3LDVA

1.77 angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase from vibrio cholerae o1 biovar eltor str. n16961
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
231
structure length
231
Chain Sequence
b'AMNDPKVIVALDYDNLADALAFVDKIDPSTCRLKVGKEMFTLFGPDFVRELHKRGFSVFLDLKFHDIPNTCSKAVKAAAELGVWMVNVHASGGERMMAASREILEPYGKERPLLIGVTVLTSMESADLQGIGILSAPQDHVLRLATLTKNAGLDGVVCSAQEASLLKQHLGREFKLVTPGIRPAGSEQGDQRRIMTPAQAIASGSDYLVIGRPITQAAHPEVVLEEINSSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
molecule tags Lyase
source organism Vibrio cholerae o1 biovar el tor
publication title 1.77 Angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase from Vibrio cholerae O1 biovar eltor str. N16961
rcsb
total genus 78
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ldvA00
2HS6A 2G5WA 1QPOA 3BG9A 4DELA 2RH9A 5CZTA 4AMAA 1W0MA 1XC4A 3NQAA 4PC8A 3SY5A 5FESA 1XDMA 2EGZA 2V30A 5BNKA 5U7SA 3DZ1A 2DP3A 2FDSA 3W85A 4IMEA 3NPXA 3M0ZA 3CIWA 3W83A 3O6YX 4AWTA 1SZGA 1JCJA 3IRDA 4N6EA 1FUYA 1RQHA 1ML1A 1YADA 3W7IA 5FF7A 1XFBA 5HUPA 2QCLA 4IOTA 2QCHA 5C55A 4RXGA 3W7LA 1G69A 2VFEA 4RKAA 3O8AA 3NOEA 1NFBA 3NM3A 2YXGA 4QITA 4ALDA 1WBJA 4N9BA 3NL5A 2QCNA 3NPUA 1U5JA 1OFQA 5G2HA 3O6DA 4UIOA 3W22A 2DORA 4HIBA 4MPQA 5KZDA 4ZL1A 5BOOA 2ZRVA 4E0CA 5CPNA 1M7OA 3P5YA 1Q6RA 5I3KA 1JVNA 4GWEA 2FIQA 4LS0A 1FWNA 5F4SA 1EUNA 1NSJA 2GPTA 4GUGA 1TPEA 1KM6A 1I2PA 1OFDA 3W9ZA 3SR7A 2OCZA 2Z6IA 2B4GA 4LV4A 1Q6OA 4IPIA 3H55A 5D2YA 5HUOA 2ZA3A 3NR0A 5I3GA 5D37A 4A29A 1O95A 1GPWA 4MFEA 2JK2A 4O50A 4A3UA 7TIMA 2Y88A 2V9DA 2ZQ0A 4ZQOA 2VXNA 3FYOA 3QMSA 1SFLA 3W7KA 4M5PA 1EWEA 3GXNA 1JUKA 2CZ5A 3Q2DA 5DCBA 2YR1A 1GVSA 4MIMA 5G2IA 5HJLA 4GUFA 4OWGA 4ORMA 3EWZA 1A5SA 4DO4A 2NX3A 1ZCOA 2OJPA 4UNKA 1OF8A 1XBYA 1F73A 3L5LA 3NQMA 3TSMA 4O10A 4YCPA 4UFKA 1WQ5A 3MYOA 4O54A 3KX6A 2E09A 4WQ6A 2WKJA 1LOSA 1OVDA 2X2GA 3EX3A 1JJKA 3F1QA 3RU6A 1IXPA 1K7FA 1H7XA 1JR1A 1TPFA 3ELFA 3KVMA 4HSNA 1SO5A 3TXVA 3VFLA 3WJSA 3RF9A 1H7RA 3A23A 3W73A 3G1XA 3G3MA 4OU1A 2J9XA 3Q37A 3C6CA 1KFKA 1E51A 3CT7A 4H4IA 3LHYA 2AAMA 4ZQCA 4JN6A 5LNWA 3M5YA 2ZBTA 4WXZA 3NGJA 4JYFA 2V2CA 2GVLA 3GNDA 3HGSA 3W1PA 3M5ZA 1H61A 4DF0A 4CNOA 4JX4A 3W76A 1QNVA 4MJZA 3VE7A 1WDWA 1N55A 1W5MA 3FA5A 1UASA 4HNUA 1ICSA 3LXAA 1K7EA 1YYAA 2E6AA 2QAFA 5AHFA 3T4CA 1WV2A 3NQFA 5HULA 3C4UA 5LSMA 1QO2A 2XN1A 1ZENA 3PBVA 3G1AA 4MLJA 3GYEA 3UPBA 4N9DA 3TQKA 2ALDA 2X1SA 5TIMA 2JKAA 3IIXA 4PCFA 1KFEA 1TV7A 1RD5A 3UYCA 1H1YA 3STCA 1LLWA 4MUZA 1DKWA 8TIMA 3M9YA 5FF4A 6ALDA 2Z1BA 3TXZA 3RK8A 1EB3A 3B0PA 3UY7A 3C56A 1B4EA 1JUEA 2C3ZA 2QUTA 2XN0A 3G22A 1HO4A 4AF0B 5FF3A 4AEOA 2ZZ6A 1WBHA 3QC3A 3DI1A 3DGRA 4GFSA 4DBDA 3LB0A 5FEXA 5A8GA 1LLZA 1YPIA 3GZ3A 3O63A 3O6CA 4CNPA 2FLIA 4QNEA 3EWYA 2V82A 5EY5A 1FY6A 1YXDA 2YPIA 1Y0EA 4FHAA 3W70A 1FQ0A 5HQEA 5LGZA 4MZ8A 3NQ2A 2B0MA 3FKKA 5T26A 5C54A 5LKYA 2DZWA 5D2TA 1PHWA 5EKYA 1UJPA 4K7VA 3W84A 1WX0A 2BX7A 1ICPA 3EWXA 1VPXA 1FDZA 4JIQA 4XWUA 4ADTA 1QR7A 3E49A 3CC1A 5IBXC 2FPVA 3W1QA 2A1YA 2P1FA 3TSBA 4XQ6A 4Y96A 3A22A 1LP6A 1SSDA 3M1ZA 1B57A 1R2TA 1FCUA 1W54A 2VENA 3L65A 1GG1A 4YCOA 1X6UA 3W72A 1FX6A 3PVFA 4Y6GA 1FCBA 4K6AA 1ZALA 2NLIA 5D32A 1G4SA 3M6YA 3TAOA 3MBFA 2WOQA 5CKSA 3F4NA 3GLCA 1VQTA 4UTUA 5K9XA 3LHWA 4JNMA 4WZHA 3S5OA 3MBDA 4QIUA 5F2LA 4GC4A 4LUIA 4N4QA 3QQ1A 1SZEA 1Q6LA 1G7UA 3LCLA 4MY9A 3TR2A 4AH7A 1LRNA 2ZRUA 2Z0IA 1AK5A 4UR7A 3E9AA 4DXVA 1K03A 4WD0A 5AC6A 3HPSA 3S1XA 2V8ZA 4UNLA 5DXYA 3M7WA 3O1NA 3USBA 3EXTA 4A22A 3NQDA 2E1DA 2E5BA 3IVUA 1W5NA 1TV8A 1EPXA 3VCRA 3FIGA 3QEZA 4AWSA 1OJXA 4XZ9A 3C2OA 2RHGA 2VFGA 2Z6JA 3W2UA 3O06A 3LTSA 2I9EA 4LC8A 3TSDA 1MSSA 4L4MA 3UXDA 2FQIA 5D03A 1ZHAA 3S5YA 2ZYFA 1KV8A 1Z44A 3PWAA 3UZ5A 1GYNA 4LRTA 1G6CA 3GVGA 5G4EA 3NXFA 1LBLA 5H91A 5G1TA 3T40A 3TH6A 3LHZA 1YDNA 2ABAA 2Q3OA 3MI2A 4BFAA 4IMGA 5LNUA 3QMTA 4X2RA 4JTLA 1OG0A 3CTLA 3WJZA 5D38A 4KWVA 4EVZA 1W5QA 4JTHA 4BWLC 5AN7A 1DVJA 1C8VA 3DFNA 3P7YA 2TSYA 3LCFA 3W1NA 3PBYA 3F03K 2V5BA 2WNQA 2GVGA 4S2CA 3BK0A 5CZJA 4YLWA 5DCDA 1PV8A 1BWLA 2LLEA 3FEMA 2Y63A 1AL7A 1OX4A 3RMJA 2VFIA 4FNPA 4IX2A 5AYZA 3GDMA 3DHFA 1T99A 2FB3A 5AB3A 5IM51 3BW3A 3MUXA 3LTPA 4LV9A 4POCA 1WOBA 3R2GA 1V5XA 1K8XA 1NVMA 3TQ0A 3TFXA 4JTKA 4J9JA 1H7WA 2VEKA 1DHPA 1W5OA 1K3UA 1RPXA 5EL1A 4O11A 2VEPA 5CPMA 3WFAA 3B06A 2ABBA 3CLMA 1H50A 4M6VA 2A4AA 4UFMA 1X1OA 4Z1BA 4MZYA 3UD6A 5U4NA 1R47A 1MZHA 2JKEA 4NJIA 2NUWA 2A7RA 1VYSX 4I7WA 2GQAA 1S5WA 3CM4A 4AHQA 5HR6A 5BMXA 2QCFA 2QR6A 2NWSA 3I7SA 1GTHA 3WK3A 3DI0A 2Y7GA 5A5WA 1ADOA 3TC7A 3W87A 2OT0A 3IVTA 3KHJA 3W7EA 1I8JA 1JCXA 4ZQMA 1AW1A 2NXHA 1OFRA 4Q33A 3W7QA 2YX0A 4HNNA 3E12A 1KM5A 4IMDA 4O1CA 2WSQA 2FPYA 3HG2A 3OHIA 3L21A 3PM6A 4IUOA 3LHTA 2QAPA 3NQVA 5EA9A 1QO5A 3CB8A 2DZVA 4E2DA 1OK6A 2GOUA 4NJGA 4A21A 4HN4A 3GAKA 4LTSA 5AYYA 4IJBA 3TROA 3NA8A 5KZMA 4JTTA 1D3GA 1G7VA 4LY8A 3M16A 4HKPA 4L4LA 1VZWA 3LXCA 5I3JA 1LRQA 1P5BA 1GG0A 1DQXA 3P81A 3GKFA 4Y90A 2B7QA 1EP1A 1FWTA 1F5ZA 1GYLA 1JRBA 3W74A 3LRLA 1WXJA 1TYGA 3W7JA 3LM7A 4TU1A 3HGJA 5HWJA 4DBEA 3NPWA 1LBFA 3MP5A 4O18A 5D02A 4UTWA 1GZGA 2H8ZA 2RKXA 1GVOA 4A2RA 3VE9A 