3G3DA

Crystal structure of human orotidine 5'-monophosphate decarboxylase covalently modified by 5-fluoro-6-azido-ump
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
256
structure length
256
Chain Sequence
ELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-activity relationships of orotidine-5'-monophosphate decarboxylase inhibitors as anticancer agents.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Uridine 5'-monophosphate synthase
total genus 95
structure length 256
sequence length 256
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2009-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3g3dA00
1PHQA 3CU2A 2OMAA 3W7IA 3GVGA 3QMTA 2AQWA 2EGZA 5BRBA 1W3IA 3R2GA 3OBKA 1XDMA 1PCKA 4NJGA 5BOOA 4GRSA 3TKFA 3F03K 1B3OA 5BMWA 3TXVA 3NA8A 3DFTA 4LVDA 1PL9A 4R53A 1FWWA 5DXYA 3F4WA 4MUZA 3DFPA 1OFDA 3GXTA 3EWYA 3TSMA 1CW2A 4PL1A 5KZMA 4RR4A 1F73A 1SZNA 2TMDA 1EWDA 1KV5A 1GT8A 3FEMA 2NXHA 3PWAA 1JJKA 3QW4B 4TIMA 3NOEA 3NO5A 2CLLA 4MYXA 3LTSA 5LNWA 1F76A 3R8RA 3KVKA 1JUEA 1KTNA 2JBMA 2FJKA 3TJLA 3DKJA 4MJMA 4NUWA 1W31A 1R2RA 1KBJA 1E51A 5E93A 1F6PA 3L5MA 2CLHA 3UWWA 1KM6A 3IVSA 1T0OA 3UPWA 4X3ZA 1NFBA 1F5ZA 2ZZ4A 4O13A 3DI0A 2RH9A 3EX1A 2RKXA 1N8FA 4M6QA 3CIWA 5AOUA 2CLMA 2PURA 5CZTA 4FIRA 3GXNA 1F2JA 1W5MA 2AGKA 3HBLA 2VEIA 3IRDA 3GKFA 1JCNA 3DH7A 2V5LA 1K7FA 4NJIA 2OX1A 4LNYA 2YYTA 3PM6A 3ZR4A 2ZZ5A 4TX9A 1KLYA 5KZDA 3W72A 1RQHA 3G1FA 3KXQA 4R34A 1VYPX 3LHYA 3NQFA 4E0CA 4MLRA 3HMJG 4ML9A 6ALDA 1OFBA 4JGDA 4HIBA 1J5TA 3EX3A 3LLFA 1K8XA 2QDGA 4UCGA 5CSRA 1TSIA 3W1TA 1O94A 1PCWA 3VE9A 3WJZA 1Z42A 1LYXA 3LI0A 2X1RA 1O5XA 1VLIA 2R14A 3OHIA 1TPUA 3G0XA 4I7WA 3TJXA 1Q45A 1OX4B 4BF9A 2Q8LA 3GR7A 1LOQA 1FWRA 1EUNA 5IBXA 1FXPA 4M6PA 4AWSA 2E5BA 2DZXA 3GZ3A 4QNWA 4BK9A 6TIMA 3W7JA 2QAFA 2JGYA 4XBSA 4ORIA 4WXYA 1UB3A 4A22A 2X1TA 4MVAA 1GPWA 3IGSA 4QISA 5FEZA 5L9FA 3CPRA 4XBKA 2RDTA 2Z6JA 1XI3A 3ZFHA 1VGAA 1SZEA 1FUYA 2J9XA 3G3MA 4I9AA 4O53A 3RLUA 4DBDA 2ZTJA 1GVRA 4IGHA 1YDOA 1IIHA 3W7KA 1W56A 4O1CA 3BARA 4JD4A 3CM4A 1VYRA 1QWGA 4XUGA 1EB3A 4UUIA 1VC4A 4DF0A 1ZFJA 5G4WA 3HPZA 1G4EA 3OIXA 3IIZA 4Y9AA 1WOAA 3KVLA 2BTMA 4MLJA 3QJAA 4OT7A 3A22A 3W2LA 1VS1A 3B05A 4UTTA 2TRSA 3W1UA 1TPDA 1THFD 3B06A 2PRMA 1KW1A 3G1SA 2W79A 1RVGA 5E1QA 2VFFA 3LCLA 4MYAA 2Y85A 5I3HA 4QIUA 3PS7A 3NG3A 3N9SA 1OHLA 3ATZA 3M41A 3SGZA 4JTSA 4KFPA 3NZ1A 4UTHA 2B0MA 4NZFA 3LOTA 4AEOA 4AH7A 3W6YA 2CZEA 1FDJA 4FIQA 1H1ZA 3PY2A 1H7PA 3G3DA 3KOFA 4JEQA 2VFGA 1IGSA 4ZL1A 3Q2DA 2B7NA 3DBPA 3PBVA 5HWNA 5HJLA 4PH6A 3LRLA 3W85A 3A5FA 3TX9A 1H63A 2V2DA 3LCWA 2VENA 2OT1A 2XFWA 2CW6A 2CLKA 4NJKA 2GQ8A 2VXNA 1H5YA 3HGJA 4HPJA 3UQNA 1D3HA 4UR7A 2CZDA 2QCEA 1KA9F 1SO5A 4IMCA 3W7GA 2YFNA 4B5NA 4Z1CA 1LCOA 4JDYA 3NQAA 4MFDA 3M5XA 3Q58A 2ZRVA 4QJ1A 3C0JA 5K2ZA 2QJGA 3SW6A 1KFKA 3HIJA 3NQEA 2C16A 2IQTA 3FYOA 5DN1A 1IXQA 4UFKA 1BWKA 3HOJA 3TC7A 4X22A 1GYLA 3W7MA 4ZQPA 1OX5A 3TC6A 5G5IA 4K7YA 2GVLA 3MO7A 3FLUA 4IMDA 5D37A 3NPUA 1JUBA 4DQWA 3F4NA 3FS2A 2CLOA 4N2YA 5D05A 2H3BA 2DZSA 4IPIA 3DHFA 1L2UA 1DVJA 1ICSA 3LCHA 4EVZA 1LRQA 1XFBA 1NF7A 4JX5A 1SSDA 1QFEA 2EAWA 3GIYA 1XBVA 3L5LA 1B4KA 1KM1A 3W2NA 5GVJA 2OCZA 5HWMA 2ISSA 1DJNA 3W83A 3LI1A 4DPPA 1GG1A 3NVTA 1ZENA 1OG0A 2WO5A 3W7QA 3EWUA 1TTPA 1JCYA 1FWTA 3M1ZA 4D2JA 2HS8A 1PE1A 1A5SA 1AW2A 5C5YA 3LDVA 3NZRA 2YCEA 4RKAA 2C13A 3Q37A 2E68A 1SW7A 4O17A 4YLWA 4LV4A 1OYAA 1U5JA 1KM4A 1VCVA 1TPC1 1JCLA 5EBUA 2WKJA 1Q6OA 1KM5A 1OABA 1PV8A 5TIMA 1S5WA 1J4EA 3S1VA 1TRIA 1W1ZA 3HPSA 2QCDB 1I2OA 2J9ZA 2C0AA 3G0UA 2ZRZA 5H2ZA 5KZEA 2G5WA 2CFFA 3NQ6A 1RD5A 1QCWA 3EB2A 4C1LA 1AL7A 2H8XA 4LU0A 2FPYA 4IMFA 1EUAA 1WA3A 4UIOA 3FFSA 1G4SA 2WQPA 5L6UA 2QCCA 2R94A 5C54A 2G95A 3WJXA 5I3FA 3O16A 3WJYA 3E0IA 1KV8A 4TMCA 1W3NA 4UTJA 2B7QA 4RZ6A 1LTDA 5U7SA 2YX0A 1M5WA 5I3KA 5CZ0A 2ZRUA 2B4GA 5FF4A 4XKYB 1XBYA 5FF7A 2EPHA 1MO0A 2YSWA 3NQGA 3LHVA 4LRTA 3NL2A 3HGSA 2QUUA 2E1DA 3I65A 5HR6A 4O8RA 3MP5A 4Q32A 4OHQA 4LS0A 2ZDRA 3EX4A 1M6JA 2FPTA 2QCHA 3LXBA 2NLIA 2ZRWA 4JTFA 1MEWA 4KKXA 3C8FA 2TSYA 1K02A 3VCRA 3SZ8A 3HGOA 1HO1A 1T8XA 2Y7GA 2X1UA 2DZPA 2NX1A 3NPXA 4LVAA 2J88A 4MZYA 1FXQA 3VFLA 4WUIA 2FDSA 3C2FA 2BLEA 2V0TA 3D0CA 3TK7A 1W0MA 2TPSA 1SO3A 3GB6A 3IIXA 4ORMA 4AF0A 3THAA 3NEVA 4JTIA 2CLFA 1X1OA 3NQCA 3LCFA 3RMJA 4PC8A 1SFLA 4RZ5A 4NNAA 2FB3A 3P82A 4GUHA 4I7VA 1T96A 3CT7A 2QCFA 4HNVA 3T4CA 3V1PA 1MSSA 5FEWA 2P10A 3I7QA 4BWLC 3TQVA 3LRMA 3HJZA 4AF0B 1IIGA 3E9AA 2GOUA 4NXKA 3NM1A 1YTKA 1BEUA 1LBMA 3GR8A 3EKZA 1UUMA 5FI8A 4Y96A 3TIMA 5LGZA 3LHWA 3BG5A 4FX7A 2CWNA 4S2CA 4P61A 2G96A 5D03A 2P1FA 3TNOA 3N34A 2CLEA 4HPXA 1GVQA 4N9DA 4O52A 4JY8A 4K37A 3C2VA 3O6YX 2H3DA 2R91A 4TU1A 3T78A 3HG3A 3MP4A 4MY9A 1JQVA 3O63A 5G2HA 4NZJA 1RQEA 3HGRA 1YXCA 3L9CA 3OVQA 3TFCA 3EX6A 3N73A 4HNUA 1V7YA 1L6YA 4ZQNA 3SI9A 3CEPA 2F7FA 1TPH1 1I4NA 3GDMA 3BGGA 4LW7A 4A29A 1HG3A 3ZS4A 1X7FA 2V81A 4Q4KA 2NUYA 2FLIA 3LXAA 4WD0A 3TMLA 3L0GA 3WJSA 5EMUA 3BW2A 1QR7A 3G1YA 5HMSA 1ONRA 4O10A 4QSHA 1TJRA 4DO4A 3I7SA 3LERA 2VFHA 2OJPA 3M7WA 3SY5A 3M47A 3OA3A 2C1HA 3QQ0A 4FEZA 3UZ5A 3LHZA 2ABBA 