3LDVA

1.77 angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase from vibrio cholerae o1 biovar eltor str. n16961
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
231
structure length
231
Chain Sequence
b'AMNDPKVIVALDYDNLADALAFVDKIDPSTCRLKVGKEMFTLFGPDFVRELHKRGFSVFLDLKFHDIPNTCSKAVKAAAELGVWMVNVHASGGERMMAASREILEPYGKERPLLIGVTVLTSMESADLQGIGILSAPQDHVLRLATLTKNAGLDGVVCSAQEASLLKQHLGREFKLVTPGIRPAGSEQGDQRRIMTPAQAIASGSDYLVIGRPITQAAHPEVVLEEINSSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title 1.77 Angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase from Vibrio cholerae O1 biovar eltor str. N16961
rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Lyase
total genus 78
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ldvA00
3DFQA 1T8XA 3TK7A 4ZQMA 5EKYA 4JX4A 5LZLA 5G1TA 3OG3A 3BK0A 3CQ0A 1XDLA 3W7JA 3A9IA 3QJAA 3BV4A 1WOAA 3QSRA 4E0CA 4GWEA 1L9WA 3KFTA 1KBJA 4IMDA 1VS1A 5KZMA 3E96A 3UPBA 2VFHA 3JR2A 2C18A 3PSVA 4NNBA 4JD4A 1U5JA 3T40A 5AHLA 1ZAIA 3U2OA 3LHWA 4K38A 2G95A 2NV2A 3WK2A 3QEZA 1VR6A 3QQ0A 3UWZA 2B7PA 4LVDA 4CCDA 2EKCA 1PCKA 1PHWA 2RDTA 1J5TA 3NG3A 5I3FA 1KBIA 2V82A 3G3MA 4WJEA 3B06A 3SIZA 4JDYA 4UNKA 4GFSA 3G8RA 2ZQ0A 3I7QA 4AVFA 3S8HA 3LXAA 4N9DA 3P60A 3Q2DA 3O1NA 3O6CA 2YXGA 3M7WA 1YLVA 5AYXA 4UFMA 1EA0A 1H7PA 1JCNA 2CWNA 2RDWA 5K9XA 1OFDA 5J5DA 5AHIA 1AMKA 3M43A 4UFKA 4MKNA 4O13A 3ZFHA 2V2HA 3BGGA 5EA9A 2R91A 4UTKA 3LOTA 4Z08A 3L66A 1VYRA 3NO5A 4JTFA 1YTDA 1QOQA 1I4NA 1C9DA 1T96A 5CPOA 1M7PA 1S5VA 1I2OA 4LRTA 5ABTA 1WA3A 1XC4A 3S9YA 4PC8A 2XN0A 3M6YA 1TQXA 3OVRA 4FO4A 3G1SA 3MBFA 4UFHA 2QUTA 2JKPA 2WNQA 4ZQPA 1A5BA 3IGSA 4ADSA 3CT7A 3O16A 3ZWSA 3KOFA 5D04C 3MBDA 4Y6GA 2W0UA 4D2JA 5DELA 2YFNA 1LRNA 5FF0A 1WBJA 4O50A 2LLEA 4Z0SA 3P5YA 5LHFA 4CQAA 3GKFA 4CQ9A 4U28A 3W7MA 1Q45A 4JTTA 1KM6A 3MUXA 3BG3A 1QMLA 4Z1DA 1SO4A 3A24A 4AHPA 1DVJA 4QNWA 4MJMA 3DU0A 4G1KA 1JUEA 3W7EA 2V0TA 2PRMA 2YZRA 7TIMA 1GTEA 3W72A 3W1NA 3NDOA 1LLZA 2NX1A 4RK8A 5LNWA 1RV8A 1OVDA 1ZHAA 1JUBA 2ATMA 3QRHA 1A5AA 2FQIA 1O4UA 1LYXA 4LVBA 4ZQRA 3N19B 5LNSA 3PB0A 5EPDA 4UMBA 4QAIA 2A6LA 4QIUA 1BWKA 2X30A 1RPXA 4JXCA 3YPIA 3DZ1A 1L6YA 3B4UA 4PTNA 3F1QA 1RQEA 3IEBA 4UR8A 1S3HA 4POCA 4M6VA 3G8EA 3E12A 3NQ7A 3PVFA 1TTIA 3QW4B 3TNOA 2VENA 3W88A 3TAOA 5DCBA 5F1UA 4AHOA 4LWWA 5IM51 4IPIA 3AJXA 3W84A 1TV8A 3EX4A 3OA3A 4OT7A 4JS3A 4BWLC 2G5WA 2Q8ZA 5FEWA 3N9SA 3NXFA 1TTQA 4K8HA 1DQWA 2J27A 1WAUA 1H61A 3EWWA 4XQ6A 2E5DA 1LORA 3HO8A 2ZZ5A 4FB7A 4ZQCA 1XBYA 4I7VA 4YXGA 1SO3A 5TQLA 1OFRA 1JRCA 4N6FA 1VLWA 1MZHA 1LRQA 3CEPA 1Z48A 2ZRXA 3QSTA 1JRBA 3TSMA 3W1AA 4XBSA 1H50A 4UNLA 2QJIA 4OU1A 2DP3A 1GPWA 1YPFA 2E5CA 2QCLA 3VFLA 2BWGA 3QFEA 3MP3A 1NAL1 3W2NA 3TQ0A 3WJWA 1C8VA 2DZPA 3G0UA 1HFBA 3E9AA 2Q8LA 3TCEA 1W5NA 3DI0A 1RQHA 3DXIA 3RMJA 4LVAA 5AHNA 4H3DA 2ZRWA 4HHPA 1SSDA 4FX8A 3I68A 4FIRA 4IQLA 2BX7A 3G1XA 1LRTA 2QDGA 3TC6A 3GDKA 2ZRYA 1HO4A 1Q6RA 1F76A 4NT0A 4O4VA 1RD5A 4BF9A 4R34A 3BPWA 4O1AA 4JNMA 1EPXA 3F4NA 1UBSA 4OV9A 5I3JA 1VJIA 2GVGA 4X9SA 1HO1A 3CU2A 2WV8A 3GK0A 4OQVA 1ZJIA 2ISWA 1I8JA 4MZ1A 3GNNA 3HBLA 4LTSA 1GYLA 1QPRA 3U8GA 1WYIA 4DPQA 2E6YA 3GLCA 3TIMA 2O7SA 3LB0A 1EWEA 2VFEA 3FLUA 1FXPA 2EPHA 3GDLA 3KRSA 1TREA 1OFBA 5HNRA 5LNUA 1PS9A 3NL5A 2NWRA 4JTEA 4PA8A 3TAKA 1UB3A 3E0IA 1H5YA 3QH2A 2Z6JA 4HKPA 4O12A 1D3HA 2QCFA 2X1UA 2W6RA 3KRZA 3NZ1A 2PRLA 4NX0A 1O5XA 2ZBTA 3LI0A 3TW7A 4L4MA 4Y96A 3GKAA 1ALDA 5CZSA 2CFFA 1SQ7A 4JTKA 1VQTA 3UWUA 5G5IA 3CM4A 2ZZ2A 3MHGA 2X16A 2UV8G 2DJXA 3EWYA 3P62A 2J9YA 1ZNNA 3W7IA 2AQWA 1VGAA 1IXPA 2X1RA 4W9TA 4XBKA 3A5VA 1FBAA 1G4EA 2BSLA 2H3BA 5E93A 3LHZA 2I9EA 1EIXA 1KFCA 1PCWA 1ONRA 4RZ6A 3EB2A 3LX9A 4KKXA 1FDZA 2R8WA 1O94A 3ABSA 1FDYA 4I9AA 1F2JA 1NEYA 4RV8A 3EEGA 3BGJA 3LV6A 1MSSA 1W56A 2B7NA 2NUYA 3W76A 3UZJA 4I7WA 4JTJA 4NX5A 3GAKA 3DHFA 1LBFA 4UTWA 5BW6A 1VZWA 3W83A 4EVZA 1VCVA 1UUOA 4TMCA 2QCMA 2J24A 1KM4A 3L5AA 1PE1A 5L6UA 4O10A 3NM3A 5G2WA 1EX5A 2QCHA 4DO6A 3W2JA 3N2XA 2G96A 4JYFA 1QFEA 1DHPA 1N8FA 2ZTJA 5IBXC 3G1FA 2QAFA 2H3DA 3T55A 1X6UA 5F2MA 3EWBX 4RX0A 4NJJA 3C2RA 1B4EA 4OBTA 1YXCA 2C1HA 3TFCA 5C5YA 1KFKA 2Y70A 1G4PA 2AGKA 3KVKA 4Z1AA 1GTHA 3EXSA 3MMTA 4BI5A 1X8FA 1SW7A 4PL1A 2CLLA 1G67A 1CW2A 2Z2UA 1AW5A 1VH7A 3UXAA 4S1FA 2WKJA 2IQTA 1XL9A 3W7HA 3NQVA 4Q4KA 1FWWA 1LOQA 2NUWA 1OYCA 3HIJA 2NXGA 1SO6A 2E6FA 3SR7A 3WFAA 1KM1A 1LCOA 1C29A 1B9BA 5LNRA 4DXVA 4R7JA 3R2GA 4P61A 1TPWA 2RFGA 3PBWA 5F2LA 4UFJA 1THFD 1FY6A 4K7VA 1XXXA 2RKXA 3ABRA 1RZMA 4EWND 1L2UA 2HS8A 2D73A 4AF0B 3P7YA 3SFKA 2Y89A 4C1KA 4IXXA 4NJGA 1H1YA 4UMCA 4H6KA 4UXDA 1P1XA 3KX6A 2RHGA 5AN7A 3BW2A 2V5BA 2WSYA 2NLIA 4M5PA 3VE7A 1CI1A 1QDSA 3GDRA 4HNUA 4IPJA 4JGDA 1YPIA 4GUJA 4LS2A 3PG9A 5G1YA 3V75A 3L2IA 1TTPA 1JCYA 4MLJA 3S1UA 2QCDA 2W79A 2ZDRA 3W07A 2AAMA 4WUIA 4DEFA 3HG3A 4ZL1A 1R2RA 2E68A 4GRSA 3WJZA 2DJLA 3DFOA 3NQEA 3IGXA 3IVSA 4JY8A 3KVJA 2JKAA 3NQ6A 1XM3A 2VKZG 5F4XA 3PAJA 4LRSA 2VFDA 3JS3A 3W86A 1NVMA 3OVPA 3L21A 2ATSA 4CLMA 3LHYA 1KFJA 3PG8A 3LCFA 3SJ3A 4N9CA 3NL6A 1G4SA 2CLMA 2V81A 3L9CA 5KZDA 3MO7A 1ZY9A 1IIGA 5AC8A 4UTHA 1W54A 4HNVA 1IGSA 1YDOA 