3G3DA

Crystal structure of human orotidine 5'-monophosphate decarboxylase covalently modified by 5-fluoro-6-azido-ump
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
256
structure length
256
Chain Sequence
ELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Uridine 5'-monophosphate synthase
publication title Structure-activity relationships of orotidine-5'-monophosphate decarboxylase inhibitors as anticancer agents.
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2009-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3g3dA00
3IGXA 3G18A 4UTIA 1G67A 2V5BA 3TMQA 3W74A 1F73A 4IPJA 4ML9A 1TSIA 5CGQA 3LRLA 3L5MA 4I7VA 1DQXA 5KZMA 1HFBA 5F2GA 1O5KA 4I7WA 1WOBA 3CWNA 2GUUA 4P2VA 1JUEA 4RJEA 2QKFA 1BTMA 1XXXA 3WK2A 2WO5A 1TREA 2PRMA 2NZLA 3M41A 3I68A 4UTMA 1QWGA 2B7QA 3KVMA 1XUZA 2R14A 1TTJA 1F5ZA 3M47A 1X6UA 1IXOA 5CPOA 1AW5A 4H4IA 4UMBA 2YYUA 5DCDA 3FYPA 1Y0EA 1LZOA 5EYWA 4AXKA 2O7QA 1X7FA 3SFKA 3ZWSA 5GVJA 2R8WA 1EIXA 1G4PA 1JUKA 3P67A 2BSLA 1Q3NA 3TC7A 4IX0A 1YDOA 2GQAA 3L0GA 1THFD 2BWGA 3HG5A 1FWSA 3LCIA 4R33A 4FNTA 2DZXA 1UUMA 4QIUA 2QF7A 3KRUA 3W71A 1TTIA 4GUHA 4NT0A 1OYBA 3M5ZA 3TDFA 2A0NA 2DJXA 1XFBA 2QR6A 1XDLA 3R89A 1T96A 3ABRA 3NDOA 4NJGA 4YL2A 5G4WA 4EF8A 4FO4A 3M5YA 5E1QA 4Z0SA 4QM1A 2JKPA 1B4KA 3OG3A 3SECA 2V2CA 4FX8A 4M6PA 5FF4A 2ZRZA 3SGZA 3W1XA 1LYXA 2GPTA 4A29A 3D0CA 3IIPA 4KFOA 4MPQA 5DN1A 5F2LA 3W7GA 5BW6A 4Z1CA 3TAOA 3NQ8A 3TX9A 4AAJA 3PUEA 1GOXA 4DELA 1S5VA 3S9YA 4UIOA 1UASA 2J27A 3MI2A 2A7PA 3P61A 1G4TA 3G8EA 2NV1A 4MJMA 3HO8A 3DFOA 1RPXA 1JVNA 3NXFA 2VEMA 3PB0A 2VEPA 1WXJA 2PCQA 2Y7DA 3M43A 4PODA 2FIQA 5HUPA 3QPYA 3W7EA 4O53A 2DU2A 2G5WA 2B7PA 4TMBA 3M44A 5F1UA 3Q58A 1KV8A 3P74A 2ZCGA 4MOZA 3WK3A 5LGXA 4UFHA 4PH6A 4HNUA 5FEWA 1A50A 4XKYA 3EWZA 1TB3A 1ML1A 3QH2A 2E6YA 3ELFA 3THQA 5LHFA 4M6VA 2ISWA 3QMRA 3GKAA 2AGKA 2QCGA 5DBTA 4PCFA 3DGRA 4OBTA 1UB3A 4EF9A 3TUUA 2ZDRA 3R5EA 3THAA 5AN7A 3YPIA 1A5CA 3BG5A 3W88A 3TW7A 3W1RA 2WSRA 4JDBA 1B9BA 3NQCA 5A5WA 4QITA 1X1OA 2CW6A 1ICQA 3M5VA 1OK4A 5J5DA 5HJLA 3CEUA 2YW3A 3L66A 1VC4A 3VI2A 4JY8A 3QM3A 3PWAA 4X22A 1ZAIA 1TV5A 2E5BA 4WJEA 4X3ZA 2YXGA 1T0OA 4ZQRA 1LROA 1RQEA 3EX1A 3EX4A 4MYAA 5BMWA 2J6XA 1PV8A 3KVKA 2ABAA 3KAOA 4H6KA 2NLIA 1ZJIA 2J9ZA 1GT8A 4JTFA 4JS3A 1BEUA 3R12A 1F6PA 1L6YA 3QF0A 2P0OA 3F1QA 1TRIA 5AHNA 1TV7A 5FF2A 3W7CA 5K9DA 3T4CA 3G1VA 4CCDA 3NGJA 3NVTA 1U83A 2NV2A 5DLCA 3WJXA 1KM0A 4MZ1A 1Q6OA 1UBSA 5CSSA 4PTNA 4GBUA 4AWSA 3NQ2A 3UXAA 1TQJA 4BFAA 3NO5A 2H6RA 4GWEA 1Z42A 3EX3A 2QCLA 3IIOA 3L65A 1LOQA 1KM2A 3B06A 1Q6QA 2V5LA 3BV4A 1JCXA 2C16A 5EA9A 1R2SA 2JGQA 2PRHA 4ZQMA 1GWJA 1BWKA 3EWBX 4UTKA 2H3DA 5K2ZA 3C2OA 1TYGA 1KLZA 1BWLA 4JYEA 3I7SA 1IXQA 4LS0A 4ZQPA 5BRBA 1OJXA 3E49A 5KITA 1FWRA 2FB3A 1QR7A 1C29A 4NXSA 3EKZA 4UC5A 4M7TA 2B4GA 2VFGA 4LS1A 4E0CA 1H7PA 2TRSA 1DKWA 3WJYA 4MYXA 4FX7A 2YGYA 3MWAA 5HWJA 1KM4A 2J9XA 4LC8A 1DL3A 1ME7A 5SWUA 4IGHA 1FDJA 4MFDA 1XDMA 2DZWA 1OFBA 4W9TA 3LHWA 3MI6A 3I65A 2X16A 5AHFA 3U8GA 3V1PA 4GUIA 4RLIA 3I7RA 1GTEA 1C9DA 1VCGA 4ZVJA 1GVFA 3LERA 1W5MA 1KM3A 2A6LA 4O57A 4WQ6A 4JX5A 3H53A 5LNWA 4O28A 2H90A 3FA5A 2QCEA 1KM6A 3QFEA 2ZZ2A 3LCFA 1PE1A 4UUIA 1OX4A 2JKAA 3GK0A 1KTBA 1RD5A 1UUOA 4LRSA 2YYTA 3S1WA 2DP3A 4XBSA 4O11A 1S5WA 3PR2A 2C1HA 1NVMA 1O60A 3UXDA 1JCNA 1SQ7A 3VE7A 3NL6A 5HQEA 2GVJA 3NG3A 4XKYB 1QPNA 2WSYA 4O0KA 1ZFJA 5F2MA 1J4EA 1GVOA 5BOOA 1FXQA 1YADA 5D2YA 3LXCA 3CTLA 5K3VA 1VLIA 3N2MA 5LHEA 5AC6A 1F74A 4QSHA 4MLRA 4Q32A 3KFTA 2OZ0A 2H3BA 5K4ZA 3C4UA 4O4WA 1PVNA 5HR7A 2GVLA 2Q3RA 5AYXA 2QCCA 3FOKA 4HHPA 1D3HA 4WD0A 3OVQA 2B0MA 4UTLA 4FXRA 3TXZA 4OT7A 2CWNA 4UFKA 4UFIA 4KFNA 1VCFA 1KBIA 4GE8A 3QW4B 3LB0A 4MJZA 1W3IA 3NPUA 3E9AA 5DELA 3N14A 4YWIA 1WQ5A 4O14A 3PBYA 4Y9AA 1ZENA 3UPBA 1K7XA 3O16A 4LT9A 5H91A 1F6KA 2VFDA 4OV4A 2QUUA 4JX4A 2WNZA 3MP3A 1EP3A 2C15A 4N9EA 1MSSA 3LCGA 1KFJA 4O16A 3C8FA 1EEPA 1VQTA 3N3MA 4NU7A 3QJAA 4BF9A 3W07A 4MZYA 1OVDA 4K8HA 4K7YA 1L9WA 3QRHA 4WZHA 2YFNA 2X1UA 1H60A 3JS3A 3NEVA 2OMAA 2VFHA 1XC4A 1OG0A 4I7UA 4ZQCA 3HOJA 3CIWA 1GPWA 2A2IA 1I8JA 1OHLA 1AG1O 3MYPA 3P60A 3QEZA 4AH7A 2E5DA 3SW6A 3ZR4A 3LDVA 1W3TA 3ATYA 5EY5A 3RFAA 1CX9A 4UTJA 2VKZG 2YX0A 3B04A 4A21A 3KHJA 3EXSA 5AC7A 3W7LA 4I9AA 1YTDA 1N7KA 3LV5A 3G0XA 5HMSA 2Q8LA 3EEGA 4C1KA 1EA0A 3B4UA 2QCDB 3FFSA 4NNBA 1GQNA 2ZTJA 1YDVA 3M5XA 3SR7A 6ALDA 3PY2A 5G1TA 3M7WA 1B3OA 3S5NA 1UJPA 1E51A 1DJQA 3IIXA 3C2EA 3NAVA 5K9CA 4FEZA 4E38A 3PSWA 4LTSA 5D38A 4E2BA 1P4CA 1HO4A 4LC6A 3TIMA 3CHVA 2EAWA 2RFGA 4M6QA 2ZA3A 3WJZA 4JTJA 3ABQA 5HWMA 3N9SA 4R7JA 3NZRA 4U28A 3FS2A 3TJLA 1FCVA 3TQ0A 2OX1A 3G22A 2W0UA 4G1KA 5I3KA 2NUWA 4O54A 4JY9A 5FF7A 1XCFA 4HSOA 3PBWA 3R13A 3G24A 4QAIA 5I3FA 1KBJA 2BZNA 3MUXA 4MKNA 3BO9A 3PBUA 1PL9A 2QJGA 1GG0A 1HL2A 2V9DA 5DXYA 1AMKA 3PM6A 4IMGA 2E5CA 1YTEA 3BW3A 5TQLA 4KWVA 4BWLC 3T78A 5DCBA 1LOSA 4WOZA 2Y89A 1OFQA 2VENA 4NUWA 1QDSA 5CKSA 1R46A 4DF2A 3DKJA 5J5RA 4LNYA 5EKYA 5A8GA 3LM7A 5KZEA 4RCXA 5F2IA 1H1ZA 1TO3A 4UFLA 1LRNA 3HF3A 1W54A 3EKLA 4UTTC 1JULA 2GVGA 2V2DA 3FEMA 3MI3A 2RDUA 3KRZA 4KWWA 