4WRHA

Akr1c3 complexed with breakdown product of n-(tert-butyl)-2-(2-chloro-4-(((3-mercapto-5-methyl-4h-1,2,4-triazol-4-yl)amino)methyl)-6-methoxyphenoxy)acetamide
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
316
structure length
316
Chain Sequence
b'QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Breakdown product of N-(tert-butyl)-2-(2-chloro-4-(((3-mercapto-5-methyl-4H-1,2,4-triazol-4-yl)amino)methyl)-6-methoxyphenoxy)acetamide trapped in active site of AKR1C3
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 116
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4wrhA00
4IJCA 2FZDA 3CASA 2PDNA 3LZ3A 3EB4A 2P5NA 2I16A 4JTAA 1PYFA 3M4HA 3H7UA 4PR4A 3LN3A 4JQ4A 2PDPA 5AZ1A 2QXWA 4XZNX 3UG8A 3O0KA 2PDFA 3EB3A 3DN5A 4L1WA 3KRBA 2BGSA 3N6QA 3GHRA 2PDKA 1GVEA 2PDIA 1R38A 1C9WA 1HQTA 1IHIA 2R9RA 4H8NA 1T40A 2I17A 4L1XA 2ISFA 2WZMA 3R43A 2FZBA 4QXIA 1MZRA 3ONCA 3LEPA 2HVOA 1ZSXA 3UP8A 2PDBA 3V0UA 1EKOA 4MHBA 3LZ5A 1FRBA 3V35A 2IQDA 3R7MA 4ZFCA 2PD9A 2HDJA 3LNMA 4GCAA 4QR6A 4XVDA 4YS1A 5HNTA 1EF3A 1T41A 2PDLA 1S2CA 3H4GA 4JTDA 5HA7A 4XZLX 2IPGA 3FJNA 4ICCX 1VP5A 5KETA 1US0A 3G1RA 1A80A 3BURA 5DANA 4FALA 4XZIA 4WDTA 4PRTA 2HV5A 3BV7A 4FAMA 3UFYA 1EXBA 1XJBA 3RX4A 3MC5A 3CV7A 4XZMX 2IPJA 4JQ3A 3UZXA 5LIXX 4G5DA 4LAUA 2A79A 5LIWX 2HVNA 1AH4A 2C91A 1LWIA 3LQGA 4FA3A 4HBKA 4DZ5A 2PDGA 3ONBA 4WGHA 3UZZA 3S3GA 3QKZA 3M0IA 2PZNA 3R94A 2PDXA 4NKCA 3T42A 1IEIA 5JH1A 2IPWA 4XO6A 4DBUA 4IJRA 2HE8A 4YU1A 4WRHA 2ACRA 4GQGA 2F2KA 3D3FA 1QRQA 4JIIX 1RY0A 3WBWA 2HEJA 3R58A 3RX2A 2PF8A 1Z3NA 3BUVA 3CV6A 4JQAA 4YVVA 2INEA 2IKHA 2FGBA 2PDYA 2PDQA 2IKIA 1ZGDA 3WG6A 4GIEA 4XZHA 2PDWA 1Q13A 3LD5A 2PDMA 1MRQA 4AUBA 2DUXA 4DBWA 4YVPA 3Q65A 1PZ0A 2PD5A 1Q5MA 4XVEA 2VDGA 4GABA 4HMNA 1SM9A 4ASTA 4F40A 3F7JA 3RX3A 3G5EA 4Q7BA 3MB9A 3U2CA 3H7RA 4QBXA 1AH3A 2PFHA 4WDUA 1AZ1A 1X98A 4LBSA 1S2AA 4EXBA 2IS7A 3M64A 4JTRA 5C7HA 4LBRA 3R8GA 1ZQ5A 1J96A 1HW6A 4JIRA 1S1PA 3V0TA 1JEZA 3UZWA 1PZ1A 3BCJA 3V0SA 2PDJA 1YNQA 1X96A 1OG6A 2FVLA 1MI3A 3LUTA 1AFSA 4PUWA 2PDHA 1S1RA 1LQAA 4GACA 3N2TA 4XAPA 4PRRA 3FX4A 3UGRA 3P2VA 1YE4A 2R24A 2IKJA 2INZA 5JH2A 1RY8A 2IPFA 5LIYX 3GHTA 2NVDA 4Q3MA 1K8CA 1EL3A 2BP1A 2DUZA 4LAZA 3GHUA 2DV0A 4DBSA 4GQ0A 3GHSA 1ADSA 3COTA 3VXGA 3UZYA 1UR3M 5LIUX 1YE6A 3UWEA 3WBXA 4JTQA 2ACSA 2AGTA 1XGDA 1Z89A 5HNUA 2IQ0A 2IKGA 2J8TA 2WZTA 1M9HA 4OTKA 3LQLA 4PMJA 4I5XA 4LB3A 4EXAA 1RALA 1AZ2A 5AZ0A 3CAVA 4WDXA 1Z8AA 4FZIA 2PDCA 3DOPA 3R6IA 2F38A 2CLPA 3NTYA 1PWMA 3C3UA 4H7CA 3WCZA 2FZ8A 3WBYA 4IGSA 1PWLA 4XK2A 3LENA 4PUUA 2ACUA 4JQ1A 4RPQA 2BGQA 1ZUAX 3CAQA 4JIHA 2HE5A 4LB4A 4JTCA 1QWKA 3GUGA 4GA8A 4JQ2A 3O3RA 5M2FX 3V36A 2ALRA 2PDUA 4R9OA 3UYIA 1Z9AA 3EAUA 3B3DA 4YVXA 2NVCA 1XF0A 2FZ9A 4QX4A 3R8HA 3CMFA 2PEVA 1VBJA 1YNPA 3ERPA 4WEVX 2ACQA 1X97A 3LBOA 4XO7A 5LIKX 3Q67A 1AH0A 4WDWA
chains in the Genus database with same CATH superfamily
4OT7A 1EJRC 2F8QA 3SSJA 1L2QA 2QCNA 1FVPA 3KVLA 1TMHA 4ZA0A 2C0AA 1J5SA 1J12A 2DZXA 4ZQPA 5AY7A 3E38A 4UQCA 4AVFA 1IGSA 1KCKA 3BLLA 3QV8A 4IH3A 3CUFA 2BVWA 1X8CA 2EG8A 1SGJA 3STGA 3WDHA 5EA9A 1KCZA 3LSCA 3NDOA 1HL9A 4PCPA 3OBEA 2EQDA 1R87A 2V3FA 5G4HC 4PTXA 4LUYA 1TRIA 1R47A 1EQCA 4IISA 2C1IA 1XL9A 3O0FA 2MANA 2OT1A 1JYVA 2ZX9A 1FP9A 2C1GA 1D2KA 3CPRA 1NJJA 2X16A 2HWGA 1H51A 4X3ZA 4FXSA 4LNCA 4F3HA 1Q6OA 1SJDA 4FNQA 4IX2A 4LW7A 4ZENA 4XVDA 4QR6A 4O11A 3B97A 3FYYA 3WLIA 1GOWA 5D03A 3HQNA 2ALDA 1QK0A 1TPVA 5CZTA 4CVUA 1XSJA 4CNSA 3BLDA 4XIAA 2IXUA 3CZJA 5KETA 2RDUA 3EMQA 4FALA 4XG1A 3B4YA 3CXOA 4HU3A 2G8ZA 1EJXC 2NQ9A 1WXZA 3L4VA 3ITCA 1UD8A 3IANA 1QI4A 3QRHA 1IT7A 4E2OA 4QHRA 2C8NA 2OOFA 3ZXWA 4UOQA 3GRIA 5CPQA 2XG9A 2C91A 3CT7A 3WDIA 3S2NA 3KM8A 3FEQA 4JFWA 2PDGA 3C8FA 4ZFMA 3TR9A 4A2RA 3W2KA 3WBEA 3GZAA 1P43A 1YPXA 5I23A 3T42A 4PBGA 4HTYA 5A8QA 2XVKA 4WKAA 4Z42C 3GC2A 3AAMA 3UWZA 2P0IA 5DMNA 3CGTA 3EA2A 4NJGA 1I2RA 2GDUA 3IGHX 4UB9A 3PANA 1TRDA 4LV4A 1ICSA 3DZ1A 4R9XA 3FYPA 3HV8A 3TXVA 1FCQA 3FOKA 4KKXA 4XD6A 3KEHA 1W0MA 2OGJA 3A13A 4IIFA 2FGBA 2H3DA 3AC0A 1XUZA 5FJTA 2Y7GA 3VC6A 1RP9A 1BSLA 1ZENA 2PP3A 1ZGDA 4LJ3A 2CLMA 2GQ3A 2VOTA 3LD5A 3Q58A 2PDMA 2CC0A 3P3BA 2VFDA 1B30A 4TMCA 3S5NA 3MSDA 2R94A 3UWQA 2AL2A 4DZAA 2CZDA 2BB0A 1W37A 5HWJA 2ZZ1A 4LH8A 3GG0A 4O16A 1HFBA 2ZUNA 3ZMRA 3F7JA 4B92A 5AC6A 2PGRA 1V3LA 2X1SA 1Z32X 2VFIA 2CLOA 1FCUA 5IFTA 3A21A 5HR7A 2E3ZA 1OBAA 2XINA 3GNDA 4O0QA 1UZ4A 4Q8MA 4KWSA 5GJNA 1VH7A 2QYGA 3AHYA 1V0NA 4IFKB 1OT2A 1AODA 2BOGX 2VDHA 1N82A 3F2CA 5XIMA 4U28A 3AUOA 3W28A 5E0FA 1ALDA 3NPWA 3D47A 3NCOA 4TX9A 4XV0A 3CWHA 3AISA 1PCWA 1RUSA 1X7IA 5HQEA 3VVGA 1P0EA 1YNQA 3SCTA 4PUWA 4GBDA 1V3IA 4A29A 5I03A 3WEOA 3O05A 1XIHA 3UWWA 2X0HA 3V1PA 2F84A 4M81A 1JZ6A 1E0WA 4JXCA 3GHTA 4PUKA 4I7VA 2WJZA 2Q8LA 3UVIA 2DUZA 1XYMA 3NPUA 1XH1A 4HKPA 3W2NA 4JEJA 3BLFA 2G97A 4OBTA 3QPYA 4N9BA 5LIUX 1OYAA 1LRQA 4GH1A 4GJIA 3Q2DA 3WBXA 4B91A 3TV8A 1C90A 5DBUA 4N9EA 3K4AA 3BSGA 1UC4A 4PN2A 4HNOA 1UKSA 3E9AA 4MM1A 3VM5A 3MDUA 4I5RA 1RALA 1AZ2A 1IZKA 4KWUA 5AZ0A 3FGCA 4IXHA 1I2QA 3VGEA 3R6IA 1IWAA 1R85A 3M0YA 2Q8XA 