3FKRA

Structure of l-2-keto-3-deoxyarabonate dehydratase complex with pyruvate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
304
structure length
303
Chain Sequence
TPRHRGIFPVVPTTFADTGDLDLASQKRAVDFMIDAGSDGLCILANFSEQFAITDDERDVLTRTILEHVAGRVPVIVTTSHYSTQVCAARSLRAQQLGAAMVMAMPPYHGATFRVPEAQIFEFYARVSDAIAIPIMVQDAPASGTALSAPFLARMAREIEQVAYFIETPGAANKLRELIRLGGDAIEGPWDGEEAITLLADLHAGATGAMTGGGFPDGIRPILEAWREGRHDDAYARYQAWLPLINHENRQSGILTAKALMREGGVIASERPRHPMPELHPDTRAELLAIARRLDPLVLRWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords L-2-keto-3-deoxyarabonate dehydratase
publication title Structural analysis of L -2-keto-3-deoxyarabonate dehydratase an enzyme involved in an alternative bacterial pathway of L-arabinose metabolism in complex with pyruvate
rcsb
source organism Azospirillum brasilense
total genus 110
structure length 303
sequence length 304
chains with identical sequence B
ec nomenclature ec 4.2.1.43: 2-dehydro-3-deoxy-L-arabinonate dehydratase.
pdb deposition date 2008-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3fkrA00
1K02A 1SUXA 3TSMA 3NEVA 3N2XA 1TPDA 3TU9A 2QJHA 1T8XA 4AH7A 3W1PA 2B7QA 2A4AA 1BTMA 2H8XA 5K9CA 3LDVA 3A24A 2ABAA 2C13A 3S5ZA 1YLVA 3G24A 3TFCA 1OFDA 4MKNA 5AHIA 1SZEA 1W54A 2ISVA 4W9TA 3CB8A 3EEGA 3DHFA 1JRBA 5IBXA 1PE1A 2KZHA 3EX6A 3GKFA 4AVFA 3ABSA 3LHUA 1LYXA 3VKJA 3MMTA 3FEMA 4QQ3A 1QO2A 1TQJA 1XCFA 2TSYA 3SY5A 4GNJA 2O7SA 4R53A 3O15A 4XKYA 3E0IA 3W7QA 2WV8A 1GVQA 5HUPA 1NFBA 5HUOA 5K2ZA 4O28A 4LVAA 1P0KA 3O6CA 4XWUA 5EMUA 4E2BA 3S1WA 3TQKA 4YMZA 4WXZA 1RVGA 4Y90A 3OVRA 3W2NA 4DO4A 4X2RA 1FDJA 4O1DA 5IM51 1TJPA 3C6CA 1H61A 3TXVA 4KFNA 3OHIA 2CZDA 1T0OA 1C9DA 5E1QA 3DHDA 4LUIA 5IBXC 4NU7A 1TREA 1LRTA 3RU6A 3CU2A 4PL1A 1OFRA 2E68A 5D2XA 3CTLA 1HG3A 2X1UA 4H6KA 1CX9A 1KLZA 1GG0A 1A50A 2YR1A 5G4WA 4UTUA 4PC8A 1LROA 4JX4A 3V1PA 5F1VA 4DPQA 3LCIA 2RKXA 4AHOA 3WK2A 3VNDA 4TU1A 3GK0A 2F7FA 2ZZ5A 2FIQA 1W3IA 1KM3A 2BWGA 1BWLA 2E1DA 3VCRA 3I6RA 2PRLA 4C1LA 2ZDRA 1O94A 2CW6A 2QDGA 3DFTA 4Q33A 2VFGA 3DAQA 2C1HA 5CSRA 1F6PA 1C29A 3LTYA 1AW5A 3WK1A 5LHEA 1Z48A 3TJLA 2DJXA 4LC6A 2QR6A 2A0NA 4GUFA 1H1ZA 2J88A 3IEBA 1G6CA 2A6LA 2HTMA 1AK5A 1VCVA 4Z0JA 2V82A 3PC0A 5HWMA 4JTUA 4R33A 5I3JA 3G8RA 4P2VA 3W86A 2ZRWA 3CIWA 3GVGA 3W83A 1NAL1 3C2OA 2R91A 2X1RA 1W56A 1W0MA 1TO3A 2WNZA 1L9WA 3UQNA 3OG3A 3NR0A 3E49A 1NF7A 2NWRA 3PUEA 3P84A 2CLLA 3FA5A 1YXDA 5HWJA 2VXNA 4I7VA 1EPXA 3TSBA 3FJ6A 3TW6A 4O14A 1YTDA 5LNRA 3QSTA 1EWDA 3HPXA 4NNCA 4NJIA 1QOPA 2YGYA 4GUGA 3B06A 3EB2A 4EWND 4GC4A 3EXRA 4JN6A 3N19B 3LB0A 3NQGA 1H7NA 4RCXA 1I8JA 2RDTA 5F2GA 1KM2A 2IQTA 4QNWA 3KRZA 1RD5A 2B7NA 4EF8A 1M7PA 2VFFA 1WA3A 3UWQA 2FJKA 2ZCGA 3C8FA 5AC6A 3LBCA 1HUVA 1K7EA 5CG7A 3MW7A 3A22A 3NXFA 2NXGA 1TJRA 3QJAA 4BK9A 3TK7A 1FCQA 2NWSA 2B0MA 2V2CA 3M5ZA 4X22A 2I14A 1F2JA 4LVBA 4LVDA 1W31A 5EBUA 4Y6GA 3GR7A 3OVQA 4QIUA 1JJKA 4HHPA 5AHLA 4GE8A 1R30A 4JGDA 4OGZA 5D05A 4O4VA 4YL2A 3GDRA 3O8AA 2A5HA 3PAJA 4DEFA 2Z2UA 3B0UX 1WBHA 3W7KA 3ANYA 3W7PA 4P61A 3G1FA 3W7MA 4TO8A 5D30A 1O5XA 3UPBA 5FF2A 2B7OA 3IVUA 3QQ1A 5E0KA 4GXMA 1SU5A 5CZSA 3P8JA 4E0CA 4N9DA 1KFKA 4CQAA 4QITA 4C1KA 4K7YA 3LHYA 1LOQA 3GR8A 2FPVA 1XBYA 5D2YA 4NNBA 3LTPA 3STEA 2FPYA 2ABBA 2RHGA 4UFMA 4UMBA 2WSYA 1VH7A 1F6KA 3VE7A 2Y6ZA 4LS2A 4O19A 3L66A 1SW7A 3GDLA 1X6UA 3TC7A 3W7OA 1W5QA 4XBSA 2GQAA 5DCEA 3W71A 2A2IA 3S1XA 4OHQA 1K8YA 1KM4A 3IIVA 1GVSA 2H8ZA 3C0JA 4UFKA 2C3ZA 2WJZA 4Y96A 3W7CA 4N6FA 2Y7EA 3PBYA 3TIMA 4PEKA 3R89A 2OX1A 4IXHA 3TROA 1QO5A 3P81A 1ZNNA 5F4XA 1LLWA 5I3KA 5D2TA 5I3HA 2OT1A 2OJPA 3LHZA 3M5VA 6ALDA 4HSNA 2DJLA 3IIZA 4WX2A 2DZVA 2G96A 3NL2A 3MBDA 3QMRA 2BXVA 3C3NA 4OT7A 3HGRA 4FIQA 1XFBA 1GYLA 4NQ1A 2R8WA 2V9DA 1UCWA 4I7WA 1PIIA 1TRDA 1Z42A 1ME7A 2JBMA 3R5EA 3MP4A 4DF2A 1ZHAA 2TYSA 1F05A 3DXIA 4RZ6A 4JTFA 3V75A 2VEMA 1A53A 1VCFA 1N8FA 1TV7A 2E6YA 1UASA 1ME8A 1GVFA 4CNPA 4WOQA 4JXCA 2QUVA 4DBDA 5G2IA 3M9YA 1OX4B 2TPSA 4MLJA 3C2RA 4AWTA 1OK4A 3QYQA 1KM1A 1HO1A 4LU0A 3EXTA 3MWAA 3S0CA 4LRSA 5HMSA 5F4SA 3BW2A 3W88A 1QAPA 2V2DA 5CPMA 2C19A 3JS3A 1XDMA 4NX0A 1Q6RA 3A5VA 4ALDA 1JR1A 2YW3A 2Z6JA 1UB3A 2EHHA 3MUXA 4MOZA 2E09A 4O10A 2JKPA 2VFIA 5FF4A 3TMLA 1QPRA 4G1KA 1NVMA 2RH9A 2HS6A 3PSVA 2CWNA 3I7QA 1T96A 3TC6A 4O8RA 1PVNA 1FBAA 3H54A 5KZEA 4UFIA 4WY0B 3UNDA 5F4WA 4OQVA 1QWGA 3W6YA 3TE9A 2NV2A 5U4NA 3UWUA 3P5ZA 2JKAA 4MZ1A 3WFAA 4BFAA 4FNQA 3UWZA 3G1HA 8TIMA 3L2IA 5DXYA 1I2RA 4UFLA 1VGAA 3GXNA 3ABRA 5D03A 3GAKA 2ZZ1A 4Z1DA 4DELA 2QF7A 3IVTA 3AO0A 1L6SA 4BR1A 1OX4A 4TX9A 2XN2A 5EL1A 1GTHA 4K8EA 4NUWA 1VHNA 2CLEA 4IX0A 2YDAA 3ELFA 2QCNA 5HQEA 3KHJA 4MVAA 3IIXA 3M44A 3A21A 3TSDA 3G1YA 2A1YA 3PG9A 2GUUA 2OCZA 3PG8A 1D3HA 3ATZA 4N9CA 4ZZ9A 1S5WA 3PY2A 4D2JA 3MYPA 3WK3A 3S6DA 1X8FA 3NDOA 3CEPA 2Y85A 3T4CA 1HO4A 1TPEA 2YPIA 4K6AA 2TRSA 3B4UA 2YX0A 4M7TA 3NPVA 3UPWA 3T40A 5LNVA 1WQ5A 4M6QA 4LTSA 2QCHA 4WY0A 3W3OA 2CLHA 4EIVA 3GIYA 4MJMA 5BRBA 1LM1A 5D37A 3NM1A 5K3VA 3PR2A 2GVJA 4FNRA 4I7UA 3R8RA 3BARA 2AGKA 1VCGA 4RV8A 3EWWA 5KZDA 1LBLA 2ZQ0A 1Q6LA 3SFKA 1DJNA 1MEWA 1OABA 3QMTA 5HJLA 1THFD 1F74A 3CHVA 5KINA 2ZZ6A 3W7EA 3USBA 5DBUA 2X1TA 