3G3DA

Crystal structure of human orotidine 5'-monophosphate decarboxylase covalently modified by 5-fluoro-6-azido-ump
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
256
structure length
256
Chain Sequence
ELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine 5'-monophosphate synthase
publication title Structure-activity relationships of orotidine-5'-monophosphate decarboxylase inhibitors as anticancer agents.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 95
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2009-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3g3dA00
3P84A 3W7HA 1IIGA 1YXYA 2XN2A 2Y88A 5F1UA 1S5WA 4JY8A 4ZQRA 4P61A 4O1AA 1AK5A 1LRNA 4HIBA 1HUVA 2A7PA 2YXGA 3DFSA 3P5ZA 3SECA 2NZLA 4O11A 2ATMA 4LWWA 1PIIA 5F1VA 1L6SA 2ZRXA 4MYAA 3O05A 3JS3A 3PF3A 2EGZA 2ALDA 3PSVA 4QITA 2RDTA 1JRCA 1TTPA 1WA3A 3LHUA 1XUZA 3PY2A 5LNVA 2V2CA 3UWYA 2A7NA 5I3JA 1R2TA 4FNRA 2ZA3A 3LCXA 2Y63A 5F2GA 3TH6A 2J6XA 4KWWA 1YDOA 2E09A 4AWSA 2DZWA 3AO0A 3CM4A 4TR9A 2I1OA 1OX4B 3NQ8A 3KRZA 1SZEA 2YFOA 2V2HA 2E68A 1VHNA 5D2TA 4N2YA 4ZL1A 1EPXA 2B7PA 5F4XA 3A22A 4LVGA 4M6VA 1UASA 1VHCA 1TPVA 1K03A 3LB0A 3NQ2A 1F73A 3CPRA 3LHZA 1TPFA 5FI8A 4NX0A 5HUPA 3TE9A 4LS2A 1OF8A 1OF6A 1VRDA 4NNCA 2CLHA 1XBVA 2DZTA 5L6UA 1RD5A 2ATSA 4I7WA 1NF0A 4O10A 2GJNA 2Y7EA 3EWYA 5BMXA 2YZRA 4WZHA 3KRSA 3PVFA 5HJLA 1RQEA 4B5NA 3EXSA 4FXRA 1G7UA 4HSOA 1EB3A 3L67A 2EKCA 4GUIA 4UFLA 5AC7A 2GOUA 3I7RA 3O06A 1HFBA 4O28A 3W2NA 2JGQA 1A53A 1SQ7A 4LC8A 4FHAA 1H7RA 4JGDA 5FF3A 1GYLA 3DFQA 3S1WA 3SR7A 1HO1A 1VH7A 1GVSA 1GTEA 1T0OA 3TFCA 3PUDA 5SWUA 1YADA 2WSQA 4GXMA 1LRTA 4RXGA 3P60A 4XKYA 1KFEA 4K6AA 3GDRA 4RKAA 2H3BA 1K7FA 4HNUA 4K8HA 1SO3A 1FWTA 3H53A 1FUYA 3BVJA 3MI3A 3FYPA 3PBVA 5I3IA 3NAVA 4CCDA 2X1UA 5HMSA 1QOQA 2FIQA 1QR7A 3TFXA 4O4WA 2G96A 1YDNA 2X2GA 4HNTA 2E6DA 3LRMA 1P0NA 3G0SA 3LHTA 3R5EA 1PE1A 3MO7A 2B7QA 3NPXA 5LHFA 2R91A 3UYCA 2BSLA 3BK0A 4X9SA 4M6PA 2ZBTA 4BI5A 3STCA 2E77A 1VLWA 2DZUA 2QJIA 1OFDA 3TQVA 1NFBA 5BMWA 1FWSA 4HT3A 2EPHA 4JTLA 4HN4A 2FDSA 1JCYA 1JQXA 2P10A 2YSWA 4NJJA 3CWOX 1TTJA 1XC4A 4RCXA 3L5LA 1NAL1 4WOQA 2GQ9A 3DKLA 4MKNA 4GWEA 1J5TA 4M6QA 4I7VA 3W2MA 3MP3A 1F6PA 3E0IA 2A2IA 3M41A 3STEA 3W7JA 4QNEA 1WV2A 4UNKA 2QCFA 4UNLA 1QMLA 5EYWA 4QSHA 4UIOA 2ZZ5A 3G8RA 5KZDA 1RZMA 2HTMA 2AAMA 2CLLA 4UMBA 5C54A 4O0KA 4MFEA 1TSIA 4I7UA 4G1KA 1H50A 2YW3A 3TQKA 3TIMA 1DVJA 3C61A 2E5BA 4WOZA 4MIMA 3WJZA 4NNBA 2IQTA 3RF9A 1I2RA 3K30A 3TNOA 1SFLA 1V5XA 1JCLA 3MHUA 2GUUA 3QYQA 3QW4B 4RX0A 1FX6A 4LS0A 4UTIA 1ICPA 5CZ0A 4K39A 4DELA 4PEKA 4CNPA 3KRUA 1T8XA 3W88A 1TQXA 5F4WA 5TIMA 3NPWA 1TREA 3UWVA 3B06A 4XBKA 3NZRA 4Y6GA 1I2NA 3TV8A 1OFOA 1Z44A 4XTDA 2V9DA 3TAOA 4UTUA 5FF7A 3W7GA 2WOQA 1HO4A 1ML1A 3W1TA 1AG1O 3DAQA 3EKZA 4NQ1A 3TC6A 2C6QA 4XWUA 3W9ZA 4AMAA 3GDMA 3G0UA 4IXHA 3DH7A 1S3HA 1Q45A 1W31A 5FEWA 1TPC1 3GYEA 4MLJA 1ZNNA 3NL5A 1YXCA 5CSRA 1XM3A 3OVRA 3VCRA 1TTIA 3P80A 4O1BA 1TO3A 3M5ZA 2ZDRA 3RNDA 2VFIA 4IMCA 4OHQA 5EKYA 4ALDA 5HWNA 2DZXA 3MI2A 1MSSA 1F5ZA 1W5OA 4GBUA 3P7YA 3GVGA 1TV8A 2CZFA 1E51A 1H7WA 1O94A 3S1UA 4JTGA 3GR7A 5IM51 4PH6A 4EVZA 5CPOA 3UZJA 1FCBA 4UCGA 1FDJA 5AYYA 3NNTA 1MXSA 3MYPA 3W1MA 3VKJA 4CCCA 1MEIA 4O52A 3W7MA 4GE8A 3SZ8A 3OVQA 4LW7A 3TR2A 1TCDA 4GNJA 3MWAA 4KFOA 1NF7A 2E5CA 1F2JA 3G0XA 1C29A 4JYEA 5G1TA 2FPVA 3KHJA 1KLZA 2CLOA 3NXFA 2X1SA 5LNRA 3G1SA 2A6LA 2VFEA 4Z1BA 3EWWA 1OYCA 1K8YA 1XXXA 4FO4A 3N9RA 1JCMP 2Z6JA 3DI0A 2JKEA 4YWIA 2ZYFA 4YLWA 5DBTA 5AHNA 3LI0A 4AVFA 5DBUA 4NUWA 1YTEA 2GVJA 2O7SA 4UFKA 3R8RA 3TKFA 1W5NA 1YPFA 2A4AA 5K4XA 2X30A 2Y61A 1XDMA 3N9SA 2XN1A 3W83A 5G2IA 1F6KA 3EWBX 4J9JA 2YDAA 4UXDA 3B0UX 1SW0A 3PG8A 1Z48A 3G8EA 3C3NA 1SO5A 4JTUA 4O53A 3I7QA 1GTHA 3W7EA 1D3HA 2NX9A 4LVAA 1SFJA 1KV5A 5HNRA 3GDLA 1IIHA 3LM7A 2A5HA 4LUJA 4YCOA 5G4EA 4CQ9A 1HL2A 3T44A 2WKJA 4PL1A 2ZRVA 3C8FA 4RZ5A 3VNDA 2DJLA 1A50A 3DZ1A 1FBAA 3W1QA 4FNPA 3TXZA 3KVJA 4XUGA 1KA9F 5G2WA 2HSAA 1QAPA 1BEUA 1TTQA 2VENA 3HGJA 3P62A 1O60A 1QOPA 4O1DA 4IXXA 5FF4A 1RVGA 1KM4A 2Q8ZA 1D3GA 1W1ZA 1C9DA 4Q4KA 1FXPA 1F7BA 3TSBA 5C5YA 3GKFA 3V75A 3BG9A 4MY8A 2P0OA 2TSYA 4DQWA 3W7LA 3B4UA 4E2DA 4IGHA 5AHLA 3GK0A 5DLCA 4N9CA 3LTSA 2ABBA 2GVLA 2R94A 1JCXA 3C2EA 5BRBA 2NXGA 5DCDA 4RV8A 2C13A 3PUEA 2WO5A 3M7WA 5HR6A 4Y96A 4R34A 4HKPA 2QF7A 1SSGA 3AJXA 4WX2A 1PHQA 4IJBA 2ZFAA 4GUHA 3NGJA 2CLKA 3E12A 1H7PA 1GYNA 2ZRYA 1K02A 3G1AA 2QAPA 2QCHA 4GUFA 4MZ8A 5CPMA 4EF9A 4NU7A 3SJ3A 5EBUA 3U6WA 2YFNA 3UD6A 2G5WA 1EP3A 4AEOA 3W1UA 1K8ZA 1DQWA 2HS6A 3QM3A 3S5OA 1XDLA 2FB3A 1FWRA 1JCNA 4ZQOA 3RMJA 3M6YA 5G1YA 4Q33A 3LTYA 5D04C 3HOJA 2QDHA 3PG9A 4UTJA 4OU1A 4JX6A 1GZGA 3QC3A 4MJMA 5HUOA 4EWND 2EAWA 4XBSA 3SW6A 1XI3A 2Y7DA 5G2HA 4JTHA 1W37A 4GJ1A 3UY8A 1B9BA 5DELA 2RDWA 1VLIA 2V0TA 4N4PA 4OWGA 3QMTA 1LLZA 1QPQA 2Y89A 3ATYA 3OVPA 1DL3A 4NT0A 4DF0A 1W8SA 4I9AA 2DORA 3IGUA 1MEWA 3P82A 1CX9A 3KX6A 3M5YA 3TU9A 4LNYA 4IMFA 3OG3A 5CPNA 4C1KA 2CZ5A 3C2FA 1OYAA 2ISWA 3WJWA 4OQVA 1TPUA 1YLVA 4ZVJA 3LRLA 1R46A 4QISA 4N6FA 3GNNA 5HQEA 1WBJA 3B04A 4MUZA 4E0CA 1Q6QA 4K36A 3NL3A 