2C8NA

The structure of a family 51 arabinofuranosidase, araf51, from clostridium thermocellum in complex with 1,3-linked arabinoside of xylobiose.
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
501
structure length
501
Chain Sequence
KKARMTVDKDYKIAEIDKRIYGSFVEHLGRAVYDGLYQPGNSKSDEDGFRKDVIELVKELNVPIIRYPGGNFVSNYFWEDGVGPVEDRPRRLDLAWKSIEPNQVGINEFAKWCKKVNAEIMMAVNLGTRGISDACNLLEYCNHPGGSKYSDMRIKHGVKEPHNIKVWCLGNAMDGPWQVGHKTMDEYGRIAEETARAMKMIDPSIELVACGSSSKDMPTFPQWEATVLDYAYDYVDYISLHQYYGNKENDTADFLAKSDDLDDFIRSVIATCDYIKAKKRSKKDIYLSFDEWNVWYHSNNEDANIMQNEPWRIAPPLLEDIYTFEDALLVGLMLITLMKHADRIKIACLAQLINVIAPIVTERNGGAAWRQTIFYPFMHASKYGRGIVLQPVINSPLHDTSKHEDVTDIESVAIYNEEKEEVTIFAVNRNIHEDIVLVSDVRGMKDYRLLEHIVLEHQDLKIRNSVNGEEVYPKNSDKSSFDDGILTSMLRRASWNVIRIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insight Into the Ligand Specificity of a Thermostable Family 51 Arabinofuranosidase, Araf51, from Clostridium Thermocellum.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
molecule keywords ALPHA-L-ARABINOFURANOSIDASE
total genus 171
structure length 501
sequence length 501
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.2.1.55: Non-reducing end alpha-L-arabinofuranosidase.
pdb deposition date 2005-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06964 Alpha-L-AF_C Alpha-L-arabinofuranosidase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 2c8nA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2c8nA02
1PJ9A 3MMUA 1MWOA 3T0BA 3I3DA 4PCTA 1D2KA 1OGSA 3UR8A 2VX7A 1V6VA 2YA2A 3GM8A 1BYCA 1QBBA 1V0KA 4JHOA 5E70A 3EJPA 4XB3A 2BS9A 4UFHA 3BAWA 3AFBA 1WDQA 2UY4A 3ARQA 1ISZA 1I1XA 2DSZA 4PMDA 3AIQA 3MMWA 1JZ4A 3HG5A 3OLGA 3CUGA 2PWHA 4B9ZA 1VEOA 3TV8A 1Q6EA 1C8XA 4BA0A 3MMDA 4YN5A 3LPPA 4FK9A 2YBUA 4BZYA 4JFWA 1M03A 1UZ4A 4TVUA 5FL1A 1PBGA 4D6HA 2WWCA 2VNCA 4NSBA 4W8LA 3WH6A 4FNQA 1GOKA 1M53A 3SIMA 3CUFA 2DT1A 2O9RA 3NJ3A 3GXTA 3BAXA 1PX8A 3N18A 1QNRA 1NWRA 1SMDA 4AYGA 3VNYA 3OB8A 2YFNA 1CXEA 3OLEA 1R47A 1TE1A 1E15A 2DT0A 3ALGA 2A3EA 3VINA 1GHRA 1HKKA 4E8DA 2GK1A 3PZTA 2J7EA 1HVQA 1OWQA 2BY1A 2BHUA 3OBAA 5FL0A 1ODZA 1UWUA 4CU8A 2WK2A 5A2BA 1ODUA 4CUCA 3CZGA 1TQTA 5DMYA 1C91A 1JIBA 2W5FA 3EMQA 1SZNA 2YA1A 1W3KA 2G3JA 3UEQA 4MB5A 1XSIA 3QHOA 2XIIA 2BVYA 1J0KA 3S5ZA 3ZJ7A 2G3NA 2FHBA 1E0VA 3OLIA 3WQVA 1JGIA 2DSKA 3B9DA 3ZJKA 4EE9A 2ZUTA 3WQWA 1CGVA 2XFYA 2OWCA 1WZLA 1HF6A 4CKQA 3CHCA 4EANA 2VURA 1Q4NX 3VD3A 1R46A 1ZS2A 4CN6A 1QNPA 4WIWA 4CU6A 3AMLA 4W8AA 1H5VA 1GOIA 4LQ1A 4DWSD 4OJYA 4MPKA 1J0YA 1UH4A 4FMVA 3GTNA 1PX3A 5FIPA 5A8MA 3VU2A 3N11A 4XZWA 3A23A 3HG2A 4MB3A 3WEOA 2X0YA 4XX6A 3WNOA 3DX2A 4W89A 1ECEA 1HXJA 3L4ZA 3WMSA 1E4LA 3TOPA 5D8WA 1HJQA 3KL0A 3TTYA 4UOZA 1FH7A 1XD0A 2J8FA 4F66A 1KR1A 1XYZA 1ZBWA 2VR5A 3N04A 4UR9A 2JF7A 1HWWA 2VR4A 3W28A 3VVGA 4PUEA 1J0ZA 1LL6A 4W7VA 3WDIA 3N1AA 4ZFMA 2J7HA 4M81A 3RIKA 1NARA 4OBRA 2CHNA 2CIPA 3D51A 2OSYA 1AMYA 5IHRA 2FDMA 5M3WA 1XH1A 4HP5A 3K4DA 2OW6A 4JFSA 1UKQA 4URIA 2J7BA 4W93A 4MNKA 3VDHA 5JUVA 4C7DA 4M29A 5IDIA 1J0IA 3UR7A 1EIBA 2V3GA 3MUY1 1Y7VA 2X2YA 4RL3A 1QHOA 1KR0A 1UD5A 4GO8A 1CIUA 1G5AA 3U7VA 3ZT7A 1AVAA 1MQQA 3FHQA 3W26A 3NDZA 2FH6A 2PB1A 4H8UA 3BMVA 4AZ5A 1PPIA 3SCUA 2WLZA 4A3HA 3AIWA 2FH8A 4UQDA 4JFTA 3BLPX 4TX6A 4NZFA 3SCRA 4DUWA 3CIVA 1GUVA 2PBGA 4NRRA 3THDA 1XD1A 1ESWA 3WD0A 2XJ7A 1NH6A 1TG7A 2GJPA 1B3VA 4C7FA 4D6DA 3VM5A 2CBUA 2XVPA 2E9LA 2UWFA 2BV9A 2VTFA 4D6CA 1CWYA 4H8HA 3WH5A 1XSJA 2WANA 1MQRA 1QI0A 1QW9A 3DX0A 4ML4A 1Q6GA 4WLCA 1V3LA 3ZT6A 3L4UA 4BQ5A 3IJ9A 2O9TA 4WKHA 1V6XA 3LPFA 1W9XA 1KXQA 1US2A 1JG9A 2NSXA 1V3IA 4QP0A 4WJXA 4KGJA 1EOMA 3ARXA 1DTUA 4ACZB 5I3DA 1X1NA 2VMFA 1PS3A 4ACYA 3L4TA 3SCWA 3PZGA 4BF7A 2BNJA 4AIEA 3W81A 3VSVA 1GJWA 2ZIDA 3II1A 1OB0A 5JIWA 2F8QA 3WF3A 1CTNA 4W7UA 5IFPA 1MXDA 5HDRA 2ZICA 2YDRA 4W5ZA 1HJUA 4AZBA 1W1VA 5A6KA 3BUPA 4C7GA 1KXVA 2OYMA 1JAKA 2DH2A 5CXPA 4WKAA 4LX4A 3LX9A 2F7PA 1GORA 3VSTA 1KBBA 3AXIA 3VDAA 1IZJA 2ZXQA 1CGUA 1BFNA 1DWJM 4UZSA 2VOTA 3I3EA 2OLHA 4P7RA 2J4GA 4AD1A 4CCCA 1JYVA 3F5JA 3K4AA 2XVGA 1E4MM 4OGZA 3HJEA 4GPNA 4IISA 2XSAA 4GQRA 1R33A 3RCNA 1K9TA 4D6FA 5C70A 2IXUA 2J25A 2Y8KA 1B3XA 5E0CA 3EJTA 2XN0A 1BYBA 2ZX7A 3WFLA 1GQLA 2WPGA 4GIAA 1QPKA 1VENA 2FHFA 4DUVA 1UR0A 4M24A 3WBEA 4N42A 4W5UA 1HIZA 1C3FA 1W1TA 4AW7A 4U5IA 4CD5A 4NF7A 1DWAM 1WDPA 4BQ2A 2V5CA 1CXHA 5E6ZA 4UQ9A 1CPUA 1VEPA 1BAGA 1D7FA 3GNPA 2WNWA 4M56A 4P7QA 3OG2A 1HT6A 1B90A 4DO4A 4MNJA 2CKSA 4UFLA 1PZ3A 1OCQA 1V3HA 3GXNA 2ZXBA 1VIWA 2VCAA 2YOCA 5DO8A 1ITCA 2JIEA 4NZJA 1R34A 3CUJA 2JEPA 1N82A 5EBAA 4J3XA 2WHJA 2YDSA 3AIRA 2VO5A 4P8UA 3CZKA 5HXMA 4QAWA 4GZEA 1AQMA 4W87A 3MSDA 5A8NA 3RPMA 4H2CA 3KL3A 4UOQA 1KQYA 1UD3A 4A4AA 3UCQA 2DIEA 4JFVA 3S2CA 3MO4A 4GZIA 4KMQA 3MSGA 1GNXA 3VM7A 4AZHA 2X09A 1YQ2A 1UOKA 2BY2A 1JZ3A 3VDBA 5C71A 1OD8A 4W86A 1EDTA 1JF5A 1SFSA 1LG1A 3AS0A 2X2JA 4AD2A 5GNZA 3LMYA 3N9KA 1KGWA 2X1IA 3G6LA 2O9PA 2E9MA 4OZOA 3W82A 3EYPA 1JZ6A 1EOKA 1E3ZA 1BHGA 1US3A 4OOUA 4FLSA 3AICA 5IFTA 5LYRA 1L0PA 3DX3A 2D22A 4JKMA 3HZ3A 4U31A 3PZUA 5EB8A 4CCDA 5JBDA 4ZE5A 1H2JA 3SCOA 3VUPA 4BS0A 2WLYA 1JZ2A 4PBGA 4HA3A 3LPOA 3AYSA 4DWSB 4V28A 3WKZA 1W9BM 1VJZA 3A21A 5IHSA 