3LDVA

1.77 angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase from vibrio cholerae o1 biovar eltor str. n16961
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
231
structure length
231
Chain Sequence
AMNDPKVIVALDYDNLADALAFVDKIDPSTCRLKVGKEMFTLFGPDFVRELHKRGFSVFLDLKFHDIPNTCSKAVKAAAELGVWMVNVHASGGERMMAASREILEPYGKERPLLIGVTVLTSMESADLQGIGILSAPQDHVLRLATLTKNAGLDGVVCSAQEASLLKQHLGREFKLVTPGIRPAGSEQGDQRRIMTPAQAIASGSDYLVIGRPITQAAHPEVVLEEINSSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.77 Angstrom resolution crystal structure of orotidine 5'-phosphate decarboxylase from Vibrio cholerae O1 biovar eltor str. N16961
rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Lyase
molecule keywords Orotidine 5'-phosphate decarboxylase
total genus 78
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 4.1.1.23: Orotidine-5'-phosphate decarboxylase.
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ldvA00
1LOQA 4QISA 1MEWA 1OFQA 2H3DA 3AJXA 3C2EA 2ALDA 1R2TA 4ZQPA 1YDOA 4P61A 1W56A 1GVRA 5FF0A 3W88A 2GOUA 1AW1A 3TA6A 1KTNA 4ZMGA 3LCIA 3N3MA 5G5IA 3H53A 3G0SA 4ADUA 1C8VA 5AHNA 1DJNA 1QPRA 3CWOX 3QC3A 3NEVA 1H50A 4RK8A 2A85A 2Y70A 1GPWA 2ZRZA 3EXTA 3CM4A 2Z6IA 3MYPA 2CZ5A 3DH7A 5D37A 3UPWA 3PULA 1KA9F 3KRZA 1EUNA 3W3OA 1JQXA 1VCGA 2CLEA 4GBUA 1M7PA 2QCFA 3LCLA 5AHFA 4WQ6A 3LCHA 3M7WA 3NVTA 4M6PA 3ZWSA 5CPNA 3NA8A 4XTDA 1FY6A 3VNDA 4LTSA 1MSSA 2ISWA 5C5YA 1OYCA 3JR2A 1TTPA 4O52A 1KTBA 1KBJA 1Q3NA 4PA8A 1G4EA 3EWYA 3B03A 5LHEA 5KZEA 4PTNA 3FIGA 4JIPA 3NNTA 2WOQA 1JVNA 3W7PA 2C14A 4MLJA 2J88A 2TSYA 2VFEA 3H54A 2AAMA 2J9YA 3NQGA 4UUIA 3W7DA 1H60A 4K7YA 2QCGA 4IMGA 4IMEA 1XFBA 1VPXA 3A5FA 5D04C 3HPSA 4IMCA 5F4SA 3M9YA 4JTEA 4BFAA 3Q94A 1G7UA 1K7FA 5D03A 2J27A 2NWSA 3ABQA 3TIMA 3O8AA 1KM2A 2RH9A 3HGJA 4FXRA 5AYZA 5ABTA 5D02A 3O1NA 5FESA 4JTIA 4AF0A 4MPQA 3LCWA 5EYWA 2A6NA 1D3GA 2ZZ2A 2E6DA 5TBOA 2X1TA 1GYLA 4JTLA 1PCKA 3DU0A 4AEOA 1GOXA 3NQ6A 4DELA 3W85A 5FF3A 3W7QA 1A50A 5IBXC 8TIMA 1PE1A 5CPOA 4AB4A 2C6QA 1O5KA 5F4XA 1AK5A 2Y88A 2EAWA 1P0KA 2YYUA 4AHOA 4MYAA 1ZFJA 1LORA 3MBFA 5I3IA 3LB0A 1U5JA 2GVGA 2ISSA 2HS8A 4WY0F 2ZCGA 1R47A 4YWIA 2CLKA 2ZFAA 1O4UA 3T78A 3SFKA 3RK8A 4NZFA 2R94A 2X1UA 4DF1A 4MY8A 5L6UA 3LTSA 4RCXA 3UD6A 3QSTA 5K9CA 1VYSX 4XQ6A 5K4ZA 3WJXA 4MYXA 3FLUA 4MZ1A 1LYXA 2VXNA 3EWBX 4NUWA 1XBYA 3FYOA 5HR6A 4CQ9A 2FPTA 3G24A 4UMAA 1TCDA 3CQ0A 3P81A 1G6CA 3USBA 2JKEA 4YMZA 1OJXA 4JDBA 2EHHA 3F1QA 1YTDA 3EX1A 4ZL1A 4I7UA 3W7JA 3QM3A 2ZTJA 5CKSA 4A21A 1TTIA 1OFDA 3S9YA 3MWAA 4JTTA 3IGSA 2ZZ1A 4D2JA 5BW6A 3FEMA 4EOUA 2VEKA 1LDCA 1W31A 3TNOA 2QF7A 3UY7A 4UFHA 5K2ZA 1R30A 1N7KA 1TV7A 4LVBA 5HWMA 5AYXA 3ATZA 4O17A 1KTCA 2W79A 4PL1A 4FNUA 4UMBA 4OWGA 2I1OA 2HTMA 1IXNA 1I2NA 4IX2A 3HB9A 1QR7A 4M5PA 2V82A 3UY8A 2H8ZA 2CZDA 2JKAA 5KZDA 5FEWA 2OJPA 4K36A 4XTIA 4L4MA 2C19A 4N02A 1CI1A 4XKYB 1M5WA 5D2WA 1Q6RA 2QUTA 3S5OA 1EIXA 2A5HA 4O1AA 1W5OA 1H61A 3NQAA 5H91A 1W37A 4N2YA 4UNLA 1HUVA 4WY0A 3MJYA 3STGA 2QAPA 3W2LA 1I45A 3I7SA 3EX6A 3W70A 4JYEA 5DBUA 1OF8A 2OMAA 3GR8A 2A21A 4ML9A 3PB0A 4HPXA 4BWLA 1RVGA 3UXAA 5D2TA 4UFMA 5DXYA 4JYDA 2NUXA 1SZGA 3GKAA 3M41A 1XC4A 4LV9A 4MIMA 5K9XA 1F05A 3ATYA 3EXSA 3LRKA 4PFMA 2ZZ3A 1F2JA 4IOTA 3LRLA 1GJPA 3W7GA 1AL7A 3NQCA 3PBVA 5F2IA 2BXVA 3DFPA 5HQEA 2WQPA 1DL3A 3LTYA 1CW2A 1K8XA 4WD0A 1B9BA 1TPB1 2QCDA 1VCFA 3W1RA 5E0KA 3DI1A 4BI5A 1SZFA 4XBSA 4NZJA 1HO1A 4NU7A 1K02A 4WZHA 4H6KA 3DFOA 1VC4A 1S5WA 1QPOA 3Q58A 1QDSA 2P1FA 3W22A 4MZYA 3NPUA 1TV8A 4ZQMA 1BWLA 2NWRA 3M44A 2QEZA 5U4NA 3NG3A 1I8JA 4GC4A 1LOSA 1IXPA 2QCMA 3MMTA 3L0GA 4PCFA 1WOBA 4O53A 1XCFA 1H1YA 5F1VA 2ZZ4A 3S42A 3W1UA 3FOKA 3TC7A 3WJWA 5DCBA 1O60A 3S8HA 3FJ6A 1TPC1 4NXKA 3KHJA 3CHVA 3IIXA 4RV8A 3WK3A 3G1VA 3FYPA 4K38A 3GLCA 2GJLA 3EX2A 3M5YA 2NX9A 1FWRA 1ZAHA 2BSLA 3GDLA 4OGZA 2DZXA 3SGZA 2QCLA 5AHIA 1L6SA 4UR8A 4O1CA 3NAVA 4JYFA 5FF7A 3W1XA 4C1LA 4YXGA 5AC6A 1I4NA 1ZHAA 2G95A 1E51A 3OHIA 3W23A 3GB6A 4FO4A 3EKLA 2ZRYA 5GVJA 1AG1O 3LRMA 2A7RA 3MUXA 4JY8A 4OU1A 1OFEA 3W9ZA 5D05A 1QAPA 2QAFA 3GDRA 1O5XA 2ZZ7A 3B0PA 4IPIA 2G5WA 1P0NA 3P8JA 3BPWA 4UTHA 1JQVA 1FDZA 5CG7A 2CZFA 3C52A 3T40A 4EF8A 4JTSA 4CNPA 4EWND 1OHLA 1PIIA 2FB2A 2YR1A 5LKYA 3NQ2A 4LRSA 4YLWA 1SUXA 4GUGA 3SW6A 1W3NA 2C16A 3TFCA 2GVJA 1ME7A 4WXYA 2ABBA 2CZEA 1H7XA 1KFLA 1O95A 1SO3A 1TPDA 5D30A 2VKZG 4MVAA 4S2CA 3BG9A 3HPXA 4TIMA 3RNDA 3N19B 5AN7A 2ZYFA 2LLEA 2Y7FA 4TX9A 1V5XA 4FF7A 4WX2A 4NQ1A 3HMJG 1UBSA 4K6AA 3G1DA 2CLHA 1KW1A 3G0XA 3THQA 3TW7A 1ICPA 1VH7A 5TQLA 3R13A 4ADTA 3D0CA 1WXJA 1TMHA 5F2GA 2DJLA 3F03K 3QH2A 3MI6A 4KFPA 2CLMA 3EXRA 3NL6A 4LUJA 4BF9A 2WV8A 3W1TA 1ZAIA 1W5NA 1HFBA 4JXCA 4CCCA 5CSRA 1EWDA 2P10A 4TMCA 3G22A 3Q2DA 1QPQA 1B3OA 2V8ZA 4WXZA 1PVNA 1P5BA 4A3UA 2J9XA 2FFCA 4GWEA 2R14A 2Y61A 2FPVA 2H90A 1UJPA 2PRMA 3N2MA 3PBUA 4X3ZA 4CCDA 4ICNA 4JTKA 3TSBA 4IX0A 3QJAA 1JUBA 3DFTA 4OV4A 2FB3A 4TU1A 1JCMP 3TDFA 3STCA 2NUWA 5IBXA 4PL2A 4LVGA 3HO8A 3NL2A 1D9EA 1CX9A 3GIYA 1T0OA 3WK1A 4HNUA 1EUAA 3PUEA 1KBIA 3PSWA 4YCOA 4O18A 5CZJA 1IXQA 2TRSA 3B0UX 1H7RA 1F7BA 5LZLA 5CZSA 3W2JA 5L9FA 3H55A 3W7KA 2Y7GA 2YW3A 5BMWA 