3GH4A

Crystal structure of beta-hexosaminidase from paenibacillus sp. ts12
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
519
structure length
507
Chain Sequence
HHHHSSGLVPRGSHMASMSQPSILPKPVSYTVGSGQFVLTKNASIFVAGNNVGETDELFNIGQALAKKLNASTGYTISVVKSNQPTAGSIYLTTVGGNAALGNEGYDLITTSNQVTLTANKPEGVFRGNQTLLQLLPAGIEKNTVVSGVQWVIPHSNISDKPEYEYRGLMLDVARHFFTVDEVKRQIDLASQYKINKFHMHLSDDQGWRIEIKSWPDLIEIGSKGQVGGGPGGYYTQEQFKDIVSYAAERYIEVIPEIDMPGHTNAALASYGELNPDGKRKAMRTDTAVGYSTLMPRAEITYQFVEDVISELAAISPSPYIHLGGDESNATSAADYDYFFGRVTAIANSYGKKVVGWDPSDTSSGATSDSVLQNWTCSASTGTAAKAKGMKVIVSPANAYLDMKYYSDSPIGLQWRGFVNTNRAYNWDPTDCIKGANIYGVESTLWTETFVTQDHLDYMLYPKLLSNAEVGWTARGDRNWDDFKERLIEHTPRLQNKGIKFFADPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular cloning and crystal structural analysis of a novel beta-N-acetylhexosaminidase from Paenibacillus sp. TS12 capable of degrading glycosphingolipids
pubmed doi rcsb
source organism Paenibacillus sp.
molecule tags Hydrolase
molecule keywords beta-hexosaminidase
total genus 191
structure length 507
sequence length 519
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3gh4A01
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3gh4A02
3WH6A 2RGMA 3WUEA 1VBRA 4ZXLA 3MSDA 2E8YA 4PMUA 5FIPA 3WDHA 4BZYA 4JCMA 1BGGA 2YLAA 5I77A 3AIVA 4OBSA 2FH6A 3L4WA 1XH2A 2G41A 2XYLA 4JL1A 2ZUNA 5E6ZA 5E6YA 4ACZA 1EOKA 1MQPA 2WMGA 4ATDA 3UG4A 4D6JA 3AS2A 3CZ8A 1C7SA 3VIKA 3WBAA 1GQKA 3N13A 3CMJA 3M6DA 4PUEA 2MANA 1LL7A 3MO4A 2YA1A 5DO8A 1K9TA 4CVWA 1ZB5A 3NYDA 3WNKA 1C90A 4GI6A 3OG2A 2RGLA 4JFTA 4D6GA 1UD2A 4W86A 4MNMA 5A6MA 2OWCA 4WKHA 3U5YA 2VMFA 3VINA 2C8NA 1XHGA 3AS1A 1JXKA 4AD2A 1TE1A 4LQ1A 3FW6A 4S3JA 4W5ZA 5CLWA 2WYSA 3AYRA 1CENA 3PZMA 4QAWA 2GVYA 4QCFA 3N11A 3AXXA 2J7CA 3IAPA 4DUWA 1QW9A 2WMIA 1CXLA 2WCGA 1EOMA 1OIFA 1BYAA 4NSBA 3WN6A 1B1YA 3EBVA 3U7BA 3UR7A 5ABFB 4UQCA 1TR1A 3NSXA 3S2CA 5D9MA 1XCWA 2PWGA 1ISWA 1BAGA 1UR4A 1UWIA 4HA3A 3VDAA 2BY3A 4W85A 1JYVA 3D3AA 3MANA 3ZJ8A 3PTQA 1V6XA 4BS0A 3RPMA 2A3CA 3AS0A 3CZJA 1Q6DA 4JFVA 1B2YA 3UESA 4QLJA 1EA9C 1E40A 1W1TA 2WKGA 3EDKA 5D8WA 1BLIA 4D71A 1BHGA 3AMGA 1XRVA 4YN5A 4CD5A 1J0KA 3N04A 2CXGA 2VRJA 2D3NA 4D1IA 2DIJA 4LYPA 3K8KA 3FY1A 1UA7A 4UFIA 2CBIA 4RL3A 3K4AA 1Q4NX 2W62A 2O9OA 1UA3A 5D4YA 1DWIM 5JBEA 1KBBA 3QHNA 4TUFA 1UWUA 2VZSA 2X8RA 3VD4A 1WDSA 2D24A 3MUY1 2YA0A 1VFFA 2VVNA 3TTOA 3ALFA 1LG2A 1R7AA 3OLIA 4OUEA 3VTRA 2EBNA 3ZR5A 4W7UA 1W9PA 3MMDA 2A3AA 3RO8A 1BTCA 1GVYA 4W5UA 4Z2HA 4BQ4A 4HPGA 1SR0A 1V6WA 2G3JA 4J7RA 2YL5A 4HZ6A 4PMYA 3SURA 2WMFA 2ZE0A 1QI5A 1UR2A 5IHSA 2F8QA 2BHZA 2EJ1A 1M01A 4JFWA 4AYSA 5HPOA 1GVIA 2VZVA 3WY1A 1OSEA 4B15A 5CG0A 3AQUA 2UY2A 2CBUA 5E0CA 1BG9A 4CD6A 4AXNA 3WD4A 1I75A 2WMKA 2BFGA 3DHUA 4UNIA 2YBUA 1QNRA 1M04A 3KEHA 1KWGA 4U3AA 1J0ZA 1H5VA 2E9LA 3KZSA 3GH7A 1HKMA 1ISYA 1UR9A 1E6ZA 2WVSA 4AMCA 1Q6FA 5A6BD 3ZQ9A 4HP5A 1NH6A 2GDUA 2DH2A 4HOWA 3WDQA 5JIWA 5D9NA 1DWJM 1V3HA 3FXYA 3SCPA 2WLYA 4F8XA 1OGGA 3FNDA 1WAWA 1NOUA 2WZHA 5BCAA 3AIUA 1E6SM 4OOUA 2WSPA 4HTYA 2ZIDA 2J78A 3ARZA 4NRSA 4MB4A 4EAMA 3MKKA 1W3JA 1KCLA 2IXUA 3RM9A 5DFAA 4X9YA 5BXPA 3SCNA 3CBWA 4GO8A 4PTXA 2E8ZA 4XX6A 2CPUA 2BS9A 1ZBVA 2J7GA 1TVNA 4HPHA 4TVUA 5AYIA 2DSKA 1VB9A 4OBRA 1EXPA 1V0LA 4FMVA 2YOCA 3VDBA 2YL6A 1KXTA 4AZ6A 4W93A 1FA2A 5BROA 4WF7A 3RJYA 1OM0A 1JAEA 4AD4A 1SYTA 4UFJA 1QHOA 2J8FA 4PMRA 1KQZA 5GNZA 4AIOA 1B3WA 2WWDA 3WBEA 3T0BA 3CZEA 4E8DA 5IFPA 1E3ZA 1QOXA 1XD1A 3WD0A 2Z1KA 1HKIA 1TA3B 1RPKA 2C7FA 2WZEA 1B3YA 3AZRA 1H1NA 1VEMA 1IV8A 4QDMA 1PBGA 2TAAA 3QHMA 4OKDA 3ZOAA 1UR0A 2J62A 4LPCA 1VJZA 1E0XA 1W9XA 1X1NA 2CEQA 3VM5A 1UG6A 5JBDA 5CQ1A 3IANA 1EDQA 5ABGA 3SEPA 2WMIB 3CH9A 4GZIA 1U2YA 2IUZA 2DT0A 3SUUA 3AMKA 1HJQA 5ABFA 4PYSA 1CGUA 2J77A 4P7RA 1HVXA 3GXMA 2WMHA 1HT6A 1E55A 3I3EA 4JHOA 6CGTA 1Q6EA 1QHZA 4JIEA 3A47A 3K1DA 3L4TA 4H04A 2DT2A 3BMVA 4WSJA 5C70A 1ZL1A 7A3HA 4AZCA 4PN2A 5CGMA 1DWHM 2GUYA 2VC9A 5A2CA 2XM2A 1PEZA 5M17A 3RCNA 3PZTA 1MWOA 4WJXA 1PZ2A 2BXZA 4C7DA 3PBGA 2GDVA 3VX0A 2DSWA 1ZJAA 2VJXA 3EMCA 3AXHA 1H49A 1B3VA 3VIIA 1HJUA 4OJYA 3SCWA 1W3KA 1AQHA 4M8UA 1QPKA 4JFSA 1GOIA 5HDRA 2BXYA 1JZ4A 3L2MA 3ZIZA 1FFQA 3VIJA 4KGLA 2YL9A 1E72M 3BLKA 1E5JA 1WCGA 2FH8A 3ARRA 3KE0A 1X6LA 3F5KA 1KWKA 2ZXDA 1L8NA 3AROA 3AZTA 1JNEA 2DT1A 2J7EA 1OT2A 5A94A 1H11A 5LA2A 4HMEA 1YQ2A 1PX3A 1UKOA 3AYSA 3LPPA 1DWAM 4CU6A 3AI0A 4AD0A 2ZOXA 4P8VA 2BVDA 5LA1A 2BHYA 3ZJ7A 1B9ZA 4TTUA 1UD6A 3U5UA 4IUGA 1R7OA 1PX8A 1BVZA 3OGVA 1MW0A 3VIFA 4BQ5A 1JZ5A 3I3BA 3MMUA 5FKYA 4AZ7A 4BQ3A 3AIEA 4CU7A 3OLDA 4GQRA 3SUTA 1J01A 2XVNA 1EO7A 1GJUA 1CXIA 4W8LA 3SUWA 5A8PA 1HL8A 4UZSA 3ZMRA 3HU7A 4A3YA 4PMXA 1ISXA 1E71M 2GJPA 2NT0A 1W9BM 3GZAA 4W88A 3SCUA 1H09A 3ZT7A 4HA1A 1UD8A 4AZGA 3CMGA 1K9DA 3GH5A 1E73M 1JFHA 2GJRA 3WQ6A 4PCTA 4B9ZA 2WBKA 4TVDA 1A47A 3NCOA 2OWXA 1JL8A 1K9FA 1ITCA 4P8WA 2VRKA 3GXDA 4JKLA 1UWRA 2BVTA 2D0GA 5CZKA 1GW1A 1WZLA 5D9PA 2YKKA 2Y5EA 3VD3A 1EGZA 1J18A 3N1AA 3IAQA 4ATWA 2XWEA 3W6MA 3CTTA 1KGUA 1JDAA 3WL1A 3OGSA 1F4HA 3ARWA 3L4YA 3VMNA 1QI2A 2WWCA 4PMQA 3WQ5A 5A6JA 1VIWA 1TG7A 1C7TA 3N17A 3ZJ6A 3VILA 4DWSA 3O6AA 4IPNB 2VCBA 4D72A 3BCDA 3PN8A 3THCA 3WH5A 