1CECA 3VGEA 4PMOA 2A3HA 1CGTA 3DDGA 3CO4A 1UYQA 3AMKA 3IAPA 4DM2A 1UA7A 1E1FA 1RP8A 1C8QA 1E4IA 1JDAA 3NSMA 3CBWA 2E3ZA 3PTKA 3BVXA 5BRQA 1KB3A 4TUFA 5CGTA 1R8LA 4E8CA 1VFOA 3BAYA 3NSXA 5CJ5A 2PI6A 1W91A 3PZNA 3WH7A 3QOKA 1TA3A 1UA3A 3SCVA 3EMCA 2VZOA 4Z2HA 3OLDA 1G9HA 4UQAA 2D24A 2QPUA 3O2LA 3EBVA 2WZEA 2ZXAA 4FNTA 1FA2A 2YL6A 3MI6A 3ZR6A 1DP0A 1MYRA 2D0GA 1HKJA 5A6AA 1Q6DA 5A69A 1UR8A 3VPLA 2E9BA 1CXIA 2VQTA 1W9DM 3BVUA 1JYWA 3FAXA 2VVSA 2X05A 1WZKA 3I3BA 3HG3A 2D3NA 1TVNA 1U30A 5JBFA 2WSPA 1E3XA 2YLAA 2E8ZA 5GQBA 3GBEA 3B9EA 1QI4A 5E1QA 3JUGA 3CGTA 3APGA 2WKGA 3QR3A 2WVVB 1HXKA 4FLRA 1R86A 1W9PA 4PCSA 2GJXB 1UR1A 1D3CA 1H0GA 2WHLA 1HL8A 3IJ8A 1PIFA 4U2YA 4Q7NA 3EDFA 2QF8A 1P6WA 4Z2GA 2PWDA 3DYPA 3BMWA 3WQ5A 4JL1A 2OSXA 1H09A 4AD3A 1E9LA 4HTYA 2YBTA 4H8VA 4Q22A 5LA0A 1XCXA 4TXEA 2XYLA 3PZVA 2J74A 2CXGA 4KRTA 2OYKA 1W1YA 4CCEA 4JL2A 3M7SA 1EDQA 4AMWA 2J7GA 5JIPA 1TQWA 3LRKA 2A3CA 2W67A 1M7XA 4PMQA 3AXXA 1FP9A 3ZQ9A 4AC1X 2G4FA 1BVZA 3K8MA 3UERA 2DH3A 2QPSA 4NX0A 2J7FA 5BXRA 2UY3A 3AMCA 2XVKA 5M03A 1F4HA 3AQUA 4CN4A 2VC9A 1E6ZA 4EKJA 1HKMA 4TVDA 3HMCA 1BYDA 2AAAA 1OSEA 1MFVA 1JAEA 3WF1A 2XSBA 1WKYA 1VBRA 3AI0A 4HA1A 4BCEA 3S6TA 3T09A 4JKLA 2XHYA 3CMJA 2WCAA 4AMCA 1E0XA 2X0HA 1HNYA 2Y24A 4UFKA 3HG4A 2XN1A 1VEMA 5ABHA 1V6WA 3VIFA 3EMZA 4OOZA 3BC9A 3VGFA 2WZHA 3VIKA 2XWEA 3WL1A 2BY0A 1R7OA 5HPOA 3KLKA 1UD2A 1CLXA 1JDDA 2WW5A 1B3YA 4DO6A 1CENA 1LJYA 4M80A 2WVTA 5CGMA 2GDVA 2VX6A 2EACA 4JAWA 4MDPA 3W38A 5BXSA 3A5VA 2OSWA 3PZMA 1VFMA 4ZE4A 2WMJA 4CD7A 1J12A 1TVPA 1QW8A 2CCRA 5ABGA 2OW7A 3ECQA 5A6LA 1K9EA 2EPNA 4DM1A 4UFJA 5ECUA 5A3HA 4PRWA 3WY1A 3CZNA 4PYSA 1FFRA 2WMFA 4KGLA 1KCLA 3W4RA 1GOMA 2F61A 4Y7EA 1XHGA 2WC7A 5IXEA 1J9YA 4D6GA 3FAWA 1TQSA 3F5LA 1H3GA 1E56A 3LRMA 2JIWA 2WWDA 3W27A 2WAGA 4NXKA 5CLTA 4DO5A 4LYRA 3BVTA 1HP4A 5CZKA 3CZLA 3B9AA 1MW1A 4AISA 4E4PA 1KQZA 1E6XM 1T0OA 1HL9A 1HJWA 1W3LA 1W2PA 2BVTA 2ZUUA 5DF0A 1WPCA 3RILA 3AZSA 5BXTA 2Y4SA 2FGZA 3BAJA 3CLWA 3WY3A 4NZCA 1RD6A 1FH8A 4AIOA 3W6LA 1R75A 3ARZA 3WY4A 4RE3A 3CC1A 2PBOA 1EHAA 1W9UA 2TAAA 3AXHA 1WAWA 3NSNA 2JFEX 2ZXDA 3A24A 2YKKA 3CZEA 1VBUA 5FOOA 3AMGA 4ATWA 4QDMA 3BUQA 3IK2A 4V27A 1QNSA 1UR4A 4AZ7A 1V6YA 1TMQA 1TFVA 1DWIM 3MU7A 4UFIA 1JXJA 2ZOXA 3SCSA 3WFZA 1JD7A 5HOSA 3VOCA 3DYMA 3J7HA 4AD5A 3AMDA 3OA5A 3ZJ8A 2PWGA 1E70M 1KBKA 4E2OA 1O7DC 5BROA 1ISVA 3ZIZA 4AZIA 3LRLA 3W24A 1JNDA 1VFFA 5TD4A 1RP9A 1QBAA 2CHOA 3SEPA 4AD0A 2XFRA 3K8KA 3WNPA 2CERA 5I23A 3AHYA 4B16A 3QHMA 3BVWA 1GVYA 3CHDA 3VGGA 3PZQA 2W63A 3ZSSA 2WMKA 3WDHA 2WZIA 3GXFA 1UWQA 2GDUA 1K6AA 3AROA 1X6NA 2VQUA 1BQCA 1VRXA 4ZEPA 2X2IA 5EMYA 4CU7A 3WELA 1OINA 1HTYA 3WD1A 4P7LA 5GPRA 3FNDA 1E55A 2WMHA 2WBKA 4GINA 3AS2A 4QLJA 3TTQA 1JZ8A 1NWSA 1GHSA 3LXBA 1ZL1A 2IXVA 5A6SA 2C7FA 2IUZA 1QI3A 1JZ7A 3SCTA 1PX4A 2FGLA 4UZUA 1Z32X 1H1NA 1VAHA 5A2AA 1JDCA 4HU0A 3VX0A 5I78A 3WNMA 3G6MA 3U57A 3CH9A 3PZ9A 2ESCA 4HA4A 4QCEA 1EXPA 4U3CA 4PSPA 2PF0A 1H41A 5I5RA 3ARTA 2GJXA 2E4TA 4J7RA 2Z1KA 1KWKA 4PUDA 2WVUA 1IT0A 4U5KA 4RE4A 5AYIA 3WMCA 2EPKX 4PMVA 3ZMRA 3RM4A 3VDCA 1KXTA 3BLKA 1UR9A 2D2OA 2XGBA 3TONA 1VB9A 3VIIA 1U2YA 1LLOA 3DC0A 1G01A 2CITA 3CUIA 3U5UA 3UETA 4CD8A 1VF8A 7CGTA 3BLBA 4H41A 3L4XA 1JI1A 3ARYA 1EHNA 1C93A 5A6BD 3O6AA 1DWHM 1E5NA 4JCMA 1WDSA 1OGBA 5KEZA 3AHVA 3FXYA 1B9ZA 1OT1A 1GVIA 4H7VA 3EDJA 1R87A 4AEFA 3PHAA 1K9DA 2VZTA 4J3UA 1ZBVA 3IANA 4AEEA 1V3JA 1LF1A 3ARUA 3VIOA 2W91A 3CZJA 3VO0A 1E40A 2CNCA 3WDRA 4AZCB 2JEQA 3WF0A 1L8NA 3K46A 2XGIA 2YLLA 2CESA 3POHA 1CYGA 1BYAA 4UTFA 5A8OA 1KXHA 2BXZA 3ARVA 1E4NA 3MS8A 1DEDA 2E40A 3GXIA 4HPHA 2A3BA 2J8GA 4P8VA 3VMPA 1KGUA 2WCSA 2ZX8A 3FW6A 2G41A 3N13A 4L4PA 2VL4A 4MTVA 3ZO9A 2WXDM 3GXPA 1UKPA 2EXOA 1PEZA 1C90A 3CZSA 1Q6CA 3GNRA 2WBGA 1LL4A 5GNYA 1NOWA 2V3DA 1R85A 2HISA 2WKLA 4MAZA 4IPLA 1MW3A 5A2CA 3CUHA 4PMZA 1UWIA 1GONA 4BQ3A 1JF6A 3A22A 4M8UA 3AIBA 4QLLA 4TX8A 1NWTA 3GH7A 4A3YA 1JZ5A 4M82A 1V3KA 2G8ZA 3CV5A 3DX1A 4PTWA 3AHZA 1EGZA 4F9JA 2WHMA 5FKYA 3TA9A 4AMXA 5F7UA 4W85A 4JHZA 1QWUA 3MUIA 3WBAA 1K9FA 1J01A 3BUBA 1FP8A 1CGXA 3VIPA 2O92A 1CXFA 1JXKA 2D23A 3B8SA 5I79A 5A8PA 5CG0A 5AC4A 4MB4A 3VNZA 1ZBKA 2QMJA 6TAAA 2O9OA 4CGTA 2XPKA 2YL9A 4PTVA 4J3SA 2CKRA 1LWHA 3SUVA 2X8RA 3IAQA 4Z2KA 3K8LA 4GZJA 3VTRA 3THCA 3EJRA 5DT7A 1UQZA 3SCPA 2VRJA 3AIVA 3PN8A 4NXSA 3IGUA 1H0IA 1KWGA 1W1PA 3M07A 3FN9A 2XTKA 2BVDA 4W8BA 3WDJA 3WH8A 2ZUMA 1EH9A 1CXLA 3A3HA 1SR0A 1MXGA 3PTQA 3VMOA 4KWUA 1WB0A 4H04A 4FNUA 2WVVA 1DHKA 2RGLA 4PMXA 3TTOA 1V0MA 2VT0A 2GJRA 4QLKA 1TZ7A 2VJXA 2F1BA 1CGYA 4PSRA 3WQ4A 1A47A 4U3AA 2VZVA 5A94A 3BUIA 2E8YA 1SMAA 4N0RA 1QX1A 2D1ZA 4PMYA 1O7AA 3BCFA 2WMIB 3DECA 1FHLA 1OM0A 4NI3A 1HJSA 3WSUA 1UZ1A 2CBVA 3VIMA 1SYTA 1ISXA 2BY3A 2ZX5A 3K1DA 3RJXA 4B9YA 3WD4A 2BHYA 4CVWA 1E71M 5CQ1A 3VIHA 2OWWA 3EJUA 1ITXA 5CPTA 2EEXA 1V3MA 3L4VA 1S46A 3LXAA 1TA3B 2XVLA 3BSGA 4S3JA 1B1YA 4TOQA 4UNIA 5I77A 3T08A 4OBSA 1MVYA 2EPOA 3AZRA 1UKSA 3AIUA 4F79A 4AXNA 4AD4A 4YHEA 2D3LA 1FOBA 3PTMA 3L4YA 1MW2A 4HZ7A 3M6DA 1JD9A 1PIGA 1B0IA 2F7QA 2XVNA 4PEEA 4DWSA 3CPUA 2DSVA 3OGVA 4S3KA 1GQJA 4W7WA 2QLYA 1C92A 1JI2A 4YPJA 4HMDA 1IZKA 1BG9A 3E1F1 2J77A 5A6JA 3T2QA 3VGDA 3VD9A 1I1WA 3AYRA 3NDYA 3DYOA 