2Y88A

Crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase (variant d11n) with bound prfar
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
244
structure length
244
Chain Sequence
MPLILLPAVNVVEGRAVRLVQGKAGSQTEYGSAVDAALGWQRDGAEWIHLVDLDAAFGRGSNHELLAEVVGKLDVQVELSGGIRDDESLAAALATGCARVNVGTAALENPQWCARVIGEHGDQVAVGLDVQIIDGEHRLRGRGWETDGGDLWDVLERLDSEGCSRFVVTDITKDGTLGGPNLDLLAGVADRTDAPVIASGGVSSLDDLRAIATLTHRGVEGAIVGKALYARRFTLPQALAAVRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bisubstrate Specificity in Histidine/Tryptophan Biosynthesis Isomerase from Mycobacterium Tuberculosis by Active Site Metamorphosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
molecule keywords PHOSPHORIBOSYL ISOMERASE A
total genus 95
structure length 244
sequence length 244
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2011-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2y88A00
1VYSX 1P0KA 4S2CA 1ZCOA 3TW7A 4JXCA 4QM1A 1W8SA 1EP1A 3EXTA 2CLEA 3EWYA 3S1XA 1DKWA 2XN0A 3TIMA 3DFOA 2CFFA 4OHQA 4DPQA 2G95A 4LVAA 5EPDA 1KFCA 4NJKA 3P80A 4JEQA 1WYIA 3LERA 3GZ3A 1W5OA 4LVDA 3TAOA 2WKJA 1PE1A 3DXIA 1VC4A 5KINA 1KW1A 2C19A 1SPQA 3W83A 4LVFA 1KBJA 2H8ZA 4FIRA 1RQEA 3NPUA 3MHGA 3MJYA 4TR9A 1TREA 2C6QA 3I7QA 1G4PA 3NQ8A 3OHIA 1XC4A 4UMCA 3CEUA 2GJLA 1KTBA 3BW3A 1Z41A 4IMEA 3GIYA 2ZBTA 4FXSA 5HWNA 1W5QA 4LC6A 3LB0A 4PCFA 4WX2A 3L21A 3PUDA 1ZHAA 3GYEA 2YPIA 4DELA 4L4LA 3W76A 3MBFA 4UNLA 1DQWA 3NPWA 5LNVA 1EEPA 5D30A 4PFMA 4Z1DA 3MW7A 3G22A 3R12A 2HS6A 1TPWA 3TUUA 3QRHA 2J27A 1RPXA 3NVTA 3L5LA 1YXYA 3B03A 3UY7A 1SQ7A 5U7SA 2CLLA 4HSNA 5F2GA 1H5YA 4R33A 1FUYA 3NL3A 3IRDA 2WNZA 4O57A 3TX9A 2CLKA 3W75A 1OFAA 4LV9A 1QR7A 2QR6A 5F1VA 1SR9A 3KRSA 3W2MA 5EL1A 1SO5A 4WOZA 3IGSA 3NEVA 1A5BA 1Z48A 2ZZ2A 3GB6A 2NUWA 1H7WA 1M5WA 1QWGA 5F4XA 5BRBA 2RKXA 1XI3A 5FEXA 2OZ0A 3DKLA 5F4WA 3H54A 3BARA 1H1YA 3HMJG 1X1OA 3WK3A 3G0SA 1TPDA 2GPTA 4R53A 4K7VA 2DZTA 5E93A 4DXVA 3ELFA 5FEPA 2DZXA 4DF0A 3NL2A 4UR8A 1MZHA 3TKFA 1ZAIA 2ZRXA 4DF2A 3O15A 3UWWA 1PIIA 2YR1A 3T4CA 1F7BA 4O8RA 5C5YA 4FB7A 3I68A 5GVJA 1Z44A 3P74A 3HB9A 3HO8A 1EUNA 4RLIA 2ZTJA 5E1QA 3QC3A 1W3TA 4LS0A 5DXYA 2FPVA 3O05A 4CCEA 4JS3A 3LI0A 1OJXA 4M6QA 1YXCA 4LWWA 1OVDA 2FFCA 4PC8A 1EB3A 2A7NA 3TSMA 3BLFA 4O1CA 3BV4A 3BG9A 4IMFA 4NZJA 1O5KA 1A5SA 1YYAA 3DHFA 1H50A 5HMSA 1D9EA 2EPHA 2V9DA 3TNOA 5LSMA 3A9IA 3DI0A 2A21A 2X1TA 1TPC1 1KM1A 5G2WA 2VC6A 1W3NA 4IMGA 3HG2A 2NUYA 4JN6A 2GVGA 3TSBA 1O94A 1SO6A 4QNEA 4XWUA 4EF8A 3NAVA 1I2NA 1HG3A 3LM7A 1P0NA 1VCVA 3O6DA 3W9ZA 4Y8FA 2VEMA 3L5AA 1YXDA 4QJ1A 3P60A 4RJEA 1F6PA 1L2UA 1DOSA 4O13A 4JNMA 5LHEA 2VKZG 3YPIA 1X6UA 2Y6ZA 3BO9A 4IX2A 3HJZA 5LHFA 3LXCA 4WD0A 1A50A 3VNDA 4LY8A 3RLUA 2GQAA 1PHQA 2C15A 4GUHA 2GVLA 3CC1A 8TIMA 1AW5A 3SSJA 1G4SA 1JULA 2A6LA 2BSLA 5AYYA 4O53A 2YCEA 1TB3A 2A6NA 4FF7A 4Y6GA 2QCCA 4D2JA 4JDBA 1TPUA 3NM1A 2VOMA 4AH7A 3M44A 3O8AA 3HPXA 1KFKA 2ZTKA 4WY0B 4FNRA 4LC8A 4M19A 3I7SA 4XTDA 4LS1A 2V81A 1M7OA 2H6RA 1K8YA 4QAIA 2ZDRA 3S5ZA 3VE9A 1VZWA 4OWGA 3NQ7A 5H2ZA 3C52A 3E96A 1TV8A 3C2RA 5C2XA 1LRQA 3LXBA 4ADSA 5KSWA 3TW6A 3LLDA 1K3UA 4AHOA 1EWDA 4JTKA 4JX4A 3STCA 1H1ZA 1WBHA 3NOEA 2I1OA 1H7NA 3CTLA 4NJHA 4OV4A 2NX3A 4G1KA 5KZDA 1KV5A 5CPMA 1AW1A 3KXQA 2A7PA 1FBAA 1BEUA 3W88A 3M5XA 3E9AA 4Q33A 3PBUA 4EIVA 1VJIA 1OFDA 2VFEA 2WNNA 3M5VA 3GR7A 1RQHA 1G69A 1GJPA 4YL2A 3USBA 3L2IA 1JRBA 2QUVA 4DO6A 3Q94A 3CWOX 3NG3A 3LX9A 2B7QA 4QITA 1LLWA 5AN7A 4ZQNA 2ZRZA 3TQKA 1LOLA 3DH7A 4UTMA 2B4GA 3TR2A 4AMAA 1FWNA 4MZ8A 5G2IA 2X2GA 1Q3NA 2WO5A 3NDOA 1EWEA 3W1AA 3QH2A 4FNSA 4UTKA 3G1DA 3S0CA 3H53A 4XZ9A 2Q8LA 5L9FA 5F2LA 1ZJIA 3HGSA 3NPXA 4MLRA 1YDNA 1VHCA 3DFTA 2CWNA 1D3HA 3A22A 3C4UA 1AW2A 2FJKA 1SO4A 2E6FA 4LVBA 5AOUA 2CU0A 3TMLA 2QF7A 3DAQA 3FLUA 2HMCA 2R91A 3G18A 2Y7EA 3JR2A 3MP3A 1FDJA 3HG5A 3CB8A 3HG3A 1SW7A 3HF3A 3OVPA 3T7VA 4CCDA 4YXGA 2BX7A 5E0KA 4ZQOA 3IV3A 4L4MA 1Q6RA 1KM4A 4UTTC 1N55A 1QPQA 1V7YA 2X16A 5L6UA 3QYQA 1KTNA 2FDSA 1GPWA 2YYTA 3W7RA 2G96A 1GVSA 1EUAA 3W7MA 4AWSA 2V2CA 3W87A 3M41A 3CLMA 3W1XA 3S42A 3TMQA 5KZEA 3W7NA 2A5HA 3Q2DA 2F84A 1D3GA 2GQ8A 2Z6IA 2NV1A 1JCXA 3GKFA 3TCEA 3MWAA 1JUBA 2NXHA 2ZQ0A 4JIPA 2O7SA 3W7IA 4A3UA 5H91A 4IX0A 3M16A 4O1DA 3PG9A 3DKJA 1WDWA 5BNKA 5HQEA 1LBFA 4HNNA 3LXAA 3P5YA 5K9DA 1WBJA 3IVSA 3NQMA 4CQ8A 2YW3A 4AF0A 4AWUA 4GXMA 3LHWA 1PVNA 1JR1A 5EA9A 1I4NA 4HKPA 1N7KA 4IMCA 4DBEA 5KZMA 4NX5A 5AYXA 1PHWA 3LLFA 3BLIA 3NL5A 2CLOA 5CPNA 3LBCA 4HSOA 1FY6A 2QDHA 2QJGA 5CPOA 1GTHA 1OG0A 3LHUA 5EY5A 1AL8A 3PG8A 4N9BA 1VPXA 2VXNA 4POCA 4MUZA 1LYXA 3NR0A 4MZYA 2TYSA 3TFXA 1XBXA 4K6AA 4MPQA 1R2RA 5FF4A 4OGZA 4WY0F 1BKSA 2NLIA 5A5WA 3ABRA 3P7YA 1W31A 1F6KA 1TJRA 4UTTA 3EXSA 1GYNA 3GXNA 3M6YA 4IUOA 4ORIA 3LV6A 3OVRA 1SO3A 5CKSA 2J9ZA 3B0PA 4KWWA 1OFPA 2KZHA 4HNUA 2ZZ7A 4KFNA 3O06A 4GRSA 2I9EA 1JCYA 4H3DA 3FKKA 1W0MA 3TK7A 5CGQA 2C18A 3KOFA 2ZA3A 1QO2A 4QIUA 2Z1BA 5MHBA 1FCBA 3M9YA 4X2RA 3W07A 3BPWA 2VEPA 1JCJA 4ZQPA 1ICQA 3LI1A 1YADA 5C55A 1DVJA 1W54A 4DO5A 1T0OA 4BI6A 3LRLA 3PBWA 1QPOA 1KLZA 5DELA 1JCLA 2QAPA 4UTWC 3W7GA 1IF2A 1LDCA 5BMWA 1G7VA 1RD5A 2NV2A 4N9DA 4UTWA 