4WRHA

Akr1c3 complexed with breakdown product of n-(tert-butyl)-2-(2-chloro-4-(((3-mercapto-5-methyl-4h-1,2,4-triazol-4-yl)amino)methyl)-6-methoxyphenoxy)acetamide
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
316
structure length
316
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C3
publication title Breakdown product of N-(tert-butyl)-2-(2-chloro-4-(((3-mercapto-5-methyl-4H-1,2,4-triazol-4-yl)amino)methyl)-6-methoxyphenoxy)acetamide trapped in active site of AKR1C3
rcsb
source organism Homo sapiens
total genus 116
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2014-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4wrhA00
1VP5A 3EB4A 2FVLA 3UZXA 5HA7A 3CMFA 4QXIA 3LQLA 2PDGA 4RPQA 4XO7A 3RX4A 4H8NA 5JH2A 4ICCX 3FJNA 1GVEA 1S1PA 4L1WA 1MRQA 4GABA 2P5NA 2IKIA 2WZTA 1S2AA 4H7CA 2PDXA 1Z3NA 3M4HA 3DN5A 3BCJA 4QBXA 1YE4A 1M9HA 4WDUA 1C9WA 4YS1A 4XZLX 5LIKX 3F7JA 1FRBA 5AZ0A 3UZYA 2PDHA 3Q65A 2DUZA 1JEZA 1YE6A 4XZNX 2IPJA 4WDXA 4JQAA 4L1XA 5LIYX 4PRTA 2HE5A 4JTCA 2IKGA 4FAMA 3CAQA 3CASA 1LWIA 3H4GA 2I16A 2R9RA 3VXGA 3WBYA 2HDJA 3R7MA 2I17A 1AH4A 3G5EA 2CLPA 2PDQA 1AZ2A 3COTA 3V0SA 3UGRA 2PDUA 2HVNA 2IKHA 1OG6A 1S2CA 3FX4A 2PDBA 5AZ1A 5LIWX 4IGSA 5C7HA 1PWMA 2PD5A 4JIRA 2PD9A 1R38A 1MZRA 2PDFA 2QXWA 4XO6A 3EB3A 4I5XA 1SM9A 2FZDA 4LB3A 3S3GA 3MC5A 2BP1A 3LBOA 4F40A 1ZQ5A 4QX4A 2IPWA 3R58A 2HVOA 4XVDA 4GIEA 4AUBA 4YU1A 4EXBA 1Z9AA 1Z8AA 3ERPA 3R94A 1EF3A 3NTYA 4WDWA 4JQ3A 1ZGDA 4ASTA 1S1RA 4NKCA 2HEJA 3RX3A 2PDLA 4XZMX 2ALRA 3P2VA 3UYIA 4LBRA 1PZ1A 2PDPA 3WG6A 3KRBA 2PDKA 2INZA 2HE8A 1YNPA 3UZZA 4ZFCA 2VDGA 3R6IA 3UZWA 1IEIA 4XZIA 1HQTA 1Q13A 4XAPA 2PDMA 2PEVA 4FZIA 4JQ2A 2PDCA 4XZHA 4WEVX 2F2KA 1RALA 2BGQA 2PDYA 2PF8A 1X98A 2IKJA 1T40A 2ACSA 2PFHA 2BGSA 3R8HA 4Q7BA 4HMNA 4PMJA 3V35A 4XK2A 5KETA 2NVCA 4GQ0A 3O0KA 4R9OA 1Z89A 1XJBA 4DBUA 3UP8A 3MB9A 4WDTA 4YVPA 4JTAA 3CV7A 4JQ4A 2FZ9A 3LUTA 3G1RA 5DANA 1ZUAX 2J8TA 3V36A 4MHBA 1XGDA 2A79A 2DUXA 1US0A 4JIIX 2ACQA 1ADSA 2HV5A 1QRQA 2IS7A 3BUVA 5HNUA 3N6QA 1VBJA 1J96A 2F38A 3WBXA 3B3DA 4GA8A 3CV6A 2DV0A 1EL3A 1MI3A 2AGTA 3N2TA 5JH1A 4OTKA 3V0UA 2IQDA 3M64A 3UFYA 4PUUA 4DBWA 4YVVA 2PZNA 3QKZA 5HNTA 3LZ5A 4QR6A 3GHSA 1QWKA 3H7RA 3EAUA 3C3UA 1A80A 4DZ5A 3LN3A 4PRRA 3ONCA 3LZ3A 3BV7A 4LAZA 2PDIA 2FZBA 1PYFA 3BURA 3UG8A 2FGBA 3GUGA 4XVEA 3R8GA 4FA3A 2INEA 4LB4A 3M0IA 4GQGA 3O3RA 1YNQA 4LAUA 2ACUA 1UR3M 5M2FX 3U2CA 4G5DA 1LQAA 1PWLA 2PDJA 4DBSA 1AFSA 5LIXX 4WRHA 4LBSA 2IPFA 1XF0A 3GHTA 5LIUX 4HBKA 4PR4A 4FALA 3LD5A 3ONBA 2ISFA 1RY8A 3UWEA 2IPGA 3GHRA 4IJCA 1RY0A 1T41A 1HW6A 4YVXA 1K8CA 1IHIA 4IJRA 3WCZA 2ACRA 2IQ0A 3GHUA 2C91A 4GACA 4GCAA 2NVDA 3Q67A 4EXAA 4PUWA 3CAVA 4WGHA 3D3FA 4JQ1A 1EKOA 2PDNA 2PDWA 1ZSXA 1X96A 4JTQA 3V0TA 3T42A 2FZ8A 3R43A 1EXBA 3H7UA 3RX2A 3LQGA 3LENA 1X97A 1AH3A 1PZ0A 2R24A 1Q5MA 3LEPA 1AH0A 4JTDA 4JTRA 4Q3MA 4JIHA 3LNMA 2WZMA 1AZ1A 3DOPA 3WBWA
chains in the Genus database with same CATH superfamily
4D6GA 4E4PA 3U5YA 1Q6QA 5I3DA 3RU8X 2D2OA 3WNKA 1W3IA 4KFOA 4J2MA 5HA7A 1KCXA 3ID7A 2EPLX 7TIMA 1LYXA 4DJEA 3IIVA 3CO4A 2I14A 3RX4A 3VC6A 3C8FA 3EA3A 1W3NA 1YPIA 1V77A 2J62A 5C9ZA 4PE8A 3G24A 4IH3A 1WYIA 4XKYB 2Y2WA 4H6KA 4MKSA 3VM5A 1R7OA 3MSRA 3VIGA 3KOXA 3EBVA 1DV7A 3C2RA 3P8IA 3MHFA 2CNCA 3QGKC 4WQ6A 4CN6A 3W7JA 3LPPA 1QK2A 1G67A 4IT1A 3L67A 2GYIA 4GLEA 1A0CA 2MNRA 1TJ0A 3MPGA 4M19A 3W9ZA 1W6TA 4O50A 4FR1A 2BHZA 3VGFA 3KL5A 3WIJA 3L2LA 4DJED 1VPYA 2ZX9A 4IPIA 5U7SA 2GGGA 1MW3A 1V6YA 3M0JA 3AC0A 3NQEA 1WAUA 3G5EA 3W72A 3NJ3A 1Z44A 2NV1A 4F48A 4HNVA 1OFEA 1J12A 3G77A 1E70M 4UFMA 3N14A 5HWMA 2A7NA 1O94A 1XIIA 3P82A 1ZTVA 3VX1A 1KM3A 2PDFA 4GQQA 4KGLA 4XAGA 2G3FA 3TE9A 1PDZA 3TKFA 2WMHA 4F4RA 1V4YA 2VT0A 4I9TA 1FWEC 5AHEA 2ALDA 3OLDA 4XZWA 1AA1B 4PTXA 4D6HA 4W9TA 4HK7A 3E02A 1SO3A 2HVOA 3UPMA 4FPSA 3RLHA 3UPWA 3PN8A 3BAXA 3E0LA 1W1PA 4BI7A 5A1AA 1J2BA 1B54A 3ABZA 3RCYA 4XISA 5DCBA 3FVDA 3CHVA 1EF3A 5FI8A 1F3XA 1UD6A 1NSJA 2WVUA 3QKEA 3K1DA 3G1YA 1IQ8A 4G9PA 1HXJA 4PCNA 3H22A 1QUMA 4NKCA 4ILSA 4C7FA 4OKDA 4LBRA 3AMGA 3B8WA 3DBNA 4V28A 6REQB 2GQAA 2WQPA 3E2SA 1W3HA 2PDKA 1DHPA 2Z1SA 1JIBA 2GVEA 3S47A 3CS2A 4FI4A 4EANA 4ZFCA 2VDGA 2OQYA 2QVNA 4UZUA 4GPNA 5DMNA 4RNHA 2BY1A 3C2OA 3FV9A 3SRDA 1H50A 1R3WA 1R5YA 2A7RA 3CV2A 2PEVA 3IJ8A 1RALA 2HBVA 2QAPA 1X98A 4N4QA 4GY1A 1EPXA 1D2KA 1F3WA 1JZ8A 2Y62A 3NCOA 1O5KA 3MUY1 3MA8A 1M7XA 4AZ5A 1AK5A 2GGIA 1JNDA 1C9DA 2PE4A 2XN0A 4HK6A 3CH0A 4A3YA 2WZHA 4YHEA 4WDTA 4JKLA 4OT7A 4FOJA 3TYBA 1J0ZA 2QUNA 4LBUA 3WK2A 3CV7A 4NT0A 3QV7A 3L23A 1Z41A 4AQLA 2XTKA 5HQEA 2AL2A 2ZRWA 5EB8A 1OT2A 1JD9A 1NAL1 3VABA 5HATA 1MDLA 2HK0A 2OZTA 3CB3A 2VX7A 1EXPA 1XPGA 1OGBA 1TZZA 2FVMA 1QOXA 2RAGA 4UQ9A 1Q45A 1UR9A 4YL2A 3NQ8A 4C6QA 1JXJA 7TAAA 4ZXOA 4CQBA 1LBLA 2AGTA 3ZM8A 1Y8BA 3ARWA 1SQ7A 2WVTA 2BXYA 3W1PA 1YDNA 4TV6A 4LAKA 4IOTA 4FB7A 4N9CA 3UFYA 2QGYA 3BCDA 4RZBA 1ECEA 1BXBA 4MUZA 4QLKA 1SMDA 5CPQA 3C2FA 5FL0A 3W88A 3IEBA 3O15A 3KBJA 3N4AA 3VD7A 3GDBA 1YPXA 4TMBA 4AZIA 2FPTA 4U5IA 6A3HA 3LHZA 5I79A 3CPUA 4JTFA 4FMVA 1OM0A 2YFOA 1I2PA 4INFA 5M1TA 1IEXA 