2HRWA

Crystal structure of phosphonopyruvate hydrolase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
290
structure length
281
Chain Sequence
MTKNQALRAALDSGRLFTAMAAHNPLVAKLAEQAGFGGIWGSGFELSASYAVPDANILSMSTHLEMMRAIASTVSIPLIADIDTGFGNAVNVHYVVPQYEAAGASAIVMEDKTFPKQELVRIEEFQGKIAAATAARADRDFVVIARVEALIAGLGQQEAVRRGQAYEEAGADAILIHSRQKTPDEILAFVKSWPGKVPLVLVPTAYPQLTEADIAALSKVGIVIYGNHAIRAAVGAVREVFARIRRDGGIREVDAALPSVKEIIELQGDERMRAVEARYLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Phosphonopyruvate hydrolase
publication title Structure and Kinetics of Phosphonopyruvate Hydrolase from Voriovorax sp. Pal2: New Insight into the Divergence of Catalysis within the PEP Mutase/Isocitrate Lyase Superfamily
pubmed doi rcsb
source organism Variovorax sp.
total genus 104
structure length 281
sequence length 290
ec nomenclature ec 3.11.1.3: Phosphonopyruvate hydrolase.
pdb deposition date 2006-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 2hrwA00
3EZ4A 4QG9A 1DXFA 3ME3A 4JPGA 3T07A 1O5QA 1SGJA 4TV5A 1XG3A 3MA8A 3B8IA 1OQFA 2VGGA 3IS4A 1PKLA 4KS0A 3E0WA 1S2TA 4QG6A 4WJ8A 2HROA 4L7ZA 1PYMA 2KX9A 3SRDA 1F8MA 1O68A 1XG4A 1MUMA 1Z6KA 1GGOA 4FXJA 1DQUA 4B5SA 3OYXA 4ROQA 2V5KA 2L5HA 4YNGA 3N25A 3FA3A 3T05A 1A49A 3EOLA 3OQ8A 3EOEA 3QLLA 2XZ7A 4DRSA 3BJFA 3LG3A 3T0TA 3KHDA 3SRFA 2V5JA 1KC7A 1S2WA 3PP7A 1M3UA 2VWTA 3G2GA 3QV7A 1S2UA 3HQPA 1IZCA 1A3XA 4HYVA 2G50A 2R82A 4IP7A 3SRKA 4B2DD 2WQDA 3QV6A 4G1NA 1DXEA 2ZE3A 1PKNA 3HQNA 3U2ZA 1U5VA 1OY0A 1E0TA 1F61A 4B5VA 2BG5A 3QV8A 4B5XA 2HJPA 5JVLA 4RPPA 4L9YA 4IMAA 4HYWA 4IQEA 3VAVA 4KCUA 3M0KA 3GG8A 3EOOA 3BJTA 2QIWA 4YJ5A 4IQDA 3OYZA 1E0UA 3LYEA 1DIKA 4MG4A 1M1BA 3GR4A 4KCWA 4LSBA 4B5TA 1PKMA 3M0JA 1ZJHA 1O66A 2OLSA 4B5WA 1VBGA 4TV6A 2DUAA 1F3XA 1VBHA 4FXFA 2VGBA 1T5AA 4KCTA 3P0XA 1A5UA 4KRZA 2DIKA 2VGFA 3E0VA 3R4IA 4L80A 1PKYA 4KCVA 3H6OA 1KBLA 3I4EA 3QTGA 4B5UA 3GQYA 1JDEA 4QGCA 1U5HA 2HWGA 1S2VA 2VGIA 3FA4A 3HQOA 3KTXA 4QG8A 5TAOA 3SRHA 2X0SA 3PUGA 1AQFA 1F3WA 4L9ZA 3E5BA 2XZ9A 1UJQA 1F8IA 2HRWA 3QQWA 3QV9A 4MF4A 2XDFA 3QZ6A 2VWSA 1IGWA 1ZLPA 2E28A 1A3WA 4B2DA
chains in the Genus database with same CATH superfamily
3EZ4A 4BY3A 3PN8A 2VP8A 2IS7A 4DY1A 4V1XA 1MUCA 2AQVA 1WDPA 4UTJA 1WBHA 3OJGA 3H2AA 5ABEA 4PUJA 2ZFAA 2PB1A 1W3LA 4I5RA 3UJRA 1M9HA 1KTBA 5D05A 1VFOA 3GX9A 2X8RA 4HT3A 4H8HA 1A5KC 5C5YA 4LVDA 3MKCA 1Y0EA 3FA3A 2XIMA 1GQLA 1B57A 3CYVA 4JY8A 1QPNA 1B4EA 3ANVA 2YIHA 3C0SA 2WJZA 3FA5A 1QTWA 3IAQA 1UWIA 4F0HA 1V4YA 1G01A 2BP1A 2W6RA 5GNXA 3ZFHA 1JCLA 3F4NA 1E0WA 1TV7A 1S3TC 4AX7A 2GJXA 2OSXA 2JIEA 3VNIA 1EPXA 2ZXBA 1EQCA 1M1BA 3R94A 2VR2A 1D8CA 3FKKA 2E5CA 3U0HA 4XBSA 1ME8A 3ITCA 4U31A 1PE1A 3PWGA 2BSLA 2QCFA 3UXIA 2ADAA 4C6MA 1JDCA 3PWIA 1G0CA 1R85A 1REQB 1LRQA 3GVRA 3VVGA 3ES8A 3AC0A 1KCLA 1EO7A 1Y5VA 4S2BA 1QNRA 3GNDA 3E12A 1KTCA 1J5TA 4HA3A 1KB3A 2Y8VA 1HXJA 1B30A 2ZDRA 1MYRA 4ERAA 1SFLA 3NNTA 3VYLA 3F4WA 1NIUA 2EAWA 4ML4A 1JF5A 3AMKA 4P7QA 1JCTA 1JCJA 3KVLA 5BWFA 2XM1A 3GKAA 2XIBA 3NO3A 2FZ9A 2C13A 3NZRA 3WLOA 5BU6A 4D6FA 4DWSD 2YXXA 3ZMRA 7REQB 3VE7A 1RVKA 1EJ7L 1QO5A 3SJ3A 3QC0A 4X61A 1W3TA 1OC7A 3O9NA 5FJPA 1F61A 2PCEA 3UW6A 3L66A 4Y9NA 1Q2SA 4AD2A 2PODA 5AYXA 3GXTA 4UTWA 3UETA 4ML9A 1RK5A 1XRVA 2CU0A 3UA4A 1OM0A 1UH3A 2WMKA 2CETA 4OZOA 2QR6A 3A9IA 2OXNA 2W61A 4JDYA 2D3NA 3W7MA 1W1A1 4H7CA 4ORIA 2DVUA 5I3FA 1A5MC 3RN6A 1FQ0A 4XVDA 4O11A 3ITVA 1QK0A 2XIJA 4CD4A 5IM51 4NX5A 4D8LA 3NQAA 1TUFA 4AMCA 2IPJA 5C8BB 3W70A 4XKYA 5AVHA 2D2JA 2BV9A 5H1WA 4NJGA 3CUFA 6ENLA 2CZFA 3OG2A 3STGA 4PUKA 4K7YA 2HQAA 4OU1A 3U8GA 3VZXA 2XN1A 5FF2A 1LQ2A 2FZDA 1GVEA 4D72A 3UWYA 1OD8A 3PZMA 3SIMA 3IJ8A 1N7KA 4O54A 1QUMA 4OECA 2E40A 3TQVA 1Y5XA 4FALA 1Y8BA 2VRKA 4FR6A 2EHHA 2ZVIA 2WMFA 1T7LA 4KBXA 1A49A 4Q32A 4RNHA 1XYBA 3M6DA 4PC8A 1OX4B 4C6BA 5JQ9A 3LRLA 3W25A 4FSAA 1C9WA 3ZS4A 5C55A 1IZCA 3BLDA 3GXIA 2D2OA 1HVQA 2VCAA 2OT0A 5HMEA 3M0XA 5JBDA 2WHLA 3EOOA 4HJWA 4CD6A 4JY9A 4FIQA 4IIDA 1E9LA 3AIUA 4L6HA 4HOZA 3K8MA 4JTFA 3LXCA 3VCRA 2R1LA 4AZ6A 1RCQA 4JGDA 2PFHA 2V38A 4QLLA 3ZM8A 2VGFA 4JTAA 3CL8A 2GVLA 4G2DA 2BDQA 4GI4A 5AECA 2YR1A 1IXOA 2E9LA 4EXQA 4QEHA 5E9XA 2CZDA 2CYGA 1ODUA 5DXXA 3TYUA 3FFSA 3IJIA 1L6FA 1ZJBA 2AKZA 3IWPA 1V79A 1UB3A 4IXHA 4Y9OA 1IXQA 3QYQA 3VKBA 3P67A 1LWHA 2ISWA 4BF7A 1PSCA 1JR1A 3NPXA 4XD4A 2G5WA 2WNNA 2QCCA 3DU0A 4ZXLA 1FHUA 1AZ1A 1U2YA 4NQ1A 4XAFA 4ADUA 4IFOA 4HMDA 5JH1A 3VMPA 3IVTA 3O07A 3UQNA 3WH6A 5LIKX 4DUWA 4FEZA 1DJGA 1OCBA 1UR9A 3GDLA 3PG8A 3PFMA 4AF0A 3E0IA 3NGJA 1FVPA 4AEOA 2G50A 1TCMA 2TMDA 3N12A 2F6UA 1ZENA 1QXLA 3RUBL 3WDRA 3D5HA 2DPEA 4GRSA 1KNWA 4PFMA 2OGYA 3GC2A 4LX4A 4X2RA 5JVLA 4WIWA 2XPKA 3UCQA 1Z42A 1W3HA 5LA1A 1J0JA 1RHCA 1A0DA 4MWAA 1NOWA 5A94A 3S2LA 1Y7VA 2EJAA 4A3UA 2G97A 3L12A 4EWJA 5DFAA 1E4IA 1FFRA 2DIJA 2YYUA 4J3UA 2XN0A 4AZCB 4NAFA 5E1QA 3HURA 2G41A 1N8WA 5JMUA 4CVUA 2R94A 2FYMA 1T0OA 1YLVA 4LS1A 4JFSA 4G7FA 3CM4A 3O0FA 3TYCA 1K4HA 1O1ZA 3W7GA 5RUBA 4UR8A 3KWSA 4NZ3A 4JTCA 1S2AA 1N82A 4CGTA 1E6XM 2CEQA 4JKLA 1NSJA 3E2QA 2VCCA 3PJTA 3B8UA 5CSRA 4J27A 4IFKA 1E0VA 1ZAJA 4W5UA 1YDYA 3L4XA 4TOQA 1V0LA 2V5KA 