2HRWA

Crystal structure of phosphonopyruvate hydrolase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
290
structure length
281
Chain Sequence
MTKNQALRAALDSGRLFTAMAAHNPLVAKLAEQAGFGGIWGSGFELSASYAVPDANILSMSTHLEMMRAIASTVSIPLIADIDTGFGNAVNVHYVVPQYEAAGASAIVMEDKTFPKQELVRIEEFQGKIAAATAARADRDFVVIARVEALIAGLGQQEAVRRGQAYEEAGADAILIHSRQKTPDEILAFVKSWPGKVPLVLVPTAYPQLTEADIAALSKVGIVIYGNHAIRAAVGAVREVFARIRRDGGIREVDAALPSVKEIIELQGDERMRAVEARYLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphonopyruvate hydrolase
publication title Structure and Kinetics of Phosphonopyruvate Hydrolase from Voriovorax sp. Pal2: New Insight into the Divergence of Catalysis within the PEP Mutase/Isocitrate Lyase Superfamily
pubmed doi rcsb
source organism Variovorax sp.
molecule tags Hydrolase
total genus 104
structure length 281
sequence length 290
ec nomenclature ec 3.11.1.3: Phosphonopyruvate hydrolase.
pdb deposition date 2006-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 2hrwA00
1A3XA 4DRSA 1S2UA 1XG3A 3BJTA 3OQ8A 3ME3A 3T05A 4L80A 1DQUA 3FA3A 1IGWA 2XZ7A 2ZE3A 2QIWA 1E0UA 3M0JA 5JVLA 1F3WA 1F8IA 2V5KA 4FXFA 1DXFA 4B5TA 3E5BA 3QV6A 2L5HA 3R4IA 2BG5A 2VGFA 2V5JA 4RPPA 3I4EA 4KCWA 3QLLA 1S2WA 1MUMA 3QZ6A 4KCTA 4B2DA 3T07A 3QV7A 4YNGA 2VGIA 3SRDA 3LG3A 1PYMA 4QG6A 4KRZA 3GG8A 2VWTA 3E0WA 4ROQA 4KCVA 3BJFA 4G1NA 1XG4A 4HYVA 1IZCA 1F8MA 1U5VA 4L9ZA 4WJ8A 2HROA 1KC7A 3IS4A 3PUGA 1E0TA 3QQWA 3QV9A 2DIKA 3B8IA 1VBHA 3N25A 4TV5A 4IQEA 4MG4A 1OQFA 2VGBA 3U2ZA 4MF4A 4B5UA 1A49A 4JPGA 1PKMA 3LYEA 3QTGA 3SRKA 2R82A 1KBLA 1UJQA 3QV8A 1F61A 1S2TA 5TAOA 1M1BA 1M3UA 3HQNA 4HYWA 2VGGA 1AQFA 3G2GA 3PP7A 3T0TA 2WQDA 2HRWA 1PKLA 1VBGA 2KX9A 1DIKA 1T5AA 2HJPA 2HWGA 3GR4A 2OLSA 3VAVA 3H6OA 1JDEA 2VWSA 4IQDA 4QGCA 4QG9A 4KS0A 4TV6A 4L7ZA 2X0SA 4KCUA 4B5VA 3M0KA 3HQPA 3OYZA 4FXJA 1ZLPA 4B5XA 3KTXA 1O68A 1O66A 4B2DD 1DXEA 4LSBA 1ZJHA 3GQYA 1SGJA 1A5UA 3SRFA 1A3WA 3HQOA 1OY0A 1GGOA 3FA4A 2XDFA 3E0VA 1PKYA 3EOLA 4IMAA 3EZ4A 4QG8A 3OYXA 2DUAA 3EOEA 1Z6KA 3P0XA 4YJ5A 3KHDA 3MA8A 1U5HA 3EOOA 2XZ9A 1O5QA 3SRHA 4B5WA 1PKNA 2G50A 4B5SA 2E28A 1F3XA 4IP7A 4L9YA 1S2VA
chains in the Genus database with same CATH superfamily
3MP5A 4HA3A 1YYAA 5DMYA 1VCFA 2WLZA 1XYCA 5BOFA 4BA0A 3M44A 1KRCC 4OBTA 1I2RA 2AKMA 1RJQA 2BZNA 1A5LC 4CNOA 4PUMA 6CGTA 4LC6A 1RQEA 2QCEA 3PBGA 4PZVA 3T2QA 4E4PA 1NF0A 3H2EA 4HCLA 1XCFA 2QZRA 3PUEA 3GU1A 1ZS2A 4BI6A 3WH6A 1QCWA 3W1QA 5KZ6A 4JX6A 3ENLA 3CO4A 2ISWA 2VRQA 4IQEA 4JTLA 3TJXA 3M6DA 1OB0A 2YKKA 3KRZA 1FFRA 4NHVA 4J5NA 4GIAA 3VKKA 2PDJA 3WNNA 1XHGA 3EB2A 3T0TA 2PDHA 4FIRA 3PBMA 4PYSA 4GX9A 5C7HA 3NNTA 1EO5A 4XO6A 2NLYA 3SY5A 1Q63A 5BU9A 5HUPA 3F03K 5TNVA 1H50A 4ZQMA 3F7JA 2D2OA 4ZL1A 3I65A 4Z1CA 1PHQA 3MO4A 4RV3A 4QCFA 5LHEA 1KTNA 4N9BA 2PDLA 1KRBC 1J2WA 3MUAA 1JEZA 3BLKA 4V28A 2G3NA 3TYAA 3RPDA 4JQ1A 2F2KA 2V63A 1VH7A 2CXEA 2WXDM 1IEQA 4DAFA 3G1DA 4J3UA 5E6ZA 3WUGA 3T8LA 1T8QA 1XS2A 3AC0A 5G1MA 3VIFA 3CMGA 3SGGA 3OTRA 1VS1A 3VZZA 4QE1A 2FVKA 4OFCA 2FJUB 3PJXA 1HL9A 1MXGA 3TKFA 3O0FA 3TC3A 3ARUA 3B0YA 2VEMA 3H22A 2QIIA 1XSKA 3WQOA 1YPIA 4QISA 1F6PA 3TYDA 5F2IA 4QAWA 4EXQA 2I57A 4QE5A 4NVTA 4M81A 2DVUA 4J7RA 1CDGA 2XVPA 4GQBA 3E0LA 2JALA 2W9MA 3SI9A 4OU1A 2WZEA 3T9PA 1MZHA 3M16A 5EA9A 2D3NA 5D2TA 3LCGA 3OQEA 1YE6A 3APGA 5DRIA 1US3A 2QJHA 4TX8A 4IIGA 1W54A 2XGZA 3VKBA 2PDQA 1E0WA 1V6XA 3DEQA 1GK8A 1V7YA 2CWXA 4LRSA 4BEUA 2ZE0A 3BLPX 1YEYA 3HPZA 1H61A 1SFLA 1SJCA 4LTSA 3W2MA 4RW3A 2PLCA 4D8AA 3VOIA 1POJA 1W9XA 5CSYA 1P6BA 3RM8A 2J24A 3H2FA 3WFZA 5CJMA 5CGTA 2QUMA 3GDMA 4NXKA 1OG6A 5EBUA 1DV7A 3O16A 5U7SA 3IIVA 3PVFA 1KQYA 2QF7A 3TTYA 5IOBA 1BSLA 2ESCA 4Y7EA 3S2CA 1PUDA 2V5KA 2CKSA 3QOKA 4RKAA 1E4IA 3RK8A 2VJXA 4P7LA 1VHCA 1KO0A 5FAGA 2CCRA 2YDSA 3OP2A 1E4NA 4L61A 3UY7A 1QNRA 2WVTA 3MP4A 4KEUA 1PWLA 4AWSA 4QHRA 1GVYA 3AS2A 3Q45A 1HGYA 1UC4A 1TWDA 3NZQA 2ICSA 5D9PA 5C6MA 4ZQPA 3U8GA 4H4IA 3C61A 1V5XA 3E9AA 3NQMA 3R94A 3S42A 2VC7A 4HOZA 1HXJA 4PBFA 3ZFHA 3UCQA 1NWSA 2Q8XA 4JTIA 3QY7A 2NUWA 2IPFA 1KCZA 1GWJA 2QDEA 1Y65A 2Z24A 2YL8A 3EXTA 3NCOA 1RALA 5TIMA 1TTIA 1RQBA 3VNYA 1FXQA 2J6VA 3KS6A 3DI0A 3ES7A 5G1TA 3GDBA 3LHZA 3KX6A 3KOYA 1W9BM 4W9TA 3XISA 1TX2A 2Y88A 2EO7A 1BF2A 2DPEA 3R58A 5DEZA 1FWGC 3AZRA 2OSWA 3W07A 4GKLA 2JFEX 4PUKA 1MQPA 1DTNA 1QVBA 4CQCA 2BY3A 4JIQA 4Q8VA 1CT5A 3U2CA 1U1JA 3MSRA 2MUCA 3EX1A 5FESA 5C54A 3QV6A 3M7WA 1Q85A 2XVLA 3PTDA 2H9AB 3EDDA 2EBNA 4L9XA 2V0TA 3W7NA 2UWFA 5CPNA 1TPFA 1KRAC 1TCMA 2W61A 1RH9A 3PZIA 2HROA 5LNWA 4GBDA 4LF1A 6XIMA 3ZJ8A 4R3UA 2PSNA 2RJHA 2EPMX 1C7SA 1Q6RA 1JGIA 1UP3A 1XC6A 1SYTA 4O15A 4WJEA 5I3JA 3MZ2A 2X09A 1JL8A 2ZIDA 2WVVB 4D6FA 2WQDA 4WDXA 1SZFA 4W7WA 3E2VA 2AAAA 1R3QA 4J40A 4PUUA 4NAFB 4X60A 3DFSA 5JIPA 3LEPA 1YE4A 2PWFA 3IEBA 1DWHM 2ZA2A 3E74A 5IRPA 1O12A 1JZ7A 4C6IA 2FTWA 3E6EA 3CT7A 4C6PA 1FY6A 2PBGA 4JFTA 5BRBA 4CCEA 4ZO7A 4F40A 1HO4A 3RF9A 5CAHA 1UWAA 4B5WA 2EHHA 3AHYA 1OC6A 1F4AA 4IP7A 2R1LA 4J3XA 4C6EA 3UQNA 4HYRA 3LLDA 5IM51 1E71M 2A6LA 3TWBA 1LJYA 3GXNA 3DHDA 4GY7A 3H21A 2ZADA 3P2VA 1G94A 4CQ9A 2BNJA 1E6PA 3T7VA 4AIUA 2WSQA 3I3BA 6REQA 2E67A 3HG4A 2QMKA 