3AMLA 4UWMA 2WC4A 1CYGA 2D2HA 2QIIA 3M0YA 3W1TA 2EHHA 4J4KA 4UTIA 2XWDA 2WKJA 2DW7A 4HNOA 5LYRA 4S3EA 1GHRA 1V93A 5DMMA 5EGRA 1B31A 4YCOA 1DXIA 2XFFA 3RXZA 3C0LA 2FH6A 3ZMRA 1VS1A 1ZB5A 4YMZA 5CEWA 3TCEA 5FESA 1J93A 1TPB1 3GHTA 1OIFA 1GYMA 2J9YA 4MDPA 4B3ZA 4PR4A 3ITVA 1HVQA 3SQMA 1F8MA 4A22A 3LHTA 3SUSA 2J8FA 4WZHA 1TMQA 1EUNA 3ECQA 2IPGA 1V0MA 2GQ9A 4FOKA 3NM1A 4IJRA 3WCZA 3BLIA 3H4XA 3LCWA 4B15A 4PZVA 2Z6JA 3V7PA 3NQGA 3AJ7A 2Y5EA 3GLCA 3MUIA 3S5OA 3EOSA 1B3WA 4UTTC 4B3KA 1DJZA 3W82A 4LV4A 4WUIA 1BSLA 3BL3A 4EPDC 3DG7A 3SBFA 1MRAA 3H2MA 4ZOBA 3T42A 1WO2A 4G1NA 3ARYA 3WNNA 3VNIA 1KXHA 3SCNA 4QISA 4HYVA 2E9MA 1P1XA 2ZOXA 1OD8A 2CC0A 1ZBCA 1Z69A 1AH3A 3ZXWA 3LEPA 3I4KA 3TEVA 2RDUA 1UWRA 4IIHA 3GNRA 4H19A 5CCZA 2G3JA 4H6QA 4D8ZA 4MWAD 4QJ4B 2NUXA 3Q94A 5HMEA 3MKKA 4KWWA 5EMJA 5BU6A 4E2DA 2V0TA 1JCJA 3WN6A 4QDMA 1R6WA 3GDKA 3HB9A 2P3EA 3H2FA 1REQA 2QCDA 4EP8C 1XSJA 1A5MC 1GKRA 5DCDA 4XO7A 2YYTA 4D9PA 1CPUA 2H8ZA 4O1EA 2DQXA 1X7FA 2XIJA 4LF2A 1S2AA 3AXIA 3LU2A 4QE5A 2DQWA 1HF6A 1TX0A 4L4MA 4NASA 3H53A 1WZLA 2P53A 3P8JA 4R7OA 2AL2B 3EX4A 3RILA 3FK4A 4HNCA 2VI0A 1W3JA 1RR2A 5TBOA 1ITCA 3M47A 3NUKA 1GQIA 1YKWA 2DVUA 1R46A 4XSLA 2GGEA 3ZOAA 2CLMA 5FKYA 3W1RA 3SUTA 4O1BA 3UJFA 1S3HA 4C6NA 1CCWB 4FAMA 3OEXA 1CXKA 2JE8A 2OSWA 3U4AA 1YTDA 4WD0A 3QV9A 2E28A 2FGLA 2GJLA 2XIQA 1W9DM 2HXTA 4AVNA 2A7PA 4UNLA 1XBZA 4KCUA 2X1IA 1YBQA 1G6CA 3QY8A 4AWUA 5LIWX 2ZE3A 4IGSA 4CD4A 3U4FA 5E70A 3LBMA 1VJSA 3UJSA 4PEEA 1R38A 4JTHA 1PTAA 2NQJA 5XINA 1P43A 3DC8A 3RLVA 4PUMA 4MB3A 2BTMA 1K02A 4NYYA 3AO0A 1GVQA 2F61A 4IQJA 4DAIA 3IARA 1XHGA 1W1IE 1KKOA 1O7AA 2IQTA 2VCCA 4ZB2A 3T4CA 3EDJA 4KPLA 5KMYA 2ZTJA 3SUWA 5C70A 1FWJC 4NXSA 4JY8A 3QSRA 3ZYZA 1ZNNA 3BAIA 5JXQA 3L4VA 2GUUA 2CETA 2C1HA 3VKJA 5ABTA 2V5BA 4WLCA 1EA0A 4ZXLA 3KOFA 1WNOA 3IS4A 4RV8A 1WOBA 2BASA 2WLZA 2XH0A 4XZMX 4CNOA 4FXFA 5K3VA 4M51A 1EJSC 1FWAC 1CIUA 3EXRA 4L6HA 3WQ8A 2QUMA 3WH8A 3NM3A 4PUKA 3W7IA 3MV11 4M6PA 3W6YA 5DT7A 1KFCA 3WL1A 1ISVA 4Q6JA 3DERA 2A3LA 4UQBA 1RQEA 1W9BM 4GBDA 1KV5A 3H26A 4C91A 2PWEA 5IRPA 2Z7KA 4WEVX 3WLQA 3EWXA 4S39A 4GX9A 1DJGA 2PFHA 4X61A 4AHPA 1XX1A 4CNSA 3R8HA 5A6BA 1KM5A 4PCFA 4H4IA 4HMNA 1TUXA 3CYVA 2NV2A 2ZA3A 1M68A 2C1GA 2EGZA 4YYFA 4MB4A 5LNRA 1UUMA 3SW6A 4GZIA 4DBUA 3KDOA 3NQAA 3RCMA 4K1WA 5EPDA 1GTEA 3NQDA 1DJNA 4M6QA 1L8NA 2W66A 4XX6A 1JD7A 1JZ7A 4GI8A 1KRBC 1TTQA 2X2GA 2CXEA 1E0VA 3W01A 2AL1A 4G1KA 1SGJA 1TPVA 2WNZA 4DWDA 5E0FA 3AU2A 5FD0A 5A8QA 4EOUA 2VM8A 2WM0A 4ZODA 3VNDA 4YCPA 5AHFA 4CUCA 3LRMA 1EJVC 4X3ZA 3SFWA 1BXCA 3THDA 1REQB 2QCDB 5A6BD 2F38A 2QF8A 3H55A 3R25A 5I3GA 3IAPA 1H2JA 4RK8A 1KTCA 1TJ2A 1CGVA 1ZP4A 4KESA 2XZ9A 3CEPA 1AJ0A 4DBEA 3TC6A 3UBPC 4H01A 2J7HA 5D04C 1MZHA 2XIMA 4YVVA 5G2HA 1E9ZB 4PB3A 5FOOA 4L1GA 2DIJA 4C6KA 1DKWA 2QCHA 3XINA 2SFPA 3P67A 1JGMA 3QOMA 1XLGA 3GBDA 4TX9A 2VEKA 1X38A 4IMAA 3UG8A 4MB5A 2PMQA 3GUGA 2OEMA 3R8GA 4MLJA 2ZZ4A 1QNOA 4P61A 3S6DA 3DFSA 1VRDA 1JGIA 3QR3A 2R1KA 3MW7A 4HQVA 4NI3A 5CZ0A 2YFNA 1YBQB 3DX5A 5I7GA 3F4WA 4S3CA 4IG2A 2NUYA 3FXGA 1SJCA 4JKKA 1OX4A 3OU8A 4AIUA 3WK3A 2D1ZA 3QYQA 2J13A 5DMLA 1AUSL 4HBKA 4YPJA 3WH6A 3CUFA 4NHVA 1WB0A 4Q8NA 2VNCA 1DPMA 8XIAA 2VJXA 1W5MA 1N55A 3NFUA 5D2YA 3C86A 5FJUA 5FAJA 1JZ6A 1Q3NA 3KBWA 1EP1A 4PULA 2OR2A 4GCAA 4PMZA 3MU7A 4JQ1A 1HP5A 3AQUA 4HCDA 4CCZA 2PTXA 3UR8A 2OOFA 1E0WA 1KBLA 3BGJA 1C7SA 1SFJA 3PAOA 3VD3A 1MFUA 3H7UA 3THAA 4P7OA 4POCA 2DVXA 4IXHA 1PZ0A 4JHZA 1XIMA 1E1EA 4Q3MA 4AVFA 2AAAA 1OZQA 1L9WA 3KDNA 1E1CA 1GG1A 1RK6A 1WXJA 3UZJA 4HNNA 1DE5A 2YL9A 3B8SA 1JZ5A 3W26A 1TYGA 3LM3A 3LA4A 3PPFA 4M1RA 4PB4A 1WKEA 4JY9A 2EPOA 4NAFA 3VFCA 1XIGA 4ZZ9A 1R86A 4LGXA 4LTSA 1MRQA 2CZEA 3EWYA 2P5NA 1IWAA 2V6AA 1Z3NA 3GXNA 1CW2A 1KGWA 2PI6A 3L65A 4JOMA 2ZXAA 3SCSA 3L2IA 1UYQA 3QGVA 5RUBA 3A5VA 3WK0A 1GKQA 3B8VA 3HPSA 4FNSA 4IUOA 2TRSA 2WJEA 3WH9A 2V63A 2ZZ5A 4L1XA 3G6MA 2HE5A 3R10A 3DG6A 4JTCA 2I5QA 2ESCA 3C2VA 1R3RA 2A6NA 2FFCA 2OKOA 5HXMA 3TFCA 1VEMA 1X8CA 3CV1A 1HT6A 4S2BA 1JUEA 3WEMA 4J1OA 3LCLA 4KMQA 2QDEA 3LXCA 1ME7A 1XSKA 2DJXA 4S3JA 5AOUA 4OQVA 4YN5A 2WM1A 4EE9A 4C6MA 4C5YA 1GVIA 1JPKA 1UWQA 3DESA 2PDUA 4XV0A 4Z0JA 4MJMA 4MDOA 1E56A 3H12A 3O6DA 5C7HA 1PWMA 2OZ3A 4K38A 4DUOA 2QYGA 1ODUA 1YEYA 3AS3A 5HUOA 1Q6LA 3NSNA 1UOZA 3TR2A 1PPIA 1O68A 1SM9A 4NAEA 1C91A 5LNWA 4N4PA 1MW0A 3MC5A 1FWBC 2Q8XA 2BVTA 1WZAA 4HA1A 4UFJA 3W7MA 3GZ3A 2NXGA 3ZVIA 2QW5A 1SJDA 5T26A 3SR7A 2B7NA 1W8SA 2V82A 1QBAA 3W83A 2OGJA 3R2GA 1LG1A 3U48A 4LJ3A 1UKPA 3SCTA 3OGRA 1JFHA 2X41A 3A64A 3NURA 5FACA 4IG2B 3GU2A 1NEYA 1BRLA 1VYRA 3LXBA 4L9XA 4MYXA 1QOQA 4AZ6A 1OX4B 2PWVA 2VFFA 4PMDA 1VRXA 1OIMA 4PH6A 4XD4A 3RX3A 8RUCA 3AIUA 1OFOA 2ZTKA 3OBEA 1XYFA 1WAWA 4GO9A 5DELA 4Z1DA 3DFNA 3NYDA 1BWKA 4GNJA 1H7RA 4DPPA 3B0PA 5G2IA 1AQMA 3KVJA 4XZHA 3T08A 1ITXA 1CXHA 1WA3A 1B3VA 2CLHA 4O18A 3TYAA 4IL0A 4QE4A 2BGSA 2CBIA 1M1BA 3IJ7A 5BZAA 4GI6A 1RLCL 3ZFHA 4LFYA 4E2BA 3S9IA 2OEJA 1JYXA 4F2BA 1XJBA 1V3LA 1NDWA 2ZX5A 4XD6A 4ZBCA 3GFZA 1M7JA 1E1CB 4W7VA 3DH7A 1CLVA 2E68A 3CUGA 3NYZA 5DANA 2PU0A 4GUHA 1KBIA 4R5EA 4QDWA 4G8TA 4ZQRA 2O9TA 