1WXYA

Crystal structure of adenosine deaminase ligated with a potent inhibitor
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
349
structure length
349
Chain Sequence
TPAFDKPKVELHVHLDGAIKPETILYYGKRRGIALPADTPEELQNIIGMDKPLTLPDFLAKFDYYMPAIAGCRDAIKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVQAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDTTLYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRFKNDQVNYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLDLLYKAYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Adenosine deaminase
publication title Structural Basis of Compound Recognition by Adenosine Deaminase
pubmed doi rcsb
total genus 142
structure length 349
sequence length 349
ec nomenclature ec 3.5.4.4: Adenosine deaminase.
pdb deposition date 2005-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00962 A_deaminase Adenosine/AMP deaminase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 1wxyA00
3RN6A 5E5CA 4KERA 2E1WA 4QRNA 3E0LA 4H9TA 1EJXC 4C6MA 3WMLA 3R0DA 3QY6A 1FKWA 3HTWA 3LA4A 3EGJA 3TNBA 3PANA 4KETA 1V4YA 3GTHA 4C6PA 2R1MA 2OB3A 1KRMA 2W9MA 3S2NA 1W1IE 4IFOA 1FWGC 5LXXA 1IE7C 1K70A 3GIQA 1UBPC 4C5ZA 4ZSTA 4H9MA 3AU6A 4LALA 4EPDC 3D6NA 4F0LA 4R85A 4CEXC 4Z42C 1GKRA 1NDVA 1ONXA 1KRCC 3LU2A 4P5UA 4QS6A 4G7EB 5FSEC 4C6CA 1J5SA 2QVNA 4DYKA 1KCXA 4NP7A 1GKQA 4RDVA 3CAKA 2AQVA 3F4DA 2IMRA 3LGDA 3GU2A 2PUZA 4UBPC 4XD5A 3QGAC 3A3WA 3WYZA 1FWJC 1V79A 4BKNA 1RA5A 1ITUA 4C6KA 4IF2A 1E9YB 4M51A 2G3FA 3SO7A 3F2DA 2XIOA 3K2GA 4C6QA 4DLFA 2FTYA 4XAFA 2BB0A 2CZVA 2O4QA 2GZXA 2Z27A 3F4CA 2Z25A 1XWYA 2VR2A 4C65A 1YBQB 3LY0A 4LH8A 3MJMA 2Z4GA 4C6OA 1ITQA 4WVXA 1XGEA 1BF6A 3UR2A 4XD4A 1NDYA 1KRAC 3EWCA 3A3XA 1M7JA 5A6TC 2KAUC 3MDUA 4DIAA 2E25A 2VC7A 3UPMA 4C6EA 2ANUA 2VHLA 2Z2AA 4IFKA 2I5GA 1GKPA 2HQAA 4BJHA 1FWIC 3N2CA 4GXWA 4V1YA 2R1KA 4LCQA 3FEQA 3T8LA 1EJWC 1UMLA 4PBFA 4OFCA 1VFLA 4IG2B 3E0FA 2PGFA 1EJTC 2OGJA 3OQEA 1YRRA 3LSBA 2EG6A 4RDYA 4IGMA 3IRSA 3ORWA 4PBEA 2F6KA 5G4HC 1YIXA 3BE7A 1ADDA 3LSCA 1PSCA 1P6CA 1KRBC 3A4JA 1M65A 2Z24A 3F2BA 1EJVC 3S4TA 4G2DA 2QT3A 4YIWA 3S2JA 3IJ6A 2O4MA 4HK7A 4IQJA 4EPBC 3RYSA 4H9ZA 4DNMA 1QXLA 2R1LA 3DUGA 4KQNA 4PE8A 4IFRA 4LFYA 3NURA 2HPIA 1R9XA 4KEVA 3IV8A 1P1MA 4EPKA 3E74A 5FSDC 3URBA 1EF2A 1RJQA 4H9XA 4AC7C 1V51A 4C6NA 3GU1A 3S2MA 3ITCA 3MKVA 4CEUC 1POKA 1EJSC 3QY8A 3TN5A 1FWCC 3MPGA 4GZ7A 4R88A 3UR5A 4IH3A 1K1DA 3OJGA 1RA0A 1J6OA 4EPEC 3AU2A 1A5MC 4MUPA 1E9ZB 1K6WA 2FVKA 4H9UA 4E3TA 5HMDA 4XAZA 1O5RA 2ADAA 3OODA 4C6LA 2GOKA 3FDGA 4H9YA 2EG8A 4GY7A 1FKXA 3MSRA 5HMFA 1A5LC 1R9YA 3O7UA 1PB0A 2Z2BA 3QY7A 1PO9A 4F0RA 3GG7A 4LCSA 4GBDA 1EZ2A 4C60A 4GOAA 2Z7GA 2AQOA 1YMYA 1NDWA 3MTWA 3T81A 4D8LA 4C6FA 3EWDA 2Q01A 4XAGA 3DC8A 4NI8A 2WJFA 2OODA 3B0YA 4CNTA 4GX8A 2FFIA 4QS5A 3IARA 3MDWA 3GU9A 4HK6A 3HM7A 3CJPA 2PAJA 3NQBA 4L9XA 4BY3A 3TN3A 1V77A 3GTFA 3DCPA 4KEZA 2FVMA 2YB4A 5AKQA 2QPXA 4CQCA 4PCPA 1EJUC 2VC5A 3F2CA 4ERGA 1RK6A 1FWFC 3OOQA 1NDZA 1XRTA 1RAKA 1UIPA 4TQTA 2DVUA 2D2HA 2DVXA 1RJPA 4RDWA 1A4LA 4GC3A 4RDZA 3PAOA 1P6BA 2VUNA 2HBVA 3MVTA 2Z00A 4B3ZA 4HJWA 1ONWA 4XAYA 4F0SA 4J2MA 2Z29A 2FTWA 2RAGA 2Z28A 4C5YA 3IACA 1FWBC 4J5NA 2QS8A 1V7AA 2A3LA 2HNHA 4L6DA 2OQLA 4KEUA 4I6VA 3GTXA 3RHGA 1RJRA 3KM8A 3O0FA 3RCMA 1ZZMA 3GUWA 4G7EA 3QGKC 1RK5A 4QROA 3URNA 4CQDA 3ID7A 4EP8C 4C6JA 2UBPC 2GWGA 1O12A 2VM8A 2YZ5A 4KF1A 4I6KA 4C6DA 4CQBA 3NEHA 1FWHC 2BGNE 2DVTA 4GK8A 3OU8A 2PGRA 1HZYA 1JGMA 2ICSA 4XD3A 3GRIA 1J79A 1M68A 4WGXA 4B92A 4ICMA 1YBQA 4DO7A 2I9UA 2WJEA 3URAA 3MVIA 4J35A 1I0BA 1R9ZA 1QW7A 3GTIA 4LAMA 1YNYA 4C6BA 2AMXA 1NFGA 4DZIA 3URQA 1A5NC 1I0DA 3PNUA 2R1NA 1FWEC 4IGNA 3PNZA 4LCRA 3IGHX 2WM1A 3SFWA 3JZEA 4UB9A 4HK5A 2D2JA 3T1GA 3OVGA 3PBMA 1FWAC 3FDKA 2OOFA 2Q09A 3LGGA 2P50A 5HMEA 1EYWA 3K4WA 3G77A 4PCNA 4QSFA 5CH9A 4GYFA 4IG2A 2YXOA 4DI9A 2D2GA 4JOMA 3AUOA 3GIPA 4ERAA 4INFA 3V7PA 4DLMA 4C6IA 4GY1A 3WZ0E 2Z26A 4ERIA 3HPAA 4DZHA 2Y1HA 4QTGA 1PTAA 2YB1A 2P53A 3UF9A 4B90A 3E3HA 4LANA 4HA0A 2HPMA 1A5OC 4B91A 3IPWA 4LAOA 2GSEA 4XD6A 3K5XA 4V1XA 4ZSUA 2R1PA 2GWNA 3S2LA 3UBPC 4KESA 2HBXA 1S3TC 2UZ9A 4RZBA 1XRFA 4LEFA 2WJDA 1FWDC 3ISIX 3B0XA 3C86A 3ICJA 1A4MA 1WXZA 4CNUA 1EJRC 1J6PA 4WHBA 4H00A 4AQLA 1POJA 3TN4A 3B40A 1A5KC 4LAKA 4CNSA 3LNPA 3CS2A 4IFKB 4GY0A 2ZC1A 1WXYA 4H01A 4GX9A 4KIRA 3E38A 4DI8A 1UIOA 4H9VA 4R7WA 4NG3A 1DPMA 4RE0A 3TN6A 3LS9A 2PLMA 3E2VA 2EG7A
chains in the Genus database with same CATH superfamily