4RXFA 3LLFA 5DLCA 3ATYA 3TDFA 3DBPA 3M43A 4LWWA 3OVPA 4XKYB 3BPWA 3L68A 3CHVA 3HQ1A 1PCWA 4OGZA 3QZEA 4PTNA 1F2JA 2ZFAA 4FNRA 4K8EA 5CSSA 1V7YA 4X22A 5C5YA 2NUXA 1ALDA 4KFOA 2A6LA 1H1ZA 2Z2UA 1OFPA 2ZTKA 2RFGA 4Y8FA 4AHPA 2Y7DA 2DZPA 2OX1A 3C3NA 1T8XA 2FFCA 2H3BA 4WY0A 2YYTA 3B04A 1A5CA 3HGRA 2I14A 3KXQA 3TCEA 2C15A 5I3FA 3LLDA 3IIZA 3HIJA 1DQWA 3NZRA 2V2HA 4GUIA 1LBMA 3LXBA 5DBTA 2R8WA 2VFDA 2G96A 3QH2A 4FNQA 1F6KA 4JEQA 4AXKA 3N9SA 3A5FA 5HR7A 3WJWA 5LNVA 2CZDA 1I45A 4KFPA 2GUUA 2ZZ4A 5KTLA 4K37A 1FXPA 1JQVA 1FWWA 2OMAA 1EA0A 2RDWA 2A85A 1AMKA 3E0IA 5F4XA 3TUUA 2CWNA 2ZTJA 1NEYA 1LZOA 1QMLA 3IIPA 2G95A 1XBZA 3LCIA 4NZJA 2P10A 4ZQRA 2ISWA 4JDBA 1O4UA 2A21A 4RLIA 3LTYA 1QPRA 1OFEA 3FFSA 4TR9A 4AVFA 2V2DA 1XUZA 4K38A 5F1UA 4UMAA 1KLYA 1LTDA 3EXRA 3C2EA 3ABQA 1XDLA 3G1DA 3UWUA 3LI0A 5D2XA 2DZXA 3TMLA 5AHIA 4O13A 4MLRA 2QUUA 3KFTA 1TTPA 3O05A 5K9DA 2Y62A 4RZ4A 3HPZA 1ME7A 3W7CA 3QPYA 2AGKA 5LNRA 3F4WA 4FF7A 1R2SA 1I2NA 3DFTA 1SW7A 3N2XA 3A21A 2A6NA 4GBUA 4UC5A 1EUAA 4LW7A 3S1UA 1KBJA 1SPQA 3KRUA 1IGSA 4GJ1A 5D04C 2DZTA 3UWWA 1SZNA 3EX6A 2NZLA 2OT1A 1X8FA 1G67A 2YW3A 2ZZ5A 3FS2A 1D3HA 3NQ8A 1TQJA 2XFWA 3JRKA 1LYXA 3FJLA 4RZ5A 4KFNA 3UNDA 2JGQA 1VH7A 3GDRA 1H51A 3SSJA 3QFEA 3M5XA 4WOQA 1M6JA 2X1RA 2FTPA 5CSRA 1YTEA 3NAVA 2X1TA 2Q8LA 5AFDA 3PG9A 3DHDA 3NNTA 4TO8A 3TA6A 3W7DA 3TJLA 5G2WA 4QISA 3BG3A 3P60A 4TIMA 4GNJA 4BI6A 1YDOA 3BGGA 4PODA 3DFOA 3UWVA 3WK2A 3GXTA 2ZA1A 2A7PA 4JXCA 4RK8A 3W2NA 4U4MA 3LX9A 5FEPA 3I68A 4FX7A 1F6PA 3LOTA 4MVAA 1TO3A 2CLMA 3MHUA 3YPIA 1VRDA 3W7GA 4LS2A 4UTLA 3IGUA 1SO3A 1ZFJA 5G5IA 1TJPA 1OK4A 3L5MA 1CI1A 1ZY9A 2ZZ3A 4IMFA 4ML9A 1PS9A 3P67A 3KRZA 4G1KA 5CZSA 1DJNA 2PRMA 4CQAA 4N02A 4CCEA 1PCKA 3DH7A 1Z41A 3PSWA 2HMCA 4GXMA 3W71A 2IQTA 1XUUA 3L67A 4IPJA 3BW4A 4H3DA 1L2UA 3HJZA 3KAOA 1H63A 3W75A 3C61A 2A2IA 3ANYA 2QJHA 1KBIA 4RX0A 4JD4A 1IXQA 1QPNA 5F1VA 3GR8A 4IGHA 4O52A 1KM0A 3I7RA 4JICA 3GDTA 3G1VA 2YDAA 2CW6A 1XL9A 5I3IA 1VC4A 2CLEA 4GE8A 1IF2A 1OX6A 2VELA 2W79A 3MW7A 3S1VA 4JY9A 5BMWA 1HG3A 3PB0A 4PEKA 5HWMA 3TU9A 5J5DA 5C2XA 4O1BA 5AHNA 3NYZA 3LCWA 3FKRA 4LT9A 4OE7A 1SR9A 2PCQA 3R89A 3CEPA 3TNOA 1TCDA 2C6QA 3I6RA 1J4EA 3OA3A 5LHEA 3VKJA 2B7OA 2WV8A 1BWKA 4M6QA 2D73A 5HINA 3PBWA 2H8XA 4CQ8A 1S3HA 1FCQA 2X1UA 3QPZA 1Q6QA 1YPFA 4E2BA 1XKYA 3HF3A 2E6YA 4EWND 1KFJA 4MYXA 3PUDA 2NXGA 3WK1A 3W86A 1YXYA 1SW0A 4WXYA 3NQ7A 1FDYA 4OV9A 3S5NA 1W3IA 2QCMA 3S42A 1LROA 2QCDB 5F2IA 3C0JA 5AHEA 4AAJA 1OYCA 1UB3A 1XCFA 2FPTA 4MYAA 3OEXA 1YXCA 4FXRA 2Q3RA 5LHFA 3CIXA 1OX4B 1F76A 5FI8A 5DELA 5KITA 1AW5A 1TTIA 1CW2A 3FJ6A 3G1SA 3WJYA 3W3OA 2E5CA 2J88A 3HG3A 3MP3A 3SGUA 3A24A 2BSLA 4O0KA 1LOQA 1DL3A 4GRSA 1TRDA 3RFAA 1L6WA 1LOLA 1ME8A 4BR1A 1NF7A 3MP4A 4R53A 3STFA 2V5LA 3RLUA 1VR6A 3GB6A 4N9CA 2EPHA 2UV8G 1HTIA 4IWWA 3VI2A 2TPSA 2NX1A 3S8HA 5BRBA 3Q58A 4QJ1A 1W1ZA 4FIRA 4CCDA 4ICNA 3ZS4A 3TK7A 3NVTA 3I65A 4HPJA 2J27A 5CZ0A 1PIIA 3TW7A 2I1OA 2E68A 4HT3A 1QCWA 4YL2A 1JUBA 3BVJA 3KVKA 3TE9A 4UTHA 3R13A 4LVDA 2WNZA 5J5RA 2VKZG 3L5AA 3CPRA 3P5ZA 1ZAHA 2O7QA 3G0SA 3PULA 3N9RA 5E1QA 1TTQA 5HNRA 3HMJG 2FB2A 4N6FA 2YZRA 3SW6A 1HL2A 2QCEA 4O17A 1TIMA 3TX9A 1Z42A 4LVGA 5F2GA 4K8HA 1VS1A 4PFMA 2JKPA 1TSIA 5H2ZA 5LZLA 5SWUA 3W1XA 3UXAA 1R46A 1S5VA 3H54A 1KFLA 4QQ3A 2B7PA 4O1AA 4Z1AA 4O4WA 1TQXA 2BZNA 1WAUA 4IXXA 5K3VA 3U6WA 3JR2A 3K30A 4Y9AA 4UFLA 3N19B 4WUIA 3W2KA 4CNNA 3EX1A 3QMRA 3G8RA 2VEIA 1QWGA 2CZFA 3SIZA 3GDLA 1A53A 4JTIA 2Y7EA 2X16A 5C6MA 3SI9A 1Z48A 2TMDA 1G4TA 2WSYA 3LCHA 2DZUA 1VGAA 4UCGA 5AYXA 3P61A 1YDVA 1MEHA 5KMYA 5AOUA 1TREA 3EEGA 3GK0A 2CZEA 3EKLA 4Z1DA 1JQXA 1MXSA 4I7UA 2ISSA 3ZWSA 1VYPX 2AQWA 4JY8A 3BGJA 2B7NA 3L9CA 3PG8A 2ZRYA 1CX9A 3E96A 2X30A 4N2YA 4A2SA 4O57A 4O28A 2YFOA 2E6FA 3UPWA 3W1LA 5LGXA 3IEBA 1G4EA 3HBLA 1LDCA 5EBUA 1QDSA 4WJEA 4IMCA 4QNWA 4XBSA 2H3DA 4JGDA 2C13A 3OG3A 1JCYA 3W2JA 4O15A 1H7PA 2E5DA 1GVRA 3HG4A 4NZFA 3M47A 4OV4A 1VCGA 3LBCA 1RQBA 1JCMP 1L6YA 2Y6ZA 1KM4A 1EX5A 3V75A 4WY0F 3G0UA 4ONVA 1DBTA 3W7RA 4JTGA 5KZEA 3QJAA 3IIVA 3OBKA 3BLFA 4FNSA 3P8IA 1TPC1 2P0OA 3EX4A 1IIHA 3MMTA 3G3DA 2ZZ1A 4FB7A 1VJIA 5EPDA 2W0UA 1FXQA 4E38A 3S6DA 3S9YA 4UTWC 3QF0A 1U83A 2RDTA 4MKNA 1DORA 3HO8A 4IX0A 1I4NA 3IGXA 4W9TA 4RR4A 4BI5A 2GVJA 1ONRA 1RZMA 4UR8A 3RLVA 2EHHA 3PAJA 3HG5A 4UFJA 4LVAA 2EAWA 1KM2A 4JTFA 4AB4A 1EP2A 1TPVA 3AJXA 3GX9A 1WYIA 1OF6A 5FEWA 4M6PA 4ADUA 3G24A 3HGOA 4HHPA 1H60A 1T96A 5EYWA 3G0XA 5HWNA 5D05A 4UTKA 4JTSA 3C2VA 3C2FA 3LV6A 4ORIA 4UTTA 3LCXA 4GUJA 1GT8A 4TX9A 2A0NA 3DENA 4N9EA 4XTIA 4UXDA 3S1WA 4OBTA 2WNNA 3W6YA 1R2RA 1OYAA 1O60A 2VFFA 2WSRA 3PC0A 4EF8A 1IXNA 1M5WA 3OIXA 3W1AA 4KKXA 3TV8A 4MZ1A 1W8SA 2V0TA 1O5XA 1IXOA 3T7VA 1HO1A 5D2WA 4MFDA 3NO5A 1EWDA 3GKAA 1TRIA 2CLFA 4K39A 4JYDA 2ATMA 3DXIA 5GVJA 4UTIA 1WA3A 3NEVA 2TYSA 3PSVA 5CPOA 3PUEA 3TKFA 3U2OA 1JRCA 1F05A 1F7BA 3QSTA 4HPXA 3WK0A 3NQCA 1KV5A 4JS3A 3UY8A 3ZR4A 4DEFA 3BARA 3P80A 3KVJA 4IXHA 1VHCA 5D30A 4NXKA 2E77A 5BW6A 3SZ8A 4NNAA 2CLIA 3V1PA 2GQ8A 3B05A 3NZ1A 4FX8A 4JR5A 3N2MA 1SSGA 1SUXA 1W56A 3FYPA 1AW2A 2R91A 3LRKA 3TC6A 1JULA 4K36A 2PRHA 4Z08A 2FJKA 