1RQEA

Propionibacterium shermanii transcarboxylase 5s subunit bound to oxaloacetate
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
472
structure length
472
Chain Sequence
PREIEVSEPREVGITELVLRDAHQSLMATRMAMEDMVGACADIDAAGYWSVECWGGATYDSCIRFLNEDPWERLRTFRKLMPNSRLQMLLRGQNLLGYRHYNDEVVDRFVDKSAENGMDVFRVFDAMNDPRNMAHAMAAVKKAGKHAQGTICYTISPVHTVEGYVKLAGQLLDMGADSIALKDMAALLKPQPAYDIIKAIKDTYGQKTQINLHCHSTTGVTEVSLMKAIEAGVDVVDTAISSMSLGPGHNPTESVAEMLEGTGYTTNLDYDRLHKIRDHFKAIRPKYKKFESKTLVDTSIFKSQIPGGMLSNMESQLRAQGAEDKMDEVMAEVPRVRKAAGFPPLVTPSSQIVGTQAVFNVMMGEYKRMTGEFADIMLGYYGASPADRDPKVVKLAEEQSGKKPITQRPADLLPPEWEKQSKEAATLKGFNGTDEDVLTYALFPQVAPVFFEHRAEGPHSVALTDAQLKAEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords transcarboxylase 5S subunit
publication title Transcarboxylase 5S structures: assembly and catalytic mechanism of a multienzyme complex subunit.
pubmed doi rcsb
source organism Propionibacterium freudenreichii subsp. shermanii
total genus 194
structure length 472
sequence length 472
ec nomenclature ec 2.1.3.1: Methylmalonyl-CoA carboxytransferase.
pdb deposition date 2003-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00682 HMGL-like HMGL-like
A PF02436 PYC_OADA Conserved carboxylase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1rqeA01
4CCEA 4AVFA 1PL9A 5HUPA 1H51A 3FOKA 5MHBA 3C2VA 3LCXA 3BG5A 1LM1A 1N55A 3T4CA 4J9JA 2GOUA 1IXQA 1H7WA 3C3NA 2Y7EA 4LC8A 3W86A 3OBKA 5KZMA 1W5QA 3UY7A 4Y6GA 3R13A 3BLEA 3TE9A 4ALDA 4CCDA 1LOQA 2OX1A 3GIYA 1YXYA 3IV3A 1EPXA 3W1NA 1JQVA 3ZR4A 3LOTA 1KA9F 3NL3A 1W31A 5LNWA 2NUXA 1FQ0A 2ZZ2A 4MZ8A 5F4WA 2E09A 5H91A 2QCEA 3A9IA 3H55A 3LRLA 3I68A 4HHPA 1K7XA 4YMZA 1KTNA 4PC8A 3TU9A 2OCZA 3WK0A 4N4PA 3T40A 3HO8A 1V5XA 3DKJA 4HSNA 1FXQA 4O53A 5D38A 1X1ZA 4Y90A 1JRCA 2PRHA 3M1ZA 1R2SA 3QC3A 3PBYA 1XC4A 3N9SA 1WBJA 4OV9A 4ZQMA 1OFOA 3OHIA 5D32A 2I9EA 3GXPA 2JK2A 5BMWA 3WJXA 1KM5A 3DI1A 4RR4A 1TV5A 4CQAA 4UTMA 2YYUA 3FIGA 4GFSA 3CPRA 3M43A 4JDYA 4UMAA 4OGZA 4A2SA 2RDWA 3O16A 4PL1A 1H62A 3NL6A 4MOZA 2UV8G 3S1XA 4Y96A 3UY8A 3KAOA 1JUBA 3STFA 4UFJA 4JX6A 4O12A 4K7YA 1XBVA 4R53A 2W79A 2H6RA 1YLVA 1YTKA 3OA3A 3W74A 1AW5A 3DFPA 1HG3A 5DBTA 4BR1A 4ORIA 5KZEA 3F4NA 1I2PA 4JGDA 3QZEA 8TIMA 3NO5A 3M7WA 4XTDA 1OABA 4JX4A 5K4ZA 4JN6A 4NVTA 3LTPA 1KM6A 4N9CA 4A3UA 4O18A 3FYOA 4NNCA 5G4EA 3EB2A 3NR0A 1EB3A 3L21A 4ZVJA 2P1FA 1O60A 3I7SA 6ALDA 3MO7A 2CFFA 1X1OA 2J27A 2R8WA 3CM4A 5G1TA 1LOLA 5AHIA 3F1QA 4CCCA 3JR2A 2GJLA 1ZENA 2QCHA 3U6WA 1NEYA 3I7RA 2YFNA 3F03K 3MUXA 5D30A 2ALDA 3P5ZA 3LCIA 1H7NA 3GNDA 4X3ZA 2ZZ4A 1AK5A 1ONRA 3TW7A 1MEIA 4A22A 2C6QA 3QMTA 3BO9A 4POCA 3DHFA 1HUVA 3QFEA 5D37A 5F4XA 2E1DA 1P5BA 2BLEA 5HR6A 2TPSA 4O1BA 1W1ZA 3TQVA 4XQ6A 4IMCA 3HF3A 2ZRZA 2RKXA 3DENA 3L0GA 5EPDA 1TREA 5FF7A 5CGQA 2CZEA 4LRTA 2G96A 1VLWA 2FB2A 3M5VA 5C6MA 2CWNA 4BK9A 3S42A 1CX9A 1YDVA 1RVGA 1YXDA 1JULA 5F2MA 4JTGA 3E96A 3W1LA 1OF6A 1W37A 1YTEA 3N9RA 1C9DA 1LRNA 4LVBA 2A6NA 1KM0A 5D03A 3QEZA 4R34A 1R46A 3NQFA 2E5CA 3TK7A 4UC5A 3W73A 4NT0A 2QF7A 5FEWA 1VQTA 4HNVA 2FFCA 4LT9A 4LV4A 4AWUA 3LV5A 4GWEA 2JKEA 1JCMP 2OT1A 3FYPA 3L5LA 4DBEA 1SSGA 2HS8A 3TMQA 5FI8A 3UZ5A 1FWTA 1ME8A 3ZWTA 1PHQA 4UMCA 2H3DA 3BARA 4NX5A 4JTEA 4PL2A 3W2KA 3R8RA 4PODA 3DFNA 1IXOA 2HS6A 4JTFA 4EIVA 4UTIA 3MMTA 3S1VA 1A5SA 4MIMA 3CEPA 2QCFA 3LHYA 2ZZ3A 4RJEA 4IGHA 1ZNNA 4Z0SA 1XUZA 3HG3A 4ADSA 5BRBA 1QCWA 5C54A 2RFGA 4JYDA 1LDCA 3W71A 1TIMA 1NAL1 3W2NA 5I3JA 3SZ8A 1ZAIA 5FEPA 3THQA 4RV8A 1Z48A 3NL5A 4K36A 1SO6A 5HWMA 2ZA2A 3O06A 3O6YX 3S8HA 3FEMA 4JICA 5AOUA 3W72A 4LUJA 1G67A 4EF9A 1EP3A 3PG9A 3V1PA 3SW6A 1UJPA 4UR7A 5A8GA 3S5OA 4ONVA 4C1KA 1SPQA 1VJIA 3PS7A 5TIMA 4NX0A 2YFOA 5FF2A 3UWZA 4IMGA 3ZS4A 3O07A 3VNDA 3PC0A 1PVNA 3NG3A 3C52A 1UASA 1M6JA 3G1AA 3IGXA 3NL2A 1DOSA 5LNVA 2ZZ7A 5CZTA 4EOUA 4N6FA 2ZFAA 1L6SA 2W0UA 3NPXA 1T0OA 4HNNA 4IUOA 1L9WA 3MP4A 4M6QA 1VCGA 4O54A 3IIXA 3LXCA 2Z2UA 5HULA 1ME7A 5FF0A 1ICPA 1SZNA 4I9AA 5DCEA 3AJXA 2JKAA 4RZ6A 2V5BA 3HQ1A 5LKYA 1EUAA 3CIXA 4NJHA 1AW1A 1M7OA 5K2ZA 4LC6A 3UNDA 1R2RA 5IBXC 1BTMA 4MJMA 5J5DA 3P5YA 5AHNA 2ZA3A 1BKSA 5D04C 5T26A 1KFEA 3A5VA 4EF8A 3P67A 2WNZA 3KVMA 1XDLA 1TRIA 2VXNA 1SR9A 1QR7A 4ZQNA 4MFDA 3P84A 1OF8A 2ZTJA 1B4EA 1KLZA 1GQNA 4BFAA 4IWWA 3B03A 5ABTA 2B7PA 2A4AA 3O6DA 1FWRA 1QWGA 3O6CA 1YPFA 5D09A 3W1QA 3PBWA 4O28A 3QMSA 3C56A 1FWWA 1I45A 1G6CA 4O10A 3E02A 4GUHA 4UTUA 4MLJA 2DU2A 4UTTC 5AN7A 4RX0A 1QPRA 4IX2A 1PE1A 2DZVA 4OBTA 4NNBA 4LNYA 3PG8A 1I2NA 4OE7A 3DKLA 3R89A 4E2DA 1VRDA 2VKZG 1ME9A 4UFLA 2NX1A 4GUJA 5F4SA 1EX5A 1QAPA 2WJZA 3TC6A 4ZMGA 1G4TA 2CLLA 1Q6RA 3DHDA 3GKFA 1VS1A 4O14A 3G0SA 5U4NA 3GXTA 5IM51 2W6RA 3WJSA 1TTQA 4LUIA 3G22A 4I7VA 3HG2A 4PH6A 4TMBA 1YPIA 4N9BA 1VH7A 4O15A 4BWLA 2Y61A 2YSWA 2B0MA 4IPJA 4FF7A 4W9TA 4OT7A 3VE7A 3PBUA 4GXMA 4DF0A 3G0XA 4ZQCA 2BSLA 3W7GA 4BI7A 2WQPA 3W7KA 3EWYA 2JGYA 3DZ1A 4DQWA 4K37A 2HMCA 2Y89A 2NUYA 5EY5A 3UD6A 1ZAHA 1QDSA 1WBHA 2NXIA 3GDMA 4RK8A 4QAIA 2YW3A 1LRTA 5G5IA 2VEKA 3THAA 3TQKA 4YWIA 3P82A 4UNKA 2TYSA 2Q3OA 3N3MA 1K03A 4UR8A 1VZWA 3C0JA 3PB0A 2A7NA 3UWVA 3W7OA 1VCFA 3BG3A 5A5WA 1QPOA 1EUNA 3PF3A 4N6EA 3NQ8A 1DVJA 1G69A 2ISWA 4OQVA 1G4SA 