2Y88A

Crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase (variant d11n) with bound prfar
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
244
structure length
244
Chain Sequence
MPLILLPAVNVVEGRAVRLVQGKAGSQTEYGSAVDAALGWQRDGAEWIHLVDLDAAFGRGSNHELLAEVVGKLDVQVELSGGIRDDESLAAALATGCARVNVGTAALENPQWCARVIGEHGDQVAVGLDVQIIDGEHRLRGRGWETDGGDLWDVLERLDSEGCSRFVVTDITKDGTLGGPNLDLLAGVADRTDAPVIASGGVSSLDDLRAIATLTHRGVEGAIVGKALYARRFTLPQALAAVRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords PHOSPHORIBOSYL ISOMERASE A
publication title Bisubstrate Specificity in Histidine/Tryptophan Biosynthesis Isomerase from Mycobacterium Tuberculosis by Active Site Metamorphosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 95
structure length 244
sequence length 244
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2011-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2y88A00
3PBWA 4CCDA 2XN0A 3LRLA 1VLWA 1YTEA 1W5MA 5I3IA 5TBOA 3NPVA 1KBIA 4DEFA 4DF0A 5D33A 4AMAA 3NM3A 2YGYA 4IOTA 3DFPA 3BO9A 1TPVA 4ZQMA 3TV8A 3TKFA 3R12A 3T44A 1H7XA 2R14A 2RDTA 3BW3A 1WV2A 3CB8A 4Y8FA 2XFWA 3TA6A 1XFBA 1G4SA 1SUXA 4FIRA 5CSRA 4MVAA 3MI3A 3UWZA 3R5EA 5HNRA 4IQLA 4FEZA 2WPBA 4XBKA 4O18A 2B4GA 1OYBA 4ZQNA 2Y85A 2CZEA 4ADSA 1KFKA 3C2FA 4NVTA 3UPBA 1VPXA 3O07A 3ZWTA 3UZ5A 4ORIA 3TC6A 5CGQA 4HNTA 5K7JA 1XBYA 2DZVA 4WUIA 3O1NA 3S5YA 1KM5A 3LTPA 1A50A 1TTPA 1TJPA 5IBXA 1H7PA 3CEUA 3BARA 3W1LA 1IIHA 1Z48A 4JICA 5FF0A 2QCGA 2QUVA 4O1CA 1A5BA 4UTWA 1FXQA 3M41A 2LLEA 3SY5A 4C1KA 4N2YA 1KV5A 3W2LA 2C1HA 1FCUA 2RDWA 2WNNA 3B04A 4IMCA 4QNEA 1G6CA 2TYSA 5FEZA 1YPIA 1GG0A 2ATSA 1TRDA 1O5XA 1OFPA 3PM6A 1GTHA 5EY5A 4Z1CA 5K2ZA 3DAQA 3EWXA 1TB3A 3FS2A 2QCMA 1Q45A 3UZJA 3NG3A 1LOQA 3G24A 2GQAA 3ABQA 3LCIA 3M5ZA 1M7PA 4MLRA 2A1YA 1KFBA 1ZNNA 1SR9A 3QJAA 3MI6A 4PFMA 4GUJA 2CWNA 1D3HA 1H1YA 5G2HA 5K4XA 3CU2A 4JTGA 1ZHAA 3W1MA 2J24A 5TIMA 1CW2A 5F1UA 4BF9A 1KTCA 1B57A 1F74A 2HTMA 4IX0A 3HQ1A 1KA9F 1GVQA 2F7FA 4GJ1A 3HBLA 1B9BA 1YXDA 5DCBA 4OU1A 1RQEA 3CLMA 3GDMA 4BK9A 5D09A 4LS1A 2YW4A 4E0CA 3WJSA 4E38A 2CLOA 1W31A 3IV3A 5FEPA 4CQAA 5HWNA 4M6QA 1RV8A 3LI1A 3GK0A 4JTSA 2W6RA 3W7JA 4HNVA 2QJHA 1EB3A 5J5RA 3FJLA 3FFSA 1KFJA 3SGZA 3TMLA 4XZ9A 1LDCA 4N6EA 3W7QA 4N9CA 2HS6A 4RXGA 5LSMA 2WO5A 1XBVA 2JKEA 4AAJA 5AHEA 3BLEA 4N9EA 5G2WA 5KZMA 2P10A 3KVKA 3GNNA 3DGRA 1R30A 4GUHA 4FXRA 2H3DA 4JIQA 1FX6A 2CFFA 3IGUA 2JKAA 2OX1A 1ZENA 1JJKA 1SO3A 2DP3A 2DZUA 3MBFA 4UCGA 1HG3A 1WXJA 5AYZA 4N9DA 4Y90A 2VFDA 4ZQRA 1IXNA 1A5AA 1XCFA 3G1XA 1U83A 5ABTA 4JTKA 3IIOA 1KTNA 2WNZA 1WBHA 1YPFA 2C3ZA 2Q3OA 5G4WA 3MI2A 4EF8A 1VYRA 3PUDA 4O28A 3ANYA 1ZCOA 3N19B 3TQKA 1JRBA 2WKJA 2WNQA 3B0VC 1J2WA 4YL2A 3NZ1A 2OCZA 4FNQA 3C61A 1TREA 3C2VA 3PBYA 1GZGA 2VEMA 4MYAA 3M0ZA 3NQ2A 1QNVA 2DORA 3RLUA 3C56A 3OIXA 1HO4A 4YXGA 2ZYFA 4WJEA 4FIQA 1W1ZA 3DI0A 1THFD 5K9DA 3M7WA 1T96A 1FWWA 4O4WA 1SZFA 2QCHA 3CIXA 1FXPA 4JDYA 2V8ZA 2GVGA 3UQNA 1H50A 1KFEA 1TMHA 4U28A 3LHTA 3WK2A 4TMBA 4CLMA 2C0AA 3L5LA 1TRIA 2Z0IA 4TMCA 1DV7A 1Q6QA 2CLKA 3TQ0A 1H1ZA 1W0MA 3BW4A 5D03A 1KLZA 1XKYA 2RH9A 5G1YA 2Q3RA 2R8WA 2QUTA 1NAL1 3GB6A 4JX4A 4MZ1A 4RLIA 4MFEA 5FF3A 1QO5A 2PCQA 4NQ1A 5G2IA 4WY0B 3LERA 3G1DA 2VEPA 2ZA1A 1ZAIA 3KFTA 3NL3A 4UC5A 3W7IA 1XUUA 3KOFA 3G8RA 3W72A 4BI5A 3TC7A 5TQLA 2XN2A 2NUYA 4XQ6A 1QO2A 4NUWA 3DENA 3M9YA 2CLFA 5AC6A 5CSSA 1QPQA 3M1ZA 5A8GA 3C8FA 5FESA 3N73A 3Q2DA 3VE7A 4Q33A 4N4PA 4FXSA 5DCEA 1KBJA 5KZDA 3EXSA 2W79A 3GIYA 2E5CA 3TCEA 1K8XA 5D38A 1FCVA 3QM3A 2I1OA 1NFBA 3EKZA 1FBAA 3N34A 1LZOA 5I3KA 2C16A 2J9ZA 3PVFA 1HTIA 3P84A 5LNUA 3BGGA 5C55A 3G22A 1O94A 1R46A 3NEVA 1NSJA 4LC6A 1BKSA 5AYXA 2FPVA 3LCXA 5DLCA 2PC4A 4JGDA 5HJLA 1CI1A 2QF7A 3S0CA 1EUNA 1GYNA 3I68A 2NV1A 3ZWSA 3S42A 5D2VA 3P7YA 1M6JA 1ADOA 1XC4A 1JCMP 1K8ZA 4KWWA 4PC8A 1RQHA 2QCDA 1T99A 1AL7A 1DHPA 4BWLA 3TNOA 1FY6A 2VFHA 3CWNA 3TFXA 1H7WA 1EP1A 1JVNA 3CWOX 3OHIA 3GXPA 2B7QA 2GQ9A 3L66A 2V5BA 4E2DA 1LBFA 1SO6A 2P1FA 3LLDA 1WX0A 4OV4A 1F76A 4PL2A 1EUAA 3AJXA 3QSTA 4YCPA 2YYTA 4NX5A 2DZPA 4JYFA 4ONVA 3SZ8A 5HUOA 5H2ZA 5D2XA 3W7RA 3LI0A 4YLWA 4DO4A 4Z1DA 3IIVA 2ZZ5A 5KMYA 2R94A 3B06A 4M6PA 4IXHA 1EEPA 1OVDA 3Q58A 5D05A 3W74A 2NUXA 4LY8A 1ZAJA 2ZZ7A 1IGSA 1MZHA 4MZ8A 3B8DA 2X1UA 3HPSA 1D9EA 3PBVA 3W75A 3NNTA 3GX9A 2NLIA 1W5QA 2DU2A 3KRZA 2VXNA 5AC7A 2NXHA 1KW1A 3HJZA 3P8JA 4O54A 4JD4A 3BG9A 2TRSA 3IEBA 2FQIA 2NX1A 4RZ5A 3G1AA 1VH7A 4O0KA 1G7UA 5EBUA 3B0PA 3L0GA 4O19A 3QMRA 3UYCA 4K6AA 3BK0A 2A7NA 2FLIA 3H55A 2FTPA 3W7DA 1SW0A 4A2RA 2AGKA 4WD0A 1R2TA 3W7GA 4JY8A 4O0ZA 3IRDA 2B7OA 4FX6M 1J5TA 2WSRA 1OFOA 4K39A 4LVGA 1I2NA 5C54A 2YW3A 1DQXA 3JS3A 1ZALA 1F6PA 1ALDA 3QZEA 4KFPA 3TDFA 1OX6A 3FJ6A 1DJQA 4UFHA 1KM2A 1W5OA 4UFJA 4NZFA 2NXIA 1VQTA 4DF2A 5AHFA 3QW3A 4OV9A 4UTKA 3STGA 1B4KA 3KRSA 1LM1A 1LCOA 1W5PA 4ADUA 1G4EA 1YTKA 4NJGA 2QAPA 1JCJA 1KFCA 3ABSA 1TPH1 3FLUA 3PG9A 4X9SA 3WJYA 1DORA 2FB3A 4QISA 1Q3NA 1K7XA 1RQBA 3L65A 1TTIA 1TTJA 3UY8A 1EWEA 5E93A 5BOOA 1FDJA 4LVFA 3MMTA 4AHQA 5I3FA 2WSYA 3Q94A 4GRSA 5HUPA 1K7FA 4Y96A 4MOZA 3A23A 3ATZA 4FX7A 1JCNA 1UJPA 2ISSA 4LU0A 1YDNA 4O1AA 5HMSA 2TSYA 