2C8NA

The structure of a family 51 arabinofuranosidase, araf51, from clostridium thermocellum in complex with 1,3-linked arabinoside of xylobiose.
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
501
structure length
501
Chain Sequence
KKARMTVDKDYKIAEIDKRIYGSFVEHLGRAVYDGLYQPGNSKSDEDGFRKDVIELVKELNVPIIRYPGGNFVSNYFWEDGVGPVEDRPRRLDLAWKSIEPNQVGINEFAKWCKKVNAEIMMAVNLGTRGISDACNLLEYCNHPGGSKYSDMRIKHGVKEPHNIKVWCLGNAMDGPWQVGHKTMDEYGRIAEETARAMKMIDPSIELVACGSSSKDMPTFPQWEATVLDYAYDYVDYISLHQYYGNKENDTADFLAKSDDLDDFIRSVIATCDYIKAKKRSKKDIYLSFDEWNVWYHSNNEDANIMQNEPWRIAPPLLEDIYTFEDALLVGLMLITLMKHADRIKIACLAQLINVIAPIVTERNGGAAWRQTIFYPFMHASKYGRGIVLQPVINSPLHDTSKHEDVTDIESVAIYNEEKEEVTIFAVNRNIHEDIVLVSDVRGMKDYRLLEHIVLEHQDLKIRNSVNGEEVYPKNSDKSSFDDGILTSMLRRASWNVIRIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-L-ARABINOFURANOSIDASE
publication title Structural Insight Into the Ligand Specificity of a Thermostable Family 51 Arabinofuranosidase, Araf51, from Clostridium Thermocellum.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
total genus 171
structure length 501
sequence length 501
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06964 Alpha-L-AF_C Alpha-L-arabinofuranosidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2c8nA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2c8nA02
2OWCA 1UHVA 4W84A 2X2JA 3VIPA 4HZ7A 4LXFA 3WEZA 3WUEA 1EO7A 3POHA 3KWXA 3POCA 3WNLA 2PWGA 2O9PA 2E8YA 2WKGA 3O6AA 4UOQA 2DEPA 3OB8A 3U7BA 2JFEX 1XD0A 4PMDA 3U5UA 1B30A 1WP6A 1WZLA 2WWCA 4PMNA 5A6SA 5ABHA 1GHSA 1MQPA 2OWWA 2VCAA 5C71A 3GNRA 1KTCA 4UFHA 2F7PA 2XVNA 1E4MM 3UERA 3ZO9A 2DT1A 4MAZA 1GORA 3ARTA 5A6MA 3WH7A 1MYRA 3EJSA 2FHCA 3CV5A 2ZUWA 5A2BA 3IJ8A 4AIOA 3AIQA 3ZSTA 1JF5A 3U7VA 2CKSA 1E3ZA 1K9EA 2XUCA 5IHRA 2FHBA 5E6ZA 4NZCA 2WYSA 1VRXA 1WDPA 4PSPA 4GPNA 4YN5A 2EABA 3GH4A 2DH3A 3BLPX 1GQJA 1XSIA 4F8XA 3D51A 3AHXA 1VEPA 2O9TA 2YJQA 5I5RA 1AQ0A 3WUGA 1WDRA 2C8NA 1BLIA 3GYCA 1MXDA 2J78A 1PPIA 3AS1A 4AEFA 4CKQA 1K6AA 3KE0A 1HJUA 4DWSC 3W6LA 3WQ8A 1JFXA 3OBAA 3VPLA 1C93A 1R34A 5D8ZA 3L2MA 1HKIA 1BFNA 1E5JA 4KGLA 4ZXLA 1GHRA 3WH5A 3ZQ9A 2D20A 2W66A 3MO4A 2ZOXA 1KXVA 3BMVA 1ESWA 4M8UA 3D52A 1RH9A 2JF7A 4P7LA 1PX8A 1MW0A 1UYQA 2AMGA 3W6MA 4FLRA 1HJWA 1DEDA 1U33A 1QVBA 2DT3A 3RM4A 2UWFA 4W8LA 3T2PA 4HA1A 3CHDA 1HWWA 3VIOA 9CGTA 4P8WA 3GXDA 3AYSA 4MNKA 1H5VA 3L4YA 2VJXA 1KXHA 2WVVA 1UKTA 2CCRA 4IISA 2J7EA 2ESCA 4AD2A 3RCNA 2EPMX 3HG5A 3F4VA 3WMCA 3OZPA 3ZJ7A 1QW8A 4HZ6A 1CGTA 1J0IA 3WDPP 4LPCA 1CDGA 1XH0A 2FGLA 1L0PA 3ARSA 2XGIA 4CD4A 3AHYA 4OKDA 3OGRA 1ZBCA 4K68A 4MB5A 2J62A 1Y7VA 3AHVA 1QX1A 3ZR6A 2FH6A 1BYBA 1UA3A 3VM7A 2CBJA 3W26A 1MWOA 3MV01 3WY2A 1YHTA 4YPJA 2E9BA 1GQLA 1LL6A 3I3BA 4W7UA 3W0KA 3N18A 4J7RA 4MPKA 3SUVA 2HVMA 3WNMA 2VRQA 4J3VA 4HU8A 3DHUA 5JBDA 2A3AA 3L4VA 1CGVA 2F18A 2RGMA 3SUWA 1UD3A 1K9DA 2X2IA 2ZX9A 1CZ1A 1GOWA 3CZLA 2IXUA 2XVLA 1EHAA 2JEQA 2WHMA 1M03A 1W2PA 1Q6CA 1GOKA 4ACZA 1JZ8A 5A8PA 4PTXA 3BSHA 2VZUA 1UG6A 4CCDA 3ZJ8A 2ZE0A 4CD5A 4HOXA 2BXYA 1WDSA 1VENA 2YBUA 4OUEA 4D6EA 1B2YA 4M81A 4MB4A 2WCAA 1VBUA 2W4XA 3LRKA 5HBFA 1J0YA 4W5ZA 3OGVA 3W82A 1CPUA 5I79A 4L4PA 1CGWA 4AZBA 3K46A 2G3NA 2D3LA 2G4FA 1OD0A 2GJXA 2FGZA 2BV9A 1H11A 4ML4A 1KCLA 4R27A 1QNSA 5FOOA 1E6SM 4GXPA 2F7OA 3AXIA 2BS9A 2WMFA 4ACYA 3LPGA 1M01A 3H54A 1KR1A 3RMEA 3VGBA 3OLIA 1TA3B 1XHGA 4CD6A 3W29A 1JYVA 1F4HA 3T0AA 2GDVA 2VRKA 3K4DA 3VMPA 4CN6A 4W89A 3RM9A 3VD3A 3A4XA 4PCTA 2NT1A 4PUDA 1W9PA 2D0HA 1E1EA 2DSKA 1GOMA 1KQYA 5E1QA 3VIFA 2IGTA 3A22A 1GPFA 1W2VA 4EANA 4JCLA 3DYOA 3VGFA 4LX4A 1DHKA 3UETA 4WSJA 4P8UA 3A4WA 4P7OA 3AIUA 3AS3A 2OYKA 3L2LA 5CG0A 4D1IA 1UQYA 2J7FA 2WSPA 3BAJA 2OSXA 3T2QA 4N42A 1SMAA 1CWYA 3WMBA 3WENA 4MNLA 5A2CA 1EHNA 2FHFA 3UEQA 3RIKA 1C91A 1UWRA 1UWQA 4IM4A 3M7SA 1EH9A 4CUCA 1BYAA 5M3WA 1HVQA 1UH2A 3MS8A 2VQTA 2J7HA 1E6RA 3VSVA 3GXTA 3VGEA 4PTVA 3NSXA 3FNDA 1W9UA 3PN8A 3WDJA 3FAXA 3WQVA 1XD1A 2DT2A 3ZT6A 3UCQA 1W3KA 2XG9A 2CXGA 2CBUA 2C0HA 5FIPA 3PZUA 2X8RA 5JIWA 1CXKA 2VUYA 3KLLA 1JGIA 3LMYA 3NSMA 4RE3A 3SURA 4JZ5A 2PF0A 3THCA 3WEMA 3D4ZA 2X2YA 3MUIA 3EJUA 1B31A 3PZGA 3WIJA 1HTYA 1OD8A 1H0IA 1GW1A 4RL3A 1B3YA 3WH8A 3SCNA 1C8XA 1UD2A 1HP4A 5LA2A 1R85A 3T0DA 1EGZA 3AROA 1VFUA 4QFUA 3CZNA 2V3FA 5A6LA 1WO2A 2XYLA 4RE2A 1VFOA 3ZSSA 1HKMA 2OYLA 2JIEA 1JZ4A 3TTSA 1HIZA 4E8DA 2V3EA 2WCGA 1VEOA 5A95A 4X9YA 2E3ZA 4W88A 4DWSD 1OIMA 1IZKA 3MUAA 5CQ1A 4M56A 1R7AA 3WD1A 3NYDA 1FHDA 2E4TA 2ZWYA 1EOMA 2CPUA 3EDDA 3WF0A 5KZ6A 1ODZA 2EPNA 1MQQA 1FH8A 3PHAA 2XWEA 1OGSA 1CENA 3CO4A 4P7NA 3BC9A 3UR7A 3ZMRA 4MTVA 1C90A 1ISVA 1QNPA 4UOZA 3VMNA 2YFOA 3WF2A 1G94A 2G3MA 1BAGA 1E72M 4UQCA 3LXBA 1KR0A 4DUVA 1V6WA 2UY4A 3ZJ6A 1V02E 1QI0A 1BHGA 4BA0A 2ZUNA 1P6WA 1V3MA 1BVNP 5BXPA 1CBGA 2A3CA 5I0DA 4BQ4A 2VL4A 5CGTA 1E6QM 3UR8A 2XHYA 5ABEA 2BVYA 1OT2A 1CXFA 4V27A 6TAAA 6A3HA 3PZMA 5E9AA 2RGLA 2A3HA 2E40A 5GPRA 2AOSA 3ARPA 1GONA 4JFVA 4WF7A 3UESA 3ZIZA 3TTOA 4PTWA 4GZEA 4Z2JA 2WC7A 4KH2A 1TQWA 1GOQA 4B9ZA 1L8NA 1T0OA 1TVPA 1UD5A 3EDJA 2YLAA 1ZBWA 5AY7A 1HL8A 3LX9A 2WXDM 1TQSA 1JIBA 1IT0A 3BAKA 1E0XA 1E70M 4PYSA 5CLTA 3QOKA 1H4PA 4S3KA 4Z2LA 3ZJKA 2F2HA 1KB3A 3VGGA 3FAWA 