4JIPA 3GDRA 4FNTA 3EXRA 1FY6A 3UY7A 2X1SA 1JR1A 4LVBA 3S42A 3H53A 3MP3A 3LTYA 4HNTA 2Q8ZA 2NZLA 1L6WA 3IEBA 4OBTA 5AHMA 3STCA 1OFPA 3QF0A 4HN4A 5AN7A 4DO6A 1QPOA 1ADOA 5AHEA 1KM0A 1I2NA 3SFKA 4OGZA 2RDWA 3PSWA 3IV3A 4NNBA 1R30A 1IXPA 3Q94A 4FF7A 3OEXA 3IGUA 3TAOA 3NQ8A 3P61A 1GTEA 4GXMA 5FF0A 3E49A 1YXYA 3R12A 4UTKA 3WK0A 3NPWA 3GXPA 3FOKA 1OFAA 3U8GA 3QYQA 1KM3A 5D2WA 2ZFAA 2Y89A 3G22A 1SZFA 4YWIA 3G24A 1P0NA 3MUXA 1EP2A 1F6KA 3W1MA 5KTLA 4FNPA 1KLZA 3EEGA 3B03A 3O8AA 3THQA 1W3TA 1WYIA 1JCMP 2DZVA 5KMYA 3INPA 4JX6A 3JS3A 1LOLA 1O60A 3LHTA 4N9EA 1QAPA 4ADSA 3PBYA 4E38A 4O54A 1XXXA 1ZAJA 4M5PA 2E6AA 1FWNA 5D2TA 4FB7A 4RCXA 5EY5A 1P0KA 3W1PA 1QOPA 4N9BA 5HUOA 4MY8A 3HB9A 3OVRA 4UFHA 5DCEA 3G1HA 1M7PA 3L0KA 2H8ZA 5F4XA 1LP6A 3P7YA 4JXCA 2V2CA 3FKRA 4C1KA 1VRDA 3MBFA 1FCQA 5HULA 5CPOA 3QEZA 5D2XA 4IXXA 3W7EA 4NX0A 5KSWA 2FPVA 3W1LA 5DY2A 4GJ1A 4QNEA 4JTLA 4Z0SA 4S2BA 2VEKA 3B8DA 3W86A 4FO4A 2HS6A 4CNPA 1QPQA 1H51A 1WDWA 3W1RA 4IWWA 2C3ZA 4K6AA 4O4VA 2DORA 2WOQA 2ZA3A 4IMGA 1VZWA 3M43A 1ALDA 1TPB1 3G1AA 2WSQA 3ZWTA 1HUVA 2EKCA 3KX6A 4JN6A 4CCEA 4UFJA 2YPIA 2C19A 1KM2A 1IXNA 3W9ZA 3W1AA 1FCBA 3QMSA 3IVUA 3VI2A 3A23A 3A24A 3ABRA 4WQ6A 3SSJA 4KWWA 1HO4A 2YZRA 4O50A 2GPTA 2GJLA 2ZRYA 3KRSA 3QPZA 4ZQMA 2QCLA 3G8RA 3UPBA 2A21A 5BW6A 2CZFA 1K8ZA 2ZZ2A 2OT0A 3M5ZA 1D9EA 1TB3A 1BKSA 3BPWA 4LVGA 1HFBA 2O7SA 4LTSA 4OQVA 2V2HA 1SU5A 5FF2A 5A8GA 5AB3A 4O18A 2WSRA 3BG9A 3FYPA 4IX2A 5D2VA 3EWBX 4YCOA 1XUZA 5C6MA 3T7VA 4IJBA 4QQ3A 1VQTA 4PFMA 1Q6LA 2BZNA 3NQ2A 3W3OA 3G18A 3PG9A 5G2WA 2QJHA 3ZWSA 3DAQA 1D3GA 1YXDA 4H3DA 1GTHA 1C9DA 3L67A 4O12A 2Y6ZA 4OU1A 2FB2A 2HMCA 3NR0A 3DXIA 4BI6A 3P60A 1DBTA 3B0PA 4Z1DA 3TW6A 4IXHA 1W5OA 5LNUA 1AK5A 4EOUA 3BLIA 2ISVA 1BTMA 3QM3A 1GEQA 4WY0F 3NYZA 2E09A 3W73A 4ZQRA 1J2WA 2ZBTA 3DKLA 3PR2A 5D09A 4AAJA 1YYAA 3G1XA 1MXSA 1OK6A 1SW0A 1LM1A 3H54A 1I2QA 1GVFA 2A85A 3GNDA 5FF3A 4HT3A 2C6QA 3NM3A 1P4CA 2FIQA 1HL2A 2PCQA 3TFXA 5H91A 1TV7A 2P0OA 4LC6A 3W7HA 5CPMA 4MKNA 5G4EA 3I7RA 3IIOA 3PBUA 5BNKA 5EPDA 3W23A 3WK1A 1OFRA 1VHNA 1EP1A 3L65A 3P62A 4M7TA 1B57A 2BSLA 4YMZA 2QF7A 3TROA 3R89A 4AXKA 3O05A 4N9CA 3FA5A 4X9SA 2A5HA 3S6DA 2X16A 2R8WA 2ZYFA 4RLIA 4U28A 3FIGA 2O7QA 4N6EA 3TH6A 3TR2A 3W07A 4O1BA 2VOMA 4A2RA 1ZAHA 4XQ6A 4GC4A 3W76A 1KFBA 2YW4A 1TCDA 1A5AA 2V5BA 1VHCA 4X2RA 5HWJA 1PHWA 5DBTA 4Q33A 3UWZA 4O4WA 1YTDA 3QSTA 1QO2A 4O0KA 2V8ZA 4RJEA 3NQMA 3QZEA 1N7KA 5DCDA 4K38A 1ZHAA 4CNNA 2J9YA 4UTIA 2DJLA 1EWEA 4XKYA 3W7LA 4MPQA 5AYYA 1EPXA 3C61A 1TQJA 3CIXA 3DGRA 4ADTA 2YW3A 4M7SA 2ZZ6A 7TIMA 2DZTA 1IXOA 5AC8A 3KFTA 3G8EA 2A1YA 4ZQOA 1LBLA 3MYOA 2ABAA 3C2OA 2H90A 5C2XA 4MIMA 3EKLA 4RZ4A 3GX9A 5CPNA 2VFDA 4Z1BA 5LZLA 5CG7A 2VFIA 2JK2A 2A2IA 5AYXA 3LX9A 3R13A 4JNMA 4RX0A 3GYEA 3W1QA 3HG5A 3P81A 4TMBA 3BGJA 1YLVA 1XDLA 1WOBA 3B0UX 1QO5A 3EWXA 1FCUA 4NT0A 3PUEA 5D02A 1GVOA 1O4UA 3LRKA 4MOZA 3ABSA 2CU0A 3U6WA 3TW7A 4UTWA 2QCNA 2WV8A 4LS2A 4ZZ9A 1TO3A 3N3MA 1JUKA 4PCFA 3IIVA 4O57A 3C3NA 3PB2A 3BW4A 4XZ9A 4O16A 5F2LA 3GAYA 5LGXA 3ABOA 2VFEA 3BLFA 1LRNA 3NL5A 1AMKA 1XBZA 2YYUA 2NX9A 5F2MA 4JTJA 4WOQA 5HINA 3E02A 1LLWA 4IPJA 2J6XA 3PUDA 3B4UA 5G2IA 1YDVA 4O28A 3KVJA 1OYCA 1NF0A 1FCVA 1LORA 2A7PA 3DFQA 3PSVA 1LDCA 1KBIA 2QEZA 3W7CA 3IIPA 4EWND 4TO8A 2UV8G 2RDUA 4NJHA 3S0CA 3KVMA 3C2RA 3PULA 2GQ9A 2Y61A 1OYBA 1QMLA 2WJZA 1G67A 5DBUA 4KFNA 2D73A 3BV4A 4AHQA 1KFEA 1DV7A 4JYDA 2E6YA 3MYPA 4GUGA 1B9BA 4YCPA 4KWVA 1DJQA 3GK0A 4H4IA 3QQ1A 5IBXC 3ATYA 1GWJA 1WBHA 3NQVA 2ZZ7A 2DZUA 1TMHA 4WXZA 2G97A 3O07A 2I9EA 1G4TA 5D32A 5G1TA 5BMXA 5HUPA 4O1DA 5J5DA 2A7RA 4OV9A 4GUIA 4W9TA 5AHNA 3LV6A 1H50A 4UNKA 2GVJA 1FWSA 2QR6A 3MWAA 3NAVA 5EL1A 2J27A 5K4ZA 3GLCA 3NQDA 3UXAA 4DXVA 1G7UA 1GVSA 3RF9A 2NXIA 2FQIA 2QAPA 1FBAA 3TDFA 3W84A 1K7XA 4POCA 4WY0A 1ZY9A 1ME7A 1TTQA 4ZQCA 1LZOA 3W7DA 4BWLA 1NEYA 3MHFA 1NAL1 1T99A 1ME9A 2I1OA 2YR1A 3M5VA 3P8JA 3TE9A 1H7OA 4HKPA 3STGA 1TPFA 2W0UA 4IMEA 3LGEA 1P1XA 1I45A 2E5CA 2X2GA 3P80A 2JGQA 4AVFA 3OVPA 3UWQA 3SGUA 4R33A 1KFCA 3QH2A 2ZA1A 2Z1BA 2RHGA 1VLWA 1EX5A 3DFNA 1H7WA 3AO0A 4DEFA 4Y90A 1RV8A 3QFEA 2CLIA 1GJPA 4GE8A 2PRHA 1G6CA 4CNOA 3W1NA 1XL9A 1MZHA 3TMQA 1A5CA 3L5AA 4RXGA 4LUJA 1G7VA 4GWEA 1N55A 3W2UA 2HTMA 3WJWA 2NWSA 1X8FA 1DORA 1VJIA 3TQKA 3BW3A 1S3HA 3BLEA 3UWUA 2JKAA 4ADUA 3CQ0A 1A50A 1TV8A 3N2XA 1ME8A 2A7NA 3PAJA 3VKJA 3USBA 3C52A 5K4XA 3LV5A 3UYCA 3DFSA 4O1AA 3O6DA 3DI1A 2Y63A 4NJJA 3W2JA 3CLMA 2VEMA 1QDSA 1EIXA 2BXVA 3CB8A 4FXRA 2WSYA 3CTLA 3H55A 3S1WA 1ZCOA 1EEPA 1SR9A 1R47A 1LOSA 3PVFA 5EYWA 3S1XA 1OJXA 4FNRA 3WK2A 1H1YA 1LROA 3FKKA 2QDHA 5CZSA 4CCCA 3GDKA 3G1VA 1Q3NA 5EKYA 4E2BA 3FJLA 3P5ZA 2ZRXA 3UD6A 4HSOA 4FNUA 1OFOA 2ZZ3A 5C55A 1R2TA 4JICA 3UNDA 4IX0A 1XUUA 1XM3A 3S8HA 4MZ1A 1W54A 2C14A 1AG1O 4ZMGA 2KZHA 5K3VA 3LBCA 3S5ZA 3T40A 3AJXA 2TYSA 4GFSA 5TBOA 1TPVA 1GOXA 1SSGA 5IM51 1RZMA 1A53A 1ZAIA 1UASA 4WJEA 4UNLA 1W5PA 1X6UA 3V75A 3HF3A 4J9JA 2ATSA 5FEPA 2J24A 4MY1A 4IUOA 4XTIA 1NVMA 1GZGA 1HTIA 1VPXA 1YPIA 4Z0JA 4PL2A 3RK8A 4CQAA 3WK3A 3L21A 4WOZA 3HG2A 3O15A 1OF6A 2E6FA 4UR8A 5K9DA 2ZZ1A 1ZNNA 3SECA 5TQLA 