3GH4A

Crystal structure of beta-hexosaminidase from paenibacillus sp. ts12
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
519
structure length
507
Chain Sequence
b'HHHHSSGLVPRGSHMASMSQPSILPKPVSYTVGSGQFVLTKNASIFVAGNNVGETDELFNIGQALAKKLNASTGYTISVVKSNQPTAGSIYLTTVGGNAALGNEGYDLITTSNQVTLTANKPEGVFRGNQTLLQLLPAGIEKNTVVSGVQWVIPHSNISDKPEYEYRGLMLDVARHFFTVDEVKRQIDLASQYKINKFHMHLSDDQGWRIEIKSWPDLIEIGSKGQVGGGPGGYYTQEQFKDIVSYAAERYIEVIPEIDMPGHTNAALASYGELNPDGKRKAMRTDTAVGYSTLMPRAEITYQFVEDVISELAAISPSPYIHLGGDESNATSAADYDYFFGRVTAIANSYGKKVVGWDPSDTSSGATSDSVLQNWTCSASTGTAAKAKGMKVIVSPANAYLDMKYYSDSPIGLQWRGFVNTNRAYNWDPTDCIKGANIYGVESTLWTETFVTQDHLDYMLYPKLLSNAEVGWTARGDRNWDDFKERLIEHTPRLQNKGIKFFADPIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords beta-hexosaminidase
publication title Molecular cloning and crystal structural analysis of a novel beta-N-acetylhexosaminidase from Paenibacillus sp. TS12 capable of degrading glycosphingolipids
pubmed doi rcsb
source organism Paenibacillus sp.
molecule tags Hydrolase
total genus 191
structure length 507
sequence length 519
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3gh4A01
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3gh4A02
4EKJA 3AS3A 4GXPA 3T0AA 5EB8A 1JZ8A 3GNRA 3AIBA 3WQ6A 1BF2A 4CN6A 1VF8A 1W9BM 1ZBCA 5I77A 2YL8A 1E15A 1UWRA 1CXEA 1UR4A 4H7VA 2VMFA 1F4AA 3TTQA 4GINA 1E71M 2E9MA 3PZTA 5HPCA 2OSXA 5JIPA 4UOQA 1MVYA 1UOKA 5A1AA 3WNPA 1W1VA 1ISZA 4GO8A 4CKQA 3JUGA 1HIZA 2B31A 2QMJA 4JFTA 3IANA 5JBFA 1JI2A 2NSXA 3APGA 2VJXA 5A8MA 4P7RA 3POCA 4ZENA 1K9EA 3WBAA 1CXFA 4C90A 2VZVA 5C71A 2NW0A 1WZMA 1Q6GA 1E40A 4OOUA 3MS8A 1FH7A 1LL7A 1QBBA 2F61A 3VDCA 5A6MA 4D6DA 4A4AA 2FDMA 4FK9A 4XX6A 2ZUTA 1KXHA 2CESA 2BY1A 1V0LA 3MV11 4LYPA 4D6FA 3UG3A 2BHYA 1TZ7A 1W9DM 5BXSA 3CLWA 1FOBA 6CGTA 3SCWA 3WH9A 5E0CA 1NWRA 1J0YA 1EOKA 2OWWA 5A8PA 3WBEA 2X1IA 4HTYA 4PBGA 4PMOA 5A3HA 2EQDA 5F7UA 5DT7A 2CBIA 2VRKA 3U7BA 1VJSA 1B1YA 3CUIA 4QDMA 1MYRA 5DO8A 2YDRA 5E9AA 4M1RA 1V3KA 3WNNA 2ZOXA 3FAXA 7A3HA 1IZJA 2BNJA 2C7FA 3W82A 4J28A 3AQUA 2J74A 2X09A 2QLYA 3IJ8A 5E0FA 4D1IA 3WNKA 1LWJA 1E5JA 2D3LA 1BVZA 2WC3A 4JFVA 3EMQA 2GK1B 3PZNA 3L4WA 4LXFA 2J7FA 1DWGM 2Y4SA 1DWIM 3CHEA 3UG5A 1V6VA 3GM8A 5I0DA 1PIFA 4JL2A 1EO7A 3EDKA 1G9HA 1W9VA 4PCTA 4PTWA 3WNOA 1NOFA 1GOOA 4UTFA 4W86A 2WC7A 4MB4A 3ECQA 2DQXA 2VR5A 1KBBA 1B3WA 1K9FA 2CBUA 4A3YA 3GTNA 4U3CA 1ESWA 1QPKA 1Y7VA 2W91A 3W0KA 2WK2A 1NOWA 1V3IA 1KQZA 3SCTA 3L4ZA 1E1EA 3WDRA 2NT1A 2XVGA 3E1F1 3NDZA 4DWSD 1HKJA 3SUUA 3T0DA 3PZ9A 1PZ2A 2WVVA 3VD4A 2XGIA 4UFMA 2EBNA 1R86A 4C91A 3UETA 1SMDA 4JFSA 1JNEA 1CGVA 1DHKA 2O9OA 1E5NA 3RM9A 3VD7A 4GZJA 3I3BA 1F4HA 1CIUA 1TCMA 3WUFA 2W62A 3WQ5A 5I78A 4D6JA 2J7DA 2EPLX 2A3EA 5A6SA 2Y8KA 1VJZA 5A6KA 3VGEA 2QF8A 4P7QA 2C0HA 2ZUSA 2YBTA 4GI6A 1Z32X 5IDIA 1W2VA 3LMYA 3VIHA 1CDGA 2WANA 3GDBA 4H8UA 2XWDA 1HKMA 2XSAA 2ZUWA 4PMZA 4DWSC 5BXPA 5A6JA 4AIUA 1HX0A 2DT0A 3AICA 3UERA 2VRJA 2J47A 1GOMA 4NRRA 4WSKA 1UKOA 2VUYA 4HU0A 3WF4A 4Z2KA 4UFJA 1FHLA 1JDAA 4U2YA 2ZXAA 1VBRA 2WMJA 3MV01 3CMJA 1VEMA 2WMGA 1TG7A 1ZS2A 1ITXA 5D9NA 2FHCA 3EYPA 1XRVA 3VM5A 5JBDA 1J01A 4MB5A 5AYIA 3VILA 4TVDA 3OGSA 4MPKA 4MTVA 1XD1A 4NSBA 1I1XA 3W81A 5CLTA 1OBAA 1BAGA 5I24A 1OIMA 1WDPA 1Q4NX 1C7SA 2VCBA 1QI4A 1KR1A 3ZJKA 1MW1A 3RCNA 1MQQA 4HU8A 2JEQA 9CGTA 3AZTA 1RD6A 1E6NA 3LPGA 3T2OA 5D9MA 1CPUA 4PMRA 4W7WA 2Z1SA 3VKKA 1QI5A 1NOUA 1CEOA 3VGBA 2DSZA 3VIPA 4UR9A 5E6YA 2D0GA 4XV0A 2J7EA 1UR2A 1ZL1A 2CBVA 1TA3B 3FN9A 2YJQA 1KWGA 3K8LA 2WC4A 4HPGA 1B3ZA 4U31A 2BVTA 4P7OA 4CVUA 4BA0A 1W9XA 3VIOA 1M7XA 3VMPA 1JD7A 2JEPA 2WVUA 3W6LA 2MANA 1ECEA 2Y8VA 1UA3A 4LPCA 7TAAA 1W9UA 1FFQA 4HA3A 3AIVA 3MMWA 4UQBA 2UWFA 3WFLA 2ESCA 1ZJBA 1J11A 4HZ7A 3BAIA 4AXNA 4D1JA 3VOCA 4PEEA 4Z2LA 4LYQA 3AYSA 2OYMA 4UFLA 3GH7A 3DHPA 4B9ZA 1BTCA 2WVVB 1B3XA 1Q6DA 2J77A 1R87A 3OB8A 2XGBA 4AMCA 5DMYA 3MSDA 1BGGA 3KL5A 2RGLA 1CWYA 4WIWA 3WMBA 2CHNA 3VGGA 5IFPA 1FH9A 1R7OA 1O6IA 3WDQA 1BG4A 1J0JA 1V3JA 2VVNA 1TUXA 4M81A 2DSKA 2VX7A 4H8VA 3WENA 2QPSA 4AIOA 4AEFA 3I3EA 3EDJA 4R5EA 1HNYA 1J10A 1C8XA 1C8YA 1CXLA 1GNXA 2VX5A 4HA4A 3SCOA 3PHAA 3PTMA 4WLCA 5LA1A 1UUQA 4HA1A 5KEZA 1GVYA 4XZWA 1CXIA 3D3AA 4D72A 4XZBA 1MXGA 3ARZA 1QHOA 4UQAA 1GQKA 1QOXA 4JL1A 1IT0A 3WD1A 1U2YA 4DUWA 4PSPA 2PI6A 3CPUA 4MB1A 2A3HA 1H49A 1OT1A 3CMGA 3SURA 2W63A 2XVLA 1VFMA 2G3JA 2WZEA 4CCCA 3BAJA 2EPMX 1JZ3A 2DSWA 4F79A 1QNRA 3U5YA 1BG9A 2XSBA 3GXFA 4TVCA 2ZE0A 5HBFA 1OB0A 1A3HA 4TXEA 3AHYA 3WH8A 1EHNA 3DYMA 3MO4A 3CUHA 3S2CA 4FLQA 4MNLA 2AOSA 2YA1A 4WK9A 5A2BA 1B2YA 4KGJA 5CXPA 1BPLB 2XIBA 1BGAA 1XH0A 3VIIA 2XM1A 1V3MA 1W1YA 3L2LA 1OCQA 4AD5A 3WF1A 2ZUNA 2GJXA 3AXIA 1OGGA 1B3YA 1S46A 3ZJ7A 3RIKA 4FLSA 3B9DA 1VEPA 5ABGA 3RM8A 1UR9A 1KGWA 3GYCA 3ARWA 4AEEA 3A47A 3FAWA 4MNJA 3DECA 3CUJA 2BXYA 3MUZ1 4UQ9A 4PSRA 4QLLA 2VTFA 5IXEA 2VT0A 1M03A 2VURA 1ZB5A 4M8UA 2HISA 2EO7A 1P6WA 2E3ZA 1WZLA 3I3DA 1XH1A 3GNOA 1KWKA 1B0IA 3AI0A 2W5FA 1JZ2A 3N9KA 1NARA 2IXVA 1V03A 5CGMA 6TAAA 4U2ZA 3G6MA 4QLJA 3ZMRA 5ABEA 4OBSA 5ABFA 1QHPA 1QVBA 3BAYA 4XUYA 1LG1A 2EPOA 1OD0A 2WB5A 1J0HA 3BLPX 4AD1A 3VGFA 1RP8A 1WDQA 2WSPA 3VO0A 1J0ZA 3OZOA 