1WXYA

Crystal structure of adenosine deaminase ligated with a potent inhibitor
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
349
structure length
349
Chain Sequence
TPAFDKPKVELHVHLDGAIKPETILYYGKRRGIALPADTPEELQNIIGMDKPLTLPDFLAKFDYYMPAIAGCRDAIKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVQAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Compound Recognition by Adenosine Deaminase
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Adenosine deaminase
total genus 142
structure length 349
sequence length 349
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2005-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1wxyA00
1RA5A 4DLFA 3LS9A 4H9UA 3K2GA 4RDVA 4V1XA 4UBPC 4R85A 2R1PA 1YMYA 1FWBC 2RAGA 2R1KA 4CQCA 3ID7A 4XAYA 2D2JA 1EJVC 1I0BA 1S3TC 4ERAA 4GC3A 4IF2A 4L9XA 4LH8A 3SFWA 2GSEA 4C6DA 2WJEA 3QGKC 1UBPC 2E1WA 3GTXA 3WYZA 2EG6A 4XD5A 2WJFA 4CNTA 1NDVA 3LSBA 3URQA 1EJRC 3FDGA 2VC7A 4G7EB 3GU2A 3PNUA 4H9ZA 1JGMA 4BKNA 3E38A 2D2GA 4HK5A 5G4HC 2ADAA 2EG8A 1J6PA 3OJGA 1QW7A 4RZBA 2KAUC 3IPWA 2YXOA 3IARA 1POKA 4QTGA 4LAMA 4NI8A 1EJSC 5CH9A 1GKRA 4CNSA 4IGNA 4F0SA 4QS6A 3T81A 4ICMA 1J79A 3OU8A 1M68A 4DLMA 4H9MA 3JZEA 3QY8A 1YNYA 1PSCA 3QY6A 1EJUC 4MUPA 2HNHA 2R1LA 2BGNE 4OFCA 4C6MA 2FVKA 2Q01A 1A5MC 1R9XA 3QGAC 4EP8C 4J35A 3UR2A 5A6TC 2GOKA 2I9UA 4LFYA 4R88A 3ISIX 2OQLA 3OVGA 3LSCA 3TN3A 2OB3A 3MPGA 3MVIA 1A5NC 4ERIA 4F0LA 4WHBA 1ITQA 4RE0A 4H01A 1QXLA 3DCPA 1UMLA 4IFOA 4XAZA 3WZ0E 4C5ZA 4G2DA 4Z42C 3GU1A 4KF1A 3ORWA 3BE7A 4DZHA 2W9MA 3UR5A 3UPMA 3S2JA 2Z26A 3GTHA 1RAKA 4RDYA 2CZVA 4LCSA 1POJA 1RJRA 3B0XA 3FDKA 1RA0A 4DIAA 2Z7GA 3T1GA 1DPMA 2ICSA 3MDUA 2I5GA 4GBDA 4J5NA 1XRFA 2DVXA 1V7AA 4PBEA 1GKPA 4QROA 3CJPA 3E0FA 3IGHX 3OODA 4XAFA 4GY1A 4ZSUA 4E3TA 3IV8A 1R9ZA 3HPAA 4GY0A 2ANUA 5AKQA 1NDWA 4CQBA 4B92A 1V77A 4EPDC 1FWDC 1YBQA 1WXZA 2R1NA 3IRSA 4I6KA 3E0LA 1RK6A 3A3WA 4BY3A 4UB9A 2Z2BA 4C6EA 4IGMA 4C65A 3F4DA 2Z28A 4AQLA 2PUZA 2Z00A 4HK6A 1A5OC 1ADDA 1IE7C 3UF9A 4LCRA 5E5CA 1EYWA 2WM1A 4QS5A 4H9VA 1K1DA 3RHGA 2GZXA 3V7PA 3TN5A 1M65A 3HTWA 1HZYA 1YRRA 1O12A 1RJPA 4D8LA 4KIRA 2G3FA 2VC5A 2O4MA 3MJMA 1UIOA 4BJHA 1XGEA 4NP7A 4YIWA 3T8LA 3KM8A 4DZIA 4C6LA 4TQTA 2DVTA 2E25A 4DYKA 1KRBC 3E74A 3K5XA 1ZZMA 4ZSTA 1P6CA 2BB0A 4QSFA 4F0RA 3MSRA 4DI8A 4CEXC 3GTIA 3F2CA 3LY0A 4INFA 4GK8A 2O4QA 2OOFA 2AMXA 1PO9A 4CNUA 1E9ZB 2QS8A 3SO7A 2WJDA 2A3LA 3AUOA 3EWDA 1V51A 2Z25A 3CAKA 3MVTA 3QY7A 3LGGA 3NQBA 2VUNA 4WVXA 2OODA 2PLMA 1A5LC 4XD6A 4C6IA 1ONWA 1FWIC 1NDYA 3UBPC 1R9YA 3S2LA 3S2NA 4C6CA 3NURA 4IH3A 5FSDC 2HBVA 4KEUA 5HMDA 2P50A 4H9YA 4RDWA 1FKWA 1V79A 3GRIA 4L6DA 2FTYA 1KRCC 1J6OA 3GTFA 3GUWA 4HA0A 4KEVA 4HK7A 4C60A 4H9XA 3C86A 2QPXA 1FWHC 2HQAA 2QVNA 1A5KC 4LEFA 3A4JA 1ONXA 3LU2A 3OOQA 4J2MA 4WGXA 4AC7C 5HMFA 1RJQA 3EWCA 4B3ZA 3D6NA 1KRMA 1A4MA 4KERA 3F2DA 5HMEA 4CQDA 3LNPA 4B90A 4DO7A 3B0YA 4GY7A 2FTWA 3R0DA 1VFLA 4IFKA 2PGRA 1P1MA 3URAA 3O7UA 4NG3A 1YIXA 3EGJA 4PE8A 4C6BA 4C6OA 4CEUC 2Z24A 3ITCA 2GWGA 3FEQA 4M51A 3LGDA 4KETA 4G7EA 4EPEC 4IQJA 3CS2A 1BF6A 3N2CA 4JOMA 1NFGA 1I0DA 4IFKB 1E9YB 1A4LA 3URNA 4GXWA 3PBMA 3DUGA 4I6VA 2Y1HA 3TN4A 4C6NA 1EF2A 4IG2A 2FVMA 2ZC1A 4V1YA 1KRAC 4C5YA 2FFIA 1PTAA 1PB0A 4GX8A 1FWJC 3MKVA 1K6WA 4H00A 1EJTC 4KQNA 1EJWC 2HPIA 3WMLA 3PANA 1FWGC 4EPKA 4C6QA 2HPMA 2XIOA 3IJ6A 2VHLA 1XRTA 1ITUA 2UZ9A 1W1IE 3GU9A 4C6KA 1WXYA 4LAKA 2Z27A 4KESA 4XD3A 3F2BA 4XAGA 2F6KA 2DVUA 4LALA 2PGFA 4GZ7A 4RDZA 5LXXA 3TN6A 1EJXC 2Z2AA 4XD4A 4EPBC 2R1MA 3MDWA 3S4TA 4DNMA 1NDZA 1J5SA 2PAJA 2UBPC 2VM8A 1FWCC 4PCPA 2YB1A 1FKXA 3PNZA 3RCMA 3GIQA 3GIPA 2Z4GA 2AQVA 3DC8A 2HBXA 4IFRA 2GWNA 3AU2A 2YZ5A 1RK5A 2Q09A 3HM7A 2OGJA 1GKQA 1P6BA 4LANA 2IMRA 4P5UA 3RYSA 4ERGA 3NEHA 3E3HA 2Z29A 4R7WA 4GOAA 3RN6A 1FWEC 1EZ2A 2AQOA 3G77A 5FSEC 1V4YA 2P53A 3URBA 4KEZA 3S2MA 3B40A 4C6FA 3E2VA 4PBFA 2QT3A 1M7JA 4HJWA 4GX9A 1KCXA 2VR2A 3LA4A 4GYFA 2YB4A 1FWAC 3K4WA 3IACA 4B91A 4LCQA 1UIPA 4LAOA 1YBQB 2D2HA 1K70A 1O5RA 1FWFC 3OQEA 4C6PA 4DI9A 2EG7A 3MTWA 4PCNA 3PAOA 4H9TA 1XWYA 4IG2B 3TNBA 3GG7A 3O0FA 3A3XA 3F4CA 3AU6A 4QRNA 3ICJA 4C6JA
chains in the Genus database with same CATH superfamily
3T0BA 4DLFA 2WHJA 1SO5A 3N25A 4GUJA 3IWPA 3GDBA 2PP1A 3OLGA 2ZDSA 2ZTKA 1IWPA 1SZNA 3L2IA 3NO3A 1FOBA 5CC6A 3LCGA 2BOEX 4FLQA 4GRSA 3L2MA 3C2EA 2A5HA 4UR7A 1FP9A 4OOUA 4KH2A 4MNLA 4S3CA 2AL2B 2VENA 4NL1A 2ZUNA 2DUAA 4ML4A 4IX2A 4W7WA 1OZMA 2IS7A 2WYSA 1VJSA 3R12A 4J1OA 5D2YA 1YNQA 2YL6A 1QBBA 3CEUA 4MWAE 4AX7A 5C55A 3U2OA 3VNZA 3A6OA 3I6TA 4QJ1A 1TYGA 4H83A 3IUIA 2ZVRA 4D6DA 4ZL1A 1AA1B 1GVFA 2B0MA 3MSGA 4Q4OA 1UP2A 2OQYA 1EJSC 2PI6A 2R8WA 4WSJA 4FI4A 3P14A 1V0NA 4WCJA 3VC6A 5FD0A 1FCUA 3AOFA 2OU4A 4ZB2A 3B8UA 4C6MA 1F3XA 3L12A 3NYDA 4XZHA 3G1HA 1BXBA 4TO8A 3W7RA 4ML9A 2V6AA 5A5WA 4L4MA 4Y9PA 3LDVA 4MJMA 4QG6A 4JHZA 3H54A 2Z1BA 3CV2A 2PBOA 5JBDA 4JTCA 3NQFA 1PHQA 3TW7A 3AROA 5D38A 4F0LA 1BVNP 1NOFA 3KBVA 1FBAA 1MQPA 5AHFA 5HJYA 5I7GA 2YA0A 4W5ZA 5I00A 1V3JA 1RAKA 4RDYA 3UZYA 3TK7A 2QPSA 5A2AA 3RRXA 1S1RA 3LHZA 2ZX8A 1KM4A 4B5VA 2WCSA 1M41A 4DIAA 1L2UA 1KFBA 