3G3DA

Crystal structure of human orotidine 5'-monophosphate decarboxylase covalently modified by 5-fluoro-6-azido-ump
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
256
structure length
256
Chain Sequence
b'ELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine 5'-monophosphate synthase
publication title Structure-activity relationships of orotidine-5'-monophosphate decarboxylase inhibitors as anticancer agents.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 95
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2009-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3g3dA00
1RQEA 4FNUA 1J5TA 2GVLA 4ZVJA 5IM51 3C3NA 3L5LA 4KFOA 5HINA 3QPZA 1WV2A 4W9TA 3O6CA 4H4IA 5DXXA 4KKXA 3HF3A 2YZRA 3HGSA 1H50A 5D2TA 2QDHA 3SGZA 3PB2A 4MFDA 4O13A 3C2RA 1OF8A 1OYAA 1GTEA 2ABAA 1G67A 4ZQRA 5CZ0A 5LNVA 3RLVA 4QM1A 5U7SA 1W5MA 2E1DA 4X2RA 3CPRA 3O06A 4MYXA 2ZZ5A 3JS3A 3PULA 4JN6A 1I2RA 3N14A 1TJRA 3EX6A 2ATMA 5FEXA 1OFBA 2OT1A 1T99A 3RK8A 2WOQA 1L2UA 2AQWA 4BWLC 3G1SA 3LRMA 5AC8A 1YADA 3LHZA 2H6RA 5D2YA 2CZDA 3ATZA 4Z1DA 4WZHA 1R2RA 4MOZA 1RD5A 4EF9A 1PHWA 2G5WA 4QAIA 3BW4A 3HPSA 5E0KA 4AHQA 1D3GA 2Q3RA 3IGXA 5CG7A 1RPXA 4C1KA 5D02A 3EB2A 3LX9A 4IGHA 1M5WA 4OHQA 5AFDA 2YXGA 3DI0A 1XXXA 1OK4A 4GUIA 2RHGA 4WY0B 3LHWA 2TPSA 1SZEA 3TV8A 2X1TA 2JK2A 4DF1A 5TBOA 5I3KA 3GNDA 3UD6A 3HQ1A 3SY5A 3PBWA 4Z1BA 5DCBA 1C29A 3LOTA 1QNVA 3NQGA 1Z41A 1R30A 2C14A 3LHTA 5KZMA 1TRIA 4DO6A 1W5NA 5KINA 3DH7A 2A2IA 2E09A 5T26A 1QPRA 3TW6A 2FTPA 1TSIA 1W8SA 1GG0A 3T44A 1FDZA 3LXCA 1G4SA 1FDJA 5LGXA 4IMDA 2EPHA 1H1YA 5G5IA 3BW2A 5C2XA 1CX9A 1LBMA 4IUOA 4UIOA 2DZUA 3SECA 2QCDB 3W7JA 4IPIA 4XKYB 5HWNA 3Q2DA 4ORIA 4GBUA 2HS6A 2YPIA 3DHFA 3JRKA 1WYIA 3I65A 2ZDRA 3BVJA 1I2PA 3T55A 2ZFAA 4ONVA 1VYSX 1JQXA 3CTLA 1RVGA 4I7WA 1DBTA 2YSWA 2JKAA 1IF2A 1XL9A 3TAOA 4E38A 5IBXA 2Y6ZA 3O16A 4N9BA 1VLIA 3LGEA 5K2ZA 3C4UA 5CGQA 1GTHA 2V5BA 3ZFHA 2A5HA 3G8RA 1M7OA 3PY2A 3LERA 2G95A 1AL8A 1LLZA 3DGRA 1JRCA 5C55A 1KM1A 3W07A 3WK0A 3CEPA 3TCEA 3UYCA 4DBDA 3CEUA 4NXKA 5F2GA 1G7VA 1I45A 1Q6OA 4JTGA 3P84A 4ZMGA 3DFOA 1MZHA 5G2WA 1LORA 3SFKA 1KM3A 4IQLA 1T96A 4M5PA 5CPNA 4O54A 3LXBA 2H3DA 4N6FA 5G1YA 4UTTC 4DF0A 2PCQA 3LTSA 3DENA 1EA0A 1HUVA 4ZL1A 3GVGA 1YLVA 1X7FA 1SFJA 3IVSA 1DJQA 1X8FA 3EWBX 4RX0A 4QSHA 3RLUA 4UCGA 3NNTA 3IIPA 3LCXA 3DHDA 1JCMP 2A7RA 3B0UX 1SSGA 1OFEA 2WJZA 5F2IA 4NNBA 5DCEA 2WKJA 2ZZ3A 1XDLA 3W1XA 5LKYA 2NUYA 3R89A 1BWLA 5A8GA 1MEIA 1TCDA 1X6UA 2NXGA 5I3GA 4IX0A 2PRHA 4LT9A 2ZYFA 3L21A 5LHEA 1TIMA 2ISWA 2UV8G 5F1VA 3N3MA 4EWND 3SW6A 2VFFA 2Y62A 1GYNA 3N2XA 2NV2A 3GXPA 3PB0A 3NR0A 1RQBA 2GQ8A 2FB2A 4OQVA 3W2LA 5DBTA 5H2ZA 2Z0IA 2YX0A 1XBYA 2FPYA 1XUZA 4LS2A 3BG9A 2A4AA 2LLEA 1K7FA 3S0CA 5LNUA 1LOQA 4O10A 2C6QA 2FJKA 4UUIA 2TRSA 5F1UA 5H91A 4XWUA 4UTMA 2JGYA 4K7YA 1JCJA 2J27A 5FF0A 2OT0A 1XUUA 2Y7FA 3W87A 1TPFA 5D37A 5EYWA 4E0CA 3CLMA 4L4LA 3TAKA 3HGJA 3N9RA 5KSWA 1IIGA 3M1ZA 3TNOA 4OBTA 1SO4A 3WFAA 2YYUA 2H8XA 2QCHA 3P60A 1TV8A 2V2HA 4AHOA 1I2NA 3HG2A 4ORMA 3MUXA 3NQCA 3QQ1A 2CLEA 2Y89A 1VRDA 4HKPA 3W7MA 1NF0A 3PF3A 5BW6A 1KFJA 1T8XA 1G7UA 1QO2A 5FF7A 3EXSA 4BI6A 3H53A 1KLYA 3WK2A 4GUFA 1WOBA 3TKFA 1S5VA 2DJXA 4IJBA 4UTJA 3GIYA 1R47A 3L0NA 1W56A 4LVGA 3U8GA 3GNNA 5AYZA 1OFOA 4BI5A 2YW4A 1U83A 5K9CA 4JTJA 4MPQA 1EP1A 3FLUA 3O6YX 1JRBA 5LHFA 4IMEA 1S5WA 3ZS4A 3A9IA 1TV7A 3STGA 4AVFA 2DU2A 1BEUA 4JYEA 2CZFA 4EVZA 7TIMA 1DOSA 3BG5A 1F5ZA 3W86A 4O50A 4D2JA 2QKFA 1OFQA 3S1VA 1Q6RA 1ZENA 4LRTA 4MY1A 4H6KA 3T7VA 3GYEA 1GT8A 4O17A 4QITA 1L9WA 4R7JA 1FBAA 5CSSA 5FEWA 1G4EA 3S42A 1TREA 2CLLA 1N7KA 5KMYA 3VKJA 3I7SA 3LCHA 1D9EA 3EWXA 4NZFA 3QSTA 2FDSA 2Y88A 5TQLA 1K8YA 3W7QA 4AXKA 4LVBA 1L6WA 1GYLA 4JTIA 1IIHA 5A5WA 5MHBA 3LTPA 1JCNA 3NL2A 4A29A 4MYAA 1JUBA 2JBMA 1ICPA 5K4ZA 5E1QA 3P80A 4Z1AA 3TQKA 2NWRA 2D73A 1M6JA 2NX1A 4JX6A 4OGZA 3H54A 4Q4KA 4ADTA 1EEPA 2EGZA 3CQ0A 2NX9A 1YPIA 4M6VA 3W2KA 3CM4A 4QJ1A 1SW3A 1LP6A 4K8EA 3NYZA 4O14A 5LNRA 1A5BA 1PCKA 1XBZA 3NG3A 4MJMA 4LVAA 2VEMA 3NQ7A 1TPC1 3TE9A 3A5FA 5GVJA 3R5EA 3W2UA 1YDVA 5AHLA 4LUIA 4RZ4A 2X1UA 2NXIA 2R14A 3TQVA 3L0GA 2E68A 3I7QA 4NJHA 2QF7A 4JTSA 2HTMA 4CNOA 3DAQA 5K9XA 3EKZA 1LRQA 5HMSA 5DCDA 4OV4A 3QMTA 1F74A 3NQEA 5HUOA 3CWNA 3WJZA 2VFHA 5I3IA 3DBPA 1KBIA 4FNPA 4MFEA 4CLMA 3KFTA 3I68A 3IIOA 4LTSA 5HQEA 3GZ3A 1OFRA 1PHQA 1K02A 3CIWA 1N55A 2W0UA 3GR7A 3V1PA 4IMFA 3G1XA 2QJIA 3AO0A 3ZWTA 4Y90A 2Q8LA 1F6KA 2VFDA 4KWVA 3RFAA 1FX6A 1T0OA 2GQAA 4B5NA 5HNRA 4JDYA 4WOZA 5C54A 4TIMA 2FPTA 5FESA 1VYPX 1HG3A 4MUZA 4NT0A 3ATYA 4PC8A 1ME7A 3LCIA 4NNCA 1VC4A 1ZAHA 4K39A 2QUTA 4UFLA 3QW3A 4HHPA 2CLKA 3G1HA 4MVAA 4Z0JA 4YXGA 3QH2A 1WAUA 3M7WA 4Y9AA 1JQVA 1TTQA 5K4XA 1IGSA 4FB7A 4N6EA 4AWTA 3B05A 3UWVA 3KVMA 2XN1A 3AJXA 1LLWA 1ZALA 3QEZA 2V0TA 4PODA 1SQ7A 5L9FA 1VGAA 4O18A 3G18A 5BMWA 3U6WA 2E6FA 3UWUA 2GUUA 1EB3A 3NQVA 4DF2A 5D38A 2VFIA 1W0MA 3LLDA 1OYBA 4ICNA 3TSBA 1G69A 2NWSA 4UMCA 3BO9A 4RR4A 1DJNA 1O94A 3HIJA 2E6DA 3IEBA 1K8ZA 1TPDA 3TU9A 4JIQA 5AYXA 4UTWC 3NOEA 1L6YA 3IIZA 2CZ5A 1C9DA 3G24A 2ZRVA 4GJ1A 1OHLA 3M47A 2RH9A 