2QUVA 3R5EA 2WJZA 5K7JA 4OHQA 1VCFA 4QAIA 4O53A 3BG5A 1MEWA 5D09A 3HPXA 3NPVA 3C2RA 1RV8A 2C1HA 3L0KA 4EIVA 1VHNA 4LRSA 3C8FA 3DU0A 4RZ6A 2GQ9A 1VCVA 3NQGA 2Y70A 2YCEA 5DXXA 1G4PA 2QCDA 4NT0A 3B0UX 3PF3A 4NNBA 3LCGA 2H90A 2JGYA 4FO4A 3S0CA 4RV8A 5D2VA 4NUWA 5DY3A 3TFCA 3W1RA 1KTCA 4IQLA 4AHOA 4O0ZA 5KINA 2QEZA 5AC7A 1OHLA 4O19A 4GUHA 1TPDA 5E93A 3P82A 4YWIA 4M19A 4O14A 3W23A 2QJIA 4FNTA 1UUOA 1WOAA 1TPWA 2E6DA 2HS8A 2ZRWA 2DJLA 2ZRXA 2C16A 4UUIA 3AO0A 3GXPA 4NJHA 4NNCA 4NX5A 4ZMGA 1DOSA 3NQEA 1PE1A 1Q45A 2YW4A 2Y85A 2Q8ZA 3O16A 3GIYA 1GJPA 1TB3A 1C29A 4FNUA 1H7NA 2ZRZA 2R14A 4BF9A 1S5TA 2ZA2A 4BI7A 4OQVA 4MY1A 1I2QA 1YTKA 3P62A 2QCGA 3DKLA 3BO9A 3LRMA 2F84A 3TJXA 1W3TA 4UTTC 1KLZA 5HMSA 3UZJA 3EWUA 2VEMA 5DY2A 1A5AA 2C14A 4TMBA 4TMCA 2C0AA 3DFQA 3MO7A 4DF2A 3BLIA 3UQNA 2GJLA 3MI3A 4U28A 4HSOA 2A5HA 1OFAA 1A50A 5L6UA 2PC4A 4FX6M 4LUJA 4LVFA 4R33A 1PL9A 3CEUA 1HFBA 2A7NA 3S5ZA 1ICQA 1KFCA 1P0KA 5CGQA 5AHMA 1Q3NA 3CQ0A 4X3ZA 2OZ0A 4R34A 1AG1O 2DZSA 2WO5A 2ZDRA 6TIMA 3H53A 3W2LA 1SQ7A 3QRHA 4C1LA 3ABSA 3BV4A 2F7FA 3EX2A 3R8RA 4BWLA 2ISVA 2BTMA 3PUOA 2BLEA 1MEIA 4S2BA 1P1XA 5L9FA 1OX5A 1L6SA 1A5BA 3T44A 1QPQA 1FBAA 4MOZA 3E02A 4CCCA 3OVRA 3M5VA 3D0CA 4O8RA 3M41A 3B4UA 1RQEA 4AWUA 3P74A 3W7MA 3T55A 3LHVA 4PL1A 2QKFA 3MWAA 2NX9A 5DCEA 4LOCA 3B8DA 1ME9A 2YYUA 4FXSA 3GDKA 2QCCA 1EP3A 1LORA 3A5VA 4RCXA 2CLLA 4WOZA 3N3MA 5EMUA 2PRLA 4BK9A 1XBVA 4UFIA 1L9WA 4O12A 1EIXA 3IGSA 4OT7A 2NV2A 2R94A 3ZWTA 2HSAA 1KM3A 3NDOA 4I7VA 2DU2A 3G8EA 4JYEA 1LCOA 3T78A 3VNDA 1XBXA 3CU2A 4NU7A 4HNTA 4I9AA 3W7OA 4DO6A 1J5TA 2KZHA 3NQ6A 3DFSA 1KTBA 1ZAJA 2GJNA 5K2ZA 1GQNA 2CU0A 1FCVA 2CLOA 3QW3A 1PVNA 4WY0B 3WJXA 3IVSA 1JCLA 1P0NA 2C19A 3MHFA 1XXXA 1DV7A 3EWWA 4YXGA 2ATSA 3NM1A 3FLUA 2EF9A 4UMBA 1KW1A 1TMHA 4UTJA 1GOXA 3L2IA 1H7OA 4XUGA 3IV3A 4P61A 2WQPA 2NWRA 1X7FA 1KA9F 1QOPA 2PURA 1O5KA 3N34A 3MJYA 3GR7A 4Q32A 4Q4KA 4LVBA 4QSHA 3MHGA 3THQA 4NVTA 1KFBA 1O94A 3QSRA 3MYPA 1N7KA 3TW6A 4PL2A 1KM1A 4UFHA 1P4CA 2YFNA 3NL2A 3ZFHA 1H5YA 3IIOA 3EB2A 3L0GA 2H6RA 4NJJA 1FDJA 5F4WA 4ADSA 5FF0A 3NL6A 2DJXA 3QQ0A 4JTJA 1B3OA 3TIMA 2JBMA 4NQ1A 3KRSA 1AL8A 3UWQA 3STEA 3DKJA 1K7XA 3LDVA 1T0OA 2ZZ7A 5F2MA 3A9IA 1NF0A 1BTMA 2VC6A 3G1YA 4EF9A 3N14A 3NG3A 3LBMA 4XTDA 3CWNA 3L66A 1XM3A 2ZZ2A 4DF1A 4QM1A 3LV5A 2ZCGA 4LU0A 2QDGA 3SFKA 4C1KA 3W1MA 1W5PA 5K9CA 4Z0JA 4RJEA 4DO5A 3PY2A 1XI3A 1SW3A 1H62A 3JS3A 1OFBA 1JCNA 3LGEA 1K8YA 2TRSA 1SU5A 4XBKA 3P8JA 5TQLA 1PHQA 3W7NA 1RVGA 5AC8A 2Y89A 1QAPA 5KSWA 4NXSA 3ATZA 1NAL1 1SO6A 3LI1A 3DAQA 3G1HA 3TQVA 1R30A 3EXSA 3RNDA 3Q94A 2RDUA 1TJRA 1DJQA 3SGZA 3KOFA 3LERA 4FIQA 4MY8A 2NXIA 2W6RA 3PS7A 1W37A 4FEZA 4LNYA 1ZJIA 3INPA 4CLMA 1FWRA 3QYQA 4UTMA 1UCWA 3G18A 4K7YA 2YSWA 3U8GA 4XKYA 1M7PA 2VOMA 1YTDA 1TV5A 1W3NA 4EOUA 5AHLA 3LHUA 2PE4A 2VFHA 1GTEA 1GVFA 4JX5A 4JTUA 3TAKA 1THFD 5DN1A 2Y7FA 4HNVA 4WX2A 1BEUA 1ZAIA 3PR2A 4ZQPA 3FOKA 1LRTA 4JX6A 5MHBA 5D33A 3W88A 4N4PA 3DFPA 1GEQA 4LS1A 5G4WA 4DPQA 1SZFA 3W07A 4LC6A 3THAA 4Z1CA 4O16A 4KWWA 2J6XA 2BXVA 3I7QA 3QW4B 3NL3A 3B03A 1OFOA 5G1YA 1VLIA 1ZNNA 3SJ3A 1K8ZA 2J24A 5ABTA 2J9YA 3STGA 4DQWA 5K4ZA 1RR2A 4ZZ9A 5DBUA 2NV1A 4PA8A 4Z0SA 3PBUA 1TTJA 3GNNA 4NX0A 1F74A 1MO0A 4JIPA 3HOJA 1N8FA 3GAYA 3G1FA 1GVQA 1KTNA 4JDYA 2CLHA 3BW2A 4O4VA 1FWSA 5FEZA 5CG7A 5IBXA 3SECA 4M7TA 4PH6A 1SO4A 1OABA 2QDHA 5LNSA 3L0NA 1UUMA 3B0VC 3HB9A 2QJGA 1VLWA 4NJKA 1K02A 3W7PA 4M7SA 4ZVJA 4D2JA 1QFEA 1VYRA 2G97A 3O15A 1I2OA 4S1FA 1B4KA 1B9BA 4CQ9A 3KVLA 3QM3A 2QF7A 3ABOA 3O07A 1GWJA 3MI6A 2WPBA 1W31A 4ZQNA 1EEPA 1IIGA 2C18A 2CLKA 3N73A 4R7JA 5I3HA 5K4XA 1I2RA 1TPH1 4X9SA 3BLEA 4JTEA 3W2MA 5FF2A 5TBOA 4MJMA 1OYBA 3OVQA 3W7HA 1UBSA 5E0KA 4UMCA 1C9DA 4AF0A 4B5NA 2YGYA 1YLVA 3M44A 2EKCA 4DPPA 1X1ZA 3C52A 1HUVA 2CFFA 3P84A 5CPLA 1SFJA 1TPB1 1TPUA 2XN2A 3EWBX 4H6KA 4YMZA 2HTMA 3W1UA 3ABRA 1J2WA 3CWOX 3PB2A 2V81A 4O1DA 1QOQA 3R12A 2Y61A 3TMQA 1BKSA 2BWGA 3EKZA 1D9EA 3UWZA 3UWYA 1LM1A 3W1TA 2O7SA 2NUYA 2J9ZA 4P2VA
chains in the Genus database with same CATH superfamily
2HS6A 3VNZA 3JZEA 4MB1A 4DELA 5CZTA 4AMAA 3F7JA 4K1WA 1XDMA 3DESA 2V30A 2FVMA 3DZ1A 2GLKA 1GW1A 4NAFB 4IMEA 2SFPA 4YNGA 3ANVA 3WUFA 1XYZA 4AWTA 2VJXA 4PUEA 2VVNA 5FF7A 3H2NA 3NEHA 3N12A 5C55A 4RXGA 2ZUTA 1G69A 4KMQA 3G5EA 4JL1A 1REQB 2YXGA 4S3GA 4ALDA 4MWAB 4N9BA 1KO0A 1FH7A 3NPUA 1U5JA 5G2HA 4UIOA 3W22A 5LXEA 4YU1A 4IGNA 1EGZA 3QVQA 1XLJA 1PZ0A 5CPNA 3MCOA 3QBUA 4TXEA 1ECEA 3FDKA 3CHDA 4DXKA 1EUNA 4LYKA 4MB3A 3AYVA 3GIPA 3UETA 4GUGA 3FVDA 1OFDA 2EG8A 2PWHA 1UWQA 2Z6IA 2B4GA 3HM7A 2R82A 3A4AA 4PE8A 3EOEA 2Z7KA 2ZA3A 3NR0A 4O0QA 5D37A 4A3UA 3WUBA 4QE4A 4AWEA 4ZQOA 2VXNA 1GPFA 1E55A 4DAIA 4FXJA 2CZ5A 1Z8AA 5DCBA 1H0GA 2YR1A 1HL9A 4MJ4A 2J7HA 4ORMA 3V0TA 4OZOA 2NX3A 1L2QA 4M8UA 1ADSA 1ZCOA 2OJPA 1XH2A 4G7EB 2EJAA 1OF8A 4AX7A 2QYGA 3SJNA 4IL2A 2HE5A 4YCPA 4DWSD 3MYOA 1WZAA 3VM7A 2DH3A 1LOSA 3F1QA 4HU4A 1AH4A 3HV9A 1SO5A 3TXVA 3RF9A 4YPJA 3W73A 1E9LA 4OU1A 3Q37A 3C6CA 4JN8A 3CT7A 4H4IA 7ODCA 5LNWA 5IDIA 1UKOA 1CGWA 2ZBTA 3B8VA 1ISZA 3OVGA 3VOJA 3GNDA 5DX7A 4MJZA 4X2PA 5T8GA 3FA5A 4BQ3A 3POHA 4LXFA 5FIPA 