2HRWA

Crystal structure of phosphonopyruvate hydrolase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
290
structure length
281
Chain Sequence
MTKNQALRAALDSGRLFTAMAAHNPLVAKLAEQAGFGGIWGSGFELSASYAVPDANILSMSTHLEMMRAIASTVSIPLIADIDTGFGNAVNVHYVVPQYEAAGASAIVMEDKTFPKQELVRIEEFQGKIAAATAARADRDFVVIARVEALIAGLGQQEAVRRGQAYEEAGADAILIHSRQKTPDEILAFVKSWPGKVPLVLVPTAYPQLTEADIAALSKVGIVIYGNHAIRAAVGAVREVFARIRRDGGIREVDAALPSVKEIIELQGDERMRAVEARYLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Kinetics of Phosphonopyruvate Hydrolase from Voriovorax sp. Pal2: New Insight into the Divergence of Catalysis within the PEP Mutase/Isocitrate Lyase Superfamily
pubmed doi rcsb
source organism Variovorax sp.
molecule tags Hydrolase
molecule keywords Phosphonopyruvate hydrolase
total genus 104
structure length 281
sequence length 290
ec nomenclature ec 3.11.1.3: Phosphonopyruvate hydrolase.
pdb deposition date 2006-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 2hrwA00
1PKYA 2VGBA 4LSBA 4TV6A 1S2UA 4L80A 3ME3A 1F8IA 1U5VA 4HYVA 4YJ5A 3MA8A 3R4IA 2DUAA 4B5SA 4KCUA 4KCVA 2ZE3A 1IGWA 1F3XA 1AQFA 3QV7A 4B5VA 1ZJHA 2R82A 4TV5A 3GG8A 1UJQA 4B5UA 1F8MA 1PYMA 2L5HA 3B8IA 3QTGA 4MF4A 4B5WA 4DRSA 1DXEA 3SRHA 3G2GA 2HWGA 3LYEA 1O66A 1O5QA 2KX9A 3QQWA 2OLSA 4B5TA 1S2WA 3LG3A 4KS0A 4FXJA 2VWSA 3N25A 4QG8A 4L7ZA 3T07A 4ROQA 3E0WA 1A49A 4B2DD 2V5JA 3M0JA 1XG4A 3PUGA 1A5UA 4QGCA 1DXFA 1GGOA 1O68A 4IQDA 3T05A 2VGFA 3GQYA 1VBGA 2VGGA 1PKMA 3BJTA 1JDEA 3HQNA 4MG4A 4B2DA 2X0SA 5JVLA 4JPGA 2E28A 2QIWA 2HROA 3T0TA 3QV6A 1PKLA 1KC7A 3QLLA 3U2ZA 2DIKA 3EZ4A 2XDFA 1ZLPA 4KRZA 3EOOA 4YNGA 1IZCA 1XG3A 2XZ9A 2HRWA 3SRFA 3SRDA 3P0XA 3IS4A 2V5KA 3BJFA 3KTXA 1F3WA 3EOLA 3OYXA 3SRKA 2G50A 4QG6A 2VWTA 3E5BA 1SGJA 4IMAA 1A3XA 2BG5A 3KHDA 3HQPA 4FXFA 4B5XA 1OY0A 3HQOA 1T5AA 3QV9A 1E0TA 4QG9A 3GR4A 3I4EA 3H6OA 1VBHA 3PP7A 3M0KA 1DQUA 2XZ7A 1S2TA 3FA3A 1Z6KA 2VGIA 3QZ6A 4KCWA 1OQFA 3QV8A 4IQEA 1M1BA 4L9ZA 1DIKA 1E0UA 1A3WA 4RPPA 3VAVA 4HYWA 4IP7A 3OYZA 1F61A 4WJ8A 4G1NA 2WQDA 1PKNA 2HJPA 1KBLA 1U5HA 3FA4A 1MUMA 1M3UA 1S2VA 3E0VA 4L9YA 3OQ8A 3EOEA 4KCTA 5TAOA
chains in the Genus database with same CATH superfamily
3BOFA 1CBGA 4MUZA 4YWSA 1FRBA 2E8YA 5FIPA 1WXZA 2V2HA 1WDWA 2VXNA 1UUOA 3B0XA 2CNCA 2NQHA 2Z2AA 1Q6EA 3RM8A 3W1PA 4OVXA 4TV5A 5C2XA 4GUIA 2BVDA 1P7TA 3FXGA 1EQCA 4S3DA 1LG1A 1UWTA 3OGSA 2YBTA 1GW9A 1SZFA 2BOFX 3J7HA 4AY7A 4V2XA 5CZJA 1YMYA 4P8VA 3NZGA 1HW6A 3F5LA 4F0MA 1LBFA 1R3SA 2J4GA 3CZKA 3KDNA 4WDXA 4IL2A 3M5YA 3SADA 4HTBA 4Y9NA 5CBIA 4AIOA 4DNMA 1KGXA 1ODUA 2EPKX 4GGBA 3QOMA 1UHVA 2FGBA 3ARUA 3UWZA 5ABEA 4MADA 3E49A 1GTEA 3KL0A 3EMZA 3WDJA 4MZ1A 3E5BA 2DH3A 1XI3A 4HPGA 2JF6A 1POJA 4C1LA 2ZXDA 3G1RA 4NZ5A 1W5PA 5BOOA 2F2KA 1EBGA 1WX0A 2R8WA 2O7QA 1XYLA 1QWKA 4U4MA 3SSZA 3ZWSA 3ANUA 4MWAE 1WZMA 1T96A 3MI6A 5IM51 4RDWA 4Q32A 3GHTA 4W8AA 4L6OA 4DJFC 2PDXA 1QI0A 3ME3A 3REQB 4A29A 1B30A 5I0DA 2E9MA 3LM7A 1XCXA 5F2GA 4QNWA 5CKSA 1ZAIA 3BDKA 1V3HA 4YTUA 2VTFA 3MI3A 2C6QA 1LP6A 2WOQA 4GUHA 1TVLA 2XH2A 5A6TC 2QDEA 2YL6A 2GVEA 3LTYA 2DORA 2HPMA 3TQ0A 4HU3A 3NQFA 5HK4A 3F4WA 3FIGA 3IS4A 2VI0A 3OO2A 1UUQA 3B9AA 3EMCA 3ATZA 4ZVJA 4IGHA 4J40A 4BF5A 2VFEA 3NAVA 3ABZA 4DLMA 5GJMA 5FJIA 3SY8A 3CV2A 1VYRA 1X96A 4O18A 4GYKA 2PP1A 4HNUA 5IRPA 2HVOA 1F61A 4R5EA 1HXJA 3QKZA 2VQUA 4PUDA 2YA2A 4XK2A 1OYCA 1RBLA 4AWEA 4GQBA 2OXNA 1QCWA 4JIRA 1K6AA 3WNLA 4FA3A 1S2UA 4XZNX 3WBYA 1V6YA 1O95A 4ZB5A 3LV6A 3STPA 2GUYA 5AFDA 4JYFA 1UOZA 2IKIA 4X9SA 3B40A 1FH7A 2ACSA 3N04A 3NYZA 2VOTA 1A80A 3KLKA 3SBFA 3PZ9A 4LCQA 3N12A 4EPDC 4UMAA 5E0KA 1OINA 2O7SA 1YXDA 4N0RA 1K9FA 3WQOA 5CC3A 5DANA 2ZFAA 4MB1A 1ECQA 3ZSTA 2X2YA 1E4NA 2QVHA 4C6MA 3RCNA 3IVTA 3W1LA 1ITCA 3W53A 3H55A 2TSYA 2QUNA 2V5CA 1UIOA 3WNMA 7CGTA 1FWTA 3WQPA 3E1F1 3PBWA 4QROA 5FF0A 1RK5A 4PMQA 3ARYA 4XKYA 3ARQA 3H22A 5K7JA 1EA9C 2Y0FA 3G24A 3AMLA 3B8WA 3QHMA 3OLEA 1RLCL 4XISA 3PY2A 3WMCA 3G8RA 4RNIA 1NP0A 3U9IA 1K4GA 2QMJA 2TYSA 1V3MA 3ES7A 1V6TA 1ISZA 4HIBA 4RPQA 1VFHA 2DW6A 3QKEA 1E1FA 1RY0A 4TVCA 4D71A 1VBRA 3Q58A 2UY3A 2J7BA 4H9TA 1OG6A 4DJEA 5C9UA 2VFHA 1XLMA 3RX3A 1J12A 1KFWA 1L2UA 3S46A 3IUHA 1QNSA 4WR3A 2PCQA 2Z27A 4CCCA 4PMUA 2VZSA 1HL2A 3S47A 5D32A 5L6UA 2EEXA 3NSNA 1OK4A 1I60A 3NJ3A 4AX7A 3RO8A 4IPIA 4AIUA 4YPJA 3DFNA 1TE1A 3GHSA 1MRQA 1VYSX 1QVBA 3G0SA 3TK7A 1AW1A 3LB0A 2Y2WA 3TTOA 3GNRA 3MP3A 3VIOA 4Y9PA 2Z7GA 1KXVA 4Z1DA 4JPGA 1BXNA 1M53A 3VCRA 1BXBA 1W54A 3CTTA 3VK5A 1DHKA 1YXYA 5FCZA 4KRZA 2OWCA 1I0DA 5BW6A 3O0FA 4U5IA 4NHVA 1J5TA 1EC7A 2W3ZA 5EFDA 3ZMRA 4EP8C 3NL6A 4K8GA 3KRUA 1WA3A 5GPRA 5KTLA 1BSLA 4M80A 2QCFA 3CBWA 1SFJA 4GFSA 3IPWA 1A5AA 2GUBA 4JIIX 4UFIA 1ZAHA 3LCWA 1YPXA 1C93A 3LU2A 3VC5A 4AZ5A 3FDGA 3H70A 4U10A 3MSYA 1TV7A 4MWAB 2G3IA 1JXKA 4M6QA 3TH6A 3M9YA 3VNKA 2DQXA 1UYQA 4GY1A 3QOKA 2V3EA 2P8BA 3ANYA 3BPWA 3LSCA 1XISA 5LIUX 5I7GA 1W37A 1H2JA 3L12A 3LA4A 4UMBA 3LENA 1MUMA 3H12A 3VD7A 4G7EB 2WZHA 1PKYA 2V63A 3VKCA 5I06A 3CIVA 1DJQA 4PC8A 3AU2A 3JS3A 4FALA 1PDYA 3NO1A 4KPLA 1G67A 5EL1A 1UQYA 4WSKA 2O9RA 4GE8A 3RYSA 1P48A 3BO9A 4LBRA 1R9YA 4RLIA 2XSAA 4GNJA 2PLKA 1IV8A 3G0UA 