3UT0A 3BSMA 5FF4A 4HNLA 3ZT7A 1GVOA 2X7WA 1LTDA 2WJZA 4WSKA 1E51A 1KKRA 2D2JA 3IV3A 1ZL1A 1XP3A 4NAFB 3TW7A 1J0HA 6TAAA 4FR6A 1DWHM 2BY2A 2PSNA 7PTDA 5E9AA 5E6ZA 3ALGA 5IOBA 1L6GA 3UGVA 3WLTA 3SGZA 4BWLC 1H60A 4IIGA 2CZ5A 1FWFC 3CZKA 4BF5A 3VNMA 2WSQA 1TREA 1E73M 3L2MA 3AIQA 4DZ5A 4H8VA 3BAWA 1ELSA 3EX2A 3RJXA 2C3ZA 1W54A 3ICJA 3MI2A 2RGLA 3P7YA 1XI3A 4HPGA 4HNTA 3VOJA 1KCLA 4XD3A 1TJRA 1JXKA 3PHAA 5FF2A 4IPLA 1EGZA 3M7WA 2INEA 2BV9A 1E6RA 1WDQA 1IIGA 4JIQA 2QT3A 5A8OA 3NXLA 2FDMA 4LAUA 5G4EA 3J7HA 1VENA 1Q65A 3W1QA 1FWDC 1D7FA 1JCMP 4Q8MA 1A50A 3U2CA 1S5TA 4E8CA 4IF2A 4K36A 3P6LA 1BQCA 2C8NA 1B2YA 4NAEB 4BQ3A 1IZCA 5TD4A 4JGDA 3IJDA 4IIBA 1XLIA 1JG9A 2AQWA 3T2PA 4JTIA 5EBUA 4RW5A 2GL5A 3KCLA 1TRDA 3GXMA 1GQLA 3H70A 3I7QA 3EKLA 1EDTA 2REQA 3MCMA 3WUFA 1JCTA 3ZQ9A 3BJFA 3D3FA 1BRLB 3AOFA 5C71A 5I07A 1NIUA 4FF5A 1UC5A 2FMOA 2FZ8A 1LOLA 1A5LC 3R43A 4MB1A 3L7RA 3VOHA 1XWYA 3T8QA 5BOEA 2YB4A 2DZUA 1R9ZA 4H1ZA 3RCNA 1CXIA 3GTXA 2B31A 1K4GA 3U8GA 2WZMA 1CENA 3DFTA 3W1UA 3H2CA 5C6MA 5HMSA 1ZJHA 1XRSA 4DX3A 4AZCA 3OP2A 1C8XA 3UZXA 4DWSA 1OHLA 5AN7A 2WANA 4CN1A 1I45A 2WBKA 2VRKA 1B1YA 1FFQA 3K4AA 2PDXA 4DJEC 4Q32A 4GC3A 4ZOEA 4IUGA 3HURA 4MY9A 3RPMA 1C9WA 3BW2A 1RPKA 1LUCA 2CYGA 2PDHA 4A3UA 2PPGA 1H63A 5F1UA 1N7KA 2FHCA 4HK5A 2D0FA 2OFJA 4DWSD 1S3TC 2VDIA 4PTMA 1TTIA 1LLZA 3CAQA 3H24A 2C1IA 1IE7C 3CUJA 1F6KA 1ZU8A 1UROA 2CLEA 1TWIA 3R7MA 1J4EA 3VNYA 1HKMA 2EPMX 3NGFA 3P0XA 2O9OA 4UTHA 4EWJA 2PLCA 3COTA 4FLQA 3QN3A 3M0ZA 1T5AA 4ZQCA 4V33A 4K8EA 1HL2A 3N73A 3QHOA 1KTNA 4EAYA 1FDZA 2PTYA 4XO6A 4Z17A 3KL3A 4LUIA 3KHDA 5J5DA 5T91A 2D0GA 3BLDA 5CJMA 2PODA 4LB3A 5M3WA 1E55A 4PA8A 1ZQ5A 3ITLA 3N9KA 3G22A 1GW1A 1RLDA 4PB5A 4MPKA 1EOKA 4TVCA 1WZMA 4WY0F 2FMNA 2R1LA 3RU6A 3SJ3A 1DIEA 3CWOX 5AYXA 3TYCA 5DMYA 1UP2A 2R1NA 1CGXA 2J75A 4MM1A 4OBSA 2OOGA 3PBMA 5G2WA 5T9BG 1BVZA 3NPUA 3VIOA 2HEJA 4J35A 2ADAA 2VR5A 4I7WA 2YSWA 3K46A 3L5AA 3LMZA 4A05A 1TIMA 3UZZA 5HULA 3AIEA 3UZWA 3CC1A 4L61A 1RA5A 4UTMA 3EZ4A 4O0ZA 3WJZA 2VEIA 2REQB 3OVPA 4ZOAA 5A3HA 5F4WA 5JBEA 1DWIM 1QI5A 2O56A 2QULA 3FA5A 3KAOA 2P76A 3E5PA 2Z26A 4RPPA 5HPOA 3TTYA 3FXYA 2VGFA 2FTWA 2ZCGA 4D6FA 4GQ0A 1RP9A 1E0TA 3BAYA 2A5HA 3KTSA 4W5ZA 2YDSA 3TX9A 3WD1A 2UY4A 4DJDA 1H7OA 2QMKA 3R1ZA 5H1WA 3ALFA 2IMRA 1PKNA 2YBVA 3HQPA 3TOYA 5EMKA 3N2MA 2ASHA 1O12A 2QJIA 5FJPA 1GCYA 2YR1A 4AZCB 3AS2A 1ZCCA 3FDGA 3EDKA 1UWTA 2I7GA 3EOEA 1F3TA 2I5GA 3VO0A 4DWSB 2QJJA 3M0XA 1R30A 5DLCA 4ZEPA 3W0KA 3RRAA 3GNDA 7XIMA 4O1DA 4NZ1A 4Y2WA 4GVFA 2ZBTA 2VELA 3LI1A 3WFLA 1P48A 1E3XA 3LBCA 1XIEA 1PX8A 1SJAA 2ZQ0A 1R9YA 1L6FA 3BC9A 3DAQA 3G3MA 3VKAA 2E77A 1NWRA 2IQDA 1XL9A 4DJDD 1UA7A 4Q22A 2OEKA 1LUCB 2PLKA 5CSYA 3G2GA 1NWUA 3TYUA 3VIJA 2VQUA 5D32A 1A80A 1FKXA 4HPHA 3VCRA 3PZOA 3HFYA 2R82A 3N19B 1FXQA 6XIAA 3G1HA 1JPHA 3S1UA 1MVYA 2G97A 4K8GA 4GJJA 3WQOA 4LB4A 1XCXA 1GTHA 3TP4A 5C5YA 3OQ8A 1X7IA 1HKKA 2CW6A 3AHTA 2BMBA 3CK5A 4GYFA 3AYVA 3UU0A 1B4EA 3NQ6A 2QV5A 3DIPA 2J9ZA 2VC7A 3RLGA 1O5RA 2JEPA 4I3GA 1YXYA 2Z2BA 5CPMA 3O9NA 5CC6A 1P0KA 3S9YA 3S1GA 2VURA 3B9AA 3NR0A 4C7DA 4FLSA 4C6DA 2P8CA 1HFBA 3B05A 4WOZA 2C7FA 2KX9A 4ICMA 3TTQA 3CAKA 3LY0A 4Y96A 3W7GA 1QOPA 4M6UA 3PWIA 1KV8A 4O8AA 2V69A 4M7TA 2HSAA 2WKLA 1CB7B 3H6OA 3HJEA 5CSRA 3CHFA 4Y9AA 1SW7A 4F8XA 1O6IA 1X96A 3ES7A 3V16A 5A2CA 2CBJA 1KC7A 1G9HA 3WQEA 1KCZA 1YXDA 3LERA 2CHOA 3M44A 4ML9A 4GIAA 3UXIA 1D9EA 1RCQA 3BZJA 3LENA 3S2LA 1TR9A 2QPXA 3WJXA 5EMYA 1DWJM 4C1LA 3OOQA 3C4UA 3KRUA 4JX6A 1C8VA 1EH9A 3CIXA 4UTJA 4P8XA 3NQCA 1CLXA 3DOPA 5XIMA 1BVNP 1XQKA 1IYXA 1JQXA 1XLMA 4WY0A 1JYWA 2HXUA 1FY6A 2DIEA 1F07A 1GPFA 2Z0IA 2G96A 3VKCA 3CUZA 2XH4A 4UTUA 3UYCA 3WDHA 1MEWA 2X7VA 3SO7A 1UQYA 2E7FA 1BF2A 3RDKA 1G4SA 3INPA 3A4JA 4L7ZA 4BF9A 3L0GA 4GABA 2CIPA 3L0NA 3FNDA 4RW3A 2IKIA 3S1WA 4AYGA 4NL1A 4J5NA 4KIEA 5D9PA 1R3SA 1XIDA 4DO5A 3UZYA 1NQ6A 5F2LA 2YDRA 1XUZA 2DUZA 3A47A 4G56A 4PRTA 4XIMA 3VDCA 5HOSA 4QGCA 5DBTA 4DI8A 5I23A 3PTQA 4HSNA 1UH2A 2Y7EA 1A49A 5CH9A 2PDQA 4A3HA 3P14A 3GVVA 3LS9A 2PTWA 2V3FA 1OG6A 3QQWA 2JALA 2OG9A 1W0MA 4JIRA 4QG8A 2AMXA 4FSAA 1K7EA 1X1ZA 5HANA 1DQXA 2QPUA 1A0DA 5HUPA 1J0YA 4RXGA 4NJHA 3EB3A 4I5XA 3UA3A 7REQA 3LBOA 3K5XA 4JYDA 3ZJ6A 1VKFA 4DM2A 4XQ6A 5A6JA 3PNZA 3R58A 2CZVA 2W91A 3EB2A 4GIEA 3NO1A 1PTDA 3CJPA 3ABSA 2ZUWA 2OZ8A 1V7AA 4YU1A 4EXBA 1J01A 4F79A 1QMLA 1S2WA 4AX7A 2OT0A 4FNPA 2F6KA 3LTPA 3GC4A 3WJWA 4D6IA 3LYEA 2XVNA 4US5A 3P60A 2OSXA 4PEKA 3PZQA 3FSUA 4Q6XA 4IMEA 3EKGA 4YYCA 3QW3A 3UYIA 2VMFA 3PM6A 3GFYA 2P1FA 2PDPA 1P6CA 1TV3A 4ZVJA 2XUCA 3N18A 4BR1A 2ZZ6A 1RBOB 4LCRA 4O19A 1UMLA 1UZDA 3LB0A 5A95A 1JQVA 3VDHA 1MW2A 5GQBA 2TPSA 1NQKA 3VKKA 4FK9A 1OK6A 3G8RA 1KO0A 4US5D 3S8HA 3U2OA 2OODA 2NT0A 3QZ6A 3QQ1A 3S2JA 3C5QA 4B4FA 5M17A 3W7KA 3VX0A 2F9RA 2V3GA 1W1B1 3VTRA 3HGOA 1RXOB 1XG3A 4UR7A 3N9SA 3SIMA 5CSUA 4JTAA 1OY0A 4PMUA 1F6PA 3AIBA 3G1RA 3RMEA 4FS9A 4P5UA 5K9CA 2OWXA 3SM0A 4HGXA 4WY0B 1DL3A 3ELFA 4IJBA 3OG3A 5DBUA 1ADSA 1Y0EA 1LROA 3IRDA 1W9PA 3N6HA 4IMGA 4Q8OA 4HOXA 3SIZA 4U2YA 4QM1A 4DO4A 3CV6A 3DDMA 5D8ZA 1AJZA 1UIPA 2JIWA 1QNSA 3CIWA 2YBUA 3RGTA 