3KRUA 1QFEA 4O17A 3MI3A 1B57A 2NX3A 4IXXA 4JY8A 1PCWA 3EWZA 1Y0EA 3VFLA 3P7YA 1CW2A 3GDMA 3KXQA 4UC5A 1IGSA 3LHVA 2XFWA 3RLUA 3RNDA 4OWGA 5CKSA 1LLZA 1H7RA 5I3GA 1KV5A 3PB0A 1MEIA 2CLIA 4IGHA 1TTPA 3LOTA 4EVZA 2ATSA 2AQWA 4JTGA 3G18A 1IXNA 4O1AA 1ICQA 2PURA 5GVJA 2X1SA 1RV8A 3ZS4A 1DQXA 2WNQA 3CM4A 3G1XA 3SR7A 1JCNA 1Z44A 3UZJA 2Y63A 1KTCA 1QDSA 1FWTA 1KFEA 4AMAA 3W84A 1SZNA 1ZAHA 3M7WA 1BKSA 4AAJA 3W1AA 2V8ZA 2BTMA 3KVLA 3WK0A 3G22A 4LV9A 4JD4A 4JYFA 3TQVA 4RR4A 3W7DA 4O0ZA 4UFJA 4JYDA 1GVRA 3UWVA 4FX7A 1SO5A 1EB3A 3GXPA 5DY2A 5FF3A 5LNUA 2WSRA 4ORMA 1VC4A 4HNVA 1JCLA 1XBXA 5HR6A 1KFCA 1QPQA 1H51A 2J9YA 2BLEA 1OFQA 2JKEA 3LRLA 3DI1A 3G0SA 4JS3A 4PTNA 5MHBA 1MSSA 4M7SA 2FTPA 1KFBA 2FLIA 3LX9A 4O4WA 2VEPA 2ZRYA 5FEZA 1MXSA 1XBVA 3M0ZA 3MO7A 4L4LA 2WPBA 1KLYA 3LBMA 3IRDA 5BNKA 2A6NA 1LOSA 2E5CA 2XN0A 3N9RA 3W75A 4O1CA 3W1RA 1IXOA 1LRNA 1P4CA 4NJJA 1Q6OA 2G97A 3LV5A 1LCOA 1KTBA 3MP5A 3PSWA 1Z41A 3BK0A 3GNNA 3STCA 1A5BA 4GUHA 3F03K 1SO4A 5HNRA 3HGOA 2OMAA 3DU0A 2RDWA 4FNSA 2ZA1A 3LXAA 1W5PA 5AFDA 1JQXA 4ICNA 1OF6A 3N14A 4HIBA 4LW7A 1B3OA 3H55A 3GZ3A 1B9BA 2QCLA 1RQBA 3EX1A 3W1XA 1OFPA 1W37A 4WZHA 5DBTA 1PHWA 1YXCA 4A22A 3MHUA 3DBPA 2AAMA 3Q37A 3R13A 2ISSA 1G7UA 4XUGA 1TSIA 3TQ0A 1K3UA 4RZ4A 3DH7A 4O54A 1TMHA 4K37A 1LZOA 1YXYA 4GRSA 1LRQA 1TTIA 3OBKA 3GXTA 4NZFA 3NL3A 1H7PA 3JRKA 3MYOA 1XKYA 3DGRA 4NNAA 5C55A 2ZZ3A 2TMDA 3UYCA 3Q94A 1TPB1 1XM3A 3NM3A 3UWWA 2Y7FA 4I9AA 2QDHA 3L0KA 5KITA 2V2HA 3O05A 3FS2A 3EWYA 2VEKA 2ZA3A 5AB3A 2CFFA 3QPYA 4FX6M 2P0OA 3TW7A 2VFHA 2NUXA 1OFAA 3R2GA 1G4PA 4NZJA 4KKXA 3SZ8A 3W1UA 1KV8A 1W5NA 1Q45A 1TRIA 1H62A 3KRSA 3M5XA 4PODA 1TTJA 2VEIA 2Q8LA 1H7XA 3NG3A 3HO8A 5D04C 1OX5A 3P74A 1HL2A 2GOUA 2FPTA 3CQ0A 4NXKA 4JTJA 1MEHA 3HIJA 4MUZA 3W76A 2FFCA 1YYAA 1SSGA 3N34A 3NL6A 1XUZA 4UTIA 2XN1A 4YXGA 2HMCA 4FNPA 1FDZA 4KWVA 1EUAA 3MI6A 4NJKA 2V30A 2Y7DA 3IV3A 4B5NA 3QFEA 4WY0F 3UZ5A 3DFPA 1CI1A 1NSJA 3HBLA 1IF2A 1FX6A 2I9EA 4YLWA 1SFJA 3TUUA 3W87A 4MLRA 4EF9A 4AXKA 2J6XA 1WXJA 3NOEA 3NQ6A 2QCDB 5BMWA 3LI1A 1X1ZA 3NQ7A 4MZ8A 4JEQA 3TH6A 3I7RA 1IXPA 1VRDA 1LORA 4FNUA 1OX6A 3SI9A 3LERA 5F2LA 2FB3A 1YDVA 4HSOA 1KTNA 2CLKA 1YDNA 3G1SA 1K8ZA 5EKYA 2E6AA 5DCBA 1FWWA 3BGGA 5BOOA 1GEQA 4X3ZA 1X1OA 3G0XA 3L65A 3ZR4A 1ICSA 5FEPA 1LDCA 3HMJG 2DORA 4RXGA 3OA3A 5FF0A 2DZXA 3C2EA 1JULA 1JCMP 1GG1A 1LBMA 1PCKA 1SZGA 4GUJA 4TMCA 3KFTA 1VYSX 4LNYA 1XXXA 5C6MA 3R12A 1VJIA 1OFBA 2GPTA 4AHPA 3LTSA 4CCCA 1S3HA 3DFOA 3I7SA 3LCGA 3PULA 2RFGA 2GQ9A 3FYPA 4LRTA 5KZMA 5G2WA 4S2CA 4R34A 4WQ6A 2DU2A 3L9CA 3L0NA 1TIMA 1VPXA 4O52A 1PV8A 2WQPA 3QSRA 1FY6A 3NVTA 1KW1A 1KM5A 4UNKA 2QCDA 1R2SA 4RXFA 3UD6A 5ABTA 1F76A 5LZLA 2ZFAA 3W1LA 1I2NA 3U6WA 5G5IA 1QPNA 3UWYA 4YCOA 2JGYA 5AHFA 3O1NA 4O53A 3L5AA 3W1NA 2CZ5A 3RMJA 4AB4A 2H3BA 2NX9A 1IIHA 4A29A 1J5TA 3PF3A 3TFXA 3PBVA 4FF7A 1FXQA 1G4SA 4JR5A 4WOZA 1XL9A 1AL8A 2VENA 2Y61A 4IMCA 1DQWA 2Y7GA 1VLWA 2VELA 4OV9A 1TV5A 2A21A 1GT8A 1V7YA 2G95A 1J2WA 1G7VA 1QPOA 3EKLA 2B4GA 1JCYA 3TKFA 1GQNA 5I3FA 4Z1CA 3L67A 4UIOA 4K8HA 4M19A 2GJNA 4IWWA 2Q3OA 3TAKA 3W7GA 1AMKA 2ZZ7A 4JTIA 4RX0A 3FFSA 4A3UA 1GOXA 4PFMA 3L68A 3C2VA 1FDYA 5G1YA 5KTLA 3LLFA 3NZ1A 4ZQOA 5C54A 3RK8A 3SECA 3I65A 4RZ5A 3KVKA 1EIXA 1D3GA 1WBJA 4KWWA 3NQVA 1U5JA 1OFOA 1EX5A 1K7XA 2BX7A 3ABQA 3P82A 2Y62A 3T78A 1WX0A 4ZQPA 5HR7A 3CLMA 4DF0A 1FUYA 1AW1A 5HULA 4UTHA 4DO5A 2CLMA 1EEPA 4UTJA 4IMDA 1QCWA 3HG5A 4WD0A 4GWEA 4BI7A 1I2PA 3P5YA 3W70A 3K30A 2CU0A 2WKJA 4WUIA 2V5LA 3B05A 3BLFA 3STFA 3LXBA 2YYTA 1MZHA 1UUOA 3DFQA 3DI0A 2QCGA 4AF0B 2ZA2A 4LVFA 3LHTA 1JUKA 1UJPA 1TB3A 1JQVA 3O06A 2GVLA 3GNDA 4ZL1A 3U2OA 3T55A 4IJBA 4CCDA 4UTKA 3T44A 3KVMA 1F73A 2DZTA 5L9FA 3W2KA 5F2IA 1OFEA 1H7OA 4CCEA 3E96A 5AYZA 3W2MA 3ZWTA 3Q2DA 2JGQA 2A7RA 4PH6A 3MJYA 1SO6A 2EKCA 4O13A 5A8GA 5K7JA 4YWIA 5SWUA 1TPVA 4N4PA 3S1UA 3EX3A 4FXSA 3NO5A 3I68A 5K4XA 2WSQA 3NYZA 5KSWA 3KVJA 4FXRA 4LOCA 2QCEA 2V5BA 3STGA 2QEZA 5G2HA 3MP3A 4U4MA 3LI0A 3SGUA 5LGXA 3O16A 3FJLA 4CNNA 3W1QA 1QR7A 1GTEA 3YPIA 2ZTJA 3QW4B 1RPXA 3OIXA 4HPXA 1NF0A 3M41A 3NAVA 2H90A 5FI8A 3NNTA 2W6RA 5D33A 1ME9A 3LCHA 4AF0A 3BGJA 2W0UA 4MY1A 1G4TA 4QM1A 1IIGA 5DLCA 3L0GA 4AHQA 3P62A 7TIMA 1OJXA 2QAFA 1I4NA 2PRHA 4IUOA 3QPZA 4XTIA 1RZMA 4QAIA 4JTLA 1ONRA 2ZRUA 2NXHA 4NVTA 2YW4A 3UY7A 3E02A 1PHQA 4H4IA 3G8EA 4K38A 5L6UA 3W07A 3LXCA 4Y9AA 2X16A 2GVGA 3S5OA 2A7NA 1N55A 3TCEA 4IOTA 5LHFA 4KFPA 2A85A 3WJYA 3CWOX 2J24A 1OYCA 1SZFA 2LLEA 4TMBA 4ZVJA 4HPJA 3KX6A 4O1BA 2YSWA 4QSHA 1AG1O 3S5NA 3QM3A 3DFSA 4IMGA 3B03A 4BI5A 5DXXA 1TPH1 4MFDA 1SPQA 2VOMA 3PVFA 3GDTA 2X30A 5BMXA 3W1MA 4A21A 1H50A 1G4EA 3QZEA 4Z1AA 6TIMA 1H5YA 5D09A 3F4NA 1VQTA 1BWKA 1ZAIA 1DOSA 3SIZA 4MJZA 3S42A 4HT3A 1TPWA 3P61A 1G67A 3EKZA 4O11A 1S5VA 1VYPX 3NQMA 3W7IA 1H60A 2C15A 3C52A 4E38A 3C56A 4ML9A 2Q8ZA 1TPFA 2C6QA 1W8SA 2YXGA 5EA9A 4HNNA 3A9IA 4JTSA 2D73A 3EWUA 3MI2A 1XUUA 3U8GA 3B04A 2C14A 1FWSA 3M16A 1VR6A 4DQWA 1R2TA 3S1VA 5TIMA 3B8DA 2PCQA 4AWUA 3LV6A 4DO6A 3TR2A 3LM7A 3GDKA 1ZCOA 4S2BA 3LCWA 1D9EA 5AOUA 1AW2A 4JTKA 1YTKA 1O95A 4PA8A 4DBEA 1ZY9A 1IXQA 4Z0SA 3LRMA 4CQ8A 1KM0A 4RK8A 1O5KA 3THAA 4E2DA 2ATMA 3M6YA 