3QF0A 4LUJA 3W71A 3L66A 1MEWA 1LP6A 2DZPA 3LDVA 1XBZA 4MYXA 1GOXA 3FEMA 3G1HA 4Y90A 3R2GA 3WJYA 1IIGA 5HULA 1VYPX 2GQ9A 3MYPA 4LTSA 3W7OA 5DCEA 4NUWA 2E77A 4JY8A 4LVGA 5T26A 3IIZA 3TE9A 5D09A 1GVQA 3CU2A 3G1XA 4CLMA 1DQXA 1TTJA 2UV8G 4EVZA 2ZA2A 4IXXA 3CWNA 4FNQA 4JYFA 5HR7A 3UZ5A 3KRZA 4O54A 2BLEA 3DBPA 1B4EA 3LTPA 4BR1A 2HS8A 1W1ZA 2FTPA 1WV2A 4JTJA 2PCQA 2YGYA 1OYBA 4LW7A 1JUKA 2E5BA 3U6WA 4E38A 1QOQA 2HSAA 4ONVA 5D38A 2E6YA 2RDUA 3PULA 3GDKA 1OK6A 5AFDA 1SFLA 1SUXA 1H7PA 3A23A 5BW6A 1HO4A 4GFSA 4MY1A 1QPRA 1ICPA 2CZ5A 1YLVA 1A53A 4ZQMA 5TIMA 1ZAJA 3T55A 3S1WA 3PAJA 4IOTA 3C3NA 4CCCA 1XBVA 4Z1CA 1FCQA 3L0GA 1NF7A 1JUEA 4XUGA 4TMCA 3BG5A 5KMYA 1C29A 2WJZA 3E02A 4IPIA 1BWLA 1GWJA 1Y0EA 4WJEA 2D73A 3W22A 5K4ZA 3GDTA 5TQLA 4O4VA 2BXVA 4ALDA 3O1NA 1U5JA 1LZOA 4FEZA 3Q37A 4ADTA 4MYAA 4UTLA 4O17A 1TV5A 1W5MA 6ALDA 4JTTA 1KM0A 1H62A 1IXOA 1GVRA 2RDTA 3C2OA 3C56A 1AL7A 4PEKA 2EKCA 3QQ1A 1TPB1 1EP2A 1WOBA 3EX4A 1H7OA 4JR5A 2JKPA 3SGZA 2VEKA 4Y9AA 1R30A 2A4AA 4NNCA 2ZRWA 3G1YA 1NFBA 1QOPA 2NWRA 2J24A 4O15A 3VI2A 1KFEA 3TV8A 3C0JA 2RH9A 3TC6A 4ZQCA 2ZRUA 1YTKA 4HNTA 2VEIA 1I45A 1GYLA 2FLIA 4O19A 1KFBA 2NX9A 2W6RA 3W7JA 3EWUA 4JTLA 2AAMA 1FX6A 1I2QA 1F73A 3HQ1A 1F74A 4K37A 4A2RA 3P8IA 3EB2A 4UMAA 4UTHA 5D33A 4I7VA 3VFLA 3A5FA 4R34A 3QMSA 4QISA 1K8ZA 3NPVA 4FIQA 3S8HA 4N4PA 1W56A 1PS9A 3DGRA 5AC6A 3NQAA 4GUGA 2QCGA 3QW3A 3IIPA 4ZMGA 1FQ0A 2ZZ6A 2Q3RA 3GXPA 2A7RA 3CM4A 2NXGA 3W3OA 3TC7A 2DJLA 3MI6A 3LHZA 4AAJA 2V5LA 1YDVA 2C13A 3C2EA 4IQLA 1LRNA 3W70A 2HTMA 1R2SA 3IVUA 4C1LA 2Z2UA 2JGYA 2AGKA 5FF2A 1JQXA 3KAOA 3UWYA 1GZGA 3RFAA 2R14A 1BWKA 4RKAA 4O28A 2R94A 3PUOA 1EIXA 2FB2A 4YCPA 3S5NA 1KM3A 1CI1A 2ABAA 4XTIA 4BWLC 1Q6QA 3EX2A 1TRDA 2ATSA 2EHHA 3W7QA 3BK0A 5I3JA 1I8JA 3F4NA 1WXJA 1Z42A 3OG3A 2WPBA 2R8WA 2QKFA 1IXQA 5D2WA 2YYUA 4TX9A 5HINA 4JDYA 3PBVA 1OF6A 2YXGA 4XBSA 3W7KA 4JTEA 4MLJA 3P67A 2V82A 2CZDA 5CG7A 1TV7A 4BI5A 5K2ZA 3GNDA 1OX4B 1AK5A 1ML1A 2H8XA 2I14A 2FPYA 1UB3A 4FX6M 4K39A 3OIXA 1QNVA 4Z0JA 4U4MA 2A85A 4M5PA 3F4WA 3N14A 1MSSA 3I65A 1E51A 3PSWA 3R13A 7TIMA 5I3KA 1VCFA 1LLZA 4TU1A 4AVFA 1XUUA 4FNPA 3WFAA 1XBYA 2O7QA 1Q6LA 3SW6A 1OX5A 1F76A 1IGSA 5HJLA 2FPTA 1VQTA 3QMRA 4O0ZA 3ZWTA 2VFIA 1ME9A 3MYOA 1NSJA 3UYCA 4UIOA 1TTIA 4GC4A 3SY5A 1T99A 4Z1BA 3QSRA 1G7UA 3W85A 1ZY9A 4RXGA 3BVJA 1DORA 2H90A 2Y89A 4NX0A 4MVAA 2OMAA 2YW4A 4BFAA 2XFWA 2EAWA 3PS7A 2PE4A 3AJXA 3W2JA 4IXHA 4MFEA 3S9YA 2E68A 5F2MA 3P8JA 5K9CA 1I2OA 3UWUA 4CNOA 1JCMP 3STEA 2Q3OA 5KTLA 2Z6JA 1NVMA 2V2HA 3MBDA 3N9SA 3LHYA 3W1LA 1XL9A 4FNTA 2VFDA 1H7RA 1X1ZA 2DZUA 2ZA1A 4MOZA 1N8FA 1TYGA 2ZRVA 3TA6A 2V8ZA 3HGJA 1TCDA 4ZZ9A 2OT1A 1TQJA 3WJSA 4DPPA 1BTMA 1O60A 3GDLA 1VHNA 3BW2A 3EKLA 3GLCA 3NL6A 3G3MA 4K38A 5G4EA 4AF0B 2YX0A 4JTIA 3S5YA 3LCWA 1VS1A 5FF3A 3M7WA 1O4UA 3GDMA 1GG1A 3S6DA 3NQGA 1LOSA 2B0MA 3GAYA 4E0CA 3SGUA 2EF9A 4NQ1A 1B57A 3MI3A 1DBTA 2WNQA 3W7EA 2VFGA 3QSTA 3O6CA 4MY8A 5ABTA 4H4IA 3HIJA 3P81A 3QQ0A 4PL2A 2VFFA 2E09A 4UFMA 5I3GA 5D37A 5EBUA 2YFNA 2F7FA 1VH7A 1RVGA 2QCLA 3QEZA 3W1PA 4RV8A 3H55A 4K8HA 1XXXA 4JTGA 1ZNNA 3MP5A 3OEXA 4YCOA 4Q4KA 3IIOA 4UXDA 1GVOA 1RZMA 3W7LA 2X1RA 1FDYA 5EKYA 3HOJA 5LNSA 4OQVA 2G97A 4GUJA 3IGXA 1TJPA 2C16A 5U4NA 4ZQRA 4TO8A 5G1YA 3B05A 4A22A 1WA3A 1LCOA 1NAL1 2V0TA 4LT9A 2ALDA 3MUXA 3EWBX 3G1SA 4RR4A 4NZFA 1IIHA 1VGAA 3L65A 3TXVA 3ZR4A 3M43A 5F2IA 3G8RA 2BTMA 1XM3A 4N6FA 1FWWA 4KWVA 3P82A 4N9CA 1HO1A 3C61A 1B9BA 3OA3A 1G4EA 1LROA 5CZTA 4BK9A 1VCGA 4UFHA 3MHFA 1G67A 1V5XA 3E12A 3UD6A 3W73A 3CIWA 4IJBA 2ATMA 1K8XA 3W1TA 3LOTA 1L6WA 3O16A 1ZALA 1JRCA 3EXRA 1X7FA 2ZFAA 3W6YA 2V30A 3INPA 3W1MA 3KVLA 4FNUA 4UR7A 1KFLA 3NZ1A 1P5BA 3THQA 1KTCA 5CZJA 3W1NA 3SIZA 3QPZA 1WAUA 1WOAA 3CPRA 5LGXA 2X1UA 2AQWA 3K30A 1VR6A 3FJLA 4LS2A 4MJMA 1UJPA 2JBMA 5D03A 1XDLA 5KITA 4O4WA 1K02A 5AHIA 3DU0A 3TFCA 3N2MA 3ATYA 4N2YA 4WQ6A 5LGZA 1XUZA 1R46A 4NJGA 3SI9A 3LCIA 3IGUA 4BI7A 3B4UA 4AWTA 4CNPA 3D0CA 2J88A 2WQPA 3LGEA 3T40A 4HHPA 2P10A 4NVTA 3A24A 3DFPA 3KVJA 3PC0A 3CT7A 1FXPA 3F03K 2FB3A 3HGOA 1A5AA 2YDAA 3DHDA 4QQ3A 1L6YA 3SZ8A 4N4QA 3RMJA 1GEQA 4I7UA 2RHGA 3B04A 2X30A 4RZ6A 3KFTA 4IGHA 4DEFA 2C1HA 4KFPA 3QW4B 1VLIA 4I7WA 5K4XA 4AXKA 3R5EA 3G1VA 3BW4A 4K7YA 1LOQA 2VFHA 5HUPA 3S5OA 5D2XA 4HPXA 1OX6A 1T96A 3A5VA 3WJXA 1SW3A 4PODA 4M7TA 5LZLA 4JTHA 2J6XA 4ZL1A 2JKAA 4WUIA 4WXYA 3PF3A 5D2VA 2DJXA 3JRKA 5D02A 5AHLA 3IEBA 4B5NA 1VYRA 1R47A 2QUUA 3Q58A 3THAA 3EEGA 3I6RA 2LLEA 1SSGA 2W0UA 3TQ0A 3TU9A 3S1UA 3KX6A 1QFEA 4AEOA 4ADUA 1F2JA 2C0AA 5FI8A 1RQBA 3W86A 1QPNA 5D2YA 4OT7A 3DFQA 3TXZA 2ISVA 2TPSA 2QCHA 2Y7FA 3NQVA 3WJZA 1OABA 3DFSA 5HWJA 3FIGA 5IM51 1UCWA 2ABBA 4AB4A 3ZWSA 3PB2A 3U8GA 3RF9A 2NZLA 5AHFA 3O6YX 3O63A 3TQVA 4R7JA 1ALDA 5FF0A 5FEWA 2DP3A 1S5WA 2PRMA 2QCNA 2PURA 4JYEA 4O1AA 4X3ZA 1EP3A 3DFNA 4FX7A 4N9EA 4UFJA 2EGZA 3F1QA 1XCFA 5D04C 3UQNA 3W1RA 3UPWA 3PY2A 1EA0A 4Z08A 1KM2A 2ZZ3A 4HIBA 1M7PA 4TIMA 4U28A 3C6CA 1C8VA 3W7PA 3FKRA 3NNTA 4K8EA 1YTEA 4IMDA 1S5TA 1Q45A 3NGJA 4RX0A 1OYAA 4NT0A 2QJIA 3QZEA 4XBKA 2GOUA 4NXSA 2OT0A 2Y63A 4JX5A 5HNRA 4UFIA 4IPJA 5BMXA 3G8EA 3N2XA 5AHEA 3ANYA 3G1FA 