3G3DA

Crystal structure of human orotidine 5'-monophosphate decarboxylase covalently modified by 5-fluoro-6-azido-ump
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
256
structure length
256
Chain Sequence
b'ELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine 5'-monophosphate synthase
molecule tags Lyase
source organism Homo sapiens
publication title Structure-activity relationships of orotidine-5'-monophosphate decarboxylase inhibitors as anticancer agents.
pubmed doi rcsb
total genus 95
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2009-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3g3dA00
2HS6A 3UWQA 1IIHA 2E6YA 3GVGA 3LTPA 3ZWTA 2AGKA 1H7PA 1PIIA 1ADOA 1LOQA 3DENA 1OJXA 1OYAA 1ONRA 4MZ8A 3P7YA 4AMAA 1JJKA 2A0NA 4DF0A 1W0MA 4BWLA 1RV8A 3CLMA 4LV4A 5IM51 5D2YA 4ADTA 4WOZA 3WJYA 4JICA 1JUKA 3LCFA 1G7UA 1ZNNA 2YFOA 4CCDA 3S5ZA 3QH2A 3LLFA 1Y0EA 1I2QA 2QCGA 4FX7A 1WBHA 1TYGA 3P82A 5DXXA 3G22A 4JN6A 3LBCA 1YTEA 4OBTA 5D33A 4AWSA 4LUJA 1DJNA 1KFCA 1AW1A 3SY5A 3E9AA 3LRLA 5K7JA 4N9EA 4CNPA 1FWWA 1WBJA 3E12A 2EGZA 1B9BA 2JGYA 4HIBA 3QMTA 3I68A 2RHGA 3NL6A 6TIMA 4CQ8A 4NNBA 1YDOA 3DI1A 2NWSA 1WX0A 1Z48A 3BG3A 4PH6A 5LNVA 1FY6A 3Q2DA 4GJ1A 4O1CA 2YDAA 1OFOA 3QQ0A 1JUEA 3S1WA 2JKPA 2OMAA 5G4WA 1R46A 4AVFA 1LRQA 3W7CA 2ZTJA 4WX2A 3O1NA 1KM0A 2A6NA 3E49A 2D73A 2FQIA 5AHNA 4LRSA 1M7OA 3DGRA 1EIXA 2P1FA 2J9ZA 1MEIA 4O1AA 1FWRA 2PRMA 1K8YA 3UWYA 1ZAJA 5F2LA 2GVLA 2ZZ5A 2NXHA 5HWJA 1OVDA 1VYSX 5I3GA 3VI2A 3KVMA 5D37A 4UUIA 2A7PA 1VPXA 3FLUA 2QCHA 3KHJA 3WFAA 2NX9A 4JIPA 3UD6A 3U2OA 1KFBA 3M5VA 4KFPA 4BFAA 5AYZA 2JK2A 2RDTA 4HT3A 3UPBA 4MLRA 1S5WA 1W8SA 1I2RA 3O8AA 4LTSA 1W5QA 1KFEA 1SZEA 3PUEA 1H1YA 2NX3A 1LLWA 3NG3A 3FS2A 1YPFA 5EA9A 2FPVA 4HNVA 1TPC1 4TMBA 3QRHA 3OG3A 4JTTA 3W7EA 4XQ6A 4CNOA 3TK7A 1LLZA 2GQ8A 2DP3A 3NL3A 4O1BA 4OU1A 5L9FA 4WUIA 4G1KA 4K6AA 5KZEA 4RZ6A 2DU2A 4UTWA 5DBUA 4IWWA 1RPXA 3TC6A 5G2HA 2WSQA 5C5YA 5U4NA 2QUTA 5U7SA 3EB2A 5A8GA 4PCFA 3S1VA 3MI2A 3GIYA 1F76A 5HUPA 3G0SA 3HQ1A 5BRBA 4ADUA 3T78A 3FJLA 3W2JA 1ZCOA 3DFTA 2NUWA 5CPLA 2TSYA 3I7RA 3W7PA 4R7JA 3S8HA 2DZXA 4PA8A 2X1RA 2Z6JA 4JXCA 3DFOA 1Z44A 3ATZA 4FNTA 3PF3A 3P5ZA 1PVNA 1K7EA 1D9EA 3TMQA 2YW4A 3KAOA 4LVDA 1DQWA 5F4WA 4RLIA 2BXVA 3NO5A 5AYXA 3QPYA 2Y70A 1TPUA 1PCWA 1N55A 3PSVA 1LBMA 1O60A 4UFMA 1XM3A 3TSMA 1XKYA 3O16A 3EX4A 1TB3A 1F6PA 4DO6A 2ZZ4A 1TV7A 1OF6A 1H1ZA 3JR2A 1SO3A 3GNDA 2FTPA 3GNNA 4AWUA 1D3GA 5J5RA 3M44A 3NDOA 1K02A 1HO1A 3LHZA 3ZFHA 2BWGA 1L6SA 1S5VA 2ZRYA 4JTJA 4NJIA 5DELA 2V2CA 1FDJA 2ZZ1A 4WOQA 5DLCA 2EKCA 3LERA 3EXTA 1W1ZA 3M43A 1TRDA 2J6XA 5TBOA 4C1KA 4KWVA 4H6KA 2EHHA 2Q8LA 2VFFA 1Q6OA 4UFLA 2NV2A 1BKSA 3LHYA 4MIMA 1TPVA 2QCDA 4LVFA 2EPHA 4Z0SA 1TQJA 4Z1BA 3ELFA 4A3UA 3W07A 2CLIA 4LNYA 1P0KA 2DJLA 1SZNA 3DZ1A 2G96A 3TAOA 5F1VA 1JCJA 4TX9A 4BK9A 1IXNA 1UUOA 4DPPA 1D3HA 2ABBA 4IPJA 2QJGA 4QJ1A 1CI1A 1QDSA 1RQHA 4ZQMA 1THFD 2O7SA 1V5XA 3IIVA 3A5FA 3P60A 4NU7A 4QSHA 1ZAIA 3S9YA 1JQVA 4NX5A 4JDYA 1YTKA 2RDUA 3W7QA 4O16A 1VCVA 5KINA 2DZPA 4PTNA 1H63A 3QSTA 1JUBA 3CHVA 4AF0B 1TMHA 1HG3A 1OABA 4MY1A 4JDBA 1FCBA 3P62A 4EF8A 1WYIA 3GXTA 2F84A 1MO0A 2OT0A 1SPQA 1GT8A 3OVRA 4MJMA 3VFLA 3ATYA 4LWWA 3SJ3A 2PRHA 1LBLA 3ANYA 3BPWA 2ZQ0A 3HB9A 4UFHA 3DHFA 3USBA 1IIGA 3R13A 5EBUA 2FIQA 2VFIA 3DKJA 1SZGA 3NM3A 3DI0A 4FHAA 3W1TA 3NPUA 3F4WA 3VNDA 3P8IA 2WNNA 1KTBA 1IXQA 1TV5A 1DORA 2ZA3A 2J9YA 3C2OA 4PFMA 4LS2A 3N3MA 5FF4A 1VH7A 1VZWA 3MYOA 5D30A 3DFQA 4K7YA 1HO4A 3ABOA 5E1QA 4N6FA 1R30A 2IQTA 4JNMA 1HUVA 3U8GA 5FF2A 3N14A 4N4PA 1QWGA 2AQWA 4O15A 4YXGA 5G5IA 2BLEA 1JRCA 2OJPA 3VKJA 2ZA2A 2V82A 3A24A 4Y6GA 3TA6A 4A21A 3M7WA 1F74A 3NA8A 3NQ8A 3HOJA 3TUUA 1XUZA 3NPVA 5EKYA 2E09A 3PSWA 2ZRXA 3A9IA 3MHGA 5L6UA 3EWUA 3UZ5A 1VCFA 3SR7A 2PURA 4IMCA 4ALDA 4AHQA 2C19A 1UUMA 1JVNA 4JTEA 2GPTA 3FA5A 2Y89A 4R33A 3C8FA 1DQXA 2PRLA 3L5AA 1W3IA 3R12A 4Q32A 5I3HA 1OG0A 4JTGA 2JKAA 4NNCA 2CZFA 3S5YA 5K4ZA 1OFBA 5C54A 3IIPA 4QNEA 4UTUA 3QZEA 5AC8A 2WKJA 4KWWA 4OT7A 4BWLC 3UWVA 5CPMA 1KLYA 2A6LA 3FKRA 2B4GA 3CC1A 1WOAA 3M1ZA 2QCMA 4FNUA 3KX6A 3FFSA 1TJRA 4Z1DA 3RNDA 2RKXA 3KXQA 3PVFA 4MUZA 4GWEA 3P5YA 5CGQA 2GUUA 1QPRA 4IMGA 4YL2A 4GRSA 1XDLA 4HKPA 4QIUA 3I65A 4N9BA 1BEUA 1W37A 1W5OA 5G4EA 2CLEA 2E5BA 3CT7A 4FNSA 3QYQA 3IRDA 2EAWA 3BLEA 1K7XA 1OFEA 2H8XA 3F03K 3W85A 3JS3A 4WJEA 3MP5A 1JULA 1KW1A 3CTLA 1GEQA 1Q6QA 3IV3A 3NPXA 3S1XA 4DF2A 4GFSA 2AAMA 4EOUA 3EXRA 1GVFA 3C2RA 4OE7A 1P1XA 2ZRWA 1EPXA 3N34A 2A5HA 3UZJA 3HF3A 3M5XA 5EMUA 3P67A 3GKAA 4K39A 4WXZA 3GYEA 3RU6A 3DXIA 1QNVA 1TPWA 3R5EA 3W7HA 2E5DA 3W23A 3R89A 2I1OA 1QPQA 4RXGA 2W6RA 3S5NA 4CQ9A 2YZRA 1K8XA 2Q3RA 1LP6A 1G4EA 2XFWA 4UNKA 1WXJA 3MBFA 2X1UA 3TJXA 3WJZA 1YXCA 2QJHA 1PCKA 4ZL1A 2VFGA 3LBMA 3KFTA 4ONVA 3R8RA 3INPA 2QEZA 1TIMA 1QOQA 1ZJIA 4M6QA 2NLIA 3PB2A 2C13A 2WOQA 3N73A 2VC6A 3NQFA 4IMDA 4O10A 5HR7A 1R47A 1YPIA 3EWXA 1XBXA 2YXGA 3DFSA 4LVBA 1KM5A 4TMCA 4IX0A 3KOFA 1TPFA 1E51A 1A5SA 2XN2A 3IEBA 1ME9A 1XUUA 1YDNA 1C9DA 4U28A 3VCRA 3UXDA 3VE9A 4DO4A 3PG8A 4EF9A 1W56A 4RKAA 1EUAA 1GWJA 1ZENA 3KVLA 