3LHWA 4TIMA 3SGZA 2HSAA 2PC4A 2YFOA 3QF0A 3N73A 3TJXA 3B0VC 3IGUA 4ADUA 5CZ0A 1Q3NA 3EXSA 2ZZ2A 4H3DA 2ISWA 4NT0A 1TPUA 3GAYA 5LKYA 1VZWA 1M7OA 2E6DA 5CZJA 4N02A 3HG3A 3WJXA 2NX1A 1WOBA 3KAOA 3KOFA 1YPIA 1LOLA 3VI2A 3SW6A 4QNEA 2BZNA 3RLVA 4OU1A 4GJ1A 3NQ2A 1KA9F 3IGXA 4YCPA 4GFSA 4K39A 3UY8A 3BVJA 1TYGA 3HPZA 4FNTA 3D0CA 4K7VA 2NUWA 2EF9A 4N9BA 2ZRZA 1OG0A 3NQ8A 1RQHA 5AC7A 3BW4A 5AN7A 3PUOA 2NXIA 3W2UA 3NQCA 3E9AA 2QKFA 5F2MA 3H53A 3NZRA 2CZEA 3ATYA 1T99A 3NPWA 2NUYA 4S1FA 3TMQA 3EWXA 4MZYA 1ALDA 4JIQA 4WJEA 3PS7A 2DZSA 3B0PA 3W72A 1O4UA 1VYRA 5LNSA 2DP3A 5CZTA 5AYXA 2NLIA 5CSSA 3C2FA 1M6JA 1FCBA 1UBSA 2VKZG 1JRCA 2QCFA 2C0AA 3BPWA 4MY9A 3FIGA 3G0UA 1EP1A 4WXYA 2J9ZA 4O15A 3EWBX 4JICA 1YADA 4AWSA 2ZRXA 4JTEA 4HKPA 4BI6A 4ONVA 5C2XA 3W2JA 5HINA 5AYYA 1SO3A 4O57A 3JR2A 1DVJA 3LCFA 1EUNA 1KBJA 1KM6A 3W7NA 1TCDA 3TXZA 1JUBA 1W5OA 1EA0A 4K36A 4RJEA 3AJXA 1DKWA 4UFHA 2J27A 1ML1A 4FEZA 1W5MA 2B7PA 5T26A 3A5FA 3P80A 2ZZ4A 1DHPA 3G1AA 2YFNA 3GYEA 2OZ0A 4KFOA 4XZ9A 4JTTA 4N6EA 5H91A 3NPUA 4NJHA 2QJIA 5C5YA 1ZALA 3BLIA 1AL7A 1OVDA 5A5WA 4UTMA 4UXDA 3S8HA 1DL3A 3L21A 4IX2A 4UR8A 3C4UA 2NV1A 4FX8A 4DF1A 1BEUA 1HTIA 1K7FA 3LRKA 3W85A 1L2UA 4ADTA 2G5WA 3ABOA 4GBUA 3PUDA 3G1DA 1P0NA 1OHLA 2ALDA 1I2QA 2P1FA 3QH2A 4N4QA 3BW3A 3CIXA 4LC8A 1W3TA 1ZENA 5TBOA 1X7FA 3FYOA 3O6YX 4LV4A 1VLIA 1A5AA 5G1TA 1A5SA 3M5YA 3HG4A 3IIOA 3WJSA 1WOAA 1GVOA 3PB2A 2E6FA 3EX2A 1Q6QA 4POCA 1I2OA 3RF9A 1LBFA 4JYEA 4OE7A 5I3IA 4JDYA 4JTHA 2Q3RA 5E93A 5HWNA 3LLDA 4XQ6A 4JIPA 4IMFA 3FOKA 3LCLA 2QUUA 2ZYFA 1ICPA 4FO4A 4PL2A 3NL5A 2FB2A 4UUIA 4JDBA 1L6WA 3BG5A 1OYAA 4Q4KA 2NZLA 4CQ9A 3UXDA 4MYXA 2EAWA 5AHNA 4XTDA 3W23A 4LY8A 1P1XA 4RLIA 5FEXA 4HN4A 3GB6A 4JX6A 1H63A 1OYBA 4LWWA 2W79A 2Y70A 1J4EA 1EP2A 3W74A 3HG2A 1B4EA 4UMCA 1TTQA 4NX5A 5K4ZA 5D2VA 3BLEA 3OVPA 2ZRVA 5J5RA 2GJLA 4MY8A 3DKLA 5LNWA 3S5YA 1F5ZA 3L5MA 1QNVA 5LSMA 1V5XA 2A7PA 5DELA 3L5LA 3G3MA 3W73A 1DV7A 1G69A 1YTEA 3O07A 3M43A 2HS8A 1QOQA 2FDSA 3BG9A 3HGSA 1PL9A 5FESA 1O60A 5EYWA 5BW6A 3W22A 3GX9A 3NA8A 4DPPA 4LT9A 3DZ1A 2GQ8A 1R46A 1XI3A 1FXPA 1XDLA 4GUIA 4UTWA 3NQEA 3P8IA 2E5BA 2Z1BA 1MO0A 3T7VA 5K9DA 5AHMA 2ZBTA 4QISA 2V81A 3HJZA 3WJWA 5D32A 2Y88A 1A5CA 1R2RA 3ZFHA 2Y89A 3W9ZA 5H2ZA 3W7RA 3O63A 1H7WA 3IGSA 1ZFJA 3N2MA 4UR7A 3BO9A 2VC6A 3MBFA 2RDUA 1WDWA 1ZJIA 3LGEA 3GKAA 1DBTA 2X2GA 2C16A 4Y8FA 1GWJA 4R7JA 3QRHA 3TDFA 1ZAJA 1JUEA 3CEUA 1I45A 4IQLA 3W1TA 1NEYA 3QW3A 4CLMA 1UUMA 3CPRA 1FQ0A 1QMLA 3EX4A 3BV4A 2QUTA 4UTWC 4O12A 4LS0A 2H6RA 1TQXA 3SSJA 4O18A 3NGJA 3QC3A 4MYAA 1LP6A 5CPOA 4HNTA 5DCDA 1DORA 3TNOA 2PRMA 2CLFA 1WV2A 2EGZA 2EPHA 5J5DA 4ZMGA 2ZTKA 3S9YA 3NPXA 4N9EA 3PM6A 1TV8A 3DFNA 3TA6A 1PS9A 1XBZA 2C18A 3WJZA 1JCXA 3W2LA 2I1OA 3FKRA 5AHEA 1U83A 5CPLA 1XC4A 3M1ZA 3O6DA 4M6PA 1KFLA 5KMYA 4ZQRA 1SFLA 3THQA 2DZWA 2JK2A 3BG3A 2R14A 4AEOA 1K8XA 3OEXA 3HQ1A 4O16A 1H1YA 3HB9A 1K03A 3F1QA 5CPNA 2QJGA 3A23A 4DXVA 3F4WA 2WOQA 4O0KA 4BWLA 2QCMA 3FLUA 3M47A 4EOUA 4Q32A 2OT0A 3W7LA 3G3DA 2YZRA 4RKAA 3PBUA 4X9SA 2P10A 4A2SA 4JNMA 1HFBA 4XBKA 3MHGA 1FCVA 1GZGA 4LUJA 4OV4A 5EY5A 2J9XA 4Z1BA 4Z08A 4L4MA 3FKKA 3TAOA 5D2WA 2CLOA 3W7JA 2Z6IA 4FHAA 1B4KA 5FF7A 4BF9A 3IVSA 1JCJA 2QAPA 2H3DA 3MHFA 3VE9A 2WO5A 1KFJA 3HOJA 1GJPA 5D38A 4MIMA 5U7SA 2Z0IA 1DJQA 1W3NA 2QCCA 5G4EA 1SW0A 4OBTA 3E12A 3IIPA 4U28A 2V0TA 4IMEA 1TPC1 1OF8A 1S5TA 4TR9A 5EPDA 3Q58A 2DZPA 4UTTA 2WNNA 5F1UA 1ADOA 5LGZA 3P67A 4BWLC 4J9JA 3NQFA 1YPFA 1RQEA 3DENA 3TX9A 3INPA 4JY9A 3GLCA 3HPSA 2R94A 3N9SA 4FB7A 3HF3A 2O7QA 3DKJA 4M6VA 2DZUA 3C61A 1M5WA 3QQ0A 5K9XA 1EWEA 5D02A 1F7BA 1WAUA 3QMSA 1KBIA 1JVNA 1P5BA 4LS1A 4N2YA 4UNLA 4ZQNA 4LVGA 1RR2A 4UCGA 4UMAA 5TQLA 3CT7A 3QEZA 1EP3A 4ZQCA 1SQ7A 4MPQA 3LCXA 3P60A 5CGQA 3NQDA 4ADSA 1VS1A 3HGJA 4IPIA 5FEWA 4ZQMA 4PCFA 1SSDA 1E51A 4JX5A 3G1VA 4MFEA 2F84A 1YDOA 5DN1A 3TV8A 2YCEA 3SJ3A 4UTTC 3W7HA 1WYIA 5DY3A 1SW3A 4NJGA 4IPJA 4ORIA 3ZWSA 1N7KA 1W1ZA 3NQAA 1FWNA 1LTDA 2YYUA 2VFEA 1FCUA 4FIRA 4A2RA 4M5PA 1GYNA 4CNOA 4NXSA 2UV8G 4XKYB 1FWRA 2CZFA 2FQIA 3UXAA 2VFDA 1C8VA 1SR9A 3CWNA 2E5DA 5AC8A 3N3MA 4UTLA 1OK6A 3PWAA 4QJ1A 4HNUA 2E77A 1VHCA 1GPWA 1L6YA 2PE4A 3CC1A 1R47A 3PBWA 4O50A 3RFAA 2BSLA
chains in the Genus database with same CATH superfamily
4WSKA 2FTWA 3VNIA 1PX4A 3WLOA 3WUEA 5K9CA 4S3GA 1E9LA 4C6CA 2C13A 3TFCA 1OFDA 3CHEA 4DZIA 4MKNA 5AHIA 3CZEA 2Z7KA 1NP0A 4W9TA 1NWUA 3VCNA 3CB8A 3DHFA 3CPGA 1PE1A 4AZ6A 1GJWA 3ABSA 2V5CA 3VKJA 1J11A 1B90A 3MMTA 1K9FA 4QQ3A 1FP8A 1FWIC 1FWGC 4R53A 3O15A 3G77A 2ZUNA 2WV8A 3VD9A 2CBJA 2WBGA 3BZJA 1V3LA 3EOLA 3S2MA 4O28A 4LVAA 3TTSA 2PDJA 4DZHA 4XWUA 4E2BA 1FWBC 3S1WA 4WF7A 1E1CB 3TQKA 3TN3A 4WXZA 4Y90A 1OCJA 4NZ4A 5LIKX 4KFNA 1E71M 3FCPA 3SY1A 3WBAA 4GNVA 2EG7A 3Q65A 1RVKA 3GHRA 4OOZA 3CU2A 2XIMA 2XIQA 2NQZA 3V7PA 3FSUA 2YR1A 2ZUSA 2WSPA 5G4WA 1FWCC 5DEZA 3V1PA 5F1VA 4DPQA 4IFRA 2RKXA 2JFEX 3VNDA 2Z1SA 1R6WA 1PX3A 2ZZ5A 1MQPA 1E70M 1W3IA 2DSWA 1KM3A 1SR0A 4GI6A 4YU1A 1WKYA 4P8WA 4DBWA 2ZDRA 3EB3A 1O94A 1OGBA 3LS9A 4Q33A 2VFGA 2YA2A 1Z48A 4F2TA 3TJLA 2DJXA 3TZFA 2VR5A 5BWFA 1H1ZA 3KBNA 5I3DA 1KR0A 1XSIA 3ZOAA 1FRBA 3KRBA 1VCVA 4Z0JA 1B30A 