4WRHA

Akr1c3 complexed with breakdown product of n-(tert-butyl)-2-(2-chloro-4-(((3-mercapto-5-methyl-4h-1,2,4-triazol-4-yl)amino)methyl)-6-methoxyphenoxy)acetamide
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
316
structure length
316
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Breakdown product of N-(tert-butyl)-2-(2-chloro-4-(((3-mercapto-5-methyl-4H-1,2,4-triazol-4-yl)amino)methyl)-6-methoxyphenoxy)acetamide trapped in active site of AKR1C3
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C3
total genus 116
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4wrhA00
3EAUA 3FJNA 2IQDA 3M0IA 2PF8A 1Z3NA 3QKZA 4JQ1A 3RX2A 1XJBA 4PRRA 4ZFCA 4H8NA 1A80A 3UWEA 2IKHA 3G1RA 4XZMX 3UP8A 3UGRA 1YNQA 4XO6A 4XK2A 3WCZA 4YVPA 3CASA 2J8TA 3LUTA 4PR4A 3R43A 1XGDA 4LAUA 4DBWA 3UYIA 1AFSA 2ACSA 2PDGA 3LBOA 2IKGA 2AGTA 4YS1A 5KETA 4YVVA 2FZ9A 1ADSA 3LQGA 4XZLX 1R38A 3BCJA 4JQ2A 3GHUA 4JQ4A 3LEPA 2INEA 1HW6A 1QWKA 2BGSA 2NVCA 2PDMA 4NKCA 2PDYA 2FZBA 4PRTA 3CV6A 4LAZA 1X97A 4MHBA 4F40A 2PDNA 2FZDA 4GQGA 2R24A 2A79A 2ACQA 4XZHA 2DV0A 4H7CA 4IJRA 3V0TA 1US0A 4YVXA 4DBSA 2ALRA 3DOPA 3R6IA 4GIEA 3LNMA 3CAVA 2IKIA 3O0KA 4JTAA 1PYFA 3P2VA 1YE4A 2HEJA 4G5DA 4WGHA 1K8CA 1OG6A 1FRBA 4WDTA 3WBXA 2PDJA 4WEVX 1RY0A 3D3FA 1ZQ5A 2CLPA 3FX4A 1Z9AA 2PEVA 2HE5A 4EXBA 4XVEA 3R58A 1RALA 4QBXA 3LQLA 1RY8A 4JIRA 4LBSA 2IPWA 3GUGA 3C3UA 5HNUA 4GCAA 2NVDA 1HQTA 2FGBA 1XF0A 1AZ2A 1T40A 3CMFA 3GHRA 1MI3A 4L1WA 5LIWX 3V0SA 4OTKA 1JEZA 3LD5A 3ONCA 5LIYX 1AH4A 4JQ3A 4JTCA 3MB9A 3Q65A 3R8HA 3BV7A 1S2CA 2BGQA 5AZ1A 5LIKX 2FZ8A 3COTA 1M9HA 1MRQA 4DZ5A 1ZSXA 4WDUA 1AH3A 4RPQA 3N2TA 4GQ0A 4LB4A 3O3RA 3R8GA 4XVDA 1EXBA 3UZXA 2IPGA 3DN5A 1UR3M 2HDJA 3B3DA 2PDLA 3GHSA 2HVNA 1PZ1A 1AH0A 3N6QA 2PDXA 3R7MA 4FAMA 1IEIA 2PDUA 2HVOA 3H4GA 4L1XA 5AZ0A 1AZ1A 3Q67A 3NTYA 4PUUA 1EKOA 2VDGA 2INZA 2PD5A 3LN3A 4XAPA 4QXIA 2PDBA 2PDFA 1X96A 1IHIA 5HA7A 4JIIX 4LBRA 1PWMA 1S2AA 1T41A 3CV7A 2F2KA 4FALA 5JH2A 3LENA 2PD9A 1LQAA 1ZGDA 1C9WA 4PUWA 1MZRA 2IPFA 3ERPA 3V36A 2WZTA 5M2FX 2IKJA 4XZIA 2PDCA 1J96A 3MC5A 2HE8A 4Q7BA 4GABA 1Q5MA 4IGSA 1YNPA 4JTQA 4EXAA 2PDPA 3LZ5A 1Z89A 3RX3A 3H7RA 5LIXX 4JTRA 2ACUA 3KRBA 3V0UA 1SM9A 3UZWA 3WBWA 5LIUX 4XZNX 4PMJA 3H7UA 2I17A 2PDIA 1S1PA 3BURA 4LB3A 3ONBA 1QRQA 3VXGA 1ZUAX 5C7HA 2PZNA 1Q13A 3UZZA 1VBJA 1PWLA 2ACRA 4FA3A 3R94A 2IQ0A 2PDHA 3WBYA 4AUBA 4FZIA 3T42A 2WZMA 4I5XA 2C91A 4WDWA 3GHTA 3WG6A 1PZ0A 2DUXA 3UFYA 1S1RA 2P5NA 2F38A 3EB3A 4ICCX 1LWIA 2PDWA 4JTDA 5JH1A 1EF3A 4IJCA 5DANA 4R9OA 1EL3A 1YE6A 4XO7A 4ASTA 3BUVA 4QX4A 2PDKA 1Z8AA 2BP1A 3V35A 2PFHA 1VP5A 2PDQA 3UZYA 4HMNA 2QXWA 1GVEA 5HNTA 3U2CA 2DUZA 4YU1A 3F7JA 4Q3MA 3LZ3A 3UG8A 3S3GA 2FVLA 4JQAA 3G5EA 3M64A 4QR6A 2I16A 2ISFA 4WDXA 4WRHA 3M4HA 4JIHA 4GACA 4HBKA 2HV5A 4GA8A 2R9RA 2IPJA 2IS7A 3EB4A 1X98A 3RX4A 4DBUA 3CAQA
chains in the Genus database with same CATH superfamily
1Q6FA 1ZBCA 5FEXA 3U57A 1YW1A 1Z3NA 1CGXA 2DQXA 3GH5A 4YL2A 2OCZA 1E70M 3TN6A 2DEPA 1VIZA 3NQGA 3WUBA 3NIYA 2E6DA 2P88A 1W3JA 3CU2A 4CN4A 3L9CA 2XSXA 1RQHA 2ISSA 1LZOA 1JZ2A 4UFHA 3TMLA 2BVWA 1AW1A 3LUTA 4JTEA 5D9PA 4QIUA 1LOLA 3TCSA 5EBUA 1UG6A 5G4WA 4DO4A 3F4NA 4YIWA 3UCQA 2WVVA 3QPYA 3DYOA 1XL9A 4A2SA 3HFTA 3C6CA 3DGBA 3KVLA 1O5RA 4YHGA 1B31A 3H53A 3PP7A 8XIMA 1EDQA 4M7TA 1E0TA 1HW6A 5BMWA 5DCDA 4JPGA 1K8YA 3GNPA 1U2YA 4IUOA 3KCJA 3O1NA 4UTTC 2E9LA 3LBCA 3TLQA 1GPFA 3IV3A 2R91A 5E09A 2CLIA 3ITOA 5JIPA 3W7OA 1RCQA 4IPPA 1ISZA 2ESCA 3U2ZA 4TIMA 4O54A 4OT7A 1OC7A 1UJQA 1ZS2A 1XSIA 4DJEC 3LHZA 3O0KA 1O5KA 2VC5A 5FCZA 3TROA 1E6NA 1ZAIA 3ITVA 1F73A 4HMEA 3VNDA 4BWLC 2JK2A 1K8CA 2A7RA 1TR1A 3QEZA 2WZIA 4C90A 4UZUA 1R87A 4Z2GA 2OGJA 2XVPA 1UZ4A 5CQ1A 1EPVA 4KCTA 2XGZA 4YYCA 3PAOA 2EEXA 5I00A 2YIHA 4CQ8A 3GUGA 3QFEA 3GC5A 3C3UA 2CCRA 4JGDA 3GNRA 3L66A 1R3TA 1C29A 3PNUA 3NQCA 4IM4A 3UT0A 1VENA 2E28A 3S8HA 1FFQA 1L8PA 1QW8A 1TJ2A 1M7PA 2E68A 5LIYX 3TYEA 4KCUA 3RU8X 1IT7A 4S3EA 1KRCC 2GOUA 4TX6A 1OYCA 2GVEA 3O7UA 4DELA 5LIKX 4A29A 2HISA 4MKVA 1MRQA 1RJQA 3W1UA 2W62A 4GNKB 4F0RA 4I90A 3N18A 2VQTA 3N2XA 1FHLA 1UR3M 4YTSA 3WEZA 3GIPA 2PDLA 3C52A 2WWDA 4JTLA 5E9AA 1M7XA 3GDMA 3VIMA 1EX1A 1GCYA 1UOKA 4ZR8A 3S5SA 4HNTA 3N3TA 1KCKA 5T26A 4E5TA 2DGAA 3I7RA 3H4GA 3ARPA 5D2WA 3AHZA 1H61A 3WLLA 4ZQCA 4XISA 3RM4A 1ISYA 3H2MA 3K1GA 1EP2A 3IAQA 3T4WA 4BEQA 4LVBA 3F4WA 3CHVA 4P8UA 4REQA 2GJXB 5MKGB 4ZQPA 1PHQA 4IOTA 1M7OA 1T41A 3DFQA 1M03A 3DI0A 3C86A 3UPWA 5JH2A 3BARA 4KWSA 5DELA 3BDKA 4N9DA 2QDGA 1F74A 3Q45A 3DFNA 3AU6A 4HOXA 4YWSA 5EA9A 1NOUA 1GYNA 5I3GA 2DU2A 1QT1A 3S9ZA 5AOUA 3V75A 3SURA 4R27A 1PV8A 4IGSA 1BF2A 3WF2A 4ACZB 3BC9A 4UC5A 1KRAC 4OQVA 4RZBA 5CAKA 3VCNA 3EOEA 2XFRA 3NQ6A 3BMWA 3N14A 1UWTA 5EL1A 1MZHA 1OFPA 4AEFA 5KITA 7REQB 1CBGA 5LIUX 3MHUA 2W5FA 3NZGA 4CD5A 3WJYA 1FDJA 2C0AA 3E0IA 4DAIA 1TPUA 4WXZA 5FAJA 1LL4A 4NIRA 2ASHA 5C7HA 3AMDA 3T40A 3SQLA 2DZWA 4IP5A 2AKZA 1I60A 4AD3A 2BXZA 2E0PA 1WKEA 4JTUA 4DM2A 1BG4A 3CQ0A 1P1XA 1WA3A 4V1YA 1J0JA 4E4UA 4Z2JA 3W0KA 2GQAA 1XLEA 3GDKA 1XBYA 4ADUA 3AU2A 3G1HA 3OHMB 1GG1A 4FNSA 1VS1A 