2Y88A

Crystal structure of mycobacterium tuberculosis phosphoribosyl isomerase (variant d11n) with bound prfar
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
244
structure length
244
Chain Sequence
MPLILLPAVNVVEGRAVRLVQGKAGSQTEYGSAVDAALGWQRDGAEWIHLVDLDAAFGRGSNHELLAEVVGKLDVQVELSGGIRDDESLAAALATGCARVNVGTAALENPQWCARVIGEHGDQVAVGLDVQIIDGEHRLRGRGWETDGGDLWDVLERLDSEGCSRFVVTDITKDGTLGGPNLDLLAGVADRTDAPVIASGGVSSLDDLRAIATLTHRGVEGAIVGKALYARRFTLPQALAAVRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bisubstrate Specificity in Histidine/Tryptophan Biosynthesis Isomerase from Mycobacterium Tuberculosis by Active Site Metamorphosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
molecule keywords PHOSPHORIBOSYL ISOMERASE A
total genus 95
structure length 244
sequence length 244
ec nomenclature ec 5.3.1.16: 1-(5-phosphoribosyl)-5-
pdb deposition date 2011-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00977 His_biosynth Histidine biosynthesis protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2y88A00
1AK5A 3TMLA 4EVZA 4JXCA 4UR7A 4N9EA 3PM6A 3W88A 2PCQA 3TSBA 1F73A 4P2VA 2JGYA 4NQ1A 2NXGA 2DZWA 1W8SA 5T26A 1OYCA 3MW7A 3NYZA 1OF6A 1OFPA 1NAL1 3G0SA 2Y61A 3L5AA 2FTPA 2RDUA 2ZZ5A 3IIVA 1RQEA 4ML9A 1DL3A 5DY2A 1B3OA 3CIWA 4A2SA 4DBEA 5C6MA 3KOFA 4UXDA 2WSQA 3E02A 3FIGA 3LV6A 4DF1A 3W1MA 3M5ZA 1UB3A 2P10A 2BZNA 3G1HA 4DO4A 3NQFA 2DZUA 3P80A 2ZBTA 5BMWA 4UTUA 1OFEA 1Z42A 3Q94A 3FEMA 3EEGA 3TFXA 4P61A 1QPQA 2ATSA 1W5NA 3OVPA 3O6CA 2E6AA 4WY0A 4NJIA 5ABTA 2FIQA 2H3DA 4I7UA 2NXIA 4U4MA 2FB3A 2X1RA 1ME7A 4Q33A 3W3OA 4NJJA 4JR5A 2HS6A 5KZDA 5TBOA 4FHAA 4UTTC 4O28A 3DI1A 5F1VA 4WZHA 2ZTKA 4GUFA 1YXDA 1GTEA 1OFQA 4OQVA 2A21A 5K3VA 1K7XA 3P7YA 5MHBA 3HGOA 3T7VA 2E6FA 3G3DA 1KV5A 4GUJA 5G1TA 5I3KA 5LGZA 4ORMA 4UC5A 2V5LA 3LX9A 2QCGA 3CU2A 5K9XA 4NT0A 4UFKA 2NV2A 1OVDA 4O50A 4MIMA 2C1HA 3LCIA 1DBTA 3TC7A 2WNZA 2HMCA 4HT3A 4MYXA 4M6VA 2Y7FA 3STFA 1MZHA 1G7UA 1G7VA 3JRKA 3PB2A 1BTMA 1GG1A 1VQTA 1GYNA 1FQ0A 1YDNA 2WJZA 1KFBA 3RLVA 4O8RA 4O1BA 3ZFHA 1WBJA 5D2WA 5U7SA 5CG7A 4N2YA 4KWWA 3TKFA 1F5ZA 3GLCA 4WY0F 1H62A 5FF4A 2C15A 4UTWC 1GVSA 1VH7A 4LWWA 4UFIA 3Q58A 5H91A 3MHUA 2VC6A 1YADA 4JGDA 2P1FA 2DJXA 1QNVA 3QMRA 1Z44A 1OX4A 1XUZA 3LTPA 1FCBA 3INPA 3R12A 3W1NA 1H7RA 1XBZA 4NZFA 1H61A 1ZJIA 3UNDA 2Y6ZA 2QUUA 1W5QA 4EOUA 2G95A 4XTDA 1GZGA 2VEPA 4ICNA 1G67A 3P81A 2TMDA 3UWUA 3UWYA 3WJXA 1ZFJA 4JTSA 1OYBA 1JQXA 4GJ1A 4BF9A 4QNWA 3BK0A 1Y0EA 1UBSA 3FKRA 1OK6A 3GXNA 4JTKA 1E51A 3B0UX 3KVLA 1C29A 4UMBA 4M6PA 1GOXA 1C9DA 2YFNA 3PAJA 4UMAA 3BO9A 3A5FA 3NQEA 5KZEA 2A7RA 3LTSA 1JCYA 1DJNA 2ABAA 5FEPA 4XKYB 4AWUA 3LHYA 3PUOA 5IM51 2YDAA 3MHGA 1SW0A 1FCVA 4RLIA 1F76A 4XQ6A 3W1QA 1IF2A 1OX5A 2E6DA 3GXPA 1L2UA 4EF9A 2FB2A 4N9BA 4LUJA 1WX0A 3CQ0A 1FWRA 2OX1A 4RX0A 3P82A 1LBMA 3NL3A 3DU0A 1AL8A 3VFLA 1W0MA 3NQVA 3O6DA 3NPXA 1EP2A 1VRDA 3SSJA 4OV4A 3M0ZA 4A3UA 2KZHA 2VKZG 1DV7A 4HPJA 1W5MA 4Q4KA 1P5BA 1LP6A 5G4WA 4M19A 2JKAA 1FX6A 1WAUA 1WOBA 3IIPA 3W7LA 4PL1A 3W7KA 4R53A 3MP3A 2FLIA 3W2KA 2DP3A 3QC3A 1XI3A 4FXSA 4H4IA 1I8JA 4MKNA 3HGJA 1ZAIA 3RNDA 3VE9A 1DHPA 4JD4A 1EPXA 1H7OA 3LCLA 3QPZA 4N6FA 4A29A 3QSRA 5F2GA 3KVMA 3C52A 2Y85A 1JJKA 1PHWA 1ME9A 3UXAA 4ZL1A 1EIXA 5D04C 3MI3A 2XN0A 2YPIA 3TSMA 3MP4A 4DBDA 5I3IA 2E68A 4WOZA 2W79A 3TNOA 4GC4A 3T55A 2GPTA 1RPXA 5E93A 2WSRA 4RK8A 1DKWA 4Y6GA 2DZVA 2JBMA 3OA3A 2EKCA 3B8DA 5CPNA 4AVFA 5CZ0A 2OZ0A 4RKAA 4WXZA 2A1YA 5TQLA 2H8ZA 4A22A 2NUXA 3W1PA 4JTHA 3N3MA 3GNNA 5AYXA 3GR8A 3K30A 3MO7A 3IIOA 3LRMA 1ME8A 1PHQA 1YYAA 3C61A 1UCWA 4QM1A 4E0CA 4IMGA 2GQ8A 4FEZA 2VENA 4AEOA 4JDYA 2NLIA 1TPEA 2GVJA 3USBA 4X3ZA 2VFHA 1ONRA 2Z6JA 1WA3A 2A0NA 5G2WA 3CM4A 1EB3A 3EX2A 2VEIA 3W73A 2ZFAA 4LVDA 3BG9A 3C2FA 4UTJA 2ZZ4A 4N9DA 4DELA 5HNRA 2DU2A 1K8YA 3T78A 2IQTA 3P61A 3M41A 4ADSA 3LCWA 4LVAA 4UFHA 4CCDA 3W74A 1AW5A 2QCEA 3SY5A 2RDTA 2B7NA 3LHUA 1L6YA 4KKXA 1PCWA 4N9CA 3TROA 3ATZA 2ISVA 4PTNA 4LTSA 2XN2A 2O7SA 4K37A 4NXSA 5LNRA 3UQNA 5AB3A 3TK7A 4JICA 3KVKA 1RZMA 3P74A 1AW2A 1VPXA 3N2XA 3LV5A 4O1CA 4H3DA 1W37A 3I6RA 4GXMA 2V5BA 4UFLA 1RQBA 1RVGA 1W54A 2V2DA 4LRTA 4UUIA 1S3HA 3UD6A 3W84A 3GAYA 1W56A 3G1DA 3QZEA 1AL7A 4JTTA 4IX2A 1YTKA 4UNLA 2C13A 3EKZA 4YCOA 2YR1A 3S9YA 4AMAA 3GDRA 4MFDA 1LYXA 2DZPA 1VLIA 5D38A 4K8EA 3IIZA 3EXRA 5D2YA 2HSAA 3F03K 3PC0A 1I2NA 1W3TA 1YTDA 1QO5A 3QF0A 4M7SA 2QJHA 3F1QA 5KZMA 5AHMA 1UASA 3LLFA 2B7OA 3WJWA 5EMUA 3W87A 4GUHA 3RF9A 3B0PA 3M6YA 5TIMA 1UUMA 3DKJA 2CLLA 1ZHAA 2PC4A 3NQAA 4UR8A 1R30A 2WNQA 3CT7A 4PH6A 3O06A 3NM1A 4QNEA 3D0CA 1PS9A 3B0VC 5D02A 3C2RA 1SSGA 2C16A 1KFKA 2E5DA 5CSSA 1T96A 3NM3A 2LLEA 1O5XA 4RZ6A 4TX9A 4X9SA 4MZYA 1WDWA 6TIMA 3KVJA 1G4PA 1M5WA 2UV8G 3B04A 2ZZ6A 3EWXA 1G4EA 3L0GA 3T40A 4CCEA 1SPQA 4NXKA 3TUUA 3NL2A 4LW7A 3B4UA 1EWDA 3M16A 4TMCA 1ADOA 3HG2A 1O4UA 4S2BA 4EWND 1GEQA 2J6XA 2ZRZA 1R46A 5FESA 2CLMA 4LRSA 3S0CA 3MI6A 1W5OA 3PULA 4GBUA 3KFTA 3LCFA 3NQMA 2OCZA 4C1KA 3NZ1A 1EUNA 1A5AA 4UTHA 1AMKA 3W86A 2OMAA 1JUBA 1BKSA 4MPQA 3EWWA 1A50A 5K4XA 4IMEA 3DHFA 3YPIA 2WV8A 1W1ZA 5F2LA 1VLWA 5AHIA 3UWWA 1SU5A 3G1SA 4CNOA 1XBYA 2A6NA 1SZNA 