4WRHA

Akr1c3 complexed with breakdown product of n-(tert-butyl)-2-(2-chloro-4-(((3-mercapto-5-methyl-4h-1,2,4-triazol-4-yl)amino)methyl)-6-methoxyphenoxy)acetamide
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
316
structure length
316
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Breakdown product of N-(tert-butyl)-2-(2-chloro-4-(((3-mercapto-5-methyl-4H-1,2,4-triazol-4-yl)amino)methyl)-6-methoxyphenoxy)acetamide trapped in active site of AKR1C3
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 116
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4wrhA00
1EKOA 2IKHA 4IJCA 4OTKA 3GUGA 2FZBA 4QBXA 3G5EA 2NVCA 1S1RA 4LB3A 1ZUAX 2FZ8A 2PDWA 2ALRA 2PDCA 1ZGDA 1K8CA 4JQAA 2INEA 3RX3A 4JQ1A 4QR6A 4PUWA 2PDFA 1QWKA 3BURA 1AH4A 2HVNA 2IPFA 3CAQA 1PZ1A 2FVLA 4XAPA 4JTDA 2PZNA 2ACUA 2IPWA 2R24A 3M64A 1PWLA 1XJBA 3V35A 1RY0A 4ASTA 5AZ1A 4EXBA 3Q65A 4JTCA 3EB4A 2FZ9A 4YVVA 2WZTA 4LBRA 4WEVX 1RY8A 3V36A 4H7CA 2NVDA 1Z89A 3LQGA 2DUXA 1EF3A 4DBSA 2IKIA 4DBWA 4XK2A 1MZRA 2HV5A 1ZQ5A 3G1RA 4GABA 2ACSA 3VXGA 1HW6A 2IQDA 5HNTA 3FJNA 4I5XA 1FRBA 2R9RA 2PD5A 4JTQA 3M0IA 2PDUA 4JQ4A 4QX4A 3M4HA 4LAZA 3LD5A 3U2CA 4FA3A 2BGSA 1XGDA 2PF8A 4GQ0A 3DN5A 4IJRA 3EAUA 3GHTA 5JH2A 3R43A 4PRTA 1JEZA 3UGRA 1MRQA 3V0SA 1AFSA 4FALA 2PDJA 3D3FA 5HNUA 5AZ0A 2A79A 2QXWA 3UZZA 2PDGA 2PDPA 2CLPA 2DV0A 2FZDA 3UZXA 4YS1A 2HDJA 1Q5MA 5LIWX 2ACRA 4YVXA 3R58A 3LBOA 3CMFA 4HBKA 3UYIA 3LUTA 4WDUA 2BP1A 3LZ3A 1PYFA 4F40A 4LAUA 2PDIA 1S1PA 2HVOA 3ERPA 3CV6A 1J96A 4HMNA 4JQ3A 5KETA 4WRHA 1SM9A 3H7RA 4GACA 3WBYA 3EB3A 4GIEA 3CAVA 2PD9A 3WG6A 3LEPA 1IHIA 3UG8A 3GHUA 3BV7A 3H7UA 4XO6A 1ZSXA 4XO7A 4AUBA 3Q67A 2PDQA 3NTYA 1LWIA 4FAMA 2INZA 2BGQA 2PDHA 2VDGA 3COTA 1AZ1A 2HE8A 3N6QA 3R8HA 1ADSA 2ISFA 4Q7BA 1AH0A 3WCZA 1EL3A 3LNMA 3LQLA 1S2CA 4JIRA 4XVDA 2FGBA 3GHRA 5JH1A 1QRQA 1EXBA 1YNPA 3BUVA 4YU1A 4JTRA 1Z3NA 4NKCA 3GHSA 1PWMA 3MB9A 4JIHA 4JTAA 2IPGA 4WDXA 2F38A 3O0KA 4ZFCA 2WZMA 3O3RA 2PDLA 3QKZA 4G5DA 1VBJA 1AH3A 3RX4A 1M9HA 3WBXA 2HE5A 3R6IA 1MI3A 4PUUA 2PEVA 2PDNA 2P5NA 1Z8AA 1AZ2A 4YVPA 2I17A 3ONCA 3V0TA 1XF0A 3ONBA 4JQ2A 4XZHA 4DBUA 1VP5A 1YE4A 4JIIX 2J8TA 3LZ5A 2AGTA 4XZLX 1HQTA 1C9WA 4R9OA 3P2VA 1UR3M 4L1WA 1GVEA 4PMJA 3WBWA 2IKJA 4GCAA 4XZNX 4XVEA 3H4GA 1R38A 3N2TA 2DUZA 4H8NA 1X96A 4WGHA 2PDKA 2HEJA 3R7MA 3CV7A 1PZ0A 4PRRA 5LIKX 3KRBA 5LIUX 2IPJA 3MC5A 1LQAA 3F7JA 3LN3A 1YE6A 4Q3MA 1Z9AA 1RALA 4MHBA 2PDYA 5LIXX 1X97A 3S3GA 5LIYX 3R8GA 3RX2A 1X98A 4ICCX 4EXAA 3V0UA 4RPQA 2IQ0A 2PDMA 1YNQA 2I16A 3DOPA 1S2AA 2PDBA 3LENA 4PR4A 2C91A 3BCJA 2ACQA 3FX4A 4QXIA 2IKGA 3UZWA 4LBSA 4XZMX 1OG6A 5C7HA 4GQGA 1T40A 1Q13A 4LB4A 1US0A 4WDTA 2PFHA 3B3DA 4GA8A 5DANA 3UFYA 2PDXA 4IGSA 2F2KA 3C3UA 1A80A 5HA7A 3CASA 3T42A 3UWEA 4DZ5A 3UZYA 4FZIA 1T41A 4L1XA 2IS7A 3R94A 4WDWA 3UP8A 4XZIA 5M2FX 1IEIA
chains in the Genus database with same CATH superfamily
2VR4A 5JMUA 7PTDA 4GISA 3E0VA 5CXPA 3FXGA 3GFXA 1L0PA 3GDMA 4M3PA 3WFLA 1TA3B 3IWPA 3VMPA 2CZEA 4JTKA 1XH2A 4UTLA 1GW1A 1FWRA 3EOEA 1CB7B 2NWRA 3G0SA 3CQKA 3RU6A 3MUCA 3G1XA 4GC4A 4RV3A 1EBGA 2PZNA 1YRRA 4F8XA 3U2ZA 3UYCA 3TR9A 4F9DA 3K5XA 1U1UA 2YB4A 3WMBA 1WXZA 3TJIA 3FGCA 3CB8A 2VD9A 1Q7ZA 3CMGA 4HYRA 1XV8A 4JTCA 4ZMGA 2X0YA 4XV0A 4DWSA 1TRIA 2W67A 1JCMP 2QDDA 1F61A 1V0KA 3KBVA 4RXGA 1PHWA 2XFWA 2G8ZA 1DXIA 1SO4A 4IQDA 2WPBA 3SBFA 1GOQA 3LQGA 5A8NA 5CBIA 4OVXA 4ZENA 5CCZA 4XIMA 3UA4A 3GH4A 2YFNA 3CZEA 4GH1A 2V0TA 5HULA 3BDKA 3U4FA 1XINA 2PDUA 2G4JA 3H23A 2UBPC 3CS2A 4S39A 4ZE4A 3G18A 3O6YX 2XVNA 1P6BA 1GVFA 3W38A 1X6NA 3LGGA 2A4AA 2BX7A 1R0MA 2GZXA 2I9UA 4DN1A 3WK1A 3UGRA 4DBEA 1DQWA 3CHCA 3O0FA 1KBKA 4CQDA 4G2DA 1KD0A 3ZT6A 1BRLA 3CZKA 1UKQA 1K4HA 2ZQ0A 3A64A 4KWOA 4YS1A 2AKMA 4E4UA 4Q32A 2I14A 2V68A 3TVAA 2O9PA 4YVXA 1KBBA 3USBA 6REQB 3DGBA 3SUVA 2NVAA 1QAPA 1LT8A 3SJNA 1E51A 1XLMA 2Q3OA 2FMNA 3PWGA 3MWAA 2UY5A 4HCDA 4ZE5A 4E2VA 2OEKA 3NWRA 1I2RA 4R27A 4LUSA 4GGBA 3ZO9A 3W1MA 1W5NA 5D02A 2HSAA 4RNJA 2J9ZA 5D2TA 4GWEA 3VZZA 1P7TA 3FVDA 3GHUA 2W61A 4BJHA 5DMYA 1K7FA 3AHZA 4GINA 1ISWA 1BWVA 3LTYA 5BROA 3W7CA 2CU0A 4PBFA 3FFSA 2PMQA 3W83A 4XD5A 3WFAA 2PDHA 1WXYA 3O9NA 1HGYA 4WSKA 3EWCA 1HGWA 3DKLA 4H9MA 2G37A 3BOXA 1G94A 1IT7A 1G67A 1AW1A 2C1HA 3QKEA 3E2RA 3H26A 4GUHA 2WVVB 1JUEA 3WIJA 1AG1O 2WVTA 3MHUA 1XPGA 4WY0B 1NFBA 4Y9AA 2J6VA 3GUWA 4EF8A 2V5KA 3OHMB 5SWUA 3G1VA 4Q7IA 3P67A 5A94A 4H8UA 5DLCA 2X2GA 5U7SA 3HA1A 2V2CA 3PZGA 3VGFA 1T0OA 3R12A 4OV9A 2VRKA 1GCYA 2HE5A 3OODA 4MNLA 3V3WA 1LL7A 2XSXA 5LXXA 3NQ7A 2WNQA 3ARPA 4AIBA 1C91A 4CNNA 3LV5A 3QRHA 5I0DA 2BOGX 1JZ6A 1RHCA 1JGMA 3EOUA 4HSOA 1OIFA 1YDYA 5A6KA 2VUYA 2E1WA 3H54A 1TMHA 1X6LA 2KAUC 4JPGA 1C9WA 5DCBA 1SZEA 2B81A 1UR3M 1OYAA 3OGVA 4L1WA 3WQ6A 4G7EB 4E6MA 5C54A 3CU2A 2O7SA 1XDMA 4XAZA 3O05A 1ICSA 3WBWA 1FDZA 3NR0A 1FWJC 3M44A 3H4GA 3F5KA 3W1LA 4FSAA 1V08A 2PWEA 2YBUA 1EGVA 2QCDB 1UC5A 2D20A 1EJ7L 1DJZA 3QYSA 4AYGA 1V03A 1WUEA 2IPJA 1XX1A 2Y5EA 2WHLA 3CK5A 1S5WA 3HG5A 2ISSA 2CBJA 4GC3A 5CBBA 2ZXDA 4L80A 5KZMA 1TVLA 4AC7C 5CSYA 4NZ3A 1PBGA 5E6YA 2DIKA 3PF3A 2ZXQA 3LN3A 