2QR6A 3M9YA 4MVAA 1Q3NA 4JTJA 3HG5A 3CWNA 1OFDA 4QNEA 5DY2A 1TSIA 1DKWA 2PC4A 3N2MA 2FJKA 4UUIA 3STEA 4Z1BA 2X1TA 2OT0A 3EWZA 3E0IA 3PUEA 4GBUA 3G1FA 3TV8A 3C2FA 3W7MA 1JQXA 4QNWA 4KFPA 2ZRUA 4XTIA 3S1UA 4OV4A 4E0CA 4HPXA 2YX0A 3GK0A 3E12A 1B9BA 4UIOA 2YDAA 2GVJA 3LTYA 3DU0A 3P61A 4LS2A 3KVKA 4BF9A 1LBMA 3T44A 1SFJA 3BLIA 3C8FA 1BEUA 1W56A 1XBXA 3TROA 3BLFA 3CIWA 3M44A 4MY8A 3W70A 2TMDA 2ZBTA 2G5WA 3DGRA 3CQ0A 2J9ZA 1DL3A 1DJNA 3C6CA 3A5FA 3Q37A 1X6UA 3TFCA 3TSBA 4UTLA 4PTNA 1W54A 1XL9A 5HUOA 3MI3A 5AYXA 1FCQA 1R30A 5D05A 3P7YA 4O1DA 2QKFA 3QH2A 4O16A 3LI1A 4UFIA 3TMLA 1BWLA 3CTLA 4FX6M 4UTHA 4NXKA 2JKPA 3BW2A 1FDYA 1GOXA 2VC6A 3W1RA 4QITA 3NM1A 2ATSA 3DFSA 3BPWA 4H6KA 4IMEA 1GYNA 2CLIA 4LY8A 4IMDA 3W3OA 2PRMA 1DQXA 3H53A 2CW6A 4NJJA 3S5ZA 3LHWA 1UCWA 3R12A 2GUUA 1GT8A 1QPNA 2C16A 1UUOA 3KRSA 3L5MA 4JTSA 1TV8A 1SSDA 3I6RA 3CWOX 4WOZA 3SSJA 4Q33A 1ADOA 3B0VC 1L2UA 4NUWA 3M6YA 1OG0A 1DHPA 1EP2A 1RQBA 2X16A 5D2TA 1ZJIA 3O63A 1LBFA 3T55A 4M7SA 3HOJA 4CNOA 2QJIA 1K8ZA 3LHTA 1WDWA 1W5PA 2NV1A 2WSRA 3MHGA 3CLMA 1O5XA 1KBIA 4AHOA 5CPLA 4RXFA 1HL2A 3L5AA 3IIVA 3G1XA 4FXSA 1G7VA 3ABQA 3W9ZA 2Y70A 4WUIA 3FA5A 3LCWA 3W7EA 4JTHA 3QM3A 4FO4A 2ZRWA 4XKYB 1J4EA 2H90A 5E1QA 2C13A 4UNLA 1RQHA 3I7QA 5LHFA 3LCHA 3M0ZA 4JIQA 3IIOA 4X2RA 1OX4B 1SW7A 3W7PA 1CI1A 1FCVA 4K7VA 4MYAA 4FNPA 3MYOA 1PHWA 1H5YA 1VC4A 3FS2A 4IOTA 2J6XA 2C1HA 4HIBA 3RFAA 3R2GA 3SY5A 2RHGA 1GG0A 3W7QA 2QEZA 4LOCA 2QCMA 5CSRA 5FF4A 4KWWA 1OX5A 4RKAA 2V8ZA 3F4WA 3HPZA 3PSWA 3NPWA 1H61A 5L6UA 1SFLA 3EXSA 4KKXA 5KMYA 1W5NA 3OVQA 3W1XA 4MYXA 3PAJA 2J9YA 3LDVA 1O94A 5F1VA 5KINA 3LRMA 5G4WA 1OFPA 2NWRA 1I2RA 1B57A 3NQ6A 3GYEA 4DF1A 2Y85A 3S6DA 3LV6A 3B06A 2CLEA 4YCOA 5CSSA 1U83A 3W2LA 2WPBA 3L67A 3W7NA 3S5NA 4WQ6A 1M7PA 3LERA 3P74A 3PM6A 1PS9A 2WO5A 2QCDA 1K7EA 5BOOA 2A7PA 1LOSA 1GPWA 3YPIA 1TB3A 2WV8A 2VFEA 4LVDA 3G1HA 2EGZA 4LVGA 4ADTA 1F2JA 1N8FA 4PFMA 1KTBA 2QCCA 3EWWA 1DQWA 3MHUA 4LU0A 4MY1A 3RLUA 2J88A 3OVRA 1GVRA 1GWJA 2YGYA 3LX9A 5D2XA 1QOPA 4JDBA 2F7FA 3CB8A 5AB3A 4YCPA 1UBSA 4UTJA 3TUUA 2ZDRA 3USBA 4O1CA 2NXHA 4Z1CA 1MEHA 3HJZA 2XN2A 4I7WA 4FIRA 5FESA 1K7FA 2VELA 3KX6A 2NX3A 4JD4A 3B4UA 3QQ0A 4FEZA 1GYLA 4NJIA 1D3GA 2WSYA 1VHCA 1GTHA 2CLHA 1WOAA 3EKLA 3S0CA 4WOQA 5AHEA 2NV2A 4OU1A 4FHAA 4TMCA 4ZL1A 3ZFHA 4A29A 2R14A 1P4CA 2OZ0A 4AXKA 1QNVA 2Q8ZA 3C2RA 2ZRVA 1TJPA 4CLMA 3NVTA 1W5OA 1H63A 3MP3A 2WSQA 1KM1A 2CLFA 2TSYA 1XBYA 2O7SA 3EXTA 4PEKA 4XZ9A 3Q2DA 3FFSA 3A22A 3VE9A 2BX7A 4O8RA 1EWEA 3QRHA 2QDGA 3NA8A 1FUYA 4JR5A 1TYGA 3UXDA 3W2UA 2GJNA 2EF9A 1F6PA 2C3ZA 3N2XA 3MI2A 3MI6A 3MHFA 4KWVA 2BZNA 2ABBA 2D73A 4M6VA 1FBAA 4TU1A 4ICNA 1HO1A 2B7OA 1H7XA 2E6FA 5CZSA 4H4IA 3P81A 3TXVA 1LRQA 1AG1O 4O52A 4HT3A 3SIZA 5DXXA 4RLIA 3QW4B 2Z6JA 3RMJA 4M7TA 5J5RA 2PE4A 4BI6A 4O1AA 3L65A 3VCRA 3UPWA 5C5YA 3NGJA 3TW6A 1MXSA 1OYBA 4LVFA 5U7SA 3DFTA 1H7OA 5D33A 1OX6A 3E49A 3N73A 3MW7A 3NQGA 3FJ6A 3FJLA 3G1SA 4NZJA 4CNNA 3GKAA 3HGSA 2F84A 3SECA 3W1PA 2ZA1A 3TC7A 3MYPA 1IXNA 5K3VA 3W87A 3SFKA 3MP5A 4A2RA 1F05A 1R2TA 3B0UX 1TQXA 3M47A 4OWGA 4E38A 5I3FA 1XUUA 3SJ3A 2Y7FA 1QOQA 4QJ1A 1XCFA 4FB7A 3NNTA 4JNMA 5I3KA 4X22A 3M16A 5HNRA 3HB9A 3O15A 3CHVA 1SO5A 3W1AA 3JS3A 2ZYFA 2VEMA 4WD0A 4ML9A 1O5KA 5AFDA 2HTMA 3RF9A 3EXRA 1B3OA 4JXCA 3TAKA 4PA8A 3DFQA 3ABSA 5DLCA 3NQDA 3GDRA 5AHFA 3GVGA 2VFDA 3NPUA 3ATYA 1W0MA 1WXJA 4KFOA 3LB0A 3WJYA 1FY6A 2ZZ1A 5D2WA 1AMKA 1KBJA 4XBSA 3A21A 4IX0A 5LGZA 4FNSA 2H8ZA 1I4NA 2GPTA 4NNAA 3KVJA 3VKJA 5HWJA 3IIPA 3HGOA 3T78A 1S5VA 1KLYA 1KFLA 5DY3A 2VENA 1R47A 2CLMA 2ZQ0A 1FDJA 1LYXA 1GVFA 3TNOA 3FKKA 3TAOA 2VOMA 2EAWA 3WFAA 1DBTA 4MPQA 4BI5A 1S5TA 3QPZA 5EMUA 2KZHA 4UTWC 3TDFA 4HNTA 1JCXA 2FLIA 5E93A 3UWUA 3VI2A 4HSOA 5FEZA 4EWND 3LHUA 2YCEA 4X9SA 1F74A 1KTCA 4O57A 5EYWA 3G18A 2Y7GA 3W07A 4XKYA 1P1XA 2G97A 3LBCA 2V81A 2E68A 1RPXA 2DZSA 1OX4A 1FXPA 3B04A 6TIMA 3LHVA 3W88A 3BK0A 4CQ8A 2Q8LA 3TA6A 1A50A 1B4KA 2DJLA 3BGJA 4AAJA 2QCDB 4N4QA 1W3NA 2DJXA 3NQ2A 5D2VA 2V30A 4O0KA 1SO3A 4N2YA 3EEGA 2C14A 1SZGA 3W7DA 3W1TA 1XBZA 4TR9A 3O1NA 3BGGA 2FDSA 3W7CA 3BG9A 5K9CA 2ZZ5A 1YDOA 4IJBA 1AW2A 1ML1A 2A7RA 1C29A 4CNPA 3L2IA 5DCBA 1VLIA 4FNQA 4MY9A 2ZRYA 5AHMA 1H1ZA 2YYTA 3PULA 2AAMA 1FCUA 3KXQA 1F5ZA 1WOBA 3EWXA 4MZYA 4AWSA 5L9FA 3W83A 1H50A 1FCBA 1AL7A 2Y62A 2YXGA 2Y88A 3P8IA 3N14A 4G1KA 3B8DA 4L4LA 3EX6A 3LBMA 2O7QA 3PWAA 1OK4A 2EKCA 2GQ8A 1ALDA 4WX2A 3S5YA 4DO5A 3B0PA 2E5BA 3UWWA 3W23A 4N9EA 5DN1A 1K8YA 1TMHA 3NZRA 5FEXA 3UWYA 3GNNA 2CLKA 1KFCA 1I2QA 3G3DA 3NQEA 2DP3A 4JY9A 5K4XA 3LI0A 5C2XA 5IBXA 3GZ3A 3L68A 4GJ1A 3G24A 5EL1A 5I3GA 4AF0B 2G95A 2J9XA 4FX7A 5LGXA 3GR8A 3ZWSA 3DFOA 1OVDA 5I3IA 3M5YA 1OYAA 3NQVA 2VEPA 5TQLA 3G1DA 4TX9A 3EWBX 4XBKA 2A5HA 1NVMA 2IQTA 4MJZA 4JTKA 3LTSA 1ICSA 4ORMA 1QPQA 1ZY9A 4EVZA 1A5CA 3W2JA 4WY0B 3ANYA 2A85A 1LCOA 1EIXA 1A5AA 4GC4A 3G3MA 1OFEA 1LLZA 5K9DA 1LORA 5CPMA 4U4MA 4A21A 1NF7A 1PCWA 3QW3A 1QO5A 1YYAA 1OJXA 4JX5A 5LSMA 4RZ4A 4UTTA 3S1WA 3GB6A 3LM7A 5TBOA 1A5BA 3C4UA 3DI0A 4M19A 1XFBA 2EHHA 2WNQA 3LCLA 5KSWA 4LRSA 4LW7A 4O50A 3W85A 2FIQA 5LNUA 1TPH1 4FNRA 3ABRA 3CEUA 3TH6A 1TQJA 4O11A 4WY0F 3PR2A 1IIHA 3Q58A 4JS3A 3TXZA 1Q6LA 3U2OA 2V9DA 3TQ0A 