3N9RA 3TSMA 4HN4A 3L66A 4N9BA 2H8XA 1G69A 1AMKA 1OFOA 1GEQA 3DBPA 1EA0A 2PC4A 2HS6A 3PR2A 3E96A 4NX5A 5I3FA 3PF3A 1Y0EA 4Z0SA 4UTIA 3DI0A 1Q6QA 1IXOA 4O10A 3WJYA 3EX3A 3NL5A 4NVTA 1VYRA 1JCYA 3NM1A 3C3NA 1K7EA 5DCEA 3GNNA 1SZEA 4WJEA 3R2GA 3FFSA 1L6YA 3KFTA 1WX0A 1XUUA 3HG2A 1OX5A 3FJLA 3ANYA 3DXIA 3I68A 1GWJA 4LS0A 1TRDA 3O05A 2G96A 3UWUA 3P5ZA 1SSGA 1TJPA 3HPZA 4L4LA 3IIPA 1BEUA 1L2UA 1QO5A 2GUUA 4R53A 3CB8A 4Z1AA 3QQ0A 3G1FA 3UZJA 3O6DA 1FCBA 3NPVA 4FX8A 2X30A 4R34A 4HKPA 2P0OA 1NF7A 3G1AA 3IRDA 1R2SA 5HWJA 1Q6LA 2ZA3A 2V5LA 4KFOA 3O07A 1PCWA 1W1ZA 2YGYA 3A23A 3VFLA 4U4MA 3W7IA 4LS1A 1TV5A 3IIZA 3DZ1A 3GX9A 4TMBA 5KZMA 5LSMA 1XBXA 1PHQA 4HSOA 3LV5A 3A5VA 4AWTA 3TROA 3UYCA 3PBWA 1QPNA 5G4WA 1WOAA 4O14A 3ZR4A 4OQVA 2F84A 2VEMA 3IVUA 1TTQA 3KXQA 1SW7A 1OX4B 4PEKA 4CNNA 1EP2A 3L5MA 4A2SA 3NM3A 1JRBA 3RMJA 2HMCA 4IPJA 2Y85A 5EY5A 2ZRXA 4QM1A 1GVFA 3UQNA 3P62A 1SFJA 1T99A 3PY2A 3INPA 4RZ6A 5G4EA 2Y7DA 4IGHA 5MHBA 4K37A 2VEPA 3HQ1A 1H51A 2WO5A 1Q45A 1TTJA 3PVFA 4UMCA 1GVQA 3LV6A 2WJZA 3W7NA 3TV8A 4BWLC 3F4WA 3GZ3A 4JDYA 4UIOA 4QITA 4JN6A 4UFIA 2YDAA 1WBHA 4GJ1A 3G3DA 5AC7A 1BKSA 5FF2A 4N4PA 3G18A 3LLFA 3DAQA 4RKAA 3LERA 4ZQCA 3N9SA 3TR2A 2ZDRA 5DBTA 4HSNA 3VI2A 5AHEA 1TPFA 4LVAA 4GE8A 2G97A 3MP3A 2VFHA 4AWSA 3I7QA 3R8RA 1OFAA 4O19A 3MYOA 1HTIA 4A2RA 4DO5A 5EBUA 4DQWA 3QRHA 1EPXA 4Y8FA 5D2YA 2NXIA 4N6EA 1JCNA 1WAUA 3L0NA 4FNQA 4AF0B 2BLEA 5HJLA 1XUZA 5HULA 4OE7A 3ELFA 3EWZA 2V30A 1Z48A 3W7LA 1XI3A 4UXDA 4RX0A 5F4WA 3M5XA 3DHDA 3LLDA 1FXPA 3MO7A 4KWWA 3QMSA 3GDMA 3W86A 1R2RA 1TQJA 1YTEA 1M7OA 3LM7A 3LHVA 1PS9A 4UTWA 2WNNA 3KVJA 2QCHA 2QCCA 4UTUA 2A7PA 3SJ3A 5G2WA 4PH6A 1KFEA 4AHPA 1S5VA 1XBVA 3SY5A 1QOPA 3EWUA 2ZRVA 4Y9AA 3GKFA 1H7OA 1W0MA 2ZZ5A 1FWTA 3FS2A 2DORA 5FEXA 1G4PA 4HNTA 1VZWA 2FQIA 3B04A 1P1XA 1B4EA 4QIUA 1W8SA 3G0UA 1TPEA 3UWYA 1TQXA 5CZTA 1WQ5A 3LBMA 2FIQA 6ALDA 4AH7A 3TQVA 3O16A 1KM1A 4M6VA 3K30A 5CSSA 3W72A 4GUIA 3S0CA 3M1ZA 2NUYA 1H7WA 1GTHA 2O7QA 3V1PA 1JR1A 4TR9A 2CLLA 4MJZA 3TAKA 4Y96A 2FJKA 1YYAA 3C56A 1JCJA 4NXSA 4NT0A 4O12A 4Z08A 2E6YA 3NGJA 3W7HA 3KRSA 3DGRA 1FCQA 4UTJA 3TU9A 3HF3A 1C9DA 1F6PA 1W5PA 3L68A 1WA3A 5LNWA 3UWWA 1RQHA 1ZAJA 2PURA 2Q3RA 3WFAA 1TPUA 2E09A 1TO3A 3PG9A 3QMRA 4ORIA 1OK4A 5AB3A 1YLVA 1PHWA 4R33A 4K8EA 4O0KA 2E6AA 5BMXA 1TPVA 3UWVA 1GZGA 3BG5A 3EB2A 3E02A 1LBFA 3HG3A 1I2OA 1NVMA 3IGUA 1R46A 4AXKA 4JTHA 1J5TA 2B0MA 5AC8A 1LRNA 3NR0A 1XM3A 1V7YA 3O63A 2V81A 4MUZA 4MLRA 3HG4A 4N9CA 3GDKA 3I65A 1QFEA 2NV1A 4LC8A 2C3ZA 4GRSA 4UFJA 2Z1BA 2W6RA 1MO0A 3NOEA 2D73A 1ZJIA 4LUIA 3NPWA 1KV8A 2WSRA 3UWZA 3O6YX 4QJ1A 3QPYA 1DBTA 2A7NA 4NJGA 2BWGA 1EP3A 4ZQRA 2DZPA 2VOMA 1G4SA 1ZNNA 4J9JA 3HG5A 4DF0A 5F1UA 5AHLA 3CT7A 3KVMA 1FCVA 2BTMA 1F6KA 1VS1A 5H2ZA 1T8XA 3E9AA 2YW4A 1HG3A 2GQ9A 1KFBA 1A5CA 4AVFA 3C8FA 2NZLA 3B4UA 3STEA 1Z44A 5G1TA 3DHFA 1VJIA 1KM6A 3CLMA 3IVSA 1ME9A 4Y90A 2ZZ6A 3TJLA 4LC6A 3S5ZA 3BLFA 1X6UA 3G8RA 1A5BA 2DU2A 2R91A 4S2BA 2ISVA 3DFNA 3BARA 5HINA 2QUUA 5CPMA 3OG3A 4KKXA 2C1HA 4UNKA 2I14A 3L5LA 4FIRA 2WPBA 4NX0A 1K8YA 2GVLA 5DELA 3LXAA 4BI7A 3W84A 3VKJA 2BX7A 2YSWA 3GVGA 3GXNA 3CEPA 2F7FA 3W75A 4ZQOA 5EMUA 2WNZA 3MBDA 1NFBA 2NX1A 4LT9A 1EWEA 4POCA 1OVDA 3LGEA 4NJIA 3O15A 4S1FA 3L0KA 3QYQA 4LVFA 3PM6A 1VRDA 2NLIA 1VHCA 3BG3A 2Y6ZA 2PRLA 3TMQA 2YXGA 2QJGA 4JEQA 1N55A 3N2XA 1GQNA 1LZOA 3KVKA 5EPDA 2DZSA 3QEZA 3E0IA 2A1YA 1JJKA 3IV3A 3CTLA 4RZ4A 3SR7A 5D33A 4AMAA 1B57A 1RQEA 4K39A 3NL3A 4DO6A 3N14A 3PBYA 1UCWA 2XN0A 3NQ7A 1X1ZA 2B7QA 2EPHA 3NPXA 3W2KA 4GUJA 3PUDA 5HUPA 2ZA1A 3TW6A 3UPBA 2WSQA 4N9DA 4DXVA 1F74A 1W54A 3CIXA 1H7PA 5J5DA 3C61A 1HO4A 2QDGA 5DXXA 3C2FA 3W76A 4RXFA 2TMDA 1SR9A 2OX1A 1FUYA 4RXGA 4FNTA 1DQWA 4MOZA 5G2HA 4XZ9A 2WNQA 3EWXA 1OYAA 1EB3A 2C15A 4TO8A 2JKPA 3QW4B 1FXQA 5DLCA 3FKKA 2VENA 4ZQNA 4RR4A 5C6MA 3U6WA 4W9TA 1PL9A 2CLOA 2JGYA 1OFBA 4AHQA 4HPJA 1XDMA 3TUUA 1LP6A 2Q3OA 5LNSA 5EL1A 4K7VA 5E1QA 1G67A 4WUIA 1MEHA 3G1SA 1AW2A 3RFAA 1XL9A 1OFRA 5HNRA 4HIBA 3BW4A 2CU0A 4IJBA 1FCUA 3T7VA 1YTKA 1OFPA 5D2XA 3TQKA 3LI1A 2W0UA 2YYTA 3B0VC 2NXGA 3EX4A 3W1LA 1W5QA 1UASA 2B7PA 5D38A 2VFGA 4UC5A 1XKYA 1ICSA 4ORMA 3HGRA 3HGOA 4O4WA 4Q4KA 3UWQA 2Y89A 4E2DA 1NAL1 3NDOA 3I7RA 3NYZA 4LWWA 5LNUA 4MKNA 1DOSA 2H3BA 3S6DA 3TFXA 4O57A 4FNPA 4R7JA 4FIQA 4AWUA 5HMSA 4CNOA 4HT3A 4NNAA 2DZUA 2E1DA 2OT1A 2Y62A 1DVJA 4FB7A 3WJZA 4M19A 1JCLA 1EX5A 3NZRA 4JTUA 2AQWA 1KFJA 2JBMA 5I3KA 1H1ZA 2Z6JA 2C18A 3EWWA 5BRBA 4PC8A 4GNJA 3GXPA 3FKRA 4B5NA 2X1RA 4CLMA 3DKLA 3L67A 2FTPA 2C0AA 3LCXA 2VFFA 4U28A 5K7JA 2AGKA 1ICQA 5EA9A 1NEYA 3CIWA 4KFNA 3ABOA 4EF9A 1N8FA 1QMLA 3W1QA 1RV8A 1YXDA 2Q8ZA 4E38A 4FEZA 3SECA 3GR7A 3R89A 4LW7A 2ZQ0A 1WDWA 1Z42A 2OZ0A 5KTLA 2FDSA 2A4AA 4M6QA 3RF9A 4KWVA 4CCEA 5C2XA 1LOLA 5AOUA 1IIGA 1QNVA 4IWWA 1GVSA 3PB2A 3W1AA 3NQMA 1HL2A 3PS7A 3W7EA 3JRKA 4JY9A 1D3HA 3C6CA 3NO5A 2DZTA 1WYIA 3S1XA 3P80A 3NQ8A 1P4CA 2UV8G 2I9EA 2QCEA 3L9CA 2ZRUA 1EEPA 2RDWA 3BW2A 2YCEA 1L9WA 4N9EA 1X8FA 1H5YA 1SO6A 1ONRA 2YPIA 2CWNA 4O1BA 3DFSA 1LRQA 2J24A 3SIZA 3N73A 1EP1A 1KLYA 2E5BA 2OT0A 1K8ZA 1SW3A 3L5AA 3LXCA 5IM51 4O16A 2ZA2A 3OEXA 3JS3A 3LDVA 4Z1BA 