2HRWA

Crystal structure of phosphonopyruvate hydrolase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
290
structure length
281
Chain Sequence
b'MTKNQALRAALDSGRLFTAMAAHNPLVAKLAEQAGFGGIWGSGFELSASYAVPDANILSMSTHLEMMRAIASTVSIPLIADIDTGFGNAVNVHYVVPQYEAAGASAIVMEDKTFPKQELVRIEEFQGKIAAATAARADRDFVVIARVEALIAGLGQQEAVRRGQAYEEAGADAILIHSRQKTPDEILAFVKSWPGKVPLVLVPTAYPQLTEADIAALSKVGIVIYGNHAIRAAVGAVREVFARIRRDGGIREVDAALPSVKEIIELQGDERMRAVEARYLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphonopyruvate hydrolase
publication title Structure and Kinetics of Phosphonopyruvate Hydrolase from Voriovorax sp. Pal2: New Insight into the Divergence of Catalysis within the PEP Mutase/Isocitrate Lyase Superfamily
pubmed doi rcsb
source organism Variovorax sp.
molecule tags Hydrolase
total genus 104
structure length 281
sequence length 290
ec nomenclature ec 3.11.1.3: Phosphonopyruvate hydrolase.
pdb deposition date 2006-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 2hrwA00
4TV6A 4KCTA 2L5HA 3HQNA 3T07A 1ZJHA 3BJTA 2XZ9A 1F8IA 1F61A 1M3UA 1O66A 4MG4A 3E0WA 4DRSA 1PKLA 3EOEA 3SRDA 1KC7A 2BG5A 3QV8A 4L9YA 1PKNA 2KX9A 3KTXA 1T5AA 2DIKA 3QV6A 1S2TA 4QGCA 4LSBA 2R82A 1GGOA 2XDFA 1A5UA 1SGJA 4L7ZA 3OQ8A 4QG9A 4B5WA 4QG8A 1S2WA 3QV7A 4KCWA 3PP7A 3OYXA 3E0VA 4L80A 4B5VA 1AQFA 4HYWA 4G1NA 1XG3A 3OYZA 1F3WA 3U2ZA 5JVLA 1A3XA 2V5JA 4B5TA 4IQDA 3GQYA 3MA8A 1E0TA 2HWGA 4FXJA 3G2GA 3LYEA 3PUGA 1PKYA 3HQOA 1DIKA 2VGBA 3QV9A 4YJ5A 4B2DA 1IGWA 3B8IA 3EOOA 2WQDA 3QQWA 1UJQA 1S2VA 1ZLPA 1F8MA 2QIWA 4B5UA 3SRFA 1KBLA 2VGIA 3BJFA 2V5KA 3N25A 4ROQA 4B5SA 3M0KA 2XZ7A 3I4EA 4IP7A 3E5BA 3ME3A 3QZ6A 4IQEA 4JPGA 4B2DD 3SRHA 4KRZA 1M1BA 1DXFA 3IS4A 4FXFA 5TAOA 4TV5A 2X0SA 2VWSA 4QG6A 3QTGA 2ZE3A 1PYMA 3GG8A 3KHDA 2E28A 3QLLA 4IMAA 4MF4A 1O68A 3H6OA 1F3XA 1MUMA 1OQFA 4KCVA 4KCUA 4KS0A 3LG3A 3M0JA 1VBGA 4L9ZA 1XG4A 3T0TA 1DXEA 2HJPA 1VBHA 1U5HA 3EZ4A 2VWTA 4YNGA 1U5VA 2OLSA 2G50A 1E0UA 3T05A 2VGGA 3HQPA 1O5QA 4B5XA 4RPPA 1DQUA 4HYVA 2HRWA 1A3WA 1JDEA 1S2UA 3FA4A 3SRKA 1PKMA 3R4IA 2VGFA 1Z6KA 2DUAA 3EOLA 3VAVA 4WJ8A 3P0XA 3GR4A 1A49A 1IZCA 1OY0A 2HROA 3FA3A
chains in the Genus database with same CATH superfamily
4LAOA 3KDNA 3WG6A 4PUEA 5JBEA 3IPWA 3DN5A 1WDRA 2RJGA 1RP9A 3M16A 1P6BA 4BKNA 1UOZA 4JFUA 4WKAA 4IQLA 3SUUA 2INFA 2W4XA 2R8WA 1KFJA 2OLAA 5JU6A 3MKCA 5FI8A 3UA3A 2C0HA 4LAUA 1CIUA 1FCUA 1YLVA 4QFUA 3LSCA 2DW7A 1V6VA 1BRLA 4DBUA 2ZWZA 4XKMA 3HOJA 4PH6A 4I8DA 5BXTA 3KRBA 4LAZA 4DYJA 1B54A 1GKQA 4MM1A 1FKWA 4GC4A 4QROA 2VCBA 3VX0A 4S3CA 2B0MA 2WHJA 1ZAIA 2VZUA 1R3SA 3TWAA 3HB9A 3ZWSA 2OZTA 3MZNA 3W25A 1H61A 4RJEA 3OHIA 1OM0A 3W85A 4X3ZA 1XINA 3KDOA 1PYMA 1ESWA 4XD4A 4H7VA 3PJTA 3GX9A 4HYRA 1AVAA 1RJRA 2ZX5A 1B57A 3WQOA 1XLFA 1JG9A 1E5NA 1DTNA 3WKZA 1MRAA 3VKKA 1WZMA 4PBFA 3MI3A 3NSMA 1O6IA 2FZ9A 2G4JA 4FMVA 1OFDA 4HHLA 1UASA 4IUGA 4DWSB 3ITVA 4A8LA 4JTDA 3CPRA 1VRXA 4HOWA 3CAKA 1DIDA 4LYQA 1F61A 1FHLA 4UTTA 2VEKA 1KV8A 4JTQA 3WD1A 2E5BA 1LOQA 2XFYA 3QV6A 3GTXA 1NH6A 2XDFA 4A3RA 2WYSA 4Q4KA 3VIHA 4E4UA 3NQCA 2I7GA 2F38A 2VKZG 2DJLA 3STPA 4DZ5A 1R3VA 2CZDA 3PJUA 4YXGA 3LHTA 2O7QA 1S3HA 1DOSA 4KW2A 1BQCA 4EP8C 2VTFA 4O28A 1CTNA 5CPTA 2A3LA 2ISDA 3TVAA 4Q8NA 1M7XA 2DZUA 3QGVA 4YS1A 3R5EA 1KA9F 2FLIA 1QWGA 3GS6A 4MNLA 1M03A 2DIJA 4MNJA 3KOFA 3B4UA 1W9DM 1MYRA 1QPKA 3FYPA 4DF1A 1WP6A 1VCVA 2GWGA 4MFEA 1Q6EA 4JTRA 4M6PA 1ZBVA 2HJPA 2D3LA 3AU6A 5D2YA 2QUVA 4X2PA 3CB3A 4PODA 4PFHA 4DUVA 2P3ZA 1JDEA 5DBTA 3HPXA 2ZCGA 4JQ3A 2QCCA 3O8AA 3VTRA 3GXFA 1DJWA 3NYZA 5F4XA 5ABEA 1H4PA 3ITLA 5G1YA 1XPGA 1XQKA 5A8MA 2PF0A 4TV6A 4YTUA 3MWAA 3F7JA 1FX6A 1SZEA 3BSGA 1GPWA 1YE6A 3N2CA 3T42A 2VX5A 2Y61A 3WLKX 1JIBA 1NP0A 3TUUA 1BEUA 4GUFA 1WDWA 4PTDA 1E6SM 2VCCA 2MNRA 4AWSA 1VFLA 2WNNA 5FJRA 4K1WA 4JL1A 3NQGA 3HPSA 4ZZ9A 3BJSA 2PEVA 3ZZ1A 5LIKX 3EWDA 1D3HA 4ILSA 3CWOX 3RM9A 5REQB 5CPNA 3NVDA 5BU6A 3EMCA 3UY7A 3PZGA 1JPIA 3LHVA 1YPXA 4N42A 3N2BA 2YW3A 1ZY9A 1FH7A 4NF7A 1TRIA 1JR1A 3BW3A 3E3HA 2YL6A 2ZRYA 4LUYA 2H8XA 3VMOA 3T0AA 3CH0A 4BZYA 1NF7A 3WUBA 3W7LA 1QI4A 4LVFA 2HMCA 4DN1A 1XCFA 5CJNA 2XINA 4NY2A 1FKXA 2Y63A 1JVNA 1UD4A 2QF7A 3OGSA 3SUTA 5GJNA 1ISYA 4J2MA 4A2SA 1HXJA 1LOSA 1T99A 3K13A 3GY1A 4W86A 2XPKA 1HJXA 2BHZA 3LCHA 3M0YA 1OK4A 3VK5A 3EWXA 2DFAA 2OO0A 2PDXA 1VHCA 1ZJIA 3I10A 4M0XA 3UJFA 2WK2A 2I5IA 1GONA 3VDBA 1S2TA 2DQWA 2HV5A 4YTRA 4P7QA 5IDZA 2F2KA 3W7HA 2QEZA 3VIPA 3G1YA 4JTJA 5E93A 1TWWA 4L1WA 4ALDA 1R9XA 1TMLA 3XIMA 2VFEA 4YWIA 3A9IA 2VMFA 3IANA 2X1TA 5ECVA 1AG1O 2PBGA 1M5WA 3TC6A 3KRSA 2ZDSA 1UHVA 3T78A 2B7OA 3SIMA 4A8IA 4Q32A 4AD5A 2JQXA 2OSXA 7PTDA 3SCNA 3ZR5A 4Q4PA 1UUMA 1LT7A 1R38A 3GG1A 3O07A 3JU2A 3N4FA 2GQ9A 3WF0A 2FMOA 5EFFA 4LPCA 1U5HA 4BA0A 3EZ4A 4LUJA 1U2YA 2NUXA 3NVTA 4Z0JA 3DH7A 2OWXA 1SO5A 2BOGX 7XIMA 2PWDA 1PKMA 1R7AA 3DU0A 2ZZ7A 4S3KA 3VAVA 3WFZA 2YFNA 3S1GA 1XH2A 2WKGA 5FSDC 4FNQA 3GW3A 1KRCC 2CYGA 4GUJA 2X1UA 2PDLA 3BJTA 3IGXA 4ZB0A 2Z6IA 3BW2A 1XSIA 3S0CA 1SVDA 3HPFA 1QBAA 3IVSA 3WQ5A 3BZGA 3HN3A 1FVPA 4FO4A 2ZX6A 3H23A 4K68A 3OPSA 1XLCA 2VENA 4DAFA 4Z42C 4LEQA 1A80A 1H2JA 4Q7BA 4MMWA 4ZQPA 1NF0A 1LRQA 4GX8A 