2C8NA

The structure of a family 51 arabinofuranosidase, araf51, from clostridium thermocellum in complex with 1,3-linked arabinoside of xylobiose.
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
501
structure length
501
Chain Sequence
KKARMTVDKDYKIAEIDKRIYGSFVEHLGRAVYDGLYQPGNSKSDEDGFRKDVIELVKELNVPIIRYPGGNFVSNYFWEDGVGPVEDRPRRLDLAWKSIEPNQVGINEFAKWCKKVNAEIMMAVNLGTRGISDACNLLEYCNHPGGSKYSDMRIKHGVKEPHNIKVWCLGNAMDGPWQVGHKTMDEYGRIAEETARAMKMIDPSIELVACGSSSKDMPTFPQWEATVLDYAYDYVDYISLHQYYGNKENDTADFLAKSDDLDDFIRSVIATCDYIKAKKRSKKDIYLSFDEWNVWYHSNNEDANIMQNEPWRIAPPLLEDIYTFEDALLVGLMLITLMKHADRIKIACLAQLINVIAPIVTERNGGAAWRQTIFYPFMHASKYGRGIVLQPVINSPLHDTSKHEDVTDIESVAIYNEEKEEVTIFAVNRNIHEDIVLVSDVRGMKDYRLLEHIVLEHQDLKIRNSVNGEEVYPKNSDKSSFDDGILTSMLRRASWNVIRIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords ALPHA-L-ARABINOFURANOSIDASE
publication title Structural Insight Into the Ligand Specificity of a Thermostable Family 51 Arabinofuranosidase, Araf51, from Clostridium Thermocellum.
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 171
structure length 501
sequence length 501
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06964 Alpha-L-AF_C Alpha-L-arabinofuranosidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2c8nA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2c8nA02
1R86A 1U2YA 4J3UA 3WNMA 2WAGA 1HJXA 3B9EA 3A24A 2WZIA 2WSKA 4AIEA 4UR9A 3WFZA 1KBBA 2D24A 2WHLA 4OBSA 2OW7A 1TZ7A 1UZ4A 1V0LA 5JBDA 3CZEA 1GQIA 2YA2A 3AHZA 3A21A 1UWRA 3BCFA 3GDBA 4MB3A 4TVCA 4H8VA 3FN9A 1UKQA 1E6SM 4D6CA 4XZBA 3LXAA 3L4ZA 3L4VA 3WL0A 2VRKA 2AMGA 2CERA 3K4DA 4J3TA 3KL0A 2D22A 4PMOA 2BVYA 5I77A 1HVXA 1UD3A 4TTGA 2ZUNA 2Y4SA 2PWGA 3CHEA 1CTNA 4LYPA 3OZOA 3MANA 1CPUA 4UOQA 1HJWA 4K68A 1OINA 4NI3A 5HNNA 1E40A 4YHGA 3WY2A 3VDCA 3OLIA 3QR3A 1GJUA 1VB9A 3WNPA 4W7UA 2V3DA 3B8SA 3RJXA 3VO0A 1JZ7A 1ECEA 1E4NA 2PB1A 4HPHA 4P7OA 4NSBA 1AVAA 3DHUA 3EJPA 4OIFA 3KEHA 1H1NA 4WKHA 4CCDA 1ZJBA 3W26A 4HP5A 3GXFA 5KEZA 1ZBCA 1OIMA 2HISA 5GNXA 3VINA 1QWNA 2AAAA 1EDGA 4NZJA 2EACA 5I79A 3WELA 1B3YA 1CGVA 3GXTA 1B90A 3LRKA 4NZCA 1CXHA 4AISA 1R7AA 1SFSA 5GPRA 4LYQA 2CKSA 4N0RA 2ZX9A 4ACZB 3UG5A 3DX1A 1E5NA 2A3CA 2DDXA 3AYRA 2PWDA 3EJUA 2VX7A 3SCNA 3CIVA 5D8ZA 2V3GA 1DWJM 1QVBA 2XFRA 3BAJA 2VR5A 2D0HA 1W91A 1K6AA 4CD7A 3DX2A 3WF1A 4L4PA 3SCPA 1R8LA 5M03A 1MXGA 1GHSA 1ISXA 3LXCA 1MQRA 3MUZ1 2XGBA 2OSWA 1UA3A 1FH9A 4MNMA 4UFKA 3W29A 2J62A 5IHSA 4Q7NA 1GOWA 4W8AA 3EDDA 1UHVA 4U5KA 1JZ2A 4NZFA 3MV11 3U5UA 3SUSA 1W9PA 2BV9A 3CHDA 1ISYA 2DSUA 3PZQA 1BYAA 2E4TA 4W5UA 5HXMA 3N9KA 1JYNA 3CUJA 3LPFA 3W4RA 5A6AA 4GXPA 2Y5EA 4UOJA 5AC4A 3GXNA 1KWKA 3WDRA 2ZWYA 5CLWA 2CNCA 1QI2A 2VCBA 4HA4A 2XPKA 1UH2A 4N42A 6A3HA 3N11A 2X09A 2FYVA 4LYRA 4D6EA 3FNDA 3VNYA 1VEMA 4D72A 3AQUA 5BRQA 3S6TA 3ZJKA 1XYFA 1LLOA 3VD9A 4C7DA 3OGVA 3FW6A 5GNYA 5BXRA 4Z2HA 1OD0A 2GFTA 1EHAA 1JF5A 3AISA 3ZT6A 5LA0A 2E3ZA 2WMGA 2BY3A 2BXYA 4JIEA 3GXDA 4GI9A 4TXEA 2F18A 4A3YA 1CNVA 1IZKA 3WMSA 3ALGA 3F5LA 2FE0A 1X6NA 4IUGA 1NM9A 2Y8KA 2YL9A 1VEPA 3TTOA 1AQMA 1UKSA 1KCLA 3CV5A 4WSKA 3BMWA 3UCQA 3WF4A 2YL8A 5CZKA 4FK9A 2XG9A 3AZSA 1GW1A 5IFTA 1R7OA 3A4WA 4AEEA 1XRVA 3ARQA 4IPLA 1JYWA 3VMOA 3ZR5A 3D3AA 5DFAA 2VZVA 5DF0A 1KGUA 1S46A 1BYBA 1KXVA 3BAIA 2X2JA 3LRLA 4Z2IA 1XH2A 4BA0A 2XYLA 4MDOA 2GDVA 2NW0A 5A2BA 5A2AA 4HMDA 3RCNA 1HJVA 1ESWA 4W89A 3S5YA 1M53A 1B3WA 2A3EA 5E1QA 4KGJA 1QBBA 5ABEA 1ODZA 3N17A 2EQDA 1HL8A 3UG4A 1W1YA 3A5VA 1PAMA 1MW3A 3CBWA 4WSJA 3T2QA 2VURA 5CLTA 4P7NA 4JZ5A 5GQBA 5E6YA 3HG2A 3BC9A 1C7SA 2GJPA 2XM2A 3WNLA 4JFSA 2CBUA 2G3MA 3PZOA 4KRTA 1UD8A 4PMDA 3VDAA 1CBGA 1OGGA 5BRPA 1GQLA 2YLLA 1JFXA 2UY2A 4JFWA 2J8GA 3BH4A 5FCZA 1D2KA 1MVYA 4JFTA 4MNKA 4TTUA 4IISA 5A8QA 3W0KA 4JHOA 4DUXA 2EPKX 2O92A 1FH7A 3BUDA 3THCA 4P8XA 5DO8A 1UWTA 3BGAA 3LRMA 3D50A 2FGLA 3MMUA 1JDDA 1V3KA 1UKOA 1VIWA 2FGZA 3RM8A 4CCCA 1E6PA 3DC0A 3NYDA 1V6WA 3AJ7A 5I6SA 3VX1A 4GZJA 1I75A 2ZUUA 1LG2A 2OSXA 5FD0A 3II1A 2W4XA 1BG9A 2Y24A 3B9AA 4PMRA 1GJWA 4QLJA 3AHTA 3MUAA 1E6NA 5JIWA 4MTVA 4X9YA 4P7RA 2DSZA 3N04A 4QFUA 3SCTA 3PHAA 1SZNA 1Q6FA 3CHFA 1PZ3A 2BXZA 3GM8A 4D6DA 2WC4A 2XWEA 1BPLB 3CUHA 3RM4A 5LA1A 1HXKA 2PWFA 1EOKA 3WH5A 2VC9A 1BVZA 3KWXA 5A8MA 4CVUA 3RDKA 7A3HA 2XUCA 3RIKA 4ATWA 1JYXA 1CIUA 4UFHA 4HU0A 4ACYA 1HIZA 3AMCA 2E9MA 2CPUA 3O6AA 3WD4A 2VL4A 2WVUA 1R75A 2WANA 3WF2A 5LYRA 3S2CA 1Q6GA 1TVNA 3L4WA 4OKDA 2DT1A 4PMXA 2MANA 4FNUA 1BYCA 3EDEA 3A3HA 2W67A 3D4ZA 3L4TA 2WM0A 1E3XA 4J3XA 3M6DA 1H5VA 5AY7A 3ZQ9A 2CETA 3WL1A 4YHEA 1OD8A 1KCKA 5D9PA 1OGSA 3AS2A 3PZIA 5HPOA 4W85A 3AROA 4ZE4A 1TR1A 5M3WA 2VVSA 1JZ8A 3CZSA 3SEPA 3UESA 3W24A 3BSGA 4AZ7A 3PZNA 3VOCA 2ZX7A 4AIUA 1Q4NX 1OSEA 4GI6A 1X1NA 3WDHA 5HPCA 1ZJAA 1JL8A 4AZIA 3A22A 1QI4A 3CUFA 5FL0A 1OBAA 3VIGA 2BVDA 2CHOA 4PYSA 3WUEA 1M04A 3AS0A 3GH7A 3DX4A 3IJ9A 2VX6A 1HJSA 1UR8A 1XV8A 1W1TA 2WMJA 1H4PA 3CZNA 4FNSA 1VJZA 1SMDA 3VIKA 3VSTA 1GORA 1JAKA 4J28A 3WUGA 1QI5A 3CHCA 4MB4A 1TQVA 3AFBA 1WCGA 2VR4A 3IAPA 1WPCA 2EO7A 1B0IA 1V03A 3FHQA 1JI1A 2XN2A 5JIPA 4HZ6A 4NX0A 2VQTA 3N13A 1GONA 3KL3A 1D7FA 4KWUA 3WF3A 2OYLA 4CD5A 4CCEA 3AS1A 1C90A 3WY4A 3W53A 1KXQA 5A8PA 4GO9A 