3W24A 5A8QA 3AS0A 1XYFA 3WH7A 4F9JA 2E9LA 3GXDA 3ZM8A 3BAWA 2VZTA 4ACZA 2WLZA 2YLAA 3THDA 3SEPA 3A3HA 2PWHA 2VL4A 4PMNA 2ZX5A 4TTGA 2WHJA 2ZX8A 1VENA 1H5VA 1XSJA 2CEQA 1UD2A 3WD4A 3PBGA 1K6AA 3N18A 3VIKA 3AMDA 3CZLA 2JF6A 2XG9A 4Z2HA 3CGTA 2W92A 1HN1A 2ZX7A 1HT6A 1CXKA 3WQ8A 1UWSA 1LG2A 1W91A 2YA0A 1ZJAA 1UD4A 1XCXA 3A4WA 4KH2A 4NI3A 3IAPA 4TX8A 3VNYA 2XWEA 5A95A 1G0CA 3PZUA 1H0GA 1SR0A 3W26A 5CSYA 3ZT5A 5EFFA 3GBDA 4PUDA 2PWDA 2DDXA 2G4FA 1XCWA 2OSWA 2CXGA 3VIMA 3AIUA 3ARQA 2WMIA 4JHOA 3WQ4A 3WH5A 4D6IA 2J78A 4KWUA 2GJRA 4KRTA 3ARPA 5A6BA 4RE2A 1LJYA 3AHVA 1UKQA 5BXRA 1GJUA 2DH3A 5I3DA 1QW9A 4CUCA 4MAZA 1MWOA 5A2CA 1H3GA 4AZHA 5A8NA 3CO4A 3HN3A 1CZ1A 1CNVA 1TMQA 3L2MA 4DUXA 1V3HA 2GJXB 1FA2A 1KGXA 1B90A 4M24A 4X0NA 5CZKA 1BQCA 1VFOA 3K8KA 2BHZA 3ZSSA 1ISXA 2EJ1A 2OWXA 1E1FA 3BLKA 2RGMA 4HZ6A 5M17A 4DUVA 3N1AA 5FCZA 1OWQA 3N11A 2XPKA 1H0IA 3K46A 1WCGA 1JZ5A 4V28A 1K9DA 4MDPA 5I79A 4PYSA 4WSJA 3AMKA 3WN6A 4WKFA 1AQHA 4Q7NA 3FHAA 3ZJ8A 2WMHA 1PAMA 2CKRA 4JCLA 2ZICA 4CU7A 4UNIA 1C7TA 5D8ZA 1E6SM 4BS0A 5ABFB 3SCNA 1XYZA 4KGLA 5GNXA 3MU7A 1EDQA 1MXDA 3KL0A 3VNZA 1XV8A 1MQPA 2XYLA 4AY1A 1GQLA 5IHSA 1E6XM 3BSHA 3QGVA 3AIRA 3WD0A 4MNMA 3UCQA 5BRQA 1JYWA 1JF6A 1W2PA 4C7DA 3BC9A 1NQ6A 1E4LA 1BYCA 3VM7A 4J7RA 3OGVA 2CYGA 4W8BA 1CLVA 3AZSA 4UFKA 2XVNA 2WSKA 5I5RA 1RH9A 3BMWA 5HOSA 3WDHA 1Q6EA 5C8BB 3F5KA 2FH6A 3TTOA 1ZBVA 1V3LA 4ZFMA 3MMDA 2CITA 3OGRA 1AQ0A 2DSUA 4AZBA 2W66A 3WDJA 3OIHA 2D1ZA 2ZWZA 3KZSA 4EAMA 2X05A 2EEXA 3ZQ9A 1C93A 1OIFA 4E8CA 4CN1A 2J8FA 1V02A 2VZSA 4R27A 5D9PA 2WMIB 1NP0A 3ARSA 5CPQA 3VU2A 1H09A 1GHRA 1VRXA 3EDEA 4M29A 3WEZA 2Y2WA 3VGHA 3EMZA 1EGZA 4PMDA 2XFRA 3W27A 3AIEA 1UKPA 5D9OA 5ABHA 5HPOA 1W3HA 4BQ4A 1UYQA 3VIGA 1OGSA 2WLYA 5CG0A 1JL8A 3MKKA 3WFZA 1E70M 4AZ6A 2XIIA 1WPCA 1ZBKA 2Y24A 1HXJA 2WMFA 2XUCA 5AY7A 4CVWA 1JI1A 1LL6A 1CGXA 1ZBWA 2WBGA 2CCRA 1E56A 4MADA 3F5LA 1DWHM 2E4TA 3II1A 1XH2A 3WL1A 1IV8A 2WHLA 1KB3A 3CHDA 4H04A 3RPMA 4E4PA 2WWDA 3RILA 3GH4A 4GQRA 1BVNP 1E3XA 3N15A 4PMYA 1DEDA 2F8QA 5DF0A 5LA2A 1WE5A 5BROA 1PX4A 2BV9A 4J3TA 8A3HA 4M82A 3OZPA 5JUVA 1C91A 5GQBA 3K4DA 2VNCA 2CKSA 3IJ7A 1MQRA 5EBAA 1UZ1A 1HJSA 3CZEA 1US2A 5IHRA 2W61A 2WVTA 2J7GA 2DIJA 2JFEX 2VR4A 4PMXA 3CH9A 4QAWA 1JFHA 1ISVA 5M03A 3BAXA 4KMQA 3HJEA 1CLXA 1QI3A 3W37A 3TTSA 3SCQA 3RJYA 2O9TA 2X8RA 2FGZA 2ZXQA 3OLIA 3CUGA 4IUGA 2WVSA 4LYRA 4MB3A 4IPLA 3K1DA 3WUGA 4PN2A 5DEZA 3FXYA 4FMVA 3WF2A 2GDVA 2XFYA 2JIWA 2O9RA 4N0RA 2D22A 4CU6A 2QHAA 3CZGA 3W29A 3NSXA 5E70A 1E73M 3AS1A 3PN8A 3BSGA 1B3VA 1KGUA 3N17A 2YIHA 4LX4A 1UH2A 1JYXA 2E40A 3GXIA 4P8VA 3VDAA 4EK7A 4PCSA 3F4VA 3M46A 2DT1A 4J27A 4IISA 3L4TA 3WELA 1OT2A 3NSNA 1HL8A 4W5ZA 1GHSA 1MW3A 2AMGA 2CNCA 1PEZA 2GJPA 3ZOAA 2ZXDA 1JIBA 4WKHA 1UZ4A 2V3GA 4HOWA 2E8ZA 1UD3A 2GDUA 4AD3A 4Z2GA 5FKYA 4QFUA 3B8SA 3THCA 2YDSA 4AZ5A 1UKTA 2DEPA 2PWGA 1W3LA 4UZUA 3W25A 3ZO9A 4JKKA 1UD6A 3ZT6A 3GBEA 4ZE5A 3VIJA 3VGDA 2J8GA 5CGTA 1E0WA 3M07A 2V3EA 3WDIA 4DWSA 4L4OA 4AZIA 1H11A 1I75A 2O92A 1U33A 1GOWA 1HVXA 3SUSA 1M53A 3AHTA 4U5KA 4EE9A 1E9LA 1W32A 3WY1A 4YHGA 4TX6A 2DH2A 4FF5A 1GPFA 1PPIA 5BRPA 1GQJA 4Q22A 5A69A 1CGUA 1NP2A 4PTVA 2WCAA 4W7UA 2YL6A 2X0YA 1UWIA 4KRUA 2VX6A 5CLWA 1WP6A 1HKKA 1RPKA 3UESA 3N12A 3VIFA 4QCEA 4UFHA 3NDYA 1L0PA 2VI0A 3PTKA 2WKGA 3MUAA 3PZIA 5FD0A 1R7AA 4J3UA 3EDFA 1HKIA 4W88A 3EBVA 4AD4A 5A6BD 4U3AA 1WZAA 4M56A 4J3XA 1B31A 4GPNA 1Q6FA 1QNSA 2PF0A 1JXJA 3WUBA 1YQ2A 5FIPA 1EQCA 1EH9A 1HL9A 1QI2A 4UFIA 1GOQA 1CYGA 3CHFA 3WIJA 4TVUA 2VCCA 3A6OA 1WB0A 2V3FA 1W1TA 4C7GA 4JKMA 4CD7A 4JKLA 1QBAA 1X6NA 2G41A 1CBGA 2GVYA 1B30A 3IK2A 5BWFA 2W4XA 3WKZA 2XM2A 3CHCA 2PWEA 1MW0A 4GQQA 3OLDA 4WJXA 3NSMA 3WMCA 1EDGA 4J3WA 1HJVA 3KEHA 4AZCA 3GXMA 2J4GA 4NF7A 3VINA 2Y5EA 2CIPA 1NH6A 4PMUA 1N82A 1WAWA 4GI9A 2AAAA 3AMGA 1Q6CA 1TVPA 1E55A 1LF1A 3WD2A 1GVIA 1LWHA 1EO5A 4AC1X 3LPOA 4OOZA 1E4IA 1ODZA 3BXWA 3FHQA 4H8HA 3QHMA 2XHYA 4GI8A 5I6SA 3DHUA 3DYOA 1PX3A 3AISA 4S3JA 4J3VA 1SYTA 1JZ6A 4JCMA 2XJ7A 1R85A 4DWSB 2W67A 1CENA 4JFUA 3A4AA 1C8QA 1ISWA 1G5AA 3WD3A 3MUIA 4BQ2A 1HVQA 1QNQA 2WCSA 4JAWA 2WAGA 1ITCA 3O9NA 5HDRA 3MANA 1XGZA 1KCKA 3BCDA 2G3MA 1HJXA 2F2HA 3AYRA 3N13A 2OYLA 3NJ3A 4OJYA 4AISA 4H2CA 1HJWA 4Z2IA 4L4PA 3T08A 3W6MA 5D4YA 4GO9A 3ZJ6A 1ODUA 1DP0A 4W8LA 1J0IA 1DWFM 4W93A 4TTUA 1QNPA 4UOJA 5TD4A 1VFFA 1J9YA 2J7BA 1E0XA 2V5CA 3LPFA 2BFGA 3RDKA 4E8DA 5JIWA 1VAHA 3AROA 4BF7A 1CXHA 1KXVA 4CU8A 1JZ7A 3BAKA 2J7CA 3SUWA 4X9YA 4LQ1A 4OIFA 1XSIA 1L8NA 4BQ5A 1FP8A 3QR3A 1V08A 3UEQA 1U30A 3PZOA 4B3LA 3WQWA 1MW2A 1JDCA 3NYDA 4W84A 3WNLA 5CSUA 4D6HA 1JAKA 3WEMA 1EDTA 5HNNA 4UQEA 2WCGA 4AIEA 4HMDA 3W4RA 3TTYA 3SCRA 1D7FA 3TA9A 2FHFA 2FH8A 3L4YA 1TR1A 3WNMA 1UWUA 4ZEPA 1H2JA 2CERA 3B9AA 4AZCB 1EOMA 1V02E 1WKYA 4TUFA 3VDHA 2D23A 2OSYA 1SFSA 1PBGA 3SCUA 3WF0A 3VD9A 4MJ2A 1FFRA 3BCFA 4XB3A 3QHNA 4URIA 2OWCA 1QI0A 2UY5A 2ZWYA 4UOZA 5D8WA 4D6GA 3PZMA 3RO8A 1OGBA 2GFTA 2WZIA 3U7VA 5KZ6A 1GJWA 1CTNA 4PMQA 2E0PA 1MFVA 2BY0A 4BZYA 1E72M 1BYAA 1HJQA 1JGIA 2PC8A 3OLEA 4OZOA 3QHOA 1VFUA 4Y7EA 1LLOA 2WW5A 3W38A 4MAVA 1HP5A 4RE4A 3ARYA 2D0FA 2EPKX 2E9BA 2GSJA 4ACZB 3PZGA 1V6UA 4AZ7A 3WL0A 1IZKA 3VTRA 1W1PA 