4WRHA

Akr1c3 complexed with breakdown product of n-(tert-butyl)-2-(2-chloro-4-(((3-mercapto-5-methyl-4h-1,2,4-triazol-4-yl)amino)methyl)-6-methoxyphenoxy)acetamide
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
316
structure length
316
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Breakdown product of N-(tert-butyl)-2-(2-chloro-4-(((3-mercapto-5-methyl-4H-1,2,4-triazol-4-yl)amino)methyl)-6-methoxyphenoxy)acetamide trapped in active site of AKR1C3
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 116
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4wrhA00
3UWEA 1J96A 3LBOA 4JQ2A 3R8GA 4DBSA 4FALA 1PZ1A 1HW6A 4ASTA 1AZ1A 3H4GA 4YVVA 3RX3A 3BUVA 4IJCA 2R24A 1EL3A 1Z89A 1EKOA 2FZDA 4PUWA 1MRQA 1AH3A 3O0KA 1PWLA 4OTKA 2AGTA 2PDUA 2HDJA 3DN5A 3COTA 2PDCA 3CASA 4GACA 3F7JA 2DV0A 4XZMX 3UP8A 2PDLA 3Q67A 3UG8A 3LQGA 4JTRA 3H7RA 1PWMA 3LQLA 4JQAA 2C91A 1AH4A 2PDMA 4FZIA 3UFYA 3QKZA 4IJRA 4YVPA 2I17A 3T42A 3G5EA 4PRTA 1RALA 2HVNA 5HNTA 1R38A 4XO6A 1YNQA 2BGQA 2IPJA 2IQ0A 3EAUA 2ACQA 4GQ0A 1X96A 1X98A 2PDXA 2VDGA 4WDUA 3BURA 2INZA 4JIRA 5AZ1A 4JQ1A 1Q13A 4EXBA 2PD9A 4F40A 2P5NA 1JEZA 4Q3MA 3LNMA 5LIUX 4WDXA 3RX2A 2F38A 2CLPA 2PDKA 2IPGA 2INEA 4LB3A 5LIYX 3MB9A 4PMJA 3C3UA 2HE5A 3GHTA 2F2KA 3NTYA 1Q5MA 2ACUA 4WDWA 4YS1A 3ONBA 2PDQA 1MI3A 1EF3A 3FX4A 1AFSA 4DZ5A 4I5XA 2J8TA 4AUBA 4DBWA 3UZYA 4WRHA 3UGRA 2IQDA 3GUGA 5LIWX 4ICCX 1ZGDA 2HEJA 2IKIA 2NVCA 1T41A 3DOPA 3BV7A 4DBUA 5JH2A 4H7CA 1VP5A 4YU1A 4LBRA 4JIHA 2FVLA 3KRBA 1YNPA 3LUTA 2QXWA 1FRBA 3R94A 3U2CA 3G1RA 1S1RA 3B3DA 4L1WA 2WZTA 1PZ0A 1A80A 2PDPA 2PFHA 2PF8A 3WBYA 3WBWA 5AZ0A 3N2TA 3LEPA 1M9HA 3UZZA 5JH1A 3N6QA 4RPQA 4JQ4A 4JTCA 4LB4A 4XVDA 3H7UA 4GABA 1XGDA 4XO7A 1HQTA 1IHIA 2BGSA 3VXGA 5LIXX 2PDHA 3V36A 1AZ2A 4HBKA 2PEVA 4R9OA 4XAPA 3CMFA 4Q7BA 4XZNX 4PUUA 3Q65A 5KETA 4JQ3A 1T40A 5DANA 1S2AA 4IGSA 1Z3NA 3M4HA 1ZSXA 5C7HA 4FA3A 1IEIA 1S1PA 3GHSA 3ERPA 3WG6A 1RY8A 1Z9AA 2FGBA 2FZBA 3GHRA 3FJNA 3V35A 1S2CA 4WEVX 2ALRA 3LD5A 4GCAA 2PDBA 3CV7A 1UR3M 3R43A 3D3FA 3EB3A 3M64A 4GA8A 1X97A 2DUXA 2I16A 4QR6A 2PDIA 5LIKX 3EB4A 4WDTA 4QX4A 4HMNA 4GIEA 1LWIA 3LZ3A 2ACSA 3P2VA 3R58A 2IS7A 1Z8AA 2R9RA 4QBXA 4QXIA 4LBSA 4XZHA 4XZIA 4GQGA 1US0A 3S3GA 3WBXA 2ACRA 2WZMA 1QWKA 2IKHA 3BCJA 3CV6A 1VBJA 3UYIA 2FZ8A 1OG6A 5HA7A 3V0UA 1C9WA 4JIIX 3M0IA 4ZFCA 4FAMA 4JTDA 1XJBA 2DUZA 3UZXA 3GHUA 4XK2A 2FZ9A 2IPWA 1EXBA 3CAVA 1ZQ5A 2A79A 4EXAA 5M2FX 4PRRA 3R7MA 4MHBA 1YE4A 3R6IA 5HNUA 2NVDA 2HV5A 1SM9A 2PDFA 3O3RA 2IKJA 1AH0A 4JTAA 1MZRA 3LN3A 4YVXA 4NKCA 3LZ5A 3ONCA 4XVEA 2PDWA 2IKGA 3MC5A 1RY0A 3WCZA 4LAZA 2BP1A 4G5DA 1ZUAX 4LAUA 2IPFA 3V0TA 1ADSA 3LENA 1LQAA 1XF0A 2PDYA 1QRQA 2ISFA 3R8HA 3UZWA 4JTQA 4PR4A 1GVEA 2PDGA 1YE6A 4XZLX 1K8CA 2PDJA 2PDNA 3V0SA 4H8NA 4WGHA 2HE8A 2HVOA 3RX4A 2PD5A 2PZNA 1PYFA 3CAQA 4L1XA
chains in the Genus database with same CATH superfamily
4P2VA 1QK0A 2CZFA 1T0OA 4IIHA 3VX0A 4R34A 3E12A 1FWDC 3I4EA 1CGXA 4PTMA 1UWAA 2NQ9A 4FXFA 4AY1A 3NXFA 3VNKA 2V8ZA 2XH7A 4CU8A 4E3VA 1HT6A 1E1EA 3EWXA 3GDBA 1EKOA 2WPGA 4ZBCA 1JYXA 2FZDA 2NQHA 3U57A 1IXQA 3QR0A 3NR0A 3BOLA 4TMBA 1V6WA 2Z4GA 3E1F1 2CZEA 5I23A 1GQKA 4LUSB 3F7JA 4E2OA 1O1HA 2J9YA 2A3CA 1IEQA 3CHCA 4Q8VA 6XIMA 4NXKA 3C2EA 1MUMA 2JGQA 1H63A 1KM4A 3SGZA 1UKPA 4DM1A 3A47A 4WY0A 3IIPA 3LU2A 4GYKA 1TIWA 3KBVA 3LRLA 1AQMA 3G5EA 1FCQA 3NZQA 2OSYA 3GB6A 1J10A 1QPOA 1B3ZA 2CLKA 4OV9A 3GDLA 3I4KA 3A4JA 3TAOA 5HPCA 3KRUA 3LYEA 4GXMA 3LHZA 4PMRA 2YA2A 4GUFA 2VEIA 2PD9A 3I7QA 1XC4A 4N02A 5K7JA 1TTJA 3G0UA 4QAWA 5CPTA 3H23A 3AHZA 4YNGA 4PC8A 1L0PA 4WY0F 2PTDA 3RX2A 1VRXA 4FX7A 4JBRA 4PMZA 1JG9A 1J5SA 2QCDA 3VIKA 7REQB 1RVGA 1YXYA 2GDUA 4R85A 2IPGA 3THDA 1NFPA 3L23A 1UASA 2RDUA 1E3XA 5DY2A 3I10A 1W1YA 1NARA 4JIEA 1IXNA 3QZ6A 2WK2A 2CERA 2B31A 2FDSA 2WHMA 1QW7A 5FJJA 4DZAA 4R33A 3GW0A 1H1NA 1TA3B 4IIFA 1QNPA 3P5YA 3VKDA 4ICCX 3PZMA 1LLZA 4PN2A 2C79A 1PSCA 2D3NA 2XSAA 3UXDA 3AQUA 3IAQA 3N73A 3MKVA 4FLOA 3M0HA 1F74A 2FVLA 1YNPA 7TAAA 1UQZA 4ZB5A 1UR1A 5CPOA 4XKYB 4D6GA 4UR7A 4H6KA 3MU7A 5ECVA 4MIMA 3W87A 2EKCA 1PIIA 2VFIA 5JIPA 1POKA 3WFLA 4FX6M 4Z0SA 3CTLA 3WF2A 1EBGA 5FEXA 3LHTA 2VL4A 5KEZA 1GOKA 4LCRA 5H8PA 2DW6A 2JEQA 3HTWA 2Y7DA 3LXBA 2G95A 1CEOA 3VD4A 5FF3A 1J79A 4GUJA 1YDVA 3S2JA 4XAPA 5E1QA 5A6BD 7A3HA 1V79A 4TVCA 3N11A 1VF8A 1WZLA 2A2IA 3GM8A 4LANA 5DANA 3S2NA 2Z2AA 4DO5A 1PHQA 4B4HA 1LOSA 4S23A 3RLHA 4V28A 2J7FA 1C91A 1S1PA 2PURA 3LSBA 3HG5A 3AWNA 4UTLA 9CGTA 2DZPA 2FZBA 1NDZA 4BQ4A 1W54A 1P7TA 2PDBA 1UR3M 3D3FA 3EB3A 3M64A 4A05A 2EBNA 4U5IA 3LRMA 5IOBA 4HYRA 1BGGA 3RK8A 3URQA 2Z1BA 5AHMA 2GGEA 2ZZ6A 1FWGC 1XIFA 4UZSA 1OCQA 3BAYA 1CGTA 5XINA 4NI8A 1JCMP 3C4UA 1HKKA 4TV5A 1JCTA 3D3AA 2AKMA 4H9MA 1TMHA 3NWRA 2XZ7A 4GC4A 3U5YA 1IT8A 1UA3A 2OELA 2HTMA 2E9LA 1DQWA 4KEMA 4O4WA 3KLLA 2NWRA 1KXQA 3UXLA 3KTCA 5FJUA 3RMEA 1I2RA 4IMEA 1WBJA 3K46A 5CSRA 4F2UA 3WH7A 2YLLA 1SZRA 1V93A 3UR8A 2V3FA 1QASA 3LK6A 3L66A 3I65A 4ZSUA 2V30A 4Q32A 3TDFA 5IHSA 4J35A 3EWWA 4L9YA 2J7GA 1E3ZA 1WKEA 4UQAA 4GGBA 5CH9A 1R7AA 1YTKA 5EY5A 2GFTA 4J7RA 5HQMA 