2O56A 4S3AA 1UOZA 2E1WA 3B0VC 4JCLA 3L4TA 4H6QA 1PS9A 3GW3A 1J0HA 5F2GA 4KETA 3BOLA 6A3HA 3OA5A 3CLMA 5K4ZA 1PZ2A 3VNMA 2IUZA 5I5RA 4LOCA 3KFTA 3BJTA 1U30A 5HATA 4B5SA 2XM1A 3HQOA 2PEVA 1R3VA 3F4DA 3CT7A 4R53A 5EY5A 4MPKA 2FLIA 3NDYA 3IJ7A 1FH7A 1TFVA 3A3WA 1Q6GA 4QNWA 2CKSA 4GJ1A 4FEZA 2AAAA 3W7CA 1XIGA 4LBSA 1XKYA 6REQB 1H62A 2Z0IA 2XIOA 2BVTA 2FTYA 1AL7A 3GG1A 3OZPA 4KRTA 2GZXA 4M1BA 2BGSA 1XLDA 1VLIA 2G37A 3M7SA 1HIZA 4ZQRA 1VFFA 2EPOA 3QV7A 4C6OA 4N0RA 5FEWA 4ZB0A 3P5ZA 3EWCA 1S1RA 3VCCA 3CO4A 2R9RA 3CEUA 3UESA 3GD6A 4LUIA 1KXQA 2I5GA 1TRDA 2HQAA 1TVNA 3AICA 1TV3A 3S6DA 3T8LA 1KTBA 1VFLA 4B4FA 4HHMA 1CEOA 4O1CA 3W86A 2G3JA 1QNSA 1FVPA 3LSBA 4QM1A 3EEGA 4AH7A 3FNDA 4FZIA 1WKYA 3C3UA 3FHQA 1X1OA 5A94A 5LNSA 4J3XA 3KP0A 3GNRA 4W5ZA 3KWXA 1GOMA 4L1GA 4X9SA 1PWLA 4PUDA 1RR2A 2P3ZA 5REQB 4YIWA 2OZ0A 4UR9A 3M64A 3RYSA 1W8SA 2RJGA 3M0MA 4LV9A 4PE8A 5LSMA 3NURA 2RKXA 3REQA 1C90A 4BCEA 2XVPA 5T91A 1K8XA 1THFD 4QX4A 3K8KA 1GQJA 2XN1A 2WCGA 3S2MA 4LYPA 1WCGA 4XWUA 2X0HA 4OUIA 4IH3A 2G41A 5BOEA 3GNOA 2P5NA 4PMNA 2XHYA 1UWIA 3AS1A 3MUZ1 1EYEA 3UP8A 1GOIA 3CZEA 4E4PA 1FKXA 2FFCA 3S1UA 5BRPA 3A21A 5M03A 2IW0A 3G0SA 4BQ2A 1JQXA 4AEEA 1LG1A 3IIPA 3VXGA 4X0NA 2GQ8A 1W1VA 2Z1KA 4OOZA 3T81A 3MYOA 3MUAA 2PFHA 3LPPA 1QNQA 3K1DA 3IARA 3U3HA 5JXQA 4QJ4B 3WNNA 1T5AA 3B8UA 2WNQA 1V77A 3DIPA 1HL8A 3WQCA 2WWCA 3QKZA 3NNTA 2FYMA 1BGAA 2FJUB 3ARSA 3JR2A 4HT3A 2A1YA 3NYDA 3RILA 5DO8A 4JDBA 3WEZA 2GJPA 4H8NA 4LUSB 1GYNA 4TQTA 1LWHA 2D2HA 4W7VA 4GCXA 5EFDA 4MSSA 4P8WA 4C1NA 5FEXA 2VEKA 4JKLA 4XISA 3PAOA 3VDCA 2VUNA 4EVZA 3RLGA 1SZNA 1W3JA 3LX9A 1RALA 4XAYA 1TV2A 1E6PA 4IXHA 2FTWA 2VDIA 4AG0A 1EGMA 3LPGA 3WK3A 4FB7A 4OV9A 3AZRA 2Z2UA 2OQLA 2YCEA 1GJPA 3A13A 4BK9A 4GVIA 4Z2HA 4NJHA 2WJZA 4IMAA 3GUWA 4EP8C 1KM2A 2GWGA 2RDUA 3MBFA 4G1KA 5IDZA 4IMCA 2ZXBA 3MKKA 4Q32A 3VX1A 4NRSA 3QTGA 2CZFA 3OU8A 3UJEA 3QPEA 4MJ4A 5K4XA 2OLAA 2ZTJA 1P5BA 1YW1A 4GH1A 3MUCA 5LA0A 2YDRA 1M68A 3AIBA 4MG4A 4HMDA 1EJ7L 3ITGA 1L2UA 3AIRA 5FEZA 2XUCA 4UTMA 1BWVA 2WJEA 1E4IA 1TWSA 1QR7A 3HPSA 1QW7A 1X7FA 3R8GA 1T0OA 4C6BA 2Y5SA 3WL0A 3T44A 4MKNA 3THQA 2PWHA 4QCFA 1I0DA 2PU0A 1FWSA 2W63A 2F84A 1RD6A 4XVDA 3T1GA 3PBMA 2ACQA 2QYGA 4MY8A 1A0EA 5HMEA 3S6OA 2NXIA 3ZQ9A 4YCPA 3VC6A 3IUIA 2J66A 1CXKA 2Q8ZA 1AW1A 3HMCA 4K3ZA 4Q8TA 1E40A 2QULA 4L65A 1O94A 3GDKA 1H49A 3QV8A 4O4WA 2EAWA 1PKNA 3E02A 3A5VA 4HA0A 4ZXOA 1BXBA 2C1GA 3KBNA 2GSEA 1XG4A 3VNLA 2WCAA 3PWAA 4MJMA 3UZXA 4CU7A 3BXWA 1Z6KA 4IL0A 5KZDA 2WVUA 1QO5A 3OBEA 5KTLA 4REQA 3T6CA 3W7JA 5LGZA 1EJRC 1JZ3A 3GUGA 3K8LA 3NXLA 4BF7A 2V5DA 3ABZA 2QGHA 1XIFA 1QW9A 4NJJA 3DFSA 1CGWA 1JRCA 4TR9A 3TR9A 1IR2A 4ZOEA 4B2DD 1T7LA 2VMFA 4YNGA 1UUQA 3ZSTA 4F79A 3EWZA 1XLEA 1HKKA 1UG6A 3LHZA 3W23A 3TTSA 4CD5A 2WKLA 1P7TA 2RGMA 2BY1A 3UWZA 5J5RA 5DFAA 4JL1A 3VNJA 1V0LA 3E0LA 4Q8NA 3UG3A 1B5TA 1XUZA 1J18A 4C6MA 3FS2A 1FKWA 3AOFA 1V4YA 2JK2A 3VILA 3GQYA 4CN4A 4ZSTA 1G94A 1OCNA 3BZGA 4AIBA 5CAHA 1ZP3A 2CBVA 3U4FA 4ZE4A 3BJFA 4NAFA 2A4AA 4QP0A 2EEXA 4MB5A 3KVKA 4S3BA 1T8XA 4P8VA 4PMZA 4A3UA 3LERA 2IMRA 5D09A 2ZRYA 4GQGA 3WYZA 3PSWA 1XLBA 4JFSA 3WLKX 2WBKA 4X60A 2DIJA 3MB9A 4JR5A 3TQVA 3GR7A 2DP3A 3GDLA 4XAFA 4QCEA 5CZSA 4C90A 4UQCA 2Z27A 4HYRA 2Z25A 1L6YA 3KCOA 1XDMA 4YS1A 3W2LA 1VFOA 3SSJA 2IPWA 1NVMA 2QEZA 3A3XA 4MZYA 2PI6A 1TA3A 4F2BA 1K9DA 5D04C 1GOKA 1XYBA 1AMKA 2OOGA 4WSJA 1YLVA 4HB7A 1GEHA 5H8PA 1AQHA 2Z2AA 2ZUWA 3N2TA 2YGYA 3BQ6A 1X6NA 1SSGA 3G3MA 4KFNA 4GXWA 1CDGA 3EPMA 1EPXA 2X8RA 1LUCA 3ZT5A 3BAJA 2OT0A 3CYVA 1XC4A 1TPUA 2F9RA 4L4PA 2OQYA 2JGYA 2WSRA 2WZIA 3JZUA 4LBUA 1YRRA 1BSLA 3WJSA 2XSBA 4ZTXA 1QUMA 1LOLA 1AFSA 4UNIA 2W79A 1PSCA 2BHYA 1BG4A 4KCWA 3W7KA 3ZR4A 3E0IA 1IEVA 3UD6A 1KTNA 1ZNNA 4L64A 3P61A 1JUEA 4GG9A 1DJYA 1XLGA 1R46A 4PTMA 3WSUA 2QT3A 4MY9A 3GLCA 1OB0A 3WBXA 4EPBC 4H9ZA 3T09A 3PULA 2OWWA 4FNTA 3NGFA 1PYFA 2XZ7A 2PDMA 5JBDA 2G3MA 1H7WA 2E5DA 4WDTA 4QE1A 1P1MA 3ZJ7A 2PP3A 2DZWA 3TNOA 1QPQA 3DI1A 4JN8A 3DOPA 1EHNA 3EPNA 3UR5A 3SI9A 4ATLA 3L0NA 2DZTA 4DBSA 5XIAA 1A5MC 3W1TA 1UR4A 1IQ8A 4ZQMA 3CNYA 1E9IA 1YE4A 1R38A 1IYXA 4ZR8A 4JGDA 1O5RA 3BOXA 2GOKA 1CI1A 1R5YA 2EG8A 5BXTA 4A6GA 5KMYA 5AB3A 1JPIA 3DHDA 1PPIA 2E5CA 2QLYA 3GXFA 4OTKA 4DB7A 4GBDA 1QNPA 3M0VA 1OIFA 4PMQA 4HOWA 3MTWA 3IS4A 2J8TA 2YCKX 4AY8A 3U4AA 3HF3A 4MIMA 3LI0A 1NTHA 4XKYB 2HK1A 3GXMA 3R6IA 2PPGA 1KCZA 3M41A 3PB2A 1E51A 4N9DA 3L5MA 1ME9A 1QK0A 1TYGA 4RXFA 3QMRA 1GYLA 1JRBA 4UUIA 2YW4A 3WH6A 2VC5A 4RZ6A 3H4WA 1BD0A 3NQFA 5D9NA 3OOQA 1VCFA 1AK5A 3QFWA 3W2UA 3M0KA 3NEVA 5DT7A 3KTXA 3NDZA 3OZYA 1TTQA 1PDZA 1UZHA 1BEUA 1XLJA 3NYZA 3RLVA 2JALA 1WV2A 2V2HA 1QOPA 3R11A 5DBTA 2C16A 5KZ6A 1W1TA 3TKFA 3G0XA 2XG9A 1WBHA 4J5NA 4NNAA 2WLZA 2QCGA 1JCJA 2OYLA 1HQTA 3KDNA 3VE7A 1RCQA 4FNQA 2OR2A 4HNTA 4E38A 4UOJA 2BTMA 3QGKC 1GVOA 5C54A 2A6LA 4CQDA 5A69A 1B3XA 1B57A 3M47A 4IHCA 1TPH1 3WQWA 2GSHA 4HN8A 1TTIA 2YCLA 3BL3A 2FZDA 2WMIB 2VZTA 1JGMA 4Z2JA 3QV6A 3H7VA 3N17A 2J78A 5L6UA 6REQA 2NVCA 2VWTA 1H1YA 5FF4A 1JGIA 4Y6GA 4HJFA 5LYRA 1R6WA 1DJHA 1I0BA 4LVAA 3PB0A 2V5BA 1I2RA 2AMXA 2ZWYA 1ZAIA 1SQ7A 1GNXA 2JKEA 4IT1A 3HIJA 3E2QA 4YXGA 1GZ1A 2Z1WA 3MZNA 5CSUA 3S1WA 1OX5A 3FDKA 3LEPA 3N1AA 2EPNA 3IJDA 4QSFA 4ML9A 4WEVX 3MMTA 2GGHA 3SJ3A 1HJUA 2VFIA 1UD2A 1VYRA 3W2MA 1JYXA 1H0GA 3S5ZA 4XZHA 3MCNA 3FGCB 4BQ3A 3IPWA 1LRQA 3PF3A 4R9XA 1LRTA 3B9EA 2R82A 5E70A 1Q7ZA 4RZBA 1ODUA 1I2OA 1HJVA 3ISIX 4A3YA 4UNLA 1NM9A 3AMDA 3ME3A 1KFJA 5IHRA 3GR8A 4NX0A 2J25A 2W61A 5F4SA 2Y0FA 5CKSA 2GLKA 2IQDA 4IFKB 3QSRA 2FDSA 3PPHA 1UHVA 1MW0A 5I3FA 3P0WA 6XIMA 3PJTA 4O17A 1TIMA 1VF8A 3EKZA 2YDQA 2CBJA 3WFZA 4E2DA 3QN3A 2OX4A 3R12A 3N4EA 1CTNA 1QNOA 1W1IE 1AQ0A 1W1A1 1UC5A 5FKYA 4LSBA 3TJXA 1VBGA 3GBDA 5J8LA 4F0LA 3AALA 1VFUA 1NDVA 1KBJA 3STGA 4WKAA 1YE6A 3FIGA 4QS6A 3W70A 