3FKRA

Structure of l-2-keto-3-deoxyarabonate dehydratase complex with pyruvate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
304
structure length
303
Chain Sequence
TPRHRGIFPVVPTTFADTGDLDLASQKRAVDFMIDAGSDGLCILANFSEQFAITDDERDVLTRTILEHVAGRVPVIVTTSHYSTQVCAARSLRAQQLGAAMVMAMPPYHGATFRVPEAQIFEFYARVSDAIAIPIMVQDAPASGTALSAPFLARMAREIEQVAYFIETPGAANKLRELIRLGGDAIEGPWDGEEAITLLADLHAGATGAMTGGGFPDGIRPILEAWREGRHDDAYARYQAWLPLINHENRQSGILTAKALMREGGVIASERPRHPMPELHPDTRAELLAIARRLDPLVLRWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of L -2-keto-3-deoxyarabonate dehydratase an enzyme involved in an alternative bacterial pathway of L-arabinose metabolism in complex with pyruvate
rcsb
source organism Azospirillum brasilense
molecule tags Lyase
molecule keywords L-2-keto-3-deoxyarabonate dehydratase
total genus 110
structure length 303
sequence length 304
chains with identical sequence B
ec nomenclature ec 4.2.1.43: 2-dehydro-3-deoxy-L-arabinonate dehydratase.
pdb deposition date 2008-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3fkrA00
5F4XA 4KKXA 4G1KA 3QQ0A 4NJHA 3BVJA 2C13A 5AC7A 2WSYA 5K9CA 1KV8A 3GYEA 5GVJA 4MLJA 1I2NA 3N9SA 4OHQA 1MO0A 2Q8ZA 4XTIA 5AHIA 4MUZA 4YCOA 3R89A 1DHPA 2YFNA 4UTLA 1B3OA 1LDCA 5D2YA 3IV3A 5I3JA 1KLZA 3FYPA 2ABBA 1CX9A 2OCZA 1W31A 1XBVA 4YCPA 4AHOA 2GJNA 3NQMA 4X3ZA 5EBUA 1PCKA 2FPYA 5BNKA 4PODA 3S9YA 4DPPA 1S5TA 3DI0A 1KBIA 4E2BA 3DGRA 3NYZA 4N4QA 2BWGA 3F4NA 3C61A 3BPWA 1WOBA 1VH7A 2A7NA 4DXVA 3O05A 1F73A 1XBYA 5D2WA 3TW7A 3QM3A 1OX6A 4XBKA 3OG3A 2XN0A 3A5VA 3NZRA 2G5WA 4M7SA 5AYXA 1DBTA 5KSWA 4LTSA 5G4EA 3T7VA 1JULA 3FKKA 2C15A 1GPWA 4CLMA 3S6DA 3WJXA 3M0ZA 4OV9A 4YL2A 1K03A 3GZ3A 4UCGA 3S8HA 4ML9A 1WQ5A 4BF9A 1EP3A 1LRQA 1GVSA 2GVLA 5FEZA 1XI3A 3TC7A 5C55A 2C1HA 1MXSA 1GVRA 3PVFA 4XBSA 3EB2A 5K2ZA 5AOUA 1ML1A 5A5WA 4X2RA 2O7QA 2RFGA 1WBJA 3UPWA 4IXHA 3W7EA 3PUDA 5L9FA 1W5QA 1IIHA 3CC1A 4IPJA 1AMKA 3SGUA 1TTJA 2B7OA 1JCXA 2Y85A 3IEBA 2V9DA 1YDVA 3E96A 3I6RA 4MJMA 4LS2A 1HL2A 1VGAA 1W3NA 3AJXA 3NL2A 3W7IA 4MLRA 3CWNA 4O14A 4FX8A 2JGQA 1OK4A 2B0MA 3A21A 1KTCA 3EWUA 1H7RA 4WX2A 4N9DA 1QMLA 4EF9A 4JTEA 1OYBA 2WNNA 2Y62A 1SO5A 4MJZA 1EA0A 3PM6A 3W1MA 3C4UA 3H55A 4PEKA 1U83A 3UWYA 1MEWA 4M6PA 2HS8A 1PCWA 2YZRA 3PB0A 1KLYA 3PSWA 1ME9A 1K3UA 3M47A 1VYPX 2QCCA 3NGJA 4NNBA 1ZAHA 1ZENA 3NL5A 4O28A 3HIJA 4PL2A 3P7YA 3UWQA 1EB3A 4Z0JA 3HPXA 4ADSA 5CZ0A 3UPBA 3EWYA 4O4VA 2CLEA 3LV6A 4JTJA 3EXRA 3WK0A 1GT8A 4K6AA 1UASA 1SQ7A 2RDTA 3MYPA 2AGKA 1S5VA 3VCRA 5AHEA 1Q3NA 1QOPA 1EEPA 1EWDA 1TPEA 4O19A 4N2YA 4GUHA 1SO6A 3P80A 2E6FA 1T96A 4AHQA 4U4MA 2ZZ6A 1ZAJA 3M5VA 3LXAA 1AW5A 5FF0A 5K9DA 4UTIA 5IM51 3TU9A 4CNNA 4O50A 4Q33A 3PBYA 1ICPA 2H8XA 4NT0A 3G22A 4R34A 5DCBA 3BG5A 1SO4A 3TIMA 1ICQA 2NLIA 3BW3A 1K7FA 1YXDA 5BOOA 5C6MA 1P1XA 3NQ7A 3EX4A 3PC0A 1TB3A 3FYOA 1OX5A 5F2IA 2HMCA 3LXBA 3NG3A 4JS3A 3STGA 4A2SA 3W1TA 5AYZA 1O4UA 4X9SA 3MHGA 1F6KA 3O6YX 1BTMA 3W6YA 3HMJG 3A9IA 3LLDA 4FNRA 1ADOA 3FLUA 3FA5A 4E0CA 2CLLA 4O12A 3CHVA 3QFEA 1OF6A 3W2JA 5KZDA 3O06A 4O18A 3V1PA 1XKYA 4XKYB 3S5NA 4ONVA 4DF2A 4R7JA 4QQ3A 1OK6A 4FNTA 3PBVA 4O1BA 4R33A 1ME8A 3GXPA 4XWUA 3O6CA 4HNUA 4EIVA 1AL7A 4LV9A 1JCNA 4UTUA 1IGSA 1VJIA 3FKRA 5CPOA 2A6LA 2ZZ1A 1N7KA 3MP3A 3VE7A 1J2WA 3NPXA 1PV8A 2V2HA 4FIRA 3LCFA 1GVQA 1GTHA 4O17A 4A21A 3QSTA 3G1VA 2ZDRA 4BWLC 5C54A 3BLFA 5D38A 3THAA 1OF8A 1MEHA 4JN6A 1LORA 5CPLA 4PL1A 3W23A 2FFCA 3LDVA 4LVDA 5HR6A 1OYAA 3DU0A 4OQVA 3M9YA 1F76A 4JIQA 2A2IA 3B04A 4M19A 5J5RA 1EWEA 3TQVA 3PAJA 1LLWA 2AQWA 1O5XA 4ICNA 4RKAA 3R8RA 1LYXA 4UUIA 3LHZA 3L5MA 1AW1A 2PRMA 2W0UA 3S5ZA 3W76A 3BG3A 1G69A 3PF3A 2NV1A 4NXSA 4UFJA 4C1LA 4CQAA 3IGXA 4Z1AA 3TQKA 4K8EA 3SIZA 4RV8A 2ZA2A 3EKZA 1OG0A 5K4ZA 4JTSA 1KM3A 5F1UA 2Z6JA 1O60A 4YWIA 3LCXA 4TIMA 4AB4A 4IWWA 2Y7GA 3KVKA 2GVGA 1L6WA 3O6DA 1YDNA 1X1ZA 4O13A 5FI8A 5LNRA 3R5EA 4O52A 4PFMA 3B03A 3K30A 2A7RA 4BI6A 2WNQA 4JX5A 1TTIA 5FF7A 5G4WA 2A7PA 1I2QA 2CU0A 4TR9A 3BO9A 4FNPA 3LGEA 1TPH1 3HQ1A 2FB2A 1DORA 3L0NA 2QCGA 3S1UA 3P81A 3C2EA 4NQ1A 3IIXA 5D03A 3SI9A 2YPIA 2C0AA 3L5LA 4RX0A 2DZWA 4RR4A 2DZTA 5FF2A 3PS7A 2PURA 4KFOA 1F74A 3W2UA 5LNUA 2VEIA 3IGSA 4E2DA 1M5WA 4EVZA 2QDHA 4NNCA 1H60A 1XBXA 2J24A 4JTLA 4LUIA 1H7NA 1VS1A 3HOJA 3DXIA 4GNJA 1RVGA 2VENA 3NPUA 2GQ9A 1FX6A 2E5BA 1VCFA 4UNLA 3OEXA 1R30A 1XUUA 5FEPA 1W0MA 1SUXA 2X30A 1F7BA 4ZQCA 3O07A 4DF1A 2Y89A 1Q6OA 3R13A 2NX3A 3T40A 1UJPA 3ABSA 3HBLA 3STEA 3M1ZA 4AF0A 4RXFA 1PE1A 4O11A 2J9XA 5HQEA 4LNYA 4OU1A 5G2WA 1H62A 1YADA 3LHYA 4KFNA 3L9CA 1BEUA 3QMSA 4JICA 4K36A 2TRSA 4LS0A 1FWTA 2B7PA 2ATMA 3BK0A 3H54A 5LNVA 1A5SA 4LT9A 3EXSA 5J5DA 5F1VA 3S1XA 4ORIA 5AN7A 3OIXA 3I7SA 3SR7A 3TK7A 4NNAA 4UTTC 1KM1A 1CW2A 3W73A 3WJYA 2H6RA 2B7NA 3QH2A 2CLFA 4IJBA 3PULA 4OWGA 4P2VA 1QFEA 2ZTJA 3H53A 4UFLA 4IMFA 5A8GA 1JUKA 1HTIA 1QCWA 3C3NA 4I7WA 3EX3A 2DZUA 3NOEA 1WOAA 1WV2A 2NV2A 2GQAA 4UFHA 1G4SA 2A4AA 1GWJA 4XUGA 4UMCA 4RZ6A 4MY1A 1WDWA 3HG2A 5C5YA 3S1WA 4N02A 5LZLA 2Y63A 2YFOA 3QF0A 2H3BA 2E68A 1G67A 5KITA 3NQAA 3PUEA 3WFAA 1OFEA 2PRLA 2NZLA 1GOXA 3PR2A 4AWTA 4AMAA 2Y7EA 3TXZA 3TAKA 3C8FA 4PTNA 4JTUA 1MEIA 