3FKKA 3UZ5A 1MO0A 1W5QA 5HR6A 2YFOA 3IGUA 1SUXA 3BARA 4AEOA 4QITA 5LNVA 1MEHA 3I6RA 2QDHA 3ZWTA 2H8ZA 2JGYA 2XN1A 2Y62A 3W1PA 4RZ5A 3TR2A 3FFSA 3W87A 3T7VA 2R94A 2NX9A 1TIMA 3TH6A 3MYPA 3O6DA 4NJKA 4WD0A 4UCGA 2A5HA 2VOMA 3OBKA 3GZ3A 5FF3A 3RK8A 2VC6A 5EBUA 3LRKA 2BXVA 2XN2A 2A1YA 2QCNA 3MP4A 5HWJA 1XKYA 1UASA 3SECA 3PS7A 5HJLA 3KRUA 3P80A 1LTDA 3LHVA 1VHCA 3CLMA 5K9DA 1YTEA 5D30A 2GUUA 1HUVA 4N02A 4FNQA 3TW6A 3O07A 3P8IA 3F03K 2C16A 2FB2A 2OCZA 3FYPA 2E6AA 3OHIA 4PEKA 4JX5A 2J6XA 4NNAA 4K39A 3H54A 1OABA 3TSDA 3DFTA 4R33A 4GUFA 4KWVA 1G7VA 1RVGA 2TMDA 3G1YA 1F6PA 4ORMA 3UNDA 3M5XA 1VLIA 5HQEA 3G1HA 4O1CA 3B8DA 1I2PA 1LM1A 2ZZ7A 3M9YA 2P0OA 4UFLA 2WSQA 4TR9A 3CB8A 4U4MA 5DY3A 2CZEA 4NZJA 2Y85A 3CHVA 1QNVA 5MHBA 1TPFA 4RZ4A 3IIOA 3C3NA 1R30A 2I1OA 5HWNA 2CZFA 1TCDA 3NEVA 3T78A 5U7SA 4DF0A 4Q32A 4YCPA 3G1VA 3W7QA 1LOSA 4O15A 3C2OA 3G24A 1Z42A 3M41A 2HSAA 5FI8A 3O6YX 4ZQOA 4O0ZA 4O18A 3B0UX 3QMTA 3LM7A 1MEIA 5AYZA 3M5YA 5F2GA 1AL7A 4IMEA 4NU7A 1PHQA 4OGZA 1SO5A 1B57A 3AO0A 3LBMA 4QM1A 2GQ8A 1JVNA 3UY8A 2YW3A 4UMAA 3PSWA 4R53A 3CIWA 1W37A 2YPIA 4DBEA 5D2YA 3GYEA 3S5NA 1KV5A 5AHEA 3THAA 4K8EA 4A21A 5DN1A 1IF2A 3WK0A 3U6WA 2DU2A 4MLRA 5I3IA 5A8GA 3CTLA 2JGQA 2ZTKA 1H7RA 4GBUA 3OEXA 2ZCGA 2EF9A 2QKFA 4LC8A 1B3OA 4FNTA 1VCFA 2CLFA 1G6CA 1FWRA 2GVLA 3QQ1A 4IMCA 1PIIA 2ZZ6A 3NM1A 5KTLA 4FHAA 2ZRVA 1GJPA 2QEZA 3WK3A 5AC6A 4DO4A 1L6WA 2GPTA 3D0CA 4FIQA 1O60A 3NZRA 3MHFA 2J9ZA 2QCGA 3PBUA 1EP2A 4DF2A 1V7YA 5D2XA 3A22A 2ISVA 3VNDA 3A23A 3NR0A 1JCMP 2H8XA 4XWUA 2CLOA 1P0NA 1TO3A 2Y7DA 4NUWA 4BI6A 3FS2A 3P81A 3B0VC 3O8AA 1FWNA 3MI2A 4UIOA 3GX9A 1H7OA 2CZ5A 3TSBA 3E49A 3UYCA 4UTTA 1W3NA 4ZMGA 1Z44A 2I14A 3OVQA 2V2DA 1W3IA 3DFSA 4ZVJA 1W3TA 4JTLA 3W22A 3W1QA 3PULA 1XDMA 1M6JA 4CCCA 4WX2A 3CC1A 3EKZA 3BLIA 1AL8A 3IVTA 2FPYA 5C55A 3VI2A 4TIMA 5K2ZA 4O1DA 5F4SA 3EX3A 2ZRUA 4JTGA 4M6QA 1Q6OA 1VCGA 3NQDA 1OFEA 1ZAJA 3QMRA 4JYDA 5F1VA 3N9RA 1YDVA 4JIQA 1LBMA 1DOSA 2NXIA 3C2FA 4Q33A 4UFIA 3I65A 1UUMA 4E2BA 3M0ZA 3LRLA 1W8SA 4O19A 3PF3A 4NQ1A 1LZOA 1ZCOA 3LGEA 3EKLA 1SPQA 2ZRZA 2YYTA 1MEWA 1DQXA 4FXRA 3KAOA 1H62A 3O15A 3R5EA 4LS0A 1LDCA 3SW6A 3LTPA 3I7SA 3MW7A 3O05A 5EYWA 1ZAHA 1TRIA 3HGOA 4AHQA 1EB3A 3HF3A 4ONVA 2PE4A 3DGRA 1F6KA 1K7FA 1W5PA 3ANYA 4L4LA 3QF0A 2O7QA 5HUOA 1KTCA 2E6DA 4LU0A 1SU5A 1Q6LA 1WOBA 2X1SA 1K02A 1JUKA 2PRHA 5HWMA 3P74A 3GR7A 3UWQA 4DF1A 4QISA 2Y7FA 1K7EA 5D2TA 4GC4A 1AK5A 1X1OA 1QPQA 5HULA 1TPUA 4K36A 1GZGA 5K7JA 1SW0A 4LY8A 3W7NA 3NL3A 1F05A 3STGA 2NWSA 3LBCA 1GWJA 3S5YA 4DPPA 2R14A 1YYAA 3NNTA 2Y7EA 1WX0A 1ZENA 2B7OA 1FWTA 2FPTA 4LVFA 1FDJA 3Q94A 5E0KA 3LTSA 2WSRA 2YDAA 1DJQA 3HG5A 1OX6A 1SFLA 5D32A 4AWSA 3NQGA 5CPNA 1M5WA 4KFPA 1IXNA 3S5OA 5AHFA 3TX9A 1XUZA 3NPUA 1T99A 3NQAA 1KA9F 4PL2A 3UD6A 2GVJA 3ZS4A 1P0KA 1EUNA 2QAPA 1W31A 3M5VA 1ICQA 3LCIA 3LCGA 5I3HA 3UWYA 1KM5A 1VHNA 3SGZA 3PC0A 5CG7A 3TV8A 1BKSA 2F84A 4EF9A 5G2HA 1OF8A 2BZNA 1K8ZA 1I2NA 1D9EA 4O14A 3C4UA 3NQFA 4LT9A 4AWTA 4E2DA 1DV7A 1ZALA 2TYSA 1OK4A 3W7KA 5CSSA 5L9FA 1H63A 1QR7A 2H6RA 3LI1A 3QYQA 2X1TA 5DBTA 4ADUA 2C6QA 3R8RA 3DKLA 2VELA 4LOCA 4N4QA 3RF9A 3Q37A 2EAWA 5FF7A 5U4NA 3LXCA 2E09A 3TXVA 2JK2A 1GYNA 4A22A 3IIZA 3GDMA 4GUGA 3L0NA 1MXSA 5IBXA 3HB9A 2NV1A 1JR1A 1IXQA 2YW4A 3MI6A 1G7UA 3MWAA 1WBHA 1WXJA 3P8JA 1O5KA 3RU6A 3UWVA 4UC5A 5GVJA 1KLYA 4K6AA 3PUOA 5EMUA 4O54A 4MYXA 3W85A 3R13A 3S1WA 2KZHA 3MYOA 4IGHA 3DI1A 1RQBA 4EIVA 4MIMA 3GNDA 3GXTA 1KV8A 4NXKA 2DZUA 3I7RA 3UWWA 1TJPA 2FIQA 3NQ8A 3OIXA 1N7KA 4ZQNA 2C15A 4NNCA 1VPXA 3PY2A 1X1ZA 2B4GA 4MY1A 3GVGA 1AG1O 5D09A 5FF4A 4TMBA 5FF2A 4JX6A 5G2IA 4TO8A 4I7UA 3UXDA 1KFEA 1W5OA 3N73A 2Q3RA 1ICPA 4XKYB 3T44A 5BMWA 1O95A 5AHMA 3LCXA 1YXYA 2F7FA 4XTDA 3DFPA 4AMAA 4YCOA 4Y90A 4LUJA 4JICA 2YSWA 2V5LA 4O16A 5DLCA 4A29A 1XCFA 4JIPA 1SZNA 4HNTA 2WNZA 3DKJA 2G97A 1ZFJA 1TB3A 2NZLA 3C8FA 5DCEA 3GAYA 1B4KA 3SZ8A 4RXFA 1FQ0A 1KW1A 1KLZA 2QF7A 3W7DA 3KHJA 2XFWA 3PBYA 4CQ8A 1F5ZA 5BOOA 5CZTA 4WY0B 4PODA 3RLUA 1JQXA 2ZZ4A 3LRMA 3S1VA 1K03A 4AF0A 5FESA 5KZEA 1EWDA 3ABQA 3W2UA 1OHLA 5LHEA 3TDFA 1JULA 4LUIA 1KFLA 2DZXA 1I45A 1EUAA 2V2CA 2CLKA 5F2IA 2C13A 3TQVA 2EGZA 4O11A 3LCHA 4YLWA 1LBLA 2J88A 4WXYA 3SY5A 1S5WA 1KFBA 2EHHA 3M44A 8TIMA 2ALDA 3HPSA 3LXBA 2J9XA 3M5ZA 1H7NA 2JKEA 4A2SA 3DBPA 3GB6A 2P10A 4UTMA 3TA6A 4NZFA 3W7PA 1LOLA 5D02A 3EXRA 1JQVA 3P82A 3NQMA 1JJKA 4QQ3A 3F4WA 3B05A 1QOPA 4OE7A 2ZZ1A 2WNNA 2FFCA 1GT8A 1K8YA 5LGZA 4PH6A 3SGUA 1K8XA 1V5XA 2P1FA 3O06A 4HSNA 3W9ZA 3HG4A 1AW2A 4XTIA 4JEQA 5I3GA 2A2IA 3W2KA 4N9EA 3W1LA 3FEMA 3TMQA 1S5TA 2VEIA 5D33A 3NPVA 2NX3A 3STCA 3CIXA 4HN4A 1OYAA 3QM3A 2GQAA 1GVQA 4AB4A 1ADOA 2C19A 3HMJG 1XBXA 3KVMA 4XZ9A 5DCDA 1HTIA 4IUOA 5K4XA 4LW7A 3BW3A 3A5FA 2OZ0A 4LV4A 5KINA 1M7OA 2B0MA 4CNOA 1QPOA 4JTSA 1DJNA 1DBTA 1QCWA 5AOUA 1TPB1 4A2RA 1LP6A 3WJXA 3S5ZA 4MUZA 4HNNA 1P4CA 1SZEA 1FX6A 5KMYA 5KITA 3PM6A 3WJYA 5C6MA 3P84A 1R47A 4ALDA 4AAJA 4DELA 1T0OA 1ME7A 2BLEA 2YYUA 3V1PA 4OV4A 5G4EA 3CWOX 2QR6A 3VCRA 1SZGA 1OG0A 5AB3A 3TQKA 2Y88A 4WOQA 1AW1A 4LV9A 4E38A 3P5ZA 2Q3OA 1KTBA 4Y8FA 3C0JA 3BLEA 3FOKA 1OK6A 3M1ZA 4M7SA 