3MUIA 4MDPA 3AHXA 4UFLA 5E09A 3SCOA 3UEQA 2WCSA 1CXFA 3AJ7A 1W2VA 4DWSD 1KXQA 1W2PA 4J3SA 1MVYA 4OIFA 4WSKA 4XZWA 4QLLA 3WUGA 2CNCA 1HVQA 4QFUA 3WQVA 3WEMA 1GPFA 2WVUA 5C8BB 1JYNA 3T2PA 2ZUMA 1NOFA 3WNMA 1C8XA 2WAGA 2EQDA 1XYZA 4J28A 3VIOA 3OBAA 4H8UA 4WLCA 4UFKA 4AC1X 1LQ0A 3GNPA 4CD8A 3GBEA 4W7VA 2WBGA 2WHJA 2E4TA 1NWSA 1OT1A 2J25A 1M03A 2CKSA 1OBAA 4JZ5A 3IJ7A 1C91A 1W91A 2PF0A 4LX4A 4PTVA 3A3HA 1E4LA 2VNCA 2F2HA 2XFYA 2DSZA 2ZUVA 1GNXA 4B3LA 1E0WA 2XVGA 3ARSA 1E6PA 1LWJA 3OA5A 2QHAA 2VOTA 3W29A 4EANA 5GNXA 1UUQA 1V6VA 5HBFA 1VENA 3W6LA 2EPNA 1J11A 3RJXA 4L4OA 4Z2JA 7CGTA 1CEOA 3QOMA 1G5AA 2WPGA 3AOFA 4J27A 5FL0A 5GQBA 1IT0A 1B90A 2JF7A 4CCCA 4MNJA 2G3MA 4KGJA 2Y4SA 4B16A 2EPOA 1E9LA 1VF8A 3SCQA 1E43A 3ARPA 1XV8A 1KCKA 1AMYA 4M24A 1VBUA 2VX7A 1R8LA 3MUZ1 1JIBA 2QMKA 5E0FA 1QVBA 3NIYA 2V3EA 4D6CA 4FLOA 1ZBCA 3N18A 1LWHA 2OYLA 2E40A 1OCQA 3FHQA 4FF5A 2OSWA 3WDPP 1EHNA 3L2LA 1UH2A 1P6WA 4TOQA 4M82A 3AHYA 2WKLA 2WLZA 1OINA 3BCFA 1HIZA 3LPFA 2FHBA 2ZUTA 1QNSA 4HMCA 4CD7A 1UWSA 1MW2A 5I6SA 3ALGA 2PB1A 3B9DA 3ARTA 4KRUA 2QMJA 4J3TA 1JI2A 4JFUA 2EEXA 5AC5A 2V5CA 4B3KA 1HNYA 2WVVA 1ITXA 1J0IA 5I2UA 1XD0A 1GQLA 3L4ZA 3WIJA 2FHCA 1E0VA 3WDJA 4C91A 1EQCA 1W3HA 4KH2A 8A3HA 4HOXA 4TX8A 4EE9A 3WNOA 2XSBA 3WKZA 3EMZA 1H0GA 1W1VA 1UQZA 3SCTA 3ARYA 3PZ9A 1W32A 1HP4A 4R5EA 3W26A 3AMLA 4TXEA 1CTNA 1CYGA 3FAWA 4CN6A 1BF2A 1WZAA 1W9VA 1GJWA 2XPKA 3VGEA 2EXOA 1PIFA 2ZICA 3E1F1 5D9OA 1QW8A 2CKRA 3CLWA 4IM4A 1VEPA 2YBTA 3LPGA 1GOMA 4GINA 2VI0A 1ISZA 4D6HA 1CXEA 2XIIA 4ACZB 3IJ9A 2VX4A 4RE2A 4JKKA 5CPTA 4XUYA 4LYRA 1Q6CA 1TCMA 1K6AA 3BAJA 2V3GA 5C71A 3WELA 3SUSA 4CKQA 1V3LA 1GCYA 2CERA 3BC9A 4OZOA 4GI9A 4AWEA 2BY1A 3PTMA 2PI6A 1J10A 3OLEA 4J3VA 3B9EA 4MJ2A 3HMCA 1B31A 4HA4A 4UCFA 4J3XA 3VGHA 2ZX8A 2CITA 2E9MA 2XUCA 1XGZA 3AZSA 2XJ7A 1O7AA 2WC3A 2AAAA 4RE4A 1UWQA 2XVKA 5ECUA 1WNOA 3HJEA 2YA2A 3PHAA 2VRQA 4PMNA 2UWFA 1HKJA 3APGA 3NJ3A 3VNYA 1J0YA 3AHZA 1LF1A 4M81A 1PPIA 2D1ZA 3WF4A 1UD3A 1KFWA 1D3CA 3PZVA 4MB5A 2CIPA 3GM8A 4F9DA 4GO9A 1V6UA 5I5RA 1ODUA 4MAZA 5EBAA 2JALA 2PWDA 4HU8A 2BV9A 3UG3A 2J74A 2OYKA 4GPNA 5A6LA 3PZIA 4PCSA 1MXDA 2YL8A 3UR8A 4ATLA 5DEZA 2ZWYA 1ZBKA 5TD4A 1HP5A 3VU2A 4AEFA 1ISVA 3WEZA 3EDFA 4NF7A 1QI0A 4M1RA 3T2QA 4U5KA 2VCCA 4WK9A 4C7GA 4HMDA 1XCXA 3T0AA 1DWFM 1V0KA 3BSGA 3CUFA 5CSYA 3W82A 4CVUA 1JYXA 1HXJA 1Y7VA 3M46A 3VKKA 5CJ5A 1FHDA 3FN9A 4LYQA 3VD7A 5FD0A 3AMDA 2W91A 4U2YA 3W37A 2VURA 5BXRA 1NP2A 4UOZA 2PWFA 1CIUA 2JE8A 1L0PA 2O9RA 4PMVA 3WMBA 4B9YA 1CLVA 3AISA 2XWDA 1BVNP 3BGAA 4ZE4A 1UZ1A 1V03A 4D1JA 1EIBA 3BAYA 3HN3A 1JXJA 1KR0A 3AIRA 4X0VA 2X09A 2ZWZA 1JDCA 3PZUA 4PMDA 5LYRA 3N15A 3VGDA 3B9AA 4UQBA 2BNJA 1GOQA 1EO5A 3QOKA 1V3MA 1V3IA 4E2OA 1ZS2A 1OGBA 2YIHA 1MFUA 2QV4A 2GJXB 4GIAA 2G3IA 4L4PA 1KBKA 3WD2A 1GHRA 3MS8A 3U7VA 3VX1A 1CNVA 2J75A 4GQQA 2J8GA 1QNOA 4XZBA 1QI4A 5AY7A 3WNLA 4YHEA 5A8MA 4ZXOA 3CO4A 4U33A 2UY3A 1W9UA 1E56A 3POCA 2O92A 2WHKA 2VZUA 4W8BA 2ZX9A 3WMCA 1MQQA 1MW3A 1JZ2A 5FCZA 1E6QM 1WZMA 1G01A 5I0DA 5I3DA 5EFDA 1BYBA 3GH4A 3OZPA 5BRPA 4AZCB 1HN1A 2OSYA 4PRWA 1OD0A 3ARXA 1O6IA 1UZ4A 3W4RA 3NDZA 1KB3A 1W1YA 1BYCA 1CXHA 5FL1A 2PWHA 3VPLA 2ZX7A 1E15A 2E9BA 2QF8A 1LL6A 3LPOA 4CUCA 4DUVA 1PZ3A 3VD9A 5A6AA 4D6IA 5F7UA 3AHVA 3WUFA 1GUVA 1X6NA 4AEEA 5BXSA 5M5DA 1DEDA 3RM8A 3VIPA 2JF6A 3WMSA 2WZIA 2Z1SA 1Z32X 3K8LA 2CCRA 3ZT6A 1HJSA 1Q6GA 4CU8A 3AHTA 3PZQA 3OIHA 2V3DA 4BF7A 3T0DA 3WH8A 5EB8A 5CSUA 2J7BA 2JEPA 3U57A 1KXVA 1N82A 1VEOA 4DWSB 4PTWA 3ZT5A 1KR1A 2JFEX 3BAIA 3L4XA 3WH9A 1OWQA 1CLXA 1GOWA 2FGLA 3CHFA 1PX4A 4QLKA 4AZIA 2BVYA 5A1AA 1TA3A 3BXWA 1UKQA 1UYQA 4HOZA 3BMWA 5BXTA 3UG5A 3MV01 1WB0A 5KEZA 4MB3A 4XB3A 1J9YA 1VFOA 3CPUA 5A8QA 5CGTA 2W67A 1ZU8A 4IPLA 1PAMA 4PUDA 1OIMA 2OSXA 1UWTA 3EMQA 4AW7A 4UOQA 3WH7A 2A3BA 2FDMA 4N0RA 2Y2WA 2ZXAA 3A4WA 2X1IA 3VGGA 1E6NA 2YDQA 1KGXA 2DDXA 2WK2A 1D7FA 3L4VA 4U2ZA 2GK1B 1V08A 1UD4A 4UFMA 3CZGA 1CXKA 1V0MA 5ABHA 3MUAA 1GZJA 1V02E 2D22A 4JHZA 4C7FA 3TTSA 1JAKA 5EFFA 5A3HA 1JGIA 3I3DA 3WFLA 1BPLB 1R85A 1GORA 3W81A 1UKPA 4Z2KA 1CZ1A 1TZ7A 1JZ6A 4CN1A 3CHDA 3WF2A 5IXEA 2Y24A 5CXPA 4S3KA 1JZ3A 3WQWA 3AIQA 1WE5A 1CGYA 3NSNA 1HL9A 5DF0A 1XYFA 1RH9A 3W27A 1WPCA 3CGTA 1NM9A 2J79A 2W5FA 1QHPA 5GPRA 1JF6A 2JEQA 4TVCA 3DYOA 1GHSA 1GONA 2W66A 3PZGA 3WFZA 4ML4A 2D3LA 1E5NA 4W87A 1V02A 1QI3A 4W89A 2GSJA 3ZJKA 2VT0A 3THDA 3WDIA 3SIMA 4D6FA 4AZBA 3ECQA 2WVTA 5I24A 4ZE5A 2ZUWA 2BY2A 4ACYA 1MYRA 4Q22A 4QP0A 1DTUA 1BYDA 3VMPA 5DT5A 1JD7A 1NWTA 3W25A 4W84A 2WCAA 1HKKA 3VIHA 1MFVA 1CDGA 3W24A 1C93A 3PZNA 3VD5A 3TOPA 4PTMA 2QLYA 1E1EA 3POHA 3VUPA 4JCLA 3PZOA 1GOKA 1G9HA 3BH4A 3OGRA 3AS3A 4U31A 2CBJA 2VVSA 5CPQA 1KXHA 4AD1A 3D5HA 5A2AA 4HZ7A 1W9DM 2X05A 2CHOA 4P8XA 3BLPX 4ZFMA 1I1WA 2D23A 3RDKA 1WDRA 1HJXA 3EDDA 1XSKA 3KL5A 2D2OA 4GKLA 1H0IA 4DUXA 3F5LA 3FHAA 1D2KA 3PTKA 3NSMA 1KGWA 4ZEPA 4PBGA 2HISA 1JZ8A 3RILA 4Q7NA 3SCVA 1G1YA 4H2CA 4V28A 1S46A 3RMEA 3ZR6A 3AICA 4MADA 1LL4A 4P8UA 1OD8A 4DM1A 5GNYA 3BAXA 3OB8A 2Y8KA 1UKSA 2XVPA 1JDDA 5AC4A 1DP0A 4UQ9A 4UOJA 2WNWA 2F61A 4Z2LA 1E3XA 5I23A 3T09A 6TAAA 2X0YA 6A3HA 4CN4A 1OGSA 5D8ZA 1V0NA 4BCEA 3T2OA 4UQEA 1W3LA 2V38A 4J3WA 