3GH4A

Crystal structure of beta-hexosaminidase from paenibacillus sp. ts12
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
519
structure length
507
Chain Sequence
HHHHSSGLVPRGSHMASMSQPSILPKPVSYTVGSGQFVLTKNASIFVAGNNVGETDELFNIGQALAKKLNASTGYTISVVKSNQPTAGSIYLTTVGGNAALGNEGYDLITTSNQVTLTANKPEGVFRGNQTLLQLLPAGIEKNTVVSGVQWVIPHSNISDKPEYEYRGLMLDVARHFFTVDEVKRQIDLASQYKINKFHMHLSDDQGWRIEIKSWPDLIEIGSKGQVGGGPGGYYTQEQFKDIVSYAAERYIEVIPEIDMPGHTNAALASYGELNPDGKRKAMRTDTAVGYSTLMPRAEITYQFVEDVISELAAISPSPYIHLGGDESNATSAADYDYFFGRVTAIANSYGKKVVGWDPSDTSSGATSDSVLQNWTCSASTGTAAKAKGMKVIVSPANAYLDMKYYSDSPIGLQWRGFVNTNRAYNWDPTDCIKGANIYGVESTLWTETFVTQDHLDYMLYPKLLSNAEVGWTARGDRNWDDFKERLIEHTPRLQNKGIKFFADPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords beta-hexosaminidase
publication title Molecular cloning and crystal structural analysis of a novel beta-N-acetylhexosaminidase from Paenibacillus sp. TS12 capable of degrading glycosphingolipids
pubmed doi rcsb
source organism Paenibacillus sp.
total genus 191
structure length 507
sequence length 519
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3gh4A01
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3gh4A02
1E6SM 3FAXA 3BCFA 3VDCA 2D0FA 3I3DA 1XHGA 3BSHA 1OIFA 1FOBA 2GDUA 1V0MA 4C91A 5CPTA 3WQVA 5FL1A 1G5AA 1SMDA 1HJWA 2X1IA 2WMGA 1B3VA 1JF6A 5JBDA 1UWRA 3ZSTA 3MUZ1 2J7EA 1V02A 4MNMA 1HN1A 1G0CA 5DFAA 3MO4A 2GVYA 1EHAA 4ZE4A 1AQMA 4F9DA 1R8LA 2JIEA 4UZSA 2DT2A 3VM7A 1EQCA 4J3WA 1WO2A 3IAQA 1JFHA 4AZCA 5DT7A 3J7HA 4B16A 3NYDA 2A3HA 1ECEA 1KQZA 3ARVA 3VGHA 3F5JA 3MMDA 1XYFA 2ZX5A 4M1RA 4CGTA 1LWJA 3BAJA 4JHOA 3AXXA 1KWKA 3CHCA 4UQCA 2W63A 3L4XA 3GNRA 2D20A 1VJSA 4UZUA 5LA1A 2D1ZA 1S46A 2OSWA 5CLTA 5LA0A 4P8VA 1NP0A 1MQQA 3VO0A 1RP8A 4GO8A 2ZUWA 1V6YA 2E8ZA 4OJYA 1UD8A 1N82A 5HPCA 3VMNA 1LLOA 2DQXA 3POHA 1CTNA 1ISVA 3HU7A 1BSIA 1JXKA 3TA9A 2MANA 3RCNA 1JD9A 2VZUA 4JFVA 4M82A 4D6FA 3SCVA 1H4PA 3TTOA 2NSXA 4FLOA 1NWTA 5A6BA 3W4RA 1XYZA 2ZXQA 4MB3A 2D0GA 1Q6GA 3GNOA 1B90A 4B3LA 3AHXA 3WBEA 1EQPA 2JE8A 3BAWA 3EDEA 2IXUA 1VRXA 3CGTA 3W37A 2XUCA 1CECA 1QPKA 5CPQA 3A6OA 2YDRA 1QVBA 3WENA 1OBAA 2QHAA 3F5KA 4CU8A 1FH7A 1MFVA 4Z2GA 4HZ8A 2BY2A 1V6UA 2WMIA 1W1PA 1AQ0A 4NI3A 4YN5A 2F8QA 3CHDA 4PUEA 1G94A 2PWGA 4ZXLA 1H09A 4Z2IA 2NT0A 4P8WA 1PZ2A 3WEOA 1US2A 4UQAA 2Y8KA 4D6CA 4CCDA 2CKSA 4AD3A 1WDPA 1HVQA 1QHOA 2ZX9A 4MDPA 3AIBA 3HMCA 2VTFA 2WVVB 4WSJA 2EPKX 4S3KA 1B3WA 3VX1A 5HPOA 3GXFA 3L4WA 1J12A 1VAHA 1H2JA 1EOMA 6CGTA 5E6ZA 2XM2A 3KE0A 3PTQA 2OYMA 3B9DA 5E0FA 1MYRA 4AD5A 4DWSB 3NIYA 3TP4A 1E1FA 1BYAA 1QBBA 5D9MA 3PBGA 3BH4A 1CXIA 4HA4A 2VI0A 2OYLA 4V28A 2G3NA 1C7TA 1SR0A 1UKQA 3WL1A 4MAVA 1VBUA 1DWGM 1KR0A 4AEFA 3PZOA 5A6JA 4CD5A 1E9LA 4N0RA 5A8QA 2DH3A 1W9XA 2VQUA 1QNOA 1V0LA 3SUWA 1DTUA 1XSJA 1ITCA 3SUVA 1B30A 1OIMA 5IDIA 3THDA 2CITA 1CGXA 3DC0A 3QHOA 4R5EA 1QBAA 3W82A 5FCZA 3L4VA 3FXYA 2XSAA 4V27A 2O92A 5BWFA 3UCQA 2BHZA 1BG9A 4AIEA 5ABFA 2WMJA 1QI5A 4ACYA 3CHFA 1ZBCA 1CXEA 1KFWA 4WIWA 2G3MA 3WUGA 2BVYA 2OWWA 1JZ2A 1TE1A 2E3ZA 4W7WA 1MXGA 3NSMA 3VGFA 2WVUA 5GNXA 1I1WA 3WQWA 1CLVA 2GFTA 3AIRA 3W28A 3KL3A 2WSKA 5LA2A 1TR1A 1HJVA 3WDHA 3B9AA 4PSRA 2BHYA 1ISZA 5A6LA 2BXZA 4DWSD 4GQQA 1HKKA 3T2QA 3CO4A 3L4YA 4GZIA 4EKJA 3AOFA 3U57A 2BY3A 1OD0A 3WDJA 4D1IA 1ODUA 3EMQA 1JYVA 4PMDA 1JD7A 4LQ1A 4JFTA 4LGXA 2F61A 2XFYA 1WZAA 3VMPA 4D6HA 1NP2A 3U5YA 2ZIDA 4F9JA 2NT1A 4WF7A 4TXEA 1LL6A 2VR4A 1W1VA 2XWEA 2YL6A 2WVSA 4OOZA 2CYGA 1ZL1A 2VZSA 3WH9A 4F66A 5A69A 2PWDA 3BXWA 4ACZA 5BXRA 4PCSA 1JF5A 2WSPA 4MB1A 3WUEA 4CN4A 4FK9A 2WW5A 1UKOA 3CUJA 1UH3A 3K8LA 2G4FA 1XC6A 4LX4A 1JXJA 1HIZA 3IK2A 1V6WA 2VR5A 3GNPA 4AIUA 1PX3A 1KXQA 1WZKA 4HTYA 3W25A 3JUGA 4QP0A 3AHYA 5A8PA 2BVDA 3GM8A 1ZJAA 4ZENA 3UETA 3CMGA 3VOCA 1TMQA 4W5ZA 4GI8A 1JDCA 3BLPX 3U7BA 4HPGA 3L2MA 2WVVA 3BC9A 4CD7A 1E71M 1V3LA 5KEZA 2JFEX 2XTKA 4P7OA 4OZOA 3PZIA 1PPIA 1H1NA 4PUDA 1TVPA 4H7VA 2FHBA 4URIA 2BVTA 3W53A 2WZEA 3AMGA 2DDXA 1A47A 1Q6FA 1LQ0A 3FHQA 4U5IA 4JKKA 1QI0A 2W61A 1EXPA 1HVXA 2ZUNA 1OSEA 1JDDA 3VINA 2VZOA 5A6MA 1GOQA 5A95A 4U2YA 3MV01 3ARYA 4UQEA 3CZ8A 5CSUA 3RM8A 2OWXA 4U33A 1F4AA 2VX7A 4CVWA 2FGLA 3BSGA 2CNCA 4P7QA 4W86A 3PHAA 3VIOA 1FFRA 1PIFA 3W0KA 2XVKA 4WK9A 4AW7A 1WE5A 3BGAA 3GBEA 3VIGA 1W1TA 1M03A 3A47A 3KEHA 1D3CA 3IJ7A 4W93A 1V3JA 2XIBA 1Q6DA 1IZKA 4Q7NA 3OLDA 5IXEA 3G6LA 2WC7A 4FLSA 4PMYA 5C8BB 3VIJA 5FOOA 3OZPA 4HOZA 4AZCB 2C7FA 1NM9A 3WY1A 1HT6A 3WDIA 5I24A 2CETA 4UOQA 3PZNA 2C0HA 3T08A 3I3EA 4BF7A 3WD2A 3N11A 4OIFA 4M81A 4W89A 3WQ8A 2ZUVA 3AXIA 4GZEA 2A3AA 1DHKA 3ECQA 4HOXA 1H5VA 3I3BA 3ZMRA 4AXNA 5CGMA 1TCMA 1L0PA 2WMKA 1E56A 5A94A 4CD4A 4U3CA 3F4VA 1NH6A 5BCAA 2DSVA 1QW9A 1F4HA 3WNNA 1RPKA 4MAZA 4MNJA 3SCQA 4FMVA 1KCKA 3WH8A 3SCPA 1CEOA 3OGRA 4JHZA 1MFUA 3QOKA 2W62A 4S3JA 2BHUA 1WB0A 3WKZA 1OINA 1LF1A 1J0JA 3MV11 1H41A 3AZSA 4UOZA 3CIVA 3II1A 5CLWA 1KXVA 2YL5A 3VD9A 5CZKA 4PTXA 1GONA 4AY1A 1J11A 4CU6A 2V3EA 3AHTA 1TZ7A 4L4OA 2QMJA 3OLGA 3UR8A 3VIFA 1UG6A 3EDJA 2YBUA 1OGSA 1WP6A 2XIIA 1Q4NX 2RGLA 2NW0A 4DUWA 2Z1SA 1FH9A 1GOOA 1M01A 5DT5A 4X0NA 1U2YA 1CPUA 4GXPA 2XPKA 3ALGA 2WMIB 2FGZA 3FY1A 2F2HA 2VO5A 2W5FA 1OCQA 