4UTLA 4B5UA 1VQTA 8A3HA 4MSSA 5HNRA 1NARA 1F8MA 4E8DA 2Z28A 2OVLA 2UY4A 3ALFA 4NT0A 4UXDA 1TPEA 5CZJA 4HIBA 3MT1A 3MSGA 5FACA 4X2RA 3OBAA 3SUSA 4K1WA 1TWZA 3WQCA 3NQFA 3PUEA 3EKLA 5D05A 2BFGA 3H6OA 4MFEA 1W5PA 4QITA 2CHOA 3DHFA 3SCPA 5H8MA 3TN4A 3OYXA 1HKMA 3N1AA 4KWUA 1PX3A 3AS1A 3DG3A 5JU6A 4Q3MA 3AJ7A 1L2QA 4O11A 2V3DA 3BO9A 1EFZA 3P3BA 3ME3A 3G18A 4CD8A 3TP4A 3ZVHB 2I5GA 3HV9A 3UD6A 4C91A 4EAMA 1TREA 5EBAA 3VOFA 2VFGA 3NVTA 3P14A 5I3DA 1GVIA 3L5LA 2NV2A 2XIOA 3EAUA 4DBUA 3O06A 2DIJA 1KXQA 3QQWA 1FWCC 5TD4A 1IQ8A 4FNQA 1TVLA 4HZ6A 1O7AA 1SR0A 2QYGA 2CLLA 3MUIA 2YCIX 4QS5A 3WJWA 2XPKA 1E1EA 3G1XA 3OLIA 3W7MA 3A21A 5FKYA 1BYBA 1JGIA 3IK4A 4GY0A 3UP8A 5AN7A 3S2JA 2JGQA 1GHRA 2X42A 3GG7A 1SGJA 3SR7A 3G1FA 3KVMA 2H9AB 5HPCA 2J9ZA 1V03A 3FJ4A 2CLHA 1P0EA 3W53A 3M0MA 2VZVA 1IEWA 4H9MA 1KB3A 3WMLA 3E12A 5FJUA 2D73A 3AWNA 3QPZA 2PDGA 2QJIA 2VYOA 4I7VA 4AQLA 3WQGA 4O8AA 3STCA 4W7UA 5CGQA 4E38A 2PB1A 4MZYA 1HP4A 2E09A 4OZOA 7ODCA 2XIMA 4W7WA 5RUBA 1WZAA 1C8VA 2QUNA 4JHOA 5IDIA 3WO8A 4FX7A 1XISA 4L64A 4XX6A 5CJMA 4XD6A 2XVKA 4AWTA 3D5HA 3UYCA 1O94A 1NOFA 2TRSA 2WHJA 3RRAA 5HK4A 3INPA 3VIPA 3HG4A 3QR3A 2ACQA 1P48A 1YPIA 1YTDA 2G41A 3BAJA 1FWIC 3CAVA 4M5PA 3HFYA 4QP0A 2VCCA 1IR2A 4C6OA 2Y63A 4GY7A 3S42A 3TZFA 4M8UA 3UG3A 1HKJA 3GTNA 4JKMA 1BWKA 3PZ9A 2FQIA 4M82A 4FLOA 5AHLA 1RA0A 4AHPA 1VHNA 3W1LA 2PURA 9XIMA 2Q8LA 1RUSA 2VGGA 3T05A 2X1SA 5MKGA 4LRTA 1FWRA 5HINA 4Q4KA 3BW2A 3Q37A 2HBXA 2VRJA 3P62A 4LUTA 3HGRA 2NVDA 5BZAA 1XIGA 1MRAA 4C6PA 3GC4A 4FF5A 1XYCA 2F7FA 3B9DA 3BTNA 4QM1A 3V0SA 1QNOA 1QDSA 3I10A 1V51A 3HA1A 3NXFA 2CBVA 1HJXA 4H6QA 2NUYA 4J3SA 4Q8TA 3A5VA 3C5QA 2GGGA 3MI3A 3BG5A 3VNLA 1V6UA 1UWUA 1LLOA 2YCJA 3N2OA 3RJXA 1E6QM 4PCTA 1XPGA 2A3LA 2E6YA 2IPGA 4C7GA 1Q85A 3N2MA 2PP0A 4JEQA 4R33A 2CHRA 2QMKA 3ES8A 3O6CA 3AYTA 4PCSA 2VVNA 1XDLA 2FFIA 2YBTA 3K4DA 3GXNA 3TW9A 1SMAA 2HVOA 3VOGA 3WLSA 4ZGYA 2OU4A 1JQXA 1XD0A 1KTBA 1N8FA 5IOBA 1OD8A 4HN8A 4HZMA 5D2XA 2WWCA 4IQLA 3VIIA 2JKAA 2INZA 2F8QA 4OOZA 3H2EA 3STGA 1K4HA 3UETA 4IG2A 3FW6A 4LBRA 3HM7A 2POTA 4E2BA 2QDEA 3KDOA 3T0TA 2PRLA 3NL6A 4NAFA 3IJIA 1GEQA 4H9YA 4EK7A 4QCFA 2BVTA 3LV5A 3SGGA 1FWSA 4UTUA 2XIJA 3W22A 2XFFA 4GYKA 2Y7DA 2FTYA 4DY1A 5BOOA 3QTPA 1R9ZA 4HK7A 4WKAA 3MC5A 1D3CA 4OJYA 3W1MA 3RO8A 4GABA 1UQZA 3IVTA 5G4HC 3CV2A 5M17A 1JQVA 3EEGA 2ZVRA 3ARVA 3WK1A 4TMBA 5GPRA 3WYZA 4ZB2A 1BWVA 1S38A 1ITCA 3ZVIA 3F4DA 1OFDA 1VBHA 2HVMA 4NZ1A 3UGVA 1R30A 1V4YA 4PMJA 3SRFA 3SFWA 3QR0A 1V3HA 3K8MA 3TYZA 3RDKA 1EEPA 1T5AA 4K1GA 3QF0A 2PZNA 2WW5A 4MYAA 3CTTA 1MQRA 4OHQA 2ACRA 3FLUA 3NUKA 4M1BA 3HN3A 1G4TA 1UBSA 1EIXA 3AUJA 3W07A 4MZ1A 4XSMA 1KTCA 2C91A 2VM8A 3DH7A 5A6LA 2PE4A 3V18A 2PWVA 1YXYA 1J18A 3WG6A 1JPDX 3CHCA 4W86A 3GR8A 1N7KA 1JCNA 3N13A 2WHMA 3SCOA 3NO3A 4HNLA 2CBIA 4B3ZA 4W85A 1EF3A 1SO6A 4AVOA 4NNBA 3ARUA 3W1TA 5C9RA 2OSXA 2J7FA 1EHAA 5L6UA 2DSWA 1OT2A 1Z8AA 3WQPA 3W6LA 2PDQA 1Y5VA 5CAHA 4CNSA 1P4CA 5FJJA 5CC6A 5E5CA 3C2RA 3KE0A 5CSRA 2DT1A 1FWDC 4DF1A 4A2RA 4B2DD 4HJFA 5D9MA 2GJRA 3OBKA 3I6TA 3A6OA 4JTFA 1AVAA 1SU5A 3DBPA 1W3LA 2E25A 1MVYA 3WD0A 1K1DA 1RPXA 4E3VA 3NM3A 3IANA 4NNAA 4HNUA 2OWWA 3TR9A 3AYVA 4DPPA 1B5TA 1XYBA 4A21A 4WHBA 1AJ2A 3QOKA 3M0IA 1XIFA 3GKAA 4J2PA 2J7HA 2D1ZA 5FF0A 2Y89A 3R2GA 4K37A 4NXKA 3VIHA 4B91A 2YZ5A 3SY5A 2XFYA 4Z1BA 1J2WA 2QAFA 4MKNA 2P50A 4O18A 3W4RA 2FYMA 4W84A 2W61A 3UW6A 4MNMA 1WDPA 1EJVC 2QPSA 2WQDA 3WEMA 3CZ8A 4QLJA 4R7WA 1JCLA 3R43A 3W71A 1XGDA 4IWWA 5A5WA 2QCHA 1F9CA 4X2PA 3SCSA 2XTKA 1BXCA 2FZ9A 2JKPA 3R13A 3LQGA 1EC9A 4D6IA 1GPWA 3UR7A 2INEA 4HYVA 1TWIA 3MP4A 3ARQA 4BQ4A 1UWIA 3SN0A 4FXFA 1XX1A 4B5XA 1U1UA 5A94A 5HQMA 4HSHA 1G4EA 2NXHA 1Q6EA 4LSBA 2VTFA 4GGHA 3LOTA 1AJZA 4FOKA 4ILSA 4XUYA 1L0PA 1OM0A 3PVFA 2WLZA 2X40A 2ZXQA 3NQMA 5JBDA 3ARWA 1KM1A 1G94A 2IKIA 3RPMA 4ZA0A 3P2VA 3LCFA 4YPJA 2P1FA 3OO2A 3LSBA 5B7YA 1XIEA 1TV7A 3OU8A 5HJLA 1G9HA 4JFUA 4US5A 1Z9AA 2PEVA 3SJNA 5A6MA 3SRKA 1H1YA 3VCCA 1GOXA 5LA2A 4LV4A 1PS9A 4CGTA 1J0HA 1TO3A 1RY8A 1W3TA 1RCOB 3C61A 4GBUA 1FX6A 4ZOEA 2G3FA 4AWSA 3SM0A 5IHSA 4FOUA 3MI2A 2PI6A 1S3TC 2QCMA 4JYEA 1HJUA 4AMAA 2ZUWA 1QO2A 3AIWA 3WBAA 2EKCA 3V5FA 4NX0A 3TVAA 1E40A 1V0MA 3GW0A 2RGMA 4DXVA 5C54A 1UKTA 5TF0A 1S2CA 3PZNA 4X0VA 4XBKA 2OB3A 4I6KA 3F5LA 4Y96A 3TUUA 4J35A 5EMKA 3B0VC 3W29A 4N4PA 2J13A 4H04A 3UZXA 4LYRA 1MWOA 3OLGA 2VFFA 1KFBA 1KO0A 3MKCA 4Y7EA 2QUMA 4ICNA 4GWEA 2I7GA 3VMNA 3N3MA 4HT3A 4AMCA 5A2CA 3MDUA 4G1NA 2FB3A 3NSMA 3KBNA 4D1IA 5HXMA 4I7UA 1FHVA 4QRNA 1OK6A 1XP3A 2GVYA 5AC7A 3G3DA 1R9XA 2Q8ZA 1KWKA 2H6RA 2D24A 4BF7A 4HD5A 4UOJA 1T99A 3OA5A 4H7ZA 4P7OA 1OYAA 1SFSA 1EDTA 5FAGA 4LH8A 4GIRA 3WX7A 4QDPA 1QHOA 3LDVA 1YHTA 3R4IA 4HNVA 3MANA 1WAWA 2H9AA 1UHVA 1G1YA 3CV7A 3NQBA 2DZVA 3EOOA 2WMJA 2NXGA 2FGZA 2QCCA 5HWNA 1CTNA 1VH7A 2C1IA 4C6KA 2KAUC 4Q4QA 4DWSB 1B1YA 4TUFA 1P7TB 1DPMA 3AS0A 2WCAA 3LYEA 1MW3A 2X05A 3DKJA 3W23A 3GLCA 5CCZA 3N34A 3R1ZA 1CLXA 2X7VA 3PBYA 1H7WA 1E71M 2DZAA 2WZHA 3BOXA 4IL0A 1GVQA 1JPKA 2UWFA 3UZWA 3E0WA 1PIIA 3BAXA 3V3WA 4A3HA 1NSJA 2BGNE 4CN1A 1Q6LA 3DYMA 4CVWA 3FDGA 3AQUA 3H55A 