1JFHA 6A3HA 1J11A 4MB1A 2W61A 5I2UA 2D73A 3F5KA 4MJ2A 2ZX6A 2RGMA 3A4WA 1KGXA 1JNEA 1GZJA 2J78A 3RDKA 1HVXA 4RE2A 1UH3A 5EFDA 1E6QM 2W92A 3M46A 2ZUSA 3T2PA 1UKTA 1JL8A 4D6IA 3ZT5A 4LPCA 4J27A 2OWXA 2YFOA 5D9OA 4UQEA 1EO5A 3AS1A 3OIHA 1MFUA 1XYFA 2D0FA 3AHXA 4MADA 3AISA 3N17A 3W0KA 1GW1A 4KH2A 3GXDA 4OUEA 4CN1A 1LQ0A 2C0HA 1V0NA 2YJQA 4ZXLA 2EABA 2WHKA 2YL8A 1GOOA 3KLLA 5AYBA 2J47A 1WP6A 1XSKA 3SCQA 3SUUA 1GOWA 3EDKA 4JCLA 4AZ6A 3T0AA 3VD7A 5ABFA 4IM4A 1WDRA 4ZXOA 3WDQA 3GZAA 5D9MA 1QWNA 1C7SA 1XH0A 2ALWA 1UQYA 2B31A 9CGTA 2FHCA 2D0HA 3KEHA 4XZBA 2VVNA 3KL5A 3RM8A 1TR1A 2V38A 1XGZA 1OD0A 4IPNB 1BGAA 1KTCA 4HOWA 3MUZ1 3WQ8A 2F7OA 4B15A 2GVYA 3D52A 2Q8XA 2CBJA 2JF6A 1C8YA 3UG5A 3POCA 1PAMA 2DDXA 1RH9A 1W2VA 3VMNA 4D6JA 3A4XA 1EO7A 5I24A 4X0NA 2EPMX 5BWFA 8A3HA 5HBFA 3WNNA 2DQXA 1YHTA 3L4WA 3SUSA 4F8XA 3WUBA 5DFAA 3ARSA 5E9AA 1UD6A 1B3ZA 3T0DA 3WF4A 1CDGA 1WCGA 4MJ4A 3U7BA 1BVNP 2V5DA 3OGSA 2YA0A 4AIUA 1GOQA 1OIMA 3F4VA 2WVSA 2ZUVA 2VX4A 1M04A 3H54A 3ZSTA 4P7OA 4AWEA 1V6UA 2MANA 4UOJA 1QI5A 3VKKA 1G1YA 3BAIA 2F7RA 4WKFA 5D9PA 2XIBA 1BTCA 4CVUA 3ARPA 5AC5A 5FD0A 3CMGA 2ZUWA 1EQCA 2EBNA 3GYCA 4U33A 3UG3A 3O9NA 4KRUA 1TUXA 3EJSA 2J7DA 5CLWA 4R27A 3KWXA 3SUTA 3DDFA 1HN1A 2JALA 1DWGM 1XCWA 2HVMA 5CPQA 5I6SA 5ABFB 1V02A 4GXPA 1E6NA 4UCFA 5HPCA 4ACZA 4IUGA 1E6PA 5E0FA 3AZTA 1QNOA 2G3IA 3MV01 3U5YA 1M01A 2J79A 5M5DA 2QMKA 1TCMA 2AMGA 2WMGA 2DT2A 5A95A 2GSJA 1UASA 3BVVA 3IJ7A 3VSUA 4FNSA 4P8XA 1WZAA 2J75A 3WH9A 2ZE0A 3FY1A 3D3AA 4JIEA 4GI6A 4X0VA 5A1AA 1LL7A 2WB5A 4WSJA 2UY5A 3RO8A 2G3MA 4GI9A 2GK1B 3DHUA 4F9DA 4HZ6A 1TQVA 4J3VA 5A6MA 3KE0A 2EJ1A 3CTTA 1UWRA 1R7AA 2ZWZA 2XM2A 1E1EA 4FLOA 4QFUA 5DEZA 4Z2LA 1BF2A 3A47A 1UWSA 1W3HA 4PTMA 4HZ8A 1W32A 2DT3A 3AHTA 3WN6A 2CBIA 4AZGA 4ZENA 2NW0A 4HU8A 3VIGA 4QCFA 1VJSA 2BHZA 3CHEA 3ZJ6A 2PC8A 4XUYA 1GQIA 2CPUA 3WY2A 3H55A 3WDPP 5LA1A 3W25A 4MNLA 4AY1A 3ARWA 4D72A 3LXCA 2ZUNA 4FNRA 1NP2A 5CSYA 4GI8A 4HPGA 4OIFA 2W4XA 8CGTA 1ZJBA 3EJQA 1EA9C 6CGTA 5CSUA 5CPSA 3WUEA 1UKOA 1J0JA 4UQCA 1OBAA 1HP5A 2YL5A 3VD4A 2XFFA 3AIEA 3WQ6A 3L2MA 3W37A 3OZPA 3A4AA 3PZOA 3WEZA 2WM0A 4LYQA 1E43A 4WF7A 1J0HA 1BSIA 4WSKA 1QOXA 1G94A 2XN2A 2NT1A 3WEMA 1FH9A 1XRVA 1B2YA 2WMIA 2W66A 3NUKA 4M1RA 3L2LA 3AS3A 3CHFA 5BRPA 2VCCA 2OYLA 3KZSA 1AQ0A 2F1AA 3WMBA 1RPKA 3GXMA 1E5JA 2VZSA 4GKLA 5D9NA 3SUWA 1OIFA 1O6IA 1NWUA 1QHPA 2EADA 1WZMA 2DIJA 4LYPA 4UFMA 1ZU8A 2YIHA 3NIYA 2DPEA 2WC4A 5LA2A 3VIJA 1KFWA 2WCGA 3OGRA 2F2HA 2CYGA 3ARRA 2DSUA 3PZIA 4W88A 1QHZA 3UG4A 2VZUA 4J3WA 3ZR5A 2C8NA 2EAEA 5E09A 1UD8A 4J28A 1ZB5A 2UY2A 3RM9A 1C7TA 1W3JA 1EDGA 1QI2A 3VD5A 2W62A 1UWTA 2CEQA 1EQPA 4PN2A 1HJXA 2EQDA 1TQUA 3PBGA 2EPLX 1NP0A 1QVBA 1JYXA 4ATLA 1Q6FA 1BLIA 3AOFA 1E6RA 4PMRA 2QV4A 2XG9A 3H53A 2VRKA 4UQBA 3WL0A 3VGHA 4FLQA 4PMUA 1AQHA 1E6SM 3HU7A 3BCDA 2Y8VA 4XV0A 1B31A 4L4OA 1QNQA 1BGGA 5DT5A 1B3WA 3RJYA 4K68A 3BGAA 1NOFA 1DWFM 3QHNA 1GQKA 2BXYA 1CGWA 3GBDA 3QOMA 1XV8A 2AOSA 1CBGA 1I75A 1XH2A 3BSHA 5EFFA 5A8QA 5M17A 4GO9A 3BUDA 3BXWA 3NYDA 1KTBA 3BAKA 3VGBA 2J7CA 1V03A 4LXFA 1GCYA 2VUYA 4TVCA 3DHPA 5GNXA 2IGTA 1ISWA 2DGAA 3ZM8A 3LPGA 4TTGA 1OGGA 4JFUA 2DEPA 4LGXA 1H4PA 3ALFA 2WC3A 7A3HA 1FFQA 5ABEA 3WNKA 1UR2A 2JE8A 3TP4A 5A6BA 3CZ8A 1CNVA 1UHVA 4MAVA 1UUQA 1IV8A 3EDEA 1GPFA 4J3TA 1E0WA 4EAMA 4HMCA 4DUXA 3GH4A 3WUFA 4PMNA 1PZ2A 1BPLB 4P7NA 2D20A 1W9VA 1LG2A 1CLVA 1WNOA 3TTSA 4Z2IA 1H49A 4JKKA 1OT2A 1BG4A 4MDOA 1B30A 1V0LA 2F18A 2QHAA 1WE5A 1ZJAA 4WK9A 5E6YA 3VILA 7TAAA 3N15A 3FHAA 2Y2WA 5D8ZA 4JZ5A 5BCAA 1WO2A 3D5HA 3GH5A 5D4YA 5KZ6A 2GFTA 4D1JA 2WSKA 4FNPA 1HKIA 5C8BB 2PWFA 1GJUA 2DSWA 4GQQA 1UH2A 2ZX9A 2VCBA 4B3KA 1XC6A 4HOZA 3WD2A 1CXKA 2ZWYA 1J18A 4DWSC 2XWDA 3VX1A 4D71A 4U2ZA 3MUAA 4CD6A 4EK7A 2XM1A 1CEOA 4BQ4A 4ATDA 1E73M 2NT0A 1UG6A 3W53A 2Z1SA 3A6OA 4TTUA 2VRQA 2YDQA 4YHGA 4Z2JA 1JFXA 5BXPA 2Y5EA 2GUYA 3D4YA 3QGVA 2CETA 3WNLA 1MQPA 1H11A 4HMEA 4B3LA 1V02E 3AJ7A 1UD4A 1LWJA 4CD4A 2J62A 3MKKA 3RMEA 3MV11 3WIJA 2A3AA 3S5YA 4W84A 2V3FA 3WENA 1ISYA 2PWEA 3N12A 4D6EA 5FCZA 5I0DA 4V2XA 2E0PA 1X6LA 1MW0A 3D4ZA 5BYWA 1NQ6A 1V08A 2V3EA 4HOXA 3HN3A 3UESA 4AYSA 3SURA 3W6MA 3ZOAA 2FYVA 1A3HA 4R5EA 3D50A 2VX5A 5JBEA 4NRSA 4D1IA 3EDDA 1ZBCA 3GNOA 4MNMA 3T2OA 1KCKA 1FHDA 1G0CA 1HX0A 2XUCA 1E72M 4PTXA 2FE0A 3GDBA 1NM9A 3W29A 3NCOA 1NOUA 3MANA 4FF5A 2BFGA 1F4AA 5HNNA 2X2HA 3DX4A 1JYNA 2WYSA 1VFUA 3WUGA 4OKDA 3OZOA 3SCNA 4AZCA 4P8WA 3WD3A 3WF2A 1J10A 3BH4A 1HJVA 2VI0A 1U33A 5AY7A 2EO7A 4X9YA 1CZ1A
chains in the Genus database with same CATH superfamily
