2C8NA

The structure of a family 51 arabinofuranosidase, araf51, from clostridium thermocellum in complex with 1,3-linked arabinoside of xylobiose.
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
501
structure length
501
Chain Sequence
b'KKARMTVDKDYKIAEIDKRIYGSFVEHLGRAVYDGLYQPGNSKSDEDGFRKDVIELVKELNVPIIRYPGGNFVSNYFWEDGVGPVEDRPRRLDLAWKSIEPNQVGINEFAKWCKKVNAEIMMAVNLGTRGISDACNLLEYCNHPGGSKYSDMRIKHGVKEPHNIKVWCLGNAMDGPWQVGHKTMDEYGRIAEETARAMKMIDPSIELVACGSSSKDMPTFPQWEATVLDYAYDYVDYISLHQYYGNKENDTADFLAKSDDLDDFIRSVIATCDYIKAKKRSKKDIYLSFDEWNVWYHSNNEDANIMQNEPWRIAPPLLEDIYTFEDALLVGLMLITLMKHADRIKIACLAQLINVIAPIVTERNGGAAWRQTIFYPFMHASKYGRGIVLQPVINSPLHDTSKHEDVTDIESVAIYNEEKEEVTIFAVNRNIHEDIVLVSDVRGMKDYRLLEHIVLEHQDLKIRNSVNGEEVYPKNSDKSSFDDGILTSMLRRASWNVIRIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-L-ARABINOFURANOSIDASE
publication title Structural Insight Into the Ligand Specificity of a Thermostable Family 51 Arabinofuranosidase, Araf51, from Clostridium Thermocellum.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
total genus 171
structure length 501
sequence length 501
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06964 Alpha-L-AF_C Alpha-L-arabinofuranosidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2c8nA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2c8nA02
1EDGA 1OIFA 1Y7VA 3VMOA 5FL1A 4UZSA 2Y5EA 1ZJBA 4AZCB 4CKQA 3BLKA 3DECA 3VIIA 4UQEA 1GQLA 1V3JA 1ZBCA 1C93A 3T2OA 3OG2A 1E6SM 1GVYA 5D8WA 5HOSA 4S3KA 1JYVA 3SIMA 4B3LA 2DEPA 5D9PA 1E70M 4V2XA 1V02E 4EANA 4PN2A 3L2LA 3VX1A 3KEHA 4JFWA 4MAVA 4C7DA 3S5ZA 3M07A 1XRVA 2BVYA 3AMLA 4WJXA 4UTFA 3DC0A 4PCSA 4GO9A 4NRRA 3TTYA 2D20A 4HZ7A 3MKKA 4W86A 3WD2A 1XCXA 2X2JA 1WAWA 3U7VA 4CD8A 2J25A 1PAMA 1KQYA 4WK9A 4W7VA 2E3ZA 1ZU8A 1R86A 1LL4A 4WSKA 3BGAA 2VRKA 3NDZA 5HNNA 2CBJA 4OIFA 3BLPX 4PSPA 2J8GA 4Z2HA 4XX6A 5AC5A 1VRXA 3VIJA 3RJYA 4AZGA 3BUIA 3HN3A 1WP6A 3WQ5A 2GUYA 2A3EA 3CO4A 2GK1B 3BVTA 1DEDA 5I2UA 4FLSA 3F4VA 2OWWA 2J7CA 2D2OA 1EA9C 3II1A 3MMDA 3VD4A 3G6MA 3WY4A 2X8RA 4AIEA 3ZJKA 3TP4A 5I3DA 1WCGA 5DT5A 3SCPA 5CSYA 1LL6A 2WC7A 3BXWA 5BXPA 3ZM8A 4KWUA 1UASA 3ARQA 4NXSA 5EMYA 3W25A 1CGWA 3FHAA 3A4XA 1GVIA 2DQXA 1BLIA 1H2JA 3T08A 4KGJA 3RM9A 3UR7A 5HPCA 1ECEA 2CHNA 1NWUA 1I75A 1QW8A 3A47A 1LQ0A 1S46A 4Z2GA 1J12A 2GJPA 3CZJA 4EAMA 2BFGA 2XN0A 1E0WA 1H11A 1NWSA 4X0VA 2XHYA 2J79A 1TA3B 1MW2A 4UFJA 5IFPA 1NARA 1WDSA 1B2YA 4M80A 1TCMA 4F66A 4B9YA 1UA3A 4FLOA 3AHVA 2YOCA 1RP8A 1KXVA 2XM1A 2CBVA 3CHEA 1DHKA 4D1JA 1T0OA 5C8BB 2XN1A 1V0LA 2J7EA 2UY5A 4QFUA 1EQCA 3AZTA 1GNXA 3MSGA 2HISA 1WB0A 4FNUA 1KGWA 5CQ1A 3PZQA 2NW0A 1J0JA 1QBAA 2CESA 2PWFA 1BAGA 1XCWA 3VILA 2WNWA 3VGFA 3OLEA 2WZHA 2XGIA 2A3BA 3EJPA 1NH6A 2GDUA 4LYPA 5A6MA 3WQVA 4WKFA 1IV8A 4W5UA 1LWJA 2TAAA 1JXKA 1HTYA 1H4PA 3L4TA 3TTSA 2YL9A 4WSJA 4E4PA 3T09A 3BUBA 1O6IA 3MS8A 3H53A 2FHFA 4UNIA 1MVYA 2J7BA 4EK7A 2YA2A 2CCRA 5EB8A 1J0ZA 4AISA 3UERA 2VZOA 8A3HA 1XSIA 1Q6DA 5I24A 1HJWA 2CITA 1UHVA 5CPTA 2IGTA 2WPGA 2CBUA 1K9TA 3CZEA 1NOWA 1BG4A 2YDRA 3AOFA 1QI2A 4RE3A 2D24A 1VF8A 2AMGA 3DX3A 1EOKA 1AQ0A 3WENA 3NIYA 3VIHA 3PTMA 1W9DM 1UR9A 3GXTA 1C7SA 5GNYA 4U3CA 3WDIA 3EDFA 1MQQA 3MV01 3APGA 1XSKA 1E0VA 8CGTA 3NUKA 1E1FA 1JZ2A 1R87A 3MI6A 2GJXB 1J0HA 1HL9A 3TOPA 2WHJA 5CGMA 4KH2A 4W8LA 1AMYA 4DWSA 2CIPA 3ZO9A 2JF7A 3GH5A 2VZUA 3CHCA 5E9AA 2XN2A 3VMPA 4AWEA 5A2AA 2BV9A 3EJUA 2YFNA 4ACZA 3U5UA 1W2VA 4W84A 4WKAA 1GHSA 1GOMA 3ZOAA 4GINA 5D4YA 1US3A 2G3IA 3WNLA 4MB5A 3W6LA 1C90A 3GXMA 3AIQA 4GO8A 1V0KA 3DYMA 3W26A 4HMCA 3K46A 3ZMRA 3GTNA 3BUDA 2G3NA 3PN8A 4PBGA 1ITCA 1E3ZA 4XUYA 4FLQA 3OGSA 1QHOA 3EDEA 1HJQA 2WMKA 1R34A 3CZKA 1JFXA 1J9YA 1EQPA 4PMDA 5ECUA 2ZUMA 3VIFA 5IHRA 1QVBA 5D8ZA 1EO5A 3SCOA 4U33A 3HZ3A 2CPUA 3CUHA 5D9MA 4X0NA 4QDMA 4UQAA 3AHYA 1PEZA 3D52A 5A6LA 1YQ2A 1V3LA 4JFUA 3CV5A 2OWCA 1EO7A 3O2LA 1H09A 4GI9A 2W91A 3B8SA 5CPSA 3W82A 5A3HA 3W29A 1CXFA 3OLGA 2Y4SA 4D6EA 2DT1A 5CZKA 4J3XA 1Q6GA 1JZ4A 3ZSSA 5E0CA 5BWFA 1OINA 5E09A 2CKSA 2VL4A 5I6SA 4MDOA 2F7RA 2JE8A 4H8UA 3PHAA 4CUCA 4A4AA 3CUFA 2G8ZA 4KMQA 2JALA 5LA1A 2EPNA 3FW6A 3ZR5A 1O7AA 1TQVA 4D71A 1O7DC 4J27A 3VMNA 3GXPA 1BQCA 4MJ2A 5CXPA 1CPUA 2WLZA 1NQ6A 4H04A 1CXKA 3LPFA 1PIFA 2EEXA 1GPFA 4UQ9A 2F7QA 3IJ7A 2W92A 3WNMA 3EDJA 3LRLA 3BSGA 1LG1A 3VNZA 9CGTA 3GNOA 3W0KA 3CZGA 5FCZA 1QBBA 1UKOA 3ARPA 3RCNA 3ZJ8A 1HT6A 1R33A 3DX0A 2ZUSA 6TAAA 2YL5A 3I3EA 4AEEA 4CD4A 2Y8KA 4AC1X 3BCDA 1GJUA 5IHSA 4TVCA 2WHMA 4MNKA 4PMNA 1V6VA 4K68A 3ZQ9A 4KRUA 1OD8A 3EJQA 3T2QA 5A6JA 5ABFB 2WKGA 3LPGA 1E6RA 4QLJA 3ZT5A 2D73A 1JD9A 4FNTA 4FNSA 2WMHA 3GZAA 1GOOA 4FMVA 1JF6A 1ODUA 4PMYA 4OBSA 4BQ3A 4PEEA 1JYXA 1VBRA 1JFHA 4NF7A 2W61A 1ISWA 4U2ZA 1C3FA 2DDXA 1M01A 1LJYA 1VEOA 3AIVA 3A3HA 4H8VA 3ZJ7A 1G1YA 1OWQA 5LA0A 5M5DA 1CNVA 1VEMA 3AS2A 1RP9A 1KWKA 3MUY1 2E8YA 4A3HA 4E8CA 4HA4A 2BNJA 3WIJA 1UWUA 1XV8A 2UY3A 4DO4A 5DF0A 1E73M 3CHFA 4JL1A 1G5AA 4UR9A 2VVNA 4FNQA 4HTYA 1OGSA 4X9YA 2XGBA 1QNSA 3NYDA 1JZ3A 2ZXQA 5CSUA 3G6LA 4BQ2A 5A8QA 1CLVA 2FGLA 1GONA 3AHZA 1CXEA 1JXJA 1UH3A 5BCAA 1LL7A 5E6YA 3CZ8A 2AOSA 1D3CA 1JZ5A 1V3IA 2J78A 5IDIA 5A6BD 1G9HA 4LYQA 4AMCA 2QV4A 4Z2LA 2V5CA 3WEZA 