3FKRA

Structure of l-2-keto-3-deoxyarabonate dehydratase complex with pyruvate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
304
structure length
303
Chain Sequence
b'TPRHRGIFPVVPTTFADTGDLDLASQKRAVDFMIDAGSDGLCILANFSEQFAITDDERDVLTRTILEHVAGRVPVIVTTSHYSTQVCAARSLRAQQLGAAMVMAMPPYHGATFRVPEAQIFEFYARVSDAIAIPIMVQDAPASGTALSAPFLARMAREIEQVAYFIETPGAANKLRELIRLGGDAIEGPWDGEEAITLLADLHAGATGAMTGGGFPDGIRPILEAWREGRHDDAYARYQAWLPLINHENRQSGILTAKALMREGGVIASERPRHPMPELHPDTRAELLAIARRLDPLVLRWAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-2-keto-3-deoxyarabonate dehydratase
publication title Structural analysis of L -2-keto-3-deoxyarabonate dehydratase an enzyme involved in an alternative bacterial pathway of L-arabinose metabolism in complex with pyruvate
rcsb
source organism Azospirillum brasilense
molecule tags Lyase
total genus 110
structure length 303
sequence length 304
chains with identical sequence B
ec nomenclature ec 4.2.1.43: 2-dehydro-3-deoxy-L-arabinonate dehydratase.
pdb deposition date 2008-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3fkrA00
3C6CA 2ABAA 3GK0A 2C1HA 1QCWA 2YGYA 1TSIA 3DHDA 1KV8A 1TYGA 3QQ1A 4JIQA 2QJIA 2YZRA 2RHGA 3GDLA 1V7YA 3IIXA 1DL3A 2TMDA 2GVLA 1WOAA 2P10A 1JCYA 3ABQA 1I45A 3UXAA 1TRDA 2VELA 4UFKA 1DJNA 3R2GA 3I7QA 4BFAA 3PUEA 3TH6A 1GVSA 4OWGA 4GFSA 1QNVA 1RQHA 1W37A 3PR2A 1QWGA 4JTHA 3SFKA 1W31A 1I2QA 3NA8A 4Z1CA 3E12A 2Y7GA 1P0NA 3L5AA 1OFEA 4AF0A 2Q3OA 3EWZA 4BWLC 2P1FA 3NQFA 2KZHA 4UIOA 4OBTA 1ALDA 4O8RA 3CT7A 5AYZA 5LNUA 1KLZA 4FIQA 3GVGA 1SPQA 1JCNA 4UUIA 4ONVA 1NAL1 2Q8LA 3PWAA 3C2OA 1HO1A 2ZBTA 5E1QA 4WX2A 4WUIA 2W0UA 3BO9A 1SZNA 2ALDA 5AYXA 5CZJA 4K39A 3VNDA 2OT1A 5ABTA 1KTNA 1OHLA 3DFSA 1IIHA 1W5NA 3W1UA 1WXJA 1W5OA 4FXSA 5FEXA 3M41A 1XXXA 1DKWA 1EWDA 1GT8A 1OX4A 1C9DA 4GUHA 4YWIA 1YLVA 2B7OA 7TIMA 3GNDA 3C4UA 3FJLA 4AHPA 5F2GA 3STCA 3QPYA 1I2OA 4IXXA 1Q45A 4NJIA 3DAQA 3G1XA 4FX6M 3WK0A 2B7NA 3DXIA 4KFNA 1ADOA 5T26A 4O15A 1HFBA 1KM1A 1M7PA 1GVOA 3O63A 3STFA 4E2DA 3MI2A 3PS7A 3TNOA 2H90A 4NVTA 5FEZA 2JGYA 3HGRA 1GEQA 1HO4A 5F1VA 4Z1AA 4UTWA 4FIRA 1DV7A 3P61A 4O16A 3HG2A 1B4KA 3HJZA 1GJPA 1ZY9A 5KZEA 4CNOA 1YDNA 5C54A 3L0NA 4XKYA 3M5VA 2ZRYA 3P81A 5AHEA 3QEZA 2FPYA 2GUUA 3DZ1A 1OFOA 3LCXA 3S5ZA 2NZLA 4WXZA 3DKLA 3GDMA 1MSSA 4N6FA 1DHPA 5CPMA 5G2IA 4N6EA 3KFTA 2ZYFA 4ZQMA 2A5HA 2ZA1A 2J9XA 5EPDA 3KVMA 2GQAA 2Z1BA 3CLMA 5KZDA 1EEPA 1OF8A 1SSGA 3T55A 5G5IA 5AHLA 4K36A 2DORA 4P61A 1G4TA 1YYAA 4XZ9A 3A24A 1D3GA 1FCBA 4TR9A 4Z1BA 2LLEA 4WD0A 5IBXA 4JTIA 3S42A 1LBLA 1XBYA 1BEUA 1K8XA 1ME7A 1LM1A 5AB3A 2TYSA 2ZZ1A 5LNRA 1IXNA 3HGOA 2WSRA 4XUGA 3W2MA 3NPWA 1EPXA 4KFOA 3LI0A 1SU5A 2Z2UA 4O28A 3S1VA 1VR6A 4IMGA 1XUUA 3O05A 2C0AA 1UUMA 5CGQA 4JTKA 3TCEA 2WSQA 3MP4A 4O0KA 1G4EA 3B4UA 1WQ5A 1H61A 3W7HA 2NXIA 4LV9A 3I6RA 4FX8A 1GYLA 4IOTA 1MEWA 3IGUA 1GQNA 4E0CA 2YDAA 1XCFA 1JUBA 4IWWA 1C8VA 4IX0A 3W70A 3USBA 1VLWA 2AQWA 2GPTA 4JX4A 3CPRA 3WK2A 4JTTA 3BG3A 4Q4KA 5I3JA 1O95A 2C3ZA 3NR0A 5AC6A 4XTDA 3S6DA 1OX4B 3W1AA 3FOKA 1RQEA 4GUFA 4MY8A 