4IMFA 3U2OA 5LNVA 1DJQA 2FLIA 2NX3A 3TE9A 1QCWA 1IGSA 3M16A 3PC0A 2Z0IA 1J2WA 4Z1DA 2ZBTA 5J5RA 1Z41A 3QQ1A 3RLUA 4IQLA 4Z0JA 5KSWA 4A29A 3W2NA 2DP3A 3P7YA 1A5AA 3IIOA 1SFLA 2WKJA 1KM5A 4RZ5A 7TIMA 3DKJA 1FBAA 4QNEA 3P67A 1M6JA 2VFDA 3S1WA 4BI6A 4E2BA 2KZHA 1X1OA 2NXHA 4QSHA 1VCVA 1PV8A 4RJEA 2H6RA 5E93A 2E6FA 5G2IA 4OV9A 2VELA 1W3IA 3EEGA 4FNRA 2V2CA 3WK2A 3MI2A 3T44A 1JULA 3RLVA 4JGDA 2PE4A 1SW0A 4MY9A 3M47A 3CC1A 5F2MA 2CLIA 3CPRA 3MI3A 1FX6A 3LCFA 4O13A 4AAJA 4JR5A 3GYEA 1KM3A 3QZEA 4N4QA 1DORA 3QSRA 1OX4A 4UR7A 2A2IA 1YXCA 5U7SA 1JUKA 3LX9A 3E49A 2VC6A 3E12A 5DY3A 5D2VA 1ADOA 4O50A 3R12A 5LGXA 4JX6A 3MP4A 3LHUA 1VQTA 2JK2A 5AYYA 3BV4A 1TREA 5K3VA 4O4VA 3V75A 3WJSA 2GQ8A 3GAYA 4O54A 5CZ0A 2VEIA 3N34A 3C2OA 3PWAA 1H7NA 5K9DA 4NJHA 5KINA 2JGQA 3MW7A 1MZHA 4ZZ9A 1LLZA 4HNNA 3S1VA 4BR1A 4LU0A 4PODA 1JUEA 3B06A 3W7CA 1QWGA 2ZTKA 3IGXA 4M7TA 3SI9A 3A22A 1RQBA 1TRIA 4OT7A 3MHUA 1GVOA 1SO5A 2QCNA 3GK0A 3GNDA 4G1KA 2O7SA 4EVZA 1THFD 3QW3A 3OVRA 4I7WA 3MP5A 1RPXA 2QCDB 5HWNA 3OA3A 5BOOA 3P61A 1KV5A 2YX0A 3KRUA 1DQXA 3O06A 3TX9A 1H63A 1W5MA 1YPIA 4GUHA 4LV4A 3A21A 3I6RA 4O0ZA 4ONVA 1F73A 5D32A 4A22A 3LI0A 3LHWA 5G1YA 3ZFHA 5I3GA 3R5EA 5EKYA 2RDTA 1YDNA 2A0NA 3OBKA 1I2PA 2QJIA 1K7XA 3B8DA 3A9IA 5KMYA 5A8GA 4DF2A 2Z2UA 4UFLA 1OF6A 4UTKA 2X16A 3VCRA 3M6YA 3BLEA 3W7RA 1J4EA 4UTTA 3L65A 3OIXA 4Q32A 3ABRA 4Y6GA 4JTFA 4FX7A 1LCOA 3TQ0A 1RZMA 1SQ7A 3L2IA 4JIQA 3W73A 4WY0B 4FNSA 1T96A 3PG8A 2Y7EA 3NQEA 3M5ZA 3TXVA 3BGGA 5C55A 1C29A 1KFKA 3P60A 3THAA 1FDJA 2HSAA 4IXXA 2YFNA 1TB3A 1L6WA 2VFIA 4CQAA 3AO0A 2RHGA 3W2MA 4P2VA 3W74A 1LBLA 3HIJA 1OX6A 2DJXA 3TJXA 5KITA 3SZ8A 2XN1A 1XBZA 3KAOA 3P84A 1LM1A 1XXXA 5AFDA 2Q8LA 3LBCA 3T4CA 5TIMA 1ZY9A 1QOQA 1NSJA 2B7NA 1ML1A 4LOCA 3LTPA 1TPWA 3IVTA 4FXSA 3VE9A 1WBJA 4DPQA 2YFOA 5FEPA 3LCGA 3STFA 3IEBA 4YCPA 2E5DA 4QQ3A 1BWKA 1SSDA 3L21A 3LHZA 3M5VA 5FI8A 4CQ8A 4HNVA 4NNBA 1XDLA 3ZWTA 1UUMA 3MHFA 4UFKA 4E0CA 3HJZA 3P82A 4LRTA 1F5ZA 2GQAA 3U8GA 4X9SA 4YL2A 3B05A 3W1NA 3PSVA 3RU6A 2BZNA 3BK0A 3W87A 2ATMA 2NV2A 4O1DA 3FA5A 3KVLA 4JICA 3W6YA 3W07A 3WK0A 4JX5A 3DFQA 3TAOA 4EIVA 1VLWA 3GAKA 1ME8A 1GG0A 1GG1A 1B4KA 4FHAA 2DZWA 3YPIA 1F76A 5T26A 1FDYA 3G1HA 4DEFA 1ZCOA 2X1SA 3G1YA 3CEUA 2RKXA 3UXDA 2E77A 4MJMA 2PCQA 1WV2A 4GXMA 4O28A 1FWWA 2V2DA 1JRCA 4XUGA 2ZRWA 2C13A 4MY1A 1OYBA 1YXYA 4X2RA 5CGQA 1G7VA 4IMDA 1I2RA 4JX4A 4QNWA 1QO2A 3UZ5A 4ADSA 4OHQA 2QKFA 3P74A 2B4GA 1OG0A 2E5CA 4Q33A 3NZ1A 3HOJA 1UB3A 1S3HA 3LOTA 2R8WA 4JNMA 1TPH1 2CW6A 4I7VA 4M7SA 2YZRA 4DBDA 4O11A 4QAIA 3CWNA 3BVJA 4DBEA 1I2QA 1UUOA 1FQ0A 1TYGA 3VE7A 1TJRA 1BTMA 3SSJA 1NF0A 3NQFA 3P5YA 2QUVA 4LNYA 2X2GA 4H4IA 3TH6A 4C1KA 2XN2A 4GUFA 3W1MA 3W83A 3ABSA 3P8IA 3OVPA 4ALDA 3G3MA 1Q6OA 2RDUA 4JD4A 4O8RA 3W7OA 4RLIA 1IIHA 2E68A 3G8EA 3LXBA 1LTDA 3QFEA 1A5SA 1K03A 3BW3A 2XFWA 5LGZA 4JS3A 2ABAA 5BNKA 5SWUA 3NQVA 3QPZA 4UTMA 5CPLA 4NJJA 1G4TA 3KOFA 5C54A 3W2UA 1LBMA 2V9DA 1GYNA 2V0TA 3HGSA 3TXZA 4WOQA 1VGAA 2DZVA 1GT8A 1SPQA 2RFGA 5DY2A 1VR6A 3PUOA 3C4UA 5DN1A 2GPTA 4MFDA 4IXHA 5HUOA 2TYSA 1KM4A 1O94A 3OVQA 3S5YA 2EF9A 1YADA 2J9ZA 5AHMA 1ALDA 1ZALA 1JCXA 3TSDA 4N6FA 3QF0A 3NQDA 4GFSA 3S5NA 4OBTA 2CLFA 1SU5A 5D09A 4I9AA 6TIMA 1VLIA 3TC6A 3CU2A 4XKYA 2EGZA 3C2RA 3M43A 4O15A 4XBKA 3KX6A 3Q37A 1LRTA 3UNDA 4JTGA 3SGUA 5FEZA 4UTWC 4HHPA 1YPFA 4UTLA 2IQTA 3MHGA 1X7FA 1SO4A 3C2VA 2QJHA 1GTEA 2CFFA 4IUOA 1DHPA 1A53A 3W7MA 3TKFA 1AW5A 3TCEA 5A5WA 4K8HA 4Z1CA 4DPPA 1S5TA 2V5BA 4X22A 1FWNA 1LLWA 3TK7A 2ATSA 3QMTA 4NNCA 2WSYA 5K4XA 1RR2A 1W3TA 2Y63A 3M0ZA 1TIMA 1VYPX 3W71A 2OCZA 2FPYA 3W1PA 4MZ8A 4UTTC 5DCDA 3G1XA 1DKWA 1K3UA 3C0JA 1LROA 5FF4A 1KLZA 3T55A 1TSIA 3TMLA 3ZS4A 1ZENA 2GJNA 3HBLA 3BGJA 1DV7A 1KFCA 4NJKA 5I3JA 3GXTA 2TPSA 5LHFA 3BLIA 3EKZA 1VHNA 4LVDA 1H62A 1KM0A 1AL8A 4H3DA 4DO4A 3S1UA 1FWSA 1MXSA 3PAJA 2EKCA 4JTJA 1SZNA 5I3HA 3GDTA 2QR6A 4LS2A 2B7OA 4WOZA 3A24A 1RD5A 4FX6M 1U83A 4LY8A 5F2LA 5LNRA 1MEIA 3DENA 1OABA 2QDHA 4XWUA 4ZVJA 5HR7A 1IF2A 4UCGA 2V2HA 3BO9A 2PRHA 3F4NA 3IIVA 1OK6A 4MFEA 1YDVA 4BK9A 2A6LA 3LHTA 3NXFA 2J6XA 3O6CA 3LHYA
chains in the Genus database with same CATH superfamily
1MEWA 3S4TA 1XISA 4P61A 3W00A 1B3YA 1EGZA 2J62A 5FF0A 3W02A 3H2AA 3ZT5A 1CT5A 3V0UA 3G0SA 1DJNA 5C0QA 2DUXA 1HJVA 5IXEA 5XIAA 3A13A 4G6CA 1H50A 4C6FA 4H8VA 1HKMA 2Z6IA 2CZ5A 3DH7A 3UPWA 3ZO9A 7REQB 1KA9F 1EUNA 4MNLA 3W3OA 1DWHM 1JQXA 1XYCA 2HV5A 3LD5A 2Y0FA 4J3WA 3M7WA 4M6PA 3ZWSA 1FY6A 3VNDA 4WK9A 1JGIA 3JR2A 1TTPA 3BCJA 1KTBA 3T0BA 4YTUA 3D3FA 3ANUA 3FJNA 5LHEA 3RRXA 4PTNA 3R11A 1QI4A 1UQYA 2WOQA 1YNPA 5DFAA 2J88A 2TSYA 3VCNA 2VD8A 2AAMA 3MKCA 2CHNA 1MQRA 3W7DA 3OQ8A 1DWJM 4A3QA 6CGTA 4WDTA 4JL2A 4WDXA 1VPXA 4Q7BA 1Z69A 4X0NA 3HPSA 3OIHA 3M9YA 1MQQA 4JTEA 4W93A 4BFAA 1R86A 5I3DA 5LXXA 3ABQA 2JEPA 2RH9A 2XGIA 4LAKA 3WLTA 2ANUA 4MWAA 3WD3A 2OLHA 4JTIA 4MPQA 3LCWA 2A6NA 3CS2A 1JPMA 1LL7A 4FR6A 1W1TA 2E6DA 5TBOA 4MWAB 5A8MA 1Z7AA 3WQOA 4DWSD 1VFLA 1UKOA 3KP0A 3W85A 3B9AA 3SUSA 3M0MA 8TIMA 2C6QA 4J1OA 3BOFA 2Y88A 4RDZA 4D6JA 3LB0A 1U5JA 4QCEA 2HS8A 2EEXA 3SUWA 3T78A 2J77A 3SFKA 1XKJA 3T08A 1RPKA 4PMUA 2YOCA 2PBGA 1VYSX 