3GH4A

Crystal structure of beta-hexosaminidase from paenibacillus sp. ts12
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
519
structure length
507
Chain Sequence
b'HHHHSSGLVPRGSHMASMSQPSILPKPVSYTVGSGQFVLTKNASIFVAGNNVGETDELFNIGQALAKKLNASTGYTISVVKSNQPTAGSIYLTTVGGNAALGNEGYDLITTSNQVTLTANKPEGVFRGNQTLLQLLPAGIEKNTVVSGVQWVIPHSNISDKPEYEYRGLMLDVARHFFTVDEVKRQIDLASQYKINKFHMHLSDDQGWRIEIKSWPDLIEIGSKGQVGGGPGGYYTQEQFKDIVSYAAERYIEVIPEIDMPGHTNAALASYGELNPDGKRKAMRTDTAVGYSTLMPRAEITYQFVEDVISELAAISPSPYIHLGGDESNATSAADYDYFFGRVTAIANSYGKKVVGWDPSDTSSGATSDSVLQNWTCSASTGTAAKAKGMKVIVSPANAYLDMKYYSDSPIGLQWRGFVNTNRAYNWDPTDCIKGANIYGVESTLWTETFVTQDHLDYMLYPKLLSNAEVGWTARGDRNWDDFKERLIEHTPRLQNKGIKFFADPIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords beta-hexosaminidase
molecule tags Hydrolase
source organism Paenibacillus sp.
publication title Molecular cloning and crystal structural analysis of a novel beta-N-acetylhexosaminidase from Paenibacillus sp. TS12 capable of degrading glycosphingolipids
pubmed doi rcsb
total genus 191
structure length 507
sequence length 519
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3gh4A01
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3gh4A02
1JI1A 2YBTA 2D23A 2XVLA 2RGMA 2VO5A 4JCLA 5ABFB 1VIWA 1HKIA 4U3AA 1EHNA 4F66A 3WKZA 5CPQA 4J27A 1A3HA 2DT3A 1C7TA 3B8SA 3SUSA 1I75A 5IFPA 4URIA 2ZUTA 1QBBA 4UQDA 4LGXA 4E2OA 3G6MA 2QLYA 4CU7A 5HBFA 1B2YA 3G6LA 1BYAA 1IZKA 1W9BM 3SCUA 1MFVA 3JUGA 3T09A 2PC8A 1GOWA 2E3ZA 1VFUA 3MO4A 2VZTA 4MDPA 2JEPA 2WNWA 5A69A 2IXUA 2WK2A 1BQCA 3VNZA 2G8ZA 1WB0A 2WCGA 3K8LA 4BQ5A 1Q6CA 1H41A 4CU6A 3N9KA 1Z32X 1GVYA 3VDBA 1QNOA 4RE4A 1KGUA 3CGTA 4C90A 3RMEA 4B9YA 3VGEA 1GUVA 5BRPA 1S46A 2W4XA 2DDXA 4IUGA 3WIJA 1EQCA 1Y7VA 3BCFA 3M7SA 4F79A 1V6XA 4TVDA 5AY7A 4WIWA 2A3HA 5CJ5A 1QVBA 2AOSA 1V6WA 1ITCA 4QCFA 3ZM8A 1G94A 1V3HA 1UR4A 2F8QA 1GOOA 2XVPA 5I3DA 1R85A 5A6MA 4FMVA 3WH5A 4CD5A 1K9FA 1JXJA 1MQRA 1RD6A 2FHFA 3GM8A 2A3CA 1OIFA 1UKPA 2W66A 5CQ1A 4P8VA 3BMVA 2CITA 4HMEA 4UFMA 4AZIA 2FHBA 3EDEA 4JKKA 4ACZA 2O9TA 2EQDA 1TG7A 1W9DM 4R27A 5A2AA 3VD3A 4W7VA 5HPCA 1YHTA 1HJVA 1E6PA 2AAAA 3WY1A 3AMLA 3OLGA 4MPKA 2VRKA 4M80A 1L0PA 4B16A 1UWTA 1B0IA 1U2YA 1M53A 4D6DA 3AIRA 1TVPA 1ZBWA 1V0MA 1ZL1A 3WSUA 3AHXA 2OSXA 3CUIA 3UG3A 1TA3A 2A3EA 4CKQA 4GI9A 2BV9A 4MNKA 1MYRA 2WPGA 2WB5A 1SFSA 4W85A 2X0HA 4LYPA 4PEEA 4AW7A 3EDKA 3W25A 1GOQA 2ZUWA 2DSVA 4HOZA 2J78A 2YA2A 2OWWA 4WKAA 1AVAA 3W82A 2QF8A 1UZ4A 2V3FA 4F8XA 5A6JA 1FH8A 4YN5A 2A3BA 2DT0A 2WSPA 3KL5A 5I2UA 2VNCA 2W67A 3GNPA 3IJ7A 2OSWA 2WVVA 1QBAA 1U30A 3RM9A 2EPKX 4CCDA 1TA3B 3BH4A 3OLEA 3N12A 2V5DA 3T0DA 3PZTA 4HA3A 4B3LA 2XSBA 5M3WA 1NM9A 1JFXA 1UH3A 3WEMA 4HP5A 5BRQA 2EEXA 2J79A 2ZX6A 1E1EA 3VMNA 2BVDA 3ARXA 1P6WA 1OD8A 3NJ3A 4PTMA 2D20A 4GIAA 4UQEA 3CTTA 4PMNA 2WMIA 3MV01 1CTNA 5D9NA 3T0BA 1OGBA 1Q4NX 1JFHA 2W91A 1CGTA 3QR3A 3OB8A 5M5DA 4QAWA 1DWGM 1UQYA 3KL0A 3D3AA 4H8HA 2XHYA 3CZJA 4TOQA 4V27A 1W9VA 3GNOA 2ZX9A 3VKKA 4IISA 1HXJA 1CGVA 3PHAA 3ZSSA 2FH6A 2Q8XA 2D24A 3UG4A 2C7FA 2XVNA 5A6BA 6A3HA 3WH9A 1G01A 3HJEA 5E9AA 1JGIA 1LLOA 1ISVA 2TAAA 1XHGA 1WPCA 4GPNA 4HPHA 4Z2IA 5E6YA 1WAWA 1UYQA 1WDSA 2QPUA 4HOWA 4UOZA 1UWIA 1DWJM 1JZ6A 1UR8A 1JZ4A 2WMKA 5DMYA 3N15A 1J0ZA 4MB5A 4J3XA 1MQQA 2GSJA 2EPNA 1H11A 2FDMA 3ZIZA 1GQIA 2UY5A 4D6JA 1JZ5A 3AMKA 3WD1A 5ABEA 3WFZA 2DPEA 1BYBA 4UQCA 3KWXA 2PF0A 3W37A 1C91A 2G41A 3RM8A 1K9DA 1LG2A 3K8KA 3I3BA 1K9EA 3AICA 5D8ZA 2VZUA 3WNOA 1H2JA 3BAWA 5I78A 4UZSA 5I6SA 2WWDA 3VIJA 1QHOA 1CXIA 3CUFA 1E43A 2WHJA 2IXVA 3WL0A 2JF6A 1IZJA 1LQ0A 4XUYA 1EOMA 4D6EA 2WC7A 1OM0A 2BHUA 3W28A 4BQ2A 1R87A 3B9DA 3O9NA 4GZIA 2WZIA 4U31A 3AHTA 3DECA 1GJUA 4OBSA 1W2VA 1KQZA 4QCEA 4U2YA 1QW9A 4AY1A 2CPUA 5CPSA 4OOUA 4KRTA 4QLJA 1QPKA 3FW6A 2VCBA 4CN4A 2BXZA 3UR8A 3T2QA 5A1AA 1CGWA 4BZYA 5C8BB 1UWUA 1VFMA 3WBEA 5HXMA 3VD4A 1CXKA 4UCFA 5D8WA 3VGDA 4UTFA 6CGTA 3SUUA 1FFRA 3AISA 3SCSA 2GFTA 4PMDA 1J10A 1QHZA 2C8NA 2XFFA 2YL6A 3CHFA 3THCA 2BHZA 1V3MA 2NW0A 3ARPA 3CHCA 2DT2A 2VJXA 2WMHA 1CXEA 3PZQA 2EXOA 1B1YA 1V3KA 4AD5A 4HPGA 1FFQA 1BSIA 3VGGA 4W86A 4AD3A 4JFVA 2RGLA 2X1IA 1G1YA 5A94A 1R7OA 4U2ZA 2UY3A 1JDAA 1Q6EA 2VRJA 3IK2A 1JYNA 3GH5A 3T0AA 1OBAA 1E15A 4OBRA 5ECUA 3W29A 5CPTA 2ZOXA 4JFUA 3ZT6A 3UG5A 1KR1A 4H41A 3NSMA 2E4TA 1M04A 1B31A 4HTYA 1E72M 2PWGA 2XJ7A 4JIEA 4KH2A 2WZEA 4PTXA 4AIUA 5KZ6A 1BGAA 2ZX7A 3W53A 1J0KA 1UD3A 5HDRA 1VAHA 4U3CA 1GJWA 3I3DA 3KEHA 4GQQA 3U5UA 1CXHA 1JDDA 2V3DA 5A8MA 1OB0A 1BHGA 3GXIA 1E6XM 3CZGA 1V03A 2VC9A 2VQUA 1DWIM 4DM2A 1HVQA 1LWHA 2E8YA 1B3XA 3PZ9A 3AZSA 4PMQA 4TX8A 3OZOA 1BF2A 2OYMA 4C91A 4XV0A 1E6QM 2YL9A 1WZMA 4ML4A 4FLSA 2YL8A 1VF8A 3WN6A 3MMDA 4B15A 1VEPA 4JHOA 1G0CA 3OGRA 5FCZA 2EPLX 4U33A 4CVWA 3WQ8A 2WKLA 1EDQA 5I77A 5A2CA 4L4OA 4CD8A 1QI0A 4V28A 3ECQA 4DWSB 1GHSA 4UR9A 1GQJA 1KR0A 1MWOA 2E9BA 4UZUA 3VGBA 2B31A 1NWUA 3WMCA 3PZGA 4DWSD 1JZ8A 3WELA 3B9EA 1NWTA 2J7GA 1ISZA 2QPSA 2VZOA 4QDMA 1DWAM 2WMFA 3TTOA 1FH9A 2BFGA 2BHYA 2YLLA 3AXIA 4A4AA 1FH7A 3WUEA 2BXYA 1E5JA 2J7CA 6TAAA 4Z2LA 4QLKA 4M8UA 4KGJA 1CXFA 1W1VA 1OT1A 3L4ZA 2ZUMA 2JEQA 3PTKA 4BF7A 5IFTA 1X6NA 3BC9A 1BTCA 3EMZA 