4O57A 1X1OA 4Z0JA 1T99A 2EAWA 4ORIA 3NOEA 1SQ7A 3V1PA 1B4KA 5K2ZA 3IV3A 5I3HA 4BFAA 4HNUA 3FLUA 4JY9A 5CPOA 3W1RA 3KHJA 2ZA2A 1TPVA 5HULA 3RFAA 1XDLA 3FJ6A 1KM2A 2J27A 3GKAA 1LOLA 3BVJA 4O54A 3A22A 4OGZA 3MBFA 2ZZ7A 3P5YA 3GXTA 4Z1DA 5K9CA 3L67A 1MSSA 5HWMA 3DFTA 3IVUA 4FNTA 1KM5A 2A4AA 2H3BA 1TMHA 4UTTA 1VR6A 4MZ1A 3H54A 3QJAA 3ABRA 3E96A 2AGKA 1KTBA 4K39A 1XL9A 3GDMA 5J5RA 4LT9A 3B06A 3OEXA 2WNNA 3M43A 3MI2A 3NPVA 2V30A 4MY9A 4E38A 2ZZ1A 4LV4A 4HKPA 3DGRA 2D73A 3HF3A 3W72A 3EWUA 5G5IA 2WSYA 4IMDA 1JCNA 4E2DA 2X1SA 3QSTA 2A85A 3TW7A 1K3UA 3C56A 5EY5A 1TSIA 2Z2UA 5LNWA 1SSDA 5J5DA 1WYIA 1QPRA 3IVTA 1HUVA 3PF3A 1X6UA 2EHHA 4LUIA 4UTMA 3P8IA 3L0KA 1DORA 3GKFA 3CC1A 1Q6OA 1EWEA 4ZVJA 4XKYA 5FEZA 3LHWA 3QFEA 1TREA 4QIUA 5G2HA 1MXSA 1J2WA 2VFFA 1ALDA 4AH7A 3LRLA 2BSLA 4FX6M 5EKYA 3S5ZA 4JYDA 4TR9A 1PE1A 3BLFA 3HPZA 2YYUA 4O18A 2RDWA 2E5CA 4O4WA 3ELFA 4RCXA 3A9IA 4QITA 5E0KA 4QSHA 4MLJA 2FQIA 1EX5A 3A5VA 1KLYA 4WXYA 2A7NA 3KX6A 1LTDA 1SR9A 3LB0A 1FDYA 2B0MA 2G97A 3PUEA 1XKYA 3S42A 1ZALA 1VYRA 2ATMA 3M5VA 4TO8A 1ICQA 2X1UA 3N14A 3P5ZA 1R2SA 3NVTA 4W9TA 4RXFA 4AAJA 1QCWA 1JRCA 3O1NA 1F2JA 2GUUA 1W3IA 4YXGA 1P1XA 1XUUA 3PB0A 3LHTA 4WY0B 4WUIA 1TO3A 3W07A 3W6YA 3TQVA 4AWTA 4Z1BA 3THQA 5F1UA 2CZFA 3G18A 3KXQA 4DF2A 5DBTA 2WO5A 2F7FA 4FIQA 4WX2A 3NZRA 3WK2A 3IGUA 3LHZA 3E12A 3VE7A 1AG1O 1CX9A 3LOTA 5BMXA 1YDVA 1DQXA 5DCDA 1S5WA 3HGRA 4QISA 1X8FA 3JS3A 4ZQRA 1FCUA 2C14A 3R8RA 4S2CA 2PRHA 3DH7A 4OHQA 1P0KA 1TQXA 4GFSA 2V82A 3W75A 8TIMA 3GNDA 5IBXC 1QO2A 1VHNA 3TXVA 1TRDA 2ZRWA 5AYZA 4JIQA 4LC6A 4MJMA 5DELA 3DBPA 1TTJA 1GVRA 1G6CA 1PVNA 1GTHA 2CLHA 3W7OA 3EX3A 3KAOA 5IBXA 4O14A 4BR1A 3ZWSA 1JRBA 1F7BA 1GPWA 4AXKA 4U28A 1SZEA 3SIZA 3LRKA 2OT1A 2GJNA 1TIMA 1VC4A 1SUXA 5D33A 3W7HA 1KW1A 1OFDA 4CQ9A 3L65A 1H60A 2OJPA 3G1AA 1TPWA 1H50A 2O7QA 3TW6A 5K9DA 3QM3A 2VXNA 3UY7A 2C3ZA 1KTNA 4GUIA 3QRHA 2PRLA 1OFOA 2YXGA 3MUXA 3EX4A 5LHEA 3H55A 3GAKA 4DPPA 3FYOA 2X16A 3G0XA 1TTIA 3UPWA 3PBVA 1GYLA 3W1UA 4DXVA 5HUOA 3GVGA 2JGQA 4FX7A 5FF2A 4JY8A 5D2TA 3GR7A 1KTCA 1W3NA 5DCEA 3PVFA 4N4QA 3EKLA 1XBXA 3CWNA 2F84A 1LLZA 3WFAA 2YGYA 3UZJA 4LVGA 1X7FA 3W7PA 5F4WA 1NEYA 2V81A 2V9DA 3GK0A 3MWAA 4K7YA 3UWQA 1I2RA 2QJGA 4WOQA 2VFIA 3NQ2A 2Z6IA 4PFMA 1WBHA 3JR2A 3M5YA 3LI0A 1L9WA 3G24A 3IEBA 3S8HA 3AO0A 5EYWA 1KBJA 1ZY9A 5A8GA 2J24A 3FYPA 4N02A 2ZDRA 2CLIA 2I9EA 3PUDA 4O0KA 3NR0A 3CIXA 2A5HA 1LRNA 4JTUA 2ISWA 3P8JA 3KRZA 3LHVA 2W6RA 1KBIA 4JS3A 3HPXA 3RLUA 1R2TA 5AC8A 3EWZA 4A21A 1NVMA 1F6PA 3U6WA 3EWYA 3T44A 4MJZA 2QCCA 1KM3A 3NL6A 3HPSA 4HN4A 4K7VA 5U4NA 3W7CA 1TTQA 3L5LA 3S1UA 2QAFA 2FPTA 3M1ZA 3DKLA 1JCMP 1O95A 1FWSA 1TPH1 2J9XA 1IXPA 1JUKA 1LORA 3PSVA 4JNMA 4UMCA 2WQPA 3O16A 4MVAA 4ZZ9A 5HUPA 2DORA 2EGZA 3H53A 3NQ6A 2ZA1A 4HNTA 3QYQA 5BRBA 4NJKA 2B4GA 4Y90A 4IX0A 3W9ZA 2ZZ2A 2V2CA 4WD0A 5HR6A 3W23A 2GJLA 2G5WA 2Q8LA 1MO0A 3DXIA 1ICPA 3QEZA 3M5XA 1I4NA 3BG3A 3MHFA 1VZWA 3EX1A 3QPYA 2TRSA 3G1YA 3CEUA 3U8GA 1H7PA 3G8RA 2GQ9A 1LDCA 3TX9A 2ZTJA 1JCXA 3GDLA 1RR2A 2CLFA 1RV8A 4O53A 4FX8A 3A21A 3I65A 1FXPA 5L6UA 4A2RA 3LDVA 3SFKA 1TV7A 4CCCA 1YPIA 2R94A 3NO5A 3CPRA 5K4ZA 4UTIA 4Y96A 3G22A 1FDZA 3TFCA 3O15A 3G1XA 2WOQA 2B7QA 2RFGA 1OABA 1PV8A 1K03A 2RH9A 4KFOA 2VEMA 4XZ9A 2H6RA 2GVGA 2QJIA 4HIBA 2FFCA 4OU1A 3BW3A 3LERA 3NA8A 4J9JA 3QQ0A 4CLMA 4LNYA 5LSMA 2NUYA 3GDKA 1ZAJA 4UTWA 2ZZ3A 2QUVA 3WK3A 1GQNA 2DZXA 5AYYA 3HJZA 1QPNA 1IGSA 1U5JA 3G0UA 1SZFA 2EPHA 1H7WA 1LRQA 4LV9A 1LCOA 2X1TA 4IXHA 2CWNA 4LS0A 1DVJA 1TYGA 5CZJA 1HO1A 4L4MA 2RKXA 4ONVA 3W2JA 3NAVA 2Y62A 3TR2A 4JX4A 1W31A 4MUZA 1K7EA 3WJYA 5C54A 2ZRVA 5HJLA 4QAIA 3V75A 3EB2A 3BW2A 2QCDA 6ALDA 2PE4A 1QAPA 3PBYA 1NFBA 3W1TA 3L2IA 4NX5A 2J9ZA 1LOQA 7TIMA 3E49A 2ZQ0A 3W7GA 3BGGA 1A53A 2Q3OA 4M5PA 3GIYA 1K02A 5F2MA 3NG3A 5D09A 3TQ0A 3ZR4A 2GOUA 2TYSA 3W1LA 1NF7A 3DFPA 1GJPA 1OFRA 3OBKA 4XBKA 2XN1A 3NQCA 1OFBA 2CZEA 3QW3A 3A24A 2BLEA 4IMCA 5DBUA 2Q8ZA 5D2XA 5D05A 1D3GA 3DI0A 4K8HA 4QJ1A 3TU9A 1SO6A 4MOZA 4PODA 4LU0A 2QDGA 1Q45A 4M7TA 3BPWA 3W7JA 1Z48A 3L68A 3O6YX 3P67A 4YL2A 3S5YA 3EXTA 3NPUA 3CLMA 5BOOA 3DFSA 5CZSA 5F2IA 3W7MA 4DPQA 2WPBA 3W22A 4HPXA 3QQ1A 3TQKA 3SECA 1K8XA 4O0ZA 1QPOA 4PCFA 5G1YA 3U2OA 2NWRA 5LKYA 5K7JA 4ALDA 3R13A 4JYEA 1EA0A 3W1XA 1VHCA 4JTGA 2R8WA 1H5YA 3A23A 3W2UA 1VYPX 5D37A 2C18A 2QF7A 3FKKA 2YCEA 2J88A 3G3MA 4O15A 3VCRA 3LTYA 3SGUA 3HG4A 3B05A 3P84A 4JTEA 3PBWA 4NNAA 2WKJA 1P0NA 1V7YA 4DO6A 4CNPA 4FNRA 3LBCA 1OX6A 4FXRA 4ZMGA 3CHVA 4RJEA 1JCJA 1IXOA 1A5BA 3DFOA 3QMTA 1EP3A 3TDFA 4CQ8A 2DJLA 5CKSA 5I3FA 5HQEA 3VKJA 3M47A 3NQGA 4I7VA 1Q6RA 2X2GA 1J5TA 4UFJA 1UJPA 1FUYA 1LBFA 3BLEA 1S5VA 2CZDA 4GUGA 4DEFA 3GYEA 3LCGA 5CSRA 1NSJA 4XUGA 1TPDA 1B57A 3KRUA 4O13A 4TIMA 3R5EA 1SW7A 3S5OA 3RK8A 5FF0A 2W0UA 1KV8A 2YX0A 3ABSA 3OIXA 3R89A 4OBTA 3S1VA 3OVQA 5EPDA 3TIMA 4HHPA 5EL1A 1H63A 1L6SA 3ZWTA 2YW3A 5DY3A 3HOJA 5DLCA 2GQAA 2QCDB 1WXJA 1BEUA 1IXQA 1SO4A 4PC8A 1KM0A 1TV8A 4GNJA 1XM3A 2FDSA 4CQAA 2CLOA 3HBLA 1WV2A 3FJLA 1A5SA 3SJ3A 1P4CA 5BNKA 3KRSA 2CFFA 2Y7DA 3C3NA 3LGEA 4NNCA 4UNKA 4I7WA 1R2RA 5C55A 1Z41A 1OYAA 1KM6A 1XCFA 5F4XA 2H8XA 2NUWA 3W83A 3WJSA 2R14A 2CW6A 