3GH4A

Crystal structure of beta-hexosaminidase from paenibacillus sp. ts12
Total Genus 191
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
191
sequence length
519
structure length
507
Chain Sequence
HHHHSSGLVPRGSHMASMSQPSILPKPVSYTVGSGQFVLTKNASIFVAGNNVGETDELFNIGQALAKKLNASTGYTISVVKSNQPTAGSIYLTTVGGNAALGNEGYDLITTSNQVTLTANKPEGVFRGNQTLLQLLPAGIEKNTVVSGVQWVIPHSNISDKPEYEYRGLMLDVARHFFTVDEVKRQIDLASQYKINKFHMHLSDDQGWRIEIKSWPDLIEIGSKGQVGGGPGGYYTQEQFKDIVSYAAERYIEVIPEIDMPGHTNAALASYGELNPDGKRKAMRTDTAVGYSTLMPRAEITYQFVEDVISELAAISPSPYIHLGGDESNATSAADYDYFFGRVTAIANSYGKKVVGWDPSDTSSGATSDSVLQNWTCSASTGTAAKAKGMKVIVSPANAYLDMKYYSDSPIGLQWRGFVNTNRAYNWDPTDCIKGANIYGVESTLWTETFVTQDHLDYMLYPKLLSNAEVGWTARGDRNWDDFKERLIEHTPRLQNKGIKFFADPIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular cloning and crystal structural analysis of a novel beta-N-acetylhexosaminidase from Paenibacillus sp. TS12 capable of degrading glycosphingolipids
pubmed doi rcsb
source organism Paenibacillus sp.
molecule tags Hydrolase
molecule keywords beta-hexosaminidase
total genus 191
structure length 507
sequence length 519
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2009-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
A PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3gh4A01
3.30.379.10 Alpha Beta 2-Layer Sandwich Chitobiase; domain 2 Chitobiase/beta-hexosaminidase domain 2-like 3gh4A02
3WY1A 4D71A 3IJ9A 2CERA 2XIBA 4QAWA 2DT0A 4BQ4A 3W6LA 2UY4A 5C70A 4ZFMA 2G3NA 5D8WA 3PZIA 2A3AA 4HZ8A 2CITA 3NDYA 1H4PA 3CH9A 1W9UA 1E6ZA 4NZCA 4UCFA 1PX3A 5LYRA 2J7HA 3CHEA 3KWXA 1DWHM 3CPUA 2BVTA 4GIAA 4OIFA 3QHMA 2YBTA 4HPHA 5EFDA 2J8FA 4MJ2A 1NOUA 2DT1A 3AIRA 3CGTA 4X0VA 4D6FA 1V3IA 1W3JA 3POCA 2WXDM 1QNPA 3RM9A 4ZEPA 2BY1A 3VIJA 1W9XA 4AD1A 3L4WA 2QF8A 1B3YA 4B9YA 2PBOA 2BHUA 2XSAA 1KBBA 5I23A 4NF7A 1E6XM 1PX4A 3VPLA 3ARZA 3GNOA 1H5VA 5M5DA 2PWFA 2ZX5A 3J7HA 1W1TA 1NWUA 2VX4A 1J01A 1UR8A 1CGTA 2VRJA 2DGAA 4P8UA 4W5UA 3O2LA 3WNKA 2GUYA 3PTKA 2OWWA 3WQ6A 4WLCA 2CHNA 3ALGA 5CSUA 5DFAA 4UR9A 1E6PA 1CXEA 2CKRA 4C90A 3AMLA 5E9AA 4UOJA 4B3KA 4BQ5A 4PUDA 4J7RA 1DWJM 1I75A 1UA3A 2FHFA 2VNCA 2A3BA 1C7SA 1HNYA 4AEFA 4QLJA 1E71M 2VR5A 3K8LA 2XWDA 3WD0A 1V08A 1A47A 1B3WA 1M7XA 5AC4A 1PZ2A 5E6ZA 1VRXA 1CWYA 4DUWA 4TTUA 4W86A 2J8GA 2FH8A 4YHGA 1OD8A 2FGZA 1GJWA 1KXTA 5CGMA 2WK2A 2X1IA 4PTVA 3K8KA 1ODZA 1CXLA 4JAWA 1GHRA 4HMDA 5CPSA 3BSGA 4FLOA 6A3HA 1FOBA 2PWDA 5M17A 2CBIA 3L2LA 4AISA 1GCYA 1W3LA 1W1PA 2XIIA 3ZSTA 1M53A 4JHOA 2UY5A 4HU0A 5D9MA 4HZ6A 2YDSA 1BLIA 4HP5A 3VIGA 1GQLA 3NIYA 4PMXA 1B90A 4OKDA 1SFSA 4CCDA 1E5NA 3AIVA 4YPJA 2WMIA 1HF6A 3OGVA 3CMJA 4JCMA 2O92A 5KZ6A 1CGYA 1KB3A 3ZM8A 2OWCA 1FP9A 1NOFA 3WF1A 4E8CA 1XV8A 1MXGA 4AZCB 3MUZ1 3ZMRA 3AQUA 3ZJKA 1J10A 1JI1A 4Z2HA 4U5KA 5A6LA 5A8MA 3OBAA 3QHOA 5BXSA 2BXZA 1FH8A 1JXKA 1XSKA 1MWOA 2WBKA 1TVNA 1R7AA 3ZJ6A 5LA2A 4UFKA 1BYBA 3WDIA 2EO7A 3AYRA 3AHTA 2Y8KA 4XUYA 1E0XA 3N12A 5CG0A 1DWGM 3BMVA 2DSZA 3GXIA 4D1IA 1M01A 1UWRA 3SCNA 1E70M 1QI4A 1RH9A 1ZB5A 4CN6A 1MXDA 4TVDA 4C7DA 2J7CA 4PMRA 3CBWA 3WF0A 1E72M 4FLSA 2E8YA 2E4TA 1V02E 2NT0A 1GW1A 2ZOXA 4QLKA 1LG1A 2GDVA 3AXHA 1E15A 2YIHA 1TUXA 1JDAA 2O9PA 1VEPA 4MB5A 4N0RA 5E09A 4PTXA 1VFMA 5BROA 7CGTA 1UH3A 2XGBA 4D6HA 2BNJA 4YN5A 2E8ZA 3DHPA 1V6VA 4PN2A 1TE1A 3QHNA 2DSVA 1V03A 4JKLA 1HJUA 4P7QA 5IXEA 5FOOA 4UZUA 3AS1A 2VCAA 3EDKA 1JL8A 3SCUA 2UWFA 4XX6A 1JNDA 1PX8A 1H3GA 2OSXA 2JF7A 2WZEA 3AOFA 2BVYA 4LGXA 3IAQA 2BVDA 1PJ9A 2JEQA 4PMOA 2HVMA 4GINA 1K6AA 1BPLB 2YJQA 1VB9A 5AC5A 1K9EA 2ZX7A 1XCWA 5GNXA 1W3KA 2WVUA 4PBGA 3VGBA 1ZU8A 1H11A 4D6EA 4AD3A 1C92A 1CDGA 2JEPA 4JCLA 4CN4A 5BXTA 1CLVA 2OSYA 2QV4A 3VKKA 5I5RA 1Q6CA 2XPKA 1W9BM 3VD5A 3GBDA 3N17A 1H09A 2OYKA 1JNEA 4MB3A 4RE4A 3GM8A 1G9HA 3AIWA 3WH6A 2X0YA 3CHFA 3GXMA 3VDCA 1DTUA 4ATDA 2PI6A 3CZEA 1US2A 4JKMA 4J3XA 4B16A 1VFUA 1K9DA 5M3WA 3EDFA 3RM4A 1Y7VA 3W38A 1PAMA 3WD4A 1ODUA 1WPCA 3ZQ9A 4E2OA 5ABFA 4ML4A 1C8XA 2D23A 2WW5A 1UKTA 3RMEA 2XJ7A 3U5UA 1XGZA 2WNWA 2E9BA 6TAAA 2VZSA 3AHVA 1UKQA 3WNLA 1B9ZA 1EQCA 3WH5A 5DO8A 3CUGA 3F5LA 3GNPA 2VUYA 3II1A 4L4PA 1OSEA 3TA9A 2YL9A 1EIBA 1CIUA 1V02A 2D3NA 3UESA 1EA9C 4DWSA 2RGLA 2VX7A 1FFRA 2QHAA 3VU2A 5IFPA 4CGTA 3ARUA 3WMBA 3POHA 1ISXA 5IDIA 2WB5A 3WD3A 4PCTA 1KWKA 1PZ3A 3VVGA 2O9TA 4PMVA 1R8LA 4BS0A 1E6QM 5ECUA 5A69A 3AZTA 4JFWA 4C7FA 1KGUA 4PTMA 4UFLA 1VBRA 2Z1SA 3WL1A 1YQ2A 3ZJ8A 2V5DA 5A3HA 3IANA 2EBNA 2DT2A 2WMKA 2ZICA 1W32A 1U30A 3KL0A 2WLYA 1UD6A 2X0HA 3CZ8A 1DEDA 1HL8A 3BGAA 3W4RA 3IJ8A 1SMDA 1V6XA 3CIVA 1E4MM 3FHQA 4V27A 4E8DA 3WF3A 5A2BA 4W7UA 1C93A 2D22A 1SR0A 3TTYA 4Z2KA 5I24A 1HKJA 1TMQA 1UD4A 4QDMA 2XVNA 5F7UA 1AQ0A 3W29A 2QPUA 4MDOA 2CEQA 3W28A 3WUFA 4C7GA 3BAJA 1EGZA 2E40A 4MTVA 3SUUA 2ZWYA 2GJXA 2WC4A 5D9NA 3WDRA 3WKZA 1WE5A 5A6BA 5I6SA 5BRPA 3T2PA 1W9VA 3L4ZA 2C7FA 2BS9A 3PBGA 5D4YA 2QMJA 2RGMA 2G3IA 4AZGA 3B9DA 1DWIM 3BAYA 3NSNA 2JALA 2W5FA 3A3HA 5E0CA 3WQ5A 4U31A 4K68A 1XD0A 1ISVA 3WF2A 3BCFA 4KRUA 3W6MA 1JZ5A 4D6JA 3ZJ7A 4EE9A 1UWIA 5CZKA 2AOSA 3I3EA 3CUIA 3SUVA 5D9PA 2BY2A 4S3JA 5DF0A 3WNPA 1HJVA 3NSMA 4AD0A 4PTWA 5A8PA 3VGDA 4P8WA 4CU7A 2WMGA 3CHCA 1OGGA 4OOUA 1WAWA 2YLLA 1EO7A 