5LNSA 1R30A 1RR2A 1B57A 2X1TA 3NO5A 1Q6RA 3M44A 1WX0A 3MBDA 3PB2A 4BF9A 3SY5A 3TA6A 2FPTA 1FDYA 1QO2A 4K7YA 5L9FA 3PBWA 3LTPA 5G4WA 3DFNA 5KINA 1FCQA 1VCVA 2WSRA 3U8GA 3QPYA 2D73A 1KM3A 1NEYA 1A5AA 2C19A 2ISVA 1IXOA 4UTWA 3TSDA 2WNZA 2FLIA 1XBYA 3STGA 4NJIA 3W84A 2CLFA 4JIPA 3BGJA 1W5MA 4Y90A 3HG3A 1TYGA 2G95A 1A5CA 3ANYA 3LBCA 4IMGA 3WK2A 2OT0A 2WSYA 5EY5A 3W85A 3QPZA 3PAJA 4TMCA 2PRMA 1W0MA 1UUOA 1JJKA 1GEQA 4LV9A 1SO4A 2EHHA 3L0NA 3C6CA 4TO8A 1VC4A 4O50A 1H5YA 4O17A 1T99A 2NUWA 4AB4A 1QCWA 2BXVA 4PC8A 1OG0A 3FJLA 3LBMA 3WK1A 4FNQA 3W71A 1I2PA 2C15A 3Q94A 1QPNA 1TMHA 3EX6A 1K8XA 1SUXA 3RLVA 3NQEA 4PA8A 4HPJA 1X1OA 1A5SA 5LNWA 3MUXA 3JR2A 2QJGA 3DENA 3O15A 3O6YX 3L66A 5J5RA 2VFHA 2ZZ3A 3FYOA 4R53A 1KBJA 5LKYA 1DORA 1TIMA 2HMCA 2V5BA 1RPXA 3N34A 4IX2A 2QCDA 4L4LA 1LLWA 3SGUA 3UWQA 3W2JA 5FEZA 1G6CA 5D32A 3IIOA 1AW1A 4TIMA 4NZJA 3TQ0A 1KM1A 1KM0A 5AFDA 1ICSA 1SW3A 2B7NA 1FCVA 3BW3A 4IMDA 4JTTA 5AYZA 4NXSA 2QCEA 3T40A 4H4IA 1O5KA 4UFHA 4FF7A 1SPQA 3RU6A 3EX3A 1OFPA 1TV7A 3ATZA 5G5IA 3LXBA 1ME9A 5DY2A 2QCCA 3SSJA 2YYUA 1YXDA 3E49A 4RZ4A 3W86A 2TYSA 3YPIA 2DP3A 1OFAA 3STFA 5KMYA 2J27A 1VYPX 3GXPA 3OIXA 4BR1A 3E96A 3V1PA 4K37A 2ISSA 3QFEA 1SR9A 3TUUA 1CW2A 1LOSA 4O13A 3NQCA 2HS8A 1GVRA 1TPH1 3W1LA 1AW5A 4FB7A 2VFDA 3EWUA 3N2XA 1JCJA 1BKSA 4WD0A 4EIVA 3FA5A 3BW4A 2ZZ6A 2WV8A 4AHOA 4NX5A 1ONRA 2V82A 3HGOA 3S5ZA 3TW6A 3B8DA 5J5DA 2CW6A 4W9TA 3CEUA 1KFCA 3LHWA 3HQ1A 5AC6A 1M5WA 3VE9A 4DXVA 4JYDA 5DCBA 2KZHA 3KAOA 4RXFA 3WJXA 4JYFA 5TQLA 3TC7A 4FNSA 5E0KA 3CQ0A 3DKJA 1SU5A 5FF0A 3ABSA 3KVMA 5IBXA 2BLEA 3RK8A 3S1XA 4MLRA 2ZCGA 2C16A 1B4KA 4PODA 2CLEA 4JTEA 2LLEA 1XUUA 1WXJA 2BWGA 2CZEA 2ZRUA 4FNUA 5F2IA 1Y0EA 3B0PA 2I14A 2YW4A 3EXTA 4YMZA 3NQFA 5D02A 3HG2A 4GUJA 4Y8FA 3W23A 5H2ZA 1TPB1 3L68A 5EMUA 5CPLA 5LHEA 1O95A 3W7CA 4UUIA 3FS2A 3HPZA 1H51A 1I2OA 2QKFA 5DXXA 3LI1A 5H91A 4JTFA 4Z1DA 2RH9A 1EWDA 1MO0A 1WDWA 1GVOA 3C0JA 1F74A 1UB3A 4CNNA 3GDKA 4PL2A 1GOXA 4QM1A 4AWTA 4WQ6A 3NOEA 3N3MA 3HBLA 1R2RA 2JKPA 2QJHA 5I3FA 1XBXA 1G4PA 3TAKA 1PL9A 1P5BA 3R13A 4DEFA 2CLIA 2PURA 2QUVA 2VEKA 2Z1BA 3NPVA 1Z41A 3P5YA 4U28A 3MYOA 5AHFA 3NYZA 4WXYA 1GJPA 2PRHA 3PBYA 1JRBA 1R47A 3W2LA 4IPIA 1ME8A 1OFRA 2RHGA 3PS7A 4FIRA 4S2CA 5AHEA 4LVBA 4NNAA 4UFMA 5DXYA 2QUUA 3N14A 3CLMA 2YCEA 4AF0B 3A9IA 4O12A 2C18A 4ADTA 4MZYA 1J4EA 1JVNA 3GZ3A 4JDYA 3NQDA 2AQWA 5CZTA 4AHQA 4N4QA 3A5FA 2WJZA 5K9CA 2NV2A 2WPBA 1CI1A 4O1CA 3QSTA 4WJEA 4IOTA 4QIUA 1W54A 1JULA 1LYXA 3B03A 3NVTA 3LCWA 4UR8A 4JDBA 2GPTA 1H62A 4UTKA 1W3NA 4NJHA 4QJ1A 3EX1A 3PBUA 1NVMA 5K4ZA 5K2ZA 4M19A 4ZQCA 1ZY9A 3OA3A 1W56A 3SFKA 1VYSX 1FY6A 1W3IA 3EXRA 3G18A 4OV9A 2C0AA 4DF2A 1NSJA 3FKRA 2V30A 3N73A 3TCEA 3FEMA 1TB3A 4WXZA 3QQ0A 4DF1A 1EWEA 3W70A 3FFSA 1LTDA 3NG3A 3S8HA 2RKXA 1OK6A 1W5QA 2AGKA 1U5JA 1SSDA 2WQPA 4IWWA 4WY0A 1LDCA 3GNDA 1A5BA 1YYAA 1VPXA 3GKAA 3VI2A 3QH2A 3QQ1A 2B7OA 2Y6ZA 4AHPA 3HB9A 4O18A 2NXIA 1GWJA 5E93A 4JS3A 2VEIA 4ZQPA 4UTWC 5KSWA 3G1XA 3R12A 4O4VA 3MI6A 1FCUA 2VELA 1I2QA 4D2JA 3WJYA 3QZEA 3ZWSA 3MHGA 4LRSA 3L5MA 4JX4A 3F1QA 3LERA 1THFD 3LGEA 1GT8A 4HSNA 2VEPA 4FX8A 4MY9A 4JTSA 4OV4A 5D2XA 4MOZA 3L2IA 3LHYA 3CHVA 3M16A 3G1HA 2F84A 5K3VA 2NX1A 4PCFA 1HG3A 1QPOA 1DJQA 1X7FA 1VGAA 2OZ0A 5LZLA 1X8FA 3NEVA 1ZJIA 3P74A 1DV7A 4DPPA 5D30A 2Q3RA 4M5PA 3DGRA 1WYIA 1F05A 3TX9A 4JICA 4NJGA 1YTKA 3GAKA 3W1PA 1JUEA 2FTPA 3TROA 4RJEA 5D2VA 5LGXA 3CB8A 1KM2A 3MP5A 1GVFA 1PHWA 2E6FA 4UTHA 3PULA 4O8RA 1L6WA 4AXKA 5KZEA 3GDTA 4BI7A 4BWLC 3IRDA 5HINA 2QDGA 3W7DA 3BLFA 1TRDA 4OE7A 3L9CA 1ZHAA 3QMSA 5FEPA 3LCFA 3UXDA 3W07A 3C2OA 1WAUA 3M1ZA 2JBMA 8TIMA 5FESA 1OHLA 3TSMA 4ONVA 1HTIA 3BARA 2XN0A 2WNQA 4OGZA 2GQ8A 4OBTA 4FEZA 1P1XA 3ZFHA 3L5AA 1C8VA 3L0KA 3TK7A 4WUIA 3W1NA 2Q8LA 1LCOA 2ZRWA 4KWVA 2GJLA 3EWZA 2F7FA 1VCGA 2PCQA 2NX3A 4PTNA 2R14A 4A3UA 3E9AA 2X1RA 2TPSA 1BWLA 3RLUA 1OFQA 1OJXA 4JTIA 2ZZ4A 1X6UA 2PC4A 1K7XA 3A23A 4O54A 2OT1A 3INPA 3G1DA 3TJLA 1KFKA 3QSRA 1XL9A 3ABQA 2RDUA 3C56A 4S2BA 4LOCA 3W76A 1KTCA 3LCHA 4CCEA 4NXKA 4XTIA 3GIYA 1IXPA 3EX2A 4BI6A 1P0KA 3IGSA 6ALDA 1S5TA 2QCMA 4HPXA 4ICNA 4PFMA 3KOFA 1WOAA 3W74A 4LRTA 2QCNA 3CIXA 1SZNA 4QNWA 2NWSA 1LOLA 5D2WA 3LXCA 4DO6A 3DHDA 2DZSA 5AHMA 5KTLA 4OT7A 4DO4A 4MVAA 4LV4A 1UJPA 4P2VA 2OCZA 3Q2DA 4R7JA 4JTJA 5D33A 5LSMA 4JX5A 3CIWA 2GQAA 1R2SA 1AMKA 2Z6IA 1ZFJA 1N8FA 2FB2A 2OX1A 5IBXC 1L2UA 3PSWA 1L9WA 1RQBA 1TRIA 1UBSA 5DN1A 2DU2A 1VZWA 2VFFA 4EOUA 2A0NA 4ZQMA 4Q32A 2C14A 4Z1CA 1H7XA 3G1FA 4M7SA 3BV4A 1H7NA 4JXCA 3LV6A 4BFAA 2NV1A 2QCDB 1QFEA 1DOSA 3H54A 1MEHA 3UZ5A 3KFTA 3NL2A 3QRHA 3C2VA 5AHIA 1P4CA 3ABOA 2NUYA 4JY9A 1PVNA 1G4EA 3NL6A 3TW7A 3FJ6A 3R89A 3HGRA 1KTNA 3MP4A 3O07A 5U4NA 4IMEA 4XQ6A 4JR5A 2ZA2A 3EKLA 2BTMA 1AW2A 4ZZ9A 3FKKA 3ELFA 4H3DA 1EUAA 1QWGA 4U4MA 3WFAA 1H61A 2ZA1A 1RQHA 2QEZA 3TXVA 1BTMA 2TMDA 1ZCOA 4CQ8A 3BPWA 3M47A 3O6DA 3PWAA 2V81A 4LTSA 3FOKA 4XKYB 4H6KA 3MBFA 3NPUA 3NZ1A 3KVKA 4DO5A 4K38A 1EEPA 1MZHA 1IXNA 4KKXA 1G4SA 1WBHA 3MW7A 1QDSA 4A2RA 2A85A 1Q3NA 3PM6A 5CZSA 1KV8A 2QR6A 5I3GA 4LC6A 3C52A 5F4SA 1GVQA 3I65A 3T4CA 1LBLA 