5DMMA 1VJZA 3UZZA 2Z1XA 4PMYA 4XZWA 2J7BA 6A3HA 2GVJA 2GPTA 2VELA 3QM3A 3T42A 1OFBA 2EG7A 4PMDA 1QI5A 3SRDA 4GI4A 3AALA 3BE7A 3PTKA 2WNNA 3MCNA 2Q71A 1T8XA 1KV8A 3GXMA 1KM4A 4D8LA 3VDBA 1TX0A 3TC7A 4ICCX 1LORA 3EA2A 2QUTA 4C6EA 4EVZA 2WNQA 4E6MA 3WFAA 2PTDA 4ZQMA 4FR6A 1W37A 3BUVA 3QC0A 4PTDA 1VGAA 4OE7A 4DBEA 5DX7A 3RLGA 4TV6A 4HMNA 4RK8A 2O7QA 1K8ZA 3F7JA 4HYRA 4UQBA 1E0VA 4GC4A 3VE7A 4W8AA 4NVTA 3LTSA 2IMRA 3BSGA 3KWXA 3VKJA 2DZTA 3M0HA 2WHLA 3U0HA 4D6HA 4AZIA 5HNNA 3C2EA 5TAOA 1K70A 2X41A 1M68A 1TWSA 3IUDA 5I09A 2ZXAA 1U83A 3EXTA 1F3WA 3EB4A 2VWSA 3WLQA 5H1WA 3OGSA 3GFYA 3GDTA 3ANUA 2V63A 1ICQA 1F6PA 3QKZA 2NQHA 1PTAA 4HCDA 1EC8A 5FF4A 1KFJA 3CPRA 2FZMA 1G5AA 7TIMA 1BQGA 2P8BA 3BOFA 3HMCA 4RE0A 4JKLA 3WD3A 4HHPA 3V5OA 4WK9A 5GQBA 2QUVA 3MO7A 3B8IA 4GBDA 1YNQA 4XO6A 5I06A 3TC6A 2OT0A 1V6XA 1FP9A 3VO0A 2VR5A 3S5YA 4JXCA 1GW1A 4UNKA 8CGTA 2QJHA 5C9WA 1ZAHA 4UQEA 4PR4A 4ZBCA 3W1PA 1QOPA 2ZA3A 3PZQA 1LQ0A 5CEWA 1ZHAA 2QMJA 1XICA 1YADA 4TOQA 4JDYA 2QAPA 3SCWA 2D0HA 3CL6A 2OOFA 5GVJA 4LAUA 3I3BA 3RLHA 4QTGA 1KKOA 1YPXA 4H8HA 3SUUA 2TYSA 1EWDA 3BLKA 1R38A 2VO5A 1WZKA 2NT1A 1YDYA 2QCGA 2W3ZA 3BCFA 3CUGA 3VNMA 3N4FA 5HBFA 1QWKA 2BGSA 2W4XA 3VGEA 4ZQOA 5AVNA 2PDYA 4I3GA 2DZXA 3OJGA 2X0YA 4QISA 1FTXA 1O5XA 4M56A 3QN3A 3L65A 2QV5A 1BAGA 5DRIA 4S2CA 4XAFA 4WJ8A 2RFGA 3QMSA 3QV9A 3TJ4A 5FL0A 3KRZA 5HDRA 1JDDA 1EJRC 3W3OA 1WUFA 2HK0A 2BHZA 1GZJA 2I14A 3R6IA 4GIEA 3EPOA 4IIGA 4E4FA 3SIZA 3HV8A 1EYWA 2YXXA 4QJ5B 4G5DA 2YL8A 3NZRA 3WBXA 1KM5A 1RY0A 2CLPA 3FJ6A 2C8NA 5F4SA 2XINA 4IPNB 4ZVJA 4MUPA 3MPGA 4NJHA 1XKJA 2E67A 3HG3A 3BLLA 1F2JA 4QBXA 3LQLA 2OSWA 1R2TA 1WCGA 1VAHA 4UNIA 2FGBA 1EOMA 5CPQA 4DUVA 5FF7A 3VUSA 5J04A 2JGYA 2V5BA 4QG6A 1V3LA 1VFSA 2P0OA 1QMLA 4LUIA 2OX1A 3U5YA 1ZJBA 4JTCA 5G1YA 1T0OA 3VGFA 1EXPA 4GH1A 2CBJA 3S6TA 4DIAA 1E1CB 2Y2WA 2J7CA 3PZIA 4CD7A 5AC4A 1IF2A 3COTA 4UR7A 1TPWA 3AYRA 1I2QA 5M1TA 2Y8UA 4GO9A 4H6RA 2OKOA 5HWJA 3H22A 1P0KA 5AYZA 3U4FA 2J9XA 4J2MA 4LVGA 3GYEA 2NXIA 3NDOA 4NI8A 1UWRA 3LSCA 4BFAA 3IIXA 4JIPA 3VX1A 3MSDA 1FA2A 1KQYA 4BR1A 3CEPA 3SEPA 1BXNA 1HZYA 3MDWA 2GJXA 3PZOA 2HPMA 5BMXA 3KOYA 4P7LA 1PCWA 1X1OA 3W9ZA 4LS1A 4WX2A 1UD5A 2PCEA 4IFKA 2YB4A 2J4GA 3A9BA 2AGKA 2P0IA 3ZJKA 1A0CA 3KAOA 1KXVA 1H5YA 2PDBA 3AIRA 5TQLA 4FX6M 1IHIA 1H7NA 2FZNA 3ABZA 2FTPA 2WJFA 2WLYA 3B05A 4NZ5A 3LHUA 3VAVA 1XINA 5TBOA 3DG7A 3E3HA 3MVTA 3UWZA 1V5XA 3V36A 4INFA 2VX4A 1HVQA 1UYQA 4D6EA 4XZIA 4GLEA 4B5VA 4DO6A 1JYXA 5HUOA 3TONA 4O8RA 2EPMX 1N82A 3FHQA 4JL1A 2Q6ZA 4JTQA 2OZ3A 3W7HA 4KRZA 1RP8A 2WQPA 3OVPA 2P53A 4EXQA 1GK8A 5KTLA 4JTRA 1VCGA 3CMJA 4J7RA 1OB0A 5HR7A 3GXTA 4J4KA 2OQHA 4A4AA 2HXUA 1UH2A 3WNNA 1H11A 1OEPA 3EPMA 1W6TA 3U5UA 3PPHA 1XLFA 1JIBA 3CQJA 3SUTA 1UUOA 3BICA 4EWJA 3ITLA 4FOJA 3NAVA 1O6IA 4BZYA 3NNTA 2V8ZA 2DH3A 1JAEA 3R94A 2PDHA 3IGUA 4PN2A 3HF3A 3VCRA 4EPDC 1V6YA 4Z42C 1ML1A 4YWIA 4G7EA 2DSVA 1M3UA 3W7LA 3DU0A 2B0MA 3JZEA 7TAAA 2AL2A 4QE4A 2GLKA 1H41A 1TPC1 4Q22A 3TFXA 3TYBA 1VPYA 2JFEX 2FMOA 3ELFA 2OLHA 3QHOA 3SUVA 3I7QA 4MB4A 3F2DA 4ASTA 1NU5A 2PDKA 5AHIA 4Z0JA 3POHA 2ZUNA 2HWGA 4DZHA 5GJNA 3MSYA 4NYYA 2G5WA 1ISXA 1Q4NX 4IF2A 1F6YA 3PUDA 5CPNA 3WD4A 5HMFA 4NHVA 4W8LA 3RR4A 3KZPA 2Y6ZA 1VRDA 1M1BA 1BVNP 4WQ6A 4FB7A 2I5IA 1YLVA 4X22A 4ZE5A 4GZEA 2ZQ0A 1UA7A 3WLKX 1PIGA 2OLSA 4YXGA 4OUIA 4OBSA 4IIHA 3AHYA 4QE5A 5FEPA 2IPJA 3KBWA 1X98A 3BOLA 3I3DA 1OY0A 3YPIA 2A5HA 4WXYA 2A3EA 2PGRA 3W00A 3RX2A 3WDIA 4QEEA 4YLWA 4U33A 1VCVA 3G1RA 4S38A 2NLYA 3CTLA 2BY0A 3TLLA 1W3NA 3TW7A 4P8VA 3NWRA 5A95A 3T44A 4PB5A 2V2HA 1VJIA 4EF8A 1UB3A 3KS6A 3IWPA 4GQRA 4J40A 3CUFA 3VNIA 4K8HA 1ZLPA 1FCQA 5CG7A 1DE5A 4DBWA 3TJXA 3BANA 3TNOA 2ZX5A 3UCCA 3S1GA 2QLYA 2D0GA 3J7HA 3MY9A 2A21A 3S1VA 5IFTA 2J8FA 3NJ3A 1J0YA 1NH6A 4G56A 1OX5A 3UXKA 1E0UA 2HCVA 4O50A 1EJSC 1W9VA 1K3UA 3GXFA 5JBFA 3WNOA 3UPBA 3SIMA 4AD0A 3E74A 4EOUA 4ALDA 1I45A 1LBMA 1HUVA 4WY0F 3UCDA 4KCWA 1W9UA 2BWGA 4IL2A 5AECA 1MQQA 1W1A1 4MUZA 1GEHA 4XZHA 1O1HA 3PBMA 1QWGA 5TNVA 3WQ6A 3A9IA 2ISDA 2E1DA 2HJPA 3HPSA 5AC8A 1P0DA 1HN1A 1GQKA 4EPEC 1FP8A 1KD0A 3PC0A 3VILA 3R12A 4A22A 4UTWA 3G6LA 3BJSA 2RDWA 4JFWA 1TSIA 5IHRA 4PCFA 4AY7A 2ODOA 1TJRA 1FHDA 1B2YA 1KXHA 1DIOA 3NZQA 2VVSA 1KFCA 4MGGA 4CVUA 2A6NA 4DAFA 1AMKA 4XKMA 2CERA 3WQFA 4A6GA 1E6XM 3KVJA 3MUZ1 3CPUA 4IIEA 2YSWA 4UFIA 4YHEA 2E7FA 1V02A 5DF0A 3M7SA 4GC3A 1OGSA 2HNHA 2JALA 3OW1A 1H5VA 4OTKA 5AC6A 1E6SM 4DZAA 3TA9A 2QJMA 4JQ3A 6REQA 1LUCB 3BV7A 1CGYA 1HGYA 2UY2A 1A5KC 3TC3A 2ZC1A 1FWFC 1M01A 1XXXA 1ZB5A 2CNCA 1XGZA 1VBRA 4JHMA 1VBUA 3TW6A 2QJJA 1DVJA 2PF0A 2GGHA 4XD5A 3QZEA 3GKFA 1LWJA 3UVAA 1UD6A 3TYAA 3W76A 3NXLA 3WJZA 1LDCA 1M53A 3D47A 5A8GA 3UBPC 1W56A 5LA1A 3N25A 3TYDA 3TTSA 4GUGA 3U7BA 4JTKA 3HMJG 4B92A 6XIMA 4RPPA 2AKMA 4X3ZA 1UKQA 4E2VA 3FXGA 3G1VA 3CEUA 3U3HA 7REQA 3S5NA 4TVCA 3AIUA 4K3ZA 5CSSA 2C7FA 2B81A 2RJGA 3LN3A 3OGRA 3AJXA 3LTPA 1C9DA 2DH2A 2WKGA 3HURA 4JIIX 4PMXA 2Y24A 1ISWA 3G0SA 1XG4A 2I5QA 2C71A 4HA4A 1MZRA 2IPFA 1G4SA 2QCDB 4IG2B 5D09A 1W0MA 3AAMA 3T2OA 1CIUA 2CC0A 3GNDA 3VFLA 3C4UA 1HFBA 1UZHA 5BXSA 4Q7BA 