1WAWA 1K7EA 4U5KA 5AHFA 1A47A 3NURA 2ZWYA 1WV2A 4BKNA 4UOZA 5HULA 3QOKA 1WDQA 1WZMA 1QO2A 2XN1A 3WF2A 3PBVA 3G1AA 4KESA 3RMEA 4WDWA 4QG6A 4PCFA 4RE3A 5BCAA 1FWFC 1BXBA 3UYCA 2BVDA 4H2CA 4E2VA 2AKZA 2YCLB 6ALDA 5CPQA 1NQKA 3UY7A 1JUEA 2OQLA 2REQB 1LT7A 2ZZ6A 3WD0A 3XISA 1JNDA 1YPIA 2FLIA 4QNEA 2V82A 4Y9NA 4LEFA 4NAEA 4FHAA 4AC7C 1FQ0A 2BODX 5T26A 5C54A 2FZ8A 4W7UA 1UJPA 2BX7A 4YVPA 4GZIA 2Y24A 3EWXA 1VPXA 4NIRA 4IIHA 2ZX6A 1QPKA 3DYMA 2RJGA 3TYEA 1GJWA 2P1FA 1QHOA 1FWHC 4XB3A 1ZJAA 4Y96A 1GG1A 3APTA 1V3MA 3W72A 1R85A 3AMDA 1Q7MA 3XIMA 3R94A 1ZALA 1EBGA 3D5HA 3VNIA 2NLIA 5D32A 1JDDA 3TAOA 3TWBA 1E3ZA 2WOQA 2E8YA 1Q8AA 5CKSA 3RM4A 1QNQA 1F3WA 2PU1A 4HU8A 4UTUA 5K9XA 3TP4A 3S83A 3S5OA 3ITXA 1K9TA 4DJFD 1K9DA 4WCJA 2OGYA 1TX0A 4MY9A 5F7UA 2JEPA 2PLCA 4DXVA 3E9AA 4WD0A 1E6NA 3S1XA 4UNLA 3M7WA 1JAKA 3USBA 1W1TA 4A22A 1Q6EA 3AXMA 4D8LA 1W5NA 1TV8A 4HYWA 3VCRA 5A8PA 1UBPC 4V33A 1J0YA 1T41A 4E3TA 2PDMA 4F2BA 1OJXA 4XZ9A 2RHGA 3RYSA 1LUCA 4MUPA 5I77A 2WHJA 3O06A 1CXHA 3VM5A 3GFZA 3FGCB 1N82A 1OC6A 4A3YA 3EB4A 4XAFA 2AGTA 5IDZA 2OKOA 4UCFA 3ISIX 3WLKX 2FZMA 4AIBA 3KBNA 1ZHAA 4IP7A 2X0SA 3BANA 4JFVA 4DJDC 1KV8A 4PB4A 3UZ5A 4LRTA 1G6CA 3GVGA 3NXFA 2XM2A 4HA4A 1LBLA 5H91A 2GK1B 4OTKA 1OINA 4BFAA 1PWMA 5KETA 4GNVA 4X2RA 4AEFA 3CTLA 4KWVA 4EVZA 1VF8A 1W5QA 4BWLC 3KTXA 5AN7A 3T4WA 2ZWZA 1JYVA 3W4RA 3F5JA 1F3TA 2WNQA 2GVGA 3OG2A 1K77A 3GXIA 4NZ1A 1Q4WA 3BL3A 1AODA 4GZ7A 3ZT6A 2VFIA 4ROQA 1JDFA 1NM9A 3BW3A 3MUXA 1IZCA 1U5HA 3OTRA 3TQ0A 1K8XA 1CEOA 1EJWC 4J9JA 1G94A 1PDZA 2QHAA 1W5OA 5FJUA 1RPXA 1UKQA 5JMUA 5CPMA 1IR2A 2WWCA 2ABBA 1XKJA 3CLMA 4AZ5A 1H50A 3VO0A 4EXBA 4UFMA 3SUSA 4MZYA 3SUTA 5U4NA 1R47A 4HOZA 1MZHA 2XZ7A 2NUWA 3P2VA 4MB4A 3AUJA 4ACZB 4I7WA 1X6LA 2ODOA 3CM4A 1PDYA 4GIAA 2QCFA 4LALA 2OFJA 3DI0A 4PUUA 2EG7A 1DWGM 3V5CA 2XIJA 1BG9A 1AW1A 4HD5A 1GOQA 4Q33A 4S3BA 4DJED 2XVGA 3HG2A 3OHIA 2Z29A 3B8SA 1WXYA 3NQVA 5EA9A 3KEHA 2WANA 2DZVA 1OK6A 2GOUA 1XG4A 4XAYA 2VD9A 4IJBA 3TROA 1UR0A 4LY8A 3M16A 4HKPA 4L4LA 2PDGA 2V3EA 1NIUA 1WDRA 4LX4A 2NT1A 2VGIA 5JH1A 3VK5A 1EOKA 3BQ5A 2F61A 3ARRA 3LM7A 1W3KA 3EGJA 4EAMA 2ZXAA 1V6VA 3NPWA 4O18A 1R3YA 2H8ZA 3T09A 4GYFA 1GVOA 3LLFA 5DLCA 3ATYA 3TDFA 1XX1A 3AZRA 6REQB 4XIMA 4LWWA 1KRMA 3OVPA 4L9ZA 3BPWA 1YRRA 3ITLA 2WSPA 4NZ3A 3QZEA 1ITUA 4X22A 2L5HA 4GQBA 3CQKA 1E4MM 3SBFA 2OODA 3T0TA 2DZPA 2FFCA 2FFIA 4PBFA 4WY0A 1YEYA 1GOMA 3B04A 4W85A 3RDKA 3CS2A 4P8XA 1QI5A 2I14A 3ZYZA 2PBOA 1WKDA 3KXQA 2C15A 2OEJA 3PPCA 2GVYA 4F0SA 4PCSA 1LBMA 1W3HA 3LXBA 5GNXA 2ZVRA 4WK9A 4QJ3B 4YJ5A 3QR0A 2I5IA 3GVRA 4JEQA 2QGHA 3N9SA 2HK1A 3QHMA 4XKMA 5A6BA 3AZTA 3WNLA 2IPFA 2CZDA 1I45A 3N6QA 3LA4A 2ZZ4A 2BG5A 1JQVA 1Q63A 1EA0A 7CGTA 1H41A 5F4XA 3GC5A 1LUCB 2CWNA 3FEQA 5BXPA 1E1CA 3WD2A 1QMLA 3TYCA 5I23A 3VZYA 4ASTA 2P10A 3HPAA 1O4UA 2AMXA 2FTWA 3EAUA 3H7UA 3LTYA 2PODA 1C7SA 1W9PA 4W89A 1OSEA 2FZDA 4K38A 2PP0A 4LUTB 3LEPA 4P8WA 1KGWA 1CECA 1LTDA 1XDLA 1O1ZA 3OLIA 5JH2A 4S38A 3ORWA 3AXHA 2TODA 4MLRA 2PDJA 5K9DA 3L2MA 4J7RA 1FH9A 2ZXDA 1R2SA 1I2NA 3BCJA 3DFTA 3A21A 1REQA 3RLHA 1EYEA 3GHRA 4RE2A 3KBVA 3RN6A 3S1UA 1PIGA 4C1NB 1KBJA 4KCUA 4MNMA 3SQSA 3GTHA 2DZTA 1V77A 1SZNA 3EOUA 3DECA 2PWGA 1S2TA 2YW3A 2VVSA 5A6JA 1D3HA 1V0NA 3JRKA 4DXXA 5CH9A 4CVUA 3FJLA 4RZ5A 1VH7A 1HKIA 4RV3A 3SCPA 3GDRA 1AUSL 3QFEA 3M5XA 4WOQA 3OGVA 1YTEA 1AZ2A 3DHDA 4Q6JA 3AUOA 5G2WA 2F9RA 4H9YA 3P60A 1FWEC 4GNJA 4BI6A 4PEEA 2QNEA 3U7BA 3DFOA 1QI2A 2ZA1A 1AH3A 4JXCA 4RK8A 3W2NA 4V27A 2EXOA 1PX4A 4REQB 5FEPA 3I68A 1YIXA 5CSYA 3R58A 3QLDA 4XAPA 3W7GA 7XIMA 2AQOA 3IGUA 1SO3A 1ZFJA 3SCNA 4PTXA 1CI1A 5TD4A 2BV9A 4HPHA 1PS9A 3OZYA 1GONA 2Z4GA 1DJNA 1E71M 2V5KA 5JXQA 2WAGA 1HJWA 1CDGA 4AIUA 3L67A 1UD6A 1W6TA 1L2UA 3ZIZA 5DMLA 1H63A 2IQDA 1KBIA 2XGBA 4RX0A 2YDQA 1IXQA 4E4PA 3I7RA 3GDTA 3NJ3A 4ERAA 2P3EA 4HHMA 3R43A 1XL9A 3AIUA 5I3IA 1VC4A 1Q85A 1EOMA 1MVYA 2PDXA 3BICA 3TW9A 3S1VA 1FHLA 1HG3A 1TFVA 1XS2A 3VAVA 4GQQA 3LCWA 2XFRA 1MQQA 5DT5A 1Y5XA 4LT9A 1XYAA 4OE7A 4Z2LA 1Z3NA 3TONA 3DHPA 2HNHA 2PTDA 7TAAA 1PIFA 3CMFA 3OA3A 5LHEA 2WV8A 2CCRA 3IK4A 4GJJA 1NFGA 3RG6A 5B7YA 1S3HA 3SRHA 3HU7A 2VMFA 4MKVA 3GTNA 4OFCA 5C7VA 4IFKB 3KOWA 3HFYA 1XRVA 1DTNA 3UERA 1CCWB 1VEPA 2NXGA 3UCCA 3E3HA 3W86A 4FLRA 4XZBA 1YXYA 1RHCA 4D6GA 1TVNA 4FZIA 3NQ7A 3GZAA 4H7ZA 1V3LA 2QCMA 1LROA 5C7HA 4BEQA 5AHEA 3N6JA 5GNYA 4ZODA 4Z2KA 1YW1A 4DBWA 1YXCA 1UZDA 1E1CB 6XIAA 4HZ8A 1DEDA 2XIIA 3DFHA 1JXKA 3HG3A 3UBPC 2PTXA 4YHEA 4L1XA 3A24A 3QPEA 4XZNX 4GD0A 2DUZA 4AD1A 3RFAA 1L6WA 3BAJA 4BR1A 1NF7A 1TZZA 3MP4A 1D3CA 2QPXA 4GJIA 1XLDA 1ITXA 4GY0A 3S2MA 1VFTA 1B3WA 3VKDA 1EL3A 3SY1A 5C9ZA 2J7EA 1OCJA 2V5LA 3STFA 2BGQA 1PBGA 1VR6A 4N9CA 4N7QA 3ARUA 4IWWA 3WFLA 4R5EA 2XUCA 1PAMA 4ICNA 3PZOA 3POCA 4AD2A 4W8AA 3TA9A 1AA1B 3R7MA 4IP5A 5CZ0A 1YPXA 2I1OA 3PPHA 1XQLA 2E68A 3BVJA 4KF1A 1CWYA 3TE9A 4NAEB 4HU3A 5J5RA 4QE5A 1Z6KA 4GYJA 3I4EA 4A8NA 2O7QA 3G0SA 1GNXA 3PULA 4US6A 3VOFA 1U22A 5HNRA 3NIYA 1KCZA 1XGEA 4HB7A 1XYLA 3SW6A 1HL2A 2PCEA 1PKLA 1OD0A 4XISA 4LVGA 5F2GA 4K8HA 1R87A 1KRCC 1KCKA 4P5UA 2JIWA 4S3FA 1VBRA 3TQPA 5LZLA 5SWUA 5MKGA 4IPNB 1R46A 