4JTIA 5K7JA 5F1UA 5C55A 1WQ5A 4DO6A 4AEOA 3MBFA 3IRDA 3HG4A 2JBMA 3SGUA 5LZLA 1JR1A 3VFLA 4QSHA 4P61A 1DJQA 1QO2A 1VYPX 1IGSA 1KW1A 4IPIA 2DZPA 3NXFA 4JTLA 5SWUA 4WXYA 3OIXA 3G8RA 4K38A 3NYZA 2YR1A 4E2BA 2VEIA 3MWAA 2E6YA 3CU2A 2QUTA 1J5TA 3A23A 4NQ1A 2CZDA 1ZHAA 3WJWA 2C15A 1AL8A 2C19A 2X2GA 3BW3A 3IVSA 1JCYA 3C61A 5EKYA 4UMBA 1UB3A 4MUZA 1RZMA 1KFBA 2V0TA 4U28A 5HMSA 4GUIA 3R5EA 1WV2A 3LHZA 4XWUA 1TPC1 3INPA 4AB4A 5D2YA 3ELFA 5K9XA 1LTDA 1ZCOA 1L6YA 1TPFA 2BWGA 2YPIA 4YLWA 3HMJG 3E9AA 3STGA 1K8XA 1TPDA 2Z6IA 3B05A 4N02A 2DORA 2A2IA 2E6AA 3LXBA 3EKZA 5EA9A 2NX9A 4Z08A 4K8HA 4B5NA 4Y8FA 5F2LA 3OEXA 3W76A 1EWDA 1EA0A 3GXNA 1XI3A 1G4EA 1PIIA 2Z0IA 3NOEA 3W7LA 4M5PA 2P0OA 3MJYA 4FNTA 5H2ZA 1FWNA 2H8XA 2PURA 2WKJA 1LROA 4UFMA 2LLEA 2ZRXA 4Z1AA 2A0NA 3TSMA 2CU0A 2FPYA 3W7RA 1MSSA 1G4PA 3L9CA 2DZWA 3EWUA 2ISSA 2QCGA 1OK6A 3TR2A 3C2EA 1LP6A 3UXAA 5DBUA 1T99A 1TPEA 2AGKA 3PVFA 3TKFA 1MZHA 4ZQRA 4UFHA 2ATMA 2CZ5A 3FLUA 3QPYA 2PCQA 1YTDA 1D9EA 4FNUA 1DORA 5G1YA 1IF2A 3GR7A 3M5ZA 1KM3A 1GTEA 3GAKA 5EBUA 3OVPA 4GNJA 2VFIA 5F2GA 4IXHA 4DBDA 2V82A 3KFTA 4FX8A 2NWSA 4HPJA 4R7JA 1S5WA 2FPTA 4I7UA 4Z1DA 4P2VA 1IIGA 2VFFA 4Q32A 5G2IA 3JRKA 4UTKA 1KV5A 1NF0A 1HO4A 3QMRA 5AC7A 3O8AA 5HQEA 5KTLA 1VHNA 1FDZA 3LCGA 3NQAA 1GJPA 5LNSA 2QUUA 3V75A 3W75A 1XDMA 3PSVA 1Z42A 2XN0A 4C1LA 4XUGA 4QIUA 1MO0A 4JEQA 2FQIA 3TCEA 3GDLA 4KFNA 5CPNA 3EX2A 5D02A 4LS0A 5KITA 2R94A 3IGUA 3HGRA 4GRSA 2ZZ6A 3C2OA 5AHLA 1QMLA 1LLWA 4ZQOA 1MEWA 4AWTA 4Z0JA 2QJGA 3PBVA 3IVTA 1CW2A 1E51A 4K39A 2R91A 2B4GA 4AH7A 3ABOA 4LVAA 2VFHA 2GVGA 3EX1A 3P8JA 1KFJA 2HSAA 3NM3A 2NXGA 4JYEA 3QF0A 1TRDA 4UXDA 1TTIA 3W7HA 3M41A 2QCNA 2CZFA 1S3HA 2ABAA 5BW6A 2X1RA 4DF2A 2GQAA 3NQMA 4ZQPA 4HKPA 5BNKA 3LLFA 2XFWA 1SZFA 3EX3A 1VYSX 3IGSA 5HWNA 4AF0A 2AQWA 1SU5A 4O17A 1ZALA 3GDTA 3GX9A 3IVUA 4JTTA 4IXXA 4LS1A 1NSJA 4NZFA 3SI9A 3RLVA 4R33A 5CZ0A 2E5DA 1JJKA 3LRKA 1SW0A 4WY0A 4DXVA 2P10A 1M5WA 3KRUA 3WK1A 1YADA 1VCVA 5AC8A 4ZZ9A 1EP1A 4DPPA 3G1YA 1VYRA 1VR6A 3P62A 4NXSA 1D3HA 5DELA 2FTPA 3G1VA 3TSDA 1K3UA 3W6YA 5GVJA 2B7QA 2B7NA 4MKNA 3TIMA 2V5LA 1SZEA 3LGEA 3TX9A 4GE8A 3T7VA 3L0NA 1I2OA 3W84A 5I3HA 4BWLC 4JYFA 1W3TA 3L0KA 3PB2A 3TFXA 3QSRA 4MZ1A 3GAYA 3KVLA 4O0ZA 3W1UA 2GQ9A 3U8GA 1JCLA 1VPXA 4DELA 3NQCA 1GG1A 1WAUA 2X1SA 2H3BA 1GVSA 1JCJA 1GZGA 2QAFA 1SQ7A 4IQLA 1N7KA 1RQEA 3L66A 2E77A 4M6PA 4IMFA 4NJGA 3NPVA 2OMAA 5LNRA 2QUVA 1WA3A 1PCKA 3D0CA 3UYCA 3SR7A 4WZHA 7TIMA 1TJRA 1OFRA 2V2DA 4D2JA 4WJEA 4DO4A 1H60A 3BVJA 4O19A 1TPB1 2QCLA 3LLDA 4H3DA 1NFBA 3ATZA 1OFBA 1RV8A 3UWQA 4O13A 1V7YA 4YXGA 1G7UA 5LHEA 1OHLA 4CQ9A 3M5XA 3W7IA 3OG3A 1GVQA 3HGJA 4WXZA 1TTJA 2NLIA 4LV9A 1WX0A 4MLRA 1P0KA 2RDUA 3G8EA 5G2WA 4HNUA 1Q45A 1X7FA 3QYQA 4ADUA 5AC6A 1F73A 3SGZA 1FX6A 1BWKA 4K6AA 3MBDA 1YXCA 4QQ3A 3IEBA 4UFKA 3W2MA 5E0KA 1TV7A 4S1FA 2Y7DA 2BTMA 3RU6A 1P0NA 3STCA 4AHQA 1Y0EA 1TO3A 3P60A 1OFAA 3AO0A 1RR2A 1FWSA 3LCFA 1F7BA 1OFQA 1X8FA 1T8XA 1XXXA 2NZLA 1W3IA 4PCFA 2FB3A 5DCDA 1OYCA 4UCGA 1SO4A 3I65A 1ZFJA 2A21A 4Y9AA 2E6DA 4Q4KA 1O4UA 4L4MA 4FIQA 2OJPA 1H7RA 1VGAA 1QFEA 3W1MA 2Q3RA 1SW3A 1KM4A 1HFBA 5CZJA 5DXYA 3N34A 4JY8A 3HBLA 4TIMA 1W5MA 3NEVA 4N9DA 5HJLA 2DZXA 3NZ1A 1U5JA 3HIJA 3W22A 4QISA 1JVNA 3GDKA 2ISVA 3A24A 4S2BA 1ICQA 3K30A 1SUXA 5CPOA 5AYYA 4RZ5A 3DXIA 2WOQA 1L6WA 1JRBA 1XM3A 3UQNA 2CLOA 2VFGA 4LTSA 1JUKA 1F76A 3TJXA 1TPVA 2YW4A 3NAVA 2TRSA 3QJAA 4AMAA 2FPVA 2QDHA 2Z1BA 5HR7A 5AYZA 1TPUA 4MFEA 5FF3A 1GEQA 2XN1A 3WK2A 3CC1A 1H7PA 2Y63A 1KFKA 4DEFA 5BMXA 1PV8A 3FKRA 3NDOA 3BV4A 2RDTA 2YZRA 3CT7A 2C0AA 4NJKA 3O05A 4S2CA 1TTPA 1GVOA 2RH9A 4HN4A 4FXRA 3UPBA 3TJLA 3RNDA 5G2HA 4RXGA 3WJZA 1KM2A 2A1YA 3G0UA 3HPXA 3PUOA 2V2HA 2X1UA 4TO8A 1JCNA 4K8EA 1LZOA 1IXPA 1XKYA 4RCXA 1O95A 2X30A 1J2WA 3W7JA 3HPSA 3H54A 1F6KA 1K02A 5CKSA 3UZJA 3KRZA 1Z44A 1H1YA 4AHPA 4GUGA 1C8VA 1I8JA 1HTIA 1EEPA 1Z41A 3LXAA 1WYIA 3DH7A 1TCDA 3GLCA 4DPQA 1KV8A 1DV7A 3WK3A 4JTUA 2V2CA 2ZCGA 1W8SA 4YL2A 2DZUA 2NUWA 1THFD 3EX4A 5F2IA 3IIZA 3DBPA 3KOFA 2BXVA 2WNNA 3P80A 3RK8A 3Q94A 4OHQA 3PY2A 2ZTKA 3PUDA 4UTWA 2QJHA 5HINA 1A53A 3NQ7A 3BW4A 1JUEA 2I1OA 4LWWA 3QQ1A 3S9YA 1LBLA 2EPHA 4GUFA 4O4WA 2I14A 3N19B 2DZTA 1Q6OA 3KHJA 4JIPA 5CG7A 2A6LA 3DAQA 2J24A 2GVLA 2JGQA 2QAPA 1Q6QA 1UUMA 1ZAJA 1RD5A 4O4VA 1T96A 4NU7A 4QM1A 1YDNA 2C18A 5KZDA 3QSTA 1TPWA 2PRLA 2Y6ZA
chains in the Genus database with same CATH superfamily
1A3XA 1RA0A 3FOKA 1QK2A 3BG5A 1LM1A 5I00A 3QKZA 2MANA 3AIWA 4D6DA 3GXDA 1Y8BA 4DY1A 1H7WA 3C3NA 2FFIA 3RDKA 2W66A 4XV0A 3W86A 4ROQA 2EQDA 3WLTA 5KZMA 3BLEA 7PTDA 1ZJAA 3OGVA 3PZOA 3ITCA 4Z2LA 3GIYA 2EEXA 8XIAA 2XZ7A 4H8UA 1DYSA 1PX3A 3WUGA 4M24A 1EPXA 2PDLA 3W1NA 2AOSA 1P6WA 1E3XA 1W31A 3ZR5A 2ZZ2A 5H91A 1MFUA 3H55A 3WQDA 3I68A 3NZGA 3UJ2A 1UR9A 3BSHA 1KTNA 3TU9A 3RPDA 3CUHA 1M04A 3T40A 3R25A 3DKJA 4AZHA 4HSNA 4FAMA 1VFSA 4PZVA 1JRCA 3M1ZA 1R2SA 4OV9A 3ZM8A 3S2JA 1MQPA 3OHIA 3C8NA 5XIMA 2QUMA 1PUDA 4LUTA 2Y24A 4Q4SA 4AVNA 5I02A 3T2OA 2F2HA 1SJCA 2ZX8A 4TV6A 4A2SA 3O16A 1H62A 4MOZA 4I9MA 3WLPA 1IT7A 1SJDA 4Y96A 4NL1A 3GZAA 5GNXA 4R53A 3KTCA 1N82A 4JNYA 4PUNA 4GI8A 5IHRA 4YVXA 1YLVA 1IEWA 4AQLA 3W74A 3R43A 1QNPA 4XZLX 5DBTA 3MU7A 