3RMJA 4RV8A 2E09A 3O07A 3CTLA 2JKEA 5I3GA 4O1DA 3UYCA 1UUOA 3MYOA 3WK0A 3G1FA 1TPUA 4UFMA 5AHNA 2E77A 1IXNA 3TSDA 3PG8A 3TH6A 1QOQA 1TQJA 3S1WA 5G2IA 4RZ5A 4IJBA 2QDHA 2V0TA 3EXSA 5DN1A 1LOSA 1FWNA 4AF0A 4K36A 3GDTA 3L66A 2V2HA 3WJZA 3DHDA 4BI6A 1I2QA 1OG0A 4IUOA 4JYFA 1VJIA 3QW4B 1QR7A 3GB6A 3O8AA 3NGJA 1TV5A 2Q3RA 3W76A 5AOUA 4C1LA 2FPYA 2QUTA 5D30A 3PG9A 3TCEA 5KTLA 1OF8A 4IOTA 4LVFA 1Q6LA 3STGA 1TCDA 4NVTA 5AHFA 5BW6A 4GWEA 4Z0SA 3F4WA 1KFJA 2VEKA 3ABQA 4L4LA 3DFNA 1XC4A 2VFEA 5GVJA 3TE9A 2VELA 1FY6A 4Y9AA 2CU0A 1S5TA 1JULA 3IRDA 5CGQA 3SR7A 3TJLA 4NJHA 1VS1A 4JIPA 2XFWA 1ICSA 2BWGA 2B7PA 3C2OA 3SI9A 3TC6A 4NX0A 1CW2A 3N34A 1AW1A 2PRMA 4D2JA 1ZAHA 2P0OA 5HWNA 1A5CA 3I7SA 1ZCOA 2RHGA 2QCHA 4JTLA 3W2NA 3UZ5A 4G1KA 1F05A 1TPC1 1HL2A 1I45A 3W2LA 3LBMA 3UWZA 3IVSA 1T0OA 3NQDA 4Z1AA 1VCFA 1CI1A 1EUAA 1OK4A 3LCHA 3BW4A 1GT8A 1JUEA 3C6CA 4FNQA 1PCKA 4XWUA 2E5BA 1SZGA 4MY8A 3TAKA 1PL9A 3HIJA 2Y70A 5KINA 4N6EA 3W7DA 4MZ8A 1MEWA 5AHLA 1LLWA 3MBDA 4TMBA 1H7NA 1GG0A 1IIGA 3BV4A 2ZYFA 3DENA 4K6AA 1C8VA 2Y7EA 3MJYA 4JN6A 3O05A 5DXXA 4HSOA 4QQ3A 2H90A 5HR7A 2Z0IA 1D3HA 3L0NA 1TJRA 2QCLA 5D2VA 3ANYA 2J9YA 4ZQPA 4NZJA 3HO8A 4MYAA 1D9EA 1I2OA 2Y7GA 1ZENA 1OHLA 4AB4A 3PR2A 2C0AA 1LZOA 1SO5A 4N4PA 2CLKA 1N55A 3C2VA 1HO4A 3P60A 5AC7A 2QCMA 2OT0A 2BTMA 1SFLA 1H1YA 1FDJA 1MEIA 4FNPA 4IWWA 4JTIA 4O10A 4JX6A 3SW6A 4NUWA 4UCGA 3HMJG 1KM1A 3M7WA 3FA5A 5KITA 1OFAA 4O17A 1THFD 3F4NA 4FNSA 4LC8A 3BARA 1YPFA 3CWOX 1TRIA 3NEVA 3W7NA 3PSWA 2R91A 3FS2A 3P62A 4R7JA 3HB9A 2A6LA 4O1AA 2YSWA 2I1OA 1ML1A 2NV1A 4Z08A 3W2MA 4RR4A 1V5XA 5LZLA 3N2MA 4OT7A 2YW4A 3BGJA 2G96A 4Q32A 3WK1A 1YTEA 1X1ZA 2FJKA 3W7RA 4WQ6A 3C0JA 2ZRYA 3O63A 3L21A 2ISSA 4I9AA 2HS8A 3BG5A 1EEPA 3PY2A 2ALDA 3NXFA 3C4UA 4NJGA 1YDOA 2BXVA 5HINA 2QEZA 4ADTA 3NPWA 1W5PA 3HG3A 1YXYA 1K7FA 4OV9A 1MEHA 4MY1A 4TU1A 1LROA 3LCXA 4FF7A 2NX3A 3LI1A 1J4EA 2FPVA 3LXCA 1TJPA 2DZSA 3N9SA 2QAPA 2TPSA 4LY8A 3R2GA 2NX9A 3G8EA 2QCNA 2YZRA 3W7EA 2NWSA 1HG3A 3E0IA 1SFJA 3LM7A 2YYTA 1GVOA 3ABOA 2E1DA 4O4VA 4AF0B 2GVLA 1VCVA 1Q3NA 3IGXA 1FCQA 4FB7A 1B4EA 1G4TA 3STEA 4S1FA 4BI7A 2A2IA 1QWGA 4IMFA 4PA8A 3TXZA 5LHFA 3LLDA 4FO4A 3NQ8A 3LXBA 3FFSA 1FWWA 2VOMA 2CZ5A 3I68A 4IPIA 1GWJA 1H1ZA 5SWUA 2DZTA 3PWAA 1IIHA 1N8FA 1M7OA 1XDMA 4AHOA 1K8ZA 5G4EA 4LVBA 2I14A 1QMLA 1KFCA 2AQWA 4Z1CA 3UWVA 4JTFA 1TPB1 3DFQA 1DOSA 3S5NA 3L5MA 1L6WA 2E6YA 4UTLA 1B9BA 1F6KA 3BLIA 4NU7A 1H51A 3W1AA 4KFPA 4YCPA 1FXQA 4HNNA 1O60A 1G69A 3I7QA 4UIOA 5EA9A 5HWJA 5H2ZA 4AWSA 1O5KA 1NF0A 5E1QA 1FWTA 3SGZA 5AFDA 3SZ8A 5FEWA 2EF9A 2Z1BA 1OX4B 4RZ4A 4JX5A 3RU6A 1JCLA 4POCA 4MLRA 4KFNA 1Q6QA 3M44A 2ZRXA 1ZNNA 3W70A 3B03A 4FNUA 2QR6A 4DO5A 1JQVA 1M6JA 1YLVA 3PS7A 3QH2A 5LNSA 1VGAA 4JTJA 1T8XA 4BK9A 4LS1A 1DJQA 4UTKA 1HFBA 3W85A 4JEQA 4FIRA 3TV8A 4K38A 5LGXA 1KLZA 2VFDA 3MP5A 3T4CA 1TB3A 5LNUA 1N7KA 3IGSA 5AC6A 1QDSA 1XFBA 2YFOA 2Y63A 4IGHA 4Y8FA 4GRSA 1TPFA 2BX7A 1XBVA 4DQWA 4WJEA 4XBSA 1LRTA 4RXGA 1JVNA 3Q37A 1QOPA 3Q2DA 4E2BA 4PL2A 3VNDA 4O16A 2AAMA 5AHEA 1KFLA 2NZLA 3S6DA 3DZ1A 3NL5A 4O11A 4O19A 4X22A 1FBAA 3TA6A 1O94A 1VYSX 5L9FA 5I3JA 1F74A 3HG5A 5DXYA 3HGSA 3CEPA 3GX9A 4JDBA 5F4SA 4EIVA 3N9RA 4PEKA 2Y89A 3STCA 3PBUA 4YWIA 5D03A 3OVRA 3N73A 2VFGA 3DAQA 1WQ5A 2V8ZA 4BWLA 3ATYA 2JKPA 1U83A 4KWVA 3S1XA 1LBLA 1WOAA 5C2XA 3HQ1A 4EF8A 4ZQCA 1DQWA 2ZCGA 5FEXA 1I2PA 2ZA3A 4H6KA 1QFEA 5A5WA 5D32A 4LOCA 3OHIA 4YLWA 2X30A 1SO3A 3I7RA 3EWBX 1KM4A 4AHPA 3TMQA 3MMTA 3G1VA 4BWLC 2A7PA 4XTIA 3AJXA 1YXCA 4M6QA 2ZRUA 2CLEA 3L9CA 3W71A 3VI2A 5LNVA 3N19B 5FI8A 2NXHA 2ABBA 3MYPA 3LXAA 3THAA 1KFEA 3GZ3A 1BWKA 4DF0A 3E9AA 1KA9F 4CNNA 4GE8A 3NQ7A 4R34A 2HTMA 3UPBA 4LS2A 1LM1A 3M9YA 3TAOA 3IIXA 5FF3A 5CZTA 5EBUA 2C6QA 2NX1A 4AHQA 4B5NA 2C19A 3ZS4A 4ADUA 4MFEA 3W7IA 4HNVA 1TTPA 3CB8A 3OG3A 4O12A 2QCFA 1H7XA 5CPLA 1M7PA 3EX6A 1RQHA 4O52A 3W7QA 4ZQNA 3FOKA 1VCGA 4OWGA 1PIIA 3NNTA 4ZQOA 2PURA 1GVFA 1OJXA 1EP1A 2Y88A 3TJXA 1HTIA 3NDOA 1R47A 1XXXA 5KSWA 2JK2A 4HSNA 5CPMA 4YMZA 3UY8A 3C8FA 4BI5A 5DCBA 4X2RA 1RD5A 5KMYA 4NNBA 1G4SA 4IXXA 3UXDA 5HMSA 4IQLA 1SW3A 1JR1A 4OE7A 5FF7A 5C5YA 3C2EA 4IPJA 3QMSA 2QKFA 2TSYA 1BWLA 4ZQMA 5AN7A 1GVQA 4R33A
chains in the Genus database with same CATH superfamily
3TMLA 3W88A 1F73A 2DZWA 4RPPA 1HW6A 1SGJA 1OFPA 1NAL1 1RQEA 4Z2GA 1DL3A 2XU2A 2HE8A 5C6MA 2WSQA 3FA4A 4Q8MA 2P10A 4MTVA 2DZUA 4TQTA 1Z42A 2IKHA 5AC4A 3ZIZA 3WLTA 2BY2A 3HZ3A 3MT1A 1IEWA 4OBRA 5ABTA 4WY0A 4NJIA 3WD3A 2YDSA 4U4MA 1TMLA 7ENLA 2QULA 1QNRA 3ZLHA 3PN8A 4Q33A 1OCJA 4UQAA 4PCPA 1XLIA 3DI1A 4WZHA 4GUFA 1OM0A 4DBSA 3KLKA 1D8WA 1K7XA 3T7VA 1TVNA 1RD6A 3EAUA 4ORMA 3AWNA 4UC5A 2QCGA 4C6DA 1Q65A 1IZJA 4UFKA 4CU7A 5BOEA 2NV2A 4QDMA 1VPYA 2QXWA 2YKKA 3LCIA 1DBTA 2PDQA 5T8GA 2HMCA 3A9BA 3STFA 1ENUA 1G7UA 1UKTA 2Y5EA 4F2BA 1G7VA 3WLJA 4DB7A 3FAXA 1H3GA 3WMLA 2G37A 4O1BA 3AYTA 5D2WA 2I7GA 4KWWA 3TKFA 1F5ZA 3GLCA 2DIEA 2J8FA 2OO6A 4BKNA 1QHPA 2X7WA 4D8ZA 2ZX9A 6REQB 1MNZA 2VC6A 4US5D 2YOCA 4UQ9A 3JZUA 2ISFA 3CO4A 3ZMRA 2DJXA 3CMJA 3UNTA 3ARTA 4DZHA 2ADAA 1Q4NX 1M9HA 1NJJA 3WDQA 3INPA 3VNJA 3WDRA 3W1NA 1H7RA 4F0HA 1B54A 1UR1A 4KCWA 1ZJIA 3UNDA 1AQ0A 2QUUA 