4F9DA 3PZIA 3EJTA 4PTMA 2MANA 3GM8A 2D22A 3WH9A 3VIHA 1HP5A 4A3HA 5CPTA 3EJPA 4UFIA 2WMIB 1TZ7A 4PMQA 4DO4A 4OIFA 3A3HA 5A6BA 4MDPA 2W62A 4DO6A 1LL7A 1Q6FA 4PMYA 4PMOA 2WVSA 1G5AA 3W81A 3WD3A 1BPLB 1KWGA 3JUGA 4TUFA 2WB5A 1SYTA 4JFUA 4LYRA 5BXSA 3K4AA 4CN1A 1R86A 4CU7A 2WANA 1UR2A 4UNIA 4D72A 2YBTA 2QMKA 4MNJA 4JFWA 4HPGA 2NT0A 5I24A 5BRPA 4AZHA 2F1BA 3I3DA 2DIEA 4D6FA 1TA3A 3OGSA 5IFTA 2VZVA 4Z2HA 3A23A 4QP0A 3CUFA 3ARZA 4W85A 2UY5A 4WLCA 1I1XA 1DWGM 3PZNA 4WKAA 3PZTA 2VO5A 3BVVA 4JFTA 2Y5EA 1KTBA 1J11A 3BVXA 2ZX8A 5BXRA 3DC0A 1RP8A 2J75A 2WBGA 1ISYA 2YLLA 3WQWA 3RM8A 1E55A 3MMUA 3QR3A 1OB0A 2BHYA 4TOQA 1OINA 5E09A 4F9JA 2GJXB 1CGXA 1LF1A 4RE4A 2PBOA 1H41A 4UFLA 4UQBA 1BG4A 1LJYA 1W3LA 2E8ZA 4XUYA 3HG2A 3BAWA 3VILA 4PMUA 3EMCA 3NJ3A 4AMXA 2YL6A 1PIGA 3F5KA 3GXPA 2WVUA 1FHLA 5A8QA 4DM2A 4AZCB 4BS0A 2BXZA 4IUGA 1W1YA 3W27A 4JFSA 3A47A 1VBRA 4GO9A 4FF5A 4FNPA 1XV8A 5D9OA 1E73M 1E0WA 1W91A 4QLJA 5DO8A 1A3HA 4BF7A 3ZT7A 1J12A 3L4TA 4AD3A 5CSYA 3RPMA 4X0NA 2VT0A 4WSKA 1ISZA 4WJXA 1DP0A 3FN9A 4H8HA 1BF2A 1FP8A 3CUIA 2FYVA 3OLEA 2VVNA 2G8ZA 1ITXA 3NDYA 5M03A 3WQ6A 3QGVA 4M1RA 3TP4A 4BQ5A 5BROA 3A4AA 1JYWA 3VGDA 3VD4A 3ZT5A 4W8BA 1M7XA 3AZTA 3T0BA 3VM5A 1LWJA 5A8NA 3WD4A 5FD0A 2WC3A 5FKYA 4BQ2A 1M53A 4U5KA 2YKKA 2DSWA 2J4GA 5A94A 3DDFA 4CVWA 1V0NA 2VX5A 3M46A 1BYDA 4C7GA 3BLBA 4JHZA 4W87A 3WDRA 1KFWA 4PEEA 3MUZ1 1JG9A 2XIIA 2Y4SA 2QF8A 5EB8A 5GNZA 1HJQA 3B8SA 2Y24A 3VIIA 3EDFA 1E6XM 1E9LA 3QOMA 2YL5A 3PBGA 2E9MA 2O9OA 4TXEA 2CYGA 3IGUA 1AVAA 1UD8A 1CTNA 4D6GA 3D50A 3AHZA 4LYPA 4WK9A 3WL0A 1E6ZA 4UCFA 4AIEA 4PMRA 1BYCA 2VMFA 2ZXDA 3AMCA 3CZJA 2ZUTA 1HX0A 2W5FA 4QCEA 3VIKA 4JKKA 4YHGA 4NI3A 1K9TA 3AMGA 1KXTA 2YDQA 2YOCA 1B9ZA 1GUVA 4YHEA 1JF6A 1R8LA 5KEZA 1JAKA 1CLVA 3WNKA 3THDA 2Y8KA 2FDMA 2VX7A 3WBEA 3LPPA 7TAAA 2JEPA 3CUGA 1V6YA 1PS3A 5LYRA 1E56A 1HJSA 3BAYA 1U30A 3BMWA 4L4OA 1PZ2A 1TG7A 3ZOAA 2C7FA 1C7SA 2J77A 2EXOA 3WELA 3VOCA 2XIBA 4W7WA 3SUSA 3AXHA 4GINA 3LPFA 3CHFA 3SIMA 3W4RA 1K9FA 5DF0A 2X0YA 3WL1A 2PC8A 4OJYA 1OGBA 5HXMA 2E9LA 2WNWA 2WMIA 3HU7A 1HJXA 4Q7NA 3GZAA 2VR5A 2WZEA 3EJQA 3AJ7A 1KGWA 1UH3A 4U33A 2ZXQA 3UG3A 5A6AA 4W7VA 5IFPA 1TQVA 1V3KA 3AQUA 4WKHA 1J0JA 3VD9A 3GH5A 4Z2GA 4B3LA 1BSIA 1E5NA 3VD7A 4MDOA 1XSJA 2WLYA 1CGYA 4PMVA 1J0KA 3DDGA 4MADA 3G6MA 1J0ZA 1W32A 5F7UA 5HNNA 1HN1A 4CGTA 5JBEA 4Z2KA 3ZM8A 1R75A 1J01A 4KGJA 4H04A 3SCSA 4KMQA 1WNOA 4AISA 3SCTA 5C70A 5GNYA 4D6DA 1W1PA 3U57A 1M04A 4LQ1A 2BNJA 1WKYA 5GNXA 1BGGA 2PWEA 5DT5A 5DEZA 1CXLA 4PMZA 1HT6A 1QI5A 4FNTA 2XJ7A 4TX8A 4NX0A 1KQZA 3CZKA 1UWTA 2CKRA 2FE0A 3BSGA 1EIBA 4MJ4A 3MANA 3K8KA 1CYGA 1X1NA 1O6IA 2BY3A 1CXHA 4GKLA 3AZSA 1QNRA 2IUZA 2WZHA 1UKSA 1WE5A 1KBKA 2D3NA 3SUTA 2BY1A 3EMZA 1NM9A 3LRLA 5CPQA 7A3HA 3I3EA 1ECEA 4AZCA 1MFUA 2CIPA 3ARRA 1HL9A 3TV8A 1DWHM 3ARVA 1HXJA 3UG5A 3K1DA 2WPGA 2FH8A 3CHCA 4UFKA 5A8OA 4PUEA 2XFFA 2WLZA 1ZL1A 3SUUA 4D6CA 1KGXA 1Z32X 2OYMA 3OG2A 3U5YA 3IAQA 4F79A 3BVWA 3VIJA 3WY4A 2DDXA 4DO5A 2VCCA 3GNPA 3B9AA 1VEMA 4HA4A 1NWRA 2J7CA 1XRVA 3VVGA 4M82A 1CXIA 1NWSA 4W86A 4W8AA 3VNYA 4CD8A 1MQRA 4UFMA 1XCWA 2G41A 3NDZA 3AIRA 2V3DA 1DWIM 2XM1A 4IPNB 1MXGA 5D9MA 2W67A 5LA1A 1Q6GA 4KRTA 3CGTA 3VX1A 4FLOA 1NWTA 4AD0A 3AIVA 3T08A 2V5CA 1I1WA 4AYGA 1NP0A 3BCFA 1BG9A 1UUQA 1E1FA 5E0FA 1J18A 5CZKA 4EE9A 4HOWA 3WKZA 3K8LA 1V6XA 4DM1A 4H8UA 1GCYA 2J8GA 2ZX5A 3VTRA 3A24A 2J79A 3OLGA 4J3WA 4DWSB 2BVTA 3SCWA 2B31A 3S2CA 1R87A 4N0RA 2EEXA 4ATDA 3BUPA 1FFQA 1JZ2A 3ZR5A 4PCSA 5C8BB 1Q4NX 1JZ3A 4XB3A 1V3IA 5HPCA 3WEOA 3W24A 3RILA 3CZ8A 3NIYA 3N11A 5DMYA 3DX1A 3SEPA 1LLOA 1QHOA 3K8MA 1J9YA 1A47A 3A21A 4ZXOA 3FY1A 2PWHA 3IK2A 4U5IA 4D1JA 1YQ2A 2X0HA 1J0HA 1J10A 2QMJA 3LXAA 3WDHA 4XV0A 1KGUA 1PAMA 4AZ5A 3BXWA 1KBBA 1V0KA 4GI9A 4NZJA 1EXPA 1R7OA 4P7QA 2CETA 3CUHA 1EQPA 1O7AA 4U2YA 3BGAA 5CPSA 2D2OA 1JNEA 1EOKA 2XPKA 4MB3A 1JXJA 4UTFA 4OOZA 2EBNA 4CU8A 2XM2A 1SR0A 4TVUA 3II1A 4UFJA 3OIHA 1IZJA 4HU0A 2XFYA 1FOBA 4OOUA 2VQUA 3WD2A 4TVDA 3KL3A 1HKKA 3NUKA 5BWFA 4AD4A 2J7GA 2EACA 2WHJA 1I75A 1H09A 4R5EA 4U2ZA 4AZGA 4LGXA 3TOPA 3BVTA 3BUIA 3EJRA 3W38A 4XX6A 5I2UA 3BUBA 1QNQA 2PI6A 1ITCA 4AC1X 4QDMA 3DYPA 1V02A 2V5DA 3MV11 2UY3A 3RJYA 3KL0A 2VZTA 2XVKA 1H3GA 1W1TA 5ABFB 3VDHA 7CGTA 5AC5A 1Q6DA 4AZ7A 4BZYA 2CBIA 3MKKA 2GSJA 8CGTA 1UA7A 4QCFA 5EFFA 3CUJA 4Y7EA 3N1AA 1S46A 3TA9A 1EDGA 2F7RA 3AIBA 3PZVA 4WKFA 4ATWA 5AYIA 4GI6A 3WFZA 4A4AA 3BAIA 2O92A 4NRRA 1OGGA 5CGMA 2WW5A 4U3AA 1V03A 4PMXA 2ZUSA 1MW2A 3CZEA 4GIAA 3GBDA 4URIA 5I6SA 4H41A 4GQRA 1ZB5A 2DSUA 4QAWA 2DT0A 2F8QA 4E4PA 3AIEA 5E0CA 3TTQA 3PZ9A 3WF1A 4ZENA 3S6TA 3UG4A 2YA1A 3S5YA 3KL5A 2TAAA 1UR8A 1JDCA 2BY0A 2F7QA 3KEHA 1ISXA 3QHNA 3N15A 3GXFA 4P8XA 1EO5A 1EQCA 3CH9A 3DHPA 2E0PA 4JL1A 3ALGA 3SCUA 2PWFA 1NWUA 3NSNA 5DT7A 1BVZA 2CESA 1OBAA 1H0GA 1UR0A 1WDQA 1QOXA 2XWDA 4KRUA 1R47A 2EJ1A 1XH1A 2VZOA 3AI0A 2QPUA 3IAPA 2OSWA 3VKKA 3VDAA 1B3ZA 2PBGA 1WZAA 4FNRA 1OIFA 5ABGA 3HJEA 2XTKA 4AIUA 3APGA 1FH9A 3PZQA 3SCRA 1TR1A 3BCDA 1UQZA 4W93A 3VDBA 3AS2A 4PRWA 3VUPA 3DX2A 1KXQA 2NSXA 4OBRA 3WDIA 3H55A 1QBAA 3W37A 1BGAA 3WDQA 3AMDA 2YL9A 2ZWZA 4J27A 4AZIA 2D0GA 3VINA 4CN4A 1ODUA 5HPOA 4P7RA 1QBBA 1WPCA 4FNUA 4ZEPA 1JZ6A 