1TPEA 4YJ5A 2Q8LA 4GQBA 1B9BA 4AZ5A 4DBEA 3H2MA 3PUEA 4RXFA 3VZYA 4GYPC 4ZSUA 1UQYA 1AH4A 1OFPA 1W3LA 4ES4A 4CD4A 4DO4A 5HR6A 4OGZA 3W72A 3VKBA 1YYAA 2X7VA 3AMDA 2MUCA 3IAQA 1A0EA 1A5SA 3RR4A 4C6IA 2CESA 1KBKA 2NX9A 2A21A 1AJ0A 4BF7A 4MYAA 2Y8KA 3WBEA 3RMJA 3WF1A 1PYFA 1OT2A 3QPEA 1JDAA 5FJJA 2DDXA 2Q71A 3G1RA 2GSHA 4GACA 2ON3A 4XUGA 1MQRA 3SBFA 2VZOA 1VIWA 2BMBA 4BCEA 1WCGA 5E70A 4O1BA 1QBBA 5L9FA 3DFTA 3ARSA 2PU0A 5A6LA 2Y88A 3EOEA 4AYGA 1XDMA 1SU5A 4WUIA 3C52A 4C6DA 2PWVA 5FF7A 3CZKA 1L6GA 1TUFA 3P14A 3F2CA 1GOWA 4Y2WA 3APGA 3G18A 1ZENA 3PBWA 1RD5A 2C8NA 4G1NA 3SCTA 1F3WA 4Z1AA 5AN7A 4UIOA 5FCZA 2VX7A 3VNYA 3MCMA 1X7IA 1H7WA 3FJ4A 1FXPA 5C2CA 3WJXA 5E0CA 5AHIA 4M6UA 3WQWA 4PTVA 1G69A 1OF8A 1AW1A 3GSMA 4BY3A 4IIEA 3WQ8A 3OODA 4WRHA 1EJXC 2OT0A 3S6DA 5BMXA 2PDBA 1R6WA 1GVSA 3CUFA 1H63A 5J5RA 4LOCA 3C3UA 1W8SA 2IPGA 3UZ5A 1ZUAX 1V0MA 3HJEA 2J7BA 2ONEA 3BUVA 1UH2A 1UMYA 2OFJA 4R88A 1ZU8A 1XIDA 4L5ZA 3ZSTA 2XH7A 3OIXA 1GQKA 4KMQA 2WSKA 3TSMA 4PBGA 3CPUA 4A21A 2ZA2A 4HBKA 4IP4A 3WSUA 3PULA 4ATWA 1SR9A 3G1AA 1BWVA 3MUAA 2GOUA 5HMDA 1XLLA 1QRQA 1PZ2A 3NFUA 2R24A 2VZVA 4DJFA 1PCWA 1KC7A 2GQAA 5A5WA 3IVUA 3P5YA 4W88A 3LD5A 1JULA 3LM3A 2OLHA 4IGNA 3VM7A 3QH2A 1X39A 4XBSA 3IRSA 2I9EA 1TJ0A 4QE1A 4PGLA 3KW3A 1L9WA 2WMFA 1VIZA 5C7VA 3GNRA 4E4PA 3HZ3A 5LXEA 2WZTA 1ONXA 1ZP4A 4XZHA 4C1LA 1ZLPA 4WEVX 3ES8A 1C8YA 3LPOA 3FK4A 1SPQA 1IXQA 5AVHA 5GNXA 3C5QA 4KRZA 4RLIA 3B0YA 1RLDA 2Y7FA 2V9DA 1E9ZB 4UC5A 2FHCA 2HEJA 4HP5A 4HK7A 5D9MA 4S3EA 2VEMA 1TV3A 1H5VA 2GUUA 4QCFA 3JZUA 4W7UA 5K7JA 3R8HA 1DWIM 4YHGA 2DZWA 1DHPA 3C2FA 5C70A 4NAFA 3RX4A 4GJIA 1S5TA 4JOMA 3PN8A 2BXVA 1N82A 2FKPA 3TU9A 2D2OA 3DFHA 5LA0A 1VAHA 4GQ0A 3WH6A 2Z2UA 3E0LA 4C6KA 4FP1A 3IJQA 3S2NA 2HVMA 4US5A 3OLIA 3SRDA 5I07A 2ANUA 2PF8A 3NURA 5DRIA 2W62A 3LS9A 1F74A 4EXQA 3M0IA 4X60A 1ONRA 3LNMA 3ZO9A 1J11A 4I8YA 5BXRA 1EB3A 1HX0A 1XBXA 3CZJA 1RCQA 4GH3A 4RW3A 4TMBA 2DVUA 1V6WA 2WKLA 4QITA 8TIMA 4E5TA 1XL9A 1E1CA 3KBJA 1FWAC 5H6HA 4XO7A 3S5NA 4GYJA 1XLDA 1NWUA 4XZLX 1IGWA 4GI4A 1EUNA 2O4QA 2PPGA 4EPKA 3IJ7A 2Q8XA 1B3ZA 1S5VA 4GXWA 1JCNA 2GJNA 4OV4A 5LGXA 5DO8A 1HP4A 3O6CA 3WJZA 1F7BA 3N2OA 2Z0IA 1PIIA 1EDTA 1L6SA 3GO2A 3MSRA 4CUCA 3G6MA 3MMDA 1QASA 4J3TA 1MSSA 3H8AA 1SSGA 3W82A 4UQCA 2ATMA 3AI0A 4PMNA 3ONCA 3H2FA 5FOOA 2CXGA 4A6GA 1R0MA 3H26A 5G1MA 4MKNA 4RPQA 2BOFX 4R3UA 4XIAA 3DFQA 1OZMA 1I2OA 1B0IA 2FFIA 4AMCA 3WDJA 3DECA 5D05A 2DUAA 4C5ZA 3NGFA 3U9IA 4DIAA 4BI6A 1MXGA 1L8NA 2WSQA 1KBJA 3WUEA 5XIMA 4CVWA 5FEWA 1ZAJA 4CNOA 1EA9C 1OB0A 4WF7A 2EG7A 2D0FA 1B2YA 4DRSA 1VYRA 1XC6A 2XH0A 4JKKA 2XM2A 1KNWA 1UROA 1JPKA 2OYKA 2EGZA 3ABXA 1MDLA 3OZOA 3QV7A 3M0VA 2FHBA 3VUSA 2F6KA 2V6AA 1G6CA 1WKFA 1RXOB 3FCPA 1G4EA 2CLLA 1V3LA 4B5TA 4BQ2A 2B7PA 3CYJA 1S2VA 3M64A 2H9AB 4JTUA 2JIEA 5A1AA 4ADTA 4ADSA 4JN7A 1Q13A 3II1A 1KRBC 2QPSA 3SECA 1LRNA 2WMIB 4RE0A 4CCZA 3H24A 4BEUA 4C6NA 4DWSA 3QRHA 4ZEPA 2ZFAA 5IRPA 3CZLA 5M3WA 2X0SA 4HNNA 4C6PA 1H7NA 2D73A 2V67A 4JHOA 1V0KA 4QR6A 3LGGA 4G9PA 3LGEA 4LB3A 1TIWA 2R91A 2XJ7A 4OECA 4UFHA 5BWAA 1XD1A 1XISA 2OJPA 4AZ7A 3LRMA 1MEHA 3T05A 2A6NA 1Q45A 3ITGA 1Z41A 1QJWA 3F03K 5GNZA 2VR4A 4XTIA 4HPGA 2E6YA 4X22A 3PWIA 4JX6A 3DGRA 4GE8A 1VH7A 1YHTA 4P7RA 1LBMA 4JTCA 2XIJA 5DN1A 1S5NA 4WSJA 1C7SA 5A6MA 1QWKA 3NIYA 3BANA 2PGFA 4J7RA 4D9PA 2YSWA 3BW4A 4AZBA 1BGAA 1UKPA 2POTA 3MUZ1 4S3FA 1JZ4A 4JFWA 1QPNA 1E71M 2V30A 3M0XA 4Q22A 2CLPA 1H7OA 4RXGA 3DUGA 1IIGA 3AHVA 5A95A 1OFBA 1K8ZA 1RBAA 3NDOA 3ELFA 5FJPA 1UJPA 1YEYA 1FHVA 2LLEA 1UA7A 1NEYA 2Z6JA 5EMKA 4IIHA 1UWQA 3KL0A 4JN8A 3RPDA 3W76A 1IT0A 2BZNA 1F5ZA 3G1DA 2ACQA 4U5KA 4IJBA 1WDQA 2BB0A 4JTLA 4JY9A 5AKQA 3MWCA 4IX0A 2BGQA 3L68A 4U33A 4H01A 2JGYA 3DHDA 3IUHA 1OQFA 4CNTA 1NIUA 1JQXA 3GYEA 3ARZA 4HJFA 3W0KA 2DZBA 2QJMA 3AISA 2XM1A 2PE4A 1U5VA 1Q66A 3UR5A 3V75A 2PD5A 4PMDA 3IIZA 5CCZA 1AQ0A 5BOFA 5I02A 3MBFA 1L6YA 4MVAA 3T0DA 1BF6A 2ZZ6A 2ZX9A 4JIEA 3WEZA 2QJGA 2HROA 5HUPA 4JTKA 3W74A 4H7CA 5FJTA 5REQA 1E72M 1HW6A 1TMHA 4QDPA 3NQ8A 2WCAA 3TYZA 4Q8MA 3R25A 3MV11 3MQTA 2WHLA 3N1AA 3MCOA 3NG3A 1P0DA 2J7FA 3CB8A 3UEQA 3RO8A 2J66A 1EP1A 3OU8A 3OQ8A 1JUBA 1RLCL 2UY4A 5DBUA 1IZKA 1B3OA 4AD0A 1OCNA 3RRAA 3L5AA 5TNVA 2OGJA 4IMCA 3FA5A 2YA1A 4G5DA 3CQKA 1UR8A 4YIWA 3SFWA 3WUFA 1HGWA 1EKOA 3F4NA 3DX5A 3GXDA 3BC9A 3EWZA 4RDZA 3EB4A 4MKSA 3P0WA 1V03A 4L9XA 2IXVA 3K8KA 3W1QA 4FNSA 1GOQA 2NV9A 2TMDA 3UFYA 3MI6A 3A64A 3NA8A 1XLBA 1IT7A 2DUXA 1FWBC 3GNOA 2UBPC 4JZ5A 2DSWA 2XSXA 4ZVJA 3ECQA 4XSMA 1PZ0A 3TN6A 3SCWA 4OOUA 2OLSA 2FDMA 4K39A 4LBRA 2PWHA 4DUWA 1IR1A 3A3WA 2A5HA 1AD4A 2VI0A 3ABRA 1NM9A 1E6NA 2QUNA 2CLHA 3V5CA 2Y8UA 1VBUA 4JYFA 4HPHA 2B7QA 3M0MA 4HNUA 3SEPA 3RCYA 3GDLA 1W9PA 3SGZA 3AS2A 3T07A 1HJWA 4MG4A 4F9DA 5F2IA 4N6EA 3PPCA 3GWQA 3W2LA 3G1SA 1X97A 3GLCA 1YBQB 2WZMA 4J9JA 3KLKA 1E3XA 1XXXA 4XX6A 4KH2A 4AIOA 3S2CA 2QDGA 4M82A 3AXIA 5HUOA 5A6TC 4PYSA 2J4GA 2CLOA 2W66A 3ZYZA 4UNIA 8RUCA 5E9XA 2HPMA 3MMTA 1N8IA 4PCFA 1MEIA 4FNUA 2RDUA 3VNDA 1MW1A 2FDSA 3SRFA 1QR7A 3L4YA 4M7TA 2CBJA 3UCDA 2FZNA 3ARYA 2VWSA 1HTIA 2NT1A 1PX4A 2OEJA 4GKTA 1CLKA 2W67A 4HNCA 1X6LA 2PLKA 4YU1A 3KOYA 3B04A 