3FKRA

Structure of l-2-keto-3-deoxyarabonate dehydratase complex with pyruvate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
304
structure length
303
Chain Sequence
TPRHRGIFPVVPTTFADTGDLDLASQKRAVDFMIDAGSDGLCILANFSEQFAITDDERDVLTRTILEHVAGRVPVIVTTSHYSTQVCAARSLRAQQLGAAMVMAMPPYHGATFRVPEAQIFEFYARVSDAIAIPIMVQDAPASGTALSAPFLARMAREIEQVAYFIETPGAANKLRELIRLGGDAIEGPWDGEEAITLLADLHAGATGAMTGGGFPDGIRPILEAWREGRHDDAYARYQAWLPLINHENRQSGILTAKALMREGGVIASERPRHPMPELHPDTRAELLAIARRLDPLVLRWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of L -2-keto-3-deoxyarabonate dehydratase an enzyme involved in an alternative bacterial pathway of L-arabinose metabolism in complex with pyruvate
rcsb
source organism Azospirillum brasilense
molecule tags Lyase
molecule keywords L-2-keto-3-deoxyarabonate dehydratase
total genus 110
structure length 303
sequence length 304
chains with identical sequence B
ec nomenclature ec 4.2.1.43: 2-dehydro-3-deoxy-L-arabinonate dehydratase.
pdb deposition date 2008-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3fkrA00
3MI3A 5CZJA 2CZ5A 4NXSA 2NV2A 2H3DA 1KLZA 2RDUA 2JGYA 2WJZA 5D2WA 3HMJG 1G6CA 4QJ1A 4RCXA 2ZZ7A 2BX7A 3O16A 1JCLA 4B5NA 3S5YA 2V82A 1FCBA 2W0UA 3NM1A 1VRDA 1F73A 2ALDA 4IXXA 1UBSA 2P1FA 4M7TA 1NEYA 1B4EA 2E6DA 2YW3A 1JCNA 4XTIA 4JTGA 5F2LA 3N3MA 4O1BA 1R2SA 3I65A 4XZ9A 3O05A 1S5TA 2PC4A 1TO3A 1G7UA 3S6DA 1W5NA 4IMGA 2HTMA 3W1RA 3NNTA 1XDMA 4HNTA 4PFMA 3LCIA 5D2VA 2R8WA 3PG8A 4JX4A 3GDLA 4E2DA 2PCQA 4OV9A 5K7JA 1H1YA 3W70A 1TJPA 4HNNA 3C4UA 3EWYA 2VEKA 3FEMA 3S8HA 1FX6A 3GAKA 2QF7A 3TFCA 3B06A 4O4WA 3ANYA 1WXJA 4Q32A 4YCOA 3WJXA 2D73A 3HB9A 2GPTA 5J5DA 4L4MA 1OYAA 3T4CA 3HG5A 1GYLA 2DZWA 1TPEA 3MHUA 3QYQA 3NDOA 3UXDA 2DZUA 2ISWA 3EWXA 1V7YA 1F2JA 3EXTA 3L0NA 3M7WA 5C54A 3SFKA 2V9DA 3P67A 4XWUA 3O06A 2Y89A 4UR8A 5FI8A 4BR1A 4DF0A 4LU0A 3TQVA 3ZR4A 2JKEA 1OJXA 1FBAA 1TV5A 3UPWA 1TYGA 2FJKA 3L0GA 1JCMP 3BV4A 5EY5A 3W88A 1EUAA 4AB4A 2YYTA 1TPFA 4TIMA 1H63A 2XN2A 1TMHA 3O8AA 4NJKA 3UWWA 4PCFA 5HJLA 3HF3A 3LRLA 1G4EA 4Z1CA 1KFEA 1UUMA 3W7QA 3EWUA 2Z0IA 4AH7A 3A24A 3UXAA 1NSJA 3DFNA 3WJWA 1K7XA 3TIMA 4XBKA 1IXPA 2X1TA 2Q8LA 3NQFA 3PR2A 2HSAA 2X30A 3E49A 1C29A 3E02A 3PULA 4GUIA 4O18A 5CPOA 1MXSA 4IUOA 1ZY9A 3KVMA 3GXPA 3DFTA 3GYEA 1A5SA 1IIHA 3KRUA 1TCDA 4ZL1A 3MP5A 3UZJA 5E1QA 1H61A 1F5ZA 3C56A 4ZQPA 3WJYA 3STEA 4R33A 4WOZA 2CU0A 2E68A 3NXFA 3C3NA 4ZQNA 5KSWA 1TRIA 1BWLA 2Y85A 1PIIA 5K4XA 3MBFA 4ICNA 3C0JA 2X2GA 1GTHA 3W7EA 4AF0B 3QEZA 3B8DA 3TV8A 3L67A 1AW2A 3S5ZA 2X1RA 2C18A 1OFQA 4ZQOA 3HGRA 2A5HA 5IBXC 5DY3A 2CWNA 4AXKA 3L5MA 1KV5A 1ZNNA 1TTJA 1IXOA 1W56A 4MY9A 1LROA 1PCKA 1GEQA 4LTSA 4K6AA 3PS7A 3W3OA 2IQTA 1FWSA 2J27A 2VEIA 3HG2A 5SWUA 2YR1A 3USBA 4O52A 5EL1A 4FNTA 3G0UA 3O63A 1H5YA 4W9TA 3FLUA 4XBSA 3KHJA 3W2NA 4NX5A 3B03A 1A50A 4HSOA 2YXGA 4MY1A 1VPXA 3HO8A 4YCPA 5HR6A 1I2NA 4BF9A 2WQPA 2VXNA 3N2MA 5CZ0A 2WO5A 3WK1A 1QOQA 2OX1A 3MI6A 3V75A 3U6WA 3O1NA 3KX6A 3GNNA 1C9DA 3LDVA 4IMDA 2ZYFA 4MFEA 1RPXA 4MLRA 5I3HA 4S2BA 3LERA 5HQEA 4GXMA 1DHPA 1WV2A 3M43A 3W7KA 1KM0A 4LVDA 5BMWA 5J5RA 4Y8FA 3R5EA 1ME8A 4YLWA 3W7CA 1J2WA 3C61A 4AWUA 5F2GA 3YPIA 4NNAA 1LM1A 4JEQA 3OIXA 3TX9A 4NZJA 1ML1A 2LLEA 3CQ0A 3LI1A 1YDNA 3UY7A 4UTWA 1PVNA 1W0MA 1EUNA 2DJXA 1WBJA 3P81A 2ZRYA 3GDTA 1ALDA 5C6MA 3RLVA 1P5BA 4N9EA 4UR7A 3S1WA 3PB0A 3GDMA 1YXYA 2WNQA 2G96A 3NQ7A 3E9AA 1ADOA 4TX9A 4NJIA 3QQ1A 5D03A 3P8IA 2HS6A 3FKKA 3FKRA 4DQWA 3MBDA 1AL7A 1SW7A 3BG3A 4O19A 4KFOA 3TAKA 3M44A 3C8FA 2NXHA 3RNDA 3Q37A 3B04A 3LCXA 1N55A 3G1XA 1JCYA 5CZTA 3UWQA 1HO4A 3WJZA 3TC6A 4C1KA 3PBYA 1DORA 1OYBA 1GG0A 1RVGA 1V5XA 1JUKA 1WOAA 3IV3A 3LCFA 1F76A 1N7KA 4TR9A 4O13A 5G1TA 2Y63A 3L9CA 5CKSA 4EOUA 4JIPA 2G5WA 4EF9A 2ZDRA 1FCVA 2GQ9A 3O07A 1Q45A 2W6RA 4HPXA 1IIGA 5AHEA 3FYOA 2QUVA 4IOTA 1JUEA 3SIZA 2C3ZA 1VCGA 3BGGA 3NQVA 3P62A 3SY5A 1F74A 4U4MA 3SI9A 2BTMA 2J24A 1GZGA 2H6RA 1A5BA 2NX3A 1KV8A 3QJAA 5LZLA 3MI2A 2Y88A 3NPUA 1EX5A 1QCWA 2B4GA 4DO4A 2VELA 3SZ8A 4WY0B 2VFIA 4XTDA 3MWAA 3NEVA 1SZGA 4WY0F 3O6YX 4XUGA 3L5LA 2WNNA 5BOOA 2QKFA 3GIYA 5DBTA 1VC4A 3VNDA 1LZOA 1KBJA 1FXQA 1CI1A 2UV8G 4UTLA 2JKAA 1A53A 1QOPA 2V2HA 3GB6A 1Z42A 5AHFA 4UMCA 3EX3A 2EHHA 4HT3A 1VZWA 3KRSA 1DQWA 4WZHA 4O4VA 4AHPA 4R34A 7TIMA 3PSWA 3NGJA 4PL1A 2NX9A 3E96A 3EKLA 2ZTJA 3ABQA 1OG0A 1TREA 4GNJA 3OVRA 3QW4B 3OG3A 4LS2A 4I9AA 2A21A 4FNUA 5EKYA 4WD0A 2X1SA 3BGJA 4O0ZA 5KMYA 1FWRA 3LHYA 1LYXA 3IGUA 1KFLA 3GDKA 1LBFA 1VYPX 1IXNA 3NA8A 3CIWA 4KWWA 4EIVA 3PBWA 2RFGA 4AHQA 4UFMA 4RZ6A 4PL2A 3NQ8A 2FB3A 2P10A 2I14A 4BK9A 3LCWA 1K7EA 1I2PA 5I3GA 2JBMA 2BLEA 4UUIA 4JDBA 4O1DA 3DI1A 3EB2A 3W1NA 4FX6M 1FDJA 5CPLA 2ZRZA 1E51A 2V0TA 1EB3A 2VOMA 2E6YA 1X1OA 4RXFA 1Q6LA 3P5YA 4RZ5A 4NJHA 4FX8A 1OFBA 4IX2A 3NQGA 3PBVA 4GE8A 4JY8A 5LGZA 1VHNA 2BSLA 4Z08A 4JGDA 1VLWA 4DF1A 4EVZA 1XL9A 5AC7A 1YXCA 1ZJIA 2V2DA 3DENA 5FF7A 3P8JA 5G4WA 3N9SA 2J9ZA 3DU0A 4LVAA 4UTKA 1KM4A 3PWAA 5K9CA 1G4SA 1RQEA 3DGRA 1TV7A 4O11A 4JIQA 5LHEA 4ADTA 3DXIA 3IVUA 1JCJA 1O5KA 3TW6A 4GJ1A 1AW5A 3KFTA 3NZRA 2CLIA 3MHGA 2C19A 3QMRA 1GVQA 4IMFA 2CZEA 3G18A 3G3DA 1G67A 1NF0A 3PSVA 4LVBA 