3BW2A 3W7RA 1TV8A 1QNVA 4O4VA 1I45A 3LBCA 5CZ0A 3RLUA 4XTDA 1PCWA 1K8ZA 4IPIA 4OWGA 3LLDA 1ZHAA 4IMCA 3DHDA 1QMLA 1EUNA 4HPJA 3R8RA 3AJXA 3UWQA 4M5PA 1FBAA 5KSWA 5D05A 1NAL1 3TR2A 1EB3A 2ZRVA 1DBTA 3HGRA 1G7UA 1MEHA 1HO1A 4RZ4A 3Q94A 1OF8A 2Y85A 3BGJA 4L4MA 3DI1A 4RV8A 4K6AA 4Q4KA 3LHUA 2Y6ZA 3SIZA 2YR1A 4PEKA 3G1XA 3GDLA 2V0TA 2G97A 1W3NA 4AHPA 2VEKA 5D37A 1WDWA 1GTHA 1ME8A 3QZEA 4EWND 1OFPA 4RXGA 4XWUA 2Z6IA 2ZRUA 3RMJA 1ME9A 4RXFA 4O1BA 5D33A 1H5YA 4MVAA 3QC3A 3GDTA 5K9XA 2ZQ0A 3FJLA 1W37A 3L67A 4HT3A 4LVDA 4JIPA 2WSQA 2CLIA 3E0IA 2YFOA 2I9EA 5I3HA 1JCLA 3IVSA 3PG8A 3P62A 3A23A 2A1YA 1B4EA 3SJ3A 4UNLA 5HUOA 3RK8A 3USBA 4CNPA 4M19A 2O7SA 3STCA 5IBXC 1G4SA 2OT0A 3UWYA 3I7QA 2QCMA 2FQIA 1MXSA 5D2WA 4ZZ9A 3W72A 4NVTA 4LVGA 1V7YA 1KFLA 3GNDA 1OFOA 2GJNA 4MLJA 3W1UA 4UMCA 2C0AA 1KFKA 2NUYA 4HKPA 4A3UA 4N4PA 1Q45A 1C8VA 2A21A 1SFJA 3L2IA 3PBVA 1DV7A 4JIQA 3G0UA 4LU0A 4RR4A 1FCUA 4FF7A 4O50A 5MHBA 3ZS4A 3MP4A 4NZFA 3CLMA 1F05A 3U2OA 1TPB1 1YXYA 3WFAA 3BG3A 3PUOA 4H3DA 4JDYA 4N9CA 2EKCA 1VGAA 1EUAA 3QMTA 4BWLA 5AC8A 1H7OA 5U7SA 4X9SA 2VFFA 3BG9A 2ZRWA 3T7VA 2CZFA 3TFXA 4GUJA 3L21A 2NX9A 3W7HA 2CLEA 4Y6GA 3RLVA 4WXZA 5K4XA 1M7OA 2YW4A 5KINA 1LLWA 4FNRA 4BK9A 3W85A 1KFEA 1OABA 4IMDA 4K37A 3UY8A 1A5AA 4ORMA 1ZNNA 4UTTA 3A21A 1T8XA 5I3JA 3G8RA 3GXTA 1TIMA 3WJSA 4E2DA 4NNCA 3LX9A 1W1ZA 4GUFA 2A5HA 4S2BA 1VJIA 3HMJG 2ISSA 5CZJA 4DO5A 1BKSA 2UV8G 1DHPA 2ALDA 3BARA 4IJBA 5G2HA 4NJKA 4BR1A 3OHIA 1SSGA 3DU0A 4ICNA 1VS1A 4Y8FA 4KKXA 3TCEA 3CQ0A 3CT7A 1SW3A 1TRDA 3C2FA 5EL1A 4TR9A 4BI7A 1F76A 2RHGA 4DO4A 4FNUA 3V75A 2DJLA 1ZAJA 4GUGA 5TIMA 1H50A 3UQNA 2OJPA 3KVJA 3ABSA 2EPHA 3L5AA 4O12A 4Y90A 2E1DA 1FCQA 4LVAA 4DXVA 2CLFA 3DI0A 4ZQNA 1TQXA 3RNDA 2A7RA 4QNEA 3A9IA 3QW3A 3PAJA 1IIGA 3PG9A 1VCVA 2V2HA 3TAKA 3LXAA 2F7FA 1NFBA 3O63A 2JGYA 4UCGA 1XBXA 4FNQA 1YDNA 1H7XA 4JTEA 5HULA 1A53A 2ATSA 5D02A 3K30A 3CWOX 4MY1A 3W6YA 2DZTA 3LI1A 2VOMA 2QCDA 3C52A 3FKRA 3G1FA 3EWWA 2HS6A 2TYSA 1GYNA 3IVTA 3S42A 2ZZ3A 1P0NA 3NNTA 3NQDA 1O4UA 3W7DA 1QPRA 2W6RA 3W86A 4CNOA 3LCLA 5IBXA 2C19A 1IXPA 1LCOA 3SZ8A 4RKAA 5L9FA 1KFCA 4K39A 2V30A 1ONRA 3G1YA 1AK5A 3OVRA 2ATMA 2NXHA 1TPFA 1RR2A 4NX5A 1SO5A 2E68A 1P0KA 2Y7GA 1EPXA 2GJLA 1K8YA 1FWNA 3FJ6A 3NQVA 5AHMA 2I1OA 2Y61A 1OX5A 3IRDA 4YXGA 5FF3A 3DBPA 3F03K 1RZMA 3W22A 4LUJA 3B03A 4O18A 2NXGA 4PL2A 1IF2A 1GEQA 2OCZA 1SZNA 3NR0A 1G7VA 2OT1A 3W1LA 4EIVA 1VYRA 4JR5A 2V8ZA 3R2GA 1KM5A 4A2RA 1XM3A 4O1CA 3GDRA 3MW7A 3WK0A 5C2XA 3Q2DA 4EOUA 5HR6A 3NPVA 4MZ8A 1MEIA 5LKYA 1TPH1 3LGEA 3UZJA 3HPSA 3B0VC 2RDWA 2YDAA 1H7RA 2FPTA 3JR2A 2AAMA 2EF9A 1QPQA 4ZMGA 4CCCA 1WX0A 4HNVA 1W8SA 1W5QA 1LBLA 4BI6A 5C6MA 1KV5A 3NQAA 1AW2A 1T99A 3MBDA 3F4WA 5LGZA 2CZEA 1F2JA 3E12A 3PF3A 2FFCA 3EB2A 4AHQA 4UFMA 2ZTKA 1KTCA 4OQVA 4BI5A 4LRTA 3W2LA 1W5PA 4ADUA 3W75A 3C61A 3Q37A 4LW7A 1TCDA 4ZL1A 2W79A 3STGA 1R30A 4Z1AA 5DXXA 2ZA2A 5AHEA 2RKXA 3LCWA 3ANYA 2HSAA 3EWUA 5E93A 4DO6A 4Z08A 2NWRA 1EX5A 4CQ9A 2B7OA 3H54A 1FX6A 1LBFA 4TIMA 3LTPA 5D30A 1SU5A 4JICA 1SO3A 3LHYA 4POCA 1SW0A 3MHUA 4O0ZA 2C13A 2Q8ZA 4N4QA 2B7NA 3UWVA 1VRDA 3ABOA 1H51A 2GQ9A 3M1ZA 5CPLA 5BNKA 4PC8A 2FTPA 3E02A 4UNKA 1OFAA 2CZDA 1JUBA 4YMZA 3CU2A 1YXCA 3W7KA 2RH9A 3GKFA 4WX2A 3W2UA 4IOTA 4HSNA 3VNDA 1I4NA 3N2XA 3STFA 3DFSA 2Y70A 4FNSA 4IX2A 3W2MA 4OE7A 3GNNA 1XBVA 3NM1A 1A5SA 2QCFA 2Z0IA 3HIJA 4JYFA 3B8DA 4J9JA 2H8XA 3F4NA 3G1SA 3HGOA 3BLEA 5FEZA 1QOQA 1HUVA 4NJIA 4UTWA 3LTYA 1XKYA 3BW4A 3W73A 2CFFA 4NNAA 3DKLA 1W5OA 1K7FA 4ORIA 3GAKA 1W56A 2A7NA 4JTSA 4HPXA 1O95A 3P8IA 5BMXA 2VEIA 4WY0B 1GZGA 2ISVA 3LXBA 4LV4A 1TPDA 3GXNA 1NF0A 2V81A 1KLYA 2YCEA 2FPYA 3VE9A 2XN1A 3B05A 1VZWA 2VFIA 3MYOA 1H63A 4XUGA 5LZLA 3UY7A 7TIMA 3UNDA 5U4NA 1XI3A 3QSRA 3VKJA 3DH7A 1W31A 3QQ0A 3A5VA 2R91A 3MO7A 3INPA 1GVSA 2C18A 3HB9A 1WAUA 1QFEA 4IQLA 1YYAA 2J88A 3G1HA 4HNNA 3TK7A 1GJPA 3I6RA 2QJHA 1H7NA 1RVGA 3SSJA 3L5LA 1U5JA 3TC6A 3LRMA 2DZPA 4O13A 1JRBA 4AWTA 5C54A 3IGUA 2ZYFA 3C0JA 4A2SA 2CZ5A 3UWWA 3UYCA 3GVGA 2HTMA 3PSVA 3NL5A 2C14A 3EXTA 3SI9A 2WJZA 5LNSA 3BK0A 1R2TA 3TSBA 1TPVA 1JR1A 1Z48A 4NQ1A 2CU0A 2P10A 1MEWA 3NQ6A 3DZ1A 4AF0A 3TA6A 4LVFA 2X30A 1Z44A 3GXPA 3GX9A 3KX6A 5L6UA 1YLVA 3G3MA 1QPOA 4N9BA 2Z6JA 5CPMA 3DAQA 5DBUA 1RV8A 1S5TA 2QJIA 4CQAA 5D2VA 4AHOA 4B5NA 2FLIA 3BLIA 1AL8A 2GQ8A 5KMYA 2QUTA 1VHCA 3IGSA 4OV9A 3L68A 2XN0A 1JQXA 3NL3A 1SZFA 1G69A 4D2JA 3RF9A 3TSDA 4TX9A 1KA9F 4CNNA 1UCWA 3KXQA 1ZAHA 3ZWTA 1VHNA 4DBEA 3RU6A 2H8ZA 2JK2A 3TSMA 1EP2A 3T40A 4TMCA 5I3IA 1LM1A 1J2WA 1P5BA 1SPQA 3W7OA 1YPIA 3WJWA 1FY6A 1PHQA 1TJRA 5AHIA 3AO0A 2QDGA 3B0UX 2YSWA 1VLWA 3ATZA 2NWSA 3S5ZA 4IUOA 2ZRXA 1LTDA 4MIMA 2PURA 2Z2UA 1WOAA 5G2IA 4JTIA 1ICPA 4GJ1A 3TQVA 2WQPA 3S5YA 3LTSA 1QO2A 2QCNA 3E96A 5FF0A 1X8FA 5FEPA 3O6DA 3QQ1A 3NQFA 2FB2A 3LI0A 1DORA 2J9YA 2Y88A 3FIGA 2WOQA 3W7QA 3SY5A 3MBFA 3LBMA 1O94A 1M6JA 4EVZA 3P80A 4JX6A 3IEBA 1OK6A 1R47A 3O05A 1OFDA 4K36A 5EBUA 3TU9A 1JCYA 3OIXA 3C3NA 2NXIA 5DY3A 3KOFA 5AOUA 3EX2A 4HN4A 3L0KA 4C1LA 3W1PA 4RX0A 1TJPA 3FYOA 4ZQOA 3GZ3A 4M7SA 4DF1A 1LBMA 4IMFA 1IXNA 1TMHA 2DZVA 