1RQEA

Propionibacterium shermanii transcarboxylase 5s subunit bound to oxaloacetate
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
472
structure length
472
Chain Sequence
PREIEVSEPREVGITELVLRDAHQSLMATRMAMEDMVGACADIDAAGYWSVECWGGATYDSCIRFLNEDPWERLRTFRKLMPNSRLQMLLRGQNLLGYRHYNDEVVDRFVDKSAENGMDVFRVFDAMNDPRNMAHAMAAVKKAGKHAQGTICYTISPVHTVEGYVKLAGQLLDMGADSIALKDMAALLKPQPAYDIIKAIKDTYGQKTQINLHCHSTTGVTEVSLMKAIEAGVDVVDTAISSMSLGPGHNPTESVAEMLEGTGYTTNLDYDRLHKIRDHFKAIRPKYKKFESKTLVDTSIFKSQIPGGMLSNMESQLRAQGAEDKMDEVMAEVPRVRKAAGFPPLVTPSSQIVGTQAVFNVMMGEYKRMTGEFADIMLGYYGASPADRDPKVVKLAEEQSGKKPITQRPADLLPPEWEKQSKEAATLKGFNGTDEDVLTYALFPQVAPVFFEHRAEGPHSVALTDAQLKAEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords transcarboxylase 5S subunit
publication title Transcarboxylase 5S structures: assembly and catalytic mechanism of a multienzyme complex subunit.
pubmed doi rcsb
source organism Propionibacterium freudenreichii subsp. shermanii
molecule tags Transferase
total genus 194
structure length 472
sequence length 472
ec nomenclature ec 2.1.3.1: Methylmalonyl-CoA carboxytransferase.
pdb deposition date 2003-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00682 HMGL-like HMGL-like
A PF02436 PYC_OADA Conserved carboxylase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1rqeA01
1ZAHA 2RDWA 3HIJA 3HMJG 2WNQA 2I14A 3IVTA 1K3UA 2E6FA 3HGSA 4QNEA 5G2HA 3ZWSA 3QYQA 3GXPA 3GAKA 4JYEA 1EEPA 4O4VA 1HO4A 4ADSA 1KFEA 1ML1A 1PCWA 3BW3A 4X3ZA 1I2NA 1PHWA 1F76A 3PUOA 4NNAA 4ORMA 3KX6A 3PG8A 3QQ0A 2BTMA 4MYXA 3T55A 4IPJA 1HUVA 3P82A 3WFAA 4UIOA 1LBFA 1M7OA 3LERA 3L5MA 4FIQA 2YCEA 1FCQA 3QRHA 3CU2A 1SZGA 3UNDA 1KFLA 3W9ZA 3LCIA 1DQWA 1D9EA 5U4NA 3GXNA 4FF7A 5D33A 3PR2A 3TX9A 5F4SA 4NJHA 3W7EA 3FIGA 1B57A 3PBVA 2GQAA 3A23A 3C4UA 2NWRA 1G4TA 2DZUA 5AC7A 2H3DA 4JX5A 2ZRUA 3LDVA 5I3GA 5D2YA 4RX0A 1H61A 3DHDA 3TKFA 4O1DA 4NUWA 1W8SA 5I3HA 3GVGA 3UYCA 4EWND 1UCWA 3CHVA 1OG0A 1XM3A 3N73A 1XBXA 3QSRA 3G1HA 2ZA3A 2EAWA 3GDMA 2OT0A 3E0IA 1QO2A 2AAMA 3OVQA 3STEA 4RZ6A 1DL3A 3PVFA 1SFJA 1X1ZA 1VCFA 5BOOA 4ZQMA 5A8GA 3LI0A 3C0JA 1SR9A 3M47A 4HPJA 4K8HA 4X22A 1YXYA 2JK2A 5HQEA 3QH2A 2CFFA 2Y61A 1FDYA 1TRIA 1JCLA 3BK0A 2LLEA 4LS0A 1W0MA 2WSQA 5KMYA 2WJZA 1SQ7A 1LTDA 2V2DA 1TCDA 1A5CA 3C56A 4AWTA 2VC6A 4MZ8A 3L21A 3P60A 1Z42A 1GTEA 1AL7A 5AHIA 3P84A 2ZCGA 1KM1A 3S1UA 3FKKA 1X7FA 3NZ1A 3HOJA 1ADOA 3O6YX 5D09A 3PBYA 5H2ZA 2FTPA 2ZDRA 4O12A 1UUMA 4IX0A 4ML9A 4AF0B 1LORA 1UB3A 3QPYA 2CLKA 3GR7A 5K9XA 2QCMA 4OGZA 1W3IA 3DFQA 1GZGA 3NVTA 2E6YA 3MP5A 2WNNA 3S0CA 3IIOA 4UC5A 4DEFA 3BO9A 1SPQA 1GOXA 5EL1A 3IIXA 4OE7A 5I3JA 2ZRVA 4NT0A 4UTJA 4MFEA 4DF2A 3LRKA 3SI9A 4FO4A 5AHLA 4AHQA 2Y62A 3HG2A 4NZFA 5D02A 1RV8A 3P67A 3MP3A 4X9SA 4K38A 4WX2A 1YPFA 4LRTA 4CQ9A 3TNOA 1NSJA 3UWUA 1TO3A 1OJXA 4ADTA 2KZHA 1GWJA 3GZ3A 3Q94A 5LNRA 1S5TA 3N9SA 3WK1A 5KITA 1BKSA 4FEZA 3G1VA 1B9BA 2ALDA 3MI2A 1IXQA 3IRDA 2TMDA 4LVBA 2CZEA 1PE1A 2JBMA 1XDLA 3W1XA 4PTNA 2F84A 5D03A 3VCRA 2J9ZA 1HO1A 1N55A 2GOUA 4R34A 2CU0A 3I6RA 3I68A 3S6DA 5TQLA 3UY7A 3U6WA 3U8GA 4RZ4A 2P10A 1VYSX 1LYXA 1O4UA 1PV8A 3PY2A 3P7YA 4JX4A 2QKFA 1QNVA 4N02A 4AWUA 3TW7A 5FI8A 2QF7A 2C3ZA 4UR8A 1R2TA 1Z48A 5D37A 5C6MA 3B06A 4O8RA 3GDKA 2ZYFA 3NL6A 3VI2A 1W5OA 5A5WA 3G8RA 3ABSA 1RQBA 5CPMA 5T26A 4JEQA 4EF9A 1LLWA 3ATZA 5D38A 1TPFA 1XL9A 4PL1A 2C0AA 5CPLA 3SR7A 2VFDA 2EKCA 1KV8A 3KOFA 2DJLA 2VFHA 3B05A 2CLIA 1J2WA 4KFPA 1ZAJA 4A21A 3YPIA 3LBMA 4CCCA 5K2ZA 5D2VA 2E1DA 4QISA 3PUDA 2X1SA 1KTCA 3GX9A 4G1KA 1QPOA 3EX1A 5CKSA 3UWWA 4EIVA 2FIQA 4K6AA 1WXJA 3I7SA 2B0MA 2A6LA 4MZYA 1TPH1 4ZQNA 2R94A 1T99A 1W3NA 3R5EA 2B4GA 2R8WA 5EBUA 1FWSA 4R33A 3HJZA 5HULA 3NQ2A 1I2RA 3LHVA 1F6KA 4O17A 2ZZ5A 3Q2DA 4RZ5A 2P1FA 3UQNA 3MI6A 1TPVA 3W6YA 5LHFA 2WO5A 3M41A 3M5YA 5D2WA 3KVJA 1H7OA 1DKWA 4Y96A 3H54A 3NQGA 2AGKA 4RLIA 3W87A 4NZJA 3F4NA 3O06A 3NM1A 2XN1A 5G5IA 2YPIA 3TUUA 3K30A 2V2CA 2X30A 2ISVA 4ZL1A 4ZMGA 3LCFA 4RXGA 4JXCA 4PODA 3Q58A 2VFIA 3RF9A 5HWNA 3LXCA 1QDSA 3MI3A 5K4ZA 1JQVA 1SFLA 4TU1A 2PCQA 1GT8A 2ABBA 2J88A 3W7KA 1W5PA 5LKYA 2PURA 3W1MA 3NO5A 2TSYA 3LCHA 3W2UA 5HUOA 3G3MA 4MIMA 1VYPX 1YYAA 3QW4B 3KFTA 1PCKA 1DVJA 1VLIA 2CLHA 1KBJA 4UFLA 2NXHA 2VEKA 1KM2A 3ABRA 1SW7A 3OA3A 4HIBA 4GRSA 5AHEA 1EWEA 2J6XA 2C13A 3R13A 2QEZA 1TV5A 1Y0EA 2DZTA 2QJGA 3ZFHA 1E51A 4IPIA 3L67A 1F6PA 1A50A 4DO5A 4M7SA 3DFNA 4Q33A 4XZ9A 3W3OA 2VEPA 3W1PA 1TRDA 3LTSA 1LLZA 5G2WA 1B3OA 4JTGA 1TV8A 3MW7A 1K8XA 3IIVA 2X1UA 4XUGA 5G1YA 2WPBA 3I7QA 1C9DA 4N9EA 2NUWA 3DFOA 2DZVA 2E6AA 2QCGA 2PRMA 2F7FA 1VHCA 1JUEA 2ZRWA 2D73A 1GVOA 4DF0A 5FF2A 1CI1A 2E77A 4O53A 3PG9A 4WOQA 3A22A 2BZNA 3NEVA 3W1QA 4NU7A 4IX2A 4HHPA 3RK8A 3TH6A 1VC4A 3HPXA 1OX5A 1X1OA 1ME7A 4A22A 1LROA 1CW2A 5C5YA 4JIPA 5LNVA 1J5TA 4HKPA 4LS1A 4JYDA 4MY8A 1TSIA 3B03A 3LB0A 1KM6A 1ZCOA 2E6DA 3NPWA 2Q8LA 1PHQA 3SW6A 3KXQA 3NGJA 2ZZ4A 5DY2A 1WAUA 2BSLA 2RDTA 3I65A 2V5BA 5DCDA 1D3GA 2OZ0A 3GXTA 5DXYA 4Z08A 3P80A 3IGSA 4NVTA 3O05A 3UWZA 4KWWA 3V75A 4PA8A 7TIMA 2ZTJA 1FX6A 1N7KA 3A5FA 3O07A 4YL2A 4Y90A 1F73A 1KA9F 1WQ5A 4RK8A 3PM6A 3W1LA 1K8YA 3DKLA 5BW6A 3LRLA 3P8JA 4CCDA 2I9EA 4AMAA 2G5WA 4RCXA 4UR7A 4IOTA 4YMZA 