3GH4A

Crystal structure of beta-hexosaminidase from paenibacillus sp. ts12
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
519
structure length
507
Chain Sequence
HHHHSSGLVPRGSHMASMSQPSILPKPVSYTVGSGQFVLTKNASIFVAGNNVGETDELFNIGQALAKKLNASTGYTISVVKSNQPTAGSIYLTTVGGNAALGNEGYDLITTSNQVTLTANKPEGVFRGNQTLLQLLPAGIEKNTVVSGVQWVIPHSNISDKPEYEYRGLMLDVARHFFTVDEVKRQIDLASQYKINKFHMHLSDDQGWRIEIKSWPDLIEIGSKGQVGGGPGGYYTQEQFKDIVSYAAERYIEVIPEIDMPGHTNAALASYGELNPDGKRKAMRTDTAVGYSTLMPRAEITYQFVEDVISELAAISPSPYIHLGGDESNATSAADYDYFFGRVTAIANSYGKKVVGWDPSDTSSGATSDSVLQNWTCSASTGTAAKAKGMKVIVSPANAYLDMKYYSDSPIGLQWRGFVNTNRAYNWDPTDCIKGANIYGVESTLWTETFVTQDHLDYMLYPKLLSNAEVGWTARGDRNWDDFKERLIEHTPRLQNKGIKFFADPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords beta-hexosaminidase
publication title Molecular cloning and crystal structural analysis of a novel beta-N-acetylhexosaminidase from Paenibacillus sp. TS12 capable of degrading glycosphingolipids
pubmed doi rcsb
source organism Paenibacillus sp.
molecule tags Hydrolase
total genus 191
structure length 507
sequence length 519
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3gh4A01
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3gh4A02
4A4AA 1XV8A 2W67A 5E9AA 3WKZA 3VM5A 1UH3A 1UWQA 2FHCA 1CIUA 1J0JA 3T08A 3VGEA 4DWSB 4M8UA 4UQAA 4XZBA 1CECA 4S3JA 5BXTA 1GVYA 1WNOA 3SURA 2WBKA 1AVAA 5HBFA 5BRPA 4GI8A 1B90A 4S3KA 2XSBA 1QVBA 2BHUA 4B9YA 3OG2A 4HPGA 3FY1A 1MFUA 1JZ6A 2WZIA 4HA4A 2BVTA 5DT7A 1UUQA 2WW5A 3TTOA 2VRJA 1GQLA 3A47A 3WELA 2GVYA 4QP0A 2ZXDA 3QR3A 3OBAA 4AY1A 3OIHA 2DSUA 4AZHA 1LL6A 3CMJA 1VF8A 1XH2A 1E6ZA 3AI0A 3CUHA 2W92A 5AC4A 5D8ZA 4H41A 1EDGA 3ARTA 1Q6DA 1MW3A 1NOUA 2WVSA 5KZ6A 3UR8A 3T2OA 3VD4A 2EPLX 2Z1SA 3OB8A 1BPLB 2WMKA 5BROA 3O9NA 2VVNA 4YN5A 1N82A 2Y4SA 1OB0A 2FH8A 1FP8A 5ABFB 1OWQA 5IDIA 1W3JA 1B0IA 4W7UA 4U2ZA 1JI2A 1ECEA 1QBAA 2DIJA 2EPKX 2BHZA 4PRWA 3VU2A 1HNYA 2WZEA 5CGTA 1R86A 3PTQA 3ARXA 1ESWA 2W5FA 1A3HA 2ZUMA 4MTVA 5A2BA 2F2HA 2CIPA 3ZJ7A 4TTGA 1W3HA 3POHA 2EPMX 1CXKA 3MO4A 4BZYA 4U5KA 3EBVA 3VNZA 3ZOAA 1G94A 3J7HA 4DUXA 1PX3A 3MUZ1 4CN1A 1J0YA 1W2PA 2CHNA 1PAMA 3D3AA 3ZR6A 3PN8A 3ARVA 2E9MA 4UFKA 5A8QA 1HL9A 6A3HA 3OLGA 3QOMA 3WH5A 3W6LA 3MANA 1MW1A 2X05A 2EPOA 1TA3B 2CKSA 1L8NA 3AMKA 5E0FA 4CVUA 1UD8A 5LA2A 1JAKA 1HJSA 4JKKA 1JDCA 1V0MA 4D6FA 3WY1A 2X0HA 1SR0A 1MVYA 1JYNA 5IFPA 4NRRA 3D5HA 1JXJA 1M03A 1BFNA 1V6WA 2XVKA 3WN6A 5GQBA 1JXKA 2WHKA 1EXPA 4WIWA 1B3XA 4P7NA 3WFLA 2F61A 3ARUA 2WMIB 2J7FA 3SCNA 1UWRA 1R7OA 5A8NA 3GH7A 3CHCA 2PI6A 3SCQA 2EEXA 2ZUNA 1MW0A 4Z2LA 9CGTA 2BS9A 1IZKA 1AMYA 4MADA 2CITA 1X1NA 5I5RA 2RGLA 3N15A 2ZXBA 1ISVA 1GHRA 2VUYA 2VZTA 1V3IA 3BCDA 3ZQ9A 4BQ2A 4UOJA 1PX8A 2E9LA 1MXGA 2DSKA 4XZWA 1NWRA 2DSZA 4U5IA 4AD0A 2OWCA 4V28A 1EOMA 1EGZA 2O9RA 1CBGA 3SCVA 4MNJA 3WH6A 3AHZA 4UTFA 1BG4A 1WDPA 3WL1A 3AICA 3N18A 4U3AA 5I23A 1JFXA 3KEHA 4LPCA 5CJ5A 1UD5A 2XGIA 5I77A 5CXPA 4CCCA 1FP9A 4JKMA 4CN4A 4Q7NA 3IJ7A 1JFHA 1BYCA 5ABHA 2ZUSA 2WB5A 1OSEA 3N9KA 2ZWYA 5AY7A 1W1VA 1EQPA 4Z2IA 4C7FA 4B15A 3OLIA 8A3HA 2VCBA 4DM2A 1B1YA 4UOQA 5A1AA 1JF6A 2ZIDA 4BQ3A 2XVGA 2E8YA 3VIMA 3WMSA 4HOXA 2YDQA 1MQPA 2J7BA 2XPKA 2ZXAA 2D3NA 3L4WA 4NF7A 2FGLA 3K4AA 1RP8A 4J3TA 1US3A 3F5JA 5JIPA 4BCEA 1UWIA 2GJXA 5ABGA 1CXFA 2XFFA 1ISYA 2YJQA 2O92A 1VIWA 3RCNA 1LL4A 1BSIA 1E4LA 5IHRA 3AYRA 1LG1A 1W9XA 1GQIA 1JYVA 4LYRA 2AMGA 4F9JA 4UCFA 5M5DA 1FH9A 2C0HA 2VNCA 2CCRA 1CGWA 2PBOA 4F66A 3LPGA 4P8VA 4JL2A 1HF6A 1GW1A 1UKSA 3WF0A 3ZM8A 1EDTA 3GBEA 3A4XA 4HPHA 3WDRA 1H49A 4V27A 2DIEA 1JZ3A 1ZBWA 1UKTA 3UR7A 2WLYA 4QCFA 4AWEA 1UWUA 2WWCA 2D1ZA 2YA1A 4PMYA 1NQ6A 4K68A 4MAVA 3AIUA 1QNSA 4NSBA 2QHAA 5FD0A 3VIIA 1JD9A 1J18A 1PBGA 2G3NA 1VJSA 3WQ5A 2J75A 2DSWA 3SUWA 3A3HA 3VIOA 5LA1A 4HMCA 4UZUA 2JALA 3T0BA 5CLTA 2XJ7A 2XYLA 4W8AA 2V5CA 4GPNA 3W26A 4ACYA 3AS2A 2CBIA 3ZSSA 1YHTA 3CHEA 3CZEA 2PF0A 5BCAA 2UY4A 2ZX7A 3FW6A 1CGVA 1UD4A 4TTUA 1XYZA 4D6GA 3WENA 1C8QA 4J3VA 1QI2A 2G3JA 3WD0A 1JYWA 2XFYA 4PSRA 4PYSA 4NRSA 1Q6FA 4H8VA 3W24A 5JUVA 2XTKA 2YDRA 3HMCA 1E6QM 2HISA 1HKKA 1V6VA 1UR0A 3DYOA 2G3MA 2CKRA 4X0NA 1ZU8A 2ZX5A 1TR1A 4M56A 1TCMA 5EBAA 1B31A 1V3KA 3B8SA 1UHVA 3EYPA 3WMBA 1QI0A 2QPSA 1V3JA 2PWHA 4E8DA 3EDFA 4P8XA 1FH7A 2VQUA 4PN2A 3EDJA 4W7WA 5FCZA 3CHFA 2VT0A 1V08A 5E6YA 3WBEA 1PX4A 2PWGA 3WUBA 3BGAA 5FIPA 4J27A 2ZWZA 1E1EA 2GFTA 3GXDA 5ABFA 3VGFA 2DT0A 4XX6A 5A8MA 3WD4A 1ZBVA 4GZEA 4N0RA 1EA9C 2WVTA 3WNKA 1WDSA 2Y8VA 1B3VA 4F79A 4OZOA 3A6OA 3HN3A 4PEEA 2XIBA 2J8FA 3AIQA 1CWYA 3CUGA 3NDZA 4CUCA 4JKLA 5A6BD 1UYQA 5E6ZA 1E9LA 4KH2A 3VM7A 2BY0A 3WH9A 2YOCA 2ZUTA 2V3EA 3GTNA 3CO4A 1EO5A 5D9OA 3U5YA 4OBRA 5CPTA 4HP5A 2WVVB 3GYCA 2YL8A 1WB0A 4P7QA 3FAXA 2E40A 3KE0A 4P7OA 2XFRA 3A4WA 3T0DA 4CKQA 1C7TA 2EO7A 3AXIA 4GQRA 1XRVA 4UFJA 1CYGA 5A2CA 1U2YA 2NSXA 4GO8A 3BMWA 2VTFA 1M01A 3AHYA 2W91A 1UD2A 3DYPA 3W0KA 5LYRA 4WLCA 3ZSTA 2CETA 2BNJA 1OINA 2VRQA 1PPIA 4N42A 4H7VA 4KWUA 2Y8KA 3AXHA 5JIWA 5HXMA 1HJVA 4CGTA 3WQ8A 3GH4A 2CBUA 4ATWA 1E1FA 3ARSA 4YHGA 4WSJA 3WH7A 4F9DA 3VD3A 2WMIA 1CXIA 4MB3A 1WP6A 1E3ZA 1JI1A 1SYTA 2QF8A 1EHAA 1DEDA 4ATLA 1WDQA 4AD2A 3CZGA 3M7SA 1TVPA 4Z2JA 1GNXA 