3MI2A 4OV9A 2Y70A 1TPFA 4GBUA 1XFBA 4RXFA 3JS3A 3G3DA 2GJNA 1TO3A 2ISSA 4TMBA 3CHVA 3RNDA 1KA9F 5AYZA 1AG1O 3FYOA 5HWMA 2QCMA 1SFJA 4QNWA 3NQCA 1EX5A 2XN2A 1OF8A 1KBIA 4O10A 1A5CA 1KM5A 1OHLA 3IIVA 1JQVA 2A2IA 3FOKA 1UBSA 4O52A 2DZSA 3G1AA 1W37A 2B7OA 5DBTA 4RZ5A 2E5DA 4RCXA 4FHAA 4O16A 2H3BA 1H63A 4NU7A 2YFOA 3LV5A 2QJHA 2E1DA 4JTFA 3R89A 4EOUA 3I7RA 4XQ6A 1OX4A 5LNWA 4E2BA 3EWXA 4O18A 2W79A 4JY9A 1C9DA 2QDGA 3UNDA 1ONRA 2QUTA 1PCKA 3FJ6A 2TRSA 4UTIA 3TROA 1YDOA 3WK2A 1DHPA 3G0XA 3MMTA 1UUOA 5FEZA 4N02A 1OFRA 1GT8A 1SZGA 1P1XA 2NXIA 2TMDA 5DY2A 3UXAA 3UPBA 3M47A 4Y96A 4AHQA 1FWSA 1TPEA 3DENA 1RR2A 3L67A 4X22A 3BGJA 1H60A 2OX1A 2OCZA 2ISWA 2JKEA 4JD4A 4EWND 1TPH1 1VLWA 1FWTA 3LTSA 4LNYA 3BLEA 2Q8ZA 1R2TA 2GUUA 3UWVA 1OFQA 4NJJA 5G1TA 1VRDA 1YTDA 2V2DA 3KRUA 1GVFA 3UWZA 3IVTA 3ZFHA 1UUMA 5D2TA 2G5WA 3KVKA 2B7PA 3EX3A 4QSHA 4JGDA 5HR6A 1K7XA 1PL9A 1LBMA 5J5RA 3T78A 4HN4A 3L5MA 2IQTA 3FFSA 4JICA 1GTEA 2NUXA 2WSYA 3BGGA 3MHUA 3GDRA 1X8FA 4JTSA 3LCLA 3DZ1A 3W2KA 1GQNA 3NO5A 1ZAHA 4GUIA 4JIQA 4C1KA 2PRHA 5LNUA 1MXSA 1YPIA 3TJLA 1THFD 4WZHA 4YWIA 4LRTA 1I2PA 5AB3A 2J9YA 4M6VA 4S1FA 4AHPA 3V1PA 3T44A 4CQ9A 5EYWA 4A2SA 1YPFA 2CZEA 2WOQA 4OE7A 4A21A 1AMKA 1TMHA 4WOQA 2OJPA 2P1FA 2ZZ4A 5SWUA 3WK0A 4ORMA 4BF9A 1G4TA 5DY3A 4M6PA 1G6CA 5CZ0A 5C54A 1PV8A 5CZSA 2CLMA 3P84A 1ICSA 4E2DA 2A0NA 3NQEA 1L6SA 3TSDA 3W23A 3W1UA 1LBLA 6TIMA 3PR2A 2QCDA 2YZRA 5I3HA 1QAPA 1K7EA 1WQ5A 1WX0A 5D05A 4LUIA 3HPZA 3QM3A 3VCRA 1TIMA 2DZVA 3WJWA 3DI1A 5FESA 1O95A 3QMTA 2ZZ5A 2Z0IA 5AHNA 4J9JA 3ABQA 1DJQA 3UWQA 4KKXA 5BOOA 2TSYA 3PBYA 2C14A 3RK8A 3W7HA 3ABSA 3MO7A 3P5ZA 3QJAA 1W3IA 2E6DA 4UC5A 3FA5A 3O07A 3RLVA 4OU1A 3NM3A 1JVNA 3EKZA 3N19B 1O5XA 3C8FA 1H51A 3A21A 3UZJA 5I3FA 4JX6A 3OBKA 3KVMA 3LBMA 4MZ1A 1JJKA 1HUVA 4PA8A 4MY9A 3W1QA 4UMBA 3L0KA 4P61A 3W2NA 2Y62A 2FQIA 4ICNA 3W84A 3BG3A 1Q6OA 1KLYA 1GG0A 3STGA 4FX8A 1XDMA 1KV8A 2Y61A 3GAKA 1L9WA 4LRSA 1NF0A 4JTUA 3STFA 1FCVA 3TH6A 3M5ZA 4DBDA 4M7SA 3W7CA 1OK4A 4XKYB 1EPXA 4NNBA 2JGQA 2ZZ1A 5J5DA 2BWGA 4UCGA 3NXFA 4Z0SA 2ZYFA 3GR8A 4CQAA 2QEZA 1TRIA 3W74A 3LTYA 1IXNA 3PWAA 2Y7DA 3B0VC 3L68A 1F5ZA 3LCHA 4PH6A 5CSRA 3KHJA 4FXRA 3PUEA 5G4WA 4X9SA 4PL1A 5A8GA 1KM6A 3E0IA 2ZRYA 1DV7A 4ML9A 3NYZA 1OFBA 3N3MA 4OBTA 4EF9A 5IBXC 3EX1A 5LKYA 3WK1A 3R8RA 2WV8A 2WSRA 2CW6A 3NA8A 1S3HA 5IBXA 1H61A 3HBLA 3HPSA 4O50A 2CLHA 3NQFA 3W7DA 3EX6A 3M1ZA 4PTNA 3CEPA 5DBUA 1SSDA 1ME7A 4GUFA 5K9XA 3SECA 4O11A 2PRLA 2QAFA 1XKYA 3LHTA 4GE8A 2WSQA 4WXZA 1QMLA 2B7NA 1SW0A 3B8DA 3P62A 3N73A 1SZEA 1MEHA 5CPLA 1ADOA 3NZRA 5C6MA 3W2LA 1HFBA 3NQ2A 3MP4A 5FF7A 1LTDA 1QCWA 1W5PA 1K7FA 1JCNA 4HT3A 2Y7GA 3IIXA 4ZVJA 3G24A 4MFDA 3TAKA 1QDSA 4Q32A 3NQ6A 1HL2A 3PM6A 2P0OA 2QCDB 4UUIA 2RDWA 4LOCA 2CZFA 1OFOA 4I9AA 4WY0A 3QFEA 4W9TA 1M6JA 1H7XA 3LRKA 4UFKA 5CSSA 2Y85A 2VENA 3GX9A 4RZ4A 4JYDA 3TJXA 1CW2A 3N34A 5DLCA 4UTUA 3P61A 3QPYA 1NEYA 3GK0A 3SJ3A 2NWSA 3UY8A 2QCEA 4MJZA 4KFOA 4UTJA 1J5TA 2PC4A 4MIMA 3U2OA 3HGRA 1TTQA 2NX1A 4DO4A 5F1UA 1DL3A 1FXQA 3ATZA 3EWWA 4GJ1A 4K36A 5DCBA 4LU0A 3LCXA 4H6KA 5LNRA 5DN1A 3W72A 4UNKA 5DCDA 1TTPA 3CQ0A 4YLWA 1CX9A 1S5VA 1LRTA 3LCGA 1J4EA 1FCUA 1J2WA 1LORA 2YSWA 2CLFA 5HUOA 1ZENA 4IWWA 3C2VA 3PSVA 4UFLA 3LHVA 5G2HA 5AC8A 1OFEA 3PB0A 4RK8A 3LCFA 3UXDA 4DF1A 5AC7A 1FDZA 4HNVA 2A1YA 3G0UA 1P4CA 3EWZA 4MKNA 2FIQA 1FWRA 1PCWA 1U83A 5D32A 4N6EA 1T8XA 3VE7A 3FYPA 1B4KA 1SU5A 3GKAA 4YMZA 3AO0A 1SZFA 5DXXA 3S1VA 4S2BA 4BWLA 5I3IA 5K3VA 2E5CA 4XKYA 3B06A 4P2VA 4O14A 1K03A 2J9XA 2H3DA 5K7JA 4HPJA 1UASA 4DQWA 4GWEA 3M5YA 4GNJA 2QCFA 3ZS4A 2E6AA 2C3ZA 3W2UA 4O1BA 1DJNA 2ZCGA 1IXPA 1F05A 2GVJA 1MO0A 2X1SA 3N9RA 1TSIA 4O12A 1I2RA 2Y88A 3L9CA 1HTIA 1B3OA 1RV8A 3HG4A 5TBOA 3CIXA 3TDFA 4FO4A 3C2FA 1TQXA 1ZFJA 4CNNA 5EMUA 2CLIA 4O0KA 3RU6A 5AHMA 3SFKA 3FS2A 3VKJA 1TPVA 2VELA 1ME8A 5F4SA 3OVQA 2BZNA 4NXKA 1OYCA 2DORA 4Z1AA 2DZWA 3GXTA 4A29A 3M0ZA 3B0UX 3PVFA 1MEIA 2V5BA 1KFJA 2DU2A 4NJIA 3ABOA 1SZNA 2JK2A 1LM1A 3GNNA 3GVGA 3V75A 5G5IA 1W5NA 1QO5A 3LRMA 3NQDA 2RFGA 4NNAA 3E49A 4LV4A 3SR7A 3L0NA 2XN1A
chains in the Genus database with same CATH superfamily
4S2CA 1IZJA 1KR1A 4M24A 3BQ6A 3SCOA 3AMKA 1HKVA 3UYIA 5DANA 3GG1A 1EP1A 3EXTA 3S1XA 3NDZA 1QNSA 1UKSA 4PMOA 3TIMA 3FY1A 2CFFA 4OHQA 4DPQA 4LVAA 4LPCA 4LAZA 2NW0A 1AJ0A 4GD0A 4I8DA 4A8RA 3LERA 3WLKX 3XINA 5BXRA 4H19A 3I3EA 4U3CA 4LVDA 3TAOA 2WKJA 5A2AA 1JDAA 1JZ8A 5LIKX 3IARA 2OFJA 1L6GA 2I5IA 2PDJA 4DNMA 4JL2A 3UR5A 1JAKA 1RY0A 2PODA 3B8WA 1TUXA 4NILA 3WDJA 4UMCA 1XIIA 2V38A 3BW3A 1Z41A 4IMEA 2YCLB 4FXSA 5E70A 5HWNA 1BG4A 1WKEA 2GSEA 3PUDA 1J10A 3H22A 4FF5A 3APTA 1PZ1A 4HYWA 4UNLA 3ARZA 1CIUA 4PFMA 4Z1DA 3MW7A 4Q8PA 1F6YA 3TUUA 3SRKA 2QZRA 3QRHA 1RPXA 1GONA 2KAUC 3M7SA 5ABEA 1EL3A 3QQWA 2ZX9A 4PBGA 1H5YA 4AY7A 1FUYA 4NI8A 1HN1A 2WKGA 2XVPA 4JFSA 4AC1X 2HCVA 1TR9A 2P50A 4LV9A 2VRQA 5F1VA 2EQDA 3KRSA 1HJVA 2WVSA 4WOZA 2OYKA 3H26A 2PD9A 3NEVA 1K9TA 3CMJA 4FA3A 3QOMA 1CGVA 3BARA 1H1YA 2QQ6A 3ZLHA 1DWJM 1X1OA 2VZOA 1OC6A 3G0SA 4W4QA 3U48A 3GU2A 1CPUA 2YCLA 4HTBA 4UR8A 3LPGA 3VCNA 1I1XA 1ZAIA 4Q8OA 3UWWA 2NVCA 1PIIA 2I57A 2YR1A 3T4CA 3V5OA 