3QR0A 3L9CA 2PLJA 3NPXA 4NJJA 1YDVA 4DB7A 4LS0A 1SMAA 4M82A 3UXDA 4QLLA 1PTGA 5HNTA 4QR6A 2GVLA 3FW6A 4OUEA 1LRNA 4UFHA 3QHMA 3M0KA 2CLOA 3L5LA 3JUGA 3M7SA 3OBKA 2BVDA 2D22A 1UZ1A 3BV7A 3D47A 1RHCA 1WQ5A 3PZGA 1CGTA 2DUAA 3A12A 2Q71A 3TDFA 4DUWA 1Z32X 4YTQA 3MJYA 4TR9A 1CDGA 2G3IA 1TPH1 3V18A 1W1ZA 4ENLA 1FCQA 3W53A 2ACUA 4D71A 1U33A 1TVNA 3NSXA 4HJWA 3GVQA 5JVLA 3B4UA 4HN4A 4WRHA 1S2VA 2XIIA 2PP0A 2DSZA 7REQB 3LD5A 2J74A 2QNEA 2VFHA 2ISFA 3NAVA 2X2YA 1FTXA 3SI9A 1TCMA 4WXZA 4E0CA 1GYLA 1A5UA 2VR4A 4J3TA 3DGRA 2V2CA 1K8CA 4MG4A 5AYZA 3NQ7A 1TMHA 2PWGA 1KM4A 1IXOA 1XRTA 1H11A 3Q67A 4PUWA 3H4WA 2WK2A 1I6NA 2OTDA 4GMEA 3UWQA 1EJ7L 2LLEA 5CZKA 4UTWC 4AFYA 3L68A 4WIWA 4TQTA 3PZVA 1DIKA 4JCLA 4MFEA 3OZPA 1DJHA 4MNMA 1L6SA 4MWAE 3V5OA 3P62A 2WWCA 4X9SA 3VNZA 1UR1A 4DYKA 1KM6A 1PZ3A 1XIJA 3GVGA 3WEZA 2ZRVA 5MKGA 5K2ZA 3TTOA 4QJ3B 1MMFA 3VDBA 4JYFA 4WX2A 5LKYA 1AZ1A 1OYAA 4JL1A 2Y1HA 3T05A 1VP5A 5AY7A 4BEUA 3IVTA 3CAWA 3N29A 4LPCA 3CMJA 1NM9A 1SR9A 3FYYA 3N12A 3CYJA 1WXYA 3TSBA 1JNEA 1TPEA 2E8YA 2A4AA 4H8NA 2FKPA 2RGMA 1GVEA 3UWUA 4CQAA 2F8QA 3BLOA 3B9DA 4AW7A 2JKAA 4E6MA 3A4AA 4IMDA 3WENA 4Z2LA 3ITCA 1DBTA 1VBHA 2R6OA 3C2EA 3DN5A 4QBXA 5GNZA 4JTTA 3WLRA 1BKHA 3V1PA 5AZ0A 1CXEA 2XVLA 1Z42A 4CLMA 2E6YA 3APGA 5BRBA 1JEZA 1A3XA 2OSYA 4XZNX 4WDXA 3TJXA 4JQAA 4PMYA 2OLHA 1FWRA 3GBEA 2W9MA 2YCJA 4WSHA 4Z1AA 4K7VA 2QMJA 2BB0A 3O2LA 4UQEA 3ZLFA 3WBYA 3ZSSA 3DFOA 3BXWA 4H41A 2VEMA 4MKNA 5A6MA 1N82A 3K8LA 4H9UA 3G1FA 1EHNA 3PWGA 1TPDA 5AB3A 3W87A 1V03A 5A6KA 1X6UA 3OBAA 3CT2A 2FPYA 1TV5A 2ZDRA 4LUYA 2NQHA 3FX4A 1E5JA 5ECVA 1AD1A 1G7VA 4D1JA 1MZRA 3G1DA 3TNOA 2YPIA 4BI5A 3FJ4A 2ZUSA 4NX5A 5A8NA 2ICSA 3IJIA 4KS0A 3E6EA 3GE7A 4M8UA 3PF3A 3IANA 5JIPA 3JR2A 5C7VA 1AW1A 1EJRC 3SSZA 2WO5A 4I7VA 4HD5A 4PGLA 5KZEA 3PB0A 1Y5XA 4UMAA 3MKCA 5GPRA 5HDRA 4ACYA 3G1SA 3W7EA 4C6JA 4ERGA 1KR0A 1W3LA 1W1YA 4JQ3A 3EPNA 2VUNA 3H54A 2ZUVA 3A4XA 4RCXA 4DHGA 4KIRA 4HOWA 3R0KA 1W1TA 3AIVA 4LEFA 4M81A 5HNRA 2YW3A 3T0AA 4D8AA 3CL6A 1H7WA 1ZJAA 4EF8A 4IIFA 2Q01A 4F66A 2HE8A 4ATLA 1F76A 3IGSA 3KRZA 4NIRA 4XZIA 2ZX7A 3AICA 3CBWA 3GS6A 4LS2A 1KFBA 1WV2A 4Q8QA 1ICPA 4KEMA 3RR4A 3LTYA 3EEGA 4FZIA 5D4YA 2QPSA 2FTPA 4HYWA 3QF0A 1E9LA 1Q7MA 4H6EA 4Q4PA 3ITOA 3E38A 5C55A 2ATSA 1W32A 1A5KC 3TWBA 4ZL1A 1HP4A 3ZJ7A 4PCSA 5KETA 2B0MA 3KP0A 1VJIA 4ZO7A 3S2CA 3CO8A 3CL7A 1R9XA 4N2YA 4ZQOA 2ZXDA 5MKGB 3H2EA 3SUUA 2FZ9A 1MEHA 5GJNA 5KZ6A 3QBUA 3CZLA 4GJIA 4JKMA 4CD6A 1B4KA 5J8LA 3N17A 4ACZA 4R34A 3I6RA 2ACQA 2WMJA 1XC6A 1WBJA 1VQTA 4XG1A 5G4WA 1EFZA 1JPMA 3WBXA 3LLFA 2HCVA 4L5ZA 2GSEA 4US6A 1EL3A 3UG3A 1MI3A 4HIBA 2BOEX 1NH6A 3I3DA 4KEZA 4QEEA 1PKYA 4U31A 3F2BA 2VHLA 4PUEA 2QCCA 4A8IA 3W7RA 2BHYA 1EX5A 1H09A 4JFWA 1CECA 4FLRA 1TIWA 1QT1A 4RNIA 1ME8A 4LY8A 3UJRA 2BGNE 2C16A 2V9DA 1HZYA 3FJLA 1PIIA 2QDDA 1XM3A 1XINA 3PPCA 4S1FA 4GKLA 2FZBA 4JX4A 1W2PA 3L4ZA 5DY3A 1O60A 2FGBA 1UJPA 2Z4GA 3OLGA 1KW1A 5G5IA 4W88A 5E1QA 5FIPA 3NPVA 3R12A 3W6MA 3VCCA 2V2HA 3M0HA 2EJAA 1Q8AA 3QC0A 1UR3M 2ZYFA 4PUNA 3HG3A 1J11A 4Y9NA 2BWGA 3L4WA 1I8JA 4Q4RA 3GTHA 4PCPA 1QW7A 2IXUA 1DP0A 2C6QA 5J5RA 1H0IA 5BWFA 3P93A 3K1GA 3RN6A 4C6EA 5GVJA 3UR7A 3WD4A 2FZMA 1K9DA 3TFXA 3N9RA 3FEMA 4LVAA 2Z00A 3OW1A 1C8YA 1QPKA 1RP8A 3MYOA 2OYMA 3SECA 3VIMA 5HWJA 2GSHA 4GACA 1E6ZA 4Z2HA 3W23A 5G1MA 5I77A 1RAKA 1JDAA 3QZAA 1RBLA 4WHBA 4OWGA 2ABBA 3P81A 4EACA 3IGHX 4S3BA 5HMDA 2Z24A 3EX6A 4S3DA 4W4QA 5E0KA 4DIAA 4ZA0A 4RV3A 5HQMA 3OGVA 4RNJA 2POZA 4E3VA 3W07A 2ZDSA 4CD8A 2RUSA 1C29A 3RAOA 5AYBA 3ZLHA 1XLBA 3CLWA 4DUVA 2D3LA 2DIKA 1UR2A 3EXSA 3AXMA 1U2YA 3UERA 2XDFA 3GVWA 2VRQA 4DO6A 1LP6A 3M6YA 1QO5A 2ISVA 2YA2A 2BODX 4GYJA 3POCA 3NDOA 4QEHA 1D3GA 1UB3A 4MSSA 2O0TA 2QCFA 3NZPA 3FHQA 1FWIC 1IT7A 1M04A 3DUGA 4L56A 1K6AA 3VC5A 2I57A 2UV8G 2YL6A 2X16A 4R88A 1PSCA 4DWSC 2XISA 3MHUA 1PHQA 4Y9MA 3A13A 3FFSA 3IV8A 1XIFA 4DUXA 1TJPA 2VEPA 3BCJA 2NX9A 3W1LA 4DZHA 4O16A 1JJKA 3LGGA 1CB2A 5AVHA 4YS1A 4WKHA 2VCAA 2RHGA 3F7JA 3VINA 2FHBA 3ATYA 3HQOA 4RR4A 3NZQA 1A47A 3WEOA 4ACZB 1UHVA 3MJMA 3TSMA 2PGFA 5LIYX 2QAFA 3GU1A 1R7AA 3AMKA 3LCHA 2G4FA 2QHAA 3AZTA 3EMCA 2HTMA 3SGGA 2UZ9A 2WJFA 3CGTA 4D6DA 1R2TA 1PKMA 4LVBA 4R53A 4B90A 1CZ1A 4HZ7A 5DRCA 2HISA 1S5WA 3QMSA 4EKJA 2V5CA 3VFLA 4KGJA 2XINA 3PP7A 4J2PA 2WQDA 4O14A 2DP3A 2MUCA 3T78A 3DYPA 3MZ2A 5CC3A 4Z2KA 3QGAC 1LM1A 4HCLA 2CZFA 4F2UA 4UB9A 1ISWA 4F0MA 1XLFA 1ENUA 4HZ6A 2Z7GA 4UCFA 5D2TA 1XS2A 2E6DA 4NF7A 3S3GA 2JEQA 4JPGA 2DZSA 3STCA 1F05A 4CN4A 7ENLA 2X05A 1XIHA 3DG3A 3WO8A 4Q4OA 1UKOA 4LVGA 3OYXA 5GJMA 2VFGA 4L4LA 3LHUA 4R7JA 4PC8A 4IICA 1K8YA 4Q4QA 3VNJA 3WD2A 3IWPA 1HJVA 1QTWA 2J7FA 1HKVA 4GNVA 1FWNA 1S46A 1QVBA 4Q4KA 2Q09A 3EDEA 4M5PA 1AD4A 1ISYA 3CTTA 3IVUA 4GCXA 2PDLA 3ITGA 1SO5A 3R8RA 3KBNA 6PTDA 4KQNA 4DYEA 1K9TA 3VILA 3VOCA 1W9VA 4UQAA 2XVGA 3OVRA 3AU6A 4LAMA 3RO8A 3KS5A 5A8GA 4BA0A 1HG3A 1GEHA 4W5UA 4XBKA 4CNPA 3VCNA 2VO5A 3VKDA 1E1FA 5D2XA 2E8ZA 1B5TA 4KWVA 1IV8A 5BMWA 5CPOA 3SCPA 1T40A 1EGVA 3WLPA 4JNMA 2PBGA 3PY2A 5FJTA 3MVTA 3LI0A 3EX3A 1IXQA 3D6NA 2NVCA 2HVMA 3C0QA 4L64A 4WCJA 1EYWA 4Q4MA 1QR7A 3B03A 