5M03A 3WUFA 3F5KA 2GUYA 1UR1A 4ZXOA 2VMFA 2XVNA 1HJWA 2JE8A 2G4FA 1FOBA 2WC4A 1CDGA 3IAPA 1VJZA 3AXXA 1UR9A 3LPFA 1HJXA 2OSYA 3SCOA 2AOSA 2UWFA 3W27A 3OLEA 3HJEA 3SUSA 8CGTA 4A3HA 4RE3A 6TAAA 3ZJ6A 1XSKA 1M04A 2OYLA 1BF2A 1VFOA 4J28A 4U2YA 1KGUA 1BLIA 1JDAA 2ZE0A 1JIBA 1DWHM 1CXEA 3AHXA 2JF6A 1HKJA 3WNLA 2J8GA 4HA3A 1QW8A 4KGLA 1CXHA 4QLKA 1J01A 1JNDA 3SCPA 2WHJA 3F5LA 4H04A 1KR0A 1KXVA 2GK1B 4JL1A 2DDXA 4AZ5A 1FA2A 2MANA 1QI4A 1XYFA 4HZ8A 2A3BA 3VD7A 2BVYA 2V3FA 3RIKA 1BHGA 3AS1A 1SFSA 1UR2A 1MYRA 4HA1A 3VGGA 4LXFA 5A6SA 5A8OA 3WD3A 2Z1KA 3L4UA 4L4PA 4PMRA 2X1IA 1J0KA 5EB8A 4J3WA 3BLPX 2Y24A 1BAGA 1JZ7A 2G3IA 2VCCA 5CPQA 2J7GA 2VO5A 2YLAA 1K6AA 2BVDA 2J7CA 3AYSA 2JIEA 3EDEA 3TTSA 1QNQA 4HZ7A 1JDDA 3PZVA 2HVMA 4CD5A 5CZKA 2WM0A 4W8LA 5D9PA 2OWWA 1H0GA 1O7AA 2E0PA 2VL4A 4WKFA 5BYWA 4AD5A 3M07A 2PWFA 1E6XM 3ZO9A 4Z2GA 1G01A 4AEFA 2VURA 4J3UA 1H3GA 3BLKA 3WFZA 1E4MM 3WQVA 2W4XA 2E9BA 2F8QA 1NM9A 1DHKA 5EFDA 1JZ4A 4EANA 1W32A 4PMNA 3UEQA 1V6UA 1ZBCA 3NSMA 5C71A 3MU7A 4M81A 1UA7A 2W66A 3EDKA 4CN6A 4GO9A 1QBBA 2D24A 4QLJA 1DWFM 4AD3A 2C7FA 3PTMA 3WEZA 1KR1A 2WHLA 4MJ2A 4X9YA 1TUXA 4KRUA 4B9ZA 5HOSA 2EPNA 1SMDA 1WZKA 4GIAA 3VX0A 5GNXA 4DWSC 1HT6A 1YQ2A 3ARQA 2BV9A 3ZMRA 4TOQA 3TA9A 3VKKA 4AIUA 4R5EA 1OGGA 4U3CA 2D22A 1CLXA 1VFUA 1PZ3A 5I79A 1VBRA 2FGZA 3CIVA 1VENA 1KBBA 1WDRA 1RPKA 3U7VA 3K8MA 1EH9A 4DUWA 2J7HA 3WMCA 3CZLA 2CERA 4R27A 3UETA 6CGTA 5DO8A 1K9TA 4AIOA 5FKYA 3PZ9A 1BQCA 3G6LA 5BXSA 4GI6A 5BWFA 4TXEA 1HVXA 2VVSA 3RMEA 3K8KA 3CTTA 4PTXA 3ALGA 1FHDA 3VMPA 3VX1A 2E4TA 3GNRA 2QMKA 3WF3A 1R87A 2Q8XA 1HXJA 1JG9A 1QNOA 3MS8A 3SCRA 1JZ8A 3T2PA 2X8RA 1E73M 3F4VA 1OD8A 2RGMA 2WMJA 2XM1A 3WDIA 5EFFA 1HN1A 3THDA 4J7RA 3DECA 4MNMA 4IPNB 2WKGA 1V3LA 1CLVA 1WZMA 3AZSA 1CGTA 3WDHA 1L0PA 1VRXA 3CUJA 2FHFA 1V6XA 1KFWA 4PMOA 2BY2A 1M53A 3AISA 3BAWA 3CZ8A 4TX8A 2GSJA 1OM0A 1OD0A 3VMOA 1W3LA 1J12A 1HX0A 1PIGA 1US2A 2D23A 1WAWA 4MB1A 3KZSA 5A69A 5M17A 4E4PA 3RM4A 3PTKA 4J3XA 1GHSA 5A6JA 2O9TA 1DTUA 1EIBA 1EO7A 3SCTA 2DPEA 4NI3A 1UR8A 3ZT5A 1X6NA 3WQ6A 1C7SA 1E4IA 1XGZA 3GNPA 3AQUA 3K4DA 3IAQA 2ZUWA 1HJQA 1Q6GA 3BAJA 3NSXA 2E3ZA 1BYBA 2BHYA 3GXFA 1A47A 4JFTA 3FHQA 5F7UA 4AD4A 4AZ6A 2D0GA 2ESCA 3RILA 2G8ZA 3WDQA 3FXYA 4LX4A 2WVVA 4W8BA 4BF7A 4QDMA 1BVZA 2CNCA 2X2YA 1KGXA 3CGTA 1G9HA 1AQHA 4WKHA 2UY3A 5A6AA 2XVPA 2X09A 3VVGA 4UFIA 3MSDA 3GH5A 2OLHA 3M6DA 1BYAA 3CH9A 3VIHA 2YA0A 3S2CA 3ARPA 1V0KA 3TTYA 4PMVA 4GZIA 1C3FA 1XH0A 2E8ZA 2VR5A 1XCWA 2VI0A 7A3HA 1JF5A 2XG9A 2BXYA 4WKAA 1OT1A 3CHDA 4OKDA 1VBUA 3ZR5A 3L4YA 1NWTA 4QCEA 3B9DA 3WH8A 2J7EA 4PMXA 1CPUA 4MPKA 1VFFA 4JCMA 1XD1A 1CEOA 1C90A 3DHPA 3WDJA 2A3AA 3SUTA 1KQZA 3VD5A 1BTCA 1E3XA 1NP2A 1U33A 1ZB5A 3WNNA 2UY2A 4MB5A 3MV01 4PTWA 3ZT7A 4P8WA 1E5JA 1Z32X 2ZX6A 4PUEA 5BXPA 3MMWA 3WD1A 3VDAA 1VEOA 1ZBKA 1ZS2A 3HU7A 5GNZA 1CGXA 3GDBA 3EMZA 4UQEA 3L4ZA 3SCSA 3TTQA 3TONA 4DWSA 1JZ2A 5DF0A 2PBGA 3TP4A 1KCLA 1FH8A 2NT1A 3PZGA 1GUVA 1V0LA 1QW9A 4PUDA 4QAWA 1VFMA 2YIHA 4AMCA 2GK1A 2D0FA 2YL9A 1E70M 2WCSA 3RPMA 3AS0A 4M29A 4D1JA 1FFRA 2V38A 1TG7A 3K46A 5A3HA 1JGIA 1I1XA 4H8UA 2VX4A 3MUY1 3B9EA 3ARRA 4WK9A 3OA5A 3CUFA 1UR4A 3AZRA 2WPGA 4D71A 1QNRA 4TVCA 4F8XA 3WNPA 3AIWA 4Z2HA 4BQ4A 4UQCA 4MDOA 2XHYA 1XHGA 3L2LA 1MXDA 1QOXA 2QV4A 2GDVA 2QMJA 1KGWA 4EK7A 4QLLA 1GVIA 3JUGA 1H1NA 3WBAA 5I78A 3SEPA 5JBDA 1TFVA 2D0HA 3K8LA 1BGGA 1E40A 2NW0A 3MUIA 1MQRA 1OIMA 4JHZA 4MB4A 2CPUA 3KWXA 3OGVA 1S46A 4XV0A 3GBDA 2CHOA 4RL3A 3BAYA 4MJ4A 1ZL1A 1R85A 3FNDA 2O9PA 4W5UA 4AC1X 4D6CA 4D6DA 1QI3A 1UKQA 3AMCA 3SUUA 4AW7A 5ABEA 2V5DA 2BY3A 1O6IA 3WQWA 5A6MA 3MV11 3VIJA 3U57A 2OSXA 4KMQA 3AJ7A 3QHOA 4TX6A 3NYDA 4OBSA 2BFGA 2PWEA 1EQCA 1QHOA 3FHAA 4JZ5A 1HVQA 3N04A 1P6WA 3E1F1 4AZCB 3SCWA 3EDDA 3M46A 2D20A 2DH2A 3WEMA 1ISXA 1CXLA 2DT2A 3WEOA 1E55A 1W9UA 5C70A 4UR9A 5CLWA 3IJ9A 1ZJBA 4AZ7A 1EDQA 1TA3A 1CNVA 3BAKA 1EOKA 1J10A 2ZUVA 4P8UA 4ZENA 1GQJA 2FHBA 4IM4A 4MNKA 4JCLA 4OJYA 2YL6A 1JNEA 3ARZA 2J79A 1E5NA 1C8XA 2G41A 4GI9A 3L4VA 1XSIA 1V02E 1V0NA 3O6AA 4IPLA 5E0CA 3I3EA 2W62A 4HTYA 2BXZA 1H11A 2J7DA 2WANA 1BYDA 3VILA 1X6LA 1E72M 4B3KA 1E0XA 2QLYA 3NDYA 3LPPA 3I3BA 2DT3A 4GKLA 4W5ZA 3GM8A 4XUYA 3WSUA 1J0HA 1XD0A 3AIRA 1W91A 2WBGA 4ACZB 1E43A 4WSKA 3VIKA 1MW2A 1GOMA 4LGXA 1H2JA 4D6IA 1GOWA 4AZBA 1F4HA 5AYBA 1EHNA 5DT5A 3W81A 4CCDA 3G6MA 1IV8A 2IXUA 4W89A 4V2XA 1V3MA 3N1AA 3NCOA 4HOWA 1DWIM 1R7AA 1GPFA 1Y7VA 3NJ3A 1I75A 2CEQA 2WLZA 1ISZA 1FHLA 1H0IA 1CZ1A 4CD4A 1B3ZA 4UFHA 3VDCA 4GXPA 2GJPA 1NOFA 2ZUUA 4YHEA 3W25A 3WF2A 4M24A 1KXHA 4FLSA 2Y5EA 3BSGA 4Z2KA 4E8CA 1MWOA 2WK2A 1VB9A 2FDMA 2CXGA 4TUFA 1ITCA 1JAEA 1UZ4A 4OIFA 4X0VA 2V3GA 3PZNA 3FN9A 1XH1A 1K9EA 1OBAA 1VEPA 4P7RA 3PZTA 1H41A 1D7FA 2EXOA 3PBGA 2J4GA 4GQQA 3GNOA 1W9BM 5CSYA 2WWDA 1UQYA 1W9VA 3T0AA 1RP9A 1KCKA 3RJXA 1ODZA 4CCEA 1VAHA 4HU8A 5FL1A 3PHAA 1LWHA 5CSUA 4D6HA 2A3CA 2DT1A 1UH2A 3AROA 3RM9A 4DWSD 4HOZA 3PZUA 4FLQA 3W38A 2CBVA 2WHMA 3MMDA 3AMDA 1UA3A 5I6SA 4FF5A 1W9PA 3ZT6A 4M82A 1IT0A 1OCQA 2WNWA 1PZ2A 3QHMA 4FMVA 4ZXLA 1HP4A 2WCGA 2X0YA 4PCSA 4UFMA 4BS0A 4B3LA 3ARYA 1E4NA 5I0DA 4AISA 4EE9A 2YBUA 1W9DM 5HPOA 1W1YA 1G0CA 1NWSA 4A3YA 3AHTA 2XIIA 2WMFA 