1JZ6A 3PZ9A 1B3ZA 1BG4A 1AQHA 2UWFA 5D4YA 2WANA 3AZRA 1U30A 2VMFA 2YKKA 2W67A 1OM0A 3N15A 3IANA 4DWSC 2D3NA 2VJXA 2XVLA 3ZIZA 1B3YA 1GPFA 4BS0A 4BA0A 1H49A 2CKRA 2FH6A 3AISA 4TTUA 3WD0A 1XD0A 1KXHA 2VX5A 3U7VA 1L8NA 1MXDA 3HN3A 2FHFA 1QHPA 3VDAA 4CU7A 1W9PA 1V3MA 3SCTA 1D2KA 1J0IA 4OOUA 1JGIA 4TOQA 1XH1A 5HOSA 1SYTA 2E4TA 5GNZA 1W3KA 4RE2A 3SUTA 4PMUA 4AIOA 1UD4A 1E72M 5E9AA 5A6BD 1UWIA 5AYBA 4MTVA 3LPOA 3WIJA 2YLAA 1E1EA 4M24A 4F79A 4MDOA 4EK7A 3OA5A 1EDQA 1UR9A 2WM0A 3GXIA 1E4MM 2EXOA 1AVAA 3VMOA 1VFOA 3O6AA 4OUEA 1BHGA 4KWUA 4J27A 2X8RA 2VT0A 2VZVA 2XFRA 3O2LA 1H0IA 4DUXA 3PZVA 5A2CA 5ABFB 2WB5A 4H8VA 5M03A 4H41A 1JDAA 2EPLX 4P7LA 2CPUA 4Q22A 1IV8A 3FW6A 3DHPA 2DH2A 2YJQA 3PZTA 2G8ZA 2J78A 3ZQ9A 1JYNA 1PAMA 3AIQA 3CBWA 1JZ3A 4DM1A 2J47A 2EPNA 1E0VA 1TVNA 3QHMA 3ARXA 2DPEA 1ISYA 5I78A 4M29A 2WMFA 4PRWA 4JCMA 3A3HA 3NDZA 1GJUA 2JEQA 1UR4A 4GI6A 2J62A 1K9TA 2O9OA 7A3HA 1KBBA 3QHNA 3KL5A 2VL4A 1JNEA 3WH5A 5TD4A 5BXTA 1MQRA 3EMCA 3GTNA 3B9EA 1BGAA 1CDGA 1EO7A 1XH0A 2BFGA 2J7BA 3CH9A 1B31A 3CZLA 2VURA 1VEMA 3T0AA 2J75A 4KH2A 3VGGA 2YBTA 3VNYA 2QF8A 2O9TA 3ALFA 1HXJA 2VC9A 3VILA 1D7FA 1DWAM 1W91A 4JL1A 4HP5A 1BQCA 5IFTA 2A3BA 2G3IA 3B8SA 3IAPA 4H2CA 2A3CA 3VPLA 3ZM8A 3W27A 4GIAA 1O7AA 1LL4A 3VIMA 1EHNA 3FHAA 1VB9A 4ACZB 2OSXA 4JFSA 1PX8A 1G9HA 4FF5A 2J79A 2ZUTA 3LPGA 1GUVA 4HPHA 4HOWA 4BQ4A 2CBJA 3AJ7A 4D6IA 1OT1A 5GQBA 3LMYA 4V2XA 4QCEA 2CEQA 1WDSA 1TFVA 2VUYA 1GVYA 3GZAA 3WUBA 1EO5A 1GQJA 4U2ZA 1C8XA 1CLXA 3M7SA 5F7UA 3AYSA 1KGWA 1CXKA 1GVIA 1LWHA 1FH8A 2JALA 3ZJ8A 1CIUA 4P7RA 1GZJA 1UOKA 3WDPP 3A4AA 3K4AA 3WNLA 4HA3A 3VX0A 1ZBVA 3SUUA 4PBGA 4B3KA 2CIPA 4CD6A 3ARZA 3AHVA 1CZ1A 1BYBA 4LYRA 1WNOA 1HJXA 3VD7A 5M17A 3OB8A 4NRRA 3OGSA 2WKLA 2PWHA 2CERA 1NOFA 2XWDA 4MB5A 1DEDA 4W5UA 2WCAA 5ABEA 4QDMA 3RO8A 3MMUA 1W9DM 3WELA 1LL7A 2CHNA 3VGBA 3AS2A 5C70A 1K6AA 3DYOA 1BGGA 8A3HA 4XX6A 4AZ7A 2EQDA 3FN9A 3L2LA 2WMHA 1B0IA 3S2CA 1GHSA 1BPLB 2ZX8A 4ZE5A 4D1JA 3AFBA 4D71A 1G01A 3WF0A 4AD1A 3WSUA 4UOJA 3VD5A 2XVPA 2JF6A 4A3YA 2ZUSA 3RPMA 5AC5A 4BQ2A 1US3A 4TTGA 2WWCA 2CESA 2ZWYA 1C8YA 2XYLA 5I0DA 2X0YA 4UFLA 4PMXA 4UTFA 3FAWA 3QGVA 3WMCA 1WDRA 1GORA 2VNCA 4W7VA 5GPRA 2J74A 1DWJM 1JYWA 1V6XA 1HP5A 5FL0A 5E6YA 3AMDA 3SCNA 3UEQA 4MNLA 1M53A 5I6SA 2GUYA 6A3HA 2VX4A 4QFUA 1R85A 1E70M 3KZSA 1UA3A 1V02E 1W32A 5I5RA 8CGTA 1CBGA 1UD5A 3WF1A 3AZTA 4D6EA 1OB0A 1DP0A 3KWXA 4M80A 4HA1A 3L4UA 1NWSA 3CZEA 5I2UA 2DIEA 4WJXA 1BFNA 3G6MA 3VDHA 1R7OA 4LYPA 1GJWA 1E0XA 2BY1A 4ATWA 5D9PA 2JIWA 1SMAA 1JIBA 3WDRA 3WNOA 1O6IA 2D23A 1M7XA 1ZU8A 2DSUA 4HU8A 3TTQA 1VFFA 3MSDA 1UD3A 4AD4A 2WNWA 2AOSA 3NJ3A 3CUHA 5ECUA 4AZHA 1GW1A 1E6XM 2GJXA 4AWEA 4HU0A 4AD2A 3AICA 5A8NA 2ESCA 3PTKA 4CN1A 4NF7A 5IHRA 4M56A 2D22A 4MJ2A 1UWUA 2CBVA 2ZX6A 3VNZA 2WLZA 3T0DA 4BQ3A 5A8OA 2J7CA 4YPJA 1CXFA 4D6GA 3THCA 3L4TA 1FP8A 2E9BA 4HZ6A 2BS9A 1UR8A 3IJ8A 1JI2A 4MNKA 2CXGA 1HP4A 3ARTA 3M07A 1HKJA 4KRUA 1B3XA 5D9NA 5I79A 3WF2A 1E73M 2ZUMA 3AIWA 1MW2A 3BAYA 1GOKA 1UKSA 1HNYA 2QV4A 1CYGA 1EIBA 2YIHA 4J3TA 1XRVA 3SCWA 3W6MA 3OIHA 1FP9A 4XV0A 1PX4A 3AROA 3SEPA 4K68A 2DGAA 4B15A 4LYQA 3ZO9A 4UQ9A 3VIHA 1VENA 4GKLA 2GK1A 5A6AA 2FHCA 4AISA 1LG1A 1V3IA 3ZOAA 4AZBA 4XZWA 1QI2A 5BYWA 1R86A 1J10A 3WBAA 1J0ZA 2W66A 4FLQA 3EYPA 2D0HA 2WLYA 5D8ZA 4OBRA 3WEMA 1V3HA 1GOIA 1NARA 2RGMA 4UFKA 1HL9A 5A8MA 3BAIA 2OWCA 2ZE0A 2WCGA 3GBDA 1OD8A 4XZBA 2PWEA 1FHDA 4LPCA 1C3FA 1E3ZA 3AMCA 4X9YA 1DWIM 1QNPA 4E4PA 3VVGA 3ARRA 5AY7A 4AZIA 3WMSA 5CJ5A 1R7AA 2VRQA 1BLIA 4H04A 4UQDA 4UCFA 5BROA 1JZ5A 3DYPA 1ZB5A 1XCXA 3RM4A 1RD6A 3VD3A 5A3HA 1J9YA 2IUZA 3ZR6A 4TX8A 3WNKA 1K9EA 3AQUA 5A1AA 1UQYA 1RH9A 2J8GA 2UY3A 2XGBA 3APGA 3ARQA 1V0KA 2X09A 3ZT5A 1X1NA 5DF0A 1W2PA 1W3HA 1XSKA 1UWQA 1JI1A 2WZIA 4CCEA 4PMOA 1VEPA 1Y7VA 4H8UA 4WSKA 2BNJA 1NWRA 3K1DA 3WNPA 2VCCA 1TUXA 4Z2JA 1JFXA 1JL8A 1GHRA 1GCYA 1WKYA 3CUIA 1VF8A 2WXDM 1J01A 2XGIA 4AZ5A 2DT1A 4XB3A 5JUVA 2ZXDA 2UY2A 2V5CA 3TOPA 1CXHA 3WQ6A 4W8AA 1GNXA 2DT3A 1E3XA 2G3JA 2CCRA 2ZXBA 2X05A 4PTMA 1OWQA 2PI6A 3W6LA 4W8BA 1UUQA 4NSBA 1UQZA 1UR1A 2YA1A 4TVDA 4H8HA 3SCRA 3WD3A 2WC3A 5M5DA 1E4IA 3VU2A 1W9UA 1FHLA 5E09A 3WQ4A 4D72A 5HNNA 3BAXA 4AZGA 4E8DA 3QOMA 1C7SA 4N42A 3CZJA 5CSYA 1HL8A 3VD4A 3AS1A 5KZ6A 4GPNA 1PBGA 2ZUUA 3BMWA 1ISXA 1MW3A 1GOMA 2YOCA 1CGWA 3K46A 1QNSA 1PJ9A 5M3WA 2O9RA 3MKKA 2PB1A 2ZICA 2D24A 3AS3A 1RP9A 1EOKA 3PN8A 1UR2A 3SURA 3UG5A 4C7DA 3O9NA 3ZJ6A 2PBGA 1NWUA 3LPFA 3T0BA 1B1YA 1HKMA 2BV9A 2V5DA 5A2AA 3QR3A 2J25A 3BAKA 2IXVA 3VKKA 3S6TA 1QW8A 4E2OA 3D5HA 2DEPA 1ZJBA 3POCA 1H0GA 1BVZA 1E43A 2X0HA 4JFWA 4F8XA 2ZOXA 3PZUA 1UA7A 1MW1A 1ITXA 1Q6EA 4A3HA 1KCLA 1E15A 2EBNA 2YA0A 5CXPA 3RDKA 2WZHA 1E55A 3N1AA 3CZGA 3N12A 3UERA 1KXTA 1E5NA 2XVNA 4PN2A 2DSWA 4E8CA 2Q8XA 3CPUA 5JIWA 4TVCA 2VVNA 2VRJA 4MADA 1PZ3A 1EH9A 2QPSA 4IPNB 3N17A 5EFDA 2GJPA 1V3KA 4J3SA 2QPUA 1HJQA 2ZX7A 1C8QA 1K9FA 3CUFA 4J3VA 3WEZA 1E4LA 2E8YA 2J7FA 2XFFA 3VIKA 3AIVA 2EPMX 1UKTA 1ZBKA 2WC4A 3AS0A 3TONA 5BXPA 5E70A 1V0NA 1XD1A 1MVYA 3T2OA 4Z2HA 3AXHA 4PMNA 1SFSA 2YDSA 4WKAA 1AMYA 2WHJA 1E6QM 1B2YA 4KMQA 3WFLA 3NCOA 5CGTA 2PBOA 2BXYA 3ARUA 3CLWA 1CWYA 1HJSA 4HZ7A 3WD1A 5E0CA 