1UR0A 3STEA 3QPEA 1TPC1 4GK8A 2IW0A 4DLMA 2A3AA 1L6YA 5CBIA 2Z1KA 2P10A 3GX9A 4P7NA 1P6BA 2GFTA 1JI2A 2J66A 2ZRXA 4Y7EA 1FWWA 1JCYA 3V36A 3PTKA 4DJDC 1XGDA 1EWDA 1OEPA 1U1HA 4JIIX 4Z08A 1E4IA 5I78A 2AQOA 3TROA 3PBGA 3N6QA 4QJ1A 4RDYA 3VOGA 1J96A 3EEZA 4J3XA 2X0YA 1XC4A 3WK1A 1Q8JA 2AAMA 4B9ZA 3TC3A 2W27A 2PCQA 2RFGA 5CGQA 1EC8A 5LNVA 2ZZ3A 1YYAA 3P0WA 1Q7ZA 1GOIA 4HTBA 4QFUA 1LQ2A 1E6XM 1LRQA 1RJPA 4M56A 1UKSA 3H7RA 4ZQNA 4IHCA 5BWAA 4ECLA 3ANVA 1ADDA 4UIOA 1MW1A 5T8GA 5CC7A 4MY8A 1X6LA 3LZ3A 4D72A 1U22A 2YOCA 4V27A 3W76A 3TN3A 3E2RA 5CLWA 1EJXC 5E5CA 3VYLA 4AH7A 3FA3A 3VGEA 2OLSA 1HN1A 2HRWA 2Y8VA 3VNKA 5AHNA 1EJTC 3VKBA 1F6YA 3SCVA 4XD5A 1Q6OA 1HL8A 1GGOA 2VZUA 3O3RA 3VGHA 1K9FA 3WJYA 3FN9A 3N04A 3SADA 3LCGA 1G1YA 1XSIA 4GBUA 4F9JA 3FJ6A 1NU5A 1IEWA 4Q33A 1OADA 1K77A 3MY9A 1KFKA 2PF0A 3P80A 3K4DA 4DELA 2IPFA 3S5YA 4LCSA 3W2UA 3DECA 4D6JA 3GG8A 2ZUTA 3PK7A 4QIUA 2H3BA 5I3JA 2C19A 1XKYA 4QS6A 3S5SA 4WJXA 1DVJA 1DIDA 4S3FA 3IVSA 4QJ5B 3TK7A 4GVHA 1A5AA 2NXHA 1FFRA 3TQVA 4PMVA 3RYSA 1BG9A 3H23A 3UETA 2XVPA 1XLKA 4J40A 2XH2A 1U83A 3MDUA 3DI1A 3ARVA 3M5ZA 2CPUA 3ARPA 4U2ZA 2EBNA 3DHUA 3AHXA 2G41A 5K9DA 3ARTA 5FAGA 4U33A 4X60A 5I24A 5L9FA 2UWFA 2FYMA 2QKFA 3I6TA 1F73A 3WH5A 5F2MA 3N1AA 2C0HA 1C7TA 3PC0A 5D2WA 3OHIA 2Y5SA 3GH7A 2BDQA 1XW8A 3ANYA 3DFHA 4AY7A 1H7NA 1X97A 1G01A 1SFSA 2EKGA 4HJFA 1SR0A 1GT8A 4GI4A 4LS1A 3TSDA 2ZRZA 4HKPA 4E5TA 3GXPA 1KQZA 4UOQA 1XYBA 4AEOA 3MMUA 4Z2JA 3CB8A 1I2QA 3MO7A 4P7RA 3IIZA 1NF7A 4IPPA 1JCNA 2FVLA 3HU7A 4HU0A 3B40A 3A22A 2BNJA 1Q6DA 4RPQA 1TCDA 5AVNA 1I0DA 3GKAA 3F4CA 4XBJA 4A6GA 5JH2A 3FJNA 1S1PA 1FWTA 3WZ0E 3MVIA 4HU4A 3D46A 4Q8UA 3F4NA 2DU2A 4EPEC 1EWEA 4E8DA 3T2QA 1Y5WA 4DLFA 2VX5A 1M9HA 3W37A 3CTLA 1ZPTA 4HHLA 5AYYA 8XIMA 1CTNA 2ODOA 4NRSA 1QHOA 5LHFA 4AD5A 4GX8A 4KH2A 1AVAA 1JF5A 1YE6A 5BYWA 4I9JA 5CBJA 5ENLA 1UH4A 1BYAA 3OPSA 2F84A 3W27A 2Z1BA 5BRQA 1H41A 4WKFA 1GYNA 4ORIA 2I17A 2G4JA 2WBGA 2QS8A 2Y8KA 5GNXA 1AZ2A 1GQKA 2OT1A 3B04A 3CLMA 2HVNA 3SEPA 4ZGYA 3PZNA 3PFRA 4UOZA 3OQEA 3B9OA 3KTXA 2QCNA 5AZ1A 1B9ZA 3HN3A 3TJIA 4HHPA 2PB1A 1AMYA 3TW6A 4H8HA 2X1RA 3UXKA 3LK6A 4I6VA 1D8CA 4ZQPA 3KHJA 1PX4A 4EF9A 2CBVA 4CNTA 3HTWA 4OU1A 3DFYA 2DDXA 1J5SA 4PN2A 1VD6A 2GZXA 3A3WA 1KGUA 4HT3A 2XIBA 1TV4A 4GOAA 3RR1A 1KBJA 2OQLA 3B8DA 4AXKA 3PJUA 2XPKA 3STPA 4AZBA 2CHRA 3KUMA 3BLPX 3DFPA 4MJ4A 4YTUA 3TA6A 3LX9A 3ERPA 3PSVA 4ADTA 3E1F1 3MYPA 1KGXA 3SN4A 1G7UA 3QSTA 2IUZA 1MQRA 3WF1A 1S2UA 1JDEA 4E2OA 3QR1A 3WLHA 3BE7A 3HOJA 2NX1A 5GJPA 3CQJA 2ZUNA 4JEQA 2GVGA 3A24A 4L4PA 1UD3A 2C18A 4HP5A 3W84A 2Y7DA 2WW5A 3GXFA 3T8LA 3U7BA 1GOKA 4JIPA 1XD0A 1UQZA 3MZNA 4JL2A 1HJXA 4XSMA 2VR2A 1SZGA 8TIMA 1WXZA 1Q66A 2CESA 1VAHA 3BMXA 3I3BA 2J6VA 3W7HA 5AC6A 2VENA 4D6EA 1RA0A 4J28A 2PDYA 5FEWA 4FHAA 1R3VA 3BGGA 3WF4A 2EJ1A 4Q8WA 1LORA 1NJJA 3QV8A 3O0KA 2GVYA 3AYSA 4HU3A 4MKVA 5EBAA 2Y89A 2BVWA 4JFSA 1T0OA 1AQ0A 3AS0A 1ZHAA 4OGZA 1FDJA 3MI3A 2CHNA 1IZKA 2DT1A 3GO2A 3TIMA 3LUTA 3QOKA 3TN5A 4PMNA 5XIAA 3BOFA 4MWAA 4H9ZA 2B7PA 1ZJIA 2A3CA 3GC2A 2VP8A 2CITA 2V5KA 1I1XA 2Z1XA 1TE6A 2D69A 3BUVA 3NXFA 5HNUA 2ZXBA 3G0UA 3GYEA 4GH3A 4UTFA 1VFSA 4CKQA 1E40A 4HU8A 3S0CA 3KS6A 3XISA 1V5XA 2Z1WA 4FOUA 3BLKA 4KEUA 3VM7A 1O5XA 4URIA 5J04A 3TC7A 3WMBA 4JXCA 3Q45A 2NQZA 4JN7A 2QUVA 2ZIDA 2NLIA 4M29A 1UCWA 2JQXA 4DQWA 3ZS4A 4QG9A 4FNTA 2O92A 4O4VA 1QWKA 3QZEA 5A6SA 3RFAA 4XAFA 3TNBA 1H7XA 1VJZA 4UFKA 3GU9A 2ZA2A 1VBUA 2FDSA 1RD5A 3GG7A 2ISWA 3AXHA 2L5HA 3O05A 1EQCA 4A35A 2PDIA 5I5RA 3VOFA 1ONWA 4ONVA 1PYFA 3BW3A 1W37A 1QXLA 1EYEA 1PL9A 5E93A 3CU2A 1HJQA 2FJKA 4EX4A 4JN8A 3EOUA 2DT0A 4GQGA 3W7CA 4C5ZA 5C0QA 2QF7A 5H6HA 3NQFA 3ZSTA 4GKTA 1D7KA 3I7RA 4NNCA 1DEDA 3SCQA 2Z28A 3VIPA 2BVYA 4PBGA 4X2PA 1GQJA 4IM4A 1R2SA 1TV8A 1V51A 1LQAA 1KBKA 2GDVA 2WZEA 5LIXX 1A3WA 4LC8A 2YZ5A 5I03A 4MY1A 2VZOA 2X1TA 1FX6A 1VFUA 1BTCA 1O1HA 1GOWA 4ZB5A 4WF7A 5EU9A 2J25A 4YVXA 2X8RA 3UWYA 2CKSA 5KINA 6XIMA 3R79A 4H2CA 4W7UA 3IJQA 2ZUMA 2NVDA 4AU0A 3H7VA 4JBRA 3W71A 3BW4A 4QP0A 3KP1A 4GGBA 1IGWA 4W8LA 3EXTA 1HUVA 2RJHA 3VNLA 4MAZA 1J18A 4J3VA 1H7PA 1QBBA 1ITUA 4H9TA 5CZSA 1VYSX 2E5BA 4M1BA 5I00A 2YA0A 3IGXA 1ITQA 1UKQA 5CAHA 5A6LA 5I06A 2R24A 1TR1A 3T0CA 1AH0A 3QM3A 4LWWA 2HNEA 2PRMA 1UG6A 4QROA 3WD0A 2VDHA 2ZVIA 5A2BA 1XPYA 1A53A 1VB9A 4OZOA 2YYUA 3P3BA 1RCOB 1QW9A 3HO8A 2Y63A 3CMFA 1NWSA 3HGJA 3RM4A 4W85A 2O55A 3B4YA 3VAVA 3MSGA 2C71A 1KM1A 4QQ3A 3WDQA 3EWWA 2QDGA 2CLLA 4GZJA 1K03A 2R14A 4MFDA 1U1JA 3TONA 2WMGA 2D0HA 2G50A 3O6YX 3VPLA 3GB6A 3N4EA 3QEZA 3F5LA 5C9UA 2DZAA 1Q6CA 4I5RA 3SY5A 3B0UX 2OYKA 4MWAB 1DQWA 1XRFA 2EO7A 4E3TA 1EIXA 1HJSA 2WVSA 1Q2RA 1P1MA 3T9PA 2IKGA 3OA5A 4CVWA 4J3SA 4NZ3A 1ME9A 2Y24A 3II1A 2ZWYA 4DXVA 2HDJA 4PL2A 4IP5A 5F1VA 1O1ZA 4BZYA 3QRHA 4MNLA 5HJYA 1LBMA 3THCA 5LSMA 3N11A 6ENLA 4TXEA 3VGGA 2GWGA 1BYDA 2PD5A 1XDLA 4BKNA 1HGWA 2PD9A 1EOMA 4GUGA 1V0NA 1N8WA 2E25A 3LHWA 3PTMA 4DBDA 1JVNA 4AWTA 2GJXA 2E3ZA 3W24A 4U28A 2FZDA 1YW1A 3TR9A 3CHDA 2BS9A 2VEGA 3I3EA 3HGSA 4KT2A 1V3JA 3WQ5A 1CNVA 2DEPA 4IMCA 4E2VA 3E9AA 1A4LA 4XVDA 4KETA 1A0EA 1F61A 1KM2A 1XYZA 