4C1LA 3TE9A 1TPVA 3QMSA 2RH9A 1TV5A 3B0PA 1G69A 3C61A 4JDBA 1XBZA 2V30A 2YGYA 3CEUA 2FJKA 2DORA 4Z0JA 1A5CA 1QO5A 4JTUA 4AH7A 4O28A 3W7LA 3QPZA 2VFIA 2Y6ZA 3JRKA 3HG2A 1ICSA 2Z0IA 1FCBA 4GXMA 4PFMA 2QUVA 3KVLA 3NL2A 3P61A 4ZZ9A 4ICNA 5CGQA 1VYPX 3IV3A 4IOTA 2DZTA 2E1DA 1GQNA 1NFBA 5HINA 4FEZA 4OHQA 1XUUA 4RKAA 2DZVA 1GVRA 1GVFA 4MOZA 4JY9A 3BVJA 1E51A 1JCXA 1DKWA 1UJPA 3THQA 4RR4A 1NF0A 3H55A 3N14A 3W23A 2OJPA 3HPZA 2GJNA 3S6DA 2Y63A 3BW4A 4ML9A 3NYZA 5DBUA 4O1BA 3FJLA 1QAPA 2JBMA 4NJIA 2PURA 1YTKA 4O4WA 4BWLA 3DENA 2VXNA 2VEMA 1VRDA 3EX2A 4KFNA 2VEPA 5E1QA 3RLVA 1FWSA 4QNEA 3G1DA 3FIGA 4MFDA 3B04A 3W1UA 5D37A 3NQCA 3UPWA 1DL3A 5D05A 5EY5A 3S1XA 2A7NA 2VEKA 1X7FA 4KWWA 4FX6M 4JR5A 4MY9A 3W7OA 2WPBA 5FEPA 4M6PA 4DQWA 3PUDA 3E02A 3G1AA 3LLDA 3STEA 2BTMA 3ATZA 3LLFA 2PCQA 4XUGA 2WQPA 4MPQA 3W7CA 1OFQA 3W7RA 3LHTA 4KFOA 2GQ9A 4UR7A 3MJYA 3VE9A 4B5NA 4O17A 2HTMA 4M19A 3KXQA 3W73A 2A4AA 3W2MA 5TIMA 2Z6IA 1QPNA 1YDNA 3N3MA 4NXSA 2QJHA 4MJZA 1R46A 1Q6QA 5BRBA 3LDVA 2A7PA 2FLIA 4RXGA 1K7XA 4MZ8A 1WDWA 3HPXA 3DFNA 4GNJA 1KM3A 2FTPA 2Y61A 3SI9A 3N2MA 1YXDA 4BFAA 5DXYA 4MYAA 5LSMA 4QSHA 3TFXA 3L5MA 2CLIA 4UTLA 3L0GA 2V9DA 3G18A 4TU1A 1TPC1 1GG1A 5BMXA 1W5MA 1FCQA 3TC7A 4IMFA 2A7RA 1N55A 1R2TA 4S2BA 5HR7A 1J2WA 3GXPA 4X22A 3W74A 2DZWA 4H4IA 5FEZA 4BK9A 3TJLA 1KTNA 3G0SA 2C0AA 1Q3NA 2ZA1A 2QJGA 4LNYA 2OX1A 3W2LA 1SW3A 4IMGA 1OJXA 2NUXA 3C56A 3P67A 4UTJA 4UTTC 1IIHA 1SR9A 2FB3A 1VC4A 2YCEA 5AFDA 3FA5A 3ZR4A 1LLWA 4K37A 4RCXA 4O8RA 5F4WA 1BTMA 4FF7A 2NXHA 2ZYFA 4ADTA 4ORIA 1L6SA 3UQNA 3HGSA 4IX0A 4Z1BA 1Y0EA 3Q58A 2YX0A 1D3GA 1PVNA 4JN6A 3IIXA 3TUUA 4DO5A 1SZFA 2HS6A 4HPXA 3BLFA 1P5BA 4N6EA 3WJSA 1PL9A 3NPXA 5SWUA 4WY0F 3C2VA 2Z1BA 1NF7A 1A5SA 3HQ1A 3IIPA 3FJ6A 4RJEA 4WQ6A 4PCFA 3TJXA 1J4EA 3NVTA 4MZYA 2RDUA 4UUIA 3LTYA 2ZFAA 3NA8A 1TTJA 1VYSX 3R89A 2HMCA 4J9JA 1XBVA 3FKRA 4IJBA 4JTIA 1A50A 4FNUA 2FDSA 4M7TA 4TX9A 1GVSA 1FUYA 3BG5A 3MI3A 1FCVA 1TPH1 3EWUA 3DH7A 1GVOA 1EEPA 3RNDA 4P2VA 4WZHA 4GJ1A 4HSOA 4N4PA 4NVTA 3B03A 4K7YA 2WOQA 3INPA 4EOUA 5J5RA 1U83A 6TIMA 5BNKA 3GDTA 3GIYA 3L5LA 3PWAA 3EXTA 1G4TA 4AWUA 3PR2A 5CZJA 3IVUA 4BR1A 2OT0A 1LROA 1QWGA 4FNPA 3TU9A 4QJ1A 2OMAA 1F7BA 4O0KA 4MFEA 2B7QA 4HT3A 4A3UA 3TROA 2VFFA 1UCWA 5AYYA 4CCEA 3EWZA 1OFAA 1WV2A 3IIVA 1TPDA 5K9CA 3W71A 2ZA3A 3HJZA 1W1ZA 2DZSA 1K3UA 1WQ5A 3HGRA 5CPMA 5DXXA 2VFGA 3UY7A 3HGJA 1SSGA 2ABBA 3ABOA 3FYOA 2ZA2A 2CZDA 3EX1A 3MP5A 1I2QA 3VKJA 4YL2A 3NPWA 1TV7A 5C54A 4FNSA 2GOUA 3PUEA 5TBOA 1A53A 4MVAA 1OFOA 4DBDA 5CKSA 5K3VA 3W75A 4FX7A 1XFBA 2A0NA 3W1XA 1FCUA 3W1TA 1H7XA 3NQ2A 3W7GA 3R12A 2TSYA 3L65A 4N9BA 4X2RA 3H53A 3C2EA 2PC4A 1HG3A 3M47A 1H7WA 4WOZA 4Y9AA 4EF8A 2CLHA 1TJRA 3L0KA 4GUHA 1GOXA 3PBVA 4O57A 3LCWA 1JCLA 4FNRA 5AC7A 1CX9A 2OT1A 2ISSA 3LHUA 5FEXA 1SFJA 5LGXA 4NJHA 5HUPA 3W1MA 4FXSA 1TMHA 5HMSA 1KM0A 1NSJA 3NAVA 5T26A 5K4ZA 1Z41A 3G3DA 3K30A 4UTWC 3QPYA 3CWNA 3QZEA 4RLIA 6ALDA 3SSJA 3ELFA 3L68A 1TPEA 5CZ0A 4UTUA 5EL1A 4O53A 3M16A 4LVGA 2C14A 5D2VA 3S0CA 3NOEA 3USBA 1QO2A 3PB2A 3S42A 4CNNA 4HIBA 2CU0A 4X3ZA 5D2WA 5CPLA 2QUUA 3BG9A 1GEQA 3WK1A 4OWGA 1OX4B 5DY2A 2WJZA 4YWIA 4XKYA 5C2XA 3T4CA 4UTIA 3QC3A 3W6YA 5D38A 3QW3A 1TSIA 4S2CA 4WXZA 2ABAA 2H90A 3ATYA 4BI7A 5KSWA 3RFAA 2C3ZA 5G4WA 5LKYA 1OYBA 1H60A 1BWLA 3STFA 2WO5A 1DORA 1H1ZA 2TPSA 1JCJA 2GJLA 4N2YA 1ME9A 1EP1A 1OX4A 3LCLA 5H2ZA 2V8ZA 4IXHA 4CNPA 3G22A 4YMZA 1TQJA 2QCDB 1ME8A 4MY8A 3G0XA 4AXKA 4JYEA 5I3KA 1XI3A 2E5BA 2FPVA 3W70A 4HPJA 1KM2A 2CW6A 4WY0A 3MHUA 2X2GA 3A21A 1IXOA 1TRDA 4Z1CA 1OF6A 1OFPA 2A6NA 4JTHA 3TKFA 1ML1A 2A85A 3TMLA 3NGJA 2TRSA 3C6CA 3GXNA 3C52A 1EP3A 5CSRA 1HL2A 4IWWA 1BEUA 2QCEA 3N34A 1TYGA 1PV8A 3DAQA 4GUIA 1FXQA 3DHDA 5H91A 3GR8A 1RR2A 1F74A 2CLEA 2QCCA 4O52A 3TXZA 3LERA 1H51A 5D03A 2A21A 3L67A 3O63A 3HOJA 1OX5A 2E77A 4LS1A 3W1RA 3W3OA 3CPRA 1W0MA 3EWXA 1F73A 1GG0A 4GE8A 5A5WA 1YADA 2ZZ3A 3IRDA 1R2SA 3BO9A 3EX6A 3LV5A 2Y7GA 1I2RA 4IX2A 2YR1A 4LC6A
chains in the Genus database with same CATH superfamily
3DFQA 4QEHA 4JX4A 1I1XA 2HPMA 3OJGA 3OG3A 2WMIA 3QJAA 4E0CA 4GWEA 3AIVA 3ANVA 1H5VA 5KZMA 2PBOA 3UPBA 3V35A 4WSKA 2C18A 4JD4A 1U5JA 5AHLA 1AH0A 2PWDA 4K38A 1VR6A 1QI2A 2Y0FA 5FJUA 3NG3A 4RE0A 3MDWA 4GVHA 2V82A 1UH3A 3VUSA 4WJEA 1QNQA 3G8RA 2ZQ0A 4D6GA 1D7FA 4MWAD 3DIPA 4P7OA 3Q2DA 2EQDA 3M7WA 1YHTA 3E0LA 2J7BA 4L4PA 3GNXA 4H8NA 4V33A 5K9XA 5J5DA 3THUA 4MTVA 3M64A 3M43A 1E4NA 4UQ9A 1XIJA 3BGGA 2R91A 2WZIA 3U7VA 4ATDA 3AROA 1XPYA 4QJ4B 3WLTA 1MW3A 1R7OA 3H21A 1QOQA 1I4NA 1C9DA 4HHHA 1M7PA 1S5VA 1WA3A 4F0MA 1FH7A 1XC4A 3MVTA 5A1AA 2XN0A 2HZGA 2FZ8A 4NYUA 4FO4A 3G1SA 1E1FA 3CUFA 2JKPA 1A5BA 4ADSA 1WP6A 3CT7A 3O16A 3ZWSA 3LSCA 1UMYA 4TXEA 1WBJA 1WB0A 3WQFA 4ERAA 3P5YA 4GVFA 2GGGA 3IJ7A 3MUXA 4C5ZA 1QMLA 3A24A 4JTQA 1DVJA 2CETA 1EJUC 1YNQA 4L65A 3VMPA 1VIWA 2ZX9A 4AMCA 3KBSA 2X7WA 1ZHAA 3PAOA 3QRHA 1Y7VA 3QLDA 3PZTA 3N19B 5HPCA 1TIWA 4MNLA 1CXEA 4UMBA 2TODA 1BWKA 3PZVA 2X30A 1RPXA 4CQCA 1IWPA 4P8VA 3F1QA 1RQEA 1IGWA 3V0TA 2OGJA 3TYCA 1BSIA 3GVQA 5A6MA 3H2AA 1TTIA 3TNOA 5M1TA 3W88A 1GKQA 7XIMA 5F1UA 4AHOA 2HVNA 1XINA 1J0YA 