1UH4A 2E9LA 3AXHA 4MTVA 5EFDA 1C8QA 2FHCA 3CBWA 4AD0A 2OYLA 4MJ2A 1J0HA 2OSYA 4D6HA 3K46A 1ISYA 2CETA 2O9OA 1BG4A 1J0JA 3QOKA 2VCAA 3ARWA 3BAKA 3GBDA 3B9AA 1CDGA 1E4LA 2XUCA 3KL3A 3RIKA 4PSPA 3FY1A 1E6NA 3CMGA 2NSXA 2E0PA 5JBEA 3ALGA 1JNEA 1OINA 3SUTA 1ZU8A 5BWFA 2X0YA 3CZ8A 2VX5A 4GKLA 4LXFA 5KEZA 1JYWA 1GORA 4KGLA 1EQPA 3N17A 3OG2A 3AS1A 4AZBA 1GNXA 3TONA 2D0FA 2YJQA 4PBGA 1KCKA 3VX1A 7TAAA 5EB8A 1TZ7A 3WDJA 4KMQA 4EAMA 3WF1A 1E56A 4N0RA 2XTKA 1UKTA 1E55A 3CUHA 2VMFA 4PMZA 2DGAA 3L4YA 3WDHA 5FIPA 1BYDA 4AZHA 4PTVA 4PSRA 3ARZA 1W91A 1TMQA 4DUVA 5DO8A 5E0FA 1JF6A 3QHOA 1W9XA 1ZS2A 1ZBVA 3PZIA 2GDVA 3WENA 4C7GA 3WDRA 2Y5EA 1J9YA 3OGSA 1AQHA 2WLZA 2WWCA 4PCTA 4RL3A 2JIEA 3QGVA 1KXHA 2QV4A 3SCRA 5A6SA 4PUEA 1GOIA 3N18A 3EDFA 3DYPA 1OIMA 3BSHA 2PI6A 4W5ZA 5A95A 1JNDA 3FN9A 2VX7A 4ATLA 4C7DA 2F2HA 4LYQA 3VD9A 3AIQA 3MV11 3UR7A 5A8PA 1HIZA 3F5JA 1J11A 2WBKA 3F5KA 3WMBA 8A3HA 4J3VA 1KQYA 1JAKA 4GO8A 4EKJA 2D22A 4UOQA 4MB3A 4DM1A 5DT7A 1KCLA 3CUJA 1TUXA 4AD4A 1WDPA 3ZJ8A 1KGWA 1CGXA 1LJYA 4W89A 4N42A 5A6AA 3VU2A 1PZ2A 4J28A 2WCSA 4WSJA 3T2PA 2CKSA 1UA7A 3BCDA 3AYRA 4M24A 3BSGA 1UG6A 3IAPA 3MU7A 5FD0A 3APGA 3DYMA 3A47A 5D9OA 2WCAA 3FAWA 2PWFA 5I24A 1CLVA 1KXQA 2BVTA 2J77A 3ZR5A 2XYLA 2VZVA 1C92A 1FP9A 1VFOA 2YDQA 1E40A 3MMUA 1DWFM 1W2PA 2XVKA 3DHUA 1WZLA 1K9TA 2YOCA 3K1DA 3VGHA 1E4NA 3M07A 3ARVA 4J3SA 3QHMA 5A8OA 1BG9A 1E5NA 3F4VA 5TD4A 1JDCA 2D0HA 2VI0A 4S3KA 1XCWA 3RPMA 4ATDA 4U5KA 3AFBA 3ZMRA 1ZJAA 4QP0A 1TE1A 1OD0A 5CZKA 1JD9A 5LA0A 2VRQA 1XYZA 2DQXA 1SYTA 4MB1A 4W87A 4ZE4A 2VURA 3AYSA 4CU8A 4TX6A 5GNXA 1CGUA 4S3JA 1HJXA 3K8MA 3DHPA 1CZ1A 3VILA 1MW1A 1IV8A 4JFWA 4OOZA 3F5LA 4HA4A 1B30A 3SUVA 1XV8A 4JZ5A 4TVUA 4D1IA 1NARA 2J7HA 3ARTA 2WANA 1VJZA 5A6LA 1NWSA 3ZR6A 1D3CA 3VGFA 3N1AA 4UQAA 4X0NA 2W92A 4D71A 1JYXA 4HOXA 1WO2A 4CN6A 2YA0A 3WF4A 4CGTA 4X9YA 4WK9A 2CBVA 2G3NA 1AQMA 4PMVA 3GNRA 2V38A 3SURA 3EBVA 4CD4A 5GNYA 3PBGA 2QHAA 4UFIA 3UETA 5D9PA 2X09A 4PMXA 4AZ5A 3DYOA 1UR1A 2PBOA 3WNNA 1GOKA 1GW1A 1VEOA 3BAIA 3PZVA 2D0GA 3CMJA 4GINA 4TVCA 5AC4A 3PZUA 1OWQA 3AIEA 3GTNA 3SCNA 2HVMA 4Q22A 1EH9A 2WHKA 3MANA 1ODZA 3EMQA 2ZXDA 2J7DA 3RCNA 1EO7A 4U5IA 1BFNA 5ABHA 3ZJKA 2VL4A 2WHMA 4QLLA 2UY4A 5DF0A 3KZSA 1TR1A 3OA5A 3O6AA 5HNNA 3WNLA 1QW8A 4P8XA 3AHZA 1PIFA 1PIGA 5GQBA 3VDAA 4HU8A 3SCOA 2ZUSA 1KB3A 4JFTA 2CNCA 5CGMA 1J0YA 4ZFMA 3SCQA 3CPUA 4JAWA 3VD5A 5AYIA 3SEPA 1V6YA 3AS2A 1QHPA 1LWJA 5DEZA 2GJRA 3POCA 2CERA 2EO7A 3K4AA 3THDA 1J12A 1UA3A 3VIOA 3VIGA 3UEQA 1EIBA 2DSUA 2A3AA 2HISA 5I5RA 2XIBA 1V08A 1U33A 1A47A 3CUGA 2C0HA 1HF6A 2WMJA 1QNQA 1UKOA 4M81A 4CCCA 1E4IA 1R7AA 2E9MA 3BAJA 2VVSA 1H5VA 4CVUA 1UH2A 1CLXA 1VENA 4ZEPA 1BVZA 3WMSA 4AEEA 1C7SA 2Y8KA 1RP8A 1RPKA 1NOFA 4JKMA 4UNIA 3S6TA 3SIMA 4UFJA 3FAXA 1V3IA 5I0DA 4HZ6A 2ZX8A 3NIYA 5GPRA 3ZSTA 3WF2A 4LX4A 2WMGA 1W3LA 1BGGA 1QI5A 1O6IA 3QOMA 4Z2HA 3GDBA 1WDRA 2VOTA 2DIEA 1ZJBA 4R5EA 3AROA 5E6ZA 4NZCA 4NRRA 1V0LA 2VR4A 1JZ2A 1D2KA 1TCMA 5BYWA 3VDCA 5IHSA 1KXTA 2BS9A 3MUAA 3AMDA 3W6LA 4W88A 4W84A 1VB9A 1HP4A 2WSKA 3NCOA 1XSKA 2EPMX 2WZHA 3PZOA 1ZBCA 3OLDA 3WUGA 5I79A 3II1A 4AMCA 3AXXA 2DSWA 4AC1X 1BVNP 2PB1A 3AZTA 4W7UA 3VM5A 2XWEA 3NSNA 2Y4SA 4TTUA 4MAZA 1E6RA 2D1ZA 5AYBA 3TOPA 3QHNA 5BCAA 3MSDA 4DUXA 2G3JA 5E09A 1NWRA 5FOOA 1W3JA 4PRWA 4D6GA 3VIIA 4BCEA 3S2CA 2JF7A 2VQTA 3ZQ9A 1HNYA 2PWEA 3BAYA 1DTUA 3ARQA 1DP0A 4PMYA 2WC3A 1HJQA 3PTQA 1NOUA 2XPKA 3VPLA 1UKSA 5D9MA 3LMYA 4P8WA 1BLIA 4TTGA 2QMJA 3WQVA 5A8QA 4W8AA 1CECA 1OT2A 5EFFA 1VEMA 2J74A 1UD2A 3AOFA 3VINA 4ACZB 1W1TA 1B3WA 5CSUA 1O7AA 1WKYA 1GHRA 2WYSA 1C8YA 1E71M 1EO5A 1RP9A 1JZ7A 3AIVA 2OWCA 3WF3A 1OGGA 1UD4A 4P7QA 4A3HA 2DH2A 3I3EA 2CBJA 2PBGA 2VX4A 1DEDA 2WMIB 2W62A 1SMAA 3WH6A 5HPOA 1V0NA 3CO4A 4MDOA 4PMOA 3L4TA 3TP4A 1W1YA 4RE3A 2ZUVA 4GZEA 2CHOA 4CCEA 3UCQA 2XFYA 1HKKA 1OSEA 1PPIA 4WSKA 1MQPA 1PAMA 3WQ5A 1TVNA 4AZGA 3VIHA 3MSGA 3VD7A 1B3ZA 1QOXA 3WH8A 1UR9A 3L4XA 3WFLA 4HA1A 2DIJA 3WQWA 1XYFA 1G5AA 3CZKA 4BQ4A 2D3NA 1H3GA 2VCCA 2O9PA 1WE5A 2Z1KA 1XGZA 1H0GA 2WVVB 4IPNB 5LYRA 4W8LA 4B3KA 2O9RA 1GZJA 2XGIA 4UQ9A 1E6SM 4MJ4A 2J62A 1BYCA 5E0CA 1ESWA 1XSJA 2YBUA 2CXGA 1XH0A 1H0IA 4J7RA 5GNZA 4D72A 3AMGA 4BA0A 4W7WA 2J7BA 4CD6A 3ARYA 1UD5A 5D4YA 3W27A 3AJ7A 4PCSA 3NYDA 4OZOA 1OGSA 2UY2A 5M17A 1MFUA 4J3WA 2IUZA 4P7OA 1KBKA 3WH7A 3CZEA 2J25A 1EGZA 2V3GA 2XGBA 4NI3A 1UOKA 4JFSA 2GJXB 4H7VA 2D2OA 3L2MA 1LL7A 1JXKA 1M01A 9CGTA 1R8LA 1B90A 1VRXA 3POHA 5BXSA 3NUKA 4H8UA 3RM4A 4HZ8A 4ACYA 1UWSA 5A6BD 1QNPA 2J8FA 4JHZA 2GK1B 3IAQA 3O2LA 1AQ0A 2UWFA 1WDQA 1QI2A 2AMGA 4Q7NA 3N04A 2CIPA 5A3HA 4P7RA 3WQ6A 1UR2A 4YPJA 2ZX5A 4FLOA 3CIVA 2ZIDA 3U5YA 2GJXA 3WNPA 4UFHA 1CEOA 4UOJA 1KWKA 5CLTA 3HU7A 2OYKA 1MXGA 1D7FA 3RILA 3AHYA 5CG0A 5F7UA 2MANA 1UR0A 1ECEA 2O92A 1MW2A 3ZJ7A 2WBGA 2WLYA 3OIHA 2DSKA 2V3EA 1W3KA 2BY3A 2D3LA 4EK7A 1PX4A 3L4WA 3MUIA 3N11A 2GK1A 3A4WA 3AI0A 1C3FA 4FF5A 4WKFA 3WEZA 2WHLA 3ARUA 1I1WA 2ZUNA 5IXEA 4F9JA 1HL8A 2VT0A 4D6IA 3NDZA 5BXRA 3WD4A 4YHEA 2XG9A 1C93A 2FH8A 4BS0A 5DT5A 1E73M 4DWSC 1GCYA 1PX3A 4GXPA 3T2OA 2CCRA 2ZXAA 3AHVA 3BGAA 2X8RA 3HN3A 2ZWZA 4OIFA 5ABGA 1E70M 2CHNA 4OKDA 2JALA 2Y24A 3ZO9A 1JG9A 5HOSA 