2R29L 4TPRL 5DI8A 5E6SB 3JQOB 5E9DD 5LBSL 3AT0A 3MMUA 5DD0H 4QM1A 4XCNB 3TA6A 1MWOA 3S35X 1KM1A 3R5EA 3T0BA 4O50A 1ERNA 2CLZA 4UOW1 1AH4A 3H7BA 4DBUA 1OGSA 2P1YA 3T2NH 2VX7A 1V6VA 2NPLX 3VA6A 2YA2A 1DVFA 3TT3H 3KGRA 4DVBB 3S8FB 4L65A 4JY5L 5E9DE 3NQ6A 5ITFB 2B8OT 1FG2A 4KPHL 1JCYA 2BS9A 4NWUL 3F6IA 1JCVA 3FTGB 2NLIA 1NEPA 3ARQA 4RFNC 2PYED 4XWGL 1PHQA 1I1XA 2DSZA 1MCCA 3A0OA 3VG9B 5I9QC 4N22A 3BG5A 1P7QD 5K1JA 4KW2A 2VWEE 4EOWL 1DORA 4W4NA 3MMWA 1MEIA 4O1DA 3L3JB 4LCVA 2WLIB 3HG5A 3BK0A 3CUGA 1ZE3H 3CVBA 3F05A 1VDGA 5C09D 3V95A 2CDFA 4M5YH 2DUZA 2WZTA 3IIZA 3R8GA 2B7DT 5DN1A 4O2EA 2NQHA 1DJHA 1Q6EA 3TWCH 4BY3A 4BA0A 3MMDA 3OHMB 1GAFH 4LKXA 4WCYL 3T0WA 2K4AA 5LNGA 1EVUA 2J8UB 2RIKA 3BPNC 5DQ9B 4RMBA 5TFSH 1QCWA 1GVSA 1BZEA 4OGAC 4TVUA 3UROR 5B4MC 1E42A 1BLNA 5H35A 1N6QL 4IH3A 4D6HA 4FD0A 2NYZA 2FIQA 2X1OA 4YDLC 3TC9A 3FC8A 4U7MA 5E51A 1BEXA 2EYTB 3SIMA 1B0GA 1AGDA 3ZVVA 2PDLA 3WUWG 2VDMB 1AW5A 3RFZC 2DP3A 2HDJA 4ADGA 3OVQA 1E9ZB 2XJKA 1TTJA 2O9RA 3EXRA 2AQRA 3NJ3A 5KJ4A 2X7LB 3LV3B 3BARA 4UMCA 4P8QA 4RNRB 2IIJA 1E1CB 1RK5A 3TJLA 1UCBH 4RMTA 4MA8L 4PUNA 4GH1A 3ESPA 5I1IL 1EF3A 5AZEH 3LKPB 1BDYA 4AYFA 3GJFH 1OWRM 1YDYA 3GSNH 3OB8A 4NGHL 5CIPH 2Q8ZA 4FX8A 4KDWA 3R7QA 1LP9F 1DLFH 1ESOA 2O6CA 3HHRB 4HA0A 4G6FB 3K5XA 3TJEL 1VSCA 1TWIA 3IYLW 5K69A 4F91B 1R3YA 2XWJB 1VFSA 3W7RA 5L8JB 2HPIA 3VINA 3FB8A 3F84A 5J6HB 4E8DA 1QACA 2W61A 2VGIA 4FXGC 4AYDC 3D47A 3ONCA 3B3IA 4LCWE 4XP4L 5C07B 1H7RA 1N8FA 4B96A 2OO6A 4N1EA 4QRFA 5ID0B 5ID1B 2QJNA 3V55A 2IPJA 4WDXA 1MY5A 2UZXB 1G7JB 2Y5TA 4QHMA 1Z9PA 1SN5A 2WK2A 3V5HA 4ENEC 1UWUA 1GPOL 1XG4A 3JT2A 4CUCA 1OPOA 2AJVH 3P2VA 4LDOB 1HYSD 2PW1A 5KOVC 3WK0A 4AKQA 1QSFD 7TIMA 2W5FA 3BICA 3NNTA 5IOKA 1SZNA 2OMTB 1OZQA 3N9RA 4PY7B 2ZCHL 4L37A 1EPXA 1R30A 4KK6D 5DZ9A 3BD4A 3K0YA 1MCNA 4ZW8A 4MB5A 3P82A 1K77A 2XIIA 4XWOC 4YX2L 3DX8B 3OM3B 1BBDL 4ODUA 1OABA 3CD4A 1IC0A 3UYRL 5K39A 5L8LB 3M0KA 4OTKA 2QHRH 4E0RA 2VD8A 4J4PA 1M4KA 2I16A 1MRFH 4Z3EA 5I5JA 4OGYH 4OQ1A 4JQ4A 4JTDA 2FHBA 1E0VA 3OLIA 4EOUA 1CFMA 1T89A 1JGIA 1V6TA 3EOTH 3B9DA 5F7LB 4GXWA 2ZRWA 4R9OA 2C4XA 2VDKB 2F8VA 4NIKB 1R0AL 1ICSA 4LIQE 4DPPA 2VLMD 1CGVA 3AU0A 3WQWA 3S37H 4LSQL 2XWBA 3WLBB 3QH2A 2XFYA 1JTOA 3G5ZA 3BESR 4M93C 3D30A 5IHLB 5AALA 4I2XA 3LCHA 2PDWA 1WF5A 4PUWA 4OZGB 5E03A 4O00A 1NCCL 2OTWA 2VLKA 4Y5VB 5KS9B 2X2GA 4CN6A 4WIWA 1UM4L 4WWOA 1IAKA 2XT1B 4ZDHB 1H5VA 5D6DA 3L68A 4JVPA 1GOIA 4JIPA 1LP9E 4FZEL 1P7QA 4MPKA 4BH7A 2B5IB 1X38A 1B4JH 3ZU8A 4C54A 1PKYA 3W57A 3SZ8A 2Z7YA 3N11A 4G7VH 4JQVC 3RQ3A 4YDVA 3HG2A 1H8NA 4O51A 3WEOA 2Z7GA 4XX6A 4JX5A 1XPYA 2HLAA 2OLAA 3NQMA 1G7PB 5C86A 3LQLA 1BZDA 1K4GA 2XHNA 1A4CA 4HAGA 4XO9A 3WMSA 1R3HB 5HDQH 5DXWA 4K71C 3WJJA 1QKZH 3RWHB 1TNMA 2A9AA 3STZB 3TTYA 5DJDB 4KRPB 3EOOA 5FEXA 1EL3A 3ZKQD 1F3JA 3ZJAA 2YSSA 5D6DC 2WLLB 3DWTA 4HEPG 5IQNA 1Z9NA 5FYKL 3T8XB 1S5HA 1U8KA 5FR3A 3Q05A 1KR1A 1ZBWA 1SXCA 3NL5A 3USZA 1ITUA 1VPOH 2VR4A 2F5AL 3W28A 3VVGA 1MUJB 4XNUL 1CWVA 2BMKB 1TYEB 4WI9A 1AO7D 4FQJL 2J7HA 2YYTA 5D03A 4QRRB 3UWYA 1YTKA 1T66D 5E9DB 2G0LA 4DKDC 2CQVA 4AFYA 1BOYA 4OLYL 4BE5A 1QRNB 4M7LT 1GK8A 1M65A 3UTTA 4PJFF 4YC2C 4S1SH 1F18A 5ILTL 4LAOA 3O9WA 2PGRA 1WIOA 5IHRA 1CF1A 3A4EA 4HP5A 3K4DA 5F0JB 2WW8A 3UOAB 4PJCA 1X7TA 2Q87A 3VNIA 4M7KL 4QRTB 2VC2H 3FU9A 3GB6A 5A8GA 4CQDA 2E86A 4JFSA 1UKQA 4KEMA 4AQZA 4X98B 5EL1A 4W93A 4MNKA 4WFFE 1UVQB 2TSAA 4N2NA 1WZ1L 4NP4H 5T1KA 1YG9A 3BSZA 4G8EB 5JO5A 1J8KA 3Q6GL 1RA5A 3I9PA 4TUOA 3GAYA 4HDIB 3N4AA 4KDVA 1DJIA 2HPMA 4OD3H 1J0IA 2DTMH 1PDKA 1QOPA 4HXAH 4RL3A 4A68A 5G1MA 1QZNA 4NKDB 3TN3A 1O9WA 1XLBA 1ET8A 1MRCL 2AZAA 4GCAA 4N0YH 1CIUA 4YSPA 2BSED 5A16B 2JF1A 5I3GA 1GMIA 1FFOA 1NGWA 1S7TB 1UM6H 5EN3A 3K2IA 5ACLA 1W0WA 3NDZA 2A4ZA 2YK1H 3I02B 5D1QA 3RRQA 3F7YB 4OV6F 1INQA 3VXRD 2PR4L 1PKNA 4YYCA 1FFPA 3ARED 4M4PA 4H8UA 5I6KA 2ZCLH 3TBVA 3WJLA 2Z64C 3BMVA 4N2FA 4AZ5A 4P3CL 3S5OA 4BWLC 3W75A 3DHFA 4FOUA 5CJBA 1VLIA 5C9KA 4CCZA 5IK3A 3S36L 2B9AA 4A3HA 4YGVB 4AWUA 1C12A 4LBAA 4REQB 2CA4A 2G75A 1FH2A 2JH2A 2XBTA 1AQ8A 1P1XA 3IUHA 3U1QA 4NZFA 3SCRA 4QE1A 2WO3B 3QKZA 5J7CC 1J96A 5AEAA 2PBGA 1ACCA 3DIFB 1NLDL 1HE7A 1OKEA 4X5XB 4FQCH 3BKML 2FTWA 3TAOA 3WD0A 6XIAA 2R1WA 1WCQA 1OQOA 4X9FA 1QABA 4KRMB 5TF1L 4HUVB 2GJPA 4YBHA 4C7FA 4IEFB 3T4AC 3VM5A 4PI0A 4AVHA 3OB0K 3K6SA 1Y5VA 4TSAL 2HVBA 2CBUA 2EG6A 2XVPA 2VISA 4AC2A 1IT7A 3FQWA 3UZXA 2WXRA 4PJ8A 4PB3A 2SODB 4L05A 5E2TH 2VTFA 1XLEA 3BQ6A 3L3KA 3Q13A 4D6CA 4APQD 4ZMNA 4FAMA 3WH5A 3MSYA 2RA1A 2V7NA 3BGMB 4U6VL 4WD0A 1CGSH 3O2VH 1MQRA 3E2HB 1QI0A 2XBZA 2V68A 3WFDL 3GS4A 1W54A 2ZKHH 4WLCA 3FDGA 1CB7B 3JTTA 3P0GB 3L4UA 2Z1PA 5GRWA 3ZT6A 3UT0A 5GS0D 3O4LB 1QEXA 4FKEA 1OGPA 5T33H 1IGWA 1FCBA 3OC5A 2W0FA 3GI8L 3KLSA 3OKNA 1V6XA 4AWSA 1MCIA 1KXQA 1KFAL 3CMOH 1BZ9A 3O3AA 4GMSH 3C4UA 4HNUA 3S2NA 3S3JA 3FO1A 2YGYA 3B8WA 1KKRA 3T6CA 1FSKB 1P4BH 1RLWA 4QP0A 1QOQA 4UU9B 4QJ4B 1OZTG 4P5TC 1JHTB 3AJXA 3LHTA 3PPCA 4PJAF 3F4NA 3Q2NA 4KGJA 4P4RB 2BG5A 3B2UC 3ARXA 4XN5A 1NVMA 4ACZB 5I3DA 1R5WB 2VMFA 2PRMA 4XZ9A 2VC2L 3F2CA 1Q66A 3SCWA 4OZHA 5SWZD 3T5WA 1F3DH 4U1LB 3TZFA 4LNRA 2UV8G 2GCYB 4BF7A 2BNJA 1FDYA 3RL1B 2Q2LA 3M17A 1MRDH 3MRHB 1IEBA 2OL3H 5HVWA 5G2HA 4LUIA 1KN2L 5DJZB 5TGBA 1AYOA 2ZIDA 3SJNA 3IBOA 3ALWA 2ODHA 3II1A 3IDGB 4HXAL 3JWNH 4WI4A 4Q4PA 5K2ZA 2FZMA 2MCPH 1CTNA 3FYPA 1ZALA 5HANA 1Z89A 2NUTB 4HIXH 5DHYA 4Q8OA 1MXDA 1YJDL 3D5OF 1G4TA 5D8JL 3KRSA 3L5AA 3MVTA 1NIAA 2X40A 5KYWB 1T41A 4NP4L 2HP4A 2HB0A 5HDRA 1J93A 1BEYH 3EGJA 4N9CA 5DMIH 4AZBA 2YQ2A 1T22A 1ZJIA 3EW3B 5A6KA 4KKZA 3V0WH 32C2B 1KXVA 4UT7H 4FX7A 2X28A 5TQ0H 4AE0A 4WKAA 5JHLA 1WC7B 3TBYA 2C7UA 3IVKB 3U46A 1T21A 2IQDA 1YN7A 4Q6IA 4L80A 4I87A 1FORH 4GQBA 1TJHH 1XMWA 1M42A 1KBBA 1H9VA 2P42B 3IDIA 4KTYA 5I7GA 4FXLA 3AB0B 4OLWL 3UAJD 3VQ2C 1FN4A 1J5IA 1BFNA 2QXWA 4XH2B 1RZFH 5TDPB 5AG9A 3ULUF 3PVFA 4O2FB 