2C8NA

The structure of a family 51 arabinofuranosidase, araf51, from clostridium thermocellum in complex with 1,3-linked arabinoside of xylobiose.
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
501
structure length
501
Chain Sequence
KKARMTVDKDYKIAEIDKRIYGSFVEHLGRAVYDGLYQPGNSKSDEDGFRKDVIELVKELNVPIIRYPGGNFVSNYFWEDGVGPVEDRPRRLDLAWKSIEPNQVGINEFAKWCKKVNAEIMMAVNLGTRGISDACNLLEYCNHPGGSKYSDMRIKHGVKEPHNIKVWCLGNAMDGPWQVGHKTMDEYGRIAEETARAMKMIDPSIELVACGSSSKDMPTFPQWEATVLDYAYDYVDYISLHQYYGNKENDTADFLAKSDDLDDFIRSVIATCDYIKAKKRSKKDIYLSFDEWNVWYHSNNEDANIMQNEPWRIAPPLLEDIYTFEDALLVGLMLITLMKHADRIKIACLAQLINVIAPIVTERNGGAAWRQTIFYPFMHASKYGRGIVLQPVINSPLHDTSKHEDVTDIESVAIYNEEKEEVTIFAVNRNIHEDIVLVSDVRGMKDYRLLEHIVLEHQDLKIRNSVNGEEVYPKNSDKSSFDDGILTSMLRRASWNVIRIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insight Into the Ligand Specificity of a Thermostable Family 51 Arabinofuranosidase, Araf51, from Clostridium Thermocellum.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
molecule keywords ALPHA-L-ARABINOFURANOSIDASE
total genus 171
structure length 501
sequence length 501
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06964 Alpha-L-AF_C Alpha-L-arabinofuranosidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2c8nA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2c8nA02
3MKKA 4AMWA 2AOSA 4NF7A 3GBDA 3WDQA 1FFQA 2QPUA 3AZSA 4YHEA 1W1VA 5E6ZA 1PPIA 4X9YA 1FFRA 1HXKA 3I3EA 5BYWA 5M5DA 2ALWA 2OSWA 2YBTA 3WQ8A 1WB0A 1EHAA 4FF5A 4NXKA 4PMOA 2CETA 4MAZA 4XZWA 3LRLA 4QLJA 3SCRA 3KLLA 2J7GA 3AIUA 2ZX9A 5TD4A 1E70M 4JKKA 3AMLA 4F8XA 4U5KA 1E43A 2WHKA 2NW0A 2GJXB 3VD5A 1XV8A 3BAIA 1UH3A 3WDRA 1XC6A 2F7OA 3FXYA 3NCOA 1ISVA 1PZ2A 4U2ZA 5AC5A 2AAAA 5IHSA 1CGYA 5BXSA 2ZUVA 3MUZ1 2BY2A 1US3A 1PS3A 1V02A 1XSKA 1NWSA 5D9OA 1H0IA 3GXIA 4TVDA 3WY2A 3ARWA 4QP0A 1HJXA 2WBGA 3TTSA 4AC1X 1CLVA 1JZ3A 3OB8A 1G5AA 1DWGM 4AZCB 2D0FA 4CCCA 3WEMA 1JL8A 1JYNA 4AMCA 2VQUA 5I2UA 4W85A 1JAKA 1CPUA 1EQCA 1UR9A 2VZTA 3U7BA 1K9FA 2GVYA 1E6RA 2ZICA 1X6LA 4M1RA 1E4IA 2Y5EA 1V0KA 5ABFB 3VMNA 1PX8A 2ZUMA 2WYSA 4AIUA 1VAHA 5C71A 1VBUA 3A47A 3PZUA 5CZKA 1UOKA 1KR1A 3EDJA 3CZLA 1BFNA 1UWUA 1W1TA 2CHNA 1QI2A 1UD5A 1LQ0A 3A24A 3A6OA 2BY1A 4J3WA 5ABGA 3PTMA 2BNJA 2X1IA 4UQAA 4M81A 2WLYA 4JCLA 4D6HA 2F18A 3N04A 5CPTA 3ARSA 1C93A 4MB4A 1EO5A 1E15A 3W6LA 2A3BA 4ZXOA 1XYFA 1UWQA 3T09A 3VIPA 4W8AA 1GHSA 2VOTA 3CUIA 3DHUA 3MSGA 2WCSA 1EHNA 4HOZA 3ALGA 2XM2A 1T0OA 1V0LA 3WQVA 1MYRA 1W2PA 4BCEA 3FAXA 2J7BA 3L4UA 4CU7A 4WK9A 4PMUA 1NWUA 5ABFA 1BGGA 4OBRA 2DSZA 4A3YA 1U2YA 3MMWA 4UFLA 1EO7A 5IHRA 1QHPA 5A8MA 2CBVA 4ZE4A 4XZBA 2CKRA 1MFUA 1XCWA 2WKLA 3VMPA 5I23A 3EMCA 3FNDA 1FP8A 2GJRA 1P6WA 2WMIA 3T2QA 2J4GA 3ZT6A 3RDKA 2XFYA 1H2JA 2OSXA 2HVMA 2BHZA 1D2KA 3F5LA 1CXFA 2CHOA 1EIBA 3VX0A 2E8ZA 1LL4A 5GNYA 2CCRA 3W37A 3TP4A 3A5VA 3CLWA 1OD0A 3AYSA 4QLLA 3WMSA 3WQWA 5HBFA 1B30A 1PBGA 4HMCA 1FP9A 4U3CA 3WNPA 1JYVA 3AS2A 3SCNA 3AMKA 1EGZA 1W3JA 2ZUSA 3LXCA 1UR1A 2BS9A 3VOCA 1V6UA 1V6VA 3RO8A 4CUCA 3EMQA 2ZUNA 1GQJA 3PZNA 4KRTA 1JGIA 2XSBA 1PAMA 2YOCA 1VFFA 1OSEA 3EMZA 3BAJA 2YA1A 1BPLB 3EJRA 3HMCA 3BUBA 3PHAA 2E4TA 4HPHA 4S3JA 1ODUA 4DM2A 4B16A 1MQRA 1C3FA 2ZX5A 2YLAA 1MWOA 2X0HA 3AS3A 4D6JA 3S5ZA 4XX6A 1UZ4A 1JIBA 1Z32X 4TTUA 2C7FA 4D6CA 1EH9A 1KBBA 3VMOA 2D3NA 1CIUA 4OJYA 3DYMA 4PYSA 4J3VA 1W3LA 3GXNA 3CZGA 2VZVA 4CGTA 1E6NA 3OLIA 2OW7A 4MDPA 4URIA 3B8SA 1QHOA 1GOMA 4P8VA 1UKSA 1E1FA 1WO2A 3KLKA 3D51A 3BVUA 2XFRA 2EACA 3CUJA 4GI8A 3BVWA 2QLYA 1JYWA 2IXVA 4PSRA 1OCQA 2XG9A 3ZJ7A 3KZSA 2WMFA 5LYRA 3WL1A 3AZTA 3DECA 3HJEA 1BYAA 2CITA 2VQTA 2OYKA 3L4YA 4B3KA 4C7FA 4GKLA 1KXTA 4EK7A 1F4HA 3WH8A 3ZMRA 2ZXDA 4AD0A 1C7TA 3TA9A 1UWSA 1R7OA 2EPNA 5EFFA 4NZCA 3WD3A 3BUPA 2TAAA 3W6MA 3N13A 4LGXA 3VSUA 1DWAM 4CCEA 3MMUA 3WN6A 5A6AA 2WVVA 2YDRA 3BAXA 2BHUA 1JFHA 5IXEA 1Q6DA 1ZBVA 1K9TA 2FHBA 3SUUA 3IGUA 1SMDA 3LPPA 1JXKA 1BYDA 1W3KA 2GJPA 1PIGA 4H8UA 4LYQA 4CVUA 1H5VA 4KRUA 1LJYA 2EJ1A 4R5EA 3VD3A 2ZUUA 2PWHA 3CZSA 1B3YA 2NT0A 1B3VA 2ZXAA 1UQZA 3PN8A 2E8YA 3VGBA 1W9PA 2YJQA 2EPKX 1QVBA 5FKYA 5AY7A 5A6BA 1VBRA 3FAWA 3PZIA 2VI0A 4AD5A 4AZ5A 2WPGA 1WDQA 2V3DA 4IUGA 3L4TA 4X0NA 1UD3A 1BAGA 3N12A 3GXMA 2OSYA 4CU8A 3A23A 5ABEA 2VCBA 4BQ4A 3PBGA 7TAAA 3WDIA 2DH3A 3B9DA 4QDMA 5ECUA 4W5UA 1E0WA 1TUXA 5D8WA 2YFNA 1HL8A 4FLQA 3EJPA 4P7OA 3GXDA 3CHFA 3I3DA 3VD7A 1ISXA 4TOQA 4H04A 1OIMA 2ZWYA 3WBAA 5A69A 4D71A 4Z2JA 1H3GA 1Q6GA 4UQDA 1SYTA 3TV8A 3RCNA 3I3BA 2EADA 1NWTA 1GONA 1EQPA 4NSBA 1E6QM 4H41A 3EDEA 1NWRA 5D9MA 1CXLA 2WBKA 1JD9A 3PTQA 3LPGA 4V27A 3GH7A 1TMQA 4J3XA 4HMEA 4AWEA 1WZKA 3BCFA 4UZSA 2EPLX 3HG3A 2GK1A 4PTVA 3RJYA 2D24A 3VTRA 1BHGA 1W1YA 3VNZA 1MXGA 3AIBA 1DWJM 2NT1A 1QOXA 2ZX6A 2VC9A 4AY1A 3CMGA 3AHXA 3H54A 3ZJKA 5A2AA 1UA7A 5DEZA 2GK1B 1V3IA 1TVPA 5A2BA 3L4XA 3MSDA 4FNRA 4DO4A 3EJUA 4UCFA 1CXIA 1XD1A 4MB1A 4XV0A 4UQ9A 4Z2IA 3A4WA 1V02E 1VFMA 4MDOA 5BCAA 4ZFMA 3GH4A 4PMXA 1HJSA 4DWSA 4FNPA 1HTYA 1JDAA 4EE9A 3EBVA 1B1YA 1PJ9A 3BLKA 1H1NA 1M04A 1M01A 3OLDA 3N15A 2OYLA 3BLBA 2W61A 2O9PA 1PX4A 3CUFA 4Y7EA 1QWUA 4GQRA 3KE0A 4WSKA 4D72A 4ATDA 1E5JA 2W92A 5CLTA 1O7DC 2X05A 2A3EA 4HZ8A 2FDMA 3K46A 1SMAA 