4LOCA 3P81A 4JDBA 1SPQA 4POCA 3W7RA 4ZQOA 2Y85A 4AF0B 3M0ZA 2J9YA 3CWOX 4NVTA 1AW2A 3W7CA 2Y7DA 3F4NA 4TMBA 4GWEA 3FFSA 3MYOA 3HPXA 1VZWA 2GJLA 1H7NA 1OF6A 3DFQA 2CLIA 3UWQA 3EX3A 3C56A 3TJLA 5KTLA 3G1YA 4OE7A 4PFMA 3SZ8A 3W1RA 4FIRA 4RCXA 3W75A 1XC4A 1NVMA 4H3DA 3UWWA 1W37A 4RV8A 2VENA 3FOKA 3G1AA 4ZQNA 3IVUA 3UPBA 1SFLA 1EWDA 4YMZA 2DZTA 2X1RA 4JTLA 3TJXA 1P1XA 5K9DA 1OABA 1UASA 1SU5A 4N4QA 4XBKA 1Q3NA 5E93A 3TX9A 1U5JA 2W6RA 4LVFA 3DXIA 3ELFA 3MP5A 3CT7A 4Y96A 3UPWA 2B7NA 4NX5A 5EMUA 3G1DA 5FF2A 2OZ0A 2RDWA 4JS3A 4GRSA 3GDLA 3WK1A 1K7XA 1UB3A 1LBFA 1QPNA 2Y7EA 3TC7A 3TMQA 1SO6A 3W1NA 3GDTA 3QW4B 4LC6A 3HG4A 3TSDA 3FEMA 3NM3A 3MHFA 3A5VA 1ML1A 1K8XA 1HFBA 3TIMA 1OFDA 1BWKA 4N02A 5AYYA 1R46A 2Y61A 1YPFA 5HWMA 3E96A 1YDNA 3EWYA 1G4PA 3OEXA 4A22A 5LNSA 3NL3A 1I2QA 2VC6A 3INPA 1FXPA 4RKAA 3OHIA 5K3VA 1FCBA 4JGDA 3ANYA 3W83A 1Q6QA 1TJPA 2PRLA 3GKFA 4PEKA 2ZA3A 5G2IA 1KM5A 3E12A 3UQNA 1JUEA 5BMXA 1ALDA 1DL3A 5CZSA 2BXVA 4ZQPA 4CCEA 3W1UA 2QR6A 5DN1A 5D2XA 5HULA 3BPWA 3NL6A 2BWGA 1B4EA 5K7JA 4N4PA 1H7OA 3TK7A 2B7PA 3W74A 5IBXC 4LV9A 4FX8A 3LI0A 4Y6GA 4JTHA 1OJXA 5D33A 3C2EA 3B0PA 4UR7A 1UCWA 4O0KA 4AHPA 3KXQA 3W1TA 3W7IA 3Q58A 1DV7A 1KTBA 1W5OA 3NXFA 3O05A 5D03A 3TH6A 4GUGA 1AG1O 1SW7A 1W5PA 1LOSA 3PVFA 2H3BA 1HTIA 2O7QA 2X2GA 5F4SA 3PC0A 4WOQA 5FEZA 4O16A 4FNTA 2A0NA 4UFJA 5G4WA 1H61A 3NQFA 3LCWA 1W5QA 5BOOA 2C18A 1IXOA 3O6DA 3GDKA 2Y70A 4Q32A 4DO4A 2NLIA 1JVNA 2Z6JA 4M7SA 4JXCA 4JYFA 4JIPA 3L67A 3TXVA 1LROA 2BX7A 2Z6IA 3BK0A 1SZNA 2J88A 1C8VA 3QFEA 1THFD 1AMKA 1TPH1 4MKNA 3M5ZA 3MMTA 4IXHA 4M6QA 3C6CA 1VYRA 4A2SA 4U4MA 1D3HA 3LTYA 3W6YA 1A5AA 1GVOA 1TV5A 4EIVA 3OBKA 5EL1A 1GVSA 1YYAA 2QAFA 3NGJA 4MLJA 1KV5A 5CZJA 1ZAIA 1PIIA 3GB6A 1GQNA 1MEHA 4BF9A 3W73A 2W79A 3N2MA 1K3UA 1H7XA 1QMLA 1I2OA 3P8IA 4DO5A 2BZNA 5DLCA 2A7NA 1SZFA 3GXTA 1W3NA 3R12A 4YLWA 1XBVA 2WO5A 4UTUA 2DZPA 3W72A 2CLFA 2GOUA 4BI7A 1H1ZA 2CLOA 1V7YA 3LBCA 2P0OA 3S6DA 4FO4A 2CU0A 2PE4A 4GUHA 1OX4B 1N8FA 1F76A 1O95A 2ISVA 3KRZA 3Q94A 1O4UA 3EKLA 2C15A 4O12A 2R8WA 8TIMA 4R53A 4BFAA 2ZCGA 5AHEA 4E2BA 4YCPA 3GR8A 3L66A 3O63A 5G1TA 2A21A 3I6RA 2G97A 2ABBA 4NJIA 4O4VA 2ZBTA 3W22A 3GXNA 1PVNA 3NAVA 3MI6A 3F4WA 1TPB1 2YYTA 2Z2UA 3B0VC 1GVQA 3HGRA 2RDUA 1RZMA 4K38A 2QCMA 4LV4A 3MO7A 4UNKA 1OVDA 1WQ5A 3IRDA 2E6AA 1QR7A 4CNPA 2J9ZA 2FPVA 1KBJA 2WSQA 3UNDA 3W7KA 4IX2A 3STCA 3KX6A 3STFA 4QNWA 2NX3A 3W1LA 4YL2A 3DZ1A 4MZYA 5CPLA 4NUWA 1LBLA 4PL2A 1GZGA 4A3UA 1WDWA 3EWUA 2FIQA 1VH7A 1NAL1 3QMRA 3S5YA 3R13A 4PCFA 1ZJIA 5DBUA 2CZEA 3LRKA 4ALDA 1ZAJA 3YPIA 4N2YA 2X30A 1H7PA 4MJZA 5SWUA 3T40A 1J2WA 3EX1A 1SUXA 4FHAA 1UBSA 3LHUA 1FCVA 3SIZA 4LWWA 4I7UA 1GOXA 3PBUA 3NPXA 3W2JA 3KAOA 1J4EA 1NFBA 2V30A 3NM1A 2G96A 4JY8A 1TTJA 2V5LA 1VQTA 2QCCA 2ZZ6A 3P82A 1OK6A 5KZEA 4R34A 2ZZ4A 2VXNA 3HG3A 2JKEA 4AWUA 1TTIA 2C1HA 1B3OA 4RZ6A 2RDTA 1KFBA 1YTKA 1KFKA 4M7TA 4NNAA 4AEOA 3OG3A 4WQ6A 3DU0A 1QCWA 2DZWA 3LM7A 3PG8A 4RK8A 3LCGA 1EWEA 1ZY9A 3A22A 1JCLA 4QIUA 3PBVA 4JTEA 1TQXA 3TQ0A 1HO1A 3W2NA 4MLRA 3G8EA 4OU1A 5AOUA 5L6UA 1F05A 1TPVA 1VCVA 4WX2A 2VEKA 3L65A 1OX5A 3BLIA 4GNJA 3NQ2A 5D30A 3NDOA 4LU0A 4QNEA 3E0IA 1FCQA 1AL7A 4HNVA 3L5AA 1L6SA 4TU1A 2BSLA 2I1OA 3MYPA 4FXRA 4CQ9A 1LRNA 3R8RA 3W85A 2C19A 4FF7A 1ME8A 3BW3A 4TX9A 2DJLA 1DQWA 4RJEA 3W9ZA 1UUOA 5TIMA 4Z1CA 3W3OA 3DFSA 3HJZA 1FWWA 5FEPA 1FWTA 3ZWSA 4HNUA 3FJ6A 1UUMA 3PUOA 1QWGA 2GQ9A 5AHIA 1PS9A 1TPUA 1QFEA 5FI8A 2ALDA 5CPOA 4EOUA 5CSRA 4DQWA 1QOQA 1SSDA 4WUIA 1SW0A 2ZRUA 4IOTA 2CLMA 3HPZA 3B8DA 1YXDA 3C2OA 2AGKA 2QCGA 5LZLA 4JTUA 5BNKA 1VCFA 1XKYA 5LSMA 3OVQA 1IXQA 2Z1BA 5HUPA 1E51A 1Q45A 3GX9A 3NQAA 3MW7A 1H5YA 2RKXA 3MP3A 4Q33A 2EAWA 4HT3A 4UMBA 4HN4A 1WX0A 4DXVA 4KFPA 2F7FA 3P5YA 1QPOA 4O11A 2TMDA 1B4KA 5G2HA 2ATSA 3IVTA 1EP2A 2XN0A 3QRHA 4M19A 4YWIA 1W1ZA 1H7WA 1ZNNA 3G3DA 4JNMA 1KV8A 5ABTA 3LI1A 3MBFA 1TPEA 6ALDA 1XCFA 4WY0F 1CW2A 3QPYA 2HS8A 4LUJA 3W84A 2PRMA 4NXSA 5DELA 4E2DA 1EX5A 1VPXA 2WQPA 2ZTJA 4O19A 2Y7GA 3P74A 4O15A 3TC6A 5AHNA 1F7BA 1FWSA 3NQ8A 3MWAA 2EKCA 5F4XA 1OX6A 3DFTA 4O1DA 3W7PA 3M5VA 2WNNA 2B7QA 4WJEA 3CB8A 3DFNA 5I3HA 1LYXA 3R2GA 5DY3A 4LS0A 1KFLA 4XUGA 4O4WA 3TA6A 3KOFA 3UY7A 3P67A 1KA9F 3QMSA 4O0ZA 3QZEA 5D2WA 1VJIA 3ABRA 4HSOA 5I3FA 3B04A 3IV3A 2NZLA 1FWNA 4CNNA 1FWRA 4X9SA 4O1CA 1Z42A 2OCZA 2DORA 1UJPA 2ZTKA 4O53A 4XBSA 3M5YA 3LRLA 2FLIA 1I4NA 3KVKA 2OMAA 2J24A 1OYCA 4KFNA 1KM4A 1EUAA 2R91A 3TW7A 1X1ZA 4O28A 5AC7A 2WSRA 1NF7A 4UTIA 3PUDA 1ZCOA 3ABQA 3S1WA 4PA8A 4N9EA 3NA8A 3FJLA 2HMCA 4HPXA 4U28A 3VI2A 5J5RA 4JX5A 4GE8A 4JD4A 2B0MA 3BG3A 3W70A 4UXDA 4L4MA 3P62A 1O5KA 6TIMA 4KWWA 2BTMA 3G1VA 4JEQA 4O52A 2F84A 2WPBA 2VOMA 4ADSA 3S8HA 3HBLA 1FDYA 4HIBA 3Q37A 3NEVA 3U2OA 2P1FA 1KTCA 2QEZA 3SJ3A 2VEIA 1QPQA 3C8FA 2YFNA 3NQMA 3SI9A 1W54A 3W7GA 4RLIA 1H62A 4BWLA 5EY5A 3HGOA 1MXSA 2QCNA 4UTKA 5EPDA 3FS2A 4JX4A 3S5OA 2QAPA 2CW6A 2A1YA 3EXTA 4IWWA 4CQ8A 3RMJA 3LV6A 1SZGA 1OFPA 3WJSA 4IPJA 3GAYA 1YXCA 5U4NA 4CCDA 1EP3A 5AC6A 3L0KA 5F2MA 2PURA 3MP4A 3C2FA 1P4CA 2QUUA 2R94A 1Z48A 4TO8A 3RU6A 3G0SA 3TSMA 1ZFJA 2FFCA 4HSNA 5HR6A 1KM6A 