4P7RA 1GS6X 3QORC 2Y36H 2XWRA 1NLDH 2VITA 4H8QA 1DE4A 1KBGH 3KH3A 4CCCA 2WYHA 4NI6A 3SCMD 3D25A 5CR1A 3BJTA 3F5JA 3QQ9C 3UTSE 4ODTH 5IT2H 3RY6C 5FJRA 4YCPA 1AHKA 1LEKB 4ZPTB 3MO1A 1ETJA 1JZIA 3KOXA 2YGNA 3GTFA 4PFMA 1A6UL 3QNZB 1YNKL 5D1XE 3X14B 4MVAA 3MBED 2VKXA 1I8LC 2OSLB 4LNCA 1K9TA 3NOIA 3RIFF 2P8PB 3V0JA 4G83A 2VDML 3ME0A 2VEPA 2EDXA 1TPVA 1KJ2L 1R1CA 1B2WH 2VDQB 3G3LA 3LZRA 4WGWB 1IEAB 1I7TA 1NC2D 1BG1A 3QXDA 5KTLA 3C8KA 1AXIB 2NTFA 2QCNA 3EJTA 4MSWA 2FWOA 2Y7FA 2XN0A 5CEZH 3FVDA 3L0NA 4PA8A 4MAUL 4HWZB 2ZX7A 2H3NA 1ITQA 3C8NA 3WFLA 4FB7A 3KBVA 1O9ZA 2G9HA 4MNGE 4GIAA 2J4WL 2X4SB 5C08D 1IEQA 4N6FA 2VWEC 3QIBA 3QBUA 4GFIA 1KNOB 5FYJH 4IIFA 1OTUD 4GH3A 3MBEA 2XY1A 5G1YA 4L9LA 3ZRFC 1HIZA 3UIZA 3S2JA 2DJXA 2I7OA 3ULVH 3A3WA 5HNRA 1MVUA 1TTUA 5TQLA 3IDYC 2Y2TA 1URZA 2VLRB 3GKWL 2O6PA 4AY7A 4C5YA 1E27B 2PTVA 1B4LA 2A1YA 4YVPA 1OCOB 1S5WA 3S96B 5E4EB 1TQJA 3M41A 1IVLA 1ZA3B 4NKOB 1P6CA 3KLAB 3PUOA 1CXHA 3NSNA 3ARGB 2Z4TA 3K6NA 4PJCE 3ATEA 4UQ9A 1OFQA 3DFPA 1BAGA 1VEPA 3NXFA 3B7SA 1D5ZA 2WNWA 1D5IL 2HH0L 4JZOA 4M56A 1OAZL 3ZO0A 1OFEA 2QS8A 3OG2A 4LVDA 4NUWA 3MA8A 4L3EA 4NYLA 4X6EB 5C7XH 3V6BR 3S97C 5K7JA 1PZ3A 4ANWA 1KA9F 5D05A 1PNDA 1V3HA 4RNJA 2GUOB 3S8HA 4WRLA 2ZXBA 1U8NA 3P30L 1VIWA 5DQDL 3TPKA 4QCIA 3WG7B 1LCOA 1MNNA 3KBNA 4CNPA 4LEOB 4Z8FL 1Q94A 3CDZB 4BFKA 1G4SA 3FQYA 2QQNL 2JIEA 4HK3N 1EJ8A 4G7YL 5LAPA 1G0DA 1WDWA 2C71A 1RZIB 2ICES 4PUMA 3CUJA 2JEPA 2PCPA 4A3RA 2TYSA 2DIBA 1CVRA 4QRPB 4PRTA 4JGNA 2WHJA 3CXFA 2YDSA 3B6SB 4BM7A 5IHZA 3AIRA 4HNLA 4WI7A 2R7EA 2VO5A 5BZWB 3RVXC 4XO7A 1FVPA 4JRWA 3KWTA 1XH3A 3I50H 1L9SA 4Y4HC 3L08A 3BXNA 1AQMA 3CC5B 4QWWC 1XLLA 4PULA 5A8NA 3PHQB 4JTKA 2AJSL 1OM3H 3LOTA 4RZ5A 3KL3A 3MNWB 1KQYA 4R2GC 1I9RL 4KITB 1DUYA 3EH5B 4XC1L 4OCXH 3UCQA 3T07A 1CLOL 4N4YB 1F6AB 5D2NE 3CQIA 3N2MA 4A7GA 3VM7A 2ZADA 1AZ2A 1YQ2A 1UOKA 4G7SB 1T8XA 2BY2A 4CNTA 2XVBA 3SQMA 5DZLA 1V7NL 1GYNA 5C71A 3W7LA 1GZQB 2BC4A 3AYTA 5DJCA 4W86A 3ULUH 2VLKE 3T4YA 3TX9A 4K3EL 5IBLC 1SVZA 2A6LA 3LDVA 4FQXA 5J5EA 3HR5B 3AS0A 1OAKH 3GAKA 4P57A 1KGWA 2X1IA 1EWEA 4HS6B 4A2DA 2O9PA 2IADA 3U2SA 2E9MA 2IFFH 3WHXB 4GAFB 4DFIA 2QVKA 3HURA 4MUZA 5GGRY 5LCVH 1VFBA 4PUKA 4NO3B 3LKNB 1WK0A 3K5SA 4ODSH 1QNIA 3GSWB 4UUJA 1IU1A 4YQXH 5FX3A 1EOKA 1JUBA 2ADAA 3NZ1A 1BWMA 3VC6A 2GK0A 3DFHA 3AICA 1Q0EA 2NNFA 4LLDB 5SWSA 2W60A 1OT4A 3N14A 5IV2A 3ULUE 2IMMA 3CN3A 4ONFL 2Q3AA 2CZ5A 2QZ5A 3HZ3A 2CBTA 2DD8H 4WU7A 3KPSB 4HWBL 5BXFB 1WOBA 2VDKL 1XIGA 4JHWL 5I5MA 3CFKA 5EB8A 3PHOB 2FJHB 4RKAA 2BVUA 4ZD3L 5MI0B 1E5AA 1KTKE 1H2JA 4J2PA 1IC7H 2Y62A 4JZNA 5JIMA 1IGYB 3E8UH 5J1AB 3OB0H 1UWGL 1S7VA 1ZTMA 1SY6L 1S5IH 4P57B 2JK5B 3LPOA 1XYAA 3LCLA 4R0LA 3JXAA 5I06A 2D8KA 2ZD0A 5DVMA 1K6QH 1MAML 2UZIL 3I2CL 1J05B 3ILPB 3T0EC 2QTEA 1DDTA 5DEJA 4H9VA 2F54E 3QDMD 3U0WH 5G4EA 5HAOA 1E6OH 1YPZA 2RACA 4IP5A 4XAKD 2VR7A 3DDGA 4NWUH 2GPZA 3AMKA 4MVBC 3SE8H 4EXPX 5L7XH 3VWJD 1Q8AA 5AW6B 3MLUH 3QDMB 4Q4SA 4S2SA 3INPA 1C8QA 2JB5H 3TU6A 3H8NA 2L7UA 1JN6B 5FUCE 2B7NA 3VWJB 3V3WA 3PTKA 3BVXA 1Z6JT 3MNWA 4XPTL 5BRQA 3VOJA 1KB3A 1W1A1 2DW5A 3MCLH 5C8JA 4MQXD 3CC5A 3G1XA 4Z7UE 3BXNB 3BEVB 5L0QB 2W9MA 3GHUA 1BEYL 3ATFA 2Q7YB 4DYEA 1XP3A 3ZL2A 5JIDA 1A6WH 3CFNA 1U3NA 2MMXA 3STEA 4I9JA 1CB4A 5KSBE 4IRSD 3TPUB 1EHLL 2GWGA 3EOEA 3QZWB 2GUBA 4RFOH 3G5YA 1UA3A 2B39A 4BXSV 3EMCA 1A3ZA 2XA8H 2VZOA 5CZVH 4ZS7H 3AACA 4BFNA 3QJTB 4NM4L 3AQXA 2PP0A 2GQAA 1G9HA 3BGGA 4S1FA 2R82A 1LJMA 2VXNA 3CFEA 1H63A 3O6LH 4PRBB 5IB3A 4LEOA 5BRZA 2EGZA 5I30L 3MOBL 3N41F 2NVAA 4PRDA 4FNTA 3MBWA 1A7PH 4I0PB 3ZR6A 4JO8A 3NDZE 4DCQA 4KI5C 3N1FC 1EEZA 3PBYA 4PJFA 1I9JL 4L3EB 3RUGA 3L2IA 4JDBA 5A6AA 2MWCA 3TJHD 3TT1L 3H4GA 2DM7A 1Q6DA 3E2RA 3RFRA 1ZLDA 3HBPA 1G6CA 3QORA 4NI8A 2E9BA 1CXIA 3P0YL 1W9DM 2XZAH 3F62A 3QRGH 4S2CA 1BKSA 3MYZA 5KVEE 1C29A 3L5WA 2VVSA 5DMLA 5B3JF 1IAII 5D1ZD 2BOEX 4Y5YC 3GDLA 1EANA 4J12A 5EC2B 3GINA 3R06A 2R51A 3W7IA 4GW1B 3VFPA 1D6EB 4EI6B 2NX3A 4EN3B 4GY0A 5JBFA 3RZCD 3ULVC 2E74C 3UDWC 2C3VA 3U2ZA 3V4PL 3O3EA 3MBEB 4Z7WE 2E8ZA 5FK9B 4WU5B 3QH3B 5TH2A 3GBEA 3N1QC 2V2XB 4YQXL 3HB3C 4TRPH 5E1QA 4NQUA 4FA6A 4JFHE 1ONXA 1NPUA 2H3NB 2QJJA 4IBTA 3T3PE 2AJ3B 1WAAA 3APGA 3C8KB 3WJMB 1H3PH 4HKJA 4IRJB 4TULH 1TT6A 1R86A 4YWGH 2F53B 2GJXB 1PZSA 2BO0A 3EBGA 3TS8A 1D3CA 3Q0HA 3C60D 3BO8B 5J5RA 1ORSB 5LDUA 1QJWA 1KB5A 2HVKA 3VH8G 1HL2A 4DP5X 3QJFA 1PIFA 4ZRGA 5D7HA 3EDFA 3QNZA 5GS1A 1ML1A 3W5MA 3IKCA 4R34A 1CD8A 1O12A 4PJBA 2J66A 1X5FA 1MF2H 1LEKA 5IIEB 4AAJA 4QXVA 1KV5A 2ORBH 5D70L 2PTXA 5CEXB 1HEZA 3MODL 1RU9H 3MRPA 5JNYB 2J24A 4AD3A 2VAAA 3GMRB 1DE4B 3WLTA 3N0PB 1VHPA 3C2AH 4H8VA 3SZ6A 4I6VA 2YGQA 2PDQA 3VKDA 3TGXA 2WQRA 1XCXA 2L7QA 4XH2A 3KYNB 2G2RA 3X12B 3UPWA 2Y5QA 4HS3A 3MCYA 3OJMB 8RUCA 2J74A 1MCRA 3WIFA 2EVJA 4KXCA 4KRTA 1K3IA 1SPDA 4QAMB 5HD8D 3T0EE 4JL2A 1WC7A 2ENQA 5DJAA 3TBYB 4AJVA 4ZFZA 4X4YB 4H13C 3C52A 3FSWA 1EDQA 2PO6A 3V5OA 2J5LC 3P4OA 4JQXA 2GIYA 4TVPD 2Y61A 3LV6A 3ZVHB 3S0CA 1WBZB 5KSAB 1FP9A 1XAUA 4NNYA 4ODWB 1AUSL 4QRNA 4ESKA 5IWLA 1H8OA 1ZTXE 2AEOA 4MAYC 3U9UA 1UACH 2G4FA 3IPBA 3UERA 4O14A 2DH3A 3UNTA 1KIQB 3V2AR 2QJIA 1OOWA 4NRXA 5K9QG 4LANA 3SN6N 1YEDB 2XVKA 2XYCA 3TIEB 5HYEA 4X8JB 1F4HA 5TGBB 