3MY9A 4JFUA 3EDDA 2WBGA 3PTKA 5MHBA 2EQDA 2YA1A 2YJQA 3SUWA 5H8MA 1ADOA 1X98A 2PZ0A 1RP9A 3MUZ1 4ICCX 5D09A 2XH4A 1FUYA 2G3JA 1QW9A 2ZADA 2XJ7A 2NQHA 3BG3A 4S23A 4ERIA 3TP4A 1Q45A 1LQ0A 4RXFA 3S1XA 4JKLA 1IIHA 3VZXA 1G1YA 1V3KA 3U5UA 4RL3A 3V5FA 4HK6A 1A47A 1JUBA 3P8IA 2WMJA 5K9DA 4U2ZA 1ONWA 2PTXA 3MPGA 3E2SA 3QEZA 1YHTA 1RBLA 4ZCWA 4B15A 4XIAA 5J5DA 1KGUA 3CYVA 5JXQA 3UFYA 4Y8EA 5HMFA 1YMYA 2F2KA 4B4HA 1P6CA 3Q45A 2VVNA 2PWVA 3BANA 3UZYA 1T41A 2PI6A 4NXSA 2WKJA 5JQ9A 4WDWA 1V51A 3HF3A 4XZIA 5CAHA 1IZKA 4IJCA 3O7UA 1V8EA 3TQKA 4IFRA 1GOXA 3GVGA 4AFYA 4CNUA 4CU8A 3ZMRA 4N42A 3RPTA 2FZ8A 4PYSA 5KMYA 2ASHA 3QQ1A 2MNRA 4JQAA 2VENA 1EIXA 3THAA 2WMIA 3KZPA 1SMDA 3FNDA 4PE8A 4NUWA 1UQYA 2HVNA 2FTYA 3CAQA 1JD9A 1S2VA 2WMGA 3TC7A 4UWMA 2XH7A 4K1WA 3VTRA 1T5AA 1AK5A 2WJZA 3PZVA 2J7DA 3BO9A 3PZQA 4GX8A 2EPNA 2GWGA 3Q58A 4Q6XA 4W9TA 2Y1HA 2EPLX 3UJEA 4QROA 4IPJA 3ZWTA 4O4WA 1OZMA 4TUFA 5H6HA 2CLFA 1EJRC 4PMNA 1E1EA 3EXSA 4JY8A 1H7NA 3TUUA 4X3ZA 5FF2A 1KGWA 1PJ9A 3T44A 1EF3A 3LG3A 3MYPA 3KXQA 4AD2A 1W9VA 3M0LA 4CCEA 3KP1A 3CUGA 2X1UA 1L9WA 2IQTA 1O5RA 5DMNA 3HV9A 2OZTA 1YXCA 2PP1A 3A5VA 3WH5A 3VIIA 4Q4SA 2G50A 2WSPA 1MMFA 3M0YA 4OFCA 3ABQA 3QXBA 1R3QA 1OVDA 4QLKA 5BXSA 1O66A 1IT8A 1A5MC 1DJNA 3TLLA 1FQ0A 1JJKA 3CEPA 1OABA 5D32A 3GDTA 2XIOA 3CHVA 5K9CA 2ZTJA 1MFVA 2Z26A 2A2IA 3AS0A 2WCAA 3BXWA 3LRLA 3USZA 3AJXA 3LCWA 4JL1A 3T2OA 3DDMA 1WXJA 3SFWA 3AIRA 3UWWA 1S38A 3K4WA 4QAWA 1LUCA 5E0CA 1J0KA 1GQIA 1I45A 1FWSA 1ZAHA 4DWSD 1Q7MA 5DXYA 3G1YA 3QHMA 1GVRA 1DQUA 3T6CA 3UZZA 4GD0A 1JDCA 1BYBA 1CYGA 1KCXA 4MWAB 4Y9OA 3UYIA 1B9ZA 2FHCA 1UBSA 2UY4A 4NYUA 2R1KA 3AROA 4CQBA 2BDQA 3DYOA 2OG9A 1LQ2A 3WQWA 3RN6A 1GKPA 3U4AA 3RCNA 3EB3A 1VIZA 1P0NA 4IG2B 1BTMA 3MUXA 3WFZA 1UP3A 5D30A 1FH7A 3UG8A 3BV7A 4JTJA 1M7OA 4JICA 1LORA 4C6BA 2ALDA 3UXIA 4GIAA 3PPFA 1PIFA 1BGGA 2Y7EA 2F6XA 4GNVA 3WENA 3FVMA 1LWIA 3W74A 2Q8LA 5AN7A 4UBPC 5EMYA 3NQ6A 4FF7A 4FEZA 1X1OA 1J01A 3BW4A 4F0RA 2WCGA 5KZDA 3WQOA 3EOLA 2VL4A 4UR7A 5I3KA 4MAVA 2XG9A 3NURA 4RUBA 2E8ZA 5JH1A 1W5PA 2F7FA 3BUVA 2BVDA 5AHIA 3V1PA 4HPNA 3SZ8A 3W7DA 2GL5A 2H9AA 1EHNA 4JTRA 4GXMA 1DJGA 2XN2A 3EWBX 4GI9A 3H2MA 1HJSA 4DO5A 2RHGA 2WLZA 3GY1A 5C70A 1R47A 4MVAA 1BG9A 4XKMA 4ZFCA 5BU6A 3PUGA 3VD7A 3QTGA 4B5TA 3HG4A 4IL0A 2JF7A 4JTGA 4BHYA 3TK7A 3APGA 2XH0A 2AAAA 3MKKA 1PTDA 4HNOA 2BXYA 3CV2A 2O9TA 4ML9A 3SCQA 3SIZA 1XRSA 3S6OA 4L9ZA 3SY5A 4QE5A 2RUSA 4LS2A 3DC8A 4BEUA 4S3FA 4XZHA 5FAGA 4ZTYA 1HL8A 2CW6A 1EH9A 1V79A 1EX1A 1YE4A 3IVUA 4GBDA 4Q6JA 2Z2BA 3WYZA 3W2UA 4S38A 3P2VA 1J5TA 2WQDA 4JTFA 3OQEA 2OQYA 3VDAA 1Q7QA 4NF7A 4YPJA 4HTYA 1OX6A 2TPSA 1QXLA 1LLZA 2IKJA 6A3HA 4GCAA 3WD3A 3AZRA 5IDZA 2HCVA 1XLGA 3IUIA 3GVRA 2CHNA 4CQ8A 2YCLB 2BY3A 1K8XA 3WLJA 3E3HA 3B8WA 3O6DA 1CBGA 2FLIA 1BKSA 1MSSA 2EF9A 1WDQA 2FH8A 2KX9A 3AOFA 3DENA 1JZ7A 2WMKA 3TOYA 2ZVRA 4JL2A 2WSKA 3N73A 4ADUA 3G1HA 1RH9A 3VZYA 2W27A 3LLDA 1RALA 4IIGA 4QG8A 3REQB 3CZ8A 3VD5A 1RAKA 4RLIA 2D22A 3SECA 4QSHA 1ZBWA 5LIXX 3CPGA 3RX2A 4HU4A 5K9XA 5EMMA 5TIMA 2ZC8A 3OPSA 3P6LA 2H8ZA 1HO1A 4MGGA 2WOQA 4Z1DA 4QGCA 1KRCC 5DT5A 4B5SA 4O16A 5BU9A 4TX8A 3NXLA 1LDCA 3C61A 4E3TA 1H09A 3CAWA 3HJZA 1NOFA 1Q4WA 3BCJA 1KCZA 3WLQA 3FX4A 1FWDC 2WQPA 1EWEA 3EMQA 1PL9A 2NQ9A 2OSYA 4XZMX 4NX5A 1U2YA 2VZOA 1X6UA 2QPSA 3HPZA 1V6XA 1A53A 2E6AA 2V3EA 1A80A 4EP8C 1OK6A 1SVDA 4MSSA 1SFSA 4I6KA 4PB5A 2VOTA 1YADA 1IXQA 5T9BG 3S5SA 1FP9A 3P80A 3W1XA 2VZTA 3HU7A 3WDJA 4W5UA 5M2FX 1KBIA 4DZAA 5EPDA 3I6TA 4FNUA 5CPQA 4U3AA 1ONRA 4B9YA 4HA0A 3NQGA 3W1TA 3GXNA 3M0VA 5JU6A 2NLIA 1ZUAX 4QS5A 4OUIA 1XBZA 1TPWA 1U5JA 3GC4A 3BURA 3TQVA 4IP4A 3O8AA 2VD8A 4D8ZA 1PX3A 3L12A 5CH9A 5A5WA 3KS5A 3QMRA 5HMSA 4LV4A 2HQAA 4JTDA 4L56A 3C2RA 5BXPA 3NQBA 3R89A 2OQHA 2W9MA 3LHTA 2V38A 4KESA 2RJHA 1UIPA 3BWWA 1PV8A 2Y85A 4PA8A 3GG0A 2CKSA 5G1MA 1TV7A 4ACZB 5FACA 5D33A 2E0PA 5G4EA 4RZBA 4IQLA 5BOEA 2UY3A 3WF3A 3W2MA 1ZB5A 2PB1A 3PG8A 5GJMA 5EFFA 3RR1A 2DZUA 5ABGA 1XLCA 2AQVA 2NVDA 4UCGA 1Z89A 1BFNA 2A3AA 1Q63A 3QQ0A 4M0XA 4DBSA 1B90A 4GZ7A 2X7VA 2XN1A 3KVJA 1BLIA 4QP0A 1DJWA 5BXRA 5C5YA 3LBCA 1XIDA 4QITA 6XIAA 3U2EA 3EA1A 4C1NA 5BRPA 3WL0A 3A22A 4E8GA 3GX9A 1QI0A 1XD0A 2R14A 2ZDSA 4GZIA 1XI3A 2E77A 2PF8A 5BOOA 3F1QA 1ZCCA 3GU2A 3MWCA 4MNKA 2BFGA 3WH9A 4MB3A 1JYWA 3A13A 4PRTA 4D71A 3BCFA 3BLFA 1W1ZA 1POKA 1F74A 1E71M 1ITXA 4AX7A 4DJFC 5FF0A 1X8CA 1D3GA 3ZVHB 3ATYA 3D0CA 3R25A 3NEVA 4N7QA 3B8DA 3LHYA 1NWSA 3AIVA 2PDPA 4DYJA 4HP5A 3CTTA 1QNVA 1EYWA 2Z7KA 1JDDA 4EXQA 1MNZA 4WXYA 1XQLA 3CIXA 2JBMA 4XD4A 1GVOA 2W63A 5LGZA 4DJED 3UXDA 2ZZ3A 1PKLA 4JXCA 3GNDA 2DY3A 3GO2A 4AIUA 4ZSTA 4C6OA 3TYEA 3PZMA 5LNRA 3AFBA 4D6EA 4QJ4B 1OBAA 3DAQA 3LEPA 3SB0A 3WG6A 1UH3A 4NNAA 4Q8WA 1ZAIA 4RKAA 4X2PA 2O4MA 2PWDA 3BQ6A 5H1WA 4L6DA 3AXMA 3CUHA 4K68A 4CD4A 4IMEA 1OGSA 4M7TA 4DRSA 4IF2A 1A5OC 1XBXA 5DO8A 2GK1B 2ISFA 2V3FA 1AH0A 4YWSA 5HAOA 5CC5A 1EL3A 1JCJA 2A1YA 1JRBA 2PWHA 3KRSA 1EC9A 1KTCA 1UUMA 3DKJA 3NDYA 3G24A 3FA4A 4DXXA 3MZ2A 4WLCA 5D37A 4C6FA 1R6WA 4IX2A 2O7QA 4IUOA 2IW0A 2WMHA 3AHTA 4JNMA 3VABA 1MQPA 1IWPA 2R82A 1Q6RA 2QDHA 