3A3WA 3DECA 1DL3A 3SN1A 1AMYA 1DEDA 3LERA 3R8GA 1IXNA 2BX7A 5CC6A 4UNLA 3G24A 2V5JA 1YXYA 1PYFA 1WA3A 2D23A 3W2MA 3ZVIA 4B2DD 3MVTA 3PUOA 4A21A 3KBWA 4FK9A 3OLEA 1NDYA 4JIPA 2ZC1A 4YMZA 3WDJA 4B5XA 2X40A 4OGZA 2AMGA 2RJHA 5BYWA 3R0KA 3S9ZA 3TQKA 3K46A 5HK4A 4MAZA 2X16A 1EEXA 5I5RA 2A1YA 4GUGA 1T41A 4TV6A 3C5QA 4RPQA 5LGXA 4P8UA 1MNSA 3VX1A 2WC4A 1AD1A 3AXMA 2VVSA 5XIAA 5LSMA 1U22A 1JCYA 5BRQA 1CDGA 2VEKA 3PFRA 1QOPA 3V16A 3UXDA 3VGBA 4BI6A 3WQOA 1K9FA 4LS0A 4CUCA 1B3YA 2GDVA 1WP6A 3V35A 3ARRA 3CWOX 4D71A 2D0GA 5I03A 3CWNA 1EPVA 2EPLX 1UC4A 4MWAE 5I3GA 1GVIA 1TJPA 2ISSA 1SJCA 5CG7A 4ENLA 4O18A 2C15A 3DG6A 3SN0A 3UVAA 4PFHA 3NL3A 4PCPA 5A6AA 1AUSL 5D8WA 3H26A 3MDUA 2L5HA 3ABZA 2Y63A 3AHTA 3M0LA 4W4QA 8A3HA 3IUHA 3LDVA 2YL9A 5LXXA 4S3KA 3WDIA 1OF6A 1ITUA 1OYBA 3NAVA 4FAMA 2XHYA 1H7NA 3K13A 5ABTA 2PC4A 3M5VA 1KRCC 3EPNA 2QXWA 4WHBA 4YVVA 3W7LA 1E6SM 4C1KA 1K7EA 4EACA 3A3XA 1XGEA 3UJSA 1VKFA 4PB3A 1QW7A 1GOMA 1I75A 3W6YA 3G18A 4WKAA 1DXIA 1OYCA 4WQ6A 1ELSA 4W84A 1XLHA 3SURA 3KOZA 3NPUA 4K1GA 5DN1A 5HMDA 3AIEA 4F2UA 1W17A 4BHYA 4N9DA 5CC3A 1LUCA 2VDGA 3L67A 2HCVA 2WBGA 3AOFA 3LPGA 1C92A 2CKSA 1U1JA 3WQ4A 2G3FA 3MZNA 3NQGA 4GNKB 4PMRA 1A5CA 2P8BA 3G8EA 1NDZA 2OODA 4GG9A 3GY1A 4D2JA 3IUDA 2WHJA 1E43A 4IFKB 3ELFA 1FH9A 3RK8A 1NWSA 1SJBA 5LNSA 2FMNA 4FB7A 1MZHA 3BICA 3UA3A 3W7IA 5HOSA 1E0XA 3ARPA 3E49A 2A79A 3AS1A 4W8LA 1UD6A 1J01A 4XK2A 3R11A 4O13A 2YL8A 2NQ5A 3QVQA 4I9MA 2OQHA 4MY8A 4DJFC 4BI5A 4P8VA 4ZB0A 4LC6A 1Q6FA 3DZ1A 5DX7A 1OT2A 3ZVHA 4LGXA 2VEMA 3A3HA 1UCWA 4G9PA 2G3MA 4N9EA 3SUUA 3C2YA 4GJJA 4ZBCA 1Q3NA 2QJNA 1TJ0A 4UQCA 3L2MA 4REQA 1UKOA 3VUPA 4JEQA 4ZL1A 2G8ZA 3ARXA 3OG3A 1Q6OA 2CBIA 3HG5A 3GC5A 3A24A 4WSHA 3PAJA 1IT8A 1ZPTA 1JZ8A 3UG4A 3KTXA 4Q33A 3W7QA 1X6UA 4H6EA 4O8AA 4NAEA 3ZIZA 4F0LA 1Q7ZA 2G3JA 4GX9A 4AZBA 5CG0A 2P50A 1MW3A 3ME3A 1XD1A 3WNMA 3TYDA 4HMCA 4H9MA 1GOKA 4KIRA 3GM8A 1SZRA 1VPQA 4KS0A 3VIFA 2GWGA 3JUGA 1SMAA 3U9IA 3C3NA 1UR4A 1GGOA 1I60A 4JTQA 4RZ5A 3EX1A 3V5OA 2WNWA 2J25A 3II1A 1H63A 3EOEA 1M41A 3PAOA 4ERGA 3AS3A 4L1WA 1RY8A 1KGXA 4LW7A 2Y5JA 1A3XA 1JYNA 2Y8KA 3HA1A 2BGQA 3AALA 3M7WA 3W0KA 3WBAA 4L6OA 4HPXA 2C8NA 5CPMA 4IL0A 2EJ1A 3IAPA 2H3BA 3N18A 3VGGA 3WJYA 5AC6A 1EA9C 4H8NA 2DU2A 1UR3M 2WMIA 1ZBVA 2NQZA 2X2YA 4WXYA 3PZGA 3OEXA 3P2VA 2VL4A 1TRDA 3FXGA 5D9NA 3EDDA 3HM7A 5FACA 3CHCA 4X0NA 1LUCB 2I17A 1AQHA 4PRRA 5IDZA 2VFDA 5G4EA 1KBLA 1LG1A 4IJBA 1B54A 2FZBA 1K03A 4N7QA 4ZO7A 3NQVA 4JNYA 3IRDA 1WKEA 1EL3A 2PDHA 4YXGA 3UY7A 3M0YA 3W2NA 1DXFA 3AROA 3ABSA 1XS2A 4RNJA 2ODOA 4DIAA 1TMLA 3OW1A 1ZALA 4DO7A 3IJ6A 4IMFA 3R8RA 1YQ2A 1IR1A 4B3LA 2X09A 5HWMA 4J3TA 3PZQA 1YTDA 3VX0A 4ROQA 1M01A 1YPFA 2GQ8A 1OINA 3AS0A 4HA4A 1QMLA 2QW5A 4H8UA 1DJZA 1R5YA 2CLKA 4MWAD 4XISA 1Z69A 4L6DA 4RL3A 1WDQA 1HW6A 2XFWA 4V33A 3PTQA 5FSDC 4MB4A 4DJDA 1SSDA 4J28A 3VU2A 2WZMA 1FBAA 1PXGA 3EXTA 1IIGA 4H01A 1PS9A 1RY0A 2PTYA 4KQNA 4E4PA 3FS2A 4GFSA 4YWIA 3DGRA 2FGLA 4N4QA 2IKJA 4RDZA 2AGTA 5E93A 4QX4A 4I7UA 3TTSA 1DORA 2OOFA 2CLOA 3REQA 3P8JA 3KCJA 2HWGA 3WZ0E 3C2FA 4C6LA 1F4HA 2Q3OA 3NSNA 3KTCA 3WBYA 5G2IA 1UWQA 3QH2A 1U30A 3R12A 1UJPA 1F6PA 1YNPA 3AHXA 3HB9A 1H1ZA 1O5QA 2OWXA 1M53A 4JFWA 1OK4A 4UBPC 1WXYA 3LGDA 1OC5A 4LF2A 4UMAA 3W2UA 3TN4A 4CN6A 4JX6A 4YVXA 3V5CA 1EOMA 2FHBA 2DJLA 4Q22A 3WDPP 3AIQA 4FIRA 2PLJA 4K36A 5JBFA 3QQ0A 3QHNA 3S3GA 4QROA 3VKDA 1NVMA 2HDJA 1SR9A 4E8DA 3WQDA 3BWWA 3TXZA 5HNUA 1ISZA 1BYDA 5I79A 3QLLA 1CGUA 3OB8A 1WZAA 3W2LA 3W23A 2BVDA 4A4AA 1U1HA 1YKWA 5LIUX 5FEWA 4YHGA 4WVXA 2H8XA 3JVAA 1X7FA 2DDXA 4CN4A 4E8CA 5CC5A 3SB0A 3N2TA 4HP5A 2RGMA 4J9JA 4MJMA 3TONA 3T1GA 3W7OA 3UESA 3VIIA 1OABA 4JTKA 5D30A 3GIQA 5EU9A 5EKYA 1VYPX 4PL1A 1R86A 2X0HA 5BMXA 1SSGA 2Y88A 2AQOA 3GG0A 3ITYA 4EF9A 1RUSA 2GGEA 3FJLA 4LV4A 5SWUA 2V3GA 1JD7A 5C9RA 1R8LA 4MADA 1DWAM 1MXGA 2DUZA 3B3DA 1KWGA 1H09A 3CC1A 2ZX8A 1Q6QA 3E2SA 3LSBA 3NQBA 3H54A 1LOLA 2WK2A 3AU2A 3ZSSA 3LNPA 4XIAA 3WN6A 4UMBA 5ABGA 3D3AA 2X2GA 1WXJA 3BW3A 1DTNA 1EFZA 2NXIA 4I8DA 4FXRA 5D9MA 4US5A 4Q3MA 3NQDA 3VFCA 4WLCA 3DFSA 4D6HA 4Y9AA 2CPUA 4ZVJA 1H41A 3A64A 4ZFCA 2HPIA 2HXUA 3LOTA 2WCGA 4LUYA 4IPJA 2D0FA 4Q4KA 4WJEA 1I2OA 4KFPA 3W87A 1PJ9A 2WNZA 3T44A 1QATA 2OFJA 1KC7A 1KLYA 1UUOA 5CBIA 5C6MA 3B0XA 3MWCA 3QLDA 1E4MM 2BMBA 1CXLA 2G37A 3GWQA 2WLYA 4LVBA 4C60A 4C1NA 2VEPA 4XBKA 1QI2A 3QOMA 5DMMA 3R1ZA 4HCDA 1XX1A 4JCMA 1DE5A 3T09A 3OPSA 4LTSA 4QS5A 3TQPA 1KBBA 2POTA 1Q5MA 2VCBA 2GYIA 1MZRA 4CD5A 4PMXA 3ARYA 2C16A 1FWHC 3HPSA 3B97A 2PGWA 2G4FA 1XH0A 3E0VA 4O1EA 4M6VA 3CIXA 1RK6A 2ZYFA 1SMDA 1XYAA 2ISVA 3CWHA 3N11A 5U4NA 3LHVA 1AL8A 1VBRA 4OUIA 1UJQA 2Y2WA 4AB4A 3QY7A 4F66A 5DY2A 1ENUA 1JULA 3MYOA 3DFPA 2PDMA 4Z08A 3E2VA 3Q58A 1V08A 2O4QA 3UWWA 1GZJA 3PUDA 2C1IA 1HJUA 3HPXA 1NEYA 1NDWA 3CIWA 1WDWA 3KW3A 1SZNA 1M68A 1UWUA 4XTDA 1JZ2A 3L0NA 1CGTA 3VKAA 2PDBA 3VNMA 5MKGB 2GQ9A 4MB3A 3HFYA 2GJPA 3HGSA 4WSKA 1ISWA 1D7KA 3TN3A 3O6DA 4MB5A 4QR6A 3WD3A 4YCPA 4A3RA 2A7PA 1OIMA 2HS8A 1CI1A 2PTZA 4ZCWA 4ZE5A 1PKNA 4GGHA 4JCLA 3SFWA 2QT3A 3VE9A 4GFIA 3GNRA 1SYTA 3OZMA 4AHPA 3WNPA 1GZ1A 1Q63A 3I7QA 4C6QA 3L7RA 2UY5A 3DKJA 1H7OA 3VABA 4HHLA 