1UWRA 7CGTA 3W81A 3VX0A 3FHQA 3LPOA 1CIUA 2CESA 4IPLA 4MAVA 3SCPA 2NT0A 3NDYA 1FHLA 2ESCA 1HN1A 1GQLA 1ITXA 3GYCA 1VBUA 3CHEA 4XX6A 4F9DA 2BY2A 3L4VA 2QMKA 4PUDA 1UD6A 4M29A 2WVSA 1XD0A 3ARSA 4Z2JA 1H1NA 2BY0A 4UFLA 1Q6DA 4DWSA 1G9HA 1CENA 2XWDA 5A6KA 2ZWYA 3KE0A 1WZAA 3OBAA 3PZNA 1JYVA 2XM2A 4Z2GA 3W24A 1UD8A 2YA1A 3VTRA 1JF5A 1XSIA 4AZ6A 4E8DA 1E3ZA 1KFWA 3OGVA 3TTSA 3ZT7A 1E1FA 1E0XA 3BLPX 2VVNA 1K6AA 4X0VA 3AS3A 1FP8A 4MADA 3VVGA 2J8GA 1EHAA 1US3A 1BAGA 1EA9C 4GI8A 2PWHA 1CXLA 2GDUA 1RH9A 3OLIA 4AWEA 4IM4A 1V0KA 1Q6FA 4UQBA 3VO0A 4MNMA 3RO8A 3GBEA 4AXNA 4AIEA 3CHDA 1H09A 3W0KA 4QFUA 1ZB5A 3AIUA 1V3JA 3IJ8A 2YKKA 1W3HA 1ZBKA 1WNOA 1HVXA 5BXTA 1FOBA 3A3HA 3A4AA 4HZ7A 3IJ9A 1L8NA 4WKHA 4Z2KA 1E9LA 2DSZA 2WW5A 2OLHA 4RE2A 1M03A 4GQRA 1KGXA 1SR0A 3ZJ6A 4EANA 1LL6A 1WP6A 2XM1A 1QNSA 4J3UA 1F4AA 1W32A 3ALFA 1H4PA 1GQKA 4LPCA 4XZWA 1J01A 4W8BA 5M03A 3MKKA 4GZJA 1X6LA 4C7FA 3D5HA 4W93A 1J0IA 1PZ3A 1KWGA 3BMWA 1IT0A 3A6OA 3TTQA 4PTWA 4MNJA 1UQZA 3CZLA 4K68A 1YQ2A 3NSXA 1HKMA 1HP5A 4L4PA 1JI2A 2BNJA 1KBBA 3RJXA 2W5FA 1HX0A 1WCGA 4E8CA 3IANA 3GXFA 1LF1A 1CGYA 3W4RA 3AIBA 2ZXQA 3VNYA 1CNVA 2X05A 4B9ZA 3BAXA 1JIBA 2ZXBA 4JL1A 1HJUA 2VTFA 3N13A 1FHDA 5EMYA 3WL1A 2YDRA 3VIPA 1C8XA 1B3VA 1MW3A 1UWQA 4Y7EA 1JD7A 5JBFA 3WD3A 5LA2A 1PJ9A 2G3MA 3PN8A 4AD2A 1B3YA 1QNRA 1XD1A 2NT1A 4JKLA 2E8ZA 3VIFA 1CPUA 3SCVA 3MS8A 3WQ4A 4NRSA 1UKQA 5I23A 2ZE0A 3WDIA 2CBUA 1XH1A 4FLQA 2YLAA 5CSYA 1UZ1A 2JE8A 2ZICA 1VJSA 2PWDA 2J75A 3J7HA 3BLKA 1OCQA 2BVYA 4JCMA 3GH7A 5CLWA 3AQUA 4AZ7A 1E0VA 3VDHA 2EPOA 1NH6A 3WDPP 2WC4A 2YL5A 2W61A 4AZCB 4D6FA 1HJSA 2WXDM 3E1F1 3OZPA 1NP2A 4PMRA 3U7BA 3WF0A 3LPGA 2J47A 4NF7A 5JUVA 1PX8A 2ZUUA 1GPFA 4UFKA 3WD2A 1H49A 5JIWA 1E6ZA 3WDQA 1SMDA 2WM0A 4H2CA 3WUFA 1UHVA 1E0WA 2J4GA 2YDSA 4ZXLA 1Q6GA 1HT6A 1JZ3A 1EDTA 4LQ1A 4AZCA 4OJYA 4H04A 3L4UA 1QI3A 1W1PA 3UERA 5AC5A 2XFRA 4KRUA 1X1NA 3CLWA 5JBDA 5IHRA 2OWXA 3AZRA 5CGTA 3W38A 1HKJA 4A3YA 3VIMA 1JAEA 3RJYA 3SCWA 2E40A 3VMPA 3TTYA 1W9UA 4D1JA 2CEQA 2YIHA 1AMYA 1EDGA 4WF7A 4MNLA 4PMUA 4TUFA 4DUWA 4EE9A 1J18A 1N82A 3ARRA 3PTMA 2CBIA 4XB3A 4YHGA 3U7VA 3HMCA 2GVYA 1XRVA 1B9ZA 1KXVA 3WD0A 4NSBA 1MXDA 5C71A 4MB4A 3MMWA 3TA9A 5A2BA 3VM7A 2WVUA 4P7LA 3MUZ1 3WUBA 1NOWA 4M82A 1UUQA 2FGZA 3M6DA 2EJ1A 5FL1A 1FA2A 3LPPA 2FGLA 3VMOA 4P7NA 4W5UA 1NQ6A 5DFAA 1EXPA 1I1XA 4HMDA 5FL0A 2WAGA 1V6VA 1US2A 1WZKA 5JIPA 3UESA 3WEOA 4FLRA 1C90A 3GH4A 3FHAA 1XH2A 5LA1A 1HL9A 4JL2A 3DC0A 1PEZA 2DT1A 2X2YA 2XVGA 5EBAA 3EDDA 1CWYA 1MW0A 2G4FA 4AIOA 2JFEX 3LPFA 1CBGA 1E4MM 2F61A 4OUEA 3K4DA 4M1RA 4CUCA 5A8NA 3U57A 5CXPA 3EDJA 3M46A 1TFVA 4XZBA 4D6CA 1VBRA 4CN1A 3RDKA 3ZOAA 1F4HA 2GJPA 4AD1A 4WLCA 1CYGA 4GI6A 4PYSA 2CKRA 1GOMA 3MUY1 3GXDA 1ISXA 2WVTA 4ZE5A 2XSAA 4HU0A 1W9PA 5FKYA 3AIWA 3VIKA 1HJWA 4AYSA 3W6MA 4BQ3A 2VX6A 2V5CA 4M56A 4PN2A 3PZMA 4FK9A 3SCTA 3WBAA 1BPLB 3ZT5A 1LG1A 2JIWA 3WNKA 3GZAA 3SUWA 4ZENA 4WJXA 1R86A 2DEPA 4GO9A 2W63A 2J7EA 3L2LA 2J7FA 2Y2WA 4P8UA 4KWUA 2WKGA 3EYPA 1NP0A 4H8VA 2BY1A 3T08A 1XC6A 4E4PA 4AISA 1XCXA 2VUYA 4ATWA 1LL4A 3AS0A 2XIIA 7A3HA 4ZXOA 1V3LA 3A4XA 1VFFA 2G3IA 5BXPA 3VUPA 2DH3A 1GVIA 2Z1SA 1GONA 5BROA 4AEFA 8CGTA 2CYGA 4TXEA 1V02E 4HMCA 5E70A 5ABFA 1JL8A 1QI4A 3WNMA 1DHKA 4LYRA 2EBNA 3BXWA 1ISWA 2VZSA 3W26A 2GUYA 3VOCA 4J3TA 2Y8VA 4V2XA 3FNDA 3CH9A 3FXYA 5C70A 1EOKA 3GXMA 5IDIA 1ODUA 1MVYA 2VR5A 1V02A 4CD7A 1PBGA 1M7XA 3EMCA 1E3XA 1V6UA 1DWHM 3AMCA
chains in the Genus database with same CATH superfamily
1JI1A 4A8RA 3LG3A 4M6UA 3BANA 4XBJA 4HNLA 4J27A 2DUAA 3IGHX 3WLLA 4R9OA 1I2RA 1C7TA 2DT3A 1W1A1 4F0MA 3BJFA 1ZNNA 3BTNA 3LY0A 4URIA 2GYIA 1UR3M 1PZ0A 1N55A 3KS6A 3RX3A 4IWWA 5HBFA 3W1RA 1A5UA 1B2YA 1I4NA 1BYAA 3W1XA 3IGUA 4GBDA 1W9BM 4IJRA 4DJED 3KOXA 3Q94A 2YR1A 4HNNA 2PC8A 1B57A 4QE5A 1VFUA 1TZ9A 3IV3A 2WNWA 5A69A 3CS2A 3VNZA 3K8LA 1W3NA 4ORIA 1GVYA 1KGUA 3CGTA 1ONXA 1OC6A 2HTMA 3G5EA 5BRPA 4NZJA 2CLFA 2W4XA 5KMYA 1EQCA 3BCFA 4EIVA 5AY7A 4FEZA 3BWWA 5D02A 1FWCC 5CJ5A 1QVBA 4DBDA 5FA5A 2AOSA 5D2XA 3FSUA 1JDFA 1UR4A 3FJ4A 1GWJA 1BRLA 4BF5A 1RD6A 4YMZA 3PJTA 5LIYX 3I7QA 3IIXA 4XZHA 3SY5A 4JY9A 4O16A 4UFMA 4XZMX 1EWEA 3EDEA 2W9MA 2O9TA 2EQDA 1W9DM 4CEXC 1YW1A 3QQWA 3QMTA 4G7EA 3ATZA 5LXEA 1M1BA 4ILSA 2AAAA 2GSEA 2O56A 4GXMA 1W31A 5J8LA 5C5YA 2VRKA 1P0NA 4B16A 2YZ5A 4DJFC 1M53A 4ZQMA 5HWMA 4JTRA 4HK6A 1V0MA 3WSUA 4ZSUA 1XCFA 1OK4A 4LCSA 3KP1A 5KETA 4LWWA 1DTNA 2GVJA 4CKQA 1JCNA 2BV9A 2WB5A 4W85A 4PEEA 4QJ3B 4IICA 4HGXA 7ENLA 2ZUWA 3U2ZA 5CZ0A 2DSVA 2QDDA 3NM1A 2Y89A 4Z08A 4HOZA 2J78A 2O7SA 3DG3A 1PXGA 3IGSA 2V3FA 3T42A 3KXQA 2HRWA 1GZ1A 2A3BA 4XUGA 2DT0A 4O52A 2ZKMX 3IJ7A 2WVVA 2PURA 3LXAA 4WOQA 2NX3A 2ZZ1A 2EPKX 4PZVA 2J9YA 1PTGA 1W1IE 4BWLC 3NQVA 3O16A 1US0A 3T0TA 3T0DA 3FA3A 4B3LA 2XSBA 4UTTC 1JFXA 4DXVA 4HP5A 3H2OA 4R3UA 1Q63A 3TC7A 3VMNA 1OD8A 5EY5A 2D20A 4GIAA 3DGRA 2WMIA 3MV01 1CTNA 3T0BA 3VOFA 5IDZA 2DZAA 3SN0A 4IX0A 4A2SA 1CGTA 1O5RA 5EMJA 1DWGM 4AWTA 1UBPC 3D3AA 4JNYA 5CC7A 3QQ1A 4ZOBA 2FTPA 1DPMA 5F2GA 4IISA 3EEGA 3PHAA 3ZSSA 2XVNA 6A3HA 3LM7A 3WH9A 1KLZA 2OODA 5E9AA 1JGIA 1I6NA 2A6NA 1XHGA 1WPCA 3T78A 1TIWA 3WLNA 3RCMA 4LANA 4IP7A 4UTIA 3AYTA 4G9PA 2WMKA 