2QPUA 2DH2A 2JALA 5D9NA 4LXFA 4E8CA 1XSKA 2D3NA 5E0CA 1J9YA 1TQWA 1CECA 2W5FA 2ZUMA 1EXPA 1VRXA 4AZCB 5JBEA 1W9VA 2WHMA 1C8QA 1LG1A 1UR0A 4JKKA 3WDPP 1V6UA 3ALFA 3PBGA 3OG2A 1JD7A 1QW9A 1FHDA 2EPNA 3EYPA 4U3CA 3ZT5A 2WXDM 2D73A 1RD6A 4R5EA 5CGTA 3BXWA 3AYSA 1ZS2A 2F61A 1G0CA 1PX4A 4F79A 3POCA 2CXGA 3BSHA 3VD3A 1B3ZA 1C7TA 1DEDA 5AYBA 3W6LA 3GXIA 2VZSA 1JG9A 1V3LA 2QV4A 3RMEA 3BAXA 3ZOAA 2VZUA 4P7QA 2Y8VA 2EABA 3W27A 3AICA 3DX3A 2DSKA 2HVMA 1ISWA 2XVNA 1BGAA 4RE4A 2E8ZA 3ARUA 2D2OA 3OLGA 1G1YA 3GNPA 1V08A 1J01A 1JFHA 5ABHA 1O6IA 4PBGA 1CGWA 1KQZA 3UERA 1HJUA 3VDBA 5EFFA 2OWWA 2WZHA 2WNWA 1AMYA 4F9JA 1W2PA 1QPKA 1JNDA 2OYMA 3VU2A 4KMQA 2E40A 2XM1A 3OGRA 3WH7A 4A4AA 1HNYA 2IXVA 4AD1A 3M7SA 2X8RA 3QOMA 1JGIA 2WSPA 2ZX6A 2WKLA 4D71A 5A6SA 3WMBA 1BHGA 1VFMA 4Z2LA 5ABFB 1QHZA 4CN4A 3BMVA 1WZMA 1VFOA 1GOKA 2VX4A 1KR1A 1L0PA 1V3HA 3GZAA 3WF0A 4CD8A 1H2JA 4MAZA 1LL6A 3WIJA 2WB5A 3IAQA 2E9BA 3I3DA 5A8NA 2OW6A 2J47A 1XSIA 2X1IA 3KE0A 4MDPA 4HA1A 4OJYA 3SCOA 1QBAA 3M46A 2VI0A 1I1WA 1TQTA 1XC6A 5IXEA 4UQCA 3UEQA 3KLLA 2EBNA 1KFWA 3K8MA 4YPJA 3ARWA 4PUDA 4WK9A 5IHRA 2ZIDA 1C91A 4U2YA 1E6ZA 1OM0A 1B9ZA 5HBFA 1E1FA 3VIHA 2WMFA 1JYVA 3BAKA 3ECQA 1VAHA 1Q6EA 4QP0A 3VD7A 3MUIA 1CLXA 1ZU8A 3HG3A 3EDKA 5ABGA 4UFLA 3DX0A 4AD5A 1GOOA 2GJXB 2VMFA 4OUEA 2XIIA 1NWUA 4PEEA 4AC1X 2WMKA 4DWSC 1JZ6A 2CBJA 3A47A 4AMXA 3ZT7A 3APGA 1MW1A 3UR7A 1PJ9A 5C71A 1US2A 2WW5A 3VILA 3KLKA 3HZ3A 3VTRA 2XVGA 1JZ4A 3K1DA 2JIWA 2J7EA 3L4UA 2ZOXA 3EMCA 4UFJA 4AZCA 1HP5A 2WC7A 2J74A 3SCVA 3VDHA 5JUVA 1CYGA 3HN3A 1KTCA 4AZHA 2UY5A 4H8UA 1KWGA 1LWHA 3WQWA 1KGXA 3OBAA 4TX6A 2E9LA 2WLZA 2ZX8A 1PBGA 4EKJA 1V02A 4M29A 2FH6A 3VUPA 4NXKA 3IANA 5I0DA 1G94A 4KRUA 4AMWA 2F8QA 3AMLA 2ZUTA 1UH4A 2J7HA 4BCEA 1MFVA 3FXYA 1UD2A 2WBGA 3OLDA 3WNNA 3G6MA 4GO8A 1W9BM 1DWFM 4U2ZA 1B3XA 1QW8A 3CUGA 3I3BA 2FHBA 1HN1A 2XSAA 4W84A 3CO4A 1GVIA 3GXMA 3N12A 3MMWA 3WD3A 2O9OA 1EO5A 4HU8A 1XD0A 2J7DA 1R34A 1WB0A 3VVGA 1UZ1A 1H41A 4PMZA 2WBKA 3H53A 4AZ6A 3DDFA 3AMKA 2DIJA 1G01A 1M03A 1KR0A 3SIMA 3VMPA 1U33A 3DYPA 3VIMA 5A94A 5E9AA 3VGEA 4MADA 3ZMRA 1DP0A 2YDSA 1ISVA 3K8KA 3AIWA 2XSBA 1J0ZA 4PCSA 3FAXA 1H49A 4GZIA 1XH1A 1NOWA 2D1ZA 5ABFA 1LL7A 3PTQA 1JD9A 5IFPA 2ZXBA 4CVWA 2NT0A 1ZB5A 4JHZA 7TAAA 4BQ3A 3G6LA 2A3HA 5DMYA 4HOXA 1O7AA 2Z1KA 3PZ9A 3VGFA 4BQ5A 2YIHA 4D6JA 1BYDA 3VD4A 1H0IA 1HKJA 4DWSB 2EJ1A 3A6OA 4RE3A 3HG5A 2BY2A 4AW7A 4IPNB 3DYMA 2WVVB 2IXUA 2W63A 3OIHA 1XHGA 2CEQA 1H3GA 1FOBA 1GCYA 1EHNA 5E0FA 3AIUA 4UTFA 1UR1A 1MFUA 1HP4A 5CPSA 2J4GA 2A3BA 3T0DA 3H55A 4WF7A 3AXIA 3NSNA 1QNRA 1BF2A 2FHCA 4DO4A 3AZTA 2XIBA 1UA7A 1E70M 1GHRA 2OSYA 1NQ6A 3BLBA 3D5HA 1E4IA 3UR8A 3TOPA 2CESA 3GH4A 2GJXA 3VX0A 1UQYA 2DSWA 3DHPA 3HMCA 3CZKA 2UY3A 1W9XA 1MQPA 1GOMA 5A6BA 3PZVA 4QAWA 2WZEA 1IZJA 4AZBA 4ACZA 4U5IA 3L4YA 5A69A 1CEOA 5IDIA 1W9UA 1QWUA 3CMJA 4B3KA 3WEOA 3WBAA 3PTMA 5I24A 4GZEA 2WPGA 4JKMA 1GZJA 2GJRA 3WQ5A 3VIPA 4BF7A 1R47A 2W62A 1NH6A 3W82A 2F1BA 4ZE5A 1SYTA 2EADA 2D0FA 5CSYA 3RM9A 2BY1A 4ZXOA 2DT3A 2ZXDA 2VUYA 2G41A 3AHXA 2CYGA 3BAWA 3IJ7A 1E4LA 1JIBA 6CGTA 4FNQA 2WCAA 4WKAA 4B9ZA 4PCTA 1PEZA 3FHAA 3MO4A 3L4XA 4BS0A 1FP9A 1E55A 1A3HA 2WMHA 1E73M 3CUIA 4QCEA 3EMZA 5FOOA 4W7WA 3W38A 1EOMA 1VEOA 3N18A 1MQQA 1HKIA 5TD4A 1OGBA 1BSIA 2W66A 1UD5A 1UR9A 3OGSA 4HMEA 1OCQA 3LMYA 1JDAA 2DEPA 3T0BA 3CH9A 2JF7A 1FH8A 3WQ8A 4OOZA 3DECA 4WLCA 3WUFA 4OZOA 1C93A 1HJQA 2XJ7A 2PWEA 1JI2A 7CGTA 1CXIA 3HU7A 3KL5A 4FLRA 1Y7VA 2F2HA 4FNPA 1K9EA 2BHUA 1DWGM 3EJTA 4PTVA 3WNKA 4AMCA 5A6MA 4CN6A 1DTUA 2FH8A 1CXKA 1VF8A 4PMQA 5M5DA 4U33A 3AXXA 1WZLA 2YFNA 2GUYA 1QNSA 2OWCA 1UKPA 4FF5A 3D51A 2WWDA 4GQQA 4QLKA 3S5ZA 3MI6A 4XX6A 3WY3A 1J10A 3EMQA 5ECUA 4DUVA 1W9DM 2Z1SA 1TQSA 2VCCA 4DWSA 1C8XA 3RPMA 1QI0A 3K46A 4PUEA 4L4OA 1Q6CA 2RGLA 3VGGA 4PTWA 3UETA 1KGWA 2F7OA 3CMGA 1B1YA 4HTYA 1UWQA 4QLLA 4EANA 4LQ1A 1NOUA 3POHA 4CU8A 3BUBA 2WKGA 1RP8A 3TTSA 2BVTA 3ZJ7A 3FY1A 1J12A 4M80A 1VENA 4V27A 1J0IA 2VRQA 1KQYA 2VO5A 4CD4A 2XFYA 3WH6A 5A95A 1NWTA 4NRSA 4JFUA 4AXNA 3U5YA 4PRWA 1E0WA 3WBEA 5FL1A 4J3WA 1G9HA 5BCAA 4OGZA 2PBOA 2WK2A 2D20A 4M56A 1UG6A 2DGAA 3ARSA 3WN6A 3PZTA 3QHNA 3VD5A 3VNZA 1E3ZA 4J27A 1GUVA 3ARTA 3AIBA 4MAVA 1QOXA 4F9DA 3SCSA 2D23A 2XGIA 1V3MA 2XVPA 4UQDA 1PX8A 3VIOA 4JL1A 2VCAA 1BG4A 4CUCA 5CG0A 3CPUA 4JKLA 4H04A 1UWUA 2X05A 3ARXA 4LGXA 4BQ4A 3AI0A 3FAWA 3DDGA 2CIPA 2RGMA 2W92A 2J7FA 4UCFA 1KXTA 1LL4A 1QNPA 4ATLA 5EFDA 2WVSA 5I3DA 1PIFA 1CDGA 3T2OA 1K9DA 1LF1A 2JF6A 4AYGA 4EAMA 5D9OA 3RILA 3TTYA 1HT6A 2XVLA 1LQ0A 4X0VA 1DWAM 4Y7EA 1V6YA 1R87A 1B2YA 4NXSA 3SCUA 3T0AA 1V0MA 3U7VA 2CCRA 1M7XA 2JE8A 4UFMA 2ZICA 4UZSA 1EDQA 1AQ0A 1DWIM 2J75A 4HMCA 2QPSA 5CSUA 4UZUA 1V6XA 3QHMA 5HOSA 1RPKA 4FLSA 1JZ3A 4Z2JA 2ALWA 3ZJ6A 1UD6A 4MNLA 3I3EA 1WNOA 3BVXA 3VMNA 1CGXA 3RJYA 4XUYA 4TOQA 3SUTA 1KBKA 4M82A 1JAEA 2DPEA 4EE9A 1J11A 3GXPA 1UOKA 3GTNA 2DT0A 4D6IA 1W3LA 4D1JA 3VSUA 1VJSA 1EGZA 1WP6A 3T09A 1W1PA 3NUKA 4HOWA 1PX3A 1IV8A 3AMDA 1V0KA 5DT5A 3NJ3A 3WFLA 3L2MA 5A6JA 1W3KA 3AS3A 3ZM8A 1X6LA 1HL9A 2CBIA 4DO6A 5A6KA 3W81A 3GNRA 5DT7A 1UR2A 3QGVA 1LJYA 1WE5A 3U57A 5LA2A 1ISZA 3T2PA 2YL5A 4UQEA 5I78A 4XB3A 2F7RA 3AOFA 3LPGA 3ZSSA 1E0XA 1NWSA 