4XB3A 1VRXA 4QAWA 2G8ZA 4B5XA 3KAOA 2XVPA 3TAKA 4HZ6A 1X6LA 2PB1A 3R1ZA 3FGCA 4JAWA 3VNJA 1V77A 2YYTA 1YBQA 2YCLA 1WXZA 3MB9A 3OGSA 4I8YA 3OZMA 3AUJA 3C0JA 2Y61A 4O1FA 1XXXA 5D9MA 4DJFC 1LLWA 3K4DA 2HROA 3T9PA 2P0IA 4ZO8A 1FWWA 3N12A 4KRZA 3GUGA 3SCPA 3HURA 2YCIX 3SUWA 4Q8QA 1NSJA 1LL6A 2A7NA 1BG4A 4S1FA 3TNOA 1GG1A 4WJ8A 2G0WA 1JRBA 4NASA 4QCFA 1QPNA 4MB3A 3MC5A 1UIOA 2Y85A 2VFHA 3BARA 1XUZA 3VNIA 1JFXA 2R82A 3KWSA 3SCQA 4IPLA 3E74A 3KX6A 1WDSA 4Q8MA 4ZSTA 4QE5A 4P8XA 3GQYA 2FZDA 3N3MA 3QMSA 4XUGA 2BG5A 1UR0A 4N9EA 3ZXWA 3W29A 4PA8A 4TIMA 1TPFA 4TX9A 2ALRA 2C16A 5E6ZA 4UFLA 2A3LA 4DUOA 1VP5A 3TYDA 1FFRA 2X16A 3KHDA 2RKXA 3OVQA 4GG9A 2DIJA 2NXIA 5BCAA 3WQ5A 3C8FA 4HZ8A 3M9YA 1I2NA 3KHJA 4FEZA 2FZ9A 1BWVA 1US3A 1GTHA 5I3IA 4GFSA 2QUUA 1T5AA 1XGDA 1OX6A 3WSUA 4AX6A 1QNOA 1ZAIA 5J5DA 4O50A 2Z1XA 4HK7A 2QPXA 3VINA 4ZGYA 1M53A 1WDRA 5EY5A 1TMLA 2XM2A 3D6NA 3CH9A 2DGAA 3HJZA 3CHFA 1VH7A 4RE3A 4GVHA 3GNRA 4JQAA 4IMCA 3MYOA 3THAA 2QYGA 2EHHA 3HN3A 3KXQA 1VFFA 4UQBA 2Q8ZA 2E67A 1BSLA 3W28A 3DHFA 4QAIA 4HTBA 2Z24A 1QAPA 1SFLA 2EAWA 2ATMA 1RV8A 3I7QA 1JDDA 4G7EA 1L6WA 2R6OA 4M1RA 2CETA 3TIMA 1UD4A 4AY8A 1Q6RA 1D7KA 2QMJA 3KDOA 3MHGA 4ZXLA 4WDWA 1PTAA 4D6FA 1T0OA 1RBOB 4PCSA 1D3CA 1EJTC 1ZJHA 4GYPA 3WMLA 3N6QA 2WK2A 3OHIA 3BCDA 1GK8A 3BLLA 3UG8A 3A9BA 1O94A 1QNQA 4E0CA 2HK0A 4PMXA 4KESA 1ONRA 5D9OA 2E9BA 2XWDA 1UMYA 4XIAA 1H0IA 5LNUA 1EJXC 1VAHA 4JD4A 4HSHA 3VNYA 4Q4KA 3D0CA 3AZTA 1UH4A 1VHNA 3EMCA 4J3WA 2PWUA 4IFRA 2WMIA 4P2VA 1E4NA 4O15A 3SDOA 4WY0B 1CDGA 4NHVA 4BQ3A 3HM7A 2QNEA 5A69A 3SZ8A 2H3DA 1F3WA 4EWJA 3UZ5A 1JVNA 5IDZA 4LB3A 3W27A 2BFGA 3A22A 2WSYA 1VBGA 2WVSA 2VR4A 3ITYA 2Y8VA 1UWTA 4A05A 3DAQA 2B7PA 4YCPA 3KP1A 1XLFA 1KKOA 1PVNA 1EC8A 2BZNA 2YW3A 3TNBA 4LEQA 3VE9A 5AN7A 4KFPA 2VJXA 3RR1A 1M5WA 3EB4A 3BMWA 3MHUA 1U22A 1Z69A 2CKSA 2DZXA 2WZIA 1IEWA 2XSAA 5I79A 4LVGA 4XKYB 1YMYA 1ZLPA 1WKDA 2Q8XA 1ESWA 6ALDA 5LNWA 2F2HA 2OEMA 2RDUA 4IF2A 1C8XA 1EEXA 2PDXA 5AFDA 3CWOX 1A5UA 2FDSA 2FMNA 4KCTA 1VBRA 3RXZA 4Z1CA 1EIBA 5EBAA 5HJLA 1IR1A 3QPEA 4PULA 4J27A 3W23A 3XINA 1GJPA 4DWSB 4Q6XA 2C0HA 1PCKA 3BG5A 3DERA 5M2FX 3TWAA 5CZJA 3USZA 4YL2A 1HT6A 4ZTXA 3O6YX 2V2CA 3FK4A 1UA3A 3LRLA 2E6DA 2GJNA 3NAVA 3WEZA 4XZBA 3BOLA 3W2JA 4RNHA 3JZEA 3K8MA 2Y5EA 4O0ZA 2XU2A 4DBSA 1KM0A 4IJCA 4OFCA 1FH9A 3RO6A 3CZJA 2Q01A 4DN1A 4PMJA 5JU6A 3CUZA 1R9XA 4JIHA 4ASTA 5FEPA 5A6TC 3I4EA 3LHYA 3SI9A 1JGIA 5AC4A 4MHBA 2XISA 2VRQA 2PDYA 3NFUA 1I2RA 2J25A 4OZOA 3LM3A 5KTLA 3UYCA 4HNUA 2QV4A 2O9OA 1TWSA 1N7KA 4UIOA 6PTDA 1E15A 3N1AA 3DX5A 3SUTA 1W3IA 3GKAA 4JCMA 2V5JA 4E6MA 2OO0A 3MWAA 4ACZA 6CGTA 5DY3A 2ICSA 2JBMA 1XF0A 2WBGA 2XG9A 3L4TA 3BXWA 3CJPA 3E0FA 3ABQA 1JZ5A 4JFVA 1J9YA 4CVUA 1ICQA 1ZB5A 5A6SA 3CTTA 1FHLA 2Y0FA 5F1UA 1PUDA 5E6YA 5CC3A 4HOXA 3DGRA 2FKPA 3II1A 2EPLX 4CQAA 4AQLA 2WMHA 1K6AA 2GDQA 3OIHA 2GL5A 4AVFA 3UXIA 1D8CA 2EBNA 3NXLA 3QTPA 5D2WA 3E0WA 4D8LA 2OWWA 4IUOA 5I77A 4OKDA 3DFYA 4WEVX 2J4GA 1XLHA 5CZKA 4BJHA 1XBVA 5HWNA 3GKFA 1BXCA 2XIIA 3FA5A 4L4PA 3P3BA 2G3NA 4Z0SA 2E4TA 2E1DA 2X1IA 4MGGA 1B3WA 4FSAA 2J7EA 1EFZA 2ESCA 1JG9A 2EPNA 2X1SA 5CJ5A 4MYAA 1GW1A 3ARRA 3NXFA 2DZPA 2VP8A 3C0LA 5HDRA 2QS8A 3HFYA 1UD3A 1QATA 4Q4PA 3UQNA 2Z25A 5A1AA 2OODA 2J7DA 3PTDA 3H2AA 1LWJA 2Y62A 2C1IA 4AY1A 2J24A 3QLDA 2QDHA 4UTTA 2YFOA 4HZ7A 1OBAA 4YS1A 5HMDA 4A3UA 2P50A 5MKGB 4H9YA 3DHPA 1EGVA 2PRHA 1V79A 1NF7A 3RITA 3OBEA 2XVNA 3GUWA 5E0FA 5I07A 1V3KA 3W86A 1XIMA 2NZLA 3T55A 3UGVA 3ZMRA 1J0JA 3FAWA 1GQJA 2CWNA 4NQ1A 4H3DA 2PF8A 5C2GA 1U1JA 3TUUA 2G37A 5LNSA 3VAVA 1W37A 2A7RA 4MWAA 1PYMA 3PZMA 2QUTA 2V5DA 3WLNA 1OFEA 1Q63A 4E8GA 3MKKA 5FESA 1K7FA 2YCLB 2BASA 2QCLA 2F8QA 2ZUTA 3TKFA 3ITCA 3FEQA 4FNUA 1Z41A 1R5YA 4QQ3A 4OUEA 5M17A 2VKZG 4I5XA 1Q5MA 5F4XA 1IEXA 2HNEA 1EF2A 4DJFA 4MB1A 3WD2A 1KR0A 1YXDA 1H11A 1SW3A 3SUUA 4C7FA 3MKVA 1W31A 3RUBL 1Q65A 2Z1KA 2HS8A 3GO2A 4KCWA 1HL2A 4Z08A 4AEEA 5D37A 3NGFA 2P1FA 4PFHA 3GR4A 1E0UA 3C0SA 2BVDA 4IP5A 3Q65A 5D8ZA 1YPXA 1WZKA 3MUXA 3KBJA 5F7UA 3F5JA 2E6FA 4LALA 1EL3A 1I60A 3OIXA 4AZCB 3FLUA 2YJQA 4DNMA 3UVAA 5H8PA 3EKLA 4IXXA 1ZSXA 4AWEA 1FWCC 2BY0A 2POTA 3CGTA 1R85A 4H19A 2PDIA 1KTCA 3RIKA 5A6JA 4J3SA 1JYXA 1ZHAA 3QZEA 1TRIA 4NF7A 2PDWA 3ZLGA 1D8WA 3QXBA 4AD1A 4KPLA 3CQIA 1M3UA 2DP3A 1H60A 5XIMA 3G77A 3P7YA 5M5DA 3URBA 5H8UA 4XSLA 4ZOEA 3OLDA 2CPUA 4O4WA 1P43A 4PFMA 3AXMA 3ZJ6A 4Y90A 2Y88A 4GJ1A 3S5YA 1XIJA 1A49A 2REQB 5HAOA 2VRKA 1FWAC 4O57A 2IKJA 4HHPA 5C6MA 4UC5A 5D09A 4TOQA 4AWSA 2D1ZA 4CD8A 3KOZA 3MCMA 1XWYA 4D8ZA 4UTLA 3K13A 2WOQA 4OHQA 4S2BA 3SB0A 4C1NB 4LV9A 4ZO9A 2NV9A 2VUYA 5F1VA 1QK2A 3BLIA 4XAYA 3B9DA 2G5WA 1WPCA 1JZ8A 1BFNA 1EIXA 3IJQA 4EE9A 1VYPX 4C6DA 4L56A 1TPH1 4XD5A 4S3GA 1NDVA 1HP5A 2AQWA 1HX0A 2WSRA 3EX6A 5C9XA 3PTQA 1DHPA 6XIMA 5D03A 4JX5A 4D71A 2AKMA 4Z2IA 4RZBA 3ATZA 3G1XA 3AJXA 5A8OA 3BDKA 4JFTA 4L7ZA 3FHQA 3PWAA 1NQKA 3N6HA 4H6EA 3SURA 3VNMA 1S5TA 3LB0A 4IGNA 3WUFA 5B80A 3ANYA 2XIBA 1R86A 4FZIA 4QS6A 4M0XA 5EMYA 7ODCA 1VFSA 2Q8LA 3N9SA 4E4PA 2V3FA 4UMBA 3QHOA 4IIDA 4WQ6A 2WHLA 1A5MC 1HVQA 4AG0A 2A85A 3CM4A 3H2MA 4UQDA 3W22A 