5TNVA 7REQB 3AC0A 1WZLA 3PUGA 1XV8A 3NGFA 1Q6DA 5D33A 1CGYA 4ZQMA 4C6BA 3CUFA 4MSSA 2ANUA 3O2LA 4KEVA 3L4WA 1DJGA 3WDRA 2EPMX 2CLPA 3EZ4A 4DWSA 3NOYA 1XIGA 2I5IA 4I8DA 5EMMA 4QEEA 5C7HA 3RM4A 1XDMA 2FJUB 1U1UA 4K7YA 3TV8A 3UXIA 2E6AA 2Q8LA 1FHLA 4QDWA 1KRBC 3GTNA 1OD8A 1DQUA 1FWIC 3TQVA 3WH7A 3WQ6A 3NSMA 3SCUA 3VZZA 1R3TA 2VZOA 4WKHA 1IZKA 3TW9A 4GINA 3C2VA 3VPLA 1KCZA 3M0MA 1VENA 4DF1A 2QCCA 2OMAA 3LCIA 3GXNA 5DELA 2E5CA 2PLCA 1IHIA 3TDFA 2PP3A 2R9RA 3Q67A 3ZFHA 2ZOXA 3HJZA 1MFVA 5I24A 1OX4A 4C7GA 4LVAA 2RGMA 4ZQOA 5HQEA 1EBHA 4ES4A 1XGEA 2ZVIA 4L6HA 5HBFA 2J8TA 2YW3A 4PH6A 2ZICA 4PUMA 4JTHA 1M7PA 5U7SA 2DT0A 1FCVA 1AUSL 4F66A 3FSUA 3LCGA 3DFQA 2FJKA 4WGXA 1US2A 1XUUA 3G77A 3U4FA 3WEMA 1K02A 3KVLA 4JAWA 1H4PA 2V82A 4H2HA 5E1QA 2GUUA 1F07A 3ZJ8A 1C9DA 3BOXA 4AZHA 4XVEA 4GRSA 1NWTA 2AGKA 5HR7A 4GIYA 1TTJA 4KBXA 3IJQA 4KWUA 1W9XA 5A69A 2F6KA 4RDVA 3SCVA 3QH2A 2GQ8A 4NJKA 1JZ8A 1UQZA 1XQKA 3T9PA 4LUIA 2XIOA 3SDOA 3CH9A 3QR1A 1I2RA 3G1VA 3W28A 1E0XA 2BP1A 2PZ0A 3VX0A 5I3GA 1CWYA 3BMVA 4QLLA 4F4RA 2POTA 3TKFA 1J0ZA 3ATYA 1ISVA 3PZNA 4BQ3A 3OZOA 3W07A 4WSHA 1B2YA 1RQHA 3M1ZA 1X97A 2ZX5A 5TQLA 1V7YA 4M6UA 7REQA 4A3HA 1D3HA 3MBDA 2OOGA 3KVJA 1P6CA 4ZTYA 3WJZA 4NZFA 1QMLA 5EMLA 4LT9A 4I5RA 4JXCA 4BEUA 1P7TB 4GI4A 1H1ZA 4CNOA 3MMTA 2WPBA 3R11A 1U83A 1VBGA 2V81A 2JIWA 3KOWA 1JCTA 2BZNA 4JYDA 3P62A 1XBZA 3PZMA 4FNPA 1ME8A 2Y6ZA 1VEPA 1H49A 4XWUA 3EDKA 2D1ZA 5EFFA 3GUWA 3SECA 3P74A 5DFAA 1GQKA 3CC1A 3T09A 1GQJA 4B90A 1TV2A 3VM7A 2HQAA 4XD4A 2WZMA 3RNDA 2OLHA 3W00A 3L21A 4KFOA 3A24A 2WJZA 5I00A 5PTDA 1FP8A 3EX2A 3U6WA 3VNZA 5D02A 4S3GA 2Z1VA 4F2TA 5I3IA 1B0IA 2D2OA 1M3UA 3APGA 1ZS2A 3POHA 4CVWA 1KLYA 1V6WA 3N9SA 4D1JA 2IMRA 2V5BA 1HKJA 1TR1A 3URBA 1C90A 1KFKA 1U5VA 1KCXA 1LWIA 5LXEA 2PF8A 3UVAA 3W7IA 2A5HA 2WAGA 2C71A 2NQZA 3DZ1A 4JFSA 3RF9A 2VFGA 1K8XA 1EPVA 1KV8A 3CS2A 2E68A 3A4WA 3VMOA 3IVUA 2FH8A 2P76A 3DENA 1H1NA 1W0MA 3PTKA 2FDSA 3WQFA 3L5MA 4FNRA 1LLZA 1O6IA 1JZ2A 1PUDA 1ZLPA 2QUVA 1LRTA 2X40A 3ITYA 1YIXA 3EOSA 1B3ZA 1ME9A 4B3ZA 3RX2A 5CG7A 1XD0A 3CUHA 1TCMA 3A4XA 5F2MA 4OZOA 1ZENA 5FI8A 1MYRA 3A64A 3G1DA 3DHPA 2XZ7A 1WZKA 1HP4A 3WUGA 3JW7A 4XO7A 2ATMA 1GUVA 3AS3A 3ZT6A 1EJXC 2ADAA 1EYWA 3B8TA 3KAOA 3QFWA 1T99A 5KINA 1E55A 2PC8A 4ASTA 3B9EA 1TWIA 4J2MA 2GGJA 3KBJA 3H24A 1X98A 1F2JA 2BS9A 3AIEA 1SPQA 1WOAA 3QHNA 9RUBA 4ZOAA 3IUIA 3I3BA 4HKPA 5G2IA 1J18A 4IISA 4IPNB 1NY1A 3KBSA 4YTQA 1S38A 3F4DA 2WWDA 1VFOA 4X9YA 4W7UA 2YCLB 3SUSA 4AVOA 2O92A 1EIBA 2ZZ2A 4PUUA 1R3YA 3HG5A 3FS2A 3L4XA 2PDLA 2ZZ7A 4RZ5A 1VP5A 1TPH1 4RCXA 3ZIZA 3M5VA 3W2JA 1EJUC 3NR0A 2QCLA 4H9XA 2C79A 4HNOA 2Q02A 1GW1A 4ZO6A 1E40A 4JY8A 3V16A 1DKWA 3WJXA 4ADUA 3TC6A 2O0TA 2Z6JA 5HWNA 1US3A 3W71A 1K7EA 4H9ZA 4AY8A 3G3DA 2DH2A 3WZ0E 2NSXA 2ESCA 2FHFA 1JRBA 3BQ6A 1OHLA 5BU6A 1EUAA 1J2WA 5HUOA 2VD9A 3W3OA 4FNQA 3PVFA 3N6QA 2VZTA 1GOXA 2OEMA 3PWGA 1QUMA 5E9AA 3CWOX 1AJZA 3C52A 3TTEA 4CN1A 4EPKA 1CXHA 3UJEA 4MKSA 3KVKA 3HTWA 4QJ1A 2XWEA 1JQXA 4UXDA 1W6TA 3LHVA 1W1IE 2ZE3A 3HU7A 5A5WA 2NV1A 4QQUA 3PB0A 4L1GA 1S5TA 3JRKA 3NEHA 4Y7EA 3T6CA 4Z2GA 3EWYA 2SFPA 4NNAA 4F0RA 3E02A 2EHHA 3H23A 3UR7A 1W9BM 3BV7A 3WX7A 1FX6A 3GZAA 1QNVA 2B0MA 2EO7A 3W2LA 1EGVA 3BJTA 4JTEA 3C2YA 2VOMA 1VRDA 3K4DA 3MV11 2Z0IA 3QV6A 1NM9A 1EKOA 3LBCA 1C3FA 2FGZA 3JU2A 4KMQA 1SFTA 4W89A 3SQSA 2BG5A 3HQPA 3QMTA 2J6VA 3CZEA 2ZZ4A 1ZUAX 1RD6A 3BGJA 3KX6A 3GH4A 4PTVA 5ECUA 4GI9A 4ZFMA 4M1BA 3S3GA 5FAGA 1AK5A 3BICA 4PZVA 4V33A 2WZIA 3WF1A 2Y62A 1GVOA 3UJSA 3W4RA 3WQVA 3IIZA 5TAOA 3W27A 3WD0A 3B03A 4C6IA 3BXWA 4HU4A 3W1TA 4GNKB 1G4TA 3BMXA 1OC7A 9XIMA 3VMPA 3IJ8A 2X1SA 4HPHA 5F4WA 3AIVA 1F4HA 2TAAA 4B5WA 1TJRA 1W1VA 5I79A 4U33A 1V51A 1R2TA 3FLUA 4B5TA 4R7JA 3RJXA 4FEZA 3EXSA 5CPSA 3ZM8A 5CPTA 2Y7EA 3KVMA 4O0KA 1JYWA 2BXZA 3KTSA 3RITA 3JZUA 3TVAA 1KW1A 3BW2A 3W1XA 1ZB5A 5HMEA 5DXYA 4LF2A 1H51A 3GFYA 5CC6A 1Z9AA 2W79A 2P50A 2RHGA 3LI1A 3CQHA 1B4KA 4IQJA 3N34A 2CBJA 4NXSA 4EVZA 2FLIA 3NIYA 2W67A 2DVUA 4LV9A 1PPIA 3EOUA 1BFNA 3A3HA 3HFTA 3DKLA 4ENLA 1RBAA 4TQTA 1A5OC 4N9BA 3W26A 2WNWA 2PGFA 1V6XA 4AEFA 3OJGA 4MKNA 4HYWA 4LB4A 3DOPA 1W3KA 1C9WA 2BHZA 2WC7A 1A3HA 3LCFA 1D8CA 1TV5A 5HNTA 2INZA 4UQAA 1DHPA 1XIBA 3GX9A 7A3HA 3C4UA 1AJ0A 4WZHA 4LBSA 2X2GA 4LAMA 1VLWA 4A8NA 1UR4A 4LSBA 1UKSA 2HBVA 3U5YA 4MHBA 3HGOA 3TYCA 7PTDA 3ZJKA 2ZUTA 1NJJA 1V0MA 2DJXA 5D38A 3H2EA 4HP5A 3T0CA 1SM9A 1E6QM 4DJDA 4DWSD 3IV3A 3T78A 3GC2A 3FVDA 4UR7A 3P5ZA 3C5QA 1YDNA 4LOCA 1RLDA 4ZGYA 3KW3A 2ISVA 3XISA 1K9TA 4Z1YA 2YCIX 1TVPA 2BTMA 1UASA 4HSHA 1QJWA 4F2UA 4FLSA 4MPKA 3QPZA 4O53A 1XDJA 2HMCA 4EXAA 3GTXA 4PCTA 4GVHA 4Q7IA 4ZQRA 1KC7A 4A3RA 3S2NA 1G7UA 5HNNA 3W6MA 3MSRA 1V3KA 4O10A 6REQB 4O1BA 4S3AA 3UFYA 1F3WA 1H7PA 4MYXA 4Q4RA 1XX1A 2ZUUA 1MZHA 2WANA 1TJ1A 2WNZA 3A5VA 5HANA 3R5EA 1QNOA 4LTSA 2VURA 4I9AA 1LQAA 2W9MA 2VC5A 1WOBA 5E0FA 4AHQA 1ZRQA 1L6GA 2TPSA 3WJYA 4E2OA 1GYMA 3PZTA 3LI0A 4GBDA 2QF8A 4ERGA 1WYIA 4OJYA 2Y8VA 3II1A 5EMJA 2XINA 1B5TA 3MZNA 4GLEA 4MB4A 4W8BA 4H6RA 4BI6A 1S46A 4B15A 1IR2A 4HOXA 3AUJA 1VJIA 3S0CA 3UG5A 1Q5MA 3AWOA 3KUMA 2ATSA 3W73A 1DWIM 4ILSA 3WBAA 1QATA 3DYOA 4WEVX 4GX9A 