4JYFA 1K7FA 3RLVA 2XN1A 4DO5A 2ALDA 5FEPA 2X1SA 1RQBA 2DZSA 3Q58A 1WAUA 4RXFA 1QPNA 3MP3A 1T96A 2Q8ZA 2DJXA 2V2DA 3LXCA 4DEFA 3SGZA 4N4QA 4D2JA 3QQ1A 1VS1A 3G1FA 1EEPA 2YCEA 4AXKA 1EB3A 2DZTA 1SW7A 5DXYA 3N2XA 1OF8A 3QSRA 3TXZA 2J9XA 2VXNA 4UFKA 5AN7A 2ZYFA 3W1AA 1GYNA 5LNSA 4AEOA 2ZA1A 3W71A 1PHWA 1AW2A 5BNKA 3W88A 1QFEA 4FX6M 3E02A 3EX3A 4IMEA 1XFBA 3HIJA 3MW7A 3LHTA 3THQA 4HNNA 1IXOA 4R53A 3OA3A 3TQ0A 1FCQA 1H60A 3G18A 2WPBA 4OHQA 4NJJA 5FEZA 3ZS4A 5AB3A 4LT9A 3RFAA 2ATMA 1TPB1 3G0UA 3TR2A 1IGSA 1UJPA 2PC4A 2V2HA 1TV8A 2B0MA 1XL9A 3CB8A 3QJAA 2QKFA 4ZQPA 4FNRA 5LNRA 1H7RA 4MYAA 3Q94A 4JX4A 3N19B 5D02A 4GBUA 4HNUA 2J27A 2C18A 1SR9A 2G5WA 1YYAA 1G4PA 4CCEA 3LTYA 2QF7A 1MEWA 2NXIA 1X1OA 4GUFA 3NQAA 3DKLA 2RH9A 3L66A 1OYCA 1O95A 3LCGA 4GUGA 5F4XA 3G1DA 4Y9AA 1RZMA 4E2BA 1H7NA 4QISA 1MSSA 1O4UA 3DHDA 4UTKA 4MY8A 1XC4A 3QF0A 1M7PA 4JTSA 1GVRA 3M5YA 1ICPA 4LRTA 2ZZ6A 4PL2A 3A22A 3EWYA 3B8DA 1TO3A 4IJBA 4XBSA 1DL3A 1T0OA 1G69A 1WOBA 1Z41A 1A50A 4ICNA 3L0GA 3C2EA 3HPZA 5D2VA 2F7FA 1EP2A 5F2MA 4M6PA 5G1TA 1VLIA 5AYYA 1Q45A 3W70A 3W7NA 1X7FA 1YXYA 3W73A 5GVJA 1AL8A 4JGDA 3NPWA 4LUIA 3MHUA 4OQVA 1W3TA 2OT1A 4JTKA 1FWNA 5CZTA 1LROA 5AHLA 2WNQA 3DBPA 3W2KA 3UPWA 5K9DA 2V30A 1OX4B 1SQ7A 1LORA 1VRDA 3G0XA 1EP3A 1NAL1 4TIMA 4XKYA 1X8FA 2OX1A 5C55A 3G8EA 4JEQA 1KM6A 2C6QA 3LI1A 5K9CA 3G1SA 3O07A 4K36A 4O54A 1GG0A 3MJYA 2RFGA 1WDWA 5F2GA 5G2IA 3GKFA 1JRBA 1XI3A 4GXMA 4ZZ9A 1KTCA 3LHUA 1KM4A 3R2GA 1FWTA 2CLFA 4LW7A 3TQVA 2VFEA 3CM4A 4POCA 3GDLA 4UMCA 2H3DA 3QPZA 3TC7A 3EKLA 3L0KA 1EWEA 3NZRA 3NR0A 3C4UA 2J24A 3TW6A 3UY8A 2W0UA 1JCYA 1VJIA 1A5AA 2I14A 4NJGA 1XBZA 2ISSA 4O4WA 4K37A 3BV4A 1NF0A 1TTIA 2JGQA 1VYPX 2ZRVA 2YPIA 5J5DA 1ALDA 2VEIA 1KM2A 3IIZA 1K3UA 2CZDA 5LNWA 3NL5A 4UTMA 3MMTA 3B0PA 4IQLA 4O17A 5I3JA 5G1YA 3C52A 2NZLA 1M6JA 3STGA 1RQEA 1TTQA 3S42A 4H3DA 1OK4A 4YCOA 1LOSA 1X6UA 4K38A 3NAVA 3UY7A 4K8EA 3BG5A 1H7OA 3CIXA 4ADSA 3PBVA 3BLIA 3DH7A 4NJKA 4UTWC 1YTDA 1ICSA 3L5LA 3W87A 1J5TA 3EWZA 4O11A 1LYXA 5EY5A 3QFEA 4IMFA 3VE7A 4B5NA 1LCOA 1ICQA 1EA0A 2OZ0A 2NXGA 3NQDA 3EEGA 2DZVA 4K7VA 4NX0A 2W79A 1H62A 4DELA 3IIOA 3EWBX 4GNJA 4ZMGA 3PY2A 1U5JA 3AJXA 1F7BA 3BVJA 3QMRA 3M6YA 4HNTA 4RCXA 3LGEA 3C6CA 1HFBA 3W7DA 1TCDA 3FOKA 3DAQA 3S5OA 4EWND 2HSAA 5HINA 1XDMA 3PUOA 3ZWSA 3SI9A 4LY8A 2V5LA 1U83A 1NFBA 4Z08A 4GUIA 3TX9A 2A1YA 3MHFA 4XTIA 4ZQCA 5HQEA 3LCWA 6ALDA 1YXDA 2ZDRA 1SZFA 3SECA 5DN1A 2ZFAA 4IPIA 3GK0A 2QCDB 4LS0A 5DY2A 1FXQA 1LRNA 2BTMA 4UTJA 2C3ZA 4JYDA 4X9SA 1SW3A 3LLDA 8TIMA 4LVAA 4CLMA 3I6RA 3IVSA 2TMDA 3W2MA 3TW7A 1N7KA 1UBSA 1DOSA 3G8RA 1XCFA 4JS3A 3W7RA 3H54A 3W2NA 2WO5A 3UWZA 2V8ZA 4RZ4A 2P0OA 3TH6A 3TROA 1PV8A 2E6FA 2Y7GA 3DFPA 1TPDA 2CZ5A 4RV8A 1TPEA 4ORMA 4MOZA 4X2RA 4O1DA 4OGZA 5CSRA 4MZYA 3GB6A 4O53A 2QUVA 3BLFA 2E1DA 1QO5A 4ORIA 2R14A 1KTNA 1LRTA 1NF7A 4XKYB 1P4CA 4YMZA 2X30A 5T26A 3TXVA 3H55A 3STFA 3G1HA 2GVJA 1TPH1 2YGYA 3HPSA 3W7KA 3LOTA 1B3OA 3MYPA 1I4NA 1FX6A 3MBDA 1R2RA 2XN0A 1H61A 2YFNA 3T4CA 2DORA 1Z42A 2C14A 1TTPA 4MJZA 2WSRA 3NQ7A 1J2WA 2YYUA 2QAFA 3SSJA 3FYPA 3UXAA 5KITA 3LCXA 1RD5A 1GTHA 3W6YA 4Q4KA 3ABSA 2A85A 1WA3A 3L2IA 4FNPA 1FXPA 4UR7A 5AC6A 4A29A 4AAJA 4EIVA 3LM7A 3N9SA 3UWWA 4HPJA 4MFEA 4DXVA 2VKZG 2WSYA 3C2FA 2CLOA 3PUDA 3W1XA 5E93A 4DBDA 2ZRZA 4HPXA 1YDVA 3N2MA 5SWUA 2E6DA 2ZZ2A 3W1RA 2VEKA 1ME7A 1OYBA 5HWNA 4AWTA 4CQAA 1GVOA 4UC5A 1KFKA 1M5WA 3E0IA 2C1HA 4PL1A 4FB7A 1LOLA 4NJHA 5FF7A 2FDSA 4IX2A 4MKNA 4NQ1A 3KRSA 3STCA 3HBLA 3OVPA 1X1ZA 1PS9A 2H6RA 3EX6A 5HMSA 5KZMA 2O7QA 3TSDA 2ZBTA 2CWNA 5AOUA 1G7VA 1I2PA 4P2VA 1OFPA 2VEMA 3IVUA 1BWKA 4WY0A 3LB0A 1JCNA 4RR4A 4TR9A 5FEWA 2A7NA 3OEXA 4WQ6A 2WJZA 3UNDA 5FEXA 3CIWA 3B0VC 1FDZA 1W54A 1KFJA 4DPQA 5AHFA 3LV5A 1F05A 3NYZA 4PC8A 3W74A 3LI0A 1GQNA 3NQ6A 5H91A 3LX9A 3H53A 4R34A 1TJPA 3E96A 4BI7A 5C6MA 4U4MA 1BWLA 3HG5A 4N02A 3C0JA 2QCEA 4JY9A 4MFDA 3HGRA 3BK0A 4IXXA 1DBTA 1H5YA 1VLWA 4IOTA 1QO2A 3C3NA 2QCCA 1QMLA 3BARA 3W7JA 1HL2A 4UNLA 4MLJA 3YPIA 1OK6A 4GE8A 2HMCA 3G3DA 1KV5A 1XBVA 4E0CA 1JCXA 2B7QA 3P8JA 3W7LA 4JY8A 4O14A 2VENA 4FIQA 3RLUA 3W7IA 5LNUA 3EX1A 3TE9A 3G3MA 2YX0A 5LHFA 3FYOA 4N9CA 4S1FA 4UMAA 4KFOA 4Z1CA 4FF7A 1FQ0A 3PR2A 2NX1A 2Q3OA 2ATSA 1F73A 4AHPA 4QAIA 3MP4A 2Y61A 1TSIA 4LU0A 4FEZA 5I3IA 3W1LA 4MYXA 2VELA 1WV2A 1SUXA 4UTIA 3C61A 3FJ6A 4M7TA 3T7VA 3V1PA 4QITA 1RVGA 1FWSA 4WZHA 4L4LA 4I9AA 3WK1A 3HG2A 5D04C 4QM1A 3GAKA 5FI8A 3W1PA 5LGZA 2H90A 2BX7A 1P0NA 2VEPA 5TQLA 1KBJA 3NZ1A 4QNWA 3K30A 1GVSA 2X1TA 4PODA 4XBKA 4O19A 4WY0B 1H51A 2QJIA 1A53A 4ZVJA 2QCLA 3CEPA 1OFQA 4UFJA 4H4IA 1KFLA 1TTJA 4YLWA 3OIXA 5TIMA 4ZQOA 3HMJG 4JX6A 3NXFA 1AK5A 1Q6RA 5LHEA 2FPTA 4BF9A 5D09A 3I7SA 3G1XA 3FEMA 4A2SA 2Y63A 4OWGA 3M9YA 2WNZA 4NNAA 1SSDA 1DJQA 4FIRA 3M41A 3BW3A 2QDGA 1PL9A 3IGXA 3THAA 2Y88A 3S6DA 2FFCA 3HPXA 5D2WA 1JCMP 1JR1A 2E5CA 4RX0A 1JQXA 3HGJA 5I3KA 2H3BA 3W3OA 1YLVA 2HTMA 1GTEA 1SFLA 3A5VA 5CSSA 3NQVA 1NVMA 1O94A 2BZNA 3TU9A 3NQGA 4MVAA 4E2DA 3P74A 4ML9A 1UCWA 3LRMA 1R2SA 5CKSA 3V75A 1FDYA 2JKEA 3ABQA 3W72A 4NZFA 5F1UA 3NQMA 5LSMA 5AFDA 2GQ9A 5LKYA 3GR7A 