4LQ1A 2YL6A 2VEPA 2C15A 3TYBA 4P8XA 3B0UX 4RE2A 3MI2A 2OX4A 5CZSA 4O4WA 1W3LA 2J62A 3G1FA 3W01A 4ERIA 4IX0A 1IZCA 3FAXA 1KRMA 2REQA 3TQPA 4PUWA 5GNZA 5HULA 3W2NA 1E5JA 2XN0A 3FXGA 5KINA 3PTQA 4PMUA 4TVUA 3B04A 4GUJA 1ICPA 2HBVA 3B8VA 4A05A 3K1GA 1TA3A 1DBTA 4W84A 4DJFC 3NSNA 5I00A 4JD4A 3KCJA 3VOCA 4H8HA 5AZ0A 3NYDA 4DN1A 2PDFA 2DT1A 3TAKA 1OFQA 1AL7A 3LPOA 3WMCA 4DI8A 3UG4A 2XDFA 1ADSA 1OADA 4H9MA 1UBPC 1XYZA 3T42A 4HNVA 4IGHA 1QK2A 2VC5A 4E3VA 4Z08A 3UJFA 3B8WA 4BF9A 2VURA 5HATA 4CU6A 4HJFA 1V4YA 1K8XA 2DIEA 4WKFA 2XJ7A 1TJRA 3U48A 3DHPA 4RXGA 3WH5A 1GQLA 3V5OA 1TV3A 4IIEA 1IR2A 2E0PA 1ZTVA 3RM9A 2D2JA 1E0UA 3W1UA 1F3WA 3HTWA 2YBTA 1IEIA 3GYCA 1X8CA 4LS2A 2QJGA 3ITOA 1TTJA 4JQ3A 4YCPA 4IPLA 5D32A 3S47A 3E5PA 3G6MA 1PIFA 4C6BA 4HJWA 1P0NA 4RCXA 1WAWA 3R12A 4GYJA 1CGXA 4LB3A 5M2FX 1EJRC 3A3WA 1KXQA 4DY1A 3WJXA 3UPMA 4BZYA 4NL1A 3CL6A 5REQA 3NURA 4QP0A 4LANA 3AROA 1EL3A 3ABZA 5CZKA 1ZAIA 2OODA 3FYYA 1FH8A 1YPXA 3FVDA 4CCCA 4LUSB 4A35A 4X0NA 1GZGA 3CYJA 5A8PA 3VIOA 1RP9A 3FV9A 1QPQA 1OX5A 4WK9A 1PCKA 5DXYA 3CJPA 4N4QA 2V9DA 1AD1A 1NWUA 1MI3A 4P7NA 4O16A 3NQFA 4O1CA 4K2SA 2GGGA 1UWTA 2YCEA 1ALDA 3VIPA 1CCWB 4D6HA 3TJIA 5MKGB 3OBAA 4ACZA 1KWGA 4IM4A 2ZWZA 3IVUA 1WKFA 4C6OA 3MU7A 3GD6A 1R9YA 1DWJM 3COTA 3I6RA 3QH2A 1UOKA 3LBMA 1YQ2A 4D6CA 5CPTA 5J5DA 3WK1A 3G1AA 2HPMA 1HT6A 3VIGA 2QJNA 4IT1A 4G1NA 1VYSX 1Q6CA 4NU7A 5G4EA 3GM8A 1J0ZA 4EAMA 1MW1A 1JZ6A 2Y8UA 5DLCA 3LGDA 2DORA 1GZ1A 3A9IA 1GQIA 1K4HA 4TXEA 4KWOA 4XVEA 1H7WA 5BMXA 4XAZA 4GC3A 3GXFA 3LK6A 1H7RA 4H83A 4QNEA 3NPWA 1F76A 3HURA 2OGJA 2A3HA 5H8UA 2Q71A 1I0BA 4H19A 3U4AA 1U1HA 1LWHA 3AZSA 3WUEA 1SFSA 2RKXA 2GGEA 3AS0A 1TWSA 2PD5A 3NQBA 1BLIA 2WHMA 3BUVA 3BLLA 3GXMA 4ZO8A 2FDMA 4C6LA 5FSDC 2BDQA 3BOXA 1K8CA 4KIEA 2Y62A 1E0XA 3P0XA 4MFDA 4JHOA 4GJ1A 3HGRA 2VEGA 1V8EA 3L0KA 3PY2A 4IX2A 2AQWA 5ABFA 4ADUA 1UZ4A 2PC8A 1E6SM 1QT1A 1W5OA 5CSRA 3W1AA 2DVXA 3RRAA 4IPIA 1CWYA 4GYPC 4DWDA 1TCDA 4QS6A 4ZBCA 2NX3A 3O9NA 5C0QA 4M24A 2V81A 2Z1VA 4Z42C 1X97A 4HHPA 3WBAA 1FKXA 2NSOA 4B4HA 5K7JA 7REQB 4K7YA 1ZY9A 4BQ5A 3FDKA 3R0DA 4O8AA 3PB0A 2BVWA 5LKYA 1S46A 3RMEA 1JR1A 3GLCA 1H5YA 3GH7A 2A3BA 4WY0A 4ZSTA 2RJGA 3WLOA 2G3IA 1XGZA 1XBVA 1DXIA 2E1WA 3MCNA 2YDAA 3PZTA 3G77A 3DCPA 4NJHA 2OKTA 4NI3A 3OB8A 4GNKB 1MUCA 3QTPA 2XINA 3IIXA 1RBLA 4P2VA 1FH7A 2FZ8A 4IMCA 3RLUA 4B5NA 3WD1A 2G4FA 2KZHA 3SR7A 2EG8A 3FKRA 1K1DA 2PDMA 4ZSUA 3W82A 3FDGA 2A7PA 1ISXA 2YXOA 1ZFJA 5H8MA 3VNIA 1JCXA 1GQJA 3N9RA 5EPDA 2AKZA 1ISZA 3CAKA 3VE7A 1UR4A 3ITYA 5JIWA 4H9UA 2HK1A 3T2PA 1PIGA 1TVLA 4W85A 4DF0A 4E8GA 1QO2A 2D24A 2WSKA 3W7PA 4GA8A 3MSGA 2P8CA 3WQ6A 1CENA 4J35A 4O1BA 4M29A 3TVAA 3GU9A 1XV8A 3MKVA 4IPPA 4U31A 1HL2A 3GDTA 4Y8EA 2ZZ2A 3KBJA 1LL4A 1IXOA 1KQZA 2I16A 3I7RA 3L5AA 3E2RA 3TLQA 1AW2A 1W3KA 4HPHA 2NX1A 2PTXA 3E0FA 2A2IA 3CEUA 1Z42A 1QWKA 3I4KA 1W5PA 2DT2A 1QW8A 4H9YA 1P0DA 4AZCA 1BEUA 1GOWA 4UR8A 1E6RA 2Q3OA 1EDQA 3VFCA 1DJHA 1XGDA 4CNPA 3TROA 3QW4B 4ADSA 4IMFA 1C9DA 1MEHA 3G2GA 3WLMA 4ALDA 1P6WA 4GQ0A 2FFCA 5CQ1A 2WC4A 1EX1A 1UZHA 1JI2A 2R24A 2O9OA 2Z6IA 1IXQA 4NNAA 5KZEA 1IEVA 1UKQA 2FB2A 4V33A 1I60A 5BOEA 4NUWA 1U5JA 2QMJA 1LQ0A 3DESA 3QR1A 2YCJA 1GOQA 3U3HA 4HSNA 2E28A 3KOXA 2X2GA 4WGXA 1DQUA 5F2MA 3V1PA 4X9SA 3UPWA 5EMKA 4FXFA 4FR6A 1D3HA 4DXVA 1BXBA 1G7UA 1I75A 2D73A 1XF0A 1OCNA 2Q09A 1GOKA 4F66A 3P62A 5GVJA 3W0KA 2HZGA 3AFBA 1L6WA 3E0WA 4ROQA 3WMBA 2Y5JA 5I7GA 2CIPA 3MUIA 3QFWA 1OC5A 4ZE5A 2WPGA 3TIMA 3CO8A 3L7RA 1DOSA 2JEPA 4MF4A 3AJXA 3VE9A 2WKGA 3NDYA 3F4VA 4HD5A 3N04A 3G1SA 1BGAA 4JAWA 4PRRA 2D3LA 4ZMGA 1LOSA 2E3ZA 2VUNA 2A5HA 3N17A 1RD6A 2BHYA 1UH2A 3KCOA 1R9XA 4S3GA 4N4PA 2ADAA 1LL7A 3C8FA 4L4LA 2QJJA 3UXIA 1N8IA 4W8LA 2OTDA 3KM8A 5B7YA 3KDOA 1XH0A 4HZ7A 1ISVA 3WEOA 3S5SA 4UNKA 3Q58A 2NUXA 2R9RA 2D2GA 4LOCA 1BFNA 4JR5A 3WFLA 4WDWA 2JEQA 4GZJA 4OIFA 1J10A 3LMZA 4LAOA 3W7DA 1G4PA 3VZYA 5CPQA 1UA3A 1EYEA 1EOMA 5FOOA 2DUZA 3M4HA 4TOQA 4MZ1A 4MZ8A 1UQYA 5HJXA 5JH1A 4L4MA 2VGFA 1MW0A 3NQVA 3EMCA 2G41A 4LH8A 3FEQA 3L67A 4MWAE 1KBJA 3RLGA 3WD3A 1HKVA 1Y0EA 2VVSA 3EWCA 2VNCA 2QULA 2GGHA 1UKSA 2ZZ5A 2GOKA 2YGYA 4FOKA 3RAOA 1VFHA 4AZGA 3WEMA 3BWWA 5DY2A 5AB3A 3WF1A 1NWTA 1KBLA 1TKKA 3EDFA 1G69A 1H60A 1UD4A 3RU6A 1XIBA 6REQB 5GJPA 1R6WA 3VIIA 4DX3A 3WQPA 2OQLA 3CAVA 2DZTA 4PTDA 2XFWA 3EAUA 2VD9A 1ME9A 1MQQA 9RUBA 3LXCA 2CXGA 4FNRA 2REQB 4M7SA 2JGYA 2PDBA 1O6IA 5I78A 4IP4A 3PZGA 5K9XA 1DJNA 1PKNA 2NVCA 3HG5A 4R5EA 4BS0A 2VOTA 3PBYA 2O55A 1TA3B 2YLAA 3SN1A 4LAMA 1CGVA 1JFHA 3ZLHA 4AZHA 4ICCX 3R1ZA 4QFUA 2FPYA 3PS7A 1IWBA 2OEMA 1UH3A 2QUNA 1V08A 1KGXA 3DECA 4MAZA 3NZPA 4ZE4A 1UKOA 5LNVA 4CU8A 4NYUA 1YDOA 5LHFA 4UTTA 1DVJA 3FN9A 2D20A 2DY3A 3ZR5A 1SPQA 1R3YA 3VI2A 5D33A 3S3GA 3CUJA 2DVTA 1XYLA 2HISA 2P10A 4OQVA 3QY6A 3NYZA 2H8XA 3URQA 2ZUMA 4NJIA 3LU2A 1W9DM 1XICA 2VFFA 5E0CA 2XGBA 2RDWA 4AVNA 1EF3A 3MKKA 2JF6A 3UFYA 3BGJA 1AH3A 3V7PA 2W67A 1O68A 4REQB 4NZCA 2VDHA 3IARA 4QDPA 4OUIA 4GQRA 1RV8A 1KKOA 1SJAA 3Q37A 2WB5A 2AQOA 3B8TA 4WRHA 1DJQA 5D9NA 4KKXA 2DUAA 1P6CA 3THDA 1Z7AA 3QKEA 3F2DA 3EMQA 4IXXA 4KMQA 5CSSA 2BVYA 2VP8A 1WB0A 3UXDA 5REQB 3MS8A 2OO6A 1OK6A 3ME3A 