4JTKA 3LDVA 1Q6OA 4QQ3A 1OVDA 2I9EA 3T78A 2Y7GA 1LOQA 3W7KA 3DBPA 1EUNA 3ABRA 3P61A 3S5NA 2RFGA 1YTDA 3PC0A 5I3HA 1H60A 2E6YA 1U83A 2YX0A 3SI9A 5HWMA 3QF0A 1LP6A 5DCEA 4O16A 3DHFA 5T26A 4MYXA 1ALDA 3DFOA 1OFEA 4KFNA 1KW1A 4HNNA 1KM5A 3IIZA 5BOOA 3S9YA 4IQLA 3IGXA 4BWLA 3ZR4A 1PCKA 4DPQA 1VYRA 1ZALA 3WJSA 4MZ1A 3HPXA 1LROA 4JNMA 4YCPA 1UUMA 3HGSA 4RR4A 3TMQA 3NM1A 3TDFA 5D03A 3B0VC 4Z0SA 3Q37A 4FX7A 4GUGA 5K9DA 4UTTC 1TJRA 1TQJA 3NM3A 5EL1A 2E5DA 2H6RA 5D2YA 1SZGA 3QEZA 3U2OA 3LXAA 4LVFA 4GC4A 3D0CA 3W3OA 1PCWA 4A21A 3O6CA 1SZFA 1GG0A 3LX9A 4WY0F 2J9XA 2B0MA 5BNKA 5BW6A 4E2BA 3UNDA 1QPRA 1KFLA 1JUBA 3S5YA 3NQ6A 3NQ7A 3A21A 5E1QA 2NLIA 3FIGA 2QCLA 5CKSA 2PRLA 1KFBA 3W7PA 1LORA 3M9YA 3W1RA 1JQVA 2ZRZA 1SW7A 3C4UA 2TRSA 4NVTA 3W7IA 4C1LA 2Y85A 1G7VA 2Z0IA 5AOUA 4IUOA 2GVGA 4N9BA 3IV3A 3EB2A 4EF8A 5C2XA 2BZNA 1OX4A 1G4TA 1TPEA 3HJZA 4MFDA 3P8JA 3CT7A 5AC8A 4XZ9A 3EX4A 4LVDA 3UPBA 4DBDA 2CLMA 4HHPA 4X2RA 4N9EA 2A7RA 3HO8A 1OABA 3RFAA 1JR1A 3QW3A 2J24A 3QMRA 5A8GA 3FLUA 5D38A 1ZAHA 3HF3A 4ZMGA 3M0ZA 1J2WA 5F2MA 5ABTA 1EX5A 1FDZA 1LM1A 3EWXA 4N9DA 1LBFA 1N55A 2B4GA 1H1ZA 2WNNA 5A5WA 4N02A 3VFLA 4ADUA 4LU0A 3IIXA 3S1VA 3P67A 3VE7A 1JUKA 1TJPA 2DZPA 2FPYA 2ZTJA 4ORMA 5KZMA 1SO6A 4NJKA 3HMJG 3LLFA 1GQNA 4RK8A 2VC6A 1DJNA 5I3KA 1B3OA 3DFPA 2G97A 4N6EA 3DI1A 1S5VA 2YGYA 1FXQA 4UTMA 2Q3OA 5LNUA 3THQA 5HR7A 3P81A 3TMLA 3G3DA 3UQNA 1G69A 4WY0B 3DXIA 3GX9A 3NR0A 1K7EA 1VR6A 5D05A 3UPWA 1G67A 3M43A 2JKAA 1TPDA 7TIMA 4O15A 4UC5A 4YL2A 2W6RA 2QUTA 5CSSA 1FWWA 1H7OA 5DY3A 2OMAA 1M7OA 1UCWA 2P1FA 4AH7A 2JK2A 4RLIA 4E38A 3OEXA 3LCGA 4M7TA 4JEQA 2NUXA 1ZAJA 4S1FA 2BX7A 1B4EA 1N7KA 3G24A 1ADOA 2W79A 2C3ZA 1AL8A 1TPWA 4MY1A 1ZENA 3G22A 4K7VA 1RV8A 2V5LA 3CU2A 5FF2A 1OFBA 4AAJA 2Y7FA 3W1XA 3JRKA 2NWRA 5C6MA 4POCA 2ABAA 4ADSA 1AL7A 1XKYA 3CEPA 3IVUA 2NXHA 4K8EA 2J9ZA 1VCFA 5K7JA 1YDVA 3M5VA 2ZQ0A 1OX6A 4IX0A 5F2LA 4QAIA 1VJIA 1Q6LA 3F4WA 3ZS4A 3GR8A 4L4MA 3IVTA 3NQVA 4X22A 3W22A 5CGQA 2V8ZA 3W7NA 3HG4A 3SGZA 2CWNA 4BK9A 3UWWA 6TIMA 3LRKA 5LGZA 3IIVA 4TMBA 5U7SA 3T55A 2EF9A 4CQAA 1OK4A 3G1YA 1KTBA 3OBKA 1LZOA 5EA9A 1FWNA 2V2DA 3L21A 4ML9A 5KITA 5GVJA 1PS9A 2ZZ1A 1LRQA 3H55A 2FJKA 1GPWA 2CZDA 4UTTA 2DZVA 3I6RA 3NA8A 4ZQNA 4LUIA 3LHVA 3UWUA 4A2SA 3USBA 2DJXA 3WK3A 3MMTA 3ZWTA 4DBEA 2J88A 3BLEA 3B05A 4O57A 1DHPA 3NQAA 3BG5A 3IVSA 1PV8A 1QO5A 2PE4A 2VXNA 4CLMA 1O4UA 2Y70A 4HNVA 4JD4A 3CWNA 3O16A 4GFSA 1M7PA 4MPQA 2R8WA 3GLCA 3S0CA 3LCIA 3DU0A 2O7QA 3CC1A 1OYBA 2CFFA 3W87A 4RZ6A 4FIQA 2XFWA 2VFGA 3SIZA 5CZJA 4Z0JA 3QJAA 3BGGA 3OHIA 4AWUA 3F4NA 3CTLA 3O8AA 3THAA 1V7YA 5AB3A 3MJYA 3G1VA 3NQGA 3O1NA 3N2MA 1GG1A 4O14A 1EIXA 2J9YA 4MJZA 3BW2A 3L0GA 1OX5A 5HWJA 5C55A 3KXQA 3NQMA 1H1YA 3PR2A 3F03K 3S6DA 1M6JA 2QCGA 2Z2UA 1W3TA 2ZZ7A 1KM6A 1DKWA 2A21A 1Z42A 1VQTA 4X3ZA 4AF0A 1W5PA 1I4NA 3W7QA 1VS1A 1XFBA 4JN6A 1D9EA 4UMAA 4FX6M 3NDOA 5TBOA 3PB0A 4Z1AA 5EPDA 1FQ0A 1KFJA 2Y62A 2VOMA 3W7RA 3W7OA 3L65A 3UXAA 4UFIA 3W72A 2VEMA 1T96A 3HG5A 3LV5A 3BLIA 3KVLA 3PUOA 4UR7A 1ICQA 3I68A 1DQXA 3EEGA 1DBTA 3C2RA 3IIPA 4A22A 1L6YA 2X16A 3T7VA 3P8IA 2YPIA 4TX9A 3W73A 4IPJA 2FFCA 5AYXA 3LCLA 1BWKA 4Z08A 2A6NA 4FXSA 1O5XA 3W2UA 2UV8G 3UWZA 2YYTA 1WQ5A 1LBMA 2YR1A 3R2GA 1WOBA 3HPSA 3GAYA 1XBZA 1IXQA 4R33A 4O0ZA 1I8JA 3E02A 1I45A 5AN7A 5D37A 4UFJA 3DFTA 2CU0A 3Q58A 3A5VA 3G3MA 5D09A 1EP1A 2ZZ2A 4JIQA 1EP2A 4LT9A 2QAFA 2H3DA 3N19B 1TV5A 3GB6A 3S42A 3UY7A 1XCFA 2E1DA 4YXGA 3TJXA 5K9XA 2FQIA 4GRSA 1H63A 4Y9AA 1KBIA 3GXTA 1IF2A 3W6YA 4ORIA 3LLDA 2W0UA 3IEBA 2H8XA 4UTLA 4UMCA 1KLYA 2VKZG 3HIJA 1K3UA 5HULA 3W2KA 2E6AA 5MHBA 5CG7A 1X1ZA 3M5XA 2JGYA 1EA0A 3LOTA 1YPIA 4LY8A 2H8ZA 4CNOA 4FNTA 2A1YA 3BG3A 3W1AA 1ME7A 2ZTKA 4TU1A 4NZFA 3I7SA 1ZAIA 3W75A 2H90A 4O19A 3BO9A 3WK0A 4A29A 1IGSA 3A24A 1F76A 3O63A 5FEXA 2C1HA 4KFPA 1QNVA 3MHFA 2OJPA 3GXNA 4LS1A
chains in the Genus database with same CATH superfamily
1IIGA 3UG3A 1XCXA 3DHPA 1RK5A 1YBQB 2Y88A 3NWRA 1S5WA 4MNKA 4P61A 5GJMA 2OEMA 4E3VA 3V0UA 3EMCA 3QY6A 1HUVA 3TP4A 2A7PA 1B3YA 1RK6A 4QBXA 3P5ZA 3SECA 4HHHA 1S2VA 2YL8A 4LWWA 2JIWA 1CCWB 2ZRXA 3NSXA 3PF3A 1PX3A 4BF7A 1QW7A 5JBDA 1FP8A 3MKVA 3PSVA 2HPMA 1JYNA 1XJBA 4MNJA 1TTPA 2FGBA 1WA3A 3AS3A 1XUZA 3LQLA 3UR5A 1CGWA 1EPVA 1UKSA 1R3SA 2PC8A 5I3JA 1BD0A 2HDJA 3R1ZA 3VD9A 3LCXA 1E0UA 1TWDA 5F2GA 2TODA 2J6XA 4KWWA 5HNUA 5DT5A 1RHCA 3AO0A 1E3ZA 3NQ8A 4KCUA 3ARTA 4IF2A 3E5BA 2E68A 5D2TA 4N2YA 1EC7A 2VCBA 2X41A 1EPXA 3N6JA 3A22A 2J47A 4GJIA 4LVGA 3ITOA 4XAFA 2WKLA 1UASA 1ZCCA 1BKHA 1K03A 1TPVA 3RXZA 1F73A 3QOKA 3NO1A 1TPFA 5FI8A 5HUPA 2HEJA 1Q4NX 4XV0A 1LG1A 1OIFA 2CLHA 3P14A 3NQBA 1QI4A 4TXEA 2VR5A 5JVLA 4KCVA 4I7WA 1BAGA 1NF0A 4O10A 1UH2A 2HBVA 1QK0A 2IPWA 4RV3A 4MWAC 3GHUA 3BJFA 4XZHA 1C91A 2EKCA 3MMUA 4GYFA 4UFLA 4WSKA 3O06A 4O28A 3W2NA 2JGQA 3EMZA 4PRTA 3BC9A 4FHAA 2I5IA 3M0LA 3DGBA 4HYRA 3VU2A 1EF2A 5REQB 3SR7A 1HO1A 3VTRA 1T0OA 3TFCA 4CNSA 1YADA 2ZUWA 2WSQA 3I4EA 4OBRA 3GTFA 3EPMA 3BAJA 2NVAA 1VIWA 1K7FA 4K8HA 4ZOAA 2YZ5A 1FUYA 1B2YA 4E8CA 5HMSA 1F3XA 1XRSA 1HZYA 3ZXWA 2DZBA 2PDQA 4HNTA 2E6DA 3BAWA 4LALA 