1BPLB 3T0AA 1JNEA 1UWQA 2FDMA 1MXDA 4ACZB 1KWGA 3AS1A 5BYWA 4JKKA 5KEZA 3CUIA 4HOZA 3PZGA 1P6WA 1C7TA 5A69A 1WDRA 3WDJA 5D9NA 1WPCA 1GQIA 4U3AA 1YHTA 3KLKA 3VIKA 4M24A 4DUWA 4NI3A 3POHA 4RL3A 2VQUA 4JHOA 3VGDA 2XFRA 3OA5A 2QF8A 4W5ZA 2VZVA 1BVNP 2CHOA 2D0HA 3AXIA 1V3KA 5C70A 1D7FA 3AMKA 4U31A 2G41A 4GQRA 3IANA 2BY3A 5DEZA 4TOQA 6CGTA 1U33A 4JZ5A 2EBNA 4GIAA 5A6KA 4URIA 1UWTA 3LRKA 3ARTA 3D3AA 3SCWA 4LXFA 2VCBA 4B15A 1CXLA 2VX6A 3UG4A 3WF0A 3AISA 5I77A 2CKRA 1TZ7A 3HG3A 2JFEX 1W2PA 2BY0A 1ZBVA 2E40A 3WH8A 4L4OA 5M3WA 5TD4A 3HMCA 1GQJA 2YA0A 4RE2A 1UD3A 2VT0A 3PZMA 3AS0A 1EGZA 4Z2KA 3W37A 1VB9A 3LXAA 1MFVA 3SCNA 1GOIA 1UH2A 4H8HA 3N11A 3GBDA 3SCSA 1QWUA 1HL8A 3SUVA 4OJYA 3M46A 3IAQA 4HP5A 4PMQA 3ARUA 1TQTA 1F4AA 3N04A 4JFVA 4ATWA 1CTNA 4UOJA 1HJVA 3HG4A 3H55A 1XH1A 4YPJA 1XD0A 5A6SA 1L8NA 1M04A 1U30A 1CZ1A 2QLYA 3T0DA 3PZ9A 3VDCA 3WH9A 3WL1A 4A3YA 1CEOA 1B90A 4UZUA 1TR1A 1OT2A 4OUEA 3CLWA 1UKQA 3VU2A 2DGAA 2YBUA 1E1EA 1R7AA 4JHZA 2VRJA 3WD0A 4BQ5A 1I1WA 2VR5A 3CMGA 2A3HA 3GH4A 1VIWA 4UFKA 2F8QA 1XSJA 3L4WA 1DWHM 1MW3A 4F9DA 2J8FA 4GZEA 5A2BA 3VD3A 1HNYA 4W7WA 1KB3A 5A6AA 4YHGA 1B3YA 2VC9A 3LX9A 3NJ3A 1V02A 3F5KA 1A47A 2W4XA 1C92A 1OGBA 3N9KA 1Z32X 4CD6A 4R27A 2D1ZA 1TFVA 1HKMA 2WYSA 4GZJA 3KL3A 2WANA 4FLRA 1XGZA 3EMZA 2V3EA 2MANA 3W24A 1B3VA 5DT7A 5EFFA 1BF2A 2WHKA 2QPSA 1W32A 3SURA 3OLIA 1W9UA 5A8MA 3L2MA 2DH2A 3AHXA 1ISVA 2VVSA 5FIPA 1B1YA 2XYLA 4M82A 3BUPA 4XZWA 3BSHA 2BVDA 2XUCA 2DT2A 2G3MA 3W81A 2BY1A 1E72M 1GUVA 3GM8A 2GSJA 3DX2A 4Q7NA 4R5EA 1GZJA 1J18A 3AMGA 2F7OA 4BCEA 1FP9A 1BGAA 3K8LA 4TTGA 3MANA 1UH4A 3S6TA 3BAIA 2WHLA 3VM5A 1PZ3A 3A24A 3VDBA 1E5JA 1JI1A 1XHGA 5I23A 1KXQA 3ARRA 1MWOA 1UD2A 4NRSA 4NSBA 3VVGA 5JBDA 4B9ZA 3OGRA 2D3NA 4PMRA 3GXNA 4F79A 3GNRA 3S2CA 2XVKA 2D23A 4ZENA 1CGYA 2WM0A 1UG6A 4TX6A 1JL8A 1XC6A 1QNOA 3QOKA 2OW7A 4FK9A 1E4LA 4DO6A 4YN5A 4GXPA 3WNOA 3WDPP 2PBGA 1HP5A 3AI0A 1SMAA 3I3BA 3U57A 2EACA 4C7GA 1AVAA 1UWIA 3WL0A 3OIHA 1KQZA 1OB0A 2RGMA 2VO5A 3THCA 1PIGA 4MNMA 1HX0A 2DSZA 7TAAA 2F7PA 1N82A 2G3JA 3WUBA 3W6MA 3CBWA 1CXHA 4AYGA 2PI6A 4RE4A 5GPRA 2E9MA 1PJ9A 5HXMA 3A5VA 2EPMX 1E56A 1LLOA 1WZLA 1ZB5A 1QI0A 1JZ6A 1JDAA 3WD3A 2EQDA 3VNYA 4HA3A 1FOBA 1JD7A 1B3WA 2ZICA 4MADA 1GHRA 4TX8A 3CMJA 2XSAA 3UETA 4CCDA 3BMWA 2XFYA 1H0IA 3AMDA 2E4TA 4XV0A 3J7HA 4M56A 2ZIDA 3POCA 4CU8A 3AMCA 1FH7A 5F7UA 1EHAA 3WDRA 3BVWA 2F61A 2PWEA 3B9AA 4AEFA 1HWWA 2WSPA 3VX0A 2UWFA 2X2IA 1BTCA 4UFIA 2J74A 3RM4A 1SMDA 4XZBA 4HOWA 1E3XA 3PTQA 2J7HA 4PMUA 2D0GA 4AD3A 4B3KA 1CBGA 2CETA 5A8OA 1GOQA 3ALFA 3VD9A 2C7FA 1R75A 2GJRA 2J62A 2O92A 1JYWA 1H1NA 4E2OA 2XG9A 1KTCA 3VKKA 1ZBWA 4BZYA 3NSMA 3VSVA 5BRPA 1WKYA 3ZJ6A 3B9DA 5I0DA 5DO8A 2X0HA 4MPKA 3SUSA 2IXUA 1JAEA 1UQZA 2OWXA 1QPKA 3VUPA 3IJ8A 1F4HA 1RH9A 3BVXA 4NZJA 2YJQA 4W85A 3IGUA 1QX1A 3GDBA 1HIZA 2FE0A 3VD7A 3WH5A 2WVTA 1ZBKA 4MDPA 1SZNA 1JG9A 1ODZA 3FAWA 2WSKA 3PZVA 4AZ5A 3BAXA 2Z1KA 1E4IA 3VM7A 3ALGA 2PWDA 3UR8A 3WQ6A 4CVWA 5ABHA 3W28A 1TQUA 1MYRA 5A94A 2VMFA 4D6JA 3EBVA 2VRQA 4OOUA 3SUTA 3NDYA 5JBEA 2Y24A 4AMXA 2WMIA 1DP0A 5HBFA 4D6HA 1H41A 3MU7A 3NCOA 2IUZA 4W87A 4IM4A 5A1AA 1IZKA 2VNCA 3EYPA 1GJWA 4ATDA 1G01A 1CLXA 4JIEA 4MB4A 5AY7A 4AZ7A 3WELA 2VX4A 3VPLA 4LX4A 4AZCA 1V6YA 2FHBA 1UD6A 5I79A 4DUVA 1KCKA 1IZJA 2J75A 3WBAA 3L4XA 4C7FA 1EDQA 5I5RA 1RPKA 1TQWA 2X2YA 4DUXA 3WQ4A 1QWNA 4F9JA 2PF0A 4IPNB 4TVDA 1V0NA 5LYRA 2DIEA 2O9OA 3QR3A 3KL5A 3RILA 2YDQA 2DIJA 4H2CA 2XVLA 3FY1A 1TQSA 2DSKA 1EH9A 3DDFA 5CLTA 2X05A 1MW0A 1CXIA 2J4GA 4TTUA 1G94A 3L4UA 3AXHA 4BQ4A 2ZUUA 3SCQA 4PCTA 1SFSA 3EJRA 1E0XA 1I1XA 3OBAA 1JAKA 3RO8A 2VQTA 1PPIA 1ZJAA 1BYDA 2XPKA 4PTXA 3AXXA 2GFTA 4PMVA 4QP0A 1CENA 1JYNA 4TXEA 1UZ4A 2DSUA 4D6GA 3FN9A 5I78A 1KTBA 3ZT6A 1D2KA 2ZE0A 3DHPA 4GZIA 1FHDA 4N42A 4P7QA 4W89A 3WD1A 3CH9A 3S5YA 1AQMA 3RIKA 3KLLA 2W5FA 3AROA 4Q22A 3O6AA 1CIUA 1VFFA 1W3HA 1HKIA 2EABA 4D72A 1WZAA 4HMDA 2WLYA 5HDRA 5GNXA 4D6CA 2FH6A 1XD1A 2YLLA 3OZPA 2Y8VA 3WN6A 2ZXBA 3VIPA 1V0MA 2PC8A 2DT3A 4P8WA 3EDDA 1NOUA 1OIMA 3VTRA 2EADA 1W9BM 1K9FA 2D0FA 5FKYA 2FYVA 4HPGA 3QHMA 2BHYA 4P7NA 5CG0A 1JZ7A 4ZE4A 3SCUA 1WDPA 4UCFA 1W9PA 2W66A 5E0FA 5CPQA 4UQDA 3CIVA 4WF7A 3OZOA 4OKDA 2J7GA 2VX5A 4Z2IA 1E6QM 2UY4A 3NSNA 3WF2A 1MQPA 2WC4A 4KGLA 3VGGA 4JAWA 3VDHA 2J7DA 4AD2A 2QMKA 3CHDA 2WWCA 2FHCA 3BAJA 2ZUWA 3WBEA 4DWSB 3CUGA 3OLDA 3LRMA 3HJEA 4M29A 3OB8A 3A4AA 4PYSA 2G4FA 3DYOA 1UYQA 1UWSA 4P8VA 2W63A 1KXHA 2EJ1A 3D4ZA 1TA3A 2E9LA 2QPUA 3QGVA 4CCCA 1JIBA 1BYCA 2YL6A 3FAXA 1CDGA 3KZSA 4JL2A 4Z2JA 4CD5A 1FFRA 2VCCA 3WEOA 2BXZA 2FH8A 1QOXA 4AZIA 5E1QA 3AICA 4AD1A 5LA2A 1TE1A 4U5KA 4AMWA 2YFOA 1E6PA 3EMCA 5ABGA 4ACYA 4HOXA 4DO5A 4J7RA 1IT0A 2OLHA 1GCYA 4AYSA 2ZXAA 3MUIA 2QHAA 5BXRA 2XIIA 1TG7A 2WVSA 3WMCA 2XSBA 1UZ1A 2J77A 1C8QA 1HJUA 1QNPA 1EXPA 4D6DA 4M81A 1PX4A 2YDSA 4P7OA 1E4NA 3DDGA 2EO7A 3TTQA 4W8AA 4NXKA 4JFSA 2OYKA 1OGGA 2ESCA 2JF6A 4UOQA 4P7LA 2V3GA 1KFWA 1B9ZA 3VGEA 3VIOA 3QOMA 4HZ8A 3WMSA 1DWFM 5C71A 1LG2A 3IK2A 3UESA 2ZXDA 5BXTA 1QI3A 1HJXA 1HJSA 3PZOA 4AZBA 1E6NA 1MFUA 4MNLA 1EHNA 1NOFA 3GXIA 1V6XA 3ARVA 3W38A 4JKMA 4H7VA 4OOZA 1UR4A 4WLCA 3KE0A 1GOWA 2WVUA 2VI0A 4AD5A 1CYGA 5A2CA 2EPOA 2GJXA 