3LDVA

1.77 angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase from vibrio cholerae o1 biovar eltor str. n16961
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
231
structure length
231
Chain Sequence
AMNDPKVIVALDYDNLADALAFVDKIDPSTCRLKVGKEMFTLFGPDFVRELHKRGFSVFLDLKFHDIPNTCSKAVKAAAELGVWMVNVHASGGERMMAASREILEPYGKERPLLIGVTVLTSMESADLQGIGILSAPQDHVLRLATLTKNAGLDGVVCSAQEASLLKQHLGREFKLVTPGIRPAGSEQGDQRRIMTPAQAIASGSDYLVIGRPITQAAHPEVVLEEINSSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title 1.77 Angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase from Vibrio cholerae O1 biovar eltor str. N16961
rcsb
source organism Vibrio cholerae o1 biovar el tor
total genus 78
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ldvA00
4MUZA 4K7VA 2ZCGA 3FKRA 1QOQA 2ZRZA 3DZ1A 3GR7A 4LVAA 3QC3A 3W9ZA 1GTEA 3DFQA 4AWSA 4UR8A 1VGAA 2DJLA 3HG5A 5CSSA 1WV2A 3A21A 4GUIA 5DCDA 3L66A 1SR9A 4JTEA 2Y7FA 2RFGA 2CLIA 4FX7A 3RMJA 4AH7A 1GVRA 3TSBA 4WXYA 3OVPA 3P80A 2RDTA 1GVSA 4TO8A 4NT0A 1I4NA 4Y96A 2ZQ0A 5KINA 3WK2A 3MJYA 1FX6A 3IRDA 4O4VA 2P0OA 4LVFA 3P81A 1QPRA 2JKAA 1HFBA 1GTHA 5D03A 1SSDA 3IEBA 1EWEA 1ZFJA 1JR1A 3TW7A 4JTTA 1Z41A 3W2NA 1HUVA 4DELA 3PULA 2D73A 4MFDA 3ZWTA 3T7VA 1JQVA 1ME7A 3G1VA 3S1WA 1VCFA 1KBIA 1OJXA 1SZGA 3ZR4A 1GVQA 3FA5A 4KFPA 3B06A 3L21A 2GVGA 1IXOA 5LHFA 2FLIA 2GJNA 4MY1A 3LCGA 4JDYA 2FPTA 2P1FA 4HHPA 3T40A 1OF8A 4IPIA 1O5XA 5K9XA 4FXRA 5EL1A 1SW0A 3EB2A 4ZQOA 3ANYA 1KFBA 2E6DA 4MLRA 3CQ0A 4EOUA 1SW3A 4DPPA 3EXTA 1I2QA 3DFNA 4OE7A 1YXYA 4IPJA 1OFQA 3CTLA 3QF0A 2ZZ7A 4LC8A 4Z0SA 1FWNA 3EWBX 1XUZA 2GVJA 2W79A 3NM1A 4IOTA 4HIBA 4JTHA 1DOSA 2TRSA 3MI2A 4B5NA 3IGUA 1B57A 4MJZA 4JX4A 2YR1A 3NZ1A 2FB2A 4RV8A 3C2VA 3TXZA 3GNNA 3DXIA 3W7DA 4I7UA 4ZQCA 2DZPA 2Q3OA 4K37A 3T55A 2ALDA 4RX0A 1FDZA 5K4ZA 3QEZA 4FX6M 3NQFA 1H1YA 2C6QA 4YWIA 2HSAA 1KV5A 4WD0A 1TPVA 3BV4A 3LX9A 1RQHA 1N55A 5HUPA 2V2HA 3S5ZA 3TFCA 5K9DA 5I3KA 3R13A 4GUHA 5D09A 3W85A 3ZS4A 2C14A 2Y89A 3PB2A 5DXYA 1W1ZA 3BG9A 4NZJA 5K7JA 4IXXA 1G4TA 1MEIA 2YW3A 5D32A 3STFA 2PRLA 2ZA2A 2CZEA 3UY8A 4Z1BA 1SZFA 2Y85A 3W23A 3RK8A 3DENA 1MO0A 3DFPA 1QPQA 2C3ZA 2RHGA 3FJ6A 3LHYA 1IXNA 4C1KA 4DXVA 4MVAA 3L0NA 3TXVA 2VFGA 4JTKA 3WJZA 1EP2A 1VYPX 3CIXA 1OHLA 1H1ZA 4A3UA 1TPH1 1L2UA 7TIMA 4O19A 3LXCA 4KKXA 5F2MA 2ZRWA 3LRMA 4PTNA 2NV1A 3G3MA 3A5VA 1R47A 2Z2UA 4TMCA 2HTMA 1TRDA 4HSNA 4LVGA 4ML9A 2WPBA 1P0KA 2JGYA 5E0KA 1JULA 4S1FA 1OYCA 4QSHA 1TJPA 4QAIA 1LM1A 4LWWA 3P82A 3TMLA 1SO3A 5F4WA 3KRZA 3SGUA 3PBYA 5I3IA 1SZNA 4PH6A 4YCOA 4H4IA 2B7QA 4IMFA 5FF3A 3W1TA 3BK0A 4Z1AA 1I2NA 3HGRA 1YXDA 2DU2A 3W71A 4UTKA 2ISWA 3QPYA 3B04A 1GOXA 2WSYA 4WOQA 1FXQA 4LRTA 3WK0A 5TIMA 1VCGA 1FUYA 2VFIA 4JTSA 1JCLA 1AK5A 4MKNA 2TPSA 2FFCA 3B05A 3KX6A 5I3FA 2I9EA 1UJPA 2OJPA 2V2CA 5DELA 2Y61A 2EPHA 1AL8A 1OG0A 2E6FA 1BWKA 4CCCA 3ABQA 3H55A 2KZHA 3W07A 4JTLA 3LB0A 3QJAA 4GJ1A 4YL2A 1KFLA 4LY8A 2QCDB 3UY7A 4Q32A 2O7QA 4QM1A 3C2FA 5AHIA 1H61A 3OA3A 4BWLA 1TPUA 2H8ZA 4UMBA 2BXVA 2ZFAA 1AMKA 1TV7A 3EKZA 1ZAIA 3VE9A 5DCEA 2W0UA 3GDRA 2QKFA 3Q37A 1KM3A 4FO4A 2ATSA 5BRBA 5J5RA 3LV5A 3OG3A 5CGQA 3R2GA 1XXXA 3STGA 3CPRA 1YPIA 1OFPA 4XBSA 3PSVA 3QZEA 4UTJA 1A5CA 4KFNA 4UTTA 5FESA 4O1CA 3LTPA 4XZ9A 3L67A 3W86A 3BARA 4CNNA 2YCEA 3W7OA 3PAJA 4FIQA 3W7MA 1FDYA 4N9EA 3W7IA 2QCEA 2ZYFA 3KVLA 1B3OA 4X2RA 5DCBA 1AG1O 4N9DA 1VH7A 3O16A 4HN4A 2E5DA 2X2GA 3G8RA 4TX9A 4YCPA 4FHAA 1GEQA 5LKYA 3NQEA 4IUOA 3NQ7A 3W1MA 5KITA 2QUVA 3W2LA 3F4NA 2A21A 3NOEA 5EMUA 4M6QA 4O28A 1ZHAA 3QW3A 4Z08A 4PL2A 3W7JA 3G8EA 1GG1A 4S2BA 3TQKA 2XN2A 1THFD 3T44A 4R53A 1WX0A 1TIMA 5DBTA 5D05A 2JKEA 3E0IA 4AHQA 1OVDA 4DPQA 1YTDA 4LU0A 1J4EA 4LOCA 4MYXA 2BZNA 3EWUA 1UASA 4CQAA 4AB4A 3MYPA 3IIVA 3PBUA 3W6YA 3TCEA 4RR4A 3W87A 3C2OA 1SSGA 2DZTA 1PHWA 1LLWA 2NUWA 2J6XA 3Q94A 1OFEA 5AHLA 1YADA 5DBUA 2NUYA 2VFHA 3L5LA 3LCHA 4UTIA 5AHMA 3S42A 1LRTA 2A5HA 1LLZA 1RVGA 2NX1A 5KSWA 3MHUA 3UPBA 2QCCA 3EXSA 2VOMA 3T4CA 3G1DA 2E5BA 2ZTKA 3O07A 4M6VA 1XDLA 3W75A 1H63A 4N2YA 4DF0A 3QMSA 4OGZA 1LYXA 4N02A 1SUXA 3TK7A 2O7SA 3IIPA 3W1XA 3O8AA 2WSQA 3EXRA 1ML1A 3GK0A 2OCZA 1YTEA 3BW2A 2VFEA 3NQ2A 2A2IA 4H3DA 5CZ0A 4KWVA 3N2MA 5AC7A 3UNDA 5EKYA 1OK4A 1QFEA 4NNCA 5SWUA 3GZ3A 5DXXA 2G95A 3W7HA 3SW6A 4I7VA 2QCFA 2NLIA 4RZ6A 3MWAA 2ISVA 4D2JA 4Z1DA 1HL2A 3LLDA 4DBDA 2ZZ6A 5KZMA 1S5WA 4IMDA 1KM5A 2PCQA 1W56A 3WK3A 3UWWA 5U4NA 3C56A 2QCHA 1TTPA 1LBMA 1QDSA 3MP5A 1WOAA 1UBSA 5IBXA 3G24A 1LORA 4KWWA 1W5NA 4GBUA 4A2RA 3HG2A 2NV2A 2NXHA 3GXPA 1TPFA 3GX9A 4UTLA 3CB8A 3T78A 2FJKA 3AJXA 4PODA 2YPIA 3KRUA 1SZEA 2CU0A 4I9AA 4O17A 4UFKA 2YYUA 3G0UA 2A4AA 4ORIA 4O57A 1YTKA 2CZFA 4UFHA 3L65A 3FFSA 3GXNA 4BI6A 4Y9AA 1Q6QA 1KM4A 3GDMA 2V30A 2XN1A 4K6AA 2W6RA 1CW2A 2PRMA 1QOPA 3E49A 3PG8A 2BWGA 2VFDA 3NPVA 3QPZA 1UB3A 3R5EA 5HWNA 3KAOA 1JRBA 2WO5A 2ZRXA 3W7EA 3VNDA 2YX0A 4XKYA 1FWSA 3W7NA 1KA9F 1YYAA 1AW2A 3ZWSA 5LGZA 3SY5A 3USBA 1JVNA 3GAYA 2E09A 1QAPA 1Q6LA 5T26A 1TQJA 5GVJA 5AHEA 1XI3A 2I14A 4G1KA 2ZDRA 4IMCA 1JCYA 2GJLA 3BO9A 3LOTA 1H7OA 1KBJA 1GQNA 5AHNA 3W7KA 5HULA 5AYYA 5E1QA 1GYNA 5D2WA 1KM0A 4RZ5A 3QFEA 