1K3UA 2HS6A 3PSWA 3BLEA 5CPNA 5LHEA 1O5XA 4DEFA 1VJIA 1CW2A 5HJLA 5U7SA 5E0KA 4NUWA 4K37A 2WV8A 1O60A 4NNBA 2QUUA 2E5CA 3RF9A 4CLMA 1HTIA 3ZWTA 4I7UA 3TW6A 4A2RA 5KZMA 5G1YA 3MI3A 4FB7A 2QKFA 3EX3A 3KAOA 3GKAA 2TPSA 4UNLA 5DXYA 2OMAA 3KRZA 4HIBA 1GYNA 2ZRWA 3TSBA 3O15A 1NF7A 2PCQA 1FWTA 1SW3A 2DJXA 3NAVA 5CPOA 3DFTA 1F2JA 3LLDA 1TPB1 4GRSA 4XKYB 4OV9A 1QDSA 2I9EA 4YL2A 2FFCA 5IM51 2F7FA 2ZZ2A 3IVTA 3GR7A 3N3MA 2GVJA 1L2UA 1OJXA 1LRNA 3L68A 1TPVA 3M5ZA 4JTFA 1YDVA 1AL8A 1DVJA 2QDHA 3NXFA 4NNCA 5D02A 4UTTA 3B05A 8TIMA 1FCUA 3N14A 2G97A 4BK9A 3LXBA 5TIMA 5K9CA 3GX9A 4Y96A 1RV8A 3QSTA 5A5WA 4RLIA 4YMZA 3M16A 4O54A 3DHFA 4DXVA 1ZNNA 2HS8A 4NT0A 4ADTA 3C56A 1TV8A 4ZQOA 1KBJA 4FNSA 1OF6A 5BNKA 5C5YA 2A1YA 2YSWA 2E6DA 3EB2A 1KFKA 2CFFA 3P8IA 4R33A 1A5BA 1LBMA 1YDOA 1KBIA 2DZXA 1BWKA 3FS2A 3CIXA 3NQ6A 1ZALA 1QPRA 3R89A 3G3DA 2VEIA 3TQKA 2PRLA 1HL2A 4NU7A 1EP2A 4O1DA 3S8HA 3P80A 3UWVA 1MEIA 1KM6A 4UC5A 3TV8A 1MEHA 2Q3RA 2QCLA 1UUOA 1YXDA 1AW5A 1EA0A 1LCOA 3W7QA 1NVMA 3C2EA 2F84A 5BMXA 3W7JA 1AW2A 4PC8A 3RNDA 3LTSA 2E68A 4JTGA 1A53A 3U8GA 1XL9A 2O7SA 1VQTA 3UYCA 5AHMA 3LHYA 1S5WA 5DY3A 4O4VA 4C1LA 1P1XA 5I3KA 4IX2A 6TIMA 4PA8A 1TTQA 3S1UA 4D2JA 3W7EA 2DJLA 4OQVA 5AN7A 3RLUA 1QPQA 3KVLA 4KFPA 1SW7A 3W7OA 1H7PA 3MP5A 2B7QA 5DELA 3M47A 5J5DA 5LKYA 3QYQA 2WNZA 2ABBA 5L9FA 3N73A 3P62A 1B57A 3G1DA 3RLVA 1FDYA 5CZTA 4NX0A 4CQAA 3MBDA 3W86A 1YPFA 5HNRA 3BV4A 3G1AA 3P8JA 3C3NA 2NXHA 4PODA 3G24A 2RH9A 4S1FA 3IIVA 2J6XA 3TK7A 3G3MA 4JS3A 5CZ0A 1T99A 1IXPA 4UMCA 4O13A 4POCA 5EKYA 4G1KA 3NQ8A 1YTEA 4AEOA 3ABSA 4K7VA 3B04A 1O4UA 2J9YA 1GG0A 4AB4A 2WSYA 3NQMA 4K7YA 2VC6A 1JULA 2G96A 4O14A 2TSYA 1R46A 1W3IA 5CSSA 3LXCA 3TQVA 4QNEA 1I4NA 4TU1A 3IGXA 3T40A 3NZ1A 4K38A 3S1WA 4NJKA 4ZVJA 4RK8A 3HBLA 3FLUA 2CLMA 3U6WA 3R8RA 4QQ3A 3W1PA 2D73A 5FF0A 1A5SA 1Q6RA 4GBUA 3DFNA 3GXTA 5EMUA 4CCDA 3TKFA 1S5TA 2QCCA 4YLWA 4GUJA 4M5PA 4IMCA 4UFLA 1L6YA 3EXSA 1JR1A 5K4ZA 1VCGA 5AHFA 2ZZ5A 4MJMA 1JVNA 5CPLA 1X1OA 2A7RA 3PULA 1DORA 5G4EA 1LP6A 3FKKA 1SO6A 1VHNA 1YXYA 2V8ZA 5LGXA 4AH7A 5AHNA 3RMJA 1ICPA 2RKXA 1HUVA 3GR8A 4QISA 3WJZA 4CNPA 3QMSA 2YFOA 1QO2A 3F4NA 4O12A 3L2IA 4FF7A 1TRIA 5K9XA 5H2ZA 1KA9F 3NQ2A 1H50A 3R5EA 3IIPA 5D30A 5DBUA 1H7OA 4UTJA 4CQ8A 1L6SA 2CZEA 2CW6A 4BWLA 2GQ8A 2EF9A 4I7VA 4CNNA 5D2TA 2C18A 1VCVA 2Y63A 5G4WA 1GWJA 4HT3A 3GAKA 4WY0B 5L6UA 2V2DA 1XBVA 1IF2A 2EKCA 4Z08A 4CQ9A 3TFCA 1KLYA 4UFIA 1H1ZA 5DLCA 1TO3A 2OX1A 3N9SA 1KFLA 4ADUA 5KTLA 1JJKA 1NFBA 1O94A 2WJZA 2QJGA 3FYOA 3LGEA 2VEKA 3VE9A 4N9EA 4JDBA 2Y89A 2QAPA 3ANYA 4N9DA 1SZGA 1QPOA 5HR6A 2J27A 3GDKA 1G67A 1OVDA 5AC8A 5DCEA 2C13A 4JTUA 4R53A 3P7YA 1LRTA 4LVBA 2DU2A 1LORA 4NNAA 1JQXA 1SSDA 4AHOA 3T4CA 3HO8A 2ZRZA 3W9ZA 1KFEA 3W1TA 3PF3A 2DP3A 3BW3A 4ZMGA 4O11A 1C29A 3M6YA 4LU0A 4WY0F 1VZWA 2OT0A 3FKRA 2A6LA 5H91A 3NQGA 3TDFA 1PCWA 2BSLA 1IGSA 4IQLA 1NEYA 3SECA 3TR2A 1THFD 5K7JA 4FNQA 3W85A 1FCQA 4IJBA 5I3HA 5AYYA 2RDWA 1Y0EA 2XN0A 1OFPA 4M6PA 4RZ6A 3UWQA 3WJSA 3F4WA 4BR1A 1WX0A 1W5PA 4R7JA 5D33A 1U83A 4JTLA 2YFNA 1P0KA 3Q94A 