2PB1A 3QHNA 1QHPA 1VFMA 4NZCA 2WXDM 2XVNA 5KZ6A 1E55A 5IFTA 1G0CA 1UR0A 4FF5A 4P8UA 4DM2A 2AAAA 3BLBA 3L4YA 2O9PA 3WQ8A 1HKJA 1KCLA 2YA1A 1FP8A 1V6WA 3WH6A 5A6BA 3H54A 1CGTA 4W8BA 1VAHA 1WZMA 2ZX5A 4V27A 5D9OA 1W3KA 4BA0A 4BF7A 1RD6A 2ZX7A 3A21A 3I3DA 5GNZA 5AYBA 3WF1A 1FH9A 4UFHA 3WY3A 1UD5A 1K9DA 2W62A 1V3HA 3K8MA 2CXGA 4HU0A 2VURA 4AZ6A 2NSXA 2WAGA 4ZEPA 5A8NA 1KXTA 3BH4A 4TUFA 3A22A 5BRQA 1KBBA 4PTVA 2ZX9A 4WKHA 1UD8A 2WMJA 3WKZA 3M6DA 1XH2A 4UOZA 3D50A 3F5LA 4CN1A 3AZRA 1ESWA 3CTTA 1UKSA 3HG5A 5E6ZA 4J3VA 3EJSA 1Q6EA 2OSXA 1UUQA 2JEQA 2CERA 1QHZA 3VGHA 1BGGA 4U5IA 1K9EA 4PMZA 3RM8A 3WUGA 2ZX6A 2WKLA 3WSUA 1ZL1A 1KR0A 2WBKA 2YKKA 4DWSD 3D4YA 3WEMA 3HG2A 5BROA 1M53A 1EDTA 1NP2A 1M03A 4IISA 1NWRA 1A3HA 4W88A 1MQRA 3AHTA 3SCTA 3AIUA 3SUUA 1E6ZA 1B0IA 1W1PA 4UFMA 4PUDA 1W3JA 3AIEA 1W3LA 3VIGA 2ZX8A 3WNPA 1M7XA 5AYIA 2O9TA 3LXCA 3N12A 5E70A 3LMYA 2OYLA 3WDHA 4J3SA 5DMYA 1DWGM 3BCFA 3MV11 1R46A 2E0PA 3GXDA 5IXEA 2WWDA 3WF4A 1J01A 2CNCA 2X0YA 3AIRA 3ARXA 2ZOXA 2DT0A 3O9NA 3VD5A 2WVVA 3B9EA 3RPMA 2VOTA 1PZ2A 2OYMA 4OBRA 1UKPA 2XVPA 2X09A 1H3GA 3LPPA 4H41A 5ABFA 3KL0A 3UG3A 4UFLA 4MNJA 1J0IA 3GBEA 5A95A 3ARZA 1E4MM 3VINA 3WFZA 1QNQA 1WE5A 1FFQA 1BSIA 1BVZA 3WY2A 2WMFA 1JDCA 3PZUA 4GI8A 4ATLA 1EIBA 1VENA 1B3XA 5CJ5A 2DSVA 3AS3A 4AY1A 1KGUA 1OBAA 1CGUA 1MXGA 3DX1A 2EXOA 2IXVA 4AZHA 2WW5A 3VO0A 4AIUA 3ZR6A 2XTKA 1QI4A 3T0BA 4CN4A 3BUQA 2XFFA 3AYRA 3SUWA 2WZIA 3ARSA 1MW1A 1UD4A 1VBUA 3BVVA 4GI6A 2F18A 3QHOA 2UY2A 3A6OA 4LQ1A 5AC4A 1BYAA 2XWDA 1B3ZA 1EOMA 4JKLA 4MB1A 1B31A 3IJ9A 3PZIA 1HVQA 3UCQA 1UWRA 4ZFMA 5JIWA 5EBAA 2ALWA 3WD4A 1WDQA 3K1DA 4UQCA 1UR8A 3MMUA 5JUVA 1NP0A 1QNRA 1NWTA 1X6NA 1W1TA 2YBTA 4EKJA 3LPOA 5FD0A 3K4DA 2PWHA 2DPEA 2V38A 3VOCA 2WMGA 2JIWA 2J7FA 3IAPA 3MMWA 3EDKA 4NX0A 3UG5A 2VTFA 2F1AA 3VSTA 1W1YA 5FL0A 1W9XA 2VR4A 3TV8A 2ZUTA 3THDA 3DYPA 3GXFA 3BC9A 1OM0A 2YLAA 2JIEA 1VJSA 3AIBA 1LWHA 1E40A 4FNPA 2PWGA 5EFDA 3N1AA 4LGXA 4YHEA 3WQWA 4BS0A 1UKTA 3UEQA 4D6IA 1X1NA 1R47A 3JUGA 3W4RA 3CZSA 1CGVA 2PBOA 3ZSTA 1JNDA 2RGLA 3AIWA 4MAZA 4DWSC 3W53A 4PTWA 4JCLA 4MB3A 3T2PA 3W27A 2XIBA 4AIOA 1OD0A 3F5JA 2VZSA 1W91A 1OCQA 4AW7A 1QI5A 1R7OA 2BHZA 4PUEA 1SR0A 3CZLA 1CWYA 3RDKA 2BHUA 4JCMA 1DWIM 4FNRA 5HPOA 3ZIZA 1NM9A 4CCEA 1TVNA 5ABEA 2E9BA 1BYBA 4CU7A 1Q4NX 1V03A 3EJTA 5CLWA 1XH0A 3BAKA 4TVUA 3VIMA 4B16A 3WMBA 1GORA 3ARYA 4AD0A 2WCGA 3BVUA 2A3CA 1UOKA 1V3MA 2A3AA 1SYTA 5BXSA 1FA2A 1TMQA 1JI2A 3MSDA 1JDDA 4GPNA 2OSWA 4J3WA 1C8YA 2XM2A 4PMXA 3GNPA 1PX3A 2ZUVA 4UQBA 3D51A 4KRTA 6A3HA 2WCSA 3TTOA 1J10A 3DHUA 4J3TA 1Q6CA 4DM1A 2WBGA 3HU7A 3TONA 1C8XA 4U2YA 2NT0A 1B30A 2WCAA 5JIPA 2XWEA 3AJ7A 3VSUA 4HMEA 2NT1A 3WNNA 4F8XA 4CD7A 2BVTA 2ZWZA 3A23A 3L4VA 3ZT7A 1JGIA 3U7BA 3N17A 4OZOA 1V6UA 1KGXA 3FHQA 1UQYA 1PX8A 2B31A 5A8PA 1VFOA 3WUFA 2ZWYA 2WK2A 4CGTA 2BS9A 2WB5A 1E6XM 1U2YA 2C0HA 4IUGA 4MJ4A 1ISYA 4QLLA 5DFAA 2YIHA 2WVVB 2V5DA 4J28A 1W9VA 5GQBA 1C91A 3MUAA 1E5NA 3K4AA 1XYZA 4PSRA 1W1VA 7CGTA 2X1IA 5M03A 1BFNA 1J11A 3ARWA 1DWJM 1KR1A 1OSEA 2VJXA 4LYRA 1QW9A 1PS3A 4PTMA 4Y7EA 1VFUA 1K6AA 4QCEA 1KBKA 4ZXLA 4M8UA 2J47A 4W7UA 3VGBA 3D5HA 2EAEA 4GQQA 1TUXA 3RMEA 3BMVA 1LF1A 4CN6A 1E15A 3EMQA 3AQUA 3BAWA 1HF6A 2D22A 3N15A 2GK1A 1R8LA 1WO2A 1PBGA 3E1F1 4QAWA 4ML4A 3CGTA 2DH3A 3PBGA 4V28A 1HKKA 2OW6A 4CVUA 3WFLA 4GKLA 4LPCA 4AXNA 4P8XA 1UR1A 2W67A 2FGZA 4PMOA 3RJXA 2VX7A 1Q6FA 1HVXA 4E8DA 4N0RA 4QCFA 2CYGA 4S3JA 2CEQA 1J0KA 4HZ6A 3A4WA 1ISZA 2E8ZA 3LXBA 3CZNA 4CU6A 5CGTA 3CC1A 3N18A 1UA7A 4OGZA 1FHLA 1VEPA 3FNDA 4P7RA 2XJ7A 2Q8XA 3BAYA 1TVPA 3CPUA 3K8KA 4D1IA 2DSWA 4J3UA 4L4PA 2WC3A 1HXKA 5JBFA 1US2A 2EPKX 1GQKA 4W93A 2C8NA 1FH8A 3NSXA 1HN1A 2F2HA 4PRWA 1L0PA 2EPLX 2VUYA 4ZXOA 1CECA 2ZUNA 1GW1A 2D3LA 1GOKA 3FXYA 1V08A 1VJZA 1X6LA 4NZFA 5FOOA 2O9RA 4ZE5A 2GDVA 3L4ZA 3PZTA 3M7SA 3SEPA 1ISXA 4HPHA 2Z1SA 3PTKA 2VZTA 4WIWA 3WY1A 1UR2A 1DTUA 4XB3A 2VCAA 3MUZ1 1JZ8A 2XVGA 4JFTA 3AZSA 4IPLA 1OT1A 2QMJA 1ITXA 4HU8A 1JF5A 1AQHA 4AD4A 3TA9A 3WH7A 2F1BA 2WZEA 5M17A 3WNKA 1HP4A 4QLKA 2X2HA 2BY2A 1H5VA 3DX4A 3WUEA 2YL8A 3N13A 2HVMA 2V3FA 2V3DA 1E71M 3OGVA 4D6FA 2OSYA 4M1RA 3GYCA 3CUJA 1HXJA 3MO4A 1BHGA 1J0YA 1BG9A 3KWXA 3PZNA 3SCRA 2Y2WA 3U5YA 1H49A 4MTVA 1ZS2A 1H0GA 3WF3A 1WZKA 1E9LA 2WMIB 3AFBA 1E43A 3GH7A 3SCVA 7A3HA 4HA1A 2BXYA 4EE9A 3ECQA 1DWAM 1WNOA 3WDQA 3AYSA 2JEPA 2GVYA 1R85A 2CBIA 1CGXA 1XYFA 3VDAA
chains in the Genus database with same CATH superfamily