5FF0A 3GD6A 3E9AA 3AUJA 1IYXA 2BOGX 4GNVA 3GE7A 3P60A 4XAZA 1EIBA 2WKJA 1LROA 1ESWA 3EDEA 4P7RA 5D2YA 4PRTA 3UWZA 3WLMA 1PKYA 3M44A 4LBRA 3TWBA 1JRBA 5ECUA 5AYYA 3RF9A 1V0NA 1JPMA 5I06A 3NR0A 5DBUA 4FLSA 1DWIM 1KA9F 4GI6A 3WL0A 3TYBA 4S3EA 2Q3RA 1C7TA 1CYGA 4XZWA 4H83A 1F4AA 3F5KA 1TELA 4LF1A 3SM0A 3LCGA 1UZHA 2VEFA 2ZZ4A 2D3LA 4GK8A 1TR9A 4EPDC 3PF3A 5CC7A 1V03A 3RRAA 1QNOA 2BY2A 3DX5A 3R13A 3O63A 1KFKA 2YCJA 2FHCA 3UJ2A 4DF0A 2C0HA 2R8WA 3W07A 3QSRA 4O1DA 4KGLA 3URAA 5EB8A 4IG2A 3W7RA 5CPNA 3HO8A 3WNKA 3N14A 2WMHA 7CGTA 2PLCA 6TAAA 2NQJA 3BQ6A 4N6FA 3GU1A 3MSYA 2SFPA 4J5NA 4O1BA 4B5TA 3WENA 1A0CA 2CXEA 2VVNA 3ALGA 3SZ8A 3VDHA 4KWWA 4ATDA 1ECQA 4LCQA 4WGHA 4PUDA 1R3TA 1RD6A 4NP7A 3CS2A 3RMEA 3EPMA 1PZ1A 4R5EA 3WBWA 3R4IA 4I5XA 5CH9A 2DVXA 3QJAA 4GQ0A 3BOFA 2VMFA 2XVKA 2Y7FA 1R9XA 2R6OA 5A8QA 1VS1A 2XIIA 4S38A 3BJFA 3QKEA 3GBEA 3RLHA 4Z2LA 5D2WA 3GW3A 1FCVA 3VCCA 2VELA 4NILA 4DJDD 4WDWA 2OO0A 1M65A 3T4CA 1C91A 1J2BA 3B8TA 1XBVA 3GNXA 1PVNA 2XFYA 4J3WA 5CGMA 4F0KA 3HPZA 3SCOA 3LBOA 1PB0A 1WAWA 1VGAA 4ZQMA 2CIPA 3ONBA 4PTDA 2E5BA 3AMCA 1ONWA 3KHDA 1W2VA 3LMZA 4C7GA 4E5TA 1S2UA 1X8CA 3OU8A 1F74A 4ZOBA 4C1LA 2W66A 3OTRA 5DXYA 3T2QA 2CFFA 1WCGA 1WUEA 3S5NA 1NTHA 1LORA 4FX6M 2EF9A 4MNJA 3VGHA 4U3CA 2RJGA 3N04A 1YTEA 2PZNA 3TTYA 4UTFA 1B5TA 2H6RA 3WDHA 2X1UA 3INPA 1NY1A 3QKZA 1IIHA 1EJSC 2Y5EA 3PZOA 3WJSA 5AY7A 2J47A 4S2CA 4HBKA 1CIUA 2E6FA 3AU6A 4DZAA 3G1XA 2FZMA 3GTFA 2B7QA 4Z1AA 4YS1A 3SGZA 4RDWA 4M80A 1XLJA 3N17A 4JIEA 4CD8A 1CB7B 1PZ0A 3G8RA 3UR7A 2V3EA 3KCLA 1BXBA 3KRBA 3DC0A 4NXSA 1RXOB 4XUGA 4P8XA 4LNYA 5C9UA 3K1DA 1YW1A 1ZP4A 4LB4A 6REQA 2Z1VA 3CNYA 2NUWA 5CJNA 4CQBA 3RPMA 1TCDA 3WD1A 5A2AA 3W9ZA 1W9DM 2WW5A 3COTA 5LKYA 1P7TA 4XV0A 3SQSA 3RG6A 2G3IA 3VOFA 1N2VA 3CZLA 3S1VA 3EOLA 1KO0A 2WMGA 3OHMB 4C90A 1RBAA 1C3FA 3T7VA 4ZTYA 3BANA 1TSIA 2PWGA 3RPTA 4DF2A 3CO4A 5I3JA 1I4NA 3LCXA 1BRLB 2BHZA 3QV6A 1XDJA 5M17A 3CV6A 4G6CA 1A5OC 3B0UX 2PD9A 5CKSA 1VFTA 2V2DA 4HNNA 3SY1A 3V5FA 1X6NA 1IQ8A 4L4LA 3VC5A 1ZHAA 1R6WA 3GUGA 1XC4A 5BMWA 5AHLA 1R87A 1P6CA 3CUHA 4US5D 1UZDA 3RO6A 3NQEA 1ZJAA 4L80A 5HMSA 2GGIA 6A3HA 2O92A 5I0DA 2GDUA 2QV5A 4BQ4A 5BNKA 2HVMA 2R1PA 2REQB 1GVSA 4FNQA 4HGXA 5DMNA 1VCVA 3RCNA 3MTWA 4XUYA 1F2JA 4XIMA 4YCOA 1BQCA 3QBUA 1QBAA 3JZEA 4FNSA 2OZ0A 2ZZ7A 3FXYA 3GS6A 3KL3A 3UR2A 4WOZA 5H2ZA 2V67A 3B4YA 4V15A 3BG3A 1H1YA 3G6LA 1VZWA 4PGLA 3PTMA 1A4MA 2DIEA 1D3GA 4Z2IA 4FZIA 3CQ0A 2A3CA 4TMCA 2Z7GA 3M0IA 2FMOA 3O06A 2FFCA 2FVLA 2YLLA 3OVQA 1XLLA 4FF7A 3B0VC 3G0UA 1J6PA 4NG3A 3MUAA 3W1RA 2E3ZA 4O17A 3GIPA 3L4VA 1TJ2A 3TUUA 4GY7A 3VGEA 1EC8A 3BE7A 5FESA 1MSSA 1V77A 1U33A 3BGGA 2VRJA 2D69A 4KF1A 1ICQA 4YTTA 3W53A 1GKQA 1CEOA 4GQQA 3WQCA 1AFSA 1CBGA 1FWEC 2ACRA 3DFHA 3UZ5A 3AIBA 1S2VA 1EC9A 1FX6A 3GTNA 3QTPA 3TC7A 2WANA 4JTGA 4XG1A 3NZPA 1VENA 3WYZA 4HNCA 4XBJA 3C8NA 1R9YA 4CU8A 2FTYA 4WEVX 1N55A 3THAA 1PCKA 1VPYA 4ZB2A 2ZZ1A 1XIMA 3GXPA 3T78A 2CHOA 3VIPA 4ROPA 2PURA 4PCSA 4MYXA 3MANA 2IXVA 3WLQA 3CU2A 1VJSA 1LF1A 4HQVA 3UZZA 1DJNA 3OQEA 5K3VA 4MUZA 4I7WA 3IIOA 3DERA 4GUIA 3QGVA 2ZRWA 4LY4A 4ATLA 3HOJA 1B90A 3CHDA 4UOJA 4NKCA 1UH4A 2CLHA 7ENLA 1W37A 2PEVA 4DF1A 1P0EA 5A8OA 4OBSA 3VNZA 8XIMA 3RX2A 1VCFA 4MOZA 3B05A 4AYGA 1LBLA 2W9MA 2QGYA 2MNRA 2E6YA 1FHLA 4OUEA 1NJJA 2OO6A 3R10A 3B8DA 5FJRA 1N8IA 3AO0A 3U2OA 1E4LA 3AYRA 3HJEA 4KETA 1WPCA 3DBNA 4GXPA 3NCOA 3WMBA 1K77A 1DIDA 1TTIA 2GJRA 4U2ZA 2XINA 4L9XA 3BARA 3FSUA 4JN8A 5GPRA 3WK3A 1GUVA 3HIJA 4P7LA 3BMVA 2RGLA 3GG1A 3TYZA 3PZVA 2OKOA 4ZOEA 4NSBA 3FY1A 4O1FA 2XTKA 7TAAA 3FVMA 3W6MA 9RUBA 4DPQA 4JYDA 2GSJA 3G1YA 4E8GA 2XVGA 9XIMA 1FOBA 2WVTA 2BY3A 4OV9A 1F07A 5A6MA 1O60A 1BHGA 2CC0A 2JGQA 2I5QA 4K39A 2BZNA 4WDXA 3DYMA 2C79A 2GJNA 3F7JA 1E0UA 4Y6GA 1OWQA 1ZP3A 2XFRA 1WBJA 2ZE0A 5DCEA 2XFFA 1TV3A 3GH4A 5F2LA 3LBMA 1QI4A 3IUIA 2B7PA 2ZC8A 1FY6A 2XIOA 5KZMA 2QAPA 4GD0A 3BCJA 2P0OA 4ZXOA 2PCQA 2Z29A 3TIMA 3TK7A 2OQLA 1Q6DA 4HHPA 1GCYA 5AZ1A 2EKCA 3AYTA 1KXHA 3P81A 4UR9A 4UFJA 2ZX6A 1JI1A 3EOSA 3CUZA 3E96A 3NUKA 3WUFA 1E6RA 1QHPA 2XISA 1W9XA 3GSMA 1ISXA 1X7IA 1VBUA 1JG9A 2DQXA 1F6KA 2KX9A 1YE4A 3CT2A 1EGZA 2PWFA 1XL9A 4JQ1A 4K1WA 3RLUA 3N34A 4DO4A 1I2NA 1LOSA 2V2CA 2PP0A 2PTXA 1AW1A 1YRRA 4GVGA 3WFZA 3M1ZA 3MQTA 5T26A 3FNDA 3UGVA 1A5LC 5AYBA 1KV5A 3S6TA 1E6ZA 1XIEA 2GVGA 3T0BA 4QJ4B 3NQ6A 3WQ8A 3TLQA 5E9AA 2ZE3A 1JGMA 4BEUA 3KP0A 2VFGA 5CBJA 4H9VA 5G4WA 4AIOA 4DAFA 1WUFA 2QIWA 4RR4A 1BF6A 2VRQA 4UTTA 1LL6A 3IJQA 2E9MA 2V69A 4DZ5A 5C7HA 2ACSA 1BLIA 1R2RA 3EMQA 2BASA 3QXBA 5HBFA 3JR2A 1I9CB 2VNCA 5D37A 4MMWA 3CK5A 1J93A 1AD4A 2I56A 1XLKA 3CGTA 3N6QA 1WE5A 2B7NA 5FL0A 1FWCC 1B3ZA 2XH2A 4DHGA 4DWSC 2D1ZA 5FF7A 1O4UA 3BG9A 1J10A 4OQVA 2BOEX 3W7HA 2V81A 1O1HA 1L8NA 1W5MA 5DCBA 5EY5A 1WZLA 1ZLPA 3WK0A 2OU4A 3NFUA 1RAKA 3MWAA 4Z2GA 1G4EA 3LSCA 4H2HA 3AYVA 1JEZA 1T96A 2E6AA 1IE7C 3EWUA 3TU9A 3MHGA 5KINA 1XBXA 1ZL1A 5FKYA 3W74A 1A53A 2ONEA 1OFBA 2CERA 3W3OA 2GUYA 5G4HC 3S5YA 2XIQA 2BS9A 1GVYA 3LI0A 2I5IA 1VIWA 2VDIA 4MHBA 3TJ4A 3BQ5A 3K2GA 2XH0A 2OEJA 3VOCA 4WY0A 4CNUA 2BY0A 3AICA 4PMDA 2Y70A 1K7XA 1LBFA 1E56A 3PPCA 3GHRA 4KPLA 1EO5A 2CWNA 