2WKLA 3NSNA 3VTRA 4MNLA 3ALFA 3VGHA 1GZJA 5I3DA 4M1RA 2VZSA 5JBFA 4PMZA 3OLDA 1C93A 5FL0A 1GONA 3N13A 5C8BB 2ZX9A 4YPJA 3W6MA 3ECQA 5A8PA 3POCA 1WO2A 1E6RA 1LJYA 2VCAA 2VX5A 2WC7A 2OYMA 4W87A 1WKYA 1QI5A 1W3KA 2Y2WA 2XVLA 3CBWA 3B9AA 1NARA 3NUKA 2ZICA 3TOPA 2J47A 3CMGA 4UNIA 4MDPA 4PTMA 5I2UA 5IXEA 3WF1A 2DSVA 1UG6A 3N11A 4UFLA 4OUEA 5AYIA 3AS3A 3PZQA 3IANA 4D72A 1UWTA 1JYXA 3PZOA 1KBKA 4U33A 4D1IA 3WNMA 5A94A 2ZXQA 3WL0A 3GXIA 1LF1A 2PWDA 3AIVA 1K9DA 4GZJA 3U5UA 3VUPA 4NZCA 4CD7A 1B2YA 1BVNP 1E71M 3UCQA 5A6KA 1GOKA 3QHNA 4UQ9A 3WD2A 2VC9A 3N17A 3DHUA 2VZUA 5A6BA 2XSAA 4QFUA 1TVNA 1CGYA 2ZX8A 4KRTA 4WF7A 5A95A 4DUVA 3LMYA 2JEPA 3OGRA 3ZIZA 4PBGA 2JIWA 1W1TA 4IISA 1J11A 4PTVA 4AXNA 4HMEA 2WVUA 1B3WA 1UD6A 3BC9A 1CTNA 1DWGM 2YDSA 3U7BA 4HU0A 4C91A 4W7VA 3BAXA 3VO0A 4JFVA 2J78A 1UWSA 3LPOA 1QHPA 4AD1A 3BAIA 4C7GA 1TZ7A 3L4TA 4Q22A 2O9OA 1Q6CA 3EMCA 1WCGA 2YLLA 4WJXA 4CU6A 4H2CA 4OOZA 2XUCA 4W84A 4CD6A 5EMYA 3IJ8A 2EJ1A 4L4OA 3MMUA 3T09A 1RH9A 4BQ5A 3AZTA 1C92A 3BSHA 3VGDA 5E09A 1H09A 5IHSA 1JD7A 5ECUA 1NP0A 4P7LA 3W4RA 1NOWA 4AZCA 1LWJA 2A3HA 3MSGA 4GINA 2OSWA 5CG0A 2NT0A 3I3DA 1HL8A 5D9NA 1Q4NX 5E70A 3ARWA 1GOOA 1HIZA 3W37A 3AMLA 1UH4A 1QHZA 1QNPA 2WMHA 3CZJA 4AZGA 1E6SM 2VJXA 4PCTA 4W93A 1UD3A 2A3EA 3CZKA 4CU7A 2IXVA 3AHVA 1KWKA 4CD8A 3T2QA 5DFAA 2GJRA 1V6YA 2WSKA 5DEZA 1E0WA 5A2AA 4ZFMA 2IUZA 4IUGA 3KL0A 3RDKA 2AAAA 1ISWA 3L4XA 3AIEA 1V3HA 2W61A 2WCAA 1J0IA 4TVDA 3CLWA 1AQ0A 2YA2A 2DH3A 1W1PA 3KL5A 1WZAA 3ZJ8A 3GZAA 2FH6A 4URIA 3VNYA 1JL8A 1KWGA 1WPCA 3NIYA 1PIFA 1CENA 4PMUA 4TVUA 2JF7A 2WAGA 4W86A 4MAZA 1LL7A 3WUEA 1DWAM 1KXQA 4CVWA 2J74A 2J62A 4PMDA 1B30A 1MFVA 3VPLA 2GDUA 1J9YA 4ACZA 1PEZA 3APGA 3L2MA 2J25A 4JHOA 1E6NA 1UOKA 2VZVA 5TD4A 4PMQA 1OT2A 3A4AA 2QPUA 3VDBA 1UQZA 1E56A 1GQKA 3VMNA 4J3SA 1HKIA 3W53A 1WE5A 2XGBA 2DQXA 3UG4A 1D2KA 1E6PA 1ITXA 1HP5A 2WZHA 4LYPA 3QGVA 1XC6A 4U31A 1HKMA 5GPRA 1GORA 3PZIA 3UESA 2VOTA 1NWUA 1NH6A 1GCYA 4W88A 1U30A 1LLOA 2JEQA 2DEPA 4JFUA 1IZJA 3WF4A 1B3YA 1F4AA 3QOKA 5CGMA 3SCUA 1PJ9A 3UG3A 3FAWA 5LA0A 1DWJM 4UQDA 1AQMA 5D4YA 2EQDA 4H8HA 4JFWA 3WNOA 5M3WA 3BXWA 2OYKA 2VQTA 1VEMA 3VIPA 4DM1A 2WMGA 3VIFA 1C8YA 2PB1A 3CPUA 1M7XA 1OGBA 4D6EA 3K1DA 7CGTA 3W29A 2XWDA 1E0VA 2CYGA 3W82A 3IK2A 1KQYA 3WQ4A 3MKKA 2TAAA 2WSPA 2YL5A 4ZE4A 4JFSA 2PC8A 3AMGA 1GJWA 2WYSA 4RE2A 1ODUA 1C91A 3AOFA 3SUVA 1XCXA 2J77A 2W63A 1I1WA 2YBTA 5HPCA 2YKKA 1XSJA 3SIMA 2B31A 4M80A 1LG2A 4W85A 2D2OA 3WIJA 3THCA 2V3DA 4Y7EA 4RE4A 5DMYA 4CU8A 1BGAA 4C7DA 4FK9A 2ZOXA 4C90A 5KEZA 1KXTA 4LYQA 5D9MA 3UG5A 1QPKA 2VX7A 4ATDA 3VIGA 3UERA 5D8WA 3RO8A 1UKOA 2D3LA 4XB3A 5HNNA 3OZPA 1H4PA 3DC0A 4HZ6A 3PZMA 4ZEPA 1G5AA 5GNYA 1BG9A 1OGSA 1ZJAA 4AIEA 1GJUA 1OIFA 3S6TA 3OZOA 5JBEA 2BY1A 1GOIA 2VR4A 1DP0A 3W28A 3WDPP 5I24A 3ZJKA 3II1A 7TAAA 2CESA 4EKJA 4PSPA 1HJUA 4HMDA 4OOUA 2XWEA 5CQ1A 3VGBA 3OGSA 1JZ5A 4LQ1A 5BXRA 1UZ1A 1Q6EA 1WZLA 3CUIA 1RD6A 1GOQA 3VOCA 5BRQA 2GJXB 4UQBA 2VZOA 1E15A 3VDHA 1D3CA 3MUAA 1B9ZA 1MQQA 4AZIA 1TE1A 1W2VA 4E2OA 2VRKA 5A6LA 3BH4A 4UZSA 1KB3A 1K9FA 4ML4A 1FFQA 3WUGA 2DGAA 1J0ZA 2VX6A 4FLRA 1UKPA 3VD9A 4D6JA 4JAWA 4ZE5A 2EBNA 5IFTA 4FLOA 5AC5A 3RJYA 3AFBA 1R8LA 4EAMA 3DYMA 3GXMA 3EMQA 2JFEX 1G1YA 4KGJA 2CBJA 2UY5A 3AIBA 1TMQA 1LQ0A 4B16A 1SMAA 4UOZA 5HDRA 3O2LA 4AYSA 5FOOA 2C8NA 3KL3A 3VINA 3RM8A 1V03A 3N12A 2OWXA 1H5VA 3BMVA 1CGUA 4AEEA 4BA0A 2WXDM 3BCFA 4JIEA 5CPSA 2XM2A 2WC3A 1V02A
chains in the Genus database with same CATH superfamily
3NYZA 4A4AA 2QDDA 3V1PA 3IRDA 3VM5A 1UWQA 4C6EA 2FHCA 3JVAA 1MXSA 3T08A 3UWYA 4JX5A 1IR2A 1A53A 4UQAA 4J2MA 4JTQA 3W7EA 4H9ZA 3IGXA 3A24A 4AIBA 5BRPA 4GI8A 1DORA 3NOYA 1QVBA 1M7OA 5T91A 4YTTA 3QZEA 1XYCA 3VCCA 3DEQA 1JZ6A 3PPFA 1HL2A 5FJJA 2WW5A 4CEXC 1TV3A 2GVEA 1JPHA 3A47A 3AUJA 3ZWTA 1ZP3A 4D9PA 4MKNA 1DJXA 3ABSA 3G77A 1VF8A 3E0FA 3CUHA 4FIQA 3NL2A 5BOOA 2XU2A 1NOUA 2YFNA 3T2OA 3LLDA 3OB8A 2WMKA 1A5LC 1N82A 4B2DA 3DZ1A 2FH8A 1OWQA 1EJUC 5IDIA 1UR3M 3TJLA 1WDWA 4U2ZA 1JI2A 3LRLA 1ECEA 3THAA 1JRCA 1DPMA 1E9IA 3UXDA 1W56A 3VU2A 2YX0A 4O4WA 3UP8A 1R86A 3VE7A 3PTQA 3ARXA 4GK8A 4O52A 1A3HA 2F2HA 2CIPA 1W3HA 3TFXA 3A4JA 4U5KA 3UBPC 1G94A 1FUYA 5MKGB 1YTKA 4HHLA 3UXIA 4EXBA 3ZR6A 4F0HA 3ARVA 1JDFA 1B4EA 3FLUA 3QOMA 3GVGA 3W6LA 3QPEA 1TJ2A 2OELA 4JIPA 1PHWA 3BANA 3NQMA 2X05A 3RLVA 5HINA 2CKSA 3WCZA 1L8NA 3KM8A 4JKKA 2XN2A 1VCVA 2X0HA 4KKXA 3FYYA 1IT8A 4ADSA 3N9SA 5D2VA 1A5SA 1VQTA 4NRRA 1SR9A 9XIMA 5HJYA 1RV8A 1M03A 1BFNA 3VOHA 1IZCA 2CLEA 5T9CE 1GYNA 3QTPA 4WIWA 1B3XA 4P7NA 1F3TA 5CZ0A 3ARUA 3O06A 3TFCA 2WMIB 3TE9A 3H7RA 2P0IA 1YIXA 3NXFA 5A8NA 5C7VA 3M0ZA 2PI6A 2ZUNA 1MW0A 4Z2LA 2BS9A 1IZKA 2ISFA 4MADA 5DXYA 4L5ZA 2CITA 4C1KA 5I5RA 3Q58A 3S3GA 1VLIA 1J6OA 1QW7A 1GHRA 3BCDA 1EWDA 3ZQ9A 1Q7ZA 3XIMA 1EJVC 3IIXA 1PX8A 2X1UA 3EKGA 1NWRA 2QCDA 3M47A 1O60A 2DSZA 4U5IA 2YFOA 4AD0A 2OWCA 3DOPA 1EOMA 3P62A 3GUWA 4S1FA 3BW2A 1V5XA 4UTFA 5CZSA 1WDPA 1J4EA 1NFPA 2EF9A 2G5WA 1JFXA 5CJ5A 4BK9A 2CU0A 2PURA 2QF7A 4XZIA 4Q7NA 1BYCA 4C5YA 5ABHA 1EZ2A 3KCJA 1OSEA 4QR6A 1K70A 2ZWYA 1EQPA 3R58A 4YIWA 4QEEA 1RXOB 1ITQA 2VCBA 1B1YA 3MCOA 4L64A 1JF6A 4BQ3A 2OQHA 3OZMA 2PDFA 1ZPTA 2PF8A 2E8YA 