1QNQA 4PMQA 3EDKA 5ABHA 4JL2A 4ML4A 2WHKA 4J28A 1EDTA 4U3AA 2Y4SA 3W24A 3WH7A 3PZQA 4W7UA 2DSZA 1CXLA 3W26A 5EMYA 5AC4A 5I3DA 3N18A 2X2YA 1MW0A 3ARPA 3F5LA 3GXDA 1MWOA 4CUCA 3WMBA 2GJXB 4D6JA 3ZT7A 4W87A 4UFJA 4QAWA 4UQBA 3VIPA 4AD0A 3WF3A 4J3UA 3WD4A 4U5KA 2E40A 3WH6A 2WVTA 1FA2A 2WBGA 4GQRA 5LYRA 4JZ5A 5IHSA 1KB3A 2O9PA 2WK2A 1BTCA 4IM4A 3ZJKA 4Y7EA 1KGUA 1E6PA 2J4GA 4YHGA 4MJ4A 4PYSA 4DM2A 2XSBA 1UR0A 4CCCA 4EAMA 4TX6A 2CBUA 3FNDA 4C7GA 3VGEA 3VIIA 1GQLA 2EO7A 5A6KA 3OG2A 3MUY1 5FKYA 1OT2A 1C92A 4M8UA 3BMVA 4IPLA 4WLCA 1VJZA 2GK1B 2XM1A 1WDQA 3W81A 1UH4A 1VFUA 3AMLA 1BYDA 2OLHA 4NZCA 1IT0A 1Q6CA 1W3JA 3VTRA 1TA3A 1FFQA 3VUPA 1HX0A 7TAAA 2A3EA 2XJ7A 1QHZA 4IISA 4OBSA 1GQIA 1BAGA 3VM5A 1EGZA 1PIGA 3W38A 3MUAA 4QLJA 1C93A 2J7GA 2Y5EA 4J3XA 4UNIA 3UR7A 1JAKA 1CNVA 4XUYA 4GINA 1YQ2A 1CGVA 1BF2A 1ODZA 4PTVA 4CN6A 3VGDA 1OGGA 1XV8A 2AAAA 1XGZA 2VZTA 4A4AA 1A3HA 5HXMA 3AIUA 2OSYA 2WYSA 1XCWA 3RILA 3N9KA 9CGTA 1UWSA 4NRSA 4BQ5A 3MUIA 1X6LA 2D3LA 3N04A 1ESWA 5JIPA 4JKLA 4JCLA 4QCFA 3U5UA 1WPCA 1QI4A 1VIWA 4LXFA 3GH4A 1XSIA 1WCGA 4UR9A 5I77A 4WKHA 5I23A 3DYMA 3GDBA 4J7RA 1EDGA 5CPSA 5CQ1A 1QI3A 3GXMA 4UFMA 2XVGA 1E4NA 2YDQA 5FIPA 3LPPA 1E6RA 2UY5A 2WBKA 3K8MA 2QLYA 3M6DA 5DEZA 4P7NA 3ARWA 3GYCA 2YLLA 4HMDA 4W84A 2V3DA 3AI0A 3BLKA 4GI9A 1E5JA 3WQ5A 3NSXA 1UH2A 2J77A 4CKQA 2PWFA 3ARSA 1VEOA 3SCUA 1UYQA 4PMRA 4DUVA 1H3GA 4B9ZA 1NOWA 2JEPA 1UD2A 1V08A 3ZJ7A 2FDMA 1J0HA 4PMZA 3MANA 5A2BA 1NQ6A 1DWFM 1P6WA 4PSPA 4W88A 4AZ6A 1JZ7A 2WAGA 4Z2LA 4PCTA 2E9MA 1J18A 1W9VA 4X0VA 3AIEA 4AEEA 4ZEPA 2VOTA 2CHOA 4ATDA 1B9ZA 4CVUA 1KQYA 1WZMA 1U33A 1EA9C 2ZXAA 2VRKA 1WAWA 2WCSA 3K4DA 5JBEA 3SCSA 1K9DA 5C71A 1UKPA 1JYXA 2V3FA 2VCAA 2YL8A 4W8LA 1W3LA 1MQPA 3ZSSA 2Y2WA 2GDVA 3TTSA 3UG4A 4RL3A 5HDRA 5JBFA 4WKFA 1LG2A 1W1YA 3WNMA 1QNRA 1G1YA 2YA2A 4B9YA 3OBAA 2J7DA 4FLRA 3W29A 4AMCA 1OGBA 1IZJA 2Y8VA 3MMWA 1M04A 1JZ4A 2VCBA 1UZ4A 1CGYA 4YHEA 2V3GA 4QLLA 4ATLA 2AMGA 1GOWA 1H11A 4RE4A 5DMYA 5A6SA 2OYKA 4Z2KA 2W4XA 3MS8A 1BVNP 3EDFA 4C90A 2E0PA 2HVMA 2VVSA 4DWSA 2QMKA 3GH5A 3ZT6A 1J0KA 2CBIA 2WPGA 3CMJA 1VBRA 4PEEA 2VQTA 2PF0A 3EMZA 2DIJA 3CHEA 2DSKA 3A4WA 3OGVA 3RJYA 3PZMA 3EDDA 3RJXA 4ZFMA 2EEXA 3ZR5A 3WUFA 3UESA 3OLIA 3AMKA 4JAWA 4OKDA 3SUSA 2HISA 1R87A 3AYRA 4KGLA 2PC8A 4MPKA 4AC1X 2GSJA 1KBKA 1BYCA 2Z1KA 2VX6A 2J8FA 3WF4A 3T2PA 5HBFA 4TUFA 3NSNA 2WKGA 1KWGA 3DHUA 4P8XA 5BRQA 3RIKA 2WWDA 1UD6A 3HJEA 4UFHA 1VFMA 3NDYA 1I1XA 1E40A 1XH2A 1UWTA 3NUKA 2C8NA 4PTWA 7CGTA 3RM9A 3L4ZA 4C7FA 1DWHM 5D9OA 1ISWA 3IJ9A 2JF7A 3WDQA 1JAEA 1W9BM 3EBVA 4HMEA 4UFIA 2B31A 1CGUA 3BCDA 1WZLA 4R27A 2GJRA 1TG7A 4RE3A 1Z32X 3OLEA 2FH8A 1HJUA 1NOUA 4PMVA 4JKMA 4BCEA 1C90A 4TVUA 1J0YA 4ZXOA 1YHTA 3D3AA 3SIMA 4JFUA 3RMEA 2V38A 1QOXA 3MSGA 4L4PA 1E6NA 3VDBA 3MU7A 1KR1A 1ZBWA 2ZWZA 4EE9A 2E9LA 1X6NA 5CG0A 3CTTA 2TAAA 1GQKA 2UY4A 4GZJA 5AYIA 3GH7A 3WL0A 4EANA 4W85A 4KRTA 1CGTA 1KGXA 4P8UA 3TTYA 4AYSA 1E6ZA 6TAAA 4IUGA 4BZYA 1HKIA 1UZ1A 5EB8A 4MB4A 1V03A 1W2VA 3E1F1 1JZ8A 5ABGA 1CENA 1HF6A 4GO9A 3DECA 5EBAA 5EFFA 2EPOA 3A4XA 3WFZA 4HMCA 4KGJA 2J7HA 3T09A 3M46A 3PTMA 2G41A 2EJ1A 3CUGA 3SCOA 2WHMA 3OZOA 3AHZA 4JIEA 1TA3B 3N13A 2BY0A 5BXSA 1JG9A 3KL0A 3UG3A 3WN6A 2XHYA 4QLKA 2W91A 4U31A 5GNYA 1C91A 1V6VA 5IFPA 5FD0A 5BRPA 3K8KA 4CD8A 1E0WA 2D2OA 1ZS2A 5DO8A 2YL9A 1LJYA 3CZKA 2WHLA 2Y24A 1PEZA 5D8WA 1I75A 2W92A 3PZGA 2XG9A 4D6DA 1UHVA 1JNDA 2DT0A
chains in the Genus database with same CATH superfamily
5T8GA 4J5NA 3FAXA 2VC6A 3B4UA 4ZFCA 2OT0A 1XHGA 1SW7A 1DORA 1FOBA 4DF1A 2GDUA 4XZIA 4C91A 5FL1A 3QLDA 2I9UA 1G5AA 2WMGA 3CV1A 3PY2A 1B3VA 3VC5A 2B7OA 5JBDA 1UWRA 4QGCA 4OHQA 5U4NA 3RF9A 1HO4A 2JIEA 2PDYA 3P3BA 2DT2A 1PB0A 4MZ1A 3UF9A 4AZCA 1AW1A 3DUGA 1TTJA 2WZTA 2A3HA 2B4GA 1S5MA 4M1RA 4NIRA 4HSHA 4CGTA 3BAJA 4JHOA 1YXCA 1WXZA 2W63A 2Q71A 2ZFAA 1S46A 2OFJA 3PFMA 1ADDA 3VOIA 4P8VA 5LA0A 3VO0A 1R3YA 2ZUWA 1V6YA 2F6KA 2E8ZA 4OJYA 1UD8A 1NAL1 2CZVA 3E9AA 2AL1A 4UTWA 3F4NA 1TE6A 1LLOA 4M0XA 3ES7A 5KMYA 3HU7A 2WNQA 1JD9A 1XINA 1H61A 4Y8FA 4AY8A 2X40A 5I3GA 2VFFA 4JQ3A 4WZHA 4C1NB 1XYZA 1ZY9A 2ZXQA 5T9CE 4MWAA 3ITXA 5AZ1A 3BAWA 3LLDA 2IXUA 1VRXA 4ZL1A 1Y5XA 2OQYA 4KEUA 1CECA 1IYXA 3E0IA 1O12A 5AC8A 1T96A 2DZVA 3WENA 3MCNA 4IP7A 4V1YA 3F5KA 4YJ5A 4QROA 3W70A 1V6UA 4NI3A 1H51A 4HNLA 1H09A 3I4KA 4Z2IA 3HGRA 3LRLA 1US2A 2Y8KA 4KW2A 4LW7A 3B9OA 3LB0A 1DJZA 2ZX9A 4HU4A 2Q8ZA 3AIBA 2XN1A 2WVVB 1JPKA 4D8LA 4S3KA 5AC7A 1B3WA 2ASHA 1QNVA 1J12A 6CGTA 1OFEA 2XM2A 3B9DA 3UXAA 4XBKA 5C9RA 3GX9A 3E6EA 3PBGA 3T40A 2PGRA 1R9ZA 2P5NA 3W7OA 1YNPA 1C7TA 2Z7GA 3LGDA 4GY0A 3R1ZA 5KINA 1VBUA 1LUCB 3LHWA 1E9LA 5A8QA 3WX7A 3AJXA 1UB3A 1QXLA 2QIWA 1DTUA 4K8GA 1XSJA 1ITCA 4QQUA 3ZLFA 1B30A 3QHOA 2YCEA 4GYPA 4R5EA 4N6EA 5CKSA 3UJ2A 3PJWA 4UMAA 5BWFA 2O92A 5KTLA 1OFBA 3BJTA 1O5KA 3IJDA 4ICCX 4BI7A 1BG9A 4Q32A 4GOAA 1W3NA 1QI5A 4ACYA 2Z1WA 2EG6A 4WIWA 2KZHA 4G7EB 4DY1A 3ITGA 1TE1A 1R3QA 1XUUA 4O57A 2FGBA 3H2OA 4QE4A 3RXZA 1KTBA 1ZAIA 3WQWA 1CLVA 1RD5A 2TPSA 3LX9A 3T8QA 4AYGA 1R38A 3F4DA 4N02A 3G8RA 2CZEA 2WSKA 4AVNA 1TR1A 1I6NA 3TYDA 3B9AA 2BOFX 3QZ6A 5A6LA 2BXZA 2QJMA 3BQ5A 1G4EA 3W7KA 5A6TC 3MI6A 4LWWA 1YADA 