5CSUA 4JNYA 4N02A 1XBVA 1MXDA 3K46A 3B9DA 4XTDA 4DPQA 1CXKA 3EA1A 2QVHA 2VFIA 4XQ6A 4AY1A 3CMJA 4DLMA 2Q8ZA 3LQGA 4RK8A 5MF5A 3GXMA 1UKQA 4XISA 5AYYA 2GYIA 4EE9A 3S8HA 4P8XA 3M0ZA 3NZGA 3B8WA 4WR3A 1RK6A 4HOXA 2Z25A 3UESA 1H5YA 1Q2RA 3S1XA 1EYWA 3TWBA 1SSDA 1X1NA 5CGQA 2CBIA 3BARA 3DI0A 3KTCA 4F40A 3EWUA 3L0GA 5AC4A 2EPMX 2PP0A 3TLLA 3C2EA 3NUKA 5IOBA 4PUDA 3ZWTA 2ZBTA 4L80A 2XVKA 1UD8A 5HNNA 3LNPA 2CKRA 1LWIA 4IPJA 1EZ2A 5B80A 3P8JA 3W87A 1GT8A 3PUGA 4UBPC 4Y9OA 1EOMA 3CT7A 4US5D 2E9BA 4PB3A 3RUBL 3NSNA 4NG3A 1B3WA 3G1VA 2A3EA 1MO0A 3PPFA 2WVVB 3HG2A 1VB9A 2H90A 5GJPA 3TKFA 3W83A 3LGDA 4QG6A 5D2WA 5GPRA 1TPFA 4MLRA 4KCUA 3G24A 5I3JA 1RQBA 4MGGA 4RNIA 4LAMA 1OG0A 3O63A 3WLMA 1DJHA 1HKIA 1TJ1A 2WNZA 4KWSA 1DQUA 2G3JA 4JR5A 1S2UA 1TWSA 4ZB5A 3DFOA 1RPXA 1OCBA 3GAKA 4L64A 5K9CA 1JD9A 1XHGA 1DWHM 5G4EA 3WJSA 1K02A 3VOCA 5XINA 4AZIA 3AUOA 4UFMA 4NL1A 4JFVA 3GU2A 2TYSA 2B4GA 3CH9A 3NO1A 1LWJA 2VDIA 3TLQA 2NVAA 1G94A 1EBHA 4U3AA 4R7OA 4J3WA 3GG0A 5DRCA 3HQOA 3BLOA 1R85A 2P50A 1NWTA 1CT5A 2D0HA 1EBGA 3O2LA 1PTGA 3E74A 3K8LA 4O1FA 3OZMA 5EKYA 4J1OA 3AIVA 1Q6LA 2C1IA 2GQ8A 4PRWA 5KZDA 4B92A 3BAIA 1NELA 2WMHA 3MHGA 4S2BA 4E2OA 2ADAA 3OVPA 4JKLA 4DZAA 5I3FA 6ALDA 4HIBA 4OUEA 4K38A 4Q7IA 4ONVA 5LHEA 1AL8A 1UZ4A 3TROA 3V16A 1GTHA 2BY0A 4FA3A 1M04A 4AEOA 4IMGA 1Z6KA 2NUWA 2H3BA 5HPOA 5EYWA 1Q65A 3WH8A 3WL1A 2CC0A 1JRBA 4O0QA 4NRRA 1P48A 5CBIA 4IOTA 4LTSA 3GDTA 5D09A 4W85A 4FR1A 3CXOA 1K7FA 2FJUB 3SGUA 4GJ1A 4I6KA 3P81A 4REQB 4HMCA 1LLOA 3SUWA 3DENA 2GK1B 5CZSA 3F2DA 3L4XA 4IFKB 4FI4A 1XI3A 2YOCA 1KXVA 2ZQ0A 3SGGA 4PRRA 1Q7QA 1OBAA 4IZGA 1XBZA 5F7UA 3U57A 1VR6A 1AFSA 1RK5A 3N15A 1I0DA 2DSVA 4YN5A 3DBPA 3RK8A 2IQDA 4IPPA 2O92A 3PSVA 4QJ4B 4B5UA 2YX0A 5DY2A 2IPJA 4ICMA 3C4UA 3VOGA 3UR8A 1PE1A 3LY0A 4WY0B 3V0SA 1RHCA 4GNVA 2XWDA 4PSRA 4MWAC 2XIMA 1O5RA 1NWRA 3R7MA 3NL2A 1O5KA 1KR0A 4WJEA 1UP2A 4GMEA 3QMSA 2XISA 6PTDA 4QE4A 2DZVA 2Y7EA 2JKEA 3ZLHA 1MW0A 4OV9A 4F79A 3NNTA 2PCEA 1KFLA 3MDWA 2VXNA 2YL8A 3GFYA 2QLYA 4DI9A 3K4WA 3COTA 2OG9A 2GUBA 4YMZA 3VE9A 2VX6A 3SFKA 3NPUA 3ISIX 1XD0A 4DXKA 4MYXA 5H8MA 1CXIA 3VM5A 3PBVA 1GVEA 2VELA 2KX9A 1E4LA 2OEMA 4KEZA 4S23A 1CXHA 2P1FA 4CQAA 3CPGA 3E2RA 4X61A 4MAVA 3BL3A 4AVFA 4FNPA 1UH4A 1ISVA 3VX1A 1RR2A 3UA4A 5TQLA 3WQGA 2HBVA 2ESCA 4PBEA 3VC6A 4RW5A 2Z28A 2DT0A 3HBLA 3QGAC 2GGIA 4PFMA 4AC1X 1ICSA 4NNCA 3UNTA 3P5ZA 5HWNA 3RRXA 2BDQA 2QIWA 3M5VA 3LDVA 4UB9A 3DHUA 1VCFA 2BV9A 3PVFA 4H8HA 2QHAA 5TD4A 1DE6A 1DXFA 2F6XA 3PB0A 5CC5A 3BQ6A 1A3HA 4Z1DA 3KEHA 3W6MA 1KKOA 3W7JA 2PWGA 1JF6A 4KS0A 1R9ZA 4O16A 2XFFA 3OBKA 4F0KA 2FTYA 2CLIA 1NOUA 3BH4A 2Z1SA 1A0DA 4XZNX 1KTBA 2D1ZA 4HA4A 5DMMA 1K9DA 3VD5A 3W9ZA 1E9IA 3VIFA 1GKRA 3WDRA 1JGIA 1JFHA 3M4HA 5FL1A 2IMRA 4KWUA 3SDOA 4C6FA 3T7VA 4ZQMA 1WDSA 2AAMA 2QCDA 4YTQA 3TJ4A 4EF8A 1GQIA 3R94A 3I6TA 4JD4A 2E8YA 1XGZA 4FHAA 2H9AA 3QQ0A 3W1NA 4GOAA 1ODZA 3GFXA 3NOYA 1KCZA 1MUCA 2J7DA 3R43A 4FPSA 4HU8A 3QEZA 2WMIA 3WQCA 5HWMA 1X8FA 1RCXB 1W31A 3GXPA 3PNUA 4KGJA 1BG9A 3UCCA 2WMGA 1JYVA 5I24A 1Q6CA 5HQMA 1QI2A 3I7SA 3FSTA 3L4TA 4IH3A 1EEPA 1FTXA 2Z27A 4AZ6A 1VQTA 3SCPA 4EWJA 3PZTA 2E8ZA 1QI0A 4TOQA 3S3GA 3BZJA 5PTDA 4LC8A 5AECA 4UNLA 4MF4A 2V38A 1WXYA 1JEZA 3KL5A 1M7OA 2PDPA 4LWWA 3T0TA 4OBSA 3C0LA 4M1BA 4WIWA 1S46A 4HCHA 4H1ZA 1E6QM 5B7YA 2NQ9A 4YLWA 1J18A 2DEPA 4PULA 1Z7AA 4PUUA 5IXEA 4UCGA 1EHNA 3A12A 4YVPA 2ZYFA 3UXKA 1BAGA 4MDPA 2ZZ4A 3TFXA 1QFEA 2VFFA 3WQ6A 3HQNA 1M41A 3ITCA 4ZSTA 4C6BA 1XLKA 4C7GA 3HPAA 4KEUA 5DELA 1B9ZA 4AAJA 4ZENA 2PODA 4O8RA 4CD5A 4GYPA 1PWLA 4LCQA 3L65A 4NIRA 3UZYA 1YPFA 2DZSA 2XVLA 2RGMA 3UCQA 5A8PA 3U2ZA 5FL0A 2FGBA 2BVTA 1JJKA 1NU5A 3G1FA 3QSTA 1EO5A 1TZ7A 4H9XA 5A3HA 5J04A 1TX0A 9XIMA 3GIPA 4JX4A 4Z2KA 2Y1HA 3DOPA 4MJZA 4Q6XA 1QOXA 5BNKA 3SR7A 4WY0F 3N2TA 4BK9A 4KGLA 1I0BA 4AIEA 3HV9A 3KS6A 2BGSA 3ARQA 2GL5A 1TB3A 4DZHA 4FXFA 3S5YA 1WYIA 4J3SA 2AL2A 3CQ0A 4CQBA 4Z2GA 1XCWA 3PWAA 4NJGA 1GHSA 2PZNA 1FBAA 2CNCA 3GZAA 1RA5A 2QKFA 4UQDA 3S1UA 2Z1BA 3ZLGA 4E38A 1J93A 5CBBA 5KITA 1DIOA 1ZFJA 2Z24A 3NDYA 1C90A 1H1YA 1W17A 2BASA 2C15A 3AYSA 5E9AA 3IJIA 2PP1A 2J7CA 3R10A 3W6YA 4KIEA 2J78A 3DZ1A 3EWWA 1D2KA 2Y4SA 3MTWA 3B9NA 4RCXA 1AMKA 3W1UA 4Z0SA 4PSPA 3U8GA 3CO4A 8XIMA 4LVGA 5A8QA 4H83A 2C91A 3DGBA 3TYEA 3QYQA 3BV4A 4PCPA 2D23A 2VRKA 4DBSA 3U7VA 1GVQA 3BQ5A 3N17A 3O05A 4NZJA 4Y6GA 2NX3A 4DYKA 3BG5A 3VDHA 1EGZA 3V0UA 4GO9A 1CPUA 2E67A 1ECEA 2B7NA 3C2YA 4MKVA 1GEQA 3V4BA 1XYAA 3PS7A 1HKWA 3PSWA 1ADSA 3KZPA 4LS2A 4J3VA 4LU0A 2D2JA 2VEIA 4IX2A 1KM2A 4A3QA 4P7NA 1H1NA 1ZBKA 2FZ8A 1F3EA 4E6MA 3G1XA 1PHQA 1P1MA 1YBQA 3ORWA 3M41A 4QQ3A 2WSYA 2ZXQA 2IKHA 3UERA 2JF6A 3OTRA 4PB4A 4X63A 1UBSA 1XPYA 5G4HC 2ZRXA 1UP0A 1V6XA 3SN1A 5KTLA 2W91A 4HPJA 2YR1A 2FVLA 4GI6A 3E0FA 4HCLA 3TXZA 3KBSA 3VINA 3ZVHB 4UFKA 1WX0A 4DZIA 1KXHA 4XKYB 3TP4A 4ML9A 1UD3A 4RE2A 3EPNA 4AX7A 5CAKA 3BOFA 4GZ7A 4IUOA 3S5ZA 1VHNA 3BMWA 3BK0A 4PB5A 3V0TA 3IIVA 2YYTA 2ZA3A 1YDOA 3A4WA 5F2GA 4OWGA 2E1DA 3QQWA 5CEWA 1DKWA 1B4KA 3U4FA 1G7UA 4PMQA 1I6NA 4C90A 3H21A 4JPGA 1ONWA 4M5PA 4GY7A 3H53A 1TZ9A 2UWFA 1H41A 3FV9A 3RX2A 1CGUA 5JBDA 4NP7A 3ENLA 1MMFA 3EGJA 