3IGXA 3LXCA 4JTTA 3S1UA 1EP3A 1QNVA 1L9WA 5J5RA 2WNNA 5F4SA 3VNDA 4Y8FA 3N19B 3MJYA 3LB0A 2ISWA 3R5EA 1WAUA 2C15A 1VH7A 5CZJA 1TPEA 3B04A 4UTMA 2Y62A 3SJ3A 1WX0A 3TXZA 2NUXA 1FX6A 5CKSA 4CQ9A 4LOCA 3P67A 4CCDA 4AWUA 2JKPA 1K3UA 1Q6RA 5AHFA 5CSSA 1I2RA 2XN2A 2Q3RA 3JRKA 3LCXA 5DY3A 3EXTA 5LHEA 1AL8A 1VYSX 3S9YA 4H6KA 4DPQA 3ELFA 4WX2A 1K03A 3MI3A 1W5NA 1P5BA 3QPYA 4TR9A 1OFQA 4ZVJA 1WBJA 4HNNA 2YDAA 3MI2A 5FEXA 4EIVA 3M0ZA 5F2GA 2GJNA 3TCEA 4EF8A 3P8IA 4JTHA 1G69A 2PE4A 5A5WA 1CI1A 1ZJIA 4N02A 4JR5A 2Q3OA 4LUIA 4JDBA 4LT9A 3W71A 4OWGA 3STEA 2A0NA 2QCMA 4KFOA 2Z0IA 3C4UA 2WNQA 3M9YA 5D2YA 3QRHA 3W75A 4E2DA 2Y7EA 5SWUA 3P5YA 3UWYA 2FTPA 2QJIA 2Y70A 4M19A 1SPQA 4IOTA 2DU2A 3M16A 4FX8A 1W37A 1RQBA 1SUXA 3RLVA 5AFDA 4Z08A 3BG3A 1DKWA 4MFEA 3MHUA 4NXSA 4UMBA 2A4AA 4NNCA 4P2VA 1OVDA 5LSMA 3RU6A 3CWOX 1FQ0A 3LTPA 1TTIA 2V30A 5KINA 1KFLA 3FJ6A 3LBMA 4AHPA 4EF9A 1XC4A 1O5KA 4OV4A 1C29A 3CEUA 1MEIA 3WFAA 4JTEA 3KRUA 1VR6A 1ZALA 4BI7A 4FNSA 5HR7A 1S5TA 4L4MA 2W6RA 4Y6GA 2V82A 3BO9A 4S1FA 2VC6A 2ZA2A 1SO4A 1W8SA 1H60A 1GG0A 3S5NA 2XN1A 4GBUA 5DXXA 1KTBA 4UFIA 3G0SA 4YL2A 3N2MA 4JY9A 3EX2A 3CHVA 3L66A 2VELA 3MW7A 4NQ1A 5KITA 5E0KA 4K7VA 3QC3A 4UFLA 1OX6A 1UBSA 3MHGA 3W7NA 3TAKA 2BWGA 1YDNA 3M44A 2ZQ0A 3B0VC 1FDYA 3E12A 1ICPA 3K30A 3LLDA 1CX9A 3P84A 4UTWC 4M6VA 5I3JA 3TU9A 5D38A 3TSBA 1BWLA 3TV8A 1DQWA 4CLMA 4G1KA 1JRBA 3UY8A 4RXFA 2E5DA 4A2SA 4R7JA 3DHDA 1GYNA 5LHFA 4CQ8A 2NXGA 5K7JA 4LVFA 2GUUA 3OG3A 3EWZA 3W7OA 3NDOA 2DZWA 3BVJA 4JYEA 4UFMA 3UWVA 5K9CA 1PS9A 4JS3A 1S5VA 4QM1A 3GAKA 2Z2UA 3GNNA 3QW3A 3HO8A 4NX5A 1SQ7A 2RFGA 4I7UA 1OFEA 3W87A 4PODA 1TRDA 1YTEA 3LM7A 3O1NA 4WZHA 1F05A 2ALDA 1SZGA 4BFAA 2EHHA 2QUTA 3ANYA 3C6CA 2YFOA 2ATMA 2Z6IA 3A9IA 1H7XA 4XWUA 1JVNA 4K36A 2Y88A 1AW5A 1K7EA 1MEHA 3T55A 3O06A 5F4WA 3TSDA 2E6DA 5F2IA 1PVNA 2Y7DA 4MJZA 1F7BA 2QCGA 3N9RA 1Z44A 3A5VA 3U2OA 1Y0EA 2NUWA 3UXDA 1JRCA 5HNRA 1XCFA 3TUUA 3LHUA 5G1YA 4O15A 3O6CA 4PTNA 4A21A 4BR1A 2VEPA 3DZ1A 1Q6QA 1R2SA 4JYFA 3STFA 3W2MA 1RPXA 4IQLA 1VCFA 2PC4A 3PB0A 1B4EA 3EXSA 4FHAA 4N6FA 3SR7A 3JR2A 3BK0A 1KTCA 3NL3A 3HQ1A 4DF2A 4JTKA 3LCIA 4O0ZA 1ICQA 2NV2A 4Z1AA 5AHLA 4DO5A 4QITA 3PBWA 5AC7A 3I68A 1QPNA 5F1VA 1TJPA 2A6NA 4NVTA 4WY0B 3ABQA 3W1XA 1SO6A 5I3GA 4A3UA 1NSJA 1UJPA 2V9DA 2GVGA 4ALDA 4YXGA 1AW1A 3P74A 4K8EA 1DQXA 3M6YA 5FESA 5LNSA 3MBDA 1TQXA 4N4QA 2Y7FA 2I14A 5DCBA 2AAMA 2HSAA 5AYZA 5CGQA 4QAIA 2LLEA 1QPRA 1JCXA 4BI5A 2H6RA 4N4PA 5K9XA 1W5QA 2QCDA 2OZ0A 5MHBA 2XN0A 2YGYA 3KRZA 3W2KA 4JTUA 2YXGA 3QMRA 1RR2A 1DL3A 3NGJA 5D33A 4AMAA 4FX6M 2NWRA 5DELA 5HQEA 1TREA 1FDZA 3HPXA 3SIZA 8TIMA 4AWTA 4DELA 1U83A 4HSNA 3NNTA 4UTTC 5AHIA 3CC1A 1DOSA 4UMCA 4GUFA 1TPWA 1G4PA 1UCWA 2QUVA 3MI6A 1H62A 1O95A 2CZ5A 3KHJA 3W22A 2X30A 3YPIA 2WNZA 4FXSA 5CPLA 2EF9A 3PF3A 2B7OA 3LCGA 1IF2A 1TTJA 1ML1A 3KAOA 3CWNA 2VKZG 3TA6A 2GQAA 4XTDA 1KFJA 1F74A 3E96A 5LKYA 1Z48A 1YADA 3NPVA 1C8VA 1WQ5A 4UTUA 1M7OA 4DBEA 4GNJA 3DU0A 4UXDA 1I2PA 1X1ZA 3L2IA 4LV9A 4LS1A 3A21A 5T26A 3G1DA 4U4MA 1SW3A 2PRLA 4JX4A 4LY8A 4JTGA 4FNQA 4ICNA 3RFAA 4DF1A 5I3IA 3W88A 5LNRA 3W7RA 2A6LA 4NU7A 5D30A 2ZTKA 3PC0A 3PUOA 1LLZA 3MMTA 1TYGA 2FFCA 3S5YA 3UZJA 1XKYA 4O11A 4RV8A 1L6SA 4LWWA 5ABTA 1PIIA 2BX7A 2DJXA 2NV1A 3T44A 1JQXA 1LRTA 4K8HA 3DENA 1R46A 2C18A 1JCJA 2JKEA 3HG4A 4RK8A 2DP3A 3W7PA 3M5YA 1H61A 3L0NA 3NL6A 1TV5A 1H7NA 2WPBA 3QSRA 4O14A 5D04C 1EA0A 4UMAA 4UC5A 4UTLA 1DHPA 3C2EA 5U4NA 2QKFA 4LC8A 1OX4A 5F1UA 4L4LA 1OK4A 1H7RA 1YPFA 2B7PA 4MZ8A 4O19A 1I8JA 2ZCGA 1SFJA 1GQNA 3GDTA 5LNVA 4ONVA 1XBXA 3NXFA 3W70A 3W74A 1V5XA 3I6RA 1VCGA 1QOQA 5EA9A 3F1QA 4PEKA 1K8YA 1UUOA 2F84A 3NQ7A 3TQ0A 3S5OA 4OE7A 3GKAA 4LRSA 1TIMA 3PG8A 3IVTA 4AHOA 3DFOA 1OF8A 1A5BA 1WV2A 5AC6A 4PA8A 4JIQA 4GUJA 4K39A 1JULA 4HHPA 2NX3A 3C56A 2E77A 5DLCA 3VE7A 1Z41A 1WXJA 4AB4A 3N14A 3RNDA 3GDLA 3L68A 1LBFA 3EWWA
chains in the Genus database with same CATH superfamily
2ON3A 1Q8AA 1OB0A 3FHQA 3VGFA 1V0KA 4UZSA 5BRBA 3UGRA 4C90A 2WKLA 2OEMA 1EH9A 2VYOA 3R2GA 1PCKA 1E6QM 3CHEA 3C5QA 3F03K 1XLMA 2WMFA 3NSMA 4JHMA 3TXVA 4AY7A 2O9OA 1J18A 5DXYA 3F4WA 3DFPA 3GXTA 4D6IA 2DV0A 4L1GA 3BOXA 2JALA 3H7VA 1CW2A 4PL1A 5KZMA 4RR4A 4H9TA 1JG9A 3ZVHA 3FEMA 3UERA 3SRFA 4JPGA 1F76A 3KVKA 3GW0A 3TJLA 3DKJA 4I8YA 2FHFA 1E51A 3ZVHB 1U30A 3UWWA 1UJQA 3PZGA 5B7ZA 2Y0FA 2J6VA 3PUGA 2ZZ4A 3BAIA 4TVUA 1QU4A 3DI0A 1W3LA 4AYSA 1B31A 4L6HA 1N8FA 3V7PA 2Q02A 5GQBA 4GHRA 3VDBA 3ERPA 4FIRA 3WMLA 5GJNA 4MF4A 3OZPA 1Q7MA 3GKFA 2EPMX 2VD8A 4H9YA 1RSCA 2V5LA 3RRAA 4LALA 1AJZA 5LYRA 1E4MM 4F0LA 3CQHA 4JQAA 4U5IA 1RQHA 4V28A 1R87A 2AL1A 2I9UA 3RHGA 5H8MA 2I5GA 4OBSA 5AVNA 3HMJG 1EF2A 6ALDA 1WE5A 3KBVA 4HIBA 1VFHA 5C2GA 5A69A 2Z2AA 3DG7A 2OSXA 2E9MA 2V5CA 1Z42A 1LYXA 2CXGA 1O5XA 3MJMA 3OHIA 4I7WA 2Q8LA 2TAAA 1FWRA 4GD0A 4AWSA 3OBEA 3VK5A 3V5OA 1QI3A 4XZMX 4PEEA 3GIQA 3CO4A 5HDRA 5A8MA 2QAFA 2JGYA 4XBSA 4WXYA 1UB3A 2X1TA 3UVIA 3B8TA 4U3CA 4JIIX 3RITA 3KP1A 3ZLHA 3GUGA 1NDVA 2RDTA 1OC7A 2Y8KA 4AX6A 2FGLA 1V6XA 4C6BA 1DEDA 1X6NA 4QJ3B 2R6OA 3CJPA 1DJYA 5A6JA 1YDOA 1V6UA 3W7KA 1W56A 4LYKA 4W7UA 