3TKFA 1G67A 4UTTC 3EXSA 4LC6A 5D38A 4N2YA 3GDRA 3M16A 2YSWA 3UWUA 3S1UA 1FUYA 1LZOA 2NWRA 2VFHA 3PBWA 1L6WA 5EL1A 2V9DA 3NVTA 4TO8A 1ZY9A 4UTHA 2ZZ3A 3IGSA 3NEVA 1DV7A 3TFXA 4I7UA 3U6WA 3MWAA 2H8ZA 2UV8G 4M7SA 5K4XA 1ML1A 1OFDA 1SO5A 3EKZA 3BO9A 3TV8A 1GOXA 4WXYA 3W1UA 1HTIA 5HNRA 2B7PA 4O18A 1A5BA 4I7VA 4MY9A 1L6YA 3N9RA 3NQCA 3P80A 2TYSA 1GZGA 4LOCA 5CPNA 3TNOA 3W1MA 3NL2A 5ABTA 1TRIA 3CWOX 1XBYA 1FBAA 5BOOA 1I45A 2HS8A 2CLMA 3L0NA 4K8HA 3RF9A 1NEYA 5KSWA 3WK3A 2CLKA 4NUWA 3W22A 1B4EA 5LGXA 3PS7A 2GJLA 1P5BA 1S3HA 3B03A 1W5MA 1AL7A 1W5NA 3O6DA 4O50A 2GQAA 4WY0F 2E77A 3AO0A 2FB2A 4JTIA 2YW3A 2ABAA 2A7RA 1MZHA 1QOPA 1B4KA 4LS1A 1T8XA 3HGSA 3BW4A 5IBXC 4N6EA 1NSJA 2Y62A 2X16A 3G1VA 4JIQA 1F2JA 2FB3A 5CPOA 2Y7FA 2R94A 4RK8A 3HG3A 3TDFA 2Y85A 4BI5A 3LTSA 4ZQNA 1W5PA 1PE1A 1G4SA 3IGUA 1SO6A 2CLHA 1N8FA 2WQPA 3O6YX 3W1NA 1DKWA 5KZDA 2QCFA 3F1QA 1I2OA 4GC4A 2QCNA 1VCGA 2Y7EA 1C8VA 4KFNA 4XWUA 4M6VA 1L9WA 3UQNA 3W76A 2B7OA 1MXSA 1VR6A 4L4MA 3L5MA 3TAKA 5LZLA 4XTDA 1IXPA 3M47A 4CNNA 4JR5A 2DZWA 3W1QA 3LXBA 2ZCGA 4HSOA 5H2ZA 4A2RA 3DFNA 3TCEA 5A5WA 3L68A 3IIXA 5CZ0A 3D0CA 1V7YA 4Y96A 3RK8A 1R2TA 2Z0IA 3W2UA 3QEZA 5AHMA 4O13A 5CZJA 1VHNA 2X2GA 3SW6A 1TREA 3LDVA 3QW3A 1G4TA 3C56A 1KM3A 3Q37A 1LBFA 1Q3NA 3P81A 4UTLA 5DCEA 2QR6A 1I2NA 1XXXA 3CU2A 3LHWA 2V5BA 3BW2A 4FX8A 5D32A 1LDCA 5BMXA 4O4VA 4GUJA 4FO4A 4QQ3A 3ABRA 2PCQA 3B06A 4DBEA 1AG1O 4X3ZA 4RZ5A 1TQXA 3NOEA 3W7OA 1CW2A 2QUUA 3W84A 4NXSA 2C0AA 5KMYA 4NZJA 3WJWA 5DY3A 3P84A 4IUOA 3B0UX 3HG4A 3SZ8A 3T40A 3I7QA 2TPSA 4O57A 3F4NA 2BSLA 2E6AA 3KVKA 2TRSA 2A4AA 2GJNA 4UTTA 1GG1A 1EP1A 1H7WA 1SU5A 4FXRA 5DCDA 2CLLA 3LCLA 5CG7A 3B05A 4CCCA 4JTLA 2NUXA 2A2IA 4TU1A 4Z0JA 4X22A 4RJEA 2V81A 3W9ZA 3O05A 4YCPA 3UYCA 4AB4A 3GLCA 3GDMA 3B04A 3KVJA 5CZSA 1DHPA 3KRZA 4HSNA 3A21A 5FF3A 3G1YA 3PAJA 5D2XA 1KV8A 3BGJA 3TSBA 4KKXA 2G97A 3IVTA 3MUXA 1O5XA 1S5TA 3LRKA 5BW6A 3O06A 1Q6LA 1VYRA 2Z2UA 1OX6A 2J88A 1KA9F 4O8RA 1AMKA 3O15A 3WJXA 3S0CA 3HJZA 2LLEA 7TIMA 5HUOA 1EUNA 4BR1A 1UASA 1LTDA 4UXDA 2JBMA 4JD4A 4Q33A 3QMSA 1QR7A 2Z1BA 4UCGA 1DVJA 1B57A 1OX4A 4NT0A 5DBTA 1W3NA 4XZ9A 3BG9A 3QM3A 2QDHA 2EF9A 3O6CA 3HO8A 3GDTA 1WQ5A 3OHIA 3W86A 3TFCA 4E38A 5DCBA 5AC7A 1GJPA 1QAPA 1VQTA 1W31A 3PWAA 3GXPA 4O12A 5F4SA 4JTUA 4M19A 1K03A 1ZFJA 3GR8A 1K8ZA 4IXHA 1F6KA 4O0ZA 4ZQRA 4OV4A 4AF0A 4DQWA 2R8WA 1T99A 3TIMA 1KM1A 4M5PA 3W83A 3NGJA 4LC8A 1PHQA 2B7NA 4LV9A 3T44A 1GPWA 1C29A 4OV9A 3QW4B 4JTHA 5EYWA 5F2IA 3SFKA 3O63A 2VFDA 3EX2A 3NQEA 3WK2A 1QPOA 3EWWA 2ISWA 5IBXA 1IF2A 1J4EA 5HR6A 5FESA 2VOMA 3TJLA 2CU0A 5G2WA 4GUHA 3C2VA 1EWDA 4EVZA 5K2ZA 4AHOA 5HULA 2DZUA 1MEHA 1SW0A 4O28A 4YWIA 3NNTA 3MI6A 1FCVA 2I9EA 1VGAA 2Z6IA 3ZR4A 3P61A 2CFFA 5FF0A 3LCIA 5K9XA 2C15A 5AHIA 5C2XA 1RR2A 3BGGA 3NM1A 3LHVA 5HJLA 1GYLA 2QAPA 1VC4A 4W9TA 4O52A 4C1LA 2KZHA 5KTLA 4S2BA 1UB3A 4FNQA 4I7WA 3TQKA 3KRUA 4LVGA 4NXKA 5D2TA 3CPRA 5AHEA 2RDWA 3LXAA 3CEUA 1OFRA 4A22A 3GDKA 2OCZA 4NVTA 3WK0A 3GX9A 1H7XA 3GXNA 1KBIA 1G6CA 3PC0A 5E0KA 1ZHAA 1EX5A 3JRKA 4JX5A 3W2LA 1GVQA 2CZEA 1YADA 2ZZ7A 1F5ZA 2CW6A 3A23A 2ZTKA 3QC3A 3L9CA 2E68A 3B4UA 3PULA 3W7GA 2FLIA 3CQ0A 3NQ2A 3FKKA 4JYEA 3LCHA 4O0KA 1O5KA 4DF1A 3MO7A 2WV8A 4Z1AA 4BI6A 2GOUA 4UR8A 4AH7A 2NV1A 3WJSA 3W75A 3L21A 3OVQA 5EPDA 5D03A 3PM6A 3DU0A 4MZ1A 3L67A 3LV6A 4HHPA 4S2CA 1H50A 1I8JA 4UIOA 1L2UA 3W7MA 3TMLA 1SO4A 3MI3A 3OBKA 3G24A 3GZ3A 3G1AA 2Y6ZA 2G95A 4UFIA 1SSGA 4Y90A 3HGOA 1AW5A 5D05A 4FXSA 4PEKA 3PBYA 2P10A 4N9DA 3L65A 5BMWA 3PG9A 4UMBA 4JTFA 1BTMA 4Y8FA 3M0ZA 4XUGA 4HN4A 2V0TA 1ME8A 1ZALA 3RMJA 2ISVA 1A5CA 2NUYA 5K3VA 2PE4A 3FIGA 1OX5A 4MPQA 3PB0A 4IGHA 5MHBA 3GAYA 2FPYA 3PBUA 3STEA 1CX9A 2YYTA 1ZAHA 2R91A 1OHLA 1KLZA 3SIZA 1FCUA 3M5ZA 3CWNA 1LM1A 2A21A 2C16A 5HWMA 3SGUA 1JCLA 2YR1A 1OFAA 2FJKA 2ZRUA 2Y7DA 4P61A 1QCWA 1SFJA 4J9JA 3T55A 2GVGA 5I3FA 4WD0A 1VHCA
chains in the Genus database with same CATH superfamily
5M5DA 2ZADA 1LOQA 3DENA 1OJXA 2BY0A 3WBYA 1XV8A 1ONRA 3FW6A 4JN7A 4PSPA 4AMAA 2BY2A 2PP0A 2A0NA 3WQPA 4FLRA 5A8NA 3SRHA 2PWEA 9XIMA 2EXOA 1UKSA 5IM51 1B2YA 4WOZA 3VNIA 3WJYA 1JUKA 5BXTA 2YDRA 4GLEA 2VRKA 1DJWA 4AQLA 1Y0EA 4FX7A 4PCSA 1TYGA 3P82A 5DXXA 5DMLA 4S38A 4I8DA 4W84A 5D33A 1UR2A 3E9AA 1RCXB 4HTBA 2DDXA 3QV7A 5GQBA 4HIBA 5FOOA 4J3SA 3I68A 1AD1A 4E4FA 3DI1A 2NWSA 3RM4A 1K6AA 1VKFA 3MC5A 4W7VA 5LNVA 1FY6A 4GJ1A 3S1WA 3TN3A 1TVNA 2OMAA 4AVFA 1LRQA 1WNOA 2ZTJA 1GK8A 2EBNA 3VNZA 1KM0A 3RMEA 4LRSA 4ENLA 4UQ9A 3OBAA 1MEIA 4ZFMA 2PRMA 4E8GA 2YA2A 5DT5A 1C9WA 3BAYA 1VFSA 2NXHA 4M80A 5HWJA 1CXKA 3VD3A 4HMDA 4IJRA 1ISWA 1TWIA 1VPXA 2A7PA 1X7IA 3G5EA 4JKLA 1YIXA 3NEHA 4JIPA 3FY1A 1T5AA 4DJDA 1KFBA 4KFPA 1HW6A 2Q09A 4BFAA 5AYZA 1A4MA 2RDTA 3PFRA 3IUDA 1W8SA 3GVQA 3PBGA 4IP5A 3REQB 4XSLA 2EPNA 2BHUA 2IKIA 4PTMA 3QV6A 3AYVA 3LENA 3MUAA 5CH9A 2D22A 3FS2A 4QS6A 5EA9A 1JZ4A 3QRHA 3OG3A 1E3ZA 1JDDA 1XYZA 4JTTA 4AD5A 3W7EA 4PRRA 3P93A 1QHZA 3AROA 2ZC8A 3GU1A 4JQAA 2IPJA 3APGA 4O1BA 2YDQA 4B16A 3WLRA 4K6AA 5IRPA 1EJUC 4GISA 4IWWA 5G2HA 4DUOA 5D9NA 1R9YA 5EMLA 2E0PA 3GU9A 2CKRA 3R0DA 2XIJA 3S2NA 1HKWA 