2JKPA 1F6YA 3L5LA 8CGTA 1ME7A 4XO7A 4WDTA 3C2VA 2ZCGA 2PTDA 4DYKA 1NAL1 4J4KA 4ZO8A 3N4FA 1F7BA 4TIMA 1DJHA 1M03A 3M16A 1HN1A 5KETA 2O56A 1ISYA 2PF8A 1CXHA 5CJ5A 3LD5A 2CW6A 4UFMA 3OP2A 3LCIA 1UBPC 1LWJA 4GC3A 1BQGA 4RZ4A 4WKFA 2EKGA 3H70A 2YSWA 3GTHA 5LYRA 3W24A 5C70A 3M07A 4PTVA 1BGGA 2FH6A 4RE0A 2Y85A 4D1IA 4KEVA 3GXMA 3ORWA 4O50A 4QISA 3QPYA 3B9EA 4NU7A 1BG9A 4N6EA 4H19A 4J3SA 3HF3A 1KFWA 4ZB5A 2BY1A 4AWUA 1LWIA 3ITLA 4PTXA 1JD9A 1GT8A 3PANA 3HZ3A 4O0QA 4DEFA 2TODA 5A8PA 1OYAA 2JKAA 3EXSA 3TE9A 3K30A 2YZRA 1TR1A 3H4GA 3VMOA 3MCMA 3U2ZA 4UMCA 1H7PA 2EPNA 3ENLA 4O1AA 1SFJA 4FI4A 2QJMA 2Y5SA 4Q7BA 3VOIA 1K6AA 1M6JA 4AD5A 1UD5A 5KITA 4KMQA 9XIAA 4IIFA 3M5YA 3TTQA 3S0CA 1QI5A 1A5UA 2RHGA 3AZSA 3USZA 4GQBA 2OLHA 3BC9A 2J8GA 4HZ7A 1WKYA 4PSRA 4LPCA 4AHQA 3POCA 1BEUA 2DSVA 3PUGA 4QJ3B 4AY8A 2AAMA 3WUGA 4HNVA 4DNHA 2D20A 4BFAA 4OFCA 3TV8A 4GIAA 3M6YA 3WBEA 3EX3A 5EFDA 3UR5A 4L56A 1QAPA 3GYEA 2FTPA 5M03A 3WQWA 3K4DA 4A3QA 4N9BA 3S1UA 3PNUA 5IHSA 1YBQB 2P3ZA 4DXXA 1UC5A 3BPWA 3UD6A 3GR7A 1ICSA 3DENA 2FFIA 3ICJA 3SEPA 3UCDA 1HT6A 3OHIA 2X7WA 3GTXA 4NZ1A 3N15A 1CECA 2F7FA 3L21A 1RJQA 5CZ0A 2Z1BA 5K9XA 3ITTA 3PBUA 3L23A 2O9RA 4M5PA 4S3CA 1W54A 2YW3A 1EX5A 4BKNA 4JN7A 4LAOA 1OFEA 1G7UA 1GYNA 4TTGA 1EXPA 1M04A 2V0TA 4JIQA 3ID7A 1CZ1A 1YYAA 2PDJA 3AHVA 1X39A 4YJ5A 4LYPA 1HFBA 2YCEA 4ACZB 3ES7A 3WUEA 1WDSA 1PIFA 3NQCA 1PTGA 3W83A 1BFNA 2YA0A 3SCUA 1OX6A 5K4ZA 2VHLA 2VI0A 3KRUA 3WQFA 2HNHA 4D6JA 4A8NA 3TZNA 2DV0A 2JIWA 2DZTA 2QYGA 2VD9A 4L64A 4B4FA 5JBEA 2X0SA 3IJLA 4TU1A 3CZKA 2ZA2A 5C2XA 4DYJA 1CCWB 4AIEA 3V36A 5A6KA 2HE5A 1JZ5A 4C6IA 4Q8UA 1SVDA 2YCKX 4NUWA 3VGFA 4TV5A 2IQDA 2GGGA 4NJKA 2Z28A 4B16A 1BSIA 2HPMA 1K9TA 3T8LA 4GUJA 2BHYA 2WSYA 3GHSA 2UBPC 2VENA 2O9PA 1M5WA 2DP3A 1ZB5A 5C9WA 1FWWA 3BMXA 1BWKA 3CHEA 1CNVA 1GVOA 1R7OA 4GIYA 4IF2A 4TX9A 4DZIA 1ZCOA 3G1RA 4H6RA 2E1WA 3F5JA 2FDMA 3TQ0A 2H3DA 1J9YA 2VUYA 4AY1A 4GNJA 4FF5A 1EXBA 3GU2A 3TYEA 1H61A 3CQKA 2DT0A 4H9YA 4NJJA 1O5XA 5CPQA 4AEFA 2E5DA 2DGAA 4HHMA 1PDYA 3R7MA 3CHFA 3NM3A 4O57A 3CLWA 5CZSA 1E15A 2GK1A 3Q4DA 1E71M 5DRIA 4MNLA 1WZKA 1FDYA 3CV1A 7ODCA 2V63A 3FW6A 1O5KA 2RAGA 1W6TA 2E8ZA 2GSEA 2ICSA 2WVVB 3EGJA 2WNQA 5TAOA 3MDWA 3O15A 3DHDA 4L9ZA 1H51A 1O94A 3WLKX 2ZXQA 1XYCA 2A7RA 1TJRA 4HU4A 1E3ZA 1UR0A 3GH7A 2OYMA 3QGKC 4RDVA 3UZJA 4F2TA 4S3AA 1KR0A 2OGJA 4GA8A 1XC6A 4MFEA 1R7AA 1UBSA 2J79A 4JNMA 4AG0A 1OZQA 4FNUA 2CWXA 1OK6A 2GVYA 4ATWA 4ZQOA 4KH2A 4WD0A 3PZIA 4Y96A 1OEPA 4F0SA 4CQCA 3GC4A 2J7GA 3CL6A 4GKLA 1EP1A 3VDBA 1CXKA 1AODA 1Q7MA 3EWWA 1E6NA 2GOKA 2QUTA 3HN3A 5LA2A 1LT8A 3FOKA 3VAVA 3BAWA 2AMXA 3FJ6A 4FX8A 2J75A 5D33A 3GNPA 3LYEA 5FF4A 4H9XA 3D46A 3O1NA 4O14A 4PODA 2WJEA 1M7XA 4MSSA 3PJXA 1C90A 4UTWC 5CQ1A 1KKOA 3VUSA 4YIWA 3N19B 5A3HA 2R9RA 4WZHA 2DJXA 3HQOA 1Z7AA 3H8AA 5T9BG 1I6NA 2EO7A 2PP3A 1HL2A 3LI1A 1TFVA 4QP0A 4NYYA 2QMKA 1EJRC 5XINA 3ZR4A 4PH6A 1VBJA 1XG3A 3S8HA 3BCDA 3ARZA 1VHNA 4NF7A 3L2LA 2QDHA 3HQ1A 2OEMA 2CXGA 3UERA 1MFVA 1Z48A 4B3ZA 3B0PA 3VD7A 1KKRA 5D2XA 2VOMA 4GKTA 4AU0A 1EUAA 5J5RA 4HB7A 2VX7A 4QSFA 2ZICA 3GAKA 2UZ9A 1P0DA 9CGTA 3WEZA 2MUCA 6TIMA 3PS7A 1KCZA 3CAWA 2INFA 2Y8UA 3HPAA 3HFTA 4DJEA 1ZZMA 1W56A 2QJIA 4RW3A 2HJPA 4H6KA 3BAIA 2WM0A 3PJUA 3FYYA 2WMJA 1UG6A 3BJTA 3OYZA 1DIKA 1E55A 2PPGA 1RSCA 3FAXA 4WF7A 3KOXA 1UMLA 2R91A 4MZYA 2DZSA 3GFXA 5BRPA 1JDDA 3AZTA 4MDPA 3C86A 2Q8ZA 2VTFA 4ZO9A 3UR8A 3NL2A 3TAKA 3SGGA 4LAKA 3WFLA 2X1TA 1K8YA 2HTMA 3IIVA 1Q4WA 3ZOAA 2ZVRA 4IMEA 1DIOA 3EB2A 5HULA 3LLFA 4XTIA 1TWIA 4RCXA 5DQPA 4K2SA 3BLOA 2RDWA 3KS5A 1F73A 2J66A 3MUY1 1UQYA 1DKWA 2ZZ2A 3BUVA 5D2TA 2KZHA 4K6AA 3HMCA 1J18A 4DUVA 2ALRA 5MF5A 2FPYA 5TIMA 3LM7A 2YDSA 3TN5A 4O19A 1TVPA 2YKKA 4YWSA 3RJXA 1G9HA 2GOUA 2QPSA 4XX6A 4AYSA 3EAUA 3KTSA 3GG7A 3N25A 3VD4A 5AC4A 2JEPA 2E67A 1NQ6A 2QCGA 2Y61A 2BFGA 2XWEA 1JUBA 5IFTA 4EXBA 2VZTA 4IPLA 1W3IA 2FVMA 1P43A 3F4DA 3N2CA 4PEEA 3WSUA 5BXPA 3T8QA 3BAYA 1Q65A 3B9OA 4PB4A 4U33A 3M5ZA 3SADA 2YA2A 3VM5A 4LFYA 4KRTA 3SUWA 2QJHA 4X22A 3UZXA 4GGBA 1UA7A 1FHDA 3N3MA 3WH7A 4EAMA 2V5BA 1L0PA 4O53A 3BO9A 4HZMA 4ZFMA 2BOFX 4K38A 4TO8A 4MWAC 3S6OA 1VYSX 2NXGA 2MANA 1REQA 5C7VA 4IICA 1IT7A 3N6JA 4UQEA 4R27A 4Y9MA 3SY8A 3GNNA 4XD6A 2BBFA 3DG3A 3N1AA 1TB3A 4FXSA 2ZZ3A 4N2YA 4MY9A 3QHMA 3BOLA 3FJ4A 1OT1A 2WC7A 2PWEA 3W7JA 2VJXA 3AJXA 5J04A 1HL8A 3MVIA 1R3SA 3CB8A 1O5RA 4KGJA 1CGYA 3QC3A 4GQRA 2I9UA 4XO6A 3UYCA 1XRTA 2EPOA 1HTIA 5KZ6A 3OVPA 3AWOA 1SFSA 3PBMA 1J96A 3KBVA 4PTMA 4F3HA 1GYLA 7REQA 1JGIA 3RRXA 3FLUA 3W2JA 1LL4A 4GISA 2ZTJA 3UEQA 3W27A 2ZKMX 4CQ9A 2YLAA 1OADA 3MMDA 3TWAA 2BGSA 1EGMA 4ZGYA 2J7BA 1H5VA 4BR1A 2XGZA 3GRIA 3THQA 2E68A 3SQMA 1WOAA 1LRTA 1SZFA 1Z44A 4JTLA 1B9BA 3NO5A 4FOKA 4J3ZA 4TXEA 4JTIA 4ZZ9A 4NT0A 3VZYA 5HR6A 1GKPA 4RK8A 5A8MA 1H4PA 4NNAA 4JL1A 2Z2BA 4D6GA 2QQ6A 4MY1A 4AZIA 3EXRA 4HN8A 1UR1A 5G1MA 4RZBA 1UWRA 1XV8A 1R3RA 2C0AA 4NZJA 4I3GA 1UW9A 2VGIA 4IZGA 4MYAA 2QVHA 4TTUA 2F2KA 3FAWA 4GHRA 3DYPA 3NOEA 2P1FA 1JFXA 4QG9A 3T2OA 2J7DA 3VC6A 1AJ2A 5E0CA 3AYSA 5HR7A 3KWXA 4IXXA 3GZ3A 3WLIA 2WZEA 3PHAA 3PUEA 3TOPA 1P0BA 1MQPA 1OX4A 4DXKA 1Z6KA 4GZIA 4UQBA 1L6GA 3DCPA 