1DQXA 1EO7A 4RV3A 4HTYA 4O13A 1UZ1A 2H90A 2QZRA 4HJWA 3K8LA 3W7KA 3MMUA 3B40A 2PC4A 3EMCA 4YNGA 2VFEA 4DN1A 5I3IA 5HMDA 4D2JA 3WBWA 4PODA 2ZRWA 2FPTA 1B3VA 1PZ3A 4UTKA 2QNEA 3LLDA 1MNSA 5JQ9A 3MMDA 3ZOAA 2XUCA 3C8NA 2PUZA 4XV0A 5D8ZA 3AZSA 4EF9A 3PZUA 3MBFA 1IIGA 3LCXA 2PA6A 3FV9A 3W37A 1UPMB 5REQA 3SSZA 2R94A 1I2PA 3MUXA 4NZ4A 4IICA 2ZWYA 3L7RA 3MSRA 3NFUA 3TXVA 1J93A 1B3ZA 3CHFA 1Q65A 1AQMA 3RRXA 5E6ZA 3UZJA 3WDQA 1UKOA 4QQ3A 2VEMA 2YA1A 4UQAA 4NF7A 3G22A 3H8AA 1F76A 1QBAA 3CT7A 3VMOA 3LCGA 3PBVA 5DANA 2Q8XA 2RAGA 3B9OA 3ITCA 1RPKA 3SY8A 3VIOA 1E5NA 1LROA 1WOBA 3WDRA 3CAWA 4KCVA 5AHNA 2J9YA 1KWGA 1B57A 4PBFA 4IIDA 4R88A 1NDZA 4J1OA 2QXWA 1Y7VA 1BVWA 2O9PA 2PTWA 4CNOA 4MPQA 1FWGC 2GL5A 4GI6A 2CLKA 3S3GA 5AY7A 3SCRA 3S2CA 5A69A 4M3PA 2W0UA 3M64A 1UR4A 4IIBA 1ZNNA 1BWLA 3OG3A 3TWAA 4RNFA 3LXCA 3TX9A 4BJHA 1UIOA 2VCAA 3UXAA 3HPFA 2G3IA 4HZ8A 4GA8A 2R9RA 3AROA 4ROQA 4PMOA 1NFGA 5HJXA 3ZWTA 1L6WA 1SYTA 4AW7A 2OX4A 1TZ9A 3P67A 3UJ2A 1A0EA 5BYWA 4UTIA 1XJBA 2BY1A 1WBHA 4J28A 5LNSA 4DJFD 4UFKA 1JL8A 4LALA 4PUNA 3W1AA 3MZ2A 3RFAA 1VFFA 3AXIA 4PCNA 4R85A 3LPFA 1W5QA 2CWNA 1S5TA 4Q8NA 3C0JA 3CWHA 3FVDA 4GH3A 2HRWA 3BXWA 4ORIA 3CWNA 2G3NA 3AXXA 4U3AA 5HQLA 2ZUMA 1SUXA 4MJZA 1F3TA 1DXIA 2DVUA 1DWFM 1E1CA 3GTXA 1KM0A 4IGNA 2CKSA 1WE5A 4NZFA 4GNVA 3W2NA 1S2VA 3RK8A 2OFJA 5T91A 1IXQA 2G3MA 2J6XA 3VOJA 4U5IA 2C3ZA 3L68A 1GQNA 4B5WA 3GU9A 2ZA2A 1TZ7A 3B8TA 1GVSA 1W2VA 1M41A 3WLNA 4PH6A 1M04A 1SZFA 3DHDA 1IGWA 4PMUA 1JULA 2A4AA 1LF1A 3G77A 1VR6A 4G1KA 4JTGA 3GH4A 3V0TA 3ATZA 1J6PA 3MA8A 4DXKA 2YX0A 5G1MA 4AWUA 2V68A 3OQ8A 4FLQA 4A35A 3WK0A 3P0XA 4WUIA 2BOGX 3EWYA 1HKVA 3PPGA 3FYOA 1NWTA 2FJUB 1EJ7L 2R1MA 4TQTA 2V38A 3RJYA 3ZT7A 4IPIA 3AC0A 5D30A 1W17A 3GG1A 1NF0A 4O0KA 4UTWC 1A4LA 1ZBVA 2J6VA 2GZXA 2O7SA 1E0WA 1QATA 1THFD 3WLJA 1HQTA 2GK1B 2J7DA 3NPXA 1DJXA 3BK0A 1BSIA 3LB0A 1MEIA 1ME8A 1CYGA 5ABTA 4JTIA 4GCXA 3AHTA 1KLYA 1PE1A 1QNRA 4OECA 4MF4A 1EGVA 1GUVA 2QF7A 1SJDA 4DJEA 5CBJA 3RGTA 5EY5A 2D2OA 3MKKA 3RCYA 2PRMA 3CWOX 1K6WA 2Z27A 2AL2B 1HJVA 1ZSXA 3WMBA 1PO9A 3VM5A 4ATWA 4MFDA 4HHHA 2QF8A 4IXHA 3QV8A 1LBLA 2BV9A 2DPEA 4J3UA 1WDDA 1PJ9A 1Q8AA 3TN5A 2X1UA 4ES4A 1ALDA 2ABAA 5EPDA 2Y1HA 3ZT5A 1ECQA 4X60A 3WUFA 1Q6OA 1Q6GA 2TPSA 2V30A 3NYZA 4NP7A 2QCLA 3H2FA 1AZ1A 3CJPA 4CEXC 3W27A 4AYGA 1NJJA 1UROA 1EKOA 3LXAA 4W7VA 2QHAA 2AAMA 4XBSA 4L9YA 2Y7EA 3FEMA 1TR9A 4IX0A 5I3KA 1UIPA 1H63A 2X8RA 4ZE4A 3SN1A 5D4YA 3GXIA 3LXBA 3BCDA 3IGSA 4FALA 4H9ZA 1OHLA 3QGVA 1JDCA 4G6CA 1F3EA 3S0CA 2VHLA 5E0KA 2EPLX 3GG8A 3S2NA 2H8XA 4ZZ9A 2DZBA 1QPRA 1D7KA 3DC0A 4HOWA 3TTYA 1X6NA 2I1OA 4GINA 3URNA 5C9UA 3EDFA 4N9CA 1Q6CA 3HQ1A 4W5ZA 4P61A 4AXKA 3KCLA 4N02A 1YNPA 3OLDA 2YA0A 3B8UA 3RX3A 4NJIA 3WQEA 1WZLA 1NDYA 1S5NA 4MYXA 1K02A 4XKYB 2ZOXA 4UTMA 4DLMA 2Z25A 2I17A 3KM8A 1J0KA 4R34A 5EU9A 1QW7A 1HJQA 1I4NA 4EACA 1J0IA 4E0CA 3L0GA 2HMCA 4D6FA 2V9DA 4HU0A 2W79A 4FA3A 2XVLA 3W7EA 4GUFA 4XQ6A 3GDLA 4HP5A 2EJAA 1AMYA 2YBVA 4GIAA 1PZ0A 4OU1A 3UFYA 1S1RA 1S3HA 3CNYA 3NL3A 4M6VA 4PUEA 1V6WA 4O19A 2OG9A 4XUGA 2A2IA 1UUMA 4RNIA 4OKDA 2FGLA 4JBRA 1Z41A 3VNZA 3A4JA 5JH1A 1RV8A 3AISA 2GQ3A 1UCWA 3GXPA 3E1F1 4X0NA 4H9UA 3TU9A 3CIXA 4GXWA 1Q45A 1VBGA 2OELA 4HNOA 1XLDA 1JDFA 4IJBA 1YBQB 3UG8A 2ZA1A 4E3TA 1W3IA 4ORMA 1CLVA 4GHRA 3LU2A 1WQ5A 3AHVA 1Y0EA 2CESA 3M5ZA 4C7DA 3RO6A 3VNYA 3EOUA 2FMNA 4IISA 3IPWA 1XKYA 4AD1A 4BF5A 4IQDA 4EE9A 3VMPA 2J74A 5CZSA 1MEHA 1Q7MA 8XIAA 3UJEA 4KFNA 3G6MA 2ZIDA 4HZ7A 4F79A 3K5XA 3FA4A 3BLFA 1WDQA 1EUAA 3WH6A 1ITUA 5FI8A 2EKGA 1XCFA 1G6CA 2C1HA 1L6FA 4AWEA 3IVUA 4TU1A 2C0HA 4RW3A 1MSSA 2ZRUA 1XCWA 3VDAA 5C2CA 3TOYA 1O95A 1JDEA 4K2SA 3TSBA 1K6AA 1JCTA 4YVPA 4DJDC 4Z0SA 1OWQA 1R7AA 4CQBA 3WQ4A 3E2VA 3GNNA 1ZBWA 3GQYA 3LBMA 1PX8A 2ISWA 1OIFA 3K4WA 3UYIA 2V5LA 3KL3A 4JNYA 1VD6A 1SO4A 5DT5A 1AL7A 4DYKA 5KETA 4QSHA 1KGWA 4WLCA 1KBBA 3CZLA 4JTSA 3SFKA 1J10A 3LEPA 4PUMA 3PZMA 2AMXA 1XLJA 5TIMA 2NUXA 3CH9A 1JD9A 2YLAA 4O10A 5DRCA 2DORA 1MW1A 3KS5A 1FXQA 1LOSA 4LBUA 1LG1A 3EWWA 1B90A 3R5EA 3L2MA 3B4YA 1JCJA 1XRTA 1XLGA 3BG9A 1MW2A 1XRVA 3TV8A 4CCZA 1LBFA 2FZDA 4MB3A 1Y5XA 1VFLA 1YNYA 2BASA 5DCBA 4CNUA 1ZCOA 3L5AA 2X2GA 4IGHA 2FHFA 1KR1A 1AUSL 4L5ZA 4IJRA 1DJQA 1SZGA 4NSBA 3E0LA 2OQLA 3GFZA 3DFOA 1ADOA 2YLLA 3AFBA 1GQIA 4I9TA 5I03A 3M43A 2G8ZA 3GM8A 4ZQRA 4Z08A 3CUHA 4UCGA 1C90A 1V08A 4WGHA 1F07A 3MQTA 1MUWA 1CDGA 2TAAA 1TWWA 4GX9A 1XCXA 4Y9PA 1JNDA 2VUYA 4XKYA 3FS2A 1DWHM 4J3XA 1V8EA 1GHSA 1EX5A 1GVRA 4EAYA 5BRBA 2ABBA 4MY9A 3FGCA 1L2UA 1LUCA 1KW1A 2J78A 2WC7A 1ZAJA 2PS2A 1SW7A 1SZRA 1EQCA 5CXPA 1QPKA 4PSPA 1WP6A 3KBSA 3N4EA 5ABFA 1YPFA 1UW9A 1GW9A 1OYBA 3N15A 3VGDA 4E4PA 3BJFA 3ECQA 4RLIA 4OVXA 2YXOA 4GGBA 3T0BA 1JYWA 1W5MA 3VD7A 3PR2A 1GTHA 2VQUA 4JL2A 3CQHA 4O0QA 4AZ6A 2WVTA 5KZEA 1ZU8A 3N9SA 1XYAA 1F7BA 3VIGA 3MHGA 1Q63A 1GOKA 4PRWA 4B5TA 2HS8A 5FEZA 4MB1A 1UR8A 3WLTA 1IR1A 1XLKA 4IIFA 4ZSTA 3B97A 3S1XA 2WZEA 3M0KA 5DLCA 3A22A 4KEMA 1POJA 1IV8A 2HVNA 1GONA 3N6QA 4JY8A 2ZZ4A 1FWBC 3WH9A 3NYDA 1KFKA 4H8UA 4X61A 2XSBA 1ONWA 4PUJA 3EOSA 4W9TA 3CL8A 3VU2A 1H3GA 2Y5EA 3W24A 