3MHGA 3FKKA 2QJGA 2VFEA 1Q6LA 4K8HA 2ISSA 4A21A 3GDMA 3QM3A 3PWAA 2GPTA 3EXRA 3GAKA 1F73A 3W23A 1JULA 3KVLA 2XFWA 3CHVA 1B57A 1W3TA 3UZJA 2QCFA 1VLWA 2DZSA 2H8ZA 2J6XA 4MY9A 3N73A 1GVRA 3OVRA 1DQXA 3PG9A 1KFCA 3RF9A 4GUJA 4MZ1A 1KM2A 3A24A 4UC5A 1VS1A 4FNRA 1BKSA 3T78A 5D09A 2E77A 2WV8A 4JYDA 2EHHA 2QCEA 3HMJG 3W7DA 4FX7A 1TPWA 3CC1A 4O1BA 3THAA 2HSAA 3NVTA 3KHJA 1PL9A 3NQDA 4LNYA 1TB3A 4OWGA 5KITA 4AAJA 4LS1A 4UNLA 4K36A 2VFGA 1F6PA 3PM6A 1VHCA 3BARA 5KZDA 3TFCA 3HOJA 1B9BA 3W1QA 3NL5A 4GFSA 3O07A 4PL1A 4LVDA 3K30A 2Q3OA 4BK9A 2ZRWA 5LNWA 1DVJA 4C1LA 3TMLA 1ICSA 2Y63A 3GK0A 5EBUA 3W1AA 2YDAA 4UFMA 3TXZA 4NU7A 4GC4A 1YDOA 1QO5A 2E5BA 3KRUA 1MEWA 3NPUA 3C2VA 4Y8FA 4AF0A 1MSSA 2V9DA 2ZQ0A 2ZZ7A 2I14A 4K6AA 3VFLA 5AHMA 2NXHA 4S2CA 3WJWA 5D05A 3DI1A 3LLFA 4WXZA 3BLEA 1A5CA 3WK3A 3SSJA 2OJPA 1FY6A 4A2RA 4M6PA 3S5ZA 2A6NA 3P8JA 3LHYA 4ADUA 4DPQA 1GVFA 4FX6M 3P61A 4UTTA 1JCYA 5I3JA 2O7SA 2VKZG 4IMCA 4OV9A 3VE7A 1YXYA 3FYPA 3A23A 3B06A 1GEQA 2J9XA 5F4WA 1ADOA 3QYQA 4LC8A 2B4GA 3W2MA 3E02A 5CKSA 1BTMA 3B03A 1YTEA 3PSVA 4WXYA 3LXAA 4NQ1A 3P5ZA 3L2IA 3FYOA 1K7EA 1KFEA 1QDSA 3BGGA 4LRSA 2QCLA 3PR2A 3PBYA 3PUEA 4UFIA 3W7OA 1K03A 4UR8A 4GXMA 3LV5A 2V81A 5G4EA 1JJKA 2ZA1A 5AN7A 1JCXA 3P7YA 3RNDA 4WY0A 2OX1A 4K7VA 4NJKA 4XZ9A 3UY8A 1AW5A 3W88A 1G6CA 3OIXA 5D04C 3IGUA 3USBA 1QAPA 3W1MA 2YGYA 1KM0A 4O57A 2DP3A 2TYSA 1GWJA 1O5XA 4UMAA 3C52A 1RQHA 3E9AA 2CFFA 3O8AA 3W7HA 4UFHA 1WA3A 3PS7A 4R33A 1G4TA 4YCOA 3MI2A 1PE1A 5EKYA 3TR2A 3DFPA 4BR1A 3W7LA 3O1NA 3C0JA 4O8RA 3EWWA 5C5YA 3GKAA 1O60A 4I9AA 3QSRA 5CPMA 4PH6A 3N9SA 4NX0A 5J5DA 2YFOA 4O1AA 2NUXA 4CQAA 1KW1A 4XTIA 2C3ZA 4HNTA 2QCDA 3LHVA 2DZVA 4XKYA 2V2DA 3EX2A 2C0AA 4ZQMA 4X22A 5HR7A 3NQ6A 3L68A 5FF3A 3HO8A 1AK5A 3LB0A 1OFAA 3L5MA 2YR1A 3CIXA 3ABOA 3DKLA 4MIMA 4Z0SA 4JTKA 4LY8A 2NV1A 4CCCA 4JTTA 1NEYA 1PCWA 3W71A 3EX4A 1P0NA 1HL2A 3O15A 1RV8A 2EF9A 4MY8A 3T4CA 1A50A 4QISA 4I7VA 1M7PA 4PTNA 5CZTA 1V5XA 3HB9A 4UTLA 1PV8A 2QDGA 5D2VA 3QC3A 2WNZA 3FIGA 1JR1A 4FEZA 1Y0EA 1ICQA 1S3HA 3E49A 2PC4A 3M6YA 2I9EA 2ZZ1A 2ZA2A 1ONRA 3TFXA 2C16A 2V82A 1VHNA 3F03K 3NPWA 2GVJA 2JKPA 4RXFA 3WJXA 4IMGA 1FCUA 1XFBA 3UZ5A 2A7PA 4S1FA 3BLFA 2P10A 2E5CA 3N34A 1KTNA 4P61A 5DY2A 3M16A 3BV4A 2FQIA 1WBJA 3S1XA 1TRDA 4QQ3A 3QJAA 2NUWA 2QUVA 3PSWA 4RXGA 4X3ZA 3IIVA 4K37A 4WD0A 4JY9A 1XBXA 2FB3A 5LGZA 4JTFA 1LRTA 1P0KA 4JR5A 3SR7A 1YTDA 1HO4A 1DORA 1WXJA 1IXNA 1DHPA 3LDVA 4AB4A 1LZOA 3FA5A 3OA3A 1TO3A 3G0XA 1GPWA 1W3IA 4N9DA 4TR9A 3F1QA 3C61A 4UTHA 2ZRXA 1DKWA 3GDRA 1OX4A 1A53A 3LCLA 3ABSA 4G1KA 4EF8A 1XM3A 1LTDA 4LW7A 4XQ6A 3M41A 3W76A 4J9JA 4TMCA 3NZ1A 4XTDA 3S1UA 3MBDA 1EPXA 4ZQCA 2WNQA 3UXDA 2TSYA 4DBEA 3W1PA 2E6YA 2CLHA 3D0CA 4MZ8A 4HPJA 1H60A 1SR9A 1I8JA 4UFKA 5DXYA 1EUNA 3STEA 1FXQA 4FXSA 4FIQA 3VCRA 1LOLA 2YCEA 3VNDA 3LBMA 3S9YA 3S5NA 4ML9A 1FUYA 3LCFA 4S2BA 3NZRA 2QJHA 2VELA 5HWJA 3TDFA 3EEGA 2WSYA 3ZR4A 4FNSA 1NSJA 1LCOA 2V2CA 3OVPA 3MI3A 2JGQA 1OG0A 1SO5A 1QOPA 1LM1A 1GG1A 2E5DA 3TUUA 3KVJA 3VE9A 3HG5A 2GVGA 4DELA 5AB3A 1P5BA 2YW3A 3V75A 2BLEA 1AW1A 5HJLA 1LDCA 5EA9A 2ZRYA 3GLCA 3H55A 4NJJA 3JR2A 2H90A 1XDMA 3IGSA 3QF0A 1X1OA 3DKJA 1IXPA 1H7RA 4AWSA 1VR6A 3NPVA 4RZ5A 2X16A 3KRSA 1ZHAA 3G22A 4FNQA 2Q8ZA 3BGJA 4NJGA 1WOAA 1SO3A 3I7RA 4AMAA 1FQ0A 5FF4A 4HNNA 2IQTA 1VCGA 1TMHA 1ME9A 3IIXA 3MHUA 1TTPA 3L9CA 1S5TA 1H51A 1TYGA 4N9CA 4AH7A 4OT7A 1RR2A 2CWNA 2ZZ2A 3TROA 1KLZA 2KZHA 3G1FA 3M44A 1WBHA 3FKRA 3CU2A 3PAJA 4ZZ9A 2C13A 2X1SA 3M43A 4P2VA 3SGUA 2DZXA 3EWZA 5D32A 3UWYA 3M5XA 3B4UA 4Z08A 1XI3A 3UWZA 1TQJA 2VEPA 4DPPA 3N19B 4JICA 5BRBA 1MO0A 3W7EA 3UXAA 2B7OA 2XN2A 2V8ZA 4DEFA 3THQA 3QQ0A 1W31A 5AHFA 5C6MA 1GJPA 3G3MA 3NO5A 1H63A 2AAMA 5F2LA 2A6LA 3G0UA 4NZJA 1CI1A 3M9YA 3MJYA 2A85A 1A5SA 3W7NA 4UTWA 1F2JA 3A21A 2ZRZA 1R2TA 1EIXA 1R2SA 2GJNA 4IXXA 2RFGA 3WJYA 1JUKA 1Z44A
chains in the Genus database with same CATH superfamily
3C3NA 4M81A 3L5LA 4DWSA 1WV2A 1PX8A 4EWJA 1OM0A 3QHNA 1DIOA 2A79A 1SR0A 4IJRA 2QDHA 3ZJ7A 4UZSA 2W4XA 1TKKA 1OF8A 3MUIA 2WBGA 1G67A 1JPKA 3CUXA 5CZ0A 3RLVA 1CIUA 1XIIA 3RM4A 5BOEA 2E9BA 3O06A 2VDGA 4XO7A 1VBRA 2ATMA 1J5SA 5FEXA 1OFBA 2XIMA 1T99A 4NAFA 3L7RA 5M5DA 3EGJA 1UP2A 3LM3A 2I5GA 2WKLA 1PKNA 4MWAA 4BCEA 3EWCA 2ZUMA 3ATZA 4PSPA 3AIBA 4Z1DA 1R2RA 1RD5A 1C7SA 2Q3RA 3IGXA 5CG7A 3LX9A 5AFDA 2P0IA 3E0VA 4AX7A 2XVNA 1SZEA 1RCQA 2QVNA 2X1TA 1Q6FA 3OGVA 5I3KA 3UD6A 3SY5A 1OCQA 3TZNA 5JH2A 3LOTA 1XW8A 1QNVA 4NAEB 3NQGA 2C14A 4PCPA 4DO6A 5EMJA 1W5NA 5KINA 1HZYA 2A2IA 2E09A 1KFWA 3ARZA 4Z2GA 1XYFA 3TW6A 1TSIA 3SRKA 3AIUA 3WNPA 1FDZA 1XIFA 4GI6A 5LGXA 1YKWA 3BW2A 3V5CA 4IUOA 4UIOA 2HVOA 4IPIA 5HWNA 3S2NA 1VBUA 3L4XA 4GBUA 2IQ0A 3I65A 3BVJA 1I2PA 3T55A 1VYSX 5D9NA 4O1FA 1JQXA 5HJXA 4I7WA 3W29A 2CETA 3PFRA 1FWJC 3TAOA 3UR8A 2OOGA 5IBXA 1TCMA 1J11A 3O16A 4MKSA 1VLIA 3LGEA 2PWUA 3WIJA 2C7FA 4M1BA 1JDAA 3TLQA 4GI8A 1M7OA 3U4FA 3DGRA 1JRCA 3VDBA 2QGHA 1WKYA 2PGWA 4JN8A 3TCEA 4EACA 2PWHA 1I45A 1I1WA 3GXIA 3KL5A 3L4TA 3WEZA 2AAAA 1KM3A 4IQLA 3O0KA 3LXBA 4MHBA 3BAYA 1XYMA 1JNDA 4DF0A 3AALA 3DENA 1A5MC 2RGLA 4W5UA 1X7FA 