3MUY1 6A3HA 3ZR6A 1UR0A 2D20A 1UWQA 4MJ4A 2BY2A 5BXTA 4AWEA 1JNDA 1TE1A 5FL1A 1EQPA 1NWSA 3OLGA 2CBJA 3AHZA 2XVPA 3VMNA 2YDQA 1EA9C 4C7FA 1AQMA 1G94A 3D5HA 1DWJM 4HOXA 5A6LA 4ATWA 4FLRA 1JF5A 4CCDA 3AIWA 3WSUA 1BSIA 1MFUA 2XVKA 2D24A 4CCEA 2CHOA 3CZJA 1C3FA 2GUYA 2XTKA 1GZJA 4ZXLA 3MSGA 4RL3A 3T0BA 3ZIZA 5A6AA 1TA3A 4OKDA 2PBGA 4WKAA 3VUPA 1J12A 5C70A 1JG9A 4F66A 2X0HA 2G3IA 3GNPA 1E43A 2QPUA 1OINA 5GNYA 3POHA 3NCOA 2V38A 1JZ4A 3MMUA 5I23A 3CTTA 2ZXBA 4P7NA 1UR1A 4MNKA 5A94A 4P7LA 1BYBA 2VC9A 4QLKA 5A8OA 2DIEA 3VD3A 4HZ8A 4PMVA 1E6QM 4P8WA 1WDRA 1UHVA 4BQ3A 4D6EA 1VBUA 2XFFA 4Z2JA 2J79A 4B3KA 1E0VA 4AW7A 3ZR5A 5AC5A 3FNDA 2VRQA 5DT5A 4E2OA 3SUVA 1C92A 3IJ9A 1BYDA 5M5DA 2WMKA 5FOOA 2UY4A 3OA5A 5HXMA 1A47A 3KE0A 2CPUA 2WHKA 1OM0A 1NWTA 2ZUMA 3U57A 1KXTA 4CD6A 5EFDA 4FLOA 4B15A 3O6AA 4IM4A 1YHTA 2X2YA 1WNOA 5EMYA 3ZT7A 4OUEA 2PWFA 3AXHA 2ZX6A 4UCFA 1E6RA 1C90A 3BGAA 4HMCA 3AXXA 1UA7A 2FGLA 4JIEA 2BS9A 1E3ZA 5CPTA 1V0NA 1XD0A 4F9DA 1W3KA 2WPGA 3UR7A 2WNWA 1BLIA 1W9PA 3L4UA 1QNOA 2WBKA 3SCVA 1QW8A 2WZHA 4EANA 1D2KA 1M04A 2O9PA 4W8AA 4PUEA 3W28A 3BMVA 3EMCA 3AHXA 4D6CA 1HP4A 4W87A 1UR8A 1R8LA 3CBWA 2V5DA 3J7HA 4JHZA 3TP4A 1X6LA 3CIVA 3K4AA 1VIWA 3WF3A 5JBEA 3AOFA 1KFWA 1PZ3A 1OSEA 5DFAA 2BVDA 3IAQA 4GZEA 3W53A 5A2AA 1KQYA 3ARXA 4B9YA 5AC4A 3ARUA 2Q8XA 3NIYA 1JXKA 2J62A 1PX8A 3B9EA 1PIGA 4U33A 4QCFA 4W89A 2CETA 3SIMA 3TOPA 3UR8A 4A3HA 2J25A 1GQIA 3VX0A 7CGTA 2V3DA 4AD0A 1GUVA 4AZGA 3G6LA 3T2PA 4F8XA 3AIQA 1QHZA 1K9TA 1UWTA 2WWCA 4CD4A 3AFBA 3BH4A 1DWAM 5BCAA 2ZIDA 3GZAA 3A4XA 1US3A 2VZUA 3RMEA 1FP9A 2JALA 2VO5A 3KL3A 2D2OA 3TONA 2YL5A 3AS2A 3EDDA 1VB9A 3DC0A 1I1WA 3QOMA 2VZOA 2JF7A 2EPNA 3AJ7A 3CUFA 5GPRA 1HF6A 4IPNB 2YOCA 4PTMA 1KXQA 2IXUA 4PRWA 2YKKA 4NRSA 1E6ZA 2DT3A 2A3AA 1G01A 2DPEA 2J75A 3VMOA 1UG6A 3PTQA 1V0KA 1BFNA 1D3CA 4LGXA 3WUEA 2QV4A 1GORA 1AMYA 4ATDA 5I2UA 3KWXA 2WHMA 4AYSA 2NT0A 2PBOA 3VD5A 2D3NA 4YHEA 3SUTA 5FL0A 2VX4A 3PZQA 2DGAA 1E6PA 3M7SA 1RP9A 1EIBA 1UQZA 4U5IA 1WZKA 4YPJA 1V6YA 1CGYA 4BCEA 5CJ5A 3N04A 3U5UA 1B9ZA 4V27A 2VQUA 4DM1A 1HJUA 1UQYA 1GCYA 1KBKA 1NWUA 3L4VA 2YLLA 4OBRA 4HPHA 1UD5A 5GNZA 1E4NA 4P8UA 1XSKA 3ALGA 4YN5A 1J18A 1JYVA 1W3JA 3T2QA 1CECA 3ZSTA 4CD5A 2BVYA 4D71A 2J7HA 3HU7A 5ECUA 2BY3A 1UH4A 2JIEA 3ARTA 3FY1A 5E6ZA 3NUKA 4P8XA 2Z1KA 2VOTA 4X0VA 1V0MA 1VEOA 3QOKA 4W5UA 4K68A 2WYSA 2HVMA 3AMCA 2QMKA 5IFTA 2YL9A 1TFVA 3RJXA 1JDDA 1WDSA 1KCLA 3HMCA 4CN4A 1CGTA 4AD2A 3SCSA 2G8ZA 1KR0A 5M3WA 2PB1A 5AYBA 2WKLA 4UZSA 5LYRA 1LL4A 4DM2A 2OYKA 1JFXA 4TOQA 4MDOA 2YBUA 1SMAA 2WXDM 4ATLA 4CGTA 4NZCA 1JD9A 3VVGA 3O2LA 4J3SA 1UD8A 1AVAA 2A3CA 4HP5A 1O7AA 3WH6A 1XC6A 1X1NA 4N42A 4WF7A 5CPSA 1NM9A 4B16A 2FHBA 1H4PA 2VCAA 3GH5A 1GOKA 2G3NA 2ZUUA 3PZVA 1ZU8A 1G1YA 4S3KA 3WEOA 4ZXOA 2ZUVA 2C8NA 3F5JA 3CZ8A 3AZRA 1DTUA 1CGWA 3WQVA 2DT2A 3AMLA 1XHGA 2VQTA 1J0KA 3WDPP 4W7VA 2A3BA 4H41A 3S6TA 1JAEA 2VVSA 2ZX9A 4ZE4A 2D0HA 1OD8A 1EXPA 1PJ9A 1V6WA 4UQDA 3OG2A 4GIAA 4HOZA 3OBAA 1E4MM 1EHAA 3K8MA 3ALFA 1GOIA 2EXOA 1TVNA 5LA0A 5BYWA 2JE8A 3WMSA 3VDBA 3DYPA 4RE3A 2DSVA 1UH3A 1M01A 4JFWA 2WM0A 2YA2A 1FH8A 3L4XA 4GKLA 3T09A 2OLHA 2UY3A 5CQ1A 1UKSA 2UY2A 3VX1A 1H1NA 3ARRA 1V6XA 2BXZA 4M80A 4V2XA 4PTXA 3ARVA 1GONA 3UG4A 4ML4A 3LPPA 2BHUA 1GW1A 2GK1A 3VPLA 3SCPA 1JYNA 1FHDA 5E09A 4UQCA 4CD8A 3RM4A 1WO2A 8CGTA 3M6DA 1H41A 3FW6A 1BHGA 2TAAA 4HMEA 1ISYA 3CZKA 2E8YA 2IUZA 4QP0A 4W85A 1LQ0A 4GZIA 4ACYA 4JZ5A
chains in the Genus database with same CATH superfamily
2ISVA 4Q7IA 7XIMA 4GXPA 2Z28A 3GNRA 2GGJA 3S3GA 6ALDA 1BF2A 1UWRA 3S5ZA 4PUNA 1CXEA 2PGEA 4QTGA 4UXDA 4RZBA 1F4AA 3SFKA 4ZODA 3PZTA 4NAEB 1MVYA 4NU7A 1F6KA 2NUYA 4JDYA 1F61A 2PP3A 3LHYA 1V93A 1CT5A 4HK6A 3HIJA 2QMJA 5JBFA 4O17A 2VJXA 3WG6A 5A8MA 3UJRA 3RITA 4ES4A 2AGTA 4QNEA 5HJXA 3NQAA 4RZ5A 1VP5A 4C90A 2B81A 1JGMA 1OFOA 3GDLA 5C71A 3TYUA 2ATSA 1WZMA 1E40A 4K37A 4DPPA 3CV6A 3PFMA 1LL7A 2F61A 4A4AA 4QRNA 1N55A 1KXHA 3DFNA 1FBAA 4IX0A 4H19A 4FX6M 4EXAA 1K8XA 4N9CA 3S1XA 4B2DA 3NQ8A 4NZ3A 5BXSA 5EY5A 2CLOA 1FOBA 4S38A 3GR8A 4H9XA 5H8MA 1TJPA 3STPA 1EOKA 4DO4A 2OWWA 3O06A 5A3HA 1ZALA 4N9EA 4HNVA 1WV2A 3CUIA 1OC7A 3HG3A 4LBRA 2E6AA 3DG7A 2YDRA 5E9AA 4M1RA 1DE5A 2A21A 3EA3A 1EIXA 3W7PA 5BU6A 3RHGA 4C60A 3FAXA 3GAYA 2VFEA 3BZGA 3GIYA 2C7FA 3W82A 2J74A 5E0FA 2I5QA 2X42A 4Y96A 1ECQA 4QNWA 4EF9A 3EMQA 1UMYA 1QW7A 4ZSTA 3RXZA 2E6YA 5E93A 2O4QA 3V35A 2J7FA 1DWGM 1DWIM 3UG5A 1Z3NA 2X1SA 3TC6A 1W9VA 2P53A 4PCTA 4LS2A 3G3DA 2CLEA 5AKQA 2NQLA 4UTFA 4H9MA 2WC7A 3ECQA 1RALA 4AB4A 2DQXA 2VR5A 4H8NA 2VDIA 2E1DA 2CBUA 3GTNA 1ESWA 1K4HA 1V7YA 2H6RA 3DX5A 3W0KA 2WK2A 1KQZA 4OTKA 3EWYA 3Q2DA 5AFDA 3N3MA 3UJFA 4WR3A 1L2UA 4XIAA 1EP3A 3CYJA 4WY0A 3PZ9A 3LA4A 3T0DA 3CH0A 5BOOA 4UFMA 4ZA0A 3VKAA 3UETA 4ADUA 4C6EA 4DQWA 1JNEA 5KETA 1HO4A 2Q8ZA 2Z7KA 4GX9A 3TJXA 3VD7A 2XN0A 3WQ5A 5I78A 4D6JA 5H8PA 5CJNA 5A6SA 3BOXA 3HFYA 3VGEA 1POJA 2QF8A 3QQ1A 4GI6A 1Z32X 4HNOA 5IDIA 3LMYA 4V1XA 3DXIA 4IOTA 3GKFA 2ZUWA 5L6UA 3PBUA 3CWOX 3K30A 1I60A 2CLIA 3WK0A 4LF1A 1UKOA 2VUYA 1SO3A 1P1XA 1TV2A 4LBSA 1GVRA 4IP4A 1XW8A 3N34A 1DKWA 2ZXAA 1VBRA 3UR2A 2CU0A 3DU0A 2WMJA 1FY6A 3MV01 2WMGA 3GFXA 1TG7A 1T41A 1ZS2A 