3LDVA

1.77 angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase from vibrio cholerae o1 biovar eltor str. n16961
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
231
structure length
231
Chain Sequence
AMNDPKVIVALDYDNLADALAFVDKIDPSTCRLKVGKEMFTLFGPDFVRELHKRGFSVFLDLKFHDIPNTCSKAVKAAAELGVWMVNVHASGGERMMAASREILEPYGKERPLLIGVTVLTSMESADLQGIGILSAPQDHVLRLATLTKNAGLDGVVCSAQEASLLKQHLGREFKLVTPGIRPAGSEQGDQRRIMTPAQAIASGSDYLVIGRPITQAAHPEVVLEEINSSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title 1.77 Angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase from Vibrio cholerae O1 biovar eltor str. N16961
rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Lyase
total genus 78
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ldvA00
2O7SA 4ALDA 2R91A 2NXIA 3W1QA 2GJLA 1SUXA 3BVJA 1T99A 2V8ZA 3HB9A 1OFDA 3NQAA 3L0KA 2E68A 4PH6A 1JUKA 3W6YA 2V0TA 3DGRA 3NQDA 4OV9A 3Q37A 3TFXA 2RFGA 1XDLA 3E12A 2EHHA 4JTEA 3EXRA 5AC8A 4PL1A 5C6MA 3MMTA 3B0UX 3W72A 4Q32A 1ICSA 3UWYA 1PHQA 1LBMA 2V2CA 2X1SA 4JYEA 2OJPA 3QH2A 3TFCA 1AW2A 3LBCA 3MP3A 4R34A 3TUUA 2VEIA 4M6QA 4RXFA 3LTYA 4GUIA 2C13A 3LHZA 2VEMA 5LNRA 3MP4A 1T8XA 3IEBA 4FNSA 1SQ7A 1OX4A 2C0AA 3PBVA 5F2MA 4Z1DA 2Y7EA 3K30A 5HWMA 1VCFA 2ALDA 1IXPA 4FNUA 4O57A 4DO4A 5DY2A 1AG1O 1HG3A 3DH7A 3E96A 3TA6A 3WJYA 4UTUA 3NQFA 3GYEA 3A9IA 2B7QA 3P82A 3UD6A 3S8HA 4JTLA 1AMKA 1CW2A 4YWIA 3TKFA 2A7PA 2QCNA 4LWWA 4M6VA 3B04A 3P80A 3WK3A 1P1XA 4KKXA 2QCEA 3W1NA 4O19A 1ZJIA 1H63A 3TC6A 4FEZA 3M0ZA 4GE8A 4TO8A 4O15A 5K4XA 4QQ3A 1UCWA 3F4NA 2A7NA 3W2KA 3PBUA 4ZQMA 3GDLA 1T96A 2CZ5A 3IV3A 4NU7A 3GX9A 1VLWA 1LP6A 3R12A 1G7UA 4QSHA 1LBFA 1BEUA 3S9YA 1LCOA 1GJPA 1O5XA 1YDOA 4IMEA 5FF7A 5LNSA 4BFAA 3G0UA 1OYAA 1TPUA 2G95A 4MFEA 2HMCA 1OFOA 2R8WA 5CPOA 4A2SA 3CWOX 4O28A 5HQEA 5D2VA 3T44A 3QW3A 4FB7A 4OGZA 3IIVA 3L21A 1FBAA 3QMRA 4O4WA 1F7BA 2X2GA 1G4PA 4GUHA 2R14A 3CEUA 4WXZA 3TROA 1SO3A 2JKEA 2BWGA 6TIMA 1KM1A 1TB3A 4JTKA 3R8RA 5LKYA 2Y85A 2A6NA 3IGSA 4GBUA 4LOCA 2GPTA 1KFCA 1FWSA 2Y70A 1KV5A 3GXNA 2E6DA 3NM3A 3T78A 1GT8A 1I45A 1KTNA 4XTIA 3LX9A 2DZVA 3FJLA 3IIOA 3RMJA 4DF1A 3EKZA 3OBKA 3N2MA 4MLRA 1LRNA 4TX9A 4QNWA 1ADOA 1JVNA 3ABSA 4YCOA 1GPWA 4M5PA 3O1NA 3HO8A 2NX9A 1K8ZA 3ATYA 4LTSA 2Z1BA 5HUPA 3I7SA 4JYFA 4DQWA 1L6WA 3IGUA 5I3FA 3VFLA 3WK1A 4ORIA 1U5JA 3L2IA 1WV2A 2RDTA 4OV4A 4N9CA 3S5ZA 1PL9A 2H3DA 1OX4B 2J9XA 1OHLA 2YX0A 1XI3A 2B0MA 3GB6A 4IPIA 3ATZA 4IGHA 2GOUA 4MJZA 3LHWA 1SZGA 1JR1A 3B03A 5D2TA 3KHJA 3TSBA 4RV8A 3LHUA 5HUOA 4DBEA 1A50A 1ZHAA 1LYXA 5F2IA 2PRLA 5AHIA 3TMLA 1KM2A 1W5PA 3F1QA 2CLLA 2J9ZA 3ABOA 2VC6A 4HNUA 4YXGA 4NZFA 5KZMA 1I4NA 3PBWA 4CNNA 3BLIA 3T40A 4LY8A 1VCGA 1OFRA 3BGJA 1W8SA 3NL6A 2DZUA 1SPQA 1JCXA 5K4ZA 1MEHA 3KVKA 1HUVA 1ZAHA 3HPZA 3TR2A 3FFSA 3O6CA 2QAFA 4JTFA 1HFBA 3C3NA 2C1HA 3FYPA 1TPH1 3G22A 1YXDA 1K3UA 1JRBA 1P0KA 3TV8A 1JQVA 1FY6A 3FYOA 3VI2A 3HMJG 3P8JA 1TPFA 3PUOA 2ZA1A 1D3HA 4DELA 1VS1A 3HG3A 3I7QA 1B57A 1XBYA 1L2UA 2XN2A 2A0NA 4TR9A 1IF2A 5AN7A 2Y63A 3GVGA 1S5VA 2HS8A 3LI0A 3P61A 4FNRA 4TMBA 4LUJA 3TAKA 4FXRA 3CT7A 2X16A 4U28A 3S5OA 1VLIA 4IQLA 3SZ8A 1AK5A 1P5BA 3W7EA 5AB3A 1JCJA 2V9DA 1J2WA 3W1XA 1B3OA 2QUTA 5AHNA 2X30A 5EL1A 4TIMA 4FX7A 4LS2A 4QAIA 1RD5A 1QCWA 1TQJA 3RLUA 1LLWA 4QNEA 3BW3A 3STEA 1VHNA 1JULA 4G1KA 3FJ6A 3JS3A 4DO6A 2DJXA 4RJEA 4K38A 3P60A 3S1XA 2PRMA 3EEGA 4AVFA 4IMFA 1SR9A 4WUIA 4N02A 4WQ6A 2I1OA 1BWLA 4LS1A 4RXGA 1SFJA 3T7VA 1TRDA 3L66A 5BNKA 2GQ8A 1VRDA 1XBZA 3N9SA 1ICPA 3QJAA 4GNJA 4O1BA 4HNVA 3B4UA 3CLMA 3HG4A 3W2NA 4RZ5A 1QWGA 4O18A 3EXSA 4NJJA 4NNAA 4M6PA 3NR0A 4QIUA 5E0KA 3G1XA 3TIMA 5HMSA 3BO9A 5TQLA 3KVMA 3KRZA 3NQ7A 1KLZA 2ISWA 2J88A 4MY1A 3RNDA 5LNVA 2QCMA 1W56A 5K3VA 2DZWA 1KFLA 2OCZA 2ZZ1A 4WOQA 3W1RA 5H2ZA 3M16A 4UTTC 3W7MA 3TE9A 3M5YA 1VQTA 1FDJA 2AGKA 3DAQA 2GQAA 2XN0A 1WOAA 4JX6A 5IM51 5CZTA 4ZMGA 1ZFJA 4HT3A 5I3GA 1VYSX 4X3ZA 1W3NA 2A21A 4JIQA 3NQ2A 2QDHA 1QR7A 4UFJA 3VNDA 3SJ3A 1DQXA 3W7OA 1PHWA 3CWNA 3WJZA 3MI6A 4UTWC 1EEPA 1F76A 2ZYFA 1TO3A 4YLWA 5SWUA 2QCGA 3L0GA 2OZ0A 1SSDA 4UTIA 3W7PA 4K36A 1M7OA 1ZY9A 3P5ZA 4FNQA 1QPOA 3EB2A 2NUWA 1H51A 3QRHA 1KA9F 4NXKA 1RQHA 4H4IA 5LGXA 5HULA 3TQKA 4JDYA 3UWUA 2VFIA 4LUIA 2I14A 4IMDA 5D38A 1D3GA 2ZRWA 1EPXA 2ZA3A 3DFTA 5F2GA 1THFD 3HGOA 3QC3A 5DCDA 5FESA 5TIMA 4EF8A 1H7NA 3W1AA 3CC1A 3EWZA 3PS7A 3M9YA 3BLEA 3W2UA 3C0JA 2NWSA 2FJKA 3I7RA 3R89A 3PB0A 3FKRA 4O10A 3BGGA 2VENA 3KXQA 3M41A 3UY8A 4AB4A 3EXTA 2A2IA 1DBTA 1F2JA 1ALDA 4AHPA 1GTHA 1VJIA 2V2HA 3AO0A 2Y7GA 5F1UA 1JCLA 4IXXA 1TTQA 4S2CA 3W9ZA 3TMQA 4MY8A 3W22A 3DHDA 1ZAIA 3CEPA 4NJKA 2FPVA 2CZFA 3BW2A 4Y9AA 3TU9A 3M5XA 4A2RA 3LHTA 1IXQA 5D05A 1X1OA 4RX0A 3QSTA 2P0OA 4CLMA 3KVLA 1ONRA 1KW1A 3HIJA 3L5LA 3E02A 2VEKA 1W1ZA 5DXXA 4TU1A 4MVAA 4ZZ9A 1S3HA 2Z6IA 1YYAA 4O50A 1GVFA 2QF7A 3QM3A 4AWUA 2NLIA 4UCGA 1LBLA 2C15A 3M47A 1ZCOA 1DJQA 1EUAA 1GYLA 5DXYA 2YPIA 3O6DA 3MW7A 5CG7A 5LSMA 4A22A 4WXYA 3S42A 2DZTA 2YW3A 1XCFA 2C14A 1H5YA 3WK0A 4DEFA 3C61A 3LCWA 3UWZA 3NQEA 4AEOA 4XZ9A 2WNNA 1IIGA 1UB3A 2E6FA 3W3OA 3NL2A 4AHOA 2CLIA 1YTDA 2WPBA 5D09A 3LRMA 1E51A 3W7CA 