2VFFA 2E5DA 1NF7A 1W1ZA 3W2MA 4UTWC 5DBUA 3BG9A 3A5VA 3KRSA 1MZHA 2A6NA 5F2GA 2Y85A 3QQ1A 5CZTA 3G3DA 3EEGA 4DO4A 1BWKA 1PS9A 4A2RA 1B4KA 3KVKA 3FLUA 4Y9AA 3NQ8A 3EWUA 4Z1DA 2Z0IA 5I3KA 4TMCA 4CQAA 4K39A 4LS2A 2NX9A 4JTEA 4RKAA 3OEXA 5DLCA 2YDAA 4U28A 5AN7A 2H8ZA 4LVAA 4N4QA 4MFDA 4JN6A 5CZ0A 1YXCA 2DZXA 1FWRA 1O95A 4DF1A 3W86A 2GUUA 4BWLC 1DBTA 5GVJA 3W1NA 4DPPA 2O7SA 3UZ5A 1W31A 4UNLA 3WJZA 3HGRA 3G0XA 1YXDA 5G1TA 1EP3A 1M6JA 5KTLA 5BMXA 4GWEA 1XBZA 1OX6A 3FKRA 4UFMA 4NQ1A 3DH7A 3NXFA 1KFCA 1G67A 1NF0A 1TQJA 1OHLA 3PAJA 4N9CA 5C55A 1AW5A 2GQ8A 1MEHA 2VFEA 5J5RA 4P2VA 4IWWA 3H53A 3F1QA 1WOBA 3TSDA 2W79A 4JTSA 1L6YA 2V30A 1LBLA 5D04C 1X6UA 3W1AA 3IVUA 3PF3A 3TU9A 6ALDA 3NQ6A 4FNTA 1IXPA 2ATSA 3B0PA 5TIMA 5KINA 4ICNA 1W56A 2X2GA 1T0OA 3WK0A 1OX4B 5K4XA 2VENA 3EXTA 3M0ZA 1GVQA 5CSSA 4CCEA 3W70A 3DZ1A 1VGAA 4O13A 3R12A 3CC1A 4RJEA 2GPTA 3LXAA 3G0SA 1FCUA 1HL2A 1W5QA 1Q3NA 3AO0A 4TO8A 1DJNA 3PB0A 2CW6A 1RPXA 4CNNA 3TCEA 1WV2A 2QDGA 2YYUA 3VFLA 3NQMA 3RFAA 4IQLA 4N9DA 3OBKA 1FWTA 3EX6A 3LI1A 5D30A 1JQXA 5CPOA 2ISSA 4K8EA 5HMSA 2E5CA 1G7VA 1DV7A 3HO8A 1LOQA 3NPUA 1G6CA 1SO5A 3O6DA 3PBWA 1VHNA 5CG7A 1TPC1 2FLIA 3SFKA 3C61A 4ORIA 5AYZA 2WQPA 3MYOA 3QW3A 4D2JA 3BPWA 4JD4A 4FNSA 1JCNA 2IQTA 2ZBTA 3UXDA 4I7WA 1FDJA 4Q4KA 3W1TA 4L4MA 2A1YA 4DBDA 4BF9A 4JIQA 1JCMP 3GIYA 4WXZA 4JNMA 1MEWA 2OJPA 4ZVJA 2Y88A 4MOZA 4XKYA 4UXDA 1SSDA 1V5XA 1ZY9A 1FCVA 3LBCA 4O52A 6TIMA 3ELFA 1OYBA 4MKNA 4IMEA 4GUHA 4ZQOA 1H50A 2NUXA 3H55A 1W37A 1XDMA 3W7HA 1SZFA 1LZOA 4X2RA 1KM3A 4FX7A 3R89A 1OX4A 2DZWA 2NLIA 3W2KA 3LCLA 4O0KA 3TQVA 2EPHA 3W74A 2CLFA 1AMKA 2Q8ZA 5D2TA 4EF8A 4M7TA 3FOKA 3L5AA 4CQ8A 3A24A 5LZLA 4UMBA 1HFBA 1JUBA 1I2PA 4LV9A 3P61A 2Z6JA 1OFRA 1FXQA 3G1XA 1UBSA 2YW4A 4PCFA 2G95A 3RNDA 5E1QA 3M5VA 4IJBA 3G18A 3LHYA 3BLEA 1JCXA 1KM4A 2B7QA 4UFKA 3JS3A 1KTBA 4AXKA 4AAJA 3B4UA 3HG5A 1M5WA 5G4EA 5FEWA 2A5HA 1TYGA 3KRZA 1OF8A 5FEXA 1ICSA 5EY5A 4RXFA 2WSYA 1JCJA 2QUUA 4DQWA 1PIIA 4PFMA 4JX6A 2E09A 3TK7A 1YDOA 2ZZ6A 4WOZA 1VR6A 5LNSA 2JGQA 4LNYA 3C6CA 3DAQA 4JICA 4AVFA 1SZNA 4LRSA 3LOTA 1KTNA 1G4PA 2J9XA 3C2VA 3HG4A 2VKZG 1LM1A 3QPZA 1AW1A 3S5OA 4MJMA 3TJLA 3KVLA 4H4IA 4JDYA 1IXOA 2QUVA 4Y6GA 1H7XA 4FB7A 4FNQA 3NR0A 4PC8A 4W9TA 1O5KA 1MSSA 2TYSA 1TTJA 1G4SA 4OT7A 4O54A 2Y7GA 3LV5A 3T78A 1FQ0A 2RKXA 2GJNA 4LUJA 4A29A 3M1ZA 3GAYA 1PVNA 3W7GA 5E93A 3OHIA 3DENA 5CGQA 4K7YA 1VH7A 1S3HA 2QCDA 5CZSA 3TAOA 5DCBA 1XBYA 3BW4A 1V7YA 2CWNA 3QF0A 3LHTA 3M6YA 4Z1CA 4Z0JA 4H6KA 1H1ZA 2ZZ7A 3CWOX 3D0CA 2QCLA 1MXSA 4N6EA 2C14A 3QMTA 4LU0A 3SZ8A 3WJYA 3NPXA 4RR4A 4MLJA 5CPNA 1FBAA 3TW6A 3TC7A 3P8IA 3ATYA 1P0KA 5G4WA 3RMJA 1QPQA 4N4PA 3QSTA 2NZLA 4NNCA 3HBLA 1I2QA 3FFSA 1P1XA 4O1BA 3GNNA 3L0GA 1FWNA 3V1PA 5LGZA 1F74A 3NG3A 2C19A 2FQIA 2O7QA 3NM3A 3B0VC 1GVRA 1SO4A 3W2LA 1WYIA 1RR2A 2G96A 1K8ZA 3QMRA 4A3UA 5DN1A 3Q37A 3DBPA 1ZNNA 2A7PA 2YFNA 4MZ1A 3O63A 4LW7A 5BMWA 3T44A 1OFQA 4IMGA 4GUIA 1HG3A 1M7PA 5FF4A 3USBA 3DI0A 1S5VA 2QR6A 3CLMA 4GXMA 3UPWA 3EWZA 3MBDA 4O18A 1XBVA 4N9BA 3DHFA 1FY6A 4NXSA 3W7OA 3GNDA 4YCOA 1TJRA 2E5BA 4WUIA 4YCPA 1CX9A 3LHWA 3W22A 3LHUA 3MUXA 3NL3A 4C1KA 3IIPA 1OVDA 2PRHA 5DY3A 4CNPA 3EX4A 1H1YA 4MVAA 2JKEA 1EPXA 2A2IA 4Q32A 4M6QA 5F2MA 1W3TA 4NJGA 4O0ZA 3W7JA 3QZEA 4CNOA 3HPSA 4PEKA 3T4CA 4K7VA 3QC3A 1TPDA 4HNNA 3EWYA 4POCA 2QCHA 5L6UA 2Y70A 3KAOA 1DQXA 1Z41A 5G2IA 1TV7A 3IIZA 4S1FA 2QCCA 1I45A 4FHAA 4LVGA 3M7WA 3N19B 4GBUA 4IGHA 1EIXA 1Z44A 3LXBA 2DJXA 2BXVA 3W7PA 3W7RA 4DPQA 3LHZA 1LRQA 3TSBA 2BX7A 1GYLA 1R2SA 1YTKA 3E12A 4IMFA 3P74A 3HF3A 4IXXA 3CTLA 3S5NA 1JUKA 3QM3A 3DFTA 3VKJA 3GDTA 3OVRA 2ZA2A 3W7MA 1C29A 5KZDA 1GPWA 3GDLA 3KVMA 3RLVA 5EYWA 2VFGA 1AK5A 1KFJA 2YSWA 3M44A 1DJQA 1VLWA 4JY8A 1KFKA 4AHPA 5AHFA 4Z0SA 1W5MA 1I4NA 2R91A 4WZHA 5MHBA 5F1UA 3B04A 2NXIA 4GUFA 4QAIA 2ZA1A 3PSWA 1P4CA 3TQKA 3W7NA 4ONVA 1NEYA 2HTMA 3LCWA 4WXYA 4FIRA 3MHUA 2QJHA 1YDVA 3O8AA 1XKYA 3NQDA 1YADA 4JTUA 1TPWA 3ABQA 5K3VA 3AJXA 1OABA 3EWWA 2W0UA 4LVDA 1VYRA 1TPEA 3EX3A 3G22A 2QUTA 2B7PA 3MJYA 3ANYA 1L6SA 4OV9A 4N6FA 2YX0A 3UWVA 1SW0A 3CT7A 1Q6LA 4TX9A 5AYXA 3W1RA 1EUNA 2CLOA 1GQNA 4O14A 3M5ZA 3GDRA 4NXKA 3W73A 4E2DA 3TXZA 1QCWA 1VZWA 3M9YA 4JS3A 4LC8A 2WSRA 2X1TA 2YYTA 2Z6IA 2V9DA 3NL2A 1JR1A 1H7PA 4M6VA 3DKJA 3LRMA 8TIMA 4DELA 4UNKA 4BWLA 1G69A 5EKYA 5FF3A 4NJJA 2VEMA 3HGJA 3HQ1A 2ZFAA 4UTLA 1ZHAA 2ATMA 4AWSA 2ZTKA 1KLYA 1BTMA 1K7EA 1UJPA 3DI1A 3SIZA 1PL9A 3E49A 3W85A 2QAFA 1R30A 1KM0A 4O28A 4HT3A 4GFSA 2PRLA 1SW3A 1GVSA 4I9AA 3LTYA 2CLLA 4YWIA 3CEPA 3B8DA 1NFBA 4NX0A 1WOAA 1IIGA 4FXSA 1TTIA 5E0KA 2ZZ3A 2YFOA 1A5BA 3GYEA 3PC0A 4AH7A 5EPDA 2WNZA 1EUAA 1QAPA 5C2XA 3EX2A 4WQ6A 3EB2A 2A21A 2EHHA 4UTTC 3W2NA 2NWSA 2YZRA 4HN4A 3UWYA 1WBJA 2V82A 2A7NA 4N2YA 2GQ9A 4GE8A 2X16A 2H8XA 4WY0A 1TIMA 1Q45A 2A7RA 5BRBA 4A2SA 1IXNA 2QJIA 3A21A 3N3MA 4FX6M 3S1XA 1VPXA 1A53A 3TA6A 4UFHA 2OMAA 2WV8A 3EWBX 3S1VA 4XBSA 1QOQA 1TTPA 3E9AA 1JRCA 3TMLA 4B5NA 5D2XA 2ZRXA 3PUEA 3F03K 1TPUA 1WX0A 4H3DA 2DORA 2YR1A 2FFCA 3RLUA 3S8HA 3OIXA 1OFEA 5KZEA 1OFAA 2QAPA 1W5NA 2R14A 3FJLA 4XKYB 4AEOA 1R2RA 3BGGA 2XFWA 3G24A 1F05A 1IF2A 4OQVA 3VE9A 4QIUA 4S2BA 4UCGA 3QMSA 1L9WA 1G7UA 3MWAA 4QJ1A 5HR6A 1ALDA 