3UWZA 4N6EA 1R2RA 3CM4A 4K38A 3STEA 3UZ5A 1XL9A 3W84A 1IIHA 4JD4A 2VC6A 4O15A 1Q6LA 1LLZA 3O07A 4JTGA 1ZY9A 2HS8A 3OA3A 4XBKA 1XUUA 3C2VA 3W7IA 3GIYA 3U6WA 2QCHA 4YCPA 3A22A 1HG3A 5C55A 4JEQA 3M16A 2BX7A 2D73A 3W1TA 3P84A 2A4AA 3NA8A 1KW1A 4N6FA 3DENA 3LRKA 4HIBA 4GC4A 4LWWA 4CCEA 4O17A 2DZSA 2NUXA 3LV6A 3C56A 3NQGA 1B57A 1CW2A 3W7MA 3BGGA 2QAFA 4MY8A 5G2WA 1I2RA 5I3GA 4JNMA 3MJYA 2CLOA 3A5FA 3HGSA 2F84A 3IVUA 1SSDA 3BPWA 2J24A 1SO6A 3S1UA 2G95A 4Z0JA 1K03A 3TXVA 2Y63A 1PS9A 3HPXA 3TH6A 1YPFA 4YLWA 1H62A 2BXVA 3NQ7A 3P5YA 5IM51 1VYPX 2KZHA 1D3GA 4Q33A 1NF7A 4O19A 4S1FA 1RQHA 1D9EA 3S1XA 4DPPA 2Y62A 1OFEA 4OHQA 5LNUA 4WXYA 4JYDA 3NZ1A 1QCWA 3M9YA 4AF0B 1FUYA 4JTLA 3NOEA 3HJZA 3DFNA 2WKJA 4DF0A 3W7PA 3GR8A 2V82A 3O8AA 1YXDA 3LHVA 3N73A 3PUDA 3DFQA 2VFEA 1QAPA 5CSRA 2Y7FA 3S1VA 3TW6A 1H1YA 1PIIA 4NX0A 2FJKA 2WNNA 2CLMA 4RZ6A 3PVFA 1I2NA 3CB8A 1A5BA 2ZZ7A 2E77A 1CI1A 1EWEA 3CPRA 4O1AA 5AFDA 3PS7A 1H7WA 4XTIA 1ZALA 5LNVA 1V5XA 4K8EA 3QPZA 3MMTA 4RK8A 2NX3A 4PA8A 3PULA 1OYAA 4Y96A 2LLEA 4HNTA 1NSJA 1GYLA 3P7YA 1SZGA 1ICSA 1VYSX 1RQBA 4NJHA 4JTHA 2TPSA 3TV8A 1MZHA 3OEXA 1TPWA 1OYCA 1OF6A 3P8JA 4UXDA 3C6CA 2ABBA 2PE4A 1SFLA 3GR7A 1P1XA 1WBJA 1G4EA 2FPVA 1IGSA 5CZTA 3TQKA 4A22A 4PL1A 1QO5A 3GB6A 2JBMA 4O1DA 2ZZ1A 1DQWA 1TPC1 4FIQA 3S5OA 1DJNA 1OFRA 2VELA 1F7BA 2IQTA 1I2PA 4FNPA 3WK1A 4O8RA 1WYIA 4WOQA 4WY0A 1LRTA 4UTWC 1M7PA 3P82A 5AB3A 2XFWA 4JTTA 5F4SA 3UWUA 1FCBA 4UR8A 1VPXA 2HMCA 3HG3A 5F4WA 4ADTA 2XN2A 4QJ1A 4JN6A 5CZSA 4DBDA 1L6SA 2ZZ4A 2E6AA 1GG1A 5T26A 4S2CA 3W23A 2Y7EA 1X1ZA 3BLFA 1QOPA 3EWXA 2NX1A 3W76A 3EX6A 1JJKA 1ADOA 3DHFA 1J5TA 3W2NA 2E09A 3HG2A 3T55A 2ZA1A 4IMEA 5F1VA 4FIRA 4KFPA 1MO0A 4K7VA 3GYEA 3SGUA 1VH7A 4R53A 3W1MA 4UTUA 4ADSA 3O6CA 3JRKA 5HINA 3ZFHA 2DZUA 1WA3A 3LCHA 2ZBTA 3CEPA 1PHWA 1DVJA 2VXNA 1SW7A 1S3HA 4LS2A 3P5ZA 4FHAA 5D03A 4QQ3A 4GNJA 6TIMA 1LOLA 1I2QA 2WV8A 8TIMA 4L4LA 5HNRA 3DFPA 1ZCOA 3O15A 4ALDA 5KZDA 1JQVA 2QAPA 4X2RA 3TFCA 1W0MA 3N34A 1FWTA 4U4MA 4CQ8A 1PCKA 4GXMA 3PC0A 4XZ9A 3O1NA 4DPQA 3QYQA 5D09A 3W87A 1WBHA 2BTMA 2GOUA 4AB4A 3P81A 3KVLA 4Z1DA 1GVRA 1FDYA 3O6YX 1YTKA 4NZJA 3IIVA 5CG7A 3LHTA 4RZ5A 3HPZA 4IWWA 5AYYA 4JXCA 1DOSA 4N02A 3TROA 3O06A 3QMSA 4DQWA 4FX6M 3BVJA 3W1NA 4DEFA 3NYZA 2E6FA 3W7NA 2Q3OA 5H2ZA 3EXRA 1I2OA 3GDKA 2AQWA 1EWDA 3NQMA 3HBLA 3TKFA 1GVQA 5G4EA 2P1FA 2Z1BA 2CLHA 4XQ6A 3MHGA 1ALDA 3W9ZA 3LLFA 4FXSA 5HWNA 1LDCA 3GDMA 3TNOA 3S8HA 1O5XA 1OX6A 3L0NA 4FB7A 3M6YA 4CLMA 5FEXA 3TE9A 3W1AA 2R94A 3G3DA 3OBKA 3W7JA 3EWYA 4UR7A 1M5WA 2X1RA 2E6DA 4N9DA 1TPEA 3PB2A 1L2UA 1JCMP 4MFEA 5KTLA 4P61A 5G1YA 1N8FA 5F4XA 3M0ZA 4JGDA 4JTUA 3N9RA 5D32A 4PFMA 4UTHA 3QSTA 3HGJA 3B0PA 1H61A 4LVBA 3W1QA 2FDSA 3GLCA 3L9CA 4MUZA 4R34A 5G5IA 4OU1A 3MHFA 5EPDA 4JTKA 2A6NA 3VFLA 3LOTA 4NXKA 2CLKA 3OVPA 3T44A 4TU1A 4Z1BA 4TO8A 2A85A 5LSMA 1W5NA 4UFJA 3CIXA 2TSYA 1Z41A 3TJXA 2YZRA 3G0SA 5CPNA 3S6DA 1Q6RA 4GFSA 3G1AA 2X1SA 1EP1A 2WNQA 2JKEA 5FI8A 1LP6A 5FESA 4QNWA 1K7EA 5DY2A 5EMUA 2C6QA 2ZFAA 3FLUA 1NEYA 3DXIA 4MY9A 1FXPA 4NJJA 5D2TA 3UD6A 1WV2A 4O10A 1TTPA 3HQ1A 5D2XA 2C3ZA 4LOCA 2PC4A 3GAYA 5K7JA 2QDHA 1KFBA 1FQ0A 4LUIA 2G96A 4AVFA 4LY8A 1SO4A 1G6CA 4N2YA 4GRSA 2YPIA 1AW1A 1LRQA 3CC1A 4O52A 3HG4A 4QISA 2WPBA 5ABTA 1AL7A 2EGZA 2EHHA 1K02A 4AWUA 1JRCA 3H55A 3S0CA 2PRLA 3G1DA 5E0KA 2ZZ5A 1KTNA 1L6WA 1OX4B 2ZRYA 1FWWA 5TBOA 1K3UA 2BLEA 3KRSA 1SUXA 4ONVA 3C2RA 1FDZA 3NPWA 4WUIA 2TMDA 2X2GA 2CLLA 5LNRA 4IXXA 3NM3A 4WY0F 1XBYA 3NL2A 4AMAA 3LHZA 3A24A 1XBZA 3NQEA 1N55A 2ZZ6A 3MP5A 3VCRA 4UMAA 5DCEA 5AYZA 4IXHA 5AHLA 3W70A 4LV9A 3W2JA 3DFTA 1VR6A 3TMLA 2QUVA 3FKKA 3W83A 1TPUA 2RDTA 1JCJA 1LORA 2DORA 4YCOA 1K8XA 4OGZA 2X1TA 5D04C 3W2KA 2I14A 2QEZA 3LCXA 1HTIA 1TTQA 1SZEA 3UPWA 5C5YA 1KM1A 3IIZA 3IV3A 3NPXA 1SR9A 3N19B 4AEOA 3W3OA
chains in the Genus database with same CATH superfamily
3L4XA 4JL2A 2V5BA 3L4VA 3W74A 4AMCA 2RGLA 1VIWA 4KEVA 1F73A 1TSIA 4EPEC 3BAIA 3H23A 1WE5A 4L9YA 5CGQA 3LY0A 2I17A 1DQXA 5KZMA 2P88A 3NO3A 4Q4RA 5FJUA 4YWSA 1V3LA 4CD5A 1JUEA 4L1WA 4RJEA 3VUPA 4LAZA 2DFAA 1XXXA 5HQMA 2D2GA 5CH9A 4JIRA 5A8NA 2NZLA 1B3ZA 2ZE3A 3PBMA 4WDXA 3M47A 3AU6A 1QUMA 4UMBA 2BODX 1OT1A 4OUIA 3B40A 3E3HA 5EYWA 1W6TA 1XG4A 3P2VA 1X7FA 1NWUA 1A3WA 3MO4A 5C9RA 1X1NA 2J47A 2BSLA 4H6RA 1THFD 4MNJA 2WHKA 1TWDA 1AZ2A 4YTQA 3KBJA 3T1GA 4KIRA 2J77A 1SR0A 3G6MA 1OYBA 3M5ZA 2DJXA 4CU8A 2ZUTA 3ZLGA 2VURA 3NDOA 2I9UA 4YL2A 1T7LA 3QHMA 4FO4A 2J13A 5E1QA 1ECEA 2Z1VA 1B4KA 2OGJA 2V2CA 1Q6EA 4K3ZA 2ZRZA 1LYXA 5A6BD 1ZZMA 4C6QA 4MM1A 3EDJA 3IIPA 7PTDA 4KFOA 3URQA 4P7RA 4Z1CA 3NQ8A 5CCZA 2WVUA 4AAJA 4DELA 1S5VA 4UIOA 3MI2A 4PYSA 1H2JA 4MB1A 3ITOA 1D8CA 2OLHA 4XAGA 4MJMA 3VMPA 3A3WA 3DFOA 2OWCA 2XIQA 3PB0A 1JCTA 1V6XA 4S38A 5BU9A 1IGWA 2G5WA 3EA1A 4INFA 1CLKA 1C93A 2WMFA 3CZEA 2Z1WA 3NXLA 2ZCGA 5LGXA 4UFHA 4JEJA 3R7MA 1HL9A 1A50A 3ZJ7A 3RUBL 2WZHA 4V1XA 1M7JA 1LLOA 5LHFA 2ISWA 3R43A 3W82A 4H8HA 2X09A 4PUWA 1E6NA 4PCFA 3DGRA 4OBTA 3THAA 5AN7A 3YPIA 4YTSA 3W88A 2WWCA 1MW1A 3UVIA 2BG5A 3W1RA 2WSRA 1JD7A 4ZB2A 3BSMA 4CVUA 3NQCA 2EPKX 5A5WA 