1T6MA 4EOUA 2G95A 2VMFA 3N15A 4EXQA 2PF0A 4ICNA 1UR8A 2TMDA 1UWSA 4QE1A 1W1PA 3VMNA 5DMMA 1JQXA 4ZCWA 4GJ1A 5EMJA 3WBYA 3BK0A 3VGFA 4CQCA 3SCUA 1OK6A 3GXNA 4JTKA 3MWCA 3W53A 1C29A 4ICCX 3CMFA 4AZIA 1C9DA 2YFNA 3GUGA 1I9CB 4XO7A 3PPHA 1C8YA 2I16A 5FEPA 3PUGA 2YZ5A 2BGSA 3GU1A 3LHYA 1V3MA 4E2VA 1XX1A 1OCQA 2JQXA 3BQ6A 2RJGA 3GNXA 4XQ6A 3U5YA 1N82A 2OTDA 3GXPA 2XISA 4F40A 1T40A 2FKPA 4N9BA 3CQ0A 4PRRA 4RX0A 1OSEA 2X40A 1LBMA 1EBGA 1AL8A 3VFLA 3O6DA 4D6IA 3NPXA 1EP2A 1W1B1 1AH4A 2VKZG 3H2OA 4TOQA 1UWUA 2P53A 3ABXA 1F8MA 2P50A 1QW8A 4GOAA 2ZWZA 1E4IA 3IIPA 4HOWA 3W7LA 3MP3A 2WZHA 1WO2A 4JFUA 3H7UA 2PMQA 1HX0A 5A6BA 3QLLA 1S1RA 3CH0A 4O8AA 1U5HA 3HGJA 4RW3A 4QROA 1S2WA 3VE9A 2ZUTA 3LCLA 4N6FA 3AHZA 3KWXA 5F2GA 1ME9A 2PDJA 2VM8A 1EIXA 1JFHA 1U1JA 3MI3A 2O56A 4CVUA 4DBDA 2W79A 4E3TA 4GC4A 2Q71A 3WL0A 1W3JA 1DWAM 2BXZA 1RPXA 5E93A 2GGIA 4B3LA 2Y8UA 4AVFA 1ZQ5A 3KOXA 4RKAA 4WXZA 2A1YA 2H8ZA 3QOKA 2NUXA 3W1PA 3XIMA 1WKDA 2Q09A 3M4HA 4FSAA 3K30A 3KBVA 5AYXA 4J7RA 5HDRA 3MO7A 3LRMA 1ME8A 5EMKA 2OYKA 3S5SA 4Z2IA 3MC5A 3VMOA 4D6DA 3WNLA 1GOQA 1PIFA 4XAFA 4E0CA 4PMVA 4Z2JA 3ZLFA 1PEZA 4YVVA 5XINA 1CWYA 2BOGX 4FEZA 2VENA 1M3UA 4JDYA 2NLIA 1SZRA 1TPEA 1ITXA 2VFHA 1QI0A 2Z6JA 3CAQA 4X61A 1WA3A 4B9YA 1NY1A 5G2WA 3KDNA 1EB3A 3EX2A 4S3BA 1BD0A 3TJIA 1ZBCA 2Z26A 1E6NA 4MWAB 3BG9A 3DG6A 3MU7A 2CZVA 3C2FA 3EA3A 2A79A 4C6EA 2DU2A 1K8YA 1PIGA 5CSUA 2FZ8A 2OR2A 1TCMA 4F4RA 2IQTA 3UXLA 3LCWA 4LVAA 4UFHA 4PMUA 3OB8A 4P7RA 2VUYA 3LHUA 3B8WA 1L6YA 4DNMA 4KKXA 4N42A 4Q8PA 2O9RA 2ISVA 4IGSA 4REQA 4LTSA 1Y5XA 3H23A 3LD5A 4GG9A 4C6IA 3P74A 1AW2A 3WQCA 3K2GA 4YNGA 3AU6A 2NQJA 2HZGA 3WLHA 2INEA 1W54A 1S3HA 1JDEA 1GOIA 3UESA 3JW7A 4XKMA 1UWTA 1KKOA 1YTKA 3EKZA 3HQPA 5DMNA 4AMAA 1OCBA 1F4HA 5AVHA 2CESA 5D38A 1SMDA 3T4WA 3EOUA 2QF8A 3SY8A 3HPFA 3EXRA 2CYGA 3PC0A 3W81A 3QF0A 4EPEC 3GTFA 6XIAA 5KZMA 4D71A 2B7OA 2GSEA 4NRRA 1R9YA 2NT1A 2WLZA 3OZMA 3UJFA 1ITQA 5HATA 5TIMA 3DKJA 1LT8A 1XIBA 4DRSA 2REQB 3SUTA 1FWEC 3PZOA 1LUCB 2ZXAA 4FLQA 5D02A 3C2RA 1T96A 3SCOA 2LLEA 1J0JA 1MYRA 2P3EA 5I77A 2DT3A 4EXAA 1V79A 1M5WA 2UV8G 4BS0A 2ZZ6A 3M0YA 3EWXA 4W5UA 1G4EA 4ZA0A 2EQDA 3FVMA 3DYPA 3TUUA 4GH1A 4TTGA 4LW7A 3RGTA 4TMCA 1ADOA 4XVEA 3UG8A 4IIDA 1E9IA 5FESA 2YDQA 2XDFA 3PULA 4XAPA 5M17A 4C1KA 4LBSA 2X0SA 3DFYA 3TEVA 1A5AA 4PUNA 2GGJA 1K9DA 3UWEA 1KRMA 2Y0FA 4IG2B 3N12A 1BKSA 5FJJA 3IRSA 1J93A 4Q4PA 1W1ZA 1VLWA 1ZJBA 1UA7A 4W8AA 1UR9A 3G1SA 5C9XA 1XBYA 2CWXA 3QY6A 1SZNA 4UQCA 2EAWA 2AQOA 2DUAA 3NOEA 1SQ7A 2Y8VA 3V1PA 5I3HA 5DO8A 3CUHA 5CPOA 4NI8A 4LUYA 2Q6ZA 2ZA2A 2A3EA 1XDLA 3BJSA 1UC5A 4U5IA 3QZ6A 3WLSA 2GZXA 4GXWA 3IVUA 1N2VA 4DWSA 1HL9A 4FNTA 1KM5A 2A4AA 3B8UA 3H54A 4CU8A 4H9ZA 3SM0A 1KBKA 3BJFA 4M6UA 3ARQA 1TZ7A 4K39A 3UPMA 4J4KA 2R9RA 2I56A 3WO8A 4LT9A 3OGRA 3B06A 4D1IA 2WPGA 1F3XA 2G3MA 2V30A 4E38A 4HKPA 4LXFA 1DWFM 1A49A 2WSYA 4IMDA 1YPXA 2D69A 3QSTA 3KBMA 2A85A 3C56A 1M04A 4GMEA 3WH5A 2PP3A 1TSIA 2Z2UA 1SSDA 1FVPA 1XRSA 1WYIA 4L64A 1HUVA 3M0XA 1X6UA 2EHHA 3GIPA 4PSPA 1QI3A 4XAGA 4Q8TA 1OD0A 3REQA 3CC1A 3F4VA 4GJIA 1XSKA 4C6FA 3QC0A 1EWEA 4ZVJA 4XKYA 1GCYA 1EFZA 3L2LA 2WJFA 4XZWA 3IUHA 4FX6M 2HK1A 4JYDA 4LNCA 3HPZA 2AAAA 3F2BA 1ZBWA 4PBEA 4N0RA 1OGSA 2RDWA 2OG9A 4HPGA 1PUDA 2E25A 3K4DA 4QSHA 3WUBA 3DOPA 3A5VA 1KLYA 4OOZA 1LTDA 3GNRA 3LB0A 1G94A 4JZ5A 5RUBA 3S42A 3EKGA 1VYRA 1TV4A 4L6DA 5IRPA 2DW6A 3UF9A 5A2BA 2D0GA 1HNYA 4FALA 1BXCA 1JRCA 3TVAA 1DQUA 1WUFA 1F2JA 2CETA 2ANUA 1KBBA 5LIUX 3S6TA 4WY0B 1TO3A 4DXXA 1P0EA 1Z7AA 3THQA 3I3BA 3PZUA 5F1UA 3G18A 3KXQA 4PUMA 3VNMA 4AZHA 2WO5A 1ECEA 3BICA 2YL6A 2PUZA 1S3TC 3LHZA 1QW9A 3U9IA 1DQXA 2QYGA 2PP0A 1S5WA 2DT2A 4IIEA 2C14A 2VCBA 3DH7A 4OHQA 3W75A 3S47A 2DFAA 1VHNA 2ZRWA 3WQ5A 2Z00A 4ILSA 4GJJA 1T8QA 1TTJA 1PVNA 2ZXDA 1AQHA 4NZ3A 3NZPA 4AWEA 5IBXA 4O14A 4BR1A 1JRBA 1F7BA 1GPWA 3A4WA 3BWWA 4AXKA 2WMFA 4U28A 3BOXA 3POCA 1HJUA 3IANA 4ATDA 1A3XA 2PBOA 4CQ9A 5HPCA 4DZ5A 3ISIX 4ATLA 3A3HA 1UG6A 1H50A 5K9DA 2O4MA 2E67A 1XF0A 1EL3A 2C3ZA 3BDKA 1F8IA 3BSGA 3QRHA 2PRLA 4GUIA 4IG2A 4AIBA 3B9OA 3FYOA 3W1UA 4DXVA 5HUOA 3GVGA 4QE5A 3N11A 4MUPA 4AD3A 5ECVA 4MB4A 3EDEA 1KTCA 1W3NA 2P8BA 2G3IA 5E5CA 3PVFA 3DBNA 2QQ6A 2E4TA 2O9PA 3GSMA 4YTRA 1CBGA 2F84A 1LLZA 3GE7A 1KFWA 4AX6A 3G6LA 2VP8A 4E5TA 2V9DA 1DWJM 3GK0A 1V02A 3O0FA 3SGGA 1QNOA 1Q8JA 2VFIA 4PFMA 2GOKA 4B5TA 3M5YA 3ARUA 3G24A 1TV2A 3IEBA 4L7ZA 3S8HA 1R6WA 1ZY9A 2WZTA 3E2VA 5A8GA 3ARSA 3FYPA 3VUPA 2PTDA 3FJNA 2VVSA 2BVYA 1VRXA 1LRNA 4GX9A 4JTUA 1KKRA 2ISWA 1W1IE 3KRZA 4LAUA 3IK4A 2UY2A 4MKSA 2EG6A 1QNQA 4DWSC 3VOGA 4A21A 3EOSA 4GY7A 4A05A 4CU6A 2VX7A 3W7CA 3L5LA 1BYDA 3N13A 2ACRA 2FPTA 2CBUA 1JCMP 4S3GA 5LXEA 2E9LA 1IXPA 4R9OA 4L80A 4EANA 4IIGA 5HUPA 3H53A 2MNRA 4K3ZA 4HQVA 4HNTA 3QYQA 4IP7A 2XGBA 4NJKA 3J7HA 4Y90A 3W9ZA 2WANA 1NWSA 4GKTA 1H5VA 3W28A 2Q8LA 4GINA 4ICMA 1ICPA 2DZBA 3QEZA 1VIWA 3BG3A 3MHFA 2HNHA 3EX1A 3DHUA 3G1YA 3CEUA 2AKMA 3U8GA 2ZTJA 1JCXA 4Q4QA 1RV8A 4UR9A 4FX8A 3I65A 1LJYA 5L6UA 1E5JA 4AYSA 1EZ2A 1O6IA 4BEUA 3B40A 1PKLA 3GNPA 4UQEA 2AMXA 4LANA 1J8VA 4Q3MA 2O55A 2RH9A 3PBGA 3T42A 3ORWA 2GVGA 4TUFA 4ZOAA 4M8UA 4YVPA 4OU1A 1EJRC 2PAJA 