4ZZ9A 5IBXC 3LLDA 1LBMA 1T96A 3TV8A 4TR9A 2WOQA 5AC6A 4LWWA 3NQFA 1TQXA 4J9JA 4Y8FA 3IGUA 4XQ6A 4UTMA 4NNBA 2FJKA 5J5DA 1K03A 3TMQA 2V8ZA 3JRKA 5F4WA 3EXSA 3TFXA 1O94A 1VCGA 3BLIA 1QR7A 3C3NA 4BFAA 1KM5A 2FDSA 3QJAA 1YTDA 4O19A 1TMHA 3JR2A 5KZMA 2DU2A 3THQA 1LDCA 1YLVA 3UY8A 1GJPA 3STGA 3PBUA 4UTKA 4PH6A 1XI3A 3W7QA 5FEPA 1ICQA 3TIMA 3B0UX 1ZALA 1H7NA 4K36A 1FUYA 1EP2A 4JGDA 4JTFA 1H63A 3N2MA 1N8FA 3WK2A 4MUZA 3E02A 3W75A 2G97A 2VOMA 3GR8A 3TQ0A 2NV1A 5DBTA 5FF7A 3LM7A 3U2OA 4EVZA 3W83A 4O50A 3SECA 2PE4A 3BV4A 3TC6A 4UTIA 1SO6A 5AHNA 1XCFA 1K7XA 2A85A 3E96A 2Y63A 5HINA 5HWJA 3M43A 5I3FA 3ZS4A 4HNVA 1JRBA 4ZQCA 2EGZA 1FXPA 1ICPA 1DOSA 5SWUA 4U4MA 3C2FA 3TXVA 4R53A 3NQCA 3TR2A 3MHFA 2TPSA 4IXHA 4KWVA 3CB8A 4DO6A 3BARA 2H3BA 3W72A 4P61A 5BNKA 4LUIA 1JULA 2B7OA 3UPBA 1GYNA 2C1HA 2Y7FA 1ZENA 5FESA 4LV4A 5K9DA 2CLMA 3FS2A 1DORA 3IV3A 1GVFA 2QCDB 1T8XA 3W88A 2V2HA 3LCGA 3ABOA 4O57A 4KFOA 4ALDA 4AHOA 3CIXA 3VE7A 3O6CA 4C1LA 2JKAA 1VQTA 2Q3RA 4HNUA 1TTQA 1NAL1 1UUOA 5H91A 3W7IA 3VNDA 4JYFA 4OV4A 4LC6A 1X8FA 2ZZ2A 2Y7DA 3W71A 3MYPA 4EOUA 2FB3A 5LNWA 3IEBA 3P5YA 4FNPA 3O15A 3HGOA 4UMAA 1A5AA 4M5PA 1GG1A 1O5XA 4TIMA 2RH9A 1VS1A 3HG3A 3LGEA 4GUGA 1EWDA 1RQEA 1AL8A 3TAKA 3CPRA 3DGRA 3MP4A 2HS8A 4R7JA 2FPTA 1XXXA 2Z1BA 4UTUA 2YW3A 1GTHA 3CWNA 5LHEA 2ZRYA 1H60A 1D3HA 5DCEA 1IGSA 5FF0A 5CSRA 4S2CA 1H7WA 1ME9A 1OFPA 3G1AA 1L6WA 4MY9A 5F2LA 3W84A 1OFDA 3IVSA 1YTEA 4XWUA 1FDZA 1Q6RA 3SGZA 2EF9A 2GJLA 2TRSA 5EA9A 3LV6A 2C16A 2OT1A 1C8VA 1WDWA 4IMCA 4JTJA 1JCYA 3MO7A 5D05A 1B4EA 2YXGA 1LOSA 1LRTA 2DP3A 2V5LA 3CQ0A 2WKJA 3FEMA 2J9YA 3HPZA 3R2GA 5K9CA 3L0KA 3NPVA 3C2RA 3T7VA 4GUJA 4O1AA 3PWAA 1O60A 1MEIA 3TSMA 3NNTA 1OF6A 5AYYA 3C8FA 2RHGA 1W54A 3LX9A 3DXIA 4XBKA 3LTPA 4E2BA 2BWGA 2ZRZA 2QCNA 2HSAA 2Y6ZA 4O4WA 3W7DA 3TE9A 2GVGA 3TDFA 3NZRA 2UV8G 1H5YA 5DELA 1THFD 3UWQA 1DHPA 3G1FA 3BW2A 5HJLA 2GVJA 3W76A 4I7UA 3IGXA 3P5ZA 3P62A 4UFIA 3NA8A 5AB3A 4AF0A 4MLRA 1TPB1 2DZPA 5D32A 1UASA 4QM1A 4FNRA 1RZMA 3N2XA 3MHGA 2A4AA 4ZQPA 4O11A 3N9RA 1TJPA 1HTIA 1QMLA 3NQ7A 1Q6QA 1NVMA 4MJZA 3W2JA 2JGYA 3PS7A 2CZDA 4Z1BA 4L4LA 4WJEA 5LGXA 2Y7EA 3WK3A 5HWMA 1QWGA 3L5LA 5EMUA 4XTDA 3M5XA 3OG3A 4MPQA 1OFBA 4FNUA 1AG1O 3EXRA 1KW1A 1GEQA 2Z2UA 3A9IA 2XN2A 1EB3A 3S9YA 4LTSA 3FJ6A 3NQAA 2C15A 5IM51 1JVNA 3GLCA 1QO5A 3CEUA 4M19A 3NYZA 4E0CA 1A5SA 2GVLA 2ZQ0A 4BI5A 4FXRA 1IIHA 4KKXA 3UZJA 1F7BA 1TREA 2VELA 2VEIA 2NX1A 3G8EA 1RQHA 3WJSA 1EA0A 2H6RA 1ZJIA 1GG0A 1TB3A 4GJ1A 4OBTA 4YLWA 3OVPA 2FB2A 3BG3A 1ME8A 1ZFJA 4ZQRA 2I1OA 1U5JA 2Q3OA 3NOEA 1F5ZA 1F2JA 4O16A 4GNJA 4NJKA 3FYOA 2A0NA 2RDUA 3PSVA 4JTTA 1QPRA 1SU5A 2FPYA 1R46A 4HSOA 2W6RA 3ZWTA 3HB9A 3M16A 4O10A 4I7VA 1S5WA 3I7RA 2AQWA 1XUUA 1P5BA 1XC4A 3N14A 2QDHA 1K7FA 3G0UA 3FYPA 1L2UA 3EWXA 4ADUA 3PB2A 1I2OA 2RFGA 5U7SA 3GKFA 5DXXA 1VJIA 4QSHA 3MBFA 1SUXA 1RD5A 1ZAIA 1ONRA 1WA3A 2BLEA 4QQ3A 2HS6A 4BI7A 4WY0F 3GK0A 4QITA 1U83A 4NJIA 3NL5A 3TJXA 1VRDA 1SZEA 3L68A 2ISWA 3S42A 3F4WA 4AB4A 4BR1A 1LRNA 3G1YA 1H62A 3TFCA 2HMCA 4JTHA 4TMBA 3QEZA 3UD6A 1QOPA 1YPIA 3G1SA 3O16A 4JR5A 1LOLA 5KSWA 2CZFA 3T40A 4WD0A 2P0OA 3QFEA 3L65A 3DFSA 1MO0A 2H90A 3L9CA 2QCFA 4GC4A 2V81A 4CLMA 1OFOA 4OU1A 2QCEA 1LP6A 3CM4A 4IMDA 4DXVA 1BEUA 4O1CA 3RU6A 3WJXA 3THAA 2NUYA 1OK4A 1H7RA 2NX3A 3G1DA 5I3IA 1JJKA 2VXNA 5HR7A 5F2IA 4UTWA 3S5ZA 2ZZ1A 1WBHA 1I8JA 3C2OA 3EKZA 3S5YA 3LLFA 4WY0B 5F4XA 4MYAA 1SSGA 3W7LA 2C18A 5ABTA 4LOCA 3W7CA 2CLEA 3EKLA 4MY1A 3L0NA 3TROA 4M6PA 3W07A 2FPVA 3MMTA 4UTTA 1OYAA 3DU0A 4K37A 5K7JA 1EX5A 2NV2A 3L2IA 3GB6A 4BK9A 3C52A 4OHQA 1XUZA 5TBOA 3CIWA 3SSJA 4RV8A 3SY5A 4UUIA 2C6QA 4JTKA 2NXGA 1VCVA 2CZ5A 4QNWA 4HPXA 1G4EA 1OK6A 1K02A 2E68A 4IUOA 3W23A 4E38A 1P0NA 3INPA 2B7NA 1KBIA 1Q6OA 3SJ3A 1SO3A 3BLFA 5CZJA 5HNRA 4NX5A 4XTIA 5AFDA 2OCZA 3DFPA 3R8RA 3STFA 4KFNA 2XN0A 1KLZA 5LSMA 4O15A 1LCOA 3W1UA 1QPNA 4JDBA 5AOUA 3C2EA 4Z1AA 2YGYA 4LVFA 1AW2A 5AHMA 2V0TA 4BI6A 4YXGA 5C54A 1EP1A 4UMCA 3P81A 1YDNA 2DZSA 4OWGA 4HNTA 1BWLA 4LT9A 2OX1A 4UFJA 3STCA 5LNUA 1R47A 5HUPA 5IBXA 2JKPA 3BG5A 1XFBA 1FCBA 3N34A 3L66A 4LY8A 1OYCA 1QFEA 1H51A 5F1VA 1RVGA 3WJWA 3S1WA 3UXAA 4UTHA 3O1NA 3LCXA 2PC4A 1KFBA 3NDOA 3BVJA 3GKAA 4HSNA 3KHJA 5L9FA 1J4EA 1FWWA 2ABAA 4JY9A 4DBEA 3BGJA 3FA5A 2Y89A 4JTIA 4FX8A 3ZR4A 5AC8A 3PULA 3NAVA 2J24A 2J27A 3KRUA 2X1RA 3NQEA 3SGUA 4PL2A 3NQVA 1KV5A 5FEZA 4JTLA
chains in the Genus database with same CATH superfamily