2WWDA 1YHTA 4HU0A 2VL4A 1E6PA 2VVNA 1U30A 3ARRA 4WKHA 3WMBA 1DP0A 2XWDA 4P8UA 3WD1A 2YKKA 1E3XA 2GDVA 4DM1A 2V5DA 3T08A 5HDRA 1E9LA 3CHCA 2UWFA 1KB3A 3M07A 1EA9C 3T2OA 3VX1A 3GXFA 4OKDA 2VUYA 5DT7A 4JFWA 2JEPA 4KH2A 2EXOA 4PCSA 1BVNP 4W89A 1H09A 2D3LA 4WJXA 2CBUA 2ZOXA 3SUVA 4CCDA 3SCVA 4AMXA 3ZM8A 3CV5A 3CO4A 1R33A 1GOWA 1UD8A 2QMJA 2J74A 3WEZA 3TTOA 1EOKA 2BHYA 3SCTA 4WLCA 4JCMA 3SCUA 3VGDA 1W9UA 3SUWA 2WMGA 2XTKA 3RM4A 4NI3A 3AIEA 5CQ1A 4XUYA 1BYCA 3M46A 3QHMA 3RPMA 2DT2A 3W28A 1UH4A 1HJUA 3AICA 5IFPA 1R47A 3OLEA 2CIPA 1R75A 1LL7A 4DWSC 1KQYA 3AROA 2OLHA 3DYOA 1CXEA 1CGXA 2EAEA 1W32A 3AISA 1LF1A 1B3ZA 1TQVA 3LPOA 4FNUA 4BA0A 1V6YA 5KZ6A 4P8XA 5I79A 1J0JA 1XH0A 1FHLA 3THDA 3L4WA 2Z1KA 2WW5A 4D6DA 4BF7A 1G9HA 2J78A 2D73A 4M56A 1BLIA 1D7FA 3T0BA 4EAMA 3WKZA 4PMYA 4AISA 1HJQA 1OGSA 2ZWZA 3VGGA 1E40A 4RE3A 1H11A 1HVXA 3VD4A 3UCQA 3WIJA 3KEHA 4PBGA 1LWHA 1ESWA 3BAYA 1KR0A 2XYLA 3LX9A 1JDDA 2XJ7A 3PZOA 4UFMA 3OZPA 1VEPA 3S2CA 1L8NA 1JI1A 4RE4A 4D6GA 3W4RA 1C90A 1JF6A 2FE0A 1WCGA 3IK2A 4GPNA 2PC8A 4PMNA 3PZ9A 3DC0A 7CGTA 2JALA 1E5NA 2WMJA 4A3HA 3L4ZA 3K4AA 1KCLA 4MNKA 1C7SA 3AYRA 4EANA 3MV01 5AYBA 1BYBA 4HTYA 3WY4A 5E09A 2XVPA 1O6IA 4J3TA 3ZT5A 4PN2A 2Y8VA 1C8YA 1EDTA 3W81A 2G8ZA 1J0YA 2D23A 4EKJA 4M24A 4U31A 2WSPA 4RL3A 4WIWA 3ZSSA 3HU7A 3LRKA 1CEOA 3B9EA 4TVCA 3BMWA 4WF7A 5CPQA 5HPCA 3F5KA 3NYDA 1W2VA 4GQQA 5CG0A 1HJVA 2WHLA 4QLKA 1BG9A 4Z2KA 1QPKA 2D0GA 1PIFA 4AXNA 1E3ZA 2BVYA 3W24A 5LA0A 4PMDA 2CYGA 4AEEA 5DT5A 3AZRA 4B9ZA 3A4AA 1XYZA 2PWDA 3MANA 5C8BB 2Q8XA 5CSYA 2O9TA 1V3LA 2FYVA 1CGWA 4U5IA 3VDHA 3AIWA 5A94A 1RP8A 5HXMA 4LX4A 2WB5A 2EQDA 2CEQA 2F7PA 5CXPA 3M6DA 4D6EA 4FLOA 1GUVA 1DWFM 4PTMA 5ABHA 2CXGA 4UQBA 1R87A 1R86A 4L4OA 3K8KA 5BRPA 3U7VA 3SCQA 3IJ7A 3S5YA 3PTKA 1HF6A 3NDZA 4GINA 2FH6A 3WEOA 2WLZA 1GNXA 1NOFA 1V6XA 4UFIA 5BWFA 1KTBA 3GYCA 4NXSA 1A3HA 3OGSA 3SURA 3LXBA 1V0MA 4J3UA 4MNMA 4WSJA 4UFKA 1OBAA 2QHAA 4HPGA 4CN4A 1WZAA 4OBSA 1HL9A 4JFSA 1B90A 2WAGA 2F7RA 1MFVA 2UY3A 3SUTA 2XVGA 3AQUA 5D8ZA 1WKYA 2F2HA 1TQTA 1UKTA 4WKFA 3BCDA 5FD0A 2X2JA 2ZE0A 1HJWA 1TE1A 4HZ6A 3VIMA 1HKMA 3VIIA 2MANA 3WNLA 3POHA 1MW3A 4UTFA 3ARVA 2HISA 4UFHA 1RP9A 3AHYA 4JL1A 3HG4A 1VJSA 3AHVA 2EEXA 1CYGA 3W29A 1NARA 1NOUA 5A8OA 3WFZA 3DHPA 1JI2A 5A1AA 3CZNA 1XRVA 4AZ7A 1ITCA 1QNOA 3LXAA 1FHDA 2JIWA 2EPMX 5D4YA 5C70A 1J12A 1TQWA 5DMYA 1QI5A 1WAWA 3BGAA 4F9JA 4OGZA 1TQSA 1CXKA 3L4VA 2XIBA 3OLGA 5JIPA 2YDQA 1IT0A 2CESA 1E0XA 3WD2A 2FGLA 3WH7A 2J47A 2VX6A 2X09A 3EJSA 3MI6A 3BLPX 3J7HA 2XVNA 3HN3A 3WH5A 3N9KA 4BQ3A 3N18A 1OWQA 1US2A 2WC3A 4LXFA 3HZ3A 4AIEA 3A4XA 4TXEA 3GXPA 3VILA 3RM9A 1M03A 3FW6A 1UWIA 1M53A 1GPFA 1KGWA 2PBGA 2C8NA 4AD4A 4IPLA 1YQ2A 3K8LA 3WDHA 2JFEX 3NUKA 1K9DA 4W84A 1JF5A 1C8QA 4FK9A 3CUGA 1TQUA 4FNQA 1BGAA 3EDFA 1H49A 1X1NA 1LLOA 1MW0A 3GH5A 1JZ5A 3QGVA 1VJZA 4PMQA 1J0KA 2WZIA 3AIVA 1HIZA 3OZOA 3UEQA 4AYSA 5CPSA 5JBEA 3GDBA 3BH4A 4B9YA 1QX1A 3QHNA 1EOMA 2RGLA 1ZBCA 3MO4A 5A8QA 2IGTA 1FH8A 2E9MA 2V38A 4XB3A 3ZIZA 3WDJA 5GQBA 3VGFA 1BVZA 4UR9A 3ZQ9A 4AZHA 3GZAA 2YA2A 1NP2A 3BUDA 2VTFA 3AHTA 1VIWA 2VNCA 3EJQA 1JZ6A 6CGTA 3CTTA 1O7AA 3VU2A 3GTNA 3ZO9A 1RD6A 2B31A 4LYPA 2QF8A 3U57A 4M29A 1MW1A 4H8VA 5EB8A 3WNNA 5E0CA 3HG2A 2WMHA 4V2XA 3PZTA 1DEDA 2XIIA 3VGHA 6A3HA 1BG4A 3BVTA 1GOKA 2PF0A 1JAEA 1V03A 1E1EA 4ZEPA 2XM1A 2PWGA 2ZIDA 2ZX8A 2E9BA 3MU7A 3DDFA 1W3HA 1K9EA 2G3MA 2J7HA 1LG2A 5CSUA 1OT1A 5JBDA 1JDCA 4UFJA 5A8PA 4CKQA 3NIYA 2XWEA 5M17A 1SZNA 1UD2A 1QNQA 2V3GA 2WHMA 4AEFA 1XH2A 5EMYA 4UNIA 1EXPA 2OWWA 1RPKA 4UQCA 3ARTA 2DH2A 1DWIM 2DT3A 3F5JA 5GNZA 4J28A 4ACZB 5I78A 3TTQA 2WC4A 1SR0A 2F7QA 1UKQA 3POCA 3QOKA 5CLWA 1R8LA 2RGMA 3GNRA 4ZE5A 1QNRA 4AZGA 1BSIA 4M8UA 1QW9A 1QBAA 3DX3A 1ZL1A 1WZLA 2J7DA 5D9PA 1IZKA 1JZ2A 1JNEA 3ARQA 2IXUA 5I6SA 3DYPA 1E73M 5I5RA 5E0FA 2WM0A 4HA4A 1KCKA 4Q22A 4B15A 4PTWA 4IM4A 2XGIA 4JZ5A 4FMVA 5E9AA 3VIKA 2E40A 1U33A 2VMFA 4LPCA 2CPUA 1PZ3A 1QNPA 5M03A 2C0HA 2Y24A 2EABA 1PEZA 2D20A 5BXRA 4MPKA 4C7DA 3UR8A 4ZXLA 2VJXA 5FOOA 3CGTA 1UR0A 4PMZA 3EDDA 3CMJA 2VZSA 2WHJA 1E6SM 3PZVA 1FA2A 4KWUA 1QI3A 4MB3A 2QPSA 1TFVA 1WDRA 1V3KA 1D3CA 1CNVA 1B3WA 1KWKA 2VCCA 1AQ0A 1L0PA 4H2CA 5LA2A 4P7RA 2WNWA 4HP5A 2VR5A 1GORA 1W91A 2A3AA 2VX5A 3NSNA 3PZMA 4J3SA 1KXHA 4W8LA 3ZOAA 4HA3A 4TVUA 4AD3A 3MS8A 1XHGA 4N0RA 2FH8A 3WD4A 3S6TA 1J0ZA 2YL8A 3AMDA 2DSUA 1GCYA 1OD8A 2NSXA 4CD5A 1B3XA 1CLXA 2A3HA 3VO0A 5JIWA 3VDCA 3NJ3A 1S46A 1ZJBA 2CBJA 3QR3A 4NRRA 2WKGA 1GZJA 5JUVA 4D1JA 5CGMA 3GNOA 3AJ7A 4N42A 3CH9A 2WSKA 2BVDA 1JFXA 4F79A 2F1BA 3VDAA 5IFTA 4PRWA 1BQCA 4W86A 4A4AA 3WL0A 5BRQA 1BTCA 1KGUA 2W62A 3W0KA 5A8NA 2JF7A 5E6YA 5A6MA 2X2YA 1TVNA 2J79A 3WQ6A 5F7UA 1KXVA 4F66A 1LG1A 3SCWA 2WCAA 1HWWA 2D2OA 3VVGA 2PWFA 4IISA 3T0DA 4JFUA 4PCTA 4CD4A 4P7LA 1B0IA 3WY1A 4NZFA 2YL9A 3FN9A 4TX8A 3WH6A 3RM8A 1LWJA 2O92A 1Q6CA 3GXTA 2XVKA 2J7FA 3W82A 1UA3A 2V3EA 4Z2GA 3WY3A 1GW1A 3ZR5A 4CN6A 3U5UA 3VIFA 1I1WA 4M80A 1XGZA 2WZHA 3RJXA 3WUBA 3ARZA 1HNYA 4AYGA 1GJUA 4FNTA 1HKIA 4CD6A 1V3JA 2J77A 5A2CA 1JZ4A 3K1DA 4DUWA 3KL5A 2G3IA 1G1YA 2DPEA 4DO5A 1CGTA 2VCAA 3FHAA 3MUIA 1J0IA 1E0VA 3VKKA 2WCGA 2J7CA 3UR7A 1CECA 2OYMA 2WWCA 1QBBA 3FY1A 3DX0A 