4BQ2A 4AC1X 3VGGA 1E3ZA 2VJXA 3N1AA 3O6AA 2YLAA 2W67A 1W91A 5A8NA 3RCNA 1WO2A 2X8RA 3FNDA 2BY3A 4W8LA 4ACZA 1H41A 3MKKA 1EHNA 2ZUUA 1BSIA 3L4YA 2NW0A 3W26A 2DEPA 4UZSA 1TCMA 1WP6A 3MV01 1E9LA 1NWSA 2ZX9A 5CPQA 3WUEA 4Z2IA 5HNNA 1QNRA 1E6RA 4GO8A 2QPSA 2V38A 3FW6A 2DSWA 1RP8A 5CJ5A 2D24A 3IJ7A 3SCWA 4ACZB 3CUJA 2BXYA 2A3CA 1GQIA 4CD7A 4HOZA 3OZPA 2PBGA 4ATLA 1GHSA 5FIPA 1WCGA 2A3HA 3EDEA 4PRWA 2IXUA 4J3UA 1GOIA 4W7WA 3ARVA 1CXIA 3MUAA 4P8XA 5A6JA 1PBGA 2DT3A 3PZGA 4GI6A 1OIFA 1J0KA 4AEEA 1G0CA 2J4GA 4DUVA 1EH9A 1GNXA 2VZUA 2XGIA 1A3HA 2ZXAA 1G5AA 1J0JA 2GJXB 3G6LA 1D3CA 4TVCA 3VINA 1EXPA 3RILA 2AMGA 1I1XA 3MMWA 3BLKA 1DWAM 1EHAA 1FFQA 2C8NA 3L4XA 4P7RA 3MMDA 2Y24A 2HISA 5JBEA 3WNNA 1CNVA 4EKJA 3BAXA 2JIWA 2EXOA 3OLDA 1BF2A 5I78A 1JDCA 1N82A 4Z2JA 3ARWA 5DEZA 4URIA 3UR8A 4JL2A 1DHKA 4V28A 3OB8A 1V6YA 1GVYA 2W91A 1Z32X 4H8UA 3ZOAA 1R85A 2ZWZA 3EMCA 4W89A 2VRQA 1JD9A 1X6NA 1HKKA 3AYSA 1PIFA 5BCAA 1HT6A 3PZTA 1CENA 1E4NA 3A4WA 3T0DA 3WF4A 3AZSA 2W63A 4R27A 4AD4A 1SMAA 4HOXA 2J47A 2G8ZA 1WZKA 1E73M 1AVAA 4B9ZA 4TX8A 3VDHA 1XYZA 3SCSA 2XM1A 3GH5A 2W92A 4OBRA 1JZ4A 4IPLA 4DM2A 2GK1A 2FHBA 3LPGA 1QNSA 4MB4A 1V3JA 2YL8A 2VX6A 4J3SA 1GUVA 2GJPA 3AIBA 1WDPA 3AS2A 1JFHA 1MFUA 3KE0A 1E40A 4U5IA 1C90A 2DPEA 4TTGA 3S2CA 1QPKA 3D3AA 2D3LA 3ARPA 4U3AA 1UYQA 3AIQA 1W1VA 3PZUA 4H2CA 4MADA 4NRSA 1I1WA 3N04A 4OJYA 1NOWA 3NYDA 1JD7A 2PWHA 1J12A 4MDPA 4M8UA 4HOWA 2VRKA 4JFTA 2WC7A 3WDJA 4OBSA 1BFNA 1BYCA 5HXMA 4BQ3A 2DQXA 1JYVA 1UWUA 4PMYA 2XVPA 4HU8A 2FDMA 4UQEA 1Q6EA 4CD6A 3NSXA 4JFUA 3G6MA 1WB0A 2W61A 1ZBVA 3U7VA 2MANA 1B2YA 1HJQA 4ACYA 1VEOA 1BVNP 4ZXLA 3M6DA 1E0WA 2D0GA 3AMGA 4NRRA 3VMOA 1JF6A 4PSRA 3AHZA 4H7VA 4WKFA 4IM4A 2ZUVA 4U2ZA 1H49A 3FAXA 3N18A 4HMCA 1BG9A 4LYPA 3RIKA 2GJRA 3FY1A 1YHTA 3GZAA 1ISZA 3JUGA 5CGTA 4W88A 2ZXDA 4P8VA 3T2OA 4HTYA 4D1JA 1E6NA 3GBEA 1OWQA 5GNZA 4HA3A 2CPUA 3WDPP 1OD0A 5IHSA 4DWSB 2D2OA 4GZIA 4W5ZA 5ABGA 1MW0A 3L4VA 1UOKA 4LXFA 3BSHA 4HPGA 4AD2A 4LX4A 5JIWA 1ISYA 2CETA 1FH9A 3OGRA 1CLXA 4RL3A 4MNMA 2XVGA 5A6AA 1HVXA 2J75A 1U33A 3AMKA 1E5JA 3WMCA 2ZUSA 3AIEA 3UG3A 1TZ7A 1KWGA 2QMKA 3MU7A 4GZJA 3WIJA 4CCCA 4HA4A 3RO8A 1E1EA 1WDRA 1PIGA 1CXKA 1X6LA 2YDQA 3WQ4A 1V3KA 1BGGA 4J3VA 1CEOA 4A4AA 3WD2A 1C8YA 5EFFA 3ARTA 1FA2A 1NP0A 1HJSA 4MJ4A 2X2YA 3CZJA 5E70A 3FN9A 1HJXA 2ZXBA 3LPPA 4UQ9A 1HN1A 2XFYA 2J74A 1XD1A 2J7DA 2BHYA 2VCCA 1XH0A 2Y8VA 1J18A 2XUCA 3WUBA 5AYIA 4A3HA 1JZ2A 4KH2A 1M04A 2FH6A 1ESWA 4CVWA 3AXIA 1CGXA 1E43A 1VJZA 3TTQA 1B3ZA 1ZBKA 3EDJA 3VGFA 5I79A 3EDDA 4JIEA 3A6OA 1QHZA 1EOKA 1GOWA 5HOSA 4GQRA 5EB8A 3FAWA 2QLYA 3K8MA 3HN3A 2G41A 1JIBA 4W8BA 1QNQA 1VAHA 3AROA 3ECQA 1JF5A 4UNIA 1JZ3A 2XFFA 4JHZA 1VENA 2TAAA 3BMWA 2Y5EA 1CGVA 3WDHA 2PF0A 3M7SA 4AD5A 4PCSA 1B3XA 5FCZA 1UA7A 3DC0A 3KZSA 1VEMA 3MSDA 3L4UA 3DYMA 2X05A 1KQZA 3WEMA 2CIPA 1WDSA 1XSIA 2GFTA 1VJSA 4WSKA 4Z2GA 1VFOA 2YOCA 3NDZA 2ZE0A 4OZOA 3O9NA 4QFUA 2X09A 5ABEA 3ZIZA 3F4VA 3DHUA 3K4DA 3U57A 2VQUA 1ITXA 2BFGA 1C7TA 2YBUA 1VIWA 1XYFA 2EJ1A 3TTOA 4F66A 4V2XA 1ZBWA 3APGA 1JI2A 3RPMA 2EEXA 2VVNA 1ITCA 5LA1A 4XV0A 1GJUA 1KXQA 4HA1A 1MVYA 1W3HA 2J77A 4BZYA 1GZJA 1TVPA 1TA3B 1TG7A 3HU7A 3SCQA 3MUY1 5I2UA 3BAIA 1OINA 4ZENA 1JG9A 1QI3A 4AMCA 2D20A 5A94A 3VILA 4PSPA 1UH4A 4AZ5A 3WFLA 1CGUA 2ZIDA 3BAKA 3DYPA 2XG9A 3ZO9A 4P7NA 3VUPA 1BYAA 2C0HA 1J0YA 2XM2A 2WZHA 4FF5A 1CZ1A 1KGWA 3T08A 3SCVA 3TOPA 1OT2A 3WNMA 5I0DA 3QGVA 3TTSA 4IUGA 3PHAA 2V3DA 3AHYA 3M46A 1LL4A 2WHKA 1KQYA 3CZGA 4AZ6A 2E9LA 3N13A 1H1NA 1MQRA 3T09A 3WFZA 2BY0A 1WKYA 1J0ZA 2WAGA 1FH7A 3NUKA 2V3GA 3SUSA 1VF8A 1XHGA 3RDKA 3CMGA 1O6IA 3WENA 6CGTA 1L8NA 4HMEA 4GPNA 4M82A 4S3KA 5AY7A 5EBAA 1ZJBA 5C71A 1OBAA 4OUEA 4TUFA 8A3HA 3VGHA 5A2AA 3AFBA 4QLLA 2UY2A 4ATWA 1MYRA 4U2YA 1JYXA 1GOQA 4M24A 4N42A 2CYGA 4W93A 1C3FA 5C8BB 3RM8A 4GKLA 3W27A 2WMHA 1CBGA 1HP5A 1UR0A 1QW8A 3U7BA 1QHPA 4LQ1A 3LMYA 3OA5A 4D6CA 1QHOA 3QR3A 1E6SM 1IT0A 1EQPA 3WBEA 2Z1KA 4BF7A 4P7LA 2WZIA 1F4HA 5BRQA 2W62A 3GH4A 3MSGA 1VBUA 3VOCA 4AZBA 3EYPA 4EK7A 1U2YA 3GDBA 4J27A 3AISA 1JYNA 3TP4A 3PZMA 1UHVA 5GPRA 2WKGA 4MAZA 3ZT5A 1KFWA 2J62A 3EBVA 2EPKX 4B15A 3GNRA 1AMYA 1GVIA 3CUFA 4JFSA 3GH7A 4XZWA 2J7FA 3OZOA 3VO0A 2DIEA 3ZSSA 1RD6A 3KL5A 4U33A 4UFHA 4H04A 5BYWA 4QCEA 4LYRA 5D9OA 1MFVA 1HJWA 3CHDA 3MV11 5GNYA 5JBDA 3GYCA 2D0FA 4WF7A 3WN6A 1QI0A 1DWFM 3ARXA 1JDDA 5CPTA 1UWTA 5A6BD 4GI9A 1H0GA 1WZLA 3CTTA 2WMIB 2OYLA 2VOTA 4PYSA 3VD7A 3FHAA 3F5JA 3VD3A 4B3LA 1UD5A 1ISWA 2CBVA 3SIMA 4Z2LA 2XFRA 1CYGA 1Q4NX 3ZT6A 3VX0A 4W84A 2JFEX 3I3DA 2CHOA 3SCTA 3WELA 1XCXA 3SCPA 1WDQA 3WQVA 3VIOA 2YA0A 1HKIA 4FMVA 2CBUA 1E4LA 3VGEA 4CUCA 5A8OA 2ZX8A 4TOQA 5ABFB 1B0IA 3UERA 2VO5A 1KCLA 4DM1A 3EMQA 1G94A 4MNKA 3MANA 2VVSA 7TAAA 1J0HA 4UTFA 1C8QA 1OCQA 3ZT7A 1EOMA 2ESCA 3WEOA 2VR4A 2CBJA 1JAEA 2XWEA 5DT7A 4M80A 4M81A 2PC8A 1VFFA 4UFIA 1B3VA 1NWRA 3WMSA 1W9DM 2W4XA 3E1F1 1EDQA 2WCAA 3U5YA 1US3A 4AWEA 1NARA 1NQ6A 2E3ZA 2VTFA 2VURA 1EDGA 3B8SA 2XSBA 4W87A 1KR1A 3BXWA 3VD9A 2JE8A 3VMPA 1UZ4A 1K9FA 5I77A 5A6KA 1J0IA 4PEEA 4WIWA 4PUEA 3VM5A 5HPOA 4J28A 1CGWA 3W53A 3VM7A 2E0PA 2WCSA 1NP2A 4KRTA 2J25A 2VZTA 4GXPA 4MNLA 4C91A 4UQBA 5A2CA 1R87A 2O9OA 1UR4A 1ECEA 1BQCA 4PMQA 