4B91A 2VX5A 5A6AA 5GJMA 3E1F1 3NO1A 4QX4A 3DHPA 5G4WA 3VU2A 4Y9AA 2XGZA 2BY1A 4ZTYA 3H2AA 4H00A 3WH9A 4JTDA 2V5KA 4NY2A 4R9OA 4L7ZA 4GQ0A 2TRSA 4C6MA 1JPMA 3B06A 4PMQA 1MW2A 4W89A 1KW1A 3G1SA 3U2EA 4MYAA 2Y85A 5I3HA 4MJ4A 3PS7A 6TAAA 3SGZA 3ZJ8A 1XLIA 3BMWA 3W6YA 4HQVA 2CZEA 3AZTA 4JEJA 4HOZA 4PMRA 5ENLA 1XJBA 1UP3A 3PY2A 2VFGA 2QPUA 1UR3M 3N4EA 5HJLA 4OECA 5D8WA 2DEPA 2PDUA 4LYRA 3AIUA 2YCLA 2GQ8A 3QGAC 3HGJA 3H4XA 1OCNA 1D3HA 3BUVA 2C91A 1JI1A 4PFHA 1BYBA 2YXOA 4GO9A 3GHSA 4MFDA 4FLSA 3R58A 4CQDA 1HP5A 4QJ1A 1W1YA 1KFKA 3UG5A 1DWIM 1RBLA 2C16A 5DN1A 3RAOA 3KP0A 5AZ1A 3I3EA 5BU9A 3CLWA 1OX5A 4ZOAA 5D37A 3OJGA 3NPUA 2DSUA 4DQWA 2OLAA 1FWCC 4H2CA 3QOKA 1V8EA 1EJTC 3BL3A 3LEPA 4A4AA 4QXIA 2DZSA 1X38A 1HT6A 3KTSA 1CZ1A 1PX3A 1QI0A 3ZR5A 9XIAA 1DVJA 3LCHA 4EVZA 1QFEA 1OG6A 2EAWA 1ISZA 3VD9A 1B4KA 3W2NA 1M7XA 5GVJA 4WDTA 2QT3A 4DPPA 3NVTA 1ZENA 3EWUA 2J7FA 1E15A 4F9DA 1PE1A 2O9PA 4AD4A 2PF0A 1E6RA 2C13A 4DXKA 4PULA 5A8PA 2VQUA 1DJHA 4MAVA 2A3HA 1KM4A 2GQ3A 1VCVA 3DYMA 1TPC1 4RW3A 1JCLA 2X05A 1Q6OA 3AI0A 1KM5A 1EDQA 1TVNA 2O55A 3H2NA 3R94A 3S1VA 1UUQA 2QCDB 1EKOA 5JBFA 2GDUA 3N2TA 4M1RA 1P6WA 2VC5A 1TIWA 3GD6A 3EB2A 5HA7A 3PPFA 5DO8A 4HSHA 1DJXA 5XIAA 2PDWA 3EWDA 4XO7A 4TMCA 3IUIA 4RZ6A 3BLKA 3M46A 3N2CA 4MAZA 2YX0A 4RL3A 3QN3A 4I5UA 4OIFA 3WLQA 2ZRUA 3K8LA 3WL1A 1XYAA 3B9OA 1A49A 3NQGA 3WF0A 3NL2A 1KRCC 1ELSA 4L1XA 1BSLA 2AKMA 4MNLA 1TFVA 3KZSA 3KCLA 2J66A 2Z1SA 3DDMA 2FPTA 4IP7A 3F2DA 4JTFA 3R25A 1MEWA 3LMZA 5IRPA 3H12A 5CXPA 1K02A 2XWEA 4E3VA 3CZEA 1O5RA 3QY8A 3HGOA 2DZPA 2J88A 2BVWA 1FXQA 3AAMA 4QG8A 4KF1A 1W0MA 4MKSA 1YIXA 3IIXA 1NOWA 2XG9A 4Q8VA 4V1XA 3KL3A 2OGJA 1PYFA 4RZ5A 2FB3A 1N8IA 4LFYA 3CT7A 2D3NA 3WQ6A 2P10A 3ZXWA 4I5RA 2DGAA 1IIGA 2VR4A 2FH6A 9XIMA 3EKZA 4JQ2A 1UUMA 5FI8A 2W4XA 1Q65A 1GKPA 3LHWA 4FX7A 3AICA 2OODA 5DMNA 2G96A 4BS0A 1E70M 4GIYA 1IZCA 2Y5JA 5E70A 2CETA 1XYCA 2FHCA 1K9EA 5AYIA 1SR0A 4L6OA 4TU1A 2R91A 3HG3A 3AIEA 1RBOB 1FHDA 3UETA 1JQVA 3TWBA 3A4AA 1YXCA 1V0MA 2BOEX 3EX6A 1B3VA 3TLLA 4HNUA 3AMLA 5T9CE 1TPH1 2ESCA 3GDMA 4RDWA 2ZXQA 3UCDA 1HG3A 1X7FA 4KCVA 5HBFA 4PUNA 3WJSA 3BW2A 5HMSA 3U4AA 2J77A 1TJRA 4DO4A 3I7SA 3LERA 5T91A 1RK5A 3M7WA 3SY5A 2UY4A 1OT2A 5JH1A 5A6KA 5T9BG 1V6VA 3KL5A 3RIKA 4WR3A 2AL2B 3H53A 3ARSA 1TV2A 2WHLA 4U5KA 4C60A 1TWWA 5J8LA 1MDRA 3EPNA 2EBNA 5AHMA 5CBBA 3STCA 4DJFC 5AHEA 1QW8A 2G3IA 2RDWA 4NNBA 3WQCA 3ICJA 4Q7BA 1P0EA 3Q94A 2XTKA 5LIXX 3VDCA 3O7UA 1YXYA 4UTKA 1SMDA 2Y8VA 3OO2A 3U8GA 4QJ4B 3QYQA 4A3HA 3LZ3A 2VEGA 3MUXA 2VOTA 1LQ0A 2OU4A 5KTLA 3EEZA 1CYGA 5J04A 3THQA 4J40A 2OZTA 2XFYA 4HYVA 2W63A 3WN6A 1VBRA 5BOEA 4S3GA 3O0KA 3GXIA 4ADSA 1ZAJA 3K8KA 5M3WA 3TTEA 1BVWA 3R79A 5CJ5A 3RLHA 4RCXA 2PWEA 5EY5A 4V15A 5DCEA 4UFHA 3G1HA 3ABXA 4IJCA 1M7PA 3OB8A 3QOMA 1LP6A 4JXCA 3PZQA 4YTRA 4W86A 4CD5A 3R1ZA 1FCQA 4PCSA 1KGWA 1TELA 4GJ1A 3EDJA 1AUSL 4JTLA 2HXUA 2VEKA 3WQVA 1UWIA 1H51A 1WDWA 3W1RA 5I07A 4K6AA 4IMGA 3M43A 1ALDA 1TPB1 3ZWTA 1HUVA 4JN6A 4CCEA 5EMYA 4EPEC 3L4XA 2CHOA 1CENA 4NP7A 3A24A 4PTDA 1HVQA 3SSJA 4E2OA 3KLKA 3QPZA 1KQZA 2QCLA 3VABA 1DPMA 1EDTA 1BKSA 4PRRA 4LVGA 4S3CA 2O7SA 4LTSA 4OQVA 2V2HA 2X7WA 4FALA 2HPMA 2PDMA 5D2VA 1XUZA 3BLLA 3T7VA 5C6MA 4IJBA 3DERA 1V3MA 2R82A 1YMYA 4QQ3A 3TWAA 4OBRA 3THCA 4PFMA 4YTQA 3W3OA 3G18A 4ACZB 3DAQA 5BZAA 1WKDA 3L67A 2VCBA 4O12A 4GKLA 4OU1A 2BOFX 4C91A 3NR0A 4M24A 3DXIA 1F4HA 3P60A 1FWEC 4IGNA 3TW6A 3BLIA 3KBNA 3QM3A 1GEQA 3GU1A 4GVHA 2ZBTA 1UP2A 4AY1A 2XU2A 2DW7A 3WMCA 3POCA 5FACA 4XK2A 1FA2A 2BV9A 1QBBA 1RJPA 3S83A 3NM3A 4JAWA 1HL2A 3L4TA 1F8IA 3IJ8A 1AQ0A 2DZAA 1VHNA 2XDFA 1BVNP 3E2SA 2BSLA 1L6GA 3TROA 2BS9A 3R89A 1LWHA 3O05A 1CXHA 2A5HA 3CV1A 2R8WA 2NQ5A 4RLIA 4U28A 2O7QA 4B3LA 1NH6A 1OADA 1Q66A 3WCZA 1AA1B 4P7QA 4UR9A 2VOMA 4E5TA 3GVWA 5HNUA 4GC4A 4YNGA 1KFBA 1WO2A 2YW4A 2Y24A 1V79A 3PJTA 4DJDD 2G8ZA 2WB5A 1EYWA 1IYXA 1E0VA 1YKWA 4LQ1A 1E73M 4O4WA 2OELA 4O0KA 4UCFA 4DLMA 1PBGA 3B8SA 4LH8A 4RJEA 1N7KA 5DCDA 4K38A 1JI2A 1EWEA 4XKYA 3AWNA 3PBGA 3C61A 3CIXA 1OC5A 1BHGA 2DZTA 5AC8A 4HMCA 1E9LA 2WZHA 1MW3A 3CZ8A 5F7UA 4RZ4A 2VFDA 4Z1BA 2JK2A 4HOWA 2PBGA 1VFMA 2CWXA 2ZXAA 1HZYA 1EJSC 2D22A 3EWXA 1IWAA 4GA8A 2J62A 2TODA 3PUEA 1W1A1 3VMPA 5IDZA 2E7FA 3SCNA 4DWSA 3LRKA 2QCNA 4UQBA 1AQMA 1TO3A 3IIVA 4H1ZA 3C3NA 3UZWA 3MDWA 8XIMA 2DVTA 2FMNA 4XZ9A 1G1YA 2OKOA 3KL0A 3ABOA 2QULA 1D3CA 1Q63A 1XBZA 3W4RA 1AVAA 1TWZA 1K1DA 4WOQA 5HINA 5G2IA 1JZ6A 4XAYA 2WJFA 2WMKA 1ZQ5A 3KVJA 1OYCA 2E1WA 1NF0A 4KESA 1SJBA 3AWOA 1LDCA 1KBIA 2PU1A 1E5NA 3SCOA 1Q6FA 3BSMA 4ZXOA 2Q01A 2E25A 4FMVA 4FOJA 2ALRA 6PTDA 2XZ7A 3IGHX 3ZIZA 4AHQA 5D4YA 3MYPA 1B9BA 4YCPA 3DIPA 2YLAA 3GK0A 5I24A 5IBXC 3ATYA 1GWJA 3S46A 2ZZ7A 3AYVA 5FOOA 3DX5A 1DHKA 2DZUA 2FVLA 1HGWA 2JIEA 3WNPA 5G1TA 3FNDA 5BMXA 2XHYA 2VZOA 5HUPA 4E6MA 4LAKA 2QMKA 1O68A 1JXJA 4IGSA 2GVJA 1FWSA 4PCTA 3L4WA 5EL1A 2J27A 4FLQA 3O9NA 5K4ZA 4B92A 3WFLA 1Q2SA 1WDQA 5DANA 1LQAA 3BLDA 1E3XA 4ACYA 2PDXA 4POCA 3F4VA 3ID7A 1E6XM 1ZY9A 1ME7A 1TTQA 3W7DA 1E4NA 1NAL1 2PTZA 3OZOA 2QYGA 3A12A 3TE9A 4YTSA 4X60A 4IMEA 3LGEA 2XM1A 1P1XA 1PZ2A 4S3BA 