4M6VA 3CPRA 1GT8A 2GOUA 4FIQA 4JYDA 1XXXA 3TQ0A 1WQ5A 3LHVA 3NQEA 1QPQA 2Z6JA 3O6CA 3P74A 4WY0A 2BWGA 4IMEA 2VEPA 3IIXA 5C2XA 4GUFA 3GNDA 3RMJA 1WX0A 4X9SA 1A5AA 1X8FA 3W76A 3GDRA 2Y7EA 1X1ZA 5D02A 3CTLA 3T44A 1R46A 2CLMA 4JS3A 3C52A 4RZ4A 1U83A 3FOKA 2FTPA 4MVAA 5HNRA 2DZPA 4WXZA 4DO6A 4WQ6A 4AEOA 4ALDA 2V5BA 4QISA 1O94A 1XFBA 3W2UA 1JCXA 3H53A 3STFA 4GFSA 3CIXA 1XI3A 4RK8A 4AHOA 3TKFA 1W37A 4UNLA 4DBDA 3VE7A 1SPQA 3RU6A 2WSYA 3B05A 3PAJA 3QPYA 4MYAA 3BO9A 3QW3A 4E38A 5KZEA 5HR7A 1GVSA 1VCFA 2E1DA 2Y7FA 4JTUA 1SZNA 3W1MA 3S9YA 3B0VC 4O1AA 2J6XA 4NJJA 1EWDA 1P4CA 3W22A 1OFEA 3PBUA 4RXGA 2YX0A 2V2CA 4BI7A 2WOQA 4NUWA 2XFWA 1W3IA 4OQVA 5D05A 3MYOA 1LCOA 1A5CA 2RDTA 3NO5A 4K8EA 5EBUA 3M1ZA 2DZVA 3HOJA 2GVJA 3WK0A 4K37A 1UJPA 3W7MA 5E93A 5F2MA 5D37A 4QSHA 1GOXA 2TYSA 3TR2A 2F84A 3CM4A 3EX6A 3TQKA 4HPJA 5I3FA 1SSGA 3I7SA 2NXIA 2Z6IA 3QMSA 5G1YA 5KITA 2QCDA 1W31A 1VJIA 3LV5A 1M6JA 4NQ1A 4ZQMA 1W5OA 3I7QA 3GR8A 2PURA 1B4KA 3FJ6A 5D2XA 5HWMA 2DU2A 5AFDA 3AO0A 2E77A 5U7SA 4OE7A 4FB7A 1ICSA 3BPWA 5I3IA 2Y7GA 3DKLA 5LSMA 3MP4A 5HINA 4JX5A 1KFCA 4TMCA 1X7FA 3C2EA 4GWEA 3M9YA 1TTQA 3ATZA 4JYEA 5EA9A 3NG3A 2X16A 1BEUA 3PVFA 1I2QA 1GWJA 4JX6A 2CZFA 4FNQA 3PG9A 2EF9A 2I9EA 1OX4A 4TO8A 5FEXA 3W1TA 3IGXA 1K8YA 2A7PA 5EPDA 4JTLA 1AW1A 4CQ9A 4JXCA 4ZZ9A 4UTTA 5LNWA 4TU1A 1VH7A 2A0NA 2AGKA 4OWGA 5DN1A 3U2OA 1PCWA 4LV4A 3BW4A 3TW7A 1OYCA 4PC8A 3O6DA 5BRBA 4KKXA 1JR1A 2R14A 2YPIA 2C16A 1PHQA 3EWBX 1LRNA 3S5OA 1M5WA 1EPXA 1FXPA 1I2RA 4O1CA 3W1LA 3E0IA 3STGA 4MKNA 1MZHA 1OX4B 1YLVA 4FNSA 3ABOA 2B0MA 3OEXA 3N34A 1VHCA 1H50A 1ME9A 4NZFA 2QCMA 3GXTA 1KTNA 1GG1A 3GVGA 3G24A 4AF0A 5LHFA 1KM1A 1SU5A 3W07A 3LXBA 3UWZA 3UWVA 4GBUA 4LS1A 1IGSA 4YXGA 1M7PA 1GQNA 2HMCA 4OT7A 4H3DA 3IIOA 4QNWA 5F4WA 1F7BA 3BVJA 2EKCA 3ZWTA 3QFEA 2FIQA 1KFJA 1L6WA 1H60A 4K7VA 3PUDA 3P80A 2Q3OA 3TJXA 3HGSA 3L5AA 4NJGA 1SW0A 4FHAA 5DXXA 5D38A 4UTMA 1ICQA 3JR2A 3BLFA 4LVFA 3UD6A 1KM6A 3T55A 4UIOA 3BG5A 3KOFA 3CLMA 3DFPA 4LUJA 1I45A 3S1VA 3CB8A 4O50A 1M7OA 3NQ2A 4OBTA 1I8JA 4O10A 2ATSA 4K38A 3TMLA 1H7NA 1W5QA 4E0CA 1TQJA 4UTJA 4MLJA 1W1ZA 1K02A 1MEIA 5D30A 3WJSA 4JTIA 1MEHA 4O15A 5GVJA 1HG3A 4EWND 1TPVA 2W79A 3IGSA 2NV1A 4M7SA 5DY2A 4DO5A 2C6QA 4LWWA 2RH9A 1QNVA 1RQBA 3KRZA 4ML9A 3A5VA 4O14A 3G0XA 1LTDA 3DI0A 4R7JA 1ICPA 4RX0A 1TPH1 4OGZA 5AYYA 5K4ZA 1LLZA 4JR5A 2NLIA 2QCLA 1NFBA 1TPDA 3L66A 1YYAA 4Q4KA 3FS2A 1DQXA 5D32A 1XCFA 4FXSA 3EXSA 5U4NA 4WJEA 3TSBA 5K9XA 5F4SA 3TK7A 3BARA 4YL2A 2YSWA 4MYXA 4HIBA 4UFJA 3W72A 3TXZA 2Y61A 5G4EA 3UZ5A 3FJLA 5DCDA 3B0PA 1ONRA 4PODA 3WFAA 2GVGA 1W5PA 4Z1AA 2NX1A 4N9CA 4AWTA 3TU9A 3IRDA 3U8GA 3HBLA 2GJNA 1T96A 1T8XA 1ZCOA 1K8XA 2VKZG 4E2BA 3S0CA 3ZFHA 2QCEA 4Z1DA 1WAUA 3NQCA 1G4TA 5DCBA 2CLLA 3F4NA 3GLCA 5C55A 1WYIA 3Q2DA 1QPOA 3GAYA 1I4NA 2ZZ4A 3KVJA 1KM5A 1UUOA 5ABTA 1EWEA 2QJHA 4UFIA 4A2SA 3THAA 4HNUA 3NL6A 3LB0A 4POCA 4DF2A 3QM3A 4MJMA 3HPSA 4IPJA 1L6SA 4O28A 2ZZ6A 3EEGA 3W87A 5DXYA 1OK4A 3T40A 1ZALA 4LS0A 4MY8A 4LOCA 2QUTA 5CPNA 3VCRA 1W8SA 3P60A 2E5DA 3NYZA 3DH7A 3S5NA 5D33A 1OK6A 2ZRXA 1Q6QA 4BWLA 4HHPA 5D2TA 3IIVA 2ZZ5A 2J88A 3LCGA 3TAOA 4JTJA 2QCDB 1F6PA 3G1VA 2FFCA 1JRCA 2FQIA 1TTIA 1GPWA 2YFNA 2JGQA 5LNRA 3P61A 3FYPA 3LLDA 1KTCA 4N6EA 4DEFA 2PRMA 4JNMA 2TRSA 2VFEA 1HL2A 2QR6A 3L68A 1TPUA 2WPBA 1TQXA 2A1YA 2ISVA 4DPPA 4CLMA 4FF7A 3N9RA 5AYZA 2VFDA 3LTYA 1PE1A 1L2UA 4M6QA 1D9EA 1H1ZA 4UTUA 3EXRA 1HUVA 2VENA 1HFBA 4CCCA 1KW1A 3B0UX 2OT1A 4O57A 1LOQA 4HNVA 3QPZA 2YYUA 2B7OA 1Q6OA 2O7QA 1SO6A 2RKXA 4KFNA 4LT9A 1XC4A 5AB3A 5FEPA 3QF0A 4MOZA 2ZRUA 1AK5A 3LI0A 3HPZA 4U28A 1JQVA 1DV7A 4O8RA 1K03A 2GQAA 1GTEA 1XM3A 1FWNA 2C14A 2WKJA 3WK3A 1EIXA 2OZ0A 2OMAA 5AN7A 1OF8A 1YTKA 1W3TA 2FDSA 1P1XA 3QC3A 4NNCA 4UTHA 3TC7A 3M16A 4J9JA 1GVFA 4UMBA 2NWRA 3SSJA 3TFXA 1TIMA 2ZA2A 2A85A 3LBCA 1DL3A 1FUYA 3IIZA 1O4UA 3M5XA 4K39A 1LOLA 3TH6A 2NWSA 4A22A 3KXQA 4Z1BA 3NPVA 3FIGA 4ZMGA 3DAQA 3LRKA 3Q58A 3CU2A 2B7PA 4M19A 1AMKA 3TROA 1QR7A 2YGYA 1TJRA 4I7WA 5KINA 3VI2A 3W7NA 3BW3A 1TTPA 3M5VA 4BFAA 3GKFA 4N2YA 1J4EA 3EX2A 4FEZA 3INPA 3NQAA 1L6YA 4CCDA 1B9BA 3PUOA 2JKPA 1HO1A 5HMSA 3T7VA 4IQLA 3NL3A 5C5YA 5K9DA 3ABRA 4HN4A 1BWKA 5K2ZA 5AHMA 2FPYA 4JICA 2Y7DA 3UNDA 3BW2A 5AHLA 4UFLA 2CLHA 5LNUA 1TB3A 1OFPA 3LGEA 1BTMA 1Z48A 3NR0A 5LNVA 3CEPA 3NQDA 1FY6A 4LVGA 2V81A 1D3HA 3G3MA 4N4PA 1P0NA 4RKAA 2NXGA 1R2TA 1L9WA 1TV8A 1BKSA 4UTTC 4LV9A 2C0AA 3NL5A 4X2RA 4CNNA 3NZ1A 1QMLA 4JTFA 5D09A 3FFSA 1SW3A 3G8EA 3NQMA 3UY8A 1QPNA 2WSRA 1I2OA 3W1UA 1SO3A 3R8RA 3CWNA 3HQ1A 1YDVA 2XN0A 1XUZA 4IWWA 4MIMA 4OV4A 3MW7A 5D04C 3NQ6A 5LKYA 2H8ZA 3ELFA 1NVMA 2QDHA 3W83A 3W1QA 1SO5A 1VGAA 3DHDA 1SFJA 1WBHA 4FO4A 5BW6A 1B3OA 2V30A 3W7RA 3PM6A 4UFHA 3W6YA 3HGJA 2Y70A 4QNEA 4IJBA 3NPXA 3R2GA 5LNSA 1NAL1 3M0ZA 2QCNA 4NNBA 2EPHA 4AAJA 4DXVA 4G1KA 3QSTA 5TQLA 3LM7A 2QJGA 5KZMA 3KVKA 1JRBA 5F2IA 2Q8ZA 3DFOA 2A6NA 3R89A 2ZCGA 8TIMA 3EX1A 2FB2A 2BZNA 2CLFA 4FIRA 5BNKA 4QQ3A 3E12A 1RZMA 1R2RA 3CC1A 5CSSA 4IGHA 4XKYA 5D2YA 1RV8A 4RLIA 3W7JA 1JULA 1VR6A 2Z1BA 1HTIA 3SJ3A 1OFOA 4JD4A 5A5WA 4LC8A 5MHBA 2WV8A 3DHFA 4O0KA 3VFLA 4D2JA 4S2CA 3G0SA 1UCWA 3FA5A 3JS3A 1S5VA 3W7PA 