2WWDA 1BTCA 8CGTA 3WH7A 4WK9A 4H8HA 4X9YA 4AIEA 1W1YA 1S46A 4BCEA 4CKQA 2WANA 3IAPA 5CLTA 1R7OA 3SCOA 1LL7A 1E55A 4TX6A 3W37A 5A95A 1D2KA 1UR2A 3PZ9A 3GTNA 4A3YA 3BH4A 3WH9A 1JXJA 1UKPA 2VCBA 2CESA 2CNCA 2O9RA 3BLPX 2PWGA 4R5EA 3B9AA 1LG2A 2VC9A 5KEZA 3VD4A 5A6SA 1UUQA 5FKYA 4GZEA 1GONA 3PZOA 1GQJA 2A3EA 1V6WA 2GDUA 5ABHA 4LYQA 3T0AA 5GQBA 4F8XA 4QP0A 4CD5A 1G01A 3VNYA 2DIJA 3UG4A 1JZ7A 3OLIA 3VDBA 4MAVA 4Q7NA 3LPFA 4M1RA 1RP9A 3AS0A 5M03A 3W0KA 4UQDA 2GSJA 2VT0A 1BHGA 4FK9A 4F9JA 5AYBA 3WD1A 1GPFA 1QNOA 3ZR5A 1TA3A 3PZQA 2AAAA 2D0HA 4NI3A 2PWEA 4GO9A 3AICA 1BGAA 2G3MA 1QI5A 4H8VA 1EO5A 1FHLA 2WWCA 3S6TA 4UQCA 1QBBA 1UG6A 5A1AA 1V0LA 4AYSA 2G3JA 1KGXA 1OT1A 1WNOA 1K9TA 1LLOA 3AHXA 4J3TA 3RJXA 4NSBA 4M56A 3AS3A 1QOXA 5JIPA 4M29A 4W85A 1X1NA 4JKKA 2YL6A 2WVVA 3VNZA 1H0IA 1HKMA 3CUHA 3N15A 1HVQA 3T0BA 1OGSA 1J9YA 5E0FA 1MW3A 1UWQA 5DMYA 3VDAA 3VIHA 3A4XA 5CQ1A 1C91A 1V0MA 3W82A 4D6IA 1QW9A 2BV9A 4H41A 1P6WA 4EAMA 2DH3A 5IHRA 2XYLA 2D1ZA 3L4TA 1XC6A 2XHYA 3NCOA 2XTKA 3WQ8A 3VX1A 1GOMA 1PEZA 4MPKA 3MS8A 3MO4A 1ZL1A 3AMCA 1H2JA 5A8QA 1QBAA 5A6MA 3RJYA 1IZJA 1UZ1A 1UKOA 2EQDA 3PN8A 1QVBA 2VQTA 2F2HA 1W9PA 3KL3A 3VIKA 4AY1A 4F9DA 4TXEA 2PB1A 1J11A 1CXFA 3K4AA 1V6UA 1E1FA 1LJYA 4QCFA 4WKHA 4YHEA 3PTQA 3VIMA 4KMQA 1GOKA 3PZNA 1BYDA 5FL0A 2EPNA 2V5CA 1HXJA 4U3CA 1JYWA 4D6GA 1GQKA 4IISA 5HPCA 3NJ3A 1D7FA 1MQQA 1V3LA 4UQAA 1LWJA 3I3BA 4CU8A 3AIUA 3CLWA 2ZUMA 1M03A 1W2PA 9CGTA 3ARRA 3MUIA 4J3WA 2YA2A 4P7OA 1KXVA 1UH2A 1MW2A 2WPGA 1HL9A 2EPOA 3QOKA 4EANA 1ZBCA 1GOOA 3SUWA 2XVLA 1RPKA 4LPCA 4JZ5A 1BAGA 1JZ8A 1NH6A 2WVVB 5HBFA 3K1DA 3DECA 2Y2WA 4WKAA 3WL0A 3VTRA 1V0NA 1BG4A 2F8QA 2J78A 3OG2A 2ZUTA 4UFMA 4AW7A 2ZX6A 3F5KA 4JFVA 5LA0A 4MB1A 1CXHA 4X0NA 4CN1A 3IK2A 3UCQA 3SEPA 3OLEA 1UD8A 1OIMA 1UWSA 2ZUWA 2WYSA 1Q6GA 1HP4A 2FHCA 1IZKA 1CTNA 3MMUA 3AMDA 4KGJA 5CSYA 4F79A 4D72A 1AQMA 2WM0A 2V3EA 4PMDA 4XB3A 1XRVA 1L0PA 1B30A 3OIHA 1UQZA 1FP8A 1ZS2A 4RE2A 3CO4A 4WJXA 1LQ0A 1NWTA 4IPNB 4AXNA 2DSUA 1UR9A 5FL1A 4ZE4A 4TVUA 5CLWA 3THDA 2B31A 2WHMA 4XZBA 2OLHA 3WDQA 2CKSA 1LF1A 2WKLA 5DT5A 3UETA 1TR1A 2WVTA 2WC3A 4KWUA 5D8ZA 2WLZA 3SURA 4UOZA 3W25A 3W81A 1HIZA 1G1YA 3L2MA 3CZKA 2VMFA 2NT1A 4KGLA 5BWFA 1HX0A 2ZXQA 2IUZA 4CVUA 3VIPA 3ALFA 4W8AA 4FLQA 3SUTA 1UD2A 2FGLA 1Q6FA 2WSPA 5HDRA 1ZJAA 4MNJA 1JFXA 3UG5A 2VX5A 4PMZA 3FXYA 3BCDA 3EMZA 2YA1A 2VI0A 4PMNA 1OGBA 4CU6A 3M07A 3B9EA 5FD0A 2CXGA 1JZ6A 1NM9A 1B31A 4Q22A 4AZHA 1FHDA 3HMCA 3WQWA 2WMJA 2WCGA 4W7VA 2V3FA 1KCKA 2OWXA 2VZOA 4UOQA 2WVSA 3WNOA 3GXFA 1XSJA 2Y4SA 3VMNA 2YDRA 4DUXA 5IFTA 2YKKA 4AIOA 3AI0A 1KBKA 1B1YA 1GORA 1UQYA 2JIEA 2E9MA 2OSWA 3T2QA 1MQPA 2F61A 4CCEA 2WHJA 2UY3A 3AJ7A 5CXPA 5BXPA 1XH2A 2DDXA 4Y7EA 1LWHA 4ZXOA 1WZAA 1XH1A 3D5HA 3BAWA 3LPOA 4OOZA 1OM0A 3PTMA 3UR7A 2J7EA 1BVZA 1IV8A 7A3HA 1WZMA 5E6YA 2JF6A 4UFJA 1W2VA 1KXHA 2WMFA 3DYOA 2IXVA 3QOMA 1KR0A 2GVYA 3VIFA 1TFVA 2VL4A 4AZCA 3PZVA 1E56A 2GK1B 1AQHA 2VZVA 1DP0A 1MW1A 1UR1A 1SYTA 3GXDA 1LL6A 3TONA 4RE3A 3AXXA 5JUVA 4CD8A 1CECA 1OB0A 1V0KA 3A47A 3A4AA 2ZUNA 3VIIA 5I3DA 1JAKA 2DSKA 2EPLX 4L4OA 1E0VA 3AZRA 2Q8XA 5JBFA 3OLGA 4ZE5A 3N9KA 2DH2A 3W24A 3WSUA 4FLRA 1F4AA 2EPMX 5EMYA 3WH8A 1EDTA 1V3MA 3ARSA 1O7AA 2J7BA 2W66A 1E3XA 3WBAA 1V3HA 3N11A 4GQQA 4WSJA 5BXRA 4DWSD 3THCA 1JGIA 1UD3A 3ARYA 3ZR6A 3CZLA 1Q6DA 1R86A 4D6DA 2WBGA 4BA0A 3SCRA 2J7GA 4HZ7A 3BC9A 3HJEA 2J79A 2CCRA 4PMUA 4JL1A 3WEZA 1UKSA 4E4PA 3WUGA 5TD4A 4DWSC 1QI2A 3ARQA 2OYMA 2YL5A 1E4IA 1PPIA 4AZIA 4GI8A 4AZ7A 2G4FA 4CD4A 3K46A 3UEQA 1CPUA 2WHLA 3OGSA 4AIUA 2XVKA 3KEHA 2BHZA 2NSXA 2WSKA
chains in the Genus database with same CATH superfamily
2NZLA 4BR1A 5D30A 4HSNA 4AX6A 1VQTA 4BQ4A 4WR3A 2C0AA 5C70A 5BRBA 3E38A 2G3NA 5EY5A 5D8WA 4GCAA 4HZ8A 5CBIA 2CITA 1TVLA 1RCOB 4LTSA 3BLDA 3CH9A 3H55A 3EGJA 3E74A 4UB9A 4G1KA 3HV9A 4FEZA 2J7HA 1AW5A 3CHEA 3P81A 3VOFA 3T4CA 1NOUA 2QJJA 3AIRA 1R9ZA 4GBUA 4X0VA 1KRMA 1W3JA 2H6RA 3POCA 4Q8VA 3W87A 4GQ0A 5D2WA 1W9XA 2NQZA 5H8MA 2RHGA 2QF8A 4DBEA 2OTDA 1S5TA 4OQVA 4OVXA 2PBOA 5I23A 3PPFA 4M1BA 3HOJA 4QG9A 4O8AA 2ASHA 3GNOA 1H5VA 5M5DA 1SZNA 2PWFA 3J7HA 1W1TA 4XQ6A 2NQHA 3W70A 3P3BA 2J27A 1XG3A 1XIEA 2OWWA 4IIGA 3AMLA 5E9AA 4BQ5A 3SFWA 3P6LA 4WOZA 1I75A 2ZRVA 2HXUA 3MC5A 3IRDA 2VNCA 1B3OA 3KS6A 1C7SA 3RR4A 1SZGA 4H8NA 4QLJA 5AC7A 3WQOA 2H3DA 5AC4A 1PZ2A 1VRXA 1CWYA 4DUWA 3CQIA 2FH8A 2PLMA 5EBUA 3PULA 4YHGA 1OD8A 2WSRA 1QPQA 2FVLA 1KXTA 3FKKA 2X1IA 2HV5A 1ODZA 3O7UA 3N6JA 4K1GA 1HUVA 3C2RA 4HMDA 3RHGA 3UG8A 3PWIA 5CC7A 3QQWA 2XIMA 3M44A 5RUBA 5E1QA 2PWDA 3OZMA 2CBIA 3SY1A 4AISA 1GCYA 3T4WA 4IHCA 3ONBA 3WLSA 1JPHA 4JHOA 3LM3A 2UY5A 2YDSA 3UFYA 3CL6A 4KWWA 4K8EA 3CEUA 1VIZA 4HP5A 5BMWA 3NIYA 4PMXA 2JGYA 1SFSA 2GQ9A 4CCDA 5SWUA 4F0MA 5JMUA 2PDKA 3EPMA 2X41A 4KKXA 4KEZA 2INEA 1IF2A 2O92A 1EJRC 4JN8A 1CGYA 3IRSA 1MXGA 3ZMRA 2C19A 4Z2HA 1GVOA 4F4RA 4GBDA 3STCA 3WJXA 3MUCA 1RA5A 1KM6A 3SY5A 4UMBA 1FH8A 1F5ZA 1MWOA 3STPA 1R7AA 1F3XA 2HJPA 4CQAA 2VHLA 3WDIA 4M19A 1A3WA 2Y8KA 4XUYA 3N12A 3OVRA 1DWGM 1TTPA 3BMVA 4D1IA 4S3BA 3LRLA 3G1FA 3NXLA 1UWRA 1M5WA 2V69A 1E70M 2OCZA 1QAPA 3DC8A 3N14A 4XAYA 1OFQA 5AN7A 4RV3A 2NT0A 3WLTA 2ZOXA 2OO6A 2GDVA 3AXHA 4DIAA 1G7VA 3W1MA 