5C2GA 3GK0A 1JCTA 2J75A 3CUIA 3WK3A 3SURA 4B3LA 1AD4A 3KTSA 3LXCA 4K2SA 4WOQA 4Y96A 3USBA 1H09A 1B3VA 3HGRA 3NYDA 3ES8A 3QTPA 1JXKA 3CAQA 3VDAA 3ABXA 3DH7A 3WYZA 4X60A 1QUMA 4GA8A 2CLIA 2WPGA 2YXXA 2EHHA 3BAKA 4AAJA 2VCBA 3GLCA 3L2LA 3CH9A 5HATA 4IUGA 1UZHA 4DJFC 5EKYA 1CDGA 2ZZ6A 3TTSA 1FWBC 3BOXA 3KRSA 3CIWA 2GSJA 4I8YA 1XRTA 4XBKA 3GQYA 2A5HA 4CQDA 1SQ7A 2Y7DA 1J4EA 3W25A 2L5HA 3RJYA 4HZ8A 4MYXA 4W85A 2FFCA 4JFVA 3NNTA 2I9UA 4LVFA 1XRSA 1WYIA 2OLHA 4K68A 2BVTA 1DXFA 4MSSA 4F0HA 3AHTA 3VE7A 2E1DA 2UY5A 3LXBA 4G9PA 2EBNA 3U2OA 3H7UA 3WFAA 3QFWA 2PWUA 2QGHA 4EANA 1TWZA 1FBAA 3BO9A 2RJHA 1VLWA 3U8GA 3HFYA 2Y4SA 3OODA 2OXNA 2XH2A 1OD8A 1BXCA 3CEPA 4XWUA 4AZHA 1HT6A 5EL1A 4O14A 1DWAM 1TJ0A 2XJ7A 3W29A 3P80A 4CU6A 4IMDA 3JUGA 3GXIA 3P5YA 1IIHA 2V5CA 3UJ2A 3B0PA 3PPCA 4EAYA 1F9CA 2WW5A 3GM8A 1XM3A 2Y61A 3ONCA 2BASA 5H1WA 2PDBA 4IGNA 2NT0A 1ZCOA 2X30A 1C91A 1EDQA 3AROA 2PBOA 1XDMA 4KCTA 4GINA 1G5AA 2PD9A 4O4VA 4GCAA 4N02A 3TTYA 1E0TA 4QS5A 3WUEA 1GKPA 2WMFA 1ZJBA 2R1PA 1UUOA 2DZTA 3P14A 4E2DA 3A47A 2CLHA 5CPNA 1K7FA 3G0XA 3RN6A 2DZAA 2FH6A 2XISA 5BU9A 4ZOBA 4H9TA 2HK1A 4AVOA 1A0CA 3FKKA 3OQEA 3APGA 2XVLA 4JX4A 3LHZA 2QS8A 3LHTA 5HXMA 4GLEA 1P0DA 2C79A 3B0UX 3NL2A 4BCEA 1GQLA 4OGZA 4OIFA 4Q32A 4GRSA 4O50A 4EIVA 1TKKA 1DORA 4BQ2A 4MDPA 2YL9A 1UJPA 4AEEA 4DN1A 4DRSA 5TQLA 2QCEA 1XWYA 1FH8A 3B9OA 3NO3A 4RDYA 1D8CA 1QMLA 4NT0A 5LA2A 4JX6A 3JR2A 3OA5A 4W88A 3UERA 3LTSA 3W1LA 3IUHA 4IP7A 5FEXA 4DJEA 2W92A 1V03A 2VUYA 2WOQA 3CLMA 3TVAA 2INEA 3QV7A 3VABA 3DI1A 2PWDA 2O4MA 1OEPA 1FHDA 4XZHA 3FXGA 4GY1A 4KEZA 5DCDA 3PNUA 4IIGA 2XWDA 4NAFB 1B3WA 5FJUA 1ZRQA 4X63A 1Q5MA 3HBLA 5D37A 2YFNA 3I6RA 4XVEA 3MV11 1PHWA 5L9FA 3MZ2A 2ZA1A 1GHSA 4GXMA 4FLRA 3H7VA 2QCFA 4GGHA 1XIEA 5BXPA 1UWAA 2DZBA 3HGOA 1R2SA 1V7YA 4CQAA 3TJLA 3H7RA 1PPIA 3QLLA 1AH3A 1R7OA 1XCFA 1D3CA 2VZUA 3I3BA 2J8GA 4OUEA 3VAVA 3WLQA 4QJ1A 3P93A 1H41A 4UUIA 3I4EA 4WUIA 3BV4A 3VM7A 1A5AA 3KBVA 5I6SA 4FSAA 3NAVA 1J96A 1PE1A 2D22A 2P3EA 1F3EA 1JEZA 3U6WA 3VIMA 1KBIA 3V0SA 4C6FA 2OSYA 4F8XA 1FWSA 2I7GA 3B05A 4LUSA 1X8FA 3A22A 1DIKA 1KKRA 2VRJA 4UMBA 3C2EA 2DIJA 4PRRA 4IP4A 1YDVA 1ITQA 3O16A 1B3YA 2R24A 5FSDC 2J66A 3BG5A 1JG9A 5D8ZA 1G4SA 1ONXA 3BW3A 2OSXA 1TIWA 4C6BA 4BK9A 5BYWA 3G0SA 4GKTA 1JCNA 1VPYA 3UZYA 4GMEA 1DJWA 5A8NA 4I5UA 4QEEA 4PA8A 2VMFA 1BWLA 2WZTA 3WH8A 2QMKA 2D24A 3NQDA 4PMJA 1ITUA 4MWAE 2VVSA 2A1YA 3JZEA 4MGGA 3CAVA 3KAOA 4H01A 2FVMA 1BEUA 1PSCA 2X1IA 3AI0A 4E2VA 1XV8A 1LZOA 2F38A 3FHAA 2E68A 3A4AA 2B7NA 1T8QA 2VRKA 1NOUA 1HF6A 2OQYA 4QQ3A 1BHGA 3RNDA 2C16A 2WCGA 3WJZA 4H8HA 2X1TA 4NNBA 3TNOA 4JKKA 4YWSA 1OB0A 4PL1A 1VCGA 1V3MA 3RO8A 1QWGA 2VX5A 3L7RA 1T6MA 5D8WA 3OLEA 4JIHA 2G95A 4CD8A 4QFUA 5GJPA 4O13A 3LXAA 3TCSA 3BLKA 4BI6A 2Z6JA 4PRWA 2OYLA 1TTPA 2XN0A 2ZUTA 2JKEA 4TTUA 3IGSA 5CZJA 3JS3A 1XLMA 2FZNA 4AIOA 1LORA 3ARWA 3OPSA 2C7FA 5CSYA 3KFTA 1C8VA 4GZJA 5C9XA 4X2PA 4WEVX 2DZUA 3NDZA 4MVAA 2OYMA 3II1A 1AW2A 1ZHAA 1W1ZA 3ZFHA 3B9AA 1ADDA 2FZDA 1WDRA 2Y85A 4KT2A 1JZ2A 1OX5A 2NW0A 1EYEA 2XFWA 3BQ6A 3VIFA 3JVAA 4JTAA 4BY3A 2WMGA 5AC5A 1FH7A 1YNYA 3NOYA 3W37A 1CTNA 3WNOA 2ZUWA 3WQ8A 3NURA 1ZBVA 4YNGA 4J3TA 2CLKA 3W85A 1KM3A 3EXSA 3GBEA 5LNSA 4UTMA 3W7EA 1A5MC 3QW3A 4IJBA 2FB3A 1R38A 1Z7AA 1HQTA 1SMAA 1BKSA 1HKWA 3KWSA 3DFSA 3GYCA 2ZA2A 4PMUA 1LL7A 3U5YA 3V5FA 1XXXA 1OGGA 4DY1A 1PKLA 1PV8A 3TOYA 1KR1A 1HP4A 3LCLA 3LEPA 1W56A 3AYVA 2PWGA 3S42A 5CKSA 3DG7A 3KBNA 4A3RA 1Y5VA 8RUCA 3QBUA 2WZHA 4MF4A 4DEFA 3F4CA 3VNLA 5KZDA 1Q6DA 5T91A 1XR2A 1UMLA 3LI0A 2GQAA 1C8YA 1CWYA 3UETA 3PWGA 4K7YA 1XH0A 1MNSA 2GUBA 1KGWA 4RE4A 4W7UA 4AD5A 3UCQA 2V5BA 2IPGA 1KB3A 5C7VA 1HZYA 1QPQA 6REQA 4J3UA 3E3HA 1E3XA 3CIXA 2QGYA 4GX8A 3H26A 2CZ5A 3PJUA 4JGDA 2JIWA 2PU1A 4QNEA 4M1BA 4QG8A 3C56A 1X6UA 2J7FA 1GEHA 4WZHA 3TN5A 2PTZA 3MDWA 3L2IA 5G2IA 2P88A 1TYGA 1Q8AA 1L6GA 1JPHA 1LDCA 3AYRA 3W38A 3L4UA 1TZ7A 3LS9A 2A6LA 9XIAA 4PEEA 3H2NA 2PC4A 4NZ3A 4OV9A 2YSWA 1G6CA 1MW3A 1JR1A 4HVXA 4GHRA 1E0XA 2A7NA 3P81A 1W5MA 1WAWA 2D2HA 4DJFA 4QCFA 4W7VA 4NKCA 1LT7A 3WMLA 4L64A 4A3HA 4LVBA 1K1DA 7CGTA 1TQJA 1VC4A 1CGVA 1Q6EA 1EZ2A 4HU0A 3SCPA 1FKWA 4L6DA 1LT8A 1MUCA 4RV3A 1Z3NA 1Q45A 2YA1A 4ICMA 1TELA 3N3MA 2VELA 3RHGA 2XSBA 3CV6A 4TR9A 2XIMA 3CZ8A 3EB2A 5IM51 4FK9A 2Z2BA 4LTSA 2OEKA 4GUHA 3P0XA 3KBJA 2I9EA 1WDSA 4TIMA 5LZLA 4X0NA 1Z48A 5DCEA 3Q65A 4PTVA 3KP0A 3AUJA 6XIAA 1C29A 3VA8A 1B9BA 2YZRA 4W7WA 4GI6A 1LUCB 3TTEA 1AA1B 3IRSA 3CQ0A 4BQ4A 1LBLA 2VJXA 4AZ5A 3UJSA 3LM7A 4CQBA 4M1RA 1REQA 4M5PA 3RDKA 4CCCA 1UBPC 1AMKA 1GUVA 2G3FA 5A6KA 3GAKA 1LWJA 3PZUA 1SR9A 2Z1XA 1JI1A 4WSJA 3U48A 3CHEA 1PKMA 4O8RA 4DO7A 1MDLA 4LFYA 4OV4A 1PB0A 1UD6A 3C0LA 5FEZA 4B4HA 3IJDA 3N4EA 3DERA 4HPNA 5D04C 3PC0A 4IPPA 5BWFA 4NAEA 1MI3A 3G1FA 3B8IA 1W3LA 4H2HA 1A5OC 4ZL1A 3TYAA 4TV5A 2OFJA 4N2YA 3W23A 4Z0SA 3SDOA 1YE4A 1QO2A 3D46A 1CXKA 3SRKA 4UXDA 5LIYX 2ONEA 2PRLA 2QCHA 4QDMA 2BHYA 1N8FA 2PRHA 3BGAA 4O12A 4H6QA 5REQA 3PBUA 3UWEA 4CN4A 1KXQA 1ZCCA 4BEUA 3K13A 3KBWA 4W9TA 3WJXA 3V7PA 4PODA 2JIEA 3TUUA 3G1VA 3AIEA 1OIFA 3S46A 1IT8A 4OTKA 1NWUA 3EPNA 