1HKKA 3T2QA 5EPDA 4EKJA 2BY3A 3WDJA 1ODUA 1RQHA 3VABA 4PMDA 2F61A 2OLAA 5EGRA 4JDYA 5D32A 1RBAA 3UR2A 4F9JA 3QMTA 1W1VA 3PJTA 4OOZA 1ZL1A 1QPQA 4Q4PA 3BSMA 4PCSA 1JF5A 3WUEA 3CUJA 4O53A 3LCHA 3W7RA 2XIMA 1HIZA 2VR5A 3CTLA 1WBJA 1PX3A 3TX9A 1EZWA 1KXQA 3JUGA 4TV6A 3AHYA 5A8PA 3WBYA 2BVDA 3GM8A 3QY7A 3N2MA 2QUVA 1OYCA 3G0UA 3VOCA 1TMQA 3GVVA 1SGJA 1DL3A 2C1HA 1W5OA 1B4EA 5HJYA 3MSRA 4CD7A 3CIXA 2VOMA 4P7OA 3CWNA 3GXNA 4JQ2A 3KS6A 1PPIA 3LERA 2ZC1A 3AMGA 1A47A 1Q6FA 1LQ0A 2Y5SA 2Z1XA 1QO5A 3STGA 1UPMB 1HVXA 2ZUNA 2TODA 1CX9A 4PUKA 3L9CA 1XBXA 4KRZA 3RK8A 3DX5A 3CZ8A 3GTFA 5CSRA 1ZALA 4U33A 1AODA 5I3IA 3TW9A 1GJPA 2NWRA 3LHUA 3BSGA 4ASTA 4P7QA 1FFRA 3W0KA 2XVKA 1GG0A 3BW4A 3P5ZA 3BGAA 3TJ4A 2AKZA 3CWHA 3WLQA 1LBMA 2PLJA 1KLZA 1RCOB 1SFTA 2UBPC 3CL8A 4LV4A 1V3JA 3B04A 1IZKA 3RPDA 1OADA 3OLDA 3G6LA 2WC7A 4AY7A 5C8BB 3CWOX 3WDIA 1NDYA 4BWLA 4DZHA 2IPWA 4UOQA 3I3EA 4OIFA 3MMTA 4W89A 4ZQRA 3WQ8A 3CQKA 3TYBA 4GZEA 1DHKA 4HCHA 4OU1A 2H3DA 4AXNA 5CH9A 4H9VA 2WMKA 2BSLA 3H8AA 3O15A 4U3CA 5BCAA 2Y70A 2DSVA 5SWUA 1F4HA 1DIDA 3BG3A 1RPKA 4AHQA 4MAZA 2TSYA 3WLRA 2P50A 4K39A 4IP5A 2CLLA 1DV7A 4AWSA 4JTCA 1XPGA 1MFUA 4MKSA 1D7KA 1LF1A 3R79A 5CZKA 1J11A 3PB2A 2F7FA 1TZ7A 3EX3A 1J6OA 1XLBA 2GGEA 3W1RA 3R8HA 3CXOA 3U2EA 1K7XA 3IEBA 1OGSA 1X1OA 1P1MA 2XIIA 2RFGA 1OG0A 3G5EA 4DUWA 3RG6A 1M01A 5BMXA 4X0NA 1U2YA 1CPUA 4GXPA 3LMZA 3ZFHA 3ALGA 3UZJA 4JIQA 4HU3A 3FY1A 2VO5A 2W5FA 1OCQA 4LS1A 1F3XA 3PZ9A 1AQHA 2QYGA 1U5HA 3NQGA 4R7OA 1U30A 3GVQA 1OM0A 2IS7A 3R89A 2V5BA 3GU1A 2LLEA 1H49A 3N2XA 4JTTA 4I5UA 3T7VA 3WD0A 1K8CA 4M3PA 3OG3A 2VX5A 1A50A 1TR9A 1WBHA 1MXDA 1ADOA 3LA4A 3VDAA 4CU7A 3VZYA 2G97A 3CAQA 4OOUA 1RK6A 2R14A 3TA6A 1UP0A 3P8IA 4NZ1A 4A8RA 4ZQCA 4QJ3B 3TCSA 1N2VA 4LUSB 3S1WA 5E9AA 1Q3NA 3U8GA 4N2YA 4QJ5B 4KCVA 3WIJA 2Q3RA 2YLAA 4M24A 2WM0A 2EXOA 3I4EA 5LZLA 1XBZA 2HTMA 2GLKA 4M1BA 1XLGA 4JHMA 1FXQA 2VT0A 2VZVA 3O2LA 1M5WA 2WB5A 5M03A 4H41A 3U2CA 3M44A 1ADSA 2CPUA 3WFAA 1I0DA 2R91A 3GWQA 1GW9A 2YJQA 3DFSA 1JYNA 5I3JA 3PWAA 3M16A 4K2SA 3CBWA 3H24A 3QSTA 1W5MA 1JZ3A 4O52A 1GVRA 1TVNA 1F2JA 1IZCA 5HR6A 2FDSA 1GEHA 1PIIA 4IMDA 2WMFA 3A3HA 4M7TA 3NDZA 5IRPA 2JEQA 1KM3A 4MZYA 1O68A 1XRFA 5D37A 2QUUA 3T07A 1KBBA 3NTYA 3NL2A 3WH5A 4UNLA 5G4EA 2X7WA 1TPUA 3IVTA 3GTNA 4JTJA 3B9EA 3CZLA 1BGAA 3CH9A 1B31A 1VHCA 2QS8A 4M51A 2QF8A 4DJFC 2VC9A 1W91A 3H70A 4JL1A 2A3BA 3B8SA 2A3CA 2HV5A 4LC8A 5EMLA 3VPLA 1RCXB 1A5BA 5HAOA 4QIUA 3V36A 3VIMA 3FHAA 1TPH1 3GNXA 6ENLA 3HFTA 1EJVC 4JTAA 5CC7A 2ZUTA 1GUVA 4HPHA 4D6IA 5GQBA 4QTGA 1ZHAA 3N9RA 2C15A 1NFGA 1VFSA 1GQJA 1HTIA 4G2DA 1C8XA 3TQVA 2PRLA 1DXFA 2GSEA 4YXGA 2E09A 1MXSA 1LWHA 2PDCA 4C6BA 3KW3A 2PGEA 3TFXA 1UOKA 3K4AA 3U2OA 7XIMA 3VX0A 3W1LA 3VOJA 2CIPA 2FKPA 5CPLA 4CD6A 1BYBA 3IGHX 3KAOA 1WNOA 1J5TA 3VDGA 3OB8A 4FHAA 3SECA 4NNCA 1GVSA 2WKLA 1TPVA 1NOFA 1S2AA 5HJLA 1K4GA 5AB3A 4LYKA 1DEDA 4W5UA 4PL1A 1SZGA 2WCAA 1XLCA 1LCOA 2JGQA 1W9DM 1FDJA 2Z24A 3DYOA 4IH3A 2EQDA 4EOUA 1A5SA 3PWGA 3L2LA 2PD5A 1DYSA 2FZ8A 3DFYA 1B0IA 1GHSA 3IRSA 1BPLB 4D71A 4P61A 1S2TA 3KBJA 3EA2A 3P84A 4AD1A 3WSUA 3HF3A 1X6UA 2JF6A 2HSAA 4A3YA 2ZUSA 2CESA 2P3EA 4G1KA 4NJIA 3FAWA 4M6UA 1EKOA 3QGVA 3WMCA 1WDRA 4IGMA 1V4YA 1GORA 3UVIA 1G69A 1XKYA 3F2CA 1JYWA 2GQ9A 5FEWA 5FL0A 2ZYFA 3B9NA 3SSZA 4PL2A 5E6YA 3JR2A 3S3GA 2CZFA 2GUYA 1A4MA 4O28A 3T0TA 3UU0A 4UTWC 1XLHA 1E70M 5EJ1B 1W32A 3RN6A 5CGQA 2HS6A 4H9XA 3PPHA 4M80A 4P2VA 1TV5A 1S2UA 4ZQMA 3L4UA 2ISDA 3TW6A 4WJXA 2QCMA 2FFIA 3VDHA 2NXIA 4MWAC 5G5IA 1EWDA 4DLFA 1TCDA 4ATWA 3GC2A 1XI3A 1SMAA 2DFAA 5G2WA 3GG8A 5AFDA 3MSDA 1PL9A 5C7HA 1K8ZA 3LBOA 3OZYA 2AOSA 4PH6A 3U6WA 4PB5A 2RJGA 3NJ3A 4AF0A 4AZHA 1GW1A 3TAKA 4LRSA 3SW6A 4QEEA 2NV1A 4FXSA 2DZSA 3ANUA 4KESA 5F4SA 3PTKA 3VAVA 2D22A 1UWUA 2ZX6A 5DXXA 5A8OA 5DCEA 4D6GA 3L4TA 2ZBTA 1TREA 4HZ6A 3IJ8A 1JI2A 3FSUA 4H7ZA 4D8AA 1F74A 1VKFA 2HQAA 3NPUA 1E9ZB 5D9NA 4EF8A 3ATYA 3DERA 1MW2A 3BAYA 1GOKA 2A85A 2X1TA 1SFJA 2YIHA 2NXHA 4J3TA 1GYMA 6PTDA 1RY8A 1XRVA 3W6MA 5AHIA 3OIHA 1F8IA 4UXDA 4NZ3A 4LYQA 3ZO9A 3OYXA 1L6GA 3SDOA 4AISA 2G0WA 2V5JA 1XRSA 3DIPA 2ZA2A 4H9UA 3Q4DA 1LG1A 4AZBA 4GH1A 1TELA 1J10A 3NQ7A 1J0ZA 2POTA 4QSHA 1MEHA 2WLYA 2QGHA 5D8ZA 3TZNA 2J6XA 1Z42A 1AD4A 4UCGA 3OQ8A 2WCGA 3W7HA 1OD8A 4GUHA 4MUZA 3NZQA 1FHDA 4UTLA 1H7RA 3A13A 1AL8A 1U83A 1WOAA 5FJOA 1S3TC 2FVKA 1R7AA 3MCOA 4RKAA 6XIMA 2VRQA 1BLIA 4H04A 4UCFA 4QXIA 3GDTA 1X7IA 1RD6A 3OVGA 1J9YA 4JY8A 3WNKA 3M0ZA 4I7VA 1W37A 3HPXA 2UY3A 3ARQA 2O56A 4UWMA 4BF9A 3URQA 3DG7A 4PMOA 1Y7VA 1IXNA 1SSGA 3L7RA 5DANA 3RX4A 3QYQA 3WNPA 1ZCOA 1PDZA 1OCJA 3LYEA 1XL9A 2QEZA 1JL8A 1WKYA 3CUIA 3NA8A 2CLIA 2WXDM 2ZZ5A 5KITA 4AZ5A 1EGVA 4C6OA 4XB3A 2ZXDA 4AXKA 5TIMA 2UY2A 1JCTA 1XRTA 3V0SA 4GYFA 1E3XA 3BV4A 2ZXBA 4JGDA 1HKVA 4E4UA 3N2TA 4R7WA 4ZO6A 3GFXA 2VXNA 1RVGA 3ERPA 1PWLA 4TVDA 1FKXA 2R8WA 3W9ZA 3VU2A 3LHVA 2XH7A 3TNBA 1WV2A 4PUWA 5HNNA 4LAUA 1HL8A 3AS1A 5KZ6A 2W0UA 1PBGA 2ZUUA 2X1UA 4DB7A 1SZNA 1C9WA 1CGWA 3OA3A 4IX2A 3VK5A 4GISA 4YWSA 4S3CA 4S3AA 4KCUA 3N6JA 4MLJA 4Q4OA 1RP9A 3B97A 1XQKA 3G1RA 1EUNA 5H2ZA 3UG5A 4E3TA 3B8TA 4UMBA 3H2AA 1NWUA 3LPFA 1B1YA 4GCAA 4H9TA 1ZSXA 3QR3A 3PM6A 4DHGA 2IXVA 