1H62A 1QFEA 3TCEA 4ADSA 3I7RA 4JTHA 2FPTA 5G5IA 4GUHA 1G69A 2R94A 5F1VA 4UMAA 1EEPA 2QAPA 3KAOA 1U5JA 4WUIA 3UPBA 3LRMA 4O17A 1W5MA 5AHNA 2QUUA 4UTIA 4A2RA 2DJLA 1XUUA 1TPWA 2G95A 3OA3A 4A29A 2VC6A 4P61A 1OX6A 3W84A 2NZLA 1ZAIA 4MUZA 1Q3NA 1FQ0A 3UWYA 3Q94A 3G1YA 1H7OA 2NUYA 1QO5A 3H54A 1ZAJA 4M5PA 2KZHA 4BI6A 3GX9A 1LBLA 3QSRA 3G1FA 3W1AA 1OFAA 1XKYA 4FXRA 4LRTA 4P2VA 2V5LA 5CZSA 5HWNA 2CW6A 1MEWA 3BK0A 1TRDA 3LOTA 4O53A 2H90A 1OVDA 5G2WA 3PF3A 5DBUA 1GVRA 3F03K 1DJNA 3BG9A 2A7RA 3DFQA 2A7NA 2DZSA 3M5YA 2ABBA 1DJQA 1QAPA 1EP3A 3A21A 2QCHA 3PB2A 3LTSA 3GK0A 4X22A 1KA9F 4JTTA 3TA6A 5FEWA 1G4PA 2ZBTA 5FESA 1TPB1 4N6FA 3W85A 3D0CA 2VEMA 2TPSA 4A21A 4UNKA 6TIMA 1EA0A 4ADUA 2J9XA 3HG4A 3C2VA 4Y90A 6ALDA 3SR7A 4QAIA 1VCVA 1R30A 2WSQA 4JY9A 3THQA 3PUEA 2ZRWA 1N8FA 3LCLA 3EWWA 3RLUA 4DELA 3N19B 2QCFA 2H3BA 4XQ6A 3IVTA 3LTPA 1QDSA 1SZFA 3LLFA 3C2OA 3UYCA 4CQAA 4ZQCA 4N4QA 2CLEA 2YDAA 4H4IA 1YTDA 2ZA3A 4BI5A 3OVQA 3NOEA 2OCZA 4FNRA 2ZQ0A 2C15A 4XKYB 3LHWA 3W86A 4AMAA 4R53A 4LC6A 4RV8A 1PL9A 4I7VA 2QDGA 3L0KA 2NUXA 3A5FA 1WOBA 2YZRA 4Y9AA 2DZTA 5AYXA 4AWSA 3W73A 5I3KA 3VE9A 3SGUA 3W75A 5G2IA 2GJLA 2ZZ3A 3C2RA 4Z0SA 3QQ0A 3UQNA 3LHZA 3LV6A 2EAWA 1H7PA 1XBYA 3L2IA 2C13A 2FLIA 2YW4A 3A22A 2ABAA 4IMCA 3TSDA 3M5ZA 4IXHA 3LHTA 3M47A 1OHLA 2J9YA 2RDWA 4N9BA 2TSYA 1SR9A 3G1SA 3STCA 3MHFA 1SFLA 1QPRA 2ATMA 2QCCA 1B57A 1XBZA 2I1OA 1JUBA 3I68A 1C8VA 3MUXA 3P7YA 1FCUA 2G97A 2WNZA 3SGZA 2V8ZA 1OFDA 3AJXA 4NXKA 1WA3A 3DZ1A 3JRKA 3CHVA 3S1UA 2HS8A 1T0OA 3G1HA 3P82A 1LP6A 5AC8A 3R13A 1VYSX 4KFPA 1RD5A 3W1PA 3W2KA 1H7XA 3LX9A 2CZDA 2CLOA 3MYPA 4L4LA 3SECA 2BXVA 1IXQA 3OHIA 3TXVA 1Q6RA 3W7GA 1H7WA 1KFBA 5TIMA 2A6LA 4OHQA 3G1DA 2C1HA 3HGOA 4K36A 4M6PA 2PRHA 1LORA 1FDYA 2CFFA 3TUUA 3BLIA 4CNOA 3LXAA 2DP3A 2PRLA 2YFOA 1VYRA 4JN6A 2QCGA 3MMTA 4ONVA 1KTBA 5KZDA 4PEKA 3MJYA 3W7LA 1J5TA 5AC6A 1SQ7A 5KTLA 5CGQA 1LOSA 5DELA 3W2JA 1O5XA 2OJPA 1SUXA 5HULA 1LRQA 3V1PA 3GZ3A 4I7UA 3S42A 4RJEA 4FNPA 3W1XA 4UTWC 4JTEA 3GKAA 3DFSA 3TSMA 4KWVA 3QRHA 1W3NA 2R91A 1VQTA 4GC4A 3VKJA 4ORMA 5H2ZA 4MZ8A 3W9ZA 3N14A 1H7RA 3R12A 3W7OA 4NT0A 1S5WA 3TMQA 1WDWA 1LBMA 2E6FA 1DVJA 1G7VA 1SZEA 3QMTA 4N02A 2VFHA 3HG3A 5L6UA 2DORA 3N73A 5LGXA 2ZFAA 4MJZA 3HJZA 3DBPA 3DKJA 2NUWA 4ZQRA 4NX0A 3W2MA 3GXNA 1O95A 2GVLA 4X3ZA 3ABSA 3NAVA 2DZXA 4MFDA 3IVSA 2TMDA 2AAMA 5F1UA 3MO7A 3CWOX 1PHWA 5FF4A 2Y62A 3HPXA 4Z0JA 1JQXA 1D3GA 4WXYA 5HUOA 5AOUA 4UFKA 1YPFA 1K7FA 2Q3RA 4UXDA 1XDLA 2EGZA 1GVOA 1QWGA 4DPQA 1Y0EA 3L65A 1X6UA 1KFKA 2A2IA 4MPQA 5HWJA 5TBOA 3IEBA 5CPMA 5IBXA 3TE9A 1T99A 1YADA 3A9IA 4H6KA 3P5ZA 5EYWA 1KLYA 4LUIA 3B4UA 3EWZA 5E0KA 5HUPA 3W7HA 4EF8A 3ZWSA 3F4WA 1PS9A 1AG1O 3RK8A 2H8XA 2Z2UA 4A3UA 3PY2A 1FCQA 4LRSA 2F7FA 1R47A 3G8RA 2E09A 2ZZ1A 4Y6GA 1W54A 3OBKA 5CG7A 1GYNA 1JJKA 2FPVA 2B7QA 4JDYA 1CX9A 5G2HA 3W2LA 1PV8A 1YDOA 3T78A 2CLKA 3OVPA 4RR4A 4ORIA 1S3HA 1VLIA 1XBXA 5AHIA 1ZFJA 2O7SA 1NF7A 4QM1A 4AVFA 4K8HA 2OT0A 3EKZA 2ZTKA 1FWWA 1GJPA 2QJIA 4IPIA 4DBEA 3TDFA 3LXCA 4JTKA 3RFAA 1LDCA 3I6RA 4JYFA 5H91A 3P84A 1OF6A 4UC5A 4O12A 5FF0A 4UCGA 4YMZA 3MP3A 1AL8A 1Z44A 2QAFA 1KM3A 1THFD 1OABA 3CEUA 1DOSA 4MZ1A 1EP2A 1LLWA 1YPIA 4GRSA 4PA8A 3QH2A 4NU7A 1FWTA 1VS1A 3EX4A 4N9DA 3G1AA 5IM51 5L9FA 1F6KA 4HKPA 2JK2A 3SW6A 5A8GA 4PTNA 5K3VA 3RF9A 1DKWA 3O15A 3PC0A 4QIUA 1QO2A 4LNYA 2B7NA 1ZHAA 1MSSA 1CW2A 2AQWA 4O16A 4YWIA 2E5BA 3NPWA 2PE4A 3LBMA 3CT7A 1H51A 3L21A 5CSRA 3W7IA 3M6YA 1DBTA 1OX5A 4Q33A 4ZVJA 4JTSA 5DCEA 1SSDA 1KBIA 1YXDA 3W7DA 4C1LA 1O60A 3C2FA 1P0KA 1RR2A 3QZEA 1ME7A 3KVLA 1LRTA 1FDZA 2X1UA 3GR7A 5BMXA 3K30A 3NL2A 2A4AA 2GUUA 4IX0A 3IIPA 3BLEA 5DLCA 4LW7A 1K3UA 3C6CA 3W71A 3W23A 1TSIA 3N2XA 3TJLA 5FEZA 5EMUA 4O54A 2VFFA 4WX2A 1UB3A 1K8ZA 3A23A 1SO4A 2P0OA 5I3JA 3M41A 3LCHA 4FX7A 4GUGA 2VFGA 4PH6A 1F05A 3S1XA 2GQ8A 1MO0A 4CCEA 4S1FA 3UWUA 3ZS4A 1OFRA 1JVNA 2ZZ2A 4CQ8A 4WOQA 1TPC1 1Z41A 4MZYA 2Y6ZA 2XN1A 4HSNA 4LY8A 1RQHA 1UASA 3G22A 3LHUA 4NVTA 4Y96A 3H55A 1IF2A 4TMBA 1EP1A 2E5CA 3W74A 5F4XA 3F1QA 2ISSA 3TNOA 2QEZA 2RHGA 2ZA1A 5T26A 5FF3A 1YTEA 3NVTA 3ATYA 1XBVA 4CNPA 1ZAHA 4K7YA 4BWLC 1KM2A 4OU1A 3HIJA 4GUJA 4QITA 5FF2A 3NM3A 2E6AA 3WK2A 2YCEA 1ZENA 2ZRVA
chains in the Genus database with same CATH superfamily
2BY2A 4GY0A 1KLZA 4KGLA 2RDUA 4B2DD 2PI6A 3QTGA 2WHJA 3HMJG 2ZZ7A 2ZUTA 1PWLA 3NM1A 2W0UA 4RV3A 1F73A 2ACRA 4I5XA 4J3TA 1B4EA 3AZSA 1DE5A 2YW3A 5DQPA 2XH0A 1JCNA 4XTIA 5CPTA 5F2LA 3N3MA 4O1BA 2YCLB 1GONA 1IEQA 4D8LA 3TYUA 3S2JA 2HTMA 3BWWA 4LBRA 4G7EB 3ID7A 2I17A 2ZADA 4GQRA 4JKMA 1W3LA 1XLLA 1HT6A 1TJPA 3CZKA 4L64A 3S8HA 3ZR6A 4XO6A 1FX6A 1UC4A 2HDJA 3GAKA 1ONEA 4Q32A 4YCOA 1GHRA 3AMLA 4L4MA 1DWHM 4GK8A 3TC3A 3HG5A 3LGGA 1YMYA 1GYLA 2DZWA 3NDOA 1Q8AA 2O4QA 2DZUA 2GOKA 1YBQA 1F2JA 4GX9A 1UHVA 2QPSA 2ZUMA 3UWEA 3VPLA 4XWUA 3O06A 4XISA 4BR1A 2PDYA 3RJXA 1CGVA 4MAZA 2F6KA 1TV5A 1TYGA 3W0KA 2DSWA 1JCMP 4KEVA 3ONCA 3A64A 5EY5A 4AB4A 1MUCA 4H8NA 2DUAA 3RDKA 3EWDA 5M1TA 3UWWA 1X39A 3GTFA 3LRLA 3UG3A 3BANA 1UR3M 1LT7A 3W27A 3EWUA 3DFNA 4GPNA 2QULA 1CZ1A 3EDFA 3H2AA 4YIWA 3UA3A 3E49A 4GNVA 3E02A 4O18A 5CPOA 3AU6A 2VO5A 1IIHA 4JFUA 4QP0A 3MP5A 4GC3A 