1GOXA 3GS6A 2PFHA 3T44A 3UXLA 4K39A 4ZA0A 1KV5A 2X05A 2QNEA 4TVDA 2PP3A 2PDCA 4PMZA 4Q4KA 3GNDA 5A94A 4H7CA 1W9VA 5XINA 3QHMA 3EWYA 4AIBA 1JRCA 1D7KA 3AIWA 4PTVA 2V3FA 4R85A 4HHHA 1HJQA 4DHGA 3CL7A 4DPQA 3KLLA 1IZKA 1OT2A 2G95A 3K8KA 1T41A 1IGSA 2IKJA 1CGTA 3MHFA 3GTXA 1M01A 4MG4A 2X7WA 5H1WA 1YDVA 2GQAA 1P1XA 1OHLA 4ACZB 4J3TA 3LM3A 4LAKA 5FJTA 2H8ZA 2DSUA 3W25A 4UQEA 2CBJA 1RAKA 1ADDA 4RDWA 2HE8A 2ISSA 2DZXA 5BWAA 3DXIA 4FF5A 3TE9A 4MJMA 1TWZA 1WXYA 3GY1A 4B9YA 3CC1A 1LCOA 1VHNA 3W1MA 3HQPA 1P1MA 1AVAA 3RHGA 4IOTA 2TMDA 4JL1A 2H6RA 3KBSA 4R7OA 2DU2A 3KWXA 2X40A 3WBEA 2HNEA 3CUFA 1Z6KA 2WQPA 3OLIA 4QX4A 3FJNA 1QK0A 4C91A 5LXEA 3GDRA 2D2HA 3U2OA 4FO4A 6PTDA 3A4JA 5CC7A 5LYRA 2EG6A 3MUCA 3ARYA 2DT3A 1ZU8A 3PTMA 3QBUA 1WXZA 2PDUA 1X8FA 1EJVC 1FCVA 3M0ZA 4O1FA 4KFPA 1WUEA 2DZBA 2NQLA 1QOPA 3P5YA 4PTNA 5FL1A 3VUSA 1A4MA 3FSTA 3ZR4A 3A21A 4PBGA 1F07A 3WJYA 3BJFA 1CXEA 5LNRA 5ABFB 3BW3A 3RFAA 1FX6A 2ZBTA 1G6CA 2MNRA 4HMDA 3ONCA 1X6LA 3N29A 4L6DA 2DJXA 3G8RA 3KZPA 3V5FA 5IDIA 3R0UA 4Q7NA 1QI3A 4W88A 5BRQA 3IJ8A 1H62A 4NP7A 3WLPA 2GQ8A 2D22A 3GR4A 4GXWA 4R53A 3ZYZA 1J2BA 3PM6A 1R3WA 4YIWA 1H0GA 1LT8A 1UPMB 1UP2A 1YPFA 1WP6A 1EA9C 1XIHA 2NVAA 3ICJA 2EEXA 1EWEA 3APYA 1KFKA 2BHUA 4K6AA 2TODA 3A4WA 4WY0B 2VCBA 3CAWA 1XIGA 3KLKA 1ISWA 2C16A 3M5ZA 4QLLA 1PHWA 3V5CA 3FEMA 1NFGA 3MO7A 3VD3A 3DHUA 3WDRA 2OKOA 3BCJA 3QR0A 4Q6JA 1MYRA 1UUQA 2XFFA 1B3WA 2CC0A 3BURA 4XZHA 1RK6A 5JBEA 4AQLA 2ZZ7A 5HK4A 1MUMA 4AVFA 3BO9A 3AXIA 1TQJA 1Z44A 4UTWC 2DW6A 4O13A 3WY1A 1PZ0A 4KCVA 3P8IA 1FWIC 3GU2A 1EDTA 4O12A 3DGRA 3CZJA 1K9EA 3ARPA 2GFTA 2V2CA 3FFSA 4MNLA 1FTXA 3S2LA 4LX4A 1O5RA 4ZQRA 4JTRA 4IIHA 3SBFA 1MW2A 1J79A 2PDXA 3ZVHA 3MYPA 5CBJA 1AQFA 3WF4A 1UZDA 3CQKA 2GSJA 2B0MA 1W37A 2WHJA 1V6UA 3GVRA 4PR4A 4GYFA 1PO9A 4GXMA 5I24A 2DT0A 3TJLA 4DZIA 4U33A 3PPFA 1D8CA 1HFBA 2J6XA 5FIPA 4E2BA 3T09A 1YIXA 1JUKA 4JBRA 3VKDA 3WLJA 4AZCB 3VGEA 2OO0A 3LN3A 4DBSA 3GR8A 3W2UA 2OLAA 2VTFA 1ZUAX 5I02A 3B8DA 4UFKA 4O18A 1IQ8A 1WV2A 3R79A 2E77A 1F2JA 2Q8LA 4S3KA 3QZEA 5L9FA 1G4SA 1HN1A 4D6DA 5C7VA 2AMGA 5TQLA 4QEHA 5G4HC 1K9TA 2O92A 1UKTA 4TMBA 1UR0A 5CG0A 3QQ1A 1B9BA 5IHRA 3ABOA 2PMQA 3DDMA 3VD9A 1XBZA 2HVMA 4GI9A 3CL8A 1NDZA 1S1PA 1HG3A 5D05A 4KWUA 3O6CA 4Y9MA 2ZRZA 2Q3RA 3SCUA 1A5SA 4K8EA 5D9OA 3UYIA 1BD0A 2GWNA 4MWAC 4WHBA 3N3MA 1ZBCA 4DLFA 2ZZ6A 5A2CA 3WCZA 1T7LA 4JIPA 2W27A 4JFSA 4UQDA 1ZNNA 3BZGA 4D6EA 3WUFA 3GE7A 4YPJA 2X0HA 3BAIA 1XQKA 5ABTA 1QHPA 1UW9A 4C5ZA 2E5CA 1K8YA 2V5LA 4U5IA 1OGBA 1YBQA 1XIIA 5AECA 1SGJA 2V38A 3M47A 4PULA 3VNMA 1GUVA 3EB3A 4LYRA 5FJPA 3C8NA 3U4FA 1W1TA 3D3AA 3IJ9A 3AO0A 2VX5A 2E68A 1ONWA 4J3WA 1FRBA 4Q8TA 3PR2A 5CPSA 1HQTA 4OECA 2CU0A 1ITXA 4FLOA 3P14A 4GQQA 4FNPA 4AD5A 3WLNA 4WDTA 4FLQA 1W17A 3QV7A 1CW2A 3ZT6A 2QV4A 3CV7A 3SY8A 4Y90A 4O11A 3UGRA 3F4WA 4JL2A 3MUZ1 1SO3A 1Q3NA 2QUTA 3KRBA 5E0KA 3W7EA 3DOPA 7TAAA 5HBFA 4J27A 1W3IA 3VGGA 2OVLA 1ODUA 3S6TA 3KL0A 1G01A 3TSMA 5E1QA 4EPKA 2BGQA 2JQXA 3IGHX 3ABQA 4Y9AA 3TW6A 3DG3A 1Q66A 2ZWYA 2VGGA 3CMFA 2VVNA 3U5UA 4LPCA 3EOUA 3ARRA 4O17A 1HGWA 4HNNA 4XIMA 4AXNA 1W9UA 4XZBA 3Q67A 1WO2A 4AIOA 4W5ZA 1E9LA 5A6TC 1GYMA 2YDRA 5CPLA 3KUMA 2PI6A 3FA4A 3EOEA 2DSZA 1NAL1 4GJJA 5HPOA 1KBKA 2Z1KA 3HFYA 1RR2A 4XKYA 2G50A 3AISA 4S3FA 5CZTA 2EPHA 6A3HA 1CXLA 4M1BA 3WQEA 3LUTA 4OZOA 5AHFA 2PCEA 1H49A 1QR7A 2J79A 3LSCA 3G3MA 4JHMA 4PFHA 1Q4WA 3LCIA 1IT8A 1PX8A 1M6JA 1FBAA 2BG5A 1Q65A 3UBPC 2BSLA 4B9ZA 1A0CA 3DC0A 4A2RA 3AMGA 2YJQA 2F8QA 4H8VA 4YNGA 2ZXBA 3M5VA 5E9XA 2SFPA 3GHTA 1ICQA 3J7HA 1HIZA 3ALGA 2ZVIA 1MW3A 5LIUX 2HCVA 1KB3A 1O5KA 3AYTA 1ZCOA 1ME8A 3GZAA 3MHUA 2WMIB 1XLAA 1W6TA 3BLIA 4EE9A 1H2JA 3MC5A 4E2OA 3Q4DA 3WQWA 5CAKA 1Y5VA 1GKRA 3M5XA 3IJQA 3OLGA 4WSJA 1E43A 1R85A 5AYZA 1ITCA 2XFRA 2V3EA 3EXSA 1RCQA 1AA1B 3TUUA 4UUIA 1ZQ5A 1R3TA 1CGYA 2HSAA 2J9XA 1EOKA 1TIMA 1GVOA 4MJ2A 4IMGA 5DMMA 3WMLA 1H63A 3H7UA 1S2VA 2H90A 2E6DA 2CLKA 2CETA 3W1NA 3DFQA 1BGGA 3C52A 4YTSA 2FGBA 3RIKA 3H12A 3TFXA 1I2OA 3CTTA 5G2HA 3FSUA 4FHAA 4QLKA 3RCYA 4Z1YA 3PWIA 4RJEA 5HR7A 3RX2A 4DZAA 3H8AA 4HIBA 1RLDA 4UTWA 4FP1A 3NPVA 4L4OA 1WE5A 1LRNA 1UG6A 2VQTA 4RNJA 2XVGA 1NM9A 2A3CA 5AN7A 3TR9A 1HJWA 1QXLA 1RA0A 3R6IA 3K1DA 1JD9A 3U2ZA 5FEWA 3RPMA 3GXDA 2XISA 4XO7A 5GJMA 2WHKA 3SIMA 3SB0A 2R82A 4LC8A 3QGKC 1WKDA 2V3DA 1TV8A 1I2NA 2X0YA 1SFJA 1OVDA 3N12A 4V1XA 4PEEA 4IL0A 3Q2DA 5FF7A 5L6UA 3M07A 2CLFA 5G2IA 1H11A 1IXNA 2J7EA 3N18A 4LCRA 2VZOA 1E1EA 3RLHA 4B15A 3EMZA 7ODCA 5C9UA 1A3WA 4G56A 3CWOX 2PRHA 3D3FA 4MDPA 2OWXA 4CD6A 4UOZA 1DORA 3WNKA 4UNLA 3PJWA 1K7FA 4W7UA 3O2LA 2I9UA 4GZEA 4DJEC 2I56A 2PU0A 4UZSA 3GG7A 1EPVA 2C13A 1A80A 4XD3A 2CLIA 2PB1A 3GH5A 3BDKA 4I6VA 1AFSA 4GVFA 4HK5A 1UWQA 3STEA 4A3QA 1UYQA 3OIHA 3ZVIA 1GOIA 4GUHA 4Q8QA 4MUZA 5LZLA 1RP8A 4EX4A 2WVSA 5EMJA 3RUBL 3THUA 1HP4A 3O15A 2OZ8A 3WDQA 3AHTA 1QWGA 5F7UA 3E49A 1OFAA 3L4VA 2I9EA 1CPUA 4N02A 1AMKA 4DJFD 4ZFCA 3N2CA 4U10A 1Q6OA 4FMVA 2EF9A 2IPGA 2C71A 3KWSA 2OZ0A 5FEXA 3IGUA 3G8EA 2NQZA 4PCPA 4QQ3A 2ASHA 3HO8A 2V6AA 1EC8A 4A22A 1NP2A 4Y9PA 4ATDA 4GUFA 5RUBA 1R0MA 4MM1A 4NZJA 3BGAA 3W7LA 3TU9A 3GQYA 3BV7A 4NZ5A 1SUXA 2JE8A 