3N15A 4KRZA 8TIMA 5CAHA 4MMWA 1D9EA 1MQQA 3H55A 4KERA 3E2VA 4UCGA 3ZIZA 2PDPA 3LQLA 1GQIA 4O4WA 3BPWA 4QJ4B 3MUXA 4IPJA 3L65A 5F1VA 1GW9A 4XTIA 3WFZA 3S1WA 3A21A 2G41A 3RM8A 4DJEA 5HQLA 4EWJA 1LG2A 2R1MA 3V0TA 3PJUA 2DVTA 3WNOA 1XYMA 4EP8C 3UXIA 4U10A 1LLWA 4J2MA 1IEVA 1E43A 2WHJA 1B3OA 4IL0A 3TOYA 1VQTA 4GY7A 4XUYA 4D6EA 3TCSA 1R87A 3GAYA 3B9DA 3O9NA 5D2TA 1CT5A 4GZIA 1RQBA 3G22A 2H6RA 4ECLA 1W3IA 2VGFA 1W1B1 3VOGA 3DIPA 4QCEA 1EJ7L 1M65A 1ONWA 1QW9A 3RX2A 5C6MA 4OOUA 4RNIA 4QLJA 3PBWA 1QPKA 2FVKA 3JZEA 1CGWA 1SSGA 3WBEA 1IGWA 2YYUA 1F61A 3CNYA 3VD4A 2QCDB 1QU4A 4UWMA 3NURA 3UR5A 2PFHA 1QHZA 3UF9A 1S2AA 3DG6A 3CHFA 3THCA 4C6NA 3NQ8A 1V3MA 4UMCA 5LNVA 3ARPA 1SW7A 3N2BA 2NUWA 3NWRA 3GKAA 3PBMA 3E96A 3VGGA 2V63A 3TVAA 2QUUA 2RGLA 3V5CA 3WLOA 1G1YA 2OT0A 4U4MA 4KCWA 4NYYA 1LOSA 4U2ZA 1XUUA 1JDAA 2UY3A 1KM4A 2I7GA 4JTHA 1OBAA 1YIXA 3Q2DA 3PNUA 4IGSA 1JPHA 5ECUA 5CPTA 5I09A 3ZT6A 2QCDA 3Q58A 3UG5A 1KR1A 3CUZA 4LY4A 4IQJA 1HGWA 3NSMA 3GXPA 4IZGA 4RR4A 3REQA 1BGAA 2IQTA 4B2DA 4U3CA 5DX7A 1TYGA 2GQ8A 4GQQA 2ZRYA 2XN0A 3U5UA 1CXHA 1OFDA 2CZDA 3WLKX 2HBVA 1OB0A 1OFOA 4R53A 4TX9A 4US5D 1V03A 4BI7A 3VXGA 4DM2A 1DWIM 1MDRA 1CW2A 3CU2A 1B3XA 4QG6A 3C0SA 1C9WA 5C2CA 1LCOA 4UR8A 1BF2A 4WVXA 1XDJA 1E6QM 4EF9A 1VF8A 1RALA 4JHOA 4N4PA 1LRNA 1K8YA 2B81A 4L6DA 3UYIA 4CVWA 4GFSA 5A2CA 4XO7A 1QI0A 4C6MA 2C1HA 4GQGA 1OFQA 3AXKA 1GHSA 3L2IA 4UR9A 1PL9A 1MWOA 4LEFA 3CQJA 2E9BA 4UZUA 5D05A 4YL2A 3OJGA 1FWDC 3QW3A 3VGBA 2FZ8A 5B7YA 2V2DA 3PZGA 1V5XA 3B03A 5E5CA 4DWSD 3HG3A 4RK8A 1JZ8A 2AQVA 3CK5A 2OPJA 1H7OA 1AZ1A 4FR6A 2ZRZA 1XDMA 4UR7A 3M0IA 1M7JA 2BASA 2YLLA 3AXIA 1XLHA 3LCLA 3OQ8A 5I02A 3CJPA 3WUEA 3V16A 1G69A 1E5JA 3CAWA 6TAAA 4Z2LA 4QLKA 4M8UA 3O8AA 4O4VA 1LRTA 4XZ9A 1CXFA 1W1VA 1W5MA 6PTDA 1Y5XA 3D0CA 2NSOA 4GA8A 3FLUA 4I8YA 4DJDA 2P0IA 2YB4A 3RXZA 3BC9A 4V1YA 1TJ2A 1KFJA 1NEYA 3GHSA 1N7KA 2J24A 1LT8A 4UXDA 4EXAA 1B4EA 4D6HA 3K46A 2BP1A 4HHPA 1BG4A 5E0KA 3GAKA 2VCAA 3P81A 1LDCA 4POCA 2XUCA 3B9AA 3RIKA 3VI2A 5FEZA 2WQDA 5EKYA 3FY1A 2VFGA 3KOYA 4DXKA 3CMGA 3OYXA 2NSXA 3TA6A 2E09A 2E0PA 4Q7BA 5JBEA 3ALGA 3S6OA 3TAOA 2VP8A 2VX5A 5KZDA 4GKLA 1JYWA 3V3WA 3A22A 1TV3A 1SPQA 3TONA 1FCBA 4PBGA 1KCKA 2OKOA 3NO5A 1HW6A 4R9XA 3WF1A 4F0HA 2XTKA 4FOKA 3NAVA 5ECVA 1FDZA 1UKTA 1E55A 4PMZA 2DGAA 2RKXA 3L4YA 4RNFA 1X7FA 3FKRA 3VAVA 4DUVA 1RBOB 4MKSA 1K7FA 4ICMA 1JF6A 3NVTA 1UZHA 4LY8A 2IKHA 3L9CA 1MRQA 2EG6A 2Y5EA 2ZVRA 1J5SA 2WWCA 4UTLA 4CNSA 4PCTA 4RL3A 1YBQA 6XIAA 3N2OA 3WBYA 3AU6A 2W79A 3DYPA 4RLIA 3M0MA 4HN4A 3BSHA 4W5ZA 4UTUA 4C7DA 2F2HA 3VD9A 3PULA 3MV11 3L0KA 4YJ5A 2A4AA 2PAJA 1HIZA 1J11A 5EPDA 1KTBA 3E02A 3IVSA 2NXIA 3C56A 1JAKA 3TJXA 4EKJA 1C8VA 1K8XA 3LHUA 4X3ZA 4X22A 2EGZA 1WKEA 3CEUA 1WDPA 3S3GA 1CGXA 3IACA 3NOEA 3GTXA 5E1QA 1QPRA 3P84A 3T2PA 1HTIA 2OG9A 2VDIA 2AQOA 5I3FA 4K1GA 1V7AA 1UG6A 3MU7A 3APGA 4KFNA 3NXLA 1NIUA 1RXOB 2YCKX 1CLVA 1KXQA 2BVTA 1ML1A 2XYLA 1C92A 3PY2A 1VFOA 3F7JA 3L21A 3WJZA 1WZLA 3AUOA 1W5QA 4XTDA 1YX1A 2YOCA 3K1DA 3T07A 5HANA 2FFIA 1E4NA 2WO5A 3KVMA 4NJKA 3S1GA 1YADA 3QHMA 1R2SA 5A8OA 1BG9A 2Q6ZA 4MY1A 5I3GA 3Q37A 1F3WA 3IJDA 3UZYA 4KBXA 3SRDA 1JDCA 2V69A 4S3KA 4GYKA 1AL7A 1XCWA 1OX6A 4ATDA 1XICA 3W2NA 3ZMRA 1XIHA 1ZJAA 4RDYA 1OD0A 2E1DA 1XYZA 2DQXA 1SYTA 4LCQA 1TMLA 4H9MA 3DHPA 3HG2A 3VILA 4A3UA 2PCQA 4C6FA 2FFCA 4OOZA 3F5LA 4HA4A 1XV8A 5A6TC 3PP7A 2PGEA 3W1QA 4BJHA 1NARA 3ARTA 3QBUA 3VK5A 3MTWA 3W84A 1XRFA 1Z9AA 1EWDA 2XGZA 3N1AA 1KBLA 1JPMA 3N14A 4GH3A 4HOXA 1WO2A 2YA0A 3UWEA 2DZSA 3N2CA 1DJGA 3W73A 3HMJG 3GRIA 4CGTA 1KFLA 3Q65A 2I9EA 1S5TA 2CBVA 4TR9A 3GNRA 1SZEA 2V38A 4CD4A 3UETA 5D9PA 3DYOA 4FNSA 1UR1A 3WNNA 1GOKA 2A21A 1NQKA 4B90A 2D0GA 2OX4A 4QM1A 3TWBA 3CV7A 1OWQA 3DHFA 2WNQA 1L6WA 1WYIA 3WQCA 2DZTA 1ODZA 5J5DA 4A22A 2J7DA 1OCJA 3MYOA 1EO7A 4U5IA 3ZJKA 4FXFA 3SI9A 4QLLA 4WJ8A 1OYBA 4WDUA 4QRNA 3PC0A 3KZSA 2QIWA 3TIMA 1XFCA 3OA5A 3URBA 5HNNA 3WNLA 3D47A 3G8EA 5GQBA 3VDAA 4JX5A 2ZUSA 5D37A 2B4GA 2CNCA 2C6QA 1J0YA 1XBZA 4PCFA 3AS2A 5AC7A 2QDGA 1PYFA 3DUGA 2OZ3A 1I2QA 3K4AA 1VKFA 3THDA 3BO9A 2ODOA 1QWKA 4LBUA 1EIBA 2HISA 1HZYA 3LCXA 4CCCA 1VZWA 1E4IA 3FEMA 2VFIA 4HYRA 4HNUA 1TPC1 1VENA 4LW7A 6TIMA 5LIKX 4ZEPA 3LSCA 4IIBA 4O1DA 1NJJA 3BZJA 2Y8KA 5I06A 1NOFA 2VWSA 4JKMA 3S6TA 3E0WA 4LS1A 1V3IA 3B8IA 4HZ6A 5A5WA 1GG1A 1QI5A 3QOMA 2FTWA 1UP2A 4GJJA 5TIMA 4GYPA 3TLQA 5DCEA 2VEKA 5AOUA 4EPDC 2DIEA 1XXXA 3EGJA 2ATMA 1QOPA 1V0LA 3BOLA 1D2KA 3NQMA 1XINA 1OF8A 3N9RA 1A4MA 5F1UA 3LQGA 1XSKA 3CUXA 2EPMX 3E49A 1Q7MA 3PZOA 3VNDA 3APTA 5LKYA 2P3ZA 2E7FA 1AZ2A 3AXXA 1B9BA 4WDTA 1VH7A 2OO0A 1Q5MA 1TPB1 3RFAA 3LLFA 2XWEA 4KIEA 2E28A 4WQ6A 3EX2A 2W0UA 3H7RA 5AHNA 4NU7A 3PUOA 1XM3A 3E5PA 4JTJA 3W3OA 3UZZA 1K1DA 4YXGA 2WNNA 3GE7A 1NWRA 4PRWA 4PB3A 3S2CA 4GY1A 4QQUA 3BAYA 3BLFA 3UWWA 3B0PA 1HJQA 1A5NC 3VPLA 2WJDA 3TX9A 3NGFA 3H2CA 1D7KA 1CCWB 4JTFA 4NNAA 3R13A 2DV0A 1CECA 1SW0A 1OT2A 5LXXA 4H01A 3MZ2A 3B8WA 3VFLA 3MHUA 5D38A 1QK0A 2ZRWA 1O7AA 4NJIA 1WKYA 4O12A 1VBHA 2WYSA 1C8YA 4CLMA 3AIVA 2OWCA 5AECA 2E5CA 1EJRC 1OFEA 1UD4A 2FB2A 4P7QA 2DH2A 1UMYA 3WH6A 1SMAA 1X1ZA 3KM8A 1K03A 3I6RA 1XGEA 3HG4A 1W1YA 1AQFA 4LB3A 4CCEA 5C2XA 3F03K 