1ITXA 2VEIA 2E5BA 3DOPA 1JPDX 1SVDA 5D9NA 1IEVA 3NURA 1XRVA 3BG5A 4G1NA 3GNXA 1J01A 4MB5A 1Z69A 4TVDA 4MTVA 1XD1A 4KERA 4MY8A 5CLTA 1OBAA 1OIMA 4PB4A 3S1UA 1WDPA 4JOMA 1QI4A 1KR1A 4S3EA 1MW1A 3RCNA 4ZB5A 1YBQA 4HU8A 4F0SA 1RD6A 1TSIA 2FTYA 5D9MA 2QDGA 1TZ9A 4EX4A 1IQ8A 2Z1SA 1G4TA 3VGBA 1FWIC 1JR1A 4FNRA 3M41A 2CBVA 3OW1A 5CC3A 2YJQA 4YCPA 2B7QA 4U31A 1SJCA 3CU2A 2MANA 1ECEA 1UA3A 4MOZA 7TAAA 4QG8A 5FJRA 4HHMA 2YYUA 3WJYA 2HDJA 4UUIA 1ZQ5A 3MMWA 4B5TA 4KFNA 5LXXA 1YKWA 2ESCA 4AYGA 3C2EA 4AXNA 4D1JA 2P1FA 4PEEA 1TX2A 3AYSA 3I6EA 4UFLA 3DHPA 4RW5A 1NEYA 2J77A 3OB8A 3TXVA 1GVOA 5DMYA 3SY1A 4JY8A 2RGLA 1CWYA 4WIWA 3L5AA 4GVGA 5AZ0A 1UUMA 3L21A 1FH9A 2PDLA 5FEZA 4GY1A 1WOBA 3OVPA 3A23A 5TF0A 3WDQA 1BG4A 4PC8A 3LD5A 2IQTA 4REQA 2VX7A 4YCOA 4H8VA 3WENA 1TQXA 2QPSA 4UTJA 2CWNA 1GNXA 4DJDA 3PHAA 5ENLA 4WLCA 3KVMA 4HA1A 1GVYA 4XZWA 5L9FA 4I7WA 4UQAA 1RQEA 3V0UA 4JL1A 3MBFA 1U2YA 1YNPA 6PTDA 3P93A 1SFJA 4G9PA 3PUDA 2HXUA 2V8ZA 1YPFA 1X6UA 3ME3A 2G3JA 4KPLA 1P0EA 3QV9A 4F79A 4YL2A 3SM0A 1O5XA 3VYLA 1UWAA 2XSBA 3GXFA 5JH2A 4TVCA 1KRAC 2ZE0A 3GC2A 2BZNA 4WD0A 1OB0A 4BK9A 1Z48A 3MDWA 3WH8A 1EHNA 3R8GA 3WLSA 5BU9A 2HWGA 4UTLA 1EB3A 4WK9A 1DOSA 5CXPA 3UZJA 3MPGA 3VIIA 1OCQA 4Z1CA 2ZUNA 3UF9A 4A05A 3AXIA 4JYEA 3O8AA 3S2LA 1E1CA 1AJ0A 3OZMA 5C9ZA 1EF2A 1VEPA 5ABGA 4S3CA 1ZY9A 3NL6A 2PDNA 4HT3A 1FDJA 4MNJA 4GACA 4EVZA 3DECA 3PUGA 3O1NA 4Y9AA 1E9ZB 3LX9A 3TX9A 1OCJA 4LVDA 5IXEA 1R2RA 3REQB 4RKAA 3B4UA 1VKFA 1VC4A 2EO7A 4FALA 1P6WA 8XIMA 1KWKA 1B0IA 4DJFC 3N2TA 4ZL1A 3TC3A 4PUUA 2RKXA 3E0WA 4YTSA 3BZJA 4Q4PA 1R3RA 4XG1A 1RP8A 5F2IA 1WDQA 2CC0A 5KSWA 4U4MA 3VO0A 3OZOA 4LH8A 3W24A 1AW5A 5A8QA 3WH7A 2F6KA 2VZTA 5EJZB 4H2HA 5H6HA 3MKCA 2V6AA 1OYBA 3A3HA 4QX4A 3PPCA 2ZX5A 1Q3NA 2V82A 3LV5A 2ZX8A 1XSJA 2P8CA 3ABQA 1UD2A 3PBGA 1K6AA 2C79A 4YU1A 3N18A 1C9WA 5F4XA 3CL7A 4FX8A 4QDWA 2YB4A 2W92A 1HN1A 3YPIA 1HT6A 1UWSA 1W91A 4AH7A 1XJBA 3E3HA 2G96A 4KH2A 1IT7A 3UWVA 1TCDA 3G8EA 3EKLA 4LFYA 4PUDA 3B8TA 2RH9A 3LXBA 4GIYA 3CAVA 4O53A 3VIMA 4GJIA 1RPXA 4JHOA 2J78A 5I02A 2GJRA 3AHVA 1W6TA 1J8VA 2DH3A 4R7JA 5IBXA 3CUZA 4DPQA 7PTDA 4PRTA 1RJPA 1QW9A 4CUCA 4LS1A 1MSSA 1CZ1A 4M6UA 4R7WA 1V3HA 2GJXB 3IV8A 1KGXA 4O15A 4WXZA 4TV6A 5T8GA 4DF2A 4ZQCA 3B8VA 4UNLA 3ITGA 5CZKA 1T7LA 1BQCA 3K8KA 3BLDA 4C5YA 2A6NA 2RGMA 3WBXA 4XD5A 2A7NA 5A5WA 3W6YA 1LRTA 4L5ZA 5H91A 4NL1A 5FI8A 1WCGA 1K9DA 4O12A 4GRSA 1L2QA 1DJXA 4HNTA 2DP3A 3KCOA 4PYSA 4WSJA 2GGEA 1Q7QA 3VFLA 3G77A 4JTIA 1ZCOA 1PAMA 4Q8VA 3CQHA 3IRDA 2R94A 3PBVA 1TTJA 5D8ZA 3FFSA 3RRAA 1DJNA 2FZ9A 4L65A 4NXKA 5ABFB 4XBKA 1XYZA 1IXNA 3MU7A 1MXDA 1XDMA 2FTPA 1K7EA 1MQPA 5F2MA 4UTTA 1E6XM 3AIRA 1K02A 1QO2A 1XIIA 4UCGA 2RAGA 4PA8A 2NSOA 2P0OA 4IHCA 1W2PA 5DBTA 2VDGA 3ANVA 1JVNA 1WQ5A 1IWBA 2CYGA 4W8BA 2QCEA 3F03K 4CEUC 3ENLA 2WSKA 4BWLA 3WDHA 3XISA 5C8BB 4RLIA 1DJIA 3LUTA 3F5KA 3IIXA 4JGDA 1UC5A 1DIOA 5CZJA 4ZFMA 3QYSA 3TXZA 3OGRA 4IJRA 2DSUA 5D05A 3OIHA 5IOBA 1Q63A 3KZSA 1DIDA 2X05A 1ITUA 3G18A 2JKEA 1X97A 1C93A 1E0UA 1G67A 3H22A 3KBSA 4KRZA 1UP3A 4R27A 3VU2A 4H4IA 3R6IA 5EA9A 4M29A 1TPVA 4G1KA 3L2IA 2ZRUA 3A5VA 2XFRA 5FSEC 3U2ZA 1EGMA 5ABHA 4KIEA 4IL0A 2C91A 3RLGA 2DZVA 2NLIA 3C4UA 2XH0A 5LGXA 1WPCA 1ZBKA 5DANA 3QR1A 1E9IA 3QMTA 4WCJA 1GKRA 1XUUA 1ZBWA 3V36A 1IIGA 2OOGA 4MADA 3QRHA 3M7WA 2GOKA 3BVJA 3DIPA 1PZ1A 4JTSA 3II1A 3F4WA 4E3VA 2V5KA 1S2AA 3LNPA 2WHLA 1XM3A 1IWPA 2Y0FA 1PTGA 1GQNA 3ABXA 3N2MA 2WWDA 3O16A 5HMSA 1BVNP 4PMYA 1DEDA 2ZDSA 3KOWA 3W23A 2BV9A 3QZ6A 1C91A 5JUVA 5RUBA 5DBUA 2Q09A 2VHLA 5HUPA 4K7VA 3CZEA 5IHRA 2J7GA 2DIJA 2KAUC 3B04A 4IH3A 3M0LA 1JFHA 3S6OA 5M03A 4B3ZA 3HJEA 1CLXA 3W37A 3RJYA 2GOUA 3HZ3A 1XYCA 1KFKA 3UZ5A 3CASA 4HPJA 3UP8A 3ID7A 3S1GA 3KTXA 2ZXQA 4FX7A 4MWAE 3VNJA 1ZNNA 4QEEA 4LYRA 5BNKA 4IPLA 1H50A 3WF2A 2GDVA 2XFYA 2JIWA 4KFPA 2RDTA 3UWQA 2GVEA 5E70A 2G4JA 3M5YA 2VD9A 3M0MA 6TIMA 3H2EA 5FEPA 3LERA 5I03A 3VDAA 3LRLA 1QWGA 3QVQA 3FEMA 1OT2A 1GHSA 4JTAA 1O68A 1YIXA 2CHRA 1XLGA 4GBUA 3T78A 3UXAA 3IVUA 4QJ1A 5CPLA 2C14A 2ISDA 2FKPA 4WDWA 3SR7A 4Z2GA 2QUUA 3WK2A 4NJKA 1ADDA 3S42A 3E0VA 1VYSX 4XAPA 2DEPA 3HOJA 1LBFA 1T0OA 4UZUA 2HQAA 4ICCX 1X96A 1D3GA 3VIJA 1EUNA 5BOFA 1Q7ZA 1S38A 4HNNA 4LWWA 1E0WA 3M07A 2V3EA 4Z17A 4XISA 4JYDA 2O92A 4HIBA 1GOWA 3H2CA 1RBAA 3V75A 4JNZA 1R6WA 3Q58A 4FXJA 4EE9A 4DYKA 2DU2A 4RW3A 1G6CA 3EB4A 2Z00A 1WX0A 4RE0A 1A5LC 4QITA 4Z0JA 5HQEA 4HG6B 2V67A 1CGUA 2DZUA 5DXYA 1OX6A 1X8FA 4PTVA 1IE7C 2AAMA 2YL6A 1I2PA 1SO4A 3COTA 3VNKA 4FIQA 2VGGA 3N12A 4QCEA 3PTKA 1VFLA 3MCMA 3V0TA 1K4GA 3QQ0A 4WGXA 1RD5A 4IQEA 4N2YA 4U3AA 1XX1A 1YXCA 4M56A 4J3XA 2VWSA 5I06A 1OX4B 2PZ0A 2W9MA 4Z08A 1Q6FA 4PGLA 4IWWA 2HBVA 2D2GA 3IJIA 1YQ2A 5FIPA 1UB3A 1EH9A 4D8AA 2NUXA 1REQB 4UFIA 3UVAA 2OR2A 3OBKA 3H2NA 3GR4A 2V3FA 4C7GA 1W1TA 3M5XA 2J13A 4JKMA 4JKLA 5FF7A 4GZ7A 3W1NA 1B30A 1OCBA 4OUIA 1MW0A 4XKMA 4A8NA 1SFTA 3RR4A 4AZCA 3GXMA 2J4GA 5KINA 2ZA2A 2DZXA 4WY0F 5C7HA 4NNCA 2CIPA 2PS2A 5I07A 4DUOA 5BMXA 2AAAA 4AY8A 2Y70A 1TVPA 1XS2A 1LF1A 3EXTA 4OV9A 1EO5A 3TYDA 3E02A 4FNQA 1E4IA 3GHUA 3QHMA 3E96A 4WOZA 4D2JA 2NVAA 1GW9A 4HQVA 1LCOA 1BD0A 1PCKA 4J3VA 1JZ6A 1QRQA 2FFIA 3M5ZA 4OV4A 4DWSB 4JFUA 