2BVTA 4QXIA 3WJXA 2QPXA 4Q4RA 4MYXA 4IF2A 3GD6A 4S3FA 1UR3M 4FXFA 2GSEA 4Q8VA 1X39A 1UZHA 4HHLA 4HTBA 4BS0A 5HR6A 2QVHA 4UMAA 4YHGA 1TCDA 1TE1A 3P81A 1G6CA 3CQ0A 4AUBA 1IWAA 1OJXA 2ZOXA 1A49A 1EA9C 3SRKA 3SADA 1XG4A 1CPUA 3EX1A 4WJXA 3W7JA 3QM3A 2ZICA 3NZQA 4A21A 2XISA 4QDPA 3OYZA 1J0ZA 2DGAA 2ZZ1A 3S6OA 1UBPC 2HDJA 1ITXA 2VEKA 1LDCA 3AHXA 4F0HA 3TNOA 2ZDSA 3FAXA 3VNJA 4FOUA 4YTSA 1N7KA 4LVBA 1EJTC 1EC7A 5CH9A 1EZ2A 2W79A 1R85A 3WLNA 4PL1A 4INFA 3AMLA 4L6DA 1IXNA 3VGBA 1QR7A 4PFHA 2OEJA 4PBEA 2JF6A 2EG7A 4WVXA 2WPGA 4Q7IA 4K36A 4L4MA 2WLYA 2C19A 1M5WA 4C6MA 2VCCA 5D2WA 1N2VA 3KRBA 3L4XA 2A5HA 4O1AA 1UR0A 2X0SA 1W37A 4N2YA 4JTDA 3TC3A 4KWOA 1DJXA 3W2LA 3O6AA 2POZA 3W70A 3B97A 4JYEA 2OMAA 3PB0A 3AS1A 3AWOA 4YTRA 7XIMA 3U48A 4B92A 1XC6A 4PYSA 5DXYA 1UD5A 1XIEA 3LU2A 1F05A 3EXSA 3LZ5A 1FWHC 6XIAA 1AL7A 3NQCA 5F2IA 3CAWA 2WQPA 3LTYA 1F07A 2VX6A 3R0KA 2PTYA 1TPB1 2QCDA 2QULA 4YWSA 1NDWA 4GNKB 2C7FA 4C6JA 1OD0A 1BVWA 1SZFA 2PLJA 3NO3A 3OZMA 1HO1A 3T0AA 4MGGA 1K02A 2O4MA 4H2CA 1S5WA 4CN1A 3KL3A 1QDSA 4L6HA 2RUSA 2PI6A 1J0IA 1OCNA 3SY1A 3W81A 3W38A 1BWLA 5CQ1A 2NWRA 3U7VA 4OZOA 1JZ7A 2YA2A 4GC4A 1LOSA 3ITCA 5FJJA 1JEZA 4O53A 4EAYA 1XCFA 5F1VA 3FOKA 4IIBA 3TC7A 1KXHA 3S8HA 1A5MC 1TPC1 3BLKA 1KRMA 4NXKA 5EBAA 4LUYA 3JW7A 3L4UA 2ACRA 5CPSA 3G1VA 3FYPA 3RG6A 5LIYX 1GUVA 3GLCA 3SGZA 1VFSA 2QCLA 3NAVA 2A3BA 4YJ5A 1XLDA 3BAKA 2A3LA 1XLEA 2OOFA 3GB6A 3PNZA 3N4AA 3IK2A 1AG1O 3DC0A 5CEWA 1EJSC 3MUXA 3LY0A 4KETA 5MKGA 4JY8A 1OFEA 1C7TA 4H9MA 1HVQA 4XZLX 1PEZA 4GGBA 1ITQA 1OGGA 3B0PA 4IPIA 3BPWA 5CG7A 3SCQA 3T40A 4EF8A 1RJRA 4EWND 3CHDA 4U5KA 4GUGA 5I77A 1W3NA 2QUNA 2C16A 3R7MA 1WZAA 4F40A 2I5QA 4Q22A 2CZEA 1H7XA 1NDVA 1O95A 1SJBA 2NQ5A 2PEVA 4Z2LA 1DQUA 5F7UA 4G8TA 4S2CA 3BG9A 1HKJA 2W5FA 1G0CA 1P43A 2VM8A 2ZYFA 2LLEA 2Y7FA 4RNJA 4WX2A 3VDHA 3VKKA 3GFYA 3WNNA 1ICPA 3V5CA 5TQLA 3R13A 1WXJA 1TMHA 3LPOA 1VJZA 2DJLA 2FVKA 3O3RA 2CLMA 4LUJA 1YNYA 4JQ2A 3QR0A 3L4TA 4JXCA 1EWDA 2P10A 3Q2DA 4JBRA 3UJFA 1P5BA 4PTXA 4A3UA 1FWJC 4L1WA 2WB5A 4B5SA 1CBGA 5M5DA 1P6WA 3N2MA 1C3FA 4CCDA 1A3HA 3FYYA 4M0XA 3AIWA 1JNEA 2BY0A 4IX0A 4BKNA 3ZVIA 4B5UA 4AZCA 3VOCA 3TDFA 2NUWA 4HOZA 5IBXA 3TYZA 3CV7A 3N29A 2PDQA 4LVGA 5DRCA 3FXYA 4HNUA 1V0NA 3MMDA 1KBIA 3PSWA 1W9DM 1W3JA 1CWYA 2X0YA 3ZT7A 1KD0A 3VIMA 2PP3A 4MKVA 2XWEA 3U5UA 2WWDA 4E4PA 2DSWA 1TVLA 2VCBA 2Y7GA 2YW3A 4DYKA 3FW6A 3N9RA 2WMIA 3E2VA 3L66A 3B9DA 2VOTA 3LYEA 4Q8MA 3MMWA 1WUEA 2H8XA 3B8SA 2ESCA 3DBPA 5DEZA 4IPPA 3PR2A 3PF3A 4AZCB 4QP0A 1E1CB 1Q6QA 5EGRA 2Y5SA 3EX3A 3NL5A 4NVTA 1VYRA 1JCYA 1QK0A 3NM1A 3C3NA 1BAGA 3R2GA 3FFSA 3KFTA 1D7KA 1FTXA 3HG2A 2OKOA 1OX5A 3FJLA 5A6MA 1EFZA 2IKHA 5HNTA 4DUXA 3P5ZA 1H11A 5GNXA 4R53A 2GUUA 1ZP3A 1XHGA 4EWJA 3CB8A 3G1FA 4WKHA 1REQB 4FX8A 4R34A 5DO8A 1XH1A 3OZYA 1R38A 4YPJA 1NF7A 4AVOA 1UYQA 8XIMA 3SY8A 3O07A 4NAEA 2YGYA 4GIAA 3V4BA 4TMBA 5KZMA 3VABA 1XFCA 4HSOA 4XBJA 1S3TC 2BP1A 2CHRA 3TROA 3PBWA 3LG3A 1XYMA 4GABA 1C8XA 4AD3A 3BMXA 1A0CA 1CTNA 4U33A 1ZBWA 3M7SA 2WHJA 3IVUA 3KXQA 4HYRA 3L5MA 3ZLGA 4ZB5A 4IPJA 4R7OA 2E67A 4QM1A 3FVDA 3P62A 2D3NA 1T99A 3PY2A 3INPA 3KTCA 3VAVA 2PP1A 1KRCC 5MHBA 2VEPA 1H51A 1Q45A 5LIUX 2PWGA 3QV7A 4GY1A 6XIMA 4E2VA 1XR2A 3F4WA 4JDYA 4UIOA 3M0YA 1BRLB 4C1NA 3EOLA 4JN6A 2YDAA 3BZJA 3G3DA 5AC7A 5TF0A 4I6KA 1AH4A 4ZQCA 8CGTA 3N9SA 1G1YA 4XX6A 5AHEA 5CCZA 1V6TA 3ZSTA 1RA0A 2DEPA 3N25A 2ASHA 4V1YA 2G97A 5J04A 2YBTA 1D3CA 4JZ5A 1XLFA 4MB1A 4A3YA 4E2OA 7A3HA 3KTXA 1AD4A 2CWXA 3URNA 3MYOA 4DQWA 3QRHA 4AYSA 5D2YA 3UYIA 1JCNA 1WAUA 1SFSA 1MFUA 1E43A 3L0NA 1EQPA 4FNQA 1RBAA 1XUZA 1EDQA 5DMNA 4OE7A 1CGWA 3ELFA 3ICJA 2HPIA 1OG6A 4BJHA 4HA0A 3DHDA 3M5XA 3PAOA 3MUCA 3CHEA 3KHDA 1TQJA 4MSSA 1PS9A 2WNNA 4O1EA 1AJ0A 2G0WA 1JDEA 2A7PA 3QGVA 5FA5A 4C65A 1XBVA 3EWUA 2ZRVA 1OM0A 1H7OA 1FWTA 4DY1A 3WF1A 5A6BA 1W8SA 3G0UA 3A9BA 5T8GA 3UWYA 1U2YA 4GY0A 3NDZA 4KBXA 5CLTA 3M64A 2PAJA 4MG4A 4GUIA 1C92A 1IR1A 4OVXA 1UP3A 2NUYA 3HU7A 3SQMA 2CLLA 2WSKA 2Q8XA 5I2UA 2FJKA 1YYAA 4HQVA 1EDTA 4F0LA 3KZPA 3C56A 3KBNA 3H7VA 1XLMA 3TU9A 4PCPA 1C9DA 4X2PA 3MT1A 3H2CA 3UWWA 1RALA 4GG9A 2GOKA 2FZDA 3OBAA 1N82A 5FL1A 1WKEA 1ZBCA 2HQAA 4Q7NA 1ONWA 4LALA 5FAGA 4ORIA 5AB3A 3CGTA 4ZSUA 4R33A 4K8EA 4R5EA 5BRPA 3JZEA 5A69A 3UVIA 5BMXA 4TXEA 2QPSA 4J3UA 3UWVA 2ZWZA 1GZGA 4CQBA 3HG3A 1LBFA 1B90A 1I2OA 4NY2A 4AXKA 4JTHA 1JFHA 1GJUA 2ADAA 1LRNA 1GOOA 3L23A 5M1TA 1W9PA 3M0LA 2EJ1A 3KLLA 4P5UA 3HG4A 4XIAA 3G77A 3CUGA 3ITYA 4HTYA 2C3ZA 3CAKA 4AX6A 3AICA 1MO0A 3N1AA 3T8LA 3CB3A 3VC6A 1NFGA 1KV8A 2W67A 4MKSA 3FY1A 3WX7A 3QPYA 1M68A 4NJGA 3UG8A 2BGNE 1Q6FA 3GNRA 3GQYA 2D2OA 2OSWA 3HG5A 1Q66A 1QNPA 1M65A 3KVMA 1F6KA 5H2ZA 5CJMA 4H19A 1Y8BA 4UZSA 2YCIX 3N2TA 4GC3A 4AW7A 3NQBA 5FJRA 3GXMA 3VD3A 1VJIA 4BY3A 3CLMA 2ZZ6A 1X6UA 2VDHA 3L4VA 4HVXA 4S2BA 2QIWA 3DFNA 3EAUA 2QUUA 5CPMA 7ODCA 1UD8A 3ZJ8A 2FVLA 2C1HA 3L5LA 2DIKA 4ML4A 1K8YA 2PWDA 2IKIA 4BI7A 1ONEA 1XPYA 5ABHA 1J18A 1EDGA 4EXBA 3MANA 2BHZA 4EP8C 4GYPA 4ZO9A 4LT9A 1PB0A 1RHCA 3KBJA 3IPWA 1OIFA 1MWOA 2EKGA 3LGEA 3L0KA 1HN1A 7TAAA 3WNOA 5JBDA 4PTVA 4M3PA 1VHCA 2XG9A 2QJGA 3N2XA 4NIRA 2DZSA 4AD1A 1Z32X 