3W7KA 4LAUA 2R82A 4MB5A 1LDCA 2OX1A 4PTXA 1UH3A 4QXIA 2A7PA 2XGBA 4XISA 2IQDA 3LHZA 5LIXX 4HZMA 2E8ZA 1Y5VA 1Q8JA 4PN2A 3LZ3A 2ZRWA 3VUSA 3JRKA 4YWSA 1Z7AA 3EDKA 1JCLA 5FEPA 5HWJA 4NNBA 2UWFA 1PDYA 5FJOA 4RPPA 1Z89A 1PX8A 3G2GA 2DZBA 3W1LA 2WZEA 2JF7A 2BVYA 1TIMA 4C6OA 4MY8A 4HNVA 3IAQA 2HVMA 4GINA 2YJQA 1IWPA 1VB9A 5AC5A 1PZ1A 3SN0A 1XXXA 2QIWA 3O6YX 4ROQA 4KCTA 3CAVA 4AU0A 4D6EA 1CDGA 3BK0A 4GD0A 1F6KA 3NQFA 2E67A 2OSYA 1GKQA 1A4LA 1Q6CA 3NVDA 3U0HA 3LMZA 4NQ1A 4DUOA 5AECA 4LV9A 3USBA 3CHFA 3VDCA 4H7CA 5CPLA 2PI6A 3MQTA 1J93A 4B16A 1K9DA 5M3WA 3QM3A 3OVQA 1Y7VA 3N3MA 3ZVIA 1OC7A 4G7FA 4ZA0A 4E2OA 3R12A 4ML4A 1C8XA 1BXNA 1RQEA 2XJ7A 2A6NA 2WNWA 4I90A 1ME8A 2E9BA 3CYVA 3KDOA 3TYAA 4B91A 3AHVA 1MRAA 2A85A 2PDJA 1GVRA 5HMSA 3WNLA 2YCJA 1WBHA 1EQCA 3WH5A 1VJIA 1XISA 3B97A 3K1GA 3CUGA 4H01A 4DF1A 3II1A 2NUYA 3P67A 3THAA 1HTIA 3QF0A 3MSYA 3RLVA 5IFPA 3ARUA 4RK8A 1I60A 4XO6A 3Q94A 3PG9A 3N34A 4LUJA 3WD3A 4PCTA 1PZ3A 3VVGA 3EEGA 2ATMA 5AC6A 3ES7A 2VELA 2PGFA 2QR6A 4H9UA 1IEQA 2QAFA 4LS1A 2INZA 2R8WA 1IXNA 3N6QA 1FQ0A 1KGUA 4PTMA 1VFSA 2VENA 4BFAA 3IANA 3QSRA 2WMKA 2ZICA 2E6DA 1U30A 1A5LC 4JTLA 2Q3RA 2X0HA 1DEDA 4I9AA 1SMDA 1V6XA 1TJRA 3FS2A 1ADOA 4E8DA 3O07A 2OZ8A 4QAIA 1FWEC 4O16A 3WO8A 1NTHA 5FJJA 2Y7GA 1HKJA 3IIVA 2P88A 1WV2A 1XDLA 4MZ8A 4N9BA 2IS7A 2E40A 4A22A 2HDJA 2O55A 3W7IA 3W72A 3L0NA 2FJUB 3WKZA 2WC4A 1O1HA 1LYXA 1MNZA 3E5PA 4IP5A 5BRPA 3T2PA 3ERPA 1EPXA 2C7FA 5REQB 2QCNA 1AW1A 3IVUA 3NFUA 5D4YA 2RGMA 3G1XA 1I45A 2RJGA 1DWIM 2W5FA 3WQ5A 4U31A 4YCOA 2PZ0A 1S5MA 4Z0JA 5E93A 3QMRA 5BWAA 5HQEA 3RPDA 3CEPA 4D6JA 4EE9A 1UWIA 2VOMA 3E49A 3MKCA 4N4QA 3CUIA 1LM1A 1PUDA 4RDWA 3P74A 2AL1A 1XC4A 3R79A 4IP4A 4HJFA 3MPGA 2WMGA 3CHCA 5KITA 1KCZA 1F05A 3WQCA 4RNIA 1C9DA 4NASA 3S2LA 1Q3NA 2YLAA 3OVPA 3DESA 3QC3A 3WYZA 2W67A 1LRNA 4JTEA 5A8NA 3RCNA 2X8RA 2BY3A 3WLPA 4ACZA 1H41A 5D04C 1QRQA 3EA2A 1ZRQA 3W26A 4UZSA 4QRNA 4H9TA 2ZX9A 2FIQA 4GHRA 1E6RA 1TPVA 2QPSA 2DSWA 1W5NA 5CJ5A 5E9XA 1HGWA 1QK2A 3DFTA 2ZVRA 1GQIA 1D9EA 3SADA 4NZ3A 3V36A 2A3HA 2I9UA 3EDEA 4PRWA 1W56A 4J3UA 1AZ2A 3ARVA 4S3FA 1CXIA 3EWBX 4GI6A 1G0CA 2J4GA 3LM7A 1T0OA 4G56A 1R0MA 3G6LA 2GJXB 3NL6A 1FCVA 1XBYA 2PDHA 1N8WA 3GNDA 1P5BA 3GKFA 3MDWA 4P7RA 2QAPA 1XDMA 4WJ8A 1YXDA 4BWLC 3ME3A 1CNVA 5AVHA 1ALDA 2JIWA 3T55A 2CZ5A 2DVUA 2EXOA 4DJEC 3C0QA 1GEHA 4RV8A 1OG0A 4XO7A 3UR8A 1Q7ZA 4V28A 2FZ9A 1V6YA 2W91A 3C0JA 1XLKA 3I4EA 4H8UA 4W89A 2QVNA 1V4YA 1JD9A 3W2KA 3QGAC 3AYSA 1CENA 4NI8A 5HK4A 4LSBA 3WF4A 1MEIA 4GNJA 3AZSA 2W63A 1XYLA 2A7NA 3HGRA 1DJGA 2HVOA 1AVAA 1JQVA 1R6WA 2X7WA 3VDHA 4GJJA 3QQ0A 3TR9A 1NELA 1W17A 3QBUA 3TDFA 3NO1A 3SCSA 4YTRA 1ZCOA 4A3UA 3LPGA 3E2QA 4MB4A 4IH3A 2P10A 3JR2A 4TIMA 3STGA 4O1CA 3KE0A 2I57A 2DPEA 4KEUA 3S2CA 3FFSA 2X42A 4Q6XA 1W1VA 1I1WA 1W3IA 2HSAA 4B90A 1XYBA 2XH4A 2XZ7A 3VCCA 2ACSA 4OBSA 4DXKA 4WD0A 3A24A 5ABTA 3WK3A 4WRHA 4PMYA 2GDQA 4CQBA 2HVNA 4V33A 3EOLA 1R9XA 2PDMA 2C1GA 1TPFA 1NEYA 1WB0A 3KHDA 3U48A 3UWQA 3IUDA 3RLGA 1B2YA 1HJQA 3I10A 3GFYA 3VDGA 1E0WA 2D0GA 3OHIA 4V1YA 4I7WA 4H7VA 3F2CA 4N2YA 3N18A 4HMCA 2OOFA 4UTHA 4NL1A 3GZAA 4LF1A 2PLKA 5HULA 5HR6A 1SM9A 1R38A 1E6NA 4TMBA 4A3QA 3WDPP 1V79A 5IHSA 2D2OA 4GZIA 2VFFA 1UOKA 3GWQA 1PTGA 3W7RA 1ISYA 3HO8A 3QN3A 1FH9A 1A3XA 5A6AA 1OC6A 4H9ZA 3DU0A 1OFAA 2NUXA 1UROA 1BKSA 4HNCA 2E6FA 1E1EA 5BU9A 3LGEA 2NXHA 7PTDA 3WCZA 1JCTA 1R2SA 1EL3A 2YDQA 4O28A 4J3VA 3WD2A 4DQWA 3P84A 4CNNA 1XLMA 3TW6A 5F1VA 1RVKA 3GIYA 5E70A 4ZSTA 1OF6A 1ZUAX 2J74A 4LC6A 2J7DA 3MTWA 4FPSA 3W7EA 2Y8VA 4M6QA 5D2YA 2JQXA 2HPIA 3R0DA 2QKFA 2JKEA 3WUBA 4ZO8A 2QCFA 2FH6A 3E5BA 4GQGA 2O7QA 4IQEA 3AXIA 3TN3A 1E43A 3QR1A 1XRTA 1ZBKA 2PTXA 1O4UA 3EDDA 3ABQA 2V0TA 1QHZA 4GQRA 2XIQA 4I8DA 2O56A 3UA4A 1OG6A 2G41A 4LVBA 2DW6A 1IQ8A 4W8BA 1AUSL 2PSNA 1QNQA 1TRIA 1VAHA 2QYGA 3TYZA 4GISA 4KFPA 3ECQA 4UXDA 3GNXA 3KBWA 1GT8A 2PF0A 4AD5A 4PCSA 1B3XA 3RMJA 2A4AA 1GZ1A 1K3UA 2FTPA 3T8LA 2RDUA 2X05A 1JRCA 5CPMA 2GUBA 4HSHA 1Y5WA 4FHAA 1U1UA 4AWUA 2NXIA 4PCFA 5LIWX 3BJSA 3N2XA 1EWDA 1XSIA 3QSTA 1VJSA 3GSMA 3PM6A 3O9NA 3S6OA 4H1ZA 1UCWA 3GU9A 2BFGA 3LK6A 3NQ2A 3TTOA 1EYEA 4F66A 1EZWA 3G77A 4DBWA 1XX1A 4XV0A 3B8IA 3THUA 3V7PA 1SZRA 5I03A 1KXQA 3U8GA 4HA1A 1W3HA 2I5QA 3W02A 1D8WA 2J77A 1TVPA 3RCMA 1FXPA 2HBXA 2VGFA 3NGJA 4DO5A 2RAGA 1TG7A 1CB2A 3KHJA 4M6VA 5I2UA 3BAIA 4ZENA 5TIMA 1EJVC 4R7OA 1UC4A 5A94A 1M3UA 4ML9A 5D2XA 4AZ5A 3EOEA 5F2LA 1TPWA 4PUKA 4P7NA 1OYAA 4YVVA 4FNTA 3NA8A 4DO4A 3F03K 4REQB 2WZHA 4A8RA 4FF5A 3UBPC 3T08A 1FWTA 3QGVA 1YADA 3H70A 1N55A 2YDAA 4U10A 3CIXA 3AXKA 4JXCA 3M46A 2IKHA 1MNSA 2YZRA 1KQYA 2NLIA 3EX3A 2PTDA 2BY0A 3S9YA 2WAGA 3MBFA 5LNWA 3I7SA 1VF8A 1XHGA 3CMGA 3KVMA 4DXVA 2OG9A 4REQA 6CGTA 1KNWA 4M82A 4HMEA 4S3KA 4BI6A 3CHVA 4A21A 1FWHC 1ZJBA 5C71A 4PB5A 3WQEA 4OUEA 4GFSA 5AYYA 4E2VA 1K03A 4QG6A 4M24A 4W93A 2FPVA 4QIUA 5C8BB 1DBTA 5G2HA 2BTMA 1YIXA 3W27A 3W71A 2WMHA 3CL7A 1HP5A 3GTXA 1YPIA 3SJNA 2Y63A 4NKCA 1EGMA 4ILSA 2NUWA 4Y90A 4HHMA 5IDZA 1IT0A 1EQPA 1O5XA 4BF7A 3PWGA 1VHNA 4IFOA 4J1OA 4AF0A 1Q85A 1XLJA 3VOCA 4AZBA 3INPA 3NR0A 1UR3M 1RALA 2B4GA 4AH7A 1HO1A 1BWKA 1XIMA 5HUPA 3BOFA 4J27A 4NZJA 1JYNA 4PCNA 5JXQA 2HPMA 4Q32A 5B80A 3LCIA 