3HNTL 3QCVH 3BLKA 1CDHA 4IOFC 1DO5A 3PY2A 4NC0B 5AZ0A 1PQZB 1LOSA 4R7NA 5EA0H 4B3LA 3HCVA 4H9VA 5DD0H 1SM3H 1D2PA 3P4LA 3JXAA 3L2LA 3VX1A 1BQLH 4M7JH 3VXNA 3AUVA 5HPMA 2EE2A 3RVXC 1SLXA 3FTGB 1KJ2L 4PCSA 4PJGF 5D2NB 3QCUH 5I8EB 4FR1A 3W73A 1SLVA 2HLFD 3PSVA 1JPEA 1T22A 3RGTA 1CZ8L 4Z2HA 1BJ1J 3HGSA 1AZRA 5JZ7C 4LKCA 3IUIA 2YQ2A 3HN3A 1KCUL 4IBYA 1O7SA 4DBSA 1VGKB 4Q4IA 4TV5A 1Z66A 4HZ1A 4JO5A 2P24B 1QOQA 5GS2H 1TV4A 1ZCOA 5CZ0A 3NRFA 1YYAA 3SB0A 5F72S 1FUNA 1LL6A 2WC7A 1VCBC 1V7ML 4O8RA 2OO0A 1CGWA 1ZCRA 5SX4H 3S3DB 4AT6B 2QNEA 4XGZB 4ZUWB 4JTSA 4P4KC 1N6QL 3DWTA 4GMSL 1P48A 2AJUH 4UTMA 4PB3A 3GIPA 3QG6B 5RUBA 4Y4KD 3O4LA 5E95B 4Y4HD 2Z7YA 1NPJA 2BW4A 3UTZA 5GSRB 3MSGA 3WLLA 4Y9NA 4DHLA 5J04A 3PZQA 3AB0C 4IKJA 5ICXB 3HG1D 3EWDA 2TPSA 4LT7A 4QHPA 5JPMA 3L7RA 3TCEA 3Q6FA 3WJZA 3BH8B 1C16A 1QR1B 4N2BA 5H2ZA 4WKFA 2V63A 1VBJA 3T09A 2AQOA 1P84K 1AC6A 2B9BA 5AVUB 1EC9A 1CFTA 2FYYA 3QYCA 1W0YT 3S47A 2AERT 4KUCF 4WUUA 5DR5H 4LEEA 2R1YB 1PSCA 1MQQA 1FZKB 1S7SA 4MKMA 1E0VA 4QG6A 2DQDL 3KS5A 4NZUL 4B9PA 1P6CA 5JLZB 2I5YH 1KB5A 1CE1H 3C3NA 4YWGL 4X6DF 1KPUA 1BFVH 3PGFL 3QRGL 2ZNWA 5A2AA 3Q06A 4HZLA 2DWXA 1PD6A 3PP4H 4HU3A 4PRPE 2P5EE 5F1KC 3DYMA 4GACA 4I88A 3W26A 3KOWA 1G0DA 4GWEA 3BUDA 3FULA 4FLQA 4XBPA 3WFHB 5DHXB 2C9RA 3BZEA 5IQ7L 3ZY7A 4HIIA 3IN2A 3T6VA 3G5ZB 3CUHA 2BIPA 5HQEA 1TMLA 3N4EA 1T66C 1SOXA 2CUHA 4OM1L 3MYPA 1UCTA 5FUCE 4XN7A 5JIIA 2ZWNA 4RSYA 3OEXA 4LUTA 1Q90A 3FFCD 3F4CA 5CZTA 1G43A 1MUJA 1JZ4A 2CCWA 2QCDB 1AH0A 4H8UA 4R9OA 2Q86B 1NGQL 1H5BB 3GXPA 1K7EA 1J2BA 2VWTA 4XNXH 3COOA 3MUGA 1GPFA 3LRLA 3QUZC 2ONEA 2Y61A 1D6VL 1GTEA 3DIPA 3FO2A 2VN3A 2WZ6A 4IFKA 1R33A 4JG5A 1G6RL 1DR9A 4OJFH 2VEIA 3S3GA 4ICXA 3M0JA 2BIIA 4OQ1A 3O4OC 3BOLA 1TLKA 5FUCC 3BWZA 5I8OL 2G9HA 3BZDA 1N5AA 1B0RA 4FALA 1JS4A 4ZT1A 4OBSA 3HQ1A 5FEPA 4IBLT 3DFHA 2WXOA 4M51A 4GW5A 3NK3A 5A3IC 1Y0LB 2OXGA 2DWDB 2F53A 3P0WA 1KCRH 3EKGA 3LZFL 3AS2A 3UBGA 3QGAC 1MIML 1SSGA 2ZYHA 2ICCA 4E8CA 5KVEL 4A8IA 4FX7A 1FCUA 2QAPA 1OOAA 4UR9A 4QXWA 1ONQB 2JKEA 3BKJH 4H1LG 1JZ3A 2C4FT 2CGZA 3LHAA 4NNCA 3QPXH 3SYAA 5DJAB 3BT2L 1EBAA 4M5YH 4W70A 4NSKB 1UC6A 1D3CA 1HIMH 1UEYA 3S5NA 4ONGL 3HBGA 4BY3A 4DIXA 2DEXX 3QAZB 3WEZA 3SE8H 4UIKH 4J2PA 2ESVE 5DZOA 2KQMA 4MMXB 1DL3A 4GIOA 4HW6A 1SUXA 4LEFA 3V4BA 4EI5C 2V69A 5IJVB 4FEIA 5FGRA 2FD6H 4PI2A 3UZVA 4FQJL 5B80A 2B7OA 25C8H 5IV2A 1XAKA 3EF4A 4FA8A 3QV6A 8FABB 5DEZA 2C3ZA 4AI7A 3RA7H 3ARTA 4TSCL 4HKJB 3KRZA 1DDTA 4U3HA 3CXHK 5FGCB 1OL0A 3W1NA 3LOWA 1QTWA 1ZP3A 3A6CL 1U8LB 4L8BA 1R3HB 4NYLB 5K59E 3VJ6A 1CDJA 2AGKA 4K07A 3JWOL 1ORSA 1KFEA 4PFMA 2MOQA 3TVMC 4TNVK 6FABL 4LOUC 5CP3H 3SZ6A 4Z0JA 3HG4A 1IIGA 4P2AA 5EMLA 4XN9A 4PB9L 5TK4A 3T0DA 1YNYA 3CQFA 3V4VB 5EEWA 3KM1A 1KEGH 2FBOJ 4JHZA 3WD0A 4Q8UA 3FRUA 3RWHA 1SXZA 1OP3K 4B41A 3S35H 4KIRA 4QYAA 3PJNA 4M4RB 4NYUA 3F5KA 2PP9A 1Z32X 1SJEB 1FIEA 3QWOA 2R29A 3GBNH 3NPSC 2E6QA 2QPXA 1EXBA 2WSRA 4MOZA 4U1JA 1B3VA 3X3FH 5JORB 4N2CA 2BOBB 1WYJA 1O12A 4POZC 2B1OA 4EX4A 4XPBH 4GSUA 3NPZB 3OAYK 4KNSA 2Z4QA 3IGFA 4ZCWA 3K8LA 1OADA 1Y6MR 3AWFA 1JI1A 2V37A 5BRZB 3N0PB 4IRSA 3NZHL 4DGUA 5DHDA 4NRSA 3O0RL 2D3NA 4B2DA 3H6OA 4H3DA 2WM0A 4N2FA 2D2GA 1RV6X 2Y07H 4F15B 1E4LA 2ZCLH 4FFZL 1ZA6A 3GHEL 4FOKA 1BX2B 4PUKA 4ZTYA 1GCFA 2HH0L 1PIGA 1D7BA 4AXWB 3QORB 3W6MA 4D2NA 4J8QA 4PJCF 4D3CH 4UTKA 1LRTA 4RE4A 5HHVL 4EIZC 2G2PA 1E56A 2OXNA 1NFDF 1AI1L 2EG6A 2X1OA 2CZ5A 2EQDA 1XDTT 2DLFL 2QVKA 2ZICA 5DK2A 1PKQE 4QOKD 3ZJAA 3W2JA 5CEZE 4O17A 4AUBA 2F5AL 3MMEA 4W4OA 1OTUC 2AZAA 5C0RH 5DBTA 2IMNA 5EUOB 1GZHA 1EHAA 1OKEA 3BVWA 4ZMQA 4N02A 4KWVA 3AY4C 2UZ9A 5D03A 2RQ8A 3EYVA 4F7KA 2SEBB 4OGQC 3NIFB 3ISYA 4EXPX 4JFYB 4HSOA 4P3CL 4ERSH 1CICD 1JN6A 5E2JA 2JCCA 2C7FA 2GJRA 4PULA 4PJDE 3R0NA 4KEUA 4IHBA 2HCVA 3Q1SH 5CEXB 3RU8L 5DO8A 3WFCL 2UZYB 5BMFH 4WFHE 1OD9A 1R3IL 3M44A 3VUPA 4GYPC 3IDJB 2OTDA 1NIAA 5ERWB 4JIHA 1QX1A 4ERAA 1JPKA 3H3PH 4XN2A 1VFAA 1TU2B 3VFPA 5JW3H 2QQNH 1HCFX 4PV1C 3VC6A 4Y2WA 3MJMA 2PWDA 1AY1L 2CBTA 3WFEL 5I00A 1JGEA 4ETQA 4ABQA 3TNMB 4AUJA 3CU1A 3ILPB 1WUZA 4CQCA 4MZRA 1YBQA 1FXQA 4O11A 5KAQF 3TC7A 1DTNA 2HMID 4D6HA 1L6WA 5A1AA 1TPEA 2DTML 2CO6B 4KAQH 4XBGB 5F7NC 3MBEB 2OLDA 3GTIA 3I84A 3O3AA 4X6CA 4V1DD 4DUVA 1FIGL 4N4YB 2INFA 1T1YA 1AODA 3KPSE 3RDTC 2DIEA 2VISB 4U6VL 4XNYH 3O6YX 3L1GA 1JPHA 5CLTA 3FONA 7PTDA 1Q6LA 5DGQA 4TTUA 3OPUA 4YJZL 4MQ7A 1FN4A 4GIRA 5I1JH 1EHXA 4ZXBA 3JVAA 5EU3B 1KTBA 2GVGA 4U3SA 5J3HC 1P7TA 3S5YA 2QQKL 2R8SL 1E6OH 1TYRA 4EUPH 2VFEA 5GNXA 3H2PA 1XBYA 1OEZW 4MXQC 5ADOL 2YUVA 2PC8A 4P8WA 4DEFA 3DJ9A 3T04D 1CI1A 4U0QB 4GABA 4KRPB 4PVMA 4DPAX 5ACZA 3NCYP 1I8IA 4E5XG 1REQA 2QUMA 2LOEA 5CPQA 2BP1A 2DFAA 5GZNC 3TYUA 4JRYB 4IMAA 2BCKA 1NGYB 4Z7NE 4FFZA 5JXAH 3ALPA 1JPSH 5GISL 3OLDA 3O81A 1XS2A 2JJTC 4M8QB 4YDVA 3QXWA 4IH3A 1DJQA 1HINH 4BQ9A 3D3VE 3UZWA 2I07B 2YL6A 2BVQA 2DQIL 3VFGL 4Z2JA 4CD5A 3IIPA 1IC1A 2VCCA 3M0MA 1UWFA 3W0WD 1DEEB 1XCQB 2VMJA 3N1QC 3L3DA 1R9YA 5DMKA 4JY9A 4L3FA 4N68A 4NFCA 1JRBA 2NYYC 1C8QA 3M16A 4PI0A 1ICQA 1NMCC 2HE5A 4DTGL 4UOQA 4ZB5A 2H3XC 3UYRL 4NENA 5K9KB 2WTPA 2IDUA 2VDML 4C6OA 3PBYA 2AJZA 3B7RL 3HPLB 1SZFA 1NEZB 5ALBH 3SO3B 4N2NA 2XFXB 4JTKA 4D9PA 1HZKA 1YN7A 1IM9A 4GXVL 3S2LA 4OZIB 1P7QB 4KRLB 4PREA 2DIBA 3TXZA 4N9DA 3JWNE 1UCBL 1J8KA 4HEMA 3C86A 5IMOB 4N9CA 2W60A 1F8MA 4LCIH 3GO2A 5I30L 1HJBC 1LO2L 5C0BA 5M1TA 4ELMF 1Q8MA 2ZX7A 2ISFA 2XHNA 4RNRA 3VKCA 1KEML 1CU4H 4J1UB 5I6PA 5G1MA 5A8NA 5GGSB 1XQLA 4TSAH 4CADB 2GPTA 1TTUA 2WMJA 4U10A 5T1KD 2VDRH 4CJ0A 4G5DA 1QYGH 2PTWA 2QDVA 4HAFA 3ZWSA 1N8OE 3RNDA 4L9XA 3QEGH 1NICA 4YYFA 3SSGA 3QFJB 4QHRA 1XLCA 3G1XA 4OVUA 4P06A 3FO1A 3ZYZA 4MJ5B 2NW3B 3MMTA 3CK0L 2H6PA 1NANI 3H2FA 4NJKA 3D4YA 4DWSD 2C1OB 1MRDH 1OFEA 2PLKA 4IISA 2CBMA 5EEZA 2J5LB 1U36A 4DP0X 4KV5E 5IQ9A 3I4KA 1P53A 4XX1E 1EJ7L 2HXTA 2FEEL 5KBLA 3NT0A 2DLIA 1Z6JT 5ID0A 5BS0D 1Q4WA 4H41A 1LXMA 2VO8A 1MDTA 2Y7SA 3MRHA 3WFZA 3UJTL 3X14A 3L95B 1ILSA 