3HMJG 3HIJA 3IVTA 3GNXA 2OFJA 2QGHA 1ZPTA 4UR9A 2CHRA 4L7ZA 4O4VA 3Q67A 3ZLHA 3VXGA 4CQBA 1ML1A 3NJ3A 1I2NA 1RCOB 3KLKA 4DJFA 2PSNA 2BVYA 1NIUA 3NO1A 3P82A 4UIOA 4GGHA 3W00A 3LERA 1PDYA 1GOIA 1FKWA 3AUJA 3NVDA 3M0JA 3VYLA 1SZGA 1KFLA 1PZ2A 3MTWA 2D0GA 5D33A 4GFIA 3PR2A 3W7EA 3FIGA 1OD8A 3C4UA 2NWRA 3HU7A 1G4TA 2H3DA 2POZA 4AVOA 4PMNA 3ARWA 1HVQA 4PTMA 4NUWA 2XGBA 3GVGA 1UZDA 1OG0A 1XBXA 3DIPA 2ZA3A 4JEJA 3BMWA 1QO2A 3OVQA 1WKDA 4CUCA 4AYGA 3PP7A 1RJRA 1LLOA 1X1ZA 2YB1A 2O4MA 3LI0A 3M47A 4X22A 1YXYA 1DWAM 2ZUSA 4XD6A 2CFFA 3F2DA 4XZWA 2PFHA 3RMEA 3BK0A 2LLEA 4IF2A 4LS0A 4KERA 4LUSB 4YYFA 4XBJA 1KBBA 4G7EA 1LTDA 2IPWA 3K2GA 4GIRA 1A5CA 1DJYA 3L21A 4B5XA 1A5NC 1JDCA 4D9PA 4Q3MA 3A3WA 2ZCGA 3VC5A 1AA1B 3NZ1A 2BVDA 4YHGA 5H2ZA 3D47A 1VKFA 1V6YA 4IX0A 1UB3A 1HKKA 4W8LA 2CLKA 3GR7A 4QDWA 4QLLA 2EKGA 3DFQA 2SFPA 1I6NA 2HE8A 1E9YB 2VD9A 4GIAA 5EL1A 1BKHA 1E4NA 5I3JA 4XAYA 3VM7A 3CO8A 3FGCA 5J8LA 3KS6A 4W88A 3QY8A 5FAJA 1W6TA 1DXIA 1AODA 3SI9A 2B31A 3FVMA 4C6LA 1R3QA 3OLEA 4K38A 4WX2A 1PEZA 4LRTA 5HNUA 4CQ9A 3WZ0E 2W61A 1UR9A 3CQJA 1TO3A 2QT3A 3WH5A 1DWHM 2J6VA 3N9SA 5KITA 2ZX7A 1JZ3A 2W5FA 1B9BA 4ZE5A 3IRDA 1WAWA 5D8ZA 2TMDA 4C1NA 2ZX9A 1KBLA 2V5KA 1R7OA 1XDLA 2F84A 3LN3A 5D03A 3VCRA 2R1MA 2BXZA 3OG2A 3CZGA 4L4OA 4EPEC 4CU8A 1RLDA 2HVNA 1FWEC 2R1LA 1UR2A 1XLEA 4FLOA 4JTAA 3I68A 4PTWA 5C0QA 2GGIA 4PUMA 1X96A 1OGGA 4LJ3A 1PV8A 3AIBA 2IPGA 1EJTC 3S1GA 2QKFA 3ZM8A 7REQA 4H9ZA 2J7BA 2ZYFA 3NL6A 4LCSA 3VI2A 2RDXA 3H12A 1W3KA 5A5WA 5CPMA 2IXVA 4DLFA 1X38A 1ZRQA 4R9OA 1GOKA 4AD1A 5CPLA 5XIAA 2VFDA 3MS8A 1CGUA 2GWGA 1J6PA 1TVLA 1KV8A 3PZMA 2VFHA 4BZYA 2CLIA 4BCEA 4KFPA 1ZAJA 5A6LA 4LQ1A 1X98A 4E8CA 1UW9A 3SO7A 3P3BA 4DWSB 1KTCA 3UERA 1E6SM 3AISA 2FIQA 3UCDA 2PDXA 2WZEA 3BLKA 4XD3A 3TN3A 3OVGA 1M01A 4WVXA 2B0MA 2VR5A 3NWRA 4MZYA 3VILA 1XLLA 4BEUA 1T99A 4Q4MA 2B4GA 5EBUA 4JAWA 4R33A 3WENA 5HULA 3NQ2A 2A3EA 1OZQA 3SCWA 3UQNA 1JI2A 1MQRA 5DMLA 3ZXWA 2WO5A 3BAXA 3R7MA 1ISXA 3MUCA 1YNYA 3CXOA 3NQGA 1Y5VA 2FJUB 2XN1A 1AQHA 4CN6A 5G5IA 4UQBA 3W02A 5M17A 3K30A 2V2CA 1R3RA 4ZMGA 4RXGA 1QI3A 1DIKA 3Q58A 2EPKX 3TN4A 5HWNA 4M0XA 3LXCA 3SCPA 3MI3A 1SFLA 2PCQA 3CUHA 3OZPA 3W7KA 1TR1A 1W5PA 2VHLA 4F9DA 3TN6A 3W1MA 1GK8A 1BYCA 4DBUA 3G3MA 1VYPX 1TV3A 2JEPA 3EB3A 1KBJA 3KL3A 2E40A 4P8WA 1PO9A 2PP0A 1DP0A 3ABRA 1E9IA 1AUSL 4HIBA 2PLJA 2J6XA 3R13A 4MB1A 9XIMA 3IK4A 1TV5A 2QJGA 1V6UA 3REQA 3LNMA 3T6CA 3CL6A 2GJXB 4JTQA 3SRHA 2VVNA 3WLRA 1XD0A 4M7SA 3DFNA 3IRSA 5FSEC 2VEPA 2WVUA 3MUZ1 1I60A 3LTSA 1B3OA 3PZTA 4LCRA 3GW3A 2OGJA 1EJVC 2ZUMA 3IIVA 2WPBA 4HD5A 4N9EA 1RAKA 2PC8A 1UR4A 4WDXA 4GOAA 2E6AA 1CLKA 2QCGA 2PRMA 1BRLB 2BVWA 2PWUA 1V4YA 4DF0A 1HL8A 5FF2A 2J47A 2OZ3A 1UKPA 1C7TA 2E77A 4O53A 2JEQA 3THUA 1Z9AA 3F5KA 5CC3A 1PX3A 3SCSA 3A22A 2BZNA 1EQCA 4IX2A 4NU7A 4HHPA 4IUGA 1VC4A 1ME7A 1D8WA 2X2YA 8RUCA 3UCCA 1W3JA 3QR0A 1W9BM 4LYKA 3B03A 1WO2A 2XFFA 2E8YA 2XSAA 2Q8LA 1WAUA 3WBWA 5DCDA 3GXTA 1E3XA 4R7WA 1D3CA 3T2OA 4NVTA 3W82A 3VD9A 1UWSA 2JE8A 3QVQA 4H04A 4QROA 3A5FA 1FX6A 1WQ5A 3GFXA 3R0KA 6TAAA 2ZWZA 3SUVA 3VUPA 3P8JA 3NO3A 4UR7A 1EC8A 3GC4A 3WQ4A 2WHKA 4MB4A 3SQMA 2VFFA 3RIKA 3RX3A 3BG9A 1WKEA 3A5VA 3ZSTA 4YVXA 1CZ1A 3KRSA 1EDQA 1UWUA 1WXZA 2A6NA 2Y85A 3CPUA 2AL2B 4X61A 5C9ZA 5CZTA 4DO4A 3A6OA 2VI0A 2ASHA 1F3XA 2A3CA 1WDDA 1Q6CA 3NQ8A 3EWUA 2OWXA 5A3HA 3PTMA 4Z1DA 1MW3A 5I3KA 2CPUA 1AQMA 3AIQA 4ICMA 1QNOA 4LS2A 1WE5A 3VIKA 1ZBKA 2WCSA 2O56A 1DIDA 1BD0A 4LYRA 2H8ZA 4LVAA 1PB0A 2VYOA 1YXCA 1UYQA 3PZUA 1SGJA 1REQB 1Q2SA 3I6TA 2QNEA 4GIYA 5GVJA 3W1NA 1ZP3A 2X42A 5PTDA 2Z29A 1FH9A 4UNLA 4U33A 1YXDA 1TELA 1EP3A 3H2FA 5BMXA 1XBZA 4Y9PA 1ITUA 4UFMA 2VCBA 1KFCA 1G67A 4W8AA 2OELA 3TC3A 4N9CA 4DJED 1MEHA 4L6OA 5KEZA 1TZZA 2UZ9A 1ISYA 4IWWA 1WOBA 1XYLA 2W79A 2YDQA 2OLSA 4HHHA 3IVUA 3PF3A 6ALDA 4FNTA 1IXPA 2ATSA 5D9PA 5TIMA 4ZB0A 4DUOA 1V79A 5KINA 2UY3A 1BVNP 1OX4B 3L2MA 3HJEA 3A47A 2CNCA 3RXZA 4ERGA 1KCXA 3N2TA 2WMHA 3AYRA 1VGAA 3VOFA 2XSXA 3CC1A 1K70A 3LXAA 3AO0A 2VZOA 1EC9A 4LAUA 4R7OA 2CW6A 4C91A 1EO5A 4G2DA 3GHRA 4ZB2A 3ABZA 4N9DA 4P8UA 4HZ6A 1SM9A 3EX6A 1LL4A 2HISA 3ARUA 5CPOA 4K8EA 3T07A 3UA3A 4UBPC 3CNYA 2WC4A 3QYSA 3ZJ8A 6CGTA 3OYXA 1MFVA 4GZ7A 2FLIA 5CG7A 2YL5A 5H1WA 3CV1A 5AYZA 3ICJA 3TTQA 1W3HA 1XV8A 2PLCA 5JIPA 3NSNA 2IQTA 4HMEA 3UXDA 2QVNA 3W1TA 2NSXA 2XGIA 3V35A 4AIUA 2PBGA 2A1YA 4DBDA 1JGIA 2GUYA 4FS9A 4WXZA 4JNMA 1MEWA 2OJPA 2WVVB 1I9CB 2VCCA 5IOBA 4KCWA 2Y88A 4B5VA 1ZY9A 1FCVA 4RNFA 5CCZA 6TIMA 1CLVA 3MSRA 3BAIA 3FJ4A 3QGVA 8XIAA 3RR4A 2QZRA 4Q8PA 1RD6A 3JZUA 1LZOA 3S2CA 2QGYA 4C6EA 3BOLA 4PMJA 2DIKA 2G4JA 4LXFA 2Q8ZA 2NVAA 2GWNA 3FOKA 3L5AA 4CQ8A 3A24A 3LA4A 1D7FA 3BMVA 4R9XA 1JUBA 2HBVA 3OQEA 4ZGYA 3P61A 2Z6JA 4PTDA 3N6JA 4HN8A 4GABA 5CPTA 1FFRA 2G95A 2DVUA 1B30A 3BLEA 4DBWA 1JCXA 4G5DA 4MG4A 1H3GA 4UFKA 3JS3A 4AXKA 4S3AA 3B4UA 3U2EA 3LZ5A 1Q7ZA 5G4EA 1UBPC 2A5HA 3MDWA 5FEXA 1UD6A 4GVIA 5A6BA 1PIIA 4PFMA 3AIWA 3A4AA 3P0XA 2E09A 2XU2A 4WKHA 5T8GA 2ACSA 1VR6A 2IQ0A 5A6TC 3RCNA 2V69A 4LNYA 1BG4A 2W66A 3I3DA 4QLKA 3AWNA 2W62A 3LOTA 2GVEA 4BQ4A 4ZOCA 1Z6KA 2J9XA 1AW1A 1Q85A 4KRTA 1MVYA 4MJMA 3V7PA 3KVLA 4H4IA 3VD4A 1HNYA 1QI0A 1BFNA 1V3HA 3MANA 2VX6A 2GL5A 3WCZA 1MSSA 2IXUA 2TYSA 2J77A 4O54A 4XZNX 4HSHA 2XIOA 1H0GA 2GOKA 4JQ1A 4LUJA 4A29A 1JDDA 5IHRA 3SEPA 4FXFA 3AMLA 2QCDA 5CZSA 1SJBA 2EG7A 2YCLA 4ZO9A 2Z27A 2O9TA 1I75A 4M82A 4Z0JA 4M80A 3CWOX 4A05A 1MXSA 3VNLA 3TYEA 3MZ2A 3WJYA 1QW9A 1FRBA 1FBAA 2BHUA 3TC7A 3ZT5A 3RMJA 1KXTA 4PUEA 1NOUA 3WDPP 3L0GA 4G8TA 1FP9A 1JNEA 1P6BA 4ZR8A 3QV7A 2C19A 2O7QA 1GVRA 5LXEA 1WYIA 3VNYA 3DBPA 4PCTA 3OGVA 2YFNA 2G3NA 4MZ1A 5BMWA 1QBAA 5JQ9A 4GUIA 1M7PA 5FF4A 3DI0A 3L4ZA 3AFBA 1B3ZA 4P5UA 3VNZA 4O18A 4TQTA 1XBVA 3DHFA 1FY6A 4JN8A 4E6MA 3NQBA 4HTYA 3LHUA 3WQDA 3IIPA 4WHBA 3LQLA 2XFYA 1F3WA 3SM0A 2WNWA 4CNPA 1UD3A 2QV5A 4GYPA 5ECVA 4M6QA 2PF8A 3KS5A 4CNSA 1UQZA 2QJNA 4H6RA 3W7JA 3HQPA 3AIEA 1J18A 3FYYA 4CNOA 2ZE3A 4HPHA 3EWYA 4POCA 2QCHA 