5HJYA 3DDMA 5KINA 1LL7A 3UF9A 1FUYA 2DY3A 1U1JA 2QDHA 1S2TA 1J9YA 3IIZA 2G50A 1D7FA 3TA6A 1DKWA 1QK0A 4QG9A 3PTDA 2CIPA 2CYGA 4D71A 1GKQA 3PBUA 3B0YA 1W1TA 4LQ1A 4HVXA 1XG3A 4ECLA 1TJ0A 3WH7A 4GVGA 2R1LA 2W27A 3NDZA 1SFJA 5FSEC 4AC7C 1OCQA 2NWSA 4KGLA 2PDCA 4A3UA 1KGXA 2ZRZA 5AYXA 4GG9A 3W74A 1IIHA 1DWGM 3GY1A 2A1YA 4WOQA 4XZ9A 1Q5MA 5CBBA 2BTMA 3IJDA 3PZGA 1Z89A 3U2OA 3RILA 4LUJA 4H1ZA 5AKQA 1H62A 1YKWA 4AC1X 1VLIA 4U10A 4XZNX 1FWNA 3GTFA 2F84A 3W7JA 3EA1A 3BURA 4LB3A 3KXQA 2OJPA 3T07A 1I9CB 3DHUA 3TYCA 1IGSA 2Z6JA 3DERA 1HG3A 2EPNA 4B4HA 1N8IA 5E1QA 4DM1A 4J3ZA 2IQ0A 2VP8A 4WGXA 1VEPA 2BODX 3SW6A 4N6EA 1KCZA 5IDZA 2UY3A 3KP1A 3UY7A 1EQPA 1QI3A 5A6SA 1GVOA 2WB5A 4AAJA 4F0LA 2XIIA 1ECEA 3TR2A 4DX3A 2SFPA 4S23A 4U4MA 4I8YA 3M5YA 4WVXA 3HPZA 2PWEA 2X16A 4QFUA 3SRHA 3I6RA 4FX8A 1WDSA 4LPCA 2PFHA 1A50A 4LU0A 3O6DA 3W81A 1QHZA 4LV9A 3LERA 5LGZA 1WXYA 4Q32A 3OB8A 4JQAA 2G0WA 1DJGA 3UJSA 5FL1A 1PB0A 1LG2A 4DJDA 4WDXA 1F4AA 4KPLA 2GGJA 3TTQA 1TA3B 3M4HA 3A3HA 3LRKA 1XBZA 3ITTA 4FF7A 2Q02A 4N6FA 3PTMA 4DPQA 4MDPA 3TCEA 2DT3A 3CAQA 3HPAA 3H4XA 4W89A 4UOQA 1Q7QA 2ZX7A 4G9PA 1RXOB 2IQDA 3NSNA 3MVIA 3P5ZA 2R8WA 1QHPA 1TTQA 4JQ1A 2DJLA 4GK8A 1ZCCA 3NO5A 4LFYA 1V6VA 3VVGA 2IKHA 3BAYA 3OVQA 3JU2A 3AO0A 3ZJ8A 5HULA 2B7PA 2GGEA 3DEQA 4Q4MA 3VKAA 1LTDA 1O5QA 3W01A 4JNZA 4NL1A 4URIA 4L61A 4KESA 4I5RA 4ZOBA 2FIQA 2WCSA 3IUHA 4AIOA 2J8TA 2AQWA 1K9FA 3ZT6A 6TIMA 4U2ZA 4C6NA 1XFCA 2O0TA 3SQSA 1XYMA 3G8EA 2ZXBA 3TIMA 2PWGA 4HMCA 3GXDA 1TPH1 4OBTA 2C15A 2W6RA 1HT6A 4FK9A 2J7EA 2BZNA 3O15A 3KOZA 3GSMA 3I6EA 3ARYA 1JI2A 3M0LA 4CD6A 1W2PA 2BX7A 4MB5A 3NQAA 4NQ1A 2VRQA 1OFAA 4DRSA 1XRSA 2H3DA 2D20A 4FNTA 5LA0A 2KX9A 3N12A 4Y90A 1JXJA 3DKLA 4Q7NA 3TN3A 3UJRA 2XYLA 1UOZA 3SJ3A 1JXKA 5JVLA 1JR1A 4H19A 2XZ7A 4ZODA 1XIJA 3JS3A 2R24A 3N73A 4PMQA 5EFFA 1UWQA 1B9ZA 3AMGA 1VPXA 1G67A 2O4MA 1EGMA 2C1GA 4YVXA 1EJWC 1IZCA 1H60A 3WK3A 4AY8A 4LAOA 3BG3A 1TUFA 3VIJA 1UKPA 5BRQA 2NQJA 5FJTA 3TTOA 3GW3A 4UMAA 4CNPA 5CLWA 3L5MA 4UQ9A 3PAJA 1JNEA 3WL0A 3LNPA 3W2JA 4E8GA 4ZB5A 2GUYA 3LA4A 2CWXA 4KETA 4PFMA 5EMMA 3LTYA 5D9OA 2QDDA 5E0CA 3ZFHA 4Y8FA 1FH7A 1P0BA 3GWQA 2PODA 5BU6A 3LI0A 1RK6A 1DJZA 1DYSA 1GVFA 2E77A 4I5UA 2WMIA 1U22A 2V5DA 1TV2A 4KWVA 2QIWA 1D3GA 1L6GA 1RD6A 2NQ5A 3ARRA 4Z1CA 1OFRA 4LEFA 1PL9A 5FF2A 2ZDRA 3W86A 1ZALA 2F2HA 4W93A 4GQ0A 4AZCB 4I9JA 1YXCA 4AH7A 1BF6A 2ZZ5A 3KTSA 4WCJA 1OG0A 4Z2IA 2A85A 4A8LA 1OD0A 3WQ8A 2GDQA 1VFMA 4CKQA 5K9XA 1W1ZA 1KA9F 3GB6A 1OADA 2Y0FA 4W4QA 1D3HA 2OZ8A 3VNKA 2J75A 2WSPA 5FD0A 3OVGA 5FJIA 4TR9A 5SWUA 1YTEA 1UUQA 4KF1A 1TCDA 1HX0A 1Q6DA 3CLWA 4QXIA 3EDJA 5BOFA 2VEPA 4M0XA 5HA7A 2E9BA 1DIKA 3HB9A 1Q3NA 4GZIA 3T0AA 1PWMA 1E15A 3KL5A 4GQBA 4ACYA 3LENA 1W31A 4PUWA 2V2DA 1JAKA 4PYSA 4GIYA 3HQNA 2OEJA 1FKWA 3OGVA 4CN6A 3XINA 4PEEA 2OMAA 2QVNA 4FNRA 2BDQA 4JD4A 1XC6A 4QQUA 3E38A 1CZ1A 4G7FA 1PKNA 2KZHA 4EXAA 2PC8A 5LXXA 1J01A 4ZCWA 3H7RA 3M47A 1F61A 2BS9A 1PKLA 3R0UA 1FVPA 3GZAA 1R2RA 1SQ7A 3MP3A 3JRKA 2NVAA 3DIPA 5GNXA 1GKPA 1W9PA 3ABRA 3FK4A 2F9RA 1A5BA 1S2WA 1VYRA 2C14A 2XG9A 1J6OA 3CUZA 1YX1A 2EGZA 2PCQA 4IFOA 4D72A 4OIFA 3CLMA 1LWHA 2PTXA 4Z17A 1B3OA 2UV8G 3LY0A 4M7SA 1QI2A 4J3TA 3I3EA 1XYZA 5LYRA 2X7WA 4RUBA 4A3YA 3FIGA 5I5RA 3V1PA 2I57A 3GHTA 2DUXA 2PGWA 4GE8A 1LLWA 2CLEA 1RBLA 3Q58A 1H7RA 1D8CA 1PBGA 4IPJA 1DL3A 3LPGA 3QJAA 3UWYA 1QPOA 1JZ5A 5M03A 3KOFA 2VGFA 5HOSA 2A3CA 1SZEA 4JTDA 5DMNA 2QVHA 1KFLA 2B31A 1R85A 4N2YA 5A6BD 4XO7A 3CQIA 2OWCA 4N9BA 3VC5A 3OIHA 4GQQA 1H7OA 2FB2A 1W9BM 4HMDA 1BHGA 1VP5A 1R2SA 3MUY1 4XAGA 3PSVA 4P5UA 3MZNA 3ZSTA 2QCFA 2QUUA 3R8RA 2BG5A 3Q94A 4PTMA 1F5ZA 1C7SA 4YU1A 3RF9A 4AZCA 2Y7FA 3K1DA 4GMEA 1K77A 5REQB 3DFYA 1LT7A 1OF6A 1S5WA 1R3VA 1FWAC 1KBIA 4CU6A 3MV01 4L56A 4B9ZA 2V3FA 3W1QA 3MUCA 3VKDA 4I8DA 1XD1A 2A6LA 4ZOAA 4FS9A 3CB3A 5BXPA 3CYVA 5G2WA 1CXEA 3R79A 1JVNA 4IP7A 1UP0A 4C6IA 3PWIA 1ME7A 4M19A 1K7EA 4HA3A 1BQCA 5I77A 1DJHA 3FJNA 4F8XA 3NL5A 3CYJA 4H8NA 5A6KA 2DZSA 9XIAA 1JF5A 5LXEA 2I9EA 3GU2A 4K39A 4KBXA 4C6FA 4IGMA 4ZB0A 4WIWA 4DUOA 4Q8WA 3CASA 4KIEA 4D9PA 1C92A 4F2BA 2XVNA 1D9EA 4H01A 2E5DA 1C8QA 3W7CA 4MM1A 3S2MA 1H09A 1AFSA 1U30A 2PRHA 3T8LA 2ACSA 2J27A 2IKGA 3I65A 5FOOA 4YVVA 2VR4A 5IRPA 2VZOA 4XZLX 3O8AA 3MW7A 4F2UA 2D2HA 4NU7A 1REQA 3PPFA 4V1XA 4LANA 1UR9A 4ZENA 5GNYA 4YTTA 2IXUA 5L9FA 2A3AA 4POCA 2I56A 3JW7A 2FZBA 2C18A 2JE8A 4L80A 5BROA 4ZTXA 3NQ2A 2YL9A 1Y8BA 4X63A 2FVMA 3IRSA 4LY8A 4ML4A 2GUUA 4PRTA 2F6KA 3VD3A 4QAIA 2D69A 1XLLA 2D22A 4MLJA 4MHBA 1ZJAA 1DXFA 4MADA 3KLKA 2WMGA 3FY1A 2A79A 3QKEA 4Q4SA 1CX9A 4RDZA 5LHFA 3R89A 3SY1A 1M6JA 2OO0A 4CCCA 5PTDA 1OJXA 2V5KA 4DBSA 1NFPA 1ZFJA 4CNNA 4TX9A 2R14A 1W32A 4O1AA 2NZLA 3C0QA 3L4TA 2PLKA 3ID7A 4DUWA 3T9PA 4Z2HA 4JFTA 4WDTA 1UC4A 3DFPA 2WV8A 1VCFA 5KMYA 1CWYA 1GQLA 2WANA 3T2QA 1J12A 3SGZA 3PY2A 3D3AA 4S2BA 3DECA 1XH0A 2IPWA 4QNWA 4H4IA 1X7IA 3VKKA 2VEGA 4FP1A 5DFAA 4LUYA 1KBJA 3CUXA 3T78A 1ESWA 2XJ7A 4IXXA 4QNEA 4JDBA 3LHWA 2FFCA 3GVQA 4IQEA 4GJ1A 1QI0A 3G1YA 3GR4A 2RH9A 3MBDA 1F3XA 1HXJA 2O92A 3E2SA 1H51A 3CS2A 3MB9A 3NURA 5MHBA 3WLPA 4F0SA 1VEMA 