1O12A 5C5YA 4URIA 3I68A 5GVJA 3TTSA 3GH5A 3HB9A 1RCOB 1IT8A 1EUNA 2ZTJA 2FPVA 3CUJA 3NXLA 2OEJA 5JVLA 4F48A 3WH9A 3CYVA 4M6QA 1FWGC 3GC5A 4PC8A 3BLFA 4O1CA 1M68A 1LQ2A 1XLHA 1V3KA 3AIWA 1M03A 1UWIA 1W1A1 3B0XA 3DHFA 5HMSA 3B8TA 2J13A 2A21A 4K1WA 3NJ3A 5CAKA 5G2WA 4P7RA 2NUYA 4JN6A 4CN1A 1WDSA 3A4JA 4GY0A 4FSAA 1XH1A 1I2NA 3LM7A 2X1IA 4Y8FA 1YXDA 3DG3A 3VKDA 5A8PA 3HN3A 1SGJA 2HRWA 2DDXA 2CKSA 5LHEA 3HQOA 5HA7A 4IX2A 2BGNE 3BO9A 3DBNA 2DH2A 5FJRA 2VDIA 3LXCA 2PDQA 4LY8A 2C15A 1DJIA 5E6ZA 3B9OA 4RNFA 3IK4A 5AYYA 2YCEA 1TB3A 4FF7A 4OOZA 4EX4A 3CXOA 2VJXA 5HOSA 1QWKA 1TPUA 3V3WA 1XGDA 4GX8A 3ID7A 4IFRA 1E6RA 1R38A 3FAWA 4LC8A 3DYOA 1JZ5A 1XRTA 1A5MC 4L7ZA 1JGIA 3GFZA 4DI9A 2VX6A 3S5ZA 3VE9A 1VZWA 4C6CA 3EOUA 3H4XA 4CNSA 3PWIA 1KO0A 1N8IA 1LRQA 3LM3A 2VMFA 3LLDA 1EWDA 4JTKA 3BSMA 1ODZA 1H1ZA 2EPLX 2VGGA 1FP9A 1CWYA 3PZTA 4OV4A 2OWXA 1DXIA 2ISDA 1FBAA 1N2VA 1BEUA 2Q6ZA 4Q33A 3UCQA 2YB1A 1OFDA 4ZR8A 3GR7A 1GJPA 1VEMA 1Z7AA 1XHGA 3VZZA 4KS0A 4LBRA 4DO6A 2OKTA 3RGTA 4AISA 4QITA 5AN7A 4HNOA 4ZQNA 4D71A 1XLEA 1EXBA 3TQKA 3N1AA 3DH7A 3E2SA 3KZPA 4ZENA 2OVLA 1EWEA 2ESCA 1B3ZA 3W1AA 4Z2HA 2FVLA 3G1DA 3H53A 4K1GA 3V16A 1YNPA 3UG5A 1AQFA 1A3HA 4JQAA 2BDQA 3NPXA 3MQTA 1JCTA 3TP4A 4WDUA 3NZQA 1D3HA 3A22A 4U2ZA 1M7XA 4A3HA 1W91A 1KC7A 3BCDA 4HB7A 1EZWA 4QLJA 1B5TA 1Q2RA 2Y7EA 3CB8A 3HG3A 4MHBA 3OVPA 3T7VA 2VZTA 3IANA 1Q6RA 1AUSL 2PZ0A 1RD6A 1HNYA 2CHOA 3PP7A 3B8SA 5L6UA 1J93A 3ENLA 2FDSA 4KGLA 1GVSA 1AA1B 2R1MA 3ICJA 2WKLA 1PKYA 4Q8NA 2Z1KA 1H3GA 3S42A 1JPDX 2GQ8A 3GIPA 1P7TA 4H8UA 4CU7A 1RUSA 1M53A 1XSJA 1JCXA 3GKFA 3IJIA 4LGXA 3TCEA 2ZQ0A 4JIPA 3WBAA 5FIPA 3AZRA 4A3UA 3FA3A 3VD9A 2Z26A 3MSGA 3WD1A 2BY2A 1ADDA 2HISA 1D7FA 3PG9A 1VFFA 1WDWA 1TJ1A 5HQEA 1LBFA 1EJWC 4HNNA 1WBJA 4CQ8A 1JDEA 2FH6A 4GXMA 5CJMA 4WIWA 1UUQA 1ZP3A 1DWFM 3WL0A 2OZ3A 1B9ZA 3AMCA 4HKPA 2VT0A 1MW3A 3LLFA 1I0BA 3BLIA 4LFYA 5CPNA 4HSOA 1JIBA 4DBSA 5CPOA 3W01A 1OG0A 1G1YA 4S39A 4Q6XA 3PG8A 1Z8AA 4TVUA 4N9BA 1VPXA 3HMCA 3H2NA 3H70A 3AS1A 1IYXA 4L4PA 4F2TA 3NR0A 1GGOA 2YIHA 2Y2WA 1CCWB 3TFXA 1OY0A 4MPQA 5HQLA 4H8NA 3LPPA 1TJRA 2D3NA 2NT0A 1X97A 3LV6A 5A6AA 5CKSA 2J9ZA 1RJPA 3S9IA 3B0PA 4H41A 4KFNA 5HNTA 3O06A 2WPGA 4W89A 2PEVA 3BJFA 1S38A 1JCYA 3R0DA 2QPUA 5CGQA 2Z1BA 1Z32X 2D2OA 2PDFA 3CJPA 4ZQPA 1JI2A 1U33A 1ICQA 2EG8A 3LI1A 1A0DA 4PCSA 5BWAA 3DG7A 2D2HA 3PBWA 4JIHA 3JZEA 5DELA 1JCLA 2QAPA 4UTWC 3MJMA 4F8XA 3TYUA 1G7VA 1RD5A 2X2YA 4N9DA 3VGFA 3LN3A 3QF0A 1VBJA 2PDWA 1KD0A 4LUJA 4HU8A 2DZPA 1QASA 4Y90A 4MWAE 3WJYA 4S3DA 3WD2A 4DZAA 1LUCA 4PBFA 2OR2A 1MWOA 4UCFA 1E4NA 3MYPA 2GQ9A 2PDIA 4AZHA 2ZE3A 5FAGA 4G6CA 3IIZA 4AZCA 1V6UA 2BVTA 3CU2A 3UCCA 2V5DA 1RY8A 4CLMA 1DQXA 1TWWA 3QGKC 2UV8G 4IXXA 4O54A 1E6QM 1H09A 4BR1A 4NZ1A 1W1ZA 1CT5A 2PCQA 4LW7A 1JUKA 1TG7A 3KS5A 1A5NC 4DUOA 1QOQA 1V77A 3PULA 1VFTA 2REQA 3O7UA 4BCEA 5FD0A 1BSLA 5BW6A 1QPRA 3C86A 2X0YA 1KKOA 3G5EA 5JQ9A 4EPBC 3PJWA 3EMZA 4D8ZA 1ZAJA 2E7FA 3T55A 1EJTC 1NWUA 4H9XA 4Z2KA 3H7UA 4Z1CA 3F4VA 4TMCA 3BG5A 3VX0A 3UNTA 2G3FA 1E9ZB 2AL2A 1Y0EA 2D73A 4RW5A 4DBUA 1EGZA 4ZB0A 2XFFA 1DJXA 2GGEA 3O1NA 1XX1A 4ADTA 5HK4A 3H23A 4O17A 3TZFA 3LEPA 1SM9A 4K68A 1W2PA 4JIRA 4U31A 1B54A 5GPRA 2DIEA 2RDTA 4J3UA 4GXPA 4PEKA 1LG1A 4CCZA 2OODA 3CK5A 3EX4A 4XIAA 2JFEX 1EDGA 4DX3A 4JR5A 2JKPA 1PIFA 2PP0A 3EBVA 4H6EA 4JCMA 3VNZA 1EDTA 4NNCA 2ZRWA 4OTKA 5AVHA 2NWRA 1XINA 3M0MA 2FDMA 2ONEA 2Z29A 4ZQCA 3E5BA 4AXNA 4M6UA 4HNTA 2VEIA 5I0DA 2W6RA 3W7JA 3EWUA 1F73A 3HQ1A 4LF2A 4XZBA 4J7RA 4UTHA 3WMCA 4DBWA 1ZUAX 4FIQA 5HDRA 2WVUA 1PS9A 3RRXA 3FN9A 4LYRA 4R5EA 3NQAA 3QW3A 3IIPA 2ZZ6A 1BYAA 3GXPA 4MDPA 4WCJA 4O1EA 4IQLA 1RAKA 4C1LA 1U1UA 4MGGA 4GKTA 3RFAA 2QPSA 2PCEA 5DQPA 2R14A 1AVAA 1BWKA 2G3IA 2R94A 3U9IA 3OG2A 3PUOA 2WB5A 3IJ8A 3PZGA 3TZNA 4YCPA 2XH2A 1KM3A 3QV7A 2R24A 4D8LA 2GWGA 1TRDA 2ATSA 2EHHA 1FA2A 1I8JA 3RPMA 2WPBA 9XIAA 1IT0A 1RBAA 5D2WA 4HMCA 3AROA 1JDDA 1B2YA 3W7KA 1FFRA 3RCYA 2WVTA 3P67A 2V82A 3AWNA 2F6XA 5CG7A 1TV7A 4LUTB 1R3WA 5K2ZA 3TJIA 4BQ2A 4A3YA 9CGTA 2I14A 1UB3A 3ARVA 1EH9A 4UQBA 3OIXA 4Q22A 1VBHA 2A85A 1C91A 3F4WA 1AMYA 3I65A 1LT7A 1WO2A 5A6TC 3L4YA 1DIDA 1VEPA 4FNPA 4Q4OA 1XBYA 1DWAM 1US3A 4KWOA 3E5PA 1NP0A 4U5IA 2VZVA 2FPTA 3L4WA 1VQTA 3QMRA 2VOTA 5D9NA 1BGAA 5ABHA 1OBAA 3LK6A 5BOEA 3QSRA 3W85A 1ZY9A 4RXGA 2QDEA 1UR3M 3BVJA 4NX0A 4MVAA 4ROQA 3QKEA 4BFAA 2EAWA 3PS7A 4H2HA 3SADA 3S9YA 5CPSA 2GZXA 1ODUA 3P8JA 2W66A 4CNOA 2IKJA 2OEMA 3SBFA 3STEA 5KTLA 3GIQA 1NVMA 2E8YA 3LHYA 3W1LA 1XL9A 3E0FA 4OFCA 1R3QA 2VFDA 4MOZA 3E0VA 1TYGA 3HGJA 3N9KA 4ZZ9A 5CG0A 1TQJA 3WJSA 1S1PA 1UQZA 4R7WA 5G4EA 3EKLA 3GLCA 6PTDA 1MZRA 2XZ7A 3K46A 1LL4A 3LCWA 1VS1A 3FAXA 4S3JA 1LOSA 3GAYA 4PB5A 4NQ1A 1R86A 3LD5A 3B8IA 3M0VA 2Y8VA 1W32A 1GOIA 3QSTA 1NQ6A 4P7OA 4WSHA 3JU2A 2WZEA 3W25A 4PL2A 4UFMA 5I3GA 3FSTA 2V69A 1RVGA 1HJXA 1V0KA 4LYQA 3QEZA 3W1PA 1DJGA 3VMPA 4NHVA 4DJFA 1CECA 1DEDA 3VOHA 3S46A 4K8HA 1PTGA 4QE4A 2JIEA 5EB8A 4Q4KA 3VIMA 4MWAB 1XJBA 4J3XA 5EKYA 3SCUA 3RILA 3TYAA 5LNSA 4YWSA 4PSRA 5T9BG 3A64A 4TO8A 4ZQRA 2AOSA 1VD6A 3RU8X 3RM8A 2V0TA 4LT9A 3NOYA 3EWBX 2GK1A 5CEWA 3MU7A 4NZFA 4PTVA 1XCXA 