1H5VA 4J35A 3LSBA 4L1GA 4CNUA 1KM6A 3UR5A 4NNCA 3EB2A 3FJ4A 4N42A 3L21A 3GC4A 4OBSA 4ZVJA 1OM0A 1TUXA 2J27A 4D6GA 3JR2A 2GJLA 2VEFA 1NEYA 3I7RA 2YFNA 1XYMA 1MUCA 2CERA 2ZZ4A 3Q67A 2IKGA 1ONRA 1MEIA 2PF8A 4GC3A 3CO8A 3BO9A 1HUVA 1GQKA 5D37A 3PPCA 3DESA 2BLEA 3WNLA 4O1BA 1EJTC 4XQ6A 3ITVA 3CYJA 2ZRZA 2RKXA 4FOJA 1S2TA 3NYDA 3SCRA 2ZUMA 1TREA 3OLGA 3HA1A 1VD6A 1GKQA 4PRTA 2GSHA 3PZ9A 1JULA 2RJGA 4H9ZA 3W1LA 5AYIA 1OF6A 3TZNA 3N9RA 1LRNA 4WRHA 2A6NA 4Q8WA 1I1XA 3NQFA 4XVDA 4L7ZA 1TCMA 4KCWA 4QDWA 1REQA 2E5CA 1E6ZA 2BGSA 2ZX5A 2QF7A 4B92A 3VO0A 4JN7A 1VQTA 5FEWA 1PX8A 4LT9A 3VNJA 4AWUA 2Z1XA 3FYPA 5C2CA 3CT2A 1IV8A 3ZWTA 1T40A 2IPJA 2H3DA 3BARA 4PMRA 3W2KA 4PODA 3DFNA 4DZAA 3WF1A 4UTIA 3UG3A 4EIVA 3PHAA 3MMTA 4EACA 3VPLA 4KCUA 2V3GA 2FMOA 3LHYA 3CNYA 1UR2A 4IGHA 1ZNNA 3A3HA 1XUZA 4S3KA 1K6WA 3MZNA 5I3JA 4RV8A 4K36A 5HWMA 1SO6A 2VM8A 2PP3A 4LCQA 4LUJA 2OZ8A 1EP3A 4L6HA 3V1PA 1UJPA 3E0VA 3S5OA 3I4EA 4C1KA 1PIFA 5C7HA 3UWZA 3MCMA 3O07A 1D3CA 3NG3A 4MWAA 5D9MA 1XYAA 1UASA 4XAZA 1M6JA 1SR0A 1KXVA 3B9AA 4RE2A 4EOUA 3MSDA 4PMUA 2ZFAA 5LA2A 1T0OA 4HNNA 4FF5A 1L9WA 3N6JA 3N6QA 2WNWA 4O54A 1Q65A 4TOQA 2POZA 2VD9A 3T2QA 1EUAA 1L0PA 1HKKA 3MUY1 2V68A 1M7OA 1EJRC 2YBVA 4LC6A 2VO5A 3PANA 2J79A 4JQAA 3N1AA 2BFGA 4KGJA 2ZA3A 2ZVIA 1JDEA 3AISA 1G94A 1KFEA 3A5VA 1XLBA 3POHA 4EF8A 3HN3A 1TRIA 1SR9A 2ZVRA 4ZQNA 4IGMA 4GCXA 2JFEX 1VFOA 3KBMA 3UT0A 3B03A 1UIOA 3SCQA 1D7KA 2A4AA 4D6IA 3UA4A 2RGLA 3A64A 1CLKA 3NZQA 2G0WA 3W1QA 5BRPA 1L8NA 4WJXA 3P2VA 1W3LA 2DQWA 3OA5A 5AN7A 2O9OA 5AYBA 4DYJA 1FRBA 1XW8A 4LNYA 4YVPA 4MHBA 2QDDA 4C6MA 3E5BA 4JCMA 4F0SA 1VEOA 2PWFA 3ARWA 1OIMA 1QAPA 4B5SA 2SFPA 2CLLA 1Q6RA 4O14A 4TVDA 5IM51 2WSPA 1V02E 3G22A 3L4UA 4I7VA 1YPIA 4IP4A 4O15A 4GD0A 4DLFA 4U3CA 4GJIA 3PBUA 3L23A 4IIBA 1YX1A 3QGAC 4QP0A 4WR3A 3W7GA 2Z2AA 3PZNA 5CC6A 1V3MA 3BJTA 1QW8A 3OZYA 2Y89A 1QI4A 1ZAHA 1QDSA 2WK2A 1FWJC 3GDMA 1X6NA 1LRTA 2I57A 3VUPA 4UNKA 3CK5A 4AZCB 1FHDA 1VZWA 1AVAA 5MF5A 4A8LA 2ANUA 1QPOA 3PF3A 4N6EA 4OQVA 4YWSA 4PFHA 2I17A 4C1NA 3ZQ9A 4MB4A 2B31A 4MVAA 2P76A 1Q3NA 2OPJA 4QCFA 5DY2A 2PC4A 2FJKA 3MVTA 3STEA 4I8DA 4WF7A 2OT0A 4RPPA 3U3HA 3URBA 3TV8A 4DUXA 3C2FA 3GH7A 1W6TA 1UP3A 1JQXA 1EF2A 2VRJA 4QE4A 3K8LA 4DM2A 4OV4A 4E0CA 3QY8A 2YX0A 1V6VA 2GSEA 4WLCA 3DU0A 2NT0A 3HM7A 4JQ1A 1C8QA 4GHRA 2OYLA 1W56A 1UWSA 2WJEA 1UD2A 2DT0A 1BYAA 1UR1A 3DGBA 3CQ0A 1LWIA 1DJNA 4URIA 5HK4A 4OOZA 3BH4A 2QPUA 1MW2A 1C3FA 1WZAA 2E40A 2WLZA 4PTNA 4CD8A 1W54A 5FAJA 1LL7A 3P7YA 3GTXA 2QKFA 3VMPA 1BWLA 1NARA 4FX6M 2WZIA 2QV5A 1FDYA 2VC6A 5A2CA 3W1RA 4C6QA 4UWMA 4QITA 3SCTA 4H6KA 5B80A 2CWXA 4XZIA 1VFUA 4R88A 2CW6A 3S5ZA 3PBGA 4L1XA 1GT8A 1ZJHA 1JF5A 1XLKA 4HYRA 4Q33A 1ADOA 3GNXA 3B0VC 2XH7A 3CJPA 3WNNA 4NF7A 4DUOA 5GNZA 3EDFA 5D2TA 1B3ZA 4DNMA 4GQBA 4Q4MA 4ATLA 3O63A 4M7SA 1ZB5A 3HOJA 1HZYA 4CNOA 1PZ0A 3S9ZA 1W5PA 2NV1A 4EP8C 2WSRA 3MHGA 2A3AA 2VCAA 3IJ7A 1KBIA 1EX1A 5CPLA 1QU4A 1BKHA 2HE5A 3LZ5A 2BHYA 4ATWA 3E2SA 3G1XA 5J04A 3QM3A 2ZRWA 4FP1A 3SURA 3WSUA 2CHRA 1UWIA 4UNLA 5KETA 1E0VA 1IZJA 4X2RA 2Q71A 1QRQA 1GCYA 4A6GA 3BMXA 2HBVA 3MYOA 1H5YA 2PGFA 2X0SA 4IOTA 1A5MC 3EMZA 3RFAA 4S3DA 3W7QA 3GY1A 1KRAC 4HZ8A 1Y5XA 4QX4A 2X40A 4XSMA 1U2YA 4KWWA 4XB3A 1KRBC 4LFYA 3L2LA 4PTMA 2V8ZA 3F4WA 4ZODA 3H4XA 3PSWA 2PB1A 3NPWA 3PBMA 5L6UA 4KKXA 4MDOA 4Q3MA 5KMYA 1FTXA 2GDUA 4BQ5A 2EPKX 3LRMA 2ZXBA 1I2RA 3UA3A 3WNPA 1GW9A 4GXWA 3M46A 4DF1A 2X41A 1BF2A 1AMYA 1SJBA 3LV6A 3B06A 2YXOA 3SIMA 4ZO7A 2WPBA 4ZTYA 1SMAA 4RUBA 1PS9A 5FL1A 3APTA 3F2BA 4Q8MA 1TB3A 5FJJA 5A69A 3G6MA 3G1HA 3WD4A 4FR6A 3UF9A 1PTGA 1F2JA 3ZZ1A 1UH3A 2QCCA 2YCLA 3BXWA 3MHUA 3LY0A 3RLUA 4P7RA 1QOPA 4JKKA 4QLKA 1SJAA 3RX3A 3CB8A 4P7LA 5AB3A 2CHOA 3LSCA 2CXGA 8RUCA 1RD6A 2J7GA 4I7WA 2V67A 5FESA 1K7FA 1F3EA 2BXZA 2ZADA 3U5YA 7ODCA 1TA3A 3BTNA 1BG9A 4JD4A 2VGIA 3QQ0A 3DECA 2EPLX 1GYLA 2XGIA 4PUJA 1VHCA 4WSHA 4ASTA 3MT1A 1Q8JA 5M2FX 2ACUA 1V51A 1ITXA 4GVGA 2NV2A 4OU1A 4CN4A 1Q4NX 1DIOA 3ZFHA 2R14A 2QQ6A 1QNVA 1JGMA 3C2RA 1XSKA 1CGWA 5ABGA 2WSQA 2CLFA 3PZVA 4PEKA 4LBRA 4HPGA 4A3RA 3Q2DA 5CLWA 3FFSA 3NURA 3HJEA 2BX7A 3U5UA 3KBSA 4XZBA 3M0KA 1TYGA 4UQAA 1DWFM 3BOXA 2GJNA 3WBWA 2EF9A 2XSXA 2WWCA 2PTZA 3RITA 1H7XA 3P0XA 2JEPA 1TWZA 2VEGA 5DXXA 1J9YA 3UWEA 5IHSA 2P8BA 4RLIA 3QFWA 1ENUA 2FMNA 4HU8A 3BOLA 3H7UA 3AYTA 3RMJA 3P93A 1KWKA 3MC5A 3L65A 2I56A 3W28A 5C5YA 2EPOA 1OYBA 4Y9OA 3URQA 1FWDC 4Q4PA 1H7OA 2DDXA 2ZX6A 5D33A 4B5TA 3CWHA 1G0CA 3HGSA 5CLTA 2WANA 3SECA 3MYPA 3H26A 1R9ZA 3UZXA 1QHOA 1B3VA 1V3KA 4B9ZA 1W1TA 3B0UX 4OWGA 1LQ2A 2XM1A 1ISVA 2Y7FA 2VC7A 1XCFA 3MB9A 3MS8A 3NNTA 3IWPA 3BQ5A 1AD1A 3HB9A 3O15A 2OZ3A 1SO5A 4GJJA 4IIDA 2VEMA 4ML9A 1LT8A 1BXCA 3AIRA 1B3OA 4JXCA 5AHFA 3ATYA 2E9BA 4E2VA 4R9XA 4HVXA 2ZZ1A 3HPFA 5LGZA 2DT2A 2D2HA 1I4NA 2H8ZA 4NNAA 1E6RA 4S3EA 5HWJA 2PGRA 2DFAA 3BLOA 2CLMA 5AKQA 3MV11 1EJ7L 1XQLA 2ZQ0A 1LYXA 4FI4A 2J4GA 2VOMA 3A4WA 3KOWA 5EMUA 2KZHA 2FZNA 3MMWA 3TDFA 3KHDA 1JCXA 4IIGA 4AIOA 1ZS2A 2XZ9A 4HSOA 5FEZA 2YCEA 2XYLA 1F74A 5EYWA 2Y7GA 4XKYA 2XIIA 1F4AA 1P1XA 2E68A 1RPXA 3VKKA 3PZMA 3S1GA 2Z28A 2WCSA 1E6QM 3W88A 3BK0A 4CQ8A 1UJQA 3QR0A 1NOWA 2DZAA 4KIRA 2DJLA 3BGJA 1BYDA 1X98A 3NO3A 3B9DA 