3G5WA 3ARFA 2DN7A 3CX5J 2DLHA 2RDTA 4G42B 5J9PB 1MCNA 3CQKA 2H8XA 1WFOA 3VO0A 5B39G 4HA0A 3FCSB 4U1SB 5CG7A 4J3ZA 3BPCA 4OLEA 4H26B 5AOZA 1BYAA 2P5NA 1Q9LA 4GSDL 5AZ2L 5CF3A 4HUWB 3ZVHA 1HOEA 1N59B 4LSUL 1TPH1 5J4MA 5L9DL 3LPOA 2GBTA 3B3IA 4Q6JA 4QS6A 5JXEA 2WMGA 2AXFA 4EN3C 4MA8L 2AV7B 4E6MA 3VSTA 4QHUB 3QJQB 3GLCA 3AO0A 1E9IA 4JNXA 3NJVA 2JIEA 3D33A 4LNYA 2P8MA 1E51A 3UEQA 1A22B 1Q9OA 3B1UA 3QUMA 1NEUA 1Y5WA 5C7HA 4MAZA 3W53A 2ANUA 3ZLHA 3F5JA 3SKJH 3TU6A 2QJHA 2HBVA 4BJLA 4JCMA 5C0CD 4DOHB 4HPJA 4XBMA 1QO3B 1AGEB 7PCYA 1JWMB 3KYKH 4S0HA 1S5HB 1K85A 2W27A 1OCWL 2WY3B 4L5FH 1ME7A 1MFEL 1JDDA 3RYSA 2OSWA 3GG1A 3GAKA 3PV7A 4L0YA 3S8FB 4DGYH 1E50A 5FX3A 2FAUA 3DHUA 1O4UA 1GYAA 4OGAC 3LG3A 3T9PA 4BQ6A 3HU7A 1SY6L 3TWAA 4WXZA 2HFFB 4YPGB 2FZBA 3Q13A 3TC6A 5GGTL 4J40A 4TTDC 3OAUL 4NN7B 2X4OA 2QADC 1TVBB 1PX8A 1NAKL 4LYKA 4NT6A 5HGGS 1EGJH 1C9DA 4TM9A 4PJXA 3L5LA 5E4IA 2YXGA 2YIHA 1ND0B 5IF0B 1Y5XA 2WINB 3CB8A 5M03A 4BFKA 1GC1H 4AMAA 4I7VA 4ICMA 5EEVA 3DOIA 1S9XA 4FKKA 4MD5B 2FFIA 2XNAB 2HJFB 3NH7L 3EYUL 1IHIA 2IPUG 4Y5YB 4MGXA 1C1EH 2WZ0A 3KJ4B 1WG3A 3MKCA 2NNRA 1J5OL 2DVUA 5GZOD 5IW6A 2CYGA 1M65A 3LDBC 2NY4B 2C15A 1WKDA 4TUOA 3H4WA 2WIMA 3MODH 3U4EB 4XVTL 2Z1WA 1FHLA 2XJ7A 2FBRA 1TVDA 3HRZA 2D03H 5EF2A 1JXDA 3OW1A 2OI9C 5KJ7E 4RFNC 1ZT4A 5JOFA 4M5TA 1RBAA 2I27N 2YLKA 3INUH 2WLHA 4ONFH 3LI1A 3NL5A 4XNBA 1T4KA 5D2LB 2H2SD 3L3KB 1P1ZB 1VJZA 4G8GD 2CC0A 3W9ZA 3L1OH 2YWYA 3SEPA 1AJ7L 5K9OA 3QWQB 4MMYA 2WXIA 3XIMA 3Q6GL 3L48A 3Q05A 4Y4KB 3G0UA 3TA9A 3PNWA 4TF4A 5AYTA 2XT1B 1Q9KB 3W1PA 4KROB 2WYIA 4GLEA 3QXBA 1W5NA 2EH8L 3QDGB 5AYQA 2Y36H 2X0SA 5IHWA 3TO4B 2F9RA 3U5YA 1IEBB 1XGTA 2BHFA 5F1NB 1E9LA 1V7NL 4Z5RB 2WMIB 1OE1A 3SCVA 2KLRA 3G18A 1XIGA 5JQ6H 1PVNA 3EYOB 2QCMA 4HYRA 5FO8A 1MIEH 1JGUH 3IJDA 3G04A 2HP4A 1F58H 2DWSA 1F6AA 5FB8B 2NYKA 5G1YA 5D8WA 2C3XA 2YBRA 1JYVA 4TNGA 4S1DD 1V02E 4KKAC 1SYVB 3KEHA 5KSAD 3DO7A 2YOAA 1YUHB 4NQCA 3MTWA 5DC9B 3TV3H 3KWTA 2AGJL 4E41E 3PB2A 1YLVA 5DEGB 2HZHA 3SPIA 2D20A 4JFFD 2BSED 2FKPA 1TQCC 3U4BH 5KBDA 4LBUA 4ZPVA 4FQIL 2RCSH 4R2GD 2IFFH 3OMIB 5XIAA 3N25A 5HNNA 3DBNA 1PLAA 3BLPX 3KDMB 3GSUA 4FQXA 1CLYL 4NO3B 1BYPA 3RJYA 2Y5TA 3QEQB 3P1VA 3EWWA 5CD3B 5GGTA 1YTEA 3FSOA 1U95B 3V5CA 2FSDA 3V0SA 5CZXD 2ISDA 2WCPA 4AYEC 1BWMA 3P8JA 1IBGL 5LDUA 3P73A 3ZM8A 4CNSA 4L8SA 2NY0C 2HT3C 4XAKE 1SVDA 5KTEL 4RW5A 2YK1H 2FRGP 3M0HA 4EUPB 4MNHA 3CZJA 3EJCA 1H11A 5JPNB 3WUWB 3I6KA 4YTUA 1G0XA 1UA3A 3UCRA 1RP8A 4HJIA 3T0EC 4I0PA 1T2QH 1DJNA 1XMEB 2A77L 3F12B 1XLDA 3VILA 3DO3A 5EZPA 1FSKC 4IMDA 3OLEA 1I53A 2A3BA 2IEPA 1HO4A 4OJAA 4F7EB 2TAAA 1NOLA 4I3RL 5EU4A 4PFHA 1MFCH 4FKEA 3TEVA 2VZOA 5D1ZC 1BG4A 1N4XL 1HAUA 4GW1A 2OQJB 4YK4C 2HXUA 4CC1A 5BXFB 4JDEA 1Z5YD 3A5FA 5CBIA 2KKQA 5CSZB 4FXGC 4WWKA 3BGFB 2GJXB 3BP5B 4RDVA 3G5VB 2F6KA 1YNTA 1A1OB 5E9AA 1S7RB 1MHPH 1LLWA 4M6QA 4ACZA 1BWVA 4JAMA 2BVOB 1HEJC 1JFQL 2YAFA 4H1LH 3WO8A 2P0OA 4FF9A 5D4YA 4MB5A 1C90A 1LO0L 3KP0A 3S34L 1EVTC 3D6NA 3RX8A 5J12C 4Y9EA 1ITCA 1IR1A 1GXEA 4Z0BH 4DGIH 2WMKA 1H7WA 4J39A 1VLIA 2MCAA 4PRHD 3BVJA 3EF7A 4XP1L 4X7SL 4HUVA 3SCOA 1U93A 5CP7B 3DBXB 4N6RB 3W7DA 4KTEL 5KBMA 4UUJB 1OP5K 3CV5A 1S9YB 2IANA 2OWCA 1EO7A 5FYKH 1KLFB 5AC8A 5A3HA 1F73A 4G7VH 3BJSA 4XIAA 3W3BA 4UAOC 4L6DA 5DK0A 1CDYA 1TZHB 1LEIB 3VDGA 4OCYL 2X3BA 3RWJB 3A6BL 3IU3B 1MVUB 2ENJA 1A0QL 1QEXA 4JDTL 4LIQE 4GBUA 5D2YA 1LEGB 3NSYA 4Z7VE 4M1BA 4Y5VB 1F02I 2AI0L 3SY0A 1A6UH 1NDTA 3DRTA 1UYWL 2FZ3B 1DVTA 9CGTA 2VDRB 3W2MA 4OZFA 3QR2A 1E2VA 2ZCGA 2PP8A 4K68A 5CBEB 3L4CA 3CLFL 4JHAL 3O6KH 4MVBC 4EI6A 4HC1L 3FB7B 1IKNC 2NV9A 4FNTA 4FNSA 1PFOA 1NAL1 1S7UB 3W86A 3T8XB 3H6AA 1AGDB 5F9AC 1VEOA 1BQHA 5LA0A 2YPKA 4OQTL 2WV8A 3G3LA 1AHWC 1LLZA 4PV9A 1UWUA 4L1DA 1JP5A 1FG2A 1T1XB 4JL1A 2Q20A 2OGYA 4FNQA 2GGGA 1OGSA 2PCFA 2NY3C 3TBYA 3KWUA 4QXGH 3ZE2B 1NY1A 3W7RA 3EGDA 4CJ1A 2ACUA 4XCEB 3PE9A 1A5UA 1CLVA 2PTVA 1E67A 4KEVA 4YVXA 4NP4H 3ILQD 3MP4A 4LSBA 3GUTB 1I9CB 3P11L 2AOSA 3TA3A 4PJEB 2OMBA 2J78A 3GG7A 5T33H 3FMGL 3LERA 4OD3H 2OMWA 3IARA 2PR4H 5C7XH 1JNEA 3GMRA 4UTWC 4JIIX 4MZYA 3EKCA 3IIZA 1PWLA 4HUUA 2YSWA 4HYTB 2AJYH 5J11B 3CDGA 1DFBH 3UZEA 4WY0A 3T8VA 4WNQA 4WRLA 1MEIA 3QPYA 5F7KC 1EP2A 1W72A 3UYOD 1FFNA 1V3KA 1OZUA 3GVRA 3FT4A 3G08B 3D46A 4L1SA 4UILL 3VQMA 2B39A 1QABA 6REQA 4Y2LA 3LCLA 2EXTA 1A6PA 4LLUB 3V4LA 3G6DL 1TZ7A 1XL4A 5ICZA 4O4WA 1CFBA 2BY0A 5DJ6B 2A9AA 5I6NA 3NGJA 3TQ0A 1GKEA 1OWWA 5DRNB 1GRWA 4Q0XH 2PW2A 2YA0A 3AS0A 4KHXL 1EGZA 3KH3A 3TR2A 2G4EA 2Y7EA 2LE9A 3CDYA 3R4RA 5HNRA 2INEA 1WUEA 4G8FA 1WWCA 3N11A 2Q87A 3XINA 2KL6A 2V5KA 3M46A 2PDCA 2Z31D 1ZGDA 4UU9A 3NVTA 2QGBA 4Y7MA 3FXIC 4M6NH 4BCZA 3FYIB 1X9UA 3H55A 5I5MA 2BSRB 4XVSL 1JCYA 1AQFA 3L9EA 1KUMA 5GRUL 3IJHB 3QEUB 4O02H 4S1RH 3OR6B 3MV8A 5AAPA 4Z7AA 2E7BA 2Z0UA 1Q0XL 1DWHM 5G1TA 4F9DA 3VD3A 5A6AA 2Y5SA 2A1WL 1NC2B 2A0LD 5DXXA 1FWFC 5HYJD 4I3SL 5EOQH 3RMJA 2WANA 3O6MH 3KS6A 4U1LA 5F9WC 5HDQH 2H3KA 4L4LA 3Q2WA 4Y6GA 2WXMA 3IS0X 4FOUA 5FPIA 5A8MA 3L2MA 1RY0A 2F54E 4ALAH 1R3TA 1NZRA 2BY1A 5CAYB 5C3IA 1JF1A 2QAFA 3TLRA 4MSSA 4BCEA 4O4YH 4TTGA 3BAIA 3B6SB 3FUIA 1X5ZA 1KV5A 1XF0A 2J3SA 5DDHB 1PZ3A 4JFHE 3PYCA 1FI8C 3AT0A 1WXZA 4HC1A 