4RUBA 2BB0A 1VFTA 2FZBA 5AYXA 1ECEA 3W81A 1BQCA 2HWGA 1E73M 3EWWA 5BRBA 4IMGA 4U3AA 1E51A 3GU9A 1IZJA 1SU5A 5GJNA 1A49A 2D0GA 1FWJC 2OQHA 1R85A 3CQKA 1LT8A 1I1WA 4AYGA 1SW7A 4MOZA 4N6EA 1UC5A 1TTPA 4S2CA 2IKHA 4GYPC 5HJXA 4KH2A 2QGYA 5KMYA 3NM1A 3AXHA 3MDWA 4ZQCA 3AHYA 4DJFD 4DBDA 4RNJA 1H7RA 4KGLA 1XYBA 1OJXA 4KEMA 4QG6A 5LA1A 1NAL1 2AL2A 1U2YA 1VAHA 3TTYA 3L0NA 1JDAA 1QWGA 2CERA 3VIIA 4E8CA 4EACA 3AMGA 1G4SA 5KETA 3KRZA 1QPRA 1TKKA 4O16A 5FL0A 3CMJA 2EKCA 4A6GA 2R94A 1C8VA 1ZL1A 3B8SA 5AHLA 3LS9A 1M1BA 4IQEA 1GQLA 2A3BA 4V15A 5AZ1A 2BASA 1NWRA 2DU2A 4MFEA 1MEIA 4K1GA 2VVNA 3CT7A 2DSUA 2HZGA 1FVPA 3H7RA 4LFYA 1G4EA 4GWEA 3DN5A 1A5SA 2W4XA 4GISA 1GOQA 4O0QA 1H63A 1BEUA 3UERA 4GKLA 2IUZA 3C0SA 4JR5A 3FSTA 3KS5A 4ZCWA 1BYAA 4LVFA 3I3DA 2BGNE 2FZDA 2DT1A 2EJ1A 2W63A 1XF0A 3N2MA 1FWEC 4S1FA 1GVIA 3S2JA 2ZWZA 1TRIA 1SW3A 1Z44A 1W31A 2FPTA 3AHVA 3ARVA 1PZ0A 4Q3MA 1NIUA 2GK1A 3LGDA 4J3ZA 2E9BA 4V27A 4ROPA 4US5D 1DXFA 4JTGA 4JEJA 1A5MC 1HKVA 4CVUA 2I9EA 4PCSA 5E6YA 1QU4A 5TF0A 3S5NA 5A2CA 4GX8A 4H19A 1XIIA 4LAZA 4I3GA 3LLDA 3FXYA 3DC0A 3W1UA 1JDFA 4DJEC 1R38A 3FJNA 3OLGA 3UXAA 4H1ZA 1O5KA 4HA0A 3PUOA 3WK2A 3S1UA 2VC6A 1GVRA 4NRRA 4FF5A 4F9DA 2CHNA 1SUXA 3N13A 1CCWB 4QHRA 1EIXA 3BQ5A 3GZ3A 5JMUA 5I07A 4JHMA 2YYTA 4PTNA 3KL5A 4WJEA 3EX1A 3O8AA 3TAKA 1FWRA 3W7QA 4CN4A 3W7OA 2NUYA 3W7NA 3ARTA 4ZBCA 1NU5A 3PULA 2OQLA 1PWLA 1YTEA 4ORMA 5AVNA 5EBAA 1GKPA 3B04A 5JBEA 2ZRYA 3S2CA 2J78A 3HV8A 1CPUA 2DSVA 3P60A 3P82A 3H21A 1MFUA 3CIXA 1QO5A 4UOJA 5B7YA 5AECA 3UWVA 3S9YA 1KFJA 3VDGA 1XIJA 4QBXA 4H8HA 4JN6A 3AICA 1YTKA 1CEOA 3TTSA 2RDXA 5EU9A 4C1NB 2VP8A 5FAJA 3WSUA 5A6BD 1EEXA 3VKBA 4C6QA 1X1NA 3RLGA 1YNQA 3W22A 1IR1A 3QLLA 3W2MA 5HJLA 3GDLA 3AXIA 3W9ZA 2CLIA 4LY8A 3V3WA 4HCDA 4CU6A 1TJ0A 2BGQA 4AQLA 3TN6A 3VGGA 3LBMA 1QBAA 4RZ4A 4IUOA 1W5NA 1VBHA 3S9IA 3E2QA 3A6OA 3WLJA 2X09A 4YN5A 3RX4A 4D6GA 4S39A 5FJJA 1A3WA 3P80A 4J3TA 3YPIA 5D8WA 1DBTA 2IXVA 3E0IA 4YMZA 4CUCA 1MXGA 3B8VA 2P53A 4OHQA 1MDRA 4XUYA 2B7NA 2VZUA 4YVVA 3W7PA 3FDKA 5DQPA 3IARA 3TC3A 5J04A 3BAJA 1CLVA 5AY7A 4BCEA 3RCYA 4AEOA 5BOEA 2H6RA 4WXZA 3WLMA 2HTMA 5LA2A 4PEEA 3O0KA 1TPUA 4W4QA 5M03A 5BMWA 3BLLA 5LIKX 3SB0A 1TPEA 2XVKA 2L5HA 2G96A 4MF4A 4A3UA 3W1NA 1F7BA 1Q8JA 4RJEA 1WPCA 3EWXA 3B0YA 2Q6ZA 4QG8A 1G94A 1SFSA 4X60A 3W25A 2GDUA 4FX7A 1K1DA 2ZX7A 2R1LA 5EY5A 4O54A 1J0JA 5HMDA 5EB8A 4IFOA 1KQZA 1KQYA 2V5DA 1R46A 1IZCA 3E12A 1AMKA 5HWMA 2VM8A 6PTDA 5D37A 1F3TA 1WV2A 2V8ZA 5M5DA 1VRXA 5AN7A 1CZ1A 2NQ9A 3H26A 3JR2A 1ALDA 3G6LA 4FOJA 2FZNA 4GACA 1OQFA 1EEPA 4B4FA 2HE5A 5A6MA 1E0UA 1GVFA 4UR9A 3L7RA 3H54A 3GAYA 5BMXA 2VQTA 4N2YA 3HJEA 1FUYA 3AXXA 3W84A 4A22A 4WIWA 3NL5A 1I1XA 3C6CA 3GDKA 2BBFA 2WZEA 3RRXA 1VFUA 1ZSXA 1XCWA 1F8IA 5FESA 3MZ2A 3VVGA 5I3JA 2J13A 2JGYA 1TWWA 4LYQA 2C16A 3CMGA 4AWTA 1GOOA 3WNKA 3AAMA 2C8NA 4H7ZA 4KIEA 1KTCA 1IIHA 4ZQPA 2UY4A 4IPJA 2CXGA 4C90A 3M16A 5T91A 4L64A 3DBNA 2DT2A 2JFEX 4C6FA 1GVQA 3KHJA 3W7GA 3ALFA 3AZTA 3BC9A 3PPFA 5HULA 2CPUA 3K5XA 5HMFA 3GVQA 4DELA 2QJIA 3N2OA 3SW6A 2PUZA 1UMLA 2VWTA 3OODA 4A4AA 4WSJA 2YXGA 2VRQA 3CZGA 1T5AA 2QDHA 3I3EA 2GJLA 1HGYA 2DGAA 3NQCA 3A21A 2ABAA 5T26A 5CSYA 1HQTA 3HPAA 4HNLA 4E2VA 1QR7A 3VAVA 3D47A 4O8AA 2WHKA 4H3DA 4M3PA 2VUYA 2HJPA 3FYPA 5F2IA 3WQGA 3PBYA 3R89A 4ICNA 1G5AA 2GJPA 4AX6A 1P0DA 1B31A 2W92A 3U7VA 4GJIA 2OO0A 2V67A 4N9CA 2J66A 5HA7A 4BI7A 4CQBA 4K68A 2UY5A 4G9PA 1OCQA 2JF7A 4DBWA 3IRSA 1EPXA 2E40A 4RL3A 2AAAA 3H2CA 5E5CA 2BVYA 3VGDA 3QY8A 5HWJA 3B8UA 4O19A 2OX1A 5K9CA 2GWGA 1I45A 3A4AA 3C0JA 3SR7A 2GFTA 1FKXA 1V6UA 3WJSA 3BMWA 2J88A 4AD1A 4R33A 4M51A 2DQWA 4QJ3B 3CHCA 8XIMA 2FGLA 3M5ZA 4LUSA 4E3VA 1TPC1 3Q94A 1XRVA 5A6KA 4NILA 3ZLFA 1V0KA 2WHLA 5D03A 5DBUA 5H1WA 4Q22A 1S3HA 3NQMA 4KETA 1XUZA 4LS1A 2INEA 2R24A 1XH0A 3E38A 3EAUA 5H8MA 3PZQA 2I17A 1P6WA 5JH1A 3VIJA 3GM8A 2BHUA 4J27A 3AMCA 4HNVA 1J11A 3CB3A 2Q3RA 1QOPA 5D2WA 4E8DA 2GJRA 1TYGA 5HAOA 4DJFA 4RDYA 3W85A 3NVDA 3C0LA 1X7FA 4D2JA 1YPFA 2OEJA 1R3QA 2YBUA 4GIEA 1OABA 5FJPA 1W5OA 1X6LA 5F4XA 2ZA1A 4IJRA 3O7UA 1TO3A 4YS1A 1E0WA 2V3DA 4DX3A 1FWSA 2FFIA 1EJTC 4A2RA 2OPJA 4Q6XA 3HBLA 2QCNA 4R27A 1KWKA 4DXKA 3NQAA 5JBDA 3TN5A 4QS6A 4LYKA 3CV6A 1O66A 2OR2A 4Y96A 3U48A 2G8ZA 4GFIA 5H8UA 3TMLA 3TYZA 1TSIA 4FXJA 4PB4A 3MKCA 2CLKA 2R1KA 3NDYA 4WDUA 3T4WA 2J7HA 2VGFA 4DEFA 3UPBA 3PJTA 4B2DA 1BWVA 3DCPA 1DE5A 3D0CA 4L5ZA 2R14A 3M47A 1C7TA 2XDFA 2NX9A 1ZBCA 4HA3A 2VZVA 3TZFA 1A4MA 4DWSB 4C6KA 3WD4A 3S83A 3BGGA 4DUVA 1I6NA 3A9BA 3PZVA 4PCFA 3UY8A 3N3MA 5FACA 1XSJA 1OEPA 2DZBA 2PDFA 1DJXA 1GEHA 5U4NA 4MAVA 2WLZA 4U3CA 1OFAA 1RCOB 1RAKA 2VEMA 4GNVA 5FD0A 3SIZA 1MXSA 3DI1A 3UR2A 1N8WA 3WQ5A 2RDUA 4KCTA 4Q4KA 4H83A 2PDQA 5I78A 4S38A 1MQRA 2PWHA 1YQ2A 4WGHA 1IIGA 1KCLA 1CT5A 4JTAA 4XTDA 3AHTA 1UZDA 4CD8A 4M56A 4GH1A 2WSYA 4GUFA 2YDRA 2WNQA 3QZEA 4AHPA 1KRMA 2QJGA 4GQQA 4ZOBA 3CQ0A 2FH6A 1CECA 3VKDA 4ZXOA 1CW2A 1NELA 4P8XA 1KM1A 2ZC1A 1Y5VA 2OCZA 5CSSA 2FVMA 2X0SA 3K2GA 1W56A 1XWYA 4D6DA 4BI5A 1JPHA 3NA8A 4AWUA 3BG9A 3W7DA 4URIA 3T0BA 2G3NA 3ABSA 4MYAA 3MHGA 1XC6A 5C2CA 4DJDC 4ZE5A 3ZVIA 1TJPA 3VNMA 5C7VA 3UZJA 4JHZA 1TPB1 