1FH9A 2I16A 1TE1A 2WPGA 1P0BA 2E68A 3C3NA 4ZQNA 3BAJA 4BS0A 3NIYA 4CN4A 1J5SA 4IG2A 2X2GA 4UBPC 3W7EA 4AF0B 4E8CA 3QPEA 4QDMA 3QV6A 1CXIA 1E6NA 1AW2A 3L67A 3GO2A 4ZQOA 5DY3A 1IGWA 2CWNA 5BOEA 5M03A 3N6JA 1A5KC 3QGVA 3H24A 3ABZA 2DVTA 1PCKA 1GEQA 2PDQA 4LTSA 4OUEA 3ARQA 3W3OA 4BKNA 3OLEA 2Z4GA 3NVDA 2ZDSA 1VJSA 1XGDA 3KTCA 3FLUA 4XBSA 2QMKA 5FL0A 3W2NA 2ZUVA 4WVXA 1A50A 3TLLA 4HSOA 3VUSA 3WNLA 3CAWA 4YCPA 1OEPA 5JUVA 3N2MA 3PBGA 4IGSA 4AX6A 1MUWA 2E4TA 3V75A 4QEHA 3CWHA 3UESA 4DLMA 4DVOA 4HB7A 4UQBA 3V36A 4S2BA 5BZAA 3KWXA 4CD8A 1WV2A 1Z32X 3M43A 5BMWA 1F61A 3S46A 3R5EA 5I79A 3C61A 4AWUA 5F2GA 1KCLA 3YPIA 3LY0A 4IQJA 3WNNA 4NNAA 2OU4A 1LM1A 4JEQA 3TX9A 1EBGA 3CQ0A 1MDLA 2ZRYA 5C6MA 5ABFA 3R4IA 1NWUA 2G96A 3NQ7A 4QE5A 1ADOA 5AKQA 2J7EA 3QQ1A 4DM1A 4GGHA 3P8IA 4W4QA 3FX4A 3T2QA 1SJDA 4E4FA 3MBDA 1SW7A 1K77A 3BG3A 1JNEA 3RJYA 3ES7A 2PDXA 5FJUA 2NXHA 2I5QA 3LU2A 1DIKA 3WH9A 3WL1A 3G1XA 2HQAA 3SCPA 1QT1A 3UVIA 3WJZA 2BHYA 4Q8UA 3QHNA 4KCTA 4C1KA 3PBYA 1HKVA 3WMLA 1RVGA 1WOAA 4TOQA 5DMYA 4PUUA 5G1TA 2R1LA 4D6IA 3OTRA 1ENUA 4D6CA 5HANA 1EJTC 4HPXA 1IIGA 4C6NA 1JUEA 3SIZA 3CO4A 4UQDA 4U4MA 2EEXA 1W9UA 2BTMA 2J24A 3C3UA 3BAKA 1A5BA 2Y0FA 1QW7A 1QCWA 3AMKA 4DO4A 3SZ8A 3BJTA 4V1XA 1SZGA 3LM3A 3MS8A 3GIYA 4RL3A 1W9PA 5DBTA 1TWDA 4KESA 4Q6XA 1ISXA 1FXQA 2EQDA 1MI3A 4QCFA 3GB6A 4HK7A 3K46A 1VFTA 5AHFA 3CH0A 2XIJA 1QI0A 2YZ5A 4WZHA 3LPPA 4R34A 3PSWA 2OYMA 2IPFA 1RA0A 2AL2A 2WZIA 2OEKA 4A3YA 3TLQA 1H1NA 1E3ZA 1C92A 1MW3A 1R87A 3LHYA 4Z2GA 1UD6A 1KFLA 1VIZA 4C91A 1QNSA 4KWWA 2C1GA 4UFMA 1K9EA 3WLHA 3C0LA 2R1PA 3IAPA 3NQBA 2DEPA 2P10A 4W87A 2JBMA 1A5UA 4JDBA 1KGXA 3VNMA 4IT1A 3TYBA 3AS2A 2BVWA 2G3MA 4FX6M 4JIEA 5CPLA 1UROA 3SQMA 3UBPC 3K13A 1Q6LA 1HKWA 2FZBA 4NJHA 3EMCA 4C65A 4X2PA 7TAAA 1VLWA 1XL9A 5A8PA 1MUMA 1ZL1A 3BH4A 2V2DA 4Q4SA 3MC5A 3DU0A 2O9PA 4LVAA 4UTKA 5K9CA 4CGTA 4YWSA 3RPMA 4YTTA 2VP8A 3DGRA 6CGTA 1WKFA 2Y5SA 3TNBA 3DXIA 3ARVA 4DZIA 4CN1A 2VGGA 1AW5A 2V5DA 1JZ5A 1LQ2A 1XSKA 1E9IA 3QMRA 3WH5A 3LK6A 1RH9A 4HN8A 2QUMA 4IMFA 2CZEA 3G18A 4Q3MA 2WWDA 3ZM8A 3WNPA 3TQ0A 4DAIA 3LHVA 1QATA 3E0WA 3NQEA 1EQPA 1M03A 3O6CA 3P74A 2BWGA 1RK5A 4IMEA 2VEPA 4QG9A 1RSCA 5C2XA 3GNDA 4MUPA 1JYXA 4KH2A 3RMJA 1NFGA 2GL5A 5IDZA 5A6LA 4X9SA 3N4FA 5XINA 1A5AA 4QLLA 1EHNA 1X1ZA 3K1DA 3ZYZA 3CTLA 1V0MA 2CWXA 3PFMA 1R46A 3C52A 1HGWA 3KDOA 3V7PA 2MUCA 2PTYA 5HBFA 4UZSA 3V16A 1E6PA 1PZ3A 5GNXA 5M5DA 2FTPA 4MVAA 5HNRA 4F0MA 4DO6A 4QJ3B 1U1JA 4IIFA 3EMQA 3QZ6A 2GQ3A 3RXZA 4AEOA 4US5A 3TWBA 2V5BA 4QISA 4GHRA 3UZYA 2P88A 1JCXA 4Q4MA 1N8IA 3STFA 3LD5A 4A05A 4ZB5A 3OG2A 2BP1A 1SPQA 2WSYA 3GFYA 3R25A 4B3KA 1PX3A 4NAFA 1XLBA 1QTWA 4MYAA 3BO9A 2E1DA 3EWCA 1XLEA 4DUOA 1M3UA 5DRIA 4YU1A 3WQFA 5A3HA 5A2BA 2OLAA 3VTRA 4NUWA 1W3IA 1E6ZA 3EDDA 3KEHA 4K8EA 5EBUA 1UMLA 3WK0A 4LCQA 1HIZA 5BU9A 1V51A 3I3DA 2TYSA 2F84A 3H2MA 2YCKX 4I5UA 3EX6A 3AHVA 2XM1A 2XJ7A 4Z2IA 3A13A 5CGMA 5I24A 3KBNA 4HA4A 3EPMA 3OLDA 3UXLA 3MO4A 1EGMA 4EWJA 2PWGA 3PPGA 2C0HA 4RE3A 4DJFA 1B4KA 1BRLA 4Y9MA 5D2XA 2DU2A 2Q8XA 3GUWA 3APTA 5AFDA 4QQUA 4OE7A 3BPWA 3DKLA 1YE4A 4AXNA 3C2EA 1PDZA 4GWEA 2ZOXA 3M9YA 3ATZA 5EA9A 6PTDA 2QPXA 4MF4A 1BEUA 2VQUA 2QF8A 1R3TA 3UA4A 3PG9A 4LBSA 5CCZA 3W1TA 1YE6A 2WCGA 2BNJA 3G77A 3IGXA 2X05A 4M51A 4CQ9A 1AW1A 3KOXA 4ZZ9A 3VFCA 5LNWA 1VH7A 2PGEA 3U2OA 2XHYA 5GPRA 3BW4A 2YBTA 4PC8A 4PMOA 5FJPA 1C91A 2X0YA 2C16A 3EWBX 1LRNA 5FJRA 1EPXA 1I2RA 1M5WA 2UY5A 4CD6A 3IJ7A 1GZ1A 1Q6FA 1YLVA 2Z24A 5JU6A 1J2BA 1MDRA 2QVNA 3N2BA 1VHCA 3G2GA 3NUKA 3GXTA 4QCEA 4AIBA 1E9LA 5CSYA 4Y9PA 1XIDA 2XYLA 4XAZA 3UWVA 1GOMA 4LS1A 1IGSA 4YXGA 4ILSA 3LPOA 2HMCA 2EO7A 1BRLB 2VUNA 2PF0A 3RGTA 3LBOA 1F7BA 4GVHA 3KTSA 3UEQA 4JN7A 1NQKA 4F2BA 4MMWA 4YS1A 4DZ5A 2WYSA 2A79A 3L5AA 4NJGA 2A3EA 5DXXA 1PO9A 1A0EA 2O0TA 1Q5MA 2HNEA 5H1WA 1KM6A 1XICA 2J79A 2OVLA 4ERGA 3BUVA 1ZTVA 2JEPA 3CLMA 4PE8A 1GVYA 4S3KA 1I45A 3S1VA 3SUUA 3AIQA 2NVCA 4E4UA 1CEOA 3K8LA 3OODA 1YNQA 4O10A 5E5CA 1KXTA 4GKTA 4B5UA 2V5JA 1H7NA 8XIMA 5A2AA 1TQJA 4NI3A 4M1BA 4UTJA 3GFXA 4MLJA 2DVXA 1W1ZA 3EGJA 5D30A 4CQCA 3WJSA 3EOLA 1X96A 3IGSA 4DO5A 4PMXA 4KIRA 4PB3A 1RP8A 4C6LA 3KRZA 1RBAA 1OIMA 4OGZA 5K4ZA 1LLZA 2OTDA 1TPDA 4Q4KA 3FS2A 1DQXA 2BFGA 2DVUA 3EXSA 4WJEA 5U4NA 3W26A 5K9XA 2YSWA 4LALA 3U7BA 2V63A 2AKZA 5G4EA 5EMJA 4PMQA 2DW7A 5DCDA 2WMHA 5E9XA 3BURA 2GVGA 1W5PA 4N9CA 5D9PA 3T09A 4DBUA 3IRDA 3I6EA 3U8GA 5I0DA 3NFUA 1AH3A 1ODZA 2I5IA 1K8XA 1H5VA 4J1OA 3S0CA 1YRRA 3S5SA 4Z1DA 4DJDA 1G4TA 2CLLA 5C55A 3Q2DA 1JEZA 1PDYA 2PBOA 3H70A 2WHKA 3OW1A 4MJ4A 4CVWA 2FHFA 2QDEA 2QJHA 3SCVA 3P6LA 1XSIA 4Y9NA 1GCYA 3TQPA 3EA2A 4POCA 4B91A 5BYWA 3HPSA 2ZZ6A 3EEGA 2YIHA 4QTGA 1ZALA 4LS0A 3RITA 4N0RA 2P3EA 3VCRA 2XISA 3RHGA 1GK8A 1S2WA 4IIHA 4BWLA 4HHPA 3IIVA 2ZZ5A 1M68A 3N2OA 3TTQA 3RIKA 3WLTA 2FQIA 1TTIA 1GPWA 5LNRA 3H6OA 3P61A 3LLDA 1KWGA 4N6EA 1O6IA 2ZXAA 1TWWA 2PRMA 3PN8A 2TRSA 1E71M 4CU6A 2VFEA 2BBFA 3VK5A 4GJIA 3N9RA 4ENLA 3WUEA 1V0LA 4EX4A 4B5WA 4M6QA 4YHGA 2WM1A 1H11A 1R5YA 5IRPA 3VKAA 1BHGA 3T4WA 1FFRA 2X7WA 2NQJA 2Z26A 2DPEA 1SMDA 1ADSA 4HNVA 3QPZA 1UZ4A 2B7OA 1Q6OA 2O7QA 1SO6A 2RKXA 4AIUA 1XC4A 3MKVA 1CXHA 3ZZ1A 