2XSAA 1TUFA 4R33A 1XYCA 3G8RA 4P2VA 3W86A 3CIWA 3GVGA 4CCZA 1AJ2A 1NWRA 2WNZA 9XIMA 3UQNA 3JUGA 3OG3A 3CO8A 2Q71A 1ZJHA 3E49A 2NWRA 4I6VA 4M29A 2IQDA 3FA5A 5HWJA 5GPRA 3I3DA 4ZOCA 1M53A 2VEGA 3FJ6A 3TW6A 4O14A 1EWDA 2DIKA 2BASA 4ILSA 3N13A 4BQ4A 1W8GA 5FACA 3R7MA 2PD9A 4C7GA 3OLDA 4LYQA 3EXRA 3PJTA 3LB0A 3NQGA 1H7NA 4RCXA 2IQTA 3CZLA 4QNWA 1RD5A 2VM8A 4RNFA 1LWJA 3SCPA 3UWQA 2D1ZA 2FJKA 3C8FA 1ZJBA 3BANA 4EAYA 3T0AA 3KLKA 5CH9A 1TJRA 1FFQA 3QJAA 2XYLA 3NJ3A 3KZSA 5D9NA 4Y6GA 3OVQA 1R85A 3CAKA 5AHLA 2G50A 2O9TA 4OGZA 4O4VA 3GDRA 8RUCA 3D47A 1XYFA 4LPCA 3WH6A 1IZKA 2Z2UA 1XIIA 3TVAA 4JIIX 3W7KA 3ANYA 5FJPA 2OG9A 3W7MA 4TO8A 3UPBA 2C91A 4YHEA 2B7OA 3U4AA 1SU5A 5LIWX 2GVYA 4K2SA 3PTMA 1E15A 5CZSA 3P8JA 4YS1A 3HPFA 1V6YA 4C1KA 4G5DA 4F9DA 5HMDA 1SGJA 3AIBA 3VD3A 5D2YA 2XISA 3LTPA 1UH4A 2PUZA 2ABBA 4PMOA 3NZGA 4UMBA 2WSYA 4QAWA 2NVCA 1VH7A 3THDA 3AIUA 4LS2A 3S2LA 2ACQA 3GDLA 1F8IA 3OLGA 3E2SA 2X7WA 5DCEA 3W71A 2A2IA 3CQKA 4HCDA 1K8YA 3WQDA 3PPGA 4PMDA 4M1BA 4UFKA 4LB4A 2C3ZA 4LF2A 3PBYA 1XYAA 1UROA 4PEKA 3R89A 2VX7A 1E4NA 2XIOA 1RUSA 1QO5A 1RBAA 4ZBCA 3ZLFA 3ITVA 5D2TA 5GJPA 2OJPA 4HSNA 1C91A 2DJLA 3IIZA 4O0QA 1VB9A 3HGRA 3M0KA 1XRFA 3OZYA 2V9DA 1UCWA 1Q65A 4LALA 1Z42A 3UU0A 3MP4A 4XUYA 4MNLA 4EAMA 2R1NA 2CLPA 2KAUC 3U2ZA 1A53A 1K8CA 1VCFA 1N8FA 1TV7A 1ME8A 4EK7A 1R8LA 4WOQA 2YXXA 2O9PA 2J47A 1OX4B 4H9ZA 4DX3A 4AWTA 3SUSA 3QYQA 1KM1A 2R1KA 1P0BA 3EXTA 5HMSA 4C7FA 3BW2A 1S46A 3QHMA 1KBLA 2ZIDA 3K4DA 1UB3A 4U33A 1BG9A 1H0IA 2E09A 5M2FX 3V35A 3DN5A 1QPRA 2FVLA 4LAUA 3PSVA 2WVVA 4O8RA 2IPJA 3HMCA 5KZEA 2WQDA 1JEZA 4AD3A 3KTSA 1VF8A 3UNDA 2XH0A 1ZLPA 4TUFA 2UY4A 4OQVA 1XYZA 4HPNA 4UCFA 1F4AA 4HU4A 4MZ1A 1E6SM 4FNQA 3UWZA 2NV9A 1I2RA 4C7DA 3BAYA 5D03A 4H2CA 4H9YA 3GFZA 1JYVA 4Z1DA 2YLAA 3E0VA 4C6KA 4TX9A 4IX0A 2CLEA 2YDAA 2PFHA 3L2LA 1BVWA 2FFIA 3WMBA 2F9RA 2GSJA 3M44A 1UR2A 2XM1A 5CEWA 1X6NA 1OT1A 3IJLA 3TSDA 3G1YA 1CB7B 2GUUA 2EPNA 3BLPX 4XZHA 1QI5A 3MYPA 5I07A 4GX8A 5H6HA 3S6DA 5JBFA 3CEPA 1TE6A 5BOEA 1TPEA 3F2BA 1C90A 3MU7A 3NOYA 3UCCA 4M7TA 1BVNP 3S3GA 3W3OA 2CLHA 4EIVA 5HAOA 5D37A 4FNRA 4I7UA 2OLHA 3H26A 3NDYA 4U3AA 4Y9MA 5ABFA 4YTSA 2J77A 5A6SA 2R1LA 3CHVA 4RZBA 3FAXA 3EMZA 3HV9A 1EGMA 3USBA 7ODCA 1QFEA 4O17A 2GDQA 2VJXA 3QR1A 4XZLX 1NM9A 3EWZA 3RHGA 3VFLA 3WX7A 3GDMA 1IGSA 3WD1A 1PTDA 3TTQA 5I3GA 2FMNA 1XD0A 3M0MA 2AQWA 3G18A 5GVJA 1RV8A 4KERA 4P7OA 1A5NC 4LUTA 3TTEA 3OZOA 1KTCA 1EZ2A 1QDSA 2J25A 1RY0A 1FWTA 3W84A 3LUTA 3N12A 3MWCA 1E56A 2X05A 8XIMA 4JTCA 5BCAA 2V8ZA 3CUHA 3VA8A 4PMQA 2ZX6A 1IQ8A 4JYFA 3TQVA 4RR4A 4NIRA 4O0ZA 4UFJA 3WH9A 3TONA 1H4PA 1GVRA 2VQUA 1TR1A 3UWVA 4FX7A 1UBPC 3GXPA 4ZR8A 3RM4A 4AIUA 5MKGA 2GK1A 3K13A 1J0JA 4ORMA 4JL1A 3SQSA 5HR6A 2PF0A 1KFCA 2TAAA 4A8NA 2ZUMA 2OWCA 3MCOA 4FXJA 5AVHA 2C0HA 1QPQA 5C2CA 1H51A 2BLEA 2JKEA 3DI1A 4JS3A 4PTNA 4C90A 2PBGA 5MHBA 1KFBA 1HKIA 3N6JA 2VCAA 2FLIA 3TEVA 2WVTA 3WF0A 2VEPA 4Y9OA 4QDMA 5FEZA 1MXSA 3VD7A 1XBVA 1NP2A 3WMSA 1E6ZA 4L4LA 1KLYA 4NAFA 3IRDA 1WDSA 2A6NA 4WKAA 1UA3A 3HA1A 2WCSA 1LRNA 3KS5A 1OINA 2O55A 2G97A 2J4GA 3LV5A 2GJXB 4KEMA 4JNZA 2QYGA 4Z2GA 1OD0A 3BK0A 1WZLA 4GABA 3SADA 2Z24A 2DSKA 3ES7A 1A5BA 3ZQ9A 3CNYA 1QVBA 3HGOA 3DU0A 2RDWA 4FXFA 5HMEA 1ZP3A 3H23A 2BY2A 1YDYA 4ICNA 1OF6A 4HIBA 1BGAA 1EJ7L 1B3OA 3H55A 2XU2A 1Z7AA 2VRKA 3C0SA 1SM9A 2BY0A 3UJ2A 4MF4A 1TG7A 4A22A 2OZ8A 3DBPA 2VGBA 3Q37A 1XJBA 4O54A 4PMJA 3KOZA 4NP7A 1XLAA 1PIGA 2BV9A 3UCQA 1YXYA 4GRSA 1D3CA 1TTIA 3GXTA 2WCGA 2E7FA 3JRKA 2PDFA 1XKYA 3DGRA 4NNAA 2ZZ3A 4LX4A 1CGTA 3UWWA 2XVNA 3EWYA 1I1XA 2ZA3A 4NZ5A 2P0OA 4C6DA 2E8YA 4W88A 5CPSA 3LMYA 4NAEA 3N3TA 2NUXA 3PZVA 1G4PA 4NZJA 5DMMA 5AKQA 1R9YA 1Q45A 4DZ5A 2HISA 1H62A 1S39A 3AS0A 1RLCL 3O3RA 3M5XA 1TTJA 2VZTA 3VPLA 2Q8LA 3GVRA 1H7XA 1GZJA 2DQWA 2INFA 3HO8A 5M03A 4XZMX 3B9DA 3CQ0A 1L6FA 2OX4A 4EP8C 3LPPA 3BDKA 4GCAA 3CPUA 2R9RA 3E0WA 2ZOXA 2XN1A 1VRXA 2DVUA 2EEXA 1E0VA 1EUAA 4L9YA 1K70A 1CI1A 1VAHA 3HBLA 4GPNA 1EFZA 3WG6A 4YLWA 2ISDA 2JF7A 3W87A 2VO5A 4MLRA 3V5CA 3CH9A 3K2GA 3FHQA 1VPYA 2WNWA 4DWSA 5DANA 3I7RA 4F0RA 2XG9A 2DUXA 3N2TA 1YDVA 4A05A 5CQ1A 2CLKA 3G1SA 1GOMA 1W9BM 3DFHA 1C8XA 4FLSA 2I5IA 3WLJA 3K46A 2WMIB 4GGHA 1X1OA 2ZXQA 4LYKA 3L65A 2OSXA 3CMGA 3ARTA 5B7ZA 3GM8A 4RXGA 3GIPA 2DZXA 3C2EA 3RDKA 1LBMA 4DNMA 1K6WA 1VYSX 1WPCA 2GGIA 4KEZA 3OQ8A 3EA1A 1CYGA 3GG7A 3LTSA 3LCGA 2OKTA 5C2GA 1FWDC 2GQ9A 4GH1A 1K9DA 4R34A 2DU2A 4XBJA 2V6AA 4UOJA 1T41A 3WLKX 3UT0A 3S5SA 1XIJA 3HFYA 3A12A 2Y4SA 1QW9A 2B81A 4CEXC 1QPNA 1IEXA 3I4KA 3GXIA 5AHFA 3L5AA 4AW7A 2CZ5A 4XO6A 5I02A 3RLGA 2NX9A 3K1GA 1IIHA 3BAXA 3TFXA 1TR9A 1UKQA 1DE6A 4FF7A 4ATLA 4Z2LA 4JR5A 3DYOA 1BXBA 4G1NA 3BXWA 2NQ9A 4LCRA 4IMCA 1DQWA 1VLWA 1WO2A 2BVWA 4QX4A 1V7YA 2G95A 3MUCA 4WR3A 1V3HA 3TLQA 3WQ5A 4E8DA 5BU6A 3BLLA 3JZEA 3GTFA 3L67A 4P8UA 4M19A 4IWWA 3FJ4A 1VBUA 5B7YA 3TCSA 3EOUA 3T0CA 4PFMA 4H9UA 4B92A 1RCQA 3L68A 3C2VA 4IISA 1IE7C 4QCFA 1V03A 4JTQA 3LLFA 3NZ1A 4ZQOA 3FN9A 3RK8A 3SECA 1AVAA 2PWUA 1WBJA 3W00A 2CHRA 1U5JA 5EMMA 3VOGA 1TV2A 1EX5A 2BX7A 2OOFA 1FHUA 4DF0A 1GGOA 1MW3A 3A47A 5GNZA 2Y5JA 4JQ1A 2HROA 1EEPA 4GWEA 4BI7A 2X1IA 1I2PA 2NQHA 4WUIA 