1RVFL 4MXWH 1H51A 4H9XA 4LBEB 5D2LB 5DD1L 1EJSC 1VC4A 1NCGA 4FEIA 4NKIL 3ZE1F 1MDAA 2ERJB 3T0VA 4DGIL 4EKJA 5JHAA 1HKMA 1OC6A 4TVDA 4DPQA 1KLUB 1OSEA 3HUJF 5FEZA 1OGAE 1J1XL 3QC6X 3O07A 4GW5B 3C6LB 2AI0L 4JRLA 1EC9A 1HAWA 4U1LA 4FQIH 3EOBA 4WO4B 4QHRA 3FL7A 2R14A 5BS0B 3AI0A 4PWFA 3IDUA 3R19A 4PY8I 2VM9A 2ACUA 3L67A 3MP5A 5GVJA 3D39D 4GKTA 4FKHA 3W71A 3IU3B 1OFBA 2DM2A 3DGRA 3LKQA 4WI6A 3VSQA 3GR7A 3ULAB 2BS71 2OL3L 3WJXA 5L6YL 3L3HA 3HTLX 2YCJA 1VEMA 3BZDA 2CLKA 5ICXB 3P84A 3S5LG 2BXVA 4P2AA 1T7XA 2VMJA 3T0XA 5ABHA 1M71B 3VYNA 2V9RA 4DKFH 2FLMA 2Y7SA 4N9GB 3P8JA 2C3WA 2BH0A 4LCRA 3B4YA 4CILA 2WZHA 2ZP0T 3QFDA 1F5ZA 3OTRA 3HV8A 2HROA 1PDYA 3SD5A 2BY0A 4Z0SA 3WL1A 4PRAB 2XH7A 3I9GH 4JTLA 2B3IA 3H56A 2WW5A 3VFUA 2CHDA 3RX8A 4Y5XA 2WVTA 3VFNB 1M05B 3ISIX 3FQWB 2GDVA 1RA0A 3VYPA 2ZZ7A 3VI2A 4C6IA 1IO4C 4JAWA 5H6HA 1UYWL 3A5VA 4HGMA 3B2VH 1C5CH 4IEFA 4KFZC 1IL1A 3SPVA 4MWFA 4EAEA 4YHNB 4RZCA 4LEXL 3CHSA 2HPOA 3AXLA 3LN5B 1F4WH 1J12A 4HHMA 1QWKA 3TFXA 2CCRA 5ABGA 3ECQA 3RL2A 5A6LA 3QZ6A 3IXAA 5DWUL 1URIA 3L7RA 1HH6B 4K55A 5ECUA 2O72A 5A3HA 3NN8A 3CN4A 3TWYA 1NICA 3L5IA 3ZN6A 1NPJA 4K2UL 4BRVA 1EJRC 5G5DB 1YEFH 3EH3B 1UB5A 4N2CA 3KTXA 2DRUA 3UTPD 1FQ0A 1NEZB 1SQMA 2PFHA 3L9CA 5I19L 5FV2A 2WMFA 1GAFL 5IW6A 3QEQD 2Z9TA 5H8PA 2VR8A 5ICZA 2IQ9H 3MRCA 1TKWA 3P4LA 1DQML 1W8EA 4FQCL 3WHE0 5IJKC 3W4RA 2AKMA 2XKSA 2HKFH 5GGQH 3S5LA 3I02A 5D1QB 1FDJA 4K15A 1HTIA 3BZGA 3PWAA 5CZXD 4GBDA 1QRND 4PN6A 2HVOA 2PNDA 3LNMA 5CCKH 1TG8A 5J12B 5A16A 1J9YA 1T03L 2GLKA 1R5VB 2YPIA 3V0HA 4WZ9A 4DIAA 4S3DA 1YEWA 4FMFA 4L8SB 5D1QD 3F5LA 3V9EA 5F6HJ 5C0QA 2EE0A 3LRMA 3W7CA 1R9ZA 3W27A 3HG1B 2P44B 1OARH 1I9JH 1JRBA 4LYRA 4J35A 4GW4B 1HP4A 4L8SA 4QOKB 1VA9A 4I13B 5CZKA 3TL5A 1XL9A 5BZAA 1WITA 4PBDA 3B9AA 2VN7A 4EMZA 3H9SE 3EXJA 4W1TA 4E4PA 1X44A 4I7ZC 1E6XM 1KQZA 1QP1A 4X98A 1HL9A 2B1AH 2XH2A 2QDWA 3PL6C 4XD4A 1NBYB 3MRCB 3B7YA 4JMNA 5ICZB 3MV7A 5HWNA 1TQXA 2VENA 4EUPB 5DF0A 1PKQE 3ZK0A 3FU7B 1QRQA 4QNEA 3THUA 5EIIA 5BXTA 2FGZA 1NCAL 2F9BT 3CLWA 1FDLH 4PHZA 1U8IA 2UWEE 3ZKMD 2E56A 2PP9A 3MKGA 2W07B 5G5DA 5HK4A 1J5HA 3GMMA 3GX9A 2IKJA 5HBBA 4CC0A 3C2EA 3QT2A 3W6LA 1UWYA 1LQBC 4KZDH 3BW9B 4W9DC 3FIGA 5HJDA 1RIVL 1S7SA 3X1FA 3H2OA 1KJVB 1X5MA 1MUJA 3G6JB 5HQMA 3BQUB 1EHAA 3RA7H 3AXLB 5IB5A 3MXWL 3H2CA 2H47C 3CLEH 1BIHA 2AQ1A 2ZXDA 5F2LA 1W6WA 4JY4A 4DRSA 1N7ML 3G1AA 4EZLA 1G4PA 2VB5A 3V1PA 4LCYB 2DYRB 4XMPH 2CHZA 1L2UA 1HYRC 3URAA 1XGQA 15C8H 3EF7A 3WNIA 1GOXA 3Q58A 4QDMA 5D6CA 3NFUA 4AZUA 4F33B 1S2WA 4WUUD 1HNGA 4V27A 4RDWA 1LBFA 1QNSA 5GGUA 1UR4A 1B4TA 5I6PA 2CLEA 3S9YA 2NY6B 3BKCH 2COQA 4YHKH 2WINA 1G7PA 3IDMB 2EIKB 4B27A 3QFDB 1ZPTA 1JGEB 4LUTA 5DLCA 1WT5C 4N8PA 4Q9RH 1ENUA 3I68A 3WFZA 4ASTA 5HOSA 5F97E 2QVTA 2YGOA 3GHBL 4N9GA 3DYMA 4KJYA 1F8MA 4BH7B 3QUYC 2YXVA 4UTBA 4YHML 1K7FA 1L6WA 3VXTB 3RFAA 1T1XB 2PWGA 2P47B 3HPFA 5B4MD 3U6XA 1ND0A 1TJHL 3FS9A 1S9VB 4PS7A 5HYSG 2OTWB 2VLKB 1BGXH 4X5WA 4Y5VA 1I8MB 3DURB 3VVVA 3FUMA 4TN9A 4TLUA 2A9NH 2NY0C 4M8VA 4XBJA 3HAEB 4H0LC 3U7YH 4XPGL 3KPPB 2YZRA 1BFOA 4OAWA 5IQLA 1FO0A 1IBZA 2X6UA 3JWDH 1RP9A 5DJXB 4Z7IA 1QMLA 3FK3A 3A67H 4NCDA 4KO7A 2CHOA 1OF0A 4FQHB 3KBEA 4JTQA 5I28A 5DXXA 3P54A 4AD0A 4IU2B 2YEVB 3K8KA 4H25B 4N20A 2CERA 3UZEC 2H8ZA 5I23A 4E0RB 1NCCH 1ZSHA 5XIAA 3VD0A 4XXWC 4BH8B 2X41A 3W7QA 1I2OA 4UIKH 1WD8A 3BVWA 3CHDA 3PZQA 1AR1B 2FNBA 2PYFA 5D2NA 3QY6A 4Q8VA 3M86A 4AV4A 2WMKA 4KIEA 5KJRL 1UC4A 4MCNA 4L37B 5LXGH 4UBPC 4AB4A 1SYVB 5MERA 1U8LA 4Y9BA 1HEHC 3GXFA 3LZQA 4ZOAA 4PVLA 1OHQA 2CGRH 2N59A 3W7GA 1K6AA 3G77A 5CEZD 4PCYA 1QFPA 1DQQB 4ODWA 4JFZH 3BVJA 1JHLL 3P4OB 2X2IA 5DRNB 3SFKA 1S9WA 2C9PA 1AH3A 1O4UA 4H2AA 4M5TA 1P0EA 2P80A 1ZLWK 3PXJA 1LUCA 4HWNA 4P7LA 4HCFA 3VAEA 4P5KA 2VERA 3OPUA 3FB8B 4O19A 1QBMH 3KYNA 1VPOL 5F9JB 3GNML 1JZ8A 3G8EA 4R9HA 1NWSA 3LXBA 5IB2B 2DZBA 1S8DA 3AYVA 2WSQA 3FHEA 3BV4A 3O81A 3GRWH 4QXGH 1KEGH 3SCTA 2VAAB 3GMRA 3KYAA 4NAJA 3MRPB 2Y72A 4UZUA 5JNYA 1UIPA 2FGLA 1Z32X 1UPPA 2QUNA 4GUFA 5HGHA 3NQGA 3OPSA 2WCPA 1HHJB 5CZSA 4ZBCA 3V52L 3VE0B 3MR9A 5HWMA 3OKKB 3QXAB 1N7MH 1E1CA 4XXDA 3U57A 1ZTXH 5F3HA 1FPTL 4NJAH 2CH8A 2Y07L 4PJ7E 5JXEC 4NZ1A 1BQ5A 1I1AA 3MW7A 3ATYA 1SXZA 3LCWA 3TN5A 4DHGA 3U25A 1CUOA 4ZI8A 1D7KA 4XMKL 4Z0XA 3PM6A 2HVKB 5LNEA 1EYEA 1CI5A 5I5RA 2RDWA 5CD5D 3QSTA 4J7RA 2IC2A 3B0PA 5DMIL 5CNHA 4GUHA 5CC5A 2Z1KA 3HA0A 1KWKA 4G6CA 3W86A 4TLTA 4NQTA 5H35B 3QMTA 2WVUA 1SDDB 2NVDA 3SDOA 2X4TA 1V05A 5JA8B 4C90A 2LAAA 2R0KH 5DQ9A 3NCJH 2J8UA 3TQPA 4Z95H 2I25N 1RCOB 3PS6A 4MJHA 2L5HA 2XZ7A 3STGA 1JFQH 4LKXB 3LU2A 4DAGL 1LILA 2V2XA 4ZCWA 1T6VN 2AF2A 3IETB 5HYQA 3IJDA 5B1JC 5FF4A 2XGBA 1E4WL 3TYZA 2C3VB 2PF6A 2V7HA 2F54D 3HS9A 3L48A 3QDJD 4PODA 3O3RA 1U2YA 4X60A 1TR7A 4YLWA 2IQAB 2PDGA 1D6EA 1J7VR 4XPGH 3RUGF 3CEPA 1G01A 3PP3H 1CE6A 2C13A 2QDDA 1ZCRA 3L17A 3HI1A 3OAZH 3NVTA 5HJ3A 3QDJE 5IROC 2QUVA 1Z9MA 4Z3JA 3LS4L 1DVUA 3L4XA 1JI1A 2B1HL 1ONQA 1FI8C 2E9WA 2ZOKB 4HJIA 3QORB 4JKPL 4NKMA 4OTXH 4P46C 3UC2A 2DQGH 2O5XL 2XQYK 3P77A 1KFKA 4UTIA 4IK6A 2H1PH 5FGBC 3U0PA 4LSDA 3UNDA 4UTLA 3LEYH 1DVFB 1N67A 4J9JA 3FT2B 5C0AA 4XN1A 3NL2A 3T81A 1JPKA 2EH8L 1OGBA 5U4NA 1PG7L 1Y6KR 1QATA 3WTWA 5KEZA 3FXYA 3MBWB 