2JEPA 5CPTA 5CXPA 3ZO9A 3MKKA 3WKZA 3DYOA 3VM5A 4AY1A 3LPPA 4A3HA 3ZSTA 5FIPA 4Q22A 4W88A 1WDSA 4V28A 1XD1A 1NP0A 4AZGA 3O9NA 3IGUA 3LX9A 2QMJA 2QLYA 3F5JA 3CTTA 3AIRA 1VFFA 2E0PA 4ATDA 1XCXA 3OA5A 4AD2A 1NARA 1H09A 5D8WA 4IM4A 5I5RA 1JDCA 4CN1A 4URIA 3VGDA 1UYQA 1H11A 2Y2WA 5HDRA 1ITXA 2VRJA 2WHKA 3NCOA 3ARPA 1E56A 2WVTA 4FMVA 1E6XM 3CZJA 2UWFA 1ZBKA 4CKQA 1CXFA 2XVKA 1BGGA 3QHOA 1GQJA 2D3LA 3M07A 1IT0A 3MV01 3U7BA 1BVNP 1UQZA 4AYSA 1U30A 2JEQA 3TA9A 5E6ZA 3WD0A 1E71M 2WMIB 1BLIA 4S3JA 2PI6A 1UASA 4W8BA 3OLEA 5D4YA 2WC3A 1FA2A 1LWJA 4GINA 2VZTA 1E15A 3ZIZA 3EJQA 1HXJA 1HVQA 4AD3A 3BUPA 4PMUA 1WDQA 4D1IA 2YLAA 1ITCA 3SCQA 3VIIA 3CGTA 4UFIA 1UD4A 3VIJA 1BFNA 1MYRA 4E8DA 5BWFA 2EPLX 3PN8A 1PIGA 1CGUA 1JNEA 3RO8A 3CZGA 2G4FA 3TONA 4MNJA 1OB0A 3PZMA 3HJEA 1YHTA 2ZX5A 4GQRA 2CKRA 2V5DA 1GNXA 4D6GA 4J3SA 2FDMA 5GNZA 1GQKA 1E43A 1EQPA 1UWSA 1E6QM 3SUVA 5KZ6A 1XYZA 1H0GA 2X2HA 4CD6A 1WDRA 4M1RA 3ZR6A 2W61A 3UG3A 1F4AA 5A3HA 3NSMA 2GDUA 1EIBA 3TTQA 3H54A 2W91A 2YDRA 4JCLA 5AC5A 4FNTA 1HKMA 1CLVA 4W5ZA 1UWIA 1PZ2A 3W37A 2ZE0A 4D6FA 3HG4A 2DH3A 3WD2A 4AD4A 2O9PA 1UUQA 3WH8A 1RP9A 4J3VA 3AIVA 1CWYA 1TA3B 4ML4A 2C7FA 1D3CA 1W3HA 5EBAA 1E6RA 4GI8A 4PMNA 2GVYA 1EDTA 4DO5A 4DM1A 4P8WA 1HWWA 4ZFMA 3LPOA 3BCDA 1CZ1A 2J7CA 3A23A 4PN2A 2VNCA 2ZUVA 5E70A 3WD1A 4AZ5A 4OBRA 4H7VA 2EXOA 1V0NA 2OLHA 2OWXA 3VKKA 3ARRA 1SMAA 4P8UA 1JF6A 1EA9C 3PTKA 4W86A 3VSVA 1V3JA 4M8UA 1OIFA 1T0OA 4J7RA 4RE2A 4UQ9A 3THDA 1B30A 3AIQA 4RL3A 1EH9A 3NIYA 2EAEA 2WWCA 4EK7A 2OYKA 1L8NA 3GBDA 2YJQA 2ZXQA 2J8FA 1CENA 1TG7A 4F8XA 4HZ8A 1J0KA 4H8HA 3WUBA 3W28A 2NSXA 3AIEA 3AXHA 2D0GA 1JXJA 5BXSA 2J7BA 4E2OA 1CGTA 4F66A 3SURA 1QNOA 4CGTA 3F5KA 4PSRA 2QHAA 1P6WA 1N82A 2ZWZA 1AQHA 3KZSA 4TVDA 2X2YA 4DUWA 5A6BD 3BLKA 3EJRA 5EB8A 3ZJ8A 3VGHA 2XHYA 4Z2KA 3MSGA 3WEZA 3TV8A 4MJ4A 3GBEA 3BUIA 2XFFA 5JBFA 5AYIA 2GK1B 2WLYA 2EEXA 2J7GA 1GPFA 2G3JA 2BHZA 2WCGA 1NP2A 5EMYA 4YN5A 3SUWA 1QI3A 3K8LA 1WAWA 1FFQA 2C8NA 1K9FA 1KXHA 5BYWA 4B9YA 2A3AA 1DHKA 1HX0A 1ZBWA 2G8ZA 5BROA 3NDZA 4UQBA 4W8LA 3SUUA 4PMVA 2J25A 4U3AA 4PTXA 4W93A 4GPNA 5D9MA 1E9LA 3B9DA 2QMKA 1MW0A 4GIAA 4E4PA 2WMIA 1XCWA 1JZ5A 2XTKA 2BS9A 5I2UA 1EO7A 1CGYA 3EJSA 1UR4A 1BAGA 2IGTA 2V5CA 4X0NA 1WKYA 3WDQA 5A8OA 3O2LA 3JUGA 3BUQA 3WNOA 3NDYA 2X0YA 5DEZA 1B3VA 4ZXLA 2V3EA 1OWQA 3AZRA 1OT1A 4B3LA 1C3FA 1OT2A 2VJXA 2ZXAA 4Z2GA 2ZUSA 1VBRA 2BHYA 2G3NA 4ZEPA 1Q6DA 1XGZA 1J18A 3AMGA 2YL6A 3VIFA 2GSJA 2XN1A 1HKKA 1V6VA 5CPQA 1ZL1A 4CU7A 3D52A 4GKLA 3WY1A 1XH0A 2DIEA 1B31A 3VM7A 4WJXA 3J7HA 2JIEA 4B15A 2AOSA 4LX4A 1UKTA 1R85A 4CU6A 3A4AA 4JFVA 3CZ8A 4AIOA 3WQ6A 1UH3A 3L2LA 1TA3A 2YBTA 2WHJA 3E1F1 2PWHA 4FLOA 3WMCA 5I23A 3W6MA 3GYCA 4H41A 5A2CA 2QF8A 2C0HA 1XSJA 2XN0A 1BTCA 1CXEA 3D4YA 3F4VA 2VQUA 3EDJA 1G5AA 5A6LA 4DWSD 2IUZA 1FFRA 4AWEA 3BVWA 2YFOA 2VZOA 3WQ4A 3ARVA 4M24A 4P8VA 4FLQA 2WYSA 1C8YA 3W25A 4WIWA 3BVUA 3CZLA 2DQXA 1J0JA 5BXPA 1E5JA 4P7LA 2ZUWA 1E0VA 1KTBA 1NWRA 5C8BB 3WH9A 3SCRA 3VGBA 2V3FA 1KB3A 1SR0A 1VBUA 4ZENA 2YA1A 1YQ2A 3WEMA 2BNJA 2WVVA 4W7VA 8CGTA 2O9RA 2TAAA 2CITA 4FNRA 3PZUA 4H2CA 2DSVA 4D6HA 4BQ2A 1ODUA 2G3IA 1CXLA 3OB8A 2EPOA 4JL2A 1MWOA 3EBVA 2E8YA 1QX1A 2O9TA 1R46A 4BZYA 3IK2A 9CGTA 4B16A 1EQCA 5FKYA 3N15A 3EDFA 3BVTA 1GVYA 4PTMA 2YKKA 2YOCA 2GK1A 4HPGA 2XWDA 1V3IA 4S3KA 3K4AA 5C70A 1WDPA 2J77A 4AEFA 1J0HA 3QOKA 5F7UA 4XZWA 4JAWA 1NOFA 2YBUA 4MPKA 1E4MM 3BLPX 1ZBVA 3GNOA 1WZKA 3VPLA 1E1EA 1E72M 2PC8A 1C92A 3WDIA 1PS3A 2Q8XA 4KGLA 3WENA 2J78A 2J79A 1TQUA 2F1AA 4JCMA 2UY4A 1TCMA 4C7FA 3BVVA 1TVPA 1PPIA 2DT2A 4HOZA 2BY0A 2ESCA 2BFGA 3MMDA 4XV0A 4NRRA 2VOTA 1WO2A 1QHOA 5CGMA 3ARZA 1I1XA 1W2VA 3WDJA 1M01A 2PBGA 2EPMX 4HZ7A 1TUXA 3T08A 1A47A 3A4XA 5CJ5A 3MSDA 4UOZA 3MS8A 4MB1A 5BXTA 1F4HA 4U31A 4C7GA 2NT1A 1GOIA 5A1AA 1US3A 3MU7A 5M17A 4QDMA 4TVUA 4WKFA 3LXBA 4MJ2A 3PZGA 3OZPA 3GH5A 4W87A 1WZAA 2VX5A 2YDQA 2V38A 6TAAA 2CBVA 3AHYA 1FP8A 2JFEX 3CC1A 4PSPA 1K9TA 3IJ8A 4HA3A 1QNQA 4KH2A 1O7DC 2F7QA 3NSXA 1V02E 3ARYA 3WSUA 1FHLA 2PF0A 3SCWA 4AD0A 1TE1A 4QCFA 4R27A 2VT0A 3AHVA 4MB5A 3TP4A 1W32A 1HF6A 1MW2A 1QHPA 3WQVA 4LPCA 1TFVA 4TUFA 1GOQA 3MUY1 4NF7A 1VFUA 2VVNA 1JXKA 1R33A 5E09A 2X2IA 2WCSA 1W1VA 5CQ1A 3CLWA 2B31A 4TX8A 8A3HA 4UQAA 3BAYA 4UNIA 4PMYA 1RH9A 4M81A 1HTYA 1BQCA 4V2XA 2F7PA 1Z32X 2X0HA 3N1AA 1MXDA 4OOUA 4DM2A 1W3JA 2YA0A 2CHNA 2FHFA 1DWHM 2VTFA 1TMQA 1J0YA
chains in the Genus database with same CATH superfamily