4MHBA 3WF0A 1CXFA 3SN0A 2NQ5A 1EJ7L 3QM3A 3PWAA 3TTYA 1TV5A 3WBEA 2E5BA 5DT7A 4JCMA 4X3ZA 3AMLA 4ZQRA 3EX1A 4MYAA 3FVDA 3VX1A 1ZJIA 1OBAA 3ID7A 5I02A 5EMKA 5FCZA 1J12A 5FAGA 3R12A 4HHLA 3UERA 5JBEA 1GKQA 1L6YA 1KO0A 3VDHA 4AD5A 2AQOA 5AHNA 3W7CA 5K9DA 4FS9A 3WQWA 5DLCA 3WJXA 1KM0A 2XVNA 4J35A 5FIPA 1R8LA 3R1ZA 4AWSA 3NQ2A 3UXAA 3B9EA 3POHA 3NO5A 1UJQA 2XFRA 4GWEA 3EX3A 3L65A 4UCFA 3BV4A 3BAJA 4PMNA 4Z2GA 2VZOA 2WC4A 1R2SA 2YA0A 2BHUA 4UTKA 1BWKA 5K2ZA 2W3ZA 3U7BA 3BJFA 2ZADA 4JYEA 1IXQA 2C7FA 4ZQPA 5BRBA 4K8GA 3D6NA 3LPOA 1FWRA 4GMEA 2REQA 4NXSA 2OFJA 4E8GA 4UC5A 4XX6A 4M7TA 2VFGA 4LS1A 2E7FA 3WJYA 4MYXA 4FXFA 3MUZ1 1VB9A 4LC8A 1XINA 4MFDA 2DZWA 3AIBA 3MI6A 1N2VA 3UXLA 3U8GA 4HMCA 3CNYA 1QXLA 4GUIA 4RLIA 3I7RA 7CGTA 1PO9A 3RX3A 1GVFA 2ALRA 1JPKA 4GZJA 4JX5A 2WQDA 3H53A 4PMDA 3WUBA 2VO5A 5BOFA 2H90A 2QCEA 4ES4A 3CTTA 5HMFA 2E0PA 2CBVA 3GR4A 2JKAA 1Y5VA 1UUOA 2DP3A 5IDZA 4IP7A 3S6TA 4D8ZA 1O60A 1SQ7A 3BICA 3NL6A 1QI2A 3OB8A 1BYCA 1GZ1A 2HRWA 3VTRA 3SSZA 5A6KA 2WSYA 3IV8A 1ZFJA 5REQB 1QNRA 2IUZA 4WKFA 4LAKA 2ANUA 1FXQA 3MC5A 2Z7KA 4BHYA 2YCIX 3ZT5A 5HA7A 1CGVA 5K4ZA 4GNVA 5FOOA 5AYXA 4HHPA 3ANUA 3OVQA 4J1OA 2B0MA 4OT7A 5I06A 4UFKA 3MKVA 5FJIA 3ZJKA 5EU9A 4UFIA 4KFNA 1VCFA 1EF2A 1KBIA 3JZEA 4N7QA 3AIEA 1DJIA 1I0BA 4MJZA 4D6DA 2F6XA 4GIRA 3HMCA 1TX2A 5A1AA 3H21A 1MRAA 3DYPA 1K7XA 2RAGA 3OU8A 1XLHA 3KM8A 3WY1A 3UJ2A 2PTYA 4A6GA 1KFWA 3VOIA 2VCCA 4XSMA 2D22A 4QE4A 4JX4A 3EPMA 1UR4A 1EP3A 2C15A 5I23A 1MSSA 3LCGA 1KFJA 1OT2A 4O16A 3QLDA 5I78A 3R8GA 1HKVA 1J8VA 1VQTA 2VUNA 4I9JA 1BG4A 3S47A 4FLQA 1RJRA 3W07A 4MZYA 4DVOA 3IJ7A 3R58A 4K7YA 3QRHA 1H60A 2VFHA 3ME3A 1GPWA 2DZBA 5CC6A 1MUWA 4XB3A 2P3ZA 4MG4A 5H1WA 3SW6A 1UC4A 3BURA 1W3TA 2MUCA 2PDNA 3E0WA 1S39A 2BY3A 3KHJA 3W02A 4WSKA 3B9OA 3EOUA 1N7KA 4KERA 2YXXA 2DIEA 2EG8A 2PTWA 4JPGA 3M5XA 3BOLA 2J78A 3GTHA 5EBAA 3WSUA 1DJQA 1XYZA 4EAMA 2HE5A 5AZ1A 1P0BA 3BAWA 3T0AA 3CHVA 3TJIA 4KWUA 4Q8TA 4MB3A 3ABQA 5HWMA 2PP1A 3MDWA 3RPDA 1AD4A 1B0IA 4U28A 3CUJA 3M6DA 4F0LA 2OX1A 4HNOA 5I3KA 3VC5A 5D8WA 4IG2B 3UZZA 4ATWA 1F3WA 5FF7A 1IEVA 2QLYA 1UIPA 3WUFA 3DESA 4LB4A 4QAIA 4DWDA 4QQUA 3W38A 3BLOA 4E6MA 5CC7A 3S2MA 1NOWA 5DXYA 3IAQA 1SYTA 1XH1A 2PDXA 2I16A 1NWSA 3WF4A 1C92A 1XYLA 3BDKA 5DCBA 7ENLA 1TJ2A 2VP8A 3MT1A 4NUWA 4M51A 5J5RA 4LNYA 5EKYA 2GDQA 1B5TA 3LM7A 2BB0A 4Z2JA 2VHLA 1SJBA 3W4RA 2F9RA 2XH7A 4IHCA 2KX9A 2X0SA 2GVGA 4JTDA 4AY8A 1HKWA 3T6CA 1PB0A 4S3FA 4IPPA 1QNVA 3ZZ1A 3UCCA 3GXIA 1Q65A 4XTDA 4FR1A 1K8ZA 4IPIA 3H70A 4PSPA 1IYXA 4UBPC 1FBAA 5D05A 3TR2A 3CMJA 1EZWA 4LEFA 3G2GA 1ISWA 3Q94A 1OEPA 2W4XA 4Q8VA 3LLXA 4K6AA 4Q4KA 3WD1A 3WUGA 1UKSA 1B90A 1EIBA 3SIZA 2DVUA 1UZ4A 2XM1A 1BYDA 2NV9A 1WDDA 1J0YA 2VEKA 3F5LA 1XIEA 2VMFA 1ME8A 4DO7A 4BJHA 4XWUA 2Z6IA 3RMJA 4RXFA 1XLMA 1J0KA 3N17A 5D33A 3A13A 1H5YA 4UQCA 5BWFA 3C86A 3GDTA 2ZX5A 3CV1A 4W88A 3FJLA 1LJYA 3LS9A 2NQ9A 4JIPA 2WSQA 1R9ZA 2CLIA 4AZCB 5HXMA 4OJYA 1B4EA 2IKHA 3SJ3A 4UNLA 1REQB 4YYFA 5IBXC 4U31A 1IHIA 1IWPA 3UWYA 2QCMA 1VRXA 3WENA 4AYGA 3N12A 4NVTA 2DH2A 1L6GA 1EOMA 2D2JA 1FWIC 4OOUA 3K2GA 3VINA 1W2VA 4MLJA 4G5DA 2VRKA 3HA1A 3PZUA 1KFKA 3WQ6A 1Q45A 2O9OA 2GGEA 5T9CE 4M29A 1U33A 3L2IA 1DV7A 4RR4A 5FAJA 4Z42C 5MHBA 1EDQA 3ZS4A 1AH3A 3PZTA 5REQA 1S3TC 4NZFA 5FD0A 1M7XA 2INZA 3WLMA 4JDYA 3RO8A 2DDXA 2PBGA 2VT0A 4U10A 1W2PA 2CESA 2WMIB 2QZRA 4KIEA 4BWLA 2BXYA 4AY7A 5U7SA 3NTYA 3VCCA 3T7VA 4RW5A 3TFXA 1W1B1 2NX9A 3W7HA 2CLEA 3GRIA 1EBGA 5K4XA 1M7OA 3MV01 5KINA 3M46A 3T42A 1LLWA 3BLKA 4BK9A 2PWHA 2YLLA 5HMDA 3V4BA 1A5AA 5EMLA 3HFYA 2DUXA 3H7VA 1P6CA 1T8XA 4E2DA 3TONA 2ISSA 1FHDA 1BKSA 3P3BA 3KWXA 3DU0A 1K70A 4GXPA 4L5ZA 3KWSA 1P6WA 3V5OA 3OLDA 4DO4A 4ZODA 5TIMA 1H50A 1K77A 2J8FA 3Q4DA 2NVDA 3VOGA 1W91A 4O12A 4CGTA 4JFVA 4US6A 3DI0A 3RNDA 1DJYA 2VQUA 3T0TA 3VIGA 2PWFA 2V2HA 1PKYA 4F0SA 2Y2WA 1XSIA 2DSKA 2KAUC 4Q4OA 1UR1A 3GYCA 3E5PA 3O63A 2JGYA 1H7XA 4I6VA 3CWOX 1EJSC 2JEQA 3VOCA 1JL8A 3C5QA 3DEQA 3FXYA 3P0WA 2VOMA 2X8RA 3FKRA 3G1FA 3I4EA 1GYNA 1ZJHA 3NNTA 3WD2A 4MPKA 3APYA 3CASA 3LCLA 3VKBA 2PDCA 1IXPA 4OBSA 4NHVA 3ONBA 1A5KC 1ONRA 1AK5A 1WCGA 1HJVA 2C71A 1SFSA 2Y7GA 2GJLA 3FJ6A 5AHMA 1S2WA 2XTKA 3BGAA 3IRDA 3NDZA 3TZNA 1GQIA 2PODA 4IG2A 3F03K 4W89A 3CMGA 1RZMA 3W22A 3K4AA 2YBTA 2NXGA 4PL2A 1IF2A 1GEQA 2OCZA 1KRCC 1NP2A 1G7VA 1MXGA 3W1LA 3FJ4A 4GYKA 1OC7A 1KM5A 1OCJA 1XM3A 3SCNA 5C2XA 2FDMA 4EPBC 5HR6A 2WW5A 5DRIA 1YX1A 2RDWA 2DEPA 4K1WA 1A4LA 2FPTA 2AAMA 1DJZA 3I3BA 3OQEA 1XCXA 3EYPA 2V3DA 4W87A 5I6SA 4HNVA 3N11A 1W8SA 5AVNA 2PDMA 3E2VA 5C6MA 3MBDA 3E12A 1TKKA 5H8MA 1E40A 4HA0A 4AHQA 1JZ7A 4XSLA 2UZ9A 1W5PA 4P8VA 4ZL1A 3KTSA 2VQTA 3STGA 2EPLX 2VD8A 4JKLA 2B31A 2RKXA 1V6UA 3ANYA 3LCWA 4LY4A 3RU8X 2DIKA 2PAJA 5E93A 4NI3A 1Y8BA 2Y8UA 4IT1A 1UD8A 2NVCA 3NSXA 1LBFA 2VX5A 2AGTA 2YOCA 3KE0A 3LHYA 4GQ0A 1SW0A 4WHBA 4I5XA 5E6ZA 4O0ZA 2B7NA 3CHEA 3QY7A 4XAFA 1BHGA 2XH0A 3DG6A 4HCHA 1US3A 3E02A 1IR2A 1JUBA 1UHVA 4GH1A 4MKSA 3BTNA 3OYZA 4JQ1A 4IOTA 3C0SA 4HSNA 2D1ZA 4PTWA 4QDWA 1YHTA 4QDMA 2GVYA 3W2MA 2R82A 4BQ5A 1XBVA 2DSWA 3AOFA 2Z0IA 3HIJA 3ZR6A 3B8DA 