4GC4A 2LLEA 2H8XA 1XC4A 4CCEA 1SU5A 2DJLA 1I8JA 3MP5A 3W7LA 3IIPA 4FHAA 2HS6A 4NJIA 2PURA 3G1YA 3TSMA 4K8EA 1JRCA 1EP2A 1PS9A 4LV9A 5TBOA 2ZZ2A 1QPNA 4JTSA 1R46A 3TC7A 3EX6A 5D2YA 4JY9A 1WX0A 5F1VA 2YDAA 1VC4A 3GDRA 1M7PA 1A5SA 4UTJA 2Y62A 4CQ9A 3MYPA 2AAMA 1EWDA 4X22A 2A1YA 3EWWA 2QJIA 5CPLA 1F5ZA 2W0UA 3HG5A 3LV5A 4W9TA 3STGA 2CWNA 3LXCA 2YZRA 4C1LA 3MBDA 4ZQPA 4XKYB 4EOUA 2H90A 3N9RA 5EPDA 3G1HA 5DCBA 2GJNA 3M5VA 1RQBA 4NX5A 3UPWA 2HSAA 2E1DA 3WK2A 2VXNA 5CPMA 2J24A 4PL2A 3S1VA 1R30A 4LU0A 4O0KA 3NO5A 1DVJA 1H7OA 1S5WA 3W1UA 2Y7DA 1QAPA 2G5WA 2E5BA 4RLIA 1X6UA 3L67A 3OHIA 3W2MA 1LOSA 2FB2A 3G8EA 4K8HA 3JR2A 3KFTA 1QO5A 4ORMA 3C56A 4FXSA 4O52A 4RZ6A 3NZ1A 1SSGA 1K02A 3QYQA 1TJRA 3A22A 1VPXA 2Q3RA 1FCUA 3KAOA 1S5TA 2CLOA 2TPSA 3ABQA 3SGUA 3IVTA 3L9CA 2QAPA 4IJBA 5CPNA 1PIIA 3A5FA 1SFLA 1LDCA 4MYAA 4JY8A 1WDWA 5AHMA 3PG9A 2CU0A 4ZQCA 3IIZA 1ME7A 3NNTA 5D37A 3W7DA 1TTJA 1SZFA 3GR8A 3UWWA 5I3IA 4ADSA 2QR6A 2VKZG 4DPQA 1EWEA 4R7JA 5DBUA 3KVJA 4Z08A 5HJLA 3DI1A 1H7WA 3FOKA 4E38A 3UYCA 5EY5A 1DKWA 4H6KA 2G97A 3UQNA 2YCEA 4MFDA 2BLEA 1H62A 4IOTA 4YCPA 1WBHA 4HN4A 3HF3A 1TCDA 1KFKA 3W7QA 1PCWA 1WA3A 4O14A 4Z1CA 4N6EA 1UBSA 2WNZA 3TW7A 1XBXA 1TMHA 1B4KA 5HWJA 2Q8ZA 1DOSA 2CLMA 1LZOA 1WBJA 4LVAA 2QCDA 2V5LA 3RK8A 2JGYA 3GAYA 2H6RA 3DFPA 4OT7A 4IXHA 1QPRA 1QOPA 3HJZA 2E77A 4JTJA 2Q3OA 1Z41A 1OX5A 3O6YX 1A53A 1FCQA 1K7EA 3GK0A 1TRIA 3NM1A 4JDBA 3P62A 3LB0A 1W3TA 3W84A 1O4UA 3THQA 3ZFHA 3QMTA 4A3UA 5LZLA 3MWAA 3VCRA 1W5QA 3B06A 1XBVA 2B7NA 3L5AA 4OHQA 1K8YA 3NOEA 4FNPA 4JR5A 1XM3A 4S1FA 1NFBA 1TV8A 2C16A 3EX3A 2CFFA 4I7WA 4MPQA 1B9BA 4B5NA 4FNTA 5D30A 2VOMA 4JD4A 4AWTA 1XFBA 4M19A 3NL5A 3Q58A 1XUUA 1WXJA 3BW4A 1FX6A 1Z48A 5U7SA 1J4EA 3A21A 2NV2A 1KFJA 3CB8A 1SZNA 3N3MA 4I9AA 3NVTA 5EMUA 4OU1A 3O16A 4O4VA 5KMYA 3MHUA 3GLCA 4OWGA 2UV8G 3LRKA 2B4GA 4NXSA 1AL7A 4LVBA 3FA5A 4UTTA 1LOLA 1KM5A 4OE7A 1X1ZA 4CNOA 4E0CA 4YMZA 4H3DA 3NAVA 1HL2A 4MZYA 3W7IA 2RH9A 1FWRA 1KM4A 2JKPA 4NX0A 2P1FA 1MZHA 3O06A 1R2TA 3W74A 4NQ1A 3P67A 1WOBA 1JJKA 5HWNA 3NA8A 1UJPA 3BARA 4X2RA 3O05A 2ZBTA 2G96A 4UTWA 1FXQA 1FCVA 1YXCA 3S1UA 6ALDA 5FF4A 2FIQA 5K9XA 3TK7A 2DP3A 1GVRA 2YSWA 2GVGA 3DFSA 3E9AA 4HPJA 2J27A 3IRDA 3P74A 4ZVJA 3TXVA 3W7HA 1ZENA 3N19B 2ZFAA 4UTKA 1FXPA 1I2QA 1XDMA 4RCXA 2IQTA 2PC4A 4GFSA 2B7OA 4X9SA 4JX5A 1GG0A 5DY3A 5BOOA 1QDSA 3GDMA 1TTIA 1W5OA 3CU2A 3CQ0A 1A5BA 2QCDB 3W2LA 4MY9A 5BMXA 5LNWA 3LCHA 4FIRA 3M44A 2F7FA 4XBKA 5FF3A 1GWJA 1EB3A 3IVUA 3W7GA 3MHGA 7TIMA 3GIYA 2E5CA 1KBIA 1LORA 1IGSA 2FPTA 4UC5A 3G1VA 1P4CA 1YXYA 2WKJA 3EKLA 3N14A 3PUDA 3STFA 2WQPA 1EP3A 2ZCGA 3C4UA 2C6QA 1K03A 1YTEA 4JTIA 2NV1A 1BWKA 3UNDA 3W1PA 3LBMA 8TIMA 2Z0IA 5E93A 1GTEA 2GQ9A 4FX8A 3PC0A 1FCBA 2VFHA 2FB3A 4POCA 3W7RA 3UWVA 2ZDRA 1NF7A 1XUZA 4K37A 5K9DA 3C8FA 4MOZA 1IXOA 2BZNA 4AHQA 2Y89A 3TSDA 4UR8A 4LV4A 3GKFA 4UNLA 4UTMA 3SSJA 3G3DA 1Q45A 1DL3A 1XXXA 4MLJA 1TV7A 3S0CA 1FDYA 3O15A 2VFEA 3UXAA 2TSYA 5A5WA 5C54A 3P84A 3QMSA 2ATMA 4JXCA 3HPXA 2Y6ZA 4FIQA 3TQ0A 2ZQ0A 2DZSA 3LM7A 3MHFA 4YL2A 4FX6M 2F84A 3ZS4A 4UFMA 3ZWSA 3P5YA 2QKFA 1NF0A 3W7KA 3CHVA 5IBXC 5D04C 4MZ1A 3W87A 4PEKA 1RR2A 3F4WA 3M43A 4JTHA 4JS3A 3U8GA 5CSSA 5T26A 3O07A 1OX6A 2GUUA 2NZLA 1Q6QA 4NNBA 2J6XA 2ISSA 3HGJA 2EF9A 2A4AA 1TPVA 2YFOA 3C2RA 4HIBA 3CPRA 4ZQOA 3Q94A 1GVQA 3BLFA 4TMCA 1EX5A 3PUEA 4ADTA 4MKNA 1JUBA 1FUYA 3DFOA 4XQ6A 3S6DA 4R53A 1OFAA 1A5CA 4NUWA 3W1MA 4Q4KA 2ABAA 2BSLA 2QCHA 3KOFA 4LT9A 4LS0A 1ZAJA 3CM4A 5K9CA 1FDZA 5KINA 3G0SA 3RU6A 3GAKA 1G6CA 3NDOA 2RHGA 3GNNA 4KWVA 4RK8A 4FO4A 4O13A 5GVJA 3H53A 3QW4B 4PCFA 2RDWA 2DZPA 2V5BA 5CGQA 4K7VA 4Z0JA 5CSRA 4ADUA 1KLYA 2BTMA 4Q33A 4MZ8A 3N34A 3L5MA 2V81A 1M5WA 2PRHA 5ABTA 3HOJA 1FWTA 1QO2A 4GUJA 3FS2A 4XKYA 3P7YA 3QF0A 5FI8A 5MHBA 2Z6JA 5FEWA 1R2RA 4IMGA 1TPEA 4KWWA 4LRSA 2Z2UA 3MO7A 5G2IA 3GDTA 3OVQA 4O0ZA 4ZQNA 2YW4A 2ATSA 4IPJA 4IWWA 1SW7A 4JTTA 4DF2A 1TTPA 4QITA 1N7KA 3PWAA 4NT0A 3HGSA 1QPQA 1OF8A 1SO6A 4WY0B 1VGAA 3LCLA 3MBFA 3AJXA 1Q6LA 2ZRZA 4N9EA 5F4XA 3DKLA 4JX4A 4ML9A 3DI0A 3OG3A 3CIXA 4AF0B 1D9EA 4BI5A 1M6JA 3G1SA 3NGJA 5C2XA 2WOQA 3S1WA 3ELFA 4BWLC 3QQ0A 4WD0A 5AC6A 1RVGA 1OVDA 3S5YA 3QPZA 2ZRYA 2TYSA 5AYXA 1W37A 3G8RA 1N8FA 2P10A 1F05A 1YDNA 2VEPA 3EX1A 3EWUA 1DJNA 1Z42A 1TIMA 5AYZA 3DFNA 3LLDA 3M1ZA 3N2XA 3FLUA 3W86A 3EWBX 3DHFA 4DO5A 3G3MA 2A6LA 3QQ1A 1O95A 4LW7A 5EBUA 4DPPA 2EAWA 1OYBA 1F73A 3IIXA 5L9FA 4PC8A 4EIVA 3G1AA 3ANYA 3MI3A 3DBPA 4GJ1A 4N4PA 1AL8A 2ZRVA 3U2OA 3G1FA 1YPIA 5FF2A 3NYZA 1FWNA 3W73A 3W1LA 1VH7A 4Y6GA 2AQWA 4HPXA 1X7FA 2X1RA 3LCIA 3PG8A 3I6RA 3CIWA 3EX2A 3QPYA 3NQVA 4XBSA 2OX1A 3G0XA 4HHPA 3NEVA 4E2BA 1L9WA 1GOXA 3ABRA 2X1UA 5G4WA 1GEQA 3R2GA 1KM3A 3T4CA 1K7XA 5KZDA 3LDVA 3W1TA 1OFEA 3PR2A 2YYTA 3BG9A 4RZ4A 2FQIA 1QFEA 2ISVA 1MEIA 1W5NA 1ME8A 2B7PA 1O5KA 2ZA2A 1U83A 3OEXA 4MUZA 1OFPA 4CNPA 5A8GA 5AC7A 3DENA 2OT0A 1H60A 1GVSA 4DF0A 1SO4A 4XUGA 5EYWA 3W85A 4Z1AA 4S2BA 4MJMA 2ZTKA 3GXPA 3WJWA 3OA3A 2PCQA 2E09A 3FKKA 1TPB1 4AWSA 3M6YA 3SIZA 1O60A 1FQ0A 3EWYA 1YPFA 1W3IA 1K8XA 2HTMA 3NQCA 2CZEA 4BI6A 3P8IA 3W07A 3B8DA 5HR6A 3G18A 3NPXA 5D2XA 