3NL6A 4NJIA 1RQHA 3FSUA 3VIHA 4L4LA 1E6PA 4NIRA 1UB3A 2YFOA 1SPQA 5HNRA 4LEFA 3MUY1 3NTYA 3FFSA 2OGYA 1PWMA 2W4XA 3SECA 1L9WA 4P7OA 5AYYA 2R1NA 5A2BA 3BE7A 5MF5A 5D4YA 3LENA 1DQUA 3VDHA 4GYFA 4H41A 5E93A 2WM1A 1W9BM 2JQXA 4LGXA 3RPMA 4O0KA 4XAZA 1BXBA 3TYCA 3AS3A 3PAOA 2QAFA 4IWWA 4WF7A 4XTDA 3IEBA 4Y8FA 2VFEA 1F05A 2BXYA 4Q4KA 1E43A 3ZLFA 4EPKA 2GK1A 4JQ2A 4REQB 1E3ZA 3B8VA 1TVNA 1TZ9A 2X1UA 2WKGA 3N2XA 3J7HA 2PTDA 2FFIA 3LSBA 5A6SA 1V02E 3GDTA 2BS9A 1Q63A 4LUJA 2NLIA 1XPGA 4J5NA 5CC5A 3ITXA 4PMDA 2J27A 2GGHA 1X97A 1IF2A 3WQDA 1S5VA 4HQVA 1OT1A 3TYDA 1EBGA 3IIZA 5LIKX 4RDVA 3VD9A 1W3JA 1JIBA 4HYVA 3EB4A 5I5RA 1CW2A 3N73A 3KRZA 2VX4A 2ZXDA 1J8VA 3CAKA 3CTTA 1OX4A 1UH2A 4Y9OA 1GVSA 3L9CA 4DJFD 3DFYA 5I3DA 3IVUA 3RPTA 1G0CA 4KW2A 2ZE3A 1BKHA 3KRBA 3W7CA 1XYAA 2DVXA 2WBKA 1E40A 3NEVA 1QPKA 3OO2A 1TREA 3LDVA 5IFPA 4PL2A 4FXJA 4NUWA 5F2LA 1XHGA 1KKOA 1TPH1 4F2BA 2RFGA 3LGDA 4IIEA 2BLEA 3WNMA 3K8LA 2V30A 4MJ4A 3WQFA 7TIMA 1XYFA 1OFAA 2E1WA 1H2JA 3BAIA 3SRDA 3H2CA 1BRLB 4XAYA 4XUYA 2O92A 1F2JA 1I0DA 4WY0F 1W3HA 3RM9A 2IQDA 3L68A 1I1XA 3MY9A 4ZOEA 4M0XA 1NFBA 4HMCA 4RPPA 3VE9A 2FJUB 1GJPA 4NZ1A 3MO7A 1T41A 2PDLA 2C3ZA 3IV8A 1JD7A 4H19A 2PU0A 4Q33A 4A21A 4JFTA 1AQFA 2NSOA 2E28A 3A12A 5DF0A 3SUTA 5FACA 4DLMA 3N14A 3OEXA 4PGLA 1FP8A 1I2PA 2WNNA 2WVTA 4LWWA 5D9OA 1NWTA 4LAKA 1MSSA 3PTMA 1FDJA 5XINA 3M46A 3I7RA 3RK8A 4IGMA 2WPBA 4FAMA 4LU0A 3H4XA 3RX4A 3UWUA 4GNJA 2G96A 3TSDA 2DUAA 2BGNE 4YJ5A 3MVTA 3WL1A 3QMTA 3AIRA 4CCDA 4JN7A 2ZZ5A 2O9TA 3W7KA 4LUTA 1KFKA 4LPCA 1N8IA 5K2ZA 3WN6A 3EWBX 3R1ZA 4WD0A 1TX0A 4OWGA 1J6OA 3CBWA 5LSMA 2RDWA 1EGMA 2XIBA 1E9IA 1TG7A 4US6A 1QXLA 2V63A 3CUHA 3WQGA 4JS3A 4KCWA 4DM2A 4B9ZA 2X1RA 3CC1A 1Q3NA 1SJAA 4HJFA 4H6RA 2VGGA 1K9DA 1JCJA 2HE8A 4C6CA 2WO5A 3HPXA 1OVDA 3D3FA 4JIIX 4X0VA 1EJVC 5FA5A 3WH9A 4L9XA 4DYKA 1R7AA 2X0YA 3VCNA 4JQAA 4GUFA 1NWSA 3BMXA 2IKHA 1JPMA 3UXAA 1S3HA 1JUKA 1KA9F 7XIMA 2W9MA 1WO2A 1FWNA 1J0YA 3WG6A 4GIEA 1MRQA 3UT0A 3K46A 2ZDSA 3HPFA 5D2YA 2Q8ZA 3NQ2A 3UA3A 1PZ0A 1RPXA 2GGGA 3WUBA 1GWJA 1KWGA 5HQLA 1C92A 2QT3A 4HMNA 1V77A 1SM9A 3FA5A 4AY8A 1JXJA 2YDAA 1NOFA 2HNHA 4QG9A 3EWXA 4O17A 1NDZA 5LGXA 2W0UA 3C0SA 5I06A 1JUEA 2B31A 4AMAA 3NQBA 4C6MA 3UBPC 2MUCA 4LBSA 1PIGA 2ZTKA 3R12A 3HGSA 1U33A 1P5BA 3PUOA 4ZODA 4GQBA 8XIMA 3BVJA 2YL6A 4C5ZA 4DUWA 4O8AA 4A8RA 2O7SA 3HO8A 3BCJA 3WDQA 2PTYA 4I6KA 1VJSA 3H24A 1WDWA 4OBSA 4UFLA 3ZWTA 1NSJA 3UG5A 5DRIA 1TPWA 1Q7QA 4XAPA 3WQEA 4OBRA 3HQPA 2G37A 5I3KA 1DJYA 4FX8A 2GZXA 2Z27A 2Z1SA 1ZLPA 3C8NA 2AL2B 4K1WA 1F74A 5CEWA 4H9VA 2RJGA 3AHVA 4DBSA 4JD4A 2E7FA 1AVAA 1Q8JA 3UWYA 1IR1A 3LV6A 3UXKA 2AGTA 5E70A 4NVTA 4XB3A 1F8MA 1RQEA 1XLHA 3GX9A 2PI6A 4L7ZA 1TA3A 2UY4A 3OZYA 5CSSA 1LBMA 4C6DA 3KOYA 3GSMA 1EWEA 2YCJA 2VEKA 1GVYA 4ATDA 3VNJA 1F3XA 3C5QA 3EDEA 4FZIA 5FF0A 5FJPA 2Y2WA 3NA8A 2FPYA 5A8GA 1V3HA 1EJUC 1MYRA 5DXXA 3R25A 1D3GA 5LHFA 4LY8A 1E6ZA 2NUXA 1VCFA 4QQUA 5ABFB 2R6OA 2JKAA 4JQ1A 5F2MA 4GGBA 3T40A 5BMXA 4FPSA 3U7BA 4MZYA 1DVJA 1GTHA 2Y8KA 3M6YA 3TFXA 5DY2A 3N9RA 3OU8A 5FSEC 3ABQA 4PBFA 3INPA 5JU6A 3TQPA 1X1OA 2ZWZA 3LCFA 3WNPA 4X61A 4Q4QA 5G1TA 5FF2A 4HB7A 3B06A 5JIWA 4BFAA 2CESA 4TO8A 3N4AA 4D6CA 1XD0A 1OYCA 3UYCA 4C5YA 1L6WA 3FGCB 3KDNA 3UCDA 3PK7A 4GZIA 1E4NA 3WFLA 1KV8A 2OZTA 2Z24A 4DI9A 4U4MA 4GQRA 5JIPA 2FDMA 4JICA 2QXWA 4BEQA 3N2OA 5CC3A 2R91A 2OYKA 1K9FA 1PKYA 3WZ0E 3QN3A 4GVIA 1YPFA 1E0VA 2ATMA 4C1NA 3LCGA 4XZWA 3WQVA 4GUIA 2Q3RA 2VTFA 5IDIA 2PDKA 2E25A 1K4HA 3QM3A 1WBJA 3CZGA 4GNVA 1N55A 3W73A 4F2TA 5E5CA 1FWTA 1GOXA 3HG4A 4C7GA 2PGWA 3L2MA 4QLKA 1ONEA 1W9XA 3WLNA 2PP0A 4V27A 4G2DA 3CB8A 3QQWA 4XBSA 3GS6A 3RM8A 3KP1A 4HP5A 4K8GA 2UWFA 1V6YA 5A94A 5HINA 3ZS4A 4GG9A 3ALGA 4AX6A 3SUWA 1PTGA 2GPTA 2NXGA 4HK6A 2PAJA 3LA4A 3CHVA 2WMIA 3SADA 1TV7A 1PIIA 3GW0A 3EMCA 4IX0A 5HNNA 3USZA 3M47A 4HHMA 1PYMA 4WXZA 5CZKA 5MHBA 3RLHA 4IPNB 2HDJA 4MNJA 2P50A 4QRNA 3PSWA 4YS1A 2X7VA 4UTWA 3WK0A 3H12A 3G1XA 3REQA 1P48A 5KMYA 1OD0A 3UG4A 1WDDA 1YW1A 4IT1A 1IWPA 4XZLX 4HNVA 1VFOA 2GWGA 2PPGA 1FUYA 1V5XA 1SFTA 1US0A 3OGSA 3BGJA 4ZR8A 1FHUA 4U3AA 1TFVA 2YW4A 1ZAHA 4CQ8A 3S2CA 2AAAA 4HIBA 3GXFA 3LPFA 4Q8TA 4NL1A 5AHFA 1QDSA 2BHUA 3GVQA 1U5JA 5HK4A 4HA1A 1VBGA 2GUYA 3CPUA 2A79A 4NYYA 3VUPA 3CNYA 2Z1BA 3OZPA 1CX9A 2XIQA 2OX4A 5EBUA 2VQUA 1XIMA 4RNIA 5CLWA 2DJLA 1FXQA 5A6BA 3GNNA 3ZR5A 2BOEX 4DXKA 4RXGA 2R1MA 3W70A 3N3TA 4QDWA 3S1WA 3ZJ6A 3ID7A 1R2TA 4W86A 3ORWA 1VRDA 4GQQA 3WH5A 4G1NA 1Q4NX 1NDYA 4YU1A 4UFKA 4O1BA 1DEDA 4HJWA 3TMQA 3WBWA 4WKHA 1SSGA 2A3AA 3AFBA 3CLWA 3LLXA 5I2UA 3GZ3A 2WB5A 5I3JA 3E12A 4GYKA 2PF8A 3QGKC 4POCA 5ECVA 1GNXA 4XKMA 2VC5A 4YYFA 1NP0A 3DC0A 3OIXA 4D6DA 3W87A 4S23A 1W31A 1V08A 4AHOA 1E1FA 3W24A 4B2DA 1JD9A 3URNA 4WQ6A 2WQDA 3WH6A 2ANUA 4S3FA 3AIWA 2HZGA 3DIPA 3I7QA 1JCMP 3CHCA 2DUXA 4CN6A 1MXGA 5LKYA 3AMDA 1QHPA 4O19A 5GPRA 3QEZA 4LRSA 1YXYA 2R8WA 3GFYA 3F2DA 3NZRA 3W81A 1ZALA 3KUMA 4C60A 5CGMA 2QDDA 2VDGA 3AMGA 1BFNA 2F2HA 3LGGA 1XLCA 2ZX6A 4BF7A 4ASTA 4GO8A 5G5IA 1VLIA 3AHXA 3ABSA 4IUOA 4Z2HA 2ZVRA 3VZXA 4GO9A 3N6HA 3N25A 1AZ1A 1QW8A 1VIWA 4CD4A 5G1MA 