5LHEA 3EMQA 3N19B 5BU9A 5D02A 1GZGA 5AZ1A 2WHKA 2OWXA 3FA5A 2X1RA 4YCPA 5I78A 3T7VA 3CM4A 1P6WA 4O1BA 4RZ6A 2DSKA 2GJLA 2PBOA 1O1ZA 3P80A 3DN5A 1HF6A 2QJNA 1H7XA 5EKYA 5C9ZA 4AYSA 2PMQA 1N2VA 1H7PA 1KBLA 8TIMA 2WVUA 3FAXA 1Z48A 3PSWA 1WKFA 1XV8A 2OGYA 4FAMA 1IEIA 3H23A 2WC3A 3KBJA 4ATLA 1EC7A 2MNRA 4PUDA 4MWAD 1PAMA 3VZXA 3OG2A 1P6CA 1S5VA 1ZTVA 4MNJA 1TRDA 5B7ZA 1H0IA 4JX6A 3UERA 3BPWA 4GYPC 2B7NA 4DYJA 4DLFA 3KTCA 1WB0A 4MY8A 1F05A 7ENLA 4QSFA 1V3KA 4N0RA 3RCMA 2DW7A 2VEKA 2DIEA 2VKZG 1PKMA 2NV1A 2DT0A 2NQ9A 2JIEA 2Z7GA 3M0XA 4E8CA 4C6BA 4I9MA 3WY1A 3OZOA 2JF7A 4WR3A 3UA4A 1UMYA 4JTHA 3N6JA 5BXRA 4YYFA 1HL2A 1E5JA 3RAOA 2PGEA 4H9TA 4MWAB 4AFYA 3CZGA 3W38A 2YYTA 1E51A 4S3JA 4UBPC 4LCSA 4PBEA 2OQYA 4TTUA 1IWBA 4UFJA 5CPTA 2YYUA 3F5JA 2DJXA 5XIMA 3D6NA 2Y8KA 4YTRA 1V77A 3OVRA 5CH9A 3H2CA 5ABEA 4JHZA 3URAA 1LYXA 1IT0A 1UD2A 1I2OA 3EWBX 2XFWA 3POCA 1A3XA 4AD5A 2ZUTA 3QHNA 1TMHA 5GJMA 3WFLA 4DWSA 1MDRA 2VXNA 2WZMA 2CW6A 4MZ8A 4PZVA 4PUKA 3HOJA 2VWTA 1OGBA 1T7LA 2ZCGA 2ZFAA 1C8XA 3IJ9A 4QJ3B 3TZNA 4CLMA 2Y88A 4HKPA 2VDIA 3GTIA 2YKKA 4JN7A 3LMZA 3QPEA 1Z32X 4DNMA 1DIDA 2OR2A 2WJZA 5J5DA 1YE6A 4QX4A 1JPHA 1R6WA 4B3LA 3LLFA 3V35A 4HOZA 2ZWZA 5CC5A 4KKXA 2DUAA 3VGHA 3NGJA 2D2GA 4O57A 3W7IA 1SZNA 3AWOA 4AISA 4FO4A 4FNUA 1NF7A 1JUBA 3KWSA 3AXKA 1KM6A 4LRSA 4KW2A 4NAFB 3H26A 1C8YA 2FLIA 4GO8A 2G4FA 2WBKA 5CBIA 4MIMA 3R11A 1GQJA 3FSTA 4L4OA 2YDAA 4UQCA 1OF8A 4OFCA 4WRHA 2UBPC 4GUJA 3AI0A 1UPPA 1XUUA 4JIHA 4GACA 3L0KA 1E9ZB 4FIQA 2X0SA 3QLLA 4MPKA 3GH7A 4MJ4A 4BQ3A 1MFVA 2IS7A 1UWSA 3P6LA 3RX4A 3CIWA 2CEQA 2WAGA 1VFUA 4D6GA 4GFSA 3FNDA 2QJGA 5C0QA 1CGUA 3WSUA 1JFHA 1KFWA 4B16A 2GUBA 3ZZ1A 3B0PA 2VGBA 1U5HA 4R5EA 3SCTA 2B7QA 3P84A 1YDOA 5IFPA 1A5CA 4S3KA 3WNMA 1UC5A 5HANA 2MANA 2AQVA 2GSEA 1B3WA 3BSMA 4YCOA 1R3YA 3RMJA 4XSLA 2ZDSA 4Q6JA 1IEXA 4DI8A 3MP5A 3PUGA 5LNUA 1UD3A 1J0ZA 1DJWA 4RX0A 3W73A 3IAPA 1GOOA 1JDAA 3ICJA 1CB7B 7PTDA 1R8LA 2Y8VA 2XGIA 3ZLFA 1H4PA 4Q8VA 4L7ZA 1EBHA 1JZ6A 3LBOA 2CETA 4YS1A 1JYNA 4FR1A 3W70A 3SADA 2H8ZA 4LJ3A 4JQ2A 3WKZA 3EX4A 2QCEA 1YBQA 4ERIA 3A47A 5F2LA 3W2KA 4GYJA 3PBWA 2BLEA 4X9YA 3LCWA 3NA8A 5ECUA 2A7NA 3THCA 1SJAA 3MWCA 4GRSA 1B3XA 3S46A 3EOLA 2QS8A 1RSCA 2E4TA 4QDWA 2VGIA 4N9EA 2BY3A 3BGAA 1CECA 3AMLA 8RUCA 2YW4A 3WZ0E 5H91A 2DV0A 4RW5A 1A49A 1PSCA 1HNYA 2VOTA 1HO4A 3HGOA 1DXEA 4ICMA 3M41A 1GOWA 3S5ZA 2ALRA 3DOPA 2F6XA 3LNMA 1JZ3A 3VA8A 1EB3A 4S1FA 3U4AA 4HU4A 3G24A 5C5YA 4QEHA 4B9YA 4RE4A 5U7SA 1UD4A 1K8XA 3N17A 4KWOA 4L9ZA 3PFMA 4XZBA 2OKTA 3QQ1A 1SR9A 1UJPA 2H3BA 3EWUA 2WMIB 1E9IA 4C6LA 1XLIA 4EXBA 4F3HA 3FHAA 5C71A 1PTGA 2OOGA 3A3XA 1V0KA 2WBGA 2DT2A 4LBSA 1B4EA 2WM1A 3M1ZA 2LLEA 4CCDA 2ZZ2A 5C2GA 4NASA 4CU7A 5HNUA 1PX4A 2PAJA 4WY0A 3URQA 4D1JA 4L4LA 1RVGA 4L1GA 2VJXA 2GQ9A 3GHRA 3P0WA 2ICSA 4N42A 1KXTA 1WV2A 3WF1A 2YW3A 3N2BA 1H1NA 5CSUA 4RNHA 4JCMA 2PTYA 2TODA 3EX1A 4PE8A 2ZZ6A 1BKSA 2DW6A 2CPUA 5G2IA 3DFTA 4LW7A 5I3HA 1QI4A 2Z2BA 1Q7ZA 3MCMA 3PB0A 4WDUA 2FKPA 5D04C 4XAYA 2P3ZA 4B15A 4LB4A 4ONVA 4IHCA 4Q8QA 4DVOA 3TQPA 4OUEA 3GHSA 5AYYA 4U28A 1JRCA 3IJ6A 3NPVA 1AD1A 1LJYA 1U5VA 4XB3A 2XWDA 5XIAA 2ZX8A 2E8ZA 1BTCA 3W6YA 3QW4B 3T0DA 7XIMA 3MKVA 3TK7A 3QR1A 3CUJA 1ZENA 2HROA 3DHPA 3UPMA 4G2DA 4F0KA 2JEQA 3QH2A 3CBWA 3WL1A 2PDFA 3SUWA 4RZ4A 1O66A 4BI6A 2ZRXA 2YCEA 2WNZA 2QULA 4M81A 5A6TC 2ALDA 2JKEA 2V82A 1L6SA 1LT8A 4QLKA 5H8UA 5CGTA 3B9EA 5EYWA 2X30A 2BXVA 1GJUA 3DFSA 1J96A 3ZJ6A 1DE6A 2HXTA 3IIVA 2YL5A 3CMGA 4Q4RA 3N11A 1A5NC 4GFIA 3OLEA 4NZ3A 3LGEA 1BPLB 2HTMA 3S6DA 3UWVA 1UD8A 4UMCA 2V3GA 2FDMA 5I79A 4HCLA 4I7WA 5F2MA 2GVGA 4CQCA 2NUWA 2CITA 2WYSA 5G5IA 1RP9A 3THAA 3V0UA 3VC6A 1XWYA 4S3DA 3S1UA 1KCXA 1FY6A 3B9AA 3WELA 4Z2LA 4IMDA 4AXNA 4Y9MA 1QUMA 5I24A 2E5BA 1ZUAX 3W2LA 2PP1A 4QAWA 3UR2A 4KEUA 1WAUA 1UP3A 1F4HA 1HIZA 1J5SA 3HQOA 3L4ZA 3RU6A 3SCVA 3L0NA 3GVRA 4HK5A 3BVJA 3G2GA 3BLDA 1WPCA 1XI3A 2ZRVA 5A1AA 4TX8A 4P7NA 6REQB 2R6OA 2OO6A 2GOKA 4B2DA 4IQJA 3L4WA 3II1A 2P5NA 3L4VA 3L4YA 4JX4A 5D38A 3EB3A 2WCGA 2OODA 3B4UA 4PMZA 2D2JA 4RJEA 3LK6A 4WSHA 4ACZA 1O60A 4GOAA 1U5JA 5E9XA 1EL3A 1Z7AA 1EIBA 4LYKA 3GIYA 4JN6A 3OZMA 2BMBA 3TJLA 1SSDA 4PB4A 1NWSA 3NGFA 4R9XA 2ZXDA 3V4BA 5A3HA 1GNXA 3WUGA 3V1HA 3W2MA 4NXSA 3M0YA 3ARZA 1GWJA 4GVHA 5ECVA 1UBPC 1H1ZA 4CUCA 5HAOA 3G0UA 4DJDD 1EUNA 2ZKMX 3UVIA 1NWUA 4M51A 2NQLA 1V3MA 1VFTA 3DCPA 1QFEA 4O4WA 5DY2A 3W26A 4DYEA 3E5BA 1W9XA 5F7UA 4F0MA 4FXRA 3WNPA 2GJNA 3FAWA 3F5KA 2NSOA 2FJKA 1UWAA 3NDYA 5LZLA 1V3IA 4GZJA 2L5HA 2QPUA 1HL8A 2C6QA 4PRRA 3M44A 2FPYA 4HHLA 3H21A 3UWEA 1S2UA 1UMLA 4GY1A 3PWAA 4KEVA 3WFZA 3EZ4A 4RR4A 3ZS4A 3C0SA 4AD2A 3A5FA 3FYPA 1ZJHA 4JIEA 4AHQA 4XK2A 4YTQA 1VRXA 1NFBA 3MTWA 5K7JA 1CXKA 2O56A 2NW0A 5J5RA 3QY6A 3PG9A 4GISA 4Q33A 1OZMA 1ADDA 3BLOA 2BVDA 4C65A 5A6AA 3CC1A 2DIKA 3QYSA 4FPSA 1E4IA 4F2TA 3U48A 3ZWSA 4NYUA 5A6JA 1K9DA 3UU0A 1J4EA 2XIQA 3TSDA 4DI9A 3GHUA 3JZUA 3UY8A 4I6VA 2PLCA 6TAAA 2VOMA 4C6QA 3CK5A 2NV9A 1T96A 3IVSA 3BAKA 1VHCA 4AU0A 1V79A 1MXSA 3O16A 3WDJA 3BW4A 4MTVA 3PN8A 1I0BA 1X97A 2O4QA 4AB4A 1KV5A 2ATSA 2OZTA 2XU2A 3NQ7A 3LG3A 3WBEA 