1T0OA 4O57A 3R2GA 3H54A 3BG3A 5F4XA 3O06A 2Y61A 3PSVA 3A24A 3PS7A 5AYYA 3FEMA 6TIMA 2QR6A 3LB0A 4DO5A 1DKWA 2VKZG 3D0CA 2V5LA 3RK8A 4GC4A 4UTLA 1SPQA 3M6YA 1WDWA 1Q6LA 5U7SA 2HS8A 2VC6A 2VFEA 1J4EA 3I65A 3LCLA 4JTTA 1KV8A 3EKLA 4D2JA 3C3NA 1VC4A 2H8ZA 2DZWA 3DFNA 3Q37A 1OX4A 1Q6RA 4R33A 3SSJA 5KITA 4DBEA 1H62A 3STFA 5F4SA 3HB9A 3KAOA 1U5JA 4N4QA 1H60A 3N9RA 5AOUA 1UB3A 3NQCA 4NJIA 2W0UA 1QFEA 1ICPA 1XBZA 4UNKA 1SSGA 3HGOA 2DJLA 2Q8LA 2NX3A 1UBSA 1R2SA 1XUZA 2H8XA 1R47A 3O05A 4CNPA 4N6FA 3DHFA 3C4UA 3MHFA 1YYAA 2ZFAA 3TJXA 3HPZA 4TR9A 5LNRA 1ZFJA 3FKKA 1N7KA 2DZTA 3G3MA 4R7JA 3G1YA 4I9AA 3S1WA 4R53A 4B5NA 3LHVA 1SW3A 2Z2UA 1P4CA 3L5MA 2X1RA 4AVFA 4JX6A 2V2DA 3THAA 3GDKA 4EF9A 1Z42A 1UUOA 3NXFA 3NQDA 4MJZA 3FYPA 3TFCA 3W23A 1EP3A 2ZDRA 3UWWA 1SQ7A 2ZZ1A 4LVBA 1DBTA 1GWJA 2QCFA 3OEXA 1JRCA 2X2GA 1OABA 3E0IA 4LRSA 3GKFA 3PR2A 3YPIA 4MY8A 5FF7A 2ZTKA 5FEWA 4S2BA 2Y7GA 3W2UA 3SECA 4TU1A 1YTDA 4FNRA 1F73A 3NL6A 1PCKA 4A2SA 4WQ6A 2Z6JA 3KHJA 3O6YX 3MP5A 4NU7A 3PBUA 4RKAA 3EWZA 3DKLA 2GOUA 3LHYA 3W2NA 4LRTA 4O53A 5G5IA 4NJKA 5C5YA 4I7WA 1GJPA 2EHHA 1ICQA 5BNKA 3QPZA 3L21A 1RR2A 3IGXA 4UFIA 2ZZ3A 3QH2A 1CX9A 3CT7A 4RCXA 2YXGA 3W1TA 1TSIA 3F4WA 3HIJA 4ML9A 4LWWA 3MHUA 3NPUA 4LVAA 4RV8A 1F2JA 2DZXA 4OT7A 2QJIA 2E6AA 4UFKA 1K3UA 1ONRA 3G8EA 3L5AA 3LHWA 1I45A 2ZTJA 4IMGA 1W5NA 2H6RA 4FHAA 1PIIA 3O16A 4MZYA 1A53A 2RFGA 5MHBA 1SZEA 5FF4A 3DBPA 3HOJA 2V0TA 3NL5A 5D2YA 1ME7A 3GYEA 1SU5A 1H61A 1TIMA 5DY3A 3C52A 2O7SA 2VOMA 4LS2A 3LX9A 5I3HA 3W71A 4UMAA 1L6WA 1I2RA 2E77A 4JTFA 3GZ3A 1FCBA 1PS9A 3M43A 4JYEA 3SJ3A 3PC0A 1YXYA 2VFFA 3NQMA 7TIMA 2BXVA 4EWND 2C19A 4PA8A 4KWVA 3QRHA 1RPXA 4UTTC 4ICNA 4JNMA 4YCOA 2YDAA 1I2QA 4JTHA 3UWQA 4XTDA 4O1DA 4GE8A 1UCWA 1HO1A 3EX6A 4H3DA 4FNPA 4M5PA 3IVTA 5HWJA 2ZBTA 1MXSA 5D04C 1AL8A 1F6KA 5DELA 3HG3A 1WBJA 1MEIA 2O7QA 3G1VA 5K4ZA 1V5XA 3TROA 4LV9A 3NQ8A 1AW1A 2RHGA 4O17A 1W3TA 4RJEA 2ALDA 5LNSA 1FWNA 1VHNA 3PB0A 4K7VA 3SGUA 3QYQA 4XKYA 1XM3A 4K8EA 1O60A 1W56A 1IXPA 3WJXA 1GVFA 4CNOA 1WOAA 4UIOA 1DQWA 4A21A 2PRLA 1AMKA 1VGAA 3WFAA 1TPFA 2YSWA 3R89A 2FFCA 4DELA 3QQ1A 3MUXA 5I3GA 1QMLA 1DOSA 2NWRA 3LV5A 3OVQA 4ZQCA 1EA0A 2VFGA 1W37A 4K38A 2E5BA 3W86A 1Y0EA 2FPYA 1EWDA 2CZFA 3VE9A 1OF6A 1OFDA 3VCRA 1NF7A 3W85A 4M7TA 3W7PA 4Z0JA 1TO3A 4X3ZA 3LBMA 4CNNA 3EXRA 2NV2A 4MLJA 3M5XA 5CZJA 1VR6A 1N55A 3ZS4A 5D37A 2YFNA 3G1HA 2Q8ZA 5GVJA 3IIZA 3IIPA 3S1XA 3F1QA 3R13A 5EL1A 6ALDA 4Y6GA 4TO8A 2J88A 4WZHA 2WV8A 3JRKA 1R2RA 3PWAA 5EA9A 3NM1A 3O8AA 4O15A 1M7OA 1JUKA 1YADA 5G4EA 4JYDA 5FI8A 2D73A 1TPUA 1C9DA 4U4MA 4QM1A 1LROA 3NO5A 3EX2A 3QPYA 1XDMA 2FDSA 3PULA 4GUFA 3DI1A 1XBXA 2CU0A 2EAWA 3NVTA 1S5TA 2NX9A 4G1KA 3HF3A 3W1QA 2EF9A 4MPQA 3HPXA 4IMEA 1VJIA 2BTMA 3M5VA 4UNLA 3V75A 3RLVA 3TAOA 4UR7A 4JTIA 1TJRA 3USBA 3P81A 1P0KA 3S1UA 3OG3A 1QPRA 3GDRA 1B4EA 5K9XA 4AWTA 1KM3A 4O10A 1YDOA 3N2MA 2Y7FA 3G1FA 2PURA 4FO4A 4EVZA 3NQEA 1ML1A 3HG2A 1ME8A 2H3BA 3G0XA 1AW5A 3EWYA 4OGZA 5LNWA 2TMDA 4O52A 2ZA3A 4X2RA 3P82A 5H91A 1TV5A 1TCDA 2I14A 4AF0A 1NF0A 4S2CA 1OK4A 1OYCA 2YR1A 2V81A 3UY7A 4HSOA 1KM1A 4ADTA 1BWLA 1ZAHA 2Y88A 1S5VA 5LNVA 1RVGA 2G97A 4JTEA 2EKCA 2WQPA 1S5WA 4JR5A 3BW2A 1G69A 3TW7A 2ZZ2A 1LRTA 4I7UA 3NR0A 1FQ0A 3I7SA 1M5WA 1PHQA 3L0KA 3GDTA 4LT9A 1NEYA 3I7RA 2J27A 2BX7A 1YXCA 4GUIA 3F03K 3LDVA 3PB2A 3RU6A 3A9IA 3SW6A 5E1QA 4A29A 4IUOA 3P61A 2YX0A 1VS1A 1YLVA 3TX9A 4UR8A 1IXOA 4KFOA 3AO0A 1SSDA 4NNCA 5CZSA 3W87A 3BV4A 2Y62A 5C2XA 2A2IA 3NPXA 4M7SA 5FF2A 2WSQA 1W54A 2X30A 1EPXA 4A3UA 1H51A 3P67A 2V9DA 4ZMGA 3RFAA 1OX5A 2V2CA 4RX0A 5G1TA 3A5FA 4UTIA 3O6CA 3P62A 1VYPX 4S1FA 2OZ0A 1P5BA 5HINA 4LVDA 2NXGA 3PUEA 1X6UA 2GQ8A 3CIWA 3CQ0A 3QMTA 3EX3A 2BZNA 1O95A 1F7BA 5F1VA 2ABBA 2Y6ZA 2QCDB 1OF8A 1HFBA 3W2MA 5DBTA 3SI9A 1XI3A 2A6LA 1L9WA 3LTSA 4LUIA 4NJJA 3W83A 1W8SA 3GDLA 1Z41A 3DXIA 4JS3A 3B05A 4PTNA 4FNUA 1MEWA 1BTMA 4N02A 2CLLA 5AFDA 5AHMA 1GVSA 3FIGA 1W3IA 4JEQA 2E6DA 3GR8A 1JCLA 2H90A 3CPRA 3DU0A 5LZLA 1VCGA 3M44A 1LBMA 3CEPA 4A22A 5HWMA 4NXKA 1H7NA 5DN1A 3MJYA 2CZ5A 3A22A 3CHVA 3WJZA 2B7PA 4ZQOA 3LXAA 5EMUA 1OYAA 2CZDA 2V82A 3P60A 3ABOA 4M19A 5I3JA 1V7YA 4EIVA 4L4LA 4BR1A 5U4NA 4PEKA 4P61A 2RDUA 2V2HA 3OVRA 3SIZA 4NNAA 3A5VA 3ABRA 2QCLA 3L68A 2DZSA 3G1SA 1QPNA 3I6RA 3PG8A 4WOQA 3S5ZA 4MIMA 3RF9A 2OMAA 5DY2A 4WOZA 3VI2A 3W1NA 5F2IA 5DCDA 1BEUA 2YCEA 3TAKA 1H7RA 3G18A 1GVRA 2V30A 3IVUA 3W1UA 3BLIA 3TSBA 3LCGA 1PVNA 2J9XA 4DPPA 1WAUA 2ZA2A 1DL3A 1SFJA 4Q4KA 4AB4A 2OT1A 4ZQPA 4IXXA 5DXYA 4HSNA 3EEGA 2WJZA 4AHPA 3UD6A 1LP6A 3W7EA 2A5HA 2YYUA 2ZCGA 4UMCA 5CZ0A 5SWUA 4IJBA 3P8IA 3LCFA 3OVPA 3U8GA 1GOXA 4UTUA 2B0MA 2ZQ0A 3G3DA 4XUGA 3L9CA 1IIGA 1ZJIA 5LHEA 3W1AA 3W1PA 2ZRWA 4H6KA 2ISVA 3C2OA 1JCYA 4YMZA 2FB2A 1TPEA 4CQ9A 3INPA 1E51A 1K03A 5LHFA 2R91A 3N3MA 5L6UA 4OE7A 1VYSX 2C15A 2GUUA 3NOEA 4JIPA 3WK3A 4UTTA 1XXXA 4LOCA 3T4CA 4HHPA 1SW7A 1TPB1 2NWSA 3TXVA 5D02A 4LTSA 3F4NA 3ATYA 3NQVA 4WX2A 4K7YA 3N14A 5HR6A 5DXXA 4BI6A 2QCEA 1UASA 3SR7A 3ELFA 2BWGA 4AWSA 1A5CA 1EP2A 2NZLA 4MYXA 2C14A 5HULA 4HPXA 4JTUA 5CG7A 4E2BA 3C2RA 4CCCA 2ISWA 3BGJA 4GXMA 3W70A 2GVJA 4CCEA 2CLIA 4LS0A 3NL2A 