3SQLA 3MKKA 1QW7A 1WDRA 4NI8A 4B4HA 3GNXA 4AVFA 4KCUA 2HRWA 3OVPA 2CPUA 5E0FA 4R33A 3PZ9A 2C1IA 3QZ6A 2RHGA 1L2QA 3IJ6A 3GTHA 1CGWA 1GJPA 2WAGA 4GE8A 3N17A 3O3RA 2Z25A 3UP8A 4YPJA 3ITLA 4UQCA 4MWAC 3MTWA 1VF8A 4I6VA 1V0NA 1EJUC 1ZZMA 1Z8AA 3A4XA 2JEQA 4B5SA 3MCNA 4GYJA 3DFYA 2F8QA 1Q4NX 1RP9A 3ARXA 2V67A 4YWSA 5HJYA 4H9MA 3CZLA 3BLEA 1Z6KA 2XH2A 4H8UA 1ME8A 2A7NA 4HZ8A 4PUKA 3USBA 3C52A 3BMXA 4DIAA 4GVIA 5K4XA 3UYCA 4PRWA 5IHRA 3LM3A 3FJNA 4ZENA 1H41A 2VO5A 3WNLA 1IT7A 2ZUWA 1MUMA 2Z1WA 1ZCOA 5FJJA 1P6BA 1XIEA 5D9OA 1KWKA 3AXMA 3WD0A 1PUDA 4FNRA 1H1YA 3L4VA 4FPSA 2QDHA 3WX7A 2OOFA 2OX4A 4KBXA 1K6AA 3FJLA 3WSUA 3UD6A 1CLXA 3RR4A 2W3ZA 1V51A 2AAAA 4D6HA 4JICA 1V77A 1NQKA 1PKMA 2Q71A 3ZM8A 3AYRA 3AJXA 1FWBC 2PC8A 4GCAA 1FWJC 4DUVA 1GOXA 3WG6A 5IM51 3TYAA 1O12A 2H9AB 2XH7A 2BXYA 2QQ6A 3CZGA 4RDVA 3R6IA 1YPXA 3DG3A 4HB7A 1J96A 1A0DA 1XISA 1L6FA 5BRPA 4I5XA 1VPXA 3UCQA 1UR0A 3VOHA 1K4HA 1C9WA 1RPKA 4MM1A 3WQ5A 3ME3A 3SECA 3L12A 4LF2A 5TQLA 3M64A 3BLPX 4B5XA 2P0IA 1L9WA 2E40A 2XSBA 4Y8FA 5E9XA 3WF4A 5JBEA 1FTXA 2ISWA 3R5EA 1JPHA 1NDWA 1M03A 4EACA 1AODA 3B04A 3WUEA 2PBOA 5GNZA 4JZ5A 5CKSA 4CQ9A 2PTWA 3P67A 3GNOA 2DSZA 1K3UA 4KS0A 4FXJA 3JRKA 3LCXA 5JUVA 4AC1X 2WMHA 1CLKA 5LHEA 1VYSX 3UF9A 3R4IA 5CZKA 4WX2A 5CC7A 5JU6A 3VDGA 3MI3A 1EPVA 1US0A 3CXOA 3QPYA 4TR9A 4ZVJA 5I5RA 4Q4MA 4X0NA 3TN4A 3P8IA 4JTHA 5FKYA 1G69A 2PE4A 2ZIDA 2PEVA 1ZJIA 2VC7A 2BHUA 4KFOA 3C4UA 4Y9NA 4CU6A 2CBVA 1W32A 3ITYA 5SWUA 1VEOA 2J7EA 1SPQA 1U1UA 3K8MA 3M16A 1RQBA 3MQTA 5AFDA 4Z08A 3WDPP 1FWHC 4YN5A 3TTOA 3ARUA 3AMKA 4MFEA 3AIQA 5AYBA 4PTMA 4JTAA 3LBMA 4OV4A 4YS1A 4E3TA 1NP2A 4B3ZA 1C29A 2W92A 4JTEA 4J3SA 4M1BA 4CNSA 3A6OA 3EGJA 2FVMA 4QFUA 4FNSA 3S5SA 5HR7A 1S5TA 2OQHA 3C0QA 2QMJA 3AISA 1JDCA 1KRAC 1W8SA 6CGTA 1H60A 3S5NA 3SO7A 1IEQA 2RAGA 3N18A 1N8WA 4JY9A 3MW7A 4J3UA 4NQ1A 3QC0A 1EO5A 5A6BA 5ABFB 3GBDA 2OWXA 2BWGA 3P93A 1FDYA 1CXEA 1XH2A 3TA9A 3K30A 3IAQA 3RPMA 3QGKC 5KETA 2O9RA 4M6VA 5I3JA 2PDFA 1AZ2A 4DZ5A 4LX4A 5FSDC 2PPGA 1OM0A 3ITOA 2OTDA 4GGHA 2J7GA 1GYNA 1Z69A 5LHFA 7A3HA 2NXGA 3OTRA 1WKFA 4WCJA 3W7OA 3FV9A 5REQA 4JYEA 4AMCA 1C8YA 1ITXA 2GGGA 4IPPA 1S5VA 3OLIA 2Z2UA 3GNNA 1GHRA 1SQ7A 1US3A 4I7UA 1OFEA 1U2YA 4PODA 7REQA 1YTEA 3O1NA 4PMXA 2ALDA 1SZGA 5HXMA 1UWQA 3CQIA 3ANYA 3C6CA 5CG0A 3KRBA 1EC8A 1ZJAA 4XWUA 1D7FA 1UD3A 4GIEA 4H7ZA 4GK8A 1PKNA 1AW5A 4IG2A 2BVDA 3UFYA 3TSDA 3WLTA 5F2IA 4RUBA 1PVNA 3OLDA 1F7BA 1WUEA 2GZXA 2HCVA 3UXDA 2DSVA 4JIRA 4S3KA 2BY3A 4O15A 4Z2GA 3AXHA 4PTNA 2VEPA 3DZ1A 1Q6QA 1R2SA 1PX8A 3NYDA 1JFHA 3ZSTA 3SRDA 2CCRA 3P3BA 4NZCA 3LD5A 4IUGA 4W84A 4CNTA 3JR2A 1MUCA 4C7GA 4AWEA 3LYEA 1XLHA 2KX9A 4Z1AA 2WHJA 4DO5A 3KTCA 3OIHA 4TV6A 3W29A 1E43A 2D0GA 1BFNA 4J5NA 2A6NA 4GZIA 1SO6A 3CUIA 4TTGA 3HQPA 1RD6A 1DQXA 4P8XA 4Q4QA 3MBDA 4A3QA 3HMCA 2Y7FA 5M1TA 2AAMA 5CGQA 4DYKA 4R85A 1QPRA 1JCXA 2DDXA 4N4PA 1M7JA 2QCDA 2OLHA 2NT0A 2XN0A 1Z9AA 2YXGA 3QMRA 1RR2A 1H2JA 3NO3A 4AMAA 5D9NA 2QLYA 1JYWA 4S3JA 2IXUA 4QS5A 3HPXA 3UG8A 4AWTA 4WF7A 5HJXA 4HSNA 2WWCA 1UA3A 1DOSA 3QHNA 4GUFA 3M0JA 3WQPA 1H62A 1KXTA 4TUFA 2PCEA 2SFPA 1NIUA 3KHJA 4AZCA 4IPLA 5BXSA 2EF9A 4ILSA 3UGVA 3D46A 3LCGA 4PUDA 3MDUA 3KAOA 1POJA 3TN3A 1B54A 3TA6A 1Z3NA 2GQAA 4XTDA 1V6WA 4DB7A 4HYWA 3Q67A 1BVZA 4H6EA 3WF1A 3E96A 1UC5A 5I23A 1W9PA 4DBEA 4GNJA 2Z26A 3U7BA 5T26A 1RY0A 1SW3A 1BF2A 4L80A 5C9ZA 3TYZA 3RFAA 1CXKA 4ZE4A 1GUVA 5LNRA 1GONA 3W7RA 2DUXA 1EF3A 3AHTA 2ZWZA 3OODA 3V18A 3WQWA 4JN7A 1XLAA 4RV8A 1H5VA 1I75A 5ABEA 1O1HA 3HQOA 1RP8A 2QGHA 1Q7QA 1O5QA 4K8HA 1R46A 3DENA 4RK8A 3HG4A 2DP3A 4HZ7A 3VD7A 1H61A 3BJFA 4Q8WA 5I79A 2GJXB 5D04C 3V0SA 1OCJA 2FZDA 3S2CA 1BGGA 4UTLA 3TR9A 1DHPA 1F4AA 5U4NA 2VCAA 1OX4A 8XIAA 4GJJA 4L4LA 5C70A 1OK4A 2PGRA 1R85A 2R1KA 2D2GA 1QI4A 4Y9PA 2PS2A 4W93A 4O19A 3UXLA 2ZCGA 1E55A 1GQNA 1NM9A 4B9ZA 4ONVA 2EG8A 5BRQA 3CAWA 3QTPA 4PEKA 2IKHA 3BTNA 1UUOA 5AC4A 4OE7A 5HAOA 2BGQA 4AHOA 4W5ZA 3HPFA 4M82A 1U5VA 3E0FA 3KTXA 5DLCA 1WXJA 4LPCA 4AB4A 4IL2A 4F4RA 3RNDA 3EWWA 4JOMA 1UZDA 1PHQA 2OMAA 3GVGA 3STPA 4QROA 5CPTA 2AQWA 4W7VA 3J7HA 3U57A 1TZ7A 4NJGA 4J3VA 3HV9A 3I6TA 3TKFA 3A3WA 3MUCA 2ZC1A 2WVSA 1TJ1A 3BICA 1PL9A 1FWWA 1Y5XA 3E2QA 2FHBA 3EWYA 3TSMA 1EWDA 1KV5A 1GT8A 1TJ0A 3NOEA 2BNJA 3CV2A 4MYXA 2YKKA 3AZSA 1JUEA 2VHLA 5BXTA 1ZU8A 4DN1A 2QW5A 4XZWA 4MJMA 4ZO9A 4NUWA 2WVVB 1R9YA 1XRSA 4WIWA 1F6PA 4IT1A 1A5MC 1KM6A 3IVSA 4RE4A 4PGLA 3UPWA 3UXIA 1YE4A 3PTDA 2ZICA 4O13A 3W26A 3UZYA 1WKYA 1ZUAX 1JDAA 4FSAA 4HZMA 3KE0A 3MVTA 4WEVX 2PURA 1E71M 4I9TA 4WDXA 3GXNA 1W5MA 4H7VA 2ZC8A 1JCNA 1D8CA 2HROA 4JIEA 4NJIA 2OX1A 3ZYZA 4GYPC 1HN1A 1UWSA 3ZR4A 2QPSA 2VQTA 1FWAC 3LK6A 5G1MA 2YCKX 2W91A 1GVIA 1E6SM 3NQFA 4MLRA 3AYTA 1ZBCA 4JGDA 1CECA 1XLGA 2YBUA 1J5TA 3LLFA 1TSIA 3W1TA 1PCWA 4MGGA 3VE9A 3WJZA 2X1RA 2R14A 2POZA 4EK7A 3VNMA 4BF9A 5EMKA 1FXPA 1PAMA 2E5BA 4IQDA 2DZXA 2YCLB 2NQ9A 4AD1A 2WLZA 5EGRA 4QNWA 4BK9A 2WZTA 5HNTA 1GKQA 2CC0A 3COTA 3FXGA 6TIMA 1SFSA 1H0IA 4H7CA 4ORIA 4PTWA 4MVAA 4UQAA 1GPWA 3H8AA 3FDKA 1K77A 4QISA 8A3HA 3VKKA 1JAKA 1UKTA 4BZYA 2AL2A 5EFFA 3ZFHA 1VGAA 3CL7A 4O53A 