1LQAA 3E0IA 3U9IA 2A1YA 3VMPA 1L6FA 4D8ZA 2X05A 3SR7A 2Y8KA 3BICA 1B57A 1LLOA 3GY1A 3ZJKA 2XN0A 4TV6A 4E8DA 2EPHA 3BJFA 3AFBA 1XIDA 3PUDA 1UA7A 2ZA1A 3KL0A 1E6SM 2WSQA 1F74A 1MDLA 3KP1A 4LCRA 3BMWA 1TMQA 5DXXA 3C2FA 3AUJA 2OX1A 1IEQA 3MZ2A 5FJUA 2C15A 2Y5JA 3PTKA 4TO8A 1TZZA 1ZPTA 5FACA 4J3VA 3W25A 5DLCA 3G6LA 3FKKA 4RR4A 1S5NA 2D0GA 2E8ZA 3H21A 4A8IA 5XINA 1OFBA 2C8NA 4HPJA 4AHQA 2Q3OA 1G67A 2GGJA 4GH3A 2GLKA 1AW2A 1TWDA 4HIBA 2E9BA 2Y8UA 3LZ3A 1LUCA 1YTKA 1H0GA 5D2XA 1RCOB 3N18A 2W0UA 4X63A 1UR9A 1W5QA 5D38A 3SQLA 3HGRA 4X61A 4KCWA 2OSYA 4LY4A 4LEFA 1AFSA 1DOSA 3LNMA 4O57A 4AWUA 4HT3A 2E1DA 4J3ZA 4DBSA 3WBXA 2XYLA 4M19A 2IKJA 1EX5A 2J8FA 3EEZA 2JBMA 1XV8A 1CXIA 1GOMA 2Z6JA 3R43A 1TX2A 4B9ZA 3ZIZA 4G5DA 1J5SA 1K9FA 3VO0A 2X1RA 4FP1A 4BZYA 3GFZA 2FTPA 3OZOA 2VFFA 1DPMA 2PTDA 1NEYA 4W7WA 4S3KA 3ABOA 4W89A 2HK1A 1QMLA 3GM8A 4Y9OA 5LIWX 1RV8A 2FJUB 3MPGA 4US5D 3GR7A 4LW7A 1EGMA 5FJTA 5C2XA 5C9WA 2L5HA 3I4KA 1IIGA 2WKLA 4IWWA 3PZNA 3PS7A 1LWHA 4JY9A 1D3HA 3C6CA 3NO5A 1A5OC 4L56A 3TN5A 1OT1A 3NQ8A 3P80A 3AMDA 4AZHA 1EEPA 3IACA 1AODA 4XG1A 4QTGA 1KWKA 1H5YA 4P8WA 2HVNA 1XLGA 1KLYA 1CEOA 4WGXA 5IM51 3FHQA 4O16A 4QSFA 4B2DA 3JS3A 5B7ZA 3U2OA 1ZJAA 3PTDA 1HKWA 2JE8A 2X0HA 4HPHA 1W9BM 3M16A 4H8UA 3SB0A 2ZBTA 5J5RA 1Z41A 3RLUA 4L6OA 1JD9A 2DP3A 2NSXA 1SFLA 1EJUC 1KM5A 4LBUA 1JZ8A 1SYTA 3P2VA 2KZHA 1H4PA 1QT1A 1R7OA 3UGRA 5E93A 2E6FA 5G2IA 1SMAA 4OV9A 2OEKA 3EA3A 2VELA 4IGMA 1W3IA 3EEGA 1ZCCA 3HQOA 1QBBA 3KS5A 3WK2A 4JGDA 1U5VA 2C0HA 3GH4A 3ARTA 3F5LA 4MY9A 4IFOA 2BV9A 4PCNA 2XTKA 4AAJA 1MI3A 4KGJA 4N4QA 1DORA 2BFGA 2UY2A 1FHVA 3ZT6A 4GJJA 3MB9A 1PKLA 5BWAA 2JK2A 2WNWA 3F4DA 4O4VA 4KF1A 4MF4A 3WJSA 3AYRA 5CZ0A 2XIIA 3G5EA 2VEIA 3KW3A 1LUCB 1YE6A 3PWAA 1H7NA 2JGQA 3MW7A 2ZXAA 5FL0A 4CVUA 4J27A 4U2YA 3HJEA 4ATWA 4BR1A 4DBWA 1K70A 1UWSA 3W7CA 1W91A 4G9PA 1E0XA 4OBSA 2XFRA 2WCSA 2Z1SA 1IEXA 4C6PA 3R25A 3A22A 2VEGA 5EMYA 1BXNA 4V27A 1I60A 1TRIA 2PTZA 4OT7A 3MHUA 4PB5A 1GVOA 1SO5A 4QG8A 3GK0A 1UR8A 2GJPA 3QHOA 1THFD 4ZO6A 3DGBA 3JU2A 1A5LC 4LJ3A 3K46A 2QCDB 5HWNA 3IJ7A 2YX0A 3A4AA 4HCHA 1SMDA 1Z89A 4LV4A 2ZKMX 1OQFA 3HFYA 2E1WA 3AALA 5EKYA 3LQLA 3OBKA 1E6ZA 2QJIA 4H8NA 3A9IA 4L1XA 2Z2UA 4KQNA 3OIXA 3EDFA 4L9XA 4OKDA 1RZMA 4HU4A 1TWIA 4JIQA 1AJZA 2XINA 4C6CA 1R3YA 4HBKA 2D1ZA 4W88A 1BLIA 1WDSA 2DV0A 4BQ2A 3SCOA 1F3WA 1XLJA 3NQEA 1XYZA 1UC4A 1SJDA 4QCFA 1WPCA 5C55A 1ZBVA 5GJNA 3RAOA 2UY5A 4HHHA 2IPGA 4HMDA 4IXXA 2HNEA 5BRQA 1JZ6A 1S46A 4GYKA 1BG9A 2RHGA 3H2EA 1IWBA 3ZMRA 4CVWA 2ACQA 1BYAA 4IP7A 4DJDC 4F0KA 5KITA 2OZTA 2XN1A 4BF7A 3KAOA 4OBRA 3P84A 2VRKA 3FNDA 1NOWA 2DSUA 3F4CA 1ZY9A 4W4QA 2Z00A 3LTPA 3ZXWA 4F9JA 3AYSA 3TZNA 4FXSA 3VE9A 1NTHA 5IRPA 4W87A 4GQQA 3STFA 1BWKA 1JZ5A 3GYCA 4CQ8A 4HNVA 4A8RA 1B31A 1IYXA 2CKSA 4EXQA 3PJXA 4RDWA 4UFKA 1TCMA 4QDWA 4PBFA 2MANA 3B05A 4IIEA 5I03A 3ZR6A 3RM9A 4RL3A 4JICA 2VTFA 1RCQA 3W07A 3W6LA 1FWFC 3XINA 3I3BA 3GAKA 1GG1A 3KEHA 1M41A 4KWSA 1RD6A 3SN0A 5BXPA 1DE5A 3I3EA 3G1YA 4HB7A 4ZEPA 4XD5A 1LWJA 3UXDA 3RX4A 3SQSA 4HNCA 2UWFA 4MY1A 1OYBA 4X2RA 4QNWA 1QO2A 4I8YA 1UA3A 3SCVA 3VGFA 3W26A 5I7GA 4S39A 1UB3A 3PZTA 4V2XA 1S3HA 4L5ZA 2R8WA 3A4WA 4FMVA 2V5KA 4XZBA 1HKKA 4I7VA 3UZXA 1B30A 3FGCB 4I90A 3VE7A 2DDXA 1TJRA 1BTMA 3KDOA 4Q4MA 1NM9A 3VKAA 3SCWA 3ARYA 3DECA 3QLDA 4WSKA 3L4WA 2XN2A 1UMLA 3TONA 3ABSA 3WENA 3P8IA 1Q6OA 4JD4A 3VZZA 2E68A 1RSCA 1HP4A 1PYFA 3QFEA 5E9AA 1F4AA 2Z1VA 2XFWA 5LGZA 4JS3A 3UPMA 2GVYA 2WLZA 2ABAA 3VOGA 4M51A 3BJTA 4UR9A 3A4JA 4V15A 2F8QA 4NJJA 3VDGA 1G4TA 3FCPA 4W8AA 5C54A 3N6JA 2OO0A 3W2UA 1LBMA 1YMYA 2V9DA 1GYNA 2V0TA 3PFMA 3T8QA 2RFGA 3HM7A 5DY2A 1VR6A 4PRTA 3THCA 4XKMA 2Y5EA 3CZLA 5HUOA 5JBFA 1KM4A 4PUWA 4ECLA 1V7AA 1OCJA 2R1KA 1ALDA 4N6FA 3NQDA 2Y4SA 2WAGA 3S5NA 3GNPA 4I9AA 3ZLHA 2XFYA 4DJDA 4NZ3A 1NOUA 4XBKA 4XV0A 1LRTA 3UNDA 1PXGA 2GGEA 4JTGA 5FEZA 3OLGA 3WBEA 3PPFA 2IQTA 3VOFA 3GVWA 1C9WA 4PB4A 1DWIM 3LA4A 1A53A 2GUBA 4A05A 1AW5A 1US0A 2R6OA 2VZUA 1HXJA 4Z1CA 1JAEA 2V5BA 1QNRA 1FP9A 1FWNA 2QDEA 5BXTA 1I6NA 9RUBA 1V51A 3QV9A 2DIEA 3GC4A 1KQYA 2G4FA 2AOSA 1DEDA 4BQ4A 5AY7A 1TIMA 3N04A 3GW0A 2OCZA 3W27A 4MZ8A 2ZVRA 5CPQA 2EG6A 4K1WA 5JBEA 3BMVA 1QASA 1LROA 2EPOA 1SJCA 1IT8A 1TSIA 4B91A 2GJNA 3HBLA 1DV7A 4UQAA 4MJ2A 2VZOA 1PKNA 1PBGA 3BLIA 3S83A 1KM0A 3TNBA 2FZ9A 2EPLX 3VYLA 4LS2A 1VEOA 3UERA 1RD5A 1U83A 2G50A 3UFYA 2DT2A 2E4TA 5F2LA 2XZ9A 4IZGA 3TYDA 1MNZA 1R7AA 4QBXA 3D5HA 2Z24A 2NVDA 4ZVJA 5HPOA 1IF2A 3BV7A 3F4NA 4RW3A 3IIVA 3TN3A 4XISA 3WQFA 3VINA 1EC9A 2A6LA 2DVUA 2PF8A 4GA8A 2J6XA 3O6CA 1I0BA 1LOQA 3ERPA 4A4AA 3AJXA 4E8GA 4KS0A 1R2TA 3WBAA 1YDOA 3V16A 1E9ZB 3TLQA 2IXVA 1VFUA 1OC7A 3TN6A 5ABEA 2GOUA 3UR7A 3TA6A 1XIMA 1T41A 2BY3A 3N3MA 1P0DA 5AHNA 3S1GA 3BL3A 3CWOX 3QC3A 3NEVA 1E4IA 3WNPA 2Y70A 5A3HA 2VC5A 4J3TA 4P7RA 3USZA 1GVIA 1L6GA 9XIMA 2R9RA 1D7FA 3P3BA 2DIJA 3KBVA 4YYFA 3HURA 3KRZA 4UQBA 3HFTA 4KRUA 1VCGA 4NASA 2AGTA 5D8WA 1P0EA 3CQJA 3MKVA 3LCLA 5AHFA 3OP2A 3O9NA 5CPNA 1WNOA 3K4WA 1E56A 2YLLA 4LTSA 1OYCA 3NTYA 1YDYA 4O52A 3WDJA 4HMEA 1O66A 4LUSA 1OWQA 3EDJA 3Q65A 1UD2A 1G4EA 4DNHA 5FCZA 1JF5A 5KZEA 4HU3A 3FIGA 2FTYA 1ZJBA 