1N82A 3VIKA 4P8WA 1WV2A 3O3RA 4GI8A 3RIKA 3WBAA 3THCA 3KOFA 5CPMA 2X30A 1MI3A 4CNTA 3POCA 1G4SA 1O7AA 1JF5A 1NAL1 1TUFA 3V1HA 4ONVA 3WH6A 4DPPA 5EFDA 4EWND 5D03A 4JTLA 5FF3A 3H2FA 3ONBA 4GIRA 3OVGA 1QCWA 2AQWA 3WNKA 3ZLGA 2WHMA 2QJMA 3NQDA 3HQ1A 4EACA 3SCUA 2P8CA 2OO0A 3MSRA 4XSLA 5D9OA 4LF1A 1WOBA 1XLJA 2Y0FA 1SUXA 3SI9A 1JAEA 3K8LA 3APYA 4A22A 1E6NA 3V7PA 1R38A 2OVLA 4IHCA 3F4VA 1OD8A 1V5XA 4F0HA 2DUZA 3NVTA 3WEOA 3DZ1A 2C16A 3BAYA 2POTA 4RNIA 5F7UA 3IIXA 2Z7GA 3VGEA 1C29A 4RDYA 3C0JA 4TOQA 2HBVA 3P84A 1LQAA 3R1ZA 5MF5A 4Q4MA 6TIMA 2PTDA 2P3EA 3UWUA 4RPPA 2GVLA 2C8NA 4FNQA 2PRMA 2Q71A 5G2HA 2A3LA 1GHRA 5HMEA 3I65A 3UETA 4AVFA 5CPLA 2I7GA 5A8QA 4QG9A 1FWFC 4ZQNA 2FGLA 3T08A 3N34A 1AJ0A 2J47A 5A6JA 3WLRA 1EPXA 1MW2A 2I56A 4NNBA 1BTCA 5K7JA 1TJ2A 1VBGA 4LB4A 4WVXA 2I5IA 4DJFA 2PFHA 1OCBA 5I07A 5I24A 4UQEA 3WBEA 4OE7A 3A3WA 2OCZA 3W22A 1EDQA 2Z29A 4O1AA 4BF9A 8XIMA 2Z6JA 3L4XA 1QHOA 1OADA 4MNMA 1CB2A 3A4WA 3O6AA 4C7FA 1JG9A 1GJPA 3KBMA 2TODA 2VHLA 3GUGA 5FL1A 4P8UA 4HHLA 4ORMA 2W6RA 1TJ1A 1Q6FA 4X0NA 4BQ4A 1SO5A 3WNPA 4AXNA 3AUOA 4MZYA 4A8LA 3EB2A 3SCSA 3RX3A 1CECA 1VJIA 2XFYA 4ZVJA 4QTGA 4C6LA 1XIFA 4S2CA 3LY0A 5C2XA 4AW7A 1YDOA 1BQCA 2BY2A 3WLNA 3SGUA 2ZZ6A 4PEEA 1H7RA 3URBA 3BJFA 1NARA 3NIYA 1ICPA 2ACUA 1R86A 4PB4A 4XUGA 3NZQA 1M03A 4R33A 1SJAA 1DJIA 2GJLA 3RRXA 3WMCA 1HL9A 4HCLA 2J75A 1YBQB 3W1RA 2PLCA 2NSOA 3ZJKA 3EWUA 5HJLA 2VWTA 3IAQA 4FB7A 4IFOA 2WKGA 4GVGA 1ITQA 5DMMA 1GYNA 3I4EA 4H7CA 1A0CA 1YPFA 4LCQA 3TTOA 1ITCA 1OJXA 4D2JA 4DNHA 3TYAA 4GUJA 2IKIA 3M46A 4GUGA 4XK2A 1SW7A 1W6TA 4BEQA 4N6FA 1WX0A 2ZZ5A 1XG4A 2Y7DA 3VXGA 3BJTA 2OGYA 4MWAE 1HW6A 3KOYA 1IEXA 3XISA 4I5XA 4I6VA 3ZQ9A 5MKGB 1OSEA 4FX6M 3LXAA 3KW3A 5K4XA 3VOFA 4LAZA 3LD5A 1W0MA 2A7RA 2EG7A 3U2CA 3ZR6A 2BVYA 1TPDA 1DHKA 2VEIA 4O1CA 3WDRA 2E3ZA 1WAUA 3JUGA 3CB3A 3DN5A 4H7VA 3AI0A 4J7RA 3GBDA 1W2VA 1HKMA 4HIBA 3W81A 4B3KA 4PSRA 5GJNA 1WPCA 3O1NA 3GU9A 1JPMA 4JIQA 3IIVA 1MDLA 2Z4GA 4ZXLA 3H21A 4R34A 5CKSA 2OMAA 2QKFA 3I4KA 4E2OA 7XIMA 4CD5A 1RBAA 4GNJA 4NJIA 1Z32X 1EC7A 3TAOA 1VCGA 4HVXA 4UOZA 3GDRA 3RILA 3OTRA 2F2HA 2UZ9A 4RE2A 2BP1A 1DWGM 1KW1A 4QLJA 4AH7A 3N2BA 4F40A 4M7SA 1KKRA 1NTHA 1OF8A 3TEVA 1E9YB 1J12A 1OINA 1GG0A 1FBAA 4UIOA 5KETA 1PIIA 4BI6A 4GFIA 3FA5A 2JE8A 4BA0A 3H7RA 3NQAA 4UTTC 3VKJA 1QW7A 3IK2A 2QPXA 4FP1A 4PTWA 4J1OA 1C93A 3G3DA 3RK8A 5BRBA 4KIEA 3OOQA 3BAWA 3H7UA 4ZEPA 4C6MA 1XSKA 4L9XA 3T4CA 5FCZA 4FLSA 4D1IA 2P10A 3W7QA 1E9ZB 1A5NC 1QJWA 4QQUA 5GQBA 3GW3A 1FXQA 3MU7A 4Q4OA 4DXKA 3KBSA 5A2AA 1DIOA 2VURA 3EBVA 1JZ4A 1QOQA 1CGTA 1YNPA 2VEFA 2VFHA 1LBFA 1GJUA 4W87A 3NL3A 1TPFA 3BMXA 2C19A 4DUOA 1VBRA 2O9RA 1LZOA 3LGEA 3HQNA 2XIJA 3DU0A 1XGZA 1XLFA 1FWIC 2F8QA 2CWXA 4JIHA 3TJLA 3U3HA 1F5ZA 1YLVA 3WQPA 2ZUMA 2OZ0A 4IXXA 1V6YA 4PTNA 1FXPA 3RX4A 1O68A 3H6OA 1OT1A 4C7DA 4MOZA 1UZHA 4GZEA 2X05A 5F1UA 2V5JA 1XF0A 1KXQA 5HBFA 4JQ2A 4CD7A 2E1DA 3K1GA 1YXYA 1TPEA 3P7YA 3ZLFA 3NNTA 4LEFA 2J8TA 2XM1A 1N55A 1H50A 3A12A 3ABZA 2PPGA 5FF7A 3OW1A 1ZL1A 4AZ5A 1ZS2A 4J2PA 5JBFA 1AQFA 5AYBA 1GVSA 4ZODA 2E28A 4PUNA 1W1YA 2VCBA 4IGMA 1V02A 2YKKA 4UTMA 4REQB 2J4GA 1W2PA 2OT1A 2PU0A 1FHUA 3XIMA 1HL2A 1JCNA 3MHGA 4KERA 5HINA 5IHRA 3KRUA 4ORIA 4PRRA 3W6YA 4LUJA 3VI2A 4CQAA 4MB5A 3WNNA 1Z48A 1UR1A 3KX6A 3ARSA 3TR2A 3U7VA 4XG1A 1W1VA 1ZBCA 1MEHA 3K1DA 1B3YA 3EKLA 2YA2A 3EDFA 2XGZA 4AMCA 2ON3A 3CWHA 4O0KA 4OT7A 1E72M 1M01A 4G8TA 1JPHA 2YW3A 8TIMA 2XZ9A 1X1NA 4LY4A 1H0IA 5AC6A 4RZ6A 1D8CA 1QATA 2DT0A 1FCBA 1A5CA 1T8XA 4D1JA 3WLHA 4ZR8A 2FMOA 3GDKA 2FB3A 4O0ZA 1YNQA 1PVNA 3CWNA 3TFCA 1XKYA 3RM8A 1Q6OA 3UY7A 4AHOA 4RV8A 4LBSA 3W6LA 2I5QA 1JCTA 4QS6A 1NDVA 4O13A 1W5QA 9XIMA 3CJPA 4I5UA 2YCEA 4MFDA 3WDPP 3MYOA 4XTDA 1SSDA 4PMZA 5T9CE 2C7FA 3AUJA 4PCNA 4PTXA 1UMYA 3GG1A 3THUA 4E8DA 1A0EA 4YLWA 1J0YA 2OOGA 3WJYA 4YHEA 4JDYA 4I90A 1LP6A 3TN5A 4B5WA 1PZ2A 4O57A 2FZBA 2J79A 3F5LA 3G5EA 4YL2A 1UHVA 5D2WA 1EA0A 2QCLA 1Q6LA 1KCLA 2NUWA 3TA6A 3TONA 2QMJA 2VUNA 4UMAA 3STGA 1ZGDA 3H70A 1QWKA 1ESWA 4X9SA 5LKYA 2KZHA 4UTTA 1K7EA 3SIMA 2FVLA 4AWTA 3VYLA 2REQB 4NL1A 3CL8A 4GYFA 4H04A 4FMVA 1EGMA 1LRNA 1S5TA 3W25A 3MMDA 5I5RA 4WIWA 2EPOA 4AWSA 4GPNA 4L7ZA 3KTXA 1W3HA 3LCHA 3ZJ8A 2A3EA 1PSCA 1J9YA 5FOOA 2FZ9A 4YVVA 4JCMA 3ZFHA 1LBMA 4C6DA 3VNMA 1AMKA 3O06A 3PN8A 5FEXA 1OFAA 5FSEC 1TE6A 4FR1A 2CIPA 4HA3A 2NV9A 2CLMA 1MZRA 4IH3A 3WUGA 1V3MA 3L2IA 1ZQ5A 1FP8A 3BV4A 2A5HA 4JTIA 3ZVHA 3FJNA 4JHZA 3GG8A 3PUOA 4ROQA 1QASA 5BXTA 3AS2A 2WSYA 1A4LA 3A6OA 2CBVA 2GDUA 4FA3A 1ZTVA 3RM9A 5C55A 1P0DA 5E70A 1W31A 3UWQA 1HT6A 2CLHA 2ODOA 4PBEA 1YXDA 4A21A 4KWVA 1E1CA 3MZNA 3R43A 4QAIA 5GJPA 3V0SA 3LSCA 4DAFA 1Q6EA 1UUOA 3W0KA 3QSTA 1O5QA 3P5ZA 5AZ0A 2NUYA 2JKAA 4BF5A 5A8GA 4C60A 1QR7A 4AZ7A 1GOIA 4QEHA 1BQGA 2DQXA 3PB0A 1P1XA 2BHYA 2HDJA 2ZRZA 3S5ZA 1F6KA 1HP5A 3GH7A 3LBOA 4UFHA 4GFSA 3I7RA 1DP0A 3WF2A 3ORWA 3WUBA 1CXKA 3QPZA 1R3YA 1W9PA 1OFPA 4L4OA 4IGHA 3M5YA 4PUJA 1SM9A 4MWAD 3LCLA 1I2PA 5EA9A 4MKVA 2QCMA 5DT7A 4DZHA 2ZZ2A 1OFEA 3OGSA 4XBSA 3RG6A 2WWCA 1LL4A 3AXHA 4JR5A 3Q67A 3S9YA 1IQ8A 3HIJA 3WLTA 3FAXA 1XYBA 4X9YA 4O18A 