4GVHA 3KBNA 1X38A 3R94A 2B7QA 3ABXA 1XLMA 3WQPA 3AU2A 3EDFA 2R91A 5I6SA 5HAOA 1IZCA 1UQYA 2WZHA 3ZVHA 1GOMA 4AZGA 1K9EA 1NFBA 4C6IA 1UIPA 2WHKA 4Z2JA 1FWSA 1IT7A 2FDSA 1JQXA 2P10A 2YSWA 2OKTA 4NJJA 1GK8A 3CWOX 1W9VA 4B9YA 3GQYA 4WOQA 3QBUA 2Z1XA 4GWEA 2DQXA 4I7VA 4MKVA 3MP3A 3KDOA 3SN1A 1W6TA 2PDBA 3W7JA 2PZNA 4UNKA 4UNLA 1FWJC 2WSKA 4IJRA 5I79A 1E55A 2J74A 4XAYA 3V5FA 3T2OA 4MDPA 4QSHA 4UIOA 4YVXA 1OC6A 2AAMA 3VILA 1NP2A 2EXOA 2CBJA 2FVKA 4UOQA 4I7UA 5FIPA 3TQKA 1DVJA 4BJHA 3NIYA 4TVUA 4WOZA 3BCJA 3FXYA 4PCNA 1TWWA 5IFPA 3K30A 2G37A 1OB0A 2PLMA 4LS0A 1FWBC 1QNPA 1MXDA 1PJ9A 4PEKA 1KR1A 5FSDC 3IJ7A 2WHJA 2ZVRA 5F4WA 1Z9AA 4DLMA 4CD8A 4RNIA 1R9ZA 1GHRA 3S2MA 3OQEA 1XGEA 3GTIA 3NZRA 1A4MA 1EJUC 2D24A 1OFOA 4XTDA 4UQ9A 3TAOA 5FF7A 4PTDA 5CLWA 2WOQA 1W3LA 2O92A 4LUYA 1UD8A 3EKZA 3W81A 1L2QA 7A3HA 4LUTA 3DH7A 4CEUC 5FEWA 1Q45A 2WVVB 3GYEA 4MLJA 3NL5A 5CSRA 4QLLA 4UOZA 1XM3A 1TTIA 3P80A 2B81A 1XIBA 3RNDA 4OHQA 4DUXA 1NM9A 3ARUA 4CKQA 1JDCA 3MCNA 1BYAA 3BLOA 3TTSA 3P7YA 3GVGA 2CZFA 2X7VA 4KF1A 3RRAA 1NY1A 1H7WA 1O1HA 5IM51 3IJQA 3IJLA 2XISA 4EAYA 3FK4A 4AISA 4ZB2A 4WGHA 4D6JA 4EVZA 3NEHA 5CPOA 1ZRQA 4UCGA 3BQ5A 1UC5A 3MZNA 1FDJA 1MXSA 3W1MA 2IKIA 1MEIA 3TEVA 3FSUA 1NFPA 1EX1A 3A47A 1TCDA 5I03A 4F0MA 4KFOA 1NF7A 1TWSA 1C29A 5A6TC 5A6JA 3KHJA 2CLOA 1VJZA 2X1SA 2MANA 3G1SA 3PZUA 1X8CA 3EWWA 1OYCA 1ISVA 3H2OA 3F4VA 5TD4A 2GFTA 4MSSA 1CNVA 3TKFA 4BY3A 3FJNA 1XDMA 2XN1A 4HBKA 4EXAA 4S3AA 4UXDA 3B0UX 3G8EA 4PCTA 1SO5A 4JTUA 1GTHA 1H1NA 1SFJA 4QROA 1Q6FA 3BL3A 2R1KA 4TUFA 1J12A 3QXBA 1TVPA 4U5IA 4CN4A 3EB3A 4HP5A 4RZ5A 2Z1KA 2IW0A 4CNTA 3DZ1A 1EO7A 1FBAA 3TXZA 4RL3A 3W01A 1KA9F 2KAUC 2HSAA 3OGRA 4R7OA 4D6CA 3WQWA 3T81A 1O60A 4IPNB 2GDQA 4PTVA 2I7GA 1RVGA 2GQ3A 4AD2A 3WFZA 1C9DA 2QW5A 1F7BA 5C5YA 2P8CA 2X40A 1V0NA 1US0A 2CHNA 2GJPA 4MY8A 4I9JA 2CBUA 4DQWA 3W7LA 3LPGA 2GJRA 1K77A 4E2DA 1WKFA 2VTFA 2PGRA 3K8MA 3OGVA 1IEIA 1IGWA 3LTSA 1M53A 2ABBA 4GIYA 1GONA 3C2EA 1JCXA 2BDQA 4P8UA 4C6EA 3B9NA 3MC5A 3PUEA 2WO5A 2GUBA 1VB9A 2QF7A 4WX2A 1PIGA 1V0KA 4B5XA 4GUHA 5FSEC 1W2PA 1S2UA 2XINA 3VNMA 1RSCA 1KBKA 5CPMA 3G1AA 2QAPA 3VOHA 4NU7A 5KZ6A 3VGFA 3U6WA 2YFNA 4KWSA 4ZEPA 3KLKA 2V63A 2VGBA 5FL1A 4LB4A 4DVOA 1K1DA 2ASHA 2GGEA 3DN5A 6TAAA 3T0CA 4L56A 1FWAC 1DQUA 3MS8A 2DVUA 4W88A 3RMJA 1KXHA 4Q33A 3HOJA 2QDHA 1OGGA 4OU1A 4JX6A 1RY0A 4MJMA 2OOGA 5EBAA 2EAWA 3UEQA 1XI3A 1D7FA 1W37A 2WKGA 3AMCA 1J0JA 1A3HA 4GJ1A 2RDWA 2V0TA 3AUOA 1OY0A 3TWBA 4I9AA 4A3RA 3IGUA 1MEWA 3P82A 1J0IA 3M5YA 5EMJA 3TN6A 4GACA 1FHLA 4C1KA 5C70A 1AD1A 1WAWA 1OYAA 4L9ZA 1JI2A 1EJSC 1IWPA 3GNNA 5HQEA 1WBJA 2J77A 4HOZA 2OELA 2PP1A 1B57A 3OQ8A 1CB2A 1WDPA 4ZXLA 4PMOA 1I6NA 5RUBA 3CHCA 2FPTA 2RJGA 1B3VA 4MADA 3DFNA 6XIMA 2WSRA 3DIPA 3PZIA 3U8GA 3GE7A 1KM3A 1NEYA 1A5AA 4MUPA 4ASTA 1TVLA 3MKCA 4V1YA 1XBYA 3VIPA 4E3TA 5JH1A 3WQ8A 3IJDA 3ZJ7A 3GVRA 1OIMA 3VM7A 1A5CA 4AZHA 4MB1A 3LBCA 3M6DA 4L6OA 5H8PA 3QPZA 4DI9A 3LS9A 3FDGA 1W0MA 4EPDC 1JJKA 2VEGA 4LV9A 4ES4A 3IAPA 5EMMA 3E0LA 1VC4A 4O50A 2BG5A 3CV6A 4AB4A 2IKGA 1AQFA 4IISA 1W17A 1TMHA 2AAAA 1SUXA 3QKZA 2ZUMA 2VJXA 4JTDA 3E5PA 2BVTA 2GOKA 3O6YX 2XU2A 3M0HA 3RR4A 5AYBA 4HMNA 3P6LA 1H09A 4YTUA 4DAFA 3CH0A 3HFYA 4ICCX 4L4LA 1P6WA 4IX2A 1LLWA 3UWQA 1EL3A 2GK1A 1G6CA 3IIOA 5DANA 1MNZA 2VNCA 1W1TA 1E71M 3CHEA 4NZJA 3HJEA 4KCWA 1E4LA 1KM0A 2FHCA 1J79A 5CEWA 2E9BA 1LLOA 2MUCA 1QATA 1VBJA 1T40A 4HNOA 4H4IA 2ISFA 4FF7A 1SPQA 2NQLA 1EZWA 3V4BA 3LXBA 4CEXC 5DY2A 1YXDA 3W86A 2TYSA 1OFAA 1VBGA 3GXPA 4AY8A 3QFEA 2I9UA 1XH1A 1IQ8A 3VX1A 1OSEA 1GVRA 4QE4A 4LCQA 3EWUA 3WN6A 2CPUA 5D4YA 2WV8A 3EZ4A 1MRAA 2PZ0A 4HGXA 3SCNA 3TW6A 4G8TA 1HVQA 5AC6A 4NILA 1GNXA 4DXVA 5DCBA 2KZHA 2HJPA 3ZSSA 3KAOA 1V3MA 1I1WA 3KTSA 1CPUA 1W3HA 1VBUA 3TN3A 1S2AA 2D2JA 2RGLA 2BLEA 2PD9A 2VHLA 3SCSA 3RK8A 1Z8AA 1NJJA 2C16A 4KEVA 1B4KA 3KUMA 2PBOA 3V16A 2BVDA 2CWXA 2IKHA 2PDHA 2LLEA 4MB3A 5I77A 3N4EA 1W91A 4Y2WA 4PMRA 4FNUA 3COTA 5D02A 4CNUA 2WHMA 4Y8FA 1M9HA 1A5UA 3L68A 5CPLA 2Z25A 3UBPC 1KWGA 3FY1A 4LUSA 5BXRA 4CVWA 3GY1A 3C0JA 3AIEA 4J5NA 3GDKA 3KTCA 1GOXA 4AWEA 5JU6A 3HBLA 3MT1A 2JKPA 3WDIA 1UH4A 3HQNA 3MMWA 2PGWA 1PL9A 4H6EA 3MY9A 4PRRA 4J3VA 4KS0A 1RCOB 2YDRA 3P5YA 4KRUA 3P2VA 2R6OA 3NFUA 3MYOA 2DVTA 5AHFA 3KBVA 2VUYA 1JRBA 1ZB5A 1RH9A 4FIRA 5AHEA 5AKQA 5C71A 2VZSA 3G5EA 4DXXA 2Y24A 4EE9A 3N14A 2ZUNA 2PS2A 3WG6A 4AF0B 2C18A 4MZYA 4AIEA 1J4EA 1ADDA 1KCLA 1KXTA 4X0NA 3GZ3A 4JDYA 4BZYA 1E1CA 2WCGA 3B9OA 3GU2A 4MHBA 1KRCC 3D3FA 2NV2A 1CI1A 4FP1A 3L4WA 4YJ5A 3QSTA 4QIUA 4K3ZA 2FZBA 3LCWA 3H2NA 4BS0A 4JDBA 1UR1A 2CITA 5DFAA 2HZGA 3EX1A 1LL7A 4WHBA 1ZY9A 3MKKA 1VYSX 1FY6A 1W3IA 4OV9A 1NSJA 3H2CA 2V30A 3N73A 3HN3A 3VXGA 2EO7A 3DG7A 4S3CA 4DF1A 2AGKA 2PDLA 4M80A 1U5JA 3WQGA 3AMKA 4XB3A 4WY0A 1LDCA 2HWGA 2R82A 3GNDA 2IQ0A 2B7OA 4AHPA 5B80A 5DMLA 4IUGA 1F9CA 1GWJA 2WVUA 1FH7A 2REQB 3T8QA 4UTWC 5KSWA 1Q7MA 4O4VA 5CBBA 1W1VA 1FCUA 1VEPA 3MI6A 4XZMX 3QHOA 2BOGX 4ACZB 2VQUA 2Y5SA 3MHGA 5EMYA 4ZO9A 1PZ3A 4GD0A 1WPCA 4LRSA 1M41A 3R4IA 3GDBA 1THFD 1GT8A 2VEPA 1DIOA 3S2JA 4OV4A 4MOZA 1XIHA 2QT3A 3AIRA 1G94A 