4MWAB 3O1NA 5C9ZA 1BFNA 4YVXA 1ZB5A 5CKSA 4L9ZA 4H4IA 2CCRA 3V3WA 1X8CA 4RZ4A 4ZB2A 6CGTA 1HF6A 1QOQA 4NHVA 4HMDA 5CGTA 2GVEA 1UP3A 3VE7A 1W3TA 2QMJA 3RO6A 2QCMA 3WENA 4TX8A 5HINA 3V5FA 4MTVA 3VIIA 1R7OA 3GBEA 2NSOA 1JGMA 2BODX 1EO7A 1J2WA 1WPCA 2VYOA 2EKCA 1V0LA 1FWJC 3QC0A 1ZCOA 2X8RA 1TPWA 4S39A 3F5JA 4GVGA 4WSHA 3ZT7A 2GGGA 2PRMA 4DJFC 3MSDA 3Q4DA 1XIHA 5CXPA 3OLGA 3VD4A 4PN2A 5RUBA 1AK5A 2HS8A 1XCXA 5HDRA 2WVVA 2VEPA 4E4FA 3W27A 4E8DA 2PWFA 4M6VA 3QR1A 2JKPA 2C1GA 4NZ1A 3RGTA 1HVXA 4XVEA 1EZWA 3GQYA 2BBFA 2VC6A 3KUMA 3M5YA 1F76A 1HL9A 1SYTA 3UZJA 3WBYA 1OT1A 3WK3A 3O0FA 1LM1A 3THDA 1T8QA 3AU2A 3ZQ9A 3N73A 5HULA 4FR6A 1F8MA 1MEWA 2YCKX 3W53A 3HGSA 4Q8OA 2A85A 2VDGA 1JAEA 1UYQA 4EACA 2PDWA 4UTIA 1W5PA 3AZTA 3L4UA 4JFTA 1Q8JA 3ZFHA 3TW6A 4XZMX 1VLIA 4KCVA 1RP8A 3FAWA 1DTUA 2QIIA 3TK7A 5BRBA 1XRFA 5D30A 5TF0A 3WD3A 1L0PA 4B5XA 3REQB 4QRNA 1NWSA 5HJXA 3W7DA 3OG2A 3UETA 3FA4A 3GUWA 1VFHA 3UYCA 4UZUA 1BKSA 2PDYA 4AEEA 4TVUA 3DHFA 1IV8A 4LBUA 1GORA 4NUWA 3CGTA 3W6LA 5LNRA 1SJBA 3B8TA 5FAGA 4BQ4A 3I3EA 1XM3A 2X1IA 3TNOA 3W4RA 3LLXA 3AIQA 2C7FA 4DHGA 3G3MA 2RDTA 3DKLA 1SZFA 1KM4A 4D8AA 5E6ZA 1YKWA 2Y62A 3GE7A 3IIOA 1WBJA 3UWQA 3R8GA 3HGJA 3GAYA 1O1HA 3SQMA 2VGBA 1GG1A 2V5BA 3QZEA 4W89A 5I79A 1NOWA 3AC0A 3FJLA 2NXHA 3A4AA 1SMDA 3GD6A 3U4AA 3LV5A 2XZ7A 3BLLA 4PTNA 3VNIA 1W9UA 4MUPA 1K03A 4MUZA 1SW7A 1W5OA 5HMEA 3AHXA 4GFSA 5HANA 3PBUA 2VFHA 3LN3A 2BXZA 4O1CA 1GVOA 4Q4QA 1P0EA 1JYXA 1E4MM 4REQA 1L2QA 4W4QA 4GCXA 4DNHA 2GK1A 1MQPA 4QQUA 4L4OA 3DG7A 4IFKA 4GC3A 5KZEA 2AQOA 4DI8A 4P61A 4V33A 5CG7A 5C2GA 1UA3A 1T8XA 3WEMA 2WSPA 5HWJA 1TE1A 1FCBA 1YXYA 3N11A 4H2CA 4ZE5A 2I1OA 4KWWA 4AMAA 2GPTA 1CENA 3LBOA 3G8RA 4O0ZA 5AYBA 1H7RA 3TH6A 3KTXA 1PS9A 1Z9AA 1EH9A 3LTSA 3W24A 4C6CA 4WCJA 4WY0A 4CEXC 3RX3A 3W1XA 1Z42A 1PTAA 4KQNA 1QVBA 1YNQA 3H7RA 2YL5A 2J7GA 2WOQA 3K4AA 3GNPA 4LH8A 1A3XA 3LQLA 4IM4A 3I4KA 4PMZA 5CSYA 1I8JA 3FVDA 1WBHA 1SZGA 3I7QA 5G1TA 3NCOA 1F2JA 4HSNA 2R1NA 4KWVA 3WBWA 2YW4A 1YQ2A 4U31A 3N25A 1YPIA 1Y0EA 2EAWA 1DWAM 4CU8A 3WMBA 4A29A 2P0OA 3KHDA 4DWSC 1HKVA 2IKJA 3ALGA 5LYRA 4ZR8A 4XG1A 2FPTA 1BD0A 2I17A 1W3IA 2I14A 2ATSA 2Z1VA 4NX5A 3RR1A 4S3JA 3WL0A 3BE7A 5M5DA 3N3TA 3MUCA 1E15A 1BVNP 1SFJA 2G3MA 1FH9A 1Q2SA 4AD1A 3WLRA 5BW6A 1VPYA 3A4XA 2V82A 1LLWA 2J25A 1FHDA 2V3FA 4UMBA 4O18A 2YXOA 1M3UA 4F9JA 4H00A 2PTYA 3ES7A 3BAXA 1GQLA 4BS0A 1DIEA 4O19A 4NNAA 1NOFA 2WPGA 3CLMA 2RGLA 4IFOA 1MFUA 2X2YA 4H8NA 2G3NA 1TA3B 4CGTA 3PUOA 3FKRA 2VHLA 4G8TA 1OD8A 3UGRA 2GOKA 4L4PA 1VFTA 4AFYA 1EUAA 4M6QA 1E0TA 4EX4A 1ISZA 2XWEA 2AQVA 4I7VA 1O1ZA 3WF3A 2Y6ZA 4LNYA 2X1RA 3BLKA 3MPGA 4B5NA 2NQZA 4FXRA 4AZHA 1TWDA 2QCNA 1IHIA 2QV5A 3B03A 4IQEA 1OIMA 3MUXA 1CYGA 1VFOA 1W0MA 4CKQA 2KAUC 3FGCA 3GNNA 5LGZA 1YDVA 4WDTA 5LNWA 1QPOA 3LXAA 1TJRA 4Z2JA 1DHKA 2A1YA 5IDIA 1H7XA 4JHMA 3PWGA 1BKHA 3VFCA 2O4MA 3W7OA 1BYCA 1TELA 1DQXA 4S3DA 2ZX7A 3WLLA 1GNXA 3GB6A 1RQEA 2QCGA 1JZ3A 5D2XA 4DB7A 3PBMA 1O4UA 4AG0A 1S38A 3VCRA 2NWRA 1ZP3A 4S3AA 2G4FA 6TIMA 2UV8G 1H60A 1XLGA 4WHBA 2H8ZA 2ACUA 1K7EA 3ABQA 4GX9A 1S2WA 3N12A 4ZQNA 3W1AA 2FPVA 2GGEA 3S42A 4GHRA 3R2GA 2ICSA 4A3YA 3SW6A 1RCOB 3A21A 3Q65A 3TQPA 2CLKA 2VM8A 1GKPA 3CQIA 4Z2LA 1M68A 3W1MA 2PDNA 2X0HA 4C6LA 3KVJA 2CIPA 4UZSA 1YNYA 4ML4A 4B5SA 5BXSA 4JEQA 1PX8A 4B2DD 1HKKA 3CIWA 3CMFA 1CI1A 4PUJA 2XVGA 2PGWA 1JZ6A 4MLJA 5FAJA 3O15A 5I09A 1DJNA 1OC5A 3JW7A 4ZE4A 3PBYA 5IFTA 4I7WA 2VVNA 1RAKA 1GZGA 4R33A 3SUSA 1OGBA 2ZTKA 5F2LA 2ZXAA 4ORMA 1NQ6A 1UG6A 4R7WA 4NX0A 2GLKA 2GSJA 5EBAA 2XTKA 1W1TA 3WH7A 6REQA 5A6BA 4N9CA 3R0DA 1XLHA 2ZADA 4B9YA 3TQKA 2FJKA 3W7PA 2FGZA 2IQ0A 2HQAA 2REQB 3RIKA 1Z69A 4KT2A 1JZ7A 1AUSL 1SFTA 2ZZ5A 4U2YA 4QP0A 3OIHA 4H9MA 3GNXA 2PP3A 4HKPA 4XBJA 3W1PA 4ROPA 1KFWA 3DDMA 1V93A 2XSAA 3E6EA 3KTSA 2BY1A 3DFNA 4H19A 1OYCA 7REQA 3B8IA 4U4MA 2VFGA 3KVLA 4WOQA 2QCLA 3VPLA 3BG9A 4DF0A 3T55A 3P2VA 1AW5A 2PDKA 2J6VA 2VCAA 3LCWA 2D0GA 5CH9A 3G22A 2DZAA 3V18A 1FDJA 1RSCA 2X09A 2NSXA 2QMKA 4H9ZA 3W88A 3ZOAA 2DZXA 4PCSA 3WQEA 3MY9A 4GVFA 3LTPA 3CAQA 2WQPA 1NDYA 4IMFA 4ZXLA 4GH1A 2CHOA 2A2IA 3RFAA 4G1KA 4W93A 1BXNA 6A3HA 1K7XA 3DG6A 1CDGA 3STCA 2WJDA 3PM6A 4Q4MA 3TZNA 3NEHA 5AC8A 1U1UA 2TODA 3ONBA 2HBXA 1VKFA 2WKJA 3QR0A 1KKRA 4EPBC 4NASA 4LB4A 1QK2A 4IJRA 1N55A 2GJLA 4GLEA 3NOEA 1WAUA 3P3BA 4JDYA 5C6MA 2G37A 5LNUA 4K1GA 4M56A 2Z7GA 1TYGA 1GEHA 4FNTA 3MA8A 4GK8A 2GQ3A 3CV6A 2I5QA 2Y70A 4TQTA 1DYSA 3G0UA 2GDQA 1H09A 3AS3A 4KIRA 2HE8A 4ZMGA 3W2UA 3IWPA 2CWXA 9RUBA 3QOKA 4GZEA 1C92A 3MJMA 2PDCA 5G5IA 4N9EA 3RPTA 4AIBA 1TRDA 4EOUA 5KSWA 3PFRA 1DE5A 2E25A 1A4LA 5C71A 1YDYA 3GBDA 4ZQOA 4PTMA 2XYLA 2BXYA 3GVRA 3ZVHA 3LI1A 1XYMA 3M9YA 4UOZA 2YIHA 1Q3NA 3DFYA 1KGUA 1TV5A 1E4NA 2JIWA 1RPKA 4XKYA 5FSEC 3TE9A 4N6FA 3C0JA 4GY0A 3SJNA 5AHLA 1OWQA 4EANA 1JCMP 2UY2A 3UG3A 4PUNA 1MZRA 2WC4A 4ZQRA 1ITQA 1WB0A 4V1YA 3TTOA 4FF5A 2DQXA 1K77A 2I9UA 1TVLA 3UPMA 2QCHA 3O0KA 3W7QA 4RE3A 4DO6A 5CJ5A 3DCPA 3LHWA 2Q09A 2VEGA 3NQ7A 1PHWA 3AYTA 3XISA 4DXXA 3LHUA 2YCJA 3E0VA 2VOMA 3RITA 2EEXA 4MWAA 3T1GA 2VD8A 4LF1A 2PDIA 1GOXA 3WBAA 3UY8A 2HCVA 5L6UA 4MY9A 3UW6A 1A53A 2YZ5A 3USBA 1E1FA 4UTUA 