1IKFH 3V52H 4I2XE 4DP4X 3CVIH 3H2NA 3US1A 1F3JA 3DXAB 2EG8A 1GSMA 2VERN 3WN5C 2IADB 3RU8X 3LQZA 4Q52A 4JPQA 3FK4A 3OYZA 2F19H 5IM7B 4YN5A 3WJJA 2XPGB 2BNUA 5KMYA 4D0DB 1AVAA 2W80C 1UACH 3WL0A 3I68A 1ZGLA 1ZTXE 5AB0A 1HYRC 3DETC 1OPGL 1HX0A 3ES7A 4P2YA 1KNOA 4YLWA 3TCXA 3PAZA 3P0VH 1N67A 3H23A 1QJWA 2FGBA 3VNYA 2J6EL 1UURA 1I9EA 5B8CC 1WBHA 1JV5B 2Z25A 1ZT1A 3I2CH 2EVIA 4RUBA 4YIWA 3AMDA 3VCLB 3C60D 1CW2A 3POCA 3E96A 2R91A 4Y88A 4FQQB 2I9UA 5DRWA 2FLIA 2HDJA 5C0JB 2J74A 4GHRA 3J8F7 2E6YA 4JB9L 3CLMA 3SYPA 2I7OA 4PMUA 1F1DA 2J8UA 3MUJA 1AH1A 1CBGA 7ENLA 3VNKA 1R75A 4IQHA 2IPJA 4YSPA 1XO8A 3RAJL 2VFDA 4C56E 4GCXA 4BZYA 1XCTA 3EKLA 1TO4A 4ZW6A 5FDWB 5GJSH 2HQAA 3BQUB 2HFEB 2JWYA 2YR1A 2G96A 4G6FD 1RD5A 5E08H 3SFKA 4JG0H 5L7XH 1H3UA 1F18A 4FR6A 2WQWA 1FRGL 3TYGL 4KU1A 3K6SA 4R88A 1ODZA 1A9EA 1FNLA 3NRPA 5F21B 4X4YB 1ETJA 2OK0H 5JW4N 3UJRA 4K23L 3BD3A 3V0GA 2TSYA 3S88L 4I77L 3P0YL 1K4GA 3RN6A 5JW4M 2VFHA 3IRCA 1WUFA 1ZANL 3F1QA 4FC3E 5G5DB 4AGMA 3EYPA 5MENE 3OP2A 2GOKA 2E1WA 3FB5A 4UINH 1DJZA 3TN0A 1MFDH 1A3RH 3UXIA 1KFCA 1ZLPA 4GG8B 3O6DA 1GJPA 1K8IA 5LYRA 2MTPA 4Z1PA 3LV3A 3WLKX 2BVWA 1CXIA 3M8OL 1XFCA 5F9OL 2ZUUA 3SDXB 4B6ZA 4B27A 4HFWB 1JAKA 2VQTA 3R0DA 1YEHL 1XGPB 5FXCH 1GR7A 5HMFA 4M6VA 1JYNA 3UU0A 3DHPA 2DUZA 3SRFA 4DKDC 3OHXB 1AQMA 5AFAA 3NJKA 1CIUA 1W3HA 3PWAA 3JU2A 1ZXKA 3EZ8A 1N55A 2YLLA 2UZXB 2C91A 1JPMA 1BXAA 3VXUE 1NTDA 1JGDA 3HE7B 2JI1A 2EDOA 4NPYB 5HYQA 4XBJA 5K39A 4XP6L 4Q4RA 1GG1A 1FPTH 3GVVA 3AAZA 3RIFK 3LZQA 4B53A 2IH3A 1ALDA 4FYTA 1NCUA 4DWSB 1EUTA 3I7QA 4U1GC 3D30A 3H2WA 1X7FA 3VTTA 1HL2A 4MJ6A 4OFDA 2JVUA 3PABB 1FKXA 5HHMB 2J6EA 1M56B 3E0LA 2FPYA 3ZGIA 4M9OA 2CLEA 5LIUX 4LQFH 4ZFCA 4QISA 2N0KA 4HZMA 2A9BA 4YVPA 2V17H 2CBPA 1TMHA 4MS8C 4LSPL 4XWGL 5BNKA 1FL6B 4JUSA 2QDEA 3O9WC 3OVPA 1SHXA 3DDGA 4H13C 2Z28A 2LHAA 3SKMB 1TOXA 4H1LB 3MA7A 2YWZA 5B38B 1DWFM 3BPLB 4XPHL 5EUOF 1NTHA 2BK8A 4W9JC 4AWTA 1TYJA 3O2VL 3NIFF 3QNYB 3P9LB 4TULH 1ZALA 5AN7A 4IFRA 1VFMA 4NZCA 2Z65C 2Z92B 3K74B 1ZAGA 2AAAA 5E8PA 1UXWB 4HCGA 3R18A 2O9PA 1G1KA 4HT1H 3WQ8A 4PJ9B 1U8PA 2R14A 3RGVD 2J20A 1IT8A 1F56A 1CGTA 3QUXA 4CSSA 1FWTA 1VAHA 3VXQB 1WZMA 5D9OA 3SBQA 3UIYA 4DETA 3NTCL 5GNZA 1QMLA 4L4TB 1KYAA 1GYMA 2BSCA 3WXWL 3V95A 3TA6A 4GUQA 5BRQA 2P3YA 4AX3A 1H15A 2BP0B 2GI0A 4KKCD 2PNDA 3KOFA 3SGJA 4M3PA 4RRPA 1YC7A 1UKSA 3N6YA 1Q6EA 4AKOA 3TTEA 5C0CB 3KPRE 2CDFA 5HD8C 4EDXA 1THCA 3MNZA 3WUGA 4X6EA 2F58L 3WSUA 3FEQA 3HC0A 4IG2B 3T8MA 3JUYA 3ZXAC 1XF1A 4Y4FB 3MCKB 1NP2A 1QNIA 4L61A 5F4SA 4RCAA 4HMNA 3SY1A 1J9TA 2HYMA 4AC7C 3PJUA 3WNPA 5IOKA 5MHSD 1BD2D 5T1MB 1EP1A 4Y2DC 4KPHH 5AAMA 2P43B 1PKNA 4LAKA 5IXEA 3AIRA 4YQXH 2NVCA 3RU6A 4HCIA 4PJBE 3HEIB 5JIKA 2DDQL 4BZ2L 1OOWA 1W5OA 3UW6A 4L1LA 2ITEA 1VLWA 3PF2A 1JDCA 4L56A 4ATLA 2CLKA 1EIBA 2EE0A 5MKGA 3SDOA 2ZCZA 2WXHA 3EBIA 3FB8A 2GGHA 1KTJA 2Z3FA 4AZHA 1XF3A 4OCSH 2A4ZA 3O6LL 1Z42A 3S0PA 1Y1DA 4FXJA 1OX4A 5I1CH 2EDTA 3B2MA 4PWEA 4LCCA 3S3SA 3ITGA 3F4WA 2CUAA 4KBPA 3SDDB 1ZS8B 3THQA 1P5UC 1ACYL 2J6VA 4ZFMA 3DMMC 3OTRA 5KW9L 4DW2L 4UV7H 1MWAA 3THMH 2FQDA 1FVPA 2W0LA 4H88L 2PXYB 2VLME 1D9KC 3RX4A 2VR3A 5LGYA 3GU2A 5DO2C 4APQA 2OR9L 4L9LB 1G1OA 1E6JL 4YZWA 2FWOB 3RURA 4O5LH 1KTDB 2XA8H 3AIBA 1E40A 5K69A 2D7PA 3UJ2A 1ZV2A 1FNSL 2NZ1A 4E4FA 2WW8A 5FO2A 4IMLB 1TCRB 2VLKB 5DCDA 5JHDE 5HAOA 3DUUA 3T6XA 4PUEA 2Z7ZA 1Y5VA 5D1QB 1FBIH 1Z69A 4OCRH 3WNIA 1PD1A 3QI9B 4LO9A 5K9JL 4YXHH 3VIMA 1LUCA 1JI2A 4UM9B 3OGOE 4NRZB 4BQ8A 4O02B 3K91A 4RISH 3GLAA 5BZWB 2R8WA 3MWAA 5LKYA 5DCEA 5LAXA 1OFBA 3B40A 4OZIF 3EOSA 4NQDA 3AYVA 2AEPL 4U2YA 1W0WA 1B30A 1M2VA 2XWEA 1ZSHA 3T78A 3CSFA 1KJ2A 1TNNA 4H00A 1I7TA 5DXWA 4DBWA 1SHSA 4KZDL 3QUYD 3MRMA 3K0WA 3HC4L 3MAWA 3VWKD 1DE4A 3JTSA 4L9DA 1ISYA 2OTPA 5IFJA 2PTXA 1J11A 1NPUA 4B5XA 4R9HA 3ARWA 5KSAB 3E3HA 5DT1H 2VXQH 4LYRA 4XQ6A 2CXEA 2NQLA 2PMZA 1FYTA 1W8EA 5AOUA 5AYXA 4JTGA 3FQRB 2XOTA 1EJSC 4EBQH 4R2GB 3LKNB 5HJDA 4JHMA 1YMME 1BIIB 4JPIB 1GA2A 2B81A 2AC0A 3RKPA 2MTAA 4WEEA 2PODA 4HCRH 4FAAB 1QR4A 4HUMB 3VI4A 1CFQB 3A4WA 4XNUH 4CU6A 2VEGA 1RZ7L 3NEVA 2PGRA 3ZGHA 3SJ3A 1P0SE 1TVPA 2KX9A 3GE7A 1WTGT 5J8OA 3TAKA 4XH2A 4NKMA 2O7QA 2NOYA 3ABGA 3IN0A 3NZQA 3NYKA 2Z7WA 4ZE5A 1V7YA 2NXIA 3L3OB 2AXJA 3PTKA 4PGEB 4AQOA 3RTQD 3NQ8A 5K33A 4L5ZA 3MUZ1 1X7SA 3GS7A 3GSVB 4E9SA 4HU8A 3D39D 5FOBB 5I1AB 2WZEA 3LN3A 3KPOA 1PDYA 4FTVB 4IMKC 3MLWL 5F89B 4XO6A 2ADFL 1T6BX 3PS7A 5FCUL 4DJDC 3BOVA 3MWCA 3NQ6A 1I2QA 5I8CB 2OT0A 2E75C 1AZCA 1E8WA 3MRRB 3KPNA 5MEPB 3HI5H 2HRHA 4JXCA 5ISZA 3O8AA 4K9JA 3Q58A 2CUMA 1SVBA 4F0KA 4MZ1A 3DECA 3VIIA 2W88A 3TJ4A 1O68A 4BSVA 1QZNA 2NUYA 1YLBB 3K2IA 1XYCA 4ZDHB 3PDDA 1QFEA 2POTA 3BSMA 5AW9B 4EANA 5AVZB 2NXYD 4PN2A 1I3RB 2EVGA 1XBXA 3LHYA 3KXFA 4WUKH 3WSQH 3DX8A 4EXBA 4BH8A 2JKSA 2WBJC 2VOMA 1D5RA 3WD2A 2J25A 1OG6A 1BQUA 1ZU8A 3A13A 4HPXA 1HEHC 3BLDA 5D5MA 1VDGA 3VIJA 2QVMA 4LPYA 4P2RA 3WQ5A 1N7ML 4JR9H 3MJGX 3QQXA 1XF4A 4M8VA 1EA9C 2V7NA 2ZCKL 3AREB 1ZHAA 2A6DB 3EG9B 5BUPA 1UA6H 1WISA 4RFOL 5DQJA 4H0IA 5I3DA 4NNXB 4OVVA 1JZIA 1PZ5A 3ULVL 3BKMH 4PYHA 1G6RA 4KWUA 5I5JA 3RZWA 1UASA 4NXSA 2YAQA 5L2KA 3BESR 5SWSA 4F24A 2ZSVB 1II4E 3QZ6A 3LCXA 4B9FA 2VITB 4AL8L 4X7TB 