5MKGA 3CHVA 2E8ZA 3VX0A 2WZTA 3VZXA 5TAOA 3APTA 1DE5A 3OPSA 3I3EA 2FHBA 4C6CA 3REQB 3R11A 3LBOA 5D30A 2J8TA 2Q3RA 4X63A 4UZSA 1CXLA 1F05A 4JICA 3W00A 3GAKA 4GCAA 3IK4A 1PHWA 4AQLA 4AXKA 1ZUAX 3ZOAA 4R88A 3W7DA 3M64A 4ATDA 3M0XA 3VKKA 4C5ZA 3BLFA 3SRDA 1MW0A 2WXDM 3QMSA 5FJIA 4HNLA 4MG4A 1SFTA 3C2OA 1OHLA 1IYXA 3EKGA 2OODA 1XYAA 3S4TA 1OC5A 1TE6A 1U1HA 3KDNA 1U22A 5J8LA 4OGZA 1EDTA 4HB7A 1WZAA 4AG0A 3QHMA 3CO8A 3QR3A 2Q8LA 4KWVA 4XKMA 1KKRA 1ITQA 2R14A 4LAUA 1EXBA 2ZZ4A 2PB1A 1K7XA 4BEUA 3FA4A 2GDVA 2VRJA 3QSRA 3OIHA 4QLKA 1OC7A 3W76A 4CCEA 1Z3NA 3H4WA 3IGSA 3U7VA 1S5TA 4HPXA 4PFMA 3D46A 1XQKA 7CGTA 4JFWA 1JDEA 4OT7A 3B97A 6REQB 1FVPA 4LV4A 5E9XA 1BQGA 1UJPA 7REQA 3Q2DA 4F3HA 5D33A 3LMYA 3CIWA 2NQ9A 2Z6IA 5LIUX 4NSBA 1UKQA 1EJXC 5IDZA 5IBXC 1GQJA 1L2UA 3PSWA 4AUBA 1RQBA 5JIPA 1VZWA 3RCMA 4PCPA 2C14A 3UGRA 3VO0A 4IMAA 2NV1A 2QV5A 3H54A 2YB4A 1NDVA 4JTAA 4XZLX 3ABOA 1R6WA 5CG0A 1PVNA 1G4EA 1J0HA 3R89A 1KTNA 1P48A 1JZ6A 5U4NA 1CLKA 4UTFA 1BLIA 4YIWA 1LQAA 2BTMA 5CJ5A 1H61A 2QEZA 5GJPA 4B4HA 3URAA 2C0HA 2ZUTA 1DXIA 3O6DA 4F0KA 4EX4A 1SM9A 4K38A 1MZHA 1IXNA 1FWHC 1UKPA 1G4SA 5A6MA 4H19A 5FJTA 2A85A 1WZMA 4DHGA 4GQBA 3VABA 4LC6A 1JAEA 2PWUA 1IEVA 3RCNA 3OTRA 5M1TA 3VD4A 4QQ3A 1OVDA 1QNRA 1C3FA 2VOTA 3T78A 3GTHA 2Y7GA 2FFIA 3MQTA 3VOFA 3T2PA 1BYBA 1YKWA 3UJRA 2E4TA 3W6LA 2WCAA 3ZVHB 3RDKA 2YCLB 1J0KA 1JZ8A 4TX6A 2Q09A 4L9YA 1AVAA 4AD0A 2HK0A 1A3XA 3DHFA 5T26A 3GG8A 4RZBA 3RO6A 4DJFD 2BHZA 1PX4A 4P8WA 4E4UA 4E8DA 2DGAA 3ZR4A 3VC6A 2AMXA 1ZALA 3VDAA 2F6KA 3XINA 4RR4A 1ONEA 1HGWA 4LAOA 4X61A 1E4NA 4H04A 2CXEA 1RBOB 1UOKA 4GUGA 4LAKA 2H6RA 3QGVA 5D2YA 3QEZA 3MDWA 2NT0A 4LVFA 4GC4A 1MMFA 4HNCA 1PCWA 4JEJA 1H41A 1PBGA 1LT8A 5BNKA 1JDFA 4RDYA 5M03A 4QXIA 1KFLA 1BXCA 3VVGA 2DV0A 3ZM8A 3NQ6A 3NQ7A 4U3CA 3WENA 3ZIZA 2PRLA 2QXWA 3W1RA 3WBWA 3E0VA 1QHPA 1HKKA 2PDGA 4TTGA 2VI0A 5AOUA 3TN5A 4DNHA 3E6EA 4BCEA 3AHZA 3ZLFA 2BZNA 1G4TA 4RE0A 3T1GA 4XZ9A 3EX4A 2PWDA 1ZS2A 1GJUA 4REQA 4PZVA 5A8GA 1E9IA 3KS5A 3Q67A 1KNWA 4G7EB 3HZ3A 5EB8A 4ZMGA 3H2AA 3W25A 2WLZA 1DE6A 4J7RA 3EWXA 2RAGA 1N55A 4ADUA 5EGRA 3WNLA 4AY7A 3ARPA 4KCTA 3S2NA 3VE7A 2VGGA 1TJPA 3R7MA 5KZMA 4NJKA 2HE8A 3HMJG 2CERA 4WIWA 3R8GA 3E2VA 2VC6A 5B7YA 5D9OA 1B3OA 3DFPA 4N6EA 1Q2SA 3THQA 5HR7A 3JVAA 1EZ2A 4LFYA 3NR0A 2DT3A 1K7EA 3CUJA 3M43A 2JKAA 4Q4RA 4K1GA 2PF8A 1XYCA 2WJDA 1FP9A 3GVQA 2WMGA 3V5CA 4IIBA 5DY3A 3RHGA 5H8MA 2ACSA 1C92A 4RLIA 3LCGA 2D22A 3WNKA 3K5XA 1O7AA 1ZAJA 5GQBA 2C79A 3SBFA 1ECQA 1ADOA 5M3WA 3BLKA 1TPWA 4MY1A 1ZENA 1RV8A 5FF2A 4KGLA 1OFBA 4HK7A 3DECA 1K6WA 4WVXA 1Y5XA 2WCSA 1KBBA 1EJVC 4I5UA 1XKYA 3S3GA 3F2DA 3CEPA 2NXHA 1RLCL 7PTDA 5GJNA 3QLLA 2ZQ0A 1OX6A 4IX0A 5F2LA 4QAIA 1VJIA 3F4WA 3ZT7A 4FMVA 3NQVA 3W22A 1IE7C 4L64A 2BOEX 3IJ9A 3UWWA 6TIMA 1XS2A 5BU9A 3IIVA 2QVHA 3AS0A 2QPSA 5FKYA 3OBKA 5EA9A 4ML9A 3M46A 3R0DA 1UJQA 2OZ3A 4MWAA 1TZ9A 3EDJA 3KBSA 3NA8A 2X0YA 3LHVA 1BF2A 1W9PA 3USBA 4WDTA 3WEMA 1CGYA 2J6VA 4PMJA 5XIMA 3PNUA 1ZP3A 3ZWTA 1RY8A 1G0CA 3IVSA 3NXLA 3O16A 1M7PA 2R8WA 4PMNA 2O7QA 5T8GA 3WKZA 4HZMA 4QEHA 3Q4DA 1KGWA 2DQWA 1TJ1A 5CZJA 1J11A 3ZT6A 4HSHA 1XIMA 5CBIA 3PPCA 2I5GA 3OW1A 3S1GA 2WVTA 4UCFA 4DJED 1H11A 3THAA 2EJ1A 1GQKA 4KT2A 3L0GA 1OX5A 4JL1A 1MUWA 3F03K 2ZZ7A 3RITA 1W2VA 1JAKA 3MUZ1 2JEPA 2A21A 1Z42A 3CTTA 4I8YA 2XIOA 4H7CA 4HZ6A 4LF1A 1EKOA 4GQQA 4I8DA 4M8UA 3LGGA 3HQPA 2QUMA 3PB0A 5CJMA 3BJTA 1GPFA 1FQ0A 2Y62A 2AL1A 4GI9A 3OZOA 2VRKA 1XPGA 2VEMA 3LV5A 3BLIA 3KVLA 3EEGA 5XINA 4A22A 1OCQA 2X16A 3P8IA 3LCLA 4DWDA 3ES8A 2A6NA 4HCDA 4FXSA 4RPPA 5IHSA 4C6OA 1EF3A 1WKYA 3W2UA 2PTDA 5TF0A 2YYTA 4NHVA 2I5QA 4INFA 2CBVA 3HPSA 1A80A 4JQ1A 4OKDA 4C6QA 3QC0A 1JI1A 3E02A 5IRPA 1JL8A 4HYWA 2GZXA 5D37A 4QCEA 4W8AA 3RCYA 1EQCA 2RDXA 3LQGA 3G3MA 1EP1A 1EP2A 4LT9A 2QPUA 4IIDA 2VDHA 3VIGA 2FHFA 3R25A 3UY7A 3N4AA 1XCFA 3TJXA 2ZDSA 3DERA 2WBKA 3L4YA 4GRSA 1H63A 3GM8A 1KBIA 4J35A 1QHOA 3A4WA 1IF2A 3GXTA 4ORIA 3W6YA 3LLDA 2PDIA 2W0UA 4F2UA 2Z24A 4L7ZA 3LM3A 1CXHA 4UTLA 4UMCA 1XP3A 3HIJA 4GXPA 4NP7A 1X1ZA 3M5XA 4PN2A 2JGYA 5HOSA 1YPIA 4V33A 4O8AA 2H8ZA 3WLOA 2A1YA 5T9CE 3W1AA 1VBHA 2V69A 5LXEA 2XWDA 1OCBA 2XZ9A 4DM1A 1FHUA 2DW7A 3BO9A 1WUEA 3AXHA 3MUCA 2W67A 3VM5A 3BAIA 3GC5A 4KFPA 3GH7A 5H6HA 2J25A 4B5TA 4W7WA 4LS1A 2GK1B 4D1JA 3HFTA 3W7HA 4PUNA 3GIQA 1FWFC 1A5LC 4ZQRA 3E38A 4O1AA 3SAZA 2W4XA 4HIBA 4D71A 1R38A 3CUZA 3DFSA 4HPHA 2FZNA 2NZLA 4ML4A 4O11A 3N4FA 2E9LA 4JL2A 5FAGA 4RUBA 4NRSA 1M04A 2XUCA 3O05A 3F7JA 4PMXA 2EGZA 2ZICA 3OYZA 4QITA 1Q65A 3SCUA 1JRCA 1WDDA 1IEXA 1LWJA 1J8VA 3LHUA 3WNOA 3VOJA 1J93A 4Q8UA 4AXNA 1BVWA 3EOUA 3UWYA 2A7NA 5A94A 3VNIA 2ZA3A 2Y63A 1MW1A 4HU0A 4AWSA 5AYIA 4TR9A 5FJPA 2I1OA 3CAVA 1OX4B 1VIZA 3RR1A 1XGZA 3KWSA 1E6NA 4B16A 2PGEA 2W91A 2B7PA 5F4XA 3ARYA 4M6VA 2GJXB 3FN9A 4GX9A 2E67A 3NQ2A 3ONBA 3PNZA 4R7WA 5CJNA 4NX0A 1SMDA 5KETA 4F0RA 2Z26A 4DWSD 3WDPP 1OF6A 1VRDA 4NNCA 3WMBA 1K70A 1RD5A 2ATSA 4XSMA 3ZZ1A 8CGTA 3AAMA 3WF0A 5A2AA 5CAKA 2XHYA 2Z27A 3EWYA 4E4PA 4WZHA 3KRSA 4P7QA 3W0KA 3F2BA 3H8AA 1BTCA 2OEJA 2P5NA 3EXSA 1EB3A 2BS9A 4GUIA 5AC7A 5A95A 