3LPGA 3LMZA 2ADAA 2P0IA 3ARUA 3LNMA 2A6NA 3SN4A 3CIWA 3WY1A 5I3IA 3RLVA 1H1ZA 1Q4NX 1KQYA 2WMFA 2EO7A 4A3HA 5AFDA 3NL5A 5B7YA 3GSMA 1CXHA 4TV6A 3VDGA 3IGXA 2OYMA 1F05A 4JTAA 4AISA 3ATZA 1ZP4A 3RHGA 1BHGA 3HMCA 2WM0A 3V4BA 3R6IA 3BCDA 1MQRA 4BI7A 3VAVA 4MFEA 3RCMA 1BVZA 3L4ZA 4K8HA 3U2OA 4GGHA 3FLUA 1XPYA 3WQGA 1DHPA 1XYLA 3H53A 1CGUA 3TMQA 3O07A 4UQAA 2OWXA 1YEYA 4XX6A 2DUAA 2X16A 2FHFA 3ZVIA 3SN1A 1GW9A 4YMZA 1I2OA 1A3WA 5HNRA 1ZENA 4R7OA 2X1IA 5C9ZA 2WYSA 3VX1A 1F3WA 4QE4A 2BXZA 1TG7A 3VPLA 1TPUA 3GG7A 1KFCA 4D8AA 4N9BA 2ANUA 3QZEA 4V33A 3WLIA 3G3MA 2B7NA 2X8RA 2YLLA 1TV2A 5DN1A 4IUGA 3TSBA 5E0FA 2ZX8A 4PZVA 3N6HA 3L4WA 2O55A 2HEJA 1J6OA 4KPLA 2VC6A 2OODA 1S5MA 1L6YA 3H4WA 4DI8A 1PZ0A 4LAKA 3CTLA 2TAAA 1G4PA 4WKFA 1JPDX 1UJQA 2OO6A 1POJA 3TCEA 1J8VA 3NQFA 1DKWA 3N18A 1JYNA 1K77A 1UJPA 1OC7A 4FOUA 1EEXA 1HKWA 1XG3A 1E43A 1Z9AA 1ECEA 3SW6A 2YDSA 3QFEA 3LHUA 2CHOA 2CKRA 4O4VA 5PTDA 1XYAA 3N13A 3NUKA 2PDBA 5G4HC 1Q8AA 3ZM8A 5LA0A 4U33A 3BQ5A 3TV8A 1W1B1 3VDCA 1DL3A 1EP3A 3AMLA 3B4YA 1P6WA 4KFPA 5DANA 3UR2A 3NZGA 3GKFA 3LV6A 1JNDA 4GJIA 3IGHX 3W1QA 1DJQA 4M56A 3T42A 1CEOA 5A6BA 2W91A 3T78A 1UKPA 4O8AA 4N9EA 4E2BA 2IS7A 2DSZA 3O15A 4PC8A 4G7FA 4AIOA 2NVCA 1S1RA 3OJGA 3T09A 3VKDA 1KA9F 1WDPA 4GO8A 2GSEA 4PCPA 1JZ5A 3H4XA 1EP2A 2VC5A 3W73A 3QR0A 1I2NA 3MP4A 1CDGA 1P0KA 4IT1A 1XLDA 4PUKA 1QI5A 1DEDA 1HZYA 4JIPA 4A4AA 1EA9C 4D8LA 3ZR5A 1D7KA 5GNXA 4Z2HA 2JF6A 2J74A 2YXGA 3TLQA 4W85A 2GQAA 3VE7A 3FDKA 2NQLA 1OX5A 3BW3A 1EOMA 4NRSA 3Q65A 4IP5A 2J9XA 3CH0A 1CGXA 3W7RA 2W4XA 3WO8A 4NZJA 3MBFA 4WEVX 4TO8A 4NP7A 3BLIA 3ES8A 1PUDA 5AHEA 3FK4A 2CNCA 1JPIA 1VEOA 5AHLA 3GLCA 1G4TA 3EWDA 4RJEA 5DF0A 3TN4A 3KVMA 2XPKA 3CUJA 1OG0A 3KS6A 3IGUA 4GKTA 4S3EA 3KBJA 2IQDA 4QDMA 2R9RA 3HV8A 4FOKA 3WF4A 1ZJBA 3ITCA 4PULA 5G2IA 4WKAA 2QCEA 3PWAA 3OEXA 3OB8A 4KQNA 4YTRA 3BE7A 3C0LA 3UJ2A 3P0XA 5DBUA 4W89A 3KLKA 3E9AA 8XIAA 3LRMA 2Z24A 3N4EA 1W32A 5FEWA 1OFDA 2XHYA 1KM5A 2NW0A 4FALA 1M41A 2WNWA 2WSQA 3AC0A 4CCCA 5HOSA 3F2CA 1XH0A 5HPOA 3GR7A 3IJ8A 2YBVA 4G56A 2GGIA 1YYAA 2BWGA 4P8VA 4LCSA 3SDOA 4C6PA 4ML4A 1QNRA 4KWSA 1FWGC 2BOEX 2PS2A 2TYSA 1Q6QA 3G1FA 3AIUA 4AD4A 3DHDA 4BQ5A 4BS0A 3ERPA 2A0NA 4NAFA 3HURA 5H2ZA 2YPIA 1V6WA 1VZWA 1YKWA 3QTPA 2CZDA 3DC0A 1TFVA 4QRNA 3SSZA 3HMJG 1NQKA 1I60A 3PY2A 1P43A 4DELA 4DBDA 1IHIA 1TPC1 1S5VA 1NOUA 5KTLA 2PWUA 4BQ3A 3FV9A 3PBWA 2CC0A 2ZDRA 2WK2A 2HPIA 2GGGA 2VEKA 3EPNA 2C6QA 1NSJA 1XH1A 2I9EA 4F4RA 2BGQA 4LVFA 2VDGA 3H55A 1E0UA 5C9XA 3VNIA 1S39A 2FPTA 4Y8FA 2QCCA 3K8MA 3IEBA 4JS3A 3DI1A 4C6KA 4IGNA 5LA1A 3LQLA 4XB3A 2NXIA 3MCMA 4IMCA 3KL0A 3NFUA 3VOCA 4C90A 2XUCA 1QWGA 1YTKA 3W70A 3TAKA 1IR1A 5JUVA 2J88A 3GHSA 3PVFA 2AL2A 3QHNA 4NI8A 3UR5A 4MY9A 2GVYA 1EJUC 2P8BA 3QR1A 4AZGA 4GKLA 4GY0A 1TRDA 5CBJA 3ISIX 3G1AA 2LLEA 2YDRA 1F4AA 4YHGA 1VQTA 1KR1A 3L7RA 1DORA 3PR2A 4O1DA 5AC8A 1HFBA 4MYXA 4LVGA 1FWWA 2E09A 3RCYA 4LUTA 2VEGA 1ME7A 4MKNA 5LYRA 1E4LA 4F0SA 3ITOA 3WLOA 1PB0A 3EA3A 1E55A 5E93A 3SCNA 2EXOA 3Q2DA 2WNNA 1MVYA 1G5AA 1J11A 2OJPA 3KCLA 3JVAA 1UWUA 2D2JA 1TPB1 1JUKA 2RGMA 1OC5A 3U5YA 2EPMX 4RW3A 1H7OA 2DVUA 3BZGA 3M6YA 2Q8XA 1HF6A 1GTHA 3QV9A 2BG5A 3SO7A 2ZOXA 1IGWA 3QR3A 4AHPA 1EC8A 2AOSA 1M1BA 3STPA 4MMWA 5A6SA 2NX9A 3HB9A 5KZEA 2OOFA 3NYZA 4ZQOA 5TQLA 3U57A 4QJ3B 1JQVA 1Q2RA 4H01A 4ZA0A 1V0NA 3EA2A 2X0HA 2C1IA 1JRCA 1H0GA 3LHVA 1R9XA 3T07A 1FKWA 4OQVA 4QLLA 2BTMA 2F61A 3T8QA 2OT0A 2X41A 3LGDA 5FD0A 3FAWA 1IGSA 3VNKA 3H8AA 4LSBA 3TE9A 4C5YA 3SCRA 3GVVA 2GSJA 4KRUA 1XCFA 2CITA 3FJ4A 4YWIA 3PBGA 3TSMA 2DZBA 4KCTA 3W71A 1H5YA 2Z2UA 2QCGA 3GW0A 3CWOX 2HTMA 5IRPA 5HJYA 2MANA 3EEZA 1XYZA 3C52A 2QDGA 5F2GA 3FW6A 1A3XA 4MIMA 1I4NA 4UQCA 1K9EA 1UG6A 4QG6A 3ALFA 5F4XA 5GPRA 2XIBA 3MV11 2Y63A 4MZ1A 5ABFA 3AU6A 3UEQA 4NASA 4OBSA 1UKOA 5DY2A 3VINA 3PFRA 3PZUA 1SSGA 3WKZA 1DIEA 1RQHA 2PAJA 2YYTA 3S2MA 3TOPA 3GH5A 3KZSA 4IL2A 4QNWA 4LYPA 5CC6A 3FYPA 2CCRA 3UWEA 3EMCA 3AYVA 3BL3A 1R8LA 4QISA 3SRDA 3NSNA 4UZUA 3PBVA 4A2SA 5FAJA 2H90A 1J79A 3RYSA 3T1GA 2OX4A 1V3IA 2GVEA 1W37A 3STFA 4QR6A 4Y9PA 4Y96A 3ABOA 3N2MA 3MTWA 4HOWA 2RDWA 3EPMA 3TXVA 1O12A 4HYWA 4LC8A 3UD6A 3MUIA 2ZWYA 4J35A 5D05A 2PP3A 3SCWA 2TRSA 5TD4A 4NZCA 3PJTA 4RDVA 4GRSA 1GOMA 3GNRA 4HD5A 5LXEA 2QT3A 1OF6A 1VYPX 1REQA 3A47A 1WZAA 5DBTA 4MZ8A 4Q8PA 3WLKX 2WWDA 1QPOA 4HN4A 1CW2A 4PTVA 3T0BA 2IMRA 5FEPA 4PODA 3I7QA 1UZDA 3JZEA 5A6BD 4XKYB 3GTNA 1F6YA 5J8LA 4RE0A 2DP3A 1HVXA 2DZWA 3IV8A 4LW7A 3HGSA 1VLIA 2DPEA 3ZIZA 1DTUA 2XVKA 4M6QA 3KTSA 4L65A 5JBEA 3DFPA 3AMGA 4AZCA 4NQ1A 3OG2A 2HV5A 2AGKA 2PLJA 1SO6A 1XQKA 4MM1A 5D04C 3UXAA 1O6IA 4Q4QA 2RAGA 1PTGA 1FRBA 3LHWA 4DJDD 5AHMA 4M1BA 3M4HA 3TCSA 3RAOA 4F0LA 4NAEA 3B4UA 5CJNA 3AWNA 1HJXA 5CGQA 1GOWA 2HPMA 1WQ5A 3TTQA 5D38A 4K8GA 1I6NA 4Z1YA 1SFJA 1W8GA 2ZZ4A 2A7NA 1SFLA 3KFTA 4LYKA 2WZHA 1DWIM 3N2XA 4F66A 3I6EA 4MDOA 5LA2A 4JZ5A 3LOTA 4GQRA 3CUZA 1V93A 2ZX6A 3UZXA 3WZ0E 2WM1A 3T40A 4AF0B 1IEWA 3PJXA 3EX6A 2QIWA 1LWJA 3A4XA 4PN2A 2Z1WA 1FHVA 3GYCA 9RUBA 4CCZA 2VM8A 3AYTA 3N9RA 4WDUA 2CZVA 3AHYA 3NGJA 4F2TA 4S3AA 3ANYA 4IWWA 3RGTA 2OXNA 