1I2PA 2DP3A 3C56A 4M5PA 3HG3A 1DJNA 4GUFA 3TAOA 4IXXA 2O7SA 5BMWA 1M6JA 2BLEA 4POCA 3TV8A 4DPQA 5LGXA 4NJGA 4CNPA 3W7PA 4N9BA 3DHFA 4LV4A 4KWWA 5AYYA 1G7UA 2Y88A 3NEVA 2A1YA 5D2TA 1QOQA 2TYSA 3ZWTA 2FDSA 3CB8A 3PG8A 1EP1A 3TMQA 2ZTKA 2VXNA 3EWBX 2Y7FA 3W1PA 2NUWA 1ZHAA 3NQ2A 1I2OA 5HINA 1U5JA 3NPVA 3HGSA 1W8SA 4ZL1A 1VQTA 3FS2A 2WOQA 4LW7A 2CZ5A 2QCFA 5D02A 3SFKA 3A5FA 3A22A 2A6NA 5BW6A 5FF3A 2QUVA 1TQJA 1JUBA 2J9YA 4O57A 5D05A 3W07A 1R2TA 3EXTA 2VKZG 4Q4KA 4UTMA 3BW4A 5BMXA 4FXRA 2DZSA 3G3MA 1LOLA 4LVFA 3W1QA 2JKEA 5HULA 2RDWA 4WY0B 3MHFA 2VELA 4K8HA 1OVDA 1LBFA 2PCQA 4K37A 3U8GA 1RPXA 3LCLA 4YMZA 4MYXA 3DFTA 4TU1A 3EEGA 3QW4B 4FX7A 1M7OA 3QMTA 4L4MA 3QZEA 2Z0IA 3EWZA 4K7VA 2DZVA 4CQ9A 3ABQA 3LHVA 3W72A 4BI7A 4IUOA 4WY0F 3GDKA 1DV7A 1DOSA 1JCLA 8TIMA 2A5HA 3STFA 4I9AA 1BWLA 1TSIA 1GYLA 1W1ZA 2ZBTA 4FF7A 3W9ZA 2ALDA 4PC8A 2E09A 4DBDA 1KM0A 3PBWA 3NQ8A 4DO4A 4UFMA 3FJLA 3W7MA 1AG1O 1HFBA 3O8AA 1RZMA 4TMCA 3C2RA 3CLMA 4GUGA 1I45A 1XCFA 1JQXA 2CLIA 4O16A 2P1FA 3INPA 2V30A 4S2BA 1FCQA 1IXQA 3G24A 1YTKA 2NXIA 2ZRYA 1AW2A 4GUJA 3NM3A 2DORA 1JRBA 2VFFA 3E12A 3WK2A 2G96A 4O1AA 2YX0A 1TPUA 3P67A 2QKFA 1NAL1 1JJKA 4RJEA 3ZWSA 2PE4A 4DBEA 3NAVA 3F1QA 5G2IA 1SO3A 3UWUA 3P5YA 2C14A 2R91A 1J4EA 2H90A 4Z1CA 1VYRA 1TJRA 1W3TA 5DXYA 3M5ZA 1LRTA 3MJYA 4DQWA 5H2ZA 5LNWA 1C9DA 1K7XA 4O15A 5CGQA 3EX1A 2QCNA 2V81A 3TUUA 2C3ZA 4O10A 3W83A 1MZHA 1UCWA 3C2FA 4MVAA 4B5NA 2ZRUA 2DJLA 4TMBA 5HWNA 3U6WA 4OE7A 1QAPA 1RQEA 4JGDA 4DELA 1TPC1 3HPZA 1SW0A 1KTNA 3U2OA 1JR1A 2ABAA 2XFWA 3N73A 3G0UA 4QIUA 1W56A 3HGOA 4CQ8A 3KAOA 4XTDA 4N9CA 2TPSA 4MIMA 2EF9A 3P8IA 3Q94A 3G1XA 5G5IA 2HSAA 1H50A 2WQPA 3NQEA 2CLHA 4NUWA 4RCXA 2H8ZA 4CCEA 2ZQ0A 1ZFJA 1UUOA 3BGJA 5D30A 5BRBA 4UTWC 2QJHA 3EWXA 4R53A 3B05A 1FCUA 1J5TA 3UZJA 1K8XA 3DFPA 3KX6A 1DVJA 3KFTA 1KFBA 3RU6A 3TH6A 3TW6A 3GNDA 3HF3A 1QR7A 1GVFA 4IPIA 1FWNA 1Q6LA 2V5LA 2ZRXA 3ELFA 2YXGA 4DEFA 2ZZ5A 1LP6A 4Y8FA 1H5YA 3I68A 1LBLA 1O5KA 1LOQA 3O16A 3OBKA 2BZNA 4LC6A 4OGZA 4UMAA 3TR2A 3CIXA 3TC6A 5HR7A 4O0ZA 1LZOA 4CCDA 3W7CA 3P61A 3W7JA 4JTFA 5I3GA 2V2DA 1X6UA 4Y90A 3LM7A 2OX1A 3UD6A 1T8XA 2DZXA 4ZZ9A 1LCOA 4FNSA 2VOMA 1ZAIA 1B57A 3FFSA 2E5DA 1EUAA 1GG1A 3P82A 3NR0A 1FY6A 4D2JA 4M7TA 2DJXA 1G4TA 2QUTA 4RXGA 1D3HA 1ME7A 4ZQMA 3QPZA 3WJWA 1NEYA 3W7HA 4MZ8A 3NL3A 2FTPA 3LHUA 3B0PA 4QISA 1N55A 1N8FA 1LLZA 4DF0A 2OMAA 2E6YA 3M5XA 3L67A 3R2GA 5AHNA 4HPXA 3TSMA 3A24A 4HT3A 1S3HA 1EP2A 1GG0A 2ZA3A 4O8RA 4ZQPA 5D33A 2I9EA 5C2XA 4JNMA 5L6UA 1W5OA 3W85A 4WOQA 1P0KA 3JR2A 4NZJA 1EUNA 3DFSA 6TIMA 3FEMA 1VLIA 4E38A 1GQNA 1QPQA 1B4EA 4AHPA 3LTYA 5EYWA 4P61A 4IX0A 1OFOA 3NQVA 2QCMA 4IMEA 4QJ1A 3B4UA 2EPHA 3LTPA 3R12A 2VFGA 5AFDA 3QC3A 4Z0SA 3KVJA 1X1OA 2TMDA 4ZQOA 4NJKA 1SPQA 4GWEA 3DBPA 2ZYFA 5AHLA 5CSRA 3LHTA 1YYAA 4AF0B 2RHGA 1RV8A 3LBMA 1PHQA 5K3VA 1OFQA 2YR1A 3PG9A 3M5YA 1TPDA 1KFCA 2VEKA 2XN1A 1P4CA 1OFRA 3QJAA 1JQVA 3QSRA 5DY2A 4FNUA 3W84A 3G18A 1SZEA 4O1CA 3S5YA 3TXVA 1YXYA 1KA9F 4JD4A 1LTDA 4ZMGA 4UTKA 2W6RA 4GFSA 4ALDA 4GBUA 2VFEA 3DH7A 4DO5A 3GDLA 4GC4A 4NJIA 4BFAA 3NQDA 4CNOA 3WK1A 1R2RA 3L2IA 4GRSA 5FEWA 1E51A 3TJXA 1RQBA 1WAUA 5D32A 3BLIA 5CSSA 2CLOA 3TE9A 4UXDA 1PVNA 2Z2UA 5ABTA 1ZCOA 2QEZA 2JK2A 1D3GA 4N6FA 1A5BA 1EX5A 2WJZA 3T55A 2R14A 3UQNA 3FOKA 5K7JA 4ADTA 1TCDA 5HNRA 2QCDB 2QAFA 4GJ1A 4Q32A 4EOUA 4WXZA 4JEQA 4TX9A 1TV7A 1L6YA 2GVJA 2YSWA 3CQ0A 1PHWA 3LBCA 5G1YA 1FDYA 1YPIA 3MUXA 2CZDA 2FIQA 2VFHA 3IVUA 3QW3A 1OABA 1TRIA 1XFBA 1JUEA 1KBJA 3M43A 2E6AA 1WXJA 3W1NA 1KFKA 2Q3RA 3MHUA 1QPNA 3GR8A 4O53A 1TRDA 2WSQA 2CW6A 1CI1A 5F4WA 3HO8A 3O63A 3LERA 1LM1A 1UB3A 1KV5A 4MZYA 4WY0A 1GVOA 1KFJA 2CZFA 4FB7A 4BWLA 3W74A 2NXHA 2Y70A 3G1SA 3W1RA 4UTHA 2NXGA 2QAPA 2QDGA 3G1DA 3LHWA 3M7WA 3VKJA 4RZ5A 3SZ8A 4RZ4A 3RLVA 2EGZA 2V0TA 2ZRZA 2V8ZA 3G1YA 4UFKA 1XXXA 1AK5A 1YLVA 1XDMA 2R94A 1LROA 4ORMA 3G3DA 4MOZA 1GEQA 3TDFA 2FPTA 5DLCA 3LCWA 1G7VA 3NM1A 3TQ0A 3TSDA 1JCMP 2QF7A 1TQXA 1OFPA 4KFPA 2FPVA 4RK8A 2CLMA 3N14A 4GUIA 3MWAA 3PSVA 4N9EA 3GDTA 2ZRVA 3BLEA 1OFBA 3L66A 1QPRA 2XN2A 1RR2A 2ZZ4A 4MY8A 1ALDA 3UXDA 1W3IA 4LVBA 3KOFA 4LVAA 3L21A 3DZ1A 3BGGA 5KMYA 5IBXC 1Z44A 2VFDA 4AXKA 5AC8A 1ZALA 3TFCA 3NDOA 2IQTA 3MP4A 2Q3OA 4O4WA 3SY5A 1JCJA 2QCHA 2ZRWA 4LRSA 3S42A 6ALDA 3W2KA 4AWUA 1G4EA 1H7PA 1WX0A 2E1DA 2PRHA 1EIXA 1W5NA 4WQ6A 5HWJA 1OX4B 4MFDA 3ZS4A 2YW4A 5AB3A 5LHEA 4HNNA 4Y96A 4X22A 3G1HA 3JS3A 1TTPA 2NWSA 5K4XA 4HNTA 3UWWA 1IXPA 3OA3A 1FWRA 1WYIA 4WJEA 4FEZA 1AL8A 2GOUA 3P8JA 4JYFA 3N9RA 1SR9A 3L65A 1TREA 1F2JA 5EPDA 3N19B 2I1OA 1OHLA 4LUJA 4NXKA 1VYSX 3DFQA 1W5PA 2OT1A 1TTQA 4TO8A 4UNKA 4UTTA 3NNTA 3W1UA 2YW3A 3P62A 3LI1A 3EX6A 3I7RA 3B0VC 4H4IA 3NVTA 1M7PA 3C2OA 3W7QA 2A0NA 2E5CA 2ISSA 1F5ZA 1KM6A 3OVPA 3NQCA 3VI2A 1FUYA 2VC6A 4OT7A 2BTMA 5DCDA 3WK3A 4OBTA 2QCEA 4HN4A 1K02A 1D9EA 4H6KA 1OYCA 3E9AA 2V2CA 4BI5A 1G6CA 2BX7A 3I7QA 4BK9A 1QO5A 2F7FA 4YLWA 3PUOA 3LCGA 3GDMA 4IGHA 1KTBA 3LV5A 4JTTA 3W1LA 2OJPA 3KVLA 3N2MA 3G0SA 3RMJA 3MO7A 3W7NA 4LVGA 3IVSA 2C16A 3GKFA 4UTWA 2E77A 3GR7A 3O1NA 3IIOA 3S1VA 4LU0A 3M6YA 1IIGA 3O15A 1RQHA 2WPBA 1WA3A 4K38A 1QO2A 1EPXA 5DBTA 3MI2A 1A53A 1BKSA 2J27A 3DFOA 