4N4QA 4QJ3B 1TUFA 2G3IA 1NH6A 4S3GA 1PO9A 4O0KA 1SO3A 3B9NA 4W88A 4QEEA 3IJDA 1LQAA 1SZGA 3TCSA 5A8PA 4H2HA 1S1PA 4WIWA 1UWUA 1AZ1A 3L2IA 4CNPA 2WB5A 5AHMA 2YYTA 5DX7A 3VZYA 3DX5A 4Q7IA 3CAWA 2AAMA 1W1PA 3EWXA 4MZYA 3GU2A 1RALA 4AWSA 4WK9A 2CHNA 2WZEA 3P8IA 3N14A 4G1KA 3WQCA 4Q4RA 3B8DA 6CGTA 4A8RA 3A13A 2YCJA 3LBMA 4K3ZA 2HNEA 1ALDA 4WX2A 3S5YA 3BOFA 4DO5A 4ZR8A 1DTUA 3MSGA 1OCJA 3NZRA 1TMHA 5FEXA 3SDOA 4S3FA 4B4FA 4DJFD 3C5QA 4EPKA 1K70A 2R24A 1BRLB 5K4XA 5C8BB 1UZ1A 2YXXA 3FHQA 4PSPA 5JBEA 4GJ1A 4DAFA 3G24A 5EL1A 1H49A 2PDUA 1V93A 1AFSA 4FX7A 3DFOA 5I3IA 2NT1A 5KZ6A 4TX9A 2A5HA 3LTSA 1XGZA 1LCOA 1EIXA 1A5AA 3G3MA 1EGZA 1OFEA 1W2PA 1I60A 5CPMA 3BUVA 2IXVA 3PWIA 1MQQA 1LQ0A 1MQRA 2PGWA 2EG7A 1XSJA 1Z9AA 1YW1A 2WSKA 1YYAA 4JTCA 4J3SA 5DFAA 1OJXA 1F07A 3S1WA 1AJ2A 4IGNA 3IARA 2J7BA 4U2YA 1UC5A 4M19A 1PAMA 1CLVA 3SSZA 3QHOA 4FA3A 4LW7A 2FIQA 1E43A 1CNVA 4LANA 1QWKA 1XRTA 1NOFA 4NI8A 2MNRA 5E0FA 3PR2A 1A5NC 1MZRA 3Q58A 4IPNB 4AIUA 2V9DA 3TQ0A 2O9TA 1WQ5A 2X1IA 4M29A 4DO6A 9XIMA 2XWEA 3MBFA 2H9AA 4KRUA 3IJ6A 3LEPA 3O2LA 1X39A 1VF8A 4GQ0A 2IXUA 3CUIA 2E3ZA 2V69A 2WKLA 3NYZA 1EYEA 1DP0A 4E2BA 4AU0A 3MWAA 3EDKA 2C19A 2X2GA 3AS2A 2I9UA 3QGVA 3N11A 4UMBA 2X0YA 3ZJ7A 3L4YA 4MUZA 2E9LA 1RZMA 2IUZA 1KFBA 3VINA 3W24A 1WV2A 5EU9A 1P7TA 3KOXA 4PGLA 1MUMA 2CBIA 4HYVA 4YLWA 3M0MA 3RO8A 2Z6IA 5DQPA 4N02A 4JKLA 2DORA 2A2IA 3EKZA 1XCXA 4I90A 4OVXA 4WGHA 4B5NA 3VOCA 2ZXQA 3N15A 5CBBA 3OEXA 3W76A 1EA0A 3N18A 2YDSA 4GZ7A 4F79A 5A2BA 2VX7A 2P0OA 3MJYA 3EAUA 4FNTA 2X05A 1UZ4A 3R0UA 1VBRA 4UFMA 2LLEA 2ZRXA 4Z1AA 2A0NA 2GK1B 1CBGA 3VILA 2UY5A 4V27A 2ISSA 2QCGA 4H7ZA 5DBUA 3TKFA 2AGKA 3PVFA 5M17A 1MZHA 4UFHA 4UTFA 3FLUA 1EOKA 3PTDA 3QPYA 3TLQA 5G1YA 4AD2A 4QDPA 3W53A 3GAKA 1UD5A 3CH9A 4GNJA 5F2GA 3BWWA 1V3JA 5G1MA 3KFTA 1GOKA 3ITTA 3GRIA 3K4AA 4HPJA 3PTKA 3OODA 3W29A 2VWTA 2FPTA 5GQBA 2G3MA 4I7UA 2OG9A 2VGFA 2OGJA 1R0MA 4BY3A 1HO4A 3QMRA 3O8AA 1Z7AA 2CPUA 3C0QA 5H1WA 4H9YA 3DCPA 1FDZA 3MKKA 2QUUA 3PSVA 4ZBCA 2XN0A 2R1NA 1KBKA 1MO0A 3ZOAA 3RIKA 2BASA 3TCEA 1POJA 4KFNA 3EZ4A 3H4WA 2J66A 4I9TA 3HGRA 2ZZ6A 4ZQOA 3R58A 5A8OA 2PLCA 1UKTA 3CASA 2ACSA 1Q8AA 3PBVA 4PUKA 5H6HA 1OSEA 3IVTA 4V1YA 4AD3A 5DMYA 1P1MA 1NFGA 1BHGA 4JIIX 3MVIA 2R91A 3ABOA 3SUTA 4H7VA 4IF2A 3TN4A 1C92A 4J7RA 1TWSA 3QF0A 3RXZA 2Z1WA 1Z3NA 2QCNA 2CZFA 2GGGA 2ABAA 1GVYA 3RR1A 2X1RA 3WZ0E 4DF2A 2V38A 2HPIA 3NQMA 2NQ9A 5DMLA 2OELA 5BXPA 4PCNA 3IGSA 5CG0A 2AQWA 1XYLA 3U0HA 3BZJA 1JYVA 1TWDA 3P14A 3GDTA 4US6A 3IVUA 4LS1A 3QOKA 1NSJA 3GNPA 4G56A 4R33A 1A0EA 5FJUA 4XX6A 1E56A 1JJKA 3OG2A 3S2NA 4I6VA 1QI0A 5JIWA 1D7FA 1A0DA 2BOFX 1M5WA 1BTCA 1EP1A 4DPPA 3G1YA 2XJ7A 1Q6GA 4NI3A 3AXHA 1XGDA 5JXQA 2FTPA 1RBAA 2OEMA 3WNKA 5GVJA 4J2MA 2PDGA 3VX1A 3V0UA 4L1WA 1I2OA 3W84A 4BWLC 1H0IA 3E0LA 1XLAA 1DJXA 3SFWA 4MZ1A 3GAYA 3AAMA 6TAAA 1VPXA 3LNPA 4IP5A 1JCJA 2QAFA 4KEVA 3CZEA 1BQCA 4HMDA 3D5HA 4AC7C 4S3JA 2E77A 1UH2A 5G4HC 4NJGA 3VDGA 2DGAA 3H4GA 1PCKA 4D2JA 3CYVA 4WJEA 3D47A 4GVIA 4O19A 4H3DA 5HQMA 1NFBA 1X38A 4GMEA 3FCPA 1OFBA 3UWQA 1V7YA 1H2JA 2VZOA 1I0BA 4IIEA 4CQ9A 2R1PA 2WC4A 3HGJA 4ZGYA 2NLIA 4LV9A 4FLRA 1YE4A 4JBRA 3G8EA 1X7FA 3ZMRA 1F73A 4E4PA 4DZHA 2VDGA 3AIQA 1J10A 3UXKA 2PU1A 4JPGA 4QQ3A 1V3HA 1X96A 4CQCA 5LXEA 4HNLA 1TV7A 3K46A 1WPCA 1E40A 1OFAA 4HZ7A 2FYMA 4G9PA 4HMCA 4KWSA 1F7BA 3L4TA 2ICSA 1X8FA 2PDMA 3TN3A 1XXXA 4UCGA 1SO4A 3CGTA 2A21A 1KQZA 2E6DA 4G2DA 2OSXA 4FIQA 2OJPA 4UQDA 1IWAA 1SW3A 2WMJA 4V15A 5DXYA 2HBXA 3N34A 1W9UA 1OGBA 2PWEA 3VCNA 5HJLA 1V6YA 3VDAA 4F0LA 2BVDA 1VEPA 1SUXA 5AYYA 3TTQA 3CUFA 3WQ4A 1S5NA 1F76A 4M51A 3QYSA 3NAVA 3W25A 4MFEA 5FF3A 2IW0A 3CC1A 2Y63A 1HL8A 2HXUA 2BY2A 5BMXA 2WM0A 3NDOA 3QY6A 3Q45A 4A8NA 4QAWA 3O05A 3B8WA 5ABFB 2ISDA 2WC3A 1SGJA 4X63A 5CC5A 2POTA 1KM2A 2X8RA 2BOGX 4JIRA 3G0UA 3PUOA 3P6LA 4RCXA 1O95A 4IICA 4GKTA 3QZ6A 3HPSA 3H54A 5I2UA 1F6KA 2O55A 3CQJA 3UXIA 2XWDA 3KRZA 1XLDA 1MXGA 1DXIA 1J11A 1Q66A 3AHVA 2DUZA 1HTIA 3WD2A 3NFUA 3VOFA 1E72M 2VUNA 4ACZB 3AXMA 4BEQA 4DO7A 3PZIA 4ZE4A 3GLCA 4DPQA 3WN6A 4J3UA 4JTUA 3UP8A 2V2CA 3SCWA 1JYWA 2NUWA 1THFD 5F2IA 3BAKA 3VABA 1E6NA 2Y5SA 5JIPA 3OVGA 5E6YA 1XQKA 1WCGA 3EWCA 2DIKA 3Q94A 4OHQA 1EKOA 2ZTKA 2ZX7A 5A8NA 5LIKX 2IPGA 4ZXOA 4C6CA 1EDTA 3UBPC 3GHUA 2Z1VA 1R3SA 2A6LA 1UHVA 1D8WA 4GBDA 3DAQA 2J24A 1Z32X 2GVLA 2PDJA 2JGQA 2QAPA 2G3JA 1UUMA 3TP4A 1T96A 5A6TC 1RK5A 2QGHA 3GS6A 5KZDA 3QSTA 1YDYA 2PRLA 4F40A 4CCEA 4AVFA 1B3YA 5HUPA 1H51A 3C2VA 3LCXA 3OGSA 3S4TA 3FDKA 4QE1A 1IXQA 2OWXA 4BJHA 3OBKA 1XIEA 4XUYA 4Y6GA 1KD0A 3AMGA 1ODUA 3H70A 3R13A 3UVIA 3TE9A 4ALDA 4CCDA 2VR5A 2OX1A 2P50A 4H41A 1HNYA 1PTAA 1NQ6A 5JBDA 2INZA 3IV3A 1ZGDA 4DJDC 1XYBA 3ZR4A 1TR1A 3NL3A 1DPMA 2NUXA 4MZ8A 3FXYA 2PGEA 3LRLA 1JAKA 1XX1A 4YMZA 2EJAA 2OYKA 3GBDA 4PC8A 1EIBA 1E9ZB 1V5XA 4AYSA 1FXQA 4Q4OA 5D38A 4AX6A 4Y90A 2PRHA 3QC3A 3TYBA 4CQBA 3WQ8A 1WBJA 4ZQMA 3T07A 3HMCA 1J6OA 3GXPA 2JQXA 1J0JA 3DI1A 4RR4A 1TV5A 4CQAA 2QYGA 4UTMA 1BLIA 2YYUA 2HZGA 3CPRA 3M43A 1A5KC 4JDYA 2VT0A 2RDWA 4OKDA 3NL6A 4XIMA 4LBSA 3UY8A 3KAOA 3NWRA 3URNA 1MXDA 2PDCA 4IL0A 3BMWA 3STFA 4UFJA 4JX6A 4O12A 2P3ZA 4K7YA 1XBVA 9RUBA 3EOLA 2H6RA 3U2CA 3RLHA 1C9WA 3OTRA 3PFMA 