3AS0A 2G3NA 2X2IA 1K6AA 3OA5A 4JHZA 3AIRA 2YBUA 4U3AA 5A95A 5DFAA 2Z1SA 5HOSA 4CU6A 4Z2LA 4AIOA 3D5HA 1WDSA 2VO5A 5AYIA 1HN1A 4HZ7A 3SCPA 3SIMA 1KXQA 1QNSA 3E1F1 1W9XA 2ZX7A 4ZENA 3L2MA 3D4YA 5DF0A 3ZJ6A 2PBOA 3VNYA 3MV11 3WF1A 2ESCA 3BC9A 1EDGA 1TG7A 3AMCA 1WDPA 1E4LA 3W38A 2DGAA 3CBWA 5BROA 4GIAA 1UZ1A 3APGA 3KL0A 1UWTA 2E9LA 3RMEA 3CZEA 3WBEA 4FLRA 3IANA 1JZ8A 1UR2A 5A6JA 2F61A 1OM0A 4OUEA 2VURA 1IZJA 1GVIA 3ZJ8A 1QWNA 1TA3B 1XCXA 3AI0A 3VIHA 4UOJA 4YPJA 2XFFA 1CWYA 3BXWA 4E8DA 3U5YA 1CENA 3WNKA 1J01A 3UG5A 4M82A 1AMYA 1UQYA 2PI6A 3CHEA 4E2OA 2ZUTA 3AOFA 3AIQA 3ECQA 1ZJAA 1BF2A 2D1ZA 1AQHA 3SEPA 2X8RA 3AFBA 4AZIA 1JYXA 4RE2A 2J62A 1E72M 2OW6A 3D52A 4H8HA 2XHYA 2E3ZA 1AVAA 1ISWA 2WVUA 4U33A 1W9BM 4JAWA 4Z2HA 4BS0A 3BSHA 1C92A 2CNCA 1QI0A 1HP5A 2J8GA 3NSXA 4MTVA 3WQ4A 5GNXA 4BQ2A 4QFUA 3DX4A 1WNOA 3SUSA 2V5CA 2YIHA 4ATLA 1HX0A 4PTXA 3W26A 5LA1A 2VX7A 3ARYA 2WZEA 4W88A 3H55A 5CGTA 1VEOA 1CXHA 2QMKA 3CIVA 4QCFA 3AHZA 1G0CA 1I75A 3EDKA 5FIPA 2X2HA 1HP4A 3QOMA 3CHDA 1MQQA 2UY2A 3BAKA 4GZIA 4YN5A 1NQ6A 1TR1A 5I3DA 2VX4A 5BXTA 2FHCA 3NDYA 5FCZA 3VDBA 3JUGA 1QI4A 2ZUWA 3N1AA 3N11A 4KMQA 4JKLA 1ZB5A 1KGXA 1E56A 2GDUA 2XPKA 4E4PA 4DWSB 3F4VA 3UESA 3PZQA 4OIFA 2O9OA 3VPLA 5HNNA 4UOZA 3O6AA 3WUFA 2GJXA 2VRQA 1E6XM 2EBNA 1E4NA 3WF3A 2J8FA 4BQ5A 1W9VA 3WMCA 4AZCA 1HKKA 3WDPP 2W4XA 3NSMA 1RH9A 3IAQA 2W5FA 1JG9A 2DSVA 4NX0A 1E6ZA 1GQIA 4R27A 1XSIA 4UOQA 3OIHA 3TTYA 1KWGA 4LYRA 2W67A 4ACZA 3DX1A 4DO6A 4QAWA 1E71M 1I1XA 1J0HA 3WF0A 4CVWA 1MVYA 2GUYA 2VR4A 3IJ8A 3WELA 1TCMA 4C7GA 5EBAA 3T2PA 3VGEA 3OG2A 5AC4A 6TAAA 3WSUA 3BMVA 3WUEA 4D6IA 1ECEA 1TZ7A 2BVTA 4W7UA 4HU8A 4PMRA 4AD1A 1KQZA 1Q6EA 3AXIA 3M7SA 3PZGA 4ATWA 1UWRA 4X0VA 1ISYA 1OT2A 4L4PA 4OOUA 1ODZA 2VT0A 5A6SA 3SCSA 1JXJA 1J18A 1MXDA 2J7EA 5GPRA 3OGVA 4Q7NA 8CGTA 2O9RA 2VRJA 5IDIA 3WF2A 1UR4A 5A6LA 3W25A 3IJ9A 2XUCA 3A21A 4UQEA 1OINA 1UASA 2PWEA 2BXZA 3KWXA 4J27A 1NOWA 4DUXA 5DO8A 2DQXA 3LPFA 1QW8A 2FHFA 1GVYA 4MJ4A 2ZXBA 1JD7A 4QCEA 1XSJA 3CZ8A 3LMYA 3THCA 1VFOA 1W9DM 2CBIA 3RIKA 4LQ1A 5FL1A 3ALFA 1OGBA 4CD7A 3O2LA 3EJTA 3W27A 4NRSA 1W1PA 4HMDA 2UY5A 2J25A 1V0NA 2DT0A 3CZJA 1B9ZA 2Y8KA 3AS1A 3L2LA 4D6FA 1N82A 3MUAA 1VEMA 4GO9A 4W87A 1UH2A 3TOPA 4W5ZA 1V08A 4JFTA 3VSVA 3BVVA 2V3FA 1WP6A 4PEEA 3GM8A 4MJ2A 1DHKA 3TONA 4D1IA 1AQMA 1CTNA 2CERA 1FH7A 3UERA 2DT1A 9CGTA 1J10A 3B9AA 4MNLA 2BY3A 4DUVA 1M7XA 2DIEA 1XH1A 1HT6A 5I0DA 1GJWA 4MAVA 1UYQA 3BSGA 2YFOA 5A3HA 2XGBA 4B3LA 3OBAA 1ZS2A 3A22A 4NZJA 1XD0A 3ZR6A 2YA0A 1NH6A 5BXPA 5FL0A 1PX3A 1MW2A 5D9NA 1C8XA 2WXDM 4JHOA 3WF4A 1H41A 1C91A 3ZT7A 2XN2A 1UKOA 1UR8A 3VM7A 2WC7A 2JEQA 1VFUA 5E1QA 3UG3A 3K8MA 4MNJA 2WVSA 1GHRA 2GFTA 1UHVA 1ISZA 2GSJA 3GNPA 1VB9A 1H4PA 3VIOA 4E8CA 3G6LA 4P8WA 2WMIB 4PSPA 2BY0A 2E0PA 3D4ZA 1OB0A 1VF8A 1ZBWA 4DWSD 2G41A 1UG6A 3ARXA 2VVSA 5E70A 3VD9A 2W91A 4KGJA 3VIGA 4GI6A 2WK2A 1UKPA 3LRMA 4JL2A 2W66A 2ZXQA 2AMGA 1UUQA 1F4AA 1KTCA 1KBKA 1GQKA 4U2YA 1ITXA 4UZUA 4AW7A 4WKAA 2QV4A 1MQPA 3ARPA 3W53A 3WQ5A 3VM5A 4HOXA 4IPNB 3WNOA 5M3WA 3EYPA 3H53A 1NP0A 3BUQA 1WE5A 7A3HA 3UETA 2IUZA 4W7VA 3VIJA 4GZEA 2D0HA 1LL6A 1QHZA 1R85A 1HVQA 1JNDA 1Y7VA 1KFWA 3RILA 5A6KA 4ML4A 1J11A 1E55A 1IV8A 1WZMA 3CPUA 4GI9A 1FH9A 4JKMA 4MADA 1CGVA 2BV9A 3KL3A 3VSTA 4OOZA 5I24A 3QHOA 4J7RA 2XN0A 1CZ1A 2A3CA 2J75A 2WVVB 2UY4A 3BAWA 1EDQA 3G6MA 4S3KA 2DEPA 1FOBA 5HPOA 3MUY1 3AMGA 4GO8A 2F1AA 2JF6A 3DDGA 3UG4A 3II1A 3WNMA 3AXHA 1H0GA 2EPOA 2OWXA 4W8BA 4YHGA 2FGZA 1R34A 3SCOA 2VZUA 3D50A 2PB1A 2X0YA 2DDXA 4PUDA 3ZSTA 1DWHM 2DIJA 4GXPA 1GOOA 5JBFA 2G3JA 3WH9A 2JE8A 2XSAA 4OZOA 3BVXA 1E4MM 3WENA 1GQLA 3VUPA 1J9YA 2WMKA 2YLLA 1NM9A 1DTUA 3WD0A 4HA1A 1R7AA 2W63A 2VZOA 1Q4NX 4V28A 4MB5A 2G4FA 4AZ6A 1A47A 1X6NA 4ACYA 3OGRA 4FLSA 1B2YA 5A6BD 3AXXA 3CZKA 4TX6A 3IAPA 4AZBA 1TA3A 2YDSA 1SFSA 1OGGA 1GOIA 2DSWA 3O9NA 1HKJA 2DSKA 3T0AA 3HG5A 2OWCA 4CD8A 4JIEA 1CGUA 1G01A 4W93A 1R46A 2XVLA 4JFVA 3N17A 2Y4SA 1HXJA 3VINA 8A3HA 4HOWA 3FHQA 4TTGA 4KGLA 2BXYA 2VRKA 3GBEA 3A3HA 4PUEA 1CBGA 3K4DA 2D22A 2YL6A 1VENA 4FNSA 4TUFA 4K68A 1V6WA 1G94A 2Y2WA 1V3MA 4H7VA 1CDGA 1B31A 4GZJA 2WANA 3CC1A 2JIEA 4F9DA 3MMDA 2F8QA 5I77A 4CN1A 1GOQA 1OIFA 1JZ7A 3WUGA 2CKSA 4W7WA 2XN1A 1Q6FA 4PMVA 3BUIA 5EFDA 5KEZA 4BZYA 1UD4A 4P7QA 2WVTA 5CJ5A 1WPCA 1V3HA 3CUHA 1UD6A 3D3AA 1ZBKA 2BFGA 4P7NA 2YL5A 3WFLA 3DX2A 1ZU8A 1VRXA 2EO7A 4AD2A 3ARUA
chains in the Genus database with same CATH superfamily