4TU1A 2YDQA 4F0MA 2D3NA 3G8RA 4DJFC 3L4WA 4YCPA 3CL8A 5GJMA 1TX0A 3EWBX 1CXFA 3QQ0A 1GT8A 2YJQA 4JTUA 2QCMA 1MMFA 3AC0A 3WLQA 4BF5A 1LG1A 2HS6A 3N6HA 1FHUA 4IJRA 4PTNA 5M5DA 4G2DA 3NPXA 4HNVA 2OZ0A 3LPGA 4P8VA 5CJMA 1HF6A 3WF0A 3BJTA 3NQAA 3A4XA 3W7MA 4QJ1A 4N9DA 4FNQA 4GABA 3WQOA 4HZMA 4NI8A 4MMWA 3NG3A 2P8BA 4B3ZA 1FVPA 3V0UA 1A80A 4K68A 2B4GA 2G96A 2QHAA 5FD0A 1PBGA 3L0NA 2DSWA 3A3HA 5I3KA 3VIOA 1ZZMA 1J2BA 4Y8EA 1LP6A 2HVNA 2QXWA 4JQ4A 2JALA 3RAOA 4LVAA 3BURA 5CC6A 2V5CA 4GPNA 3W26A 4ACYA 9XIAA 1H1YA 3M0XA 5BOEA 3BQ5A 4Z42C 2CBIA 3ZSSA 3CHEA 2DUXA 4QE5A 3AU2A 1A5CA 3HG2A 3RNDA 4TTUA 4D6GA 3WLPA 1C8QA 3R10A 5D03A 4QJ3B 3WD0A 4PYSA 1E51A 3LGDA 4E4UA 2NUWA 5JUVA 4KRZA 2EJAA 1H61A 2YCLB 3QF0A 2XTKA 2YDRA 2HISA 1HKKA 1VC4A 5AHLA 1AA1B 1V6VA 3EKLA 5DBTA 3IV3A 1ZU8A 3KLKA 3S0CA 2ZA2A 3GHUA 1N8WA 4IFKB 2ZX5A 4OUIA 4WCJA 4NY2A 1A5OC 5EBAA 2X42A 1B31A 3QVQA 1V3KA 1UHVA 3MCNA 3M16A 4Y90A 3EXRA 3HGOA 2QPSA 3I7RA 1V3JA 4E8DA 3EDFA 4P8XA 1FH7A 2GQAA 1PHQA 2Z26A 4O0QA 2VQUA 4Q8OA 2BWGA 1KLZA 3GRIA 3EOOA 5H8PA 1QO2A 3WUBA 5FIPA 1ZJIA 3PWAA 5ABFA 2FYMA 3O15A 1Q4WA 4C1NA 4XX6A 1ZBVA 4DF1A 2H9AB 4GZEA 4N0RA 2BOEX 4LV4A 4F79A 1B3VA 1CB7B 4MY1A 4OZOA 5BRBA 5LGZA 1EZWA 1M7PA 3B0PA 4M7SA 1TQJA 5K9XA 3CUXA 5FJOA 1NDVA 4FZIA 4JKLA 2CXEA 4S2BA 5E6ZA 2HMCA 2B7NA 4KH2A 3VM7A 3KS6A 4FNPA 3GTNA 4G7EA 4J9JA 2H3BA 3CO4A 2PGWA 1S2TA 1TCDA 3BSMA 2WVVB 2YL8A 3JR2A 3FAXA 3KE0A 1XRTA 4Q8WA 3INPA 3QR1A 2WNNA 4AY8A 3A4WA 2EO7A 4IIFA 4JYDA 4GO8A 4H9VA 1GK8A 3HGSA 3CLMA 3CK5A 2W91A 3HIJA 3KP1A 3PUGA 5LYRA 4WLCA 3ZSTA 4N42A 2PDCA 3LU2A 4KWUA 1PUDA 1Q8AA 1TWSA 1HJVA 4DJFA 2E67A 3U2CA 3WQ8A 3IGUA 2CBUA 3LBOA 3PVFA 1TPFA 4ATWA 4MZ1A 4TV6A 1VFTA 3NEHA 4WSJA 1QO5A 1TPDA 5F4XA 2TPSA 1OYAA 2ZC8A 2CZ5A 1L6SA 3NPWA 1TV5A 5LIYX 1S2UA 3GUGA 2C15A 5M03A 4EXAA 3WUFA 2Z0IA 1R3WA 3BLOA 2PDJA 4JICA 3KLLA 4WGHA 3LHWA 2GUUA 3RO6A 3IAPA 2WC4A 1DIDA 2PTZA 4C6OA 2AOSA 1SW7A 3G1HA 1YW1A 2X1RA 4J28A 1O68A 4ORMA 1JDAA 3UFYA 1CXEA 4ICCX 1FCVA 1HKJA 2PAJA 3IV8A 1CXHA 1JNDA 3SCPA 4LOCA 4ZOAA 1DKWA 1OYBA 3TROA 4EF9A 2DDXA 4AZ5A 1VYSX 4RZ6A 1XYFA 4PFMA 4HZ8A 4FI4A 2A3BA 3VD7A 2QUMA 3RIKA 4ZTYA 3WQGA 4I9JA 1EC8A 4PCFA 1S2CA 4RW3A 5A6SA 4FX6M 2ALDA 3CEPA 4IG2B 4J3WA 3W1TA 2RHGA 1X8FA 2NXGA 2QR6A 2DJXA 1BAGA 1EBHA 1FTXA 2G3IA 3STPA 2J7GA 4JGDA 1PVNA 2J7CA 3N3MA 2JIEA 3EDEA 3MP3A 3KCOA 2HVMA 1V7AA 4FA3A 1WBJA 3N2BA 5H8UA 1W1A1 3DDMA 3GTHA 1LYXA 3W85A 2R6OA 4Y9OA 2WQPA 4AEFA 3BLKA 3LERA 3WQVA 2W4XA 3WK2A 1NM9A 4MG4A 1DHKA 2BMBA 1JZ4A 2I14A 4R85A 1V6UA 5C71A 2F38A 4AHPA 1JUBA 2YZ5A 1H51A 2D24A 1IXPA 4QLJA 4IMGA 2C7FA 3UY8A 4DEFA 3WEZA 1XG3A 1XW8A 5H8MA 3G0XA 4X9YA 1EP1A 5HOSA 1MEWA 2EPNA 4GIAA 3CH0A 4LFYA 4TOQA 1OGGA 4NKCA 4U3CA 1R2RA 2RKXA 1VFUA 5K2ZA 3QV9A 1A3XA 4JS3A 2C13A 2IS7A 4WY0A 4I7WA 3TYCA 1EH9A 1RD5A 3OA3A 2J7HA 4IPPA 5AVHA 1MRQA 4QG6A 3SGGA 1XYMA 4AIOA 3PZ9A 1K4GA 3E2SA 3UJ2A 3SY1A 3KZPA 3TYBA 1OC6A 4GI6A 1ZCOA 2VVSA 2NUXA 3VOJA 3CTTA 5REQB 4IMEA 4YMZA 2E4TA 2FPYA 2QMKA 4O13A 1XYBA 3T2PA 2X8RA 3F4VA 1UIPA 3E5PA 5C7HA 3WDIA 5EFFA 3THDA 4MNMA 4BI7A 4WUIA 2WKGA 3C8FA 3H22A 1TJRA 1F8MA 1WUFA 3AZSA 1VBGA 1TSIA 3CJPA 3WDHA 4L61A 3FK4A 1RA0A 4M3PA 3CUJA 5IM51 1A5UA 1V6XA 1KFWA 1SUXA 4PMOA 3IPWA 3CZ8A 3O16A 3WLNA 4TX8A 2GSJA 1IWAA 3VMOA 2KAUC 2CZFA 3F4DA 4ZO8A 1SSGA 2POZA 3GU1A 1P43A 4J3XA 2O9TA 1GVFA 4FNUA 1Y5WA 5CBJA 3ENLA 4UR8A 1X6NA 3ABRA 4J4KA 2B81A 2DZWA 1E4IA 4X61A 3GNPA 2ZUWA 2ATMA 2DZAA 3GTIA 4I3GA 3UWWA 1EJXC 3KTXA 4JFTA 4YL2A 4DNMA 2RJGA 1XDLA 2PP1A 1G7VA 1KM0A 3PUOA 3RILA 3W7GA 4S3DA 3FXYA 4Z1DA 3S8HA 4RNFA 4ZQMA 4YTSA 3RLUA 2CNCA 2X2YA 2Z7KA 2C1GA 2ALRA 4I7VA 1K03A 4WKHA 1HGWA 4XZHA 5A6AA 2X09A 3N25A 3C56A 3GD6A 3M6DA 4HBKA 3RLHA 3FXGA 3V5FA 5AHEA 3LCGA 5HMDA 1T0OA 1EC9A 2VR5A 5DY3A 4XSMA 3UVAA 3O6YX 2P8CA 1VPQA 3TEVA 4O53A 3VKBA 3C2RA 2XG9A 1IEXA 3UYCA 1OT1A 3CHDA 3OVPA 4OKDA 1VBUA 3L4YA 1W5NA 4UNKA 3RK8A 1PS9A 1QASA 4ECLA 4MKSA 2XIQA 1TPUA 4M6UA 4INFA 4O1DA 3ZVHB 3GHTA 1IE7C 4QXIA 1IEWA 5HQLA 4FSAA 3LSCA 1CEOA 1C90A 4HU4A 1X8CA 3WDJA 2A3AA 1Q6QA 1PDZA 3VD5A 1BTCA 1E3XA 1U33A 1Z6KA 4PTWA 2WV8A 5LIWX 3Q94A 1E5JA 3MYOA 3TUUA 4S2CA 1Z32X 3I10A 3BVJA 3DBNA 1FWFC 1YADA 1Z7AA 4XO7A 3QYQA 1K8CA 1VCGA 4ZZ9A 4DBSA 1KCLA 1PWLA 2TRSA 1FH8A 3OW1A 4KFOA 1GUVA 5BW6A 1Q8JA 4AMCA 2YIHA 2PDNA 2GK1A 2YL9A 3W1LA 1W37A 3N29A 2WCSA 4KBXA 2DU2A 3ABQA 5AHMA 1TTIA 4D1JA 5CZJA 4YJ5A 5A3HA 4NAEB 1BWLA 4H8UA 1A4LA 1K6WA 1DTNA 3LCXA 2WOQA 3B9EA 4WK9A 5AN7A 2P0OA 1QNRA 7REQA 2GSHA 1WKEA 1XGEA 1SW0A 4LJ3A 4RCXA 3NQFA 3OPSA 1SZFA 2AKZA 4US5A 4AEOA 5J5DA 3P81A 4YCOA 3BPWA 4L9YA 1J2WA 3BG5A 1Z41A 1QOXA 3EPMA 3CNYA 3OTRA 2OGJA 3CPRA 5D30A 3WBAA 5JBDA 2D0HA 4I6VA 1MNZA 3SQLA 3MUIA 1MQRA 1OIMA 4E2BA 4JHZA 5JQ9A 4OBTA 1OFPA 2IPWA 4S3FA 3DFHA 4MJ4A 3USZA 1QI3A 3EX6A 5HMSA 3AMCA 4Y96A 1FWCC 3VNIA 5ABEA 1TE6A 2BY3A 3I6EA 5A6MA 1F9CA 3MV11 3EKZA 4NZ1A 1RA5A 4UIOA 1OX4B 5K3VA 3QHOA 3GE7A 4AHOA 2OX1A 1SZNA 2PWEA 5I02A 1M1BA 3FHAA 1HVQA 3N04A 1P6WA 4AZCB 1TJ0A 3EDDA 3SY5A 2FJUB 2D20A 1F74A 1CXLA 3TTEA 3NO5A 4J1OA 5C70A 2I16A 3MWCA 3ZLHA 2Y85A 3NNTA 4R88A 3BAKA 2D73A 3P82A 2VEPA 1J10A 1A5NC 2ZUVA 4P8UA 1QCWA 