3T1GA 1M41A 5F2IA 3G8RA 3SM0A 3CZLA 1LF1A 1XYCA 3BAWA 2C91A 3DC0A 2Y8UA 4QAWA 4NASA 2QIIA 1HO1A 1B9BA 2OGJA 3BC9A 3RLHA 2PDGA 4LY4A 1B1YA 1YBQB 1L0PA 4UFHA 4QROA 3AYRA 3E3HA 4AZIA 1UA3A 4IJBA 4B2DA 1K8XA 4IIHA 5HNUA 3BANA 4MG4A 3O9NA 4PMVA 3FEQA 4FNUA 4D1IA 3NZ1A 3VPLA 1P6BA 1ZBVA 2QF8A 2OYMA 3FGCB 4JTRA 2AMGA 3K30A 1VR6A 1KRMA 4LS2A 4MJMA 3FA4A 5D03A 3WBYA 1XDLA 5M3WA 4PMZA 3TFCA 3UT0A 4ASTA 5C8BB 5LGZA 5A3HA 1XUZA 1ZBCA 4H83A 3SI9A 2A3HA 4I9MA 5XINA 4N0RA 3GY1A 4AWTA 1V0MA 4HHPA 1H5VA 2YA0A 3KVJA 3W38A 3PC0A 5GNZA 3UP8A 1PKNA 5IHRA 5CPQA 4CVUA 4L6OA 3HGOA 1V3JA 4QXIA 4ZXLA 4NRSA 1X39A 4QQ3A 3M07A 1L6YA 1XQKA 1GEQA 2RHGA 4XD6A 3OOQA 1FWHC 1YNYA 4D6HA 2E67A 2C1HA 2BY0A 3AIEA 2QJNA 5AVNA 4PYSA 4PUMA 5C9UA 2VR5A 5DT7A 5HMFA 5JXQA 5HUPA 5JMUA 1T96A 4J28A 3WJXA 1SW3A 2B31A 3QBUA 5LZLA 2O9RA 1JPMA 4AY1A 3IS4A 2BP1A 5D2VA 5TNVA 3JRKA 1DIKA 1O7AA 1SFSA 3EOLA 2QUUA 3RCNA 3AXKA 3GTIA 4LUSB 3D5HA 3KDOA 1SSGA 2W0UA 1I60A 4HCHA 3S1UA 2IPGA 3Q4DA 1J11A 5ENLA 4ADUA 1F2JA 3T08A 1RQBA 3W86A 3MUAA 2ISVA 2Y7FA 2QCHA 1SVDA 1OABA 3P2VA 4LUSA 5IM51 1UCWA 3N04A 3PB2A 3U8GA 2PDNA 2OSXA 2NZLA 1XYMA 4IUGA 4HA3A 1U2YA 1PZ3A 4UQAA 1S5WA 2QCNA 1EP3A 3N6HA 3DFNA 4FX7A 3KLKA 4HHLA 3LGDA 5T91A 2D1ZA 3F1QA 5D04C 3SCSA 4NZ4A 1A49A 3GXFA 3W00A 3GTHA 4U28A 5LA0A 3W7PA 3FKRA 5A6JA 3WQ6A 3HV8A 3RPDA 4K8EA 1YTEA 3A6OA 1Y65A 1GKRA 1KCLA 1S5TA 1JEZA 1OYAA 1XPGA 4S3CA 5BMXA 3G8EA 3KBMA 2GSJA 2Y70A 4DJEA 1XH0A 1TO3A 2ISSA 4H9ZA 4XZHA 3CUFA 2KX9A 3SQSA 3H8AA 5HWMA 3VKBA 1SFJA 2XN2A 1KBIA 2J74A 3BV7A 4ZOEA 1QJWA 4KRZA 4E6MA 1UBSA 2DZSA 4I9TA 2QMJA 3LY0A 2BGSA 2DSKA 3RXZA 4RCXA 8CGTA 1A0EA 4KWSA 4O16A 2H3BA 2PU0A 2YFOA 3LV5A 2E1DA 2QV5A 4JTFA 3GVWA 1QTWA 3BJSA 2W79A 3H2AA 2QGHA 2J25A 4JY9A 3GYCA 2FHCA 2P8BA 1XICA 3UNDA 1NM9A 1ZB5A 1E6XM 4L9XA 3FJ6A 4M3PA 1YE4A 3TROA 4XV0A 2INEA 4Y9PA 1YMYA 3G0XA 3MMTA 3L12A 2PDLA 3VZXA 3WH6A 1SZGA 4GQ0A 2YXXA 2TMDA 1MYRA 4L1XA 2OPJA 3WL1A 5H8PA 4MSSA 4AHQA 4LYKA 1RR2A 3L67A 3BGJA 1H60A 1WB0A 2C7FA 4PZVA 2JKEA 4JD4A 1FP8A 3VU2A 1FWTA 3LTSA 4P7QA 2UY5A 1V3LA 3BLEA 4I5UA 1IWBA 1R9YA 4J2PA 2GUUA 1IHIA 4NJJA 3SB0A 1YTDA 4L80A 4HMEA 4ZB5A 2G5WA 4QSFA 4QSHA 1JDCA 3IK2A 2PI6A 4ZCWA 3WLLA 5J5RA 1NFGA 2VWTA 3WD4A 3FFSA 2NUXA 3EAUA 3C3UA 1E6ZA 4Q7IA 4P8WA 2BOGX 3SN0A 1BKHA 3NO5A 1IZKA 4GUIA 3KBSA 2INFA 2PTXA 4HBKA 1O5QA 1YPIA 4CNUA 2W5FA 3TJLA 1ONEA 3TOPA 4GIAA 2HV5A 3NSMA 2J9YA 5DT5A 4M6VA 1F3WA 4ZE5A 1BXNA 2D3LA 4A2SA 4EACA 2Z27A 2WOQA 4OE7A 2QMKA 4JOMA 1AMKA 2Y24A 4DJDA 4GINA 1L8PA 3BAXA 5SWUA 2IPFA 3T6CA 2CLMA 2CITA 3TSDA 1LBLA 3PR2A 2QCDA 2Z2BA 1DIEA 3F5JA 1UR2A 1K7EA 3WFZA 2WHLA 5ABFB 3HPZA 2J6VA 4NIRA 4XZWA 2TODA 4J9JA 2PA6A 3ABQA 3KP1A 5ABGA 3UWQA 1MI3A 2PLKA 4GY1A 2QJJA 1KRAC 1UR8A 3RAOA 5HJYA 2WJFA 4LBUA 2EEXA 4L6HA 5TAOA 2J4GA 3D46A 3TVAA 3FA5A 4HU4A 3RLVA 1XLIA 4IIBA 4OU1A 4P5UA 4PCPA 3A21A 3UZJA 5M1TA 3KVMA 4CEXC 2WZTA 2X05A 1TJ2A 4BQ4A 4IFKB 1F07A 3W2NA 1PTAA 3U57A 2FQIA 3T0DA 3CTTA 2WYSA 3W84A 3BG3A 1Q6OA 2XINA 1GG0A 4FX8A 1KV8A 2ISFA 2CHRA 3GAKA 1L9WA 2E9LA 4JTUA 4OECA 4A35A 3WSUA 1MW2A 1J18A 1P7TB 3LUTA 4TVDA 2W4XA 3M0HA 5I6SA 4FOUA 1QHOA 3A4AA 3MUIA 2Y8KA 4DO7A 4XKYB 1OB0A 4UB9A 4JNZA 3OLGA 3GR8A 2ZC1A 3SY1A 3L68A 4JHZA 4ZODA 1PUDA 3MKVA 1K9EA 4QG8A 4IT1A 5A8GA 1KM6A 2ZRYA 1WZAA 2NLYA 4ML9A 2C1GA 4LAKA 4HSHA 2PGWA 3R8RA 2WV8A 4IPLA 1VJSA 4EP8C 1H61A 3AIVA 3CL8A 4HA4A 4XO7A 4W87A 4PTNA 3CEPA 1ME7A 5K9XA 1LT8A 1E4LA 1T40A 2PRLA 5BU9A 1XKYA 2YL8A 4GE8A 2WSQA 3FXYA 4HCDA 5BXPA 1ADOA 3ERPA 5C6MA 3VD4A 1QCWA 3GG8A 2Z24A 1K7FA 1B3WA 4V1YA 1XV8A 3NQ6A 3OGSA 3N4AA 2P88A 3HFTA 2UY2A 1KQZA 3GS6A 1B3XA 3QGVA 3TCSA 3BJTA 4M80A 2Y85A 1F8MA 3SAZA 3RHGA 3TJXA 4RE3A 2CBJA 3U7VA 2CESA 1UOKA 3T81A 1FWAC 2CXGA 1KGUA 2DSWA 2FGBA 2EO7A 4MJZA 2PC4A 3MCOA 4IIDA 1C8XA 1R7AA 1NOWA 2VL4A 1KXQA 2VZUA 4LU0A 5HQMA 3KBWA 3SEPA 4B5XA 5DN1A 4UNKA 3CQ0A 1Q6EA 1LRTA 1S5VA 4ZO6A 2BMBA 4LCQA 4HNCA 1ZENA 4IWWA 4QP0A 1RP9A 3TNBA 5G2HA 2NVDA 3VK5A 3PB0A 4DF1A 5AC7A 3EGJA 3EWZA 2CHNA 2YL6A 3T2QA 4HPHA 1Q8AA 1U83A 1UKQA 4DLMA 4C6BA 2HPIA 1XYFA 4HMDA 1B4KA 4DJFD 4YMZA 1V6TA 4HMNA 3WYZA 3AO0A 1UWSA 3ANUA 5DXXA 3B8UA 3R8HA 2DV0A 4ZTYA 4F0KA 5K3VA 4NZ3A 1XIHA 2HK0A 3B06A 1P1MA 4E5TA 2V67A 4F3HA 2OOFA 2H3DA 4H6RA 4TQTA 1UASA 4DQWA 3EPMA 3M5YA 4GNJA 2E6AA 2OO6A 2J7DA 2Q8XA 1U5VA 1IXPA 1QI5A 4O12A 1I2RA 3RX2A 1IT7A 2Y88A 3L9CA 3MSDA 3CAWA 1RV8A 5TBOA 3U3HA 3BUVA 4FO4A 4GYPA 2I16A 1TQXA 1HJWA 1ZFJA 1Q7ZA 3LG3A 1HZYA 3RU6A 4D6DA 2UZ9A 3VKJA 1TPVA 4C91A 5F4SA 4HJFA 3IUDA 2BZNA 3UVIA 3GXTA 3M0ZA 2BXZA 2OZTA 3PVFA 3CH9A 1X38A 3POCA 1KFJA 2R82A 4NJIA 4MWAC 1LM1A 1A4MA 3WMBA 4AZGA 5G5IA 4BY3A 3NQDA 2XIJA 1CGYA 5CBJA 1Q85A 1VYSX 3H4GA 4QM1A 3QFWA 1FWCC 1W8SA 3TW9A 5I06A 3TEVA 3EWYA 1Q2SA 1O1HA 4PMRA 2BASA 2R9RA 2GLKA 1KFCA 4GNVA 2H9AA 4KCUA 1PO9A 5FJJA 3BAYA 2X09A 4JEQA 3SDOA 1CXHA 3ITLA 3WQEA 3QYSA 4C6NA 4G56A 1TVNA 1GQKA 3A3HA 2FYMA 3MO4A 3DN5A 1ITUA 3U2CA 3H2MA 4RDWA 1KBJA 3WQFA 2H8ZA 4GO9A 1S5MA 1RQEA 3NPUA 3MHGA 1NH6A 2C6QA 3I7QA 4QTGA 5I00A 1G4PA 5M17A 4X2PA 1BF2A 4CU8A 4F4RA 7REQB 3CEUA 2OU4A 2J79A 1VFLA 3VNMA 1NELA 3TWBA 1CDGA 