5DCDA 5XIMA 1XW8A 4MAZA 5I2UA 2V67A 3ES7A 2ABBA 4F79A 2DVTA 3WMSA 3W24A 4CLMA 1EWDA 3NPVA 3N9SA 3VKCA 4KGLA 3ARVA 3NSMA 3TNOA 3PBYA 3W7GA 3N2OA 4GUIA 3AMDA 2JIWA 2X40A 2CLEA 1VRXA 1RCXB 4IZGA 2A6LA 3BC9A 3A3XA 3WJXA 4DYKA 4G1NA 4N4QA 2BMBA 4LVDA 3CBWA 4Z17A 3SR7A 1LT7A 1NP0A 1S2CA 2D2HA 2E9BA 1E3ZA 3MJMA 1RJQA 4IISA 5M1TA 3TKFA 1PEZA 1ZAJA 3MJYA 1TREA 1MYRA 4NJKA 4NY2A 3L65A 1P48A 5AYZA 3FSUA 4BWLC 1SGJA 3CPUA 1O95A 3T2PA 1ZPTA 1O4UA 2Z00A 4W93A 1BYDA 4I8YA 1GORA 3R5EA 2G0WA 2O9OA 5I6SA 4OBRA 1JI2A 3S47A 2MUCA 3AYSA 3GXFA 1TSIA 4DI9A 3TZFA 3W26A 4WR3A 3S2CA 5J04A 1RSCA 4HMDA 1T6MA 2R1MA 2DW7A 2Z6IA 2PGWA 1GONA 4PMUA 3AICA 3GAYA 1KNWA 1YTEA 3UCQA 1HQTA 4UNKA 4HT3A 3ITLA 4O50A 4R5EA 3VFLA 1EIBA 1PE1A 1QI4A 1V3HA 3GR4A 1J18A 2XGBA 1R7AA 4OKDA 1SJDA 3AALA 3DI0A 2PTZA 2DZXA 1B3VA 1V4YA 3N2TA 4UMBA 4Z08A 1W91A 3VGGA 1MW3A 3MI6A 1UD8A 4H8NA 4O52A 1PZ3A 3EWWA 3GTFA 2R1PA 3BW2A 3L0KA 3UA3A 1TWIA 1VB9A 5E9XA 3ITXA 5LNSA 3TA9A 1KM4A 2FJKA 3TMLA 3F7JA 1KBLA 4I7UA 1LG2A 1A5UA 1F8MA 1VLWA 3SQMA 1YE6A 3FA3A 2E6YA 2QGYA 2XTKA 5AYYA 3OA3A 4I3GA 4HPGA 2E67A 4UQBA 1FTXA 4EVZA 3PZ9A 1V6VA 7ENLA 1W1TA 5G1YA 3WLPA 3EOOA 3TQ0A 1Y0EA 3LS9A 2JKEA 4Q33A 4H9XA 3GKAA 3SURA 5J5RA 4WOQA 2OELA 3CEUA 2NV1A 5FESA 1CXLA 3G6LA 3N14A 1RJRA 3L0GA 3F4WA 2RFGA 1EUAA 3B3DA 3LDVA 4S3BA 4DVOA 3EOSA 3SRKA 4KF1A 4IICA 4Z0JA 3MCNA 4UOJA 2J7BA 3ARTA 5CZJA 4D6HA 2BSLA 4W7WA 2G95A 4J3VA 4B2DD 5RUBA 3I3BA 4C65A 1EKOA 4NYYA 5EMLA 5F4SA 3IPWA 3BVJA 2QF7A 3E5BA 3NQ2A 3PZTA 1W17A 3GXDA 5BWFA 5EMUA 1C90A 3S4TA 4Q8MA 3B9DA 4JQ1A 3B8UA 2VZVA 1TVPA 4OZOA 3WDQA 2YXOA 5DCEA 1IWBA 4U31A 3KUMA 1YPIA 3H24A 3T0CA 1P5BA 5JIWA 3HFYA 3LU2A 5BNKA 1UD6A 1MZHA 1XIGA 1BF6A 1BGAA 4E4PA 3GD6A 4FXRA 1O1HA 3NGFA 2D3LA 3G8EA 3GIYA 2W5FA 3RR4A 3VUPA 3CPRA 4H6KA 2YL5A 3AIWA 4M51A 1KFWA 2WC3A 3HG2A 3LNPA 3ITYA 3S2LA 3TDFA 4DX3A 8A3HA 4UTFA 3II1A 1UZ1A 3WQ5A 3KVLA 1OD0A 3ANVA 3IJLA 2WC7A 4BWLA 1NP2A 3S83A 2OKOA 3VKKA 3R0KA 1DWHM 1EFZA 1IZCA 5HNTA 5EGRA 3O16A 2P76A 2CYGA 1TWWA 4GX9A 2QW5A 4F0MA 1US2A 3ZSTA 1E0WA 2J62A 2GYIA 4JTQA 3WNMA 5T26A 4DLMA 4JQ4A 2CWNA 1UD5A 1FCVA 2BNJA 2QJGA 4GCXA 1OZQA 4A8IA 1FFQA 5E5CA 3P74A 4DJEC 3GHTA 2ZIDA 1D9EA 1XDLA 4TVUA 1RXOB 1EDGA 4PUDA 4R85A 1AODA 1XHGA 1FDYA 3L2MA 3GTXA 1UP2A 1DPMA 3ARZA 3EWYA 4BK9A 3OG3A 1F76A 4DUXA 2FIQA 4K37A 3BICA 3W87A 5A6TC 2YDAA 1Q5MA 1CXIA 1N8WA 4C1KA 1KTBA 3LI0A 5C2GA 1PHQA 1ELSA 4PMVA 4CEXC 5F2IA 4B90A 1DJHA 4LQ1A 4LAUA 3SQLA 5EU9A 3TXZA 5AOUA 3T81A 3BSGA 1C8XA 5E09A 1H60A 4YTUA 1EJVC 4YNGA 4GACA 3SM0A 4KEZA 2H6RA 1JDAA 2PBOA 5CGTA 4GIEA 3CAVA 2WPGA 4WSJA 1TB3A 4ZSUA 3BJSA 2C13A 1K7XA 2EKCA 3OYXA 1J10A 3SY8A 3HPXA 3L23A 2PDQA 1EF2A 1VEMA 4CKQA 4DF1A 2J7FA 2I5GA 2Y88A 3W23A 1QI2A 5C7VA 2HRWA 1PCKA 2CFFA 1W8SA 4B5XA 3N17A 1H7WA 3LTSA 4CN6A 2DSUA 1B30A 3FGCB 3IIPA 4LVAA 5I06A 3GHRA 3OLDA 3GVQA 7CGTA 2R1NA 4YU1A 4Y9MA 3ZWSA 2WHKA 3H7VA 4GBUA 4TQTA 4DEFA 4DWSB 3H12A 4PMOA 1CGYA 1OCQA 4FF5A 4Q8NA 3UVIA 1YDVA 1ZRQA 4GE8A 1PS9A 1ENUA 3IRDA 4Z1CA 3L4TA 2PA6A 1T8QA 2JIEA 3W72A 2WZMA 3QBUA 1KRMA 4YCPA 4Q8QA 3B97A 1Y5WA 2Z0IA 3WQVA 2A7PA 1XFCA 3P0WA 1NDYA 2GJXA 3LCXA 4GO9A 4YVPA 3UCCA 3V5OA 4B3LA 1W3TA 4S2BA 1Z44A 3RJYA 4ZQMA 1G7UA 2VOMA 4CCDA 4HN8A 3PAOA 3A3HA 3WD1A 3UPWA 3GAKA 1GTEA 1XIHA 5TNVA 4MF4A 1QHPA 5C6MA 5FJIA 1NOWA 3N04A 1FVPA 3LXCA 1NY1A 4E0CA 1BRLB 1CENA 3WLMA 1UOZA 4DY1A 1S3TC 4NJGA 5F2LA 5BZAA 2A85A 1IXOA 4LX4A 3M5VA 3MP5A 1FHLA 4JFSA 2V6AA 4NNCA 4BZYA 4XAGA 7REQA 1QPNA 2CBIA 4JN6A 4H00A 3OIXA 2VMFA 3VX0A 1LM1A 2X1RA 3WD0A 3M6DA 2OWCA 4AVNA 4K39A 5ABEA 3VD3A 1RA0A 3GK0A 1AW5A 1F3EA 2HMCA 3DHFA 3MHFA 1RBOB 1W1IE 1V3JA 3RF9A 4AZHA 4N9DA 4LUSB 3AS1A 3W2LA 1B5TA 4F0KA 1GVIA 1BG4A 4AZBA 4RNFA 5BRQA 4IOTA 3MKCA 2OEJA 3KLLA 4MHBA 2ZXBA 1P7TB 5LIYX 1CNVA 1BWLA 2D2GA 2OR2A 3RFAA 3PTMA 3PBUA 2ZKMX 1A0DA 3N11A 2PDMA 2HBXA 3ZT5A 3LM3A 4LXFA 1C8QA 3C0SA 3NPWA 4IMDA 1PIGA 1BKHA 4DJEA 3EDEA 2YZ5A 1OFOA 4JKKA 1HG3A 3ME3A 2DSVA 1GT8A 4GQGA 3NPXA 3WQ8A 2FTPA 3TSDA 3MANA 4AXKA 1SZRA 3NO5A 3E38A 3C0QA 4MKSA 2YCJA 5AVHA 2G41A 2VFIA 4M82A 4CD8A 2ZXAA 4N9CA 3W4RA 2XH2A 2QZRA 4Z1AA 2INFA 1I8JA 3UP8A 1UR8A 1IEIA 3JRKA 1F73A 2DT3A 2W62A 1J93A 2YA0A 1VFMA 1NIUA 4UQ9A 2AKZA 4V28A 3R10A 4YTQA 1F7BA 4INFA 1NEYA 1VAHA 4DM1A 5HR7A 4FNTA 3MI3A 2OX1A 3FY1A 2ZUNA 4KFOA 4CUCA 3E0IA 1CI1A 3IV3A 2XIMA 4AG0A 4HU0A 3QOKA 2WC4A 4J3WA 1Y65A 4PMXA 4L4LA 3PFMA 1VBUA 3G22A 2R24A 3BARA 1MQQA 3L67A 1HP4A 3DFTA 3ITTA 3MI2A 5EMJA 2V5CA 4P7OA 4IM4A 4KEMA 1G6CA 3B8TA 2R1LA 3UWYA 3BG9A 3BGAA 3NQCA 1F07A 3GXTA 1HKVA 2OWWA 2VELA 2W3ZA 1GZJA 1SZGA 5CG0A 3ARXA 4ZFMA 4WKHA 1DOSA 3S6TA 2XFFA 3FJLA 3VU2A 3DG7A 4H2CA 1VHCA 4IPNB 1RVGA 3NL2A 3BK0A 2X0SA 3ZT7A 3TH6A 1DXEA 2RDUA 4DIAA 1VGAA 1VPQA 5CLWA 3TYBA 1PXGA 4HSHA 3KOWA 1VCFA 1JVNA 2ZVIA 5DRIA 2OLAA 3W6MA 1OYCA 1BSIA 1NDZA 1WOAA 1NELA 1AQHA 2AMGA 1DWAM 4KT2A 1DQXA 2BZNA 5HDRA 4Q4RA 3P93A 5JBDA 2Q8ZA 1Q65A 3KRZA 3DECA 4FR6A 1OX4A 5HR6A 3I10A 4YIWA 1UIOA 1Z7AA 2PDJA 3IAPA 5EYWA 1MW0A 4IP7A 4YJ5A 1FX6A 1WZKA 1T96A 4ACYA 2FZDA 3IVSA 3MBDA 3CMFA 3OIHA 5BOFA 