1JBJA 4J3UA 3WNMA 4QE5A 1XH3B 3A24A 4AIEA 5DRWB 2D24A 3IMBA 1WXZA 4OBSA 1PEWA 5I2IB 1UZ4A 3LDVA 4WV1B 1WV7T 5FUZL 2GFBA 4JRXA 3AU6A 3D85D 3MMTA 3BCFA 3IMWA 4FR1A 3N19B 1IGJA 2AMGA 3T4AA 2QCDB 1VS1A 4OGXH 2F5BL 4ENLA 3SYAA 3A3XA 1BM3L 4UOQA 4K68A 4LANA 5HNNA 5EUOE 1I7RA 1MF2L 4EIUA 1JZ7A 5EOCH 3QEQB 1CO1A 4LLVA 4C1NA 4P7OA 4HZMA 2L7UA 4X8CA 5TDOB 5GHWL 2XA8H 5DJ0B 5GNXA 3W7JA 1EHKB 2AAAA 1T1ZB 4YSQA 2O6EA 5FO7B 1SM9A 2HX8A 3BEVA 4ZSTA 2BW5A 3PV6B 4UM8B 4KO7A 4Z95L 3QO1B 5DZNA 4ENEC 4WO4A 5EA0L 3SCNA 5FEBA 3S4SA 1T89C 3MBFA 2YRBA 1WHPA 4PIRF 2OEKA 3SCPA 3ZTNH 4ICNA 4XI5C 3QJHB 3QZWB 2H7WA 4JIHA 4Q6KA 5KVFL 3HEIB 3ZX1A 3OF6D 3HA0A 2GPZA 4JQ4A 5C0EB 5LBSH 3O63A 1OPOA 3FO0L 1X5YA 3CFTA 3HZMB 1MDRA 3N9KA 1RU9L 5A6AA 5D7JC 4LU0A 3G6DH 5F7EL 2ZWYA 2K8MA 1QI2A 2XN9B 2K0RA 3WO4B 3GPEA 1VEMA 2IO5A 2A38A 4XP4L 4HT3A 3TA6A 5HVGB 2A6IA 1N5YL 4P2RD 4YDKH 1SQMA 2EKGA 2GHWB 1RUAH 4FEZA 2CLVB 3H7BA 5EMJA 1E5AA 4I9TA 4A3YA 1U3JA 4IGBA 1P7HL 1KT2A 1RJRA 3FQUA 2OAAA 1VEPA 2R2CA 1A1NA 3STPA 3HO8A 4FK9A 2NYYD 5BVJB 2EIBA 1FWSA 1JYWA 2ATPB 2GUBA 3MUJA 2H6PB 2FJUB 3RIAK 1IVLA 4JKNA 2X2JA 2WZ0A 1BJ1H 2YZ8A 5HHVH 4JS7A 2HLAB 3KZPA 4PY7A 3UBPC 1ADWA 2FLIA 1ES0A 1A5SA 1QEWB 5HR7A 1JR1A 1MW3A 2WMPB 4OCYL 2PRHA 3L9YA 3MVIA 3LS5H 4GIOA 3BC9A 4ODVL 3BO9A 2IQAA 1CBGA 2MNUA 4HK3N 4JHMA 4XVSH 3QJUB 1CI5A 3UJRA 4XX1G 3CFMA 4K3DL 3HM7A 4JKPH 2FNBA 2CK2A 1G9MC 2DN7A 3RGVA 3W87A 2OMVA 2EPKX 1A02N 1WFUA 5EFIB 3D50A 2OR7A 2FGLA 3Q3GB 3K2UH 1FNGB 5FWRA 3RY5A 2VDPB 2MJWA 2KHAA 1RUPL 1E2ZA 3MUAA 4MTVA 4HV8B 4PFEA 4JFED 1Q6FA 3EZJB 1V79A 4IOSA 1XBXA 4KJWC 4MXQD 4MA8L 1OVDA 1AD4A 4S39A 4OCMC 2Y7NA 3RIKA 4UIOA 3BZFB 4HETA 2QCNA 1RPXA 4N0CD 2CPUA 1QXLA 3H42H 4ZRGA 3ES8A 4JTHA 5F7KC 2XWXA 1E0OB 2XOTA 4PGBB 1WWAX 3UP1A 1JGDA 1SOSA 3V4PA 2VSMB 3VFMA 3US9A 3F7VA 5HHMB 3W2UA 5DC4B 4RGOH 4CJ0A 1XBVA 5GZOA 1AI1L 3SI9A 3L6FA 3UESA 4DNMA 2C4XA 3GT6A 1IT9H 3GYRA 1CD1B 4KTDL 1OD7A 4HSCX 5C07E 2HTKC 4AZ8B 1NC4A 3DX4A 3GHRA 4PJXE 2V5JA 1XGRB 4I1PA 1LO2H 1TV4A 5I66A 1GORA 5DELA 5DT1L 3V4VB 3CV7A 1ZSDA 4FQXC 4KKQA 3AFBA 2ADJB 1FXQA 2XN2A 3VI2A 3QNZA 4H1LA 5I3JA 5JIPA 2A6JA 2XPYA 4NX0A 4Z7VF 4Z8FH 3GSUA 3RN6A 1A22B 4R0LB 3WF3A 2YR3A 1F18A 2CRIA 3GKWL 3AS1A 4FX6M 5E2VH 1GKQA 2OX4A 4YFLF 2RJGA 1I2QA 4JREB 3ILDA 2FIRT 1W0VB 3S9ZA 1FZJB 1HKLL 4LIQE 2CCLA 3PG8A 1UCBL 4NOBA 1G9MH 1R1CA 2DWSA 4QHKI 4NWUL 5KYXB 1U8CA 1ADQA 5M1TA 3SE6A 1RD6A 4P5TD 2Q86A 2NZ9C 2OJZL 1B3ZA 4B5NA 3MV7E 4R2GB 4KHTL 5AYBA 4NO0B 3LHVA 3F6LA 3V4LA 3BAXA 2VZUA 5DYFA 1IQWH 4KRPD 1KSRA 3W27A 5B39B 1ISWA 3T0WA 2EIZA 2E8ZA 5D9SB 1UACH 3OLGA 1JEZA 4E4UA 1EVUA 4IG2B 2G5RA 3WXWH 5SWQB 3GIZH 2G0KA 5IVXF 2BASA 5K3VA 4Z78A 3TC3A 5IB1A 4OB5L 4IZGA 5AG8A 1EYEA 3VQ1C 1Q4WA 3D87B 4GRWH 2ZCGA 2E25A 3N2OA 2PYED 3FQNB 1MG3C 1UR3M 2PF6A 1OX6A 1T83C 5H35B 4CN4A 2XISA 5DZPA 3BMVA 3CK0L 2ADGB 2D4FA 1ZA3B 3I50L 4JFHE 3ZL1A 2VXSL 1JHTB 4JG1L 3N2CA 1TVHA 4JTKA 3ZVIA 4M3JA 3EO1A 2X4SA 2J47A 3KCOA 3B0VC 3RYMA 2ARWA 1XQKA 1MRFL 3UBHA 3U79A 5FUZH 5AZ2H 4WJ5A 1G43A 2ZIDA 2NQ9A 4XPAH 3TW9A 3HVDA 2CDEB 1NFDE 3UTPE 2EAWA 1ZU8A 5JOFA 1AMKA 3BMXA 2WLKA 1ZGLM 3RX9A 1CG9A 2DL9A 3GIYA 3GLZA 1REIA 4F58L 4NM8L 2CBJA 1BM3H 5I03A 2YLKA 1MF2H 1C5CL 5EU3A 2WW5A 3W3OA 1ZS8A 3BPCB 1HXMA 4JUTA 2NUXA 3O0FA 1RHFA 4DESA 1DN0B 5JUVA 3P73B 1EZVX 4PJBF 4O4VA 4LCUA 5LXVA 3GMPA 2CU0A 4NSKA 4IL2A 5BV7C 2PS2A 3P7YA 3X3GL 3VUSA 3FU0A 5T1LD 3KYMA 1R2SA 3A4EA 5HHNA 2GQ3A 3MKVA 3GZ3A 1JDFA 2PU1A 2J1YA 4ZX4A 5F3HA 4BSJA 4OLWH 1NGQL 3ZS4A 1DFBL 1YKWA 3UIZA 4BJHA 2VR9A 2QPDB 2L7EA 5ENWB 3P1VA 2WBKA 2P8PB 3AMKA 3FO0H 1OP9A 3CG8A 2VKWA 5J8LA 3KZ8A 3L3GB 3DXIA 4PCSA 3TCEA 5F7EH 2ZDSA 4CVWA 2NT0A 1A4JA 5DJ8B 3KHJA 4PODA 2BOCA 1SHXA 1I1CA 1SO3A 2EJ1A 4K9EH 4AG0A 3EOBA 1NDMB 5LDSA 1N5YH 1KJ2B 4K37A 3FRPG 5EPMB 1JJUA 5JA9A 3NQ2A 3BZJA 4OVVA 1LQ2A 3ALXA 4LAUA 1GS8A 1MHPL 2FHCA 2IH1B 2JK5B 3EW3B 3P3UA 5K1NA 2KI6A 5DHEA 3D2UD 4L1LA 5I1GL 4AF0B 1MCBA 4QAWA 4WI0B 3GB6A 5HGBB 4K3GA 1Q0XH 4E9YA 1QWUA 1NCDH 3GD1C 3QDGD 1UOVA 3B7SA 1YTDA 3ZE0B 3S9YA 4A29A 1FZOA 3Q8EA 1AW1A 2D0FA 3ZDZF 3B7UX 3E6HA 4OCYH 3UWVA 2BRQA 1JF1A 4UTTA 2VENA 4Q8PA 4AV4A 4GB9A 1T66D 5FYKL 1EFQA 4JTLA 2O4QA 2IPFA 4GQ0A 3VYOA 3ILPB 3VZZA 1MJJB 3RHWF 1B4JH 3ASWA 8TIMA 3EA2A 1F3TA 5D96C 4F0HA 4QHLA 1OTSD 1T5WA 3LQZB 1JI2A 1D3HA 2C7UB 5ADOH 4I48A 2PA6A 2V69A 2FJGB 1BVOA 4Z1BA 2XWTB 5DMKB 3OGCB 5HYJA 4XPBH 1N8IA 4M6QA 2CUMA 3QSRA 1KY6A 3R8BB 4V11A 3SGDI 3PWNB 4WFED 4G8GE 1FL5A 2JBMA 4XPGL 4JO2L 1H15B 4TMPA 3I6KA 4XAWL 4BEUA 1K8XA 2Y89A 5D5MB 3RDJA 4QLLA 5FO8A 1F00I 1MWAB 7ODCA 4Y5VC 3DTXB 1VYPX 3P14A 1FCBA 1KCUL 2WD0A 1K3ZA 1LVEA 4NRSA 5HPMA 1H0DA 2RB8A 3T77B 2VL5B 1HH9A 5BCAA 3G04A 3VD5A 2BSDA 1INDH 2K4AA 1K8IB 4KTDH 1JSYA 2AXJA 5CG0A 1RPQA 4JQXC 2EE2A 2W0LA 4X6DA 2VLJE 3UPWA 3QFDA 5DT1H 4NNCA 4UT9H 5F9JA 1AUSL 1IC4H 2DWEA 3T2OA 4WW2F 3O3DB 2FJHB 5D6CA 5IJVA 2DFAA 5PCYA 4JY4B 3EH2A 2DM4A 5K9QG 1FGVH 1DJWA 4XC3H 1YUKB 2VDRB 3BWZA 3HLAA 2NX1A 3SCUA 3HRZC 1U8KA 4K2SA 3MGOA 1TELA 3TVMC 5IMOB 4L29A 1MIEL 3SN6N 3BKYH 4HKXB 1Z1WA 5C2BH 1V6XA 1UCBH 1IL1A 3QNFA 4CC1A 3HZYA 5HDWA 3FH7A 2AQ2A 1UD6A 4FS9A 1UUSA 1NL0L 1ICQA 5ACZB 4F7PA 2GKIA 4UR8A 2XPGA 3GKFA 3E0IA 4FP8L 4LIQH 1M71A 3L3OB 3LQLA 2AAMA 3OKDA 5EBLA 2PPCA 1CU4H 1I3GL 4Q6IA 3OHXB 4ICWA 2VO8A 4IOFD 4Y2DB 1WFIA 5TGBA 5DY2A 4QY8B 4LF2A 2VYRE 3QGVA 4XG1A 4ZCWA 3U57A 2DLIA 2E9IA 4MZ2A 3E0LA 4JX6A 4C56B 3ZRSA 2XFWA 2DS4A 3H9SA 4IQJA 1F3JA 3GMMB 3LPGA 3ZL2A 4OB5H 4X4XA 4S10A 4W81A 3QJVB 1FHVA 2DQDH 4BK9A 2E67A 4Y6GA 2GTZA 3CK0H 3CH1A 3T6XA 2GSEA 4EXQA 2W60B 2VXSH 3OA5A 2HFEA 4B5UA 4WY7H 3CSFA 4AEIH 5EBWA 3TCLB 2VRJA 2V9QA 4WQ6A 2K3TA 1E6XM 2C9SA 4FQLL 4DZ8A 1GQJA 3X1BA 3U7BA 2E7DA 3IETA 1SZGA 3CWHA 3DOIA 4KXAA 2I9UA 3SSJA 4G80B 3W75A 4KRNA 4JO4L 1Q7QA 1CICB 5IIEA 3GF8A 4DP1X 3BUPA 5EU4B 3RZCC 3O6YX 1AGDB 4I7ZC 3SPCA 2COQA 4DPCX 1DCLA 4F58H 1YHTA 4GQRA 2CKRA 4D6GA 5GNZA 1KPVB 3O9WA 