3CB3A 4LC6A 3L21A 4KQNA 3GYEA 5A8NA 4QLKA 4L4LA 3W76A 1DQWA 3NPWA 7PTDA 3WIJA 3G22A 3EMQA 3SN1A 5MF5A 1NQKA 1TPWA 3QHMA 1LQ0A 2I17A 2FJUB 1VFSA 1YXYA 3UY7A 4MWAD 1SQ7A 1KBLA 5U7SA 4IHCA 5F2GA 2IQDA 2ZXDA 1KR0A 3NL3A 2WNZA 3TX9A 3W75A 2DQXA 1QR7A 1LG2A 1SR9A 1Q7MA 4H9VA 1TE6A 2P76A 1UMYA 1SO5A 3EOEA 3IJLA 1Z69A 4W5ZA 4PSPA 3IGSA 3I4KA 1UR0A 4GACA 3GB6A 2NUWA 4EPEC 5F4XA 2J7GA 4BJHA 2RKXA 1XI3A 5BRBA 3AXIA 3H54A 4H04A 3HMJG 1MUMA 1TPDA 1S3TC 1B30A 1ZRQA 4R53A 4WSKA 1HJUA 5E93A 1EGMA 3VDBA 3NL2A 1LQAA 1MZHA 1PYFA 2GVYA 2ZRXA 3O15A 1F7BA 4O8RA 4FB7A 1LUCB 2W9MA 1Z44A 3P74A 1U22A 1YBQA 4LYPA 2RUSA 3IWPA 4L9YA 1VPQA 4NAEB 1P6WA 1W3TA 4G7FA 4LS0A 2XIQA 1K6WA 1AQMA 4CCEA 2OWWA 1BTCA 3LI0A 3IPWA 1YXCA 3DHUA 2CLPA 3WLPA 5E9AA 1PWMA 4B90A 2UBPC 3UZYA 4WK9A 4JFWA 1O5KA 1YYAA 4GABA 3VILA 3TNOA 5CAHA 4J27A 1TPC1 1KM1A 2GVGA 5GQBA 4JFVA 1SO6A 4EAMA 4KCVA 4QNEA 2CC0A 5JH1A 1P0NA 3O6DA 3W9ZA 4I6KA 3B9EA 5A6MA 1TX0A 3P60A 1L2UA 4FS9A 4O13A 4MAVA 4JNMA 2VKZG 1HP5A 3YPIA 1HL9A 2Y6ZA 4D8AA 3KOYA 2QVNA 4OUIA 1SMAA 3VNDA 3PAOA 1KCZA 2AKZA 1XRSA 3SSJA 4C6DA 1G4SA 4IFOA 2A6LA 4UR9A 2BSLA 1KB3A 1XF0A 3AHTA 3KLLA 2QCCA 3CT2A 3VD7A 3P3BA 5LIUX 3NM1A 3RX4A 2VHLA 3M44A 3O8AA 3ZJ7A 5BRPA 3OVGA 2ANUA 4HHMA 3KWXA 3CQIA 2TAAA 3I7SA 1FHVA 4XTDA 3RITA 4LS1A 3WQ5A 2V81A 7CGTA 1M7OA 2R1PA 3VNLA 1BPLB 4QAIA 4RDYA 5GJNA 3MKKA 4J3TA 2WC7A 1VFHA 3WUGA 3C2RA 3UA3A 4QG6A 1K3UA 4JX4A 3GW3A 1CLKA 1WBHA 3A4WA 4HD5A 3CZGA 1E6NA 4HOWA 4B3ZA 1AW1A 3W88A 3BLKA 1GZ1A 4PCTA 4JHOA 3COTA 4EIVA 4L61A 1JYVA 1RQHA 5FACA 3KS6A 4YL2A 1HKKA 4HOZA 2GUBA 4PUEA 3VDCA 3QKZA 3Q94A 4DJDD 3CWOX 1LLWA 3K8MA 3KBVA 3P6LA 4GI4A 2ZRZA 1LOLA 3ARRA 4DB7A 3VKKA 2B4GA 4B9ZA 1HF6A 4XK2A 3R58A 5CJNA 1DE5A 3GNOA 2X2GA 4ZFCA 1Q3NA 3NDOA 4HQVA 4NKCA 2QLYA 1RBLA 3QH2A 4FNSA 3S0CA 1UH4A 5F2LA 1HXJA 4IISA 2AGTA 1ZJIA 5EMLA 5AKQA 1VHCA 3FHAA 3DFTA 2CWNA 3C4UA 6REQB 3W53A 1AH0A 2E6FA 3KE0A 2CU0A 2WM1A 3DAQA 1ZZMA 1GVYA 2J62A 2Y5SA 3G18A 2WANA 5JIWA 1XIEA 5IHSA 4CCDA 2BX7A 1J5SA 3IV3A 5ABFA 1KM4A 1PSCA 3GTXA 1PTDA 3QYQA 1HVXA 5EGRA 1GPWA 3W0KA 3AALA 4TV5A 3W7RA 2J7EA 3ZSSA 1E0VA 1C90A 5IDZA 2VD9A 1UR4A 3W87A 4JEJA 3OBAA 4DY1A 4JHMA 3POHA 2A5HA 4KRUA 1MXDA 4R9XA 1J0JA 2F84A 1D3GA 2VCCA 1C93A 3CUXA 4A8LA 4M1BA 3OO2A 3MWAA 5E6YA 1VEOA 3W7IA 3CHCA 4ZA0A 4BEQA 5H91A 4IX0A 4ACZA 2FZBA 4D6JA 4CQCA 4O1DA 4IICA 3OP2A 1AD4A 3OHMB 3QY7A 2YW3A 3RG6A 4MB4A 3BURA 2OX4A 5EA9A 1I4NA 1XLJA 1QW7A 2I5GA 1AODA 2WWCA 1PPIA 2QDHA 3CUGA 1XYLA 3WLMA 5EY5A 4DYEA 3AIQA 1UMLA 1CGTA 4QRNA 1M1BA 4OZOA 1LYXA 5DFAA 3UXKA 2HQAA 4MZYA 4HA0A 1XBXA 3A9BA 1R2RA 5FF4A 3H21A 4OGZA 1ZLPA 2NLIA 5A5WA 4JTDA 2XTKA 3GO2A 3TLQA 4MB1A 4F0MA 1SO3A 4XO6A 2FGZA 4KWWA 1OFPA 1XLFA 2ZZ7A 1B3YA 4FMVA 1XLAA 3FKKA 1W0MA 4INFA 4QIUA 2BOEX 1GQIA 2WC4A 1O5RA 4BKNA 1J0YA 4AIEA 2QXWA 1V8EA 1KRCC 5C55A 3T07A 3PWGA 1W2VA 1T0OA 3IJ9A 1KRBC 2WLZA 1TV2A 3LRLA 4H7VA 1D3CA 2PWHA 1KLZA 4GQRA 3W7GA 3ITGA 3QHNA 4HYVA 3THUA 2WMIA 4KEZA 4ZSUA 3IJ6A 4W8LA 2PLMA 3W71A 3LDVA 1KFWA 1XBZA 5C9RA 4MYXA 2ZADA 1GOXA 3G1HA 1POKA 1TELA 4DXKA 5HULA 4LEFA 3W7OA 3KEHA 4C1NA 2VNCA 3UERA 5D09A 5A6KA 3G1XA 1TTJA 2YLLA 3WLRA 1EJVC 3CWNA 5A69A 3M0IA 3UZ5A 3KRZA 2BLEA 1WZMA 4IIGA 2HS8A 2FTPA 1WV2A 2DSVA 3M0LA 6CGTA 3WLNA 3CQHA 2E6YA 4HCLA 5A6BD 4HZMA 4YPJA 3BOXA 4MUPA 3AIRA 2MNRA 1HO4A 4MY1A 2G3MA 1SJBA 2DY3A 5C7HA 1NWSA 2Z00A 4O0QA 2XIMA 1JF6A 3WX7A 3TN4A 3L4TA 3PAJA 4PEEA 2ZX6A 4CCCA 5HBFA 4YTQA 4DJED 4Q4PA 3CS2A 1GWJA 2EBNA 1R3YA 2J7HA 3UCDA 4BS0A 3GDTA 2BXVA 4IPPA 1K4HA 1R3SA 1VIWA 1OADA 4UQDA 4GGBA 1E1CA 3Q37A 3P0XA 1W5MA 6ALDA 4JTTA 3R0KA 3QTGA 1FWIC 2IPWA 1E0UA 4C6KA 1DTNA 1C92A 1T5AA 1A4LA 1KM0A 1IXOA 3K8LA 3A12A 3W81A 4Q8WA 3C56A 4YVPA 2EKCA 5EBAA 1EOKA 4XISA 4CVWA 2E1WA 1OG6A 5AY7A 4Y9AA 1R30A 2WHMA 2A4AA 3G1YA 1GQLA 3OPSA 1B90A 3R0UA 3TV8A 1LLOA 3C0SA 2RH9A 3TC6A 1CEOA 3VNKA 3GHUA 2I56A 5E0CA 1NDWA 1I45A 1GYLA 2FLIA 4O19A 4AX6A 4XUYA 4DUWA 4JTLA 2AAMA 1I2QA 1F74A 4K37A 4A2RA 3EB2A 3EB3A 2PWEA 3V18A 3CHEA 4ENLA 5D33A 3CPGA 3A5FA 4R34A 5LYRA 3QMSA 4QEEA 4KH2A 3S5SA 4N4PA 3TA9A 4C60A 4TV6A 5AC6A 4D6IA 1DTUA 1UWAA 2Q3RA 3H4WA 3OGRA 4P8UA 2NXGA 2WC3A 3W3OA 1PEZA 1E1EA 2PLCA 4AAJA 2C13A 2J66A 2DFAA 2HTMA 3IVUA 5FF2A 1JQXA 3Q65A 2WZIA 3SCTA 1JDFA 3ISIX 2HDJA 7ODCA 1XISA 1SJDA 5CH9A 4G8TA 3PNUA 3S5NA 4XTIA 1XIGA 9XIMA 2D2GA 4BWLC 3D6NA 3EX2A 3EA3A 3W7QA 3BK0A 4Z17A 5I3JA 5DMMA 1WXJA 3VUSA 2R8WA 3R94A 3W6LA 1E73M 3E38A 3AOFA 5HINA 3PBVA 1Y5WA 4JTEA 4AFYA 1XW8A 4HA1A 3V35A 2QPXA 1CGWA 1ML1A 1GK8A 2H8XA 4HU3A 4IGNA 2E3ZA 1JZ4A 1ZJAA 4Z0JA 3PZOA 4U4MA 1K1DA 2BHUA 3K1GA 3N14A 2WXDM 1QHPA 7TIMA 2AQVA 3N2CA 1XUUA 1V02A 4JCLA 4C6QA 3CMGA 4TUFA 3ABZA 2Z28A 2QUMA 1IGSA 3VC6A 2DQWA 2VFIA 3SY5A 1T99A 4Z1BA 5C2GA 4PUJA 1EBGA 1HGWA 2ZX7A 1G7UA 3NFUA 4E4FA 1QI0A 5HPOA 2H90A 1F8IA 4ZSTA 3K4AA 2EJAA 2XFWA 2XVGA 2PE4A 3AJXA 3W2JA 4IXHA 4MFEA 4GBDA 3T8LA 1MW1A 4WHBA 1P43A 1VKFA 1EBHA 1JCMP 3KOZA 1QK0A 2Q3OA 1OZQA 2V2HA 2IXUA 1GKPA 4LAMA 2GWNA 3WQ4A 4UNIA 3LENA 1UP0A 2DZUA 4DZIA 1TCDA 1POJA 1HKMA 2NSOA 3VX1A 2GDUA 4DPPA 1I6NA 1O60A 3GDLA 4K38A 4AF0B 4JTIA 3S5YA 