4P7NA 4XV0A 1UKTA 1BG4A 2J7DA 4Y7EA 1E1FA 2XFRA 2XGIA 1JZ7A 3ARVA 5A69A 1US3A 4M80A 2WHLA 1JI1A 2D0FA 2J7HA 1YHTA 2FHFA 3OLGA 7TAAA 2UY5A 4E4PA 4URIA 2QPUA 1TMQA 3EDJA 4GXPA 2CESA 4JL2A 1RP8A 3TA9A 1WP6A 4FLRA 1CWYA 5I79A 4Z2GA 1C3FA 1HJWA 1CGTA 3GNOA 1UHVA 5FOOA 2XHYA 3LMYA 4E8CA 2GFTA 5DT7A 4RE3A 3GXIA 2A3HA 4AY1A 3CHEA 3GDBA 5BRQA 1ESWA 3QR3A 3BAKA 1DWGM 4F9JA 1V3JA 4AD3A 3K4DA 2VX6A 1J0JA 3RM4A 1U30A 2WW5A 3B8SA 2CBVA 1H41A 3A6OA 4CCDA 3JUGA 4GZEA 2XSAA 3TONA 4A4AA 4C90A 3QGVA 3MMWA 2NT1A 1AQMA 3J7HA 3WQ4A 1MQRA 1K9EA 3KL3A 4F66A 2WMJA 4IISA 4CGTA 2J7FA 1CGXA 2J47A 1E4IA 1B30A 3G6LA 1JD9A 1PJ9A 3VO0A 1IZKA 1CBGA 2PC8A 1E4NA 1WKYA 1US2A 3VOCA 2NW0A 2VCAA 4D6EA 3FAXA 1FH8A 4P7OA 2W61A 5A8NA 4AZHA 4AZ5A 4NZCA 1VAHA 2DH3A 4MAVA 1JF5A 3WF3A 5A95A 4AIUA 4ZENA 5HNNA 2E3ZA 2J4GA 4CCEA 3WF1A 3IK2A 2DT3A 3W0KA 1XC6A 5KZ6A 4H41A 1RP9A 4OOZA 1FHLA 2VTFA 3QHOA 1WZKA 4MNLA 3CUHA 1B3XA 1VJSA 2VR4A 3TTQA 3M07A 5A6SA 4HZ8A 5ABEA 1XH0A 4PSPA 2AOSA 2VUYA 4MB1A 3TTYA 2G3NA 2UY4A 1JYWA 4V2XA 2B31A 4MJ4A 1VFMA 4A3HA 4PMOA 2VL4A 3L4UA 4J3UA 3GBDA 1G94A 3GTNA 3AFBA 3WNNA 1JFXA 4YPJA 1J0HA 2PWEA 1C8QA 4K68A 3S6TA 1C92A 3WF0A 4BQ2A 1H4PA 1NOWA 1TVPA 2DGAA 5EMYA 1GQJA 3IJ8A 1UH4A 1AQ0A 3VM7A 3ZO9A 1CGWA 3II1A 3AXIA 5HOSA 1M53A 2V5DA 3VMOA 1UQYA 2WC4A 2JIEA 1OB0A 3ZSTA 2E0PA 2XGBA 4GI8A 2VZTA 1H2JA 2ZXQA 1SMDA 2HVMA 1E6RA 3O2LA 5CLTA 1EDGA 4W7WA 4AIEA 3N9KA 1LLOA 2EPLX 4JKMA 3CUGA 5IFTA 3WL0A 8CGTA 1IZJA 1EQPA 2EPKX 2DSVA 4R27A 2EO7A 1UR8A 5A6KA 1TFVA 1H3GA 3N12A 4WKAA 2W4XA 3W38A 1B3ZA 1BFNA 5A6BA 1FFRA 1HF6A 1BQCA 2VZOA 4JAWA 3WD3A 5E9AA 2G8ZA 1XH1A 2EPMX 3WUBA 1R86A 3VIGA 5LA0A 3O9NA 3AIWA 1V6YA 3K46A 2NSXA 4KWUA 5E70A 1ECEA 4UQDA 1NP0A 2DQXA 3OZOA 3ARUA 5BYWA 4LXFA 1HJVA 1QBBA 1HX0A 2PBGA 1V3KA 4PMZA 2YDRA 3VDHA 2AMGA 3A4AA 1W1PA 4Z2IA 1E6XM 3AMCA 2ZX6A 5JUVA 4M56A 4AISA 2VR5A 2WSKA 2X2YA 4AD5A 1KQYA 4DM2A 1UH3A 2C0HA 4M29A 2XIBA 4MPKA 3DHPA 1EHAA 2CETA 1ZJBA 3GYCA 1RD6A 2DSUA 4WKFA 1UD5A 5HXMA 2VX5A 1VFUA 1SMAA 3VVGA 4N42A 3NUKA 4EKJA 2DIEA 2YJQA 4UQAA 3VGFA 2QPSA 5DMYA 1FH7A 2GJXA 3KWXA 3CZKA 4MTVA 3BAWA 5A8OA 3UCQA 1EDTA 4U5IA 2YDSA 3WEOA 3DECA 1FH9A 3RIKA 1FOBA 2D0HA 1GOOA 4KMQA 2W92A 4EK7A 1QBAA 1SFSA 2CHNA 3WDRA 3EYPA 3SCRA 1I1XA 3ZM8A 4CD4A 3UERA 1E70M 3DYPA 1AVAA 4U3CA 3KL0A 1EH9A 3W28A 5BWFA 4H7VA 2JIWA 4MNKA 3VIMA 1G0CA 4P7LA 3CUJA 1B0IA 2X0HA 1ODZA 1TUXA 2WM0A 1C8YA 3GNRA 3MSGA 2WXDM 2ZX5A 1ZBWA 3VDCA 2XFFA 4NI3A 2D20A 2XTKA 4UTFA 2ESCA 3ARQA 2O9PA 3F4VA 3WNPA 4D6DA 4HU0A 4FLQA 5A2BA 1LG1A 2Y8VA 2IXVA 5JBFA 2PBOA 3WENA 2VQTA 2WC7A 1GQIA 4PEEA 2VQUA 4LGXA 5M3WA 1NARA 2WVVB 3BSHA 2ZUUA 2VO5A 3CHCA 1VRXA 4UR9A 3SUVA 3AIBA 4GZJA 3W53A 3G6MA 2ZXBA 4YHGA 2YLLA 1XSJA 1NWRA 3ZSSA 2CYGA 1UR1A 4UFHA 3WQ8A 1CGVA 3CUIA 4NRRA 4TX6A 1F4AA 3F5JA 3VGBA 4UZUA 4WIWA 1PIGA 2OLHA 1MXGA 4V27A 3CIVA 9CGTA 3UETA 2OWWA 1XSIA 4P7QA 4FLSA 2DEPA 5IDIA 5JIPA 3CZLA 2Q8XA 4FK9A 1MW1A 2XG9A 3T08A 1NWUA 2XM1A 2A3EA 1WDPA 1QNQA 3WD1A 2ZUSA 3MU7A 2V3FA 4PSRA 4MDOA 3EDEA 5AYBA 1CECA 2O9TA 1CPUA 1JNDA 1M7XA 1NQ6A 2BY0A 2WANA 4H8VA 3DC0A 1LJYA 2W63A 3DYMA 1E4MM 3NDYA 1JG9A 3GXFA 1U33A 1BSIA 2XVLA 5IHRA 1FP9A 5HPCA 4DWSC 1R87A 3K8MA 5M03A 1BGAA 1A3HA 3A4XA 1DHKA 2WB5A 4KRTA 1UOKA 3WSUA 2DPEA 2WHMA 2BHUA 3SCSA 4F79A 2GK1A 3VNZA 3M7SA 1WO2A 2G4FA 4W8AA 4QCEA 1FP8A 1QNPA 1WDQA 3MV11 5I78A 2OYMA 4BA0A 1J12A 5CPSA 4X0NA 4TTGA 2FGZA 4H8HA 3TP4A
chains in the Genus database with same CATH superfamily
2RGMA 3MSDA 4AEOA 1EUAA 2GDQA 2RFGA 3L12A 4IMGA 5B7ZA 1DQWA 2P3EA 4OE7A 1UC5A 1OEPA 5AB3A 4M0XA 1TV5A 5L9FA 1RJPA 2XYLA 3P3BA 5XIAA 2I5QA 1AODA 1EOKA 2WMGA 1XIIA 4ATDA 3NQMA 4A3QA 2GOUA 1VPYA 4D6JA 3B9NA 3I6EA 4M1BA 2BB0A 3TJLA 3CZ8A 3WBAA 2Y70A 3HV8A 3MO4A 2ADAA 2YA1A 3OA3A 2YCLA 4C6IA 2FDSA 1ZB5A 5AC6A 3NYDA 4GOAA 1B3OA 3WNKA 2YYTA 3OG2A 2RGLA 4D6GA 4W86A 4LUSB 2OWCA 1NJJA 3KP0A 4WKHA 3WLTA 3TCEA 1N2VA 3WJXA 2VEGA 4XVEA 1RQBA 4GX9A 1XS2A 1ITQA 2WYSA 4QCFA 3H8AA 3RNDA 3AXXA 5FESA 1QW9A 4J9JA 1OCJA 3C56A 1BYAA 2DORA 2FQIA 4EPBC 3BDKA 1XCWA 3Q4DA 2PWGA 1ISWA 3GFYA 1XCFA 3EOEA 3VDAA 4RLIA 2X1RA 1H7XA 3MANA 3LTSA 2H8ZA 3VZZA 1TIMA 3G1SA 5BOEA 1AFSA 4YTQA 1LZOA 5KINA 4QEHA 1XRVA 3M64A 1BQGA 2DIJA 3C2EA 1A5KC 1EJVC 4AHOA 4PB3A 1UPPA 1R2TA 1G4TA 1UA3A 1DWIM 4LBRA 2Y89A 2DVUA 3PUDA 4TV6A 1TVLA 3I7SA 4A2SA 3QTPA 4NHVA 4NXSA 3MUY1 3GDTA 2VVNA 3TTOA 1RA5A 3ALFA 1LG2A 1R7AA 1RBLA 4JQ4A 5E93A 3TYEA 4WD0A 3SN1A 3QV8A 5JU6A 2A3AA 3RO8A 2QJJA 4BQ4A 3WLQA 1WUEA 1SR0A 3S83A 3FJNA 3IVUA 4J7RA 5HWNA 3LYEA 3DFYA 5CZ0A 2PRLA 3JZEA 1BWLA 5IHSA 2BHZA 1M01A 4JFWA 5CC3A 5HPOA 4ZZ9A 2FMOA 4C6MA 2UY2A 4DQWA 1F76A 3G1FA 4IX0A 4NZFA 5TQLA 1I75A 3WD4A 2BFGA 4UNIA 1RXOB 1KWGA 4U3AA 2E9LA 4UTKA 1A80A 3UY8A 3BW3A 5DXYA 4AXKA 1Q6FA 4DBUA 3ZQ9A 2VFHA 3FJLA 1POKA 3S2JA 2GDUA 2DH2A 2PLMA 2ZA2A 4KPLA 5D9NA 1DWJM 3UPBA 1DV7A 4BKNA 4CQCA 2FTPA 4CNOA 5BCAA 4S3EA 1OVDA 2QJNA 4OOUA 3MI2A 3VZYA 3S5YA 4RV8A 3LTPA 4PRRA 2ACRA 4UMAA 3CTLA 1W3JA 2IXUA 3D6NA 4DJDA 2CLFA 3T7VA 4KCVA 3USZA 1QPQA 2MNRA 1F6PA 1P48A 1FXPA 3CASA 4MKNA 1JJKA 3TC7A 3F7JA 3T42A 4ZMGA 2BTMA 1VB9A 4GX8A 3DG6A 3NDOA 4XIAA 2YOCA 2QAPA 4XWUA 4AZ6A 