1XR8A 4KO9A 2Y25A 4L4TD 4Q74A 3VZYA 5ISZA 4E5XB 4HIQA 1T2XA 3MBED 1EIBA 1BW8A 3TEVA 2WNGA 3KPRB 3KYNB 1H8LA 1YDOA 2ZE0A 1F11B 5D1QD 3EXJA 2DORA 1OCNA 4ZTPL 3F4WA 1DBKL 5IKCA 5A2IH 1BQSA 3LHUA 4JK0D 1F2JA 1AE6H 3DRTA 5GS3A 1G4PA 3X3GH 1JGEB 5BUGA 3ZHFA 3W2KA 1VZHA 2XQBH 2CHXA 1PGRB 3VKKA 4NO3B 4B97A 4NZTH 3INUL 4A35A 1C5BL 2ISVA 1OIFA 3OQRA 2CM5A 4GSXA 4RFNB 2EAEA 1HC1A 3DMMA 2J8FA 5IB2A 3DG3A 1XP3A 1YNTA 1P43A 1FX6A 3W28A 3REWB 4P2OB 1N82A 4NEHB 4PB9L 4AC7C 2H0FA 1QZNA 1EMTL 2H9GA 2CHWA 2Q3OA 1KC5H 5ERWA 1XCQB 4UNKA 3DV4B 5EEXA 1OJXA 3OKLA 1UCWA 1KXHA 1REQB 1GZ1A 1NSNL 1MCJA 2A3AA 4JPWH 4PRRA 1ZBWA 4ANVA 5F1NA 2FIKB 5JW5B 2F6KA 2HG0A 4FYQA 4ZBJA 3LQMA 4C1LA 5IHBA 4WU7A 4DEUA 4KTEH 4F8QA 1MNSA 2F58L 1MHPH 3WNOA 2Z93A 3OMIB 3HIJA 3C60A 1C3FA 4DN3L 3V6OA 4PEKA 3IS4A 5A2KH 4GG6F 3T0EA 2GSJA 4D2JA 2NSMA 2WLIA 1W80A 1FCQA 1TVBA 4NQCD 5GGRY 3I6LE 2GSGB 3P0XA 8FABA 2BP0A 5FLVA 2DJMA 3TNBA 2V7HB 3KXFD 4AK2A 1KB9K 4MLSA 3LBOA 2PCPA 3BG5A 2QJMA 1Z66A 4ZO7A 1SPQA 1FFRA 2D31A 3ME0A 2ITFA 4FP1A 1YEGL 5FLUA 4IIHA 5IMKA 4O2FA 4RQQB 2Q8BL 4PQXA 4UMCA 2ZWKA 3MJ9L 3Q6FA 4UV4L 4AWUA 4OT1L 4A6YL 3GHBH 3UDWC 2ITCA 1XC4A 2BP5M 1WITA 3LU2A 3VGBA 3EB4A 5HJLA 1NEZG 4HWBA 3FO2A 4AQEA 1IFRA 4W7VA 1J1PL 4RNRA 3UTSB 3PZUA 4L1GA 3FU7A 1RSYA 5KVEH 1ZXQA 3Q2LA 4E41D 4XN1A 4B16A 2EEFA 4TPRL 1JWUA 2FT6A 4DP2X 4AJWA 4DGYL 5L9FA 4JPIA 3E80A 5G2IA 4JRXB 2J6WA 4HNUA 3TA4D 1F3RB 4YCOA 4XPGH 1RZKL 3L5JA 1IGJB 3T4AB 5GRXG 4XAWH 1IARB 4Y0GA 4HIIA 1I7RB 2E75C 2HVBA 4UC5A 3OQ8A 4RLIA 4LLVB 4C1NB 4AVIA 1PL3A 3WDJA 3TYDA 2ZAIA 3SJVD 1AGFA 1E9PB 4L9DA 1P0SE 2EKSA 3OX8A 4AX3A 1JNJA 3LXBA 3GHTA 5EZLA 3RJDA 1K7XA 2X4NA 3GXUB 1F90H 4WO4B 3BGFB 1TKWA 1LD9A 2V38A 2CBVA 1KIPA 2X6VA 5EIIA 4NQEE 1RURL 3LRGA 2E7LC 3BDYH 1E9OA 4QRRA 3AHVA 3GINA 2R69L 2WXRA 4PRDA 4JFZL 1CZ8L 4LJ3A 5EPDA 5C9JA 2GGIA 4P5SA 1GOQA 1RH8A 4MNQB 3PUOA 1UGKA 1KTLA 1F73A 8A3HA 3UBXG 4PTUA 1KPUA 1MIEH 5AALA 3P5ZA 1Z32X 3T6QC 1PKOA 3UY8A 4QISA 1TX0A 3H8NA 2YKLL 5MF5A 1J0YA 1U2YA 2A6IB 1XIJA 4Y1TA 1U8MA 2HNHA 1VSCA 4JY8A 1GVFA 2WAGA 2WSKA 1RUQL 2VSDA 1OSYA 3H7BB 4XPFL 1UB3A 4BSVA 3ULUE 2NPLX 1IWPA 2EUXA 4IGBB 1EX0A 4AUJA 3CZEA 2YA2A 1I3GH 2NY7H 5DJXA 4XNMA 3GUTA 1VFHA 3FQUB 4MJIE 4F8PA 1A1NB 5CLXA 4J3BA 4L37B 4JKWA 3I75A 5D2LE 4MMYA 2Y4SA 3ULUL 1YPZF 3RIFK 3RWHB 1SQ2N 3RCMA 3HS8A 2YUZA 5B1AB 5ALBH 1ZJBA 3N0PB 1FC2D 1TRIA 4RDVA 1EVTC 3GHEL 2EVIA 4HHPA 4FHKA 1QWNA 3WJLC 5F2LA 5GRVL 2R59A 1B3YA 3LRKA 4NQDE 2YXMA 1R3LA 1A2YA 3QXWA 1E5NA 4PTDA 1UG9A 1NFPA 4ZMZA 1L3WA 3N34A 2IQAB 4FQLH 4IP4A 5IR1A 4HSAC 1R5VB 3GTHA 3A3YB 4CD7A 4UOW1 3DX2A 2VR2A 4QXWA 1GHSA 2FX7H 3M0MA 1UA3A 4M6NH 3RGVB 4JO4H 2OMVB 5I5JA 4ABUA 3TNMA 1JMZA 4FO4A 4NPJA 5HHQA 4H9VA 2BWDA 3OVUB 2X4PB 1HGYA 4KY2A 1DQDH 4V1DD 4OV4A 4P23B 4ASTA 4JRLA 4MYXA 4UQ2A 5E6IA 4PJDA 3G24A 5JHLH 2PW1B 4MBOA 2VR7A 2R27A 4ZTPH 4NIYE 4M1DL 5ID1A 2D3JA 4D3CH 4YX2L 3QORC 3WMSA 4FZEH 2CA4A 2FBOJ 4H8WC 5HHPA 4ZO6A 3HFMH 2I5YL 3TTOA 2QQLL 3PP7A 1PWLA 2ZZ1A 3TN4A 3INUH 1MI5A 5LCVL 1PD6A 4YFDB 4X42A 3F7VB 3IMVA 3Q94A 4ELMB 5AYQA 3JQOB 1XRSA 3UPBA 3THQA 3ARQA 5D93C 2W94A 2XBZA 3D8MA 3SDCD 4JNYA 2EXSA 3PWPB 4Z2IA 4U6VL 5JR1L 2EDDA 1L9TA 3VOIA 4JGUA 2R4RL 3BOVA 3EH1A 4PB9H 2FB4L 1EMTH 4Y5XB 4J1UA 1HHKA 2IANE 3GDKA 5I02A 1PDZA 4MVBC 1ZNNA 3GU1A 1N3NA 3IFNH 3VXUE 2DW7A 4LQFL 3N17A 1QSEA 4DJFA 1BD2E 2C9AA 1ZSDB 1IWBA 3QNZB 1N7MH 3HG2A 3LZRA 4H1LB 1EZUA 1J8HE 4JPKH 2A6JB 3HFFA 5ABAA 1UD8A 3NIFE 4XCFL 3GSUB 1MSSA 2Z2BA 5IDZA 3IWPA 2WJ7A 4I6KA 4LSPL 3EYQD 5IOPB 1RD5A 5DRCA 4ONFL 4JHOA 2WLJA 2GJ6A 3DBNA 2OPCA 3NH7L 3E9TA 4DN3H 3BN3B 4JPVL 2EUZA 5JMUA 1U8CB 3MLTA 1V6WA 3PHOA 5I6SA 1Z5LA 4MZYA 3R12A 4Y7OC 1JTPA 2DZBA 2ESVB 1WH0A 3DOHA 1RPUA 4NENB 2IWKA 3QUML 4M5YH 2Q86B 4YFLI 3AT8A 1PE1A 3NCWA 2D7NA 4CVUA 1M7JA 5EBMA 3ZDXF 5KSAA 2I7GA 4YHLL 2Z35A 4UFHA 1NZRA 4GSDL 4OFPA 3RY4A 2CLPA 1BEUA 1FAIL 2AMXA 5LYRA 1W5QA 1YEGH 5KBLA 4GW1A 5T33H 4HZAA 4Z78B 3IRSA 2Q8BH 5IB1B 4H8WH 2CO6B 1HZHH 3M6DA 3MJ9H 1PKNA 1IXNA 4OT1H 1NIFA 4PN6A 1HQRA 3UAEA 1H8NA 4JFOA 3U4KA 4IS6A 1JZ8A 1RZGB 2ED9A 3BSGA 3NO5A 5SV3A 1J1PH 2VM4A 4MYPA 1PV8A 4MCNA 4MJJA 3FSTA 1VKXA 4MD4A 3V0UA 4BCZA 4TPRH 1T22A 1WCGA 4GUGA 3SDDA 1NDGA 3IXAA 2DJUA 1RZKH 5AOKA 5JOFB 2ERJB 1TJXA 3AY4C 3QW4B 1CG9B 1Q13A 3JV5A 1R3HA 1I85C 4HPOL 2UWEA 3CHPA 3FCUB 5ADPL 5ICYA 3DJZA 5FKAA 5E0CA 2NXYC 4IX0A 1NC2A 1ZS8B 1HXMB 4UI2A 4NAMA 1C8QA 3C5XA 3X3FL 4LCUB 1G6RH 4XVTL 4NSKB 5HNUA 5I6XB 3CFJB 3W7MA 2G2PA 4NUPA 3U83A 4Q9RL 3KYMB 2F2KA 3BKJH 5HHNB 4R7WA 1TO4A 2J21A 2Y8VA 2QIWA 1NTDA 3GJEB 4QUOA 2R8SH 4RE4A 1RURH 2MNRA 2G4EA 4PBGA 4U1MB 2REQB 2R69H 4JFZH 4G7QB 4GAFB 2ZXWB 8RUCA 3FB6A 1BXBA 3AWNA 2B5IC 4UT6L 3LSOA 2ABBA 1EEZA 1V3HA 1A4JB 1H2JA 2DQJH 1LL6A 2A85A 2BOCB 1I1AA 2YKLH 5T3XE 4LL1A 4AQ1C 4LMQI 4F0LA 9PCYA 1L9SA 3AM8C 1RUQH 4XPFH 4KTGA 1O94A 3TPUB 2PGEA 1E27A 2CUHA 5DS2A 3ARWA 4FABL 35C8L 1T0NB 1E6ZA 3REQA 5D38A 3HMWH 3O4OC 1CLXA 4LV9A 4LF3B 2R1MA 2VR8A 2EH7L 4OF8A 3KLSA 3S3PA 3ULUH 2WMKA 1X5AA 2Z7WA 3O3RA 3ZT7A 2GSHA 4LPTA 4MQXD 3CNYA 2G9HB 1RHHB 2OK0L 4KNUA 3KVDD 3ILEA 2A83B 4TL5A 3TBBA 3W70A 1Z8AA 3W84A 1WX0A 4HGMA 1JF1B 3VNKA 3NQBA 3J8F7 4KEZA 