3VOGA 5A94A 4IQJA 4CNTA 1F3TA 3AYVA 4E0CA 3SGUA 1BG9A 1FHLA 3MY9A 3W7EA 2VYOA 3O6CA 4MY8A 2W67A 3GHTA 2V63A 5ABTA 4H4IA 3HIJA 3P81A 3QQ0A 2HNEA 3N29A 4PTWA 3UBPC 2DEPA 2HBVA 5EFDA 2PP1A 3CUHA 3CHFA 5EBUA 4JN7A 1NP2A 2F7FA 1GVIA 4P7LA 1WDRA 4HTYA 4IP4A 3UR7A 3LA4A 3BLPX 3VNYA 4PUUA 1SMDA 4P8XA 3L4XA 3B97A 1XXXA 3RLGA 4JTGA 1ZNNA 3VVGA 1W3HA 3S3GA 1O1ZA 2VGIA 3ZSTA 4UXDA 5CC3A 3PZVA 2X1RA 1E55A 2WMIB 1GOMA 3HOJA 4WEVX 4DAFA 2G97A 6XIMA 3IGXA 3N15A 5HJXA 1LCOA 1BRLB 2ALDA 3CO8A 2GGGA 1U1JA 3G1SA 3PJUA 3L65A 1GJUA 5FJTA 1BYCA 2BG5A 1EJSC 4N6FA 1TA3A 3OB8A 1R3RA 1ZPTA 3PTQA 4H6QA 3C61A 5CZTA 3W29A 7REQA 3E12A 3UD6A 1B0IA 1WNOA 2OTDA 3CIWA 3AHYA 1E1CB 4GLEA 3M0KA 5TF0A 2V30A 3THQA 2GJPA 2VUNA 1KXVA 3FJLA 5D9MA 1UR1A 2YXOA 4HGXA 4A6GA 3DU0A 3N2MA 2BVWA 3OLIA 4YHEA 1R46A 3B9NA 3BCFA 3LCIA 1FRBA 4BI7A 3B4UA 4GYJA 4CNPA 4MKVA 1MXGA 3SCVA 2J88A 3RR1A 3ANVA 3T40A 2BVDA 1W9XA 3EDKA 1TA3B 1V3IA 4TXEA 1UH3A 2FB3A 1VFMA 3D3AA 3ABXA 4Z42C 4NYUA 1A5AA 1J8VA 3HFYA 5T8GA 3VIHA 1Q8JA 3SZ8A 3AU2A 1EQCA 4RZ6A 3KFTA 3MV01 1KKRA 4DEFA 1TE1A 3BAKA 3ZO9A 1JG9A 1S2UA 3C8NA 1RA5A 4DJDC 4I7WA 3HPFA 2P53A 1JYXA 3G1VA 4PUNA 3WEOA 1LOQA 2VFHA 2G50A 3S5OA 5D2XA 1DJYA 3NO3A 4OIFA 2V5KA 3SUTA 1ONXA 2BXYA 1PZ2A 2R1LA 3EMCA 4TTUA 4WUIA 4YYFA 4L65A 3PF3A 1V6VA 2DJXA 5DF0A 3IEBA 1UZHA 1VYRA 3HQNA 1TWDA 3WEZA 3C0LA 2LLEA 3V5FA 3T2OA 4JTQA 5JUVA 1XFCA 1QFEA 4E4PA 1UBPC 4LAUA 1F4HA 3TYEA 4B3LA 5ECVA 3Q67A 2HVOA 3REQA 1QPNA 3WJZA 3WQGA 3D3FA 5CSYA 3WDHA 1Q6DA 4BZYA 4AB4A 5I2UA 4J3ZA 1K70A 3TQVA 1V03A 2D24A 1ALDA 5FEWA 1C8YA 4H7CA 2IKHA 2PURA 2Y1HA 4MF4A 5CPTA 3DUGA 4YTRA 1DWGM 2EGZA 4Z08A 1R6WA 2WSPA 1RPKA 1A5LC 2Z1WA 2XUCA 2O9TA 3WY1A 3O2LA 1NY1A 3NIYA 1XLBA 3NGJA 3T0TA 2BY3A 2A3EA 4NT0A 4QBXA 1JZ6A 4L4OA 4CD6A 6REQA 2J78A 3CL7A 2DUXA 5E0FA 4AY8A 5H8UA 4F40A 3G1FA 1XGZA 4OV9A 1TPFA 4EAYA 4TMBA 3CHVA 4AD3A 2PWUA 1OF8A 1CXKA 3H2FA 1KM5A 2P8CA 1RLCL 1UWTA 2A2IA 4QS5A 4O52A 2Q01A 5CSUA 4F0LA 2B7OA 2QS8A 4NF7A 4RZ5A 1S1RA 3B4YA 4JKLA 3N4FA 4Z2JA 3R89A 3I10A 3I7RA 5LNWA 1TVLA 2VM8A 3LQLA 4MJ4A 2PDYA 2GK1B 3V0SA 4WKHA 2JIWA 2GJXB 2ZUUA 4ILSA 3V7PA 1ONRA 4CN6A 1PZ0A 3M0JA 4UTIA 3WK2A 4WDTA 3R4IA 5FEZA 4N02A 4QJ3B 3CNYA 1GT8A 2D23A 3DECA 2NXIA 4YHGA 5DY2A 3LS9A 1Q13A 2OX1A 4S23A 2DSZA 3URAA 2FVMA 2ISWA 4EWND 3K2GA 4LNYA 4E3TA 1R2TA 1XIBA 4GZJA 4PTMA 4J35A 4O8AA 2I5QA 1VRDA 2RJHA 2V2DA 3KRUA 2Q02A 1FKWA 1E1FA 2O92A 3VA8A 3KVKA 2B7PA 3EX3A 2BHZA 2O55A 1JNDA 1DHKA 5AZ0A 3T78A 3NGFA 3BGGA 3VOIA 4JTSA 3LCLA 4Q8TA 2GJXA 1CLVA 5LIYX 4V33A 4PFHA 5LNUA 2F2HA 3ZOAA 3VYLA 4B92A 2UWFA 1THFD 4LRTA 3MZ2A 1T41A 5A8QA 1I2PA 4W7VA 1BHGA 4PMJA 3VOCA 4S1FA 4AHPA 3T44A 2EXOA 1BSIA 4CQ9A 5EYWA 2EJ1A 2CZEA 3U0HA 2BFGA 2X0HA 3QR3A 3BMXA 2DIJA 2OJPA 3V5CA 2ZZ4A 1ESWA 4BF9A 1G4TA 5C54A 1PV8A 5E9XA 3QTPA 3W23A 1M01A 4OVXA 1DXEA 1X8CA 4GK8A 3SCWA 4NAEA 5D05A 1Q6FA 3F2CA 1UD5A 2PDHA 3VCRA 2Z1SA 3OZMA 1TIMA 3AC0A 5FESA 1O95A 4GG9A 5A8MA 3S6OA 1XSIA 4RE0A 4XZMX 5AHNA 4KKXA 5BOOA 1EIBA 1WKYA 5FAJA 4JBRA 3T2PA 1BYDA 1LL6A 4MJ2A 2Z1XA 1P48A 1R0MA 5B7ZA 2ZKMX 3QJAA 2E6DA 2CXEA 3EDJA 1JVNA 3N19B 4X0NA 2CBVA 2WVVA 3FX4A 4ERIA 2GL5A 3OBKA 4XZNX 3L4ZA 1JJKA 4C6FA 5HANA 3W28A 3WF1A 5FSEC 3VD3A 1NTHA 3TTYA 3OZYA 3W1QA 1WUFA 2RAGA 3OZOA 3GRIA 2Y62A 3UG3A 3PBGA 3STGA 3KTXA 4LRSA 4X63A 3RPTA 4B5VA 5AYBA 3STFA 4G1NA 2QVHA 2W62A 1FCVA 3LSCA 3TH6A 2HPMA 4DBDA 3NWRA 2OKOA 3SIMA 2IS7A 3AI0A 4M29A 3CQKA 3OU8A 3UG4A 1JD9A 1ZTVA 2QNEA 4NNBA 2DSUA 2OXNA 3ZM8A 1F4AA 3LZ5A 3U2ZA 4CEUC 5J5DA 1BYBA 4DI8A 3GE7A 4UCGA 2ZYFA 4F0HA 4CQAA 2QEZA 1TRIA 4ATWA 3B0VC 1IXNA 3PWAA 3QXBA 3GVRA 1JL8A 3LCHA 1ZU8A 3CV2A 1GOWA 3PUEA 5G4WA 4NI3A 2W61A 1JNEA 1S2TA 3NYZA 3GU1A 1OFBA 2ZUSA 4OBTA 4EF9A 3R8GA 3EX1A 5LKYA 3WK1A 5C0QA 2WSRA 1XG3A 1G01A 3NA8A 4D6GA 2ASHA 5IBXA 3VIGA 4H01A 3RO6A 1QI2A 5KETA 1T7LA 2INZA 3HPSA 2AL2B 1E72M 3WLHA 3CIVA 2VUYA 1EX1A 1R3VA 2QAFA 4LSBA 4CD7A 3IJQA 5BXTA 3U7BA 2D2JA 1QBBA 3N73A 1SZEA 1MEHA 4AD4A 3NQ2A 5REQB 4H1ZA 3MP4A 4PE8A 1XKJA 3LZ3A 4XIMA 1VFOA 4S3FA 5TD4A 4HT3A 4ZVJA 1KXTA 2Y7GA 3IIXA 2ZUTA 3G24A 1QDSA 4IJCA 5KZ6A 1HL2A 3PM6A 2P0OA 3BLOA 4HNLA 3L7RA 1V02E 1VBRA 1EYEA 4A8NA 1H7XA 4UFKA 4DRSA 5CSSA 4LH8A 2VC9A 2ODOA 3GX9A 4JYDA 3PK7A 4US5D 5DLCA 2E4TA 4R9OA 2PBGA 3P61A 4KGJA 1NEYA 3MC5A 4JAWA 1WP6A 3ZVIA 4KFOA 1O6IA 1J5TA 4MIMA 3U2OA 3HGRA 1E0WA 4H8HA 5F1UA 1DL3A 1FXQA 3ATZA 3WDQA 3LCXA 4RPQA 1F3EA 2BNJA 4H6KA 3W72A 5DCDA 1TTPA 3AUOA 1J4EA 3R25A 1J2WA 3WO8A 5HUOA 3MA8A 8XIMA 1FH9A 3C2VA 3PSVA 3OZPA 3LHVA 4HHHA 3KCJA 4RK8A 1L2QA 1XD0A 1FDZA 3G0UA 2FKPA 1PCWA 1IEXA 5A8OA 3NDYA 3QOKA 3NYDA 3VE7A 1SU5A 1WE5A 2PU1A 4X9YA 1RSCA 5GNXA 2REQB 3EOOA 3FHQA 4QJ5B 3S1VA 2NQLA 2A3AA 3CBWA 3DGBA 1W8GA 1X98A 4BWLA 4IL2A 1IR1A 3AHXA 4IIEA 3ALGA 2OG9A 1MDRA 4ZBCA 4XSLA 4GWEA 3ZS4A 2C3ZA 3W2UA 4O1BA 2XISA 2VRKA 1F05A 1XSKA 1MO0A 1U30A 4U33A 2W92A 2VR2A 3CAQA 2F8QA 3ZT5A 3FGCA 4CNNA 5EMUA 3EPOA 3K1DA 1EJXC 1ITCA 5FJUA 4MAZA 1ITQA 2VELA 1ME8A 3SRFA 2UY3A 3O0KA 3B0UX 1CENA 3W6MA 1AH3A 1MEIA 3OQEA 4B3KA 1GJWA 2JK2A 3BAJA 3GVGA 1UD3A 5D8ZA 4KF1A 4QGCA 4R7OA 4RNIA 1CX9A 3WBWA 3KBJA 