1XDLA 1X1OA 3M47A 4HT3A 1GG1A 4XWUA 3JR2A 1LLWA 3GAKA 1RZMA 4AXKA 3LXCA 2FPTA 2X16A 2J6XA 1MEHA 1ICSA 3C6CA 4O14A 5CPLA 2A4AA 1X7FA 3N2XA 1OFAA 1OX4B 4JXCA 3PSWA 3FA5A 1OK6A 3MYPA 4R34A 1WYIA 1GTEA 2E68A 2VEKA 3NQFA 1SO5A 4GUGA 2ZZ4A 5K9CA 4HKPA 4ZL1A 5BW6A 4RR4A 3HG5A 4LNYA 1VZWA 3UXDA 2CLHA 2A6NA 5A5WA 3QQ0A 3S6DA 4ZZ9A 2AAMA 3B0UX 5AHIA 3H53A 3R8RA 3IVSA 5HQEA 4UTHA 1OJXA 1A5SA 5K3VA 4O4VA 2YZRA 3LM7A 5E0KA 2HSAA 3PF3A 3L2IA 3LV6A 1FCQA 4CQ8A 1K02A 2OT0A 3DFTA 4RZ4A 1O5KA 1D3GA 2CLMA 1IF2A 1LORA 3B4UA 1GT8A 3E49A 2B7NA 4ZVJA 1QOPA 1L2UA 2ZZ6A 3QW4B 4MUZA 3TR2A 2QUUA 3UPWA 4PH6A 1LRQA 4DO6A 4AEOA 3A21A 3KVJA 2PE4A 1WOBA 5J5DA 4K37A 2BLEA 1ZY9A 4NXSA 1G67A 3TW6A 4XTIA 2E09A 1KFLA 1TQJA 1HL2A 3E12A 4IMFA 4O16A 2JGYA 3G0UA 8TIMA 2G96A 1JQXA 1BWKA 4O50A 1QOQA 3GXNA 3CTLA 3TMQA 4AH7A 2ZRXA 5D2TA 5F2LA 3WK1A 1H63A 2KZHA 1K8YA 4GNJA 1SZNA 2Z6IA 1GVOA 4IPIA 1I8JA 1JR1A 3W7HA 3NDOA 5F2GA 2VFIA 1F05A 1VLIA 4MY1A 2VEIA 3NA8A 2G95A 1JCXA 5CPMA 5KSWA 3GNDA 1H7OA 4O12A 3W88A 3S8HA 1L6YA 3LBCA 5AHLA 3W7NA 3EWWA 2ZRZA 4JDBA 4L4MA 1TQXA 1OHLA 1I2OA 3S1VA 1X8FA 5AB3A 3QSRA 1P0NA 5CPOA 1OFRA 3HG4A 4JTLA 4O11A 3L0NA 3LTYA 4X22A 3T55A 3ZFHA 4DPQA 3E02A 4UXDA 2EGZA 3P5ZA 3U6WA 3W7KA 5F2MA 2ZRYA 4JTJA 2E6FA 4WY0A 5IBXC 3KVMA 4RK8A 5D30A 3W2KA 1UUMA 3W07A 4QIUA 4Z1BA 4O1BA 3TIMA 4AHOA 3T40A 4UTWC 3C2EA 1T8XA 3UXAA 1VCVA 3HGJA 4Z1AA 4JX5A 3EB2A 1PCWA 1OFQA 3KXQA 2I9EA 3NQ7A 1HUVA 4IMDA 2A7RA 2E1DA 4PCFA 3P5YA 3UWVA 5BMXA 3HMJG 3K30A 4UMBA 1VRDA 4H4IA 1XL9A 1AG1O 1SO4A 4DF1A 1KM4A 1ME9A 3NZRA 3QEZA 3GR7A 4OBTA 3TUUA 1SFLA 5AC8A 5D2WA 1TPC1 4YWIA 3QMSA 4QJ1A 4IPJA 2G5WA 4O13A 2Y63A 1KM6A 3C0JA 5LGZA 1Q6OA 1TPDA 3QC3A 1LRNA 3TJLA 4GWEA 1LOSA 2E5DA 3E9AA 1L6SA 3NGJA 3NYZA 2PRHA 1S3HA 1GPWA 5C6MA 3V1PA 1OFBA 3W22A 2GVLA 3S5NA 1LYXA 1JUEA 2PRMA 1LOLA 1PHWA 4ALDA 3GLCA 4XKYB 3VKJA 1GYLA 3P74A 3TH6A 3W2JA 2Y89A 2Y70A 2HMCA 1FDYA 2X1TA 3CM4A 2VELA 4UUIA 3DH7A 1C29A 3P80A 1PE1A 2BSLA 2C18A 2OJPA 2QDGA 3NQ6A 4RZ6A 2A0NA 3QF0A 3LCHA 1FUYA 1C8VA 3W6YA 3S5OA 1W3NA 5HR7A 4MKNA 1TTQA 2DJXA 4FX8A 2FJKA 2ZRVA 3W7MA 3EXTA 5T26A 5LGXA 3N9SA 4IGHA 2YFOA 3FKRA 4TX9A 1DVJA 4I7VA 3WJWA 4P2VA 5BRBA 1WQ5A 1PV8A 1DJNA 4NT0A 1G4TA 2P0OA 4NZJA 1QPOA 4XBSA 1X1ZA 3KVLA 2C13A 3W1RA 3W9ZA 3T78A 5AN7A 3LOTA 4KKXA 3TK7A 3THQA 3TQVA 3TU9A 3HO8A 4W9TA 5FEXA 4LUJA 3W7OA 3STCA 1TPWA 4QITA 1KTBA 3DZ1A 5CPNA 3IGSA 4AWUA 3O6DA 4DBDA 2C6QA 4K36A 1AK5A 5BMWA 3OBKA 3MO7A 4BFAA 3KX6A 3MP3A 1KLYA 3W7LA 3KRUA 3OA3A 1MSSA 3DKJA 4UTMA 5D32A 1VCFA 5DBUA 3TE9A 1JQVA 3LHZA 4MJMA 2VENA 1JUBA 4N9BA 3LCWA 1LLZA 2QEZA 4LW7A 3SFKA 2F84A 3DFOA 3GAYA 5F4WA 4OQVA 3NQGA 4JY9A 4QSHA 4POCA 3TSMA 2NUWA 2E6YA 1I4NA 4LC8A 3T7VA 1FWRA 3MWAA 3WK0A 2XN1A 3UWUA 2EPHA 3EWUA 4FF7A 1EX5A 3FYOA 3MHGA 3U2OA 2AQWA 3HGSA 5CKSA 3VFLA 4DQWA 5EPDA 2QKFA 3LGEA 3W84A 4GBUA 2J9YA 2X1SA 1QWGA 2TPSA 3PY2A 4M6VA 1OFEA 1AW2A 4WXYA 2GJLA 3RMJA 3O15A 5KZEA 5EYWA 4AF0B 4O8RA 3W3OA 1FWSA 2IQTA 4MFDA 2RKXA 1F5ZA 4RXFA 2ATMA 3LRKA 3L67A 1TV8A 2UV8G 3LLFA 5CZTA 3BLFA 5AHNA 1QDSA 1Z44A 3GVGA 1OG0A 3VNDA 1QCWA 2QCCA 3MP4A 4WXZA 4Y9AA 1FDZA 1NVMA 2Y7DA 4DXVA 3NQAA 1SZGA 4EOUA 1QR7A 4FB7A 4Z08A 3DFSA 1VHCA 3PAJA 2Z1BA 4QAIA 1B3OA 3W73A 4ORMA 4UFLA 3CC1A 2JK2A 1K7EA 3O63A 1RD5A 3S9YA 1YDVA 3FOKA 3MBDA 4FNSA 3M16A 1KM0A 5L9FA 3GXTA 4LV4A 2A7PA 4GFSA 3MYOA 4HNNA 3PUOA 4MY9A 2A85A 2WOQA 2GJNA 1FWTA 3M5YA 4Q32A 3BG5A 4NJHA 4UTJA 1H5YA 4WY0F 3LRMA 4QNWA 3DHDA 1TYGA 3STEA 3I7QA 3HGRA 4PL1A 3IIXA 2GPTA 3UNDA 2ABAA 3ZR4A 2JKPA 1MO0A 3LXBA 5LKYA 4FNTA 3E96A 4HN4A 2A21A 1JULA 3EX1A 4J9JA 4JN6A 3W1XA 3RNDA 4Z0SA 4OHQA 4NNBA 4TIMA 3W7CA 2CLEA 3UWYA 1TV7A 1QAPA 1IXQA 2JGQA 3EWBX 4HPJA 5KINA 1LTDA 2QCNA 1G4PA 4NX0A 3W76A 3MW7A 1WA3A 3DFQA 4BWLC 4PODA 1G7VA 5KTLA 3TSDA 5IM51 3QFEA 4K8HA 4C1LA 1O4UA 3EX4A 3TXZA 3G0SA 2QJGA 1I2PA 2QDHA 1EIXA 3NAVA 2Y7EA 2JBMA 3BPWA 4HIBA 4KFNA 3GKAA 4IX2A 3LHUA 4UFMA 5EKYA 4BI7A 3NPWA 2QAFA 4QQ3A 3B03A 1PL9A 2FIQA 2ZRUA 4OWGA 3BVJA 4IWWA 2YPIA 1GQNA 1LBLA 1N8FA 2CW6A 1GEQA 1P1XA 4HNUA
chains in the Genus database with same CATH superfamily
1VLWA 4FR1A 3SDOA 3NPVA 3BH4A 4DEFA 4AMAA 3ERPA 4Q8PA 5C2GA 1WDDA 2R14A 2RDTA 1QVBA 3CL8A 2BOEX 3BW3A 1WV2A 3CB8A 4Y8FA 7ODCA 1XFBA 1SUXA 1V6TA 5CSRA 2JEQA 3GY1A 3M46A 3CZGA 3UWZA 3R5EA 4IQLA 2DV0A 1XV8A 1V08A 3GG7A 1Q7QA 2Y85A 1KFKA 3UPBA 3CYJA 1KRBC 2WMIA 2CKRA 1VPXA 4F9JA 2XISA 3ZWTA 3E0WA 3H8AA 4ORIA 2GJPA 4W5ZA 5CGQA 4WUIA 2HVOA 5A8QA 1W3LA 3S5YA 1TZ7A 1O6IA 4R88A 4UOQA 5CJ5A 1NQ6A 1YQ2A 4QDPA 5D9PA 1Q7MA 4HGXA 5AECA 1XIMA 1S39A 4ACZA 3IGHX 4JNYA 1ESWA 5FF0A 5A2BA 2XPKA 4RDWA 4AX6A 4DJEA 2WKGA 3M41A 3PN8A 1KV5A 2YKKA 5ABEA 4XAYA 2WNNA 3GU1A 2HNHA 1YPIA 1GG0A 1TRDA 1PWMA 1OFPA 1IEIA 3AICA 3DAQA 4CEUC 2O4MA 3FN9A 1TB3A 8CGTA 2QCMA 1Q45A 3UZJA 4US5A 1Q65A 1QNSA 1KCLA 3NG3A 1LOQA 1UROA 2GQAA 1BGAA 1KFBA 1K9FA 2E0PA 3SY1A 3VDCA 4GUJA 3PJXA 2CWNA 2PWDA 3CH0A 1D3HA 5G2HA 3VNMA 3CU2A 4IJRA 1EZ2A 1CGXA 3W1MA 3W24A 3QR3A 2E9LA 1WDRA 2RJGA 1RLCL 2PDWA 5EFDA 1XLHA 2HTMA 3OP2A 3HQ1A 2F7FA 3RX2A 4BK9A 5DCBA 1RQEA 3CLMA 3GDMA 3A6OA 1OZQA 2YW4A 4I5XA 