3CMJA 1X8FA 3SCOA 4QSHA 3UVAA 1XHGA 4FK9A 3LCXA 3CUIA 3DHDA 3T6CA 2A7RA 1ZL1A 1SSGA 5F2IA 1XDLA 3R89A 4XAGA 3PANA 4LT9A 2PRHA 4GNKB 3LA4A 4XSMA 2UY2A 2ZX5A 1J18A 3RX3A 4F0MA 1AMYA 4ZSUA 3E1F1 3N3MA 2VFFA 2Y62A 3VD7A 3QLLA 1HGYA 4DJED 3D47A 3WUEA 3VFCA 4OQVA 3PZOA 5H2ZA 2YX0A 3VABA 3AS1A 4JTCA 5LNUA 1LOQA 4UUIA 3ARXA 4XWUA 4UTMA 3ORWA 4I8DA 3AIRA 3FDGA 3SCWA 1IIGA 3IAPA 1QWKA 2DV0A 1E72M 3M1ZA 4OBTA 4GZ7A 3HQOA 2XSXA 2H8XA 2VZUA 2IKIA 4AHOA 4HN8A 4N42A 4YYFA 2VTFA 4KWOA 1U22A 3MUXA 4J40A 3QQ1A 2F6UA 2Y89A 2PSNA 2VX4A 3PZUA 5BW6A 1T8XA 4PB3A 4P8VA 1V02E 4U2YA 1V7AA 3N29A 2QJJA 1KBKA 4BI6A 1KLYA 3K4AA 4ZEPA 3CQIA 2Z00A 3WK2A 4MDOA 1WOBA 4KH2A 4A3HA 1AD4A 1BGAA 4HSHA 3DIPA 3L0NA 5CG0A 4QJ5B 3S2JA 4LVGA 4LQ1A 3QV6A 2DGAA 1OFOA 5DRCA 1V6TA 2PBOA 4IIGA 5D8WA 3S4TA 5B7ZA 1UMLA 1RVKA 1S2TA 3K8LA 1UD3A 1E0UA 1S5WA 3QGAC 1MZRA 3CYVA 4FPSA 4RDZA 2VT0A 3A9IA 4ZB0A 4X2PA 4Q22A 4AVFA 2DU2A 4Q7NA 1BEUA 2CZFA 4URIA 7TIMA 3VCCA 3UW6A 1WZMA 3RO8A 1OFQA 3S1VA 1VFSA 1N8WA 4ZOEA 4MY1A 3T7VA 3GYEA 4E8CA 5IFTA 4B3ZA 5TF0A 3LNPA 3M0VA 5FA5A 3T8LA 3AHXA 1IR1A 3S42A 4Q8MA 5E6YA 4JKLA 1IZJA 2XM1A 2G3NA 4QDPA 1K8YA 3W02A 4CNSA 3W7QA 4LVBA 4AYSA 1IIHA 1PZ2A 3DC0A 5A95A 3AUJA 4IFRA 1JUBA 3JUGA 3AZRA 5K4ZA 1W1PA 5E1QA 3QTGA 1TWWA 2VRKA 1X98A 4Z1AA 1HT6A 1PWMA 1KWGA 1UWIA 4OGZA 3H54A 4Q4KA 1G0CA 1EEPA 3BC9A 4GJJA 2NX9A 5FIPA 4D8ZA 3A3WA 4IPLA 3EB4A 1QK2A 3RXZA 2YLLA 4K8EA 1PCKA 4HHLA 4W88A 4HA4A 1TPC1 3SIMA 1C90A 4I9MA 1UROA 1WDDA 3AHTA 1ZGDA 2E68A 4PCNA 2XZ9A 1VJSA 3OPSA 3CZKA 1EBHA 2HTMA 3MVIA 3EKZA 1LRQA 9XIAA 5I09A 2OB3A 2RJGA 2OEMA 5A69A 4GG9A 3NQEA 4H8NA 3WH6A 1BKHA 4KIEA 2EQDA 5I3IA 4FNPA 4W85A 1EYEA 3KFTA 3W81A 2OO6A 4GD0A 3CIWA 1NARA 3I3BA 4G7FA 1N55A 4PRRA 3B8TA 1HX0A 4EAYA 2PDHA 4B2DA 4GA8A 3S6TA 4Y90A 1QVBA 1F6KA 2VFDA 1VB9A 3DHPA 3R0UA 5C54A 1RHCA 1X38A 1KXHA 4IIFA 1XLIA 4NT0A 4WSKA 3ATYA 4FXJA 2HBXA 2OQLA 3CAQA 4AVOA 4UFLA 2QUTA 2AKZA 2YZ5A 4FLRA 1IEWA 3WF0A 3MV01 4DI9A 3M7WA 1R0MA 1WDQA 3ZIZA 4NRRA 3LMZA 4I8YA 1EJTC 5K4XA 1NDVA 3SCSA 1SQ7A 1VGAA 4RNHA 2GUUA 4HZ6A 3MJMA 2PU0A 3NQVA 1OIFA 4GNVA 2D0FA 5BROA 2NWSA 4UMCA 2QYGA 3AMCA 3IEBA 2BY3A 4GKLA 5AYXA 4UTWC 1OB0A 2O92A 2ZRVA 5ABFA 4AIBA 2WYSA 4CVUA 3LG3A 1V0KA 4JDBA 1P7TA 1J6OA 1SPQA 2Y85A 3GW3A 3CWOX 2XIOA 4NVTA 3T0AA 1R9ZA 1TVNA 4GYJA 1AW2A 3W7CA 1WXZA 4S3DA 1MFUA 3WN6A 3CQJA 1EQCA 4GWEA 3FFSA 4RNIA 3MYOA 4D6GA 1E40A 3H24A 1D7FA 1T5AA 4H2CA 2CLIA 3UWQA 5KTLA 3G1YA 3SZ8A 1GPFA 3CPGA 3W1RA 4H1ZA 4FIRA 1DEDA 3N25A 3WQ8A 1NVMA 3UWWA 2VENA 4HU0A 2WZMA 3IVUA 3K1DA 5KZ6A 2PTWA 1OC6A 4BQ3A 4GQ0A 2DT0A 1R3RA 2ISDA 3TJXA 1JCTA 3RLGA 1P1XA 2F2KA 4PB5A 3STPA 1Z9AA 1CXFA 3GXMA 1J0ZA 1DWFM 2Y5EA 4WKHA 4M6UA 4LVFA 5A6SA 1DWHM 3QY6A 5EMUA 2JIEA 1QI5A 4JS3A 4GRSA 1VFOA 1OC7A 1LBFA 1QPNA 2CESA 3TMQA 2RGMA 3GDTA 4LUSB 4LC6A 2IPFA 5CGTA 3FEMA 3NM3A 2QS8A 1CECA 1K8XA 1OFDA 1UWQA 4LF2A 3ZJKA 2OOFA 1H41A 1UZ4A 1YPFA 3VGGA 5HWMA 1JYXA 3MU7A 1I2QA 2VJXA 2XGIA 4M80A 2VP8A 1CGYA 4FSAA 4H8HA 4G5DA 4H7ZA 2PFHA 1JUEA 2OSWA 3KBSA 4ZOBA 5I00A 2ZX9A 1XSIA 1K70A 4I9JA 2BXVA 1JYVA 5D4YA 3W1UA 3WF1A 4KWSA 1CXEA 2YJQA 5D2XA 5HULA 3SAZA 1BG9A 3MY9A 2ZUTA 2BXZA 5K7JA 1HF6A 3GIPA 3Q65A 1H7OA 3UJFA 5AKQA 3O6AA 2G37A 3IJIA 4KERA 2J66A 3C2EA 3N9KA 3BLDA 1UZ1A 2FTYA 4OBRA 1KTBA 2Z1XA 3TH6A 3M0LA 3OVGA 4C65A 2O7QA 4IICA 3WBXA 1REQA 3WQFA 4O16A 5B7YA 2W9MA 1E6PA 1S46A 4UFJA 1H61A 5LIWX 3RDKA 5BOOA 1IXOA 2NSXA 4H9YA 2Y70A 4ERIA 4UOZA 1JVNA 4R7OA 4L6OA 4IUGA 2UY3A 4JFWA 1B3YA 3QFEA 2C71A 4HZMA 5JBFA 4MKNA 4IXHA 4M6QA 3ZQ9A 4PTDA 3OBKA 3SB0A 2QAFA 1KV5A 4ATDA 1ZAIA 1PIIA 3ANVA 3PJXA 2OYMA 1R3SA 3SCPA 2ACRA 1QMLA 3E2VA 3OODA 2E67A 3R12A 1SZFA 3CAWA 1W3NA 2WO5A 1HJSA 5MKGA 1HJXA 2DZPA 2NQHA 4C7GA 3VCNA 4JQ4A 2YL8A 2XVKA 3L2LA 3LBCA 4FO4A 2PWGA 2OZ3A 2XH7A 4J27A 1TJ1A 1E6SM 2NQLA 1ZJAA 4X0NA 1F76A 3FK4A 1HN1A 1FWDC 3IAQA 3EKLA 3UA3A 4F9JA 4MNKA 1XJBA 1V4YA 3I6RA 1XYBA 5T8GA 3GXNA 1PVNA 4C60A 3LNMA 3HGRA 3GVQA 2RDUA 4Q8NA 4DBWA 3UETA 3XISA 2DPEA 4LV4A 3BCDA 2PTZA 4UNKA 3WFLA 3ZO9A 1WQ5A 3IRDA 4P7RA 1JZ3A 4HZ7A 3CBWA 5BU6A 4CNPA 1WUEA 1PDZA 1UC4A 3F5JA 5C9XA 4GCAA 4KGJA 1V03A 5JIWA 5CPLA 4GYPC 4UBPC 2JF7A 4XSLA 2JQXA 6REQB 3EWUA 3KWSA 4HPGA 2PGEA 4GZJA 1DTNA 1KCLA 2ZUUA 3QMRA 1K4GA 2EKGA 4HQVA 1UP3A 3VNYA 3YPIA 1YNYA 2X30A 4MJZA 3EX1A 4OUIA 3QGVA 3T2OA 3MUCA 4F2UA 1F9CA 1GOXA 3KAOA 2OR2A 3NM1A 3ZT5A 3S9IA 1E9ZB 4JY8A 4OZOA 2V5LA 3F7JA 5KZEA 1BVZA 3TYUA 2ZZ4A 1UYQA 2VXNA 4R9OA 3HG3A 4AWUA 3AYSA 4JZ5A 3VD9A 1VRXA 1R87A 2YBVA 3OO2A 4NNAA 4C6NA 2XH4A 1BVWA 1E3XA 3DU0A 3DESA 2DZWA 4LALA 1DWIM 1EWEA 4CD6A 3NIYA 3PTKA 4QIUA 1X1NA 3WX7A 4MLRA 4QAWA 5AOUA 3OYXA 1VCVA 2VEKA 4GVGA 1GNXA 3RN6A 3E0IA 1S39A 4DWSB 3APYA 4QS5A 4TU1A 3IJLA 2DQXA 3NEHA 1RA5A 4AY1A 2VX6A 3R8RA 4GK8A 3W85A 1DJWA 1ME8A 3BW3A 5C7VA 1EDTA 1WAWA 3VKBA 4DVOA 4ZB5A 3PUOA 4XG1A 1PS9A 4MWAB 2BDQA 4JAWA 1QFEA 1UIOA 3CQHA 5CPOA 1ZBKA 2WHMA 3ARWA 4EOUA 4DQWA 4GMEA 1YPXA 2XIBA 1SW0A 2ESCA 3TW9A 1A5KC 2CLMA 4R85A 1YBQA 4YHEA 1XC6A 1W32A 3S2MA 2QCGA 3N11A 3SCTA 1VCFA 2PDCA 3OVQA 1VFMA 4HYVA 1XRVA 