4LYKA 3QMRA 1XCFA 3WNOA 3R94A 2PTZA 3PG9A 3O8AA 1MNSA 4UR8A 1UPMB 3O07A 4JFTA 4LOCA 2FZNA 1L2QA 3NSMA 4ASTA 4QQUA 4LX4A 1DWAM 3AS1A 2NQ9A 2D2GA 1GVRA 1KFEA 2ALRA 1KNWA 4JNYA 4ZE5A 4C6BA 1SFTA 2J27A 2INZA 1NF0A 5F7UA 4Z2IA 2NSOA 4N6FA 3UZ5A 4X0VA 3SQLA 2O4QA 4EK7A 1NDZA 4F0RA 5EKYA 4HSHA 2D23A 1DJYA 5JBDA 2PDCA 1TFVA 1TQJA 2F2KA 2BGQA 2ZA1A 1MNZA 3BZGA 3PJTA 2IKJA 4B5XA 5B7YA 1RQHA 3BANA 5FEXA 1N8IA 4Q7BA 3I10A 3VDAA 1BWLA 1KCKA 4PMJA 2GJNA 4YHGA 1RH9A 3LM7A 2QUTA 1VFFA 1OFRA 2HMCA 1MYRA 1Z89A 2WYSA 5JMUA 1JDDA 1GONA 3BDKA 5HQLA 1OC7A 3F5JA 4H8UA 4Q7NA 1VFHA 3VVGA 2PUZA 4XAYA 4KRUA 4UTWA 2W6RA 1ZUAX 1E6NA 4ES4A 3W02A 3T40A 4DXKA 1W1VA 2R1PA 1ZS2A 3GAYA 1QRQA 2OELA 1KRCC 3JZUA 4DXXA 3RPDA 3V5CA 4ZE4A 1UR4A 3OHMB 1I60A 5AHLA 2ZRUA 3WLNA 1UIOA 5LA0A 1DJIA 3TN4A 1OF6A 4GXPA 1R47A 4BHYA 3MWAA 5AHMA 2W4XA 4U5KA 4P8UA 3TAKA 3UG5A 2PZNA 1VGAA 3NL3A 1FHLA 3W2KA 1WBHA 3QLLA 2NX3A 2GDQA 3EAUA 3M46A 1ZFJA 1HO1A 3AISA 3ZR5A 4P8WA 2QCMA 4ZSUA 1LOQA 4TTGA 2OXNA 3AWNA 5FEZA 3EKZA 1V0LA 3UJEA 4O28A 4KCVA 3QTPA 4NX0A 2ZZ7A 3O6CA 4FA3A 1HNYA 4GY7A 3URBA 2FH8A 3S1XA 2TSYA 2VOMA 4RJEA 1NY1A 3KW3A 3W7PA 1U5JA 4JD4A 4WKAA 1OX5A 2ZFAA 3SY1A 4PTVA 3IAQA 2UY2A 2GJXB 3B8IA 2P8BA 5G4HC 1H0GA 3G8EA 5D05A 3T0BA 3WDRA 2FJUB 3HMJG 2R94A 2QDHA 4CNUA 2B7OA 3QPYA 2OB3A 4RLIA 3GHUA 3SSJA 3F5KA 2C91A 3SURA 5C9WA 4EXAA 4DF2A 4K39A 1Q6EA 4GUJA 4WGHA 1KTBA 1EKOA 1E9YB 4BK9A 4AD1A 1Q6FA 2GLKA 2GPTA 1P0EA 2VOTA 4J27A 2YB1A 3OZOA 4C6OA 4CGTA 3K4WA 5DCEA 5DFAA 1BEUA 1JPIA 2DZXA 3RX2A 1RBAA 4AMCA 4GO8A 2O7SA 1T7LA 3P84A 3TVAA 2GGHA 2WXDM 5LNUA 4C7GA 4DY1A 1R8LA 2H9AA 4JTRA 4KWSA 2ISSA 1GHSA 3FIGA 2FHFA 1HJUA 2BXZA 4MNJA 5JUVA 1W3KA 1VH7A 3GK0A 1UWAA 3A6OA 4ZOCA 1V6VA 1TVPA 2A85A 1E71M 1FHDA 1LL6A 1OC5A 1V3MA 1WE5A 4QXIA 2V67A 3E96A 1UR8A 2RDXA 1YDYA 1UP3A 3BK0A 3MTWA 4P7LA 1EZWA 5A8MA 1EX1A 2GQ8A 2BFGA 2XYLA 3AZRA 2QJMA 5DX7A 1OFQA 1CI1A 3CUIA 2FLIA 1YE4A 3G1VA 1T8XA 3DYOA 3FDKA 3SN0A 4AEFA 2W63A 4NNAA 5D9NA 3FY1A 2QJGA 3PZMA 3HGRA 4IFOA 3W86A 1FBAA 4C60A 3PPGA 2IPJA 4NYUA 5D9MA 5IBXA 1YQ2A 3IGUA 4NZ4A 4GFSA 2F2HA 4AISA 3O6AA 4C90A 1HTIA 3KBSA 3CMGA 1P4CA 3FKRA 3VXGA 3FYOA 4DJFD 3WLSA 1SUXA 3TTSA 1G5AA 2QUUA 2YL8A 2Z25A 1UP0A 3HPXA 3TOPA 1PIFA 2DT2A 3TLLA 1VC4A 4UTLA 4JTEA 1S2CA 3L4UA 2WC3A 3Q37A 2BHUA 3AIWA 3GQYA 3GNNA 1GVFA 4ZENA 2QXWA 4RXFA 1VLIA 1NTHA 5LA2A 3FOKA 3BSGA 1ZCOA 2O7QA 4RDWA 1EIBA 1CXLA 3WD3A 3PSWA 4C6LA 2OU4A 1V6TA 4MNKA 4NILA 4FXJA 1JDCA 2YIHA 3G0SA 1OFBA 2WB5A 5D03A 2IPWA 5D09A 1ZAJA 3PBUA 1JDFA 4YTSA 2WHMA 5HJXA 3VI2A 4H9VA 3L0KA 4AC1X 1WDWA 4N9BA 3THUA 4AHOA 2VFIA 3W85A 2GWNA 1KB3A 1BAGA 1F8IA 2CBUA 3AMDA 1PUDA 4MTVA 3HF3A 4PTWA 1Z6KA 3UNTA 3DKLA 4TVUA 1ZP3A 1L6WA 2PRHA 4YWSA 3MO4A 5BOFA 1TG7A 1PS9A 2VX6A 1QHPA 1FVPA 1W31A 2Y7FA 3C0SA 1Q6RA 4IXXA 1JCXA 1XH1A 4N0RA 3UEQA 2TMDA 5C2GA 3C8NA 1BSIA 1LL7A 4MPQA 1HQTA 2JGYA 3IK2A 3WF3A 2TAAA 3VMNA 1KBBA 2PDMA 3I68A 3A3XA 4LY4A 1XGEA 2YLLA 1JPDX 5C54A 4DN1A 1LDCA 5EMLA 1VZWA 1EBGA 3L4YA 1SW0A 1X39A 4FNUA 4OOUA 3B0YA 2XZ7A 4MJZA 4K68A 3F4DA 3MT1A 4QCFA 1OQFA 2Q02A 3S6TA 3R5EA 2H9AB 2E5CA 2XFYA 2FQIA 3TAOA 4A8LA 4H6RA 1PDYA 2V2DA 3S42A 4HA0A 4NSBA 3WFAA 2OGYA 3GIPA 4BFAA 1QI2A 3KVMA 3OVQA 1EUAA 3EWUA 4M3PA 3PUGA 4PMOA 4JFUA 4ADSA 3ZT5A 1J0IA 3R13A 4RZ4A 3WLLA 3AHYA 3Q4DA 4A3QA 5A69A 4Z42C 2WHKA 8CGTA 3NVTA 1S38A 1BGAA 3DHFA 5E09A 2ISDA 3HBLA 2O9PA 4LC6A 3B3DA 2X0SA 5ABFA 1IF2A 1DIOA 3WNLA 3N2TA 1I0BA 4MUPA 3WLOA 3RHGA 3CPGA 4F9DA 1FH9A 4FX7A 4OVXA 3S5ZA 1D3CA 3NG3A 2YLAA 3SCWA 4DBWA 2XHYA 2QLYA 5CSSA 1I9CB 4ZTXA 4B5TA 1FH7A 2W62A 3GTIA 2YZRA 1XLHA 4Y90A 3CWNA 4DZAA 2XJ7A 5TAOA 3WLIA 1EGMA 1OVDA 3WLMA 4M0XA 3V75A 4TMCA 3AMCA 3IIPA 1RVKA 2XM2A 1VEOA 4F2TA 3G6LA 3NDYA 4OIFA 3KX6A 4NZCA 3NEHA 2EPHA 3O0FA 3GG1A 3W2LA 1YXCA 4IGHA 4N9DA 1I75A 4AIEA 3TA9A 4NU7A 1C8QA 3EDFA 5EA9A 2JKEA 1PWLA 2PDJA 3ARRA 4DBSA 4GUIA 5FA5A 1AFSA 3HG4A 5BW6A 2Z1VA 3EA2A 1P0BA 5LIUX 1H1NA 4FALA 9RUBA 1OJXA 3LLXA 3GNXA 3OODA 4WR3A 3NOEA 1V6WA 3GRIA 3UWEA 4BY3A 1FWCC 1RY0A 1T41A 4Y9OA 3IUHA 1IHIA 1W9XA 3R0DA 3E74A 4C1NA 1EF2A 3LPFA 4U10A 1XFCA 5D9OA 2CERA 3LTSA 3VZXA 1NWTA 1ZSXA 4OOZA 1TV2A 4LYQA 5BROA 3V0TA 4GZEA 4B5WA 3V3WA 3TJLA 1B9BA 1ICSA 3WLKX 1FCBA 1FA2A 3BICA 3DXIA 4G2DA 5AC7A 2DVTA 2ZX8A 2KAUC 4GD0A 1HL9A 4M7SA 4PMRA 1Q5MA 3GXTA 1ISZA 6TIMA 2D3NA 5CJ5A 2CEQA 3IRSA 4L6DA 2GK1A 1PV8A 2V5DA 4TIMA 1UBPC 2OLAA 4H83A 1LOSA 2NV9A 1XG4A 1YX1A 4HHMA 1E6QM 3M5XA 5FF0A 3EPOA 4LUJA 4PRWA 4AZHA 3WQGA 1XYLA 4PTDA 4IGMA 1RUSA 3DFQA 1UJQA 3RK8A 4DYJA 3CQKA 4U3AA 3N2XA 3TQPA 3NL6A 1FWGC 3SRHA 4O10A 5LXEA 4PSRA 3RMJA 3HA1A 4IMFA 3W1NA 2FIQA 2QVHA 2QV4A 3MSYA 4IP4A 4LYRA 1HX0A 1TMLA 1MXSA 3GY1A 3VOIA 3HZ3A 3KFTA 1SU5A 1T99A 3APYA 1GEQA 5ABFB 1DHKA 3LV5A 2CXGA 3PBVA 2R9RA 3R0UA 5D2VA 4A8RA 1OCQA 4M80A 5FSEC 1R85A 1UD4A 3PAJA 3U2EA 5FF7A 3S1VA 1G4EA 2CLPA 3LCXA 2PWHA 1C90A 1H61A 1VHCA 2UY5A 1M03A 2NWRA 4OBTA 2RDTA 1S39A 4KWUA 1H5YA 2DZTA 3NA8A 3VU2A 1YDOA 5AC8A 3AWOA 3EGJA 3K30A 4DRSA 4YLWA 4HN8A 5KZMA 3MSDA 4UC5A 2YL5A 4WVXA 4GI9A 4EWND 1KLZA 4F40A 3AYTA 4JR5A 2DJLA 3MP4A 