1W31A 3IV3A 4YTQA 4Z42C 4YVXA 4M6QA 1HXJA 3GW0A 5FJRA 1TJ1A 3BOXA 1XYBA 3W01A 2C8NA 4HNVA 2QJHA 3FJLA 4UQDA 3KP1A 4E2OA 4P8UA 4RXGA 4K2SA 1KO0A 3IARA 2ZUMA 5AHEA 1GOKA 3FAWA 3QY6A 1EGVA 1XH2A 3H2EA 4IFOA 3EGJA 1KD0A 2J77A 3IGUA 3VM7A 1ZENA 4CU8A 1JJKA 1EJVC 1MQPA 4ERGA 4D71A 1P7TB 4UCGA 4L1WA 1WXJA 3IUHA 5FD0A 1GOQA 4WJXA 4Y90A 1W9VA 1XYFA 1XCFA 2JIEA 2OZ3A 5ABTA 4GCAA 3S2MA 4PRTA 2C3ZA 3B9AA 3MI2A 4OUIA 4XG1A 5C8BB 3VNZA 3HTWA 3ANYA 4AZ5A 4DJEC 3B0VC 2O55A 3I4EA 4I90A 4CU6A 3C61A 3SURA 3RG6A 1GZGA 1M53A 3NQ2A 3UJRA 2H9AA 1K6WA 2DORA 1A0DA 3KCLA 1HO4A 4WJEA 3VGBA 2ZUUA 3RGTA 4QJ3B 5K9DA 3CIXA 1NM9A 1EQCA 5T9CE 4U28A 1KFEA 3ZXWA 4CLMA 1RCXB 2ZWYA 3SUUA 3L5LA 3WLSA 3FSTA 4TMCA 2V69A 1DV7A 3WH6A 3CQHA 4PMZA 3BW4A 5D03A 3SQLA 1XKYA 2YB4A 2RH9A 1LT7A 4NI8A 1MVYA 4HJWA 2QUTA 3GB6A 2QDDA 4MZ1A 1UBPC 2YBUA 1AJZA 1EH9A 4HA4A 3G1DA 4Z1YA 2ZX7A 2FKPA 2ZA1A 3NL3A 4AU0A 3L2LA 5H8PA 4W8AA 4U10A 2XN2A 2NUYA 4XQ6A 1QO2A 5D4YA 3UG8A 3M9YA 3SAZA 2PDFA 3M1ZA 1O12A 4S38A 3LZ5A 3AFBA 3C8FA 2YCJA 4N4PA 4HCHA 3EXSA 4S3EA 5KZ6A 2E5CA 1JGMA 3N9KA 3H2OA 3WLOA 1NFBA 1FBAA 1HJWA 3N34A 5BWFA 4AD4A 4HA1A 3A4XA 1HTIA 4J3SA 4MWAB 1QI3A 3P84A 4GYPA 5XIMA 1Q63A 1UA3A 1XGZA 3NEVA 4LC6A 2YL5A 3NGFA 2Q01A 1EJWC 2DUAA 3VVGA 2FPVA 4B9YA 3T8QA 4JGDA 2D2OA 1OCJA 5HJLA 4L80A 5BCAA 1CI1A 1MUCA 3OODA 1MYRA 3PTDA 3S0CA 7A3HA 2O56A 3L4VA 1ITXA 2PDQA 3P7YA 5D2VA 1M6JA 4ASTA 1ADOA 2BHZA 3E6EA 4GQGA 4PC8A 1PX8A 2QS8A 5IDZA 2QCDA 2YDRA 1JVNA 1EP1A 3G6LA 3OHIA 3WENA 1X8CA 1PZ2A 1SO6A 2OEJA 2Z1WA 1OM0A 1WX0A 3MPGA 1JFXA 1F76A 3N2CA 4W89A 3OZMA 4YCPA 1MRQA 2YYTA 4PMDA 2KX9A 2DZPA 4A8RA 4YLWA 4JIHA 1XLKA 3DHPA 3EOLA 5LXXA 2VX5A 1W9BM 1OVDA 3Q58A 2X0HA 5D05A 1V3MA 1VIWA 2J79A 1ZAJA 2VT0A 2ZZ7A 4F0RA 3B8DA 4Q8OA 4CD4A 4GYJA 9RUBA 1W5QA 2Z2BA 3BICA 1EKOA 1KKRA 1ZZMA 3HU7A 3P8JA 1DWAM 3BG9A 1Q6GA 4WVXA 5FAJA 1XSIA 1JPIA 1NELA 4O0KA 3B0PA 2VHLA 3L0GA 3UYCA 1NWSA 3ITXA 3W7DA 2E8ZA 3TTYA 3CUJA 3H2FA 2YZ5A 4A2RA 1R2TA 1GQIA 3RXZA 1BF6A 3E2VA 4LAKA 4BEQA 3JS3A 1ZALA 4KFPA 3H26A 2AMXA 1ZCCA 3RDKA 1OX6A 3R6IA 4OOUA 1KM2A 1W5OA 4AY8A 4UFJA 4NZFA 1S5NA 4AG0A 5I79A 3RUBL 5I78A 1HKJA 2JEPA 4UTKA 2BXZA 2FTYA 2OYMA 1B4KA 5I06A 4DAIA 3KOZA 1DIDA 3VIGA 1XF0A 3FLUA 5D9NA 3KBJA 2PDIA 4D8LA 4X9SA 3WJYA 4EP8C 3L65A 3MO4A 1TTIA 2PWFA 3GVQA 1EWEA 5E93A 5BOOA 5JH1A 3SCTA 4AHQA 3EA1A 3Q94A 5A2CA 5HUPA 1K7FA 1Q8JA 3A23A 3CT2A 3O7UA 4FX7A 3WBWA 2UWFA 3KTXA 2CLPA 3P0XA 1YDNA 1B3WA 3AZTA 3UEQA 1NY1A 1V02E 3R2GA 3EMQA 3VIOA 3H24A 1XRTA 2HISA 1RVKA 5I07A 4DO5A 2VKZG 4REQB 3M6YA 1EOKA 3I65A 1KV8A 2ZUNA 1UWSA 2VX6A 2DZWA 3LD5A 1OX4A 3TTOA 4R33A 1QI0A 3STFA 3BDKA 4IISA 5ABGA 3Q45A 1H60A 5HOSA 3NQCA 3R0KA 4ZTXA 1BXBA 2W0UA 1V3LA 4UQ9A 1ICPA 3WDQA 5HMDA 1XBZA 4PBEA 3PZVA 4IG2A 4HPGA 2W62A 3HGOA 2DJLA 2VC9A 2Q8LA 3U0HA 4V1YA 1UBSA 1R2SA 3QN3A 2H8XA 4FPSA 4CNPA 4N6FA 3TEVA 2JALA 3TJXA 3FDGA 4H6QA 1C9WA 3FKKA 3L4TA 1RALA 3KTCA 4MMWA 4R7JA 4O0QA 1ZTVA 1UR4A 4BJHA 6REQA 4R53A 2ZX8A 5BU9A 3DC0A 1P43A 3GO2A 4UQEA 3IACA 2EG7A 1W1PA 4A35A 4KEUA 1H2JA 2ZZ1A 3KDNA 3HM7A 1DBTA 1GWJA 5IHRA 2QCFA 1C8QA 1JRCA 3TLQA 1XLEA 4NAFA 3LGGA 3OYZA 4W8LA 3YPIA 2J7BA 2Y7GA 1FH7A 2WVVA 3A3XA 3SECA 2XFFA 1YTDA 2YXXA 5DEZA 2WJFA 1JF6A 1FH8A 1HKVA 4DJDC 4HYRA 1Z9AA 1YHTA 2VO5A 4D6FA 1W32A 1B31A 6XIMA 4IG2B 1G0CA 4Q4PA 3TWBA 1R3TA 1UUQA 3IRSA 2ZZ3A 3OVGA 1CX9A 4RCXA 1TSIA 4I9TA 3HIJA 4ACYA 5BWAA 2EG6A 3MHUA 3B8SA 1XLDA 1F2JA 2IPFA 3WY1A 3H70A 4NRSA 1I45A 1TCMA 5MHBA 2EJ1A 1A53A 2RFGA 1SZEA 3DBPA 2CBVA 2V0TA 5D2YA 1BQGA 3ARSA 1H61A 3GYEA 3H4WA 3V7PA 4IPPA 1K8CA 3BQ5A 3WLTA 3C52A 4LUSA 1RCQA 2E77A 1RLDA 4Q7IA 3M43A 4NAFB 1W1B1 1AZ1A 3WNPA 3CBWA 3B0XA 5G1MA 1YXYA 4D1JA 3NQMA 7TIMA 4EWND 2WVVB 4UZSA 5C9WA 2NQ5A 4GQQA 4Y9PA 3UA4A 3TN5A 2WSKA 4KWVA 5CPTA 1Q4NX 1EL3A 1C8XA 5H8MA 1CYGA 2I5GA 3REQA 1D2KA 4C7FA 1UQZA 3VXGA 4L65A 4H3DA 5A94A 4ICCX 5HWJA 5HNUA 1MXSA 2XVNA 1F6KA 5DELA 1J9YA 3N6JA 2O7QA 2HDJA 2WHMA 2YOCA 3NQ8A 1W3TA 1L8PA 2DSUA 4KMQA 1FWNA 4BCEA 1A5NC 3QYQA 1ZJBA 2IXVA 1O60A 3ITVA 4K8EA 2AL1A 2VGBA 1JZ3A 4ZO6A 2BY1A 4LUSB 2V3FA 4ZB0A 4RDZA 3N25A 2YSWA 3R89A 2WCGA 2VGFA 1TA3A 5I3GA 2AGTA 2FH6A 2YDSA 1HQTA 3LV5A 1EA0A 4TQTA 3W86A 3K4DA 4WDUA 1OF6A 1OFDA 4D6IA 1NF7A 3W7PA 1BKHA 4W7WA 4CNNA 3WDRA 1FWHC 3W28A 3EXRA 3DYOA 2NV2A 5CZJA 1VR6A 1N55A 2QNEA 3ZS4A 3VOIA 3RPTA 3G1HA 5DX7A 1UZ4A 3IIPA 3R13A 4LYRA 1J0IA 3EZ4A 4WZHA 1EZWA 3NURA 2J62A 5G4EA 4XIAA 2D73A 4GX8A 1TPUA 2C71A 1C9DA 4B90A 1K4GA 5I24A 4QM1A 3T9PA 2FDSA 1YNPA 3GG1A 3MKVA 3RM8A 1H49A 1DJIA 3PPFA 3OW1A 3NVTA 1ISYA 4J7RA 4G1KA 3HF3A 3W1QA 2V3EA 5JIPA 3HPXA 4IMEA 1VJIA 3PBMA 1TA3B 4QHRA 2WYSA 3THUA 1A80A 4UR7A 1W9DM 4JTIA 2VOTA 2D24A 1TJRA 3USBA 4EXBA 4AFYA 2DUXA 1QPRA 3GDRA 2CHRA 3F4CA 1JYVA 2QVHA 3N2MA 4DBSA 2PURA 3NQEA 1ML1A 3C0LA 1OT2A 3MDWA 1ME8A 2H3BA 3G0XA 3T08A 1J12A 3S2LA 3CZLA 5LNWA 4TX8A 4TVCA 5LIWX 3TN4A 5H91A 1TV5A 2I14A 3WDHA 4AF0A 1NF0A 3OYXA 1OYCA 3B40A 4HSOA 3OGRA 4ADTA 2PEVA 1ZAHA 2IUZA 3CUFA 1RVGA 2G97A 2DPEA 4JTEA 2EKCA 2AKMA 2VRKA 2ZZ2A 1XRVA 5LA1A 2OSXA 3I6TA 1FQ0A 3I7SA 1N8WA 3SUVA 3GDTA 1TUFA 2J27A 3M0VA 4L4PA 