1Q6GA 5ECVA 2VQTA 1XLMA 4PTWA 3LCFA 1UOZA 3EDKA 1TIMA 3RYSA 1L9WA 1JVNA 2I7GA 3ZJKA 1KWKA 3GBDA 3PC0A 3EX4A 1OFDA 4I9AA 3VKKA 5D4YA 1G4SA 3W1NA 5EMMA 4PCFA 1LP6A 3D47A 4RV3A 4AUBA 4BJHA 4HU0A 1YDNA 3L65A 3C8FA 1HUVA 1DJWA 1JIBA 4LSBA 1QOXA 1GWJA 4UQAA 4IQJA 4E2OA 1XUUA 3BMWA 3ARWA 3TC6A 4P61A 4ADTA 1EX1A 5GJMA 4JTEA 1M7OA 1T5AA 3NM1A 3SR7A 3W26A 2OCZA 1HKWA 4WX2A 2UY2A 1W5PA 3I68A 1FH8A 3MZ2A 3MMUA 3ERPA 4I6KA 3FA4A 3H55A 2C14A 1K9DA 1UWAA 2R14A 4RUBA 2DSWA 4B91A 3ZXWA 4F48A 3MT1A 1IR2A 4GABA 3VNJA 2W79A 4HPHA 1U83A 4ZODA 3UP8A 1A5SA 5FEZA 3EEGA 4FOUA 1PEZA 4AZGA 1CXIA 3L5MA 3VXGA 4Z2HA 4C7DA 4X3ZA 1YDOA 5D09A 3F03K 2ESCA 3WK1A 2YW4A 4XZNX 1TVNA 4PEKA 3IIXA 4LEQA 3WLTA 1GW1A 4DLMA 2VC6A 4PUEA 5F2GA 3SRFA 1AQMA 4M8UA 2PGEA 2IW0A 1J11A 4IMDA 2YL6A 1QR7A 1L6YA 1GQIA 1GPWA 2F9RA 3ZLHA 4G1NA 2ZZ5A 3SI9A 4PUMA 4IIBA 5M5DA 1KM5A 3W00A 3PPGA 8XIAA 4AD4A 4P2VA 3SSZA 4LRSA 1NWRA 3TR9A 1XDMA 2VFFA 3GLCA 3LZ5A 3RM8A 3UU0A 4AZCA 4TVCA 3W7KA 3KZSA 2XH4A 2D0HA 4KWSA 3TJLA 1GG0A 3SN4A 5EMYA 1JQXA 3M4HA 5HQLA 4CLMA 3DFNA 1B3WA 2OZ3A 3FX4A 3FEQA 1FWBC 1JYWA 1R2SA 4L1GA 4QDMA 3ATYA 3E5PA 5AYIA 2GUBA 3ZWTA 2HXTA 2EQDA 1KGUA 4QAIA 4UB9A 3N9KA 4ZOAA 3CUIA 3P3BA 3EWBX 1CLXA 4PCNA 5TBOA 3UT0A 2TAAA 1FDJA 3KUMA 1FWJC 4XSMA 2WM1A 1QI0A 5DT7A 1E9ZB 4NASA 5EGRA 4IX2A 4DJED 3HV9A 1FWRA 4LALA 1JJKA 5A5WA 1G5AA 1K9EA 3ATZA 5CPLA 1A3HA 1S3HA 3OZPA 1KBJA 2NLYA 1MWOA 3IJ9A 1S5VA 2J6VA 3PZNA 1NP0A 4IGNA 1ZNNA 4JTHA 2X42A 3HBLA 1L2QA 2CZVA 1E70M 1C8XA 3NDOA 3W02A 1L2UA 3UPWA 3LXAA 3OZYA 3SDOA 5HUOA 3W1XA 3SSJA 4X9YA 1GW9A 4GZJA 4Q4QA 3MSRA 3DKLA 1MRQA 2HK1A 1MQRA 4OIFA 4YTUA 2WJFA 2BNJA 1A80A 3NXFA 4PRWA 1VBGA 4FXFA 3LTYA 3V0TA 4O4WA 1T8QA 1XF0A 4Q8VA 3TVAA 5EMLA 3UVIA 4PE8A 1ZQ5A 3F4VA 5BXRA 2A85A 4UFKA 3D3FA 1AQFA 3CZGA 4AZHA 1QNPA 3T9PA 1LLWA 2F6XA 3LK6A 5BXSA 5K4XA 4QS6A 5EA9A 1KM6A 1JZ7A 3ANYA 5AKQA 3CAKA 5GVJA 1HKJA 1V6YA 2PBOA 1TVLA 3AXIA 3SQLA 2IUZA 4B9YA 2PWHA 2Z25A 2XSBA 5HDRA 3HJZA 2FTWA 4GXMA 4QE1A 3H2FA 2GQAA 3HV8A 3AUOA 3FVDA 5HMFA 2GWNA 2PGRA 3UJFA 4D9PA 2RDXA 5FJTA 1XDLA 3DOPA 2QCHA 3SJNA 1GQJA 5A2BA 3W72A 1M3UA 2C18A 2VWTA 1TMQA 4OOZA 1ADDA 1JAEA 1RZMA 3TROA 3BL3A 3TJIA 3U4FA 3BH4A 1F76A 1OY0A 4GYJA 3G0XA 3CQJA 4IQEA 1DHPA 1J8VA 1BTCA 4EX4A 4CU6A 2J62A 4DJDC 3PBWA 5LXEA 5DEZA 4WCJA 4TVUA 4XZ9A 1DV7A 3WJXA 2WBKA 3OBEA 2J7FA 1YXCA 3BLKA 3CH9A 2BHUA 3QN3A 4I9JA 2QUNA 2E25A 2P53A 2J13A 1CGVA 2VEGA 3XISA 4R7OA 4AC1X 3G22A 1QNVA 4LYRA 1IZKA 1LZOA 1XYLA 4CN1A 4A29A 2E28A 2ZOXA 1AZ2A 4Q7IA 1ECEA 4H2CA 1FUYA 4DLFA 4W7UA 3UNDA 1MW1A 1UHVA 4AW7A 3N3TA 3GVWA 4LUJA 4ZQPA 1DQXA 3I3DA 3DI1A 3BW2A 4CEUC 5G1TA 4PL2A 2OZ8A 4MUPA 4YLWA 5XIMA 1SQ7A 5I2UA 1TA3B 3BAJA 3PVFA 1J6OA 3KVMA 5LZLA 4JFTA 4WDUA 4IUOA 2PD5A 3TYAA 1KFCA 3UY8A 4RE2A 5DO8A 4L61A 1UKSA 1XICA 5AYZA 5DY3A 3GKFA 4FLOA 4Y8FA 2YB1A 2VKZG 1X98A 1YTKA 4ONVA 3EA2A 1EHAA 1AK5A 1IEWA 2Z6IA 3BSHA 3N2XA 3GVGA 2QNEA 2ZX5A 1X1OA 2ZUMA 4WK9A 3QF0A 2A3BA 3W75A 4LEFA 3FJNA 4C6DA 4YL2A 3FHQA 4P7OA 3QY8A 4Y8EA 2E09A 2P88A 6CGTA 4JICA 2OMAA 2PP1A 1H0GA 5LNWA 4KFNA 4MKSA 3QPZA 3SRHA 1KFJA 1E1CA 3WF2A 3VD5A 2QCLA 2JALA 1OGBA 1TPH1 1A5AA 1CXEA 1H3GA 5CPSA 1B2YA 4AWTA 4MF4A 4EXAA 3AFBA 5JU6A 4PA8A 3WQPA 3MO7A 5EMKA 3GXNA 4A8RA 2HE8A 3ALFA 2BWGA 1HJWA 1SO4A 1N8FA 4HHHA 1V6UA 4K3ZA 4PMJA 5G2HA 2P10A 1H7XA 3QGAC 2EXOA 1KM4A 2NWSA 2QF7A 4IGSA 1CLKA 2JF7A 3L9CA 4W93A 3R25A 4MPKA 1EZ2A 4HTBA 1TWZA 1S2WA 2EG6A 1WNOA 1DYSA 2QLYA 5EBUA 2NW0A 3RFAA 1HKMA 1OX5A 4XZMX 3USBA 2QDDA 3LLDA 1IEQA 1QPOA 3MW7A 3WG6A 1XLIA 2QUMA 3VIKA 1YNYA 1RJRA 3GZAA 4DO6A 2WAGA 2WYSA 4F2BA 1EH9A 2AL1A 3OBAA 3QMTA 4DNMA 3KBNA 3R0DA 3WLHA 3Q67A 4AD3A 1QU4A 2IPFA 1PTAA 2ABBA 2RH9A 3LENA 3DXIA 2Z1KA 2PRLA 3CV7A 4KCVA 1J0ZA 4UC5A 1DWHM 1K4GA 1XCWA 1Q45A 4QEEA 4W87A 2VDHA 1AW5A 4QG8A 4BQ3A 3PSVA 1PV8A 1X1NA 3MS8A 3A47A 3ZO9A 4UXDA 2PDYA 3FYPA 1AH3A 4KW2A 1BG4A 2ATMA 4U28A 1FWAC 2BXZA 5IFPA 2JBMA 3A22A 5CJMA 2VFIA 2PU1A 1VAHA 2ZUNA 5K9CA 3C0QA 3WMSA 4H6QA 5DMLA 1I1XA 1THFD 3MUCA 2YXOA 1HQTA 5DLCA 3KFTA 3R89A 4M19A 2Y6ZA 2E7FA 2C71A 4CQAA 3G1HA 2A2IA 1XR2A 1TPB1 2F61A 4R7JA 3R6IA 2J9XA 3DAQA 4KEUA 3APTA 4UZSA 3F5LA 3LCLA 1HGWA 3W29A 3OVRA 5GQBA 2B7OA 4Q6JA 1JUKA 2RKXA 1IGSA 4BQ5A 4BWLA 2CKRA 4IP5A 4DQWA 2PGFA 3GNOA 3BXWA 1OSEA 1IWPA 1TO3A 3VGDA 2ZWYA 3GR4A 3LV5A 3URBA 3WF0A 2ZZ6A 1YIXA 1B3VA 3VOHA 3ZJ6A 2JF6A 4I90A 3IGXA 1E1CB 4HKPA 3WBXA 4PULA 2X7VA 4U10A 4GYKA 4QSHA 5I23A 1TPVA 5AHEA 3QW3A 3OGRA 2J77A 2V3FA 1QPKA 3EA3A 4W9TA 1XW8A 1KLZA 3GDTA 1W3JA 3W6LA 2PC8A 4N9CA 3T08A 2Z2AA 4R53A 3KL0A 4JQ3A 2Z24A 1W1ZA 3W1QA 2YBVA 1RP9A 1ZRQA 3SCVA 4HVXA 2VUNA 2HS6A 2P76A 1NP2A 4NJHA 3MP5A 1S2TA 4DI9A 4Q4MA 2Z00A 4MGGA 1H7RA 3MUXA 3LHYA 4Q8WA 2GGJA 2J4GA 1SUXA 3PG9A 3OOQA 4NNBA 1GPFA 2A5HA 1PDZA 4CCEA 4CU7A 2XZ7A 3KEHA 3GO2A 4Y7EA 2POZA 1ZTVA 1TQJA 4O15A 5ABFA 4IPNB 1XWYA 1P6WA 5I09A 1P1MA 3H2NA 1NELA 1S1RA 2OR2A 1BYCA 4KIEA 1SW3A 2X41A 2Q01A 3VCNA 3N9SA 3PBYA 1R0MA 2ASHA 3RCMA 2F2HA 2G0WA 1UUQA 1D7FA 1ITCA 3I4KA 4AMAA 1RBOB 1VD6A 1SZGA 4PMOA 4Z0SA 4AH7A 1XUZA 1D8WA 3L0GA 1GJWA 1WKFA 1LOQA 1RPXA 3CMJA 3STFA 4LUTB 3ITOA 