3B05A 3UY7A 2EGZA 4GXMA 1NVMA 4UFIA 1JCMP 2C19A 1XKYA 3GDKA 3NQMA 4C1KA 5G2WA 1BTMA 4UR7A 5G5IA 2OMAA 5L6UA 1MSSA 3RF9A 3DZ1A 4KFNA 3H54A 3C52A 1BKSA 4JTGA 1L6SA 4UFHA 1G67A 5HR7A 1H7XA 4QM1A 3I68A 2QDGA 4UIOA 2J9YA 1I2RA 2R94A 1WYIA 1ME9A 1YADA 3B0PA 1W0MA 1JQXA 5LHEA 4JEQA 1EUNA 1SZEA 4O11A 2FTPA 1UUOA 4GWEA 3QSRA 3DFQA 1GVOA 1G69A 3ZR4A 3GZ3A 2BXVA 4IX0A 5K7JA 2TRSA 3LHVA 2ZZ7A 4NJHA 2VELA 1LM1A 5D02A 2ZZ4A 3NG3A 4NZJA 5HNRA 3SW6A 2XN1A 2CLFA 2WSRA 1OFQA 4JN6A 1TQXA 1TPDA 3UWQA 1QOQA 4XWUA 1LRQA 1R47A 2TMDA 3KX6A 1KM6A 3OIXA 3W23A 4GRSA 4LVFA 4HNTA 4JYDA 1KTBA 4AH7A 2E6YA 2GVJA 4UFLA 1VYPX 4NVTA 3IVSA 5DN1A 4UMAA 2ZRUA 3U6WA 5LGZA 4NJGA 3PBYA 2NWRA 3FEMA 4WJEA 3TX9A 4HSNA 4HNNA 1SW0A 1V5XA 3LXAA 2RKXA 2QEZA 2V2DA 4Y8FA 2A5HA 3PM6A 2ZZ3A 4CQ8A 3W2JA 2Y7FA 3TAOA 1ZNNA 4UNKA 3A23A 4UTHA 1G7VA 1VZWA 4O8RA 4Z0SA 4AAJA 4BF9A 1DQWA 1PV8A 2FLIA 3EWXA 1DORA 1TSIA 1OF6A 3HBLA 4QISA 1VCVA 3UZJA 1KV8A 1QNVA 3EX4A 3W7NA 3TCEA 5DELA 2NX3A 4LVDA 1EA0A 3PSVA 3W75A 4IX2A 1N55A 3GR7A 3LCXA 1OG0A 3PY2A 4WX2A 5DCEA 5AOUA 1LRTA 3BK0A 4N9DA 2QJGA 5F2LA 1TJPA 4JNMA 4NNCA 1X8FA 1YTKA 3LCFA 1G4SA 3O8AA 1R2SA 3BV4A 3C2OA 3C2VA 2EKCA 4KFOA 1DHPA 1H1ZA 1WQ5A 1O94A 1RV8A 5D03A 3P81A 3LCGA 5CKSA 1H1YA 3G24A 3LERA 1TYGA 4D2JA 5BW6A 1Q6OA 1GZGA 3LLFA 3USBA 1OFBA 1H7PA 5IBXA 4WOZA 1G4EA 4N6FA 1VYRA 5AFDA 1TV5A 3CTLA 3LHYA 4Y90A 5LHFA 3ZWTA 3T55A 3L65A 4RKAA 5FEPA 1TPWA 1P0NA 1F74A 1PCKA 1HO4A 3UPBA 2A85A 1CI1A 1MO0A 2YXGA 4JICA 5KTLA 3GXTA 3HPSA 5AHFA 1Y0EA 3Q2DA 3A5VA 1MXSA 1OK6A 4UTLA 2WSQA 1OK4A 3G1DA 3NZRA 3QEZA 5DBTA 2QUUA 2CZDA 4ICNA 1TREA 5FEXA 1H7RA 5AHEA 3W88A 4E2DA 3NPVA 3BPWA 1F6KA 1JUEA 4ZQRA 4ZL1A 1Z44A 2NUXA 4OBTA 5J5RA 4PFMA 1I2NA 5CZSA 5HINA 3M7WA 1OJXA 4LVGA 1UASA 5D32A 2E6AA 1RZMA 3SR7A 1I2OA 3OVPA 3QFEA 1QMLA 2QCLA 3W76A 3SY5A 3VKJA 5EKYA 5G2HA 2JBMA 4GUFA 1LOQA 5KITA 3LI1A 3KRUA 2OT1A 3E49A 4RR4A 3DKJA 3F03K 4FF7A 2GVLA 3PSWA 2W79A 4IMCA 3PVFA 3FIGA 3W70A 2VFGA 3GKAA 3M5ZA 3PF3A 3STCA 3W7JA 5LNUA 2JK2A 4O17A 1GYNA 2QCCA 3SI9A 1C9DA 3A24A 1VR6A 5C5YA 4O53A 3B0VC 2WJZA 1H61A 3TXZA 1DV7A 1RPXA 1LLZA 1HO1A 1ZALA 3O63A 1NAL1 4M7TA 3UXDA 4WY0A 4R33A 3V1PA 1J5TA 2JGQA 1ICQA 2CLHA 3TJLA 4N4QA 1W5MA 1C8VA 2NXHA 3C2FA 3L68A 3LGEA 3TNOA 4KFPA 2ZZ6A 2WO5A 4CCCA 3BG3A 3R5EA 1C29A 4A21A 4AF0A 4BWLA 5BMWA 4AMAA 1Q6RA 5I3HA 3NQ8A 3GNDA 5E1QA 4EWND 5C55A 2QCFA 2WV8A 2XFWA 5BRBA 4DXVA 2ZRXA 1H50A 3JRKA 5FEZA 3C6CA 2D73A 4U4MA 1KFEA 4Y96A 3LV6A 4L4LA 2NXGA 4LRTA 3D0CA 3TJXA 1YLVA 3INPA 3THAA 1A5AA 3NQGA 4BI7A 5F4WA 2YYUA 4I7UA 4LC6A 5J5DA 4M7SA 4K39A 4UUIA 1ML1A 1GQNA 3SECA 4K6AA 4EVZA 4PODA 1L6YA 4XTDA 3LTSA 1IXNA 1KFBA 2WNQA 3MYOA 4L4MA 1OABA 1CX9A 3QZEA 4WZHA 2WSYA 4DBDA 4PA8A 1F6PA 3KRSA 5DLCA 1EIXA 5U4NA 3LTPA 1JCYA 3HGRA 4UMCA 3UZ5A 4OQVA 4CQAA 3MI2A 4GUGA 1KTCA 2RDUA 4MYXA 3WFAA 2H8ZA 2V30A 2FFCA 5CZJA 1NSJA 2NUYA 2H3BA 3TDFA 3PB2A 2C18A 1FWWA 4P61A 1JCNA 2Q8LA 5K2ZA 4IUOA 3TW6A 4A29A 2YFNA 4N2YA 4O1AA 3TH6A 3YPIA 3MUXA 1GG1A 2DORA 2V82A 3W71A 5F4SA 1W31A 5FF0A 3H55A 3S5NA 1V7YA 4ONVA 5CZ0A 1PE1A 4O1CA 3C2EA 2DZXA 1B4EA 2JKAA 2KZHA 3LRLA 2BX7A 2VFDA 3RLVA 2NX1A 2VFFA 1RQEA 4HKPA 1MEWA 3NPUA 1IIHA 5H91A 5KSWA 3WJSA 1UUMA 5AHLA 3I65A 3OVRA 4UFKA 3NQ6A 3E0IA 4UXDA 2ABBA 4N9BA 2X1TA 3NPWA 4I7VA 1I2PA 3TQVA 3VE7A 4BR1A 4J9JA 3MJYA 2Y61A 1SW3A 3DU0A 3N73A 2PE4A 4LC8A 3NL3A 2YGYA 5G1YA 1LTDA 2CW6A 2CLKA 5D2WA 1AW5A 1PVNA 3SFKA 1Q3NA 4AXKA 4PTNA 5AYYA 1WAUA 4QJ1A 2FDSA 3PAJA 2A7RA 3NXFA 1XL9A 3DXIA 3HQ1A 5I3JA 5D33A 4UMBA 3IGXA 2ZZ5A 4MIMA 3PULA 4K7YA 2C3ZA 2W6RA 1EP1A 1SO5A 3V75A 1LROA 5I3KA 4EF9A 2DU2A 2YR1A 4O12A 1K7FA 1T0OA 1TPC1 1AW1A 2E5DA 2I9EA 3L0NA 4CCDA 4HSOA 4JGDA 3VE9A 1KBJA 1NEYA 5G1TA 3R13A 2Y88A 1OYCA 2CLEA 1W54A 1YDVA 4JTUA 4WY0F 4BK9A 1KM0A 2FPYA 3LXBA 2O7QA 2ZTJA 4O16A 4Z1BA 3SGZA 4P2VA 4O54A 2QUVA 4O1DA 1VHCA 3LOTA 5G4EA 5KZEA 4JIPA 3W83A 3BG5A 1HTIA 1G4TA 4LNYA 5EA9A 2QJHA 3HG2A 2EPHA 3RFAA 3WJXA
chains in the Genus database with same CATH superfamily
5IXEA 3C0LA 1NM9A 4GO9A 2NXIA 2GJLA 4GABA 1T99A 4GQGA 2QIWA 2IPGA 2RJHA 5M17A 3IS4A 5T9CE 1JUKA 2NQ5A 3W6YA 2V0TA 2OELA 4WR3A 3Q37A 2RFGA 2EHHA 4C7DA 3W72A 2WCAA 1H2JA 4Q32A 1QW8A 4DBUA 1KGXA 1IWPA 2OJPA 3LBCA 4NYYA 1XLMA 3W38A 1VFLA 4LBSA 2L5HA 2Q09A 4L6OA 3LTYA 1M01A 3SCWA 4C6QA 3VYLA 3ES7A 2A3HA 2OSWA 3VM5A 1B31A 2X40A 3VNKA 3PBVA 3DOPA 5HWMA 1VCFA 1IXPA 3GD6A 1XLJA 4NF7A 4DO4A 1XQKA 1RJQA 3BZJA 1XIBA 3DH7A 1D3CA 2DSZA 3ZT7A 3TA6A 4KESA 3GYEA 3WBWA 3QYSA 4DI9A 3S8HA 1CW2A 4YWIA 1ZZMA 5I24A 4DX3A 4US5D 4M6VA 2GZXA 2QCEA 5A94A 3S83A 4L9YA 3QY7A 4O15A 1UCWA 3F4NA 1ONXA 1T96A 1VFHA 2CZ5A 3AS1A 3GX9A 1WP6A 3WBXA 3R12A 3EDEA 1G7UA 3K5XA 2E8ZA 1IT0A 2PTYA 4A35A 4YTSA 3CK5A 4BFAA 2O9OA 1C7SA 3RM8A 2R8WA 1QWKA 4A2SA 2OLAA 1DJHA 4UCFA 3DERA 1UPMB 3IIVA 3SY1A 1F7BA 5BWFA 2FGLA 2B31A 3TROA 2XSXA 3AIRA 1DIOA 4AD1A 2Y85A 3ITXA 2YBUA 4GBUA 1XKJA 4LOCA 3UXIA 4EXBA 2GPTA 1A0CA 4WKFA 4QDMA 5H1WA 1LG1A 4AX6A 1GQKA 2FZMA 4MWAC 1LUCA 3AYRA 1ITXA 3N18A 2DSVA 4KQNA 3BL3A 4QNWA 1JCTA 2IPJA 3ABSA 2W62A 3REQB 1OSEA 2OPJA 4IIDA 4DQWA 1L6WA 