1U1UA 2VC7A 4HQVA 3LDVA 3MUZ1 2Z00A 3RU6A 3A9IA 5E1QA 4EPKA 2ZUSA 4QXIA 5C7HA 1YLVA 1QOXA 2V6AA 1GJWA 4UR8A 2FJUB 3AO0A 3W87A 3BV4A 1MW0A 3EPOA 1EBHA 3NPXA 1W54A 4A3RA 2X30A 5AC5A 3BLDA 2EO7A 2YLLA 4MPKA 1M7JA 5I3DA 1H51A 2XYLA 2V9DA 4ZMGA 1W2PA 1OX5A 2GK1A 1UMLA 1VYPX 1XGEA 5AZ1A 1REQB 4PR4A 1YE4A 2NXGA 2GGJA 3THDA 2EPNA 2JF6A 3CIWA 3TYCA 3CQ0A 2VWSA 3EX3A 4Q4QA 1F7BA 5F1VA 4MADA 2IPJA 3KDOA 3WLIA 1EF2A 4BF5A 1F3WA 1QJWA 3AXIA 3LTSA 4LUIA 5D8ZA 1W8SA 3QKZA 2ZXQA 3QLDA 4KW2A 3DXIA 5HK4A 1QTWA 3RO6A 1S5MA 1MEWA 1V6XA 4EAMA 1F61A 1NDZA 1POKA 5FJPA 1HVQA 4GLEA 3CPRA 2GDQA 5LZLA 4GO9A 3GSMA 3S1GA 2CZ5A 4ZQOA 1JDDA 4WKHA 2B31A 5C7VA 4MAZA 2PDXA 4LUTA 5I3JA 1V7YA 4JIRA 4NY2A 1HIZA 4GXPA 4L4LA 4PEKA 3BLPX 1NFPA 5B80A 2GK1B 2CERA 3A5VA 1TFVA 3L68A 2DZSA 1QPNA 4GVHA 2PTWA 1ENUA 1SYTA 4DJDD 3M64A 2OMAA 4WOZA 1W3HA 4S3JA 5F2IA 5DCDA 1BEUA 4ZSTA 3G18A 2J78A 4GK8A 1CXEA 3IVUA 1XIFA 4FAMA 3TSBA 3LCGA 3N2OA 3RO8A 3E5BA 4DPPA 4C6QA 4Q8NA 4HZ6A 4PCPA 3FGCB 4F4RA 1SFJA 1FOBA 4G7EA 4AB4A 4AZ7A 1XLBA 1ZUAX 3VK5A 1E1EA 4ZQPA 3LM3A 4EPBC 1MW1A 3EEGA 4AHPA 4JFUA 5FJUA 1UH3A 2YYUA 2ZCGA 4UMCA 4YTRA 5SWUA 4FA3A 4IJBA 2CPUA 4IIEA 4LCSA 3OVPA 3U8GA 4UTUA 1AD1A 3G3DA 2XGIA 3M7SA 2EG8A 1R9ZA 4LUTB 4YMZA 3OTRA 3W0KA 5LHFA 2R91A 1XLAA 3D3AA 1VYSX 3NOEA 4JIPA 1DEDA 3TXVA 1TPB1 2NWSA 2ZX9A 4X61A 2J4GA 4C1NA 2OQYA 1AH3A 1CTNA 2QCEA 1UASA 3ELFA 2D3LA 2OLHA 3GTIA 1EP2A 2RGMA 1UWRA 4FMVA 2XIMA 2Y5SA 4YTSA 1H4PA 2NQJA 4RE3A 3WQFA 4GXMA 3WDIA 2GSJA 1IEWA 3KS6A 2P50A 3TZFA 1JYXA 4LS0A 3NL2A 1DIEA 2VNCA 1GG1A 4XWUA 4AXKA 2FPTA 1OC5A 3HQOA 2JFEX 3VX0A 2P8CA 3C6CA 4O14A 1OFAA 3GIQA 3IS4A 3QKEA 4JXCA 3FA5A 3R94A 2POZA 1OK6A 4R34A 1CXKA 1TE6A 2VEKA 5K9CA 4MG4A 5BW6A 1VZWA 3NIYA 3TVAA 2A6NA 3H4GA 3ALGA 2OB3A 5AHIA 3H53A 2YL9A 3SJNA 3BSGA 1UKSA 3B3DA 4C1NB 2XUCA 1A5SA 1A0CA 4O4VA 2GWGA 3CIVA 3L2IA 3QTGA 4H2HA 3TZNA 2QMJA 2I5IA 4GYKA 1O5KA 2PGWA 3B4UA 4MB1A 1GT8A 3E5PA 3UXIA 2ZZ6A 3QW4B 2ZC8A 2QUUA 3WLJA 2X1IA 4Q8VA 2DY3A 4DO6A 4AEOA 2PDBA 5JBEA 4QGCA 1DJGA 1WOBA 4JCMA 3I3EA 4XTIA 3PJTA 4GVFA 3CAKA 3WQVA 1TQJA 1HL2A 4O16A 1DQUA 4Q7BA 3UPMA 4F2UA 8TIMA 1UYQA 1QOQA 3GXNA 1X98A 3CTLA 3BLKA 2ZRXA 2KZHA 1K8YA 4GNJA 4RNIA 3BSHA 3GHTA 3LMYA 3NDOA 4GISA 2BMBA 5CBIA 3PK7A 1VLIA 4F79A 2NVCA 3NA8A 2G95A 1N8IA 3AXKA 3W6MA 5KSWA 3GM8A 1H7OA 2QVNA 3S8HA 1L6YA 4G6CA 4K1WA 1O5QA 5AHLA 1W1A1 1I6NA 1UD5A 4JDBA 1M01A 3FEQA 4L4MA 1TQXA 1I2OA 5CLTA 2W5FA 1X8FA 5AB3A 3WNOA 5CPOA 3HG4A 2G3NA 2J74A 2BVWA 3E02A 1JDAA 1VEOA 5T8GA 4D1IA 4JKLA 1QT1A 1WXZA 4GJJA 1VBRA 1PJ9A 2C79A 3CS2A 4O1BA 3T40A 2OQLA 1VCVA 3EB2A 1PCWA 1OWQA 4W8BA 3TN3A 2I9EA 5CC5A 2YA2A 4IMDA 3UWVA 5BMXA 5C9RA 1NWTA 3B8VA 1NQKA 4RL3A 1ZP4A 1BLIA 1XL9A 1X38A 2D20A 2VZOA 1AG1O 1SO4A 4NZCA 4DHGA 1CGTA 3TUUA 1MI3A 5D2WA 4HCDA 1TPC1 5IRPA 3F2CA 4QJ1A 2G5WA 2FMNA 4LBSA 1PUDA 1Q6OA 1TPDA 4JTCA 3QC3A 3WQCA 2OKOA 1G94A 3FJ4A 3E9AA 1L6SA 2RDXA 4GX9A 3SUWA 3V35A 2ONEA 3W22A 3M07A 3VOJA 3BJFA 4XKYB 2BOGX 3KOXA 3P74A 3BZGA 3W2JA 3SQSA 2Y70A 4B4HA 3GVRA 4MNJA 1FDYA 1JAEA 4RPQA 4XVDA 4IM4A 2BSLA 2C18A 2QDGA 4AUBA 4XAZA 3OOQA 3VNIA 4RZ6A 1A5MC 1E9LA 2BVDA 1UC4A 4MF4A 5EMKA 2PGFA 1PTGA 4MKNA 2GFTA 5E70A 4AZIA 3PWGA 5XIAA 1I1WA 3FKRA 2XIOA 4NZ3A 4PMYA 3PZTA 4P2VA 1WQ5A 4OJYA 4YTUA 1G4TA 2C13A 2HXUA 5AN7A 1E56A 5DMNA 3M0XA 1R6WA 3HO8A 1IV8A 4W9TA 3W7OA 4GY7A 3STCA 1TPWA 2I56A 3GHRA 1VRXA 4GY1A 2Z1SA 3VGGA 3OBKA 4QE5A 3KLLA 3ZLHA 3QR1A 3DKJA 4UTMA 3ABZA 3TE9A 1TVNA 3SBFA 2EPOA 3AHXA 3LHZA 1K9EA 2Z7KA 1JUBA 3LCWA 4AY7A 3FHQA 3WQEA 3SO7A 2QEZA 4PBGA 3SFKA 2F84A 3DFOA 4JY9A 1GQLA 2WMGA 2NUWA 1XINA 4C7GA 4H8VA 1E72M 4UTFA 1FWRA 3DEQA 3B9NA 2XN1A 1FA2A 4AISA 2OEKA 3BAWA 4C6OA 1KRCC 2VMFA 3MT1A 1CECA 1UD4A 2DW7A 5EPDA 4IFRA 2D1ZA 5HA7A 2ANUA 3I3BA 4GBUA 1UPPA 1EJ7L 4D8AA 5A6KA 1MQQA 2Y5EA 3T2OA 2J7EA 3J7HA 5H8UA 3RRAA 4XKMA 1MRAA 5FAGA 1EHNA 4MFDA 4RXFA 1J0ZA 2PWEA 3LRKA 2WZEA 4Q7NA 3WH7A 2UV8G 4LSBA 2HXTA 5LA2A 1Z8AA 3CYVA 5CZKA 1QDSA 3LPPA 4JTQA 3OO2A 4WLCA 1Z44A 3T0CA 4J27A 4IJCA 5FIPA 1QCWA 1P1MA 3MP4A 3GRIA 3ONBA 5FSEC 2Y7DA 1CB2A 1UWAA 1QR7A 1U5VA 2FDMA 4EPDC 1V03A 1R3SA 4QFUA 3S9YA 1DXIA 1LT8A 3M16A 5L9FA 3WZ0E 3GXTA 4LV4A 2A3HA 4HNNA 3PUOA 4IIHA 1R0MA 4HMCA 5A6JA 5A6SA 1Q85A 5E6ZA 3RLHA 1GOWA 4MJ4A 2AOSA 1XJBA 3QOKA 3WG6A 5A6BA 3WQGA 1TYGA 2NV9A 3IIXA 1LL6A 3ZR4A 3NSMA 5JBFA 5LKYA 4FNTA 1C93A 1CGUA 4HN4A 1JULA 3WH9A 4HOXA 2Y2WA 4NNBA 1VFLA 2CLEA 1ITUA 1CLKA 3VDBA 3GXFA 1G4PA 2WM1A 3WUGA 3WD2A 5DQPA 1G9HA 4BWLC 1E0VA 1VFOA 3M0JA 4AEFA 1G7VA 1PIGA 4LXFA 3VC5A 1J11A 2INZA 5HBFA 3OBEA 4H04A 1O4UA 5A1AA 3TXZA 4CU7A 4A8LA 4CD8A 1QNRA 5GPRA 4W4QA 2JBMA 5HMFA 2VGIA 3PFMA 4LAMA 2QAFA 3EBVA 2ZRUA 2WSPA 1CBGA 5TAOA 2CW6A 2R6OA 1P1XA 3PBWA 4CCDA 5DO8A 2XN0A 5TF0A 4IQEA 4WK9A 3NM3A 4C6LA 4IOTA 5HPCA 1TPVA 5GNYA 3R12A 2PBOA 2ZOXA 5EB8A 2RUSA 4DWSD 1KXTA 4YJ5A 1XCXA 4MHBA 5CQ1A 4FIRA 3MI3A 4F48A 4K8GA 4KEZA 2B4GA 3M0YA 4P7RA 2BY0A 4HYWA 4ADSA 5C2CA 3C2FA 4EWJA 2J75A 4X0VA 4U5KA 1XLGA 3UZ5A 4HMEA 3TC6A 5K7JA 1GORA 3O1NA 2OOFA 3SM0A 1TE1A 1A50A 1TTPA 2E67A 3CV2A 3PWIA 5IBXA 4Q4SA 2BASA 3BCFA 4JICA 1JYNA 2PWUA 