1S5VA 4L7ZA 2HXTA 1WKEA 3H54A 1KFLA 2B7PA 3VIGA 1OZMA 4AVOA 4IXXA 4GCXA 5K3VA 2WZHA 1OIFA 1WUEA 3U6WA 5FAJA 3L4TA 1S46A 4WUIA 2UY3A 5ENLA 4W7WA 2O9TA 3F5LA 2WKLA 3RU8X 2GJXA 4JTIA 3N15A 3R79A 3N2CA 4H6EA 4Q8OA 4CQCA 1Z48A 5XIAA 4IUGA 2VZTA 3VC5A 3VNKA 1XIFA 2WM0A 4EANA 1VENA 1MEHA 1DIDA 4HA1A 2VEFA 3D47A 1G9HA 2PWUA 4CGTA 3LQGA 1CX9A 3E96A 3R0UA 4N2YA 3WF3A 4O28A 1JF5A 3W1LA 5LGXA 3BUVA 3IEBA 1G4EA 3S3GA 1QDSA 2FMNA 2VC5A 2Z1WA 1XC6A 4QNWA 1J11A 1UZHA 3GVQA 2ZKMX 2C13A 4Z42C 3W2JA 3VIHA 1H7PA 5I78A 3HQOA 3E1F1 3B9DA 1UR3M 1M3UA 2A3EA 3HG4A 4NZFA 2YA1A 1HP5A 4J3ZA 4KEVA 1JCMP 5EFFA 4DUWA 1CLXA 4BF5A 1HJVA 1EX5A 5GPRA 4D6IA 3G0UA 3C2YA 3W7RA 3QJAA 4QCFA 2GWNA 3BLFA 4TV6A 4FNSA 4HYVA 1ZB5A 2DH2A 1F3EA 3P8IA 2EEXA 4KIEA 3EX4A 4ZOCA 3W24A 1NDZA 4JFUA 3MMTA 3WNPA 3SO7A 1VPQA 1RCXB 4FB7A 1VJIA 5EPDA 2W0UA 3OYZA 2G3IA 4E38A 2FGZA 3G6LA 3S6DA 1EO7A 1NJJA 3CZLA 3P6LA 3PNZA 3WLLA 1U83A 3KS5A 3VUPA 2D0GA 3BZGA 2BNJA 4H41A 4BI5A 2GVJA 3GY1A 8XIMA 2EHHA 1KM2A 1K8CA 2BS9A 4J27A 4JTFA 1OG6A 4ZE4A 1WYIA 4XZMX 2Q6ZA 3AWOA 4QP0A 2PDPA 3VKAA 5LIWX 5I07A 3G0XA 1DXEA 5D05A 5B7ZA 4YIWA 4JTSA 3C2FA 2YL5A 4UTTA 4GUJA 1XCXA 3RM8A 4UQBA 1KB3A 3DENA 4GHRA 4TVDA 4IP4A 5T9BG 4ZFCA 4ZA0A 4IIDA 4LBSA 4OJYA 1R2RA 4HNOA 3PC0A 2GZXA 1R3SA 3WLPA 1HKVA 2GDVA 1J0KA 4IQDA 4H19A 1MRQA 4KKXA 1ELSA 4Q8UA 4NZ4A 4S39A 2CXGA 2X41A 4GIRA 1EWDA 3GH4A 3GKAA 1TRIA 1UHVA 2CLFA 2ZXBA 4K39A 3VD9A 3VDBA 3DXIA 3H22A 3SGGA 1RLDA 1WA3A 4EPBC 1O66A 1A3HA 2V63A 3PUEA 2VGBA 4K8GA 1F05A 1KV5A 4JS3A 3AHTA 4V28A 3T8LA 3N2MA 4V15A 1E6RA 1ZUAX 3ZJ6A 4HHLA 1ADDA 3SRDA 1W32A 4Q8PA 2QUVA 2VL4A 2YCKX 4OHQA 4X61A 4QAIA 1DJXA 5HA7A 4AZIA 1KC7A 2Z1SA 4NHVA 2J7CA 1XHGA 1A3XA 3RAOA 2FVKA 2VZOA 1I0DA 1RV8A 4P7LA 1HW6A 4EIVA 1VHNA 3WMCA 4EPDC 1CXFA 2PDLA 3UZYA 3DU0A 3GFXA 3TN6A 2GQ9A 2Y70A 3CUZA 3VDCA 4NT0A 3B0UX 1BLIA 1JF6A 4KCTA 5D4YA 3T6CA 3WQVA 2JGYA 4FO4A 3VU2A 3EDFA 1JYNA 5DY3A 3W1RA 4FMVA 4AHOA 1OHLA 1MW2A 4HPGA 2Q02A 5E93A 1J12A 3W23A 5H1WA 3PZMA 1W9DM 1VP5A 1UWTA 1KBBA 1TPWA 1W9VA 2E6DA 1SJAA 1E0XA 2YZ5A 1AQHA 4DWSC 3AO0A 3GXPA 3OZOA 4NX5A 1DIEA 1MNZA 3SURA 4XO7A 2YW4A 3DFYA 2Q8ZA 1K6WA 2VTFA 3GIYA 1DIKA 5A3HA 1EZWA 4PMVA 3BSGA 3OGRA 2VZUA 3COTA 2WB5A 2ZA2A 1JGIA 1YTKA 3TJXA 3GH7A 1DWJM 3V1HA 1EH9A 5HMSA 2OEMA 1OGGA 2CXEA 1NOUA 3AC0A 4U28A 3RGTA 3UGRA 1GKPA 4HSOA 3K1GA 3PJXA 4FX6M 4KGLA 4IH3A 3NZQA 3VPLA 4R33A 3S5ZA 1R6WA 3WBWA 3AMGA 1UD8A 3V18A 1VBHA 2OZ0A 1UMLA 2DZSA 2DW7A 4FLOA 2ZDRA 6TIMA 2W4XA 1QT1A 3H53A 2ZX5A 2G4JA 1SQ7A 5MF5A 1M9HA 1E15A 2ISVA 4F3HA 3CYVA 3PUOA 1R9XA 3OOQA 2BLEA 4TUFA 1P1XA 5L9FA 4HK5A 3HA1A 3GU9A 3T44A 4LCSA 4P8UA 4I8DA 1CYGA 1L8PA 3AROA 4CCCA 3OVRA 2VR2A 2MANA 4AUBA 3M41A 3P74A 2I17A 3T55A 3LHVA 2QKFA 3HTWA 3MWAA 2B81A 2YYUA 4FXSA 3FSUA 3RCYA 3IRSA 1LORA 4ZBCA 4GQGA 2DIEA 3EZ4A 3KP0A 4KS0A 1XBVA 4O12A 3KOZA 4HJFA 2NV2A 2R94A 3ZWTA 2HSAA 3G8EA 3H2FA 4JYEA 3UGVA 4DLMA 2W92A 1A80A 2BOFX 4NU7A 3CAVA 3SAZA 4DO6A 3S1GA 2GJNA 3OYXA 1FCVA 2CLOA 2XSAA 5BXRA 3MHFA 4YXGA 2ATSA 2EF9A 3CGTA 1GOXA 2QDEA 3DGBA 3VABA 5A6KA 1KA9F 1W8GA 3AS2A 3MJYA 3GNRA 4QSHA 3MHGA 3IV8A 1KFBA 3QSRA 4PUKA 1KM1A 2O56A 4UFHA 1U1JA 2YFNA 2X05A 3IIOA 4AX6A 1GYMA 3WH7A 5D8ZA 1WUFA 2OOGA 5F4WA 5FF0A 3MZNA 4Q4SA 3NL6A 1A3WA 5IOBA 2PZ0A 1E1EA 1MI3A 1ODUA 1T0OA 5F2MA 5CJNA 1NF0A 1QW7A 2VC6A 3VGGA 1VEOA 3LBMA 2PI6A 4EXAA 1BTCA 4D6HA 5E9AA 4H2HA 4N42A 4QM1A 3CHFA 4C1KA 1NH6A 3PZQA 1W5PA 1TUXA 5K9CA 4Z0JA 4RJEA 3PY2A 1IV8A 3FA4A 3KL3A 4PCPA 1V0LA 4NXSA 1V03A 3ATZA 2QV5A 1R30A 1ZJBA 1NU5A 2HISA 2OZ8A 2RDUA 1TJRA 1DJQA 3NDYA 5I06A 4DI8A 2CLPA 2Y8KA 2MNRA 2NXIA 5REQA 3INPA 3EB3A 4JHMA 4UTMA 1UCWA 3F4VA 4GC3A 2BGNE 4C6KA 2VOMA 1VBJA 5CC5A 2J47A 3IUDA 4DWSB 1GTEA 3GQYA 1XP3A 4DJFA 2Y7FA 4RPPA 4WX2A 1LRTA 4LYPA 4DAFA 1D8WA 2PD9A 3DFPA 5G4WA 1EJVC 3WEOA 1SZFA 2IPWA 2ZIDA 4ZE5A 4O16A 3WF4A 1PKNA 5HPOA 2BXVA 5BXTA 3M0XA 2WVTA 3HV8A 2E1WA 4N0RA 2ON3A 2QQ6A 1SMDA 1QBBA 5C0QA 3AS3A 2J24A 1AQFA 1KXHA 2I7GA 3V0UA 2J9YA 4ZZ9A 1M01A 4PA8A 1TTJA 2GGIA 1QOXA 4JIPA 3UZXA 3D3AA 3W27A 1KTNA 1C90A 4TX8A 5HMEA 1T6MA 2C91A 2CLHA 1U33A 1SO4A 1EJUC 5LNSA 3L0NA 2DPEA 2QJGA 4NJKA 3LQLA 4M7SA 4URIA 1L8NA 4D2JA 2A3BA 2G97A 1CENA 2FHBA 2P5NA 3O15A 4B3KA 1N2VA 3VC6A 3KVLA 4JKLA 3ABOA 2X7WA 2O9RA 1GWJA 2WPBA 1F4HA 5ECUA 2CLKA 5I3HA 3M64A 3BLEA 3JU2A 3TTSA 3FCPA 3W2MA 3RILA 4MJMA 2WLYA 1J6PA 3OVQA 4UMCA 1SYTA 3EEZA 1I9CB 3DX5A 4QSFA 3OLGA 2VCBA 3APGA 1W1PA 2CFFA 5CPLA 1SFJA 3WLNA 3KWXA 2XIQA 4JIRA 3EWBX 2YOCA 4H6KA 4Z2JA 2F2HA 2W63A 4H8UA 1HJSA 2E40A 2HTMA 3CB3A 1LQ0A 3RO8A 2V81A 2BWGA 1D9EA 1Q66A 3ZZ1A 1LM1A 3FSTA 3MZ2A 4P2VA 3U4AA 1W2PA 4H9XA 5E6YA 3L2LA 2GDQA 4GYKA 5C9XA 2DSVA 3IJ6A 1W0MA 4PC8A 3URAA 2PBGA 2EGZA 5BNKA 5U7SA 3NPXA 3M0ZA 1BHGA 2YA0A 4R9XA 3W83A 1WZLA 2Y0FA 1JFXA 3HFTA 3WBEA 3W0KA 1JCJA 4KBXA 5JUVA 3KTSA 4N6EA 4CQBA 1FUYA 2WWDA 3WQ4A 3ZVHB 1ML1A 3W7IA 4ZO9A 1Y7VA 4HVXA 2QCLA 5HQLA 5M2FX 2VFEA 5ABFA 1NFBA 3T0BA 4C6FA 3PZUA 4CN6A 1EYWA 5DT7A 4QITA 1WBJA 4YVXA 2QCNA 2DORA 4HIBA 3PNUA 2ZRVA 4E0CA 4C6BA 4I5XA 4F0HA 1Q6RA 1JVNA 4GWEA 2FIQA 4LS0A 3S2NA 1FWNA 4CVWA 