1XDLA 1UD2A 3INPA 4L1XA 2G60H 3VABA 2NY3C 4IKJA 3PHQA 3P3SA 4PG9A 3CUGA 3GU9A 3WHXA 5AVSB 4FX7A 3BHBA 3F7LA 4QHLB 2A74B 5DX7A 3ALPA 2YPLE 3WCZA 5SX5H 4FAMA 3IBOA 1QNVA 3CXHJ 4JM4H 4AQZA 5A3IC 4Y16B 2HE5A 3ABZA 5ABFA 4HK7A 5HYJB 1ZLUH 4I5RA 1QABA 2ZXBA 3G6LA 3PG9A 3LJ3A 5EORH 5CJMA 5DMLA 3G6JE 3VGFA 3WLWD 1R0MA 5B38G 3QR2A 3FU8A 4R83A 1FLTX 3TCSA 3QB7C 1FL5B 2YWZA 4M1DH 5BQ7A 1TJHL 3I6KB 4DTGH 3PGCA 3QS2A 3V7AG 1NCWH 5C6TL 3S7GA 2MCPH 4HLZG 5JIKA 4Z7QE 1T6VN 2AP2A 2VM3A 4FQPA 1FJ1A 2VCOA 3RLHA 1OZTG 3G5ZA 1YDVA 3DU0A 1E6OH 1H0DB 1KM0A 5EF1A 1SLUA 1HH9B 3IVKA 5D7HA 3MZGB 1FYTA 3G04B 2HCVA 1SEQL 3VA6A 1CI1A 2QGHA 3AXKA 2PKDA 2VZ1A 5D2VA 2PFHA 2FB4H 2IGFH 1CE1L 2PTTB 3OIXA 3VIPA 1R47A 3EEZA 4X6DB 4ZE5A 3F2DA 3BN9D 4AGPA 2AQVA 4F7EB 2EG7A 2OOFA 2AXFB 5JDSA 4M8RA 3R1GL 4WUIA 4ZDHA 1ZALA 1E73M 1ZHLA 5IJVB 4XCFH 2FEEI 4X7FC 1MQQA 2R0ZH 2OTUA 1B3JA 4U3XA 3HA1A 5E94A 5AVRB 3HLAB 4HMEA 1U8KB 3DHJA 3CH9A 4ONFH 2MCAA 3C0LA 3WUFA 2PWEA 3GS7A 3HU7A 2BZNA 1KF9B 4UDTA 3FFCE 4L29B 1BQKA 2W80C 3ZIMA 1IL1B 4I87A 4JPVH 3HZYB 4Y1AD 3SPIA 4ENZA 1CXKA 3BEWA 4TR9A 3VSQA 1B0GB 3MBDA 4F7PB 1Q2RA 3ABMB 3U3HA 2YGQA 3LKSA 3AXXA 1KNOB 2J4WH 1SDAB 3S8FB 5GRYA 2I5GA 4YHML 2DU2A 1BV8A 4XI5D 3QUMH 4X0KB 1Y5XA 3OKDB 3QUZD 4DUVA 4Q6IB 2KQMA 3RPMA 2R4SL 1SJBA 3IGAA 1VYRA 5TGBB 3GEFA 5F2IA 5REQA 3NK4A 4GSDH 3D30A 1OE1A 1RZIA 4PJAA 5I1CL 1J5OL 1FAIH 3EOAA 4FS0A 2PCYA 4X6FB 1F3JB 4X4XB 4D8AA 3KNBA 4PG2C 3S1WA 1DZBA 3HC2A 5AHIA 1FLRL 3UWYA 2G50A 3CH1B 3WN6A 3QHNA 2HFEB 5DQ9A 1XFBA 5I1JL 3MP5A 3V3WA 3CPUA 1K2DA 3U8GA 1E8ZA 4DZ8B 3VWKD 3TVAA 3DDGA 2WZTA 3IETB 1QR4A 3I10A 2VAAA 4MA7H 1DZ0A 3U46A 4C5YA 2P44B 3TW7A 5BS0B 4OE7A 2IJ0C 3SDAC 5AW8B 4OFDA 5IIEB 3O4LA 3TTYA 5KSBA 1LQ0A 3AG2B 4XAPA 3MXWH 1F2QA 4X6BB 3HOJA 4GBXD 4PJ8A 3O9WB 3TOYA 5ADPH 4O14A 4AX7A 1S2VA 4PRAA 1M9SA 4AG4L 5ISZB 3QXDA 1F4XH 4L3EB 1SLVA 3PP3H 2XLLA 1S78D 3QXBA 5E2WL 3GC4A 3PAYA 4EZMA 1CGXA 5HNRA 3P5YA 5IKCB 3HQOA 3C9NA 2NSOA 2ZA2A 3DRTB 1VJSA 4HALA 4ZYKA 3B04A 3DVGA 3X13A 1AXSA 1LT7A 3AMDA 2Z4GA 2GQ9A 3ZM8A 2GTWA 2NQCA 3QRLA 2SFPA 4YC2C 1ISZA 3DMMB 1FL6A 5CGYC 4DK5A 4ZOCA 3DFSA 3WIAA 3RL1A 4X9GA 2WGNB 3VM5A 4E38A 3PS7A 4KJWD 3UL4A 3IF1A 3VAVA 5HSFA 5ERWB 2EH8H 2WJ5A 4XZHA 1TIMA 4X4YB 2HRGA 1AL8A 4YHYB 4F2TA 4OQTL 5HDRA 1QA9A 1FDLL 3BD4A 4U7SA 3CZJA 1BVNT 1OPGL 4JM2A 3T42A 4WU7B 3PR2A 5I71B 3ZLFA 3W7HA 2VQ1B 35C8H 5HYIA 1UASA 3RKDC 1LLWA 3LZNA 4GINA 3ZKMD 4DB7A 1HVQA 5T3XH 4TMCA 2X1QA 2Z93B 3CVBA 5KVFE 1H5BA 2Z26A 4MNJA 4MHHG 4LEQA 2VGLM 3T0EB 4LVBA 2YCJA 1E43A 1E6QM 1NKOA 3BFWA 1WDRA 2WLIB 4KW2A 5ECJE 4BBWA 1TVBB 3KGSA 4FQXD 1PD1A 1EDHA 5DLLA 1HKMA 2UX6A 8FABB 1PZ2A 2BP0B 1WUZA 4AD4A 2ZCHL 1CWYA 4NGHH 4BFFA 1K70A 4G8EA 1ADDA 2OMUA 4DM1A 3FVMA 2IQ9H 1HWWA 3OPUA 4ZFMA 3CH8A 3LPOA 2J7CA 1KIUA 2VDLL 3MHGA 2D31B 4A05A 3ME0B 4R88A 2VDNH 2Z1VA 4I0KA 3JWNG 4O2FB 4ZW7A 2YPKA 4R7XA 1EA9C 1TOXA 5AN7A 3GWQA 3QQNA 5J13B 2RAGA 3DGGA 1V3JA 5DCDA 2QADC 4LCWE 3F2CA 3THDA 3AIQA 1SHWA 4KCVA 2ZXQA 4P4RA 4F8XA 3NGFA 3WO8A 1J0KA 4DF0A 2H2SC 3M41A 5C92A 3FO2B 4LS1A 4AQEB 1CGTA 4N0YH 1KCRL 2NZ9D 4RNRB 4CGTA 5J11C 4PSRA 3I6GA 4TVDA 4TUOA 5A6BD 4CGUB 1OFRA 1IBHA 1ZLVH 3OYXA 4AWJC 1V7MH 2N1TE 5DD5L 2FB3A 1H7XA 1XXDC 3NZHL 1FFQA 2C8NA 2DKMA 4IIDA 4CMHB 1FF5A 3GS0A 1YYCA 1YADA 2XTJB 4UQBA 4W8LA 4HHLA 4L9LC 4GPNA 3JTTA 1NEZA 3LIUA 2DM2A 2FWUA 4Z08A 2EDTA 1NLBL 3HI6L 4CADA 5GGTA 5IW1A 4G11A 1UP3A 1WKYA 1TWWA 2W65A 5DEZA 4ZXBD 4Q32A 3AZRA 3VC6A 1AO7E 4Z2GA 2NZIA 3ITOA 4BK4A 3FUIA 2H3NB 1AGFB 5EMLA 4LV4A 3QYMA 3RFZC 4U1JB 5HATA 1SEQH 3HJZA 2AV1A 5C09D 3U30B 2EKSB 4FDWA 2AOSA 3LD8B 3JWOL 2X4NB 3FYEB 1TKWB 3CZ8A 1LD9B 3WQ6A 1IGFL 1UH3A 2WQXA 1KIPB 5AAMC 3LOWA 1W6TA 5HNTA 4LVNC 2ZCLH 4GKNA 2IUZA 1ZAGA 3R1GH 1E9OB 5E99L 4QRRB 4NO5A 3BLFA 3P69A 3PGDB 5TDPA 4PRDB 5C9JB 4FFYA 1KLFA 4X9IA 4E5TA 2XKNA 5IVZA 1FQ0A 1KTBA 3CJJA 1M68A 1UBSA 1KTLB 4JDZB 4GJTB 4RNHA 4PTUB 5AAWC 4ZENA 5JIIA 4OCRH 1QUNA 2J8UA 3TFCA 3QR1A 4XRCB 2CITA 2MWCA 4BQ2A 2QQKL 2ZVRA 2G0WA 3F4DA 1U8MB 1EERB 1KEML 1LP9A 2P50A 1WAAE 3P74A 4XD6A 3S37L 3FF8A 2IAMA 3B56A 4NHCH 2XWDA 3MLVL 5CPLA 5DJXB 4XNMB 3MR9B 3GUTB 3CLEL 2H2PC 1N8FA 2W59A 4MWAD 1YEJH 5IMMA 3SE3A 3R8HA 3I75B 4YMZA 5E9NA 4MMYB 4HLJA 3DARA 2VXVL 1J5OH 5FAGA 2MSPA 4JHAL 3GFZA 2TRSA 3UFYA 5H2ZA 5FA3A 2EVHA 1SXAA 3ARZA 4ZB0A 2P5WE 3TZVA 3QG7H 4G9PA 1XIFA 4WKZA 4N7QA 1PKYA 1VCGA 3L48A 1KM1A 2PPDA 4AI7A 1A2YB 3NSDA 4LDEB 4WK2B 5CHNA 2DQCL 4JTSA 3WFHA 3VCNA 1NAML 3CC1A 4OF6A 4N2OA 2CXKA 5IR1B 1AC0A 3LB6C 1NCOA 3LPWA 1CFNB 2P0OA 1FBAA 3ROOA 1E5BA 5AFAA 1XYAA 4KROC 1W32A 2QVHA 3TNMB 2L8AA 4LRSA 3TXZA 5CZRA 4UNIA 3L67A 4EXKA 4WGWB 4XNYL 4AG4H 4F2MA 1OAQL 2C3WA 1OZUA 3ARFA 3N14A 4PJDB 2CHNA 5E2WH 4NT0A 3DOSA 3I9IA 1XQ4A 4H9ZA 2F53A 2PE4A 1YQVH 3B2DC 5ID1B 4DVRH 5HYEA 4X4ZA 2Q5BA 7REQA 3VU1A 4LS0A 3DXAD 7XIMA 3A21A 3FUFA 1TIUA 4O51B 3LKPA 5HHPB 3ZVVA 4K9EC 4TVCA 4PV1C 4IEFB 1L7IH 1ID2A 2X0WA 5LHFA 3FTUA 4RNFA 4KITB 1MI5B 1P4BL 2D22A 2J27A 3EFFA 1YHPA 4HMNA 2WXPA 5GGUA 4LYPA 1NOLA 4PJGE 3MRGA 1O7DE 2PDFA 1EPXA 1X7IA 3D85A 3CFNA 4RMUA 2PB1A 5MEND 3E2QA 4XO6A 4TU1A 1AXIB 3EWUA 1TZIA 3PJNA 1N3NB 3CQ0A 3MRMA 5D7EA 1U3YA 2F5BH 