2DI9A 3MKKA 1W1IE 4ZAKD 3ZDZE 5BQ7B 1HHJA 4IMAA 1V27A 4L23A 3AU0A 1N6UA 1DOSA 3OJGA 3VSQA 1FFQA 5T91A 3L16A 3L3OA 3VQ2C 1S39A 4PVLA 4YXKH 2B59B 5E6ZA 5JORB 3MV8D 1PPIA 1MZYA 1N8WA 4XC3L 4X9YA 5D7SL 1O9WA 2OZTA 2XZ9A 1FL5B 1GZGA 5BYWA 4LP4A 2PCXA 3C6LD 2YBTA 4FQ1H 1EJFA 1HKLH 2WLMA 4F0RA 3WQ8A 4V1YA 3VA2C 1BCIA 1EHAA 5HP5A 4ZSTA 1RBAA 3GS7A 3OYZA 1M05B 4MLSA 2EEDA 2PO6A 2QQNL 4GCXA 1RBLA 3CWNA 3LRLA 3UADA 1MCBA 4YQXL 1QSEE 4QLJA 2P8PB 5AHEA 2OGJA 3S36H 1LO2L 5D32A 2ZOUA 4Z7OE 2C4FU 3KOWA 3VI4B 5BRBA 3AIUA 2BINA 2XXFA 1UJTA 3KEDA 5TD4A 5JDJA 5FA3A 5C0RH 4G1MB 1GYVA 3CQJA 3TCLA 3SE4C 5HR6A 4UB9A 3W7MA 1MRAA 1WUFA 3TFCA 4X83A 1P4IL 2DWXA 1JUFA 4GFTB 5JZ7D 5SWUA 1UH3A 3MLTA 3WHE0 3QWNA 3VAVA 2JIXD 2F7OA 1J2WA 5DD0L 1R3YA 3W2JA 3DX8A 3FXYA 3C12A 1IM3A 4IMCA 4KU1A 1J5SA 4OGAD 1PL9A 2YEZA 4TNVK 4H6KA 3QXUA 4NJAL 3TEZA 1ML0A 4G7FA 2C1OA 2C19A 2Y1YA 3GLDA 2WP3O 1PZ2A 4OUOA 3ME0A 1CFSB 4YDZA 2CR0A 4NCC1 3D18B 4NM4H 4PJ5A 4IOFC 2ALRA 3MHFA 5F6HI 3G6DL 3LI0A 4ERGA 1LXMA 3MYJB 1WJ3A 4NNXB 2O5ZH 1QVOB 1Y6NR 2ZUVA 4FXLA 4JGJA 3BQUD 3BI9X 2YX0A 2VXVL 3L5AA 1XGRA 4FE9A 2IOMA 3TW9A 5ITBL 4NNPL 2QZRA 4OM0H 2DWEB 2VR9A 3VXME 1XSKA 2O5NA 3GK8L 2BZCA 3MRJA 2I32A 4IIZA 4N0UA 5FYJD 1KT2B 3TZVC 4XO7A 4S2BA 2FJGB 1UOLA 4M1GL 1GGBH 4TTDC 5IQ9B 4XTRC 3GXIA 1SJHA 4X4YA 2FWOB 2OJZL 1XDTT 4Y2LA 2G5UA 4LCWA 4YSQA 1CT8A 3K2UH 3SGKA 2P53A 4XE0A 1A6AA 4QP0A 1LT8A 2VISA 3RY5A 2ADGB 3PJSA 1BM3H 2HLAA 5B38G 4DJED 2DQDH 1QVOA 4PRHE 1G5AA 1DWGM 1K8CA 3NQFA 3ARDA 3PPHA 2BCKA 2YRZA 3CSTA 3OQ8A 2CIIA 4AGLA 4EUPG 2V7NB 2P3YA 3WEMA 4H6RA 5I1AA 4HJFA 2J44A 2JJSA 2OZ4L 3NFNB 1A8JH 3RFZC 4PREA 2A4CA 4HHWA 4UILL 4IDJL 1OK6A 2HH0L 4G59C 4P57B 4W85A 2R59A 3QQ9D 1CPUA 2MTAA 5C0BD 1UR9A 4IXXA 2GVYA 5K9KA 1N7MH 4LIQL 2ZICA 3QA3A 3VRJB 4HK6A 5IMLA 4M1RA 2V63A 4K7FA 4FERA 3FH5A 1F58H 5FDYA 1PG7H 1JWSB 1PX8A 2VUOA 3VMNA 1KFBA 2WYSA 2ZUMA 3DMMC 3HS0C 1VBUA 4JDYA 3VXQB 3L7EA 1OGTB 3G0SA 5C0CB 1VKXB 1F61A 1UOKA 3O9WC 2COVD 1KR1A 3T1WA 3T6ZA 3LU2A 3CZLA 2OT1A 1L9RA 4F7CB 3FU9A 2HAZA 2FT7A 2P5PA 3QORD 2OEMA 1E5AA 4IXHA 4O53A 2IMRA 2AK1H 5E6ID 1BMZA 4OBTA 4X7FC 2CHNA 3OR6B 1H0DB 1UD5A 4L9LC 1NAMA 3A24A 5LN8A 3QT2A 5J4MA 1E4WL 2VFDA 4J3WA 3CXDL 4JY5H 3PTMA 3V1HA 4M03A 5A8GA 3CN0A 2POTA 3W2DL 2O61A 3KW8A 4JCLA 3HE7D 5FYKL 5IVXB 1ORSB 2F18A 3ZDZF 2JELL 4HZAA 5CPTA 3ARSA 2O26U 1R17A 2R4SL 2P7TA 5TF1H 1EANA 3JU2A 4MKSA 4ZX3A 2LGNA 2W07B 5G1TA 2HKHL 4PY8J 4NAEB 2R9HC 3QDMD 2NYYD 4KJQC 1WAAF 3LN4A 5FEPA 3GSRB 1NUNB 4ZXOA 5GGSB 3FB8A 1JTTA 2B9BA 5C0AB 2Z1XA 3CZFB 4GYKA 3T09A 1HE8A 4OZHE 3VIPA 3NSJA 3KXFE 2UZYA 3MRPB 1GHSA 1HKLL 4RJEA 4M6MH 2OTUB 3CUIA 1DSYA 3DHUA 1AUSL 1KFJA 3NESA 4G9FE 4YXHL 1EBHA 2YD1A 4BKLA 5GZNC 3HOGA 1S2CA 1GSKA 3TO4B 1RVFH 4DEPB 4FFVD 1EP1A 1L7TH 2FZBA 3GPEA 1AR2A 3EYFA 5ANHA 1A0DA 2GHWB 3WIFB 2Z93B 1AG0A 1DVFB 2CK0H 4NAEA 3ROOB 4Y5YA 3WFCL 2KYIA 1ED3A 5CS7A 3DESA 4PUKA 2R0WH 3R4RA 2J7BA 5LXXA 4G1KA 3LOWA 3L4UA 2G4JA 5LWYL 1J48A 2YW3A 4B5UA 4HK3N 1NWUA 4ELKA 5ADPH 4OBRA 1BGGA 4HV8A 1I8AA 5F7DA 1ZVHA 1MZHA 5EU6E 1HWHB 3QUXA 4AIBA 3ZLGA 3CSYB 2AJXH 5ICUA 3MSRA 1BD2B 4X8XA 4YMPA 3KBFA 3VVWA 3TH6A 4XVEA 3DV6A 5A8MA 3P11L 4NLHA 5F6IC 4AC4A 4KFMA 2AZAA 4FA3A 2Q3XA 4ILSA 1DSFH 2WKLA 1H5YA 4HD9A 4XX1E 4R0LC 3VMPA 3KBJA 5SX4H 5J11C 4GUCA 3QG7L 4Q9RH 3WLWC 4EP8C 5KVGH 1NOLA 3GS4A 2BOFX 3FNDA 4PRHD 4Y9NA 5I8KL 1PZSA 4JPWH 3GM0A 4M3JA 3A6CH 3FF8A 4K4KA 1KTLA 3CS2A 1SBBA 1U9KA 2JMRA 4WFHD 1H2JA 2HVMA 1UZGA 3FKRA 3R5EA 5K9OB 2DIKA 4XBJA 2VZ3A 1EIBA 3VFGH 1JVLA 5DJXA 3H2NA 5FYJE 4UNVA 4LAMA 3JYCA 2XWTB 3BKCH 2P8LB 2A9DA 2WQVA 5REQA 2J73A 4EVZA 2UYLA 3W37A 1HE7A 3ZUCA 4DN4H 1TTAA 5AW9B 2LQRA 5B39B 1GJPA 3SSJA 3S96B 4G8FB 1ZHKA 1KTLB 2BPBA 1MQKL 3NIGF 4HT1H 5DJ6B 1VZGA 3QJXA 3QXBA 3TNMA 3P77B 3VWJA 2I9LA 4HMCA 4IS6A 1V7NH 4LPWA 5FM5O 5CP3A 4K5MA 4U3CA 3WNPA 2EKSA 4NWUH 1TV8A 1U3HA 3A67H 2EHHA 3SYAA 1NJ9B 4NN5B 5B22A 4BSJA 4K7PH 2ICSA 1SEBA 5IWLC 3W73A 2HXTA 1V6UA 1V6VA 4GH7B 4TM9A 2WLJA 2NXGA 1WH0A 4JG1L 3V7PA 4MJ5A 4KUZH 4F3FB 1GQJA 4H26B 4KBPA 1MDAA 2I07B 3ALPA 5MEPA 4FHBD 2YOCA 2WSRA 1XB8A 4X7EC 4Y1AB 1DJXA 3G6AB 3MBWB 1AXTH 4XCYA 3VCLB 1DE5A 3STLA 2HPTA 3T8MA 1VFFA 4AXKA 1HL4A 3M45A 2VN6A 5D1QA 3REWA 4LEXH 4LLDB 4DEWA 2P3ZA 4PODA 1NCBL 3EGSB 3FPYA 4KDVA 1F4WL 2OL3L 5I6LA 4XZHA 4KAQL 1HEZB 4Q8MA 4L4TE 1TYEB 3EJRA 1KCBA 4WTXA 3PHAA 3Q8CA 2E4TA 2PO6C 3UIZA 4HPHA 3F00A 3TEYA 1ODUA 1E1CA 3FUEA 3X3GH 1W1B1 1MQRA 2VEMA 3CUPA 2ZX5A 3K71B 5DZAA 4GBUA 1SVDA 2BOLA 1EEZA 1MJ7H 3NQIA 4XPTH 5H37A 1M7PA 3PBUA 2L7JA 3D0VA 5AAMC 4EDXA 1MJJB 4N2EA 3N0AA 4GS7C 4J12A 4Y1AA 4OCRH 1ROWA 2H1XA 3QULB 3S5ZA 3DFYA 3NOEA 1S78D 3CBJB 3TN0D 4JFYA 1OGPA 2C7FA 1WBYA 3H9HA 1MQ8A 1NCIA 2L8AA 4H1ZA 5B7FA 4TTUA 4KWOA 3VWJC 3OKKB 4S1SL 4WWOA 4J3VA 1ADDA 3JXAA 4JDVB 5BMXA 1Y18B 8PAZA 3W74A 3T2NL 4D9RD 3NSDA 4DJFA 1Q94B 4JZOB 3CYVA 4X9GA 1CYWA 1KLUA 3D9AL 4D9QD 3K71A 2XV3A 1ZXKA 5AD0A 1SHMA 1MRQA 2ADFL 3IDGB 4H9ZA 4GSQA 4WZ9A 4LOFA 4XD5A 1S38A 4KJQD 1WBYB 3KUMA 3BVUA 2EACA 3UF9A 4E41E 3URAA 3GMNA 1RUSA 5GS1C 43CAA 3PE9A 2FT6A 5HDOA 5G55A 2QLYA 4E68A 3MLVL 2AL2A 1ETZA 3ANUA 2XYBA 2I7OA 4PSRA 3V4PL 1OCQA 4HBKA 1BQHA 1NCGA 4Y4FC 5ELIA 2MQ0A 1RALA 4H88L 1YUKB 4NJJA 3P30H 3AG3B 3AFLA 1RUQL 3ETSA 3ETBJ 1TV5A 5LYRA 2Z8WC 3FONA 3SGEI 3WL1A 3AZTA 1M7DA 2IV9A 4YDIH 4JFPB 3HJEA 1HILA 2E7FA 4C1KA 3VKCA 4U1JB 1XBDA 5I74C 2CITA 4X8JB 1KV5A 1W1A1 5BOEA 3L4YA 4B3KA 1JNLL 4MNHB 5KVGE 3AXLB 5IJDC 4EK7A 3QPKA 4OLYL 3ISIX 4DN1A 5T1MA 2ZXDA 5C0NC 4NNYA 3RWEA 3BW4A 4B91A 1NCWH 2CJUL 4I5UA 2YO3A 4HKPA 1L4IA 3UGEA 2P5EA 4LCWE 4XAPA 5HHNA 5DMKB 2WNGA 2B5IB 3C2SA 3LCIA 4ERIA 4NZCA 1B4KA 2HSIA 3BUPA 1P4BL 4X2UA 5D7HA 1HILB 3QPXL 5IW1A 3EGXA 2TAAA 4PV8A 2TYSA 3N13A 4H00A 3ZWTA 5KTEL 3Q0HA 1W16A 3BXNB 2B20A 3KHQA 3MNWA 1ZLEA 2KLSA 4AH2A 5F44A 3PDOB 1U5VA 5G4OA 2DBLH 3IV3A 4JS3A 4NPYB 3WN6A 3LKNA 4UBDC 2YDRA 5DJDB 3HLAA 5I8EB 5I5JA 1Q2SA 2BHUA 1JFHA 