2V82A 5SWUA 4MZ1A 5FESA 3L21A 2CLIA 3PSVA 3CM4A 3M9YA 4NXKA 1K7FA 1F6KA 2ZA2A 3LRLA 3W87A 4FO4A 3E96A 5K4XA 3NM3A 4O10A 4JY9A 1QPNA 3B8DA 3V75A 4O52A 3WFAA 3MHGA 3P74A 2JKAA 3C2RA 3CHVA 3KRUA 3WK1A 5LHFA 5D2YA 5CSRA 2E09A 2X16A 5HWNA 3M43A 3MBFA 1YPIA 1LOSA 1D3HA 2HTMA 4MIMA 1X8FA 3G1VA 1FDJA 4IPJA 3TJXA 4MYAA 1EB3A 2FPTA 2H3BA 2JKEA 3GB6A 3PBYA 2G95A 5DXXA 2V9DA 3LHWA 2NX1A 1VHCA 2QCEA 3NDOA 4N9CA 3IGSA 3QC3A 1XC4A 1QR7A 2AGKA 4HNUA 4M6QA 3NO5A 1SO4A 3KVKA 4IMFA 1Z41A 3O6CA 2CU0A 1CI1A 4DBEA 1SZFA 1XDMA 4LRSA 3CB8A 2JGQA 4IUOA 3O07A 4N4PA 3IIZA 5FEWA 4MZYA 1CX9A 2NUXA 3PBWA 3UD6A 1LLZA 3A23A 3L65A 1Z44A 3VCRA 2FB3A 1VCFA 1H7NA 2YXGA 3UWWA 3LV6A 5D05A 4WZHA 1FWRA 1G4SA 1VH7A 4GXMA 4RXFA 1GVFA 3INPA 5C6MA 2A4AA 4JYEA 5DY2A 4RZ5A 2CWNA 1RD5A 3TSDA 4UXDA 3EKLA 1ZCOA 5LSMA 4Z0JA 4A3UA 4N4QA 4O4WA 3EX2A 5K2ZA 1OFQA 4H3DA 5LGZA 3CWNA 4OV4A 1RPXA 1RVGA 3FEMA 4EOUA 3B0VC 3LOTA 4UNKA 1SR9A 1TCDA 4Q33A 3TXVA 4TO8A 4XQ6A 3W84A 5DCBA 4LVGA 2NXGA 2NLIA 3E49A 3G1SA 3W7IA 2HSAA 4AF0B 3N19B 4RJEA 3NL5A 3UZ5A 1R47A 1I8JA 3W22A 3UNDA 3UPWA 2FQIA 4WQ6A 2QUTA 3HOJA 3OVPA 5F4XA 2VEPA 1AK5A 2NX3A 2E6FA 2ATSA 4O19A 3LHUA 3W1LA 1OFAA 4N02A 3NPUA 3KRSA 1TREA 3DGRA 1KTBA 2ISVA 4TMCA 3PVFA 1LDCA 1TJRA 4HPXA 2A21A 4HSNA 2NX9A 2X1TA 1JUKA 4DF1A 1OABA 3T7VA 3LI1A 3TXZA 1PV8A 4UMBA 2ZQ0A 4LS2A 1TPFA 5F4SA 3W2UA 3BLIA 1K8YA 1VRDA 4GJ1A 4LTSA 3W3OA 1DQWA 4PL2A 3E0IA 4EVZA 5HQEA 4Z0SA 4ICNA 3LDVA 1SFLA 5CZSA 2A7PA 2Y88A 4MKNA 5BRBA 1MXSA 4Y90A 2ZRVA 5HULA 1EWEA 3I7RA 3SIZA 2ZZ3A 3DFOA 1AMKA 4NJGA 3SI9A 1FUYA 2H3DA 3LTPA 4NQ1A 3IRDA 4QNWA 4DQWA 4MJZA 1LBFA 4YCPA 5C2XA 1T96A 4KWVA 3S5OA 1S3HA 1TQJA 3LBMA 4K8EA 1KM0A 5D2WA 3G1YA 2W6RA 3QRHA 1W0MA 4O57A 1UCWA 4GWEA 5HWJA 1VLIA 1TJPA 1A5CA 4JY8A 4UMAA 1WYIA 4JYFA 4M19A 1H63A 2Y62A 2YW3A 3HF3A 3L67A 4Y8FA 3TQ0A 2R14A 4E38A 3SSJA 1EX5A 3JR2A 3NQAA 3LCHA 4DF0A 2XN2A 4OHQA 3P5YA 2V5BA 4U28A 1LYXA 3TROA 5D37A 4NJJA 3TMLA 4KWWA 3IEBA 5FF7A 4YCOA 1K02A 2E77A 2EGZA 4LY8A 4DO5A 3NNTA 4LWWA 2BZNA 3LRKA 4P2VA 3IIOA 2CLKA 1ICSA 1K7XA 3SGUA 3Q58A 3W1QA 4S2CA 1YADA 4MYXA 2QR6A 1N7KA 1QFEA 4UR8A 5AOUA 3U2OA 2DZPA 3SZ8A 4HNVA 1F76A 4X22A 1SO3A 1IXOA 1JRBA 3OG3A 3QMTA 4W9TA 2Y7FA 3QPZA 1OFBA 2ISSA 2CLFA 2GOUA 1X1ZA 1N8FA 3D0CA 1KV5A 2QCHA 4ML9A 4N2YA 1TPC1 1K7EA 4AXKA 1W5QA 3W7MA 1WDWA 3RK8A 1OK6A 3ZFHA 3LERA 5LNWA 4OGZA 3DH7A 2WKJA 1AL7A 3C2FA 2FDSA 3G22A 1R2RA 3R12A 5EA9A 4AAJA 1WAUA 2R8WA 1XBXA 2NUYA 1JQVA 4Y9AA 5G1TA 2CZFA 3DKJA 1W54A 3AO0A 2ZTKA 3N2XA 1LRQA 3EX1A 2IQTA 4O1AA 4JIPA 3QF0A 2A6NA 3CU2A 1JCJA 3SJ3A 2J88A 4LC8A 3W2LA 4LS0A 4A22A 4LW7A 4AWUA 5BOOA 1LZOA 2CLOA 1GTHA 2VFHA 2Y70A 2RFGA 4M7SA 3LV5A 4JD4A 3E9AA 2C14A 4WXYA 3W7DA 1QO5A 1TPH1 3SR7A 2EPHA 2OCZA 2QCDA 3NYZA 3UY7A 4RKAA 1MZHA 1TTJA 1E51A 2FJKA 4LVFA 4UTIA 1PE1A 4UTLA 2CLHA 4RX0A 3S9YA 2I1OA 2I14A 1H62A 2VKZG 3Q2DA 4JYDA 1L6WA 1XM3A 3G1HA 4LUIA 1W3NA 1GVQA 3FA5A 4MPQA 3BVJA 3WJXA 1LTDA 2V2HA 3H55A 4FNUA 2Z6IA 4JX5A 3TAOA 1LOLA 4ZQCA 1FWWA 3ZWSA 4N9BA 4O18A 1QAPA 2QF7A 4KKXA 2ZZ6A 3LCGA 3W1RA 1KFBA 