5FEPA 3WQ6A 4OIFA 2D2OA 1VAHA 3T0BA 4O8RA 3R94A 4RPPA 2P8CA 2OZ0A 3AUJA 3WLRA 4I9JA 5AN7A 2UWFA 3V0SA 1P1XA 1WP6A 4DIAA 4NNCA 3L4VA 1R8LA 3DERA 2QS8A 3ARSA 2D23A 1QOXA 3MUAA 3IIZA 4K39A 2HXTA 1WDQA 3L2MA 3TH6A 2PDUA 3IAQA 3WD0A 2NWSA 3BICA 4WDUA 4YTSA 3DN5A 3LQGA 1E4NA 5G1MA 3HN3A 1RVKA 2A3CA 2WJFA 4NSBA 3WL0A 3A4AA 2WWCA 1EJVC 5KINA 4JOMA 1Z9AA 4BEQA 1OZMA 3GKFA 1J4EA 3EX2A 3NQAA 1L6YA 5CH9A 2UY4A 4GCXA 3T7VA 4IQLA 3NL3A 5K9DA 3FVMA 1YEYA 4UQEA 4EXBA 3NSNA 4AY8A 5AHLA 1TB3A 2PA6A 4FSAA 1Z48A 3VOHA 4PMDA 2OGJA 4LVGA 4Q22A 2V81A 3V5CA 1UWIA 4N4PA 1P0NA 2NXGA 2FFIA 3CL8A 1E0TA 4X2RA 3BZGA 4B2DA 1QU4A 3PHAA 3UJFA 3RLGA 3IUHA 2PB1A 3GTNA 1KQZA 1TJ0A 3H22A 3S9ZA 1E9ZB 2VGIA 3UY8A 4QS5A 4CEXC 1EC7A 4MPKA 1BVWA 3F4CA 3QZAA 2OGYA 3GVQA 3NJ3A 5AYBA 3R8RA 1UR2A 3BQ5A 3CWNA 2IQ0A 4MIMA 4OV4A 3AAMA 4Q8QA 4H7VA 1OG6A 3AYTA 5LKYA 3IJ6A 3VIFA 1EGZA 3QTPA 3EAUA 5CG0A 1SO5A 1VGAA 1X97A 1H41A 4FO4A 1B3ZA 2VVSA 1K9TA 2V30A 3U57A 2J7HA 2WANA 2HWGA 4AC7C 4ZO8A 2VCAA 3OZOA 4X60A 2YCIX 3NPXA 3R2GA 1CGXA 3M0ZA 1B2YA 2VX7A 2BGQA 2EPHA 4G1KA 3FYYA 3PANA 3ZSSA 4A8IA 2AL1A 2YLAA 4GGBA 5A94A 4DRSA 2Q8ZA 3DFOA 3EDEA 2A6NA 2ZCGA 2BZNA 1PJ9A 4FIRA 2I7GA 5BNKA 3E12A 2OYKA 1R2RA 4HPHA 3CC1A 1DTUA 2AAAA 3IJQA 1M7JA 4RLIA 3W7JA 2Z1BA 3VIPA 2VZTA 3C2YA 5A5WA 4HCHA 1FKXA 3DHFA 3VFLA 4D2JA 4DYJA 4HMNA 1UCWA 3FA5A 4U5IA 3JS3A 3BSHA 3VD5A 1S5VA 1DWGM 3TN3A 3PTMA 2DY3A 3TCEA 1E6QM 4ADSA 3I7RA 2X40A 1VBRA 2ZWYA 2R94A 2WNWA 1PXGA 4ZB2A 1EEPA 1FHDA 3UPBA 5DRCA 3LRMA 4XAFA 1XV8A 4CQBA 2DJLA 6XIMA 1TPWA 1UWAA 2G95A 3RCNA 2ZWZA 4PUMA 4A29A 3W84A 4MUZA 3PZGA 2NUYA 3NDYA 2KZHA 2ZUWA 2PU0A 3W1AA 1XKYA 4FXRA 2I57A 4GD0A 4GH3A 1OBAA 1EXBA 4Q7BA 1E55A 3LOTA 5T91A 3ZT6A 1GEHA 5DBUA 1W2PA 3DFQA 2DZSA 5CC7A 7PTDA 2Q02A 3VM7A 4IG2B 3OP2A 3PB2A 4X22A 3QY6A 4DX3A 2JEQA 1TV3A 5FESA 3W85A 2PDPA 2VEMA 2TPSA 3G1RA 4A21A 1FWJC 4EPKA 1W1IE 2J9XA 3GBEA 4Y90A 3EOEA 2V5KA 2VTFA 4QAIA 1VCVA 1R30A 5DEZA 7REQB 3JZUA 4GH1A 1N8FA 3N19B 1DWFM 3PWIA 3AMGA 3LLFA 3MMDA 3R8GA 3WG6A 4ES4A 4ZQCA 4N4QA 4KCVA 3PZOA 4BI5A 4D72A 2PCEA 3UCCA 3VKBA 2OCZA 4AMAA 4M3PA 4RV8A 4LH8A 2IS7A 3BGAA 2OFJA 3WQPA 3L4YA 4D8ZA 5AYXA 3W73A 2PGRA 3W00A 3U48A 4CEUC 5AVNA 2GJLA 1F3WA 4Z0SA 1BG4A 4DWDA 4BF7A 3B40A 1ZUAX 5JQ9A 1X1NA 2Y4SA 1LL7A 3L2IA 1Z3NA 1XCXA 2FLIA 2YW4A 2ABAA 3ES8A 5JBDA 3M47A 4PRRA 1RY0A 2R82A 1SR9A 3STCA 3F2DA 1K9FA 3RM9A 1HVXA 1WO2A 1OM0A 1PYFA 2QCCA 2I1OA 1WDSA 2IUZA 1M9HA 2D3NA 2WCSA 3ARXA 2G97A 4D6DA 3MUCA 5J04A 4YJ5A 1US3A 1WA3A 3CHVA 1J9YA 6ENLA 4TXEA 3TOPA 3G1HA 6REQA 3P82A 4G1NA 1CDGA 1RD5A 1JDAA 4I5RA 3W2KA 3LX9A 2FGZA 3GU1A 1GOQA 1EEXA 2BXVA 3VNJA 4DJEC 3GHSA 4IQDA 2EPLX 1UMYA 1IT0A 2A6LA 1E4MM 4OHQA 4GNKB 1PZ1A 2C1HA 1V77A 4DI9A 3HQNA 4M6PA 1AQFA 5JMUA 2PRHA 3GW0A 5A6TC 4LJ3A 1FDYA 2WMIB 5IFTA 4BQ5A 3A9BA 5AECA 3H8AA 1ZP3A 4CNOA 3FVDA 4LAMA 1J93A 2YL6A 3GS6A 3OB8A 4PEKA 3W7LA 1GOOA 4PTWA 5KTLA 2DUZA 3AIUA 3MQTA 5CGQA 2OZTA 1QRQA 4HHMA 2A3HA 4PMJA 1SUXA 5HULA 1RUSA 4RNFA 2VWTA 1V6TA 4I7UA 3S42A 4RJEA 3W1XA 2PEVA 2CERA 3BCFA 1OGGA 3TSMA 2BOGX 4KWVA 1VQTA 4ORMA 5H2ZA 4N7QA 3N14A 4JTDA 3VKKA 2Z2AA 3W7OA 3MUZ1 4E2OA 1JDCA 1LBMA 1EOKA 4S3EA 1DVJA 3FK4A 3W01A 3QMTA 5L6UA 1R9XA 4UOQA 4M8UA 4MJZA 3HJZA 4DO7A 1TCMA 2Z2BA 3QKEA 3W2MA 4BZYA 4FR1A 2GVLA 3NAVA 1MFUA 2XZ7A 3WLQA 3IVSA 3TYCA 5BROA 4EKJA 5DT5A 2W4XA 4INFA 3MO7A 1GHSA 4WKAA 3QV8A 4UFKA 4KEMA 1CECA 3BOLA 1K7FA 5GQBA 3W6MA 1XG3A 1GVOA 1UZDA 3T2OA 2F61A 3FSTA 3FJNA 1R7OA 1CGYA 2A2IA 2DFAA 3WH7A 4ACZB 5CEWA 1XRVA 3KOWA 4H6KA 3P5ZA 4LUIA 3EWZA 1UD2A 1TVPA 2QLYA 4KRUA 3NZGA 4RNJA 1UQZA 4AQLA 4GZEA 2PTZA 2F7FA 2G4JA 1R47A 3WELA 1HKJA 2ZICA 2WZTA 2HK0A 5C8BB 2GUYA 1JJKA 4NP7A 5PTDA 3ARYA 1L8NA 2CETA 2JALA 1YDOA 4I90A 3CIVA 1Z8AA 3OVPA 1SR0A 5AHIA 1ZFJA 3M0JA 3QY8A 4LCRA 4GQ0A 1E0WA 2OT0A 3VIHA 1E5JA 4DBEA 1BF2A 3MWCA 3M0IA 3R79A 5FF0A 4U2ZA 2WMJA 1IHIA 4O0QA 2QAFA 1R3SA 3AMDA 2QT3A 4ATLA 4L9ZA 4CNSA 2E8ZA 3BAIA 4MADA 5CXPA 3QH2A 1FWTA 1VS1A 4Q4PA 4AYGA 3U2ZA 2VD9A 5A6JA 2D69A 1GKRA 3O15A 3AS1A 1QO2A 4LNYA 2B7NA 1CW2A 2AQWA 2VHLA 1AZ1A 5A6BA 4L6HA 2CBIA 3M6YA 4MB3A 4XZLX 2E8YA 4JTSA 1JG9A 2CHNA 1KBIA 4W84A 1BXNA 4I6VA 1P0KA 3QZEA 2PZ0A 3SO7A 1FDZA 2X1UA 3OOQA 4P7QA 3GR7A 3KS5A 2CXEA 4FS9A 4MHBA 5BMXA 3K30A 2A4AA 2CHRA 3PZQA 3W23A 1TSIA 1JZ7A 1W8GA 5CJ5A 2VFFA 4RE2A 3XISA 4JKKA 2QGYA 1H4PA 2P0OA 3II1A 3LCHA 4FX7A 1TWSA 2GYIA 4PH6A 2XFYA 4YTRA 4H00A 3PZVA 3OZPA 4CCEA 3EDJA 5AZ0A 3ZS4A 1OFRA 2XU2A 1HW6A 4WOQA 4U10A 1TPC1 1Z41A 4MZYA 4WCJA 2Y6ZA 4HSNA 1Q6EA 3G22A 4L61A 2G8ZA 2FZ8A 1UOKA 3H55A 4IMAA 1E70M 3POCA 4AG0A 1EP1A 3EPOA 4JTQA 5LA1A 2ISSA 2G3FA 2PSNA 2WVVA 4DYKA 1XBVA 2OO0A 5JBEA 1BKHA 4V28A 4R3UA 3M46A 1DQUA 4HNCA 3HIJA 4QITA 3ZOAA 4GISA 4PMVA 5FF2A 3NM3A 3FV9A 2ZRVA 1ZENA 4BQ4A 1QBBA 3N29A 1UYQA 2ZX5A 5CZJA 5HJXA 3HMCA 4BQ3A 2VUYA 1NIUA 4JFSA 1HNYA 1FTXA 2D2GA 2GSJA 1VRDA 1UW9A 1GKQA 3H7UA 2HBXA 2WSPA 1UBSA 2P1FA 1R3VA 2OPJA 1PYMA 1R2SA 2CESA 3O05A 1TO3A 3UJEA 1GOKA 4IMGA 1PX4A 3VC5A 3AC0A 1XDMA 4PFMA 3LCIA 3VIIA 1EX1A 2Z1SA 3PG8A 3ZXWA 4HA1A 4E2DA 4OV9A 1H1YA 3PPCA 4O1FA 1KKRA 3TFCA 1QNRA 1WXJA 3N15A 1HP4A 3WENA 3ZVHB 