5C2CA 1ZP3A 1DIOA 3EX6A 4MAZA 3ZT5A 1KFWA 2BLEA 1K4HA 2J62A 3EBVA 4RDZA 1AMYA 3D47A 2Z2UA 2XN0A 3CUFA 4ADTA 3H7UA 4I9TA 2R6OA 3H54A 4UFHA 1D8CA 4ICNA 5AHFA 1LUCB 3GYCA 4QM1A 2D0FA 4A8LA 1QI0A 3H24A 3JU2A 4GI9A 1XLEA 2QUUA 3UPBA 3MP4A 3CTTA 2WMIB 1PCWA 5FJRA 1L6YA 2OYLA 4HGXA 3F5JA 1EPVA 3SIMA 4Z2LA 1XQKA 5FA5A 2OZ0A 2RKXA 3WELA 2PPGA 3WQVA 1LROA 3TSMA 1E4LA 4S2BA 2GPTA 2GZXA 3M0MA 3NQAA 2XH0A 1EBHA 2ZC8A 2VO5A 4DM1A 4G6CA 3EMQA 4IOTA 1V93A 1JDFA 3TXZA 4KQNA 4O15A 3ZT7A 5CKSA 2H9AB 2NV9A 4JY8A 3W1RA 5HMFA 3M0ZA 2R1PA 1ONEA 1Q6RA 2VFHA 1QW7A 2O4QA 3C2FA 4DXXA 1JAEA 1Q65A 3CT7A 4WZHA 1POJA 5DT7A 5K7JA 1XGEA 3B06A 3WG6A 3WMSA 3W1QA 4ZO7A 1R3TA 2EG8A 4L9XA 2W4XA 3CAKA 4AWEA 1NARA 1E0TA 3CM4A 1B9BA 3O05A 1XKYA 3G1SA 1I0DA 3FGCA 2DFAA 4HNNA 3NVTA 1UZ4A 1RR2A 5I77A 5A6KA 4UNLA 4OECA 4F48A 3S2NA 1Y8BA 3GXPA 3H8AA 2WCSA 1NP2A 2J25A 2VZTA 3GB6A 4IICA 1R87A 4HJWA 2ZDRA 2Z26A 2QCCA 4PMQA 3V0UA 2TPSA 4HMNA 3A23A 1W1YA 3R7MA 1AH0A 2CLKA 3WJWA 3IGUA 5CLTA 1NF0A 4Y9OA 4L61A 3SCOA 4RX0A 3BW3A 2P50A 3EZ4A 5EPDA 5A95A 1D2KA 1DIKA 2OXNA 1TV8A 2C91A 1JXJA 1UKPA 2Y1HA 3TC7A 3QY7A 1K8CA 5HWNA 3E12A 3L0KA 3HIJA 1B54A 1P43A 2ZFAA 3BV4A 2ABAA 4O8RA 3TYDA 3JZUA 3MVTA 1F6YA 4R53A 3F1QA 4L7ZA 4Y8EA 1JUBA 3PZOA 3QC0A 1Q6QA 4LYQA 4PE8A 4F8XA 3R2GA 2PTWA 5H1WA 2DIJA 4S38A 4DJED 2R94A 3UG4A 4Q7NA 3LPFA 1LBFA 2G5WA 2PCQA 2GSJA 4C5YA 2ODOA 4FK9A 3FSUA 4GX8A 4F9JA 1TX2A 3WD1A 2QDEA 2AAAA 3PBMA 4GXWA 4GO9A 5E5CA 4L4LA 2G3MA 1QI5A 4UC5A 1GJPA 3GW3A 4KWSA 3HA1A 4I7VA 4NJKA 1UG6A 4EP8C 3Q58A 2G3JA 1OT1A 1TIWA 1K9TA 3AHXA 4J3TA 1H60A 3MI2A 4AY8A 4IIHA 1XFBA 2HE8A 4Q8NA 4M29A 4W85A 1K70A 3OBKA 5K9XA 2YL6A 3OZYA 3CB3A 3PUOA 3P93A 1HKMA 3CUHA 1LQAA 3G5EA 1HVQA 1J9YA 4IP7A 1MW3A 4AC7C 4C6EA 4LH8A 4J3ZA 1C91A 1TO3A 4D6IA 3ZLGA 5DANA 4H41A 2BB0A 4EAMA 1YDNA 2RDTA 4PUMA 3GHTA 2W79A 2XHYA 3VXGA 4X9SA 3WQ8A 2P76A 4MPKA 1ZAJA 4NAFB 3PUEA 1J2BA 3O0KA 1DQXA 1KLYA 3FKRA 1ZL1A 1ENUA 4JQ2A 3GUWA 1QBAA 3HPZA 2DVTA 3RJYA 1UZ1A 3N2BA 3I6RA 4OV4A 3VIKA 4F9DA 4TXEA 3G18A 4IZGA 3NZ1A 3TSDA 3VIMA 3APYA 4DBUA 1GOKA 3C3UA 3PZNA 4G7EB 5FL0A 4Y9MA 4AVOA 2REQB 3C2YA 3CV6A 4KW2A 1GQKA 2IQTA 2YCEA 3PP7A 3NJ3A 4IISA 4UBPC 4HN4A 3I3BA 4O13A 2ACRA 3W23A 3CLWA 5BMXA 1M03A 1XINA 4B5NA 2HRWA 9CGTA 3ARRA 4LRSA 2YA2A 3LSCA 2BMBA 2ATSA 3DBNA 1TREA 2EPOA 3GG1A 3QOKA 1BF6A 1IIHA 3R10A 4Q6JA 3V1HA 3SUWA 1FWRA 4LPCA 5FJPA 1XF0A 4JZ5A 1YMYA 1JZ8A 3MZ2A 5T26A 5HBFA 2Y61A 1B57A 3GG7A 3WL0A 1EJ7L 1K8YA 2J78A 3OG2A 2ZUTA 4AW7A 2QZRA 3SR7A 3F5KA 3KWSA 2FTYA 5FSEC 1WXYA 4LUTB 3BCJA 4ZQMA 1E1CB 1X97A 1OIMA 1AJ0A 2FZBA 2PUZA 4H4IA 4ZL1A 2PLJA 2OZTA 2FHCA 1IZKA 1PKNA 3UPWA 4KEVA 2VD8A 5CSYA 5CPNA 3EWYA 2V3EA 4LUTA 3WX7A 1Q6LA 3RFAA 3HBLA 5LGZA 1XRVA 1UQZA 1B30A 1FP8A 1WA3A 1P0BA 2DVXA 5I3KA 1ZS2A 4RE2A 3CO4A 1NWTA 3DG3A 4DZ5A 1CLKA 1EKOA 3ITXA 1M1BA 2DSUA 3PBYA 2EHHA 2V5LA 1X8CA 2YB1A 5F1UA 2CKSA 2WKLA 1VLIA 3LBOA 3UP8A 1TZ9A 3LERA 3TN4A 3T78A 2QGYA 3ICJA 5TAOA 3W3OA 5D8ZA 4DEFA 3APTA 3UVAA 3W81A 5HAOA 3F4NA 4ZOAA 3CZKA 2VMFA 1U1HA 2P5NA 3M0JA 1HX0A 2ZXQA 3EKZA 3VIPA 3ALFA 3GVQA 3CTLA 3LEPA 3ABXA 3GG0A 4JNYA 4XZLX 4PUJA 2VGGA 4DELA 4PMZA 4S3AA 5TF0A 4JHMA 1OGBA 2QDHA 3EOOA 4CU6A 5D38A 2CXGA 1NM9A 2Z25A 2OB3A 3B0YA 1RBLA 3WQWA 4R34A 2WCGA 1I8JA 5D32A 5CSRA 2OWXA 4H00A 2VZOA 1ZTVA 4UOQA 1OCNA 3BGGA 1ZP4A 3GC5A 2JKAA 3EKLA 1HKWA 4G2DA 3DX5A 2E9MA 2F61A 3MYOA 4ONVA 2WHJA 2D73A 2PE4A 1FXQA 6XIAA 2DDXA 4MWAA 1GTHA 4E6MA 1JCNA 1WZAA 3S4TA 3D5HA 3EEZA 3BAWA 3B0UX 3UR7A 3HQPA 3QLDA 1W8SA 2QT3A 5A8GA 3B8WA 4X61A 3DYOA 4Q4SA 2IXVA 4YCPA 1TFVA 3OBEA 2WM1A 1K8XA 1DP0A 5DXXA 2FB2A 3S1WA 3AXXA 4DJDC 3V35A 4Z08A 3A47A 3RYSA 2ZA1A 3A4AA 2ZUNA 1THFD 3M16A 1JAKA 4EWJA 1E0VA 4QJ5B 4ZE5A 1H7WA 4DAIA 3S47A 1QCWA 3WSUA 2EPMX 3WH8A 1V3MA 4ZQRA 3ARSA 5EKYA 1HW6A 4XZ9A 3TNBA 2W66A 3LTYA 4GXMA 3KVKA 3THCA 3ARYA 2PP0A 1Q6DA 1XW8A 2X7VA 4GNKB 3CB8A 4HPJA 2G50A 1TQXA 2OOGA 4PMJA 1SO4A 3BC9A 3HJEA 4JIHA 4JL1A 3WEZA 4G5DA 1GEQA 4IMDA 4E4PA 2WJDA 1WKDA 4GG9A 2OYMA 2PA6A 2D2JA 4ZB0A 2WNQA 4AZIA 4GI8A 2X40A 2G4FA 4G7EA 4O53A 4GX9A 3SSZA 3OGSA 3KEHA 2Z7KA 5CSSA 2NSXA 3BJTA 2WSKA 3WY1A 3IJ9A 4F0SA 4HU3A 3LHTA 1SO3A 1GKRA 4QNWA 2Z6IA 4AAJA 3LHUA 1SPQA 3NURA 3BV7A 3W6LA 2UY4A 2BOFX 3CU2A 2V2DA 3PZIA 4NY2A 3N2MA 3GDKA 4NHVA 3DHDA 4V1XA 4NZCA 1KD0A 4KBXA 1DWHM 5G4WA 3S42A 4OIFA 4IMGA 3QHMA 2Y6ZA 2YBTA 3BUVA 4HPHA 3KTSA 4MIMA 4MJ2A 2DT1A 2IKIA 3CGTA 1KFCA 1W5MA 3QV7A 3RM9A 4ZEPA 2BY1A 3VIJA 4EF8A 4QE5A 3OQ8A 4UNKA 3GQYA 3FXGA 3TW9A 4EPKA 2BHUA 3HPAA 4KF1A 1YTKA 3FLUA 1WUEA 1PX4A 3LA4A 3VPLA 2EF9A 2EPHA 3EX2A 2PDCA 2CZDA 2E7FA 4LALA 3QY8A 4UR8A 1J01A 1FCBA 1GYMA 1UR8A 1S1RA 4RE0A 1LZOA 1ZENA 4QROA 3P8JA 4AWSA 3OYZA 3WNKA 1TWIA 4WLCA 2CHNA 4Q8WA 3ALGA 1U5VA 2C71A 2CKRA 5HWMA 3H21A 4UOJA 3W2LA 3NL3A 4J7RA 1Q2RA 1UA3A 4FAMA 2FHFA 4Q4MA 1SVDA 2A3BA 1HNYA 1SSDA 3QGKC 2WOQA 4AEFA 1E71M 2VR5A 1IEIA 1B3WA 3LZ5A 3D6NA 2FFCA 2IW0A 4W86A 2J8GA 4W4QA 3PAOA 1R3QA 4OTKA 2GVLA 1GJWA 2OVLA 6TIMA 3K8KA 3SO7A 4DO6A 2C16A 1OABA 2PDFA 3BSGA 2PDNA 4KCVA 1E9YB 1OEPA 1K7FA 1FOBA 4UTTA 1ZFJA 2A0NA 1XLIA 5M17A 3UCCA 5JVLA 3L2LA 1UBPC 1W1PA 4YYCA 4RLIA 5D9MA 1J96A 2DZAA 3T05A 2OLAA 2ISVA 1BSLA 