3B05A 3BQ6A 1VBGA 2PDBA 2YYTA 2REQA 3DI0A 4B2DD 4UQAA 2ZA2A 1EDTA 4OBRA 4HPHA 4LVFA 4HJFA 4AVOA 1JAEA 4Q8OA 1HKKA 2OEJA 1JYXA 2ZX8A 4ZXOA 3KVMA 2Z2AA 1F73A 2DZTA 5F2IA 3S1GA 3E96A 3AICA 4PUDA 3NIYA 3L12A 3Q2DA 2JGQA 3EMCA 3QY7A 1CXEA 2V38A 5SWUA 2JF6A 4LF1A 1Z9AA 1AQHA 3EX3A 3KCOA 3MY9A 4FXSA 5K4XA 4LBUA 1PXGA 2R6OA 4FXRA 4LOCA 3CZGA 3O0KA 5FSDC 2QDDA 2V5BA 2VEFA 3EDKA 3KP1A 1DTUA 3MP3A 4U4MA 1VFFA 1OEPA 3ITYA 4CNNA 1H1NA 1GTEA 1ZCCA 1RPXA 1NF0A 2W91A 3NNTA 4AF0A 2QS8A 2W0UA 2BHYA 2FHBA 1G4TA 3WSUA 3AXKA 1IIGA 1EF3A 3NO1A 2QAFA 3MJMA 3T07A 4IUOA 1RZMA 4JTLA 2ZRUA 3WIJA 1PHQA 1E0XA 5L6UA 1BFNA 4C6LA 4Y9AA 3CHDA 3S5OA 3BMVA 3O0FA 1XPYA 3OA5A 3LM3A 2W27A 1TWDA 2LLEA 4ZVJA 3UXIA 4HPJA 3B0XA 4QEEA 4O1BA 2ZC8A 3WQEA 1AG1O 1PDZA 3QM3A 3DFSA 4IMGA 2W9MA 4C6PA 4JKLA 3VUPA 3GDTA 1ZP4A 5BMXA 1S3TC 3QHOA 2ODOA 2QQ6A 1OGSA 3GO2A 3RU8X 1VQTA 1F3XA 1A80A 2QJMA 1DIOA 2OZ3A 1UP3A 4GJIA 1JZ6A 2PDPA 4GVFA 1XIHA 2Y0FA 3S42A 2PDHA 1FH9A 2F6KA 2P5NA 3EEZA 2OPJA 3E1F1 1XCXA 4I6KA 4DHGA 3R0UA 5FAGA 1H60A 3C52A 3MUZ1 2Q8ZA 3RCMA 4YYCA 2C6QA 1EJRC 3RXZA 4XB3A 3EWUA 3QV6A 1SJBA 2FZ8A 1VR6A 4Q4QA 3CV7A 2J13A 1XH1A 2XVGA 3WQWA 5EMLA 2PCQA 4PRRA 4AWUA 1CNVA 4DO6A 1N2VA 3TR2A 4AISA 2FGLA 1UJQA 1HIZA 2PU0A 3QLLA 4CN6A 3A6OA 4MTVA 4JCMA 3LCWA 1D9EA 3HPAA 1AW2A 1YTKA 2AGTA 4Y7EA 1IXQA 3LRMA 3SAZA 3A4AA 4PSPA 4CQ8A 4RK8A 4QE5A 3GVWA 4TIMA 1E6RA 3VOFA 5B80A 1NY1A 4AZIA 1TKKA 4AX7A 2HSAA 2PC4A 3N73A 3TJXA 2ASHA 3VAVA 3BOLA 4S3FA 5ABGA 3IUHA 4H3DA 3ZM8A 2WC7A 4GZEA 3ZIZA 4NT0A 5CSUA 1PWMA 3T4WA 3GAYA 1VD6A 1M3UA 3REQB 1VZWA 2HWGA 1BAGA 2E6DA 1QT1A 2UWFA 1KCXA 3KAOA 4F2BA 3KOFA 1YPIA 1LOLA 4AU0A 2IPFA 4OU1A 3NQ2A 1KA9F 1CDGA 5REQA 1XPGA 3UY8A 1BRLB 4QROA 1YQ2A 2NUWA 3VGBA 2UZ9A 2GL5A 2ZVRA 3WLHA 3NQ8A 2Z1VA 3CAQA 5AC7A 5HQMA 4B4HA 2FGBA 1V02A 3BC9A 2NXIA 4IIGA 1JZ2A 4WJXA 2CZEA 3N2BA 4LY4A 1T99A 3ICJA 3TMQA 4S1FA 1C8YA 4ERIA 1KQZA 4JIQA 4WJEA 4LB3A 2Z4GA 3PS7A 3B0PA 1OIMA 3FJNA 1O4UA 4OTKA 9RUBA 2XSBA 4C60A 2DP3A 4GVIA 1T5AA 4CNTA 4FP1A 3T8QA 4C1NA 4GI9A 2QCFA 4R88A 3BPWA 5GNYA 2J9ZA 1BSLA 3EWBX 4QBXA 1YADA 3IJ9A 1ZRQA 1UIPA 4OUEA 5I77A 3VOIA 4M6UA 4O8AA 3EOEA 1V3JA 4C6QA 5HINA 2XGZA 2C8NA 1EUNA 3W7NA 1DJHA 4RJEA 1DKWA 4UFHA 4JCLA 5IDIA 1HNYA 1KQYA 1DHPA 3GYEA 3PWIA 1TZ9A 2QPXA 3TWBA 3S9IA 4DYEA 3H2MA 1TJ2A 2CZVA 1C9WA 3S8HA 2F38A 1RAKA 3RIKA 2NSOA 3T0DA 4UR8A 3N29A 4DI8A 1M01A 1BEUA 3F4CA 3W85A 2OQLA 3GDBA 4X2PA 4QRNA 4XD3A 2ACRA 3M0HA 1JDAA 3N04A 3V18A 3GU9A 3AIVA 3RAOA 3CIXA 1W9PA 1J0KA 5G1TA 1A5SA 2DW7A 3HG4A 3WJSA 1VBJA 1WOAA 3GG8A 4XG1A 4AYSA 3UJFA 2GSEA 2WCAA 4JYEA 2O4QA 5AVNA 3LLDA 3CHCA 4KIRA 3PTQA 5GNXA 1RK5A 2DPEA 3GHSA 3NL5A 1QTWA 4Q8VA 2OU4A 5ECUA 5DQPA 1B3VA 3UZXA 4Q4KA 1YIXA 3E2RA 2YB1A 3DYPA 1W1B1 5AHNA 1P1XA 5FEXA 2JEQA 3A9BA 2Q01A 2Z26A 1H63A 1OYBA 3W74A 3WFLA 3HG2A 2OWWA 4L5ZA 5D2VA 4FOKA 3L5MA 3PZGA 5LSMA 4ICCX 1V5XA 5DELA 3G3MA 5CJ5A 3W73A 1DV7A 4AEEA 5FJIA 4F0SA 1J9YA 1O60A 3WF1A 1V3KA 1T6MA 4W84A 3DOPA 2GQ8A 1R46A 1XFCA 1XI3A 2Z1KA 4KWUA 2QPUA 2E5BA 1MWOA 2DUZA 5E5CA 1DJIA 1TA3B 3T7VA 4L6OA 5K9DA 3M6DA 2V81A 2PDIA 4UTFA 5D32A 3AZTA 3LG3A 3ZFHA 1DIKA 3WKZA 3ZR5A 1XYLA 3CZJA 3N4EA 3BO9A 3IWPA 1XV8A 4MWAA 3IPWA 1PZ0A 4OVXA 1AZ1A 2F8QA 2PZ0A 3LNPA 3EDEA 3SRHA 5HANA 3LGEA 3OJGA 3KBVA 3KBMA 2YL9A 1BYBA 5DRCA 5CAKA 1MUMA 3ITLA 3UWEA 4YYFA 4R7JA 4O1EA 1ZZMA 2BHZA 4UZSA 3IJQA 4IQLA 3M0YA 3QW3A 2XVKA 3TR9A 4H01A 4QP0A 1XISA 2QUTA 5HA7A 4C6OA 2H6RA 2J7EA 3QC3A 1LP6A 2J8GA 3TNOA 2CLFA 1V6VA 1WV2A 3H6OA 3KHDA 3S9ZA 2EPHA 2D20A 5J5DA 4ZMGA 4N9EA 1WB0A 1TV8A 4MWAC 3MV01 3TA6A 1TWIA 1CT5A 4G7FA 3OQEA 2O9RA 1LWIA 4L9ZA 1V6XA 1FFRA 3MCMA 1QBBA 3BG3A 4TV5A 5CJNA 3OEXA 4O16A 5BOFA 3KTCA 1X7IA 4BEQA 4O0KA 1DXIA 3QY8A 3EB4A 1WP6A 3M47A 4UOQA 4AUBA 4EWJA 1D2KA 1HFBA 1EL3A 1LL7A 4JIRA 4XBKA 4D9PA 5FJOA 1FCVA 3DYMA 4UBPC 3U4FA 3VINA 4LUJA 5JH2A 2BVDA 4IIBA 3AHVA 1PTAA 2CLOA 3VKKA 2Z6IA 4FHAA 5FF7A 4BF9A 4GXWA 1JCJA 1F8MA 1GJPA 5U7SA 2Z29A 2WZEA 1SW0A 1YBQB 4IMEA 2RGLA 2DZBA 1ZJAA 2QJJA 5A6BD 4TR9A 3Q58A 2DZPA 4IIEA 1EJTC 4ES4A 4J9JA 2W92A 2X40A 3NQFA 4BKNA 1RQEA 3WD2A 4F48A 3TX9A 2GSHA 4JY9A 3N9SA 4C6FA 4I90A 3DKJA 3BCJA 3QQ0A 1EWEA 5D02A 1F7BA 3QMSA 3D3AA 3ME3A 1KBIA 2I16A 4KCVA 2TODA 4LVGA 2GFTA 1RR2A 4UMAA 3QEZA 1MXGA 1EJWC 5I03A 1SQ7A 3MZNA 4ENLA 3P60A 5MKGB 1JPDX 4A6GA 4BQ2A 4IP7A 1TJ0A 1YDOA 1QI3A 4HCLA 2YCEA 4L6DA 3WLMA 1UQYA 1WYIA 2WKGA 2PTDA 1W6TA 1SW3A 3R6IA 1UD2A 1XQLA 3GH4A 2H9AB 4I5RA 1K9TA 1GEHA 2FZBA 2HEJA 4UWMA 3NQAA 2CYGA 3WMLA 2PWGA 1K4HA 1LTDA 2QV4A 2YYUA 1DIEA 2VI0A 1FCUA 3T1GA 4X9YA 2G4FA 1LUCB 1HKMA 2BMBA 2QMJA 4XKYB 4GBDA 3GUGA 3HU7A 2XFRA 3H2OA 2W63A 1UMLA 4HN8A 1C8VA 3IGHX 1UKTA 4MPKA 1J5SA 5AC8A 1V8EA 1W3LA 1B3XA 2OQHA 3PWAA 4UZUA 4HNUA 3SM0A 2G3JA 4OECA 1L6YA 2PE4A 1R47A 4NY2A 4LEFA 4HK5A 1JIBA 4R9OA 3V3WA 2QJHA 1MYRA 4DJFA 4D6HA 1REQB 1T8XA 2ZVIA 1VIWA 4H7ZA 2B7QA 4Z2HA 2A4AA 1BTMA 1S5MA 2GYIA 1DWAM 1AD4A 1YLVA 3G24A 2POZA 3VO0A 5CBJA 3A3HA 4RNHA 1XLEA 4L7ZA 2CHOA 3WQGA 4UNIA 3EEGA 3KL0A 3WF2A 3WL1A 3GKFA 1LYXA 3CZKA 4IGMA 2PWDA 2NT1A 1PKNA 1QO2A 1ZB5A 4D6DA 1XCFA 3ZR6A 3SY5A 1JXKA 4GNJA 1ECQA 3ONBA 1PB0A 