4O1CA 4UTWA 5BOEA 3SY5A 4JZ5A 4C1KA 1KNWA 4N2YA 2UY2A 1PSCA 1YKWA 2C1HA 3B04A 4IMCA 1FTXA 3MSYA 1AZ2A 3VX1A 1W17A 3QYSA 1UD3A 4XISA 3PM6A 3APYA 1HP4A 1GTHA 5EY5A 5K2ZA 1YMYA 4CN1A 3FS2A 3S2CA 2TAAA 3LCIA 3DG6A 3M5ZA 2VZVA 4DRSA 3IJ7A 2A1YA 2ODOA 1QW7A 3SUSA 4AZHA 3MI6A 4WSJA 3V5CA 1R85A 1EYEA 3IJQA 4UR9A 2GJXA 2PTYA 4B3LA 2VCAA 4E8CA 5K4XA 4H41A 4JTGA 4H9XA 2DT1A 5T9BG 2WPGA 2J24A 3N17A 5TIMA 3AUOA 3O2LA 4RE2A 5F1UA 4DLFA 1KTCA 1B57A 1F74A 1BXCA 3JUGA 1UR3M 1KA9F 3BTNA 1UA7A 4LS1A 3WJSA 1WCGA 2G3IA 1J0KA 3AXHA 2WCAA 4D9PA 4XUYA 3VZXA 1CXHA 4CVWA 5E9XA 5HNTA 1KWGA 3POCA 2WJEA 1A0EA 3FFSA 1TX2A 3SGZA 4XZ9A 4N9CA 5LSMA 4WEVX 3NVDA 1TWDA 4B2DA 2WO5A 1XBVA 3G5EA 4AAJA 3R1ZA 4NI3A 2Z7GA 5G2WA 1VFUA 2P10A 3KVKA 3LYEA 2X7VA 1J2BA 3D3FA 1R30A 4GUHA 4FXRA 2H3DA 4JIQA 2FZ8A 3T09A 2JKAA 2GVYA 4NAEA 2OX1A 2F9RA 2W4XA 3OLDA 2OYLA 2VGGA 3MBFA 3VCCA 4N9DA 5H6HA 2VFDA 1I0BA 4HK7A 4JTKA 3E3HA 2Q3OA 2IKHA 2RGLA 4EF8A 1C91A 3K46A 1A4LA 4O28A 1C3FA 1U1HA 1JRBA 2WNQA 1UWTA 3P6LA 4PSPA 4YL2A 1LWHA 3BWWA 3S9IA 3OG2A 4DUVA 3PBYA 2W63A 2VEMA 2WLYA 5ABFB 3M0ZA 2DSZA 4GZ7A 3TYZA 1EDQA 4ZOEA 2ZYFA 4FIQA 4AZ6A 1EPVA 3T0AA 3VTRA 3M7WA 1T96A 4O4WA 3BAYA 4IICA 4JDYA 7XIMA 1Y7VA 3G2GA 3LSBA 1H50A 2F2KA 3LHTA 2UY4A 4DBWA 4ZE5A 4UNIA 2C91A 4FALA 2C0AA 2Z1XA 2Z0IA 3W37A 1Q6QA 2YJQA 4B16A 3TQ0A 2DVTA 3VGDA 4UOJA 3KS5A 1CGVA 5G1YA 4M24A 3PAOA 4HN8A 3RRXA 1L2QA 3WMSA 4IGNA 1NAL1 1NDWA 3UCDA 3VZYA 4CNSA 4JX4A 4LJ3A 4BQ5A 3UNTA 4QJ4B 2Q71A 5CC6A 2PCQA 3C0SA 1ZBWA 1W1TA 4WY0B 3R8GA 3LERA 3PTMA 2VEPA 5BRPA 3ZLFA 2GWNA 4ZXLA 2WZMA 1XUUA 3TQPA 4PEEA 3KBMA 4NUWA 1OGSA 3UZXA 5AC6A 3HJEA 5CSSA 4YS1A 3WELA 4LEQA 5FKYA 2Z28A 5A8GA 2WBGA 5KETA 3N73A 4WGHA 4RE0A 3FXYA 4PCNA 3S4TA 3ALFA 2W79A 3SGGA 1XSKA 3K13A 1LZOA 4GZIA 5I3KA 2C16A 2GGHA 4DZAA 1OD8A 4A3YA 1X39A 4Z2KA 5LNUA 3G22A 1O94A 3W81A 3U4FA 1E73M 1BKSA 3IPWA 3NCOA 5D9MA 4N0RA 3LCXA 1B0IA 5DLCA 3B8IA 1NOUA 1QASA 3A4AA 3GFZA 1V0MA 4KESA 1QU4A 4C65A 4DJFC 1OGBA 1SVDA 1E1FA 2IMRA 5HPOA 1A4MA 5AKQA 1PAMA 4MAVA 4KWWA 4GQ0A 1AL7A 4KRUA 3FA3A 1AH0A 4KGJA 2OSWA 3GXPA 4HZ7A 5I09A 1PKYA 3O3RA 1QI4A 2P1FA 1WZMA 3BURA 3WL0A 1ZLPA 4PL2A 3AJXA 1O5RA 1AQMA 1BYBA 1TMLA 2IW0A 3UF9A 4LAUA 3W7RA 4R27A 1PIFA 3LI0A 1IT8A 4DO4A 4Z1DA 3MY9A 2ZZ5A 1EF3A 2IQDA 5KMYA 4QS5A 2R94A 3OGSA 3CPUA 4GVGA 2DSWA 3U2CA 4IXHA 1B1YA 3VDHA 3N12A 3IJ8A 1J93A 3LU2A 1IGSA 4QLLA 3B4YA 2R24A 4INFA 1HX0A 2X1UA 1R3QA 2ZXAA 3PBVA 1VEPA 5CEWA 3APTA 1TWWA 1OG6A 3U7BA 5AC7A 2NXHA 1KW1A 1JG9A 2FGLA 3IEBA 2FQIA 4AC1X 3G1AA 2FGZA 4PE8A 1VH7A 1G7UA 3EWCA 8XIMA 4O19A 2WQDA 2OSYA 3QMRA 3H4XA 1UPMB 4K6AA 2A7NA 3H55A 4HNLA 1DIOA 1SW0A 4WD0A 3O0KA 3QC0A 3W7GA 4JY8A 1KGWA 4OBSA 4RDVA 3ITGA 1J5TA 4TX6A 4LVGA 5HANA 2PDPA 2YW3A 1DQXA 2EEXA 2G3FA 2NLYA 2MANA 3ECQA 4UFHA 2WZTA 4E3VA 2NXIA 1GZ1A 1OY0A 1VQTA 5AHFA 4OV9A 4DYEA 3STGA 1TJ2A 2ZKMX 2YDQA 5CLWA 5J8LA 1YTKA 1AUSL 4AYSA 5AC4A 3PG9A 3N15A 3MJMA 1RQBA 1GQKA 4HP5A 3FAXA 3U7VA 1FDJA 4LVFA 4RNFA 3URNA 3SADA 3QTPA 3RM4A 3FW6A 3WF0A 3V5FA 4Y96A 5IFTA 1JCNA 2WW5A 3CQJA 3R7MA 3N18A 1UJQA 5DT7A 3NJ3A 4O1AA 1FH9A 4IHCA 3H54A 3BG3A 1M41A 5F4XA 3O06A 3A24A 1ECQA 4WSHA 3PS7A 3VDAA 3OBAA 6TIMA 2QR6A 3LB0A 3WCZA 3VDGA 4GC4A 5U7SA 2HS8A 2VFEA 1VC4A 3OB8A 3EOEA 3Q37A 1RK5A 3N6HA 1L6FA 2J7GA 3U2ZA 1VBGA 4GH3A 1H62A 2PD5A 3KAOA 1U5JA 5AOUA 5FJJA 4NJIA 1YPXA 5I77A 1QFEA 2F6KA 1T41A 4W5UA 3WD4A 2VURA 1S1RA 4Z2GA 3N04A 4JPGA 3ZYZA 3DHFA 3MHFA 2GOKA 2ZFAA 3HPZA 1ZFJA 2WK2A 4XK2A 1N7KA 3IANA 2ZXDA 1T7LA 3G3MA 3UW6A 3G1YA 2D2JA 3AS1A 3LHVA 4AVFA 2Z2UA 1P4CA 2FHCA 1ZQ5A 3L5MA 3WQPA 2V2DA 4NZ5A 4EF9A 2PGEA 2E7FA 4ERIA 2ZDRA 4LVBA 2HE8A 1RPKA 2X2GA 1CZ1A 1OABA 2EQDA 4DAFA 3GKFA 3BMXA 4AMCA 4QG8A 2XTKA 5FF7A 3ZSTA 4DWSB 5FEWA 3W2UA 3A4WA 3TN6A 1XPGA 1W1YA 3RPDA 1M3UA 4J35A 3MP5A 4NU7A 1JPMA 3EWZA 5FACA 1IEVA 4H8UA 2W66A 2GOUA 1MFUA 4O53A 1GJPA 2QYGA 2O9PA 3C0QA 3UWEA 3DBNA 3QPZA 2OWWA 3UJSA 1UR9A 3PTQA 1RR2A 3LA4A 3W1TA 3F4WA 4LWWA 1GHSA 3NPUA 4OT7A 4BEUA 5B7ZA 4IMGA 2H6RA 4FHAA 1PIIA 2QV5A 1HKIA 4I8YA 3FK4A 4XZNX 5CSYA 3PFRA 5CJMA 3UXLA 3P14A 1WKEA 5LXEA 4OFCA 2VOMA 1HP5A 3P93A 3SCSA 4F0LA 3LN3A 1QW9A 3PBGA 1CIUA 1I2RA 2E28A 4BHYA 1C7TA 3SJ3A 2HCVA 1NOFA 2VFFA 2GDVA 2R1NA 3UVAA 1J0HA 4ZO8A 2G8ZA 4WIWA 3ITTA 4JNMA 4YCOA 1JFHA 1HKKA 1I2QA 3GR4A 4MGGA 4WKAA 2OELA 6TAAA 4XTDA 4GE8A 1JNDA 1UCWA 1VP5A 3EX6A 4RDYA 4ZOCA 2PA6A 4GNVA 5K4ZA 4KCWA 1AW1A 1TR1A 2PDKA 4O17A 4RJEA 2ALDA 3C3UA 3S83A 3CZEA 3SCWA 2PCEA 5LNSA 2NVDA 2X0SA 4TXEA 1VHNA 4HNOA 3SCNA 1W3KA 4K7VA 4QR6A 1AFSA 5E09A 3VD3A 4BY3A 4DJFD 1C8YA 1XM3A 5H1WA 1IXPA 2YL6A 3WJXA 4A21A 3G1RA 1BVNP 1TIWA 1OD0A 1XH1A 4FLSA 4QTGA 1VGAA 3WFAA 5EU9A 1TPFA 5LIXX 4QQUA 1K6AA 4AEEA 3AIQA 3QQ1A 3MUXA 2NWRA 3OVQA 4J2MA 2VFGA 4RNJA 1W37A 1GVYA 2W91A 3HA1A 3RR1A 2E5BA 3SIMA 2FPYA 3HURA 4D6CA 4FXJA 4IUGA 4B3KA 3RITA 4Z0JA 1TO3A 3SCPA 1TV2A 4R7OA 4KWOA 4AD3A 4MLJA 3A3HA 1NDVA 2YFNA 1BTCA 2OGJA 1JF5A 3IIZA 5MKGB 5EL1A 4Y6GA 4TO8A 2J88A 1I1XA 2WV8A 2OXNA 1Y5VA 3A47A 3O8AA 1PKLA 5DMYA 1JUKA 2BHYA 3TJ4A 3WLMA 3ARZA 2RJHA 3KLKA 5FI8A 2YLAA 1M9HA 3T2PA 4C6CA 5REQB 1A5OC 3NO5A 