1QNRA 3EX4A 3A12A 4JS3A 4BWLC 1JZ8A 1W9VA 3GSMA 3GZAA 1XDJA 1WAUA 4MWAE 3ES7A 3HO8A 1XBYA 2G50A 4I7VA 1SO3A 1OFRA 2PDFA 3MDUA 3VGEA 4TVDA 3WH7A 2X0YA 2O9OA 3KEHA 1U22A 1H50A 2QJIA 1GPWA 2XH4A 3BSHA 2XFYA 2XVKA 3DYPA 2Z4GA 1R86A 1C8VA 2DZPA 4L1XA 4HU8A 4KESA 2G41A 2Q8LA 1F4AA 3HPAA 1BGGA 3R7MA 4H9ZA 1W5NA 3DI0A 1NWUA 3TOYA 4QG9A 1F61A 3QN3A 3T0BA 4IQDA 3BCJA 5AHNA 4A05A 4MG4A 3I68A 3GU1A 2OYMA 1LRTA 4QXIA 2ZRYA 1Q6RA 5RUBA 3VIJA 1F76A 4FR1A 4O4VA 2J66A 4BF9A 2IPGA 3BSMA 5D9MA 1FWIC 5CC3A 2OLAA 4DAFA 4A3QA 1QNOA 3DN5A 4AD3A 5MF5A 3QGKC 3CU2A 4YTSA 2WV8A 3GK0A 5FJOA 4OQVA 2ISWA 3CLWA 3GNNA 3R94A 3HBLA 4IGNA 1GYLA 2BXYA 1S2TA 4D71A 3DGBA 3ITVA 4ROPA 3VDCA 3CMJA 2VZSA 1FXPA 1OBAA 1UWRA 5FJRA 3ZSTA 1QASA 4KPLA 1HKMA 4PA8A 1DQUA 2XVNA 1EOMA 1UB3A 1TZ7A 1XH1A 1H5YA 4HKPA 2X1UA 4CN4A 3L4YA 1YBQB 4NX0A 5D9PA 3LI0A 3TW7A 1AJ2A 1T8QA 3ZJ7A 1SQ7A 1KR1A 3TP4A 1DJHA 3UWUA 2FKPA 2UV8G 3UJEA 2J9YA 1ZNNA 3AJ7A 2AQWA 1VGAA 2X1RA 3CNYA 4XBKA 2I5QA 1FBAA 2H3BA 5E93A 2I9EA 1KFCA 1T6MA 1ONRA 5G1MA 4S3BA 3EB2A 4KKXA 3AIEA 2R8WA 1O94A 2ICSA 1NEYA 3EEGA 3N3TA 3BGJA 2XH7A 3TLLA 3U57A 1ZUAX 2CWXA 4S3DA 4L56A 4JTJA 4FAMA 1MQRA 2XDFA 1MMFA 2EBNA 3W83A 4F0LA 3TVAA 1UUOA 2ZOXA 3P14A 4C5YA 4TMCA 2QCMA 5JVLA 1XV8A 3N12A 4O10A 1PYMA 4ZB0A 1EX5A 1V6UA 4RNJA 1YW1A 3N2XA 4FOJA 1JXJA 1DHPA 3XISA 2P88A 4C7FA 3TYDA 4WKAA 4B5TA 1R3SA 4U5IA 3ZOAA 4NJJA 3KM8A 3C2RA 1B3YA 3TFCA 1JF5A 4DYJA 2AGKA 3EXSA 1F4HA 2ZXAA 4E3VA 3E6EA 3K4DA 5JQ9A 4S1FA 2IQTA 3W7HA 3S9ZA 3NQVA 3WLNA 2YL9A 2E6FA 2WMJA 1ZB5A 1B9BA 5LNRA 7ENLA 4R7JA 3GW3A 4XX6A 2BNJA 2RFGA 1JCTA 4EP8C 1YQ2A 1THFD 4JNYA 3M0KA 1J8VA 4H6QA 3JZEA 4ICCX 4KW2A 1QBAA 4F66A 3WMCA 2HS8A 3ZJKA 5TF0A 2D73A 3SFKA 4CQDA 3OGVA 2NQJA 4IFOA 4H6KA 3KX6A 5AN7A 2EJAA 3BW2A 3FVDA 4MDPA 3VE7A 1S38A 1ZZMA 1CI1A 2FGBA 1UWUA 4FF5A 3SN1A 3H2NA 4HNUA 2AMGA 1X7IA 4GY7A 5FIPA 3L2IA 1TTPA 4W86A 1CB7B 1JCYA 1UC5A 4LYKA 2QCDA 4ZXOA 4X0VA 3LENA 5BWFA 2AAMA 2AL1A 1S5MA 1P6BA 3WJZA 2DJLA 3BOLA 3DFOA 1XM3A 5MKGB 1AA1B 3ZVHA 2ZC8A 5FOOA 1UR4A 3W86A 1NJJA 2DW7A 2JF6A 3LCFA 4B5SA 5IDZA 3SJ3A 4NZ3A 4IGMA 3T8LA 3MTWA 3L9CA 1EBGA 3WYZA 1V03A 1W54A 2GDVA 2XIIA 1R3YA 2WKGA 1MO0A 1MUWA 4PMOA 5HR6A 1E0TA 4AG0A 5A2BA 1W32A 3PBMA 4AEOA 1OQFA 5LNVA 3MC5A 4Q6XA 5I5RA 1XRVA 2QDHA 4KIEA 2BY0A 3W1PA 2WYSA 4RZ5A 3E1F1 3TR2A 3FFSA 2J7GA 1UUQA 3MYPA 3VM7A 4NJKA 3VA8A 3FSUA 1P0EA 4BHYA 1XLIA 2VT0A 3GH4A 7CGTA 1CT5A 3G2GA 1CXKA 2BY3A 9CGTA 5EBUA 3T42A 3V1HA 4JBRA 1XIBA 2QW5A 3PS7A 4H9MA 1X1NA 3P80A 1A5MC 4NF7A 3GH7A 1YTEA 3K5XA 4P8WA 4N02A 3TW6A 4JFVA 3VOHA 2PGRA 5BOFA 4HNCA 2DFAA 2E6AA 2NT1A 3UJSA 2DQWA 1DWJM 3EDJA 2PD9A 4XVEA 3SUVA 3M5XA 1VLIA 2BBFA 4DUWA 3NEHA 4O1CA 3MWCA 1WKYA 2XH2A 1HQTA 1MXGA 4XD5A 3TZFA 5A6BA 3ARUA 2ZZ7A 4ZO7A 2PC8A 4C6MA 4UFLA 4JOMA 3ZXWA 1BRLB 2BY2A 1BQGA 2VWSA 2Y85A 4J7RA 1QI3A 3B8VA 1XD1A 3CHVA 4LCRA 1R3VA 1XRFA 1CDGA 1TPFA 1R30A 3LQGA 5U7SA 4MHBA 3W7QA 3E2QA 2D0HA 2PCEA 5J04A 3KOZA 3V0UA 4D6HA 5EFDA 2WAGA 4C6LA 4O0ZA 3GVVA 3B0UX 4A8LA 3M5YA 4OGZA 1FVPA 3UY8A 4UMAA 4DWSC 3SN4A 1W1VA 4M82A 4GISA 2YPIA 4DBEA 4O1EA 1KV5A 3CYJA 3OYXA 3ZQ9A 5BXTA 3WK0A 3U6WA 2DU2A 1MFVA 1OY0A 2E8ZA 5A8GA 4ACYA 3WQDA 3GC5A 4IP4A 4HPGA 4IIHA 2ZTKA 5TAOA 1H7RA 1H49A 1JDFA 1PDZA 1JGMA 2R6OA 3RRAA 2ZCGA 3A64A 1G6CA 3NM1A 1R9YA 4YTTA 3L12A 4IFKA 3C3UA 4JQAA 1GJPA 3QR3A 3OZYA 1U33A 1L6WA 5HANA 3VGDA 1O60A 2J9ZA 3REQB 3HFTA 2QCGA 2D3NA 1EP2A 4GGHA 1MWOA 2XHYA 3GQYA 4GI4A 3UVAA 4I3GA 2XVLA 2WSKA 4XWUA 4YIWA 4X61A 2Y7DA 3SGGA 1I75A 1MQQA 4CVWA 3MI2A 4UIOA 4XAGA 1H7OA 3ECQA 2CZ5A 1Z44A 1BG4A 3DFSA 2QT3A 3II1A 4ZVJA 3W22A 3JU2A 1J01A 1M6JA 1XDMA 2J47A 4AD4A 5C55A 3VI2A 3OTRA 5A8QA 5F4SA 1BXCA 2D2JA 4AD2A 3AICA 1ZCCA 5I06A 2ZRUA 2WZTA 4EE9A 4JYDA 4JIQA 1C91A 1EQPA 3GHSA 2XIQA 4Q33A 3CMGA 3PF3A 1LZOA 3NDYA 1SMDA 2OLSA 2YYTA 1MEWA 1ADSA 4DNMA 3KAOA 1VFLA 3AUJA 2NQHA 3O15A 4B5WA 3F4VA 3R8HA 3MW7A 4MADA 4RE3A 1D7KA 1ZAHA 2DT0A 2XSXA 5CBJA 4GG9A 4ONVA 2HISA 3C8NA 4L4LA 3MV11 3MMDA 3PPFA 3A4WA 2VEFA 4JQ1A 1J10A 3P74A 1IE7C 4BF5A 4PBGA 4DF1A 4QISA 1QU4A 5D2TA 1AK5A 1X6NA 4H7VA 4DYEA 4LY8A 3U5UA 1F05A 1JNEA 3S5YA 3NURA 2R14A 3NSXA 3NNTA 2WJDA 1WX0A 2B7OA 2FPTA 4AD5A 1KBLA 3AS0A 5E0KA 5AYIA 1SVDA 1SFLA 4LAZA 3NQGA 3S2LA 1M5WA 4I5UA 5PTDA 1XSKA 3ZS4A 1NU5A 1EUNA 2QAPA 3GNOA 1W31A 2HBXA 3M5VA 4IL0A 2J7EA 1MNSA 1UA3A 3UXKA 2HBVA 1KM5A 2OOFA 3PC0A 5CG0A 5G2HA 1XF0A 2JQXA 4S3AA 3L4ZA 4Z2LA 4QLLA 1ZALA 1ITCA 5LA1A 3TN5A 3ITLA 3TWAA 4U5KA 3QYQA 2X1TA 5DBTA 4DZIA 2C6QA 5JXQA 2VELA 3TC3A 4D8AA 3Q37A 1JI2A 3WG6A 5U4NA 4E8CA 3LD5A 1Q63A 1RA5A 2CITA 1E6SM 3E2SA 3VXGA 3VZZA 2EPKX 4HZ7A 5FL0A 1PDYA 3IIZA 4PCTA 4NRSA 1RJRA 1WDRA 1MXSA 5IBXA 3HB9A 3LGGA 1GHRA 3OG2A 4GYFA 2YW4A 1OC7A 3MWAA 3KOWA 4EWJA 3BJSA 1UD4A 2VUYA 3RU6A 2G8ZA 3MB9A 4KEVA 3UWVA 4UC5A 4W93A 5BU6A 4B3LA 5REQB 4K6AA 3V5CA 3UR7A 2V3FA 3HV9A 3KTXA 4UB9A 4MYXA 3W85A 1OG6A 3A9BA 5IFPA 1I6NA 1RQBA 1LQAA 1FH8A 2ACSA 2EG8A 4NXKA 2D23A 3I7RA 1KQYA 3BLOA 3RIKA 4ZOBA 4ZQNA 4PMRA 5CPTA 4WDXA 1X1ZA 2HE8A 3PJXA 3GVGA 2DY3A 4Q4SA 1EQCA 2V3GA 4TO8A 4IICA 5F7UA 3N73A 3CPUA 3GXIA 