3K8KA 4A8RA 2WPGA 4Q4OA 1FXPA 1NQ6A 1TG7A 4A3QA 2C16A 3VM7A 5H8PA 1ZRQA 5D2TA 4JTAA 4RDYA 3U9IA 3AICA 2HEJA 2VZSA 3CZJA 2E9MA 3H7VA 2Y7GA 1DJNA 1BYAA 3U7VA 3LCLA 4L6OA 3WMCA 4LNYA 2FVKA 2PWUA 3R58A 4H2CA 5HUPA 1W91A 3MMWA 4IMCA 1CPUA 2OT1A 3VD4A 3STPA 3HO8A 5LSMA 4PSRA 1E73M 3R0DA 3CMFA 1R47A 3VD5A 2Z24A 4JZ5A 4BA0A 2HNEA 3H24A 3ONCA 5I3JA 1AH4A 3R8HA 4MG4A 4L6HA 1KRBC 4CQAA 1TZZA 5BWAA 1ODZA 2RHGA 1FWEC 3ARSA 4ADSA 5BOEA 1EZWA 1HKIA 3O3RA 1NP0A 4XVDA 1EXBA 2ZICA 3A3WA 4K6AA 5CG0A 2FH6A 4Q7IA 3M5XA 3JUGA 3PZVA 1SO3A 1UASA 4LOCA 3B3DA 1RJPA 4DUXA 4JNMA 1OCJA 1EP3A 5BWFA 2PDXA 2OYKA 1EZ2A 3WK2A 1HVXA 3CB8A 3PM6A 1RCXB 4TXEA 3Q4DA 1ZP4A 3VDHA 5AZ0A 2EPOA 3EDDA 5CC7A 1TRIA 4PUUA 5A6BA 4PL1A 1Q2RA 1KFEA 2RDUA 5T9BG 3VFCA 1TTJA 1WX0A 3EEZA 1X96A 1CT5A 1IYXA 5EMLA 4L6DA 3SECA 1MUMA 3UJFA 1PEZA 3WQ5A 3QQ0A 3TNBA 2Z7KA 4PBGA 4UUIA 2Z26A 2BY2A 1LQAA 1AW2A 1MDLA 2YXGA 3S2LA 2WVVB 5M2FX 2IKJA 4C6MA 1BSLA 1SO5A 3I7SA 3G0XA 2CXEA 3WLIA 4RDVA 3P82A 1YDNA 1W1VA 3K46A 4FNPA 3WH5A 1QNPA 4DF0A 4WOZA 2ZX6A 4C6DA 5EMYA 3E49A 3XIMA 2PLJA 3K30A 1MMFA 2Z00A 4TMCA 4L9XA 4M6QA 1LCOA 1DQWA 3EMZA 2ACUA 1GJWA 5JIWA 1QCWA 3T8QA 5AHMA 2CKRA 2CFFA 1RD5A 1ZPTA 2C13A 2J79A 3HQPA 1R0MA 3ZR5A 4TV5A 1A0DA 2XGBA 3U2EA 4WY0B 4UOZA 1KLZA 3LHVA 3PS7A 3AMKA 3VKCA 4AHOA 1O12A 5DBTA 2J47A 3GU1A 3CAKA 1DWIM 4NJKA 2WSRA 4XBJA 1PWLA 3SZ8A 1R3WA 2GJPA 4JTJA 2QW5A 1W9DM 3ENLA 1AQ0A 4K7VA 1US3A 2PU0A 3K4AA 2HK1A 3W7QA 3CH0A 4FI4A 1FQ0A 3SBFA 3BGJA 2YFOA 2XISA 1BGAA 1CNVA 3O6AA 3PJTA 1TMLA 2VEIA 5CSYA 5A2AA 3NZPA 3P74A 2G96A 3HPXA 5D03A 3E2QA 3QV7A 2V3EA 2FH8A 5C6MA 4LUSB 3NEVA 1AODA 3A4XA 3T2PA 1XIMA 4M80A 4FLSA 1AD4A 5K4ZA 1HJWA 5IBXC 4LY4A 1I2RA 3GTHA 1DWAM 3MJYA 1XLBA 1NAL1 1A5UA 3P5YA 5CPOA 5BNKA 2ZZ3A 3ZM8A 5F1UA 3AS2A 1J8VA 1ME9A 4ZXOA 3BZJA 5ENLA 4C1NB 2WC4A 4P7RA 4MAZA 3K2GA 3DZ1A 1EBGA 4O1CA 3UESA 5BXTA 4MJ2A 3CHDA 4XTDA 3VOIA 2WVSA 2XM1A 7CGTA 2Y5SA 2PSNA 1ELSA 2P8CA 4C1LA 5A8MA 1GG0A 3ZR4A 1R86A 1GYLA 2BXYA 1QVBA 3VI2A 3IJLA 2Z1BA 1P5BA 1IT8A 4XZMX 3T1GA 3UGRA 2XZ9A 3EPNA 3VPLA 2BB0A 3AS3A 1E6RA 1W3HA 5ABHA 3DC8A 3T81A 2YPIA 4FHAA 4ATDA 3TAKA 1OX6A 4JR5A 4DWSC 3BQ6A 1KR0A 4EKJA 1XGEA 1DP0A 1FWTA 4CD4A 2J8GA 3QVQA 1W3KA 1K9TA 2G37A 3FSUA 3W87A 4HPJA 2OLAA 3BAWA 2YA2A 3T0CA 4NG3A 4ZO6A 4GUIA 3VX0A 2RDXA 3BCJA 2A7PA 3HBLA 2UY5A 2Q01A 1AL8A 3KFTA 1FWHC 2AAAA 4AX6A 4JTTA 1JCYA 3NR0A 2YDRA 5CJNA 1UZDA 3ITGA 3WDPP 4AZBA 3CV6A 1IEVA 3KHJA 3AHXA 4LVFA 3QBUA 3ZQ9A 4OBRA 2WOQA 5ABFB 1EYEA 3W72A 1SW0A 4A05A 1LRTA 4B4FA 3VINA 4H7CA 3TQVA 2REQB 3LV6A 1REQB 3B8DA 4BI7A 4RL3A 1AK5A 4K8EA 2PBGA 3GVWA 4QE1A 2ZTKA 1ZBKA 3BH4A 2R82A 2JEPA 4UNLA 4PTNA 3TAOA 5HR6A 4S39A 1GYMA 5AYBA 3RCNA 1TV3A 2W9MA 2Z29A 1TJ1A 1EGZA 2A3HA 3GDBA 1LM1A 1XYLA 2PDJA 2YOCA 3P81A 2VC7A 3URBA 3S5OA 2YL6A 3FX4A 3IK2A 3REQB 3LMYA 4NX5A 3ZMRA 4XAZA 1BD0A 2J77A 1X6LA 2CZFA 1XH2A 2W67A 3PTQA 4KIRA 4X9SA 3N04A 5K2ZA 1KCLA 4JIRA 2CBUA 4NRSA 4GYFA 4N4QA 3KDNA 4UIOA 3WLHA 2WXDM 1XF0A 3APTA 3LX9A 3GBEA 1AZ2A 4C1KA 4RKAA 3GIQA 4QHRA 3MCOA 1KKRA 3UWWA 3U8GA 1R7OA 1XHGA 1C93A 3ANVA 3B04A 3VDCA 4GNJA 3VZZA 1NP2A 1X1NA 4AF0B 1JEZA 1G69A 3WLRA 4I9AA 2QV4A 3OPSA 5HATA 1IE7C 3T09A 3DX5A 4LYQA 3W1RA 5E6YA 2BGQA 2YZRA 3UXIA 1SPQA 2FZ8A 3N9RA 3O0FA 3BQ5A 3MUAA 1W5NA 4EP8C 5D2YA 1TPFA 3R8GA 2J24A 4NNCA 2VC6A 3W02A 4O15A 3RXZA 5AC5A 2HDJA 3W85A 3NZ1A 5EFDA 4N7QA 5KZDA 4DJED 1XRFA 1MXDA 3WDHA 1Q2SA 1IWAA 3TDFA 5KSWA 4S3CA 4NZCA 2PWHA 1AG1O 1XC4A 2PDUA 4S3BA 2Z2AA 2V0TA 3WNKA 2F6UA 4HHMA 4BKNA 3C2OA 1KC7A 2WSKA 5I7GA 2PU1A 3TTEA 4HA0A 4KQNA 1OFEA 4C1NA 3GRIA 4J9JA 4ROPA 4DHGA 3W7NA 3EWZA 1RQEA 1HTIA 1C7TA 3KBVA 5CC3A 2Q09A 2XHYA 3EXSA 7A3HA 3G8RA 3KRUA 1WBJA 3AIBA 2Q3OA 3FN9A 1R3QA 1FWWA 4KFPA 4Y9NA 2G3JA 5I02A 5I23A 2HE8A 2ZUUA 4EX4A 1FCUA 2G97A 2OYMA 6ALDA 4O12A 1S5MA 2WPBA 4IT1A 3W6MA 1QO5A 3KTXA 3PF3A 4GUHA 2ZC8A 1NM9A 3FFSA 3THQA 2GSJA 1WDRA 4EANA 1PZ2A 3UNDA 1DTUA 4GD0A 3CL7A 3GVVA 1PUDA 5A2BA 1S1PA 1B30A 1XIDA 2DSZA 1QRQA 4IUGA 3NO1A 2J25A 3UG4A 1X39A 2I9UA 4FSAA 3W7RA 1VBJA 1JI1A 4AEOA 1E4NA 3F2CA 4XD4A 4Q6XA 1KGUA 4I5XA 1QAPA 3M0VA 4IP4A 1CGWA 3VTRA 4LWWA 3HIJA 3GD6A 3WMSA 3TYUA 4KERA 1GVYA 2D3NA 3EKGA 3PBGA 3WH8A 4DBDA 4O52A 1JRBA 4IFRA 3RM9A 4AIEA 1A5OC 1FHUA 2PDWA 3LS9A 4IJCA 3L2LA 2E5CA 2YDSA 2D0FA 5F4XA 4JS3A 1G4PA 4MY1A 1AA1B 3FGCB 1K4GA 1I6NA 2O9OA 1BEUA 3EGJA 4DJFC 4H8VA 2OPJA 1X1ZA 4R7JA 1A5LC 2GK1A 3ITYA 3VGGA 4JN8A 5HMEA 5AVHA 3A64A 3B0XA 4PMNA 3GG0A 2CU0A 3P8JA 3FXYA 3G5EA 4PGLA 2JQXA 3EWXA 2ISFA 4ML9A 2TSYA 3G1AA 4HK6A 4O0ZA 3AZTA 4RV8A 1OFOA 4JY9A 2HBVA 1FDZA 3LHYA 2V67A 1GOQA 2O9RA 3P61A 1M65A 4WJEA 1AQHA 1E72M 3MHFA 1QJWA 3ZO9A 3OZYA 4JAWA 2V5CA 3VK5A 4TTGA 3PK7A 1RHCA 3KBMA 2FHCA 2W66A 2PF8A 1VLWA 3VD9A 4ZFCA 4PCPA 1A80A 3H2NA 3UG5A 3BL3A 1DV7A 3E5PA 2HPIA 1K03A 2IUZA 4C6JA 1IZKA 3M6DA 2R1PA 3RR1A 1XIHA 3O9NA 4V33A 1TE1A 2B7OA 2YDQA 3GX9A 3TWBA 1T8QA 3C2YA 3SCNA 4P2VA 1WO2A 1WXZA 1ONRA 3QV6A 3OHIA 4YJ5A 4WKHA 1JCMP 1E3ZA 4QDMA 4M1RA 3W88A 1VPQA 2FTWA 1MYRA 4HYWA 4G8TA 3L2IA 3HZ3A 3I68A 2VFDA 4K8GA 4F66A 3KW3A 3VIFA 