1MW1A 2FHFA 2XVNA 1YTKA 3FJNA 2PP0A 4LNCA 3ZT7A 3OA3A 2YDQA 4HA0A 1T5AA 3U48A 3DFPA 1J0YA 2DPEA 5KZEA 2VC5A 4WEVX 1KKOA 3QZEA 3M7WA 3V16A 4XTDA 1OABA 4JX4A 1SZRA 3U7VA 4YYFA 2XVGA 4DBUA 1VBGA 3QHMA 4X0NA 4HHMA 4JHMA 3FYOA 5G4EA 1EB3A 3TC3A 3WQGA 2HEJA 2CFFA 1QOXA 3SN0A 1B1YA 3CM4A 3LD5A 3E6EA 5I79A 5HANA 1ZENA 3RMEA 3UCDA 3RILA 3MUXA 1UMYA 5D30A 5HNNA 3PTMA 2D69A 3LCIA 1H7NA 4UB9A 3EMCA 3BSGA 2MUCA 2IQDA 1X1NA 3QMTA 2RAGA 3QFEA 2OFJA 5F4XA 1EPVA 1WUFA 3A9BA 5HR6A 1W1ZA 3VIKA 3PZUA 4W84A 3TQVA 4J3WA 5CGQA 1P0DA 2HXTA 2G96A 3R94A 1UD8A 1VLWA 3M5VA 5C6MA 2CWNA 4TVCA 4BK9A 5LIYX 3KEHA 1CX9A 1YXDA 4C6OA 3H2CA 4ZOCA 2PDHA 4JTGA 3E96A 4JHZA 1UR0A 4AZ5A 1JPDX 1XP3A 1C9DA 3RRAA 4N7QA 4DRSA 3T42A 1JPIA 7REQB 2VVNA 3KZPA 3VNLA 5E9XA 5HNUA 3QEZA 1PKNA 3EDDA 4PTDA 4A4AA 2VUYA 3CIVA 3GW0A 5I24A 4AZCA 2FFCA 3R10A 1H1NA 4AEFA 1XWYA 4P8WA 3ALFA 1XG3A 3L5LA 2VVSA 4DBEA 1SSGA 3TMQA 4MJ2A 3MUCA 3WEOA 4PR4A 3BV7A 4BQ4A 2WHJA 3ARSA 4QLLA 2W5FA 3STPA 2XM2A 4JTEA 4ZFMA 2YOCA 1RPKA 4C7FA 5CGMA 3S1VA 1HF6A 3KUMA 1KBLA 4MIMA 4NASA 2QCFA 4DWSC 2OQLA 2ZZ3A 3GG1A 3MSRA 4Z0SA 4ADSA 3OJGA 3W71A 1TIMA 2Z2BA 3F5JA 1BXBA 1P43A 3NL5A 4X61A 1EH9A 3FEMA 1DE5A 4JICA 5AOUA 2OQHA 3N13A 1BFNA 4PB3A 4JHOA 3W72A 2WCGA 1E9YB 1M3UA 4F2UA 4ONVA 1L6GA 1SPQA 4AUBA 5TIMA 2GQ3A 3M6DA 1W2VA 5T91A 4ZCWA 4DX3A 1US0A 4IMGA 3ZS4A 4I5RA 3PC0A 1KXQA 1PVNA 4XO7A 3SBFA 3TZFA 3IS4A 3ARUA 4M6UA 3G1AA 3I3DA 5LNVA 4HU0A 4UOJA 1W3HA 4Z2KA 4NAEB 3NPXA 2FVMA 4HMNA 4H6QA 5CAKA 1S2AA 1QHZA 2PBOA 3MP4A 3N4EA 1FHVA 3IIXA 3DG3A 3NDYA 2Z2UA 5HULA 1O66A 4QRNA 2PLMA 1EGMA 2JKAA 1RCOB 4GI9A 2Y8VA 2J77A 1CXKA 4LF1A 1HQTA 1OGSA 4NJHA 1AW1A 3RRXA 1R7OA 1V0LA 4GG9A 5J5DA 4G8TA 3GO2A 3WLRA 5DRCA 3KP0A 3KVMA 4JTDA 4XG1A 4J3TA 2E67A 1QR7A 1E71M 3L2MA 3P84A 2PLKA 1B4EA 3DERA 1GQNA 1E0WA 4JL2A 1XYCA 3V36A 1Q85A 4IWWA 4D8ZA 2DW6A 2OKTA 2VZSA 4MTVA 5ABTA 1C93A 3PZTA 3O6DA 4NZCA 1FWRA 3BCDA 3BAIA 4GO9A 1YPFA 4EKJA 4H9UA 3PAOA 3SUVA 1H11A 4O28A 1TG7A 4GIRA 3K1DA 2QPSA 1GEHA 4O10A 4LAKA 1J01A 2UY4A 1DQUA 4MLJA 4UTTC 5C70A 2ISFA 4RX0A 4CUCA 1QPRA 1PE1A 2DZVA 3WLIA 3PG8A 2HVNA 3DKLA 2VKZG 1ME9A 2WYSA 4YTQA 2NX1A 2VOTA 5F4SA 4C65A 4PMZA 4PBEA 5FA5A 3TC6A 3GNRA 1VPYA 1VS1A 1UD4A 3GXTA 3WG6A 2BBFA 3BDKA 1B3XA 3WJSA 2ZE3A 1TTQA 4LUIA 3UNTA 3HG2A 3ZT5A 4PH6A 3N3TA 4IPJA 3H6OA 2KX9A 4GXMA 2IPFA 3LA4A 3G0XA 1ZTVA 3VNKA 1W9VA 1LWJA 4BI7A 1EC9A 3GG7A 3ZJ6A 2CNCA 1NP0A 2J7DA 2WQPA 5JQ9A 5M03A 4PULA 3SCUA 1Q6CA 4K37A 3W37A 1XFCA 5EY5A 2QZRA 1WBHA 3VKCA 4RK8A 1EHNA 4QAIA 1LUCA 1ZBVA 2YW3A 4REQB 2GWNA 2F61A 3FNDA 3P82A 3KE0A 2TYSA 1J96A 4UR8A 3QR1A 3IK4A 3C0JA 1AJZA 1O1HA 1XINA 3PB0A 1FH7A 3UWVA 3VXGA 5E70A 3BG3A 1TMQA 1FVPA 1GZJA 5A5WA 4B16A 5C9ZA 1XD0A 3WUEA 3BAYA 4DJEC 3CWNA 1OFDA 3KL3A 1FFRA 4UUIA 9CGTA 4IPPA 1GQLA 1XIIA 4HOWA 2UZ9A 2XVKA 2YBTA 1UR3M 3KL0A 4H7CA 2XISA 1GKRA 4KCTA 3E2VA 4KFPA 2ZRUA 4XTIA 1A4LA 3GU9A 3AYRA 3NSMA 3WLHA 3RM9A 3LTYA 4LS2A 3KVKA 1DHKA 3BLIA 1BEUA 1F3TA 1XBXA 3TROA 3BLFA 3CIWA 4DXXA 1E1FA 4Q8OA 1HGYA 2G5WA 3DGRA 1QI2A 1DL3A 4DJFA 3WBYA 3C6CA 1D2KA 3A5FA 3Q37A 2QVHA 3TFCA 4J40A 3R7MA 3WD1A 1AZ2A 3EA1A 1JIBA 3MI3A 5D9PA 3ZSSA 4O1DA 1B3WA 4TXEA 2Z27A 3NIYA 3QH2A 4O16A 4UFIA 3DHPA 3TMLA 4BHYA 3VX0A 1R9YA 2JKPA 2J7HA 3BW2A 3N2TA 1Q6FA 1UYQA 3MDWA 2RDXA 3DFSA 3BPWA 1XHGA 4IMEA 1GYNA 2CLIA 4L80A 3W3OA 2PUZA 3H53A 1KKRA 2J6VA 4NJJA 3CZLA 4QG9A 1UG6A 1FHLA 2GUUA 3FAWA 3CWOX 2GJRA 1IEXA 2XUCA 1L2UA 3K4WA 1NDZA 1PWLA 1DHPA 3D46A 8XIMA 2AGTA 3GXMA 5RUBA 3GFZA 3T55A 4GXPA 4ZE5A 2QJIA 1R5YA 1UW9A 1K8ZA 3LHTA 1WDWA 3LMZA 4F3HA 4AHOA 1HL2A 3GSMA 4H19A 3I10A 3CO4A 3DIPA 2Y70A 1OC6A 3W7EA 1E0UA 1OCQA 4XKYB 1K9TA 5E1QA 1PDZA 3FW6A 2GSJA 4AD4A 3VDBA 4RE0A 3S2LA 5LHFA 2D3NA 4JFTA 2REQB 4AW7A 5DEZA 4MYAA 1HN1A 4FNPA 1XLGA 3OQ8A 1XC6A 3FS2A 4HIBA 2RHGA 4GGBA 1U5VA 2QEZA 3R6IA 4R9OA 2IPWA 2ZC1A 3H7RA 2FZ9A 4IFKB 3HPAA 3KWXA 4L64A 3HPZA 4E2OA 2AKMA 1UD6A 4D8AA 4G7EA 4GFIA 4ERAA 1XSIA 5CJMA 4F4RA 2J9YA 5HPOA 1O94A 5KINA 3QQWA 4LXFA 3RPTA 1AA1B 5BROA 2V63A 4WDTA 4YYCA 1U83A 3W7NA 3S5NA 4RW5A 4WQ6A 1M7PA 3KTXA 1K4HA 3ARYA 1LOSA 1GPWA 1HKIA 3HFTA 3TOYA 2XDFA 1ODZA 4U33A 4DZ5A 3W81A 1XIFA 4ADTA 5A6BD 4FK9A 1DQWA 3AALA 4PB5A 2OR2A 4RNJA 4MY1A 1RHCA 2HNHA 3CTTA 1GWJA 2YL6A 3LX9A 4IP7A 5D2XA 4HTBA 2F7FA 5A8QA 4YCPA 1IYXA 1PDYA 3USBA 4O1CA 4H8NA 1GOMA 2NXHA 3HJZA 4FIRA 1M68A 5EBAA 3RCNA 3VKBA 3WBXA 5IFPA 2FGBA 4FEZA 3QVQA 1RLCL 2GLKA 3ERPA 5TF0A 1UZHA 2CLHA 4HJFA 1ECQA 2PTYA 3OQEA 1R3VA 4OECA 4GX8A 1PZ2A 1WO2A 1P4CA 2OZ0A 4AXKA 2NQLA 3AFBA 4CLMA 4B3KA 1KM1A 4XZ9A 2QGYA 1BRLA 2FZDA 1DIEA 2PZ0A 5GJMA 4H6EA 4O8RA 3QRHA 3NA8A 1FUYA 4ENLA 3R79A 1S2VA 3W2UA 4GYFA 1H4PA 3N2XA 4BEUA 4KWVA 4PUWA 3NDZA 1HT6A 4M6VA 1KFWA 1CLXA 1KBBA 5CZSA 4H4IA 3ITXA 1AG1O 4O52A 4IIFA 4KWOA 2OLHA 3SIZA 2QMKA 3QW4B 2Z6JA 4GGHA 4M7TA 5J5RA 1US3A 1NELA 1SM9A 3GHRA 2J7CA 2XH4A 3ZYZA 3NZPA 3UPWA 3TW6A 1Z8AA 2XFFA 4UQEA 3H7VA 2V3FA 4MKSA 4QG8A 4TTUA 1BVZA 4FSAA 4TTGA 3ZIZA 2CBVA 3NQGA 1Z89A 3AIUA 4NZJA 1K1DA 3W1PA 3XISA 4OUIA 3USZA 4ZB0A 1QASA 5K3VA 3W87A 3MP5A 2NQZA 2OWCA 1UD3A 4C6EA 2OZTA 4WKFA 4Z17A 1OBAA 3E74A 4E38A 2Q8XA 1NJJA 4JNMA 4EANA 1QUMA 4EAMA 1F8IA 4HMEA 