2ICCA 4M7LT 4CSSA 2GGIA 5IXEA 5HHNB 2CCVA 3MOAH 3QJRB 5HGAB 2FHBA 2GHZA 1XZ0A 2VLLA 2VXQA 1EUAA 1O5RA 3GC5A 3IGUA 1W3KA 1KCRL 1YTKA 1X5ZA 3E0WA 1PSCA 2VC2H 4ROQA 2R69H 1T8QA 4LYQA 5CZJA 3ZO0A 1TKKA 1H5VA 3EEZA 3R8RA 2DAVA 4UTAL 3UWVA 1MQKH 4A2SA 4EBQH 3CVCA 4C4UA 3FTGB 1XM3A 5E1IA 1I9JH 4Z7QE 1GVOA 2GCYA 4UINH 4ATTA 3ZDXF 1B3YA 3CZSA 2NX3A 4LPUA 1T03H 2UZ9A 2ACQA 1GPOL 3QZNA 5FCUH 3TO4D 1UQZA 3VGBA 3EX2A 1UZHA 1NGPH 2EC9U 2XT1B 3LCFA 4R8WL 1VBRA 5DO2D 3X1NA 5HI5C 3BN9C 3C3UA 4Q3MA 3MLXH 2J6EA 1YDVA 1RHCA 1B0GA 2IGFH 4N8VG 1W31A 3BOFA 3VUSA 5I8CA 1EJTC 1AGFB 2X4PB 4TNEA 1WDQA 2WAHA 4IUGA 3L4TA 3D3VD 1D9KD 2E67A 5J3HD 3M0YA 3PREA 1WV2A 3SBWA 4AVJA 3FTXA 3GXMA 3P0VH 2W0UA 3DKJA 5ICZA 3NA8A 2FO8A 4A2MA 2OL3A 4P2OB 2OMBA 4GIPD 4AUYA 4CU8A 3D25B 2VIRB 3EJCA 4KNTA 1OCOB 4M7LL 3JR2A 3WDIA 3CD4A 4JTRA 2DH3A 3K5XA 5JDSA 1W72B 2VLKD 2GOUA 4PFEA 3F6LA 4N8UA 2I24N 2BTMA 1CDBA 4LWWA 1HG3A 2O5YH 2P5WA 4MWAB 1S2UA 1OHLA 1SN0A 2DV0A 3MFGB 3LKSB 3EJPA 2P42B 4P7OA 3NQ8A 1AH0A 2NUWA 3GJFA 1Y5XA 4EJ1C 3MNMA 4LVHB 2FECL 2H3BA 4US5A 4NAQA 3I3DA 4PS8A 3ZLQC 5ICZB 5FEZA 3QIWB 5KBPA 4XVOA 2IPKA 3IGLA 1PZBA 4TOQA 1JRHL 4ZD3H 3SD2A 5B8CC 4HJTA 2ISWA 2ZWYA 2PXYC 4ZMGA 2WQUA 2ZRXA 2ZXEB 2ADAA 3H3BC 4N2CA 1UATA 2G9KA 5L2KE 1RY0A 3M88A 5IROD 1A1NA 4BFJA 3EWXA 4C6EA 2VXUL 2ZP9A 3DV4A 5IV2B 3S42A 1M71A 2VW4A 3T4YA 5H8DA 4QRNA 4PJ8A 1CE6A 4UQDA 4JB9H 4X5WA 2K6YA 2EADA 4J5NA 1NWTA 5HHXL 1EQPA 2YCJA 4H41A 4NSBA 3L5JA 5A16B 2KC0A 3BO8A 3RLSA 2PGFA 2E7LC 4N1EA 1G7HA 2N0MA 2NY6B 1NWRA 1NU5A 5D9MA 3LPGA 1KO0A 3U4BL 3DIDA 1PHQA 1F86A 3BARA 3C2OA 4K7YA 4V27A 3RK8A 2G0LA 3LIZL 5H37G 1IXPA 2Y70A 5K33A 4RNJA 2X0UA 2VJ0A 4PJCB 4XN2A 3GUTA 2DZUA 1ETA1 1ECQA 3WS3A 3BKYL 4KETA 3UDWC 1G1OA 3VTRA 3VNZA 3PBMA 3V6FA 1D2PA 2IOIA 3FQ4A 3CVHH 2NT1A 1QOXA 4NNXA 1XIGA 5SWZD 3HUJE 2VC9A 4BJHA 4S0HA 3TR2A 4ADIA 5F96L 3CH0A 3PFUA 4GJTB 4AG4H 2DQCH 3FQTB 3S35H 3EH3B 2O56A 3RL1B 1C08A 3B0UX 3I75B 1AD1A 3ZJKA 1ORQB 5A2AA 2XTSA 3GUTB 1V3IA 3B3IB 2DWDA 3SB3A 3L4XA 1BJ1H 2BB0A 4Y2OA 3AU1A 4NUJA 4U1HA 4MB1A 4XN1A 1MCWM 3MRKB 4N2LA 2GAZB 1A6PA 4XNBA 2NY7L 1M9HA 4Z2IA 5LXGL 1JPTH 4ANXA 2YYUA 2WZPD 2BCKB 4UT9L 1LO2H 4JTFA 4RX0A 3GMRB 3OPUA 1ZFJA 4E8GA 3KZPA 3RL1A 4DWSA 3MKGA 4TVPL 4N9DA 1AXSA 3JZUA 1HTYA 2FB2A 4K2UL 4XZNX 4BUHA 3MRQA 2TRHA 3NG5A 3QCTL 5C7XL 1JDAA 3LQAC 4L37A 3T0TA 3GSWB 4XVTH 5ESAB 1P2CB 3WFBH 1EGJL 4BS0A 5F7LB 1PSKH 1VJIA 3OZ9L 5T1DL 3EW3B 1JCYA 2C91A 4PWKA 1SO4A 3MV9D 2LT9A 3KDMA 3NIDB 3BLKA 1JWMB 4AE0A 4RDZA 1H1NA 5DT7A 2BG5A 1L9MA 4LVDA 4YTUA 4HGWA 2ATMA 1XI3A 1A7QH 4UDTB 5JW4M 3BLBA 4C6OA 4EPBC 3SKMA 1SSGA 2W61A 1XF3B 3RB5A 5FA3B 2O9PA 3C6LC 5H94A 5KANI 3EXLA 1F3XA 4P3CL 4Y7EA 3FOMA 1QWUA 3N6QA 2H41A 4HIJB 2HRHA 1QBLH 1A4LA 2B0MA 4CNSA 3M16A 5HK4A 5I6OA 2J21A 3J27A 2ZVIA 1CFVL 4JRXD 2ZE3A 2EDQA 1BQUA 3MLXL 3KCLA 3MTXA 1NTHA 5CLTA 4YSSA 3FB6A 2JF1A 2X05A 2WBJC 4Z5RA 1H15A 1TE6A 1QSED 1CL7L 3CE1A 1ZTXE 2FIRT 3OJDB 4TSCH 3N73A 2NX5D 4QRPB 2GW5A 1H3PL 5J12C 2QAPA 4AF0A 5L9DL 4I18C 4APQB 2BBFA 1PYWA 2CHRA 4HXBL 4UV4L 3KJ4C 2UY6B 1F6KA 2WWDA 1GY2A 1SXZA 2H3KA 3MYPA 2GWGA 2ODHA 4JTGA 1A3RL 3GTTA 5L7XH 1WITA 3GSRA 2OJZH 5BRZD 3ARRA 1X8FA 1T6MA 4WKHA 2C9PA 4CEUC 2IBZX 3VU1A 3ZIMA 1R0AL 3CZFA 3N2JA 3O6LL 2FVLA 4UBPC 3WMBA 4DF2A 3FSZA 4DVRH 4P8UA 2EDOA 2GDVA 2X70B 4BV1A 5CKSA 2IQAA 6PTDA 1B6DA 5HDRA 3OAYK 4OJEH 3CV2A 4K39A 2DW6A 3HFTA 5I1IL 2ZD0A 5B3NA 4YHKH 1KULA 1CZ8H 3EYFB 2Z31A 1EA9C 1FXQA 2BNUB 3T2OA 1ZJIA 1LO5A 1N9PA 1WG3A 1OFBA 3P4LA 1XHHA 1JPSH 5GGVL 1HH6A 5GZOD 3CPRA 4PCPA 4R88A 4M7JL 1SZRA 4JFWA 5D1XA 5L2KD 5KUMA 3LEYH 4PCSA 2PFHA 4LESA 1PTAA 4XWGH 3SIKA 1H09A 5AW6B 4S2CA 3IFOB 2PW2B 4E3TA 3FRUB 1E9QB 5I6KA 4K94L 4AWJC 3LMJL 4AMXA 1MIEH 2A9ML 5KSBE 3ZM8A 5LGZA 1DQQB 1A7OL 2IJ0C 4XPAL 1P7HL 1JK8B 3GQYA 1FZMB 1R33A 1LL1A 4BCZA 1GOWA 3A12A 5E2UL 3A3XA 3I7RA 6TIMA 5KZEA 3NAVA 3R7QA 3WEZA 1AY1H 2V2DA 4KQ4L 1HH6B 1XJBA 2BHYA 2QSVA 3BP5A 2V5TA 3GAYA 1EX5A 4L61A 1BIHA 3VGDA 1W9UA 1S5TA 1A4MA 3RM4A 3FO2A 4AKOA 1MFDH 4AQ1B 4HWUA 1YYLH 2APWA 2EDMA 2NSQA 2WXOA 5FYKH 1O5QA 2VSCA 2V81A 1T03L 1IM9B 2AABL 4I3RH 1AD9B 3PWPA 2OMAA 3N2BA 3QEZA 4KERA 3RX2A 3M46A 3I9AA 4OH2A 4NJAH 3GBLA 2ZAGA 3RVTC 5J6HA 3LHYA 2AANA 4RNRB 5BW7C 3CNYA 2QVTA 4JPKL 4PVNA 1HJUA 4R4NC 4ZPTA 3OLEA 1A25A 4OZFA 2B3RA 2CIPA 4G7EB 4NU7A 3HC0B 1IL1A 4GRLD 2QNEA 1KQYA 3AROA 1CLCA 1PEWA 3DYOA 3T65A 1ZQ5A 4BFFA 4IPJA 5IBLC 1XCQA 5F7HA 4GAJL 4APXB 4JREC 1LP9F 1PCKA 2X0VA 1IM9A 3WO4C 5JW4Q 4P5TC 1W32A 3AISA 4DPQA 4OLXL 1WGVA 2W07A 3MUJA 2IMNA 3LPOA 4L3ED 5ACZB 3WFAA 5KZ6A 2CH8A 1WBXB 4P3DA 4QHLB 1M6JA 3NFPA 1YPXA 1ZCRA 5HDBB 4I0CC 3TPKA 2B1AL 2CCLA 1RPQA 3L3GA 4ZUSB 5GRJL 5I6MA 2OFJA 4P8XA 4DI8A 1UPMB 1YBQA 1QA9A 4ZX6A 2Z1KA 1ZCOA 4B5EA 2WW5A 4NNCA 1RZKC 3FH7A 3NYKA 3V6OA 2ZCLH 1BXNA 1TWDA 3LV5A 4BF7A 4M56A 1A1MB 1GOGA 3U3HA 4C6DA 5JTWA 5KYNA 4K3DH 5LBSL 4LRIC 5L4FA 3FVMA 3N3MA 1GZHC 3OGCA 2P8CA 4ZW5A 2AXGB 3C4UA 4PMYA 2AJXL 2WXQA 3ARFA 5DLLA 1L5GB 5A7BA 1D6VL 1OW0A 1FYTB 1YPZB 2F2KA 3GRWA 5I16B 5IQOA 2Y63A 1Y8BA 3BGJA 5HGDA 5T8GA 5EMUA 1JF1B 2P52A 3KEHA 1JNNL 1KEGL 1QZNA 1U8OB 4PBGA 5KZCB 1C1EL 1CBVH 3T0EC 3WE6B 1NFDE 3BUYB 