2W4XA 1WZMA 3FJLA 3W2JA 2DZBA 2DUAA 3DFTA 1UOKA 2OKOA 2NQJA 1UIPA 3MWCA 3FXGA 3I7RA 4PA8A 4DBUA 2X1RA 4Q4MA 3FAXA 1F4AA 3B97A 2VZUA 3ICJA 1JGMA 1UR9A 2G41A 4R3UA 3PF3A 1A47A 4TVCA 1GYMA 5IXEA 2Y70A 1TPUA 5DANA 1JL8A 1J9YA 4AYGA 1LBMA 1RD6A 1O60A 2ICSA 4J3WA 1CGYA 2PDGA 3O16A 3EX4A 2VZVA 1TB3A 3GBEA 1EDTA 4DO6A 4DAFA 1TV7A 1KRMA 2QIIA 1U5VA 1OF6A 2CESA 3U4AA 3KP0A 3RU8X 3GNDA 3SGGA 1YBQA 3WDJA 3MB9A 3NDOA 1K02A 3LHZA 3ZFHA 4F48A 4S3BA 3K8KA 1R3RA 1A3HA 3VMNA 1R3TA 1JNDA 4D6HA 2EKCA 3D6NA 3K8MA 5TF0A 3M43A 2J6XA 3VIFA 2EO7A 4KWVA 2EHHA 5C71A 1EJXC 1HJXA 2Q8LA 2VFFA 2NV2A 2DPEA 3EMQA 4LX4A 1Q6EA 4KEUA 4R27A 1GUVA 4MIMA 1TPVA 2VR5A 1US3A 2YCLA 3MKCA 4Z0SA 1IEVA 1S46A 4LNYA 2IQDA 1R86A 3QTGA 5F1VA 1IXNA 4GY7A 2ABBA 3E2SA 3CQHA 2O7SA 3P60A 3A5FA 1ZAIA 1XSKA 3N2TA 1JQVA 3AS1A 5D9OA 3VKAA 3A4WA 3L2LA 2RDUA 3W7QA 4IP7A 3OQEA 3VK5A 3ALFA 1TE1A 2KX9A 3TTOA 4WDTA 4DJDC 1PX3A 4NHVA 4C7GA 4MY1A 4G9PA 3P62A 1WYIA 1VFFA 3TNBA 1SPQA 3OVRA 2Z29A 3SJ3A 2E9LA 1MQRA 1LBLA 3BPWA 2ZQ0A 1NU5A 4A6GA 2BXZA 2PF8A 3DHFA 4L1XA 2XIMA 1IIGA 5EBUA 2FIQA 4L9YA 1BSLA 5F7UA 2YBTA 2PP1A 1NWTA 9RUBA 4FHAA 3W1TA 3NPUA 3P8IA 1TV5A 5M1TA 2H9AB 4S3KA 4DZIA 2IXUA 4KS0A 3KOYA 2J9YA 4R7OA 4Y9MA 2QVHA 4LCSA 2VVSA 1PDZA 3W28A 5IOBA 5E1QA 2PLKA 3U8GA 1GKQA 5CXPA 4ZB2A 4CU6A 1B3WA 3A9BA 1O1ZA 4GVHA 5G5IA 3JUGA 4ACZB 3MSRA 3VKJA 3CIVA 3TUUA 3HOJA 3ARTA 5EKYA 3WUGA 1DTUA 3PSWA 2ZRXA 3UZ5A 3TONA 3WQWA 2Q02A 2Y8KA 3N04A 3C8FA 5JBFA 2PRLA 3R12A 3GRIA 4Q32A 3H6OA 5I3HA 4D8ZA 4OJYA 1FKXA 2SFPA 2GGHA 4JTGA 1TR9A 3GVRA 3D3AA 3IIPA 4QNEA 4LAZA 1DHKA 2WKJA 4KWWA 1FKWA 4LPCA 1VBHA 3FKRA 3WN6A 5PTDA 3M1ZA 5LA2A 2OG9A 1TJRA 4Z1DA 3ANUA 4GRSA 1XDLA 4XAFA 3I65A 4N9BA 1J0IA 4ZXLA 5CPSA 3G1RA 2GJXA 2E9MA 1B9ZA 3HJEA 3SN4A 3CT7A 4CGTA 3QYQA 3WMLA 3IRDA 2P5NA 3CK5A 3W85A 3CZJA 3JS3A 1W1YA 2V69A 3L4ZA 1JULA 3A6OA 1EGVA 3PPHA 3MUIA 3W37A 3PZUA 1NQ6A 4AIUA 3WLPA 4NYUA 4EOUA 1BYAA 4F0MA 4HPNA 1W1B1 3WQFA 3ITOA 4ZOAA 3GKAA 3GYEA 4GOAA 3DXIA 1QNVA 1TPWA 4IGMA 5EGRA 2I1OA 3QGAC 3CHDA 4DHGA 4R9XA 4Q8VA 3S5NA 1LP6A 2BGQA 4UNKA 3SEPA 4XAZA 4S3DA 1YXCA 3KOWA 1PCKA 4MWAA 4GFIA 3RAOA 4ONVA 3R8RA 2QHAA 5HA7A 2BOEX 1ZJIA 1KXQA 4OECA 2XWDA 3M07A 3WLLA 1P43A 3VGDA 3BMXA 1S3TC 2VC6A 1EO5A 3RO6A 1IYXA 4LVBA 4F79A 1R0MA 2VX5A 3P3BA 1E51A 1A5SA 2XN2A 4GBDA 3SY8A 3KZPA 5FL1A 1YDNA 3VCRA 3UXDA 4DZAA 1E71M 4XX6A 1RLDA 1GWJA 1AZ1A 1W8GA 1ZENA 2ALDA 2X1SA 4L4PA 4REQA 4YHGA 1CBGA 2G4JA 5CSYA 3DFHA 4RXFA 4DJFC 1T96A 1H49A 2DJXA 3LXCA 3URBA 2VC9A 2PAJA 3QQ1A 1EB3A 3QOKA 4JN8A 3AMCA 4HSHA 1OF8A 3ZT6A 3GIPA 4PSRA 4UFKA 1VBUA 5AN7A 1GYNA 4US5D 2NT1A 4DAIA 1QNSA 1UWAA 4HA4A 1O5RA 2XISA 4G56A 1VBGA 3W88A 5BNKA 3E02A 3IANA 4D1JA 3HIJA 3MW7A 1YQ2A 1IXOA 2VX4A 4DZ5A 1FCQA 2BASA 1V0KA 2XPKA 2ZUNA 4KRUA 4XZMX 3VU2A 4HVXA 1MW2A 1IZKA 1TV8A 1XL9A 2PDCA 1H7RA 3T05A 1V8EA 4JX4A 4YU1A 1XWYA 4E4UA 1O5QA 1UQYA 2WBKA 3U3HA 1YYAA 3W0KA 1G4PA 2IS7A 2QF7A 3ARUA 3G6MA 1X1OA 3I4EA 3KBSA 1SJBA 2OKTA 1EX1A 3OYXA 2RH9A 3BJTA 3PZVA 4GUGA 4H9ZA 4FXFA 3G1DA 1VFOA 3AICA 4E2BA 2PGEA 4IUGA 2FGLA 1O4UA 1XC4A 2YCJA 3VOGA 4JTSA 1ZTVA 1XICA 2ZZ6A 4PL2A 2GZXA 3EWYA 3C0QA 1OY0A 1Z8AA 3NGFA 3ALGA 3N3TA 1DL3A 1T0OA 1G69A 1HGYA 1Z41A 3VIMA 3UCDA 4ICNA 2GJRA 3S9IA 3UWEA 5I06A 1EP2A 1RY8A 2V5CA 4M6PA 1TZ7A 1VLIA 3CMFA 3W7NA 3VIHA 2PDJA 4V1XA 3GXMA 1GOMA 4Y7EA 4OQVA 2JEQA 5I03A 3H7VA 1TZ9A 2PZNA 3DBPA 1EZWA 4CEUC 4Q4QA 3G0XA 4LAKA 4DWDA 5D8WA 4JEQA 3VD7A 2ODOA 3VILA 2PTDA 4AY7A 3O07A 3GTNA 1KNWA 4O54A 1V03A 2W66A 1Q13A 3PJTA 4HU3A 3WL1A 5BWAA 6ENLA 2BGNE 5JH1A 1JRBA 2A79A 3RPDA 5FAGA 1HIZA 2V3FA 4PMOA 3LHUA 5H6HA 4KMQA 1FWTA 2CLFA 2WHKA 3CM4A 1AA1B 2VYOA 4POCA 4UMCA 2PWDA 3QPZA 3TC7A 3NUKA 3EKLA 1R7OA 3WQ4A 1KD0A 4Q4PA 2GSEA 5CBJA 1GW1A 1OT2A 3GTXA 4O4WA 4OBRA 1Q7QA 2WSKA 4W5UA 2ZRVA 2BY3A 3T09A 3MSGA 1VPQA 2EJAA 2VEIA 4AZ7A 5LNWA 3N1AA 1IQ8A 4O17A 3ITGA 3GUGA 1M6JA 3STGA 2I7GA 1TTQA 2PWHA 3S42A 3LSCA 3IUHA 4YCOA 1LOSA 3A3XA 4D6GA 1LG1A 2R82A 5A6TC 3GC5A 4ADSA 3M0HA 4Q8NA 3C0SA 5JUVA 3GXIA 2HEJA 3VZYA 2HPMA 3QLLA 1XRVA 1PTGA 5I6SA 3VE7A 4B5NA 4JZ5A 4BCEA 1SFTA 4CUCA 1ICQA 2XSBA 4CKQA 1CXIA 2QJNA 1MQPA 3B4YA 1NDYA 3IIOA 4BF7A 1CYGA 3QY6A 3BVJA 1UD6A 4WJ8A 4RNJA 4AZIA 3EMCA 5IDZA 1HKIA 2E40A 4EX4A 3T8QA 1SMDA 1W3JA 1XIHA 3OG2A 2PLCA 2VR2A 1M7XA 2FTWA 3SB0A 4DYJA 4Z08A 4QDPA 4ZQCA 4GJIA 3WH9A 4DWSB 3OODA 5JIWA 2QCDB 2ANUA 4OUEA 4LS0A 2BTMA 3ZJ8A 1LF1A 2B81A 4JYDA 1TFVA 8TIMA 4RV3A 2HE8A 2TMDA 7A3HA 4HCLA 4F0SA 2VDHA 1UBSA 3G8RA 3SCVA 1YNYA 3H54A 1VIZA 5TD4A 4BHYA 8XIMA 1ODUA 2QQ6A 4RZ4A 1S2TA 4L80A 2Y7GA 3NSMA 1Q63A 4PUNA 3GHTA 4ORMA 4H41A 2QS8A 4LB3A 4MOZA 1YBQB 4A3YA 1B3ZA 3L2MA 4Q8WA 1DTNA 2QV4A 3K1GA 2QUVA 3BLFA 1R3YA 1KCXA 3SQSA 2I57A 4ORIA 2V5DA 1KTNA 4O1EA 1NF7A 4XKYB 3WQ5A 1I60A 4XIMA 3BWWA 3LA4A 2C79A 1NARA 1IWAA 3HPSA 4F66A 1ZU8A 4MJ2A 1V51A 1VBRA 2X1IA 4PCPA 2C14A 4C65A 3SSJA 2J7BA 3UXAA 3CLWA 3LD5A 3W6YA 4Q4KA 2A85A 1Q7MA 1E6NA 4A29A 1M7JA 3NZPA 1WDRA 4ZTXA 3LM7A 3KCJA 4I8YA 3UWWA 4IQEA 4G5DA 2VZOA 4H8NA 1TX2A 2Z2BA 4PCNA 4B3LA 2VKZG 1QU4A 4C1NA 1VAHA 2DSUA 5GNZA 