5EL1A 1Y65A 5FSEC 3CAKA 1H5VA 4FF5A 1WZKA 3M43A 2VEPA 3LBCA 2OEMA 1LT7A 5F1UA 1EUNA 3FAXA 3ARQA 5DY2A 4HYVA 4ZEPA 4HOZA 4JDYA 2GJXB 3WQFA 2BB0A 1TMHA 4M80A 1ECQA 3FJ4A 3N6QA 1ZLPA 2ZZ5A 1UKPA 4IOTA 3GHRA 4HU4A 3H2OA 2X1TA 2J6XA 5HANA 4LJ3A 4XD4A 4H4IA 4GA8A 1XSJA 3W00A 1JF6A 2QKFA 2ZUVA 1QO2A 5AYZA 2E25A 3KUMA 1OD0A 1FQ0A 2GUBA 3BDKA 2PP0A 3G18A 4AMAA 3FVDA 5CBJA 5C8BB 1M7OA 4WDWA 2MANA 1B30A 2OGJA 1H63A 5K3VA 1XM3A 1SZEA 5D4YA 3CUIA 3ELFA 4RV8A 4D72A 3TJIA 2Y6ZA 1OINA 4O13A 2F6KA 2ZRXA 3BCJA 3HGRA 3OGVA 1GQLA 3N2XA 1TUFA 2Z24A 4GIEA 3LCLA 1UPPA 1P0EA 5TQLA 4G2DA 3WDHA 2P8CA 2Y2WA 5IM51 4F2UA 3A3HA 1QJWA 1SJDA 5GNZA 1LP6A 1Q8AA 3E74A 3P8IA 4DN1A 1EF2A 3WF3A 3VIKA 3O6CA 4F3HA 3WQEA 5MHBA 4JFTA 3HG3A 2LLEA 1ZJAA 4NZ3A 2ZFAA 3ARPA 4R27A 4BHYA 4KFPA 1SMAA 4GUGA 3RGTA 2EXOA 4DXVA 4EXBA 1W0MA 5AC4A 3FDGA 4N9BA 1FP9A 2HE5A 2D0HA 2HJPA 1L0PA 1XLIA 1M7XA 5MF5A 2QAFA 2OX1A 4JIIX 4ROQA 2REQA 4GOAA 2ZZ3A 3VNKA 5EBAA 3DFNA 2TYSA 1TPDA 1V08A 4W7WA 4O4VA 3VOFA 1PTGA 1GCYA 3QQ1A 3GR4A 3GU9A 4UZUA 4LYQA 3Q37A 4NUWA 1H1ZA 4JAWA 1Z89A 4HNCA 1TRIA 4HKPA 1L6GA 3DGBA 1NWTA 4GVHA 3GHTA 3T2PA 4QXIA 5A95A 2ZUNA 1KQZA 3IK4A 4ICCX 3W6YA 1UA7A 3WD3A 2J24A 4N7QA 5GNXA 1AODA 4DRSA 2B0MA 2Y62A 3Q67A 3FLUA 4GYPC 1XH2A 1OX4B 5HINA 1KWGA 4C1LA 1HTIA 4JIQA 3AZTA 2B81A 2JFEX 3DU0A 4X0VA 3YPIA 1TPVA 2VDHA 1XBVA 1E1CB 1N82A 1QNRA 3STPA 4Q4QA 2JIWA 4HSOA 2PD9A 4HMNA 1CGXA 3TLQA 4UMBA 2DFAA 4MTVA 1GVIA 4L9ZA 1ICQA 2HS6A 3LQLA 1G0CA 4TV6A 3O8AA 3AISA 2ISFA 4BFAA 5C2GA 3C56A 3KTSA 3QEZA 4DWSB 1IV8A 1YYAA 3TX9A 5BZAA 2VJXA 1FX6A 3H2AA 4B92A 2DUAA 3WX7A 1PIGA 2BLEA 4FOJA 2I9UA 4ZOCA 2YYUA 4UC5A 3WN6A 3H22A 2ZRVA 3O1NA 1O60A 1KFWA 2B4GA 3URQA 3CYJA 1HJWA 1HT6A 1US3A 1JZ8A 2R8WA 3FXGA 3UY7A 3PPGA 2C8NA 3OVGA 1TUXA 3ZIZA 5LGXA 1IXNA 2OEKA 4L80A 4Q8QA 2CWNA 3LM3A 5U4NA 1VAHA 1PWMA 3L4WA 2OEJA 4Z0SA 4DZHA 4JY9A 4BQ4A 2YB1A 1R2TA 2DZBA 3PZIA 2ON3A 4OBTA 1LQ0A 3K1GA 4DJDA 3TEVA 2INZA 3GY1A 3DESA 3UR8A 1LQ2A 3HBLA 1TREA 1TWDA 4I9JA 3SQMA 2VELA 3AYRA 2WW5A 5LIXX 2HBXA 3LQGA 4MYAA 3APYA 5EU9A 1DXEA 1POJA 1CECA 1GW1A 1WAUA 3VNZA 4H2HA 1W1YA 1W17A 5G4WA 5K9XA 3A5FA 1WO2A 4KIRA 2BZNA 2QV4A 1I9CB 1I45A 3GAYA 1AL8A 3VDBA 1YQ2A 3RN6A 4DO4A 2ESCA 2E40A 2GUUA 2XVKA 2QCLA 4GI6A 3BW4A 3GS6A 4CKQA 1XLKA 3WMLA 3KVJA 2WZTA 4DZAA 4K38A 5MKGA 2W9MA 2VURA 1C29A 1S39A 3F4WA 3C2YA 1VGAA 3TYCA 2EPLX 1XFCA 4MNLA 2J79A 1F74A 4XKYA 4LALA 1XX1A 3NVDA 3GC5A 2C1IA 3SDOA 1JAKA 2A3BA 2XVGA 3HG2A 3KS5A 4WZHA 5H91A 3GE7A 3HPXA 2PC8A 4FOKA 1AA1B 2VWSA 1V6XA 4V28A 3L0KA 4D6HA 5ABHA 2YA2A 4FOUA 3OVRA 4WY0F 3PBGA 4PC8A 4E6MA 1A3WA 2CHRA 3TYEA 3PUEA 2P3EA 3W1PA 3AXMA 1GQIA 1PV8A 4GNKB 2VR2A 4JTAA 1VZWA 4E4UA 3AIVA 4I8DA 2AAMA 1P6WA 2IS7A 1DTNA 3HQ1A 3C2OA 3F5JA 3BPWA 4IIBA 3M1ZA 3WNOA 1KRAC 4I5UA 3SGGA 4K37A 3UFYA 4MGGA 4GPNA 2ZX8A 1ZBCA 3B8DA 1YHTA 3FY1A 3TXZA 3H55A 1W56A 4WF7A 1A3HA 1QI4A 3KVLA 4HN4A 3BLDA 2EO7A 3UJFA 3EYPA 4IQEA 4IIHA 4X3ZA 4KBXA 2F2HA 2EG6A 5H2ZA 5HJYA 3NSNA 1TG7A 3AQUA 1HP5A 3DYMA 3VA8A 3P5YA 1ME8A 4EAMA 3H2CA 1SGJA 1W1ZA 1W91A 2GSJA 5E0CA 1UYQA 2QDDA 5AHMA 2XGBA 4KWSA 3N04A 4P2VA 5EB8A 1SJBA 4CCEA 3S2JA 4M5PA 4A21A 3UWUA 2PF8A 1W9XA 4JIHA 2G97A 4WD0A 2XN2A 1RP8A 4ZO7A 4OZOA 3SUUA 3ITCA 1EQCA 4QLJA 1SU5A 3TN5A 1FWRA 3CZJA 1LQAA 1UUOA 1V7YA 3OJGA 3R4IA 1RA0A 3AHVA 3QHMA 1JXJA 1VEOA 2PRMA 1JCMP 1BQCA 1XYAA 2ZBTA 1M3UA 3LZ5A 3BLFA 1HKWA 5E9AA 5IHSA 1Z3NA 3NM1A 2X7VA 1XLMA 1W1PA 4YTRA 1NU5A 1PB0A 1SO5A 1PO9A 3WNMA 2BP1A 3FGCA 3CQKA 4QHRA 2AQOA 4HQVA 1HG3A 3CMFA 3NQGA 4WIWA 4NI8A 1IT8A 3ZJKA 2HE8A 1LZOA 4DO5A 1JQVA 4HK6A 1V0NA 1Q85A 3HM7A 5GJPA 3UZZA 1VCGA 3HOJA 4BWLC 3ES8A 1Q6CA 1B1YA 1S1PA 1S2WA 1PCWA 1SR0A 4PCPA 1EJUC 2QDEA 1RK6A 4OUEA 2VOMA 3S5SA 4DAIA 5BXRA 3LMZA 2E4TA 3QGVA 4DJED 4RDWA 1GTHA 1BVWA 4FPSA 3GDRA 3L5LA 3BG5A 3I7RA 1XBZA 3TTEA 4QDPA 2VC6A 1BPLB 1JCYA 4XZIA 2FZMA 1ONWA 2ZUSA 1K9FA 4GMEA 4DEFA 3WO8A 2E1DA 3H21A 4YWSA 1MEHA 3G3DA 4K8GA 3MYPA 1G9HA 3VKAA 1NP0A 2TSYA 3NA8A 4JFWA 3O0FA 5FF7A 3C52A 2OSXA 4UQDA 5HNTA 1OJXA 4O1AA 3S42A 5K9DA 2IQ0A 3WUEA 1F8IA 2YZ5A 2XVNA 1OYBA 3HPFA 2HMCA 4LS2A 3RDKA 1EXPA 4DJEC 2PWFA 4HPJA 1VPQA 3QHNA 4GACA 2X41A 2OKTA 2PGRA 7CGTA 1U2YA 2WVVA 1NFPA 3PG8A 2GJXA 2DT0A 4ICMA 4FIQA 2DW6A 4UR8A 5CXPA 3N3TA 3CV6A 4J35A 2PRHA 2CETA 3VPLA 4AZBA 4F9DA 3VKBA 4DYEA 3NQCA 3FA5A 2E6FA 2DY3A 4QBXA 2FGLA 1UWAA 5JVLA 3JZEA 4Z0JA 3MUXA 2OOFA 3G6MA 2Q09A 1RCOB 2VGFA 4TTUA 2CW6A 1XLAA 2OPJA 5DXYA 3K4WA 4QJ3B 1LOSA 2YXOA 3TFXA 2KZHA 1WDRA 4US5D 3S5OA 4Y7EA 5AHNA 3BH4A 1GG1A 4RE4A 1A0CA 2VEMA 1SFJA 2CLHA 5EMLA 5CPLA 1GPFA 1XLCA 4CQ9A 3R0KA 1MNZA 2QW5A 3W7NA 3BVJA 3N9RA 3S2LA 4AVNA 4F0MA 2XSXA 1SO3A 3P80A 3OZMA 5DF0A 2QCDB 3RCYA 5D33A 5E9XA 3EWXA 2O7QA 5CJ5A 3RRAA 1QDSA 2QDGA 2X16A 3WQGA 5CBBA 4QNEA 4JNMA 3O15A 1MFUA 2WHJA 4J40A 1ZBWA 3T7VA 1RQHA 3O6AA 1DPMA 3BAWA 3MY9A 2VX5A 2X1RA 3G5EA 1F3TA 1XI3A 3TN6A 1W9PA 1DIKA 3T40A 3ZVIA 4I5RA 4KERA 1W3IA 1FXQA 2Y7DA 3QC3A 4OGZA 1IWBA 1W32A 3QLLA 3R0DA 1E1FA 1TQXA 3XINA 2GDUA 4C6PA 1DVJA 1WOBA 4MNKA 3GKFA 2PWUA 3V5CA 1AMYA 4H9MA 2V3GA 2FPYA 1NY1A 5EBUA 1GKRA 1B31A 3UWEA 2W67A 4FNRA 4GD0A 