5GGQL 1B9ZA 4LOFA 1GVIA 4S1RH 4L4LA 5FGRA 4AEFA 1G7VA 2K8QA 5D09A 1K9DA 4M6QA 2AEPH 4LASL 1ZT1A 1QFHA 3ARGD 2XZ9A 2VZTA 2NVCA 2LU7A 3FOKA 5K4XA 1YUHB 4LRTA 3IIPA 4DP9X 3LI0A 3LS5H 3ARUA 3WAKA 3EPOA 2W91A 4D0BB 1T1YA 1UOWA 5EO9B 3VO0A 4ABWA 1J5DA 3RDJA 1E40A 1BQLH 3GO1H 2JJVA 1Z9SB 2WXPA 4M7ZC 2PLCA 2POZA 3I6TA 3Q43A 4EIBA 2A3LA 3SE8L 1U8CB 3Q2DA 3CPLB 1G7MA 2IMNA 1A3RL 2R29H 3V8CA 1PO9A 4LEXH 3UR2A 5A8OA 1HHHA 1KXHA 2JIXA 2BXZA 5HP5A 2XTJE 1RJYA 1ZLSH 4JIQA 3UWWA 3Q2WA 1PLGL 1GTNA 1MRAA 2GGHA 1TSHA 3PFQA 4Z0BH 5BUPA 2R39A 3ENLA 2G3FA 5C0CB 2WXKA 1EEPA 1NTHA 2HRWA 2J8GA 4PS8A 4RAUB 3U9PL 3DKHA 1IQ8A 1KGUA 2WCSA 4IHOB 3FW6A 4P8VA 4L4PA 2DS4A 6PAZA 1QFWI 2UYLB 4YDIH 5C0GA 4JPVL 1TZ8A 1MIEH 2ZPKL 4KQ3H 2WXDM 5B7FA 1R9YA 2PMQA 4NQEB 3ABGA 4S0SD 3S6CA 5GSRA 3N9GH 2EAWA 3FMGH 2J21A 2XQYA 4HH8A 3DV4A 4U1GB 1F6PA 2OQYA 3V0VA 5DJ8B 4J3ZA 4NT6A 4EDWL 1Q6CA 3KR3H 1TEGA 4QRQA 3ZMNA 2V67A 1I1YA 2V3DA 1NOWA 3H26A 3H4HA 2PODA 5IF0A 4DYJA 4KO9A 1YNTB 3SKMA 2FATL 1JQVA 3DKLA 7ENLA 1AOHA 4IPLA 5HMEA 4HIHB 3KBMA 4ALAL 3TWCL 1HSAA 1A7QH 3V4LA 5IHHA 4WU7B 4OLVL 1GONA 1WBJA 3RG6A 5IV2B 2OJEB 2OFQA 3BWAA 4BJHA 1JF6A 3W5NA 4Q58C 3A22A 4M8UA 1QK0A 5BOOA 4QQ3A 4M6ML 3ATDA 1NWTA 1U36A 4OCRH 2OZ0A 2NY3C 1XF2A 3GSVB 4CW1A 3PFRA 3L21A 1GZPB 3S1WA 1CBVL 2Z24A 1KDJA 2ITDB 1HHKB 4NUJB 3T77A 3DX1A 3H3KA 4PTWA 5DY3A 4K7YA 2A7PA 2GOKA 5EU3A 1Y0EA 3KVKA 3QZAA 2WHMA 3N6QA 4FQXB 3FUNA 4E2DA 2WAHA 4LCWA 1MNSA 1SEQH 1SHXA 5DJCB 1GZQA 2IAMC 2Y7QB 4AU0A 1GGCH 1WWBX 4JQIH 4XBGB 4OLEA 3F7JA 2MQGA 2ENPA 3QUMB 3TFKC 2WWMC 4PGBB 1K9FA 3UVIA 4FQLH 3SQRA 4S1SL 3IAGC 5CBEA 5ENWB 4N7QA 3WJWA 3BUBA 1G7QB 5AVVB 2ILLA 3COTA 3CYJA 2L7EA 1EJUC 3RGVB 1S2AA 2O92A 2YMOA 2EC9T 2D23A 4C83B 5A8PA 3G3DA 3QV9A 4HT1L 5CG0A 1ZJHA 2F6KA 5AC4A 1YPIA 4ZFGH 3UZVA 4C1NB 2O9OA 3HVNA 3PHQA 4HKZA 1FUNA 2O5YL 3WEAA 2OI9B 5IVXB 2V5JA 2YL9A 2Q6WB 4J3SA 1CFTA 3BP4A 2ZF8A 2HFGL 4TQPA 1XG3A 4Q2ZB 2FO4B 3IAQA 3KYMB 4IBLT 3K8LA 4KO6A 4AV0A 3TIDB 3BJ91 1YXYA 4UB9A 4WOZA 4MA1C 4LU0A 3EJRA 3VTRA 1P7BA 3O3DB 2I5YL 2VRJA 3B6SA 1DVYA 5IHZB 3QZNA 2WXIA 2OLSA 2HLEB 1KJ2A 1OYAA 1H0IA 1QLRA 3LS9A 2ESVE 1RZMA 4K7PX 3VZZA 4UINH 1AG6A 4UB0H 4UB0L 3O6ML 4NG3A 1XB3A 2EXSA 4IPIA 4X7TA 3TFCA 2ORBL 4F5CE 2GVJA 2IQTA 3PTQA 2C1GA 1D8WA 3TX4A 4Q6JA 2V5TA 1WB0A 1UW9A 4TNWK 2Z3FA 1HKLH 4AY0A 4IMEA 4ZXBC 1L9WA 1H3UA 2ESVB 1YUKB 2ICEB 1FCQA 4FOMA 3PNZA 1F4YL 1RLBA 5CFAA 2WV8A 5FYJL 1Q45A 3FEMA 4NAEB 4J23A 5T1KD 3ZTJG 3F6LA 2QAPA 1TTQA 1KTJA 4I0PD 2JKTM 5KVEL 4EX4A 2N1TE 5AD0B 3QKEA 4TMCA 1ED3B 3QAZB 2YMTA 4GRLD 3QHFL 2R94A 3A67L 3JV4B 2CRMA 5KETA 1MVUB 2UWEF 4NC2B 1F8TL 4KJPD 4NDMA 4WQOA 1PTAA 2P28B 3CLFL 4PMYA 2HFFA 1O7AA 3MRMA 2E6AA 2WMIB 4Z1DA 1BAFH 2VDQL 1H1YA 4Q33A 4OZIF 1U2HA 3QLLA 4HUWB 4OQVA 2F2KA 5DO2C 3OKYA 3Q2LA 1HJSA 3L3DA 2ZCKH 4R4BB 4WCYH 4MA7H 4E9RA 4DN4L 1UZ1A 4OLUH 4CC1A 5J9PB 3PAOA 2OCJA 3EGDA 4JE4B 5IBUG 5LQBH 3OL2A 2XH4A 4P46B 4H7ZA 4JQXC 4C4KO 4FGMA 4H0HB 3VIMA 5E8PB 2BY3A 5DVOA 4M6MH 1ISXA 1KCZA 4HJ1A 1I7TB 4JCWA 4TL4A 2NLJA 3ATBA 3K1DA 4FQXC 2NXZC 2DQEL 3C8DA 1VHNA 2X89D 4WK0B 4ZMTA 3M44A 3WD4A 2IAMB 4H0IA 1HEJC 2FKPA 4GXUN 1A7QL 5CQ1A 3RPIB 2F53E 5C9XA 2A6IB 2Y36L 1Z0MA 4H8PA 4KKPA 1HJBC 1ITXA 5CPTA 2W0LA 1V3MA 3TMLA 1CS6A 3NFNB 4R5XA 1LT7A 3KGTA 4K07A 2I60H 1EK3A 1W5QA 2AAVA 2NSMA 3F7VB 2PTYA 5ADOL 2H7WA 5CIPB 4ELMF 1EJWC 2NX1A 3NO3A 1EVTC 4S3JA 4FP8H 4PRPD 5I77A 1DEEB 3FCUB 4I48B 2A9MH 4LLQA 3DBPA 2A0LC 1IGML 4FFZL 1GOGA 3ARFB 4FXSA 4WHYG 4H88L 3AUOA 4M9OA 4DY1A 1A5FH 2B59B 1ZWIA 1IGIH 2EXTA 3D08A 1S7WA 1WFIA 4PJHB 5AOIA 4JLRA 1TTPA 1U93A 4PVMA 4O2FA 4PRPE 1EAQA 2BOCA 1UKSA 4XMLH 3WUWB 3BIKA 5T5FH 1YEGL 4R0LC 4AXNA 1AZUA 3HE6C 4YHEA 4B5WA 2D3LA 4RDZA 3EB4A 3PTMA 4P0DA 3IJSA 3RMJA 3UIYA 1YMHB 2XJLA 4O9HL 3OHXA 4HIPA 2VXQA 4GIOA 2UZ9A 5CC7A 3BX7C 3D6NA 3NPXA 3TR2A 1H3TA 1PIGA 2C7UB 3U46B 15C8L 1NWPA 5KYUA 3TVMA 1PSKL 5IMKB 2FZ9A 2OKOA 2X1TA 2ZZ5A 2E6QA 5TAOA 1X5KA 1KYUA 1A7OL 2X7VA 1EGJH 3NQCA 1A3QA 3M43A 4GB9A 2XVNA 1H3PL 1FVEA 1JZHA 1I1CA 4WSHA 5LHFA 4DWSA 4P61A 2RH0A 2DSVA 3TSMA 1AZBA 3BUYA 4NOFA 1E65A 4JZJB 2ID5A 5BOPA 5C0NC 1F6LL 5FKPB 1FIEA 4MRCA 4IBVA 2DMKA 3E1ZA 4Z9KB 5B80A 1K4HA 2QSVA 3D0CA 2VRAA 1HDMA 4XNXH 4Y16C 3S4SA 3A6BH 3H9SD 4E0CA 3ABQA 1CC3A 2NQ9A 1BG9A 3C2RA 3E1F1 3U30B 4Y2DD 2W5PA 2ZSWA 4KAQH 1WYJA 3U0WL 3ZKXB 3VD9A 4A7UA 4M62H 4N0YL 4NC1E 1G9NL 3B2VL 1LVEA 1A64A 1K4CB 2ZT9C 2YC1B 3TVMD 5K9KA 4GUJA 3SB0A 4MCYA 4DGVH 3PDOB 4P2RE 5D96C 2R1YA 4Y2DB 3TA3A 1UWGH 1IAOB 4AQEB 3AYRA 1F58L 2WTRA 4FNLH 4TQTA 4MRBA 3WKML 5L9FA 1JFHA 3MJ8A 1J11A 4KIRA 4R2GD 2W65A 4MB1A 2ZZUT 3ES6A 1P5BA 1QVOA 1YCSA 2FWLB 3QJVB 4MMYB 5GSVB 2CLVA 2N4IA 4P4RA 4QPEA 2EXWD 3UAEA 4B9JA 4FIQA 2KBGA 2ZX6A 4JQAA 2RGMA 4APXA 2E6YA 1KGXA 1HOEA 1IEHA 2CLLA 2J78A 3A4WA 3ZWSA 2VUOA 3LH2H 5AC8A 4BFAA 4XBEH 4RE2A 2OZ8A 3N85L 4BKTC 1KCUL 2WYTA 2CXEA 5F72S 4JPSA 1BZ9B 3O3AB 1JMZA 4AEIL 4GSRA 3MBDA 2W92A 1THAA 2X53A 3D48R 1FL3A 2LV4A 3GZKA 1XX9C 4FULA 2CALA 1SJMA 2UXFA 4I1NB 4ZOCA 4HK0B 1I0DA 2XIOA 5DQPA 1OGTA 4DJEC 3U30C 3G0UA 2YPVL 2OWXA 4TVSa 3OIXA 3ZE2B 3LNDA 4Y19E 3KYOA 1VFLA 4UQEA 4WDIA 1EO5A 2D7PA 2V7NB 3AS1A 3BGMA 3OIHA 2B0SH 1XYFA 2QR0A 4K8RL 5I8KH 