2O9OA 2CXEA 3QBUA 4GIYA 3B3DA 2PDYA 3SQLA 2I57A 4DJFC 5K2ZA 1KNWA 3O6CA 4HVXA 4P7QA 3P14A 1FHLA 2OEMA 1R3WA 3LY0A 1UUQA 3W2NA 4J2MA 4HA4A 3ARZA 4O1DA 5IM51 3C6CA 2AQOA 4LYRA 4G7EB 5E1QA 3DHDA 3ZT7A 2X8RA 2V63A 1TREA 1CLXA 4XV0A 3RU6A 3EPOA 4PL1A 2YBTA 5D2XA 1MFUA 4HOWA 4H6KA 2O0TA 1Q85A 2MUCA 2KX9A 3NVDA 4XKMA 1U33A 4UTUA 4PC8A 1LROA 2IW0A 1AH3A 3QZ6A 3USZA 2XUCA 4US6A 4TU1A 1EYEA 3GK0A 3M0LA 3OVGA 4V15A 4RDVA 2FIQA 2BWGA 2W62A 4B3LA 1BWLA 3G6MA 1QHOA 2PA6A 3TN4A 4C1LA 2CW6A 5CLWA 1O1HA 3DFTA 1F6PA 3WK1A 1RY8A 4DWSB 2QR6A 4GUFA 3IEBA 4Q4MA 2EKGA 4B5SA 2V82A 3PC0A 3WNPA 3M0XA 4XVEA 4JTUA 5HWMA 1RH9A 4MB3A 3EDDA 2EJ1A 2I5GA 1W1TA 1E1CA 5DF0A 3W83A 1NAL1 3GRIA 2R91A 4IJRA 2X1RA 1W56A 1W0MA 4DY1A 5DT5A 1B0IA 1L9WA 4IPPA 1J79A 1W9XA 4I9MA 4GY0A 4XSMA 3VOCA 5BXRA 1UD4A 3P2VA 1AH4A 1ESWA 5HPOA 3APYA 4I7VA 4CGTA 4H00A 5LNRA 3QSTA 4QLKA 5T8GA 4OBSA 1BPLB 4HYRA 3AYSA 4R85A 4AWEA 3A4XA 4EWND 5CC6A 4KGJA 2PPGA 5A2CA 4QLLA 1CGXA 2RDTA 3CWHA 3VD5A 3WQOA 1M7PA 2Y8UA 1WA3A 4MNMA 2ZCGA 4TVCA 1MMFA 3KP0A 5CG7A 2BVTA 3MW7A 4MNKA 2ZKMX 1E0TA 3APGA 4B9YA 2V2CA 3KLLA 2JIWA 1PSCA 2I14A 3APTA 4X22A 1W31A 5EBUA 2GDVA 3KBJA 3U57A 1U1UA 1HF6A 3UESA 1DJGA 3COTA 3T6CA 2HPMA 4QDPA 3PAJA 5MF5A 5HJXA 3W7PA 4P61A 3G1FA 3UG4A 2OGJA 4PTDA 1ZL1A 2YOCA 1QW7A 3H2NA 4H04A 3AALA 4GXMA 2HPIA 4QS5A 3WQPA 4RUBA 3OZPA 1WZKA 4IUGA 2ZX7A 4N9DA 3FDGA 4K7YA 3GR8A 2FPVA 3OTRA 3D6NA 2DFAA 4GIEA 3UJEA 4UFMA 2WAGA 4HD5A 4V33A 1GHRA 2I9UA 3N6HA 3M4HA 4HZ7A 4NZ1A 4DUOA 5I24A 1BYCA 4C5ZA 1DWJM 2GQAA 3S1XA 5D8WA 1KM4A 3IIVA 1GVSA 2H8ZA 2VT0A 3ARWA 4Y96A 3WNOA 3TIMA 1VFOA 4DUXA 1R0MA 2OX1A 5A6KA 1UZHA 2EO7A 1J6PA 2OT1A 3LHZA 1V51A 1E0UA 1OZQA 1QNQA 1V77A 1EJVC 2GOKA 3N18A 4K68A 1E9IA 3EDJA 3ONCA 4FIQA 3M07A 3GH5A 4RDZA 2R8WA 3FDKA 4JQ2A 5A3HA 2DV0A 4XK2A 1A3HA 4US5D 5DMLA 2DEPA 2WJEA 2TYSA 1F05A 3SCSA 2J62A 2VEMA 1PPIA 3GSMA 3O2LA 3MA8A 1V3MA 1W9DM 1RP9A 1HGWA 4CNUA 1ITCA 5G2IA 3M9YA 4ZOEA 2TPSA 4S3EA 3V5OA 4MLJA 1OK4A 4WSHA 2P3EA 3MWAA 3Q45A 4LRSA 3S0CA 5F4SA 3UR2A 3CO4A 5EB8A 1QAPA 2V2DA 1MQQA 4DJED 3JS3A 1W91A 3EPNA 3AXMA 4NX0A 4ALDA 1JR1A 3T2OA 3ES8A 4QJ3B 3MUXA 1R3YA 2OGYA 4MOZA 3NSXA 3B8TA 2JKPA 2VFIA 3TMLA 3V1HA 1U2YA 5ABHA 4JFSA 2CWNA 1T96A 2YCLB 2QGYA 3MC5A 3H54A 4PUMA 4UFIA 5A6JA 4W8LA 5F4WA 3BWWA 1QWGA 3V0SA 4RE0A 3B9AA 1TVPA 1I60A 1JPIA 4YVVA 8TIMA 1Q7QA 5D9PA 3GH7A 4U2ZA 3T05A 4UFLA 3R43A 3ABRA 4F40A 3E74A 3AOFA 1VPQA 4P7RA 3IVTA 1L6SA 4BR1A 3UJRA 1OX4A 2XN2A 1FH7A 1GTHA 4YJ5A 1VHNA 1GW9A 2VVSA 2QCNA 1XR2A 1ZBCA 3IIXA 2CNCA 5E0FA 4B3KA 2Y5EA 3JW7A 1JI1A 2EPLX 2I5QA 4QGCA 2WZTA 3AWNA 3PG9A 2A1YA 5JXQA 2OCZA 4CN4A 4ACYA 3BAIA 2CKRA 3ATZA 1TVLA 4D2JA 2AL2B 1X8FA 3LQGA 4GY1A 3L4UA 2TRSA 2WM1A 2YX0A 1EF2A 3N1AA 2DQXA 3NPVA 1I9CB 2R82A 1KR1A 4L64A 3T40A 5LNVA 3U2EA 4HBKA 4M6QA 1A0CA 2JIEA 2BVYA 4HOZA 4RV8A 3M0IA 1CGYA 1Q6LA 3PZIA 3UFYA 1DJNA 3URAA 1F74A 4M81A 2ZZ6A 3W7EA 2X1TA 1F07A 4D6FA 2CERA 4PUWA 3MI3A 1R86A 1B57A 3QY6A 4ZFMA 4IXXA 3CMJA 1Y0EA 2VMFA 3KXQA 4DN1A 2VP8A 1E40A 3LHVA 2WHJA 1UD5A 3RLUA 3MDUA 5CKSA 1XF0A 2PSNA 3PB0A 2CLIA 3SN4A 4YTUA 3LOTA 1IXNA 1ICQA 2X1SA 4YVPA 3PWGA 3R25A 1DQXA 2WNQA 3CM4A 1JXJA 3UZJA 1D8WA 3LGGA 1B3YA 3IK4A 2A79A 1ZAHA 3PAOA 4D6IA 4PMYA 4W7UA 1HQTA 2HVOA 2UBPC 1PDYA 3W1AA 1MRAA 1Q6FA 1PTGA 3IJDA 1QHPA 1W1VA 3MVIA 3VNZA 3CHFA 1HJUA 4WKFA 3C5QA 2D2HA 5LNUA 2WSRA 2O92A 4HNVA 3W6LA 5CGMA 4REQB 3FHAA 2I56A 4HMCA 1OFQA 3RPMA 4W7VA 3DCPA 4AZBA 1MSSA 4E6MA 4M7SA 2FTPA 4BZYA 1H3GA 1XLGA 1QXLA 2ZRYA 4D8AA 1GNXA 3N9RA 4WGXA 3W75A 3S83A 2PDGA 4MUPA 4BHYA 2P0IA 3OO2A 4GC3A 1Q6OA 3MKVA 2G0WA 2HXUA 1Z41A 2E3ZA 3GNNA 3VIMA 3F03K 3T0TA 1B3ZA 2VZOA 4QEHA 3LZ3A 5T9BG 3WD4A 2ZA1A 3AWOA 4C6MA 1W5PA 4LW7A 1XX1A 3GZ3A 4WSJA 2QCLA 3KOWA 2DSUA 3EX1A 3UZYA 5C7HA 1C7TA 1XGZA 5DBTA 4WVXA 1KCKA 1K3UA 4RZ4A 5C9ZA 3RR4A 1GZ1A 1W3HA 3U7VA 5LYRA 4NZFA 2WW5A 4MGGA 5I00A 3Q94A 4L1GA 1G5AA 2Y7FA 2QDHA 3O05A 4IFOA 1TV3A 2Q8XA 2VEKA 3ARQA 2CFFA 2WZMA 3R10A 1DYSA 1HJXA 4MDPA 1OFAA 2A3BA 3T81A 4MKVA 1W5NA 2GJXA 1TRIA 3UGRA 3KRSA 1I75A 4PODA 2YXOA 3DIPA 2VEIA 1RCOB 4PR4A 3UXLA 3CAWA 3UP8A 4N42A 3VDBA 3NYDA 2RJHA 3P74A 2GOUA 3SUVA 3AYTA 4UR9A 3WD3A 3WZ0E 4JTJA 3HIJA 3WBXA 4IFKA 2FFCA 1YYAA 4TTGA 3W37A 3NL6A 1NTHA 4H9XA 5DT7A 4YWSA 2HMCA 4FNPA 3MI6A 1SJCA 2V30A 4B5NA 1KBKA 3QFEA 4JL2A 1VJSA 1NSJA 4LNCA 4H6RA 1IF2A 2I9EA 4EANA 2VGIA 1FA2A 7ENLA 1HJQA 2WWCA 3LNMA 5CCZA 3NQ6A 2E4TA 1X1ZA 3NQ7A 1QRQA 4JEQA 1KWKA 3TH6A 1G01A 1IXPA 1LORA 5EMJA 3RUBL 2EG6A 4EPKA 4HSOA 2FH6A 1J6OA 1YDNA 3RCNA 3L4WA 5BOOA 1OD8A 1NQ6A 4AEFA 1XSKA 4XZWA 3RJYA 4V1YA 3GWQA 1J10A 3G0XA 3BSHA 2HV5A 1SVDA 4RNJA 2XWEA 5C7VA 3GE7A 4WHBA 1JULA 3OHMB 3DBNA 1PCKA 1SZGA 3WDHA 1MQRA 4TOQA 4TMCA 3KFTA 1AZ2A 1X38A 5C6MA 1FP9A 4JQAA 3U3HA 4H41A 3UYIA 1RJRA 2E8ZA 1S3HA 3DFOA 3I7SA 2RFGA 4ZXLA 5C0QA 3WO8A 5KZMA 4WQ6A 4AIEA 1QNOA 5HK4A 2V5JA 4DLFA 1FY6A 1ISYA 4UNKA 2Z7GA 1R2SA 2VZSA 4C5YA 4YTRA 4B15A 4HK7A 2V5KA 5M5DA 3KUMA 5I09A 1EOMA 3BURA 1IWPA 2H3BA 3F2DA 3N2CA 3PBVA 3I3BA 1G4SA 3MSRA 4XZIA 1OIFA 3PNUA 2VELA 4S3KA 3R58A 2A21A 2BGNE 3UG3A 5LA1A 3KCLA 1GT8A 2POTA 1PAMA 2HNHA 1QPOA 1G7VA 