1Y65A 2PP1A 2OZ0A 4L80A 1H50A 1X7FA 3EKZA 1F6KA 1J0ZA 3PTMA 4KMQA 2UV8G 3ZS4A 3M5ZA 2X2GA 3OTRA 4JTSA 3CLWA 1CTNA 5HWJA 3LZ5A 4KWSA 3F5LA 1QHPA 2V6AA 3C2VA 2IKGA 1EUNA 2WNZA 4C5YA 1D8WA 2E25A 2CBVA 3L68A 4NILA 2QKFA 3F2BA 4DI8A 3ZJ7A 2BP1A 3N6JA 1M7JA 2FTPA 1RVKA 2IPFA 4M6PA 3ITVA 4H6EA 1XINA 3SADA 1K8YA 2PDYA 3Q2DA 4YYCA 3LHYA 2YBUA 4O1CA 1XIDA 1TRIA 2OGJA 1XLCA 1EHAA 2QGHA 1G5AA 5C71A 1TX2A 4LEFA 2YCEA 3AUJA 4B9ZA 4PCNA 2V2HA 5A2AA 4W87A 4UIOA 3K13A 4EPBC 2CKSA 5HWNA 2X40A 3TKFA 4RE4A 4M81A 5CAHA 3WJYA 1OFAA 3WNMA 3BWWA 3OGSA 3EDJA 4YVVA 3IIXA 1BKSA 4NX0A 4F0RA 4UFHA 4GD0A 4OKDA 4LS2A 3IRDA 1DTNA 4H9ZA 3WK0A 3H2NA 3VE9A 1ZTVA 3A12A 4LY4A 2DV0A 4CQDA 5F2IA 3STGA 1A53A 1XKJA 4NVTA 5CGQA 2B7NA 2FZNA 1D2KA 3EMQA 4LC6A 2WVVB 2XFYA 3S5YA 4JYFA 3WQOA 1TIMA 5I3KA 3IV3A 3B9DA 4HD5A 3VOJA 2A1YA 2ZX9A 3S6TA 1L8PA 1LM1A 3OPSA 3GH4A 1YNQA 4S2BA 4NZ5A 5LA2A 2BASA 3MSGA 1CXKA 1IF2A 3GG7A 1KKRA 2QUNA 3IACA 5BMXA 2VD8A 1JZ6A 4UUIA 4UQDA 1QMLA 4MDOA 3PULA 1R3VA 4K1WA 4F40A 4IPLA 4CVWA 3NURA 3UXIA 1OQFA 5CSSA 3QY6A 3CMJA 3E0VA 2CHOA 4DYEA 3WYZA 1PL9A 4NRRA 3OOQA 3PUGA 2YPIA 2CIPA 1V6YA 3W2JA 4ML4A 1RJRA 4X63A 3IJ6A 2HE5A 3GKFA 2ZVIA 4NNBA 2ACUA 2ZXDA 4WDWA 1FHDA 4S3KA 4ECLA 2WM0A 3KOYA 3WDPP 1ELSA 1OX4A 4JFVA 1R7OA 4MOZA 3VFCA 1OSEA 3KP0A 3OLIA 1AJZA 3ARRA 1MQPA 2O9RA 2NLIA 4JTFA 4XV0A 3O8AA 1SR0A 4JYDA 3THCA 4H2CA 4K2SA 4RLIA 1D3HA 5A6BA 3G0XA 3WLKX 2CNCA 1YLVA 3H70A 1G1YA 5H8UA 4ZB2A 2WNNA 1FVPA 4HVXA 3NOYA 2DVTA 4IXHA 1TV8A 4WJXA 1H62A 5A8NA 2G3IA 4O0ZA 3RM8A 1F4AA 2W91A 3K5XA 4MPQA 3B8IA 3IIZA 3VIJA 4IQDA 3AMDA 3GLCA 1HXJA 3VIIA 3PM6A 1NY1A 2AKZA 2HJPA 3A3XA 2CBUA 1RQBA 4DJDC 4GIYA 2ZYFA 4XO7A 5AHFA 3B06A 3MMUA 3AC0A 2E28A 1RV8A 5HWMA 3W2NA 4HZ8A 2I57A 1W3TA 3I3BA 1VYSX 4PCFA 2VEMA 3K30A 1FWHC 4RZ4A 1VJSA 1SZNA 3S5OA 4NJJA 4AD4A 4F2BA 4Q4MA 4UOJA 3UR2A 3RO8A 4JNMA 3QFWA 2NUXA 4XAGA 5I3GA 1UG6A 1AW2A 3PNZA 3MHGA 3N2BA 4AU0A 2YXGA 3LM3A 4MTVA 1N55A 1PB0A 3ZT7A 3L2MA 2E5BA 1W0MA 2OSXA 3GHRA 1QBAA 1IV8A 2DVXA 4H9VA 1S2CA 2D0HA 4WEVX 3FKRA 2PTXA 3LD5A 3H2MA 2YCLB 3DI0A 1RH9A 4GBDA 2BVYA 4A8RA 2WC7A 3AMKA 5DMMA 1F3EA 1IXPA 4V15A 2Z28A 4WSKA 2XG9A 1MMFA 4OQVA 4FLSA 4NASA 1HKJA 3HURA 3GDTA 3GNOA 4XSLA 1ZBKA 1P0DA 1NP0A 4I8YA 3G77A 1CGUA 4AG0A 3GRIA 3RLVA 2A7PA 4Z2HA 4H41A 3OIHA 1Q4NX 1ALDA 1A4LA 2P1FA 5FSDC 4S3DA 4GYPC 4H9XA 5A8MA 2VFDA 4TO8A 3HPZA 1OWQA 4LBSA 1BYDA 2OTDA 4GQGA 3CT2A 3O05A 1US0A 4I9TA 1AMYA 4BI6A 4IX2A 1AD4A 5A6KA 1W9BM 3PFRA 2XTKA 4JDBA 2VZUA 2ZZ4A 3WJXA 4IG2A 3SDOA 4DBEA 4QFUA 3ABXA 3EXSA 1ME8A 3T2OA 4QDMA 5AVNA 3SI9A 2CITA 4AIOA 1SW0A 1V8EA 3GD6A 1TJ2A 3R6IA 1ZJAA 2VOMA 4HA4A 3WLSA 4Y8EA 1DKWA 3QOKA 1LJYA 5HR7A 4E2BA 4GZIA 1XCXA 4MWAC 4GHRA 3CGTA 3T05A 1Q6QA 3PNUA 5EU9A 4CCZA 1V3LA 3GYCA 3FY1A 3QY8A 4E4PA 1KO0A 2E5CA 3IS4A 5E9AA 4L1GA 3NPVA 4AEFA 1ZJIA 3QY7A 3EDDA 1A0EA 1TKKA 2HRWA 4KWOA 1JD7A 1QRQA 1IR1A 1D7KA 2WB5A 1UD2A 1YE6A 2JFEX 4Z2KA 4RZ5A 2FVKA 2PDNA 2JKPA 1UZ4A 2QAPA 1MNSA 2HE8A 5EFFA 3WEOA 1F3TA 2VELA 3GBEA 2YDQA 4O15A 1E1CA 1T5AA 3ITOA 3C2OA 2W6RA 4HU8A 1ZBCA 1XI3A 3AI0A 4NAEB 3B8VA 4H9YA 3VOHA 1BXBA 3RJXA 2G8ZA 2RGMA 3HA1A 3RMJA 2O9OA 4JN6A 3PJUA 3RX3A 5D2WA 5FACA 5D9MA 4GK8A 3WENA 5IXEA 2HK0A 3T8LA 4AVNA 3KBWA 3ZQ9A 3K8MA 2GLKA 3GG1A 3IIVA 1XR2A 2PU0A 1BRLB 1U5JA 1UWRA 3PB0A 4J3XA 1Y5XA 6TIMA 3GTIA 1K02A 1OD0A 2VX6A 3OG3A 4S3CA 1TV4A 5HAOA 1W3LA 3WFZA 2HISA 4C7FA 2F2HA 1PXGA 3UFYA 1SYTA 2R1LA 5KZEA 4GY1A 1KGWA 3V1PA 1R38A 4DQWA 3MV11 1OG0A 1XSJA 3E6EA 2Z2BA 3SRFA 2B4GA 4O13A 1R5YA 3EAUA 4F48A 4C65A 1EJWC 2WM1A 1WDPA 3LLXA 1J18A 1DJNA 1MYRA 3WQGA 3WQ6A 3P74A 2D0GA 3TIMA 5DT5A 3UWYA 3NPUA 3KDOA 2P50A 3HM7A 3C0QA 3OZYA 1WYIA 3SCQA 3T0TA 3PUEA 3SSJA 1VLWA 1LBFA 1RBLA 5HJLA 1VYRA 1D3GA 3FVMA 4Q8QA 4UFMA 5CSUA 5FJOA 1EOMA 2DY3A 3SN4A 1LOQA 1GYMA 2P0OA 3UZYA 1H3GA 2WHLA 1XLAA 3ZLGA 1UBSA 4DZIA 1Q6EA 1NM9A 2Z00A 1DQUA 4IMDA 2HEJA 2Y7EA 2ATMA 3UT0A 4B5NA 4HTBA 1JZ8A 3DC0A 1GTHA 5IRPA 3LTSA 3POCA 3KRSA 2EKGA 1UR9A 3WQ5A 2QDHA 1Q63A 5AHIA 1G01A 2BHUA 1GZJA 1WAWA 3W2MA 4GXPA 4N42A 4AQLA 1ZJBA 2NZLA 4Q8NA 4G6CA 1B31A 4FF5A 1X6UA 2A3LA 2IMRA 4JTEA 1QK2A 1UOKA 4AXKA 3T4CA 1LRQA 3MYOA 1C93A 1JUBA 5FSEC 4LB4A 3TZFA 4BZYA 1H61A 1MXSA 1ODUA 1OF8A 1PKMA 3K1GA 3BGAA 4REQB 2OT1A 3HQNA 2VRKA 4N7QA 3LHWA 2PWVA 2XH4A 4ZXOA 1GJUA 3L9CA 3OQ8A 4BQ5A 2OFJA 3ZWTA 3SCPA 1S2AA 2D2HA 4J5NA 4O17A 1V77A 4XIMA 2EPLX 4F0LA 4HNLA 3EXTA 1UR2A 1PKYA 4AZHA 1E51A 4V1XA 5BU9A 1JF6A 4GCAA 3ZR4A 3TC3A 2J7HA 1V7AA 1X97A 3VNZA 5JU6A 3DGBA 1GEQA 1OC7A 1KBIA 4W88A 4XG1A 3M0KA 4WDTA 1J8VA 2PCQA 1TPB1 2ANUA 1KRMA 1OF6A 3LZ3A 4AZBA 3L0GA 1GTEA 1AUSL 1DHKA 3EEGA 1VIZA 2FJUB 3QC0A 3GXNA 1EP2A 3WF4A 1QHZA 1KGXA 1KXTA 3LGEA 3WD1A 2Q71A 4GXWA 2A4AA 5CC6A 3HGSA 1C9DA 3AHTA 3L4TA 1BSIA 4JTDA 1KXVA 2H6RA 3TU9A 3FDKA 2DZXA 4PCTA 2EO7A 1A5AA 1ZQ5A 4EPKA 3LPPA 4LS0A 1CPUA 3C8NA 4H4IA 4O1DA 4PMQA 5M2FX 4AHPA 3R7MA 4NZ4A 2FH6A 1WKFA 2XYLA 1XH2A 2PRHA 4MLJA 1S2TA 2JIWA 3VOGA 4Q8TA 1XLMA 2WLZA 3CAWA 2WCAA 4Q4QA 2X1RA 3TWAA 4PBFA 1YBQA 5MKGA 2NQZA 2WVUA 3CZJA 3REQA 4HSOA 3UJ2A 4KRZA 2Z25A 