2YYTA 3HPSA 5AHFA 5DBUA 4JX6A 2D73A 3GXNA 1IXNA 4OV4A 4WUIA 5G1TA 3NL6A 4LC8A 2CWNA 2CLKA 4O1DA 1O94A 1KW1A 3CIWA 5EY5A 4AH7A 1KM2A 3FJ6A 3W88A 3NO5A 4JX4A 1VHNA 1XC4A 2QUUA 4ZQNA 3VFLA 1I4NA 3LI0A 4HPJA 3S5OA 1TJPA 3TSBA 4MFEA 4UMBA 4A3UA 3ZFHA 3CWOX 1MSSA 1W5MA 4LRTA 2W79A 3AO0A 2VEPA 3MBFA 5CKSA 5DCEA 4JXCA 2WO5A 3GX9A 1SSDA 4Z1BA 1SFJA 4Z1DA 5MHBA 3Q37A 4L4LA 3GKAA 2EAWA 1TPVA 1GJPA 5TQLA 7TIMA 2BXVA 4DO6A 4NJJA 3G1AA 1H7OA 1NVMA 2C18A 5CZTA 1L2UA 3NA8A 4IMGA 5CPMA 2Z6IA 1KFEA 3DKLA 2ATSA 1KFLA 5LGZA 4AWSA 3RF9A 3W75A 3Q2DA 4IQLA 3YPIA 4JTKA 4PH6A 4GE8A 2OZ0A 5G2HA 4AAJA 3DI1A 1W54A 3IRDA 5CZJA 2H3DA 1XM3A 5TBOA 4FHAA 3IIPA 3MI3A 1Y0EA 1VRDA 2X1UA 3D0CA 3OVRA 3KRSA 3ANYA 1Z48A 4WOZA 5E93A 3L0KA 2FB3A 2JGYA 4Z08A 3UZ5A 1FCVA 1R47A 1B9BA 3L68A 1YPFA 2BSLA 3ABRA 3CPRA 4UC5A 1YXCA 4QM1A 1VLWA 2WSRA 4O54A 3EKLA 3S0CA 1OFDA 3THQA 1H7WA 4I7VA 1XBZA 2E6DA 5KZEA 2C6QA 1VCGA 4A2RA 4IMCA 5CG7A 3MMTA 3LX9A 1OJXA 3W1XA 5U7SA 1X7FA 5LNSA 3GLCA 2ZCGA 3LLFA 4MY9A 3SECA 1K7EA 4WD0A 3NQFA 3IGUA 1FDJA 1QDSA 1R46A 3QQ1A 1B4KA 3T78A 3W7OA 3OVQA 3LOTA 3PWAA 2UV8G 1THFD 5F2LA 4JTGA 3RNDA 3SW6A 3W70A 5D2VA 1VZWA 4AEOA 4YXGA 1L6SA 4PA8A 2P10A 3WJSA 3MI6A 3VNDA 5LKYA 3TKFA 2ZZ2A 4Y9AA 4HSNA 1DL3A 1T0OA 2WKJA 2GPTA 4MZ1A 4JTIA 3GB6A 4NZFA 5FF4A 3TROA 2HTMA 3BW2A 1QNVA 4HHPA 1I8JA 4LS1A 2C19A 4S2CA 3KRUA 2AAMA 1FXQA 3VE9A 1TPWA 3TFXA 5HUOA 1ONRA 3NPWA 2FQIA 3M44A 4AVFA 5HUPA 1TIMA 1X8FA 3FIGA 4IMDA 2NX1A 4UR7A 4JIPA 5EA9A 3UNDA 5H91A 4NU7A 5CZSA 1LBMA 1Q45A 3EWWA 3UXAA 4MYAA 3LRKA 4UIOA 3G8EA 3L5AA 1V5XA 3CT7A 2V82A 3QEZA 2Y6ZA 2P0OA 1H61A 5KINA 4LWWA 1IF2A 3T44A 3L0GA 2JKAA 4U28A 1SSGA 4ZQRA 3RLUA 3ABOA 3ATYA 4IOTA 3QMRA 1FBAA 3T4CA 4KWVA 1HG3A 4NX0A 2YGYA 1ICSA 3B06A 3RFAA 1H1YA 1SW7A 4S1FA 1Q6RA 3GDRA 3GXTA 2Q8LA 3HG4A 1VC4A 1V7YA 3TX9A 3LTSA 3B0UX 2B4GA 1UBSA 4BR1A 5E0KA 1F6PA 3KVMA 3NXFA 1S5WA 3PB2A 1SZGA 3DKJA 3TMLA 1XUZA 3M41A 3BV4A 3W71A 2QR6A 1QWGA 3GK0A 4N4PA 2VFIA 2CZEA 2DU2A 3G0XA 5KTLA 5I3HA 4QNWA 2GUUA 3QYQA 1VHCA 4H3DA 5LHFA 1SZNA 2YCEA 3F03K 1PS9A 3N34A 1T99A 1LOSA 3P74A 1L9WA 1KM5A 4CCCA 1Z42A 2EHHA 3P5ZA 4IX2A 4HIBA 4HNVA 2DZPA 1VR6A 5DXXA 3N3MA 1H63A 1SZFA 3PY2A 5FESA 3P60A 3DHDA 2RKXA 4XZ9A 2OT0A 1FQ0A 3CTLA 1F05A 5D2XA 1FWWA 1I2RA 2X1RA 2GQ8A 3LRLA 1K8YA 4O0KA 2RDUA 1Q6QA 3UWZA 2GJLA 1WBHA 2WNZA 3KHJA 2NX9A 3W1AA 2TSYA 3RK8A 2J6XA 3WJZA 4EF8A 1UUMA 3W7LA 5F2MA 4JYDA 3OHIA 3MYOA 1Z41A 1TO3A 1GZGA 1C29A 4JYEA 3E0IA 3M16A 2X2GA 1QPOA 3C2VA 1FWSA 4UFIA 2KZHA 3TA6A 3SJ3A 5I3IA 3TNOA 3CEUA 4M6QA 1RD5A 4JTHA 3W7GA 3CM4A 3C6CA 1HUVA 1TV8A 1DJQA 4JR5A 3UYCA 5D09A 1YDOA 1ZY9A 5F4SA 2ZZ3A 4JY9A 3NQ6A 4WZHA 3CEPA 2X16A 1NSJA 3P84A 4MKNA 2FLIA 3HG5A 2NUYA 3GIYA 1P5BA 1C8VA 4PCFA 1DKWA 3W7KA 5D37A 4J9JA 4Y6GA 3UY7A 1VCVA 3IVTA 3KXQA 5TIMA 2JBMA 1ZJIA 3I65A 5E1QA 4HKPA 5U4NA 3LCIA 1TPFA 3BG9A 4WXYA 3DFNA 3E49A 2X1TA 5DN1A 4FXSA 5EKYA 5D04C 3TJLA 2YDAA 1ZNNA 3JRKA 5AC6A 4A29A 1JVNA 4JDYA 1A5AA 3W22A 3GVGA 2ISVA 2J9ZA 1DQXA 4QSHA 1H1ZA 1LRNA 3HJZA 2FJKA 2JKPA 4EWND 3SSJA 4XKYA 2Y61A 2NWRA 2I14A 4QITA 3W3OA 3IIVA 1IXOA 4GXMA 1FCBA 4NVTA 2B7QA 5F2GA 3V75A 5SWUA 1NF0A 1SW3A 3G8RA 5FEXA 5DELA 1NF7A 4K7YA 1YTDA 1O95A 3LRMA 2LLEA 3QRHA 1P0NA 3HB9A 4XQ6A 3C52A 1H7XA 3E02A 2NUXA 5EL1A 3W86A 2A85A 2V5BA 3LCHA 1DQWA 2CFFA 2YYUA 1FDZA 3EX2A 3HGRA 4ADUA 3ATZA 4QAIA 5LSMA 3W2NA 3MP5A 3LXCA 1TV5A 3HGJA 4N6EA 4M6VA 1GYNA 2G97A 5K9XA 2EKCA 5CPNA 3IIZA 1OFAA 2X1SA 2QCLA 2ZZ7A 1BWKA 3TCEA 1YTEA 5I3KA 3ZR4A 4A22A 3UWVA 4FNQA 3SGZA 2F84A 5HMSA 4W9TA 3W2MA 3NQGA 3C0JA 1A50A 1SU5A 1KM4A 3B8DA 4JY8A 5I3FA 2ZA1A 4LOCA 1JRCA 3UY8A 2G95A 3PBUA 1VPXA 4JDBA 3DAQA 1HO4A 2HS6A 3NZ1A 2A21A 3QPYA 1G4PA 1A5CA 1HO1A 4FX6M 4HSOA 2VEMA 3LB0A 3W7DA 4RLIA 3GNNA 4C1KA 5HWMA 2Z1BA 1XDLA 4QNEA 3STCA 1TPB1 1GTEA 2J88A 1FXPA 2RH9A 2Y7DA 4I7UA 5EMUA 3G1FA 3GAYA 4LY8A 1PL9A 3CU2A 3W2LA 1W37A 5T26A 4FIQA 5KZMA 3GAKA 4ZVJA 1JCYA 2PC4A 3DENA 1XL9A 2ISWA 2QCDA 4K39A 3W7RA 3A23A 4UTJA 4FO4A 3MBDA 5IBXA 3USBA 3BARA 1H51A 4UR8A 2QJIA 2WV8A 1SFLA 3Q58A 1R2SA 1TYGA 3W87A 1PIIA 1TMHA 3MW7A 4NX5A 2ZFAA 1K8ZA 2R8WA 2QJGA 4MPQA 5DY3A 1OX4A 1NFBA 5HJLA 5AHMA 3N2XA 3F4WA 3KRZA
chains in the Genus database with same CATH superfamily
3ZVIA 4NJHA 3LUTA 1O1ZA 4LCRA 2DDXA 5FCZA 4FXJA 3ITYA 2GGIA 2WSYA 4F79A 4IT1A 1Q5MA 3N2BA 3BQ6A 1I2NA 4OHQA 1V93A 1XLMA 1K6AA 1Y65A 2H9AA 4UTLA 5GJNA 1QBAA 3SQMA 3R0KA 3IV3A 2HROA 3ZXWA 1CX9A 5A6BD 1W31A 4HMNA 1KWKA 4I8DA 1XBVA 1W2VA 3QOMA 1XRVA 3A9BA 1JI1A 5BNKA 1UPMB 4MUPA 4PODA 3CUJA 6REQB 1S5TA 4AEEA 4GJJA 1KBIA 2PLJA 4RE0A 4E2BA 3C61A 3BZGA 3GVWA 3RIKA 3RRXA 3LM3A 2W61A 3OG3A 4V2XA 4NZ3A 2XN0A 5BWAA 4J3ZA 1LWJA 1SMDA 3AIQA 2XSXA 3SAZA 1Z89A 4CLMA 4ZODA 1JF6A 2HEJA 4ATDA 3M0ZA 1UJQA 3SRHA 5REQA 1K03A 3GZ3A 4M56A 3CYJA 1PJ9A 4L1GA 4DNHA 2D2JA 1GVSA 1B30A 1RXOB 1E71M 3SB0A 2C1HA 1MXSA 3OOQA 1GVRA 3EB2A 5A6JA 4JFVA 2O4MA 3B3DA 3CQIA 1WBJA 4IXHA 2YJQA 1OIMA 3ARSA 1WZLA 4UOZA 4IPJA 1AMKA 4AY7A 1VFSA 1TTJA 1KXQA 4I8YA 2PLMA 3BJSA 3SFWA 3OLGA 1YDVA 1RLDA 2OLHA 4MJMA 3P0WA 1VGAA 1XGDA 2FTYA 2WZTA 1Q2RA 2GQ3A 4S3GA 4GNKB 4PMRA 1C92A 3Q65A 5I2UA 