4JQ3A 2X7VA 1OF8A 3B0XA 4Q3MA 4RK8A 1QWGA 4ZENA 1QATA 3W84A 4IXXA 4TMCA 1GKRA 3NGFA 1JNEA 4HMNA 2YYUA 2NVAA 3URNA 3TQKA 1C8XA 4GI9A 3CQIA 3PWIA 1QOQA 4CEUC 3M9YA 1V02E 4CQAA 3C0QA 3O6AA 4N6EA 4XO6A 2PLCA 4FXSA 4GLEA 1KM5A 2J7DA 1BYDA 2NV1A 4NXKA 1JCNA 1E0XA 3LPPA 1GVQA 3GDMA 4ZR8A 3ZYZA 4XUYA 4PL2A 1DJYA 3CL7A 1W91A 3IGHX 3V1HA 1MW2A 3KFTA 3ABZA 4AZBA 3TW9A 4QJ5B 1UZHA 4IFRA 1JEZA 2O0TA 2OKOA 2WJFA 1UPMB 4HOWA 2VOMA 2QCFA 5AECA 3TNOA 4C6NA 3UJSA 3E49A 4UFHA 3GFZA 3W25A 2ZUUA 3WF2A 5G4EA 3IJ6A 4FLSA 2Y5EA 1AFSA 1DXFA 3GG7A 2CXGA 2FVLA 3QY8A 3TC7A 1ITCA 1FWNA 1Z42A 1VKFA 3C2FA 4X0VA 1K9EA 1VEPA 5HAOA 1FWGC 3RRAA 3ISIX 3M5XA 3B97A 3EAUA 2EXOA 3PBGA 1FRBA 1K77A 1W9BM 1VZWA 3N14A 1GYMA 1FWBC 1WXZA 3CUZA 1KCKA 2QQ6A 1OVDA 1H63A 4RUBA 4CCEA 1VAHA 3T1GA 3UVIA 4CQ9A 3PHAA 4FALA 4LNCA 4ZCWA 3RM9A 4O28A 4DWSD 4HOZA 4FLQA 1TO3A 2WHMA 1M9HA 4IH3A 1UB3A 1ONWA 3ZT6A 4M82A 4FHAA 3M43A 4ZXLA 2QIWA 2X0YA 4PCSA 4UFMA 4BS0A 4Y9MA 3AO0A 3AALA 4JTJA 4EE9A 3E74A 3ONCA 4P2VA 3SFWA 1XI3A 4A3YA 3QKZA 4GZ7A 2XIIA 3H4GA 3DX5A 2GVGA 2GOUA 3ALFA 5I3DA 4M1RA 3LXAA 2VZSA 4XBJA 5JBFA 4L80A 3N13A 5C8BB 4YPJA 3PWGA 1H1ZA 2QGYA 2EG6A 3H2CA 5A8PA 3WMLA 1E6RA 2VCAA 2VX5A 4O10A 2FJKA 3MW7A 3VFLA 4UTLA 3MZ2A 2PLKA 3QV8A 3CV7A 3SB0A 2XVLA 2OVLA 3B9AA 3CBWA 3MMTA 3HJZA 1EA0A 2G37A 3CMGA 1F6PA 4PTMA 5IXEA 4F2TA 2DSVA 3RPTA 1FHVA 4CNOA 1A5KC 4KWWA 2BG5A 1B57A 4D72A 1VS1A 2QDGA 3WNMA 2HEJA 3CMFA 3W7CA 2OEKA 3WL0A 1LF1A 1W3TA 4NYYA 3FA5A 3AIVA 4GZJA 5CC5A 2R24A 3DBPA 1O5XA 1DE6A 4I5UA 1AD1A 1B2YA 5D09A 1E71M 3UCQA 1I45A 5A6KA 5JXQA 1YDVA 5A6BA 4L9XA 3C0JA 4QFUA 4EPBC 1CGYA 2ZX8A 5SWUA 3P3BA 3GB6A 4WF7A 5A95A 3DFQA 3OGRA 2IPGA 1W1TA 3U2ZA 1J11A 4PTVA 4XD5A 4AXNA 2EKCA 4RDYA 1X98A 1UD6A 2YDSA 1I0BA 4HU0A 1EEPA 3VO0A 2H9AA 3NQVA 3OYZA 3LPOA 1RVGA 4DJFD 1OC5A 4Q22A 1ENUA 2NQLA 1Q6CA 3MP4A 1K7FA 3EWWA 1UOZA 4DJDC 1Y8BA 5C55A 4AX6A 1XDMA 4W84A 4CD6A 3DHDA 1V7YA 5EMYA 3IJ8A 2EJ1A 4L4OA 2GLKA 3MMUA 3T09A 2C3ZA 5KZEA 1XYLA 5E09A 3LS9A 2OQLA 2YXOA 4GC3A 1J5TA 1JD7A 3EWDA 4XAYA 1GG1A 5C9UA 1NP0A 2ZZ4A 4PUNA 4AF0B 4UTMA 1P5BA 4JNZA 5D9NA 3M44A 5I00A 3ARWA 4KQNA 1HIZA 1CX9A 3AMLA 1QHZA 2WMHA 3MCMA 1AK5A 1KCXA 4PCTA 2VR2A 4GIRA 3LUTA 3M0LA 2PU1A 1KO0A 2GJRA 1H7XA 4MZYA 3GVVA 1DYSA 5C9XA 1IIGA 3RU8X 4ZFMA 2IUZA 4JIIX 3TJ4A 4JX4A 4UMAA 3C86A 3KL0A 2AAAA 1J0IA 3SRKA 1RPXA 1AQ0A 2DH3A 3TQ0A 4GYFA 1WZAA 4LVBA 1F2JA 3SN1A 2Y5SA 1TWIA 3H4WA 1WPCA 4GUFA 1PIFA 1CENA 4PMUA 4DLMA 4POCA 4ICMA 1KXQA 1FXPA 1A4MA 3E38A 5BWAA 4B4FA 4ACZA 1YDYA 2ABBA 1E6NA 2ZZ1A 5JH1A 5DRIA 1OT2A 1D3HA 1WXJA 4IPJA 3DESA 1E56A 3R5EA 1AD4A 3P0WA 1KCZA 4NAFA 1VFSA 4DBUA 2HPMA 3LCLA 1F8IA 3IVTA 1E6PA 3Q2DA 2ZRZA 2DVUA 4H00A 4LYPA 3NQGA 3ERPA 3PZIA 3BLFA 2PZNA 3KTCA 3UESA 3W2KA 2VOTA 3PANA 3ES7A 1NH6A 3TC3A 5DMLA 3NZ1A 3B4YA 6ENLA 1SJAA 1U30A 3EPOA 3LCHA 4FAMA 4HSOA 1F4AA 2Z28A 3UG3A 1Q66A 2P10A 4UTIA 4H8HA 2WZTA 3ITOA 3LHZA 3UJEA 5M3WA 2JKPA 4DM1A 4G8TA 3KOFA 2E09A 2XH4A 3FIGA 4H9YA 1KFBA 4U4MA 2XWDA 1E0VA 3W82A 1KQYA 2Z7GA 4XTDA 2TAAA 2YL5A 4BR1A 1PKMA 3QLDA 4ZE4A 4JFSA 4HN8A 3SQSA 1K8XA 3XINA 3OHIA 3EA2A 3VOGA 3H7UA 1EB3A 1I1WA 2YBTA 3SIMA 4UR7A 4Q4KA 3BG3A 1P7TA 4IIDA 4WDXA 4RE4A 4IICA 3KCLA 5DMYA 4CU8A 4C7DA 3ES8A 4C90A 2BOFX 5KEZA 1DJWA 4KWSA 4LYQA 2VC7A 1KFJA 2OU4A 3RO8A 3TJIA 3OOQA 4MOZA 2D3LA 3F4WA 4G56A 2BGNE 5HNNA 2O4MA 4ZEPA 5C9WA 4PUJA 1NEYA 1OGSA 1ZJAA 3WQFA 4DJDA 1OIFA 2YDAA 3S6TA 1I2PA 1MUCA 2OXNA 5JBEA 1GYLA 3M41A 1WYIA 1R6WA 3WLTA 4Q4OA 6REQA 2W0UA 3TWAA 5DX7A 2CC0A 1HJUA 4OOUA 4NNCA 4DJED 5CQ1A 3VGBA 4A2SA 3OGSA 3W7QA 4FF7A 4H01A 1WZLA 3CUIA 1RD6A 4YWIA 4C5ZA 4GNKB 5BRQA 3EB4A 2FVKA 3BDKA 1X97A 3MUAA 2HTMA 1XBZA 1W2VA 5A6LA 4NJKA 4ML4A 2Z6JA 4JNYA 3WUGA 3DFYA 4GACA 2A3LA 3GAYA 4PB5A 2DZSA 3PJUA 3H7VA 4LUSB 3VD9A 4PMJA 1CW2A 1MSSA 4JX6A 4XBSA 3UXAA 3VC6A 4NASA 4ZE5A 5IFTA 1P6CA 3AFBA 4HN4A 2XZ7A 4Q6JA 3EMQA 4QSFA 1KTBA 2HQAA 4KGJA 1QK2A 2UY5A 3AIBA 3USBA 1BWKA 1TMQA 3OVQA 4AYSA 4S3GA 1PYMA 2C8NA 4X9SA 5AFDA 2J9YA 4JIQA 3N12A 5JU6A 3ATZA 3TAKA 1QPNA 4N2YA 1R47A 5CPSA 2XM2A 3V3WA 2W67A 1LBFA 1M65A 4L6DA 1XYAA 1ELSA 4H9TA 1CIUA 1J0JA 3WLHA 1ECQA 4M8UA 2HXUA 1XLGA 3G1AA 3MKVA 5IBXA 5M2FX 3SURA 4PRTA 3PJTA 3RR1A 3CAVA 1B90A 5H1WA 2P88A 3I65A 1M3UA 2BHUA 2O7QA 3VNDA 2HSAA 4HPGA 1MFUA 4JQAA 1AJZA 3A21A 4MSSA 1XLBA 4H8NA 4O8RA 5F4SA 3QR3A 3QZAA 4AY1A 1S1RA 3AJXA 4AZHA 7ENLA 3W7LA 1E6ZA 2Q3OA 5AC4A 4H41A 1EGVA 2HPIA 1MW3A 3S1GA 3RG6A 4G5DA 3H2AA 1KNWA 4GGBA 3O9NA 2XDFA 3HPSA 2V6AA 1KFKA 4H7ZA 1B0IA 4W7UA 3SRFA 4GUGA 4ZQOA 5G2HA 2DIJA 3LD5A 1OFBA 4O8AA 4TMBA 1IIHA 4PEKA 3R0KA 3BMXA 6PTDA 4GUJA 4US5D 4GVIA 2ZUMA 4MTVA 2CLKA 3ZJ7A 4TTGA 3POHA 2EPMX 5TQLA 4AFYA 5HQEA 3VNKA 1Q6RA 1RLCL 3M7WA 4FNSA 3MUZ1 4CN1A 1XPYA 3D3AA 4IP4A 5A8QA 6A3HA 3OLGA 3WH5A 3UZXA 2W3ZA 1S39A 2AGTA 2ZFAA 4DN1A 2QDHA 3GXTA 2EPOA 4ZGYA 1TA3B 1JAKA 1HJSA 3ZR4A 4MWAB 1TPVA 5DCBA 4D6FA 3KRZA 1MVYA 5CPMA 3IARA 2OR2A 1DXIA 3E12A 1AW5A 4WY0F 2XVKA 3WN6A 3S1XA 2WHKA 4L4MA 1EXPA 1EJRC 1VFLA 2WJEA 3NQ7A 3WFLA 2V63A 4J2PA 4ORIA 3A64A 3C52A 1W5PA 1ICSA 2HWGA 4ALDA 3PSWA 1SJCA 2ZBTA 3G1RA 3KAOA 9CGTA 1AMYA 1FKWA 3R0UA 1X1ZA 5KMYA 1PZ1A 3IIVA 