1NF0A 2Y7DA 1GPWA 1TPDA 5FF2A 1JCXA 1G7UA 3DBPA 3BG9A 2Y85A 1XUZA 2X1SA 1T0OA 4HHPA 3A21A 3S1XA 3OHIA 4JTJA 4UTKA 1BKSA 3V1PA 2RDTA 3W83A 5EL1A 2ISWA 4FNTA 2C15A 4LT9A 4FNRA 3G8RA 4HKPA 1YTKA 3UWUA 4ADSA 3IV3A 2CZ5A 1S5VA 2ZZ7A 2YPIA 1XKYA 2OZ0A 1OK4A 4WJEA 1K8ZA 3HIJA 2QUVA 2X2GA 1HG3A 3NVTA 1VGAA 5KITA 1JUEA 2A0NA 3HG5A 1V5XA 1KFJA 1SW0A 1PL9A 3L66A 3T78A 5I3FA 1SO5A 3WJWA 1FDZA 3PB0A 4LVDA 3EXTA 1TIMA 4UFJA 3PB2A 4EF9A 3HMJG 1I2PA 4DO4A 1H7WA 4DELA 1W3TA 2JBMA 2X30A 5KINA 4RCXA 4HNTA 1ICQA 1TV5A 3B06A 1LROA 3CIWA 5F2LA 1SZEA 3LCIA 5D2XA 4A29A 4IMEA 1TPUA 1WBHA 3LXAA 4AWTA 3C52A 4IXHA 3G0XA 4FHAA 1EUAA 4X2RA 3GKFA 5FI8A 2CLEA 3GZ3A 2R94A 3LHZA 3M1ZA 1PHQA 3UWZA 1B3OA 5AHIA 4LRTA 3W71A 3A22A 1NSJA 1PHWA 1VPXA 3C2VA 2UV8G 3OBKA 1Q6OA 2ZTJA 2A7NA 5KMYA 5CG7A 3TAKA 3OIXA 4L4LA 5F2MA 5EYWA 3QFEA 2DZWA 3OVRA 4XBSA 1ZFJA 5HMSA 5FEPA 1SQ7A 3DFQA 5AC7A 4UTMA 5A8GA 3O06A 1R2TA 1XI3A 2OJPA 1DJQA 3ABRA 3VKJA 1H1YA 3A9IA 3WK3A 1J2WA 1H5YA 3W72A 3BW4A 2QCDB 1PVNA 1W1ZA 3PG8A 1KM4A 1W56A 1WV2A 1KM2A 3BLFA 3LX9A 1G69A 1OX6A 2YYTA 4AMAA 3BW2A 1UB3A 2VFEA 1SFJA 2CLLA 1Z42A 5F4WA 4R34A 1IIGA 4BI6A 2C16A 3EWYA 3NPVA 4DPPA 4UFHA 2YR1A 4DO6A 5G2WA 2FPVA 2W79A 1VYRA 4JGDA 2WNQA 1KFCA 4A2SA 2NV2A 4H4IA 2YW4A 4MZ8A 4JXCA 1MO0A 4X3ZA 3UZJA 2JK2A 3W75A 3MHFA 1R2SA 2RDUA 5HUPA 3BGJA 3NOEA 4OE7A 3TUUA 3MO7A 1X6UA 3MI6A 3TA6A 3UXDA 4QSHA 5LZLA 2O7QA 3BGGA 3OA3A 2YCEA 3C8FA 3EEGA 4S2BA 4U4MA 4JTSA 3DU0A 3FJ6A 1UBSA 3OVQA 3IVUA 4RR4A 4GE8A 2XN1A 2VOMA 4LVAA 4QAIA 5I3GA 1F5ZA 3HG3A 5E93A 3TX9A 1F6PA 2ZRUA 3HGJA 1QOPA 2BX7A 3GLCA 5HUOA 3MJYA 3O16A 3LCFA 1XBZA 3NG3A 3CEPA 2VXNA 3FIGA 4CCCA 1FQ0A 1JRCA 3UY8A 4ZZ9A 1FBAA 1ZAHA 4ALDA 3W07A 3O6DA 3T44A 3W88A 4JX6A 3O1NA 1Q3NA 3LBCA 3W7GA 3DI1A 4O1BA 4LC6A 2WNNA 3HPSA 4JN6A 2ATMA 3RU6A 1M6JA 1X7FA 3GNNA 4A21A 4JNMA 3PAJA 4QIUA 3S5NA 5DN1A 1FY6A 3NPXA 5D09A 1QOQA 5I3IA 4EF8A 3EWUA 3WJYA 4LV4A 2ZFAA 3MWAA 2R91A 3JS3A 3UQNA 4GUIA 4AHQA 1U5JA 5TBOA 2H8XA 4PH6A 3W1XA 4IPIA 5C55A 1FXPA 1BWLA 5K3VA 3N9RA 4WOQA 3YPIA 3G8EA 3MMTA 3TIMA 4Y6GA 2DZSA 1DOSA 2V30A 3N2MA 1B9BA 2J9ZA 5HR7A 3BPWA 3QQ0A 4MY1A 1F05A 1TTIA 3G0UA 4I7WA 2VFFA 4PL1A 4XWUA 3ELFA 5J5RA 1J5TA 1BTMA 3LHTA 5K9DA 2YX0A 2FIQA 3DI0A 1EUNA 3HQ1A 4O0ZA 4DF2A 1WA3A 4LS1A 4GNJA 3TC6A 3UWYA 2NUWA 4MFEA 2Y61A 2Z0IA 2QAFA 3FYPA 4GC4A 4MY9A 4PEKA 1KM3A 3EX4A 4ORIA 1F74A 3HPXA 4BI5A 2TRSA 3CTLA 4OU1A 3L9CA 3QM3A 3DENA 2QDGA 4UTWC 3PUDA 4BF9A 4J9JA 1FX6A 1TTPA 3TW7A 3KX6A 3H53A 2QCNA 3HGSA 3P5ZA 3EX6A 2FTPA 2B7PA 1OG0A 1M7OA 3TSMA 4RXGA 1VYSX 3AJXA 1I2NA 4IMDA 4MLRA 1L9WA 3VFLA 4CCEA 2GQ9A 4JDYA 3MHUA 1D9EA 3CEUA 3KOFA 3NQVA 3CQ0A 3LCLA 3PG9A 3HPZA 5HINA 1ZAJA 4K8HA 1AW1A 3PY2A 2PRHA 2HMCA 2WOQA 3QW4B 3S5YA 4FXRA 4GUGA 1EP3A 4FNPA 5KSWA 1I2RA 3QW3A 4FEZA 3NM1A 1G7VA 1PCKA 1TV7A 2DZTA 1ME8A 2Y7EA 4MVAA 5BMWA 4HN4A 1TB3A 3P60A 5IBXC 1EP1A 2X1RA 2E5DA 3P84A 3GIYA 3W74A 3M5XA 1KW1A 4EIVA 4NZFA 3GDTA 2PURA 2BTMA 2BLEA 2Z6JA 2H8ZA 3TC7A 2ZRXA 3PBVA 1ONRA 4UTUA 2C19A 2QCMA 1OYBA 4O17A 2VFDA 3E02A 3NL6A 2NWRA 