1Q6FA 3UG8A 3KAOA 4QRNA 2G0WA 4EXBA 4TXEA 4LVGA 3M7WA 2B81A 3EDFA 4JIHA 4MB5A 3W7PA 2REQB 4HA1A 3LHZA 1LRQA 4P8XA 3M07A 1RY8A 1DWJM 1TV2A 1Q6DA 3ORWA 1N8IA 1UR1A 3S5NA 4IH3A 4UQDA 3DFTA 3VKJA 4EANA 1C29A 4QTGA 2QVHA 4WSJA 3VA8A 2V3DA 2PLMA 5E5CA 2VFGA 4LBUA 4Z0SA 1HQTA 1YKWA 1W5MA 3U7BA 1DXEA 2PODA 5CH9A 5C9XA 2VQTA 1NDZA 3QQWA 1P4CA 3S9ZA 3LCWA 1A0CA 4WXYA 2OQLA 3KZPA 4AD0A 3O2LA 2W67A 1YE4A 1FWBC 3NQDA 3V0SA 1T41A 3NTYA 4JTUA 1TPWA 4E5TA 5K3VA 4HHLA 1OABA 1CT5A 8XIMA 4LVDA 3WNLA 2W9MA 1VYRA 3EX3A 3G22A 1VBUA 3LGDA 1NWUA 1IE7C 1XYZA 2GJPA 4N6FA 3ZOAA 4NI3A 1GQNA 1JYWA 3M9YA 1B9ZA 2X1TA 2IS7A 3LPOA 3ZMRA 3GQYA 1S2TA 8TIMA 5I23A 2OKOA 4JCLA 2ON3A 4BWLA 4EACA 5EKYA 4B15A 4NJJA 2VEMA 3VCCA 1ZHAA 2ACQA 2V5JA 1K7EA 2WMFA 3DI1A 1PL9A 3VM5A 1R30A 3UGVA 3TYZA 1EJXC 4HT3A 4I9AA 4O1EA 1BHGA 4PR4A 1WOAA 1IIGA 2E1WA 1TIWA 4FXSA 1DJIA 2ZZ3A 2YFOA 4QE1A 3A3XA 2WZMA 2QV4A 2XWEA 3OZYA 4YN5A 4J1OA 5C2XA 1QAPA 1PTGA 3T8LA 3GXIA 4HN4A 3GDBA 4J7RA 2GQ9A 2X16A 2H8XA 1UD5A 3CMJA 1Q45A 5BRBA 4A2SA 4IICA 2QJIA 5ABFA 4Y9MA 3S1VA 2JF7A 4D6GA 4XBSA 1BSLA 1JRCA 1IR1A 1CDGA 1EJUC 3ITTA 3SCTA 2BXYA 4PBEA 1EX1A 2EG8A 3BICA 4L9YA 1WX0A 4HU4A 2DORA 3FSUA 3GTFA 1QJWA 3H70A 4IZGA 2BY0A 3S8HA 3V36A 2PWVA 3LUTA 3OIXA 2XISA 4DN1A 5KZEA 3AXIA 2E0PA 2ZXDA 4XUYA 1LL6A 1ZBWA 3PWIA 1IF2A 1R87A 4OQVA 5ABHA 1TJ2A 4QIUA 3GY1A 4URIA 2PWEA 1F3EA 1CIUA 4QEHA 4M3PA 5LA0A 1G7UA 2ZUUA 4QJ1A 1XJBA 4XZIA 1ALDA 1QOXA 3MUAA 2VGFA 3LLDA 2ZC1A 1OIMA 2J7GA 4D6IA 4DZAA 3DX5A 4JL2A 2WOQA 2OB3A 3NQFA 4AZCB 2A3BA 5D9NA 4OKDA 4XQ6A 1L6FA 4H8NA 1NTHA 1BYDA 5J5DA 2WSKA 3HQOA 2Z2BA 3O3RA 2V8ZA 5F4WA 3TFXA 3GTNA 2P3EA 2ZX6A 2V3FA 4PE8A 1XIBA 1UROA 3VK5A 4J3TA 1YTDA 4LEFA 3VKBA 5KZMA 4LANA 5DFAA 1LDCA 1YLVA 2ZDSA 1GJPA 3AROA 3C8NA 3O7UA 4IHCA 2ICSA 2D2OA 1ZALA 4K36A 3BAJA 1UG6A 4JTFA 5CBJA 4C6OA 2VGGA 3WK2A 3E02A 3W75A 2VD8A 4D71A 3TQ0A 2NV1A 2JALA 3U2OA 4MNJA 3W83A 2PE4A 5IFTA 3IK2A 3O0KA 4DJFC 1E55A 1XCFA 2JF6A 3DERA 3KOYA 3UVAA 1NARA 3A4XA 4QG9A 2V3GA 2DW6A 1DWIM 3WLIA 2DUXA 4JNZA 4ZQCA 1TUXA 3T0DA 3TR2A 3MHFA 3WX7A 2TPSA 4ERAA 3QHOA 4DO6A 3BARA 2H3BA 4PYSA 4F8XA 4N42A 1ADSA 1HIZA 2B7OA 2J7EA 1Z32X 5HMFA 4L9XA 4KRZA 4A3HA 3R8HA 4IFKA 4M1BA 2XDFA 2AKZA 3ARQA 4MWAE 1T8XA 3W88A 4KFOA 4H9YA 3VE7A 1NP2A 2X05A 2JKAA 5RUBA 2IMRA 5I06A 2D0FA 1S2VA 1EJRC 4ZOEA 3B8VA 2PI6A 3ONCA 3MYPA 2WK2A 4EOUA 2OXNA 4ZXLA 3P5YA 4FNPA 3HGOA 2DSWA 1O5XA 5AZ0A 3GHUA 3LGEA 4NAFB 4C6DA 1RQEA 4R7JA 3CPRA 2HS8A 4UTUA 2Z1BA 1JFHA 5LHEA 4LALA 1H60A 1D3HA 1J0IA 1MUWA 1OFPA 1DYSA 3V0TA 1CPUA 1TWWA 1JPKA 4WF7A 1L6WA 3SCRA 4MY9A 5F2LA 3W84A 3EOSA 1YTEA 4XWUA 1IEVA 1TFVA 2DQXA 1Q6RA 2QYGA 2PDNA 1WKYA 2PU0A 2OT1A 2Q01A 3IJDA 3M4HA 4GIEA 3SCQA 4ZODA 3WLPA 1W1VA 3P2VA 3KZSA 1W8GA 1GORA 3T4WA 3FEMA 4QQUA 1A47A 3NZQA 3R2GA 1HT6A 3L0KA 3T7VA 3PJUA 3PWAA 2OVLA 1MEIA 1NWTA 3TSMA 3NNTA 3UXLA 2WAGA 5AYYA 4XBKA 3DXIA 4JOMA 3QBUA 2ZRZA 4O4WA 2Y6ZA 1NWSA 3KWSA 1HL9A 1JF5A 1B31A 3T2QA 3VDGA 3QC0A 1F4HA 4AMCA 1DHPA 3G1FA 3BW2A 3L7RA 5A8MA 3IGXA 3ARSA 3NA8A 4I9TA 3T0BA 2R9RA 2Y5SA 1UASA 2GVYA 1HKJA 1FWGC 4ZQPA 3N9RA 4H2HA 1W2VA 1NVMA 1U5VA 4B4HA 4B9YA 2CXEA 1G0CA 5I00A 5EMUA 4P8VA 3O9NA 2OZ8A 2WW5A 3PNUA 4HJFA 5TNVA 3EXRA 3A9IA 4B3KA 3SN0A 2XN2A 4NL1A 1GPFA 4NHVA 3S9YA 4FLQA 3MY9A 2H9AA 4C7FA 3GLCA 1XKJA 3GTIA 3CEUA 1J93A 2ZQ0A 4PMVA 3Q45A 4XVEA 2NT1A 3PZVA 3URQA 1IIHA 1TREA 3WNOA 2WC7A 2J74A 1CNVA 1WDQA 3C0QA 1XPGA 1ZJIA 4ATLA 4OBTA 1B2YA 1U5JA 3MV01 3NOEA 1F5ZA 1EJSC 2OZTA 4GNJA 3FYOA 1EH9A 4RPPA 1QPRA 4W87A 4HSOA 3ALFA 4O10A 3N2BA 4YS1A 1RP8A 3ITXA 4MNKA 3T9PA 3CB3A 1XC4A 3N14A 2QDHA 3SRKA 3WIJA 2VC7A 3FYPA 3ISIX 2XIBA 2CBIA 1I2OA 3PB2A 2RFGA 4Y2WA 2PTWA 1PYFA 2HNHA 3B8SA 3MBFA 2Z1KA 1RD5A 4JIIX 3M64A 5ABEA 2BLEA 4QQ3A 1J10A 8CGTA 3AMCA 4WY0F 1XX1A 1UH2A 4XK2A 4NAEB 4NJIA 4XZLX 4A8LA 4W86A 3WQ5A 1ZBCA 3HPFA 4PRTA 4WK9A 3G1YA 4W5ZA 1H62A 3ALGA 3TFCA 4JTHA 4TMBA 1HJSA 2YJQA 1LOLA 4J3SA 1TKKA 1MO0A 2H90A 3AI0A 3L9CA 1W1YA 3ZVIA 1QBBA 2QCEA 4L1XA 4GYKA 4ZEPA 3CM4A 4QAWA 2E3ZA 5MKGA 2FZNA 3UPMA 1EXPA 3RU6A 1XIIA 3RG6A 2Y5JA 4KEVA 1JJKA 2I5GA 5HR7A 2YOCA 4UTWA 3TZFA 1WBHA 1I8JA 4WY0B 1PX8A 5F4XA 4MYAA 4JCMA 4LUTA 5ABTA 4LOCA 3W7CA 4PRWA 3EKLA 3B8IA 2YBTA 3TROA 3GIPA 4UTTA 3DU0A 1O5RA 4K37A 3L2IA 5IRPA 1JPHA 4OHQA 4F2UA 4IM4A 3R43A 2NXGA 2CZ5A 1W9UA 4HPXA 2E9LA 2HZGA 4U2YA 2E68A 1T6MA 3VKDA 3INPA 4ZO6A 1EPVA 3SJ3A 2OTDA 5CZJA 1XHGA 4XTIA 3DFPA 1UOZA 3CUXA 1V02E 3CAQA 1NU5A 3UF9A 1Q6GA 4O15A 2CBJA 5BRPA 6REQA 7A3HA 4H9VA 1GW1A 1BWLA 4UFJA 2ACUA 4F3HA 5LNUA 2QIWA 1TJ0A 2IKHA 2JKPA 3BG5A 3DYPA 4PBFA 4RE2A 4PUKA 5E9AA 1FCBA 3N34A 3KBWA 5E70A 3SUWA 3AWOA 1JD7A 4GQRA 1RVGA 3WJWA 3R6IA 4MAVA 2PC4A 3WUGA 3MCNA 1U22A 5L9FA 1FWWA 4MGGA 1XSKA 5KZ6A 3FW6A 2IW0A 4AVNA 1EO7A 3AMGA 5B7ZA 4N7QA 2Y89A 3ES8A 3U3HA 4GYFA 3KRUA 2X1RA 1KV5A 3RJYA 4J2MA 5I6SA 3K5XA 2I14A 1K3UA 2E6FA 4QNEA 3BANA 5BXPA 5G2HA 1R9YA 2Q71A 3VGBA 2I7GA 3QYQA 2CHOA 3GAKA 4GKTA 5C9UA 5REQB 1NDYA 1MUCA 4ADSA 3BW3A 1PHWA 3PNZA 5F7UA 5FJPA 3KX6A 3PG8A 4DX3A 3WL1A 1UZ1A 2X0SA 5AVHA 3DG7A 2V68A 1HUVA 1ZL1A 1E6XM 2E7FA 4NIRA 4Q4RA 1WKFA 3L5MA 2YCEA 4EWJA 1SVDA 1MDRA 3CU2A 5FACA 3W9ZA 2PDPA 4DO7A 2VR4A 