3UF9A 4YPJA 1TVPA 5I06A 2QDHA 4BQ5A 2WJEA 1QNOA 1IQ8A 3MMWA 4DO5A 5I3DA 2C6QA 2ZZ3A 3I4EA 1NQKA 3ME3A 2FH6A 3WDIA 3B8DA 2JEQA 4TV5A 3GVGA 5FF4A 1VCGA 2E28A 1J9YA 3UWEA 4HA1A 4GVHA 4DM2A 5AHFA 2TAAA 1LJYA 2DT2A 1YRRA 1CB7B 3GR7A 5LIXX 4O52A 5AC7A 1W37A 1M7JA 5D04C 4NZ3A 4DEFA 4ENLA 1EF3A 3D46A 3DFPA 5GVJA 3EKZA 3NQMA 2WC7A 1J96A 4Z1BA 4MDOA 4FLRA 1TPVA 3LK6A 2C18A 3FA3A 3T0BA 4A8NA 1MI3A 4MY8A 3W00A 3AXXA 4H6QA 3UBPC 1PEZA 4L6DA 3MT1A 1OG6A 3IJDA 3QXBA 5KZ6A 2TSYA 4XAFA 1J0IA 3VIKA 2PB1A 4F4RA 4HZ8A 2PAJA 3L23A 3M0LA 2G41A 5D32A 1Z3NA 3VIMA 3CK5A 4UMCA 3VI2A 2J24A 1BSIA 3IGUA 3KX6A 2IUZA 4D8LA 1TV4A 4QJ5B 1DJQA 1Q5MA 3AZSA 4YHEA 5I3KA 2WV8A 2I56A 3AMKA 3LCGA 4JTEA 3REQA 3GHSA 5LA1A 3C61A 3TV8A 2QZRA 4QLJA 1KLYA 3VGHA 4JQ2A 5TAOA 2TRSA 3INPA 4ZCWA 1BSLA 4ICNA 2GJPA 3FEMA 3NSXA 4IHCA 2FB2A 3B8UA 2EJAA 3TMLA 3UR2A 3WLIA 5DY3A 3EDEA 2DH2A 1RUSA 3FFSA 3AHZA 4XAGA 5CLTA 1H0GA 1T41A 3UXLA 1EC9A 4WXYA 3W81A 2OWCA 4HN8A 2OO6A 2ZXDA 3TQVA 2Y5EA 1UQZA 4DELA 4NJJA 3TN3A 1GW1A 1FRBA 3HPZA 1R86A 2CLMA 4MB3A 1QDSA 4K8HA 2PTZA 2ZWYA 3LI0A 4HMEA 1H11A 2WLYA 3OGVA 5CQ1A 1S5MA 4AQLA 1T6MA 3PAJA 1VJZA 3TOYA 5T8GA 3E0IA 2H6RA 5AOUA 4X9SA 3N19B 3AQUA 1J6PA 2PLJA 5LIWX 1QUMA 2ODOA 3AS0A 1UWSA 2OT1A 1G1YA 3H2NA 2QJIA 1WZLA 4QTGA 1AA1B 4R53A 2DUZA 5LXXA 1M6JA 5H2ZA 4PL1A 4L1GA 2PDQA 1DIKA 2OZ8A 4RDYA 1AZ1A 3HO8A 3RYSA 2PDMA 3VKJA 4Y8EA 2YDSA 2XG9A 4OZOA 4B15A 2G95A 1HL2A 1LG1A 3U3HA 1ME8A 4LJ3A 1XLEA 2QULA 2QPXA 1CGXA 1J0YA 1XIFA 5A94A 2Q3RA 3H4XA 4W8AA 4TX6A 3BICA 4RR4A 4ZL1A 2PURA 2FTPA 3VMNA 1E9LA 3T08A 1EC7A 4RDWA 1CNVA 1UZDA 3CUZA 2O9PA 1IEVA 4MPKA 3SO7A 1VFSA 3A47A 2D2GA 1VC4A 3A24A 3PAOA 1PCKA 1CW2A 1TMQA 3NZPA 4IIFA 1ZL1A 1OC7A 1OY0A 3N2XA 1R9YA 5FA5A 4L61A 2ISSA 5I0DA 1CX9A 3MUIA 1JDCA 4UQEA 1EXPA 1EHAA 1P6CA 1I2RA 3AIRA 3EKGA 2YZRA 4BR1A 3EDFA 3K4DA 4D6CA 1VPXA 2R1MA 1UBPC 1LG2A 1S39A 4I5RA 4B5WA 5C2XA 1FOBA 1LQAA 4Y9MA 3TQ0A 1BGGA 3MV01 4R9XA 2PDGA 5A6BD 3KBVA 4O1DA 4B3LA 1HJVA 3KVKA 3NQFA 4D6IA 4UNKA 1AL7A 4O53A 1DXIA 3EYPA 4I9TA 5C5YA 2P0IA 5MHBA 2ZOXA 3M0KA 3AZRA 4AU0A 4EWND 1ECQA 3GXIA 3U48A 3KHJA 5T9BG 2VD9A 3CEPA 2IS7A 3UG4A 2YKKA 1OFAA 3W02A 3S5OA 1V6UA 2CZEA 3LMZA 1SO3A 1UWAA 5I6SA 5CPQA 4XIMA 4YTTA 2X2GA 1P0NA 3FHAA 3GIYA 1TA3A 3DBNA 3N3MA 2I57A 3B8VA 3A9BA 3WQPA 4IF2A 4ZFMA 3FW6A 1XYZA 4GABA 4EAYA 2J62A 3USZA 2I16A 5JBFA 3TYAA 2I5GA 4HQVA 1JNDA 4ERIA 3EX1A 4X0VA 1MWOA 4O11A 5EMMA 1JNEA 1IEXA 1MNSA 1B1YA 2HXTA 2R1KA 5CPSA 4A3UA 3L4WA 3MP5A 4MIMA 4FF7A 2ZICA 2OKOA 3BSHA 1QHPA 3LENA 1AQFA 1QHZA 4GI8A 4LGXA 3GH7A 2PD9A 5F1VA 8A3HA 3UXAA 3VNLA 3PPGA 5D33A 1PKYA 5JMUA 2QCEA 1QXLA 4NRSA 3UGVA 3OO2A 3HTWA 1GWJA 1KBLA 5CAHA 1TTIA 2XFWA 3CWNA 3E5BA 3UJEA 2XGIA 4DAIA 1LQ0A 5F1UA 3WH5A 4FLOA 4WKFA 2DY3A 2KZHA 2YYUA 2VWTA 1ML1A 1UWTA 1XGDA 1DQWA 2VGGA 4FIQA 5HPCA 2J13A 4E8GA 1NDZA 3IK2A 2IXUA 1C8VA 1CXEA 3N04A 3APYA 3CAVA 5HR7A 3P0XA 3RCNA 3G77A 1B31A 1RQHA 3BLFA 4UTLA 1VENA 1K8YA 1KBBA 3GK0A 1XH0A 4FLSA 3KRUA 4MNMA 4PEEA 3BMXA 4IPIA 1JPMA 3MMUA 4IICA 4KFNA 1XDJA 3WLNA 4FX6M 5HQEA 1LL4A 2PWUA 1MFVA 4C7DA 2P5NA 2UY3A 3WH9A 2NQJA 4K6AA 4DNMA 2YCEA 1V3KA 5HATA 1LZOA 2WZHA 4NZFA 3U7BA 1HQTA 1O94A 3KWXA 2JK2A 3EPOA 1MUWA 2YDAA 2C13A 5LA2A 2E1WA 3SCOA 5E1QA 5EU9A 1BTMA 4GVIA 4QCEA 4KERA 3KL3A 2XUCA 3S5SA 1CGWA 1ME7A 1G01A 3ARXA 3D47A 1EJ7L 4C60A 1W9BM 2PDFA 3ZVIA 3FXYA 4QM1A 4AZCB 3AALA 1W32A 3B9OA 4MWAD 4C5YA 3AHYA 1XIIA 2REQA 3B0PA 2P8BA 3VKDA 2D24A 4DF2A 2CZ5A 1Y5VA 1XKYA 2FVKA 3HMCA 1I4NA 2W79A 3PZOA 2XIBA 1DVJA 2MANA 4KRTA 3SCVA 3UR7A 2OTDA 1U30A 1OC6A 2WJZA 4Y8FA 3LLDA 4DUXA 1Q6DA 4H6EA 3B0UX 3URBA 4RNJA 1CLVA 4P8UA 3STGA 1U1HA 5AY7A 3UD6A 2BS9A 2R14A 3AYRA 3S4TA 3D5HA 4LRTA 4QX4A 4Q6JA 2JFEX 1MW3A 4NILA 3MW7A 4QG9A 3DYPA 1G4PA 1FCVA 1QO5A 2J47A 3T9PA 2VJXA 1EL3A 1VJSA 2GUYA 1UIOA 1R47A 1CB2A 3WMSA 1LOLA 1QPRA 1H0IA 1LORA 3CS2A 4JTSA 1WDPA 1TE6A 1TWZA 4GINA 4GUIA 3LCIA 3W7IA 1KCLA 2CU0A 3BDKA 3LCLA 3N9RA 2ZE0A 1MW2A 4EAMA 4ZO8A 2NQLA 1R8LA 3S1WA 1EWDA 3QYSA 1UB3A 3R1ZA 4W5UA 2PDJA 1EIXA 3CHFA 1KM5A 1W3HA 4WVXA 3CU2A 1BQGA 4HN4A 3SB0A 1JCJA 4JGDA 1EQPA 3CC1A 4IIDA 4BWLC 2QV4A 2A6LA 4Q8PA 3BVJA 2GDUA 3B40A 3P67A 3QBUA 2J7EA 4JNZA 2C1HA 2YCIX 3AFBA 4PTWA 5MKGB 2HSAA 4OOZA 3LTYA 1UZ1A 2PS2A 1ALDA 3RXZA 3DESA 4M8UA 1V02E 2ABBA 1J5SA 4L6HA 3C3NA 1TZZA 3FNDA 4ZO6A 2VDHA 5FEPA 5T9CE 5FACA 4AD3A 1FWFC 4KRUA 1J12A 1Y5WA 1IXPA 3UWVA 3W01A 4C1KA 4K7YA 1KM3A 2BTMA 4G7EB 3CL6A 4UFLA 1MNZA 1WA3A 4IMDA 3O7UA 3STEA 2CZFA 2PGRA 2QT3A 5C7HA 3O3RA 4GUHA 3TYCA 1UJQA 1FWGC 1ZTVA 4F48A 2AOSA 2O0TA 4CQCA 3VABA 5AZ0A 5HA7A 1YNPA 2V3DA 2E0PA 2NV2A 3H22A 3GG8A 1GTEA 3WFLA 1ZBCA 4U3CA 2WVUA 3EX4A 4AYSA 3AO0A 5D8ZA 1WQ5A 4ZO9A 4GBUA 1PXGA 3NZRA 4W5ZA 2WSRA 5I3HA 4F2BA 1I45A 3PPHA 2RDWA 2VRJA 4AEFA 4WDUA 1S2AA 3E1F1 1V7YA 4L1XA 4AHOA 3MP3A 3RNDA 2WXDM 4O13A 4O17A 1UW9A 4D6DA 4X0NA 1A50A 4A8RA 1HP5A 5HMSA 3WY1A 4J3UA 3TMQA 2NVCA 1X6UA 2XZ9A 2NWSA 3EWYA 3KLLA 1JZ8A 3ABOA 1HGYA 1BYBA 1WOBA 2QCDB 1FP9A 3E2SA 2QDEA 3U5UA 5I3GA 4KFOA 3WLOA 1NDWA 3T4CA 3D3FA 1DJIA 3FKKA 1ZJBA 4H9TA 5AYIA 3QKEA 4DWDA 3L21A 3D6NA 2NLIA 4FX7A 3UJ2A 3FYYA 