3TOYA 4XB3A 4D6GA 4EWJA 2W3ZA 1PKYA 4QG8A 2E9MA 1D2KA 3PPHA 3UR5A 4KW2A 4C5YA 4JCMA 1XYFA 1CBGA 2CYGA 3SURA 3CHDA 3N73A 1B57A 4H7VA 1AL8A 4HCHA 4B91A 4DJDD 4V15A 4YU1A 2VDIA 4JQAA 3JS3A 2ODOA 3W86A 4DZ5A 2P53A 4RDZA 4S3EA 2IQ0A 3ITXA 4Q7BA 4KCTA 5DBTA 3BG5A 4FK9A 1FWDC 2PWGA 1K70A 1O7AA 3MZNA 3NIYA 3QR3A 3QY8A 2DZWA 3CNYA 1Q4NX 2P0OA 2TRSA 1EJWC 4AWTA 4WVXA 5M1TA 1C91A 5CBIA 3RG6A 1E0VA 2J75A 2JIWA 1JPIA 2WBGA 4X63A 2E4TA 1JCTA 3USZA 1JQVA 3V35A 3TTOA 1JCLA 1QNQA 4PMJA 1RJRA 3VILA 3VD4A 3V0TA 3K8LA 3SCTA 4GI4A 3W88A 1BRLB 1U22A 3SQLA 9XIAA 1H0IA 3NFUA 1KGWA 4AX6A 4Y96A 1CXHA 3NO5A 3WELA 4LUJA 1FHUA 1VCVA 4QTGA 1C9WA 4NQ1A 1VRDA 3W73A 4JN6A 4IQLA 1GHSA 1V93A 1W1YA 1R7AA 4PUEA 1MFVA 1C29A 4MB1A 4QQUA 3IIOA 2CZEA 1ODZA 3MMUA 4U5KA 3W26A 1V0MA 5AC7A 3N2OA 4U4MA 4A4AA 1LWJA 4FNSA 2TSYA 4M5PA 4GISA 3M0HA 3S1UA 1W32A 1OIFA 1VR6A 3MWCA 4UFJA 4PL1A 4CUCA 2WZTA 2F6XA 1VF8A 3AXXA 4D6JA 4QROA 1EQPA 4IJRA 4AZBA 4EPDC 3RJXA 2FHBA 4TV5A 4ZQNA 4LBSA 5E0FA 3FYOA 3P82A 4LVBA 4M0XA 3T6CA 4GGHA 1W91A 3SCQA 4DQWA 1KM6A 2DZVA 3K4WA 3B9OA 3CK5A 4DIAA 2X2YA 3L68A 4PA8A 5IXEA 5AC8A 5HWMA 3O7UA 3KL3A 4GABA 4I7WA 1EGMA 3BMXA 1VFUA 3I3DA 4E6MA 1JXKA 4GY1A 4A3UA 3W83A 2X1UA 3TXZA 3B9NA 2HTMA 1E40A 4ZOEA 2AOSA 5DRCA 3AIUA 1RPKA 2B7QA 4FNUA 3CZGA 3FA5A 4GUIA 3WNLA 3BG3A 2WSRA 1NEYA 4OE7A 1EXBA 5XIMA 3TV8A 4R9XA 1R7OA 2BOFX 3MT1A 4OKDA 5T9CE 5A6KA 1RCXB 3DC8A 4XZNX 3UF9A 1E4LA 5FJJA 3JZUA 2VX7A 1LOQA 3ABSA 1FA2A 3LTPA 3W2JA 3WO8A 2G3FA 5LGZA 1L6SA 5D04C 1I8JA 4UCGA 1VEMA 4F0HA 3CXOA 1MRAA 1L0PA 4PMQA 3B0VC 1XLFA 4JTAA 5LNUA 3GBEA 4KERA 2BY2A 1YW1A 2QGHA 4GIYA 1EJTC 2Y8KA 4PCSA 3SIZA 3GKFA 1XD0A 1KM4A 3ANYA 2A7RA 4JX4A 1AH4A 3BW4A 2Z0IA 1IIHA 1MEWA 4XZWA 3HZ3A 3TQVA 4X3ZA 3BLOA 1QATA 3E38A 4FX8A 4NNBA 5F4WA 4GPNA 1NARA 3AIRA 1GW1A 1UP0A 1TV7A 1X7FA 5D09A 1OFRA 1NU5A 5DQPA 5HAOA 5A6MA 1VJIA 1UROA 4MNJA 3NQ8A 3GSMA 4HPXA 4Q8WA 2NT0A 4Z2HA 5J5RA 3A24A 4FNTA 4NXSA 3TA9A 3GX9A 3UJSA 4JN8A 5DCBA 5HXMA 3GTNA 4IZGA 4JTTA 1UD6A 2ZA1A 1P0BA 3UR8A 4LCSA 1L9WA 2J66A 1TJPA 1W31A 7ENLA 3G0SA 3H54A 3P74A 1FOBA 3LRLA 5SWUA 4DYKA 1GQNA 2YSWA 3OZPA 5KEZA 3RNDA 4JIIX 1TJ0A 1DJIA 4E3TA 3S6OA 4DJEA 3LHVA 1JVNA 3NZGA 2VC6A 1MQRA 3P80A 4PCTA 3VGHA 3VIHA 3BLDA 5AVHA 3OJGA 1BYBA 3JUGA 3R0KA 2YXGA 1XDMA 1PJ9A 3U2EA 2OSYA 3BOLA 4B2DA 4E38A 1XRTA 2QW5A 4KRZA 1XLIA 4HOWA 1TPDA 2FHFA 3HPXA 2FZNA 3EBVA 4RK8A 4XKYB 3LCLA 5EKYA 1XCWA 1TJ1A 3WQDA 4UMAA 4AHQA 3CGTA 2G5WA 4I9MA 2R6OA 1IYXA 3H23A 2VELA 6ENLA 1KCLA 3C5QA 3WNOA 3ABXA 1XIFA 5AZ1A 3QPEA 3L12A 1S3HA 2VFHA 4CD5A 2X41A 2OQHA 1MXDA 3HQNA 2C7FA 4OUEA 1NY1A 3GYEA 4FSAA 4PFMA 2ATMA 4XBJA 3VYLA 1R46A 5F2LA 2B7NA 5BOOA 3ZT5A 1VEPA 2CW6A 3CUZA 2I1OA 1BWVA 2CBUA 5K9DA 4BK9A 2RDUA 3QHNA 4JTSA 5D02A 2PDIA 5CXPA 4RZ5A 2FLIA 1QDSA 5I77A 2J7DA 4GO9A 3N34A 2GWGA 2QVHA 3BAYA 3E2QA 2ZDRA 5H8PA 1OFOA 1TZ7A 3DN5A 3MB9A 2PP0A 1UWUA 3QF0A 4GI8A 4KESA 3F5JA 4DYJA 4K37A 4NAFA 5I3FA 3QYQA 1PE1A 3ZMRA 1UD2A 4XZ9A 4X22A 1EA0A 1WA3A 3UWYA 1F8IA 3W74A 1J96A 1UUOA 4B5TA 3CIXA 2ZC8A 3WFAA 3P0WA 3GKAA 1PPIA 4YN5A 1WOBA 2Y1HA 1PL9A 2ZUNA 3TMQA 1V51A 3OW1A 1YX1A 1ZPTA 1W2VA 2B31A 3UZXA 1PVNA 3ORWA 1LORA 3SUUA 4DUXA 2E9BA 1Y8BA 3GG0A 1V0KA 4YXGA 2I14A 4W87A 2UY2A 4E2VA 5D30A 3NOYA 3PBVA 2YBVA 3BGGA 4RL3A 4AF0A 4XTIA 3S2NA 4X9YA 3O6AA 5A1AA 4JX5A 1GYNA 1FWHC 3LQGA 2WCSA 4DXKA 2EKGA 1CX9A 3EX4A 4MTVA 2PLJA 5A8QA 5CGMA 3W28A 1ICSA 3EKLA 5FAJA 5B7ZA 1T40A 4I90A 3PTKA 4N6FA 1A47A 1W1VA 1B54A 4Z2KA 1EUAA 4KT2A 3PPGA 3VM5A 4UQ9A 2FVMA 2PUZA 4J2MA 5ECUA 4D2JA 4KETA 3MI3A 3OG3A 3KHDA 1FWWA 3EDEA 4XSLA 2QR6A 3RILA 1KBIA 3TNBA 8XIMA 4NJGA 3G3DA 1C8YA 4US6A 3WBWA 5HDRA 5BRPA 1DJXA 1A0EA 4DBWA 4PGLA 2YCLA 1OYBA 1SO5A 2CZDA 1NDYA 3KXQA 2J4GA 1Z3NA 4HNOA 1R2RA 3WQCA 1RSCA 3L0GA 2DUXA 1JYVA 1L6GA 3T0AA 2PDNA 1E73M 1DE6A 3CWNA 2Y7DA 2YYTA 1YTKA 3A5FA 1DEDA 1UR2A 5HR6A 3LHWA 3LXBA 3PK7A 2C6QA 4ZTXA 3B0XA 4ZCWA 2ZCGA 1TV4A 1K02A 3W1RA 2C1GA 4P5UA 1E4MM 3AALA 1WYIA 2DP3A 3NDOA 1QU4A 2G4JA 4B3ZA 1OX4A 2YW4A 5BXTA 5DCDA 1FUYA 5DMLA 2DFAA 4BI5A 3CMJA 3TC6A 4EVZA 1V6YA 1FWTA 3OBEA 3A13A 3RJYA 2NT1A 3N6QA 1BWKA 5JQ9A 4C6QA 3KW3A 4JIHA 4UR7A 3C2FA 2ZX8A 3IRSA 4GZIA 4AD1A 4JTDA 3G18A 5CJ5A 4FF7A 4C6KA 4AUBA 3W29A 1XIDA 3NUKA 1F74A 4XAGA 3LPGA 1N82A 1WUFA 3EOOA 3VK5A 2CWNA 2POZA 3THQA 2IKHA 4Z1DA 3PC0A 4UOQA 2NW0A 5HANA 2WSYA 4DO4A 1A5MC 4I7UA 3TQKA 1H7PA 1FHLA 1WDRA 1X96A 3BANA 4MNKA 3UT0A 4GE8A 1Q5MA 3LCFA 3ITLA 4GVGA 3LRKA 2WJFA 3SGUA 2HQAA 4FXSA 1DQXA 2INEA 4E8CA 3Q94A 2Y63A 4KRTA 2XIQA 2EJ1A 2GDVA 1NTHA 1BSIA 4L6OA 2OELA 2OR2A 4D8ZA 3ZLGA 2RAGA 1TJ2A 1ZENA 3WK3A 3MMDA 1J5SA 1IV8A 2Z27A 1C90A 1NQ6A 4Y8FA 5MKGA 1GQKA 1O95A 2VFDA 2A3AA 5FI8A 2ZX7A 1E6NA 3RLVA 2FPTA 4PB4A 2WJEA 5FSEC 5CGQA 3AS1A 3A64A 3NWRA 4HT3A 4PUDA 4JFVA 4AMAA 3PZOA 3EPMA 2Z1WA 2ZRXA 3W7GA 4OOZA 1B1YA 1EJSC 1EB3A 3VC6A 2QUUA 3W75A 3PWAA 3P3BA 3CHFA 5K9CA 2NQ5A 3P5ZA 5BWFA 5I3GA 1BTCA 1ZLPA 4RE0A 2CERA 1DJWA 1TE1A 4HTYA 2JKPA 4UCFA 3GHUA 4JFWA 1IE7C 1I2PA 4D9PA 2OLHA 2Z26A 3MA8A 5LA2A 3GH4A 3RX4A 3SRHA 3M5YA 1PSCA 3M0VA 3BAWA 3SFWA 1XG3A 2WMKA 1LM1A 3DFPA 1GVQA 1W5NA 1TRIA 4NZ1A 