3EOEA 3WLRA 4JYDA 4WSKA 2AKMA 3MZNA 1PAMA 1TVNA 2X30A 4QSHA 3VNKA 4AZGA 3VIHA 2ZC1A 3L4XA 4HNTA 2DFAA 4O11A 3W22A 3TSBA 1XYFA 4H6QA 2D3NA 1DQXA 3UGVA 1KM6A 2O9PA 3PTDA 1XGZA 5H91A 2V5BA 4O14A 4ERGA 4W8LA 5F4WA 2EHHA 1WOBA 5F2IA 3W1TA 4UQ9A 1E6SM 3SFWA 4AF0A 4FO4A 3SGGA 2P50A 4WD0A 1I0DA 5E0CA 1ESWA 1O66A 3PJXA 1SW3A 1H0IA 2QNEA 2VFDA 5CCZA 5D4YA 1YDVA 4JQAA 4OZOA 3HQPA 3P0WA 5BU9A 1FHUA 2IUZA 2FZMA 4EF8A 3ID7A 1KBKA 3CZEA 1V6TA 4AEOA 2INFA 3PG8A 1O12A 5LIWX 1V51A 2GJXB 3H4GA 2D2OA 3L2MA 2PUZA 1Q2RA 3OZMA 1JXKA 4ORMA 1R8LA 4H3DA 3TYEA 1VRXA 4H9UA 5BXSA 1QXLA 4ADSA 4XD4A 1GJPA 2J8FA 1LQAA 3PUEA 5EMLA 4AX6A 4Q7NA 2Y85A 2PGWA 2YCJA 3QY8A 2CIPA 5A3HA 4CQDA 1EXBA 1MUMA 2NQJA 4YPJA 2ZX5A 2ZIDA 1TJ0A 4JTIA 4UOJA 3HU7A 1TWZA 1ELSA 1D7FA 3RILA 2IPFA 5F7UA 2MANA 4IFKA 4KETA 5AHEA 1SO6A 3OIHA 1F7BA 1T6MA 3KWSA 3OOQA 3B8DA 1Q2SA 2CHRA 1OYAA 1UCWA 3A4WA 3TN3A 4FALA 1JGMA 3AI0A 1C3FA 4WKFA 3ARUA 4M7TA 3ME3A 3LX9A 1PTAA 2PP0A 1GPWA 4AYGA 1RZMA 4D6IA 3NDZA 5BXRA 1H7WA 3GWQA 1VIZA 3UNTA 1C93A 2TRSA 2RAGA 1REQB 5LNRA 3H4XA 4GXPA 3T4WA 7TIMA 4M1BA 3T2OA 2CCRA 3KLLA 4MIMA 4DHGA 4DUOA 2X8RA 3B0XA 1N8IA 3GHTA 3RUBL 2DU2A 1QRQA 3OU8A 2I57A 4MPQA 1AD1A 4HNVA 3GU1A 3S0CA 3I65A 5XIMA 2Y24A 4JIIX 2C16A 2QCFA 3CTLA 1M68A 3VX0A 3N3MA 1CIUA 2A7RA 4IIEA 4IPLA 4MAVA 3SCPA 2NT0A 4JS3A 5CBIA 2NVAA 4DLFA 3M0KA 2BY2A 2PE4A 3E74A 3A4JA 2QMKA 1Q6QA 3M4HA 1LUCA 4AY7A 2PDYA 1EPVA 1SO3A 1H1NA 1XP3A 3GDMA 2HXUA 3SQSA 1FWTA 4IF2A 1XLEA 3W24A 4FB7A 4MFEA 2J6XA 4E8DA 1E3ZA 3OGVA 1E0TA 2E6YA 3QZAA 1L6YA 3PR2A 1ALDA 1E0XA 1BEUA 2VVNA 3VFCA 4G8TA 3KCOA 3M5ZA 4NZ5A 1THFD 1BWKA 1XIIA 3BLOA 4MADA 1BD0A 3LCGA 4WOZA 3MY9A 4F2TA 5CC6A 1QW7A 1QPNA 4AHOA 3LRKA 3VO0A 4FX7A 3GKFA 3GR8A 1MEWA 4RW5A 4WDXA 2DVUA 1I8JA 3W0KA 4QFUA 4L1XA 5CBJA 2V67A 2X16A 5M2FX 2YKKA 3FGCA 2YXOA 4Q4MA 5BXTA 1FOBA 1RCOB 2Y7EA 1A5MC 2DSZA 5G1TA 1GYMA 3S9IA 2R1LA 3K1GA 2Z1BA 2FPYA 1WP6A 4PTDA 3WZ0E 1H62A 3W07A 1V8EA 1H4PA 4XZWA 3BOXA 4GNKB 1S5WA 4O28A 3KS5A 4LVFA 4C7FA 1OFPA 3D5HA 3EAUA 4IP4A 2XN2A 3C5QA 1OHLA 4BEQA 4C6KA 3A6OA 4KEMA 4PTWA 3FJNA 4EVZA 5HJXA 9XIAA 4PUKA 3CZLA 2RDTA 1EJVC 3RJXA 1DXIA 1WCGA 3W2JA 3GXFA 4DIAA 3G3DA 3V75A 2V81A 3UNDA 3BAXA 3TE9A 5TQLA 2CLLA 4JL1A 3N13A 4O1BA 3TYBA 5EMYA 3WL1A 3BG5A 2YDRA 1A3XA 1XIJA 4JTUA 4XD6A 4TO8A 2G3MA 3N4AA 3PN8A 1B3YA 5EMUA 2E8ZA 1H50A 5IBXA 4ALDA 4OQVA 3WQ4A 1XYBA 4I9AA 2ZE0A 3W7JA 3WDIA 2ADAA 4FLQA 2POZA 1OC7A 3T55A 4RZ6A 3LUTA 5JH2A 1UZ1A 2JE8A 3F2DA 2NXHA 1VJSA 4XSMA 2J75A 3J7HA 1DIOA 1OCQA 3GH7A 1RLDA 2Y8UA 1NH6A 4MVAA 4I6VA 3T1GA 2W61A 2G4JA 4AZCB 4NP7A 1HJSA 1XLFA 3BDKA 2ANUA 3OBEA 3U7BA 1WQ5A 3EWDA 4NF7A 1PX8A 2ZUUA 1GPFA 1FKWA 3SRFA 1X38A 2WM0A 1PDZA 2ACQA 3N73A 3WK1A 4PTNA 3PWIA 4GX8A 3PWGA 3RYSA 4NQ1A 4GQBA 2HXTA 4C6BA 3EX1A 3O15A 4OJYA 5U7SA 3L5LA 2XH7A 5JBDA 3UR2A 3CL8A 3AZRA 3W38A 2H90A 1PKLA 3LCIA 4CNOA 5B80A 1IEIA 5BNKA 5AB3A 3TTYA 3ITLA 4AQLA 3LHVA 3STEA 4JQ2A 3VE9A 1EDGA 4TUFA 4EE9A 3U7VA 2O0TA 4GY0A 2I14A 4N9DA 1D8WA 4FZIA 1XRVA 5MKGB 1F74A 4KFOA 5JMUA 1XFBA 1YXDA 4M82A 3FVMA 2FGLA 1IEWA 4Y8EA 4YTTA 5DFAA 1I1XA 3M7WA 1R3VA 4LTSA 2GJLA 3UESA 1EYEA 1C90A 4MM1A 4JTKA 1XH2A 1A53A 3SJNA 5LA1A 1HL9A 2Q02A 3DERA 1KV8A 4F2BA 3QMRA 3FA5A 1ADOA 2G4FA 2QZRA 4LVBA 4AIOA 3IUHA 3KHJA 4CQ8A 3LPFA 3IGXA 1CBGA 2F61A 3TU9A 1ZP4A 3W1AA 2F6KA 5CZSA 1Z41A 1VD6A 3M46A 4D6CA 1AH4A 3ZOAA 1A5LC 3HGOA 4K8GA 3T9PA 2Y88A 3T7VA 1OABA 1CYGA 4ES4A 3CQKA 3W7MA 1F6PA 3EPMA 1IWAA 1XIGA 2VDGA 4QE4A 3PPGA 4TIMA 3FX4A 5LHEA 4BQ3A 4S3BA 2INEA 3MDWA 5AN7A 4Q4OA 1ITQA 3WNKA 4ZENA 1RCQA 3C2OA 2HPMA 1YDYA 2IKGA 4JQ3A 1VHCA 4GO9A 3C2VA 2R91A 3PM6A 4LB4A 3EYPA 2QT3A 3QH2A 3BL3A 2DUZA 2YB1A 2DZBA 2CWXA 2VUYA 3PANA 4ATWA 4US5A 4ZTXA 2XIIA 3A4XA 1VFFA 2G3IA 5C55A 4TXEA 1DL3A 1V02E 1GVQA 1QI4A 3RRXA 4LF1A 3UPWA 4I5RA 1FCUA 4XKMA 4J3TA 3TDFA 1VCVA 4NIRA 4V2XA 3FNDA 3I4EA 5G2WA 5C70A 1EOKA 4GVGA 3N9SA 4M19A 1V02A 4CD7A 2ZA2A 1MZRA 1J4EA 4YTSA 2IPGA 1RJRA 3AMCA 5T9CE 4OV4A 4JCLA 4QROA 3BW4A 1VIWA 1PE1A 4WRHA 4LUYA 4NAEA 4XAZA 2D73A 1A3HA 5EA9A 2Y5JA 3UGRA 1FDYA 4AVOA 4DO7A 1XPYA 3ELFA 3SUSA 4ZOCA 2ABAA 1I75A 2ZUTA 2NV9A 1QBBA 4DN1A 4PRTA 4A21A 1FWIC 3TMQA 3WLHA 1DQWA 1VYPX 3ANYA 1IZKA 3T09A 3B97A 2E3ZA 1J93A 4E3TA 4IPIA 2VEGA 2WCGA 4BQ5A 4NAEB 4F3HA 1QDSA 3GIQA 3KRBA 1Z32X 2GL5A 4JHMA 1QNOA 3N25A 3NQ6A 3W2KA 4JN6A 4C90A 1O68A 5D33A 4QDWA 4PODA 1GUVA 1EBHA 2DDXA 1DIEA 1TZZA 4S1FA 3R8RA 4IUGA 4AY8A 3FFSA 4F79A 3M7SA 3C6CA 2CLHA 1J8VA 4WDWA 3PB0A 4QQ3A 3RR4A 1Q6LA 1TWDA 4WSHA 4TVDA 1XX1A 3E0VA 1SR9A 1F6YA 9XIMA 2A3HA 2VEFA 1Z48A 2ZZ6A 4OVXA 4KEUA 1WX0A 4QCFA 2GGHA 2PTWA 1G94A 1V3HA 3HPZA 2F8QA 4IIDA 4AWSA 3JRKA 5I3DA 4E0CA 4O0ZA 4FNTA 2ISWA 4CD5A 1K9FA 1JXJA 3FA4A 2PDNA 4HBKA 5CC5A 2A3CA 3ENLA 1UKPA 2A0NA 5JU6A 3M47A 5CQ1A 4OWGA 3QV6A 4AZIA 1TG7A 4P00B 4R27A 4W7VA 3EKLA 4JIRA 5HPCA 1HJVA 4WGHA 4CNUA 1UP0A 4MPKA 2P76A 3JW7A 3GW3A 3TLLA 4GZ7A 1TPEA 4MWAE 3GXNA 1B0IA 1U2YA 2VGIA 1S2VA 5FJPA 4H6RA 3G18A 1TSIA 3S47A 2FIQA 5HR7A 2OSXA 3C0LA 1DORA 2C0AA 3UG3A 1TA3A 4GI9A 4MNKA 3W75A 2WPGA 1VCFA 1SFSA 2X0HA 3NQFA 3EDKA 2QYGA 4O10A 3W25A 4HMNA 5AFDA 2JKAA 2OWWA 4WKAA 3V0UA 3TK7A 3W82A 