4B16A 4NT0A 1PBGA 4I9AA 3CUJA 1IT8A 5KEZA 5AC6A 2XVPA 4FALA 4FZIA 6XIMA 3HM7A 4DJDC 3TYDA 4AUBA 3WQ4A 1XW8A 4XZIA 2AL1A 1KB3A 1J0KA 4G6CA 3VOIA 2XH2A 2OSWA 3UZWA 4M1RA 1XJBA 1JQVA 2BY2A 1UUOA 3ZJ6A 4XO6A 3WNMA 3SADA 4A22A 1WDDA 1S1RA 1EEXA 3VC5A 2IKGA 3C56A 1Y5XA 1ITXA 3AS1A 4RE4A 4CVUA 3QR3A 3SQSA 1E1EA 3HA1A 1VFMA 1QNQA 5FF3A 3KS5A 3V1HA 5ABTA 1BYDA 3LOTA 3SN4A 2E77A 4JQ4A 1HNYA 4RKAA 2V3GA 3GU1A 1B4EA 3CZ8A 3HGOA 2ZRVA 3ATYA 3KFTA 3M7WA 1Q63A 4TIMA 2WM0A 3GHUA 2WVTA 1ZGDA 2GWNA 3VXGA 4QHRA 4J2PA 2WCSA 3ZM8A 4F0MA 4GIYA 5CPOA 1PPIA 5JVLA 3TW9A 1Q7MA 1UKTA 4V1XA 1ITUA 3BAJA 3VNKA 2Z29A 3AMGA 4BQ3A 1FXQA 1M7PA 4JX5A 5KMYA 4GCAA 3G0SA 2YBVA 4NZ4A 1R30A 1V77A 2HS6A 3BGAA 2VGIA 1W6TA 3GDMA 1TJ2A 1BTCA 3G6LA 1J5TA 1E0XA 4PTXA 1BWLA 3EAUA 3SCRA 3CJPA 1EDGA 2Z00A 1IXNA 2A7PA 2XH4A 1C29A 5U7SA 5GQBA 4LV9A 3HG5A 3WNLA 3R13A 2W0UA 2VUNA 3EKLA 1HZYA 2AL2B 1EJVC 5IHRA 1LUCB 2X1SA 1H62A 1E9YB 3PZVA 4OBRA 1FWHC 4HD5A 2HRWA 1HT6A 1B5TA 1HJSA 2IW0A 5CSSA 4AIUA 2R1LA 1IF2A 4QLLA 1EX1A 3UYIA 1XF0A 4DX3A 1Y7VA 2OCZA 1P43A 1K1DA 3S2JA 4XBKA 1BXCA 3ATZA 3VYLA 3W7MA 4MJ2A 1ZJHA 2J77A 1FWDC 1RA0A 3BLIA 2Z2BA 3H4WA 2B31A 3QV8A 4L9YA 3TSDA 5T26A 4GRSA 2XFRA 1I2NA 3CV1A 1BG4A 2E09A 1TPH1 4M3PA 1W2VA 3ITOA 2J9XA 3NQ2A 4QISA 3Q94A 3WEOA 4WDWA 3M07A 3EX6A 3SAZA 4ZQCA 3KZSA 1V3IA 4U28A 1ZSXA 4OIFA 2YGYA 2WBGA 2R9RA 2HK1A 3IVTA 4WX2A 3LZ5A 3STFA 1OFEA 4LY4A 1DJZA 1TVNA 1LROA 4UMAA 3N9KA 3P84A 4C6OA 3DXIA 2V81A 2C0AA 2Y5SA 3LZ3A 3WD4A 3EOUA 2EHHA 5BRPA 2DVXA 2GZXA 5I5RA 3UG8A 4HNOA 4UR9A 3W73A 4H2HA 3A13A 3CTTA 1CEOA 3W2JA 3HQPA 1ME9A 3TR2A 4UXDA 1A3WA 1H49A 4TO8A 3PF3A 3B06A 4UR7A 2Y0FA 3NL5A 5K4XA 4XWUA 4CQ9A 3LRKA 1XS2A 3W37A 3NQAA 1EJUC 2OZ0A 3PY2A 1IWPA 7A3HA 4MJMA 2QCFA 4RV8A 2PFHA 3E2QA 3PZMA 4Y9AA 4L4MA 3TXVA 3EWCA 3W86A 1V6YA 4OE7A 1RY0A 2ZC1A 4HGXA 5LSMA 4YVVA 1K4HA 2FGLA 2OPJA 1FH8A 3VDAA 1C93A 1XRVA 4MPQA 4DJFD 3F2BA 2EO7A 1A5MC 4WGXA 1FWWA 3NGJA 2YB1A 1QAPA 1PTDA 1GYNA 3FVMA 3S47A 1F6YA 3S2LA 4LYRA 4GXMA 1E5JA 1W3NA 3QV9A 2W92A 3CZEA 4CNSA 1POKA 4DJEC 1JCXA 2WQDA 3IRDA 4UTKA 4OVXA 5AVNA 2HPIA 2WANA 4F2TA 1NFGA 2QAFA 4IP7A 3QHMA 2QXWA 3ITTA 4M51A 2VRQA 3Q37A 4D6JA 1IR2A 1PX3A 2EPLX 1FWIC 3DERA 1HVQA 4V27A 1KM1A 5A69A 4OKDA 3LPFA 4GJJA 1FWSA 4OJYA 4B3KA 1EJSC 1JAKA 1Z8AA 1V7AA 1O5QA 5ABFB 4DO7A 4MNKA 2CFFA 3C2VA 1JZ5A 4UFIA 2CKSA 4ZFCA 2VL4A 4UWMA 1CBGA 3BAYA 3K5XA 1TCDA 2X42A 3NL3A 2WMJA 3GHRA 3NPXA 4MZYA 2QJNA 2WB5A 3E96A 2L5HA 2J8FA 4TX9A 1F8IA 3MBDA 3TTSA 1O95A 5FF0A 4AC7C 2BX7A 3W3OA 3OJGA 2B81A 1QNRA 1K9FA 4ZGYA 1LL6A 1AQMA 1E56A 2ACSA 1DJXA 1VLWA 1OVDA 3ZS4A 1GVRA 2WHKA 3W75A 4N4QA 3I68A 5EMLA 2YLAA 4ZOCA 1LYXA 4LFYA 4AHPA 2INEA 1PIFA 1P6WA 1J10A 3ABSA 5I78A 2V5CA 4UTMA 4GO8A 3A5VA 4GYFA 4LVDA 4OHQA 4JQ1A 3P7YA 1TPC1 3TYUA 4HNLA 1UD2A 2RFGA 1XR2A 4NXSA 1D3CA 1VF8A 4L65A 3FAXA 2XGZA 2YL9A 1SMAA 3W7EA 3VCCA 4ACZB 1QNPA 2EXOA 2PDHA 1JCYA 1W1VA 3TCSA 4Y9PA 3NPVA 3BURA 4N9BA 4RNFA 2CERA 2OKTA 3SQLA 5LNVA 1E51A 4LCSA 3A6OA 3UP8A 1JPHA 3POHA 4CD7A 1EQCA 3NXLA 4B91A 1V3JA 1ELSA 1EPVA 2NV1A 4Z2IA 1FDYA 1X6NA 3DYMA 3SCSA 4L4LA 4W7WA 2ZIDA 3N4EA 1X7FA 1VD6A 2JALA 4A3HA 3WLQA 1XQLA 2EPKX 4M80A 1VP5A 4NAEB 3NTYA 5HJYA 3OG3A 2G8ZA 1DL3A 4UQBA 1PZ1A 4RUBA 4AZCA 1PAMA 4IGSA 1K8CA 4WLCA 2W3ZA 3TN5A 4HHMA 5FEZA 3L5LA 3SURA 4CNNA 3HQ1A 3LYEA 1WNOA 4LCRA 1JCLA 4L6OA 1E0WA 3VNZA 5CC7A 5CSRA 2BHYA 2OQLA 3CUXA 1GG0A 3MP4A 3SJ3A 4D2JA 1KM6A 3IJLA 4I90A 1IWBA 4K3ZA 2AKMA 4UQ9A 5D4YA 3M5ZA 3UZZA 3VOFA 4AHQA 3MO4A 3W7GA 1I9CB 3LG3A 1XRTA 2OGYA 4I9MA 2FIQA 4DWSD 3PZUA 3DIPA 5DCEA 3CIVA 1RV8A 4AB4A 4Z1YA 4JFSA 3HG4A 4HJWA 4LYPA 4O8AA 1CWYA 5CC3A 3TR9A 2VVSA 4ERAA 3UVAA 2ZZ2A 1XSKA 2JEPA 2QR6A 5TBOA 7TIMA 4WZHA 2AAAA 3OZYA 1E0VA 3P82A 1RVGA 1KCKA 1E73M 2ZUSA 4J4KA 2J88A 2PDUA 1KFCA 3E0WA 1FCQA 2WO5A 1PV8A 1YMYA 2FTWA 3MS8A 1JCTA 1H50A 4QGCA 2HVOA 4IPNB 3CIXA 4ZOEA 4QAIA 1KWGA 5C0QA 3WF2A 3QFEA 2F84A 1GZ1A 4PR4A 4WSKA 3RU8X 1MZHA 4KCWA 3S9ZA 4CN4A 5BXPA 1C8QA 3E2VA 1W1YA 3EDJA 3APTA 3PTMA 5C9XA 3W2NA 4DPPA 4LXFA 5B7ZA 4CLMA 1K8XA 3QSRA 2PC8A 2DT3A 1LL7A 1UR3M 5A2AA 4PUWA 1GJWA 3FIGA 6XIAA 1WO2A 1VFUA 3CL7A 5HXMA 1D8CA 3GTIA 4JY8A 3SRHA 4TUFA 5DXYA 4ZOBA 3BAWA 4IWWA 5HAOA 5MKGA 2CHNA 1IEIA 1GW9A 5JIPA 1Q4NX 3H6OA 1W1A1 3FEQA 3CUHA 4QSFA 3N2MA 3L2IA 3VIGA 2G3IA 4GZIA 1E43A 1MQQA 5EPDA 4IT1A 1HFBA 1MXSA 2F8QA 2RJHA 1H1ZA 5EY5A 3B0XA 2OYMA 2SFPA 4H9YA 4HU4A 4UTFA 2WCGA 5AC5A 2FH8A 1S5WA 1R3YA 1Q7ZA 4G7EA 2BOEX 1ZBWA 1V02A 4EIVA 4HK6A 1X38A 1LLZA 4XK2A 5DCDA 3TOPA 2HK0A 4Q8QA 2DU2A 3OA5A 3F5LA 2WPBA 1UUQA 1OABA 3ARUA 4JQAA 4URIA 1AH3A 4N2YA 2J74A 4FLQA 3H2AA 5BZAA 1B90A 3GR8A 2P76A 5C9RA 1XG3A 3B0VC 3NJ3A 3PG9A 3M47A 2W6RA 3OP2A 1R5YA 1XIEA 3CV2A 3FXGA 2NQ5A 4B4HA 5ABGA 3MCNA 3IUIA 3TIMA 1U33A 3EXSA 2WHMA 4HT3A 1QI5A 3NQ6A 1D8WA 5G2IA 4K8GA 1GQJA 4IMAA 1F3XA 4ACYA 1NY1A 4RV3A 3RF9A 1H3GA 1K6WA 3FGCB 1IIHA 4M7SA 2E5DA 3FHQA 5H1WA 1ZJAA 3VGFA 1UH3A 2R1PA 4H8VA 4LALA 5AYXA 3B9EA 1FA2A 1F6KA 3SY1A 1QK0A 1GYMA 4U10A 1QOPA 3LXCA 5I03A 3CMGA 3EOLA 1F4AA 4NYYA 1A5CA 3W28A 4KF1A 1WKDA 4F0LA 4IJCA 1BLIA 3VUPA 2HNEA 2C16A 4IQJA 1XC4A 2JF7A 