2Y5SA 3A4WA 1FHUA 2ZTJA 3GU2A 1GVRA 2VCCA 4ERAA 3K1DA 4CN1A 4ERGA 3FXYA 1HL9A 3KBJA 3Q4DA 1J6OA 1QWGA 4XUGA 2NQZA 1EB3A 4OKDA 4UUIA 4ZXLA 3GXDA 3WNMA 4DF0A 1A5LC 4H9UA 4DWSC 3HPZA 4ACZA 3RUBL 2B31A 2P53A 2BTMA 1EGMA 3QJAA 4ZB0A 3VNIA 3AU2A 3NFUA 2R1PA 3W1UA 4MNMA 1TPDA 5DFAA 3GG0A 3UT0A 4QG9A 3UEQA 2PRMA 3URAA 5HNNA 1U1JA 3NG3A 1OHLA 4KFPA 1QI5A 1RCXB 3WY1A 4UTHA 3GG7A 3T0DA 1R6WA 4FIQA 4JFSA 1H1ZA 1H7PA 2EKGA 3KOFA 4JEQA 4NAFA 3R0UA 4AC7C 2OR2A 4P5UA 4M29A 2JQXA 5HWNA 3PBVA 3W85A 2EO7A 1H63A 3LCWA 1JYXA 4IIBA 2YL9A 4NJKA 2VXNA 3W6MA 3G5EA 4HPJA 3UQNA 4EPDC 4UR7A 2CZDA 3APYA 5FJRA 2YFNA 4Z1CA 1LCOA 2ZE3A 1XIJA 4NKCA 1CGTA 2ZRVA 2QJGA 3WUGA 3HIJA 3TZFA 5IHSA 1EBGA 2WC3A 1BWKA 3HOJA 4HN8A 2EG7A 3TC7A 3TN5A 5G5IA 2I17A 3QXBA 3MO7A 1JZ3A 4IMDA 4AY8A 3WH7A 1BYAA 3FS2A 3VGHA 1X98A 4UWMA 4F40A 5C2CA 4IISA 2GYIA 4LF1A 4Y7EA 3CL8A 3DHFA 2CIPA 4HGXA 3PBMA 1QNRA 1L2UA 4GJIA 1SSDA 4S39A 3L5LA 4ZB2A 1UD6A 2OCZA 2V69A 3VDHA 1DJNA 3SDOA 2WO5A 1OG0A 3W7QA 4US5A 1K9FA 2INFA 1TTPA 1FWTA 3M1ZA 3VZZA 2HS8A 1A5SA 3V3WA 1HXJA 1AW2A 2YCEA 1OT1A 1FHVA 3TZNA 1GVYA 4QRNA 1W9BM 4YLWA 1R3WA 4DBUA 1OYAA 5FL0A 1ONEA 1NP0A 5DRIA 1PV8A 1J0HA 4B16A 5TIMA 1S5WA 1J4EA 1TRIA 3G0UA 1KNWA 1F9CA 3AMDA 3NQ6A 2Z7GA 3VGBA 1EC7A 4LU0A 2FPYA 2Z1VA 4XUYA 3H4GA 4R88A 1A5OC 1X97A 3V1HA 1B3XA 2QCCA 4MWAD 2ZX5A 2VP8A 2YA0A 4JFVA 3GFZA 1MRAA 5A6TC 4W5UA 3CB3A 3AXIA 3VD5A 3L4ZA 2VM8A 3E6EA 4C6JA 3E38A 5I3KA 5C9UA 5BXPA 2DUAA 1ZB5A 3A9BA 4W4QA 1IGWA 1UR4A 1Q6GA 2GUYA 2DUZA 2YSWA 3QGVA 2A3BA 4XISA 1ONXA 2QUUA 1TV4A 3VX1A 5C7VA 4Q32A 4JTRA 4OHQA 1A47A 4KWUA 3WEOA 3UR8A 5FSEC 3EX4A 3GH5A 3MUAA 1XRVA 2QCHA 3K1GA 3HFYA 2FDMA 2WSKA 3C8FA 2TSYA 1UR2A 3BCDA 2BDQA 3WKZA 3SZ8A 4XSMA 1T8XA 3NPXA 1H49A 5DT5A 3T2QA 4WUIA 1E3ZA 3TK7A 2V0TA 3BQ5A 3VC6A 2VVSA 1FKXA 4DHGA 1HJUA 3GVVA 3ZT6A 3KBSA 2CLFA 1X1OA 3NQCA 3LCFA 2XIMA 4LCSA 4BJHA 4I7VA 3P82A 3CK5A 4WJXA 2DT0A 3SM0A 3I7QA 4HJWA 7ENLA 4AYGA 3E9AA 1ZTVA 3AUJA 2HWGA 2VZSA 2BY2A 3OW1A 3MSRA 4CD6A 1JNDA 3TIMA 2WKGA 4S2CA 3VUSA 4HA4A 2IPWA 2BGSA 3MU7A 3TNOA 1XKJA 3NZQA 4D6JA 1GVQA 4QR6A 1RJRA 4JY8A 1S2UA 3C2VA 2F6UA 3WMBA 3O63A 5G2HA 3HGRA 3TFCA 3BZJA 3N73A 1CGXA 1EZ2A 3SI9A 4LAZA 3IRSA 4GI6A 3GTIA 3CEPA 4XV0A 2F7FA 4KERA 1I4NA 4LW7A 4A29A 4OFCA 2ZX7A 1W1TA 3ARWA 2V81A 4Q4KA 2AOSA 2OLSA 3SCQA 5EU9A 4E4UA 3AS2A 1QR7A 4O10A 4QSHA 5LXXA 1ADSA 1XPGA 1P48A 2HZGA 1CNVA 9CGTA 3QQ0A 3EBVA 3NDYA 4JIPA 1CLVA 1EXPA 1NWRA 2GVYA 3EXRA 3NZGA 3NTYA 3D3AA 3S42A 4JKMA 4HNTA 2Q8ZA 3P14A 3GQYA 2XSXA 5LA0A 1HX0A 1OFPA 1I2NA 4JKKA 3SFKA 3TTSA 4NAEA 3H21A 3LPFA 3IV3A 1IXPA 4AEFA 2ZADA 1KXVA 1JIBA 3PZNA 3QKEA 3P61A 7CGTA 1GTEA 3WQFA 2ACUA 3FOKA 1OZMA 3G22A 4YWIA 4J3WA 3KOZA 1LT8A 5FJTA 4P7OA 2NVDA 3VIJA 3B03A 4DUOA 2IQDA 1WYIA 1MXGA 1M41A 2HXTA 1AD4A 3JS3A 4EX4A 4GISA 3LHTA 3W37A 3PBYA 1Q6CA 4E38A 3ES7A 2E6AA 4AIUA 5D2TA 4DO7A 5A1AA 1A5KC 1D2KA 2DH3A 5HUOA 4MY8A 2HVOA 2HNHA 1FWIC 3L0KA 4YIWA 3WLIA 1SVDA 5F4XA 1LJYA 3MZNA 2G3FA 1VEPA 2A3EA 3N25A 1BXNA 1VRDA 2OYLA 3DG6A 3WUBA 4MB3A 3QEZA 5D2XA 4NX0A 3PZTA 4IPNB 4QNEA 2ISDA 5JXQA 2ZUNA 2WCSA 1R3VA 1QPQA 1TA3B 3WD4A 5DF0A 4XD4A 3UYIA 2WOQA 2ZA3A 4NSBA 5FJOA 1VZWA 1PZ1A 5E09A 2XVLA 3URBA 3KX6A 2YPIA 3VIIA 2C19A 1IXNA 4Q4OA 1KB3A 3W9ZA 1S2WA 3W1AA 2XINA 5C7HA 4UQDA 2UBPC 3QMSA 3A23A 4GI9A 4KWWA 1HO4A 2X41A 4PB3A 4PMNA 3QYSA 1C7TA 3SQSA 1KO0A 1D9EA 1TB3A 4M3PA 2PZ0A 1Y5VA 5A8GA 5D9MA 5ECUA 4GLEA 1KCZA 4DZIA 4IX2A 1QVBA 3WBWA 3RPDA 2BVYA 2BZNA 2JEPA 1ISWA 5IOBA 3PG9A 1OWQA 3CUXA 4H3DA 1C9DA 2XGBA 2FB2A 4HOXA 2GJRA 4GIRA 4WSHA 1DBTA 2I5QA 3B0PA 4YYCA 1W5OA 2PODA 1AK5A 3WQEA 2DT3A 4EOUA 5CBIA 2ISVA 2E09A 3WFZA 3W73A 3VNJA 1A4MA 1UPPA 4N7QA 3IPWA 3W82A 1YYAA 4AZ5A 1OK6A 1LM1A 3KZPA 2OB3A 4A05A 4E8GA 4TXEA 2IPGA 1P4CA 1KD0A 2FIQA 4KIRA 2PCQA 3TFXA 3W7HA 5CPMA 1M1BA 2OGYA 3I7RA 1EJXC 1I1WA 5EPDA 1KBBA 3KCOA 3W23A 3WK1A 1LG1A 1PEZA 2MNRA 5BOFA 3P62A 2YBVA 3QR3A 4M7TA 3W02A 1R38A 4YMZA 4AXKA 4N9CA 4X9SA 4YU1A 2ZYFA 1KKRA 3I3BA 4HP5A 1V93A 2INEA 3W07A 3UA4A 3TC3A 4NI3A 3PTKA 3QHOA 3WUFA 1G9HA 1HKVA 1ZAHA 1AD1A 4ES4A 2E3ZA 1KXQA 3M6DA 4PUMA 1A5AA 2V3FA 3T9PA 5HWJA 4MDPA 5CJMA 1UR8A 3BC9A 2V8ZA 1EO7A 3RPTA 4BF5A 3NZPA 3NQMA 4GVGA 3WLRA 2J9YA 3H70A 2DJLA 4AG0A 3L2MA 3GTNA 3PZOA 2YBTA 4KEUA 1WZLA 1A3XA 2YW3A 4M7SA 1F6YA 1IWBA 2VGBA 1IXOA 4GQBA 4L5ZA 4NRRA 3H2EA 4PCNA 1XV8A 2FTYA 1B3WA 3MYOA 1XLLA 2ABAA 1R9ZA 3HA1A 1K8CA 4MIMA 2J79A 4TV5A 5CPNA 3D5HA 5CG7A 1JGIA 2VFIA 3TYDA 4FR1A 1UD4A 4TMBA 1WOBA 3OGVA 4XAFA 1QO5A 2ZWYA 3RO8A 1FCUA 3EMQA 4NT0A 2XYLA 1DE6A 1KRBC 3GC4A 1BG4A 4DNHA 3TW7A 4UTWA 4LXFA 3N3MA 3ZLFA 1NU5A 4PCFA 4OZOA 4H2HA 4QLKA 4M6UA 3TCSA 2Z24A 5F2LA 3GAYA 2VFEA 3BLFA 1HVXA 3NL5A 3W28A 4QEEA 2CITA 4IPJA 2YDRA 5CJNA 4KETA 3CPUA 3WQGA 1CGUA 2WZIA 4P8VA 1C90A 2ZDSA 4LUSA 3IV8A 1GOKA 2PP1A 3IIPA 3LSBA 4TO8A 3E0LA 2Q09A 4WDWA 4WK9A 4IICA 4QGCA 1IT0A 5A2AA 4R9XA 1QMLA 2WJZA 5DBUA 4ZB5A 1VFOA 4GUGA 4Q8QA 1DJQA 4PMYA 4DVOA 2EXOA 1F3TA 3ZT7A 3OP2A 2J8FA 3O07A 3I10A 1PXGA 3EDKA 1NDYA 4BA0A 1GOQA 4EWJA 1H11A 1E4LA 2Y4SA 5J5DA 4JL1A 2YXXA 4W9TA 