4QROA 1UROA 1FA2A 3TW7A 4WF7A 4IIBA 4UFJA 3IJIA 1B54A 5GNZA 2ZQ0A 3PNZA 2F7FA 1B3WA 3LCIA 3WBEA 1L6FA 2WZMA 1VRDA 1XD1A 3PJWA 4KETA 1AA1B 3VOHA 3GC5A 1TA3B 1QR7A 4IGHA 1RPKA 2C7FA 5D37A 4A8IA 1IV8A 1BTMA 4QDMA 4UMBA 2TAAA 3QHMA 3SFKA 1QPNA 1XBYA 1UR0A 4A22A 4LPCA 3HA1A 1W9XA 2PDQA 3HO8A 4DJEA 4Q8QA 1A5UA 3IANA 5ABGA 3T78A 2IUZA 3B0PA 3TYCA 4AX7A 1PSCA 3AMKA 1JRBA 1HJQA 4PYSA 4DXVA 4JR5A 3TYDA 4MY9A 1HVXA 3MVIA 3R8HA 3UXKA 4QRNA 3DHFA 1VFLA 3QMTA 6CGTA 5LGXA 4FOKA 1QHZA 2OODA 4JIEA 2ZTKA 4H04A 3UJEA 4F0KA 7A3HA 4AZCA 3HB9A 5A2CA 4OHQA 2XM2A 3C52A 4JN6A 3QXBA 5CCZA 2ALDA 3P61A 2BXZA 2GDVA 1I2PA 2VD9A 4U4MA 1J96A 5KZEA 3ITLA 1B3VA 4M3PA 4RK8A 3VIIA 3QLLA 5HNUA 4X2RA 2XN0A 3SFWA 1ITUA 4M8UA 3BJSA 1GOIA 5HDRA 3DERA 4JX6A 2BXYA 1JZ4A 4NX0A 3Q58A 3WK2A 4QHRA 2YL9A 3MQTA 4XAPA 2WO5A 1EGVA 4L1GA 3ZWTA 2ZXDA 1L8NA 3M0IA 4WGXA 3TYBA 1KM1A 4XZIA 1KLZA 2QJGA 5BU6A 3M5VA 5A94A 3F03K 2QCFA 2Z6JA 3NPXA 5IOBA 4AHQA 1EEPA 2VWTA 4GUGA 3OVPA 4O12A 2FTYA 2ZOXA 4P8VA 4NX5A 1WOBA 4PR4A 3UP8A 3BJFA 3BW4A 3ZJ7A 4JYDA 4TTUA 4E2VA 1UD6A 1DXIA 3OGVA 4Y9PA 3V3WA 1SW7A 3T0TA 3PFRA 4AZ7A 2WQPA 2PFHA 1ZCCA 3KRSA 3GLCA 2OQLA 5BW6A 4KQNA 1R3TA 1GJUA 4W8LA 1GTHA 3W1UA 2VFFA 4UZSA 4AIBA 4PMXA 2WNQA 1ISXA 2J13A 2NT0A 1B5TA 4G1KA 4IL2A 4E4UA 3QC3A 3SW6A 3SGGA 1OADA 2ABAA 1E73M 4S3GA 4PCTA 3NZGA 1RLCL 1A47A 2PDNA 1S5VA 1K9FA 4LW7A 4NYYA 1ITCA 4P8WA 1XYBA 4EF9A 3DFOA 1DJWA 1UWRA 4NUWA 1R38A 2BVTA 4MWAA 4XG1A 2D0GA 3AWNA 5GVJA 4C6FA 3C86A 5JMUA 1RR2A 1Q65A 1EGZA 4IXXA 3AU2A 4IQDA 1HGYA 4FNUA 2YGYA 3CTTA 3MP5A 1PHWA 3WL1A 3OGSA 1QI2A 2WWCA 1VIWA 4DLFA 2FIQA 1X8FA 3PWGA 2IKIA 2FJUB 4D72A 1W31A 2GGJA 3REQA 3KDOA 3PN8A 1Y8BA 1SO6A 2VFIA 4MDPA 4WOZA 4DI9A 5E09A 1S1RA 5D38A 3WQDA 1F5ZA 2ZBTA 4DWSD 4J3SA 4JTCA 3CC1A 1V4YA 4WCJA 4E2BA 1TKKA 4QLLA 1C9WA 2CNCA 1PL9A 4LANA 5JH1A 3QKZA 4XO7A 1P0NA 1NQKA 3WQVA 5C8BB 3STPA 2ZUMA 3WNMA 1Q6OA 1C8XA 2EQDA 1XYZA 3VIOA 4WLCA 1RSCA 4CD8A 3GBEA 1VBGA 1M03A 3DXIA 3WX7A 1OBAA 4JNYA 1ZAIA 2PF0A 1W91A 3A3HA 1EC7A 2QCDA 2XFYA 2V0TA 2ZZ7A 3BGJA 5EPDA 3TROA 4DJDC 3RHGA 3TR9A 2XVGA 1RJQA 2A6LA 4D8LA 2Z28A 1OHLA 3QN3A 1A0CA 1DPMA 1TIWA 2BOFX 2XGZA 4XISA 3KTXA 1OFEA 1KV5A 7CGTA 1A53A 2WPGA 1US0A 3LM7A 1SSDA 2CZVA 2IPGA 4KGJA 4KCUA 1VF8A 3PBWA 3SCQA 3C2YA 4BEUA 3NQGA 1W37A 1J8VA 4M24A 1VBUA 5A8GA 3A64A 1JIBA 2EAWA 3EWZA 5MF5A 3O6YX 3M44A 4D6CA 3CT7A 3N18A 4I7VA 2X7VA 1QPOA 3KAOA 3ZVHB 2C1IA 1TRDA 3L2LA 4IG2B 1FBAA 3E5PA 1W0MA 2WKLA 3TR2A 2OOFA 5I07A 3LPFA 1EJXC 1N7KA 4ZOCA 3C0SA 3GVRA 3ALGA 3OHIA 1KM0A 3H2FA 4Y9OA 1D8WA 4KRUA 1PCKA 3UJRA 3ZVIA 4J3TA 3LNPA 2KX9A 5AC5A 1UUMA 3VNLA 1C8VA 2ZTJA 3QQ1A 4B2DD 1TYGA 3WLKX 4DF1A 3L4ZA 3W3OA 3WIJA 4HHMA 3CQKA 5CH9A 1DXEA 5BRBA 3R89A 4C91A 3U48A 1FRBA 4EE9A 3EMZA 1PTDA 3BOFA 1H0GA 3VNJA 3EB4A 3ABZA 1HP4A 5HUPA 3W26A 3AMLA 2QUMA 3CV1A 3TMQA 3R4IA 3FAWA 2XPKA 4GVIA 5HANA 2CKRA 2Z2BA 3FYPA 4IM4A 4RPPA 1VEPA 1A5AA 3RLVA 4RW3A 1R9YA 3LPGA 2VI0A 4D6HA 3WG6A 4UBPC 3UPWA 5D32A 3NQAA 4WDWA 3SUSA 1FWRA 2CERA 3BC9A 4OZOA 4EX4A 1D8CA 4DO6A 2VHLA 5DQPA 3B8UA 1TRIA 1J10A 4KIRA 3B9EA 3F4NA 2FZNA 1NIUA 2X16A 3O15A 2ZX8A 2CITA 3WBXA 2OXNA 3FEMA 2E5BA 1LDCA 5K9DA 3T07A 2CZEA 3LCGA 2AAAA 1T7LA 4S3AA 8RUCA 1UWQA 5ECUA 2GGHA 4QQ3A 1Z42A 4GNJA 3IJQA 1GG1A 3FKKA 2E28A 3UJSA 1CW2A 1J0YA 5TBOA 1XFCA 2D2JA 4M81A 4O1EA 3TOYA 3WF4A 1KFWA 1JPHA 2RDWA 4GO9A 4H7ZA 2NSOA 5IRPA 2NQJA 1SSGA 1OZQA 2C19A 1IE7C 4HKPA 1ODUA 3RMJA 2JALA 3P80A 1GVEA 1SJCA 2OYKA 4EWJA 4GPNA 3N73A 4GMEA 4LCQA 2YL8A 4ATLA 2ZWYA 5F2LA 1ZBKA 3GW0A 1G7UA 3TJXA 3EDFA 3NZRA 4NF7A 4M1RA 3T2QA 1O94A 3HTWA 4WK9A 5FJUA 3XINA 1QUMA 4HMDA 1XCXA 4A29A 3T0AA 1DWFM 3B3DA 4LT9A 4CVUA 1HXJA 5CJ5A 3VKKA 2R1MA 1FHDA 4LYQA 1FDYA 3VD7A 1TQXA 4Q6JA 3RRAA 4U2YA 1Q3NA 4O54A 5BXRA 4UOZA 4GYPA 1L0PA 1MRQA 4PA8A 4BK9A 3WMBA 4B9YA 2EKGA 4M19A 5LXEA 3U3HA 3P93A 4YCPA 5C9RA 2FB2A 1R0MA 4D1JA 4GE8A 3HN3A 1JXJA 1M7OA 3BV4A 4X0VA 1OABA 1K02A 1XIHA 5LYRA 1SM9A 3W6YA 3VGDA 3B9AA 2W6RA 2ZRZA 3COTA 4ZB5A 3GTFA 2QV4A 1J79A 2FPTA 1ZRQA 1DIDA 3BSMA 3MS8A 2Y6ZA 1OG0A 1TB3A 4C6NA 5JXQA 1RQHA 3URQA 3PWIA 3WYZA 3CO4A 4S23A 4OV4A 1GVQA 1I45A 1GEHA 1QWGA 3EGJA 1IHIA 2DVTA 5EA9A 3I6TA 4Q8UA 4DNHA 4QG8A 1VFHA 2RDXA 1S38A 3W83A 1A3XA 2O55A 3W7JA 3OZPA 3WQFA 5BRPA 2ATSA 3HG5A 2WNZA 4XD6A 2PZNA 2OSYA 1BSLA 4PRWA 3LCFA 4LU0A 2GQAA 4LEFA 3TX9A 4GJIA 4GQ0A 2HBVA 2ZX7A 1O5QA 2QF8A 1KFBA 3THQA 4CUCA 4DUVA 5A6AA 5DCBA 4Y9MA 3WJSA 3WUFA 2ZZ4A 4ALDA 2ISDA 1X6NA 2NQHA 4YMZA 3RM8A 4FF7A 1WAUA 2ALRA 3ZT6A 3H2CA 2Y7FA 2V3DA 4BF7A 3WH8A 2J7BA 4O57A 3H7VA 3UJ2A 1IQ8A 3A22A 1EWDA 3RLGA 3H53A 2JFEX 3GU1A 1CLXA 4K1GA 4XZ9A 3S42A 5FEZA 1T8QA 2FGLA 1LYXA 2BVYA 3ATZA 1TA3A 3CQJA 3BXWA 1XR2A 4C5ZA 3MP3A 3MV01 4QJ5B 1PKLA 3BLEA 2XFWA 4IPLA 1OIMA 2OSXA 2A3BA 3N3MA 1IIGA 2VWSA 4G1NA 5G1YA 3NM3A 4US6A 4HT3A 2YDQA 1KGXA 2WK2A 4IPJA 1PKMA 2GK1B 3QMSA 3VCCA 2Y8UA 2OLSA 4C6OA 1H51A 1I2NA 3DCPA 5ABHA 2OZ8A 1GZJA 3FYYA 3OOQA 4N9CA 1JAKA 4JTKA 4PCPA 2HXUA 3I3DA 1I2QA 2JQXA 3OYXA 1KKOA 1GORA 1SO4A 4Z2KA 3CHDA 3O16A 3UXIA 5CXPA 1V7AA 3EPOA 4LYKA 3WQWA 4E3VA 2OB3A 2VKZG 1F9CA 4JIPA 3HPFA 2ZE3A 2PTDA 3NSNA 3MPGA 1HGWA 4F0MA 1XYFA 3W27A 