1U33A 1B90A 3NCOA 1H5YA 2RKXA 1K6AA 3MP3A 1DP0A 1UWSA 4HT3A 1I0BA 4L1WA 3U2EA 4YVVA 4TVCA 2INFA 3T09A 1YX1A 2PDJA 4KFPA 1VJZA 4CNTA 4O11A 2TMDA 5G2HA 4AUBA 1EP2A 1OWQA 3WDQA 3AHVA 3RJXA 2IXVA 4WGHA 3F2DA 3G3DA 4M82A 3P14A 1A3XA 1KV8A 3LI1A 4V15A 3NDYA 3C0SA 3N1AA 5JXQA 2ADAA 5T91A 2VX7A 1XRSA 1VPXA 3CH0A 3BGAA 5DT7A 2ZTJA 1A0DA 4X61A 4ERGA 3MWAA 5F4XA 4PMZA 3LS9A 2B7QA 3PJUA 1AZ1A 2J7DA 1LYXA 5I3HA 5DY3A 5IHRA 3A4WA 3CV1A 1KA9F 2W3ZA 4O0ZA 3QZEA 1Q6CA 1J9YA 4HSOA 4HJWA 2EO7A 1A3WA 1L8PA 3HQPA 2NZLA 1Y8BA 1FWNA 5EFFA 3V1HA 4GIYA 3QKEA 2ZX7A 2P53A 3VX1A 1TVPA 2YA1A 3RPMA 3M5YA 2V67A 5HXMA 2PDIA 5A94A 1XDJA 4P7NA 2OMAA 2ALRA 3VKKA 3N2OA 1EH9A 1OG6A 1KM4A 3BOFA 3HPAA 4D8LA 1EUAA 1B0IA 3PHAA 3TW7A 5A2BA 1PKMA 1M01A 1PKYA 5AC7A 3ITOA 5DRIA 1ZCOA 3OQ8A 1K9EA 1PTAA 2HV5A 3OGRA 3F5KA 4N9EA 3NA8A 4IPNB 4U28A 3DDMA 1QUMA 1E5JA 1XPGA 1V6WA 4U3CA 4DJDD 1UOZA 3G1VA 4I5RA 1J01A 3E74A 5A6KA 4ADSA 1XIEA 1ONEA 1YE6A 1TJ0A 4F0LA 5I24A 1PZ1A 3W4RA 1FDYA 1KCXA 3WBAA 3UG5A 3NEVA 1RCOB 1CNVA 1KTCA 3W7GA 1H62A 4BWLA 3W38A 3FXYA 2OG9A 3N4EA 5FJPA 3FS2A 1ZQ5A 3EOLA 4JX4A 2XH2A 3DN5A 1F8IA 2XTKA 3DFHA 2DQWA 4C6LA 3EXTA 3GU2A 3RPTA 4IPJA 2CERA 1H3GA 2W67A 1AQFA 3CMFA 4I90A 3L0KA 4GISA 3C2FA 4J3WA 4DYEA 4TO8A 2DY3A 4ZFMA 3MQTA 4GO9A 4S3EA 4HSNA 2VFEA 3TJ4A 1Q6LA 4S3BA 4A21A 4JCLA 4W7UA 3FGCA 5C70A 1JULA 3SCNA 5BYWA 3WMSA 1BXBA 1AJ0A 5CZKA 1QNQA 1W3TA 2D2OA 2QCFA 4B3LA 2DZSA 2J6XA 2YDRA 2BVYA 4KQNA 3BCJA 3PG9A 3ABZA 2V5KA 3RUBL 3CUHA 3ZR6A 1KM2A 3CK5A 4XAYA 4FNRA 1BKSA 4XK2A 5D09A 4ROPA 2VGIA 1GZJA 3IK2A 1DJYA 2PODA 2D2GA 1SJDA 3NVTA 3WQDA 4PUUA 1NOUA 4PUDA 3SSZA 4BKNA 1FOBA 4MNLA 1FKXA 4FALA 4K36A 3ITXA 1RBLA 2E0PA 3PZQA 1E0VA 1V77A 3F2BA 3HOJA 1B9BA 1E6RA 4GFSA 4LBUA 5JQ9A 4DJDA 2GGJA 5LNWA 3EOEA 2Y63A 3ES7A 3GK0A 3W1AA 4DJFD 4E4PA 2OEJA 5A8NA 1IYXA 4GC4A 3ARPA 1QO5A 1AH3A 3KRUA 2PEVA 4LSBA 2YCLB 4AF0A 2O56A 2V9DA 2ZQ0A 2YCIX 4KRTA 3VFLA 2NXHA 1KCZA 3LLFA 1UR3M 2Q09A 1OIMA 4ZENA 1A5CA 2OJPA 5ABEA 4M6PA 4DPQA 3WL1A 1E43A 1W9DM 1JCYA 5I3JA 2O7SA 2PWFA 3PJTA 1B9ZA 4IMCA 4OV9A 2DIKA 3VE7A 3OG2A 3VK5A 2E40A 3FSTA 1PO9A 1EOKA 4R3UA 3TOPA 1GEQA 2DVUA 4LC8A 3N15A 5A6JA 2FZ8A 4L6DA 3CS2A 3E02A 1FWFC 3N18A 5IHSA 1US3A 1BTMA 4JNZA 3B03A 2RAGA 1JDCA 1W9BM 4UOJA 5BCAA 4J2PA 4NQ1A 3L2IA 1K7EA 2QCLA 1QNSA 1EO5A 3SUTA 3PR2A 3PBYA 3PBMA 3PUEA 3ZM8A 5HANA 1UC5A 1LG1A 2X0YA 1XLCA 4Z2KA 2W91A 4MB4A 1DXEA 2ZA1A 4CN1A 3K13A 1QRQA 1ZBWA 4K7VA 1AW5A 3W88A 1LUCA 4Q8QA 5D04C 3B9NA 3IGUA 1Y5WA 2AGTA 4UMAA 2BMBA 1Y65A 6XIMA 1QK0A 3WYZA 1HJVA 2HPIA 1WA3A 2HDJA 4A3RA 3EEZA 4PBFA 2R1KA 3KS6A 3EWWA 3GKAA 4I3GA 5DMNA 4I9AA 4PH6A 2WJFA 1XGZA 4NF7A 4O1AA 2NUXA 4AEFA 2W5FA 4CQAA 2C3ZA 1NJJA 1PYFA 3UA4A 4HNTA 3GM8A 4DJFA 4U5IA 2C0AA 4WKAA 5C8BB 2VEFA 4LYKA 3HO8A 3LB0A 5PTDA 1V3IA 3ABOA 3SCVA 4MIMA 4JL1A 4Z0SA 3T0BA 4NI8A 3FCPA 3W71A 4D6IA 3D46A 2UBPC 4ILSA 1GORA 4MY8A 3AS3A 3H6OA 2QHAA 5CZTA 1H5VA 2INEA 1Y0EA 5E5CA 5BXRA 4GX8A 2PC4A 5ABFB 1ONRA 4I6VA 1VEMA 4JQ3A 2ANUA 4F0RA 4KT2A 4RXFA 1TE6A 2ACUA 1FCUA 3UZ5A 4S1FA 4DWDA 1SM9A 3WEOA 4QLJA 3K8KA 2FQIA 2XIIA 5C2CA 1TRDA 4QQ3A 2NUWA 2REQB 4WCJA 1XBXA 5T9BG 3K4DA 3BMVA 2OLAA 3VIPA 1YTDA 3EKGA 2XDFA 4JFVA 3AIEA 3GZAA 4P8UA 2Y24A 3M07A 2ZRXA 4J28A 3DECA 2VWSA 2GYIA 2I5IA 1W1TA 2X40A 5GPRA 2G3IA 3S1UA 3BLLA 3MBDA 4ZQCA 4DX3A 4S3AA 2A3BA 4ES4A 2TODA 4Y9NA 4E8GA 5ABHA 4DBEA 2WM0A 2CLHA 3HJEA 1H60A 4ZXOA 1SR9A 3S3GA 3P0XA 3WLHA 4WK9A 3STEA 4FIQA 1LOLA 2YCEA 2WPGA 3DC8A 3M7SA 4DLMA 4ML9A 2NQ9A 4FNSA 1LCOA 2JGQA 2PLCA 3HG5A 1EJUC 3LN3A 3W82A 3ZVHA 2YW3A 3V75A 3DCPA 4GIAA 3VIMA 2BODX 1JF5A 1FFRA 4G56A 3CV2A 3VGFA 1TUXA 3UJRA 2HE5A 3RYSA 1V8EA 3JR2A 3MKKA 3GTHA 4ZO6A 4TOQA 2FHCA 1P48A 1TZ7A 3DKJA 1BAGA 1VR6A 1H4PA 4W8AA 1T40A 3G22A 4FNQA 1POJA 2GL5A 1LJYA 1DJIA 3I7RA 1X39A 1Q65A 2E1WA 1VCGA 2X8RA 3N04A 1MW2A 3BSHA 5BWAA 3HMCA 2ZZ2A 2OYLA 2KZHA 2VD9A 5A2AA 3QC0A 3CU2A 2Z7KA 3TN5A 2C13A 4Y9MA 1REQB 3T2PA 1YIXA 4KCWA 4L7ZA 1GW1A 1NELA 3LPFA 1XI3A 4JL2A 5BRBA 2VEPA 1MO0A 2J7FA 3NDZA 1D3CA 1ISZA 4FAMA 4JCMA 3G3MA 1X6NA 2AAMA 4QHRA 3G0UA 5CAHA 4ZOAA 4ZBCA 2A85A 2QJNA 2WHKA 1XLGA 2HZGA 1R8LA 4ZTXA 2GJNA 2FJUB 4IXXA 3WJYA 4FNUA 1J5TA 4ZVJA 5LA2A 3QPZA 4C91A 4KEVA 4PULA 4YPJA 2CBJA 3ZOAA 1H50A 5D2TA 5MKGB 4B5UA 1VFHA 3SGZA 2YB1A 5I77A 2BY1A 3C2RA 2WMJA 1GTEA 2ABAA 2GVYA 5LNVA 1BGGA 2RDXA 4K68A 3H7VA 3QOKA 4BZYA 1V0MA 2ZZ5A 4WSJA 3PULA 4JN6A 3V3WA 1TJRA 2FHFA 1MDRA 2OT1A 3RK8A 4QEHA 1XFCA 4JTAA 3A4XA 3QZAA 3QOMA 4Z2IA 2CXEA 4XAZA 3G1SA 4D6JA 1E5NA 5AC8A 1S2AA 2H6RA 4ZCWA 5D2YA 5FAGA 1G01A 4WZHA 4MOZA 2G5WA 5AZ0A 4JFSA 2PF0A 3HPSA 4AHQA 1MNZA 2HXUA 3KWXA 1RPXA 3EB2A 2ZXBA 4GABA 4OHQA 3RM9A 4HZ8A 2YXGA 1VBGA 3DI0A 1XXXA 1Q6EA 4AZCA 5J04A 2C79A 4PB4A 1BF6A 3LHWA 4ATWA 4WGXA 3TV8A 5TBOA 1TMLA 4S23A 3RAOA 3POHA 4PUEA 1XRFA 4RV3A 1CT5A 1C29A 1R30A 5KZMA 3ALFA 3R11A 1RBAA 4O0QA 3WD3A 4DBUA 5T26A 5KEZA 4C5YA 5CH9A 1W8SA 1GG0A 3LXCA 2Y5SA 4IMDA 5FACA 1WZAA 2EPHA 5G5IA 1E1CA 4C1NA 2PDYA 2V69A 4LUYA 3Q2DA 3N13A 2HS6A 3TYBA 1XD1A 2YPIA 4PUMA 1WYIA 1V6XA 1BD0A 3M0IA 1XLKA 1RVGA 4HMNA 