2Q3RA 4XKYB 3T44A 3WLLA 4HK6A 5AHMA 2J62A 2ZIDA 3H22A 4D1IA 1POJA 3PZMA 1Q6CA 4EPDC 2PDHA 5C71A 3MT1A 2WVTA 4A29A 1SZNA 2VM8A 1ZFJA 1TB3A 5DCEA 3TYAA 1GNXA 1J2BA 1GYMA 1B4KA 3EA2A 3SZ8A 2NT0A 3QR0A 1XJBA 1KW1A 4YVXA 1B90A 4Y9NA 1L0PA 3W7DA 1IZCA 3XINA 3VDHA 4QSFA 3GUWA 3RLUA 2I5GA 2PTZA 4H7CA 4AF0A 3ABQA 3N13A 1JULA 1RH9A 3AAMA 1G9HA 1ZU8A 1V79A 5ABFA 3EMZA 2QLYA 1K8CA 2D2HA 1KGXA 4J3UA 1VFUA 3NZQA 2EPLX 2YDSA 4YLWA 1X96A 1G0CA 1WPCA 4H9TA 4WXYA 3LPFA 1JDEA 1CXIA 2PDCA 5A8NA 3R25A 1JGIA 3UZZA 4A2SA 3GB6A 4GYPC 1XGEA 3W7PA 3FY1A 3P82A 3NQMA 3TJ4A 4GH3A 9XIAA 1KBBA 2WNNA 2QDEA 2FFCA 3BE7A 2WMIB 4DNHA 4HPHA 3SGUA 1V5XA 3O06A 4OKDA 3W9ZA 2XTKA 3W1LA 2NVAA 1BWVA 5D33A 3STCA 3THDA 3VPLA 1UPMB 3TNBA 3VDBA 2GQAA 1GVQA 4CN1A 3S1GA 2XM2A 1JPIA 1EC9A 5HK4A 4XZ9A 4EPKA 4IUOA 3W01A 1FP9A 4J3ZA 1REQB 2IKJA 4LW7A 1BYAA 3BW3A 3A5FA 3BAWA 2OZ0A 1EHAA 1IV8A 1M7OA 2F6XA 4W89A 4ZO6A 1UR0A 2QS8A 1DBTA 1QCWA 1P6CA 2IXUA 1TPB1 2E25A 1QNPA 1LP6A 1MW0A 2VDIA 3CAQA 3PJUA 4NI8A 2J77A 4S38A 4Q8QA 4RE2A 1G94A 2YA1A 5CJMA 1T41A 1UYQA 1FX6A 1HGWA 5KMYA 3GBDA 4X60A 3P84A 4W8LA 2BLEA 5G4EA 2EO7A 2P3EA 3VCRA 1W3LA 4LV9A 2ZWZA 1BAGA 1BYCA 2RJGA 1KTBA 4Y8FA 2OEMA 1X6LA 4ZOAA 2OQHA 4M7SA 1ODZA 1EZ2A 3AZTA 4UQCA 3TE9A 1FP8A 2GZXA 1MZRA 3ICJA 3GBEA 4M80A 8CGTA 3FAXA 3KW3A 3LSBA 2YGYA 2FJKA 2HROA 3AHTA 2PS2A 2DORA 3R0KA 1XG4A 4US5A 1IWAA 4S23A 5CSUA 3JRKA 3ARWA 3UJFA 1ICSA 4DJDD 3NL2A 4ZZ9A 4ICNA 5CGQA 2O4QA 4IOTA 2DZTA 3ZZ1A 1GQNA 4BQ4A 4FEZA 4REQA 4RKAA 2PWEA 1GVRA 1GVFA 1MYRA 3MKCA 1P7TA 1E51A 5C9XA 3FAWA 3R1ZA 2CKSA 1UJPA 1HKIA 3THQA 1NF0A 3KDOA 2CBUA 2GJNA 2XSAA 3P2VA 3N4EA 2F2HA 4HYWA 4BEUA 1UIPA 2QQ6A 3NYZA 4C6OA 3U2EA 4YTRA 1QAPA 3NYDA 3S83A 4O4WA 4BWLA 4HHLA 3RLHA 2VXNA 1KD0A 3NOYA 4JFWA 2V67A 3ZM8A 3L23A 5XIAA 4AEFA 2IKIA 2VEPA 5E1QA 1FWSA 3G1DA 3SBFA 1EXBA 4MFDA 4MM1A 1DL3A 4ZXLA 2A7NA 4KWWA 2IUZA 2DGAA 3AYRA 1P0DA 3HPFA 3PWIA 3G1AA 3LLDA 3STEA 1PB0A 4XUGA 2GK1A 2WQPA 3GG7A 4IPPA 4Y2WA 4MPQA 3SRFA 1XW8A 4KFOA 3RO8A 4O17A 1Z3NA 1FHLA 1XIFA 3KXQA 3SCUA 3OBAA 1TE6A 3S9IA 4URIA 3PWGA 3LDVA 2A7PA 4YHEA 2AKZA 2FLIA 1K7XA 4MZ8A 3VC6A 1HIZA 3PPCA 3SCRA 2Y61A 3N2MA 1YXDA 1DIDA 2GDQA 3WLHA 4BFAA 3L5MA 4EANA 1KKRA 1I9CB 3TYBA 3G18A 4G56A 4MNKA 2VMFA 3CIVA 5BMXA 1W5MA 1FCQA 4AYSA 1N55A 3AIRA 5HR7A 2VUNA 5A6SA 2X7VA 3W74A 2DZWA 5FEZA 4BK9A 3RX2A 3TJLA 1V3HA 1KTNA 3TN6A 4GINA 4IMGA 3C56A 4LAUA 3H8AA 4UTTC 1IIHA 3CL7A 1YE4A 2FB3A 4DJFC 3N2OA 1AH4A 1VC4A 3FA5A 2F9RA 4K37A 4L80A 4XD3A 2ZYFA 4Q4QA 3UERA 1TMLA 1K9FA 4IX0A 4Z1BA 4HTBA 4NZ1A 2J13A 4NASA 1NH6A 1PVNA 3TUUA 1BFNA 2IQ0A 2HRWA 1LUCA 4NSBA 3NPXA 1A5SA 4HU3A 3WQCA 4WQ6A 2VGFA 1UP2A 4MZYA 1R7AA 2RDUA 2RJHA 1E4MM 2REQA 1TTJA 3GVRA 4J9JA 4HA3A 2O4MA 4FNUA 4TX9A 2FDSA 4GXWA 4EAMA 2VGGA 3DUGA 1FCVA 3EWUA 3U7BA 1XIIA 3DG7A 4WZHA 2CHNA 2P76A 1M65A 4K7YA 3VKBA 1VFTA 5J5RA 3RR1A 3T09A 3RO6A 1TJ0A 3PWAA 4DHGA 1G4TA 2VDGA 3R8GA 2YA2A 1V6VA 1PIFA 1H09A 4FNPA 3T0CA 4W4QA 2OMAA 1QPKA 4O0KA 3S2MA 3ID7A 1OZMA 2B7QA 5H8MA 1TWSA 1ESWA 4H00A 3G77A 1OFAA 1RXOB 1TX0A 5K9CA 2Y5JA 1NELA 5JBFA 1AQFA 5D4YA 1F8MA 3QHNA 1Z89A 2DZSA 3HGRA 5CPMA 2BMBA 3DG3A 4CU8A 1TE1A 2VFGA 3HGJA 3GTIA 4GOAA 1OCQA 2CZDA 2OR2A 3MP5A 3I6TA 3S3GA 4YL2A 3NPWA 3VINA 1TV7A 4FNSA 2GOUA 2VVSA 1KFWA 5JU6A 4DBDA 3W75A 4FX7A 4E3TA 3W1XA 3S6OA 2QXWA 3R12A 3VIMA 3L65A 4IQEA 4GYKA 4CD8A 1TUXA 1H7WA 5AYBA 4EF8A 3TLQA 2DIJA 5CCZA 1E56A 4UQBA 1JCLA 3A47A 4UOZA 2DW6A 2ISSA 2A3CA 4LF2A 1SFJA 4NJHA 5HUPA 3MCNA 5LXEA 4GNVA 4FXFA 4J2MA 2R1KA 1MI3A 3GHUA 5T26A 3CGTA 4UTWC 4HA4A 6ALDA 4RLIA 3SSJA 3ELFA 3ANUA 2WM1A 5CJ5A 2O0TA 4NIRA 4UTUA 4GBDA 1XCWA 2C14A 1OWQA 3WMBA 4MF4A 3S0CA 1FHDA 1QO2A 4IZGA 4HIBA 4HP5A 3WLMA 1PO9A 4AFYA 2V68A 3C5QA 4C6DA 3BGAA 3T4CA 2QPXA 4HNLA 4H2HA 1B54A 3W6YA 3WEOA 3T81A 1V02A 1D3CA 2ABAA 3ATYA 5KSWA 2C3ZA 3SCQA 2DUAA 2DH2A 2TPSA 4N2YA 2GGHA 1OX4A 4I6KA 4DLMA 4PMXA 1RBLA 2QCDB 2VHLA 4MY8A 1PAMA 3SQLA 2W61A 3E5BA 4AZ6A 2C1IA 3TTQA 4OTKA 3W70A 4WY0A 4E5TA 1RSCA 2X2GA 3BCFA 2PGWA 3CAWA 4PUDA 4Z1CA 3UZXA 2XIMA 4JTHA 3V16A 2J7HA 2VRJA 3RX4A 2A85A 3CQJA 1QW7A 3TMLA 3ZVHB 3NGJA 1PWMA 3C52A 1BEUA 2O92A 2Z24A 3DHDA 2Y5EA 1NTHA 4K3ZA 1F74A 2CLEA 3LERA 4H01A 4RNHA 4C6FA 4DVOA 3O63A 1R3TA 1VENA 4MSSA 4PUEA 2CHRA 3EWXA 3EWCA 1GG0A 4GE8A 1WAWA 3CZJA 3WFLA 1S39A 2CESA 6A3HA 1E6ZA 1O6IA 1CLVA 1R2SA 5E9XA 2Y7GA 3WLSA 1PJ9A 2VQUA 1I2RA 4IX2A 1KWKA 1ISVA 4ZQMA 5EKYA 2WCAA 3BK0A 2ZUWA 3BV4A 2HE5A 3OHMB 1L9WA 4FXJA 4GABA 7REQA 3E96A 4XUYA 4R7OA 3WD2A 2WVVA 2VFHA 4NNBA 1ZAIA 2YBVA 1OC6A 3U2OA 2G95A 2NV2A 4WDUA 4LUTA 3QQ0A 3UWZA 2B7PA 2EKCA 2VQTA 1PCKA 2RDTA 1CGUA 5T8GA 4GACA 4U3AA 4LYQA 3B06A 1Q2SA 1HVQA 4AD1A 4DBUA 1IT0A 3RG6A 3I7QA 4CN6A 1Q85A 4GQBA 3OQEA 1CCWB 3HQPA 2O9RA 3P60A 4IP5A 3VOCA 2YXGA 1XHGA 1YLVA 1LT8A 2CCRA 4UFMA 5FACA 3AI0A 4RPQA 4US6A 1ZBVA 3MJMA 4RNIA 3I6EA 1KXHA 1C8YA 2ACQA 4L6DA 3M0LA 2A3HA 4UFKA 4BEQA 2E0PA 4MKNA 4O13A 5CQ1A 4KRZA 4OIFA 2BHUA 5ENLA 3CAKA 1GQIA 1HL9A 1VYRA 4JTFA 1BVNP 1YTDA 3ZR5A 2WCSA 1T96A 5CPOA 4CD7A 3BAIA 1JDCA 1I2OA 4LRTA 1VJZA 4PC8A 2Q09A 1TQXA 4LXFA 3RRXA 2YL8A 3OVRA 