4HBKA 1VC4A 4LRSA 1V0MA 2VRJA 3LZ3A 1PYFA 3POHA 4LH8A 2VKZG 4ZO6A 2XVPA 2C71A 4PTDA 5LGXA 4KBXA 2PDIA 1QVBA 4OIFA 4POCA 1JI1A 1J96A 4IFKA 1A5LC 2CBUA 3T0TA 2JKPA 4OUEA 2EGZA 3QYQA 1HX0A 5CZKA 1DJYA 4FX7A 2G4FA 1WDDA 4EOUA 4ATLA 2PD9A 3S5YA 4BFAA 3B9EA 1HXJA 1KR0A 1KM1A 4OECA 2DZVA 2XVGA 4GUFA 4QNEA 5CPSA 2VZSA 3CV1A 1W9DM 2WMIB 1ZSXA 4AUBA 2C0HA 4J3XA 3TJ4A 1CPUA 1R9ZA 3C3NA 4IQEA 2QS8A 5LNWA 1LOLA 1RR2A 2QUNA 1O1ZA 1J5SA 2WHJA 3R8HA 1X7FA 4CGTA 3WELA 3UQNA 3SUUA 5A8OA 4CNOA 2J7CA 2HNHA 1L8NA 2DH2A 3NQMA 4LC6A 3O63A 3TX9A 1B4KA 1UMLA 2J7EA 5KINA 4EX4A 4K36A 3VE9A 4PL2A 1HKIA 2GQ3A 1QT1A 2BBFA 5DX7A 4DQWA 1ITUA 1XIEA 4CU7A 2VEPA 4GZJA 4ZOAA 1ZCOA 2ZE3A 3V16A 1GPWA 3M16A 3KDOA 1EJTC 1JCLA 3BH4A 3VCRA 4EPEC 3KP0A 4D6DA 1TA3A 4K1GA 2PDNA 4WOZA 2EPKX 3P5YA 4Z2JA 2G5WA 3L68A 1W9BM 3LRKA 1V7YA 4WK9A 1BAGA 1RD5A 5A6LA 2XGIA 1B3OA 4P7LA 1JXKA 3PSWA 3RPMA 1ZY9A 3VNZA 3BAJA 3BZJA 1VR6A 1D7FA 3I3DA 1TKKA 4EPKA 3QJAA 3WK3A 2PTYA 3DIPA 4QJ1A 1CXFA 5HWJA 1LUCB 2EAWA 1K02A 3C5QA 3W28A 3UJRA 1BXBA 3R0DA 4PMJA 1HN1A 2P1FA 2CLOA 1UPPA 5DELA 4AC1X 3C4UA 4XZNX 4H7ZA 4Z2LA 3E02A 3PPHA 1LWHA 4LEQA 3WUFA 3I7SA 2E68A 4WF7A 5LZLA 3SAZA 1XS2A 4GH3A 2CPUA 2QAFA 4MLJA 5DEZA 1R2TA 1XYMA 3AIBA 1QOXA 4WGHA 1W1A1 3EWZA 2BVWA 1ODZA 1FWCC 3DCPA 5LIUX 2D2OA 3FKKA 4KMQA 3EPOA 4NZFA 3BLLA 1BVWA 2EJAA 2ESCA 1GGOA 3GIPA 2VVSA 1H1YA 1OFBA 3LXBA 3M41A 4CU6A 3WJWA 1M65A 3GBEA 1NU5A 1KWGA 4HA4A 2Q02A 2FVKA 1R3RA 4AU0A 1TZZA 4JAWA 1Q2SA 1KGXA 1IF2A 1X97A 3NVDA 3UBPC 2AQOA 3EX3A 3UPBA 2WKLA 1J4EA 5REQB 2TSYA 3CYJA 1UB3A 3LCFA 4UFIA 1E3XA 5FL0A 3CLWA 1XDJA 3CMJA 2AAMA 4PR4A 5D2VA 5HK4A 1VBHA 2ZA2A 4FXSA 3OZYA 1OCNA 1E4NA 2R91A 2E5CA 3BLEA 3T0AA 3B9OA 1JXJA 2J9YA 2DIJA 1TCDA 3K8KA 3EGJA 3T2QA 2H9AB 3VNDA 1FKXA 5I00A 6REQA 4O54A 2DDXA 3VUSA 1R3VA 1GOKA 4YCOA 1Y8BA 4JX4A 4E3VA 3HO8A 4OTKA 1QW8A 2J8GA 1MEWA 2C79A 4B5UA 1QMLA 1UWIA 4S3DA 4DNMA 2ALRA 1HJWA 3DFNA 3KBNA 1KQZA 4OHQA 2PP0A 3NPUA 1AW2A 4JCLA 2VCCA 1JIBA 4WX2A 1NWRA 1G4EA 4NX0A 1VD6A 2E40A 1BSLA 3G1SA 3AXKA 3BLDA 1F6PA 4XWUA 5A8PA 4PCTA 4RDWA 4KWUA 4C6EA 4G6CA 3M64A 3KL3A 3KWSA 5I77A 1XJBA 1F3XA 3VMOA 1CXEA 4ZO9A 5FJRA 3M0JA 4W86A 2WVVA 5AZ1A 4B5NA 3V5CA 3IJQA 4Z1BA 4J2MA 4WY0A 4X22A 2ZX5A 2FPVA 1RD6A 3IARA 3MS8A 3RM4A 4HNTA 1RY8A 3QOMA 1HTIA 3B8VA 3OZMA 3EMZA 3QC0A 4Y6GA 3IJ6A 1UWQA 1WDSA 3DERA 3NL6A 2G3IA 2H3DA 1R9YA 3S0CA 3G1RA 2GOKA 3W2NA 1SW0A 1WBJA 4OOZA 1EJXC 3N9KA 4LCRA 2E6FA 4IX0A 3NO3A 5HQMA 2P3ZA 2QV4A 5I3FA 1W3JA 3CO4A 2Y7GA 1LLWA 3RXZA 4ZQCA 1R30A 1E1FA 1LLOA 3B0PA 4IJRA 3VKAA 2XFRA 3RLHA 4JYDA 1JCXA 4MWAC 3VCCA 3MO4A 3VILA 4G7EA 2XINA 2ATMA 5ABTA 4Y7EA 2VQUA 4LYQA 1IE7C 2V8ZA 1E70M 3LYEA 4AZIA 4XBJA 3AIQA 5C2CA 1H1NA 9CGTA 8CGTA 2QCDA 1TCMA 4TVDA 2GUYA 1PDZA 1S2TA 1JNEA 2A3HA 5H91A 3EX2A 1PPIA 3BGJA 4TV5A 1IV8A 3M1ZA 4K2SA 4NG3A 3PBMA 1KFKA 4JHOA 5AC5A 2BS9A 5EBUA 3CV6A 4KW2A 2ZUTA 4LRTA 4P7QA 4WXZA 2G3MA 1BF2A 3PZNA 4GJ1A 3QLDA 2BOFX 4LT9A 5G4WA 2D23A 4C1LA 4UTKA 2FDSA 1FWEC 3L5LA 1UPMB 1KRBC 4AY7A 3TW6A 1U33A 1NFGA 3NQ8A 3KOZA 3VM7A 3W01A 1K9DA 2V63A 3CLMA 1ME9A 3S6DA 3ARYA 4AWEA 2V5DA 3TJXA 3E0LA 3N6QA 1R3SA 4PB3A 2D0GA 3P82A 3VIOA 1R2SA 2ZZ1A 4QDPA 1E6ZA 1Y7VA 3W2JA 2FGBA 3B0UX 2SFPA 4KEVA 4N0RA 2Q6ZA 3AISA 4C6JA 2DIEA 2CZ5A 4A2RA 3R2GA 3OVPA 1XLKA 2IXVA 1Z3NA 1UC4A 2E7FA 5HWNA 3W07A 2ATSA 2VEMA 3K4AA 1RZMA 2QHAA 4AD3A 3KM8A 4FI4A 1RK6A 4U10A 4G5DA 1AQMA 1F9CA 1VBJA 1K70A 2X42A 3D3AA 1X7IA 4C1NB 2YR1A 4L6OA 4U5KA 2BLEA 1TPH1 6XIMA 4FLOA 1ONXA 1DJXA 4H9ZA 1VP5A 1KCKA 4D6CA 5D9NA 2BY1A 4JIIX 3MMTA 3QY7A 3LZ5A 3VA8A 2DEPA 1OCJA 3WD4A 1KFBA 3HQPA 2BGNE 3N19B 1XISA 4O8RA 1VHNA 4UXDA 4ZB0A 3B8IA 2D73A 3SSJA 5BYWA 1RUSA 1LROA 4EPDC 1UQZA 4EAMA 4XVEA 1TV3A 4E38A 5CJMA 3ANUA 1U83A 5IXEA 3SQSA 4ZL1A 3UR8A 1LTDA 4AEFA 1F2JA 3UZ5A 5IOBA 2FVMA 3GXMA 3NM1A 4V1YA 1XRTA 4PCSA 3P60A 3OBKA 1OQFA 1WDRA 3MMUA 3FN9A 4QCEA 4Y90A 1TZ9A 1PTAA 4CN1A 5E0KA 1J6PA 3VIFA 2W92A 3VNYA 1MWOA 3THDA 4ENLA 4O17A 1JQXA 3C6CA 3LPPA 3QMTA 1XUUA 3GDBA 1G0CA 3FYOA 4W84A 1JZ8A 2ZRXA 1XCWA 3UXLA 4BKNA 1TV8A 5DY3A 5FJTA 1LF1A 2I16A 3DOPA 3SFKA 1YIXA 4GVIA 1B57A 1U5VA 2BVTA 3J7HA 3GNXA 5A6AA 3W84A 3S8HA 4MTVA 4KEUA 2DZTA 2GDVA 4HNNA 4WGXA 4MWAA 2XWDA 2Y24A 3NDOA 1T40A 3W7IA 4AVOA 4AIEA 3PM6A 4M6VA 2A3BA 1BWKA 2PDXA 3UNDA 5AKQA 5TF0A 1KV5A 3LA4A 5K3VA 3C3UA 1S2UA 1PDYA 3BLPX 4DZ5A 3WQDA 2XWEA 2VWSA 4WSHA 1GHSA 1Q66A 4PMRA 1XUZA 1M7PA 2GGHA 3CM4A 4GVHA 3W2KA 3RO8A 4IG2A 4TTGA 2ZRUA 1OB0A 2D69A 1WUFA 4HHMA 3R79A 1D8WA 2INEA 2J25A 4D6GA 1AH4A 1UD2A 3AZSA 1O5KA 5A69A 2IPFA 1KRAC 3B8SA 4Z2GA 3W53A 4XAPA 5JIPA 4IPPA 3PP7A 1H62A 3C56A 1NQ6A 1IT0A 1AL7A 3GTHA 1PX8A 3PSVA 2ISVA 2WBKA 4HK7A 3S1GA 3WJSA 3I6RA 2YX0A 1PWLA 2Y70A 1W9UA 2QYGA 3E6EA 3CO8A 4ASTA 4KCWA 5AECA 2CXEA 2YDQA 1V77A 3QH2A 2R94A 3HN3A 4DLFA 2Q01A 1B1YA 4FS9A 4ZOCA 1ZJIA 1I0BA 2I1OA 4TMBA 3GRIA 1XRVA 5I09A 1KB3A 2VFEA 1QPQA 4DBWA 1XLEA 2HJPA 2QEZA 1L8PA 2Y62A 2JEQA 2VNCA 3N4AA 4GABA 5H8PA 1LL6A 2ACSA 4RCXA 4UFJA 4XZWA 3CIVA 3L2LA 1TWZA 2V2HA 1L6SA 1FDJA 5IDIA 2GQ8A 4QJ5B 3KCJA 4PFHA 3ICJA 1OK4A 