2A85A 3F1QA 2FB2A 1LLWA 4DBDA 5U4NA 3ATZA 3LLFA 1G4PA 1OX5A 3GXPA 2VFGA 4NJHA 3M0ZA 4B5NA 3M7WA 1TPWA 3LCWA 4PTNA 3NL3A 3EKZA 3IVSA 1IXQA 2V5LA 2NV1A 2BWGA 3KXQA 4L4MA 4PFMA 3L5MA 2P0OA 1AG1O 2WQPA 5AFDA 1XDLA 1EIXA 3SY5A 3MYPA 3W76A 3TFXA 3N34A 1TQXA 5HWMA 1SUXA 4MLJA 1RQBA 3DFPA 3W7NA 3TMQA 1Q6LA 1PS9A 1PIIA 2ZDRA 4JR5A 1FXQA 1ZAIA 3M5YA 1K03A 2DZUA 4ORMA 1N55A 1UASA 3GDRA 1W8SA 5LNVA 1F7BA 4M7TA 1TPEA 4E2BA 2XFWA 1G6CA 2A2IA 4MUZA 2ZA3A 1OFDA 3L0GA 3F03K 4TIMA 1H51A 3W1MA 2B4GA 3R13A 3M44A 1ML1A 3CC1A 5EBUA 5D2VA 5TQLA 3QSRA 4X9SA 4NXSA 4RZ4A 2Y6ZA 1J4EA 1GTEA 3THQA 3VI2A 3L5LA 3STGA 3H54A 4XTIA 4O1CA 3BARA 3THAA 3S0CA 3OEXA 1VYPX 2GJNA 3NQEA 2FLIA 2JKPA 1P5BA 4AWSA 3GXNA 3QMRA 3STEA 3HG4A 2J24A 3ATYA 5GVJA 3FFSA 3I68A 2WO5A 4WOZA 4WY0A 3NEVA 3W23A 1H60A 5CKSA 1OYAA 3O6YX 4O50A 2NWSA 3B0PA 3W7RA 4HNNA 5MHBA 2VENA 2Q8ZA 3B03A 3PBUA 2E5BA 4UTTC 3W7PA 1FWSA 2AAMA 2B0MA 3GYEA 3MP3A 1FCVA 4NX5A 4JICA 4IGHA 4O53A 4UFMA 2X1UA 4LNYA 3W6YA 3G0SA 1F73A 3LHVA 4LUJA 2V2CA 4XBKA 2G5WA 2EHHA 4ZQPA 3NQ7A 3ZR4A 3ZS4A 1RR2A 4PCFA 1UJPA 2PE4A 1M5WA 3MUXA 3LTYA 5EY5A 3ABOA 4MFDA 5BW6A 3LM7A 1ZJIA 1T8XA 3JRKA 2GVGA 4ZQRA 3I65A 4DPQA 3PUOA 2QJHA 2YYUA 3LB0A 3G1FA 4ZL1A 3W2JA 1XFBA 5DBTA 4TMBA 3EWBX 1Q6QA 1JCLA 4NZJA 1P4CA 5D32A 3EWXA 1GG1A 3C61A 4K6AA 3W2KA 1ZENA 5DCDA 4H6KA 4TX9A 2E6AA 2ZCGA 4UR7A 2PRMA 3BK0A 1VS1A 6ALDA 4HSOA 4UTHA 4LOCA 3SW6A 1YTDA 3UPBA 3VE7A 1JCMP 1A50A 2C6QA 1H7RA 1A5AA 1OFRA 3TJLA 1DQXA 3MYOA 3L0KA 4HPJA 1KM5A 2E6YA 1Z48A 4FX7A 5F2IA 3B0UX 1ZHAA 1H7XA 1O5KA 1WBJA 2DZVA 1R30A 2QCGA 2QCFA 3QZEA 3KHJA 1B4EA 4Q32A 3O8AA 3P82A 3EWWA 3SGZA 3LRMA 4Z1DA 3PM6A 3I7SA 3CWOX 1GZGA 3HB9A 2PC4A 4JEQA 4MOZA 2CZDA 4QM1A 3C0JA 1YXCA 3A5FA 4OT7A 3W7LA 5G2HA 2H6RA 2GJLA 4QITA 5FF3A 3TU9A 3GAYA 2WPBA 2EAWA 3NZRA 1FWNA 1W5MA 2BXVA 3TE9A 4RV8A 4EWND 3W2NA 4BI7A 4JTEA 2VEMA 3PC0A 3W7KA 3RFAA 1LOQA 1DBTA 4ZQNA 4I9AA 2V81A 4AVFA 2VFIA 3Q37A 1QMLA 3QH2A 4YXGA 1RZMA 3W73A 3NQDA 5F1UA 1KTCA 4QJ1A 3A5VA 4C1KA 3BG5A 1TMHA 2ZZ4A 3NGJA 2QEZA 1GVRA 3KVJA 3K30A 3W1NA 1OYCA 3MW7A 5D38A 5FF4A 3P67A 3G18A 3QJAA 5D03A 5LNSA 3W7CA 1VC4A 1WOBA 4UCGA 1ME9A 1GOXA 5D04C 2E1DA 2V0TA 3NL2A 3NQCA 4M6VA 3EXRA
chains in the Genus database with same CATH superfamily
1HL8A 2ABAA 3GK0A 1QCWA 3GDBA 2QVHA 2YGYA 2QUMA 3U48A 1KV8A 3QTGA 4IG2B 2EQDA 2QJIA 2RHGA 5FAGA 1G9HA 4I5XA 3ABXA 4HSHA 4Y9PA 1WOAA 2P10A 3S5SA 1I45A 1DJNA 4GHRA 3I7QA 3Q45A 4BFAA 4DYEA 3BQ6A 3TH6A 3H2MA 4JFVA 4PE8A 4H1ZA 1ZUAX 4C6LA 1W37A 1QWGA 1I2QA 1SVDA 3E12A 2PDWA 1Q6EA 1OFEA 4AF0A 5DQPA 2Q3OA 3GXFA 3WBXA 3PN8A 3EWZA 3H24A 1KGXA 4H41A 4MB3A 1T41A 2VJXA 1UP0A 3W0KA 1UD3A 1KLZA 4NILA 2EG6A 1S2CA 4UUIA 3SCOA 1RK6A 4X0VA 2PDPA 1WCGA 3VNDA 5ABTA 1AA1B 1KTNA 3W81A 3GBEA 4F48A 1IIHA 1XLFA 4YVPA 5FEXA 1DKWA 1UYQA 2J7GA 4JFUA 1V6WA 1YLVA 3JVAA 4GK8A 3FJLA 5CBBA 3M0KA 4IFRA 2IPFA 4NG3A 5HOSA 1I2OA 1KRMA 3M0IA 3O0FA 1JDDA 1KD0A 4G56A 2R1PA 1PDYA 5T26A 1M7PA 1GVOA 2RDXA 3STFA 1VFTA 3H7VA 5LA1A 2HRWA 1HO4A 2DV0A 5A6SA 3UT0A 3VD7A 2WMHA 1BKHA 3HG2A 1HKIA 