1I2RA 1LT7A 1AH4A 4Z1CA 1K4GA 1JULA 3MYPA 1GVFA 1AJ2A 5J5DA 4B5TA 4YPJA 3AIVA 1ONWA 4C1LA 2GWNA 3FJ6A 2WMIA 1HF6A 3PJWA 4MF4A 3OGVA 2ZADA 1XPYA 4JCMA 3VABA 5KZ6A 1KB3A 4WX2A 5K2ZA 2DV0A 4E8CA 1XV8A 4O14A 4AZCB 3MUZ1 3DEQA 1DL3A 4MGGA 1J10A 4RZ6A 4U5KA 5A8MA 3S1UA 3THQA 1EC8A 1A0DA 5BXSA 2BXZA 1DOSA 1TV5A 3E96A 4FNSA 3BDKA 4H9YA 4ZOBA 1BYBA 2QCGA 1VBGA 1RK6A 1BEUA 3HF3A 1F9CA 2DSZA 3IARA 4HNUA 1A5KC 4CEUC 4HYRA 1L2UA 1QI4A 4CN6A 1MXDA 3GO2A 2OODA 4S1FA 4FLSA 1YDOA 4H6QA 1LG1A 1E15A 2YIHA 3W1AA 4DJFD 2H90A 3TYUA 3IEBA 4N0RA 5EA9A 2B7OA 1NDVA 3QMSA 5E09A 1JGMA 4TX9A 3IIZA 1YKWA 1MEWA 1OX6A 1K02A 4D6HA 2BNJA 4C6MA 4YN5A 4GE8A 1V6VA 1VHCA 3KX6A 1TE1A 4BF9A 1V03A 1BWLA 4MLJA 1HJUA 3URNA 2Y5JA 5FOOA 3PBUA 4UZUA 3TJXA 1R46A 1ICSA 3AS1A 3ES8A 1JL8A 3V0SA 5D09A 1B4KA 3A4JA 4JTFA 4MKNA 3LHYA 1OFPA 1JNDA 2OSXA 3AOFA 4LGXA 3CWOX 2OZ3A 3HMJG 2BVDA 2JEQA 3M4HA 4JQ4A 5C2XA 3QW4B 1PWMA 4O50A 5GNXA 3VGBA 8RUCA 1RK5A 2E09A 4C6JA 3UPMA 1KRAC 2CZEA 4AD3A 1C92A 5H8UA 1ZSXA 4GUHA 4JTAA 2CZVA 3KRBA 4IJRA 3GYEA 1H7NA 2FJKA 2UBPC 5F2GA 1H09A 4LYKA 2OYKA 1JNEA 3GXTA 3AIWA 2HNEA 4LS2A 2VYOA 3GDRA 4WEVX 1DTUA 2NX3A 4ATDA 4OT7A 2Z0IA 1IXPA 3MT1A 4C6BA 5DLCA 3EDFA 1A5SA 2AQVA 3RM4A 4DN1A 3N2OA 4IX2A 1IEWA 4PC8A 1CX9A 3QKZA 4ZOCA 1WPCA 3SRKA 5ABFA 3LXAA 3XIMA 1IR2A 3LCXA 4O0QA 2WW5A 2GQAA 2IPWA 4FIRA 2D69A 3WLRA 2C3ZA 1XGZA 4B4FA 3TK7A 1I9CB 3E0LA 2OJPA 1UKQA 2CWNA 1RQBA 1ZHAA 4K6AA 5CBBA 3PPCA 3GNPA 4L4PA 1LOQA 2CLMA 1EIBA 3UESA 3IACA 1EA9C 4DWSA 2RGLA 1FFRA 4DPQA 4O57A 1JRBA 4GGHA 3VU2A 1UJPA 1XYMA 1S2CA 3IUIA 3L68A 3POHA 4M51A 4ZB5A 3HFYA 4JTGA 3T0CA 2WB5A 1KWKA 1TRDA 1EUAA 2J13A 4LVDA 4N4PA 1R8LA 5JQ9A 4BS0A 1NY1A 2ZVIA 5ECUA 5A69A 3AZTA 4C7FA 2QEZA 4UFLA 4ROPA 4OUIA 1VBRA 1A5BA 2Z1SA 2BX7A 4H19A 3M0KA 3ZJ8A 4O11A 1FWCC 4AVNA 3KL0A 3WJYA 3TC3A 1LP6A 3T7VA 4KPLA 2A3LA 2YFOA 1HL8A 3W4RA 1SZFA 2Z1WA 1UC5A 1VFHA 1AK5A 4HTBA 4AXKA 3TFCA 1E4MM 3EOUA 4JICA 4V27A 1YTEA 3WF3A 1VP5A 5A2BA 1A49A 1XP3A 3C86A 3HPXA 1C93A 3ABRA 2D22A 4QTGA 4Z2KA 1TMQA 1UD4A 5FESA 3QFWA 3BWWA 4C7GA 1QXLA 3SUUA 2ZWYA 1LT8A 2JKPA 1Q6OA 3W01A 2GJXA 3WDRA 4GYKA 1O60A 3GY1A 2CLEA 4Y2WA 5A6BA 5I6SA 1OFRA 5K3VA 3MP5A 4S3GA 4IWWA 2G3IA 4AZGA 4LY8A 3W84A 3W7GA 4K68A 2Z1XA 3KOZA 2CLIA 3W6MA 3NM3A 5GJMA 4UMCA 1JZ5A 3FIGA 2GGIA 1VLWA 2HROA 5T8GA 4MWAC 4LC8A 5CZKA 3I3EA 3LCWA 2DJXA 3LD5A 3EXSA 1L6GA 3CLMA 1Z3NA 4CQCA 1HJVA 3NSMA 2BOGX 4AD0A 4PTWA 3VGDA 1F8MA 4CU7A 1UP0A 5M2FX 3HJZA 1OGGA 5C7VA 3UWEA 3SGZA 1IGWA 1O95A 4WY0F 4AC1X 3BARA 2VJXA 3N1AA 4JTQA 5AB3A 3SQSA 3HGSA 1RAKA 3IV8A 4I9MA 4ZOEA 1EHNA 1L9WA 1BSIA 3SIZA 3FSTA 3EA3A 2VWSA 2DEPA 1Z48A 3BG3A 1NWSA 1VPQA 3WUEA 4Z2IA 1QNRA 4QSFA 4GO8A 5FF3A 2OGYA 2IMRA 3TTEA 3AWNA 1RP8A 5FACA 3R13A 4B2DD 4RJEA 5BOOA 1DJYA 2A3CA 1HZYA 1BVWA 4KWVA 2EKGA 2PBGA 2V2HA 4GIYA 2VDGA 4O1AA 4YIWA 3RF9A 4RKAA 3PY2A 2CLOA 2CW6A 2VFDA 4JR5A 3MUAA 2DT3A 3PJXA 1J0KA 4AEEA 1DXEA 4LNYA 1A3HA 1G5AA 3PSVA 3GUGA 5TQLA 4IMFA 1KA9F 4B2DA 1OADA 3VINA 3KBVA 2FZDA 1I1XA 3UXKA 1EYWA 4HPNA 3UNDA 1BTMA 1DWAM 1EHAA 1FVPA 3MMDA 2SFPA 4HCLA 4MYAA 2Y24A 2FMOA 5JBEA 5CC6A 2CXEA 2QUVA 3WNNA 3AALA 3AAMA 1N8FA 3B03A 3VZXA 5I78A 4Z2JA 5DEZA 4QQUA 2AAMA 4JL2A 3DGRA 3LGGA 3TYCA 1GVYA 5KZEA 1Z32X 1Z41A 3EMCA 3GD6A 3ZLHA 5DMMA 1HKKA 1XYCA 4MWAB 3CQ0A 3QZEA 3G1YA 1FWIC 1E4NA 3SM0A 1V7AA 1EC7A 2FB3A 3G1DA 5HJXA 4MY1A 2E1DA 4R27A 3NAVA 1SMAA 3HPSA 2G8ZA 4JN7A 4AVFA 3CO8A 1E73M 1K1DA 5CBJA 4B9ZA 4TX8A 1GK8A 2W92A 4PRTA 3DGBA 1JZ4A 4IPLA 4AY7A 2FZNA 2VX6A 1GUVA 3T44A 2KZHA 3UJSA 4HIBA 1JFHA 3H4WA 2HXTA 3BW4A 4U5IA 2D3LA 4MY9A 3XINA 4CQ9A 4U3AA 2PFHA 1R3WA 4HSOA 2F6XA 3R94A 3AIQA 3PZUA 1NOWA 2F84A 3RNDA 3S5OA 3H7VA 3LTSA 1JD7A 4H6RA 1J12A 2YZ5A 4D8AA 3NXFA 3SECA 2VRKA 3PC0A 4XD5A 3FK4A 3ZZ1A 4XAFA 3G22A 1BFNA 1BYCA 2YR1A 4BEUA 2DQXA 2FKPA 2XVPA 2Z00A 2FDMA 3ZVHB 2Y7EA 4TV6A 1HGYA 4ERIA 1TTIA 3PBVA 5HQLA 3ISIX 4JFUA 2YCLB 4L6DA 4RNHA 1ZBVA 2C15A 3B0PA 3A22A 3U7VA 3TV8A 1KLZA 1VCGA 3M64A 1BVNP 2X30A 4ZXLA 3M6DA 3AMGA 4A8NA 4IM4A 4U2ZA 1ZLPA 2I14A 3FAXA 4LYPA 4UTUA 3UZZA 4X2PA 1ISZA 3JUGA 4FO4A 1X38A 2GWGA 2ZXDA 1DTNA 3T2OA 4JTDA 1UPPA 4DWSB 4W5ZA 2OGJA 1QPOA 1MW0A 3L4VA 4K8HA 4LXFA 3BSHA 3EB2A 1GTEA 2J24A 4I5XA 4RL3A 2XVGA 2J75A 2NWRA 1U33A 1W31A 3MI6A 1E5JA 3WMCA 1A5UA 3T81A 3UG3A 1TZ7A 4KIRA 3G0SA 3MWCA 3MU7A 4GZJA 3QXBA 1GG0A 4CCCA 4HA4A 3DG7A 1A5CA 3CUXA 2PP1A 1Q7QA 3C56A 3A3WA 4A4AA 3PR2A 4QG8A 4JIIX 1FA2A 1XIBA 3LG3A 1HJSA 1Y5XA 2WJEA 4XZMX 4MJ4A 2X2YA 3CZJA 3FN9A 2YX0A 2ZXBA 3FYPA 5REQA 2YCLA 4DRSA 1XD1A 2ANUA 5TNVA 4LAMA 2EG7A 1EP1A 4YTSA 4AG0A 3NTYA 3P80A 3JVAA 1NQKA 4K38A 5G5IA 1QPRA 4JTTA 3DKLA 3VNIA 5EGRA 5I7GA 3TTQA 1DE5A 1CT5A 3C52A 5I79A 4JIEA 3N29A 1J5TA 3PJTA 3W1XA 1EOKA 3M47A 3RITA 3FAWA 2QLYA 3K8MA 4WDXA 3HN3A 2XDFA 3DENA 4JNMA 1JF5A 4WCJA 1M7JA 3BMWA 2Y5EA 4KERA 3M7SA 3ITCA 2PLCA 3RUBL 3VFLA 2VD9A 1XBZA 4ENLA 3L4UA 2DZTA 4YJ5A 1KQZA 2YCKX 2OT1A 1XYAA 5EMMA 1WDSA 5BU6A 4GA8A 3L5LA 2V68A 2GFTA 4WSKA 4FNQA 2YOCA 3VC5A 3NDZA 3DBPA 3F4VA 3U57A 1ITXA 1PZ0A 1VIWA 2FVMA 1XYFA 2EJ1A 3APGA 3ZXWA 2EEXA 3CPGA 4IPPA 5LA1A 1DJQA 4WSHA 7REQB 3A64A 2DP3A 1GJUA 2W3ZA 2XGZA 2QCLA 3TYBA 4JQAA 1BRLB 1C29A 3URBA 