4EX4A 2VX6A 3CHVA 2VHLA 3W1AA 5LIXX 2ZYFA 4WD0A 5AFDA 1O5KA 3CQIA 4H00A 3RF9A 1E6SM 5DLCA 3GVGA 3NPUA 4F66A 1W0MA 1WXJA 4KFOA 3W82A 3K2GA 1TV3A 2CC0A 1R85A 5D2WA 5A94A 2GPTA 3IIPA 3HGOA 3OW1A 1S5VA 1BGAA 1WKFA 3KDOA 5DY3A 4U5IA 3FKKA 4OOUA 2EAWA 4BI5A 3KLLA 3U57A 3GIPA 1MFVA 4UZUA 3WF0A 4J4KA 3UWUA 1CB7B 3VI2A 1GVIA 3LHUA 3Q65A 3T09A 1KTCA 1U33A 4CN1A 2G97A 3WH9A 1HP5A 1JYNA 2V81A 3LPGA 3WQOA 4LAMA 4C7DA 3B04A 4JTAA 5HQLA 1HKJA 3QOMA 3LHVA 2Q8LA 3TA6A 1B4KA 3A4AA 4MM1A 4X2PA 1CGYA 4G5DA 4AAJA 4LQ1A 3GHTA 2GK1A 5CAHA 2QCDB 1W3NA 4QXIA 2V30A 3WCZA 3A47A 5HBFA 2ZUWA 3W7DA 3O1NA 4LYRA 4Z42C 2XHYA 2EG8A 5MKGB 4GO8A 3W27A 2A7RA 4HZMA 4KS0A 2ZRYA 1ZCCA 4XAFA 3MKCA 4JFVA 4CD4A 1GNXA 3JU2A 4GYPC 3KP1A 2FTWA 2WZHA 1OZQA 3H2EA 1H50A 3EEZA 2YXGA 3UXLA 4L4LA 1EO7A 2DH3A 3PZQA 3GUGA 2PZNA 3IJIA 2E5BA 1VB9A 4WKAA 1K8YA 3UWYA 1I2QA 3V3WA 3XIMA 2OSWA 5C9WA 5C2XA 3A3XA 4MNKA 2VJXA 1G01A 3GZ3A 1ESWA 4K8GA 1H09A 3RLGA 2I5QA 5LGXA 1QNOA 1OVDA 1VJSA 1OYAA 3C3UA 3MCNA 3NQVA 1LG2A 4QG6A 3G1DA 2JF6A 1LLOA 1YNYA 3Q4DA 1JXKA 4XBKA 1R6WA 1NVMA 2IQTA 4C91A 4L9ZA 4XZNX 1PXGA 1QPQA 4MWAE 1A5CA 2A85A 1RP8A 1GYMA 1KQYA 4LJ3A 5K9DA 1LORA 1I9CB 3TYEA 1NF7A 2DUAA 1X97A 3QW3A 4J27A 3B8UA 1AQHA 4EWJA 1VENA 1JZ7A 4JX5A 5BU6A 3GB6A 3QPEA 5TBOA 1A5BA 1XFBA 5KSWA 2AMXA 4O50A 2VX5A 3ABRA 3CEUA 4LB3A 2R1KA 3IUIA 4O11A 3APYA 1IIHA 4JS3A 3TXZA 3ENLA 2PEVA 1U22A 1WZLA 6XIMA 4BF5A 1R3RA 5D9NA 4JTIA 5K7JA 4PUMA 1MDLA 1JNEA 4AEOA 3WQVA 1JR1A 1VJZA 4IPIA 2DZPA 4TVUA 3UVAA 1TVLA 2XVPA 3M0IA 4PEEA 1GONA 1BYCA 4GH3A 2O56A 1BQGA 2A3LA 3OIXA 1O5RA 2E6YA 3LBOA 1JI1A 4NQ1A 3BAXA 3WUFA 1ZHAA 3WJWA 2C15A 1AL8A 5KEZA 4BS0A 3C61A 1CXIA 3AC0A 3THDA 1BSIA 1E73M 3WH7A 2V0TA 3KS5A 4UOQA 3R5EA 4FR1A 3LHZA 2O9PA 2ONEA 4XWUA 4H6RA 3TR9A 3INPA 4AB4A 3ELFA 5K9XA 2VQTA 5I7GA 1L6YA 1DJIA 2BWGA 1ZP4A 4Q22A 2YPIA 3GYCA 1ZJBA 3HMJG 3STGA 1XJBA 2DQXA 1GQIA 2Z7KA 3B05A 5CBJA 2E6AA 4H8HA 5EA9A 5FSDC 2YLAA 4RPQA 4HZ6A 4Z08A 1CIUA 3VMOA 4K8HA 1U30A 4H9TA 3ONCA 4GZJA 1UPPA 3WL1A 1W8GA 3NOEA 1TVPA 3PPGA 4W5ZA 3RYSA 1R87A 4DWSB 4DBSA 2G37A 4DJDD 3VCCA 3TTEA 2H8XA 2PURA 3WDHA 1LROA 2Y5EA 3C0LA 3TSMA 3EOSA 3W7RA 3B97A 2FH6A 5FL0A 2YCIX 1PWMA 3QV7A 1X6LA 4ZQRA 3WLJA 4UQCA 1MNZA 2OKOA 4XO6A 1Y65A 1ADDA 1UZDA 2PCQA 1M7JA 1YTDA 1D9EA 4FNUA 2DSWA 1GTEA 1IQ8A 4DHGA 5EBUA 1GUVA 3OVPA 1XRFA 1O7AA 2VFIA 2F9RA 4NZ1A 2VZVA 2V82A 5CPQA 4XISA 3CH0A 3R11A 2NWSA 5E0CA 4R7JA 3VD3A 5GJNA 4HU4A 4QBXA 2NQJA 1JZ4A 4C6BA 2YBUA 4P2VA 3MPGA 1A0CA 4Q32A 5G2IA 2ZX9A 1V0NA 5AC7A 1RVKA 3S2MA 5KTLA 3LCGA 3NQAA 1GJPA 3WDJA 3VAVA 1XDMA 3W75A 4M81A 1JZ5A 3CAKA 4Q8PA 1UWRA 5DMNA 4C1LA 3AI0A 4JEQA 1J0KA 2BY3A 4NILA 1NDWA 2A3HA 3GDLA 5H8UA 3QV8A 5LIUX 5CPNA 2E25A 5KITA 1EGVA 3IGUA 4A8IA 4Z2IA 3C2OA 1MEWA 1OCBA 4B3ZA 5PTDA 2VRQA 3S9IA 3B40A 4PYSA 3VGEA 2V5JA 5BYWA 5ABFA 2DY3A 4K39A 3T81A 2B4GA 4W8LA 1MRQA 1QBAA 3EYPA 3UERA 1KFJA 2HSAA 3HFYA 3CZKA 1TV4A 3F4DA 1PPIA 2R6OA 1TRDA 1PKMA 2PD9A 3T0TA 1E3ZA 1RLDA 4M82A 4H9VA 2GQAA 4HKPA 5BNKA 4MB1A 3EX3A 2BMBA 2ESCA 2PWVA 4LUSB 2XPKA 4ACZA 3DDMA 3GX9A 4JTTA 4TX6A 7TAAA 3THCA 1W1YA 2E8ZA 5BXRA 2TAAA 4DXVA 1W9XA 1TX2A 3IUDA 2VZTA 2G50A 3P3BA 1XR2A 4NXSA 1E1CA 1LJYA 2BNJA 1D3HA 2JIEA 3MANA 1ZSXA 4L9XA 1S39A 2WW5A 3G1VA 5FACA 5HNTA 1K3UA 4PTVA 1NIUA 3GTHA 4MKNA 2WBGA 4HU3A 3TIMA 4ZB2A 3LGEA 1UKOA 3T7VA 5I3HA 2P0IA 4JYFA 1W3TA 1WKDA 3PB2A 6A3HA 3TFXA 3VD7A 3KVLA 4O0ZA 4XK2A 2GQ9A 4NKCA 3U8GA 4DELA 3AIBA 3WLQA 4IPLA 3O6AA 5JBFA 1SQ7A 2GGIA 1N7KA 2BY1A 1RQEA 2CBUA 3OIHA 3WX7A 1FA2A 1XH1A 4HPNA 5LNRA 2GJXA 3VGHA 1HGWA 1UC4A 2DV0A 1JCTA 1TJRA 2V2DA 3VC6A 3ANUA 3L7RA 3A12A 3BVJA 1TPB1 3ONBA 4DWSD 5JU6A 2XFYA 4L5ZA 4XAGA 3PK7A 2D2OA 3AOFA 1G1YA 1DE6A 2Z1SA 3DYOA 2BP1A 1K8CA 5LHEA 1OHLA 3G2GA 1T6MA 3M5XA 3WENA 1CENA 3W7IA 2DVUA 1GVQA 3GC5A 3SQMA 2BXYA 3QTGA 4MLRA 4U10A 1P0KA 2RDUA 5ECVA 1FH8A 1JG9A 4Y8EA 5AC6A 1FX6A 1BWKA 1PSCA 2OX4A 2OEJA 5CC7A 4KH2A 3MBDA 1YXCA 8A3HA 3TEVA 4UFKA 3PJTA 3W2MA 4S1FA 3EOUA 3RU6A 2BTMA 4KRZA 4AHQA 3GVVA 4US5A 3P60A 1RR2A 3LCFA 1OFQA 4Q8NA 1W3IA 4PCFA 1OYCA 4DI8A 4IQJA 4AG0A 4HHHA 3I65A 4P8VA 1ELSA 1VGAA 5CC3A 3W1MA 2Q3RA 1J93A 1V4YA 1M9HA 1HFBA 5CZJA 4B2DA 4PCSA 1CXFA 4C5ZA 3H2FA 1GOIA 1M03A 1W5MA 1JDAA 3TTOA 3NEHA 4B5WA 3W22A 1JVNA 2G3FA 3GDKA 4BCEA 3V5OA 2J7EA 3K30A 3CZJA 1L6WA 2ZWZA 3UQNA 5DT7A 1ZUAX 3VD5A 5BCAA 4OIFA 3TJXA 3TONA 3WMBA 1JI2A 2FPVA 3N29A 5AYZA 3T8QA 2ASHA 3NQBA 3VGBA 4RNIA 1S2CA 4DEFA 4MUPA 3M64A 3FKRA 4H01A 1EQCA 3CMFA 1B90A 5XINA 5FCZA 3F4VA 2YZRA 4NJKA 3WEZA 4LALA 4ES4A 3TJLA 3RNDA 3R8GA 5FJRA 5G2HA 4HOXA 4RXGA 1YNPA 4UBPC 5CPTA 4JQ3A 4A3HA 3HPXA 2V2HA 3WF2A 4TO8A 1JCNA 1LZOA 3NXLA 3WQWA 3WNMA 3WL0A 2FH8A 2D0HA 4LSBA 4WGXA 1GKPA 4GUGA 1I8JA 1Z41A 3LXAA 4G7FA 3DH7A 1TCDA 2FVLA 3AHYA 3VYLA 1QJWA 3TN5A 1DV7A 4C5YA 2ZCGA 1PB0A 3IIZA 7REQA 3GXFA 2XIQA 4C6LA 3RK8A 2BGNE 3A4JA 5HINA 1BF6A 4EE9A 3B9EA 3NQ7A 3W00A 3KW3A 2I1OA 2VR2A 3BLKA 5FKYA 4F9DA 3BAJA 2DSKA 4CU8A 2J8TA 4O4WA 4W4QA 1XCWA 3N19B 1KCXA 3KHJA 4JIPA 2PBGA 3BZGA 2WMHA 1Q6QA 4GKLA 4HA4A 4NRRA 7XIMA 2C18A 1S5MA 1TPWA 1KFKA 2Y6ZA 1PL9A 2FZ8A 1TVNA 1G5AA 3UR8A 1CXLA 5MHBA 4W7WA 2VCBA 1N55A 3T4CA 4IG2B 2DEPA 