5C7VA 3W01A 4H9MA 2WB5A 3N4EA 1P0EA 1B57A 3PBVA 4RDYA 2GQAA 1PIFA 2XM1A 3IAQA 4PTVA 5I3GA 4CN4A 5A2AA 5D2YA 4RX0A 1H61A 3GC2A 3B97A 4AUBA 3DHDA 1BF2A 4EPBC 3CAWA 2OYKA 5I3HA 3U4AA 4QDPA 1P6CA 3FXYA 4AC1X 2A79A 3T05A 2CEQA 1B3XA 1J0KA 3KDNA 3PVFA 1SFJA 2W92A 4XAPA 5LYRA 4ZQMA 1E6NA 3TONA 4QE4A 2A3HA 1V7AA 2O0TA 4K8HA 5HQEA 5C7HA 4QS5A 2Y61A 6A3HA 2DUZA 2PS2A 1TRIA 2PGEA 1WNOA 1JCLA 4ACZB 1PUDA 2EBNA 2WJZA 5DT5A 1FHLA 3W6LA 3WF0A 3V1HA 2V2DA 5I77A 3C56A 1GUVA 3T0AA 3P60A 4GO9A 2F61A 2GJRA 4L6DA 1GTEA 5AHIA 3UT0A 3P84A 4IIFA 3S1UA 1FVPA 3IS4A 1ADOA 4DJEA 2XH2A 5D09A 3PBYA 4L61A 2FTPA 2D69A 1UUMA 1J0ZA 3BXWA 3BCDA 1CXFA 5G4HC 4NRSA 2DZBA 4UC5A 3BO9A 4YVVA 1HKWA 4PB5A 1SPQA 2GK1B 5JIWA 1K8CA 3S5SA 3EOOA 5E9XA 1OQFA 3KE0A 1QRQA 2R1PA 3SFWA 1V3MA 3GWQA 3LRKA 3GC5A 2PP3A 2PDLA 4XZHA 3HZ3A 5AHLA 2Y62A 2IKGA 2O4QA 1P6WA 5D02A 1T7LA 4H19A 1IZKA 1XGZA 1KR1A 2G4FA 4X9SA 1FFQA 1E1EA 2O9OA 3TNOA 3D3FA 4LB3A 2QJMA 1GWJA 3GZ3A 3Q94A 4LGXA 3QLDA 5LNRA 1RALA 3WK1A 3WLQA 1XIHA 4B5UA 3G1VA 3MI2A 4XV0A 1IXQA 1HF6A 4LVBA 2CZEA 1DE6A 3SCUA 4L64A 3H8AA 1JXJA 2J9ZA 1HO1A 1N55A 4LY4A 4RE3A 4R34A 4JTDA 3I6RA 3QGAC 3NXLA 3UY7A 4F40A 2ACRA 3BLLA 1EHAA 3P7YA 4I8DA 3I3BA 4N02A 4AWUA 2P76A 3FNDA 2V63A 3R10A 4X0VA 3E74A 2C3ZA 4CD8A 1R2TA 1Z48A 5D37A 5C6MA 1ZP4A 3GW0A 4E2OA 3GDKA 1WZMA 3ABSA 1RQBA 4FI4A 4H9UA 2X0YA 3VGHA 1KWKA 2J7DA 4C6IA 2FMNA 4X60A 1XL9A 4UQAA 2C79A 5I02A 2EKCA 4KEZA 1CXIA 1QNQA 2GQ3A 3FEQA 1V02A 4US5D 3B05A 1IEQA 1J2WA 2X40A 3W38A 3YPIA 5K2ZA 4LNCA 3PTQA 5E0FA 2E1DA 3PUDA 1C3FA 3TR9A 3STPA 5CKSA 4GMEA 2VM8A 4EIVA 3EOEA 1RK6A 1R3YA 4CNTA 3I7SA 1W3NA 2R8WA 1FWSA 3VGGA 3TTEA 1F6KA 2EQDA 3AUOA 3Q2DA 2P1FA 3BAWA 2CXGA 1TPVA 3MI6A 4L5ZA 5LHFA 4HHMA 3ZVHA 3M41A 1PIGA 4ZO7A 1EKOA 3NUKA 3KVJA 2PDBA 1DKWA 3H54A 2AGKA 1P0DA 2GYIA 3F4NA 4GISA 4XVDA 4Z2GA 1VB9A 2YPIA 2PWHA 1E0WA 1ZU8A 1Q5MA 2WMKA 4H2CA 5A8OA 4NI8A 3MMWA 3SJNA 1E4MM 4PODA 2XVKA 3VX0A 4KPLA 2PGRA 2F8QA 3EWCA 2ABBA 2J88A 5LKYA 3VO0A 3CWHA 3GXMA 5HUOA 4MIMA 1YYAA 3KFTA 1VLIA 3LSCA 4HA4A 1DHKA 2CLHA 4DI8A 3GFZA 3WSUA 4UFLA 3CIVA 2WANA 1TWDA 2NXHA 1IQ8A 3OA3A 4GRSA 1IT0A 5AHEA 1RH9A 3UBPC 2C13A 2QEZA 2DZTA 5CZKA 4RUBA 3ZFHA 5CSYA 1EBHA 3SCOA 1UPPA 1F6PA 1A50A 3RRXA 3VAVA 2J7FA 1Q2RA 5EU9A 6PTDA 4Q33A 4K3ZA 3RJXA 3W1PA 1RBOB 3OA5A 4MTVA 4A35A 1LLZA 5G2WA 3ENLA 4Q7IA 1TV8A 1W9DM 4XUGA 4GYPC 2OEKA 2NUWA 4YJ5A 1AH4A 1H0IA 3VGFA 1T8QA 3MA8A 4REQB 2OX4A 3VNMA 2V38A 3VIGA 2AMGA 3VIFA 4KWSA 3TH6A 4A22A 1CW2A 1HX0A 4DJDD 1M7JA 1J5TA 4CEUC 4JYDA 3LB0A 1KM6A 2QS8A 4P7QA 3FK4A 2ZZ4A 4QFUA 3OIHA 3I65A 2RDTA 1D3GA 1EIBA 3PN8A 3VMPA 3I3EA 2G3FA 4FP1A 1MNSA 3UWZA 4IGNA 3DOPA 3NDZA 4KWWA 3C0LA 2PD9A 2ZTJA 1N7KA 1LJYA 4RK8A 2ZVRA 1A5KC 1K8YA 3PTKA 1JF6A 3DKLA 5G1MA 2ANUA 3C5QA 2I9EA 1I1WA 2P50A 4B5WA 5BZAA 4L56A 4IOTA 2V5DA 4YMZA 4KCVA 4AY1A 4HU8A 1W91A 4ZXOA 5DBUA 1XC6A 4UQEA 5F2GA 4QR6A 3QQ1A 2YB4A 2F9RA 1S38A 2RGLA 3MMDA 4FLSA 3FLUA 3U0HA 4JTCA 1CGVA 5E09A 4DAIA 2GSHA 2Z0IA 4R3UA 4CQAA 1JPDX 1E1FA 4K39A 3F5LA 3K8LA 4JTEA 4RKAA 5CPQA 3OEXA 3VCNA 3UP8A 5DLCA 2YDAA 4KIRA 4U28A 1JI1A 2CCRA 1N8WA 3VMNA 5CSUA 2WVTA 3WY1A 2DZXA 2D2HA 4MNLA 1O95A 4KS0A 3WLJA 3BAKA 2BASA 2GUUA 1RP9A 4BWLC 1DBTA 3W4RA 4JQ3A 1M1BA 2O7SA 3UZ5A 1W31A 3E5PA 4OOUA 1J6OA 3HGRA 3GVVA 3AXMA 1FOBA 2D2GA 1JAKA 3GS6A 3CLWA 3SBFA 3R1ZA 4FLRA 1NF0A 3PAJA 4G7EB 5C55A 3UR8A 5J5RA 1NJJA 2OOGA 2PU1A 2Q6ZA 4PUJA 3F1QA 1L6YA 1US3A 2V30A 5LXXA 2GLKA 3LQGA 4NKCA 5HBFA 2PA6A 4E3VA 2CKSA 3TU9A 3NQ6A 2VX7A 3B0PA 3DGBA 4ICNA 3F7JA 4WDWA 1W56A 5K4XA 3TNBA 1X6LA 5JUVA 4Z1YA 4C6QA 2VZUA 4O1FA 1GVQA 3M46A 2DH2A 4A3RA 4F0RA 5BXSA 3VDBA 3PFRA 5JH2A 3GVQA 2CBVA 4IGMA 4CNNA 4DB7A 4FR6A 3HM7A 3RPDA 3FGCB 4QHRA 3VFLA 3RFAA 3OBKA 1FWTA 5D30A 1JQXA 2DV0A 2ISSA 3EMQA 4U2ZA 5HQLA 4TV6A 4EPDC 4TX6A 2E5CA 1UH3A 1DV7A 3UG3A 3IV8A 1SO5A 2FVMA 3PPFA 1TPC1 3C61A 4BKNA 4JFSA 4D2JA 1CXHA 4RDZA 4HA0A 4I7WA 3ZR5A 4L4MA 1JYVA 3CQKA 4BF9A 4JIQA 4C1NB 2QMKA 2XFRA 5JBFA 1BAGA 4XKYA 4UXDA 1V5XA 3LBCA 4O52A 4GXPA 2NT0A 4ZQOA 3R11A 3TYBA 2NUXA 3H55A 3XINA 4RW3A 2XIMA 1W37A 1XDMA 2XTKA 3T42A 3W7HA 1SZFA 3ARYA 4X2RA 4B2DD 1QI4A 4U31A 3CYJA 1OX4A 2NLIA 3FA3A 7REQB 1RJPA 3U57A 2AKMA 4YVPA 2QPXA 1YNPA 2O92A 4LV9A 4AIBA 3E6EA 1JZ7A 4RDVA 2DT2A 1AD1A 3EMZA 3G1XA 2YW4A 4PCFA 4W85A 3M5VA 3G18A 3LHYA 1KM4A 4ZSTA 2VQUA 1M5WA 5FEWA 3KBJA 2XINA 1PKMA 2RGMA 1TYGA 5H6HA 4IIBA 1ICSA 5EY5A 2WSYA 2WLYA 5IHSA 1YDOA 3QKEA 5LNSA 1JZ4A 2J75A 2JGQA 3DAQA 1AVAA 3SSZA 2BY1A 1KTNA 1OIFA 2ONEA 3C2VA 3HG4A 2VKZG 2AQOA 3CH9A 4MSSA 2ZC8A 5A6SA 4Y6GA 4YTRA 3W29A 4FB7A 4W9TA 3ZJKA 4X2PA 2OLAA 1QT1A 4L1GA 4M8UA 1O5KA 1GVEA 1TTJA 1UD4A 1G4SA 4XAZA 4C5YA 3L23A 3BZGA 2Y7GA 3LSBA 3S2MA 3T78A 3KL0A 1S3TC 2GJNA 2Y1HA 4PULA 4NZ5A 1PVNA 1W1B1 4PMQA 5E93A 4V15A 2UY2A 4IJRA 4DXXA 1VH7A 3TAOA 4F0MA 1WP6A 4Q4QA 3OZOA 1V7YA 1BTCA 2CESA 3LPFA 3QF0A 1WZKA 4S38A 8A3HA 1H1ZA 2ZZ7A 4CD7A 4N6EA 2C14A 1A0EA 4LU0A 5BYWA 1EQPA 3G5EA 3NPXA 1UJQA 3WLHA 3TW6A 2VRQA 3P8IA 1P0KA 3ATYA 3RHGA 3QSTA 2NZLA 3HBLA 1I2QA 3FFSA 2NQ5A 3GNNA 1FWNA 3REQB 3NG3A 3NM3A 3B0VC 1RR2A 1K8ZA 4ERIA 3Q37A 2A7PA 2FHFA 3ZLFA 1FWDC 3T8QA 1OFQA 4IMGA 3USBA 3CLMA 3MBDA 