3C2FA 2D2OA 3VGBA 1JXKA 3W1XA 2IPGA 1XJBA 4HPXA 4H6RA 3V5CA 4E4PA 3RJYA 4UC5A 1KFKA 1WE5A 1ADSA 4C90A 3E0IA 2ZUTA 4QE5A 1KCLA 2BP1A 4PL1A 3AZRA 3QY8A 3MUY1 4NJHA 1BF2A 3E2RA 5FF7A 2FDSA 4PBFA 2DSVA 3KRSA 4GQQA 1PS9A 1EL3A 1E0WA 1Z9AA 2O7QA 1GONA 3TSDA 1G7VA 4JIHA 1OFPA 4DJFD 2VEMA 2WAGA 4OVXA 2QPXA 2ZX9A 3NQBA 3AMLA 3UNDA 3B0VC 4QS5A 5C8BB 5AHFA 3UA4A 1R3WA 3NQ6A 5H91A 1RUSA 2VGFA 3QHMA 3OLIA 3BH4A 4F3HA 1Q66A 1MI3A 2YL9A 5C6MA 1BWLA 3HG5A 4QRNA 4OKDA 4KEMA 2QCEA 4IXXA 1VLWA 1VBJA 1QMLA 5KEZA 4GNVA 4EANA 3W7LA 1E0VA 3TJIA 4NZ3A 1FWBC 3QV9A 3TYBA 2J78A 3TE9A 1EJ7L 1LG2A 4UMAA 4LEFA 3SCQA 1FQ0A 5FL0A 3PR2A 5IHSA 3CQIA 3AZTA 1PZ2A 2YBUA 4B4FA 4AHPA 3SRDA 4QAIA 1TSIA 3PWIA 5LIKX 3TWBA 3FK4A 2PDWA 2JFEX 3ENLA 3FJ6A 2HDJA 4WZHA 4I9AA 3HG2A 1S2WA 5D04C 4ZE5A 1OINA 1EBHA 4AX6A 1UZHA 3S6OA 1IR1A 1N2VA 9CGTA 1K9FA 3NZ1A 4QNWA 1GVSA 1SJCA 3R25A 3O9NA 3VM7A 1A53A 1EHNA 2PDIA 1OFQA 1A5LC 1KFLA 4ZQOA 4IIBA 3HMJG 4JX6A 4G2DA 4DO7A 4C6BA 2Y63A 2WNZA 1CGXA 3ITLA 3BW3A 1PL9A 2NQ5A 4I9TA 2INFA 1JPIA 3PNZA 1JCMP 1H11A 3IS4A 4RX0A 2GUYA 4H9MA 1XYFA 1S39A 5I3KA 5T9BG 3W3OA 3A5VA 5CSSA 1R2SA 3V75A 4W8AA 1FDYA 2JKEA 1MWOA 1FTXA 1DIDA 3W72A 5F1UA 1J12A 2GQ9A 3GR7A 3EXSA 1JEZA 4N2YA 2HE5A 1FH9A 3AHTA 1XLEA 3PZMA 1RBAA 2NWRA 1DJIA 4QEHA 4AVOA 1ITXA 4HMCA 4RW5A 1UKPA 1QXLA 5ABEA 3VNYA 5CGMA 4IT1A 3IGSA 2H8ZA 2UV8G 2BOGX 1ZLPA 1ML1A 2XDFA 3BO9A 1F3WA 5HNRA 2B7PA 4O18A 4KGLA 3LMZA 1U33A 4I7VA 4DLFA 4MY9A 1DIKA 5CPNA 3NL2A 3CWOX 3WF3A 7TAAA 2YXOA 1I45A 3EGJA 2CLMA 1DWAM 4K8HA 3RF9A 4NP7A 1NEYA 3UXIA 3W22A 5I78A 2OGJA 3PS7A 3WH5A 3KM8A 4G6CA 1W5MA 3NTYA 3KTSA 3OOQA 4BS0A 3LK6A 3WH8A 1ZGDA 1BF6A 2FB2A 3AO0A 2A7RA 3CV7A 1MZHA 1EHAA 1QOPA 3WFZA 3CAVA 1XHGA 4RPQA 1V6WA 3EWCA 2FHBA 3W25A 4JIQA 3MMWA 4JTQA 1F2JA 2FB3A 3L23A 3QN3A 3PZGA 3N2OA 5CPOA 2R94A 3T07A 3PPGA 2GGEA 4XVDA 4QHRA 1UH3A 1QT1A 2OSXA 4V2XA 3IGUA 2CLHA 2WQPA 3VOCA 5KZDA 3ARXA 2FVLA 3F1QA 4LCQA 3K4DA 1JYXA 2WC4A 3WZ0E 4M6VA 1SVDA 3NVDA 3W76A 3L5MA 5LZLA 4XTDA 2DZWA 2ACSA 5H2ZA 1UHVA 2GJPA 3USZA 3L68A 1C7TA 1V4YA 2PB1A 1XLFA 3FDKA 2Z0IA 4FSAA 1SFSA 1R7AA 5AHMA 3W2UA 1VHNA 3LDVA 2ZE3A 3QW3A 1LBFA 2J7FA 1Q3NA 4MJ4A 3MCMA 4UTLA 1XLCA 3LHWA 2V5BA 5CCZA 4QLKA 4NIRA 1LDCA 3W00A 4CQCA 4AZHA 4FO4A 3JZUA 3BAJA 2F6KA 1RA5A 3WUEA 3B06A 4DBEA 3W7OA 2HJPA 1W2PA 2QUUA 4NXSA 3CUXA 4NZJA 2WZIA 1W91A 3P84A 3HG4A 2NSXA 3GFZA 1XRSA 1CNVA 3I7QA 2CBUA 3KVKA 2W91A 2OLHA 2TRSA 2GJNA 4UTTA 5FJJA 3H4XA 4R88A 3LCLA 4CCZA 5CG7A 2Y2WA 5JVLA 2D0GA 4LBSA 4TU1A 3R94A 2V81A 3O05A 4YCPA 3N25A 3UYCA 3MCNA 3DIPA 1OCBA 3EOSA 4D6EA 2OU4A 3A21A 5FF3A 3G1YA 2YL6A 1JPMA 4P8VA 3UZXA 2DSWA 2E8YA 1KA9F 3B9DA 2ASHA 5M3WA 2WCSA 2XFYA 2LLEA 3F5JA 3KTCA 5HUOA 1EUNA 3GXDA 1NFPA 3AIWA 4GJJA 3L7RA 4GPNA 4NT0A 3IRSA 4KEVA 2OODA 3HPAA 1W3NA 3E2VA 4XZ9A 4Y8EA 1ISVA 2CHRA 3LZ3A 3M0YA 3OHIA 1BTCA 1XLDA 4IXHA 3S46A 3KLKA 4LUTB 4ATDA 1DJHA 3M0VA 1T99A 3IAQA 5ENLA 4J1OA 4B5WA 4DYEA 2B7NA 3T44A 1UMLA 4MWAE 3F5KA 3QW4B 5F2IA 2PUZA 3EX2A 1HL8A 1QPOA 3LQGA 1U22A 4W8LA 1M03A 1NH6A 3N29A 5KETA 4AHOA 4RDVA 4R5EA 1ZCCA 2DZUA 2OYMA 1VF8A 3NNTA 2FGZA 1HP4A 2PDHA 3HFTA 3V16A 2GK1B 1BPLB 3OB8A 2QULA 1GPFA 2I5IA 1JDAA 3P61A 2IW0A 5AHIA 1RR2A 3F2CA 3IWPA 3BJSA 1Q7ZA 4A4AA 1VC4A 3VFCA 2CXEA 3TQKA 1EQPA 4LVGA 5D2TA 4CQBA 2RDWA 2F6XA 4A22A 2OCZA 4NVTA 1BVZA 1B0IA 1JDFA 3WNNA 4NI3A 3AXIA 3SRKA 1T7LA 1EX5A 4HYWA 3JRKA 1IR2A 1GVQA 1YADA 3AISA 3LEPA 3A23A 2ZTKA 1UH4A 2JEPA 3WLIA 3CMGA 3PULA 1DWIM 3II1A 3VIIA 2FLIA 3CQ0A 3FKKA 4HJFA 2HPIA 4O0KA 4Z1AA 3PTDA 4BI6A 1HGWA 2WHLA 4V28A 3CUFA 2GOUA 4GMEA 3TC3A 2DT3A 4GYKA 3E6EA 3OVQA 1WZAA 1K1DA 4Q3MA 3N12A 8RUCA 1RJQA 4ZO8A 3T0AA 5A6LA 3BAWA 4DJED 3HMCA 5AYIA 4LNCA 3RITA 1POKA 3UR8A 1UWIA 3G1AA 4WDXA 5ABFA 3VDAA 3GG0A 4QG6A 1XQKA 2G95A 4UFIA 3R43A 1TWDA 3E74A 4Z2JA 5C9ZA 5D05A 1AW5A 4H8UA 4PEKA 4RE0A 1N8WA 4N9DA 3L65A 5BMWA 4JTFA 2WMGA 4U31A 4ZOEA 1G5AA 1ME8A 1ZALA 4OOUA 3RMJA 5BXSA 1X6LA 5AC5A 4JHZA 2PE4A 1LUCB 1Y5VA 3GR4A 3RIKA 5MHBA 4DXKA 3VIKA 1MQQA 4Z2IA 1OHLA 1W9PA 5T8GA 2OO6A 1EFZA 1KLZA 3SIZA 3URNA 2X0HA 1VEOA 3M5ZA 3CHEA 4S23A 2A21A 5HWMA 4JKMA 5HPOA 1PAMA 1OFAA 2ZRUA 2Y7DA 4P61A 1SFJA 3T55A 2VTFA 5I3FA 2VT0A 1VHCA 3P0WA 1IIHA 3ZWTA 4FMVA 3AWNA 2CC0A 3P7YA 3WD3A 1JJKA 1W0MA 3CLMA 3WLJA 1JDCA 3TZNA 1E6PA 3LCFA 3RLGA 4GIYA 4HPHA 2CHNA 4XIAA 4O8AA 1G7UA 2AL2A 1ZNNA 2YFOA 3QH2A 3LLFA 3H12A 1DXIA 1I2QA 2X7WA 1WBHA 3SFWA 4J2PA 4MNJA 4XKMA 4TTGA 3H2NA 1U5HA 3ONCA 3V35A 3ONBA 3LBCA 1YTEA 3KUMA 4HZ6A 3VIOA 4AWSA 1PKLA 1KFCA 5K7JA 4GYPC 1FWEC 2WANA 1SM9A 2WJFA 3PFMA 4CNPA 1Z7AA 4BJHA 3ZQ9A 1QHPA 3GTHA 2RHGA 3NL6A 1J0YA 3EDDA 4JPGA 4NNBA 3CWHA 1WX0A 2VRJA 3DGBA 1HN1A 1Z48A 4TUFA 4WKFA 4PH6A 2JIEA 2YDAA 1OFOA 3QQ0A 1JUEA 4X0VA 1FHUA 1PXGA 3W7CA 3O1NA 5JXQA 2A6NA 2FQIA 5EMMA 5DMYA 5AHNA 2V5JA 2PA6A 2YCKX 4S39A 1IEWA 1WPCA 2CNCA 1K8YA 3UWYA 5F2LA 3CUHA 2GVLA 2XVGA 1OZQA 3EPOA 1YHTA 3WDPP 4S3JA 1OVDA 3NO1A 5I3GA 5D37A 1P1MA 4UUIA 3FLUA 2NX9A 4UBPC 2Y5EA 3CYVA 1RHCA 1RY0A 2JK2A 3ZIZA 3UVAA 1I2RA 3O8AA 3VTRA 2GLKA 1E1FA 3PUEA 4GG9A 1H1YA 3WNKA 3NG3A 1JZ5A 