2BGSA 4LUYA 5CG7A 3KDNA 2WANA 2GJPA 4GQ0A 1VCVA 1Z41A 2VGFA 1NWTA 3B0XA 3W85A 3HPFA 2PRLA 4HPHA 1KV8A 4NHVA 3WF0A 3BG5A 1WAWA 1TJPA 1VH7A 6TAAA 5IHSA 4ZO7A 2QXWA 3HM7A 1KBJA 3NOYA 4W7UA 2YCLA 5ECVA 3L4VA 4PUMA 1E6SM 3TN3A 1C8YA 3K4DA 5LIWX 1N2VA 2V5LA 2PRHA 5B80A 4UZSA 2YCIX 1T99A 4H19A 1F3TA 4DPQA 2VX7A 4KS0A 3M0MA 4FNRA 3ECQA 3E1F1 2RKXA 1SZNA 3GZAA 3NQVA 2JFEX 1PYMA 1BYCA 4PH6A 4HPJA 4NZ1A 4HMNA 2PLKA 1H41A 3WX7A 1OT2A 3GM8A 3WBYA 3W27A 3IK4A 3REQA 4IIBA 2HK1A 5DRCA 4MADA 4L5ZA 1CX9A 3QZ6A 3TW7A 2HNEA 2QGHA 4NIRA 4KRTA 2GVJA 3NTYA 4GHRA 5FJJA 3E12A 4PCFA 5EB8A 2QNEA 1FWTA 3HZ3A 3LM7A 4R3UA 2D0HA 2XN0A 2FDMA 2HE8A 2PCQA 1AA1B 4HJWA 3S42A 3WJZA 3P81A 4JN8A 2PODA 1Y5VA 5I3DA 3CZLA 2WNZA 1EXBA 4CVWA 1E9IA 1K8ZA 2HXUA 3RO6A 3KWXA 5I3JA 2Z1XA 1G01A 2Y2WA 1RLDA 2YBTA 3JU2A 1XBVA 1K03A 5A8MA 3GNNA 4WQ6A 2JGQA 1R2RA 2WXDM 3CUIA 2QJHA 4YN5A 1JULA 3CZGA 3G2GA 1IR2A 5XIAA 1AH3A 1ME8A 2HVMA 3VVGA 3W7KA 4F9JA 4U3CA 2GJRA 5D8ZA 5C0QA 2P5NA 1K9TA 2B31A 2ZRYA 1FH8A 3WH7A 1X1ZA 4ICMA 1GQKA 3RU8X 4DUWA 3TYUA 1RCQA 4L64A 3ENLA 2YB1A 3SRHA 2VQTA 5HMDA 4H6QA 1E5NA 2ZICA 2DZSA 1IXNA 6ENLA 4JIEA 4M29A 5HUPA 1R46A 3B03A 3DFHA 1TVNA 3QZAA 4PEKA 3GZ3A 1C92A 3F2DA 4UCFA 3D5HA 3ID7A 4Q8OA 4RK8A 2ZUUA 3MT1A 3R8RA 2FZMA 4ADTA 4ACZA 1UA7A 4QE1A 4WY0F 1FA2A 2XYLA 4O1BA 3QMSA 3S9ZA 2O0TA 1XP3A 3TC6A 1TMLA 2DFAA 2NT0A 3QGKC 1MXGA 2PDKA 1LRTA 3NA8A 3W7PA 2V2DA 3WEZA 3WF1A 2W66A 5LNUA 4HU8A 5REQA 2G3FA 5D8WA 5A2BA 1C7SA 2V9DA 2VYOA 2BV9A 1P1MA 3B04A 4M6UA 4H9YA 3ZXWA 1H63A 3OLGA 3VIHA 2E6DA 4UUIA 1HIZA 2QLYA 4A29A 2QQ6A 1S3HA 3IRSA 4AQLA 2PDYA 3M43A 4RE4A 3AS3A 1Y5XA 3AMCA 4EXAA 3BTNA 4FK9A 4BCEA 4BF7A 2ZE0A 3V0UA 1N7KA 4TMCA 1AQ0A 5I23A 3QV8A 2IQ0A 1H3GA 2FB2A 2C18A 3MV01 4FO4A 4U2YA 5AHFA 4AD1A 2ZX7A 3W02A 2GJNA 4NRRA 2XVLA 4QXIA 1GEQA 4DB7A 1GKRA 5KITA 2VXNA 1HJQA 4WJEA 3GNOA 5E1QA 3SCTA 1OG6A 1HJUA 1SQ7A 2QV5A 3FS2A 3VOHA 1U5HA 3STEA 4HNUA 2CXGA 1BVNP 1ALDA 1RK5A 3FHAA 2J13A 5A95A 2J7GA 1HKKA 3GVWA 1C7TA 1XXXA 3SGGA 2XIQA 4KCUA 3IIZA 2ZA1A 4FNSA 2C1GA 3ZS4A 4QBXA 1DBTA 1DTNA 3VFCA 4FIQA 1M3UA 3DYPA 1JFXA 3VKBA 1QK0A 1JGIA 1JCYA 4QCFA 1XIIA 2V69A 2GVGA 2O56A 4O11A 1FWBC 4RNHA 4O14A 1UKTA 5BMWA 2YL8A 1R85A 2Z1VA 4CN4A 4JGDA 2VRQA 4TIMA 1QNQA 3W37A 1NFPA 2GK1A 4GG9A 5D9MA 2D24A 1LOQA 4ROPA 1W1PA 2VFFA 3W7EA 3HGRA 1KWKA 4DJDC 3V35A 4HKPA 4AAJA 4PFMA 3H2EA 5M03A 5M3WA 3CC1A 3EB4A 2WAGA 3BOFA 1YQ2A 5T91A 3F03K 4F2UA 1WBHA 2G96A 3RUBL 1VFOA 3UG4A 1H49A 2YOCA 3VIMA 1EO7A 4AEEA 2DZPA 2DUXA 3TTYA 3TYDA 4S3GA 2VGGA 4MJ2A 3DXIA 3F4DA 1E5JA 3M5XA 1WB0A 4FNPA 5HJXA 3W7JA 4HMCA 3LPFA 3UZJA 3LPOA 1YPXA 3VK5A 4V2XA 3EXRA 4QX4A 4RW5A 1M68A 1FFRA 1ZBVA 1IYXA 3PTQA 3H22A 3KCOA 2ZX9A 1TR9A 1TTJA 3A9BA 4M6PA 4UQDA 3EAUA 2NQJA 3CQHA 3BSHA 4QM1A 3V18A 4B91A 4DF2A 1Q85A 3EEGA 3WH8A 2E8YA 4ERGA 4HNVA 2DJLA 3EDJA 1BD0A 2PDGA 4F48A 2QUMA 1EUNA 1OM0A 4PSPA 1E0VA 1FOBA 1FH9A 3M7WA 3QGAC 4OU1A 1AJ2A 4JEJA 2ACRA 4ZQRA 3VD9A 4EPBC 4JOMA 4F3HA 4MJMA 3HOJA 4QIUA 4IIHA 4L61A 1N8IA 2NZLA 3A23A 1DWJM 1S1PA 3KEHA 3W00A 1NJJA 4OGZA 1EZ2A 1MDRA 1LRQA 1EP1A 1E6QM 3MVIA 1CLVA 3DHPA 1US3A 3MQTA 1DVJA 3DBNA 4FLQA 2B7QA 4U4MA 3PUDA 3S2JA 3UESA 4XO6A 2VCAA 2Z27A 3L9CA 3PANA 4M80A 4PGLA 3MW7A 1OEPA 1AL8A 3T4WA 4O28A 4C6NA 3VDHA 5TAOA 3PB2A 4L4PA 3COTA 1SJBA 4UB9A 4UTUA 2NSXA 4P2VA 1TV4A 1KTNA 3OZPA 3W7LA 1UR2A 4LGXA 1EBHA 4MLRA 2YZRA 5I03A 4XTIA 4LU0A 4JIRA 4KH2A 3LSBA 3GNPA 2Y89A 4W88A 1UUQA 3IUHA 7A3HA 3C2EA 4XBKA 3UWZA 4B4FA 3S5NA 5EL1A 1RQBA 1WP6A 3GXIA 1TE1A 2OFJA 3GE7A 1E56A 4LUIA 3GR8A 5F1VA 4IIDA 4HQVA 1EZWA 2ZYFA 1TMQA 1E4IA 2WJEA 4R53A 1UW9A 1KM3A 3O6CA 2ABAA 1T7LA 1UWSA 1Q3NA 3UWVA 2FKPA 1UH4A 4M1RA 3UCDA 3W7NA 4I9MA 3OA5A 2FJUB 4PUUA 3ABSA 4OV4A 1XLLA 4F2BA 1A5SA 2QF8A 4I8DA 1XIBA 1I1WA 3NSXA 3TIMA 5U4NA 1CTNA 2EG6A 1XM3A 2C14A 3GQYA 2ISWA 2QMKA 4IJBA 3WQEA 3BGGA 1W5OA 2ZUSA 3AZTA 3HPSA 2EBNA 1E1CB 3L66A 6CGTA 5DFAA 5HANA 1VJZA 3UW6A 1EX5A 5AYIA 3SGZA 3WQ4A 1IZJA 4GYKA 4S1FA 1V0LA 1YBQA 3AYRA 4Q22A 3APTA 4B9ZA 4IIFA 4LYRA 3PWIA 3R11A 2QDEA 1D3CA 4M5PA 4MY1A 5CPTA 4NSBA 2V5BA 4DJDA 4B5VA 4ES4A 1MEIA 3HJEA 3DYMA 2QULA 2VR5A 3KRBA 1NH6A 1TQXA 4H41A 1EHAA 3F4NA 2DU2A 3P8JA 4WUIA 1JDEA 1EJSC 1YDNA 4I9AA 1E15A 1UOKA 3FSTA 1DWFM 4V1XA 3WK2A 2E9MA 5MKGA 4TX9A 4D6JA 4I5RA 3E2QA 3KAOA 1V6TA 5LHFA 4US5A 3VNLA 1E0TA 5I7GA 3VCNA 2NT1A 1SR0A 1SZFA 3BAIA 3FJ6A 3E0FA 2HROA 1H4PA 4RPQA 1I75A 1EO5A 8RUCA 1WO2A 4E4FA 3VC6A 1NM9A 3C86A 4CEUC 4GIYA 1ZJAA 3P62A 1VKFA 5CPOA 5I79A 2X7WA 3E49A 2A21A 3CAKA 4X60A 1UWRA 1Q8JA 1Q13A 4A05A 3AHVA 1US0A 2YFOA 3QQWA 3LMYA 4LNCA 4NXKA 3GXPA 3L5MA 5HATA 1UCWA 4ZGYA 4IGSA 3UJFA 1FCQA 4CQCA 3KTCA 1EGZA 3N15A 3QY8A 2JGYA 3EX4A 1OC6A 4L1XA 3RMEA 5AB3A 4MUZA 1RVKA 1PO9A 2BXVA 3UJSA 3H2NA 3UPMA 4BR1A 1HVQA 3QLLA 4C6CA 3KVKA 3IJIA 4LB3A 3N4FA 1A49A 2EJ1A 4Q8UA 4W8AA 1OIMA 4C6QA 1XR2A 3EWXA 4JFVA 4D6IA 2PDFA 3CH9A 5CQ1A 4J27A 3DEQA 1TPVA 4XD3A 4MJZA 1UD3A 5HQEA 4GK8A 1TZ7A 2FHBA 3PPGA 4MDPA 3QGVA 3A24A 5ENLA 1XC6A 2OSWA 2PU1A 4N2YA 4L1GA 1VPYA 1XRFA 1WDWA 4Q4KA 3PNUA 9XIAA 2POZA 2RJGA 1RY0A 