3L4ZA 2EPKX 1MW3A 4FLSA 1XGZA 1C7TA 2VVSA 3MI6A 2YFNA 1PEZA 1WAWA 4DWSA 1NH6A 3WSUA 3MMWA 5A2AA 4FLQA 4D6IA 2WBKA 1JI1A 4NF7A 1B3XA 3LXCA 2W92A 2DIJA 3VDCA 1G0CA 1AMYA 3VD5A 3WMSA 1TVNA 2BHUA 2OSYA 4GZIA 3PZOA 3AIWA 1QHPA 4UQEA 1NQ6A 4ZE5A 4JKMA 4JCMA 2CBVA 3T09A 1CEOA 1R33A 4Q22A 3B9EA 1ZBKA 1JI2A 1UASA 1UH4A 2VOTA 2JE8A 5D9PA 4XZWA 2EPOA 1TQUA 2G3IA 3N04A 1SZNA 1JDAA 3SCPA 2WHLA 5M5DA 1W9VA 2WMGA 3L4WA 1NARA 2V38A 3VU2A 3EDKA 2WM0A 5AYBA 1XYFA 1AQHA 5HDRA 2Z1SA 4GI8A 3H53A 2D1ZA 3IJ7A 4D6JA 5BXTA 1BTCA 4S3JA 4AMCA 2XGBA 5E6YA 3VNZA 1JL8A 3HMCA 3PTKA 3WN6A 1UOKA 4J3XA 3EBVA 4A3YA 3WY3A 2WKLA 2ZICA 4J3UA 1C8QA 1QI3A 3IJ9A 4H7VA 4HTYA 3WUFA 1D3CA 4ATLA 2G3JA 2BHZA 4F66A 1RD6A 2WMHA 1V0LA 2GJRA 4WIWA 3VGHA 3CTTA 2WAGA 3N17A 2XVGA 2Q8XA 1DWFM 5ECUA 1OT1A 1OCQA 1VJSA 1QI4A 2XN1A 3ARYA 1XYZA 1HXKA 4JL2A 1B0IA 1V3HA 3VX0A 5I77A 2XN2A 3FW6A 2WZIA 2ZXBA 1W9DM 4M29A 2VTFA 3CMJA 5A3HA 1IV8A 1TCMA 1XCXA 4HPHA 1BQCA 2YA2A 4B16A 2W61A 1HVXA 1NOUA 3HN3A 1UR9A 4HA3A 5JIPA 3WUBA 3G6LA 4AYSA 3HG4A 1LL4A 3KLKA 1VF8A 5ABFA 1UR1A 6CGTA 1FH7A 4FMVA 4CCEA 2QV4A 3VO0A 1JYNA 1JAEA 3MSDA 4B15A 1W9XA 1V0MA 1QI2A 2YL8A 1E40A 4V28A 4DUXA 3L4UA 3LRMA 2X05A 1MFVA 2F1AA 2WSKA 1ISWA 1E4NA 1KWKA 1G9HA 1GOOA 4PN2A 4DUWA 1OM0A 4TVCA 1OWQA 4U31A 1O7DC 3CLWA 1E0VA 2UY2A 2V3GA 1QW9A 2EQDA 1VJZA 3A5VA 1N82A 2J47A 2GDUA 2DH2A 4NSBA 1B1YA 3RDKA 3TONA 1HJVA 4EK7A 1MW1A 3MMDA 4GO8A 4GZJA 3HZ3A 3CZSA 2WCSA 1GNXA 4E8CA 2PWDA 4JIEA 1HNYA 1TE1A 1US3A 4MJ2A 4JKLA 2O9RA 3QHMA 1CECA 4H8VA 2VC9A 3WH6A 3SCVA 2HISA 2J7DA 3QHOA 3OZOA 3CHEA 3DYMA 2D73A 5A6JA 3D4YA 5EBAA 1W9BM 3WY1A 1H49A 2VX6A 5D4YA 1TMQA 1WZKA 2WC4A 4AW7A 4NXSA 4HZ8A 3W28A 1GVIA 2J74A 2A3EA 4HP5A 2X1IA 3BUQA 2PB1A 3BLKA 4AEEA 4PBGA 5EFDA 4KWUA 3RO8A 3WF3A 2GUYA 1JZ7A 3VIMA 1VAHA 3WQ4A 3E1F1 1H2JA 4J28A 3SCOA 3SCQA 2Y2WA 4CD7A 1PIFA 2EAEA 1W3JA 4LYQA 4UR9A 1JXKA 3N13A 3AICA 3WNNA 1WB0A 1DWJM 2VX4A 4W5UA 1LQ0A 3BAXA 3EYPA 2XSBA 4FNQA 2IXVA 2DPEA 3DX4A 2EADA 3OLDA 4NZFA 2ZUUA 3WD0A 2VNCA 1QWUA 4FNSA 5I23A 2WMJA 5I78A 2OW7A 3CIVA 3DX0A 4NRSA 1JD9A 2WWDA 2ALWA 2DQXA 3CMGA 4C7DA 3WNPA 2EO7A 1VFFA 5BRQA 3ARUA 1C92A 4OZOA 2QPSA 2CITA 4UZSA 2QLYA 1E43A 1VIWA 2XFRA 2D23A 5A6BD 3EDEA 1PZ3A 2ZX7A 4UQ9A 1UR4A 3B9DA 3O9NA 4AWEA 3PTMA 1E15A 4AD5A 3GXIA 4GQQA 3WBAA 2X2HA 1MVYA 1ZJAA 1EDQA 3BH4A 1V6UA 5E70A 1CNVA 3AMKA 2ZXAA 4J3TA 4UOJA 3T2OA 3AYRA 3W53A 1G01A 1WCGA 3AHTA 2XVPA 4HMCA 4E2OA 4TX6A 1H1NA 3IANA 1UKPA 1TQTA 2GK1B 2VRJA 2XN0A 3CPUA 1DWAM 1LWHA 2NW0A 4X0VA 1C8YA 2VI0A 1TFVA 4TTUA 1HF6A 3WQ5A 3O2LA 3NCOA 2OW6A 4AZ6A 3FHQA 1JD7A 4AD1A 4CVUA 1ZU8A 1ZS2A 3CBWA 3GXMA 1WZMA 2W91A 3WFLA 3LPOA 2WVTA 2YDRA 2ZIDA 1QHZA 4V2XA 1EA9C 4UQDA 1JZ5A 1GJUA 4XZBA 1R46A 2Z1KA 2WK2A 5TD4A 4EKJA 2CERA 1DTUA 5CSUA 5FCZA 1Q6EA 1SFSA 3M07A 4AMWA 2ZUMA 1CGUA 1F4AA 2WMKA 2J7BA 4MB1A 3N12A 1V6VA 3AS0A 1UWSA 2JIWA 3GBEA 4NXKA 2Y8VA 2ZX6A 5A1AA 4UQAA 1FA2A 2X09A 1LG1A 3MU7A 5A8MA 1B3VA 4B3KA 1VFMA 1XH2A 1GOIA 1NOWA 1CXEA 4U3CA 3J7HA 3AOFA 3ARXA 1GJWA 5D8WA 4P8VA 3VIGA 1V3JA 5JBFA 1U2YA 3FXYA 4OGZA 5BYWA 4ZFMA 3ARQA 2CHOA 1PX3A 3AXXA 4JHOA 1UD6A 3VSTA 1G1YA 3M6DA 3DX3A 4Z2IA 1OSEA 3AMLA 1QWNA 3GXNA 1VB9A 1E71M 3ALFA 2DSZA 3PTQA 1B3WA 5IDIA 1UZ1A 2W63A 4IPLA 1UWIA 2D0FA 2YA0A 3RJXA 3GTNA 4B9YA 4AY1A 1FP9A 2BVDA 3AFBA 4C7FA 3MSGA 1X6NA 1JFHA 1QNOA 1B90A 2VR4A 1ZJBA 1XSKA 3TTYA 3L4XA 2JF6A 4ZE4A 1HKJA 1XC6A 1E6PA 1EDTA 2DSVA 1C3FA 4M24A 4QLKA 5DFAA 5BCAA 1UKOA 1CIUA 3N9KA 1SMDA 3GNOA 3MUY1 2GFTA 3F5JA 2WVVB 3WF4A 3VMOA 1JNDA 2AAAA 5FL0A 2QHAA 4OBSA 1ZBVA 5A69A 3GH7A 1E3XA 4CCCA 1E4IA 5CXPA 5A6KA 5AC4A 5HOSA 1V3LA 4BCEA 4FK9A 2J8FA 8A3HA 3A6OA 4H2CA 2J25A 3ECQA 4D71A 1AQMA 1LG2A 1D2KA 3WNOA 4QLLA 2VURA 5I3DA 1NOFA 4PSRA 3CC1A 4BQ3A 5GQBA 1UZ4A 2WHKA 1PBGA 3W25A 2YDSA 4AXNA 3AISA 3BVUA 2VZSA 4MNMA 2ZUVA 3OA5A 4EAMA 4M80A 1PX4A 1UKQA 2F61A 3AZRA 3GDBA 3D5HA 4CU6A 2CEQA 3DECA 1D7FA 5M17A 4UZUA 1GZJA 2D24A 2YIHA 5LA0A 4JAWA 1GQIA 5IHSA 2GJPA 1QPKA 3VSUA 1GQKA 1UWUA 4ACZB 2BY2A 1E6NA 1FFRA 3HG3A 1GVYA 2GVYA 1W3HA 1NP2A 2JALA 1TUXA 2A3BA 4TTGA 4D6HA 2BFGA 3BUDA 5FL1A 1JYXA 1KCKA 1W1VA 2VCBA 4HMEA 4J3SA 1X6LA 1RPKA 1CLXA 2EPLX 2OLHA 2XSAA 1UD4A 5D9NA 2OWXA 3FHAA 3CZGA 2DGAA 3KZSA 2GK1A 1RP9A 3D3AA 5IXEA 5JUVA 3EMQA 1JDDA 5CLWA 4MAVA 1PJ9A 5CJ5A 1US2A 2CNCA 1V08A 3ARWA 4HOZA 4HMDA 2CHNA 1E4LA 3F5LA 3S5ZA 5EMYA
chains in the Genus database with same CATH superfamily