4O14A 3P61A 2OX1A 3LSCA 1S5TA 4N4PA 1VAHA 2VC9A 1WOAA 1B54A 4UFLA 4Z08A 1EGZA 2HBVA 1Y5WA 2BX7A 3THQA 3S9ZA 4LAZA 1GZGA 3E0LA 1ONXA 4FR1A 1PDZA 4Y9PA 3DFSA 4QIUA 3N6HA 4HZMA 5XIAA 3Q58A 3BAWA 3QKEA 2EF9A 1CDGA 2EJ1A 4US5D 4R27A 4PB5A 3CIVA 4A2RA 3RPTA 1JXJA 3WLJA 1LZOA 4H8NA 1W17A 3CUHA 4NAFA 1FWJC 3R2GA 1ZALA 4H8UA 4LNCA 1C29A 1UKTA 1ZBVA 3VC5A 4QNWA 3NSXA 4B5VA 4W8AA 3O16A 3N4EA 1MW1A 4IWWA 3LBOA 5D32A 3OJGA 1BLIA 3WDIA 1TUFA 3H7VA 2JIEA 2XVGA 3LCIA 4WCJA 4OBRA 3RM9A 1E0TA 3W9ZA 2PGEA 1C8VA 7ODCA 1UA7A 3GXFA 3F2CA 3URAA 4GQQA 2J9XA 3EOUA 1FWFC 3TJLA 2X05A 3HPAA 3AS1A 3FW6A 5REQA 3DN5A 5B7YA 1QVBA 1C90A 1POJA 2FVMA 1CT5A 3SQSA 2AMXA 3A9BA 1QJWA 2E8ZA 1FH9A 1VBGA 3S4TA 5CLWA 1WDWA 2A21A 3TQ0A 3FAXA 3XISA 2CLOA 1CECA 1SJDA 4LAKA 2E5DA 4TX9A 1BG9A 3HPXA 3M1ZA 1G4PA 1XCWA 4R53A 5I0DA 5G2HA 4NY2A 2VJXA 3E2VA 1CBGA 4J3WA 1IGWA 4DB7A 2OO6A 4P7NA 4HNUA 3MMTA 2H9AB 7TIMA 3T0CA 4U3CA 5T91A 1R0MA 2PDXA 4DXXA 4Q8WA 4RCXA 3ES7A 5EBAA 3IGUA 3BURA 1XX1A 4ATLA 4XD4A 1K9DA 2PWGA 3A22A 2VEPA 3G1YA 1UQYA 4UWMA 1V51A 4WDXA 4BHYA 3KOXA 3LCLA 4QE4A 3QRHA 3V5FA 5HMFA 3KBSA 1DL3A 3G1AA 1W1PA 1DWFM 4GNVA 4YTRA 1KFJA 4GYJA 3HQ1A 3SIZA 5KZDA 3R13A 5LIYX 1XKYA 3RF9A 3QHOA 3UY7A 2ZZ1A 4RPPA 1C8XA 1ZU8A 1DIEA 2EXOA 2O92A 2E0PA 1FUYA 1Q85A 1QWGA 4E8CA 1U5HA 1UPMB 4NUWA 4W7WA 4MKNA 5HMDA 3NOEA 2VC6A 3LERA 1IZKA 2GJRA 4IISA 1PHWA 5B7ZA 3KOZA 2XIJA 1K77A 4BF9A 4V27A 4GWEA 2TMDA 3R5EA 1WZAA 4GI4A 4CU6A 3QLLA 3ZWSA 4JEQA 2AMGA 3FFSA 3U2OA 2FGLA 3IEBA 3QTGA 5BU6A 5CC7A 3ARWA 1GG1A 3SCTA 1HGYA 3BV4A 1DE5A 2EAWA 3BXWA 4DBUA 5JH2A 1V6TA 4M51A 1QNRA 3LUTA 1W3HA 1KQYA 2ISDA 3RG6A 5LNRA 4W85A 3THUA 1JYWA 4CD7A 3ITYA 3D6NA 3BLFA 4OBTA 4Z0JA 1XXXA 1TJ0A 1THFD 1LYXA 1JNEA 1MDLA 5D9PA 4KQNA 5GPRA 1ITQA 4D6CA 3CIXA 3JW7A 2WKGA 1BQGA 4JY9A 2GK1A 4LCSA 3GG8A 2G3FA 1LWHA 4FR6A 4IMCA 4QG9A 2P0IA 2Z7KA 1J2WA 4AZCA 5AC6A 2PTWA 2XM2A 1UIOA 1VJIA 4WY0B 3L5AA 3DCPA 3UCCA 2XVLA 2WC3A 1CXHA 1LROA 1TMLA 2ZDSA 2R14A 4FNQA 1B9ZA 4WGXA 1VRDA 2YA0A 4MF4A 1UKOA 4K7YA 1K9EA 3IGXA 2FGBA 4CCEA 1GONA 4RDWA 5G2IA 3QM3A 3W83A 3B0PA 2XSBA 3IWPA 4GZ7A 1L6FA 4KF1A 1K3UA 1NTHA 3UD6A 4NXSA 2E77A 2DUXA 3NZPA 1JCNA 4DVOA 2POTA 3RILA 3PBVA 3AIQA 1W31A 2GPTA 3FDGA 2RKXA 1KB3A 1FWTA 3EB4A 4GVFA 1X6LA 2VWSA 1LP6A 2HROA 3G18A 5I3HA 2QCDB 4I8DA 2ZFAA 4JN8A 4U10A 1XH1A 3EPNA 3F4VA 3UJFA 5AYXA 4IGHA 3EWDA 2YA1A 3MT1A 3UPWA 4JX4A 3MI6A 3LBMA 2NQJA 4MYXA 3WBXA 1XG3A 1FDZA 3AXHA 5HA7A 1C9WA 4NIRA 4DXVA 1W3JA 5DXYA 1VS1A 2RDWA 5C9XA 3A3HA 2OEMA 1VHNA 2NQLA 1B30A 4ZQNA 4US5A 3MKKA 1R2TA 4MHBA 3SJ3A 1ITCA 4QROA 2DJXA 4C90A 4O1FA 4UMBA 1XLFA 4XSMA 3WLMA 1SM9A 3NXLA 1WXZA 2WKJA 5T9BG 3O3RA 4LX4A 4FI4A 2B7OA 4MJZA 4ZQRA 2PC8A 4IL2A 3PZTA 3U6WA 1SFSA 2OU4A 1KRAC 3QC3A 3KLKA 3P93A 3ONCA 3NNTA 4AD2A 3NCOA 4ERIA 5A8OA 1KWKA 3QSRA 2QCNA 2PCEA 3MUY1 3QF0A 2QEZA 4JHZA 1B3WA 2Z1KA 4FX8A 1ZUAX 1SO3A 1ZBWA 3S2LA 1JRCA 3UZWA 4ERGA 3EX4A 1W9PA 4GO9A 3QMRA 4AZGA 3TCSA 4IP5A 2V3GA 3E2SA 2C1GA 1HP4A 3W1AA 1IIHA 4F79A 2X30A 2AOSA 4ATDA 4ZOCA 3MBDA 4ZEPA 3CUXA 4MNMA 3CQJA 2BBFA 1OYCA 1OGSA 1KBKA 2GOKA 4FALA 2YDAA 1AZ1A 5I3JA 3BUVA 1DBTA 2WC4A 2VGFA 2GJLA 1WE5A 4ACZA 2BDQA 1P7TB 1PTDA 1AMKA 1RQHA 1XLEA 2P8CA 3H6OA 1JAKA 3PFMA 1F73A 3H22A 1XC6A 4PCPA 4AYSA 1JIBA 4TIMA 4M56A 8TIMA 3GWQA 4G2DA 2NSXA 2PDUA 2HDJA 2GGJA 2AAAA 3COTA 4EX4A 1RP9A 3BC9A 3B9NA 4GUHA 4H83A 4N6EA 5BCAA 3LQGA 5CLTA 2XZ9A 3RAOA 5C54A 1E4NA 1IWBA 5A3HA 4WSJA 1KFBA 4J2MA 5DBTA 4CD8A 4XD6A 2C16A 4MM1A 3PHAA 2V3DA 4G8TA 2ZRWA 4LSBA 1J0IA 1IZCA 3SR7A 1TPUA 2TAAA 4IM4A 4QRNA 1NIUA 3TYUA 1PCWA 2V5JA 4K8GA 3C5QA 4QGCA 4P61A 1EPVA 3VIOA 1O5RA 2UZ9A 3EWBX 4M24A 3EB2A 1O7AA 1ZL1A 3PS7A 5AZ1A 2Y8KA 3WH6A 5BYWA 1DJQA 3SQLA 1TV5A 1QI4A 1VFTA 3AXMA 4XTDA 4DUWA 1L2UA 2V38A 4JX5A 1RJPA 4W86A 3VINA 1NVMA 1XPGA 2WCGA 4IHCA 3ZVHA 1CLVA 3GC2A 3P0WA 4MZ1A 1KTNA 3MO7A 1QOXA 4LB3A 3PTDA 5DF0A 3MHUA 3A4AA 1ONEA 4PTVA 1HJVA 1R6WA 1NDYA 2CZVA 2DSUA 4A3UA 2PDQA 1LBMA 1VB9A 2WQDA 1DWHM 1QNVA 1D7FA 1E40A 3HU7A 4WX2A 3VDAA 1FWEC 1OEPA 1R9ZA 4M82A 1EIBA 4DZ5A 4FMVA 5M03A 2ZTKA 3RO6A 3LY0A 2G4FA 3LCXA 1B3VA 4GMEA 4U28A 1IEWA 3EKLA 3I68A 1BEUA 4AMCA 2XU2A 5A2BA 1NFBA 2D2GA 4GJ1A 2FHCA 5JQ9A 2GQ9A 2J47A 3GS6A 1U30A 1J11A 1JFHA 1Y7VA 2UY2A 1ZGDA 1FFQA 4DWSD 4I5UA 4JZ5A 4G1KA 1H09A 4QE5A 2AL1A 4H7CA 4B2DD 4E4FA 3PZVA 2J7EA 4JIHA 4LBRA 4LRSA 1SW7A 3VE7A 3PBWA 3SEPA 5FKYA 1K9TA 2Q8LA 5L6UA 3IJ8A 1PZ0A 1FWNA 4B5XA 5J5DA 1HZYA 1RA5A 1L6YA 4UCGA 1TPWA 3TTEA 1LT7A 1EBHA 1HN1A 3UWZA 1H1YA 4RXFA 3WBWA 3N2TA 2OZ8A 2QQ6A 4HA0A 3IJ7A 3G8EA 2HNHA 5JH1A 2VYOA 1XYCA 5LA0A 3GVGA 4FIQA 4GABA 3VO0A 5CXPA 4B91A 3DKJA 2BMBA 3MQTA 5I3DA 3MW7A 1ZB5A 1SZGA 1SJCA 1AZ2A 4H01A 2PBOA 2PLMA 3PR2A 5T8GA 1EX5A 1GPWA 4N9EA 5AC8A 4AC1X 2OEKA 4PZVA 4MWAA 1TCDA 4W8BA 1MW3A 1P0BA 3R4IA 1R47A 5EMKA 1UUQA 3URBA 4Z2IA 4W84A 3NVDA 1H5VA 3MP5A 5DMYA 3USZA 3MCMA 3I7RA 3ALFA 3F2DA 1UR8A 1XGZA 3VU2A 1OFDA 4BY3A 9RUBA 2ALRA 5I00A 4QDPA 5FEPA 1E71M 4F0KA 1NU5A 3CWOX 2EPKX 3HF3A 3BAKA 3RCYA 4Q8MA 4FOJA 1I6NA 2B0MA 1VPYA 3TSDA 5DLCA 4HYWA 3N13A 3KS6A 4IFOA 3LG3A 