3LHZA 2G97A 4E0CA 1S3HA 4JDBA 4H6KA 4UXDA 5CKSA 2QEZA 2OMAA 4NZFA 2GOUA 2R8WA 3SIZA 4JNMA 5ABTA 3W2MA 3M1ZA 3P7YA 3N9SA 3G1XA 3N14A 3EWZA 4UFIA 5G2WA 1JUEA 5D2XA 1C8VA 4EF9A 3QW4B 4JY8A 1TTQA 3W74A 2H6RA 1ADOA 3P5YA 1S5TA 1GG0A 1CI1A 1K7EA 3NG3A 2QCDA 3V1PA 5FEPA 1DKWA 4O16A 5F1VA 4QNWA 4LTSA 3STEA 4NNBA 1VLWA 3EEGA 1P1XA 1VYRA 3S9YA 1DQWA 1JUKA 2ZA3A 3CWNA 1TCDA 3M5VA 3A22A 4JS3A 1YPFA 1PV8A 4X3ZA 4JXCA 3I6RA 2CZ5A 2GQ8A 5HMSA 3TQ0A 3UQNA 4RK8A 2X1UA 5G2IA 3YPIA 3DKLA 2ZZ2A 3UZ5A 2Y7GA 3RLVA 4N4PA 3NAVA 4PL1A 2A1YA 1OX5A 1GVFA 3L0GA 1BKSA 2YDAA 4POCA 5F2LA 1A5BA 4GWEA 3PBVA 1EEPA 1WQ5A 2B7OA 4GRSA 2PRHA 5FEZA 3QYQA 1GWJA 3BVJA 3HIJA 4BR1A 1KTCA 2DJXA 1Z44A 3CEPA 1OFBA 4NJKA 4K39A 1MXSA 1OX6A 1W31A 3W76A 5CPMA 3CU2A 3AO0A 1FCUA 3LCLA 1WOBA 4ADSA 2ISSA 2WSRA 1H7RA 5FF0A 1OX4A 2FPYA 1R46A 1FQ0A 3NQGA 3TSMA 3QQ1A 2QAFA 1L6YA 3C8FA 4IX0A 2TYSA 1LZOA 4JICA 2ZRVA 2PURA 3PR2A 3PM6A 4HKPA 5F2IA 3W1NA 4M7TA 1RV8A 2X1TA 3HMJG 3NPXA 3QH2A 4IXHA 4HT3A 4AVFA 3TH6A 4LRSA 3UD6A 4ADTA 3M5XA 1NAL1 3D0CA 1YLVA 4GUJA 3C3NA 1ZENA 4A22A 1LROA 3I7QA 4UNLA 3I7RA 2PC4A 1TYGA 3PSWA 4TIMA 3NPWA 1LTDA 2VEIA 1M5WA 5EY5A 2WKJA 3PB0A 3DFSA 2HS8A 2AQWA 5LNUA 3DGRA 3M41A 2CW6A 1FWRA 2OT0A 1R2SA 2Y88A 1K02A 3RU6A 4ZMGA 4PC8A 4JY9A 1T99A 4BK9A 4O53A 1ZY9A 4MFEA 3FIGA 1F7BA 2A7PA 3V75A 4EIVA 2C16A 2Q3RA 3ATZA 5KZEA 4QITA 4OBTA 1TPB1 4Y8FA 1KFCA 2YXGA 2YFNA 1H7PA 1K03A 3LLFA 4FB7A 1W5OA 3L2IA 3SR7A 1VRDA 3GDTA 1BEUA 1TQXA 3QRHA 2VXNA 3K30A 1X7FA 4WY0F 5AOUA 3MUXA 4AF0A 3W88A 1PE1A 4AWUA 3EX2A 4XBKA 1I2OA 4XKYB 4UC5A 1H51A 4IMGA 3DI1A 3R12A 3LHTA 3GNDA 3CIWA 2QJGA 4NJGA 3M5YA 5H2ZA 3LCIA 3EX3A 2BX7A 4NJIA 3IIZA 4OHQA 4JYFA 4FNSA 2J9ZA 1MZHA 5LNSA 2J9XA 3BPWA 2NX9A 4UCGA 4JTIA 4OWGA 3NDOA 4BI7A 1SO6A 4GUGA 4LT9A 4ZVJA 3BLIA 2TMDA 1OYAA 2OT1A 1KFKA 2RDUA 4UFLA 1NFBA 1NSJA 3MHFA 2ABAA 2QCLA 3W2JA 4FX8A 3EKLA 4O10A 4UTHA 3P60A 1QO2A 2BTMA 1B4EA 5D33A 5K3VA 4FNUA 4DQWA 3MBDA 4JYEA 3VI2A 1QPOA 5BMXA 3FLUA 3TJXA 1SO4A 3PUEA 1XL9A 2CLHA 3KVJA 1EPXA 1LRNA 4R33A 3TFXA 1U83A 5G5IA 3M9YA 4K36A 3HGJA 3OIXA 3WJSA 2ATMA 3UZJA 2CLKA 4X9SA 1X1OA 3VFLA 2ZA1A 2OZ0A 2LLEA 5FI8A 1OK6A 3LRKA 5BOOA 1JRCA 2Y7EA 5LNRA 4AXKA 4JTGA 1I45A 3CC1A 4CCDA 3UWYA 2DZUA 1ME9A 2B7PA 1ICQA 3TUUA 5AYXA 3WFAA 5D2YA 1I8JA 4BWLC 5LHEA 1JCMP 2Z6JA 5AFDA 4YLWA 3GDLA 1TJRA 3IVSA 1GT8A 2G96A 1F05A 4BFAA 1EB3A 3HGOA 4HNTA 2QAPA 3W1LA 5KTLA 2QDHA 1XBZA 4JX5A 1M6JA 5BW6A 1PL9A 4IWWA 4OV9A 4QISA 2V0TA 2CLOA 1U5JA 3W7LA 1PCKA 4ZQNA 1IXQA 3CLMA 4R7JA 1DQXA 1Q45A 2A6LA 3SGZA 3R89A 3TROA 3L0KA 1H5YA 4UTMA 4UTTC 3P74A 3DH7A 3G3DA 5CZJA 3F4WA 1G4PA 2E6AA 2NWRA 3LHVA 2AAMA 4O11A 1QPNA 3ABOA 3BG3A 3HB9A 3NQCA 3IGSA 4LVDA 4MJMA 1F6PA 1G4EA 1W5PA 2J24A 3NQMA 1XUUA 1D3HA 3W1RA 3G1FA 3M47A 1QCWA 3TIMA 5FF2A 4AHPA 4MOZA 2C15A 1OFAA 1W5MA 5HWJA 4FXSA 2H3DA 2EGZA 3EX1A 3NM3A 4LNYA 1FCBA 8TIMA 1OX4B 1H7WA 2B0MA 3W1PA 5TBOA 4O8RA 3QSTA 3NO5A 1K8XA 5G2HA 1IGSA 4WX2A 5HNRA 5K9CA 1Z42A 4GC4A 3TNOA 4L4LA 1N7KA 4CNPA 1WXJA 3PVFA 2VEPA 5MHBA 5I3JA 5L6UA 2HS6A 4LV9A 4I7WA 3E12A 1G6CA 2C18A 2JGQA 3HGSA 5LZLA 2BLEA 2WNNA 5C5YA 3HG4A 2G5WA 2Y7DA 2BSLA 3NQVA 3L68A 3SI9A 1AW5A 1VCVA 5HJLA 1YDOA 4CNOA 2DZWA 2X1SA 3CHVA 3DFOA 5K4XA 1XCFA 4R34A 1Y0EA 3W84A 1VPXA 3H53A 4ICNA 2ZZ4A 1IXPA 1FCVA 1G4SA 3W7RA 4AHOA 3G0XA 4Y90A 5HR6A 3MW7A 1JUBA 3N9RA 4O52A 3EWYA 1OYBA 4CCEA 1P4CA 1GPWA 4XTIA 1W3TA 3ZFHA 5CPLA 3E9AA 5A5WA 1SU5A 2X16A 3F03K 4O14A 1O4UA 1T0OA 5AC6A 3QM3A 5F4XA 3W1QA 3TMQA 2GPTA 3THAA 1X8FA 4AF0B 3MBFA 2FTPA 2R94A 3WJYA 3NVTA 4DF2A 1F73A 3BLEA 4CLMA 4N9BA 4O18A 1G69A 1DV7A 3NZRA 5AC8A 4JGDA 1A5AA 1F76A 3TAKA 3P84A 3EX4A 3A9IA 3BG5A 4GNJA 2CLMA 1FXPA 4OQVA 1B4KA 4AWTA 2V81A 2WV8A 1GVOA 4N4QA 3NQ6A 2DZSA 1KM2A 3S5OA 2CZDA 3HPZA 3O6CA 2E1DA 2Y63A 3E02A 1G7VA 3C52A 3LI0A 4RCXA 2ABBA 2E68A 3N3MA 1E51A 3RFAA 4PCFA 2ZRUA 1RPXA 2X1RA 3O06A 3G1AA 5IBXC 3PY2A 2I1OA 1GJPA 2VFFA 3DHDA 3U8GA 3UPWA 4AAJA 4IGHA 5DY3A 1VC4A 4WZHA 1RQEA 4L4MA 4JD4A 2OX1A 3KXQA 4O1AA 1ICPA 4JX6A 1EUNA 1AL7A 1PS9A 4HSOA 4ZL1A 3KRSA 4E2DA 2H8XA 5DN1A 2RDWA 3STCA 4LV4A 2GQAA 3NQ8A 3UWZA 3GLCA 5J5DA 4LS0A 5KMYA 3TC6A 2CLLA 2HMCA 3P62A 4DF1A 5HR7A 1TTJA 4UTWA 4FIRA 3W2KA 4FNQA 3NL3A 3C4UA 3GDKA 4IQLA 4OT7A 1EA0A 4ZQRA 3WJXA 3IIXA 4C1LA 1FWWA 2QJHA 3SFKA 4PA8A 3QMTA 1XBYA 3LDVA 3W7GA 2R14A 1KLYA 2H90A 3NQDA 2V82A 3C2EA 1OFRA 3L9CA 1W5QA 5D37A 3B0PA 1XDMA 2QCGA 3W7QA 2EHHA 4CQ9A 2F84A 2NXIA 1SFLA 3C2RA 5A8GA 3TKFA 4W9TA 3NPUA 3Q2DA 3S5YA 1QR7A 4DBEA 4MIMA 1IIGA 4RJEA 4OV4A 3CT7A 1EIXA 5F2GA 1OF6A 4MZYA 3M44A 3W22A 3LI1A 3KVMA 2EF9A 5BNKA 4OU1A 2WJZA 2Q8LA 4UR7A 5C2XA 3GVGA 2FIQA 2QCMA 5I3HA 4HPJA 4IMEA 3TU9A 4JTUA 2C0AA 3LXBA 4LVBA 4QJ1A 3SSJA 1FWTA 1G7UA 4WUIA 4UMAA 4TR9A 5EPDA 3W73A 1NEYA 2DZVA 1DL3A 1UUMA 4O15A 3PUDA 4NQ1A 3BLFA 1OABA 1KM6A 4ONVA 4P61A 2QF7A 6TIMA 1Q6RA 2C19A 2UV8G 3DAQA 3LERA 2A6NA 3MI6A 4XTDA 4A2SA 4M5PA 3GAKA 3W1UA 1KW1A 3TQVA 3CEUA 1XFBA 2ZTJA 3RNDA 3PF3A 3JRKA 1DBTA 5FEXA 5FF4A 4A29A 3W7PA 3EWWA 4BF9A 1EP3A 1ZNNA 1C29A 4O1DA 3SECA 1M7PA 1CX9A 2EAWA 3UXDA 4RXFA 1S5VA 4UIOA 1T8XA 