3MBFA 2QUTA 1Z9AA 4FSAA 3IGSA 3ZLFA 5D04C 1KXQA 3VOIA 4U33A 2VURA 3SJNA 1U2YA 3CUXA 1TV4A 1LRNA 5FF0A 4O50A 2LLEA 4LYRA 1CGYA 5I2UA 1O5RA 2I5IA 5LHFA 3SCNA 4CQ9A 3W7MA 3M0MA 4JTTA 1JYWA 1XISA 3QHMA 1ECEA 2W4XA 4AHPA 4MJMA 3DU0A 3CMFA 3W7EA 3B0YA 4IFKB 4DM2A 2PRMA 4JZ5A 3NDOA 5LNWA 4JIHA 4G2DA 1OVDA 3KOYA 1LWHA 2ATMA 1O4UA 1LYXA 2HXTA 4ZQRA 4RDYA 3JZUA 1U5VA 5EPDA 4QAIA 1UD6A 2WHJA 1DWFM 1RPKA 1L6YA 3B4UA 4IL2A 3T07A 4Z2GA 1QHPA 4YYCA 4H7ZA 4UR8A 4KCWA 4E2OA 4POCA 1QHOA 3HTWA 3PTKA 4IIGA 1D2KA 1Q8AA 1E71M 2VENA 3NQBA 3QOMA 2FZMA 1JNDA 2Z27A 5IM51 1MDRA 3AJXA 4JN8A 1OT2A 1TV8A 4ROQA 2GSJA 3OA3A 4OT7A 4Y9PA 4UQDA 3N9SA 1S2UA 4HCDA 1H61A 3EWWA 2ON3A 2E5DA 1LORA 2ZZ5A 4FB7A 4ZB2A 1IZJA 3EOEA 3FEQA 2OXNA 3TSMA 2R1MA 3B3DA 4OU1A 4AIEA 2QCLA 3I3EA 1W1IE 3QFEA 3L4VA 3NWRA 1XYAA 1KXTA 1AQHA 3U0HA 3WLIA 1BVWA 3LNMA 3NGFA 2Y1HA 3RMJA 5CBBA 3T2QA 1UW9A 4LVAA 1OGGA 1PBGA 3M0XA 1R0MA 3RHGA 1S2VA 4H3DA 4HHPA 4PSRA 1XRSA 2Q71A 4FIRA 4UR9A 2EJ1A 3UEQA 2IXVA 3UBPC 1TKKA 2BX7A 3G1XA 2I56A 1QRQA 4GNKB 4NG3A 1B5TA 1YX1A 3H2CA 3W02A 2YBTA 3BPWA 4O1AA 4JNMA 1TVPA 5I3JA 2WJEA 1VJIA 2GVGA 1HO1A 2QMJA 3VNLA 1QWKA 1YDYA 1MUCA 4PRWA 1I8JA 2UBPC 4MZ1A 2FZ9A 3GLCA 3PZQA 3VNJA 3LB0A 1EWEA 3GDLA 2EPHA 4DJEC 4DWSD 2BOFX 2C71A 1V0MA 5LNUA 3BAXA 3HZ3A 2NWRA 2QJNA 1RVKA 3L2MA 4WGHA 5C9UA 2NQZA 2Z6JA 4O12A 2RGMA 1HP4A 3KRZA 3NZ1A 4ASTA 2PRLA 4Y9MA 3F2DA 3CZKA 2ZBTA 4L4MA 4Y96A 1ALDA 3RXZA 4Y9OA 4YTQA 4JTKA 1VQTA 1B2YA 2H9AB 1H2JA 3MHGA 1MQPA 4GI8A 4P7LA 3N25A 4JTRA 2NQ9A 4P7NA 4L1GA 2NV9A 3A5VA 1G4EA 3WNNA 2GVEA 2P8CA 1HX0A 2INZA 2HNEA 3LX9A 5HXMA 2VDHA 1FDZA 3ABSA 1F2JA 4H83A 4GO9A 4G5DA 1V3LA 3APTA 5HBFA 1KR0A 1EC8A 1DWIM 4I7WA 2E28A 4NX5A 1XQLA 4WLCA 3VNYA 4GZIA 3DHFA 5BW6A 4H9XA 4Q4PA 3URNA 5TD4A 1UD8A 5IFTA 1BF2A 4IG2A 4PUJA 2AMXA 1EYEA 1M7XA 4F79A 5L6UA 3NM3A 4KWOA 5G2WA 2XU2A 3N2CA 2FVMA 4FS9A 1K6AA 3M4HA 4M3PA 3DESA 4JYFA 3CZEA 3D3AA 4OFCA 4GIAA 3T55A 1X6UA 3VGFA 5F2MA 5HOSA 4RX0A 1X98A 1B4EA 4OBTA 4IGSA 1W2PA 4LBRA 1I60A 1KFKA 2Y70A 3CO4A 3LZ3A 4QCFA 3MMTA 4RW3A 3N6HA 3OLDA 4BI5A 1R85A 4PL1A 4GQRA 1CW2A 3D6NA 2Z2UA 4A8NA 2E8YA 2OEKA 3UXAA 4A3YA 1XL9A 1CGXA 1DHKA 3EKGA 3M0VA 2IKHA 1LOQA 2NUWA 3HIJA 4Q7IA 3PN8A 4O0QA 1SO6A 2GGJA 2V5CA 3SR7A 4JCLA 3WFAA 4ZFCA 1LCOA 1PTAA 1C29A 2BV9A 4P61A 1Q6DA 1GKRA 4ZO9A 1UOZA 3MUCA 1GOWA 1XLJA 5F2LA 3VIIA 4UFJA 3GYCA 1FY6A 1M01A 4KEUA 1E6PA 3ABRA 3RYSA 1E9YB 4EWND 2JFEX 1UZ4A 4AF0B 3P7YA 1B31A 7TAAA 4C1KA 4TTUA 1NARA 3H7RA 4GYPA 4UXDA 4XZNX 1N8IA 5AVNA 3W81A 2V5BA 3QGVA 2WSYA 2Y2WA 2OZ3A 5ABFB 4M5PA 1I0BA 1QDSA 2V5JA 3OLEA 3CYVA 4LS2A 2V38A 4RV3A 2JE8A 2J25A 3V75A 4U3CA 1GQKA 4MLJA 3PK7A 4D6EA 1H11A 3GDBA 3LEPA 5CAHA 2WB5A 2W79A 3HG3A 2C0HA 5LYRA 4GRSA 1GZ1A 3ORWA 3IGXA 1EEXA 2VKZG 4E6MA 2VFDA 2Q01A 3CH9A 3OVPA 3L21A 4INFA 1S3TC 2VCBA 3LHYA 3PG8A 1W9BM 2OVLA 5H8PA 3QKZA 1UH2A 1M41A 2X09A 1G4SA 2V81A 2XINA 3MO7A 3K13A 4PFHA 3C2YA 3UZ5A 4AZGA 2VJXA 2ZX6A 1MEHA 4AXNA 1N8WA 3RU8X 1H3GA 3ZWTA 3BCDA 2H8ZA 2JGYA 3AIBA 4PULA 2R94A 1TIMA 3BC9A 4WD0A 3E74A 1A4MA 1NOFA 3UG8A 5FF3A 3MVIA 4K1WA 2XN2A 2J79A 1A80A 2G0WA 5HJLA 3GTXA 1GCYA 2WMGA 1XQKA 5D30A 5I23A 3ZYZA 1HUVA 4PMJA 3O07A 1EJVC 3NSNA 2OCZA 1NDVA 3OHIA 1XYZA 2ODOA 2J6XA 4JX5A 4K39A 1OABA 3TSDA 1JXKA 3T08A 3QZAA 4R33A 7A3HA 4GUFA 3UU0A 4JIIX 2Z2AA 1F6PA 4ORMA 1YIXA 5HQEA 4FMVA 3EMQA 1US2A 1LM1A 2G3JA 2VR5A 5DMMA 4KCUA 4I5XA 4U4MA 1V0NA 1UZ1A 3IUDA 4QQUA 1GJUA 1ZRQA 1E70M 2GL5A 4KH2A 1FWEC 4RZ4A 2I1OA 1IT8A 2CZFA 3NEVA 3R79A 3T78A 4DF0A 2Z2BA 4Q32A 4YCPA 3K2GA 1O1HA 1LOSA 4REQB 3C2OA 3SB0A 3KL5A 3M41A 3KLLA 3O6YX 2X8RA 4FALA 3QMTA 1P7TB 5F2GA 1JEZA 4IMEA 3LBMA 2GQ8A 1Y5VA 4IJRA 4B5UA 3UCDA 3PSWA 4JFUA 1HL8A 3IARA 1PKNA 4AWEA 3K8MA 5D2YA 3KZSA 2ZVRA 3GU9A 3WQ6A 4HOXA 1IF2A 4RPPA 4MUPA 1AODA 1FKXA 4WKHA 4GCXA 3STPA 2FZNA 3CTLA 3M0HA 2VRKA 1G5AA 2JGQA 3AMDA 6ENLA 4S3FA 4BA0A 2RAGA 4DZAA 2EF9A 5CH9A 4FLOA 2ZZ6A 4GI6A 2Z29A 5FD0A 4ATLA 4BZYA 2ANUA 3NZRA 5BXPA 3ZLGA 3MHFA 3I10A 2GK1B 3VIFA 1H1NA 3KWSA 4PCSA 1CXLA 1D8CA 5FJTA 3A22A 3N6QA 3K8KA 4IF2A 3WD4A 3NR0A 3RJXA 2J75A 1JCMP 2QVNA 3H23A 3LY0A 3CZLA 1R3QA 1ODUA 2F61A 1P0NA 1WDDA 4NUWA 4BI6A 1DWAM 2NLYA 3O8AA 3RM9A 2D0FA 2G4JA 1FWNA 3TSBA 4MB4A 4GLEA 3AZSA 3CZ8A 1NP0A 4UTTA 3V3WA 4XAFA 5A94A 4YYFA 3OVQA 1W3TA 4C6BA 4X2PA 4PZVA 3UG3A 4DUOA 3IVTA 3SAZA 4KRUA 2R82A 1Q6OA 3HURA 3QMRA 3NQDA 1BGAA 1DOSA 2A79A 1UUMA 4Z2HA 2YZ5A 3LRLA 1W8SA 4LCSA 1UKPA 1GVIA 5A6LA 3LLXA 1EJTC 2X0SA 1F3XA 3PJTA 2JEPA 3ARQA 3UG5A 4DXKA 3EOLA 3VILA 3LTPA 4PBEA 1W2VA 5EYWA 4IT1A 3RM4A 3MA8A 3BMXA 5ABEA 3QLLA 1K7FA 2F38A 3FDGA 5HUOA 1LUCB 1KTCA 1EXPA 2GGIA 2E6DA 4J5NA 1Q6LA 1WOBA 3A3XA 1K02A 1J0IA 4IFRA 1A5NC 4FLQA 2Y7FA 3AXHA 4B90A 4GC4A 3RCNA 5HULA 2REQB 1R87A 4QDMA 2F6KA 2YL6A 3NL3A 3STGA 2NWSA 2I16A 3UJRA 4A3RA 1ZENA 3TN4A 1FWTA 1TJ1A 3IK2A 1ONWA 4EXBA 3HG5A 1DJQA 9RUBA 3ZLHA 4XZLX 4QBXA 4KFPA 1XGZA 3KWXA 1XUZA 3NPUA 1T99A 3MSGA 3NQAA 1D8WA 2X40A 1DTUA 2QULA 4XG1A 2QIWA 1ICQA 3LCIA 3OP2A 4X63A 1UKSA 1VHNA 3SGZA 2DT2A 3VIKA 4Q4MA 4DZ5A 4TUFA 3A3HA 3PNZA 1DJGA 1I2NA 5EBAA 4PUKA 1QK0A 