3VD3A 1UD4A 1M01A 2ZXAA 4HMNA 4IMFA 3CV1A 1R3TA 4TOQA 2E1DA 1CGWA 1W8GA 3ABOA 2Y70A 4PTDA 4IP7A 4GG9A 4ROPA 4Z1CA 2J66A 4KWWA 2LLEA 1CB7B 3JU2A 2ADAA 1R2SA 3VD9A 2DORA 3W1NA 4E0CA 3W85A 3S3GA 4HHPA 4R5EA 4V33A 3S2CA 1V02A 1OX4B 3N17A 2PC4A 4JXCA 1A5MC 2Z29A 4NJHA 3S9IA 4C6KA 3G1HA 2BOEX 1XSKA 4KCUA 1TO3A 1VQTA 1EYEA 1EXBA 4BWLA 3O15A 5DT7A 4B16A 1A49A 3FN9A 2X1UA 2XGZA 5XIMA 3NEVA 3QYSA 5CBJA 2NVDA 3TZNA 4GQRA 5CPSA 1UWQA 2H8ZA 1JULA 5I3IA 2QDEA 1VD6A 3HN3A 4OUIA 3A4WA 3BG5A 3DC8A 3DFQA 3IANA 4TUFA 4K6AA 1AW5A 5H1WA 4XB3A 1VR6A 2VZOA 4N6FA 4S3BA 1PIFA 3NIYA 1XYBA 4DAIA 2O7SA 5BZAA 1XYZA 4GQBA 1M53A 1OK4A 1XQKA 1K7EA 1XBYA 5GNYA 4WJEA 5D2TA 3G22A 2R1KA 4I6KA 5E70A 9XIAA 3R8HA 1SW3A 3GY1A 4PL2A 2W92A 3VILA 3N2CA 3HJEA 3BICA 1TQJA 4NI3A 1KLYA 3FK4A 4E38A 3PANA 1XLJA 3ANYA 3RRAA 5F1UA 5F4SA 3CT7A 1E55A 4HHLA 2PP0A 3CUFA 5LNSA 1FHVA 1UB3A 4XTIA 4Z1AA 2QPSA 3VKAA 1TUXA 1RAKA 1XPYA 3IAPA 5BW6A 2P10A 4XIAA 3E2RA 3V7PA 1ISVA 4DI9A 1WZMA 1HW6A 2R1MA 3FXYA 8RUCA 1NJJA 3M6DA 2FIQA 4INFA 2R24A 1UROA 1PS9A 1SSGA 5KTLA 2DIJA 1PE1A 1XWYA 4DJED 4US6A 3OU8A 1GVFA 4JL1A 2BZNA 4Q8UA 4NG3A 1PIGA 2VMFA 4F3HA 2QCMA 4OTKA 4LXFA 3P81A 3AYVA 4W5ZA 2BVTA 4MUZA 4I3GA 3AMLA 4XBSA 3NPWA 3R10A 5LHFA 3FNDA 3WKZA 6A3HA 2C91A 1UMYA 1NF7A 2X1IA 2PWUA 2WHKA 3TTSA 1Q6LA 3H2CA 3T42A 1XLLA 3WMLA 3FJ4A 2R82A 1F76A 4RW3A 1G4TA 3VMPA 1QCWA 2E9BA 2YYTA 4MADA 1KM2A 4AD5A 4M6UA 2D22A 3D47A 3QXBA 1WKDA 3S1GA 1OCJA 1RD6A 1VCGA 3UBPC 4RNHA 1X98A 2EG8A 4IG2B 3IJDA 2OZTA 3AJ7A 3WJSA 5LA1A 4JIRA 3FXGA 3SGGA 1EC8A 2ZRUA 1F3XA 3S0CA 2IW0A 1K4GA 1SO5A 1ADDA 4DWSA 3UZJA 4LTSA 2UY3A 4QDWA 2DZWA 2GOUA 4KFOA 4B2DA 1WUEA 2ZC8A 2X7WA 5FJIA 3H8AA 3LPFA 2PP3A 2GVYA 3W7HA 3IUHA 4K7VA 4ES4A 3FYYA 1ITXA 3NQVA 5HK4A 4B9YA 4JDYA 1VFMA 4IPJA 4M19A 3AU6A 5C9RA 2Y62A 2ZVRA 2VEGA 2QIWA 1E4MM 3SCSA 5HMEA 2X7VA 1HO1A 4DEFA 4PTWA 2A3BA 3FJLA 1PAMA 1QTWA 3NDYA 4XD5A 2DH2A 1RCXB 3OB8A 4AUBA 1TQXA 4DUVA 3MUIA 3T78A 2ZQ0A 3VABA 4Z1BA 1Q2RA 1PX4A 3BVJA 2PBGA 2R94A 4NNAA 1V4YA 3H2EA 5LIWX 1QU4A 5A2CA 4PL1A 2FLIA 2BXYA 1T6MA 3NEHA 4D1JA 5AVHA 3VCNA 4HTYA 3WJZA 1GNXA 4FNSA 1ZCOA 1E1CB 2ZUNA 5BRPA 3O7UA 1QPKA 3LRKA 3BE7A 5HR6A 4HPHA 4JTLA 1XLIA 4LS1A 2REQA 4JIQA 3WBYA 1F4HA 2XH0A 1XDJA 3PWIA 1XRSA 4HN8A 5FCZA 3WLPA 1AODA 1UD3A 4XVDA 5AB3A 5H2ZA 3DZ1A 5E0CA 1QFEA 4S39A 4GUGA 4J28A 3OHMB 2BSLA 3IGSA 2Z27A 3M5VA 2DSVA 1V0KA 2QW5A 1HL8A 1W1ZA 9XIMA 1PZ2A 2VP8A 3W7KA 5C7VA 4CN1A 4BS0A 4WUIA 3T9PA 4HU4A 4LWWA 4QEEA 4FXRA 3E5PA 1K4HA 1RK6A 4FOUA 4KRTA 5TF0A 3Q94A 2XIOA 4AWEA 1CNVA 3FJNA 4S38A 3WMSA 2I5QA 2VRQA 4GFSA 4UTTA 4HNTA 3ZM8A 3WD3A 4Q6XA 3SUWA 3GR7A 3R43A 1F61A 2PRMA 3CYJA 3WL0A 4HP5A 2VZVA 2ZZ2A 4D71A 2XVNA 5LYRA 3EOEA 5A6TC 3HGRA 1MNZA 5LIKX 3TJXA 1GT8A 3OYZA 4WXZA 5IHRA 3TYAA 3V3WA 1VFOA 3WY1A 3BGGA 3W74A 4OECA 2AGKA 1AG1O 3S47A 3DG6A 4E5TA 3OG2A 4PUEA 2ZRYA 2J79A 3N2MA 5CBBA 1JZ3A 5FEZA 4P8UA 3M0MA 4CNSA 3CJPA 4XZHA 1E72M 1P1XA 2G5WA 2ACRA 3ISIX 1G7UA 4W4QA 4RDZA 1UW9A 2QIIA 2DQWA 5LKYA 4K68A 3XIMA 4CNNA 5FD0A 4JTKA 2WZHA 5D38A 4OBSA 3W2UA 3J7HA 4FIRA 4PRRA 1XUZA 1O6IA 4MDPA 3CH0A 1YADA 4NZ3A 3NL6A 3HG3A 3E02A 1FDJA 1JPHA 3OODA 4AHQA 2OB3A 2Y0FA 1FXQA 3UPBA 4GISA 5T9CE 3R89A 2DSKA 4M5PA 4B5SA 4YMZA 2VUYA 4CCDA 1CB2A 4O0QA 4C6MA 1M3UA 2PWDA 4OWGA 3SAZA 4RV8A 3TW9A 3P3BA 2Q09A 3E0FA 2J62A 3L4ZA 3QVQA 4DJEA 4S3AA 3DG3A 1IR2A 2QPXA 2ALDA 2YCJA 1R3SA 3QQWA 1OADA 3NQ2A 5DCDA 4Q4OA 1FWAC 1I2OA 1EXPA 1A0CA 4HPXA 3CYVA 5TBOA 4FLQA 4WGHA 4KEZA 1S46A 2V5BA 2HVOA 5HULA 3W84A 1WCGA 3B8UA 4GUIA 2QVNA 2W79A 4UNLA 3VFLA 3U5UA 3GTHA 3SRKA 1UH2A 4GJIA 3WSUA 2SFPA 5G4EA 6TAAA 3L67A 3W22A 4UTKA 3IUDA 1YHTA 3VM5A 3GKAA 1K70A 1AA1B 4H6QA 1KFLA 3QHNA 1TFVA 3OVQA 3IJ9A 3UG5A 2WOQA 3PG9A 3W72A 3WNKA 2PS2A 1Q45A 1EO7A 3CH9A 1RPKA 3EDEA 1Q8JA 2YGYA 3WQEA 3TN4A 3EGJA 1JI1A 4RDVA 4ZR8A 3U3HA 1ONRA 4KEVA 3ZYZA 1ICSA 3KVLA 3PWAA 3OVGA 4FZIA 1AL7A 5FL0A 4H04A 3UW6A 4M29A 4AW7A 3E2QA 5I2UA 1W9DM 1CXIA 1BYCA 1AQHA 4QE1A 4Y9MA 2IPJA 4WOQA 1VHCA 4HK5A 1WBHA 3VAVA 1B9BA 2ACQA 3R11A 4FPSA 3VKKA 4YPJA 2TRSA 4ZFMA 1K8ZA 3CL6A 2X16A 3LV6A 1GOMA 2CWNA 3OLDA 4V2XA 2Z6JA 5I5RA 3LNMA 1O66A 3WIJA 5D04C 2R91A 1LORA 2EHHA 2WZEA 5EMLA 1KV5A 1VFUA 1W5NA 2CHRA 3KBNA 1HJXA 4DPPA 3APGA 4PODA 2V2CA 2EEXA 1EX1A 5MKGB 1ISXA 2VURA 2PWFA 3FHQA 3KHJA 4O18A 1OVDA 3M16A 3REQB 3TNOA 2F2KA 3NTYA 1RQEA 2V9DA 2PLCA 4L6DA 3AROA 3RJYA 4L56A 4DM2A 1MI3A 3OGRA 4JY8A 1SO4A 4S1FA 1XRTA 1J0HA 2E09A 2Y85A 2WJZA 3VKBA 3MANA 2XWEA 1QNOA 3WDQA 2GQ3A 5KMYA 4WZHA 3ITCA 1AL8A 1SPQA 2CBIA 2DZVA 2Z24A 3UY8A 5I6SA 3NQGA 2DH3A 2UY4A 4NAFB 3UJRA 5KINA 1F6PA 3CUJA 5BOOA 1FH7A 1DE6A 4ZQOA 5EMMA 5I07A 2QYGA 1I4NA 2QDGA 5AHEA 1JZ7A 3T44A 1FRBA 3R94A 5A5WA 1S1RA 3B3DA 2WO5A 4C5ZA 1J01A 1DJYA 1NAL1 3QMSA 3W1PA 4YHEA 1PBGA 2D2JA 1F3WA 3BMVA 1QPQA 3EX1A 4XKMA 3KOFA 3CU2A 3WLOA 2HZGA 2O9TA 2PPGA 1BWLA 3HO8A 4YL2A 4EWJA 1HKWA 5REQB 1TMQA 2MUCA 3A13A 1YTEA 1OJXA 2QV5A 4U33A 2QJIA 4CNUA 5D8ZA 1VEMA 4PUJA 5AYBA 1XYLA 1UP3A 1B2YA 4IX0A 4JR5A 2VFFA 3W7CA 4C1LA 1VIWA 3WF1A 1LDCA 3TCEA 3OQEA 4ALDA 3TYDA 1TVLA 