1DJNA 5AYZA 1XM3A 3B0UX 3ABSA 4U4MA 1J5TA 3PC0A 3W7CA 1KTBA 4Z0JA 1ZALA 4NVTA 1K7XA 4NXSA 3TV8A 2VELA 4O12A 1ZAJA 3PUOA 3QSRA 1OFDA 5CPOA 3HOJA 4WY0A 2P10A 4MZ1A 1SW7A 4NXKA 4NX5A 5FEWA 6ALDA 3FYOA 3H54A 4JYDA 1HO1A 3TJLA 4PEKA 3N34A 5EBUA 5CG7A 3LCWA 1H62A 3UWQA 4HNVA 4FNRA 5C54A 1MSSA 3PBWA 4K7YA 4M19A 1F6KA 1H7NA 1DORA 4XQ6A 1ZJIA 3TE9A 2VKZG 4PFMA 1NVMA 3MMTA 1LBFA 4EVZA 4EF8A 3KOFA 3W70A 1P0NA 3HQ1A 3G0SA 5TQLA 4FNPA 5D02A 4YMZA 1J2WA 1WDWA 3DBPA 3GKFA 5DY2A 1SFJA 3G1HA 5LNWA 4Q33A 1WBJA 4MZ8A 1K8YA 2AGKA 1UCWA 2VENA 4O0ZA 1ZCOA 4WOZA 5CPNA 4UNKA 4BI5A 3NYZA 4GFSA 1VLIA 1IIHA 3L5AA 3LBCA 3LM7A 2EKCA 4QNEA 1NF0A 1TMHA 3B8DA 5AHFA 2VEKA 1QMLA 3PG9A 4LS1A 1SPQA 3NNTA 3NEVA 3IIOA 1B9BA 2QCNA 3HO8A 1MEWA 1W54A 1I2RA 1R2TA 3NA8A 1WAUA 4P2VA 1BWLA 3NL5A 2JBMA 3O15A 1F2JA 5L9FA 5BMWA 3B03A 1PIIA 1W3NA 4HPXA 4NJHA 2JK2A 1YDVA 3FJLA 2FPVA 4EWND 5KZDA 3BW3A 3LCFA 3GB6A 4MY9A 5CZTA 1QO5A 5D2TA 2FB3A 4DO4A 1K8ZA 1ONRA 3DKJA 4FNTA 1FBAA 1YDNA 1LBLA 3IGXA 2J88A 1XKYA 2NXGA 1NF7A 1WYIA 3LGEA 4LW7A 2YSWA 5U7SA 1FY6A 1LP6A 3IVUA 2YFOA 3HJZA 5CZSA 2J27A 3TC7A 1JCXA 3M6YA 3O6YX 3I7SA 1Z48A 4QQ3A 3SZ8A 2XFWA 1HTIA 4DO6A 1PCWA 1XBXA 3VKJA 3FEMA 3HBLA 4ZQMA 1VHCA 2ZZ5A 3L5MA 3PS7A 1A53A 3NL2A 2B4GA 1K7FA 1LOQA 4K8HA 1G67A 4U28A 4S2CA 4GUFA 3HG3A 5C6MA 3ELFA 3LV6A 3UYCA 1ALDA 3C0JA 3U6WA 1GYLA 3GYEA 4IX2A 1RZMA 4IJBA 1O95A 1TO3A 2F7FA 3M5ZA 3LTSA 3R8RA 4ALDA 5F1UA 1EWDA 2Q8ZA 1VR6A 4MLJA 3B0VC 1TRIA 1JJKA 3W3OA 2XN0A 1MEHA 2PE4A 3MHGA 2X30A 4QIUA 1O60A 3G18A 5H91A 3G1SA 1VQTA 5K2ZA 3INPA 3P67A 1V5XA 3S1UA 3Q58A 3S6DA 3NXFA 1DVJA 1Q6OA 2GVLA 1LOSA 1UUOA 4MYAA 2QJIA 2IQTA 3LBMA 3F1QA 2A0NA 1AW1A 3A5FA 1HG3A 4UMCA 2V5BA 2ZBTA 3OVQA 1TV8A 4RKAA 2WNQA 2B7NA 1VYSX 3CM4A 3E96A 3MP4A 4K38A 2TSYA 4JTFA 1VJIA 4NNAA 1SQ7A 1IF2A 3ATYA 3TSDA 3GR8A 4UUIA 4J9JA 3MI3A 3U2OA 1EP1A 1JCNA 3LCXA 2DP3A 1PVNA 5FF7A 4DEFA 5CSRA 4WY0B 5D38A 5D04C 3LXAA 2QDGA 1X1ZA 3M16A 2WNZA 5HQEA 1RR2A 4FEZA 1HO4A 4MY8A 4JTJA 4UFJA 1O5KA 2NWSA 4TU1A 1XBVA 2WQPA 4RLIA 5HINA 2RKXA 2ZZ1A 4Q4KA 1TPWA 4UTUA 5HUOA 1DJQA 2DORA 3BGJA 3MYOA 1OFOA 2V2DA 1EX5A 3W1AA 2NX3A 3RF9A 2H3BA 3O6DA 1R2RA 1VHNA 1KFEA 4RXGA 2YGYA 3S1VA 3VCRA 3CWOX 3MO7A 4NX0A 5F4SA 3FOKA 2FQIA 3A24A 1W37A 1TTIA 3ABRA 3DHFA 3FS2A 3N73A 4DO5A 3B4UA 4NUWA 3NQAA 4LS2A 2V5LA 1VZWA 3PWAA 4O50A 3DU0A 4ORMA 2A7NA 3VE7A 3S0CA 4LC6A 1F5ZA 1WA3A 1TPDA 3N19B 3UWVA 2V8ZA 1SO5A 2GUUA 3LTYA 4ADUA 2Y6ZA 2QUUA 2A7RA 4WJEA 4K8EA 3LHUA 1W0MA 4JR5A 2FDSA 1KLZA 4Y6GA 3JS3A 4E2BA 4O4WA 3WK1A 1YXCA 3A23A 3P8JA 3IVTA 1L9WA 4JEQA 5G1YA 4NJJA 1LCOA 5LSMA 3NGJA 4WQ6A 1DHPA 3HF3A 1QNVA 1A5SA 5IM51 4JIQA 3M7WA 4XWUA 3S5NA 4KFOA 3OEXA 2YW4A 3TX9A 4O54A 3LHWA 3P8IA 5EYWA 5AN7A 4E38A 2E77A 4YXGA 5DLCA 1A50A 5D2VA 2GQ9A 1L6WA 4FF7A 2E5CA 1D3GA 1W3IA 3TAOA 1C9DA 3P5ZA 2VC6A 1FCQA 1QWGA 3TDFA 1KTNA 3NL6A 3THQA 1PHQA 3OVRA 1V7YA 4N6FA 2NUXA 4LUJA 1ICSA 2CLEA 3GKAA 3GXTA 1LDCA 3JR2A 1RQBA 3I65A 3QMRA 4X22A 2CFFA 3KFTA 1TPEA 2YYTA 2DZXA 4HNUA 1W8SA 2J9YA 3TR2A 2E6YA 1EUAA 5LNVA 3NR0A 4M7SA 1I2PA 3EWXA 3TW6A 3I68A 1TPC1 4Z1CA 4O13A 1TB3A 2R91A 4O0KA 3FYPA 4O1BA 2ZZ3A 5HWMA 2A85A 3TA6A 3P61A 4LUIA 3M0ZA 3HPXA 4NU7A 5C55A 2CWNA 3MP3A 2JKPA 5D30A 1X6UA 1JQXA 4TMBA 4ZQPA 2QR6A 2VEMA 3OBKA 5G4EA 4A21A 3DFTA 4JIPA 3IV3A 4RZ4A 1TV5A 3C61A 3W72A 2C13A 1Q3NA 5EA9A 3GIYA 2CLFA 2ZRYA 1F74A 3SJ3A 3HPSA 1M7OA 4WXZA 3EX6A 5AB3A 1H60A 1P5BA 2Y70A 2C1HA 3BW4A 1BTMA 4N6EA 3KVKA 4AMAA 1D9EA 1TREA 4CQ8A 5LGXA 4UTWC 4UFMA 3M43A 4JN6A 2NZLA 5I3GA 2Z0IA 5G1TA 3RLUA 3W83A 4HNNA 3BGGA 1VS1A 5G4WA 1FDJA 3N2XA 1WBHA 1R30A 4GXMA 2WOQA 3FKKA 1H50A 3WJWA 3G1YA 3S8HA 3G22A 3O63A 1KV8A 2Z1BA 2QUTA 3O05A 3UWUA 2RH9A 3OHIA 1KM1A 3QQ0A 3UXAA 4GE8A 1TSIA 5E93A 2Z6IA 1N8FA 3W2UA 1ME8A 3C6CA 3KHJA 2YZRA 1LRQA 1O94A 4XUGA 1LOLA 1T96A 1JCJA 4N9CA 4AEOA 1ZAHA 1RD5A 1K3UA 4M6PA 3O1NA 3LRLA 3S1XA 3DI0A 1H7XA 1KFJA 4ZZ9A 4MPQA 1L6SA 2Y62A 2V9DA 1XC4A 1GZGA
chains in the Genus database with same CATH superfamily
3AXXA 4QG6A 4QEEA 3DZ1A 4LVAA 3TQPA 4LGXA 3W9ZA 4DVOA 3DFQA 4UR8A 3HJEA 5CSSA 3CYVA 3A21A 3S3GA 3E0WA 4E2OA 1FP9A 4L64A 4R7OA 2CLIA 4WXYA 1O6IA 2OPJA 3VGDA 1GVSA 1ZGDA 2ZQ0A 1FX6A 2P0OA 4S3GA 1DYSA 1KWKA 5DX7A 1QPRA 4B2DA 4LCSA 3WZ0E 2Q09A 2QPUA 1GTHA 5D03A 3TC3A 1EJWC 1JR1A 2HPIA 1QASA 4JTTA 3W2NA 1CGXA 4LFYA 4DELA 3WQ8A 5FSDC 3A6OA 3T7VA 3S1WA 4G8TA 2ZUUA 4DB7A 1GVQA 1XS2A 4KFPA 1KR0A 4X61A 2GJNA 4MY1A 3GDBA 5BU9A 5D9NA 1E4NA 2P1FA 3B8SA 4KCWA 3R6IA 2OODA 2XIOA 4CUCA 3KBVA 3CL8A 4MB1A 4A3QA 2WJEA 2XUCA 3NSNA 1AUSL 2WWDA 2GUBA 7ENLA 1Y5WA 2PC8A 4LC8A 4PBFA 1PTGA 1VEMA 4W89A 1RCOB 2OQYA 1JFXA 2TRSA 4B5NA 2XG9A 4MJZA 3C2VA 1BF2A 3DXIA 5BCAA 3ALFA 2DZPA 4K37A 1DTUA 5K4ZA 3BZJA 3QEZA 2C6QA 4KIRA 1YKWA 1MYRA 4JQ2A 1WPCA 2GQ3A 4LB3A 3LX9A 4F0LA 4FXJA 1N55A 3NDYA 4WEVX 2V2HA 3VC5A 3VU2A 5CC5A 4F0SA 4L1WA 3R13A 5D09A 1XIHA 2Y89A 3PTKA 1JYNA 2D0FA 1W1ZA 3M4HA 4NZJA 1DJZA 4IXXA 2R1MA 4HHHA 1MEIA 3OG2A 3PJXA 2ZA2A 3KBSA 3KDOA 2ZUNA 3RK8A 4J3TA 3FJ6A 1IXNA 4DXVA 1CEOA 3H7UA 4ZOEA 1K1DA 3CIXA 1G0CA 3CZEA 4ZXLA 2WKGA 4KKXA 4KWUA 