2W27A 1JVNA 3W7PA 3QR3A 1PYMA 3DG7A 1I1XA 3H54A 3AZRA 1H60A 4JTRA 1KR1A 1XFBA 4HZ7A 2V69A 4IMCA 1NWUA 2PDPA 5ECUA 5F4SA 2WMIB 1F6YA 4MMWA 2X42A 3IJ9A 4AZ6A 4C90A 2J27A 3APGA 2NWSA 1R3WA 2GZXA 1KM2A 3RHGA 3CUXA 3E5PA 4ICMA 2REQA 1EYEA 5D02A 2ZX7A 4V1XA 1TUFA 4I3GA 1EF3A 3BSHA 3XISA 3F2BA 2EPMX 5DT5A 1D3GA 3UZZA 1U22A 2PDWA 1DXFA 3B4YA 1RLDA 4JTLA 5D4YA 4DYEA 3NQ6A 4DELA 3W7QA 2Q6ZA 2XSBA 1O6IA 4Q4OA 3OA5A 4HHMA 1BQGA 2IQ0A 4AB4A 1O5KA 3MC5A 5F4XA 2PDMA 2PLKA 3WH9A 4GX9A 2NT1A 1AK5A 4MM1A 2Y24A 3T9PA 2YYUA 4CD4A 4AHOA 4MYAA 3C0LA 1LORA 3MBFA 5E5CA 5I3IA 3H22A 4EKJA 1HJQA 2OSXA 4WY0F 3VKCA 4YWIA 2CLKA 3OLEA 1XYAA 4E8CA 4KGLA 3AIRA 4S3CA 3LTSA 3CHFA 4RCXA 3UD6A 3QSTA 5JIWA 5K9CA 4IQJA 3E38A 3KDNA 1LYXA 1V08A 1UWAA 1XBYA 2FPTA 3G24A 4KPLA 4S3GA 2Y2WA 3USBA 5CGMA 3S6TA 4E3VA 4GZEA 3VDBA 1XIJA 3F1QA 1HKVA 1VEPA 2CBUA 1Z9AA 4ZL1A 2ZTJA 1JD7A 2VZTA 4IJCA 3MWAA 4RZBA 1E1FA 4IIFA 3IGSA 4US5A 4D2JA 3L4ZA 4EOUA 2Z29A 1W31A 2NQZA 3U2EA 4RPPA 3UY7A 1H2JA 5FJOA 3T2OA 1EJXC 3N13A 5AYXA 1KTCA 2QV4A 1E4NA 3S47A 4OWGA 2I1OA 2Z27A 1F8IA 1V03A 2HTMA 1I2NA 3HB9A 3FDGA 2D0FA 1CGVA 3GR4A 4XAPA 1HIZA 3UY8A 2CZDA 1UG6A 5KZDA 2OJPA 3TTYA 3VZXA 4NG3A 4N02A 2HVMA 1DTUA 1OCBA 4DYJA 2WC3A 4JQ1A 1Q6RA 1L0PA 3WQ4A 3IAQA 4K1GA 1EIXA 2HBXA 3KM8A 2PGRA 3IJ6A 4FLRA 3WLHA 4UNLA 4XAYA 4WY0A 3MJYA 1PUDA 2QAPA 1LWIA 5CC5A 1PWMA 4S3DA 5HJYA 1XGDA 1OF8A 3HPAA 2A21A 4ML9A 1IZCA 4B2DD 3SEPA 1FWBC 3BLDA 2XSXA 4WGHA 3N2CA 3UXAA 2G3IA 2CC0A 4YNGA 4IISA 4JYDA 1XRFA 2CBJA 3GKAA 1SZGA 1XC4A 4DIAA 2CESA 1J0JA 3OB8A 1FRBA 1XD1A 5GQBA 1UIOA 2ZZ3A 5D9NA 2C1IA 1CDGA 1ADSA 2XH2A 3HZ3A 4NKCA 4HYVA 1CW2A 4DRSA 1K8XA 2IKGA 3WL0A 4WD0A 1XLAA 1VCFA 2OKTA 4I5RA 3DI1A 3S2NA 4CU6A 4XBSA 3GTIA 4PMQA 3GHRA 4TVDA 3MKKA 1VKFA 2AQOA 3T0CA 4CEUC 1QXLA 3PN8A 3ARVA 4H6KA 3QLLA 2WJDA 1RBLA 2ZIDA 2P1FA 3FA4A 1ZL1A 1TV8A 1HGYA 1UKSA 3M44A 3NG3A 1B1YA 3DN5A 2UY4A 3BSMA 3WEZA 1TR1A 1WOBA 1Q85A 2QUMA 1H1YA 3S2LA 2ZZ4A 3EMCA 4LBRA 1CXKA 3UJEA 3CO4A 2XHYA 3SRHA 3EWCA 3LMZA 4ZTXA 4LAOA 1OZQA 3CHVA 3IIXA 1UROA 3U7BA 4HK6A 4K38A 3CL6A 1ECEA 3S9ZA 4OGZA 4QHRA 5AHIA 1L6SA 3EOOA 4UR8A 3NURA 5FF7A 1KR0A 3W1XA 3TEVA 1QU4A 4YXGA 5AC6A 4R7WA 1A4MA 2V5DA 5FJIA 5C8BB 3E1F1 1E51A 3OHIA 1W9VA 1UC5A 4FO4A 2ZRYA 2R1LA 2YCLB 2A7RA 1OBAA 3PHAA 4X0VA 3VNYA 5D05A 4XD4A 5REQA 3OQEA 5I5RA 1O5XA 1X97A 4D71A 1JQVA 2XZ7A 1FDZA 4MWAE 1V3LA 3MMUA 3OPSA 4AMCA 3SW6A 1ME7A 4W8BA 4WXYA 1KFLA 1QHZA 2P76A 2VKZG 2XVPA 3KLKA 2XH0A 3LN3A 1V3JA 4TIMA 1TVPA 2VQUA 2WM1A 1MRQA 1P7TA 4PUNA 3HMJG 3PTMA 4FK9A 1VH7A 3UJ2A 2WSPA 2YL9A 4M8UA 4C7GA 3M0XA 2DSVA 3QKEA 1M7XA 3HV8A 1LL4A 1ZAIA 3VGGA 4CCCA 5CSRA 3G22A 1QPQA 1B3OA 2VC9A 4F79A 3UETA 2J9XA 2FFCA 4CN4A 2R14A 2H90A 1UJPA 3QTPA 1I0DA 2PRMA 4J4KA 4I9JA 5KEZA 1TV2A 1XGEA 4ICNA 3TSBA 3CPGA 2FB3A 4TU1A 4MWAD 1JCMP 3FV9A 1V3MA 4JFVA 2Z26A 4M81A 3VIOA 4B5WA 4PL2A 1UWRA 1PTDA 1EUAA 3EA2A 4L80A 3FXGA 1IXQA 2C71A 1RA5A 5LZLA 1XYBA 3W2JA 5FOOA 4KH2A 3TSMA 5TNVA 3WUFA 1MW0A 3UR5A 1T6MA 1CXFA 1VD6A 1OFOA 5I24A 4DN1A 3JVAA 1W1IE 1GEHA 2HS6A 1ENUA 3E2SA 3E96A 2CBVA 2RJHA 3EB3A 3VOJA 1EGVA 3IUHA 3WJYA 4I9TA 1I9CB 1CENA 2W63A 4CD5A 3BDKA 1K7EA 5DCEA 4WJEA 3V5OA 2VGFA 1IEVA 1KGXA 4URIA 1IT7A 1GKRA 2IUZA 2ACUA 3I68A 1GWJA 4LS0A 5GNZA 1VBUA 4WR3A 2KX9A 1DIOA 1Q4NX 4ENLA 3KE0A 3UZJA 3O6DA 2VR4A 1JDCA 1HNYA 1UR2A 2X30A 3DG3A 1UQZA 2VMFA 2XFFA 3QZAA 3IRDA 3ARXA 2ZA3A 2V5LA 1SZRA 4KFOA 1IT0A 5FKYA 4U4MA 2ZE0A 3MSRA 3IIZA 5LSMA 1PKYA 1C8QA 3HN3A 2GWGA 3UYCA 2PDCA 5HBFA 5C2GA 2EG8A 3N4EA 1V3HA 4GINA 1WOAA 3ZR4A 4OQVA 1SW7A 3STPA 1EP2A 4AZBA 3NM3A 4CD8A 2BMBA 3RMJA 4HJFA 3B8WA 3AS3A 5BZAA 3KOXA 4GKLA 1GVFA 2OZ8A 4U3AA 4RZ6A 5G4EA 2Y7DA 4REQB 2CZVA 4IGHA 3LSBA 2WO5A 3MUIA 4ZSTA 1GVQA 1HL9A 2CLPA 1J0HA 4H6EA 5EMKA 3U0HA 3WDRA 4QITA 3TYCA 1ELSA 4JIRA 4UFIA 1WBHA 2OB3A 3TTSA 3FN9A 2HBVA 5FF2A 3J7HA 3LLFA 3DAQA 1QNQA 3TR2A 4L9ZA 4BEQA 5DBTA 4S3BA 5AVNA 3WUEA 4GE8A 1CGUA 2VFHA 3XIMA 1CXLA 4CNTA 4J3SA 4AWSA 3PZQA 1V6YA 2BVDA 3T2QA 1OFAA 4HGXA 1X1NA 1JDAA 2DW7A 4MDPA 2PDGA 4N6EA 4Q3MA 1K8CA 3T07A 4AF0B 4HMCA 2AQVA 3IUIA 2D0HA 5HULA 4MDOA 1Z48A 1XI3A 2W92A 1TMLA 1FXPA 4KWWA 2J78A 3QMSA 3W86A 2PWVA 1MRAA 1YTEA 4P8UA 5RUBA 3H70A 3LM7A 4NI3A 1V77A 4G1NA 4MHBA 2QNEA 3SIMA 3KVJA 2QCHA 3CMJA 1YNQA 3H26A 3BUVA 2DFAA 5G2WA 3B0XA 5HA7A 4PH6A 3QV6A 1S5VA 4LXFA 4Y9AA 3FHAA 3LK6A 1EYWA 1TV4A 1QW8A 2DORA 1G4PA 4HNTA 2FQIA 1B4EA 2D2GA 5DMMA 1TQXA 1HT6A 3E3HA 3M46A 3GDBA 2OWWA 2WQDA 1GW1A 1Q7QA 4DXXA 5T9BG 1L2QA 1KM1A 4M6VA 2DT1A 3BH4A 3WLJA 4Q8UA 1IZKA 1H7WA 1JR1A 3TAKA 4MJZA 3IGHX 4Y96A 2O9RA 4HSHA 1VBRA 2F2KA 4NXSA 4O12A 3VZYA 1WKFA 4Z08A 3NGJA 1JPKA 3DGRA 3HF3A 4DO7A 2YDQA 1WA3A 5LNWA 3LUTA 2PWEA 1S2TA 2DUAA 1MDRA 4MAVA 1TPUA 1TO3A 2OU4A 4FR1A 1CXHA 1P0BA 4XUYA 1QRQA 3WQCA 2E6AA 4HA1A 1NVMA 3FDKA 2VGIA 1ZP4A 5E70A 1HL8A 3GS6A 4GBDA 5AC8A 3O63A 1J10A 3TTEA 4IP4A 3VOHA 4MUZA 4N9CA 1PAMA 3I65A 4GVHA 4LC8A 4XAFA 2W6RA 2PBOA 2UZ9A 1FH7A 2ZXDA 5HANA 4LUIA 3AIBA 3T0DA 4TX6A 1LQ2A 4AY7A 1EQCA 1DBTA 2XVGA 4DLFA 1EP3A 4ZQRA 2DZPA 1ZNNA 4NRRA 4DF0A 1BG4A 5AHLA 4PSPA 4RV3A 1Y5WA 1NIUA 1D8WA 3E9AA 1F8MA 