1G1YA 4TXEA 2E4TA 1PEZA 3W1XA 1JRBA 1JL8A 3ARZA 7ODCA 3PG9A 3R8GA 3BAWA 5EMKA 2XGZA 2YL8A 4NZCA 3DDMA 5C9RA 1ZQ5A 2BBFA 3UEQA 4JIRA 5A8MA 4DAIA 2HBXA 2E0PA 1KTCA 2VFHA 2ISSA 4MKSA 4A8LA 4EF9A 3S2LA 1XBVA 3R4IA 1PZ1A 4A8IA 3LCWA 2QCDA 3LRMA 1J0JA 2Y5JA 4DELA 1JDCA 4DJDC 2OZ8A 4R7OA 4IG2A 3SCQA 3T9PA 5DMYA 4M6QA 1I1WA 3M16A 3ZYZA 1KQYA 1XSIA 3GTIA 3G1SA 3EOSA 4HSNA 3S1UA 1O5RA 4H7VA 2EPMX 4YTTA 1V6UA 2DZWA 2EG6A 2PZ0A 3WJWA 3VGHA 4OJYA 1ZP4A 5F1UA 3KOFA 1LL6A 4OKDA 4D1JA 5D09A 3C86A 3BK0A 3VKAA 3T6CA 5CSRA 2E9MA 3DGRA 3WNNA 1SZFA 3STFA 4MWAC 3SQLA 2ZZ4A 2AQWA 4I5XA 5A95A 4XTIA 4JHZA 2BTMA 3RG6A 3KLKA 2SFPA 4L4MA 5DLCA 1EHAA 5D02A 1DIEA 4NSBA 4WR3A 2NQ5A 5C54A 1GQKA 4L61A 2V81A 3M6DA 1DYSA 1VBHA 1HGWA 4LUSB 4FXFA 1UG6A 3VD5A 2A4AA 1KRBC 2PLCA 3DFNA 5AECA 5DMLA 5BZAA 4AISA 3PZMA 4KFPA 3LB0A 1NVMA 2BV9A 3ENLA 1YTKA 1WP6A 2ATSA 5BRBA 3WUFA 4QSHA 3W1MA 4IP5A 4WK9A 2FYMA 4CEUC 4MAZA 1Y8BA 3B0YA 2BODX 4BR1A 4LQ1A 5C6MA 3VFLA 3W7NA 3AYSA 3EAUA 1UIPA 2WJFA 2WHJA 5C70A 1XF0A 2DGAA 1UD2A 4S3JA 1YNPA 5A2AA 1PAMA 3SB0A 1SZEA 2C14A 2QHAA 5A8PA 1TPUA 5LGZA 1DP0A 4IPJA 4KCUA 5D2TA 1VFHA 4AZGA 3GVVA 4R3UA 4YHEA 4JYEA 4M6PA 4EWND 1VCVA 1SO6A 4N4PA 2VFFA 1KTNA 2DW7A 3QW4B 3AZRA 3KWXA 3NQGA 2B0MA 1FHVA 2DY3A 1LTDA 5EBAA 2BGSA 3MO4A 4AEOA 1B2YA 1Q66A 5HMSA 1GCYA 2YW3A 1RXOB 3EDJA 5I3GA 1AL7A 3WLOA 1R46A 2PTXA 4M6VA 1YXDA 4IFRA 2I17A 1E9ZB 4MKNA 3CQHA 3WQCA 1J0ZA 4GWEA 5A6MA 1K9EA 4B2DD 1XCWA 1MW0A 1EUNA 3MTWA 3PVFA 3ZLGA 1PDZA 3P67A 2ZCGA 1EXPA 3BMWA 1ITCA 3ZVIA 2ISWA 3PN8A 2VGBA 2G3NA 3N2CA 3QR1A 1HKIA 1BTCA 4H7ZA 1UCWA 2E6AA 2H6RA 4UQ9A 1OGSA 1NQKA 2W3ZA 1UH4A 2C6QA 2ZZ2A 4FOKA 5BOOA 4D6EA 1X6NA 2OKOA 3A9IA 3FDKA 3T2OA 3AS2A 2NQHA 2I5IA 2XSAA 1JYWA 3M0ZA 4H2CA 4S3GA 1Q4WA 2QJGA 3N4FA 1VP5A 1UWTA 1JZ5A 2B7PA 4HYWA 1A80A 4ZQNA 1EEPA 3C2YA 4I9JA 1HO1A 5LNRA 1G69A 4QJ5B 3R79A 4ZCWA 1XG4A 1XJBA 5TNVA 3M0XA 1R3RA 2GJXA 3IIVA 3VILA 4C6LA 3ISIX 3SY8A 1FWIC 3EDDA 4LV9A 3SY5A 4MPKA 3IGUA 4EX4A 3NSXA 4XQ6A 4RNHA 3DU0A 2Z1KA 1VPXA 4WOZA 3UESA 1S5NA 3RU8X 2WAGA 1TR1A 2HVNA 4J1OA 4WX2A 5JMUA 3S6DA 1EFZA 2PCEA 1G4EA 3E2QA 4HT3A 4E8CA 1M7JA 4HBKA 5AHEA 2CEQA 3QY8A 2Q02A 5AVNA 4LSBA 1CXFA 5FEWA 1KBLA 1LBFA 1A3XA 4AF0A 2YPIA 3GXDA 4JTJA 2XPKA 4UTKA 4IM4A 1L8NA 5T9CE 4XO6A 4DZHA 4H83A 1QBBA 3VKKA 3VKJA 4J4KA 2VVNA 3KBMA 1KO0A 6REQB 2AQOA 2E5BA 5AYXA 3HURA 2NUWA 1GGOA 4GPNA 1IYXA 4YVVA 4G8TA 3CUXA 5AYBA 1QPRA 3BL3A 2X7WA 2VKZG 5E9AA 2QDGA 3RYSA 3W7QA 2VT0A 1EQPA 1RLDA 2ZX8A 3GR4A 4KWWA 4S3CA 4UTJA 3MSGA 3QSRA 4WJ8A 1OM0A 3FYOA 4DBWA 4IMCA 2PD5A 4ADUA 1EJ7L 2TPSA 3RRAA 3IWPA 4DWSC 1SUXA 1Y7VA 3EWZA 3PZNA 3HFTA 1TX2A 4V33A 5EPDA 3QHMA 4HNTA 3MS8A 2RKXA 1DJIA 1XI3A 1R3SA 1OABA 1WAUA 3DX5A 2ISDA 3EDKA 4Q7BA 1G67A 3PPFA 1NOWA 4NYUA 5LXEA 3IJLA 1JPKA 3NO5A 1GZ1A 1NQ6A 1S2AA 3RCMA 1T96A 5I0DA 2YBVA 3TE9A 4UFJA 5C2XA 1UASA 5AYIA 1XLFA 3C2OA 2V82A 3D6NA 2FPVA 4MDOA 1IWBA 3NGFA 4JY9A 4Q4OA 3QJAA 1RA0A 1Z6KA 3QR3A 2VM8A 3CL7A 4JTEA 1EDGA 1UWQA 3LRLA 1L0PA 3TH6A 5H8MA 4AD0A 3NZQA 4X9SA 2UBPC 4NF7A 3N2TA 3UU0A 5E0KA 3RLGA 4UR8A 2EJ1A 1OFQA 4Q4MA 1UP0A 3L5MA 3OQ8A 1B0IA 1UJQA 3MUZ1 3DI0A 2XUCA 4EOUA 1GKQA 3K30A 1AQ0A 3EXRA 3T2QA 4EF8A 3GHSA 4QCEA 4ZZ9A 2I1OA 3W1QA 3VUSA 4M19A 3MA8A 2MNRA 4Y2WA 1YE6A 1RLCL 4FHAA 2F9RA 3NO1A 1REQB 3LPGA 2HXTA 3E0LA 1E15A 5B7YA 2NWSA 4QE5A 3RAOA 3ZT6A 3WIJA 1ME9A 3UJFA 3FA4A 1K6WA 2W6RA 1OX6A 3PUDA 5KSWA 1VKFA 2FQIA 4DPQA 3WENA 3EPOA 3SUUA 1BYCA 1Q7ZA 2NV1A 2V2CA 1RK5A 3GKFA 5J5DA 1FKXA 2OPJA 4IIDA 1TPFA 2G50A 1UUMA 4NAEB 3URBA 3AS0A 3NL5A 2WNQA 4XK2A 1EGZA 3KCOA 2ESCA 3W22A 1JUBA 3BAJA 3SJNA 5KZMA 2YL5A 4Q8UA 1GYLA 4MAVA 1BPLB 3C0JA 5M2FX 1FTXA 4W4QA 5REQB 3RR1A 2QPUA 2V2DA 3B3DA 4IIBA 3TYEA 2TYSA 3PG8A 3A9BA 3BICA 5K7JA 4YTSA 1KWKA 1C9DA 1UD4A 3SBFA 1UKPA 3FVMA 4EXQA 1QW9A 4J3SA 1ZU8A 4LALA 3OLIA 3Q67A 2FLIA 4PUDA 2PDNA 3ITOA 4J27A 3RMJA 1QASA 3MANA 3T0AA 3MYOA 1GK8A 3NDYA 1S5MA 3UXDA 5C2CA 1OCJA 4DIAA 3EX2A 3O0KA 3MP4A 2Z25A 3DN5A 3NIYA 1Q6GA 4L1WA 1HVQA 1F6YA 4MY9A 4RL3A 3TLLA 1NM9A 4C6PA 1VBUA 5D33A 2RUSA 5DRCA 4AIBA 4F2UA 4D6JA 1SW0A 4DAFA 4UTHA 1E1CA 2HRWA 2LLEA 3NZGA 2GK1B 3GUWA 4RZ6A 1NY1A 4PTMA 1WX0A 4DJDA 1H62A 3MMWA 3CYVA 3CJPA 4KGJA 3FEMA 3WX7A 3ARRA 1W9VA 5HANA 4MY1A 4WXYA 3F4WA 1FWWA 3R8RA 4BZYA 5BW6A 1JQXA 2BY3A 2VEFA 1OJXA 1M5WA 2XVGA 2VEPA 4FOUA 1FOBA 2DSZA 2G4FA 3R7MA 1E4LA 2BFGA 5F1VA 3VGDA 4ECLA 1O94A 4YCPA 1VJZA 1LCOA 3NPVA 5CZ0A 1P7TA 1ZAJA 3P8IA 3WH7A 1A5BA 2A3BA 5E1QA 1OY0A 4MWAA 1OX4B 2XYLA 1S2CA 3SFWA 5G4EA 2ODOA 1XX1A 3IIPA 4IGHA 2WK2A 1JYXA 4N42A 3OG3A 1F6PA 3QY7A 4JNMA 1NIUA 2POZA 1POKA 2H9AA 1DHPA 4JKLA 1EOMA 4B5WA 3T05A 3UY8A 2XIIA 3UY7A 3GBDA 1RPKA 4WDTA 3OVGA 4PRTA 3AXMA 4YHGA 2HV5A 4OOUA 3UFYA 1EXBA 3UR5A 3QY6A 2OLSA 1QCWA 4LAUA 1X1NA 4O53A 1TWSA 4XUGA 5DXYA 3HIJA 3OB8A 4C6JA 1JDEA 1WXJA 1B9ZA 3L12A 3TAKA 3BMVA 2PWVA 1EC9A 3GU9A 3DFPA 1TTIA 1XGEA 4D72A 4WGHA 3VOHA 3UZJA 4JTIA 1TMLA 1OFOA 2CBVA 2P8CA 2PDXA 3AU6A 3NM1A 3UXLA 2ZRVA 4FS9A 3SQMA 3QHOA 1ZZMA 3V3WA 4D6FA 1TV3A 3M7SA 4AZ7A 3GC5A 4LCRA 4V1XA 4KETA 2PB1A 5A1AA 3UG3A 