1EHNA 4FNRA 1E51A 2V5LA 4HK7A 2ZWZA 3DESA 3V3WA 4GI8A 2GPTA 1K70A 3L2IA 3WKZA 4TQTA 1JFHA 3VOJA 2V82A 4EP8C 4F0RA 5HNTA 2FB3A 3WFAA 2HRWA 1W3NA 4J1OA 3SBFA 3C2RA 1JPIA 3QQ1A 4JTJA 4W85A 3TX9A 1WDRA 3VI2A 4QM1A 7A3HA 1J0KA 4JPGA 3OZOA 3KOYA 4GUHA 2DZXA 4B90A 1QJWA 1OGSA 3CPUA 1JRCA 2PWDA 2VX6A 3U57A 1OZMA 3CL7A 2V9DA 1EF2A 1EDTA 3N13A 1SO3A 1E6QM 4GE8A 4XZLX 2OVLA 3H24A 2B0MA 3IGUA 5H91A 4AC7C 3DHFA 4H00A 5BCAA 3BW4A 3HG4A 5CAHA 1J4EA 4LANA 1PZ2A 1E9YB 4D6DA 4M56A 1JDAA 1FXPA 3ARSA 1B3XA 4A3HA 3WO8A 3KE0A 4UTMA 4YPJA 3KBMA 1PWMA 1C29A 3AZRA 3B06A 2ZA3A 3LTPA 1QPQA 1QASA 4DN1A 4AVOA 4N02A 3CV2A 1AW2A 2QPUA 4FNPA 1TV8A 4HPJA 5LNUA 1JZ6A 2QJJA 1XYZA 2EEXA 4CQDA 2DUAA 5JUVA 1WQ5A 2ATSA 3CEUA 3IJDA 4OT7A 4KCTA 4DBDA 1DE6A 3CMFA 3WELA 4LXFA 4DWSB 2CITA 1QOQA 1VEPA 4RXFA 3NXLA 3S1WA 1XPGA 4KWVA 5D38A 3KCOA 3TKFA 1XD0A 1GKRA 1PIIA 1R3QA 4E38A 2J9YA 3BAKA 1LBMA 4KRUA 2C6QA 4QQUA 1TIWA 1WYIA 2FH8A 5CCZA 1Q6CA 4ICNA 5KTLA 5A8NA 5MKGA 4UTKA 3FSTA 1MXSA 4E3TA 3EB3A 1V8EA 1XLEA 2GVJA 3BSMA 1BWVA 3NO1A 4P5UA 3ONCA 3O16A 2A3LA 4AWSA 2HEJA 3NVDA 2ZX9A 5ABFB 2F84A 2EPMX 3T55A 4GUFA 4YU1A 3GDMA 6XIMA 5HJYA 1V0MA 4A8IA 2R82A 1KXTA 2NUYA 5BROA 3W7DA 3UWQA 4D6CA 2FPVA 4H7ZA 2Y1HA 3ABXA 1DWGM 1XBZA 4HSNA 4TX6A 1KR1A 1TX0A 3UCCA 5KEZA 4GJIA 1RV8A 4ZQCA 1ISVA 1SFTA 4ECLA 3K5XA 2W67A 2WQPA 3CPRA 4XVEA 2A3HA 3MCNA 4UUIA 3PPHA 4GQGA 2VR5A 2CLLA 5C54A 5KZEA 1BGAA 3TW7A 4LU0A 4NZ5A 3BLEA 4H8VA 4GACA 1X6LA 2ZRYA 3DI0A 3V1PA 2PE4A 1A5NC 4E4FA 1W2PA 4RLIA 1F9CA 5A6TC 2ABAA 3AHYA 4B2DA 1OGGA 3LPOA 2FQIA 4ES4A 3YPIA 1EJXC 2DZPA 1XH1A 4IL2A 4C6JA 4JQ4A 5DMYA 3LY0A 3TA9A 1C8QA 3SY5A 2GZXA 2CBVA 3MBFA 2Q02A 1HX0A 3ZQ9A 3WY1A 1OIFA 2PUZA 2Q71A 4UFLA 2W92A 3NWRA 4LV9A 4IUGA 4J7RA 4X2PA 1VEOA 2VFEA 1CT5A 4RNIA 5GJNA 5FSEC 5CLWA 5A6SA 4UTHA 1FCQA 1RVGA 4IMCA 4RKAA 1ML1A 3EPOA 3HQNA 4HK5A 4PYSA 1JAKA 3O0KA 6PTDA 3D0CA 4Z1CA 1XGZA 1Z3NA 3GDBA 4QCEA 1W9UA 5MHBA 1H62A 3O7UA 4L4MA 4L4PA 1DHKA 3CAQA 2NQ9A 3H7RA 1SJDA 3LUTA 1VCGA 3S5ZA 3B9NA 4Y9PA 4P7NA 5CAKA 3UWUA 3RLVA 4OVXA 1MI3A 4JXCA 4A22A 1NFPA 5AHMA 3W7EA 3B40A 4KEMA 4ACYA 1HL9A 4QQ3A 1HO4A 2QCDB 4GCXA 2AGKA 5TF0A 3UWEA 4ZSUA 5LNVA 3WEMA 4LT9A 4OJYA 4NL1A 5E70A 3VFLA 3U5UA 1Q6RA 3VNLA 3ZT7A 2XYLA 1O7AA 2VOTA 2JK2A 1YPXA 2ZQ0A 4TMBA 3HMJG 3WF3A 1GTHA 3GK0A 4YTSA 1F8MA 1KRBC 1FKWA 4DUOA 1GYMA 3MSDA 2CLFA 3G3MA 2QUVA 4X60A 1SU5A 4G7EA 4E2VA 5LHEA 4A2RA 3MC5A 4GBUA 3L4TA 3GDKA 1AH0A 2EPHA 4C6PA 2FVKA 1ZFJA 2FGZA 3SCQA 2O7SA 5HNNA 4M7TA 1ICPA 3GR8A 3SUVA 3RJYA 3KHJA 3QV8A 2J9ZA 2B81A 4O4VA 1KD0A 2OX4A 5GJPA 2OQYA 3KX6A 4GY1A 5BOEA 3N9RA 2E77A 3C56A 2NLIA 1YEYA 1G4PA 2HBXA 1GVQA 4AVFA 4M3PA 5IDIA 5A8GA 3JZUA 5F1VA 3LTSA 5FJIA 3NQ8A 1J79A 3A21A 3QEZA 4KKXA 3SCWA 4H04A 1FWSA 4CNNA 3E6EA 1ONEA 4O0KA 2QF8A 1UKTA 5BW6A 4GYPA 4PUNA 4LUSA 5K9DA 3W76A 3SUTA 4HK6A 4D8ZA 3JW7A 3EKGA 2A0NA 4RNFA 5C9ZA 3CUXA 1UWSA 4B5NA 4C7FA 3W38A 4U2YA 3E3HA 1XFBA 3NGFA 3NQMA 2Z1SA 3W86A 1OVDA 3DHUA 3ZT6A 2I57A 3VDAA 3GB6A 1BRLA 3BG5A 3E02A 3LG3A 3P61A 4IGMA 4XKMA 3G6MA 2I1OA 3C4UA 4U3AA 3NL6A 2J74A 1XJBA 1F05A 2J8FA 3LRKA 4QDPA 2ZADA 3K8LA 4WOQA 3CO8A 2BG5A 5HQMA 4AWEA 3HTWA 3WEOA 3G0SA 3U4AA 1XISA 4DBSA 3OVGA 2VZUA 1ZBWA 4HA1A 5E6YA 4MKNA 2ZX7A 4JX4A 1JCMP 1UD3A 2GJXB 1DWFM 3MP4A 5I3DA 8RUCA 1W1IE 3F4CA 1R46A 1KBKA 4GO8A 2D2HA 4EWND 3AQUA 2REQA 1QHOA 2VC7A 5F4SA 1K02A 3N2MA 2PDCA 4KRZA 3I7SA 3TP4A 4MLJA 3IEBA 3P62A 4O12A 1TV2A 1ZGDA 3W7NA 2D24A 3W81A 5AZ0A 1DBTA 5CPOA 3N73A 2OT1A 2RFGA 2J6XA 5AHFA 3LS9A 2E1DA 2VURA 1C8VA 4AXNA 4M0XA 2AL2A 3MV01 3WQVA 4QCFA 5G5IA 1MNZA 2Y24A 3E0WA 2YDQA 4G7EB 5BOFA 1AJ0A 2DY3A 2PDWA 1UMYA 4MTVA 2QIIA 4DBUA 1TRIA 3RO8A 5EMJA 2ZRUA 4X63A 2E9BA 2Y0FA 3PJWA 3NDZA 3PBVA 1W9BM 1IHIA 3GH5A 1V7AA 2A4AA 2YCLA 4FMVA 4S39A 4ZO6A 3W37A 4XD5A 4JN6A 5HWNA 3VILA 1W5NA 3OGSA 5B7ZA 1SPQA 3IK4A 3W1PA 3DHPA 1UP2A 2WOQA 3QFEA 1BYBA 3WF1A 1GQKA 5AC7A 3BZJA 1FRBA 3MI3A 3TA6A 5LA0A 4DUXA 3L0KA 1S5TA 1UZ1A 2UY4A 4F8XA 5I3HA 1JNEA 2ZRZA 2A3EA 4B15A 4Z1DA 1V3MA 3FN9A 2J7EA 1CENA 3HG3A 3WNOA 3AWNA 3PNZA 5FIPA 4PMZA 4PSPA 1Z8AA 1E5NA 5AB3A 4UTTC 3WH8A 4WY0F 3P74A 2PDKA 2C91A 4QGCA 5HWJA 1U5HA 4QRNA 1V3IA 3GIYA 5L9FA 1HF6A 1XLAA 1K8CA 4E4UA 4LUSB 1FP9A 2VC9A 3Q94A 3KBSA 3HGOA 1YPIA 4G1KA 1FCBA 2Z7KA 4PUWA 2A6NA 3P84A 4GINA 4M81A 5AFDA 4XKYB 7PTDA 3MSGA 1LDCA 4M29A 5D02A 1PKLA 1YADA 4MPQA 5IBXA 4ZOCA 3EMCA 2NSOA 4V27A 3DGBA 2OG9A 4F0MA 4B92A 3PZ9A 1PHWA 2NX3A 1VH7A 3LXBA 1X1ZA 5HNRA 2J8TA 4QJ5B 1GNXA 3L68A 4GVFA 3PP7A 1W1PA 3G2GA 2OSYA 4IP7A 4RW5A 1XSJA 4F4RA 3CLMA 1ZBKA 2J27A 3GAYA 2C1HA 1HKVA 3KZPA 2H90A 2OSWA 1V51A 1FHVA 2PU0A 2WZHA 2WHKA 2ZUSA 3PBGA 3W85A 5EFFA 1HJQA 3V7PA 1PKMA 4EPEC 1FKXA 4Z17A 4INFA 4J2PA 4U5KA 1GONA 1MEHA 3BV7A 1W1YA 5CPTA 1G67A 4OTKA 2WCSA 3PB0A 3FCPA 3S2CA 2NZLA 1ZAHA 3NEVA 3QR1A 3RILA 4G8TA 1OCJA 1VC4A 2V30A 1V7YA 4HZ6A 2VZVA 2W3ZA 4C6FA 1HGYA 3C6CA 2AL2B 4MJ2A 3RU8X 3W01A 3A6OA 4QFUA 4QLKA 3SCRA 2G95A 4LRTA 1A5BA 2VXNA 1MXDA 3SECA 2P5NA 1IEXA 3AMDA 3MJMA 3TSBA 4PN2A 3I10A 3EMZA 1HNYA 1UKPA 4HA0A 2GL5A 3O2LA 1XSKA 4GH1A 1UD8A 4IIGA 4JTUA 4B9ZA 4HD5A 3R58A 5DBTA 5J5DA 4Q7NA 