2ZKMX 3KP0A 3SADA 5FJOA 2ZRYA 2OT1A 4D72A 3EWDA 3DI1A 4QSHA 3VNDA 3M6YA 4JDYA 2Y24A 1QW9A 1EPXA 3CM4A 4KWSA 1T96A 1FCQA 1V3JA 1J8VA 1FDZA 2C1IA 4IJBA 3CQHA 4ERAA 3T55A 4MY8A 2GUYA 4GGBA 3C2YA 3D6NA 4C1LA 5I0DA 4U28A 5A8NA 2HK0A 1A5OC 4GZ7A 2V8ZA 5A6LA 3BC9A 3QC0A 2YL9A 2EPOA 4B4FA 2J47A 7REQA 3MMWA 3CZ8A 2CNCA 2CLLA 2LLEA 4LCQA 2HS8A 2GJRA 3NEHA 3TOPA 2OZTA 1PZ1A 1A5UA 4S23A 2ZRVA 1TELA 2XIBA 5B80A 3EKZA 4O14A 5D8ZA 1UPPA 5T9BG 4UMBA 4C6MA 2OT0A 4N9CA 1B4KA 2PWEA 5ABGA 1H1NA 3EEGA 3PUDA 1KFBA 1WNOA 1TPVA 3R11A 4JTJA 1P0EA 2PS2A 4EANA 1G1YA 1YRRA 2FGZA 5BCAA 1QI5A 2ZX6A 1SMAA 1FFQA 2NWRA 2DGAA 1IXPA 4LT9A 3DX5A 3EWBX 4IXHA 3M0LA 4GCXA 4MHBA 4DBUA 4E2DA 3W37A 1F8MA 2Y4SA 3H2AA 4HBKA 4F0SA 3FY1A 2CBVA 3PUGA 1XUZA 2VX4A 2GGJA 4EWND 3TJ4A 3I6EA 1JZ8A 3B4YA 3H53A 1G0CA 1EEPA 1K77A 4H9VA 1XINA 4FLSA 1X6NA 4G1KA 3AU6A 1V0LA 4K1GA 1KGUA 1QAPA 2ISVA 2ZC1A 4DF2A 1RY0A 4KEVA 4LYPA 3TTEA 1X1ZA 1C8XA 4PUJA 4XKMA 3VNKA 5CBBA 1A50A 4QLJA 1EC7A 1IEXA 1HKJA 3C6CA 2W79A 3BSHA 4LFYA 3VOHA 3W1LA 1Z8AA 1CXIA 1NELA 3V16A 1OD0A 2AGTA 3NGJA 1UASA 3DUGA 2Z28A 1GOOA 3WN6A 3LI0A 1KNWA 5A95A 3NQAA 3P60A 4QDMA 4QS5A 3WK2A 1HO1A 1E5NA 1IGWA 2Y89A 2DSKA 3SDOA 4JTQA 3RGTA 4QSFA 4L65A 4M1RA 2HEJA 4TX9A 3V36A 3HB9A 3G1YA 1SZGA 5I03A 3VX0A 3LNPA 4XX6A 1SW7A 5LIYX 1OC7A 3OOQA 5BZAA 4PH6A 1XW8A 2J8FA 4GI6A 2ZXQA 3OZOA 2PCQA 2F9RA 1RCOB 2QCGA 2YFNA 3FJ6A 1NVMA 4DNMA 3NXLA 4J28A 2Z1BA 3N4AA 1UJPA 1AJ2A 3F4CA 4UBPC 4A21A 4FALA 3AS3A 2HDJA 3LRMA 3W71A 1EJXC 2VQUA 1S1RA 1YKWA 2RGLA 4JQ4A 3OVQA 3TFCA 1W1ZA 5EMUA 1T5AA 1XLLA 4U3AA 3L4TA 3IANA 2CPUA 3ZSSA 4QG9A 2BGNE 1HVXA 1DWAM 4CNUA 1GZJA 3EA3A 3NQ6A 1MDLA 3BW2A 3EXRA 3T0CA 1ZSXA 1KWKA 1QOXA 3L4YA 2NXHA 1MWOA 2JIEA 4TO8A 4H2CA 1P0KA 3A47A 2VR4A 3L9CA 2YA0A 5JUVA 4BHYA 4BF5A 2OGYA 1Q13A 1W3HA 2ZUTA 4AY7A 3CIVA 1RZMA 1N8FA 4LW7A 4A3HA 4XIAA 3GBDA 2B4GA 5C5YA 1XYAA 2CZVA 1YXDA 4KCWA 1WZLA 2PURA 1E9IA 4RXFA 5E09A 1TUXA 4DB7A 1V6VA 4MKNA 4P8VA 1B3OA 3T1GA 3RR1A 1JCYA 4OVXA 2CITA 4N6EA 4MWAD 4O53A 2CZFA 3RM4A 5I2UA 3LXAA 4TVCA 2V2HA 1KM3A 4IPNB 1OF8A 4UZUA 1OM0A 4PBEA 3O8AA 4O1EA 4AMCA 1MVYA 2QCCA 5FJUA 2YW3A 4LUIA 1FCUA 1R38A 3AXHA 4YL2A 1WDWA 2J88A 4AEOA 4UQCA 2JF7A 3SW6A 1KR0A 3GNPA 3LYEA 3MCOA 1VAHA 2HNHA 3UWUA 5FD0A 3UZ5A 3DH7A 3W27A 1PIIA 3C2EA 2J74A 4I9AA 4QE4A 2XH2A 4H6QA 4QNWA 1UR1A 3EWWA 4AC1X 3VFLA 4PRTA 1XLBA 2GSEA 3HV8A 4C6JA 2FIQA 1TIWA 3KOWA 1JDAA 2A21A 1VJSA 4GIEA 4FLRA 4R27A 3CPUA 3MCMA 3MYOA 1CXFA 2DZSA 2NXGA 4DPPA 4P7QA 4AF0B 1VFOA 4UQAA 3WYZA 1WKEA 5DT5A 1ZHAA 3CUGA 3I7SA 2VO5A 1BVNP 1TQXA 1W5MA 5C9RA 3BJTA 1LLWA 2A3EA 2F2HA 5HQMA 2CLOA 3QJAA 4PN2A 3DENA 1WX0A 3R4IA 1Q6FA 3E1F1 5C9WA 2P0IA 1IWAA 3LHUA 1EUNA 3OGVA 3OA3A 3PBUA 4BKNA 2OJPA 4AX7A 2WAGA 4W5UA 4KWWA 3MSYA 4MLJA 7PTDA 1N2VA 4JKLA 3NL3A 3QQWA 4UTIA 5CC6A 1G7VA 5FEZA 2PRMA 1GNXA 3OLEA 1S39A 5JBFA 2YCLB 1X6UA 3B9AA 1UB3A 3RR4A 4AZIA 1E55A 3VMNA 1A5BA 4C1NA 1AJZA 3GTIA 3CB3A 3L2MA 1VBJA 2Z1XA 1LOLA 1P43A 4LUTB 4E8DA 3C2OA 4MGGA 5A3HA 4GYKA 1PDYA 3VOJA 1OYCA 4H00A 4WIWA 1K9FA 3W22A 3VCCA 4PMOA 2WPBA 2GUUA 2QF8A 3H2NA 4TUFA 3PN8A 4HPNA 1RD5A 4IHCA 4ZOBA 3TZFA 4M3PA 1R2SA 1PZ3A 1OFEA 1OX4B 3TSBA 1OCJA 3POCA 3AUJA 3AYRA 2NUYA 2NZLA 1QPNA 3UWVA 4JYDA 3WK0A 4KH2A 1XLKA 3IUIA 3IK2A 4F2TA 1S5VA 3LMYA 4I8DA 4REQA 2C1HA 1JDDA 3TDFA 2YCIX 4W4QA 3HQ1A 4CNTA 4JTEA 1XWYA 4WGHA 4C60A 3NZRA 4BQ3A 5K4ZA 4XUGA 3W7RA 3PAOA 3N15A 2GK1A 1OGGA 5C2XA 4IGNA 3KBWA 4XK2A 3UG5A 4B92A 4LEQA 1F3TA 3QLDA 3NVDA 3SQSA 1UBSA 4KFNA 2QCLA 1R3SA 4YTRA 3UWEA 4CKQA 1N7KA 1UR3M 3DFNA 4PMDA 3HN3A 5C70A 1A5CA 3MMTA 2VDGA 3BVJA 3TK7A 3LCXA 1HL8A 3TAOA 1CLXA 5M5DA 7XIMA 4YS1A 1JUBA 4LAUA 1VKFA 2TYSA 1JZ2A 2E40A 4MVAA 4DYEA 3JU2A 3BAJA 4LV9A 1JPKA 2O56A 3BK0A 4ML9A 1TREA 3DFYA 4Q4PA 3GC2A 3N6JA 2OOGA 3DZ1A 4BQ2A 2VUYA 4PMRA 4YMZA 4AWEA 3WQGA 4WOZA 1RHCA 1Q6QA 5FKYA 1EP3A 4EPBC 3IVSA 1BXNA 2J27A 2FZDA 1I9CB 3KP1A 5H91A 1AUSL 5HINA 1ZJBA 1U33A 2OX1A 5CZ0A 3TA6A 3NG3A 2XYLA 1VB9A 2I7GA 1G4TA 3S83A 4CU7A 1KM5A 3PZ9A 4V1YA 3FXYA 3OHIA 4ZTYA 1JGMA 1UWIA 2VM8A 3ALFA 3ELFA 1JPMA 3WDPP 3WDJA 4P7RA 4O57A 1X39A 4ZQCA 2J9YA 2I17A 2QJIA 3E02A 1F5ZA 4C7DA 3HGJA 1F9CA 2OCZA 1S5NA 4PMNA 2Y2WA 2W92A 1RBAA 2PPGA 9CGTA 1M3UA 1CTNA 3L2LA 4F8XA 2ZZ1A 3NXFA 3QMRA 4LS0A 3GNRA 4IMDA 1SVDA 5CLTA 3DU0A 3EGJA 1RPXA 1QHZA 4JDBA 2FZMA 3CZLA 1JYWA 1K9DA 2RHGA 1GTEA 2DIJA 1ONEA 3C0JA 2XTKA 4JQ2A 2W6RA 4TTUA 3N2TA 1XUUA 3VO0A 1VPQA 4ORIA 3WL1A 3WF3A 2OMAA 3ISIX 5BYWA 3ONBA 4DVOA 2INZA 4UFIA 1FWRA 3H24A 4H9XA 1FWBC 1NDWA 2ACUA 4FX7A 4HPJA 4AIEA 2ZTKA 4UTTC 4ADTA 1H51A 3W1PA 4O1DA 3E12A 3NL2A 2WC7A 3ES8A 3KHJA 1L8PA 2A7NA 2OPJA 4AD3A 1FWAC 3VD7A 3ZJ6A 2YCKX 3N3TA 4AY8A 4JTFA 4QG6A 3XIMA 4C6DA 3KBVA 4HNUA 4DWSA 2Y7GA 4PE8A 3CPGA 4AD4A 2WLYA 2Y61A 3KDNA 4OHQA 3SN4A 1KC7A 7A3HA 1RVKA 3BQ5A 3QPZA 1QPKA 3LBOA 1TMLA 2YPIA 1TPB1 3SEPA 1I2QA 1RBOB 1L6YA 4W7VA 4S3JA 4GVIA 3OEXA 1CEOA 1KTCA 3M9YA 1JIBA 3HFTA 4K68A 1TX0A 5LGXA 4RR4A 1Q6EA 4DWSD 5JH2A 3NQDA 2C0HA 3PP7A 4B16A 2AQVA 3RX3A 1SM9A 4QGCA 2EJAA 2BY0A 4L7ZA 3BCDA 3ARSA 3IAQA 4LSBA 1B30A 1NFPA 3E0IA 3EZ4A 4YJ5A 2J7HA 1AW5A 1A53A 2X42A 