3KBJA 4M3PA 2ZRWA 1OZQA 4ZR8A 2Z2UA 2HTMA 3GU1A 4NASA 3THCA 4ML9A 3NGFA 1XYMA 2J47A 1ODUA 1P0KA 2JGYA 2QS8A 5E0KA 1R7AA 1XLCA 2ACUA 3AMCA 1EQPA 4PR4A 2I5IA 3GC5A 2XM1A 1MXGA 4MM1A 1SZNA 2Y0FA 4J4KA 3WNOA 1FHUA 1X7IA 2WKLA 3PBMA 3AIVA 2WSYA 3OODA 4HNOA 4LRTA 1YX1A 1EJTC 3DN5A 1VCGA 2VDHA 3D5HA 4H9MA 4DYJA 4DNHA 3QZ6A 4ACZA 3B05A 3WD4A 1F4HA 3M0KA 3ANUA 4W4QA 2FGLA 1US0A 3AUJA 1XIIA 4GVHA 1XLDA 3QHNA 4V1XA 2W92A 3HTWA 4F4RA 1KFLA 5AC5A 1SJBA 4LAMA 2O7QA 1O68A 1GOWA 1H61A 3VXGA 3TONA 2ZC8A 3BAYA 3TTOA 2ZFAA 1TV7A 5CBBA 4HK7A 3KDNA 5FJOA 2YXOA 2AAAA 4NZ3A 3I3EA 4H6RA 3RJXA 1KM3A 1DJWA 2E7FA 5E6ZA 2ZXQA 5CGQA 4NG3A 1XYFA 3GBDA 1UD4A 3CPRA 1YPIA 4DAIA 1UWTA 1HW6A 1A5CA 4CU7A 3A4AA 4KFNA 3WSUA 4DUVA 5A3HA 1AH3A 2GJXB 3URBA 4DO7A 4Z42C 1F3EA 4JTAA 1QW9A 4D6DA 5DCBA 4X2RA 2WNWA 1BXBA 3APGA 3O16A 4N9DA 4HN4A 2PBOA 4FHAA 4G7FA 1GEQA 5LKYA 3NQEA 4KIEA 2QUVA 2JF7A 3COTA 5I5RA 5EMUA 2CXGA 1GHSA 1S2UA 4H01A 4A8IA 3W7JA 3VINA 5CC3A 1D3CA 1WX0A 5D05A 2OLAA 3B8TA 5CQ1A 4LOCA 5I3DA 1W1A1 1TFVA 4MYXA 4YTSA 1UASA 2A3EA 3CYJA 1X98A 1W8GA 1S5NA 4NL1A 3FHQA 3MYPA 3Q65A 3ERPA 2HDJA 4ZO7A 5KZ6A 4GQGA 3TCEA 6REQA 2HISA 5E6YA 4RR4A 1GGOA 3C2OA 1LT7A 1K6AA 5FJJA 1ECQA 2A5HA 2NX1A 2QDDA 5E09A 3UA3A 4QTGA 2VOMA 4W8LA 3G1DA 2E5BA 3BJFA 4M6VA 3HV8A 4NZ5A 4JFTA 4DF0A 1TWWA 1IZJA 1LYXA 4N02A 3WELA 2VZOA 4QS6A 1RJQA 3TK7A 2O7SA 1BQCA 2VGFA 3N4FA 3MUY1 2Z29A 3O8AA 3BURA 2BMBA 1ML1A 2J7HA 3PP7A 3MKVA 4HPGA 3GK0A 1NWUA 1YTEA 4KWOA 5CZ0A 2VX7A 4KWVA 5AY7A 3ONBA 1MDRA 4PUMA 2G3NA 3WENA 2XGIA 3V0SA 1LQAA 2MANA 4AISA 5DMYA 3AIEA 3GVVA 5I7GA 4D6GA 4C6JA 1BD0A 1JDEA 5AVHA 4DBDA 3N12A 1XQKA 1S5WA 1POKA 3VIJA 5BXPA 3UWWA 3EDFA 3B40A 1QDSA 4QE4A 4IJRA 5EMMA 4JPGA 1LORA 1MXDA 4LX4A 1VFMA 4DYEA 2ALRA 2E4TA 3HG2A 2NV2A 2YA1A 2AOSA 3GXDA 3AMGA 3GWQA 4O0QA 1V93A 2CU0A 3KBNA 1TG7A 4UFKA 3G0UA 2A4AA 4ORIA 4GKTA 5CBIA 2J66A 4IIHA 7PTDA 3GXNA 5JQ9A 2VR2A 2J7EA 1WO2A 3AIBA 4B5UA 4Q4SA 2CNCA 1UA3A 1XLJA 4YU1A 3ABXA 2DH3A 3KAOA 2ZRXA 3W7EA 1TZ7A 2YX0A 4XKYA 3W7NA 4DJFC 2GSJA 2DVTA 4GGBA 1E4IA 3GAYA 4F2UA 4Q7IA 1FWCC 1OGBA 2XIBA 2I14A 4G1KA 2VRJA 4IMCA 5DO8A 2G3JA 1KBJA 1W1YA 3WMCA 2ZE0A 3CV6A 2ACSA 3SUVA 3W7KA 1F6YA 4LSBA 4YTUA 3TN6A 1VP5A 4RZ5A 2NSXA 2G97A 3F2DA 4J35A 4K8GA 4MWAC 4H6KA 1V51A 3NDZA 2R8WA 1ONXA 1NWTA 5ABTA 3P7YA 3N9SA 4NAFB 3TJ4A 4UNIA 4B5WA 1V03A 5G2WA 5D2XA 1CPUA 1E1CB 3ZR5A 4P8XA 4PZVA 1ADOA 1S5TA 4YWSA 1CI1A 2VD9A 1K7EA 3K8MA 4Q4PA 4GNVA 5F1VA 4QNWA 3ME3A 3STEA 1VLWA 2WZEA 1JUKA 2ASHA 2BB0A 2GFTA 3M5VA 3A22A 4JS3A 1OD0A 3V4BA 1VFUA 1UOZA 3G6MA 2BHUA 4RK8A 3CWHA 3YPIA 3DKLA 3PZUA 3WLHA 4B5VA 3WL1A 3WNKA 4N4PA 3PPCA 3C2YA 1OX5A 4GVGA 4POCA 1YRRA 1E9IA 3PBVA 3ZYZA 4GRSA 2WCSA 4EPEC 2F6KA 3FAXA 1GWJA 3D46A 2WVSA 7TAAA 2DJXA 1H5VA 4HTBA 4NJKA 1P6CA 3S2MA 1W31A 4L56A 3T0TA 3CU2A 1UZ1A 9CGTA 3AO0A 1JNDA 1DWJM 1FCUA 1EHAA 4XD4A 3AWOA 1B3YA 4LCRA 1H7RA 1R46A 3NQGA 2FGZA 3QQ1A 2QAFA 3AS1A 5REQB 1GEHA 4JICA 2O92A 2VO5A 3NSXA 4CQBA 2E8ZA 3IJ9A 3DESA 3PM6A 4HKPA 3W1NA 4M7TA 1RV8A 2X1TA 3AYVA 1DTNA 4IXHA 4HT3A 2QT3A 3TH6A 3DC0A 4LBUA 1NAL1 3UZZA 3C3NA 4DJEA 3WD2A 1ZENA 4A22A 3PPFA 4AZGA 1KRMA 1TYGA 3PSWA 4TIMA 3RCNA 3NPWA 4IFRA 1M5WA 4F0HA 5CJMA 3R8GA 2DUZA 1FWRA 2OT0A 4C1NA 1Q66A 1J6PA 3NZQA 4PC8A 3IJ8A 1T99A 5J04A 3OOQA 3PZIA 1Z7AA 3I6TA 1HNYA 1VEOA 5D8WA 3V75A 6TAAA 3H4GA 3U5UA 3ZMRA 4H2HA 4S23A 1Z32X 3WUFA 2C71A 2YXGA 2PDWA 2ZADA 1A3HA 4AZIA 4FB7A 3L2IA 3K30A 2J74A 2XVNA 1DWHM 3MUXA 1P6WA 3W88A 4XBKA 4KW2A 2WZIA 1ZJAA 5I79A 4F0MA 5A6MA 3CL7A 3VUPA 3DI1A 3RYSA 3R12A 3LHTA 3GNDA 3WQ6A 3UR8A 2OTDA 3OJGA 2GLKA 4EWJA 4OHQA 3IIZA 2J9ZA 1MZHA 1VENA 2UY5A 3MC5A 3H12A 3FGCA 2NX9A 4WCJA 2AL1A 1QNQA 4OWGA 1FA2A 1WZLA 2VMFA 4GLEA 2X1IA 1HJWA 2TMDA 4C7DA 1AQFA 1XLGA 4QDPA 2ABAA 4FX8A 2CZVA 3QKEA 1KRCC 3P60A 1QO2A 2BTMA 1S39A 2G3FA 3CUIA 1RBOB 2FVLA 3VI2A 1QPOA 5DEZA 3TJXA 1E70M 2WVUA 5AKQA 3SCRA 2VDIA 1EPXA 2C0HA 4R33A 1V6YA 5FJRA 3M9YA 4PEEA 3VILA 4IH3A 2CLKA 4Z2GA 2OELA 4HZ6A 1QHPA 4LAZA 2OZ0A 2LLEA 1UPPA 5E70A 2GVYA 1GZJA 3KWSA 3CQJA 3UWYA 1E71M 4GIAA 1KGWA 3TUUA 1P6BA 5D2YA 3K2GA 2PDNA 4Q8QA 4HZ7A 2Z6JA 3CZJA 1XDJA 1J79A 3CL6A 3GDLA 1SVDA 2G96A 4CNUA 3HGOA 4HNTA 1HF6A 2QAPA 3SY1A 4JX5A 2CESA 1M6JA 4JHMA 4RW5A 4IWWA 3ZM8A 4JHZA 2CLOA 2PDIA 4XD5A 1XYCA 3BAJA 1JAKA 4M6UA 2OVLA 4FI4A 1A5OC 1Q45A 3SGZA 3AWNA 4UTMA 4MF4A 5CZJA 1F3XA 2E6AA 2NWRA 4DUXA 1E4MM 5BWAA 2O4MA 2EO7A 1W5PA 3NQMA 1XUUA 5A1AA 3RITA 3W1RA 4XD3A 1N82A 3TIMA 2VZVA 1OFAA 1EXPA 2WW5A 3F2BA 4IQEA 2CC0A 3VO0A 2H3DA 4GI9A 5FD0A 4PGLA 3WQCA 1OX4B 2DIEA 2WJDA 4FOKA 3VABA 1REQA 4QEHA 2B0MA 3T42A 5JUVA 5TBOA 2KX9A 2VGGA 1K8XA 2W67A 3ES7A 1VB9A 3NO5A 4WX2A 4D6EA 2H9AB 4YNGA 2WHJA 3HM7A 1Z42A 2EXOA 1MI3A 4L4LA 4HU8A 3PN8A 1WXJA 2ZX8A 3PVFA 3GIPA 5MHBA 5I3JA 1NFGA 1ISXA 2HS6A 6CGTA 3DC8A 1FWGC 3FNDA 4E8GA 5AYIA 1EBGA 3SO7A 1XGDA 4XD6A 3QBUA 5HJLA 1GJWA 2IKIA 3D3AA 1VPXA 3H53A 1G4SA 4AHOA 4K1GA 2DSZA 1JUBA 3POCA 4Q8VA 3GRIA 3CUZA 3ZFHA 4WF7A 5CPLA 4LJ3A 3VD3A 3F03K 2X16A 4O14A 3VIHA 3QM3A 3M7SA 5F4XA 3W1QA 3TMQA 2GPTA 2FKPA 3AJ7A 4AF0B 3NVTA 3GG7A 1E0WA 1HKJA 