2RGMA 5C70A 1PO9A 4CLMA 1OINA 4UTWA 5IOBA 5AYYA 4YTQA 4Y9MA 1IGSA 1U5JA 4AZCA 1T5AA 3UCCA 4V33A 4NZ4A 1HP4A 2BS9A 3AYSA 4FLOA 2IS7A 1SJDA 2RKXA 3QQWA 3W2JA 3NAVA 4CD5A 5DFAA 2Y62A 2PDUA 3PP7A 4B5XA 4B9ZA 2ZRVA 5GNYA 3UR2A 1R9ZA 3EZ4A 3RO8A 4KBXA 4Y9PA 3SCVA 6ALDA 3T2OA 3SSZA 1J0IA 2BB0A 4R7OA 2B81A 3W1TA 3T8QA 3KOWA 4WGXA 2J9ZA 2WHLA 4UZSA 3BGGA 1JYNA 2Q3OA 4M5PA 1FWHC 2EXOA 1NF7A 1GJPA 1OFRA 4XBKA 3VOHA 1CTNA 3QW3A 5A94A 3A4JA 3REQB 2GYIA 1EGMA 1ELSA 5LIWX 2Z2BA 3PBMA 4GK8A 4MOZA 2Y5SA 3EEZA 4L9YA 4PODA 1Q45A 4M7TA 1GOOA 4NZCA 3GW3A 1AZ2A 3EB3A 5CG0A 4H6QA 3MSDA 1V6YA 3EGJA 3S5YA 1A4LA 1ADSA 3CLMA 5BOOA 3DFSA 3CPGA 4DO7A 4DPQA 2WPBA 1JZ3A 4HPXA 3QQ1A 4LF1A 4XG1A 3SECA 3H4WA 1K8XA 4Z17A 4O0ZA 3D3FA 4PCFA 3U2OA 1EA0A 3W1XA 2WSKA 4JTGA 1H5YA 1ZJHA 3A23A 1V0KA 3MQTA 1VYPX 2NVCA 2J88A 3G3MA 2HVMA 2A3AA 3LTYA 1FWJC 2MANA 3B8IA 4NNAA 1XDJA 2WKJA 1FP8A 1P0NA 4MNMA 1DXFA 2VRKA 1BF2A 3LBCA 3CHVA 1JCJA 1IXOA 1A5BA 5C71A 2IKIA 3QMTA 4E8CA 3WF2A 1E55A 2W92A 1ONEA 1RA0A 1GZJA 5FOOA 1PYMA 3MB9A 5I3FA 4PR4A 4LAKA 2OZTA 3VX0A 1S5VA 5CSRA 4QFUA 1NSJA 4DBWA 1XYAA 2A3LA 3PZTA 4HBKA 4AG0A 2BXYA 4H9VA 1UWAA 4BQ2A 2W61A 1KV8A 2VZUA 1KXQA 1W1YA 3OIXA 4LAOA 4OBTA 4JFSA 4DM1A 4H2HA 4AVNA 3LMZA 4HHPA 5CJ5A 1L6SA 2OODA 2CBIA 5FSDC 1BQGA 4DI9A 2F8QA 1W32A 4PC8A 2PWUA 1VP5A 1KM0A 2VZTA 4GNJA 1RXOB 5E9XA 3HBLA 1A5SA 2YB4A 3SJ3A 1P4CA 3H2FA 2WMIB 2Y7DA 1ITCA 1OYAA 4ERIA 2NUWA 3C0QA 2WK2A 3TN6A 4QX4A 3XINA 2QJJA 2Z4GA 1EF2A 1R3VA 3CTLA 2JKEA 1AD1A 1GVEA 3WK0A 3G1FA 1KCXA 3ZZ1A 4GIRA 4ACZA 1QOQA 2X09A 2QDHA 4X63A 5DN1A 1PYFA 4FS9A 4HCDA 5I78A 1ZB5A 1ECQA 3KP1A 3QBUA 1CGVA 1IEQA 3NSXA 4IUOA 4HU3A 2FMOA 1QR7A 4M1RA 3NGJA 3N2CA 3NDYA 2Q3RA 4EPKA 4C1LA 3ARRA 4MAZA 1I6NA 4LVFA 2HEJA 1XJBA 3STGA 1TCDA 2V5DA 2ISDA 5AHFA 5BW6A 1KFJA 2VEKA 4XD6A 2VELA 1FY6A 3M6DA 2CU0A 4NF7A 1JULA 1E73M 2PTWA 3LQGA 3HURA 3KP0A 2NVAA 3D47A 1A5NC 2B7PA 2XVGA 4J40A 2CLPA 1REQA 4NX0A 1CW2A 1AW1A 3K46A 2P0OA 3RAOA 3I7SA 3WLLA 1H2JA 2QCHA 1UKQA 2Q8XA 3UZ5A 3H2NA 1F05A 4L6HA 1J12A 3IVSA 2BFGA 1EUAA 1OK4A 3CUZA 3WF4A 5GNXA 2NW0A 2G50A 3VD3A 3VZZA 1SZGA 4KQNA 4MY8A 3QGVA 2X8RA 2ZUNA 3N29A 1GKQA 1C9WA 1U33A 4HZ7A 1X39A 4FOUA 5AHLA 3GTHA 1LLWA 2YA0A 4WDWA 1TV3A 4LY4A 1S5NA 3LPGA 1J18A 4YTUA 5C0QA 3LA4A 3UJ2A 4JTCA 1E0TA 2J9YA 3TYEA 1R86A 4QG6A 3B9DA 3E74A 3WQ4A 1D9EA 3HQNA 3GHUA 2OLHA 2Z28A 1LZOA 1SO5A 2GDUA 3WBWA 5ABFA 5AC7A 3L7RA 2BTMA 5EB8A 1H1YA 3VX1A 1FDJA 4J2PA 3SW6A 1LL4A 4UCGA 4FK9A 4O17A 1O12A 1E5NA 2GJXA 4J3XA 3WF3A 4FNSA 3NOYA 3CWOX 4XZMX 3U57A 1HKMA 4P7LA 2HRWA 3QFWA 1MFUA 4K68A 2A6LA 3LPOA 4Q6JA 1B1YA 1XIDA 3PTDA 1JDFA 3W2MA 4ML4A 5LZLA 2VZVA 2G96A 4Q32A 3WK1A 1X1ZA 2FJKA 3T0DA 3C0JA 1CB2A 3TYZA 3AXHA 2VDIA 4QJ5B 3NXFA 4NJGA 3MKVA 3S1GA 1HXJA 2VC9A 5M5DA 2BXVA 4ADTA 2BASA 4IP4A 3LCXA 2XIJA 3LI1A 1E1EA 3HMCA 4D6GA 5IXEA 3H2EA 4LY8A 2NX9A 1C90A 4F2TA 3BLOA 2QCNA 3KWSA 3L4XA 1RCOB 3RCYA 1GVOA 2E1DA 5ENLA 3JVAA 3PNUA 4I8DA 2XIBA 3TWAA 5CH9A 3TXZA 3A64A 1L0PA 5LHFA 1W3LA 3DHPA 3NZQA 3R11A 1FWWA 2VOMA 2R82A 2QIWA 4P7NA 4J2MA 1H1ZA 2VX5A 3F7JA 1XDMA 2PBGA 1JZ8A 3CZJA 1K8ZA 4KESA 4LVBA 3EDJA 2I14A 4OTKA 1EDQA 3UWVA 2WVUA 3S5NA 1VFHA 3ES8A 1L6WA 2E6YA 1A5OC 1H51A 3AS2A 1XLKA 3NVDA 1G69A 4JIIX 3I7QA 1NOWA 2WCGA 2BY3A 5H2ZA 2J62A 3AU2A 4H2CA 4KW2A 4AEEA 3FVDA 5E1QA 4XSMA 5FEWA 4HHLA 2O4QA 3EDKA 3GS6A 2JEPA 4MLRA 1Q6QA 1ZNNA 6ENLA 2J79A 4FNUA 4DO5A 1M6JA 4H9YA 4X2PA 5TAOA 3PS7A 4P8XA 1DE6A 4X60A 4GVHA 4DYEA 4FLRA 3UGVA 3BLPX 3EPMA 4ZTYA 4LCRA 1DJQA 3BLDA 4UTKA 1V02E 3LENA 3W85A 4JEQA 2HK0A 2IKGA 1KLZA 2VFDA 3T4CA 1Y8BA 1IT0A 5LYRA 1W9VA 2XGIA 5LNUA 4CQDA 1XFBA 1Y7VA 3AXIA 2F6UA 1KQZA 1TPFA 1JD9A 4DQWA 2DPEA 3BUVA 3CAKA 3Q37A 4G56A 4D6EA 4E2BA 2PGEA 4PL2A 2J78A 2R6OA 2PU1A 3OZYA 3S6DA 3R1ZA 4IFRA 4X22A 3UU0A 1VFUA 1RBOB 3TA6A 1V0NA 1O94A 1UQYA 3PTQA 3HGSA 3CEPA 1M68A 1RAKA 5F4SA 1RHCA 1V3JA 1E71M 3TTSA 3CQJA 3FK4A 4LUTB 4EIVA 3N9RA 4PEKA 1NWTA 4JQ2A 4YWIA 2NSXA 2XFRA 1IEXA 3N73A 2VFGA 1WQ5A 2V8ZA 3MANA 2NLYA 4EF8A 2ZCGA 1JZ7A 1KBLA 1I2PA 4H6KA 4DXKA 3SDOA 3QLDA 3AALA 3WYZA 4LOCA 3HPAA 1EQPA 4YLWA 2X30A 4DLMA 3IJ7A 2VO5A 3I7RA 3N18A 3EWBX 4AHPA 4WK9A 4QG8A 4BWLC 4XTIA 3VGEA 1JFXA 1MWOA 5AYBA 4IPLA 3VI2A 3CV2A 1E0XA 2Z7KA 4IQEA 5E70A 4MHBA 3IJDA 3GZ3A 4DF0A 4ZB5A 4AZ6A 1A4MA 4JN7A 5ABEA 4PMQA 2NSOA 5DX7A 4BF7A 4BJHA 3IIXA 3SN1A 4AD5A 2NX1A 3TYAA 3XISA 1C3FA 2XVPA 2C19A 4DJDD 4UOZA 3W7IA 3OG3A 4O12A 3MCNA 2QCFA 9CGTA 6TAAA 4GQGA 1VBHA 3KZPA 3VDGA 1PIIA 4M80A 4S3DA 4C1NB 1OJXA 1K6WA 1LLOA 1WKFA 3CPUA 1CLVA 4XZHA 1J0ZA 1EJWC 3UY8A 9RUBA 4BI5A 2VC7A 4FXFA 1J96A 4IP5A 5I02A 3RX3A 6A3HA 1UD3A 1JR1A 4OE7A 3SB0A 2WVVB 2TSYA 2BVTA 3MSGA 1HZYA 2QHAA 4JXCA 4JNZA 3PM6A 3AWOA 3TSBA 4P2VA 3C0SA 4NQ1A 3UZWA 1XP3A 5A8OA 1OT1A 3VKAA 3SO7A 4F2UA 1OF6A 2D1ZA 3G0SA 4IPNB 5XIMA 1MW3A 3L5AA 2FTPA 1GPFA 4W84A 1BGAA 2J8TA 1HJQA 3FIGA 3W1MA 2JIEA 1JYVA 2GFTA 5BMWA 4UTUA 5IDIA 1BQCA 5CC3A 1TZ9A 4MGGA 3Q94A 4CNUA 2DSVA 3KS6A 4XIMA 2ATSA 2FGBA 1DJYA 1EXPA 2E6AA 3CAVA 2H3DA 4I7UA 3NQBA 2NXIA 2FB3A 1IYXA 3BCFA 4LBUA 3LQLA 4R3UA 5TBOA 3VIFA 1GTEA 1OFQA 2OOGA 5K3VA 2VJXA 4Q8UA 1CECA 2WXDM 