4HA3A 2H8XA 3HGOA 4H83A 4AZCA 3ES8A 2DH3A 3W73A 2CFFA 2HK1A 3SRDA 3EWDA 1W56A 2A7NA 5JMUA 1O95A 5BMXA 1REQA 2HVOA 2VEIA 3GUWA 1TPDA 4ZOAA 1NF0A 1X7IA 1W1VA 2NQLA 2V81A 1KLYA 3ABZA 3VE9A 3AIWA 3S2NA 3ALFA 4LF1A 4HU3A 3QPEA 3KBSA 1KWGA 3QGVA 3QSRA 1W31A 4S3EA 4B5SA 3INPA 1GVSA 4HCLA 4QJ5B 3HB9A 4HNNA 3AI0A 1XHGA 4QCFA 1H7NA 2BOGX 2Q09A 4Y7EA 3TC6A 4AWTA 3ZLHA 4A4AA 1RUSA 3C0JA 2ZUSA 4UZUA 2CZ5A 3PSVA 4QJ4B 3MSRA 3WIJA 1MI3A 3EXTA 2WJZA 1R2TA 2V5DA 5HQLA 3IRSA 3UGVA 1EO7A 1M53A 5D9NA 2WMIA 2P10A 3ZT6A 3DHUA 3VD4A 3DZ1A 2OSWA 4YS1A 3AMGA 2EPOA 4LVFA 2X30A 3A3HA 5I09A 5L6UA 3BV7A 1DHKA 3AS0A 4N9BA 2R1LA 2OO6A 4GI4A 2Z6JA 2JQXA 2QJIA 1R5YA 1DIEA 1I9CB 3CZ8A 4CQAA 5D2VA 4AHOA 4HPHA 4J3ZA 1AL8A 2GQ8A 1BSIA 3H6OA 3GH4A 3U4FA 3NL3A 3N2CA 1SZFA 1G69A 1KA9F 5A6TC 3ZWTA 3VU2A 3RU6A 2EO7A 1VFSA 1EP2A 4TMCA 1LM1A 1J2WA 2CKSA 3PZOA 1PHQA 3EA2A 4ZSUA 1N82A 8CGTA 3ATZA 2NWSA 4C6PA 4MIMA 4OFCA 1V03A 5G2IA 4JTIA 1PTDA 1KR0A 3IACA 2WQPA 3VO0A 1QO2A 1UQZA 3LYEA 1KNWA 2V69A 1X8FA 3O6DA 1OCNA 4HU8A 3KOXA 1JDCA 3ZO9A 3FIGA 1F4HA 3UJEA 5GNZA 1M6JA 1R47A 3O05A 1OFDA 3PP7A 4ZSTA 1JCYA 4X60A 3C3NA 4WDUA 5DY3A 1V3JA 1YRRA 3H4WA 2E3ZA 3KOFA 5AOUA 3EX2A 3SCWA 4ZTYA 4IL0A 5DQPA 1TJPA 5E5CA 5CLTA 1PDYA 4DF1A 1LBMA 1TMHA 2DZVA 4GI9A 2BP1A 2WMGA 1PEZA 2WKGA 3URNA 4XD3A 4HHMA 2J7CA 4G1NA 5A6JA 1UC5A 4JD4A 1O68A 1LLZA 4GH3A 2CHOA 4F0MA 1E1CA 4IPNB 3QR0A 3C2VA 2V6AA 3A22A 1HG3A 5C55A 1P6BA 2F8QA 1JDEA 3C8NA 4DBWA 3M16A 2BX7A 1E71M 3DENA 2RJHA 4HIBA 4LWWA 3AU2A 3H2FA 2Z2BA 3GVWA 3C56A 3OZOA 1RP8A 4JTCA 2R9RA 4IICA 1TMQA 2WYSA 1XGEA 3MSYA 4F0HA 3IVUA 3PTQA 2J24A 4PSRA 4Q8QA 1HKIA 2G95A 3TXVA 2Y63A 1H0IA 4CD8A 1Q7MA 1YPFA 4YLWA 1WXZA 4F2BA 4HMDA 1VYPX 2CYGA 2PGWA 1UOKA 2EBNA 3DBNA 2WMJA 3UG4A 4O19A 3AIUA 4DPPA 5LNUA 2OVLA 4JYDA 4DN1A 1NDYA 5GPRA 1MWOA 3NOEA 3DFNA 2WKJA 1OG6A 1MDRA 3CK5A 4PB3A 1GJWA 3ZXWA 5C8BB 4GNKB 1YXDA 3WD3A 2PMQA 1J0ZA 2V63A 3DOPA 4GYPA 4DLFA 1H1YA 5EB8A 2CLMA 1V79A 3WF3A 1I2NA 3CB8A 2GJPA 3CPRA 5AFDA 1H7WA 1K1DA 2DW7A 1ZALA 3W81A 3L4YA 1UH2A 4GKTA 1EH9A 2PUZA 3PULA 3PZMA 2Z24A 1UKPA 3ARXA 1V7AA 4ZE5A 1SZGA 1DIKA 1W3LA 4C6IA 7REQB 1RHCA 3JW7A 2C0HA 1XR2A 1OYCA 4UXDA 1XYMA 3N18A 2ABBA 4Q8MA 4PUKA 1SFLA 2YDRA 3GZAA 1G4EA 2FPVA 1XW8A 4PL1A 3ALGA 3H8AA 1QO5A 4H01A 4IISA 5G4HC 4UWMA 5ABFB 1TPC1 3ZYZA 2WCAA 1DJNA 2VELA 2ZWZA 2XVPA 4XZBA 3RCNA 3SN1A 1UR8A 1LRTA 4LCSA 2PD9A 3P82A 3DGBA 4G2DA 5F4SA 3SFWA 4PRTA 4Q8PA 4S3GA 4UQBA 5E6YA 4DNMA 1S5NA 4P8XA 2ZZ4A 2E6AA 3M4HA 4U2ZA 3A12A 3W23A 2IKIA 2Y7EA 6XIAA 4GX9A 3TYDA 3W76A 3QZ6A 4HJFA 1MNZA 4P8UA 2NSOA 2FZNA 1BF6A 3EPNA 5E09A 3OVGA 4M0XA 3AMDA 4DJFC 1B3XA 1MO0A 1AJZA 4FF5A 1BPLB 3GU9A 3GYEA 1B3WA 2HK0A 5FJJA 1S2AA 2VXNA 1MRQA 4S39A 1RBLA 2DQWA 2HBXA 5HJYA 3P5ZA 1Q6DA 4JTQA 5D03A 1A0CA 1MYRA 5ECVA 4GNJA 3PTDA 3MKKA 3K46A 2WV8A 3QOMA 4L4LA 1JF6A 3DFPA 3S6OA 4XAPA 4X2RA 4M6UA 1Q8JA 5EMJA 3SGGA 4S3KA 1I60A 1V4YA 4PBEA 4TOQA 3PC0A 3CGTA 1V0LA 3O1NA 4DPQA 2VOTA 4OTKA 4AB4A 2GOUA 3V5FA 1A5NC 1GVRA 4PMQA 5CG7A 3LHTA 3VM7A 5AYYA 1H5VA 4D71A 1EJTC 1XLIA 3O06A 4FX6M 3BVJA 3EXRA 3M0MA 1I2OA 4H9XA 4YTTA 3VIJA 1GVQA 5G4EA 2XM2A 4XQ6A 2FZDA 1Q2RA 2VEGA 1ALDA 4FXSA 5HWNA 4DXXA 1O5XA 4L1GA 1OX6A 3VM5A 2OR2A 4CLMA 2DZAA 3TE9A 3A47A 3UPMA 2UY3A 3IWPA 2X1RA 2VYOA 1JPIA 1L2UA 1MFUA 1I1XA 4P61A 4GGBA 1N8FA 1QWKA 3EDDA 4JN8A 4JGDA 4JTUA 3N9RA 4V2XA 1TVLA 1GOOA 3B0PA 3W1QA 3WH8A 3GLCA 4TUFA 4R34A 3MMWA 5GQBA 3VNYA 2A6NA 4B2DA 5CGMA 1BWVA 3QTGA 4TU1A 5DMMA 4Z1BA 5M5DA 4UFJA 1IWAA 2V3GA 3FW6A 2BMBA 3VKAA 1Z41A 3KS5A 4KQNA 2YZRA 3HTWA 1W9PA 3CB3A 1EKOA 5D9PA 4LNCA 2X1SA 3KL0A 5CXPA 2ZX8A 2WNQA 3C0QA 2PDWA 4G8TA 2UWFA 3VYLA 1O7AA 4V1YA 2PGEA 3CO8A 4E4PA 4IIFA 5DY2A 4UOJA 4YHEA 1I75A 4MWAC 4MY9A 3WQ4A 3UR5A 1WV2A 2BVTA 3HQ1A 2VGIA 4GZEA 2C3ZA 2GUYA 3GNXA 3GAYA 5K7JA 3WKZA 4D6GA 5TF0A 3HFTA 1FQ0A 4DJDA 1NDZA 3QLLA 2YB1A 1KKOA 3CC1A 4QISA 5B7ZA 3K5XA 3H7RA 3GHSA 1JRCA 1RK5A 3G1DA 2AL1A 4D6JA 2NT1A 4DWSB 1K3UA 1SUXA 3WYZA 2PLJA 4IXXA 3CHDA 3MKCA 3A24A 1XBZA 1N55A 3VCRA 4UMAA 1BQCA 4IXHA 4CQDA 3W70A 4LV9A 3W2JA 3H7UA 1VR6A 3KBNA 1K9FA 3SEPA 1KCZA 1GVYA 1LT8A 4DBSA 4E4FA 3ARTA 3AIVA 2X1TA 4KBXA 5HAOA 5D04C 1SZEA 4PMYA 2P0IA 4H7VA 2YKKA 1WB0A 1HKKA 1G67A 1FOBA 1ZU8A 5J04A 3WDHA 4ML9A 4D72A 3LRLA 3L5MA 3VDAA 2PWVA 4I7VA 3EOOA 4NZCA 2VTFA 1HFBA 3N4FA 1KR1A 3BMVA 1HJSA 2PP3A 1UA7A 3M41A 5ABFA 3BUVA 2NQHA 3DYOA 3RDKA 2R14A 1IXOA 5CPOA 2YYUA 5DCDA 2IS7A 1Y0EA 1LZOA 3WQVA 5DEZA 2O7QA 3O9NA 5GVJA 4C7DA 1G4PA 1JUKA 3MV11 1Q3NA 3LMZA 3W28A 2BWGA 3BL3A 3LCIA 3CH0A 1UA3A 4R33A 2DZXA 2E9LA 3W71A 3KRUA 3SCVA 4H8NA 3XINA 4AEFA 1J10A 4GVHA 3FAWA 3PZQA 3KW3A 3AHTA 3M0YA 4GUHA 2HE8A 1XFBA 2QR6A 1XDLA 3R89A 2ODOA 3ABRA 3M5YA 4QM1A 3SECA 4ROPA 3Q65A 4FX8A 4HK6A 2FMOA 3AHZA 4F3HA 2XWEA 4MPQA 5DN1A 3W7GA 3NIYA 5BW6A 3LBOA 1XV8A 3TLLA 3TX9A 2ZE0A 5KEZA 1Z6KA 1KBLA 4C6CA 1UR3M 2NV1A 1VKFA 3LPPA 3MCNA 1JVNA 5JUVA 2VEPA 2PCQA 3S46A 3GVVA 1GCYA 3SUSA 2CERA 4PODA 2FZBA 3QGKC 2DU2A 4B15A 5CBBA 3M44A 1V3MA 1WXYA 3UZXA 2I5GA 5BRPA 3H12A 4GJJA 3G5EA 3OODA 1F3XA 3N2BA 4XKYA 