1O4UA 5BCAA 1V93A 3LLXA 1OX4B 3IUIA 1LRNA 4HSOA 1IZJA 2WMHA 4JICA 3PULA 1PTDA 1YEYA 5I2UA 3APYA 2PWFA 1TPDA 3M5VA 3SCQA 3UXDA 4LAZA 1HJSA 5D9NA 4KWWA 3LRMA 2PDNA 1GOMA 1DHPA 3GFXA 4Z1YA 4GQGA 5KEZA 1PDZA 2HS6A 2NX9A 1CB2A 4MJMA 1QASA 3SSJA 3N4AA 4K7YA 2VD9A 1AQFA 1POKA 2BSLA 1DHKA 3RPTA 1TPVA 3DXIA 1NQKA 4GJIA 3EYPA 2DDXA 3WD1A 1HKKA 1YE4A 3TJIA 3UQNA 4NY2A 4AIBA 3IJ8A 1VKFA 2VX5A 4PTXA 4RXFA 1JZ4A 2NLIA 4ADTA 2XIBA 4LXFA 3PPCA 1TJPA 4F0HA 3S6OA 2HE5A 4JIQA 1GZ1A 2G95A 4PEKA 2FHBA 3OIXA 4DQWA 4ZEPA 4K38A 2NWRA 4XIAA 1VFHA 3NL2A 2V69A 1S39A 3LM3A 2FPVA 9CGTA 2Z4GA 4MOZA 3FJLA 1V7AA 3VOCA 3EXRA 4J3WA 3FKKA 1EJUC 1MI3A 4LAKA 4L1WA 5IM51 3O63A 4AD4A 3I4KA 1CXLA 1P7TA 3ABSA 3E9AA 1K7XA 4ENLA 3HTWA 1SMDA 4KRTA 3OA3A 1TELA 5I3FA 3JVAA 4P8WA 4AVFA 4DB7A 2VI0A 4LAMA 4F9DA 2VURA 2Z2UA 2XVGA 3N2CA 3HU7A 4CQ9A 4AZ5A 1AH0A 1XLMA 3L12A 3M0ZA 2EG8A 4PA8A 3H4WA 5LNWA 3PJXA 4J3VA 2UZ9A 3RHGA 1TQXA 4J5NA 4M6PA 1HO1A 1IXPA 2CLMA 2Q3RA 1Z44A 2RJHA 2RUSA 3RYSA 3C8FA 2X1TA 2EPKX 4L1XA 1SVDA 4UWMA 4NI3A 1GTEA 1MFUA 4W87A 2GGIA 5GNZA 4ZFMA 3EX6A 3VZYA 3PB2A 3S47A 4LS0A 2R1NA 3WQOA 1O68A 2DFAA 3IGXA 3IRDA 1BYDA 2AMGA 1JF6A 2PD5A 4XAPA 3MU7A 5FEWA 1HL9A 1PCKA 3CZEA 4GI9A 4MLRA 1OCBA 3QLDA 4GXMA 3BSHA 5BW6A 1XIBA 3IGHX 2PGFA 3SQMA 1GT8A 1ZGDA 1UA3A 3D0CA 3CZKA 3W2UA 3NQDA 1W1YA 3RIKA 1OC5A 1I0DA 1Z6KA 1UP2A 2RKXA 2CZDA 2E6AA 1G0CA 3T08A 4FEZA 5AB3A 4WSKA 4IZGA 4LTSA 4HPHA 1F8IA 1LOQA 4E2DA 3WQWA 4CQDA 2QGYA 3M6YA 1TWDA 4UTHA 1ZY9A 5AHFA 6XIAA 4NJJA 3GVGA 3NQ8A 1QOQA 1SJBA 3CPGA 1AW5A 1OZQA 3EX3A 3H7UA 3BJTA 3SCUA 1OBAA 1SFLA 2EAWA 1Q6QA 1PIFA 1Q13A 3QY7A 3KLLA 3A4AA 4PMRA 2REQA 3DI1A 1TTPA 4AUBA 4FZIA 3LPOA 5DMLA 1VC4A 5LNVA 2YB1A 3IARA 3FA3A 4GJJA 4AZHA 4NRRA 2J88A 4KEZA 1MXGA 1JUKA 3AUOA 3A4WA 1TTIA 2F38A 4S3GA 5DT7A 3AMCA 3GS6A 4NAEA 2ZE3A 4JKKA 1TV8A 3O07A 2NX1A 1XDMA 3OEXA 1KRMA 3WLMA 1OVDA 5CGMA 2ZTJA 2BP1A 5IXEA 1VFOA 3BV4A 4Y9AA 1EEXA 4GXPA 3HGSA 3AXHA 3ZXWA 3EBVA 2WO5A 3UZYA 3SGUA 3AXMA 5AYIA 1SFTA 1GVEA 5HNTA 2VZUA 3NOEA 2DUZA 1XSKA 1GGOA 3UEQA 3WEOA 3LZ3A 2FVLA 5C9XA 3P93A 2WSYA 4L4MA 4ERAA 3APGA 4DJFA 3LI1A 2VMFA 4O28A 1LL6A 1QBBA 5A8OA 1IXOA 4IMGA 4HCHA 3E02A 1E4LA 3KZSA 4MWAE 5E93A 3MJMA 1VYPX 5LNRA 2V5JA 2POZA 2ZZ1A 4IPLA 3DENA 1FCVA 2DZUA 3GR7A 1TV4A 1ZZMA 2GYIA 2DVXA 5D32A 4ZOCA 2GFTA 1FFRA 3CQKA 3VNJA 1A53A 2VCBA 3WF0A 3GO2A 1EA0A 3L23A 4Z1DA 1H49A 3UZ5A 4TVDA 1XBVA 3HJEA 2HSAA 4C5YA 4AZGA 1Y5WA 3O2LA 4PULA 3KCOA 3TQKA 3C0LA 1CEOA 3QSTA 1ITQA 4DO7A 1I1WA 1YXDA 2AGTA 6PTDA 1TIMA 3M46A 1Y65A 1FWJC 1EOKA 3NEHA 3RLVA 4GPNA 4BI5A 4LEQA 5F1VA 4S3FA 4Q8MA 4GI8A 2QQ6A 4AF0A 2PDMA 2NX3A 3P7YA 3LCIA 5AFDA 2ZE0A 1XQLA 1FCBA 5FA5A 4C6CA 1ICPA 2IW0A 3WF3A 4B90A 3SAZA 1S46A 5HQEA 1LRQA 3NPUA 2DVTA 3KHDA 3GAKA 5CLTA 2ZADA 3O6YX 4PB3A 1VEOA 3KVKA 1I2NA 3F4VA 1EJXC 3KL0A 1EHNA 3MI6A 4UTJA 2Y61A 3ALGA 3AYSA 4V27A 3F1QA 2WNWA 1QNQA 3G1SA 1US0A 1E55A 4P8XA 4UQDA 4HN4A 1JZ7A 1E6ZA 3KOWA 3DG6A 1E4MM 1SJCA 2E8YA 1EO5A 3C56A 4IMEA 4V2XA 1FRBA 2V2CA 4RE2A 5K4XA 5DXXA 3RM8A 2BHUA 1HGWA 3AIVA 1GOIA 4WD0A 1EA9C 4BF9A 4REQB 3W28A 1VF8A 1MQPA 2EXOA 1TV5A 5CZKA 2IXVA 4H2HA 5FJOA 5LKYA 1PYMA 4ZMGA 4MKSA 2XN2A 3B8SA 4DEFA 3OP2A 4W8BA 2OTDA 2WJDA 5LIWX 2TMDA 4O16A 3GYCA 1V0LA 4MMWA 4GX8A 5U4NA 3ABQA 2JF6A 1BYCA 2J62A 3M07A 2Z6IA 3E0FA 3CUIA 1I1XA 1XM3A 2EF9A 3UWUA 3RN6A 3PZTA 4OOUA 2QGHA 2HZGA 4LT9A 3OQEA 1MUCA 1R46A 4U3CA 3QFWA 4F9JA 4DZ5A 3CT2A 5J8LA 1AH3A 4HPXA 4UR8A 3MO4A 1FKXA 1AJ0A 2YCLA 1W1IE 3WD2A 1WKYA 2P10A 1NELA 3FDKA 1BVZA 4Y6GA 4XG1A 1XIIA 1B4KA 2VR2A 2D23A 3S9IA 3NVDA 1A5SA 2BVYA 3EA3A 3UNTA 1CI1A 1TFVA 2YJQA 3A24A 3THDA 1J5TA 1E6PA 3NTYA 5DQPA 4ZTYA 1SW3A 1KM2A 1XUZA 4AX7A 1B3YA 1YYAA 1DWJM 1T6MA 1DEDA 4P7QA 5FJPA 3FEQA 5CPLA 1C3FA 3U6WA 1EP1A 3M7WA 4C5ZA 3C2FA 2INFA 2F2KA 4E2OA 5HMSA 2EPHA 1H2JA 2CZVA 1RH9A 4WSJA 1C9WA 2BBFA 1TIWA 4HU8A 3PHAA 5FSDC 4YTUA 6CGTA 2XH2A 4HPNA 3USBA 3RITA 4RE3A 2RGLA 2A0NA 4O14A 1F6KA 2WMKA 5KZ6A 4BQ2A 1QPQA 4IX2A 3L67A 2CXGA 2PDPA 4WKFA 3LZ5A 4MDOA 1CW2A 3QZAA 3BLIA 9RUBA 4EPBC 1B0IA 3IIPA 5D2VA 3G3MA 3W1XA 1SM9A 3TH6A 2E6FA 1D8WA 2Z1WA 3H70A 4OV9A 1E1FA 2WK2A 3H2OA 1NIUA 1RBOB 5GJPA 1NVMA 1TYGA 3P8IA 1J2BA 5CPSA 3N6HA 3ONBA 5M5DA 3RNDA 5JMUA 3EDEA 1L6YA 3FCPA 1Z69A 2GWGA 2XM2A 3N29A 2YR1A 4EPKA 1VB9A 1YDVA 3WBYA 3BW3A 1US2A 2X2YA 1UR0A 4UZSA 1MNZA 4AEEA 2Z0IA 3H12A 3PJWA 1ONXA 3WF4A 5CKSA 4O17A 1QTWA 2VFHA 1LWIA 1QR7A 3GK0A 2GVLA 3FKRA 6ENLA 1ISVA 4YN5A 4DXXA 3SN4A 3WQVA 1W54A 3DUGA 3DYPA 3AZRA 2Z1SA 2GQ8A 3GBDA 4YMZA 3IEBA 3LPPA 1XLHA 3NPWA 3U2CA 2X0HA 1RAKA 1V0NA 3WENA 1KQZA 4BK9A 1WZMA 3DGRA 4D6CA 3SO7A 4QR6A 1BXBA 3REQA 1RVKA 4HNCA 2Y70A 1EDGA 1TVPA 1QOXA 2MUCA 5G2HA 1XS2A 4IH3A 4PTWA 1PXGA 4HBKA 2VZTA 4RDWA 4K36A 2HV5A 3ES7A 2WSQA 2ANUA 2AQOA 1U1HA 3B8VA 4ZQNA 4TVUA 3XISA 4GZ7A 3CO8A 5JBEA 2E1WA 5CJ5A 3D46A 1DIEA 1WXJA 4Z1AA 1W8SA 5XINA 5C55A 4O1EA 3MWAA 1TE6A 1XW8A 4AIUA 3B9NA 4ZO8A 3T6CA 3ABXA 2GWNA 1MW0A 4XWUA 5I0DA 5G1TA 4M29A 5C2XA 3LRLA 3QOMA 3WCZA 4DZIA 2P3EA 1PKYA 1CLKA 3TXZA 3H54A 2YGYA 1ODUA 1EF2A 1UR1A 5CZ0A 3AOFA 4Z2KA