1BG9A 1VB9A 4E2DA 2TYSA 1OK4A 5CSSA 3RR4A 4PMQA 5L9FA 1H63A 4TX6A 4GI9A 1VJSA 1WUFA 3FJNA 3LI1A 2PZ0A 1W1TA 3AMGA 3AIQA 1GHSA 2C8NA 3DKLA 3XIMA 1RA0A 4PYSA 5I24A 3RGTA 2EAWA 3GC4A 3CWHA 4LYPA 4UOQA 3UZWA 2JK2A 4A22A 4MWAA 2DSUA 3WKZA 4M24A 1V3JA 2E67A 1JR1A 1U1JA 3G6LA 2FGLA 4QE4A 1XRTA 3OIHA 1GOOA 4R88A 1BTCA 3PUOA 5EMUA 4RL3A 1DXFA 4IGHA 4C91A 3DI1A 3OBEA 1CNVA 3B0XA 4EIVA 3MSDA 4MIMA 3WDIA 1BQCA 2GWGA 3O0KA 1XIGA 3OGSA 4GA8A 2DZUA 3R10A 3V7PA 5REQA 4NHVA 3OIXA 4NL1A 1VFMA 1WDSA 5G4HC 3DX5A 4NNCA 4M0XA 1PX8A 2B4GA 3VVGA 1XLLA 1AG1O 5D09A 3WCZA 1R9ZA 4S39A 4JX6A 2PWUA 4U10A 4L7ZA 3N17A 1W5OA 1W9UA 2EKGA 5C9ZA 4QG8A 4JNZA 5BMWA 3OW1A 3LCXA 1WDPA 3PFMA 3T9PA 1QBBA 4Y90A 3O0FA 4DJFD 4LUJA 5DLCA 1E55A 2WNZA 1WZKA 3GO2A 4RXFA 2ACRA 2XH0A 2Q02A 5CC7A 3KHJA 2BVYA 2BFGA 2XFWA 3PBYA 1F5ZA 5BOOA 2HEJA 3NZGA 1C90A 4WY0B 4PODA 3TW9A 5A6JA 1EGVA 3WUEA 2ZZ4A 5FESA 4F9DA 1OADA 2Z1SA 3O9NA 3ONBA 1Q7MA 2E40A 4GGBA 2AAAA 4JTDA 3W53A 4HA0A 3EBVA 2CLKA 4F9JA 5B80A 4O11A 3MUIA 4LFYA 2YKKA 3TZNA 1LG2A 3SY5A 1S5WA 3ITYA 3IJDA 1CBGA 3M44A 8TIMA 4NAFA 3HPSA 5LXXA 5LIUX 3I4EA 2SFPA 3S6TA 1H7NA 3DBPA 5E6YA 5A6TC 2P10A 4NZFA 1HJSA 4ZSTA 5D02A 5FCZA 4QQ3A 3B05A 1E3ZA 1QOPA 5I7GA 4YWSA 5AC4A 3ARRA 4M56A 4HSNA 1KBKA 1AW2A 7REQB 3IUHA 4N9EA 3FEMA 3SQSA 5A3HA 2VEIA 4KERA 1Z32X 2NX3A 4B3ZA 1XX1A 1OYAA 4XBJA 3RMEA 4KF1A 4HVXA 4JL1A 3RX3A 4AB4A 4AY7A 2C19A 1E6XM 4LUTB 5CC5A 1XH0A 2G3IA 3KS5A 1TWZA 1HTIA 3R0UA 1MVYA 5AY7A 3LNPA 2B0MA 3NZPA 5E0CA 3WJXA 1ZGDA 4B4FA 3VD4A 3QV8A 3OZMA 4MUZA 2VGIA 5ABGA 1P4CA 1K70A 1REQA 1OINA 5KITA 3BLPX 3PM6A 5E0FA 5C6MA 4ECLA 4ALDA 4AAJA 3DFHA 4OV4A 4M8UA 3CWOX 2QR6A 4M29A 1SZGA 3GRIA 1F3EA 2OYKA 2Q3OA 2R1NA 3TJIA 4GY0A 4DI9A 5HQMA 3A6OA 1QK2A 3W28A 2XGIA 4QE1A 2XIJA 2O9TA 3KBVA 2INEA 4C1LA 4WKFA 1TV5A 5JUVA 1RY0A 1XLDA 4JDBA 4NAEA 4QLJA 3CEUA 7ODCA 3VGGA 4Z0JA 4JTUA 3GH5A 4S3JA 1J93A 3WO8A 5IDIA 1BHGA 2VFIA 3RPMA 2Y6ZA 3HG2A 1YNPA 2OFJA 2OOGA 3AIUA 2MUCA 4E4UA 4GXMA 3KVLA 1JFHA 3P61A 2D24A 3IV3A 4HOZA 4AZ7A 2G37A 3UXIA 4R7WA 3EB3A 4L4OA 3VD9A 3I3DA 4V28A 3H7UA 3TWBA 4JY9A 4M51A 4W7UA 1R6WA 1DKWA 3UR5A 3W23A 1NM9A 3HPZA 3S6DA 5JIPA 1E4LA 4ML9A 3AHZA 3WN6A 1WDQA 2JBMA 4NJIA 2PURA 2HQAA 1ZSXA 4O1FA 2VEMA 2QF8A 4D6IA 3EX2A 3ARXA 1A3XA 3FIGA 5BRPA 3QVQA 2HDJA 2WW5A 3P3BA 2FH6A 5EY5A 3MANA 2VEKA 4MY9A 2WPBA 4M6PA 1QOXA 4JPGA 3PUDA 3LK6A 2BTMA 3H2MA 1EZWA 2XWDA 3FCPA 5DMYA 2D3LA 1OFQA 3LHTA 1CENA 1E1CA 4B5NA 2GJXA 4GH1A 4M19A 3W73A 1F8IA 4HJFA 3GE7A 4UQAA 1KNWA 4U31A 2WPGA 5TIMA 2QJHA 1BPLB 1Q6QA 5BRBA 2QUMA 3WZ0E 1HKWA 3IJIA 1WDWA 3AQUA 3HPXA 4I6VA 5LSMA 4QSHA 3BV7A 2CLIA 3HMCA 1SFTA 2GWNA 3PZNA 2PTWA 1JAKA 5DRIA 4TU1A 3PNUA 1ZTVA 1A0CA 3EB4A 3KTCA 4WJXA 3GXPA 1EIBA 1HGYA 4ZEPA 1UWQA 4EACA 2ZA1A 5HNTA 1GJWA 2QJGA 2OX1A 1SW3A 5KEZA 4UTJA 3SY1A 1C8QA 4QR6A 3WBYA 4B9YA 2EPOA 1FKWA 3ZR4A 3IJ6A 4IMAA 4PE8A 4RCXA 4L64A 5F4WA 4FF7A 2NXHA 4AY1A 4ADTA 1ZP3A 3IACA 3VK5A 1CLXA 3MMWA 4DUVA 1Y0EA 3KBJA 4JN6A 4N6EA 3BLFA 1P5BA 5GNXA 2IPWA 3WF4A 3EDKA 1VPYA 5SWUA 4WY0F 3C2VA 1TWDA 1XSIA 1JG9A 5BXSA 1X97A 3FJ6A 3UYIA 1JIBA 4GZEA 4PCFA 3TJXA 1J4EA 1U1HA 4FI4A 4GZJA 3U9IA 3BAJA 1S2AA 2ZFAA 3PANA 1EO5A 4N42A 3R89A 4JTIA 1FUYA 4XAYA 4LAKA 3BG5A 3NDZA 1M03A 3WH5A 4MKSA 1PTDA 1EEPA 1V4YA 1NWRA 4PMYA 4UQEA 2PWFA 1NWSA 5A8PA 3SCSA 1A5LC 1JYXA 1E4IA 2WOQA 3UXLA 3INPA 2GQ3A 2PU0A 3HQNA 1U83A 3UZYA 3GIYA 3L5LA 4S3GA 3QPEA 1M7JA 3WMSA 1EH9A 2CNCA 3BWWA 4CQBA 4MFEA 1UKQA 1WKEA 3TROA 2P53A 3EWZA 5XINA 3IIVA 5GPRA 3W71A 1A5KC 1C3FA 2WM0A 3VX0A 5DXXA 4AIUA 1ZS2A 3N4AA 1K4HA 1SSGA 4B5VA 1F3WA 4ERGA 4ZA0A 3OA5A 3QFWA 4OUEA 3A4JA 2IMRA 3EX1A 4UZSA 2PDKA 3AWOA 3U4AA 5C54A 1A4LA 2AL2A 2XUCA 4IG2B 1SJCA 5K3VA 1JD7A 4PMNA 2A0NA 2A3BA 3PHAA 2C91A 1ENUA 1FCUA 1OC5A 5I79A 1K9TA 4R85A 2TSYA 2OX4A 3GG0A 1CECA 5DEZA 3QGAC 5FL1A 2HXUA 4Y9AA 2Y8UA 4BY3A 1WZLA 1IEWA 3W27A 4NI3A 4O57A 1LL7A 3WBXA 3LCWA 4FNRA 6XIAA 2OT1A 2QHAA 3LHUA 4JKMA 4I9TA 3TTOA 2D2GA 5D8WA 4LGXA 1EJXC 3WQEA 2XVGA 3K1DA 4C65A 2NQ5A 4OBSA 4PUUA 1TMHA 2TAAA 4UWMA 5HMSA 5HJYA 2WHMA 2BASA 1Z41A 3G3DA 3K30A 3NJ3A 4ZODA 4EK7A 4KCVA 4RZBA 5IRPA 3WBEA 2WVUA 3NOEA 2J8GA 3USBA 3PB2A 3WD1A 2CU0A 4X3ZA 1AQMA 4RDZA 1VBRA 2D1ZA 3JVAA 3EAUA 3BG9A 1GEQA 3WK1A 4XZBA 1J11A 4YWIA 1RK6A 5C2XA 1GUVA 2PF8A 1B1YA 5D38A 3OZPA 1YEYA 4S2CA 2H90A 3OU8A 4I90A 1BWLA 3H7VA 3STFA 2WO5A 1JCJA 1ME9A 1B3XA 4IXHA 2GGEA 2X1IA 2ZICA 4H9VA 3ZR6A 4CNPA 4L1WA 2VO5A 2VWTA 3AZRA 3WDQA 3IGHX 1PX4A 1TQJA 4GX8A 3U3HA 4GFIA 5I3KA 4QAWA 3NSMA 5I77A 2VX5A 2E5BA 3FHQA 2DDXA 4HPJA 2PF0A 1KM2A 2CW6A 3A21A 4YNGA 2DIEA 3R58A 2OGYA 3A13A 4C6PA 4FLSA 5IXEA 4DJED 1S1PA 3ARYA 3FJ4A 3C6CA 1O66A 5CSRA 1HL2A 4IWWA 4V1YA 2WVSA 3N34A 2UZ9A 1C92A 2XG9A 3W0KA 1JZ4A 3GR8A 3VNIA 1RR2A 2HVMA 3BAYA 3CUGA 3O7UA 4UTFA 1IEXA 4BS0A 1H51A 2PDPA 4HU4A 3F2BA 3L67A 3URAA 3W3OA 1OX5A 2E77A 3ZO9A 3KBNA 4HYRA 1W0MA 2FTWA 3FA3A 1YADA 5I02A 3TYZA 3GC2A 2W3ZA 5HATA 3IRDA 3BO9A 3EX6A 3LV5A 5EB8A 4NZ5A 2YR1A 4LC6A 1V7AA 1T8XA 5LZLA 5G1TA 3W38A 2J74A 3CQ0A 3N6JA 4B9ZA 3WUBA 2IPFA 4F0RA 5EU9A 5CZKA 1SR0A 2ZX8A 3JR2A 2DEPA 