5T9BG 3GIQA 1OB0A 3VDBA 1NOFA 3QH2A 4FLSA 4D8AA 3POCA 3THQA 4M6VA 3QMRA 1HGWA 4TTUA 2PDKA 4QS5A 2WZTA 2IPGA 3VNKA 1UB3A 3HQPA 3TUUA 3S9ZA 2ZDRA 1GORA 2GYIA 3PZIA 3R5EA 1VEPA 2VX4A 1A5CA 3BG5A 3TW7A 3FV9A 2XZ7A 3PPGA 4JDBA 4FA3A 1X1OA 2W5FA 2WM0A 1OK4A 1D2KA 3CEUA 2YW3A 3L66A 1VC4A 4JY8A 4QBXA 3WQGA 3UR7A 3NSNA 4MDOA 1G9HA 1T0OA 1LROA 3KHDA 3EX4A 1Z7AA 3KVKA 3KAOA 2OZTA 1CGTA 2NLIA 2XISA 2QIWA 4P7OA 1ZGDA 3L2LA 3R8HA 2CBJA 2QYGA 2P0OA 1TRIA 1TV7A 1UD3A 4BQ3A 5T8GA 4C7GA 4CCDA 5LA1A 5I5RA 1QATA 1FHUA 3HPFA 4LANA 1W9DM 3VMNA 2IQ0A 4MZ1A 1Q6OA 2VZVA 2XIMA 1XDJA 2Z00A 1IQ8A 3WX7A 3ITXA 1C9WA 3O7UA 2RDXA 2QCLA 1SJCA 1Q6QA 3WQPA 2QPUA 2BY1A 3QV8A 2JGQA 3QKEA 2MNRA 2PRHA 3B0YA 2PEVA 1XH2A 3EWBX 1UQYA 2H3DA 2R1MA 3OBEA 1TYGA 1KLZA 3GC5A 1BWLA 1KD0A 4LS0A 3E49A 4ERGA 1P0EA 4F0RA 1QR7A 3EKZA 2B4GA 5GNYA 4E0CA 2VRQA 3AS2A 1UR0A 1IEXA 3MWAA 1F3EA 4IQEA 3KLKA 2J9XA 1PZ1A 5FACA 1XDMA 1JPHA 1OFBA 4LSBA 1SMDA 2EQDA 4UZSA 4W9TA 1UZDA 3FA4A 4NRRA 3LENA 2X16A 3WLTA 5AHFA 3K8MA 2PDPA 3V1PA 1OC5A 1HKMA 1GTEA 1VCGA 4M1RA 4O57A 4AU0A 3GHRA 1PKNA 2YIHA 3V18A 4EE9A 5LNWA 4O28A 4PTVA 3QFEA 1GK8A 3WMBA 4DWSA 4AZ6A 3FSUA 4RDYA 4LRSA 2VM8A 1JYXA 2YYTA 5AECA 2W27A 1Y5XA 1DWGM 2JE8A 3PR2A 4G7FA 2YB4A 3D3FA 4B4HA 2GJRA 2OSXA 1W9BM 4KETA 4I8DA 5HQEA 2BOEX 4L7ZA 5JH1A 3L7RA 3QR3A 1OADA 2AL2B 1YADA 4HP5A 5D2YA 1VBJA 3CTLA 4EXQA 5LHEA 4QSHA 1EJRC 2OZ0A 3C4UA 4MKVA 4O4WA 5HR7A 2Q3RA 2D3NA 3HQOA 1R3VA 3VNMA 5H8UA 2CWNA 5CBIA 3H26A 4KS0A 4GE8A 4B4FA 1EHNA 1W3IA 3NPUA 3E9AA 1W8GA 4RW3A 4XG1A 5DELA 2FGBA 1QOXA 4YWIA 3ZQ9A 3BAYA 4XZLX 3PBYA 3UR2A 4EPDC 3CZGA 3T0BA 4B91A 1PPIA 5A8PA 3LSBA 1F6KA 4OV4A 2QUUA 4YTUA 4AZ5A 1NTHA 2WNZA 2DUZA 5CG0A 4G6CA 4L80A 4ZO6A 4Z1YA 1OIFA 4NU7A 3SAZA 3F4DA 1R86A 1MNSA 1WP6A 1L9WA 2JIEA 1L8PA 2YFNA 3KP1A 3NEVA 4DYJA 1W3HA 1XC4A 4I7UA 3BLPX 3SQSA 4AX6A 2A2IA 6REQA 1FHVA 4GGHA 3NSMA 4CUCA 3MYPA 3P60A 2FZ8A 2E5DA 1BD0A 1BLIA 2YXOA 3LDVA 1QK2A 2GDVA 1HP4A 1Z32X 3ATYA 4QG9A 1ZJAA 2VKZG 3B04A 4A21A 4C60A 3W7LA 4LAOA 4HB7A 4I9AA 1F61A 1YTDA 3G0XA 5A2CA 3DN5A 5TD4A 1DWAM 1GQNA 3UESA 3SR7A 4NAEB 1RALA 1GVEA 1B3OA 3WH6A 1E51A 4I9MA 3NAVA 4XAZA 4FEZA 3ITCA 3B97A 2DT3A 3CYVA 2EAWA 4M6QA 2Z27A 1UKOA 4PUUA 4Q8OA 2J66A 4XZNX 1DWHM 4LFYA 1E0VA 1FCVA 4KESA 5FA5A 3TQ0A 4LB3A 4HZ8A 1KWKA 2VZTA 1V3KA 2YBVA 1PXGA 3G24A 1NY1A 2INEA 2GSHA 1VENA 4YHGA 3PBUA 2QJGA 1UG6A 4IIEA 1HL2A 4LH8A 3LNPA 3FN9A 4UOZA 5BROA 4IMGA 3CV7A 1YTEA 2GUBA 2OZ3A 3T78A 2WKLA 1LOSA 3MPGA 3I10A 1OFQA 3KEHA 1QDSA 1R46A 4FOUA 1XRTA 3CUIA 2WJFA 3WEMA 4RCXA 2A79A 1WZKA 4KPLA 1TO3A 3HF3A 3EKLA 4UTTC 2V2DA 1WUEA 3MSDA 3MI3A 1FH7A 4KWWA 3W7RA 2UBPC 3QV7A 4Y8EA 3W25A 1X8CA 1AJ0A 1YNQA 4O4VA 5CZ0A 5A6SA 4W5ZA 3VNLA 4NZ1A 1DQUA 3CZJA 3BZJA 3DHDA 4XZMX 1QTWA 4GVGA 1EUNA 4HPJA 3GNPA 5BOEA 4M1BA 4LYRA 1Y7VA 1EB3A 2ZRVA 1DBTA 1G7UA 4PB5A 1HO1A 4RZ4A 1OF8A 1L6FA 3AXKA 2Y6ZA 3CUHA 3MANA 4AIEA 2YR1A 3F2BA 3GDLA 2V0TA 4IP4A 1Q7QA 3IANA 4CD6A 1GTHA 4QCEA 4EWND 4IQJA 3L23A 4IUGA 3B8IA 1LL6A 1ME9A 2V5KA 2FVLA 2BY0A 2V68A 3SRHA 4DBUA 2PSNA 3CMFA 4HYVA 4JHMA 1F8IA 1W37A 3L67A 3PWIA 4X63A 3AIQA 4R9OA 2XDFA 2P76A 2I9EA 3IVSA 3P62A 3A23A 5E70A 2VDIA 3EZ4A 1FH8A 4GOAA 4NZ5A 3HN3A 3RK8A 1UP2A 4P5UA 1G4SA 3UETA 3OHMB 3R79A 4CD4A 5D9OA 2Q01A 1CLVA 3I7QA 2FQIA 2HXTA 2OXNA 3BZGA 1HZYA 4ZZ9A 3W72A 1C8YA 2WM1A 1V7YA 1KFLA 4HU0A 4JOMA 1OFOA 3S9IA 2DV0A 3EMCA 3GXDA 2WAGA 3WQ8A 3BAXA 1RVKA 2H9AB 3GH5A 4M80A 4N4PA 2A21A 1KBKA 2JALA 4JIQA 4LU0A 4ZXLA 1FWCC 2PTDA 3U2ZA 1K9EA 3GTFA 3CLMA 1F05A 3CO4A 3MY9A 2QMKA 1TPB1 4ENLA 4HPGA 2AL2A 4LCQA 4N9CA 1IT7A 3MCMA 2J7GA 1UROA 3QMTA 1Y65A 1H7OA 5EMYA 4X9SA 3CT2A 3BG9A 1WDSA 2YL6A 3QBUA 4GUJA 4UB9A 5I2UA 4AC7C 2YW4A 1R3TA 1W17A 4FNRA 1H1NA 1RJQA 1UZHA 3IUHA 1KXHA 1X38A 2AQVA 4IMDA 1YNPA 4Q7IA 1E0UA 3UCQA 4ORMA 1ZQ5A 3CWHA 2MANA 5I3JA 2QV5A 2ZDSA 1TIMA 1E9YB 3WNMA 1WO2A 3LPFA 4JQ3A 2HNHA 1GOKA 4HMEA 2A5HA 5CZJA 4FR6A 2PDJA 4E3VA 4DO5A 1DHPA 4H9ZA 4BR1A 3GQYA 4KKXA 3CQ0A 1ODZA 2CLPA 1TRDA 3NO1A 4ZOCA 1SJAA 2G3JA 2D20A 1R9XA 2XVLA 5J8LA 1F76A 4DWSD 2ZOXA 4R9XA 3V75A 4X9YA 3LGGA 3ENLA 4PUJA 1YW1A 3ARUA 5I3DA 2OJPA 2OEMA 3ABSA 3KBVA 2DVXA 4F66A 2DVTA 4ZFMA 1EC9A 1FCQA 4ICCX 2CLFA 3GU2A 4LVAA 3U3HA 3RX4A 4PR4A 4ZB0A 3LPGA 3PAJA 3CJPA 1K4HA 3N6QA 1VCVA 3QTPA 5C9UA 2PDYA 2JEPA 4U5KA 3IUIA 2F7FA 2FGZA 2QGYA 1M3UA 2CXEA 3AISA 4FNQA 2TODA 4JTEA 5D02A 1PTAA 4LF2A 4MY1A 3ARPA 3NYDA 2DZTA 4FLOA 4C6NA 1CENA 5C71A 1W9XA 2HS6A 4A8NA 4NAEA 5CJMA 2W91A 3IVTA 3S42A 3WD4A 2R1PA 1O4UA 3W7DA 3ES7A 2W6RA 3W86A 3FNDA 4XZWA 1Q6CA 2C19A 4LYPA 3AICA 3FCPA 4XBJA 4ATDA 2WLYA 3WD0A 3G1YA 2ATMA 1F8MA 2NXHA 1TPFA 2E68A 1EPXA 3OBAA 4EX4A 1FWNA 4HK5A 2Y61A 5LIYX 3I4KA 5FF3A 3N6JA 3AS1A 3AZSA 5FJRA 4B9YA 1AQHA 4DJEA 4WDTA 2BHYA 4UR9A 3B8VA 3UGRA 3NR0A 2OT1A 4MNMA 4JR5A 2V8ZA 3U4AA 2OQLA 4HZ7A 5JQ9A 4O1CA 3GDRA 3MW7A 2HROA 4PBGA 4EOUA 4MZ8A 5LKYA 1TPH1 4HBKA 2XYLA 4JNZA 2QQ6A 2O9TA 3K1GA 2WZEA 2YCLB 2PD5A 4WJXA 1HVQA 4ZMGA 1W1PA 1ZBKA 1VFUA 1JDAA 1W5QA 3E0FA 3WBAA 1LBLA 1KV5A 3KZSA 1QI3A 1AW2A 3H4GA 1CGWA 7ODCA 3EB2A 