4DWSD 1YPFA 4HNVA 4HBKA 4TMBA 4R7WA 3M0KA 4M3PA 2IPFA 5FKYA 2D2GA 4JAWA 4XQ6A 3TK7A 2PWGA 2FZ8A 2DP3A 1UWQA 3U7VA 3SBFA 4NZ4A 3PTKA 4RZ6A 3G77A 3TYEA 2C0HA 4UTWA 5DBUA 2PGWA 3MDUA 4KESA 4PCFA 1GKPA 1T6MA 3GHRA 3CH9A 1P48A 2OLAA 2EPKX 3G0SA 4XO7A 2BHYA 1KC7A 3HQ1A 3L4UA 5BRBA 4ADUA 1QNRA 2ZX7A 3OZMA 6TAAA 1ZCOA 4JFUA 3V18A 1R87A 1XSIA 3BOXA 4H6EA 2Z6JA 2VURA 4J3ZA 1IV8A 3ATZA 2AL1A 4HK6A 2PMQA 2J7CA 3M4HA 3LNPA 4WJXA 3D5HA 1D9EA 3E1F1 1SYTA 3E38A 4LVDA 3HM7A 4HZMA 7REQA 4LGXA 2VC5A 3NO5A 4B4HA 1PDYA 1V7AA 4E8DA 3AXMA 3PSVA 2OZTA 4UFMA 3TSMA 1F6PA 3PNUA 5I24A 3APTA 2FTPA 1D3GA 3ZZ1A 1PBGA 2HVNA 4GY0A 1JPKA 4C5ZA 1E4LA 1VFHA 3H70A 1L6SA 2WMIA 1DXFA 2HRWA 1LL6A 2ZRYA 4GQBA 4JTJA 1HKMA 3LPGA 3FX4A 5DELA 1FDJA 2ZZ1A 4WOQA 5DLCA 1W1ZA 3EA2A 1TRDA 4H6KA 2OQYA 1U1JA 1Q6OA 1BKSA 1I0BA 4GYJA 3LMYA 2DIEA 5ABHA 4LVFA 3CZGA 2EPHA 1TE6A 1TQJA 4Z1BA 4UQEA 1VFLA 1P0KA 3W27A 4E3VA 2DJLA 3FHQA 3W38A 1SZNA 3DZ1A 4M0XA 3TAOA 4HMEA 4DPPA 1UUOA 1HQTA 4IPJA 3WYZA 1CI1A 4BF5A 3K4AA 4ZQMA 4NU7A 4QSHA 2D0HA 4NX5A 3UVIA 2IMRA 5KINA 3MS8A 4PTNA 2ZOXA 2CKSA 3CHVA 4AF0B 2ZIDA 1TMHA 3GNXA 3REQA 4WSJA 1FCBA 4LUYA 2PTYA 1CECA 3CXOA 3V1HA 1C91A 5I23A 3U9IA 4TXEA 4RE3A 4PTWA 3R79A 5HNUA 4UFHA 3USBA 2VFIA 4MB4A 2IQ0A 3SCWA 2BS9A 3NM3A 3PZOA 1US2A 3MZNA 4HA1A 2GVEA 1DORA 2QZRA 2XM2A 2ZA3A 5AC4A 4F0HA 1JI2A 3C2OA 3LNMA 3EPNA 4PFMA 1EGZA 5FF4A 2BV9A 1VZWA 3KCLA 2FZDA 3DFQA 2OGYA 1HO4A 3ABOA 4N42A 1R30A 4JNMA 5FF2A 3N14A 5C7VA 4DUWA 3LQLA 1XYAA 2AQWA 3ARSA 3A3HA 1J0ZA 4YXGA 2NVCA 1JRCA 2V82A 4L61A 4A21A 3BLDA 4OOZA 5MKGA 1F74A 1G9HA 1XUZA 4IFOA 1AJ0A 1DXEA 4PGLA 3MHGA 4PR4A 1KWKA 2PTZA 1S1RA 2C19A 1JVNA 2GPTA 3S2CA 4H00A 4R33A 1DQXA 3L5AA 4H9TA 2WC7A 1UA3A 5BOFA 1XKJA 2Q71A 4F0KA 2VL4A 1RALA 1XIBA 1OFBA 3TTYA 3QZEA 1JF6A 4BWLC 1DJGA 3KOZA 3O2LA 4CD4A 1RAKA 2A6LA 3WNPA 2B4GA 3LGGA 3CC1A 2HK1A 1BKHA 1WOAA 3DN5A 2RKXA 3PVFA 2VWSA 4GWEA 4MUZA 5CGQA 2GUUA 3J7HA 1QPRA 4IMGA 5A6AA 4P7NA 4G8TA 3VZZA 2YLLA 3GH7A 1W37A 1W5OA 4AZ6A 2BVYA 3SUTA 4W87A 4A8IA 3BLEA 3DCPA 2GGGA 3SIMA 3F03K 3VUPA 4DXXA 4ZO9A 6XIAA 1KW1A 1W9XA 5LA0A 1EGMA 1X98A 3IV3A 4H9YA 1FA2A 1MZRA 3EXRA 2POTA 4TQTA 1P1XA 1GVYA 5CQ1A 3UZJA 3HF3A 5EMUA 5H1WA 3W7HA 2WSPA 1Y65A 5E9XA 3WFLA 1ZJAA 4RXGA 4MUPA 4CQ9A 1EZ2A 1K8XA 5HAOA 2VX7A 4KRZA 1GORA 1VJZA 1WXJA 3TJXA 3KDOA 3BAKA 4ZL1A 1OC6A 2VD9A 3KFTA 3VNJA 1QOQA 4M6QA 4NASA 1UP2A 1CZ1A 4IG2A 2C13A 3N73A 3GHUA 4IMDA 3CUZA 3ZSSA 4C6PA 3DFSA 4K2SA 1KM5A 4TMCA 2CETA 4IX0A 3PAOA 4H6QA 2GSJA 1TPFA 1C8YA 3IEBA 2XINA 1XUUA 4NILA 3N4AA 1C9DA 4ZFCA 4DO4A 1OT1A 2GSHA 1W56A 3U0HA 1EUAA 1YNPA 1MDRA 4D8AA 3KVLA 4JYFA 3RLVA 2XGBA 2XN1A 2AAAA 4DUXA 3WQVA 1A0EA 1FWAC 3AYTA 1E9LA 3G2GA 4DEFA 3SGZA 4KWUA 4KEZA 1FFQA 3G1FA 3DC0A 3MY9A 4AXKA 1LWIA 4WF7A 2DZTA 3UPMA 1P0EA 5DXYA 4GHRA 2Y5SA 1E6QM 5RUBA 3POCA 2J9XA 2VXNA 3W1AA 5LNSA 2TAAA 2OTDA 2YB1A 4IGNA 3MO4A 2OPJA 2Z1SA 3W81A 1UR0A 1FWIC 3EX3A 4PBGA 4IIFA 4HNNA 1TJ2A 3IJIA 2R1PA 1E9ZB 1PJ9A 3T2OA 3G18A 4LT9A 4XB3A 2ATMA 2Z7KA 1CLKA 1TPB1 3KZSA 2PC4A 2V2HA 4QGCA 5JIPA 2V68A 4K1WA 5CAKA 2IPWA 4H04A 4C7FA 4DBWA 4HNUA 2HBXA 2C18A 1SR9A 3SSZA 4CCEA 1MEWA 3FN9A 1TWZA 3WL0A 5CSUA 2TODA 3L4VA 2X41A 4JIIX 5BU9A 2OEJA 4F2TA 4INFA 1EJTC 1MRQA 1RZMA 1H7NA 4QISA 1MSSA 3DHDA 2OYLA 4UTKA 1E1CA 1M01A 3CUGA 4LRTA 1ICPA 2Q6ZA 3B8DA 4L65A 4IJBA 4UWMA 4PMUA 1W32A 4P8XA 4XBSA 5CC7A 4NL1A 3WUFA 1WOBA 2XGIA 2D3NA 3CT2A 1A50A 5AVHA 5D2VA 2F7FA 1XYMA 3SQMA 1QVBA 1Q45A 1ZS2A 1YXYA 1E6XM 4TV5A 2IKJA 4P7LA 4RDYA 1XLHA 1AL8A 4JGDA 4LUIA 2OT1A 3CAKA 4M51A 4TV6A 1FWNA 1XC6A 2GDQA 3W82A 1US0A 4I90A 2WNQA 5AHLA 3W2KA 1W2VA 3CL8A 3SO7A 1OX4B 1SQ7A 1SZRA 2VCBA 1WKDA 4XKYA 4XZBA 3RCMA 1X8FA 1BXCA 3UG4A 1I6NA 5I3DA 2IXVA 4ACZA 3GH5A 2W62A 1KQYA 3LI1A 5C9XA 5K9CA 4ZB5A 3T2PA 1UR1A 2CBJA 1WDWA 5F2GA 1EEXA 1R6WA 3DG6A 1HKJA 4ECLA 2IKGA 1P6WA 1NWUA 4ZZ9A 1KTCA 3R2GA 1ENUA 3CPGA 2E8ZA 4Y9PA 3WDIA 5HNTA 4Q8MA 3POHA 1EWEA 3NR0A 2X7VA 1UJQA 3ARZA 2VUYA 3UY8A 3ZLGA 1MUMA 4UTFA 4C6QA 1A5AA 2I14A 4NJGA 2I17A 3TP4A 2PGRA 2HBVA 2ISSA 4FZIA 4LB4A 5I7GA 2W92A 2A3BA 1KBBA 4XAGA 1KM2A 3IIZA 1K3UA 3NL5A 4KCUA 4L56A 1XLMA 1W3HA 5G1YA 2NZLA 4FPSA 2PZ0A 5AZ1A 4ZEPA 1RQEA 3EPMA 4RE2A 1OK4A 2J66A 4AD2A 1J11A 3GG8A 3UY7A 3V0UA 3ARPA 1DWGM 2NT0A 3CIXA 3CZLA 3E0WA 1EDQA 4NJKA 4O1FA 3MMDA 1YTDA 4UTWC 4Z2KA 3L5LA 1JZ6A 1REQB 3GHSA 4XD4A 3EWZA 3RCNA 4J27A 3RX3A 3QFEA 2ISDA 1LCOA 2BHZA 5GNYA 3GW0A 1GZJA 3NQDA 2DZVA 3L12A 4K7VA 4NX0A 1BQGA 1H62A 4GNJA 4KIRA 2WMJA 3AJXA 4JQ4A 3M6YA 4HNTA 2HVOA 2O4MA 1TCDA 1AODA 5T9CE 5IHRA 2HSAA 5HINA 2WCAA 3PUOA 3N11A 3TX9A 4IQJA 2ESCA 4XTIA 3OO2A 2RAGA 1ZB5A 1SZFA 4BQ4A 2EKGA 4IPIA 3GK0A 2DY3A 2G50A 1G1YA 1FXQA 3VD9A 1SW3A 4V27A 3LLDA 4LVAA 4CLMA 3KDNA 1VD6A 2WLYA 4CN6A 2ALRA 3U2ZA 3AMGA 4HU0A 2E3ZA 4UZSA 5HATA 1B1YA 2YA0A 2V8ZA 3PZTA 2P0OA 4WKHA 3TROA 2E6FA 3W29A 1CXHA 4RNIA 3ZR5A 3DFPA 3MA8A 1TPDA 2YIHA 1HVXA 4HTYA 4X2RA 4I5XA 1R5YA 1F4HA 5CSRA 1V3LA 3GB6A 4FOJA 2E1DA 3CZKA 2OR2A 1QO5A 2FH8A 4C60A 3DUGA 1MXGA 2GDVA 1LRTA 5BWFA 1QPKA 1P4CA 4C6JA 1RJRA 4YMZA 4DLMA 3TXVA 4AD0A 