4CQBA 3HV9A 4JICA 3INPA 3D5HA 1ENUA 2E5DA 5BOFA 1A5KC 1UA7A 1MW1A 1ITXA 3W2LA 2EBNA 4O1DA 2YA0A 3RDKA 2C1GA 1YW1A 2XVNA 4PN2A 4ZGYA 2V82A 3VKJA 3NPVA 3F2DA 1K02A 4EXQA 4S3DA 2XIJA 3REQB 3UPBA 2VVNA 1PZ3A 4ONVA 4MYAA 3TE9A 1MUWA 1OC6A 3GK0A 3ZVHB 3IV3A 1HJQA 1UIPA 4N4QA 3K30A 2ZX7A 1C8QA 1K9FA 3QKEA 4BWLC 2QNEA 4A22A 3KTXA 4M5PA 2E8YA 3DFOA 3VIKA 1EUAA 1ELSA 1DIOA 2WQPA 3QN3A 4QSFA 1XC4A 3AS0A 4A3QA 5LNRA 4KETA 1XLEA 1KKOA 1PCWA 3AXHA 1SFSA 4RLIA 3GC5A 7REQA 2QVNA 4KQNA 2CFFA 1QPRA 3TV8A 2VDIA 5LXEA 5AECA 1M41A 4LTSA 3CLWA 3PBMA 2YXOA 5ENLA 2YGYA 1HJSA 2E77A 2ZZ3A 3WD1A 1QNQA 4Q8NA 3HV8A 3EDKA 2IQDA 2VEFA 1NVMA 3S2JA 2QDHA 1UPPA 4ML4A 4J2PA 3W24A 3WH7A 2DSZA 1SU5A 1KBIA 3PS7A 3G77A 3TK7A 3TQPA 3UPMA 4GFSA 2X2YA 3VXGA 3DFPA 1MWOA 4A2RA 1WKDA 2ANUA 3ZT7A 3HG2A 2VC5A 4W9TA 4DEFA 3G1SA 3CO8A 3O07A 4UQBA 2P0OA 2XGZA 3W2KA 4AD0A 4CNSA 3WF3A 3TN6A 3W1MA 4GQRA 2WO5A 3NEVA 5LYRA 2OEJA 4JZ5A 1N8IA 1E6PA 4YHGA 4PYSA 4RPQA 3EB3A 2CBUA 1K8YA 3PUEA 3GG1A 2EO7A 3H55A 3PF3A 3ZXWA 1KM4A 4WR3A 3W88A 3VNIA 2ZRWA 1FWTA 1OT2A 2DUZA 1C92A 4IPLA 4WLCA 3UZYA 2PLKA 3SJ3A 3HQ1A 2C1IA 1KTCA 2GK1B 4GQGA 3MWCA 2PLMA 3W81A 1UH4A 1VFUA 4PODA 2OLHA 3H4GA 4NZCA 2JK2A 4ZVJA 3VUPA 2NX9A 5AZ0A 1L6WA 2ZA1A 3NM3A 2XDFA 2A3EA 4IISA 2AL2A 4OBSA 3DOPA 3SIZA 5DXYA 3VFCA 3H54A 3EKZA 1BAGA 3VM5A 3V75A 3MUAA 2WNNA 2OPJA 1JAKA 1KM5A 2NQLA 4HA0A 1DJIA 1OGGA 3AC0A 3CV2A 1NFPA 2L5HA 4GY7A 3UW6A 2PTZA 4O1FA 1XGZA 4B5VA 4B92A 1NF0A 2OSYA 4FNTA 1SO6A 2WYSA 3N9KA 9CGTA 3FXGA 1W31A 1L2UA 1XR2A 2BGQA 3MUIA 1KCXA 2D3LA 1UBSA 3UYIA 1VLIA 2GQAA 1ICPA 3VKDA 1AH4A 5I77A 3DZ1A 3UY8A 5CBJA 2WSYA 4IG2B 3TW7A 5D02A 3OU8A 4LAOA 3TN4A 4J7RA 5G1YA 1FWNA 5MF5A 3LPPA 1E6RA 2UY5A 3K8MA 4L4LA 2QLYA 3WQFA 2OOFA 4IWWA 5EMKA 3M5VA 4O1AA 2V3DA 2GUUA 4GI9A 1F3TA 2KX9A 3DCPA 3V18A 1XLKA 2C18A 2J77A 2PWFA 3WLMA 4XZMX 3ARSA 4CKQA 5HMEA 1JQVA 3SCUA 2VFIA 3QEZA 4OE7A 5H8UA 3U9IA 4X2PA 2C6QA 3VNMA 1UD2A 4ERIA 1H1YA 2FDMA 4XSLA 4ZO9A 1TIMA 4KEZA 1BVWA 3MANA 3LRMA 3P93A 3NQ2A 3FGCB 1DWFM 3LOTA 2WAGA 4Z2LA 5J5RA 4E4FA 1OF6A 1OABA 3IUIA 3AIEA 2CZDA 3TTEA 3VNJA 2CHOA 2YCKX 1B9ZA 4H6EA 4LRTA 1F9CA 4C1NA 3DI0A 2VRKA 3RYSA 1WAWA 5JBEA 1K9DA 2D73A 2V3FA 2VCAA 2ZTKA 1POKA 2GDVA 2PTXA 2BASA 3WNMA 3L65A 3A4JA 3B06A 4IOTA 4XZ9A 2YA2A 3TAOA 4A8NA 2C16A 2J7DA 1IZJA 2VUNA 2Y8VA 3BOXA 1I2QA 1JZ4A 3CV7A 3UWYA 4S3BA 4AB4A 4OGZA 2ZRYA 1UZ4A 2HE5A 1FTXA 2V3GA 4FNSA 4ZA0A 4S3GA 3SRHA 1QUMA 3MJYA 5CZJA 5A6SA 5CAHA 3MUCA 3N4EA 1BVNP 3EDFA 2ZZ2A 2VVSA 4GJJA 4JTHA 3GH5A 4WY0B 1OZQA 3SGZA 2QPXA 4CNTA 2WPGA 4PEEA 3O0KA 3OGVA 2AGTA 3F1QA 5JXQA 3UGVA 4KKXA 4IL0A 5J5DA 3ZR5A 4WQ6A 3SUSA 1LUCA 2PWUA 3KP1A 2QUMA 1VIZA 3HPFA 1PKLA 3B8UA 3NQ6A 5D09A 1VD6A 2Z1KA 3P5YA 1JEZA 3KVJA 2CLPA 2O7QA 4TUFA 1YDNA 4P8XA 5F1VA 4FNQA 3LEPA 1E40A 1UWTA 4PTWA 3L4ZA 1JCMP 5D9OA 1YPXA 3UWUA 4OV4A 1ISWA 5IBXA 3NL6A 3WDQA 2I5QA 5LHFA 3SY8A 2PDJA 3EBVA 3QSRA 5D38A 4HHMA 1P1XA 4IPIA 3LHTA 1WZLA 4IIDA 2GJRA 3GAKA 3JZEA 2R94A 1Z32X 3OLEA 3E0FA 1FWGC 3R4IA 3B3DA 3ZLHA 3SY1A 1GWJA 3NQFA 1C90A 1G4TA 1AH0A 4HZMA 2JGYA 2V38A 2VR2A 1QOXA 3WLJA 6TIMA 4HNCA 1E6NA 1DIEA 1GG1A 4AG0A 2ZWZA 3QPYA 2Z6IA 1VP5A 5FJTA 1FDYA 1QK2A 1BTMA 2TAAA 1GQKA 2UY4A 1IXOA 2PGWA 1JCNA 2IKIA 5AYIA 1XFCA 4ZOBA 3HTWA 1DQUA 3M0VA 4EANA 7ENLA 1VPYA 4MHBA 4P8UA 4KIRA 1R2SA 1OVDA 3S5ZA 5EB8A 3IGXA 1V03A 3W1UA 1JPMA 2VENA 5U7SA 2PDIA 4DBWA 4YWIA 3VFLA 3EEGA 2HK1A 3NFUA 1A0EA 2RUSA 4HMCA 5JU6A 3M46A 3PTMA 2G41A 1VQTA 2EJ1A 5K4ZA 3QY6A 2ONEA 3FFSA 2QR6A 3OZOA 1S5VA 3N13A 4S39A 2BY0A 5BXSA 1JG9A 3C52A 3S6OA 3WN6A 4AX7A 4L6DA 2XHYA 3PBVA 4QLKA 2W91A 1T40A 2OX4A 4FOUA 1A5MC 2GVGA 4DBSA 4O8AA 4A21A 1PZ0A 1XW8A 4AWUA 5F4WA 4CD8A 1J2BA 3C4UA 4YCOA 1ZS2A 1LJYA 1SO5A 2NQ9A 2WHLA 3KM8A 2CWNA 4LF2A 4LY4A 1JR1A 4D6DA 2YCJA 3VDCA 1QJWA 1OIFA 1AJ2A 1PHQA 3MVIA 1Z9AA 5CPTA 3PK7A 2IMRA 1SMDA 2QF7A 3FSTA 3TN3A 1S38A 1JF6A 4S3FA 2J7EA 2G4JA 1HN1A 4LBSA 2OX1A 1VCGA 4D8ZA 1G0CA 4PFMA 1W0MA 3AU6A 4ZE4A 2QCCA 2PDPA 1R8LA 4UZSA 4S23A 1LZOA 3GQYA 3VM7A 1EQCA 3Q58A 1WO2A 4C6LA 4B16A 1XIJA 2Q8LA 1ECEA 4E2DA 1KQZA 3IUHA 3VGHA 4KWVA 3F5JA 1XYFA 1LWJA 3TYCA 1RJQA 4I8DA 4UUIA 3CHCA 1W5PA 4R88A 3AALA 2ZDRA 2D20A 3E3HA 1MZRA 2VGIA 1BWLA 4H8NA 5CLTA 3AYVA 3E5BA 4GO8A 4U28A 1QPOA 4GUIA 1N82A 1OZMA 3LQLA 2QCGA 3EXSA 3POHA 4XKYA 4YTTA 4TQTA 4QG8A 3RCNA 4IFKB 2VZUA 4GMEA 4O10A 3SCVA 1I2NA 4P00B 3ABSA 5A6BA 4C5YA 4K3ZA 3GNOA 5C54A 3WBEA 3N6QA 2PCQA 4KFOA 1MRQA 3W37A 3ICJA 2B7QA 3EA1A 1L9WA 4JY9A 5CPQA 3MO7A 4HHLA 2AQOA 1Q4WA 1CB7B 1MFVA 3LZ5A 2XU2A 1JQXA 1W1PA 1B3OA 3HA1A 1A80A 4MMWA 1YIXA 1CT5A 4YN5A 2E6YA 3CHDA 4PUEA 3H6OA 4XKMA 2VHLA 3OHIA 3B0XA 4LVAA 3WLKX 1XJBA 1SW0A 3S1XA 2FIQA 3USBA 4FR6A 1HVQA 3LM3A 4MDPA 1XYLA 5EBUA 2VTFA 4WSJA 3GDRA 5HPOA 2WPBA 3IPWA 5E6ZA 5AHNA 3KE0A 3PTQA 3H2MA 2OYMA 1AMKA 1DJYA 3W2MA 2V81A 4LF1A 1FHUA 1MYRA 2YCLB 4XIAA 1RVKA 2V2CA 1QBBA 1PTAA 3BH4A 3M0XA 1IWPA 1MEIA 3FIGA 2VI0A 2Z2UA 3TXVA 2OYLA 1YNQA 4V28A 4K37A 2G3NA 3G8EA 4HYRA 4RXFA 4CEUC 4EACA 2GVLA 1DWGM 4AEFA 3PZOA 1GVFA 3UY7A 1R6WA 3TOYA 3MB9A 4LUSA 1XIDA 2VQUA 4HSOA 5CCZA 3Q45A 1ZP4A 3ISIX 4PB4A 4QDWA 4DELA 4ML9A 3MKCA 4DJEA 5IDIA 