5LXXA 4GVGA 2B4GA 4WRHA 3KM8A 5I3FA 1EIBA 5CGTA 1KCLA 3ZVHB 4DBUA 4GJJA 4YNGA 1K77A 4UIOA 4K8HA 5FJUA 1IR2A 4JEJA 3MCNA 4A3UA 3N9KA 1GOXA 4AD2A 5KTLA 4CU6A 5PTDA 1CTNA 3BLOA 4JTDA 3DHPA 1ODUA 3WD0A 4E3VA 4U10A 1D3GA 4CD4A 4H9TA 4NF7A 1Q6DA 2E25A 1GJUA 4HPGA 3ABQA 3P82A 4H1ZA 5DX7A 3T78A 4ZQPA 7TAAA 5HR7A 3CLMA 1GQKA 2QLYA 1AW1A 4N7QA 1S2AA 5HULA 4UTHA 2DSVA 4DO5A 4UTJA 2G3FA 3VK5A 3JU2A 4L9XA 3ALGA 1UR9A 3W70A 3S46A 4H2HA 4LBSA 3STFA 4DJDD 1E9YB 3LXBA 1Q7ZA 4WEVX 2QCGA 4PUKA 4PUJA 4H9VA 1TB3A 3HV8A 5FL1A 3SBFA 3UNTA 3LEPA 3U2OA 3T55A 4F79A 4UTKA 1JD7A 1Z8AA 5CBBA 1E43A 3QZAA 5L9FA 3W2KA 1L6GA 4RW5A 2XHYA 4CCEA 1C7SA 5JIPA 3W2MA 3ZWTA 2E28A 2A3AA 4NKCA 3MJYA 2QZRA 1P7TB 1SO6A 4LAKA 4IQJA 2EKCA 2ACSA 3GNPA 4D72A 4HYWA 4YWIA 1EJSC 1KGUA 3MANA 4MHBA 2QUNA 1TPVA 4N4PA 1JAKA 4RV3A 1DEDA 3U7BA 1MI3A 3LPGA 4LANA 1VP5A 2PTYA 1EH9A 3STGA 2QEZA 3Q67A 8A3HA 3LI0A 3SGUA 5LGXA 1R3TA 3AMLA 3RITA 3WH8A 1Q8AA 4ECLA 2FJUB 1ONEA 1PUDA 5HQLA 1YE6A 5LA2A 3NAVA 1EGVA 5FI8A 2W6RA 3IACA 3BGJA 4K8GA 3L0GA 7PTDA 3P62A 3GNOA 5FOOA 2PEVA 7TIMA 1OJXA 4IIDA 1B54A 4L65A 4XTIA 3QPZA 3H21A 1ONRA 2NXHA 4NVTA 3WUBA 3JZUA 3UY7A 3BAWA 3EKGA 2X09A 4LCQA 4K38A 1BTCA 4H8UA 4YVXA 3LXCA 2GVGA 1A4LA 2A7NA 1O5RA 1KRMA 3VIHA 5C9UA 1GVYA 4YN5A 4CD5A 3HJEA 4KFPA 1YHTA 2J24A 2F6UA 1PJ9A 1SZFA 1ADDA 3FSTA 1RBLA 3WBEA 4P8XA 1TWWA 3S5NA 1JYWA 1POJA 3O7UA 5DXXA 2WYSA 1TPH1 3PVFA 4JHMA 3OB8A 3BAJA 3BV7A 5GJNA 4A21A 1H50A 1NDVA 4Q4RA 1H5YA 4DBSA 3F4NA 4V28A 3FVMA 4J28A 4JN8A 2PP0A 4W7WA 3PZQA 4ICMA 4Q3MA 2WM0A 1OCBA 4O1FA 1S5VA 1VYPX 7REQB 4E4PA 3NQMA 4GZ7A 1RXOB 3FX4A 2C15A 2NSXA 4MAVA 3PTDA 3VIFA 2X2YA 4ML9A 4AMCA 2NQ5A 2G3NA 1VJZA 1W8SA 4PB5A 4W4QA 5EA9A 4BQ3A 1QPKA 4DXKA 5A94A 3A9IA 2QVNA 3MI2A 1XUUA 1LQ0A 3M16A 2OQYA 1R2TA 4FAMA 3S1VA 2VD8A 3KL5A 3H7UA 4KW2A 1UZ4A 3FA3A 3LM7A 2YDSA 3VKAA 5AOUA 3ZJ8A 1FHDA 4JTKA 2EPKX 5FL0A 1QWKA 1HXJA 4NRRA 2NQLA 4ROPA 3RJXA 3TYCA 4Z0SA 1O5KA 3R0DA 2OWXA 4PRWA 3AIWA 1EQPA 1NELA 1VFTA 4B9ZA 3CZ8A 3S2CA 4MMWA 3EXSA 3MSGA 4D6CA 4WLCA 1TPUA 2Z27A 1EGZA 5C9RA 4Q7NA 2OTDA 1JZ5A 4PB3A 5CZJA 4N02A 1WOBA 3UA3A 1PX8A 1OC6A 4HTBA 3OOQA 1UZDA 2BZNA 1F3EA 3AS1A 4K39A 3VZXA 2PWVA 4K7VA 3AFBA 2ZRZA 4HGXA 2ZADA 1OG0A 1XCWA 2ZC1A 1QBAA 3PUOA 3EOOA 5CC3A 4FOUA 2QKFA 1Q2SA 3H53A 6XIMA 3NPWA 2AAAA 2WVUA 2DZSA 3VOHA 4HMDA 3PTKA 1PBGA 1UA7A 2CCRA 5AYXA 1M65A 5A95A 1M6JA 1FCBA 1UBSA 3T8LA 1LLOA 2VKZG 4MJ4A 3FIGA 3G0UA 5EMKA 3VNLA 3REQA 1J96A 2DH2A 5T9CE 1UD6A 3WEMA 1NH6A 5A69A 4JTEA 3WNKA 4BI6A 4ONVA 5C2XA 3W2JA 1KFWA 4EE9A 1SO3A 1V93A 4O57A 1XIMA 3JR2A 3FA4A 1KM6A 2DT1A 1W5OA 1BRLA 1HX0A 3B9NA 3WNNA 4GO8A 2J27A 4X0VA 3H8AA 3PHAA 2CPUA 1RBOB 2ZZ4A 4XZ9A 1OQFA 4KFOA 1ZBKA 3SCTA 2WJFA 4N6EA 2QF8A 5H91A 3AUJA 2ZWZA 2QJIA 3V16A 4GMEA 3BLDA 5C5YA 1TWSA 1ZALA 3K5XA 1GORA 3U9IA 1OVDA 2VRQA 3BMWA 3CS2A 3DFYA 5A5WA 1DL3A 1UD3A 4MNJA 3C4UA 1CXKA 2VZVA 3WENA 4FX8A 2W4XA 4NRSA 1HTIA 1K7FA 1L2UA 3VVGA 4KEUA 4ADTA 3BCDA 3KWSA 2P1FA 1TUXA 3QH2A 4N4QA 2AKMA 1RK6A 1POKA 1ZENA 2EBNA 3R79A 2OO0A 1X7FA 3FYOA 3QHNA 1GQIA 1VLIA 1A5AA 3AMKA 3M5YA 1IR1A 3PB2A 3EX2A 1Q6QA 3ZSTA 2BGSA 3PZ9A 1NWTA 1JZ7A 5H8MA 2WHLA 4XAFA 2Q3RA 2YA0A 4GX9A 3AS2A 3MKCA 1Y65A 3WLTA 4IMFA 1ICPA 4AY8A 1XKJA 1XLBA 2FB2A 5H8PA 1V0NA 3GU1A 4UUIA 4JDBA 3TTOA 3BG5A 2J66A 2OO6A 3BL3A 4MYXA 1FVPA 2DGAA 1CECA 4RLIA 4HN4A 2WVSA 3GBEA 2G3IA 2IQ0A 4LWWA 2INZA 1RD6A 1WAWA 4S3AA 1TTQA 5E0CA 3BLEA 5J5RA 5I78A 5LNWA 3S5YA 2WLYA 3E2VA 3H7RA 4A8RA 2A7PA 4FLOA 2ZICA 3S4TA 4BF5A 1G69A 1YTEA 1QOQA 1QK2A 3HGSA 2QUMA 4CD8A 1Q13A 4XIMA 3DC0A 1EOKA 3GUWA 2VX5A 4DPPA 4AZCB 3DZ1A 2PGFA 4NZ3A 4X63A 4UTWA 4Z2JA 5I06A 3VIIA 1MO0A 1IEWA 3A64A 3XINA 2OEKA 2VQTA 5AHMA 4QISA 1XG4A 4QSFA 1A5CA 2Y89A 5DMNA 2QW5A 4GIAA 4PFHA 3W7RA 4NHVA 2VX6A 3STPA 4UR7A 2VC6A 1LL6A 2RDUA 1WDWA 1ZJIA 4PTMA 1C93A 4C6BA 3ANUA 3L7RA 2X2GA 4JNYA 2A3LA 4HB7A 2GWNA 4QTGA 4XZNX 3WYZA 2AKZA 4W5UA 4B5UA 1I45A 4NSBA 2WPGA 4RE4A 2GWGA 4CLMA 1A47A 1UUMA 1GQLA 4Q7BA 1QMLA 3BV4A 2O56A 4UTWC 4ZA0A 3U2CA 3URNA 3QR0A 3G2GA 4UQ9A 1EXBA 4FI4A 3VGDA 1BQGA 4IIFA 2D24A 1DXEA 3NPXA 3PM6A 5BROA 3DFNA 3OLEA 1PS9A 2BY3A 2QGHA 1XBZA 4GYFA 3ARRA 3W2LA 5JVLA 1O68A 5BZAA 1TA3A 2D0HA 2OSWA 3W81A 3GC2A 5CPLA 1VEPA 1WXYA 3MKKA 1KFLA 4HU3A 3VGFA 4D6JA 4QJ4B 3OYXA 1UC4A 3THQA 2JK2A 3BAKA 3TYBA 4AEOA 4FPSA 4I9JA 3QKEA 3HQ1A 3HB9A 1JL8A 1QNRA 3C8NA 1XLIA 3F4WA 5JBEA 5A8QA 4JQ4A 4I3GA 2QCMA 1IZCA 4S3CA 3WNLA 4EOUA 3G3DA 2P10A 1QASA 3ARXA 3MHGA 1S38A 4JOMA 4OV4A 5EY5A 4Z1BA 3FKKA 4F8XA 5LXEA 4HMEA 3TAOA 3WEZA 3SN1A 2R24A 3IVSA 2QAPA 3AYRA 2H3DA 3WEOA 5D38A 1FWFC 2Z0IA 3VMPA 4H7CA 1W3NA 1L2QA 3IIPA 1P48A 1CCWB 1TPC1 5JQ9A 1OF8A 2VUYA 2PBOA 3B40A 4DAFA 3ZYZA 2WNNA 5LGZA 3P67A 1Z3NA 4H8NA 2OR2A 3UJSA 1YPFA 3WQFA 3DENA 3INPA 2R94A 5EBAA 2O7QA 3GZAA 4ZO6A 1M5WA 4HOXA 5K9XA 1UC5A 1E1FA 3M7SA 3MMDA 1H5VA 1WAUA 1MVYA 1TFVA 4ZEPA 4LS1A 4UNLA 3UVAA 1NOFA 3CT7A 1E55A 4XAYA 1EP3A 3O6AA 5HNNA 1GKPA 3RO6A 3N25A 5CGQA 1J93A 3PZOA 4LBRA 4ADSA 4IPIA 5AC5A 1SSDA 3G1VA 2WBKA 4AD4A 1UR0A 3W53A 3SJ3A 1ENUA 2YL8A 3W7HA 3KE0A 6TAAA 4PTXA 5DY3A 4IPJA 1XQKA 3TTYA 4ORIA 3VCCA 2IKIA 4MAZA 