4ML9A 1QJWA 1X1NA 3VZXA 2BX7A 3N15A 2ZXBA 2Y88A 1EUAA 3OIXA 3C2OA 4O15A 4RDWA 1V3IA 3WLIA 2OMAA 4BQ2A 2Q01A 4XG1A 4I8YA 4JTSA 4BEQA 2DSKA 3MZNA 4KEUA 3G1YA 2Z1XA 3EWYA 1W5QA 1K02A 1JGMA 3U0HA 1BG4A 3WL1A 2NX9A 3GC2A 4E2VA 1I8JA 4U3AA 4LPCA 1UD5A 5EPDA 3TZFA 5CXPA 4JKMA 3T8LA 4YTRA 1JFHA 1FWJC 2PDXA 2ZUSA 4ZSTA 3V0SA 4LY8A 4E2DA 2WB5A 5AY7A 3TW6A 5TAOA 2PDIA 3OLIA 8A3HA 1XISA 5T26A 1JPKA 3HGRA 3LMZA 2AL1A 3KBNA 4UOQA 2ZIDA 2D2HA 1WUEA 3WK3A 2VELA 3VIMA 3WMSA 4HOXA 1ZFJA 3BGJA 2J7BA 2XPKA 4N9CA 1YLVA 5FF0A 3D47A 1RP8A 3NQDA 5JIPA 2GJXA 5ABGA 3UWEA 1BXBA 4MUPA 4BJHA 5LIKX 5IHRA 1IEQA 1W1ZA 1W9XA 2D69A 1GQIA 3A13A 3W76A 3G1FA 2F9RA 4UCFA 8XIMA 2VNCA 4TIMA 1YPXA 2PBOA 1XRFA 1KM6A 1DQXA 1MDRA 4JL2A 4H6KA 4OGZA 3A5VA 3D0CA 2IPJA 1EDTA 4IHCA 4KFNA 4F2BA 3WDRA 3HPFA 4V27A 4LUTB 2F6KA 1R2SA 4DAIA 1UKTA 4AWEA 1N7KA 2YA1A 1HUVA 1AW2A 2ADAA 5XINA 3GFYA 4MAVA 3M5VA 3S2MA 4AWTA 1RVKA 4NSBA 1J18A 2QCEA 1J96A 3WQ5A 2J75A 4F0SA 2GGIA 4N02A 4JN8A 2EAWA 2XJ7A 2XYLA 4REQB 3IIPA 2GQ9A 2PZ0A 1EP3A 1K8YA 1IQ8A 1RJPA 3VNMA 3BCJA 4CNUA 3EPNA 4YWSA 1EBGA 2UY4A 3GVWA 1Q3NA 3FW6A 4N9EA 1CGVA 3OG3A 1XYZA 2R91A 5B80A 1TIMA 1V6TA 3FGCA 2G3JA 3S1UA 1JYWA 1JPDX 2XFYA 1NVMA 4PSRA 1H7OA 3H23A 3EA1A 5FF3A 1Q6FA 3P8IA 4H8VA 1AH0A 1VIZA 3SSJA 5G2IA 3FVMA 3GVRA 3W2MA 4FR1A 1X7IA 1OFQA 1XIBA 2CKRA 1EF3A 1R2TA 4LAMA 4LEQA 4HHHA 1KM2A 4E3TA 3B9OA 3GDLA 3E02A 5C9RA 3HV8A 3B8SA 4HTBA 4ZL1A 3TLLA 3T42A 2PWHA 1S38A 1U22A 2Z1WA 3SRDA 5K4XA 1WOBA 4PN2A 4W7WA 3PY2A 2PC4A 1PX4A 3UQNA 2PWGA 3BGAA 4K8GA 4O19A 3VNLA 4QRNA 5CAHA 2ZWZA 1E1EA 4PE8A 1JCXA 2DT0A 3C61A 3LY0A 4TQTA 1EA9C 2J9ZA 2VEFA 4MUZA 2QZRA 3WNKA 4J3ZA 2Y8VA 4AAJA 2OO6A 2VFEA 3A6OA 4JHMA 2XIBA 4FNTA 4ZVJA 3L68A 3CUGA 1CWYA 1ZP4A 4XVEA 5A6BD 1UYQA 3V5OA 1REQA 2V5BA 3E0IA 3ZLFA 2YOCA 2ZUTA 4NZ5A 4PUUA 4RV8A 5CBBA 1WOAA 4ZQNA 5D9OA 3U5YA 5CPTA 3VA8A 2RH9A 2QVNA 3GYCA 4X60A 1VJIA 3NZPA 4FB7A 2B7PA 1QPQA 4H1ZA 2E40A 1QTWA 2PRHA 3S1VA 4EAYA 3T0DA 4QE4A 2HDJA 3BMWA 4YS1A 3URBA 3QW3A 1ZAIA 2E5CA 4RR4A 4B90A 1OINA 4DBDA 3DI0A 2OEJA 4HJWA 3STCA 4D8ZA 1UJQA 3AXHA 5HXMA 2BBFA 3UWQA 2E6DA 3R1ZA 5EKYA 3P74A 4WOZA 4M6QA 2REQB 3OHMB 3WH7A 2QAPA 4NZFA 4ZODA 4WSHA 4WXYA 4MB3A 2EPHA 1E3ZA 2QF8A 3LBCA 2ZKMX 1WDQA 4AD2A 1V93A 3M7SA 1QWKA 1TVPA 1GNXA 3QSRA 3QLLA 4AVFA 1NELA 1HO4A 2GUYA 1LDCA 2BSLA 2NWSA 2VMFA 3B8TA 4AVNA 4P02B 2W9MA 3S6OA 2JE8A 4HK5A 2G4FA 3APYA 3IJIA 2XISA 2OSYA 1AG1O 4EIVA 3HQ1A 1I2OA 3SCOA 2UWFA 3W87A 4HNTA 3LG3A 3OLEA 3SUSA 2Y0FA 2DFAA 6TAAA 3NL3A 1BF2A 1VFOA 2XINA 3SQMA 3T8QA 1BLIA 4JTRA 5L9FA 4C6QA 3R13A 3WNLA 1XC4A 3L0KA 1QW8A 2HVOA 4K8EA 2DIKA 4DF2A 4KW2A 4F4RA 1YKWA 1KXVA 1LLWA 1V4YA 2PE4A 2BVYA 4AF0A 5CKSA 1BHGA 3AUOA 5F1VA 1I2QA 3GW0A 3NQ6A 3VGGA 4LXFA 3D6NA 1G4EA 4XUGA 2JGYA 2E68A 4MJZA 2C71A 3B8WA 2OCZA 2Z1KA 2NXIA 3L4UA 4L4PA 2Z1VA 2X1IA 2BLEA 2DZUA 1DQWA 3R8HA 3BLPX 4Q7BA 4CQDA 4Q8UA 4QX4A 3C0LA 3G3MA 2Y24A 1MI3A 2AL2A 1PWMA 5CPQA 2C91A 5F2LA 2YLAA 1K6AA 2BVDA 2VP8A 2Q6ZA 4GOAA 3RCYA 1QNQA 4HZ7A 1JDDA 4CD5A 2NLIA 5CZKA 5D9PA 1H0GA 4XK2A 1O7AA 3U2EA 4FR6A 4R9XA 3CIXA 3M07A 3NFUA 1Q85A 1LOQA 1XLHA 1EWEA 4J3UA 1Z69A 2E9BA 2F8QA 5FI8A 1I0DA 3VNJA 4EANA 4LBSA 5LIXX 1C9WA 4HGXA 4PMNA 1ZBCA 3NSMA 4AX7A 1IEVA 4V33A 1RQHA 3EDKA 1XLIA 3ZWSA 1QBBA 4AD3A 3R8RA 2WHLA 1A0EA 3HPXA 1JULA 4MJ2A 2AKMA 1H5YA 2GWNA 1WZKA 2VD9A 1HT6A 5AYXA 1YQ2A 2A2IA 2BV9A 1BWVA 1KW1A 3VCRA 3TA9A 4AIUA 3N73A 5A8GA 5I79A 3NURA 1VBRA 5T9BG 3CIVA 1SZRA 1VENA 3NXLA 1NF0A 1B54A 3ICJA 4L56A 2ZVIA 3U7VA 4ERAA 1O1HA 3WMCA 2HJPA 1EJ7L 4YU1A 6CGTA 3CAWA 5FEPA 1DXEA 1RUSA 2WSRA 3OVRA 3GQYA 3LHVA 4M0XA 4UTHA 1O94A 4GBUA 4OT7A 2V30A 1FHDA 2ZC1A 2A7NA 2F6XA 3VX1A 4K37A 3CIWA 2ABAA 1JG9A 1PO9A 4QISA 4DJDD 2HK0A 4GMEA 4IQLA 1E73M 1OCNA 3HM7A 4GD0A 2XM1A 1I4NA 1ZAHA 4MIMA 7TIMA 2VEKA 2C79A 4L65A 2WSYA 3SBFA 1TQXA 4O1FA 1CGTA 1SO3A 3SN0A 2FB2A 2UV8G 4D8LA 3FKKA 4FXJA 4C6JA 2XFWA 2EG7A 2XH7A 1TJPA 2BY2A 3BAWA 3MHGA 2X0SA 1OD0A 1W3LA 3BQ6A 1PIGA 1US2A 3B0YA 2CLLA 2QGHA 3KRSA 3PTKA 5A6JA 3PBUA 3G5EA 2JBMA 1EIBA 3I6TA 3SCTA 2DPEA 1ZLPA 2QCLA 3LTPA 1DJZA 4R7WA 1JDEA 2L5HA 3IAQA 3O7UA 1HJQA 1U83A 1WAUA 2C14A 3BAJA 1XFBA 1GWJA 2NQZA 3N9RA 5CAKA 1O95A 3IVSA 4ZA0A 4AZ6A 2D0GA 2P76A 4ERIA 2G8ZA 2DZPA 4LT9A 4MWAC 1Z89A 1FWWA 4BF7A 3TN5A 1S5MA 1BVZA 1MO0A 4AWUA 1BVWA 2H6RA 1JPIA 5XIAA 5K4ZA 4YNGA 5CCZA 3KOZA 1G67A 2XVPA 3TKFA 3LV5A 3EXSA 2VD8A 1BYAA 3CH9A 4JTLA 2YA0A 4E5TA 3ARPA 1V0KA 4EPDC 3TTYA 1POKA 3WO8A 1C3FA 1XH0A 4PB3A 1XCWA 2VI0A 1HFBA 3G1VA 4LUYA 2ON3A 3PC0A 3O05A 2DJLA 1UBSA 3MJMA 2BXYA 3G22A 3ZR5A 1NWTA 4QCEA 2XGZA 3WH8A 3QBUA 3T78A 4KCWA 1W8GA 4LWWA 2ZDSA 2QJMA 4IL2A 5HULA 2PEVA 1LM1A 2JQXA 2PDGA 5CPOA 3B04A 3MQTA 1IEIA 1NP2A 4YTUA 3I6RA 2NXHA 2UY2A 3ZT7A 1MEHA 2GVLA 4P8WA 3MI6A 3VKAA 4S3AA 1GTHA 3N2OA 3SGZA 3MMWA 3WJSA 2CWNA 1MZRA 1ZBKA 5GNZA 1CGXA 2X2GA 5I07A 1EUNA 3EMZA 2Z29A 3MSRA 3L4ZA 4BY3A 3SCSA 3TCEA 3TONA 2PBGA 1QU4A 3HQOA 2ODOA 3LHUA 2DQWA 1DJGA 4GGHA 5FJRA 2OTDA 2D0FA 1PTDA 1E70M 4ZTXA 3AS0A 1FFRA 3NAVA 2H8ZA 1JGIA 2YB1A 3OQEA 3N4FA 1NDYA 4XAGA 2FVMA 2VX4A 4QTGA 4LANA 3OA5A 4O17A 1TJ1A 3AZRA 2WPGA 4D71A 2C19A 4F8XA 4GI4A 3TSBA 4QDPA 