3KBWA 1V3LA 3ZVHB 5A8MA 1K77A 5A8QA 3QF0A 3IEBA 1W3HA 4CNNA 3VIPA 4Q8VA 5MF5A 4J3WA 1QI2A 3AZRA 1IQ8A 4FOUA 5CPQA 4LYRA 2DSWA 3CZLA 3FFSA 3QHOA 4CN6A 4FLQA 3DYMA 4US5A 4Q4MA 4L9YA 4MDOA 4MAZA 4Y9AA 1QHZA 2WWCA 3PG8A 3ELFA 3M0IA 2P10A 3IGUA 4JTCA 5C0QA 3V5OA 4PTXA 3WK3A 1KFEA 4CGTA 3UZXA 2ZBTA 5AB3A 3W37A 2QAFA 1DORA 1ZPTA 1MI3A 3IIXA 1VEOA 2V0TA 1AG1O 1QNPA 1LLOA 2VCAA 1CX9A 5REQA 4ERAA 3KL3A 4I5UA 1PVNA 1KBKA 4L9XA 3ZWTA 5KZDA 1E4LA 1CIUA 3HF3A 1VCGA 4RX0A 1GK8A 1WKDA 1DJHA 2YA0A 2Y85A 3W74A 3WK0A 3U2ZA 1OX6A 4NZ1A 5CLTA 3BVJA 4W7WA 3BLIA 4H2CA 2D23A 4G2DA 3OHIA 3BL3A 2OGJA 3MUAA 2I5QA 1GQIA 2VO5A 1TZ9A 4QFUA 4TTGA 1VF8A 4YL2A 2GVYA 1PX8A 1FWDC 1I4NA 2ZZ6A 2PCEA 1KLZA 3NO3A 3LD5A 2X0HA 1D9EA 1VPQA 4XZLX 3RDKA 1MEHA 4JFUA 3KP1A 4IP7A 4NG3A 2VC7A 4RE3A 1PX4A 1J0HA 4DI8A 3T08A 1I2NA 4XQ6A 3CUGA 5EMUA 3NZPA 3GC4A 3LXCA 3STFA 3LZ5A 1Z7AA 2GJNA 2CLHA 4OE7A 3URQA 4ZQNA 1W1ZA 2VDHA 5LNVA 3AHZA 3ES8A 3VFCA 1XKYA 1OGGA 5FOOA 1H5YA 2R1PA 5CH9A 4AF0A 6TAAA 1MQQA 3L2MA 2ZKMX 3GG1A 2BDQA 5DLCA 3TJ4A 3B3DA 3PF3A 4WOZA 4WXYA 5I02A 3WD1A 2DZPA 1HG3A 4UCFA 4IX2A 3T0DA 1T8QA 3UQNA 2Z26A 5IDIA 4XBKA 2PDKA 3QGVA 1E6XM 4JY9A 3UG4A 1OYAA 2CKSA 4NP7A 2JIEA 2PDYA 4TX9A 1Z3NA 1OYBA 4JTFA 4Z0JA 1N2VA 2QS8A 2IQ0A 3ENLA 3O16A 4R9XA 2D20A 1Q85A 3GG0A 5K2ZA 3UESA 3PUDA 4JHOA 1F6YA 1VIWA 3GG7A 3M44A 1SMAA 1X8FA 3IAQA 1HKMA 4DPPA 1PKNA 4L61A 1RJRA 4GKTA 3RUBL 3HG3A 2QPSA 3U7BA 3RAOA 4AISA 2CZ5A 4L80A 3EB3A 4PGLA 3AO0A 3H4XA 4JTKA 2A2IA 4K6AA 5LSMA 1VS1A 4ECLA 4OWGA 1PXGA 2ZC8A 4QJ5B 1HTIA 5HNRA 1WQ5A 2A3HA 3O07A 4JFWA 1N82A 2QJNA 3LG3A 1QNRA 4RK8A 4UB9A 4ROQA 1U1JA 3AXKA 4HSOA 4ATWA 1V4YA 3QEZA 4IQDA 5A8GA 1B3OA 2J7GA 4Y6GA 1XYCA 4V1XA 3H2MA 1XP3A 2YDAA 4JDYA 1PIGA 4E38A 2QIWA 2HVNA 2FHCA 2CLEA 2E9LA 1HO4A 3L4VA 4TIMA 4BWLA 1A5KC 2X30A 4C6JA 5J5RA 5BWAA 2D24A 2J7EA 5KEZA 1Q63A 1DWJM 1MW2A 2PDGA 3KOXA 1M9HA 2DIEA 4FS9A 1GOWA 1VHCA 3T81A 2GVLA 3VD5A 4EKJA 2Z6IA 3HV9A 1BQGA 1D7KA 1GYNA 4BWLC 1JGIA 2GL5A 4GG9A 2QXWA 3AXMA 2HSAA 3LHWA 4IHCA 4AU0A 1X1ZA 3H53A 4UNLA 1OFQA 1R8LA 3IGXA 4FO4A 3WQCA 5CJMA 1X6UA 3WQ4A 5HPOA 1Y65A 3NO5A 3LOTA 2LLEA 3ZR5A 2CKRA 3FA4A 3LUTA 5C9ZA 2VFDA 3U57A 1PTGA 5LYRA 3V5FA 4CNPA 4FZIA 3E5PA 4S3FA 1Q2SA 2V69A 3PPCA 4A3QA 1IWPA 3ITVA 3C8NA 2WNNA 1PHQA 3NGJA 2R82A 3L23A 3NQVA 6CGTA 4W85A 3UZYA 1FH8A 1U22A 2XFRA 1EGMA 3LYEA 3NZQA 1E6SM 1KXQA 2YCEA 3B0VC 2OZTA 3B97A 3EA3A 5FEPA 3AYVA 1RXOB 3NPWA 1H62A 4PUWA 3QJAA 3M0JA 5FJTA 2JKAA 1GGOA 1HNYA 1DQWA 2ICSA 1TA3B 4UMCA 4FXRA 1GKRA 2NWRA 5CXPA 2PTZA 1JCLA 4HMEA 2XH0A 4NKCA 5FF2A 2NT0A 2JALA 2HRWA 2R6OA 2BXVA 2A7RA 3AIRA 1TMLA 3WDPP 4FNSA 4PUJA 4PMOA 3NXLA 2E3ZA 3IIVA 1HO1A 1P0EA 5LNSA 2QVNA 1OZQA 3B05A 2FVLA 1R47A 2ZADA 4JKKA 2FB2A 1F3EA 1Q2RA 4LU0A 3WLSA 3ITOA 4PMZA 4XSLA 3AIWA 2W5FA 2VT0A 4WY0A 4GPNA 4OBSA 4ZFCA 3HG2A 1RV8A 1S5MA 2ISWA 4XD6A 3SFWA 2YDQA 1H61A 3VCNA 2C1IA 2WVVB 1KM3A 2E0PA 4MDPA 3CV1A 3A5FA 1G69A 1DWHM 2VVSA 1QHPA 1XIDA 1EF2A 3QM3A 1SJDA 5HQLA 1ZALA 2R91A 1HVXA 5F1UA 3O9NA 1ME7A 2CZDA 2PZNA 5LIYX 3QV7A 3FK4A 1O94A 3O6CA 3FY1A 3E0LA 1JG9A 3CTLA 5BXRA 3PWIA 1CLXA 2RJHA 2Z1XA 2D22A 3MUXA 2ZVRA 3LRLA 3BAKA 2PTXA 4ZB2A 1S2WA 1TUXA 3EB4A 3A12A 3DFTA 3UA3A 3LBOA 3WF4A 4AFYA 5AYBA 2OZ0A 1QW8A 3T05A 4PMXA 3RFAA 5DX7A 1E5NA 4FX6M 5JVLA 3OP2A 3BG5A 3MJYA 3UNTA 3DESA 2EPLX 3ZLGA 2PGEA 3WF2A 5A6SA 4CQAA 1X39A 2VHLA 4O15A 4JBRA 3EX3A 3B0PA 4LUTB 4PA8A 3DHFA 4PMVA 2GGGA 4CCZA 2XGBA 4GD0A 1RUSA 3P67A 3QZAA 1Q6CA 2WSRA 1LOSA 1JFHA 5LGZA 4C1NA 5TBOA 4M24A 2A4AA 3Q37A 2YR1A 1BG4A 2B31A 3WNOA 1S1PA 4NX5A 1W3LA 2F2HA 2CLFA 2WJDA 1VKFA 3QR3A 2NV9A 2Y4SA 4CD6A 2PTDA 5C5YA 4OIFA 1I8JA 3TWBA 3ABOA 4AZ7A 3GDBA 2NXIA 2I9UA 4BKNA 5A94A 4MZ8A 3SRHA 3TQKA 1TIWA 1UMYA 7TAAA 3WDHA 4JOMA 3TYDA 5F7UA 1TA3A 3HPZA 5D05A 4XG1A 4H8VA 4Q7BA 2YLAA 3I7RA 3WMBA 1UOKA 1CYGA 3H2OA 3MUZ1 2NX3A 5T8GA 3DXIA 1I2OA 3ORWA 1V77A 1E9LA 2JE8A 4DYEA 5H6HA 3HQNA 3TJLA 2I56A 3ITGA 2GK1B 4O1CA 3MMWA 2PWEA 1WCGA 4AC7C 3ALGA 3LY0A 4AWSA 2C13A 4YNGA 1PX3A 1KCKA 3LPPA 3SRFA 2V6AA 4IF2A 2WB5A 4E4FA 4HQVA 3DI0A 1FWHC 1KM6A 3UXDA 3EX6A 4QS5A 1UH2A 4NAEB 1YBQA 2OWWA 5DN1A 3TCEA 4ZE4A 2FZMA 1N8FA 2NSOA 1PZ1A 3EWBX 9CGTA 4HZ8A 2YLLA 4FNUA 3TMQA 4ACZB 3GVVA 2G97A 1DIDA 1XH1A 3H7UA 3MP5A 5FJOA 5BU9A 3D3FA 4LEQA 4D8LA 4G8TA 2YB1A 3BJSA 1A0EA 3GKAA 3F7JA 4U2YA 1OF6A 4WKAA 4D6FA 3G3MA 2E7FA 4JQ4A 2A1YA 2XN2A 3IACA 4AZBA 5IHSA 3WQWA 3R0KA 2ABBA 4Q33A 4HNNA 4M1RA 5HJYA 3AISA 1NSJA 4PSRA 3R58A 2Y63A 4N4PA 1LT7A 4PMJA 4LJ3A 4LQ1A 4MTVA 5FA5A 2Z2UA 4GUJA 1UZ4A 5C2GA 4I6VA 1TMQA 1HJXA 2IKGA 3ARRA 3PR2A 4GUGA 4J7RA 1PV8A 1H0GA 1UWUA 3P8JA 4IGNA 1O5RA 2XGZA 4GHRA 3QY6A 2ODOA 5BROA 1UPMB 2CLMA 1QDSA 4AZCB 3QTPA 2VEFA 2HISA 1CXFA 3KTXA 2Y7GA 3S6TA 1NWUA 1JAKA 1MXDA 1VFMA 5CPNA 1EDTA 2CITA 2BVTA 1QASA 3NCOA 4EWJA 4PBEA 3DYPA 4YXGA 5REQB 3CAVA 2WO5A 3QYSA 4L4MA 2GGEA 4OTKA 4DXXA 2ZZ1A 4C6DA 4FP1A 2EQDA 1KRAC 4GGHA 1TPVA 4GVGA 4ML4A 2REQA 4CCEA 3GBEA 2WKJA 4K39A 4H8UA 3VILA 5BXPA 2G4JA 3K8LA 4MWAA 2JK2A 2EBNA 5G1TA 4PMNA 2PRMA 1J10A 1IT0A 4PL1A 4WDTA 1RA5A 4LC8A 5XINA 2PMQA 4MWAC 4JTDA 1FWBC 1PYMA 1CXIA 3PANA 2O56A 