4GUIA 3WBYA 3LV6A 4KMQA 3B8WA 3FK4A 3CUGA 2QR6A 3NAVA 2XH4A 3AJ7A 3W24A 1MZRA 3GLCA 1ITUA 2YLLA 1GPFA 4AIBA 1G7UA 4H01A 5KZ6A 2HEJA 1HKWA 1FBAA 3W84A 3HTWA 4HPNA 4FOKA 1LZOA 1NEYA 3MHFA 5H1WA 2YR1A 2OYKA 2DIJA 2W0UA 1I45A 1VD6A 2IMRA 3P80A 1BSIA 2JGQA 3MT1A 5HQLA 3RG6A 2BODX 1KFCA 2ZA1A 2VRQA 4IIDA 3EB4A 2Z29A 1VLWA 3AO0A 1E5JA 3QFEA 1G6CA 1RK6A 4KGJA 4XIMA 3PPGA 2BHZA 5JVLA 1R5YA 4GWEA 2XWDA 1W9UA 2VURA 2OXNA 2OSYA 3WDQA 3SCSA 2IPFA 1V02A 2HTMA 3WQ8A 4LNCA 4GY7A 3APTA 4HTYA 1VJIA 3CQ0A 5DT7A 3N2XA 2F6KA 1TVLA 1TZZA 7REQB 4Q8PA 3DFSA 2WBKA 4O1AA 4W8LA 3DI1A 3MANA 1S1PA 4FXRA 2I56A 3K46A 3S1WA 1XYMA 4M8UA 2IKGA 3QV7A 1MW0A 1AQFA 3GVQA 3FDGA 3S1XA 3WENA 1OJXA 1EEXA 2VJXA 1LROA 1W3JA 2ASHA 1DJZA 3FGCA 3NCOA 3T0AA 1Q3NA 5EKYA 1ENUA 2X2YA 2OO6A 1OFOA 1XUUA 2VT0A 4C6FA 1W54A 1AG1O 4ZMGA 2KZHA 2V68A 1YEYA 2E4TA 3N6QA 2XIOA 2GGHA 2PWDA 4ZODA 4IZGA 4K8GA 4C6NA 2BG5A 1JEZA 4US6A 1W5PA 3S9IA 3UJSA 4ZOEA 3HF3A 4I3GA 1BKHA 4MY1A 4XTIA 1GZGA 4J1OA 5CC3A 3AMCA 3L21A 3WK3A 4UOZA 1XCWA 4DJDA 3BQ6A 5K9DA 3WNKA 1HP4A 2PP3A 5IFTA 2G50A 1T7LA 3EMZA 3IGXA 1IWPA 1KGXA 1EP3A 1QNVA 1B9ZA 4IHCA 5F4SA 5EFDA 3VNDA 3N19B 1WAUA 1IZJA 4GINA 4FP1A 4LY4A 3HM7A 3WEZA 3OYZA 4O8AA 4PBGA 4AZHA 2Y62A 1F07A 1J93A 2OPJA 4LOCA 3VMNA 4CCDA 4D1IA 5BYWA 2JKPA 5AHFA 1V3KA 5DY3A 3EXTA 1AL8A 3JU2A 3ELFA 3DESA 1XDJA 1F8MA 1W5NA 1ZP4A 3GH7A 4ATWA 5GNXA 1VRXA 4EIVA 1K4GA 3M0ZA 1A0EA 3F5KA 4EF8A 3CHCA 4QE1A 3CMJA 1OC6A 3AIBA 3SJNA 4H8VA 4JR5A 4LUIA 1B3YA 4OWGA 2FZNA 3STEA 4PUJA 2Z0IA 3M9YA 2GGEA 5D2YA 3UWYA 3LN3A 4M19A 4W85A 3C0LA 2C71A 3JW7A 1XLEA 4LYPA 5DMMA 1C7SA 1UH4A 4P2VA 1M53A 3UR5A 2QIWA 2V30A 5KINA 1C91A 1KFLA 2D0HA 4HHHA 2ANUA 3H23A 3V36A 2OWWA 2DVUA 1H0GA 1ZALA 4PB4A 4Q4RA 1C8QA 4F3HA 3U2CA 1X39A 4L4MA 4W8BA 3QBUA 4S1FA 1DXEA 4KWOA 5CBJA 5DXXA 1KTBA 1CTNA 2YL6A 4UOQA 3G0SA 3QQWA 1BLIA 5KITA 4DXXA 1NWSA 3VFCA 2YCIX 3EOSA 4MDOA 3TAKA 3WH5A 2IKJA 3LNPA 3M44A 3LZ5A 3APGA 3POHA 4HK5A 2NT1A 3KWXA 1CX9A 3P84A 2I5IA 5D38A 3IAPA 3TSBA 1XF0A 3M0KA 3SUTA 2CYGA 3N2OA 1JPIA 1JRBA 2ZVRA 3VOIA 4LVFA 5FJUA 2DZWA 4D6EA 1UD2A 3ISIX 4UFMA 4JS3A 2PZNA 2WJEA 2G3NA 4QM1A 3N3TA 3S1GA 4R7OA 3HO8A 3W87A 4L1WA 3MPGA 1TRDA 3GU9A 3LM7A 4L6DA 2F9RA 4RNFA 4HTBA 2ZX6A 1TJ2A 3UWEA 5MF5A 3M0MA 5BROA 1FP9A 4JFWA 4G7EB 3Q45A 2NLYA 1AH0A 3AQUA 1K7EA 3EDDA 1GYMA 5ABFA 4WJ8A 1BPLB 3W6LA 1W1VA 3U2OA 1UR9A 4Q4PA 3UW6A 1XH1A 1DIOA 2NQJA 2HE8A 3GM8A 3VIMA 4C5YA 1XCFA 4WKAA 5G1YA 3O6CA 4QDWA 3VD4A 1GK8A 2AMGA 4U33A 2WCAA 4UTFA 4JNYA 3RGTA 3PB0A 4LUSB 1WZKA 1B4EA 4ZCWA 3H2CA 1QNOA 4DJFA 3FA3A 3F4CA 4FHAA 3SR7A 1WZMA 4DAIA 3FVMA 4DF2A 4F66A 4HU8A 1UPMB 1GW9A 4O0ZA 2NV2A 4ZE5A 4QITA 2EJ1A 2POTA 3WBXA 2VZUA 1EGVA 2MUCA 3RM4A 3TTQA 5AC7A 3VAVA 3GSMA 5F1VA 2F2KA 4WY0B 1S1RA 1PYMA 3ABQA 3W1XA 5I3GA 2PDCA 4YXGA 1AW1A 4XD3A 1MYRA 1TQXA 2I14A 1Z89A 1A3HA 4E8DA 5AYZA 2DSWA 4QAIA 1YQ2A 2LLEA 2H6RA 4Z1YA 5K9XA 1W5QA 1PWLA 1GOWA 3SRHA 2YGYA 3W2KA 3MKCA 1A5NC 4JTUA 1W2PA 1DL3A 3TJ4A 4FX6M 2WMGA 3MZ2A 1R7AA 3SIZA 2BHYA 1FWGC 1QNPA 3MSYA 3T05A 3NNTA 1MI3A 4UTTC 3UCCA 4W8AA 3IWPA 1Q6EA 4P7NA 2FFIA 3CC1A 5XIMA 5MKGB 1DIKA 1TPWA 1G4PA 4AVNA 3MI6A 2J75A 3S6TA 3IUDA 4GPNA 4GCXA 4FR6A 3PF3A 2B7OA 3TJIA 4FF5A 3FJ4A 2IUZA 5I6SA 4X61A 5LKYA 1Z48A 5I0DA 1M7OA 2GFTA 4GH1A 4UXDA 4IMAA 1OY0A 4Z2JA 3ZLGA 3A21A 1PIFA 4U4MA 1S46A 4DF1A 5I3IA 3VKDA 4NASA 1KC7A 2DW6A 1EX1A 1A3WA 5D30A 2ZTKA 3H7UA 2BOGX 4XG1A 4QCFA 1LLZA 1JF5A 3MMTA 2QJJA 1P0DA 1TYGA 3ONCA 1VENA 2FFCA 3S5YA 3UZJA 4O11A 5CAKA 5I77A 1PIIA 1TX2A 2DJXA 5CSYA 1XIDA 2C18A 1JCJA 2XSAA 3W7PA 1UG6A 1XW8A 2JE8A 5AKQA 1BQGA 3L0NA 1H7NA 3QSRA 1XYLA 4UMAA 4UC5A 3BCFA 3C2EA 5REQB 4LC8A 3B9EA 1XCXA 2YJQA 2XIBA 4W88A 2GVEA 3MB9A 2R24A 1YPFA 2B7PA 4MTVA 4OOZA 3GTFA 4MSSA 5LNVA 1EOMA 5CEWA 3FSUA 2VWSA 4K3ZA 2WYSA 1V5XA 3S9ZA 1VCGA 2FGBA 3ZR6A 1QOQA 1EBHA 1K8YA 1GQKA 2F84A 3NQ7A 4ATDA 4XVEA 3PG8A 1T41A 4CN4A 3DFOA 1A5BA 3H26A 5AC6A 2EG6A 1PKYA 2E77A 3WDRA 5E9AA 1Z41A 2CEQA 4MNKA 4CQCA 4A3YA 2W61A 3GDLA 1EYEA 3L68A 4Z2KA 3HU7A 2V3EA 1E40A 3W7IA 3QMTA 1LQ2A 2EGZA 4GXWA 1XGEA 4HK6A 5BOOA 3LG3A 5HMEA 2VR5A 4GRSA 2VD9A 1ZBVA 3VIFA 2WHMA 3DFTA 4LVDA 1LUCA 3I6EA 3VX0A 4G9PA 4MUZA 2J8GA 1OFDA 1XIFA 3I4KA 1F73A 1YNYA 4R3UA 1JJKA 4TIMA 1GOIA 2REQB 4Y9MA 2CLLA 3EDEA 3LTSA 1JGMA 3R8RA 5HOSA 2FJKA 1JZ4A 1R2RA 3PWGA 1IV8A 1KBJA 5E93A 2AKZA 3QLLA 2PB1A 1T0OA 1Y8BA 4X3ZA 4HVXA 3C0SA 4LUYA 1NFBA 1F5ZA 1REQA 4M81A 4MPKA 4GQGA 3P6LA 1KCLA 1V4YA 3CASA 4M6QA 2DT1A 5AOUA 2CLMA 2VNCA 2VEIA 3BXWA 4Q8NA 1OIFA 3DH7A 4B4FA 3RMEA 1K7FA 4LNYA 2YYTA 3PM6A 2ZZ5A 1KLYA 3UA3A 3W72A 3G1FA 4R34A 1VYPX 3LHYA 1CGVA 3L4YA 1AMYA 3WL0A 4E0CA 1UKSA 3F2BA 6A3HA 3H24A 4ML9A 1OFBA 1EDGA 5I06A 1K8XA 4UCGA 2QUNA 5IFPA 3SB0A 3WH8A 2P5NA 3LI0A 4XB3A 3NXLA 1VLIA 4AUBA 1AH4A 1TPUA 3G0XA 2WPGA 3WD2A 1PDYA 1LOQA 2FVKA 3GR7A 1EUNA 1MQQA 5IBXA 4M6PA 5GJPA 3FW6A 5AECA 1UWAA 2Z1KA 4GY0A 3OG2A 4XZHA 1YBQB 2GGIA 1O66A 5D9PA 3M0YA 4C6EA 1C8XA 3W7JA 1W17A 4A22A 2WZEA 2WCGA 3A13A 1K70A 3DFHA 2DZBA 2VUYA 1SZEA 3G3MA 2IXVA 2HNEA 4FZIA 3L23A 3RRXA 1IIHA 3JUGA 3SCPA 