3OLDA 4W8BA 1A53A 1P0DA 3H4GA 2PDYA 5JBFA 3EDDA 4JGDA 1X6LA 5FF3A 2QLYA 3DFQA 1H3GA 3ICJA 1VH7A 1GVSA 3PUDA 5SWUA 2VDIA 2HRWA 2XPKA 2F61A 3PZNA 4HD5A 1KFEA 3CT2A 5HPOA 3GDRA 3RIKA 2H3BA 3NUKA 3TC3A 3FYYA 3WLSA 1TE1A 3UXIA 3MI3A 1HL8A 4OZOA 3IJ6A 1EJRC 3NAVA 1UA7A 3VNZA 5A6AA 2J7FA 1QOQA 1DJXA 3PP7A 2FIQA 1QR7A 1A3WA 3TFXA 4JFVA 4O4WA 3P0WA 2X2GA 3CBWA 5LYRA 3LRMA 5A8NA 3E3HA 1M01A 3G0SA 3LHTA 1KWKA 3R5EA 1E1CB 1PE1A 3MO7A 5LHFA 4X9SA 4H00A 1VFSA 2E77A 1W1B1 4FA3A 2QJIA 1KRAC 3B4YA 4TOQA 3QGKC 4YHEA 1ENUA 3AWNA 5CSUA 3VMPA 2WMIA 1TTJA 1NAL1 2GQ9A 3DKLA 3W26A 1C7SA 4ROQA 3W2MA 1YQ2A 2Q6ZA 3LK6A 1F6PA 2R1MA 3E0IA 2A2IA 2POZA 3STEA 4Q4PA 5E0CA 1WV2A 2AL2B 1SR0A 3T6CA 1J0YA 5KZDA 1RZMA 1D2KA 2DW6A 1NDYA 5C54A 4O0KA 1TSIA 5M2FX 1Q63A 3VD7A 1H50A 3TIMA 2CIPA 3QZAA 3HV9A 4RW5A 3E1F1 4GYPC 3QYQA 3QW4B 4JNZA 4UTIA 5HATA 3E0FA 4FLOA 1T8XA 5JH2A 1XDJA 1TQXA 3QGAC 1TREA 2X8RA 1JXKA 2Z2BA 2BY1A 1LWHA 3B06A 4GK8A 4Y6GA 1EC9A 3TV8A 2OZTA 1Z44A 4NASA 4ZSUA 3W7GA 3T9PA 4B2DD 4F2BA 1HO4A 1OZQA 4GLEA 1LT7A 1ZZMA 2OQHA 3T08A 3GDMA 2ANUA 3G0UA 4IXHA 1T7LA 4NZCA 1DYSA 2AQVA 1X96A 3PBMA 4C1NA 1ZNNA 1YXCA 3W38A 5C9UA 3VCRA 2QDEA 1V0LA 3MUY1 2ZDRA 3VDCA 5CGMA 3AMLA 3MI2A 3UESA 1MSSA 1TR1A 1F5ZA 4W87A 4YHGA 4GBUA 2FJUB 4CQBA 1E51A 4J1OA 2BODX 3PJUA 4GOAA 2XIMA 4JFSA 4JTGA 5I2UA 4PH6A 4PE8A 2OQYA 2D2GA 4MNMA 2PBGA 1BRLA 2OO6A 2BOFX 5AYYA 4CN1A 3NDZA 4JFTA 3NNTA 1Q6EA 3VKJA 1JYWA 3AROA 3UJEA 4O52A 4U31A 1WE5A 2UZ9A 4GE8A 2QJJA 1ISXA 4U2ZA 4AIBA 4KIEA 3STPA 4GNJA 1GQIA 3DC8A 4J2MA 1F2JA 5G1TA 3V18A 3N29A 1H0GA 3W82A 1KLZA 2VT0A 4GKLA 2PLJA 5LNRA 3C86A 4H7ZA 2VFEA 2QULA 5ABHA 3MUIA 3AHTA 1JCMP 2Z6JA 1XKJA 5CCZA 3MU7A 3LI0A 5DBUA 1YTEA 2O7SA 4D6IA 3QOMA 3UCQA 4PUUA 5G2IA 3EWBX 1V6UA 2J7HA 1D7KA 3AYTA 4Z2GA 4AZCA 4LJ3A 1Z48A 4YVVA 3KOXA 4O53A 4NI8A 6A3HA 2R1PA 3AIQA 3S2LA 3GDLA 4EANA 1IIHA 3LM7A 4LX4A 4YCOA 5G4EA 1JF6A 3T44A 4CU6A 2CNCA 2BVYA 4IFRA 4XD5A 4CU8A 2DSKA 4NI3A 1A50A 3KOWA 3WQVA 3W1QA 1JD7A 4XUGA 2BASA 3EWCA 5G2WA 1TTQA 4KGJA 3T07A 3CQKA 5FF4A 5I5RA 2XM1A 2V3DA 4CUCA 1D3GA 5MF5A 9RUBA 1DWFM 2J13A 3V75A 5HK4A 1UZ4A 4FOUA 1S5MA 4IGHA 5AHLA 2CESA 3VINA 2VYOA 2GVLA 1UPPA 3M0YA 5BRBA 4RV8A 4DXKA 1J96A 2C13A 1QU4A 2OYMA 4Y96A 4R34A 4LBSA 4ZOCA 3UVIA 2YOCA 2BY3A 2CLKA 4DUVA 3ZYZA 1W9UA 1V3KA 3D6NA 4OUEA 1GYNA 3C8NA 1ITXA 1K02A 5LXXA 4GVFA 1HW6A 3UF9A 1G1YA 2G5WA 1NWTA 1A4LA 1H0IA 5FJOA 1DQWA 4XAGA 1EA9C 1XDLA 2FB3A 1NU5A 1XG4A 1FWRA 4B15A 3M6YA 3WLKX 2NQ5A 2PI6A 1X39A 3PG9A 3R79A 3VZZA 2XIIA 3N2CA 4LNCA 3AC0A 5HUOA 2VL4A 3LGDA 3OP2A 2HCVA 2Y7DA 5G2HA 3CAKA 4A3QA 2V3GA 3V3WA 1ZBKA 4CN6A 4N4PA 4OWGA 4K1WA 1HKWA 3SY1A 5CQ1A 4NT0A 1B54A 4DF0A 1W8SA 1R8LA 2DORA 5M17A 2R1LA 4AY1A 1PZ1A 4LNYA 5CXPA 3THDA 2F6XA 3GXFA 4GISA 2OWCA 3TYUA 2ADAA 1YLVA 4ZVJA 4C6NA 3LRLA 1BSIA 3JUGA 4XIAA 5LIWX 5LNSA 1R30A 1S39A 1QUMA 2INFA 1HJSA 3TA6A 2BGSA 3CUHA 1FDYA 2X42A 2ZXDA 3UJSA 2W3ZA 3GVWA 3LTPA 4NAEA 4H9XA 4C6MA 1VCVA 1C9WA 4IL0A 1UMLA 4CD4A 1IXOA 1H2JA 3AS1A 1XFCA 4C6FA 4UTWA 2OWXA 2ODOA 3TSDA 2PTZA 1RJQA 3PANA 2WNZA 5CBJA 2A3CA 2ZXBA 4AIOA 4JIPA 3ARQA 1H49A 4BEQA 1W5MA 2G95A 3ANYA 3NO3A 4XO7A 4IFKA 3ZSTA 4G5DA 4ROPA 2WSYA 5A2CA 4IQEA 3W85A 2WJFA 2PRMA 4MF4A 2EJAA 4LYPA 4B91A 2E8YA 2EHHA 3WL1A 1JNDA 1T99A 4Q8MA 3WK1A 3FJLA 3S83A 3W71A 4L1WA 4NY2A 3ANVA 3CV2A 3NQEA 2Q71A 3F4CA 4PA8A 4HPJA 5LNWA 3ZJKA 2P50A 3JR2A 2QJGA 4X0VA 3DENA 3O15A 3RX2A 5LA2A 1UWIA 1X1NA 1UH3A 2FH8A 3FYOA 4R53A 2XFYA 4DUWA 1LWIA 3OVGA 1RPXA 3D5HA 2JE8A 2QCDA 1V0MA 5I07A 3W2JA 5CAHA 4JKLA 1HL9A 1DJYA 2GDUA 4TIMA 2ONEA 3UZZA 4IGNA 2PMQA 5AFDA 3HURA 1QOXA 1SW3A 4WKAA 5BXSA 1KCZA 4XD4A 4JTTA 5AYZA 2XIQA 3T40A 2W61A 5BOFA 4LEFA 1OFPA 3I3BA 3MTWA 2QCCA 3WUGA 3E49A 2HXUA 2DP3A 3QV7A 4GO9A 2IPFA 4QDWA 2L5HA 3OIXA 2NVCA 4K37A 3SM0A 1JIBA 1SR9A 3TUUA 4HVXA 3S2CA 1OCNA 1QHZA 2ESCA 3NGFA 1VPQA 4DBSA 2O9RA 3TTOA 3MSYA 4FB7A 4IP4A 5IHRA 1JCJA 1BKSA 4WD0A 4EIVA 3BCDA 2OOFA 3CK5A 4YTRA 4AHOA 4NX5A 1ONRA 1FH9A 3AALA 3WLMA 2V82A 3S5ZA 4BF5A 1PYFA 4W9TA 3BMXA 1MRQA 5T9BG 3LHWA 3GC2A 1N82A 4JHMA 1M5WA 1EDQA 2ZUVA 3S9IA 4FALA 3QZ6A 4RXFA 2GGHA 5TQLA 4I90A 3B9AA 3TC7A 2VX4A 4FNSA 1MW2A 5FF0A 5IBXA 4GI4A 3S1XA 4NZ1A 2V5KA 4J2PA 4MLRA 5FCZA 1Q6DA 4HZ8A 4F79A 4MWAB 4PODA 4Q3MA 2CLEA 3QLDA 7ENLA 2CZEA 1A5KC 2IPJA 3EXTA 4WJ8A 3HG2A 4GUJA 5J04A 5H2ZA 3VDHA 3O6AA 5LHEA 1O95A 4GMEA 3CQJA 1H51A 1XRFA 1UR3M 2QKFA 3IWPA 2ZX5A 3MV01 4Z1DA 2OZ8A 2A3EA 1WDWA 3IS4A 1UR8A 1HKVA 3WF4A 1UB3A 4Y9OA 4AWTA 4UQAA 3O0KA 1EHNA 2QJHA 5I3FA 3H6OA 4F2TA 3L7RA 1G4PA 3O2LA 1DEDA 2QUVA 3QPEA 1C93A 1YX1A 4JPGA 3NPVA 4L5ZA 1J18A 1XLGA 3FHAA 4DIAA 3SJNA 2HVOA 1R87A 2GGGA 4WXYA 3TVAA 3MA8A 3GG1A 4GGBA 4QX4A 4NNAA 4IFOA 3ITLA 4NZ4A 3WNMA 1E1FA 4C6JA 2VP8A 4Q8NA 3WQCA 2E28A 1PSCA 4AHQA 2WMJA 2WJZA 2WPBA 5JIWA 1KBLA 4ENLA 3RM9A 3ES7A 5A6BD 1JULA 1LYXA 1JDDA 1Z89A 3B03A 3VKBA 2PDNA 3IV8A 1XD0A 3QKEA 4DJEA 2VC7A 4DJDD 5BCAA 1W3NA 3PBUA 4M19A 1UZ1A 3CUGA 1VRXA 4DF2A 5EMKA 3EMQA 4IG2A 3FEMA 2QV4A 3AXMA 3W70A 1FWCC 1LTDA 2I57A 3CPUA 3NG3A 3VKCA 3C3UA 1W5QA 5D9PA 4FK9A 2WQPA 