3RMJA 1UZ4A 5A6JA 4CNNA 4LSBA 3LN3A 1LBMA 2WSPA 5I2UA 5T26A 2W67A 2OSWA 2NZLA 1F9CA 3RM9A 2YX0A 3VC5A 3BH4A 5M1TA 4EOUA 4QJ1A 5FACA 4HA3A 5M3WA 4FA3A 2F7FA 3WEMA 2H8XA 4HK5A 5BRQA 5F2MA 1E1EA 1QUMA 1TRDA 1P6WA 2E5DA 3NJ3A 4PTMA 1OADA 3QQ0A 1R3QA 4PMNA 3IJLA 2Y7DA 1UUMA 3VOJA 2W91A 1YE6A 5CPNA 2ZZ3A 3UVAA 5M5DA 4UBPC 4QAWA 3KL0A 2ISSA 2OELA 1SO4A 2Z29A 4TOQA 2P8CA 1IEXA 3B4UA 3VKKA 1HXJA 1S38A 1QPQA 4DJEC 2C7FA 3GK0A 4IT1A 5HR6A 2EF9A 2PDFA 4DEFA 1XG3A 1OX5A 3EA1A 2QDEA 3QLLA 2TAAA 4GPNA 4Z2IA 1EP3A 1YTKA 1WAWA 1PHQA 7REQA 3T40A 4H9XA 3W00A 1UR8A 5DMYA 3S5SA 4I9TA 1VPYA 1R3WA 4J3XA 5HMDA 2GSJA 4AF0B 1FY6A 4L4LA 1H11A 1YYAA 4AXKA 4DBSA 2UY5A 1JZ5A 3GTFA 1QPOA 3EWYA 3RGTA 1RY0A 4UQCA 4Q8OA 3W37A 1C91A 4QG9A 3W2UA 2Y61A 3AICA 5D8ZA 2NVCA 4F0RA 5I6SA 3LU2A 2WWDA 2OMAA 2OKTA 3CUFA 5C7VA 3LNMA 3WL0A 2JF6A 3MCOA 1M9HA 1S39A 1JCXA 3SY8A 3NG3A 3S1VA 2BHUA 2OEMA 2PDCA 3W28A 4BQ2A 1JPIA 5HMSA 2WZIA 4U31A 4PB5A 2HV5A 4PL2A 1AW1A 1JQXA 1REQA 3ORWA 1GOXA 1IXPA 1W2VA 3TROA 4U2YA 4XD3A 4FAMA 4AY1A 5CPSA 2OOGA 4IJCA 3O3RA 3ITYA 1AMKA 3NQ2A 3WCZA 5A1AA 5C8BB 1FRBA 5HXMA 3QSTA 4DF2A 3SJ3A 4UTFA 3VKDA 5C7HA 1GKPA 1WXZA 2CW6A 1J10A 3MB9A 1JUEA 2NW0A 2PD5A 3CHCA 1UB3A 1CXEA 4DBWA 1V3KA 2E1WA 4HPGA 1FFQA 3NZ1A 1EJXC 2X1IA 4IJBA 2GGJA 4O8AA 5A94A 2ZADA 3L5MA 2IMRA 2VRJA 1JYNA 1VRDA 1E15A 1K3UA 3SRKA 2ZOXA 2QUMA 4D2JA 1NDYA 4H41A 4C6OA 1QNVA 1A0EA 2E4TA 1B31A 1E72M 4NZ3A 1LOQA 2XJ7A 4KH2A 3IK4A 4AIUA 3NQ7A 1UD3A 2XIQA 5HDRA 3TZFA 1WDDA 3I3DA 4P61A 1VYRA 3MSRA 2O4MA 2QGYA 2PC4A 3DDMA 3W71A 2X1UA 1XLBA 5A8MA 2BOEX 3GXIA 1K7XA 3CZGA 2EJAA 1J6OA 1K4GA 1LWHA 3DI1A 3PZ9A 1H1YA 1ME8A 4D8AA 5G4WA 5GJPA 3QC0A 4XV0A 2YL9A 1WZMA 2F6UA 3UXLA 3REQB 3G1XA 3R7MA 4B15A 1VEPA 3OGRA 5FCZA 3SRHA 1ENUA 5KZEA 3NQEA 3IIVA 3U2OA 1EDQA 1SZFA 5E93A 3NL5A 3KVLA 3CV1A 4CD8A 3TUUA 4IXHA 3KBNA 2R24A 1FXPA 5CJNA 5AZ1A 4I9JA 4GUGA 1SJCA 5B7ZA 3W70A 3UCCA 3M9YA 3AJXA 1H7XA 1ONEA 4J3ZA 2ALRA 1GT8A 1KRCC 3OODA 4IMDA 1ICSA 4UTMA 3WLQA 3VUSA 2J6VA 4GQ0A 1JRBA 4G7FA 2P3EA 4QDMA 1WKFA 1K6WA 1POKA 3C86A 2BHYA 4HA0A 1JR1A 4C5YA 3LGEA 4LAOA 2BXYA 5E9XA 3QFEA 1EUNA 2FQIA 3B4YA 1NSJA 2ZUMA 5IFTA 4Q8PA 1DOSA 1UH4A 1RY8A 2E9LA 4B4FA 3T05A 3AXHA 4DNHA 1A49A 4MTVA 1C8QA 4AD0A 1TV4A 4JIPA 3IPWA 1ISYA 2CETA 3HQ1A 1J0JA 1EGMA 1GTHA 1R9ZA 4JTQA 4Y96A 1RAKA 2OX1A 4MKNA 5J5RA 3E12A 7PTDA 1JNEA 3IIZA 4HK7A 3SUTA 1ZU8A 3NDOA 2X0YA 3CZ8A 4AAJA 3YPIA 1GORA 4Q4KA 4KGLA 1P6CA 2BTMA 1EQPA 3UW6A 4Z1YA 1M41A 4GISA 2D0FA 2FPTA 2YJQA 1S2TA 3VX1A 2PDBA 4FXRA 7TAAA 5EB8A 3WDJA 3THQA 2VMFA 3B8VA 1N8WA 1BYDA 5FIPA 4PTVA 5D03A 2JK2A 1RBLA 3ARZA 1AG1O 4PBEA 3LLXA 1TMQA 3EB2A 4MKVA 4OV9A 5G4HC 1W9XA 1ZBVA 3PZIA 1JRCA 1YTDA 3WENA 4X61A 1JEZA 3WDRA 3P5YA 3FV9A 3BW2A 2PLKA 2CLEA 1LP6A 2JIEA 1QJWA 2QCHA 2FZBA 3SCRA 5A6SA 1NDWA 1GOIA 5K3VA 1OIMA 3G77A 1NU5A 2PI6A 5A95A 2ZZ2A 4JEJA 2PP3A 2VX7A 3TYZA 4UMAA 2XIJA 3AIQA 5AHLA 1XBVA 5HK4A 3LS9A 1KCZA 4IH3A 5A8PA 1OX4B 4JQ4A 3WMBA 1KQYA 4FIQA 1CLKA 2Z1WA 3EKGA 4XK2A 3LD5A 3MI6A 1MI3A 4DO5A 2D22A 2VFEA 1LWIA 3HQOA 4DM1A 5DT7A 1KCLA 1Z6KA 1VLWA 1EYWA 4WEVX 1TUXA 4AD4A 3ZJ8A 4P2VA 1KGWA 1M7PA 2XSXA 3G0SA 5A6AA 1H7PA 3KVJA 3RU6A 4ZSTA 3ITTA 4M24A 3LBCA 4L1GA 3NZRA 3C3UA 5FD0A 2BODX 4GNVA 3FAWA 2PWFA 4JEQA 1AODA 4C6IA 2QAPA 1RQEA 3N6HA 3ZR5A 1KW1A 3BJTA 2C13A 2PZ0A 2YDQA 4H83A 1DWFM 4PCPA 2XVKA 3M64A 1Q65A 4C5ZA 1K9TA 3QPYA 2PPGA 2A7PA 4RV8A 3ARVA 3GD6A 3EWCA 2PGRA 5DBUA 4GUIA 2FLIA 3S4TA 3OYZA 1QT1A 3ZS4A 2VD9A 4XZIA 4H7ZA 5TD4A 1E9YB 3HGSA 3AFBA 4A8NA 1W37A 4A29A 1TE1A 1JD9A 1QR7A 2P5NA 4M51A 1TTPA 1TTQA 3R43A 3DGBA 2QS8A 2VURA 3AYSA 1BKSA 3AWOA 5GVJA 1A5SA 4S3JA 1HJXA 3K8MA 4Y9NA 3N2TA 1AA1B 1BVWA 2WNZA 2GOUA 4IQEA 3AO0A 3IRSA 3KBSA 2EG7A 4OTKA 2OEJA 1RK6A 2J7HA 4D9PA 2WANA 3USZA 3KOZA 2DUXA 1RQHA 1NWSA 3PJWA 3ZR6A 3C8FA 3VGFA 3K4WA 1XW8A 4UQAA 4X0NA 6REQA 3N29A 4K2SA 1WV2A 3M0ZA 1TB3A 5I3KA 4F2UA 3VA8A 4DZHA 2ZA1A 4DZ5A 1BSLA 3IUIA 3I68A 1FBAA 1TV7A 1M3UA 1AQMA 3EEZA 3NZPA 3M6YA 1P1XA 4R7WA 1KM5A 3D6NA 3QYQA 3GIYA 1F3XA 4UFIA 2PBOA 1WDWA 4ZQOA 1GW1A 1J2BA 4ZO8A 1ICQA 5AC4A 4FF7A 3AIEA 4O50A 3SECA 4DAFA 1EH9A 2CLPA 3NEVA 2WHKA 4RZ4A 4H9YA 3DFYA 2ZXDA 1M6JA 1NF7A 1TUFA 5DBTA 1XUZA 2Z00A 3XINA 1U5VA 4QBXA 1EB3A 3EOSA 1T41A 5ABHA 1Y65A 3UY7A 3G24A 1VPQA 3U9IA 5DF0A 4ZR8A 1TR1A 3URNA 4WZHA 3HQNA 3ANVA 3AHZA 3A24A 1PIFA 5D09A 5HJYA 4IG2B 3H2EA 1SFTA 9RUBA 4NAFB 4ZFMA 1W17A 5AYIA 3SEPA 5HWNA 4HVXA 5DEZA 2GJRA 3POCA 1RVKA 1J12A 1BXCA 2ZZ5A 2RDXA 3QRHA 1M5WA 4PUUA 4O1FA 3VIOA 4JTAA 3AALA 5C0QA 2DSUA 3W2LA 4F0LA 2FJUB 2XIBA 1V08A 1U33A 1A5CA 3FS2A 1HF6A 2E9MA 4KCVA 2JKPA 3ABRA 3BICA 1H5VA 4FI4A 1CLXA 1BVZA 1JCJA 1C7SA 2TYSA 1RPKA 3GG0A 5AYYA 4KW2A 4L1WA 2P0OA 5I0DA 3PUGA 3NIYA 5GPRA 1GTEA 1OCBA 2ZRXA 3WF2A 3OPSA 2W3ZA 3VNIA 2AL1A 1BGGA 1JDEA 3RR1A 3F1QA 2X42A 1ZJBA 1U1UA 3PSWA 5E6ZA 2DZXA 4MUZA 3UZJA 2DVXA 4HNOA 1VP5A 1JZ2A 3VDCA 4XBKA 4ZFCA 1DIDA 2BS9A 1KTNA 1XR2A 3MUAA 7ODCA 2FZNA 1D3HA 3CQHA 5F4SA 2BWGA 2YGYA 1XLMA 4JICA 5C9RA 1W56A 3O6DA 3V18A 3Q4DA 3WUGA 1TWIA 3PAJA 1UUOA 3QFWA 4MWAB 4PUMA 4AC1X 1SSDA 4I7WA 1YNYA 1T8QA 1JCMP 2H9AB 3T44A 1LORA 1S5VA 4G6CA 3HFTA 3H2FA 2ACRA 