2CXGA 4HCLA 2PDYA 4Q4OA 1JG9A 4ORIA 2VEGA 1EJXC 2V5DA 3VUSA 1PL9A 2H3DA 3DFYA 1OHLA 3E6EA 3N3TA 1XI3A 4YTRA 4KWUA 4MJZA 3LHWA 1SZGA 3AIUA 3KHJA 2ASHA 1AQMA 4DBEA 3IJIA 3B40A 1OZQA 1POKA 1FFRA 1AFSA 3TMLA 3TQPA 1JGIA 2J9ZA 1M53A 1O5RA 2VC6A 4A05A 4QHRA 1UZDA 3PBWA 4QE5A 4CNNA 3BLIA 2FHCA 4QLLA 3RCMA 3H2MA 2PDGA 5HK4A 3UGRA 5K4ZA 5LIYX 2QAFA 1HFBA 3C3NA 2C1HA 3WUEA 1TPH1 1PYFA 3G22A 5I00A 1E6QM 2FHBA 1JQVA 2VVNA 3MVTA 1TPFA 1GJUA 4MM1A 4DELA 1B57A 1QHPA 4U33A 1XBYA 3O9NA 1EDTA 2XN2A 3SN0A 2PDFA 2Y63A 3ANVA 3P61A 4FNRA 1PPIA 2PC8A 3TAKA 1UR9A 3T09A 4GKTA 5AB3A 1I6NA 3W1XA 5FSDC 3AU6A 2WANA 1TV2A 5JH1A 5EL1A 2PDXA 4TIMA 3C0SA 1RLDA 1QI3A 1SJBA 4W88A 2POZA 3BW3A 1PAMA 1VHNA 1JULA 3JS3A 3TONA 2DJXA 3SBFA 4K38A 3KEHA 4YVXA 4S23A 2WW5A 1F3WA 4H9YA 1TRDA 1TELA 3WQ5A 3NDYA 3N9SA 4B9ZA 4WDXA 3ARWA 1NP0A 2HVNA 1WKFA 1AH4A 3NR0A 4QIUA 3TIMA 2Y5JA 3PJTA 4TX6A 4REQA 3BO9A 2DH2A 3KVMA 3FGCA 1RY8A 1VEOA 3SCUA 1U33A 1LWIA 2DSUA 3U0HA 4O1FA 2NQ9A 2G41A 2CKRA 5K3VA 4PEEA 2X0YA 3CL6A 3DAQA 3GM8A 2XN0A 4U5IA 3GZAA 1ZFJA 1KCZA 3IK2A 5BXPA 3NQ2A 4KPLA 3TWBA 4F48A 6CGTA 3EOOA 2NT0A 2OG9A 3PNZA 1DYSA 2WWCA 3WJZA 3DEQA 1ZP4A 1EEPA 3KTXA 5SWUA 2WHMA 3UVIA 4UTIA 4Z2LA 1XYBA 1LT7A 4PFHA 3LMYA 4MB1A 2JIWA 1RPKA 3EAUA 1KA9F 1RQHA 3TOPA 5HULA 2MANA 3UWUA 1D2KA 4PRWA 1EPXA 1THFD 1L6FA 1B2YA 3HGOA 3QC3A 5DCDA 5FESA 4HB7A 1NP2A 1E4IA 3G2GA 3E0FA 2NWSA 4H9VA 7ENLA 2FJKA 4XKMA 4E6MA 2VC9A 3BGGA 3OU8A 3M41A 1JFHA 5CJMA 3EXTA 4EXQA 1XYMA 2V2HA 4H2CA 3E2SA 4FSAA 4IXXA 4R9OA 2G3FA 2QUNA 4MY8A 5FJUA 4NJKA 4B5VA 1EFZA 4F2BA 4A2RA 2E4TA 2Y8VA 4NAEB 1RCOB 3B8VA 3GTFA 3HIJA 4J3TA 4TU1A 4MVAA 3L4UA 3II1A 4RDVA 1YYAA 4O50A 2A3AA 4J3VA 1JF6A 5LIUX 2QF7A 1SM9A 4F2TA 2NLIA 3TR9A 3CMGA 1DJQA 1GYLA 5DXYA 3PPCA 2BY0A 3HTWA 1MI3A 1UC5A 3SRFA 1ECQA 2BVDA 2Z29A 2W63A 1H5YA 4US6A 3N17A 1W9BM 4AEOA 5T91A 1UB3A 1UR1A 2NVCA 2WPBA 3VX1A 2WZMA 2LLEA 1G01A 3RPTA 2H8XA 1PDYA 2PGFA 1SU5A 3BMWA 1I8JA 3W7LA 5FACA 1EKOA 3AI0A 4MHBA 2PMQA 2YKKA 1HJQA 3IJ6A 1Q8AA 3N2TA 4KRUA 2J8FA 4LV9A 1Z69A 2ZZ2A 2PLJA 3IAPA 5M2FX 3VZZA 1R46A 2CITA 1XLIA 3EX6A 3WZ0E 1KRMA 3WG6A 2J25A 1EC7A 1WX0A 1UH4A 3AISA 2O55A 1VC4A 3VD7A 2XZ7A 4FA3A 3GDRA 1S46A 1M7PA 1W17A 4CQ9A 2GGHA 1EWDA 4X22A 2NW0A 3WF1A 2W91A 3AMKA 2PLKA 4MWAA 1CXLA 4XZIA 1VFSA 5IFTA 2VHLA 3N9RA 1QW7A 3M5VA 2F8QA 2D2GA 4WSHA 3KTCA 4NX5A 1E9IA 3VNJA 2HSAA 2E1DA 3WK2A 3AROA 4PMXA 4PL2A 4IP5A 2QNEA 3NO5A 1DVJA 5E5CA 3GUGA 2E9LA 2Y7DA 1V3HA 3VO0A 4L1XA 1X6UA 2FB2A 3U7VA 3K4WA 1TE1A 5I77A 4PTWA 4LH8A 2ZICA 5ABFA 3V4BA 1UKPA 2ZIDA 3QYQA 3A22A 1VPXA 2Q3RA 2MUCA 2CLOA 2TPSA 3ABQA 1H0IA 3K46A 4AZBA 3R0UA 3WBAA 3IVTA 4A8RA 3L9CA 2BG5A 4IJBA 5CPNA 1CB7B 3A5FA 1SFLA 2ZXBA 3UJFA 5CAKA 3MCMA 3PG9A 4GH3A 2CU0A 1SJAA 2PU0A 3RX3A 2IKJA 4GA8A 4M3PA 3IIZA 3ISIX 5D37A 2OZTA 2VT0A 3GXFA 3W7DA 4ADSA 2QR6A 4LYPA 3SCPA 4Z2HA 2EPLX 4Z08A 3GG0A 3KVJA 1QHOA 4E38A 4D1JA 3MB9A 3UYCA 3GTXA 5EY5A 4H6KA 5CBBA 1W2PA 5LXEA 3UQNA 4PB5A 4G7FA 4YNGA 1TCDA 3SRHA 1NU5A 1RXOB 1UBSA 3BE7A 3TW7A 1XBXA 1TMHA 3MSRA 2HEJA 1CEOA 1WBJA 2OEMA 2JGYA 2W66A 3DFPA 4OT7A 1QOPA 2G3MA 3M07A 4W7WA 2W27A 1MDRA 1XLAA 2YBTA 1A53A 1FCQA 2VVSA 3GK0A 1TRIA 3P62A 3KWXA 3THQA 4A3UA 4B3ZA 2D3LA 4IL2A 3URAA 1WKYA 3WLOA 2PDNA 1GJWA 3B06A 3UNTA 2P88A 2OGYA 1X1NA 3UYIA 2B7NA 4BQ4A 4OHQA 4PTVA 3KUMA 4DJED 2YA2A 2EPKX 5E9XA 1NDWA 4S1FA 1TV8A 1P43A 2AMGA 3DHUA 3STPA 3EX3A 1KWKA 2CFFA 4MPQA 4JFVA 1B9BA 4B92A 1Q85A 1PKNA 4MTVA 2ACUA 2R9RA 2FZ8A 3Q58A 1RLCL 1WXJA 3H23A 2CBUA 3BW4A 1FX6A 1J01A 1EGZA 1JYNA 3FA3A 3ZIZA 1J4EA 2QT3A 2WMHA 4QLKA 1UKSA 2PDPA 2VYOA 3KWSA 4XZBA 3MHUA 1ADDA 3PFRA 4OWGA 3QKZA 2X2YA 2UV8G 6XIMA 3CGTA 3FA5A 4XIMA 4MSSA 1KM5A 1HGWA 4E0CA 5ABEA 3NAVA 1E72M 1FWRA 1KM4A 4J27A 2XVKA 1PTAA 3MJMA 2VI0A 4PCNA 1WOBA 1P1MA 4L5ZA 4EWJA 2BOFX 4X2RA 2ZBTA 2G96A 4G5DA 1B3WA 1FXQA 2WNWA 4PUKA 4RE3A 3JW7A 1WDPA 3WEMA 1XSJA 4QG9A 1C93A 4HMDA 1E6RA 2DZAA 2DP3A 2VEFA 2FDMA 3WH6A 4KEZA 3E9AA 1FWJC 4HPJA 3MKKA 3UJEA 2F61A 2GJXA 3IRDA 4Q6XA 2ZFAA 5BOEA 2AKZA 4RV3A 5TD4A 1PX3A 3R58A 5DY3A 3WNMA 2QCDB 4JCLA 1GW1A 3SCRA 2F7FA 3ZLFA 1QRQA 5C70A 4H9XA 7TIMA 3VDCA 1IGSA 3IRSA 3G1VA 3QN3A 3VIOA 2WKJA 3EKLA 1FHLA 1VEMA 5AZ0A 4FR6A 3RR4A 1K03A 2XVLA 2NV1A 3W1PA 3ARUA 1GTEA 4QROA 1OY0A 3PC0A 3V5CA 3BMXA 2OWCA 4J35A 2HQAA 2ZDRA 4LAOA 4DJFD 1R3YA 3T07A 3IV8A 4Y9OA 1FH9A 4X60A 3E0LA 4AHQA 3TSDA 1V8EA 4Q7IA 1W6TA 1KD0A 4B5UA 1D7FA 4MLJA 4AC1X 2PDMA 4QX4A 3LG3A 1A5OC 4FIQA 2QUMA 3TQ0A 3WQFA 1HNYA 1XCXA 1EJSC 5DMMA 3ZS4A 3ZWSA 4KIEA 1N8IA 3W7KA 4LALA 3W87A 4PEKA 5C9WA 2EEXA 1CBGA 3M43A 4JTHA 2Y8UA 5T26A 3O07A 2YL6A 3S6OA 1XG4A 3E38A 4NNBA 2G3IA 3QY6A 2XIIA 2Z00A 1LWHA 4TOQA 2YFOA 3C2RA 3CPRA 1JZ3A 2HBXA 3BLFA 3ALGA 3PUEA 1V02A 1JEZA 4XQ6A 4NILA 1EGVA 4JQ4A 3L4TA 1J0JA 4JHZA 3W27A 4G2DA 3W1MA 4WGXA 2ABAA 1ZL1A 4LT9A 1JD7A 2XH2A 3GAKA 2CC0A 2WMKA 3NDOA 4OOUA 4UWMA 3BSGA 4FO4A 5GVJA 2E40A 3BAWA 3LU2A 5A6LA 4ZR8A 2RDWA 3OA5A 5CZKA 3U4AA 5CBIA 2Z1XA 4MZ8A 3N34A 2GSEA 2WVVA 3MVIA 1WZMA 1A3XA 4Q8VA 5ABTA 2DH3A 1VJSA 1FWTA 4H41A 4XKYA 2CHNA 3P7YA 1RY0A 2ZX9A 3N1AA 1KCXA 1XD1A 