1PSCA 3HJZA 2YCKX 3RPTA 5CQ1A 4L9ZA 1YDNA 4QSFA 4JNZA 4LGXA 3AMKA 3S5ZA 3CZGA 1EJXC 4WXZA 2GK1A 2OXNA 3DKLA 1AH4A 2GDUA 3QLDA 4N6EA 4ZQMA 2A5HA 2VHLA 4F2BA 4OBRA 5EPDA 4OBSA 5CG0A 1FOBA 3CLMA 3I6EA 4AVOA 2J75A 1EIBA 3T55A 5G5IA 4H7ZA 2CEQA 1KC7A 4LALA 2XZ9A 3F2DA 3LD5A 4EKJA 1JPIA 2L5HA 2KX9A 2G50A 3N2CA 1FCBA 5H1WA 4WD0A 4P5UA 5IBXA 4A3YA 4JTIA 3S42A 1BEUA 1F61A 1I6NA 2TYSA 3DOPA 1E56A 3HGOA 4XUGA 3DYMA 4CNUA 4ZE5A 3UG5A 1OCQA 4DWSB 4OECA 1SU5A 2VOTA 1W1PA 1CXHA 4JL1A 2F38A 2XGBA 3MMUA 1B3WA 1G4EA 2QNEA 2XWDA 4AD4A 2HJPA 3B97A 4O1EA 4AC1X 1GYLA 1MEWA 4WGHA 4E0CA 1XCFA 1BTCA 3UESA 1C8VA 3EDJA 2AQWA 2GPTA 4PCNA 3A12A 4JTTA 4DLMA 2C3ZA 3TLLA 3JW7A 4IL0A 2ISDA 1AQ0A 1W91A 1XIJA 1OX4B 3I3BA 1EBGA 2WZMA 3LA4A 1L2QA 4GUFA 1W1TA 4AIOA 4MWAB 4DEFA 4V27A 3ZLFA 1FWAC 3VIFA 5B80A 2WV8A 1F3WA 1NJJA 2QUUA 1IGWA 1AJZA 4XISA 1SFSA 1PX4A 4FB7A 4C6IA 2QKFA 1YBQB 3GKAA 1CGWA 4Q7IA 1XF0A 3N6JA 2FMOA 5DXYA 2OMAA 1GYNA 1XR2A 3RM8A 3POCA 5GJMA 1SW3A 3MJMA 1V6VA 3DFTA 3DGBA 3EA3A 4GRSA 1RUSA 3VDBA 4KRZA 1QDSA 3CV6A 2I9EA 2OEJA 5IM51 2ZZ2A 5B7ZA 3GR7A 2CZVA 1L2UA 1OJXA 1LRNA 3M5ZA 4JTFA 1YDVA 1AL8A 1DVJA 2QDHA 3NXFA 4NNCA 4W86A 3B05A 5D4YA 1LG1A 3MKCA 3N14A 3NUKA 5A1AA 4HP5A 1E1CA 1GYMA 4BK9A 1Q6GA 3BICA 4NHVA 3GX9A 3VTRA 4RLIA 4YMZA 4ADTA 4CVUA 2GJXB 4D6JA 1OF6A 5BNKA 1RD6A 2YSWA 2E6DA 4YVVA 3AC0A 3TJIA 2CFFA 3P8IA 1D7FA 4AD5A 1ZPTA 3GIPA 1US0A 1NFPA 3GHRA 2AOSA 5KETA 4P7NA 1QPRA 1EQPA 2VEIA 3G77A 2PRLA 4WKHA 1Q66A 1V0LA 4KIRA 4NU7A 4O1DA 3EMZA 3UWVA 1R3TA 4UC5A 3AU6A 2IKGA 1IEWA 1NVMA 5BMXA 3RX3A 2GWNA 4PC8A 4WSKA 3RNDA 3FGCA 1VF8A 1HKVA 1ZP3A 2G3NA 1CNVA 4XD6A 3UYCA 4X0NA 3LHYA 1UD6A 2YCLB 4O4VA 4C1LA 5I3KA 6TIMA 3W38A 1TTQA 3S1UA 3ARUA 1M68A 2CKRA 2DJLA 4OQVA 1TWIA 3N13A 3WF4A 2ZKMX 1SW7A 2YBUA 3TTOA 1H7PA 3CK5A 2PDBA 3MP5A 2BHYA 2ZUVA 2G3JA 1PZ0A 1HGYA 1XLCA 4ZXLA 5J5DA 4XZWA 1O6IA 4Z17A 1R8LA 2ABBA 5L9FA 2Y1HA 3BCDA 3N73A 1B57A 4ACZA 3F5KA 3RLVA 1FDYA 1PKNA 2OGJA 1GW9A 2C0HA 5CZTA 3QR0A 4KIEA 1V6XA 4QS6A 1YPFA 1DP0A 5HNRA 1OEPA 3C3NA 1IR2A 1MVYA 2NXHA 4PODA 4DJDC 2RH9A 3EWCA 1XCXA 2WLYA 1M41A 4JS3A 1T99A 2VI0A 4UMCA 4O13A 2A3AA 2J13A 1ZSXA 1YTEA 1KBKA 1MDRA 3B04A 2J9YA 3L4UA 4AB4A 4K7YA 4H9MA 4B4HA 1MXGA 1A80A 1NQKA 4O14A 1XH0A 3IK2A 1PKMA 2XM1A 2DIKA 1CECA 2XWEA 1I4NA 4TU1A 4UOQA 3KCOA 3SCVA 1KXQA 3IGXA 3TYAA 4K38A 1WAWA 1J8VA 4Y9NA 4AIEA 4B4FA 4RK8A 1RCOB 1XLGA 1FHLA 1VP5A 1NY1A 2AGTA 2DSZA 3MSDA 3KLLA 5CPTA 3GXTA 5EMUA 3TKFA 1V7AA 5JXQA 4QE4A 3EWDA 4GI8A 5K4ZA 1VCGA 3EAUA 4JQ2A 5FJUA 3VX1A 1X1OA 3WF2A 1EZWA 2WHMA 3NO3A 5A94A 1UWQA 1QHOA 2W62A 1TX0A 1QI3A 3HV9A 1QO2A 4O12A 3L2IA 1VFHA 5HBFA 1TRIA 4ROPA 2V6AA 5MKGB 5K9XA 3NQ2A 4KESA 1W1IE 4V2XA 3RCNA 3RDKA 3GR4A 4H19A 1L6SA 1NWUA 2EJAA 2GQ8A 2INZA 1K1DA 5D2TA 5JBEA 1IT0A 3GAKA 4Z2HA 2BOFX 1XBVA 4QLKA 1RVKA 3VGFA 2OSWA 3WUGA 3KLKA 4CQ9A 5ENLA 4UFIA 4QG8A 1VB9A 1EGMA 3G6LA 4AY1A 4ADUA 1A4LA 5KTLA 1NFBA 3SIMA 4C6NA 4LSBA 2WJZA 1E71M 2QJGA 3NEHA 2YA2A 3LGEA 1I0DA 1PBGA 4Q7BA 2Y89A 2QAPA 3AMCA 1KKRA 1JYVA 2VDIA 4M6UA 4NZ3A 3UG8A 