3ARPA 4NZ5A 1OYBA 2WNNA 5DF0A 2YCKX 3TP4A 3EOEA 2GOKA 2PS2A 3ABZA 1U83A 2X8RA 4J28A 2ZUMA 1MEWA 1PYMA 4M6PA 4BEQA 1V3LA 3PSWA 1I0BA 8XIMA 3CL8A 3NGJA 3IJLA 1GZ1A 4CN1A 5J8LA 4AZ5A 7REQB 2WQDA 3CHCA 1S46A 1NH6A 3U4AA 3UPBA 4AIBA 4Z2GA 4O4VA 1M53A 3GFYA 5A8PA 5C7HA 4HP5A 4FPSA 2NQJA 2PTXA 1GEHA 1ODUA 3BMXA 1Q3NA 1QOPA 3N9KA 1TPEA 1SO6A 3P80A 1A0EA 2BB0A 2GGEA 5ABFA 3QV7A 4U4MA 2ZZ6A 3M5VA 5BCAA 4F0SA 1V3IA 2QPSA 3IARA 3MDWA 5FF0A 3VGGA 1S2WA 1E1EA 3BV7A 1ICPA 1JDCA 2H8XA 3E38A 3S3GA 3TA9A 1DTUA 2YOCA 1HKIA 2CWXA 5FIPA 2PBOA 4UQCA 1M03A 1SO4A 3TIMA 5E0CA 3ECQA 3TYEA 4LH8A 2G3FA 3BW3A 3N6JA 5FSDC 1P1XA 3F2DA 4G9PA 5C71A 3EX4A 2IKGA 2OVLA 4AVNA 3W53A 4IP5A 3R58A 2V5KA 3NG3A 4S39A 4GYKA 4A2SA 2YL5A 1O4UA 4X9SA 3QHNA 3O6YX 4IIBA 3W6YA 3HMJG 4R27A 3A9IA 3KEHA 4FNRA 1XR2A 4Q4QA 4GG9A 5A95A 3FA5A 3GHTA 1ZGDA 4AVOA 2P3ZA 4O12A 3CHVA 4HA0A 3W2JA 3H8AA 1PKNA 4QQ3A 4ZO9A 1OK6A 3PBVA 2PGFA 3SDOA 2XIIA 2J47A 1E3XA 2C71A 1PZ0A 4TX8A 3AMLA 4REQA 4LV9A 1JCNA 4HZ7A 4UTUA 4Q4PA 3FKRA 5CPOA 4B5WA 2ZZ1A 2V3FA 3NPXA 2V2HA 4A21A 3G1VA 2ZDRA 4YWSA 1XCWA 3D3AA 4BWLC 2C1IA 6XIMA 2P88A 4UR9A 4WIWA 3PPFA 3VGHA 4N42A 1F3TA 1LLOA 3WQVA 5CPLA 4A4AA 2FFCA 4GQQA 5AVNA 4UCFA 4YTUA 1E9ZB 3POHA 4JIQA 2A2IA 5A2AA 3WLMA 1DJYA 1QRQA 1KRMA 3VILA 1IWBA 1W1YA 4ZOBA 2NVDA 2ZICA 4HD5A 1X6LA 2PRMA 3PF3A 5FJRA 4C1NB 4CQAA 2CKRA 3R0DA 3HTWA 4GLEA 3EKZA 1OG0A 4JTSA 3VABA 1O60A 3LCXA 2VZUA 3H4XA 3P0XA 3G1RA 3KVKA 2ZKMX 3FGCA 3SCQA 5FI8A 3UVAA 2ZXDA 3R5EA 4O52A 4IIHA 3K30A 4C91A 1TTIA 4ACZA 5D9PA 2A7PA 1C90A 2CU0A 4FNPA 4P8UA 4GFIA 2VC9A 2QCGA 3S1UA 1XH2A 2YPIA 3BLPX 4F9DA 3E2RA 4B5XA 3CQJA 1XW8A 1F74A 4WGXA 1Q6CA 5I02A 3GNXA 1XBXA 4YIWA 3UFYA 5CSUA 4LUIA 4M29A 2WMKA 5JXQA 1W3KA 4XISA 1FKWA 3BOXA 5IXEA 4KT2A 2GQ9A 4DZHA 1UH2A 3K1GA 2ZUWA 1H1NA 3BJTA 2HBVA 1R30A 1W0MA 4JCLA 3O07A 3OLIA 3W02A 4DF1A 4NZ4A 1G94A 3MUY1 1T40A 4Q8QA 4NL1A 3S46A 4RXFA 2OU4A 4LNYA 3VOIA 5KZ6A 5G2WA 1H62A 3LHYA 1AUSL 1QNOA 3QMSA 4ACZB 4B2DA 2MUCA 4JN8A 3LK6A 4D71A 4Q6JA 3EXSA 2C79A 5F1VA 3S1XA 4G56A 1GGOA 1I1WA 3CO8A 3WY1A 3GRIA 3TK7A 2CESA 4I9MA 1MVYA 3C8NA 2XFYA 2RAGA 2WZIA 1OWQA 3UJRA 1F4AA 2BODX 2ZTJA 1R9XA 1HTIA 5DMMA 1NOUA 1W9XA 3VZYA 4CEUC 4QE5A 2PTDA 2A4AA 3FDGA 4PCNA 4HA4A 3HJEA 2VO5A 3BAYA 1NFGA 3UR8A 4UBPC 2VWTA 3L4VA 4RZ6A 3SCRA 3Q67A 3HG2A 3S1WA 4N02A 4MADA 1EXBA 4HTBA 2Z2AA 4XD3A 2G50A 1XH0A 4PTVA 3WL0A 2BP1A 4Z42C 2PRLA 4AWTA 2PDNA 4AMAA 4FK9A 1YRRA 3RG6A 4JTUA 3KOYA 5C9RA 2R82A 2O55A 3H12A 5LIUX 2BGQA 3TAOA 2FHCA 2J7DA 3NDZA 2O7SA 2BLEA 3JVAA 4E4UA 4DPQA 1P0BA 5A6SA 1XYBA 4CNPA 4N9BA 2DT2A 3VA8A 2FHBA 2TYSA 3CB8A 2PDGA 3PG8A 4H9VA 1WCGA 1ZHAA 3NQ2A 1I2OA 9XIAA 3LGDA 2P0IA 3HGSA 3NPVA 2ZUUA 3K5XA 1XISA 1VQTA 2WOQA 2INFA 1H4PA 5D02A 4IMAA 3PPCA 3SFKA 3A5FA 2OSWA 2QUVA 2C1GA 1AVAA 3W07A 1U5VA 3S6OA 1OC7A 4XVDA 4UTMA 4D8AA 4FXRA 3G3MA 4GKTA 1IT8A 3FX4A 5LXEA 3MHFA 4DI9A 1LBFA 4K37A 4KWSA 1JYXA 1KRCC 3DFTA 1HNYA 4FX7A 3QZEA 1MQRA 2IKIA 4CQ9A 1KD0A 4WVXA 3D47A 2J74A 3GDKA 4M8UA 1V6WA 1JCLA 1HJXA 3AXHA 4I9AA 4IPPA 3VGEA 1RY0A 4ROPA 2ZBTA 3AMDA 3AQUA 2OWXA 1BVNP 3NVDA 4AIEA 3PBWA 4B16A 1A0CA 4BKNA 3VKDA 1HFBA 1RZMA 4F0MA 1FH9A 3QOKA 1XCFA 1JQXA 4F40A 2DT1A 4DI8A 1A47A 2O9TA 1FCQA 1DJHA 1IXQA 1V3MA 1BWVA 1GORA 4WKFA 2W91A 1V7AA 3NM3A 1XG3A 4B3ZA 1WUFA 2G96A 4O1AA 4PMVA 2YX0A 1TPUA 3W6MA 3NAVA 3S9IA 3F1QA 5G2IA 2OODA 4GVGA 3P5YA 4YVXA 1J4EA 3V3WA 3V4BA 4KW2A 3PZGA 5H2ZA 3GFZA 1BYDA 1C9DA 3AYRA 5BXPA 1E72M 1UQYA 5EGRA 2V81A 3TUUA 4O10A 4PUKA 3W83A 5CJNA 1O12A 3S2CA 4OE7A 4JGDA 4X60A 1KTNA 2ABAA 2XFWA 3N73A 3ICJA 1W56A 4NHVA 1KGWA 5IFPA 3H24A 3VXGA 3H7RA 3HZ3A 2HWGA 4MM1A 4XTDA 4X0VA 3VIKA 3QVQA 2ZDSA 3WN6A 2J8FA 2WQPA 4NUWA 2EQDA 4CCEA 2CXGA 1ZFJA 4K3ZA 5BRBA 3EWXA 3TTOA 1V51A 4DM1A 1J5TA 2Q8XA 1D8WA 3NFUA 1OGSA 3WH8A 1KFBA 2WZEA 1EF3A 1XDJA 2O0TA 3GNDA 3HF3A 3PANA 2BV9A 2WBGA 2ZRXA 3UP8A 3I68A 1LBLA 3C0LA 3WQ8A 4E8GA 3OBKA 4LC6A 1UR9A 2RJHA 4QRNA 4B4HA 3TC6A 4CCDA 5DMLA 3TYZA 2CHOA 2Y8KA 1A5KC 2V2DA 2YL9A 4V33A 4Y90A 3LM7A 1T8XA 3O3RA 1LCOA 2I5GA 1B57A 4LBRA 3ITVA 1YMYA 6REQA 1EUAA 1EX1A 4NAFB 3A64A 4TX6A 1FTXA 3R79A 3CIVA 2DJXA 2QUTA 3HM7A 1D3HA 2ANUA 1NEYA 1P6CA 3W7HA 2GL5A 1AA1B 4BY3A 3BTNA 3B8VA 2FTPA 2Y4SA 4R9OA 4IFKB 2E6YA 3M5XA 3PN8A 4PMUA 3R7MA 3K4WA 1BYBA 4QS6A 1EGVA 3T8LA 2X0YA 1ISXA 2PGRA 3CAWA 1HKJA 1GKRA 2R1MA 3L4WA 5M03A 3VDGA 3D5HA 1FHDA 1TX2A 3UG4A 5C2XA 2PFHA 4GX9A 4JNMA 2NSOA 3WNLA 3W85A 4WOQA 1M01A 1EUNA 4OKDA 4ILSA 3FEMA 1GQNA 4QCFA 3WQEA 1QPQA 1DJIA 3LTYA 4HU8A 4J40A 4HYWA 2YXXA 5A8MA 6CGTA 4Q8NA 3LTPA 3HURA 3EPNA 1H5VA 2NVAA 3UJSA 4IUGA 4ZQOA 4NJKA 3TZNA 1GJWA 5CSRA 2HVOA 2AL2B 2I17A 3H23A 1YYAA 2Y0FA 4DJDD 3BSGA 4M6UA 1R3VA 2BHYA 1EA9C 3WUFA 1PTDA 3PG9A 2YR1A 2XSAA 3SUSA 3AIBA 1TPDA 3AYVA 2XN1A 1OFRA 4JL2A 3P3BA 1R8LA 4FNUA 3G18A 1WPCA 1F8MA 1SZEA 2ON3A 5C8BB 3TXVA 1YXYA 4JPGA 1KA9F 1EJSC 3BXWA 4Z2HA 4ZMGA 3FEQA 4AEFA 5FOOA 4GBUA 4DO5A 1EYEA 4GC4A 4CNOA 3WK1A 3W29A 1E51A 1RQBA 5D32A 4PE8A 1PZ1A 1ITQA 4FSAA 5CSSA 2BY1A 1OM0A 2VX5A 1TV3A 3TE9A 1MQQA 4KCVA 4N6FA 3T55A 4GO8A 1WZMA 1Q7MA 2GSJA 3UQNA 1K9DA 4DZIA 4KPLA 1LUCA 1O7AA 2QCDB 4EOUA 