4IFRA 4BI5A 1QHZA 4MAZA 2PBOA 3W2LA 1LUCB 4ADUA 2ZIDA 3Q37A 1TCDA 2W79A 1BRLB 1FWBC 3HQNA 4ZEPA 2NQZA 3EWUA 3THCA 4DJFD 4DYKA 3EMQA 1JZ6A 1E72M 4Z08A 1J2BA 1EX5A 4AQLA 4HTYA 1HN1A 1HX0A 2DSUA 1EBHA 1DJHA 4MNKA 2B7OA 2XIOA 1GKRA 4ZA0A 5D8ZA 2PC8A 3U0HA 4AZIA 3LTPA 1DWIM 3UF9A 1TWZA 1QK0A 5D30A 1SU5A 1KRBC 1S2UA 4JICA 4F0KA 1YMYA 4POCA 4KMQA 4QG8A 3ABXA 2D69A 1ODUA 3UWVA 3RM4A 1H51A 5CPLA 2WANA 2XIBA 4PC8A 4UNKA 3N9KA 3S4TA 1YXCA 2PTZA 2RH9A 3LQGA 3U7VA 1RBAA 3H2MA 4N42A 4R7OA 3VNDA 3STFA 1PX8A 2Y70A 5LIKX 3GTNA 4B5XA 4ZE4A 4BY3A 3NWRA 3W26A 2BGNE 1A47A 3BLEA 1QOQA 1HUVA 3QN3A 3LTYA 1XKYA 4H8VA 3SUTA 1DPMA 1W5OA 4WIWA 4JTSA 4REQB 3ITGA 4WY0B 4RV3A 4I90A 6TAAA 5KZ6A 1B9ZA 2P53A 3FDKA 1GOMA 2ZUVA 4B9ZA 2XN1A 3B05A 1VZWA 3A4WA 2CIPA 1BVZA 4Q4QA 4PMXA 4XUGA 1FKXA 3AWNA 3UNDA 5U4NA 1NOUA 1XI3A 3VKJA 5I77A 3MO7A 4J4KA 1CLXA 2WHLA 2J88A 1GJPA 5BCAA 3I6RA 2FHFA 1H4PA 3MUY1 2XUCA 2F61A 4B16A 1JRBA 4PB4A 4YVPA 4EAYA 3AHYA 1FWDC 3UYCA 2HTMA 4L61A 2C14A 1JR1A 5E0CA 4DXKA 5I0DA 1MEWA 3WMCA 3ISIX 3NQ6A 4AF0A 2X42A 4AD2A 1QRQA 4B3LA 1Z44A 1E70M 3GX9A 4RNIA 3RCMA 5DO8A 3ARZA 2BVDA 1QPOA 3ZMRA 2WB5A 2FHBA 3TN5A 2Q6ZA 4PCNA 1OCBA 2WVVB 2QUTA 1VHCA 4GYFA 4OV9A 3L68A 2XN0A 1JQXA 4WSHA 4D2JA 3TSDA 5FSDC 4LQ1A 5JIPA 2QDEA 2HEJA 3RX2A 4DBEA 1UMYA 3VCNA 1PX3A 2CCRA 3B0XA 3QKZA 3TP4A 3T40A 2PZ0A 4HZ6A 5BZAA 4URIA 5I3IA 2P8BA 3WJWA 4V15A 2W66A 3AO0A 1S1PA 3TW9A 3EB3A 3B0UX 2B81A 3UT0A 3MCOA 1Y5WA 2QJMA 2GLKA 2Z2UA 3GDBA 2JF7A 4HNCA 4O1FA 1FVPA 1TZZA 4W8AA 1YIXA 1KBBA 2VDHA 2OB3A 5FF0A 2UY4A 3VGDA 4E2OA 2J9YA 1XYAA 4TQTA 5LXXA 2J8GA 4CQBA 1L8NA 1RH9A 2D0FA 3MBFA 3UJSA 3PAOA 1O94A 3IJLA 1OK6A 1TV3A 2J7EA 5EBUA 1AQ0A 4ZO9A 3KZPA 4DZAA 1OD8A 1RBOB 4H6EA 2E67A 4OIFA 3WQFA 4HN4A 3ITVA 1GNXA 4L65A 2GGGA 3OGRA 4RX0A 4GA8A 1PWLA 4ZQOA 3GZ3A 4M7SA 1UD4A 4IMFA 4DI9A 3UWZA 2PGRA 1R2RA 4JKMA 2R6OA 3UZ5A 3CUZA 5CGTA 4D1IA 3W84A 1FWAC 1IIHA 4IH3A 3O07A 1ZY9A 1PYMA 1NARA 4OKDA 1BFNA 2OZ8A 3RM9A 2AKZA 2WLZA 3W7IA 2QCHA 2ACUA 1G1YA 5BXTA 1EDGA 3RO6A 4Q8UA 2GQ3A 3C0LA 1OINA 2A4AA 1KW1A 2PDHA 4CCEA 3WNOA 2DZSA 4DHGA 3MB9A 1B57A 1V51A 4OOZA 3W7MA 5ABEA 1KXQA 2QAFA 3AJ7A 2ZUMA 3BGGA 4L6OA 1VFMA 3MJYA 5FL1A 4AW7A 3HGSA 2F84A 5C0QA 1MMFA 1SSDA 4QLJA 3S1UA 3OOQA 3WLIA 3TYCA 4BZYA 3DHPA 4D6FA 4JAWA 4P8WA 4NASA 3HPXA 3TH6A 5H8PA 1YKWA 3P5YA 2J62A 3NQ7A 5IM51 3WELA 2YCLA 1CXIA 3VABA 3SN4A 3QVQA 5LIXX 4OHQA 4WXYA 4GJIA 2ICSA 3W53A 1V02A 3M9YA 1UR9A 1FUYA 3XISA 3FGCB 4JTLA 4G56A 3KCJA 3KLLA 1KCLA 4J3UA 5F7UA 3CL8A 2J74A 1BRLA 4HA4A 4WRHA 1ISYA 3UFYA 3S1VA 2EPNA 1QNSA 1PIIA 2J75A 4NX0A 1E0TA 2WNNA 4JHZA 1ENUA 1A5BA 2ZZ7A 3ZJ8A 2E77A 3ARVA 3FAXA 4NF7A 4XTIA 1TELA 1OZQA 2VDGA 1V5XA 3QPZA 3MMTA 4CVWA 4RK8A 4ZGYA 2ACSA 4PA8A 1E3XA 1P43A 4AIUA 3CAKA 4HNTA 3T81A 1NSJA 1GYLA 2CKRA 1A0EA 1ICSA 4JTHA 3WNLA 3TV8A 4DJED 1MZHA 3OEXA 1TPWA 3R4IA 3JUGA 3P8JA 4HK7A 3VGBA 3WLKX 4UQ9A 2Q8XA 3H4XA 1P1XA 1WBJA 1U30A 1AQMA 3M0LA 4WEVX 2ZZ1A 4XV0A 1E9ZB 1DQWA 4HTBA 4FIQA 7XIMA 3R0KA 3KUMA 1CB2A 2IQTA 2XIJA 5IOBA 3F4VA 3EGJA 4O8RA 4REQA 4WOQA 4WY0A 2QJNA 3IJQA 1I6NA 3VC6A 1ITQA 3FJNA 4W7WA 3VIHA 3THUA 4UR8A 1XS2A 1TVPA 1VPXA 2GGJA 4ADTA 3HG3A 1SMAA 5CSYA 1VFFA 2AAAA 4S3JA 4QJ1A 4H9UA 1E5NA 4BEQA 2VCBA 4DBDA 4CU7A 4LUTA 1V0NA 4RNFA 4S2CA 1JPMA 1QOPA 5LYRA 3VGEA 3W6LA 3LUTA 2NX1A 5D9MA 1IEQA 1N8WA 1RK6A 4XK2A 3EX6A 3RG6A 1JG9A 1JJKA 3DHFA 1J5TA 1EX1A 2E09A 1NM9A 2ZA1A 3U2EA 3T2PA 4C6LA 1O5RA 4KFPA 2V67A 1LWJA 4EACA 4KEMA 4UTUA 1E6QM 2J25A 2DZUA 3GXFA 3LCHA 3GIPA 4H2HA 1DJGA 4DAFA 3ZSTA 2G8ZA 3RXZA 2Y5JA 1DJXA 1GHRA 2EJ1A 3TCSA 1WUFA 5M1TA 4RE2A 4QQ3A 4GINA 3WDQA 5B7YA 3USZA 6TIMA 2BGSA 2X7WA 3V35A 4LUYA 4HA1A 2GJXB 1ZCOA 2WVVA 3V7PA 4XD5A 3EWCA 2OELA 4WVXA 2ZXAA 5KZDA 1J6OA 1JGIA 2DGAA 1QBBA 2CETA 3TFCA 3LZ5A 1W0MA 4JIHA 2V3EA 1R3WA 1PCKA 5BXRA 1XIIA 3KS6A 4JFTA 1GEHA 1WBHA 2BTMA 3O0FA 1J0HA 3BWWA 1FDYA 1YTKA 4XIMA 3HPZA 1R87A 3GU1A 4DB7A 1C8XA 1RPKA 3W1NA 4DEFA 1CXLA 1EXBA 3NYZA 1JDFA 1HGYA 5DANA 1TFVA 3HBLA 3TKFA 2P1FA 2Z1BA 2CLHA 3MHGA 4GPNA 3W9ZA 3LLFA 1LDCA 3GDMA 4PN2A 2VWTA 3TNOA 4ATLA 1EFZA 3L0NA 3W1AA 3W27A 3W7JA 5A8OA 4P7QA 1RY0A 2VCAA 3PB2A 4J3VA 3M0ZA 1LQ0A 1C91A 3F2DA 3BLDA 4BEUA 1H61A 4UNIA 3L9CA 1IT0A 1Q13A 4OU1A 3MHFA 1UWAA 5EPDA 4RE4A 4IIBA 3VFLA 1S2VA 3T44A 2O92A 2F2HA 3T05A 2WNWA 4DM2A 4BS0A 5LSMA 2VNCA 1DEDA 3WH9A 3IGHX 4WSJA 3TJXA 3S5SA 5HDRA 3UEQA 3PJUA 1FWGC 1U5VA 5CPNA 1EHAA 3WQEA 3G1AA 3LU2A 3RIKA 3EDFA 1LP6A 2VWSA 4QNWA 5HJXA 1CB7B 3B8SA 2ZFAA 4IFKB 1NEYA 1M65A 1M68A 4AZHA 3URBA 1J79A 4PTMA 4OECA 4IMAA 5D2XA 4LOCA 1RP9A 1M04A 3PUGA 3SY1A 1U2YA 1R3QA 2G96A 4AVFA 1G6CA 4W7VA 2YPIA 1AW1A 1LRQA 4GACA 1TUXA 2WPBA 1S46A 5ABTA 1M01A 3G1RA 2EHHA 1TCMA 4MB4A 4AWUA 2FGLA 1FKWA 3S0CA 5JU6A 2PRLA 2Y8VA 5E0KA 1OX4B 2ZVIA 3KRSA 4WF7A 1JAEA 2ZXBA 5A8MA 3ZSSA 3RRXA 2TMDA 1W1IE 5LNRA 4E4UA 3WH5A 3NM3A 3NL2A 5KETA 2ZZ6A 3MWCA 4FALA 3WFZA 2YA2A 1SJDA 2PWEA 3RJYA 3URAA 3TMLA 3FKKA 3W83A 1IZKA 1GVIA 2PLMA 4YCOA 1TR1A 1AVAA 3UPWA 1KM1A 3NPXA 1SR9A 1E6ZA 3W3OA 4IJCA 4QDPA 3G18A 4GCXA 3TMQA 3H2EA 2FKPA 4DZHA 