3ZXWA 2BOGX 2RAGA 4IG2B 4JCMA 9RUBA 2NVDA 1J01A 2ACRA 4KRZA 4LAOA 3TYAA 4DN1A 1LQAA 3H55A 5D2YA 4AZCA 4AYGA 3IPWA 1GZJA 2JK2A 2WCSA 4F8XA 3MTWA 3FYOA 1H3GA 2OSYA 3GC4A 4M5PA 1EWEA 3VOHA 3GXNA 3G77A 5G2IA 5HJLA 5I2UA 2OEKA 4RE4A 2OSWA 3EWZA 3GTXA 3SIMA 4DO4A 4M3PA 4UNKA 4LBUA 4PZVA 3LGGA 4BF7A 4XD5A 4HTBA 4QGCA 1PX8A 1F73A 3NQMA 1JIBA 1WQ5A 4WQ6A 2EG6A 2PMQA 4PTDA 5XIMA 1OVDA 2PWDA 1JJKA 1QI4A 4IISA 3SM0A 1R3RA 2YLLA 5C71A 1IXPA 1K7FA 2POTA 1JGMA 1H7XA 3KBMA 3SFWA 3KVMA 1V7AA 1YHTA 3PTMA 1Y65A 1QVBA 3G1XA 1I1XA 1LL7A 3A12A 4S3KA 3LHYA 1R3TA 4GH3A 4H8VA 2OSXA 2V2CA 5A6BD 3HGSA 2XWDA 2G3NA 3CNYA 5GJNA 4CNOA 1FWCC 3VKKA 3W76A 3ZVIA 2I56A 5DMMA 4XG1A 3BE7A 1ICSA 3LXAA 5AC4A 3DUGA 2E6AA 1VPYA 1IWPA 3MWCA 1L0PA 1W1B1 2PC8A 1BYBA 1UUQA 1ISXA 2QVHA 2WVVA 4EPKA 2FZNA 4HGXA 3B40A 3UPBA 1XIGA 3CAWA 2RDXA 4ZENA 1VFFA 3IIXA 3URNA 2A3LA 3LU2A 1H1YA 2ISFA 2Y1HA 4CCZA 3CL7A 3MUZ1 3BOXA 1XH1A 3FA3A 4L1WA 4US5A 5GJMA 3S47A 3TXZA 2IQ0A 1B4EA 1V93A 2XN0A 1HO4A 2DSZA 1DJHA 3C3UA 2YDSA 5FF3A 4W84A 1WBHA 3DI1A 3BDKA 3UA3A 4GFSA 4DBDA 1C8XA 3LB0A 2Z26A 5A8GA 1LLZA 3O63A 2HDJA 2AAAA 4CNPA 4DVOA 1B3ZA 1YXDA 3AWNA 2ZICA 4GO9A 4MZ8A 2QZRA 3FKKA 5LKYA 2GJXB 5D2TA 1PHWA 1UROA 2ADAA 2FZBA 1BXCA 4PMJA 2GJRA 4PMOA 4JIQA 4ADTA 1JDCA 3GNXA 3E49A 3CC1A 3VILA 3PN8A 3KTCA 1UH2A 1YQ2A 3WQ5A 4XQ6A 5CEWA 4B4HA 3A22A 4U3CA 4JQ1A 3M1ZA 3M0MA 1B57A 1R2TA 1JDAA 1FCUA 3OQEA 3WF0A 2Z7GA 4YCOA 4GI8A 3H21A 2EPLX 3EMCA 4Y6GA 1KXVA 1NQ6A 4WHBA 1ODZA 4Q4QA 3M6YA 2V5JA 3KP1A 3F4NA 1GUVA 3GLCA 3SEPA 1J96A 2E8ZA 3O9NA 3LHWA 4JNMA 4Y2WA 5CZKA 2CEQA 5F2LA 3QQ1A 4Z2IA 4WR3A 1EJXC 1G7UA 3TR2A 4AG0A 4AH7A 2ZRUA 3B0XA 2WZTA 3HPSA 4G8TA 5DXYA 4PB5A 3O1NA 1HKWA 4M80A 3NQDA 2E1DA 8XIAA 1RCQA 3LPPA 3PTDA 4H9UA 3FIGA 1IT0A 4R7WA 3W01A 5DO8A 2F6UA 3TLLA 2Q71A 2VFGA 3ARTA 5FJRA 2G3JA 2DSKA 1KCLA 1WNOA 1XSJA 1I1WA 5HATA 3LTSA 4QAWA 2I9EA 4UB9A 4F79A 1MNSA 2E9LA 4LC8A 1MSSA 3TSDA 1US0A 1KD0A 1OADA 2FQIA 3WN6A 3U2EA 2J75A 4IIFA 4GACA 2OYLA 3E0WA 3WEZA 1T8QA 3AMLA 3PWAA 3SDOA 1JZ8A 4AY7A 4DZHA 1TVLA 1E4NA 1NWSA 3ABZA 3VNMA 3T40A 3TH6A 2Q3OA 3MI2A 4W87A 2ASHA 4C6OA 4XBJA 1BF6A 4JTLA 1OG0A 3CV2A 4JTHA 3P7YA 2WMJA 3WNOA 4LPCA 2WC7A 4HMDA 2V5BA 1PJ9A 5CZJA 2QXWA 1BWLA 8RUCA 1XFCA 2Y63A 3H12A 3ZSTA 1W91A 2CYGA 1DWFM 3N4FA 4C6JA 3PZTA 3DHFA 1T99A 5AB3A 5IM51 5E6ZA 1LG1A 3PZVA 1WOBA 3R2GA 1V5XA 3HMCA 4JTKA 5I09A 2DZBA 1E0VA 1DHPA 4QDMA 4IPLA 5EL1A 3E0LA 1LL4A 1RVKA 4FOJA 5TF0A 3MUIA 2R1NA 3ITCA 4M6VA 3QY7A 4QG9A 3UD6A 1V6UA 3A13A 1Z69A 2ZX9A 2PWVA 4DM1A 1E6SM 1XLEA 3C0SA 2GQAA 3J7HA 4AHQA 5HR6A 3UG4A 3W6MA 2QR6A 4IGSA 3I7SA 3SCRA 3WK3A 1ADOA 6XIMA 2BVYA 3EOOA 1MWOA 4GVIA 1UD2A 2NXHA 5JVLA 1PYMA 5C2GA 5AYIA 4HNNA 3GIQA 4IMDA 2INFA 4DB7A 2FPYA 3L21A 1X96A 3CB8A 4IJCA 2Z24A 3IARA 3GAKA 5A1AA 5AYYA 5JIWA 5KZMA 2BDQA 1G7VA 4P7OA 2J77A 5I3JA 1LRQA 2QPUA 1ZQ5A 1MDLA 3VIFA 3GUWA 2DEPA 4I9JA 1GG0A 3P81A 3GKFA 1F5ZA 1WXJA 1B0IA 3HGJA 5HWJA 3MKVA 1LBFA 1ESWA 2VRJA 4UTWA 3LSCA 3DG7A 3KL5A 2E25A 1CGTA 4AZ7A 3IJIA 3IAPA 3BMXA 4XK2A 3MSRA 2Y5JA 3HQ1A 3SCQA 4OGZA 2YLAA 4LYRA 3NDZA 3FNDA 4KFOA 1GQKA 1H1ZA 2OU4A 3TOYA 2RFGA 3F2DA 4AHPA 2VP8A 3CMGA 1KFWA 4NKCA 1Q65A 3R4IA 4JKKA 1J93A 1GOKA 3ITOA 3LLDA 3HIJA 2D22A 3NZRA 2V2HA 4FALA 2NSOA 3UESA 1DP0A 1YBQA 1PB0A 2VRKA 2R8WA 2G96A 5CJMA 2MUCA 4AXKA 3SQLA 1YNQA 2G4FA 1ZJHA 4GA8A 2PS2A 4DUVA 2X42A 5FSDC 3ZR5A 4DJFC 3WJWA 5LNVA 2ONEA 2CBUA 1HGYA 3BAKA 4J3TA 2FKPA 4QG8A 3WSUA 1FXPA 4D6DA 1FWWA 2OMAA 1BF2A 1U30A 3TUUA 1S2VA 3RRXA 4HNCA 3IIPA 3C0LA 1QBAA 1XBZA 1FWJC 1DWIM 3BXWA 4NZJA 2ISWA 4JDBA 3UNTA 2A3AA 4RLIA 3AMCA 1M7XA 1QPRA 4YYFA 4TTGA 3FFSA 1BVNP 4UBPC 4AVFA 3MQTA 1YBQB 1XUZA 4RW3A 1WPCA 2CBVA 3ABQA 3ITGA 1P0BA 3CQHA 5JU6A 1FVPA 3LI0A 1BYAA 2VGGA 4O13A 1TTPA 3O05A 4I3GA 4RZ4A 2I16A 2V3DA 3HPZA 3QPYA 4Q8WA 4G7EA 3DG3A 2AGKA 3WLTA 5LNRA 3MUCA 4I6VA 4NF7A 3UZWA 3UXKA 2A6NA 4UC5A 3LZ3A 3A64A 4ACZA 2PDHA 1X39A 3KRUA 1IGSA 3ALFA 4GJ1A 2OT1A 4G2DA 1G67A 3FS2A 1EXBA 3L4YA 3STPA 1W1VA 3UNDA 3IK2A 1XGDA 3SSJA 1M6JA 2FTPA 3UW6A 2CBIA 3WLRA 1KKOA 2Q8LA 5AFDA 3SCVA 3NNTA 4TO8A 3W7DA 3TJLA 1CBGA 1YDOA 2PWFA 3EA1A 3UWVA 3CH9A 4L56A 3PZIA 2X7VA 3ITYA 1GZ1A 3LBOA 1W1YA 1QASA 3S4TA 4L9XA 3WH8A 1VFHA 2VZVA 1TO3A 2DZAA 4HZMA 3IUHA 4LS2A 2H9AB 4WF7A 5G5IA 3H2MA 1TJPA 3L5MA 4MG4A 1T7LA 1ZY9A 2ZZ3A 3KRZA 4G1KA 1JZ3A 3K4AA 2ZX7A 2PUZA 2PRMA 4CQAA 3U7VA 1BVWA 3KBJA 1UPMB 1RCOB 1XLBA 2OOFA 1W1A1 3A6OA 4DYEA 3BW4A 3MCNA 4IIGA 2NLYA 3C61A 3P0WA 4YTSA 2QJHA 1AJ2A 4GYPA 4PN2A 4JD4A 1QPNA 3GR8A 4O52A 3BCFA 4QEEA 1HQTA 1V0MA 2YDAA 4S23A 2CW6A 4DZIA 4GE8A 3UXLA 1KRBC 3MW7A 2OZ3A 4IFOA 3SCWA 3PB0A 5HWMA 5C2XA 4IG2A 5I00A 3S9ZA 1NP2A 3NYZA 3O3RA 4ZCWA 1AH0A 3BJSA 5IFPA 1IWBA 1SR9A 2PCQA 3R89A 3E6EA 2OQHA 3I6RA 5DFAA 1D7FA 1LWIA 1BWKA 4M6QA 2D73A 5HINA 2H8XA 2DFAA 1E6QM 5BU6A 3TTQA 4NYYA 2X1UA 3QPZA 3QYSA 1Q6QA 4FS9A 4A8RA 4NASA 2FGBA 2E6YA 7REQA 1O5QA 1UH3A 1J9YA 4EWND 1KFJA 1UD4A 1XG3A 1N8IA 4H1ZA 4YVVA 3SQMA 4DRSA 2PDYA 2Z00A 3H2OA 3BAWA 1H11A 4IPPA 4LAKA 3S42A 1XRFA 5GQBA 1EC7A 5M1TA 2QCDB 2FHCA 5F2IA 4AAJA 1XIEA 1UB3A 4D8ZA 3EMZA 1A4LA 