2PDWA 1W5PA 3WQ5A 1TPFA 4X2RA 3H8AA 1PIFA 4FI4A 5DBUA 2OCZA 3UWVA 1UWTA 5F1VA 4DF0A 4UBPC 3TW6A 8CGTA 1SJCA 3RX2A 3C2FA 2GOUA 3RRXA 2J7GA 4FHAA 3M5VA 1XIMA 4AD0A 3IRDA 4UQEA 3VNDA 1TZ7A 3F2DA 8XIAA 3W38A 2O4QA 1XWYA 4JL2A 1BHGA 4CNPA 3CZ8A 3UGVA 1OX4A 2Z4GA 2XDFA 1E6QM 5G2HA 3EDJA 4XZMX 4M0XA 3KVMA 3OPSA 1HJQA 3FSUA 4K1GA 4K8HA 2KAUC 4J3VA 4EACA 4AYSA 3MUIA 4GRSA 3UGRA 3QRHA 1O68A 2C79A 1XLLA 2G8ZA 4FXFA 1OFOA 3K46A 3WLTA 2QIIA 4KGJA 3UZJA 1B2YA 4V1YA 3R89A 3UZ5A 4Z1BA 2QMKA 3KRZA 4S3GA 1F8MA 2CLIA 3W72A 4FXRA 1K7XA 1FDYA 1YDNA 2RFGA 2NQ5A 1RD5A 3E2SA 2YL5A 3TTYA 4RDYA 3B05A 4IGMA 1AJ2A 4HHLA 5G4HC 1O4UA 3WQVA 1VS1A 3T8QA 3E0WA 2FDMA 2YX0A 3ZVHB 4DWSA 3MKCA 4FX8A 3QHOA 5KEZA 1Q6QA 3S4TA 1GVYA 5EMJA 4IISA 3RXZA 3DFHA 3AMKA 5F7UA 5E93A 3DI0A 1SO6A 3CHVA 4MWAE 1U1UA 3L2IA 2HPIA 3AXXA 3F4NA 3IV8A 3KDOA 3UNTA 1Z7AA 4O11A 3MT1A 4IUOA 2J27A 2BFGA 1S3HA 2BOGX 3W85A 1UMYA 5JIWA 3PZGA 2DT2A 5TAOA 3S9YA 2A3AA 2DT1A 4LNCA 5FAGA 3T08A 2ACRA 1WA3A 1R3WA 2FVKA 4K7YA 4NNBA 3HFYA 1XG3A 3A6OA 1O5QA 5SWUA 4JFVA 2YDAA 3VNIA 1XCWA 1UWQA 2VYOA 1JR1A 1YNPA 4AU0A 1FRBA 2HK0A 1TTPA 2WYSA 1YMYA 1NDWA 2H3BA 3FW6A 3EWDA 1BXCA 1T8QA 4XAGA 1I1WA 4JTGA 2QJNA 2PTYA 1KFEA 1J01A 2FFIA 3FKRA 1BLIA 1D7FA 3M0LA 2JKAA 1RLDA 1ZQ5A 3IAQA 4CN1A 4JICA 4MAVA 4GNVA 3TN3A 3GTFA 3SCOA 3GG8A 2INFA 4KEZA 1O7AA 4DQWA 4B5XA 3WQ6A 3O6YX 2QJMA 2CC0A 2UWFA 4QFUA 1TV8A 3STFA 1KM5A 3W1RA 3M0IA 3S9IA 5LA2A 5ABFA 1O5XA 2Y8VA 4Z2IA 4DHGA 3VKDA 1HKMA 3CTTA 2E9LA 4NJKA 1P6BA 4L4OA 3ZFHA 1IXPA 3R25A 3MZ2A 4QJ5B 2ZVRA 3ANYA 4EF9A 2QS8A 4QAIA 1ZHAA 2CWXA 4QLKA 1Q6FA 2X1UA 3U7VA 4M29A 4PL1A 7REQB 4AVFA 2ZRUA 2HWGA 2C71A 2Y8UA 5CZJA 2TRSA 4W8BA 1CCWB 3NZRA 4NYUA 3CUHA 4AXNA 4D9PA 5I3GA 1RCXB 2O9PA 4DJFA 4RR4A 4AEFA 1OBAA 4AD5A 4IMDA 1KGUA 1XUUA 1CGUA 2EHHA 3L65A 5BOOA 3WH9A 4PYSA 2ZX7A 1FHLA 2BGNE 2Z1XA 2P1FA 2VXNA 2POZA 4KPLA 3GM8A 3BCDA 2ATSA 3QZAA 3E1F1 2VX7A 5A5WA 4AZ7A 4J27A 3WBWA 1V8EA 1KA9F 3BAYA 1VBHA 2DJLA 1K02A 3GTIA 4Q8WA 1JIBA 1CLKA 4WJXA 1XV8A 1BYBA 4D6DA 1G1YA 4JTEA 1NFGA 4ZB2A 3DC0A 5AOUA 1TCDA 3NPVA 4LCRA 3NG3A 2G3IA 4LT9A 4O15A 4ZO8A 4HK5A 5E1QA 1M1BA 2Y89A 4PFMA 4JTUA 5KZMA 4IJRA 5CG0A 2J9ZA 5CH9A 3W6LA 1J12A 4B5NA 3P14A 3NM3A 3U6WA 2FH6A 3NSMA 2PF0A 4EXAA 1HFBA 4B2DA 3S5YA 1FBAA 5A6AA 2OLHA 1X8FA 4JTIA 3W2NA 1YXCA 3TROA 1H11A 5HXMA 4OWGA 3WF1A 3LBMA 3UJ2A 2Y7EA 4C1KA 4IM4A 4PUEA 2ISDA 3SJNA 3L2LA 3UG4A 3V16A 4MNJA 3RPDA 1WBJA 4UR7A 4RPPA 5G1MA 1UA3A 2PRLA 8A3HA 4WXZA 1WAWA 4OU1A 4PMRA 1FWDC 3IVUA 3WQPA 1KBIA 4AQLA 5E0KA 3SCTA 1B9ZA 4FLOA 4RL3A 2DW7A 2AKZA 4CNSA 4UQ9A 4CD8A 4UTTA 1UOKA 4AHPA 5FJJA 4ZENA 4H9VA 1VHCA 1XYCA 3M6YA 1KGWA 2Z7KA 3CASA 1AW2A 1FY6A 1PYMA 3N6JA 1GHSA 4A3QA 1TR9A 4U3CA 2P8BA 2CZEA 3GXDA 3TMLA 3V1HA 2FVLA 3ANVA 3LA4A 4N6EA 4YYFA 2A21A 5CJMA 2VP8A 4UFIA 2YKKA 4CQAA 4MM1A 4F4RA 1XD1A 4GIYA 3MI6A 3VOJA 4CEXC 1ISWA 1UKTA 2EF9A 4XG1A 3UU0A 4U2YA 4DYKA 5HQLA 4RDVA 1S5TA 1TMLA 3OYXA 4ZOBA 4GIRA 4UMAA 3IIOA 2E68A 3NUKA 3QW3A 5A6BD 1VD6A 1F61A 2TODA 1GVEA 4AAJA 3IK2A 1DEDA 2FGZA 2O9OA 2BV9A 1ZU8A 4C6QA 3L9CA 3IGUA 3RITA 1LBMA 3CHCA 3TV8A 4W5UA 5CC5A 4LY8A 1E0TA 3TAOA 4NNCA 3LGEA 3CB3A 5I09A 3PTKA 1W9DM 1PZ3A 1NDYA 1NQ6A 2VRQA 3WDIA 5KITA 3S9ZA 2WSYA 3TONA 1KO0A 5FF2A 1UBSA 2J62A 5H8MA 4RJEA 4FA3A 5CPQA 3LUTA 3IUHA 1N8WA 4KFOA 3ZLFA 3GAKA 1GVRA 1UD4A 4LCQA 1UMLA 5D2TA 1ENUA 3D47A 1GQKA 4WR3A 3VUPA 2JQXA 3ITYA 2ZZ2A 4WX2A 5BCAA 1J0YA 3EMZA 3LB0A 2BHZA 2B31A 2QPSA 1UR8A 4ML4A 4HNUA 1SPQA 3IJ6A 1NEYA 2H6RA 3W7HA 1QPKA 2PB1A 3T55A 3QR1A 3EWUA 3HU7A 4LFYA 1KFBA 4Q33A 5LIWX 1A5BA 2VFGA 4KH2A 1OZQA 4MAZA 1ZGDA 4H8HA 4H9XA 2F61A 2CLPA 1S5VA 4FLQA 3CMGA 1FWNA 4PMDA 2PDYA 3ONBA 4AF0A 2MUCA 2CPUA 2D20A 2H9AB 4EAYA 1EC9A 3KEHA 1TMQA 3PC0A 4PGLA 1Q63A 2E9MA 4C6LA 2XU2A 1H0IA 1IGSA 5A2BA 2HXUA 1XGZA 3HGSA 3RU8X 5GPRA 3ARUA 3UXKA 3BQ5A 2Z1VA 4JQ4A 1Z8AA 3E5BA 3ZM8A 1CENA 3DHFA 5AYXA 3GDMA 1ECEA 4Z1AA 5FCZA 3NL6A 2AL1A 3K13A 1F3EA 4WRHA 2QCDA 2XIIA 2PC4A 1HP4A 4S39A 1IF2A 2V82A 4C7GA 1R0MA 4L9XA 5HWNA 1QAPA 4IX2A 5AZ0A 3FOKA 2NXHA 2QDHA 5AKQA 2JKPA 4CQCA 5IBXC 4HZ6A 2YL9A 4ZFCA 1QMLA 4ERGA 3RPTA 2V3DA 1UP3A 2DVUA 2DVXA 2ZXQA 5IXEA 3MANA 3TYDA 4PTNA 4DPPA 3WFAA 3MVTA 3UXLA 5DX7A 1ZCOA 2HSAA 3WF0A 4A29A 3GZ3A 4R9OA 1W3KA 3SW6A 3GKAA 4PTVA 7TIMA 2WQDA 2XPKA 2HNHA 1MI3A 4YPJA 4RX0A 4AZ6A 1L9WA 4I7UA 1BG9A 2PDLA 1C9DA 3WBEA 1JUKA 5FA5A 3ID7A 4C6JA 5DMYA 3W87A 4UCFA 2G5WA 3ALGA 4ZB5A 1B4KA 2J4GA 4FSAA 3RG6A 5I00A 3C61A 3I10A 2DDXA 3ARWA 4IUGA 3NEHA 5LNRA 3HG4A 2WCSA 3SRDA 1GK8A 3GHSA 2GVGA 2PP1A 1I4NA 5LKYA 1EP2A 5E6ZA 4H2CA 1FOBA 3AIWA 4M19A 1JUBA 1YTKA 3O9NA 1MXSA 4PRRA 3NJ3A 1RPXA 4JKMA 3WK1A 2OWXA 2V67A 1UR9A 4JYDA 1FCVA 4DO7A 2KX9A 4U5IA 4DNHA 3URAA 3QR3A 5DRIA 1UH3A 3CWHA 1DJQA 4R7JA 3BG3A 2BBFA 1LLWA 3HQNA 5EMYA 3WD1A 3W7OA 3ITOA 3T2OA 4MWAC 3M07A 3CTLA 2WM1A 1LYXA 2XIQA 5LIKX 3OQ8A 1OABA 3KS6A 4GZIA 1FH8A 2O0TA 1F76A 3DEQA 3LGGA 1GZGA 1OEPA 1R3TA 4DI9A 4DWDA 3LDVA 1UKQA 2XVLA 2G50A 4DAFA 3E96A 4ERIA 3MBDA 2GFTA 2P53A 2PDBA 3FFSA 1XSIA 4ZVJA 3V4BA 5GNYA 3W9ZA 3ITXA 5C71A 4PN2A 1EKOA 4JY8A 4V1XA 4JTQA 1J4EA 1M03A 1ZSXA 3TU9A 3AYTA 