4LY4A 4WXZA 2VVSA 4XX6A 2J7GA 1E6NA 2GVJA 4P8WA 1XYAA 4Y2WA 1R5YA 1S1RA 2Q71A 4W7VA 3LBCA 4HB7A 1YPIA 3MUXA 3IVUA 7A3HA 4P7QA 1KBJA 3M43A 3WMBA 2VQUA 1WXJA 3MVIA 5IFTA 4E3VA 2Q3RA 3MHUA 2WMFA 4M0XA 4K1WA 4A35A 3HQOA 1DWGM 2CW6A 2OEKA 3AS2A 3AZSA 4DIAA 2QPXA 3DGBA 1NQKA 4JEJA 5AYIA 1TZ9A 1GVOA 2DIEA 1W1PA 5C9ZA 1XIJA 1LL6A 3G1SA 3ZZ1A 3ONCA 2VM8A 2QAPA 3G1DA 3CPUA 3M7WA 1LQAA 1UKOA 4JTRA 1JXJA 4RZ5A 3TJ4A 4RZ4A 4AD0A 4UFKA 1EJXC 4PMZA 1YLVA 1NU5A 3AS3A 2BVYA 2R94A 1GEQA 3TDFA 1SM9A 2FPTA 3WLIA 1JCMP 2QF7A 4YTRA 4RK8A 2BS9A 3SY1A 3MWAA 5T91A 4JFTA 1TELA 4QG9A 2DPEA 1QPRA 4ATLA 4KH2A 2ZZ4A 4MY8A 1ALDA 3UXDA 1DP0A 1W3IA 4XAYA 1PZ2A 3IS4A 4OECA 4WF7A 3L21A 3DZ1A 4C6MA 2YLAA 3MJMA 3BGGA 3FHQA 3GNPA 3EWDA 3GG0A 4HJWA 5B7YA 1FH8A 3ISIX 1Z44A 3E74A 1M65A 3UGRA 3TFCA 1US0A 1ZUAX 2IQTA 4AY1A 1JCJA 4LRSA 1QWKA 3W2KA 1F6YA 1WX0A 1P0EA 2PRHA 4WQ6A 4KBXA 4GIAA 4H1ZA 1TTPA 1HKMA 4HNTA 4ZTXA 3OG2A 2V63A 3OA3A 2NQ9A 4FEZA 1TUXA 1TREA 5EPDA 2I1OA 4OBRA 3DFQA 4UNKA 1TTQA 1O68A 4UTTA 3CV1A 3WQDA 1DEDA 3W1UA 1WP6A 3I6TA 2YW3A 3P93A 4OUIA 5M17A 1M7PA 3W7QA 1QPKA 2PWEA 5GNXA 4Q4SA 2GJRA 3K4DA 1EZ2A 1X8CA 4YVVA 4HN4A 3RCNA 3E9AA 1EL3A 1G6CA 2X7VA 3I7QA 4BK9A 1MMFA 3KLLA 1X38A 3VC6A 4XAPA 3LV5A 2VCCA 2OJPA 3GG8A 3BAIA 3WNOA 1FOBA 1FWGC 4MAZA 2PEVA 4EXAA 1YBQA 3W7NA 4LVGA 4UWMA 1DXFA 2Z4GA 2O92A 4UTWA 3URAA 2CERA 4MB5A 1AJ0A 3SJNA 3GC4A 4PMJA 4XZIA 2WCAA 2WVVA 4GI8A 3S1VA 4PR4A 3PZIA 2OYMA 1O66A 1DIDA 3PWGA 4E2VA 4K38A 1WA3A 2QHAA 4H41A 1QO2A 1QI5A 1SZRA 5M5DA 3WL1A 1XLJA 3VKAA 3U48A 1E3ZA 3ARWA 1VF8A 4ZO7A 4LC8A 2CWNA 1WZKA 3CIWA 4AH7A 2X0SA 2QUUA 3N6HA 4NSBA 4HPJA 3S5OA 3TSBA 1G9HA 1QJWA 3PJUA 3AO0A 2VEPA 1UWIA 4IHCA 4GIEA 1UZHA 2YB1A 4Z1BA 1W1IE 1P7TB 4Z1DA 3Q37A 1UD8A 1CBGA 1QOXA 3WD0A 3OYXA 3MQTA 3VUSA 4DXKA 2W63A 2WMJA 2E25A 3LSCA 4LAOA 3F4VA 2BXVA 4W85A 2IPJA 1KCLA 3OLEA 5GNZA 4C6KA 5CZTA 1L2UA 2XHYA 3GU1A 4IISA 1ITCA 5CPMA 1KFEA 3DKLA 2ATSA 3WDJA 3T4WA 2WKLA 4JTKA 2J7EA 5A94A 4PH6A 4KRTA 4GE8A 3GHUA 3W82A 5F7UA 3DI1A 1W54A 3UGVA 5CZJA 1XV8A 2HPMA 5TBOA 4FHAA 4AZCB 4YJ5A 2OG9A 3OIHA 1Y0EA 1E9YB 3DESA 3BANA 1T41A 5E93A 1GYMA 5LIWX 2WHMA 1RCQA 1CXHA 3HV8A 1FCVA 1OB0A 4NASA 1R47A 3ALGA 1B9BA 3DHUA 1C8XA 1FWAC 1YPFA 3ABRA 1ZB5A 2I57A 4QM1A 2WSPA 4HK7A 4O54A 1J12A 3EKLA 3S0CA 1OFDA 4GZIA 1BLIA 1Q13A 4TTUA 5C0QA 2E6DA 2GUYA 1VCGA 4A8LA 2GGJA 4HGXA 1AZ1A 5U7SA 4GVHA 2ACSA 4GMEA 3TN5A 3WF3A 4XD6A 1T7LA 4GQGA 2GDVA 3GLCA 3OGVA 1OY0A 2XTKA 4WD0A 1VEPA 2YIHA 3O9NA 4R7OA 4JTQA 1B4KA 3UZWA 3T78A 4FLOA 3OVQA 3LOTA 1CZ1A 1THFD 4JIIX 3WCZA 1P43A 1RA0A 4AZCA 1L6SA 5BU9A 1NFPA 1I75A 2P10A 3WJSA 4EK7A 4IF2A 4JHOA 3PJWA 3KBMA 1DL3A 1HKVA 4NZFA 2GPTA 4NRSA 3VOJA 4RE4A 4S2CA 4B3LA 3K8KA 3VE9A 3FCPA 1R3WA 2XWEA 1JFXA 2CKSA 3NPWA 2A3LA 1X8FA 3MUIA 4NY2A 4JIPA 5EA9A 2D24A 1XYCA 3GNOA 4IPNB 5C70A 4MYAA 4MWAE 3U5YA 2QS8A 1JL8A 2QJNA 3A3HA 1NQ6A 2GSEA 3LMZA 1H61A 7ENLA 2DUXA 3T44A 3L0GA 3E5PA 3RLUA 2J6VA 4URIA 3ABOA 1L6GA 4DJDC 4PMYA 3T1GA 2P50A 4HZMA 2QMKA 2POTA 4QDWA 3HPFA 3WLPA 4KWVA 3UCCA 1ICSA 3RFAA 1IZKA 4OBSA 1V7YA 3TX9A 3APGA 1XFCA 2FHFA 3CHDA 4LGXA 4HNCA 5E0KA 3IPWA 3NXFA 1AQFA 1XLAA 1VEMA 1XUZA 1H0IA 3GTNA 2HRWA 1XLBA 3MV11 1QWGA 2Q09A 3BCJA 2VFIA 5I23A 2GUUA 4H3DA 3ZR6A 3L7RA 3RYSA 1PS9A 3N34A 2PTZA 1BQGA 1CB7B 4IX2A 4GABA 2DZPA 3MUAA 2Z7GA 5DXXA 1NOFA 3N3MA 1H63A 3AU2A 1V02A 3KWXA 1A3WA 2RJGA 2F61A 1F05A 3SBFA 2X1RA 1ZPTA 1EJTC 1NIUA 4MSSA 3BLKA 2Z2BA 1J6OA 3GY1A 3W1AA 2TSYA 1PX4A 4EF8A 4M82A 4AISA 1Y5XA 1GKQA 4JHMA 1UP0A 2YA1A 3LSBA 5AKQA 4ECLA 3WDQA 4UFIA 1TVPA 2B31A 4JTHA 3W7GA 3CM4A 3C6CA 3NUKA 3GTHA 1HUVA 1DJQA 1MI3A 3BWWA 1MNSA 4C6LA 3FA3A 4JY9A 5DRIA 1C8VA 3MKKA 4A3RA 1K77A 4KEUA 1VCVA 3KXQA 5TIMA 4H19A 1W8GA 4HKPA 3OQ8A 1TPFA 3CJPA 2X09A 1XYLA 1B31A 2PWVA 1QI0A 1I60A 3JRKA 4A29A 4JDYA 2TAAA 3WEOA 2PB1A 1IR1A 1DQXA 4H8VA 1H1ZA 1LQ2A 3SSJA 3H4WA 3W3OA 1C8QA 2WWCA 5CJ5A 4NVTA 2B7QA 2XUCA 1NF0A 1OZMA 3G8RA 3U3HA 4K7YA 1O95A 1P0NA 1Q7ZA 1Y5VA 2NUXA 3W86A 4AC7C 2A85A 2V5BA 3LA4A 1XX1A 2CFFA 3ID7A 4QLJA 3EX2A 3PJTA 1R7OA 4QAIA 3FK4A 4N6EA 1HF6A 3VZZA 4HQVA 1GYNA 3VNIA 1JZ2A 2G97A 1RJPA 4AZ6A 1TVNA 2PUZA 4IFRA 4HZ8A 4C6EA 4F3HA 3BCDA 2ZZ7A 3WFZA 1YTEA 5C9XA 5I3KA 5ABHA 2ADAA 4A3HA 1F07A 4JL1A 5HMSA 2WKGA 3QXBA 1Q65A 2FZDA 1KM4A 4IIFA 5JQ9A 4GCAA 1R9ZA 3AICA 1R6WA 5DRCA 1HO4A 2BBFA 2NT1A 4MNKA 1HO1A 2VX4A 3WF4A 3WLKX 2VEMA 2J8TA 3CUFA 3NJ3A 1KR0A 1JEZA 3B40A 3STCA 3WNNA 2J88A 5B80A 2Y7DA 2CBJA 2XVGA 4I7UA 1PL9A 4DJFD 5HANA 1P1MA 2I56A 3DENA 3CLWA 3KCLA 2ISWA 3IUHA 3MBDA 1EBHA 1H51A 4LFYA 4UR8A 2WV8A 1MDLA 1SFLA 1UG6A 3W87A 1TYGA 4U2ZA 1FHVA 4NX5A 1EC9A 1RD6A 2IKHA 4MPQA 5DY3A 4J7RA 3F4WA 4G1KA 2X2YA 1GZJA 1EXPA 4GO9A 4HMDA 5GVJA 3WBEA 3PP7A 1GOQA 3NYDA 1GW1A 5AHIA 9CGTA 1JZ7A 2HPIA 4S3JA 4YCOA 3R89A 5D2YA 1B3OA 1LDCA 1KC7A 3MO4A 1VFLA 3CL6A 2BGSA 3WLJA 4PBFA 3CL7A 2ABBA 3SY8A 4QHRA 4LJ3A 4QSFA 4PEEA 1J10A 3CQKA 3RAOA 4X3ZA 1JCTA 3B9AA 2FPYA 4B5TA 3E2VA 3S9YA 4UZSA 3VNLA 5D9MA 4I9TA 2J77A 3OA5A 5CJMA 3DGRA 3W01A 4N4QA 2BWGA 3ANUA 3PTQA 1WOBA 3NIYA 4FI4A 3DG3A 3E0WA 4DXVA 3S2JA 5D2WA 3TW7A 4GACA 4XBKA 3NZRA 2G5WA 1DBTA 3MT1A 4LTSA 