1M1BA 3BSZH 1KR0A 1VHCA 1XIWA 4XC1H 3LX9A 4Y8AA 3ZLHA 2X9WA 2XJ7A 3I6SA 3PZOA 5CZSA 3OZPA 2HCZX 4UQ2A 1XBRA 2E7CA 2WN3A 3H3KA 1NC4D 4MD5B 3TBWB 5T1JA 1QUMA 2OMVB 2YR3A 4Y4KD 4LL9A 1KJ2B 1OAQL 3W3BA 2XQYG 2X1RA 4RZ6A 5LNRA 3ZDWA 1G6RB 2K8QA 2QGBA 4NEHB 1YNTB 3QZWG 1NTDA 2D7MA 4PMNA 5BOFA 4XWUA 1Y18A 2TMDA 3X12B 2ITDA 1U1UA 3D39A 4J1OA 3BUYA 1T04B 2O30A 1YAZA 3L1OL 4JZOA 1IJ9A 1ZJHA 1F3RB 1I8IA 4HF5H 2Q2EB 3RJQB 5D71L 5BVPL 3EOEA 4IL2A 4WHTA 5LO7A 1KCLA 5JHMA 5IJVA 1HXYA 4HT1L 4OW6A 4PTUB 1HQ4B 3WEXB 4AC2A 1D7KA 4I2XE 2Q01A 2E6FA 3MBXH 4BCYA 2XG4B 4M1DH 1QCWA 2LU3A 3VWKB 3O0KA 4OGXH 2EKJA 3T1FB 3VWJD 5E9DD 1RKRA 3EHBC 4JUTA 4IDLA 4A6YH 7REQA 4GBXD 3MKCA 1KB5L 1K7FA 1PZ5B 1YN7A 4NS0A 3DIFA 5T5FH 1KFEA 3SADA 1G7MA 1K5WA 3EBIA 4CMHB 2QTVA 4IKNA 3W81A 1N5YL 1C8YA 1DJSA 2JB5L 4KUZL 1VGKA 4ZXBC 3B4UA 4GX9A 5F7FA 4NP7A 5C0JA 4IBWA 3MKVA 3W39B 5AWNH 1H3XA 4M24A 4YTRA 4Z7UA 3UTTD 1NINA 2WSPA 5TE7L 4P3WA 4RL3A 3X1EA 4FL4B 1M7DB 3L23A 4IMDA 3KCJA 4N90E 3VW3H 3TZVB 3LBMA 3HUJB 5DMLA 4F3HA 3B9EA 3US1A 5GGTA 4X8JA 2Q20A 3N2TA 1WEJH 1GG0A 5JO5A 5DANA 2A4AA 2QVMA 3FUHA 4QHKI 4MJ5B 3NYDA 2DLEA 2GJZB 2P46B 2DZBA 2PSNA 4H9XA 5CG0A 3SE9H 4QLKA 3Q8EA 1RZJC 2Q76A 4NQCA 4OZGB 1EJRC 4Z2KA 2D0GA 2ZZUT 4PIBA 4N8CH 4XVTL 3T0XA 3WFBL 1JN6B 1PIFA 1WD9A 2CKNA 1YNLL 4ZQRA 4AXNA 1SF3A 2BVYA 4HK3J 3QNYB 3W24A 5LA0A 4UNUA 3CHQA 2ZUXA 3CQIA 1LK2B 5AZ0A 2CYGA 3HN8A 4X3ZA 2ISSA 5DT5A 5KANG 1MFDL 3SO3B 3AZRA 4MIMA 3TBSA 2JH2A 1YYLL 3TJ4A 2FATL 3A4AA 1GTEA 1UJ3B 3AWFA 1XYZA 4ICXA 4CDGC 2YMXH 2CBQA 4KT2A 4G7RB 4IP4A 1FNLA 3CQKA 3OXSB 2FX7H 4XXCA 1ALDA 4ZYKB 1O5PA 3IDMA 4BJLA 4DKDC 2BGNE 1GAFL 3KLDA 2PW1A 4NUGL 3MPCA 5CD5C 1GC1C 4XWOC 3RVVD 1JPDX 5A94A 1MJ8H 5JPNB 3G1RA 4PLJC 1NFIA 2N3JA 1BAWA 1EZWA 3MCMA 4N20A 4JDVA 4YHZH 3BKCL 4HU3A 1CFNB 2ZF8A 2CKBL 3RY6A 3ZE0E 4CW1B 1GKEA 1DO5A 4YGAB 1S1RA 2CLOA 3ZDXE 4FB7A 2F7PA 1LLWA 1NKRA 1BDYA 1N5AA 4NQDE 4DJEC 1UP2A 3IEAA 3ABMB 4OVXA 5I1DA 3IJLA 2K9FB 1OYCA 4C6LA 3BPCB 2B1AH 2LW3A 2NW2A 4FQPA 5D96B 1ME7A 1R86A 5HVHB 3B7YA 1R87A 3UQNA 5D1XE 4Z08A 3U7VA 2C9RA 3S5YA 3PTKA 2HFFB 5FKAA 2H8ZA 4JN2A 1PWMA 1MEXH 3V0JA 4YSOA 3GC3A 2EG8A 4KITB 1GNXA 1V6XA 2ICWI 1JZGA 2WPBA 1Q5MA 2AEWA 4E5XA 1EXHA 4K3ZA 1NEUA 5CINH 2GEQA 1LE9A 3IIZA 2W60A 4LK4A 4P2OA 2P10A 3QDMB 2XFXA 3RDTD 4XI5D 3CDZB 1C5CL 5FLVA 1I3VA 2YXXA 3V7MA 4HMNA 1DJGA 3KCPA 1O7DE 3CFNA 4RMVA 5DVOA 5IJBC 1A6WL 3PXJA 1MEWA 1BF8A 1IQDA 5FKAB 1WZAA 2Y0SA 4HPGA 4M9OA 1I9RH 4K71B 1HL9A 4DGVH 1MZZA 1A4KB 1BJ1J 2F7RA 4QRUA 4TRPH 5MEQB 1QFEA 5E93A 4D3CH 4LU5L 4XXWA 3H2OA 1XMWA 3KP0A 3OTRA 3SUTA 4ZOCA 1FHGA 3LYRA 4PI2A 2FWUA 5D8ZA 3WK1A 3UZQB 2F2HA 4XNAA 1DANU 5MEOB 4HALA 6XIMA 4KTDL 4PJFF 1NJJA 1Z9PA 3BCDA 4OF5A 4LNVA 5AZ2H 3RPIA 1BXCA 3OWRA 5GISL 1SJCA 3LI1A 2ZOLA 1XLMA 3LH2L 4GHRA 5C86A 4NZ4A 1AIFB 3PWGA 1L7IH 5AVQB 3NQMA 2AGTA 5LGXA 1OF2B 1T5XB 4KNSA 2VXQL 3VIMA 1DDTA 4OCLC 4WUUB 2X1XR 3ZTCC 2ISFA 3WK0A 3VIIA 2OMYB 5CN1A 1DVXA 2MANA 3O8AA 3IJHA 3MHGA 3VXNB 4QXWA 1ZSDA 2Y1AA 3VZYA 2MNUA 1KJ3L 5HANA 3MV7E 4UTFA 2AVGA 1X5JA 2ZTBA 3W9DB 4UFHA 4G9FD 1SYSA 1RP9A 5FM4A 3H2FA 1L6GA 3AHYA 2PF6A 3CH1A 4XMKL 3W83A 4GKSB 1H7PA 2BSSA 4J6RL 3DH7A 3QZ6A 2XISA 4HJ0C 1PLGH 4JL1A 4QOKA 3V4VB 4FYRA 2MCPL 1GZPB 1I1AC 4OFDA 3RGVC 1SO3A 2QKIA 4TPRH 1A1OB 4IRSB 5DRXA 5CBAB 1XKJA 2LU7A 3CDFA 4PJGB 1NOUA 3QR0A 1G7QB 3B2PA 1ZLVK 1T5KA 5I19L 2G37A 1DQIA 4L4TA 2E6JA 4GKNB 2K3TA 4UBDD 2F8XC 2HBXA 1FCUA 1TVBB 4WCJA 5BXFA 3VOFA 3FOLA 3NJKA 1BRLB 1RUML 1XRVA 4FXRA 4E4UA 1ITCA 1KLZA 3V5KB 1FHDA 3ZTNL 1QNOA 2F7FA 2ISDA 4Y90A 1FLTX 3E0IA 3RUGF 3RZCD 3FDGA 4TU1A 5D4YA 3K6FA 3S6CA 1J12A 4A2GA 3WLJA 4YAQA 4DLMA 2YAMA 4MYPA 3N55A 3GBNL 3BGAA 3QHZL 4KDWA 1QSFE 3MZNA 1DZBA 4ABUA 1CI3M 1K5NA 4NB7A 4M5TA 2PYFA 3NGBC 1DQUA 4HD5A 1T66D 2UZPA 4JFFD 3WG7B 4GKNA 1O75A 3LQMA 2PP9A 1K70A 3KPRB 3I84A 1NZRA 5MERA 4RGNE 1IT0A 4H0LC 3O4OB 4GO6B 5AKVA 3UO1H 1YJDL 4JPQA 2Y5TB 3EGJA 3GU1A 4YR6A 1OE1A 2YXFA 1T96A 1H6TA 4R2GD 3EJSA 3QH3A 2Y7NA 3BLPX 4X6DE 4UT9A 2XTLA 2XWZA 1RLDA 3B8IA 4IG2B 1A0CA 1HHIA 4N90D 3LRSB 2CLFA 12E8H 4KHTH 1V5XA 3DEQA 3N18A 4EXAA 1GGIH 2OJ1A 1AS8A 5AW7B 4ZFZB 4EI5B 3MRQB 3GDRA 4XVSH 3TO2A 3RHWK 5JHLL 1RXOB 4NG3A 1RPUA 2IQTA 1FFOA 1GKOA 3SQOH 3A4XA 4ZMPA 3UPMA 1WFUA 1Q0XH 4NAJA 5FA4A 4PLNC 4H25A 1QRQA 5B1BB 4NZRL 2TPSA 3MP3A 2DMGA 4QLRA 3QJAA 3DCPA 4HGWB 1UWIA 1O66A 3GKZA 4MXQC 1KGWA 4MS8D 2VQ1A 2X7LA 5E5RB 3BJSA 5F9JA 1KN4H 2C8NA 4FIRA 3DFHA 4AD4A 4U05A 4HGMA 3U6XS 3BW9A 1T22B 3K8LA 3WDHA 2PDQA 2JFEX 1GEQA 3ZUNC 4EN3B 4JRYE 1K9DA 3IRSA 2QZQA 1CI5A 5JHDB 3CUGA 1TTBA 1TQUA 3C75A 3DETD 4FNQA 1U58A 3EDFA 3VXPB 4A6YL 2Z00A 3KNBB 1CDHA 1P1ZB 2IH3A 2YQBA 1RULH 3G3LA 3PU7A 1LLOA 3HAEB 2JXMA 1EWHA 3MA7A 1POJA 2VGBA 1BBDH 3OM3B 3M86A 2VQ1B 2WN2A 2X7LB 3QGVA 2Z7UA 3S88H 1UTDA 2ED8A 3Q9PA 1VJZA 3RLUA 3G5YB 2XINA 3TCLB 4PMQA 3L9RA 4AK2A 3MNZA 1OCWL 4G80B 5EC2B 4D2NA 1NMAL 2WXLA 1QPNA 3AIVA 2R56L 3PY2A 1HIZA 3OZOA 2XICA 4WNSA 1WQ5A 4JDBA 5L4JA 4R7JA 5EL1A 1R5IB 5ERWB 4KV5E 1GC1H 4ZK8A 2Y23A 1PG7L 2RA1A 1FWHC 2J72A 5LAXB 1QWGA 2RGLA 1ZBCA 3QHNA 3T3MB 1D5XB 5ANME 3R8HA 5A8QA 5LNEA 2OMWB 1G1CA 3MBEA 1YDOA 4P04A 3N9SA 3VC6A 3SBWC 