5AVNA 4UUIA 3WNPA 4UC5A 3AIWA 4XWUA 3H6OA 2D2JA 3W88A 3N6JA 3VC5A 1EX5A 1GZGA 2QV4A 2NX3A 3S2NA 4QAIA 3WBXA 1RBAA 3NQCA 3REQB 4EXQA 4EK7A 4O0ZA 2QCHA 2B0MA 2WM1A 4TX9A 2MNRA 2P3EA 3Q4DA 3T6CA 1GKPA 3K8LA 3QTGA 1BGGA 1E40A 3CT7A 1WKDA 2YW3A 3V18A 3AU6A 2XIOA 1S46A 1KM3A 3Q37A 1UUMA 2CHOA 3UWZA 3NO1A 4JNMA 3FNDA 2OGYA 4W5UA 4XZNX 1TV4A 2PPGA 3S2LA 3SUUA 4NG3A 2V5DA 1PTGA 3LRMA 3VIJA 3BK0A 3PBMA 2OSXA 3AJ7A 3CAQA 4TX6A 2EG8A 4NNAA 4A21A 5HWNA 4Q33A 1XR2A 3E1F1 5F2GA 1SPQA 1WBHA 3SCWA 3I7SA 1P1MA 4H4IA 2DH2A 3WEOA 3GG1A 1Q13A 1E55A 1W9UA 1BQGA 3GYEA 4UR9A 3EX4A 3SDOA 4N7QA 4AZ7A 5AZ1A 2P5NA 1EDQA 1TA3A 4GCAA 3ZFHA 3GAKA 4MWAA 4KESA 3HFTA 1BRLA 5EJZB 2FHBA 4GUHA 4MNKA 4JCLA 3VZYA 3LZ5A 4O1CA 4DYEA 4HD5A 1S2WA 3KVMA 3ARZA 2J79A 2G41A 5BU9A 4HK7A 4LBUA 2WJZA 1IGSA 2CLPA 5HJLA 2GPTA 8TIMA 3E5BA 3NL6A 2W62A 4HTYA 2BXZA 4MKVA 2WANA 3OEXA 2DT3A 1TUFA 1OADA 4GY7A 4W5ZA 3GM8A 1XD0A 2QAFA 3AIRA 5D2WA 4Y9NA 4XIMA 1GOMA 4LGXA 3IIOA 4D6IA 2BOGX 1GOWA 1YBQB 3MDUA 3GLCA 5CH9A 3W81A 4DI8A 4CCDA 1W54A 1IV8A 3B8VA 4A6GA 2V69A 2GL5A 3QN3A 1YDOA 4O14A 3N1AA 3P14A 2YZRA 5CC3A 1RK5A 1YDNA 4KWOA 1R7AA 4HYRA 5GVJA 1Y7VA 3WLKX 1L2QA 2CEQA 2WLZA 1F05A 2ACSA 2C1IA 2Z2AA 3VDCA 4FP1A 4YHEA 4M24A 1KXHA 3F2BA 4OV4A 2P3ZA 3N2MA 3BSGA 3L23A 5CGQA 1GVEA 4RDVA 1EXBA 2GWGA 2ONEA 3H4XA 2V3GA 4Q8VA 3PSVA 4R9OA 1D7FA 2A79A 2VDHA 4GQQA 3GNOA 3FFSA 1E1CB 5CSYA 1KRMA 2WWDA 1UQYA 1DJHA 3NL5A 2PGEA 5T8GA 3TYAA 2YCIX 2O55A 3EWXA 1JCTA 4XZMX 1IWBA 4R53A 3L0GA 4GY1A 3BUVA 3H2EA 3MI2A 4Y2WA 3W1RA 1UH2A 3AROA 1XQKA 4B4HA 1XLDA 1SQ7A 5HUOA 3IRSA 1RHCA 3W1AA 3AMDA 5I6SA 1OCQA 2PDMA 2WNWA 1PZ2A 1HP4A 1PIIA 2PDBA 3ATYA 1LRQA 3ARYA 5I0DA 3SADA 2I7GA 2PDHA 2YCEA 3NSNA 5DN1A 1GZJA 2QUVA 4B5WA 1GONA 4AUBA 3STEA 3S5NA 4S39A 1GQNA 3G3DA 3UPMA 4MJMA 2OYMA 3DGBA 4W87A 4LB3A 3BOFA 4F0RA 1QI5A 4RW5A 1W3KA 2Y2WA 4CNTA 1YX1A 5TBOA 3TOPA 1JPMA 4UNIA 5I2UA 4H83A 1LORA 4KEZA 1VGAA 1R0MA 3VABA 1J6PA 3GZ3A 1ZTVA 1SFTA 3IANA 4GKTA 5HNUA 1UWTA 1JYXA 4ADUA 5A94A 2ZXQA 3GXIA 3EOUA 3IUIA 5M1TA 1K9DA 3W7KA 1Z9AA 3GXPA 4L4LA 1MEIA 1ZSXA 4NZCA 4CD7A 5C0QA 4HPJA 1GOKA 3S4TA 1E9ZB 4GVHA 2ICSA 3WD2A 3W70A 3DHUA 2VXNA 4RXGA 5I3JA 4GHRA 4A3RA 1DVJA 1TVLA 4KRTA 3HGJA 4IF2A 2JEPA 3ZIZA 3S1WA 2JIWA 3S5SA 4HKPA 4IISA 3THUA 4O4VA 4UTTC 4IMFA 1VBHA 1P0NA 4HMEA 2OOFA 4JTKA 3BC9A 1ZENA 1DWGM 3U7BA 4C91A 5I3FA 2TYSA 2I17A 4JFVA 2J78A 4AD1A 4KIEA 3K30A 4HQVA 4OOZA 2XUCA 4I9AA 4C6FA 3MP5A 4MLJA 1OCBA 4BQ5A 2FIQA 4A8LA 3AZTA 2XZ9A 3BG9A 1C92A 4L6HA 1H09A 3QW4B 4ZMGA 4ZSUA 4K36A 4Q8QA 4P7LA 3M1ZA 1LWJA 4GINA 2OSWA 1PTAA 2FZMA 2FZNA 3I3DA 3N3TA 1NFGA 3TR2A 4UTKA 1GOOA 1YTDA 1YXCA 1Q6OA 2NUYA 3CZJA 4AZGA 1E6SM 4NHVA 4W93A 3CZKA 3CEUA 1CT5A 2IXVA 3AHVA 5GJNA 2Z4GA 4K39A 1PV8A 4CD8A 4ENLA 3T2QA 5DFAA 5DEZA 2NQHA 2CWXA 2QS8A 3L21A 3R6IA 5DBUA 3L4XA 2W61A 2WCAA 1RAKA 2YA2A 3W1NA 1W1PA 3ZJ8A 1KV8A 4MPQA 3PJWA 1ZRQA 2Q8LA 2A5HA 2RFGA 4URIA 1QUMA 4LNYA 3GKFA 2FPTA 3NIYA 1W3NA 1KWGA 1S3TC 1LL7A 1YPFA 1DWAM 2OLAA 1SFLA 3R11A 5D04C 2PDKA 1XX1A 2G95A 2B7QA 5CPLA 2PMQA 4GBDA 1H62A 3LGGA 3A5FA 3E2QA 3APGA 4N4QA 4LV9A 1YEYA 1UOKA 1VR6A 4PMQA 1Y65A 3A4AA 2QPUA 1VCFA 2RDUA 1KTNA 1HKIA 3W53A 2ANUA 1WDDA 3NOEA 1UW9A 4WGXA 4U31A 1AJ2A 1TWDA 4OQVA 2I5GA 5I03A 1TPH1 1XINA 5FESA 2JEQA 2DEPA 4GH3A 4F0KA 2G97A 1KTCA 3FVDA 3Q65A 1ICQA 1EGMA 3SCUA 3SW6A 4B92A 3FAWA 1DWJM 3V35A 5D4YA 3WLOA 2EQDA 3KUMA 2TMDA 4X2RA 4XSLA 2PTYA 4Q6XA 2FLIA 3M0IA 3WNOA 3BXWA 2OYKA 2VQTA 3VIFA 3EWUA 3CPUA 4AHQA 4D6EA 3K1DA 1T5AA 5EJ1B 2CYGA 3QPYA 1OZMA 3WQ4A 2QJIA 2WSPA 1UWAA 3CB3A 4HJFA 2V2HA 2BGQA 2PC8A 1WV2A 3AMGA 4XKYA 1XQLA 1R9YA 3ITVA 1ODUA 3QGAC 1C91A 3AOFA 3SUVA 4YVPA 3QRHA 4S3CA 1XUUA 2J77A 4KF1A 1BKSA 2QCDB 2YKKA 3HQPA 3KBJA 3PULA 2B31A 3WIJA 4UTTA 4IT1A 4Y7EA 1XLCA 3RCMA 2ZOXA 1KXTA 4GX8A 1CLKA 3UG5A 2VX7A 4ATDA 2FPVA 1LLZA 4XB3A 4NX0A 3DC0A 1O12A 2GVJA 2Y7FA 4PA8A 3DAQA 2XSXA 4AIEA 3VXGA 4GNJA 1OG0A 4HYVA 1Y5XA 2BY1A 3N2TA 1ZALA 4UB9A 4OHQA 4QE1A 3MUXA 2NV9A 5HA7A 3CU2A 3F2DA 5E5CA 2RUSA 1TIWA 1FWIC 3MT1A 3AAMA 2IKIA 2E5BA 4HMDA 1QFEA 2Z25A 3PBVA 4RNHA 2R1KA 1P0BA 3FYPA 1EJWC 2Z2BA 1UZ1A 3UWVA 1Q6EA 4NUWA 4BEUA 3VOCA 4HVXA 4IMAA 4R33A 3NQ8A 4L1WA 1D3CA 3T40A 4GVGA 1MQQA 2VRKA 4UZSA 1FFQA 2DGAA 1J0ZA 2VX6A 4RXFA 4CQBA 1OX6A 2QUNA 3S83A 2PRLA 1C8VA 1KBIA 4ZO6A 2EBNA 3WLSA 5AC5A 5EA9A 3C5QA 1R8LA 4JTAA 3GXMA 3DG3A 3FSTA 4DX3A 3HPZA 4B16A 3R4IA 4LF1A 3BLLA 5HDRA 3O2LA 3RXZA 5FOOA 4G6CA 4I9MA 1DIEA 5B7ZA 2XN1A 1EYWA 3RM8A 3W7OA 3W9ZA 5E93A 1H5VA 2ZE3A 1LOLA 3M4HA 4C6DA 3LRKA 1XKYA 3MWAA 4BA0A 3BCFA 4WJEA 4NU7A 1XV8A 1JQXA 5E9AA 3WKZA 1UH3A 3BOLA 1LBLA 1YPIA 4DWSB 4XZBA 1VH7A 1WNOA 4R34A 2OB3A 4JTTA 3DI1A 4S3KA 2X41A 1RK6A 1FWEC 3KRUA 3LI1A 3UZ5A 4HA0A 3W02A 3GXNA 3MSYA 1T40A 2VRJA 3P0XA 1GQLA 2GVYA 4QP0A 4S3BA 3OBAA 1Q6LA 1JUEA 4A29A 5EYWA 2DSUA 3QEZA 4PBFA 1C29A 3CMJA 1XH2A 1P4CA 4MY8A 4EP8C 4M1BA 5D8ZA 5XIMA 3WJZA 1KFLA 5HANA 1Q6DA 4QG8A 3NM1A 3LXBA 3EX1A 5J5RA 2EPLX 2Z1SA 3VD4A 1BPLB 1NU5A 3L7RA 3IVUA 4WZHA 2VVNA 4YN5A 3KBSA 5KZMA 1TPC1 1B9BA 1OC7A 2PGRA 5ABFB 2ZRVA 3EEGA 4C1NB 1V8EA 1W17A 1W3JA 1ZNNA 2X30A 2ZRWA 2XH0A 4JTCA 1K1DA 4FNRA 1QBAA 2R1NA 