1XRFA 1ML1A 4BQ4A 1CLKA 3AXMA 3OBKA 4B5SA 2UY3A 4XVDA 5CKSA 3SJ3A 2J7FA 2NV9A 3KAOA 1C3FA 2E6AA 4IQJA 4AHPA 1LWIA 1MSSA 5H2ZA 1H09A 2WKJA 3CHCA 1UWSA 3CIWA 3WD4A 1J12A 1E6XM 2XIOA 2WVUA 2UY5A 3ZWSA 2QEZA 4PMXA 3H2MA 2AAMA 4I6KA 4DBEA 5AHLA 5PTDA 5DXXA 5D8WA 1NP0A 1XLGA 2VWTA 3VNLA 4CD4A 3T0BA 2XM2A 4HA1A 1U5VA 3HA1A 1LG1A 1NSJA 3S0CA 3LV5A 1POKA 3VMOA 3N25A 4HK7A 3TH6A 1H4PA 1GJUA 1KFEA 1O94A 3OVGA 1WDDA 3FYPA 2F61A 5D38A 1XFBA 4WSHA 3T4CA 4FOUA 3DHFA 2Q6ZA 1AZ2A 2DH2A 3WJWA 1EDGA 2BV9A 4AW7A 1MO0A 1BAGA 2W62A 4AB4A 2P3EA 4YVPA 4L1XA 2E8YA 2VT0A 1OJXA 4DLMA 3PJTA 1OIMA 3BH4A 3D46A 3ANVA 4XAFA 5TF0A 2Z29A 3AU2A 4JGDA 1V77A 3ITCA 5D2WA 4YVVA 3I6TA 3QYSA 1GGOA 4Q32A 3PULA 4G7FA 4H3DA 2WMFA 2C18A 2Y7EA 3RO8A 3S5ZA 2HPIA 1GVSA 4US5D 3M1ZA 3IUHA 2OFJA 2WV8A 1IHIA 4M19A 2QCMA 5C2GA 3ZO9A 3IJ6A 1UMYA 3QHOA 3MSDA 1EGZA 1YHTA 5CZJA 3M0YA 1KCXA 3EPOA 5A6BD 5A8OA 2O9RA 2XN2A 3T4WA 1YDYA 4MB5A 5HNUA 1A4LA 4IMEA 5G2WA 1JD7A 2ZA3A 3IVTA 3O05A 1L6FA 1I6NA 5A2BA 2GQ3A 5IHSA 2OWCA 4QITA 1A49A 3UWWA 3UR7A 4KGJA 3MP3A 3GW0A 4RPQA 1WQ5A 4JTGA 1KXTA 4XZLX 1DWIM 5BNKA 3KOZA 3W38A 3N9KA 5IFPA 3WUBA 4UTMA 1O60A 1FWSA 3GVVA 3HPFA 3B8SA 3VAVA 2PDWA 1T8XA 1KM1A 2GDQA 4Z17A 2PF0A 3AIVA 3QEZA 1JDCA 1GORA 4U3CA 3ZXWA 3AIQA 1W9PA 2A3LA 1XCXA 1JCNA 3PZVA 3UXKA 2XSBA 4ZO6A 2VEFA 3WQ4A 3MUXA 1LP6A 4CNSA 4UTKA 4P61A 2WHLA 2IW0A 1SSGA 2NV2A 2XG9A 3MJYA 8CGTA 2A0NA 5F1VA 4W89A 1KM0A 4RE4A 3UU0A 2HVOA 1KFWA 3W1XA 5KZDA 3VPLA 1IF2A 3FCPA 1HNYA 4FOJA 2G3JA 1F73A 4M6VA 4A8NA 2E7FA 4W8BA 1OZQA 3VCNA 3TTSA 4GK8A 4HTBA 4W86A 1WBJA 3DFHA 4K7VA 2QCDA 2WCAA 1QNVA 5J8LA 2BY1A 3KRUA 4HN4A 3O6DA 1Z41A 3TW7A 1EBHA 3WZ0E 2YL5A 4GH3A 1DL3A 1N8WA 1J4EA 2QCFA 3RO6A 3ARTA 2W63A 1RK5A 1EJ7L 1UJQA 3FVMA 1SZRA 2ZOXA 1CGWA 4N9DA 4RZ4A 4LV4A 3EWXA 1CLVA 2C3ZA 3CQJA 2E25A 3C3NA 4MPKA 5FF3A 5LA0A 1EQCA 1V3IA 4V2XA 4CQ8A 3GAYA 3S8HA 3LZ5A 4LVAA 1BYDA 1LLOA 3SUWA 3NPXA 1NOUA 5E5CA 4XD4A 1VLWA 2WMIA 3AMDA 2QDDA 2WNNA 4HOXA 3NGFA 4H8UA 2J7GA 3WJSA 5D37A 2XFYA 4L9YA 5HWJA 4C1NB 3GWQA 5E9AA 4O0KA 1A3XA 4F3HA 2CESA 1BYAA 4D1JA 4QXIA 3IIZA 1KA9F 2WKLA 5AY7A 3UJ2A 3R89A 4K3ZA 1FQ0A 1Z48A 3BXWA 3EEZA 1NFBA 1VD6A 4R7JA 3V75A 3HIJA 5A6AA 1J6PA 3A12A 5HNNA 3KTSA 5AC5A 2PGRA 4L5ZA 4NF7A 1K03A 5DMNA 3ARWA 3NSXA 1AH0A 2WWDA 3ITTA 2B7PA 1VQTA 2Y8VA 1WAUA 4JIEA 1W1IE 1NWRA 1GEQA 3LCHA 4ZB2A 3BL3A 3QW3A 3P93A 4QJ5B 1L2UA 4IISA 4YYCA 1KW1A 1XKYA 2HV5A 3PZQA 1HP5A 1XIMA 3SGZA 4AVOA 2GK1B 1QBBA 1YTEA 5D2VA 3GAKA 2BVTA 4B3KA 3KTCA 5CPMA 2GVLA 3VKAA 2VWSA 1KFLA 4IJCA 1S5MA 3TONA 3GTFA 5EB8A 2WCGA 3UZJA 3AIBA 1EKOA 2E09A 4CN4A 1O1HA 4G7EA 3K46A 1ZBWA 2MANA 3FGCA 3DG6A 2D69A 1JXJA 3T78A 3WF2A 1RY8A 1BG9A 4JNZA 3URAA 1ZCCA 4I3GA 5HPCA 3R13A 3VGBA 5HNRA 3EKGA 1PX4A 1JCMP 1CYGA 1XSIA 3N9SA 3WBXA 1B3ZA 3GUGA 4F48A 2PBOA 1LQ2A 1S3TC 1E6QM 2R1MA 2PODA 4S3CA 1IWPA 4XBSA 3QPYA 3GVGA 1GJWA 4LNCA 3TYUA 5CLWA 4IIDA 4WJXA 4H6EA 1JF6A 1VBRA 1P48A 1V02A 2ABBA 4PTMA 1VGAA 5A6SA 4O8RA 1W3JA 4JTHA 2Y6ZA 5ENLA 1J0HA 2HE5A 4GC4A 5DBUA 4WJ8A 4FNQA 3N11A 1V7AA 3UVAA 1IEWA 3POHA 1QHOA 3IPWA 4N2YA 4S2CA 3UG8A 4Q33A 4ZB0A 2GYIA 3FW6A 4JYFA 1WZMA 3EYPA 1B0IA 5BROA 1ECEA 1OINA 4I5XA 3A3XA 3LNMA 3VNZA 3UNTA 3MY9A 3TYZA 3G22A 2R91A 1QBAA 4XG1A 1OYAA 2V69A 3R7MA 3DIPA 4M51A 4HHLA 4XSMA 1KLZA 2NSXA 2IQDA 1LQAA 2OYLA 2ZZ3A 1L2QA 3WQ8A 4O54A 4MB3A 3QOMA 2QYGA 3SQMA 3OVPA 4PL2A 3W6LA 1UC5A 1XBYA 4YTUA 2FH8A 5DELA 4EACA 3WD2A 1XL9A 3KVKA 1Y5WA 2FMNA 1XP3A 1HKKA 4YHGA 1TSIA 2NVDA 1JAKA 1IT7A 4HNLA 4DRSA 1HTIA 1U1UA 3QGAC 3IJLA 2R1PA 1CB2A 1OK4A 3F5KA 3K13A 1WOAA 1E3XA 4ZEPA 5JU6A 2X30A 3FNDA 3GVWA 3HPAA 5A6JA 3V0UA 3FOKA 2ALDA 4UFHA 3TXVA 3BSMA 3LG3A 4CEXC 3TN5A 2PAJA 2G37A 5HJLA 1TV2A 2BMBA 2QUVA 1JJKA 3R8GA 4TQTA 2RFGA 3PZMA 3LLFA 3B06A 4E0CA 5J04A 5HQLA 4LEFA 5F1UA 3LD5A 3AI0A 1P5BA 1J18A 3G6LA 4RZBA 2VCAA 2PGWA 1RA5A 1UD8A 3WEZA 3DKLA 1LG2A 4Y2WA 2ZRWA 5TAOA 4CGTA 4EF8A 3QXBA 4ATLA 1U30A 3VIMA 3UGVA 1HVQA 4B3LA 2XVNA 3N6HA 4DWSB 2G8ZA 1NOFA 4HZ6A 3S5YA 2E6FA 5XIAA 4GUGA 1SO4A 2WANA 1FWEC 3MKCA 3B9EA 3HQOA 3VZXA 4DUVA 2BASA 4NG3A 4IP5A 4ZXLA 1EHAA 3MVTA 5D03A 1DTUA 3N4FA 4OOUA 4HVXA 2VZTA 1OSEA 4HA4A 3W2KA 1ZP3A 5JXQA 1ZP4A 4B90A 3FX4A 4CVUA 2YA1A 2ZXAA 4LVDA 1H7OA 5DCEA 3CS2A 5EYWA 2IKGA 1BRLA 3IRDA 1Q45A 3NO1A 2WM1A 1EX5A 1TWIA 4CNNA 3MI6A 4TIMA 1UR9A 1OCQA 1MDRA 3WLKX 1KBBA 4IFOA 1JDFA 2GZXA 4LU0A 5AVNA 1XXXA 4MKSA 4NJKA 2W5FA 1SR9A 1K4GA 2YOCA 1FWNA 5EMMA 1JZ4A 4HU0A 1QASA 1EO7A 3NL5A 1F05A 3S5NA 2V5CA 3W84A 5BMWA 4AU0A 4O52A 3WG6A 3XINA 1UIPA 1XLCA 4C65A 2G3MA 1XLDA 1Z9AA 4UOJA 2W66A 3ARQA 3IWPA 4Q4MA 3I7QA 1GEHA 1VBGA 1V03A 1A5AA 1RQHA 1PZ2A 3H6OA 4AD0A 1VFTA 2AMXA 2BFGA 1MEIA 5HNTA 1GKQA 3NQEA 1O66A 1HJUA 3N2XA 2QGYA 4F0RA 4M8UA 1KCKA 4KBXA 1YMYA 4ILSA 5D2YA 1EEXA 2VKZG 2DEPA 3L4UA 3OLDA 1IR1A 3MDWA 1EIXA 2DDXA 3N4EA 4WZHA 2DJLA 4A8IA 4NX5A 2UV8G 4Q3MA 1N55A 3ATZA 2GQ9A 4BJHA 1XSJA 3LPFA 3F5LA 3NO3A 4BR1A 3JW7A 4X2PA 5G1YA 9XIMA 1TTPA 4BFAA 1UZ1A 2DQWA 3H4GA 3R10A 3NQ7A 4HSOA 2VI0A 3V0SA 3VKCA 4Y9NA 4URIA 3QZAA 2YR1A 1KM2A 3HU7A 3ZOAA 4KGLA 1HJXA 2G97A 3PWGA 3SJNA 2VGBA 3CUIA 2CLPA 3U57A 4O28A 