2VDIA 3NL2A 4ZE4A 1LLOA 3APYA 4PRRA 4WHBA 3WDJA 4GBUA 3DCPA 1W32A 3GU1A 1CXKA 1UHVA 1FCQA 3WMBA 3FA3A 5H1WA 3JRKA 2DY3A 1IQ8A 1TZ7A 3BCFA 1OIMA 1TPEA 2ZZ2A 1VEMA 1G6CA 5BXPA 4K7VA 1VBHA 1DIDA 1DPMA 2DVXA 3W83A 1XFCA 3VDCA 1BAGA 3B8DA 4ZSUA 4E3TA 1EDTA 4MYXA 3NQAA 4ZQCA 3D46A 2Y7EA 4JZ5A 3ABXA 1BHGA 3OLIA 4UZUA 3UWYA 2X0SA 4RW3A 4EACA 2X40A 3DH7A 4QLLA 4I5UA 1HW6A 1NELA 2VGIA 3VKAA 3LI1A 3KTXA 1FCBA 1TG7A 1EUNA 3I10A 3H24A 1A5OC 2ZE0A 4LCRA 3UCDA 1UJQA 1YYAA 3QTGA 3W6LA 3TOPA 3S5ZA 2Y89A 3TN5A 5IM51 3LV6A 2VX5A 1X7IA 4ATWA 2NX3A 3DC0A 1EBHA 3BLKA 4NJJA 1K9EA 4H8NA 3PBYA 4GWEA 3MKCA 1NY1A 2ACUA 1UASA 3F7JA 2PSNA 1JULA 3VGDA 5A8MA 4HPGA 1CTNA 4LBSA 3NJ3A 8TIMA 2J7BA 1R3VA 1KXTA 3IV3A 5C54A 1IXNA 2HXTA 1ZBWA 5HA7A 4YCOA 1JXJA 4GK8A 4UNKA 1HJQA 1QPOA 5D32A 1IEQA 1NFPA 4XTIA 1ZCOA 2C14A 1KGWA 3LGGA 3UP8A 3MWCA 3F03K 3VIKA 1FWIC 2DT1A 4POCA 1TCMA 3WQEA 4HA3A 5FJTA 5DXXA 3REQB 1R7OA 1H5YA 4DPQA 3P6LA 1M04A 5DCDA 5AYZA 4NAFB 3L65A 4AD3A 3VNDA 5IBXC 3LMZA 4M6PA 5E0KA 1HKMA 3W7KA 4ILSA 1TE6A 4IPIA 1F5ZA 2XPKA 1C7TA 1VR6A 5GJMA 1P0DA 2IUZA 1OJXA 4US6A 1MRAA 3LU2A 4AC7C 1PXGA 3DI1A 4D9PA 2HDJA 3UJFA 1R47A 3DG3A 4MIMA 4TV6A 4Q4SA 1VFLA 1Q6DA 5C9UA 4CUCA 3ECQA 5SWUA 3TZNA 1NH6A 1NVMA 1UH3A 1G69A 1MNZA 4J3VA 5C0QA 2GSJA 3CMFA 3AHZA 2C6QA 2HSAA 4QITA 1HFBA 3WENA 3LGDA 1NF0A 3FVDA 1GPFA 4A8LA 1EXBA 3HPZA 4LVAA 3URNA 4AD0A 2CBVA 3T44A 1LBMA 3TYCA 1J93A 1KRAC 1UD2A 3AZRA 2CLOA 4JTTA 4W4QA 1G7VA 2FZMA 1ML1A 5LXEA 1HKWA 5A8GA 3QN3A 2TPSA 3AFBA 4O12A 2GGJA 1ITUA 1S3HA 2WKJA 5FJJA 4UTWC 5DMNA 1W1IE 1EHNA 1TVPA 3KZPA 4JIQA 5FL0A 1U1UA 3GVQA 1PDZA 2QDEA 2PGFA 4J7RA 2BY3A 3GWQA 1PAMA 4UCGA 4XD4A 3MSYA 1YLVA 1NDZA 1XH1A 3T0CA 1TPUA 4F2UA 1QRQA 1J2WA 3W7EA 1I1XA 5C7HA 3T2OA 3MUZ1 1DWJM 1I4NA 3QKZA 3TONA 4GZEA 3S5NA 3KL5A 4UFKA 3U5YA 1KD0A 1ADSA 2XZ7A 5EMKA 4D72A 5JBFA 3W6YA 3MSDA 3AIQA 3UJEA 3S2MA 3LRMA 2WANA 1ZAHA 1DXFA 3O63A 2FB2A 1N2VA 3TA9A 1JAKA 1FHUA 1V6XA 1Z32X 3UWVA 1JZ2A 2YCEA 2XVLA 3KOWA 1TSIA 4LAOA 1GQLA 1K70A 1TE1A 1MXSA 3FS2A 4DI9A 3GG7A 4G1KA 4DBDA 3S2CA 1RH9A 1F7BA 1G67A 2J9ZA 4QDMA 4M7SA 4FAMA 5AYYA 1Y5VA 2V9DA 1UOZA 1KXHA 1ITCA 1NQ6A 3ID7A 3EWXA 4ZXOA 5DRIA 4P7OA 1S3TC 3GXIA 1MWOA 1PS9A 4HA1A 3T6CA 1GW9A 2GSEA 1J0HA 1BGGA 5G2WA 4KWSA 4HNOA 3EKZA 4C1LA 2VFEA 5H91A 2BVWA 1E6RA 2ADAA 1F61A 4TMCA 5KZEA 3KOXA 3AXIA 2VC6A 2BX7A 2QJIA 4NILA 3TOYA 4PUJA 5A6BD 3UZZA 3IIPA 1Y0EA 2B81A 4PMQA 4ICMA 3RM4A 2ZXAA 3TE9A 4FALA 2ZXDA 3VGGA 1PSCA 4HOZA 1EJUC 5G1MA 3W82A 3VDGA 2BGNE 6ENLA 1W1B1 3SW6A 5B7YA 3LN3A 4RK8A 1Q3NA 4EP8C 4WKFA 3M5XA 1P0NA 3Q45A 5LA1A 3TCEA 2EGZA 3BW2A 2CERA 3CO4A 3AS2A 1WZLA 3HPSA 4IMAA 2ZA3A 3U7BA 2PWHA 3W7CA 2IPGA 2Z2UA 2NT0A 4N2YA 1L8NA 4G2DA 4Z42C 2CCRA 4CU6A 1R3QA 4TVUA 3FX4A 4ACZB 3CZKA 2NVAA 1VB9A 2Y7DA 3TW9A 2ZZ1A 1LL4A 1AL8A 2YFNA 5HNNA 1A3WA 1B3YA 2CZFA 1GVQA 1C3FA 1V7YA 1BRLB 2VEPA 3QH2A 4NI3A 1GZJA 1CGVA 2TSYA 3HPAA 1MUWA 1KBBA 4PTMA 4F40A 5KINA 3M6DA 4GIEA 3E0LA 1X6NA 3FFSA 1VFMA 3FYYA 3RPMA 4G7FA 1IWAA 4C1KA 2CZEA 5L6UA 3C4UA 4L61A 2V30A 4DZ5A 2Z00A 2QKFA 1ZGDA 5E5CA 4ZB0A 4PGLA 5CBBA 1KM5A 3CUIA 4W85A 1EWEA 1T99A 4WX2A 4XV0A 1JYNA 1EKOA 4GKLA 1RJPA 3G1DA 2QUVA 4LW7A 2W5FA 4A2SA 2QGYA 1R2TA 1XIHA 1YW1A 4PUMA 2WVTA 3TAOA 3GFZA 5MKGA 1C91A 3U6WA 2E25A 1WKEA 2X2YA 2PDPA 3U2ZA 2X42A 4DI8A 3F2CA 4U2ZA 3OG2A 1PWMA 3E6EA 1TV8A 3LYEA 7TAAA 4EAMA 3BVJA 1K4HA 1M6JA 1TTQA 4PUUA 3VFLA 3JR2A 3GW0A 1HTIA 4M81A 4GIRA 4JS3A 3W38A 5IRPA 1JD7A 3W02A 3CK5A 2W0UA 4XBSA 5EPDA 1B31A 1OWQA 1IXQA 1BWKA 3W7MA 1WCGA 1L0PA 4G9PA 4RDWA 1LRTA 2QJNA 4CD4A 2WPGA 1ZJAA 1E9LA 4ONVA 4ZCWA 1MQQA 1VFHA 2X0HA 4JHMA 4IOTA 3FJ6A 1UUOA 4CQDA 3A4XA 4JKKA 5AC7A 5LIUX 2L5HA 4G5DA 2BY1A 1NP0A 4FLSA 3BOFA 2ACSA 3WLMA 1MMFA 1YE6A 2V3GA 3JVAA 4CCEA 3M6YA 2WZTA 3B4UA 2OXNA 1GORA 5DANA 4W5UA 3PZOA 4K1GA 3LPOA 4MFDA 3UXKA 2Q71A 4CEUC 3SY1A 3FV9A 3AMGA 3I68A 4NJIA 5EU9A 2QUNA 2ZRZA 3NPUA 4OECA 4JICA 4XZIA 3S47A 4C6NA 5AC5A 4IG2A 4I9TA 3VZYA 1MI3A 1GUVA 1J0YA 5K7JA 3BMVA 3KRZA 2XYLA 4RV8A 1AG1O 1O5XA 1HUVA 1FWGC 3KUMA 4IJRA 2QCCA 3NL5A 2OX4A 4QLJA 4Q7NA 4HNCA 4A22A 3EWZA 2WMGA 2EPKX 1U1HA 3UJSA 4AC1X 3TSMA 1ISZA 4S3AA 3MYPA 2V5BA 4J28A 4O14A 3PBWA 2G4FA 2A6NA 3S4TA 4MLRA 3W4RA 1LOQA 1J2BA 2UBPC 3QQ1A 1Q8JA 1JNDA 4HHLA 4RE4A 1XM3A 2Y24A 3GIPA 2OZ0A 1O6IA 3PAJA 5KZMA 5FF2A 2YZ5A 1F8MA 2QEZA 2HVNA 1LQ2A 3UJ2A 2QCEA 3A47A 3JU2A 4C6FA 3RNDA 2F7FA 3G2GA 2TRSA 1L6SA 5TAOA 1UKTA 1XLDA 2XVKA 5A6KA 3K4WA 2YKKA 1BVZA 3B9NA 1UCWA 5HINA 4U2YA 1FWFC 4LXFA 3A5FA 3IVUA 3R89A 1K3UA 3HFTA 4HPHA 3BGGA 1RALA 2GQAA 2HEJA 3DG7A 2IQ0A 4M6VA 2YL8A 3LTYA 1EDQA 2QMKA 2RAGA 1KNWA 4CN1A 4DXVA 3IIOA 2VEKA 1ZAJA 2D2JA 4HNNA 4B3KA 4Q32A 1TWWA 5GNZA 2DUXA 3BPWA 4JTHA 2OLSA 2WJEA 3B8WA 5FACA 1E6NA 3MUCA 5FF7A 4URIA 4K1WA 4QGCA 3S6TA 4HU4A 3HPXA 4MWAD 1KCKA 1QT1A 4HMCA 4RCXA 1FY6A 4C91A 1ZL1A 5G4HC 4HA4A 3OJGA 4D8AA 1ZJIA 5I0DA 4TR9A 3M41A 1DE6A 4GQRA 2KAUC 1UPPA 3QM3A 1DV7A 1MO0A 2CXGA 2HS6A 3H55A 2WZEA 3OA3A 1KFCA 1RP8A 2YA1A 1QPRA 2ZICA 3LZ5A 3H12A 3M0XA 2GQ8A 2WNZA 4XZWA 2J74A 1OG6A 5DBUA 3N15A 1K8ZA 1KLZA 3CZLA 2BGQA 