1C8QA 3GTHA 4M6VA 4BQ2A 1HVQA 2I16A 2PDMA 1XLJA 4JEQA 1O12A 2NV9A 3FDGA 3O9NA 4XD6A 3MANA 1ENUA 2HK0A 5F1VA 3URBA 3CO8A 4AISA 1HJWA 3APTA 4ZQRA 2INZA 1V51A 4L4PA 3T08A 3EXRA 4K8HA 4CNOA 3QGAC 3H23A 3KOYA 1ODUA 1DP0A 3S1WA 3OU8A 4MZYA 5DCDA 4RCXA 4TTUA 1B5TA 3TOYA 4NP7A 5TD4A 5D2XA 3IS4A 5CC7A 1EX1A 2WSYA 3MHUA 2FPYA 1YNQA 1Q2SA 1OK4A 5H1WA 3LPFA 2PURA 2BFGA 2DZAA 2Z7GA 4BF7A 3P2VA 3BAKA 3SW6A 4OIFA 1Q6OA 1FP8A 1M65A 4GKTA 2GUBA 4G7EA 4R7OA 4YIWA 3W2LA 3T07A 1J6OA 1MW2A 3NYDA 3UWUA 4D6HA 3EA2A 1OFRA 5HNNA 1FRBA 4AIEA 2AL2B 1LUCB 2CFFA 3TA9A 4E2DA 2V5JA 4NY2A 3V3WA 1NY1A 1AL7A 1TR1A 1UWUA 4ZEPA 3CQ0A 2CERA 4M6PA 5IDZA 2DVTA 1V02E 2OSYA 3WF0A 1QNVA 2QQ6A 3G1DA 3P8IA 3TIMA 3R2GA 4XB3A 4MY1A 1EJRC 2OWCA 1QI0A 4J9JA 2UY5A 4JQ4A 2ZWYA 4CCZA 4RXGA 3U9IA 3NQGA 3KRBA 4C1NA 3FXGA 1A5KC 4BZYA 4IQJA 2IMRA 3W38A 1M41A 3LZ3A 5AHNA 2D0FA 2GSJA 4ACZB 2VGIA 3PZGA 3KP0A 1WBHA 5JXQA 1XC4A 3WL0A 3IK4A 3FYPA 5LSMA 1XP3A 1KM3A 3DFHA 4XD3A 3MUY1 3DENA 3TK7A 1UR0A 2D20A 1H7OA 3APYA 3GC4A 4MJ4A 2BY2A 4C1KA 4HJFA 4H6RA 4I3GA 3S0CA 1TE1A 2J88A 3OZYA 2YXGA 4HGXA 3VMNA 2PLCA 1EA9C 2OT1A 3TN6A 4C7FA 2ACSA 1IXQA 4HK5A 3G5EA 3VE9A 2QJMA 2AQOA 4NJJA 4NX5A 3QPEA 3SRKA 3SSJA 3CAWA 3EX4A 4CCDA 3WSUA 1RA0A 1BSIA 1PTDA 4PTNA 3BG3A 2FB3A 1YX1A 1FXQA 2WNZA 2RHGA 2XTKA 1YDOA 3EZ4A 1TA3A 1XLCA 1ZFJA 4S3DA 2GZXA 1EFZA 2PTYA 3CHVA 2ZZ6A 3PTDA 5C70A 1VZWA 1K03A 3C2FA 2PDIA 3V16A 2VFDA 2QPUA 4JIQA 3PVFA 4X22A 5HULA 2V38A 2WNNA 5G4WA 1RV8A 3CTTA 1GTHA 2ZXBA 5F2GA 1ICSA 3KP1A 5TBOA 2IKGA 1DXIA 9RUBA 2VC9A 3AC0A 2VUNA 4GUFA 3VD3A 2NZLA 4H01A 4RDYA 4P8WA 1OFEA 1X1ZA 1ZAIA 3ITCA 4XAFA 4F2BA 1VBUA 1VQTA 1Q4WA 2XFFA 4Z2JA 4B3KA 3PAOA 3BQ5A 3V0SA 1R9YA 4PMJA 1TYGA 3UZXA 1HL2A 2IPFA 4NNBA 5FEWA 2O0TA 2VRQA 4LS0A 2E68A 3IJ9A 5D2TA 4KS0A 3GG0A 2WMKA 3OA5A 1A47A 3KE0A 4XZHA 2RJGA 2WHKA 5FJJA 1OM0A 3U57A 1E51A 5EFDA 4B15A 4IM4A 4B5VA 5AECA 5EMYA 4JTKA 1IF2A 2Y5JA 1TZZA 4QE1A 1UIOA 4MZ1A 4HMCA 3AXXA 1W1A1 3E2QA 2NUWA 4WEVX 2JKAA 1E3ZA 3P5ZA 1B4KA 3EPMA 4DJDC 4F9DA 1W3KA 4S2BA 2WPGA 3NZRA 4AUBA 1BLIA 1BXNA 1W9PA 5B80A 2WBKA 3KBJA 1FWGC 3THUA 4FIRA 4EANA 1D2KA 1M04A 1JPKA 2EAWA 3KOXA 3W28A 4H6QA 1DJYA 5HMEA 1UR8A 5AZ1A 2V5DA 3F4CA 1X6LA 3K4AA 3IWPA 1PIIA 1K3UA 2C6QA 2H9AB 4HD5A 3VDGA 2Q8XA 2J24A 1EJXC 3ERPA 4PE8A 5JU6A 5U4NA 2AKZA 4E5TA 4QCFA 1RLDA 3VZZA 2CETA 2R1PA 1GQIA 4GABA 4AZGA 3W1UA 4V15A 4GX8A 3T2PA 4F8XA 1UWTA 1K9TA 3AFBA 3ORWA 1DWAM 3GZAA 5AHMA 3UD6A 3A4XA 4UTIA 3NFUA 1FP9A 1PKNA 3GDMA 3OODA 2GUUA 2YL5A 2QULA 4U10A 1T5AA 1IXPA 2PLJA 4QR6A 2J6XA 4WJEA 2PTWA 4DIAA 3TQKA 1A5OC 3QV7A 1EWDA 2FB2A 2EPNA 3AJ7A 4JX4A 1AW1A 4CEXC 5GPRA 3P8JA 3NOYA 1JCYA 4PRWA 4E3TA 4YJ5A 2QCDB 4RPQA 4JIIX 2HPMA 2J75A 1TWSA 3PTQA 2B7PA 3WUEA 3SIZA 1AMYA 4H6KA 3LCWA 2X1RA 3M0KA 3W76A 1TTIA 4GNJA 4JNMA 1XDJA 4MFDA 4YHEA 4N4QA 3DFYA 2YW3A 3UXLA 1E6PA 3M7SA 1EIBA 4GGBA 3LCFA 2NQZA 3WQPA 2HV5A 1B9ZA 2WZTA 4O52A 4IIDA 4DYEA 4LYKA 1GCYA 4H9UA 4FOKA 1NWUA 1JCNA 4OBRA 1U1UA 4KF1A 4P8UA 4XZ9A 4F2TA 3ALGA 1W3JA 4NI8A 3T9PA 4CD5A 4D71A 1I0DA 3P14A 2BY3A 4DBDA 4R3UA 4XAGA 2JIEA 1G7VA 1KBJA 5E6ZA 2GGGA 3DGBA 3NUKA 4P8XA 5DCBA 4WQ6A 2XH4A 3QOKA 4K68A 2WYSA 4NAEA 1JDDA 3HMCA 4CN4A 1CGTA 3SCSA 1XGEA 2G8ZA 3N19B 1KR0A 4AWTA 5FJTA 1JQXA 1G4EA 4UZSA 1LL4A 5IBXC 4TOQA 3TFXA 3EEGA 2YCKX 3DFTA 1JD9A 1ZRQA 1WDWA 4V33A 1RY8A 4C6QA 1UD8A 2A3CA 1XLHA 3UA3A 3SJNA 1GG1A 3WH6A 5K9XA 1XC6A 3G1VA 3EPOA 2FHBA 1BXCA 2VCAA 3GH5A 4JIRA 2EPHA 3GR7A 4FA3A 2PRHA 2ZUVA 2C8NA 3CZ8A 3IIOA 3DGRA 5MHBA 1WAUA 5E9XA 3IRSA 1XIMA 3BJSA 1CGWA 2W3ZA 4RXFA 2VQTA 5LHFA 3LI1A 5AVNA 3TNOA 3S6TA 3EA1A 5C9XA 2QUVA 1OD8A 1EXPA 1PJ9A 1GOXA 3LB0A 1UIPA 2R24A 3S8HA 1K7XA 4HOZA 3VCRA 1E4MM 4X63A 3GW0A 3ALFA 4I5UA 2EXOA 2QAFA 2HVNA 5LA0A 4LOCA 2JE8A 3WMSA 3A4JA 4IIHA 2DSVA 1EBHA 1IEXA 1Y5WA 1K70A 1AH0A 4EWJA 1FH8A 4UTTC 2PCEA 3P67A 4KWVA 2CZEA 1R3WA 2UY3A 5CQ1A 3A24A 2UY2A 3ARRA 1GONA 4MY9A 4ML4A 3VOFA 2X1TA 2BHUA 5D38A 3VPLA 4H9VA 3CTLA 5MKGB 3BARA 5DY3A 1BHGA 2TAAA 3N9SA 4LU0A 4F0MA 1ISYA 3CZKA 2GSEA 4W85A 3CEPA 3GDRA 4ACYA 3M1ZA 4JZ5A 4O57A 5DELA 3RNDA 3RCYA 1TV3A 5EB8A 4Q8WA 4LT9A 3WQ6A 5I77A 1E15A 3DFQA 4LSBA 1GPWA 4Q6JA 4DI8A 3DESA 2E9MA 4DB7A 2ACQA 5HPCA 1QATA 4O0ZA 1KM2A 1NAL1 5A1AA 3FKKA 3S2NA 2ANUA 1W1VA 4GO8A 4ML9A 2RDWA 1HIZA 1YXDA 4NZ1A 2B31A 1MEWA 2V5LA 4JFTA 3L66A 3IANA 1AJ2A 1M9HA 1XLKA 3BLFA 3APGA 2QNEA 4P7RA 3ZVHB 2XSXA 3POCA 3QY8A 2ZZ4A 4ZENA 3WBAA 1CXFA 3EWZA 1ONRA 2VZVA 1W31A 4YTQA 3HBLA 3AXKA 3GXTA 3W1PA 1Q6GA 1PDYA 2QUMA 4N4PA 4OOUA 3VDCA 3DH7A 4D6DA 1F2JA 2FLIA 3BLEA 2CESA 4IMGA 3LCGA 2YXOA 3GNNA 3MV11 4HZMA 4UTUA 1TPH1 4D6FA 4GBDA 6REQB 4YTTA 1Z42A 3P60A 5E0CA 3ONCA 1J0YA 3LTYA 3PPFA 2ZKMX 5A8PA 3WBEA 1JCMP 1XQKA 4OECA 3EOSA 1B1YA 1VIZA 3TSMA 4J2PA 3GB6A 1Y0EA 4M3PA 3BE7A 3CL6A 1XDLA 3S9ZA 3NO1A 1IZJA 1VCGA 3ZZ1A 3AQUA 3IJ8A 4ZCWA 3MTWA 4C5ZA 3LQLA 4ZMGA 4JFVA 1J2BA 3KHJA 2J8TA 4PODA 3QR0A 4KETA 1KFBA 4LXFA 3CHEA 5I0DA 3GM8A 1O4UA 1W5QA 4JL2A 1G4SA 3EDKA 2QJJA 3OYXA 1YYAA 4MB4A 4JXCA 3WQGA 1K9FA 4A3YA 4DLFA 3N9RA 4U3CA 4C6JA 1XYLA 4HYRA 1TV7A 1Y7VA 2PDCA 7REQB 1NOWA 3HF3A 3FGCB 4Z1BA 3VUSA 3LRMA 3L4ZA 3MDUA 3ZLFA 4JPGA 2NT1A 