3PSVA 3PZIA 3WUFA 3K4WA 3T40A 4O8AA 2WC3A 3G6MA 1RCXB 3LHWA 3QEZA 3EDDA 3V4BA 1PHWA 4XZMX 3QBUA 1J5TA 5I3FA 2CPUA 3SIZA 3H2FA 4UNKA 4GFSA 1O68A 5GJPA 2OODA 1AQ0A 3A4XA 2W63A 3S8HA 4N9DA 1E9IA 3QY6A 1EO7A 5E6ZA 3O1NA 1MNZA 2G4FA 1HJUA 4DYKA 1O12A 1EA0A 1Y8BA 4WDWA 5AHIA 1AMKA 3SUUA 3BURA 4LEFA 4JQ2A 3OYZA 3ZFHA 2V2HA 4RE4A 3SUWA 3GUGA 4UTKA 3LOTA 3L66A 3NO5A 4GMEA 3KUMA 3N15A 2FGZA 4PTWA 4LF1A 5ABTA 3S9YA 3ZT6A 1KKOA 5FJPA 1JDDA 4OVXA 5M3WA 4UFHA 4ZQPA 1FRBA 3KOFA 4Y6GA 3BLDA 2W0UA 4D2JA 3CL8A 1XICA 1XLEA 5DELA 5A8OA 1CGWA 2YFNA 4B15A 2Z1KA 3VDAA 2DVXA 4CQAA 3GKFA 4U28A 1Q45A 3G5EA 1UA7A 1KM6A 1VBUA 1SO4A 3AS3A 4QNWA 5BRQA 2JIEA 5FKYA 2V0TA 2KAUC 2YZRA 2UY2A 3W72A 1V3MA 3BOFA 4RK8A 1RV8A 2CYGA 2V63A 2CXGA 1A5AA 2FQIA 4JKKA 4S3CA 2FYMA 4LVBA 4WSJA 5LNSA 3DYMA 3PB0A 2OG9A 3ZMRA 4QEEA 1VEMA 4QIUA 3KS6A 1UZDA 4JXCA 3DZ1A 4L9ZA 4Z2JA 1AVAA 3I4KA 1FWGC 1W3KA 2PUZA 4QE5A 1XIMA 1XIHA 3ENLA 3QXBA 5GQBA 3NQ7A 3QW4B 4Q7BA 2PI6A 6TAAA 2WC7A 3SRKA 5FAGA 1TV3A 2BVWA 4LWWA 4LH8A 2QJJA 4IPIA 3CS2A 3W84A 3PJWA 4Q4RA 4XV0A 2Q8ZA 4DUXA 1CGVA 5FEWA 4B4HA 4K8HA 1DQWA 3MMUA 4J28A 1RUSA 4ZQCA 3RLGA 2ZUTA 4YXGA 1JRCA 4N6FA 1T5AA 1V6TA 1MZHA 3VNZA 1XC6A 1P48A 2ZVIA 3QSTA 1JRBA 3EOUA 3UF9A 2DP3A 1YPFA 4HSHA 3VFLA 1VD6A 3F7JA 4GQGA 3AU6A 1EHNA 3MP3A 1NAL1 3TQ0A 3WJWA 5AKQA 3G0UA 1HFBA 3E9AA 1RJQA 4WIWA 4L9XA 2BP1A 2WNWA 4PRRA 1TA3B 3DG6A 3UG4A 2ZRWA 2WWCA 1B3VA 3R0DA 4MJ4A 4W85A 4IQLA 1F3TA 1FFQA 2DVUA 1DJZA 3TC6A 3GFZA 2DV0A 1UR3M 4NT0A 1RD5A 1EPXA 2R24A 3F4NA 1EDQA 5HMDA 4X9SA 4PUMA 4LTSA 3ZJ8A 1X8CA 2WANA 2E6YA 4MGGA 1V08A 4ICMA 3TIMA 2O7SA 1CTNA 4J40A 4CVUA 1TWIA 2Y5SA 1NOUA 2VFEA 3FLUA 1OGSA 1BVZA 3KRSA 1TREA 1E0VA 5HNRA 1PS9A 3NL5A 3WF0A 5FA5A 4WK9A 2EPNA 3CV2A 2FZBA 4KWUA 4NZ4A 4M1BA 4ZTXA 3TAKA 3CUJA 5CC6A 4DIAA 4CUCA 3ARSA 5J8LA 1D3HA 2QCFA 2HWGA 2W6RA 2PBGA 1AFSA 3IAQA 4C6EA 4JEJA 4A8RA 5CPSA 3GKAA 3BMVA 5CZSA 4F4RA 3CJPA 3TR9A 2ZZ2A 3MY9A 4LBSA 1RD6A 4KGLA 4I9MA 1EDTA 5GNZA 4MWAB 4HN8A 4EPBC 4W9TA 3BH4A 3F4DA 1EIXA 4HHMA 1PCWA 4RZ6A 1JZ7A 4WVXA 4PMDA 1FDYA 4I9AA 4RV8A 1BYBA 2H9AA 2DSVA 5T9BG 3LV6A 3AMCA 4BCEA 4P7QA 1GOIA 1LL4A 2J7DA 5BU9A 1UWSA 3W76A 4BQ2A 3MO4A 3AYTA 3UZJA 1Q8JA 1HJQA 1Q4NX 2RGLA 5E5CA 1Z69A 3GAKA 1LBFA 4GKTA 4XIAA 1VZWA 3T0DA 1VCVA 5D8ZA 3E38A 3WDRA 1ZBKA 4JAWA 5HJXA 2J24A 1PE1A 3DHUA 2PDLA 3KBMA 2WCGA 4TVUA 1UG6A 3QR1A 1R9XA 2QCHA 4DO6A 3GG1A 1GZJA 3W2JA 3BXWA 2G96A 3JUGA 3GHTA 1N8FA 2ZTJA 5IBXC 1MRAA 2WLYA 2QAFA 4QHRA 3GXMA 4NZCA 1C8XA 3EWBX 4DJDA 1BXNA 3AHXA 3B8TA 1VBHA 4OZOA 5C5YA 1G4PA 4Z1AA 5A69A 1GTHA 3HA1A 1X8FA 1SW7A 2CLLA 1G67A 4LANA 1ZBWA 1VH7A 3ARPA 2WKJA 1B3ZA 4Q4KA 1FWWA 5FSEC 1AD4A 2NXGA 2ZUVA 3QY8A 2ZXQA 2OQLA 1Y5WA 1KM1A 4CD5A 4DXVA 1TPWA 1EDGA 1XKJA 5FJJA 4V2XA 1KXVA 1RZMA 1DJYA 3KOXA 2CBVA 1CEOA 2HNHA 3GU2A 4AC1X 2Y89A 1TVNA 4IXXA 2Y8VA 5EMKA 4UMCA 3T0TA 1BSLA 1P1XA 5A95A 1LF1A 2PA6A 5DANA 1XLHA 2F2KA 2XYLA 3GDRA 1EKOA 3M07A 4GUJA 5G1YA 3DC8A 2ZKMX 1OM0A 2ZDRA 3EOSA 2OSXA 4NAFB 3W07A 4WUIA 4DEFA 2BY1A 4QRNA 1R2RA 4FPSA 2E68A 3LN3A 3APYA 2D2OA 3IVSA 4JY8A 3KVJA 4CEXC 2JKAA 4GIRA 3NQ6A 2FHCA 3OGRA 5F4XA 2NW0A 2PDJA 1LG1A 3PAJA 4IIFA 3CH0A 1KGUA 3JS3A 3KCOA 1NVMA 4BQ3A 2ATSA 2Q6ZA 1V93A 5HA7A 3S47A 3ITTA 4N9CA 1ISYA 4ZB5A 3LMZA 3NL6A 4LUSA 3R43A 3W37A 2CLMA 3EOOA 3RUBL 1IIGA 1LQ2A 4W88A 3L4WA 1J0KA 3OLGA 1XCXA 4HMCA 1M68A 2YFOA 3IGUA 1SUXA 2XFRA 3J7HA 4QITA 3M0YA 4KETA 2XN1A 2Y62A 3W87A 1ADDA 3O6DA 1OCBA 2A5HA 4AZHA 4DAIA 2VOMA 3OBKA 4Q22A 5LIXX 3A4AA 2PPGA 4LPCA 5AVHA 1UC4A 3I3BA 3LRKA 4JQ4A 2BXVA 3H6OA 5HWJA 1XKYA 1XD0A 5B7YA 3KRUA 2V3EA 4OECA 2BGQA 2P3ZA 2QGYA 3CLMA 3E5PA 4OUIA 2GUUA 1CLKA 3P8IA 3UW6A 2FB2A 1J0JA 3KCJA 3LBOA 3LPPA 3KCLA 3DFTA 2D22A 2WSPA 4D6JA 5C0QA 3WBWA 4KWVA 3T6CA 1UD2A 5E70A 1UIOA 3G1YA 2BVDA 3G1HA 2GSHA 2PDGA 3B8DA 1I2PA 3RM8A 4NAEB 1FTXA 3M9YA 4F48A 3GTFA 4TR9A 3EZ4A 1N2VA 3CB8A 5DY3A 2CZEA 3VDGA 4AVOA 1XLKA 4DN1A 4HNOA 4FP1A 5C2GA 3TN3A 4DB7A 1ZBCA 4K8GA 3G1VA 2JALA 2Z7KA 1Z42A 3W4RA 5FI8A 1PUDA 3ZT7A 4O18A 3QOKA 3LM7A 1EJRC 4ZR8A 2BGNE 2ZC1A 4NU7A 1PHQA 3WIJA 2VX4A 4QM1A 1JVNA 2WMFA 2YW3A 4JIRA 3CIWA 4MNJA 3C86A 1PWLA 3EWDA 4K8EA 3POHA 4MLRA 4ATWA 3PPGA 4HOWA 4DWDA 3EA3A 4MPKA 3OEXA 3ITXA 4DBWA 2WBKA 4LC8A 4MMWA 1B3OA 2RUSA 4FNTA 4GVIA 4MKVA 1VCFA 1VKFA 2GVLA 3QQ1A 4IMCA 3BLKA 1ISZA 2ZRVA 3LUTA 2QEZA 3WK3A 1FHVA 5AC6A 1RY8A 2GJRA 2GPTA 2R9RA 3D0CA 4MNMA 1KO0A 4F0KA 5H1WA 4GQ0A 4NILA 1U5HA 3PBUA 3WL1A 2QGHA 5I6SA 4DF2A 1V7YA 3WLPA 1KQZA 2HJPA 4GKLA 5D2XA 1QUMA 2CERA 1E1CB 5D9OA 2GJXB 4Q4OA 2H8XA 2PZNA 4HA1A 4JHMA 3B40A 2CLOA 4B2DD 3GHRA 1V6XA 1MW1A 1KRAC 3P81A 5HMFA 3OB8A 5HQLA 1ONXA 1VP5A 4PMUA 2GLKA 4ZMGA 2V2DA 1DJXA 1W3IA 4JTLA 4GZ7A 3FGCB 4B5XA 3CC1A 3BLIA 1X38A 1AL8A 1MFUA 3EPOA 4JTGA 4K68A 1VCGA 1OFEA 1ZAJA 2XSBA 1JPHA 1YDVA 1OSEA 1NFGA 1LBMA 2NXIA 3KE0A 4UFIA 1ZL1A 3M0ZA 4P8UA 2YCJA 1ZCOA 2FMNA 1VBGA 1JZ2A 4W87A 2ZRZA 2VZOA 1DQXA 3F4CA 3HQOA 5TNVA 1LDCA 2X0HA 3I7SA 2CBJA 3VOJA 1L8NA 1IZKA 3ABXA 2PGEA 2VX6A 1XYCA 3HF3A 1ZJBA 2FDMA 2PE4A 1F6KA 1W3JA 4GQQA 3ANYA 3QF0A 2VEGA 2YCLA 4H8VA 4LU0A 1SU5A 3U5YA 2YXX