4HGXA 1GK8A 2X0HA 2V5KA 5C2GA 3LPOA 2X8RA 3TA6A 4MZ8A 5G1TA 4GH1A 2W61A 4C7GA 2OSWA 3G1VA 1UYQA 2WSPA 1U2YA 1I0DA 5BRBA 4CVUA 4MJMA 2WNQA 2X42A 3LTPA 4B15A 3BG9A 1M6JA 3BSMA 2V5CA 5GQBA 3O9NA 2OLSA 1ZFJA 1LOLA 1KD0A 3AISA 1E15A 4UNKA 2VC5A 1CENA 4NYUA 1UWSA 4UBPC 2NWSA 3BW2A 3PJWA 4GI8A 3JZEA 3N2OA 3VYLA 3T08A 5TAOA 1OG6A 2C1HA 4XD3A 3EOLA 2V5DA 4IIGA 1JDCA 3VKCA 4FAMA 1S5WA 2Z0IA 4AVFA 1UJQA 3GVWA 5M3WA 2QJHA 1EA0A 3T0AA 4OFCA 3UWUA 2W9MA 4TU1A 2G96A 1VFSA 2MANA 4AMAA 4UTUA 2ICSA 2YL8A 4QTGA 2C6QA 3T09A 7ENLA 3CL7A 4A8IA 2HV5A 5JXQA 4ZOAA 2PDFA 1XD1A 1KA9F 1Q7MA 4FOKA 4JTAA 1BPLB 3WZ0E 3TLQA 3NZGA 3STCA 3AJXA 1UCWA 1J12A 4EF8A 3NSMA 4GI9A 3B05A 3ARVA 2CW6A 1UUMA 3QPYA 3WCZA 4GE8A 3CB3A 4AZ7A 2ZBTA 5DRCA 3EDFA 1FXPA 1NFGA 4MNLA 3AIEA 3WLHA 2GK1B 4IFRA 1ADSA 4AEEA 1NOUA 2DDXA 2CEQA 1BXNA 1UP2A 1I45A 4AZCB 1KLZA 2WBGA 3CEUA 5HOSA 3N2XA 3LOTA 1TWIA 4KWUA 2X09A 3DENA 1B4KA 4G7FA 3ZSTA 2C0HA 1S3HA 1P0KA 1R3QA 4WKFA 3T07A 1GKQA 2XPKA 4GJJA 5FF7A 4U2YA 1RXOB 1TPDA 5EBUA 1RPXA 3SCOA 1OGBA 4C6JA 3MCOA 4N0RA 1J96A 4U4MA 1DXEA 3KHDA 3GDMA 2XN0A 3RPDA 3SM0A 1S2UA 4DO7A 2DVUA 3UQNA 5CZ0A 3ELFA 3KCLA 3AIRA 1NQKA 1R46A 4B5WA 2NLYA 3CPUA 2EG7A 1H7WA 1EEXA 2QDDA 2CZDA 1RBAA 3QV9A 2P76A 3L4YA 1OB0A 1PTAA 1SO6A 4LVAA 3AAMA 1L6GA 4XISA 8A3HA 4UMAA 2Y1HA 1EDTA 4NQ1A 1UHVA 1R8LA 3B0VC 2ZUUA 3IARA 5DXXA 2EPHA 3SCWA 1QPRA 1F05A 5B80A 4Q8PA 3T7VA 2PDMA 4WXYA 3CTTA 1C8QA 3AIUA 4S3JA 2QCGA 3W4RA 2BV9A 4GX9A 2WMGA 4X22A 3UERA 3O1NA 4PBGA 4JKLA 2QCLA 2VHLA 2E7FA 3SW6A 3C56A 3E49A 2X41A 4O54A 4GQ0A 3PC0A 5BROA 4MNJA 3I3DA 3D5HA 1IEXA 4PA8A 4YXGA 1DWIM 2CU0A 1ENUA 3F03K 5JVLA 3BJTA 1HNYA 3G24A 4HOZA 5AC7A 1SMAA 3JZUA 1R85A 1Q6RA 1R2RA 1A3HA 2ZIDA 3MVIA 2CLPA 2A7RA 2VVNA 4BJHA 3STFA 2V5LA 2OYMA 2PI6A 1J4EA 3C8FA 1MDRA 2WW5A 4O16A 4IOTA 3TFXA 1QBBA 1EB3A 3NL3A 3LGGA 1TJRA 3WO8A 1DJIA 1LUCA 4AX7A 3W76A 4PMUA 3KUMA 2H8XA 2V69A 3K2GA 1BTCA 2OQLA 3QZAA 4PSRA 4UNIA 4KCTA 3I3EA 5AKQA 3WUBA 5CCZA 4ONVA 5FJRA 3JUGA 3M0ZA 5DRIA 3MWCA 1BSLA 3HBLA 2D1ZA 3B9EA 3EMZA 3G6MA 4GY0A 1JRBA 4QLKA 3WK2A 2X1SA 1JGIA 4CQCA 3TONA 1QO5A 4H8VA 2WNWA 4ACYA 3LB0A 4CN4A 3KWXA 3TN3A 2FPYA 3KEHA 4HJFA 2FFIA 1V08A 5IDIA 3RM4A 5D05A 2GDQA 2O55A 4DLFA 1BGAA 3ARSA 1JDFA 3DU0A 1PDYA 3WD2A 3TX9A 1VC4A 2W4XA 4ACZB 1KBBA 3F1QA 5DN1A 1VJZA 6XIAA 3W00A 4LF2A 3PBYA 1H60A 4CQBA 1WPCA 3H7UA 1R3RA 3BCDA 4YTSA 2VKZG 1FKXA 1S5MA 2GVJA 4PB3A 1PKLA 3INPA 4HYVA 3KTSA 1GQLA 3T2QA 4K8EA 2H3BA 4ZOBA 2CLFA 4X0NA 1EP1A 1MZHA 3BW3A 1NOWA 1ZAJA 4PFMA 3I6TA 4LV4A 1W9UA 2GQ8A 4R3UA 2ABAA 1K9FA 4UR8A 1X7IA 3QTPA 5KZ6A 4AVOA 3GHSA 3QQ1A 3GNXA 4FLRA 2WVTA 1SFLA 3WDJA 5JBEA 3NM1A 1X1OA 3F4DA 2QLYA 2BGNE 1TZ7A 1WV2A 4WR3A 2WMHA 3VGHA 1E0VA 4P8XA 5A69A 3HJZA 4O28A 2NUWA 2BS9A 5HJYA 4F4RA 4XX6A 4BR1A 3SJNA 2VRJA 3UJEA 4LU0A 3N4AA 1O1ZA 3F4NA 3B0XA 3GC4A 3GTXA 1AJ2A 5FJTA 2VO5A 4DAFA 1BYBA 1DIOA 1XIIA 3GE7A 3HMCA 2TSYA 3WH9A 3ZVHB 3K8LA 4Q33A 1LWIA 4PTXA 2ZADA 2GJXA 2R9RA 2YSWA 1ISYA 3BK0A 4AIEA 4JCLA 3RXZA 5GNZA 4JFUA 4J3SA 3W71A 4OOZA 2DT0A 5CZJA 4OU1A 1JL8A 4IMAA 3K8KA 3A64A 2Y63A 1WUFA 1JJKA 3QHMA 3CS2A 1JUEA 3IGHX 3UZXA 3T55A 2QUUA 2FZ9A 1XICA 3PZOA 3UNTA 2I9EA 4QLLA 3P14A 4EXAA 1QATA 4IPNB 4RW5A 2A3HA 4CNOA 1H0GA 4LNYA 1TPC1 3WQFA 4L4OA 3NQBA 4L9ZA 3P67A 4MSSA 3CM4A 2J88A 3M0XA 1LRNA 3BG3A 5EA9A 1YPIA 3AS3A 1EJXC 3O6DA 3TV8A 1JUKA 1ZNNA 1O68A 4MY9A 4NSBA 4RNFA 4Z2GA 3MC5A 3GZAA 2OQHA 2VWTA 2HWGA 5EFDA 2RH9A 3OBAA 4ZOEA 3LXAA 1CXEA 3NL5A 1WKYA 3QFEA 4LAUA 4YIWA 3W7MA 1M04A 2WZIA 1LQAA 1FOBA 3KCJA 5LNUA 3NQEA 5HMSA 3V0SA 3A21A 1DOSA 4AWSA 3LDVA 5ENLA 4MWAB 3IPWA 1VFFA 4ZO6A 1G69A 4GKTA 2PD5A 1DORA 2PZNA 1UKQA 5I7GA 3H2FA 2KAUC 2Y5SA 3WELA 1WQ5A 1KV8A 3H26A 1DYSA 2E9MA 3G2GA 2CPUA 1HJQA 3ITXA 4IJCA 4DN1A 3A5VA 1R30A 4ZMGA 3ZT6A 2CFFA 5FAJA 1HKVA 3A9IA 2VX4A 3EPMA 2QT3A 3O2LA 1MRQA 5D9NA 3BLLA 2WLYA 3Q4DA 5A95A 2AGTA 1EGVA 1K1DA 2R1PA 3CASA 1VYPX 2RDXA 3RCNA 1BTMA 2VFGA 5E93A 1E6PA 4TTUA 3AMGA 2D2OA 1WXYA 3MUAA 4JQAA 3HPSA 1RHCA 4CLMA 1SZEA 2Y5JA 2YZRA 4YVPA 1V0MA 3ATYA 4A3HA 3BQ5A 2ESCA 4H7VA 4UFJA 5DFAA 5K4ZA 1WNOA 2HVNA 4H3DA 1B5TA 2YL6A 3KVKA 1S5VA 1V6UA 3C2RA 3VGFA 1KCZA 3ZJ8A 1PX8A 2D0FA 1DWAM 2OKOA 3BLOA 3NO1A 1W32A 1V3JA 4B3LA 2DZUA 2YR1A 3GK0A 1JFXA 2ZWYA 4ERAA 4W93A 4NNCA 4UQEA 1JPIA 1XD0A 3PK7A 5M17A 4W89A 3W1QA 4AC7C 3NFUA 1TELA 3HV9A 1OX6A 3MO4A 4Y2WA 1M7OA 3BGJA 1C92A 4CQ9A 2E6YA 3W1LA 3FV9A 1GYNA 5AN7A 4E2VA 3W7RA 1MEIA 3SCNA 2FTYA 1E0UA 4XZBA 3TR9A 4L7ZA 3ONBA 1Z42A 1IT7A 4KKXA 2NX1A 4EP8C 2PE4A 4CU7A 1AW1A 4HNCA 1HUVA 4QJ1A 1ZY9A 4LC8A 3LMZA 4CGTA 1A5CA 4LYKA 2OPJA 1UD6A 4FB7A 5AFDA 4LF1A 5I02A 5K9DA 2WAGA 3OBEA 5EGRA 1ZRQA 4UXDA 3SN1A 2CYGA 1DVJA 4Z1DA 3MY9A 1FCVA 3FA5A 4NF7A 1T41A 1JYVA 3BV7A 5A6SA 3CUIA 1E6XM 3I6EA 1VP5A 4YU1A 1X38A 4ZL1A 1UJPA 1NDWA 4LUTA 4QLJA 2QXWA 1EZ2A 3GFYA 3G1RA 3IK4A 2PWHA 3P5ZA 4WSHA 2PSNA 3WNOA 3VDCA 2PDPA 3CBWA 5IDZA 1JNDA 4AWTA 2Z7GA 1ZAIA 3FVDA 1Z41A 3QEZA 4PUDA 4ML9A 4QHRA 3EYPA 3RLUA 3TNBA 4B90A 5D9OA 3CC1A 4FHAA 4BK9A 3TSBA 4D1IA 4W5UA 3WFAA 3W7LA 2W66A 1TSIA 2DIKA 3FEQA 4LOCA 