3NTYA 5CR1A 5EDXA 2O9PA 4IEFA 3OB8A 5J11B 2JFEX 1XD0A 3H4HA 4AQAB 1Z9SA 1MG2C 2PTXA 4BYHA 5C71A 1JUFA 1KN4L 3ES6A 3IDXL 1E4MM 2B9BA 3ARTA 1CFSB 3EJSA 1D5BB 3RKDD 4OU1A 4Y2LA 5CZXC 3NN8A 4DCQA 4L8CA 4IJCA 1FG9C 3C09C 1XDMA 2XUCA 4O5LL 3OV6A 3FUEA 5GZND 5BJTA 1Z1WA 3L3JB 4HSHA 1ZJIA 2OMZB 3LS4H 3SRKA 5K9CA 3FO9B 3CFTA 1TX0A 4YDJA 3OOQA 4E4UA 2F15A 4S1DD 1ZE3C 2IV9A 5I07A 1Z9AA 4JY4B 3N41F 5J04A 1NBYB 1TTFA 4C83B 4MYWB 1AH3A 1YEIH 2GDQA 2JF7A 1KJVA 3EGXA 3REVA 3W6MA 4PVBA 1V93A 5DFTA 5CSRA 2W9MA 5MHBA 15C8H 2P8MB 3RM4A 3BWZA 4W8LA 3VIOA 1D6VL 3HOGA 5E1HB 4JPIB 4B3ZA 4E2VA 2PF6A 4XZ4A 2WSQA 4PV1C 1AUSL 2PD9A 1HHKB 4LPVA 3RVWD 3CG8A 2PTWA 5I3IA 1J0IA 1QPNA 2IIJA 2OX1A 4ORGB 1KJ3H 3TC7A 1MUMA 1TPDA 1VS1A 3LYEA 2QPDB 4NRXA 1QX1A 2Y85A 3N43F 1L7TL 2CLMA 5AKRA 1AHKA 3MV01 1A9BA 4H1LB 2Y36H 4E42B 4AHQA 4W7UA 4Q4SA 2E7CA 4MPKA 1EUTA 3GMMA 3HO8A 2OGYA 3NXFA 2NUPB 4HOMA 1T7WA 3DCPA 3OB0K 1DJSA 2AXGA 5AYYA 1EHAA 1IM3B 4GFXA 1ZLPA 3NESA 1CICD 4EMZA 7REQB 1CN4A 1ZV2A 3HR6A 5HULA 4JK0D 2GUOA 5JHBA 4QKTA 4CVZB 2C3HA 2PR4L 4WEEA 2OO6A 1PW3A 4P4RA 3WQEA 4MDJA 2X70A 3HAEG 1H11A 2EVGA 1C5BH 1KV8A 4TQPA 1M2OA 4ZW8A 1YDNA 2OMAA 1KR1A 4AK2A 1LK2B 4JM4H 3ULUH 3ZZQA 3P1VA 4WUUB 5HHOA 1G67A 4X4KA 4TMCA 4P23C 3NDZE 4CN6A 2G5RA 1UOLA 2D0HA 4MZ8A 1E1EA 5EBLA 4GA8A 2J5LC 3ZE0B 2IGTA 4MMXA 3KR3H 4LX4A 1WC7B 4OLXH 4Y5XC 3AAMA 3CHPA 3WNJA 4D1IA 3K6FA 3ZMNA 3RA7L 2JH2A 1SMAA 3GBMH 1M5WA 1F8IA 6REQA 2UY7A 5M3WA 1L9OA 3U6WA 1NM4A 3BG5A 1INEL 1E6RA 2ATSA 3BZEA 1OTTC 1CD9B 2BINA 2R6OA 5J8LA 4GHRA 3BPCB 3UCQA 2JKXA 5IVNA 4AJWA 2CXGA 1EJWC 1RURH 4L3EB 4Y5VB 1MHPH 2ZE3A 5C07D 4KRPC 2C1HA 3EJUA 1XIEA 5LNUA 1BM3L 3C08H 1K5NB 3BPNB 2VGFA 5CIPB 1WT5A 3H22A 3W07A 3TTSA 1HE8A 1VEOA 2V3EA 1E4XI 1P4LB 3TE9A 1DZBA 5BOOA 4M1DL 1A0QH 4E9QA 4F7CB 1CFVL 3SKNA 1FBIL 3RTLA 3H2WA 4FJYA 4PULA 3L67A 3KPLA 5HJXA 3B4UA 3DOSB 1GYWA 3Q3GA 4M6UA 4WO4B 4WU7B 2X10A 3ZTEA 5AHIA 1X39A 3F7YB 4DUVA 2BBFA 3WEXB 2GPTA 1XWVA 2AJVH 4RW5A 2A3CA 4MCYB 5I0DA 2DQ6A 3RX5A 1OB1B 2XJLA 3IMRA 1AMKA 5C0CD 3JW7A 3SQBA 1SUJA 1KTDA 1OSPL 3EFFB 2EJAA 1TVPA 2OZNA 1LM8V 4IKLA 1XYLA 1I2PA 3QMSA 1AQDB 2PDCA 1OE3A 2G5UA 3DBXA 3FT0A 4DNLA 5I00A 4IT1A 3T6ZA 5C09D 1F6FB 4KRNA 3MO1A 3S2MA 1XF5A 3CIQA 2OX5B 3TYBA 1GGBH 3DJRA 5I6LA 1AO7E 4OIFA 4HJIA 3GI8H 3S47A 4LPXA 3DUUB 4R6UA 4F40A 3GSVB 5IR1B 2YXVA 4AGQA 4OCRH 2DZPA 2WANA 3MLSL 3KYOB 1N7KA 3TIEA 3SYAA 3L48A 4HKJB 4X7FC 5KYXB 3I02A 2VZVA 2GZXA 3VGAC 3MRFA 4XP9L 3CUFA 2ZKYA 5FF6B 1HH9B 2QULA 1E67A 1W8NA 3CN2A 1RP8A 4G6JH 3SDDA 3IGAA 2CKBL 1ZMYA 3CHRA 5J12C 3TO2A 2OR9L 3ECBA 3QJZA 4O4YL 3ULUD 3HG2A 5ILTH 2OMUA 2PFHA 2W3ZA 4DEUA 2HZGA 1P0BA 3K1KC 5IFHH 4V11A 2WVUA 4QO1A 1F42A 1PZAA 5AW7B 2OULB 4PJHE 1S9XB 4EN3C 1UP2A 4GRLD 4PY7B 3R5EA 1KC5L 1M7UA 4ZW5A 5I1KL 5AHEA 2TPSA 2B39A 3OLEA 2GSHA 2VLKD 1PZCA 3RL2A 1R5WA 3MRGA 4AAJA 4UM9B 3TIMA 1IBHA 2HN7A 3BJFA 7TIMA 2HSAA 4Q74A 2NW3B 5AVVB 2BSSA 4FQXD 2VR7A 3WDRA 2HX7A 3WO4C 1FWCC 4A7GA 2UYLA 3VXQB 3T1FB 3LA4A 5EB8A 3BGMA 3GHEH 1AK5A 3S42A 5ANHA 5IMKA 3IUHA 1DFXA 3ANUA 5DK3A 4K3DH 3O3UN 4GH1A 1VFHA 2YZ1A 1I8IA 5IW6B 1ASOA 2GGGA 5DEFB 1N3NB 4A2HA 2Z65C 2EKCA 4OCSL 3T05A 2IH1B 3HMXH 2QR0B 1UROA 4JN2A 5MEQB 3FZUD 3VKJA 2BOEX 2OMYA 4HBCL 4A2LA 4DKEH 3B56A 6XIMA 3IJEB 5AFAA 3WTXA 2X0YA 1RAKA 4OJYA 4BHYA 5C0AD 1QHQA 1QSFB 3SOBH 4I48A 4EF9A 3ARBD 4F7PA 1L6PA 4EJ1C 4NUJB 1CG9B 5CJOL 3NQBA 3EGSA 3RWCA 1OZUA 3VD7A 4HIXL 5AB9A 5HQEA 1OCRB 5F7UA 4DEFA 2NYYC 3P3UA 1J01A 3R0DA 3VXRD 2VFHA 3FCSB 5E94A 3ET9F 4LQ1A 1BD2E 3LHPL 2R4RL 4MMYA 4ELME 1SYSA 1KLGA 5EC1A 5D1QC 5HPMB 1F11B 5C3LD 5D03A 3K8KA 4K71C 4G71B 1Z9OA 2V81A 4F0HA 1FPTH 4H0IA 1CD1B 4ERAA 3SUTA 2QKIC 3HRZA 2ZA3A 5B4MC 5C5YA 5DD3H 4AG4H 1R3JA 3GTIA 4ICCX 2XFFA 1IGFH 1Z32X 3NZ1A 1RZJL 1ZGLB 4OF8A 2H90A 3B9AA 2YPVA 4I7VA 1Q6QA 4A2SA 1SXAA 4WKZB 1S2AA 4M82A 3B9VA 3HI6L 1Q2SA 4J2MA 1B2WH 5EZLB 1MQRA 3VFUA 4KFNA 3UTOA 1EFXB 3G08A 3N6YA 3T1WA 5J13B 1FNGA 1F4XL 2P5EB 2W67A 1JDFA 1LUCA 3WHXB 4S1QL 4GMTH 5FUZL 4AD0A 1EEZB 2WTRA 2PDFA 3QDJE 1BG9A 5E7BA 1J18A 2XTJE 2BZ7A 3KYAA 2XZ7A 2AJZB 4X5WB 5CZSA 4DGYH 1T3FB 4N8CH 1SW0A 3QFJD 1TR7A 5ESVA 2EEXA 2OTWA 1FFQA 5G2WA 4XNXH 4XB3A 1U8QB 3FOMA 4YS4A 4X3ZA 3PJWA 3NZHL 4ELKB 4ESKA 1TTIA 4QRPD 1U58B 1BZDA 4DBSA 4ODXB 2NCMA 1J9YA 3A21A 2Z27A 4F0RA 5FEWA 1LDPL 1UOZA 2EH8L 3FTVA 3CUHA 3BKCL 5XINA 1TSHA 4YC2B 4RGNB 2XPKA 3THUA 2V5SA 2XWCA 2W9DL 4N2CA 4JFFD 4HU0A 4JMXA 3STLA 3LQAH 1UC5A 1K8CA 5C3IA 5FCUH 3MMEB 2J1ZA 3WLRA 3CCHB 1NGPH 3LS9A 3MJ9H 5B39A 2P0OA 3VCRA 1OXYA 5BV7B 4R88A 1DJXA 3CQQA 1UP3A 5AG9A 1AE6L 1MFNA 1EVUA 1KCSL 5CMAA 4G1MA 4QE4A 1KRCC 3OSKA 5F2MA 4DHLA 4WI3A 1XIMA 5L8KB 1SUXA 5DZLA 1AHMA 2HT2C 3WJLC 1T8QA 3PZVA 2QJDA 2AV7A 3ARGC 3P84A 5FWQA 2GJNA 1FL5A 3G5VB 2UZYB 2ISSA 4JFXA 1VBHA 2HJPA 2REQB 2VCOA 2DD8L 2DYPB 2TAAA 4OF3A 3NIFE 4A6GA 5ABAA 3QHNA 4GNVA 4X2RA 1RUAL 1EO5A 3BW3A 3RLSA 3NP4A 2PWFA 1DBJL 4RMUA 3EO0B 3U6XA 1IU1A 2I32A 1CW2A 1Z3GL 3QEHA 5FF0A 2B4CL 2YUZA 3B5HA 1ACYL 5KSBE 3NIDB 5JZ7D 5DLCA 1PL3A 4YPGB 4UNUA 4FYRA 3VDBA 2XWTB 2VLRA 1OIOA 3OAYH 3VUPA 3DX2A 4GABA 5IZ7A 4ZPTA 3W37A 2EYSA 2V17L 2OO0A 4FEZA 4KK5D 4O15A 3TIDA 1N6QH 4KMTH 4P4KD 2VVSA 4OFVA 3V4VB 3STGA 5IIEA 4LUSB 1TYJA 3JQOB 2OCZA 4D6IA 3FB5B 2NNXA 5ACZB 3A3XA 3IIXA 4Y4HA 3GNMH 2DQFB 4I6KA 4IBZA 3E1ZA 3MLTB 4UOW0 1M6OA 3WFBL 4TNGA 3MUUA 3L1FA 4BEQA 3PG8A 1WKDA 3QNZA 2R7EA 3M5VA 5JO5B 4FX5A 5D1XB 4KJQD 4F7MA 1W9VA 1NPUA 5B8CA 1IARB 2O5YH 3DTXB 4N0UE 4QOKA 3W9DA 4LVNC 2EG6A 1ODAA 2WMPB 3R0MA 4HH9A 5D8JH 2B4GA 1UQSA 3R2GA 2P47B 1S9VA 1GYLA 4UTCA 3QZWG 3EWDA 4R4BB 3QDJB 1C8QA 2XTJB 2CO7B 5AYTA 2N0KA 2PCFB 4GX9A 3LZFH 2J24A 4PGJA 4Z9KB 5J4MA 1NFDB 2VWSA 4F7EA 2WB1A 1TPXC 2Z2UA 5HVGB 1WFJA 3KLDA 3GSUA 2XJKA 3ZLQC 1L9RA 1T89A 1XLGA 5HNRA 1KYUA 1OGAE 3EH4B 3MGOA 2W61A 4BINA 3QJVB 5DT1L 5FLUA 3B9KA 4ONVA 1U93A 4OIAA 2DQHH 4FX7A 2Y7QA 4QCIB 4F33B 1QI2A 1NANH 5DY3A 3ABGA 1DVSA 