3COTA 3AMLA 4LRSA 4R85A 2Z2UA 3MO7A 5G2IA 3V16A 4H7VA 1GQJA 2ATSA 3H2AA 1SW7A 2PWVA 4HYRA 1PIFA 3MT1A 1TTPA 3HV8A 4QITA 1N7KA 2PTXA 2XFRA 4N42A 5CGMA 1QPQA 1DWHM 4L1GA 1Q6LA 3P14A 1HZYA 1DE5A 4N9EA 5BYWA 3DKLA 3TTYA 3WUGA 1EC9A 3DI0A 4DBWA 3AXHA 3CIXA 5CC6A 4HZ7A 1XQLA 4IGNA 4E3VA 1P7TB 5CXPA 3ELFA 3QQ0A 3T0AA 2ZOXA 3DGBA 3W0KA 5AYXA 3G8RA 4GCXA 4GI9A 3U9IA 1DJNA 1Z42A 5A8MA 1XPGA 3LLDA 3M1ZA 1NWRA 3FLUA 2D23A 4DJDC 3EWBX 1O95A 3MUAA 3PPFA 4S3BA 3FAXA 3G1AA 5ECUA 1AL8A 2ZRVA 3UR2A 5FF2A 4H00A 2GJRA 2UY2A 4JTAA 3W1LA 3SCQA 2AQWA 2O0TA 2RDXA 4ZO6A 3A4JA 1R3VA 4JTQA 3N29A 1UP0A 2WLZA 3I6RA 2OX1A 4HHPA 4E2BA 1Z8AA 4UOZA 4Q4SA 1L9WA 1GOXA 3NUKA 4GD0A 3JUGA 3VKBA 1VFMA 3ZT5A 3PR2A 2YYTA 1P48A 3BG9A 5BZAA 1QBBA 5FJTA 1MEIA 1W5NA 3A3XA 1U83A 2D0FA 2WVTA 4MUZA 1X6NA 3JU2A 4F0HA 4PMYA 5AC7A 4XD4A 1H60A 5FL1A 4XUGA 4XX6A 4MJMA 1HT6A 1YBQB 5DRCA 1TPB1 3V0SA 3BGAA 3SIZA 1T7LA 4U2ZA 1YPFA 1V79A 2CZEA 1KKRA 2Y1HA 3NPXA 5D2XA 3UY7A 4YYFA 3CAWA 4UFIA 2C19A 4GK8A 3GDKA 3UG5A 1XCWA 1F3XA 4C1KA 2AAAA 5G2WA 1BTMA 5G5IA 4NIRA 5L6UA 3OYXA 4L9XA 3FSUA 3DZ1A 4KFNA 3C52A 1BKSA 4GKLA 4CVWA 3KOXA 1L6SA 3VDHA 1E0VA 1H7XA 2AMXA 4QM1A 2WM1A 2C8NA 4IL0A 1RH9A 4UIOA 1WUEA 2R94A 4GIRA 3VZYA 4HOWA 1WYIA 1JQXA 3M64A 1EUNA 2FTPA 4NG3A 1UUOA 1EJVC 3TYUA 3AHZA 1REQA 1XC6A 1JPKA 3VCNA 2TRSA 4LFYA 3AUJA 1F07A 4AD2A 4AC7C 1LM1A 4W86A 2OYMA 3SW6A 4Q8NA 3VDBA 2B81A 3MPGA 3UZWA 2WZEA 2CLFA 1QOQA 5EMMA 2ONEA 4GRSA 4RE0A 1AMYA 4WJ8A 3UR8A 4E2OA 4NVTA 1JNDA 4LGXA 5DN1A 1DQUA 3EA1A 2ZRUA 3WQ4A 5DEZA 3R10A 1J0YA 4LCSA 1UD8A 4UQ9A 3T4WA 4AQLA 1WDRA 4F66A 1EDGA 4HSNA 5C7HA 3VOHA 6A3HA 3KTSA 2HVMA 1B3VA 3HU7A 2V2DA 3W2JA 3TAOA 3NZGA 1WZLA 3A23A 3G6LA 2XWDA 4FLOA 1DIEA 1JL8A 5I07A 4UQBA 4Z0SA 1EJUC 1UQZA 3V36A 4AZCA 2FLIA 1DORA 2AQOA 2P8CA 4AZ6A 1OF6A 5CAHA 4PB4A 4FALA 1UR0A 3UZJA 3PZNA 3W7NA 4A6GA 2NX3A 3T08A 1EA0A 8A3HA 4IX2A 3LCXA 3PY2A 1OG0A 3B9OA 3RJYA 3M0VA 4GACA 3CJPA 4N9DA 4OKDA 4NNCA 4RNFA 3MDUA 4PULA 3C2VA 4WDUA 5CCZA 1H1ZA 1T40A 2XSAA 1WQ5A 1O94A 5D03A 5HATA 3VAVA 2DV0A 3G24A 3PJWA 3LERA 1IT7A 2V5KA 4DM1A 3WLKX 4Q4QA 4D2JA 1GZGA 3WLIA 5GJMA 5JIPA 4HD5A 1G4EA 3S47A 1X39A 1E55A 2J7FA 2PFHA 3UETA 3LPGA 3OVGA 4L80A 3ZWTA 5I6SA 3MC5A 3A4XA 1P0NA 3AS0A 3ZJ6A 2YXGA 1ZRQA 4JICA 5CSYA 4XAFA 1Y0EA 2ICSA 3PJXA 4P8VA 3A5VA 3K2GA 2WSQA 1O12A 1UZ4A 2XIMA 1YE4A 1A5MC 3V5FA 1H11A 4QE1A 5J5RA 1I2NA 3MDWA 5HINA 1VJZA 4E8GA 1AA1B 4LVGA 1QNOA 1RK5A 2E6AA 4DUVA 1I2OA 3SADA 1TJ2A 2FMNA 3SY5A 4ECLA 1HN1A 2G4FA 3AHXA 5G2HA 5C7VA 3PK7A 4F0RA 5KITA 1BTCA 1TKKA 1XLDA 1GVYA 4LPCA 5GNXA 3KRUA 2OT1A 3KHDA 4QCFA 2E3ZA 5LYRA 1TWSA 3FIGA 5CH9A 4X61A 3M5ZA 3AZSA 4RL3A 3AIVA 5LNUA 1RBOB 5E9AA 1U1JA 3S6TA 3QV8A 4OBRA 3NGFA 1A3WA 2WM0A 3CHDA 3TJ4A 3UXDA 4WY0A 4I9MA 1E9LA 1J5TA 2CLHA 4N4QA 3EEZA 3L68A 3LGEA 1NIUA 4A21A 2J4GA 1MW2A 4AF0A 3GVVA 3FV9A 4AMAA 1Q6RA 4CQBA 1W3KA 2J13A 3GNDA 2QCFA 1X38A 1N2VA 1H50A 4EPDC 3JRKA 1GOKA 1PO9A 3C6CA 4PCTA 3L4ZA 2V67A 4Y96A 3AU2A 3LV6A 1VFUA 1QJWA 4LRTA 4N7QA 3VTRA 4JHMA 2GK1A 3N2OA 4I7UA 4NZ5A 4LC6A 4K39A 3CTTA 2XIOA 4AW7A 2BODX 1KFBA 2AOSA 1M9HA 1CX9A 2WSYA 4PA8A 1F6PA 3BLDA 5DLCA 2J7HA 3PZIA 3PP7A 2CETA 1JCYA 1XICA 4ICCX 5FAGA 3KBWA 2OYKA 3HGRA 2XYLA 4UMCA 4YHEA 1XJBA 3VINA 1GOOA 1RCQA 1W9UA 4MYXA 1TCMA 5T9BG 3QR1A 2FFCA 1X6LA 5BROA 3AAMA 2NUYA 3H2OA 3BLOA 2C18A 4P61A 5JBDA 2BDQA 1W1TA 2EKGA 3CZEA 1TVPA 3S2LA 1YEYA 4KCWA 3W71A 5FF0A 3I4KA 2I56A 2CESA 4F0SA 4C6JA 5HPOA 3C2EA 4H7ZA 4DI8A 1XWYA 2QJJA 2BX7A 2VFDA 2NX1A 1S39A 2CWXA 1XIIA 1EA9C 2WJFA 5KSWA 3WJSA 1YKWA 1A47A 3I3EA 3OVRA 4C90A 1OGBA 1JAEA 3NURA 1E5JA 5BWAA 3EMQA 1RAKA 3GH4A 2VTFA 3RHGA 2VX5A 4IPPA 4PMNA 3NPWA 4BR1A 1ZGDA 3DU0A 4CU8A 5FJRA 3NL3A 2YGYA 5G1YA 5I7GA 1LTDA 4REQB 1BHGA 3FGCB 2UY4A 1Y65A 4PTNA 5AYYA 4TX8A 4JCMA 3PAJA 4ZB0A 3V0UA 4D6FA 3HQ1A 1V08A 5D33A 4UMBA 3LQGA 4L6HA 3P93A 3GR4A 5HMFA 2C3ZA 3C0QA 1UD2A 4EF9A 4CU7A 3J7HA 1PZ2A 1F6YA 2I9EA 3R8GA 5AVNA 3L0NA 2PWDA 4YTQA 1PKYA 4O8AA 3SN4A 3R13A 3GXMA 3OZOA 3HV9A 1OYCA 1V4YA 1YDVA 3MKCA 4WY0F 2FPYA 2GUYA 4AEFA 5BU9A 3WSUA 4ACYA 4O54A 2VGGA 2PPGA 3F4VA 2ACSA 3VGFA 5CEWA 5KZEA 1QNSA 1KBKA 2DUXA 3BLKA 2BV9A 1G4TA 2QJHA 2PA6A 3ES8A 3N2BA 2EPHA 1PTDA 1KO0A 3TN6A 3TTQA 2O7SA 4ALDA 3H7RA 1SUXA 3AIBA 1UWSA 1X98A 3HB9A 1OFDA 1Y5VA 2C1GA 1WAWA 3L0KA 2E68A 3CNYA 1WDSA 1FHVA 2QYGA 3AYSA 4PH6A 3W53A 4QEEA 2HNHA 1XHGA 1XDLA 1PKLA 5AC8A 4PL1A 4C1NA 3EA3A 3MMTA 4J3SA 4B4HA 1ICSA 2V2CA 1Y7VA 1K9FA 3QH2A 3TFCA 3MP3A 3PTQA 4R34A 1PXGA 3WDQA 1V3IA 2O4MA 1PWLA 4HNOA 1EOMA 2C13A 1UZHA 1T8XA 4X0VA 1EF2A 4FNSA 2W67A 1NDVA 2C0AA 5F2MA 4GI8A 4Z1DA 4AD0A 2WJDA 5DY2A 2D2JA 1AG1O 1XLKA 4K68A 3TN5A 2A79A 1QI2A 4HHMA 4PMOA 4C6KA 2WBKA 4GYPC 3W25A 1M7JA 3CPGA 3P82A 3UD6A 4HCHA 3ZM8A 3LSBA 1AMKA 4HJFA 3TKFA 3VNYA 4C7GA 1UJQA 4OUEA 1P1XA 4L56A 3W1NA 5CJNA 1FWFC 4EPKA 1VPQA 2XIBA 4YN5A 4FEZA 3M0ZA 3OP2A 3M0KA 3GU2A 3VU2A 4CD7A 3PBUA 3MZNA 3GDLA 4NU7A 4EP8C 2J79A 2FKPA 3OYZA 1E70M 1BEUA 4AG0A 4R88A 1LCOA 5FF7A 4S3KA 3G0UA 3OBEA 4GNKB 4LUTA 1OYAA 1TPUA 2G95A 3R1ZA 3F4DA 3CV1A 2BVYA 1G1YA 5HQEA 4JKMA 3QTGA 3QW3A 3BSMA 