4CVWA 1EF2A 4DJDC 2UBPC 3OO2A 3O6YX 4KRUA 1R47A 3NOEA 3AWNA 1HKIA 3C2RA 4DF1A 4MPQA 3WIJA 4ZFMA 2EPLX 4CLMA 6TAAA 5A8GA 1J6OA 2FKPA 4KF1A 2WMGA 3LHYA 5IFTA 2ONEA 1IIGA 1HW6A 1PCWA 4BWLC 3C2VA 1DXEA 1PAMA 3GFYA 1SZEA 2WZMA 1T6MA 2EQDA 3SCOA 1ZJIA 2AGKA 4ERGA 2WMHA 1NJJA 3ERPA 1PTDA 4EKJA 3TZNA 1BKSA 2ABAA 2HS6A 1LBLA 2VRKA 4X0VA 1QI4A 3VIKA 3L66A 3A4AA 2FHCA 1DIOA 4RLIA 3ZM8A 3M64A 3W7HA 4A3YA 3ZLFA 2DV0A 3P8JA 3S6DA 1HX0A 2O4QA 3KL5A 4YWIA 2QXWA 2E5DA 4Y6GA 1BYCA 1OFDA 3KFTA 1J0KA 3K5XA 3SCRA 3L4ZA 5HWNA 2WZIA 5U4NA 3SM0A 1SSDA 3ZQ9A 1JUEA 2FGLA 1ZBVA 1R9ZA 3HG2A 4GRSA 3BOFA 3NEVA 3AMKA 1TVPA 3WF0A 3KBNA 4EK7A 4ZQOA 1B31A 3BE7A 1TTQA 4LBUA 1R5YA 4LALA 4XTDA 4J4KA 3VD5A 2Y7FA 1BG4A 3LI1A 4HGXA 3I68A 3MHGA 2HWGA 4Z1BA 2GUBA 4OTKA 2CLHA 2J78A 2O0TA 4KCUA 4M82A 3L4XA 2DSWA 4GKTA 2J8GA 2FYMA 3U9IA 2QCDB 1EH9A 2VX6A 4NYYA 4K8HA 2PWVA 5TBOA 5D2XA 3W7MA 3GNNA 1VFMA 2HVNA 4GH1A 2CZ5A 1P7TA 3WLSA 2JKEA 2BOEX 5LIKX 3SCPA 2XZ7A 4J9JA 3CPRA 4BI7A 2QS8A 2L5HA 4MY1A 2FTYA 4RPPA 1GPFA 1DHPA 2Z7KA 1ZAJA 3ITGA 3BTNA 2PLMA 3UJEA 1BVWA 2H3BA 2VL4A 3STGA 3EA2A 3L21A 2XU2A 3GG8A 3C3UA 2NWSA 1AG1O 1PDZA 4HYVA 4NILA 1W2PA 3TR2A 2P5NA 5G4WA 4RDVA 3VOGA 2CEQA 2ACSA 3B8IA 4H41A 2F7FA 1A3HA 3S1WA 1XLJA 3CLWA 3H70A 2FJKA 1OZMA 3OODA 4I5RA 3TC7A 3SRKA 3SUTA 1XC4A 2D1ZA 1GG1A 3JVAA 3R5EA 1AMYA 3MJMA 1P4CA 2YX0A 1ITUA 4JEQA 3OHMB 2KX9A 5HQEA 3ATYA 3GXIA 2I5GA 2ZXDA 5AC6A 4XV0A 1L8NA 1JG9A 3F4NA 5AYBA 1LBFA 4QRNA 3K4AA 2P50A 4B5XA 3KTXA 3UZYA 3PPCA 4JNMA 5EBAA 4QCEA 4LVGA 3NJ3A 5H6HA 1REQA 5EGRA 1ZL1A 4WLCA 5FCZA 5I3KA 4HPGA 4WEVX 5C8BB 5LXXA 4DXXA 3L2IA 2O9PA 3HGOA 2B81A 5HMSA 4BEQA 2J77A 3RMJA 4NRRA 4IUGA 1H7XA 5AOUA 5CC5A 1FWJC 3O1NA 5CH9A 3NZ1A 5HA7A 2R14A 1QFEA 2BP1A 1K7XA 1M9HA 3UEQA 4LVFA 4LWWA 4WY0F 2PDKA 4G7EB 4ZVJA 3FGCB 4GINA 4DM2A 1MMFA 1FXPA 3O06A 1QTWA 2NQ9A 1BF6A 1SJBA 3OVRA 1XBXA 1PTAA 3WDHA 4C7GA 2VEKA 1JZ5A 1S2CA 2GVYA 3M7SA 1E0TA 2ON3A 1M7XA 4KWVA 4CQBA 4H7ZA 4IFKA 4H9ZA 3W7CA 3GDLA 1LT7A 3VIJA 5EFFA 1BXCA 1LUCA 2FFIA 2XGIA 4AY1A 3H2CA 3STCA 3W87A 4F2UA 2ZUUA 4MADA 4F79A 3PBWA 2P76A 4H9TA 3GZ3A 3GIPA 3OGRA 4LUYA 4FXJA 2VR5A 1I45A 1US2A 2OYKA 1AD4A 4FB7A 2QJMA 3IJIA 2OQYA 5T8GA 2C19A 3UETA 4FEZA 4DNHA 4HQVA 4IICA 2VC9A 4CCZA 4DJFA 3FJLA 3SCNA 1JULA 3VNJA 2ALRA 2WC3A 1US0A 1FP8A 1DQWA 3HOJA 1JRBA 3VDCA 3AAMA 3VDBA 1DXFA 2ACRA 4J3SA 2WO5A 3OZMA 3CTLA 1AZ1A 4PB5A 1TE6A 4UQBA 3LS9A 3TLLA 2IQTA 3DBNA 4OT7A 4H8NA 4Q22A 3EDJA 1F7BA 1HZYA 2ZDSA 5BXPA 2XVKA 4GJIA 4JIRA 1X1NA 3BMWA 4MYAA 3QV9A 4IPJA 1HKWA 1GTHA 5LIWX 3REQA 3KEHA 3S1VA 3L4WA 4DJDA 4UMCA 1Q8AA 3GK0A 5CPOA 1GONA 4O0QA 2XWEA 4PUNA 3WH9A 3N2MA 1CI1A 3DERA 4MJZA 4QEEA 4EF9A 3UCCA 1XLHA 3RCMA 1GVFA 4ZGYA 2EAWA 1GKPA 1J0IA 4BWLA 5KTLA 2QCNA 1W1PA 3I10A 2Z7GA 2BGSA 4F0KA 5KITA 4HHMA 3E0VA 3CT2A 2WZHA 4LGXA 3LCWA 3AWOA 4M56A 3CASA 4D6IA 1XYBA 2IPJA 4Q4OA 4PCFA 3LTYA 4IL2A 1F3XA 3GTHA 2Y0FA 2OXNA 1C93A 4S3DA 5M3WA 1AQHA 4PEKA 2PD9A 3OQ8A 1OCBA 1FP9A 2DZPA 4JY9A 3E5BA 2D23A 2ZTJA 3BZJA 1G67A 2XN1A 3C4UA 4AD2A 3I4EA 2PTDA 2D0FA 4WQ6A 3W70A 2V5BA 1C8QA 2R1KA 4ZOCA 4NZFA 4RNIA 4LXFA 2PDGA 1VPYA 3GDKA 2XH4A 3YPIA 3QN3A 4R33A 1E3ZA 4PSPA 1JNEA 1ITQA 3G1RA 2DIKA 4MMWA 3QC3A 4XD5A 2DZAA 4WD0A 4WXZA 3MV01 2ZUSA 3FIGA 3IV3A 1Q6GA 2PE4A 5D9MA 3M0IA 3W9ZA 1XRSA 1SU5A 3TP4A 1MZRA 1SR0A 4JCLA 2PZ0A 3CWHA 3QMSA 4FIQA 4XZIA 4YHEA 3R43A 5A69A 3V18A 4MZYA 3G0XA 3TNOA 1B90A 4NY2A 1I1XA 2WJDA 2OZ3A 4M80A 4Q4SA 2CBIA 4ZXOA 2HBXA 4POCA 1VRXA 5A8MA 1DJYA 3IJDA 1D8WA 3O0KA 2Y70A 3RPTA 4S1FA 3SN0A 3CUHA 2XHYA 3NQCA 3TWAA 1XR2A 3BJSA 4RZ6A 2QT3A 4UXDA 2YB1A 2QAFA 4M6PA 4MB4A 1QNPA 2CHOA 5ECVA 4GHRA 4Q8PA 1E1CA 3KE0A 4O0ZA 2Y5EA 4HZ8A 1XH2A 4N9EA 4JS3A 1DPMA 3CZKA 1A0DA 4MIMA 4Y9OA 3MV11 1OFPA 5C9XA 2W4XA 3PNUA 1XIEA 3UY8A 3VDGA 3AICA 5FEPA 3VVGA 2QPSA 1LRQA 4JEJA 1B9ZA 5GNXA 1U83A 4GYPA 1M03A 3K4DA 1OFBA 1EHNA 3NPUA 1VCGA 1MFUA 4PMVA 1NIUA 1E9ZB 1DKWA 4I7VA 2QDHA 3WENA 4AZ6A 4CN1A 4MYXA 3M0XA 5IDZA 3F2BA 1D9EA 1X38A 3RDKA 3P6LA 2HRWA 1EWDA 1LROA 1LRTA 5I5RA 3TW9A 5BW6A 5EMYA 3SZ8A 3NVTA 2WNQA 1E70M 4WX2A 5EMLA 4W8AA 4WOQA 3VDAA 2J9ZA 2QLYA 4GWEA 3FS2A 3GC5A 2YYUA 1XLMA 1EXPA 2F38A 2WJZA 1V3HA 5DN1A 4FXRA 2Z2UA 4JTCA 1TR9A 1KXVA 4YYFA 2OG9A 4ORMA 3Q65A 4YWSA 3NTYA 2YZRA 2YXXA 4JY8A 5KMYA 3M43A 2DH3A 2PWUA 2UZ9A 2VZUA 5DF0A 1J01A 2CKRA 4NIRA 1M53A 4A3RA 1MNSA 1ME7A 3R8RA 3RCNA 3LLXA 1OT1A 3P7YA 1K8ZA 1B5TA 3B4UA 3T8QA 2ZQ0A 5I6SA 4Q6XA 2DQXA 5E70A 3KCLA 4O19A 3F1QA 6XIAA 1XG4A 2XIIA 3UZZA 3WNPA 4MLRA 1K6AA 1Q6DA 1Q7MA 4LS1A 3LHTA 1XH1A 3OGSA 1VZWA 4RV8A 5HJYA 4EPEC 1Q8JA 5C55A 1XDLA 4TX6A 3NM1A 3CBWA 2BTMA 3W7QA 3K30A 3VKJA 1SZNA 4HU4A 2C14A 4AH7A 4YCOA 3H7VA 4ZB5A 1J5TA 2VFIA 4HMNA 3HM7A 2P8BA 3M0MA 4C1KA 4N42A 1XQLA 2OU4A 4S3AA 8TIMA 2ZUVA 2HXUA 4IGMA 2C79A 3L5MA 4Z2GA 1TPEA 3W7OA 3S2MA 1XLEA 1QI2A 1W8GA 1V6TA 4E4FA 1VLIA 1A5KC 2XPKA 5C9ZA 4PTXA 2GVGA 2Q8ZA 1VFLA 2EPKX 3BPWA 1WZKA 4HZMA 4ASTA 4WR3A 4UIOA 4JKKA 1J93A 1BTMA 5DY3A 3P84A 3FA3A 1M04A 1TG7A 3W7KA 1Y5XA 4WXYA 1J0JA 4QBXA 2R8WA 3BLFA 4AC7C 5C2CA 2PRLA 1GVIA 3T07A 4WDUA 4DO5A 4JFUA 3WMSA 3WBYA 2BB0A 3PB2A 4UFMA 1XGEA 