1G9HA 1KLUB 3HC3L 1N55A 5E1AB 4U31A 1O7DC 1E0VA 2ARJB 3N42F 3VE0A 4PRIA 3A5VA 3HFYA 4MWAA 1OEZW 3G6JA 2CHDA 3DOHA 1N64L 2PWDA 4H8VA 1NELA 1NFGA 3BDYH 3OKLA 5CSGA 4P5TA 3A9BA 4ZMWA 1F3DH 4TXVB 3UZEC 1D7DA 4KWUA 3RY4A 3HNTH 4RH4A 2QVNA 5GISL 1T0MB 3HE7A 4PGZA 4CD7A 1PIFA 2V2HA 3AICA 3WNNA 1IAIH 4F3FB 2ZVIA 3KYNB 2XQBL 3MI2A 4JHVA 5DYOB 1TU2A 4FRWA 2WMJA 2YX0A 1WGOA 1NFPA 2YAFA 4Y6GA 3WTUA 4CMHB 4C7DA 1E4KC 4PJIE 2EO7A 1QRKA 5KN5B 3UJIL 4OZOA 1TCRB 3CPLA 2DTML 4HSQA 3EDEA 3ZKND 1U8MB 2R59A 3PTMA 3ECVA 1Q9LB 1A6WL 4X4ZA 3C2SA 5E70A 1Q7ZA 3IU4H 1A7PH 4B5ZA 2Q3AA 2B5IB 4XPHH 3IWVA 5LGZA 1ZP3A 3EB4A 5JPMA 2ZF9A 4NT0A 4D8LA 4KK6D 4K2SA 4HDIB 4JAMA 5T1KA 1KT2B 4RA0C 2WKOA 1JD7A 3VNIA 4Z0JA 3C60D 5DRXA 1FDJA 3PWVA 5EU4A 5SX5K 3D3VD 2ZIDA 3UBHA 1R46A 3RVVC 3MBXH 4K55A 5FCZA 3VNLA 1ES0B 1MI5E 4P2OC 3FRPB 5BVPL 3IFLL 4DK3A 5EZIH 3P0XA 4DP2X 1S3KL 3PQYB 4YHML 1HNFA 2F74A 1E4XL 3AREC 3N9RA 4L5ZA 3HB9A 4RPPA 3PHOB 4PUJA 4BZ1A 1OFAA 4DYEA 1U22A 3BH8A 1H8OA 5CILH 2FGBA 4AQ1B 1TLMA 4HUUA 4AH2A 4F58L 3TW7A 1KM0A 1F13A 2CLVB 2M83A 4IHCA 3KLSA 1G1YA 1GK8A 4Z2IA 1XLIA 1X44A 2DSZA 1GIGL 3WSQL 1UZ1A 3U4EA 3UZ5A 2X53A 4GRWH 5GGQH 2BVDA 2Y1VA 5IHUL 1JR1A 3QXDB 4BRJA 2ADIA 3H9HB 3HE6D 4G8EA 1J96A 1EDTA 1C3FA 4U49A 2O5XH 3KLHD 5TE6H 5C7VA 4G59C 1RLBA 4RIRA 4PU2A 4EBQH 4PJ9B 4NQEA 1YEGL 1OGAB 3MJ7B 2E1WA 2YXFA 3H9YA 1GW0A 3O6KL 4ZSOA 4YSAA 1S7SB 3HPXA 2ED9A 5A16B 4QLLA 1XAKA 1I7TA 4GUPB 1PYMA 1AJ7H 5EF3A 2ZSWB 3OXSA 4C47A 2PR9A 4C4KO 4NO5A 4F2UA 3CFKA 5G2NA 3GDBA 3CVHA 1ZT7A 2NY1C 2JB6A 5IHSA 4PUNA 4GKZB 4UBPC 3CM4A 4OFDA 1TSIA 2Y61A 4P2CG 1E6NA 4HQQL 2BWQA 3MYJA 2NR6C 4M7LL 2NXYB 2JALA 3D18A 4XI5C 3VXGA 3EB3A 4M8QA 1JPDX 4JFDB 4FXLA 4ICMA 4HMEA 3GUTB 4JIRA 1X6LA 1FYTD 1EUUA 3KWWA 4YDIL 4PLJD 3SADA 1EUAA 4LQFL 4J3OC 2CBQA 2DU2A 3VXTB 3SBRA 2NX5A 1UCBL 2F9BT 4ABVA 3T2NH 5D9SA 2FQIA 4MXWH 3ILEA 2DEPA 3LDVA 4NT6B 3VOFA 4RZ4A 3CSFA 4OGYH 2OL3L 4ZTYA 5J6HB 1KV7A 5SWZE 2G9KA 3P3BA 5DLML 3VXUA 4ZQMA 2WIMA 2W9EL 4L4JA 1RCOB 4LBUA 2EDWA 3VWJA 2ICWB 4JZJB 1RJCA 2WYSA 5TDPA 2FUQA 2CR3A 5MEPA 3W02A 2YYTA 3AHXA 4K9EH 1AQ0A 2GEEA 4DO7A 3AS1A 4JQ4A 2Z7ZA 4GXUM 2AFNA 2XXGA 5FA4A 2CO6B 5FGCE 4LHJB 1TKWB 3NA9H 1EMTH 3T6VA 1XIJA 4E5TA 3MACL 4Z7OE 1OLLA 2XIQA 1IEHA 3QXAA 4DZ5A 1SOQA 4XBPB 3TYDA 4Z23A 2AMGA 4B5EA 1OWRM 5IROD 3OODA 4H6RA 3W70A 3OHXB 4I2XE 3EBGA 3RTQC 1TIMA 1E5AA 3MRQA 2EPMX 4P2RE 3P4MA 2I5IA 4OCLC 1JZDC 4U1MB 3CXHK 2ZXEB 2XGIA 4LALA 1KJ2H 2XWJB 3OGRA 3FPYA 3FQ1A 4RETB 1MHHA 4QDGA 3S98A 3GE7A 4WX2A 3EOSA 4WVXA 3HI5L 3TBVB 1ADQH 1BYBA 1NCBL 3WY2A 2P80A 4YBLC 2R4SH 3MNMA 4OLYH 3N18A 2X9XA 1YBQB 4EPKA 3HUJE 1I7UA 4P3WA 1AR2A 3VI3A 3MCLH 1JNJA 5I6MA 2IDUA 2XQYA 1R3VA 2MUCA 4AL8H 1O5RA 5JHLL 3K5XA 2IG2L 2YBGA 4LSUL 3VXSD 3RDTB 5DJAA 4NCDA 4HU2A 3RY6C 5I1HL 4KDTA 3DVNB 2GC4C 2VR3A 1XR8A 2YBUA 2BDQA 3H8AA 5JHDD 3O9WB 3LCWA 3GSWA 4MJIB 4W5ZA 3TT1H 1MQKL 2IEPA 5E5LA 3GJFH 3W2LA 4A8IA 2E4FA 2IMRA 2ZTKA 2GUBA 2V6AA 4LOCA 3BIAX 2V68A 2GDVA 4K3GA 3RM9A 4ZNCD 2R1XA 5E8OB 3LN5A 3LOWA 1JPGA 4C6LA 1GOMA 1KQYA 3HS8A 2GI0A 1VGEH 2CJTA 5AW0B 2ICWI 1LP6A 2NUTA 5T1LB 4CMMA 1KRBC 4DF1A 1CBVH 4UINL 5BMFH 3HIZA 4WY7L 1EH9A 3UR2A 4Q0XL 1UH2A 4M8VA 2GCYB 3C5SA 1I0BA 5IB2B 1FO0B 4K5LA 5JW3L 2VEFA 4KK8D 3MNVB 5CP7B 2APBA 4XO9A 5FGBA 3MRJA 3FS9A 1V79A 4DI9A 2XV3A 4DF9A 3QG7H 2PRHA 2B77A 4NO0B 4OGXL 4RE3A 1FWHC 2QZRA 4POYA 4A39A 3PZGA 3D87B 4ROPA 2Q0ZX 3T4AB 1HJCA 1RCQA 4M0XA 4DOHE 1MF2H 1O5KA 2V3FA 1H19A 3V7MA 2A6LA 2IQ9H 5ICYB 4YK4C 4X9YA 1FAIL 2PXYA 1U91B 1INQB 4H8QA 3TPUB 3D85B 4JHMA 3UFIA 2OZ8A 1K85A 3FKRA 1FH8A 4M02A 4GW5B 1TZHB 2NY7L 2KH2B 5MEOB 4AVIA 5DGQA 1I7ZA 2FNWA 4N9BA 1BHGA 2ZCLL 2HK0A 1WBYB 1L3NA 2NV1A 4BQ4A 3WLKX 3N06B 4HN8A 5DDHA 2Z1WA 2BVYA 2CO2A 3U46B 5CBIA 3ESPA 2MOGA 3FSUA 3HA0A 5FGCB 2RGLA 4LCWD 3WJMB 4Z7OB 1BXVA 1GY1A 3L3GB 4AW4A 1L8NA 2V5YA 3QR1A 1IT0A 4YXLL 1U8PB 3F04A 5KSAA 3MCYA 3QOKA 3ZJKA 2WY3B 4ZFFA 5FEBA 3H2NA 4I2XB 3PZIA 4L6OA 2E7DA 3PL6B 3ME0B 2VW4A 1PEWA 1T4WA 2W95A 3LH2L 4AVKA 2UVEA 5D6DC 1LO5B 3MLXL 2WQAA 4UUIA 3O6CA 1SVBA 3M1BB 1S7TB 3MLYL 4UNIA 2O93L 5DJ2A 2DMGA 1GQNA 1MJUH 2EKSA 3ULVH 2XXCB 2F1BA 1TA3A 2IBZX 3DPDA 3LZLA 2V5LA 4LSQL 5FJOA 2YRLA 4ERIA 4HS6B 5GS0H 1DWGM 2DKUA 3ELFA 3W7RA 3QI9D 2ZX8A 2YLLA 4D94A 4ZUVB 3QGAC 4X98A 1W3LA 4R26H 3RF9A 1TTPA 3BP6A 4OUIA 3ARDC 3B34A 1X4YA 1JV5A 1ZY9A 1CX9A 1WBZB 2WQPA 3PAUA 3HFML 4AZCB 4BS0A 4FD0A 1RAMA 2XH0A 1VBRA 3PCYA 4DK6A 4RGOL 3S35H 3JV6A 3FTGA 3M47A 4KU1A 3AQZA 1VACA 4G6AD 4J4PD 2IBGA 5ENWB 5C6TL 3G9VA 2VXQH 3DJ9A 2W9LA 1N68A 4FQ2H 3W7OA 4DT2A 3WLBA 4LLWA 4BHUA 4OLUH 4W8BA 2XPZA 5I6KA 1A4JB 4DVRL 5F0MB 2WNKA 4KI5C 4CVWA 4M61A 2YOAA 4PJGE 4GAJH 3RWIA 2ZA1A 1CFQA 2X1PA 3SQLA 1PTDA 1KFWA 3T8QA 3IARA 4ZYKB 3APCA 2BW4A 3H3PH 2QF8A 4P2QD 3MLVH 1E6XM 1FZOB 5I8KH 1QYGL 4C6FA 4WI7A 9XIAA 1OGPA 2WWNA 1K2DB 4OY9A 1UD8A 4ICNA 4WK9A 3FT2B 3CAKA 5BRZA 1UXSB 5TDNB 5BZZA 4DOHB 1VZIA 3WLWD 1UWGL 4JTDA 1CYXA 5D93C 3O41A 2Z4TA 2DMHA 1U30A 3BMWA 4FFWD 4I0PA 3KAAA 3RQ3A 3GTXA 1Y6MR 1C7SA 3BVNA 4YDLC 4W7WA 4NKDA 1OCNA 5DF0A 3LEYL 3O6ML 3I75B 4R3SA 3NL6A 4WWOA 4HPYH 1SOKA 2VLJB 4WJG3 1HJXA 1QRNA 1CI1A 2PN5A 2AJYL 4N2BA 3U1QA 