1GYNA 3CWOX 3W7JA 4GOAA 2EAWA 2ZBTA 1R3VA 4BQ3A 4K7VA 2ZDRA 3TN6A 3MMTA 3TJXA 2AKZA 4H9ZA 4Q4PA 4FMVA 2PBGA 4AFYA 2D3NA 4ACZB 1BQGA 3L67A 5AKQA 3BLOA 1R3QA 4YVPA 3MUAA 4JFUA 3SSZA 1K8YA 4KRUA 4HNCA 4M7TA 4LUTB 4B3KA 4BHYA 3GH4A 3HGJA 3W1UA 1G7VA 1GG0A 3S5OA 1RZMA 5E6YA 2WVSA 3TFCA 3L5AA 2WANA 2Y5SA 2QIWA 3QGAC 3CT2A 2VRQA 1XYZA 2WC4A 2G3IA 5MKGB 1X7FA 1UMYA 3LHUA 1LLWA 4JTRA 3PTQA 2JBMA 2VEIA 2ZC8A 1OG0A 3ZZ1A 1B31A 4MOZA 3MHUA 1S1PA 2YCIX 4TVUA 2C13A 4L4PA 9XIMA 3GNPA 5AVHA 1W91A 1TQXA 2CYGA 2FTYA 4PMRA 2D0FA 4GACA 5CZSA 2X05A 3FX4A 1FX6A 2CCRA 1C7SA 3WLPA 3TW7A 2WNZA 4PCSA 1M7OA 4AD1A 2E77A 1FWHC 5L6UA 4NJJA 3DHFA 2BWGA 4QGCA 1ADSA 4O1AA 3THDA 4QAIA 2J13A 3CUGA 4QLJA 2YKKA 1A53A 3OOQA 4IPLA 4DJDD 2Y6ZA 3T8LA 1HKJA 1WUEA 3H6OA 3ZIZA 4DXVA 4Q8OA 4LBUA 3HB9A 1Q85A 1XIBA 3W86A 4QJ3B 2R1LA 1EO5A 1XDJA 5M17A 1W1YA 2KZHA 5FF7A 1P6CA 3E0VA 2D2GA 1QNRA 3M0VA 3SN1A 4PH6A 3RUBL 2Y7EA 3AWNA 1GZJA 4MWAD 2QJJA 3S4TA 4GVHA 3A4JA 4Q8NA 1HGYA 3GUGA 4KRZA 4P61A 2BOFX 3KW3A 3ATYA 4WJXA 3L0GA 1E4IA 3QF0A 1HG3A 3K1GA 4U2YA 4KMQA 3UF9A 1XLLA 3I68A 3MSRA 1O68A 2Z4GA 4HMDA 3W9ZA 1OC6A 4GCXA 1EZWA 1W1IE 3FJ6A 3N17A 2YBUA 1YQ2A 4DWSA 1TA3B 1UR2A 3O15A 3PJTA 3NQMA 4AC7C 3GXPA 3H53A 4R53A 4D1IA 1WQ5A 1VFUA 3MKKA 4QIUA 3DYOA 1FCVA 1PYFA 4AZBA 3LN3A 3CMGA 2Y70A 3BPWA 2TRSA 3A4XA 3PZVA 1VENA 3XIMA 4XZNX 4RKAA 1PTDA 5G2WA 4U5IA 2D23A 1CPUA 3ANUA 3DFHA 3O9NA 4K37A 4HNLA 2EPOA 1ZY9A 1UH3A 3U3HA 1GQNA 4L5ZA 2PDIA 4P8WA 4I7WA 4ZOAA 2QUMA 1SMDA 4AY1A 1H7NA 3NM3A 4BJHA 3IJ7A 5AHLA 2R9RA 1TIMA 1T40A 3S8HA 4MZ1A 1EO7A 4V2XA 1QBAA 5FOOA 1IV8A 3PF3A 4BF9A 3RITA 3GE7A 3G8RA 2VC6A 4LYPA 4ML9A 2HTMA 1UWSA 3S6TA 1KW1A 5EU9A 4DHGA 3W6YA 1J0HA 1L2UA 2V8ZA 2DVUA 2YA2A 3ITVA 5JBDA 1OCBA 1DBTA 3EGJA 3GAYA 1HNYA 1UC5A 2ZUSA 4MHBA 4NXSA 4Y9NA 1AJZA 1D7FA 3MT1A 3OTRA 4AYGA 1LLZA 2RDXA 3C2RA 1JF5A 5HNTA 2J7EA 1SW3A 4GFIA 4L6OA 1TO3A 3A23A 3EA3A 3QPEA 2VD9A 2GJLA 3DESA 1T99A 3GXNA 1EJTC 3IPWA 3BSHA 5EMYA 5LXXA 1GOQA 2J24A 3WD0A 4C1NB 4A4AA 1V0LA 4ERIA 3FJNA 1KC7A 2QVNA 3G1RA 1DJQA 1JZ7A 2E6YA 2VO5A 4M56A 1FWGC 4RW5A 1QFEA 1DTNA 2VZTA 4XZIA 4KF1A 2X42A 3QZ6A 3G18A 3VINA 1QNOA 2FTWA 4UTIA 3P7YA 5LIXX 1EEXA 1KLZA 4W89A 3AIUA 3QOMA 4FLOA 1KFLA 3H4WA 2POTA 3KZSA 3A6OA 4CU7A 5A5WA 2WMIB 3GIYA 1V02A 2WM0A 2WVUA 5AB3A 3S9IA 4A05A 1BF6A 3WSUA 2EJAA 3ONBA 2V67A 5LNUA 1RBAA 2JK2A 4S2CA 1K6AA 2QPXA 4LAOA 2FGLA 1UQYA 1IEIA 5TF0A 4LOCA 1XSKA 2B81A 2GDQA 3REQB 3Q37A 1W1PA 1UOKA 4MLJA 2QW5A 2QCLA 4ZEPA 5ABGA 2VR2A 3GFXA 4FIQA 3ITLA 1BG9A 4KQNA 3DBPA 1NARA 3GVWA 3L4ZA 4RLIA 7REQA 4PB4A 1D9EA 3E2SA 3OBKA 3MP3A 2NUYA 3H2OA 1EH9A 1M65A 3TLQA 4WLCA 4G1KA 4R34A 3G0UA 1W3KA 1KBJA 1XQLA 5CJMA 4GI8A 3AXIA 1IEVA 1SO5A 3ICJA 1XIGA 2VC9A 1IE7C 3N9SA 5E0CA 1RAKA 4AB4A 5I24A 1XRFA 4ZSTA 2CITA 3LTPA 1RCQA 1ZPTA 3H2MA 2P10A 2BSLA 1DJHA 4HPJA 4RCXA 1Z44A 6CGTA 5C0QA 5EFFA 1KFWA 1JQVA 4HCHA 2H8XA 3JZUA 4KS0A 2FHCA 4HMEA 4PMYA 5H6HA 2DT2A 1XKYA 2B7QA 5M5DA 3NSNA 4M80A 1XGZA 2NT1A 4GY0A 4CD7A 2NSXA 4EKJA 5LNWA 4KEVA 4DWSD 1UR9A 4AH7A 4UBPC 2OELA 3H22A 4PC8A 1SFJA 5DY3A 3SJ3A 2FHBA 3FAXA 3IS4A 5ECUA 1CGYA 5F4WA 1K8ZA 1RSCA 1JCYA 1XLEA 2YBTA 1BQCA 1M7XA 4MIMA 4UFIA 1KRAC 3IJIA 3ZR4A 3XINA 1U1UA 1LQAA 1XC4A 4G6CA 1CLKA 3IGXA 2NWRA 5EY5A 5CG0A 4PMVA 3K2GA 2A85A 1AK5A 4AIEA 2A6NA 5BXRA 4H8UA 5DX7A 3H21A 3FAWA 1B90A 2DORA 3CQJA 1K8CA 4CKQA 4HN4A 1KCLA 2WVVA 4QE1A 3WF1A 4CVWA 3VOGA 1GOKA 2CWNA 3SCRA 3R89A 3FN9A 1XGDA 4AD3A 2BZNA 4S2BA 2UZ9A 1XLGA 3QLDA 2PS2A 3AOFA 2ZFAA 1O95A 4HZ7A 4LB3A 3ITTA 2INFA 3RPDA 4DLFA 3FXYA 4O54A 1TUFA 3PZQA 1NTHA 1JI2A 4OECA 3F2BA 2BMBA 3WLTA 2RAGA 3CQIA 2OU4A 2OZ3A 2YB1A 3RMEA 4CD6A 3CPGA 2QCDB 3WBYA 2VGIA 1W54A 3T09A 4IG2B 1A0DA 2V2HA 1SSDA 4GFSA 3WF0A 4H3DA 3TOPA 1ZFJA 4DUXA 3GG1A 2ABBA 3DYPA 4R85A 4LB4A 4QDPA 2QAPA 3C61A 1VIZA 2IUZA 2A21A 5B80A 3V1HA 2VWTA 5I07A 4KH2A 5H8PA 3OZMA 3THAA 3IAQA 4YVXA 3T8QA 3GDBA 4I6VA 4LNYA 4XD5A 1K02A 1FWDC 3L23A 3NQVA 4YWIA 3IRDA 1J2BA 5FCZA 4FNRA 1KFCA 3RFAA 4JIEA 4PSPA 3FY1A 3EBVA 4UWMA 4LANA 3SCVA 3GH5A 2Q09A 1UR4A 4UR7A 3WNKA 2GQ8A 5CBJA 1I45A 4P7QA 3D0CA 4P7RA 1BG4A 1KR0A 1FXPA 4F9DA 4M8UA 3W1NA 1F3WA 4KEUA 3HF3A 1TJ1A 4JAWA 5PTDA 1D3HA 2QQ6A 1F5ZA 5IHRA 1T8XA 3SN4A 2QKFA 2GGIA 3ZJ7A 3KL3A 3MMUA 4O1FA 1XYLA 5GNZA 3MUXA 1VEOA 4JL1A 4FIRA 1W1VA 4B9YA 5FJJA 4GXWA 5SWUA 3V16A 3N04A 5LA1A 1AJ2A 1GVOA 1VEMA 4BKNA 2Y5EA 3TK7A 3SUSA 2Z7KA 4N9DA 4HZMA 1FWCC 3K8MA 5A2CA 3VIKA 4NJHA 1IXOA 4W8AA 4XAGA 3AHZA 5AC7A 1FRBA 3SAZA 3LCIA 1WE5A 2V5JA 4Q22A 2O9OA 1MWOA 2QIIA 1UPMB 4GIYA 1SW7A 3N34A 1SVDA 4PCFA 4XX6A 3EYPA 3BCDA 1O12A 4F79A 3R0UA 1MQQA 4MFEA 2A7RA 1QI2A 2BVYA 1H0IA 4Y8EA 2O55A 4QJ4B 3PWAA 1BWVA 3MYPA 2J7CA 4HPXA 3ARPA 1ZBCA 3W76A 1G9HA 4FF7A 4GZEA 3ZSTA 2Q6ZA 3ARXA 1DJNA 1QPNA 5DANA 1UOZA 2J4GA 1TB3A 3VDGA 3STPA 4IIHA 3B03A 3PBWA 2ZTJA 4KCVA 1GOIA 1JGMA 1KTBA 1ZJHA 4DO5A 3WJYA 2QF8A 1CCWB 2FJKA 3UNDA 3CHDA 2OEJA 2ZKMX 3EXTA 3QH2A 2OT0A 2UY2A 4BWLC 3UJRA 2NV9A 3KX6A 3PBVA 3IK4A 3V5CA 4QEHA 3LCXA 1TV4A 1R3TA 1QW7A 1TPC1 1KM4A 2W5FA 1O4UA 2W61A 1HVXA 3M0IA 2XVPA 2DIEA 1PJ9A 