3RU8X 2FB2A 4PULA 3THDA 3CEUA 4GKTA 2NQ5A 3NZRA 4G9PA 1WOBA 3C56A 4IGHA 5FCZA 1NU5A 3FXYA 3L4VA 4Z1BA 3W7QA 3KBWA 2XSAA 2VYOA 3UCQA 4LSBA 4RPPA 4DNMA 4AIEA 1FWBC 2Z00A 2GVJA 3BJSA 3FYPA 2G3MA 3TU9A 2BVYA 3FV9A 1F05A 1KBJA 4UIOA 3GR7A 3NSMA 3VGFA 3EX1A 5GNXA 4QITA 3E2QA 5L6UA 3DEQA 3IJLA 1MDRA 2YXGA 2H6RA 3PR2A 4K1WA 1G7UA 5GJPA 3MI2A 5D30A 4DWSD 1TTPA 5AN7A 3CO4A 4IMCA 1HQTA 2IQ0A 2PDLA 3EZ4A 4D1IA 1JYVA 4LQ1A 4JYEA 4D6HA 4YCPA 1KLYA 1XG3A 3U5YA 2CLMA 3AYTA 3CUXA 2DP3A 2Y8UA 1QCWA 2ZRUA 4KCWA 3PVFA 5F1UA 4LEQA 2X2GA 2WVSA 5CAKA 2XH0A 2CYGA 2VZSA 4LANA 3WH9A 5A69A 3VNDA 4H4IA 1EF2A 3H2EA 5D2WA 4MB1A 3K8LA 2G4FA 1XC6A 1JXJA 3IK2A 3VKAA 1V6WA 3BL3A 4B5UA 3GNPA 4AIUA 2OQLA 3GHTA 1ICSA 4KT2A 1EJWC 4KERA 1ZCCA 2GGJA 3UETA 3C8NA 1UJQA 2NUWA 1JDCA 2FMOA 3R13A 1Q65A 4XISA 3BC9A 4XZHA 3W73A 1E71M 1V3LA 1TX0A 2OVLA 3O6DA 4XTIA 2FHBA 3PSWA 2X7VA 2DDXA 3F7JA 4PR4A 2Y85A 4JKKA 1QI0A 2INEA 2W61A 3M64A 1JDDA 1QATA 3VINA 2VZOA 4U2YA 1UMYA 3MV01 4UQEA 2Y6ZA 3BLFA 2VX7A 1W56A 4CVWA 1IEVA 3LGEA 2FGLA 8RUCA 4W86A 3ATZA 3WLLA 2FTWA 3ONBA 3CMFA 2FQIA 3BLDA 4LOCA 5AOUA 1BKHA 1DQXA 2XZ9A 3TJIA 1J4EA 1G7VA 3KEHA 3NWRA 1D3CA 4W93A 3CQJA 4MG4A 1JDEA 2CLFA 3PB0A 5LGZA 3VIJA 5JVLA 4G7FA 5FOOA 3OZPA 5K4XA 1FWJC 3I68A 5DBTA 1HT6A 4Q4SA 5I24A 1KFEA 3QW4B 5HUOA 3EWZA 1DIKA 2C0HA 3T08A 3R94A 2OELA 2QAFA 1V93A 1O94A 5K2ZA 3WD2A 3MTWA 3OPSA 3IIOA 3DBNA 3AXIA 4LS0A 4HYWA 1XLLA 3ECQA 3LXCA 5C7VA 4HOXA 1H5VA 3ZMRA 5CGMA 3KHJA 1E56A 3S6DA 3WNNA 9RUBA 1XIMA 2G50A 3CIWA 1Q66A 3WH8A 1CEOA 3GIPA 4NILA 3DU0A 4DI9A 1E51A 2OEKA 4HN8A 1UR3M 3LCWA 4JHZA 3QOKA 4S3JA 2BHUA 1V5XA 4A6GA 3OQEA 5JQ9A 3AZSA 3GG7A 3M0JA 3II1A 5CLWA 1KXVA 4PTXA 4PEKA 4AY1A 2FJUB 2Z29A 2V3EA 1XDJA 2YR1A 4L4OA 5E0KA 2ISVA 5CSSA 1R3WA 1UG6A 4IXHA 2A1YA 3STFA 1PYFA 4Y9MA 2OGYA 4DQWA 4IJCA 5M1TA 2H8ZA 4IXXA 1F6PA 3B05A 2WMIB 2F2HA 1JZ6A 3W1AA 1B3ZA 1ZAHA 3GLCA 5D4YA 4WDUA 1XIBA 3AZRA 3C3NA 2CXEA 2A7RA 3A64A 3KUMA 4W4QA 2D3NA 2AKMA 4EVZA 5FA5A 4I3GA 2XVLA 3ZIZA 1B3YA 1F3EA 2FH6A 1YTEA 3E2SA 2GWGA 2HJPA 2J88A 2VFGA 1KXHA 2VEGA 1S5NA 3KOZA 3BLLA 2VEPA 4F3HA 3MW7A 1IF2A 1EJTC 4ES4A 3SCTA 1D2KA 3E74A 1AZ2A 1AW2A 1K77A 3THAA 2V2DA 1VC4A 4DPPA 4I5XA 3IGUA 1DJWA 1IT7A 1SYTA 1JUKA 2YCIX 4GG9A 1W3KA 4MFDA 1E72M 4MGGA 2PF8A 4UTJA 2QZRA 3WQDA 4MTVA 1E1EA 4N9DA 1EDQA 5IBXC 4Z17A 2IW0A 3VMOA 5LIXX 1VJIA 1EC7A 2YPIA 4OUEA 2VELA 4KWUA 4K8HA 2EKGA 2XFRA 3K5XA 1TB3A 4I9AA 3PZVA 4UTTA 5ABFB 1AK5A 1IV8A 4DF2A 2FFCA 4ZQNA 4ICMA 2DH2A 3PZTA 2G8ZA 1VRDA 2J78A 2VGBA 2DJLA 3AIQA 1H1ZA 1DJNA 4ZSUA 4HT3A 3PG8A 1E0VA 3QHMA 3UXLA 3UZWA 2NXGA 3QV7A 4M29A 2QVHA 3MP5A 3S5NA 4JCMA 1C29A 4GI6A 4NZJA 2J62A 3CQHA 3QHNA 4HB7A 2EGZA 2VL4A 3RAOA 8TIMA 5H1WA 5TD4A 3EWDA 3B0VC 3EMCA 5E1QA 2BFGA 2VURA 3C2VA 2J75A 2YBTA 2INZA 3GNNA 1XDLA 3BDKA 2O9TA 3VILA 2WV8A 1BQCA 3C0SA 5IFTA 2G3IA 1XM3A 3ZM8A 2G95A 3W27A 3THQA 3EEZA 5LIKX 1X38A 4GXMA 1EHNA 4ACZB 3R0UA 1IIGA 3FKRA 4M7SA 4PCFA 1MSSA 3AJ7A 1GOXA 3LMYA 2CEQA 3PWIA 1TFVA 3WUBA 3DFQA 3LRKA 3UXKA 1CLXA 2R1KA 5GJMA 1MEWA 4C6PA 3AYSA 1CXKA 3CAWA 3OP2A 2JALA 4P7RA 1LT7A 3A4AA 5E9XA 4NI8A 3GE7A 3ARZA 1QASA 3AHVA 4US6A 3BJFA 3WCZA 4LAKA 1HJXA 4O14A 3VD7A 5M17A 3EWBX 1PKMA 2ON3A 2XWDA 1S2VA 1GZGA 1NDWA 3A9IA 3BW3A 1EJSC 3BGJA 4QDMA 2W79A 5C70A 3AS2A 1K6AA 1A3WA 1BGGA 4XX6A 4AZ7A 2PDGA 2XH2A 5C9WA 3ANVA 3AFBA 3WF0A 5D2VA 3ZVHA 1XQLA 1PKYA 2NUYA 4UOJA 3NGJA 3QQ1A 4Q4MA 3SADA 5HNRA 2TRSA 3RPMA 5AC5A 4BQ2A 4U4MA 1XBVA 4TTGA 2WWCA 5FSEC 2ZWYA 1C8YA 3N6HA 4PMXA 4LB4A 3MT1A 2Y7FA 4KBXA 1W8GA 2J74A 1DWJM 1V6XA 3NL3A 5XIMA 1HP5A 4M19A 3UEQA 4MNLA 1M53A 4IUOA 5I6SA 4YVPA 2VX4A 4QFUA 1R85A 1TWIA 1V02E 4J1OA 8CGTA 2ZVRA 1UD5A 2B7PA 2DUXA 3GDMA 2Y0FA 2HNEA 4Z1DA 4UTUA 3KWXA 5BNKA 3LHYA 1NFBA 1NWSA 1NJJA 3NURA 5I2UA 3QC0A 1BFNA 4FXRA 4LYPA 1GJWA 1E0XA 3G24A 3L67A 5I03A 1JIBA 4GFIA 6REQB 3W7DA 2D23A 2DSUA 1ZU8A 4HU8A 3SRFA 4R33A 1UD3A 4US5A 4AD4A 4MJZA 4YIWA 2WNWA 2DW6A 3GUGA 5JMUA 3N34A 4WDWA 3CUHA 1XLIA 1YE6A 2INFA 1T6MA 4AD2A 5A8NA 2ESCA 4CN1A 5IHRA 4MJ2A 3R11A 3T0DA 4BQ3A 4ZB2A 3THCA 2XISA 1UR8A 4KS0A 4MNKA 3BV7A 1HKJA 1B3XA 1HO1A 2PCEA 5I79A 4WJ8A 1NSJA 3WF2A 2ZUMA 3RNDA 1MNZA 3WMLA 1TJ0A 2XN2A 1T8QA 4NNBA 3SCWA 5ABTA 3ELFA 1FP9A 1G4PA 3LLXA 2GK1A 2FZ9A 1A5CA 4F2UA 1UOZA 3GRIA 3S0CA 3FEMA 4O15A 3UA4A 2NX3A 1WUEA 1DXEA 2OJPA 3NNTA 3RR4A 3NQCA 3CYJA 1V3IA 5F2LA 3ZOAA 4XZWA 2AQVA 1QI2A 3DHFA 1W6TA 1EX5A 1FCQA 1E1CB 1JUEA 4GZ7A 1FY6A 3WBXA 4DJEC 3WEMA 4MVAA 3L2IA 4HIBA 3XINA 3KCLA 4DBEA 3A9BA 3BAIA 2GVEA 3T78A 7PTDA 3GC4A 3GBDA 1EC9A 5HQMA 4GWEA 2PWEA 4LPCA 1C3FA 3T55A 4GX9A 4G6CA 4RZ6A 5JH1A 4E4PA 3VVGA 3ARRA 5CJ5A 4A05A 4DO4A 5BROA 3E0VA 2QCLA 3RM4A 4TU1A 5HULA 3TEVA 4H19A 2IUZA 4UNKA 3TWAA 3KDNA 1K9EA 3AQUA 5A1AA 1UQYA 4JN8A 2XGBA 1V0KA 1H7XA 2CLOA 1UWQA 2PDHA 4DJDA 1HW6A 4PBEA 2R24A 4IG2A 4WSKA 2VGGA 1S1RA 2BNJA 4NX0A 4DVOA 3LXAA 2VCCA 4OFCA 4Z2JA 2GSHA 2FB3A 4NP7A 4Q4KA 1TTQA 2X0SA 4JS3A 1GCYA 4MUPA 3VCCA 1VF8A 1J01A 2XGIA 2DVUA 1K7FA 2DT1A 5JUVA 1TPFA 3VC6A 4H2HA 3QMSA 1OWQA 2WM1A 1VFTA 4ZB0A 3NO5A 4W8BA 1UUQA 4M6PA 4IIEA 4L4MA 4H8HA 1FQ0A 3OVPA 3FGCA 5E09A 4E8DA 3C3UA 4N42A 3RRXA 4GPNA 3BMWA 3BARA 