1TCMA 2ISFA 3KRBA 3MZ2A 3V36A 4D8LA 3PWIA 3WJXA 4JBRA 5AZ1A 3NSXA 4KIRA 1V0NA 5BOEA 2HZGA 4B5VA 3RLHA 3BJFA 1WQ5A 4H01A 4V1XA 3M4HA 2HQAA 2GVLA 1PYFA 2BXZA 3VD3A 1UH4A 4ERAA 3FSTA 1ML1A 2WHKA 5A5WA 4X2RA 4WSHA 4LUTB 3R10A 1Y8BA 1UD4A 3PUDA 3W7EA 3WLQA 5L9FA 3EEZA 1YNYA 3SGUA 3VD7A 2AAAA 5CH9A 4H8NA 2B7OA 2Y85A 3IEBA 1E40A 3L2LA 2V9DA 3E96A 3I6RA 1FFRA 3TLLA 3RDKA 3WD1A 2QPUA 5DT7A 3ZVHB 3KS6A 4FX8A 2JGQA 2ZX5A 1OK4A 3URNA 1H7RA 4KCWA 1A5NC 4E6MA 4PUJA 2FMNA 2CHRA 3SSZA 4MJZA 3PM6A 3W1MA 3C4UA 3H55A 1XWYA 4RL3A 4C6QA 1PCWA 5E09A 2YZRA 1KLYA 4GCXA 3M47A 4NNBA 5LIYX 3VMPA 4NKCA 3R0UA 5BROA 3QY8A 4OJYA 4GQBA 3VDCA 3GUWA 1IZCA 1OGBA 1GT8A 1J2BA 4H2CA 4XBJA 4OZOA 3BICA 2FFIA 2AGKA 4Q8WA 1YBQB 3R6IA 3RX4A 4IFOA 5ABFB 3E3HA 1EWDA 4O19A 4GUHA 2E8ZA 1UKSA 4AHQA 3OB8A 1ZAJA 3CZGA 3LXAA 1WXYA 1B9ZA 4HJFA 3RXZA 2VX6A 4NP7A 3N15A 1ZL1A 1VKFA 4CNNA 2WJEA 3AFBA 2ZX9A 4NT0A 1R9YA 3MSDA 4LEFA 4R34A 3QGAC 3BG5A 2JEPA 1O1HA 2V5CA 2D1ZA 5BOOA 3GQYA 5C6MA 3E0VA 4KRUA 1TB3A 2OOFA 3FYOA 1OX5A 4MWAC 4RDVA 2PLCA 3U4FA 2HMCA 1NDVA 4Q8TA 4GI6A 1EYWA 5AYZA 1BTMA 4RDWA 1OD0A 2ISDA 3TC3A 1ADOA 1PUDA 1KXVA 4E0CA 3BGAA 2CLLA 5BOFA 2E28A 3O06A 4O18A 3V1PA 3S5NA 4ONVA 3OODA 4Z17A 4L9YA 4FNTA 1ZBCA 2OX4A 4L4OA 2R1NA 2QUNA 1TJ1A 4HHHA 1MW0A 3O6CA 1SMAA 4ZE4A 5A3HA 4EIVA 1S39A 1IGSA 1VJIA 3GXDA 1UR2A 1KBLA 3KE0A 1N7KA 1BSIA 2YA0A 4FIRA 4AD4A 5EB8A 3QSTA 4XO6A 1O5RA 3AIEA 1CXLA 3H2OA 5E70A 3RR4A 3SCTA 1OF8A 1MEHA 1VBHA 5I0DA 3AALA 5I6SA 4PL1A 3V1HA 3VM7A 5AVHA 3LDVA 3GBEA 3DU0A 3FW6A 3QR3A 2GSHA 2DVXA 3KTSA 3M9YA 4M19A 1VENA 4QE4A 3N18A 1TMLA 1JDEA 1LLWA 4ICNA 4RKAA 1MYRA 3R8RA 3L5MA 4GIRA 4DLMA 5IDZA 3W76A 3WBXA 4NXSA 4QXIA 3IGXA 4Z1AA 3SIZA 1CENA 1Q85A 2VURA 1FKXA 1KBKA 2ODOA 5F1UA 4BZYA 2MNRA 4TIMA 3IUDA 4GVIA 5A6TC 4AB4A 1ZZMA 4IWWA 4ASTA 3U7BA 4YYFA 4LYQA 3RHGA 1VFHA 3IGHX 3AMGA 5EMKA 3NO3A 3E5BA 3AAMA 3SUTA 1TUFA 4KGJA 1TKKA 1HJQA 4JX5A 3QV8A 5FF7A 3AIVA 1JAKA 4TR9A 3N11A 3BO9A 5BRQA 3LGEA 3IWPA 4HCLA 1DORA 1JFHA 1X97A 3CUXA 1UBPC 3C2EA 4NQ1A 3SI9A 2C0AA 4KS0A 4X9YA 2NT0A 4QDPA 1SJBA 2PURA 3HQPA 4KFOA 3W2UA 4IIDA 5PTDA 3IGSA 3DOPA 3BLDA 4CD6A 1D2KA 3H2AA 1H7NA 2RGLA 3DXIA 4GNJA 2Y5EA 3MVTA 3A4WA 3V5CA 3NPUA 1M7XA 4CVWA 4NRRA 4EE9A 2E5BA 2VRQA 3PPGA 1VCFA 1R38A 4F2BA 2OLAA 1XUUA 5FEPA 1W9PA 1SUXA 2X30A 1F7BA 4PMNA 1UH3A 4ZQCA 3T9PA 1RAKA 5HQLA 3ANVA 3T40A 3STEA 3NSMA 4ENLA 2QIWA 4O11A 2J9XA 5HQEA 4OU1A 1JPMA 5JU6A 3L9CA 1CDGA 5CXPA 4JICA 4RW3A 1GK8A 2B7PA 3T42A 3H54A 1R3YA 4EAMA 1OC6A 4H2HA 4LT9A 3ZJ8A 5CC5A 2AL2A 3OIXA 3H70A 3QN3A 2BDQA 1DQUA 4LF2A 3SR7A 4H9TA 4G6CA 4NNAA 4UTTC 1GONA 1AD1A 1AD4A 2ASHA 2PI6A 2H6RA 3WLNA 2YXOA 3VFCA 2F9RA 3WNKA 4OWGA 3GHSA 4S3EA 3OLDA 3H53A 1AQMA 4UFLA 4IL2A 3W00A 1RCXB 1JUKA 2ICSA 3C3NA 2YDQA 3EX3A 2DZUA 1WOAA 1WV2A 2NV2A 4I3GA 4UFHA 4Y9OA 1G4SA 4JFUA 4ZFMA 1GWJA 4XSLA 1QNSA 4XUGA 4B2DD 4LB3A 5ABEA 3QKEA 3UCDA 5C5YA 3JZEA 4XAGA 5LZLA 2INEA 4Z2KA 2Y63A 3G2GA 4CQBA 2YFOA 5A69A 5M2FX 3QF0A 2FVMA 3WD2A 3QHOA 3I3DA 3T09A 1G67A 4MAVA 3NQAA 3PR2A 1O5QA 4JN7A 3TAKA 1GHRA 3C8FA 4PTNA 1I2PA 3U57A 4D6IA 2P8CA 4MKSA 4GUFA 1GVYA 4IXXA 3NXLA 2ZE3A 1V6TA 3ITLA 4NIRA 1G01A 3RO8A 2UZ9A 1CT5A 3DHFA 3LD5A 2IKJA 4LV4A 4KWWA 3GH5A 1IT7A 3TMQA 2ZTKA 2VXNA 2Y7FA 2NUWA 4AIOA 3QY7A 1WDSA 3IJIA 1XIFA 3N25A 4ZL1A 1I9CB 4QS5A 1UZDA 1XSJA 2OKTA 1UR1A 1DXIA 2CZ5A 2QCFA 3CK5A 4W8LA 4UTFA 3I10A 4XZNX 1MWOA 5FF3A 2OPJA 4Y9PA 2GVEA 2BOFX 1BG4A 3IAQA 4D6JA 4Q4KA 1JAEA 3KBJA 2OYLA 3CZEA 2DZSA 4REQB 4MJ2A 1Q6DA 1AJZA 1QNQA 1FHUA 2RDWA 1EJ7L 4IJCA 3U8GA 1RPXA 3EDKA 3LCLA 1PBGA 3QW4B 1M7OA 4L4MA 4JTDA 3EWZA 2DZVA 3S4TA 3LPOA 4BI7A 4IUOA 4JNYA 1WDQA 4PBEA 4OTKA 3ZJKA 1GYLA 1UC4A 3T0DA 4X0NA 3ZT5A 3H2FA 4PC8A 1KCKA 4LX4A 3EOSA 1KM0A 2OKOA 4CKQA 3WELA 4DYEA 3RPDA 3VC5A 4LF1A 3O8AA 2XZ7A 3C2RA 1I45A 4O16A 1EC7A 4S2BA 3KP1A 3G6LA 3G24A 1YTKA 2NXIA 5EU9A 2ZRYA 4JNZA 1AW2A 5CBIA 1TIWA 1Z7AA 3E12A 2QKFA 1JJKA 2PMQA 3ZWSA 4DBEA 2DZAA 1JG9A 2C14A 3ARTA 4F0RA 4RDYA 4RZBA 2H90A 4Z1CA 3E0LA 1W3TA 4RNFA 3KM8A 2CIPA 4JIHA 3UR7A 4KERA 3EX1A 2QCNA 2C3ZA 1MZHA 3TJIA 1N8WA 5C2CA 3U6WA 3APYA 3AWNA 5H8UA 3HPZA 4FR1A 1SW0A 4FR6A 4QIUA 2JIWA 3HGOA 4YHEA 4CQ8A 3KAOA 4H7VA 4N9CA 4JIRA 3P8IA 3Q94A 1TWWA 1XRSA 3G1XA 4PFHA 5G5IA 3NQEA 1ZS2A 4HYRA 1CNVA 2ZQ0A 3VDAA 3VUPA 4DB7A 4JHZA 1K8XA 2J7HA 3UZXA 3DFPA 3KX6A 2QUMA 2VZOA 4GYPA 2PDMA 1V6VA 1B3XA 1PX3A 4IZGA 1X1NA 4PCSA 4AXNA 2QDEA 2HV5A 1Q6LA 4J3VA 3SRDA 2PAJA 2V5LA 3ELFA 2ZZ5A 1LP6A 3OZOA 3XINA 1CXFA 1O5KA 1L8NA 3GD6A 3O16A 4LCSA 3TR2A 4O0ZA 4AD3A 3P61A 2VRJA 3W7JA 3ITXA 1X6UA 4CD7A 3FFSA 2E5DA 1ISVA 3P82A 4AG0A 1LG1A 4DZAA 4M7TA 4QJ4B 1G4TA 4ZQMA 3WJWA 2BVWA 3UA4A 1EGMA 1XIBA 4I6VA 2BHUA 3GR4A 1KKOA 1JZ3A 1US3A 3RX2A 3LHUA 2F6UA 3VMNA 4QISA 1DYSA 4DF0A 1RJRA 2OMAA 3UXIA 5I24A 2XGBA 3T8QA 3FDKA 1C9WA 3TOPA 4HPXA 3KZPA 3RM9A 2NSXA 3MTWA 4ZSUA 3UG5A 1GG0A 4O8RA 3AS0A 2I9EA 2PGEA 2HE5A 5CSYA 1W5OA 3GU2A 4NZJA 4DM2A 2CPUA 4S3CA 6TIMA 1XIDA 1VLIA 4E38A 2BNJA 5EYWA 2MANA 5J04A 4KCTA 4IX0A 2FMOA 3NQVA 2QMJA 1Z3NA 4Q4MA 3H26A 2OQHA 2CITA 2QCMA 2WW5A 4HOZA 2IXUA 1RK5A 4QJ1A 2EPHA 5AFDA 1XIHA 4A6GA 3M0HA 4Q7BA 