4IPJA 3VZZA 2RJGA 1HT6A 3HPAA 4XAYA 5AC5A 4H9VA 1IT8A 2VVNA 1O5KA 4I7WA 5CZKA 5F2GA 3CWNA 4NKCA 2PDBA 2QKFA 4AUBA 4GQQA 4D6IA 3U5YA 1BTMA 3VIPA 3WK2A 2WO5A 1TREA 3I68A 2Z1KA 4KEUA 1XUZA 1TTJA 5XINA 1UWRA 4AXKA 1W9UA 1NDWA 3GFYA 1XLAA 2DW6A 3A4JA 1EIXA 2ISFA 1F9CA 1YDOA 1V6TA 3L0GA 1QJWA 2PA6A 3GO2A 1DXEA 1FWSA 4D8LA 2CWXA 4FNTA 5AKQA 1UUMA 1R3SA 3B3DA 4QIUA 2QF7A 1UBPC 1AA1B 1BF2A 3OPSA 4NT0A 4L4OA 3TDFA 2A0NA 4C7FA 1T96A 1KGUA 4JQAA 3WLPA 4NJGA 4EF8A 3EDKA 1P7TB 5IFPA 6PTDA 1R85A 1SM9A 4Z0SA 2VUYA 1N8IA 4AZBA 5C70A 4KCWA 1YQ2A 5FF4A 4LCRA 3SGZA 1OY0A 4ROQA 1FTXA 4TVCA 2RUSA 3TYEA 2QF8A 1ONWA 3H2OA 3ZR5A 2HBVA 1QW8A 2A7PA 5B80A 3MTWA 3P61A 3G8EA 3HO8A 1ZP3A 3T0CA 1UWSA 3M43A 1J0JA 4C6OA 3SCOA 1FRBA 2O9PA 4GYJA 1KQYA 3QPYA 1XIGA 4O53A 1XC6A 1W3JA 3W7EA 4GISA 1DWJM 2FH6A 2B7PA 4TMBA 1OGSA 3VX0A 3J7HA 1BGGA 1KV8A 3P74A 4PH6A 4HNUA 3RAOA 5FEWA 1E73M 2XVGA 1TB3A 3JVAA 3WDRA 2E6YA 1HXJA 2WHMA 1TE1A 2AGKA 3GKAA 4GFIA 4Z2KA 5CPSA 3APTA 3SJNA 4EPKA 3BH4A 1B2YA 3VKCA 1B9BA 1QVBA 3AQUA 4L9ZA 4D6EA 2CW6A 5HJLA 3VI2A 4LEQA 1K8CA 3PK7A 1ZAIA 4NL1A 2VEFA 2BBFA 1W1TA 3CQKA 1VJSA 3RILA 1ELSA 2YXGA 2W61A 5LA2A 1RQEA 2ZICA 1PV8A 3QGAC 3AALA 4BF5A 5FSEC 4H6KA 4F40A 1G01A 3AYSA 1CXEA 1JZ4A 3KBMA 1GT8A 2HWGA 2HPIA 3S2JA 4MDPA 1VEMA 5BWAA 2Q71A 4C6BA 1XIFA 3NGJA 3NVTA 4U3AA 2NV2A 3P6LA 4DAIA 1UBSA 4KGJA 4PTNA 5CSSA 3UZYA 3RPMA 2CEQA 3GHUA 1XH0A 3N04A 3TA9A 3IIOA 2GGIA 1LOQA 1KM2A 2OU4A 4JIEA 3VAVA 4DM1A 2BVYA 4HD5A 4XD6A 4RNHA 4NY2A 2GSJA 2EG7A 4ZQMA 1GWJA 2J7DA 4W8BA 4QE1A 3OG2A 3C2OA 2OYMA 3I7SA 1OJXA 5KITA 1IV8A 2BDQA 1C29A 3RR4A 1EXPA 3L4WA 2TRSA 1CTNA 1DKWA 4IFKA 3I6TA 1WKDA 1A5LC 1KM4A 4J7RA 4IGHA 3LHWA 3RLHA 1XGZA 3I65A 3SQLA 5CPQA 3VZYA 1A80A 4ZVJA 3GBDA 1KM3A 2A6LA 1U1JA 2V5JA 4D6CA 2DPEA 1I1WA 3WQ5A 1KM6A 3T8LA 3UJRA 4A3QA 2ZZ2A 3WQOA 1OX4A 3CH9A 1U1HA 3ITTA 1KTBA 1RD5A 4ERIA 1DIDA 4LAMA 5DX7A 5GJPA 4JBRA 1S5WA 2C1HA 4H9TA 2PWUA 4OZOA 3UXDA 1NWTA 3SBFA 2YCJA 3NG3A 3MDUA 1QPNA 2DT2A 4O0KA 1AH0A 1J4EA 1V6WA 1CBGA 2Z26A 1VF8A 3GE7A 5K3VA 1VLIA 3N2MA 4HGXA 5AC6A 1FP8A 4MLRA 3KFTA 1IE7C 2H3BA 4IZGA 1K9TA 3QV9A 1LG2A 1ZB5A 4C6KA 1PVNA 2HV5A 2NW0A 2ZVRA 2Z28A 2QCCA 3FOKA 4IIGA 4XZIA 1B31A 2WWDA 3FHAA 2X2YA 1X98A 2YL5A 3VUSA 1R7OA 3RN6A 4M8UA 5E9AA 3ERPA 3QW4B 3BC9A 3LB0A 3PANA 3PN8A 2ZUWA 3BAKA 1XX1A 3WLOA 3TZFA 3N14A 5IRPA 4PBFA 1WQ5A 1EQPA 3AWOA 3OTRA 5CJNA 1ZENA 3MZ2A 1HF6A 2IKGA 5H91A 1JF5A 5MKGB 4MSSA 3QYSA 2I57A 2O55A 3TEVA 3MP3A 4W93A 3GNRA 3C8FA 5JBDA 3TTQA 3ZT7A 3HZ3A 3VPLA 5A2BA 2E40A 5IFTA 4ZR8A 4MGGA 4CU6A 4K8HA 4WZHA 3CLWA 4NI8A 4CCZA 1T41A 4CN6A 2A3AA 2OPJA 4XO6A 2E28A 5HPOA 2XSXA 3LG3A 3VKDA 1OHLA 1AG1O 5BRQA 1P7TA 3ZR4A 2ZXQA 3MZNA 3RFAA 3T07A 1KGXA 3M0HA 1H11A 3EXSA 5A3HA 1NU5A 1PIFA 1Q85A 4KGLA 5HMSA 1KKRA 4GBDA 2Q8LA 4Q7NA 4C1KA 3B4UA 2QCDB 3FFSA 1UP0A 1CGYA 4H2CA 4NNBA 1YDVA 1GGOA 6ALDA 2PU0A 4C6JA 2EEXA 1UJPA 4ECLA 4OUEA 2G3FA 4TV5A 3IIXA 4E38A 1H41A 4W7UA 5D38A 2DIJA 1P4CA 4KWSA 1HJUA 1ZL1A 1M41A 3WJZA 1P48A 3Q67A 4R7JA 5D4YA 2WJDA 4DY1A 3TJLA 4YYCA 1QBAA 1P1MA 1US2A 3PPHA 2G3NA 4G1KA 2NUWA 2QPSA 2PDFA 3E38A 4O54A 2DSZA 1XCFA 4HSOA 3UXIA 3RITA 4FK9A 5I3FA 3WQDA 2BZNA 3MUXA 4AVOA 2PPGA 1PL9A 3WDIA 1H0GA 1GG0A 3ANVA 1FHLA 1F4AA 2BXZA 2OQHA 3DCPA 2PGFA 1AMKA 3PM6A 4LX4A 5FKYA 1R9YA 3M07A 3E0VA 3BW3A 4NSBA 1HW6A 4BWLC 4GK8A 4MJ4A 3PHAA 1EYWA 3MS8A 4D1JA 5CAHA 4HN8A 3UWEA 3DKJA 3TTEA 4QLKA 1OZMA 1Q4WA 4PTDA 5KZEA 5FL0A 1T5AA 1H1ZA 4UFLA 1LRNA 1A5OC 3E2RA 3W29A 2W63A 4ZO8A 1JULA 4F4RA 1MW2A 3FEMA 3BXWA 3STPA 1ZRQA 3KRZA 1QPKA 1UKTA 3EEZA 5ABGA 1TV8A 2E1WA 2Y5EA 5HBFA 2YL9A 3TN4A 4PGLA 1I45A 3LBCA 1MW0A 4JTRA 1LL4A 1PCWA 2VGFA 4OWGA 3LLDA 1JZ2A 1QMLA 5EGRA 2PLCA 4M5PA 1CIUA 4AEEA 5KSWA 1HL8A 3LZ3A 3HGRA 4QX4A 3DFYA 5HMEA 5FJTA 3DI1A 3OIHA 2XU2A 3G1XA 4GI8A 1DXFA 2G97A 1W3NA 5TAOA 3G77A 3N13A 5D37A 4GIYA 2OOGA 2OWXA 4YVXA 3VNIA 2PF8A 1E4LA 4WGXA 1RA0A 4GLEA 3R0DA 4NIRA 4MVAA 1XD1A 1TIWA 1RLDA 4LVDA 2IMRA 4HT3A 1A5UA 3CL6A 5I3HA 1GHSA 3V3WA 3PG8A 3WF2A 4KCTA 4FSAA 1TWIA 5HUOA 4DYEA 4CNPA 2O7SA 3MUCA 3TWAA 1UD6A 3QFWA 5HNTA 3GVRA 4EXBA 2GJNA 4RL3A 1T6MA 2C1GA 3PTKA 4UMCA 4HKPA 4KCUA 4WK9A 3K1DA 1SFJA 3GS6A 1TZ7A 3PBVA 4LYKA 3G0UA 1A3HA 4BF7A 1FCUA 4O50A 1UZ1A 2CZVA 1GQLA 3SIMA 2E8YA 1LQAA 3U2OA 2HJPA 2XGZA 1YXYA 3WFAA 3PUOA 4H3DA 1XFCA 2EKCA 1VGAA 3AXIA 1EUAA 3O2LA 1O5QA 4CNUA 1XRFA 2VFFA 3NZPA 2ZRWA 2CZFA 3RGTA 1Q63A 1WPCA 3L21A 4YNGA 4QGCA 4Y6GA 4AD4A 4H9YA 4XIAA 3DDMA 3WF1A 1OABA 3UY8A 4K37A 4Z17A 3UG8A 3M0VA 4JCLA 1ZSXA 1ZNNA 3A21A 5CBJA 4J2PA 3WJSA 3PJXA 4YIWA 4JKKA 1W1ZA 1UWUA 2WSKA 1A3XA 1DIOA 1TR9A 1XSJA 4S2BA 1VJIA 5MKGA 3M0JA 3WEZA 3AMCA 1V02E 1X6LA 2ALDA 3BARA 5G2HA 4NJKA 1V08A 1V3HA 3FSTA 2ZX9A 4ICNA 4W4QA 4Y8FA 1S5MA 4H00A 3CT7A 5EL1A 4BI7A 1GW1A 2RHGA 1BXCA 1AODA 4FNUA 3VIFA 2DJLA 3IJ9A 2V5CA 1ZAJA 3A6OA 3UQNA 4EP8C 3TYAA 3V0TA 3L5AA 4Y90A 3UVAA 4DXVA 1UOZA 4ZQNA 4BKNA 1TQXA 4QNEA 4CN4A 3A9IA 3QW3A 1D7KA 5BXSA 2L5HA 1PAMA 4UCGA 1YDNA 2O4MA 1V77A 4Q22A 4ZO7A 1GUVA 4WLCA 3W6YA 4MUPA 2QCDA 3C52A 3EOEA 2TYSA 3GM8A 3MJMA 2IPJA