4M43H 3EOUA 1KKOA 4H4NA 2B0MA 1OHQA 4RX4D 4WY7H 3KPLA 4KKRA 3X12A 2EUVA 2OV0A 2J79A 5IFPA 1W1B1 2ITFA 3C6LA 3FHEA 1NEPA 2UY6A 1A3ZA 1GS8A 3BV4A 1M9SA 3MRJA 3OC8A 4P2QD 5E6IB 1I3GL 2QT6A 4JQVC 1N3NA 1GNXA 5GJTH 1JTOA 4ADGA 3PANA 1XCWA 1H3VA 4XUGA 1OCOB 1FA4A 1I8UA 3UTSD 2IAMC 5JYLA 3BWWA 3T6WA 1WCBA 2FB3A 2NW2A 2AKMA 3L4TA 4W6WB 4WSJA 3RTLA 3BUBA 3K6FA 3NGFA 1PB0A 1A80A 2R1KA 2VXSL 5EB8A 4XO8A 8A3HA 4WI4A 2BNRA 4QRPE 1WWAX 2NY1C 2AMGA 2WAHA 4ZUVA 4RDWA 1MDAA 3SDYL 3RGHA 2F15A 4Z7WB 4B3EA 2IGFL 3APGA 4I18B 1R87A 2F8IA 3LB6C 1GYUA 2GIMA 1MLCA 4ZQPA 2HRPL 2JELL 5DI8B 3RFZC 1EEXA 5D2LF 2I17A 1FHNA 1W54A 5DU7A 2R2EA 4WZHA 3V0TA 5FEWA 4JM2A 3K46A 2R4RH 2A9NH 4N26A 4FKHA 3B1TA 3CZKA 1POJA 5E94A 2P80A 3NNTA 4TLKA 3KDPB 3HZ3A 2CPUA 4ELDA 2G60H 3B4YA 4X0NA 3AHYA 4P61A 2ZTJA 5B7ZA 4QGCA 1XR8B 5BQ7A 4CBZA 4XMWA 1UJTA 1U8QB 4BSWB 3DG3A 1DVUA 2GT9A 4Y0GA 4HBCL 1BFTA 3VFVA 4KMQA 1I1AA 3UQNA 2NSQA 1XVSA 1ZRQA 3TH2T 3LS4H 5LBVA 2YPLB 1G7IA 2XPYA 4DI9A 4C4BA 1PIFA 1BAWA 1WBYA 1A66A 3D0CA 3JBG7 1I31A 3EDJA 4HEPG 3VNZA 3RX3A 4DRSA 3ZKXB 3CCHB 3PJLA 3W0KA 2V5MA 2IPGA 2CM5A 4Z7OB 3LH2L 3C08H 4LVFA 4CD4A 2R2HB 5T3ZL 1LGVA 4JFQB 4KJWD 3S4SA 1U3HD 3D07A 4K8RL 3SDAC 4XE5B 1HNFA 1CL7H 4KQ3H 1GYCA 3VXSB 2R69H 1QCWA 4LBSA 1JF6A 2R7EB 4XN4A 2PRHA 4PEEA 3W1AA 1INQA 4XPAH 2CLHA 3VNLA 4QRFA 4HAKA 2XSKA 2Q2EB 4L29A 3M0VA 2CLOA 3IMVA 4H8VA 3HTWA 1S3HA 3TROA 5I71C 1BVKA 3TIDB 2WWMC 3P3YA 4M7ZB 3ULUE 5DF0A 3NQBA 3ECUA 5ILTL 3PPSA 3AABA 5HJGA 1I1FA 1QNSA 4WU5B 3PGCA 2XXCB 4Y89A 5K7JA 4JFOB 4KKLD 4ZUSA 5F97E 1XTLA 2C3VA 3HM7A 4LNCA 3WS3A 2XU2A 3BK0A 3VRLE 3DKLA 4AZ8B 4UTAH 1QQDB 3U30C 2Y3AA 3REQA 1T20A 4JN2A 1R5IB 2X70B 1BPLB 4GZ7A 4E9YA 3FOLA 3WLPA 4ACPA 1MZYA 4M1CD 4YSSA 2ZYSA 3P81A 3OPZL 3ZUNC 3RZCC 1T96A 1DO6A 2GTWB 1XRFA 3NCFB 2XFRA 2TYSA 1TJGL 3ULUC 1KPVB 4IP7A 1LP9E 1IT9L 2KAUC 3FTSA 3RWGB 1YPZE 2ZRVA 5AL0A 5H2BB 2IMRA 3GDTA 6CGTA 1I1YA 2D7TL 4LCWA 4WNSA 3NBNA 3ZKND 3N40F 5I16B 1PDZA 3LLFA 5FYJD 1N8ZA 3WF0A 1YEDB 1ANUA 2DM2A 1LRNA 4Q8TA 2F5BL 1SW7A 2W1NA 3I6TA 3HMCA 1GQJA 2AK4D 1T1ZB 3QKEA 2WLIA 3PZMA 2A6KB 3O16A 1GGBL 1EJRC 4ZAKA 5F7EL 4HS8L 2W6RA 5I06A 2JMRA 3A4EA 2PYEE 1QWUA 4YHKL 2FQIA 3OQRA 5DFTA 1KYFA 2FX9L 4YCPA 3TH6A 1F8TH 3OG3A 2VXUL 4QJ3B 4EACA 3V5HB 1KYOJ 5J6HB 3HNSL 4IHOA 2E6PA 3NGBB 4YDNA 1KFAL 4G9FD 5D7KD 5C3TA 4RK8A 5TH2B 1I85A 3G9VA 4P5KA 1E1EA 1R7AA 1R3JA 2VRJA 2OLAA 1GEQA 5CJ8A 2VR5A 3GSRB 1ZLUH 1I1WA 1DYSA 4UFKA 2F8QA 2D7NA 2AJXH 3BX7C 3G1SA 4JQXA 4XX5A 1OABA 3ESPA 3IJ6A 4J3BA 5T3XL 3NJ3A 1A47A 5IIEB 2W5PA 2COQA 3ARDA 5CJQL 1M6OB 1KLUB 1XGZA 3WJSA 3X11B 4RXFA 1DVSA 1YCSA 4B9CA 1RU9L 4R90L 4TVPD 4YHYC 1B1YA 1IC4L 5E2WH 2VIRB 5C2GA 3P62A 2D7MA 3FJTA 3W81A 3SDCA 3NIDF 4WQ6A 3N85H 3BP4B 3DX2A 2H45A 2YO3A 4P57A 1GZJA 1OZQA 3NA9L 4K0OA 4NQVA 3AMGA 3JWNC 4KETA 2PSNA 1JK8B 4DVBA 3K4ZA 1XX1A 5KZCB 3A4JA 4JY6B 2YC1B 3GXNA 4O58H 1A9BA 4FOJA 4DZIA 1PSKL 1QNOA 2J27A 4FK9A 2GSHA 1Q7MA 4GXPA 4J2XA 2PBGA 1I8KB 3T4CA 4PW4A 3O6FC 4Z78A 1R9XA 4GIEA 2HT2C 3THCA 2AHIA 5GRXG 1HSBB 3GS0A 2YW3A 5DQPA 1PJ9A 1R5WA 4BI5A 2WMPB 3QJSB 4NU7A 3LD5A 1U8CB 3MLTB 4FXKB 4X98A 2YCLB 1WAPA 5D7LE 2OBGA 5MERA 3BMWA 5F2GA 3FQXB 2QPEB 3ZE2F 4Q4PA 3NZGA 5C08B 4G3YL 4HJEA 3WDRA 4UXDA 1Y6KR 1UUMA 4OV5A 4NZTL 3VWJC 3VA2C 2O61A 2QUNA 3QPKA 4U1NA 3LB0A 4PJEF 3EYFA 3HFML 3TXAA 3BGJA 2RJGA 5A2LH 4UM8B 5IK3B 4F2FA 5ANME 5HYSA 5EZIH 3W1LA 4HX1B 3QNXA 1ZVSA 2OMTA 3VXRB 1YDYA 3V6OE 3GWJA 3L5AA 1MJUL 3FU0A 5DJ8B 3GZOA 3QBTB 3L9BA 2CALA 1F4HA 2AV1A 5CILL 1YO4A 3N1FC 4GRMA 4Q14A 1RBOB 3FFSA 1UQSA 4QBXA 2H32H 4JFDB 5B1AB 3CFMA 3LHZA 2PDJA 1M9WA 4LALA 2R24A 2BVPB 1X5GA 3SE3C 1L9WA 3FBQA 3IXTB 4JPVH 2HK0A 2ZPKL 1U5JA 3EBVA 3SGUA 4DB7A 1GW0A 4G7YL 5FI8A 1GPOL 4IPJA 4LSSH 3RNQA 4MXVE 1Q65A 4NIYE 1A6WL 2CCVA 3UT0A 1ML0A 3KBMA 1HDMA 4KJQC 2XTSA 1FWXA 4XRCB 4WFEE 2E7CA 1CD1A 4HV8A 1OTTD 2B5IB 3MX0A 3V6OC 4LX4A 3KBFA 4AZCA 2X28A 1AO7E 4GUGA 5C92A 3CZUB 2CDEB 2G37A 4C7FA 1HQTA 2EUXA 2X2YA 3P4MA 1JGLH 4JTAA 1FWSA 1AZVA 1J9SA 3IGKA 3UADA 4E3VA 2YDQA 2XVLA 1JHKH 3HMWL 4ZD3H 5EF1A 1NCBH 1MNUL 3SY5A 2PDYA 1XXDC 2O6CA 3OBAA 3T1FA 3KX6A 1BYDA 5I18H 2XPKA 3I10A 5C9WA 3AXXA 4WV1C 1WIPA 5LKNA 2ATAA 3CL7A 1UB5A 4JTLA 2XWXA 1VFHA 2EABA 4D72A 1GWJA 1DOSA 1IM3D 2DJSA 5TPWH 2VDLL 5ESAB 5CIPA 5GIRA 4PS4H 3WN6A 3S37X 2ZXBA 2FIKB 3A67L 2DT3A 2OJEA 3EDDA 2A6JA 1HU8A 5HANA 2J4WL 1J9QA 2XN9E 1F4YH 1J8HE 2OZ4H 3UPWA 2ZFAA 2W66A 4XMLL 5KSVB 4ECNA 3HZYB 1PJWA 2XZAH 4NP7A 3APNA 3EA1A 1Z9OA 4JY4B 1D5IL 3HHMA 4MXWL 4JFEE 1K5WA 1EFXD 1KXHA 3NQEA 1FDLL 3BMXA 1TPB1 4LVNC 4CCCA 2DJMA 3ZIMA 5I75B 1S7QA 1BD2B 1A5KC 3DFQA 4MCZA 2XKUA 3LHTA 3WEOA 5AZEH 4GLRI 3WNJA 4F0RA 5EF0A 4CKVX 5LA2A 1TE1A 4MDRA 3F5WA 3BPWA 1FWAC 3B7SA 4AVFA 1KRCC 1BFOB 1A64A 2X9XA 2XSBA 4Y4HB 1W8OA 4M81A 3L21A 5LXXA 1KBLA 4OLVL 3HB3D 4TQTA 5FEXA 43C9B 3DURA 5DTFA 3HG1B 4L4VE 4RGOH 1P5BA 4JFSA 2NR6D 1OYCA 5C09E 5BOEA 3VIOA 4BK9A 3WMSA 1N8IA 1LG2A 2B7NA 3QPZA 1HJXA 1E6NA 2RHEA 1UR3M 1COBA 1U8KB 4BEIA 4R7LA 1IIHA 2GQ3A 1NCWH 5F7LB 3U1SH 1GOHA 1QEWB 3FUFA 3E38A 1IVLA 4FI7A 3QHNA 3SGKC 5DUMH 1XDMA 3QF0A 4GIPD 2ZJSL 1VADA 4G5AA 4PL2A 4JO4L 1JCKA 3TYFA 3CMFA 2P9RA 2FZ9A 3TQVA 