2D20A 4IWWA 4MDOA 3QQ1A 2Y6ZA 3PJTA 3HB9A 2DDXA 3MDUA 4JS3A 1RAKA 3D3AA 4ZFCA 3R12A 2Q01A 2V5CA 1W9DM 2VELA 1UBPC 3VIIA 1E6SM 1TMLA 1SJBA 2V5DA 3BSMA 1GHSA 3ZWSA 2OSWA 4LCSA 1R7OA 2J7GA 1TZZA 3LY0A 4JX4A 1Y7VA 3KLLA 5BRPA 1BVNP 4QAWA 3MZ2A 1SFSA 4FX8A 1JCTA 1TCMA 1FOBA 5D2XA 4HU8A 3L2IA 2GVYA 4EXQA 4EK7A 1UD3A 4LYRA 2YJQA 3G1HA 1PWLA 4Q6JA 2J7DA 3WBYA 1M3UA 1DJQA 1VGAA 1QXLA 4DUOA 1GGOA 4IGSA 1DV7A 4W4QA 4GH1A 3TN4A 4E5TA 3NDYA 1WYIA 3RM4A 3UXKA 1YTKA 2OXNA 1JUEA 2FTPA 1JYXA 2OYLA 5D2VA 2E6FA 2I17A 1L0PA 4UTHA 4ZA0A 3SRKA 1L6WA 1UD2A 3GDTA 4QCFA 1SYTA 3IRDA 2QDGA 4FOKA 4H6RA 2P53A 3B0YA 1HJQA 4ZFMA 4ZE4A 8TIMA 3M1ZA 1A5NC 3EWDA 1MYRA 4S3DA 1BF6A 3MWCA 4B3LA 4ONVA 2XN0A 4M3PA 3UU0A 1R3YA 1VENA 2PSNA 4K8GA 3QYSA 2PGFA 1E70M 3TK7A 1KRMA 4TVDA 3W1NA 1LCOA 2ZRWA 3E9AA 1EBHA 4DBUA 2Y8KA 3B3DA 3VK5A 1X6UA 4MAVA 3B8SA 2PPGA 4O54A 3INPA 1KFKA 3ABQA 2XH2A 2Z7KA 3OJGA 5ABFA 3H12A 1KTCA 1XV8A 3LCHA 4NXKA 1JZ3A 3TYBA 8XIMA 3GIYA 2X1IA 4BI6A 2QCMA 4JCLA 1KCXA 2VZUA 4UQBA 2QCNA 2X0HA 3CIXA 1W9BM 1SZNA 5D2WA 2NT1A 1V6VA 3KBJA 4HA1A 2DZSA 4GVIA 2DIJA 3PZQA 1MQRA 1POKA 4MVAA 4UNIA 3UA4A 4CD5A 2DUAA 2Y5JA 4GY7A 4JTJA 2GQAA 3GUWA 3O9NA 1AMKA 2FB2A 3AS2A 3BGAA 1CZ1A 2QPXA 2NLYA 4KESA 1EC8A 5HA7A 1TRIA 1L8NA 1SZRA 2A0NA 4Z1CA 2YCJA 1ADSA 1H7XA 1XQLA 3BV4A 1UG6A 5EFDA 1DXFA 3KFTA 1IZJA 2OU4A 4GZEA 2JF7A 1J10A 2WC4A 3EBVA 1A0DA 4ZTYA 2DT0A 3NL6A 3A3WA 1X6NA 2CYGA 4IMEA 2YBVA 4LH8A 3IAQA 4JR5A 1V3HA 2ZUUA 4YS1A 4ZZ9A 3FKKA 4U4MA 1FKWA 2ZA1A 1UP0A 1BTMA 1HGYA 1ZCOA 2VCCA 2X0SA 2ZC8A 1JYVA 4DWSA 2DT1A 4QS6A 4LTSA 3WMCA 3SEPA 1QI5A 1JEZA 1V3JA 2VWSA 1WBHA 2VZTA 1V93A 1XLBA 1KC7A 1Q3NA 2QR6A 4R3UA 3DYOA 3C52A 1GVQA 3GNXA 1EIBA 4OUIA 1GVYA 1AFSA 1LBLA 2F2HA 5BWFA 2I9EA 5DQPA 1B0IA 1EYWA 3RJXA 1OG6A 3DBPA 3E2QA 3CL6A 3PJXA 3UXLA 4L4PA 3PC0A 5I3HA 3MV11 1U83A 4EAMA 2FKPA 2YX0A 5I3DA 1GKQA 5HWMA 4C7DA 1LP6A 4J3TA 1ALDA 2WMIB 4HNNA 4NKCA 4G56A 5BOOA 3K4DA 1J01A 4Y9PA 4IQLA 1DJHA 5CH9A 4ICMA 1M7JA 1HP4A 2XH7A 3RMEA 4HMDA 4Z17A 3I6TA 1LROA 4JNMA 4YCPA 3QY7A 1UUMA 3TMQA 3TDFA 1TKKA 1YBQA 1EJ7L 3LPFA 1TJRA 1TQJA 3NM3A 3R58A 1G5AA 5FJUA 1UP3A 4A21A 3O6CA 1GG0A 4UR9A 4R27A 3RLGA 1UKOA 1XPYA 1QPRA 3PTQA 4QJ4B 2ZX8A 3QV9A 4GO8A 1GZ1A 4D6EA 5E1QA 2NLIA 3DOPA 4IQDA 4PBFA 2HK1A 3FIGA 5A2BA 5CKSA 3MO4A 4LF2A 1VFMA 5I78A 3W7PA 2WWDA 3M9YA 1JQVA 2ZRZA 3C4UA 4F9DA 2PTWA 1HX0A 2XDFA 1TWIA 1F61A 1T6MA 2V6AA 4PBGA 4PGLA 4EF8A 3AHXA 9CGTA 3MPGA 4LVDA 2CLMA 1NQKA 3HO8A 4RNJA 2OLAA 4JN8A 3QMRA 2DVXA 3FLUA 5D38A 3U0HA 4H6QA 5G4HC 4OVXA 2YDQA 4CU7A 3RJYA 1EX5A 1LM1A 2FGZA 2XM2A 1N2VA 3CMGA 1H1ZA 4N02A 3KL3A 3LSCA 3UFYA 1JUKA 2FPYA 2ZTJA 4ORMA 4GJJA 2D0GA 2WC7A 4H9MA 1Q4WA 2GL5A 4B2DA 1ZJBA 3K4WA 3WQOA 4WRHA 4H8NA 3W53A 3NZGA 4URIA 2GGIA 1S5VA 2YGYA 4UTMA 2UY3A 2Q3OA 4LEQA 5IOBA 3TMLA 4GZ7A 1HKJA 2Z2AA 3UQNA 5D05A 3UPWA 1SVDA 4F0SA 2QJMA 1TV2A 5REQA 4AMCA 3SUWA 7TIMA 5C9ZA 4O15A 1TG7A 1GOIA 1PKNA 5CC7A 2GGJA 1M68A 1AH4A 3TTEA 1AMYA 3ARRA 2P1FA 3URQA 4ILSA 3WYZA 3OEXA 3ZO9A 3AYSA 2CZVA 1AJ0A 3WNNA 1C90A 2G3MA 2IXUA 4AZCB 3GSMA 1NDWA 1L6GA 4AAJA 2Y7FA 1E0TA 2NWRA 4JBRA 5C6MA 4Q8PA 2ABAA 1AQ0A 2OEKA 4ADSA 1AL7A 4XK2A 2FTWA 3PFRA 5K7JA 1CXKA 5C2GA 4L4MA 4Z2IA 3IVTA 5CGQA 4S3KA 4Z2HA 3SGZA 1V08A 1Q66A 3S6OA 3T55A 4YYCA 4HU3A 4CQAA 4DB7A 4XD3A 2VR4A 1LZOA 2DSUA 1YEYA 2V2DA 3QFWA 1N8IA 4W86A 2CZDA 2IPGA 2QMKA 4UTTA 4I6VA 4ZQNA 3AMGA 5DRIA 4OTKA 3WK3A 3MMTA 4DBEA 4O57A 3NQAA 1PV8A 4CGTA 3GXDA 3CV7A 3U2CA 2PDMA 4HNVA 1U2YA 4GFSA 3S0CA 1JGMA 3LCIA 3DU0A 4LBRA 2OKOA 1VFOA 3CC1A 2CFFA 4RZ6A 1EYEA 2VFGA 3GNOA 3MSDA 1PKYA 3VCCA 9XIMA 1TZ7A 3ITGA 3VKDA 4AWUA 3AJ7A 3O8AA 3G1VA 2INZA 3NQGA 3O1NA 4FOJA 3VFCA 4YWSA 3WL0A 4MJZA 1EIXA 2J9YA 2VRQA 3LD5A 5A8PA 3I6EA 3CL7A 5C55A 1GJWA 3NQMA 4RDVA 1M6JA 1W3TA 5HMDA 4GBDA 1KM6A 4FLSA 5H1WA 1JZ7A 1H4PA 1VQTA 2V68A 3QQWA 4LANA 1VBRA 1IEWA 5AVNA 3BQ6A 3W7QA 1VS1A 4JN6A 1D9EA 4GG9A 1OD0A 1RP9A 5E70A 4FX6M 3NDOA 3T42A 4IL2A 1PB0A 4HHLA 1GW1A 2VOMA 4R5EA 1EGMA 3W7RA 4FLQA 5ECVA 1T96A 2NQJA 3U2EA 3PUOA 4UR7A 1ICQA 2XVKA 3EGJA 3I68A 2ZX9A 4H9YA 3IIPA 3B8WA 1HF6A 4HPGA 3T7VA 3RUBL 2YPIA 1W8GA 3W73A 1UC4A 1DTNA 1XIIA 4B92A 3FV9A 2Z00A 4L9XA 1C8YA 3UZXA 1W1IE 3AMDA 1WOBA 1J6OA 3SO7A 3GAYA 1XBZA 1IXQA 4O0ZA 4HPNA 2Z1SA 1V6XA 3SCRA 2CU0A 1XIGA 3A5VA 3GNPA 4GYPA 5D8WA 1UHVA 3DC0A 3S42A 1ONWA 5DMMA 5DO8A 4ZENA 5K9XA 2E0PA 2FQIA 3DG3A 4R9XA 1S2WA 3LPPA 2BY2A 7XIMA 4XO6A 3IEBA 4I9MA 1KLYA 3BCFA 4BQ2A 1UR4A 5MHBA 1O5QA 3SUTA 3WQ6A 4NZ3A 4FNTA 2H9AB 3FX4A 1ME7A 4V27A 2DY3A 1GVIA 3VIKA 4JKKA 4TU1A 4AC7C 4Q7IA 3QR0A 3W75A 2H90A 3VDBA 3RM8A 1IGSA 4GYJA 1S1PA 1F76A 5IFTA 1QNVA 3KCJA 3MHFA 5BXTA 2OJPA 2WZEA 3GXNA 5LA0A 1YNYA 3BLDA 1WB0A 3CO4A 1U1JA 5F1UA 2OSXA 3S47A 3GD6A 1AK5A 3V1HA 1LRNA 1BGAA 2YXGA 1XSJA 5AC5A 1UZDA 1XH2A 4AD5A 1PIIA 1S38A 1S2CA 1TA3A 4H2HA 5F1VA 4MYAA 2G3NA 4L65A 3JS3A 4XISA 2Z29A 3DHUA 3BMVA 2YL9A 2ALDA 2DT2A 3N2OA 1BYCA 3WDQA 3WF3A 5FD0A 4V2XA 6CGTA 1DIDA 4C6DA 3KZPA 3PZGA 5HJXA 4W85A 4AW7A 1DWJM 2V2CA 2RJHA 1R2TA 1G9HA 3ITCA 5I24A 3RILA 4HJWA 3TH6A 2E09A 2DZWA 3CM4A 