3H55A 3H26A 2GVJA 2YGYA 1XYCA 4MHBA 2NVDA 2V38A 3QVQA 3UJEA 4BEQA 2DZAA 1B3OA 1I4NA 1FX6A 1WB0A 4XK2A 4AY1A 1VENA 3VVGA 1M68A 1X96A 3N6JA 2PI6A 3T4CA 1Z42A 1JZ8A 1J2WA 2QAFA 1KR1A 3LCXA 4KRTA 3ABSA 1QBBA 3TW9A 1WA3A 4XO6A 1PPIA 4FNPA 2WHJA 1QNPA 1E9YB 3B8SA 4AAJA 1W1VA 1XH1A 4P8WA 4XD6A 5LA1A 2PDLA 4HQVA 2VD8A 4MFEA 4DXVA 2Z2AA 2FDMA 2WSYA 4L64A 1JAKA 2C1IA 2YLAA 2CLOA 3PUDA 1F8IA 4DBDA 2ZRZA 1YDVA 2PDNA 1QW8A 3N2MA 3MKKA 5SWUA 5E9AA 1CDGA 5ECUA 4QJ4B 1QJWA 3T42A 5ECVA 1OCNA 4N7QA 4FB7A 1LOLA 2PWVA 2BNJA 2XVLA 4IX2A 2WJEA 4MKNA 1KXVA 3HBLA 1H4PA 4WCJA 4ES4A 2CWNA 4P2VA 1ZBVA 2OQHA 3RYSA 1BWKA 1LJYA 3NXLA 1JCNA 4RR4A 2DUZA 4CU8A 4FLQA 3SURA 4BQ2A 3CS2A 5FEXA 3N15A 3UF9A 2XIBA 5LXXA 4AG0A 4DPQA 2OEKA 3LV5A 1O12A 2WBGA 1V3MA 4PC8A 3W74A 3LI0A 1UA7A 1WDSA 4B90A 5CGTA 5CAHA 3M0LA 3TYDA 3H53A 1CGUA 1J0JA 3UZYA 3E96A 1E5NA 2HCVA 4N02A 1RXOB 3LPFA 4JY9A 4EACA 3HGRA 1BVNP 1Z89A 4ILSA 1QO2A 2OELA 3BARA 1UWUA 1HL2A 4UNLA 2PWFA 4GI8A 3OIHA 2V3EA 1OK6A 4IFKB 5G4HC 2HMCA 3T6CA 4AX7A 1XBVA 4I5UA 2B7QA 3AHYA 1XIMA 2G4FA 3RLUA 5LNUA 2WK2A 4GYFA 5CC3A 4XZIA 5LHFA 2E1WA 3QTPA 5E5CA 4Z1CA 5FJUA 4W7WA 2NX1A 1HF6A 3PANA 5A8MA 3RG6A 3SQLA 1WV2A 3XINA 3C61A 3CHCA 4M7TA 1RVGA 4M1RA 1W1IE 4L4LA 1CXLA 1FVPA 5HQMA 4ERAA 4QM1A 1J0KA 3ZO9A 1R38A 1P0NA 2VEPA 4XISA 2W9MA 2Q8XA 1Y8BA 1DIOA 2X1TA 2WC3A 3BOLA 2OOGA 4ZCWA 1ECQA 2QJIA 3AIBA 4ZVJA 4LALA 3NZQA 2OWWA 3CEPA 4LAMA 4UFJA 4H4IA 1TTJA 4YLWA 3OIXA 3VCNA 2Z00A 3BLOA 4GGBA 1Q6RA 1WDQA 5LHEA 2HQAA 4RL3A 3I7SA 3G1XA 3ZLFA 3M9YA 3TA9A 4WHBA 5HJYA 1F6YA 1XX1A 2XH7A 3M41A 2A3LA 4DNHA 1QI3A 4RZBA 2VZSA 3S6DA 1XPYA 3HPXA 5D2WA 4QEEA 3VABA 3HGJA 2H3BA 2Y8VA 2HTMA 1KB3A 1NVMA 3N6HA 2BZNA 3TU9A 3NQGA 3CUIA 1XGEA 4W93A 4ML9A 1UCWA 5LYRA 3OZOA 3ABQA 1JDEA 3UP8A 4MKSA 3H2OA 1XIIA 1R9XA 1TV2A 3KS6A 3GDRA 1ELSA 1VEMA 2I16A 2YSWA 1FH7A 1OGBA 3K2GA 2KAUC 3PBWA 3THUA 3AJ7A 3KBVA 4AIOA 1RA0A 1L6WA 4UCFA 5EL1A 3UERA 3R0UA 3NVTA 4TO8A 2ZZ3A 4GH1A 3TFXA 3MUZ1 3UYIA 3AYRA 3UZZA 1OFDA 1SO5A 3EKZA 1OQFA 3MJMA 3MMUA 1P6CA 1VRXA 3DDMA 4L5ZA 4GQ0A 3LBOA 1RVKA 3WQ8A 1L6YA 3N9RA 1T41A 3NQCA 3P80A 4LOCA 5ABTA 2D1ZA 1FBAA 5BOOA 2HS8A 3QBUA 4CNTA 5KSWA 4I3GA 3WK3A 3RCYA 4NUWA 3AALA 4PMZA 2GJLA 2O56A 2GUBA 1S3HA 1AL7A 1UWTA 4O50A 1E1EA 1JYWA 4GXPA 3LZ5A 3T8LA 2YA1A 2ABAA 1RP8A 1B4KA 4LS1A 3GU2A 1T8XA 4JCLA 3FJNA 3S9ZA 5J04A 3FHAA 2QIWA 2VVNA 2X16A 4P8UA 3MPGA 1GNXA 4GIAA 2QGHA 2XSAA 2Y85A 4MWAD 4BI5A 3LTSA 3V0TA 4MWAB 1D8WA 1XGDA 4C1NB 1X97A 1W5PA 4EXAA 3SJNA 1SO6A 3T08A 4C91A 3SDOA 1FWDC 3W1NA 3GSMA 1H5VA 5HNNA 1I2OA 3P14A 3O7UA 2QCNA 3K4WA 1YW1A 1L9WA 2QMJA 2D24A 1MXSA 2FZNA 1VR6A 4Q4OA 3TYCA 4JTRA 3LXBA 3TOPA 1V6YA 2ZX6A 3WQEA 3WENA 3DFNA 3TCEA 5A5WA 3LN3A 4DB7A 4Q7BA 1WZLA 2PF0A 2X40A 5HMFA 2WMFA 1V7YA 4MNLA 3UGRA 2CEQA 1YPXA 1KWGA 4O13A 5CZJA 2X2GA 4RUBA 3JU2A 1E5JA 4XVEA 4PMXA 1KM3A 2J7GA 3P81A 1NTHA 2ZKMX 3VOIA 1PYMA 3N4EA 4ZR8A 3NDZA 4AU0A 3BW2A 4FX8A 3AOFA 5HANA 4GUJA 4L6HA 2R24A 1L6GA 4X3ZA 4RZ5A 3NOEA 3EZ4A 4BQ3A 5AKQA 3MVIA 2WZHA 4IUOA 4PTDA 4YIWA 4K1GA 4MAVA 1GHRA 2A4AA 3B40A 3U5UA 1GG1A 1RH9A 1AFSA 2CLLA 2ZWZA 3VOHA 1TA3A 1IE7C 1F61A 1V0LA 4JTLA 1WP6A 2A2IA 4Z0JA 4X22A 3R8HA 4YYFA 1GJUA 3B04A 3IJ9A 3WDHA 1NFGA 3EAUA 1DHPA 3VUSA 5D2XA 3TSBA 4KKXA 3U7BA 2R6OA 1AMYA 4CVUA 4RNHA 1VYRA 4N0RA 2CIPA 2J88A 3WG6A 1OBAA 3IACA 4LAOA 3KLLA 3FXYA 3HJZA 2OWXA 7TIMA 4BR1A 6REQA 1UASA 1LTDA 4LXFA 2JBMA 1FWGC 4J5NA 1ECEA 4UCGA 1B57A 1DVJA 4EXQA 4JQ2A 3WLQA 3OZPA 2QDHA 3O6CA 3HO8A 3CL6A 1J8VA 3W86A 5DCBA 2DUXA 1W31A 3PWAA 1O66A 1SMAA 3GXPA 4IISA 3B0XA 3LUTA 4JTUA 1K03A 1ZL1A 5DEZA 1PO9A 1BYCA 3DFYA 4GD0A 3CAWA 1F6KA 1PUDA 1E55A 3R1ZA 4ZQRA 4AF0A 3AQUA 4Q7IA 4HHHA 1DIEA 2Z1VA 4M5PA 3NGJA 3BSMA 3V0SA 4LV9A 5C0QA 1XRFA 4OV9A 5EYWA 3O63A 4JHMA 4PZVA 2VFDA 2QMKA 3NQEA 3ES7A 3WDRA 4YVXA 4I5RA 2VOMA 3TJLA 2CU0A 4EVZA 1EWDA 2DH2A 2XFRA 1ZSXA 1C93A 1MEHA 1SW0A 4YWIA 4O28A 1Y5WA 2VP8A 1VGAA 3ZR4A 2VC7A 3GXFA 3B0YA 3FJ4A 3RPMA 4H7VA 2FVKA 2QAPA 4C1LA 1WUFA 2KZHA 4Y9OA 5KTLA 4I7WA 4AIBA 4X61A 4NXKA 1WCGA 3CPRA 4EE9A 3CEUA 2FKPA 2OSWA 1J18A 2ZXAA 1NWRA 3UCCA 2CWXA 3IARA 3GXNA 1G6CA 2X8RA 2XYLA 3PC0A 2WHMA 4JX5A 1BFNA 2F2KA 3VINA 3DYOA 2FYMA 3AUOA 2CZEA 1M9HA 5AZ0A 4JHOA 3PPFA 3OTRA 2J74A 3LLXA 3B4UA 1CXEA 3NQ2A 4PTXA 5CG0A 2WPGA 3WLSA 1UD3A 4AZCB 2C7FA 4G7FA 5BXRA 4AH7A 2PTWA 3JW7A 4HK7A 2RDXA 3KOXA 5D03A 5CLTA 1A4LA 4V1YA 2VMFA 2JIWA 4S2CA 4Z2LA 3I6TA 3WSUA 3W24A 1L2UA 3TMLA 4F2BA 4P7RA 4DJFA 3OBKA 1KFWA 3VPLA 4HP5A 2BOFX 4WSKA 3WX7A 4B5UA 1SSGA 3HGOA 1V79A 3NZGA 3PBYA 1RCOB 3PG9A 4HJWA 4UMBA 4QQUA 2QYGA 2P53A 3SRFA 2P3EA 1XG3A 3M0ZA 1QOXA 4Q8OA 3WMBA 3ZT7A 1U30A 2WWCA 5K3VA 3OGRA 4W8BA 4C6DA 4I6VA 3VZXA 3WQOA 1DWHM 4KBXA 3AFBA 3QHOA 1BG4A 1OCQA 3PB0A 4IGHA 3PBUA 4G7EB 3QR3A 4YTRA 2R91A 1I1XA 4GINA 1M3UA 4IPPA 1J79A 1M1BA 3DERA 3CWNA 1HJQA 3TN4A 2DVTA 2XH4A 3SGUA 1JCLA 4ICCX 4RDZA 3LSBA 2FJKA 1QCWA 4FOKA 3S1GA 3L4WA 4DN1A 3LTPA 1A5MC 3OVGA 4YTQA 1WDDA 2AGKA 1H7PA 4F8XA 2Y1HA 1OYAA 4MZ8A 3KRBA 4YVVA 1AQMA 1GOQA 5J8LA 5E70A 4MDOA 2ZUVA 4BWLA 4HPGA 8XIAA 1J5SA 2EG8A 