2WXDM 3QFWA 3OB8A 1TTIA 3FJ6A 5CGTA 3WJYA 2EKGA 3D3FA 2XM1A 2E5CA 2J88A 3WUGA 4GLEA 4LANA 4HZ7A 3R6IA 4QJ5B 1LOQA 1EC9A 4GRSA 2GQ3A 2FH8A 2XU2A 1WCGA 5HJYA 3W6LA 4HP5A 1OGSA 2ZC1A 3AOFA 5AKQA 2P50A 4AC1X 2D24A 4W5ZA 1HTIA 5DQPA 3KBSA 4RW5A 4QJ1A 5HBFA 3ZS4A 1DXFA 3ECQA 4CD7A 1A5MC 2JF6A 2W91A 5BRPA 4GO8A 1IEWA 1JUBA 3BZJA 3KVKA 1GJUA 4PUWA 4UQAA 3U0HA 3REQA 2P0IA 3R13A 2WNZA 4OVXA 3UR5A 4AZGA 4C91A 3SRFA 3ME3A 3L5AA 2FGLA 3ZMRA 1ZAHA 2AL2A 4GK8A 4REQA 3N9RA 4W8LA 1EC8A 1D7KA 2WYSA 3CZEA 3GFYA 2QCEA 1KQZA 3W53A 5IXEA 3N3TA 5G4HC 4PFMA 2JKPA 1TSIA 5H2ZA 5AYBA 1FHUA 1VJSA 4CN1A 5A2AA 3WNNA 1IZJA 1ZLPA 1TQXA 2BZNA 4GVGA 2PTYA 4PRTA 3GW0A 4WDTA 2IKGA 2DVTA 3W2KA 2WPGA 4CNNA 3EX1A 4EXQA 3TJIA 3NZPA 2VEIA 2C8NA 3R0KA 1WDPA 3O2LA 1OC7A 2CPUA 1E0TA 1N8WA 3SCOA 5C6MA 2X16A 2DSWA 3SI9A 3L23A 2TMDA 2WSYA 1M7JA 1VGAA 2BXZA 1UG6A 2J6VA 4ZSUA 5AYXA 1YDVA 2HEJA 4WJXA 5AOUA 1TREA 5A95A 3PJWA 4Z1DA 2ZADA 2XH7A 2BY0A 3ZWSA 1VYPX 4MPKA 2AQWA 4A8IA 2ZRYA 4CNSA 2X30A 2A3CA 4UOQA 4V1XA 3AHXA 3UJRA 4DUXA 4IHCA 3ONCA 3CHCA 4DJDA 3WDRA 3ZQ9A 4XBSA 4JGDA 5FL0A 2OVLA 3H24A 3OG3A 2BMBA 3K2GA 2O4QA 1JCYA 4DIAA 1XIJA 4H7CA 3CUFA 2E5DA 1GVRA 5HOSA 3QY8A 4OV4A 1L6YA 1M53A 1RQBA 3PJTA 2Y6ZA 3L4VA 1JG9A 3TOPA 4CD5A 4I5RA 3IIVA 1RBOB 2DDXA 1TPC1 2OTDA 3EOLA 1IIHA 3G3DA 2ACQA 1XLIA 2A79A 1AJ0A 1UWAA 2RDTA 4MKNA 1DORA 3HO8A 4IX0A 1RJPA 3V36A 3NO1A 1I4NA 4W9TA 4MWAC 5PTDA 4WGXA 2V69A 1JEZA 1GHSA 4H8NA 4V2XA 4UR8A 1AD4A 1X98A 3P93A 3PAJA 3N9KA 3HG5A 4UFJA 1S38A 1TPVA 3K8KA 3WMLA 5FEWA 3GBEA 4MNLA 3VTRA 3U3HA 4HHPA 4XD4A 1H60A 3GTIA 1AVAA 4M81A 5EYWA 5HWNA 4JQ2A 4UTKA 5TAOA 1TCMA 3LV6A 5FJPA 4ORIA 5EU9A 3MPGA 4TX9A 2A0NA 4N9EA 1YMYA 3DC0A 3KOXA 4J28A 4U10A 3GXMA 4KWSA 3W6YA 2J7GA 3B9AA 1O60A 1FH8A 1HT6A 5CC7A 2WSRA 2C1GA 3HPFA 3ZJKA 3T0AA 4Q8VA 4JIIX 1M5WA 1PX3A 1W8SA 1IXOA 3T7VA 3RRAA 1JZ5A 1HO1A 2Z1VA 4QQUA 4L65A 4JYDA 3AMKA 1D2KA 5H8UA 1S2CA 3VIKA 3QSTA 3UJFA 4HPXA 3NQCA 3ZR4A 3KVJA 1VHCA 4GFIA 5BW6A 3SZ8A 3EPNA 4OOUA 2GQ8A 4XD3A 4JR5A 4LCQA 5JIPA 1UR9A 3CUHA 2VX4A 2PRHA 4Z08A 5HANA 3R5EA 2WJZA 3P3BA 4O53A 3UT0A 3BG5A 3QV8A 2YXXA 5A8NA 5FJJA 2XJ7A 2C1HA 4B5WA 4AVNA 1MUWA 3Q67A 2GL5A 3NQGA 4J2PA 2QCDA 4E8GA 4NNBA 2IPGA 2H90A 1EJSC 4A6GA 3S0CA 1UC4A 4XZLX 1WE5A 5D2VA 1S1PA 3NSXA 4WRHA 1Q6FA 1Z89A 1W9BM 2DSUA 5KINA 2QEZA 5AC7A 1HJUA 5CG0A 2QV4A 4O14A 1L6GA 3LMYA 2YJQA 4IICA 2HVOA 4FNTA 1WOAA 4PBGA 1OQFA 2D2JA 4UUIA 4I6KA 4TVCA 4ZMGA 3NQEA 1PE1A 4OUIA 3LUTA 4FNUA 3T2QA 1F6YA 5KEZA 1PWLA 4EAYA 4Y9MA 1IEXA 4BF9A 2NQ9A 2VWSA 4BI7A 4MY1A 5DF0A 1ECQA 3DKLA 3HQPA 4JQ3A 1W3TA 2F38A 4UTTC 1U1HA 2BHUA 2VEMA 1PZ1A 2C14A 2C0AA 3MO7A 3ARYA 4DF2A 2R24A 3BLIA 4ROPA 3F2BA 5EMYA 2GJLA 3VMNA 1A4MA 3MI3A 1QNPA 2A5HA 3VOIA 3BQ6A 4DWDA 5ABFB 3S2CA 3QZAA 9CGTA 4YS1A 2QF8A 4E2OA 3ALGA 1PL9A 3CEUA 2BY2A 4ZSTA 1ICQA 3LY0A 1P0KA 5CGQA 3CQ0A 1IT7A 2I9UA 3QHOA 2KX9A 2WO5A 3WQ8A 1UWUA 2V67A 4C1LA 3ABSA 3L4UA 3EX2A 3UYIA 4BWLA 4DHGA 3UWEA 3VCNA 5JBDA 3LZ5A 1V3HA 3GXFA 3VX1A 4IFKA 4M0XA 2FH6A 5CLWA 1L6SA 4AD5A 1DPMA 3M7SA 2PA6A 3M0IA 3PJUA 1BAGA 4NP7A 4BZYA 1A49A 3D0CA 4O8RA 4RNIA 4TOQA 4AZCB 3W7MA 3B8DA 3N04A 1ME9A 4GINA 3VIIA 2VX7A 4CNTA 1EP3A 2ACSA 1C8YA 4WOZA 2XSXA 5EMUA 2PRLA 3PFMA 3ZLFA 2CZVA 2OKTA 3WDHA 3T42A 4NZ5A 1KM3A 1EDQA 2RGMA 4LH8A 4HNLA 2O0TA 4LY4A 3R25A 4P7RA 2P8BA 2ZXQA 3OODA 3CU2A 3E74A 4HNTA 1UKPA 1J5TA 1XIIA 2KZHA 3DFSA 3S6OA 3CL8A 3QW3A 3EPMA 1HL8A 4WY0B 3WJXA 1JCLA 1P0NA 2JFEX 1DV7A 4KGJA 4UTJA 6ENLA 1UWIA 3L2IA 3TTOA 1E0UA 1TV3A 4IT1A 1BQGA 2WHLA 2ACUA 1H5VA 3KCLA 4FPSA 2XHYA 3JVAA 3ZJ8A 1TV2A 2BBFA 3MYPA 1OB0A 2I5GA 4PTVA 1TE6A 1XLKA 4KEZA 4PL2A 3NL2A 3SN1A 1E5JA 3EB2A 1M03A 3A4JA 2TAAA 4HCDA 4Q4RA 2WCGA 1FDJA 3WDIA 1Q5MA 3QQ0A 4GY7A 1B3OA 4JTJA 2JBMA 1JCTA 3VOGA 4QHRA 3EYPA 3G1YA 1BRLA 2BB0A 4EF9A 3N2TA 3N14A 3NG3A 1XM3A 4AFYA 2QIIA 4M1BA 3LV5A 5M17A 3SFKA 2NT0A 2OPJA 3RITA 5A8OA 5D9MA 4C6DA 4DO5A 4PMDA 3MSYA 5E0FA 2GUBA 3UVIA 3JS3A 3TJ4A 4AZHA 1CLKA 2TRSA 4XBKA 5TQLA 1H0IA 2WLZA 1PHQA 1ONWA 1RVGA 3SUWA 3N25A 3WH9A 1SO6A 3DAQA 5LYRA 4DWSA 2BASA 2P3ZA 4PRRA 3RNDA 1TWWA 2PTWA 3LERA 3WIJA 4F2UA 4FIQA 4MY8A 3GVWA 1F07A 2W6RA 1W37A 1R86A 3U48A 1A0EA 4FEZA 5EGRA 4LNYA 1ZJIA 4CLMA 3S2JA 3ZLGA 4HHHA 4MNJA 5BZAA 5I7GA 1W3NA 4PMZA 3UG8A 2PE4A 4JX5A 1S39A 5CLTA 4JX6A 4CD6A 1BGGA 5D33A 4LS1A 2WHMA 3K8MA 3W07A 3UPMA 1DHKA 3W38A 2DIKA 3THAA 4Z1CA 4KWWA 4BCEA 3KOYA 4WKHA 5FJTA 3K4DA 1OEPA 4ZR8A 3NL3A 3B03A 4FF5A 4NY2A 1RJQA 3GH5A 4Y8EA 3ARSA 2GSHA 1K8ZA 3AIBA 4J3SA 4DQWA 1RR2A 4B91A 5DBUA 1RAKA 4O8AA 5DRIA 4GNKB 5DEZA 1MO0A 4L64A 1N8FA 3GAYA 1TJ0A 2PGRA 2GOKA 4S3CA 1MW3A 4JQ4A 3ZSSA 1GOWA 5IBXA 3WLOA 1OCNA 3C8NA 3WQDA 1OABA 1UUMA 1AQMA 3W7PA 1K02A 5FCZA 1T40A 3QY6A 4AD4A 2VD8A 1P6CA 4S1FA 1B4KA 5E70A 4CNUA 1F4AA 1KXQA 1P7TB 4RNJA 3O07A 1XIHA 3NSMA 3MI6A 2E9MA 2G3MA 2NV9A 1EEPA 1IIGA 1CGXA 1KKRA 3OBEA 4W88A 4GIEA 1VEMA 1A0DA 4X9SA 4JTEA 4IGMA 5FF2A 4L6OA 1EGMA 3W7HA 2VQTA 1LL6A 1UBSA 1C9DA 4QCEA 4B5NA 1P6WA 3M44A 1E9IA 2XVLA 3VXGA 2IPJA 1NWTA 4DPPA 3CZGA 3P84A 3APYA 3CZ8A 3RCMA 4GPNA 4YMZA 1RY8A 3PB2A 1QOQA 3O0FA 4JOMA 