3CGTA 3N2TA 3HIJA 4JS3A 1NM9A 3LU2A 4HNCA 4GLEA 4GBUA 3QFEA 4AH7A 3DYOA 3PZGA 4HCHA 3MKVA 1AZ2A 1QI3A 4W89A 4RNFA 2GSJA 3GW3A 4H9MA 2VT0A 3UPMA 1XW8A 3APTA 2E25A 4AZBA 2HNEA 2ZUWA 2BY2A 4OECA 4IJCA 4QE4A 1DTUA 3QTGA 2PF8A 3VMPA 5DT5A 4W84A 1R3VA 1QOQA 5RUBA 1HKKA 1MFVA 1KRMA 2P1FA 1FWAC 1GVFA 1EPXA 4KERA 1C93A 4PTMA 3ABSA 2ZYFA 1LCOA 1FUYA 4QM1A 3W22A 3WLOA 1W8GA 3PZOA 1HO4A 4PULA 4L65A 3BW2A 5AYZA 1KXHA 4AMAA 2I9UA 5A2AA 5CBBA 2OCZA 4REQA 3IVSA 4DPQA 1KRAC 3EWDA 1TJ0A 4GXWA 4EXAA 3K30A 2YB4A 5I06A 4GHRA 7ODCA 2D23A 1BRLB 2X0SA 1WDRA 1JVNA 5KZMA 3KL5A 2D2OA 4GKLA 1KM6A 1H0IA 1F3WA 3S5SA 3ABQA 4MJMA 3IPWA 1RHCA 1KGWA 4ZEPA 4PBGA 4Z1AA 1OFAA 2HTMA 1G1YA 5I03A 4GNKB 3RMEA 2GQ3A 3W7LA 2VGFA 5AHLA 4DM1A 5GNYA 3NEVA 4Y6GA 1JDDA 3G0UA 1TE6A 3G24A 1UJQA 2I1OA 3QW4B 4MFEA 1RVGA 3T09A 6TAAA 5CAHA 2W3ZA 2G5WA 1O60A 5F2MA 4J3WA 2A7PA 1EP1A 2QT3A 3E0VA 4KF1A 4DZHA 3RX4A 3L21A 1US3A 1XLLA 2WHLA 3V16A 2R9RA 3G3MA 3KBJA 3OYZA 3VCRA 2FHFA 4FR6A 5EIYB 3T55A 2JKAA 2QPUA 1RP8A 1WP6A 5I79A 4FLRA 2VDGA 1BVWA 1UWAA 3NR0A 4OUIA 4TIMA 1NTHA 1A49A 3TIMA 2XHYA 4ZR8A 1O95A 3TJIA 3SSJA 3UZ5A 2GFTA 3R94A 3GXIA 4AY1A 4ZQMA 4IGSA 5BRQA 4MYAA 4JQ1A 2PDGA 3S2LA 1V3JA 4HN4A 1IR2A 1IXPA 5LZLA 2HS8A 5F2GA 2WW5A 2CBVA 3A6OA 5AHIA 3JUGA 2XZ9A 4I9AA 3OU8A 4PUKA 1EZ2A 4NL1A 5C7VA 1LBLA 2A0NA 3IEBA 3TYAA 2PPGA 4H4IA 3KP1A 4IISA 4CGTA 4O1FA 2O4QA 3INPA 2FMNA 2VGIA 1RK6A 1BKSA 3VO0A 3V5FA 3HG3A 1IZKA 1FVPA 1S5WA 1US2A 4OVXA 3PUEA 3VOCA 1PZ0A 5HMDA 4DBSA 1MDLA 2PA6A 2VCAA 3GHSA 2EF9A 4XAZA 3FAXA 2Y5SA 4P7OA 4XQ6A 2PDIA 4NZCA 1VAHA 1P5BA 9XIAA 3M6YA 4B5TA 3WF3A 4ZENA 1A5LC 1TSIA 4O13A 4CCEA 3WF1A 3T44A 3UT0A 4REQB 4DELA 5KZ6A 4J4KA 4HCLA 4WJ8A 3UWQA 1ZZMA 1FHLA 2VTFA 2V2CA 4Q7IA 3LNMA 3CUHA 2DUXA 3DUGA 2Q09A 4Z0JA 2VR4A 6TIMA 3M07A 1MNSA 2YCLB 4L5ZA 3GNDA 5ABEA 3WO8A 3LG3A 3S1WA 4MB1A 3TTYA 3W75A 2B31A 3TSMA 1BEUA 2BDQA 3HQOA 4PMOA 1WQ5A 3B4UA 3AFBA 4K68A 3WF0A 4BQ2A 1P1MA 1NOWA 3QY8A 4QITA 3G1DA 1GQJA 3DG3A 1OC6A 1UH4A 4IQLA 2GVLA 1P6BA 3ZO9A 3LSCA 5DY3A 3W70A 3TW9A 1UQYA 3ES8A 4NZ5A 4IFKA 4ZQRA 4GY1A 2VDHA 3S9IA 4AIEA 1LLOA 2XIJA 4JKMA 3W84A 1JPDX 2P8CA 3CUGA 1NSJA 5IFTA 1E9IA 5LNWA 4S38A 5D33A 1TFVA 2OPJA 4JEQA 2V82A 4L9XA 4ZOBA 2W4XA 2PSNA 3E74A 3W72A 3SADA 5FEXA 5A6BA 3WD3A 4O1DA 2J27A 3FFSA 3C8FA 1PWMA 2BZNA 4ZB0A 3B8IA 1JPMA 4JYFA 3UF9A 1V6YA 3K46A 4KWUA 1H7RA 4B4FA 2DQXA 5BYWA 2A1YA 1PDYA 3IJLA 4PUNA 3W1TA 3Q94A 2PBGA 3DOPA 3KBSA 5CG7A 1ZFJA 3E12A 4H9XA 3A4AA 4Z2IA 1E6XM 1PDZA 2ZX6A 4AISA 1Z69A 1ZSXA 4RDYA 4QNEA 2AKZA 4Q8MA 4M29A 3DHPA 1DE5A 1EHAA 1XUZA 2DP3A 1A5OC 1TQJA 2IPFA 2QULA 2VX5A 1VFUA 5HNRA 3VVGA 3A21A 1S2CA 4I9MA 2DIEA 2E09A 3DEQA 4XAYA 2DZTA 4CEXC 1IGWA 1LM1A 1FWFC 1VP5A 2DU2A 2XSXA 4U5IA 1P43A 4LAZA 3U2ZA 1TV2A 2D0HA 1DKWA 1TWSA 4EK7A 1QBAA 1SFSA 2CHNA 1EXBA 4MY1A 4U3CA 2Z1VA 3STGA 3DIPA 5CJNA 4DZ5A 2JIWA 1IR1A 4LAOA 1EGMA 3AXKA 2X0HA 3H70A 1X1OA 3NQCA 4HQVA 4US5A 3KHJA 4NI3A 2D20A 4JTTA 4QISA 3SO7A 4IH3A 5A5WA 2ESCA 3F4VA 1O1HA 3G1AA 4FLQA 2Y8VA 2IXVA 3BQ5A 3NPUA 2WC7A 2XN1A 6REQA 4LGXA 5M3WA 1SJDA 3OBEA 1XJBA 2PU0A 2VO5A 4UR9A 3AIBA 4GZJA 3G6MA 2Z24A 1H7NA 4YHGA 4GIRA 3W1XA 1XSJA 4N7QA 2ZZ6A 3FGCB 2XZ7A 1UR1A 3M0VA 3CUIA 4MM1A 1F4AA 3F5JA 3B03A 4TV5A 1MXGA 4V27A 1I4NA 1VS1A 4JTJA 2BSLA 2F6UA 2OWWA 5JIPA 2GQ8A 2J66A 4FK9A 2Q6ZA 3L68A 1NWUA 3USBA 2XM1A 5E9XA 1GWJA 3WD1A 5CAKA 3G5EA 1HW6A 4MDOA 3FV9A 3HFYA 3RU6A 2GVJA 1SQ7A 1CECA 1M7XA 1NQ6A 1RV8A 3WLIA 2A2IA 2AKMA 2PGWA 4FX7A 3KVLA 3MJYA 5FSDC 1DORA 1Z8AA 1PE1A 2W63A 2V67A 4YVXA 4RKAA 4P2VA 4DLMA 3P5ZA 1EEXA 3UD6A 3BOXA 1R87A 5AC8A 1KBJA 3W73A 4OQVA 3EX4A 1EJTC 3SCSA 2Q3RA 3U4FA 3V75A 4WUIA 3KOZA 2G4FA 1ML1A 2HS6A 3Q2DA 3VABA 3BPWA 4YVVA 1BD0A 1QNPA 4GWEA 3THAA 4DEFA 5FJOA 3TQVA 4H8HA 3TP4A 1W3TA 1R2RA 4WEVX 1VBRA 1C29A 2PRHA 3LRLA 3WJYA 5FIPA 3NL3A 4JCMA 2YLAA 1A3WA 5I77A 3UWZA 4S3BA 2J24A 4S2CA 4B5UA 3L4WA 5E6ZA 5E6YA 2ZZ3A 1B9BA 1K7XA 2PE4A 1ZQ5A 2FYMA 1XLCA 2B4GA 3AS2A 3FA5A 1C7SA 6PTDA 1V77A 1GQKA 3LHVA 3KCOA 1UMLA 1X98A 2PODA 4DY1A 5FEWA 4A8NA 3KVKA 5C54A 2GWNA 3C4UA 4CVWA 1F07A 1LBFA 1OQFA 4KEVA 2VGBA 2AMXA 1C90A 3HQ1A 3S1XA 3U5YA 4M5PA 1XHGA 3AS1A 5J8LA 1JXKA 4AD2A 1TE1A 2KAUC 4LQ1A 3FW6A 2TODA 3AYRA 4ONVA 3PZMA 2GVYA 2GZXA 2J7CA 2FFIA 4BY3A 4G56A 4DUWA 2WMIA 3CWOX 4LH8A 4C6EA 1CXLA 1YTKA 3EBVA 3LHUA 4FXFA 4UTIA 5ABFB 4UQCA 3O6DA 4IJRA 2X30A 1KFJA 4DYEA 2WJDA 2GQ9A 2BY3A 4JTGA 3UWEA 4KIEA 1JYVA 4FO4A 4FNQA 3PTQA 2OG9A 3KRUA 3CPRA 1XLIA 3HOJA 1KA9F 3WBWA 4QLJA 2WKGA 3W9ZA 5HMSA 5D8WA 1BLIA 2RKXA 1BHGA 4X3ZA 2CFFA 1J0KA 4EXQA 3N04A 2CXGA 2VRJA 2D3NA 3NQ7A 3ZFHA 3K8KA 5LGZA 3K4AA 1Q4NX 2OEMA 4ZO9A 2PU1A 3LM3A 6ALDA 5JBEA 4TUFA 1F3EA 4JHMA 4L4LA 3FGCA 3URBA 1TV8A 4HZMA 4LY4A 1RCXB 1FXQA 2C6QA 1S39A 3C2FA 1SO3A 2EBNA 3RCYA 4W7UA 4PL1A 3ZR5A 1EX1A 1OK4A 1G7VA 3W76A 2Z0IA 2ZDRA 1V6WA 1TPEA 1IF2A 3HURA 2ZE0A 1QI5A 5E5CA 4XAFA 3ZVHA 4ICNA 4AWTA 2F8QA 2AAMA 1GW9A 1TPVA 4AYSA 4MZ8A 4Y96A 1CT5A 4G5DA 3WY1A 2GSEA 2XU2A 5H8UA 3AQUA 3GHRA 4OT7A 5E0CA 5HQMA 4LNYA 2WPBA 2WJZA 1PTAA 2HBXA 3DHUA 1M04A 3KEHA 4V33A 2EJAA 1H5VA 1WKEA 1ISYA 1GVOA 1UR9A 2WVSA 5CPMA 5G4HC 1UMYA 9XIMA 5A6BD 3EWUA 1M3UA 