4OGZA 2X2GA 3WD4A 2R14A 3JZUA 4WXZA 2BWGA 4U5KA 2OB3A 1MNZA 3V1HA 3R8RA 3CZLA 2A6NA 3DC8A 3R11A 3IJ9A 1XX1A 2PWFA 4W93A 2Y70A 1KV5A 3GXNA 4GIYA 2D3NA 1MNSA 1KTNA 4JEJA 4XSMA 3WEOA 4DF1A 3OBKA 4MLRA 1E6SM 2A3BA 1ADOA 3FW6A 2RGLA 4QDWA 1JVNA 2VUYA 4YCOA 1RCXB 1GPWA 3BDKA 4M5PA 3VIJA 3HO8A 3ATYA 3CAVA 5HUPA 1CXIA 1VAHA 1MMFA 3WK1A 1U5JA 3L2IA 3S5ZA 3IAQA 1B90A 1OX4B 1V77A 1FTXA 2B0MA 1NELA 3BC9A 4IGHA 5ABFB 4CD4A 4AY8A 3SQMA 2Z1KA 3UXKA 5CG0A 1JR1A 3C2YA 5D2TA 1EOKA 3GBEA 5I23A 4RV8A 3LHUA 5HUOA 4DWSC 3NYDA 3SN1A 1TE6A 5AHIA 3GFZA 3U5UA 3PWIA 1MUMA 2PLMA 4YXGA 4NZFA 1UMLA 1BSLA 1I4NA 1OCBA 1F61A 3T40A 4LY8A 3WDIA 3P0WA 2QMKA 3BGJA 1ZJHA 4DJEC 1LWJA 1W9PA 3NL6A 4G6CA 3KVKA 4AIOA 3M7SA 3TR2A 4JTFA 1JZ4A 3FYPA 3TV8A 1P0KA 3VI2A 4HBKA 3HMJG 1D3HA 1O5QA 3SCNA 5JBEA 3I7QA 1I60A 1XF0A 1J0HA 1L2UA 4GZ7A 4PGLA 1IF2A 5AN7A 4DIAA 1ISWA 1CLVA 2HS8A 3BAJA 4DN1A 2J8TA 1VB9A 1XIEA 2X0HA 4JTRA 4PBFA 3EMZA 3ZLHA 3S5OA 1VLIA 1AK5A 1P5BA 3BAKA 3IJ7A 1J2WA 1V3JA 4FAMA 1B3OA 2X30A 3GYCA 1QCWA 1TQJA 4NZ1A 3DG6A 1LLWA 3S2MA 3STEA 1R6WA 4G1KA 3IUHA 3AJ7A 1M04A 1IQ8A 4L65A 4DO6A 3QLDA 4RJEA 4QXIA 2XUCA 2FH8A 3EEGA 1E1EA 4AVFA 3B9AA 4WUIA 1VP5A 4ZA0A 1KBBA 4LS1A 1SFJA 2V3GA 2XVPA 3H24A 5BNKA 3CO8A 1XBZA 1R9YA 1ICPA 3QJAA 4O1BA 1DXFA 1DWIM 2WK2A 3EXSA 2BHZA 4M6PA 5B7ZA 2UWFA 5HMSA 1POJA 4H9TA 3KRZA 4ZE5A 4NI8A 3RNDA 1WXZA 4KIRA 2OCZA 4ZOEA 4YVVA 4U2YA 1B3ZA 5LA0A 3AUOA 1FDJA 2GQAA 1R7AA 4NZ3A 5I3GA 1NOUA 1CGTA 2PGEA 1W3NA 2BHUA 2A21A 4JIQA 4MAVA 2ZVRA 1Q2RA 2CKSA 2QDHA 4UFJA 1DQXA 3ONBA 2ZUSA 1F76A 3V7PA 3CS2A 6TAAA 2QCGA 3L0GA 4HU4A 4BEQA 2EPMX 4Q7BA 4RPPA 2PUZA 3VIKA 4D72A 1OC5A 4GQRA 3EB2A 1QXLA 4D71A 3MCOA 1K70A 3QRHA 4NXKA 3AYVA 4IIBA 1J18A 4LUIA 2I14A 4IMDA 3W00A 4K1GA 3T8QA 5TIMA 2WBGA 1VENA 2PZ0A 3WH5A 1H7NA 3W1AA 2KX9A 4DLMA 2YDQA 3BLEA 2ZDSA 2FTWA 8XIMA 1V6UA 3FKRA 5JMUA 3KXQA 1E6ZA 3UY8A 4ZENA 4B3KA 4A3YA 1DBTA 5FOOA 1ALDA 1F2JA 3TJIA 1FH7A 2Y7GA 4AVOA 1EF3A 4HK5A 4S2CA 4I6KA 2BMBA 1ZAIA 3CEPA 5AKQA 1QOXA 2CZFA 3TU9A 1JDAA 3H6OA 1BGGA 4GZIA 1JIBA 4M6UA 4OTKA 3LHTA 1G5AA 3S2CA 2P50A 4RX0A 5AVHA 1Q6CA 2P0OA 3AIWA 1ONRA 2IQ0A 2JE8A 3L5LA 1EO5A 2EO7A 3E02A 2VEKA 1W1ZA 5DXXA 4L6DA 1GHSA 4R7WA 1Q6GA 1S3HA 3IARA 1U5VA 3AIEA 4GYPA 4UCGA 1LBLA 9XIMA 2YPIA 3O6DA 3ABZA 5LSMA 3FXGA 4C6EA 4WXYA 1EDQA 1XCFA 1GOIA 2C14A 3N4EA 2P5NA 3WK0A 1HQTA 4DEFA 4J3ZA 3C61A 4C6DA 3UWZA 2FVLA 5GJNA 2WNNA 1YMYA 3MY9A 1TWWA 4WEVX 3NL2A 2R24A 4PBEA 4AHOA 2AQVA 2CLIA 4D1IA 3LRMA 1E51A 3W7CA 4GC4A 3P3BA 2QV5A 4S3DA 1JYWA 2OR2A 3MP5A 4FHAA 2XINA 1K9TA 4GLEA 4NJIA 2CNCA 4W89A 5LXXA 3G1YA 1R9ZA 4D9PA 3WL1A 4D6CA 1JRCA 1OB0A 2O9PA 1EP2A 4AX7A 4GJJA 1PS9A 1E1CA 5TBOA 2GQ3A 3E3HA 1UWAA 2WMFA 4TV5A 1VKFA 5D2YA 3CV7A 3NDZA 3VFCA 1CLKA 3RIKA 5F1VA 3AMDA 4W8AA 4XO7A 4H1ZA 1TIWA 4GYFA 1XGEA 2A1YA 3EWWA 2QJIA 3A12A 1F5ZA 1JYVA 3LV5A 3MTWA 1CGXA 2WVVB 3NZPA 3CAKA 2HV5A 4XKYB 1V6VA 4EOUA 2H90A 5EPDA 5DCBA 1Z3NA 2VXNA 5CPMA 4ES4A 3TZNA 5IRPA 1OBAA 4ZEPA 1PB0A 3TYEA 5IHRA 4UOJA 1UA3A 2F2KA 3EDFA 1NFGA 3T0CA 3ARYA 4ATWA 4HZ8A 1H7OA 4WVXA 1I9CB 4GY0A 2HE5A 3EB4A 3W1UA 2E5BA 4K2SA 3DIPA 3OHIA 3ITOA 3W2MA 4BF5A 4K8HA 1KCKA 1QO5A 5DT7A 3NZ1A 1K02A 3SSZA 3ITYA 3K1DA 2YCKX 4HYWA 4GFIA 3QBUA 4MYAA 1FP8A 1WDWA 1PBGA 3IPWA 3VNMA 1UR3M 4UTFA 1MUWA 3OLGA 3WQWA 1LG2A 4DJEA 1TTJA 1SZFA 2X1IA 3GR8A 5I3IA 2VKZG 3BQ6A 5PTDA 5DBUA 2CXEA 3LLXA 1DKWA 2G97A 4LQ1A 7PTDA 3RDKA 1TR9A 1UWUA 1WBHA 4HN4A 4TV6A 1S2WA 2PDQA 3PZUA 3W7QA 1PCWA 1WA3A 3AMCA 1DJGA 5DX7A 1B4KA 3LGDA 4MJ4A 1ZU8A 2Q8ZA 3WNNA 2CLMA 2HDJA 3FAWA 3ZQ9A 3IWPA 2QCDA 2V5LA 1HIZA 2D24A 2FZ9A 3WENA 2VZUA 4CCZA 3H70A 3EYPA 4IXHA 4O0QA 1QPRA 3N4AA 3CYVA 1KGWA 2Q3OA 4NL1A 2WSKA 3O6YX 4H8NA 1K7EA 2JFEX 1W3TA 1Z6KA 1XLEA 2VCCA 4ZFMA 3RR1A 1D7KA 1A80A 1UR8A 1W1VA 1PIGA 1M68A 1K8YA 4JIIX 4JR5A 4GZEA 3MMDA 1S5NA 3W26A 4H19A 5D30A 2VOMA 5HBFA 1XLHA 3NL5A 1XUUA 4B91A 5AZ1A 1Z48A 4TVCA 3SEPA 2XFFA 5U7SA 3A21A 2NV2A 4WF7A 3N3MA 4XZNX 3UCCA 3NVTA 5EMUA 4OU1A 4O4VA 2DVXA 1GZJA 1MW1A 2OZ8A 2ZKMX 3BCDA 4KGLA 1XGZA 4H3DA 3W24A 1HL2A 4MZYA 1GHRA 4J3UA 5ECVA 4NX0A 1MZHA 1R2TA 3IACA 1JJKA 3THCA 4PSPA 3NA8A 1UJPA 1CTNA 4WKHA 1E73M 1FCVA 3AHTA 2J47A 6ALDA 5FF4A 2WC4A 1REQB 1GVRA 3DFSA 3ID7A 3P74A 4UTKA 1HL8A 4WJXA 3GHTA 2PC4A 2ZUUA 4GFSA 1L8PA 3A3WA 3UA3A 4Q4MA 1QDSA 1QVBA 3GNXA 1W5OA 3CU2A 4M56A 3W2LA 4MY9A 2BXYA 5BMXA 5LNWA 4PE8A 1EXBA 3E5BA 4FIRA 4FP1A 4CQDA 5XINA 2WQDA 4X9YA 1LORA 3AXMA 2FPTA 4UC5A 2POTA 2DSWA 2DUZA 4W7UA 1P4CA 1BWVA 3K4AA 4ZOBA 3N14A 5CPSA 2QXWA 1MYRA 1BYBA 5G4HC 2C6QA 1YRRA 2VD8A 4TVUA 3PZGA 2GQ9A 4KCVA 5M03A 2VFHA 1DEDA 4POCA 1E56A 3W7RA 4QAWA 2HPMA 4K37A 5K9DA 3C8FA 1IXOA 2BZNA 4DYKA 2D1ZA 2DVUA 4I90A 2ZE3A 4UR8A 4IQEA 4LV4A 3D46A 2WMJA 2HPIA 1Q7QA 1M7XA 4MGGA 1KGUA 3SSJA 1DL3A 1XXXA 3DFHA 2VX4A 1TV7A 1GYMA 2VFEA 2OXNA 4PUJA 3RILA 3TWAA 3UJ2A 3UXAA 2PP3A 3KE0A 3S4TA 4E4FA 3QPEA 4JXCA 3H26A 4QGCA 1MXDA 2ZQ0A 1AODA 2VQTA 3LM7A 3MHFA 4A8IA 4Z1YA 1K6AA 3EPNA 3P6LA 2E1WA 1IHIA 3T8LA 4UFMA 2V3EA 1XINA 3I3DA 3WELA 3ANUA 1ITCA 1XRTA 4URIA 3F4WA 1UWTA 4LCQA 3U8GA 4IP4A 2EXOA 2OWXA 1HF6A 