1N7KA 2DZAA 3SSZA 1MW2A 1YBQA 3E38A 5EMYA 1QI4A 4NXSA 3V0UA 1IT0A 1WZAA 4ZE4A 4Q8MA 3UXAA 2E5DA 2PCEA 3WDRA 1M68A 2QXWA 1UR1A 4KCTA 4QJ1A 3MPGA 1C92A 2CBIA 4ZO8A 1V0KA 2VHLA 3OGSA 3TYAA 3RFAA 3QFWA 2PLJA 1XYBA 4GLEA 1SUXA 1PZ3A 3N2XA 3NEVA 1TPDA 1N8WA 2J7HA 3WDIA 3RX4A 3W1PA 5M1TA 1RJPA 3LDVA 3A24A 3MZ2A 4QFUA 4MG4A 4ZB2A 4AZHA 1PZ2A 1S1PA 1SZEA 4JTRA 1W54A 2ISVA 3I3EA 1JRBA 4ZENA 2KZHA 3EX6A 4R9XA 1FH8A 4K1WA 3K1DA 4HNLA 2H9AA 1TCMA 2TSYA 2EJAA 1LUCA 4PRTA 4B2DA 4XKYA 1YMYA 3E0IA 3CT2A 3BICA 1YKWA 4IMAA 5HUPA 3MTWA 2WMFA 3TYUA 4HYVA 4IPNB 3B8WA 3CYVA 3AMGA 2NVDA 3SUWA 4YMZA 1RVGA 3UG8A 2W3ZA 3SDOA 4X2RA 1FDJA 4C65A 3OHIA 4IG2B 1T0OA 4PGLA 4Z17A 3KS6A 1REQA 4LUIA 1LRTA 1HKVA 1WE5A 4U3CA 1OFRA 2E68A 3CTLA 1HG3A 2X1UA 3GQYA 4FLQA 4PMUA 4IFKB 3GTNA 1A50A 4M56A 4F0MA 2HXTA 4JX4A 3VIGA 3E0LA 3LCIA 3WK2A 1KXHA 1TWZA 3MUIA 3K8MA 3N15A 5FIPA 2E1DA 3VCRA 2QDGA 3DAQA 1OC5A 5CSRA 5LHEA 3GXDA 7CGTA 1G9HA 2ZXBA 1G6CA 2A6LA 4ZB0A 2GJPA 2HTMA 4QLJA 4ZE5A 1DWHM 2C79A 1PYFA 5BXSA 4HJWA 3RPTA 1B5TA 3GC5A 1EJUC 3MSDA 5I3JA 2QV5A 3P6LA 2J7CA 3C2OA 1WKFA 4PMVA 4RW3A 4G7EA 2QJNA 3LPOA 1XGDA 1NF7A 2FHFA 3PJWA 3PUEA 3VKBA 2Q09A 4XAGA 2CEQA 1YXDA 3POHA 1CXLA 2VXNA 3TQPA 3KCJA 3TSBA 3ALFA 3V36A 4PEEA 2PDXA 5A1AA 3ARPA 2BNJA 2F6XA 1QOPA 1HJSA 1BGGA 3B06A 1LT8A 1ECEA 3AJ7A 4JN6A 3N19B 3IARA 3GXFA 4LXFA 3QC0A 1P6WA 3BCFA 2B7NA 1KKRA 2FTYA 3TJIA 4Q22A 4S38A 5AC6A 3WQ4A 3LBCA 1HUVA 4NL1A 4EKJA 2AL1A 3W29A 2NXGA 1R9XA 4S3JA 2G41A 1FCQA 3AXXA 3R1ZA 5HNTA 4A8LA 1F2JA 4LVBA 4LVDA 2WMGA 2YJQA 3GR7A 4QIUA 3T2PA 1JJKA 4JBRA 4INFA 4ZSTA 1R30A 3SJNA 4DO7A 4JGDA 3O8AA 4NG3A 1VFMA 2A5HA 2BB0A 1R38A 3B0UX 1EHAA 1WBHA 3C0LA 1V08A 3IVUA 3QQ1A 1K6AA 5E0KA 4DWSC 1P0DA 5HMFA 5EGRA 1XLJA 4J3UA 1E3ZA 1LQ2A 3GVVA 1XLMA 4CQAA 4QITA 2FMOA 3G5EA 3LHYA 4GQRA 3RG6A 1LOQA 4HHLA 3STEA 2FPYA 3HURA 1TMLA 3SCQA 4WDUA 4WK9A 5AZ0A 3VE7A 3UGVA 4O19A 1AQ0A 4MB1A 3PPHA 4HHHA 3L66A 4ZOBA 1EO5A 1DJWA 1RLDA 3CUGA 4KIEA 1WDDA 2PDQA 1Q6EA 2WJZA 2D0FA 4N6FA 3W7CA 2MNRA 2Y7EA 3CUXA 3AMCA 1QNPA 2HJPA 5BRQA 1CEOA 4PSRA 4Z2IA 1LLWA 3ZJ7A 5I3HA 2XGIA 4V27A 5HXMA 1MW0A 4FMVA 3MBDA 3MVTA 2BXVA 2PTWA 4I8DA 4S3BA 3IAQA 1GYLA 4I7WA 4QDWA 1TRDA 4FLRA 4GI4A 5TNVA 1IGWA 3R5EA 1UWTA 4HK6A 2CC0A 3DX5A 1XP3A 1ZHAA 1ISZA 1AH0A 2WK2A 3DG7A 3DXIA 4RZ6A 3V75A 2JQXA 2E6YA 4F66A 1CLKA 1GVFA 4CNPA 3N11A 4JXCA 2QUVA 1UPMB 1MW1A 2CXGA 3C2RA 4LQ1A 3WQCA 3WH5A 4LU0A 3W28A 2AQVA 3PZNA 3W88A 3AZSA 2ZWYA 2C19A 1XDMA 3A5VA 4EXAA 4CVWA 2EHHA 1D7KA 1UR8A 2HRWA 4O10A 3DEQA 5FF4A 3VTRA 4G1KA 1NVMA 1V0LA 2HS6A 3I7QA 3W24A 4GYPA 1FBAA 1OADA 4BA0A 4WY0B 2FDMA 3CLWA 4IPLA 4BY3A 3T2QA 3W6YA 1XYMA 1R7AA 3RLHA 1UW9A 5U4NA 3P5ZA 2JKAA 1UIOA 4BFAA 1A5OC 2FH8A 2Y2WA 4GG9A 2XH4A 5DXYA 3N2OA 3GY1A 1EXPA 3GAKA 1A4MA 1N8IA 2PWHA 4H83A 2OYMA 4JHOA 4DELA 2QF7A 4PB4A 3AO0A 1XH2A 1H2JA 4K8EA 4NUWA 1O6IA 4QXIA 4ZCWA 5HQEA 1CGUA 3A4WA 3IRSA 3KHJA 1NDWA 2IKHA 5BWAA 3A21A 4GYPC 4HA3A 1GK8A 1ZSXA 4S39A 3GW0A 3PG8A 3VDCA 3NUKA 2VR2A 4N9CA 4ZZ9A 4KWSA 1S5WA 3PY2A 3WK3A 1J01A 4M80A 3T4CA 2Y85A 2DDXA 3QLDA 4K6AA 3ARSA 1EKOA 3B4UA 3T42A 2YCLA 3UPWA 1OT2A 1WQ5A 3GIYA 5BRBA 1LM1A 1ONWA 2Z2BA 4XO7A 1QATA 1LBLA 2ZQ0A 4W5ZA 4FOJA 1OABA 3QMTA 4B91A 1THFD 5KINA 5DBUA 2NT0A 2JEPA 5I0DA 3SFWA 2NX3A 4JY8A 2VRJA 4DLMA 1ODZA 4WDTA 1CW2A 3IUDA 2J74A 4UC5A 1Y8BA 2XFWA 3RX3A 4ATWA 4XAZA 1BWVA 3VDGA 1IT8A 1TTPA 1ISXA 2ATSA 4KRUA 4O1AA 4L6HA 3UR8A 3ZS4A 3SR7A 3TC3A 3OODA 2Y63A 4DYJA 3AHZA 1KFEA 4AMAA 2AL2A 2XDFA 3M7WA 4ZTXA 3WK0A 3KVLA 2BTMA 3DGBA 1JZ4A 3DERA 1B2YA 2V3DA 3G22A 4LV9A 5FA5A 2JALA 3W7DA 1HP5A 2XM2A 3BOFA 3F4DA 2FZDA 4E2OA 2GGGA 1OCQA 1SO5A 3MDWA 1EB3A 1J2BA 5DY2A 3VFCA 5FF3A 5TAOA 3SB0A 1ZS2A 4J3ZA 5EU9A 1XIEA 3V4BA 3QV8A 2J9YA 3LRLA 2RUSA 1P43A 3BTNA 1RCXB 3L4TA 3UG5A 3LX9A 5C8BB 1R3QA 4O4WA 5I79A 2VURA 4L56A 1YNQA 1US2A 1Z32X 3MO7A 2WPBA 3VNJA 3LBMA 3ZJ6A 4WDWA 4RDWA 4AC7C 1L0PA 4Q6XA 3F5JA 3W1RA 1IXOA 5KETA 1EA9C 4NJJA 1KTBA 3QR3A 1WXZA 5AECA 3WMCA 2PD5A 1BF2A 4FS9A 4KMQA 3STCA 2GUYA 2DIEA 3W38A 1Q2RA 1CWYA 1EC8A 2OMAA 1SFSA 2E9BA 4FNSA 3ISIX 1NWSA 2ON3A 3LXAA 5AFDA 3TOPA 4PMXA 1PKLA 1A0DA 1EO7A 3UR7A 3WH7A 1W37A 4D1IA 1PHWA 1YXCA 4HU8A 3R13A 2ISSA 1G7UA 2PMQA 3TQ0A 1E1EA 1DJXA 1XRSA 4D71A 3Q4DA 4REQA 4GHRA 4K37A 4AC1X 1GQJA 1T7LA 1LRQA 2WHKA 3NL3A 1H7PA 3MYOA 5JMUA 4GOAA 2TMDA 3UYCA 2J7DA 4KQNA 4AIBA 4W89A 1AJ0A 3NM3A 4I9AA 5KITA 1CGVA 3L4XA 5FD0A 4FX6M 2HE5A 2NQJA 3AC0A 3LGDA 2VFHA 6ENLA 1PKYA 3VIPA 4GYJA 5HJYA 3W1UA 5LIXX 1CIUA 4OFCA 1GKQA 1XLFA 1F3TA 4OOUA 2WB5A 5J04A 1VIZA 2ESCA 3HQPA 3OIHA 3NG3A 3QV9A 1W17A 5XIMA 4H19A 1ONXA 2OLAA 1OX5A 1HL2A 5A6BA 2FPTA 1W2VA 1UWQA 1MEHA 4MUZA 5TF0A 3NFUA 2W61A 3IAPA 2VTFA 1SSGA 1IV8A 1XUZA 1W1PA 5D4YA 1X6LA 2Y7DA 3IV3A 4WY0F 3DFPA 4AY7A 2R1MA 2PWEA 3OP2A 1FX6A 1BQCA 3KW3A 1SFJA 3VDAA 4AXKA 4DUVA 2J6XA 2QCDB 5BMWA 3LI1A 4TVDA 5KEZA 4Z2KA 3VNKA 1Z89A 2P76A 3CK5A 3ZLHA 3AUOA 1R3VA 1OX6A 3LERA 2FB3A 3K4AA 1J12A 3S2NA 5A8OA 5A8MA 1K8ZA 1M41A 5EKYA 3PUGA 3MO4A 1W1IE 1ITXA 2OYKA 2E6AA 5DCBA 1FWWA 3BGGA 4D8LA 1GEQA 3TN6A 1RHCA 5CZKA 4TXEA 4B90A 3ZR4A 5FEPA 4GH3A 1LDCA 1LWHA 3HMJG 3LN3A 4LUSB