1HO1A 3V0SA 2DSUA 1P4CA 5G5IA 3UNDA 2R1LA 1SO3A 4BEUA 1JDAA 1SJBA 5CKSA 1W54A 2E5DA 5K4XA 1OYBA 1C7SA 4L4LA 2HVOA 3CPGA 3QSRA 2EJ1A 5DQPA 3WK2A 4LRTA 1E6ZA 1JUKA 1ELSA 1PX4A 4X2RA 1QJWA 2QZRA 1DXEA 2DZBA 3GD6A 1UMLA 3GM8A 4IFOA 4Q8UA 4QLKA 2QF8A 1JJKA 1D3HA 4KS0A 2W9MA 3CYVA 1A5CA 3LQLA 4HYWA 3MA8A 2VURA 2ACRA 1GVRA 1IXPA 2PP3A 1R87A 4X0NA 1W6TA 1X1NA 2VD9A 3WQGA 1EA9C 4KRTA 4M29A 4TV5A 3CL6A 3ARVA 4MKNA 1KQZA 5E09A 2WVVA 3PZTA 4GCAA 3C2FA 1JNEA 4AIOA 3OODA 3NSMA 2V0TA 1MXGA 2QDGA 2J9YA 1UKSA 3ALFA 3BWWA 2H6RA 4Y9MA 1WOBA 2IQTA 2OMAA 3IRSA 4AVNA 3M46A 1DJIA 4AXNA 1RK6A 3KCJA 4FF7A 4O17A 4E3VA 1KM3A 4CCCA 2QIIA 4PC8A 2H90A 3CL7A 3WLTA 4OJYA 3QV6A 1VFTA 4V27A 5H2ZA 3ZJ8A 3V7PA 1XDLA 1IT0A 1X6UA 1SZGA 3CASA 4FMVA 1YRRA 4JTEA 2G3FA 4WR3A 3QR0A 3KM8A 3WLOA 2EO7A 1FX6A 3T78A 1GOWA 2ASHA 3LUTA 3WQWA 1ZZMA 1R6WA 3FEMA 1ZPTA 3CEPA 2QCMA 5CC5A 2VTFA 3MO4A 2B4GA 2A21A 2ZA1A 3VD3A 3W7DA 3WF3A 3NDYA 3VM5A 1CYGA 3BGJA 1JDFA 1KGUA 3OZYA 5HUPA 3CUJA 1L6GA 3VIMA 2VFIA 2PCQA 3S2LA 4KT2A 4WLCA 1ZS2A 1V3HA 4MAZA 4S3BA 3NM1A 1QASA 1WNOA 3VO0A 3A12A 4Q4RA 3H53A 2ZE3A 1R3YA 4PB4A 3CWNA 4F79A 3WLKX 1FH7A 3AS1A 3VCCA 1C93A 1E3XA 3RK8A 3GW3A 3LPPA 4LEFA 1R30A 3OOQA 2CHOA 1TV7A 3UGRA 4Q3MA 3GG1A 1VRDA 3UU0A 4LU0A 2V68A 1WDDA 2AL2A 5FAJA 3SQMA 4QJ3B 2XN2A 1E1CA 1BYBA 3GVGA 4MJ2A 1XBZA 2X41A 1CXFA 1F6YA 2HISA 1I1WA 2ZYFA 5BMWA 5CCZA 3SCVA 2NQJA 2VCAA 5LZLA 4UUIA 3ZLHA 4JTUA 4GNKB 1RPKA 2E5BA 4U33A 1QCWA 2I5QA 4ICNA 4M3PA 2V38A 4C6BA 1BLIA 1UROA 2ZWZA 1XYCA 1GOIA 5BYWA 4JDYA 1XLBA 2ZRVA 3CAWA 4NRSA 1BF6A 1DIOA 1NFGA 2Y4SA 1TB3A 1OCJA 3HQPA 4DXXA 1DQUA 5DMYA 4DWSA 3A5VA 3RLUA 1AH0A 3E5BA 2QCDA 4V1YA 5HOSA 1VIWA 3OTRA 4GX8A 2E28A 4MY1A 3VTRA 5BWAA 3PANA 3ARUA 3W2KA 2IPWA 3LCIA 4Y96A 1VYSX 4HT3A 3P5ZA 2F6KA 1ZCCA 3CL8A 4QISA 4BF7A 1S2UA 1V02E 3O2LA 2MNRA 4WIWA 3H22A 1OFAA 4WK9A 3NO1A 3DKLA 2V2HA 1UR2A 4DUXA 3COTA 2JEPA 5C70A 4MKSA 3PBVA 4I90A 2JIEA 4JQ1A 1KFJA 2ISFA 3NUKA 3PBUA 1W8GA 2HK1A 4K37A 1NJJA 3LK6A 5FF3A 1RVKA 2IMRA 1K03A 3PJXA 4ZBCA 1B4EA 3W7PA 2PTWA 4X2PA 1YDOA 5KETA 4MMWA 2VEMA 1J8VA 2VR2A 4CGTA 3C2VA 1NARA 2ZA2A 4OUIA 3HB9A 2YB4A 1BPLB 5LNVA 1IZCA 5GQBA 2FLIA 2VQTA 3S42A 3NZRA 1GHSA 3AXXA 4QRNA 4RL3A 3NPVA 2A2IA 4XBKA 4R85A 4DEFA 1S5WA 5KEZA 3BG3A 1QI0A 1WQ5A 2YGYA 4ATDA 3BCJA 1EC7A 2YA2A 3N9KA 1EGMA 4A3RA 4AZCA 3TSBA 2YYUA 5D4YA 5I09A 3KLLA 2E8ZA 5I24A 3W76A 3KWXA 2FHFA 4AD4A 4B9ZA 1BEUA 1CWYA 2CLLA 4L1WA 3RG6A 3W07A 1VENA 4HSNA 3STFA 1YXYA 1E0TA 3TTOA 4HK5A 4TU1A 5IOBA 4ZO7A 3I6EA 2J62A 3PM6A 3AZSA 3NGJA 2X1RA 4KEMA 2VL4A 3REQA 5CH9A 4IM4A 1V6UA 3T81A 2VGBA 1O5QA 4XQ6A 1Q13A 4DAIA 2ZX9A 2TYSA 1OY0A 3RCYA 2FVKA 4ZR8A 3SJ3A 3IANA 1TV2A 4F9DA 2W27A 3ARYA 2RJGA 3HQNA 3V36A 3VOJA 8A3HA 5D2VA 5C8BB 3L4YA 3TROA 3QJAA 3OYXA 1A5NC 4ERIA 4MJZA 2NQZA 1EX5A 4LB4A 4HNLA 3GHSA 3NEVA 2WSKA 4N9CA 4N6EA 4DZHA 1TFVA 1EPXA 3GTHA 2YBUA 2ZZ4A 3WIJA 3UWWA 1GCYA 1UD6A 3M0IA 4JFUA 3O8AA 4GJIA 3B06A 3QZAA 4NZ1A 6XIAA 4MDPA 1KWGA 2WNNA 3W71A 3MDUA 1YTEA 5I3DA 3B8SA 1JDEA 3N2BA 3QBUA 1DIEA 3H4GA 4QFUA 3IAQA 2EPMX 2VELA 1L2QA 1AUSL 4JIRA 1T8XA 3UG5A 3VGHA 1XKJA 1NDWA 1RQHA 4B92A 1O7AA 2ZUMA 3HQOA 3VDHA 1JRCA 3DEQA 1Y8BA 2O9PA 1PHWA 3RJYA 2V67A 3VOFA 3SSJA 4C6EA 3N4FA 3AMKA 3BV4A 1VPYA 3N04A 2QCGA 4C65A 1XIBA 1ADDA 4LV4A 1H1NA 1VYRA 3R0KA 2WM1A 4HN8A 3RHGA 3UERA 1MFVA 3W7GA 4IMEA 2GVJA 1T96A 4YXGA 3KDNA 4JY9A 3HTWA 2I16A 3P2VA 4GYJA 2PFHA 1G5AA 1XBXA 3BQ5A 1XSIA 1OGGA 3E96A 4YIWA 3WH8A 4DZIA 3O05A 6A3HA 3FXGA 5D04C 4CNPA 4IQDA 3NSXA 3IUDA 2E0PA 4LVBA 4ADSA 1QHZA 5ABHA 2BXYA 4AISA 1UZDA 1EDGA 4IWWA 4MPKA 5D9PA 3EWBX 2PWVA 3SO7A 3LMYA 2VD8A 4CN6A 4AW7A 4HMDA 3UY8A 3T0DA 1CXIA 5LKYA 1XFBA 2YDSA 1A80A 4JL2A 3GH4A 5JH2A 2INZA 3WJSA 2V5LA 3R0UA 2GUYA 3ZQ9A 1KRCC 3ME3A 2ZTJA 4HA0A 3TJIA 2R24A 8XIMA 3HO8A 3JZUA 5K2ZA 4FOUA 3I65A 1VD6A 3C2OA 1I2QA 5DRCA 3CHDA 4EF9A 4NU7A 2YCJA 3HBLA 4LUTA 1XIIA 3W7JA 1QK0A 5DMMA 1L6FA 2XN0A 1DHKA 1QI3A 5A6AA 5D9NA 4U3CA 3CQ0A 3L0KA 1DWFM 3M16A 3URAA 2A1YA 2WV8A 2CBIA 5T8GA 4YTTA 1OD0A 2VWSA 2IPFA 4J4KA 4MB4A 3S1WA 3SCTA 3WJZA 4UQAA 1E0VA 3OLEA 2Z7KA 2I56A 2PDUA 4IQJA 1OEPA 2C1GA 1XISA 3LPFA 1VEOA 3DI0A 4US5A 1XPGA 4ZOBA 5LGXA 4L4OA 3CPRA 2DH2A 3VGFA 2PTDA 1TV5A 1OIFA 4UNIA 3S9ZA 1AJ2A 2DJXA 4A8RA 1HL9A 4JQ2A 1K6WA 4KRUA 3VPLA 2DPEA 4D6HA 3G1FA 2HPMA 4LNYA 1OABA 1JI1A 3K1DA 1DJHA 4QDPA 3W1PA 4XIMA 1AVAA 3ONBA 2WQDA 1V08A 3ITTA 2QAFA 2PD9A 4GZ7A 3RMEA 5T91A 3GLCA 1KTNA 1LRNA 2PAJA 3BGAA 3R58A 1DJQA 4B3LA 4HU3A 3CH0A 1XH0A 2Z4GA 2QR6A 3W72A 2WKLA 1WAUA 1G9HA 1MQRA 2OGJA 3EWUA 3T07A 5EL1A 1S2CA 3RYSA 4NYYA 3GXPA 1ICPA 4UCFA 1XLMA 1H50A 1EZ2A 4NT0A 1V4YA 3UYIA 3SIMA 3CMGA 3BJTA 2PDFA 2VEGA 5JVLA 4QSHA 1KCXA 2PLKA 4W89A 1CPUA 4XBJA 3GS6A 5TF0A 1VJZA 4OU1A 4A29A 3CB3A 4MTVA 3OA5A 4I9MA 1O5RA 2GJLA 3B9AA 1MNSA 1FP8A 2E68A 4H9TA 1R3RA 1JZ4A 3ICJA 1G0CA 3LM7A 1BKSA 3RILA 1REQB 3GVVA 1UQYA 1FWBC 3M0VA 4O1AA 4PZVA 4AMCA 1F6KA 2UY5A 4HCLA 4UNLA 4V28A 1EJVC 4S3KA 5A3HA 2VI0A 2CZDA 3U4AA 4LH8A 1ADOA 5BU6A 2WBKA 4BK9A 2AAMA 4RZ4A 3WYZA 4MNKA 3TVAA 2P3EA 4BR1A 3W7OA 2DIEA 9XIMA 