3SIMA 4RNHA 1IYXA 1SPQA 1KQZA 4GWEA 3GVQA 1POJA 1L6FA 3ZOAA 5AHLA 3LHTA 2DSWA 4AF0B 2RHGA 5T9BG 4A3QA 1H49A 2X42A 1R87A 2E7FA 8RUCA 2YL6A 3M5YA 2JEQA 1L8PA 1K9FA 2VEKA 1P4CA 3QJAA 5A8QA 1JQVA 3QSRA 3RUBL 4EPEC 3B9NA 3L4TA 1GOIA 1LTDA 3ZR5A 4D6HA 2W6RA 1JI2A 4GFSA 2REQB 3C5QA 4KCUA 3DH7A 3N2CA 1XS2A 3NQDA 4GZEA 3FYYA 2NV9A 1BXCA 3TJXA 1Q6GA 1X98A 4RNIA 2YBTA 4UXDA 4D1JA 2Z2UA 3ZLHA 5ABTA 1ZCOA 2WJZA 3CV2A 2Y1HA 1CXIA 5FL0A 2VUYA 3CYVA 3TTQA 1TCDA 1DWIM 4GJ1A 4JEQA 1ZQ5A 3PJXA 1TV7A 2WMIA 4G7EB 4F2TA 1PHWA 3MCNA 4XD4A 5G1YA 3WKZA 4XIAA 4P7LA 1OABA 1TRIA 2EPOA 1XFBA 1HGWA 2UWFA 4IM4A 2BOGX 4G1NA 1E4MM 2E6AA 4C5ZA 2PDQA 1Y5WA 4W5UA 4F48A 1QPNA 3GR8A 4XZWA 4FXFA 4L80A 1M41A 1VFOA 5F4WA 3HO8A 1M68A 2FJUB 3GE7A 4YTSA 3WMCA 1LM1A 1E6PA 1UB3A 1KV5A 4ICMA 4HA3A 1F61A 4L6OA 3AIUA 2CZFA 4FB7A 3OPSA 3PNZA 4NI3A 3DFHA 3LMYA 2NXGA 3LHWA 1Q4NX 4ZXOA 4PSPA 2ZRZA 2EPLX 1XXXA 5D8ZA 1TV2A 1JF5A 1XH1A 1MUCA 3UPMA 5CAHA 3TSDA 4IG2A 1OFPA 3AYTA 2FPVA 3ZJ7A 1PWMA 4DUOA 4N9EA 1S2VA 1XLEA 1EO5A 3FAWA 3GDTA 4GQ0A 5DT5A 1HL9A 2ZRVA 1A5UA 4NAFA 3GG7A 3NCOA 4LVBA 3KOFA 1WDRA 2IPWA 2XJ7A 1V79A 1QNPA 3NDOA 2NQHA 5ENLA 1LF1A 2V3GA 3MP4A 2Q3OA 1XG4A 1ITUA 3SY5A 4RUBA 2C7FA 2R1KA 3UVIA 5CLWA 3FA4A 1W5NA 5HWJA 4GK8A 3ZS4A 5AB3A 1BKHA 4X22A 1R3RA 4P8VA 1YE4A 3M46A 4R88A 4KF1A 1QI4A 3JS3A 2NWSA 5K4XA 3UWWA 2ESCA 2I9UA 4JYFA 3N9RA 1LQ0A 3OW1A 3L65A 4RNJA 3AIWA 3F4CA 1F2JA 1OHLA 4LUJA 1PKLA 3QTGA 3LNPA 2OT1A 3NNTA 4FLQA 1C91A 3B0VC 2BVDA 3THCA 3PZ9A 3NVTA 3C2OA 3HPAA 1FA2A 4PB3A 4YTTA 3VPLA 1IV8A 1KM6A 3VI2A 4B5SA 1BYAA 3CZKA 3GH4A 3WMSA 4QX4A 2GJXA 1JYNA 4W87A 4Q8PA 4L6HA 1OYCA 1CGWA 4BI5A 2F7FA 1QASA 5GNYA 3TYUA 4IGHA 3FXGA 4EPBC 3KVLA 4RE3A 2Q02A 2QNEA 2VZSA 3IVSA 2C16A 4XZMX 3II1A 3WDRA 3VVGA 1JPKA 1RK6A 1QW8A 1AQHA 4QTGA 3CPGA 3GR7A 3IIOA 5D9OA 2W9MA 4IICA 1YW1A 3M6YA 1XF0A 1LWHA 3O15A 1RQHA 2WPBA 3BSHA 3MI2A 2IXVA 1MRQA 1BKSA 1NP0A 3LNMA 3BMVA 2YYTA 3HPSA 5AHFA 5DBUA 1UROA 1SJDA 3K46A 1XYZA 2CLKA 1KW1A 4L1XA 1KM2A 3FJ6A 4BF5A 1E6RA 2WXDM 3TQPA 3KCJA 1TJPA 4YYCA 5D9NA 3OZMA 1E15A 4MFEA 4UMBA 1MSSA 2PPGA 2W79A 3GVRA 4JCMA 5DCEA 4AYSA 2PLKA 2WO5A 4HU4A 5MHBA 1T6MA 3GKAA 1CGUA 4PRTA 1TPVA 4W89A 4C90A 1GJPA 2VEGA 7TIMA 1HXJA 5C2GA 2VEFA 2C18A 1ONXA 4AZ7A 4R7WA 1NY1A 2AMGA 4QJ3B 5IRPA 1KFLA 5LGZA 1S2CA 2QGHA 4D1IA 3RF9A 3S83A 2DW6A 3OHMB 1V03A 3V5OA 4S3KA 2OZ0A 5G2HA 1VPYA 3CH9A 3CT2A 5CC3A 3HFYA 1ZJBA 2WMHA 4BF7A 3P6LA 3KLKA 4GYJA 1X96A 3IIPA 4V27A 1NELA 3GDBA 3OVRA 2XGIA 2W67A 4WOZA 4IIEA 2FB3A 3UZ5A 5ECUA 2XH7A 1U1UA 3MUZ1 4TQTA 1U2YA 2ZX6A 3AHVA 4J1OA 3UETA 1T5AA 3F5JA 1YXCA 3TLQA 4IGSA 4BS0A 1KGUA 2ZE0A 3EOOA 1XBZA 4R3UA 5KZEA 2C6QA 4A2RA 4IMCA 2GK1A 4GJIA 1OJXA 3W1XA 4ZB0A 2CBIA 2PZNA 3LLFA 4MY9A 3NQFA 1UKQA 3O6AA 1QDSA 1R46A 4AX7A 3QZ6A 1UQZA 1MUWA 4CD5A 1NDWA 3LLXA 2A3CA 3PWAA 2UV8G 5F2LA 3SW6A 5D2VA 1VZWA 3KBVA 1B3YA 2W27A 1H41A 3TKFA 2ZZ2A 1Q63A 4HSNA 2WKJA 1T0OA 4MZ1A 4GOAA 1BD0A 2HTMA 1UR0A 4G2DA 1I8JA 2C19A 4KGLA 2ZUVA 4L9ZA 5FJUA 4DJED 4PMQA 1XKJA 3TFXA 5HUOA 1ONRA 2FQIA 4KESA 5HUPA 1TIMA 4ZO8A 1IGWA 3BAWA 3VOCA 4Y9NA 5EFFA 3UNDA 1HVQA 2O9RA 5CZSA 3L12A 3REQB 4DZ5A 3UXAA 2P5NA 1R3SA 4P8XA 4OOUA 3LRKA 2WZMA 3AISA 1UUQA 4JQAA 1XIEA 4L9XA 2UBPC 3O0KA 3L5AA 3ITCA 2CBUA 3PZUA 5DO8A 3CGTA 2Y6ZA 4EX4A 1YE6A 1IF2A 3QKZA 4WLCA 3BURA 2XIQA 2I7GA 2JKAA 5MKGB 4IOTA 4AMCA 2PDHA 4YN5A 2ZXBA 3QMRA 2QYGA 3N1AA 1FBAA 1V0MA 1HG3A 1WKYA 1B3WA 2YGYA 3T08A 5HATA 4EXBA 4S1FA 1P6BA 2Q8LA 1VC4A 3TN3A 3LTSA 1YHTA 3POCA 1F6PA 3KVMA 1CGYA 3DKJA 3TMLA 3WQGA 1E5JA 1B54A 4XAZA 2ZC1A 1DIOA 1XP3A 3G0XA 3H4GA 4ES4A 5KTLA 1YEYA 3QYQA 3AIRA 4PTDA 2F8QA 4QBXA 2E40A 2WANA 2YCEA 1V6UA 2ACRA 4IQDA 5LYRA 4CCCA 2CLPA 2EHHA 4HNVA 3MSGA 1SZFA 3P60A 2E67A 1SYTA 1UWTA 2WVVB 2RKXA 3RCMA 4XZ9A 1J0HA 3CTLA 5TF0A 3LRLA 2GQ8A 4O0KA 1NP2A 3MA8A 3BLLA 5FJJA 3FGCB 3RK8A 3W25A 3WJZA 2V67A 3UJFA 5MF5A 3U2CA 1TR9A 2PDUA 4EACA 4XO7A 4JYDA 4PUNA 2HK1A 1TO3A 1HVXA 3A4XA 4CU7A 1C29A 4JYEA 2Z29A 3GW0A 3C2VA 1H09A 3WX7A 1J11A 3VIHA 3RPMA 3VX0A 4HK5A 3ZLFA 3SJ3A 1KRBC 1RD5A 6PTDA 2OXNA 1TV8A 2X7WA 3VOFA 1YDOA 3MKVA 1TWIA 2V3DA 3CEPA 1J18A 1NSJA 2X16A 3B8UA 4MKNA 3IACA 1XQKA 2FLIA 3HG5A 5CGTA 3GIYA 1RP9A 4IPLA 3CO4A 3M0KA 3WLRA 4JKMA 2HE8A 2JF6A 4Q8OA 4P7OA 3T81A 4BQ2A 1EJWC 1CXEA 4B9YA 3I65A 2XVPA 3LCIA 5DX7A 2PWDA 3LENA 4PUDA 5D04C 1EKOA 5CLTA 1A5AA 2ISVA 2J9ZA 3EOUA 1W32A 2ONEA 1BTCA 3AOFA 2EPKX 2BG5A 4EWND 2Y61A 4QITA 4XIMA 4ZEPA 9XIMA 1D7FA 4MHBA 1FCBA 2PDIA 5I07A 3QPEA 1FVPA 4BCEA 5SWUA 2P3EA 1PEZA 5FEXA 4X2PA 4WK9A 1NF7A 1YTDA 3VD5A 2LLEA 3E02A 2E0PA 3THDA 3STPA 1DQWA 3QC0A 3VO0A 1IQ8A 2BXYA 1J0YA 4ADUA 4GKLA 4E8CA 1W1B1 1TV5A 1GQJA 1XGEA 4DAIA 2EKCA 5CPNA 2QCLA 3GTFA 1BWKA 1E9LA 2J7BA 3VAVA 3DECA 3UWVA 3SGZA 1AH4A 1WAWA 4W9TA 1FWBC 1U30A 3NQGA 2Z26A 4LUSA 2ZIDA 3ARZA 4K8GA 3B8DA 4LOCA 2G95A 2PODA 1VPXA 3V5FA 1FP9A 2A21A 2FZBA 3QPYA 4ZCWA 3M0MA 3VKKA 5E0FA 4YPJA 4WKAA 5HWMA 2Z1BA 4AU0A 1XDLA 1TPB1 1FWFC 4Q8MA 1FXPA 4IH3A 4BHYA 4WCJA 2VVNA 1UD5A 3G1FA 4WDXA 3W2LA 5T26A 3HQNA 3DEQA 4AZGA 3GAKA 1JCYA 3ZSTA 2E8YA 2FKPA 1XL9A 2QCDA 3PNUA 4UTJA 4TV6A 5GJPA 1R2SA 1I0DA 2FGZA 