2GPTA 1HKJA 2KX9A 3N14A 3CS2A 4L9XA 2QW5A 3LYEA 5CCZA 3STGA 2EBNA 2CZVA 1PKMA 1EWEA 1H7PA 3PB2A 3W07A 1A0EA 4JFSA 1CGVA 1YADA 1E5NA 2HCVA 3U4FA 4QJ5B 3GG8A 1P5BA 1ZHAA 3EX2A 2J7DA 2TRSA 2EPLX 3EX1A 4JHMA 4B92A 1VJZA 3IGHX 3USBA 4P7QA 5XINA 3TUUA 3PK7A 3VIHA 1CDGA 2WANA 3QFWA 3U8GA 3LK6A 4FNPA 4IF2A 1HX0A 1G4PA 2DT0A 3AICA 5XIAA 4YWIA 4J3ZA 1GOMA 2WOQA 4HA0A 1EGVA 1U5VA 3C5QA 1FHLA 2VENA 1CB2A 1KFEA 4U2YA 1RAKA 1IXOA 3FEQA 4RDWA 2XU2A 1XRFA 4GOAA 1SUXA 1VEMA 3EPNA 3UU0A 3GC5A 1JDEA 3EYPA 3VM5A 5JBDA 4BJHA 3NM1A 4WHBA 9XIMA 4IX2A 3VILA 3LHZA 3M0JA 4XKYB 2ISWA 3OO2A 1BAGA 5BOEA 1ZGDA 1C7SA 3ZJKA 3MVIA 4PB5A 1MQQA 2PGWA 2JEQA 1YDVA 2IPWA 3LPGA 3T2OA 1CPUA 4PMRA 2GDQA 4W7WA 5E6YA 2A85A 4GVHA 3UJ2A 4R9XA 5FACA 2Z26A 2WKJA 4UIOA 2F7FA 3I68A 3AYTA 2A79A 3H55A 4CVUA 3EGJA 3VIOA 4X3ZA 2DUAA 1PHQA 2E77A 3NZ1A 1W9UA 3NL3A 1FFQA 3S9YA 3AIVA 3REQA 2UWFA 4IQLA 5LIYX 1JCJA 1ZJBA 5DXXA 4HZ7A 3QM3A 1EYEA 2OJPA 2OYMA 4WVXA 3EB3A 4Q3MA 1BTCA 2WVVB 1QTWA 1B3XA 3RF9A 4BR1A 4LTSA 2G5WA 1VJIA 3UWYA 4AMCA 1X7IA 2HS8A 3MSDA 1BGGA 5DX7A 3KL5A 2DZBA 3PFRA 2CHNA 5IRPA 3VGGA 1Q5MA 2NX3A 4L56A 1OF6A 1TTPA 3HGOA 2ZTJA 1HTIA 1O6IA 4R34A 1V3JA 3W1QA 1TUXA 4M81A 1HFBA 2DSKA 2F2KA 4QXIA 4YTUA 4EPKA 3P81A 2NXIA 4AIOA 3G1AA 4ZQPA 4RZ6A 1J10A 1C8YA 3SCOA 2P50A 3VOHA 2PPGA 3W2UA 2XFWA 1QHOA 1EF3A 4NYUA 1QOXA 5J8LA 2NVCA 3WD1A 4DUWA 2XN2A 3HMJG 1BKSA 3QSRA 5EMMA 1KRMA 1OT1A 3CMGA 3SURA 2W63A 3P61A 2FZ8A 1CCWB 3O6YX 1TR9A 1QPOA 2J66A 4O50A 1X39A 2EPMX 3FLUA 3O3RA 1QNRA 3T44A 4A2SA 1UC4A 1RA5A 2VDHA 4QGCA 4A2RA 4O8AA 1JUBA 4Z1AA 4TXEA 3AHYA 2PDHA 1F3XA 3CUHA 3HFTA 2QZRA 5HUOA 1PDZA 2QAPA 4UMCA 2AOSA 4WDTA 1B2YA 5HR6A 1BGAA 1V3MA 1W1YA 2GJXA 4LY4A 1B3YA 1VBHA 3F4NA 1IWAA 3RIKA 3WLRA 5HA7A 4F0KA 1UR9A 3N2CA 3ARWA 3A47A 2FYMA 3FAWA 1XIDA 3I65A 4NJGA 2VC5A 3MUZ1 5G1YA 4QLLA 2HROA 2VTFA 5EMJA 4GVIA 2CW6A 5TAOA 1ZB5A 1UZHA 1XGDA 1DQUA 4H3DA 2E3ZA 2HJPA 3NL5A 4IJBA 3DHFA 4OT7A 3S46A 1JZ2A 4HSNA 1KFCA 3G6MA 4NYYA 3W7JA 1XLAA 3N4AA 3L9CA 4QLJA 1KW1A 5CEWA 1C29A 3NPXA 5ABFA 3BAYA 2Z27A 3VC5A 3BLPX 1J0HA 4CNPA 1QU4A 3RX4A 3B9OA 3GXDA 3BAWA 2Z2BA 1OK6A 3BW3A 3THDA 4N6FA 4DZHA 5I7GA 4QHRA 4FR6A 5EYWA 3WD4A 4MUPA 2ICSA 3URAA 3W7HA 1OFBA 2JF6A 2JK2A 4Z2HA 2GGIA 2FVLA 1J93A 1ZJAA 3W9ZA 1UD4A 4XWUA 4TX8A 1DXEA 3W88A 1TUFA 1G0CA 3STEA 1H7NA 1SR0A 4E4UA 5EFFA 1XLMA 1KFLA 1S5NA 2YZRA 4MJZA 3NPUA 2QJGA 1Q65A 4G7FA 2G4FA 5JMUA 4FS9A 1ZPTA 2NV2A 3AIUA 4O10A 4U28A 3ARQA 4WGHA 1A0CA 1Y5XA 3PJTA 4JN6A 3WQ4A 1I0BA 3WH5A 4KWUA 4RE2A 1FVPA 2XN1A 4QG6A 1UKQA 2QF7A 1GJUA 1Q66A 4IP5A 3B0UX 3RLVA 3V1HA 1I8JA 3RLHA 4AZHA 3CO4A 1B3OA 3HN3A 3MI3A 1DL3A 4AU0A 1DJGA 1V8EA 3LHTA 1FA2A 2PUZA 1B90A 3L5LA 4X0NA 1B9BA 1VFOA 1SZFA 2BHZA 2OWXA 1E1FA 3R10A 5M17A 5LHEA 1GT8A 4DUVA 3N1AA 5FCZA 1OC5A 4LCSA 2XPKA 3CV1A 5AB3A 1JZ5A 3KVLA 4MDPA 4YVVA 3NZGA 4GUGA 3R58A 3AMKA 3KVJA 4WKFA 3FHAA 4IQDA 4DBSA 3U6WA 2WMHA 4JCLA 3H53A 2ZICA 4CU7A 3C52A 3KOFA 4J40A 4HYWA 5A6TC 1F6YA 4QE4A 1E6SM 4C6DA 3AUOA 3HURA 3WJXA 2YCLA 1JUEA 3SJ3A 3CIXA 4RDZA 3SCNA 1NF7A 3BW2A 5LIXX 1FWAC 3VNZA 3TQVA 3BSHA 3WD0A 5DQPA 3UCQA 3PJWA 3LNMA 1JF6A 3NTYA 3W2JA 1BYCA 2A7RA 4YYCA 2GJNA 4J7RA 5K7JA 5AHFA 1CLVA 3N2BA 4UFKA 4K39A 1DIKA 5HNRA 2QEZA 4K2SA 2I14A 2REQB 1Q6EA 2FH6A 4L4MA 4PFHA 3TTOA 5G1MA 4LUTB 3MMDA 4P00B 5AYYA 2CITA 3T42A 4AZBA 2W66A 2ZWZA 1LBMA 4EAMA 1PWMA 1SSGA 3ZQ9A 3LMZA 3H21A 4JTQA 1Q8AA 2J8FA 5U7SA 5DRCA 3PWAA 2WMIB 1NP0A 4NAFB 4DO6A 4NILA 3EDEA 1DV7A 4MJMA 2FMNA 1ELSA 4ZBCA 4KT2A 3OG3A 3H26A 3NXLA 4O14A 1JPIA 3I7QA 1EGZA 5HPOA 1Q6QA 5TIMA 1UYQA 1OGSA 3TJ4A 4WDUA 1JL8A 2Z29A 3A22A 3WFZA 2QIWA 3GSMA 4AZ6A 2OGYA 3W1MA 1OF8A 1T99A 2Y24A 3LHWA 2RFGA 1O5QA 1DXFA 2XUCA 4O1BA 2QDHA 3SGUA 4CVWA 3HV8A 1LRQA 3VCNA 2CCRA 1DWHM 3RK8A 2E4TA 4ERGA 4S2CA 3ZWTA 5CAHA 1XH2A 3T7VA 2F84A 4MSSA 4UC5A 3TKFA 1KB3A 1T6MA 3CHDA 3S47A 4AHPA 4ZQMA 1JPMA 3RILA 4GQRA 1KFJA 2YBVA 2X16A 1GTEA 4LVFA 4O0KA 2R6OA 1VFTA 1TWZA 3I4KA 3C0QA 3PG8A 3K4DA 1RQHA 2VNCA 1THFD 3IJ7A 2I9EA 1RVKA 2PDUA 1MQRA 1R46A 2VFHA 5EBAA 3DKLA 1HJSA 1US2A 2WVTA 2VR4A 1X7FA 2HBXA 2P5NA 3GIQA 1T96A 1KV5A 2W79A 3DI1A 4D8ZA 2G37A 2PDFA 3EOOA 1OX4A 2QVHA 2DZWA 2BODX 3OLIA 2FVKA 3NG3A 1W8GA 3Q94A 1IHIA 2ZVIA 3L65A 3WUGA 1M3UA 4CNUA 1REQA 3CB3A 3O6CA 2GVLA 4LB3A 2O9RA 4N0RA 3GHSA 3P0XA 3CZGA 3LBCA 4UWMA 8TIMA 1C9DA 3AS1A 1KGUA 3RX2A 4AX7A 3N17A 2Q6ZA 2PLMA 4LX4A 4P8VA 3VFCA 3QYQA 1N8IA 3UZWA 2DT1A 4J27A 3M16A 3WELA 1TO3A 5B7ZA 4L1WA 1HL8A 1VCVA 3MT1A 4IIBA 2CNCA 3ZOAA 2ZXDA 4Q8TA 4JTEA 1JIBA 4I8YA 3W1XA 5LNWA 1RZMA 4AD3A 2BLEA 5FKYA 1K8CA 3B8SA 3THCA 2YDSA 5CAKA 4LAOA 4AZ5A 3IUDA 2PWGA 1W3LA 3TW7A 1KCXA 3GKAA 1UD6A 1AMKA 3ZT6A 3GBEA 1ONXA 4ZE5A 1X8CA 3VGDA 3M9YA 4NG3A 4GNVA 4DWSA 1H11A 4XAYA 1I75A 1NU5A 3C8NA 4O1AA 3W72A 1HVXA 3SUSA 4GYJA 1XLDA 4ONVA 1M53A 3VXGA 3LHVA 3UCCA 4JQ1A 3CQIA 5C7VA 1W32A 2NVDA 2GQ8A 3WY1A 3R79A 3DCPA 4TX6A 2F6XA 5BRPA 1GQJA 3LM7A 1EP1A 2OODA 2WCAA 3IIZA 5CLWA 1WP6A 3ZWSA 5CBJA 4NHVA 1HKKA 1Q8JA 3NDYA 3OBEA 2V0TA 2VI0A 2X41A 3GU2A 4J3UA 3EBVA 4JICA 6ENLA 5A6BD 4E2BA 1WZAA 3MP3A 4QSFA 3W7QA 4JTJA 4RV8A 2BOGX 2PF0A 5FF4A 1IGSA 3TWBA 3WUBA 3NA8A 1MEIA 1HL9A 