2J24A 2E9MA 1D5IL 4QG8A 2Z29A 3WDJA 3OKOA 4QY8B 1FAKT 2YD5A 3UWZA 4BK9A 3Q3GB 4WI4A 2G9HA 1C08B 1BVZA 1FV1B 1G0YR 5KITA 2E7DA 3ZQ9A 3P3SA 3S34H 1RZIA 4AQEB 2O5XH 3VYNA 5L2JB 2VW6A 1E4WH 3P40A 3N9GH 3AHTA 1VIWA 4RBPK 3T77B 4E2VA 4L8DA 1JPGA 1JZ6A 3TX4A 2EECA 2P1FA 6CGTA 1UQSB 2GAZA 3CDYA 3CTTA 5B1JC 4HFUH 3UAJA 3GHUA 3NG3A 4RKAA 5AYYA 3WJYA 4ODWA 3BKJL 3N42B 3NZHL 3H4HA 3OKOB 4QY8A 5DRWA 4BXSV 2R4SH 3FN0L 4BEQA 5I75C 3C2RA 1KXQE 3THAA 3JVAA 3M0ZA 1ZLVH 4L6DA 4R4FL 2GFBA 4M29A 4YK4C 3GU9A 3KW3A 2YLKA 1SJHB 4WKZA 4H8VA 5FECB 3CFUA 4ENLA 4GXWA 2OQJB 3HG2A 2Y06H 2YXGA 3IDJB 3TASA 4PFMA 5EGRA 3MX0B 4N9GB 1Z2KA 3B3BA 3KLAB 4FG6C 3WHXA 4PBVC 5J9PB 1EX1A 1TG8A 3QJOA 3U6WA 1YNKH 2Z0UA 1ONQB 4GAYB 2XIIA 3VGHA 1SY6A 1NDVA 1G4EA 1OC6A 3ZHKA 3LH8A 3CEPA 4O15A 6A3HA 4DJFD 3GSNL 3OTTA 3IGXA 3SGDH 4DUOA 2ZFAA 1JAEA 1LO4L 2J4WH 4FXTA 4I18B 4Z95L 4APQC 2FZMA 4O1AA 1LO3H 1TLMA 1QFOA 2DZPA 5JW4N 5DT1H 3VAEA 4IW4C 1TITA 3ZR4A 4G11A 1T0PB 3L7FB 1XL4A 3IRCA 3PL6A 4NJ9L 2CDGB 4L7ZA 4FXFA 3NFSL 3DOSA 4OF3A 2G3MA 3RZCC 5BJTA 3WJLC 1OT1A 4U7MA 1JDCA 4UFJA 5E8NB 5AZEL 1IE7C 1U8HA 2PPFA 5AKSA 4CKQA 5T3XH 1Q72H 3RHGA 2OZ4H 3ELQA 5D2LB 1UD2A 5F9AC 2WHMA 4QHNB 4UILH 1DN0B 3H2EA 1RSFA 3UXIA 1QDSA 4Y2DB 4XMWA 2YYTA 3IU3A 1Z5YD 3EOYG 2GEEA 3ARTA 1HUVA 2J1XA 1S9WB 5F7BA 3W5MA 2DT3A 4JO1H 1WCBA 5EORH 3F5JA 4J28A 5I78A 3A6CL 4N5UA 5F3BA 4JX4A 2D7OA 3O05A 4OR1A 1XF4A 3POCA 2AMUA 3KYNB 2ZP8A 3QOKA 4TX9A 3OGCB 1OF8A 1OO2A 1UW9A 3SJ3A 3M5YA 1UENA 4L8SA 1K7XA 1NGZA 2NUYA 4GBXA 4R85A 4HIEB 1LO5B 2J7DA 3G8RA 2VZ1A 3SPHA 2Q1EA 4AY0A 4G9FB 1IZKA 3TN0B 4DT2A 2H3DA 3ARQA 3IGAB 2IXUA 4H8WC 3MWCA 1CQKA 1T7XA 1YO4A 5DJ8B 1KN4L 2PE4A 5DFVC 1E73M 4BH8A 3E5BA 1GW9A 4BFNA 3B0PA 3FB7B 1EFQA 1FL3A 2RQ8A 1MFMA 2WM0A 4FABH 2GSMB 1Y1UA 3H8NA 3I6KA 4L3EB 4A2LA 1MDRA 1K8YA 3GG7A 4EIGB 1LZOA 3NCYS 4ZNEA 3ZTJG 1YVLA 3TO4A 4S1RL 3HC4H 2VR3A 2PGRA 2HRPH 4IM4A 3WIFA 1IBGH 3NTCH 1L8PA 1ICTA 1W54A 1MCRA 3NZ1A 3RLGA 1FE8H 1ZPUA 4X5PA 2QLVB 3L5WA 5E9AA 1CT8B 1BBDL 4QSHA 3AT8A 3IJSB 4QHRA 4BKNA 5DJ8A 1UPPA 1HXMB 5BVJA 2CKBA 5DZLA 3OKLB 2GTQA 4NFCA 1R9YA 5I26A 1FH5H 4DPAX 4ES4A 2Z7WA 1NEZA 3RO6A 5CBBA 4O5LL 3QJFA 5D9SA 4E2BA 3ZHFA 4NO5A 4RFNC 1NCBH 1TNMA 3O07A 1E5UI 4P2OC 1YQVH 3PFQA 4RH4A 1VYRA 1E4JA 1PEZA 5BO1L 1OARH 4LCYA 2IFFL 1JULA 1K4CB 2C3GA 3AREC 1V7YA 2D20A 5D2WA 4QUOA 5IP4A 1M68A 4N25A 4OKVB 3RE0A 4HN8A 1AG6A 5DDHB 3QNFA 3SCMB 1VLIA 4BHYA 1IXOA 3VXUD 1XO8A 4HUUA 3EDDA 3QHZH 4F15C 1NDGB 1ONWA 1MJ7L 1LDPH 2VZSA 1V54B 3GD1C 3LKPA 4XN7A 1YTEA 1E6SM 5CN2A 3WL9B 2AKMA 3E8UH 1LP6A 1FA2A 4XXDA 4J3BA 1QI3A 3V0GA 1YEFL 2NNRA 2EAWA 3PR2A 4MB3A 1TYGA 3KYMA 2YD4A 1TFVA 1WDRA 5DJ0B 3GLEA 4UIKL 2OCJA 3NZHH 1FRGL 4WQOA 4FX5A 4GUQA 1LUCA 1Q85A 2IQDA 3BWAB 2PDHA 1E2ZA 2VCCA 1AQ0A 2FBJL 3BLFA 1E4KA 2DRUA 1KB5B 2X9YA 2WNWA 1AZBA 4HP5A 1GORA 4JM0A 5FF0A 4NOBA 1YN6B 1OF0A 4PMJA 3QPYA 1B4LA 4F7MB 4S3GA 1W91A 4HYWA 1XR8A 3VXRB 4C47A 1A5NC 4IL0A 3T07A 2YGQA 2Z65C 5FJIA 2E75C 3U7WL 1KXHA 3MRRB 4F15B 3WJMB 4RGNB 4OSUL 2ORBL 3S4SA 4W8LA 2ZCHH 4TVUA 2QJMA 4WFHE 3ZKSD 5IEHB 2CO6A 4HW6A 1FWAC 2R51A 3MZGB 5KW9H 2ODIA 3HB3C 1M42A 1BZDA 2BC4A 3N1MC 2HMCA 2K4AA 3WD4A 1XIWB 4JPSA 4YMZA 1ICSA 4NN6B 3TIEB 4DOHB 5DD3H 3LZ5A 2N59A 2V7HB 3DZ1A 2BDNL 4MF4A 2Z64C 3WJJC 1V7NL 2RBLA 3NCEB 3CX5K 3PHQA 4AM0B 5KVDH 4BWLC 4IMEA 4CD5A 1KC5H 3GMQA 1TETH 3IXTA 3TH4T 4IJ3B 3O3UN 4PJEF 3DXIA 2SFPA 3BPOC 3OJ2C 5ISZA 1BYPA 1S46A 4LDEB 4WW2A 3TA3D 3UTPE 4JFXB 3QR3A 2AW2A 3Q6FA 5FS5A 1YEJL 4JG1H 2EO9A 2WKGA 1ICPA 2DP3A 1UIPA 4H20H 4K7PY 5JUVA 3TAOA 2Q7AA 1KNOB 2P1YA 2NXHA 4AXWB 5FF6A 1ETB1 2JB5H 3EZJB 1THFD 3ETBF 5CZVH 4JREB 5D7JB 4O02A 3M7OA 4BFIA 3BPCA 1JFXA 4IGNA 3TVAA 4HKBB 3QXAA 4GAJH 1FY6A 1EXUA 3G2GA 3LY6A 4F0SA 4AX7A 1F73A 2NCMA 3VWKA 4XIAA 5ISZB 4PWJA 1TKWA 5C6TL 3EWBX 2DZVA 5FSDC 3L4CA 4EIZC 4RZ4A 1TX0A 3NPUA 4YBLC 2LLNA 4LVNB 1OM3L 5JW3L 2Y89A 1OK0A 4JY6B 3BEWA 3ULUD 5BRQA 3SDAD 1Z6KA 3VNDA 4KEUA 3AQDA 4PJAE 4QTIH 4GG8A 5E6YA 1OZQA 5HPMB 3H2AA 3IRDA 4XG1A 1OT4A 2YPKB 3QDMA 3BEVA 4JVWA 4NQEE 4XVDA 5DR5H 2CLZA 3GRWH 3QFJD 2F53A 4XOEA 3TSMA 5EMLA 1GVQA 1WHPA 2DKMA 3G5EA 4F66A 3U46A 1I7ZA 3PK7A 3LKRA 4W4OA 3HA1A 2AJYL 1FNGB 3DIPA 3P73A 3SCWA 4P8QA 1C1EH 1CBVL 2WCAA 3VVGA 1JCNA 3FQUB 4IPPA 3AQZA 3H24A 4WNQA 3FT2A 1FCCA 3X3FH 1OE2A 4NQ1A 2IPGA 1S7WA 4I2XA 4JFUA 4R4FH 5DJCA 4XNDA 5CN3A 4LASH 1UMLA 4YDMA 4DAGL 1OG0A 3GK0A 4MYXA 4P7LA 1GZ1A 3WY1A 4AVHA 4XAFA 3P61A 3CXOA 2O92A 2XVKA 2J7FA 1PKOA 1F56A 1UXSB 2V3EA 2XX1A 1YUHA 3D39E 3NAAH 3WY3A 4NJKA 2JQZA 4MA1B 3U5UA 5F9DC 2OXGA 4GMTL 4A8LA 1LYXA 5C9ZA 1XGZA 4FNLL 3SQBA 3ARZA 3P2BA 2N7AA 3WLBA 4F3FA 3MUXA 1ZSDB 3FQXA 1W0WB 1RUAL 4NCC2 4ZTOL 1K85A 4HCRL 3SBQA 3L5LA 1GJUA 3P3UA 3MUUA 5D71H 1HGYA 1M41A 2V5BA 4KQNA 4CD6A 2IFFH 1RUQH 1V3JA 4Y5VA 1HEHC 2L7QA 1ECYA 1MHCA 5A2CA 2AJ3A 1DVUA 3E2HB 3LZOA 4ORMA 3VIGA 3VKAA 2XTJB 5FFGA 5JIKA 3NH7L 3NOIA 4XP4H 4FQQB 2DUZA 2G3IA 4LW7A 4O50A 3F5WA 1YRKA 5DYFA 1LWRA 5EPDA 3IWUA 3I74A 2GQ9A 3E5PA 4XKMA 1QSVA 1AC0A 5CWSA 4JBSA 4TQ8A 2WO4A 2IANE 5KJRH 4DO5A 1CGTA 2E1WA 3V0SA 3MNWB 2ZONA 3PLYA 4YHLL 4MJJA 1QO3B 2WINB 4PS4L 3MUIA 4NUWA 4P4RB 1J0IA 3SJVE 3WTTA 4HQQL 