4B5WA 1ZRQA 1W2PA 3NQGA 2FGZA 3AWNA 5H8MA 1H7PA 1RPXA 2P0OA 5FKYA 4RXFA 3TH6A 2TAAA 3H2OA 2CHNA 1IIHA 3M07A 4MZ8A 2FFCA 1UKOA 4DHGA 2NVDA 3M5VA 4PMYA 4RE2A 2G96A 4HKPA 3DYMA 4LT9A 1FA2A 3OQ8A 1P5BA 2Y63A 1KM2A 5DCBA 1YNYA 5HUOA 3TX9A 1A5SA 1V93A 3CHVA 1OCQA 2IXUA 4HIBA 5H6HA 4BZYA 4NNAA 4GIYA 3PUDA 3RLVA 3LRKA 4F2BA 1DJXA 1JCLA 4E8DA 5CEWA 4FNTA 2Q3RA 4QIUA 2OB3A 2P10A 3CO8A 2VNCA 2I5IA 4ZQNA 4AY7A 4B5TA 2Q02A 1QFEA 1ITQA 2GDUA 3HJEA 4LS2A 4ATLA 3BW4A 1VCFA 3PFMA 1QNVA 4LRSA 1F8IA 1N8IA 4GVIA 3LLFA 4HPJA 2WQPA 3TV8A 3NQ6A 4JYEA 1IHIA 3B0XA 1FDJA 3FDKA 1A3HA 1EOMA 3T1GA 3D3FA 2XVGA 3GH7A 1DWHM 3UWUA 3WBEA 3AI0A 3AYRA 2X05A 2QJGA 4Y9NA 4R7OA 3IV8A 1E6QM 3IK2A 4GISA 1FWDC 3EOLA 4NNBA 5HQEA 3WD3A 1E5JA 4PH6A 2C7FA 1CNVA 3EOOA 4AZHA 1U83A 2OSWA 4QS5A 2GZXA 3SCNA 3WDIA 2PWGA 1OX4B 4RZ6A 4CN4A 1O12A 3WMCA 1DQWA 1XGEA 1U30A 1XLEA 5C9ZA 1PJ9A 1KFWA 1QUMA 3GDLA 3NQ8A 3NQDA 3IK4A 2EF9A 3OZOA 2JKEA 1KRBC 2ZXBA 1DP0A 2BP1A 2ZRYA 4MJ4A 1OX5A 1F05A 2JQXA 4FHAA 2XGZA 5AYBA 1QTWA 4IQEA 4J3ZA 3R8GA 5DT5A 2E9LA 3P93A 3P0WA 5ABFB 1NOUA 2G41A 2HE8A 3GDKA 2X1TA 3C2YA 3QY7A 2V5KA 2BVYA 1GZ1A 3GVWA 3W0KA 1NEYA 2Y5SA 1T40A 4OV4A 1AQMA 3AAMA 3C2RA 1OQFA 3N19B 4AWTA 3WNLA 1B9BA 4C6CA 2PGWA 5CSUA 3ATYA 3H8AA 2VGFA 1K02A 1V3IA 4GABA 2FTYA 4PODA 4NAEB 2VZVA 4KEVA 1CXEA 2ZKMX 1Q6QA 1ZBCA 1AQHA 3LI0A 4OWGA 3SCSA 2NUWA 4IIHA 4GI4A 1RCXB 4GGHA 1LLZA 3E2RA 1ONXA 5HMFA 1JYWA 1FWRA 3CZGA 4DJED 1VPQA 1JCXA 4DPPA 1UBSA 1IIGA 3G3MA 1Q85A 1WB0A 1R38A 2PF0A 2J88A 3GX9A 1S2TA 4XKMA 1WDPA 2JK2A 1P48A 1NWTA 4MWAB 5HXMA 1XYMA 3Q4DA 5E9AA 4PE8A 3GZ3A 1MW1A 3GNOA 1SQ7A 2PTYA 1V6YA 1E56A 3A64A 4KETA 3M4HA 1W3TA 3EOEA 1FXQA 1ZBKA 1H7OA 1I0DA 4M82A 1R0MA 4I6VA 4F48A 4IMFA 1DIKA 2E8YA 3KCOA 1J5TA 3RX2A 4ZFCA 4GINA 5LGZA 3NPWA 1KV8A 3O6DA 4JIEA 4WRHA 3V18A 3B4YA 3U48A 1XYZA 5TIMA 2PRMA 3W9ZA 3SN0A 2YLLA 2ACQA 4RR4A 1OC6A 2XTKA 3LTPA 4L64A 2XIOA 3IJ6A 4YTQA 3HPFA 2WVVB 4ZOCA 1S5NA 1PKNA 7REQA 4LAKA 2Z27A 3L5MA 3N18A 4XD3A 4JYFA 2IPJA 2DVUA 1KC7A 2CLFA 4IPNB 4RDZA 2F6XA 1DQXA 2O55A 2NXGA 4IL0A 4OT7A 5D2XA 5ENLA 3CZEA 1LZOA 4AIUA 4KW2A 3U4FA 1VBJA 2INFA 3K4AA 3CT2A 5KSWA 4LANA 3ZT6A 4LY8A 1XLGA 4US5D 1U5JA 4UFIA 5FSEC 4AUBA 2D0GA 2GPTA 5E1QA 1XSJA 3L4XA 7XIMA 4LUSA 4GVFA 3MZ2A 1C8YA 2DUZA 2ZBTA 3WK1A 2XH2A 1JCNA 4PR4A 4X22A 1LJYA 3QV9A 4DNHA 1VZWA 2J66A 3T4WA 1E1FA 3OBAA 3VIPA 1N55A 2QVHA 9RUBA 3HF3A 1XLCA 3H2CA 1QPQA 3GNPA 3TC3A 1SZRA 4V1XA 1Z48A 3BH4A 4DJFD 3C52A 1MZRA 1ZTVA 2CW6A 1OGSA 2SFPA 5DBTA 3WLSA 1BYCA 4NJGA 4ZA0A 3VUSA 4GC3A 3AHTA 3SFWA 5CPLA 5JUVA 1UBPC 1KTBA 1KA9F 3APGA 2UWFA 3BLFA 4DWSC 3W7IA 3N2TA 2GQ3A 3FDGA 3S1VA 2CLHA 4L9ZA 3E38A 1Z3NA 3V3WA 3VIGA 3W00A 4K8EA 1O68A 1QW7A 1V3MA 4GD0A 1O1ZA 1YDVA 3VXGA 4LAMA 2QUMA 1UA7A 2UV8G 1TMHA 1W1PA 3PHAA 1HXJA 1W17A 3KE0A 1SW7A 3HV9A 1YKWA 1LROA 4O28A 4F8XA 1I75A 3QY6A 4IZGA 1BXNA 1FXPA 3M64A 4PCTA 1MZHA 3SQSA 4DVOA 1JR1A 2ZFAA 1CW2A 3G8EA 3TFXA 3TR2A 3R43A 4GFIA 5HBFA 4YN5A 3VOCA 1WZAA 1W3HA 1C29A 1TPWA 4H01A 3LCFA 3WZ0E 2PD5A 1LBFA 2DFAA 3U7VA 2WO5A 2W66A 3U2CA 5E0CA 1LBLA 4DWDA 1RCOB 3QMTA 4JIPA 1LM1A 3I7SA 2J7CA 1I9CB 4LC6A 3OW1A 1JI2A 2DEPA 3VKCA 2BLEA 2IW0A 3SRDA 3U3HA 1PIGA 1WDWA 4BFAA 1R9ZA 3BL3A 4K38A 3MQTA 2CXEA 1YE4A 3KEHA 1TPC1 5HMSA 4EPDC 2YDAA 4L6HA 1XIFA 4LF1A 2ATSA 3V4BA 3VZXA 4S38A 3A4AA 3F5KA 3L4VA 3WLQA 1UR4A 4DYEA 2GOUA 4CU8A 1EO5A 4TX6A 4Z2HA 3B9OA 2OQHA 5FJRA 2FQIA 3I3DA 2OCZA 1SM9A 1TJRA 2J75A 2IKHA 3ZT5A 4NX5A 1VKFA 2P88A 4BI5A 1HZYA 4NRRA 1CECA 2DSVA 1B4KA 4KIRA 1AMYA 1K9TA 4HHMA 3S0CA 4MNJA 3SRHA 3QOMA 4FNRA 3TJLA 3ZVIA 3RRAA 1GVSA 1TV3A 1H7NA 2ABBA 1OT1A 5LSMA 3WUGA 3GSMA 3R13A 4YU1A 2EKGA 4F0RA 2NX9A 4O16A 4XZLX 3D47A 3WH5A 5F4SA 1GYLA 4FNSA 3S8HA 2DQWA 1E0WA 1GZGA 4KWVA 4RLIA 4GH1A 2WJDA 3R8RA 4LQ1A 5MF5A 1PZ1A 1XLAA 3MVTA 4NSBA 5LA0A 3NQBA 1NWUA 1UKQA 2QJJA 3WD1A 1X97A 4H2CA 3BURA 1ONWA 3VABA 4S3DA 1Q6LA 1AJ0A 5I5RA 3T42A 5A8NA 4EXAA 3S5OA 3NURA 4PEEA 5K4ZA 3PPCA 1GOXA 3RDKA 1UWIA 5AYIA 1AODA 3M47A 2PC4A 3VNLA 5A95A 1K7XA 4H9XA 2G3MA 3R94A 1OADA 2V2DA 3PWGA 3LQGA 1PKYA 1J01A 2ZC8A 2W4XA 5HK4A 1DJGA 3CB8A 3CC1A 1TX2A 3MCOA 3G24A 4Q8NA 4YTSA 4CQ9A 2ZADA 4LTSA 4KMQA 4GY7A 3KFTA 1GJWA 1C90A 4IFKA 1E43A 4O4VA 3BMXA 1FWSA 3VE7A 1MUMA 3BSHA 3FSTA 1ZJBA 1DWAM 2CIPA 3ZJ7A 5G1TA 1TJ0A 2VX6A 3WFZA 1ZQ5A 3UWEA 2VGGA 5EFFA 1XRVA 3LNMA 1E3ZA 1NWSA 1EQCA 3P81A 3CS2A 4Y8FA 4EANA 4ZODA 5M1TA 3PBMA 2Y1HA 2C91A 2VMFA 1H63A 1E9IA 2JFEX 4UTIA 3H6OA 3PG9A 2ZZ3A 3SRKA 1AZ1A 3WY1A 4UQEA 2DW7A 2X8RA 3FXYA 3QSTA 4AD2A 3DFPA 1XYLA 3PUGA 2VHLA 2MUCA 4AZ7A 1BQGA 3GHRA 1Z6KA 5PTDA 3P0XA 1EUAA 5AHNA 1W8SA 3AIVA 3WDQA 5CSYA 4DO4A 5BU9A 2AOSA 3E49A 3WDHA 4IP4A 2TODA 1QMLA 1HKIA 3R11A 5I06A 1RR2A 4UZSA 2VM8A 3UWQA 2O7SA 3P60A 4TTUA 4JNZA 3UR8A 3Q37A 1Q6GA 2YBTA 4RPQA 4HP5A 4JQ4A 4V33A 1Z7AA 1IGSA 3NSNA 2GSHA 1V6TA 4Z2LA 1OGBA 1OYCA 1UR9A 4U31A 1TKKA 2JF7A 3RN6A 2PDGA 1OZQA 1FWEC 2CKRA 5FF4A 2WW5A 1JL8A 1J0IA 3PPGA 3BANA 2PC8A 2C79A 2CFFA 4N9BA 1DJZA 1WYIA 4DELA 2FJUB 3J7HA 3FKKA 4A8NA 1GTEA 5IBXA 4F2TA 2RDXA 3E0VA 4ENLA 3G1SA 3K1GA 4LC8A 3ZS4A 4C6JA 