3TCEA 3TIMA 2QJGA 5HQEA 3K46A 4ZOAA 1PJ9A 5M3WA 2O9RA 2BZNA 2EPHA 5DMMA 3EOUA 3PN8A 1YTDA 2DZUA 5LXXA 4ZOEA 2PBGA 3T0BA 1HKMA 2BV9A 3G1HA 1TV4A 2V5DA 3QFWA 1L6SA 3DG6A 1JPDX 3TYZA 3VKKA 2ATMA 2OR2A 2DEPA 4WGXA 4NNAA 1DQWA 1BVZA 1E43A 3FCPA 2PP3A 4B5XA 3C0JA 3OYZA 3NAVA 3MKVA 2VEMA 5AVHA 1N7KA 2WQDA 4UBPC 5LIYX 5TAOA 5DCDA 4A3HA 1KCLA 3N1AA 3CZGA 3UERA 4S2BA 3QZAA 3TN5A 2DSWA 3KCOA 2FVLA 1SUXA 3STEA 3GY1A 1Z7AA 3C2RA 2F9RA 3CHVA 5D2XA 3RCMA 1XLAA 3NZPA 4ROQA 4EIVA 5JIWA 3I10A 4XD6A 3T1GA 4J35A 4WY0A 3IJIA 1M3UA 4CQDA 1Q2RA 4DZIA 4C60A 3B8DA 4IFOA 1N8WA 4AC7C 5TF0A 1H7WA 2GJPA 4F0MA 2Z26A 1ALDA 3HQOA 2IPFA 1VS1A 1FRBA 4J3VA 3WEZA 1RBLA 3GFYA 1E4LA 2XFFA 2I14A 3AIVA 3NQMA 4EPDC 4JTGA 1RJPA 4QDPA 3P80A 2V68A 1UKTA 1ZBKA 4GRSA 4O1BA 3UZ5A 1MVYA 3T2OA 3ABXA 5BW6A 4CNPA 1OF8A 3R6IA 3R58A 4WKAA 1X39A 4O16A 1E6QM 1B2YA 4KMQA 3VCNA 1O1HA 3R12A 1PSCA 2XH4A 3EA3A 4O12A 3ARUA 4CQ8A 4ICNA 1D8WA 4TMBA 4HZ7A 1EWEA 4PMQA 3W7MA 3GVRA 4I6KA 2WHKA 1EDTA 4U3AA 3UGRA 5F2MA 3N9SA 3TWBA 3IARA 4W7UA 4LVDA 3W26A 5EMYA 4O18A 3HMJG 1E0TA 1H7NA 2EF9A 3PTDA 5C55A 4CUCA 4KEVA 2GJXB 4D6JA 4LFYA 1IEQA 3G0SA 4DF0A 3HPAA 4O1CA 4JTQA 1O66A 2ZRXA 4U5KA 2E40A 1FA2A 1GVEA 4DXKA 1KB3A 4ZOCA 4IM4A 4A3UA 2PZ0A 3A21A 3U2ZA 4GIYA 3FJNA 4MJ4A 3A22A 4DM2A 3VGEA 2I1OA 1IGSA 5A6KA 2PFHA 3QR1A 3MUY1 1YDVA 5FKYA 1EB3A 2DJXA 2BBFA 1C9DA 1VYSX 1QWGA 5K7JA 4FF7A 3MP4A 1ZFJA 1WX0A 3K2GA 1YXDA 3QPEA 2ZADA 3QTPA 1BYDA 3MQTA 1U22A 4AQLA 1WQ5A 3TJLA 4H9MA 5HATA 1FKWA 4XBSA 3P2VA 7TAAA 2E5BA 3ITVA 3EB4A 2XJ7A 1QHZA 4C5ZA 1ML1A 1PIGA 4NT0A 2P0IA 2Y5EA 4GQBA 5T26A 3NVTA 2Y7GA 4UNIA 1FWEC 1YQ2A 4UR8A 3S1UA 4CN6A 4UTTC 3VGDA 4A3RA 2QW5A 1ZENA 3GDKA 4JIIX 4BF5A 2AAAA 3CNYA 1P7TB 4CQ9A 4A4AA 1LT8A 2E6DA 5HXMA 1UWSA 4BQ5A 2OTDA 3DN5A 3VUSA 1ESWA 2QKFA 3EOOA 1WPCA 3W07A 5I02A 4LXFA 3N3MA 1WCGA 5I00A 4XG1A 1EP3A 4L65A 3JS3A 5CQ1A 1QI3A 3GXMA 1E4NA 2YDQA 1V7YA 2WBKA 3M6DA 2PEVA 2DW7A 1UUOA 4IMFA 5DEZA 4P7NA 3H4XA 4I8YA 5XINA 3AI0A 3NSXA 2C91A 3C0LA 1UH2A 4XWUA 3M0MA 3C0QA 1VEOA 4C6JA 3C2EA 4PMRA 1H3GA 4B9ZA 1NOWA 3C5QA 1H62A 3VOGA 5A2BA 1NQ6A 3EWCA 4PUNA 1O95A 1JZ7A 5C9ZA 4PCTA 1WKEA 2J13A 1TV2A 4H9ZA 4AEEA 4BEUA 1Q5MA 1PTDA 4F2BA 4ATDA 3RLVA 3EX2A 5GVJA 4FOKA 1WZMA 4IFKA 2IKHA 2Z27A 2ZXAA 4GGBA 1C8VA 1XYMA 2WCSA 3K4DA 5H6HA 3IJQA 4GCXA 5C71A 1XPYA 1XKJA 1TV8A 1EP2A 2YL8A 3TTSA 5HDRA 4WKFA 1LG2A 4GLEA 3T44A 3CASA 2YFOA 4B9YA 4FX6M 3S2LA 3R8GA 4YVVA 4GC4A 4NJHA 3MMWA 4A29A 1Q6LA 3S2MA 1P0NA 4XZLX 4Y8EA 1X98A 4QLLA 2QIIA 4G56A 3SI9A 3AXKA 2OYKA 2YX0A 1MO0A 4E8GA 3MS8A 2ZZ1A 3A3XA 1DJHA 2YCLA 2HVMA 1V6TA 2QMKA 3ZT6A 3URNA 3LM7A 3E0WA 3HOJA 4IIFA 5I06A 4LB3A 1IGWA 1VBRA 3EMZA 3CV6A 3FYYA 1M65A 2DIJA 5B80A 3A4WA 3V7PA 1W3IA 4JEJA 4EPBC 1XBYA 2HBVA 4ZFMA 4DBDA 3OLIA 5LNUA 3RR1A 2HISA 1R87A 3WO8A 1IQ8A 3AYRA 4AMAA 4UC5A 5CZ0A 4TO8A 1F07A 3M0HA 4AC1X 1EBHA 3PC0A 1BYCA 1RXOB 1XUZA 2RAGA 2VGFA 4RCXA 3WF4A 3C2OA 3T2PA 5HBFA 1MI3A 3BMXA 4DWDA 1KWGA 1AL7A 2ZVIA 3P81A 1FWIC 1UD6A 4BK9A 1IHIA 3S1VA 4AEOA 2OO0A 4K8EA 3IUDA 3RM9A 4C7FA 3UJFA 3VI2A 3IJ9A 4JN7A 4U10A 3ID7A 4KEMA 4XAGA 3NPWA 2WJFA 3QV6A 2FZBA 1S39A 1HJUA 2FZMA 3WLTA 4GABA 3YPIA 4ZXOA 3D3AA 4JFUA 4QR6A 4YS1A 3KOFA 4XTDA 3RHGA 3P82A 1KR1A 4AIBA 1A49A 1N55A 2E9LA 5CG0A 1O5XA 4Y9OA 2FLIA 4XKYB 4GZJA 1PKNA 4HQVA 5A8GA 1A5NC 4ROPA 5G2HA 3R2GA 4H6QA 1YNYA 2REQB 4AYSA 4DYJA 1E6ZA 4HNVA 1KRBC 1HKIA 1VBGA 3KCJA 1W2VA 1UP2A 3FS2A 5EBAA 2EPOA 2O0TA 3A5VA 3UQNA 2NLIA 1TA3B 2XIOA 5FEXA 4NX5A 3KL0A 7ODCA 3D46A 4HNNA 4JTFA 4U31A 4J9JA 8XIAA 5IFPA 1K8XA 3CJPA 3P0XA 3VOFA 4OUIA 2DU2A 1A3XA 4PCPA 1PEZA 4TR9A 4ZO7A 3UZZA 3ITCA 3DHDA 4RDWA 5HMDA 2W92A 5LNWA 1JNDA 3DFTA 1E6SM 3BCFA 2D0FA 3I3DA 1ITUA 4E3VA 4IPPA 2V69A 3H7VA 4DJDC 3WQVA 2I5GA 3W1TA 2X1IA 1ZRQA 4L80A 4GE8A 1NEYA 3ZSTA 1W1B1 3MUZ1 1Z8AA 4N7QA 3GKAA 3G1AA 3F4WA 1F8MA 2GVYA 1AQMA 1VPQA 4F9DA 1YPFA 4RV8A 5CPNA 4J3WA 1JFHA 1JCLA 4HTBA 5DT7A 1FWSA 3UFYA 4QE1A 1M1BA 4KCTA 5DELA 1EZ2A 3ARVA 4ERGA 2RKXA 3MMDA 2ZX5A 2Z1VA 3E38A 3AXXA 1KWKA 3AUOA 4LU0A 3L4XA 1SO4A 3GNRA 2MNRA 1AH3A 1VJSA 1TPDA 1W1IE 4UZUA 1EPVA 3DC8A 2D1ZA 2OSWA 4Z42C 1NP0A 1RP8A 4EWJA 4JQ1A 4M6VA 1OFQA 5HPCA 1I60A 3VMNA 1QOPA 1VGAA 2DQXA 4XAPA 1R3VA 1Z6KA 1N8FA 1CTNA 1ISVA 1BSIA 1JXKA 3AWNA 1BRLB 4LY8A 3TTOA 3QQ0A 5FF3A 2NSXA 4FLOA 3ZR4A 2D0GA 3BO9A 3U4FA 1LBLA 4B3LA 3VE9A 1XCFA 1EQPA 3EDEA 4DAIA 1BXBA 3CGTA 2HK0A 2XUCA 4L61A 1QPKA 4IZGA 3SRKA 2YDRA 3H53A 2GUBA 1Q2SA 2QHAA 5C0QA 1S2CA 5FESA 1FH7A 4HZ8A 3LY0A 4NVTA 2BY2A 2H8XA 2WMIA 4GVIA 4ZQPA 2PWGA 4ZXLA 4WOZA 3PUOA 2NT0A 2QDEA 3W86A 4P8WA 1PZ2A 3WEOA 3IV8A 5AKQA 4D6CA 2ZC8A 4CCDA 1D9EA 4HG6B 4DLMA 1QHOA 2EPKX 3LSCA 3VX1A 3GXFA 4IX0A 1RR2A 4HSNA 4MFEA 1H2JA 2EKCA 2VC7A 3GHRA 1HL2A 1OG6A 3GTHA 1W5NA 4AD5A 5H8MA 4DWSB 3JZUA 3NIYA 1BYAA 2OT1A 4IMGA 5REQB 4US5D 1O5RA 4HA4A 1Q45A 1SR0A 1I4NA 3GR4A 3WL1A 5C9XA 2E28A 4MAVA 5DRCA 4AVFA 4JXCA 2EHHA 3UYCA 2IPJA 4CD5A 4N0RA 1JRBA 2DH3A 1I9CB 1W9XA 1QNOA 4XIMA 2GDQA 1V0LA 3FVMA 2RDXA 4XUGA 2C14A 3WQGA 3SUVA 1DTNA 3W1QA 2CITA 1WXJA 1CGXA 5DLCA 3UA3A 3P8JA 4FX8A 1KM1A 1QBAA 3W82A 1QK0A 1G4SA 4V27A 2C0AA 4YTRA 3FDKA 3CB8A 2BHZA 3PBWA 2H3BA 