2J27A 1OVDA 3PPGA 4R53A 3MKKA 3P7YA 2E9MA 2VZOA 3MDWA 1ZLPA 4NNAA 1OGSA 1SSDA 5C9ZA 4Q8MA 3HO8A 4AD3A 2PWEA 4U10A 4K1GA 2ZRZA 1TWZA 3WDIA 1WZKA 1XSJA 3W1TA 3PF3A 3VX0A 3WBWA 3WD4A 4ZMGA 2PTXA 8A3HA 4LX4A 1C29A 3M6YA 1R5YA 3LPOA 4W5UA 1AMYA 2ADAA 2A6LA 3DBNA 3NQGA 3KBJA 1G1YA 1JYNA 3SECA 1THFD 5K7JA 3FJ4A 3W85A 1AH3A 1AUSL 3QGAC 5AYYA 2QJNA 4A3HA 4RZ6A 5KEZA 1PB0A 4HU0A 3BAYA 4TXEA 3WJSA 3F4WA 1W5PA 2WW5A 2CPUA 3N18A 3TYUA 1O5RA 3G6MA 1U83A 4JTLA 3WLPA 3CAWA 2V82A 5SWUA 4J40A 2FH8A 2RGMA 4MZ1A 2XFYA 2Y24A 3GWQA 3RYSA 2HDJA 4J3SA 3CUGA 1E40A 3CM4A 3M9YA 4TTGA 1F6KA 3W87A 5K4XA 5D9MA 2O56A 4V28A 2JKAA 1TZ9A 3WF1A 1H4PA 4RDZA 4CD4A 5HWNA 3MBFA 5DFAA 2HTMA 4WJXA 1X8FA 1GEHA 1FDJA 2QV5A 3QR3A 2FPTA 4NI3A 3JZUA 3PBYA 4F9DA 2G95A 2NX1A 2O4MA 2WZIA 4PMVA 4XSMA 2QCEA 3NDOA 3MUCA 4AEFA 1J0HA 2XIBA 1XC4A 1ZBWA 1QR7A 1UZ1A 5I09A 4DM1A 2AGKA 2EPOA 1ISVA 1BVWA 2Z25A 3UZZA 3KVKA 1XLHA 2WM1A 1OCNA 2CU0A 2OWCA 4DUWA 4DWDA 2JGQA 2WNWA 4Q8QA 4JIIX 1S5MA 1V77A 3EDKA 1CX9A 2NUXA 3SQSA 1M1BA 2G8ZA 3V0SA 1LLZA 2O9RA 3UVAA 3B3DA 3LZ3A 3UWWA 2A3CA 5D05A 4DUVA 1VH7A 4GXMA 3BLPX 4XAZA 3GXIA 2POTA 5C6MA 2I5GA 3QV9A 1E6NA 4AX7A 3O9NA 2CBUA 4S3DA 3S83A 4J2MA 4A3UA 5A6LA 5K2ZA 4J35A 4JPGA 4J3WA 4HMCA 3NGFA 1RPXA 3B0VC 1TV3A 1TG7A 1TCDA 2UY5A 2G4JA 4JNYA 2DT3A 4TO8A 3SJNA 3L4TA 4LVGA 4QFUA 3VD5A 1JAEA 3W7IA 3TTYA 4HMEA 4AF0B 3BZGA 5AYBA 3N19B 4RJEA 2VTFA 5JIWA 4LAOA 1FH9A 1R47A 4QROA 4WQ6A 3GSMA 3QR1A 3VKCA 3B9DA 2DW6A 2VWTA 4R3UA 1XGDA 4INFA 1HKJA 2PDMA 1TREA 2OX4A 3DGRA 1KTBA 2Z1KA 4F4RA 2ZUWA 4HSNA 4LBUA 1GOMA 1JUKA 2J74A 5E70A 3UA4A 1OABA 4CQCA 3LI1A 1W3LA 1EC7A 3W28A 3ITVA 5F4SA 3W2UA 1MRQA 2ACSA 2ZUNA 1DQWA 3EA2A 3IAQA 1DWAM 4Z0SA 2VZTA 1JAKA 3LDVA 1SFLA 5CZSA 1Q7MA 1VAHA 2A7PA 3CMFA 5BRBA 2HV5A 3KBMA 3FXGA 3I7RA 4PUEA 3PZNA 1KNWA 3DFOA 3RLHA 1UW9A 4NJGA 1FUYA 3AHVA 2H3DA 3LTPA 3F2BA 2F6XA 4DQWA 4MJZA 3NIYA 2ZUTA 3PZOA 5C2XA 1CXLA 1T96A 4GZIA 1PJ9A 1XCWA 3S5OA 4C7FA 1S3HA 1TQJA 1HJSA 4K8EA 3CMGA 3AMLA 2POZA 4O57A 4W8BA 1JPDX 4GWEA 1TJPA 1A5CA 4KCVA 5HNUA 4JY8A 1ZCCA 4E3TA 4M19A 4H6EA 1H63A 2Y62A 5HDRA 3EDFA 2HE5A 3SSJA 1EX5A 4P8VA 3VUSA 4IPNB 2C79A 2BB0A 4US5A 4OHQA 4PTXA 3TROA 1S2TA 1M53A 4NJJA 4KWWA 4LY8A 4DO5A 3F4VA 2GWGA 3GC4A 5I06A 3SGUA 2FVMA 4DJDA 2XHYA 5I5RA 1CGVA 1E6ZA 1HQTA 1JRBA 1TIWA 3OG3A 1E9YB 4W9TA 1TWDA 2ISSA 3B40A 2GOUA 1X1ZA 1N8FA 2Z27A 5BYWA 4ML9A 1W5QA 2X0HA 5TNVA 5LNWA 1XYBA 3HPAA 3SCSA 4C6BA 3PFRA 2BY0A 3DH7A 4HBKA 3G22A 5CGMA 1ENUA 3ZXWA 4NYYA 1WAUA 4EX4A 3B8UA 1W54A 2ZTKA 3VYLA 2R82A 3IJIA 3FA3A 4NIRA 3LENA 2Z2AA 3RX4A 2XH2A 4AX6A 4U2ZA 2JALA 2D1ZA 4WKFA 1QNOA 4HMDA 4EPDC 2YJQA 2FYMA 1LZOA 5EBAA 1JF6A 1GTHA 2PA6A 4H7VA 4AZ6A 2QJJA 1TPH1 2OCZA 3AXHA 4YS1A 3NYZA 1MZHA 2FJKA 1E51A 4UTIA 1PE1A 1TR1A 5I03A 5HJYA 3AYTA 1H62A 2VKZG 4DBUA 3G1HA 3FA5A 4MPQA 2V2HA 4FNUA 2Z6IA 4KWSA 3TAOA 1LOLA 3WEOA 1JG9A 2PWHA 4FLOA 4O18A 4L6DA 1QAPA 4I5UA 4WSJA 4QE1A 3UF9A 2Y7DA 1XFCA 4MJ4A 1TR9A 1G7UA 3ITXA 1LG2A 2V63A 2CNCA 1V4YA 1HL9A 1XPYA 2ZXBA 3T42A 3FN9A 3TYDA 3RUBL 5T91A 3MCNA 1RBOB 