1B90A 3GTFA 1QSEB 2ZOLB 4YHZL 3DDMA 3NTCL 3FONA 3WIIL 1ONQA 4WFGE 3IGSA 2AJSL 4OQTH 4HHHA 1MNNA 5GHWH 1OPGH 1TTJA 3EUDA 4QPEA 4QJ1A 4L4PA 1ISXA 3KBVA 2EDNA 4GCXA 3MOBL 1PY4A 2YMTA 4E42B 2GJ6B 3MCG1 2P5ED 4Z95H 4XNZB 5EA0H 2NV9A 2B7DT 2APWA 3MLTB 3RA7L 4TQEL 3PHOB 3KDMA 5DURD 4CC4A 2F54A 5BZAA 5CLWA 1XT5A 4HK6A 1AH1A 6REQA 5BRZD 3OF6A 5KVFH 4XMUA 4XN2A 3G18A 1V5JA 4WHCA 4Q7DA 5EBMB 1RU9H 5KSAB 1L6GA 3CPLB 4G71B 4QOKE 4J6IA 1C8VA 4LH8A 5JORA 4DZAA 4HCFA 2VDLH 5F9WB 1ZV2A 3F5LA 3TVMD 4Y4KC 1Z9SB 4GW1B 4XP4H 3TU6A 5DEGB 1XO8A 3UTTD 4RLDA 4KS0A 1ILUA 4P2RA 3SE4C 4KRLB 4IFRA 1BZOA 1JNNL 1HQRB 2DW5A 3DTUB 1BXXA 2FPYA 3FTSA 4JFOB 2EICA 1KNWA 3LK6A 2I25N 1KCRH 2NW0A 4IMLA 3IJQA 2BDQA 4DGUA 1ROWA 2IH9A 1VKXB 4MD4B 4BGLA 1GZPA 4M7SA 4OCLC 3DUSA 5LWYL 2X1UA 3A5VA 3NCMA 2A6LA 1T22B 3KBMA 1G84A 3F2BA 4JFXA 2QJIA 4GJIA 3DFYA 4TMBA 2X9ZA 3SDDB 1C7SA 3MRPA 3RUGF 1NDGB 1TF4A 2G3MA 3IXAB 1J5DA 4MA3A 5FYKE 3GIVA 2CLHA 2AXGA 3C3NA 2ZZ5A 5DJ6A 3S3BB 2DDQL 3GAKA 1D9EA 2UWEB 4N6FA 5AKRA 5FKAB 1L9QA 3TJEL 4U3HA 4JQVC 4TTDC 4Z7NB 1DBBL 4ODVH 4XP1L 1E8XA 5AVVB 3DC0A 4I5BB 4LHJB 4H8PA 1O9VA 3IT8D 5E9DD 4K3DH 1EGJL 3AHTA 3BPOB 2GCYA 4IIGA 1TJ1A 4YK4C 5GS0L 3GTIA 4QFUA 3JWOH 1KFAL 4DP9X 3WN5C 3QRFM 1UTDA 1S39A 1IGFH 4TIMA 3WH5A 4US5D 3RZCD 3ATZA 4HIEA 1SFJA 4J12A 2EDKA 4FTDA 1CIUA 1XZWA 3V0FA 4C60A 1HEJC 3V0GA 4N9CA 3B0YA 1RUPH 3WF2A 3UGVA 2OOGA 1BVWA 4MAYC 3RWDA 4JFEA 4PUUA 1TLKA 3GSWB 2ZRUA 3CB8A 5AB3A 3L4TA 4RZKA 3IE9A 4MA8H 1DQQB 3F4CA 3FB6B 4E2BA 4PMFA 4FXKA 1JXDA 2W5PA 3N5AA 3NFPB 1G7IB 1EEZB 2BSED 5FGCB 5C0CE 2UZYB 4XMPL 4W70A 1I1AB 1R5WA 2PDPA 1IIKA 1KEMH 1PYWA 1W6LA 1T7YA 1WCBA 3CZNA 1OGAA 3G1VA 2VLKD 1RI8A 1EF3A 3ZLHA 3MCNA 1AI1H 5DMMA 3H7UA 3REQB 2Y6ZA 3UTOA 1FZKA 3VKDA 3CLEH 3ABRA 2CLFA 1GKOA 1IIIA 3X12A 2IKHA 3HB3C 2CBPA 3CK5A 5A8PA 2A3LA 2DH2A 2VXVH 4ZFGL 4DFHA 1V7AA 4JHAH 4OZFG 4EWJA 3OJMB 5KJRL 4JKKA 2KC0A 4PZVA 3ARGA 3GKWH 5D7IE 5HGAA 3RZWA 2V6AA 2GJZA 5JHDE 3WQGA 5J6SA 3AU1A 1HKLH 2RALA 4GI4A 3LIZL 2BGQA 1FBIL 3P80A 4U1LB 1NAMH 1O9WA 4PG9B 4N2BA 1BX2B 3WHXB 4NWUH 1U8NA 4HWZA 3BHBB 4QHKJ 3LZFL 2JQMA 5JXAL 3QQDA 4P5TA 3ARDA 5GS2H 2ZSVA 5AVNA 2IS7A 4OKVA 2H9AB 2OJZH 1E5YA 4QR7A 4KHTH 1R19A 4ZB5A 3WMBA 5BWAA 4YOKA 5ABFB 3VNJA 3KWSA 4E0RA 3NURA 4FTVE 2FVKA 3E2VA 3MJMA 3MGAA 2HT3C 3EB3A 1A9VA 1BMZA 3QWQB 4GUPA 1EXBA 1OG6A 4HA1A 2UXFA 4E0CA 2PYEA 4OJYA 1QPXA 3TF4A 3PGCB 3D39D 3EBIA 4QTHB 1PZCA 5D1ZI 4JQ2A 1RCXB 3I50H 1DXIA 4RIRA 4XMTA 3D4GA 4BH8B 4JG1H 1Q6EA 1FUYA 3WFCL 3MNVA 3Q1SL 5ABGA 4XN9A 3G5ZB 3V8OA 4QTGA 1BZ8A 1MRFH 5DVLA 4B0MM 3IVKB 2A9DA 4YWGL 3NA8A 1FYTB 3ETBF 2MHAB 2EILB 3JZYA 4PWGA 3VD2A 4H8UA 4NM4L 1MHCB 1LWHA 2I9TB 2KQNA 1PBGA 5C6WH 2Y7LA 3VUPA 1HFBA 4NM8H 2E5CA 4YHZH 1SF5A 3WIIH 1C5CH 1BYOA 1K72A 5JDSB 1A4KB 2O61A 4YE4L 1N70A 3NYZA 5B80A 2IDSA 1ZHLB 2UXGA 1QW8A 2BVOA 4WUUD 3UGEA 1N55A 2EDWA 3G0SA 3DBXA 5E94B 3T3MF 2G3FA 1QYGL 5KZDA 4NBXB 4LSVL 5HDBE 2LVEA 4OZIE 1W37A 4N4PA 3MOBH 4DQAA 4UDTB 3H0TA 5DJ2B 3ESMA 3LZ3A 1FC1A 3W1TA 2YAFA 3FEQA 5LNDA 3W01A 1X5XA 2A1WL 1NGQH 1S38A 2HK1A 4HS3B 2AAVA 3RA7H 3FAXA 4TQEH 1DFBH 3D3VE 43C9A 3CXDL 3P3BA 4HK3J 2PPFA 4DF2A 5A40E 3PTQA 3S35X 1NIBA 4LLYB 3K91A 4AQOA 1K3IA 1OQFA 4HCHA 3VD4A 2VEGA 2RDTA 2B59A 2IXUA 3E8VA 3IGAB 5AW9B 4GX8A 1S5VA 5REQB 8XIAA 4UTFA 1X9RA 3C6SB 2A1YA 1RZIB 5B1JC 2JCCE 4LLWA 3H55A 3EOAB 3TN0D 3EXSA 4EQ2A 4O58L 3AZTA 3TX9A 2Y1VA 4H2AA 3TOPA 4PYGA 4HXBL 4R4NC 1JNNH 3OKOB 4ACZA 1WT5C 5IDIA 5ITBL 3WEOA 2NY4C 3PBMA 3ESNA 2VDGA 4G3YL 3WBAA 5CLYA 3PTMA 5AYZA 5I24A 4FPSA 1OCWL 5LHDA 5HMFA 3KWVA 3D2UA 3FKUS 1SNRA 1K2DB 2YD0A 1B9BA 2V37A 5I1GH 3FDWA 4O1BA 4DZIA 1JPFB 5LWYH 2XV0A 2VAAB 5CF3A 3QDGA 3NIDF 2UY7A 1M56B 4CSZA 5ESVB 3N0AA 1XTMA 2W0FA 3S96A 1HKIA 3JZUA 3NSFA 2OQLA 1UUMA 4WW1A 3ASNB 1URIA 3HMXA 1JDAA 4Q4SA 3MJWA 4EE2A 1F9CA 2DDQH 3DECA 4PJ8B 3LY6A 2AK4E 4PRAB 5IOKA 2FO8A 2BHUA 3TJEH 3QXDB 4F24A 5A6MA 1RKRA 1MFNA 5FYKH 1DTUA 1NFAA 3LRSA 4XP1H 5DHMC 1KBPA 3P4OA 3JTSA 3DIFA 4GAJL 2YFNA 4UBPC 1EGJH 2VLRE 3IGHX 5DHXB 1E8YA 3DVGB 5BU6A 1LEIB 4Y4FC 2G96A 4A8RA 4U1GC 3X13B 1AXSB 3FO9A 2OBGA 2E5BA 1KFAH 4DWSA 1LZOA 4CEUC 3FFSA 3E12A 5DRZB 1IO4C 2F7OA 2GTWB 4HTYA 4ANUA 3Q2VA 2OZ4L 2V6HA 4MDJA 3FPYA 4ALAL 3GEWB 4U7KA 3EKLA 1FL6B 2GFBB 1J0IA 2P47B 3RL1B 2OVLA 4QG8A 4A7SA 1PG7X 1SJMA 4PRWA 1QPPA 5IHUL 4JO2H 5DXXA 4JEGB 3IF1B 4Y2LA 1CUOA 2W27A 3N6JA 4U1IA 3SPHA 2VWTA 1KV7A 4HYWA 5T8GA 4Y19E 3SCSA 3DC8A 1CDBA 5C0JA 3P8IA 1KCUH 2V4LA 3IJYA 4HCLA 2F74A 2Q87A 1JK9A 2LQRA 4N9GA 3BEVB 1LF1A 3S2JA 2ZUQC 4GIYA 5C9XA 1H5BB 4L65A 4N90E 3S4SB 4NOFA 4ZFGH 4MVBD 4GNJA 1KCVL 5I1AA 3P67A 1GKPA 2PCEA 3H22A 5F93C 4MKNA 4HD9A 1X39A 4EN3D 5C3LD 4JX0A 1NICA 5AOMA 4G8EB 4P4KC 1TTQA 3GTNA 2OMUB 4FG4A 4M8VA 4OZGA 4EPDC 1KIUB 3NUKA 2Y9RT 3HE6C 1FBIH 2QF7A 5G4HC 4Z0BL 1HL9A 2YPKB 2IKIA 1TSHA 1NL0H 2WTRA 1YDNA 4NYYA 5JXAH 1B88A 3KCLA 4KUCD 3HCVA 1LJYA 4GXUM 3ITLA 3FSUA 1EFZA 4FP8H 4P4RB 4LVDA 3DSNA 1JJKA 1VESA 3BW2A 3ZSSA 1NWSA 1KT2B 1J5SA 4Z7WF 1QPOA 4Q22A 2ADIA 3O2VL 1WDSA 4TUOB 2ILLA 3WKQA 3KOZA 4DFIA 5HI5D 2WSDA 1NGWA 4R5VA 3ZKXB 3JVGC 3S3JA 3R4DA 4KNTA 3WUWG 1EUAA 4O02L 4F15C 5FYJE 2ZCZA 1IU1A 2XVKA 3JTTB 2OKTA 