1GW1A 3EX2A 4L4OA 3PZIA 3DI1A 5JQ9A 3SRDA 3ZZ1A 4YVPA 4AZBA 1KR0A 4FXFA 2V3DA 1OC7A 4L9YA 4EANA 3V75A 3RLVA 1GUVA 3TAOA 1WUFA 5CCZA 1PDZA 1LL4A 2VZUA 3PZ9A 3S1UA 5A95A 5K9XA 1KM3A 4A8NA 3AROA 1YDOA 3N11A 3MCNA 3HG2A 2CYGA 2QLYA 5D8WA 3EWYA 4OGZA 2TMDA 2JIWA 4ZGYA 3P82A 3VOHA 3S5SA 4X63A 1PYMA 1F3XA 3UZZA 2YR1A 3PPCA 1Q6CA 5HAOA 1H41A 2Y88A 3N1AA 4RZBA 2O9RA 3URBA 4DI9A 3DGBA 1VBJA 4D6EA 1NTHA 2I5QA 3BW2A 3N4FA 3LGDA 4ZSUA 4US6A 3VD5A 3NR0A 3W4RA 1UZ1A 1EJRC 4FI4A 3DC8A 3L0KA 3I7RA 1DWGM 1JZ4A 3GG8A 1HJXA 4A29A 3BCDA 5A8MA 3P61A 3JZEA 2JQXA 3TX9A 4CD5A 3TC3A 2P3ZA 3E0VA 5CZSA 1BVZA 3VGFA 1SM9A 2A2IA 2NT0A 5FF2A 4GYFA 1AA1B 3UESA 1UD6A 4LAZA 2YCIX 3XIMA 2PD9A 3H2MA 4E5TA 1YBQA 3GXIA 5G1TA 4DIAA 3A5FA 5BXSA 4PGLA 3A12A 3O6CA 3P62A 2WMKA 4S1FA 1KRMA 3WQ6A 2R82A 2ADAA 5HINA 4LVDA 2QJMA 1X6UA 5JVLA 1QNQA 2BZNA 3LG3A 4B5SA 2Y6ZA 5I6SA 2PF8A 3TTQA 3W2MA 3D46A 2DT2A 3SI9A 3U57A 1XI3A 2A6LA 2W9MA 4NJJA 2R1LA 4FP1A 3DIPA 1Z41A 4NIRA 4JS3A 4AXNA 1E1CA 1U1JA 4IMAA 4L64A 5KEZA 2D0GA 4PMJA 3T81A 3LENA 1VFSA 2ACQA 1RHCA 3B8WA 4N02A 2E8YA 3WH5A 4EXAA 4JTRA 1UG6A 2E6DA 4GOAA 3GR8A 1JCLA 1ZBVA 2WM0A 1VCGA 2W61A 1J8VA 1LBMA 4NXKA 3IK4A 4CNUA 5DN1A 1MUWA 3CHVA 3WJZA 1ZJHA 2XSAA 3V3WA 3KL5A 2PDYA 2CZDA 3ICJA 3JVAA 5CPSA 3HQNA 4R9XA 1Z6KA 4YWSA 3WL1A 3RN6A 3NZPA 3BAIA 1YBQB 2RDUA 3NTYA 3SIZA 1EC7A 5AVHA 2QUMA 3HFTA 1JAKA 4P8WA 5I2UA 4E2VA 4MIMA 2BBFA 1GCYA 3RF9A 2PU1A 3W1NA 3TAKA 1H7RA 1CLXA 4M56A 2V30A 3ZT7A 2VCCA 3IJIA 3W1UA 3PP7A 3F2BA 2F6XA 3BLIA 1Y5XA 4KQNA 3EDEA 3MSRA 3ZIZA 2EJAA 4XAFA 3WEMA 4Q4KA 2OT1A 4IXXA 1HJSA 4HSNA 1XLIA 2WJZA 2A5HA 5BOFA 3CPGA 3SRHA 3LCFA 1KR1A 4AW7A 3W26A 2B0MA 2ZQ0A 3E2QA 5C70A 1EC8A 3WEOA 4MB5A 4H6KA 1Y5WA 4HB7A 1ZB5A 2P53A 4BA0A 4CQ9A 1K03A 2ASHA 1DWFM 4GI4A 4H83A 2NQLA 3VMNA 3WLKX 3WK3A 4UTTA 3T4CA 3U48A 1SW7A 4OUEA 6XIAA 4WX2A 4HPHA 4K7YA 4BI6A 3SR7A 3BAKA 4F3HA 2XWEA 2X05A 4LH8A 5HULA 1JZ8A 4MKVA 4CCCA 2QIIA 5HNNA 3TLLA 1BYCA 1TX0A 3T42A 3W70A 3UXKA 3XISA 5IXEA 2WB5A 5I7GA 4Y2WA 4O8AA 1X1OA 1H1NA 1WDPA 5A8NA 3APGA 1EX1A 2J6XA 4H2CA 1FWCC 4L6OA 1H09A 1S2UA 4YHEA 4GPNA 2W92A 5CPLA 1UIOA 3TW9A 2VZSA 2VZTA 1VJZA 2BVYA 3KZSA 1DJHA 4HZ8A 3MYPA 1WYIA 1GTEA 5LIYX 3VOGA 3WMCA 3NQFA 1SO5A 4GUGA 2ZZ4A 4ZL1A 2NW0A 3AYRA 3MKCA 4NHVA 3K5XA 2CLHA 1US3A 2CBIA 5A5WA 4ZZ9A 4OECA 3B0UX 4MB3A 3RJYA 2NQ9A 3R8RA 5HQEA 3EMZA 4MTVA 1GKPA 1NWUA 3ARWA 3EDJA 2OO6A 5K3VA 4TTGA 1F07A 3PF3A 3LV6A 4LANA 1FCQA 3SQMA 1IZKA 1FP8A 4GC3A 4NG3A 3BJSA 1P7TA 3K8MA 3SRFA 1XYLA 1G5AA 4JCLA 1K9TA 1L2UA 2WMFA 3UPWA 1E71M 4A6GA 1FWJC 1LRQA 3KVJA 4C6PA 4K37A 3AMCA 3RMEA 4NXSA 3TW6A 4Y9OA 5IOBA 1KFLA 4JFWA 4IMFA 1BSIA 2EKGA 3QXBA 1ELSA 4C6BA 3TMQA 3K1GA 5D2TA 5IHSA 1H63A 2VUNA 5EMJA 4Q6XA 4XSMA 2Z6IA 1F3TA 3T4WA 2PF0A 1F05A 2YBVA 4BF7A 2Z24A 1UH2A 1JCXA 2BY2A 3GNDA 1WE5A 4O12A 5ECUA 3LBCA 3PUGA 1U33A 4UWMA 3W7NA 3EWWA 2ZRZA 3S1VA 1XPYA 4JTLA 4J3VA 3W6LA 3QV6A 2CBUA 3D6NA 3II1A 4UXDA 4CN6A 4HA0A 2EGZA 4C6NA 2ZVIA 4E8GA 3W7KA 2Z2AA 3AU6A 3MUY1 5CC7A 2XVKA 4QIUA 1FP9A 2XDFA 1GNXA 3QGKC 3C2EA 1VFTA 4KCUA 3UYIA 3UXAA 1D7FA 4Z1AA 1B5TA 1EXPA 2Y1HA 2V68A 2A7RA 3S3GA 3L4YA 3KOYA 1XYZA 4HPNA 5LA0A 4UMBA 2Y4SA 4K1GA 4H4IA 1V4YA 4JFTA 3ZSSA 3T07A 3U5UA 2DH3A 4A4AA 1ME9A 3NZRA 3GR7A 4OBTA 1SFLA 5AC8A 4IPJA 2OQHA 4MWAA 5LGZA 1TVLA 1SMDA 4F66A 4GWEA 2PRHA 1S3HA 3V1PA 1OFBA 2GVLA 4LAOA 1LG1A 3BJTA 3VKJA 3IUIA 1GYLA 1ADDA 3VIJA 2HMCA 2CHNA 1A5UA 1WUEA 4R5EA 3U3HA 1C29A 1A5KC 1RXOB 4JTAA 4URIA 2P5NA 1FUYA 2I16A 1F8MA 5AY7A 2DT3A 1BYDA 4GA8A 4J3WA 2ZRVA 3N3TA 2PI6A 2RAGA 2D69A 4JHOA 1R3YA 4NT0A 4NZJA 3STPA 4YYFA 3QZ6A 3ZVHA 4W87A 1GONA 1GVIA 5DFAA 3T78A 3W9ZA 4JKMA 4AIOA 3L12A 3THQA 3OLGA 1X6LA 3GTFA 5FEXA 1FFRA 2NSOA 2FZDA 4QITA 5CPNA 4AWUA 4DBDA 2C6QA 2ON3A 3MO7A 4HZMA 4BFAA 1RJPA 5BZAA 1F9CA 1WKYA 3MP3A 3W7LA 3KRUA 1MSSA 4GZJA 1XS2A 1A5LC 4JL2A 2I7GA 5DBUA 4J3TA 3GTXA 2PWVA 4H6EA 2VENA 1LLZA 4XZIA 3S47A 2ZIDA 3GAYA 5F4WA 3NQGA 4QSHA 1UR2A 1U30A 2XIQA 3CLWA 3UWUA 1OGGA 4L6HA 4FF7A 3AIUA 1JZ6A 1EO7A 3WQDA 3GNPA 1E4MM 3NDYA 4G56A 4DQWA 1KB3A 4OOZA 3ZJ8A 4PRWA 5C9ZA 3UT0A 3CTTA 1KCKA 4G9PA 3PY2A 4M6VA 1OFEA 4WXYA 3OIHA 1IT7A 4ATDA 5EYWA 3ZVHB 3GQYA 2IQ0A 1BFNA 2IQTA 2BV9A 1F5ZA 5CH9A 2ATMA 5BXPA 3LLFA 3BLFA 5AHNA 3B9EA 1PB0A 1B9ZA 3GVGA 4JKKA 2QCCA 4PMUA 1GEHA 4Y9AA 1FDZA 5F7UA 4XO7A 1MDLA 3S46A 4DXVA 3WQ4A 4DYKA 4EOUA 3RYSA 1VJSA 1VHCA 3PAJA 2Z1BA 4U33A 3CZ8A 4PSRA 4L61A 1TUXA 1JZ5A 3EOUA 3ME3A 1ZL1A 2JK2A 2PPGA 3O63A 1YX1A 4YHGA 3UR8A 3USZA 4E4FA 3BL3A 1KM0A 2A7PA 4GFSA 3MYOA 4H9TA 1FWTA 2W27A 4GYPC 4REQA 4NJHA 4UTJA 1ZP3A 1SFSA 3GIPA 4QNWA 3DHDA 3W38A 1K77A 3HGRA 4C6MA 4PL1A 9XIAA 5GJPA 2GPTA 3ORWA 3UNDA 3FDKA 4MM1A 4J9JA 2WAGA 3EX1A 1GOMA 3NFUA 1FWBC 1UC5A 1F4AA 1UR0A 1ZBKA 2JGQA 3EWBX 4HPJA 2BB0A 5FA5A 2DH2A 3O9NA 3W76A 3OU8A 5AYBA 1YRRA 5KTLA 3RILA 4AIUA 4Z2LA 2WLZA 3LK6A 4HYVA 5M3WA 1V3IA 5EFFA 4K8HA 5EMMA 4IP5A 4JBRA 1HW6A 2BDQA 3U9IA 1I2PA 3TOYA 1E9ZB 1XHGA 3LHUA 5I02A 3B03A 3KE0A 3WD1A 1PL9A 1E4IA 4OWGA 4I9MA 2D0HA 2OOGA 4HBKA 5JU6A 1KBLA 4EKJA 1YTEA 3AHVA 4AC7C 3GDBA 1KBIA 4AX7A 7PTDA 4DF0A 3IJDA 3OGVA 2WC3A 