2E8YA 4Y7EA 2E6FA 5ABGA 4PB3A 1R3YA 4GUJA 5G1TA 1P6CA 3CHFA 5I3KA 5LGZA 2QUNA 7REQB 4IL2A 2RGLA 2WNZA 4XO6A 2ZICA 1UP2A 4HT3A 4M6VA 1Z6KA 1MZHA 3CHEA 5HQLA 3URNA 3K4AA 1GYNA 1YDNA 1JZ5A 4O8RA 5D8ZA 3ZFHA 1YX1A 5CG7A 4N2YA 3PFRA 3VD4A 3CS2A 3RR1A 2XUCA 4GGHA 1RBLA 4UTWC 1MMFA 3N4FA 5I0DA 2OOFA 3Q58A 5H91A 1YADA 4JGDA 4W86A 1GQKA 2P1FA 2X2YA 4PN2A 1KCLA 1UZ4A 3SIMA 3OJGA 1XGEA 1Z44A 3B0XA 5DRCA 5A2CA 1OX4A 3LTPA 1ZBKA 3TLLA 4NZFA 4JBRA 2VD8A 4JKMA 3VNKA 2FHBA 3GTXA 3W4RA 1QI2A 3LSCA 2QPSA 1GZGA 4JKLA 4I90A 1YQ2A 3SURA 3UWYA 3WJXA 5JH1A 1OYBA 3CB3A 1Y0EA 1UZ1A 3FKRA 3OLDA 3WFLA 4GFIA 1E51A 4PUKA 3B0UX 2R1KA 4AISA 1QNSA 5DQPA 2IQ0A 3B0YA 3WDJA 3PAJA 4D8AA 3BO9A 1YRRA 4P5UA 2ABAA 4EAYA 4AWUA 1EQCA 3PUOA 1XIEA 2YDAA 2DUXA 2P76A 2EEXA 4S3AA 1FCVA 4EE9A 1K77A 3W82A 1F76A 1BVZA 4EF9A 5E6ZA 2FB2A 3VKBA 1DE5A 1FWRA 4ZFMA 3P82A 5CBBA 4WKAA 3NL3A 1A0DA 4B5VA 1W0MA 3NDZA 1VRDA 3M0ZA 4A3UA 4MNLA 1FWGC 4Q4KA 4M19A 4NILA 4HMNA 3P14A 1WAUA 2FLIA 3FA3A 2NQ9A 1H0GA 2AGTA 3PZVA 4KGLA 4FXSA 2VNCA 4H4IA 4KGJA 4AUBA 3R58A 1ZAIA 3RNDA 4PCNA 4JD4A 5M03A 1H7OA 3F2DA 4A29A 3KVMA 2Y85A 5FACA 1R3QA 1V08A 3W0KA 2XFFA 3SAZA 3ALFA 3ARVA 1I1XA 3ITYA 2QGYA 5BRPA 3TSMA 4EPBC 3GHTA 5I3IA 2E68A 3CYVA 3TNOA 1QPKA 4GCAA 3GFXA 5IHRA 2GPTA 5AVNA 2WSRA 9XIAA 3H4XA 3CHCA 2JBMA 1Q4WA 3OO2A 5AKQA 4BQ5A 3B8TA 3FXYA 3GR8A 2J7GA 3GW0A 4G7EA 3B9EA 3TA9A 4D6HA 1WCGA 1GJUA 2GQ8A 3M0MA 3QGKC 5DMLA 4AQLA 1ONWA 3CM4A 1E1CB 4JFVA 2ZUUA 3QGAC 2W3ZA 4DJFC 4RNHA 2YIHA 2QUMA 1FOBA 2ZX7A 4XSLA 1XLAA 1XCXA 2J66A 4ADSA 4CCDA 3WEMA 1AW5A 2QCEA 5CGMA 3AYVA 2B7NA 2CBJA 4WSKA 4H9MA 2DEPA 2EG8A 4N9CA 4W5ZA 4PTNA 5BRQA 2ON3A 2W67A 4K37A 4NXSA 2E0PA 5JQ9A 3G77A 5LNRA 4GVGA 3S9ZA 2EO7A 5AB3A 2HE5A 4JICA 2EPKX 4B3ZA 3LV5A 4O1CA 1W3HA 3KOZA 2XJ7A 1RVGA 2SFPA 4LRTA 4MNJA 3TNBA 1UKPA 3UD6A 4DWSD 1W56A 4HNCA 3PZ9A 2QW5A 3OP2A 2C13A 3BLKA 1VFOA 4YCOA 4C6QA 2PF8A 2YR1A 3WL1A 1K4GA 3TN3A 1VLIA 4FZIA 3RO6A 4HTBA 1J11A 1G0CA 4C7GA 4KETA 4ZBCA 1YNPA 5J04A 3IARA 4CEXC 4K1WA 1I2NA 1QO5A 3HU7A 2QMKA 4M7SA 2QJHA 1UWIA 2QPUA 1W3KA 2PODA 2YL8A 3WJWA 2WKGA 1XYMA 1ADDA 2PDLA 3GH4A 3NQAA 4G1NA 3HQOA 1BGGA 2QVHA 1S38A 3WLNA 1H4PA 3CT7A 4PH6A 3AAMA 1WDQA 3WLRA 1QWKA 2PGWA 1KFKA 4QEHA 5A6JA 4GYKA 3IJIA 1JGIA 4P8VA 4RZBA 3B04A 1MQRA 3CTTA 3L0GA 3T40A 4CCEA 1SPQA 5DEZA 4B90A 1DJWA 3ZR5A 5REQA 4NAEA 4V1YA 2RDXA 3GQYA 2PDWA 1KD0A 1O4UA 3W02A 3FGCA 1XS2A 4EWND 4LGXA 2VHLA 1R46A 3BSHA 3KRBA 4LRSA 1Y65A 5CC5A 3TYCA 1MXGA 4BEQA 1E72M 4GBUA 1JF6A 3NQMA 2OCZA 5JBFA 1GUVA 4DJDC 1XIFA 3LNMA 5HANA 3UP8A 4Z42C 1JUBA 2F2KA 4MPQA 3EWWA 1A50A 3QHOA 5K4XA 3OPSA 1VIZA 4LPCA 3YPIA 5F2LA 5AHIA 5I24A 1X6NA 4JTDA 4MDPA 4O57A 1PAMA 4Z0JA 4AW7A 2GSHA 4L6OA 5FSEC 2H9AA 1OZQA 4KEVA 3NO1A 1XLHA 3L23A 4E4UA 1B4KA 5JMUA 1PPIA 1OIMA 3VZXA 3FLUA 1JNDA 3W1RA 1E6RA 1U1UA 4GI4A 1EEXA 4MAVA 4PMZA 3GKAA 1LOLA 3BVJA 3MBFA 2ZZ7A 3RITA 3GXTA 4Z1DA 3BE7A 5HWMA 3B3DA 3AJ7A 4K1GA 1X96A 2H3BA 4UTTA 3WQPA 3QJAA 3E96A 2AGKA 1JGMA 3MCOA 1B3XA 1KTBA 2PDIA 4FMVA 4IFKB 3ZR6A 3GDMA 1YBQB 4NKCA 3WLOA 1I75A 3UZYA 3VZYA 2Y2WA 4NHVA 2XH4A 3G1RA 2WNNA 3MI2A 4KEZA 2ZUVA 4MY9A 1E56A 1RCQA 1JL8A 2XSXA 2ZZ1A 4LV4A 2FYMA 1HKVA 4A6GA 3HF3A 4AZ5A 5A8NA 3EWUA 1M65A 3OYZA 1ZUAX 1SJAA 4B92A 2X1SA 4CN6A 2DIJA 5EY5A 4F8XA 3EB4A 1LUCA 3PF3A 1PSCA 1XIGA 3LY0A 1XG4A 1EJTC 4UTMA 5GNZA 3P8IA 1Q2SA 3GKFA 1I60A 2D2OA 3WH8A 1OIFA 1ZZMA 3WQFA 2VGIA 3BJTA 5FCZA 1CIUA 2AL2A 5D9MA 3UT0A 1IGWA 4RNIA 1L6GA 4HYVA 5G2HA 2VFFA 1GVYA 3LRLA 4O0QA 4PBGA 3H7VA 3ANVA 4P8UA 5A6LA 5A6AA 4QITA 3E38A 3S9IA 5E0KA 3SQSA 4RUBA 5TF0A 1K9FA 2XH2A 1OQFA 3KCOA 1TWIA 4HMEA 1EX5A 4WXYA 4JPGA 2D20A 1SR9A 3AIEA 3WH6A 1AJ0A 4RDZA 2CNCA 2B0MA 2G97A 1B31A 1XKYA 4F0RA 1VKFA 1ZALA 4H00A 4TO8A 3N14A 3VIGA 3P5ZA 3NVTA 4W9TA 3AS1A 4RXFA 4AD1A 4A8NA 4KERA 2CKSA 3N9KA 2PSNA 4YJ5A 2HWGA 1W3IA 1XUUA 1V03A 5T9BG 3W6YA 3TQVA 2CZFA 4NP7A 3UFYA 4DF2A 3GG8A 3AIRA 1QT1A 1AVAA 3NZRA 1RJPA 2EG7A 3IGUA 2HVOA 3R0UA 5A8PA 5BMXA 3AZTA 3MKKA 3MUZ1 2OKOA 2EPLX 3NO3A 2PRHA 1EC8A 2V82A 4GIEA 4B4HA 2ZUSA 5IBXC 4DJDA 2VDGA 2CITA 3TXVA 3W25A 3CZKA 3CZLA 5AYZA 5G4HC 3AXMA 3O9NA 4LC6A 3DBPA 1G6CA 1O66A 3AIQA 3W7OA 4WLCA 2VRJA 3KAOA 2WC7A 3Q67A 4NY2A 5H1WA 1SZEA 2WLYA 5C7HA 2OVLA 3CNYA 2GJNA 5I07A 1KW1A 5BU9A 1Q8AA 2PWGA 2X1IA 1UD8A 1RVKA 2YL5A 4GPNA 3QM3A 3S6OA 3S2LA 4QR6A 3KBSA 2UY4A 1OFOA 4JHOA 3TWBA 1W9BM 1FHUA 3ONBA 3G0XA 3UPWA 3OBAA 3PBVA 3VUSA 1UA3A 4GHRA 4MSSA 4FX7A 4MB1A 3CZ8A 4QJ4B 3JZEA 5AECA 5C9UA 2WVSA 4UQDA 3GR7A 3AUOA 1BPLB 2V5CA 1QNPA 1T41A 4I8YA 4TX6A 3CWNA 1OADA 1RLCL 4LVGA 3W7PA 3QV9A 2V81A 2J8GA 3BOLA 1XISA 3A3WA 4K7YA 1XLLA 2GWGA 3PJTA 3NQ2A 4ZXLA 2FZMA 3JR2A 3V0UA 2XIOA 4XBJA 1XSIA 3E0LA 3AO0A 5EYWA 3D6NA 1JPHA 1KBJA 1PDYA 4GYJA 2J24A 4N02A 3TTOA 2ZDRA 4HSHA 3OOQA 3A12A 2A5HA 3P8JA 4HU8A 3NEHA 5IFPA 1A80A 4GY1A 4CCZA 1UP3A 1UPMB 1PTAA 5BXRA 1NVMA 3U6WA 4MJZA 2QCCA 1UR3M 4FLSA 2ZUMA 1ONXA 3BZGA 4KH2A 4L4PA 2YB1A 1E0VA 1PDZA 2QAFA 3DX5A 3UXIA 1FWSA 1TPH1 2J9XA 2ZX5A 3M07A 1JUKA 2OSWA 3RLHA 3UA3A 3O16A 4MVAA 3HN3A 2JF7A 3E0VA 1CLXA 2DORA 2EGZA 2WMKA 3WD1A 7ODCA 1BSIA 2ZA1A 3E1F1 3U4AA 5BRBA 3B4YA 