3FUJA 1HI6A 1XGQA 2JEQA 5D7KE 1XIBA 4PY7B 3GK8L 3OBEA 1E9ZB 1YSOA 2OMYA 1ES0B 3WV0A 1C1EL 1G6CA 4WTXA 2BNRD 1ZY9A 1MI3A 3JV4A 1S8DA 4FADA 2EECA 4QR6A 3WFCH 4D1IA 3UQNA 3IWUA 1ITCA 5FYJL 4XK2A 5I1DA 4KQNA 3D33A 3MOQA 4GRLC 2WNXA 3PWAA 1H0GA 2AV1B 4BFGA 3N4EA 1CLVA 4W5ZA 4H0IA 1ALDA 3WMPA 2X3AA 1FVPA 2VJ0A 4MIMA 3UWZA 2IPKA 1MRQA 3B5HA 2K1MA 4L4TA 4GKNB 3MRBA 3Q43A 4YE4H 4D9LL 4NO5B 4H7VA 2EXOA 5CCKL 3RVXC 4IBYA 2LHAA 5D1QA 3V6ZA 2J44A 2XKNB 5I3KA 1QYGH 1DBKH 4NAFA 4M93C 4PB4A 4Z0JA 2YJQA 1JRCA 3PREA 2PDBA 3W7DA 1FZMA 1QUNB 2J8UB 3F5KA 4Q58C 3DI2B 5B7EA 1ZGLP 3V5DA 3V4PB 1JGDB 3ZJ8A 3VFMB 3CXDH 4ZS6C 4OV5A 2ID5A 2LU3A 3QJSB 3TV8A 3TK7A 3UF9A 1C5BH 4F37F 4MJMA 3UU0A 2IAMB 4IJCA 1OTTC 2WCGA 2VD8A 1QI3A 4Q33A 3UNTA 3L6FB 4REQA 5H8MA 4IBUA 5BROA 2PZ0A 4XWUA 1BA9A 5IMMB 1AH0A 1QFPA 4NZRL 3KWWA 1NC4B 4HEMA 1KD0A 3L5WA 3WTSA 3HN5A 2D2JA 5I66B 1RSCA 3MV9D 4WEBL 1RZKC 3O2LA 1CLZL 3NDYA 2BP8A 2YD6A 2F68X 4YHNA 2ATMA 1L0YA 5FA3B 1NSNH 2G3NA 3TZVB 1G7PA 5BUPA 2NXZC 4CU7A 2DJ4A 4LB4A 2FZDA 3SGJA 5D6DC 4U10A 1XH0A 4A2LA 4G3YH 2F58H 3F4NA 3MFGB 2H26A 5EY5A 2CGYA 3QDME 5CHNB 3U2OA 5JU6A 3WFHB 3VOJA 1AGBA 2WHJA 4FF7A 2K45A 5K93A 1ZTXE 4S1QL 1VGAA 4JTJA 3RF9A 2DWYA 4PLNC 4PGEA 2AXHA 4H8NA 3WQ4A 3DX8A 3TJIA 5E8OA 3W25A 4R97C 3BVUA 2QVTA 3B1UA 1ZTXL 3KXFA 1E5JA 3QUXC 3BLDA 2YUXA 4OCSL 4AXWA 5EOTA 1Q94A 3CASA 1KB3A 5F4XA 2EIZB 4F2MB 4X5QA 4MRCA 1EZ2A 3RFRA 4S1FA 2BGNE 4GAJH 1Y18A 3LERA 2F53B 3JUZA 2A4ZA 3B6SA 1GVYA 4ODSL 4UV4H 2A4CA 7REQB 4A6YH 4JBRA 3W2DL 1BRLA 2GY7B 4UTAL 1V3IA 1NBVL 1A3XA 1VLWA 3LKPB 3FT2A 2GWGA 2Y5TA 3E1ZA 1XIGA 1NOFA 1P7KA 5JH1A 1TVHB 3GQYA 3R8RA 2Y7QA 3EO1B 2X4SB 4E41A 3EFFB 3OYZA 3OAZH 5GGUB 4B41A 2OZ4H 3B06A 5KS9A 2C5DC 3MRGB 2ZUXA 2F1AA 4DGYH 4M9PA 4UNTA 4XNAA 5HWJA 3BVVA 2BDNL 5L0QC 3D85B 4WJ5B 5IBTL 1YEDA 2HP4A 1ZTMA 2WV3A 3ULUC 1A4LA 1J05A 2G75A 5IHUH 1A3WA 1TZIB 3P0WA 4L3AA 3MRMB 3GSNA 2EGZA 4JFDD 4X61A 3QZAA 1A3RL 1CURA 1US3A 2WLLA 1OW0A 5C54A 4JTAA 4BE6A 5DJYA 4TVUA 3B8VA 1ONQB 1IRAY 2WO5A 2E86A 5EU3B 1AHKA 3T1WA 2QV5A 3SJVA 1E4XI 4HA3A 3FSOA 4CAGA 3GC3A 1OARL 1V93A 1JHLL 3GMPB 1FWIC 4R27A 3ARED 2VT0A 3SJNA 5HHOA 1JTOA 4R7LA 3QDJD 3MA9L 2A99A 4KCTA 2O7QA 1DIOA 1P5UA 4XZLX 5E09A 3RP1A 5F3HB 1W1VA 3KDMB 3QIWC 2F54B 4PI0A 6REQB 3CSBA 1GC1L 3G1FA 1MXDA 4B7IA 3P93A 4GY7A 3NXLA 5DEJA 4TS6A 1Z0NA 1AC6A 1CZ8H 4XAYA 4NL1A 4IIBA 1FNHA 2OI9C 3A4FA 4FL4C 3NPUA 2WHLA 1JUFA 3VXME 1TZZA 4HFUL 3LG3A 4Z3EA 3IEBA 3D07A 3M8OL 1BKHA 5PAZA 4NJGA 2PRLA 3L4ZA 3UOAB 2LLGA 2CERA 3EHBC 4B3ZA 4P2RB 2BVYA 3EOBB 3CU7A 1BG1A 1ECZA 5E7BA 4N86A 2ICES 1W72A 1GJUA 2HBVA 3DHUA 3KEHA 4IMLB 3W26A 5DA0B 1RJZA 3OXRA 2HKHL 2XBDA 4NASA 3D69A 3W1RA 2VM9A 4PTTA 1X4XA 2CKSA 1FH2A 4JFXB 4ZZFA 2A3CA 5HHXL 3FRPA 3T4CA 2BBFA 3MRPB 3EJUA 2ICEC 3C5ZD 3AJXA 1Q7ZA 2O6FA 4MA3B 3ANVA 2VR5A 1ANUA 5LAXA 2AXGB 5DN1A 1RULL 1RQ5A 3GHEH 1R8LA 1FZOB 3GK8H 3IPWA 5DJ6B 1GKRA 2RGSA 3E6HB 3PCYA 4J5VA 4P9ML 1PKMA 1RIHL 5FYJH 4GYBA 3EOSA 3S1GA 2BH0A 3TSDA 2ED7A 2F8OA 4Z7IA 1E4WL 4GXPA 5AC4A 4Q3MA 4PJCF 3HJ0A 5E5MA 1HE8A 1TE6A 4FFZA 3UO1L 4KI5F 2GCYB 3L08A 5A16A 1T5WB 3IEAA 5L8LB 3S6TA 3SDAD 4B4HA 1FCGA 4IMEA 2N4IA 4I48B 3W1ZA 4HIEB 3CEPA 1VYSX 3PF2A 3VXSE 3ISWA 3PJTA 4HB7A 4UANA 3ALGA 2MKWA 3VFOA 1F3DJ 3RWDB 4JFEB 5CCKH 2C4FU 2ZF8A 3KCJA 2BZDA 2VC6A 3PF3A 3FIGA 4F2EA 3GO2A 1Z2KA 3JTBA 2WWMC 1CLOL 1SF3A 3FJLA 5CPOA 4GFSA 2X44D 4FXKB 4YX2H 5DFAA 2OL3A 4Y8FA 5FO8B 1POJA 3PV7A 2CE6A 1IR1A 2I5YH 5FF0A 1R5WB 2QQLH 2QV2A 3VK5A 1VACA 5LCVH 1KENL 1H8OA 1WCBB 1OGAB 1OC6A 5HPMB 4NPKA 3SDCA 3VFGL 1T21A 4ZQPA 3K72A 1XINA 4P7NA 3LH2L 5E6YA 1DDHA 1WBHA 3L9BA 4FA6A 1DE4A 1FZKB 4U6VH 5JR1H 2H3KA 3EOTL 3X12B 2R4RH 2NCMA 2J8GA 1MVYA 2EIJB 3QFDB 4LQFH 4WEBH 1T40A 5F9JB 2ZSWA 4P2AA 4Q8UA 4DKFL 2DWEB 3RVUC 3SB3A 1H61A 2A5HA 1K03A 3H7RA 5D6CB 3EH3B 4OGAC 3W1XA 3ARGB 5F1KC 3II2A 4LSPH 4JY9A 4QLJA 1UWXH 3Q58A 2GJZB 2M2DA 2R82A 1X6UA 3W7LA 3MGOB 3QP3A 3RKDD 3CHFA 2Z7KA 2ALAA 4UTHA 5HDQL 3V8CA 3D9AL 3NH7H 3BSZA 2XUCA 4ENED 1JYXA 4H8QA 4HU0A 4HWZB 2EC8A 4ZOBA 4P5TB 5AW3B 3ARDB 2JFCA 3JSSA 2ZSVB 2XPGB 1M71B 4OKVB 5BPPA 5EBLB 3KXQA 3RTQC 2O5YL 4PBFA 3QA3A 3NSYA 2JKEA 2EDJA 2C9UA 4Y9BA 4OCSH 3KPSE 4WR3A 2Z7UA 4YHLH 4DKEL 3EPMA 5D7JD 3NL6A 2YW3A 3UG8A 2D7PA 1QI4A 4C4BA 2FJKA 2JB5L 3T6ZA 3VXTA 2R1PA 2NY6B 3H9SB 1SVZA 3DWTA 4GUPB 2PYEB 1VJZA 4ODSH 2KAUC 1QI5A 2PXYC 5IQ7L 2QADD 4UTAH 3QZNA 4EO5A 2X40A 2GTZB 1NBVH 4KDTC 2NTFA 4RIRB 5D04C 5CWSA 1MQKL 2G37A 2VQTA 3MNVB 1DQXA 5E51A 4G8IA 5FFOA 2YAPA 5EBWB 3MRNA 3UZXA 2XZ9A 4E8CA 1TREA 2BDNH 5GXBB 5E4EC 1UIPA 3LVEA 5IJCC 2C1OA 3E2SA 3RYSA 3APTA 2O30A 1LG1A 4ZZKA 1AKJD 3SFKA 4B5SA 1A3RH 1FCCA 3N9GL 4HPOH 3MRJA 1FL3A 3MLUL 3MTXA 5SWZE 2WYTA 1XR8B 4LHQB 1ZMYA 2O61B 3SGKC 1RLCL 4Z76A 5IQNA 4NKQB 3DBXB 1CL7I 3X3FH 5F4WA 3UAJC 3B43A 4ROQA 2P26A 4XVTH 3QO0A 4MFDA 3S42A 5E8NA 3MA9H 4XD4A 3T71A 3TBWA 2VDML 3ATEA 4Q9RH 2UX7A 1JNDA 3CSYA 3WH7A 4X6EA 4DHLA 1HNYA 1Q63A 2X8RA 3EBHA 2ZX6A 1AZUA 3K4ZA 43C9B 1U41A 1G7QA 4AJYV 4H5SA 1SOXA 3FDKA 1L0PA 3GZAA 1GC1H 1KJVA 3IV8A 2WXIA 2ACUA 5IB2B 1YNTB 3NCEB 2H90A 4Y9NA 2F6AA 3ZE0F 2B59B 2NW2A 1G1CA 2DEXX 3WJWA 3UPAA 3PWLA 2H9GB 2FTYA 4UT6H