2XM2A 3EDJA 1Q7QA 1J01A 5I3DA 4TMCA 4IGSA 3W23A 3WMSA 1TZZA 2YA1A 3MUY1 1WUFA 4WY0F 4B9ZA 4YCPA 2GQAA 3R94A 2ZX9A 1CXLA 3B9DA 1NF0A 3G1FA 3AFBA 3LHTA 4PYSA 2BY1A 5TIMA 4YTRA 4KRUA 2Q3OA 2Y70A 2QLYA 2PC4A 4BS0A 4DO4A 3GWQA 1DXIA 4GZJA 4IIEA 3BZJA 4GZIA 3KFTA 1V3IA 3USZA 2PTWA 3B0UX 2GDQA 3L4YA 2FMNA 2ZQ0A 4AD4A 1W5MA 6REQA 3NVTA 2ZUMA 3UEQA 3CUJA 1OGBA 1FHUA 4M7TA 2MUCA 4OUEA 4BY3A 4UBPC 4P7NA 2QCDA 4U31A 3JZEA 1T8XA 4Z0SA 4QSFA 4L6DA 3E6EA 4I6KA 4GC3A 2J7DA 4ZEPA 1XDLA 3KDOA 1JDCA 3DU0A 1PJ9A 4P61A 5JU6A 4D6EA 4IIFA 3GBDA 3NQDA 1C8YA 1HT6A 5AHNA 2A3EA 3R4IA 2DUAA 1UR2A 4X61A 1J96A 3ANVA 4PMYA 3P93A 1FDJA 2WQPA 1FA2A 1EXBA 2HXTA 3NQ7A 3MO4A 4UQ9A 2DSZA 3FEMA 1B3VA 4IFKB 2C19A 4MLRA 3QQWA 3SN1A 3R0DA 2QUTA 2OLAA 1W1B1 1OADA 2Y24A 1XH2A 3ZT7A 3VIHA 4AIBA 1E43A 4CD5A 2FPVA 3HOJA 3IJIA 3MCNA 1U5JA 5H91A 3VYLA 4NI3A 1DIEA 1DWAM 2DP3A 4H4IA 4KERA 4AD0A 3UR5A 5LZLA 3QQ0A 3LV5A 5DRCA 4IL0A 2GLKA 4HN8A 3LERA 1JCYA 2YIHA 4HJFA 1WE5A 3UPWA 4K38A 2ZRUA 3MY9A 4ZODA 3AROA 4ZL1A 4HBKA 3BLPX 5HXMA 2YKKA 2AAMA 1H50A 3WELA 9XIAA 4PTDA 1LOLA 2ZE0A 3MU7A 3WIJA 3A9IA 3NEVA 1I0BA 1RA0A 1XCFA 3BLDA 3W86A 3U2CA 1FDZA 3PTQA 4FHAA 4MUPA 2UV8G 1QI4A 1ZBWA 4MJMA 1Y0EA 1G01A 2YX0A 1RK6A 4N6FA 4QNEA 3V18A 4DZIA 5D04C 3NXFA 3WKZA 1L0PA 5XIMA 3ZVHA 4DBUA 2WVVA 5HR6A 5KZEA 2WMIA 4QEHA 8XIAA 5DMNA 1B9BA 5TD4A 3CEUA 4XSMA 2FB3A 1VFSA 1Q4WA 3VNJA 4DVOA 1DVJA 3IWPA 1JFXA 3KEHA 4KF1A 4Q4SA 3QRHA 3E0WA 4GJJA 3N4FA 3UF9A 3EWCA 1A5UA 1J0KA 3BLKA 3QPEA 4H6KA 3VD9A 1IEWA 4XBJA 1GOIA 2WMFA 2EAWA 2CETA 3AOFA 3LHZA 4IX0A 2ZXBA 1ISWA 2AOSA 4S3KA 4IICA 3WDQA 4DUOA 3ZZ1A 4JS3A 2P5NA 2HNHA 4WDWA 1VQTA 2PDHA 4XD3A 4OOUA 2REQB 4X22A 1R5YA 2GVGA 2EG8A 3M0HA 1GVSA 4TVUA 2H8XA 3M7WA 1AH3A 3VGEA 3GU1A 1AD1A 1RP8A 3BLEA 1HKIA 4Q4OA 3WLKX 2DZSA 3G6MA 3ZJ7A 1ZJAA 1YLVA 3N2BA 1IWBA 2PD5A 3W83A 3VNDA 3NFUA 4AXKA 2J74A 4C60A 4JEQA 1H7OA 3C3NA 1O60A 1JZ4A 1YW1A 1QK0A 1R9ZA 2A79A 2XFWA 4BEQA 1XXXA 4V1YA 3FCPA 3WF0A 4Z2JA 3KOFA 1XL9A 3OIHA 4KT2A 3KS6A 4A2SA 2ZX8A 2A6NA 4KS0A 1X38A 3GLCA 4DBSA 3VM5A 4TU1A 2PU0A 1HIZA 1GPWA 4XIAA 3EXTA 1UA7A 3AJ7A 1M68A 1JCJA 2HEJA 2RGLA 1OCJA 3H2AA 4E5TA 3AJXA 5CC5A 4HHMA 2QGHA 1XLGA 5CZKA 2GSJA 3LEPA 3C2OA 3MP4A 3UETA 4CQ8A 2YJQA 3HGJA 1NWSA 1ESWA 4IPLA 3DX5A 1W1TA 3LQGA 1AODA 3W87A 1DEDA 3A4JA 3ERPA 4I9TA 4O1EA 3D3AA 4S3EA 3RLHA 1XQLA 3EBVA 2DV0A 2C0AA 3OYZA 5FL1A 4HOWA 1RPXA 1P1XA 3WYZA 1S39A 1EF3A 3EPNA 2OGYA 4KKXA 5FJRA 3MVTA 4LEFA 1UD6A 3KZPA 4PB3A 2J24A 4B91A 3IUDA 1UIPA 4KEZA 4JN7A 1LQ0A 4AVNA 4JIHA 4N9EA 4EWND 1AJ2A 2PLJA 1G6CA 1DXEA 4TO8A 2VEIA 1IEVA 4UTTC 3PK7A 4F0LA 2F8QA 3CPGA 5AVHA 1MW3A 2H3BA 4O17A 4P7LA 2XN0A 3GHRA 1IT8A 3TOPA 1QOXA 1SSGA 1UKOA 4XIMA 4LB3A 1XIEA 4C6LA 3D6NA 1QPKA 3M43A 4FR1A 3TYEA 1OBAA 4JGDA 3BAYA 1QW9A 1IEQA 3BTNA 4KW2A 4K37A 3O1NA 4GOAA 5JXQA 3CZ8A 4GIAA 3AUOA 2YZRA 4YHGA 2G50A 2D0HA 3S9ZA 2DZWA 2VL4A 1V02A 3CL7A 3W1AA 1E71M 3CL8A 3T8LA 5AZ0A 4LY4A 3TXVA 3F2DA 1L8PA 3ID7A 4TR9A 4HPNA 1UR0A 4JQ2A 4KCWA 4D6IA 2CFFA 4DZ5A 2PE4A 3BLOA 1XFCA 2RFGA 5IFTA 1RY8A 4KIRA 1JI1A 1HJQA 1E4IA 3UYCA 4HU0A 5DT5A 2W61A 2BSLA 2F6XA 5CAHA 2XN1A 3LTPA 3KCLA 4H6QA 2VRKA 2KAUC 1XYAA 1VC4A 2VGBA 5G2WA 2GWNA 3WEZA 3CXOA 1YADA 5K4XA 1KWGA 2E25A 5AHMA 3MA8A 5DRIA 1OIMA 1NARA 1M04A 2XSBA 1JVNA 3O63A 1KBIA 1JPKA 2G37A 3IJDA 1KM2A 1SSDA 1LZOA 1OT1A 4UTJA 2VWSA 4UFKA 5EKYA 1LRQA 3SGUA 4MNMA 4IFKA 4KEUA 1RBOB 5T9BG 1WKEA 1HFBA 1ONWA 4D72A 1QT1A 2PA6A 4L4LA 1GWJA 3P14A 3QGAC 2OQYA 1E70M 1ONRA 1TX2A 2AL1A 2D73A 8TIMA 2XJ7A 2V38A 4HNCA 3TYUA 3STCA 3CLMA 1XRSA 4MVAA 1BVWA 1AQHA 3R79A 3SJNA 1LM1A 3LZ3A 4FI4A 2Y8UA 5LIXX 3LXAA 1V7AA 1E15A 3OZPA 3S8HA 4NRSA 3B8DA 5CJNA 1UD3A 3PTDA 2PDUA 2W62A 3VNLA 4C6PA 2CZVA 3UZZA 3MI2A 1W8GA 3UYIA 3VGBA 3GIPA 4NJJA 2PEVA 1DV7A 2E5DA 1J0IA 3O06A 1LL6A 2INFA 3WF3A 2Z1BA 3ABXA 3A47A 3KRSA 1JCMP 1OFDA 3HQ1A 2A3AA 1THFD 3U2OA 1BGGA 3R13A 1UWIA 1YE4A 3NL3A 5LNWA 1SZEA 3E2RA 1PS9A 3PS7A 4LVDA 1WZAA 2WV8A 3STGA 3F5JA 3WY1A 2OSYA 2P8CA 4LS0A 3CASA 3KWXA 3CHEA 1UWRA 2RUSA 2ZDRA 1LROA 4OV4A 2BVWA 3SN0A 5FSDC 5EMKA 1AZ2A 3W7HA 4TXEA 4LPCA 1NDYA 3WFLA 4JFVA 3RMJA 4YIWA 1VB9A 5FSEC 2GQ3A 5EPDA 4FF7A 4D6JA 4UOQA 4BF9A 4QCEA 3I4KA 4AW7A 3VX1A 4LYPA 3L0GA 3S6OA 3M46A 4IPPA 4M5PA 2O9TA 2ACRA 3S4TA 1K8YA 1A5NC 4D9PA 4CNSA 2VX6A 1BRLB 3IAPA 1EL3A 3L67A 4MNLA 3DERA 3TNOA 4J9JA 4JTJA 1R6WA 4KGJA 1K70A 1CXEA 3R43A 4MM1A 5JH2A 2WQDA 3WLLA 3CMFA 5K3VA 2QPXA 3SM0A 4RV8A 3O15A 3VI2A 3TLLA 1VBJA 1WBJA 3RHGA 2Y7DA 5LHEA 1YTDA 4EXBA 2FVKA 1MUWA 2P3ZA 3F2BA 4HHHA 2VJXA 4XZHA 3QY7A 3RLUA 1SZGA 3FAWA 3G5EA 4OQVA 1F3XA 2GYIA 4LALA 2Z00A 4O1FA 1T7LA 1WB0A 5ECVA 1TPDA 2QYGA 1XLCA 3L66A 4H7VA 2IS7A 1N7KA 1Y5WA 2E77A 3OBKA 1RZMA 2VEPA 3T07A 2WYSA 4W87A 2FZ9A 1FKWA 3MS8A 5JBFA 4QLJA 4MFDA 5M1TA 4HT3A 1ZAJA 1EX1A 2QJJA 1US0A 1A53A 3W7JA 4KWOA 3DH7A 2AKMA 6XIMA 4DJED 1XLKA 2BOEX 1Z69A 3GXPA 1QI3A 5IBXA 3PBUA 5H8PA 3DHUA 3E3HA 2QUUA 2DDXA 3QXBA 3LGGA 1E9YB 4NI8A 1DJZA 1XLIA 1P5BA 2BOGX 1JI2A 4LVGA 3F03K 1S2AA 1Z6KA 1PZ2A 3ZR4A 2VDGA 4H41A 1EJWC 3LX9A 1DJIA 2CWNA 4LV4A 4NZCA 3I7QA 1R3WA 5IFPA 3AS0A 1FWNA 3E2SA 3EDFA 3UW6A 