2D1ZA 3COTA 3G1SA 3QHNA 5BCAA 3MSDA 3GY1A 4DUXA 5E09A 1OZMA 2AGKA 1IWBA 3VIIA 4BCEA 4CQCA 1QO5A 4LAZA 1XLLA 4DI8A 1F2JA 5G1YA 3BGGA 3PTQA 2XPKA 1BRLB 2WJFA 3WQPA 3ITCA 4TTGA 3WQVA 5A8QA 5EFFA 3LV5A 3RX4A 3BG3A 3G0XA 2EPHA 3TYDA 5LGXA 2ASHA 1B3WA 3L23A 5EJZB 3F2BA 1GHRA 1WUFA 1RP9A 4NHVA 1VJIA 4LC6A 3WF3A 1F8MA 4A3HA 5CGQA 2A1YA 2VX4A 3SGUA 2W62A 4H7CA 2PP1A 3CO4A 2WSQA 4MDOA 4PMOA 2Q09A 2V2CA 3L4TA 5HMEA 4RE3A 4GIRA 4MSSA 3GLCA 1J5TA 4R85A 1ECQA 1JUKA 1PPIA 1OSEA 4C60A 3C2FA 5HQEA 5DELA 4ZVJA 1ZZMA 4MYAA 1UR9A 2BB0A 1GQNA 4I9MA 1OEPA 4NY2A 1ZLPA 3OVRA 2VYOA 1G5AA 1H3GA 4DLMA 4ZMGA 4KWSA 1KKOA 2ZZ4A 4DB7A 1E0UA 2Z1KA 2HS6A 1H0GA 4N6EA 4B5XA 4IHCA 2YCLA 4RJEA 4FX8A 2O9RA 1GZJA 5REQA 2I16A 2V82A 4B2DD 2RHGA 3WLJA 1XSJA 2YBUA 4UTWA 3M0XA 4NILA 3P7YA 3TR2A 2GPTA 1XH0A 5GNZA 5LIUX 3AMGA 2V6AA 1MEHA 4CD6A 2CLKA 1ZTVA 2A7NA 5CEWA 3FKKA 4PCSA 4Q4PA 1OGSA 2UY2A 1F6KA 3P2VA 2OO6A 1RLCL 4LAUA 1C29A 2G0WA 2YCLB 3TXVA 3O1NA 3CO8A 1XYCA 1EGZA 4UIOA 4O19A 2XGBA 4GUHA 3ITXA 3H54A 2IQDA 1H61A 5DMMA 3QW4B 1M01A 3MT1A 5G5IA 4Z0JA 2DZPA 2E77A 5FJTA 5CG7A 4YWIA 3NUKA 3RM4A 1QNPA 4ADUA 3W72A 2GK1B 3IAQA 2JQXA 1CX9A 1WDQA 1QI2A 3WK3A 3CAVA 4FLOA 1XBXA 4UFHA 3LB0A 2W6RA 3F4DA 4GXWA 4IGMA 2OT1A 3E0LA 1KWKA 5CLTA 2CZEA 2OYKA 5DRCA 1MXGA 1PTDA 1FHVA 5IM51 5CG0A 1MW2A 1ZFJA 4QGCA 3GNNA 4HPXA 3MUIA 4M0XA 5DCDA 1NDZA 4FF5A 1EJTC 3WEZA 3E2SA 5FAGA 4GGBA 2VGGA 2WHLA 1XLAA 1I1WA 2H3DA 5IXEA 5KINA 2YFOA 2Z4GA 4GC4A 3LDVA 2WKJA 1V4YA 4OECA 2XG9A 4IMFA 2FH8A 4BS0A 1E73M 2JBMA 1GCYA 3UWUA 1PX3A 4H6KA 2ZXAA 3AHVA 2OEKA 3W7EA 2OLSA 4AU0A 2NQ9A 4HQVA 1JG9A 2AL2B 4RX0A 1UWRA 1LROA 7CGTA 4UNLA 3BURA 3NDYA 4O54A 1FHLA 3LHYA 4C6EA 4DAIA 1VBUA 3G1DA 1R3SA 4PB4A 1XYAA 4PUDA 4YVVA 1UD6A 4M29A 2WVSA 2BLEA 2Z0IA 3H7VA 1XD0A 3LHTA 5FF0A 1CENA 2IQ0A 4O18A 4OGZA 4M3PA 2ZWYA 3KE0A 1TIMA 2PSNA 3OBAA 2P8BA 3TQVA 4IX2A 1UD8A 2YA1A 4MJMA 3CPRA 5I00A 3B0VC 2G37A 1OG6A 3GYEA 4OHQA 3FK4A 5FEXA 1DJQA 3PAOA 4UTKA 4AVNA 1FP8A 4EWND 2GVGA 2XIOA 4RPPA 1Q6OA 2WSYA 3VVGA 4X63A 4L9ZA 4GI8A 3P8IA 2GDUA 4OU1A 3OLIA 4IM4A 1V0KA 1Q6FA 2GVLA 4L61A 4A8IA 2POTA 4MNMA 3GBEA 5G4EA 3SZ8A 1EEPA 4E5TA 3CYVA 1XIEA 1H09A 2Q3RA 3AIUA 1V3JA 3IJ8A 1POJA 2DQWA 1ZBKA 3TN6A 1HVXA 3A4AA 4IGHA 3GHRA 3LI0A 1E9LA 4QDPA 3S2JA 2WW5A 4GIYA 4RE2A 3SQMA 5K9DA 4KT2A 3UU0A 2WJEA 3ZJ6A 4EANA 5DCBA 4B91A 1PYMA 3C2RA 3ALFA 2HS8A 1RA5A 2P88A 5M03A 4QSFA 1I2OA 3GVQA 1XYLA 5K7JA 3MKKA 1X6LA 3CT7A 1J0IA 2QW5A 4F0KA 1PZ3A 3KOFA 4ZA0A 3WJSA 2NX1A 1IT0A 1W0MA 4MNJA 1SFJA 1KBIA 4K68A 2Q8ZA 4GD0A 3G8RA 1S5MA 2RH9A 4GKTA 3UYCA 3NSXA 4L4PA 2BNJA 1KBBA 1HX0A 3IANA 1LF1A 4FSAA 1OZQA 3VNYA 5AVHA 4LFYA 2XZ7A 4YU1A 4RE0A 1JIBA 5FJUA 1FHDA 4GACA 1NELA 1JUBA 1B3VA 1UWQA 1MNSA 1Q7ZA 1JD7A 1S3TC 3UA4A 4JTLA 3RPTA 4JKLA 3VIFA 4BI6A 2ZDRA 2CZVA 1EPXA 4RZ5A 1XH1A 3I7RA 3KBMA 2G96A 3TXZA 1QK2A 2V5KA 1T8XA 2BOGX 2PWDA 5CLWA 3AQUA 4AZ7A 2I17A 3VDHA 4RKAA 5ENLA 5DN1A 3BCJA 3WDPP 1MUCA 3LCWA 1R3YA 2YPIA 3S83A 3K30A 4BWLA 1FX6A 3E1F1 3OZPA 4N2YA 1NP2A 2PTYA 4PMRA 1F05A 1KRAC 1Z7AA 4WX2A 3WF0A 3LPGA 2J47A 1YXCA 5FSDC 1X39A 2HCVA 2YDAA 1HO1A 1R3RA 4CEUC 1TTIA 3NL6A 1UOZA 4QHRA 5JIWA 1E6ZA 5DRIA 2PLMA 3WDQA 2IS7A 1JCTA 3WBXA 3UA3A 5F2LA 2UBPC 1ZSXA 1E0WA 1VLIA 2PDIA 4FOJA 3V1HA 1HT6A 1VPXA 3H21A 3VKCA 4LCRA 1P4CA 2Q3OA 1JZ3A 1EDTA 2GWNA 2ZRUA 4G1KA 4AZCA 1H63A 1E9ZB 5AC5A 4KRUA 3A64A 3JVAA 4NASA 3W6YA 3CLWA 3TWAA 5IHRA 4PH6A 1W54A 1RPXA 3SCWA 4D1JA 3UZ5A 4INFA 4WF7A 1U22A 4NUWA 4RDVA 4Q33A 3WBWA 3PTMA 4YHGA 4K7YA 4AIBA 3CXOA 3V7PA 4H1ZA 1MXDA 4MB4A 1I0BA 3TA9A 3PUDA 5A2BA 3VM7A 3LXBA 3MUZ1 3M6DA 1TVLA 3LPPA 3GFZA 1MEIA 2Z24A 3TN4A 3UPMA 2P10A 2PDMA 1WZKA 4BHYA 3S5NA 4FLRA 2BVWA 1Q6RA 1TJ1A 4E4FA 3KFTA 4BK9A 3DC0A 2XVGA 2VC5A 1CWYA 1MW0A 3W01A 2W27A 4JN8A 3UT0A 2MNRA 3ABZA 5T9BG 4M1RA 4FX6M 4Q8WA 5A8NA 3U57A 5CXPA 1TFVA 4JGDA 3E9AA 1VBRA 4CN1A 1DHPA 5BMXA 4ZQPA 4AD1A 3DH7A 4GI6A 4B4HA 2CKRA 1GOMA 3MUY1 1ISXA 2WVTA 3CAQA 2FVLA 5FKYA 3AIWA 3KZPA 4DZIA 1Y5VA 3QGAC 1EX1A 2V5CA 5CPOA 4FK9A 4HSOA 3WBAA 5FF2A 1R5YA 3WLMA 2JIWA 4NXSA 3GZAA 2NX9A 3P8JA 3P0XA 1K8ZA 3CIXA 3C0JA 3SGZA 4HKPA 2W63A 4QNEA 4UTWC 4P8UA 3HFYA 4KKXA 2BY1A 3ES7A 4QAIA 4E4PA 2QCEA 2DORA 3LOTA 1PWLA 1TPDA 1R38A 5HULA 3ZZ1A 1LL4A 3AS0A 3F2CA 1V3LA 1X97A 5BXPA 3VUPA 1GVIA 4B5UA 3SN1A 4QNWA 5DQPA 3L7RA 2VDHA 3EB3A 3MVTA 1HFBA 4LYRA 1ISWA 4RNJA 2Y8VA 3EWXA 3R25A 5CKSA 1U1JA 1F3TA 1RD5A 3MMTA 1QATA 3S46A 4BKNA 3H4WA 2D2GA 2DZVA 1MVYA 4YCOA 4C6CA 3EMCA 3CPGA 1DWHM 3I6TA 5H8PA 2ZVIA 2YBTA 1IIGA 2D23A 2XVLA 1HKIA 4U3AA 4F66A 4M6PA 3IUDA 2ZTKA 1A3WA 4NZ4A 3H22A 2F6XA 3QV8A 4YVPA 4X2PA 3MWCA 4GUJA 3B8SA 2HMCA 3AUJA 4UQDA 4LGXA 4ADTA 4EACA 4CU7A 3E0FA 5CAKA 3TCEA 1SM9A 3B9NA 4O1CA 2KAUC 1U5HA 1R3TA 3SCUA 3JUGA 1S2WA 5BMWA 3DFPA 2YCEA 1GOWA 4MWAA 3O6YX 4MDPA 2JEPA 3FCPA 3NYZA 4LAMA 2QGHA 2G8ZA 1DV7A 3U6WA 1Q6CA 2EG8A 3VDBA 1RSCA 3T4CA 4DZAA 3RMEA 4XZNX 3B8TA 1S46A 5EU9A 2PDHA 3WIJA 1Y7VA 1TTJA 4LJ3A 1V6XA 1WA3A 4X60A 3AAMA 3SADA 3H2NA 3U2EA 3SB0A 3GG7A 1V6WA 1ITCA 2XVPA 1GOOA 4LRTA 3UG8A 3L68A 1J79A 1RR2A 5A6MA 4FMVA 3WH5A 4YTUA 3LGGA 5H6HA 1GVOA 4MWAC 3MBFA 2FHFA 2FB3A 2Z7KA 1OIFA 1SJDA 4NG3A 