2X4NB 4ZTOL 4NNYB 1IEXA 1EXUA 4H2HA 4JVUA 2MPAH 5JW5A 5F9WB 1OAKL 1DBTA 1OFPA 4LRIA 3LDBC 2L7JA 2YCKX 5I8OH 4ZUTB 3U82B 1AD4A 2ZKXA 3G1YA 3FC8A 3COOA 4NKQB 5F2IA 1OAYH 5AVXB 5GHWH 1E28A 1A3RL 5LN4A 2O61B 1H5BB 1DBAL 2H5UA 1UWTA 5HYSG 3QQ4A 4PJEA 1FZMB 2G3ZA 2YN3A 3ULVD 1M42A 3MCKB 5GS0D 1NINA 1UWXK 4WU5A 2EDOA 3SZ8A 3M9YA 1NM9A 1HCFX 3MJGX 1CK0L 5FJUA 3UAJC 4N2AA 4DPPA 1RZGA 1OFBA 3IJLA 4GWEA 3BFWA 1HXJA 5KMYA 3PANA 4PUEA 2J13A 1U8NA 3SUUA 5J8OA 1WA3A 4JBRA 3BQVA 4FXTA 1E8XA 2H0PA 3CX5J 5SX4H 5C0NC 4KJPC 4QWWD 3O45B 1USQA 1K7FA 1T40A 5DHVA 4AQ8C 1W72L 2V3DA 1UWFA 3PAZA 1MRCH 5FO9A 1OO2A 5LA1A 1OAXL 5TE7L 4G9FE 5E0FA 1AIFA 5DMJB 3VH8G 3CSBA 2J8GA 5C2UB 3VTRA 4HHAA 3A24A 1RK1A 2Y7DA 3OLGA 4GG6B 5DEGB 3CLFH 1DO6A 7PTDA 1ILSA 1KM5A 3IETA 5HHMD 4P46A 4WNQA 1DVFD 3KFTA 4IH3A 4LFHD 5F9AC 1QW7A 2HV5A 4I3RL 5GRYA 1CDYA 3FY1A 3CX2A 3PJSA 4RX4A 3IK2A 4Z7UE 3G1HA 4KXZI 4PB3A 2XACC 1OALA 4PTDA 5C08B 4NZJA 2CETA 4N68A 1JK9B 2PAJA 3CN4A 3RY5A 4DWHA 4LVAA 5F1UA 3OMIB 4WEVX 1KIPB 5SV3A 2AI0H 2VDRB 4XAWH 5HQLA 1SR0A 2W88A 1IZJA 3KJ6H 3M0VA 2Q87A 1EHLH 3NUKA 3UTSA 4W81A 5J1SC 1H09A 2QVFB 4TUKH 4JPVL 3FJTA 5I30H 2BX5A 5GGSB 4CJ0A 2WPBA 3QH3B 4DEWA 2OP4H 4FXKA 5TGBA 3HN5A 3GSQB 3QYQA 1MN4A 3PWNB 5DUJA 1LDCA 4K5PA 4C8XA 5CBAA 4KNSA 3EZJB 1UM5L 3NQIA 4L6DA 3GKWH 1HW6A 3TA9A 3W1QA 2NQDA 3L66A 4E9XA 2F7RA 3AIBA 1G7PB 3S4SG 3BAIA 4QHKJ 4NOFA 3QDGB 5KVGE 4L4VB 4DFHA 1TV3A 2DT0A 5KOMC 2YCEA 3KTSA 1FFPA 4WUUE 3REWB 2ZJSL 2Y3AA 3L16A 2HBXA 3WFHA 1WG3A 4LSSL 1KG0A 4E0RB 3ALGA 2CLZA 3ZE0E 2VMEA 2ENQA 1UR0A 2V2WB 1TVLA 3E6HA 5I9QC 3IAPA 4TF4A 2IVFC 3WK2A 2DZUA 4YVXA 5EV7A 4FNRA 4GGBA 1MFDH 4JEGB 4NSKB 1Q8AA 1TR1A 5E5UB 3TM6A 1GYVA 5DJZA 3FSTA 1KXQA 8XIMA 2NSXA 4KQNA 3K81A 3T07A 1Y6NR 5HPOA 3RU6A 2EP6A 1IAIM 3G5YB 4YHPB 1MW3A 3P61A 1XF2B 4C6IA 2YFNA 4I9AA 2OMWA 2N4IA 3GY1A 2FATH 5EO1A 1XGQA 3L54A 1UM6H 4ZAKB 1G0CA 3KRUA 1DE4A 1TVNA 4GZIA 3RFZC 2HRWA 2CBVA 5F1IB 4A55A 4Q22A 2ID5A 1U8IB 5D9PA 3UCDA 5EIIA 2IMMA 5HHOD 1MCJA 3X14A 2BOBA 3V4PL 4NQCB 2V38A 1XYFA 1B57A 4Y9OA 4OZFA 2HFEB 5IBTH 2NY3D 5E00A 1EGMA 1BQHA 3VNDA 3VNZA 5GZOC 3HMCA 4G9FB 3QIBB 4XBEL 3VFTA 2DQMA 2VIRA 5C9UA 5K9QI 3KXQA 2DM2A 1BWKA 2K70A 2CBMA 2DQUL 3EJZD 3TLRA 3I6GB 1KFLA 1UIPA 4FABL 1KN2L 4GUFA 4G6CA 2EICA 4Z7WB 4Q32A 2JF1A 3EH1A 1ROWA 2HYMA 5JYMA 3V18A 1UPPA 4CKVX 4HA3A 3WUBA 5GJSH 1UATA 4Z7UB 3KPTA 3GS6A 2YL8A 4V28A 3NA4A 3GZPA 4NJJA 3TBCA 2VEKA 3QR0A 4KY1H 3CDZA 3QRBA 4DN3H 2V3GA 1OFDA 3E6FB 4LAJH 4NJHA 5AW2B 2OQHA 3SYOA 2VDOL 4GO8A 2EYTA 2J8HA 4J35A 4TQTA 3ABZA 3E7JA 4QEEA 4NUGL 1US3A 1XVSA 3L7FB 1LTDA 1NBZA 1PWMA 1JCNA 3DUHA 3IXTA 2F2KA 1KTLA 5GIRB 3ZE2B 5F6HJ 5BUAA 4JHWL 4ODBD 3H2AA 4XB8A 1BXNA 4F7TB 1Y6KR 3IS1X 4IU3A 3M1OA 2Y72A 4XVUD 3LEVH 2FLMA 5IUSA 4FQJH 4J28A 1Q0YL 4XMTA 4YLWA 1BOGA 5M95B 3OC5A 1GKRA 4GIOA 3DG7A 4MBRA 3NYZA 3V5KB 4XD5A 3IDIB 1DTNA 3N2BA 2IXVA 2O1AA 2NUYA 1ZV5A 3PBMA 4R90L 1XMEB 5C0BE 4PTUA 1C16A 4D0CA 4X9GA 1TJXA 1S5MA 1TLKA 3QZNA 1IKFL 1OK0A 3UYIA 2C3ZA 3TYFB 2MQ3A 2BSBA 3TX4A 2V2DA 5CCZA 3LNMA 3S5LB 1F7BA 3CYVA 4J3ZA 4OSUH 3B9DA 5IQ9A 1CWVA 3FO0H 3HTWA 1F41A 5CD5D 3G2GA 2ZFAA 1MELA 4FQQB 1B0RA 1G01A 3PBVA 4IBUA 1PTGA 3TKFA 2E6QA 1H1NA 5EU5A 3QJTB 2VE6B 3CPUA 3X12A 3GMOB 4X0VA 2WO5A 3O7UA 4YSCA 4NZ4A 1U92B 4XIMA 2CDFA 1QLRA 3SDDD 3M5YA 3GHBL 4M7JH 4I90A 1R9FA 4P9MH 3DETD 2HKHH 1LQAA 4GMEA 5FW7A 2E5CA 2YPVH 3UBXG 2EDHA 5G5IA 1DTUA 4G1EA 2RBLA 1GCFA 3TYEA 2ICEA 2PCPA 4MMZB 4QR7A 4Z0BH 2VR2A 2DLIA 2GJ6B 3AB0C 2ZX6A 3PJNA 2C9RA 4WGVB 2YC1A 4IF2A 3QJFA 1XH2A 4IJRA 4RV3A 4XAYA 4NNXB 4OFQA 3ARXA 2TRYA 3BIBX 5LHFA 4NERA 4H9YA 4F0KA 3ARQA 1QSFE 2BODX 3INUH 2WBWB 5DELA 4WW2F 1DSFL 4MAUH 3BZ5A 4A66A 2JJVA 3S2AA 1EXHA 3Q1SL 4GAYB 4U1LA 3TLLA 4QRNA 3RJXA 1OCWH 1E30A 3ZYJA 4EQ2A 5LGHH 4PV8A 3TTYA 4H25A 2WXPA 3K1GA 1UB6B 2NNAA 3K5SA 5BCAA 2RCSL 1BWMA 3IFOB 4B7LA 5FL0A 3T0TA 2WN2A 2LV4A 3ZPDA 2FVMA 5D7IB 4Y2WA 1QFWI 2ANUA 4FQIL 2NY2C 3VOGA 4DXVA 4MRCA 4IU2A 2G60L 4FTVB 1E0TA 3P73B 4AYMC 1YPZA 4XNMA 3W0WB 2ZZ3A 2LFEA 2E7LC 5BU6A 4JFPA 3S37H 1TUPA 1OCBA 5AYUL 1FCBA 4J8RA 1QFPA 2VC2H 4YE4H 1TO4A 1OK4A 3BVUA 2X16A 3M6YA 1AZ1A 1FCQA 4QXUH 1QPPA 4KCVA 5ENLA 5DQJA 4N8VA 5FYJH 3GTFA 4N2OA 1U8JB 1TO5A 2F38A 4IOIB 3QUHA 4PUUA 3I4EA 1N2RB 5TNVA 2GVYA 4LSVH 1NP2A 3DBNA 3AUJA 2P5EE 3UZVB 2QQ6A 1U83A 1ZHNA 4XP5L 1F1DA 1XH3B 3C2RA 3NQKA 2DJ4A 1ZT1A 1ORQA 5E4EC 2PP0A 4F8QA 3HRPA 5C2XA 2CKBA 1R6WA 4QTGA 3QUZA 3ARWA 3EOBA 1RJPA 4XNDA 2YEVB 1QMUA 1N5YH 5CPMA 4HAGA 3GPEA 3CC5B 3NDYE 3QKEA 3BFQG 2DS4A 5C0BB 2FWUA 2Z4QB 4KUZL 2BGSA 3ZZ1A 1MFAH 3S36H 4XCNA 2E8YA 4UOQA 1XGRA 2PE4A 1QNZH 1RZPA 1AH4A 3NQFA 4HB7A 3WIFB 1KTCA 3C6LB 2G5WA 2XVNA 3IS4A 5C2BH 4BCXA 5J6GA 5FXCH 4AF0B 4JNMA 2ZUWA 4AIOA 3KH4A 3OKKB 4DAIA 3HMWH 5JXEC 3FN3A 1MCPL 3NZPA 4RGNE 3AU2A 2OJEB 1PNDA 4BFKA 1NAMB 2BCKA 3TN0B 3LGDA 2O9TA 4S23A 5DXYA 3APFA 3R1GL 4AEFA 4DWSC 1LRQA 4Y2DB 5KAQF 1R34A 1A1MA 1E5JA 2EH7H 2P24A 4PS3A 4XBJA 3WH5A 4Y2OA 1AZ2A 5FCSH 1P4BH 1HJWA 5K1JA 4BE5A 3OO2A 4JX5A 3L4YA 4IISA 3GJEA 4HWBL 4RGMC 5MP6H 2NQ9A 1F5ZA 4ODSL 4GSXA 5F7AA 3DNKA 1QPRA 1AZVA 1GZ1A 4HCLA 2FGLA 2IGLA 1NMCC 1M9WA 2RGSA 2J62A 3PGFL 2PDPA 3GFZA 