5D33A 1XR2A 3IV8A 2YGYA 1RP9A 3DFPA 3UVIA 3TV8A 3TKFA 4WSKA 3T44A 4C5YA 1POJA 1H7XA 3B8UA 3D5HA 5BXRA 3VIKA 1XIHA 3Q67A 3VMPA 4MVAA 3CUGA 4KEVA 1QBAA 4UOZA 3LNMA 2J7FA 3DUGA 3IUDA 3W02A 2WPBA 4XBKA 3F2DA 1OYBA 4FOJA 3GW3A 3CMGA 3TYEA 4NVTA 1YNQA 3O07A 1E9YB 4HHMA 1HJQA 3AYTA 1XBYA 1HL9A 2DZVA 5CC3A 2CXGA 1NFGA 4GZEA 1TJPA 1H7PA 3CEUA 3W1LA 3ITYA 1Z48A 2D2GA 4F2TA 2QUVA 5AYIA 2DVUA 4XZMX 2ISFA 3ZJ7A 1FXQA 4PZVA 2LLEA 2OGYA 3WBYA 5A6AA 3HFYA 3COTA 4DJED 2VR2A 5GNZA 4IP4A 2TYSA 2ATSA 3CUXA 1Q2RA 1UOZA 1XLFA 2XHYA 4Q8QA 3SEPA 3AHZA 1LJYA 3EWXA 3T2QA 2EBNA 1X96A 5CXPA 2W67A 4WCJA 1MW2A 1HGYA 1M7PA 3WBAA 4US5D 3QJAA 1SR9A 3UA3A 4PFMA 3RIKA 1BPLB 2D0FA 1H1YA 2WXDM 3SCQA 3R8HA 1ZHAA 2CWXA 4Z2HA 3TJIA 4D6DA 2AL2B 4IX0A 4DZIA 2PDCA 1LG2A 1GVQA 1P6CA 3MCOA 2Z25A 3HBLA 4HD5A 1B9BA 1YXDA 3EPMA 1M1BA 4E0CA 4PB3A 3WUFA 2CLOA 3TOPA 4CQAA 5HWNA 3LI1A 4WR3A 2ICSA 4Y9NA 1I9CB 4KBXA 4GI6A 2W6RA 3XINA 4O1EA 4S23A 4ZEPA 3QGAC 1XQLA 1LDCA 4N6EA 3W7QA 2PS2A 1FVPA 2HS6A 1RY8A 3RHGA 3BSMA 4MB4A 2JKEA 4FLQA 3BLEA 3VOFA 2Z27A 1B3ZA 2C7FA 3L2MA 4PFHA 3LS9A 2WC7A 4PUMA 4WJ8A 1XC6A 5DF0A 2CFFA 5LYRA 3UGVA 4KGLA 4H7CA 3ZLGA 2XVLA 1SO3A 2DP3A 2DZUA 3WMBA 1N2VA 1HG3A 3FV9A 3ZJKA 2PTZA 4M80A 3AIRA 1IXNA 3AS2A 3GVWA 1A5AA 4HHHA 2HK0A 4ZA0A 1JNEA 3IIOA 2G0WA 1WBHA 4KETA 4FZIA 4QSFA 3URAA 4RW3A 3PUDA 3PNUA 3N19B 1MQRA 3LPFA 3NZ1A 2OCZA 4FNQA 1TREA 1S46A 4MYAA 4WDWA 1OEPA 3E1F1 3UZYA 4F40A 4H9MA 3RLUA 3C56A 2CBJA 3OIXA 4YXGA 3ANUA 5DT5A 3ZT5A 4H9UA 4ECLA 1THFD 4AWEA 3MMWA 1UKPA 2QCHA 1FXPA 3E2SA 2OKTA 3L4ZA 2BVTA 3VD7A 2GVGA 3UCCA 3WK2A 4H7VA 4TMBA 3I3DA 4GIEA 4KF1A 1TRIA 1WZLA 2P8BA 2QPSA 3OJGA 5XINA 2OZ8A 2CLKA 4HK6A 1DPMA 5I5RA 4PYSA 2R8WA 3KZPA 3UERA 3VIFA 3B97A 4DVOA 1PDYA 5FF3A 2X41A 4LBUA 2X8RA 4DM1A 4NQ1A 1FWIC 3KFTA 2O9TA 4AD2A 4EPEC 4C6EA 3G8RA 3W72A 4LALA 1V77A 3BMVA 5M17A 2IS7A 1E0UA 1QPQA 2PLJA 1XISA 2OLAA 1RAKA 2Z26A 5FESA 3Q2DA 5A2AA 4R3UA 5DCEA 1KBJA 2VD8A 5KZDA 3TCEA 4ERAA 5D38A 1FCVA 2I1OA 1G01A 3EKZA 1F8IA 3H7VA 4DI8A 2OVLA 1TVPA 2J9ZA 3PZQA 3AIBA 4FF5A 4N7QA 1RD6A 1JIBA 3MSDA 1O1HA 5C55A 4Q8MA 2GGIA 1GJUA 1NSJA 2OR2A 3SRKA 5B7YA 2PC4A 5C9XA 2OX4A 2CCRA 3MMUA 1SJCA 1REQA 1EUNA 4QS6A 6ENLA 1NH6A 2GLKA 3I68A 4KEMA 3ZWSA 3S42A 3Q65A 1XC4A 4AIEA 5TNVA 1JCMP 3FHAA 4HU0A 3EEZA 3R43A 1T99A 2EPLX 1RY0A 1FY6A 2VFHA 3SUTA 3K8KA 2D2HA 4IF2A 3MKKA 2B7QA 1E70M 2GQ9A 2V5BA 3NYDA 4OV4A 1BAGA 1EUAA 1JI1A 4XVEA 1VFMA 4JYFA 4ONVA 3UG5A 5HUOA 5H2ZA 4CQDA 4I3GA 3ZVIA 5C71A 3IIVA 1XRSA 3B06A 4L7ZA 1LQ0A 4W7UA 4ZB2A 2V5KA 1FHLA 3ZMRA 4BQ2A 3NEHA 2R1PA 4LY8A 3AISA 4KERA 4RNHA 1MZHA 3V36A 3ZR6A 2MUCA 3HPSA 1D9EA 3BXWA 3W75A 1FFQA 3NNTA 3GX9A 2NLIA 2ZX5A 2DU2A 4I5RA 2VXNA 3VD4A 2VJXA 3FVMA 2WKLA 1FHVA 5G4HC 1C92A 1W3JA 2O4QA 3HJZA 4UQAA 1NP0A 4JD4A 1OADA 2NX1A 1CDGA 1E4NA 4P8XA 5CJNA 1EDTA 2YCLB 3SB0A 1D8CA 4QG9A 3FGCA 3BK0A 2FLIA 2FTPA 4L1XA 2AGKA 3GTHA 4O0ZA 3OHMB 2PLKA 1P6WA 4K39A 1I2NA 4XZHA 5DMLA 2DIJA 1FKWA 1MFVA 1ALDA 1OSEA 3MTWA 3TDFA 1XLCA 3MUCA 5J04A 1TV3A 4DF2A 3LY0A 3R4IA 4ADUA 1LCOA 1DP0A 2QAPA 3ABSA 2A3CA 1DORA 4HOZA 4QISA 3CHDA 1XYMA 4DXKA 3UY8A 5A69A 4W93A 2XH2A 3KBWA 2DGAA 3EMCA 2V3GA 5I3FA 2WSYA 4GRSA 4MOZA 3WBEA 1DJYA 1UJPA 2XH0A 1LF1A 2FH8A 3AIEA 1H3GA 1QUMA 4LU0A 5HMSA 4FOKA 4GKLA 2TSYA 4C6JA 1T0OA 1P0EA 2OWCA 1H0IA 1HVXA 3IAQA 4PMRA 3PSVA 2PWHA 1W9UA 3CZJA 4JN8A 2DSVA 5AYYA 2QMKA 2I57A 4ZTYA 2YA0A 1AD4A 3D0CA 3TR9A 2V5LA 1U5HA 4PTXA 4GIYA 4UTLA 2PMQA 4GI9A 5DRIA 1Q6LA 5CAKA 1V79A 2ZADA 3IJ6A 1J4EA 4JTTA 3LPOA 3LZ3A 2ZDSA 1OCQA 4D2JA 3C3NA 2H8ZA 3KRBA 1SMAA 3SSJA 1JZ2A 2OEMA 5KITA 5F4SA 4HOWA 3HB9A 4N4QA 3N9RA 5JUVA 3MANA 4NRRA 3E74A 1UB3A 1TWZA 1DJWA 4AZCB 3ARPA 3RX4A 2IKGA 3SN0A 4PTWA 3O05A 1XICA 4Y8EA 8A3HA 1YYAA 1TZZA 1V02A 2WWCA 4CKQA 4G2DA 5LNRA 3N4AA 2DZTA 4I9AA 4KWSA 3CAWA 3S1WA 5CGTA 1E3XA 4B5NA 2X1RA 4JX6A 4M82A 3THAA 3PZGA 1Z42A 3NXFA 4MJZA 3GC4A 3TFCA 3RX3A 4D6JA 3WYZA 3UWWA 1SQ7A 4B91A 1E0TA 1R7AA 1A47A 4PTDA 2YBTA 3OEXA 4PTMA 3PR2A 3GTNA 1RBLA 2ZTKA 4S2BA 4FNRA 1F73A 4YU1A 4A2SA 1E6RA 3KHJA 3O6YX 2CHOA 2DEPA 1Q8AA 2D23A 4RKAA 2SFPA 3RR4A 3WLHA 1R3RA 4R85A 4ZE4A 3HPFA 3LHYA 3W2NA 2XIIA 4YVVA 2ZVRA 3S2JA 1ICQA 5BNKA 3L21A 1QI2A 2IKIA 3FNDA 4UFIA 2WMIB 2YXGA 3GUGA 2F61A 1UMYA 4CEXC 3MWCA 4FOUA 4RV8A 2DZXA 4LBRA 4UFKA 1PKMA 2VUYA 3KTSA 1K3UA 3L5AA 3LHWA 1UD8A 1FHUA 2WVUA 2ZTJA 1DTUA 2NQHA 4MZYA 3C8NA 5FF4A 4ACZB 2DSKA 1GQJA 3HOJA 3NL5A 4XO6A 1ME7A 3ARRA 1YE6A 1BQCA 5BROA 3HZ3A 3DCPA 3LX9A 5I3HA 3W71A 4UMAA 1L6WA 4B5VA 1AH4A 4JTFA 2Q09A 1FCBA 1P0DA 1PS9A 4V1XA 4DUOA 5I00A 2VVNA 4JOMA 1F4HA 1XWYA 3ARYA 3ZOAA 2BXVA 1YNYA 4ZR8A 2CZVA 3R11A 2C19A 4I8DA 1Y8BA 1P0BA 4PA8A 3UZWA 3W53A 1WAWA 3EYPA 2QHAA 3QRHA 2VQTA 1BG9A 1K70A 4WGXA 3UU0A 4P7QA 4GG9A 3BCJA 4JTHA 3UWQA 4O1DA 3KBVA 3TONA 4XD3A 4FNPA 4M5PA 3IVTA 2ZBTA 3K2GA 2BODX 4M0XA 5D04C 4B9ZA 1AL8A 3HG3A 1MEIA 3C2YA 3DDMA 3TROA 4LV9A 4D6HA 3CMJA 1XCWA 1PPIA 1V7AA 4FK9A 3WNLA 7REQA 2E9BA 1VAHA 3RCNA 2INFA 4JTDA 1NIUA 3FSUA 3SGUA 1WZAA 2OWXA 3EB3A 4XKYA 3MU7A 1W56A 2VD9A 1S3TC 4CNOA 1WOAA 4UIOA 4HHLA 1IYXA 2FFCA 5A6MA 1N82A 4JIIX 4PMOA 1UZHA