5ABTA 1EJSC 2GOKA 5FKYA 2IPWA 1UZDA 3QPZA 1VHCA 2WKLA 3SY1A 2X40A 3L0KA 4WRHA 4HPHA 4L80A 2REQA 5LA0A 3ARVA 1QNVA 3RILA 2G3MA 3LY0A 3MI3A 4AXKA 2CLEA 2DQWA 4WSKA 5F4XA 4H1ZA 2ZUUA 2QCMA 5KEZA 3OGVA 3G1DA 5CQ1A 3PB2A 1OC7A 3W74A 3HQOA 2ZZ7A 1LLOA 5CH9A 1KFEA 5CGTA 1A5UA 1VZWA 3CAWA 3OLGA 1QNPA 2GJXB 4GY7A 2EPKX 1WNOA 5U4NA 3O7UA 3C52A 3TQ0A 2D0GA 2BY2A 4L56A 1PZ3A 3LERA 1NH6A 3W27A 3RX3A 1W1TA 1UQZA 3TZFA 1AQMA 3T55A 4RNFA 2PTWA 4ML4A 5IDZA 1S39A 4AF0B 1QTWA 4CCEA 3N29A 4UCGA 4HOXA 2XSXA 3CMJA 1TCMA 3SCWA 3L5LA 1VFSA 4OHQA 4NHVA 1QOQA 1W3NA 1WKEA 3W0KA 4C7FA 1KQZA 3CM4A 3MKVA 4KIRA 1WB0A 3GDLA 5XIAA 1HW6A 1I2NA 3E0IA 3WK1A 1E4MM 3UZWA 3ARQA 4UOZA 3OVRA 5CGQA 2OR2A 2GJPA 3LUTA 2CWXA 3W7GA 3F5KA 1IGWA 3UGRA 4S3KA 4UQDA 4RZ5A 4PMNA 1OIMA 2AL1A 3SO7A 4AWTA 3CWNA 2IPFA 4RDWA 1EPXA 4KBXA 4D6IA 4LAZA 4E4PA 5DBTA 3IJQA 3FLUA 1MFUA 1YRRA 4AHQA 2FDSA 2HS6A 1O1HA 1SZGA 5CPLA 2O4QA 4YMZA 4N7QA 3IACA 1YLVA 5HNUA 3N19B 5HAOA 1E51A 3BANA 2IKGA 2J8TA 3SZ8A 1V0MA 1SJBA 3AO0A 3KBSA 4WJEA 4E3TA 3LQLA 1GPFA 2D69A 1EP2A 3KOXA 4OQVA 2WKJA 3T0CA 5A69A 3DOPA 1WPCA 1I8JA 2IW0A 1UWIA 5T26A 4AD2A 3C3UA 2CKSA 2J7GA 3L4TA 3AYTA 1C3FA 5HPOA 2Z1WA 3DECA 4IMAA 4OE7A 4TV6A 4EP8C 1E9LA 1PWLA 2B7OA 4O1DA 1MW2A 1HJUA 2D3LA 3IUDA 1ZUAX 4ICNA 1GVFA 3PHAA 2EG7A 1TE6A 3VX0A 1OHLA 4PZVA 3O3RA 3W88A 1C93A 2YZ5A 3SN0A 1Q65A 3BC9A 3UYIA 2YXOA 3V75A 2NVCA 3NYZA 4J3VA 4KESA 4NJKA 1U83A 1Q6LA 3R13A 1GYMA 5AYZA 2EGZA 1SFLA 2DT3A 3M43A 4FXRA 4S39A 3LZ3A 3LYEA 3M5YA 1FDYA 4TX6A 1W9PA 2OKTA 5LYRA 3XISA 1KM5A 4XZ9A 4PFMA 3W7HA 2EXOA 3MSYA 4G7EA 2PUZA 4AZ6A 1DQWA 7TAAA 3T4WA 2OEMA 4J35A 4Z17A 3NJ3A 3RLUA 4ROQA 1J0IA 3GVGA 3CK5A 4A22A 4LXFA 3DHPA 3C0QA 1OFPA 3E02A 3G1YA 3W7DA 1H50A 2PLMA 1E72M 2VHLA 4C1LA 2QUVA 1S3TC 2DFAA 2WNWA 1XBZA 3CQKA 1K77A 4IFOA 5H91A 1EWDA 4D8LA 3AWOA 3H55A 1E6QM 3T2PA 1GG1A 4JFSA 2XDFA 2BG5A 3PM6A 5TD4A 1H7PA 5CSUA 2OX1A 1A4LA 4TUFA 2IQTA 2A3CA 3SM0A 2YDRA 1EIBA 1LOSA 4PUJA 1O60A 1QR7A 1V0KA 3MUIA 2YOCA 1VQTA 3FW6A 4PTWA 4PB5A 4R7JA 1ONWA 3FHQA 1SZRA 1PUDA 1ZBWA 4O1EA 4W5ZA 4ZFCA 1VEPA 2YR1A 4HA3A 4M24A 3EEZA 1MQPA 1RD5A 3WY1A 3DGBA 1JAEA 4S3AA 3GWQA 3VOIA 4I90A 1EF3A 2P8BA 3E49A 3GG8A 4UNIA 4GKLA 4LCSA 5KTLA 3NZPA 1UIOA 1H5VA 3B8UA 1W5OA 4EACA 2A3LA 3R10A 4ZGYA 4MKVA 3TA6A 1K3UA 3VYLA 4X2RA 1HJVA 2YCKX 1CGXA 5TAOA 5J04A 3QFEA 1E1CB 1BRLA 4I9AA 3GTFA 1DWGM 4H8VA 3BV7A 5HUPA 2C19A 4CNNA 1CGTA 4HHPA 1UP2A 3DHUA 3MC5A 5LHEA 3O6AA 4AVNA 4NNAA 4JQ3A 2Y7FA 3UZXA 4EPEC 4EWJA 5BMWA 2D2OA 3RGTA 3PFRA 5JBEA 2ZQ0A 4V15A 2GUUA 1W17A 4E4FA 5CCZA 3AXKA 4C6OA 2CBIA 3TZNA 1H60A 3W7LA 1AMYA 3TJIA 3SCUA 3WFZA 3WUGA 3F5JA 4YCOA 2Y63A 1P7TB 4PTDA 2VCCA 1DQXA 3W71A 4ILSA 4MWAB 3ZVHA 3WMSA 4BI5A 3R58A 1OZQA 2QDHA 2WMHA 4UTWC 1OFRA 4ZOCA 4ZB5A 2H9AB 3PZOA 1GW9A 4J3ZA 1QVBA 1GORA 2VYOA 4L1GA 3CYJA 4W84A 2IKIA 5HR6A 3LK6A 3F03K 4FX7A 4JHMA 1TV2A 2OWWA 1U22A 2OMAA 4UTUA 1XLKA 3HZ3A 5D30A 2JGQA 4TQTA 4U5KA 1AUSL 1WZLA 1H0GA 4MG4A 4HOZA 4GC3A 4HHLA 3FK4A 2D0HA 1Y5WA 3GU2A 4LT9A 1POJA 1ITXA 1W2PA 5I02A 1CT5A 3OYXA 3CL6A 3HA1A 2PGEA 4GJJA 5CAKA 3PTKA 1Z41A 3P6LA 1QJWA 3WLSA 1X98A 3PJXA 2WJDA 3S6OA 4IQDA 3W75A 2WSYA 3TN3A 3DC8A 1XKJA 2A3EA 5FI8A 4UQEA 4Y6GA 2GDVA 5M1TA 4P8XA 1NWRA 2VL4A 3K5XA 1EHNA 4P2VA 2GGJA 1L6SA 3V0TA 5IHSA 1XFCA 1AJ0A 3QSTA 1F6KA 3P84A 2FPTA 1H63A 1AFSA 3UPWA 4Z2JA 3ZOAA 1IR2A 1DJXA 3VGFA 2DH3A 1CLVA 4B5VA 1BGGA 1LG1A 4GBUA 3ABRA 4CU8A 4EPBC 1I6NA 1QPOA 1WDQA 2Y8VA 1UP3A 2A2IA 3PULA 2BDQA 2HVMA 3P61A 1D7KA 1RBLA 1J6PA 3W1AA 1TSIA 4LYRA 1GKRA 5I79A 1S2TA 1LRNA 4GQ0A 2WZEA 2BXVA 2Y88A 3M41A 3W7OA 1Q7MA 1WZAA 3GIPA 5GNYA 4NU7A 3W6LA 4A6GA 2FH8A 1CXIA 3RO6A 2J7HA 5K9DA 2ZRXA 1PZ2A 1M9HA 5A6LA 2XZ7A 3BARA 3GG7A 2VDIA 3ZSSA 1M53A 4BWLA 5AHIA 1TPB1 4LVDA 2V3EA 4DB7A 5AOUA 1ZAIA 2F61A 3FSTA 3N18A 3TA9A 2Y0FA 4JYFA 4LAMA 1ESWA 3VNKA 3EMZA 2VURA 2Y8UA 4JIPA 3PPGA 1P0BA 2CHNA 2CHOA 4L9YA 4HCLA 1J93A 5CBIA 2AGKA 1Q2SA 4UQBA 4H4IA 1EDTA 2XVNA 3LHVA 2WSQA 1QWKA 3QHNA 4ERGA 2CPUA 4AU0A 3PY2A 1PDYA 3LBMA 3TN4A 1XLDA 2QNEA 2JF6A 5I09A 4HA4A 1OK6A 2E6FA 5AC8A 1TWIA 1FH9A 4JY8A 2OO6A 3WLRA 2BHZA 4DYEA 1UA3A 4MNLA 3HM7A 3MU7A 5FF4A 3KVJA 5EB8A 1FWEC 2F6KA 2QVHA 4UTFA 5ABFA 4R33A 4GC4A 3R0DA 1DXEA 3AZSA 4TX8A 1VD6A 1VFFA 2XIJA 1R30A 2QV5A 2PSNA 2OCZA 4Y7EA 2WSPA 2ZX5A 1ENUA 3BWWA 4QLLA 4LEQA 2Y62A 3W2UA 1MUMA 4V28A 3O6CA 3JRKA 5RUBA 4D71A 4CNOA 2QDEA 3N6QA 4HYRA 1SO4A 5BXSA 5G1YA 1SYTA 3A3HA 3HJEA 3CZEA 1TWDA 4DF2A 4H8NA 1QNQA 3ZJKA 1NP2A 4E4UA 1OFDA 3F5LA 4WVXA 3SGZA 5CBBA 3POHA 1DWFM 3BZGA 3DFTA 2WZMA 3NFUA 1A47A 4JBRA 5GVJA 1DE6A 1QHZA 3MQTA 2O56A 3BH4A 3VPLA 3DXIA 3CO4A 1VAHA 3V0UA 2DVTA 2XHYA 4ZMGA 2AKMA 4DWSB 2WC7A 3M5XA 5AHNA 3RM4A 2ZRZA 3C2FA 3O63A 1XDLA 1LJYA 2X2GA 3HJZA 2I56A 2CFFA 1O7AA 1Y0EA 3T0TA 2P76A 3LMZA 4A2SA 2GOUA 5AHMA 4H00A 3IAPA 1PKNA 2VENA 2FMOA 3P5ZA 3O1NA 4ZVJA 1GPWA 1LF1A 4QISA 4P7NA 5DEZA 2XH0A 3A3WA 3AXXA 3WJSA 2YDQA 2AMXA 1QI3A 1F7BA 3ZLHA 4BS0A 1WZKA 4B16A 1GONA 1W2VA 3I6TA 3VU2A 2GQ9A 2VC7A 3BURA 4IMEA 2C0HA 3BW2A 3PZTA 1PVNA 2NX9A 3UWVA 3B4UA 3AXHA 1DOSA 2OJPA 