2UZ9A 4O1FA 2VENA 1EOKA 3B4UA 3FA3A 3ICJA 5F4XA 1W1B1 1PE1A 2Y70A 3ITTA 2YFOA 3ZSSA 1IIGA 4S3KA 4KCUA 3LNPA 4F40A 1UUMA 2NWSA 3VNYA 4GY0A 3UW6A 2F7FA 3WENA 2E7FA 1CIUA 4QG6A 1V6YA 3DZ1A 5EA9A 1PJ9A 2J7HA 4HTBA 1J9YA 4NG3A 1NSJA 4IMFA 1UR2A 4Y8FA 2VEFA 3WH8A 3F1QA 2D73A 4GH3A 2WMGA 4PMOA 1SO4A 1VFHA 2V0TA 3IVSA 4B15A 1O1HA 4AD1A 1Y5WA 1GT8A 4IIDA 4O0ZA 3H54A 3EGJA 3BV7A 1T6MA 6TIMA 2V30A 1OFRA 3B8IA 5CJNA 2GQ9A 4ILSA 2R24A 2FHCA 1IE7C 1WUEA 4QE5A 3L23A 4O28A 1DE5A 4NZCA 1OY0A 3MU7A 1B9BA 1UD8A 3G6LA 4NZ5A 3VIOA 3BCFA 4Q8OA 4GISA 2X1SA 2FKPA 3SCWA 2WVTA 3ARRA 3CV7A 3LMYA 1MZRA 1EWEA 1Q2RA 4M51A 3B9DA 1MVYA 3WQ8A 2ZDSA 3G8RA 3GYEA 1KW1A 3SR7A 5FL0A 5HJLA 2NVAA 5ABGA 1XIHA 1KWKA 3C2RA 4M7TA 1I2PA 3WLSA 3B9AA 3EOOA 3TDFA 5A6TC 3LN3A 1OIMA 1Q6RA 3OP2A 1EIXA 1V6WA 4UWMA 1RHCA 3MWAA 5G1TA 7REQA 2R94A 1P48A 1Q2SA 4KGLA 1XIJA 2PDJA 4UTHA 1TZ9A 5CG7A 1S5NA 1V3HA 2DZAA 3BUVA 3DX5A 3PTQA 3QSTA 4J9JA 1J2WA 2FZBA 3R1ZA 5G2WA 3BE7A 1ADDA 3ABSA 3C2VA 4HHPA 1QCWA 2Q3RA 2GVYA 4Q4OA 3TSMA 1UW9A 5D32A 3UT0A 3QV9A 1L8NA 1V6UA 3HJZA 1GVSA 3GB6A 3BLPX 3NL3A 1PXGA 3OGRA 4E8DA 2VCAA 4GYPA 3TIMA 1FH9A 3SCPA 2FB3A 1KXVA 3GW0A 4JYEA 2EQDA 3WF4A 3BLKA 5T26A 5LNVA 3TH6A 5XINA 3K4DA 2O92A 3F7JA 3BLEA 4PUWA 2I7GA 1HJSA 4D8AA 2E6AA 1ITXA 2ONEA 2X1IA 3NO5A 4NKCA 2VR5A 1LTDA 4GWEA 1J6OA 2QMJA 4LC6A 4MUPA 4AY7A 1T40A 1NQKA 4JN6A 1ZFJA 3DG3A 5DMLA 5AHLA 3KHJA 1GORA 4H9YA 3W82A 5LNWA 2CITA 3M9YA 1RVGA 2WVSA 1HO1A 1F6KA 5D05A 3QY7A 3N9SA 4DBEA 1PKLA 4JS3A 1CT5A 2AL2B 1TKKA 3SUWA 2HNEA 1JD9A 4B5TA 4XTDA 3ABQA 1TPB1 5DCBA 3B0YA 1DJNA 3M6DA 3BSHA 4NX5A 1JAEA 1M41A 1DYSA 1VEMA 3I68A 1CGTA 5A6LA 3OG2A 6TAAA 3AZSA 3WD0A 3W4RA 1H60A 4BA0A 4BY3A 3VD7A 2PDCA 2Q3OA 3QOMA 1Q65A 1WQ5A 1GHRA 1SSDA 3TZNA 2YB4A 1OX6A 4F66A 1EFZA 5I3JA 3QF0A 5I0DA 4GE8A 2J74A 2I14A 5JBFA 3IJLA 3W76A 1A4LA 4RDZA 4JQ2A 5AVNA 2HVMA 3SY8A 4AWUA 4HOXA 3BV4A 4IPIA 1FA2A 2D1ZA 3RCNA 3VOHA 2VCCA 3EX3A 1UH4A 4NAEA 5CLTA 1AG1O 1ZAJA 2CXGA 1EP3A 3UJSA 3TJLA 3XISA 5C7VA 1U1HA 1YPIA 1F4HA 1ZZMA 4QGCA 1TJ2A 2BASA 4NZFA 3URNA 2BG5A 5JMUA 4Q4KA 3H6OA 4AX6A 1C8QA 2W5FA 2BHUA 2CLFA 2ABAA 3OLDA 7TAAA 3CAWA 4E3VA 2WNZA 3LRMA 1FWHC 4PULA 3DFTA 2E67A 4XZWA 4O12A 3PTMA 2C91A 1QATA 4JQ3A 1HNYA 4A4AA 1QNVA 4HMCA 3TC3A 4IPPA 1G6CA 3CUGA 3V0TA 4JTFA 2NQJA 2XH2A 2QUNA 4IIEA 3MVIA 4H7CA 4O57A 3UVAA 1UJQA 3EOUA 4LAMA 4XO6A 2FZNA 1UP0A 2V5JA 4Y9PA 4DZIA 5C9WA 2B7NA 3AYSA 2OG9A 4JTCA 1GJWA 2V3FA 3VUSA 4G56A 3W1MA 1VPYA 4GYKA 3OIHA 4AVOA 3SFWA 1H7XA 2ALRA 3MUY1 3AXHA 4UB9A 1UASA 2PTXA 4F2TA 1JZ6A 3KBWA 5XIMA 2DEPA 1EYWA 1OSEA 1TPC1 4UFKA 2A7NA 1QOQA 3GHUA 4AISA 5CC3A 1F05A 1OG6A 4U3AA 2ACSA 6ENLA 1ZTVA 3IV3A 5DCEA 2ZCGA 3MSYA 3HPAA 1IWAA 3H4XA 3WDQA 1DQUA 1OWQA 4LW7A 4QAWA 2WC3A 3SIMA 3BLOA 1A5OC 2YSWA 4XUGA 2VZOA 4AZGA 2ZA1A 5HMSA 3W74A 5CAKA 3PWGA 1ZBVA 1IXOA 5CPTA 2WJDA 4AIOA 3DFYA 4HYWA 2QJIA 2DSKA 2C0HA 3GBEA 1A4MA 1B90A 2ZUTA 5DT5A 2DPEA 2VCBA 1E70M 4CNOA 3VTRA 3SUVA 4HIBA 3G1VA 3ZYZA 2BGQA 3WJXA 3FYPA 1BWKA 4YMZA 2EPHA 3NO3A 5K2ZA 1YKWA 3W2KA 4UTWA 1XGDA 2H9AA 3U2CA 4ECLA 3W7IA 5TF0A 1QBAA 3B3DA 2PDNA 5A6KA 3P6LA 1KBKA 4ALDA 1X98A 1W54A 3EOSA 3VD9A 3NCOA 3QY6A 4HU8A 2IPGA 3HB9A 5D02A 4QQUA 1XW8A 2RDTA 4UXDA 3GC4A 1FWGC 1MZHA 3VM7A 4L56A 3TLLA 4WCJA 2OJPA 4IJBA 4AMCA 3O6DA 2V8ZA 5I7GA 3KP1A 1KRCC 2J7CA 2AOSA 2Y7FA 3W7RA 3WBAA 3W7GA 2GUYA 3JUGA 3QC0A 2AQWA 1JZ4A 4DF1A 4ASTA 4MADA 4AZHA 1H41A 4CVWA 1IZCA 3ZZ1A 3KCJA 4HNOA 2XH7A 4OJYA 3IAPA 1WKEA 3KBMA 3THDA 2WMHA 1HKVA 1E9LA 1YEYA 2WOQA 2YL8A 1TSIA 3VABA 1D2KA 2QCHA 1XKJA 1I60A 1QW8A 4AD3A 1E4MM 2J7FA 2NSOA 2QPUA 3LPFA 4ZO9A 1O1ZA 1MSSA 5CCZA 2GJLA 1GG0A 3DKLA 5HUOA 1M5WA 1WPCA 3RU6A 2I16A 3ABRA 4C6EA 1XINA 4B9ZA 4NILA 3KRBA 3O05A 7PTDA 1FWIC 3PUDA 4PZVA 1EJWC 3W1LA 4W93A 4NQ1A 2OELA 1EJTC 2J6VA 1ODZA 2WLYA 2NV9A 3GNXA 1SFSA 4IMEA 4S3DA 2IKJA 1TELA 2WC7A 1P6CA 4UOZA 3CB8A 2DV0A 5AZ1A 1GVFA 1JJKA 1FHVA 3MI3A 3SURA 3WFLA 1OK6A 3NZPA 3PVFA 4GUJA 3CQIA 2PMQA 3BG9A 4Y9NA 4RW5A 3URBA 1RJQA 1JD7A 4DM1A 4Y96A 5C9RA 3P7YA 3P93A 1DWFM 4AXKA 3TOYA 2X2GA 4R88A 2X7WA 3CUJA 4XX6A 4W89A 2CZ5A 1AZ1A 4RK8A 2XINA 3AROA 3CQJA 4HA4A 4H9UA 1X6UA 3OHMB 3ZXWA 3N11A 5M1TA 3GDBA 2ADAA 3SN1A 5DQPA 4GKLA 2GQ3A 3PM6A 1TJ0A 2DUZA 2YCIX 4IP4A 2V9DA 3OIXA 4KWWA 2WZEA 4YHGA 1S5WA 2C18A 5A8MA 4S3EA 1G4EA 3LYEA 2NQZA 5H8UA 2V81A 2Z2BA 4MFEA 3VKKA 1MO0A 3T4CA 1LWIA 2Z7GA 3ONCA 3MMUA 1XLFA 3W6MA 1J0JA 3EA3A 1OK4A 3GH4A 1UKOA 1GTEA 2PLJA 3ITLA 1BTMA 4GQRA 3KOZA 2ZVIA 1JCTA 1BSIA 2YOCA 3EWBX 3MP5A 3PFRA 1B4EA 1DHKA 1XBYA 2V63A 4UTIA 4A35A 3F5LA 6CGTA 4QSHA 3AHTA 2FTPA 4BF5A 1LBFA 4KCVA 1E73M 4W87A 3EB4A 2C0AA 4TVCA 2I5QA 3EX6A 2V38A 4JX5A 1QI0A 4XSLA 4S3FA 2XWEA 1BQGA 2DQXA 1XIIA 4DX3A 4PMVA 1CWYA 3CZGA 4H6EA 3UZYA 2WM0A 5AHIA 2HBVA 4O0KA 1C9WA 1MMFA 3ERPA 2A3EA 1O5KA 3HZ3A 3PG9A 2VUYA 3TW7A 3H2MA 1KM0A 4HCHA 3S8HA 2GVEA 4JTSA 2X05A 1S2VA 4ORMA 4FP1A 1LOQA 2UBPC 1F3WA 1VR6A 3QPYA 4DPQA 2QHAA 4F0KA 2Z6JA 5I07A 2HEJA 3NO1A 2DVTA 3S1GA 1E72M 2VEGA 3V5FA 1EWDA 5M5DA 1U83A 1PZ0A 2PTDA 5CPOA 1JNDA 2Q02A 1ZJHA 4B3KA 3TWAA 1XRSA 2V3EA 2W27A 4HZMA 1XDJA 4AWTA 3DBNA 4Y2WA 1A0DA 