5EMLA 4RNHA 3IANA 5MKGA 3CQHA 3MHUA 3MDUA 1H0IA 1AH4A 3UXDA 2P0IA 2ISWA 4S3JA 3M0XA 4GOAA 2V9DA 4UR8A 5FI8A 4DF0A 4LU0A 3ZR4A 4Q7IA 1OJXA 1XYCA 3UPWA 2VZUA 4PSRA 3MCNA 3BV4A 2ON3A 3A4XA 3ZR5A 3MZ2A 4UWMA 1TPFA 4OUIA 4TIMA 2GJXB 2O4MA 1TMHA 4HSHA 3UJRA 4U5KA 3CMFA 4PCFA 5HJLA 1KFEA 1RPKA 1UUMA 3WO8A 3BOFA 2Z0IA 3UXAA 1K7XA 1IXPA 3NQFA 1NTHA 2Y8VA 3AXIA 1MXSA 4IUOA 2Z7KA 1ZY9A 2IQDA 3H7RA 3KVMA 4CU8A 2BS9A 3DFTA 1A5SA 3KRUA 3VU2A 1QK2A 4TQTA 1BD0A 2NQHA 3UZJA 5E1QA 1H61A 3CS2A 3STEA 5C9XA 4WOZA 3WLKX 2CU0A 3NXFA 2YOCA 3WCZA 1BWLA 2ZXBA 3NEHA 5K4XA 3DGBA 1JPKA 1R9YA 2RJHA 1GTHA 3AUOA 2VCBA 4FAMA 1ITQA 6REQB 3QEZA 4JKLA 1F3XA 2C18A 3HFTA 3VC6A 3HGRA 5IBXC 3LENA 1KV5A 1MVYA 1RJQA 1Q7MA 1AQMA 1DWAM 1IXOA 4ZOBA 5LYRA 1LROA 1GZJA 2E1WA 3OA5A 4K6AA 4ROPA 1J10A 2IQTA 2YR1A 4O52A 1JF6A 4F4RA 2ONEA 1B3YA 4W9TA 1VENA 2O92A 1J0IA 4WDTA 3KHJA 1F3EA 1GJUA 3B03A 3VZXA 4S23A 3CNYA 2YXGA 1VPXA 5HR6A 1I2NA 1UUQA 3KCJA 4H41A 4E6MA 3DFYA 2ZX6A 4NZCA 2Z1WA 3WK1A 4HPNA 1NOFA 3URQA 3MI6A 2ZVRA 3U6WA 1BWVA 3KX6A 3GNNA 4XKMA 1C9DA 4DXKA 4PULA 2ZYFA 2WJDA 2D2JA 4F0RA 1KM0A 4LVDA 1G01A 2O9TA 3PUGA 1ZPTA 3DBNA 4E3TA 3K2GA 4XVEA 7A3HA 3DEQA 3WMBA 1GQKA 3OIXA 4XZIA 2ZC8A 4LANA 2EPNA 3K4DA 5DMNA 1JF5A 4XVDA 1PVNA 1VFLA 3P81A 3OVGA 1PEZA 1M53A 5D8ZA 4N9EA 1DIDA 2GJPA 2OSYA 4NY2A 4L1WA 4IJCA 3GDMA 3WFZA 2VVNA 4IFKB 2KAUC 4MNLA 4NJIA 2OX4A 3FKRA 1M41A 4DQWA 5A2CA 2FZNA 1EDTA 1VF8A 4KCUA 7REQA 4L4OA 1B31A 1OC5A 4GCAA 1XLAA 1NP0A 1YNYA 2WJEA 4ZOAA 3WD1A 3JZEA 2VRKA 4CD5A 4S3AA 4XAYA 5CZTA 1QASA 3TC6A 3MCOA 1R7AA 1GG0A 1V5XA 3IV3A 5HA7A 1XYBA 2DZAA 2VZVA 2WLZA 1TZZA 2E3ZA 2VX5A 3VVGA 4EOUA 2BOFX 1E43A 3CO8A 1FCVA 2JQXA 2DIEA 3O07A 1Q45A 5AYIA 2W6RA 4FLQA 3FYOA 4DAFA 4AZGA 2C3ZA 3BGGA 3SY5A 2POTA 2RAGA 3RMEA 2OELA 4HZ8A 1GZGA 2H6RA 4LYPA 2NX3A 3T2PA 2PWEA 4FOUA 4PUEA 3CHCA 5LZLA 1PKNA 2Y88A 3MMWA 2B4GA 3VAVA 3I3BA 3NEVA 3CLWA 1FWEC 3CAVA 3GR4A 3OLIA 3H2OA 3VNDA 3MA8A 4UTLA 2JKAA 3OBAA 3GVRA 1QOPA 2ICSA 3TWAA 1Z42A 2REQB 3U5YA 4HT3A 3WBAA 4O4VA 4WKFA 5LA2A 7TIMA 1IE7C 4GIRA 3NGJA 3S2LA 4H9UA 4DZHA 1ODUA 2NX9A 2W61A 3E96A 2R6OA 3N11A 2ZTJA 3ABQA 1QNPA 1TREA 4GNJA 2QHAA 3OG3A 4RDZA 4LS2A 4I9AA 3DYMA 2HXUA 4ZENA 3BGJA 4I3GA 1RXOB 1FWRA 4NKCA 1LYXA 3PFRA 1LBFA 5BXRA 2WLYA 1UKQA 3CIWA 3PBWA 4AHQA 2W62A 2WC7A 3LQLA 3WNMA 2NSXA 1PAMA 3USZA 1J11A 2P53A 1ZCCA 5XIAA 5IFPA 3W1NA 3GC2A 1FDJA 2ZRZA 4OBRA 1E51A 2V0TA 1EB3A 3E0FA 4DN1A 2VOMA 4LNCA 3EOOA 3QVQA 4PCSA 4PTDA 3FSUA 3P5YA 4MNMA 4ZE5A 4FALA 1MMFA 5ABFB 3NQGA 4GE8A 4GO8A 2XGBA 2VC9A 2J7FA 4DF1A 3QGKC 1EYEA 1A5LC 1E0XA 4Q7NA 2PP0A 4DWSB 4E5TA 4O11A 4XAPA 4N42A 4D6HA 4ZXOA 4IPPA 4XB3A 1HGYA 2OR2A 5AC5A 3MDWA 1O5KA 3ARPA 2P76A 3G6MA 3TOYA 5FSDC 4OOUA 1GVQA 4H04A 2Z28A 1G67A 1NF0A 4M6VA 2GOUA 1GORA 1XXXA 2XTKA 3WUFA 1WQ5A 1UIOA 2W91A 1FRBA 1Y5VA 1LQ0A 3KM8A 3GUGA 3URAA 1TELA 3AIVA 2VL4A 3QLDA 1WX0A 4F66A 1HJQA 4W8BA 3L7RA 1MQRA 1X8FA 2D20A 3GDRA 3B97A 3SUWA 2Y7EA 3W76A 4GI4A 4F48A 1RA5A 4P8XA 4AZ7A 1MWOA 3PK7A 2VX6A 3DHPA 4JIRA 1V6YA 2JE8A 2HE8A 3FOKA 4MWAB 3H4WA 1JYWA 1RLCL 2YCJA 1O94A 1G9HA 1W1PA 3W2UA 5CLWA 3H53A 3CB3A 1XI3A 4M56A 5CGTA 1XLIA 1JPDX 4DBDA 1W9VA 3S2MA 1AUSL 4NZ5A 3B05A 3O6AA 4HHLA 4ATWA 4O8AA 3QW3A 3D3AA 5HPCA 1Q2SA 2WK2A 5H6HA 1JAKA 1GVSA 1SZNA 3A4WA 3T0DA 4NJJA 1REQB 4DNMA 3HM7A 1P4CA 3UVAA 3W22A 1OFEA 3BLLA 4CN6A 4ZFCA 3WDRA 1NY1A 2OLHA 1FVPA 3MYOA 5A8OA 3HOJA 1VPYA 2GVJA 1UJPA 5F2MA 4WDWA 4ZEPA 1GOXA 3TR2A 4JNYA 1Y5WA 4KQNA 4DJED 2NQLA 1BGGA 4A6GA 2YL8A 4AZIA 1XF0A 2NXIA 1VIWA 2Z6IA 1XQKA 3QMSA 1H49A 5G1YA 2QCDA 3BXWA 1JPMA 4AD4A 1ONWA 4NQ1A 1W5OA 2Y2WA 1VJZA 1ZJBA 1DTNA 3W81A 3AZRA 1TMLA 3FJ6A 5HWMA 3CHEA 4QDPA 4QROA 2E77A 5U7SA 3ARWA 3SCWA 4FB7A 5I3IA 4L4PA 3MP4A 5HINA 1UQYA 1X7FA 1IT8A 4JYEA 5A8QA 2WMGA 3NG3A 2X16A 4V27A 1I2QA 3W29A 4I8DA 4JX6A 1W3JA 3UZWA 4TO8A 1W32A 5EPDA 4KMQA 3ZJ7A 4QDWA 2AGKA 5DN1A 1PCWA 4LV4A 3IUDA 3VIGA 4EE9A 5FAGA 1JR1A 3KUMA 2OQLA 4YHEA 2R14A 4GLEA 1M01A 2RGMA 1PHQA 4RW5A 4UQCA 4R5EA 4QE1A 4AY7A 4EAMA 2DH2A 2IKGA 3R0DA 5C9ZA 1D8WA 4KS0A 1ISZA 1CGWA 1XIFA 1H50A 1ME9A 3HJEA 2QCMA 1GG1A 2AKMA 3GVGA 2BGSA 3G24A 1BYCA 4PTMA 5HNTA 8RUCA 2AGTA 2J8TA 4ZR8A 1GQNA 5FJIA 4DLFA 3REQA 1NP2A 4AIOA 3N2CA 3BVJA 3ZWTA 1HQTA 3QFEA 1BSIA 2QIWA 2CYGA 1H60A 1UWUA 2R1NA 3AALA 4X0VA 1TG7A 3QQWA 2OSXA 1GQJA 4UTMA 5D38A 2ALRA 1ICQA 3JR2A 3BLFA 3W25A 2XIIA 3RG6A 1JNDA 4LVFA 4MB5A 3KOFA 4EPDC 2DSUA 3H21A 2NVAA 1FA2A 2HRWA 4OBTA 1XDJA 4KBXA 1U22A 1UH2A 2ATSA 4G9PA 3UP8A 2XIMA 1W5QA 3H7VA 3ITCA 4HGXA 5REQB 2OLSA 2WKLA 5RUBA 4A3HA 1MEHA 4O15A 5GVJA 2W5FA 1TPVA 3AHTA 4HOZA 2NV1A 5DY2A 2C6QA 1YDYA 3GVWA 1V0KA 3UNTA 1RK6A 3CAKA 4GY1A 1XP3A 1LTDA 4R7JA 4RX0A 1E9YB 4EK7A 2NLIA 1NFBA 1J0ZA 5CPQA 1FH7A 5D32A 1XCFA 2CLPA 3PNUA 2NW0A 3BARA 4HIBA 1Y8BA 3TXZA 2Y61A 1GGOA 4PODA 2JIWA 3LLXA 4OVXA 4J35A 2NX1A 2QW5A 4KERA 2FZ9A 3TU9A 3EOUA 2R24A 4AD0A 1ZQ5A 4HMEA 4U3AA 1XW8A 5LIXX 1T8XA 1DIEA 3N2TA 4EXAA 3CGTA 3ZFHA 3CUFA 3NQCA 3SSZA 3CMGA 2YLLA 1WYIA 3N04A 3GC5A 5JIWA 4GI6A 4ML4A 3AYSA 1R6WA 1UUOA 1FFQA 1SM9A 4TVCA 4S39A 4X61A 3WQ5A 5ABTA 3KHDA 1EWEA 3ITXA 4HNUA 3NL6A 4DF2A 1E0VA 