4H9TA 4PL2A 3DG3A 4GI4A 5FJPA 1CYGA 4MHBA 2VCCA 2PZNA 3CT2A 3NO5A 1WB0A 1QBAA 1P0NA 2GVYA 3A3XA 2AL2A 1LUCA 3CUXA 5AC6A 2Y8UA 2W4XA 4LC8A 3P74A 3OLDA 3NQMA 4RNJA 3WMCA 4LANA 4J3WA 3KEHA 4O28A 4YLWA 2ZRZA 2QJNA 3WLPA 3UA4A 4NF7A 4B2DD 2WPBA 2Q71A 3GNDA 2Y5EA 3H24A 3TYBA 1SZNA 3JVAA 4S3BA 5I3JA 1N82A 1K1DA 1WAWA 4GI9A 3AMGA 1Q6CA 1Z6KA 1LWHA 3NM3A 4AC1X 3P82A 1XBYA 4OOZA 4N02A 2XHYA 3WLJA 3UY8A 5I6SA 3DHUA 3MW7A 1Z9AA 2PDYA 1K6WA 1U83A 3KBMA 4S3JA 1W3NA 2BGQA 2PU1A 3S5YA 1SYTA 3FA4A 2XJ7A 3NPWA 4IMDA 2PRMA 2W67A 1ISWA 1SW0A 4P2VA 3WD3A 1OQFA 3QTGA 3MUIA 2DZPA 2WCSA 3UGVA 4L9ZA 2WAGA 3IGUA 1ITCA 2CLMA 4N9DA 1Q45A 1NIUA 4Q7BA 3N13A 3AYRA 3NJ3A 4Z2IA 4MVAA 4IUOA 4OWGA 1VLWA 3R89A 1ML1A 3QXBA 3ZJ6A 3M0YA 1DWFM 1ZUAX 4W93A 1QNPA 4IXHA 3O15A 2C3ZA 1F76A 2D2JA 1E0XA 3SRHA 1JDFA 1W5PA 4JX5A 4F0LA 3LI0A 1KXVA 2OQYA 5C5YA 1JZ7A 1EBGA 3QH2A 2HXTA 2J7CA 3M0VA 5KZDA 2VELA 3PF3A 4ZR8A 2O7QA 1P48A 4BF5A 3QR3A 1V08A 2H3BA 3PZOA 1JDCA 3FSUA 3BQ6A 3WNLA 4M7SA 1JAKA 2NWRA 3BCJA 4UQEA 2WCGA 3W4RA 3WLHA 3TTYA 1MZRA 3SCRA 1D7FA 1QFEA 1QPRA 2VOMA 4NZ4A 5EU9A 1JQVA 2FH8A 5LGZA 2OX4A 2ZRYA 3WNMA 2GWGA 1Q85A 4ERIA 1H2JA 3QC3A 3W2NA 3WK1A 1BRLA 2PWUA 3PM6A 2L5HA 1G69A 2BP1A 5I09A 1J2WA 1XWYA 4V1YA 2V2HA 4E38A 2PDPA 1CB7B 1OGBA 4XSLA 2GFTA 4IT1A 2HMCA 3QF0A 1Z89A 2BVWA 4KEUA 1EZWA 5AHIA 4HBKA 1HJQA 1F07A 4Y7EA 2GQ3A 4MAVA 4RE4A 2AKMA 5I3FA 5JQ9A 3LN3A 2EPKX 2DJXA 4TO8A 1Q2RA 1V6UA 2A0NA 4H7ZA 3PP7A 3VTRA 2NV1A 1W1PA 4TU1A 3UZZA 9XIAA 3B3DA 3ZR6A 4EXBA 3N2OA 3S5NA 4LV9A 2EF9A 1JNDA 1EQPA 2EG6A 4ZQOA 3JW7A 2J9XA 4JN7A 1NWSA 3LGGA 3OLGA 1A53A 1OZQA 4TIMA 3TN5A 1GVEA 1S2TA 2YDQA 1AQMA 3O07A 1DWJM 1OABA 3NYZA 4HOXA 3RPTA 4GLEA 1JF5A 1OYCA 3W7KA 2H9AA 4BI6A 2XVKA 3K13A 2D24A 1YPIA 2Q01A 3DFPA 3QZAA 3N4EA 2C0AA 1KV8A 4X9SA 3MSGA 2QCMA 4NXSA 3ZIZA 3LTPA 4LAZA 3VUPA 4F66A 2X0HA 1PSCA 3LLXA 2WNQA 3OYZA 3PULA 3VOGA 3GNPA 4ZZ9A 3CC1A 3LENA 4R85A 1Z41A 4LAUA 1RR2A 1OINA 3TW9A 4JTGA 3POHA 2HVOA 1JZ4A 3MMUA 4E8GA 3S4TA 4L6OA 2XIOA 4DF0A 3G1YA 5A94A 1EEPA 3TSBA 5A8OA 2ZYFA 2OLAA 4PMVA 3WLOA 4FHAA 4YXGA 3MHFA 1UHVA 2G50A 3G0UA 3GS6A 4JD4A 1QK0A 4BQ3A 1EEXA 2Y1HA 1R5YA 2JGYA 1KO0A 3W7OA 1EPVA 1AW2A 4FOUA 2DQWA 4Y9NA 4AW7A 1MXSA 3ZR5A 1S2CA 5AC5A 4Z0SA 3FNDA 5DT5A 5EIYB 2ABBA 5M5DA 4KCUA 5FOOA 2UY4A 2OOFA 3I10A 3HPAA 2FQIA 3NOEA 1OG6A 1TJ1A 4CD6A 3R12A 3CJPA 1YTDA 3RO6A 3UY7A 3O6AA 4ZSUA 3VAVA 4OUEA 5CBIA 1EUAA 2PWFA 3VZYA 4C6BA 4RNFA 4CQAA 3C6CA 3BGAA 5LKYA 4IGMA 4C6MA 2GL5A 1V0NA 2QYGA 1A49A 2EG7A 2NX9A 2V5BA 3LEPA 1RXOB 3TW6A 1GVQA 1MRQA 3Q65A 3G1FA 1H60A 4NZ5A 4X2PA 4A3UA 2OMAA 4DEFA 3L4UA 2E28A 4JIPA 2PA6A 2O9PA 1WUFA 1VLIA 3L12A 2I56A 3EMCA 3GZ3A 4D6CA 4GY7A 5D03A 1HP4A 1JCXA 1R8LA 2GVJA 2QV5A 1XYMA 3TP4A 2C18A 1VIWA 5JBEA 1PZ3A 5C55A 3TDFA 3RAOA 2FGBA 4JS3A 2W27A 2TYSA 3P0WA 1U5HA 3R4IA 1PX8A 2HK1A 3B9EA 4PUJA 7CGTA 3SECA 3ITYA 3G6LA 3AIQA 3B05A 3FV9A 4N7QA 1ZENA 5BCAA 2WM1A 3AWOA 1R2TA 2OELA 3H2AA 5HR7A 5C9WA 2JALA 3LDVA 1GYLA 1V6TA 3TONA 2RDXA 2QUTA 5BRBA 1S3HA 2ZZ7A 3G2GA 3GUGA 4K6AA 4JDBA 1PYFA 1VB9A 4L64A 3DC0A 3B0VC 2PGRA 4WRHA 3WZ0E 3BANA 3GDKA 3T4CA 1E6ZA 2A3AA 3SQLA 3L23A 2POZA 1VCFA 3VMOA 3WBYA 4PL1A 3HQNA 3PBMA 5REQA 1BQGA 4ATDA 3W7RA 2PSNA 3KWXA 5I2UA 2NT0A 4WX2A 1A3XA 3SUTA 2VX4A 1RP9A 1UQZA 4U5IA 3V1PA 3MMTA 4YPJA 3FA3A 1CGYA 5CJ5A 3KOZA 3N04A 3U5UA 3BGGA 4V27A 1B57A 3BK0A 3GWQA 1F05A 1GKPA 1HJUA 1KBKA 2YCJA 4FR1A 3L4VA 5G5IA 3W3OA 1MEHA 4LEQA 3VK5A 5GNZA 1E4NA 5FSDC 5MKGA 2PU0A 2QDDA 3EWCA 3T2QA 3AYVA 3QY7A 5J5RA 1ITQA 5ECUA 2QS8A 2DV0A 3JZEA 1EJSC 3R0UA 2VOTA 3D6NA 3HM7A 3IIPA 1XFBA 2QMKA 1FWHC 1AD1A 3CM4A 1W5OA 1VFSA 5M3WA 3NGFA 3NWRA 5AYBA 4GXWA 2TODA 3A64A 4GA8A 2OYKA 1JFXA 4HCDA 3ZVHA 1KKOA 1SMAA 3ZLHA 3GG1A 4CGTA 1OADA 4NZCA 5AC8A 3NL2A 1DHPA 5H2ZA 3O2LA 2VEGA 4J3SA 4DBWA 1O7AA 5KMYA 3QLLA 4WF7A 2P3ZA 5CPSA 3H7RA 3Q67A 3PZVA 1ICQA 1ZU8A 1A80A 4S3KA 1BTMA 3F5JA 3A9BA 1DTUA 4OE7A 3IPWA 6REQA 1NF0A 4ICMA 2DT2A 3KLKA 1SGJA 1TIWA 3GUWA 2C1HA 1VYRA 2VVSA 3IVSA 2D0HA 4GIRA 4IGHA 4PB3A 4S3AA 3H54A 1V6WA 4HYVA 5LNVA 1A5SA 4A8IA 4H83A 1W5MA 3JU2A 1EHAA 1WBJA 3IEBA 1IEIA 1GOIA 1H51A 1BXBA 1RK6A 5BYWA 4KEVA 4O13A 2QKFA 4RE3A 3ABOA 3QKZA 1M01A 4F40A 3RU6A 2FPVA 3O63A 3TJLA 1MI3A 4L61A 1VRDA 1UKSA 1KM6A 1V6XA 3ELFA 4V2XA 4Q4RA 2DFAA 1S5MA 3BGJA 3C0JA 3C61A 1Z8AA 3KAOA 2LLEA 4OQVA 1U1JA 3SCPA 5E09A 4UQCA 4CD8A 1W17A 3R8HA 3RM4A 2JKPA 3NVDA 4Y9OA 1H41A 3ITLA 2IUZA 3DUGA 3TR2A 1LQ0A 4GZIA 3CMFA 1GEQA 2QR6A 3WJWA 3T0AA 5HATA 3LSBA 4A3RA 1FKXA 4CN6A 3R8RA 4F2UA 4KBXA 2R1MA 2YL8A 3GTXA 4DXKA 1TE6A 4AMAA 4QISA 3FGCA 4H7VA 2GLKA 2VMFA 3TA6A 4GUHA 4GINA 1E71M 3EX3A 3N6HA 4UOQA 2X2GA 4K8EA 3N25A 3WNPA 1C8VA 4CKQA 3UYIA 3JUGA 2RUSA 4PCNA 2I1OA 3P80A 3OOQA 2NSXA 3EWXA 4C6IA 1OEPA 1LDCA 5LIUX 3IACA 2VGBA 2C13A 3MS8A 1FH7A 1QBBA 2FDMA 4FK9A 2FIQA 4O11A 4K3ZA 2BY1A 5DCEA 4ORIA 4GMEA 1YRRA 1TPB1 1VS1A 2DORA 2BHYA 3GVVA 4AEOA 1W9DM 3WQEA 4JQ2A 2INFA 1U5JA 3NPVA 6CGTA 3SCWA 3WH9A 1NWRA 4N9BA 4P5UA 3SGGA 3U4AA 3T81A 3ISIX 3HG5A 4BY3A 1NDVA 4IPPA 5AHEA 1F5ZA 4B5SA 4HTYA 4PBGA 2PDGA 2X0SA 3NR0A 2CBIA 2VRKA 4RNHA 3U7BA 2PODA 4QDMA 1MYRA 1R3SA 1Q13A 4L1XA 1M7PA 2BDQA 