1H41A 1OFDA 3VMNA 5LIKX 1H7WA 3WF0A 3UXLA 2R1KA 2BGSA 2JGYA 2W6RA 1RLDA 4LOCA 4XK2A 3HQ1A 4QXIA 2OELA 3A24A 4MZYA 4S3JA 3FYPA 1XX1A 5TQLA 2VOMA 2IKGA 4Q33A 2PODA 1XYFA 3RLGA 5F4WA 3KBNA 4QNWA 3ERPA 3MY9A 2VC7A 4G7EB 1JFHA 2DSWA 2D22A 2GVGA 3WCZA 2GGHA 5AVHA 2EG8A 1J6PA 4U5IA 1Z8AA 3V1HA 2YR1A 2Y7FA 4P8UA 4X3ZA 3VILA 2J8FA 1O4UA 3GXFA 3EX1A 1J79A 5MHBA 2PZNA 3IGUA 1M68A 4Y2WA 2ZUUA 4S23A 4IPJA 3LLXA 1KWKA 1QO5A 2ZZ7A 1EGZA 1NM9A 1DE5A 3MU7A 4NUWA 3G18A 1O66A 4GQGA 4UOJA 1W3NA 1SO4A 4AIBA 1W3LA 4QQUA 1XQLA 1PKMA 2ZRWA 2NLIA 1XBYA 4M7TA 1YPIA 1DTUA 1XIGA 4NZ4A 2R9RA 1HL8A 3AHVA 3VU2A 4AZ5A 4NVTA 4QE1A 2OTDA 2JE8A 2OPJA 5I3KA 3GVRA 3KZSA 2C13A 1LWIA 3W53A 1ENUA 5HATA 1RP9A 3KBMA 5FEWA 3LHWA 5T26A 4J5NA 4Y6GA 4DWSD 1OT2A 4XVEA 3O06A 1W5NA 3THDA 1UZ4A 2V63A 1GVIA 2DZAA 5AECA 1BF2A 4Q22A 4QX4A 4FLRA 3UG3A 3ALGA 1LT8A 3WNMA 1MEWA 3BV7A 3G1VA 5LIXX 1LUCB 3NA8A 1TR9A 1RBAA 4K39A 3DESA 4L6OA 1ZENA 2Z2BA 3BAYA 3QLLA 1IE7C 1LUCA 3ABZA 5CQ1A 5K9DA 1EP2A 3BZJA 1EYWA 4HTYA 1BQCA 3G0UA 3PZIA 1NOWA 1VS1A 3NQ7A 2WSPA 3M0ZA 4PYSA 2QJMA 2XJ7A 1SW0A 2XFYA 4S2CA 2W91A 3SUSA 2VCBA 5I02A 4XKYA 1B3XA 2PE4A 4ALDA 4C6LA 1H62A 3NOEA 3M7SA 3WBYA 5EKYA 3W87A 2YOCA 4AVOA 1P6CA 4WF7A 5A2BA 2BB0A 1UWRA 1JF6A 1QWKA 2WC4A 4GNVA 3W7HA 1AH4A 2OOFA 2AMXA 4PTWA 3P8IA 2B7NA 4B4HA 3QZ6A 3KOFA 4QCEA 1V51A 1CXHA 2Y70A 3V5CA 2P5NA 1XINA 1KBLA 3UJRA 1RUSA 1CGWA 1LOSA 1HJWA 3LCLA 3WK0A 4JNMA 3S2NA 5ECVA 3IJLA 3G1YA 4LVFA 1OD8A 5ECUA 3VMPA 1KB3A 4M19A 1EO7A 3WJWA 3FSUA 5D02A 3BUVA 1WDQA 1J6OA 2D24A 4XO6A 3DECA 3C6CA 2FDMA 3QR3A 4B9YA 3G3DA 5CXPA 3P62A 2YSWA 4WGXA 1JPIA 3SY8A 4NZ5A 4B3ZA 1HGWA 3EX3A 4Q8PA 3WLLA 4QNEA 3NDOA 2NWRA 4UWMA 4BWLA 1XL9A 1GQNA 1ZALA 4EIVA 3WELA 3WUEA 1TTIA 1UUQA 2BV9A 3CHCA 2FTWA 4H7CA 2PGRA 4X61A 1XLLA 3FIGA 4R7JA 1AQFA 1GVYA 3GTNA 3I6RA 4C7DA 4M51A 3NOYA 1WP6A 3EXTA 4X9YA 4A2RA 1N8FA 3DZ1A 1JQVA 4L80A 3DENA 2XSBA 4A3HA 1RD5A 3CNYA 3I3BA 1AW5A 4PRTA 3TYAA 2Z1VA 4K36A 3DHDA 4LNCA 1FRBA 4JTDA 4HN4A 5HNUA 2I14A 1AW2A 2PTZA 2X2GA 2VC9A 3TC7A 1DORA 3PULA 1XD0A 4XG1A 4YJ5A 1XRTA 2UZ9A 3WUBA 3XISA 3TSDA 4GXMA 4M8UA 5HR7A 1H61A 3SSZA 3KVLA 1V6WA 4O54A 1XGZA 3O07A 5G2HA 1PTDA 4JX6A 3H23A 2H8ZA 3THQA 4S3EA 4M56A 1W5OA 2PA6A 2YXXA 3M0MA 3HG4A 2FYMA 2FMOA 4IMDA 2HBXA 5BOEA 4E38A 1IT7A 4E2DA 1B5TA 1GEHA 1RCQA 2Q09A 3GXTA 1P0EA 1P0KA 3EB3A 4R7WA 5EGRA 4AEOA 3CLMA 2P53A 1T7LA 1B3ZA 4Z17A 3VD4A 2VOTA 3B40A 1OINA 2XN1A 1QDSA 1E40A 1LYXA 3H4WA 3P67A 3I3EA 4B91A 1C8QA 3OQEA 3PAOA 3F4CA 1TPVA 2J13A 3EYPA 1U5VA 1J10A 4HOWA 5KITA 5CAKA 5CGTA 3KRBA 3G1RA 5KZDA 4Y9OA 4CQCA 2FPYA 2GGGA 4TX8A 4HMEA 1CLKA 4AEFA 2WWCA 1MW2A 4JTAA 3N2MA 4PMNA 1W56A 4R9XA 1IGWA 4J3UA 3VD5A 3BW3A 2EG6A 3LBOA 4F4RA 3L5LA 2DT2A 2V5CA 3ONCA 4L65A 1U2YA 1GJUA 2B7QA 5CPOA 1UR8A 4H9ZA 3ZZ1A 2D2GA 2ONEA 3NR0A 4MY9A 2PS2A 5FCZA 4PUKA 4FXFA 1B9ZA 1NFBA 1DYSA 2V3DA 3A13A 1D7FA 3BJFA 4QTGA 4JEQA 4XO7A 4NJKA 1B0IA 1CENA 4IIGA 3HG5A 5A94A 3QVQA 1HQTA 1GKRA 4CCDA 1SSDA 4CNSA 4F0MA 4LUYA 2VRJA 1A50A 1MUCA 4AXKA 2QV5A 1F4HA 4KGLA 1S2WA 4H2HA 1K9DA 1RLCL 2FVLA 4PTNA 4DBUA 1D2KA 1OCNA 2DZTA 1U5HA 2NQHA 2NV1A 1H7XA 3W37A 1PX8A 3KBWA 3W1LA 1XUUA 1XKYA 2ZX5A 3ISIX 5FJPA 4UTUA 2PDHA 3LSCA 4QEHA 4U5KA 3WD4A 1LL7A 5EA9A 5I2UA 4FB7A 4LUIA 4DB7A 2QLYA 1QXLA 5I78A 1H49A 2IKIA 3PY2A 3BLOA 4AZIA 5LHFA 3S2JA 5FAGA 1VQTA 4EXQA 2P8CA 3G6MA 3TXZA 1I6NA 1G4PA 1Q6CA 4LCSA 2FPVA 4AF0B 3MMDA 5A6MA 1GQKA 1OM0A 3WQ4A 1TWIA 3ABSA 3LPGA 3ZWTA 4FA3A 4IGSA 1L9WA 4GBDA 1FWNA 1QW9A 3BK0A 4S39A 5TD4A 2RGMA 2R91A 1QI2A 1CXLA 3INPA 5AKQA 2PDMA 1A47A 3H2NA 3WQCA 3UZJA 1W1TA 2PU0A 4I6KA 3R2GA 3F4NA 1TV4A 3ZSSA 3A3WA 1R3TA 3PR2A 2REQA 3DBPA 3O15A 4BS0A 4IGMA 2Z28A 2ZVIA 1QHOA 3AYTA 3GIYA 3IVSA 3PUOA 1SUXA 4MVAA 1JUBA 3QKEA 1QW8A 3V5FA 4FR6A 5HPOA 5BW6A 1K7EA 1I2PA 3CUFA 4NZJA 1FCVA 3ARWA 3MJMA 4HPNA 4QR6A 3BAKA 1C8VA 1L6YA 1KM6A 1TZZA 4ORMA 4P7QA 4UFJA 3UW6A 1QNRA 5CGMA 1TA3B 1FFQA 3MSRA 4PL2A 1PBGA 4CEXC 2OO6A 1PPIA 1O1HA 3E2SA 2D3LA 3IJ8A 3TLLA 3UCQA 4FS9A 1WAWA 3DG6A 3TW6A 3GXMA 1CGYA 1T6MA 3HG2A 3Q94A 2CWXA 3OB8A 4F0HA 4NIRA 1F74A 4JXCA 3DYPA 4CNOA 1H51A 2X7WA 1PIIA 1ME7A 3CIXA 1R9YA 3THUA 3NQEA 2AMGA 1G7UA 3P5YA 2PRLA 4D6CA 4KGJA 1K8YA 1XQKA 2ISSA 2I7GA 5HQLA 6TIMA 2CYGA 2V3EA 1PTGA 1MEIA 2AGKA 4N7QA 4HU0A 3PJWA 1E4MM 2Y2WA 1W3KA 3W2NA 1F4AA 5T9BG 4B4FA 2EQDA 5EMMA 3W1XA 4IXHA 1A5KC 3IIZA 3C3UA 3G8RA 1RJQA 1KRMA 2AL1A 3F2DA 1A3XA 5JMUA 5FF0A 3GAKA 5CPMA 4DO7A 2DDXA 3F4VA 5KZ6A 1DWGM 2ZWYA 4JY8A 1JCYA 4W86A 4Q8VA 2XIQA 2DV0A 3GHUA 3M0HA 4X0VA 4DF1A 3T2QA 2NQ9A 3W7QA 3ITXA 2AAAA 1P1MA 3L67A 2QCNA 5CPTA 3GC5A 3SN1A 1SR0A 2KZHA 8CGTA 1NIUA 2Z1SA 4XUYA 4O8AA 1HJXA 4FR1A 1PEZA 1UQZA 2A3CA 3T0TA 3EXRA 1H7RA 1HF6A 1YXCA 3RX3A 2ZC1A 3A4WA 1JCTA 2D3NA 3AWOA 4R34A 3EA1A 5LIYX 3WDPP 1S5VA 4MB5A 4UTMA 2D73A 3PFRA 3WNKA 4G8TA 5EMJA 4C1NA 4EPKA 1F07A 3GBEA 5CBJA 1XC6A 3W6MA 1Q7ZA 5K9XA 3UPWA 4OBSA 1BRLA 1XHGA 2CBUA 1WO2A 4GUHA 1WXYA 3N4EA 4LAZA 4M6UA 3WQFA 3KS5A 3NZQA 1AD1A 3ANUA 3DN5A 2E77A 3VUPA 3GDMA 4EPBC 1KLYA 4KIEA 1ODZA 3AC0A 1DOSA 5DLCA 1OF6A 3VYLA 3WNNA 1WXJA 1HG3A 