2YCLB 1X38A 3NQ7A 3LZ3A 4JFVA 1UYQA 3WMCA 3N2OA 3UPMA 3TSMA 2ZTKA 3QW4B 1VP5A 1ODZA 1BKHA 4C5ZA 1VHCA 5G1YA 1B31A 1XLDA 4C6NA 4AF0B 4JNZA 2BXYA 3CBWA 4WXZA 4UTUA 3O6CA 1BF2A 4ERIA 2HVOA 4K8GA 4EPKA 4S1FA 4IQDA 4AIBA 1UPMB 5A69A 1Q13A 1OFPA 2AQWA 1VPXA 1P0NA 3CB3A 5AN7A 4PMQA 4MWAB 1O95A 1S1PA 1U5JA 1BD0A 5B7YA 2WSKA 1QI3A 5DT5A 1LCOA 4TR9A 3APYA 2XVPA 2QHAA 4U5IA 4NAFB 2QCEA 3CH0A 3AS2A 4AY7A 4S3GA 3U7VA 2UY3A 1TKKA 3A4JA 1JNDA 2IQTA 1W32A 3GUWA 4MDOA 4HCLA 4YN5A 3SCPA 2OLAA 3THUA 3U2EA 4CVWA 1VR6A 3U5YA 3TOYA 1GOOA 5CBBA 1FWNA 3JU2A 3KS6A 1UUMA 2WPBA 5AHNA 4MIMA 2ZIDA 3LGEA 1S46A 5HXMA 3SIZA 4DAIA 5AOUA 2BVYA 1Y5WA 2OZTA 4H41A 5GNYA 4ZMGA 1E72M 3UFYA 1OHLA 2QKFA 4A3YA 4GO9A 4QNEA 3DIPA 4HOXA 2JEQA 1RD5A 4EKJA 2P0IA 4RZ6A 2NVDA 5DELA 4WJXA 1PWLA 1VEMA 3KDOA 2DSZA 5K2ZA 3EA1A 3GDRA 5LIXX 4C91A 3TC3A 3J7HA 3OLDA 4Q4OA 3K8KA 3TFXA 1KFEA 1UKQA 3WLRA 1UWTA 2Y7GA 1Z89A 2XWDA 3V0UA 1NU5A 2VX4A 4Q4SA 1QHZA 4RJEA 2DT3A 1TPEA 2QCMA 1IZJA 3BVJA 1ZJHA 4GZ7A 4M1RA 2DT2A 1XGDA 3N4EA 2BTMA 2XN2A 3P0XA 2GJLA 2UV8G 2WVSA 1RJPA 5HANA 3QTGA 3LX9A 3W88A 2XSXA 3UWVA 1JPDX 3WUBA 3P14A 1XKYA 2TSYA 1PBGA 2VT0A 4JS3A 1CGWA 3POHA 1E73M 5F7UA 5CSYA 5F2IA 5BZAA 2QPXA 2DW6A 4HMNA 3A4XA 3SGUA 2DZUA 3OGVA 3A9BA 2PBGA 4NJIA 5JIWA 1RQHA 4HU8A 5FEPA 4O52A 2NSXA 4EOUA 3LM3A 2NWRA 3M46A 2LLEA 1E4NA 2Z2UA 3OQ8A 4HPGA 1IWBA 4WUIA 4HNUA 1HKIA 1C8YA 2PDIA 3MJYA 1W1B1 1OC6A 1FWFC 1IWAA 4RE4A 1SM9A 1SZEA 3FGCA 5EL1A 1XIJA 3T0DA 4A6GA 2W63A 4LCSA 5CGTA 4POCA 3H4XA 1ZAIA 5FF3A 4J35A 1OG0A 3T6CA 3GHUA 1NWTA 3VIOA 1EWDA 1LLOA 1E9IA 2YZ5A 3AXXA 3S4TA 4K37A 3UG5A 1GZGA 3P5YA 1JL8A 3M0JA 3AXKA 4B5WA 4JOMA 3HGRA 3G1AA 2XSAA 2WPGA 4NI3A 4RDYA 1WDDA 4OE7A 3BLFA 1LQ0A 5C9XA 3STEA 3ZYZA 2ZRVA 2GUUA 2WB5A 5CZKA 3VMNA 3RXZA 3GQYA 1OB0A 1XLGA 1OCQA 4CCDA 4E3VA 1JPKA 3ZJ8A 3B04A 2OWCA 3BCFA 4O16A 2DVTA 3CUGA 4HNOA 7XIMA 4PR4A 5FAJA 1JCXA 3NZGA 2VWSA 2BXVA 1VJZA 1X96A 1MEIA 3XINA 1PO9A 3ARQA 1I2PA 2W27A 1OQFA 3MKKA 4H1ZA 1RQBA 1Q8JA 2BVWA 2OYKA 4NZCA 5KZDA 1MEWA 1RCOB 1RQEA 4JD4A 3VDCA 4CD7A 3T42A 5A6JA 4W89A 1QNSA 4JHMA 3AIRA 3U2CA 1B0IA 3GVQA 1RLCL 3EWDA 4PUUA 3B8VA 2OELA 5HPCA 4KWUA 5FJUA 2O9OA 3RNDA 3NDYA 3AAMA 3MU7A 1E3XA 3TEVA 3U3HA 1V02A 3W1TA 5I7GA 1OD0A 2WLZA 3MY9A 3DUGA 3MBDA 1P6BA 5IRPA 2Z1XA 3QFWA 4MNMA 2YDAA 3URQA 3TSDA 4GY0A 2CNCA 3WH5A 3M0VA 1KXQA 1Z41A 2QDEA 4ORMA 3MMWA 3K4AA 3ZVHB 4UTIA 3NQ2A 1V6TA 4BQ2A 2PLKA 1KM3A 1NARA 3WQ5A 3P6LA 1W5QA 4LY8A 1XFCA 4REQB 1VFMA 4QNWA 4UIOA 2QCNA 5ABHA 4LVFA 3NJ3A 1TV5A 4GLEA 1GQNA 3N6HA 2GDQA 1JF6A 1MO0A 1VYRA 4PTNA 4MKVA 4NAEB 4R7WA 4BK9A 2OKTA 1R3VA 3DG7A 1U1UA 4ICCX 3B9DA 1YBQA 4GX8A 4L7ZA 1AG1O 3LQGA 3A5FA 1QT1A 2NT0A 2BLEA 1O68A 3TMQA 3THDA 3M0HA 3FGCB 1YHTA 3P8IA 1HO1A 3LHTA 1P48A 4KWOA 4XB3A 3LHZA 4HYVA 3FIGA 4N42A 3RX4A 1BTMA 3UGRA 4QE5A 1ONXA 3W84A 4ACZA 3DH7A 1E0TA 5BWAA 3R43A 4UQDA 1H2JA 4PZVA 4N4PA 2CBUA 4ZTXA 3STPA 3KRSA 4DJEC 6XIAA 2F8QA 3CYJA 1NM9A 3DBPA 2OTDA 3PB2A 1E5JA 5I77A 2A6LA 3NVTA 1F3XA 5LNRA 3XIMA 3GFYA 2Z1WA 2OPJA 2FIQA 3D6NA 2WMIB 3TMLA 1X8FA 3WIJA 3ZJ7A 3VD9A 1W9PA 1S38A 4QITA 4GXWA 3T0CA 4XAGA 2FKPA 2XVLA 4X0VA 4HNTA 3MYPA 1PUDA 1S5NA 3IIZA 1VLIA 1QNQA 3EYPA 1EGVA 1GHRA 1V02E 3DFTA 4PB5A 3IARA 1NQKA 3N29A 2WO5A 1HP5A 1VF8A 1GOWA 4RE3A 5LIYX 3T4WA 4Z1YA 3FDKA 1IEVA 1J0IA 3WQEA 4GBDA 1W9VA 2NQLA 5E6ZA 2FZ8A 1P1XA 4YVPA 1TREA 2C3ZA 3ZZ1A 1ZCCA 2GSHA 2Y62A 5E0KA 3BTNA 4FXJA 4GIEA 4XD3A 2V5CA 5FI8A 4IOTA 5F4WA 3MKVA 4S3JA 3MI2A 2O55A 3TR2A 1PIGA 1RALA 4B3KA 1E1EA 2VYOA 1XINA 5KMYA 4FHAA 3TCSA 1GOQA 3NYDA 1MVYA 5EMUA 3PULA 3L5AA 3C3UA 3H7UA 4Z1BA 1C9DA 2NVCA 3R5EA 1UIOA 1H0IA 4XAPA 2WVVA 5A6LA 4L1XA 1Q8AA 4W7WA 2O4MA 3G1FA 3QPEA 2TPSA 4Z0JA 4F9DA 2OJPA 5HPOA 2Q8LA 2DEPA 4JBRA 3REQB 4MJZA 1XLCA 2XZ9A 3BV4A 1PPIA 1QWKA 4GYFA 5T8GA 3I6TA 3W1LA 4HPNA 3TNBA 3TDFA 3BK0A 3RAOA 2O0TA 4KERA 3EBVA 5D32A 1RR2A 1XYMA 1IV8A 1V6VA 2EG8A 2YFOA 3H2OA 3VIMA 4JHZA 5GNZA 5D9PA 3WLPA 4AEEA 1VLWA 2ZXAA 1JXJA 5I24A 3FEMA 4FA3A 4IP4A 3TFCA 1DJIA 3KLKA 4DJFA 1XI3A 3CTTA 5FCZA 1US2A 3B03A 2X0YA 4Q4PA 2RDUA 2W0UA 2DW7A 3WMLA 3C0JA 3A4WA 3I6RA 3IV8A 4ZQNA 5A95A 3M0ZA 2DZVA 2HZGA 4FLQA 5AC5A 2WKLA 1EWEA 1FH7A 4HZ8A 3DC8A 4UNIA 3TN6A 4DXVA 2Z0IA 2R24A 2EGZA 2I14A 3EB4A 1D9EA 2WV8A 1EDQA 4URIA 3ARUA 3NEHA 1AQ0A 1JCNA 4W8AA 2PDPA 3RPDA 2HK0A 2VC5A 3NSMA 3P7YA 2QJGA 3E38A 3V18A 1I45A 2Y7DA 3WJWA 3AHZA 2KAUC 4LVAA 3CQIA 3IGHX 4IISA 3TZFA 2WXDM 1J0HA 5EPDA 4TX8A 1CGXA 5HJXA 3QZ6A 3T0AA 2PDFA 2ON3A 1BVZA 1VB9A 3BOXA 3WLSA 3GHTA 4JYFA 3WDQA 2QDGA 3S42A 1ALDA 3O8AA 1XIDA 1RLDA 3CZJA 3KOFA 1P4CA 4LBSA 4P8WA 3EKZA 4LOCA 1NFGA 2PDGA 4HTYA 1WX0A 4KFOA 2WC3A 1OBAA 4ZEPA 2GGHA 4FX7A 4HSHA 1BAGA 3U6WA 3T81A 3EX6A 4H4IA 3SCSA 1HJSA 1NFBA 2VQUA 3VKCA 5J8LA 3MUIA 1YDVA 4AIUA 2TRSA 1TTPA 5M2FX 3O05A 3ZT5A 3M0KA 2PDUA 2WCAA 5FA5A 3DDMA 1EDGA 1UH2A 3ABQA 2EBNA 4EE9A 1RP8A 4C1NB 5FJOA 1G6CA 4PBGA 3W1MA 2V5DA 4D6IA 3ARTA 4X9SA 3BZGA 1VBHA 2YL5A 5F2MA 4IIEA 4Z2KA 4CKQA 3QM3A 1DJYA 3C52A 3BURA 4XSLA 3RIKA 1ZUAX 2CHRA 2DZWA 3ZSTA 3QRHA 1DIEA 2VD8A 2NVAA 2BVTA 3E5BA 1XIGA 1TPUA 1Q6EA 3UBPC 5LIWX 1IGWA 2IQ0A 4Z42C 