2YA2A 5FOOA 1BAGA 3RM4A 4LB3A 5AC5A 2EPKX 5I5RA 1MQRA 4KRTA 1YQ2A 2CLEA 3APYA 1DKWA 5C9ZA 3DFOA 3NZPA 5EPDA 4AYGA 1OIMA 4NJKA 3P80A 2ZVRA 3WBXA 3MMDA 1WYIA 1W5OA 1YKWA 1V6WA 1OC7A 1ISZA 4M81A 1VC4A 5KINA 1KW1A 3UGVA 4HP5A 4LVFA 2NT1A 4FIRA 3GH7A 2PWFA 4TR9A 1TREA 3KM8A 4LJ3A 1G94A 1EC9A 1BQGA 4GH3A 3ZVHB 3L4VA 1XC4A 2VQUA 4J40A 3WNNA 1S2AA 1KGXA 2GJLA 3VNJA 5I7GA 3WH5A 1JYNA 4FALA 1UC5A 3LB0A 4WX2A 4HK5A 3TYZA 1ZHAA 4DELA 1AFSA 1YEYA 2EPMX 1MRQA 4US6A 1ISVA 2WMHA 3MBFA 3W27A 5LNVA 1EEPA 4RE4A 4GI8A 2HS6A 2J27A 3R6IA 1XC6A 4JQ3A 5IDIA 3AICA 5JBFA 2CLLA 3AMLA 3WCZA 4HSNA 1QATA 3S9ZA 3IRDA 4O57A 2CLKA 5IXEA 4D72A 2QR6A 1XG4A 5EL1A 4AD5A 1XGEA 2IKGA 2BVYA 2ZZ2A 4MNLA 1H7WA 3W82A 3NEHA 3UETA 1M5WA 1QWGA 1W1VA 5FEXA 1VB9A 2OZ0A 3DKLA 2NQJA 2PDCA 4C5YA 4GYKA 4Q4QA 3WK3A 3F2DA 1J2BA 1V0LA 4K7VA 3O0FA 1OGGA 3G6MA 1CGUA 4DF0A 3TKFA 1OC5A 5C2CA 4HZ6A 4TVCA 1VP5A 2DUZA 1OCBA 2W91A 3LSBA 4I8YA 3UR2A 4O1FA 3UZXA 3HO8A 2J7BA 4RLIA 5E1QA 3QC3A 5DXYA 1NOFA 2XG9A 4EE9A 3KDNA 4NZ5A 2QW5A 4JS3A 2DW6A 4KEUA 3S4TA 1WZKA 5AZ1A 1XPYA 3AFBA 4LWWA 3TSMA 1EB3A 4ICMA 4NZJA 1UD2A 1A5SA 3SUWA 4JKKA 2EPHA 5H6HA 6XIAA 4X60A 5LSMA 3DI0A 2X1TA 3FK4A 1C8QA 4W7WA 1FWDC 3T4WA 3UJSA 4IMGA 3W02A 3HG2A 3TSBA 3AMGA 3UZWA 4GKLA 4MADA 4XWUA 4EF8A 1ADSA 1K9FA 1WXZA 2VEMA 3L5AA 3OW1A 4QJ1A 4RJEA 4FPSA 4BQ5A 4WR3A 1UW9A 4LF1A 3UA4A 3ONBA 1PWLA 2WZMA 2D69A 4FLSA 3H2EA 1IEIA 3HJZA 4DWDA 2V3GA 2E28A 4WD0A 1A50A 1V4YA 3RLUA 2GQAA 2XJ7A 4FR6A 4GUHA 4PCNA 4MKSA 4UZUA 3CC1A 8TIMA 5DRCA 5B80A 1QI4A 3WD0A 3MCMA 1H0GA 2A6NA 2XFYA 1E5JA 5D9OA 4D2JA 4KT2A 3L2LA 4JDBA 2VOMA 4AH7A 1J12A 3OLDA 1KFKA 4WY0B 3N18A 3CAVA 2H6RA 1K8YA 5CLWA 3DESA 3F4DA 4L56A 4OWGA 4M56A 3E2RA 4B5SA 1TV8A 5C2XA 1KCXA 3LXBA 5I03A 4LBSA 4ADSA 2EKGA 3TW6A 2PWVA 4AHOA 2WJEA 3STCA 3MKCA 5FJPA 1UZDA 4X0VA 3NOEA 3MVIA 2I1OA 4UOQA 1MQQA 1VAHA 3CTLA 5KZDA 1JZ7A 1KV5A 3KXQA 2A7PA 3AXHA 3PBUA 1VJIA 2VFEA 3M5VA 1G69A 1UD4A 4G2DA 3L2IA 4KWUA 3N12A 2QUVA 2PBOA 3LX9A 4DWSC 5T9CE 1SFTA 1XIMA 2O9PA 4WRHA 4UTMA 2ALRA 3TR2A 3UJRA 1A5UA 2FMNA 1UA7A 4MZ8A 5G2IA 4W7UA 2VVSA 1A47A 2WO5A 4XZ9A 2Q8LA 2ZVIA 4MLRA 3E6EA 3FXGA 1TZZA 2QDDA 4PN2A 2FJKA 4QCFA 3VO0A 3EPNA 3UJFA 5AOUA 1MUWA 4DJFC 4NAFB 2QF7A 3PUGA 1MNSA 3A47A 3FLUA 2HMCA 4EKJA 3TN3A 4JQ2A 3MP3A 3JR2A 1A3WA 1FDJA 2GYIA 3SQMA 4GGHA 3HF3A 4UZSA 4YXGA 1Q5MA 3A3XA 1N55A 3F5LA 1KTNA 3VIFA 4PMQA 2YYTA 2G96A 2OLHA 1EUAA 3W7MA 1JI1A 5DO8A 3T0AA 2ZIDA 2NQ5A 2FTYA 2V2CA 3M41A 4S3GA 5MKGA 1OM0A 1EDQA 4C6IA 1UD8A 2V5JA 1YX1A 3TMQA 2OLSA 4WDXA 4WKFA 1FFQA 1JUBA 2NXHA 2XZ9A 3WD3A 2VR4A 3GNXA 1QNOA 3JVAA 4M0XA 3M16A 2V68A 4XVEA 4GJJA 1ISWA 1E3ZA 3P5YA 3IVSA 3NQMA 4AF0A 1FVPA 2YDQA 1JR1A 3AU6A 2CIPA 4DBEA 4IMCA 1B3VA 2ZC8A 1PHWA 4KEVA 3IAPA 3NL5A 3OODA 1R7OA 2GJRA 3U5UA 1KBBA 1FY6A 2QJGA 1GTHA 3B3DA 1EEXA 4C6JA 2ACQA 4YN5A 2VXNA 1QNRA 2POZA 1CB2A 4MUZA 3GD6A 1PX8A 1VF8A 4DYKA 2TYSA 3ES7A 2F61A 4JFUA 4QJ4B 2Z4GA 5FCZA 3ABRA 1REQA 3P7YA 1F6KA 5I3DA 2D22A 1OSEA 1GYNA 4IUOA 1YIXA 4ORIA 1ZJBA 3OVRA 2HXTA 2KZHA 4HNUA 4GRSA 1QHZA 5BU6A 1KWGA 3TN6A 1RA0A 4H3DA 1NARA 2C18A 3KOFA 2ZA3A 1FCBA 3M9YA 1IEWA 3BPWA 2VEPA 1QRQA 1JCJA 3AZSA 4FXFA 3AHZA 1DVJA 1W54A 4DO5A 4XG1A 3SCRA 2FTWA 1ISYA 1DJWA 4Y9NA 1UPMB 2PD5A 4FOKA 4LAOA 1JFHA 1LDCA 5BMWA 3K4WA 5DMLA 2NV2A 3OTRA 4UTWA 3GDBA 3L66A 3FJ4A 5DRIA 1LP6A 3MSYA 3FEMA 4DZ5A 1UYQA 3R2GA 4W85A 4LTSA 2WMGA 5DCEA 3U2EA 2E77A 5HATA 1WDDA 3ZXWA 4LVGA 5T26A 4B5TA 4PMXA 4F2UA 1GVQA 1S2CA 4PULA 4IPNB 3VIPA 1EJRC 4XD4A 4Q4RA 2ZA2A 4FLQA 4GISA 4JYFA 4CQBA 3BMVA 3UFYA 4A05A 4L64A 3UGRA 1CB7B 2E9BA 2WW5A 4IP7A 3TTQA 3THDA 3E0LA 2E5BA 3U6WA 2HSAA 4ONVA 4GXWA 4C6MA 4HVXA 5D38A 3WQDA 1QOXA 2RDUA 1KQYA 3GDKA 3BSGA 3BICA 2J75A 1H7PA 3A23A 3BXWA 3N25A 3ARXA 4GFSA 3MMUA 3EDDA 1A53A 3VZYA 4AIBA 2MANA 4ZQMA 4DNHA 5TIMA 4BA0A 2YCJA 4S3KA 3S1WA 4IOTA 3C3NA 4LNCA 4F9JA 3H6OA 2VRJA 5E09A 1FCQA 2BHYA 3L0GA 1PJ9A 1IR2A 4LCRA 4XUGA 5KMYA 1C29A 3E02A 1BGGA 4IPIA 1BWLA 2YKKA 1IE7C 3W22A 5K4ZA 1YNQA 5TQLA 4Q4SA 3G77A 4XX6A 2PC8A 1U5JA 1GHRA 4FEZA 2GGIA 1GNXA 1TV5A 3UW6A 3WMLA 2XIIA 3CAKA 2ZX8A 1UOZA 1H62A 3VIIA 3T05A 4DJEC 4UOZA 3QV8A 1GUVA 3QQ1A 1TPB1 1WOBA 3SGGA 4E8DA 3H7RA 2NQZA 2ZXAA 3SGZA 2WNWA 2VEKA 3LBOA 2C8NA 5G4HC 1MNZA 2YB4A 4NL1A 4GYPC 3VI2A 3C0JA 3EOSA 5CGTA 2WCSA 3MV11 2ZRUA 5EFFA 5HAOA 3U4FA 3ONCA 1J79A 1FX6A 4AZBA 1ZBKA 3P8IA 4UMAA 3VFLA 1W3LA 4AQLA 1V6XA 1P0DA 4Y8EA 1W56A 3DGRA 4GUGA 3ZLGA 2A7RA 3GW0A 3CM4A 3ARYA 3ZJKA 3TC7A 4B16A 4HN8A 4N7QA 2DJLA 1YDVA 1LRNA 1N8WA 1R2SA 3APGA 4XVDA 3WEMA 2JGYA 2E8ZA 4UQEA 3UWYA 1GZGA 4DXXA 3MUY1 1EIXA 2FB2A 4C1NB 2ABAA 3HM7A 1J01A 4DZHA 1D7KA 4KEMA 1MW0A 3SCNA 3FNDA 3BCJA 3U5YA 4CQDA 3WDPP 2QKFA 4GVGA 1IXQA 2YYUA 2WBKA 4TX9A 2Y5EA 4JDYA 1OF6A 2YXGA 1W6TA 1E43A 3EDEA 1MMFA 2J8FA 4B2DD 2CZDA 2HE8A 3EWCA 3ZYZA 4L1GA 1AK5A 4YNGA 4EPKA 3ITCA 4FX6M 3RM9A 4K39A 1QNVA 1DWHM 2VDGA 4M5PA 1QW8A 3WELA 1MSSA 1V6YA 4PMDA 3S1GA 3PSWA 1E40A 3HZ3A 5I3KA 1VCFA 2P3EA 2XM1A 4TU1A 5D8WA 4AVFA 3CZJA 3OA5A 1UP2A 3WFAA 3DYMA 1GW9A 1UKPA 1Q6LA 3SW6A 1UWUA 1MUCA 3N3TA 5H1WA 1ME9A 3MYOA 2FFIA 3UYCA 4UIOA 4GC4A 3AS2