4HPJA 3CAQA 1FCQA 3MY9A 5CEWA 1OF8A 3S5OA 3FXYA 3SCPA 4F8XA 3BO9A 4JD4A 3UA3A 5HINA 4F0RA 1NOUA 4XAGA 3MVTA 3ZR4A 1MI3A 3W07A 4LUYA 2WSPA 4HTYA 2J78A 1JDEA 4WDTA 4WVXA 1XLBA 4MB4A 2DZBA 4EAMA 1KD0A 1XIMA 1KCLA 5DFAA 4C60A 1P0EA 2Q8ZA 5EJZB 4MWAD 5FA5A 2A7NA 3SCNA 4GO8A 2E8ZA 4CNSA 1SR9A 2J7GA 4JQ2A 3W7HA 5AYIA 1IT8A 3EXTA 2CW6A 4YVPA 2CC0A 1V0LA 2QUUA 1MRAA 2YL6A 3IUHA 3SSZA 4QEEA 4BWLA 4AD4A 3EZ4A 3U2CA 4GUFA 1FCUA 3FDKA 1SJBA 1IEXA 4PMRA 2OX1A 2A21A 1KQZA 1AL8A 3HJZA 4O18A 2WWDA 4NJHA 3LZ3A 3T0BA 3QYSA 3EXSA 4E8DA 5IFPA 4NJJA 1E3ZA 1QOXA 4H9YA 4RNJA 1K70A 5CZSA 2Z1KA 3CS2A 2JKPA 4HA0A 4NYUA 2V5JA 3R8GA 4LWWA 5BNKA 4HNOA 3MUCA 1XBZA 1B3YA 1H1NA 1DXFA 1PBGA 5CC6A 4OKDA 4S39A 1X1NA 2CEQA 3A12A 5XIMA 1Z48A 4LSBA 5H6HA 3RF9A 5CQ1A 4NXKA 1EDQA 2F2KA 3SEPA 2R1LA 2WMIB 1OFOA 1U2YA 2NV2A 1WX0A 4QG9A 4JXCA 4DBEA 5D2TA 5ABFA 1CGUA 3NTYA 4JIHA 1Q2SA 2WMHA 1VKFA 5C0QA 5HWJA 2IPJA 1E55A 4CNNA 3I3EA 3EEZA 4P00B 4JHOA 2DZAA 3R7MA 1Q6EA 2YZRA 5F4WA 3TWBA 3MC5A 3I4EA 4WSJA 5C70A 4C1KA 3UY7A 4LRSA 3W1AA 3G8EA 2AQOA 5CGMA 4G6CA 4C6QA 4KESA 5JH2A 4Q8VA 1PEZA 5M17A 3PZTA 1RD5A 1MWOA 4MSSA 2DSWA 4IMFA 1PZ1A 4UC5A 2VJXA 1HL2A 5EU9A 3N2XA 3V1PA 2BWGA 4ENLA 4QS5A 4DX3A 4DI8A 4GFSA 3SCWA 4X9SA 1M9HA 1AQHA 2FZ9A 1PYFA 4MY8A 3ZIZA 4KGLA 5FJRA 5T91A 4Q7BA 4IXHA 3BLKA 3VOJA 1WA3A 2JGQA 3KE0A 2XDFA 2OZ0A 1UP0A 2F6KA 3F5KA 5KSWA 3VDGA 3FYOA 4NIRA 3OVRA 2J7EA 4GA8A 3QLDA 4HMEA 1YQ2A 2BMBA 3ITTA 3AYSA 2C16A 2B7PA 4CU6A 3AI0A 3IVTA 1VJIA 1Q7QA 2HJPA 2Z1WA 3SN4A 1B9ZA 1X7FA 3U5UA 4IUGA 4NAEB 3DFTA 2ZA3A 5BOFA 3GIPA 1AH4A 4DPPA 3IWPA 3VIFA 3W2MA 4BQ5A 4I5UA 1XLHA 3B8DA 4GQRA 2PDMA 2XN2A 1HQTA 5EKYA 1HKVA 1VGAA 4GG9A 1FWCC 4LUTA 1HL8A 1XYCA 3ZMRA 5TF0A 4A3YA 2E1DA 1E71M 2GJPA 3GZAA 3IV3A 1L6YA 3JVAA 3ZWSA 2R1PA 4H8NA 3ZT7A 1ZNNA 4FS9A 4IQJA 4AZGA 3CMGA 4B2DA 1TPH1 1AJZA 1K9DA 2QCLA 3W7EA 4B9ZA 3NQBA 1JL8A 3GG1A 3R11A 3W23A 3SRDA 3GXDA 3WQEA 1VC4A 3FA4A 2H9AB 4GIYA 1QRQA 1WZLA 4DBDA 5HR7A 1Q4WA 3W85A 3IAQA 3S6DA 4Q3MA 2G96A 4FHAA 1Q8AA 1GG0A 3EAUA 1JDAA 3ARWA 3L4YA 4A8RA 4Y8FA 3WQ5A 2OKTA 3N17A 3GXTA 1SO5A 3VILA 1UBPC 4DWSA 1X1ZA 3GG7A 3EWBX 3TVAA 3THCA 5LKYA 4DHGA 2YCKX 3MCOA 3GR8A 3SCOA 2FPVA 1TPWA 3ANYA 3LXBA 1CXFA 3AJ7A 3MI3A 4W4QA 3NVTA 1KXQA 1W2PA 3E02A 1MVYA 4S3DA 3FJ4A 4OIFA 2QZRA 3WUGA 2FZDA 4QFUA 4XZMX 3JU2A 1L6GA 2J6VA 1GKRA 5K2ZA 1GPFA 1JYNA 1GEQA 4ROQA 4YYCA 1EJWC 3QR0A 1KNWA 1FX6A 4HSNA 4M6QA 2QYGA 4FB7A 2QR6A 3CWHA 1KM2A 3U0HA 1D7KA 3ZLHA 1LORA 3NURA 4UFKA 4AC1X 2P0IA 2NXHA 1LQ0A 3GNPA 5ENLA 4DAIA 2J25A 3L2IA 1UOZA 4U28A 1AK5A 4INFA 5FJTA 4DJFC 2F2HA 3UCCA 3CAKA 2DSZA 2QW5A 3W1QA 1GNXA 3W1MA 4PL2A 4BI6A 2OGJA 2QHAA 3BZGA 3QFWA 4EANA 5GNXA 3LGGA 3H54A 1LT7A 1VENA 3W6LA 1T5AA 2EPNA 1TMHA 4C6LA 1XI3A 4GJ1A 4Z2JA 3QOMA 4R53A 4Q8TA 2E5DA 3GTXA 3JZUA 2H8XA 5GQBA 1B90A 4JEJA 4CCCA 3WK3A 2PMQA 4MNJA 5I3HA 4P5UA 3N2MA 2VR2A 1W1IE 1E9LA 4ZO6A 4WSHA 3W01A 3N2BA 3MUZ1 2X2GA 3NIYA 4F2UA 3GXPA 4KWOA 1LWHA 1NDVA 4LBUA 5G4WA 2RH9A 4HYRA 1EHNA 3V0TA 2V5LA 4H3DA 1I9CB 3N2OA 8XIAA 1DOSA 5H91A 3AHYA 2PAJA 1OINA 3BCFA 4H6QA 1QNSA 1UWSA 3KOFA 5I6SA 4LS1A 2PTZA 3A3XA 5CGQA 1XISA 2CZDA 1JI2A 4JFUA 5GJMA 4QX4A 1RLDA 1ZHAA 3MCMA 1HNYA 4ICMA 2YR1A 1PVNA 1XD0A 1JPIA 1WBJA 2FHCA 4E5TA 3WDJA 1UB3A 1EQCA 8A3HA 3WNOA 2XSBA 2QEZA 2ZA1A 3CV6A 2V63A 1VYPX 2XIOA 1LLWA 3FX4A 2XIQA 1W1VA 1F6YA 2INFA 1EUNA 3ARYA 3PZ9A 1DIEA 4R5EA 3KFTA 3PAOA 3S0CA 4R7OA 3LD5A 1OC7A 2R1KA 3PJUA 3NO3A 3EWXA 1W9VA 1GJWA 1NDYA 2EXOA 2ZICA 1YLVA 4HN8A 1VYSX 4S3FA 4H6RA 2QJMA 4KCTA 1QW8A 3CLWA 3WZ0E 4AUBA 1UR3M 4A21A 3P6LA 1GOMA 2Q3OA 3IJ9A 4FA3A 3R10A 1R9ZA 5CPTA 3ANVA 1Q6CA 3L0KA 4Q8NA 4QTGA 3WELA 4CKQA 1V3LA 2VFEA 4XTDA 3IK4A 4GI9A 3VKAA 3O6CA 4LAKA 3A9IA 3PTMA 3BGGA 3TKFA 2PI6A 3OLEA 2VEKA 4J3XA 3VGHA 4IGMA 1EJUC 4GY0A 5REQB 2OMAA 3NPWA 2XUCA 1AG1O 3AZSA 2XJ7A 1O7AA 2WC3A 4XD5A 4Q32A 3MW7A 2BX7A 4O50A 3F1QA 4PFMA 1FWBC 1S1PA 3HJEA 3PHAA 2VRQA 3S47A 4V1YA 3R25A 1HKJA 3PC0A 4AF0A 1YW1A 1KFKA 4X61A 3AHZA 3HPZA 1PPIA 2GGEA 1UD3A 2A7RA 3PZVA 4XBKA 3TE9A 3E5BA 2CZFA 2H3DA 1V6UA 4QDPA 4A3UA 1X39A 1NAL1 5I5RA 3TN4A 1VYRA 3STCA 2J74A 4Z1CA 5A6LA 4AVFA 1V8EA 3BV7A 4S1FA 2EPHA 5TD4A 5HJYA 1HP5A 1XLMA 3TNBA 3TK7A 3ZZ1A 3KHDA 1U5VA 1R3RA 4HNLA 1QI0A 4U5KA 3UZXA 4O0QA 2Q01A 4XKMA 2HE8A 3R58A 5DXXA 2GL5A 3CUFA 3GS6A 3SY8A 3P5YA 1JYXA 3M46A 2QUNA 5E1QA 4H00A 1ICQA 2C18A 3AMDA 3W37A 2VURA 2I17A 3RO6A 4ML9A 1ZGDA 1YTEA 2I56A 3GDLA 2G37A 3GAKA 2J88A 5BMWA 1TV3A 4WY0F 4ZE4A 4MF4A 1UZ1A 3CU2A 1EIBA 3M43A 2BXVA 3PUOA 3AIRA 1OG6A 2YBVA 4DZAA 1AZ1A 5FJPA 3QM3A 3AJXA 3L0GA 4PMDA 4YLWA 4GVGA 2FVMA 3MHFA 5B80A 3W7MA 2BNJA 1GOQA 3S3GA 1EO5A 3V1HA 3SJ3A 2PDXA 1OGBA 3NNTA 2GJXB 4A6GA 1KBKA 4LS2A 3OIXA 3STEA 5I3GA 1GHRA 3QY6A 1I0DA 1EJSC 3L67A 3V4BA 3IJ6A 2J75A 1OX4A 3VCNA 4XZBA 2VC7A 5AY7A 2J9ZA 4ZXOA 4U33A 1AD1A 1O4UA 1TPC1 4CQDA 5EYWA 1K8XA 4C1LA 2O92A 5C9XA 2WHKA 2VZUA 3M7WA 4EF8A 2JGYA 4OV9A 4W8BA 4DN1A 2ZX9A 4HNNA 1EA0A 3WMCA 1MW3A 5FCZA 4DYKA 1E6QM 1WZMA 1YXDA 3S1GA 1QO5A 3WLPA 1A0EA 4QS6A 3TC6A 3GH4A 4GH1A 1ENUA 1CB7B 1HN1A 4NP7A 1O66A 3GD6A 1OD0A 1O6IA 1XKYA 1UZ4A 3W4RA 1ME7A 1Q7MA 1UBSA 3MBFA 3L23A 2E9BA 