4J9JA 3WH6A 1C7TA 2W67A 3N25A 1UOZA 2Y7EA 4DJED 4MJ4A 1EC8A 1TMLA 3EB4A 3UY7A 1XIDA 3WDQA 1LOQA 1XGEA 1NWTA 1YXYA 4GYKA 1EDQA 2VDHA 3MUAA 1JQVA 1BGGA 1KA9F 3D3AA 4HN8A 5LNWA 5F4WA 3A9IA 4WDXA 4L4PA 3AQUA 1K7XA 3GIQA 4DIAA 3R0DA 1W1A1 1OWQA 2XIJA 4NAEA 3WK0A 3CL8A 1Q6DA 3HO8A 2PS2A 4OTKA 3PBYA 2WHKA 1XC4A 4AY1A 2VMFA 4HYWA 5D32A 2I9EA 3I6EA 2JK2A 2J13A 3WJXA 1KM5A 3SY8A 7ENLA 3K8MA 4GFSA 1L8PA 4UMAA 4OGZA 5EFDA 4FXFA 1JUBA 3AUOA 4XD6A 1H41A 3SN4A 1RSCA 1E9IA 2W79A 1HW6A 4QJ4B 2Q02A 4BR1A 3F4NA 1I2PA 4S39A 4Q7BA 5K4ZA 2OLSA 3HTWA 3LTPA 4AC1X 3G77A 5I09A 5C7VA 1O1ZA 1CXHA 3MMDA 3I7SA 3MO7A 3TN6A 1A3HA 1X1OA 2R8WA 3L4XA 2DUXA 1XLFA 5G1TA 3V7PA 2VYOA 4PMDA 4XBJA 2HQAA 1DJWA 5AHIA 3F1QA 4CCCA 2QCHA 3U6WA 3PJUA 3UEQA 3F03K 3FV9A 4QS6A 2ALDA 1A3WA 3P5ZA 3GNDA 1AK5A 3MTWA 3VK5A 3ID7A 3TW7A 4A22A 1WKEA 1LUCB 2C6QA 5HAOA 3DHFA 2E1DA 1B5TA 2CLPA 1W32A 1GVEA 4GX9A 5GJPA 3PTQA 3KOZA 4KW2A 5EPDA 1GORA 5FF7A 3SUSA 1EJWC 4CU6A 2CZEA 1FKXA 5D8WA 4D6CA 4JFSA 2G41A 3EWDA 1DJYA 1Y5WA 1Z6KA 2FB2A 4AY7A 2CCRA 4GY0A 2VGGA 3SUUA 3S42A 1EF3A 2W9MA 1MWOA 1RVGA 3ZLGA 1GOWA 1W37A 1JPKA 2WAGA 1KM0A 2J8GA 3LK6A 1R46A 4REQA 4RNFA 1NDYA 1JD9A 4E4UA 3ISIX 3TK7A 4WDUA 4NT0A 1FWHC 4HNVA 4LV4A 3LV5A 4GWEA 1JCMP 3KBVA 3EDEA 4D6FA 2WVSA 3U9IA 3UZ5A 1FWTA 1ME8A 3B8IA 1RCXB 1PHQA 3IPWA 3B9OA 3ANVA 4NX5A 3VIJA 3SY1A 4QTGA 3R8RA 4JTFA 2ZKMX 3ALGA 5JH1A 3B8TA 5A6BA 3UJSA 1PJ9A 3GDBA 5FJIA 2EKGA 4B3LA 4IFOA 3AJ7A 3FGCB 1EHAA 3HG3A 5C54A 1QCWA 3ARRA 2RFGA 1EQPA 3VIMA 4JYDA 2V5DA 3OZMA 1NAL1 3W2NA 5FEPA 3THQA 2BVYA 1Z48A 3S8HA 3PUGA 1AJ0A 3DHUA 3OP2A 3VIHA 2X42A 1G67A 4EF9A 1JZ8A 1V0MA 3PG9A 1KXHA 1AQFA 3SW6A 2VC9A 4DUVA 2I16A 4NX0A 1BPLB 5CSUA 2YFOA 5FF2A 4A05A 3CHEA 3JVAA 4W5UA 4MAZA 3C52A 1H0GA 4C6PA 2FZMA 3MDUA 1TZ9A 2XGZA 2ZZ7A 2F8QA 4N6FA 3R1ZA 2XINA 5DMMA 1JGIA 2W0UA 4IUOA 5LIWX 1FWCC 4C6DA 4M6QA 4JIHA 1RBOB 3EOOA 2VGBA 1ME7A 1WZMA 3BQ6A 4I9AA 3BC9A 1CTNA 3WLKX 3AJXA 4LH8A 3I3EA 1VFLA 4JTRA 4RZ6A 2PMQA 4B5UA 1CPUA 2YA2A 5D4YA 4CEUC 4Y9MA 2HISA 5IBXC 1IR2A 4MJMA 3JZUA 1FWEC 3A4XA 3P5YA 3WH5A 3UFYA 5AHNA 3EKGA 1Z69A 3ABZA 3P67A 2WNZA 4MSSA 3V18A 3EGJA 3AYVA 1JNDA 1IR1A 1XDLA 5TNVA 2W61A 4MFDA 1M01A 1OF8A 4UOZA 1KLZA 4GIEA 3CHCA 2Z26A 4BFAA 2VL4A 5DANA 2B7PA 1QW9A 3ZVHB 3UESA 3VOHA 2PSNA 1Q2RA 2AMGA 1QWGA 5D09A 1HX0A 3L12A 5FSEC 3MKVA 1OG6A 4G7EB 3QMSA 3WMSA 3C56A 2E4TA 1G6CA 2WLYA 2YB1A 4CN6A 1W91A 4UTUA 1P6BA 4IX2A 2FJUB 4R7WA 2ON3A 1C7SA 1F6YA 1V8EA 3AS1A 5CJNA 4OE7A 2REQA 4O8AA 3R89A 1VRDA 3N4FA 4GUJA 2CKRA 3LG3A 5E6ZA 4ZMGA 1RP9A 2DVTA 1G4TA 3DHDA 4DXKA 2NQHA 4AZIA 3G0SA 3TW9A 1JL8A 4IFKA 5IXEA 3I3BA 2WVTA 4AZBA 1XD1A 4BWLA 2Y61A 2VD8A 2B0MA 3KOYA 3N2OA 1P6CA 3RAOA 4FF7A 4W9TA 3EMQA 4OT7A 1KRCC 3VE7A 4EXAA 4TUFA 1J0ZA 3GE7A 4DF0A 1PZ3A 3W7KA 1WKYA 3EWYA 7CGTA 4DQWA 2HMCA 3IANA 4RE3A 1W9DM 3OBEA 4AXNA 1EZ2A 2NXIA 4HP5A 1ZLPA 2VEKA 3AICA 3THAA 1T41A 3KTSA 2QV4A 2D1ZA 2A7NA 3NO1A 4UQ9A 1VCFA 3GWQA 1LF1A 3ECQA 1JDDA 1EUNA 4R27A 1R86A 3LUTA 3NQ8A 3UR7A 4CNTA 1G69A 1MYRA 2ISWA 2YA0A 4XAPA 1ISXA 4INFA 1G4SA 2QR6A 3PJXA 3M9YA 4ZO6A 4M3PA 4P7QA 1FOBA 4QNEA 1DKWA 3NGFA 1ZBCA 1AODA 3DG7A 4GISA 4KEZA 3ME3A 1E6PA 3LU2A 4Z1BA 3T05A 4IFRA 3EWZA 3E0IA 3G1FA 3W7MA 5B7YA 3G5EA 5TD4A 3W4RA 3T08A 3ES7A 4QNWA 5DRIA 4HA3A 3OLEA 3CHDA 1BVNP 4HPXA 5IRPA 2Z7GA 1ZL1A 2AL2B 1MDRA 4UIOA 4F0KA 2O4MA 3QZAA 3P61A 3GG8A 4BF9A 1LBMA 1SFJA 4F0RA 1DWGM 3C8FA 3BANA 2F6XA 2YL9A 1JDCA 4MY8A 1RJPA 3W70A 1V6WA 2ZBTA 1KR0A 3VKDA 3M7SA 1UQYA 3P0WA 2J9ZA 1VIZA 3N2BA 3K8KA 3WYZA 2EJ1A 1X6UA 2OOFA 4MDPA 5EMKA 1QTWA 2BODX 4HJWA 5HUOA 2VI0A 5AYXA 4F0HA 1FCQA 4HSHA 5C9RA 4ZTXA 2NV9A 1PYMA 4UTHA 5A6MA 1GOXA 3KCJA 4WDWA 3NM1A 2ZXAA 4ZO9A 3AZSA 3WLOA 1DQXA 2E28A 4JEJA 3SRFA 1UCWA 2EG6A 1TR9A 1VRXA 2C16A 2XSBA 2AQOA 1UUOA 3B8SA 3KRSA 3L5MA 4JTSA 1SSDA 3I6RA 4TQTA 1WXZA 4WOZA 3SSJA 5CQ1A 2A3EA 1FH9A 1GJWA 2BS9A 2VDIA 3M6YA 2IKJA 3HQOA 3PPHA 2X16A 2OLAA 1ZJIA 4UR9A 2VURA 3MZ2A 4PBGA 3CLMA 1O5XA 4E3VA 1GOOA 1QATA 4ZSTA 3IIVA 1ZU8A 3DC0A 1DTNA 2Q6ZA 3WY1A 4GACA 3ABQA 3W9ZA 4WUIA 3FA5A 3LCWA 3CS2A 2BY0A 4JTHA 5I0DA 4ECLA 3N4AA 2Z24A 1J4EA 4KCVA 1JEZA 3C2YA 4DB7A 1R9XA 3M0ZA 3PZGA 4GIAA 3IIOA 1SW7A 2QNEA 3W7PA 1E15A 4KMQA 4K7VA 3O3RA 3QXBA 3GXIA 3FX4A 2HE8A 2J6XA 2C1HA 3SY5A 1GG0A 3QBUA 4CD6A 1NWRA 4C60A 1OX5A 4RKAA 1DJZA 3HQNA 1J12A 1YKWA 1AH0A 3EXSA 3FA3A 1W5NA 3OVQA 2WVUA 4W87A 3BICA 3PAJA 4L56A 5G4WA 1OFPA 2NWRA 3NQ6A 5AZ1A 1R3QA 3IAPA 3IACA 2ALRA 1E70M 2YDRA 1HJXA 2CLEA 2X0HA 3L67A 4NP7A 4FALA 2WO5A 1LL4A 3WLLA 2QCDA 1K7EA 2A7PA 1KGWA 3VIIA 2NVCA 3GTNA 4Q8VA 1VBUA 2VFEA 2ZUUA 3AU6A 3R0KA 3TOPA 2WXDM 4JQ2A 3AMLA 4UZSA 4LVGA 2W27A 3VVGA 3FN9A 1N8IA 4RV3A 1KTBA 3CHFA 3EWWA 4DJDA 4LU0A 2J88A 1OB0A 3W38A 5MKGA 2ZWYA 4MPKA 4JDBA 4CD5A 5A6KA 1UBSA 1W9BM 2ZDRA 3DOPA 4QSFA 3QV9A 4O0QA 2CYGA 3IRSA 5C0QA 3KX6A 4JIEA 1JFXA 2OGYA 5HJXA 4YTRA 3B4UA 3WD0A 4HGXA 1EJXC 2HDJA 2BHZA 4GYJA 4WOQA 4Q4QA 4FHAA 4IJRA 1YQ2A 3IJLA 2WZTA 1E4LA 2Q8ZA 2FVKA 2ZRVA 3NVTA 4W89A 3MP3A 3EXTA 3A22A 4N0RA 2RJHA 1FWBC 3F2CA 3J7HA 3V5CA 3BL3A 3UXDA 2OOGA 8CGTA 1F6PA 3IGHX 2UY2A 1NFPA 4HA1A 1GGOA 3WKZA 2BZNA 2ABBA 3DN5A 2D73A 4PMYA 3WBEA 4TU1A 1Q7ZA <