2NZLA 2VL4A 2J6XA 1FFQA 2ISSA 3HGJA 2EF9A 3WD0A 1B54A 2A4AA 4XAGA 4HIBA 4LF1A 1LQAA 4ZQOA 3Q94A 1GVQA 1OIMA 3RX4A 4TMCA 2W92A 1AD1A 3EMCA 1FUYA 1Q6FA 1YIXA 4OIFA 3WDPP 4AYSA 3H4GA 2HBVA 3MSYA 4ERGA 2CPUA 1OT2A 3CM4A 4QBXA 3RU6A 3KS6A 4QE4A 4KWVA 3ALFA 4O13A 3QW4B 4GX8A 2VMFA 3TYZA 2DZPA 2V5BA 1LLOA 1NJJA 5CSRA 2EPOA 1QPKA 1B5TA 1IYXA 2V81A 2I57A 3EOSA 2PDKA 4P7RA 1QO2A 1VFTA 3TYBA 5CQ1A 2GGGA 2Z6JA 2DT0A 4IMGA 4WDTA 1HP5A 4DJDD 3RCYA 3GDTA 4J5NA 4OBSA 4UB9A 5A6MA 4HA1A 4WY0B 3LCLA 3AJXA 4V2XA 2AL2A 1VF8A 4W5ZA 4ML9A 3KZPA 2UBPC 1E43A 2VRQA 3OB8A 4I6VA 3GW3A 4AF0B 2E7FA 3WBYA 2WOQA 4Q8WA 1RVGA 3S5YA 3VMNA 3LNMA 3FVDA 1Q4NX 1W37A 1N8FA 1QTWA 3EX1A 3H2FA 4R27A 4DUWA 4V15A 1E4LA 1UWRA 3R8HA 4HYVA 1TIMA 5CC3A 3WBEA 3N2XA 4BQ3A 3E2RA 2PAJA 1XYZA 4RZBA 5MKGA 4QSFA 4XAZA 1F73A 5L9FA 4EIVA 2Z7GA 2VC5A 1XFCA 3DBPA 4N4PA 3QR0A 1YPIA 2Z1WA 3NYZA 1FWNA 3T1GA 4Y6GA 1S2AA 1F3TA 1OADA 1X7FA 2QJMA 3CIWA 3QPYA 2VZOA 1LT8A 3G0XA 1XH1A 3ARPA 4KEUA 3TN4A 5D9MA 3CZJA 5DMYA 2O9RA 1XDJA 2AL1A 3T4CA 2GUBA 3OPSA 1A0EA 1NWTA 1OFEA 2E9BA 2BVTA 2FQIA 1US2A 1E3ZA 3BJTA 1FWHC 2ZA2A 3WNOA 1UD5A 1OFPA 4P5UA 4CNPA 3N2CA 4ZCWA 3UG8A 4HCDA 2OT0A 3DENA 3HZ3A 1TWIA 4Z1AA 3CIVA 4RDWA 3HFTA 2ZTKA 2E09A 3ORWA 3CYJA 3GG8A 3M6YA 5HJXA 1K8XA 3BWWA 4ERIA 7ODCA 3P8IA 4H83A 3W07A 3ZO9A 3H22A 2GGJA 4QDPA 1W9DM 1MVYA 1XKYA 3LK6A 1A3HA 3ZXWA 1CXHA 3TCSA 3RF9A 3PTDA 3OHMB 2QMJA 4L4PA 4JTGA 1OD0A 2FYMA 2QGHA 1FKWA 4MDOA 5I09A 4WDWA 5CLWA 1KFWA 3WLNA 1RHCA 4HMCA 2VX7A 4DO7A 1KXHA 3OBAA 1A5UA 4IFKA 3N15A 2PP1A 5HOSA 1ME9A 1S2TA 1W0MA 2A3EA 4FOUA 5D8WA 5LHEA 3EDDA 3E5PA 4LCRA 3DFQA 1GVOA 3OQEA 1ECEA 1G69A 1WNOA 5FD0A 5K7JA 5JH2A 3OGSA 3I10A 2ZZ4A 1UIOA 2HK0A 5HNRA 2AKMA 2PEVA 1WKEA 3FCPA 2WSRA 2GL5A 1NDYA 4JN6A 4C6MA 4XWUA 4KEMA 2QPSA 2Q02A 4LNCA 1KM6A 4MWAE 3BCJA 1TV4A 2GVJA 3ABXA 5C2CA 1VYPX 4HZMA 2IW0A 4CEUC 4B5SA 3RYSA 3PWGA 4UMAA 1T41A 4MNLA 4NAFA 4A3QA 3ARQA 1MXGA 4PTMA 4NJGA 3PBYA 4RDYA 4FR1A 3VILA 3W01A 4HNNA 1BFNA 5E70A 1V5XA 5A6AA 3RM9A 3PM6A 2ZZ3A 4IHCA 1ZNNA 2W4XA 3GHSA 3SIMA 4AY1A 3MO4A 3OZYA 3HA1A 4I8DA 4I5XA 4U31A 4O8RA 4LBUA 4AUBA 4BF9A 1TSIA 4QISA 3HBLA 1JD9A 1BYCA 3UERA 2VOTA 5DELA 4C1NB 1JZ7A 4AZHA 3BK0A 4JNMA 2YL8A 3O8AA 1F4HA 4U10A 3C2OA 2EKCA 4J2PA 4KFOA 1RV8A 3H4WA 5CKSA 1MWOA 1E3XA 4YPJA 4D8LA 5BW6A 3GFXA 3USBA 3H4XA 4B5TA 2XH7A 3KOYA 4MG4A 4N6FA 2XH4A 1VYRA 1TV5A 3TZFA 1V6WA 3LHYA 2V63A 1OT1A 5LHFA 3T55A 1V0NA 4TTUA 1I75A 4M82A 1PCKA 1F74A 1CI1A 2BASA 3ARRA 3ZMRA 5KTLA 3APGA 3N13A 3Q2DA 1KQZA 1OK6A 4Z17A 2DW7A 2QUUA 1TREA 7REQA 5AHEA 3NPVA 5A6SA 1A49A 1F6KA 1JUEA 2FVMA 3DHPA 1M41A 1Z44A 2NUXA 3SCTA 4PFMA 5CZSA 1HJVA 3M7WA 2J7CA 5DFAA 3BAXA 4KBXA 5C0QA 1VIZA 1W1IE 5D32A 3VVGA 3SR7A 4EKJA 3OVPA 3QFEA 4LUTB 1QMLA 2QCLA 3QLLA 1IZKA 3CUFA 5I02A 1CZ1A 1S1RA 1OM0A 4GUFA 4HHLA 3AWNA 1WZAA 1J0KA 3E49A 4RDZA 3M0MA 3DKJA 4RR4A 4PBGA 4UBPC 4FF7A 2YCJA 1AD4A 3OG2A 2QV4A 4OECA 4IMCA 3W70A 1W32A 3E0VA 3O0FA 2JALA 3AS3A 3CUIA 4ZSUA 4F40A 3R6IA 3VOFA 4I3GA 1JPMA 3S9IA 4FXFA 1ZALA 1TJ0A 1LQ0A 3IUIA 4R33A 2NQJA 3V1PA 3TJLA 1XIMA 3B4YA 1W5MA 1C8VA 2HWGA 2NXHA 3C2FA 2GDQA 4KFPA 2ZUVA 4CD8A 3BG3A 7TAAA 5RUBA 1X96A 3NQ8A 1FA2A 5M5DA 4EWND 5C55A 2XFWA 2QGYA 2ISDA 3W6MA 4MPKA 3IK4A 5BRBA 4Q22A 1EO7A 4ZODA 3RPMA 2NXGA 3D0CA 1YLVA 4PN2A 2QZRA 3OO2A 3THAA 2WKGA 5J5DA 5I2UA 4M7SA 4UUIA 1DP0A 1ML1A 1GQNA 3SECA 2WZHA 2V3DA 4P7NA 3UJRA 4NZ4A 1W2VA 3LTSA 4IQDA 1JDEA 2TAAA 3MYOA 2OO6A 3QZEA 3ZLGA 4WZHA 1CGYA 2BY1A 4DAFA 1SGJA 1XIGA 2PBGA 2Z25A 3LZ3A 4IMAA 2F6KA 4E5TA 1XYLA 1TMQA 3UZ5A 1BVNP 2P76A 1UWIA 3MI2A 3GU9A 2YJQA 4LX4A 4YWSA 3GIPA 2P3ZA 1NSJA 5LIXX 1L8NA 2H3BA 1FWWA 1EXPA 4IUOA 4A29A 4O1AA 3MUXA 5REQB 1GG1A 3H55A 4LEFA 3S5NA 3QV7A 5CZ0A 4D8ZA 2VDIA 1ZJAA 3BQ5A 2YCLA 2YA1A 2KZHA 3LRLA 1NWUA 3WQVA 2VFFA 4MB3A 1RQEA 2GYIA 3NPUA 5H91A 3O0KA 4DM2A 3EA2A 1DXEA 3NO1A 4NHVA 1UUMA 1GKRA 3RXZA 4UFKA 3NQ6A 2NVAA 3N6HA 2FJUB 1UC4A 2ABBA 4N9BA 2IXUA 2CBIA 2J74A 3RGTA 1DJYA 1I2PA 4JTDA 3VE7A 1UP3A 3MJYA 1C7TA 1SW3A 4NY2A 1H1NA 4LC8A 2ZXQA 2ZX7A 3H2CA 3DG3A 1Q3NA 1R86A 3CH0A 4KETA 3ZOAA 4Z42C 4M1RA 1XL9A 1YNQA 5I3JA 1XYCA 2NSOA 5I5RA 3SJNA 4XVDA 3S5SA 2C79A 1LF1A 1V93A 4EE9A 3V75A 1SO5A 1WE5A 4JFTA 1J11A 3SUWA 2DU2A 4YU1A 5HAOA 1T0OA 1AW1A 2E5DA 2IS7A 3CH9A 3LA4A 4L61A 2WJEA 3SCOA 1IZCA 2H9AA 2Z7KA 2Y88A 1ISZA 2VRJA 2VURA 4HU3A 5J8LA 4Y8EA 3OGRA 3KOWA 2J66A 4J3XA 4CQCA 1KNWA 1NOWA 3SGZA 4AD5A 2ACQA 4F8XA 4JIPA 3BG5A 1J5SA 3QGVA 5EA9A 3L23A 4IUGA 2O4QA 3F2DA 3WJXA 2F38A 1BYDA 2R91A 5M1TA 3W1QA 1EZ2A 1K9DA 2V8ZA 4ZOCA 2I17A 1XS2A 1JZ6A 4BY3A 4W8LA 3PUGA 2GFTA 3CO4A 1AJ0A 3ERPA 3DGRA 4ZB2A 1OCNA 3E12A 4H6EA 3EXRA 5C6MA 3B0UX 2BOEX 2GSJA 3UZZA 4JYEA 1HL9A 2NQLA 1AW2A 1ZB5A 2DUAA 4D6JA 2VEIA 4M6QA 4M81A 4RXFA 1XRFA 3CASA 3I4EA 5FIPA 3LHZA 3PTKA 4Z2JA 2VEMA 4NKCA 5LNRA 3MP4A 4YTUA 3CT2A 4KRZA 3CQJA 3LEPA 5JUVA 4B5WA 2O56A 4NSBA 1OX4A 4A4AA 4ILSA 2BGNE 2ALDA 1F9CA 1XP3A 4O57A 1I0DA 4V27A 2D0GA 1EYWA 3QY8A 2XIQA 1P6CA 3E96A 3WJYA 3NQFA 3A9IA 2B7QA 2JEPA 4E8DA 2J7EA 2DT1A 4JTLA 4LAUA 2ON3A 1BSIA 2W61A 2VDHA 2A7PA 3B04A 3CQHA 4JFUA 