4O1CA 4ZO8A 3BARA 4JD4A 3A3XA 1BYDA 1VC4A 4PMOA 3OIXA 1G4EA 1XLCA 3DUGA 5IDIA 4QP0A 3M07A 1WOAA 4MLJA 4ZO6A 2VRKA 3A22A 1V6YA 3B05A 3LNMA 7PTDA 4UTTA 1OINA 3N12A 3C8NA 3NIYA 5TNVA 4HNCA 4YJ5A 5CAHA 5DRCA 1XIGA 2HBVA 3O6AA 2HVNA 4U2YA 3GWQA 4H6QA 3WO8A 3WYZA 3ATZA 5AY7A 4JTSA 3NZ1A 2B0MA 3LOTA 1ODZA 3UU0A 1PZ0A 3WLPA 2HV5A 3G3DA 2E9LA 3SY8A 2YOCA 1IGSA 3GC2A 2IPJA 2OSWA 3DEQA 4MB4A 3LRLA 1XLJA 4HYRA 3WIJA 1Q4WA 2OT1A 4C1NA 2CW6A 3M0XA 3BV7A 3FAWA 2GJXA 2DSKA 1BYCA 1TMQA 3OQEA 1H5YA 4L9YA 1TWDA 3IUHA 1IZKA 4IMCA 5FAJA 1S2CA 3W7GA 4B5NA 3GFXA 3NQAA 1MFVA 2VZTA 5I78A 1IR2A 1W8GA 1VBUA 3Q58A 3C0JA 3SW6A 2PA6A 3QTGA 2IQTA 3A4JA 1IXQA 4AZ6A 4WSJA 1X7IA 4X22A 1S5NA 1GYLA 2VTFA 4ZQPA 4F0SA 2ZXBA 1KXHA 4K7YA 2I57A 3OZMA 4I9MA 1JUBA 2YCJA 3W81A 1AQHA 2WLYA 2EPLX 3S4TA 2CLOA 4LBRA 1BXCA 4N2YA 2FGZA 4GFIA 1K9TA 2FZMA 1SYTA 1A4LA 3P2VA 2NQHA 1NF7A 3B9AA 2EEXA 1OZQA 1KM1A 3ARRA 3IJQA 5HWMA 2ISSA 1UWTA 1ZCCA 3N9KA 1GG1A 4AZ7A 1JCYA 4D2JA 3ARQA 1OCBA 4ZSUA 4C6PA 2C79A 3T4WA 3R8GA 3REQA 4IM4A 5CLTA 4D8ZA 1W1PA 3VIGA 1YW1A 3ECQA 1EJVC 3KBMA 4LAUA 1G0CA 3OBAA 2BFGA 3WLNA 5EBUA 2WKJA 3S3GA 4MB5A 1OABA 1JD9A 3HPSA 1QTWA 1I2OA 2CXEA 1RHCA 2PWUA 2C0AA 2ZRZA 2DT2A 1RD5A 1V0LA 1LF1A 1QCWA 3N13A 3F5LA 1AL7A 1VBHA 4UBPC 5HQMA 4IMFA 1EUAA 4IIGA 3KWSA 4UIOA 1G4SA 2WQPA 5L6UA 4DYJA 2ACQA 4JKLA 2J74A 4U3AA 2R94A 1OD0A 5C54A 3V0TA 3WJXA 2PWVA 4UQ9A 2CLPA 2ZUMA 4ROPA 5E0CA 5U7SA 2OFJA 1M5WA 3T6CA 5CZ0A 3QV9A 4NF7A 4XKMA 3WZ0E 4KQNA 1E1EA 5FF4A 3NVDA 2J47A 3VNZA 3EA3A 4KT2A 1MO0A 4PSPA 4LRTA 3HGSA 4NAFB 1XSKA 3CUJA 3H2FA 5HR6A 4LB3A 4ZA0A 3GVRA 3MV11 1KQYA 3VM5A 3VTRA 4LS0A 2ZDRA 1Q13A 1M6JA 3LXBA 5A8OA 1FHLA 2ZRWA 4CN6A 4S38A 4KKXA 4JHZA 1DWGM 3CQKA 3VCRA 1UR1A 1HO1A 3CS2A 2X1UA 3FN9A 2XFRA 1QHZA 4J3XA 4LVAA 3D0CA 4Q8OA 1C3FA 3THAA 3MCOA 4DWDA 3NEVA 3XINA 4DWSB 4JTIA 3WMSA 4BEUA 4PC8A 1E1CA 4NRSA 4PSRA 3UJEA 1XR2A 3MUIA 1T96A 3I3DA 2QCFA 4XAPA 3T4CA 4KH2A 2FH8A 3V1PA 1HW6A 4C6IA 5FEWA 5H8PA 1PO9A 1XLKA 3TQVA 4AF0B 3THDA 2RGMA 3AU6A 1QATA 3WLKX 1K9DA 1BEUA 1LBMA 3GR8A 2J7DA 3BG5A 5LIUX 3H2MA 4P61A 3SRKA 1S3TC 3BURA 2P1FA 2BVTA 4GYPA 2OZ8A 4N9DA 3U0HA 4HA1A 3TEVA 2G41A 3GHTA 3S47A 2C0HA 3FAXA 4Z2IA 3OVQA 2FZBA 3VD3A 1V7YA 4OJYA 2G4FA 3EPMA 2V3GA 4J35A 5CQ1A 4J28A 5HPCA 1Y65A 4CU7A 4PBEA 2NUYA 3LXAA 3R11A 4CGTA 5EMUA 3G1YA 4REQB 1ONRA 1XIIA 1UZ4A 1M04A 4CCZA 4Q6JA 5CC6A 2OJPA 3M47A 9RUBA 1RLDA 2C1HA 3LHZA 2ABBA 2X09A 3SCUA 5ABHA 4KPLA 1GGOA 3GDRA 3LLXA 1FY6A 3UY7A 2X1SA 1JR1A 1XD0A 4HPGA 3ZO9A 2PDYA 1GORA 1YX1A 2PLJA 5IXEA 2NZLA 1L6WA 3IEBA 3UG4A 3FYYA 4RDYA 7ODCA 3QF0A 4HN4A 5AN7A 4DO6A 3GC5A 4MNJA 5C9WA 3NOYA 3T07A 3T8QA 2QIIA 2FJUB 3PSWA 1W3KA 3WF3A 5LIWX 2A79A 1R30A 1DTUA 1KBKA 4S3AA 3OEXA 1ZSXA 3KDOA 4E4FA 4F2TA 3E49A 4JL2A 2GSHA 3RCMA 1WAWA 3ARTA 1WZAA 3R12A 2IS7A 3AS0A 2R1NA 4CUCA 3NPWA 1I0DA 5LIYX 2AGTA 3IARA 1OFAA 3FCPA 5D2WA 2ZFAA 1SZFA 1XC6A 4RNHA 3SN1A 1P0NA 2XZ9A 2GDQA 1XICA 1F6KA 3W1MA 3PZUA 4Q8MA 4FNPA 3EEGA 3VPLA 4CVUA 4D6DA 1IEXA 3FY1A 3ZZ1A 1Q2RA 3SCWA 2DZVA 1XINA 3INPA 4EE9A 1O60A 3BAWA 4HA3A 4O54A 1XXXA 4M5PA 1FWNA 4FB7A 2VEFA 3RX2A 1NOFA 3UJ2A 2VX4A 2X42A 1QOPA 4N9BA 4GVFA 2H8ZA 3AHVA 3KDNA 3P7YA 1MFUA 3PP7A 2JFEX 2OO0A 2VUNA 3ZJKA 4C1KA 3MBFA 4AD3A 3U9IA 5HULA 2XIQA 3W7EA 3GRIA 3H6OA 5KSWA 2FPVA 4JN8A 3W1LA 4MHBA 3QVQA 4JCLA 4Z0SA 3B8DA 3W86A 1UWRA 3DECA 4CNPA 2WVTA 3DN5A 4IWWA 2C3ZA 4H9VA 4O4VA 2DORA 2FTWA 4B3KA 3G1AA 1NY1A 3D47A 3ITGA 5FJIA 3WQ4A 1ZS2A 2EKCA 1YNPA 1KM2A 3TONA 1X8CA 1FCBA 3PPHA 4F0HA 3IVUA 2ZX8A 4US5D 4ZSTA 2G3MA 3GO2A 4O50A 2GPTA 2GJLA 2CKSA 3G8RA 2I16A 2A21A 3SUWA 5BW6A 4PUEA 1K8ZA 2ZZ2A 5HPOA 4TQTA 5CLWA 3DYOA 4C6QA 1ZRQA 3EOUA 3ALFA 4K1WA 2PGEA 3LQGA 3Q65A 4O18A 4H6RA 4O1FA 3EWBX 4YCOA 3CUHA 4CEXC 2HDJA 1W91A 1Q6LA 3NQ2A 3CYJA 3VC5A 5G2WA 2BMBA 4LYQA 1NWUA 3K2GA 1F3WA 1QPKA 1R86A 3WDIA 3IS4A 3L4UA 4BI6A 5AZ0A 4Y9OA 4Z1DA 4AFYA 2Y8UA 4EPKA 1QJWA 2QXWA 4I9JA 1BTMA 4INFA 4DNMA 2ONEA 3ARPA 3DKLA 3PR2A 3T0BA 4AAJA 3G1XA 5FD0A 2QDDA 5MKGA 1SW0A 1QASA 4IFRA 3R8HA 4G5DA 4A8NA 1I2QA 2HK1A 4HT3A 4XD6A 3OOQA 5FF3A 1DWJM 3NJ3A 1GHSA 3GHRA 1TV7A 4LC6A 4MKNA 5G4EA 1UMYA 3PBUA 3OZYA 2E0PA 2V5JA 1EP1A 3L65A 1B57A 3HN3A 1UC4A 2CZVA 4WKHA 3VOGA 5CH9A 2P88A 2X16A 4YHGA 3FIGA 3N1AA 3TR2A 2WXDM 3NQBA 2VVNA 3UZXA 2VR2A 4H9ZA 4A2RA 2P76A 3CAKA 1Z32X 2PMQA 1R3QA 2GDVA 1DP0A 3CL6A 4NZ5A 3BCJA 1VHCA 4X2RA 3MV01 1PHWA 2PDHA 4Q33A 3UWZA 2BGNE 3LENA 1YTDA 1W1IE 4IP4A 1QO2A 1VP5A 3N15A 1ISVA 3EAUA 3RX4A 4CNNA 1N82A 1OEPA 3C86A 4MPQA 3T09A 1T40A 3OPSA 4ADTA 2WWDA 4HMEA 4PMZA 2ODOA 2UY2A 4BHYA 4EAMA 1JZ7A 3G8EA 1ADDA 4ERIA 4ZQOA 1LBLA 3RM8A 4J3TA 2H90A 5C2XA 2V5DA 4R27A 3KOYA 2WMIA 4PUUA 5ECVA 5LXEA 1W3HA 2W62A 2A2IA 3LX9A 1JCTA 3GYEA 1UZHA 3W1QA 5I02A 3HG5A 3P81A 3F7JA 1B3ZA 2O9TA 4TTUA 1YLVA 1XDLA 1S38A 3B0UX 2WMJA 5D02A 2C8NA 1O4UA 4MOZA 3S2JA 3CV6A 4A3RA 2WV8A 4LS2A 2Q8XA 5EMLA 4ROQA 1VFTA 4CQBA 3CAQA 3PB2A 2E9BA 3BZGA 1RY8A 2XVNA 2CESA 4Z42C 1XFCA 1ZPTA 2VGFA 1S2AA 4G2DA 3CH0A 1E0WA 1ZJHA 2QDEA 3BJTA 1YDVA 2YA2A 1EHAA 4S3FA 1FCVA 3DFQA 2QEZA 2HJPA 4JFUA 1KCXA