1DBTA 1L6WA 3L5MA 2Z1KA 1W3KA 1J4EA 4ICCX 3BV7A 2BLEA 4C6JA 2GVGA 1FUYA 1A5UA 1OF6A 1UWIA 2OSYA 3QFWA 3FOKA 2VT0A 4JIRA 1QHOA 3MYPA 1NSJA 3L2MA 5JXQA 3MI2A 4FXJA 4DM1A 2VX4A 1VEMA 1XYCA 4H41A 3LBCA 1NFBA 3C2OA 2O56A 3EDDA 1W5QA 1JXJA 3QHNA 3I7RA 5K4ZA 4X2RA 3PK7A 2DP3A 3DFSA 3XINA 4XB3A 1OFRA 4Z08A 2ZC8A 1GVIA 3JR2A 3QTGA 1Q6QA 4H04A 3IGSA 1MUMA 2OZ3A 4OU1A 4IG2B 5BOEA 1RJQA 5CLWA 4A2RA 4Y9NA 3M46A 5KINA 2EPOA 4KPLA 3ZMRA 1ZCCA 1I1WA 4IIBA 3WK0A 1L2UA 2IPWA 2IQTA 1E6ZA 1T96A 3BCJA 1XLMA 1N2VA 1TQXA 2QYGA 1YDNA 4LVBA 2GGJA 1SO4A 3AXHA 1YIXA 3BTNA 2C71A 2P3EA 4BI5A 1AMYA 1PJ9A 4M24A 3KBMA 5F4WA 3W2KA 4S3GA 5DMYA 6REQB 3GTHA 4OUIA 5HNUA 3HFYA 1G4TA 2O55A 4HTBA 4BFAA 5HBFA 3AMCA 1BVZA 3WMLA 1POJA 3WNOA 3LUTA 1KRAC 1ZALA 4Q8VA 2ZVRA 1HKMA 2PGEA 4JTGA 2CBUA 4JS3A 1KD0A 3LHYA 3PP7A 4D1IA 4QDMA 3VO0A 1DPMA 2DSUA 4FB7A 4KETA 1T40A 4PRTA 3NR0A 4JIPA 5DF0A 3M1ZA 2ZUNA 1LBLA 3VZZA 4XZ9A 1LUCA 3AOFA 4LUSB 1VFFA 2WNWA 3IACA 7REQB 3EXRA 3CQJA 3GIQA 1G9HA 4WDXA 2V5LA 3OQEA 3CLWA 1QATA 1P1XA 4TTUA 1I60A 3EB2A 2PCQA 1B3YA 3D3AA 3OVGA 2ZUTA 3W7KA 3LRLA 3TJXA 1DXEA 1B3VA 1UD6A 3KXQA 5A8GA 1C91A 1M9HA 4ZA0A 2RH9A 3TZFA 3MHUA 4AY8A 3LCXA 3ZR6A 4XD6A 4GISA 3BG3A 3EA3A 2INZA 1AH0A 2ALDA 4WJ8A 2OYLA 3WK1A 5C54A 3LXBA 3ALFA 3WF4A 1YXDA 4JL2A 5BYWA 3E12A 2VOTA 4K36A 4D71A 1PDYA 3TX9A 3GXNA 3LB0A 1XUZA 1AJZA 5CGMA 5I00A 3NZ1A 1TREA 4F0RA 4JHZA 3LERA 1TO3A 4HVXA 3TC7A 2P88A 1OX4B 1G4SA 1I1XA 5JH1A 2J75A 1AW2A 4O12A 1WZKA 3WLJA 1UC5A 3P80A 5LZLA 1W5NA 1XBYA 3DEQA 2A79A 4IQDA 4Q8UA 2EPNA 1P0KA 2YBUA 3KOXA 4WGHA 2PA6A 2OU4A 4AVNA 2GJXB 3CYVA 3OOQA 1TFVA 2QPUA 3BGGA 1NTHA 3KBWA 3W26A 4NQ1A 4XV0A 2OMAA 3I3BA 4PUMA 1THFD 2FQIA 3TEVA 1OFQA 4XVDA 5E0FA 4IISA 3UG5A 1IGSA 1J6OA 4UOJA 1W9XA 3BO9A 1K9EA 3HURA 1L6FA 4CEUC 4ADUA 3OEXA 3HV8A 1REQB 3HG3A 4FOUA 5ABHA 4R85A 3KOZA 2ZUMA 2ISWA 1RY8A 2Z1XA 1JUKA 1HKJA 3KOWA 3NYDA 4IGMA 4TTGA 1XWYA 4QEEA 4KWOA 4MB1A 3TTYA 2X40A 3KAOA 2NQHA 3GKAA 2J8GA 3O16A 4ORIA 4MB4A 4N0RA 2OQYA 2EG8A 1OINA 4W8BA 3RM4A 5C55A 1V6TA 3WLTA 5BRQA 2V5DA 3IUDA 7CGTA 4EPEC 1NAL1 1GJUA 4JCLA 2ZUWA 5CZKA 4NVTA 5G2WA 3CHDA 4OTKA 3IJ9A 5XIAA 2DORA 2J7HA 4K2SA 1C3FA 2V63A 3NO3A 4D6HA 4H8UA 3RN6A 3B9AA 4IMEA 1DWFM 4HU3A 3GTNA 5A2BA 3L7RA 1OGSA 3N13A 4PMRA 3OA3A 3VA8A 2HTMA 2NXGA 1UIPA 4QJ3B 3AWNA 1QW8A 2E9LA 3WD0A 5ABFA 4BWLA 3GC4A 4F2UA 1RZMA 5IBXC 3WJWA 5LIYX 3ZSSA 3OZPA 3FLUA 3W71A 4S2CA 1UWRA 1JYNA 1EGMA 4TU1A 3QLLA 4HK5A 3MVTA 1E55A 2F61A 2G5WA 3M6YA 4B3ZA 1XYFA 2XVNA 2OELA 1GOMA 4ERGA 1VBHA 3Q2DA 4ATDA 3OLDA 4J40A 2G50A 4PUKA 4CCEA 4NI8A 4GGHA 4RPPA 3AUJA 1FFRA 4EF9A 1W3JA 4JTFA 3OBEA 1VZWA 4GUGA 1SFSA 4POCA 4YYCA 3QY8A 3W38A 2J8TA 4KESA 1HL8A 5EL1A 3OGRA 4KCTA 3QPZA 4UTWC 1GZJA 3UXIA 5D38A 2XHYA 3EBVA 1W1ZA 1DJYA 4CD6A 3SIZA 3TDFA 3UNDA 4GIRA 3THQA 4CNPA 1XV8A 1G7VA 4JIIX 4L7ZA 4DXVA 4QG8A 5EMJA 1BXBA 3OYXA 5CZJA 3S9YA 3LA4A 2Q6ZA 5BWFA 1RBOB 4FAMA 4Q4SA 3QKZA 3NQDA 2Q01A 2EF9A 1J2BA 3EX3A 3KCOA 1KXTA 4UUIA 5H8UA 4ACZA 4ASTA 1YTEA 7ENLA 1IWAA 3PJXA 3S46A 3RLGA 4HHPA 1UR9A 3GTFA 4QEHA 2DVTA 3UT0A 1HO4A 2WM1A 1EFZA 1CGVA 5C9UA 1QMLA 4K37A 2QJJA 1DP0A 3AYVA 3IAPA 3AJ7A 2W5FA 3RJXA 1XP3A 4GIAA 1XYLA 4O57A 1N7KA 4Q3MA 4YNGA 1XIMA 2VC9A 4UQAA 2V69A 2VC5A 1QO2A 1V08A 2Y24A 2Q02A 3GDKA 3BWWA 2Y7GA 3WFAA 5D8WA 4NAEA 2Y85A 2DZPA 1QU4A 2ASHA 4RL3A 3WBXA 3SUVA 1FY6A 1RBLA 4WKHA 3TW7A 4NZCA 4E3VA 3QN3A 1F4HA 3I6RA 3QJAA 4IXXA 4MADA 4P8WA 1TUXA 3URQA 2R82A 1KCXA 2DSKA 4DJDA 4DUOA 3KRZA 1JF5A 2PI6A 3TC3A 4PE8A 3I65A 3OYZA 1IZJA 1QI3A 4A05A 1X98A 5A8OA 1OADA 2C14A 2J79A 1QTWA 3GFZA 4LVAA 2FYMA 2QW5A 1UPPA 4PMJA 3CWHA 1GQNA 4DQWA 1TQJA 3L4ZA 4QBXA 2P8CA 4H9UA 1FQ0A 3M0HA 3IJ8A 2D3NA 3D0CA 2CEQA 3WX7A 3CHVA 5LHFA 1M53A 4Q4RA 3CBWA 2V2HA 4I6VA 2QF8A 4HNVA 1XGEA 4QDWA 2R6OA 3GNDA 1LTDA 3MVIA 4NSBA 3LCFA 3QHOA 3GXTA 1YADA 3N6HA 1JXKA 4HB7A 3TJLA 3ARVA 4QAWA 1VJIA 1AJ2A 3W23A 5K9XA 3VMPA 3OW1A 3VGBA 1A0CA 4N7QA 4PMXA 3W7CA 2VZTA 3UJSA 1NP2A 3LHZA 3AHTA 5LIUX 1RH9A 3EMQA 4CN6A 3BPWA 1OD0A 2YDRA 2OODA 5CG0A 1A5AA 3KCJA 1DV7A 3AWOA 5DLCA 1UR2A 1EC8A 1VEPA 2DIKA 3NM1A 3L12A 3IV3A 2QS8A 2WC3A 1VBJA 5K9DA 4S38A 2YLLA 1Q4WA 4AZGA 3HIJA 4E2VA 1YE4A 1TTQA 1AODA 2O7SA 4ZODA 3U0HA 2WBKA 4Z1CA 4OT7A 3G0XA 3GVVA 5C8BB 3GG7A 2ZX8A 3I3DA 3NAVA 2Z2AA 3UVIA 2CWNA 5FD0A 2BVWA 2FZDA 3VNMA 2ZVIA 4HA0A 3OBAA 1LP6A 3K8MA 2DPEA 3DHPA 4PL2A 1QW7A 1XH1A 3PC0A 5DT5A 2YPIA 4MZ1A 1VS1A 3E5PA 3G3DA 2ACRA 1XLIA 3FSUA 4XAZA 2AGTA 1SW3A 1P5BA 1R3TA 2WWCA 2VEFA 5EB8A 2IKIA 1W1B1 3A22A 3N4AA 1D7KA 3CO8A 4E2BA 3HF3A 2PTWA 1L8PA 3ARWA 1KFBA 5HQLA 1KM0A 1CGYA 1R2TA 3GC2A 3LV6A 4FNRA 4O1AA 3VGGA 3NXFA 3PZ9A 4GPNA 4AF0B 3FS2A 3N9SA 1XIJA 3A4JA 3LSBA 3QMRA 3H12A 3DKJA 2WMKA 4YL2A 5GNYA 1GHRA 5J8LA 4AH7A 4PMYA 4R5EA 2ZA1A 3LPGA 2O9RA 3GU9A 4A4AA 1EWEA 4DVOA 3Q67A 4LSBA 1I75A 1WV2A 3IK4A 4U2ZA 3CASA 4AISA 1HUVA 2W27A 3PFMA 4H6RA 3QMTA 1VEOA 5A6AA 3RPMA 1A5KC 1OX6A 1TPUA 3WNPA 3NO5A 5EBUA 1V51A 3BXWA 2XGBA 2RKXA 4UFJA 1B3XA 2QUMA 4M19A 2DGAA 5F2MA 4QS6A 3AMLA 4TXEA 4NJIA 2FMNA 1OCQA 4JTIA 2CITA 2ZXBA 3A3HA 3BCDA 4O0KA 2HZGA 4J28A 2PZ0A 1EGVA 2EPHA 3FJNA 3KCLA 3DC8A 