4LV4A 1UP3A 2D2HA 4ADTA 2O9RA 3AS3A 2W27A 1A3WA 2BFGA 2OFJA 4JL1A 2PSNA 3EBVA 4ZTYA 4CNUA 2VCAA 1QNQA 1EC9A 5C7HA 3IJ7A 1QATA 2QCGA 1S5MA 3PPCA 3KBNA 2YKKA 2PDBA 3Q67A 2R1LA 3DYPA 3G22A 4OBTA 4LUJA 1DWFM 4YHEA 1FWWA 2EGZA 1B9BA 2JGYA 4KF1A 2C8NA 4OZOA 3UJFA 4Q8QA 1H41A 3VOJA 1XW8A 4WLCA 3EMZA 3Q2DA 4O1CA 2PD9A 2JKPA 1F3XA 5G4WA 1R46A 3AIVA 1EPVA 4YWSA 2UWFA 1NOFA 3V7PA 2XGZA 3N4FA 2O9PA 1D7FA 1M7OA 3DGRA 2P1FA 2WVVA 5CZKA 4L4OA 4EPKA 3HTWA 3BLPX 3WEOA 4TVUA 4OBSA 1ZAJA 3VAVA 1B30A 2F8QA 2ZZ5A 4ERGA 4C6FA 1VYSX 3KVMA 2RJHA 4MTVA 1BYBA 1Q6GA 4GI9A 1IHIA 1ISYA 5A8PA 1E9IA 2QCHA 4JTAA 3WFAA 3MTWA 3UD6A 1DJXA 2MANA 3H4GA 5CJ5A 3E0FA 4HT3A 3UPBA 4F40A 1G0CA 1VFMA 3TN5A 1S5WA 4KQNA 1LUCA 4LTSA 1W5QA 5JMUA 2Y8UA 2NX3A 4MGGA 4YTSA 1UR3M 2FPVA 1TPC1 1J0HA 2XZ7A 2GK1A 4YN5A 3GS6A 3T1GA 4JNYA 2X2YA 4CNOA 5DF0A 2GQ8A 3NL3A 1MRAA 4OU1A 3KHDA 1W9BM 5L9FA 1CLXA 2L5HA 3UJSA 5KZEA 1CEOA 1ONWA 4NAEB 5C5YA 3TC6A 2WSQA 3NURA 3R8GA 1W9DM 5U7SA 3S1VA 3H2AA 3GIYA 1F76A 5HUPA 1UD5A 1BAGA 2QT3A 3TOYA 4D71A 1VFTA 1NIUA 3T78A 2BVTA 2NUWA 4QLJA 5CPLA 4A3QA 4E8CA 2TSYA 5JBDA 4R7JA 5I79A 2DZXA 4MF4A 1PSCA 4B5SA 4R85A 1Z44A 2R9RA 4FNTA 1E6RA 3P5ZA 3AHXA 1PVNA 3GH4A 1K7EA 4GIEA 3A4XA 4LF1A 2WMIB 3TMQA 2JALA 2YW4A 3KAOA 1EKOA 3I3BA 1KCKA 3GWQA 1DQWA 5F4WA 5I07A 4RLIA 1GCYA 2BXVA 3HU7A 2ZX5A 2XHYA 1XD1A 3GBDA 3CBWA 1PCWA 3ZJKA 4Z17A 2DEPA 1XM3A 3SCPA 3MDWA 4HZ8A 4LY4A 3RDKA 3CAQA 3EDJA 1W9UA 2ZZ4A 4AC1X 4PMRA 4AWUA 1R85A 3M44A 3UR2A 1HO1A 4YNGA 2HZGA 3R4IA 2J8FA 3EDKA 1NP0A 1FWJC 4GQRA 1EQCA 5CLWA 2NSOA 3F4DA 3LERA 1RPKA 4LBRA 1Q2RA 4C1KA 2G3FA 5E6YA 4NKCA 3CV2A 1NDZA 2QJJA 1ZUAX 3EYPA 2WZTA 5HXMA 4EP8C 1PX8A 3WBEA 3MV11 1SJAA 2FZMA 4PULA 3R11A 3LHYA 2DFAA 4UNIA 1YNQA 5CPQA 4AD3A 2QCDA 3ELFA 5C70A 4A3UA 2CLIA 4PMDA 1AH3A 3PUGA 1JCJA 4TX9A 4BK9A 5LIXX 4C6NA 1D3HA 4QJ1A 4ML4A 4GO8A 1QDSA 4XZNX 3IIVA 3N18A 5D8ZA 3S9YA 3CUJA 4H9UA 2ZUSA 4JDYA 1UIOA 6A3HA 3NJ3A 1VCVA 3RGTA 1R8LA 2EG6A 1H63A 1XCXA 3F7JA 3QSTA 4NI8A 1JUBA 3K13A 4E2VA 1JPHA 1HG3A 4JDBA 1B3XA 4HNCA 4QDMA 2CCRA 3ZVHB 1KQZA 2X0YA 3H21A 3MVTA 5B80A 4GZ7A 1MO0A 4WSHA 2OT0A 2WQDA 4UOJA 4FXJA 4HN8A 1DJYA 1ADDA 1XFCA 2Y4SA 1UBPC 1V3JA 4GABA 3E5PA 3ANYA 3HB9A 4PEEA 5AY7A 2AGTA 3SAZA 5A94A 4L1WA 4WGXA 3F4WA 1X39A 2WNNA 1KTBA 1IXQA 4M24A 3TJ4A 1Y7VA 3EOLA 4LS2A 5D4YA 3N3MA 1VH7A 4X63A 3MYOA 3SN1A 1JYVA 2I5GA 2RUSA 4N6FA 2ZVIA 2IQTA 3AAMA 1NDVA 3UG3A 4N4PA 2D3LA 1KXTA 4GKTA 4QXIA 4O15A 2OJPA 3TVAA 1XLKA 3A24A 4Y6GA 3TA6A 2I5QA 2Z27A 4L9ZA 2XTKA 3NA8A 3NQ8A 3UCQA 3VYLA 5FJTA 5BZAA 3CV1A 1OWQA 5M2FX 1BWVA 2E09A 4KGJA 2RGLA 3ANVA 3B9NA 3GIQA 1VCFA 3SR7A 4IMCA 4LYQA 4ALDA 1UUMA 4JTEA 4MG4A 3FA5A 4FP1A 3ARWA 1H0GA 1OG0A 2O0TA 2VZTA 1RLCL 4NNCA 3S5YA 4NZCA 1BD0A 4KPLA 5K4ZA 3FVMA 5C54A 5H8PA 5M17A 3AIEA 3CGTA 4V33A 4UQDA 2XVPA 3UWVA 5CPMA 3VNLA 1KLYA 3BICA 1V02E 5D9PA 3KX6A 1GHSA 3FFSA 4PMNA 1MVYA 3KXQA 2X05A 2P8BA 3P5YA 3GM8A 4F9DA 4WDUA 4QIUA 4DIAA 3I4KA 1IEQA 5G4EA 4J3XA 1V3IA 2BBFA 4FNSA 1K7XA 1OFEA 4GNKB 1S2AA 2DT1A 2H8XA 3NIYA 1S2CA 1QK2A 4WJEA 4U5IA 1OIMA 3MP5A 3CO4A 3HURA 1E4NA 4MPKA 1GEQA 1Q6QA 3NPXA 4DF2A 1GVFA 3C2RA 3T81A 1TZZA 2ZRWA 3C5QA 4GA8A 3N34A 4F4RA 2A5HA 2HXTA 4DI9A 3M5XA 1F07A 2F6UA 3KWXA 3P67A 4K39A 2VGGA 3WLNA 3RU6A 4Q6XA 3R5EA 3GUWA 3R89A 2DV0A 1QPQA 5EFDA 4U3CA 3VDGA 4C7DA 1GZ1A 5AYBA 3GNOA 2X1UA 2UY4A 2QJHA 2VFGA 3LBMA 4AMCA 3GW3A 3INPA 2QEZA 1E73M 4PTVA 2V3GA 5BU6A 2VWTA 3LS9A 4M81A 4AEFA 4PN2A 5HR7A 1R47A 4OFCA 3EWXA 4XZLX 1EO7A 2XH2A 2YXGA 3U48A 2J79A 3N6QA 3ES8A 3WCZA 5I2UA 3KOFA 4ZGYA 3GFYA 1Q8JA 4W5ZA 3OLGA 1EC7A 1ME9A 4XD5A 2X0SA 3VE9A 4EF9A 4RKAA 4X0NA 2PDKA 1K7FA 2XIQA 1BXNA 4Q8TA 5FEPA 5DO8A 1Q6DA 4MADA 5EU9A 4FR1A 1M41A 3Q58A 1QPNA 4JEJA 3IJDA 3KWSA 2V2DA 3E3HA 3RXZA 4N4QA 4D2JA 1VS1A 2YCEA 3EOOA 3BMVA 1V6XA 1SW7A 3IJQA 1RK6A 3N2XA 3OU8A 3QSRA 3TXZA 4QROA 1PTDA 4UB9A 3IPWA 5GJNA 4DM1A 3TCSA 2ZA1A 3MCOA 3ABZA 3L4TA 3WEZA 1PHWA 1QFEA 4FX6M 4IGSA 1XFBA 1EJWC 3LHTA 2DSKA 4U2ZA 4PB4A 3H7RA 5A95A 3OA3A 3TQ0A 5A2AA 3UR5A 5HQLA 1H60A 4IG2B 4HU4A 4OHQA 5FEZA 5AB3A 5A2CA 1EYEA 3BC9A 1LLOA 3G0UA 3TR2A 4C6LA 1UJPA 2B0MA 2OVLA 3WLHA 2ACQA 4FNRA 5LNRA 4MYAA 4ZODA 3N19B 3HV9A 5D02A 4GBUA 4QJ5B 4FK9A 1QI2A 3AYSA 2J27A 5BOEA 2G5WA 3PJUA 1EJSC 3M0IA 3LTYA 4PCTA 4QJ3B 4GUFA 1D8CA 1W1A1 2PLJA 3NQAA 4U5KA 4KWOA 4CEXC 3N17A 1OYCA 1O95A 3VKDA 4Y9AA 2PU1A 3GC4A 1QW9A 3FGCB 2EPOA 1BRLB 2HVMA 1Q4NX 1M7PA 3EKGA 5B7ZA 1EBGA 1GVRA 4HU8A 2XWEA 4C6CA 2VO5A 5CBIA 1V3KA 1Q6FA 4ROQA 3EOEA 3H2EA 4KH2A 3UJ2A 5HPCA 2Z7GA 3UT0A 4XUYA 3HA1A 3E0LA 3MSDA 3C2EA 3HPZA 4YVPA 5F2MA 2VQUA 2CBIA 2YL5A 5AYYA 1XLLA 3W70A 1X7FA 2YZ5A 3MT1A 4GYPA 4IIEA 1XYLA 3NPWA 4JL2A 3MHUA 1W3TA 3GQYA 3M64A 3M7SA 1P7TB 5CZTA 1LROA 3QOMA 4KETA 4KCTA 4NZ1A 1LORA 1CT5A 1EP3A 2W61A 3F2DA 2OX1A 2WJDA 1ZBKA 3A4AA 3M0XA 3QLDA 3S4TA 4YYCA 4DJEC 3V4BA 3QZAA 3QC0A 1ZPTA 1GG0A 1GJWA 1LT7A 2RFGA 2C1GA 2O9TA 5G2IA 4WVXA 3GKFA 1XI3A 5CJNA 3WH6A 3A3WA 4DI8A 4A8LA 4F9JA 2VFEA 2CXGA 2A3HA 3WKZA 3QPEA 3L0KA 2ZICA 1IT0A 3D46A 3ERPA 1J6PA 3C4UA 2J24A 4PYSA 4L1GA 3TW6A 3IJLA 4DX3A