3A9IA 1JCYA 5TNVA 1J8VA 1HNYA 2NQ5A 2WZEA 3CXOA 1F07A 5LNVA 2FFIA 5CGTA 5CJNA 2ZA3A 2W5FA 4BKNA 3W3OA 1CXKA 4JIHA 5RUBA 1Z3NA 4IQJA 3EBVA 4O50A 3ZOAA 4IGNA 3J7HA 4DUXA 4ZOEA 3LXCA 3GW3A 4XAZA 1J0YA 4H6QA 1W2PA 4BI6A 1L6WA 2E9MA 4UFKA 1HL9A 1QNVA 3GY1A 1MW1A 3HG5A 3MJYA 5E0FA 5LA2A 2W79A 2WNQA 1V0MA 3WY1A 1SR0A 2PWUA 1JYNA 4JEJA 4QQUA 2A6LA 1VHNA 3PJXA 1JXJA 3KBWA 3M0JA 4PL1A 4DYJA 1K3UA 1UIOA 2F61A 3DGRA 3NZQA 3SCNA 1T99A 4Q4PA 1R7OA 1BTMA 5FJPA 3GH7A 2EEXA 3COTA 3SSZA 4OTKA 4DNHA 1X1OA 3D46A 3QV7A 1TTPA 4IUOA 5HMFA 1GG0A 3DN5A 5HWMA 7XIMA 2YPIA 4EF8A 2VZTA 4N9BA 3OU8A 1NSJA 1MXGA 5D37A 3BJSA 4XZWA 1U1JA 2ATSA 1JVNA 3EEZA 2QVHA 4V28A 2O9RA 4Q7IA 3SCVA 3WH6A 1XIJA 3AHZA 2PDUA 2TSYA 3W7IA 2DW6A 2GQ3A 4NYUA 3TXVA 3KVLA 4GQGA 3KRBA 3AWOA 1O5RA 5C9ZA 1FP9A 1YYAA 4MFEA 4CN4A 3WQEA 2ZZ2A 3H2NA 3N9KA 1T8QA 1RJQA 4C7FA 1HQTA 4B15A 3M0KA 4NXSA 1XLAA 3MY9A 1SGJA 4LS0A 3M0HA 5A6TC 4IX0A 2VUNA 2XVGA 3E3HA 4B5UA 2Q09A 4NF7A 2FGLA 3UZJA 4I90A 4J3TA 1US3A 3F5JA 4A3QA 1OYCA 1UWIA 2FTPA 4B5SA 2C1HA 1ISYA 2O92A 5I3HA 1VIWA 3RCNA 3LLFA 1XCFA 1W1B1 1BSIA 2R94A 3AYRA 4WDUA 1R3QA 1JYVA 5LNSA 4AVOA 3ZVIA 4JYFA 2CCRA 1CGWA 4JY9A 3F1QA 2NSOA 2QCNA 3UA3A 4PC8A 1GW1A 1UKSA 5HR6A 3ZM8A 3GBEA 2BDQA 2Y7EA 1GEQA 2XIJA 3TYUA 1QPOA 3C2EA 2WLYA 2ZRUA 4YTQA 3ONBA 4V1XA 2D1ZA 4G1NA 4PMYA 5AKQA 4RPPA 3PTDA 3UY7A 3R8GA 3KX6A 3W7JA 3C4UA 2CLOA 1VJSA 4E8GA 2O4QA 1OZQA 5C6MA 4PRRA 5LA1A 4HMCA 4UZUA 5CLTA 3M0VA 3DFTA 3C0SA 1W1IE 4WY0B 3CV2A 4U10A 3QM3A 2J27A 3CZEA 1BXNA 2VM8A 4IJBA 5BCAA 9RUBA 1E0UA 2PCQA 5DRCA 1B3OA 1EJTC 2R1LA 4B2DD 2ZX7A 1X38A 3H26A 3C2YA 4XBKA 1TB3A 2J9XA 3FS2A 4J3VA 4EOUA 3DH7A 1NAL1 4NRSA 2P1FA 1OFOA 3PG9A 1KKOA 4DPPA 3LK6A 4O54A 3HMCA 1E6QM 3IWPA 2PTWA 2WO5A 1UR0A 3UCCA 2G3MA 1S5TA 3TDFA 4X0NA 4M56A 2GGHA 2QCGA 4R7OA 4A8RA 3UW6A 4JN7A 3EYPA 1TWWA 3WMBA 3FX4A 4PFHA 2ZZ5A 1A5MC 1RSCA 3GVQA 5EMMA 4PR4A 4F0LA 1VD6A 2VT0A 1KV5A 5E6YA 3TN3A 2QJJA 3AXMA 4N4PA 4XISA 1KM1A 3GXDA 1VHCA 2ZCGA 4ZQCA 4L1GA 5D2XA 2WVTA 3LA4A 1WDSA 1XIIA 3N34A 4A8NA 5FSDC 4I5XA 4MWAE 4ZOBA 5CEWA 4PEEA 2YSWA 2WQDA 1HKVA 4M6PA 2J8FA 3UZWA 3CC1A 3NDZA 3AIQA 2VHLA 3GG0A 1KBJA 4Z17A 3SJ3A 1UP2A 4AY7A 2NV2A 1E9LA 1RZMA 3QY7A 5D2YA 2EGZA 2BY0A 2A6NA 3WH9A 2V3EA 3H24A 1IT7A 5MKGA 1EO5A 4OBRA 2E28A 3DFOA 4GNVA 1WB0A 5FEZA 4A8IA 2VC5A 3QGKC 2Z1BA 4P7OA 3UGVA 5AC7A 2QEZA 1C7TA 3SRHA 1AMKA 3AXIA 2Y8UA 1KRCC 3KTSA 4UFJA 5A2CA 1U2YA 5H6HA 1KD0A 2NSXA 2VTFA 3DFSA 4ONVA 5CBIA 1TELA 5KINA 3S9YA 1UD2A 3DYPA 2VRQA 1SJBA 2Y8KA 1P6BA 4HCHA 5AOUA 4CGTA 4FXFA 3GH4A 1E1FA 4YHGA 3E2VA 2WMIA 4HPNA 1CXIA 1WP6A 1SYTA 1EHAA 1WX0A 1DEDA 4A05A 2GGEA 1ADDA 3CZGA 3VDGA 4RNJA 1UPPA 1FWSA 3PUEA 4DBEA 3F5KA 1UP0A 2F6UA 2XVNA 1HJWA 1V79A 4O11A 3AXXA 1UR9A 4XD4A 3MHFA 3LPFA 2NLYA 3PB0A 3W27A 3F4CA 8CGTA 4A3HA 4GQ0A 3W22A 1M04A 1XIDA 6XIAA 2ZADA 4Q4RA 1KGUA 2ZE0A 1DWHM 4ZB0A 2J8GA 3H2OA 5J8LA 3MBDA 3GR8A 2Y63A 2E6AA 3DKLA 5BZAA 2Q8ZA 3F5LA 4H04A 4O18A 3QV6A 2GK1B 4JL1A 1K8ZA 4PUMA 3T0CA 1FA2A 4Q4MA 3L67A 5KTLA 3NDOA 3AS1A 5EMLA 1MYRA 2V9DA 1P0DA 4PMRA 5EB8A 3T7VA 5AB3A 1FXQA 4IMDA 2VCCA 4M51A 7REQB 1RALA 2CZDA 3V75A 5K7JA 2VO5A 3AYSA 4I7UA 1A0CA 2VGGA 3TTSA 4C6LA 1AZ2A 3PZVA 1YE4A 1Z48A 4LRTA 1XFCA 2OWWA 2E0PA 3B0UX 1VPYA 3T4CA 5BYWA 4AD5A 2DVTA 2UZ9A 1A5BA 1E6XM 3BO9A 4Z2GA 3SR7A 3G0SA 4XD6A 4GYKA 4LS2A 3SM0A 3EB3A 1H3GA 3WFZA 3N4EA 3RHGA 1TPB1 1PXGA 1VBJA 3KW3A 3BV7A 2GQ8A 2WZMA 2YCJA 5EFDA 2V82A 3DERA 1FBAA 3UEQA 3W7NA 4Z1CA 3MU7A 4M81A 1OEPA 4GO9A 2PU0A 3W75A 3WQCA 1DWFM 2QJNA 1TYGA 1PDYA 3PTMA 5LNRA 3RU6A 1KR1A 3LQGA 3S2JA 4KRUA 1HZYA 3PF3A 4LUIA 1LQAA 3QYSA 5I09A 1SMDA 3TXZA 4DWSC 3F03K 3PS7A 3GS6A 4PUWA 1QDSA 3OZYA 3PBYA 4R5EA 4IX2A 4LCRA 2D22A 3TW7A 1PZ3A 1KC7A 5H2ZA 1M5WA 2FGZA 1ME9A 3DKJA 1RPKA 1VYRA 3ZLGA 4DUWA 2ISDA 2KX9A 3GC4A 2CERA 3FDKA 4R27A 5CPNA 4C6IA 3UETA 2Y6ZA 4KS0A 4O57A 1K9TA 5FKYA 1BQCA 5BXSA 4Q8PA 3NGJA 5BWFA 1XL9A 3RMEA 4E4FA 1WQ5A 1F61A 2WKJA 3K4WA 2VGIA 3SECA 2YCLA 2A0NA 5DY2A 3SCRA 2RGMA 1OY0A 2WMJA 1X96A 3U3HA 1I2RA 4J7RA 4IFKA 4IPNB 4LAZA 1SFJA 4LU0A 1CLVA 1EKOA 3FDGA 3WK1A 1L0PA 4JTDA 4DO4A 4GRSA 3TYZA 5ENLA 6TIMA 1RY8A 1M53A 2CLMA 1R38A 1OM0A 1G4TA 3MO7A 4MYAA 1GVOA 4ADTA 1WAWA 5FJIA 1N55A 3VK5A 3KZSA 5A69A 5M17A 4E4PA 1GHSA 4US6A 4IJCA 4CLMA 3ELFA 4NL1A 1DTUA 4PGLA 1EO7A 4QM1A 1UR8A 4EACA 3WQ6A 1C7SA 1XGZA 1XIEA 3AQUA 4F40A 1LTDA 3NSXA 4AQLA 5U7SA 3TA6A 4OWGA 2E3ZA 4HG6B 5EGRA 2MUCA 1BYBA 2BHYA 3AYVA 5HATA 4UWMA 4B5XA 3AXKA 3FHQA 1OABA 5F7UA 2LLEA 1ME7A 1TMLA 4DRSA 3WDQA 2BB0A 2WVVA 4W8BA 4JXCA 3IJLA 1D8CA 1KGXA 3CGTA 1AH3A 3R79A 1G9HA 1AQHA 3RRXA 3NPVA 1LBMA 3C2VA 4UFIA 4DPQA 4R3UA 3TMLA 3VIHA 4BWLC 3BWWA 2VFGA 3U4FA 3W7HA 2E5DA 4GZIA 2GYIA 2E8ZA 3GTFA 5E0KA 2PCEA 5C2CA 5CSSA 2PSNA 4MHBA 2CHRA 1KBLA 1JF5A 4WKAA 4HNOA 4B91A 1W8SA 3T55A 1SO6A 1GTEA 3ZZ1A 3DG7A 3CTLA 2OZTA 3UGRA 2J7EA 4PMXA 4HNNA 3BICA 3FJNA 2GZXA 1XD1A 4DF0A 2AAMA 3SUTA 4R7JA 1ZB5A 3DCPA 4WXZA 3MV01 4LY4A 5FEWA 1NTHA 3TIMA 3SJNA 4M7TA 1I9CB 4YVXA 4Y8FA 3VDAA 4ZQRA 1ZS2A 3HU7A 4H9MA 5FSEC 4JYEA 4X2PA 4UQEA 2R14A 4RZ5A 2V5KA 1U5VA 4DWSA 2PFHA 5DF0A 4JQ2A 1RBOB 4HNUA 5BMXA 5CSRA 4PUDA 1QW9A 3RX2A 1VFMA