3VOFA 5B7ZA 4N9BA 3EDDA 4FOUA 1G69A 1GVIA 3TYCA 1UH3A 4JGDA 4HU3A 3CV7A 4PMOA 1ONWA 3TAKA 1E1EA 3SQLA 4GNJA 1FXPA 2VGIA 1I6NA 1B4KA 3J7HA 4GZJA 4AWTA 2WV8A 1Q6EA 3VGEA 1C8YA 5HPCA 2E28A 3HPZA 3O6CA 2PP3A 4D6FA 3LI0A 3RX2A 2EG8A 2XTKA 5EGRA 3RHGA 2SFPA 1MNSA 1ITCA 1E51A 2VCBA 3WFZA 4NZ1A 2INEA 3RPDA 2I1OA 2VFFA 4AD2A 2XVKA 4IGHA 5DY3A 4PUEA 3ORWA 4UQDA 2ZC1A 2V67A 3AU6A 4IT1A 3WH6A 3SCOA 4D6HA 4JX6A 1ELSA 4E2DA 2XFRA 1IHIA 3ZQ9A 3SCWA 2WC4A 4H8UA 2BY2A 4S3FA 1W3KA 4O1EA 1LL6A 4PMYA 2VZTA 3E0VA 4IQLA 2C79A 3WJXA 2VEGA 5MKGB 3TEVA 3SFKA 3ZJ7A 5LXXA 3V7PA 2H90A 3C2EA 4DJDD 2QGHA 5BZAA 5D37A 1XDMA 4L1GA 4LUSA 3OTRA 1FH7A 3W7QA 2F84A 3L4YA 4D1IA 4S39A 1SFLA 3NPUA 1QR7A 4DBEA 3KOZA 3GC2A 5F2GA 1OF6A 4MZYA 3LI1A 4Q8WA 2XWEA 5BNKA 5A94A 4B92A 2VR5A 5C2XA 2FIQA 2G4JA 3M64A 4DUWA 4HPJA 4JTUA 4LVBA 2XZ7A 5LXEA 2XYLA 1OGGA 3VDGA 5EPDA 3WUEA 3W73A 1NEYA 4H04A 3AZSA 3PUDA 4D8ZA 3VMPA 3WQEA 2GGJA 4W8AA 3ARVA 2QF7A 5HATA 4DBSA 3L4XA 4XTDA 3VC6A 4B91A 3VKBA 3VZYA 2GVEA 4ZFMA 2YCJA 3MTWA 1XFBA 3RNDA 2GWNA 4ZGYA 3DCPA 1KCLA 5FF4A 2HROA 3QR1A 1R86A 1A5MC 1KGUA 4GYFA 4AC1X 1T8XA 4ZO9A 1L6FA 2IMRA 4U4MA 3W7CA 5BWFA 1XIDA 3ARWA 3BSGA 4F8XA 2BNJA 4NVTA 4NXSA 3TV8A 2VELA 4O12A 4JNYA 3QSRA 3WNMA 3HOJA 1BSLA 1SW7A 4NX5A 5FEWA 3K5XA 3N34A 2BHZA 4L5ZA 4P7NA 1KXVA 4Q4MA 5CG7A 1VBHA 3A4JA 4HNVA 5DT5A 1RAKA 7XIMA 1MSSA 1H7NA 3S1GA 5IHSA 3KOFA 3R7MA 1P0NA 4A3HA 3HQ1A 5TQLA 2Z1KA 1TJ1A 3CIVA 3GKFA 1BHGA 3G1HA 4CD4A 1WBJA 4FPSA 3GE7A 4C60A 1ADSA 2INZA 3F4VA 2W63A 4XZNX 1NOUA 2VENA 4O0ZA 4PTDA 4WOZA 3WIJA 1B9ZA 3LPGA 4GFSA 4PMDA 4I9MA 4GK8A 3L5AA 1L6GA 3O6AA 4AG0A 1UP0A 4RDWA 3N2OA 3B8DA 1QMLA 1SPQA 3LUTA 3NNTA 3NEVA 1EYWA 4C6DA 1W54A 1I2RA 1R2TA 2P50A 3WLLA 4GH1A 4FZIA 1E9ZB 1RPKA 1BWLA 2G8ZA 3WMSA 4JKLA 1EFZA 5BMWA 3TYEA 2QULA 2I57A 4AVOA 4TTGA 1IZKA 4NI3A 1W3NA 4HPXA 4PCSA 4GCXA 1DPMA 1ONEA 3BW3A 5KZDA 3GB6A 4MY9A 2QPSA 3N2BA 5CZTA 4AZBA 3QR0A 1K8ZA 3GC4A 1FBAA 1YDNA 1PXGA 1PKYA 3TYDA 1PX8A 3BZGA 2NT1A 1X8CA 1JPKA 3IVUA 3HJZA 1D8CA 2UZ9A 4ZXOA 2J79A 2WK2A 4ZCWA 1JCXA 1Z48A 1HTIA 2PWUA 3DYMA 4NKCA 3FEMA 3VM5A 3HBLA 3AU2A 3FSUA 1CYGA 1VHCA 1WDPA 3AHVA 3L5MA 1DWIM 4WGHA 3WQWA 3U5YA 5I6SA 3AXKA 1LOQA 3UESA 5H1WA 1G67A 3UZXA 1QW7A 3L4TA 4GUFA 5IHRA 1JDCA 1B5TA 1CNVA 2PDXA 3B8UA 1IEWA 1Q5MA 3ZT5A 3M5ZA 3N13A 5I78A 3BMVA 1CB7B 5IDZA 3GY1A 3DFHA 1JL8A 3HQNA 1TRIA 4GINA 1MEHA 2X30A 4HU4A 5HJYA 3A64A 1Q6FA 3BCFA 3KUMA 3D47A 3G18A 2BBFA 2WYSA 4J28A 1QXLA 1VQTA 1V5XA 3Q58A 3S6DA 3GUGA 2PP0A 1GVEA 3B0YA 4MYAA 1U1UA 1TV2A 3SIMA 5MF5A 4GO9A 1PIFA 3GXFA 2V5BA 3OVQA 3AOFA 1TV8A 4RKAA 4M8UA 3CM4A 1A5UA 1W1VA 1OC5A 3RGTA 3MP4A 3WQVA 4B4FA 3UYIA 2POTA 4NNAA 4X9YA 3CH0A 3GR8A 1UH4A 1WZMA 1JI2A 3LCXA 1XLLA 1X39A 5E0FA 4URIA 3KTXA 3GYCA 2QDGA 1HGWA 3TA9A 3M16A 4FEZA 2Z00A 4JTJA 1EC9A 4CU8A 4B3LA 2PWDA 3GD6A 3OLIA 1JYWA 4ZENA 2Y24A 2ZZ1A 3BDKA 4Q4KA 4KGJA 3TW9A 2DORA 1R3YA 1EX5A 3RF9A 4JTDA 4RXGA 1VFTA 4GBDA 3CWOX 1E6SM 4UBPC 2GSHA 8XIAA 3LPPA 3ABRA 3FS2A 1O5QA 4NUWA 1VZWA 3UJFA 4O50A 3DU0A 2A7NA 3S0CA 5CSUA 1EPVA 1WA3A 3PHAA 1TPDA 3NEHA 3N19B 4HNLA 3KCLA 3UWVA 2ISFA 1SO5A 2A79A 4XX6A 2GUUA 2VX6A 4XISA 4AYGA 1UOKA 3SCSA 4ADUA 2Y6ZA 4PMXA 4WJEA 4ACYA 4K8EA 1MQQA 1W0MA 4JR5A 3KZPA 1OB0A 1KLZA 1W3HA 3EAUA 4Y6GA 5G1MA 1RHCA 3QV7A 2B31A 3A23A 2CWXA 2JIEA 4QS5A 3ZXWA 2VR4A 1UWQA 5H8PA 4AQLA 1QTWA 1QU4A 4XWUA 3SUUA 2QV4A 1JEZA 2E77A 1V0MA 1A50A 2GQ9A 4FF7A 3KLKA 2E5CA 3URQA 1E0VA 1SFSA 3P5ZA 2VC6A 1EO5A 4GY1A 1RH9A 3NL6A 2F38A 3OVRA 1WB0A 2NUXA 3G1RA 4LUJA 4RPQA 5CAHA 3UU0A 3B4YA 2F61A 5EMLA 3URAA 4X22A 2CFFA 5HOSA 5A2BA 3KFTA 1E0TA 2J9YA 5GPRA 1K70A 4ZSTA 5LNVA 4IP7A 3NR0A 3TZNA 3EWXA 1V0KA 3I68A 4KT2A 4O13A 4GI6A 4ICCX 1H2JA 4O0KA 2ZZ3A 3P3BA 3M0ZA 3APTA 3WBWA 4DI8A 3CT2A 2IPGA 4ZQPA 3F7JA 3IV3A 3C61A 3VMOA 4UOZA 1Q3NA 3SQSA 3GIYA 3BQ6A 1E9YB 2ZRYA 1MW3A 3F5JA 1J9YA 3UETA 4WXZA 3EOUA 3IRSA 1M7XA 1XW8A 5FJPA 1H60A 1OZMA 1P5BA 1XC6A 2Y70A 5RUBA 3WBXA 3CAVA 2W3ZA 3TTYA 1XD1A 1MUWA 3UG3A 3M43A 2NZLA 2Z0IA 2XVLA 5M2FX 2R24A 3W83A 2HBXA 2HVMA 4HNNA 1WDSA 3WF2A 1FDJA 4Q6JA 3H70A 1WBHA 4H83A 4UWMA 1R30A 4M0XA 3WLNA 3N25A 2OEKA 3FKKA 3UXLA 2XIIA 4RL3A 4JFSA 1H50A 1MZRA 2WC7A 3G1YA 1FTXA 3S8HA 3G22A 1KV8A 2Z1BA 3UA4A 3CO8A 2RH9A 4ZB2A 5CC6A 3UXAA 3HFTA 5EFFA 5AC4A 5E93A 2Z6IA 4P7OA 4AX6A 4QQUA 3KHJA 4XUGA 1IWPA 5HQMA 1T96A 4AEOA 3MWCA 2DFAA 3WDJA 5IRPA 3LRLA 2W9MA 4MPQA 1Y65A 4NZCA 2Y62A 3SCPA 1LCOA 4HA0A 1XC4A 3FKRA 3GR7A 1GOMA 4DN1A 2PLJA 1BLIA 5C70A 1LT8A 2WMIB 4G1NA 1QI2A 5DCDA 2MUCA 4Z2JA 4E4FA 1WKYA 4CQDA 3S6OA 1XICA 3OVPA 2JIWA 5A8MA 3KTCA 2RDTA 3P80A 1X97A 4E8DA 4M1RA 4TO8A 1OIFA 4Y96A 3SRKA 5C7HA 3WK2A 4O4VA 3CH9A 1IT0A 1WDQA 4WSJA 3IJ7A 4U10A 1OT2A 1ZFJA 2DDXA 1TR1A 1M01A 1OINA 4GX8A 2V3DA 1HUVA 2IQ0A 1ME7A 1VCFA 4UQAA 1W3JA 1Z6KA 4WHBA 4GVIA 4US5A 1CGTA 1SZGA 3W6LA 3FA5A 1H0IA 1E15A 4R27A 2FLIA 2J6VA 5TNVA 3GTXA 1DP0A 1U5VA 3W82A 5DF0A 2OWXA 2GJXA 2CHRA 3UVAA 1XIFA 3WMBA 3GFZA 2QZRA 5K9XA 3BL3A 1N8WA 4FXRA 5CH9A 4DZIA 3K1GA 1SW0A 1PPIA 1R3VA 2IXVA 4I5XA 3ANYA 4P8UA 4UQBA 3CQ0A 3IJ6A 4EOUA 1DJHA 1XKJA 4KRUA 3EXTA 1I2QA 