5DBUA 5ABFA 4DAFA 1CXEA 1KFWA 4Z1AA 3OJGA 3WUGA 3KRBA 4GC3A 2OWWA 3W75A 3GR8A 2E3ZA 1MXGA 4ADTA 5CC3A 3DENA 1I1WA 2GFTA 3FA4A 3BURA 3AIRA 4LUTB 3W28A 3SGGA 2OB3A 4HJWA 3O63A 1HJVA 1XG4A 4H9YA 4PSRA 2BHYA 4IJBA 4NAEB 4QJ4B 3E5PA 3TFCA 4QNEA 4IQJA 1CCWB 3KRSA 2PU0A 3H2NA 1QAPA 2PLCA 1JDFA 5EU9A 3AOFA 4MF4A 2QULA 1EC8A 1OD0A 1S5WA 1K70A 4H00A 3PJUA 3W87A 4JFTA 1KRCC 3IIVA 1WZAA 3VMPA 1DVJA 3BLIA 4S38A 5JH2A 1DJQA 2ZIDA 1BWVA 3CB3A 2NT1A 4PB3A 4WF7A 4TXEA 1YDYA 4HK7A 2XWEA 2YL6A 2A79A 4DZAA 4TMCA 5K9CA 3ABQA 4F66A 3BXWA 4ACZA 2WSPA 3FKKA 1DE5A 2E67A 5BRBA 4CN4A 4FK9A 2WW5A 4FNPA 1EEPA 2PDKA 2PDBA 1WZKA 3H2CA 4QP0A 5FAJA 4E5TA 1ZJAA 4PC8A 2PU1A 4ZENA 5K3VA 3STPA 1XGEA 4X63A 3CMGA 2PDNA 4W5ZA 3W23A 4UTHA 3EOEA 3BLPX 3U7BA 4ADSA 4HPGA 3LLFA 3S83A 2QV5A 5E5CA 5DMLA 2JFEX 5KEZA 2OEMA 4OZOA 1UWAA 1E0UA 2ISSA 1XS2A 1TVPA 3CS2A 4H7VA 2BVTA 3W53A 4NXSA 2WZEA 4RUBA 1SJDA 3FHQA 3PUDA 1EF3A 3N19B 3F03K 5CG7A 2NQHA 1OSEA 9XIMA 5A6MA 3ARYA 5CSUA 3OVRA 2BOEX 2OWXA 3SN1A 3O6CA 1F4AA 4MZ8A 2VM8A 5KZEA 3RPTA 2CNCA 3PHAA 3VIOA 4B4HA 1WXYA 4AW7A 4NL1A 2BODX 4UMCA 3TUUA 1R3TA 4JQ4A 3GSMA 1WE5A 3GBEA 3KRZA 1W1TA 5LHEA 2GGGA 1XISA 5F2GA 1GZ1A 3A47A 4HNOA 4BI5A 3S5YA 3IJ7A 4DJFD 2XIBA 3QGAC 4ENLA 5IXEA 1I2OA 1R30A 2BVWA 1OYBA 1DOSA 1RALA 1NM9A 4H83A 5B7ZA 3RGTA 5KZMA 2CETA 3N4FA 3N2OA 2MUCA 3MHGA 3N11A 4IMEA 2ZUVA 5I3KA 3H23A 4NJGA 3I3BA 1SJBA 1TCMA 1L0PA 1K3UA 4CD4A 5EL1A 4NASA 1F7BA 3V1HA 3DKLA 4QEHA 3GDLA 1KKRA 2PURA 1KCKA 3FX4A 2QCNA 4JIPA 1TWWA 2GL5A 4B2DA 3LU2A 2PDMA 2PDWA 3W2UA 4H01A 3OGRA 1RAKA 3BK0A 2E1WA 1YMYA 4BR1A 5CZSA 1OINA 1J0JA 4FX7A 6REQA 2PRHA 3MV11 1H41A 4UOZA 1OK6A 1Z89A 2X41A 5BZAA 4ECLA 5A5WA 1OC7A 2YL5A 3WLOA 1XFBA 4CU6A 4HK6A 5I07A 1W1ZA 3KOWA 2QMJA 3UR8A 3VIFA 3EDJA 3UWEA 1LM1A 1WP6A 2GOKA 5C9UA 1YDOA 2NW0A 1FH9A 1KFJA 1GOOA 4PGLA 5DT5A 3WBWA 3BG9A 3N29A 4AU0A 4JTRA 5FJRA 4BHYA 5LNSA 1VPXA 3FDGA 4LS2A 3MYPA 1BG4A 3UJSA 2UWFA 3M5XA 4IICA 2WANA 3RITA 3WLSA 1A5UA 3N15A 3IANA 4GXWA 2IKGA 3C2FA 1TQJA 2E25A 2PS2A 3UG8A 4K7VA 4BA0A 4IIHA 3LDVA 1TV3A 3TMQA 1RZMA 2O4MA 3BZJA 1XD0A 1ONXA 1J6PA 1JCYA 1P0DA 4KPLA 4HJFA 3U7VA 1L8NA 2HS8A 3L68A 1AJ0A 3CQIA 1E9IA 3CYVA 3NQVA 1J0IA 4NZFA 2FJKA 4F0SA 1E1CA 3QRHA 4TOQA 3CL7A 4Q6XA 1J2WA 5GNZA 4RE2A 3SUTA 4AIOA 1LLWA 5FEPA 1V8EA 1GKRA 7TIMA 1UWIA 5AYBA 3ZZ1A 4EX4A 3MDWA 4Z1CA 4LAZA 5HMSA 3SFWA 4MWAD 4F79A 4EK7A 3OA5A 1H63A 3GXIA 5G2IA 3HG5A 1E4MM 3SGUA 1AVAA 1J79A 3B4YA 3ZVIA 4MPQA 1PUDA 2J24A 3O6AA 2DORA 1L6YA 2X8RA 1UZHA 4DUXA 4H8VA 3OVQA 3QC3A 2QJJA 2CWXA 3W74A 4F0HA 2EPLX 4P7LA 2ZTJA 3FW6A 3DHPA 3MC5A 1PAMA 4Q4RA 2PA6A 1WDDA 3G1VA 2J47A 2EPNA 3H22A 3ARXA 1Q13A 4XO6A 2DPEA 4CNNA 1ISYA 1XLFA 2P53A 5PTDA 3TC3A 5I78A 2NUXA 4PRWA 2Y88A 3CU2A 3HFYA 1GJUA 1UR4A 1IEXA 2Y63A 4IIGA 2I16A 1S2WA 3CH0A 3SQMA 7A3HA 1XLDA 2DQWA 4HK5A 1A5OC 4WSHA 1JNEA 1AD1A 3MZ2A 4GD0A 2P10A 2QCDB 2W9MA 3NXLA 1EO7A 1RA5A 4GUFA 1VEMA 3T0AA 1B4KA 4HCLA 4G5DA 3VNYA 1YYAA 4HNTA 3ALFA 1HXJA 1D7FA 1DWAM 2OQHA 2UZ9A 4HP5A 4GIRA 2HDJA 3DAQA 5TNVA 4KFNA 1RY0A 1OX4B 4ZCWA 4E2BA 4JDBA 2CHRA 4GHRA 2XIQA 1O7AA 1QDSA 1D3HA 1LL4A 1LQAA 3BUVA 2JKAA 1VB9A 2CU0A 2R1NA 2OSXA 4JFSA 1PX8A 1G9HA 4C6DA 3JVAA 1RK5A 2J79A 2ALDA 1OT1A 2V67A 1EL3A 4V2XA 4Q8TA 1BSLA 1WDSA 1GVYA 1EO5A 2VEIA 4U2ZA 1Y65A 4FOJA 3M7SA 4WDXA 2BGSA 3UWZA 5F7UA 1TVLA 2EG7A 3VNKA 2ZZ6A 1EBGA 2OZ8A 2YDAA 3GO2A 1GVIA 1R9YA 1XP3A 1FH8A 1ECQA 1GZJA 3IS4A 1X97A 3N25A 1KBLA 5G1TA 4GACA 4F0KA 1ZBVA 2OLSA 3SUUA 4PBGA 4X3ZA 3W7LA 2OKOA 3EXRA 1CZ1A 2NVAA 4LYRA 1SPQA 1Y0EA 4OBTA 1QR7A 2HROA 2C71A 3VNLA 3VYLA 3EPNA 2CLEA 3TYUA 2TYSA 4I9TA 1QPNA 4RDVA 1X96A 4MB5A 2HMCA 3WJWA 3W7CA 3RO8A 2I5IA 4AHOA 2HEJA 4C6EA 2CHNA 3GAYA 3VGBA 8A3HA 2PUZA 2Q02A 3L0KA 1DJGA 1PZ1A 1LYXA 3MWAA 3FN9A 3G0XA 2WMHA 2CW6A 3WLNA 3B40A 2DZTA 1G01A 3KFTA 2H9AB 4I7UA 1NELA 2A3LA 3L21A 3NOEA 2ATSA 1UIOA 1KRAC 5KETA 4KIEA 4C6MA 5I0DA 1W3TA 1ITQA 1I8JA 4W7VA 2ODOA 5GPRA 3NPXA 3V0UA 3MDUA 1J5SA 3BICA 4PFHA 4LNCA 1KV8A 1ZP3A 4X61A 1UA3A 4EP8C 3QY8A 4FAMA 4GQ0A 2AMXA 3A3WA 4D6EA 3CT7A 2WOQA 1F3WA 3CQ0A 3CZEA 3MA8A 1Y5VA 3GIQA 2DIEA 4Q8OA 4OWGA 4XBJA 4FP1A 3UVAA 1R7OA 1IT8A 1BEUA 4X22A 3EOSA 5D9PA 1M7OA 1O6IA 1R0MA 3TTQA 1VFFA 4LNYA 4HVXA 5ECUA 2GJXA 1VYRA 1XGDA 1TSIA 4HU0A 5TBOA 4MLRA 2A5HA 3AICA 3MI3A 3GUWA 3S4TA 4D9PA 3KX6A 4NF7A 4M56A 3VNZA 1NF7A 2CBVA 1W54A 3QF0A 2AQWA 4RZBA 2J7CA 4YPJA 1PWMA 3G22A 1CXFA 3PPCA 2XN0A 2CXGA 1HP4A 3ARTA 5CPMA 1QRQA 4GUJA 1GVQA 4MWAE 4XQ6A 3AIWA 1UKSA 1S1PA 1HNYA 3XIMA 2QV4A 3RLGA 5DX7A 1EIBA 2C3ZA 1JULA 2CC0A 4K68A 4B15A 1TTIA 2P1FA 4GKLA 2AGKA 5A6AA 3H12A 4DI8A 3RCYA 2OO6A 2GJLA 1XYAA 2A7NA 3TSMA 3M47A 3T9PA 2BLEA 3IK4A 4HBKA 3COTA 1TWZA 5FSDC 4HD5A 4WJEA 1R86A 4NUWA 3WBAA 3EYPA 2VD8A 1NARA 1RV8A 4DO7A 1HL9A 1UC5A 1RQBA 2HWGA 2GGHA 3ZS4A 4XZBA 1A5AA 3RX3A 1E3ZA 3TH6A 2E5CA 3UNTA 4L56A 1OCBA 3WMSA 3DYPA 1ZB5A 1P7TA 3LHZA 3MSYA 3W85A 5A3HA 1JCJA 2JQXA 1U5JA 1SZFA 4TX8A 1KNWA 2DV0A 1DHPA 1ME7A 3OHMB 3WG6A 4OTKA 3P61A 4LUYA 3GS6A 2OOGA 3ZT5A 1X1NA 2HPMA 1W2PA 1W3HA 3SQSA 3Q67A 3PFRA 3PNZA 5FF7A 1NWRA 3GU9A 3K1DA 4AX6A 1TUXA 3SR7A 3UNDA 2F6XA 1WAUA 1L6FA 4HPXA 4IJRA 1R2RA 1GHRA