2FX8L 3HZMA 4P2YA 4ZDHA 1A5CA 2QCHA 5IM51 3WLOA 4XWGL 1SSDA 4REQB 4CNIA 4TV5A 4JDZA 4ZB2A 1NBVL 5F4WA 2UUDH 3SE3A 1HYSC 3TZVC 4XH2B 1VPOL 4GT7A 1LEKA 3NIDE 2HK1A 2BGNE 3QEUB 3OZKA 3PS7A 4NJKA 3HNVL 3ETBJ 1MY7A 5CP3A 5DRNB 1RSFA 4CL7A 2POTA 3FONA 5I79A 5FYJD 3ZIMA 1PKYA 3V5FA 2CALA 2WOYA 1LE5B 1I60A 4HK5A 2Z31C 5DCDA 3CWOX 3OAZK 5HGDB 4ECNA 2WUCL 1M56B 4C6CA 1BEXA 4RDVA 2KZHA 1F4HA 4LNYA 1UCWA 1EP3A 2AQSA 3P0YH 2XG4A 4LLQA 2GVLA 4H01A 4J1UA 1KB5L 1GOXA 3A6CH 1ULVA 4RLIA 2DM3A 1NU5A 3AS3A 4OZHA 3VRJB 1KFBA 2OGJA 1UZ8A 5D1XE 3U2ZA 3R06A 3WMBA 5A2CA 1KTKE 4U1HB 2WINB 3HA1A 4ES8A 1E0OB 2DWXA 5I1JH 3BIKA 3FAXA 5EMLA 5BS0A 5I19L 3US9A 2DT2A 2H8ZA 3ZT6A 2Q8AL 5CH9A 5FSDC 3EG9A 3ZO0A 3JYBA 2NYKA 2VUYA 3UC2A 4PVLA 1NFDE 4HIEA 5DHEA 4DAGL 1PYWB 2EXWC 2QZ5A 3EGDA 2B2XL 4DELA 4JQVC 5F4XA 5LKYA 2BWIA 3UU0A 4YHKH 2VENA 3ID7A 1VLXA 1VH7A 3CVCA 4M3KB 3ZSSA 2HKFH 2IAMB 4XTRD 4BK9A 4UBDD 3FFCB 4M56A 3SHSA 4BE6A 4LH8A 3LKOA 1FHDA 2IANB 5DZVA 3D06A 2CPUA 2NSMA 4Y4HD 5DC0A 4XPAH 3VXMB 3MZGB 3NCBB 2GITA 4JN8A 2AQWA 3CO4A 1QFUH 1JPEA 3NQGA 3BZFA 3ZMRA 1Q6LA 1C90A 1PG7X 3V75A 4XVJL 5EOQL 4JRYB 3L6FA 2WSYA 3CQ0A 4YHLH 3AUVA 1JBJA 3RZCC 1LO2L 1QLEL 1IFHH 1BVNP 4DJEC 4QOKD 4GH7B 3TJXA 3WXVL 1E6QM 4PRHA 2XHYA 5LQBL 1BAWA 2BSTA 1RZIB 4XRCA 1A65A 3TCLB 2A3HA 4TQIA 3ARPA 1KEGL 4DKAA 5JQIB 3QC6X 4BZ1H 4AXWA 2KUTA 5KS9A 2HTKD 1YTEA 4HETA 3MXWH 4DKFL 3LLDA 3GDTA 5DGRA 4I9TA 1QP1A 3SJVB 4S3KA 3T4YA 3JU2A 1FNAA 3GNDA 4WOQA 3FAWA 4OLVL 4N2DA 2AQOA 4X6FB 5T1MA 2CBTA 1X4ZA 3B9KD 3DX8A 1HOCB 5C0EB 1Q6FA 2OLAA 2C9QA 3MOAH 2WB5A 4ADSA 1R86A 3L1OH 2R69L 3AM8C 2IV8A 2IALB 3CHSA 3SDAA 3MCG1 2A73B 4XN4A 4B50A 4JFWA 1OANA 2W0FA 4PRID 1AD9A 4MWAD 4XP1H 3OA3A 2DWDA 1QJWA 4TS6A 1MH5A 1HJBC 1QK0A 1G9NL 1GZQB 4M1CD 4P5TD 4A2GA 3G0UA 3K71A 2FX9H 3QXVA 4XUYA 4JDEB 1S9WA 1S7WB 3BAWA 4AG0A 2VDKH 4A7TA 4HC1L 3HE7D 3LN9A 2HJFB 4G2AA 1BBJB 3CVHH 4ZUWA 2BXZA 4IIGA 3PNUA 3GS7A 1I8KB 2AERT 1WXYA 3M7FB 2IQAA 3QULA 4Y90A 3QORC 4HJ0D 3TXVA 3WJWA 3PQYE 5ALCH 4WHDA 5IB3B 3QGVA 3BMXA 3KPSA 4UXDA 4RMRA 4OJFL 4IMGA 1EEPA 2HB0A 1R9ZA 3ITYA 3WD4A 1SJEA 2Z93B 4U1IB 2FYYB 4HGXA 5FD0A 2EZ0D 1FE8H 5FYKU 4Y9AA 4A7VA 2J44A 1LT7A 2EDDA 5LGJA 3S3PA 2POZA 5LNSA 4XQ6A 3FYIB 4PGBB 2AV1B 2CG9X 5IBUB 4PTNA 2XZCL 2H6PB 5TPWL 3NK3A 3BT2H 3DI1A 3VVVA 4NIYE 3SJNA 1CFNA 2ZCGA 3IGUA 5CWSB 4B9GA 2VLMD 5T1KD 3AFLA 3HIJA 4AYDC 5DY2A 3VAVA 5I3FA 2UXGA 5D1ZC 1XYCA 4X6EA 1Z89A 4FX8A 4BQ8A 5L4MA 2YDQA 2MNRA 1PDZA 4GQBA 4KT2A 1S38A 2ALDA 2CRYA 4M62L 5KEZA 1VADB 3CUGA 4H8NA 2EIZA 2RAMA 3P4OA 2DTSA 4K0OA 3RNQB 4NQQA 5DD5H 3BKMH 1ZUAX 3L5WA 1XGUA 1C9SA 4X8GA 3JVAA 3O2VL 4ODWA 3PDOA 3ZTNH 2DQDH 5FKAA 4TPRH 5GSVB 3O3BA 1IC1A 1IVLA 5L88H 4AY8A 3NEOA 3NTCL 2CZVA 4PAZA 1S1PA 1J0JA 1ADOA 5LUMA 1FFOB 2WV8A 4H00A 4YFDB 2BIQA 3DDGA 3MJYA 3W2DH 2XRAH 4L18A 1IBGH 2YMXH 4CGTA 3EOTL 5CGQA 4KMQA 2DQEH 4JFDE 4US5D 3ZE1F 1KBJA 5L2KA 4K3HA 4TX8A 1KQZA 1FJ1B 2A9AA 3F7JA 1LK3H 3TA3B 2O5ZH 3S88H 3ESMA 4M43H 1XLFA 5F7NC 3CH8A 1G7QB 3UC0H 2JGYA 3QRLA 3DJTA 2GIXA 1S2UA 1D7KA 1RHHA 3NP3A 4NQED 2R9RA 1KBKA 4BELD 1EEXA 2NV2A 5EIQA 3EMZA 3LRLA 5DXWA 3FLUA 3MLZL 3B2VH 1N6VA 2WPGA 4G6FB 2PYEA 4GVFA 4H26A 3FBQA 4WFHE 1WWAX 2ILLA 2LU4A 3KVKA 5A5WA 1A4KA 3BKJL 4KKBC 3S96B 1VPXA 1IEBB 2Y7LA 4Q4MA 3I85A 2I60L 4V33A 2VZ3A 3VNYA 1YNTA 7ODCA 4KKZA 3OKEA 4MZ3A 4Q2ZA 4LHQB 3QXUA 4K3EH 2APVA 2QJGA 4LCYA 3C09B 3O8XC 1IQWH 1OYAA 3NFNB 7FABH 1IZCA 1UUQA 2IWEA 1N0LA 1RIVH 3HJZA 1PKLA 4IHOB 3DFHA 4HFUL 1RZ8A 4H8UA 2R14A 1NDTA 3LTYA 4LAOA 5F3HA 5G2IA 1S5VA 3RVUD 3U2SB 2Z1VA 2NPLX 4Y19B 35C8L 4EI5D 4JGMA 5INCB 1DLHA 3K4ZA 2ATPA 2EPHA 2K4AA 4PL1A 3BSZL 4PW9A 4LASH 3HBPA 1CMOA 2ZSVA 4NKMB 1E9QA 2NX5D 2OAAA 5J1AA 3H23A 4HIIA 4HWZB 4GACA 4G7SB 3INOA 4H6EA 3CASA 4UZGA 4QRSA 4Z7AA 3I84A 4PH6A 3VXUD 1PQZB 2WSRA 2HRPH 2V2TB 3KPMB 1CDHA 2A99A 3RWJB 4TVDA 3VXPB 3LB0A 3Q2DA 3VWJD 3QC0A 1EBHA 2Y5TA 4NQDA 4D0DB 4PJXA 1XHHA 4O1DA 5AOIA 1ITCA 2WCPA 4XBGA 3K13A 3V9EA 1FWBC 2CZ5A 5MKGA 5T1JA 3RVTD 2BRRL 4UQIM 5GRUH 3ZTJH 1FXPA 3N4AA 1K1DA 4UQ2A 2X4SB 4M6MH 1A7BA 2GSJA 8CGTA 3S1WA 4KXDA 4F48A 1E50A 4Z77B 1QFWL 3CK0H 4MJIE 2O6FA 5E93A 5M2FX 4GI6A 1D5MB 5CNHA 5FOJA 3L81A 4L8SC 4PP2A 3D0VB 5KVGL 3PWPB 1HQRB 3CZEA 1OAUH 5FR3A 1FORL 4BWWA 3TTQA 1TT6A 4ZENA 1L0QA 5I1GH 1UCTA 3KL5A 3IN2A 2QVKA 3BN3B 5D7JC 1ANUA 4P23B 1XTMA 2BNQA 3CH9A 3GQYA 2DV6A 3TV3L 5IBXC 5DT7A 4EXPX 2J5LB 1O66A 1SXCA 1H0GA 2NXZB 3PPEA 1NCCL 3L13A 5BW6A 4MWFB 4Y5XB 2P80D 1GZPA 4IIHA 1PZ5A 6PCYA 4YHIA 5ABGA 4MLSA 2CUIA 4S1SH 3GK8H 5DK0B 4FZIA 3VABA 3G1XA 4O19A 1UACL 4YHOL 2RB8A 4OBRA 3B8DA 5AB1A 4JG1H 4WV1A 2R23B 4KRPB 3MVIA 4Y8EA 5SWSE 1XLMA 4Q6KA 3GVQA 3WSUA 4NDMA 3TBSA 1T2QH 2WBKA 5E8DL 2QQKL 1I1AD 2P42B 3WMSA 2JJTC 4ZO9A 3IJIA 4DVBB 2A9BA 1QHPA 2EXYD 3NCMA 3GIVB 1RXOB 3VFOA 4NJAH 4KJYA 2H6OA 3VCLB 2OL3A 5TAOA 4OZGF 3VD2A 5B1JA 4JTRA 3EDKA 3P3TA 3O11B 5EDSA 4I1RA 1X8FA 1LLWA 3MYOA 1IGCL 4XXCC 5AAPA 1E1CB 3Q8AA 3W2JA 3WY3A 2R24A 1XDTT 4ZS7H 4H83A 4OQ1A 1I45A 2C3GA 3IGXA 3FCTB 4L37A 3N85H 3VGHA 3B40A 3S3GA 2Q8XA 4LOVA 3TN5A 1B0IA 3ZMEA 3IRDA 2ZXBA 1OP4A 1C1EH 3D09A 2J88L 1T41A 5CJ8A 4HHLA 2AXFA 1VHPA 3MRLA 4RZ5A 2G97A 2OPCA 4AYSA 