2B4GA 3UW6A 2ZZ2A 2V2CA 4WD0A 5HR6A 3VK5A 1W9XA 2QVNA 3NUKA 1A5LC 1RK5A 3DXIA 4OVXA 1TUFA 1E3ZA 4D72A 1VBJA 3GU2A 2NQHA 2WJEA 4AD4A 2GQ9A 1LDCA 2PDPA 3KTCA 4KRZA 3UG3A 3GDLA 1QK2A 2CLFA 1EA9C 3GR4A 2J75A 4M3PA 3UCQA 3A21A 4L9XA 3SFKA 3LNPA 5LA0A 4JN8A 1YPIA 3AXXA 3EBVA 3AHVA 2BY1A 1FDZA 3V35A 4HPHA 3VOCA 3TFCA 3G1XA 2RFGA 3RRXA 1OABA 1PV8A 4UNIA 4X9YA 4ZE5A 3CJPA 2VEMA 3OLIA 4HIBA 1LQAA 3E3HA 3QQ0A 3GDKA 1ZAJA 2QUVA 4D8LA 4LAZA 3WK3A 4R9XA 4OUEA 2AL1A 3KL3A 5B7YA 3G0UA 3OQEA 2HPMA 3PPGA 1SZFA 2EPHA 3ONCA 2INZA 1UROA 1LCOA 4WF7A 2VGBA 4ZOCA 2BBFA 4YWSA 2CWNA 1M53A 1IEVA 3NFUA 2QMJA 5CZJA 1Q2RA 2FDMA 1HO1A 5ABFB 3VMPA 3RX4A 3PPFA 1W31A 2OQYA 4AC7C 3T0CA 3WNPA 5HJLA 2WMJA 4WGHA 4BHYA 2QCDA 1POJA 1HT6A 1NFBA 4ZTXA 3IJ9A 3L2IA 3AS3A 1LOQA 2XG9A 2ZQ0A 1G9HA 3AUJA 3GIYA 1K02A 3VKKA 5F2MA 2DQWA 3NG3A 4KPLA 2XPKA 3ZR4A 2GOUA 4NIRA 2YCJA 1NQKA 1D3CA 1FWDC 4L1WA 2OXNA 2NQ5A 3A24A 3AMDA 4M29A 3WDHA 5DBUA 2EPNA 4DAIA 3FV9A 1D3GA 3IACA 3MMWA 4XIAA 4AEFA 3TU9A 1ISWA 4Q8VA 1MDLA 3VCNA 1JPKA 3RR4A 2WVVA 3S2NA 2ZVIA 4H9UA 4AU0A 3O6YX 3GVVA 4S3JA 4BQ4A 3MV01 4YL2A 3NPUA 1XYZA 1E6PA 4ZSTA 1IR2A 4YYFA 2YLLA 2EPMX 2JFEX 2NWRA 4UCFA 2OQHA 4JYEA 1VHCA 2V67A 2YCEA 3HG4A 3AIVA 1KWKA 1J9YA 1Q6FA 3PBWA 3MO4A 2PDFA 2Q02A 3M0JA 3OBEA 1H11A 1RP8A 1V7YA 3GYCA 1NH6A 2ZC8A 3MZ2A 3TR9A 3T6CA 1RK6A 4CQ8A 2DJLA 3N1AA 3WY1A 5HQEA 4FF5A 4GQ0A 3TYBA 3NGFA 2X2GA 4UFJA 2E9BA 3WLMA 2XHYA 3GYEA 3LCGA 4DY1A 2CBVA 2WB5A 4XUYA 4QLJA 1L8PA 2DIKA 3KRUA 1SW7A 3GTIA 2E28A 3ABSA 3PHAA 3T0TA 3R89A 5EPDA 3TZNA 3TIMA 4R85A 3ZWTA 1X97A 2QCDB 1WXJA 3ES7A 1GHSA 3S2JA 3M0IA 1ZU8A 1YDYA 5EFFA 1XM3A 3U7VA 2O9OA 3EPOA 2CLOA 4G7FA 4Q8OA 5CZKA 3NYDA 4HJWA 2CFFA 4I5RA 4UNKA 3CBWA 2D0FA 3ID7A 5C55A 3N6QA 1XCFA 1KM6A 4HCHA 2H8XA 3W83A 4W4QA 1RY8A 3UVIA 4RV8A 2X05A 4OZOA 5I3GA 3F4DA 3UYCA 1GYMA 1UUOA 5HA7A 2VYOA 1TPUA 1KXHA 2BHYA 1ZRQA 4WEVX 3MY9A 1V51A 1FWNA 3OTRA 4QRNA 2G3NA 3L66A 3DHDA 4BI6A 1I2QA 1OG0A 1XRFA 4W8LA 3LLXA 1B30A 1FH9A 1DIDA 1VJIA 2V69A 3T0AA 4A35A 5DT5A 5HJYA 1E1FA 3W76A 5AOUA 1E4MM 5D30A 4OKDA 3GC2A 5EMLA 4IOTA 1Q6LA 4W87A 3S2CA 2BDQA 2HQAA 4F79A 1AD4A 2IPFA 4L4LA 1VBRA 5GVJA 2UY3A 2VI0A 4PMNA 3SR7A 1VS1A 3LGDA 1EGZA 2BWGA 4IICA 3SI9A 3VU2A 3TC6A 1OC5A 4HZ6A 4W89A 1O5QA 1V77A 1A5CA 3LSBA 3BLLA 3FGCB 2R1LA 2C8NA 4ROPA 1I45A 2BHZA 3W2LA 3UWZA 3IJQA 3NQDA 3MV11 3LCHA 3GWQA 1DP0A 1GT8A 5BXPA 4RNFA 4WDTA 1PCKA 3WQ8A 2NQZA 2E5BA 1U22A 4MJ2A 3TAKA 3DCPA 3HIJA 3ITTA 1DJZA 4DZAA 5AC5A 3ANUA 4HCLA 5KINA 3RJYA 4N6EA 4C60A 4W8BA 1ODUA 1UH2A 3MBDA 4ZENA 3ITVA 4TMBA 4XK2A 4E6MA 4K6AA 4HK7A 1C8VA 3HA1A 3BAIA 4JN6A 2PDGA 1VEOA 5DXXA 3ITGA 4QQ3A 3VIHA 1B2YA 5HR7A 1Q63A 3ANYA 1V6TA 3TYDA 2INFA 3F5JA 3QKEA 4C6PA 4DLFA 1DXEA 1ITUA 3PR2A 2C0AA 5CPTA 3PNZA 3C2VA 2CERA 3C3UA 2ACSA 5CC7A 4HA1A 1JPDX 1WXZA 2PB1A 1MEIA 2V3FA 2J7DA 1Z9AA 4C65A 3DC8A 4JX6A 1A5KC 1A5MC 4NUWA 3B8SA 3HMJG 3M7WA 1PX4A 4XD4A 2G0WA 2OYLA 3VIJA 1RY0A 2OO0A 3NEVA 4JL1A 3MUAA 3W7NA 4ZO9A 3FXGA 3GG7A 3LUTA 5HXMA 2DW7A 2R91A 3T08A 2FZBA 2YSWA 1E0WA 2NV1A 1KR1A 3N2MA 1HGWA 2V68A 4WCJA 1B0IA 3WBEA 4IT1A 4MG4A 1NDVA 1G5AA 3W7RA 4DN1A 1JEZA 4I9AA 3BG5A 3EPNA 2ALDA 4AMCA 3H21A 3C4UA 1NOUA 4KWSA 2QNEA 2E7FA 5FKYA 4Z1YA 1XHGA 1W5PA 3HG3A 4MY1A 4TU1A 4HHHA 5DRIA 2QAPA 1YHTA 3VVGA 1NFPA 1KGUA 2YZRA 4MKVA 4AIEA 3W7EA 3OYXA 2FVLA 4DBUA 1SFJA 3LM7A 3ABOA 1CLKA 2VR5A 5HK4A 2YXXA 5AY7A 4JKKA 5H8UA 1ZCCA 1B4EA 4E4PA 3VOJA 3SJNA 4PA8A 4QS5A 3LLDA 3RILA 2CZ5A 3I68A 4IPIA 1SFTA 5SWUA 1GEHA 3QV7A 2DZTA 3PWAA 1IIHA 3GXDA 2OGJA 4AHOA 1E15A 1JPMA 3W38A 2OZ8A 3ITCA 2AQWA 4JTFA 1M7XA 4DVOA 4Q8QA 3L5MA 4FA3A 4UTLA 2QLYA 1F6KA 2QPXA 4R7WA 4YCPA 1O60A 4XAYA 4UIOA 3N6HA 5EA9A 2EKGA 4AWSA 1HKJA 4RDVA 5EMYA 5AFDA 3SZ8A 2W91A 3H2CA 1HKKA 2QV5A 3SUSA 3HJEA 3B03A 1JQVA 1AMYA 5LNSA 1EH9A 1F3TA 3EOEA 1VGAA 5BYWA 2W66A 5GJPA 4RE0A 3UVAA 1EYEA 3VM5A 3FX4A 3RRAA 4YHGA 3SCRA 3P6LA 4K38A 3URQA 3IK2A 1DWIM 5LA1A 1TMQA 3HM7A 3OU8A 1CXIA 1ESWA 5AC6A 1J6PA 1QDSA 1EJSC 2QGHA 2YFOA 4IGHA 5FJRA 1XBVA 2DVTA 1LRTA 1MW1A 2PWFA 2XTKA 4DJFA 5H6HA 5C8BB 1ZS2A 3R0KA 2AAMA 3KCJA 1OWQA 3UJRA 4MJ4A 2J7BA 2ONEA 4Z2LA 3DZ1A 1XLEA 4ZO7A 2D23A 1FBAA 5L9FA 4LBRA 3ENLA 5C9ZA 3WQVA 3I4KA 1XLMA 2BP1A 4D9PA 4C6OA 3G6MA 3LG3A 3SUVA 1QW7A 4E4FA 3NXLA 4AY1A 5D03A 1WDSA 2PDBA 3DAQA 2OEJA 4ZOBA 4BWLA 2JIWA 1U83A 4KWVA 1LBLA 1WOAA 3HQ1A 3VA8A 4BY3A 3OW1A 3GXIA 1DQWA 3ICJA 3EWCA 4U2ZA 3BGAA 4W7WA 2PP1A 5A5WA 1NDWA 4U5KA 4DNHA 1SO3A 4HA3A 1RLDA 3GXFA 5FJOA 2F6XA 3MMTA 3G1VA 4P7OA 3E2SA 2A7PA 1EOKA 1IT8A 1YXCA 4M6QA 4YIWA 3GG0A 1CGUA 2XYLA 5FAGA 3Q45A 2ABBA 4B91A 3MYPA 3LXAA 1ZBVA 3C86A 3THAA 2D0HA 3UJEA 1V3IA 2XH7A 1HP5A 1US0A 3UG4A 1V7AA 2ICSA 4IIFA 4GE8A 3NQ7A 2HTMA 5G1MA 2NQLA 4LS2A 3UPBA 3M9YA 4IQDA 1UR2A 4S39A 1ISXA 4ADUA 4MFEA 3CB8A 4EACA 3W24A 5CPLA 1M7PA 2GGHA 4KWUA 4QEEA 3EX6A 1IE7C 4ZQNA 3FOKA 2WM1A 3NNTA 4G8TA 1B90A 1EP1A 3SRDA 3TJXA 1LG2A 1TJ1A 1R47A 1XXXA 4GACA 5DCBA 2DSZA 3BMWA 4IH3A 1G4SA 2DGAA 1FA2A 4IXXA 1OC7A 3P2VA 5CC6A 5HMSA 1TVLA 4GKLA 4IQLA 4CD4A 5FF7A 3VAVA 3LS9A 1HJVA 4R33A 1AK5A 1JYXA 4E2OA 4UR7A 4N9EA 2JGYA 2QJMA 1W8SA 8CGTA 1XINA 2GSJA 1OYCA 