3UU0A 5JQ9A 2ZTJA 3OVQA 2NV2A 1SZNA 2OELA 2ZA3A 4P8UA 5G1MA 1FWCC 2F7FA 2XVGA 2WM1A 2OODA 2V2CA 1E56A 4XAZA 3CGTA 4UNIA 1WDSA 2HS8A 1XR2A 3UJFA 4J3XA 1ZJBA 2GQ9A 3MYPA 4ZXLA 1E6NA 5IBXC 3HZ3A 3QQ1A 3CH0A 1KXHA 1XFBA 4L4PA 1DOSA 4P7RA 1ENUA 3P3BA 2VCBA 1OWQA 3MDUA 2NUXA 4IMCA 3MTWA 3RG6A 3ZLHA 4QSHA 3S5SA 3V1PA 1ML1A 4AF0B 1W32A 1J0YA 1BG9A 3APTA 1SO4A 3OU8A 5M17A 3R8GA 4DHGA 2WMIB 4RDZA 5A6JA 3EB2A 4RW5A 4J28A 3SUWA 1IXOA 1SJBA 3VCCA 4IMAA 1SR0A 4GMEA 1LCOA 3BAIA 3CZJA 2EF9A 3KTCA 3V0UA 3UNDA 5AYIA 3ARSA 4C5YA 1DTNA 2CBVA 3L5LA 3VD3A 4C6OA 3W7MA 3PC0A 2X1IA 5GNXA 4U5KA 5M3WA 1IEXA 3THUA 2W6RA 4ADTA 3KWSA 2CXEA 4PBFA 5CC7A 3ABQA 2X16A 4Z2LA 3N19B 3TYAA 4L65A 5ABHA 1J6OA 1GORA 1JUKA 2F38A 4DO7A 4I9JA 1RJPA 4NAFB 5D9NA 2E4TA 4X3ZA 4YTTA 3W1QA 1F8MA 2YZ5A 2OOFA 1EJVC 2ZZ5A 4UTMA 3K30A 1I75A 1ICPA 4C1KA 3L5AA 3M4HA 3UWYA 5CAKA 1JZ7A 3AI0A 1LL7A 1KO0A 4FLOA 3W7KA 4J5NA 2HVMA 4Z1AA 4MB5A 2D2HA 4RXGA 1S5VA 4WOQA 1U1HA 1PBGA 4Z2KA 4IGMA 1K6WA 3CJPA 4MY9A 1R3VA 3NM3A 2RKXA 4P2VA 3VGFA 2PTYA 3PBMA 3GW3A 1EWDA 3O6YX 3TA9A 1GQNA 1VCFA 3ZT5A 3PZUA 5G4EA 1P4CA 2PD9A 3H6OA 4G7EA 1PL9A 2EPHA 3VTRA 4RE4A 2JEPA 3AU6A 4NSBA 4WHBA 1VFFA 5T9CE 2BLEA 4WJXA 1XW8A 5I03A 3EDEA 1BYCA 2A3CA 3R6IA 3OA3A 2TRSA 4BQ2A 5AC5A 3CEPA 1RPKA 1GVYA 3E74A 4AZ6A 2QHAA 3W1MA 4O11A 1QPOA 1UA3A 4DF0A 2D3LA 3LMYA 2WHMA 2EJAA 1DE6A 3P0WA 1VCVA 3W6LA 3W7EA 4NL1A 3EKLA 4GZEA 4DNHA 3T8QA 3T4CA 1W3NA 4QQ3A 2QIIA 1V93A 4PCNA 3PPHA 5H2ZA 5D09A 3PNZA 4OU1A 1Q6QA 4L1WA 1H1YA 3RPDA 4AIEA 4XV0A 3EA2A 4EXQA 8RUCA 4GVIA 3VA8A 1EHNA 1NFBA 1QW7A 2YXXA 3PWAA 3R12A 4C65A 3WUFA 4XAFA 4DYKA 3NDOA 4C91A 1UWAA 2O4QA 1JZ3A 3KCJA 1UCWA 3VINA 1WBHA 1TV3A 1WKYA 2ZRVA 4JTRA 4JTIA 2CZFA 4EAMA 3C2EA 5FF4A 3SY1A 1TQXA 4YCOA 2PLMA 4N9DA 4PE8A 4LGXA 2NQLA 1XPYA 1B3XA 3IIPA 2C0HA 2BY0A 3AS2A 1E72M 3FKKA 3IRDA 2W0UA 5HQMA 3RK8A 3EOEA 2GJXB 1J4EA 2YL9A 1Q7MA 2GPTA 3CHDA 3ONBA 2YFNA 5GNZA 2PDCA 3WLOA 1K8ZA 1BWLA 4FK9A 3P84A 3CT2A 4JX5A 3TCSA 1NF7A 1A47A 5AHEA 1RCQA 3TQPA 1FFQA 1SYTA 4XZMX 3UT0A 1VJSA 3K46A 2OX4A 3O6DA 1DL3A 1KFLA 1BAGA 2J9ZA 3EA1A 4KWWA 3RPMA 3TYBA 4JDBA 3KOZA 2A21A 4F0SA 1BTMA 3QMSA 2JEQA 1J5SA 5EA9A 4NJHA 2DZUA 4F0HA 1IXQA 2V68A 3VD4A 1FXPA 5AHIA 1TZ7A 2D69A 4QAWA 4AY1A 1XLBA 3MO7A 1ZY9A 2J8FA 1T41A 3HURA 5L9FA 5LNRA 3P0XA 3V36A 3BJFA 3CL6A 3M0LA 4D6HA 4ERIA 1UKQA 4DYJA 1UZ1A 4B5XA 2UZ9A 4KRTA 2BGSA 5D2XA 4Q4PA 3SZ8A 3C86A 1ZU8A 4R7WA 1LBMA 1E4MM 3LRMA 5C9WA 4Z17A 3QV8A 3SCPA 3MUIA 4NZJA 2NVCA 3GDRA 5AC7A 3ITXA 2PBOA 1VJZA 4JX4A 3H2NA 1J8VA 5GVJA 3LHUA 4O13A 3BCDA 2E67A 1XYFA 1XD1A 2OU4A 1G9HA 1W9PA 2B7PA 4P5UA 3TNBA 4CD4A 4M8UA 3TFXA 3TE9A 4ZTXA 1DTUA 2X0YA 3KLLA 3S1GA 2ALDA 5DMMA 4OECA 4GQRA 4B5NA 5RUBA 3OBAA 4A21A 3TONA 1J2BA 3GNNA 3W24A 4GYPA 4OFCA 4AH7A 1IXNA 3PFRA 1B1YA 3KOYA 2OSXA 3MQTA 1QPNA 3W02A 2V9DA 4WUIA 4G5DA 1DYSA 3MJMA 1R86A 2Y61A 1D2KA 2J75A 1CTNA 5IDZA 1XG3A 3GYCA 2I14A 1XBYA 1UD8A 2PGRA 3SCRA 5DO8A 2QEZA 4ZO9A 4OOZA 1B54A 3OLIA 2GSEA 4J1OA 1JRCA 1ZCCA 4Q8WA 3KHDA 3L4UA 2C18A 1ZFJA 5DXXA 3I6EA 2I16A 2WC3A 1Y5XA 2FHBA 2XYLA 1PB0A 1C91A 5C54A 1UD4A 2GDVA 2MANA 1SO3A 2J9XA 3BSGA 4NU7A 3V0SA 3VABA 4FX8A 4Z1CA 3W1RA 3V35A 3LCHA 2WMKA 4G56A 1XLEA 2G95A 2VNCA 2DIJA 1YYAA 3FW6A 2YXOA 1G0CA 1JCXA 2AQWA 1XS2A 4E2BA 2W27A 3GTFA 1FCQA 2CLOA 5CZTA 4JNYA 3ZXWA 3W72A 3GAKA 6XIAA 1D8WA 3NG3A 1B90A 2ZA2A 1XJBA 1BXCA 2A7PA 3TSBA 1Y7VA 5FEWA 2O9PA 4PULA 5E93A 3WNPA 3AWNA 2CWXA 2YSWA 5DCDA 1TPFA 1V6VA 5HUPA 5A6LA 3OOQA 4OV9A 1QK2A 1TPWA 1R7AA 4LF1A 1EH9A 1LJYA 1C29A 5GNYA 4Q8PA 5LNUA 1P43A 1VLIA 2UWFA 1K03A 1AL7A 1E3ZA 1PKMA 1O1ZA 1TQJA 3DUGA 3G1SA 4GXWA 4HVXA 4UCGA 1ZBVA 4EF8A 2ACUA 4GI6A 1SO5A 1XYMA 2X7VA 3POCA 4WY0B 1OT2A 4JIQA 3PB2A 4PRTA 4NIRA 1EP1A 3SRKA 4MZYA 5CJ5A 4J2PA 4I7WA 2DUXA 1ONEA 4FXFA 3GTIA 1PAMA 1DWFM 3GXIA 2YCKX 3TX9A 1XINA 1TX0A 3WQEA 4X63A 1CLKA 1PHWA 1G7VA 3N9KA 4UUIA 3DBPA 2PRHA 3K8KA 3B06A 4AXNA 1Q6GA 3CK5A 5BRPA 1JUBA 4ZSUA 1W5QA 2FKPA 2POZA 5BZAA 1MW0A 3FHQA 3TA6A 1F6KA 4ICMA 3RILA 1GONA 5AKQA 1D3CA 2DT3A 3WFAA 1K9EA 2J62A 3TROA 1GOMA 4UIOA 2GZXA 3TUUA 5I3KA 4JN8A 1S5WA 1CDGA 5CBJA 3GDMA 3EXRA 3VOIA 1EO7A 1ZJHA 4ICCX 2IW0A 4ZENA 3O6AA 1E6ZA 4I7UA 5CGQA 5KZMA 2WCGA 3NQ6A 2KX9A 3QGKC 5JIPA 4LC6A 2E1DA 3IV8A 4HCHA 1GYLA 1ICQA 1E6PA 1XLLA 4DWDA 1S5NA 3URAA 2OT0A 1UBPC 5MKGA 1JDEA 2NVAA 1EHAA 3N15A 4AYSA 2Z28A 4I7VA 4DI9A 1KM0A 1JYXA 3PBVA 1AD4A 5KZ6A 3BSHA 2ACQA 3G1XA 4I90A 2B7OA 3C8FA 3P7YA 1ZNNA 3WLQA 4BQ4A 3CV7A 3CQJA 5XIAA 3MANA 4REQA 1VR6A 3NQGA 3HQOA 1HVQA 2G5WA 4XB3A 3T44A 4RR4A 1NP2A 3ARPA 3MV01 4W9TA 5E09A 4EAYA 2HCVA 4JYEA 1MEWA 2E5BA 2FIQA 2QNEA 3RIKA 2W66A 1KV5A 1P6BA 3I68A 1SW0A 1UW9A 1KB3A 2E1WA 2FMOA 5D9PA 1A5LC 1NDZA 1L6SA 3HO8A 1HKWA 2OWXA 1JGMA 1XRTA 4HPJA 1KXTA 3MSDA 4GK8A 4QDPA 1TV4A 4F3HA 4QAIA 4PFHA 4NZ4A 1J79A 3VNIA 2QW5A 3W01A 3VKAA 1PZ3A 1Q6OA 4H9UA 3PPGA 3SCTA 5CZ0A 4X0VA 1WO2A 1JPMA 2Y5SA 2XHYA 3QTGA 5C71A 1ADDA 4HOZA 3SAZA 2X8RA 4J3VA 2HBXA 4JIEA 4UQCA 4IOTA 4B2DD 1OVDA 4KQNA 3LSBA 4Y8FA 3QN3A 2DZXA 4S3JA 4F2BA 3CUXA 3URNA 5F4SA 2BWGA 2H8ZA 3HGSA 2ZUWA 4UFJA 3MB9A 2DIKA 3AMKA 4M19A 3IJ7A 