5BWAA 4IZGA 1L2UA 3BCJA 2XIMA 2HVOA 1KKRA 4D6IA 1DE6A 3AHVA 4JICA 4JTHA 3CXOA 1RZMA 1KCXA 1G67A 3IRDA 1QCWA 1AMKA 3WMSA 1U1HA 5LIWX 2YFNA 4Q4OA 1Z32X 1B4KA 1HJSA 4CU8A 3URAA 5DY2A 1XIGA 1E9ZB 1EP3A 2WJFA 5CSUA 2JEPA 3U57A 1EJRC 1AW5A 4ZOEA 4PTWA 1MSSA 1D3GA 1JEZA 4PBFA 4I7WA 1LOLA 4MVAA 3PG9A 4YS1A 3HGRA 4AZIA 4QLKA 1ZLPA 2TRSA 3CYJA 1MMFA 3DFQA 3H2NA 3BMWA 5HUOA 5BXTA 3V0SA 4ZODA 2PTYA 3P0WA 3SM0A 4MB3A 1J9YA 1VFOA 3CPUA 3IRSA 1LQ2A 4H9UA 3QY7A 5A8QA 1ZU8A 4PUDA 4UOQA 4MKVA 1TCDA 3NQDA 4N0RA 3KTCA 4UR8A 4J1OA 3M0LA 2X1IA 1E6NA 4RDWA 3ITCA 2DDXA 4IFKB 2P88A 3L4VA 4U2ZA 4NNBA 2VFGA 1AL7A 4EP8C 2VP8A 4NJKA 4KFPA 3CZGA 1KM5A 3CAVA 4XVDA 3GKFA 3IIOA 2Y7DA 3MUAA 3NZQA 5DX7A 3N29A 4DRSA 4JHZA 3SBFA 5AHNA 4BFAA 4XUGA 1PKNA 4I6KA 5A3HA 4Q8PA 5K9CA 4GVFA 1UKPA 3TQPA 3VUSA 4RPQA 4WDXA 1W56A 4O53A 2VEPA 3GZ3A 3WF2A 3VNDA 2R91A 2Y24A 3CM4A 4S3KA 2CXEA 3CIWA 1DIOA 4GJJA 4LNCA 3DAQA 5DF0A 3LRMA 1XM3A 5AHMA 2IQ0A 4IWWA 4PH6A 1RCOB 4LY8A 1OFRA 5GPRA 2YDAA 2X1UA 3TW6A 5LIUX 3HFTA 1GONA 2INEA 3WFZA 2D3LA 4NNCA 1R46A 4QG6A 2UBPC 1WKDA 1XP3A 5EMUA 1CX9A 4AB4A 3WDIA 3GVVA 3NM1A 4D6FA 3M0HA 1W3IA 2UV8G 3ECQA 2WVTA 1PKYA 2OQYA 4LF1A 1K03A 4ZQNA 4QDWA 3TN6A 3CWNA 1JCNA 1FY6A 1T0OA 1M41A 3W25A 3MA8A 2WCAA 1DHPA 3VIHA 4UTUA 3BG3A 1E1CB 4NG3A 3PZNA 2EHHA 3TOPA 3VE7A 3H4GA 2QLYA 1E1EA 3KW3A 1Y5WA 4JCLA 3BH4A 4ORMA 3TTEA 3KCJA 5C6MA 4U31A 5CPQA 1WV2A 4MHBA 3GUWA 1GPWA 3SIZA 4OU1A 1D9EA 3H4WA 2CHOA 5J04A 2HE5A 3S5ZA 3RDKA 2YCIX 1MZHA 4ICCX 3OJGA 1UP2A 3FK4A 4DUXA 2VD8A 3F5LA 3FHAA 4GY7A 3PTKA 2HISA 3R0DA 5EGRA 1RJRA 4H2CA 2HCVA 3ZR6A 1LL4A 3FIGA 3GHUA 4QE1A 1OD8A 1BXCA 3G8RA 3ERPA 3OB8A 1UKSA 1O1ZA 2E1WA 3WQPA 1DP0A 5HQEA 2C3ZA 2F61A 4PUJA 3MO7A 5KZDA 5I23A 2X0YA 6A3HA 5D8ZA 1H1YA 1V0NA 4BCEA 2RDTA 2I57A 3BLDA 1W3LA 2X1SA 4DNMA 3VFLA 1EYWA 2V5KA 2OEJA 4C6PA 5K3VA 2J7DA 1BG4A 3OZMA 4IICA 1JI1A 2D0FA 4YTTA 4QR6A 4F40A 2JKEA 7TAAA 5D2XA 4E4PA 3E96A 3EDJA 4JL2A 4WDUA 1CWYA 3BLFA 4LC6A 3N4EA 1CGTA 2P53A 4RXGA 2XH7A 5DT7A 1M1BA 4RXFA 2A3HA 5AHFA 2IPWA 5LSMA 3GDBA 3QR3A 3BAKA 4LOCA 4F9JA 3PBMA 2VX6A 2BOEX 1J0JA 3FKRA 3EB3A 3B8SA 3BG5A 1H61A 4GZEA 2XSAA 1U83A 3TFCA 3TONA 2NT1A 4E8GA 3ICJA 3LGDA 1K9EA 2Z2AA 4N9DA 2WMJA 4F0HA 1PS9A 4FXRA 4JTDA 5EBUA 1JCMP 1CGXA 5DCEA 3VNMA 4KEMA 3BICA 2E6YA 4IFOA 2J47A 1HTIA 3G6LA 3QQWA 5U4NA 3BMXA 1XBXA 3UYCA 4IL0A 3O63A 2PC8A 7PTDA 3F4CA 1XIEA 2QVHA 5CBIA 4CQ9A 3N6JA 1NF7A 3W7RA 4GRSA 3QV9A 5CSRA 3HQNA 2EG7A 3N4AA 1MZRA 2W61A 5A8NA 4AZHA 5AKQA 2ONEA 5A95A 3WBYA 2O0TA 3B4YA 1OFBA 5HNNA 2J4GA 4I9JA 3IK2A 1PYMA 1UUOA 2DT3A 4JN7A 5D02A 1Z89A 4GC4A 4LUTB 1GGOA 3QHOA 1WZKA 1Q6LA 4MNLA 1RVKA 4S3CA 3MHUA 2ACQA 3N19B 1VJSA 1H63A 3QBUA 2RJGA 2Q02A 1KBIA 4BI7A 4BF5A 3N25A 4K2SA 2INZA 4ZGYA 4MZYA 2WNNA 3QMRA 2G3NA 2UY4A 4V2XA 3W7CA 4LCSA 3LHYA 3CJPA 4A3HA 3BZJA 4J3UA 3GBDA 4AG0A 1JFXA 4YCOA 5FJIA 3S6TA 2D69A 3MWAA 4ZFCA 5G1MA 1H4PA 2NUXA 4XIMA 3AC0A 4NZ4A 1CGWA 3II1A 4UTHA 2OGYA 3O1NA 2WC4A 3VNKA 3QR1A 1BXBA 1OB0A 3H6OA 3M5YA 2ZXQA 4EPDC 3LBOA 3P7YA 4PB5A 2PGEA 3O2LA 1EDGA 4W7WA 4BF9A 2EPLX 4WXYA 3PK7A 3U2EA 4FIQA 3WL0A 8CGTA 2EPKX 3ID7A 1KC7A 3EOSA 2G4JA 5IDZA 4DYJA 1B3ZA 4L9YA 4DF2A 1FWGC 3QV6A 2VYOA 1HF6A 3UJFA 1FHUA 2G8ZA 3A3WA 4FIRA 1XH1A 2PD9A 1H5YA 3VIGA 3DKJA 1QFEA 1YXYA 2NSXA 1QXLA 4FALA 4ORIA 4UQDA 4RNHA 3OZOA 3ARUA 1KTNA 3DFHA 2YDRA 3G1VA 3VDHA 5CBJA 2QQ6A 2B81A 4PTNA 4JDBA 1E51A 3C8NA 3DBPA 4X22A 2PDBA 4GVHA 1S5MA 3EWCA 4DM2A 1SUXA 1V93A 1KM4A 4B5SA 1LBMA 4WKFA 5I09A 3GC4A 1UD5A 5HXMA 1SW3A 1SMAA 1Q85A 4N42A 3RAOA 2CLHA 3UFYA 4EKJA 3ABRA 2YJQA 1JDFA 7XIMA 1IXQA 3EA2A 3BAWA 4RCXA 5A8OA 4UWMA 3UCQA 4A05A 4GCAA 2YDSA 3WEOA 1YKWA 1YNPA 4AVOA 1GOOA 3MYPA 4ZL1A 3SCRA 4CLMA 3UERA 3WK0A 4CCZA 2YXXA 1U22A 1KLYA 2NUYA 3UVIA 2IQTA 4H7VA 4P7LA 3ME3A 3PB0A 2C15A 3T8LA 4L61A 3ITVA 2Y63A 2XINA 3W7IA 2ZX5A 4O1BA 1ZBWA 3VDCA 2XFFA 2XTKA 2AGKA 2V30A 3U4AA 3GU9A 3KRBA 4HU0A 4N9BA 5A2BA 4DWDA 2OT1A 2PBOA 3WENA 2E6AA 3KBWA 1GQIA 4PEEA 4MLJA 1UIPA 3M41A 2HROA 1BKHA 3SUVA 5CPNA 2GJNA 3RPTA 5DELA 4MZ1A 5D2WA 2YLLA 3GC2A 3GQYA 4Q4SA 1NWRA 3PVFA 3R13A 3BWWA 2DZUA 4NRRA 4TX6A 3VGBA 4WIWA 1G4PA 4LEQA 5C5YA 9CGTA 3N2CA 1Z44A 3UETA 4AWUA 4P7QA 1G6CA 1SZFA 4FLSA 3CZLA 1S2UA 4BR1A 1MW1A 2XG9A 1ONRA 3T08A 2LLEA 1DJXA 4FXSA 4XBJA 3U8GA 2V3FA 4DUOA 5MKGA 1IXNA 4ADSA 3BOLA 4UTLA 1CPUA 1JNDA 1KV8A 2BY0A 3UNDA 3W1NA 2NXGA 2DQWA 4DF0A 3KRZA 3DC0A 1LJYA 1ZJHA 1I0BA 3DYMA 3NDYA 4RE0A 2D2GA 1I60A 2A3LA 1XGDA 1TPB1 1BSIA 2XVLA 5IHRA 3IUIA 4TU1A 1FP9A 2PWUA 4K8GA 1Q2RA 1K1DA 4DWSC 5AC7A 3KVJA 4Q4QA 4LCRA 1LQAA 1A3HA 1DHKA 3PM6A 3L5LA 2PDFA 4H7CA 3WSUA 2WHMA 1IWAA 4F79A 4I8YA 2GK1A 3VNZA 4FOJA 5D09A 3TN5A 4KEUA 4HK5A 4QCEA 3FSUA 1WDQA 4L9ZA 2PDCA 2OYMA 3VAVA 3H24A 2W9MA 4XZNX 4TTGA 4IMCA 3WH6A 3WUEA 3HG2A 3H2AA 3W7PA 2E8YA 2ODOA 1ZPTA 3WDHA 2RAGA 4HK7A 3AIVA 4LB3A 4OBSA 2FH6A 3DH7A 1XH2A 4IF2A 3ONCA 2ZUNA 1X7IA 4NAFB 4ACZA 1MQPA 2I5GA 5HJXA 3UG4A 5U7SA 3VI2A 1NY1A 1TELA 1K4HA 1O5KA 4CNPA 3ABOA 3N13A 3CMJA 3M6DA 4PUEA 3BLOA 2PGRA 4I5XA 5XINA 3GFZA 4O15A 4JFTA 1UD2A 2DY3A 2C8NA 1ZY9A 1UCWA 3HPAA 1O5XA 4W5ZA 3JR2A 3W7DA 1PHQA 1J5SA 4YWIA 3C2VA 3N11A 2ASHA 4WX2A 