2G4FA 4B4HA 1TX2A 1UROA 1UP2A 3TTOA 1DJIA 1OFEA 4PL2A 3CC1A 1WNOA 3ZJ6A 4EXQA 4KMQA 4B3LA 3W81A 4XK2A 4JCMA 2GVJA 4L6HA 5DY3A 4ZXLA 3W7MA 4LNYA 4XSMA 5L9FA 1W3NA 4MB1A 4NY2A 2UV8G 2E28A 4RZ5A 4WXYA 3UERA 4XO7A 3WG6A 4PCNA 4JNYA 2OSWA 1HO4A 4JOMA 3ATZA 4DLMA 1ESWA 5FJUA 2CXEA 3GVGA 2EJAA 5HNRA 4H1ZA 5DMMA 3ZJ8A 3UG8A 2C13A 4JEJA 1BWLA 3BW2A 2DUXA 1TCMA 4J1OA 3W28A 2HPMA 2ZICA 3WL1A 1PBGA 4LAOA 1KFKA 3EMQA 3CPRA 1K4HA 3UBPC 3EDDA 4UFHA 3V75A 3DYPA 4UIOA 4WKHA 1W5MA 2QCEA 2QUUA 2X30A 1EO7A 3B0XA 5K7JA 3W73A 3S2CA 3NVTA 4IIGA 3L4XA 3BMXA 5D03A 1OVDA 4FF7A 2FPTA 3WLPA 3WNKA 5D2VA 4GLEA 4X2PA 4MWAB 4UTUA 3MMWA 2ZC1A 5T8GA 2JBMA 3FJNA 4R3UA 5JBEA 1B0IA 5AC8A 5FJIA 1SW3A 4S1FA 3L5AA 1DTUA 3WQ4A 1W2VA 3WCZA 3VYLA 4Z2LA 2R6OA 1XYFA 1TJPA 1XF0A 4TUFA 4W8AA 4E2BA 1FCQA 4JXCA 3B8SA 3KOWA 4W7UA 3UXDA 3E9AA 3H2FA 1DWIM 3TNBA 2AL2A 3PANA 3CPGA 5HA7A 4K6AA 1VHNA 1W5NA 3VIFA 4DUXA 1GZJA 1LDCA 1VJZA 1I75A 3F4VA 1ADSA 2Q71A 4P7QA 3UR7A 5F2LA 1F4AA 4Y9MA 5HULA 4BZYA 3KL5A 1ONXA 1LLOA 1N7KA 4P5UA 4IIFA 3R43A 3REQB 1UWRA 2CU0A 2YXGA 2PS2A 3FCPA 3ZWSA 4Q7IA 1RBOB 3FA4A 1MQQA 3QOKA 2ZTKA 3PWIA 1FHUA 3ZLHA 2YJQA 3N18A 1IEXA 3B8WA 4MOZA 4FIRA 3K2GA 1WYIA 4YN5A 9XIMA 1FFQA 4URIA 2P10A 4W84A 4GIAA 1RP9A 4AZCB 3W1AA 5AYYA 1LL7A 1YBQB 1MEIA 1W3LA 2W91A 1U33A 1VBRA 3SECA 4S3JA 4WY0A 2A3CA 2WB5A 3UPWA 1EDTA 3UR2A 3I4EA 3TAKA 2IPJA 4N02A 1TE1A 2NQHA 2VOTA 2EPMX 4DIAA 4D6FA 4QEHA 2PGWA 3B06A 1EP1A 2A2IA 3EWWA 5BROA 3S3GA 5CSRA 3UQNA 1F07A 2XIJA 3EXTA 2ABBA 2GYIA 5HWMA 2EPKX 2VFEA 1EO5A 5FJOA 4LRSA 3HN3A 1M6JA 3GX9A 4E8GA 2EGZA 3OQEA 2HRWA 4CD7A 3AHXA 3SAZA 5EMKA 8XIMA 1QPNA 4YVVA 3MI2A 3L21A 1UQYA 1KRBC 1V3MA 4GVFA 1SFLA 1UR1A 4OKDA 1LWJA 2GJNA 3C8FA 3W71A 2VDGA 3A9BA 2QJHA 3EX4A 4C1NB 1CLXA 1DIDA 4H6RA 4DJDD 3IJQA 4IQJA 1LRNA 4IICA 1NOWA 2QV5A 1A5UA 4AZ5A 3KBSA 3MHUA 4FR1A 1ZRQA 3ZMRA 4I3GA 4AC7C 3RR1A 1OGBA 3CIWA 3FVMA 2PODA 4QEEA 2A7RA 5KZEA 1LG2A 1DV7A 3V1PA 4LXFA 3MQTA 4KWOA 2DIEA 1JDEA 1K6WA 3W1NA 5I79A 4UFMA 5EYWA 4LAUA 1YDYA 5JH1A 3ARZA 1SZRA 3I3DA 1IGWA 1RPKA 3AUJA 4DJDC 3MSRA 1EL3A 1TZZA 2XFYA 2DZVA 1I1XA 1GOOA 4M6UA 2PDGA 1XICA 4AZIA 3LRKA 4LCSA 1XCXA 3TUUA 3EMCA 5U7SA 3OEXA 2DSUA 5DEZA 2HROA 4H6KA 4QDWA 2OODA 2ZWZA 2IKHA 2WAGA 2W3ZA 3ARTA 3QFEA 2J7BA 2PAJA 3AIUA 3NQBA 4GI8A 2DSZA 1J0ZA 4TVUA 3ABXA 3L4YA 4H19A 3G2GA 2GL5A 1T99A 5IRPA 2QPXA 4AEOA 1RAKA 4JPGA 1R3SA 1RY0A 3LZ3A 4U28A 2IXUA 5REQA 3NL2A 2VI0A 3BO9A 1WE5A 4RZ4A 3GNPA 2D23A 4YCOA 2Z29A 1PEZA 1FWBC 1TR1A 2D2OA 3NAVA 4U31A 1S46A 4L6DA 1W6TA 1GQNA 4PBGA 4QLLA 5CLWA 3H4GA 3B8TA 3VDHA 4GC4A 4KWUA 3WDPP 2VGIA 2OZTA 5HR7A 4K7VA 3VGGA 3VIGA 1OZMA 3GH7A 4OBSA 1DQXA 3E12A 4HHHA 1HL2A 2YBTA 4QJ1A 3N15A 5DRCA 1TV7A 5I02A 1OD8A 1V3JA 1QWGA 4FALA 3U7BA 4QR6A 1XC6A 3C0LA 1ZUAX 3SUTA 1FP8A 1H4PA 4ZMGA 1ZP4A 1V93A 3GRIA 3TCSA 1N8FA 4L4MA 2W6RA 3B8VA 3GVVA 3Q65A 1WDDA 3KOXA 3BGAA 3LXCA 1UZ1A 1JG9A 1R9ZA 1D3GA 3UA4A 1OM0A 4PA8A 4MKVA 4WOZA 1C8XA 4PUMA 4ZCWA 4X9YA 1A5NC 3V35A 2R1NA 1OC5A 1QHOA 2NLIA 3WJZA 4GNJA 3ALFA 1VIWA 1E1EA 1M04A 1MRQA 4DVOA 1NAL1 1Q6DA 2J88A 3LCFA 4LUSA 1OFQA 3R10A 2FPVA 3GIPA 2HVOA 1X1ZA 4YVXA 4C6IA 1KV5A 3G22A 3RX4A 1JI1A 1P43A 3RF9A 3A47A 3B0UX 1YDVA 4GQ0A 3GIYA 3LCIA 3QH2A 3U8GA 2VC9A 3CGTA 3JW7A 1EIBA 1K03A 1YPFA 2Y88A 3I7SA 1JYNA 4CNUA 4M82A 1J6PA 5HDRA 2Q8LA 4A3HA 1D3HA 1J93A 4U4MA 4KCTA 4GZJA 5JIPA 4O50A 4UQBA 4A8RA 1PHQA 4H01A 1AW5A 3U5YA 1OT2A 4LF1A 4R7WA 4OHQA 4GGHA 3HV8A 4Y9OA 1OFPA 2BODX 4O53A 2PLMA 4KRUA 2PZNA 2EG7A 4GFSA 3N29A 2XIBA 5CQ1A 3KXQA 1EJXC 3VCNA 5FOOA 3W07A 3C0JA 2VFHA 1P0DA 4HU3A 1HVQA 1VFMA 3M5ZA 4P7NA 4PODA 3S2NA 3EA2A 2DZSA 1LT8A 3GDTA 1CPUA 5FI8A 3PZMA 4IPLA 4XIMA 3GIQA 1C3FA 3VMOA 3D6NA 1Y5XA 2XM2A 3SN4A 3QLDA 2YIHA 3MV11 4Z42C 2DSVA 1DIOA 4YTUA 4G7EB 4P7LA 3DKJA 4NP7A 2YW3A 2AQVA 1MFVA 3VM5A 3FSTA 2VR4A 1V6VA 5BYWA 2MNRA 4BKNA 3M0XA 5A2CA 1ITUA 3POCA 5G5IA 4KRZA 3SFKA 2BDQA 1MW2A 1A3XA 1R86A 5AYIA 3LTSA 3FJLA 3LRLA 4HNLA 1XQLA 2PLKA 3FV9A 3LXAA 4LB4A 2IQTA 3BZJA 2WHLA 1EXBA 1BF6A 3APGA 3T07A 1TPEA 1G5AA 3CK5A 1M7JA 3HQPA 1MDLA 4WSKA 3CZKA 2YBVA 3MV01 3O2LA 1V3LA 3UPMA 4K1WA 1HGYA 4GINA 1XR2A 1V5XA 4V2XA 2OMAA 1KLYA 2WPBA 3FEQA 1KR1A 1MW3A 4YL2A 4PUNA 5LHFA 1EB3A 2E77A 1JPMA 4EOUA 4K36A 3KBVA 4N42A 3W24A 4KT2A 2GGEA 1FUYA 1EA9C 1N2VA 2SFPA 3LSCA 2A0NA 4M8UA 4NHVA 1E6ZA 4O8AA 4ZBCA 3A4JA 1IT7A 4ACZB 4YVPA 2FB2A 3SQSA 3L4UA 2ZXAA 3RM4A 5BRBA 5HQMA 3KE0A 4XBSA 1NOUA 2O4MA 2DZXA 4M56A 3LV5A 1J0KA 3W3OA 3NQVA 3N19B 3NDOA 4CD6A 1KGXA 1VYSX 2NWRA 1EX5A 4KEVA 3STCA 3WUFA 4C6NA 3GU1A 3VINA 4GCAA 3UWQA 3SZ8A 2V2CA 3FN9A 1ISYA 4HGXA 5CPNA 3VZZA 6XIAA 1UQZA 5IFTA 3PK7A 5KETA 4YHEA 1E6SM 1C91A 4V33A 3PJXA 4QITA 3DG6A 5CC7A 1KXHA 1L6SA 3CHEA 5HPCA 4POCA 1E9ZB 4IL2A 3NQEA 3TZFA 4ATWA 4XAZA 5HNNA 3BK0A 2YCLB 1IZKA 2A3HA 5I77A 3VDGA 1UD3A 3M0JA 2OT1A 4F0RA 4H7VA 1PKMA 4C60A 5LHEA 3TYBA 2VQTA 3GWQA 2QUVA 1L6WA 2GGGA 3FAWA 4CNTA 2UY5A 1XPGA 3AMLA 2OLSA 4QS5A 4AB4A 3DENA 4PB4A 1DXIA 3MDWA 4O16A 3ZT7A 1G01A 1VBUA 3KBJA 1NF0A 1OCJA 2OFJA 3WQOA 4DELA 2PDUA 4MWAA 4WJ8A 1X7IA 3R7MA 2ZX5A 2VFDA 1PTDA 5D2WA 1HL9A 1XH0A 2QQ6A 5HK4A 