3ZR6A 3M6DA 3UWZA 5LIYX 1J0ZA 3W1TA 3WENA 2J9ZA 3UXAA 3WH5A 3WQCA 2J4GA 2YBVA 2G5WA 1S1RA 2RH9A 4F0MA 3VGEA 2BVWA 3BLPX 1XC4A 3NQAA 5FESA 1J6OA 2EJ1A 5J8LA 4RDYA 1XCWA 2HK0A 4ZTXA 4IJRA 4ZFMA 3CIWA 2CESA 5CPTA 3H7VA 1UA3A 3O6YX 2G41A 4PSPA 1M65A 1XFBA 4Q4OA 2QCHA 3O8AA 1RALA 2P8CA 1ZBKA 2NQHA 4JTQA 3IGHX 1TELA 6REQA 2IKHA 3NL5A 2VCAA 1OFQA 3O6DA 3CASA 3C86A 3E2SA 4ZL1A 4XV0A 1IT8A 5BOOA 4Q22A 1M7OA 1JFHA 5I3KA 1HKKA 1EDGA 5F4SA 5XINA 2NVAA 2PPGA 2D3LA 4YYCA 4RNHA 3QN3A 4Y9OA 2GPTA 2VGFA 1TPEA 4F48A 1KM6A 1TE1A 3GNOA 3JUGA 2VO5A 1C91A 1I2PA 1H1NA 2WKGA 1US3A 4W86A 3E0VA 4JCLA 1Q6OA 3PAOA 4IPIA 1JPHA 1W2VA 3WLSA 5I3GA 3THUA 5C2CA 4MFEA 7REQB 7TIMA 3QMSA 1SFLA 3W7KA 4L4PA 1JUKA 3Q2DA 2XTKA 2R9RA 5E5CA 4MIMA 4PUMA 3M0YA 4AZBA 3ARZA 8A3HA 3ENLA 4L9YA 1Q6DA 3L5LA 2V3FA 4O10A 3W02A 2ZUVA 4O54A 1AJZA 2E09A 3EWDA 3XINA 4G9PA 3EX3A 5IRPA 1EF3A 3RU6A 5CC6A 2PTZA 4Y9PA 2WQDA 4UQDA 4Q4MA 1JR1A 2EBNA 3TN5A 3VFLA 3WJSA 1H7RA 3A23A 3WQWA 1R9ZA 1E51A 1PTDA 1J5SA 3M5YA 4WXZA 4JYFA 4HK6A 4B2DA 3W1PA 1BRLB 2DVUA 4JX4A 2X0HA 1QNRA 3VE7A 1WDWA 1N55A 1W5MA 4HNUA 1WDDA 2D2HA 3W25A 1YYAA 2QAFA 1CLVA 3T4CA 5TNVA 2UY5A 3E5BA 2PGEA 3UP8A 5HDRA 1CTNA 6A3HA 3C4UA 2WVVB 4D6CA 5LSMA 4E3VA 3SRKA 1ZENA 3H6OA 3GYEA 4N9DA 3TQKA 1PTAA 4C6MA 2X1SA 2NQJA 4M1RA 4C6EA 1IEQA 1KFEA 1TV7A 5G1MA 4IZGA 3STCA 4CD4A 1ZPTA 5FJOA 1DKWA 8TIMA 5FF4A 2Z1BA 3GD6A 3B0PA 3UJ2A 2C3ZA 2QUTA 2PZNA 1VFLA 4AF0B 3RUBL 4JFWA 3A3HA 3DGRA 3KDNA 4GVFA 2AMGA 1G1YA 1IEIA 4ML4A 5BOEA 5FEXA 3GHUA 3GZ3A 3O6CA 4UTFA 2WVSA 5EY5A 1FY6A 3F4CA 3H2AA 3BLLA 2VT0A 3LD5A 5HQEA 1B30A 5LGZA 4B5TA 3NQ2A 1B54A 3DDMA 2XIBA 3N4EA 1B3YA 3G1RA 4K7VA 1ICPA 1FDZA 1M68A 3CV6A 2FPVA 3W1QA 2A1YA 3DN5A 3KCJA 4OUEA 1CXEA 3A4XA 2WCAA 3BMWA 1E73M 3L65A 4GMEA 2J74A 2DV0A 1FCBA 2J66A 1J0HA 1XR2A 4QXIA 5EB8A 1G4SA 2QUMA 3MBFA 4W7VA 5C9UA 2QLYA 2QVNA 4L4OA 3BOLA 4WZHA 3MBDA 1E56A 3B9NA 1BYDA 4FOUA 2HNEA 3MC5A 4UR7A 4C7DA 1K03A 3KLLA 2PWEA 2V8ZA 3GVVA 5BXSA 3EXTA 1MXGA 3C5QA 4DLFA 3VIMA 2E5BA 3IVUA 4H01A 2PDFA 1RA0A 3VZXA 3QEZA 3UA4A 4AWSA 2J79A 3VGFA 3C2OA 3IJLA 1UMYA 3RHGA 3QQWA 4GX8A 2B31A 2PGFA 4LAZA 2VDIA 3WBAA 1NELA 4ZXLA 5D03A 3S5YA 3F2CA 2ZYFA 1O5RA 1HIZA 3UZZA 2OZTA 2GFTA 2XWEA 2DT2A 3D46A 1A5KC 5G1TA 1YDNA 1VFOA 2OX4A 5LNUA 3WJZA 1PSCA 1Q8JA 2AL1A 1DVJA 1C8VA 3DFNA 3GDBA 3NWRA 3W81A 2G37A 4WIWA 5HMFA 3GBDA 3CLWA 3MJMA 1P0DA 4YLWA 4M6UA 1PV8A 4PMYA 1K9FA 2LLEA 3VINA 3FEMA 1JL8A 1AL7A 4QE1A 3RMJA 4FNPA 3GDMA 1JYXA 3ERPA 1TMLA 1GOOA 2FB3A 4WKAA 4LV9A 3LTPA 5A8QA 1SM9A 3GC2A 2P88A 3WY1A 3PFRA 1BPLB 3TFXA 3ITVA 4Z1YA 3WKZA 1H7WA 2VEKA 3PZGA 3TTEA 1K3UA 1J0JA 2VEPA 1M41A 1W17A 3B06A 4L80A 3MDUA 4MNKA 4DZ5A 3MSGA 3AYTA 1GVIA 2A4AA 1X1OA 3B97A 2ZE3A 3GRIA 2JKEA 4JAWA 4J2MA 2VZSA 2G0WA 2J25A 3VZZA 1VYSX 3W29A 4JZ5A 1ONEA 1S2AA 1TR9A 5BMXA 2XH2A 1HJQA 3N1AA 3GG1A 3AAMA 3TC7A 3W87A 2OT0A 3IVTA 3KHJA 3W7EA 1I8JA 3FHAA 1VFSA 4GXPA 2WHKA 2CHOA 3RCNA 3W7QA 3E12A 3REQB 3BOFA 5I3DA 3UEQA 1IHIA 1B31A 3PM6A 4IUOA 3V0SA 2QAPA 1KCXA 4HSHA 4NJGA 4HN4A 4JNZA 3FAWA 2E28A 2EPKX 3K46A 3EA2A 4JTTA 3LXCA 2D69A 3HQNA 1P5BA 4JTCA 2CHNA 1PKYA 4R3UA 1Y8BA 1RH9A 1FWTA 3W74A 1GYLA 1TYGA 3W7JA 1O1HA 1CZ1A 1QW8A 1US2A 4Q7BA 2P76A 3CIVA 5D9OA 5E09A 2RKXA 4A2RA 1LLOA 3VE9A 4RXFA 3BSMA 1EQPA 2DQXA 3N29A 2FVLA 3DBPA 3M43A 3VDGA 3THDA 1HVXA 4QROA 4UWMA 3SB0A 4UQCA 5D9NA 2ZFAA 4K8EA 5CSSA 1V7YA 5C5YA 1ALDA 2O55A 1QI0A 3WL0A 2Z2UA 1OFPA 3QV7A 2YKKA 3BV7A 2Y7DA 3C3NA 3MVTA 1T8XA 3NYDA 2YYTA 3MMDA 2HBVA 2WJFA 2D0FA 4J3WA 5I3FA 4PRWA 3B8WA 1UZ1A 2OELA 5DBTA 2DGAA 4C1NA 2D3NA 2VFDA 3TLQA 4FNQA 1K6AA 4I8YA 2ZUUA 4JIEA 3A5FA 3FYYA 1JI2A 3WD1A 1MFUA 4KFPA 5IFTA 4ATWA 1SGJA 4K37A 4F4RA 2RDWA 4JL2A 2FZ9A 3VUSA 3E0IA 4BEUA 3CUIA 5H8PA 3T8QA 1JD7A 2ZTJA 4FLSA 1LZOA 1YKWA 2XFYA 1OT2A 1OFEA 4TR9A 1XGZA 3CMJA 1Q2RA 4JHOA 4XX6A 5F1UA 2VURA 5CBBA 3C2EA 4QR6A 3G1DA 3AQUA 3UG5A 1JD9A 2DZXA 3TMLA 3GS6A 5AHIA 1FHVA 2QUUA 3KFTA 1ME7A 1TA3A 1AQ0A 2QPSA 2BY1A 3F4WA 1XICA 4U5IA 1O7AA 3M4HA 1SW7A 4YWSA 3EDKA 3N2XA 1XD0A 4H6RA 2DY3A 4P8VA 1XRTA 5D04C 4MAZA 4HBKA 4GOAA 3EX6A 1KBLA 4E8DA 5GJPA 2ZZ5A 3K5XA 1TQJA 1LYXA 4MDPA 2JGQA 2UZ9A 1H51A 1M1BA 4MADA 2WBKA 4AISA 3AU2A 3PG9A 1TJ1A 2IKJA 4RDVA 3TA6A 4AZ6A 3GHSA 1QU4A 4QISA 4PMQA 3PTQA 3BGGA 1UR4A 4D9PA 1DYSA 3OW1A 3WK2A 3GXTA 2WW5A 4XVEA 1CXLA 4FX7A 4WDXA 1FWIC 3E2QA 4OKDA 1VRDA 2FYMA 3URBA 2CBJA 2OYKA 2NVCA 5ABHA 1XH0A 3VA8A 3CXOA 4IMFA 3AALA 5CZSA 4TQTA 2WMIA 3TC3A 1EO5A 4N02A 4C7GA 4GISA 4ZOAA 2BP1A 1Z41A 3PSWA 1Q4NX 2PF0A 1LWJA 4GXMA 2IQTA 4IPJA 1XUUA 4H3DA 3KAOA 1B1YA 2OXNA 2A2IA 3ANYA 3U2CA 4JIHA 1F8MA 3GG8A 3I3DA 4K2SA 3T0DA 3FXYA 1Q13A 4JICA 1ZU8A 3G1VA 3UR2A 4L6HA 3KM8A 3M0JA 2HXUA 5HPCA 2CLEA 2YL9A 1M04A 3EOSA 3VFCA 1IF2A 4BHYA 1OX6A 2W79A 2GGHA 3ES8A 4JY9A 3KL0A 4PEKA 2P53A 4J5NA 8CGTA 2NSXA 4B90A 5LIXX 2J8FA 3CEPA 3TNOA 1UWSA 3ES7A 2C6QA 1DQUA 4A05A 3ARQA 2WJDA 1UP3A 4AY1A 4Y7EA 3VKJA 3QTGA 1BG4A 2QULA 3WG6A 4NZCA 1XYCA 1X1NA 5JBFA 1YPFA 2XSBA 3B3DA 4H9VA 4ZB2A 1XKYA 2WMFA 5ABGA 4MTVA 4MYXA 3ZVHA 3IWPA 4X9YA 3WK1A 3GNPA 1SW0A 3UXIA 4WXYA 1FDYA 1I60A 3WX7