1FKXA 3PNZA 3VDAA 4N42A 1UR3M 2XFRA 5M3WA 4HJFA 3GYCA 5CG7A 1X96A 4EX4A 3LBCA 3PB0A 4W9TA 5HPCA 5AHEA 2AQOA 5L9FA 3E2VA 4PBFA 2P3ZA 4QG8A 4NX0A 5DT7A 2AGTA 4TXEA 2FHBA 4O1CA 3S9IA 4I8DA 4MDOA 1V0KA 2EPHA 3CTLA 2D2OA 3WQPA 1TWZA 2D2HA 3MMWA 2E5CA 1UH2A 2QCDB 5DMLA 3AU6A 1G4EA 1US2A 3ZIZA 3FNDA 2BXVA 3ZR5A 1GONA 1AD4A 3VIJA 2W92A 3EZ4A 3MV01 4YPJA 4RJEA 5ABFA 4ZMGA 1XD1A 4ACYA 2IQDA 4XTDA 1A5BA 2GLKA 3EWWA 1HVXA 3SGUA 1AJZA 1I45A 3PSVA 3JS3A 1V03A 2YL9A 2PDLA 3SCUA 4GJJA 4NXKA 1ISVA 2VR5A 1QWGA 2WMIB 1E1CB 5HNTA 1GOOA 5C2XA 2VZSA 3PZQA 3ES8A 4KCUA 1YHTA 1GVEA 5J04A 4DF2A 3FYOA 4JTJA 4ADTA 2QHAA 4AU0A 3AISA 3DDMA 4I9AA 3L23A 4PTVA 3IPWA 7CGTA 3WNPA 1AFSA 3H2FA 5ABEA 4KKXA 3EDFA 3PZ9A 4YTRA 4F0SA 1SMDA 1V0MA 3IAPA 4JGDA 3TWBA 5FJUA 4KFNA 4MAVA 5G2IA 3NWRA 3GE7A 3WEOA 3B0PA 1XH2A 1BTMA 2PDQA 3T09A 4YTUA 3L7RA 2VX7A 4MUPA 2HNHA 3BAWA 1PIFA 1H5VA 4R3UA 4R88A 1B90A 1JZ3A 4DY1A 2GJRA 4B5UA 4K7YA 4PTDA 3UZXA 2OKOA 1A5AA 4YHEA 1V6VA 3FW6A 4A6GA 3DU0A 3ZR6A 2XSXA 1R3WA 3AIBA 5AC6A 1UP0A 3AIUA 1VBUA 2CZVA 1J11A 2DJLA 3HG3A 4A35A 4O13A 1MW0A 2BOFX 2PWDA 4Z2JA 4U10A 3VC5A 2I5GA 3LHUA 3DGBA 1PV8A 2RFGA 2VDHA 4I7WA 4ZO6A 1GKPA 4CVWA 2WLYA 1RY8A 3LENA 2XM1A 4XAFA 5FEXA 4J9JA 2YPIA 2GK1B 1HNYA 4E2VA 3S1GA 5JIPA 2ANUA 4Y8EA 1VC4A 1J0KA 3R7MA 3DFOA 3QRHA 2R1NA 5CJNA 1XG3A 3V75A 3TA6A 2H8XA 1J0ZA 3VKKA 2RHGA 5GVJA 2FGLA 3W75A 3CV1A 1XSKA 1GGOA 4H9VA 2WZMA 5BNKA 2I1OA 2XIJA 2E6YA 3WDRA 3JW7A 4AZBA 1W9VA 5FJOA 2VC5A 1W5MA 4LYRA 1TZ9A 4FO4A 1DBTA 2D20A 1H1ZA 4FX6M 4BHYA 1ZP4A 4AF0A 2DT3A 4HYRA 3GG8A 4REQA 4XISA 4AB4A 1TVNA 3VOGA 1JCMP 5LIWX 1W9XA 3EX2A 3RLHA 3TP4A 4HVXA 4LPCA 1Z42A 4WJEA 5CZSA 2E3ZA 3VZZA 4ROPA 6REQB 5LNRA 3UZWA 4IUGA 3AMCA 1TUFA 2HCVA 3CAKA 3B05A 4NAFA 4N02A 3WK3A 2Z0IA 1NDYA 4OOZA 5BXRA 4ES4A 2GDVA 3IS4A 4UTHA 3P8JA 3RJXA 1I2OA 3NL3A 3LXBA 3UPBA 2W62A 4F0KA 3W85A 4H8VA 1F9CA 1TJPA 2GGIA 2WLZA 3W1RA 2NVCA 4D1JA 5FJIA 3C61A 1RVGA 1NAL1 4IJBA 3ARSA 7ENLA 3M7WA 4F9JA 1AL7A 3WG6A 3RX4A 3SCRA 1ODUA 4O19A 1EP3A 4RNJA 1PCWA 2NQLA 3B0YA 4GKTA 1EB3A 4IMGA 3BJSA 3UG4A 4B2DD 4E4UA 2A6LA 4LS0A 1UG6A 4MG4A 4JTFA 4M24A 1F3EA 1V0LA 4GQ0A 4C6OA 3AIEA 5E70A 1BG9A 2GWGA 4AHOA 4PSPA 4JN6A 2O92A 1RHCA 3LCXA 4PMZA 3R8HA 4RX0A 1OCBA 4JOMA 3N6JA 4DYJA 3AMDA 1C9DA 1U33A 2GJXB 3RAOA 1GHRA 1OHLA 3T40A 4W7VA 4HPXA 1G94A 4HYVA 4B15A 4DUWA 4WSHA 3GH5A 3ARPA 4PSRA 1F2JA 3L66A 5I3FA 4N6FA 1S38A 1XRSA 5T9CE 2LLEA 5BOFA 1WKFA 3ITGA 3N14A 3BLEA 2RH9A 4W8AA 3MW7A 4PUNA 2DIKA 4WOQA 3TYEA 1WV2A 4EKJA 3L2LA 3PG8A 4RPPA 1DTNA 3GU9A 4UTFA 4RNFA 4N9DA 3FJNA 3G6LA 3TEVA 2HZGA 3CT7A 2ODOA 3F2BA 2YW4A 2W3ZA 5FI8A 4D2JA 3M43A 3BSGA 3LEPA 1UOKA 2YIHA 3AXHA 4RUBA 4OGZA 4DM2A 4YLWA 1O60A 1IXOA 5D2TA 3OVRA 5BMXA 3NQCA 3D3AA 5I23A 3WBAA 1MVYA 3U57A 3H2EA 3T05A 4NY2A 1W5QA 1EH9A 3W7LA 4HBKA 4MOZA 4MF4A 1M7PA 3MANA 3USBA 4B5SA 4GUFA 1SJDA 3TFCA 3VX1A 2QQ6A 3AYSA 2OYMA 3N73A 4JCLA 5KMYA 2CLIA 4E5TA 3MBFA 1ZBVA 1YBQB 1WA3A 4QEEA 4C6PA 1THFD 2PDKA 4IG2B 1ECEA 4JYDA 1VCGA 3EB2A 3H4XA 3O0FA 4M1BA 3SUVA 5TBOA 3GC2A 1B57A 3VDBA 2JGQA 1QO2A 3K2GA 4RDVA 4WZHA 3AS0A 1G01A 5BZAA 1TIWA 3QV8A 1JPMA 1E71M 3MP4A 2UY3A 3RFAA 3FHAA 3W73A 2XGIA 4WD0A 1V8EA 3E12A 1OFPA 4UMCA 3T4CA 3WL0A 4CNTA 5BRBA 4K8HA 3TMQA 3MMTA 2J7FA 4EF8A 5TNVA 1DXIA 1M03A 2OGYA 3BICA 3QW3A 4BI6A 2J6XA 4MKVA 1XV8A 2ZX7A 2B7OA 3IRDA 2H3BA 4ZB5A 4J3XA 4Z1YA 1W2VA 4E2OA 2CLMA 4FK9A 1CB2A 3EWYA 1H0GA 3H7RA 2WSQA 4CU7A 1TTJA 3YPIA 1ZP3A 2GVLA 3TZFA 1W3JA 4JL1A 3NTYA 4AZGA 3OU8A 3W88A 2XFWA 4W7UA 3KCLA 4P7LA 3WF2A 5K9CA 1W9PA 3SGZA 3SADA 2PEVA 2QULA 3NYZA 3T0AA 4GO9A 2QDDA 4A21A 4LBUA 2A3AA 3BOXA 4LFYA 3C0QA 4HZMA 4AMAA 2PTXA 3S6DA 4Z1DA 3ZJKA 3MVIA 4AIEA 1J96A 1DEDA 2UY4A 3WLIA 1XLKA 2DORA 1B3OA 2CLKA 3K8LA 2DZSA 1LORA 3V35A 4XAZA 4A3QA 4C5ZA 4AYGA 2R14A 3UWZA 3R4IA 3EOSA 4OVXA 3PB2A 1KBJA 3LG3A 3N2OA 3N17A 4B5NA 2ON3A 3VOIA 3LHVA 3QGVA 3GBDA 4IL2A 3SM0A 3LOTA 3M0JA 4DX3A 4F3HA 2BHZA 4ADUA 2GJXA 1TTPA 3CUGA 3LD5A 2WCAA 6REQA 3QC0A 5AHLA 3WH7A 3I7RA 3GDRA 2JF6A 4Y7EA 1F76A 2CESA 1CB7B 4BF9A 4WOZA 4BQ4A 4JKLA 2Y8UA 1OFBA 4PMUA 2J47A 1EC9A 1QOQA 5A2CA 3QFWA 3JUGA 1BVWA 3GG0A 1G4SA 4HK6A 5AHIA 1W91A 1UB3A 3APTA 2FPTA 3CHEA 4HQVA 2ZIDA 3VX0A 5FOOA 2GYIA 5EMLA 3MT1A 2Q3OA 4XZMX 4JN7A 1XYBA 1ZFJA 3HGSA 2C8NA 2YBVA 3GNDA 3ANVA 3BC9A 4QE4A 3W1MA 2J8GA 3VMOA 2QF7A 1IZKA 1XCXA 1ZU8A 5U4NA 4H8HA 4H7VA 1S46A 4FP1A 2X1UA 3PPHA 1UWQA 1Q4WA 1UC4A 3WFLA 1MYRA 4W93A 1UWAA 4MLJA 2ZQ0A 2PCEA 3GTIA 4GGBA 2HMCA 4C7GA 5EYWA 1CGXA 3CV7A 3LCHA 3N11A 4MM1A 4DRSA 3ABOA 2CEQA 1K9FA 3TXVA 4BQ2A 3AUOA 2WCGA 3B8IA 3UFYA 5C2CA 4WVXA 3TJXA 4U28A 4C6IA 4OTKA 3PN8A 3UT0A 4Q8OA 3E2QA 1S5MA 4JTIA 3C5QA 2XGBA 3WX7A 1HO4A 1GG0A 3POHA 1EYEA 2G3JA 1QPKA 2XUCA 1FKWA 3E1F1 3WQ6A 3BTNA 3B97A 3MUAA 2EJAA 3CAVA 1SFSA 3G0SA 4GACA 1TWDA 4ECLA 4YWIA 1CCWB 5EBUA 1T8QA 1WOAA 1TQJA 3ZOAA 2Y6ZA 1QBAA 4GUGA 1OK6A 4EK7A 4KERA 5AOUA 3QC3A 1EF3A 2J7HA 4B90A 4MY8A 2ISDA 3UESA 3GXDA 4OBTA 4AH7A 1JPKA 3OP2A 2NQ5A 3C3NA 3A23A 1D3GA 5DN1A 1Q45A 4UOQA 4JBRA 3SAZA 4GO8A 1CLVA 2VFGA 2J7GA 1LG2A 3EGJA 1DVJA 4CKQA 