2DQCH 5E9NA 1QSFE 1FH2A 2GJ6E 3NDZE 4F48A 2FVMA 1NFPA 4YBQC 4V27A 4Y19E 1RD6A 1LOQA 1R5VB 3APFA 3GIZH 4EDWL 4A7QA 3DX7B 1FH9A 4YIQB 1MHCA 3NEOA 1KMGA 1AXSB 2CRZA 3C9NA 3LIZH 3EH3B 4K36A 1N70A 1OAXH 4RNFA 3JWDC 4ZJ9A 3HG5A 5IJBC 1UUQA 2FUTA 3TZVD 3K6IA 3T1WA 1FZMA 1SY6A 4JY5H 2IQAA 3ILDA 3QDME 4JIQA 3GKZA 3US9A 1FCBA 3NQDA 1YG9A 3FFCB 1R3KA 3OF6A 1Q72H 2BS8A 3DHJA 4TUJA 3TS8A 3O2WL 1SJAA 4NVTA 4UIOA 1WXYA 3JS3A 4HS6A 3E9AA 2P5WE 1TZGL 3AIEA 3UACA 5IG7B 3GHSA 4QF1A 3T77A 5CLYA 2HLEB 3GHBH 2CKBL 3BCFA 4MWAD 1EZUA 4OGXH 2HT4C 1K5NA 3MW7A 4H7ZA 3O9NA 3VD5A 2PYFA 3F7VA 1MAML 4LY4A 3SDXF 1PZ2A 2BW5A 3G0XA 3LPPA 4Z3JA 2J44A 1E27B 3VINA 3OXRA 1WE5A 1O6SB 1XZ0B 3IDUA 3MCOA 1XGRB 3TCLA 3TE9A 4OLUL 2EE3A 3QO0A 1R2TA 3ZDWA 1MXGA 2IXVA 2XTKA 2V2XA 1MCWW 2ICWB 5DHEA 3MNVA 4ZFZA 2H3NA 4IRJA 5HI4C 1FCQA 4QXUH 3REVB 1FL5B 4XB7A 3FT9A 4CAGA 3GS6A 4M62L 2H9GB 4P23C 1DLFH 4DK6A 4LAMA 4FNLH 1NWTA 2BO0A 3DKHA 1X6NA 4DJEA 1ZLVH 2QR0B 2VXTL 2CNZA 4PJFE 1XQKA 5C6TL 3ISIX 2A38A 2R2BB 1HK6A 2J9XA 3NCJL 1X98A 4NWUL 2YLAA 1XAUA 3K5XA 3CV1A 2R59A 4LGXA 1JV2A 1WFTA 3JUGA 4ATTA 4HJGB 1X44A 3QZWG 5GRWA 4PJAF 2BRRH 5AB2A 1H6UA 2D8KA 2VSMB 2PRMA 2BHUA 1DWIM 2AITA 4PTUA 3CFJA 1ZPTA 5G4HC 3WYZA 1EAPB 2VDHA 1WFNA 2JJSA 1IR2A 3IGXA 1V3MA 3TPKA 4M9PA 3R4IA 2NQCA 5E1AB 4KVNL 3LEXB 1PX3A 3NIDB 2I1OA 2IWGA 3BE7A 4B9GA 4B96A 2CD0A 4YTRA 4O2EA 2Z6JA 1M7IB 3WNNA 4P2OD 2DKUA 2HE8A 3QH3B 1RA0A 1XUUA 4QXTA 3H9SE 4QM1A 1IGSA 1GS7A 2UZIH 3OTTA 5J1AA 2BS9A 1RCQA 1Y18B 4WU7B 2VDNH 4MJ4A 4J4KA 2ZP9A 5DD6A 5D1XD 5EWIL 3FH7A 5DFAA 2WVVB 1GAFL 1JJUA 3VGAC 3EHBC 4NDMB 3A9IA 2UVFA 3GMQA 2Q6WB 4PRID 4F0HA 3H42L 1FWEC 1D3HA 2QKFA 4MJZA 2X10A 1ZCCA 4ZS6C 3AQUA 1HF6A 2GK1A 1WO2A 2QEZA 1M41A 3U9WA 3T6CA 1E4HA 2BZ7A 4KY1H 1HKKA 4XC1H 2DI7A 2FZDA 4GKLA 4CVZA 4BF9A 3RL2A 2W67A 3CQ0A 2BSTA 5KUKA 1YIXA 1XX9C 2CKBA 3EGXA 4S1QL 3CZNA 3B0UX 4EI5A 4W9KC 4G1NA 1TJHH 3QC5X 3ZRFC 2VEKA 1UA7A 3RPKA 2HWZH 4K5PA 4HHMA 4JVPA 1UJQA 1UWGL 5F0JB 3GSWB 4QNPF 4Q33A 5F1IA 3IPFA 2OTWA 3TWCL 3VD1A 3STZA 2WWKO 3ZKSD 4W93A 5I0WA 4MJMA 3OC5A 1CECA 3L5XL 3SAZA 3KRUA 4RGMC 2D3LA 2WO2B 4JFZL 3NL6A 4AY8A 3I75B 2O9RA 3PZTA 2PLMA 3IWUA 4O0QA 4EWND 2AQRA 3GUGA 1KN2L 3HFYA 3CDZA 4KI5F 3WY1A 2X4QA 4L2LA 3R79A 1WS8A 5CEZL 3O41B 1XGYL 4AD4A 1KENH 3GKWL 1BCIA 1UP3A 4P2QB 3WIIH 3ZE1B 1HILA 5IVXF 1OGAD 1VPXA 1K4CB 3TVMA 5F7HA 2V82A 2V3FA 3BEWB 4RESB 1PD0A 4GKZA 5D8JH 1RZGB 5BW7A 1JZFA 3UYCA 4CA4A 1EMTL 2Y2WA 4UQ2A 4UV4L 4MTVA 2FVKA 1O5XA 3CAFA 4BFJA 3DNKA 1JNHA 3FQ4A 5FUOL 5HR6A 3C2OA 4X5WB 4QOKB 3PIQA 5FL1A 1BLNA 5JH1A 4CKQA 4HG4K 1SO4A 3D6GA 4KVPA 3NOYA 1CIDA 2H32B 1E5BA 1UZDA 3U2JA 4APXA 2DW5A 4QRTB 5I1LB 2EEDA 3GHPA 2GW5A 3TW7A 4S38A 3OZYA 5F7AA 3ME0A 1NCCH 3JTBA 4K94H 1IRAY 1CICB 3M07A 4JNMA 3SPCA 2VB5A 1S3TC 3Q44A 3MKKA 3VFLA 3UAAA 3LSOA 1MPAH 2C5DC 4WK9A 2G5UA 3MXVH 2BP8A 4D8PB 5ELIA 4ZQKA 1E1CB 1VSCA 3F6JA 3TFCA 3DIVA 4PR5B 1BFSA 3UD6A 3KHJA 1KXQE 5CSSA 1K4DB 3V7AG 2ZWKA 3WY4A 3DO4A 3GB7B 4KCUA 4ML9A 2ABAA 1WCGA 5IW1A 5E2TH 3ECWA 2XQBH 3GJFA 1JJKA 5BXPA 3QFGA 3CZFB 4XO5A 3WCZA 5IBTH 3IFNH 1S39A 4HK3N 2FX7H 2HJLB 4X5PA 3UR7A 1ECEA 1SYSB 1NBZB 1UUSA 1GOXA 2AANA 2VDQH 1X7TA 3UAFA 4V1DB 1TRDA 4IS6A 1N0LA 3ATEA 3UWVA 3N2XA 3HUJA 2NQ5A 2YOCA 3GR4A 4R0LC 2CBVA 1DHKA 4AH7A 1RA5A 2ZZ7A 4OQTA 2BXVA 1RIVL 2ARWA 4PJ7A 3LN4B 3R0KA 2NW0A 3AY4A 2PPGA 4F37K 5BOZG 3VKDA 3LN5B 3VGFA 1EC8A 3OVRA 5JVLA 3AUWB 2F68X 3LKPA 4LYPA 4A2LA 1XI3A 1KGJA 1LWJA 2BH0A 2VWSA 1MAJA 3VXTA 3LGDA 3PL6A 3V5KB 4PV8A 1J5IA 2MNWA 1HJWA 1UHVA 1UZ8B 3KYMA 4YGVA 2OEJA 3NIYA 3VIHA 4GYPA 1UR9A 3OJDB 1TJIL 1TIWA 4FG6D 3QWRD 1J0HA 4QTGA 2Z27A 3H56A 1EHLL 4ZQOA 3INOA 1GYLA 1LQBC 3V0AC 1JVLA 1MCCA 4NJAH 3M7FB 3D12B 4G82A 1A5OC 1FV1A 1KJ3H 1GHSA 5DVPA 2NY6C 4NO2A 1V77A 1NCJA 2NXZD 4TPRL 4HJJL 2NWRA 1HL4A 4N4QA 4F7MB 5MP6H 3KAAA 1E3ZA 4XUYA 1IGCL 4GY4A 3VQLA 4U1MB 4FOMA 4HJ1A 5T1LA 5D7IB 1UT2A 4TOYH 4PMDA 2NZ9C 1LE9A 4X8JB 3EX2A 2ZUMA 1J7VR 3IDNB 4JO3H 4YBLC 3WAKA 4BQCA 3W0WB 2V6AA 1BGXH 3TNNA 5D9MA 3PBVA 3L5JA 4K8EA 4RIRB 3VFOB 3QFEA 4CNNA 4AM0B 4OZGA 3RDTA 4KX7A 3LYEA 4CMHB 4D6EA 3FYOA 3A3XA 5E0CA 3FQNA 4CUCA 2WXLA 3GGWA 4MMZA 1X5HA 3BN9D 3ZFHA 4OCXL 3FW6A 5AYZA 1XDJA 2ZYFA 4J27A 4G5ZL 4MJIE 4ZO7A 1NJ9B 1K03A 3WK3A 3N4AA 4PJ8D 1CXKA 3LPFA 1MEWA 4Y9FA 3QIBD 2DICA 4NUGL 1L7TH 4HK7A 4N1HB 4KRZA 1T7YA 5D09A 1LG1A 2DZWA 5TE7L 1XSOA 5DHYB 1BXXA 3CSGA 1MCOH 4PGCA 3RCNA 4GAJH 5KUMA 3OKOB 3BCDA 4U6XB 1T5XA 5IWLC 3BP7A 4PBEA 3GO1H 3K71A 3KYNB 3MLRH 4L8CA 1SOQA 1LD9A 2NX5D 3GT6A 3P2TA 2DBLL 5KYUB 4UI2A 3P3RA 5AB1A 3T2QA 1R3RA 4G9FB 4ODBD 3ZT5A 1A4KB 3FBKA 5GZNA 3UGUA 3GZAA 1VGAA 4MNGB 1ODUA 2JLLA 4PMYA 4BQ3A 5BVPL 1VBRA 5IKCA 1SR9A 1PZCA 4Y9PA 5C0NC 7ODCA 1C3FA 3EJJX 3UWYA 3RUGE 1OWQA 5FK9B 1JUFB 2ZSWB 4L1GA 2E8YA 1UVQA 1FO0L 3MCNA 3KPMA 4PP2A 2W07A 4PTTA 3M88A 3KFTA 3IDGA 4YEFA 1H6EA 3OWEA 5T1KB 1BOGA 5CSUA 1LDPH 1ZSDB 2WBXA 3WLBB 4C6JA 4Z76A 5EIIA 3PQYE 3WK1A 3CT2A 3M45A 2Q8ZA 3S2AA 3O05A 3BJFA 3CZ8A 4AG4H 2R15A 3DTXA 2ZZUT 4DQWA 2Y25A 1BP3B 1S3KH 2BGSA 4Y1TA 4WW2A 2WOBA 2AXHA 3ZLGA 3CUIA 4O57A 1ZA3A 1WDRA 3WS6C 3G1RA 4FX6M 3LV6A 3MOQA 3OA5A 3D3VA 4W5ZA 3GBML 1H7PA 2CHOA 1E7VA