3DGRA 2G3NA 1JPMA 3WQPA 4H6RA 5E9XA 2F9RA 1ICPA 4TTGA 1V7YA 4KESA 4RUBA 3TC6A 1OABA 3B9OA 4WOZA 4O1EA 1H51A 3VGGA 1GVOA 1H7OA 3AFBA 3SUUA 4O8AA 2VUNA 3N12A 4G7EA 3E0IA 1HL2A 3EKGA 1K7XA 2NQ5A 4UTWC 4DUXA 3NZ1A 3OW1A 1XIHA 4XBJA 4MVAA 3KL5A 2V63A 1DJGA 3CL8A 3QV7A 4K36A 4AX6A 1DP0A 4J3VA 3H21A 4OVXA 1Q4WA 2WSKA 3ZJ6A 2GL5A 1Z48A 4N2YA 5CJ5A 2VD9A 2Y8VA 4WJ8A 1EHNA 1TCMA 3UG3A 1RZMA 4DWSB 4MUPA 6REQA 3WQCA 1EPXA 4L6OA 3VX1A 3BAIA 3FLUA 3S5SA 3EEZA 2GWNA 3BW4A 4ROQA 2C19A 4UQ9A 5FAGA 7XIMA 4C6QA 4PB4A 1KR1A 1HIZA 1Z8AA 2AL2A 3IJQA 4QXIA 1W1IE 2YOCA 1TR9A 4A35A 1XM3A 2NT1A 4CD5A 4Y96A 1QWKA 4PBEA 3BCJA 4HOXA 3MSRA 2JGYA 3II1A 3ITLA 4WVXA 3R8RA 3CAKA 3LV5A 5AYIA 4LPCA 2JK2A 1UC4A 2QV4A 2V0TA 1XJBA 4BWLC 3DIPA 4KCWA 3GUWA 1NEYA 2BXVA 3GAYA 1OC5A 3SCVA 2INFA 2Q01A 3CB8A 3ZSSA 1CXLA 3GH7A 4JTHA 3M0YA 5FI8A 3QZEA 5A6MA 3VTRA 4EAMA 5CPMA 2OKTA 3D0CA 3GXPA 4I9AA 2NXIA 3N4FA 4CD6A 3KZPA 4QEHA 4J9JA 2H90A 2PAJA 2F6UA 1A5SA 2REQB 3BLIA 2BLEA 1FX6A 4A29A 2ZC1A 5CPLA 3EDKA 3B97A 5I78A 2GGHA 4PSPA 1A47A 3HQOA 2RDTA 3TXVA 1PUDA 5F2GA 3M5XA 4RNIA 5LHEA 1E4LA 1BWVA 2PF0A 1LL7A 5F2MA 3TMQA 3RRXA 1UD8A 3VNYA 1FWBC 2ZE0A 4UTMA 1GQJA 1H2JA 1A5LC 4NHVA 2JQXA 1BD0A 2VOTA 2VFEA 4GGHA 2FMNA 1GUVA 5FF4A 2O0TA 3C3NA 1PCKA 4P8VA 3WD0A 3BMWA 1U1JA 3UWWA 3VZYA 1UP0A 1XHGA 4EPEC 2XFWA 1P0NA 1B4EA 1DWJM 1W3NA 4M6VA 1GVIA 4JTJA 2J13A 1I2QA 3KVJA 3WEZA 5HQLA 4HA3A 3T6CA 2ZUSA 1Z89A 2RJHA 4RX0A 7CGTA 1Q65A 2C15A 1W91A 3O6CA 3RU8X 4O50A 3DHUA 4LYQA 4HK7A 2XIQA 4DF1A 3SY1A 1VKFA 1R87A 3CO8A 4GIAA 4Q4PA 3W07A 3AICA 5BOEA 3PTKA 3GU9A 4B3KA 4DNMA 4W9TA 4J3ZA 3Q67A 4F0HA 3LBCA 4JTRA 5E09A 3TOPA 1LBLA 3BAJA 3S6DA 3VNDA 5C0QA 4XAZA 4IJRA 3VVGA 2V2DA 4AH7A 3U2ZA 2DFAA 1UH4A 4MB3A 3LX9A 3HFYA 2BGQA 1TVPA 1U22A 5I3FA 3WLNA 1JZ2A 5HATA 2I7GA 5MF5A 3PZ9A 1H5YA 4LYPA 4H9UA 2ZCGA 2O56A 2INZA 4RR4A 3AS2A 1Q13A 4IQEA 1O5XA 3EPOA 1EJVC 1SVDA 4X3ZA 4DWSC 3P80A 3IV8A 1OFEA 2QCCA 1P0EA 3SQMA 4MYAA 5G2WA 5FEWA 1OYAA 5IM51 1EUAA 3LTYA 4L4LA 1A5BA 3SY8A 3EA1A 3L65A 4I7UA 1F7BA 4AZ6A 3TLLA 1VEPA 1TYGA 1W1B1 4GCXA 4M1RA 4EF9A 3W81A 4DWDA 3MB9A 2HMCA 2HS8A 2Y88A 4C6BA 1HG3A 4WHBA 4ORIA 3W73A 4LBUA 3O6YX 1TRDA 1BAGA 6ALDA 1J2BA 2ZX7A 3W6YA 3KL3A 1TTQA 2F7FA 1OINA 1W1A1 3F4WA 3H24A 1EWEA 4O53A 3VCRA 3ATZA 1LQ0A 5AC5A 3KL0A 4C6PA 4DBWA 4GZJA 3V75A 1BYAA 2ZA3A 2WSQA 5EMYA 5CSYA 3U7BA 1A5KC 2AQOA 1OIMA 1SR9A 2ONEA 3DBPA 2GGGA 4ZTYA 4JGDA 3C52A 2HBXA 4ZO9A 1SFJA 3FHAA 3TVAA 1WOBA 4JN7A 3RPMA 2DZTA 1OY0A 3R79A 3ARYA 4XBKA 3TW7A 2BHYA 4I9JA 4MJ2A 1XRVA 5U4NA 3VNIA 3WMCA 1OFBA 5AZ0A 2F6XA 3QH2A 1PJ9A 4GC3A 1VCVA 1IE7C 1N8IA 3CLMA 4JQ4A 3GW3A 3W02A 4JTCA 2R6OA 4DF2A 4MZYA 5E5CA 4CQ8A 3GH5A 2BGSA 5EYWA 1WA3A 3EX3A 2EPMX 3WLRA 4C6EA 2FMOA 2BB0A 3QN3A 4HBKA 3NGJA 3SUVA 2XFRA 4XAYA 1W3KA 3W7NA 3CMFA 2W67A 1FY6A 2QF7A 1FHUA 1FKWA 1HKIA 4IPIA 1CYGA 1QI2A 2OQYA 3M07A 5KETA 2VR5A 2PZ0A 3H12A 1MW2A 4J1OA 1E6NA 1L6WA 1IIGA 1FFRA 1NWSA 4PGLA 5IFPA 3AU2A 3GVQA 3ZOAA 1HX0A 1Z7AA 4D6FA 3AMCA 4IJBA 1E73M 4RL3A 1X6NA 3MBFA 3HG2A 1TPVA 2FB3A 1JI2A 3V35A 4UTTC 1ITUA 5K4XA 1J0KA 4RDYA 2OJPA 1TE1A 1TTIA 2DW7A 4IH3A 2VXNA 3OO2A 1JYNA 4A4AA 5LGZA 3ITTA 2YDRA 4BF7A 3W88A 4YN5A 3CHDA 3WNPA 1XBZA 3PAJA 3TP4A 3DKLA 3N34A 4GINA 4TQTA 4DRSA 4RV3A 4IGNA 3P6LA 3NPXA 2YXXA 5TNVA 3CHFA 1KFWA 1GQNA 5ABFA 1OT2A 2R8WA 2MNRA 3MJYA 1MXGA 2JALA 1GOOA 1EQCA 2A6NA 4QJ4B 4FXJA 2FZ8A 3S5ZA 2WMKA 1Z6KA 2VT0A 3HQPA 4O1AA 3JRKA 4IUOA 4PMNA 1W5MA 3CUGA 3ME3A 2ZICA 2IPWA 2O7QA 4X2RA 3C0LA 1ZS2A 2RUSA 3LLFA 3QGAC 3TEVA 1VZWA 1KM5A 4F66A 4GYFA 3A3WA 3R0KA 3FAWA 3SURA 4U5KA 2HPMA 4L64A 1F5ZA 5C9WA 1XCFA 1TPFA 8XIMA 3S6OA 2GJNA 4I7WA 4X61A 1UIPA 1V6XA 1AH0A 1LLOA 3B9AA 1ADOA 1ZPTA 1JZ5A 1W1VA 4X0VA 3DHPA 3JS3A 3CHEA 2WPBA 4KBXA 4FNTA 1S38A 1HF6A 3R0UA 1OGGA 4FS9A 4DJEC 3AIWA 4RJEA 3LS9A 4E8GA 2P53A 3QYQA 4HOWA 1SU5A 4TV6A 1W56A 5D4YA 3F4CA 4UTIA 3TSMA 2P88A 3RCMA 3W6MA 1QNSA 2YW4A 4JTQA 1L8NA 1GVEA 4YCPA 1UZHA 2GVLA 4IIBA 2IUZA 3RIKA 3M43A 1H4PA 3CIWA 1US3A 3UG4A 4LEQA 3PBGA 3NDOA 5BMWA 3LCHA 5HNRA 3P8JA 3CAQA 5C9UA 4HMCA 4GNKB 3AHVA 3W7IA 1WDRA 1UKSA 4WKAA 3Q37A 1NWRA 3B0UX 1PZ1A 4E8DA 2GDVA 2Q8XA 4BQ2A 4AEOA 3W7PA 4DJFD 3EA2A 4TVDA 2V3EA 4L61A 1A3WA 4NL1A 4DX3A 3DECA 1C3FA 3G1XA 3O0KA 2DGAA 3VDGA 1QHOA 1Q6OA 1G94A 1QUMA 1EF2A 5LXXA 3P0XA 3NQDA 4U2ZA 4Q4SA 2WQPA 4A21A 2PGRA 4HU3A 4HT3A 4IXXA 3T4WA 3DFPA 3SCRA 4MNKA 2L5HA 2PA6A 1NOFA 4KEUA 2E6AA 3SUSA 1AD1A 1UR4A 5AOUA 1W37A 1MEWA 2I17A 1E6ZA 3GQYA 5DCBA 4NZCA 4E3TA 3ZZ1A 3A23A 4YYFA 3SBFA 3UYCA 4LFYA 3ABRA 3LCGA 3DX5A 1FP9A 1U1HA 5G4HC 2O4MA 3L2LA 5I03A 2XUCA 3WNLA 1GORA 3ZLHA 2ZA1A 3FCPA 4D2JA 3NAVA 1I1XA 3AIVA 4GLEA 1JEZA 2PWEA 3MDUA 3TXZA 5AECA 4UB9A 3C86A 1RK5A 4KPLA 2X0SA 2XISA 4EIVA 2F38A 3CPRA 5H6HA 3WJWA 2CXEA 4UC5A 1R86A 4RK8A 3QJAA 2PODA 1IZJA 1C7TA 3M6YA 1E5NA 1ZP4A 3U9IA 1Q5MA 3YPIA 1Y0EA 2GUUA 3TMLA 1VCFA 4I6VA 4RNJA 2ZX5A 3K4AA 4S3FA 3N19B 3PF3A 3VDBA 1G7VA 1MW0A 2CETA 1TTPA 4I5XA 1OCBA 3T8QA 3A6OA 3APYA 3GZ3A 1M7PA 2PLJA 1NDVA 3AZRA 3LHUA 3UF9A 3S83A 3W1RA 1BVZA 2BVWA 1A5OC 3S2MA 3R25A 2JKEA 