3TLQA 1B0IA 1ZJIA 2P53A 4DYJA 1BXCA 2PWGA 4GE8A 1XD0A 2UY3A 3CLWA 3AQUA 2A7NA 4B16A 5JBFA 2VCBA 4DUOA 4QSHA 2EJAA 5BXSA 3LZ5A 4GVFA 4CGTA 3AXKA 7A3HA 4CD6A 1GJPA 3A3HA 1Q8JA 5LNSA 1L6GA 1K8CA 3MA8A 1F8IA 4MFEA 2HMCA 1OFOA 5CPOA 1XPYA 2DT3A 1E1CB 3T44A 3ITLA 4FB7A 3MUIA 3L21A 3QMRA 4KRTA 4O4WA 3GC2A 3UWEA 4GUHA 1XIHA 3CEUA 1SO3A 6TIMA 1TB3A 3CMJA 3GNRA 4DWSD 3F5KA 1PX8A 5LKYA 3MCNA 4IGMA 3IGSA 1MRQA 1XIDA 3GVRA 1KFCA 4RNHA 1FWSA 3B8UA 2Y8KA 2O92A 2E6DA 1TG7A 1I45A 1RBLA 3LX9A 2DZVA 3FJLA 3KLLA 4GVIA 3CV6A 5EB8A 1QUMA 3RMJA 3TTOA 5BXRA 4NRRA 2HNEA 3N2MA 2CEQA 1H3GA 3D3AA 3O1NA 1BGAA 2Q71A 1C8QA 4LTSA 2Z1BA 3LGGA 3MANA 3I7SA 3KZSA 2WHLA 5I3FA 5HNUA 2IPWA 2RDTA 2FFIA 2J9XA 5BRPA 2YX0A 4OUIA 3ATZA 4NP7A 1GPFA 1DPMA 1TWZA 1S3TC 3FJNA 3QKEA 5AYBA 3B03A 4DWSB 4UQDA 3KS5A 1HVXA 3FSTA 4ZTYA 1UBPC 2I7GA 3PPGA 5J04A 3QFWA 1ZHAA 1LYXA 5F2IA 1SR0A 1IEQA 1KM2A 1Z7AA 3ABOA 4AVNA 4HNUA 5HQLA 3BCFA 3LBOA 3PZTA 5KZ6A 3AZTA 4JKKA 1FVPA 1VCGA 1OFRA 3L4YA 1W8SA 2DQXA 1BF6A 1JCXA 5A69A 1MEHA 3VMPA 1HUVA 1ZAHA 3HPZA 3FFSA 3O6CA 4GPNA 3UCDA 1BAGA 5D9PA 1K3UA 3SUVA 1JRBA 3FYYA 1AQ0A 4FLQA 3CUXA 3USZA 4HU8A 2CZVA 1PZ0A 1VS1A 1ZJBA 3HG3A 5A8QA 3QTPA 2OKOA 4TR9A 4C6LA 1Q5MA 3GVGA 2PLCA 4C6BA 3IJ8A 4TMBA 3RJXA 4LUJA 1U2YA 4FXRA 3CT7A 2X16A 1Z32X 3SGGA 4CUCA 2WCGA 4GQBA 3SZ8A 1R3RA 4GCAA 2QUTA 4FOJA 5AHNA 1WXYA 1OGSA 4FX7A 4QAIA 2C7FA 2W3ZA 1E0TA 2A3LA 3ITTA 3FJ6A 4J4KA 4WCJA 4EPBC 1JI1A 4UQAA 4C91A 3BJFA 3P60A 5JIWA 2PRMA 4IMFA 1SR9A 3T7VA 2OOFA 1DE6A 4J3WA 4S3JA 4KWOA 2GQ8A 1VRDA 5I03A 4H9UA 4GNJA 2UZ9A 3VIPA 3WFLA 1HJUA 3HG4A 1JI2A 4O18A 1BKHA 4NNAA 3G1XA 1A4LA 1CGWA 5TQLA 2VWTA 4MAZA 3CZGA 1XRSA 4M51A 3NQ7A 4Q7NA 8XIAA 1KLZA 2ISWA 2J88A 4MY1A 1IEWA 1UOZA 4F4RA 2F9RA 1UD3A 3HPAA 4WOQA 3W1RA 3M16A 3W7MA 3M5YA 5C9ZA 4Y7EA 1ONWA 2AGKA 4JX6A 3VIHA 9XIAA 4ZMGA 4AMCA 4HT3A 1VYSX 3MMUA 3K13A 3DBNA 1MDLA 3VNDA 5FL0A 4C65A 3AXXA 4D8AA 1PHWA 4ZB5A 2HXUA 3GSMA 1EBGA 1NOFA 4YLWA 3SRDA 3VC6A 2OZ0A 1SSDA 3WF3A 4KH2A 4Z2GA 3BXWA 1M7OA 1ZY9A 3P5ZA 1ZBWA 3HMCA 3WD2A 3NXLA 3GHRA 2C0HA 1UKQA 1TZ9A 3ONCA 4H4IA 2QULA 1W1A1 4JDYA 3TQKA 3DC0A 5D38A 3GVQA 2ZRWA 5CPQA 1XYAA 3DFTA 5F2GA 1JGMA 2VRKA 4Q8UA 1E9ZB 3CC1A 3EWZA 4LUSB 4P7QA 3M9YA 1UHVA 3W2UA 3C0JA 3WD1A 1O66A 3PZMA 3I7RA 3R89A 4O10A 2OLHA 2WXDM 4AB4A 5IDZA 2JF7A 4AHPA 3DYOA 3PZQA 5HDRA 4G56A 5F1UA 2OQYA 4GC3A 3O3RA 1HKMA 2PDJA 4IH3A 3W9ZA 3W22A 4IFRA 3DHDA 3SCSA 4M29A 4Y9AA 2PDLA 1OGGA 1IXQA 4QS5A 1RP9A 1X1OA 3LN3A 3KVLA 2V5JA 2QQ6A 2PCEA 2WZIA 2OU4A 1K4HA 2GVYA 2Z6IA 1HP4A 3MS8A 2ZWZA 5EMJA 3VD4A 2INZA 3N11A 4GO8A 2C15A 5HXMA 3BOFA 1ZCOA 4RE2A 1EUAA 3OOQA 4KW2A 5CG7A 4A22A 2PF8A 2X7VA 1UA7A 1EQPA 3LCWA 2R1MA 3EWCA 4XZ9A 2F6UA 5EMYA 1IIGA 3ZSTA 2D2OA 2E6FA 4HK7A 3W3OA 4CNSA 1YTDA 5D09A 2Y4SA 4V1XA 3W02A 4S3EA 3L4XA 4CCEA 1ONEA 3NWRA 3K1GA 2DJLA 1PZ1A 3IIPA 2DIKA 2HS6A 2PURA 1ZTVA 3E2VA 1U1UA 3PN8A 1L0PA 3HJEA 4B2DA 1A0DA 4JTSA 3MSDA 2E8YA 4JY9A 3B8IA 3BICA 1V0KA 3B9EA 3DG7A 3MQTA 3VXGA 4CNUA 3KBMA 3KP1A 1A5SA 4UTJA 2AAMA 1TX0A 3NEHA 1QU4A 3ECQA 5BRQA 5CPLA 2W0UA 3HG5A 2CWNA 2DIEA 4GHRA 4C1LA 5H6HA 3MBDA 1WZKA 2GJNA 4JL1A 3OZMA 2Y2WA 4HPGA 3UPWA 1RBAA 4ENLA 4PUMA 3GFYA 2XPKA 3NQBA 2J24A 1Q7MA 4O0KA 4LYKA 1X8CA 3AXIA 2YBVA 3TYAA 2ESCA 4LANA 2VX6A 2REQB 1O7AA 3KDNA 1G9HA 1QAPA 2G5WA 4ZXOA 3WMSA 3G8EA 4F3HA 2WHKA 3JR2A 1WPCA 2AL2B 2PSNA 4FXSA 1MQQA 3U48A 4RZ6A 2Z28A 1SSGA 2YDRA 4E2VA 3V0TA 2ZWYA 3KAOA 1S5TA 2OO0A 3SGUA 2FTYA 4S3CA 2IKIA 3KL0A 3UJSA 1W1B1 2G50A 2Z26A 1YDYA 4ZQCA 3HM7A 1UD4A 3A9BA 5I78A 3NNTA 3RUBL 1D8WA 5D8ZA 3WNPA 2HVOA 4DPQA 1EWEA 4XAPA 5HJLA 3D5HA 3PFMA 3FOKA 1H7WA 5A2AA 1SYTA 2YCEA 4MFDA 4ZSTA 3VOCA 2BLEA 2BP1A 4IOTA 4YCPA 5MKGB 4A3RA 4I9TA 3UZXA 1OC7A 3HF3A 1SFTA 3GW0A 4ZE4A 1KFKA 5IHSA 1HX0A 1W3HA 1OIFA 4O14A 4Y9NA 3GG7A 4DLFA 1Q6DA 1UZ1A 4L4OA 5HWJA 1E6NA 3RK8A 4K8GA 1V0MA 1E0XA 1C90A 3PZVA 4ZO8A 2WLYA 2VNCA 1H0GA 4JTJA 2E77A 1VFFA 1Z41A 1OX5A 2V5CA 4U3AA 1WCGA 3NM1A 2VUNA 4ZBCA 4LJ3A 3ZFHA 4F9JA 3EWDA 3BH4A 4JIEA 4LXFA 3VCRA 1XBVA 2HROA 3UEQA 3UZYA 3L5AA 3NOEA 1X97A 3WEZA 1NFBA 4ZO9A 3LQLA 1S38A 2C16A 3C3UA 4I7WA 4DNHA 4DYEA 3GBDA 4FF5A 4E4UA 1MRAA 1BQGA 1XFBA 4EAMA 4Y9PA 1R87A 1R5YA 2RGMA 2BY3A 2X0SA 2WMIB 4W87A 3S2JA 3OZPA 3O16A 5FA5A 1EL3A 1FH8A 4EX4A 3GLCA 1UW9A 3LRKA 1NARA 3QXBA 2B4GA 2CIPA 4NXSA 1AL7A 1OD8A 4LVBA 1LOLA 4OE7A 4CNOA 4YMZA 2QPXA 3W7IA 3DN5A 3F2BA 2J6VA 4XG1A 4JTCA 3M0XA 2P1FA 3O06A 2FZBA 3W74A 4LF2A 4IFKB 3VCCA 4F9DA 4EK7A 3O05A 4QRNA 1A5NC 2D20A 4NI3A 1YXCA 1E4NA 3AC0A 3QHMA 3GC5A 5K9XA 4GNVA 1F8MA 2YSWA 3HN3A 3N9KA 3HQNA 3L2MA 2G0WA 4ZVJA 1UKTA 1XV8A 3N19B 3GH5A 2OWWA 1I2QA 4AU0A 4RCXA 1I0BA 1ZBVA 5C8BB 3U2CA 1BRLA 2CBJA 2VR2A 1GG0A 5BOOA 5TNVA 5HQMA 2INFA 3CQ0A 1A5BA 4HN8A 3WD3A 3BANA 3WKZA 2WSPA 1B3YA 4Q3MA 3W7GA 3XINA 3MHGA 4NAFB 4GH1A 2E5CA 1KBIA 5AC4A 1YXYA 4GZJA 3T6CA 3W6LA 3STFA 1JFXA 2WQPA 5E6ZA 3ZYZA 3CUZA 4MKVA 1US0A 3VKDA 4JTIA 3WLMA 1S2CA 2J77A 1BWKA 1K9EA 3PZOA 2YA0A 1TUXA 2Z0IA 5E93A 5E09A 1FCBA 2WVSA 1W91A 4GYJA 3T9PA 4TQTA 1Y5XA 2J75A 1ADSA 1XUZA 3CHFA 4MOZA 4HNCA 3CMFA 2QPUA 2ZX8A 1GQIA 3AALA