2XFFA 4C5ZA 2VYOA 1RALA 4W5ZA 1LL4A 1H0IA 3OYXA 2CESA 4EPEC 2QULA 4LCSA 1UPPA 5DF0A 4Q8UA 1KR0A 4NYUA 3QYQA 4QG9A 2J27A 3OVPA 4HK6A 3GFXA 3V7PA 4ATDA 1VHNA 3UCQA 3UXKA 1NOUA 1MWOA 4I9MA 4RPPA 4H04A 3L68A 3F4VA 4AAJA 1GPFA 1Q6FA 3DDMA 2PRLA 1IF2A 2QV5A 3DFYA 1N8IA 3N9RA 3ZOAA 5J8LA 2YOCA 3CHFA 4H00A 1TE6A 1HJUA 1EJSC 4O4WA 2HNEA 4NZ3A 5LA0A 1E1CB 5D2TA 1H7WA 1UH4A 3GNDA 3N11A 1ONXA 2NVDA 4QISA 5A2BA 3MWCA 2NT1A 5SWUA 4B5UA 3NWRA 4YTSA 2Q71A 2OYLA 3T1GA 3ZR6A 3GK0A 4GO9A 1KM4A 4WKFA 2F84A 1KD0A 4ZR8A 1W17A 3FJ6A 3WH6A 4I5XA 4UTIA 4AD2A 1GCYA 4HMDA 4HU8A 1CGUA 3P8IA 2BNJA 1N55A 1XIFA 2QDGA 4JFTA 3N18A 2W91A 1AFSA 4F9JA 1EDGA 3W2NA 3WLTA 3B4YA 2YCJA 2GGHA 4QE4A 5B7ZA 3OQEA 2HROA 2QCHA 1EZ2A 1PKLA 5BNKA 4DO6A 4X2RA 3IK2A 4IIDA 3R1ZA 1UH3A 1KGUA 4Q8TA 3OBEA 2DPEA 2XH4A 1SGJA 4AMCA 2R1MA 2A0NA 3VIGA 4MGGA 4DUXA 1O4UA 4MY1A 2A85A 1QFEA 5AC4A 4NJIA 3GSMA 3K1DA 1HP5A 2I5GA 4S3CA 2HDJA 1S1RA 3Q4DA 2OEKA 3QSTA 2PI6A 1O12A 3W7RA 4JIPA 2BV9A 4QE1A 1WDPA 2QDDA 1EDQA 3SQMA 1PCKA 2PURA 3VFLA 4PEKA 1KGWA 4IT1A 4MPQA 2JGQA 4RNFA 5G2HA 3NZ1A 3TN3A 2XVPA 4LBUA 4N42A 3T7VA 5C8BB 4PCPA 4NXKA 1WDRA 2AMGA 2OKTA 4P7QA 3WBEA 4DF2A 3UCCA 5LIWX 3EGJA 3UGVA 1RP9A 4UQDA 2DZVA 1VIZA 4PUEA 4PL2A 2Y88A 2EPOA 3T2PA 3U0HA 2J25A 1GVEA 2X05A 1HJVA 4LCRA 4IQLA 5DMLA 2V5JA 3DG3A 5DCEA 3V75A 2ZTKA 1RCXB 4UNKA 1VPYA 1F9CA 5ABFA 4WF7A 3QLDA 1EX5A 3PN8A 3UBPC 4FB7A 5I77A 4HD5A 1FCUA 3U4AA 2YL5A 2QJHA 4MLJA 1SQ7A 3OVGA 2CLLA 3SJ3A 4TUFA 3GE7A 5D4YA 3RXZA 5K9XA 1LG2A 2XH7A 4CKQA 2ZZ3A 1RJQA 1JCNA 1OCNA 1AL8A 1K4HA 4Q7NA 4H9MA 3WL1A 3QW4B 5B80A 3GR4A 3I65A 3RRAA 2EKGA 2OKOA 2CZEA 3EWZA 4XAPA 1S2TA 1W1YA 3BAWA 5EGRA 4OKDA 3W2UA 2WKLA 3UD6A 3W70A 3W82A 4LS2A 4CLMA 5I6SA 2P0OA 4QLKA 3GU2A 5BRQA 4HTYA 2Y1HA 3M6DA 1DP0A 5C55A 5I5RA 4MWAD 5C9RA 4IG2A 4F0KA 5CPMA 2QZRA 4Z42C 2CBUA 2DW7A 1A4LA 3VO0A 3TZNA 3E2VA 3R7MA 4J3UA 1MNSA 5A6AA 4LAOA 4RV3A 4QX4A 2Q01A 7ENLA 4P8WA 3IJ6A 3SGGA 1JPIA 5BXTA 1HGWA 1LUCB 1ISYA 3VDBA 3DFSA 4QGCA 1DJYA 1JNDA 4DPQA 4M82A 1TTIA 4HZ6A 1VZWA 1TWDA 3S42A 1UBSA 1KTBA 3Q45A 4XZ9A 2OYMA 3WBWA 1K9DA 2CU0A 4E6MA 4O28A 4RE0A 3OGVA 5D9OA 1QBBA 1JR1A 4XBSA 4PB5A 1XIHA 1RVKA 3AHXA 1M41A 4JTLA 3DKJA 5CPLA 4O57A 1QHOA 2FDMA 1H60A 1XC4A 2ZDSA 2XISA 4JL2A 3NL2A 4E2DA 5A95A 1J9YA 1GG0A 1TELA 3N6JA 4WK9A 4JQ1A 4ZB0A 1XLDA 4CU7A 1QNQA 4WJ8A 3LDVA 1A50A 3DFHA 4LAKA 2JKEA 4K1WA 5KSWA 4U28A 3LGEA 5I3FA 3UWEA 3CYVA 2GSHA 4UTLA 4ZO8A 3GNXA 4V28A 3NURA 1BYBA 3OZYA 4AVFA 1AQFA 2DJLA 1V3JA 3G2GA 2VUNA 3LNMA 2X42A 4UZUA 4U2ZA 3P5YA 3HMCA 3MKVA 2WMJA 1YXCA 3LQLA 3TW7A 5ABFB 2OT1A 1E3XA 1R3RA 1GJPA 3DEQA 3CM4A 1JL8A 4YHEA 1V8EA 3VUSA 5E6ZA 3WLNA 3CO4A 4R7OA 1EJ7L 1IWAA 3RR1A 3ISIX 3FYOA 4JTSA 4E8GA 3CPUA 2RH9A 1WUEA 5C9XA 2ZWYA 5HATA 3SUVA 2J8GA 3QC0A 2VR4A 2OTDA 1GHSA 4O50A 3QW3A 5DBTA 3BK0A 2XVNA 1X7IA 4F40A 1DIOA 3FYYA 2QCEA 1UR3M 1R2RA 4DB7A 2ISFA 3F4NA 4GJ1A 3FA3A 3UCDA 4AMAA 2CW6A 3VIMA 3THQA 5BOFA 2F61A 4Y2WA 4JD4A 2XIQA 4XO6A 3SCNA 2NX1A 2Y89A 3A23A 4DXVA 1U33A 1Q6LA 3E0VA 1PEZA 1NEYA 2J77A 4FLRA 3QFEA 3PZIA 4NAEA 3CO8A 4P7OA 1T0OA 2AKZA 5IOBA 3HPFA 3TIMA 3N6HA 3RU8X 4HPXA 4DLFA 4UFLA 3EEZA 3SIMA 1K7XA 1OFOA 3GRIA 2OO6A 4HHPA 1ZJIA 5MKGB 3V0TA 4CNUA 1W3IA 1ISXA 1TWZA 2NXHA 1UB3A 3QVQA 3N14A 3PSVA 1W1PA 3TEVA 1O5QA 3G1HA 1QXLA 3XIMA 2PSNA 4IJBA 1MDLA 1L2QA 2A3LA 5LXXA 2PFHA 2G41A 1OFRA 3L0KA 2QCDB 1B9ZA 3ECQA 3G0XA 3USBA 3ONCA 1ZTVA 4CEUC 3UP8A 4Q4QA 4HA1A 4R85A 3N73A 7ODCA 4AZCA 3Q65A 3FGCB 4A8RA 4L4OA 1HF6A 4ACYA 3EDDA 4JTQA 3H4WA 2C15A 4UTKA 4GA8A 2VR5A 1JYVA 1A3XA 4IZGA 2C14A 3SURA 3UG3A 2Q09A 2J79A 1Z41A 4MJZA 4GO8A 3PM6A 1VBUA 2XGIA 3Q2DA 1Q8AA 2DY3A 1V0LA 1XICA 1DJWA 1X8CA 2QCMA 2VCCA 4DUWA 4HJWA 1Z48A 4IIBA 4GABA 1LOQA 1KRCC 3U2EA 1CGVA 4XX6A 2PDJA 3VU2A 3OVRA 1TFVA 4EOUA 2XSXA 4CD7A 3M41A 2VEGA 2VFFA 2WSKA 1GEQA 4BHYA 2DFAA 1A5CA 4YLWA 1JULA 2WMHA 1U30A 1H11A 1HKKA 3GD6A 1L9WA 4NT0A 5CPOA 4RKAA 3MMUA 4JQAA 3LCXA 1W3TA 2OG9A 4DAFA 3S1WA 3GYEA 1B4EA 5HINA 2WPGA 1CI1A 1OSEA 1W2VA 4LUYA 3ITLA 3LCLA 3UZ5A 3K1GA 3MKKA 4Q8OA 1XLAA 3ZO9A 1XKJA 1YX1A 3HA1A 2DUZA 1P1MA 3T55A 1GHRA 3GS6A 1C8QA 3L9CA 3OG2A 3KCOA 3I10A 1OFEA 1H3GA 4PN2A 2YFOA 1GJWA 1RQBA 2P3EA 4GVFA 5CZSA 2NWSA 4C7FA 4ZOEA 4HB7A 4IH3A 3TC7A 4K8HA 4ZZ9A 4BR1A 4LH8A 2O9OA 2PDPA 3RCMA 3CNYA 3ZYZA 1CB7B 1TJ2A 3DFPA 4IIHA 2NLYA 1UZHA 2RDTA 4EE9A 3EPMA 3O05A 3R0UA 3HPXA 3WCZA 1OC6A 3UGRA 4YYFA 2WLYA 1HN1A 3AALA 1PE1A 5K9DA 2DZTA 3PJWA 3PSWA 3HN3A 4KCVA 1YNYA 3TAOA 2PDWA 1XLFA 4M6PA 4G6CA 5ABGA 1UJQA 5G4HC 3M64A 2CC0A 1EA0A 1KBBA 3IGSA 4K7VA 2WBGA 4K2SA 4OBRA 2I7GA 1C7SA 2VRJA 3S6DA 2WMGA 2J7CA 2VGGA 3FAXA 1FY6A 1CGWA 5I23A 3MVIA 4W86A 3VOFA 3UWUA 1GTHA 3SCOA 1I2PA 1OZMA 3MMDA 2AL2B 4E4UA 2IPWA 3WEOA 5C70A 4PR4A 4DJDD 1UD2A 1F5ZA 2DSKA 3VDHA 2VX7A 2PP0A 3G22A 3QV9A 5LGXA 1Q3NA 3I4EA 1LDCA 3M0KA 2QR6A 4CQ9A 2D2JA 3QZ6A 5CSUA 4IM4A 3PAOA 4AEEA 1E1EA 4ZA0A 7TIMA 2PBGA 1HX0A 2XPKA 2NXGA 3CAWA 5FF3A 3F1QA 3DIPA 1KBLA 3VC6A 5CLWA 3GR7A 2CEQA 4INFA 3OQ8A 1XYZA 2PAJA 1XGDA 3H8AA 2WCSA 3U3HA 3XINA 1FOBA 3RJYA 1L6FA 4WVXA 2IPGA 2CIPA 2E6YA 2Z4GA 3FV9A 4NY2A 1TUFA 1H5VA 4QITA 1VYPX 