1I60A 1T99A 6REQB 2W81C 5JHDA 2FVLA 3AISA 4QIRA 1JGVL 4HQQH 5C0DB 3MJ7B 3GXDA 3BSZL 3PWVA 4OUEA 1N64H 1LQAA 1TSIA 1Q9OB 2WGXA 1K6WA 4NKIH 3RURA 2CK2A 4Z3FA 5JPNA 2C0HA 3VNLA 1G5GA 4CEXC 4GBXD 3AY4C 4ZXLA 4CLMA 4HUVA 2R1WB 3HFMH 4WNQB 3MRNA 1GOOA 5J8LA 5LHEA 4QDPA 1Z3GL 2AZUA 1E9QA 3QNFA 3SCQA 4GIEA 3Q3GA 1I85C 2H0PA 4HUXA 3H7LA 4JCLA 4KJWC 1AR1C 2K8MA 4X6CA 1IE5A 1M3UA 1POKA 3SQOH 2WTOA 4HC1H 4MWAD 4AZ6A 2DW7A 1XLIA 2CKBH 1DUZA 4OH2A 4JRYA 5EZLA 1THFD 3DOIA 1UA6L 3NJKA 3MWCA 3RTLA 4X9HA 4PJ7B 5E6RB 2G75B 5IJVA 1A66A 2NX5E 1HKWA 1OK6A 2AKZA 5F6IC 4NQSA 4OLXL 3HJZA 1OCZB 4ZXOA 2YD4A 1MNUL 1G9MC 3TSBA 3GNMH 3KS0H 1F6KA 2QGHA 3QRHA 4ES8A 4M48H 2P7TA 1FFPB 1WV7T 2ALWA 2MH4A 2B31A 3L13A 4BHUI 2FT6A 2FJKA 3U4BH 3DKJA 2XQBL 1H6UA 2FYMA 2TSBA 4JTUA 2CR3A 4YWGL 3LERA 2XETA 2NX5B 1Y0LB 3EYSH 5BZDA 1TR1A 1XGZA 1OD0A 4LLUA 3JZEA 7XIMA 5HPMA 2VW6A 2BW5A 3HNTL 5E4OA 1UCWA 1K5NA 4HH9A 2CCVA 2Q8XA 1PZ5A 5DYFA 5ECGA 1I2NA 2JF6A 4NASA 5EZPA 1PAMA 5AVWB 4WK4B 3EYFB 5EA0L 1AAJA 1BOGB 1Q7MA 1W2VA 1XGPB 1EO7A 5AHMA 4F7PB 5I24A 5BWFA 43C9A 4X5QA 3CFJA 4ANUA 5FAGA 3MI2A 1UXLA 2R0KL 5D4JA 4DT2A 3EIFA 2BERA 4W9IC 5C0BA 3AUJA 5D7JA 4MX7A 3X3GH 1ETZA 1NY1A 5EEZA 1EEYA 3CAFA 5JR1L 1KFLA 1VCFA 2AMUA 4RA3A 4LSPH 5DCBA 4YK4B 3UTTB 4FQLL 3NL3A 1WV2A 1CDGA 1QRNA 4GKZA 4IGBB 1LORA 2E5DA 5EIQA 1JULA 2V5DA 4X6DF 3B7TA 4PG9B 3MRDA 4ONVA 2YA0A 2JJWA 3BUTA 1GOQA 4EBQH 3C2AL 3SY1A 2BMKA 4H9MA 1F90H 3W9EA 3QC3A 2VX4A 4DLMA 4HV8B 4F7PA 1V0NA 3C2VA 3LI1A 2CJUH 2NXHA 3IE9A 2NV1A 2YLKA 4HJ0D 1PKMA 3SQBA 1V6UA 1VCVA 3QHTC 4B5NA 1F3JB 1CDYA 4UOJA 4ZXBD 3WL9B 1EXHA 2CKBB 3W1ZA 4YSEA 3TH6A 1CF8L 1PG7X 1G1YA 1TF4A 2PPEA 3D3VA 3JBG7 4FZEH 4XMZA 1LK2B 3HPXA 1MEXH 2J6WA 4LLUB 3E9UA 4D0DA 4FYQA 1ZNNA 1Y0LA 2EDQA 1MLBA 1G6RL 1XMEB 3LQAC 3OR6B 3R4RA 1WS8A 4KBPA 3GKFA 3O05A 3WFDH 1TIUA 1YEKL 2XIDA 4LF3A 5D5ME 2BB0A 1A6AB 4RCAA 2B4CH 4O51B 5LKYA 1IKNC 3MFFB 1ILUA 3EJSA 5FFOA 3HMXA 4XZNX 5E4AA 2J7DA 2CW6A 5CLWA 4KZEH 1BQLL 4JX6A 5BMWA 4A8LA 1JHKL 1FAIL 1DQJA 3KWXA 3KLHD 1JNNL 5DD5H 3SUTA 3VB9A 2P5EE 2QQLH 3BISA 3FZUD 1DWGM 3TLLA 5HDBE 4K0OA 5C9JB 1MUCA 3F7KA 3NIDE 4EWND 4PV8B 4Z5RA 1L0QA 3UGEA 5ABFB 2IPUG 4JRYB 3TQVA 1BV8A 3VRLE 1ZVSB 4IBQA 3VNJA 2XKUA 1KCVL 1EEXA 5ADPL 2LGNA 2HN7B 3HZYA 1G1CA 3GZ3A 4X2RA 5E5CA 1A1OB 3QIWC 4JRYD 1ONRA 1L7IH 5M2FX 2Q3RA 4DELA 4AK1A 1CB2A 3GVQA 4IUGA 5E0FA 1LDPH 2BNQE 1LGVA 4LYKA 1IM3D 2C79A 3N9SA 1QSEA 1M01A 1Q9OA 4DGYL 3KX6A 4Y4KB 3D39A 1P84J 1W8SA 2AMGA 3NMEA 1V54B 2GSJA 4NN6C 1KTNA 3R25A 3BVVA 1XBZA 4AW4A 3SECA 4ZZ9A 1K8IA 3GMOB 2X4QA 2V6HA 3HGOA 4XBKA 3C3NA 1WZAA 1Q2SA 4MJ6A 4V1DD 1N3NA 4UQ2B 4Z7VE 5EEUA 2WXHA 3LG3A 2J75A 4BCZA 2A7BA 4LV4A 3CK5A 3QUXA 2ZE0A 3FY1A 2Z2UA 2YQ3A 3OTTA 5BS0D 2XYBA 4GI6A 3V6OC 4X0VA 4HU2A 1JZGA 4E5XG 2CCWA 2WNNA 3PWPA 5A1AA 1M1XA 2UY5A 4FFTA 2G3MA 4XVOA 4BK5C 3DHUA 4ZQOA 5C5YA 2ARJQ 4BSVB 4ZQCA 3MOQA 3DSNB 4KK6C 4R2GB 2P8LB 1DXEA 3V0FA 2Y3NA 4BELD 2CLVB 1FZOA 3MRFA 1QVOB 4Q14A 4G6AC 4XE5B 2BODX 1P6BA 3PUDA 1K72A 3MJGX 2A5UA 4MDIA 4EIGB 4FIRA 1P1MA 4GVIA 2NNAA 5T5NG 4B3ZA 3JRKA 4AQEA 2BVWA 4H6KA 2QFPA 5CJXA 5LG1A 3UCRA 4AIXA 2GJNA 4IIGA 3F1QA 1K4CA 1UWSA 1AW2A 3SRKA 3LRGA 3MUGA 2D2CC 2XA3A 4HZ8A 3IEAA 3GLAA 1WIPA 4P07A 5RUBA 3D06A 2O7SA 4S1RL 7REQA 1PBYA 4ZENA 4JZJA 2YPLE 5HVHB 3I65A 1A0QL 1IQDB 3MUXA 2FSDA 1P5UC 2DQDL 2BHZA 4LP8A 1BVKB 4HWBA 1KYDA 1VADB 4YHPB 3CHEA 4JPQA 4J3OH 3B37A 2PC8A 3ITLA 3PAVA 4YUEL 1GQIA 3WU1A 3BZFA 1JHKH 1FAIH 3DSFH 5E8OA 1TX2A 3GMPA 5EMMA 3H55A 4S2BA 3WCZA 1U92B 5LA1A 1FWTA 2FBRA 4AY1A 2V5SA 5HVFB 2D7NA 2BWDA 2EC9U 4E9YA 2F5BL 1LE5A 4ZQNA 2Y1ZA 2HBXA 3NZUA 3P3SA 4XOCA 3DVGB 1I82A 5DRXB 3V0AC 4JLRB 5IMLA 1H5BB 1NP2A 1G4MA 2X70B 4KKQA 4FTVE 1O60A 2B59A 3GRWL 1P2CA 5IVZA 3P73B 2PDCA 3DI3B 2MNWA 3S0PA 4HPGA 8CGTA 2AERT 1Z5YD 2YGPA 3E9TA 2DJSA 2GGIA 2NY0B 2YZ8A 3CZFA 6CGTA 1OYBA 3EJJX 5CPSA 3WUEA 3ZDWA 4NN7C 1FG2B 5HWJA 4UQCA 4KWSA 1OBAA 4G6ML 3W83A 3C5SB 3O4LD 2CLFA 3VXNB 5D55A 4OLUL 1LO3H 2YL5A 5C0EB 2G50A 3CVHA 3OJ2C 3WQ6A 4PUUA 3MCKA 3VGAC 1XIDA 1FCGA 1WEJH 5SX5K 4OZIA 3A4AA 3S88H 4X7FC 3ZPDA 1SSDA 4YJZL 3FQNA 1BAFL 3EGSB 1J5OH 1UROA 4BF9A 4WW2F 2A79A 3MVIA 2VLLA 5F1IA 4NKCA 5E8PA 3TXAA 4JQ1A 4LYQA 4LAQL 4CEUC 5A2KH 4UWQB 1AHWB 5JPMA 3UYCA 5AZ1A 3GM0A 5KSBA 1MJ8L 3LKSB 4G6KL 5DT1L 2VE6A 5EU7E 5J9PA 1NC4A 2W0UA 3NM3A 4L4MA 3REQB 2QVIA 4MLIA 2FVKA 4HNVA 2IANE 3WEMA 1NGQH 1FH9A 1H61A 1HQRB 1FIGL 3HGRA 2HFFB 2V2CA 4JM2F 3TA3C 1VPXA 1OP3H 3QFJA 3Q01A 3NPWA 3KFTA 4R26L 1FYHB 1RZ7L 2VN3A 3JV4A 2ZWKA 5C08E 1GGBL 3AB0C 5IMOA 2OG9A 1XF3A 4UT9H 1YDPB 5FM8A 3TURA 3WMBA 2V2WB 2YOAA 1XSOA 2VFFA 3KXQA 1D5XB 1E5JA 2VEFA 1TMCB 3BH9B 4DJFD 5LWYL 4NAEA 1LEGA 1RQ5A 3TWAA 2Y1AA 1OIFA 1NWUA 2PDNA 2BWGA 3Q5TA 4PUBL 4PGEA 2DBJA 1XF0A 2WNZA 5CSRA 4W9FC 4XCFL 1XQLA 5DRZA 3TV3L 2WKJA 3CQ0A 2DIJA 2MHAB 5EEYA 4UFMA 4GJIA 4QHKJ 3REWB 3GU1A 3E2SA 3WYRA 2FR4B 3NIYA 1VYRA 1U58B 3UPCA 3OZKA 1CTMA 2HFGH 4GBXC 2XTSA 4BI5A 5C9WA 1A0QH 5IQ7H 3OGRA 4JN1H 3FSTA 3GB7A 3L5JA 3M0HA 4H19A 4FFVD 1SY6A 2NQDA 3PIQB 1I3GH 3WMPA 5KANI 1LE9A 4G7FA 5GHWL 1QLRB 4OGXH 4QTIH 4E9TA 2FBJL 4IBWA 4O15A 4IG2B 1IM3B 2E59A 2VZUA 4G6JH 5AB1A 3IJIA 1B4EA 1QR4A 4YTTA 1CIC