1ZP3A 1O5KA 5IFTA 3ZT5A 4YTTA 3KBJA 4JICA 3S5NA 3KRBA 3WBEA 3PAOA 3OVRA 1R9YA 4C1KA 3PB2A 3VM7A 1GVSA 1P43A 2D3LA 4AHOA 2VGBA 5FF0A 3WNNA 2Y6ZA 4N9BA 4YWIA 1M9HA 5DQPA 3MHFA 4DBDA 3L4XA 4C6NA 1GKRA 1VPXA 3L2IA 3WLLA 1UZDA 1QPNA 3PZGA 2BFGA 4A8LA 1HQTA 3VI2A 3P7YA 2NX3A 1LCOA 2Z1SA 3MMWA 5LIXX 3N04A 3W25A 2Z1XA 4WLCA 4HNNA 4XZ9A 3L0KA 4FF7A 3W7JA 4DF0A 1ZHAA 1XLHA 1N82A 3AHYA 4E6MA 2ZZ3A 4XZNX 5DMNA 1RLCL 1E6SM 4M8UA 3Q65A 1AJ0A 2HK1A 1IWPA 1T40A 4AZIA 3R12A 4RKAA 5CJNA 4JOMA 3QPEA 1Z3NA 1MUWA 4MMWA 1MRAA 3B40A 3T40A 3WD4A 2J7CA 4F0SA 4C1NA 1UH3A 4BEQA 3M7SA 3W70A 2YJQA 2YFOA 5K9XA 5CG7A 3NGFA 4RE0A 1MWOA 1XISA 1FA2A 3CWNA 2V67A 1O5QA 1I2PA 4AYGA 4NT0A 4GA8A 4CCCA 5H8MA 3BMXA 3USBA 1IYXA 2DU2A 1M1BA 5AC4A 1GVRA 2E67A 3MZNA 1V3IA 3FSTA 5CGTA 5J8LA 4HSNA 4OE7A 3V5CA 3ZXWA 2ZUMA 3P2VA 2ZOXA 3UWVA 2G3JA 2C8NA 1E43A 1JDEA 3DBNA 3EOSA 1DXFA 1EJSC 4YLWA 1DJZA 1KTBA 4I90A 3KZSA 3M44A 2Q3OA 2XVPA 1LUCB 3CV6A 5EPDA 2BOGX 4YCOA 4ZCWA 1WB0A 1B3XA 2VZSA 1U33A 3W37A 3VNJA 2VDHA 2YL9A 3FYOA 2QCEA 2QUTA 4Q22A 2W3ZA 1KCXA 1FDYA 1EDGA 5D2VA 3HFTA 3MV01 3LM7A 1L6SA 3CWHA 4CQAA 3CAVA 2QHAA 4ADSA 2A79A 2GQAA 1ISZA 5CC5A 1O95A 5HUPA 2QULA 3UZ5A 3BL3A 4HHHA 3OBKA 4GOAA 1X8FA 2VTFA 3RDKA 5CG0A 1JXKA 4KS0A 2P8BA 3BSGA 2XN2A 2RFGA 1VEOA 1BG4A 1PYMA 5T26A 1FTXA 4PRWA 4Q4RA 3L5LA 4OOUA 2I1OA 2F6KA 3NG3A 3TQKA 4DJFA 4JIPA 3TC7A 1O12A 4DELA 3NYDA 3SRHA 4UQBA 8XIAA 2Y61A 3MDWA 1YDNA 5I09A 4U31A 3FIGA 1BF2A 1R3WA 4AD3A 3ABSA 1DTUA 2E4TA 2A3EA 2C0AA 3MCNA 2PGWA 4XZLX 1W5PA 2JEPA 1K8CA 1OFRA 5CJMA 4LAMA 3W82A 1Q6FA 3UVIA 3B4UA 4K3ZA 4JD4A 3HZ3A 3SCUA 2G97A 1R3YA 4UCFA 5I77A 3WMBA 2XHYA 5CZKA 3MSDA 1LT8A 4O19A 3W7OA 1XLBA 5BXSA 1QO2A 4JQ2A 1XFBA 2X2YA 3OLGA 1YPXA 3EWUA 3R8GA 4CD4A 4AWUA 3WLTA 4IUGA 4DBSA 3E0WA 4UMCA 2G50A 2ZXBA 1R9XA 5EB8A 4WK9A 3V1HA 2FQIA 1ML1A 4X9SA 3W7DA 3UXKA 2CLEA 2PB1A 4PUWA 5AY7A 1CGYA 1ECEA 1XW8A 4PTNA 1PWLA 5L9FA 4QQUA 1QOPA 2NUYA 5C5YA 2DIEA 1KCLA 1YRRA 4GACA 3BH4A 3BO9A 3UP8A 4QM1A 2JE8A 4AAJA 5BXPA 4MKSA 4N9DA 4AF0A 2GJXB 3WQDA 2Z26A 1Q3NA 3N25A 3AHXA 5BWFA 5I79A 2OOFA 2A0NA 3QBUA 3K4DA 4DYKA 4X9YA 4ZO8A 1JVNA 3DHFA 3B03A 2DP3A 5GJPA 3VC6A 3MKCA 3DERA 4XO6A 2BHZA 1XYAA 2XINA 3DESA 5D03A 3WK3A 1OK6A 2FYMA 3WK1A 5GJNA 2IQ0A 3IRSA 1Z32X 3EA3A 4CUCA 2YXOA 3ANVA 1UBPC 2WHJA 1VH7A 4NU7A 3WH5A 3S1UA 2P5NA 3FGCA 1TJPA 5KSWA 4C91A 1W5QA 2E6FA 1VBHA 4H9TA 1CLKA 3BLDA 3UEQA 3MMDA 3VUPA 3WUGA 3DFNA 2XWDA 5K9CA 4QITA 5AHLA 3IJIA 4Q8OA 1S3TC 2PDKA 4D72A 4Y9NA 3G6LA 4UTWA 4AIUA 2EGZA 2OLAA 3VA8A 2INEA 5HJXA 1T96A 1DV7A 1Q6GA 4Q6JA 1VFLA 3CZGA 3S9YA 3CZEA 3PJXA 2Z1WA 2VENA 2QZRA 3V4BA 4QQ3A 4IGMA 4QG8A 3DFYA 3NQMA 1UWUA 2GUYA 1XRFA 3FX4A 3W1TA 1BQCA 2D73A 1LG2A 2DT2A 3MI3A 4IIDA 3SB0A 2OYLA 4TXEA 3QLDA 4WRHA 3EBVA 4C6LA 5J04A 2RJGA 1JCXA 2IQDA 3NZRA 2ZRZA 3CMGA 3NL2A 4D8ZA 5RUBA 2BXZA 2ATSA 4GX8A 2VEKA 4FXSA 2C13A 3ABQA 4QSHA 1XL9A 2J24A 1PV8A 3DOPA 1EC7A 4MLRA 4HNOA 1GWJA 4KETA 4J4KA 4HSHA 4L1WA 1ODZA 1Q2SA 1DHPA 4EOUA 1D8CA 2GWGA 2VX5A 1TPH1 2ZUWA 1WDDA 4P7RA 4FO4A 3CK5A 2WMIA 4RPQA 3GG0A 1QR7A 3L4WA 1B0IA 1DEDA 1LL6A 4JTTA 4ZQCA 1DIDA 1HL9A 3RLGA 3VXGA 1K6WA 1B90A 4O11A 3DYMA 1SMDA 3GTFA 2HQAA 1JD9A 5FIPA 1ISWA 2VR4A 1EO5A 2PEVA 1KM0A 1S2VA 4R9OA 3DFHA 1G9HA 2QNEA 5EMUA 3WH8A 1GW9A 1KWGA 4B92A 1TR1A 4DO6A 3BOFA 1C8YA 1H1ZA 5C55A 1BHGA 3BAXA 4XUGA 3KAOA 4PUKA 1NELA 2OVLA 3ERPA 3EWZA 2GJPA 1RY8A 4BCEA 2QVHA 3HV8A 1HJWA 1O4UA 3GU2A 4S3GA 3GC5A 3FKKA 3AYRA 4IPPA 1TWDA 3TYBA 3HB9A 3VNLA 2Z6IA 2NSOA 4AB4A 1GHSA 3H4WA 2ZXQA 3KFTA 5AYYA 4XWUA 5CC3A 1FQ0A 4HPNA 4QX4A 1F8MA 4UOQA 4HKPA 4GKLA 5LNWA 3TYZA 1ONWA 4GIEA 3HG4A 3PPCA 4FNPA 4RZ6A 2IS7A 4MFEA 1W5OA 4YTQA 4YHGA 3T1GA 3W2LA 1ZJHA 1J9YA 2IKHA 3N3TA 1VBJA 3UYIA 5DO8A 5ECUA 1X8CA 5LZLA 4WKHA 5DCEA 3STPA 5ABGA 2V82A 4PMYA 4ZFCA 1L9WA 2BODX 3UNDA 3NO5A 4IFKA 3SN0A 3WLQA 1YMYA 4NRSA 4O52A 1WDSA 1S2WA 2XH2A 4M6QA 1JQXA 1H7XA 4C6DA 4WF7A 4DYJA 1B57A 3E74A 2DZAA 4NJKA 4JAWA 4LUTB 2IKJA 4NZFA 2DJLA 3W1XA 4AY7A 2C1IA 3LA4A 2PGFA 1WX0A 2TYSA 4GNJA 4K39A 3TR2A 5C2XA 3VIGA 5SWUA 1KRCC 4XVEA 1DIKA 3OIXA 1M5WA 1F6YA 4A2SA 3W24A 1RR2A 1PEZA 3DAQA 4NP7A 1KNWA 1VFHA 2G37A 4ZZ9A 5PTDA 3L21A 4CN6A 1EJUC 1NQ6A 5CKSA 3TA9A 1CCWB 4EPDC 3BJFA 1BVNP 2NV9A 5FA5A 3W29A 4KFPA 1RCQA 3CHVA 1MQRA 3W3OA 4GIRA 4MWAE 2G3MA 2GYIA 2E3ZA 1RD5A 1O60A 3RX4A 4G7EB 5AYZA 1PYFA 3PUOA 1NWTA 3W75A 5K3VA 2YL5A 1P48A 1US2A 1JDDA 1X1ZA 3Q45A 4Q7NA 4O0KA 4J3UA 4ASTA 3UU0A 3H4GA 4Z17A 2XM1A 4P8WA 4BQ3A 4M0XA 2A5HA 2BY1A 3B8DA 1EL3A 4E2DA 3BLPX 2E6DA 4JTUA 3SFWA 1AK5A 1GQIA 4IQJA 1F07A 1E1FA 3THAA 5C9ZA 4HIBA 1P1MA 2VFHA 4C6OA 1P5BA 2DPEA 1AH3A 1YXCA 4ZODA 3B0YA 2AAMA 4HCDA 2B81A 1MFVA 3PPFA 1QI5A 2J74A 1XIEA 2PDCA 6REQB 3C0SA 4FNRA 3V16A 2JF7A 3ZIZA 5C70A 1WAUA 5C6MA 2WJFA 1MO0A 4YJ5A 4CEXC 3OGVA 4ZQPA 3G8RA 3AOFA 3QGKC 1PWMA 4Z2LA 3AYTA 3GIYA 1I9CB 2AL2B 1XDMA 4HU0A 2HS6A 1A0DA 1V02E 2BVDA 1PZ3A 1RALA 5HNTA 3NQCA 2EPNA 3QR3A 1TWZA 2J9ZA 1YDOA 2WWDA 4GRSA 1X96A 3AIBA 3PBMA 4DPQA 1BWKA 1EGMA 4UZUA 2YIHA 3NSNA 4EXBA 2ISWA 3CV2A 2HVMA 2J78A 3O07A 4Q3MA 2POZA 