2YW4A 1HG3A 1FHUA 4LEQA 1GGOA 1DE6A 2PDUA 5I79A 3B4UA 3STEA 1Y7VA 3DHFA 3IVSA 1ME9A 1OC5A 3VDCA 3TJLA 4FALA 1Q6EA 3BLFA 1M53A 1B9ZA 1EJWC 2DU2A 1RAKA 2ISVA 2XGZA 5HDRA 3UJSA 3TJ4A 4KKXA 2JALA 1A4LA 4FIRA 4NX0A 3SN1A 2JIEA 4JHZA 4YU1A 1S39A 3LXAA 3AHZA 3W84A 1E9IA 2BX7A 2YSWA 4Q8WA 5BYWA 2F7FA 3W75A 2D2HA 2GK1B 4IPNB 2J7GA 1CB7B 1ZJHA 2WNZA 5A2CA 4TQTA 3DEQA 4POCA 3O15A 4S1FA 1CLKA 3QYQA 4N42A 4FXJA 2NLIA 4H04A 2Y6ZA 3WSUA 4F66A 3OGSA 2Z1KA 4DJED 1WZMA 1N55A 2VUNA 1LZOA 3PJUA 1PSCA 4ZFMA 4M6UA 3GVRA 4IJRA 2NQ9A 2BG5A 2PUZA 4RZ4A 3WQPA 5BU6A 3RCYA 2ZX6A 1RQEA 1YBQA 2PDNA 2B7QA 2FGBA 5H8MA 3W2KA 1EBGA 4EE9A 3EGJA 3AOFA 3WZ0E 3A4XA 3UA4A 3TW6A 1O1ZA 4MB5A 5J5DA 3C61A 3GTNA 4JIHA 4XZIA 3H2OA 3W76A 1J9YA 4RXFA 4OTKA 2TMDA 4J28A 4LB3A 2PU0A 1FUYA 4FNTA 4MOZA 2XM1A 1V02E 1BRLA 1MMFA 4XZ9A 2WNQA 3EWXA 4C1NB 5BXRA 1K6AA 2NQHA 2Q02A 2F9RA 1QI2A 2IXUA 2W91A 4ERGA 1UKPA 2CITA 3K4AA 1XG3A 4ZQNA 3TYAA 4UQDA 1EBHA 1RVKA 3WDPP 3SCRA 1PL9A 2CLOA 1POKA 2JGYA 4NAFB 1XDMA 4L65A 5LNSA 1QPKA 4WIWA 4WUIA 3G1SA 3RFAA 5JMUA 1OFRA 3EPMA 2PWUA 1XYFA 3T7VA 1OFPA 2GFTA 2V3FA 2X7VA 3FAWA 4ZE5A 4XAZA 4WJ8A 3MWCA 3EX4A 3W1LA 1W1YA 4W7VA 1ICSA 1QHPA 4Q4KA 2YCJA 3T05A 2Y89A 2AAAA 3NDOA 3NYZA 4LWWA 3TQPA 5LNUA 2H3BA 4NI8A 1WZLA 3S6DA 3ZQ9A 3KCJA 2OT1A 1DVJA 3W0KA 5LA0A 3UZWA 3WUBA 1JCLA 3NZRA 4JTUA 2AQWA 2ZUSA 1TWSA 3EWWA 5BRBA 5BROA 3GVQA 5AECA 2OELA 4PR4A 5HQMA 4E4UA 4CLMA 1A0EA 3QPEA 2C0AA 2WZIA 1Q5MA 2YA0A 4DXKA 4U28A 5K7JA 2AGKA 2OEMA 1ICQA 4QDMA 5EA9A 4ZA0A 4Q4SA 3TYBA 3SBFA 1V93A 3L4YA 3AU2A 4GVGA 1S2CA 4E38A 2IS7A 3N3TA 1CYGA 1QI5A 2H9AB 2ZQ0A 2ACSA 5KTLA 2FDSA 2A4AA 3QOKA 5HPCA 4M6QA 3AHYA 3P14A 3MSYA 2J47A 3W1AA 3NQMA 1HL2A 3W7EA 1K77A 3GXFA 2DZTA 1AZ2A 2DQXA 1G5AA 4H6QA 5EFFA 2RDWA 3BW2A 5HQLA 3PJWA 1L9WA 3UBPC 1SO6A 2YPIA 3DFSA 2J24A 1EP1A 5AC5A 4H41A 2O9OA 3L5AA 2ZA2A 3QY8A 4XK2A 5LNVA 1E40A 2P3ZA 1GORA 2NX3A 3TE9A 3BSGA 4IM4A 4AWEA 3RMEA 1QCWA 3WD4A 1H1NA 3PC0A 1J2WA 1UOKA 1C8YA 4XO7A 2O9TA 5DMYA 3QV8A 3O2LA 1ISYA 1RJQA 4Z0JA 4A29A 4D1JA 3W2NA 1PZ3A 4GXWA 1CIUA 3TTOA 2WKJA 4GI4A 3WCZA 1QTWA 3MUY1 1M6JA 3EWDA 4GYJA 4E2BA 3BQ6A 5ABFB 4UOZA 2OYKA 2VP8A 1WXYA 4DZ5A 4XVEA 3CV6A 1YPXA 4FNRA 2V2CA 1JULA 2VO5A 4LANA 4YIWA 3D6NA 3ES8A 3MQTA 4S3JA 5F2MA 2X1IA 3CPRA 5CBJA 3C3UA 4KESA 3FVMA 3S9IA 1FX6A 3LCFA 4KEVA 4O13A 3CHCA 2PDYA 2VCAA 2VC6A 5DY3A 3GC2A 4O50A 1J0YA 3W24A 4Q4PA 3MP4A 4LGXA 3VIIA 1VQTA 5AYYA 3DHUA 4XSLA 4O54A 2WJFA 3N34A 3QN3A 2G3JA 3UVAA 4NAEB 3OOQA 2FDMA 4DJDD 1JUEA 3AXHA 2BOGX 3WBYA 1S2WA 3BCDA 2JF7A 1BXBA 1UJQA 4HA4A 3GTFA 1MW2A 4JKMA 4GI8A 1D2KA 4KCVA 1QUMA 1QJWA 2PLMA 2E8YA 3CUFA 3QYSA 4A3HA 1T8QA 3H6OA 3GNDA 5HOSA 2O7SA 1VEMA 4LF1A 6ENLA 4D6CA 5EFDA 4UCFA 5I23A 2GDUA 5CJ5A 4I7WA 3GVVA 3REQA 4G7FA 4PUJA 3H2NA 6PTDA 1DQXA 1EZWA 3TX9A 1YPIA 4GUHA 3A21A 3ONCA 1EJ7L 3I6RA 1POJA 3OYXA 5IFPA 1F73A 4XZNX 3IJQA 5D32A 3LI0A 3M0JA 2FZMA 3SN4A 1JZ4A 4BCEA 5KMYA 1E6NA 2HXUA 4JHMA 1OF6A 3CQKA 3HV9A 2X16A 1PDZA 3M6YA 3VCCA 4DAIA 4FA3A 4Q32A 2JFEX 1DIEA 4JEJA 5M03A 2WZHA 3TQ0A 4QGCA 1YE4A 2P5NA 3NJ3A 3RPTA 3PZGA 4ZTYA 3S46A 3W73A 3UXLA 2IQDA 3GG1A 4FNSA 2WC4A 2Y7EA 3RX3A 1LT7A 1ONXA 3MSDA 1KFKA 3PBGA 3P60A 1GVEA 4JQ3A 2V67A 1TB3A 4CQAA 5HAOA 3W2MA 4P2VA 2XDFA 3VGDA 3TJXA 4FOJA 3ARRA 1KGWA 1LM1A 5CSUA 1R87A 3UNTA 3VA8A 3I4EA 2O0TA 4V28A 1UP2A 4LOCA 3WQDA 1NY1A 3OW1A 2QT3A 4HCDA 4DPQA 2YFOA 4ACZB 4C6BA 3O7UA 1WUFA 4IIHA 2GDVA 4C6NA 4YCPA 2E5DA 4QQ3A 3VD5A 4HMNA 2X41A 3LHZA 1GVYA 5FI8A 4NNBA 1XDLA 3QZ6A 1UUMA 4ACZA 4E0CA 4LRTA 1F5ZA 3Q45A 2ALRA 4CQDA 2GQAA 4X9SA 1NP0A 4NZCA 3UXKA 3BK0A 4AG0A 2ATMA 1P7TB 3KVLA 3OLDA 4XZWA 4AD0A 2G3NA 3TAOA 1ME8A 4W5ZA 1B4KA 2QLYA 4FHAA 1W2VA 1KBBA 5T26A 1FDYA 1ZCOA 3CEUA 3V7PA 2OQYA 1C90A 3EPOA 2E77A 2FMNA 4MJMA 3W82A 4LCSA 3UR2A 1FWWA 1UKTA 2V2DA 2C13A 3B0YA 4LYRA 3DERA 2BVYA 5CGQA 9XIAA 4EX4A 4F0MA 2ISDA 2OQHA 4P8VA 3HOJA 3LOTA 4JNMA 3ME3A 1R9XA 4RW5A 4DBDA 3CWNA 3BVJA 1NELA 5LIXX 1PJ9A 1TYGA 3RJXA 3R79A 1A3WA 3T0TA 4PEEA 2ICSA 1NF0A 1O1HA 3NQFA 3OJGA 3VNZA 4BA0A 4L64A 3IARA 4LNYA 2X2GA 3TH6A 2VJXA 1PDYA 4GI6A 3W83A 2ZX5A 3WD2A 4ALDA 4PMYA 3ID7A 4ZCWA 1EOKA 1P6CA 3C0SA 3G8EA 3BOLA 4RE3A 1A5SA 1V6UA 1K03A 2UBPC 3C0QA 4MNKA 5SWUA 3NQVA 1PIGA 4K68A 3IWPA 3S2MA 4DM2A 1PTGA 1OADA 2VHLA 4ZE4A 4H1ZA 4WOQA 4HN8A 2Z7GA 3TXZA 1GT8A 4IIGA 4W7UA 4ZOCA 4IQEA 4LAMA 4MFDA 3AZTA 3PPHA 5M2FX 3R6IA 3S5YA 3CV2A 2J9ZA 2J79A 2E7FA 3BJSA 5AHMA 3VNIA 4L4PA 3IJIA 3TSDA 3QF0A 4GFSA 5D09A 1SU5A 3CU2A 4XKYA 2EGZA 3C2RA 2O4QA 1EF2A 3V1HA 5A8OA 3IUDA 2VX7A 1YHTA 1E0VA 4R85A 4UTLA 1U33A 1X7FA 1G01A 3C2VA 1XJBA 3LMYA 1DHPA 4H01A 3W7MA 1V6XA 3BC9A 1S5TA 4QEEA 1FH8A 1Q2RA 4XVDA 1LLWA 1UZ4A 2ATSA 1XQKA 5A6SA 2BXZA 3FSTA 5A1AA 3ORWA 3W1PA 1UOZA 3BCFA 1KO0A 4IL0A 1GHRA 2G4JA 1LL6A 3IS4A 4UTTC 3G1XA 4N7QA 3C0JA 2P8CA 3T55A 1KLZA 3TMLA 3ZS4A 2DT0A 1KFCA 2TPSA 1WDDA 3OGVA 3GTHA 2G8ZA 3EKZA 4C6KA 1TZ7A 1ZQ5A 1TA3A 4AC1X 3CO8A 4K3ZA 3S1UA 1MXSA 1B54A 3PAJA 1KNWA 1SZNA 2NSOA 2X09A 4WOZA 3A24A 5CXPA 3WEOA 3NIYA 5EMJA 4DWSA 1A5KC 2E0PA 3RLHA 4LY8A 3SCTA 3CT2A 1MEIA 4GY7A 3DENA 1OABA 1A5UA 2QDHA 2OLSA 5HR7A 3VNKA 