2YSWA 1MNSA 1IF2A 1XL9A 2ZKMX 4FR1A 2BS9A 1OZMA 4UQAA 2V5BA 3ZFHA 2A5HA 1ZU8A 3BAJA 2PDLA 3LLXA 3U0HA 3CEPA 3UR7A 4HOZA 4NXKA 3RX4A 3OZPA 3DFOA 1QI2A 3CH9A 3NSXA 1L6FA 3QXBA 1JZ8A 4ZGYA 3O0FA 3OA5A 1LORA 1K6WA 3FEQA 3SFKA 4O54A 3F5LA 1IWBA 3TP4A 2Q01A 3GTXA 2DT1A 4UTTC 2E8ZA 3LTSA 4KPLA 1EA0A 1HUVA 1JEZA 1DXIA 4ZL1A 2AL1A 3GVGA 1YLVA 3VIOA 2QIWA 1RUSA 5JH1A 3MMUA 3M46A 3NNTA 3B9EA 4KIRA 4D1JA 2WJZA 4MM1A 5LKYA 4V33A 4A3YA 1IEIA 1MEIA 3DG6A 1UKQA 2NXGA 3SY1A 2OVLA 1M53A 5LHEA 5C9WA 2UV8G 1Q66A 4ENLA 3T2QA 3H2CA 3U3HA 1LLOA 2NV2A 1AA1B 1SVDA 4HB7A 1J0IA 8XIMA 1DJZA 3AMGA 2G3FA 2FPYA 3L23A 4YTQA 1YBQB 4CN6A 3OTRA 2A4AA 1K7FA 3S0CA 6ENLA 4YJ5A 4M51A 2FJKA 1Q85A 3ZXWA 5FL1A 1F3EA 2TRSA 5F1UA 3WLJA 1B3XA 1XUUA 1TPFA 1TR9A 3OLDA 3H2EA 3CLMA 1KBBA 1ZRQA 3HGJA 4E2VA 3B8IA 1QI3A 5KSWA 1PPIA 4PYSA 4AIUA 4GY7A 3IGHX 1TV8A 1XGDA 4ORMA 2ZADA 7XIMA 2CLEA 3U4AA 4D6HA 1ONXA 1G7UA 4OOZA 1MYRA 3PWGA 3M0MA 4CCZA 3H53A 1J96A 4GUFA 3NZGA 1S5VA 2DJXA 3UZYA 3LU2A 1R47A 3NXLA 4J4KA 1F3TA 5AYZA 4BI5A 3BCFA 1XYCA 2YW4A 5K9CA 4HP5A 3T9PA 4MPQA 1UA7A 1A80A 2QPSA 4C7FA 4IMEA 1A3HA 4C6KA 4OJYA 3WQGA 3GBEA 4MG4A 4EVZA 3MDUA 3BG5A 4L9YA 4D2JA 3O2LA 1Q6RA 4QITA 5ABGA 3USZA 2BOEX 1FBAA 3B8VA 1CGVA 4IP7A 2R1NA 3LBOA 4DZHA 3WO8A 3VKJA 2VC9A 2FH8A 4QQUA 3LCHA 1D9EA 3BE7A 4Q8UA 4QR6A 1W3JA 4NZFA 3QSTA 2Y88A 1BRLA 3B9DA 3M0KA 3FVMA 1GEHA 3MKCA 2ZWYA 1XP3A 1GYLA 3WLMA 4JTIA 2PP1A 3RG6A 5MHBA 3LTPA 1GOOA 3GXDA 5CJNA 2Q02A 4R27A 4C6CA 4UOQA 3VIIA 3MUAA 2D73A 1GKRA 4JX6A 4LCQA 4ADTA 3UR2A 1YPIA 2BGSA 4M6VA 3W2KA 4ECLA 1I1XA 1E1EA 1XLJA 1A5BA 1BG4A 3S46A 2ZWZA 1XBZA 3NG3A 2INZA 4JKKA 4MJMA 4H01A 3FDKA 4KMQA 4M3PA 1OBAA 2Y8UA 5GVJA 4XZIA 2P88A 1YDVA 1A4LA 4LUIA 2QV4A 4PR4A 1HIZA 4BQ2A 2NXIA 1TVLA 5CC3A 3L0GA 3I7QA 4NJHA 2GGHA 3DAQA 3QYSA 1BWVA 4H7CA 2AQVA 2IXUA 4PCSA 5IXEA 4W4QA 1W9UA 3A12A 3WJZA 2VFHA 3DBPA 4XZMX 2I57A 1FWBC 4PE8A 4RW3A 4RE2A 4LTSA 2PDPA 3GZ3A 1K02A 4Q8VA 4YTUA 1UR1A 1AQ0A 4P7LA 5GJMA 2WQDA 2VR4A 3CWHA 4HBKA 2DT3A 2Q8LA 3FGCB 3RFAA 2CXGA 4JDYA 4WOZA 5FESA 4PC8A 1W2PA 3KLKA 3G1HA 3MCMA 3POCA 2C1IA 5EB8A 4Z0JA 3IV8A 3K5XA 4JTDA 1XIDA 3GYCA 4AIEA 2VWTA 4H6RA 1R7AA 1JQVA 2FVKA 4N6EA 4AWTA 3UWVA 3WQEA 3KVMA 1LLWA 2Y0FA 5XIAA 4LXFA 4EPEC 2FZDA 1V0LA 5BMWA 3BTNA 4DF2A 3LLDA 1OYBA 1E9YB 1W2VA 1J10A 1A5LC 1G69A 3L12A 3BO9A 4RL3A 4DO7A 1EZ2A 4PMJA 1TWSA 4Z42C 4HNLA 1EBGA 2G0WA 3VMNA 1OT1A 3TU9A 2YL5A 4QTGA 3WLRA 2E7FA 3G24A 3M47A 3HM7A 2RH9A 4CEXC 4J2MA 2VZVA 1UKTA 5GNXA 4O8AA 2D23A 3ZYZA 3VZYA 2CCRA 4AF0B 3M0ZA 4DWSC 3WDRA 3F4NA 3G5EA 1IT8A 4KEUA 2EJ1A 2WZTA 1VZWA 3MKVA 1FWGC 1T8QA 2GJLA 2G50A 3EDJA 1H7NA 3CNYA 3CXOA 3DFQA 1BHGA 3BLOA 3WELA 3EX3A 3TJLA 4OE7A 2BBFA 2YKKA 3URBA 1A5NC 1XC4A 3G1AA 1DJHA 4MWAC 3UPBA 4G7EA 2FKPA 1SFLA 4YMZA 4IQDA 2IQDA 1EJVC 2WVUA 2XFRA 4JTLA 5K9DA 3H22A 5CPSA 3V4BA 4E5TA 4M0XA 3BWWA 4XBKA 3UXKA 1TELA 3ABXA 4IG2A 3R79A 1EJXC 2W6RA 4X0VA 1UWRA 3EDKA 3MP5A 4Y96A 2B7NA 4S3GA 1AH4A 5A1AA 4NX5A 5I78A 3G1DA 4UQEA 5FF2A 2Z2AA 4AWEA 3HV8A 4XD6A 5BXSA 2Y7EA 4E2OA 3W1NA 3L4YA 4YVPA 5D8ZA 3TQPA 1LUCB 3SUVA 1UZHA 1GZ1A 1HFBA 1BWKA 1KCKA 4N02A 5AYYA 5A8MA 1R46A 1VEOA 3OEXA 6CGTA 3IUDA 3NL3A 2VC6A 3SQMA 3INPA 5K3VA 1Q13A 1FCBA 3W83A 3SCQA 2PRLA 3GTFA 1LQ2A 4PEKA 3DERA 4AC7C 3E12A 1UOKA 5CCZA 3UQNA 4V27A 5BMXA 4AX6A 2VR5A 3TJIA 5CZSA 3MCNA 1XYZA 1UPMB 2QR6A 3B4YA 3BJSA 1FP9A 3VMOA 3GNOA 1N82A 3IWPA 2BWGA 1HJUA 1B4EA 1EDQA 4N4PA 3TK7A 3FN9A 4QJ3B 3W74A 5IBXC 4LV9A 2Y8KA 3SM0A 2VCAA 1V6YA 3GQYA 2XFYA 3MWCA 2W66A 4O0KA 4H19A 3UYIA 3W7IA 1BPLB 1JZ6A 4XD4A 1CWYA 1E0TA 1W5OA 1DIEA 1FHDA 1KRCC 4M56A 3BXWA 1AG1O 4RE3A 1HTIA 1O7AA 3KTXA 2X2GA 5F4SA 1IZKA 3PC0A 3VNKA 4DI8A 4LANA 1EGVA 4FNTA 5G4WA 3NQFA 1W5QA 3IPWA 3GDKA 3R7MA 1E0XA 1LQAA 3KBWA 1KO0A 2G8ZA 3PZNA 3K4WA 4M8UA 4JXCA 5HK4A 1OGBA 1XCWA 2BX7A 2Z6IA 3KOWA 2J88A 5A3HA 4H9ZA 3WF2A 1EHNA 3K46A 2Z26A 2ZX8A 4DAIA 1GVEA 1RJPA 3GY1A 5AYBA 4U4MA 3W6YA 3THUA 1GVOA 1PYMA 1TV5A 3CUFA 1GVSA 1YYAA 3NGJA 4MLJA 3N4AA 3GB6A 5KETA 3GC5A 2QQ6A 4PTWA 3PZIA 5ECUA 3N2MA 5E0FA 1I2OA 2BZNA 5DLCA 2A7NA 4YLWA 4DNHA 2Z25A 3TLLA 1XBVA 3MT1A 7ENLA 2PLKA 3W72A 3VGEA 1H1ZA 2CBUA 2CLOA 1C3FA 1MRQA 1VAHA 4C6BA 1RP8A 2J7HA 2WW5A 3AXKA 4E8DA 1KQZA 4B4HA 3KRZA 2R24A 2C15A 5FD0A 4R53A 3MO4A 2GK1A 4YCPA 4DNMA 3GR8A 1GHSA 1JYNA 4DN1A 4LBRA 2E9LA 2ABBA 3V0UA 1YQ2A 4PUWA 1NTHA 3NAVA 3WEMA 5HBFA 4PRWA 4K38A 5FCZA 3WLKX 1OCBA 1FH9A 1D8CA 3A3XA 4J3UA 1TWIA 3E2RA 1KBJA 2WSQA 3UNDA 4LB4A 3W7KA 3VILA 3STCA 3STFA 4QNWA 1Y5XA 2NX3A 3R4IA 3W1LA 5EFDA 4MGGA 4R5EA 1LBLA 2I7GA 4PL2A 4A3UA 3ITCA 4PMDA 4YN5A 4E4FA 2D22A 1NAL1 3GG8A 5GJNA 4MWAE 4TX8A 4ALDA 3WNNA 3WUBA 1J2WA 1E9LA 1SUXA 1I9CB 5XINA 2ISFA 1FCVA 4LWWA 4ZE5A 2FMNA 3TOYA 5I7GA 3PBUA 1J4EA 4RE0A 2G96A 1SZRA 2OO0A 3H8AA 5FJIA 1TTJA 1VQTA 2ZZ6A 3P82A 1OK6A 4ACZA 2NVDA 3E2QA 2JKEA 2I16A 4TXEA 1FP8A 1KFKA 4IJCA 3M0YA 4AEOA 2I5QA 2GFTA 4Q8WA 3C2YA 4RK8A 3LCGA 1ZY9A 3A22A 3W6LA 1JCLA 1US0A 5JU6A 4F8XA 2NW0A 1YE4A 3AFBA 4JTEA 2GSJA 1HO1A 3W2NA 3G8EA 2VUNA 4REQA 1UKOA 1TPVA 3CJPA 3BLIA 1LL4A 3NDOA 2XH0A 4LU0A 