4NIRA 1L6SA 1P6WA 5FAJA 3W87A 1G5AA 1OK4A 2PF8A 3T40A 4MY8A 4LOCA 3H26A 1W8SA 5C7VA 2E5DA 2XVGA 3DH7A 3VDHA 3MV11 1OK6A 1Q6QA 4KWUA 4C6PA 1WZAA 3LCGA 1WE5A 3TAOA 4JTJA 3QY7A 1QW9A 1S46A 3T08A 3P0XA 3HPFA 2JGQA 3FYPA 3KBWA 1L6GA 4IM4A 2HPIA 4DEFA 4QJ5B 1HL2A 3NZQA 4HNOA 2E0PA 2WPBA 4OFCA 4E4PA 4CLMA 4FF7A 3KZPA 2W3ZA 5EFDA 3DESA 2VENA 3HURA 1XHGA 4H9TA 1K4GA 3LNMA 1V03A 1A3XA 3CH9A 2OT1A 1E1EA 4J27A 3WYZA 4GXPA 1EFZA 1WZKA 2WZHA 1R9ZA 4AVOA 3AHXA 1IR2A 1RCQA 2YYUA 1KWKA 3M0KA 4KFNA 3I3EA 1KRBC 4TX8A 1N82A 3BCJA 2DT1A 1EXPA 2ZRUA 3RM8A 3VNKA 4C1NA 1FWFC 1KBBA 2EG8A 3QHMA 1DV7A 1JD7A 1O7AA 1K03A 2INEA 1GTEA 1FWNA 1D8CA 3KL0A 1ZBKA 3WQGA 4EPBC 3TC7A 1S2CA 1GVFA 3PZ9A 3SSJA 1XYMA 2ZA2A 2A85A 1KB3A 1J0HA 1UKOA 1CBGA 4A22A 3B9AA 3DAQA 3Q58A 3CU2A 3TEVA 4M19A 1J01A 3TYZA 1XLKA 1QR7A 1TJRA 3VI2A 3W7NA 3BW3A 4FPSA 3CJPA 3FA4A 4BFAA 1ELSA 4FEZA 1PIFA 2WVSA 1D2KA 2CKSA 4CKQA 2JKPA 1HO1A 5HMSA 3F5JA 2BODX 5C5YA 2FPYA 2Y7DA 3A3HA 4J5NA 3BW2A 3T07A 4IFRA 3AMCA 4HK5A 3I4KA 1OFPA 5FD0A 1E3XA 3KP1A 1W1YA 3CEPA 4QR6A 3S2NA 1A49A 1FWCC 4X0NA 5HXMA 1QK0A 1TV8A 4LV9A 4QSFA 2OB3A 2V3DA 1GQLA 4JTFA 2DSZA 4QJ4B 3PAOA 1UBPC 3E2QA 1QPNA 4HTBA 1I60A 1J6PA 3TN6A 4JHZA 4H7CA 1SO3A 1W1A1 1YDVA 2VZOA 2XN0A 3HQ1A 2W67A 3PNZA 4XO7A 4IWWA 4AD2A 4FLOA 2GSEA 3KE0A 3PPHA 4DJDD 1LG1A 5FOOA 1S2TA 1WBHA 3WQEA 3MSRA 2J7GA 5BW6A 2MNRA 2J8FA 3PM6A 1ZSXA 4UFHA 3EKGA 3HGJA 3GY1A 2Y70A 3Q65A 3S6TA 2ZUUA 3T6CA 2QCNA 4NNBA 4DXVA 3L4XA 4QLJA 2GGIA 3LM7A 4AVNA 5KZMA 3BAWA 3KVKA 4LAKA 2JF7A 8TIMA 3VD4A 3EX1A 2FB2A 4K68A 2Z1KA 1DXEA 2VR2A 1RZMA 4IGHA 4XKYA 4MKSA 3A12A 1M65A 4P8UA 1HTIA 3SJ3A 1OFOA 4DBSA 4F9DA 4DUXA 5HQLA 4WJ8A 3R7MA 5MHBA 2WV8A 3G0SA 3WF4A 1VFOA 4D1IA 2PAJA 2UBPC 1XPGA 4C90A 2FPTA 3UG5A 1Z69A 5F1VA 2DGAA 1U5JA 4R27A 4WUIA 3IS4A 4WSJA 1CTNA 4BCEA 1W5MA 1Q6GA 5AHNA 2QUUA 4UTIA 3UXIA 3WQDA 2VM8A 2E25A 3OA3A 1UD5A 1XLJA 4H8VA 3W02A 1ZAIA 1FQ0A 3UWYA 3Q94A 2E7FA 3F5LA 4BQ2A 1IZKA 4HMDA 5DANA 4BI6A 1LBLA 4WRHA 4G8TA 2OEJA 2V5LA 2WBKA 1XS2A 1MEWA 3GU9A 1OINA 1TX0A 2J7DA 3PF3A 3F03K 2A7RA 3GNOA 2A7NA 4R9OA 3VOJA 3GNXA 4DJDC 2ABBA 3WH8A 1DJQA 1W17A 3U0HA 1EP3A 3A21A 2QCHA 5CQ1A 3GK0A 1KA9F 5FEWA 1JI2A 1TPB1 2F6UA 3D0CA 1SGJA 4UNKA 3NSXA 4AUBA 2Y1HA 1EA0A 4ADUA 1O1ZA 3HG4A 1UC5A 3SRKA 3QFWA 1FWHC 1MNZA 3GHUA 3CL6A 3IARA 3WQ8A 1DJGA 3THQA 1FWBC 4H1ZA 4JL1A 3RLUA 4DELA 4GZJA 1P48A 5G4HC 2WZEA 1LLOA 1BXCA 2IPWA 5HK4A 1XYAA 3GHTA 4TX6A 1XYZA 3MMUA 2YDAA 3A3WA 2GJXA 2ZA3A 1CENA 1IEVA 3N25A 3WBEA 2A3AA 1XQLA 3NOEA 3OGVA 3K5XA 4FZIA 1BYDA 1P7TA 2G0WA 2C15A 4XKYB 1UWSA 4LC6A 4FLRA 1L6FA 3KS6A 3LYEA 1WOBA 4JPGA 3S3GA 3WX7A 5I3KA 1EC8A 3SGUA 3B3DA 3WH6A 5G2IA 5DX7A 1V08A 2Q6ZA 3LV6A 1OT2A 3CT2A 3M0MA 1C93A 2G37A 3WQOA 3B9DA 1ZBWA 4M6UA 3GE7A 1UOZA 3JW7A 4IMCA 1KXQA 1RHCA 1Z6KA 1J96A 2GDQA 2TSYA 3G1SA 2XDFA 4MWAE 1KR1A 3Q4DA 3IJ8A 1Q7ZA 4JZ5A 2HVNA 4MWAC 1XPYA 4TVDA 1V0NA 4B9YA 5I7GA 3COTA 3I68A 3UR2A 4ZBCA 1FWDC 1AQHA 2WNZA 3SGZA 1LG2A 3GNPA 2D3LA 3AJXA 1EJRC 2POZA 3JRKA 2HS8A 1T0OA 4XK2A 5AC8A 3R13A 5DFAA 4KFPA 5HOSA 4GI9A 4J2MA 4QAWA 1C8XA 3RPTA 3VDAA 2CLOA 3AISA 4K2SA 3U3HA 1V6WA 5EMYA 1EKOA 1N2VA 2YA0A 5TIMA 1P6BA 3G1DA 1CPUA 4K36A 2XINA 2J62A 3AICA 3BLIA 2DSKA 3LXAA 2PRLA 2YFOA 3BSMA 1VYRA 5F7UA 4F0HA 2QCGA 2HVMA 3MMTA 1J5TA 1XC6A 3VUPA 1W3HA 4WGXA 4X9YA 1V3IA 3QOMA 1DE6A 3QRHA 3M0HA 2X41A 1TJ2A 3WLIA 3R12A 4NT0A 4D6GA 3TMQA 1BYAA 1WDWA 1U5HA 1RCOB 1BLIA 2HCVA 1G7VA 4N02A 3AHYA 3N73A 4C1NB 3P93A 3DKJA 1ITCA 4KIEA 4NX0A 3ZSTA 2J13A 2NSOA 4X3ZA 3ABSA 4MFDA 4XSLA 3TW9A 2AAMA 4B4HA 2Z27A 1UPMB 4S3BA 5DMLA 3MB9A 1AA1B 3CWOX 3T0AA 1IR1A 1PSCA 5B7ZA 5IHSA 3V5FA 4R7OA 1D3GA 4WXYA 5HUOA 1YPFA 3LPFA 3DG7A 4KF1A 2Q3RA 4AD1A 1XDLA 2WAGA 1V4YA 4DHGA 3L65A 2VRQA 5TBOA 3IEBA 3KTXA 3TE9A 2VX4A 1YADA 5EYWA 2CC0A 3TONA 3CHDA 3B4UA 5E0KA 5HUPA 1YW1A 1MXDA 3ZWSA 3F4WA 3IGHX 3RK8A 2H8XA 5A6MA 1KFWA 4XUYA 4I9MA 1CB2A 2PLCA 3LG3A 5E09A 1Z89A 3SCNA 4MNJA 2E09A 3ZLHA 4Y6GA 1W54A 5CG7A 1QXLA 4NL1A 1UPPA 1CX9A 3H2CA 1WKEA 3W2LA 4L65A 1PTAA 1OCBA 1J18A 2CLKA 4Y8EA 4RR4A 1S3HA 5CSUA 2O7SA 1NF7A 3B4YA 5BXPA 1ZB5A 4UCFA 1K4HA 2DUXA 2PTXA 3NWRA 1SZRA 1E0UA 3VGEA 2MANA 5ABEA 3TDFA 3ENLA 3WLOA 4ZFMA 3VX0A 2HISA 2D24A 1L0PA 3GZAA 4P7OA 4JYFA 1V3LA 3MP3A 4Y2WA 3VNZA 1Z44A 5CLTA 4AZHA 4NASA 1VBHA 3U5UA 4MZ1A 3N6QA 4WEVX 1EP2A 3W53A 4PRWA 2F6XA 4GRSA 3EX4A 4Q4OA 3OZYA 3SUVA 2CITA 3G1AA 4HKPA 2JK2A 3SW6A 1JZ8A 4DUWA 2I5GA 3RF9A 2XIQA 3PC0A 1TJ1A 4HU0A 3K8MA 1PKMA 3A6OA 3LBMA 3FNDA 1H51A 3PJXA 1YKWA 3W7IA 3M0YA 1OX5A 1DJZA 1SSDA 4C1LA 3C2FA 3OBEA 4LUSA 4YVVA 3LGDA 1XD1A 4J3XA 1XIGA 1NM9A 4IX0A 4CU7A 5DLCA 4LW7A 2X1IA 1GUVA 4AYSA 3HQOA 4HZMA 1A0CA 4C7GA 3A23A 3M41A 1MNSA 4ACYA 4WKHA 4W7UA 3HPAA 4GUGA 4LB3A 3WF3A 3S1XA 6A3HA 3WDHA 3V3WA 3D46A 2V3FA 4HU4A 3UW6A 1PUDA 5CZKA 3WD2A 3ME3A 1RQHA 1UASA 3LHUA 2DT3A 4NVTA 5I78A 1E73M 1WDDA 2WMIA 3L23A 2FDMA 2E9BA 1DXIA 7ENLA 1G94A 2D0HA 3VOFA 5BRPA 2QV5A 3F1QA 3GG1A 4JHMA 1RJRA 1YTEA 2ZX8A 3NVTA 1ZAHA 3KW3A 1DJYA 2DT0A 1KM2A 2VR5A 4Z17A 3IWPA 2E6AA 2PDGA 1R3WA 5TD4A 3OU8A 4LAZA 1UZ1A 3MI3A 3MY9A 1A3WA 1FHLA 4NXSA 2NV2A 2H3DA 2JGYA 3BMVA 