3IAPA 4I7UA 2GOKA 2XH2A 3IARA 3SECA 3O05A 3TFXA 2WCGA 1OFQA 3G1HA 1OIFA 4ERIA 3WN6A 1B1YA 4ES4A 3UR7A 1XRTA 3DC8A 1TR1A 1LT8A 2V81A 3KXQA 3QPEA 1BAGA 4K38A 4V1XA 3DGBA 3D3AA 3C2RA 3RPMA 2A3CA 3AS0A 3CZJA 4JFVA 1C9DA 1B2YA 3UESA 1EA9C 1W1TA 4XD3A 3ZLGA 3EDKA 1KW1A 3LCXA 3TMLA 1VH7A 3S2MA 3PJTA 1G4EA 4GC3A 3HPSA 3FY1A 1UA7A 4UFIA 2CBIA 3DX5A 4RL3A 4JNZA 1RK5A 2PDLA 2W62A 1WXYA 5D4YA 1U5JA 1KBBA 4GBDA 1UWUA 2X8RA 4ECLA 5D05A 2NVAA 4KW2A 3W2UA 2E67A 2D24A 2DW6A 4L1WA 1LRQA 2PLKA 3NA8A 4QJ3B 2OKOA 4POCA 1VPQA 5HMFA 4TX9A 1U1JA 1GVYA 4HJFA 4O1CA 4Z2HA 5C9ZA 4HPGA 3CQIA 6XIAA 4J40A 1H62A 3M1ZA 4HSOA 3AYTA 4HZ6A 3SURA 4JTUA 5DANA 5C9WA 3ZLFA 4DAFA 3W2JA 1SPQA 4JOMA 1TZ9A 3W74A 3PS7A 2C1GA 2EJ1A 3IIPA 1SZNA 3GXNA 4ZCWA 4RV3A 3O7UA 1FWWA 1GVIA 2VZVA 1TV4A 2QVNA 1OSEA 2VENA 5CG0A 3GO2A 3WJZA 3P14A 1OJXA 4AXNA 1KTCA 3WQOA 2WMKA 3KTSA 3LB0A 3RX2A 2REQB 2AQVA 3GH7A 3LUTA 1FDJA 3RGTA 1E6ZA 4QSHA 1TJPA 3TYUA 4AMCA 4F3HA 3QZ6A 4QGCA 4HP5A 4ZA0A 1ADOA 3LN3A 3WLJA 1JULA 4JTIA 1QU4A 1V3HA 2J8TA 1F61A 3FNDA 2WZHA 4JNMA 3AIUA 3FSTA 4R85A 3ARZA 3NQVA 4MFDA 4YNGA 3RM9A 4X9YA 5BXPA 3CBWA 3N9SA 2BOGX 4K37A 2ACUA 4PTXA 4PE8A 1W5NA 1Q66A 4DZIA 2BS9A 1S2VA 3QPZA 4EVZA 4HPHA 1F6KA 1OYAA 2DSKA 2VEFA 3VDBA 3C0JA 4W93A 3MP4A 1JAEA 1SYTA 1QHOA 2J8FA 1LOSA 2YB1A 3NQFA 3RLHA 4YYFA 4JYEA 1REQA 3CZEA 4HIBA 4WHBA 1BWKA 4FOUA 3WD0A 1HKIA 2G0WA 3SQMA 3WLMA 4K7VA 3UR2A 2P50A 3F2BA 3VA8A 3SB0A 4PTDA 2OX4A 1ECQA 1VJZA 4GGBA 3R79A 1Y0EA 2HK1A 3EA1A 4ZSUA 1UG6A 5JBDA 3UVAA 4GZIA 3A4JA 3DKLA 2OO6A 3LBMA 1Z9AA 2J77A 4RUBA 4P7RA 3IUDA 1HT6A 3W88A 4AY8A 4IPPA 4GI4A 3AXMA 4D8AA 1YE6A 3BE7A 3A47A 3L4TA 4TR9A 2DT2A 1GVRA 3BMVA 3CB8A 1ZL1A 4WGHA 1GZ1A 1OY0A 4PN2A 4L80A 2QIIA 5J5RA 2QDEA 1DWHM 2GUYA 4RDZA 4LVFA 5KITA 3KDNA 3D46A 4KCWA 4UTMA 3ELFA 2NVCA 1JPKA 2C0AA 3EPMA 3KUMA 3M9YA 1H49A 2Z7GA 3KZPA 1W5OA 4OJYA 1T41A 3W00A 1QPKA 1SU5A 4RZ4A 5HQLA 4IHCA 3L0NA 3L2MA 1M7JA 4IIHA 3GVWA 1FFQA 3VIJA 1UIOA 4NILA 3H4XA 1R6WA 1GVSA 1X6LA 3FEQA 1HZYA 2DT1A 2ZC1A 1F05A 3B8VA 1Q45A 1H11A 4PZVA 1YDOA 1EIXA 1PX3A 1UKOA 3HZ3A 2E5CA 4HB7A 1OYCA 4AD0A 2BVDA 2A6NA 2C71A 4IMAA 2NV9A 2DJLA 1PX8A 1BVZA 3CV7A 3UCDA 1T99A 2FZBA 3S6OA 3NOEA 1K4GA 3I3BA 3MMUA 3W2KA 5FKYA 3DZ1A 4HSHA 3AIEA 3CEUA 3SQLA 3L65A 3B04A 4CU7A 1ZENA 4NZ3A 1B57A 1GYNA 3SUWA 5K4ZA 3HU7A 2DZVA 2ZZ5A 1W9BM 1L2QA 3R2GA 2PEVA 4W88A 6REQB 1IWBA 3SCUA 1H09A 1EKOA 3LOTA 3GK0A 4O4VA 5KETA 1UD8A 4ADUA 1L9WA 3HMJG 3WQ6A 3SGZA 2WBKA 4TVDA 2ABBA 2OWXA 1AW2A 2E68A 1TWWA 3THUA 2VRKA 4JKLA 5CZKA 5DMMA 5G4EA 2YKKA 1GK8A 2Y5EA 3VD3A 1J18A 3KX6A 4ATWA 1POJA 3I7RA 2XWEA 4JY8A 2FB3A 3W6MA 1XRFA 4PCNA 3S4TA 3PR2A 2G3FA 5A6JA 4QSFA 4J2PA 1C7TA 3STFA 1M7PA 2YCEA 1FHVA 1VQTA 3O0FA 1A5NC 4LUSA 8XIMA 3LENA 3BCDA 2F9RA 3MUIA 4UFLA 1R3WA 5D04C 2WCSA 4AU0A 3GG0A 2H90A 3KM8A 5IBXA 4IFRA 2GGGA 4B92A 2E6FA 2Y85A 1HVQA 4R7JA 3WEMA 2OFJA 3T2PA 3N6QA 5C7HA 1PXGA 1JR1A 2WAGA 2TSYA 2NQZA 4I6VA 9RUBA 2CU0A 4H8UA 1W8SA 3ATYA 1EF3A 4W7VA 3TXVA 2WHJA 1S2TA 1NWSA 1OT1A 4JQAA 3WQCA 4JZ5A 1XLFA 2ZRWA 4LX4A 4PTVA 3W7QA 4KKXA 1E4LA 3XISA 1PWLA 2VNCA 4A8LA 3VZXA 4LAMA 2Y1HA 4B3LA 1E0WA 4LUIA 1E6PA 1ICPA 1TPUA 1NDWA 3OA5A 1P7TB 3TC3A 1I6NA 2XH0A 2FFCA 1X38A 3SN0A 4JTLA 1V6VA 5HBFA 4JIRA 4FPSA 4C1NA 3KBVA 3RJXA 1G5AA 3AOFA 4J27A 5I3KA 1AQFA 2R1NA 1IT0A 2JF7A 4FZIA 2G3MA 3S2NA 4B16A 4G9PA 2EPOA 1E43A 3ARPA 1XV8A 1KCKA 3P8JA 2VX7A 3MDWA 3H2OA 1TUFA 1R8LA 3E0LA 4G7EB 2QMKA 5E0FA 3MUXA 2QCCA 3M0MA 4FLOA 1ZBCA 2Z4GA 5MHBA 4FF5A 3OW1A 4C6CA 2ZCGA 3VXGA 2OSWA 3LERA 3WDPP 4C65A 2IS7A 4LV4A 1UH2A 1TMLA 5FAGA 4B5WA 4RR4A 2WLZA 3RLUA 3H12A 3VC5A 1K8ZA 4CD7A 4HMCA 1LUCB 2PB1A 3T05A 1TX0A 2DVXA 1VLIA 2QMJA 4YL2A 1EWEA 6ENLA 4JY9A 2JBMA 3NXLA 4B3KA 5T9CE 3C3UA 2WVVA 1ITXA 2IKJA 4YTUA 1J0IA 5I2UA 2DV0A 3VE9A 1GQLA 3E49A 1P1XA 1PIIA 4R88A 5DBTA 3TAKA 3PBVA 2Q8LA 1R9XA 3P0XA 2OVLA 1W3HA 4KH2A 3DESA 1UQZA 3EWYA 2FJKA 3SCTA 3GDMA 4AVNA 4TXEA 3CEPA 1YX1A 1CTNA 4CN6A 4WY0B 1WZAA 3FVDA 3AUJA 2DW7A 3VGEA 4OWGA 1DIKA 1ZP4A 3E1F1 5D9OA 1VFSA 3MZNA 4GINA 1ISZA 1CXEA 2XIIA 4NZJA 2VX4A 3SY1A 4XUYA 3OVGA 1TCMA 3BAJA 4GD0A 1GCYA 4O11A 4DXXA 1G69A 1DTNA 5LNVA 4AWEA 2BY1A 1YE4A 4CNUA 1MEWA 4MJ2A 2NX3A 4IGNA 1B31A 3W71A 1DL3A 4UCFA 1I2RA 3K1GA 2E9MA 1EC8A 3CK5A 3GDKA 4LVGA 2ISVA 3OQEA 2Z6IA 4US5D 2H6RA 3QRHA 2GWGA 3KWSA 1ADDA 4O19A 1XUUA 4FX6M 2Q71A 2QJHA 3P2VA 2YA2A 2BP1A 1XC4A 3LV5A 4PMNA 1VLWA 1J6OA 5K7JA 2V2HA 4Y9NA 2X41A 3PB2A 3O06A 1LF1A 3TDFA 3I10A 2IQDA 4GACA 2AGTA 1D3CA 2NQ5A 4YWSA 4EAYA 4F9DA 3GM8A 4GYPC 3ABXA 3GNNA 2CLPA 1SW0A 4GXMA 4PC8A 5TAOA 1QPRA 3LV6A 4HU8A 5A6TC 4ZQPA 3ORWA 3UU0A 4DO7A 5DEZA 3VU2A 1ISVA 3K4WA 4C5YA 2GVGA 3U9IA 3WK1A 1KM3A 3EKZA 2OELA 4C7GA 3NQ6A 1F73A 3LX9A 3NZPA 2FVLA 5CSYA 3M47A 1XG4A 3YPIA 2Y7GA 3FN9A 5FD0A 3E0FA 1NP2A 2BODX 4GYJA 4K6AA 4R9OA 4B4HA 3RX3A 2PWFA 2JE8A 2RDUA 4ROPA 4LC8A 1V7YA 1LLZA 1NFBA 1EX5A 1CLVA 3AISA 3BANA 4A2RA 3BGAA 1UP3A 1QO2A 1V03A 1X8CA 3BAYA 1MUWA 3WLRA 3LCWA 5SWUA 2P0OA 2ZWZA 3PZUA 4O16A 2X7WA 4Y8EA 5EY5A 2NQLA 4WY0A 4JQ3A 3QOKA 3W1LA 4E2OA 3LI0A 4AY7A 1MFUA 2ON3A 4GIAA 1DJGA 2P10A 3L9CA 3BLIA 3B0VC 1SZEA 1GQNA 2YXOA 3VX1A 1CNVA 1ONXA <