4QNEA 3GR4A 1ODUA 1AL7A 4C7DA 1JFHA 5A8QA 3BAWA 3L5AA 1L6SA 3VPLA 5FJUA 1S5MA 2BSLA 3AU6A 4LFYA 3GTNA 2J25A 1ITCA 4CQ9A 1LRNA 2HCVA 1CEOA 3WBWA 1ZCCA 3BV7A 2C19A 4FF7A 5BOFA 4TX9A 4KF1A 3M64A 1DQWA 5CJMA 3CZLA 4Q8PA 3UWEA 1UWTA 4Z1CA 4HMEA 2WZHA 3AS0A 5FEPA 1FWTA 4YWSA 2EG7A 3VUSA 1JFXA 5AHIA 1JI2A 1TPUA 2J47A 5FI8A 3KBJA 2ZVRA 4A8NA 5JBEA 5M3WA 1QOQA 4ZA0A 3WY1A 4IOTA 2PGFA 3EB3A 2ACQA 3HPZA 2CKRA 2CBIA 3H26A 1YXDA 2AGKA 1XS2A 4AZCB 1NP0A 3FX4A 3OQEA 2J74A 2JF6A 1E15A 3JZEA 4L80A 1E51A 1XR2A 1Q45A 3GX9A 1EC8A 4Q33A 3B40A 4UMBA 4U2ZA 3BLKA 4JN7A 2W27A 2IPJA 4DXVA 2Z27A 3P5YA 1XG4A 1B4KA 5C9UA 4Q6XA 2ATSA 1ELSA 2XN0A 3VNIA 4XBJA 4HK6A 4YWIA 1AODA 4F2TA 1CXLA 1ZNNA 4W84A 3KBNA 4JOMA 4JNMA 4QCFA 2WVTA 3MBFA 1SJAA 1TPEA 2OGYA 4WY0F 5HJYA 4P8XA 3QPYA 2HS8A 5AECA 2AL2A 4YTSA 1O5RA 2WQPA 4O19A 3TC6A 3P74A 2ZXQA 4O15A 4HU8A 1XIBA 4WDXA 4F3HA 4GI4A 3BAKA 3L2MA 2OLSA 1HNYA 4O1DA 3TR9A 4A8LA 2WNNA 3RJYA 1VBHA 4WJEA 4WJXA 3CB8A 4CU8A 2BG5A 2WC4A 3R2GA 4LS0A 1KFLA 4A35A 4O4WA 1TV2A 3P67A 3W28A 1EXBA 4EKJA 4R9XA 4IISA 7TAAA 1RALA 5I3FA 4XD3A 3SDOA 4HHMA 1X96A 4HOWA 1FWRA 1PWLA 4O1CA 2QUMA 3G6LA 2OCZA 2DORA 1UJPA 4EP8C 1KNWA 4FLQA 4O53A 3SBFA 2VQTA 4NRSA 1W3LA 5G4HC 1EJWC 3LRLA 4IPPA 2FLIA 2Q8XA 1I4NA 1GQIA 2J24A 3AIWA 2J79A 2YXXA 3PAOA 2R91A 3IUHA 5A6MA 2POZA 1X1ZA 4O28A 2WSRA 3TWBA 4KCTA 1MW3A 3WH7A 4PA8A 1E4MM 1DJXA 2AMXA 3SRDA 1UPPA 4HPXA 5J5RA 5AVHA 4JD4A 5BXPA 2XIJA 4C6IA 4L56A 3C8NA 1XSKA 4CU6A 2DFAA 2VRQA 3P62A 4J35A 1KBLA 2WPBA 1Q63A 1Y7VA 1XLHA 1X6LA 5LA1A 3MSYA 2CHOA 3Q37A 2JFEX 3CL6A 2GDVA 2P1FA 1GGOA 2QEZA 3HURA 1QPQA 2O9OA 4QBXA 4IF2A 3WBYA 5EY5A 3EOSA 3V35A 5EPDA 1R85A 1XIMA 1R9YA 4YS1A 2PA6A 4IWWA 3GWQA 3RMJA 3LV6A 1M68A 2PD9A 1NOWA 1OFPA 3P2VA 3SCRA 4K1GA 3VIHA 3HN3A 4GIEA 1YXCA 3U48A 1O1HA 1XQKA 1DQUA 4CCDA 2WAGA 1G94A 5F2MA 1BVNP 1Q8AA 1P4CA 1Z48A 1U5VA 1KR0A 3MHGA 1XH2A 2QJGA 2R6OA 1SMDA 4HOXA 3N6JA 3PWAA 3U7BA 3W23A 3GAKA 1F73A 1VD6A 1B57A 1WZLA 3EYPA 3N73A 1IT0A 2W92A 1JDEA 3C5QA 3U7VA 3WUFA 3SUSA 2QLYA 3A24A 1P0DA 1PJ9A 1VS1A 2E77A 4BS0A 4JYDA 3DBNA 2GDQA 1ISYA 3LSCA 4ZE4A 4FX7A 4XVDA 3CC1A 4I6KA 3L4ZA 4PEEA 4BEQA 3KHJA 1PL9A 1TB3A 4Q8OA 4AAJA 2XJ7A 4LS1A 2Z7GA 1EXPA 3JZUA 1V3HA 3AXMA 4UNLA 1F6PA 1VHCA 3IARA 3BZJA 4X60A 3ARYA 3BARA 3U2ZA 3TFCA 1US2A 3VOCA 3SUUA 3LENA 3K30A 2Q3OA 3RR4A 2ZRWA 4BK9A 1DVJA 4B91A 1ICSA 3T81A 4IQEA 2WCGA 5EBUA 1UD2A 1HKKA 3TXZA 1HP4A 2E5BA 3ARVA 1KQYA 3GW0A 4F48A 3AIVA 1YMYA 5D05A 2R1MA 4WXZA 3RHGA 4ZO9A 1N8IA 6A3HA 1ZP4A 3BLEA 4NSBA 4NYUA 3F4VA 2PGRA 3P8JA 1KRBC 3FYPA 5AYIA 4DLFA 3A23A 1KB3A 3AZTA 3B06A 3EPOA 3K8MA 1EC7A 1YTEA 4WXYA 3FJ4A 3TEVA 1GKQA 1RH9A 1LWJA 2OELA 1KFEA 2J8FA 3BGGA 4LRSA 2GGEA 2R9RA 4AD2A 4UFIA 3VO0A 5CEWA 1DE5A 3DUGA 3ALGA 4GXMA 2X09A 3LV5A 5G4EA 1JJKA 3NTYA 3M6DA 2ZICA 2D2JA 4NJKA 1YRRA 2BXYA 1G6CA 4MMWA 1QW8A 2C8NA 2EEXA 3USBA 3W1MA 5HPCA 4OECA 3SFWA 1KM0A 4O57A 1GWJA 1TZZA 4FI4A 2WCSA 4B5XA 4NAEA 1KXVA 1M65A 4LBSA 3WD2A 4YCOA 3NZPA 5EKYA 4WEVX 2YDQA 2P8CA 3DFPA 3O1NA 3C0JA 4O8RA 5C5YA 1H1NA 1HKMA 1J93A 3OBEA 5J5DA 2VMFA 2YFOA 1KW1A 3I6EA 1B3ZA 2Z4GA 4ZQMA 3EX2A 2NQ5A 3NQ6A 1KGUA 5FF3A 6XIAA 3UF9A 4NI3A 2DH3A 3DKLA 3R43A 3B97A 3PP7A 4CCCA 2ODOA 1NEYA 2V5DA 5IRPA 2OTDA 1HL2A 1RV8A 1JG9A 2EF9A 2GLKA 3RCNA 1A50A 4QISA 4PTNA 3VTRA 1V5XA 3HB9A 2QDGA 5D2VA 2WLZA 1WO2A 1GHRA 4NILA 3M6YA 3TFXA 2C16A 5BWFA 5E70A 4LAOA 3QHOA 1UJQA 5HNNA 1J0KA 3WJXA 1U1HA 4IMGA 4AW7A 4YVXA 1XLEA 3BLFA 5LXXA 2P10A 5HQMA 5DY2A 3BV4A 4I5UA 1WBJA 2VNCA 3QJAA 4ICMA 4X3ZA 3IIVA 3KBVA 4DJEA 1Z3NA 4W87A 4L5ZA 1V08A 4MB5A 3G1RA 2WWCA 1A5OC 3SN0A 4GINA 1E6QM 1DHPA 4K1WA 3GG7A 1LZOA 3FA5A 4YIWA 5CBJA 2ZUVA 4IMAA 3HFTA 1W3IA 4TR9A 3F1QA 4CD4A 3LCLA 3ABSA 1UZDA 5ENLA 1LTDA 3M4HA 3M41A 1MWOA 4IG2B 3EDEA 1X8CA 4XTDA 1EPXA 4KEMA 2YA2A 1E6ZA 1HP5A 4U3AA 2CHRA 2D0GA 3LGGA 3W1PA 2E6YA 3D0CA 4HPJA 4DUVA 3ITLA 1I8JA 1EO7A 1AH0A 3NSNA 5DXYA 2BVDA 4W7WA 1LT7A 2YOCA 2GJPA 2OQHA 3MB9A 3S5NA 3GSMA 3LCFA 2VELA 3UJ2A 1VP5A 1V3LA 3T0TA 2QW5A 2XWDA 3ZR4A 4RDVA 1NSJA 4P7OA 4Q4QA 1EEXA 3CO4A 3WKZA 3GVRA 2DW6A 4DELA 4DZ5A 4J3XA 3VNJA 2HNHA 4IL2A 3GNRA 2FYMA 5HJLA 3Q67A 1LDCA 5EA9A 2WMHA 1PAMA 1J79A 1XDMA 4CD8A 2PC8A 2ZUNA 3QF0A 3GG1A 1IXPA 1H7RA 4AWSA 3NPVA 2X16A 3BQ5A 3ONBA 1ZHAA 3SEPA 3IACA 3APGA 3PZ9A 4H04A 1PIGA 3SUWA 4RPQA 1W1YA 1TX2A 1ME9A 4UTFA 1TTPA 1S38A 1W1IE 1S5TA 1GYMA 1H51A 3ITTA 4AH7A 2WVSA 3C86A 4QDMA 4BF7A 1QT1A 3CZGA 4KCUA 4XVEA 4ZZ9A 1L6GA 4IIDA 3FNDA 1SMAA 3OBAA 2V8ZA 4BA0A 1M03A 1VPYA 1TWZA 5AHFA 5C6MA 1M41A 1GJPA 4HK5A 5F2LA 1Z69A 4Q3MA 1CI1A 4FXFA 3AROA 3M9YA 3W7NA 1GUVA 3A21A 2ZRZA 1R2SA 2HWGA 2V68A 4ERAA 2RFGA 1JNEA 1O12A 3MDWA 1JUKA 1Z44A 4PMYA 2GVLA 5LIKX 4PTVA 2JE8A 4W9TA 3O6CA 4H4IA 3HF3A 1ZPTA 2YZRA 4O1EA 3HGSA 1E1FA 2WBKA 3PB2A 4MFDA 4O13A 1XRTA 4M1RA 4QP0A 2O4MA 1Z7AA 4QM1A 5U7SA 2E1DA 5I06A 4X2RA 4MYXA 3HFYA 3MCOA 3ID7A 1I2RA 3N14A 3EX6A 1Q4NX 2WOQA 3NSMA 4BWLC 2XM2A 4TV6A 3LRMA 1YADA 1PKLA 3FHAA 3QTPA 5RUBA 1PZ3A 3VNMA 4EF9A 1PHWA 2FHBA 3ARQA 1E4LA 3BW4A 5E0KA 3V5FA 4AY7A 3H7UA 3MA8A 4C1KA 2IMRA 2ON3A 