4MLJA 4LOCA 3E6EA 3BMVA 1Z44A 3A12A 1HKWA 4JKKA 5KTLA 1ONRA 2AQWA 4QE1A 3W7CA 1YPXA 3TKFA 5A2AA 1P7TB 1WBJA 3CV6A 3VD3A 3W02A 1V93A 1KM2A 1YHTA 1AFSA 4QEEA 3EX3A 4R7OA 3BV7A 3AMLA 3XISA 3OLGA 1K4HA 4M80A 1XBYA 2H9AA 1UWTA 1AJ0A 1XLDA 3GIPA 3QV7A 4B92A 1ZL1A 2R1KA 2NQ5A 4RNHA 3S9ZA 3CUIA 2QJIA 4B5TA 2GGEA 1MMFA 3DFSA 4H6EA 3R0UA 3C3NA 3N34A 3R8GA 3LA4A 1R9YA 1GOQA 2HQAA 1WXYA 2YA2A 3G1AA 1AVAA 3TYUA 1FKXA 4YN5A 4A3QA 1I2NA 3KL5A 1XLIA 2V8ZA 2I5QA 2G97A 3TJIA 1QBAA 2NWSA 1PKYA 1TA3B 3OLEA 3N12A 1FWAC 1Z42A 2HK1A 3DFTA 4MGGA 1VFTA 3V0SA 2EEXA 4E8GA 2J79A 1GYLA 3ARXA 2XDFA 5H2ZA 4UQEA 3CTTA 4P02B 3SSZA 2J88A 3UZXA 1CI1A 1OGBA 1HGYA 4XG1A 1A80A 2SFPA 4XBSA 1EBGA 3OB8A 4NT0A 4FNQA 1UQYA 4LBSA 1BWLA 2XHYA 3CZJA 2LLEA 1FWWA 3ZWTA 1AUSL 1CGVA 2Q8XA 5A6BA 1SZGA 1BWVA 1XGDA 1LLOA 1LTDA 4LUIA 4HPHA 3T0CA 2PU0A 5E6YA 1UYQA 1WDSA 2QPUA 4UOZA 1UWIA 3B0YA 3URAA 5C9ZA 1DWJM 2HE8A 4UUIA 2E68A 1OK6A 1JZ6A 1UPMB 1JZ4A 3M16A 5HA7A 3QY6A 3U48A 4MB5A 3VNJA 3BV4A 4LF2A 2EPNA 3G1VA 1ZRQA 2FDMA 3GO2A 4C1KA 4S2BA 1FDJA 1A0DA 3RLHA 3WQEA 3HJZA 3WD1A 5ABEA 3N3TA 2DPEA 1BYBA 1VHNA 4GWEA 1WAUA 4XAFA 4CQ9A 3I3BA 3P6LA 7REQB 3EPNA 2VZUA 1NTHA 4Q6XA 3WK0A 2Y0FA 3VIJA 3PF3A 1QHOA 1CXIA 4FNUA 4JY8A 3G0UA 2IXVA 2OGYA 1K77A 1IZJA 1LQ0A 2Y6ZA 1EOMA 3HPSA 2WC7A 1OM0A 3G1FA 4QTGA 3AHTA 3LTSA 3MO7A 1GJUA 2IW0A 1A5AA 3DC8A 3QYSA 1KQZA 3MJMA 3BZGA 3FW6A 4CN4A 3UR8A 3T2QA 1MZHA 4BZYA 1VFMA 1Q66A 1TWSA 4JTEA 3V4BA 1IYXA 3VGDA 4LALA 2AL2A 2QIIA 5ABTA 3SUUA 1CB7B 1FFRA 3AISA 1EC7A 3PBYA 4H9VA 2GFTA 1BTMA 3LGDA 2C8NA 3DZ1A 4GOAA 2OZTA 2YL6A 1ICPA 3N4EA 2BHZA 2DT2A 1LLZA 3PZQA 2EXOA 1B1YA 4IIHA 1BSIA 4W86A 2V5JA 1P5BA 1LUCB 3H24A 1R7OA 1Q6EA 4XVDA 3IK2A 3T0AA 1TPVA 4OBRA 2VR2A 4YIWA 3W29A 4JFUA 3RLVA 3SN4A 2R8WA 3PK7A 4Y9OA 3S2LA 1F76A 3CWHA 1L8PA 3GW0A 2PRLA 4HTYA 2WV8A 3PWAA 2Y63A 2I1OA 4JIEA 4LEQA 2WZEA 3EZ4A 2HVOA 2GDQA 2QR6A 3MDUA 3W53A 1J0KA 4OE7A 1I9CB 5JH1A 1H7NA 1VAHA 3KEHA 4JIQA 5LNSA 2NQLA 4GYJA 3BMXA 4DI9A 4XKYB 2V3DA 1X8FA 1W8SA 1BHGA 4UNKA 3R1ZA 2VQUA 4Z1BA 2E8YA 3LRMA 4TX8A 4Q6JA 3IVUA 3OZOA 3H23A 1PUDA 1IE7C 4ML4A 2J9ZA 4FLSA 2G3FA 2C79A 3MMDA 4HIBA 4MY9A 5AKQA 4AWUA 2EPLX 2GGGA 4DELA 2WKLA 3RF9A 3CB8A 4L4OA 3GVGA 4JQ1A 4V28A 4FNPA 1GQJA 1KR0A 1NFGA 1VBJA 2F38A 2G5WA 5AHMA 2GZXA 3RCYA 2A3LA 3MP5A 2B31A 2NV1A 1QAPA 5D2WA 3WMCA 1LBLA 3GNDA 1ME9A 5EMKA 3B9EA 1ISZA 4HU4A 4MZ1A 1P0BA 4QISA 1LRQA 2QPSA 2VZOA 3QTGA 4A6GA 4E2DA 1FH9A 2Z26A 2VHLA 3JZUA 3KCJA 4JN7A 4A4AA 1FH7A 2PMQA 3W2MA 4KGJA 1H5YA 4JTGA 1OT1A 3B06A 1LBFA 2JEQA 3MBDA 1X6NA 3EMZA 1UPPA 4DYKA 3LNPA 3UP8A 3LEPA 2FHCA 3CBWA 4PFHA 1Q8AA 3QV9A 1J2WA 4QS5A 2OYLA 2IPJA 1J0HA 4S3FA 2O9OA 3NPXA 4QX4A 3ARWA 3BAKA 2OU4A 2FKPA 3ZVHB 4WXYA 3W7IA 1E6NA 3VC6A 4REQB 1ADDA 1G7VA 1OINA 5BWFA 4LXFA 3GTIA 3THUA 1WKDA 3UWVA 3L12A 3N17A 3OG2A 3AS1A 4AZBA 1GNXA 3HBLA 2PS2A 4FNRA 3O7UA 2PDXA 3U3HA 1E56A 1XISA 4N0RA 2QEZA 3CUHA 5DANA 1TV8A 3WDHA 3BQ5A 2CLIA 3LV6A 3EOUA 4UTTA 4HD5A 2TODA 4S3DA 5E0FA 1F73A 3PPCA 3I10A 1VBGA 1X1OA 4YVXA 3WYZA 3GTHA 2A79A 4K36A 2QV4A 2AAMA 4PUEA 3EDFA 5C9UA 4OFCA 4R33A 1JNDA 2BGQA 5I3JA 3FN9A 4L4MA 4ATLA 3MP4A 5I7GA 1GGOA 4AHPA 2WJZA 2PCEA 5FEPA 3F5KA 8A3HA 4J3VA 1JPKA 4GO8A 3W1LA 4ZQRA 3DX5A 4UOQA 4YTQA 4JD4A 1DE6A 1R2RA 1NVMA 3KHDA 2OGJA 2A6LA 2CXEA 4W89A 1IQ8A 3W1PA 4N42A 1PZ2A 4J28A 2CKSA 2VENA 3BCDA 1V77A 3WO8A 3TTEA 4NVTA 3IAPA 3DYMA 5D9OA 4IGNA 2WCAA 1EGVA 3M0LA 5I24A 2XH2A 2VELA 2DZWA 2VZVA 1ZUAX 4KWVA 4NKCA 2HK0A 1E40A 4HCDA 4QS6A 1VC4A 1BF6A 4NNBA 2QCMA 1TPFA 3VGHA 3ITOA 1T99A 4HU3A 2Y1HA 3M07A 4J3SA 3FVDA 1DIKA 4GVIA 1Q85A 2DW7A 3F4VA 1OFAA 3TC3A 3W7DA 2GSHA 1XIFA 2Z7GA 3E2RA 2X40A 2VI0A 3RPMA 2R1PA 4QP0A 1VFSA 4KF1A 2NUXA 1YLVA 3VCRA 3VKAA 4W87A 1P0EA 4I5XA 4CU8A 3B9OA 2GGIA 1CZ1A 4IMAA 4L80A 1X6UA 1QCWA 3T81A 1IV8A 5D04C 3NNTA 1FWGC 1B30A 3SUVA 4JZ5A 2BX7A 4TVUA 3TFXA 1VJZA 5DY3A 5A6LA 4GRSA 1EX5A 4CNPA 4JBRA 1D3CA 3HGRA 2W92A 2OQYA 2V30A 3EXRA 3THAA 4LS0A 2PA6A 5I3HA 1JYXA 2ZBTA 3LRLA 4XWUA 3MP3A 3EXSA 4MJZA 4LV4A 3EPOA 1KRMA 3CV2A 2G3NA 4MYXA 4PMVA 3QLDA 3EBVA 5GNYA 3PBGA 2QHAA 3EOOA 4PMXA 3GFXA 4NNCA 1VEOA 3PZVA 3HA1A 3QPEA 4TVCA 3GTNA 2FGBA 4Q22A 2CWNA 4LRSA 3MANA 3RN6A 3S1UA 3I4KA 3ZR4A 3RCNA 1EZ2A 2QVHA 4UMBA 2VL4A 3NXFA 2UY4A 4LS2A 2QDHA 3GZ3A 3O6AA 2VXNA 3KCLA 1SU5A 4I6KA 2QAFA 3VZZA 3LERA 3GG1A 3KDOA 1XWYA 2BGNE 4C65A 5EJ1B 1KB3A 4DNMA 4LH8A 3MWAA 3SCQA 3VD5A 3PPHA 4FP1A 3W74A 3KP0A 4I7VA 4L9YA 4EAYA 5C9WA 1W5OA 2CERA 1S1PA 2ZC8A 3S5ZA 3ZXWA 3S2NA 3OW1A 5EMMA 1ZHAA 2PDKA 3ZFHA 3LYEA 3VIGA 3LHWA 1DYSA 1YMYA 1A47A 3CUGA 2C0HA 1UKOA 3BAJA 1G7UA 4PEKA 2OB3A 4CVUA 1UH2A 2ZDSA 4O53A 2J27A 4GYFA 1XKYA 4JPGA 4UNIA 3LXCA 3SIMA 4UFJA 4WR3A 1EP2A 3FAXA 1UMLA 2WMGA 4Z2HA 3GDBA 1VYSX 1WDRA 3OIXA 3BQ6A 3ABXA 4X9SA 3AROA 3A3WA 2INZA 4JTCA 1YPFA 3W7GA 4NRRA 4Y9MA 3NTYA 4MY8A 5IHSA 2R1NA 1TPWA 3AXMA 3AMDA 2PZNA 3IARA 3W6LA 2QCCA 4W84A 2WSKA 1UBSA 3LTYA 2X1SA 2Z25A 3U2CA 1T5AA 2B7NA 1ZBCA 2UZ9A 3OLDA 3QZEA 3SIZA 5I79A 3N4FA 1FWHC 1R6WA 4Q4RA 3RG6A 2QQ6A 1RV8A 4G1NA 4YCPA 1O5KA 3VM5A 2X1TA 1XC4A 3NA8A 1TKKA 4MWAD 1FVPA 1O1ZA 3DESA 1PO9A 1E6RA 3ANUA 4JTSA 2NWRA 3TOPA 2PDUA 3MHFA