4XZMX 3WL0A 3M0LA 4GI9A 4NXKA 2J8FA 2GSEA 4ZXLA 5FESA 2V5DA 4JCLA 4DZIA 5LIWX 2VX6A 3K8KA 1UKQA 3D5HA 3B04A 4J28A 1MMFA 2J78A 3STEA 2I5QA 2Z6IA 3O07A 3GC4A 4QM1A 1XS2A 2ZE0A 4O57A 4ZBCA 2ZRWA 1JCLA 2PZNA 4AMCA 3ARSA 1HO4A 3TTQA 3RRXA 1HKKA 5FL1A 4PCTA 3S5SA 3OGRA 1FFRA 3I10A 3WF4A 3DYMA 2HQAA 3K4WA 4F0MA 4Y9MA 3ALFA 2HK0A 4DWDA 2XZ9A 2VWSA 1CB2A 4LCQA 3LV5A 3VIIA 3ZWSA 2PMQA 1V6WA 3A3XA 5K3VA 3VMPA 3UD6A 3VKCA 1W5NA 3OP2A 1J10A 2VCAA 3SQSA 5EMUA 4S1FA 3IVTA 3QTGA 1P6BA 1RR2A 5HJYA 5D38A 3WD4A 3WMBA 4GH3A 1ME7A 1ZBKA 3A24A 4ZTYA 2G5WA 1F07A 3N1AA 2PRMA 2W27A 1F4AA 5I00A 5CG7A 2D1ZA 5FJOA 4DXXA 3PB0A 1XIFA 1BXNA 4Y90A 4EAMA 4XD4A 4JTHA 1DWIM 1I9CB 2DPEA 2I14A 2W62A 2YLAA 1LP6A 3QV6A 4MUZA 4E2BA 2OWXA 2WSRA 5BU6A 1IXNA 1ZNNA 1NDWA 3H2EA 5T9BG 3TJ4A 8A3HA 3VMNA 1OFEA 3KDOA 1XBXA 4RZBA 4NZ5A 1SR0A 4AWEA 1EX5A 5ABHA 1JDDA 4H9MA 4FOJA 7REQB 1YIXA 2VX7A 3TQVA 7ENLA 5FJIA 2RHGA 3GDRA 4IMFA 4MPQA 3ANVA 3BXWA 1MFVA 2A3HA 4UOJA 1S5TA 1BVWA 3B8DA 2Z0IA 1A5LC 2NZLA 5F2GA 5FEPA 2HCVA 2E8YA 4AYSA 1THFD 1RY8A 1RCXB 2NVDA 4DI8A 2KAUC 4DO6A 3EX4A 1F3TA 2P3ZA 4KRTA 3KCJA 2W63A 1UR3M 1RJRA 4ZB2A 3TX9A 5E09A 4YLWA 3MI6A 3F1QA 1X1ZA 4HGXA 2CXGA 5BROA 2BY0A 1BYDA 4F0SA 3GXMA 1TVPA 2R82A 2FZMA 4U33A 1XLAA 3LCHA 5HJXA 4C6NA 2XFYA 3R0KA 1M68A 4YYCA 2PDCA 1EX1A 2YCLA 1H7XA 3L4WA 1Y65A 4W8LA 1O6IA 3WK2A 3MWAA 1AW5A 3QOKA 3ABZA 4IPIA 1K7XA 3NQ6A 1ZJAA 1Q2RA 4JTTA 1PX3A 3BAYA 3BTNA 4IGSA 3O06A 2ZXBA 2O0TA 1XUUA 3IARA 1T0OA 3THUA 4ATWA 4XKYA 1MDRA 2NX1A 4JTLA 1LQ0A 3U2EA 4AX7A 5EMMA 3HMJG 2Z26A 3BZJA 1TZZA 3NEHA 2V6AA 2WVVB 1UWUA 4KFNA 1GTEA 4Z2IA 3HN3A 4Z1AA 1J0KA 4YTRA 2PDUA 1Z9AA 1KXVA 5JXQA 4XBJA 3LLFA 4W87A 4WHBA 3U4FA 3GH7A 4QX4A 4EVZA 2CERA 2D20A 2DZPA 4O4WA 3EZ4A 3IVSA 2CBUA 3RJXA 1PCKA 5CJ5A 4DM1A 1FDZA 5H8UA 2WZIA 3LMYA 3MUCA 4ZQMA 3ME3A 4US5A 1T7LA 3CASA 4RDZA 5HPCA 4ZXOA 3VOFA 2OZ0A 1NELA 4XSLA 1TUXA 1PIFA 3G1AA 1RVGA 1YTDA 2I57A 1JZ4A 4V1YA 3PS7A 2XIOA 1B5TA 5E6ZA 4E8GA 4HN8A 3MCOA 2PLKA 1RHCA 3G77A 2OLAA 4O28A 4D8ZA 3TWBA 4C6IA 5D9PA 1S5WA 3ZT5A 1OK4A 3T78A 4D6GA 1Q6RA 3P60A 4JEQA 1JNDA 2ISFA 4K3ZA 4C6EA 4JZ5A 4N4QA 1H1YA 2QUUA 5C71A 5HBFA 5CJNA 3NQ7A 1JFHA 3QV9A 4LVGA 4FB7A 5JBFA 2OQHA 1SO3A 2E6DA 3TSMA 4M51A 4RXFA 3SR7A 4KFOA 2DZSA 1J18A 1X6LA 2Y24A 3WQ4A 2WLYA 4JHOA 3VD7A 4L4OA 2DH2A 1MEIA 4DF1A 4BI7A 4FLSA 3VGBA 4HPGA 2IXVA 5HA7A 3CHFA 4U10A 1W6TA 3SRFA 4FI4A 3W07A 3U5UA 3DHDA 4H04A 1ONRA 1J79A 4IL0A 4Z2LA 4U3CA 4M6UA 3C4UA 3CU2A 4P5UA 4ENLA 4JTKA 3F4VA 2ZC1A 4WY0A 1YPIA 2PE4A 2PWFA 4IICA 4AQLA 3W2LA 3PR2A 1MXDA 3S5ZA 5A6TC 2WYSA 3H2FA 3B8SA 1B4EA 5DT7A 3ELFA 4I7UA 1RP8A 2FMNA 1OF6A 1K03A 1A0EA 1TWWA 4OFCA 3M5ZA 4HSOA 3B0VC 4E38A 2ZADA 3EPMA 4DZ5A 3QZAA 1UBSA 4PMXA 3NQAA 3S3GA 3KXQA 4JR5A 3NZ1A 2OB3A 1ISWA 4DJED 5JH1A 3U9IA 4KIEA 1XICA 3T0BA 2WWDA 3GD6A 2CZVA 4A3QA 2ACRA 1NFPA 1OFBA 1QRQA 3FDGA 4AZIA 1MRAA 2HEJA 3QVQA 1O5KA 4DYJA 1GQIA 3DEQA 2HSAA 4GK8A 4JN8A 3L21A 2DSKA 3DG3A 1KGUA 1TCDA 3EOUA 3RR4A 3FCPA 4J3WA 1F61A 5BXTA 2PDQA 3O2LA 3QC0A 1UZ1A 3NVDA 3PFMA 3PJWA 1VFLA 4KPLA 1YBQA 4I8DA 3URAA 5HQMA 1ZB5A 1NEYA 1SZNA 5GQBA 1NF7A 2QUTA 3OA3A 1ECEA 5D32A 2RGLA 4GXPA 5TBOA 2FKPA 4R88A 2OO0A 3WEZA 3TYUA 3MZNA 4DNHA 3LGEA 4KGLA 3VK5A 1UD5A 3OJGA 3T44A 1LROA 4HCDA 4EXBA 2E09A 2IS7A 5HWNA 2REQB 5CC6A 2XH4A 2VGFA 5FAJA 3I6EA 5C7HA 3EWYA 2WHKA 3VOCA 2EEXA 3ZQ9A 2Z2AA 4US5D 1ODUA 2WC3A 4E5TA 1FY6A 1TJRA 2WXDM 3CS2A 4E8DA 3W72A 1BLIA 2FVLA 1CZ1A 3BJSA 4LS2A 5KZ6A 1OC5A 1S1RA 1P1MA 4QITA 5FAGA 2GSHA 3NVTA 4IOTA 5TIMA 2PGFA 4NI3A 1LYXA 1WDPA 1OF8A 3RCYA 5JH2A 4Z2KA 3VNMA 4HZ6A 3VNZA 5IBXC 4NZFA 4PULA 2PCQA 4I3GA 1UWRA 3MVIA 3SCNA 3W7PA 1HKMA 2E5CA 2RH9A 3ARYA 4QP0A 5I78A 1QI5A 5EMJA 2AOSA 4O10A 2V38A 3WLLA 2JE8A 4GISA 2FIQA 4CN1A 4JOMA 5HOSA 4F0LA 1OZMA 1QNSA 1JJKA 4EXAA 4RE2A 3PBYA 3NSMA 1CNVA 2ZUVA 4M82A 3G3MA 3B40A 1EGVA 1LM1A 4WDXA 2OVLA 3TC3A 3VC5A 5M03A 2J6XA 4HK7A 4PUEA 1PO9A 3PZIA 4ADSA 3KTXA 1XG3A 3BLIA 1XCXA 3KOZA 2E8ZA 1UKOA 2WJEA 4HA0A 3BOLA 4GVGA 4JTFA 4R7WA 4JYDA 5CPTA 2PURA 3S2JA 2ACUA 3PUGA 3GNXA 1QOPA 2CLLA 3NL3A 1HTIA 3UCCA 1KBBA 4C90A 3BSMA 5CPSA 2QPSA 3PPHA 2WV8A 2HE5A 2DSVA 4JTCA 1PHQA 3QXBA 3VNYA 4Y9PA 4D6HA 3V36A 1FQ0A 1PS9A 3TW9A 3UA4A 4C65A 4UZUA 2OSWA 2VR4A 3S0CA 4DVOA 2AMGA 5I3FA 2FZ9A 3CMFA 3WF2A 3VFCA 3ERPA 3WF3A 2Z28A 4B5SA 2BNJA 1YEYA 4PBEA 3L4YA 3KS6A 1UPPA 1VBRA 3EX3A 4IMGA 4XO7A 1YMYA 5JQ9A 4IJCA 2X2YA 4HU8A 3T81A 2ZXQA 4MB4A 4F0KA 2J7BA 4ZO9A 5DN1A 4PR4A 4K36A 4JQ4A 1YXCA 1MO0A 2HISA 2PDPA 3W1RA 3TU9A 2XGBA 4Z1DA 2FB2A 5B7ZA 6A3HA 3THQA 3UR8A 1W8GA 1HP5A 2NXIA 4GVFA 2ZOXA 3QYQA 4X9YA 2CXEA 1E0UA 4QROA 3TMLA 3BG3A 4A35A 2E9BA 2TMDA 4AY7A 3QGVA 2P1FA 5J8LA 4GYJA 2GVYA 4MJZA 2C71A 3GTHA 4Q6XA 3QMSA 1BYBA 3BDKA 1N8WA 3CZLA 3K1DA 4K38A 3PAJA 1V7AA 1PL9A 1TJ2A 1C8QA 1GZGA 2WWCA 1H7OA 1JZ3A 2FZBA 2ZZ3A 4ATLA 4FR1A 4ORIA 3LPPA 3BLPX 1GQJA 5M3WA 3N11A 3VCRA 3UR7A 1HN1A 1CEOA 4DUVA 4C6QA 3M07A 8TIMA 3VIOA 3TP4A 3LNMA 3AALA 4YPJA 1M04A 3L4XA 5EGRA 4G7EB 4PUNA 3EKGA 4JIQA 4PUMA 3S2MA 1EBHA 3G24A 5AN7A 2TSYA 1YHTA 4J9JA 4AW7A 1C8XA 1QHOA 3IV3A 