2XDFA 1K8ZA 3F5LA 2QJGA 4D6FA 1NFBA 3T2PA 3N2XA 3KRZA 2OOGA 4KKXA 1OT2A 3BVJA 2W66A 2XH2A 3SRFA 3SRKA 2G4JA 6A3HA 5I09A 4MUZA 4L1WA 1CEOA 1T8QA 2XM1A 4C6JA 3QFWA 3B9DA 1KLZA 1EDGA 4D6EA 5DMNA 5EBAA 2QT3A 2V38A 4AHOA 3MMDA 3NQMA 3M0JA 1TWZA 4RPQA 2E9LA 2PGWA 4TVUA 3F4NA 1FWIC 4LUSB 3WH6A 4C65A 1VH7A 2PDPA 4D8ZA 3O05A 4FMVA 1F73A 2WPGA 3SN1A 4KEMA 1TE1A 3QM3A 3DDMA 1A0DA 3A5VA 5A6BA 5KSWA 1FP8A 1PIGA 5G4EA 3QYSA 2OTDA 3FKKA 3V35A 4Q7NA 3M7SA 1GPWA 4FP1A 3AUOA 1AZ2A 2PF0A 1XYFA 4OV9A 4UCGA 4ZSTA 3S8HA 3ZJ6A 4ML9A 1EP3A 1DWHM 1XI3A 5TD4A 4CGTA 1PSCA 3RR1A 1PPIA 4PRRA 4XBSA 4EPKA 5AOUA 1HZYA 1FHLA 4DHGA 3W37A 3QTPA 2O7QA 2RFGA 1DTNA 4J35A 2QGYA 1IIHA 3CC1A 4GPNA 1E43A 3N4FA 5I00A 3B9OA 4LAMA 3UEQA 1HL2A 4PUUA 1W3NA 4GYPC 3NL2A 3CWNA 1L0PA 4MNLA 5ABGA 2B0MA 2GFTA 1KTCA 2XG9A 2PTWA 4N9DA 2IQDA 3TTSA 1EZWA 2G8ZA 3UYIA 4DWSA 4EF9A 3JU2A 2F2HA 3MB9A 4L4PA 1K6WA 2DV0A 3H7UA 4F0HA 1SO5A 1X6NA 1EA0A 1EFZA 1JD7A 3WEMA 4PEKA 2REQA 1DJXA 3TYAA 4KWOA 4ZE5A 3N4AA 2HS8A 1ME9A 1K3UA 1VYPX 2J66A 1QHPA 1ZAHA 1ZENA 4O8AA 1XPGA 2IUZA 2GDQA 2A3EA 3DIPA 3P7YA 4PL2A 3UWQA 1EB3A 4Z0JA 2OO0A 4ADSA 5CZ0A 1JGMA 2VX7A 3EWYA 3VD4A 2CLEA 3LV6A 2PU0A 1UR4A 4JTJA 3EXRA 3GZAA 3WK0A 1UKPA 4K6AA 1NDZA 3CB3A 2RDTA 3MYPA 3NZQA 1X7IA 3UCQA 3VCRA 1EEPA 2VD8A 3K8MA 1T96A 1HP4A 3IANA 1LT8A 2FZ8A 4RW5A 2O9OA 2G3MA 2XM2A 4C6IA 5IM51 3TU9A 4Q33A 2ZOXA 1JZ4A 2DSKA 4G7EA 4WEVX 1UWAA 2VTFA 5DCBA 1PTAA 1GNXA 4M80A 1HJUA 1ICQA 1YXDA 3NQ7A 3PC0A 4FA3A 5CAKA 5F2IA 5HDRA 4WDTA 2DVTA 4UZUA 1ISZA 4CNUA 2YBUA 4JS3A 3W1TA 4Q3MA 2VD9A 1F6KA 3WENA 3ZT6A 3CUHA 1ISWA 3LLDA 3FLUA 4HBKA 2WLYA 3QFEA 2WSKA 4Z1YA 1XKYA 4DRSA 7CGTA 4DF2A 3I6EA 1K1DA 4O1BA 1ME8A 3GXPA 4HNUA 4E2OA 3V18A 1AL7A 3THUA 3QLLA 1GOKA 3GIQA 1JDDA 3VE7A 3LCFA 5G4HC 4U10A 4ROQA 5JBDA 5C54A 2WJFA 3BLFA 3A6OA 4GINA 3THAA 4M1BA 4Z2IA 4LVDA 5HR6A 4OQVA 3UBPC 3CXOA 1RVKA 1F76A 3SN4A 4LANA 1J8VA 1EWEA 3PAJA 2VL4A 1E56A 3TYDA 1PZ3A 2OQYA 1LYXA 3LHZA 2W0UA 2ZXQA 3BG3A 1G69A 2NV1A 1KR1A 2CXEA 4H6QA 1V77A 2BVTA 3TQKA 4K8EA 2ZA2A 1KM3A 3H2CA 4YWIA 3MSYA 3KDNA 5HXMA 2WC7A 3MUCA 4GI4A 1GCYA 2NQLA 6XIAA 4PCPA 2O4QA 1YDNA 4JFWA 1X1ZA 4O13A 3TTEA 2PF8A 5LNRA 4UOJA 1V3KA 1Y7VA 4PCTA 3B03A 2A7RA 4BI6A 1XD0A 1UP2A 2ZX7A 2ACUA 2OLSA 1I2QA 4MKVA 3IJQA 4L6DA 4PB4A 1TPH1 3C0SA 2FB2A 3EBVA 1JIBA 3L0NA 1UZ1A 4GYFA 3P81A 2ZVIA 5D03A 3L5LA 4UQAA 5LIXX 1OD8A 1EBGA 5LIKX 1RP8A 2DZWA 2DZTA 1TX0A 1MW1A 5FF2A 3PS7A 3QBUA 1OCQA 4QFUA 5LNUA 4EVZA 1H60A 4PB5A 5JBFA 2VCBA 1VS1A 1MXGA 3L2MA 1RVGA 4B5UA 3KP0A 3RCYA 5FAGA 3KW3A 1FX6A 3CH0A 4AD2A 3OEXA 2XINA 5H8PA 4HMCA 1RLCL 3R13A 2NX3A 3IJ6A 1RBOB 1UJPA 3ABSA 3MC5A 2AKZA 3M1ZA 1PE1A 3T07A 4J2PA 1OADA 1YADA 4KFNA 5MKGA 1GOMA 2TRSA 4CN6A 4CVUA 2ATMA 1GVEA 1A5SA 4FALA 5J5DA 4ORIA 4JTCA 5AN7A 2QDDA 3EA1A 4H7ZA 2CEQA 1BGGA 2Y24A 5A8NA 1KM1A 4HVXA 2BGNE 2B7NA 4B4FA 3A12A 3N4EA 3PULA 2VGGA 4P2VA 5A8GA 4L64A 1VRXA 4FLRA 1QCWA 4FLSA 4I7WA 4ZBCA 3RILA 5IDIA 3NOEA 2PDCA 5A6MA 1ZTVA 3RJYA 2ZXAA 2D69A 2HVMA 4UMCA 1YNQA 2AKMA 2A3HA 4MY1A 5FJIA 3EYPA 1UA7A 5EMMA 4ZO6A 3S2NA 2D2HA 3RPTA 1Q8JA 1UMYA 2YBVA 5A2BA 5I06A 1W9BM 2H3BA 4KIEA 4GY1A 3S2MA 4U3AA 3PUEA 4LALA 2RDXA 4C6BA 2Y7EA 4C6NA 3KOXA 3G6MA 2EG7A 3IRSA 2DP3A 3C56A 1RH9A 3S47A 3SO7A 1DJNA 1NWSA 2D3NA 1Z32X 2DVUA 3GC2A 5BMWA 1M6JA 3GTIA 2QW5A 4GHRA 3TV8A 2PDFA 5HJXA 4NAEB 4PMDA 4AD1A 5AYYA 1G7UA 1WZAA 5D2TA 1QOQA 1Q6EA 1F3WA 3CNYA 3AZTA 3H22A 3PZQA 3E0FA 3EWBX 2PDJA 4EWJA 3ITGA 3MY9A 5HINA 1U5JA 5FKYA 2VGFA 1W8SA 2DQXA 3GO2A 3VGDA 3FS2A 4IFKA 1D3CA 3KTXA 1CTNA 3A22A 2A6NA 5BW6A 2E4TA 1JUBA 2J9YA 4O57A 5D05A 4KQNA 1R2TA 4FOKA 3OGSA 1PX8A 1PTGA 1A3XA 1IZJA 5FD0A 1TJ0A 3FHAA 2DT3A 1L2QA 5BMXA 2G4FA 1LOLA 4LVFA 3W1QA 5LA2A 1BYCA 5HULA 4DBSA 3RRAA 2VELA 2PCQA 3CUGA 3IJDA 1FWJC 3AHZA 1V08A 4TU1A 4YMZA 3VK5A 4DX3A 1ELSA 3B8TA 3CS2A 3VYLA 4K7VA 1QBBA 3WNMA 5EMYA 3ABQA 3LHVA 2VZTA 3W72A 3OZPA 1KXHA 1DV7A 4ZFCA 1DOSA 1BPLB 1UC5A 8TIMA 4QGCA 2A5HA 3STFA 1BWLA 1TSIA 1W1ZA 3D6NA 2GDUA 4FF7A 3W9ZA 1TG7A 2GZXA 2XWDA 2X05A 5BZAA 1OIFA 1CB2A 4DBDA 3EB3A 1ODZA 2UY5A 3VNJA 4DBWA 4HPGA 1KRAC 1CPUA 3R8GA 4D6CA 1UD6A 1ZBVA 4IP7A 1AG1O 4H9YA 2UY4A 2CLIA 1E4LA 2P1FA 3QLDA 4S23A 3ARXA 1J9YA 4GNVA 2DORA 1S1PA 1JRBA 1XJBA 2VFFA 3WH5A 2E3ZA 3P67A 1NAL1 4RJEA 2PE4A 2D22A 3UWUA 2R24A 1SR0A 4MNJA 3FVMA 4DQWA 3M5ZA 3MJYA 3AROA 5CGQA 1UCWA 3C2FA 3WQ5A 1AMYA 4B5NA 2ZRUA 2DJLA 4TMBA 2P53A 3H2MA 1RQEA 2IQ0A 1ONWA 1FWCC 1JPIA 1TPC1 3RJXA 1JR1A 4DNMA 2GJXB 1EF2A 4EANA 2HISA 3NGFA 3VD9A 1PKMA 4IGMA 1EQPA 1G1YA 4GA8A 1ADDA 1V4YA 4MIMA 1H50A 1W6TA 5BU6A 4RCXA 2H8ZA 3LZ3A 3COTA 4JOMA 5D30A 2QJHA 2JALA 3T6CA 7REQA 3TEVA 1IEWA 2OQLA 3M0XA 3W27A 3UZJA 2DH3A 1UKTA 1BXBA 2EBNA 4C6DA 2GWGA 1DVJA 1JXKA 4H83A 1N82A 3TH6A 3TW6A 1DIEA 3H7VA 1UMLA 1QR7A 5A6KA 4IPIA 1ENUA 1R0MA 1ONEA 1ZCCA 4DEFA 1H5YA 1P0DA 1LOQA 3N13A 1YPXA 7XIMA 1C7SA 3EAUA 4OGZA 4UMAA 3CIXA 4YHGA 5HR7A 3BSMA 3O0FA 3W7CA 2Z1VA 3EA3A 1ECQA 2FYMA 5I3GA 1VFTA 1LL4A 2QZRA 4WHBA 4IQJA 3LY0A 1P48A 2VOMA 1ZAIA 3AXMA 4WSJA 3BE7A 3EZ4A 1FY6A 2YL8A 1XYMA 4W8AA 1U22A 2D3LA 4RXGA 1ME7A 4XZHA 3QPZA 3S1GA 4MZ8A 3BUVA 1UOKA 1GOOA 3B0PA