4GO8A 3BO9A 1MUMA 2PRHA 3KBMA 3R94A 1GQKA 1OK6A 3URQA 2EPKX 3LHTA 3N2OA 3NXFA 1OFQA 2H3DA 5FD0A 5I78A 5JXQA 3RITA 2ALDA 4L4OA 1DP0A 4ZQPA 2ZXQA 3Q67A 3W88A 4U10A 3EOEA 1Z8AA 2DH3A 3LCIA 5TD4A 4LNCA 3WLPA 3H53A 1C8VA 4U2ZA 4PCTA 1QPRA 4JTQA 3H4XA 5A8PA 2HCVA 1HGWA 4H9ZA 4RK8A 5H6HA 4UNIA 1GPWA 1E15A 1PZ0A 4CEXC 2ZRZA 2Z1WA 5KZ6A 3UCDA 1JI2A 3W4RA 3MYPA 2OX4A 1ECQA 3SCPA 3ARSA 2HXTA 3PULA 2W3ZA 3DESA 3PNUA 3BAJA 1M7PA 5REQB 3EMZA 2VNCA 4WQ6A 3LCHA 3NVTA 1K9DA 2DT3A 3NA8A 4GFIA 2I17A 4XZHA 3PWIA 2WWCA 1MSSA 2ISWA 1Y65A 4AIUA 2WCGA 2ZX9A 3B9OA 1XIFA 1EH9A 5B80A 3F5KA 4NYUA 1KBJA 1Q3NA 1G9HA 2VDIA 4D6FA 3EWYA 3B03A 2VR2A 5C9RA 4JIPA 4QS5A 3IK4A 4CU8A 4F9DA 3RYSA 2C14A 3SRDA 1AA1B 4MLJA 3VX0A 4UUIA 4WCJA 2BDQA 1TUXA 2DUZA 2WXDM 3LS9A 1VFHA 3A5FA 3A6OA 1Q8AA 5D04C 5A2AA 3SDOA 1JPDX 4LAUA 3AHVA 1K7FA 5D03A 3TIMA 1Y5VA 3HGJA 5AYZA 1MQPA 1NP2A 3O1NA 4Y9PA 3BE7A 4AF0A 1AD1A 3PANA 1Q7ZA 1TFVA 1WO2A 1XIIA 2FHFA 2ZZ2A 3NYDA 1XCWA 3WQGA 2X1TA 1GYLA 1K1DA 4AEOA 1ZZMA 3GIPA 3KZSA 5FF3A 1A50A 3PJTA 4AEEA 5CPOA 2FGZA 5FSDC 4H83A 4PUDA 1VFTA 1BYDA 5DT7A 2EAWA 1P0KA 3GHTA 4HCLA 1DWGM 2NQLA 2GVGA 2ISSA 4UWMA 1R47A 2BOFX 4BHYA 3RUBL 4YHEA 1BF6A 4NZFA 2R94A 3THDA 4G7EB 5L6UA 4XQ6A 4B5VA 3QXBA 4GI9A 2VXNA 4NUWA 1XINA 4H9XA 1BGGA 2VZSA 1UWTA 4JFWA 2JKEA 5DQPA 4JDBA 1X7IA 3SFWA 3B8UA 3B9EA 2Z2BA 4KRTA 4YVPA 2EHHA 3WQ6A 4Z1YA 3QGAC 1RY8A 5CKSA 1OFDA 4GXPA 3WD1A 1KQZA 1ISXA 4C6OA 3VMOA 3L2LA 1JGMA 4GZJA 1V0LA 3GH5A 2PDIA 3FEMA 5C71A 1K4GA 3FX4A 2VRQA 3WH8A 4UFHA 1ITUA 5CBBA 3PK7A 5K2ZA 1R30A 3N6QA 3KWXA 1TV7A 5HWMA 4M80A 1NWRA 3ATZA 3CASA 4O17A 3W37A 4FNUA 4AYGA 1W1PA 3WKZA 4IX2A 5GJMA 2AL2B 2BY2A 4M5PA 2V82A 2OZ3A 3RILA 2V5CA 2IPJA 3N15A 1US2A 1VFOA 3JUGA 2TAAA 3URBA 1TV3A 1JZ2A 2QUTA 3S5OA 1BXCA 4XSMA 4LUTB 3H2FA 3RGTA 1EL3A 4DZAA 1HUVA 4KEZA 3STGA 2J7FA 1MUCA 4DJFD 4Q6JA 2DY3A 3VK5A 5DBUA 1GCYA 3H12A 4HA3A 4IFRA 3SO7A 4GKTA 4QX4A 3AI0A 4BWLA 1AMYA 4DBUA 1RVGA 1M9HA 1XPGA 2A79A 2AMXA 3MV11 3WNKA 4B5XA 2NUXA 3MTWA 2QVNA 3M41A 1W3HA 3AU6A 2NVAA 4LV9A 4MIMA 5K9XA 1W1A1 3ATYA 4IOTA 3PZ9A 1GJPA 2WVUA 3KOWA 2XUCA 2VRJA 2YL8A 3PBVA 4BF5A 2BXVA 3DFPA 1GQJA 2HNHA 2OPJA 2PDJA 3BAWA 2PPGA 2WZEA 1B9BA 3T2PA 4Z17A 4GIYA 5BOEA 2Z4GA 3VKDA 4BI5A 4YTTA 4NZJA 1GZ1A 4X60A 4WZHA 1GKQA 4W84A 4I9MA 2YBVA 3WMCA 1QPOA 3Q58A 4XO6A 1RXOB 3W22A 1DXEA 4I5XA 2I56A 3RDKA 4MZYA 1KXQA 3WQ5A 4U31A 2EPNA 5U4NA 3H8AA 4GX8A 3I10A 2QCMA 3MMTA 3U2ZA 1OB0A 3L0GA 3P0XA 5MKGB 1F4HA 4H00A 2V6AA 4LCQA 1QNOA 4MUPA 1XLIA 3WJWA 3SSZA 3WLSA 5DCBA 4A3RA 3CMGA 1ZGDA 5FIPA 1M03A 4CQCA 1FFRA 1S2VA 5CSYA 1F61A 3WK3A 2GJLA 2J8GA 3EX2A 2GQ3A 3BQ5A 3ZM8A 1FWRA 1ZAHA 2BSLA 2DZXA 5BOFA 4C1LA 4Q4QA 1ZHAA 4F4RA 1WCGA 3EDKA 3WYZA 1L8NA 2D20A 3SJNA 1XLLA 1F3XA 5GVJA 5BWFA 3VXGA 3LRMA 1LQ0A 4OU1A 1CGXA 4C7FA 3GDRA 3VM5A 4RNHA 4J40A 1TKKA 1P0NA 4J35A 1WDPA 4CNPA 4LYPA 1PIIA 4QJ4B 2FKPA 2FB2A 4AZGA 1TX0A 4YLWA 4IIDA 3TFCA 2GVJA 2ABBA 1TPDA 1SO3A 2YA1A 5D30A 1Q7MA 4AISA 1UHVA 4MB4A 3SURA 3GNOA 3RNDA 3N19B 3Q4DA 1E6QM 1V5XA 4FF7A 4OIFA 4GIRA 3PPCA 4FSAA 5A94A 1Q63A 4K6AA 2CLHA 3TW7A 4B15A 2QZRA 1ISZA 2P3EA 3EMQA 2GUYA 3SUTA 4M1RA 3QH2A 4IL2A 5A6LA 3LNPA 2OXNA 3NL6A 4BF9A 4CN6A 4ACYA 1VJSA 4M29A 1W5NA 1HFBA 3DC8A 3ITVA 2JEQA 1PVNA 4WXZA 4DUOA 1TR9A 1XX1A 1BVNP 2DZBA 2FPVA 2VURA 4EPDC 4IH3A 2Z7KA 3PBUA 4X3ZA 4Q8PA 4JTKA 3CYJA 3QJAA 1JUBA 3DFTA 1CXEA 1XLBA 2REQB 3NVDA 3ONBA 1CX9A 3GIYA 3ARZA 4HU8A 2EQDA 4ZOEA 3RM4A 1D8CA 4ERIA 1XQLA 1KBKA 2GGGA 4CD7A 5CZJA 2WBKA 3B0UX 3PTQA 5C7HA 5CZSA 4WSHA 5L9FA 2PWFA 1W3KA 3H55A 3W7KA 1E70M 1RK5A 4HN4A 3IANA 3TYEA 1R3SA 3WN6A 4YYCA 3M6DA 1G69A 3WBWA 4AD2A 5JU6A 1RJPA 2V3GA 2VDGA 2BNJA 5I3FA 4Z0SA 4Q8NA 3TYUA 4UTIA 1AUSL 1E6RA 4JPGA 3VDAA 3QHNA 5CGTA 1I1WA 3AMCA 3GNNA 1SZEA 1Q8JA 1XUUA 3ANYA 3DFYA 3DXIA 2VX4A 1TRDA 3OO2A 3RM8A 2WYSA 3UWUA 1SSGA 1TJPA 3HPZA 4GK8A 4L4LA 3G1RA 3IIPA 3CLWA 1L2UA 1QO5A 1WKYA 3WLLA 2WVTA 4P7NA 2J13A 4Z1AA 4PN2A 4JKKA 3T42A 3NPVA 4ROPA 4FI4A 4AIOA 2QW5A 1KKOA 4PMOA 2VWSA 1Q6LA 6REQA 1YBQB 3C5QA 3AIVA 1W1ZA 4K2SA 1R3QA 3A23A 3VFLA 4LAZA 3AAMA 3W7IA 4LS1A 2WVVA 1H0IA 1TV5A 2OOGA 3GX9A 4HP5A 1PHQA 4PTWA 1WDQA 1HW6A 3H4WA 2FMOA 1DIKA 1UWQA 2YXXA 4QLKA 3TP4A 4DNMA 2OFJA 2CERA 4LYKA 2WJEA 3R8GA 3SCUA 2F84A 1E9LA 2VEMA 3PZIA 3RCMA 1OX4B 2WHMA 3OLIA 4PEKA 4CNNA 5T91A 1H09A 3KL5A 3PZMA 2Y85A 5EY5A 2ZRXA 3WF0A 2YLAA 1JIBA 2O56A 3BLLA 1ZUAX 1GOIA 3LPGA 2Z25A 3GO2A 3U5YA 3VD9A 1W3LA 4R27A 3A3XA 5CC6A 2WHLA 4F0RA 3EYPA 5CJNA 3TV8A 3REQB 4CNSA 2A3EA 5HNNA 1Z6KA 1CLVA 1GPFA 1GOQA 4GJ1A 4B90A 1P6BA 1WDRA 4N4PA 4RKAA 1ESWA 2ZC8A 3LERA 1J93A 2ZDRA 4TX8A 3LM3A 1TPFA 4NAFA 3I7QA 3R8RA 2ZADA 3ARUA 4A2RA 4DO5A 3VD4A 5EBUA 1EPXA 4R9XA 3DUGA 4ZOAA 3HPFA 2NXIA 4LSBA 3DIPA 3OODA 1DHKA 4PUUA 5HJLA 2QIIA 4PB3A 3BANA 3EWZA 2V30A 4RDYA 5G4HC 1W6TA 2BHUA 4RX0A 5F4WA 2PDBA 3LLDA 1A80A 3MO7A 3UGVA 4WKFA 3WNLA 1R2RA 3RPDA 3GU9A 2J75A 1BQCA 3EOUA 3WLIA 1V79A 2PDKA 1E55A 4GQBA 1KFEA 4AHPA 1X98A 3T81A 3APTA 1W1B1 3SY5A 1XD0A 4GCXA 1HJSA 2ZZ5A 1JYXA 1TJ2A 3FS2A 1KWGA 2WM0A 1P1XA 4QIUA 2GJXB 1TPEA 2BB0A 2VZVA 4HZ6A 4FAMA 5CZTA 2E9LA 2UY3A 3CQIA