2PC8A 3ABQA 2J7DA 3N4FA 2Y5JA 3U6WA 4AD2A 2P50A 2YXGA 1BXNA 5KTLA 4JICA 2DZWA 2I9UA 1PBGA 2ZX6A 1J9YA 3CT7A 2ON3A 3B8TA 3W75A 3TYDA 1TQXA 4IPJA 1AL7A 5EFDA 3KWSA 4A29A 2VUYA 3GKFA 3UCQA 3O63A 3RM8A 4B4HA 2V8ZA 1G4PA 5AHIA 2DT3A 3L4XA 3TN6A 3LV6A 4DNHA 5D33A 2JBMA 3LSBA 1GZJA 3I4EA 4QS5A 4GINA 1GORA 4KRTA 3QLDA 3E49A 2IXVA 1ALDA 1W5OA 4C1NB 4C6CA 4X63A 3UNDA 3WBEA 2B7QA 4R9XA 3GIQA 2W3ZA 4XB3A 3WDPP 2J77A 4XBSA 2BLEA 3JU2A 1TELA 4YXGA 3VGBA 3OIHA 3FS2A 3V4BA 3PFMA 3W7LA 1W17A 1Y65A 4WSJA 6ALDA 1V8EA 4ZMGA 1FXPA 4PBFA 2DZBA 3NO3A 3K2GA 4LCQA 4W89A 4O11A 3ZO9A 2CFFA 4IQLA 2YX0A 1SZRA 4AY8A 4JCMA 4DZIA 3VUSA 5C9XA 1HVXA 2AMGA 2GK1B 3M6DA 4HMEA 1IXPA 3W7QA 5E0CA 1DTUA 4R85A 1E4NA 5F4XA 4MLRA 4GVIA 1PVNA 1IGSA 1OWQA 5DRIA 1Y7VA 5BXPA 3MP3A 3W73A 4MWAC 4C65A 1XIBA 2DV0A 1PCKA 1CGYA 3U9IA 5JH1A 1Y5VA 5HR6A 3NEVA 1R0MA 1GOMA 4JDYA 4OTKA 3PANA 4B91A 3GW3A 1H1ZA 5D37A 2GQ3A 3QJAA 4R7WA 2HS8A 4HA4A 2J88A 1W8GA 3SAZA 3WFZA 2VX4A 3F2CA 4GY0A 3LGEA 3KVKA 1SZFA 1H4PA 2J79A 4N6EA 2XG9A 4NG3A 1IEQA 3LOTA 3GXIA 1F7BA 3KM8A 3KCOA 4PFMA 1PKLA 1KXTA 3NQ2A 3GNOA 4XVEA 3WQ4A 3FAXA 3WQPA 2GSJA 3CQIA 3T44A 3M0IA 4NZFA 3N3TA 5TNVA 5EY5A 1GVSA 2W5FA 4I5UA 5AKQA 1KXVA 3NQVA 3T1GA 1X6NA 1OGGA 1HJWA 1EJUC 4GIRA 4K8HA 1Q4NX 4GNKB 3NQBA 4QNWA 5MF5A 4QNEA 1DXFA 2HWGA 3IJLA 1ONXA 1RZMA 2QJNA 2YA1A 2WNNA 1E43A 4NNBA 4CEUC 4B9YA 2VC6A 1J6PA 3W00A 5TF0A 2EEXA 4S3KA 3AFBA 2ANUA 4GXWA 3P5YA 4ZQMA 3URAA 2D73A 4ZCWA 3ES8A 2ACRA 4Z1CA 4O52A 5BXRA 2HROA 3ZT6A 1M65A 3QXBA 2EG6A 2DH2A 3VD9A 2J7CA 1A5BA 2PDNA 4KF1A 1WKDA 3S5NA 2UY3A 1TA3A 3C2YA 3TJ4A 3U2ZA 3W2NA 4AAJA 3UXAA 3BOXA 1UH3A 3NIYA 1IT0A 2Y70A 1BLIA 1P6WA 4YNGA 4ZO6A 4H7ZA 4GH1A 3ITYA 1G94A 3TYEA 4IP7A 3GH5A 4B16A 3O1NA 1E72M 3M9YA 1VFTA 3OG2A 3ZWSA 3PPHA 3TZFA 3WBWA 4NJIA 4PSPA 4I9MA 1A5OC 1MWOA 4PUJA 4K7YA 4A2RA 3W22A 2PDGA 1THFD 1JYVA 2X42A 2G95A 5DQPA 4ICCX 3BO9A 3BJTA 2DSWA 4H3DA 4L1WA 3PZUA 5DF0A 3QTGA 4OV9A 3MBFA 4JTJA 2DPEA 3GDRA 2W0UA 3RO6A 5I2UA 1IXNA 3URNA 3IIXA 3KE0A 1MQQA 4PMQA 1GOXA 4I8DA 5JQ9A 5FJJA 3URQA 2Y7GA 3WQVA 3LGDA 4KEVA 5K4XA 1QO2A 3QHNA 1O95A 4ROQA 5ABHA 4K2SA 1NELA 4LW7A 1E5NA 2VFEA 4PUDA 2Q6ZA 2YXOA 5AYIA 4I9AA 3CHEA 1TUFA 3T07A 1AH4A 3FEQA 2EAWA 2QCLA 2PURA 4FNRA 3RPTA 4N9EA 2ZICA 3WH7A 3V0SA 1OYCA 5E6YA 5IFTA 2I5IA 2EPKX 2IKHA 3TXVA 1TVLA 2VQTA 4FIQA 1PHWA 1K1DA 2VFDA 4NJKA 5FJRA 4KRZA 1VFOA 3CXOA 1UWUA 2EG8A 2GOUA 2WMFA 1OG0A 1LRTA 1K6WA 3PZTA 1UOKA 4IISA 2AKMA 3EOOA 3UVAA 3VIFA 3ZJKA 1E0UA 1LCOA 4OBRA 1MUWA 3GIYA 1SO4A 2A0NA 3NVDA 4AIOA 4F0SA 5BRPA 4AMAA 4QX4A 2OCZA 3GTFA 1JF6A 2X1UA 3W2MA 3WNPA 3FHAA 1RSCA 4FP1A 4YTRA 3DKJA 1DE6A 3W25A 5A5WA 4Q8PA 3NDZA 3BOLA 4QITA 3PBYA 3BLLA 2BOFX 1K9EA 3W74A 1ZAIA 4JTKA 1C93A 3RG6A 4DNMA 4QSFA 1JRBA 4I90A 3E2QA 1ISXA 2OWCA 5C9RA 8A3HA 7CGTA 1CLKA 3P2VA 2ONEA 1SFLA 3PUDA 3LHVA 3EYPA 4PBEA 4GUFA 3WMSA 2YCLA 3HJZA 3ZR6A 2JK2A 4J3ZA 4REQA 2WSKA 5DEZA 4GG9A 1B30A 4O1CA 4RE0A 2YW4A 1H5VA 2JIEA 3ZWTA 4H00A 4AC7C 1WDPA 4O53A 1JI1A 1TV7A 4Q8VA 4AWSA 3B0XA 2Q8ZA 3QW4B 2G5WA 1TA3B 1SSGA 1X1OA 3H2NA 4ZTYA 1XYAA 1I1WA 2BBFA 4ERAA 2VGBA 1UKTA 4P8VA 4LU0A 4XK2A 4A3RA 2E6AA 1RPXA 1SZNA 1H51A 3ZVHA 3B9NA 3VGDA 1CXFA 4IIEA 1TX2A 4FNQA 1UWSA 2H6RA 3GDMA 2QCGA 5BNKA 3F03K 3UCDA 3AUOA 2WCAA 3EWDA 2P0IA 2NSXA 3APTA 1SW3A 4DPQA 1QWGA 2WMIA 1SSDA 4OHQA 2ZVRA 4R33A 2EPNA 1I2NA 2OJPA 1TSIA 1KWGA 2VC5A 4RDZA 3GFXA 3RITA 4QAIA 4GJ1A 2WNQA 1EDQA 3GAKA 5A6TC 4AF0A 1BHGA 3CH9A 5D38A 2E9LA 5CPTA 3M64A 1GZGA 2NZLA 5FSDC 2V81A 4A21A 5C2CA 1TWDA 3QKZA 4ZR8A 1WZKA 4AEEA 2G3NA 4LXFA 4LAOA 4B2DA 2GDUA 3RRXA 4GZ7A 3TW9A 2PP3A 3LN3A 3NZ1A 3BQ5A 1B3XA 4LAZA 1K3UA 1XLEA 2VZVA 2B4GA 1GPWA 3AHZA 4BQ5A 1FUYA 2G3MA 2ZKMX 1NOWA 2VVSA 1FHUA 3H21A 3OIXA 3ATZA 4KFPA 3KRSA 2DORA 3STFA 1BD0A 2G8ZA 2FGZA 1CGUA 5FCZA 2JKPA 4JS3A 1OF8A 3CUXA 4ZO8A 1PYMA 3PZIA 1BTMA 1DTNA 1FDYA 1OFDA 3NQMA 4X22A 1LWJA 4EPKA 3M0LA 1H1YA 1P0DA 2TODA 4ATWA 1JRCA 2HBXA 3ARUA 5M2FX 1QCWA 2FFIA 4GYPA 4B2DD 2WOQA 4G5DA 3WQ6A 1R2RA 1QNRA 2ZWZA 1QNPA 1V3HA 5A6AA 3VD5A 3PBWA 4NZJA 1E6SM 4B5VA 5H2ZA 3PUEA 1RY8A 4IL2A 1XGZA 1MXGA 1QU4A 1NDVA 4GE8A 1GG0A 3W7OA 1ONEA 1XKJA 1OB0A 1XYMA 3E3HA 4LUTA 4TV5A 4O13A 3NGJA 4IFKA 2YBTA 2GUBA 3RUBL 1TJ1A 3UWVA 1OK4A 1EDGA 3S6OA 4UNIA 2FPVA 4BF7A 4TOQA 3OJGA 2WHJA 4W86A 1LLWA 3UCCA 4Y8EA 4LNYA 1BFNA 3DU0A 3UY7A 2YKKA 2X09A 3H8AA 3AROA 3KZSA 4XKMA 2C0AA 3BGAA 2YCLB 3EWZA 3KLKA 2VYOA 3MUAA 5C8BB 4IGNA 2EQDA 1VCVA 1XICA 3UPBA 3A9BA 4REQB 2NLYA 4LVFA 4DM1A 2E4TA 2RH9A 1F4AA 3DZ1A 1SPQA 5K9XA 2E09A 1HKWA 3AXXA 1WCGA 4O0KA 2I9EA 2JFEX 3BG3A 4RE4A 2BSLA 3LQLA 5C2XA 3K8KA 3O7UA 4A8NA 5PTDA 1XQLA 1E4LA 4HPJA 1QAPA 3XIMA 1OD0A 3KVLA 3MUCA 2WZTA 1POJA 4CCDA 3ZVHB 4K37A 3SRKA 1XLJA 1EQPA 1R3YA 1KRMA 4DJFC 3LMYA 3TH6A 4P7QA 2NXIA 1V3IA 2ZXQA 2YDAA 4XTDA 2WMIB 4GRSA 4B5NA 3USBA 5LNSA 3BTNA 3TCSA 3A4WA 1K4HA 2Y88A 3L21A 4AZGA 5G1YA 1HO4A 5MHBA 4KCWA 3I6EA 1BVWA 3THQA 1YRRA 2QCEA 1LWIA 2AGKA 1QNVA 2DSVA 3STGA 2I16A 4UQDA 2OYLA 1OBAA 2WJDA 4AF0B 1K8XA 5IBXC 5U4NA 3U3HA 3E5BA 3A5FA 4GGHA 4CQDA 3DYMA 4O1AA 1G0CA 3UGRA 3S46A 