4RAUA 4MDIA 2XU2A 2A1YA 2ZCKL 1PF3A 3QJUB 3SGKA 2X42A 4GH3A 4YHYC 1BECA 3SO3C 4MCMA 3BGJA 1NPNA 2PXYD 4H9ZA 3Q1EA 4HVBA 2AK4A 3RDKA 3TONA 1OTUD 3QQ1A 1G1KA 3BAEH 1G7JB 1HDMA 2ZYHA 1DQJB 3CHEA 1RJLB 3KGSA 5DQDL 3KS6A 3VGAB 4I5XA 1FF5A 1SPDA 3H8NA 1U8LA 5DRZB 4DZHA 2FO8A 2QCFA 4E2DA 3E1F1 3LNDA 5I1DB 3R13A 2GQHA 4WY0F 4RFEB 2PP1A 4A3QA 5BQDA 3P0VH 3KBFA 3MI3A 5J12B 3VOHA 1EJXC 4HIJA 2I5YL 2IKGA 3UNTA 4PJBF 4W5UA 2FQFA 5JHLA 3QEGH 2DL2A 3X1NA 5BOEA 4YSDA 2ZUUA 3T6WA 2APXA 3TEUA 1TJHL 1PZSA 2VNCA 1ROCA 1KELH 2V2XB 2NOYA 5KSAD 3SE8H 1B4JL 4EN3B 3II3A 3CMGA 1K6WA 3DKJA 1IILE 4N2HA 1IWPA 2HWZL 1G0YR 4P99A 3UT0A 5ICZA 2VISA 2YAEA 4WWKA 4MS8D 4LLYB 2BSDA 3SKMB 4AD5A 3W5MA 1E15A 4YO0A 2QDWA 1WUNT 4PI0A 3H2EA 1AR1D 5D7SL 3GKFA 4OUOA 5GJTL 5F2LA 1I4FB 2CNYA 3WO4B 3R25A 3WQ5A 2OW6A 3LPOA 1W0WB 3EOOA 1QG3A 3FOLB 1WXZA 3QV9A 4O11A 5DJDA 4FFVD 4IQJA 2GSIA 2JKIS 4OIIH 5SWSB 2J7BA 1P6BA 1MRFH 4PS8A 5DHVH 2AL1A 4YAQA 3BQ5A 4EDWL 2JIWA 2O6DA 5GRVL 1F6YA 4OZ4A 1YJDL 4H5SB 5DWUL 3JZEA 2ZBTA 2CIKB 4ODVH 3HHMA 1MCNA 2NXIA 4OM1H 1NOWA 4K73A 1YEKL 1HG3A 2Q3XA 4K8RL 4N2MA 3FXYA 3H2OA 2QUTA 4ZUSA 1RUQH 2VLJE 4QHPA 1OSEA 2ZWNA 1J6OA 3KWUA 1E71M 2QUVA 3H7LA 4LLMA 2R2HB 3C2FA 1UZGA 2XG5B 4YSTA 3D48R 4O12A 1X6NA 4H3DA 1S7QB 2KI6A 4HPJA 3ITGA 1ZAHA 1E6PA 3V35A 2Q10A 1WWBX 3FO2B 3MUY1 1N26A 5D7LA 4PRAA 4PV9B 1J2BA 3MRCA 1YIXA 7XIMA 3V8OA 1I9JH 5FFGA 1AL7A 5BRZD 4K71B 1VFBA 1U3JA 4D71A 3QJXA 4XN8A 4LF3B 5HATA 2QKIB 4PG9B 3QHZH 3X1BA 2GKIA 4I0PD 2XZZA 4E3TA 1AO7A 3VYNA 2Y07L 1T1WA 2FX7H 1NJ9B 2E7FA 4HJJL 4UZUA 1OW0A 1GQIA 3UYRL 4R7NA 1WFTA 4Y16A 4UDUA 1AS6A 1NCUA 1QRND 5DVKA 3N1PC 4MVAA 2NRDA 1CLCA 2BY2A 1DL7H 1J1PH 2VDLH 1KJMA 4LEXL 3A4JA 3GSOA 1MHEA 2DZEA 4Z78A 3FEQA 3L3DA 1QCWA 4PJ7F 5C9KA 4EIUA 2BVOB 3GR4A 2EPLX 1ERNA 2LOEA 2XSAA 1X5MA 3KZSA 4WTZA 4PMEA 4GG6E 3NRFA 3ABRA 1ZLVH 3F5LA 5HJ3A 2V7HB 4NFDA 4XBMA 3C8HA 5E2WH 1O9WA 2X7LB 3H0TB 3LQZA 5DVLA 3F7PC 4PJHA 1NGXB 2CH8A 3QIUC 1XR9B 3V0FA 4F8PA 2OTUB 4PMNA 2XUWA 3CEUA 2F7PA 4FL4C 5C08E 3QUYC 5JA9A 2DLFH 1XF3B 3OX8A 2V5KA 2YBRA 4RMQA 3RKPA 1IC4H 3IJ8A 4ZQTA 4AJYV 1VD6A 4NZCA 2Q7NA 2C1OA 3C5JA 1U36A 3M5XA 5D4QA 5JMOC 4FF7A 3HS0C 1GQJA 1XSIA 3T0XA 1KY7A 2CJUH 1MJ7H 3CQPA 4NU7A 3USZA 2HFFA 3QP3A 4JFHE 3KE0A 4IRSC 3VPLA 1F9CA 4LEOA 5BV7L 3A4DA 1GA2A 3PV7A 1ESWA 4FLRA 3EX1A 4A7QA 3KXFD 4GBXB 5LO7A 1KN4H 3ILPB 5ESAB 2X5PA 4HA1A 3IDXH 4OZFH 1N8ZA 3P2BA 1MHCA 3KPQB 4P46D 4GXMA 1T5WA 1TWDA 5CAYB 2ESCA 1GKOA 4PGDB 1N9PA 3TWAA 3MV8A 3F4VA 3W11C 4E9SA 1CFMA 2PTZA 4O5LH 4FYQA 3ARGB 3QDGE 2IS7A 2Y6SD 4RX4D 1DQVA 2NUXA 3NRQA 4L4VE 1M3JA 3QR2A 4IRJA 2Z64C 3VOIA 2QADC 4GLRI 2RJMA 1BXBA 4CNUA 1FC1A 5FO7A 4M6QA 1TTQA 2CLRA 1K4CB 2VQ4A 5JBDA 3L4VA 4GQ9L 4D9PA 3KHOA 5I28A 3UTSD 2JEQA 1D6VH 1K6QL 3K2GA 1T1ZA 1UG6A 3BLLA 5G55A 2X6AA 5IQNA 4N6RA 3N44B 4D6EA 1ZS8A 1NTDA 3OGVA 1BD2A 2C1PB 3ZDZF 2FWOB 4ELMA 8FABA 5FFOA 1X5FA 3V4VL 4Y1SA 5M7QA 3EKGA 1EAPA 4R27A 1HI6A 2HPTA 2Q1EA 1L7TH 4CC4C 4MFEA 2K0RA 1ASQA 5B1AB 1HFUA 2FO1A 4ZTXA 1I53A 5H94A 5DU7A 3AU1A 4LDLB 2PDMA 4QAIA 3WN5C 1W17A 2DSKA 1YNYA 3A22A 1R0AL 3QLLA 3SDCC 1WHPA 4O1EA 3R8BB 4YEFA 2OM5A 4WI2A 4NQCE 1ZHBA 1CWYA 4QRUB 4W6WB 4IOFC 1BYAA 3FV9A 4EP8C 2N3JA 1FWGC 5AOLA 1G9MC 2VQTA 3VSVA 3MHUA 4N5ED 1W72A 1AFVH 3L0NA 3BZDA 1G4SA 4Q8OA 2YD9A 3SKUD 1C5CL 2A2IA 1BA9A 1FKXA 4DJFA 3EBIA 2EO1A 3BWWA 4WFGD 4J2PA 3D25B 4Z7WE 3GZQA 5LGYA 1WO2A 4MZYA 4Z8FL 1L2UA 1THCA 3JWNH 4DZ8A 3O8AA 2WQXA 4YXKL 5IVXA 3NGFA 2CRIA 5A95A 3APDA 1PZ1A 1GSKA 3RA7H 3MHZA 5LN8A 1TZ8A 1G87A 5C0GA 4MJ5A 1R5VB 5HDLA 1MQQA 1QEWB 4KHXL 1INEH 3OPZL 2HT3D 2W65A 2PO6A 1F8MA 4PJDE 1KR0A 3L9EA 2EDXA 4Z18A 2KZWA 3WUWB 4XC1L 2H3NB 4XX1E 3QJOA 4JUTA 1ACZA 3ZE2E 4MY8A 2KLSA 1BM3H 3UPRB 2O4MA 2JCCF 4QSFA 3KDPB 1A9EA 1R24B 3EDJA 5I1CL 5AY7A 2WXDM 4O1FA 2BSEA 1KIRA 1ND0A 4LYKA 2AQRA 4LK4A 3EIFA 1JS4A 4M1DH 3TESA 3BGFC 5I0VA 1CFVH 1FBIH 2DPKA 4W1TA 3GSXA 5TJWK 3GM8A 5HYQB 4Z7VE 1T5KA 1F05A 1FV1A 1RFDL 1CE6B 2WVSA 2X6VA 2K1MA 1SEBA 3RI5F 2BFVL 3ABXA 5K3VA 3QE5A 3RUGA 3RWHB 2QMKA 1M1SA 2A7PA 1BD0A 1ZAIA 5IFTA 1Z3NA 4QHMB 4GRMB 1KDIA 3XISA 3VOJA 1OSPH 2UY5A 3QUXA 3PZNA 1KKRA 3LB6D 5BXRA 1K72A 2J75A 2BZCA 2ZZUT 3QR3A 3V0DA 1AGCA 2H3KA 3PWUA 4PJ8A 3OXRB 4JDYA 2KZ1B 3VILA 3EMCA 5KSBA 1IAKA 3KDMA 3DMMA 3S6CA 3DPBB 4Z76A 2RH0A 1OJXA 4IUGA 1W1YA 5H1WA 1JTPA 1DUZA 2OMVB 4K1GA 2A4AA 4P57B 3WQFA 5IBLD 3D3FA 5CCHE 2W60B 1BVLB 4AD3A 3MLSH 4XXDB 1IJ9A 5GGSY 3FQNB 4P2OB 2GJ6E 4NZ8A 2I9UA 2R1MA 2D7QA 4YSSA 1SU5A 3CTLA 3EYVA 4XP9H 3TEWA 1YAZA 3AREB 1FZJA 4R7OA 4FI8A 4IBLT 3ATYA 3GMPA 2CKBH 5IFJB 2YN5A 4Z5RA 3THML 3B2UD 5C0DA 4V1DA 3CWGA 2W8CA 4N0FA 1TVBA 5DA4A 4HISA 4O4YH 2VXSH 4W87A 5G5DB 2B20A 1XG3A 3V4PA 2H6RA 3LHUA 5AKQA 4N0UA 3MBWB 2GFBB 2A9NL 2R15A 4R7DA 3FYOA 1MWAB 5F89B 2DY3A 2I17A 2JJUA 3ZW3A 2CYGA 1MMFA 4GVIA 4NUPA 3DFOA 1KC5H 3D50A 4FXGA 2G0WA 4C6BA 5I1KH 4AIEA 1TPUA 5IFAL 3OJDA 1HX0A 4QCEA 1JZFA 1WA1X 3I6SA 1IE4A 3EUDA 3PXJA 3D33A 1IAMA 5BZXA 6FABL 5D7IE 3F5WA 3VFNA 1GUVA 2NV9A 1RZ7L 43C9B 4FG6D 1BFVL 1SYVA 4FTVE 4BK5C 3EGJA 1LEIB 1BRLB 3GMLB 4JVPA 1AANA 2XIOA 4XCYA 3W0WE 2EXOA 5IM7B 3ETSA 5JU6A 4V2CB 1J5TA 3KOWA 1TV4A 3URAA 1TVHA