3WD3A 4UMAA 1XLBA 4H6KA 3G2GA 4LUIA 3UXIA 2V0TA 3OIHA 3R5EA 3MHGA 3IJ6A 1NF0A 3ARUA 4XAFA 1W1A1 2QCCA 4B5NA 1KM1A 4CQCA 3FJ4A 1L6YA 2VZOA 1OQFA 1YADA 4H9YA 1W5QA 2V5LA 2GGEA 3OVQA 4UZSA 2GVJA 3WQ5A 3S1GA 1K4GA 1PTAA 4P8UA 3MCNA 1W8SA 3OHMB 1HX0A 3GYEA 4WSHA 1GHRA 1H7WA 3WQPA 1XINA 5AC4A 1AG1O 4JCMA 4JL2A 3BJTA 1XC6A 5I7GA 1ZP3A 1A3HA 1IEWA 3EA1A 3R94A 4DX3A 2GJNA 4N6FA 1US3A 1CBGA 3AMLA 2GLKA 4UNLA 4DBUA 1OSEA 3KVMA 1VB9A 1ZL1A 3WQ6A 3V18A 2CLFA 1V79A 2GVLA 4O18A 5F7UA 3HV9A 2W67A 3APTA 3QKEA 1KLYA 3RX2A 2V69A 4K1GA 1O5QA 3KRUA 1A50A 4DBEA 1XW8A 4AIUA 9RUBA 1RK6A 1TPEA 3I3DA 1SFSA 4B15A 4JN6A 1M6JA 2DT1A 3HPAA 2X0SA 1Q13A 4AZCA 1VHNA 1X39A 1XP3A 1KM0A 4OUIA 3WNLA 4QS6A 3U4AA 1H4PA 4C6KA 4GIAA 3E74A 3SUVA 4LYKA 1LOLA 3HG2A 3H8AA 1IXPA 3VKDA 4HNUA 1CENA 3G8EA 3NUKA 2GJRA 5A8OA 1EPVA 1F76A 1RJQA 3G3DA 4MTVA 4QBXA 2PFHA 2XN1A 4DPPA 1IZCA 2PODA 4A3YA 3VKBA 4DNMA 3ZVHB 5JVLA 5D2VA 4LBRA 3W82A 4ACZA 3WO8A 4U2ZA 3GW3A 4NI8A 5D9NA 4AEFA 5EMLA 3ANYA 1UA7A 2QF7A 3CH0A 3LHWA 1EJWC 1OG6A 3S47A 3WDJA 2XM1A 4QTGA 3NQ8A 4JDYA 1CGUA 3UGVA 3PBGA 2D73A 3P2VA 4XZBA 1PBGA 2XH7A 1JGIA 5MKGA 4PTNA 1V3JA 4W8BA 3SGUA 1S2WA 3FS2A 3FNDA 4Q4SA 4CEXC 1BSIA 1I60A 3COTA 3MBDA 3PBMA 3MKCA 4N0RA 1CLXA 3GNRA 3TWAA 2QV4A 1W3TA 4F4RA 1FWRA 1V6XA 2BXZA 3BGGA 4LX4A 4DF0A 5K4XA 2OG9A 1YDYA 5F4SA 3AJXA 2XGIA 3TNBA 2Q71A 4UFHA 1RVKA 2G0WA 3GNOA 1N7KA 4MNKA 2PWHA 1O66A 3UNTA 1TR9A 2CW6A 3VMOA 3W01A 4R5EA 3EOEA 4PB3A 3KTCA 4M29A 1I0BA 2VQTA 1DJGA 1XRVA 3PSVA 5C8BB 1VR6A 1Y5XA 3AICA 3SCOA 3AJ7A 1Q6QA 1SJCA 2J25A 3KL0A 3AU2A 1OGBA 3KL5A 3DENA 4HU4A 1R2RA 4J40A 4MYAA 6TAAA 3MWCA 5F2IA 1FA2A 2XTKA 3UJEA 4OU1A 1BF2A 1VJIA 1YDNA 4RW3A 1FFQA 1E5JA 3M7WA 4R27A 3LOTA 2NQJA 3LPOA 2PEVA 1PX4A 2ACQA 1E6XM 2VXNA 2HS8A 1RH9A 1CI1A 1XIJA 1R9YA 3SIZA 2QMJA 3ATZA 4PE8A 4DBDA 1S2UA 5T8GA 1WOBA 1WOAA 3QQ1A 4P7LA 1TV5A 3L65A 1XBYA 3CUJA 1I2OA 5BOFA 1EIXA 1OCQA 1HL8A 5HJLA 3WDPP 2P5NA 2ICSA 2I16A 1A49A 1QAPA 4PSRA 4CD5A 2XFRA 4QAWA 4IQLA 2P0OA 3TAOA 1U5HA 3LU2A 2NX3A 2V68A 3S1XA 1DIOA 1MUWA 3GO2A 5D05A 2C15A 2EKCA 2QUNA 3B9DA 1JDAA 2X8RA 3P0WA 2J9XA 1V93A 4CNPA 1V4YA 3BJFA 4GD0A 4J2PA 4Z2GA 1XPYA 3SRHA 3W6MA 4HOWA 5DMMA 3OLDA 1OWQA 3FV9A 3EWWA 2OOGA 1ME8A 5BWAA 3P8JA 3F4DA 3EDFA 3JU2A 3OG2A 2FHFA 4Z1YA 2HVOA 5HMFA 3UP8A 5IBXA 1ECQA 2B4GA 1UD3A 1I75A 1EUAA 3GVRA 2VEGA 1G7UA 1M41A 2J9ZA 2NVAA 2VUNA 3OVPA 2FGZA 2R1KA 3I65A 5I77A 5A6JA 3W7RA 2G3JA 2XM2A 3H4GA 3VZZA 3N9KA 4NG3A 2JF7A 4RE0A 2HMCA 2QCGA 2W66A 4F66A 5HULA 2PLJA 3FIGA 3W7MA 3L66A 3LLDA 4UTLA 3E5BA 2J6VA 5I3HA 4FF5A 3GDMA 1E6RA 2Z7GA 2HBVA 4AWSA 3DKJA 1EB3A 4ERAA 1QO5A 1JRCA 1XH2A 3WQWA 3TW6A 4D8AA 4JDBA 4IF2A 4B5XA 3TC7A 1ICQA 2JGYA 5CPMA 1G4TA 2QZRA 2EPNA 4OOZA 3TYBA 3LHYA 5CC7A 1JULA 1JVNA 1LWIA 1G01A 2V5KA 4FA3A 3RU6A 4B5TA 1XYBA 4RZ4A 1K9TA 1VPQA 2CU0A 1XISA 4QE4A 4RE3A 2HNEA 3C2VA 3T1GA 3UZZA 3A4WA 3QKZA 4DO4A 4GJ1A 3B8WA 3TKFA 3VNIA 3LRKA 3YPIA 3MJYA 4JPGA 4IJRA 3SGGA 4IFKA 4F9JA 5HUOA 4GQGA 3WD2A 2CZFA 1KM6A 1M7PA 3R11A 3AIQA 3VD4A 3UQNA 1F8IA 4CGTA 3HPSA 3LX9A 2J62A 1HKVA 2JEPA 3DKLA 3TSBA 4HK5A 5ABEA 1MZHA 1IQ8A 4FR6A 1UYQA 1BVZA 4HNNA 4L65A 3VX1A 2PC8A 4MFDA 1P1XA 1S38A 4UNKA 1LG2A 3WLHA 1U30A 4AUBA 3W00A 4CCZA 5EYWA 4DUOA 2WMKA 4RR4A 1VS1A 2VP8A 3TR2A 1WXYA 2WCSA 4ZQRA 1MEWA 4INFA 4NY2A 3C6CA 4RK8A 3OW1A 4P8VA 1F4HA 2JEQA 2YXGA 4MMWA 2DJXA 3P62A 4MB3A 4A8NA 3DAQA 2ISVA 3MB9A 1KXHA 2TODA 3ZT7A 3W84A 1TE1A 2JKPA 1NU5A 1O5XA 1GW1A 3NOEA 1CGWA 4O1CA 3VIGA 4KWVA 2DDXA 2X41A 3CB3A 3MMDA 3SCSA 3WBAA 4X22A 2J77A 3KLLA 3CV2A 4K39A 1X38A 3F4NA 4KEMA 5JUVA 3E2RA 3M0MA 1OADA 4URIA 5CLTA 4NRSA 4PFHA 2H90A 1X96A 2YIHA 3VDCA 4O52A 2YB4A 1JDFA 2QR6A 1JZ8A 3TTOA 4Q8PA 1RBOB 1R9XA 4GIRA 5A6AA 2J74A 1NDVA 2ABAA 1H3GA 2CIPA 4LS1A 4LC8A 4WGXA 1GJUA 4QNWA 4MZ8A 3SW6A 3AZTA 2BP1A 1QU4A 3VI2A 2P53A 1MXSA 4LRTA 1XIIA 3W2MA 3Q94A 3VXGA 1R5YA 4RUBA 2VD8A 4UTTC 7PTDA 1ICPA 2IQ0A 2F6UA 3E96A 4LF1A 3URQA 1ELSA 3EKLA 5EFDA 2YX0A 4GYPC 2ZRYA 3M5VA 4IL2A 2J9YA 1DWHM 1R9ZA 3VIPA 1Z8AA 3CUZA 2R14A 4ZE4A 3WLKX 1GVRA 4S38A 4ZQOA 2OQLA 4F48A 1DV7A 3S9YA 5IXEA 4ZO8A 3U0HA 2GL5A 4OVXA 4LVAA 1BTMA 4E3VA 2W79A 2FZ8A 3PUEA 1E6NA 5K9CA 4NILA 5BNKA 2V3GA 3GDKA 4FLQA 3I3EA 3FA3A 4PUUA 5D2WA 2BVDA 3PWIA 4RPQA 2G41A 4BQ5A 4YIWA 3P74A 3EEGA 4H9UA 3GIQA 2Y89A 3THCA 1DL3A 3MBFA 2WSKA 1PXGA 1LRTA 3UVAA 2ALRA 5IRPA 2DP3A 3ES7A 4R9OA 1P6WA 6TIMA 1BVNP 3W26A 3IUIA 2EKGA 1TTJA 3AIBA 1UUQA 3NXFA 3EWDA 2J88A 3SEPA 2PWEA 2ZIDA 1U1JA 3HOJA 1B1YA 1OYBA 5KINA 1AH0A 3VD3A 4WDWA 5E9XA 2ASHA 5D9MA 4YN5A 3T08A 1JF6A 1R0MA 4C91A 4NP7A 1MW1A 2YYUA 2DIKA 3DG6A 2YCLB 4JKMA 1C7TA 4BA0A 3PTDA 1GVQA 1TJPA 2ZWYA 3WMCA 1WUFA 3W4RA 3S5YA 4J2MA 1ODZA 2WBGA 5FJRA 4J3XA 2PDFA 3M44A 5C55A 1Q6FA 3EB3A 1KCXA 3E1F1 1RV8A 4XKYB 1MVYA 1R6WA 3CV1A 4U31A 2YLLA 4S3DA 1U2YA 1QATA 2FTPA 1VF8A 1C9WA 4JNYA 1KGXA 3AQUA 4ZO7A 3PZGA 2XU2A 4D9PA 3I4KA 5KITA 4L1XA 4JX5A 4ZTXA 3BLEA 2J79A 3EWUA 2NLYA 1CB7B 4ZSUA 4AXNA 4QSFA 1B3XA 3DBNA 1KNWA 4QXIA 1JPDX 3LNPA 4AC1X 2YCEA 1EC7A 4Q8WA 1ZSXA 4W5UA 2CETA 3WQOA 4Z0JA 3ECQA 4YL2A</