4IFRA 1OGSA 5CEWA 5I3IA 4PB3A 3W6YA 2RGMA 3UERA 1P7TB 4XAYA 2ATSA 3MQTA 3UA3A 4XQ6A 3WDIA 7TIMA 2ANUA 4CQDA 4LYQA 4A6GA 1UHVA 3WKZA 4B5UA 4XWUA 1X1OA 5AC4A 3ITVA 2GPTA 3L5LA 3CHEA 3A5VA 1PKMA 1VIWA 2YDQA 1W5QA 4RDYA 2BWGA 2VYOA 2WM0A 1KTBA 2EPNA 2XH0A 1XKJA 2A85A 3IJ7A 3MW7A 3AHXA 3ECQA 1FDJA 5G5IA 3UWQA 1ECQA 1JQXA 3SRFA 1TPH1 4J3VA 3S1GA 3W6MA 2GJXA 3STFA 4GX8A 4MUPA 1J11A 4ENLA 1QOQA 4ICMA 3GR7A 5K2ZA 3JR2A 4ZODA 1UA7A 4K1WA 3B05A 1JFXA 4E4UA 4O1AA 4EXBA 2YA2A 2ZFAA 4LB4A 1VENA 3MWAA 1H7NA 1G5AA 1S2UA 1LYXA 3W76A 1AW1A 2RDTA 3BAXA 2QIWA 3UESA 3VX1A 1GCYA 3LENA 4NRSA 2YLLA 4F9JA 2GVEA 4J3ZA 4UTHA 4TMCA 1DIDA 3NM3A 1BKHA 3TCSA 1REQB 3NAVA 2A4AA 4K36A 4EIVA 3U7VA 4Q8NA 5JMUA 3NA8A 3JRKA 8RUCA 2QPXA 4KFOA 2F6KA 3HV9A 4MY9A 4GG9A 3IS4A 4CCDA 1XX1A 3QFEA 3RU8X 3QVQA 3WD0A 5T26A 4FAMA 3PSVA 1QNSA 3TYEA 2C91A 3FHAA 3TCEA 2O4MA 2W91A 1EP1A 3AMCA 4K8GA 4LAZA 2O7SA 3WLQA 5M17A 4ES4A 3OPSA 4HYWA 2OEKA 4O50A 3SCSA 5I79A 1XFCA 3DYOA 1BPLB 2ZUWA 4UB9A 4IQDA 1TVNA 1H5VA 2PGEA 2WOQA 1KKRA 2G96A 4B5VA 2FZ9A 4RE3A 4P8WA 1E72M 3W3OA 3PJUA 4IFKB 4I5UA 4PRWA 1YTDA 2ZX5A 4NJJA 2WW5A 1LTDA 3W53A 4BF7A 1M7PA 2XZ9A 3VMPA 1ESWA 3QSTA 1LUCB 4LYKA 2RH9A 3TN3A 4LUTA 1TRDA 5DFAA 4KEMA 2FVLA 3GW3A 4HU3A 3B9DA 2P88A 3OZYA 4NAEA 4LRTA 1WXJA 2PWHA 3AHVA 4DO6A 3MDUA 3RRXA 4NX0A 5T91A 3VGDA 2GJPA 4IGSA 4AEFA 1PX3A 5GJNA 1QO5A 3IK4A 3PSWA 2E5BA 2CHRA 5FL0A 4OV4A 3SAZA 5I06A 3S1XA 1E51A 4O10A 3KS5A 1FHDA 1UWRA 3B3DA 3ZT7A 3G5EA 3CB8A 5KZMA 2B7OA 1TR1A 5I3HA 3LM7A 5AHEA 3S5OA 4H01A 4F2BA 5CG7A 3AOFA 1VPXA 3LDVA 4OJYA 2J8TA 3RITA 3SSZA 4DI9A 4GNJA 1PKLA 1GVRA 3OA5A 3KZSA 2J7CA 4LY4A 3H55A 3W1TA 2INFA 4IH3A 4Q4RA 3IIPA 4NASA 4HSHA 4MSSA 3KVMA 3CV1A 1BQCA 4WSKA 3EWUA 4AISA 3LB0A 5AYIA 4IMAA 2JGQA 2A79A 3REQB 5DANA 5EL1A 3EX2A 3AXKA 3A22A 1MXSA 3HBLA 2QV5A 3DG7A 2YIHA 1G9HA 1NQKA 1AODA 4JHZA 2OEJA 3CQ0A 4LBRA 1V3LA 1TMQA 3QSRA 1GT8A 3QMTA 1SW3A 3IAPA 2D0GA 3LOTA 2PWDA 4GACA 2BOGX 2DZUA 3FJ4A 1CB7B 1S2WA 5KSWA 3JZEA 4HNTA 4ZO9A 3HMJG 3PZUA 1ZALA 2AL2A 3VA8A 3H26A 2JKAA 2V82A 1S5WA 4JN7A 2OWWA 4L9ZA 3SECA 3EWZA 4RW5A 1VBHA 1KFCA 2FDSA 4I8YA 1GYLA 1JPHA 3NDZA 1XPGA 3CAQA 3UJRA 3S9ZA 1I4NA 5DO8A 1F3EA 2GJNA 3BICA 1I0DA 3PG8A 4GNVA 2GL5A 3IUDA 3TTQA 4HN8A 4QIUA 1LBMA 5FF4A 2IXVA 1HF6A 4AG0A 4TV6A 1NDVA 3FAWA 1HJSA 3M0KA 2IXUA 3QM3A 4XZMX 2XIMA 1R8LA 3GG1A 3NSMA 2XH7A 4H6KA 2RDXA 3C0LA 1E15A 2QPUA 3T08A 1W56A 4LNYA 1WDPA 4G6CA 1TFVA 3MUY1 4ML4A 2V30A 7CGTA 1GG0A 4G9PA 1F4HA 4ICNA 1O5QA 1O1ZA 4F9DA 8A3HA 2VFEA 4P8UA 4WCJA 2TPSA 1W1A1 1XIJA 3TQ0A 3T05A 1PYFA 2TAAA 3W23A 3IV8A 4PCNA 2GVJA 1EJUC 1QRQA 4Q8OA 2QHAA 2WYSA 1I1WA 3C0SA 2BX7A 2PC4A 2NXIA 1QPOA 2RUSA 3BCFA 1EC9A 2V5JA 4V27A 5D4YA 3VXGA 5C71A 1VP5A 1ISYA 1QI0A 4IF2A 3WQVA 4J2PA 4UR9A 1JZ3A 5ABHA 1OABA 1S5TA 4BCEA 3IGSA 1LF1A 3DYMA 3N19B 5MF5A 1Q7QA 1VBUA 5BXRA 2QDGA 1NF7A 1JCJA 4AEEA 1BWLA 4FX6M 3B0PA 3AJ7A 1AJ0A 1OQFA 3GFZA 1TPUA 1E1CB 3AYVA 4GY0A 1UH4A 1Q6LA 1RJPA 4C6CA 1LL6A 1F61A 5I23A 1UMLA 5AFDA 2XUCA 1F6YA 2GGIA 2GLKA 3BAKA 3LA4A 2Y85A 3ARZA 5LA1A 4D71A 3AZTA 4WKHA 4HU8A 3ANUA 2ZVRA 2A1YA 4ZR8A 3MBDA 4P7OA 1OWQA 4U2ZA 1TPC1 1GJPA 1E56A 2XM1A 5BU6A 1XDJA 2GJLA 1DIEA 4YTQA 2VXNA 1VYPX 1VEOA 3N1AA 3NR0A 3P61A 3M46A 2Z25A 4QM1A 1GW9A 3R2GA 3T0DA 1R86A 3UA4A 1ADOA 4G8TA 4UC5A 3WH8A 3WH7A 4UTUA 1TPWA 3EOSA 1RVGA 4S38A 1FVPA 2HXTA 4R9OA 4EOUA 1XRVA 4HCDA 2X1TA 8XIAA 1FKWA 1M7JA 5I3DA 3T81A 1PYMA 3VGFA 4UTFA 3F2CA 5A2AA 3B97A 2VENA 4MDOA 4Q7IA 3S2JA 4QDWA 1B3YA 4QJ4B 1XD1A 1UOZA 2EGZA 4M7TA 4Z1AA 4EP8C 2IUZA 5FJRA 3ZJ7A 2XSAA 4OBSA 3IGXA 2C0AA 1B3XA 1TB3A 3TSDA 3UZWA 3WLTA 4ZZ9A 3DKJA 2OYMA 3SFKA 3CLMA 3G24A 1TUFA 2P3ZA 1PS9A 3E96A 1CZ1A 2GDUA 2Q02A 1CIUA 4HMEA 2GOUA 3W4RA 4KPLA 1H1YA 5EU9A 3ZWTA 4EAYA 1EGVA 4INFA 4HK6A 4W93A 2E8ZA 5K4XA 1Q2RA 3DFTA 1PEZA 4IG2A 1W0MA 1ZJAA 2E1DA 1OG0A 2FB3A 3GVQA 4LF2A 4QJ1A 1YADA 1VC4A 1WZAA 1JNDA 4HKPA 1OF6A 4F0LA 3KVJA 2CHNA 2ZYFA 4IIBA 1V6WA 1UQZA 2R94A 2VMFA 3CV2A 3LQLA 1E1FA 4ZOAA 2PTYA 5JVLA 4F0MA 2Q01A 2CLMA 2BVDA 3UCDA 2X1RA 3QLLA 2D0HA 2XSXA 2BXZA 1LLZA 4AYGA 1KLYA 1C92A 4QJ3B 1DJGA 5CC3A 1ENUA 1D3GA 3CYVA 3WQ5A 3SCWA 1PBGA 1CXKA 1OD8A 2E9LA 1J0YA 4MOZA 1OX6A 6TIMA 2GSHA 4AYSA 3CU2A 1QW7A 3LBCA 3V1HA 4JPGA 1Z89A 2PGFA 3B40A 3QV8A 4Q4QA 1DP0A 2POTA 5EFDA 4OV9A 4C90A 1QPRA 1YNYA 5IBXC 4MWAA 4FS9A 3STPA 1CNVA 2PDYA 5FACA 4M6QA 1R30A 2NV1A 1V02E 3I3EA 2FMOA 3C86A 4FPSA 3T2OA 1YXCA 4L1WA 2ACQA 3GFXA 1EZWA 3H4WA 3HJEA 3BQ6A 1VIZA 3BV4A 2E6YA 1DWFM 3LSBA 2IKIA 3UP8A 1TV5A 1AQ0A 1GPWA 3UVIA 5CSUA 1FH9A 3DGBA 4DEFA 4RUBA 3WLHA 4DWSC 1D7FA 4D1IA 5HUOA 3R25A 4GD0A 3CEPA 1YNQA 3CUXA 4N0RA 2I5QA 4JYEA 1TO3A 3QGVA 3QZ6A 3BMVA 3HMCA 5BXSA 1EP2A 2GJXB 3THAA 3TN6A 1Z69A 3VCRA 4ACYA 3HPSA 3WQFA 3EPNA 4JNYA 2WNZA 3F4DA 2YB4A 3N2BA 3INPA 2VR2A 2BXVA 4O4VA 4AWUA 4KEZA 3U6WA 3ZR6A 3W72A 4PSRA 3T40A 4HP5A 1TZ9A 1KD0A 4CQAA 3W85A 4A29A 1TZZA 3GHRA 2H3DA 4C6NA 1D3CA 1V3MA 4OGZA 3ZS4A 2Z6JA 1NOWA 2ZICA 3EDKA 2DW7A 1EZ2A 3D5HA 4GO8A 1AQMA 3ARVA 3DAQA 4XUYA 1VFSA 4KS0A 2X0SA 1X98A 2FH6A 1ZRQA 4DAIA 1HUVA 1M7OA 4D8LA 4K38A 1ONXA 1OY0A 1XM3A 4N7QA 4M6UA 4TU1A