1ZZMA 3DFNA 1YXYA 4IPJA 1OBAA 1UP3A 3QF0A 3HQOA 2ZZ7A 4QE1A 4Z0SA 3EWBX 2V5KA 1QNPA 1RP8A 2W79A 3W81A 4IOTA 2J4GA 9XIMA 4JCMA 1Z9AA 1DOSA 3CMGA 1RJRA 1ZSXA 4GNKB 2YR1A 2VC5A 3HPFA 4RV8A 3SM0A 3GNNA 1VAHA 1FHLA 1PAMA 2Y2WA 4B5XA 1T6MA 4GZEA 3T55A 2ALDA 1HGYA 4RX0A 1FDZA 3B9EA 5M17A 5AZ0A 1PO9A 3NQFA 1JD7A 4YWIA 4J7RA 1KV5A 4WD0A 5LIUX 2ZUTA 1A0DA 1HZYA 2EQDA 1KC7A 4GUHA 3W85A 2BVWA 2VI0A 4Z17A 4GABA 3MCNA 1QBBA 2PB1A 3GHTA 1XYAA 1UR2A 4DZHA 1HKKA 4RW3A 1LUCB 3STFA 3UY8A 1RALA 4Z1BA 3PWIA 3W23A 3DENA 4ERIA 1MO0A 3NFUA 2C3ZA 3LHYA 4E5TA 3L0NA 2VFGA 4H9VA 4JTKA 2ZIDA 4GYPA 4D6JA 3WJZA 3EPOA 1TPH1 2QQ6A 1PWMA 1GNXA 3WMLA 4IZGA 3PAOA 4JIRA 4UZUA 3QZAA 3CUXA 1C91A 2WMKA 5F2MA 4PTNA 3OBAA 3SFWA 4RUBA 1OCNA 2WMGA 5HNUA 1TRDA 2REQB 3H7VA 3ZO9A 3ARRA 3GH7A 1GQIA 4LVGA 3DYOA 4PE8A 4CVUA 2QXWA 2AMXA 2AQVA 3B97A 2BHYA 5GJMA 2WPBA 3QHMA 4PMRA 1LM1A 1UKOA 2YCKX 3TMLA 4ZE4A 3WCZA 4OIFA 3PBYA 3O0FA 5JVLA 4PH6A 1BKHA 4FF5A 2E1WA 4YCOA 2B7QA 5FF3A 3CK5A 2NW0A 4RV3A 1FWAC 3W71A 3N3TA 4JBRA 5ABHA 4DUOA 3WK0A 5I23A 3LS9A 1PWLA 1UBPC 3BCJA 4C91A 2FHFA 4JTSA 4WGXA 1AK5A 2DEPA 3MKKA 2TPSA 2FFCA 3GH4A 1CENA 1M9HA 1UJPA 2Y61A 4OVXA 2XGZA 1BWKA 3GHRA 3ABQA 4JTLA 4AEFA 3LB0A 4U2YA 4GJ1A 1UJQA 2IUZA 4QM1A 1JZ7A 2QJMA 5AHIA 3B8IA 1G5AA 1TPUA 1XG3A 1AMKA 3EKZA 3A3HA 6XIAA 4MWAE 3VE9A 2PD9A 5CGMA 4PFHA 2F6XA 1RCXB 5BRBA 3RIKA 3LV5A 5C9RA 5JH1A 3KL3A 3PPGA 2RJHA 4FALA 4DWSC 1RLDA 2I7GA 4V1YA 3JZEA 1UQZA 3T2PA 4A8RA 5FESA 4XZ9A 3LTPA 1S2VA 3L67A 1KRBC 4DJDA 2QVHA 3BARA 3FVDA 3BXWA 1MUCA 1V6XA 3W7MA 1KXHA 4N9EA 2QCEA 1AG1O 2D0GA 2X2GA 1BQGA 3W2LA 1ISZA 4NAFA 2NQ9A 3QW3A 4Z08A 3REQB 1GG1A 5CCZA 1E1CA 3TQKA 2PTXA 1CXKA 2V69A 2JKEA 3BLPX 4AHQA 3THUA 1YW1A 2WAGA 1J4EA 1JNEA 4U3AA 3MSYA 3WD0A 1K4GA 7REQB 1J0JA 3Q4DA 4ZFCA 4AB4A 4X0VA 3IUDA 1E0UA 1K8CA 2DSKA 4P8VA 1S2TA 3W6YA 2PFHA 3CAWA 1BTCA 3W87A 2DZTA 1F3WA 1PHWA 1LLWA 3ITTA 1EO7A 2J6XA 3Q94A 1YADA 2VFHA 4INFA 3LCHA 5AHMA 1EA9C 3TP4A 2IQDA 4AVNA 5KSWA 3MHUA 3UPBA 2QCCA 1PX3A 1B31A 1U2YA 3Q67A 3W75A 4N2YA 3ZVHB 3VZXA 3QMSA 3IUHA 3BMWA 4ES4A 4LH8A 2OQLA 5CEWA 4EPDC 3W1XA 1KQYA 2WSQA 1E0XA 2JFEX 3WN6A 1W3LA 2IKJA 1UKTA 1FH8A 2EG7A 3NSMA 3FVMA 4H3DA 4HTYA 1S38A 5AC7A 5EKYA 4LB4A 4QFUA 3E1F1 2J62A 5REQA 1QFEA 3WEOA 4NNCA 5SWUA 3GZ3A 4QRNA 4IQJA 5DRIA 4I7VA 2P8BA 4B15A 2OLSA 3KCJA 1HL2A 1J01A 3LLDA 3VA8A 5KZMA 2DVUA 4JFVA 2YL6A 1KM5A 4R5EA 2PCQA 3WK3A 1HP5A 4LBSA 3FGCB 3R11A 1WOAA 2HBVA 3G24A 4TV5A 4KWWA 4ATDA 1K9EA 3P2VA 3HV9A 1XIBA 2QF8A 1TZZA 3GIQA 3LNPA 1TPFA 3V35A 3PWGA 1VFOA 3CB8A 3ES8A 3MVTA 4PODA 1O7AA 1RA0A 3KRUA 3ARZA 3I10A 3GVRA 4I9AA 4O17A 3LGDA 1YTKA 2XZ9A 3R0UA 1G01A 3L65A 4Y9AA 3RR1A 1SGJA 1J11A 3SRDA 1KM4A 3L4WA 2BWGA 3NPVA 3RX4A 5HWNA 1XH1A 2X41A 3VNDA 1R85A 4AIEA 3LZ5A 2DGAA 5LGZA 1AW2A 1KFWA 3R1ZA 3SY5A 4LEQA 2P53A 4CD7A 5CG0A 1NH6A 4L7ZA 5JH2A 1Q6LA 1OC7A 1GUVA 5AHEA 3CUJA 3UG5A 2DT3A 1V3IA 1JCYA 3BO9A 2F6UA 1K9TA 5HMFA 3GG1A 2RAGA 1UA7A 5AHNA 2Z27A 3LNMA 3OLGA 3OLEA 3WLOA 1Q4NX 1VD6A 3QFEA 3LHZA 4PMVA 4E0CA 2FZNA 4C6PA 2WWCA 4IIFA 2QEZA 3H26A 1IE7C 4NZFA 1BVZA 4H9YA 4C6CA 4GXPA 4JNMA 2P8CA 1L8NA 4AIOA 3N14A 4UFIA 1V4YA 3H2MA 5GQBA 2F2HA 5FKYA 1C8VA 4EF9A 2YLAA 1TUXA 2BY3A 3S46A 1TTQA 4ERAA 1VPQA 5JBFA 3W74A 3P5YA 5GJPA 4Q8OA 1GG0A 4JFUA 2QCDA 5FEPA 1DKWA 1UR0A 4LTSA 1JPIA 4I9TA 4YTRA 2P0IA 2Q6ZA 3VOGA 3WDHA 1DQWA 2ZA3A 3E5PA 4ZEPA 3S2CA 3N1AA 3I6RA 3TWAA 2GQ8A 5HMSA 1E6PA 1S1RA 2EEXA 2YA0A 1EOKA 2Y7GA 3RLVA 5FOOA 3NAVA 4PL1A 4B16A 1GVFA 3L0GA 3PFMA 4IG2B 3OQ8A 4Q8NA 2ZWZA 4PRWA 1FFRA 3RO6A 3AALA 2HE5A 2R1PA 3QYQA 3ZSSA 3HIJA 3OZOA 1Z69A 1KTCA 1C7SA 4HCDA 3UEQA 2BGSA 3T6CA 4E6MA 3QR3A 1XRSA 1MXSA 4EP8C 4UTFA 1I0DA 2YLLA 4N0RA 2ISSA 5CJNA 5FF0A 1OX4A 1FQ0A 6PTDA 4JZ5A 3TTQA 4AY7A 2TYSA 1LZOA 5EU9A 5HNNA 1GZ1A 2OGYA 2H9AA 4YHGA 4BQ3A 3HURA 1BXCA 3T81A 1W91A 3MV11 3NPXA 1WKEA 4NHVA 5XINA 3MDUA 2PI6A 3UD6A 3LU2A 1FFQA 4GUJA 1WKFA 1QJWA 1F07A 5FL0A 4V2XA 3DFSA 2AQWA 2G37A 2BXZA 3M41A 2FZ8A 3S2NA 5IXEA 4BK9A 3W38A 1Q8AA 3CLWA 4QROA 2A7PA 4PUJA 2Q3RA 4OBTA 1TPB1 4Y8FA 5XIAA 1V8EA 4Q8TA 4BY3A 1K03A 4OUEA 1W5OA 4PTXA 4GYPC 2FZBA 1VRDA 3CNYA 4ML4A 2Z24A 1EXBA 4AF0A 4U5KA 4ZB5A 1XPGA 4AWUA 3EX2A 2XH4A 4A3RA 1CXEA 1BYCA 4IMGA 1E40A 3EOEA 3AFBA 3G77A 1FP8A 2QJGA 1P48A 3LCIA 3EX3A 4BA0A 3VOIA 5A69A 1J18A 1XLAA 4Y2WA 4LYRA 4L6DA 4FXFA 1W9PA 1UR1A 3V5OA 4DM2A 4LUSB 2J9XA 3BPWA 4UCGA 4BI7A 5LIKX 3AIRA 1T5AA 2IKGA 2XVGA 4ZBCA 1OWQA 1OYAA 1SJDA 3CUFA 2D2JA 4HOXA 4WJXA 3DGBA 5FA5A 3HFYA 1NFBA 3E6EA 1BG4A 3B8WA 4HYVA 1OCBA 2V3EA 2QCLA 1E6QM 4JIIX 3W0KA 1B4EA 3NYDA 3NO1A 4OFCA 4JYEA 4KS0A 3PUEA 1XL9A 2CLHA 2WVTA 4QBXA 2OFJA 4GIYA 3UZJA 4TV6A 3BOXA 2PU0A 1JGMA 3SEPA 3KL0A 2ZA1A 3MCOA 4ROPA 1OK6A 1MW2A 4QDMA 2VEFA 5LNRA 4AXKA 4JTGA 1HKVA 1H3GA 4CCDA 2DZUA 1WXZA 1XLEA 2B7PA 4RPPA 1XIMA 2E25A 4H00A 4XSLA 5MKGA 1I8JA 1P7TB 3UP8A 5LHEA 4L6OA 1NM9A 1EJSC 4W8BA 4YLWA 1GT8A 4BFAA 2ZX9A 2B81A 5KTLA 1UYQA 3I4EA 4GYJA 3RLGA 1JDFA 1KRAC 2HQAA 4IM4A 4FS9A 3W7LA 1XYLA 3FCPA 4JQAA 3IS4A 1IXQA 3WF1A 1U33A 2IS7A 1DQXA 2A6LA 3L0KA 3FDGA 3DH7A 3G3DA 3H6OA 4EPBC 1G4PA 