3RM9A 3VA8A 3WNMA 1NFGA 1W56A 1Q6GA 3EPMA 4ORMA 3RJYA 1GJUA 2VC9A 4CQ8A 5F2GA 3KXQA 3NZGA 1QFEA 2Z2UA 4OJYA 1MSSA 1VBGA 1LT8A 3GNPA 4HOZA 2A3BA 1VF8A 3TV8A 3WQDA 3CQ0A 4OV4A 3GM8A 4ICNA 2HPIA 1UD2A 2A6LA 3UWWA 1EBHA 3ZLGA 1P0NA 2WWDA 2XWEA 4W84A 2XVKA 2BP1A 4W8BA 5K4ZA 2A21A 3NL2A 3G1XA 2WSPA 7ODCA 3OZYA 2A1YA 3GDTA 1POKA 2DSKA 4MYAA 4MIMA 1Z8AA 3NO5A 3Q2DA 4UTKA 2XSBA 1MUCA 4OE7A 3B97A 3S9ZA 3QY7A 4CVUA 2XIOA 2ZC8A 3W7DA 1YADA 4WDWA 3WMCA 2V38A 4MAVA 3B8UA 2V68A 1V02E 1S1RA 1XV8A 4S23A 4C6FA 3VD4A 5CAKA 1ADOA 1QPNA 2G0WA 1UWIA 1AMKA 3PTDA 5CQ1A 3R6IA 4HB7A 3N2OA 2NT1A 3DHDA 1VYPX 3AAMA 4E4UA 4D1IA 1VEPA 4LUSA 4LUTB 1Q13A 1EZ2A 1T6MA 4O15A 4XAPA 4IFKB 5EYWA 1VLWA 4YWIA 5I0DA 3T09A 3MBDA 4I6KA 5L6UA 2PF8A 5JU6A 4GQBA 1FP9A 1V6XA 3ME3A 4NI8A 4RX0A 1ONRA 3ABRA 3VMPA 4H9MA 2D20A 1J0JA 3L12A 2F6UA 2CU0A 1RD6A 2XSXA 3KLLA 3SB0A 5A94A 3OGSA 4QLJA 1V0KA 4Z1BA 3P5ZA 1RQBA 3TXZA 5LGXA 3R4IA 1PXGA 1RJRA 4Z0SA 5AFDA 1XBYA 3ARQA 2HJPA 3KOWA 3VUPA 1HGYA 3HPAA 4N02A 3VZYA 1P7TA 3BG5A 4WXYA 1XLCA 3HPZA 1UW9A 3PWAA 1US0A 1UD5A 2F7FA 3C61A 4OUIA 4AHQA 3ARSA 3WSUA 2JF7A 4RNFA 1VBJA 1E15A 2Y6ZA 4JTSA 4PODA 3N6JA 3IUIA 4J9JA 2YCIX 4H7VA 3NOYA 2X0HA 1B3YA 3EMQA 1WUEA 1ZLPA 1A4MA 3OYZA 5HAOA 3A23A 4L80A 3BH4A 5DN1A 3V0UA 3CL8A 1C92A 3FLUA 2FVKA 5SWUA 3T7VA 4GHRA 3USZA 4EXQA 4EPBC 3B0VC 4HNUA 5CZJA 2NW0A 4WK9A 2E1DA 4Y9PA 2VVNA 5DXXA 3LRLA 3VIKA 3WJSA 1J8VA 4XWUA 3AXKA 3MI6A 4XUGA 2OPJA 3ONCA 1MFVA 1SZEA 3KOZA 3LPOA 3MS8A 3BURA 3BCFA 2GGJA 5A8PA 2YGYA 1GUVA 3G3DA 3A21A 1QPQA 4ROPA 4TVDA 4FXRA 1FHVA 1EHAA 1YNQA 2FTYA 2ZRYA 2Z29A 2EXOA 4PFHA 3WQFA 4CQCA 3SQSA 3ZR4A 4LV9A 1S5NA 5CG7A 3GYCA 4G6CA 1AODA 3GD6A 1EC9A 4JEJA 2YJQA 1VFMA 2V5JA 3HG2A 3OTRA 4F3HA 2OKTA 3ONBA 4J3WA 3SCOA 4CNNA 1QW8A 1WP6A 2BX7A 1UUOA 3NWRA 4P2VA 4R27A 5H91A 1FQ0A 1T8QA 2FB2A 3QH2A 4D8LA 3QC3A 1GZ1A 5FEPA 1ICQA 3W29A 5AC4A 2PU1A 2QEZA 3S4TA 4ML4A 1R3QA 1GWJA 4DVOA 3EX1A 1QPOA 5IHRA 3IJ6A 2VTFA 4K1GA 4TO8A 2C13A 4QSHA 3TLQA 1KWKA 4LEQA 3OVGA 9XIMA 1GQNA 2OO6A 3KEHA 1ZZMA 3VMOA 3WY1A 4HMDA 3M16A 2VZSA 1D3HA 1A3HA 1TE1A 3U7VA 5F4SA 2ZUUA 1UBSA 1EPVA 2PCEA 4JIHA 1M5WA 4O17A 1GKPA 5HPCA 1EO7A 3ORWA 1MQPA 2RDWA 3MP5A 4RE3A 3F2DA 3CZGA 1NP2A 4LUSB 7A3HA 2XGZA 3HM7A 3OLIA 1OFPA 3DGBA 1TRIA 4L6OA 2DZVA 1KXQA 2CCRA 2BY0A 4HA3A 3GUWA 3W28A 2WMKA 5I09A 1TZ9A 3GZAA 3HV8A 1LLOA 3KBMA 1TB3A 2J7GA 5CZTA 3N13A 1JUKA 4ADUA 2VEFA 4B92A 2ZZ2A 2WCSA 5BXSA 3WUEA 4B5SA 5HJLA 3TZNA 1PEZA 1DQUA 3BLFA 5CKSA 2XH7A 4WJ8A 4JHMA 3W81A 3NNTA 5HK4A 1P7TB 4H2HA 2HQAA 1U30A 1IWBA 2BY3A 4OFCA 5CXPA 1K8ZA 3BVJA 3M43A 3VZZA 3QV6A 4LANA 4H9YA 4FLOA 3UF9A 5B7ZA 5M5DA 2V3DA 1M7PA 1LZOA 3SFKA 5E9XA 3CASA 2WKGA 2PZ0A 2Z27A 2GVJA 4MGGA 3KWXA 1LWHA 3GC5A 4IX0A 4BJHA 2GJPA 2A2IA 3OZMA 2VKZG 4IQEA 3TYZA 3PJWA 2OQHA 2PDBA 3CQHA 2NVAA 2I56A 5CPLA 3TMQA 4BEQA 1YPFA 1DJQA 1TTJA 2DFAA 3WYZA 1DWGM 4O0QA 1FWSA 5IDIA 2WZIA 3SUVA 5I3FA 1M41A 3QMTA 2OO0A 2PP1A 3DENA 3QVQA 2AOSA 3DBPA 4LNCA 4EAMA 2I1OA 1KD0A 2CWNA 2B81A 1A5SA 4MZYA 5REQA 2BZNA 2PLMA 1YTKA 3TWAA 2HNHA 1PCWA 1H49A 5CGTA 1O66A 5TIMA 4YTTA 3RNDA 1UD8A 3GTNA 4K6AA 3TUUA 4MOZA 4FXSA 4JN6A 1O4UA 5I3HA 3ABXA 1UASA 2Y0FA 3SCUA 1M53A 3NTYA 3WF0A 1ZGDA 9XIAA 4FX6M 3U5UA 1XBVA 3OLEA 5HMFA 2DH3A 4Q7IA 5CBBA 3GR4A 3RLUA 5I02A 1JYNA 4J3UA 2DSUA 3E2VA 2OMAA 4EIVA 1I2OA 3M5VA 3T81A 3MANA 2RJGA 3ITXA 3W1AA 3ITTA 3BWWA 4JHOA 4TTUA 1XCWA 4CCCA 1Z7AA 2GOKA 3HG5A 3P74A 4KWOA 1QATA 2J7EA 4RUBA 3W38A 2H3DA 1QK0A 3DHPA 2ACSA 3UESA 3W1MA 4HYRA 1JZ3A 5FJOA 4IQDA 3WX7A 4CQ9A 3V35A 1DJXA 1FCUA 4R9OA 1LT7A 2DY3A 3KBVA 1LG2A 3LDVA 3G1AA 3YPIA 4WOQA 4YVPA 1ZY9A 4F0HA 3FAWA 3GW0A 5IXEA 1EJWC 3CZJA 4RKAA 1RCXB 4GC4A 4AD4A 2J8TA 1Q7QA 4FX8A 5JBFA 1YNYA 4W8AA 1L0PA 3GG0A 3SRFA 4NRRA 4MHBA 3D3AA 4X9YA 2XFRA 3VIIA 2NQLA 1J5TA 5KZDA 4IWWA 3IK4A 4Y8FA 3IACA 1DJWA 1V08A 3QFEA 4V1XA 4GWEA 1L8PA 3F4VA 4IIDA 2OZ0A 3V5FA 1QHZA 1CT5A 1IIHA 4XTIA 4BS0A 5K7JA 1VCGA 2GJRA 3V1HA 4V15A 1KFWA 3NPWA 3ZJ8A 2NWSA 3BPWA 4Z1YA 3AIRA 1T96A 3CM4A 1ZALA 3JVAA 3KL0A 4O1FA 3GHSA 1E6PA 1V3KA 2VCBA 3I65A 3MHGA 3FGCA 1F9CA 3A3HA 2ABAA 3BJSA 4AD3A 3HMCA 3UD6A 2CLFA 1FOBA 4UXDA 3MCNA 2VL4A 1W5QA 4F0LA 2X1SA 4GVGA 4A4AA 5FF3A 1GJWA 2H8XA 3SN1A 4TUFA 1YIXA 1W2VA 1HKJA 4CD5A 5HWNA 5I3IA 3NZRA 4UBPC 3E0IA 1ZAHA 4HSOA 4LRSA 4W7WA 4HVXA 2J7BA 1ML1A 4L65A 1F5ZA 1S2TA 4GFIA 5KEZA 2G37A 5FJIA 1IR1A 1H62A 1OCJA 4PL1A 3EA1A 4FF7A 3T4WA 3NL5A 4D6CA 1AQFA 3EWCA 1OCNA 3WDIA 4GISA 2W61A 2FB3A 3JS3A 3BAKA 4BQ2A 4UTTA 1LF1A 1UZ4A 3DCPA 4YIWA 4ZSTA 5REQB 3U57A 1XDMA 3EWBX 3JW7A 3MMTA 3R89A 1RJQA 5DY2A 5JIWA 2PWFA 4LT9A 3ANUA 4AY1A 1H3GA 3SDOA 3QFWA 1OYBA 3E0FA 3PB2A 1RVGA 4S2CA 9CGTA 2PBOA 2P3ZA 1EXBA 4RZ5A 2R1MA 3FVMA 3LQGA 1FCVA 4R3UA 4N7QA 1QJWA 4KKXA 4MVAA 3VIHA 3HIJA 2C79A 1M3UA 2HS6A 5IDZA 3PVFA 3BSHA 1EP2A 4A2SA 4E8GA 4E4FA 3BMVA 3LNMA 2VXNA 3C52A 2CLIA 1M01A 4UCGA 3QYSA 1W9UA 2QIWA 3BV4A 3N15A 4E38A 1J0KA 3SZ8A 2WNWA 3C6CA 5EMUA 3H2AA 4RL3A 1BYBA 1WDRA 4XZBA 3ISIX 4C1KA 2C15A 1Q2SA 4MF4A 3RF9A 3KOYA 4Q8TA 4AG0A 1N8FA 3WBAA 1XLLA 3CHCA 5IFPA 3GWQA 4AX6A 3AI0A 1B0IA