3HU7A 4QDPA 3BLIA 1FWSA 1ITUA 3L5MA 3VILA 2G95A 3WFLA 1W5PA 2NWSA 2ZIDA 3BAKA 3VNKA 2FMNA 1FWNA 1UASA 3MA8A 3V4BA 4JGDA 4QJ4B 1CZ1A 1KGWA 4MJMA 4AMAA 2P8BA 3TTSA 4E4UA 3W1NA 1Q8AA 4AWTA 1TB3A 1VZWA 1FCUA 2FPTA 3UYIA 1VFLA 2WHKA 1RY0A 4GYPA 4AZ6A 1RV8A 1MQRA 4H83A 3WFZA 2V3GA 3SUSA 1O6IA 1KBJA 4QJ1A 4C6KA 2OLSA 3GFZA 5DY2A 3VE7A 4XBKA 5EBAA 4M0XA 1QATA 2X1UA 4R33A 2YCIX 4LCRA 4QJ3B 1G7UA 1H7RA 1R3RA 8A3HA 2UY2A 1GVEA 1MYRA 4U2YA 4ATWA 4Q3MA 1JYXA 1JJKA 4BJHA 3RM8A 1XRSA 5D03A 3CC1A 1UR0A 3CT2A 3U7BA 3NQ8A 3N4FA 4E2DA 1E9ZB 3TQVA 4EVZA 3OA5A 1MI3A 4DNHA 1S39A 2DW7A 2WZIA 4GYFA 3UF9A 1F4HA 3MY9A 3MSGA 1IIGA 1SSGA 4NZ1A 1NU5A 2BG5A 4K8GA 4EIVA 2GJLA 1KBLA 2Z4GA 3W83A 3TP4A 3PZMA 5EIYB 1UHVA 1QO2A 5GPRA 2H8ZA 1W54A 4DX3A 1GVIA 2CLFA 4JFSA 3MW7A 1DIEA 1DJWA 1RJRA 4QR6A 4H04A 3S1XA 3TMQA 5BYWA 4LYRA 6REQB 2ISSA 3MV11 5GNYA 4WF7A 3WN6A 3B04A 1JDDA 5CPTA 4PUNA 5A6BD 1H7OA 1S3TC 1H0GA 1WZLA 3FDKA 5HNUA 1XI3A 4Q7IA 3PPGA 4GGBA 3TN6A 4PYSA 2VOTA 3N9SA 2ZRYA 2ZBTA 2XIJA 3ZT6A 2RUSA 3VX0A 2RDWA 3U2EA 2PF8A 2JFEX 6REQA 1F74A 3SCTA 3UW6A 1XICA 4TR9A 3SCPA 3N2TA 7TIMA 1ZGDA 2B0MA 1UMYA 2F38A 4DYKA 2ZX8A 3KBJA 3EOSA 3K30A 1TSIA 4LW7A 1T40A 1B0IA 4DNMA 4LUYA 4X22A 3MANA 2ZZ3A 4L1WA 2IPFA 1J0HA 1OCBA 2J9YA 3HQOA 4UTFA 1KM5A 1QTWA 5LZLA 1GWJA 3IK4A 7XIMA 4CEXC 2A7RA 2HQAA 3MDUA 2ESCA 1MDLA 4QX4A 3TAKA 3NPUA 2CBJA 5HANA 2XWEA 4JDBA 2VUNA 4M81A 3C8FA 2ZRXA 4UFIA 3DKJA 4NAEA 4LVGA 4OWGA 5CAKA 1PE1A 1TJ2A 4HHPA 2WCAA 3GG8A 3B0VC 2FDSA 1US3A 4FA3A 1XIJA 2VURA 1XBVA 3B8SA 2XSBA 1XS2A 3HG4A 3VD9A 5EMUA 4Y8FA 1ITQA 5LSMA 4KIEA 5A5WA 1J0IA 4N9CA 2G96A 4HN8A 3WBWA 1Q5MA 4KT2A 3W53A 3VM7A 5J5RA 3W76A 5FEZA 3AJXA 4C91A 1EA0A 4S3EA 5I3HA 2XN2A 3H2FA 5A2CA 4R7WA 4BY3A 4GC4A 1ECEA 2BZNA 3EA1A 2WWDA 1BTCA 1QASA 2FZ8A 3WH7A 4YTTA 3EWDA 1PTDA 5BW6A 4E4FA 3CPRA 3IAPA 1UOZA 3CXOA 1IE7C 3QYQA 2EGZA 4LRTA 4Z17A 1E55A 3W37A 3GTNA 3W88A 1S38A 2CNCA 5G1YA 2HS6A 3OHMB 1VKFA 1BXCA 4FOKA 1EB3A 2PWGA 4R5EA 3UXAA 4E3TA 1LG2A 3NOYA 2VC9A 3BZGA 4O0KA 1D3GA 5KEZA 5A6SA 3KLKA 5FKYA 4GZEA 1J6OA 1KRBC 5K4ZA 4IIDA 4DF0A 2GDUA 3RN6A 5ABHA 1F7BA 2TRSA 3WQFA 1LOLA 5GQBA 4QP0A 4LWWA 4CD5A 4MFEA 1G01A 3VNYA 4XVDA 3OLIA 2QIIA 3C6CA 3AS0A 4UQDA 3GIPA 4UR7A 4EAYA 2VT0A 5K4XA 2PD9A 1AJZA 2HK0A 4L6OA 3SGGA 2ZA3A 4EXAA 3ZR5A 1H50A 4IPJA 2D0HA 3RLHA 4WGHA 1PKYA 4PULA 4BEQA 4H8VA 4Q4QA 1EO5A 4DI9A 5G1MA 1FHLA 5C9UA 2WWCA 1PYMA 1FCQA 2YYTA 4PL2A 4AYSA 1KGXA 1WNOA 2I5GA 3GVWA 1H7XA 1LLOA 2NQ9A 1OK4A 3TIMA 3UNTA 4FXJA 4L6HA 2UZ9A 1LBLA 1BXBA 1FKXA 3VNZA 3N15A 2QJGA 1NDWA 3QRHA 3N4EA 3A4XA 4WHBA 4GUJA 1QFEA 4NX5A 2DUZA 2C1HA 3L4TA 3Q65A 4C6IA 2QUMA 4F2BA 4RDVA 4M5PA 3KLLA 8TIMA 5HR7A 1R2TA 1P48A 3R11A 5LNRA 3GDLA 2VEPA 1H2JA 4L65A 3RCYA 5A6MA 3S5NA 1IZJA 1UUMA 4M6PA 3LV5A 4AY1A 4UTKA 3B9OA 3K4AA 4OHQA 3S1GA 3KOYA 1V6UA 1LJYA 1REQB 4YWIA 3SAZA 3TX9A 3PB2A 3EB4A 4AYGA 1W37A 1M9HA 3LS9A 2XINA 1HXJA 1JYWA 2NQ5A 1V3LA 3PPHA 1XRFA 1W2PA 2INFA 3UJFA 1SR9A 3MUIA 4J3WA 1OCJA 2E28A 1OFEA 1T8XA 1ZBCA 1GOXA 2XVLA 4B5SA 4JS3A 4XD6A 1P0NA 1NH6A 2EAWA 3W7CA 1V0NA 4UFMA 1P4CA 1QR7A 2HE5A 2ZX6A 3MHGA 5LA0A 1YX1A 1CXHA 4I5UA 3IK2A 3OLEA 1TJ1A 2PRMA 4QBXA 1DYSA 1UD8A 3WQGA 4K37A 1Q66A 2ZUWA 3S5SA 2CHRA 3TWBA 3C8NA 3AU6A 2DORA 3AMDA 1EJSC 4UCGA 4F79A 1XL9A 2C14A 4MM1A 1AQMA 2WJFA 3SBFA 3NQMA 4PMDA 3BICA 1Z69A 3OIHA 4WXYA 1KM1A 4WJXA 3I7RA 3NG3A 1RPXA 1TCDA 1IHIA 5C9ZA 4ZE4A 2G37A 4GJIA 2OLHA 1LF1A 5DT5A 2QF7A 4PCPA 2WVTA 2WC3A 3GHUA 2WLZA 2MNRA 3W25A 2XZ9A 3G0UA 1MUMA 4US5A 1HIZA 4GIRA 1PYFA 4KGLA 3M0LA 3USZA 1W1B1 3LOTA 4CVUA 2VGIA 4FLQA 4MLRA 3SUTA 1Q6FA 2WSPA 3W6YA 3UG5A 2VX5A 1POKA 3UJRA 3FXYA 4IJBA 5FD0A 1JZ6A 1O5KA 1FHDA 1T8QA 4W7VA 2VEGA 3AC0A 2EKCA 1TPDA 4M6UA 4XAPA 3MCNA 2QXWA 3GXFA 2Y4SA 3UZXA 5KZDA 4AIOA 1Z44A 4PRRA 3NM1A 4DY1A 4CCEA 2UY3A 1XH2A 4TV5A 4Y7EA 1XH1A 3XISA 3V5OA 4FNUA 1W0MA 4OOZA 1XUUA 1ME7A 1ZZMA 4IGSA 3VI2A 5FF4A 3W7QA 4LS0A 3TU9A 1W2VA 4DLFA 2PWUA 3PS7A 1T99A 1TUFA 2NVDA 2VL4A 3PZVA 2GK1B 3E0VA 3OYXA 3TLLA 5D05A 2VZVA 5U4NA 1MW1A 1UR1A 1SYTA 4GABA 1LOSA 5DBTA 4RE3A 1OB0A 4LEQA 3WLIA 4A8IA 4F40A 3SFKA 2PDUA 3M0IA 5DQPA 2POTA 3VIIA 1TELA 4ICMA 3WK0A 3AZRA 1ONXA 3OLGA 3KUMA 2DH2A 3RU8X 4FLRA 2OQHA 4CNPA 3MI3A 1VC4A 2CZFA 4DWSD 4L9YA 3OQEA 2R1MA 3ZR6A 1H5YA 3NL2A 1SJAA 4D6DA 1AA1B 1X8FA 4K39A 3ANVA 2QUNA 3VNJA 2XFWA 5F4WA 3OODA 3GDTA 1TX0A 1UKSA 4RXFA 4UTIA 2X1RA 4DWSC 3PTDA 4LAKA 1QI2A 1NSJA 3ARQA 5XIAA 3RPTA 4K2SA 2YL5A 1E4IA 2O7SA 1S5WA 5B7ZA 4Y9AA 4GH1A 3KXQA 4CD4A 2WHLA 3TWAA 4AIUA 1Q45A 1PS9A 5A6TC 2AKMA 4G8TA 4D71A 4DBSA 2CERA 4AUBA 4ZFMA 4UTWA 5JH2A 3MKVA 3MHUA 4AFYA 3QV6A 3NDYA 2Z24A 4H9XA 1E6ZA 1I2OA 4UCFA 5LYRA 3CPUA 2BVTA 2WNNA 4XKMA 2V2CA 4JX4A 2J8FA 2BGSA 4WQ6A 2ZQ0A 4D6FA 2JGQA 1JEZA 1NJJA 2WXDM 3Q45A 3NQ7A 4AD1A 3L4WA 4Z1DA 5CZSA 4B9YA 5L9FA 1KBBA 1D3HA 3E02A 2NVAA 4NF7A 3W22A 4JTSA 4CNSA 3DIPA 2IKGA 3CQHA 4HK6A 1QPNA 2ZX5A 4O4VA 4QISA 1NWUA 1CGTA 1NDZA 4QSHA 1QOPA 1SGJA 2DGAA 3P60A 4P8UA 4X3ZA 3LGDA 4Q4KA 2GUYA 3VOIA 3H6OA 3PTKA 1ICPA 3WQ6A 1DXFA 2BDQA 5CSUA 5DFAA 4UR9A 5CEWA 1UZHA 1CXEA 3GTFA 1W1IE 3VZZA 4B3KA 3L65A 3N19B 4F2UA 4LB4A 4JOMA 1J8VA 4K3ZA 3GDMA 3MUXA 4F0HA 2ICSA 4RR4A 2HS8A 