3MW7A 3TC3A 3NYZA 2Y61A 3V1HA 3WQEA 2RDUA 2ZZ5A 3QPEA 3DYOA 1B3OA 3CIWA 4C6LA 4A2SA 3AFBA 3IWPA 2YBUA 4MWAC 4UXDA 4NG3A 3LV6A 1UB3A 3G1HA 2BZNA 2YDRA 1YMYA 3NQFA 4WVXA 1F07A 2ZBTA 1OFEA 1JDDA 4UQBA 3EEGA 3ERPA 4GQRA 3H4GA 3ARWA 1W5NA 3OVPA 5CLWA 2Z25A 2FIQA 4RNJA 2X1RA 1ME7A 4NJJA 2KX9A 4LH8A 5CBJA 1FTXA 4WKHA 4FHAA 4UTTC 1H09A 4O28A 2AOSA 2ZTKA 5H8MA 1YXDA 4OQVA 4BF5A 3U3HA 5HOSA 3P7YA 3R43A 3HGOA 1AA1B 1KV5A 2QDDA 3KCLA 5JIPA 1QASA 1ISVA 1VAHA 1UR0A 2PI6A 5GJNA 1U5VA 3LX9A 3CU2A 4NT0A 1ISZA 3WKZA 1XQLA 2V5KA 5C2CA 4YVXA 4MIMA 2C1HA 4Q7NA 4QCEA 2ACUA 3TC7A 1NTHA 4U10A 4MYXA 2Y7FA 3EDDA 4QP0A 2OQLA 3IUIA 1GG1A 3P0XA 4HMCA 4HZ8A 4CUCA 3RCMA 1HGYA 1FQ0A 1Q5MA 2OYMA 2QZRA 2PS2A 3F5KA 2WBGA 3RLVA 4IGMA 5BOFA 1WBJA 3CXOA 3F5LA 3LPFA 4GYPA 1TA3A 1H62A 1VH7A 4LWWA 1B3WA 4IFKA 1UH4A 3E6EA 3ITXA 4GGBA 4HMDA 3AZSA 3VNIA 1R3TA 1QNVA 3TQPA 3QMRA 4QQUA 5CQ1A 4R27A 3RM4A 4HNOA 1R38A 3CYJA 1IV8A 1XBZA 2FGLA 3M7SA 2WYSA 4KRTA 3MZNA 2CCRA 1UH3A 2Y6ZA 5KEZA 4XTDA 1PJ9A 3OVGA 4UZUA 1W8GA 1PKNA 1ZFJA 4JTSA 2OX4A 4IJCA 4QNWA 1UBSA 3APGA 5FL0A 2YCLA 4L5ZA 3KVLA 4UMBA 1GOXA 3QTGA 3WSUA 4UMAA 2XM2A 3A5FA 5KZEA 3LTSA 1JCYA 1DJNA 3V18A 1R7OA 1LG1A 1X7IA 3SUUA 3THCA 4HU0A 2AL2B 5IM51 3BL3A 1SW0A 4RLIA 3WQDA 3W1QA 1IF2A 3H2AA 4JCMA 2YXOA 1TWSA 4C91A 2OX1A 3R79A 1UD2A 1WZLA 3QZAA 3DU0A 1R3RA 3NQVA 1J0KA 2JF6A 5FIPA 1HQTA 1HJXA 3SSJA 4OV4A 2KZHA 4A3RA 1BYBA 1DV7A 4HPJA 1W5MA 2ZE3A 1P5BA 1LP6A 5G4WA 2DUZA 4H7CA 2V63A 1YE4A 1L8NA 1WOBA 4HB7A 5I7GA 1DXIA 4PL1A 3W7KA 4R53A 3HTWA 4KCVA 4PMJA 4Y9OA 2DP3A 4HYRA 4DUWA 3WN6A 4I9TA 3TJ4A 1MXDA 4FXJA 1AQMA 4MKNA 3CZEA 1UD4A 1CGXA 1DHPA 1Z8AA 1EPXA 3A6OA 3C52A 1JJKA 1PHWA 5A69A 4RV3A 1WPCA 4A8IA 5D04C 1I0DA 5CCZA 3UBPC 2IMRA 2XN0A 2YPIA 2JALA 4EK7A 1P6WA 2OZ3A 1P7TA 3S3GA 1FWBC 5A6TC 4RK8A 3CGTA 1GOKA 2DZVA 3OA3A 3B8DA 2WMGA 5CPNA 4DHGA 2H9AB 3BH4A 1A0CA 5TQLA 4A22A 1QI4A 4EWJA 4JTHA 3N3MA 4F3HA 4TV6A 1W6TA 5FJIA 3SCSA 4KT2A 1OZMA 1WP6A 4JEJA 4BZYA 1PHQA 2A3HA 4GX8A 2DY3A 3C61A 1QATA 4H8NA 2PDYA 3ZSTA 1CNVA 3E5BA 3GFYA 4Q7BA 4AEOA 1X6LA 2J4GA 3USBA 3PWIA 4IPPA 2A0NA 3GHRA 2XFYA 1S46A 1NARA 4GYPC 2D3LA 4HVXA 3W73A 1UWQA 2R1NA 3EYPA 1C7SA 3EMZA 2YJQA 4UTJA 1CB7B 1KXTA 4DELA 1GZ1A 5HNRA 1XYLA 4M24A 2R24A 3M41A 2J7CA 3BCDA 4FOJA 2RDTA 3SY5A 1W1A1 3KBWA 4CD6A 1US2A 4XZNX 1PCWA 3ARYA 3ATZA 3VTRA 1QVBA 2O7SA 3OZOA 2E1WA 3UQNA 3R4IA 1IEIA 1R0MA 3KVKA 5I00A 1RZMA 2FFIA 3N2TA 2GWNA 1VPXA 2I5QA 4GXMA 4H3DA 2V5BA 1PTDA 4UFLA 4YTTA 4URIA 3QV8A 4J3SA 4UUIA 3W84A 5C9WA 3PJWA 2OKTA 3G1DA 3QZEA 2Z1SA 3KL5A 4PGLA 4JTTA 4G6CA 4IX2A 4UNLA 3RUBL 1HJSA 3S9YA 1YNYA 4MFDA 1LYXA 5D9OA 4TXEA 1M03A 3FY1A 2DZPA 5BXTA 3S2MA 3WH9A 5EBAA 2FTWA 2XGZA 5D2YA 1NELA 3F03K 3PWGA 2L5HA 4CEUC 5A1AA 1YTDA 3F1QA 4W93A 4I9JA 5AHMA 2R1MA 3DFHA 4IIBA 3TTEA 3CUFA 1IR1A 3W87A 4GUHA 4N7QA 1Q7MA 1XICA 3B0PA 3MPGA 3M6YA 4GQQA 1UUMA 1ZHAA 4UR8A 1CXHA 1GOWA 4QNEA 3D0CA 1KGXA 3B0VC 1XQKA 4IIHA 1OB0A 3VYLA 3BAKA 1BXNA 1FHVA 1MNSA 2C16A 2E5DA 1O5XA 1RPKA 4RZ6A 1X38A 4TX9A 4X9SA 4MZYA 1WDWA 6TIMA 3KVJA 2W62A 1MDRA 3WZ0E 3AHTA 4NXKA 3FDKA 3MVTA 2PWDA 3MMDA 4S2BA 2J6XA 2OEKA 1Q85A 2CLMA 3MI6A 8RUCA 1V6WA 4AZGA 1R3SA 3LCFA 1V93A 3N2OA 3NZ1A 1EUNA 1IHIA 3MDWA 3GD6A 4UTHA 3CQHA 3W86A 2OMAA 3CASA 2O9TA 2DSUA 2NT0A 4S3KA 3AMCA 4JFTA 4IMEA 3DHFA 3UWWA 1SU5A 1H49A 4CNOA 4CQBA 3KM8A 4CGTA 4U3AA 2GVYA 3H22A 2WQDA 3JUGA 2JEQA 2P0IA 1EJXC 3IV3A 4BFAA 4HNUA 4JY9A 2NVDA 3KHJA 5HULA 3FJ6A 1E70M 2J27A 2Y5JA 4O54A 3A22A 4OGZA 3CT2A 3FNDA 3P5YA 3BAYA 3DFTA 4DYKA 2D22A 4PE8A 1P6BA 3ABRA 2GVEA 1ZSXA 4P8WA 1F9CA 1XL9A 5J5RA 1V0MA 1Q6DA 2PU0A 3SCQA 3OEXA 5CXPA 3I3EA 2XIMA 3M43A 1CGWA 4JIRA 2I57A 4ZEPA 4ECLA 3RM8A 2VZSA 5C7VA 2D73A 1BKHA 2QIIA 5B80A 4S3FA 5G5IA 1EYWA 3TW9A 1JCNA 2DT1A 4LUTA 1PZ3A 1K3UA 3TW7A 2ZX8A 5FJUA 5J5DA 4HK5A 1JAKA 3IVTA 4L9ZA 4U3CA 4MB5A 1R8LA 4LUIA 4IM4A 4S3EA 1DORA 3R6IA 4GA8A 1Q6OA 1KXVA 2OWCA 2PTYA 1TWWA 1DEDA 5FEZA 2VT0A 3LHWA 3QFEA 1TREA 3CQKA 1QI5A 4QIUA 3MA8A 2ZVRA 1MXSA 3KLLA 2CXGA 2WCAA 3T9PA 3R0DA 4AH7A 1B9ZA 2Z2AA 3VDAA 3S5ZA 4TR9A 1YEYA 2DSWA 4O18A 1HL8A 4PTDA 3MVIA 5BU6A 2POTA 3FW6A 4F0LA 3GM8A 2EPOA 4O4WA 1NWRA 4RCXA 3CMGA 3IAPA 4MLJA 1W91A 3OGSA 2PLMA 4ACYA 3WNNA 1XYFA 5M2FX 2XZ9A 3SBFA 3PUEA 3L4UA 5MKGB 6XIMA 2ATMA 3M5VA 3AI0A 2PLCA 4TX8A 2X1UA 3DC0A 3ZM8A 1R2SA 1QCWA 5D9NA 2GUUA 4PMRA 3SCWA 3LHTA 3N3TA 2QS8A 2X0YA 3UG5A 1MUCA 4WX2A 4AVOA 2IPWA 3WK2A 2QJNA 3R8HA 3E12A 3VE7A 1HF6A 1CX9A 4G9PA 1DWGM 3NSNA 5DCDA 4DAFA 4QISA 4C6BA 3UA4A 3HFYA 4G7EB 4ZQRA 1FCUA 2GL5A 2XWDA 4S2CA 2PTZA 1P0KA 4GFSA 3CUIA 3BMVA 3PZMA 2Y1HA 1QO2A 3ARXA 3LM3A 3WMBA 2BOFX 2YCIX 1GQLA 4GH3A 2QDEA 4JIQA 1N8IA 4KS0A 2GK1B 1GTHA 3V0SA 3LBOA 1GQIA 4GC3A 3EOOA 3KOYA 1CENA 4E8GA 2C1GA 4LYRA 3LRKA 2OT1A 1TIMA 3FHQA 1SUXA 1I1WA 1OFDA 4ZO6A 3L65A 3BC9A 3IUDA 1H60A 8A3HA 4A3YA 1TPWA 1JZ4A 5EFDA 1PXGA 4UOQA 1IQ8A 3WDPP 4YYCA 4CNSA 1KTNA 1EKOA 2VR4A 2YL9A 5LHEA 3H55A 2UWFA 2X16A 1TTIA 1A3HA 3AQUA 2VX4A 3KEHA 4JY8A 4QLKA 4KCTA 3AMLA 1KC7A 2BGQA 3PZIA 5DCEA 4HU4A 4N4QA 1V8EA 1S2CA 1XBXA 5A2AA 9XIMA 1X7FA 4C5YA 5F4WA 1NEYA 3GVQA 1EDTA 3CV1A 2CHRA 3MWAA 3UWQ