1PDYA 2FH6A 3NCOA 4HU4A 1SZEA 2V2HA 1LQ2A 1VHNA 3WUBA 4BKNA 5GNZA 5BXPA 4M81A 3PN8A 1J5SA 3IANA 3LB0A 3CPRA 4TVCA 3LHZA 4QSFA 3TE9A 4LS2A 3WLQA 1F3TA 4W89A 4ERIA 4QP0A 2HVMA 4D8ZA 5JQ9A 3SCPA 4PTMA 2AOSA 3GTXA 2GJNA 2WSPA 1KGUA 1RCXB 3NYDA 5BMXA 1E9LA 2YZRA 1OADA 3PVFA 1FKXA 4G2DA 1RQEA 2RGMA 2VZVA 4B5NA 4FXRA 1VKFA 1G7UA 4HSOA 4UQEA 1QBAA 1XLIA 2W5FA 3OG2A 4V28A 1ECEA 1SQ7A 4LC8A 4ZB5A 1NDZA 3S9ZA 4XAZA 1IWAA 3HV8A 1GYLA 3BJSA 1GTEA 1GVEA 2O9PA 1NWUA 1JZ5A 4GXMA 1LRTA 4RXGA 1DJIA 1UP2A 1Y5VA 4XKYA 1XR2A 2NSOA 1UWRA 2AKZA 2QF8A 4RKAA 1SO3A 1DWAM 3BOXA 3H53A 3FYPA 1JGIA 3OZPA 4CCDA 2X1UA 1PX8A 2WQDA 3T09A 1P0NA 4J3SA 3NPXA 1QVBA 3KZSA 4M6PA 1US3A 3STCA 3ERPA 1EFZA 1VLWA 2DZUA 2AMGA 3AI0A 1OFDA 3TQVA 4A3HA 3L23A 4ZB0A 4GKTA 3LUTA 4HT3A 4JTLA 4ZTXA 4HN4A 1R3RA 2CEQA 3N2BA 2DUXA 4QRNA 3TLLA 1HJWA 3WIJA 1XC4A 4HOXA 3RGTA 4RCXA 3L5LA 2ACRA 4QHRA 1MQPA 4M6QA 1KQZA 4IG2B 3M41A 3F5KA 4OOZA 3UR7A 1D3CA 4DLFA 5EYWA 2V38A 2Z4GA 2PFHA 3ORWA 3BAKA 1NQ6A 2CLLA 1ZGDA 4W5ZA 3RPMA 3SN0A 4MFEA 1R9XA 3OYXA 4NZ5A 3KE0A 1MVYA 4QE5A 2HNEA 1U1UA 2PWFA 2YW3A 1MQQA 3C61A 4MIMA 5A6BA 2IQTA 1I2RA 1PWMA 1SFLA 1XLHA 1V5XA 1JCLA 3MHUA 4PSRA 1UWTA 3QN3A 1WKEA 1FX6A 5CZ0A 3KWXA 1ICPA 4K39A 4DELA 1OZMA 4DJDA 4WJXA 3KRUA 4EPKA 4QLJA 3W88A 5TIMA 3HA1A 4AD4A 2PWGA 3GFYA 3UWVA 5LIKX 3BMWA 4XBKA 1I2NA 1K6AA 5A6SA 3VOGA 4UTUA 4PULA 4AZIA 3BAXA 3H7RA 3PZTA 4NQ1A 3FAXA 3TC6A 4GCXA 3IK2A 2C6QA 3VKAA 3W9ZA 3WLLA 1S3HA 3ARVA 1WKDA 3BSGA 1TPC1 4PMQA 3UW6A 1F3WA 3GW0A 3OVRA 1B31A 3PWGA 3M5ZA 3H2MA 2VFIA 1Z6KA 5EKYA 4CQCA 2J79A 4C91A 2DZXA 4YYFA 4NG3A 3U48A 4C90A 2R24A 1W5OA 4J27A 2C1GA 4E2OA 4Q8OA 1EHAA 3FDKA 3HQOA 3KRBA 4GZJA 4YNGA 2QYGA 3S1UA 3GR7A 1AD4A 3EA2A 4PUMA 4GABA 3CGTA 4RW3A 3C5QA 3UZJA 2PF0A 1FCBA 1S5NA 1Z7AA 1Q13A 3W7MA 3BSHA 3ZJ8A 3OVQA 4LW7A 3CAWA 3DCPA 3TR2A 1CBGA 3T0DA 5CZKA 2E5CA 3XISA 4JYEA 4W84A 4NRRA 1ODUA 5E0FA 4DZ5A 1NIUA 4MKSA 1NARA 3C0QA 4DJFC 2A6LA 3V0SA 2A3LA 1K8YA 4FO4A 2E7FA 2D2HA 2JKEA 1V7AA 2W92A 2ZOXA 2ZYFA 3DFHA 4YLWA 1SJDA 5AHNA 1XGDA 4AVFA 3VUPA 1BHGA 5CPTA 4UFKA 4XZNX 3R8RA 3CZEA 1W5NA 2A4AA 3FSTA 5K4XA 5C2CA 2HVNA 4MMWA 1AA1B 3N9SA 2Z1VA 1OQFA 3O3RA 1ZPTA 1F6KA 4J9JA 4US5A 2YDAA 1SW0A 3PG8A 4PB3A 1O1ZA 2OTDA 3I7QA 3W7EA 1D3HA 2F6UA 4H8HA 3L4XA 2NX9A 1OEPA 4LVAA 4ACYA 3UP8A 5HNRA 1GOWA 1KR0A 2WW5A 2C7FA 4CQ9A 4OFCA 1XLKA 1HL2A 4IQJA 1EJTC 2ZRVA 3PFMA 3C8FA 3VIHA 1QT1A 4FNPA 3KVJA 5M5DA 2G0WA 3A3HA 3UG8A 1QAPA 1BEUA 2VENA 3P62A 2YCIX 1QOPA 4O1DA 3P0XA 1US2A 1KM4A 2Q8ZA 3GHSA 3N17A 2QJNA 3K2GA 4GI8A 3BG9A 1V4YA 1J0ZA 2P0OA 4PUDA 2TSYA 3SQMA 4D1IA 3B4UA 3TQPA 4CCZA 3UVAA 4ERAA 5DLCA 4PUKA 4N9CA 2ZWYA 4DBWA 2R94A 2NXGA 4EACA 5DRCA 5HR6A 2ALRA 4HKPA 2WNWA 1GW9A 2QIWA 1SSGA 4H1ZA 3D47A 4IJBA 5BYWA 1BYDA 3BOLA 3NGJA 3UA3A 1HP5A 3PZVA 1KB3A 1E6RA 1IWBA 2QCHA 4MZ8A 1XSIA 2XWEA 1KGXA 3OLIA 4XUYA 1Q7QA 5EBUA 1ITUA 1EOKA 1I75A 3CHFA 3EPOA 3W1UA 4GINA 4P5UA 1UR2A 4LSBA 4DN1A 3ARSA 3FVDA 1K8ZA 1PUDA 2HS6A 5HPCA 1HJUA 1ZJAA 1FFQA 5D04C 4UTJA 1GZGA 2PTYA 5T91A 1NELA 2ZX7A 3E74A 2QDDA 4XBSA 1TV3A 2EG8A 3SW6A 4JTHA 3UWEA 2ZKMX 5DELA 1WDRA 5LIYX 1VLIA 3QMTA 1LLZA 1QPQA 2Y89A 3OVPA 4Q22A 2QGHA 1T5AA 3CQHA 3VUSA 4QJ5B 3KX6A 3JU2A 1K4GA 4IMFA 2XZ7A 3OG3A 2CZ5A 3C2FA 4H8UA 3ZJ6A 3VYLA 4QISA 1DPMA 4N6FA 4MUZA 4E0CA 1Q6QA 1K9FA 4K36A 2X1TA 3NO5A 4F66A 2BB0A 1WX0A 3THCA 2DEPA 1KXVA 4JFUA 3KBWA 1QO2A 4K7YA 7TAAA 1T8QA 3N3TA 3GWQA 2YA1A 3PBWA 1WXYA 5G4WA 4TTUA 5KINA 1KO0A 1F4AA 1KD0A 2J7CA 1IT8A 2J8GA 3QPYA 3SRFA 2PEVA 3T0TA 2C19A 2HBXA 3H24A 2ISVA 2NV9A 3CUXA 5CPSA 3UG5A 5HJYA 4A8LA 3SADA 3UJFA 4FS9A 3KBMA 2FLIA 4NYYA 3W84A 2CLFA 1XLEA 4B4FA 3VGEA 3BGJA 3DG6A 4Y90A 3HG3A 1TYGA 3NJ3A 2XH0A 3BH4A 3G2GA 2KX9A 3WK2A 2FZ8A 2OT0A 3LA4A 5EY5A 1NTHA 1Y5WA 4KWOA 1M7XA 4S3GA 3PZ9A 4JIEA 1SO4A 1NOFA 3L0NA 4JKMA 3H23A 1H5YA 6REQA 1E15A 2NUWA 4P7OA 4ZR8A 4FZIA 2C15A 1JZ4A 3HM7A 1RPKA 1ZP4A 3RLVA 5C8BB 1A5SA 1AH3A 4QR6A 3BZJA 3KCLA 2VDGA 3BV7A 3VMOA 3N6HA 1UR9A 3L66A 5J5RA 3Q65A 4DJEC 2VFHA 1KBJA 5LKYA 1DORA 1TIMA 2HMCA 3N34A 2OQLA 2Q8XA 4QE1A 5FEZA 4A8IA 1AW1A 4PR4A 3TQ0A 1L8PA 5ABGA 1ICSA 3L4TA 3U3HA 3WDHA 3BW3A 3GFXA 1MNSA 4IMDA 3K46A 4NXSA 1XC6A 3CZ8A 2QCEA 2P3ZA 3M4HA 1P0EA 1QW9A 3EX3A 3ATZA 5D9MA 3U9IA 4KRZA 1ME9A 6ENLA 4LBUA 3EOEA 4RZ4A 2OGJA 1FWGC 2ZE3A 3STFA 5KMYA 2J27A 3VGHA 2ZWZA 4BR1A 3V1PA 3E2SA 2ISSA 4O0QA 4MNLA 1CW2A 1LOSA 4O13A 3NQCA 2YA2A 3W1LA 1AW5A 1R85A 4GC3A 2JQXA 3FA5A 2PDXA 3BW4A 1UD4A 6XIAA 3H7VA 1X7IA 3B8DA 2VGFA 2HPIA 4LUTB 5AZ1A 3CEUA 1R3VA 1RVKA 3HQ1A 2YCLA 4V1XA 3VE9A 3WEZA 4JYDA 3VAVA 1DWHM 5A6LA 1W32A 3WD2A 3GYCA 2PA6A 3CQ0A 3DKJA 1SU5A 2G3IA 4C6LA 1QTWA 2VCAA 1XW8A 3WH7A 4ERGA 3RU8X 5IXEA 1Y0EA 1VAHA 2I14A 2YW4A 4Q8VA 3NZPA 3W23A 1TPB1 2YXXA 3FS2A 3M7SA 3PPFA 3HPZA 1I2OA 3LEPA 5DXXA 3H4XA 5DEZA 3LI1A 5H91A 1EWDA 1MO0A 1GVOA 1PEZA 3CIVA 2DFAA 2O56A 5I06A 3AZSA 4M0XA 3CMFA 2PDWA 4QM1A 3NOEA 3Q45A 2D0FA 2JALA 1E56A 1MFUA 1R2RA 2O4QA 3VNYA 1XBXA 1P5BA 3PZMA 4Q7BA 1V6TA 3R13A 4M51A 4DEFA 2CLIA 4C7FA 4ZGYA 1A47A 2VEKA 2Z1BA 3KTXA 5LIXX 2WJEA 4U28A 1V02E 4L4OA