2CLMA 1BXNA 3BSMA 3TXVA 4LYKA 5EMUA 4L6OA 1BRLB 5HAOA 3RR4A 4ZTYA 3WNLA 4N9CA 3AS2A 1H2JA 4QG9A 1PKYA 3S0CA 1RSCA 2RAGA 2Z28A 4HMEA 1ZJBA 1V7AA 2B7QA 5FESA 4NRRA 1DJGA 4MB3A 1VPXA 1DJWA 1RJRA 4UMCA 3KM8A 3VCRA 1ITCA 4OECA 2O9TA 3CAQA 1L2QA 3PTDA 3C4UA 1Q6LA 1O12A 4M3PA 1SVDA 4EKJA 1YDOA 2B7PA 3A22A 2A6NA 4IXXA 2YBUA 4CQBA 1SW7A 3DECA 2ZZ7A 4PEEA 3CO8A 3SQLA 4J28A 3PZUA 4NU7A 3SB0A 1US2A 3UETA 3PPFA 4WGXA 4AZCA 5A1AA 3O06A 8TIMA 2VKZG 1YBQA 4P8XA 4LVBA 1VLWA 4DWSD 3KWSA 4G7FA 3SCNA 4GFIA 5E09A 4QISA 1YNYA 2BVWA 1SFTA 3P67A 4GXPA 3Q45A 1QHPA 3PNUA 1OGGA 1E6XM 3NOYA 3IGHX 4AWSA 2QCCA 1ZY9A 2V68A 4E8CA 1UR3M 4ZOAA 2JIEA 1FWAC 1F5ZA 1YPXA 3DDMA 3JU2A 2F8QA 1F9CA 1FXPA 2PBGA 4FAMA 1I6NA 4GHRA 2XIMA 1HN1A 3EB2A 4NT0A 5G2IA 4GVGA 4R5EA 3H7UA 1R3YA 1TPWA 3I6TA 5I3KA 3CMJA 3KLKA 4YTQA 1YADA 5HUPA 4DWSC 3CH9A 3KTCA 4B90A 3VIJA 3QPZA 3E3HA 4EX4A 4I9TA 4N9EA 1HX0A 1P0KA 2CLLA 4ZSUA 1KQYA 2ZC8A 1NP2A 4F48A 1E6RA 5LA1A 3W53A 1NWUA 3LTYA 1XYLA 2OTDA 3EXSA 4LEFA 1MXGA 1CGVA 1D8CA 2X2YA 3C86A 4K68A 2ISSA 1QTWA 3WH5A 2F6UA 2W62A 1VBJA 4RE3A 5LNUA 3AS3A 2ZADA 1R85A 4RUBA 5K9CA 3LHUA 3M5YA 2WMIA 1ZB5A 4WQ6A 2CEQA 1VJSA 4PTDA 1WP6A 1QHZA 1DWHM 3HURA 1E0UA 1TJRA 3TYAA 3CHFA 3OTRA 3LHYA 3MP3A 5D2XA 3TSDA 1ZBKA 2BXYA 1QWKA 3W2JA 4U10A 4FNUA 1LF1A 3KLLA 4NXKA 3UPBA 1PHWA 2R1MA 2OB3A 1KRMA 3U2OA 4HU0A 1BTCA 2OYKA 3CQ0A 1Z32X 1X97A 1TO3A 3AU6A 2IKIA 4R85A 5CPSA 4MVAA 1DJXA 4JTDA 3TCEA 1WX0A 3XIMA 3CAVA 4B16A 3S1VA 1W9UA 3GU2A 2ISWA 2V5LA 1UJPA 4DJFD 4FXSA 5JH2A 3SCQA 3FJ6A 1K8YA 4IF2A 4GYJA 1W5OA 4J4KA 1M53A 2VT0A 3PUGA 2CZVA 2QR6A 3EKLA 2NQ9A 4C65A 1WUFA 3NWRA 3LY0A 5GJNA 4MZ8A 5T9BG 1LJYA 4XUYA 3NQ7A 4WVXA 1HGWA 2WMJA 4RNJA 5B7ZA 1WB0A 1Y7VA 4JTKA 3SN0A 1KM1A 3Q58A 3ENLA 4IQDA 4CCDA 2REQB 2ATMA 4PCFA 4ZQNA 3U2EA 4IFKA 5I24A 5KINA 2Y8KA 3BAKA 4DJFC 3CIVA 2CNCA 1A49A 2CLEA 4LVGA 1VYPX 4OFCA 1KM6A 3L2MA 4IG2B 5PTDA 2WSKA 2PGFA 2L5HA 1BFNA 2XYLA 5FIPA 2NUXA 4J3WA 4S2BA 1W8GA 3HG5A 2V69A 3THUA 1JDAA 3IRSA 1A5SA 4KS0A 4JN7A 2VVNA 3MC5A 3L67A 4OBRA 4W9TA 3F2BA 1FCBA 5CPMA 3BARA 3IJIA 1ZCCA 1RLCL 4D6CA 1GONA 1Z42A 4HA1A 4I7WA 4FO4A 5TNVA 4KQNA 1B54A 1VC4A 3TYUA 5AC7A 2PLCA 4UFJA 4MLRA 1EEXA 1PVNA 3OLEA 5FSDC 2ZE3A 4IX0A 1R30A 4Q3MA 3QY8A 3QW4B 4Q4PA 4WJEA 3KL3A 1RH9A 2W92A 1PX3A 1J8VA 1JDFA 3AU2A 1GPWA 3W25A 2CYGA 2Y5JA 4JIEA 3WMCA 3P62A 2J7EA 2WSQA 4NJIA 3WD2A 1C92A 4MKSA 3W1QA 2FQIA 5HMFA 3WLLA 4P61A 1QI3A 3CUXA 4Q7NA 1PUDA 1EZ2A 4MNMA 3DH7A 5DANA 1C7SA 1WZAA 2BSLA 5E6YA 4D1JA 1UD5A 1GJUA 1H1NA 3MO4A 4JEQA 3SBFA 2WV8A 2BX7A 2XGZA 1UPMB 3DFOA 3UJRA 4J3SA 2PA6A 3DCPA 2JF6A 4UTTC 3EXRA 2FVMA 5FF3A 5HWJA 3F2CA 1RXOB 2QXWA 4RV3A 5AHFA 1RJPA 5D8ZA 2PDHA 1QPRA 4JIPA 4GC3A 4HP5A 1E0VA 2ZZ1A 1EQPA 1TVLA 3KL0A 1TVPA 1OC7A 4HJWA 4NVTA 1OT1A 5LXEA 4J2MA 4HPNA 4H7ZA 4O19A 2J13A 5GJMA 1TX0A 1XH1A 3BW3A 3H12A 1KFLA 4X63A 1V02A 2E8ZA 4I6VA 3KOFA 3GTXA 1BVNP 4YTTA 4F9JA 2Q8XA 3I3EA 4KIEA 3TFCA 3CWNA 3KW3A 4G7EA 5FJTA 4MF4A 5DXXA 4BS0A 3T0CA 2IPFA 2NV2A 4CUCA 2BY3A 3NQ6A 2C19A 1VB9A 1ELSA 1Q8JA 3W26A 2RGLA 2VL4A 2PE4A 3ZO9A 2CHNA 3BOFA 1J79A 4LGXA 1QVBA 3Q4DA 3W27A 1H51A 4H83A 3F03K 2RJHA 1N8IA 1VFSA 1EC7A 3QR0A 4RNIA 1E71M 4XZ9A 1QBBA 3F5KA 3BMWA 4TMBA 4PMUA 4IGNA 5MKGB 3AJXA 1JYVA 3WMBA 5H1WA 1XQKA 2V6AA 1OC6A 3CWOX 3VU2A 3G0UA 7ODCA 1H7RA 3SY5A 2VNCA 4ROPA 1K77A 2BOEX 1WZMA 2EBNA 5CZ0A 4Y8EA 3PZQA 3IJ9A 4XVEA 1LM1A 3MA8A 3RIKA 3W7PA 3VIPA 3NOEA 4EF8A 2XN0A 1K7FA 3SRHA 4MJ2A 5CBIA 2XGIA 3WZ0E 1J5TA 3P81A 2R14A 4L61A 3W7EA 1EZWA 1QI2A 4CVUA 2WC4A 4LANA 3M4HA 4ACZA 1IZJA 3W7DA 2ZE0A 3QYQA 4I8YA 3BLIA 1IXQA 2GGIA 4GUIA 1E1CA 1M9HA 3C6CA 2I1OA 1H7NA 1NJJA 3PFMA 1L8PA 1ISVA 1J0IA 1JFHA 3AIEA 1E0WA 2NV1A 1H50A 1TQJA 3WUGA 1EOMA 2P76A 4PR4A 1JPHA 4D6JA 1M7PA 2NX9A 5G4EA 3E2VA 3J7HA 2DZPA 3H26A 2Y4SA 4DBUA 4H9TA 1XP3A 3HTWA 3QKEA 4TX9A 5D9PA 3K30A 4Z1YA 5RUBA 3ZOAA 6ALDA 4IFOA 1PX4A 2FMNA 1YTDA 2OO0A 4TX6A 3USZA 2BWGA 3L68A 4PMJA 1RVKA 1PAMA 5A8NA 3L4VA 1R2RA 3OVPA 3IJ8A 4JTHA 1JEZA 1C93A 1MQPA 5CC6A 2W0UA 3VIHA 1A53A 3I6EA 3CIXA 4HPGA 4XD5A 3QGAC 3T78A 1V79A 4XKMA 3ATYA 4C6KA 4L1WA 2AGKA 1E9YB 3WF2A 2G3FA 2Y7GA 4JTRA 1BRLA 3CLWA 3WIJA 3H2EA 2ZRZA 1MUWA 1EC8A 1ONRA 1QOXA 4JTTA 1S38A 1FCUA 5H6HA 2A85A 5C9XA 5TIMA 3WY1A 3R58A 4XB3A 1BYCA 1U5JA 3MDUA 2J75A 3G24A 4UCGA 4QDMA 2VHLA 3S5NA 1GKPA 1U5VA 4BJHA 4H41A 3LG3A 3EBVA 1JCLA 5FJRA 4JHMA 1OG0A 4NI3A 2BS9A 4LAZA 2HZGA 3ORWA 1RV8A 2WKGA 3W88A 4GGBA 1GVQA 3ARXA 4YTSA 4JHZA 2BOFX 2FHFA 3NIYA 3UY8A 1C7TA 1Z48A 1GWJA 3E6EA 1E15A 5CSSA 3Q94A 4HK7A 2ACUA 2GK1B 3DUGA 3LI1A 5I06A 3ARVA 3N13A 4EPKA 3PZNA 1EGZA 5I03A 1FHDA 5JQ9A 2TMDA 3UEQA 3W1XA 2A7PA 1OGSA 3D5HA 1TJ1A 1QU4A 3SCSA 4ZL1A 5M3WA 5A8OA 4PTXA 3PUOA 5HOSA 4PRWA 3AHYA 2H90A 4TOQA 5HMDA 3P82A 3PBVA 1AVAA 3HGOA 2J8GA 2YDSA 4CD4A 1A5LC 2G95A 3BC9A 2Y63A 2E5BA 3GG7A 2WVVB 4LUJA 1Q6OA 2PDPA 3A23A 1S2UA 1CZ1A 4FNPA 5F2MA 3SRKA 4D8LA 1VJIA 3QVQA 4ENLA 3N2BA 1XXXA 3AI0A 4IPJA 4ADTA 1TIWA 1UD6A 3T2QA 3G1DA 4GJJA 2ZUMA 4N4QA 2ODOA 1Z9AA 2CZDA 3VMPA 3QJAA 3LCHA 3VGEA 2E6DA 2XH0A 4CGTA 2VRKA 1K4GA 3C0QA 1BAGA 4ADUA 1XRTA 2QJGA 4AFYA 3UCCA 3WK0A 2DSWA 