1NCWL 2CJUH 4I0PB 2IAMA 1E0VA 5I1DB 3VKKA 2WCGA 1SDYA 4C56B 2J7CA 3I02B 4HPXA 2W5PA 3UR7A 2ZUQC 1CECA 1IIIA 2OYMA 4Y4FD 2BSTA 4PJ7B 4Z0XA 4WENB 1N3NB 1R3LB 3SKOB 2DL9A 1A7RL 1QBBA 2WWCA 1E9YB 2DJSA 1TJ1A 2IF7A 2ZVRA 4WR3A 1FWJC 2HJLB 3LD5A 5C54A 3DX0A 2G3NA 3WEAA 1C12A 2XQ0A 4HJJH 1KXTB 4QXGH 5TE6L 4JHZA 4L4VA 3MV8A 4FS9A 1Q8MA 1IGCL 5IB2B 2XFGB 4P4RA 1AO7B 1WKFA 1TQCB 2XACC 1AGEB 4UT6H 5DFAA 1FCGA 4PJGF 4L18A 2Z1SA 4H9UA 4XMUA 5CC5A 5I07A 4C56A 2E9IA 4FFYL 4K3EH 5D7IE 4CU6A 3QB7C 1ZTXL 4V33A 3KCPB 4IX0A 1U95B 2VO5A 1WDSA 4TSBH 2I27N 4GUPB 3RWJB 1TJHH 1QR1A 3EEGA 4YVPA 4Y5VC 3C5QA 1IVLA 1G6RH 3SN1A 3LRSA 4MRBA 5C07D 1QNSA 3KS6A 2BDNH 3E1F1 4L4VB 3T1GA 3L2MA 3KR3H 4UIMB 1ROCA 5CHNA 1RJZB 4PLOB 3SGJA 1FHVA 3GB6A 1HDMA 2BOCA 2PBOA 1AKJA 4RRPA 3VNYA 1K2DA 4GMSL 1BV8A 4UT7H 3X14B 3S9ZA 2WBJA 4JKWA 3TPUB 3RBGA 3ULVC 1P4LA 1UC4A 2WGXA 3WF1A 3RWDA 5AB3A 2NRDA 4TQEL 6ENLA 5JYMA 4G9DB 5SX5H 1OIOA 2UX7A 4DESA 5KS9E 4UAHA 2V9QA 3BANA 1I45A 4EDWL 1H6FA 1NQBA 4GIAA 4YEEA 4A6YB 5HHQB 1UZ1A 3LERA 3O3RA 3PJWA 2OFQA 3HIJA 1QABA 2XWBA 3BKML 3RIAK 4YSEA 4F7TB 1UWXH 3UXFA 3W7KA 1KTKE 2BDQA 2OKTA 5E1AA 3MGAA 2C9XA 2P5EB 4FXGB 5D93B 2XBDA 3VTAA 3ZN6A 1E9IA 1F05A 1IWAA 1X98A 1NBZB 4WEBH 2F61A 3FH8A 2X4RB 3RWDB 4PBDA 2JXMB 3WBDA 5HVWA 1VCFA 1ZK5A 3G1XA 1U93B 4ZMYA 2O5YL 1QBML 2VURA 3K1GA 1EAQA 5D2NB 1CB2A 3QMSA 1GVIA 4YDJB 2FEDC 4ACPA 1IRAY 3MRNB 5I0YA 2HE8A 4QISA 1S3TC 5I0WA 2OS7A 1M71B 3S3PA 2H32H 3W01A 1P9MC 4HUKB 2X1PA 4NKCA 2G3XA 3APNA 4UV7L 4P23B 5CIPA 4BH7A 1CO1A 2AQNA 4LF1A 1LP9A 4Q33A 4Q8TA 4JTUA 4FMKA 2NY2C 2AZUA 4Q74A 1LLAA 4DIAA 1ZA6B 2ZAHA 4YPJA 3HB3B 5LHFA 5HHMB 4QDWA 2VDML 3BXWA 4E8DA 1HH9B 3E49A 1U8PA 3HFMH 4KWSA 4NILA 1JVNA 1VCAA 3TJHC 3O6KL 2H8XA 4FF9A 4WI2A 1KRCC 1UCBH 2WHVA 1E6JL 3RVXD 2ADIB 1CENA 4G1NA 3UG5A 1QJWA 1VQTA 4YBLB 1AMYA 2Z2UA 2FWSA 2R0KL 3WIIH 4WD0A 3CHEA 3QY6A 5HHXH 2DQJL 3QUYD 3UMTA 1MCEA 4QXIA 3QO0A 3NQGA 3QQDB 2GG1A 4O2EB 3WUWB 2GVGA 2DQHL 2IXQB 1OCJA 4Q7DA 2WWKO 1ZJAA 2NZ9D 1ZHBB 3AY4A 2ZUYA 3O3BB 4QRRA 2F8IA 5DHVB 4LLMA 2WTOA 1H3PH 4OQTH 4NJHA 4RE2A 4HS8L 1B0GB 3MCYA 1YYAA 1QKZH 2J62A 2RH9A 3LNDA 5EEUA 3D52A 3ROLB 2E3ZA 4RESB 1U1JA 4Y88A 3FGCA 3BZJA 4Z8FL 3QUMA 3JWNC 5DD5L 4EWND 3PTQA 1TWIA 3LN9A 1W9BM 1CN4A 4BSVA 5E5UB 5IFJB 3BSHA 1SEQL 5A2KH 3C3NA 4P4KC 3I6RA 2GUOB 3WK2A 1C92A 3MLSL 1A7PL 3NSXA 2J88H 1IAKB 2OMNA 4RMRA 4X6EA 1X9UA 1EEUA 4F8TA 4HGKC 1C8PA 1DJQA 2HPIA 1VGEL 1WS8A 4UTLA 3TX9A 3FKUS 3HS8A 3PVFA 1PE1A 3SDDD 3MOBH 2F15A 1Q8JA 3RTQD 2G50A 4KKLD 3ONBA 1K8DB 1BLNA 2CNZA 3DX4A 1WNOA 2VC5A 2PDNA 3S3DB 1HX0A 3ILQC 1P0KA 1G7JA 1WWBX 3NJLA 4YNYB 3WFDL 2ZWSA 3C2FA 4MKVA 1JPFA 2C3XA 4MSWB 2BP0A 2J8UA 4MCYA 5GGVH 1AI1H 3U4EB 3H55A 4W9JC 1AMKA 3S83A 1VEOA 4QCFA 4FQXA 4MFHA 5C6TH 5CKAA 3DI1A 3HOJA 3F05A 3D06A 5E5LA 3ILPA 5B7ZA 5FIPA 4DZIA 3NEVA 2X2HA 4QXGL 1HP4A 1GYWA 5FHAL 1D5IH 3UJJL 4UDTA 4K8RH 5LWYH 5I03A 4MMXC 3UJIH 3CAQA 4YXLL 4RGND 3JWDH 3OF6A 1MQQA 3CHDA 5G2NA 3Q13A 1EJUC 1O5KA 5FO7B 4HUVA 4LV9A 5I3DA 2I5YL 4X63A 2VX4A 4YNYA 3ECBB 4YIQA 1CD9B 3ONCA 3L54A 3IU3B 4U1LB 1S3RA 4UMSA 3VRLF 4ZCWA 4PJ5B 2FQIA 2YS4A 4EOWH 4Z18A 1QQDA 1QI4A 4DK6A 2ZUWA 2NXYB 1G0DA 4N6QA 5LAXA 4R96A 3KCOA 4OJDH 1CFTB 3N11A 4K36A 1G6RL 1P7KA 1UJQA 3LG3A 4HFUL 1FPTL 1VPXA 3NXFA 1T0MA 4OZ4B 2ARJA 3DRTB 2GDUA 4OFIA 5CPNA 1RIVL 4HCHA 1I3RB 4MD4B 4EZLA 1KFAH 3F4VA 4U6YB 4U1SB 1TFPA 2Q3OA 4AJ0A 1XX1A 4YGVA 3PZQA 4WRHA 12E8L 4KHTL 1I2QA 2KZ1B 5EF1A 4UOZA 5LUMA 5L2JA 2RUSA 3GD6A 1WDAA 2NY4C 3JTSB 1OYBA 1KGCE 2GJXA 1SDDB 1I1FA 4QKXB 4X4XA 5EBGA 1ZGLP 4XPHH 4UMCA 2VISB 4O9HL 1E6XM 5BS0D 4MPQA 2APVA 4HH9B 2YMOA 3MYZA 1V51A 3VA6A 2KUTA 3MLUH 2R15A 4F1ZA 4F2EA 1W9VA 3WMCA 1YRRA 3PWVA 5DEFB 3GR8A 3UBXA 2W4XA 4TUKH 1JZDC 4Z78B 3NSMA 3NCXA 2PNDA 1ZP3A 2BVPA 3HZVB 4GFIA 1PHWA 2W5FA 4PB3A 2CZVA 3GYRA 1FCBA 2YSSB 4L6OA 5EDXA 2DSVA 3O6MH 4CNPA 3ZKQD 1RV6X 2MKLC 4JM2A 5HGHA 4UQ3A 1XLDA 3C2AH 1XSIA 3SJVD 4X7TA 3WUZA 4O11A 3ZQWA 3OIHA 3SUVA 1L6PA 4N9GA 3TCEA 4K7FB 1ZTMA 4HIBA 3STGA 1SJEB 5JIMA 2QF7A 2CKBB 4XI5C 2YDAA 1ZPLA 1GYCA 3QEHB 5CILH 4FQIL 2J5LC 4G8EA 1E71M 4AL8L 3HAEG 5DRZA 4NAFB 3A13A 5T1KB 2XPYA 4CVWA 3URBA 3OKDB 1MVYA 2G75A 3ES6A 1U1HA 3RNDA 3D46A 4D8OA 3AU6A 4RMSA 3WELA 4C7GA 1Z9SA 2CNYA 5EBAA 3T2PA 4Z7OF 3G1SA 3GBML 4L8BB 1XH3B 2XXMB 4X7TB 5IFHL 2EXSA 6TAAA 2NQ5A 4XP5H 3K72B 1A3LL 5IGXL 3GE7A 3QNXB 4XD6A 1K72A 1E28A 2UZXB 3KDMB 2FJSA 1FG9C 2DMCA 4AJVA 4AQ1A 1XRTA 1ECEA 1TR7A 1E8YA 3MV9B 5D55A 5AQ0A 3K7UA 1S7QB 3QRBA 4REQA 2W88A 2BVOA 3PCYA 4OZIF 5FFLA 2BNQD 1CX9A 1HKVA 5IOPB 1CD1A 1NDZA 2G95A 3PZGA 3PM6A 4QEEA 3AQYA 3BGMA 3LZPA 3WHE1 1RPXA 4L4PA 1CBJA 1NWOA 2D8KA 2FB4L 1IBDA 4ONFL 2WOQA 3IIVA 3EOBA 3RAJL 3DROB 5A6SA 5E5MA 1RBOB 3BWWA 3SCSA 3QSTA 4LHQB 3DSFL 1I82A 1EBPA 5CP7A 4YFLI 3SRDA 1MXDA 4YWGL 3U7YH 3VOGA 1PLAA 4JN1H 5GPRA 3EFDL 3MV9A 5H4ZA 2ANUA 3OGVA 4Q7NA 1LNUA 2J5WA 4AF0B 4M1DL 5KBDA 4A05A 4AOFA 2N1TE 3KDPB 5A6LA 4QRPD 5IMOA 3NK3A 3IJ9A 4N6RB 2Y88A 4AUBA 3A21A 4YWSA 1RUPL 2B0SL 3Q5TA 4KVCL 1OINA 1TTQA 4Q0XH 4XTDA 1JUEA 3HN5A 5BPPA 2HN7A 2YUXA 3KWXA 3WKML 4BH8B 3BE1L 4JPIB 2UV8G 5DO8A 4X80L 5DMGD 5XIMA 3OG4B 5AWNL 3GIPA 3LTYA 4K0OA 3P9W