4MB3A 4GX9A 2E5BA 2PDMA 2QULA 3MUXA 3NL3A 2BMBA 4C1KA 3UJ2A 5KETA 3RUBL 1UD2A 1L6GA 2OG9A 1H1YA 1VJSA 1V3IA 1EPXA 3WDJA 3N15A 4Q32A 3WBEA 2P88A 2WYSA 4ZBCA 3ME3A 1W3TA 4MAZA 4NJGA 4O0ZA 4L9ZA 3USZA 5L6UA 1QWKA 3U2ZA 1Z41A 5G2IA 4QX4A 3C0SA 3TA9A 1MQQA 1HKMA 4E2VA 2RUSA 4ZCWA 4HK7A 4IGHA 3RM4A 3CHEA 9RUBA 3WQEA 2BXVA 1K77A 3DUGA 3W7RA 2GSJA 1H41A 4S3BA 1PZ3A 1R2SA 3FHQA 1YTKA 3P74A 3Q4DA 3CTLA 3RX4A 2ZA2A 3W7MA 3FCPA 3KVMA 5EYWA 5EGRA 1DJQA 3GFYA 4ML4A 5AHFA 1GJWA 2R91A 4J3XA 5F1UA 1FWCC 2NXIA 4QAIA 3PSWA 2VC9A 4EE9A 5BWFA 1NEYA 1R3VA 3EKGA 4NRRA 4FIRA 3MHUA 4PMOA 2GSEA 4AG0A 3O8AA 4ZSUA 1XKYA 1MI3A 3SCVA 3G6LA 2D3LA 5I2UA 3GH5A 3CUIA 1OT1A 1XLJA 1KGUA 3BWWA 1JYNA 4O14A 3GDRA 3O0FA 3RPTA 4NXKA 5JXQA 2WKGA 3W73A 1JPIA 4E3TA 3K4AA 4IP4A 5FL0A 2VZTA 3TXZA 2Z6IA 3NL2A 1FH8A 1H7PA 4M6VA 3DKJA 3LRMA 4S3EA 5I24A 2V3EA 4DELA 4PFHA 3K8MA 5FF3A 1TA3A 2Z1XA 4EKJA 2J13A 1IYXA 3L12A 5A6MA 1UJPA 1H2JA 3EPNA 2QAFA 2XIQA 4WEVX 3PJXA 1XICA 1HGWA 3KBNA 3EDDA 1SW3A 1GVSA 2C1IA 4HPGA 3H7VA 2ZXAA 4U5KA 3A12A 3B8DA 4NX0A 4TVDA 2PDHA 1TTIA 4EK7A 1A5BA 1UMLA 3N6HA 5JVLA 1M04A 3EX2A 4WQ6A 3CZEA 4UTTC 3F2CA 1P1MA 1SMAA 3BUVA 1WBJA 2DT0A 2DZAA 4Q8OA 5CBBA 4AW7A 1P7TA 3AU6A 1TIMA 1UUQA 5FCZA 2YL9A 4PSRA 3R94A 1IXNA 3N3MA 4FX6M 1AFSA 3TA6A 2WV8A 3EWBX 3OLGA 3V5FA 1AJZA 3AXHA 4ENLA 1UQYA 5D2XA 2J8TA 3PUEA 2YR1A 3AU2A 2FFCA 4I9JA 2XZ7A 3N12A 3WLTA 2R82A 2YIHA 4OBSA 4FK9A 1YNQA 3UR7A 1W5NA 3TVAA 3HFYA 4GI4A 2PF0A 3JUGA 3WH7A 3VIHA 3BGGA 1XLIA 3G24A 4YTQA 1OCBA 5A94A 3DYMA 1Y5XA 4AYSA 3LGGA 4J4KA 3E1F1 3QMSA 1GQJA 3MWAA 1Q65A 5HR6A 4ZZ9A 1E72M 1UR3M 4OOZA 1T96A 4U3AA 3TV8A 1TX0A 1GOQA 4LWWA 2V5CA 1TQXA 3BDKA 4Y8FA 2PDQA 1PZ1A 1J79A 4NNBA 2FJKA 4NASA 4Q8UA 4KRUA 3JRKA 1E3ZA 1Y5WA 2E9BA 1O94A 1VCGA 3BLIA 3C3NA 3VDCA 3N13A 2WXDM 1JXKA 3QJAA 4O19A 3XISA 2DU2A 5FOOA 2DY3A 2OWWA 2Y5EA 1XI3A 1X7IA 2F2HA 3B0UX 1FUYA 5JU6A 4D6DA 4JGDA 1PXGA 3KOZA 3N25A 3N2MA 1M9HA 1N8FA 4AEEA 2FH8A 2G97A 2Y8UA 2GDVA 2VOMA 1Q7MA 1UD8A 2OLHA 4EVZA 3SECA 2DVTA 4I5UA 3BV4A 1UIOA 1AH0A 1JPMA 3H4WA 5DMYA 4AX7A 3FY1A 4A3QA 3WNMA 5HINA 1VPQA 1EF3A 3ZS4A 3CAVA 1CGYA 3B0XA 3FV9A 4HNVA 5CG0A 6XIMA 2DSUA 3CHDA 3U7VA 4WCJA 3UXIA 5SWUA 4PMXA 3C2FA 4R53A 1DQUA 1Q13A 4KWVA 1JNDA 3CPGA 4JPGA 4P61A 4Q8QA 2VO5A 3CZKA 4LUIA 3TLQA 4ZOBA 1KGWA 5C2CA 3UPBA 3SIMA 1GYNA 4I9MA 2C1HA 1Q8JA 4LV4A 2CLMA 3QN3A 3FS2A 2PDKA 1VBRA 3IV3A 2QCDB 3A4WA 7TAAA 2V2HA 3LCGA 1QW8A 3ABOA 3TTYA 2YCLB 3C2YA 1U33A 4BF7A 3ZJ6A 3O6CA 1UOKA 2Z24A 4S3KA 4HNUA 1MW1A 3WH8A 3OODA 1TTQA 3V3WA 3W7IA 2F6XA 3VNDA 1X8FA 1UIPA 4DRSA 3MT1A 2PGFA 2Y7DA 3W71A 4LEQA 2CC0A 3FDGA 4BJHA 3IEBA 2IPJA 4B90A 3AS3A 4UMAA 3BOXA 3WH9A 4TIMA 2RH9A 4GUGA 3HG3A 5FJRA 3AS1A 4MF4A 2DEPA 2J78A 2FPTA 3CWNA 1GTHA 3GXFA 4GJIA 2ZRYA 3RLHA 3MZNA 4S2CA 3CHFA 1XD1A 2PDWA 3VC6A 3EOLA 3PJTA 3VIOA 4KH2A 1OFDA 3WQWA 3GG7A 1HKVA 4JIRA 1H11A 2TRSA 1C8VA 2NW0A 4MUPA 3MO7A 4OFCA 5D05A 1B4EA 1LOSA 1UPMB 2WKJA 1QNPA 1GZ1A 5K9CA 4EXQA 3NPVA 3C2RA 2FYMA 4GUJA 2QIIA 4O1AA 4DJEC 1O60A 2ZXBA 1OF6A 3C8FA 1IT8A 3ANUA 4AQLA 5GNYA 3LX9A 2AL1A 1PYMA 2DSKA 3RRAA 3E0WA 2DGAA 1AD4A 4GY7A 1S5NA 2YA0A 1EC7A 3GNPA 4MADA 2HSAA 5EMKA 2GVGA 1GGOA 3AS0A 3HV9A 1H5YA 1CTNA 1THFD 4D6JA 4LAKA 3W76A 2DT1A 4I7UA 3P5ZA 2BGSA 3WUBA 3N9KA 5D9MA 4AF0A 3TTOA 2G37A 3R4IA 5D32A 3W24A 4FNRA 1ZSXA 3UESA 5EMJA 3DYOA 3MHGA 2A4AA 3PUGA 1ODUA 1LQ2A 3NQ7A 1Q6QA 2DH3A 3CMGA 2WMIA 2CZDA 4GPNA 4Z1BA 4L4LA 3LMYA 3LENA 1LQ0A 3TYAA 1WDPA 1QWGA 4KWUA 1B3WA 3M5XA 2VEGA 3OG3A 2FHCA 2YCIX 5M3WA 1AG1O 2VGBA 2X09A 4AZ7A 3GE7A 4UCFA 4LTSA 3FJ6A 4GZIA 5IM51 5T9CE 1QO5A 1S2AA 3VZXA 2GVLA 4BI5A 4DM2A 4FXRA 3UZJA 3M0XA 3KLLA 4ZFMA 3AIRA 3IUHA 1RQHA 3WJSA 4H41A 1EA0A 2H6RA 3IARA 2WCAA 1A3HA 2BB0A 9CGTA 4CU6A 1GG0A 3V4BA 3OVPA 2FB2A 3BG3A 4ZQRA 1ZFJA 1YHTA 4E8DA 4LX4A 3ZSSA 4F66A 4I3GA 4PUDA 3GR4A 4J28A 3E2SA 1TMLA 3B8UA 2W6RA 3HB9A 3M16A 2DQWA 1S5WA 5C2GA 2AQWA 3G0UA 1L2UA 3EWXA 4ADUA 3FAWA 5U7SA 5DXXA 5EMYA 1VJIA 1VD6A 1WA3A 4PB3A 5BCAA 3EZ4A 4QSFA 2PPGA 3LS9A 4QITA 1U83A 2HV5A 5JH1A 3OHMB 4MWAD 3TJXA 3OO2A 2DVXA 5DQPA 2ZXQA 2ISWA 4ASTA 3S42A 4BR1A 2WBGA 1LRNA 3LLXA 4TUFA 2D2JA 5A8QA 3UD6A 5KSWA 2CZFA 2P0OA 4H8UA 2QDEA 2BOGX 4H7VA 4D72A 1B3VA 4CLMA 1V3LA 1PKNA 4OU1A 3AQUA 4US5A 1ZTVA 3WJXA 4DZ5A 3PTDA 2C7FA 4IP5A 1OK4A 2BP1A 1X39A 2NX3A 1GHSA 5I3IA 1K6WA 1RPKA 2UY5A 5F2IA 4RZBA 2ZZ1A 4GQ0A 3PBGA 1EJ7L 3EKZA 3S5YA 3LLFA 2AAAA 3EDKA 4GI8A 3CGTA 3W7LA 5ABFB 1C8YA 3VNIA 2CLEA 1RBLA 2FPVA 2XVGA 1VEOA 1OYAA 1UKTA 5K7JA 2NV2A 5A6JA 1XYMA 3WD1A 3GB6A 4BK9A 2CIPA 3BJSA 1ITCA 1XUZA 3BJTA 3WN6A 3D3AA 3SSJA 4RV8A 3CO4A 3H2AA 1VCVA 4M24A 4GHRA 4QNWA 1J12A 3AHTA 1HVXA 3CV7A 4E38A 3V5OA 1KBIA 4PTXA 1Q6OA 1SO3A 5GJPA 4MJ2A 3BLFA 4NX5A 2PAJA 4P7RA 3R8RA 3UR5A 1B3YA 4JQAA 2Z00A 2W91A 1KLZA 4X63A 5LSMA 5AOUA 3C2EA 4LVFA 1AW2A 4IQDA 1WZLA 4BI6A 4YXGA 3NSXA 1O1ZA 1UP2A 4UMCA 1EHNA 3P81A 1YDNA 1O12A 4OWGA 4F2TA 3B9OA 3WD3A 1JAEA 4HNTA 4LT9A 4KF1A 3STCA 2ZICA 2L5HA 2CWXA 5IBXA 3FN9A 3L4YA 1XFBA 3W37A 3MJMA 1EA9C 3MB9A 4JFVA 1OYCA 3KOXA 1HXJA 4AY7A 3UFYA 5F1VA 3OGSA 3ZZ1A 2GGHA 3O1NA 3VINA 1KFBA 3NDOA 3BVJA 5FJOA 4BQ2A 4HSNA 3KHJA 2ABAA 1OEPA 4JY9A 1H49A 3ZYZA 