1VFLA 1NDYA 3DYOA 5A6BD 1JZ4A 3E38A 4J5NA 2CIPA 1E6NA 4AZGA 4DXXA 4WY0B 3A64A 1A47A 3H7RA 4HYRA 4IFKA 3URNA 4MNMA 4Z1BA 5DCBA 7REQA 2WWDA 3B0XA 1Z41A 3PPHA 3LHTA 3P93A 5AC5A 9XIMA 3CGTA 5BRQA 1PTDA 3DH7A 6TAAA 1H2JA 2UY4A 3CAVA 1KWKA 4LCSA 2V3FA 1XH1A 1TIWA 3T44A 1FDJA 1NFGA 5I23A 1H1YA 1PZ0A 5C2XA 2FVMA 1CX9A 2DZUA 3SECA 2QCDB 4C5ZA 1MXGA 5I5RA 4XKYB 2BP1A 3E0WA 3DHFA 3JRKA 3B8WA 2G4FA 3N2BA 2ZFAA 3UP8A 4ACZB 3CTLA 5E9XA 3TYCA 3SN4A 3GU9A 2PWVA 2JKAA 1OADA 4E38A 1W6TA 4TV5A 2Y6ZA 5K2ZA 2YL9A 2V38A 5CGQA 4DJDC 1GTHA 3DX5A 1GJWA 3B9OA 5A6AA 4Y7EA 3PY2A 1J2BA 2G95A 1AL8A 1LLZA 1BYDA 3W07A 3WK0A 2I17A 4LEQA 4PFHA 3IJ8A 4WRHA 2PCEA 2D0HA 1UR4A 3WF4A 1Q6OA 4JTGA 3P84A 3ZLHA 2E3ZA 4ZMGA 1RY0A 2DH2A 3DHUA 4MTVA 4DM1A 2BY2A 2J8TA 5G2WA 4AZ7A 4REQB 5HA7A 1T96A 4DUWA 3MANA 4N6FA 5G1YA 3WMLA 1FH8A 1FA2A 3I4EA 2PCQA 2VL4A 1HKVA 3N2TA 3S2CA 1AD1A 3ITVA 1QI4A 1DJQA 3EWBX 1K4HA 4RX0A 4UCGA 1ENUA 3D6NA 2OKTA 3S9ZA 1OFEA 3XINA 5DCEA 2WKJA 2ZZ3A 3EA3A 3W1XA 5XIMA 1BWLA 5A8GA 1TCDA 1W1B1 3GHSA 2PDMA 4IX0A 1HXJA 1JXJA 4JTRA 4C6JA 3L21A 4KBXA 1TIMA 2P3EA 1QHZA 3H21A 2ISWA 5F1VA 3KP0A 2GJRA 3GU1A 3THCA 1G5AA 4EWND 3SW6A 2OLHA 2W62A 3N2XA 2PDFA 5EGRA 2V3DA 3NR0A 1RQBA 3WDHA 5DBTA 1B3VA 5DMLA 1XBYA 1XUZA 1CXIA 2VHLA 2PF8A 3VIGA 2C6QA 4J1OA 5H91A 1EDGA 3WLLA 1RK6A 4PMRA 2JGYA 4K7YA 2J27A 2OT0A 2Y7FA 3W87A 2ASHA 2C91A 2R1PA 4TVDA 5D37A 4PMNA 4E0CA 4L4LA 2Y1HA 1GJUA 4CQDA 3N9RA 3NVDA 2I56A 1XGEA 5FKYA 4AD5A 1SO4A 1KR1A 4B5VA 4P7QA 3P60A 4PMXA 3BUVA 1CGWA 4E4UA 3W24A 1VF8A 9CGTA 4P8WA 4W86A 3WLTA 4D8AA 1VRDA 4HKPA 3W7MA 1NF0A 2BVTA 3PF3A 1KFJA 4DJFC 4ACYA 5FF7A 4GC3A 2P5NA 2VZOA 3LSBA 5BZAA 3CUJA 4AEEA 5HMDA 3T4WA 3R58A 2AL2B 1S2VA 5H6HA 4JIRA 1Q6DA 2GGIA 3QV8A 1YNQA 3U8GA 3GNNA 1OCJA 4F0SA 4PN2A 3TYEA 1U83A 4S3FA 5C2GA 1LL7A 3FLUA 1NFPA 1JRBA 3AHZA 4A4AA 3ZS4A 4MKVA 4Q4RA 3TTEA 4PTXA 1WPCA 1H0GA 3STGA 3RCMA 4C6DA 3OYZA 2PDBA 1DOSA 3W86A 3L4VA 2X7WA 3NJ3A 4D1IA 4QCEA 1ZENA 3ERPA 4LRTA 3CTTA 1UBPC 4NKCA 5HMEA 1AZ2A 3LUTA 4O17A 4PMUA 1L9WA 4Q4OA 3AXHA 3RRXA 3VA8A 1G4EA 1TREA 4JQAA 1J0JA 4N0RA 1N7KA 5I03A 5KMYA 1HW6A 3BL3A 3RGTA 1C8YA 1QXLA 3GRIA 5HOSA 1JZ5A 3H4GA 5TQLA 4AXKA 1L6WA 1UWAA 3VYLA 4B5SA 1ZBVA 3B8UA 3VGDA 3FYYA 4BQ4A 5A5WA 1W3HA 3NL2A 1K77A 1RSCA 2QT3A 2XIQA 4MYAA 1Q2RA 3PTDA 2JBMA 4RZBA 2O55A 3P80A 3NGFA 4ROQA 2WK2A 2RUSA 4H8UA 3IJQA 4G9PA 3CT2A 3CQ0A 2HRWA 4AU0A 2DVTA 4MAVA 4QJ1A 3TYAA 1SW3A 2HPMA 2OU4A 2DW7A 2OSXA 4M29A 4NAFB 5LNRA 1BYAA 4OOUA 4BQ5A 3E5PA 4LVAA 3TE9A 3A5FA 5CC5A 1ESWA 2J7GA 4EPKA 3SY8A 2R14A 3TQVA 1C93A 4PUNA 2D1ZA 1M9HA 2PLMA 1NDZA 4LAKA 5HMSA 1XF0A 5DCDA 4OV4A 3QMTA 3CWNA 2OFJA 3UEQA 3WLSA 5JIPA 1UMYA 1IV8A 4MFEA 3WH9A 2VCCA 1CLVA 1OFRA 1PHQA 3AQUA 4MWAD 2BGNE 3SRFA 2FFIA 6REQA 2MNRA 2W0UA 3L4UA 4OKDA 3V1PA 4IMFA 3G1XA 3VM7A 5A6TC 3AO0A 3KCLA 4WDTA 3ZWTA 5HNRA 4KWVA 4B5NA 1FX6A 1T0OA 4NZ4A 2WLYA 2OXNA 1DPMA 1ZLPA 2CKSA 3W25A 1VYPX 4MUZA 1JPDX 3H23A 2YDSA 1U2YA 3WD4A 1ZTVA 3LCIA 1BQCA 5HATA 2VM8A 1EX1A 1VC4A 2XHYA 3T08A 3QW3A 4HHPA 1O68A 2X0HA 4YXGA 2IKGA 1QHPA 1WAUA 1QTWA 4WIWA 1TTQA 1IGSA 3AJXA 1P6WA 1ZALA 3QEZA 5L9FA 1MUWA 3G18A 2QMKA 2YBUA 3UWUA 1EB3A 2VFIA 1W0MA 4ICNA 1T6MA 1L0PA 3TSBA 4FMVA 3WQVA 1O94A 3HIJA 2E6DA 1ZUAX 2WXDM 3NOEA 1L6YA 2CZ5A 1OEPA 1KRAC 1OHLA 3PPCA 4TQTA 3SQSA 1FWIC 1P6BA 2CWXA 1Q6GA 4Q8TA 3UESA 3WQ4A 2JIWA 5JVLA 3W7RA 5EMMA 4ZQOA 4PMVA 3REQA 5CLWA 2F6XA 4FP1A 2FZ9A 2Y7DA 2VQUA 1F07A 2OYKA 1JZ7A 4TMBA 4AZBA 4J3TA 4Y9OA 3WBEA 3HQNA 1JF6A 4DAFA 3LPPA 2XINA 4IQJA 3LZ5A 1OF6A 3MZ2A 5HNUA 1M7XA 4QE4A 5CLTA 3C56A 5LIXX 4DUXA 4RCXA 2WMIA 5D9OA 3ZJ6A 3W75A 3WD0A 4ZQNA 1WP6A 1PB0A 3N12A 1CGXA 1TV4A 2QVHA 3NURA 3EBVA 1OABA 1UASA 4KETA 1SU5A 1UA3A 4F9DA 4N4QA 3KTSA 1Q3NA 2IPWA 4RNJA 5A6LA 5IFPA 1K1DA 3DXIA 2KAUC 3ELFA 3CT7A 3UPWA 3BLPX 3OW1A 4EX4A 4GYFA 4XB3A 1K7XA 1SO6A 4H6EA 4L9XA 3BZGA 5HAOA 3HG4A 1UR0A 3A5VA 3TTSA 1ML1A 3UZZA 4JIHA 4E6MA 3PZGA 2EPMX 2Y61A 1KGWA 2A3LA 3APTA 1G4PA 5LNSA 1J6PA 3CLWA 1S1PA 4RKAA 1KGXA 1N2VA 3WQ6A 3THDA 4JGDA 1TJPA 5GQBA 5I0DA 1XV8A 3BMXA 3RMEA 4W93A 5G2IA 1IEQA 1KM5A 4H83A 1XIGA 1LL6A 3ICJA 1CLKA 5JBDA 2QIIA 5EU9A 1ALDA 1DL3A 4H9MA 1IWPA 2CPUA 3EDDA 5DN1A 3BPWA 3VX0A 2DDXA 4FX8A 1ZJBA 4QFUA 4JTHA 1OJXA 1XLFA 5D33A 5C71A 3R1ZA 3TONA 3B0PA 4UR7A 3UNTA 3K1GA 4DUOA 2X05A 3KXQA 1EIBA 2J77A 5IDZA 4NASA 1DV7A 3NXFA 3BSMA 5D03A 4FA3A 1SW7A 2VD8A 3PVFA 2H3BA 3TTOA 3LPGA 2OX4A 1H0IA 2P50A 2GSHA 5FEZA 2A0NA 1J0HA 1YNPA 3WH8A 3O6DA 1DWGM 3UJSA 1QW7A 4DO4A 2NLIA 2Z6JA 3IS4A 4JYFA 2YBTA 4ZB2A 4PTMA 5I6SA 3ECQA 1SZNA 1IHIA 1C8VA 1CBGA 1AMKA 3M5ZA 3MMTA 2PDNA 1VYRA 3GUWA 5FJRA 3A4AA 3AMDA 1A5AA 3HV9A 5EL1A 1U1UA 5CZJA 5DO8A 1GQNA 4BF9A 3W73A 4PGLA 1UD5A 4EXBA 2W79A 1K3UA 2XZ7A 4B9YA 3AYRA 4DO5A 1BLIA 1E73M 3GXTA 4UTUA 5DFAA 5F7UA 4IHCA 2DZAA 2CHNA 1UR9A 1ECQA 2CLFA 2ZXDA 3CHFA 1V7YA 2P0OA 3S6DA 3LQGA 5HMFA 4F2BA 3TYDA 1B54A 2PB1A 1MVYA 4GO8A 2DSVA 2ISVA 3FW6A 4R88A 1UD8A 2PTXA 3GIQA 1R3TA 2Z1KA 4H41A 4OTKA 3V7PA 1T7LA 2D24A 4BFAA 5AHEA 4AIOA 4HK7A 1S5NA 4IT1A 2HBVA 3CHDA 2EXOA 3L66A 3O63A 4JEJA 9RUBA