3BLEA 1YDYA 3GTHA 3K8LA 3S1VA 3K4WA 1V08A 1DJIA 1M7XA 4HHLA 1KFJA 5E6ZA 3UR5A 1AODA 4DJFA 3Q37A 4ERAA 4FX6M 5CGMA 4WJEA 1JDEA 1CXLA 1JCYA 4C6QA 1TWZA 3W2UA 3GR4A 4PEKA 4ES4A 1S1PA 1EP2A 4LAZA 5LHFA 2QQ6A 3UT0A 9XIMA 3SSJA 3H4XA 5EMJA 1KM2A 2DZSA 2QVHA 3ZSTA 1VR6A 2OMAA 1XR2A 4AHPA 2HCVA 4PODA 1BLIA 4XZHA 2PMQA 3EB3A 5C9WA 1T96A 1L6WA 4HD5A 4EPDC 3C2EA 1B90A 4RW3A 3WMLA 1MXSA 4OKDA 3ZWSA 2E68A 5LGXA 3P5ZA 3OU8A 4X60A 4MSSA 4U4MA 1X1ZA 1F61A 3WK1A 4ZZ9A 1U83A 4O1EA 1FP9A 3S9IA 1NOFA 3L2IA 3ZJKA 3C2OA 3B0XA 3O3RA 1MZRA 1HG3A 3QW3A 3OBAA 3QY6A 1WKEA 3VOJA 4NYYA 8XIAA 4D2JA 1JXKA 1MRQA 1KM3A 2WBKA 1TVNA 3ZJ6A 4GOAA 3GW0A 4UFKA 4LV4A 1XCFA 4W9TA 3E2VA 3GXIA 2AKZA 1M01A 5DCDA 3SCNA 3TLQA 2A1YA 3D3FA 1QMLA 4TVDA 4C7DA 1W5OA 3CBWA 3WF0A 3IV3A 2E8YA 2E4TA 1V02E 4PB3A 1HQTA 4QLKA 3B9NA 1YBQB 3UZWA 1TUXA 1VEPA 1SFTA 1TWDA 4NAEB 1VFMA 4N6FA 5CZJA 3LY0A 3M5XA 1TPH1 3A12A 3DHPA 3BQ6A 3AUJA 1HKVA 2O0TA 2QCEA 4IJCA 3QHNA 2DSVA 3W2MA 3HV8A 5IXEA 3CWNA 1TWSA 2VCAA 3S6DA 3CASA 3UXLA 1XIHA 5LXEA 4IF2A 2PRLA 3AWOA 2VGBA 3RX3A 1JUEA 3EWZA 3QTPA 2H8XA 3PB0A 3PK7A 3BJFA 2YB4A 3EKGA 1K6AA 1CI1A 4LUIA 3W1TA 3FDGA 1XCWA 2YFNA 5FJIA 1EX1A 2WVUA 4PBGA 3ZLFA 5E0KA 1ZU8A 1VPYA 1H11A 3IGHX 1X96A 5DMNA 1KTNA 1FY6A 4JCLA 4CN4A 1M41A 4PZVA 5BXTA 1CLVA 4J5NA 2QV4A 1MMFA 1S2AA 2XPKA 3S46A 1W9BM 3VD5A 4I6KA 5F2MA 2DZPA 4F0RA 3GU1A 4MB3A 4TO8A 1W5QA 3GM8A 1G9HA 2DUXA 2X0YA 3DFSA 3GXMA 2OT0A 4WXZA 3CZEA 1US2A 4JKMA 1SJDA 1VFUA 3W38A 5I02A 1PAMA 3WD4A 1ODUA 4IQDA 1K6WA 3LHVA 2D23A 2DZVA 1J5SA 4D8ZA 1D7KA 2A6LA 3M0HA 4XTIA 1KTCA 3BANA 1B9ZA 1JPKA 5DO8A 3F5LA 3MBDA 3G8EA 4US5D 1OSEA 2YL9A 1GYNA 2D3NA 3Q2DA 3HGOA 4BI7A 5DX7A 2Z1VA 2QHAA 4CGTA 4P61A 4JD4A 3RG6A 1XBXA 1ISXA 3OTRA 2CLLA 5IDIA 3QV8A 1TKKA 2O9TA 3DCPA 1WKFA 4CNTA 4WDUA 4JTUA 3QFEA 3CMFA 2QULA 2IQ0A 2AGKA 5LNSA 1A80A 2E6YA 4JFWA 1EF2A 4JBRA 1AL8A 3G1HA 4E5TA 6PTDA 4FOUA 2F7FA 1DJXA 1W32A 1GW9A 1UD6A 3CNYA 4FR6A 1G67A 2G4JA 4QDWA 4S39A 1AH3A 4H6EA 1G6CA 3PFMA 3ABSA 3OW1A 4IMEA 4W7UA 4E8GA 4LANA 3H12A 1L6SA 1OX4B 1TMLA 1SR0A 5I24A 4QDMA 2XVNA 1KV8A 4JYFA 2QPUA 4MDOA 3W28A 3WUFA 3B40A 2CFFA 4MTVA 3P8IA 3REQA 3F4CA 1FHUA 5D9NA 1SU5A 1UUOA 2REQA 1W9VA 4PA8A 3M43A 1AL7A 3PBGA 4QNEA 4ZQPA 1IGSA 2QMJA 2GUUA 4ZO6A 3MP3A 3DI1A 3BAYA 1M68A 2JALA 3A3HA 1JVNA 1ISVA 3WF2A 3BCFA 3LLDA 1WDDA 3UCDA 3ZJ7A 5H8PA 2AQOA 4A2SA 1HL2A 3SUVA 4DZAA 3TW7A 1VYRA 4XZIA 3PUDA 3ORWA 1TV2A 1Z42A 1XLDA 2QNEA 1XG4A 3NOEA 3S9ZA 4QE1A 1WAWA 2YLLA 1IEVA 1EO7A 4BQ2A 1F3WA 4P02B 3O6AA 1YEYA 3KOXA 5G2IA 1W91A 2V82A 4DYEA 4W8LA 1GVQA 3U6WA 3MKKA 3L4YA 5I09A 1MZHA 2ZYFA 5EYWA 3MV01 5HJYA 1E9LA 4K1WA 2ZZ4A 3ZFHA 1VS1A 4LOCA 5HNNA 2R91A 2EG6A 4LVFA 2AQWA 4J35A 3URAA 3FYYA 1XWYA 4JY9A 1NFPA 3OP2A 3C0LA 2D24A 3HQ1A 4HNTA 3HQNA 2VC5A 2BXYA 4KESA 1L8PA 3NO5A 4CD7A 3GLCA 3TVAA 3DFYA 4NU7A 3TQKA 1GHSA 5FIPA 4ZTXA 1WCGA 1GOIA 4PUUA 4IFRA 3QYSA 1TE6A 2ZZ2A 4Z0SA 5A6JA 3PZGA 4JIRA 1OIFA 1ADSA 2ON3A 3MJYA 1TQJA 4DUVA 3GR7A 4PBFA 2VZUA 5CJMA 2ZXAA 1D3CA 2YYUA 1U5JA 4B3ZA 4HCDA 4B4HA 4NNAA 4TVCA 3WLKX 3A9BA 1EXPA 1QT1A 3UGRA 3E3HA 2AMGA 5CG7A 4R9XA 1FFQA 2C8NA 3L4XA 1MUCA 4UIOA 3GZ3A 4B5UA 4EKJA 3BAXA 3KM8A 2OX4A 2XISA 5I06A 1IXQA 1N82A 1QWGA 3DFHA 3EWWA 3ARWA 3NL5A 4OGZA 4L5ZA 4ORMA 1VD6A 4XUGA 3OB8A 5DELA 5T9BG 1H51A 1R85A 2ZWZA 4FNRA 2VRQA 2BBFA 4Q33A 5FAGA 2WQDA 3LCLA 1PIFA 3A4WA 2L5HA 4XSLA 2J47A 3T1GA 1OVDA 2R24A 2R1LA 1XLGA 2VKZG 3CV7A 3QH2A 5G4EA 5I3IA 1KFLA 2XM1A 3GH5A 2ALDA 4OBRA 1BQGA 3ATYA 1Q4WA 4DM2A 4GVGA 2GK1A 3BGJA 1ZAIA 3SQLA 1V3JA 5CJNA 2YL8A 2GJPA 3R4IA 1WOBA 3PAJA 4CQDA 2VP8A 1MFUA 3BG5A 1E40A 3R6IA 1C90A 3GC4A 3D3AA 3W73A 1YLVA 3H4GA 1UYQA 3N04A 4OJYA 1O94A 4IQLA 4UTMA 4MDPA 3TJLA 2FZMA 5LXXA 3L12A 5CZ0A 4M8UA 4HOWA 3BLOA 4JFTA 1P0EA 2WC7A 3WDJA 2D2HA 4WOQA 2F6KA 1JYVA 4GLEA 3OEXA 3GHSA 4UQEA 3W7MA 1Z9AA 2YXXA 1Q6EA 2PEVA 1IZCA 4Q8PA 1OX4A 3MJMA 4CD6A 3NPXA 2PDGA 3STFA 3W2JA 1BD0A 2Q8ZA 4QITA 2OEJA 4DB7A 4I6VA 3IIPA 5G1TA 4NRRA 3VMOA 1JF6A 4FXFA 2Y5SA 3AHZA 5XIMA 3IGXA 4WKFA 1K8ZA 5DBUA 4FP1A 3UXDA 1RY8A 3FY1A 1TPUA 3R89A 1P7TB 4P8VA 5DXYA 3H2OA 4OV9A 3GIQA 4RUBA 2QJIA 5GNZA 3GBEA 1YNQA 4JIPA 4HA3A 1JPMA 1B4EA 3EXRA 3CJPA 5ABGA 3BURA 4AD2A 1XIGA 2CETA 4PH6A 3UGVA 4HQVA 3GU2A 1HVXA 3B8DA 2RFGA 3AMKA 4IMCA 3SQMA 4C6DA 2ZUSA 1KWGA 3E6EA 2QMKA 3HM7A 4TU1A 5AHLA 1PIGA 2WQPA 1CXKA 3BL3A 2VEIA 4YL2A 4OBTA 4Y96A 1TWWA 2FVKA 3IJQA 3WQ4A 1V3KA 3TCEA 3ZWTA 3CUZA 1C8YA 4NNCA 5EFFA 3ARTA 4NJGA 4XBSA 3ZVHA 3P5YA 3LPPA 5BOEA 1P0KA 2GVGA 2VFIA 1HN1A 2XFYA 2BOEX 1A4MA 4ZSUA 1WX0A 1N2VA 2BHYA 2VCCA 1J18A 2CWXA 4GI4A 1GGOA 4GK8A 5AYIA 3TJIA 4AHOA 4A3HA 4KH2A 1M04A 1JR1A 3LV6A 2QCDA 3ZS4A 4KFNA 1PKMA 3EDJA 3O06A 8XIMA 4XK2A 1PIIA 3A6OA 5HOSA 4L56A 5EB8A 7ENLA 1JIBA 3IVTA 3AROA 1XGDA 4UNIA 4JHZA 1LRTA 3GRIA 3WDHA 4J4KA 1OFDA 3F4WA 5FCZA 3MSRA 1L2QA 1UA7A 3KZSA 3EPNA 1VEMA 2P53A 3MSDA 2NXGA 4C6FA 3EX1A 4AHQA 1FWDC 5CCZA 3WEMA 2OEMA 4C5ZA 4C1NB 3UWYA 2CIPA 4XKYA 4IFKA 3KOFA 3VNMA 4IGHA 1P1XA 4RNJA 4Z2GA 1VFOA 4MUZA 1M7OA 4QFUA 3ZIZA 4MUPA 3K4DA 2VQUA 1C7TA 2YBUA 1FBAA 2P0IA 5C9XA 4V2XA 3UJ2A 1ZBWA 1KW1A 1Q2SA 4J2PA 1JI2A 1PWLA 1EZ2A 4G9PA 4F0KA 1K77A 1YE6A 1MVYA 4IFKB 4C6NA <