1Y5XA 2L5HA 4H2HA 4IISA 3GRIA 2BX7A 3O16A 1JCLA 4B5NA 2C79A 4IH3A 3S5YA 2V82A 3RCMA 4NRRA 4C6IA 1XIEA 4IXXA 1B3XA 1JGIA 1WXYA 4M7TA 4ATDA 1NEYA 1UIPA 3WDJA 1LWHA 2QMJA 4HK6A 1NFPA 4PTVA 8XIAA 4JTGA 2Z7GA 4XZ9A 3I65A 1I9CB 1S5TA 1G7UA 3V5OA 1B9ZA 3S6DA 1H2JA 4MWAD 1XLMA 2A3LA 1S5NA 3W1RA 2GVEA 5D2VA 3SGGA 2R8WA 3GDLA 1FP8A 1VKFA 3W70A 3VD3A 3C4UA 2VEKA 3MTWA 5ENLA 1HP5A 3N9KA 1KRAC 2QF7A 3R1ZA 1NDWA 3B06A 4LFYA 1CLKA 1JDEA 1P0EA 1QJWA 2D73A 3GFZA 3HB9A 2GPTA 3U4AA 3RX2A 1LUCB 4KEZA 1OYAA 3T4CA 3U7VA 2A3BA 1TPEA 4CNUA 3LA4A 3WEOA 3TYAA 4F40A 1U1HA 1U1UA 1V7YA 1L8PA 3XINA 4PSPA 3L0NA 3M7WA 5H8MA 4P5UA 3P67A 3LS9A 2Y89A 3WLNA 1X38A 3TQVA 2GWNA 2FYMA 2JKEA 3NO1A 1C8QA 1FBAA 1PPIA 4I6KA 1OGSA 5FCZA 1JDDA 2YYTA 4AZBA 2XN2A 4NJKA 3E5PA 2HROA 3HF3A 4Z1CA 3GG8A 1UWTA 3FY1A 5A8MA 1OC6A 1PKLA 5T9BG 2DH3A 2X1TA 3O7UA 3TA9A 4US6A 2Q8LA 1JGMA 1C29A 3GXPA 1ADDA 3TVAA 3OYXA 1TCDA 4OECA 4ZL1A 4PGLA 2VDHA 2XZ9A 4CUCA 3E2RA 3WJYA 3C56A 4ZQPA 3V0TA 3E6EA 2JIEA 4HYVA 5HMEA 2B81A 5KSWA 2BGNE 3AJ7A 3PZMA 4L5ZA 2ZUSA 2Y85A 1PIIA 3A4JA 4AFYA 5C71A 3C0JA 3SY1A 3B8DA 1ESWA 2J66A 2X1RA 4UQ9A 4B92A 4Z2HA 1U5VA 2A5HA 3A47A 1TVLA 2I9UA 3L5MA 1ZNNA 1TTJA 3RLHA 1I1WA 3UGRA 3ZO9A 2PWUA 1FWSA 3VA8A 2VEIA 3HG2A 5SWUA 1IWBA 5EL1A 3G0UA 4DBWA 3O63A 2RJGA 4PUWA 1NDVA 2O9OA 2XSBA 4R9XA 4K8GA 1PB0A 4NX5A 3CTTA 1XG4A 3HO8A 4G5DA 3ALFA 3ZJ8A 1W9DM 2WQPA 3ZIZA 3FW6A 3CZLA 2VXNA 3BZJA 3D3FA 3KBSA 4LY4A 4KRZA 3MT1A 5C2CA 3SB0A 4DNHA 1QOQA 1P43A 1XLFA 4H9ZA 5C7HA 4KW2A 4Q8MA 4WDXA 2VC5A 1BSLA 2QXWA 3AYRA 4JQAA 3RAOA 1RPXA 5I3HA 1HF6A 2CZVA 3LERA 4IJRA 4GYJA 4C6QA 1PKYA 4G7FA 3UERA 1ME8A 2EKGA 1J2WA 1H0GA 4L9XA 1IEWA 1C3FA 4HA3A 4HZ6A 4B5TA 3MCMA 4IP7A 2CHOA 3TZFA 3LI1A 2Z1VA 4DM2A 1YDNA 1W0MA 2DJXA 3THCA 3GDTA 2E9MA 1LT8A 3RLVA 3M6DA 1P5BA 2AMGA 4UR7A 3PB0A 3PPFA 1J0JA 2PUZA 9RUBA 1YXYA 2WNQA 5AY7A 3V1HA 4IIGA 4G6CA 1FHVA 3B0YA 1WUEA 3WQ4A 1AL7A 4O19A 4M1RA 3M44A 3C8FA 3FGCA 3KOZA 1I0DA 4HOWA 3Q37A 5D8WA 2EPOA 3B04A 5CJNA 1N55A 5I77A 3E38A 4A8LA 1BFNA 1JZ6A 1FWIC 4MGGA 2IW0A 3AS0A 3UWQA 1S39A 2NT0A 4D1JA 1D7FA 1JUKA 1N7KA 1QHZA 1HJWA 4CD4A 4TR9A 3L9CA 5CKSA 2O56A 2REQA 3JUGA 5AHEA 2QUVA 4IOTA 4HYRA 1F74A 2OOGA 3SI9A 1E4LA 5CC6A 1EIBA 3QJAA 4GQQA 1UP2A 5I5RA 3NPUA 2HEJA 4JEJA 1AJZA 5JXQA 2VELA 3PWGA 5FJOA 4HNLA 3WD4A 4Q8PA 1UKPA 4WY0B 2VFIA 4E8GA 4DYEA 4XUGA 3L5LA 2WNNA 3WUGA 3GTIA 4AEFA 2QKFA 2HBVA 4F0KA 4HJWA 1QPKA 4PBFA 4F0SA 1VC4A 1LQAA 1FHUA 1KBJA 1HZYA 1CI1A 3T8LA 1EJXC 4XD3A 4UMCA 3EX3A 1DQWA 3FHAA 3QOKA 4U31A 4AHPA 3UCQA 1IEIA 1PZ0A 4CNTA 5FACA 3EKLA 4WGHA 3VGFA 2A21A 4FNUA 3V18A 1NDYA 1HKMA 2X1SA 4O0ZA 4JBRA 4M29A 4C6BA 1IXNA 4KCWA 3GH5A 3VIMA 2DQXA 2RFGA 4RZ6A 3UF9A 4PL2A 1LWJA 2WW5A 3NQ8A 2CEQA 1MQPA 1S2VA 3VMOA 4BK9A 3LCWA 5HPOA 1I2PA 2BLEA 3VKDA 3DI1A 1YX1A 3EB4A 1US2A 2HK1A 3FXYA 1R86A 5A6BD 1IWPA 4D6FA 1G1YA 1JXKA 2E6YA 4IFKA 4CD7A 4S3CA 5E6YA 2GSHA 3MUY1 4IX2A 4JY8A 5LGZA 3H23A 4Q8NA 2BSLA 4Z08A 4JGDA 3VIKA 1A5MC 5JVLA 1YXCA 3DHUA 4Q4QA 5FF7A 4AU0A 1ZJAA 2AQOA 2QVHA 3LSBA 1KM4A 3PWAA 3VYLA 3MSDA 1G4SA 1UR1A 1ZBCA 1WKDA 1R0MA 4JIQA 4HJFA 1A3HA 4QE4A 3GXDA 2E9LA 1V02E 3QR1A 4ADTA 1O5RA 3IVUA 4JQ1A 3GHRA 4F2TA 4K1GA 3TW6A 1F8MA 4GJ1A 2IPGA 6TAAA 3CV7A 2PDMA 3KFTA 3NZRA 4WJXA 1DIOA 3G3DA 4LVBA 4KETA 2YBVA 5HMDA 4W86A 1QPQA 3V0UA 4WY0A 3STPA 3IIXA 4GUFA 5E0FA 2HE5A 4FOJA 4Q8OA 4KRTA 1JAEA 3APYA 4C6EA 3EPNA 4ERIA 1GNXA 4DWSC 1WAWA 4QRNA 3IUIA 4JS3A 1LL4A 3B9NA 5C9WA 5HNUA 3SDOA 1NU5A 3P14A 1U83A 3MSGA 1RAKA 2HZGA 4WXZA 4HQVA 4ALDA 1JI1A 4JAWA 1XFBA 4P7LA 3VMNA 4GFSA 2XUCA 3CIXA 3F2CA 4GKLA 3TKFA 4GZ7A 3H2NA 3QHOA 3T0CA 2X09A 3ZQ9A 4E38A 5HR7A 1VCFA 2Y7FA 4JTUA 2EG7A 3W1MA 3L4UA 3B0VC 1XLHA 1GQIA 4IICA 3S2CA 4RXGA 2PDCA 3RCYA 3WNKA 2XFWA 1WB0A 1VEMA 5D05A 4DJEA 3H4GA 3NO5A 3B8WA 3FDKA 2DZVA 2BMBA 3A3XA 3C0QA 4K37A 3UJSA 3W7MA 5E93A 5D37A 4QSHA 3VD7A 1B90A 3CM4A 3CL7A 2OQHA 3U2CA 4OBSA 1EHAA 1XR2A 3CQKA 3ANVA 4Q8TA 5KITA 3LZ3A 3RR1A 4AZ5A 3VM5A 3GD6A 5D4YA 3I7QA 4JTRA 3GR8A 2PURA 3E0VA 4A8RA 3ZT5A 1F8IA 3R11A 4H9MA 1V8EA 1EYWA 1ICSA 2Y7GA 4PBGA 3RM4A 4BHYA 5LSMA 4JX5A 1VPQA 4JQ3A 1TTQA 4DWSD 3C8NA 3PVFA 2CBJA 4H01A 1OX4A 3I6TA 2A7PA 4H9XA 4QLKA 3SJNA 5I06A 3OGRA 4JTLA 3NO3A 3B9EA 2DZBA 3AIEA 3CAQA 4JXCA 5ABHA 4UTTA 4TU1A 3C0SA 1JYVA 3V4BA 3TW7A 1OYCA 2QPUA 3O6DA 3T1GA 1GPFA 4FA3A 3R8HA 5C9UA 2WHLA 1A4LA 2GUBA 2DSVA 5HJYA 3S5OA 1FXPA 3W1LA 4RUBA 1XLGA 1UR0A 1MZHA 1OX4B 1BF6A 4H2CA 4ZOCA 4NG3A 1EJUC 4GABA 5E6ZA 4B90A 1KGUA 4GG9A 3AXMA 1JYNA 4NZFA 2YDRA 1P0DA 4AF0A 5LHFA 1S2UA 4NZ4A 1KM1A 1SU5A 2DIJA 4D6JA 3W07A 1M7PA 1NOWA 4H3DA 4OT7A 3IIOA 4QNWA 1EZ2A 5F4WA 1NWTA 1T40A 2EKCA 5M2FX 2FIQA 4F0LA 1KFJA 4NZ1A 1L6WA 2ACUA 2ZXQA 4B9ZA 1X6NA 2BASA 4K7VA 3P80A 2PZNA 2PPGA 3HGSA 3R10A 3GNRA 1ONXA 4DJFD 1S3TC 1V3JA 3TP4A 1T5AA 1EJSC 4PBEA 3EBVA 1I6NA 4UIOA 4Y9OA 2RGLA 1VP5A 3IJDA 2C71A 4O50A 1M7OA 1NJJA 3NQ2A 3B8IA 4S3GA 1I8JA 4ROQA 4K38A 3M07A 1QW8A 4ERAA 4E0CA 4HD5A 2PDIA 2ASHA 4PEEA 1T8QA 3AWOA 1K02A 4JTIA 4HOXA 1W9BM 9CGTA 1HG3A 3DX5A 4B3LA 3URNA 2W79A 3CUHA 3M4HA 4MDOA 4M7SA 4LWWA 1Q4WA 2RH9A 1KRMA 3A5VA 4O14A 2XM2A 1TPH1 4D6EA 8A3HA 2NQ9A