2AAMA 1QPNA 3ABOA 4MJMA 3IGSA 1G4EA 1R3SA 4AX7A 1HIZA 4MOZA 1UHVA 1EKOA 2OZ3A 1KR1A 4PSPA 3NM3A 8TIMA 3SDOA 1LWHA 3MSDA 2PDUA 4CN1A 4O8RA 3QSTA 4GXWA 1XHGA 1IGSA 1KGXA 2RGLA 4LYKA 5K9CA 1Z89A 4GC4A 4J2PA 1N7KA 2Q01A 2VEPA 5HXMA 1DJYA 2A3LA 2WBKA 3LD5A 2JGQA 4QJ3B 3HGSA 3SRHA 1M41A 1S5MA 2G5WA 3WLRA 3VOCA 2Y7DA 3MY9A 3T0DA 1DWFM 1US3A 3URNA 2RJGA 2GGGA 2VYOA 4CNOA 2DZWA 1V79A 2X1SA 3CHVA 3DFOA 4ILSA 1Y0EA 4ICNA 5CPQA 3BOLA 1ZP3A 2ODOA 2X0SA 3EWYA 1OYBA 2Z7KA 1P4CA 5EB8A 1AD4A 4XTIA 3T4WA 1EQCA 1XIGA 5A5WA 2WC3A 2ZXAA 2Z1VA 3ARQA 4XAFA 1T7LA 2XIJA 4LAUA 3THAA 1X8FA 3KEHA 1TVLA 2TODA 1F3TA 2D3NA 2WPGA 3V18A 1I1WA 3BLEA 4U5IA 2OSWA 4Z2KA 1W6TA 4O18A 1PBGA 2J7GA 3TVAA 1B30A 1A5AA 5DT7A 1VBGA 4DZAA 3EX4A 3M0HA 1V3KA 2CLMA 2PGRA 4NILA 1Q7MA 4HOZA 1GVOA 4N4QA 5CXPA 3LEPA 1XFCA 2CZDA 1R9XA 3S5OA 2FH8A 1G7VA 2PA6A 4H7ZA 2ZDSA 3VIOA 1MNZA 3N3MA 3RFAA 4YJ5A 3VIFA 1C3FA 3O06A 3DHDA 4AAJA 1TCMA 4AZ5A 2Y8VA 2XSXA 1VC4A 4US6A 4TQTA 2Y5EA 4JD4A 2GYIA 1JI1A 2OX1A 3KXQA 3JW7A 4IFOA 1ZBCA 4BZYA 4GCAA 1W1PA 1EUNA 3KRSA 2H8XA 2VGBA 2RDWA 5GNZA 1L2QA 1EJXC 3GLCA 4ZSUA 1POJA 4XVDA 1NOFA 5KMYA 1ZBKA 3VNLA 3P62A 2HMCA 4HPNA 2IW0A 2XIQA 4AU0A 4BCEA 5LIWX 2VCCA 1VBRA 3AIUA 1YEYA 3MPGA 1EZ2A 3GDKA 3RILA 1E3XA 4ZQRA 2VC9A 4C1LA 1E4LA 2VX4A 3W7GA 1TR9A 5FCZA 3VIIA 4ERGA 1OC6A 3NQDA 3GNOA 7CGTA 4YYCA 2WANA 5IDIA 2NXIA 4LAKA 4HCHA 4W9TA 4H6QA 3BOFA 3Q2DA 3S5YA 3ZSTA 4DWSB 3EPMA 4EANA 4MIMA 4WDTA 4GKLA 4OV4A 3CT7A 5BXRA 2EF9A 2CITA 3FA4A 4I6KA 2WJZA 2Q8LA 3ARPA 2WLYA 3GSMA 4IMEA 4XK2A 3AI0A 3TU9A 2C0AA 1NARA 4XUYA 2G3IA 4YYFA 2V5CA 3QOMA 4PMJA 3L2MA 3VD7A 4I5UA 1DL3A 4XSMA 2OWWA 1MRAA 4W5UA 4P61A 1Q6RA 2UV8G 2CPUA 3DAQA 1NIUA 1UD5A 2A6NA 3DEQA 3GAKA 4WK9A 1QW8A 3WBYA 1KW1A 3TQVA 5D9OA 3MU7A 3CEUA 2DT2A 2ZTJA 1VJSA 2Z2BA 2BGNE 5A6SA 1OCQA 1FHVA 5CJ5A 3EWWA 1LLOA 5M3WA 4BF9A 1EP3A 1ZNNA 1UWUA 1C29A 4O1DA 2PDGA 5BU6A 1BAGA 2ESCA 2PAJA 4S38A 1UD6A 3AQUA 2DQWA 3VGHA 1DJNA 2UWFA 1ZQ5A 3B0UX 3DHPA 3FAWA 3W28A 5G4HC 1MFUA 4Z0JA 4N42A 2CXEA 4A05A 5CC7A 4WJ8A 4EK7A 3ZOAA 4M82A 4H2CA 2GSEA 2OEMA 1IWBA 4JL1A 1MUMA 3H54A 3HN3A 3TJLA 2ZUVA 5EBUA 4QCFA 1AZ1A 3UG4A 1PZ0A 4XQ6A 2BOFX 1ZJIA 4I6VA 1NVMA 3MMTA 4QLJA 4EVZA 2AL2B 3ICJA 3W70A 3WLSA 4MB4A 3WBAA 1AJ0A 4R9OA 1FOBA 4AZCB 4P5UA 1WDWA 3DBPA 2VURA 3MDWA 3MJMA 1RA5A 4U31A 4MZ8A 1K8YA 2AGKA 1UCWA 3UJ2A 5DMMA 4E8CA 3N04A 1VLIA 1IIHA 4GG9A 3LM7A 2D1ZA 2AMGA 2VQUA 5GNYA 4KETA 5AHFA 2VEKA 3PG9A 3QN3A 3WLKX 5CPTA 1EC8A 3RM8A 2WXDM 1DIOA 3O15A 3OBEA 1GOIA 1JYVA 5CBJA 4GISA 5L9FA 5LA2A 1JAEA 2OZ8A 1D7FA 4KESA 1YDVA 3RPMA 3ITGA 1QO5A 2FMOA 4K68A 1UKSA 5D2TA 2FB3A 2VRQA 4GO8A 3DKJA 4FNTA 3GNRA 1LBLA 4LW7A 1NF7A 3MZNA 2AKZA 2D2GA 2PWFA 2YSWA 1AQMA 3C0QA 1UR4A 5BRPA 1LP6A 3W53A 3EOSA 5FIPA 2CHOA 2W5FA 3H2NA 4QQ3A 3SZ8A 4CN6A 2HK0A 8XIMA 1PCWA 1HJXA 3EA3A 1EJUC 3N9KA 3GR4A 4RDYA 2ZZ5A 3PS7A 4JQ4A 1K7FA 1RY0A 3MZ2A 4KEZA 2YL5A 5I06A 1H4PA 3KTSA 5C6MA 5LIXX 4S3KA 3TOPA 3WQDA 4U2ZA 4G6CA 3U6WA 1A3XA 4IX2A 1W17A 1RZMA 1O95A 1TO3A 5LA1A 2F7FA 3JUGA 1N8IA 4XIMA 1TWDA 4IFKB 5ABFB 2Q8ZA 4UZSA 1VR6A 1C93A 2WHLA 5I02A 1ZS2A 1QWKA 3W3OA 2XN0A 3MHGA 2WCAA 3PK7A 3CAQA 2FHCA 1Y8BA 4Y7EA 3NZGA 3P67A 5HBFA 2YDRA 3EDJA 2UY2A 3TYBA 1DVJA 1HJVA 3A4WA 1R7OA 1LOSA 1UUOA 2PTYA 1B54A 4UQ9A 4UQCA 3F1QA 4AZHA 2A0NA 2J7FA 3R8HA 3A5FA 5IFTA 2ZBTA 2WNQA 4PBEA 1JZ3A 2I16A 1RLCL 3E96A 5FJUA 4K38A 2TSYA 1I75A 5HDRA 4JTFA 1FWDC 1VJIA 1NDZA 4J9JA 2VX5A 3MI3A 4QDWA 1JZ6A 1SFTA 2DP3A 1PVNA 1V7AA 5FF7A 2Y4SA 3VNMA 4XZMX 4H9UA 3VYLA 2D0HA 3O2LA 3LXAA 2WQDA 3PJTA 2WNZA 5HQEA 1HO4A 4IIGA 4MY8A 3IK4A 4UFJA 1TJ0A 2NWSA 1OSEA 4F2TA 3H24A 1TPWA 4UTUA 4IICA 3UPMA 3LPOA 3CQKA 3H4WA 3NCOA 2JQXA 1OFOA 5BOEA 3PANA 3O6DA 1R2RA 1WCGA 2XWDA 3BJSA 2WMIA 1W9XA 2EG6A 2Z4GA 3VCRA 3SADA 4NX0A 2FQIA 1CT5A 4A35A 4DO5A 3NQAA 3JVAA 3M0YA 3P14A 2V5LA 2G4FA 4MUPA 3VE7A 3SCUA 1O12A 1QI3A 2FVKA 5I09A 3H2AA 4C6OA 1UMLA 2PZ0A 3VOJA 4C7GA 4I9JA 3CHEA 4X2PA 4Q4OA 1HVXA 2XSAA 3LTYA 3GHUA 4G5DA 2X0YA 1B3VA 1QI4A 3TTSA 3WDQA 1NY1A 3P6LA 3JS3A 3SCQA 1TMLA 4TVUA 3WDRA 4CEUC 2WLZA 1KCKA 4F3HA 1BYDA 4NJJA 2HCVA 3NGJA 3TLLA 4TTUA 1ZP4A 4JIQA 3M7WA 4KFOA 1TE6A 4MB3A 2ADAA 4IPPA 4O54A 1VIZA 3K46A 3P8IA 5EYWA 1HXJA 3H7RA 4C6MA 3ZLGA 4E38A 4MDPA 4YXGA 3CHFA 1ITXA 4QX4A 3EKGA 5I2UA 1W3IA 2C7FA 1FCQA 3RXZA 2J78A 4LY4A 1QK2A 1RD6A 3OZPA 1HJQA 4PTVA 4H6EA 3I65A 3WH8A 3DG3A 4GI4A 5A95A 3QMRA 2XSBA 1JD9A 4KPLA 2YYTA 2DZXA 5HAOA 1M04A 1FHDA 1AFSA 1I2PA 1ITUA 4CN4A 1TPC1 4CNTA 4Z1CA 1J93A 4HK6A 2R91A 2YDQA 4XZIA 3TA6A 1CCWB 3PNZA 1SMDA 3DOPA 3SCVA 4B5TA 1DWAM 4NU7A 5C55A 4C6BA 2CWNA 1X6UA 1KNWA 2QR6A 2VEMA 3OBKA 3RUBL 4A21A 3DFTA 1LUCA 2GL5A 2OZTA 3SSZA 3VZZA 2C13A 4RDZA 3B9NA 1F74A 3EX6A 2YKKA 2C1HA 1QPKA 1FWJC 3SUSA 2NQ5A 1RCQA 5FL1A 4M51A 1BVWA 1D9EA 1U30A 1W2PA 4UFMA 2ANUA 2OYMA 1R5YA 4JN6A 3SCTA 2ONEA 3RLUA 3WX7A 3BGGA 1LQ0A 4AY1A 1XIJA 3U7BA 4DWSD 4KCVA 2REQA 3LY0A 1TWZA 3CS2A 4GXMA 2VVSA 2WOQA 3RM9A 2KAUC 4WKAA 3WJWA 2W27A 3AICA 1M68A 3QQ0A 4DY1A 4DM1A 2D22A 1E3ZA 1DXEA 1XD0A 1N8FA 3XISA 4V33A 3MUCA 3QV6A 4H8NA 1BGAA 2DY3A 2OQHA 1ZAHA 2J8TA 