3WEMA 1OCJA 1QI2A 3ZR4A 3PULA 3NAVA 2J24A 2VZSA 3NQEA 3OOQA 1JYXA 2ZWYA 3NQVA 2WPGA 1RJQA 4QE5A 1ZAHA 2WNQA 2W63A 4ROPA 3HGSA 5EFDA 2NQ9A 3VFCA 4FALA 4IISA 1ESWA 1KFEA 1PCWA 1WB0A 3APYA 3F4CA 3FSTA 4X3ZA 1GKPA 3PZGA 4D8AA 4DJDA 3QQ0A 3B4YA 4MYXA 2D1ZA 3RGTA 4GQQA 5DMNA 3IGHX 5AC4A 1LBFA 2G3MA 3LMZA 2XZ9A 1LWIA 2DSZA 3QRHA 4IFKB 3AAMA 4KBXA 1YW1A 1TZ7A 3SADA 1DQWA 5U4NA 1NP0A 5HDRA 3U4FA 3ZO9A 4HA3A 3TX9A 2FMOA 3MCOA 3GUWA 4WSKA 4HYVA 3HQNA 3WNKA 3A23A 2DZUA 4LYPA 2ZRUA 4IFOA 1RUSA 4LPCA 3R0UA 1LUCA 4D6FA 4F4RA 1XYBA 3APTA 5A69A 3TKFA 4H6EA 4EWND 1CLXA 1UCWA 4UQCA 3EA1A 4P7LA 2BHYA 3N73A 1J0YA 1QU4A 2EAWA 3GDMA 1XRFA 2OT0A 2W4XA 3QTPA 3STEA 1DL3A 1VCFA 4DUXA 5A8GA 1V8EA 3H4XA 3C0JA 4B5SA 1SR9A 4YTUA 3DESA 3QH2A 4W93A 3NCOA 1FDYA 3VZYA 4GX8A 4DAFA 3SURA 4WGXA 1W0MA 2WSQA 4W89A 1KWGA 1SYTA 1NFPA 1TCDA 4MZ8A 1Z42A 1BF6A 1AL7A 2Q09A 3HA1A 3MKKA 1KM1A 2YCJA 3OU8A 1X7FA 3HOJA 2ZDRA 4O12A 3WQGA 4TOQA 2NVDA 3BQ6A 3QPYA 5CLWA 3GIQA 4J40A 3JU2A 4OGZA 2E6YA 1CGXA 3MP5A 2WNNA 3S0CA 3IIOA 3M0HA 2QDDA 1VBJA 1VJZA 4Q6XA 4AY8A 1GOXA 3VOIA 1CCWB 1KBKA 3CASA 4OE7A 2I5QA 4L4PA 2NVCA 4MFEA 4DF2A 2PCEA 5FA5A 1J96A 4D8ZA 2GGEA 1KKRA 4FO4A 1HZYA 3DBNA 4BQ3A 4NZFA 1RV8A 2H9AB 3P67A 1KXHA 3MP3A 2EPNA 4GA8A 2WMJA 3VD5A 3HURA 1RXOB 3VKAA 1VFHA 4ADTA 5XIMA 5HNTA 3OGRA 1S5TA 4XIAA 2FGLA 3AIUA 4MMWA 4FEZA 3QFWA 2ALDA 1V3KA 2O9PA 3AHZA 2C8NA 1FWFC 2OQYA 1PE1A 2JBMA 3VPLA 1PSCA 4AZGA 4UTFA 2J8FA 2WQDA 2DUAA 2GOUA 1E70M 5A2BA 2YZ5A 4KIEA 5H8MA 2CU0A 1Q63A 1NOFA 2YL6A 1XH2A 3S6DA 5TQLA 3GH4A 3U6WA 4RZ4A 2P10A 2E9MA 1VYSX 1LYXA 1O4UA 2Y2WA 3KWXA 3PY2A 1JDFA 3GVWA 4GQGA 1QNVA 2PDYA 5FI8A 3S2JA 2QF7A 4UR8A 2OYLA 4XD4A 3BLOA 3B06A 4O8RA 3ITCA 3M0VA 1XW8A 4PCNA 1W5OA 4FF5A 3G8RA 1RLCL 4JEQA 3DN5A 2VOTA 3S2NA 4B2DA 4DWSD 3W6MA 1TPFA 4PL1A 1BSIA 2HWGA 1KXQA 3SR7A 2WM1A 4AXNA 4GK8A 1LQAA 3OW1A 1TE1A 4D8LA 3RM8A 2VC5A 3V16A 1ONWA 2HK0A 5EBAA 4A21A 3LBMA 4WJ8A 1GONA 2WHMA 1E40A 2BHZA 4XIMA 3DHPA 3EX1A 2WZTA 2UY4A 3B3DA 1JZ8A 3UWWA 3T1GA 4YU1A 1BLIA 5MKGB 3IJ7A 1R3TA 1TPH1 4ZQNA 2R94A 1CXLA 2XYLA 3HJZA 6XIAA 1Y65A 3LHVA 4RZ5A 1MRAA 3IANA 4MDPA 3JVAA 4TVUA 3LYEA 2DIJA 3W6YA 3M5YA 3S46A 4LUTB 1S1PA 6ENLA 1H7OA 4Y96A 1GOOA 4RLIA 3W87A 4NZJA 3O06A 2D20A 3PZQA 5GJNA 2HK1A 4P7OA 1XCXA 2X30A 4Z2JA 5MF5A 1YBQA 2XWDA 3E2VA 4ZL1A 3LCFA 1KB3A 5ECUA 1CEOA 3GHTA 3ECQA 2ZX5A 3MUIA 3RF9A 1QDSA 4TU1A 1GT8A 2XJ7A 2QPSA 1U1UA 5HANA 3W2UA 4B91A 1SR0A 3EGJA 3SQSA 3QW4B 4PZVA 1TVNA 2VEKA 1KM2A 1W9VA 1NQ6A 1SW7A 3K4DA 1EWEA 4HPNA 4OBRA 1QHPA 2V6AA 3B40A 3CT2A 2VRJA 3BLPX 3TTSA 1TWSA 3GNOA 1A4MA 1ZQ5A 4DO5A 5XINA 4JHZA 4KGLA 6REQB 3QXBA 1B54A 1QI5A 1TRDA 2DIEA 1KD0A 4CVUA 3S83A 2J62A 1JDAA 1W9XA 3F5JA 1K8XA 2ISDA 3I7QA 1C9DA 1F8MA 5CEWA 1YPXA 2F7FA 1VHCA 1JUEA 2D73A 3IJ9A 1CI1A 3SGGA 3SN1A 5DO8A 3PG9A 1RK5A 2HROA 2VURA 4WOQA 1NH6A 3NEVA 5LIUX 1MYRA 4CKQA 1JEZA 4Q7NA 3RK8A 1OX5A 1X1OA 1R6WA 2TODA 2DDXA 1EOKA 3WQPA 3QV9A 1SJAA 5LNVA 2C1GA 3UG5A 2I17A 4LS1A 1TSIA 3LEPA 2DW7A 4K68A 3CZLA 4DNHA 1ZCOA 3NPWA 3SW6A 3KXQA 5DY2A 4WR3A 2V5BA 3GNRA 3IGSA 4GNKB 3O05A 4OUEA 3V75A 4PA8A 4YL2A 3WDRA 4UOQA 1PKLA 4Y90A 1F73A 3PM6A 3W1LA 3DG3A 4S3JA 1MMFA 4CCDA 4HVXA 3D6NA 2VZVA 1DE5A 1QHOA 4AMAA 2G5WA 4LAZA 1ENUA 2WC3A 5FD0A 3QOKA 2E5DA 1NF7A 3A13A 2G8ZA 4F0LA 3PHAA 3S6TA 2VGIA 3MWCA 2A3AA 1EGMA 3RR1A 4AD3A 1BWKA 1PS9A 4IP7A 4A2RA 3KVKA 3KBMA 3ITGA 4Y9AA 2JQXA 4FR1A 1PX4A 4TV5A 4DYKA 3LD5A 2XVNA 3TCSA 3M0YA 3K13A 2Q8XA 3IJ8A 3MKCA 3S9IA 4OECA 5BROA 1XLDA 4JQ4A 2E8ZA 5AN7A 4EAYA 4N4QA 1Z7AA 2YL8A 5CZ0A 2O55A 5GQBA 1FWRA 1XSJA 2BS9A 1KCKA 5LIYX 3W86A 3NURA 4DPPA 1W1PA 3COTA 2ODOA 2XPKA 4BEQA 1FTXA 3G0XA 1S2WA 5G1TA 1M6JA 5KTLA 4CNUA 2Z1VA 3FKRA 4NQ1A 3DH7A 1TQJA 1AW5A 5CPSA 2VFEA 4W84A 3T81A 1E6PA 4P2VA 3H53A 4W4QA 3TSDA 1GKRA 4JTSA 2BNJA 1RSCA 5D04C 3TZNA 3W81A 4IL2A 2VWSA 3W1AA 4TTUA 4I5XA 3UW6A 1MW0A 3WF2A 1T0OA 3WK0A 3PPCA 1HJUA 4PMYA 1BGAA 3EXTA 3VTRA 3M0ZA 3R0DA 3DZ1A 2E25A 4D6HA 3G0SA 1FCUA 1TUFA 2P8CA 3B9EA 1DJNA 3PB0A 2Z26A 3GH7A 1RPXA 4H01A 1ADDA 3NQMA 4IQLA 3EMCA 4HBKA 4A6GA 3OBEA 3LI1A 3QOMA 5HNNA 2RJGA 4Y9NA 3WMSA 1G7VA 2PWDA 3HO8A 5BRQA 1T40A 2WWCA 4F79A 1LOQA 3NPUA 1PWLA 4RW5A 3O6DA 3PBWA 4R5EA 2BDQA 3RCMA 3NOYA 1EJWC 1VRXA 1E1CA 4NZCA 4ORIA 1Z89A 2WQPA 3MYOA 2VCAA 3QW3A 3BPWA 4CD6A 4YPJA 1S2UA 1JCNA 1QNRA 4MKSA 4Q4KA 3LNPA 5LA1A 1JCMP 2P53A 3GIYA 3M0KA 4ZVJA 4MOZA 1SSDA 2INZA 4JKMA 4QJ5B 2PDCA 3ELFA 2WMGA 1OYBA 4MKNA 3B8WA 4IMEA 4GUHA 4AZIA 3THDA 1J8VA 2XIJA 1A5MC 1PZ0A 1KM3A 3R89A 3W2KA 3LCLA 4JFTA 2EPHA 4CD4A 2CLFA 3VUSA 4EF8A 4M7TA 4UMBA 1HFBA 1OBAA 3MUY1 1I2PA 3HFTA 1OFRA 4D6EA 3W53A 1FXQA 3C3UA 1UBSA 1XYFA 3RNDA 1OB0A 5E1QA 1WPCA 4AAJA 3MSDA 3VIMA 2OR2A 1M7XA 1KRMA 4RL3A 4HOXA 1NQKA 3WD4A 3SY1A 4GVFA 4RXFA 3MV11 2QUUA 4DQWA 2QHAA 4WKAA 2ZZ6A 4WOZA 1M65A 3ZJ7A 2C71A 3OTRA 1U5HA 1GQLA 3FDKA 5BU6A 3I4EA 4S39A 4A8IA 4DZHA 1PAMA 3UJEA 3C86A 3FVDA 1SZNA 1E4LA 4HU3A 4Q8MA 4C6FA 1LM1A 4V1XA 1RCQA 1XS2A 3QPZA 4R27A 3TJLA 3WQOA 1IXOA 3WDHA 1P43A 1H7XA 5JBDA 3NR0A 5A2CA 1XLKA 3ZVHB 3LV5A 1FQ0A 4ROQA 1XG4A 3M1ZA 3GAYA 1FHDA 5BXTA 3BGAA 3BQ5A 3QKZA 2QJJA 3W7GA 1AMYA 3OHIA 1XIJA 2ESCA 3O6AA 4K7YA 1S3HA 5DCBA