1FWSA 3BLOA 1V3KA 4XKYA 1O95A 3WNNA 2ZOXA 7A3HA 1EPXA 3B9NA 4J28A 5FJOA 2DVXA 4D1IA 3WNKA 2IQDA 1LWJA 3DZ1A 3E49A 2D3LA 3MB9A 1BVZA 1MNSA 2R82A 1NFGA 3T8LA 2GK1B 3PZNA 4WUIA 3TZNA 3QTPA 1G9HA 4PTWA 3BOLA 3E5PA 1QT1A 1HUVA 2BGSA 4FXFA 1PL9A 4GK8A 1ME8A 1KBBA 1B3WA 1A4MA 5T9CE 1YDYA 4Q4SA 3QPZA 2W91A 1EP2A 4M6QA 1E1EA 3WDRA 4IIEA 3E1F1 3BMXA 1EA0A 1VGAA 1PZ2A 2WVVA 2ZZ1A 3VD4A 2XGIA 4GNKB 4DAIA 1R86A 4C91A 3VKDA 2QCNA 4QJ3B 3FYOA 1SMDA 3FJLA 3TCSA 3G1HA 1DHKA 1A50A 2O9OA 3RM9A 4P61A 4GZJA 3I3BA 1TCMA 1KKRA 3P3BA 3ITTA 1N8WA 2QCLA 3V5CA 3CNYA 1Y8BA 2Y8KA 3IJQA 5A6KA 2C0HA 3XIMA 3MYOA 3UNTA 1R47A 5T91A 2VGFA 2GJLA 1HKMA 1SW3A 2XSAA 2ZE3A 3T0CA 4PMZA 4DWSC 5A6JA 1P6BA 4AIUA 4DO5A 1EKOA 2J47A 1M6JA 4NRRA 4WSKA 3UXDA 4HU0A 2ZC8A 4RX0A 4UMBA 4UFJA 1JDAA 4F3HA 1YE6A 1IZCA 1RCOB 4E4FA 2ZA3A 2IKJA 2JQXA 4DRSA 5C0QA 3T6CA 1TWIA 3C2OA 1UPPA 5JVLA 4IG2B 5AYIA 1WXZA 4NVTA 4PUMA 2D69A 3E0IA 4G6CA 4NSBA 1I1XA 4MFEA 5I24A 4UB9A 1Q4NX 4IIGA 2VCBA 4Z42C 1SJBA 4MLRA 1DQWA 3DBPA 2NXHA 1R9ZA 1MRAA 5FF0A 2Q02A 2CLLA 1CEOA 3PJXA 4UR9A 1BWVA 2D0GA 2R14A 3QW4B 2J7EA 1ZL1A 1FWWA 1TA3B 3FN9A 1NDYA 1KWGA 3K8LA 1MUCA 2YYTA 3A12A 1B3ZA 4LAKA 4BA0A 3VMPA 2WVUA 3W6LA 3SN4A 3WLTA 3U2EA 2O55A 3SAZA 2G97A 4HA3A 1UR3M 4UQBA 3WFLA 1NVMA 3VOCA 4Z2LA 4B9ZA 4EXQA 5DN1A 4GC3A 2PCQA 2OVLA 5DLCA 4H9ZA 3QSTA 1R87A 2XGBA 4WZHA 4XTIA 3WMBA 2OB3A 3EEZA 5D2VA 4DXXA 1LBLA 1J0JA 3A9IA 3MWAA 1LT8A 3SRDA 2PTDA 3SO7A 3I3EA 3EOEA 3EDJA 3DDMA 1C8XA 1CXLA 4HA4A 4J5NA 4L6DA 3VC6A 3WJSA 3PTMA 4YMZA 1UUQA 2G3FA 1CXIA 4D72A 1I2QA 3FJ6A 1W8SA 3KX6A 4HKPA 3KHDA 1IT0A 4P02B 4PSPA 2PI6A 3FDKA 1MZHA 2BBFA 4MB1A 4IL2A 3DN5A 4R9OA 1YLVA 2DJLA 1VFMA 1X98A 2WZEA 2VWTA 4Z1YA 3FJ4A 4LW7A 4CCCA 3CIWA 1JZ3A 2DSWA 4Y9PA 3B0XA 3U5YA 4DBUA 1TRDA 1TX0A 1BG9A 4XBSA 3EX6A 5HBFA 3CPRA 4I9TA 1A3HA 1EXBA 4DJED 3ZVIA 3MO4A 4H7CA 3NQ6A 3BL3A 3WK3A 3DKJA 4MNLA 3MC5A 5ECVA 2YX0A 5A2BA 4KGJA 1AL8A 1D8WA 1BPLB 5GJMA 3TEVA 1HKVA 1XH0A 4FAMA 2XM1A 3ATYA 3E0FA 1W3IA 1JRCA 3ZJ7A 4PCFA 4FLSA 1OFAA 1S1RA 1KGWA 1VPYA 2GQAA 3GYCA 2ZQ0A 2ADAA 4Q33A 2BXYA 4WSHA 4DNHA 5I3GA 4PSRA 2E6DA 3M0ZA 1M03A 3TYAA 2VURA 1FX6A 4M7TA 1I4NA 2HISA 3ICJA 1WZLA 1HW6A 3I3DA 3GNOA 3G0XA 3AI0A 2Z24A 3E0LA 3FA5A 1BF6A 2ATMA 1V03A 6TAAA 4U2ZA 4JTHA 2Z6IA 5F4SA 1PHWA 4C6KA 4MLJA 5ABEA 1QHPA 1QVBA 1TKKA 5LXEA 1OZMA 4XUYA 5IM51 3KTSA 3NEVA 2EPOA 4AD1A 2PTZA 2WSPA 1L6WA 1J0ZA 2E9LA 4MG4A 3ZM8A 4HNCA 2WLZA 2V9DA 5E5CA 3SEPA 5KTLA 2PWHA 4PMNA 4TTGA 4QG9A 2OEKA 4MWAB 3GXNA 1VENA 1H5VA 4CQCA 5DMNA 4JN8A 1VHCA 3WLKX 3VIKA 2XG9A 3CGTA 1MMFA 3FCPA 2REQA 1O94A 1NQKA 3W7IA 2YA0A 4ZQNA 4B4FA 2CWXA 1FWRA 3A4WA 4FNSA 5H8UA 3VNYA 1XCFA 5EKYA 1YW1A 5A95A 5I3HA 1H0GA 5CSYA 3ZT5A 1F8MA 4N6EA 1LORA 5CZTA 4AXKA 3KBVA 3HGJA 4NAFA 2WO5A 2WMIA 4D6IA 5A6BA 4KRTA 2ZA1A 2Z2UA 3H70A 4IGSA 3W71A 1LJYA 1DYSA 5BXRA 3W1LA 1LROA 5I3DA 3OVRA 2QDEA 4MAZA 3GIPA 4BKNA 5C9RA 3GLCA 1CNVA 2FTWA 3G22A 3L2MA 3E2RA 4DUXA 5D33A 4ICNA 4HB7A 1XPGA 3PNZA 2V68A 1ISXA 4K1GA 5D30A 3BLKA 4HZ6A 4C6FA 4DLMA 3EOLA 1RK5A 4IGNA 4LRTA 2P3EA 4R33A 4XZNX 2POTA 3TWAA 3IIVA 1H0IA 4IXXA 3VE7A 2ZCGA 3K46A 4V28A 4GY0A 1M5WA 2X30A 2DZTA 3WN6A 1AQHA 4JY9A 4Q7NA 3ZJ8A 3FYYA 1LM1A 1GJPA 2CKRA 3W74A 4NZFA 4Q8UA 5K4XA 1RHCA 4GE8A 4QIUA 4BS0A 3GVWA 2VEPA 3T4WA 1AH4A 4KGLA 4HK7A 5CPOA 3KL0A 3T1GA 3OTRA 1W1IE 1ONEA 3USZA 1TMLA 1NDWA 1YMYA 3UYCA 2H8XA 4MKVA 4F0RA 1BWLA 1JYWA 3HTWA 3UVIA 2PLKA 4HN4A 2Q3OA 4Q4OA 3W1RA 4C7DA 1NQ6A 5F1UA 2Q3RA 1PZ0A 1TPDA 3AZSA 1RQBA 1AK5A 5FF2A 1TWDA 4NNAA 1RH9A 3BMWA 2VEFA 1DIEA 2PAJA 3DG6A 4EACA 4EAYA 4UBPC 4FPSA 1I9CB 1W1B1 4AIBA 1L6GA 1O5RA 3TN4A 4ADSA 2DUZA 1V3LA 4JQAA 3T8QA 3H8AA 1F3WA 1AQ0A 3GE7A 4XO6A 4AG0A 3WDJA 3RLUA 2D1ZA 2HS6A 1E0TA 2I5GA 4Y2WA 2EEXA 1HGYA 1OC6A 3C86A 3P7YA 3F2CA 2HSAA 1GYNA 3MSYA 2VZSA 4KCTA 3QEZA 3ARSA 2Y85A 5CPQA 4HVXA 4ZTXA 1J5SA 3WLQA 3VGHA 2NQ9A 2XH2A 4FZIA 2CZDA 1AJZA 1UKPA 3ANUA 5D9OA 3W86A 1W3HA 1A5CA 2E09A 3VIGA 2WLYA 5CG0A 4OVXA 3R1ZA 1E70M 1SW7A 3QN3A 2IS7A 3LV6A 2VC6A 2WMFA 4LV4A 4ASTA 1LL6A 1CGXA 1EJVC 3QMSA 2WBGA 1E56A 3F5LA 3NO3A 1IR2A 4EF8A 4MWAD 3WL1A 4GJ1A 1IV8A 1GK8A 1ZSXA 4H04A 4ERAA 4E4PA 4W9TA 4XQ6A 4DNMA 4H6EA 2Z4GA 4B5WA 1YDNA 1OCNA 1E3XA 4PR4A 2F8QA 1XF0A 5LA2A 4LB4A 5BROA 1PX4A 8A3HA 4M82A 4HN8A 3UR5A 1O60A 4L80A 5GQBA 1DE6A 3HJZA 3CT7A 2W61A 1YTKA 3GFZA 2JFEX 3RR1A 3CH9A 1XLIA 3TJIA 4LC6A 4KMQA 3BJFA 1RBOB 1QI3A 2BB0A 1WKEA 3MP5A 3SCQA 7ODCA 1XYAA 3ITVA 2FGZA 3ATZA 3BG9A 3UWEA 3PUEA 5FEXA 3CUGA 4B5XA 5BW6A 3E6EA 3H4WA 1XYBA 4PN2A 3FXYA 5G2WA 3ABZA 1XQLA 1GZGA 2D22A 1XFCA 1QPNA 1E73M 2F9RA 5EL1A 1FWNA 3BSGA 2HEJA 4O8RA 3C56A 4UTMA 1H62A 1UH2A 2E40A 4EK7A 4DELA 1TJRA 3NNTA 4HSHA 3V7PA 7TIMA 4IISA 3L4TA 3NSNA 1B54A 4W5ZA 1MW3A 2AMGA 4HCLA 1T40A 3H7VA 3NEHA 2OZ0A 1OFQA 3GK0A 3DHDA 1M7OA 3LGEA 3VA8A 1I6NA 1UZ4A 1A5BA 3DBNA 2V3GA 3KCLA 4NX0A 4IFKB 3NQ7A 3UNDA 1RBLA 4YVPA 5HAOA 4B5UA 1DORA 3PY2A 4BI7A 1TPUA 3W25A 1EJ7L 4IICA 2R91A 4S39A 5FAJA 3D47A 2J8GA 5CGTA 4MYXA 1U33A 2BGNE 4ZOBA 3PSVA 3AHTA 4O1DA 4U5KA 3IGXA 2AQWA 1SU5A 1S1PA 5A8GA 1E9LA 3MZNA 4JTCA 1NELA 1X38A 2QCFA 4S3GA 1X1OA 2DH2A 4FF5A 3N29A 4FP1A 1PPIA 3UPWA 2EGZA