4D72A 1DQUA 4F0KA 2E9MA 1R8LA 3DI0A 3L4VA 2PLMA 5LYRA 3SN1A 1UD2A 1L6SA 1CLVA 2DT1A 1GZGA 2ZCGA 4P7LA 4PMQA 2Z1SA 2WM0A 2DJLA 1WV2A 3ARUA 5H8UA 1SMAA 1A0CA 1K9FA 5J8LA 2ACRA 1SR9A 4JTEA 2RFGA 3C8NA 8RUCA 3CHDA 2BASA 1ZU8A 4J1OA 1IYXA 3MJYA 2PSNA 3IRDA 3TLQA 4LQ1A 1JCTA 1AJ2A 2QDEA 4D9PA 2IPWA 1UP2A 3TW7A 1WNOA 2D73A 2E0PA 1JQVA 4C6KA 4LBRA 2OWCA 3VMNA 5C0QA 1YDYA 4H41A 3SGGA 2CBJA 3L21A 5LHFA 1F8MA 2HNHA 4D8AA 3E0FA 4JDYA 3UJEA 3M0IA 3L23A 2WVVB 4HHPA 3T40A 2BY0A 2DH2A 5C7VA 1OF8A 2HZGA 4IPIA 1O5XA 3E5BA 4EXBA 3U3HA 3CGTA 5EL1A 1J2BA 3EB2A 4DNMA 1KFBA 1NELA 4KEVA 4GGHA 4MLRA 1Q13A 1HP4A 5B80A 1SW3A 4MGGA 4OE7A 1VBUA 2GJRA 3CTLA 3KZSA 1PB0A 3REQA 1XUZA 2GVJA 4GD0A 4H9XA 4HIBA 2C1GA 4UCFA 1Q8JA 3VIMA 4JTHA 2EBNA 3MI2A 1B57A 1GJUA 3NZ1A 1G1YA 2FB2A 4DBWA 1J0KA 4Y9MA 4ZODA 4XVEA 4ZQCA 4LUYA 7REQA 2QV5A 2DT0A 1EYEA 4FX6M 1H1YA 4PRRA 2HSAA 4J3SA 1FWHC 1OGSA 3BV4A 1RQHA 4A8LA 1PTDA 3S5ZA 3PUGA 3TFCA 4MKSA 3ZS4A 2C14A 4B90A 3FX4A 3MKCA 3EDEA 5K7JA 5A6TC 3NUKA 4H9ZA 3VGBA 1CIUA 3EA2A 5D32A 2PRLA 1MVYA 2CZEA 1SZFA 3DFPA 3N2TA 3ZVHA 2RHGA 4C1KA 4MVAA 4RE0A 1M7JA 4BJHA 1EP2A 4EE9A 3VCNA 1OHLA 4XO7A 4A3UA 3WYZA 3E2SA 4O19A 2DV0A 3RCMA 4O1FA 4PRTA 1LG1A 3G3MA 3A5VA 3VK5A 1R47A 1HJUA 3ARYA 1F9CA 3BICA 1Q4WA 4AD5A 1JULA 1OYCA 4QSHA 1TJPA 5T9BG 4EXQA 2PGFA 2HNEA 4QAIA 4LWWA 3P82A 1EBHA 2WMJA 4PBGA 3SGUA 3WH9A 2ZE3A 2OOFA 3I3BA 2ZX5A 4H4IA 4PCNA 3OLDA 4IMFA 3AXIA 3BK0A 2NVAA 1FWEC 4Z1AA 2CBUA 1I2NA 1UWSA 3HGRA 1YXDA 2DU2A 4RE3A 4UTKA 2ISWA 1A4LA 4CU6A 1GOXA 2PUZA 3BCDA 5TIMA 2PGEA 2OYLA 4MG4A 3IPWA 5M03A 2VP8A 4L80A 4QG9A 1V3HA 4MKNA 1TIWA 2BXYA 1XRFA 3FW6A 5I3FA 2I9EA 2OJPA 2V2CA 3TOYA 2EPHA 1AL8A 2E6FA 4FLQA 4M29A 2KZHA 3W07A 4I5RA 4YL2A 4HMEA 4LY8A 2QCDB 4LNCA 4PTWA 4W7VA 3OA3A 1UQYA 1SR0A 2H8ZA 4UMBA 3CQIA 4GVFA 1AVAA 1XCXA 1ZAIA 4US5D 1GW9A 2W0UA 3H2OA 4EX4A 2VVNA 2OKTA 2QKFA 3Q37A 1XSJA 1Q2RA 4XB3A 3OGSA 4WDXA 3STGA 4XAZA 3A3XA 4XBSA 3S9ZA 3PSVA 3RLHA 4JN7A 2CHNA 1RBAA 3USZA 4UTTA 3UFYA 4O1CA 4DWDA 2Q8XA 2OU4A 5T8GA 3W86A 4JAWA 1HKWA 1KWGA 1A5KC 4CNNA 1UW9A 4YS1A 4FIQA 1FDYA 2FTYA 2XHYA 3W7IA 1MW1A 1B3OA 1FVPA 2E5DA 1GOKA 2W66A 5BXTA 3N6JA 4IUOA 3W1MA 5KITA 1NQ6A 2EJ1A 4C6NA 4M6QA 1ZHAA 4S2BA 3T0BA 2XN2A 1UMYA 1THFD 1FWFC 1TIMA 5DBTA 3E0IA 3U9IA 1Q7ZA 2YL8A 2XU2A 1OVDA 4DPQA 1YTDA 4LU0A 4YVPA 2NT0A 3H2FA 4PB4A 5GJNA 1W1TA 5TD4A 2VOTA 4JFWA 3IIVA 3KOYA 4C7FA 5A6LA 2PZNA 2QMJA 1H49A 3ITOA 1UC4A 3QY6A 2GDVA 2VZUA 3QYSA 3WH5A 1OFEA 3MSRA 2NUYA 5ECUA 1PDYA 3L5LA 4UTIA 1R9ZA 1V6UA 5JMUA 3ZT7A 3S42A 3W25A 3WQPA 3BSHA 4LALA 1GQJA 4IG2A 3EXSA 1EF3A 3T4CA 1ZUAX 3L4UA 3N18A 3O07A 2XH2A 4M56A 1XDLA 3C3UA 1H63A 2GOKA 3BE7A 4OGZA 3W00A 4W84A 3SCNA 3IIPA 2PODA 4OUIA 3BW2A 3GU9A 1S2CA 2VFEA 3NQ2A 4UB9A 3W02A 4E2VA 4ENLA 4TXEA 3UNDA 3V16A 1XQLA 2BG5A 2VC7A 2EPKX 3W7HA 2ZXBA 5D4YA 3SW6A 2J7DA 2QCFA 4RZ6A 1MW0A 3MWAA 4D2JA 4Z1DA 3OP2A 2ZZ6A 4C5ZA 4IMDA 4L6HA 3M0LA 5U4NA 1U1JA 3C56A 2QCHA 4C5YA 1XJBA 5E9XA 2XISA 1UBSA 5H6HA 5IBXA 1J5SA 4PUUA 1W5NA 2FFIA 1TELA 2O9OA 3D6NA 3WO8A 2NXHA 2QYGA 4RNHA 3ENLA 3GX9A 3R0KA 1QUMA 4MDOA 3AJXA 4Z2LA 1VPYA 2YPIA 1E1FA 3E2QA 1X6NA 4HNCA 4R9XA 4S3DA 3CZLA 3NXLA 2YYUA 1W1IE 4PYSA 2DW7A 3BLOA 2I9UA 3FFSA 3WH7A 3IAQA 1Q6QA 4G2DA 2V30A 2W6RA 3CAKA 1CW2A 2PWEA 2PRMA 1QOPA 3E49A 4QAWA 1D8WA 2PEVA 4J3WA 1UB3A 3R5EA 2WO5A 2YXXA 4CD6A 3VPLA 2MNRA 1FWSA 4IPLA 1DIKA 2C1IA 1KA9F 1YYAA 3ZWSA 1CXFA 5M1TA 4W86A 3USBA 1JVNA 2J75A 4JCLA 1U1HA 1QAPA 1YBQB 2DQXA 3TN3A 2XIMA 3SAZA 1XI3A 3W29A 4IIDA 3V3WA 3LOTA 1H7OA 1KKOA 1G94A 2D23A 1GQNA 2J13A 2INFA 2NLYA 5HULA 2UY3A 5AYYA 3C0SA 3V5FA 1E6XM 5E1QA 2GDQA 1HX0A 1YQ2A 5D2WA 4KQNA 3U2CA 2VQTA 3W4RA 4BEQA 3O3RA 2PLKA 3GVQA 3GG8A 1F61A 3IGHX 4ZOBA 5CKSA 4MPKA 2OMAA 2ZWYA 4ATLA 2V5JA 1HL9A 2XFFA 3RRXA 3W2MA 4IF2A 3WLMA 3T8LA 1CXLA 3IAPA 2V3GA 1E55A 2PGWA 3ANVA 2O0TA 1JPHA 4NP7A 3V1PA 1C8XA 1DJXA 2GJPA 3WLQA 3E3HA 3M6DA 3VDCA 1Q63A 3EEGA 1M1BA 1VYRA 2ZX6A 3GH5A 3CWNA 1TCDA 1WE5A 1PV8A 1P7TA 4HHMA 4JXCA 1EDGA 3BMXA 3KE0A 4K1WA 2ISDA 1OEPA 3MVIA 5T9CE 3RX3A 2GK1B 1BKSA 1A5BA 4Y8EA 3PPHA 5FEZA 4ASTA 1XIEA 2NQHA 3BVJA 4BR1A 4C6QA 2BP1A 1JG9A 4TX8A 1OFBA 4K39A 4GJJA 1BPLB 4OJYA 3W76A 1K9DA 5CPMA 3PJWA 5A8QA 3LCLA 3E0LA 1WOBA 3T09A 2QJJA 3MMUA 3CPGA 4W93A 3TSMA 3C8FA 4IX0A 4UQEA 2F9RA 4HP5A 2ZRVA 1LG2A 2PURA 3PR2A 4WKHA 1IT8A 5F2IA 4L1XA 4PN2A 3RRAA 4L9ZA 4KRTA 3QH2A 3FJ4A 3KRBA 4AVFA 4LRSA 5JIWA 1YLVA 3PTQA 1W32A 3I7QA 4UNLA 2Y1HA 3PZGA 1LTDA 5EY5A 2PDLA 2HS8A 5LNUA 3DGRA 5FAJA 1R2SA 2Y88A 1K02A 4ZMGA 1J96A 2P5NA 3OA5A 4JY9A 4TUFA 5C2GA 4BHYA 4O53A 3VIGA 4MFEA 3FIGA 2DSWA 4XO6A 1F7BA 1ZL1A 2C16A 2OX4A 5KZEA 1NJJA 3EWCA 4QITA 1KFCA 4ICMA 4QLLA 4R7WA 3LLFA 3L12A 4TVCA 3GDTA 4MB5A 3A4XA 3WQ4A 3GBEA 1PE1A 4U3CA 4UC5A 2OEJA 4IUGA 2PTWA 1H51A 1I60A 4HD5A 3UR2A 1V77A 1EJRC 3WLTA 1LL7A 1NU5A 3CIWA 3EZ4A 1X1NA 3DX5A 4NJGA 5H2ZA 3BTNA 2QIWA 4TOQA 3H2CA 2XVPA 4F0RA 1CGYA 3NDOA 4GUGA 4LT9A 3IJDA 3BLIA 4B3KA 2OT1A 2RDUA 4GY7A 3SB0A 3IJQA 3U48A 4HYRA 1NSJA 3GTIA 3MHFA 3VKAA 1LWJA 2PMQA 5K3VA 3QLLA 4DQWA 1T40A 2G3MA 1J12A 4RNJA 3AMLA 1E6NA 1R3TA