4QE5A 3PTDA 4ZTYA 4HTYA 4AXNA 3GM8A 4C65A 1JUEA 5CBJA 4MOZA 1PDZA 2NZLA 3OHMB 4B4FA 5I2UA 1QW9A 2G3FA 5AYZA 4HPNA 2YBTA 2OWWA 3JVAA 1K6AA 3DI1A 4JTTA 1XX1A 3SRKA 5TIMA 1MDRA 5A6SA 3IIXA 1IZCA 2WZEA 4I9JA 4JIHA 3K1DA 4OBTA 4C6QA 4CU6A 3PR2A 1FWCC 1Q85A 3EXTA 4JBRA 1F05A 4KEVA 2RDXA 1WE5A 4QXIA 1Q6RA 4DJEA 4CD8A 3T44A 2BG5A 1T5AA 5IFPA 1Z48A 3TTQA 3WO8A 4AWTA 3NQEA 2E40A 1KLZA 1OX5A 1SJAA 1XKJA 4JYDA 3PJWA 4LEFA 4HU0A 2Z1WA 3FN9A 4HMNA 4U5IA 5D9OA 4GA8A 4IL0A 1F6PA 3L4VA 4GNJA 2AQWA 2BWGA 5FKYA 3WDQA 4IG2A 3RLHA 1F3TA 4LUTB 3TA9A 3URAA 2OEKA 2ZZ1A 5H91A 2Y7DA 3KVMA 1X1ZA 4C7FA 5D9PA 4CQDA 3BJFA 5I3IA 3TJIA 3PG8A 4KBXA 1W54A 2XIIA 3QTPA 3PBGA 2PLCA 4EXBA 3RMEA 5H8PA 1US2A 3T2QA 2VUYA 1BYAA 3MSGA 1YW1A 1S2CA 4GFIA 3CV7A 3M0JA 2QVNA 1LWHA 3FDKA 3LLFA 2PWEA 1EA0A 5FJIA 3HJZA 5K2ZA 4WK9A 2A3BA 2C79A 1E6XM 4O4WA 3QY7A 4V28A 5D9NA 1J8VA 1PB0A 1N8WA 4OFCA 4XSLA 3F4WA 4UCFA 3L0KA 2PC4A 1DORA 2QJHA 3R4IA 1HG3A 4PEKA 2H3DA 1Z44A 3AJXA 3W7RA 1EPXA 2POZA 1BVWA 1UR1A 1D3GA 1HJQA 4MJ4A 3U2OA 1ZQ5A 4IIGA 4LUSA 2G0WA 4WJXA 2AGKA 4Q4OA 3F5KA 3VIOA 1GGOA 3R12A 1TKKA 2YA0A 4Y90A 4GXPA 3VKAA 2PBOA 2BGNE 2P53A 5A8NA 4IFRA 3AIEA 1DJGA 1W56A 4H6KA 5CPMA 4UTJA 4GBDA 3WQDA 4E8CA 2VO5A 4ATLA 1VPQA 3WQVA 3GVWA 4IXHA 3BLEA 4UTTC 4RX0A 2F7FA 3HMJG 4N9DA 3WLHA 2G96A 2A4AA 1OYAA 4S1FA 2A7RA 2J9YA 1EOKA 2ALRA 1R2SA 1ADOA 4NI3A 4RZ6A 1T7LA 3WCZA 3QZ6A 2DT1A 3JRKA 4G2DA 2HE5A 4AVOA 1UMLA 3QQ1A 3VFLA 1J0ZA 1FP8A 2WLZA 1C9DA 1U1JA 3GUGA 1KFKA 2P10A 2C3ZA 4CNUA 1VGAA 9CGTA 1ITCA 4HZ7A 3L0NA 3PZQA 1W1PA 4AW7A 3PB2A 5M17A 3R6IA 2NUYA 5AHNA 4KFPA 3CTLA 1OX4A 3QVQA 1B30A 3O6DA 4DYEA 4I5UA 5EMUA 1JDFA 1OJXA 4QNEA 4TVCA 4R9OA 1A49A 3GZ3A 1Y8BA 3R79A 3UWYA 2E5CA 3EPMA 2HVNA 3M44A 3UWZA 4O15A 2GJXA 3LX9A 1UWUA 3L2LA 3B05A 4CU7A 4O14A 1K70A 4J3ZA 5HK4A 2BHUA 1ZS2A 3S1VA 1GJPA 2VFDA 2Y5JA 4BJHA 1UKOA 1GVFA 1PWMA 1UCWA 3T81A 1LF1A 4NKCA 1REQA 2X16A 1V8EA 4EXAA 4HPXA 4XZWA 3HGRA 3BGJA 2V0TA 3CM4A 4D6EA 1FWEC 3FX4A 4LUIA 4ZXOA 2V68A 3C6CA 5DXXA 2VZSA 3RM8A 1AZ2A 2FPYA 3WUGA 3QGKC 1W91A 4CCDA 2VQUA 3MUY1 3NZQA 3RJYA 4DJDD 3S6TA 2ABAA 1TR1A 2A3HA 1E6PA 1Y65A 1PVNA 1KTNA 1V79A 3W7NA 2Z7KA 5LKYA 1A5OC 2D2HA 1RVKA 3WQFA 2VR2A 1MVYA 1NDVA 2NVDA 4TMCA 2F6UA 3YPIA 1JFXA 3IV8A 4MAZA 4AD2A 3TAOA 1TTJA 2BNJA 2JE8A 3PHAA 5C9WA 3T09A 3ARRA 3SSZA 4LV4A 3ARPA 1R3QA 1X96A 5K3VA 2XU2A 3W29A 4R34A 1U83A 3L66A 2AKZA 3SY8A 2QUTA 3PZNA 3BOLA 1CXLA 1KWKA 4MFDA 3WNNA 4NXKA 3ANYA 4ECLA 2YDQA 7TAAA 3PTQA 2ZKMX 4ZBCA 2CZVA 3W07A 2CPUA 1HO1A 1QNSA 3CNYA 2PTDA 1FDZA 5U4NA 4R7JA 3LM7A 1A5BA 3OLEA 3VCNA 3PTKA 2Z26A 2NXIA 1R46A 2V5JA 1CGTA 1WAWA 3IGHX 3N34A 3QC3A 4I5XA 3SN0A 4D8ZA 1UC4A 4PZVA 4O4VA 3R58A 1E70M 1JD7A 1H51A 2CXEA 2WW5A 4LY8A 1K3UA 4P7LA 1X1OA 1M65A 3BOXA 1O60A 2YCLB 4DY1A 1P7TB 5FF2A 3TONA 2JKAA 3P93A 4Z2HA 1UKSA 5ENLA 3O6AA 5M03A 1JI2A 5BOOA 4QSHA 1WXJA 1TTPA 1W5MA 4LF2A 2OR2A 5CZTA 1SQ7A 1PO9A 3TTEA 2V2CA 4QS5A 4LBSA 1D7FA 3TN4A 2VGFA 3TCEA 4J3XA 8CGTA 5LNSA 4AWEA 5FIPA 3QF0A 1EYEA 4NJKA 2A7NA 1NJJA 1VRDA 3T0CA 2RUSA 4UR8A 1F73A 1PSCA 3A3XA 4RNHA 2ZRZA 2E7FA 1FWNA 1Z32X 9XIAA 1XFBA 1O66A 1XLAA 2GDVA 1XIBA 4F66A 3GVQA 3THUA 2DJXA 1QCWA 3V36A 3UXDA 4TR9A 1XYBA 3NWRA 1VBRA 1IYXA 4C1NB 3GDBA 1R3WA 1UPMB 2PUZA 4HSHA 3WMCA 3SM0A 2HDJA 1LQ2A 5E09A 1D9EA 1SFLA 2HWGA 3QY6A 3C0SA 1E40A 1OK6A 5EGRA 3V1PA 2DSZA 4J5NA 3W22A 3H2CA 3Q45A 1XDLA 4AX6A 3P74A 1TG7A 4ZTXA 4W84A 4ZOAA 4EVZA 4HHHA 3H55A 3ERPA 3RLUA 3EEGA 4JNMA 2Q3OA 3POCA 1R3RA 1ZAHA 2V3EA 4B9ZA 2FZMA 4QLKA 4GGBA 5EFDA 5DQPA 1C8XA 4LW7A 1E3ZA 1CCWB 1TIMA 3H70A 4NJHA 1BF2A 3ZIZA 3VKCA 5CPLA 5E5CA 3A23A 4OQVA 2DH3A 2PRHA 3GDRA 2OVLA 1VYSX 5M2FX 5A6KA 3F4DA 1JDDA 2IPFA 1P4CA 3T40A 3NM3A 2BFGA 3EEZA 1TR9A 5DX7A 3O6YX 4F0HA 4HA3A 1KGWA 4IGHA 3U2EA 4F3HA 5JQ9A 1GVYA 3KP1A 2ZDRA 2PMQA 4TVDA 4I3GA 3N18A 1E6RA 4WXZA 3MJYA 4FXSA 4GQRA 5AHEA 2UY5A 1SJCA 3ICJA 1C9WA 1ZRQA 2QUUA 1O7AA 1TV2A 3NL6A 2BP1A 2O9TA 3TAKA 3WZ0E 2A3AA 2W61A 3N14A 1US3A 1U5JA 3BAKA 5DFAA 4B2DA 3RU6A 4JCMA 2CBVA 2XIOA 2YXGA 2OX4A 3K30A 4HCDA 4DJED 5HNTA 1N8FA 4G56A 2EJ1A 3MZ2A 1EXBA 5I7GA 3IS4A 3E49A 4H3DA 2CETA 3IEBA 3MKVA 4MWAE 3KWSA 1MRQA 3MC5A 1BRLB 3ZJ8A 2Y2WA 3WNKA 3NQVA 4LQ1A 3RHGA 3P6LA 4YYFA 2QQ6A 3VILA 5KETA 1KV5A 3CHCA 3WIJA 3AAMA 3EWBX 4GWEA 3R8RA 2WNQA 4FSAA 1CLXA 1EF2A 3ABZA 4C91A 3DAQA 3SSJA 2YJQA 5DCBA 2D22A 5G4WA 4GI9A 1BWKA 4E0CA 4JN6A 1OIFA 1DEDA 1ENUA 4PCNA 2GVYA 1OGGA 4BEQA 2CW6A 4UTHA 4GD0A 3H2OA 4JEJA 1BPLB 2HISA 4G7FA 3ZXWA 3NPWA 3O06A 3KBNA 3QLDA 1ZPTA 2D69A 3VGEA 4WQ6A 3EMZA 4B5VA 3B97A 4DLFA 3LEPA 4O54A 3VVGA 4W7VA 3QW4B 3JS3A 4DBWA 1LCOA 2E68A 2YFOA 3OVQA 4GY1A 4V2XA 4Q8TA 3UJRA 4H9VA 1E4IA 3TNBA 4IP5A 4D6FA 3THAA 3WJYA 3MB9A 4ROQA 3M43A 3EX2A 3CHEA 4GZJA 4XAPA 3SY5A 4FOKA 4NZ5A 1P0BA 2EQDA 3G5EA 1GOOA 5DT7A 2VURA 3VDGA 4AF0A 1TPB1 1WUFA 2FFCA 1EIBA 2ZE3A 1SZNA 1PZ3A 3VGDA 4Y7EA 2XSBA 2ZRUA 2OQHA 4HZMA 1J79A 3IIPA 1ZZMA 3F4CA 3HU7A 4KEMA 1VYPX 1HIZA 4K7VA 2ZRWA 2CHRA 3V7PA 2CLEA 1RALA 3AIBA 6TAAA 5D03A 1ISWA 3P62A 4IPLA 3C8FA 3O9NA 3R89A 1Q8AA 3DC0A 2E6AA 1UZHA 2X0YA 2AMGA 2BSLA 3GKFA 1R2RA 4LRSA 3H7VA 3EB3A 1KGXA