4IG2B 3PZGA 1WNOA 5HPCA 3AYRA 1PIFA 1DPMA 3GVGA 1OFPA 1IEIA 3NOEA 4Y90A 4A35A 4O52A 4M81A 3QSRA 4HMCA 4IMFA 1FP9A 2Y5EA 3U5UA 4PTMA 1HL8A 1YRRA 2UY2A 1HJSA 2XG9A 2EG7A 3OA5A 1GG1A 1AVAA 1EB3A 2AGTA 3IIOA 4QIUA 1M65A 4M29A 1MNZA 1SR9A 1HZYA 5DCBA 4X2PA 2BFGA 5DY3A 1ZCOA 5DMYA 3AQUA 1PWMA 3N2TA 1MVYA 4QRNA 1ITUA 1FHDA 4FOKA 1XGZA 3NSXA 1UP3A 3OG3A 3MBFA 2Z1WA 5DY2A 4HCLA 4S2BA 1EZWA 1PTDA 3CB8A 3RO6A 3CAQA 3WH5A 1LF1A 2VMFA 2FYMA 4W8LA 3MWAA 3NQEA 4DY1A 3CQIA 2PDNA 1KFBA 4UFHA 4XD5A 4DQWA 3S5OA 2YYUA 3UG8A 3U8GA 1REQA 3AZSA 3WH9A 2BX7A 2QKFA 4QCFA 2NQJA 1W8SA 3GC5A 1BTCA 3NZRA 3THDA 3F2CA 4AG0A 1GJUA 4GXPA 3LMZA 1RR2A 3PJXA 4OT7A 2CYGA 3KRBA 3GXFA 4ML9A 5M2FX 1MQPA 1YPIA 3UPMA 3FN9A 3T0AA 1OGSA 2H90A 4Y8EA 1RVGA 2X1UA 3C3UA 3ABRA 2QPUA 4J4KA 4YJ5A 5AYZA 2JBMA 1X6NA 1WXJA 1IGWA 2HPIA 2XIMA 1KA9F 5D30A 1BSIA 3GFZA 3LRKA 2DEPA 1MW1A 1A0DA 1JQVA 4LRTA 1EYEA 5HMSA 3W88A 3SUUA 3ZS4A 1REQB 1Q7ZA 1S2CA 2WW5A 1BKHA 4BK9A 1SJCA 4H01A 2NW0A 1BPLB 1Q6RA 4Y9OA 1WKFA 1LWJA 3LK6A 3WG6A 3T0TA 4S3BA 5DEZA 4UTTA 3R2GA 4IP4A 1C92A 4BF7A 3EX4A 4D8ZA 4B3LA 1QO2A 1PYFA 2CHRA 4UWMA 3IK4A 5A8PA 3TR2A 1OG0A 1ADOA 5I3HA 3N1AA 1M5WA 2OJPA 1FTXA 4H7CA 1W9DM 1F76A 4G1NA 2BODX 4A3YA 5IXEA 1CXKA 1XLJA 1FWGC 5BCAA 8CGTA 1YE6A 1PIIA 5J5DA 3HFYA 4NVTA 1LQ2A 5A8NA 4MNKA 4AHOA 3KBMA 4C7DA 2PB1A 1OX5A 3UZWA 4HZ7A 3BLFA 3GIYA 1V5XA 1OC5A 5JIWA 1SMDA 2ASHA 4R3UA 4EK7A 2H9AB 2WM0A 2G3FA 1E5JA 4IIGA 4M0XA 1HL9A 1GZJA 2C3ZA 3E0FA 3H4GA 3BAXA 4US6A 4DAIA 4GCXA 4XKMA 2TODA 3QC3A 1L6WA 2XUCA 4RE2A 3NQBA 1BRLA 1J93A 4AUBA 3C0QA 5FEZA 4D8AA 2XFYA 3KP0A 1ZZMA 3HM7A 1R87A 1T6MA 1K7FA 4O8RA 2XZ9A 3ITCA 8A3HA 1XPGA 1L6YA 3DGRA 2HE8A 5FJUA 3BH4A 4UQBA 2PWUA 3AIBA 2PU1A 4DZAA 3H7VA 4GQGA 2YCLA 3FKRA 4QJ4B 3WDIA 3CHVA 2HK1A 4DM1A 4YVXA 2P88A 3GW0A 4ALDA 1JZ5A 1J6PA 3F5KA 1EO5A 2YPIA 1TR9A 3TWAA 1W91A 2FTWA 1NDVA 2ZUNA 3VE7A 3THCA 1UKPA 4DM2A 3DG7A 1AH0A 1UR9A 3VNYA 4F8XA 3SCWA 1JUEA 4GBUA 2FTYA 1AW5A 2Z29A 1QRQA 2VFIA 4J3SA 4UTWA 3LNPA 1PCWA 1S3TC 3BOLA 3TLQA 3WN6A 3P81A 4W7VA 2G4FA 1O5XA 1UP0A 3I6TA 1EUNA 2QQ6A 3GG8A 3LHYA 5D9MA 4GQ0A 1AH4A 3DC8A 1H7XA 2PWDA 2OFJA 4GC4A 4Z2HA 3M7SA 4PBGA 3DHDA 1EWEA 3UWQA 1ZHAA 2OSWA 1O68A 1H41A 4MB3A 3GQYA 2F9RA 5G1YA 2GOUA 1E0VA 3N2CA 1QTWA 5D8ZA 4QTGA 2V3GA 4RXFA 3K4WA 4ZMGA 3A13A 1W2PA 1F4AA 5HNUA 2GVJA 4YWIA 4ZSTA 1MSSA 2D2GA 3W7CA 1XSKA 1EFZA 3PG9A 4OBTA 2PDBA 4G1KA 4L1XA 4ATLA 1NOWA 4E3TA 3C2FA 3D46A 4WQ6A 1Q65A 4Q8NA 3ZQ9A 2YB4A 3H2FA 2O4MA 4UC5A 3EWUA 5HOSA 1Z42A 4Z1BA 1JZ6A 2FQIA 3PUEA 4UTFA 4PODA 1BYDA 4NAFA 3GB6A 4G7FA 4JNZA 3AYSA 3IANA 1AQ0A 1LRNA 5G4WA 2IPJA 1FWWA 1E9ZB 1JDDA 3R8HA 2QF7A 1OF8A 4PMDA 4DRSA 5G5IA 4TOQA 5A8OA 4HYRA 3G18A 3ARWA 4FR6A 4OUIA 3HPSA 3WENA 3WQDA 1MMFA 3BW4A 1I2QA 2ONEA 3KZSA 3MHFA 3DG6A 2IPFA 5ABTA 4K3ZA 4GYFA 2WXDM 2HS6A 2WKGA 4NUWA 4JL1A 3WLIA 3AYTA 2VENA 4DIAA 4JTUA 4LAUA 1XIMA 3DAQA 3I6RA 3UJRA 2XU2A 1FWAC 4B9YA 4L56A 3NTYA 1R30A 1JIBA 4B3KA 1ZGDA 3NQ8A 4R9OA 3B9NA 3W2KA 3TSDA 3TSMA 4LANA 3GVWA 2MNRA 3GHUA 3WUEA 2FZ8A 2ZIDA 3WLRA 2X7WA 4UOZA 1JJKA 1XLHA 2WVTA 3P61A 4K8EA 1Z89A 1HUVA 5GJPA 1YDVA 1IE7C 2C91A 3N29A 4S23A 3AS1A 3EYPA 1TTQA 1P0BA 2X41A 4WLCA 2VD8A 1LUCA 3FJLA 4DZHA 3WD2A 2VC9A 4KCUA 5AOUA 5A6BA 1KR1A 1JF5A 3TJIA 1Q45A 4C6EA 2ISSA 4IUGA 2Q8XA 3HB9A 2PGWA 3IGHX 1EC8A 4X0NA 3ITTA 1Q13A 3L4TA 4I8YA 4XTIA 1XBXA 3N4EA 4NNBA 4E0CA 1SFLA 3KM8A 3BARA 1WAUA 2H3DA 1H7NA 2G0WA 1FWFC 3VXGA 3N3TA 3E96A 3EOOA 1TRDA 3NPUA 4HMNA 3SUTA 3FGCA 2ZRWA 3R10A 2JQXA 3RU6A 5E0CA 6ENLA 2PPGA 4Q8QA 3LPOA 2EXOA 3SGZA 4JQ3A 1UWQA 4WX2A 1NVMA 1EC9A 2WVUA 3HGRA 1I9CB 2WJEA 3WLPA 4LNCA 3OLDA 3VDAA 3TFCA 3C56A 4YYCA 5CBBA 4LRSA 2YW4A 1EXPA 3MPGA 2IQDA 3SO7A 5ENLA 4AD5A 3K8MA 3RR4A 3GH7A 4UR8A 3GNOA 3JUGA 1ZP3A 2BMBA 5MHBA 4TV6A 3TW6A 2X1TA 2EPNA 5EBUA 1K8CA 4RZBA 5F2LA 3MUCA 3ARZA 2YGYA 4QDMA 4PRRA 2VELA 3A3XA 5FF7A 4LX4A 1YHTA 2WSQA 4XKYB 1B57A 4UTWC 1PO9A 4ZOCA 3N25A 4IJCA 4JCLA 3PHAA 1UR1A 4JX6A 4KWVA 2A7NA 4O4VA 1DQXA 1W1A1 4AZGA 5F1VA 5A1AA 1KM5A 2OVLA 4CU8A 3OW1A 1JAEA 4KFPA 5EMYA 2Z7KA 2WZTA 1YDOA 5CGTA 2DVXA 5FKYA 2ON3A 4YVPA 1BHGA 3VKJA 2J9YA 3GR8A 1ODZA 1AZ1A 1TWSA 4H9YA 4JICA 3G1AA 3GNPA 1RHCA 3A3WA 1B3YA 4R34A 3NPVA 4HSNA 3BCJA 3MW7A 4UTHA 1D7FA 1TIMA 1R0MA 2HV5A 4L9ZA 5E9XA 2YBVA 4JTTA 1NTHA 4IFRA 4PRWA 4IP5A 4W5UA 1KKOA 1R7OA 3K4AA 3G1YA 1KTNA 3PFMA 3SI9A 4FSAA 1FH9A 3S1VA 3QMRA 4PUNA 3A22A 2D3NA 2VEKA 4MKVA 1OX4B 3W29A 4UZSA 5FEXA 3BE7A 2BHYA 2CHOA 1WXYA 2Y7FA 4HNTA 3VUPA 1NQ6A 2PWVA 2J7FA 1H09A 3L2LA 3ZJ6A 3ARXA 4LWWA 1TVNA 1UP2A 2P1FA 2VX4A 1UG6A 4HN4A 3COTA 3LM3A 1IGSA 4A05A 4MJ4A 1WAWA 4JNMA 1JPDX 2C7FA 3VMNA 3QPYA 4L7ZA 4HHLA 3RM9A 3LLXA 1XG4A 2X1RA 3LXBA 1E9IA 4Q8MA 3VIKA 3OIXA 2Y8KA 1RD5A 3UY7A 3INPA 2UBPC 4E4PA 1YBQB 2Q8ZA 1YNPA 4GY7A 1CGXA 2WBKA 3WL0A 1FFRA 3TOYA 2XIBA 3MT1A 1XHGA 3R8RA 4MJ2A 4HK7A 1W9UA 1UR8A 1M03A 2GOKA 3L65A 4KFNA 3W6YA 3VDCA 3F4CA 1V02E 1KNWA 3PNUA 3B4UA 2RDWA 3BCFA 3LLFA 1L8NA 1F73A 1QI5A 3VOHA 4ADSA 3UR8A 2E6DA 1WDDA 3T2OA 1JYNA 2CCRA 4EX4A 2OYKA 1FQ0A 3V1HA 1TCDA 2VX5A 4FMVA 4YU1A 2FPYA 3CPRA 1U5HA 3GKFA 4GH3A 4CQCA 3O3RA 4PMRA 2WSPA