3TJIA 4H7ZA 3TOYA 3K4WA 4MFDA 3H55A 3U8GA 2A7NA 1KTCA 3E3HA 5CZSA 1V3HA 4CKQA 1Q6CA 2WV8A 2OEJA 2VM8A 3NDZA 1RA0A 3ZMRA 4CNTA 2E8YA 3WDRA 4HJWA 4JTIA 4AISA 5E6ZA 2GSEA 2RHGA 1REQA 3CNYA 3C6CA 1OD8A 4X60A 2ASHA 3MWAA 3PZUA 3OLEA 1VPQA 3N29A 4R88A 3GO2A 1LQ2A 2HCVA 1KXHA 4I5RA 1IXOA 2VCAA 4FNUA 2NT0A 4EXQA 3U4AA 3CO4A 1A4MA 1GCYA 1GPFA 3KW3A 5HDRA 6ENLA 4NJIA 1EP3A 1D3CA 2KX9A 4JKKA 4LT9A 5A1AA 2WMFA 3L5MA 3GVVA 4PMVA 1EC9A 2ZZ5A 3CZ8A 1XLDA 1S39A 4UR9A 3M46A 2J25A 5E0KA 3U48A 1E70M 4R7JA 2QJNA 1KM3A 2CXGA 2W5FA 3TTYA 3AWOA 1A80A 1GYLA 2UY5A 4JKMA 1ME9A 2PFHA 2PTZA 5G1MA 3PBUA 5DELA 4EWND 1QW9A 1WO2A 4MPKA 4RE3A 3KVMA 3UZZA 3EMCA 1V5XA 3N6QA 1YQ2A 5M5DA 3P62A 4PEEA 1XFCA 3PUDA 2FPTA 2VQTA 3N18A 4PFHA 4C6IA 3DEQA 3S1VA 1UR0A 2FKPA 3W6LA 2E68A 4ZXLA 1ECQA 4D6HA 3FA4A 2WXDM 3AZSA 1WZKA 1ICQA 2ZX6A 4LVFA 4ICNA 2VCBA 3PG8A 2J8GA 2ZE3A 2VCCA 5BWAA 2YBVA 2OXNA 1XH0A 2YB4A 3PTQA 3SECA 3TJ4A 4KH2A 4IGSA 3B8SA 1JR1A 4Z1YA 3QR1A 3M4HA 5C7HA 1KKOA 1RP8A 3EX6A 3MJMA 3JR2A 1RUSA 3E5BA 4AXNA 1UUOA 4DNHA 2D20A 4K37A 1NH6A 2EJAA 2GVGA 2NV1A 5JMUA 1KRBC 1YW1A 5AHNA 2P3ZA 2OWXA 1M65A 3L7RA 3NQ7A 4M1BA 3CPGA 1M7XA 1CGVA 4D8AA 4DJDD 2Q6ZA 3GXIA 3NQ6A 2ZUVA 4QR6A 4LRTA 2QJMA 4NX5A 5CAKA 3AUOA 4LUSA 3MVTA 4ILSA 3CXOA 2XIIA 4Y9OA 2ZRXA 3P60A 3W38A 1I2NA 1M41A 4YWSA 1H7PA 1GJWA 1YTDA 1ZENA 2FB2A 3N15A 3R58A 1ZCCA 2Q3RA 4QBXA 2CWXA 2XGBA 2VEFA 1CI1A 2OWWA 3TWBA 1TB3A 3PSVA 4JIIX 4W8LA 4J2PA 2WSRA 1TV3A 2DUZA 3GHUA 4JCMA 3W23A 5I06A 3UR7A 3FA3A 1X1NA 1EH9A 1KGUA 4FSAA 3ARTA 4KWVA 1PTGA 3TN5A 4S2CA 4L9XA 5I24A 3OEXA 3H54A 3ZFHA 3WBAA 7REQA 1T99A 3TYEA 3MUZ1 4L4PA 3QW3A 4Y8FA 3N14A 1CX9A 2QS8A 1PO9A 1TWWA 1Y8BA 3FYPA 2YW3A 3WEMA 1S5NA 2XJ7A 3C2FA 4YTUA 3LLDA 3B4YA 4MB1A 3VOIA 1RY0A 3NQFA 4OJYA 1Q7ZA 3BJSA 4LUYA 3WX7A 3BLEA 4ZGYA 4C60A 1LLWA 2GSHA 4A8NA 3LENA 4EKJA 4JNYA 1DJXA 1TA3A 2ISFA 3G1SA 1E6QM 5DBUA 3WUEA 4Q7IA 1A50A 1YBQB 4JS3A 4GVIA 2DQXA 1E9YB 3RFAA 1IQ8A 1LF1A 3N9KA 1UMLA 4L1XA 2V81A 1I75A 4XZWA 3ZR6A 2QUMA 1F8IA 4XKYA 1KQZA 3TYCA 4K1GA 3W1UA 3UA3A 1A5NC 4CNPA 4MWAD 2GVEA 5KZMA 1W8SA 1DQXA 2CC0A 4LH8A 4LY8A 1HO4A 1UZ1A 5K2ZA 2PU1A 4GO8A 3UR5A 3L4UA 2F8QA 1VBRA 3GSMA 2PDLA 2XIBA 1EFZA 3QGVA 5A6AA 1GW1A 3QSTA 4PEKA 4N9CA 3G0SA 3RR1A 1JQVA 1ZAHA 3H7RA 5D09A 2FHFA 1U83A 1Q8AA 1N8WA 1G6CA 3CUZA 1AH4A 5ABFB 5EL1A 3H2AA 2YCKX 3BTNA 5J5RA 2ABBA 3S1XA 3W7GA 4HPGA 2ZZ7A 3TW6A 4KCVA 4UTHA 2QMJA 3OHIA 3EZ4A 4KERA 4P5UA 4QISA 1G4SA 1XIBA 3O63A 2VNCA 2OG9A 4WDUA 3QQ0A 1D9EA 1EJRC 2D23A 1X39A 4HMDA 1OFOA 2VGIA 3SZ8A 4BF5A 3MP3A 2DEPA 1YDYA 1QNQA 4XUYA 1T8XA 1NF0A 1OC6A 3AO0A 4OT7A 4UTFA 4KFNA 3RNDA 1H7RA 3VZZA 4ZA0A 2J27A 2TODA 5LGXA 3KDNA 3W7QA 4PMJA 1Q66A 4KIRA 3C3UA 1OT1A 4JEJA 5IBXC 4LYRA 3A5FA 2XFFA 1V6VA 3MS8A 1E0WA 4KGLA 1QI0A 4MGGA 4YS1A 4PYSA 3BQ6A 1EF3A 3LNPA 3BSHA 1UC5A 3AXIA 3VKJA 4J3TA 1KR0A 3CEPA 2VR2A 3ARPA 4IL0A 1V3MA 2FPVA 2FJKA 1NWUA 2CLMA 2RAGA 2QGYA 1HVQA 1T8QA 1J5TA 5BXRA 5F7UA 1MUCA 1KBJA 2OGYA 3ARZA 4ZE4A 3M47A 4JFTA 3LHVA 4LVGA 3GUGA 4NZ1A 2PLKA 3BZJA 2HPIA 2CLHA 3WQ8A 2E40A 1IWAA 4Y9AA 3E96A 5TD4A 3F5KA 3UJSA 1W6TA 4Y6GA 3ZO9A 1BF6A 3U2CA 5HPOA 3SRDA 1O94A 3VNMA 2WZTA 1TZZA 1XYFA 4FEZA 3RHGA 2PF8A 1Y5VA 1WDQA 2ZRVA 1W2VA 4ZSTA 2HXTA 1CW2A 3ABZA 3DH7A 5CGMA 4ATWA 5GJMA 1XIGA 5DMLA 3I7SA 3GYEA 1V03A 1E9LA 1XGDA 1IHIA 3DYOA 4DJDA 4TMCA 1VBUA 4IP4A 3VGEA 2J7BA 2PDHA 4AY8A 3V36A 2UWFA 3S46A 1LG1A 3HOJA 5G1YA 4LCQA 4TX6A 4I7VA 1JGMA 1FCUA 3VIHA 1E0XA 1HFBA 1FP8A 3MYPA 1W3IA 1F2JA 3KE0A 4TX8A 1KW1A 5DEZA 3HMJG 3GBDA 1Q7QA 1RLDA 1H41A 3W26A 2VX7A 1XBVA 2ISVA 3UPMA 3ALGA 3BPWA 2Y2WA 3IVUA 1ZSXA 1VGAA 2BY0A 4QCFA 4GPNA 2QMKA 1EA9C 5BNKA 2WMJA 3VMOA 4URIA 4LALA 3LCWA 5D2XA 4RE2A 3QW4B 4IIEA 2JBMA 3CV7A 3CQ0A 1K6AA 4JNZA 1HP5A 2QUVA 1GOIA 3LGDA 3GNNA 4QG6A 4IT1A 4O4VA 4GZEA 3STEA 3SGUA 2QAFA 4GFIA 3W53A 3GXMA 2ACSA 3OP2A 3O6AA 5FF2A 1KC7A 1E4IA 2WVVA 3IVTA 3T2PA 3SSZA 2VVSA 4NJGA 3VOFA 4GYPA 3HGOA 3KX6A 3W86A 2W27A 4PULA 4HQVA 3EOOA 4GBUA 1SJAA 2HSAA 3V0UA 3N3MA 5HXMA 3S8HA 1RBOB 4AD0A 3EWCA 2YLAA 3GDRA 1WXJA 4UFIA 2WBKA 3PSWA 1I1WA 4HB7A 4S3EA 5HQEA 1EWDA 2C7FA 2NV2A 1JDAA 3TQPA 1H49A 1TG7A 4NZJA 1EJTC 2KZHA 2YZ5A 2ZTJA 3TFCA 5FJPA 3HPFA 1UWIA 1W1TA 3C0JA 3IJLA 3WQWA 3FOKA 1MZRA 1XLGA 3M0VA 5F4WA 2I9UA 2NW0A 4EE9A 3AALA 4AFYA 3LN3A 1OBAA 3NQ8A 1HJUA 4ADUA 1MEHA 2FHBA 5BXTA 4W7UA 2PDWA 1Z69A 1QAPA 4JHMA 1YNYA 1VENA 1CZ1A 5LXEA 1TE6A 2FGZA 4QSFA 8CGTA 1TJ1A 2BNJA 3VZXA 1ESWA 4OHQA 2QR6A 3UA4A 4QP0A 3BCFA 3ZVIA 3PWGA 3TH6A 3N1AA 3VK5A 3BOXA 1JPDX 4A22A 4AIBA 4D6IA 4PCSA 5F1VA 1SQ7A 2F84A 4ZE5A 4PR4A 3U7VA 2W62A 3WN6A 1G67A 2YBTA 2NX9A 5E6YA 4P7OA 1XQLA 4B5UA 1DWGM 2XIMA 3TN6A 3CQKA 4M7TA 3TROA 3MUXA 3RR4A 1J0YA 2A85A 2XGIA 2DT1A 1NP2A 1P6WA 2PMQA 3B8WA 4BFAA 2RGLA 4G56A 4C1NB 6CGTA 1OCNA 1JCJA 3WQ4A 2BY2A 1CIUA 1XBXA 2J7DA 3UVAA 2A3AA 2XSXA 2OZ3A 2JF6A 3URNA 4ZO7A 3LCFA 2DZSA 1HKMA 3GR8A 1GKPA 2CLLA 4B3ZA 3MUCA 5A94A 2OYKA 4BKNA 2WANA 3BARA 5CQ1A 2UBPC 3U2EA 1EIXA 4JFWA 1XIJA 4HA1A 4DHGA 1LTDA 1JCLA 1H7NA 3QPZA 4N4QA 1F9CA 3GIPA 3ITGA 3LQLA 1DJHA 5G4WA 5BRQA <