3LCHA 4NX0A 1ITQA 4IM4A 1C93A 4E2DA 1ZS2A 3LBCA 3O6YX 5K7JA 2V3DA 4Q8PA 1BSLA 2BODX 4LYKA 5IOBA 2XG9A 2ZDSA 4L4OA 4QAWA 1J5SA 1EBHA 4ICMA 3I7RA 3TW9A 2CLMA 1POKA 1S5WA 3VINA 4FP1A 3CUJA 4D1JA 5HATA 1FDZA 3ITGA 1L6SA 3IK2A 1OG6A 4QDWA 4C6EA 4L65A 3A5VA 2Y89A 4MB1A 3ABRA 3IIPA 4M6PA 4O8RA 2V2HA 3LGGA 1OCNA 2I9EA 1BWLA 1QCWA 1W1TA 3SCNA 3WF4A 1UP0A 2GQ3A 1W8GA 3L4YA 4XZBA 1DOSA 3WL1A 3BLLA 3NTYA 1FFQA 1XCXA 1VFSA 3N2BA 4JL2A 4S3FA 1EQPA 2WSRA 3QMRA 1GHSA 3C2EA 5BU9A 4LQ1A 1EP2A 1WKDA 1UZ4A 1H11A 1W91A 3S2JA 4IGHA 3E74A 3LQLA 1I2QA 1JYXA 1MQQA 4BF9A 1GORA 2WJDA 3RHGA 5EYWA 1JUEA 2X30A 1GOXA 1PX8A 3O6AA 4DX3A 2GFTA 3FV9A 4Z2JA 4ZE4A 3TJXA 3TCEA 4C5YA 1LM1A 5T91A 3TTOA 3ECQA 1FP8A 3TLLA 5C2GA 1K1DA 3CXOA 1LQAA 3CZ8A 2C7FA 1F3EA 1S5MA 3Q2DA 1GOIA 2PAJA 1KRAC 2QEZA 2INZA 2CBJA 1DPMA 4JTTA 5H8UA 1FCUA 1PYMA 4BA0A 4C6KA 1T99A 4MVAA 1XYFA 1RH9A 1UROA 4MLRA 3V75A 3E0FA 3F2CA 4YTRA 2DSKA 1Q66A 4AZ5A 4QIUA 4QTGA 4IJRA 2WVUA 2YA1A 3RDKA 1LTDA 4UFIA 2HISA 1HKKA 3HG2A 1PHQA 3IANA 4OKDA 1HZYA 1QVBA 1WB0A 5A6BA 5EBAA 4DELA 2YJQA 2XGIA 2PDNA 5I78A 4W8BA 4R9OA 5PTDA 2FLIA 1TPWA 3CJPA 1E6PA 3MCOA 4IG2B 3Q37A 4GI9A 1XQKA 1M7JA 4CEXC 1UP3A 3F2BA 3EX2A 3H2CA 2G96A 4OBTA 4XQ6A 1XXXA 3JS3A 3HPFA 3LHWA 1EB3A 2E4TA 3K4WA 1LLZA 2DIKA 2PRHA 4JAWA 4J40A 4HSOA 3FYOA 3DEQA 1KW1A 1Q4NX 4PMVA 2Z27A 5HINA 4GVHA 4V1YA 2FHFA 3TTEA 1VFUA 3VM7A 1TE1A 3RR1A 2QS8A 1R9ZA 2O9TA 2VEIA 2EG7A 5LHFA 4FS9A 4A35A 1FXQA 3SCTA 3UXLA 3RGTA 5DCDA 4Y90A 2Y7EA 3RM9A 1EJUC 3RLGA 4IJCA 3W1AA 4M24A 3L4ZA 1A0EA 4I9TA 4HJFA 3CZEA 3LLXA 1GTEA 3THCA 3STCA 3JRKA 3M5XA 3EWCA 3HQPA 4AAJA 2QVNA 2PI6A 4JZ5A 1HVXA 2ZUVA 4NXKA 1JPHA 3SO7A 1H1NA 5AHIA 1FTXA 4O1CA 2AOSA 1TZ9A 1ZJIA 2IKGA 4IIHA 1K8ZA 3PZUA 1EKOA 2DFAA 3OA3A 1QO2A 5CZTA 2C19A 3GFZA 4JFUA 4MZ1A 1TJ1A 4CNOA 1B9ZA 2RUSA 3CASA 4M51A 2NT1A 3WX7A 4AVNA 3RR4A 4WSJA 3S1XA 1M7PA 3R79A 1F3WA 4DJFD 4EIVA 4OOUA 4DB7A 5B80A 1QW8A 4H9ZA 1GVRA 2YYTA 4ADSA 1RA0A 4JHOA 1UOKA 2NV1A 3FK4A 2CZ5A 2J24A 1A47A 1OJXA 1VRXA 4I5UA 3OIHA 1ADOA 4OWGA 6REQB 3TH6A 4GPNA 1ZY9A 1EA0A 1BYAA 2CLPA 3VPLA 4C6CA 1OFQA 3P80A 2X05A 3LHUA 1JI2A 2CLEA 3EWYA 4IH3A 1P7TB 3WQGA 4PBEA 2DUXA 2F6KA 1EUNA 1IF2A 1XCFA 1I2RA 4HOWA 3NL5A 1KM2A 3SRKA 4AX6A 4LAUA 3MI6A 4ILSA 4WGXA 1QPRA 1RPKA 4R3UA 2YX0A 4MNKA 4ZQRA 3ZLFA 1Y65A 1F3TA 5L6UA 2Q6ZA 4FPSA 1KBIA 4HNLA 1B3OA 4JQ2A 3RITA 3UJEA 4E2BA 4KT2A 3AISA 3W82A 1JYVA 4AHOA 5FAGA 4GVIA 3ABOA 3KLLA 3NZQA 2FPTA 2HV5A 3CAVA 2YCIX 3UZYA 1HJXA 2HSAA 2YXGA 2X1SA 3RCYA 3WJZA 2R1MA 4R34A 3QZEA 3I4EA 1EBGA 3M64A 1FWTA 4BZYA 1AL7A 1O12A 1TMHA 2PA6A 4M7SA 5C2CA 1DTUA 4NZ4A 3E1F1 1GK8A 5H6HA 4OBRA 3Q65A 1RCXB 4K7VA 3MP3A 3DFQA 4RX0A 3WD2A 1UA3A 4HYRA 4JKMA 2IKHA 1WO2A 1IXPA 2IPGA 1TPDA 1R47A 1TZZA 4M1BA 3HGJA 4UR7A 3MV11 1YX1A 4ZA0A 3KOWA 4XWUA 4CNSA 5I02A 5I6SA 5FD0A 3WNNA 1GJPA 1YMYA 4B5SA 3OO2A 1J2WA 1SJAA 1A50A 5ENLA 3WNLA 1YXDA 1R38A 3RX3A 4B4HA 3QV7A 4UNKA 4XZHA 3WQ6A 1B1YA 1EP3A 1LT7A 3H53A 3ITXA 3AIVA 3UNTA 1KGWA 4BEQA 1C7SA 1T8XA 4IMAA 1UD4A 3LMYA 3V4BA 1V3JA 2PZ0A 3UXKA 4LAMA 1KM1A 1MDRA 1Q85A 1XRFA 2RDTA 3U48A 4JEJA 4G56A 3Q45A 3ISIX 3M41A 4IX0A 1G69A 4O10A 2ZXDA 3H12A 3GW0A 2AAAA 2PS2A 3S46A 1VJIA 4RV8A 4YHEA 4XZIA 1XRSA 3VO0A 1US3A 2FZNA 1XBYA 3WK2A 3C2OA 4F9JA 8TIMA 1XIHA 2FJUB 3MUZ1 4QJ1A 3QMSA 3W1UA 3W28A 3S83A 1AVAA 2OOGA 1XQLA 2AKMA 4O28A 1CTNA 2J78A 3DYOA 3T07A 3IVSA 5A1AA 5M3WA 1WOBA 2CHNA 3BGJA 3MA8A 1KCXA 1MFUA 3S47A 1XIBA 1QWGA 2WKGA 1H7WA 1S2CA 4M6UA 4MZ8A 1PTDA 3G77A 4C65A 1XKJA 1MUMA 6ALDA 1LL7A 4HN4A 3VA8A 1L6WA 1EYWA 3WH9A 3NG3A 2NXHA 3OIXA 4GJ1A 2Q8XA 1UD2A 3WLJA 3UZWA 2WSQA 4AD1A 1GJUA 3I65A 4R33A 4N0RA 4J3XA 1DVJA 2ZBTA 3GXFA 4R88A 4NIRA 3MHFA 3KVKA 1EEPA 4W7VA 2DH2A 5FOOA 1AA1B 1VFFA 3CEPA 3VD3A 2QULA 4DBWA 3A13A 2WZTA 5DRCA 2DT1A 3CQHA 4BWLC 2B4GA 3LU2A 2PDLA 3H2EA 3R2GA 3S9YA 4GIRA 1ONRA 2NQHA 1VFLA 3PK7A 1VQTA 2PTWA 2YB4A 1TWSA 2OWWA 5TQLA 1OFOA 1PZ3A 2QMJA 2JFEX 3WD0A 4DPPA 1TWDA 4DVOA 3IPWA 3EEZA 4HCHA 1XH2A 3GVVA 3RM4A 5H8MA 3QOKA 1W0MA 3QV9A 1LG2A 3CT7A 4DM2A 1W5OA 2TYSA 4GMEA 3BLPX 3QR0A 1EIXA 2G4JA 1CW2A 1TA3A 5A6BD 2HVNA 4BI7A 4Q6XA 3C0LA 1EOKA 3QHOA 4NRRA 2H8ZA 3EDJA 4NVTA 1XIFA 2XVNA 1TV4A 3T40A 3BLIA 1KCKA 1BXCA 1E1FA 4LNCA 1KRMA 4UCGA 2PWVA 1IEIA 1TYGA 2HMCA 2QZRA 3UG8A 1W31A 1VRDA 2C1GA 2OEKA 1EJWC 3O3RA 4HYWA 3S1GA 3IRSA 4J2MA 4IPPA 1OFAA 2D73A 3OLIA 4JIIX 4FNTA 4HIBA 4MG4A 4JTSA 3VNYA 2ACQA 4WKHA 4F40A 3W71A 1QDSA 3VTRA 3W73A 3DFOA 4LWWA 3W4RA 4DM1A 2YBTA 4QHRA 3ZR5A 4EK7A 1ITXA 3VIHA 3IGSA 5U7SA 4S23A 5CLTA 4NY2A 2YFNA 3LPFA 5CGQA 1BKSA 1Z32X 3CPGA 3URNA 1A4LA 3PTDA 2PDQA 1SR0A 2XU2A 3WLNA 3E0LA 1V3LA 2E8YA 4RXGA 1BVNP 2XDFA 1G7VA 4JTDA 2A21A 2NV2A 1P0KA 1R2TA 2J7CA 1TPC1 2W62A 3SFKA 3NURA 3IS4A 3H21A 3V1HA 4QG6A 1MUWA 3IACA 3GTIA 5CSUA 4NRSA 4YYCA 4JIHA 2XH7A 1J0YA 3NQFA 4W88A 1ZBCA 2XM2A 2QV4A 4QLJA 2PRMA 1ZU8A 4QBXA 1K3UA 1P5BA 1Q7QA 1PL9A 4TVDA 4UOZA 2BB0A 3NSXA 1X97A 2ZUTA 4BF5A 3P93A 1CPUA 1XPYA 2WQDA 3QR3A 1JXKA 4H7VA 3LCWA 3CHVA 3B8WA 3MPGA 4NZFA 4GWEA 1DJQA 1AJZA 3P0WA 2UWFA 1Z9AA 3VIGA 3LN3A 1D3CA 3B4UA 4NHVA 3TAOA 4BS0A 1SW7A 1UR2A 1I0BA 1H49A