4Z42C 4UFLA 4EXBA 1FWHC 1XWYA 3ELFA 1ZALA 2DGAA 4XD6A 4HYVA 2D3NA 3G77A 1M6JA 3HG3A 3YPIA 4UNLA 3FHQA 4LBRA 1SU5A 2PURA 3W82A 3NQEA 1KXTA 3EDKA 3C8NA 1YTDA 4EK7A 1XIMA 3WK0A 3S9IA 3HBLA 1ZLPA 3GC5A 2OEMA 2OTDA 2OLHA 4XISA 5FF4A 1VYRA 3OLEA 4QSFA 2WZEA 2Z1SA 4BI5A 4ADSA 3O2LA 1THFD 4QDWA 2VT0A 3GU1A 4TTUA 4OWGA 3TWBA 2E5DA 3UNTA 1ZBKA 5I3HA 1W5MA 2TMDA 4A3UA 4YTTA 3QW3A 2R8WA 2DT1A 1LJYA 2DT2A 4O19A 3DG3A 4X2RA 1TJ0A 3IANA 1WZLA 3A21A 4M19A 3FOKA 4MPQA 2X09A 4RZ5A 1AFSA 2VDIA 4HZ7A 3RMJA 4JD4A 2OYKA 2CHRA 3SY1A 1P0EA 1JPKA 1L6GA 2E25A 2FGZA 3JW7A 3T55A 3TC3A 4DXVA 1XSJA 2IUZA 4REQA 1QO5A 5CJ5A 4L6HA 3R4IA 3L0NA 2VI0A 1JF6A 3GYEA 7TIMA 1JZ3A 4DO4A 3CT2A 2PBGA 4G1KA 4JX6A 4YYFA 2J24A 2GSHA 1W9XA 4NJJA 3WQFA 3A5FA 1W3LA 4X63A 4R9XA 2ZUVA 3VIPA 3P61A 4ATDA 4JYFA 4W4QA 4UFKA 5EBAA 2HK0A 2WB5A 1QFEA 5AVNA 3OVRA 1J0HA 3M9YA 2QVHA 3QFWA 1KC7A 1UYQA 4FAMA 4LAMA 3Q37A 3B9NA 3RRAA 1A5KC 2OPJA 1FCUA 3ZYZA 3UF9A 1AZ1A 2BY0A 1ADSA 3E0WA 4NT0A 3S5OA 4HNCA 4B2DA 2ZWZA 1TIMA 5EKYA 1CIUA 2DSWA 4LTSA 1C8VA 4AYSA 5FSDC 4KGJA 5KZ6A 4O1FA 4YXGA 3OVQA 2E9LA 3IJDA 4H8HA 3SUSA 1B3WA 3CL6A 3B05A 3T9PA 3VIJA 2EKGA 3PG9A 4JDBA 1AJZA 1S5NA 4I9JA 2G3NA 3NXFA 4E5TA 3QKZA 3MDUA 3DGRA 1M9HA 3ARRA 4H9VA 1FWAC 3NCOA 3GB6A 2AL1A 2NQZA 3BMWA 3H2OA 4HHPA 4J3UA 1TR1A 3MDWA 3ZR4A 2Z25A 1R5YA 1TTIA 2GQ9A 2PTWA 2VDHA 3IUDA 3ONCA 1GYMA 3M0ZA 3DBPA 4WCJA 3W1UA 3M47A 4H83A 3W9ZA 1VENA 2REQA 1JR1A 4J5NA 4LS0A 3OZOA 1OFQA 2DW6A 2DH3A 3BMVA 3NG3A 1JD7A 4R9OA 1ONEA 1WKEA 2CESA 5F2MA 1TELA 3R0UA 4XUYA 3ITGA 5K4ZA 3MMWA 4WZHA 3QSRA 3W7MA 3N25A 4EANA 3UT0A 2J66A 4UTWC 2QAPA 4HU3A 5KSWA 1UASA 3LTPA 3HQOA 1IWAA 3MCOA 2EEXA 3PZOA 3PC0A 3RJXA 2W0UA 2HZGA 4DAIA 2C0AA 1TJRA 1UWTA 5DMLA 2J77A 5ECUA 5FA5A 2RDXA 2PF0A 4A3RA 3MC5A 4LJ3A 4HHHA 3A9IA 3VNJA 1X39A 4NAFB 1AD4A 2B4GA 1PCWA 2VX5A 4HPXA 1GWJA 5CC3A 3G8RA 1EB3A 3ZZ1A 2Y6ZA 1FHDA 4H1ZA 1P0BA 4P7RA 4TXEA 4Q3MA 3HPAA 4MPKA 2VC9A 3M7SA 3AMKA 4D6FA 4MUPA 5GNYA 3R8GA 3TFXA 3VD4A 4ZQPA 4L9YA 3W29A 5IFTA 2GOUA 1ISVA 2V3GA 2YYUA 1TTQA 4O15A 4NILA 3TN6A 1DE5A 1E73M 1EOKA 1S2AA 3K13A 4RZ4A 1OY0A 4A6GA 4HZMA 4P8XA 1Z69A 1EXPA 2ACQA 3UGVA 1V3LA 3TYZA 4MJ4A 3QN3A 4UMCA 1M7JA 1UROA 4Q8VA 1K1DA 4H3DA 1OFRA 4NI3A 2G97A 4WDTA 3MUY1 1E40A 4GA8A 2Z2AA 4ZZ9A 5BWAA 5C8BB 1FY6A 1E6PA 4AZ6A 4MB4A 2GLKA 2JK2A 4S3KA 1IEVA 4KFNA 1MRAA 2AL2B 4GXWA 1MUWA 3ABRA 1QBAA 1VPXA 1SO3A 4LY8A 4XAYA 5TBOA 1W54A 4AD0A 2WZIA 3WL1A 3UY8A 3B40A 2IKHA 2B7PA 2B0MA 1LOSA 4US5D 3CGTA 3WSUA 3FCPA 2W79A 1V02E 2PDWA 1WKFA 3LI1A 3QF0A 1AVAA 2DQWA 1MFUA 3OU8A 4PUWA 1H51A 2VP8A 4KKXA 1H5VA 1UH2A 3UXKA 2F6UA 4LUTB 1PZ1A 3S1VA 5HNNA 2B7OA 2QUTA 4U28A 1KLYA 3U9IA 2QUUA 4FIRA 3OHIA 1QPKA 4FOJA 1AUSL 4LPCA 3SRFA 4JY9A 2JQXA 2ZA3A 1WYIA 5G5IA 1XLHA 2WW5A 4LALA 3C2VA 4UTIA 1HKJA 1DV7A 2CEQA 1QNOA 1GZGA 4DHGA 1SFTA 1NF0A 3WNLA 1ISZA 3FDGA 3AAMA 3QM3A 3K30A 3AQUA 1KFLA 1SMAA 3SCOA 2D0FA 4ZB5A 2P53A 4HZ6A 3W76A 4PTMA 4FXFA 2GDQA 1O5XA 1NVMA 3DESA 1M53A 1QTWA 1O60A 2WJDA 3Q94A 4J3TA 3EYPA 1GQNA 3WNOA 2PWGA 3M0IA 1BXCA 2PGFA 3F5JA 3W1AA 4LANA 3T05A 4UR9A 1XD1A 4RX0A 4PMDA 3G6MA 3T8LA 2FQIA 2QUVA 1XBYA 2BASA 3EXTA 2DVXA 3INPA 5L6UA 4J3SA 4ATWA 2VJXA 1B9BA 2OKTA 4CNPA 2V3DA 3OBEA 1UWAA 4HNLA 2UY2A 2J8FA 1JEZA 1WA3A 1GG1A 1RP8A 2X1TA 5M17A 3UG5A 5HNUA 3MP3A 4DUVA 2XSBA 4ZOEA 5CAKA 2ZUWA 2VC7A 1HO4A 4OBTA 3B0VC 3LCGA 3WEMA 2NUXA 5CSRA 5ABFB 2HISA 1L6FA 3TWAA 3R58A 1XLAA 3H2CA 2V30A 4GYPC 3P3BA 1H61A 4UTWA 2VR2A 5LNVA 1KO0A 1ZFJA 5L9FA 5A6MA 1XLIA 1FWNA 3TQPA 4N6EA 3AHXA 1GNXA 2PE4A 1TIWA 5LSMA 2Q09A 5FJOA 4WRHA 3NZRA 5CGMA 5BW6A 3LHZA 4H9UA 1Z6KA 2E5BA 3URAA 4A3QA 4DJFD 4ERAA 1QO2A 4DF0A 3HFTA 3VDBA 3EKZA 2QIIA 3KE0A 4MNJA 1YW1A 1PKMA 1TX0A 5I3GA 5FKYA 1E4MM 1JL8A 5CZSA 2YIHA 1ZZMA 4W5ZA 2ZZ7A 3BAXA 2PGRA 1VFUA 1QNPA 3M0KA 4Y9NA 4H2HA 1KM6A 4Q7BA 5CC7A 1REQB 1WKYA 2BB0A 4XVDA 3H2AA 1B54A 2YCKX 3WQCA 1PKNA 1J0ZA 2GUUA 2UV8G 4ZBCA 2Y7FA 3BAKA 1OHLA 3PULA 6ALDA 3C8FA 4TVCA 3N12A 4GQBA 1OGBA 3ZOAA 3NYDA 3NDZA 5G2WA 2Y8UA 4LV9A 2F38A 2RH9A 3O0KA 1VFLA 4NVTA 1W56A 1SR9A 1VJSA 4AZCB 3VO0A 3WBXA 3LBMA 2NX3A 4GOAA 4PRWA 1D3HA 4N4PA 2Y5JA 4RE3A 1DYSA 5D2YA 2YL9A 1H7XA 2HS8A 4PMQA 2IXUA 1JFHA 1VIWA 3MA8A 4DBUA 3SJ3A 4AMAA 4NAEB 1K3UA 4HOZA 1E9LA 1VFHA 1TYGA 3TTEA 2PUZA 2OQLA 2AGTA 3GS6A 1XYFA 1G69A 4Q8TA 3DFSA 2FH6A 4C91A 3DFYA 3Q4DA 1OWQA 5F4WA 2OGJA 3RITA 2X2YA 1UR4A 3CNYA 4IXHA 5CZ0A 2WV8A 2WSRA 4H8VA 2ONEA 2NQ5A 1XCXA 3RLGA 1GQJA 3DHUA 4JTEA 1ZU8A 3R7MA 1KKOA 3IVTA 1J2WA 3CHEA 2EPHA 1KXVA 1I9CB 4RDZA 5LIKX 1K6AA 1B3XA 1W3NA 1GYLA 5FIPA 2VGBA 4HA1A 4R7WA 3U0HA 3AO0A 1A5BA 3WD2A 2RDTA 2HXTA 4LBUA 1JYXA 3D47A 3M5ZA 2Z28A 4WJXA 1ECQA 4WJ8A 4J28A 3AXIA 1QNSA 1L2UA 2J7HA 3FKRA 5GVJA 1C3FA 2WLYA 3FIGA 1QU4A 2ZCGA 3PTDA 4P61A 2YL6A 3KBWA 1BYAA 1GVYA 1K8YA 3LENA 2Y61A 2ZFAA 1K4GA 4UTHA 3GFZA 4ZTXA 4GY7A 3WLSA 2IKGA 2PWFA 4J9JA 5I78A 2UWFA 1G9HA 3W7HA 3UG3A 3ABXA 4HZ8A 4MY8A 2VZUA 3A4JA 4UOQA 5FEZA 1J2BA 1L6WA 5I02A 4JTSA 3W7OA 1X8FA 3LX9A 4A8NA 1U1HA 2JALA 3WUEA 3QW4B 5HA7A 1RJPA 1UD4A 3W75A 3PJUA 5C9RA 3VOGA 3R94A 5AY7A <