3KZSA 3LCGA 4DM2A 3U57A 4AD2A 2Z00A 4FNSA 1XS2A 2HISA 3B9OA 1RQBA 4C5YA 1U5HA 4MUZA 2NT1A 5A8QA 4NZJA 2I56A 3AWNA 3RNDA 3QMTA 3B97A 4KEUA 1CW2A 4IP7A 4Q8MA 3RHGA 2XFWA 5EGRA 3EKGA 1ONEA 2H3DA 1RK5A 3DN5A 5E0FA 4B5WA 1W3HA 2GDQA 4S38A 2E0PA 4BEUA 3VD4A 2F2KA 2Z1BA 1GEQA 2VZSA 4BQ5A 3I7QA 2ZXDA 2ZQ0A 4RCXA 4WKFA 1UB3A 4TX8A 4WGHA 4GK8A 3CL7A 2AKMA 2PCQA 3GO2A 3DBPA 4HA3A 4GUFA 5TD4A 5C0QA 2CESA 4D6EA 4HSNA 2J7DA 1G4TA 1JULA 3B04A 3BGJA 3G8EA 3TA9A 5GVJA 4D2JA 3N3MA 4IGSA 2YPIA 1FWEC 3PS7A 1ZJIA 1WKFA 4YLWA 4OV4A 2WBGA 3WLRA 3U48A 2HTMA 3WKZA 3T0TA 1EHAA 4ES4A 3G77A 4GYFA 4IG2A 1WXJA 3MP4A 1IWPA 4INFA 1PL9A 7A3HA 3UCDA 3W02A 4U5KA 4M6VA 1CYGA 1PTAA 4QTGA 2Z1SA 1BF2A 4AW7A 1SM9A 2D0FA 4Q6XA 3VC5A 3NPXA 3P8JA 2VGBA 1VENA 1KTCA 2QVHA 4V27A 2C1HA 3G1RA 3TE9A 3K5XA 1S2TA 5DELA 2PWGA 1E55A 4ICNA 1Q7QA 4GJIA 3S46A 3BWWA 2IXVA 4WK9A 4HCLA 1D3CA 1ADOA 3W7LA 1VCVA 1LROA 4DO6A 4JBRA 2UY2A 1ZALA 1EH9A 3W84A 2Y5EA 3CS2A 1SZGA 2J9XA 1ZAHA 1J2BA 1WXYA 4LEQA 3AIQA 3UG5A 4GX9A 3ZWTA 3A9IA 5CEWA 1E4LA 5T9CE 1R2SA 1MXDA 1EUAA 4PB5A 1KKOA 2C6QA 1GOXA 2J8FA 3A4AA 2ISVA 3EAUA 5DLCA 4QRNA 3C8NA 4W88A 1R7OA 3WLIA 1E6NA 1Q3NA 4ONVA 1E43A 3AFBA 3MSGA 3O3RA 4LUTB 1JI2A 4Q7BA 4DBWA 1A5AA 1HVXA 2J9YA 3VKCA 4C6CA 3E5PA 1KCXA 1GKQA 1U1JA 2VD8A 3BICA 5I23A 3PJUA 1JDDA 1EDGA 1CBGA 1UWUA 3ANUA 1G4PA 2OO6A 1RA5A 4TVDA 5HQEA 4TMCA 4AUBA 1Q4WA 3LHWA 2PDQA 1AH4A 1R3QA 2ZX6A 1F6PA 2XFRA 1XISA 5JUVA 2YL6A 1OFBA 3H24A 4LH8A 4IWWA 3C5QA 3MJMA 4NL1A 5DCDA 3SRFA 2VTFA 1XGEA 4ADSA 4A22A 3DFPA 3NTYA 1Z69A 4O14A 1Y5VA 3W75A 1KD0A 4L7ZA 1MWOA 2VC7A 4BI6A 3BMVA 2ANUA 1B3YA 1NWRA 1KM3A 4O1BA 3V0UA 4W4QA 3M46A 3DG7A 4PBFA 2D3NA 1R8LA 1Q5MA 3W22A 2XSAA 3WLMA 4JTJA 3ZR5A 3FHAA 3AAMA 3FK4A 3SM0A 2PD5A 5CSYA 5HNUA 4UTFA 3VKJA 2NZLA 5ABFB 4HZ7A 2QF7A 4DXXA 2OKOA 2QF8A 1XDLA 1Q4NX 1QXLA 4PSPA 2RDWA 1W2PA 3TMQA 3WD4A 5LIUX 4MB4A 4I7VA 4H8UA 1TB3A 5EMMA 3OZOA 4IMGA 3JS3A 1E3XA 1TV4A 4G6CA 1W37A 1TTJA 3AXKA 4I9MA 1AH0A 3MPGA 4GZ7A 4DZ5A 3FKKA 4H3DA 4PCSA 1XIBA 5BRQA 1IT0A 1J10A 1K1DA 1HUVA 1X96A 3BGGA 1VEPA 1ZL1A 3PHAA 2NUYA 1XD0A 4E3TA 1OQFA 1WDWA 2OVLA 4TXEA 3NZGA 1BVZA 1EGVA 3LK6A 3O7UA 5BOFA 4PUKA 1IHIA 3IWPA 1IR1A 4BR1A 5G1YA 4A8IA 3CV1A 2X0YA 2CHOA 2Z6IA 4UTLA 1QFEA 3I65A 2VO5A 1NIUA 3UXAA 1E0XA 4PMXA 1V3IA 5B80A 3LV6A 3Q2DA 4HCDA 2PWEA 2YLLA 3CM4A 4AYGA 3G1AA 4E5TA 1TE6A 4O18A 1WDQA 4IPNB 3ZVHA 4UTWC 5BMXA 3VVGA 1FWFC 1QPOA 1UIPA 5I2UA 2P0IA 4AIEA 4A8LA 3M0ZA 3OLIA 3R94A 2ZA2A 3GXNA 1V0MA 3LTPA 5IOBA 4HNVA 1B3ZA 1DP0A 4B3ZA 1KBLA 4E4FA 3L0GA 4F0SA 4LUYA 4O0QA 4PUUA 1HF6A 5FL1A 2OQHA 1WKDA 4NZ1A 3TOPA 1VH7A 2NSXA 4LV4A 3I6RA 1CB2A 2YCJA 3FYOA 1SW0A 1ZS2A 1VQTA 1RBAA 4P7RA 2BXVA 4GXMA 4QROA 3BJSA 3WLNA 4FXJA 4AHQA 1UR0A 1S5MA 2BVYA 4BF9A 3WEOA 5IFPA 3DERA 4A05A 4BI7A 1HKIA 3EDEA 3HA1A 4A2SA 2OZ8A 1CXHA 2YLAA 2OYMA 2VD9A 3R79A 3RAOA 2QJJA 3SCRA 2RUSA 3PBUA 2QUMA 3N6HA 1KNWA 4NIRA 4RLIA 1KCLA 1EX1A 3KRSA 2G4JA 1UZ4A 3MHFA 3BAXA 4AY1A 4TV5A 2WMFA 2E09A 1X8CA 2NXGA 1ALDA 1DWJM 4K8EA 4GO9A 3HGJA 4LBRA 2WSPA 2P50A 2FIQA 2TAAA 2O9RA 5AVHA 3TC6A 3GXPA 1PIIA 1ML1A 3GK0A 4K39A 3AUOA 1PCKA 4NF7A 4P8UA 2VX6A 5I3IA 3N2OA 2FHBA 1REQB 4PTWA 3N73A 1F73A 4MMWA 3UWWA 3VI2A 1DKWA 4HBKA 2ALDA 1OF8A 4B91A 1LBLA 5EFFA 4MDOA 3LCWA 3IIXA 3T0AA 2DH3A 4XZNX 4U33A 4UZSA 4KESA 2GK1A 4PSRA 3NQ8A 2PBOA 1OCBA 1UZDA 4F8XA 3KX6A 2HXTA 4YYCA 3VGBA 4ZQCA 2GPTA 3QMSA 3PBWA 4DYJA 3OHIA 4LAKA 1Y8BA 3RJXA 9XIAA 2CLOA 5BXPA 3TSBA 4US6A 4Q6JA 1DOSA 3HJEA 2JEPA 4LRTA 3VMNA 4W86A 3E38A 4J3TA 5IDIA 4FS9A 3NSXA 3AC0A 2WKJA 3RK8A 3VOCA 3W7QA 3UNDA 4YU1A 3AMCA 1OHLA 2EKCA 1QK2A 1AJ0A 3LBOA 2GQAA 3T0DA 1XCFA 1HKJA 1V0KA 3WLQA 4L9YA 3UWYA 1JYWA 1XHGA 2BY0A 3LNMA 1MUMA 3P0XA 4IZGA 1F7BA 1WZLA 1K70A 3WDRA 4FLRA 3VD3A 1UBPC 3G1HA 1Y0EA 3LXBA 3VFCA 1BKHA 2WZHA 3TJ4A 1AJZA 3WMSA 4M24A 2HV5A 2VFFA 1J5SA 1LL4A 1EPVA 4UQAA 3K8MA 5F4WA 2PUZA 1EDQA 4JNZA 1NH6A 3C2EA 1FWJC 1G7UA 4EIVA 3MHGA 3GZAA 3SO7A 2Y61A 3USBA 4AF0B 4AHOA 4Z17A 4OIFA 2WZMA 1OFAA 4YWIA 1HXJA 1IEWA 2G96A 1O66A 1P1XA 3IIVA 5A6SA 1IEIA 4HZ8A 4H04A 2DQWA 1CXLA 6PTDA 3T05A 1OYAA 2QIWA 2VRJA 4KKXA 2DT3A 4XIAA 3GG0A 1U22A 3VOGA 4XZBA 2FZ8A 4CN6A 9RUBA 3TC7A 4Q4MA 2AGTA 4EWJA 3OBAA 3CPUA 2QZRA 3AXIA 5DMNA 2R1KA 2J77A 2Y85A 3II1A 4L1XA 3RJYA 2XFFA 1PDYA 3ZR6A 1A50A 1BYDA 3LHTA 4DUWA 4IGHA 1M65A 3T4WA 4QG8A 3SCUA 3WJYA 2NQLA 2FH8A 1EJVC 4NXSA 3GVWA 2C14A 1V3KA 1G4SA 3E49A 3N2MA 2C3ZA 1PX8A 4DNMA 2R1LA 3CT2A 4IFRA 3EEZA 4M6QA 3EDKA 1H7PA 5EPDA 1M01A 1WDSA 3CV2A 3SEPA 1P4CA 4N4PA 5BXSA 4CEUC 1IIHA 4FR6A 1FWCC 1EA0A 2CKRA 4CCCA 3VX0A 4EPEC 3MO7A 5BU9A 3H53A 2JEQA 3QM3A 4MDPA 2Y24A 3R5EA 4Z1DA 4D6GA 3UZWA 5A3HA 2P88A 2V2DA 4LX4A 2D69A 3A4XA 5FACA 3PPCA 5BW6A 1XSKA 2CLKA 3AWOA 3HFTA 4X61A 3RLHA 5LZLA 3WLJA 2JGQA 4G9PA 1PZ1A 2ZRWA 1UKSA 4ACYA 4CU8A 3NQDA 3D46A 1BGGA 2E8YA 4DXKA 1XFBA 3QYSA 1GOWA 1B3VA 2ZZ4A 3PSVA 5GQBA 3OLGA 4Q4SA 3G1FA 3UVIA 3NQAA 3U9IA 4D1IA 4B5VA 2CERA 4HNNA 4DBDA 3UA3A 1VP5A 4G8TA 1GOQA 3LM7A 4M81A 5EKYA 4LVFA 4TIMA 3A12A 2VVSA 2P0OA 3POHA 2JF7A 3P84A 4ORIA 3NXFA 4I5XA 1AH3A 3CUZA 1GUVA 1XBXA 3ZLGA 1ME7A 2PTWA 2YA1A 4HPXA