1QI5A 2GGEA 3LCWA 3W74A 2EKCA 3S1UA 1D9EA 1VF8A 4X63A 1KKRA 1X8CA 1QOXA 3BAXA 3N2CA 3IIVA 1A4LA 2A3HA 2EXOA 5AVNA 1GNXA 3KRUA 3L9CA 3GB6A 3OYZA 4PMOA 1VJIA 1S39A 4L1GA 3PP7A 1YQ2A 5EB8A 4UR8A 4K8GA 4KQNA 2TMDA 1HIZA 4D6IA 4WGHA 1CIUA 3PVFA 2A3BA 1YTDA 2QIWA 5HULA 3ZFHA 4YYCA 3B8TA 2PWEA 3DFTA 4I3GA 4GXPA 2ALDA 4LS1A 1SFJA 3WH9A 1ISWA 5AY7A 1TCDA 4TVDA 4XAGA 3O6AA 3ABRA 2WM0A 3HMJG 4NAEA 1FTXA 5J5RA 1W9BM 4Q8WA 1C9WA 1WE5A 3RPDA 1DJNA 1NTHA 1XG4A 2OWCA 3R25A 1PX3A 1J5SA 1EZWA 1NWRA 4MFEA 3GIQA 4XZ9A 1SJCA 4IT1A 1GYNA 2YLAA 3CAQA 4Q4QA 2NXHA 4CNNA 2ZDRA 3EOUA 4GOAA 4WJXA 2P8BA 3O0KA 4E2BA 4HCHA 4QDWA 1IF2A 3DFSA 3QQ0A 5C7VA 1M7JA 3U8GA 1E6XM 5AHMA 3M5ZA 4JTSA 3Q67A 4ICCX 4CD5A 1JXKA 4PCFA 3S5SA 1UWUA 5DEZA 4LCQA 2HE5A 1UIPA 3SCWA 4XAPA 4O10A 5F2IA 3EMZA 2WZHA 2EG7A 2GVEA 4PCNA 1TJ1A 3P74A 1XIEA 4GCXA 4RW5A 5HJXA 3W26A 4UBPC 4PEKA 3L4UA 1ICSA 2FHCA 3P80A 3H7UA 1UR1A 4NXSA 5ABTA 3ARQA 1N82A 1OSEA 1X98A 3ENLA 4L9XA 1LDCA 4JTQA 4JIIX 3NCOA 4GQQA 4X60A 2QCFA 1KW1A 2X0YA 2J78A 4IICA 3ITVA 3V0TA 4R9OA 2RUSA 1VEPA 3AHYA 1RSCA 3L0GA 3W2LA 1IT8A 2FJKA 3GU2A 1EBGA 1JGMA 4P8VA 2V69A 3GFYA 3T8QA 1NP2A 5A6LA 3NVDA 1RZMA 2HV5A 2POZA 2JKAA 3LBMA 1UZHA 3N9RA 3TJ4A 4NI8A 3WL1A 3DIPA 1YX1A 4HHHA 3LX9A 3AMLA 1EWDA 2D0HA 3QF0A 1H2JA 4DLMA 5C9RA 3GDTA 4MSSA 2H9AA 1VPXA 2BHUA 3OO2A 1K8CA 3WBWA 2QAPA 2F2KA 3AYVA 3F5LA 1CGUA 4DZAA 2WJZA 1XLIA 2D23A 3ZO9A 3ARTA 1HKJA 4DQWA 2GOKA 4PMDA 2AKZA 4WXYA 4GH3A 4AFYA 3H21A 3IUHA 3ZVHA 3G5EA 2FZNA 1KFLA 1OG0A 5D8WA 1E6PA 2VZTA 2OT0A 2CITA 3LLDA 3BAJA 1XI3A 3TYBA 3MBDA 1UUMA 3EEGA 2V8ZA 3N34A 5REQB 4KF1A 3ORWA 1EXPA 3EAUA 4M80A 3UPMA 3WLRA 4KBXA 2O0TA 3GHTA 5G4WA 3PUEA 4V15A 5J8LA 4QP0A 4AAJA 2B31A 1XYAA 2Z7GA 1LF1A 2BHYA 3D5HA 4L1XA 3PBGA 4PBEA 3GZAA 3H70A 3KOYA 1VLIA 5XIAA 2QXWA 1KXVA 2OEJA 3Q58A 4HNVA 1CX9A 3U9IA 1TREA 3O9NA 4BI7A 5B7ZA 1TMQA 2G3IA 5DCEA 4BY3A 2XHYA 2RJHA 2ZZ6A 4W87A 3TTQA 3AXKA 3F4DA 1Q6EA 3N13A 5HNRA 2PUZA 3P61A 2RDTA 1PZ0A 2XINA 3PZNA 1J12A 4IIEA 2OJPA 1HJVA 2C71A 2GQ9A 4OBRA 3MP3A 3TTYA 1KV5A 2EPOA 4IIFA 1LQ0A 4GI8A 1N8WA 2WNQA 3PF3A 3QR1A 2OYLA 3QEZA 2F61A 1VGAA 4GE8A 2QCHA 4HB7A 3RR4A 1DL3A 3MI2A 3FVMA 2PDJA 3W1TA 4TQTA 5I3GA 3AQUA 2XH4A 9XIAA 3IGSA 4BCEA 4QJ5B 1XCWA 3KTSA 3SIZA 3FN9A 4LYPA 3QMRA 2F38A 3TMLA 4DJDC 1E9ZB 4TTGA 3M0KA 3CUHA 1IV8A 2VUNA 4H1ZA 5CSRA 2PLMA 3TQKA 1AMKA 3VKBA 3PJTA 3TTEA 3MO7A 3WBXA 4UFMA 1KCZA 4LYKA 2ISWA 3AIRA 1RQEA 2FGBA 1JZ7A 4TUFA 4L6DA 1SU5A 4GPNA 3NPXA 1XDMA 3AICA 1XR2A 1LP6A 3C86A 3K8KA 4S3FA 5CPNA 3L5AA 1OX4A 1F73A 5HMEA 3LNPA 2QPUA 4NZ3A 3FA4A 2F9RA 3EA2A 1UJPA 4BEQA 4WUIA 3O6CA 2ZUVA 3O7UA 1Z44A 2F6UA 3NNTA 3VFCA 8RUCA 3PK7A 2ZUSA 3W81A 3VNKA 2OEKA 2CU0A 1F3TA 1T41A 1RD6A 4GXWA 1SYTA 4UTKA 3LERA 3TN4A 3DFQA 5CG0A 5D30A 1EPVA 2HRWA 4WDXA 1W0MA 1W1VA 4DJEC 1K4GA 3S6OA 4IX0A 2INEA 1CI1A 1EJWC 3OG3A 1MFUA 4NZFA 5AC8A 3W1UA 1EA0A 1JPHA 3HMCA 2NSXA 3UD6A 2PU1A 1Q7QA 2HVMA 2RDWA 2PGEA 3KP0A 3V16A 2GK1A 1BTCA 1SZEA 1REQA 3M1ZA 4FIQA 2VCCA 4REQB 4LVDA 5LXXA 3PS7A 3DFHA 4FX7A 4GHRA 2VFDA 3BLDA 3U5UA 1Q6OA 3H7VA 4HNTA 4EWND 4JNYA 4JX4A 3GY1A 2OFJA 4PUWA 2W63A 4NZCA 2EEXA 3STGA 2W79A 3EPNA 2ZRUA 1FH8A 2GWNA 3A3HA 3AU2A 1Q7MA 4I5RA 1AZ2A 4MZ1A 1YADA 2PWFA 4H7ZA 3G1AA 3R79A 4H4IA 5FEZA 4GI6A 3V5OA 2DW6A 3KVMA 4HJWA 4K6AA 2DT0A 2IXVA 2VO5A 3TCSA 4FNQA 1YEYA 1J4EA 3MV11 1QR7A 5E9XA 1SO6A 4CCZA 5FL1A 1E5NA 2NV2A 3PTKA 1KCLA 4PL1A 4JHOA 4LSBA 3XIMA 1JIBA 3A3XA 1GOQA 1TQXA 1M01A 4UOZA 4H9UA 1CBGA 1JCJA 1P7TA 1FUYA 4WKAA 3SN4A 4PB5A 3A9IA 1SMAA 4UFHA 1XIDA 3VM7A 1I0BA 4ERAA 2PBGA 5BXSA 2OZ8A 4FPSA 3EXSA 3WNOA 3QGKC 1IEIA 3N2XA 4RV3A 1DWIM 2E1WA 3ZM8A 1PL9A 4DO5A 2NX1A 5CLTA 3W25A 1KQYA 4B2DA 4CD7A 4KCVA 4GMEA 1BD0A 1Q4NX 5EMUA 1UP3A 1AQ0A 3KVJA 5JH1A 1TJ2A 1ONEA 2VXNA 5DX7A 4NJHA 3SFKA 3KW3A 3V1PA 3MP5A 2YDRA 1BWLA 1OK4A 1FHDA 3IARA 3RCNA 5DF0A 1TELA 1X1OA 1DJYA 2X30A 1Y7VA 3TLQA 4Q7IA 1BYAA 3PSWA 4TMBA 4V2XA 3UCCA 3EA3A 3OEXA 4IQLA 4CQ8A 4BWLC 3QY8A 4OQVA 1H3GA 4XZNX 3SY5A 3CXOA 3E5PA 5IHSA 5BWFA 2BY2A 4HCDA 4ZE5A 4IISA 3KS6A 3C56A 2Z6JA 3CWHA 1JUEA 1LCOA 1E1EA 3NG3A 4I7UA 4G56A 3WF1A 1V3LA 2BOGX 2DU2A 3QFEA 3W70A 4KWOA 1XS2A 4RE0A 2I9EA 4JTLA 4EVZA 1HKKA 3BE7A 3C8NA 2BMBA 3DHUA 3UR5A 2WHMA 5CJMA 2CBJA 2XDFA 5LA2A 1RA0A 3W84A 4I9JA 1E6SM 3PPFA 1FHVA 4WSKA 1PZ2A 5JXQA 1V7AA 4ZTYA 5I3JA 2A7PA 1OVDA 2E7FA 3SRFA 2VEFA 2NLYA 1Y5WA 1SVDA 1SFTA 3W1NA 4IIBA 3CQHA 4CQBA 1E4LA 1FDYA 2D69A 3BO9A 3GNNA 7PTDA 2ZCGA 3IEBA 1PZ3A 4N4PA 1I8JA 1EOKA 5JIWA 9CGTA 3NQMA 4GC4A 4LJ3A 2PLJA 4GZIA 4JKMA 3EDDA 1BSIA 3SR7A 3UA3A 3G22A 4O0KA 1K1DA 3HOJA 5CSSA 1QNPA 4W8LA 4LUTB 1M65A 4DBWA 2VYOA 1B30A 1E55A 1RQBA 3PZGA 1EJ7L 4YHGA 3LGEA 4DYKA 1H09A 4UR9A 4RKAA 5F2MA 5D33A 3AIWA 1CLXA 1OFQA 4INFA 2GFTA 3LHTA 1PO9A 1KFKA 4AHQA 5BRPA 2FIQA 2OZTA 4O11A 1UPMB 2NW0A 3RO8A 3OZPA 1RXOB 1HP4A 3EWDA 5CZTA 3WQOA 1TRDA 4XD6A 1MEHA 3HIJA 4L9YA 5HR6A 3VCNA 1WBHA 1Q2RA 4IH3A 5FSDC 4GA8A 5REQA 2V81A 3EPMA 1Z89A 3SEPA 3PWIA 1WZMA 2XH0A 4Q6JA 3IIXA 3W1QA 1QVBA 2BXZA 3EDEA 2QVNA 1MDRA 4LF2A 1C92A 1FQ0A 4DUVA 3B03A 3GR7A 5K3VA 1A4MA 4J2PA