4FNRA 3G8RA 1E6QM 4L1WA 5IDIA 2X7VA 3MB9A 4IP5A 1GQJA 4H9XA 1HP5A 1HG3A 1PTAA 4PUWA 4LH8A 1VJZA 1JUEA 1X6LA 2X1IA 5I23A 1V5XA 4IIFA 5REQB 1RCQA 2QV4A 2PBOA 1KFJA 4JQAA 1PL9A 4ZB0A 3L66A 3BH4A 3T78A 2WZTA 3WJWA 4LVDA 4ZO6A 3RRAA 3EXTA 4YTUA 4MM1A 4DO4A 4MJ2A 5KINA 2WYSA 1UD4A 1ICQA 2WHLA 4ILSA 4DB7A 3FGCB 3TZNA 4KPLA 2A3LA 4JCLA 1UQYA 1E6PA 1ISZA 4A29A 2VWSA 1R9XA 1UQZA 5DO8A 1U30A 8CGTA 4U31A 2PDJA 3G0XA 1QVBA 4BQ3A 3VDCA 2CLEA 3SO7A 3R25A 1AH0A 2CHRA 4DBSA 1QWKA 3UWZA 3W71A 1NSJA 3C2VA 2UV8G 3CS2A 2P3EA 2KAUC 1Q6OA 1N8IA 1HVQA 5A6JA 3W6LA 1GJUA 3MMDA 2PP0A 4XBSA 4ACZB 1V3IA 4CU7A 1OC5A 3AIEA 3GY1A 3B8VA 1MFVA 1EBHA 2WWCA 1BAGA 3A9IA 1QK2A 1J2WA 1H5YA 2QCDB 4C7GA 2MNRA 4IIGA 2XTKA 1KM4A 5I07A 3BLFA 3LX9A 1KXVA 3WO8A 3C0SA 1PTDA 4AMAA 3AXKA 3BW2A 4PSPA 1O7AA 5F4WA 2QMKA 5AVHA 5JQ9A 2GUYA 2YW4A 3AI0A 4MSSA 2V3DA 1MO0A 3VGGA 1ONXA 3W75A 2XSXA 3P14A 2E3ZA 5HUPA 4DRSA 3TUUA 4XZNX 3R4IA 4AZ5A 4NY2A 2O7QA 3BGGA 2Z1WA 4JTSA 4AY7A 3QY7A 1UBSA 5EFFA 3CYVA 4Z1YA 3P93A 5E6ZA 1JEZA 2VOMA 2Z29A 1F5ZA 2GGGA 1K9TA 3TX9A 2O4QA 5A2CA 3N1AA 3B0YA 4LPCA 1QOPA 3C3UA 1OGGA 4HA1A 4Q22A 1FQ0A 3UJEA 1ZAHA 1TCMA 1FRBA 3O0KA 3O6DA 3ABZA 3M46A 4JX6A 3B9NA 3VD3A 4W8LA 1CB7B 3DI1A 4L7ZA 3WF3A 4URIA 1FWBC 2WNNA 1BVZA 1NOWA 2DZAA 1RPKA 1W9VA 4B15A 3STPA 1BGAA 4MDOA 4A8RA 4QIUA 1SGJA 3WMCA 2HVMA 1LT8A 3VKDA 4C91A 5E9AA 3S9IA 1ZJHA 4EF8A 4YVXA 2VZSA 3N9KA 3CUFA 2H8XA 3SUTA 2NLYA 2YBVA 3IS4A 1BWLA 3G8EA 3MUAA 4DWSD 1DOSA 2V30A 3H7UA 3N2MA 1R3WA 2J9ZA 3ECQA 1ITQA 4YPJA 4I7WA 3OZMA 4DJEC 2HNHA 1C7TA 3BJSA 1V3MA 3MSRA 4E4UA 4JAWA 5K9DA 2FIQA 3DI0A 5RUBA 3E0LA 3SADA 3WD3A 1QNSA 2Z0IA 2UY3A 3K8MA 4MY9A 4PEKA 4BI5A 3BC9A 3CTLA 1R6WA 4UTWC 3PUDA 3BLDA 4J9JA 4GH3A 4HCHA 4C6DA 3H53A 3EX6A 4X9YA 4RXGA 4BQ5A 2PTWA 4MWAD 2GVYA 2QLYA 5C9WA 4NASA 7ODCA 4PBGA 3TEVA 1C8XA 3PG9A 1O1ZA 3IAPA 4M24A 5HINA 2W66A 4FR1A 1UPMB 2PP1A 2HXTA 2PRHA 4PMYA 4DN1A 5CPQA 3QW3A 4FEZA 5FD0A 1G7VA 1PCKA 1SMAA 5JH1A 2Y7EA 2QPUA 1U5HA 1BPLB 1P48A 2XUCA 4TX6A 3CO4A 3W02A 3P60A 1EP1A 4L61A 2E5DA 4Q3MA 4XIMA 4LUSA 4KGLA 1KRBC 1AVAA 4OKDA 2IUZA 1DWIM 4CNSA 2Z6JA 1V6UA 2H8ZA 1R3VA 3TWAA 4LF1A 1GQLA 4NRSA 5A3HA 1UR1A 4UBPC 1UC5A 5EB8A 5HJXA 2GOKA 2VX7A 3ZJ7A 3OOQA 1M03A 3R11A 2J7HA 4FXFA 1QASA 3GXPA 4BEUA 3OPSA 1TPWA 1J0ZA 3NVDA 4PTNA 1EF3A 4HGXA 1HT6A 4EACA 2BWGA 2HCVA 4F40A 5FCZA 4PMOA 1EOMA 4L4MA 2P0OA 1AG1O 3L5MA 3RCMA 4GNKB 1XDLA 1EIXA 3FV9A 4GI6A 1UKTA 3MYPA 5C9XA 1TQXA 3W7NA 1PIIA 1FXQA 1GZ1A 2Z26A 5T9CE 4ROQA 1ZAIA 1K03A 1UR3M 1N55A 1UASA 3GDRA 1OG6A 1ZBKA 4HA0A 1XISA 3AIRA 5IFTA 1JZ5A 1K9DA 3CXOA 4X60A 1V03A 1SM9A 3WL0A 2B4GA 3R13A 3M44A 3CC1A 5EBUA 5M03A 1EGVA 3QZ6A 1X7IA 4AD0A 3QSRA 4R9XA 1GTEA 3B0XA 1Q5MA 3WDQA 1E4MM 3T09A 4O1CA 3UWEA 3OEXA 1IWBA 1NOUA 1XWYA 3GNRA 2W91A 1ITUA 1P5BA 4AWSA 2OFJA 3UXKA 5DEZA 3ZLGA 2A3BA 1US3A 4WY0A 3TTEA 4ZO7A 1CBGA 5CKSA 2NWSA 1XIDA 5A8NA 2Q8ZA 3B03A 3PBUA 1UKOA 4W89A 1FWSA 3GYEA 4NX5A 2OLSA 3CYJA 3FW6A 4B2DA 4O53A 2X1UA 4LNYA 1F73A 4ZOEA 4XBKA 2EHHA 3URAA 3GU1A 4ZQPA 3NQ7A 3ZR4A 1RR2A 1KQZA 3TN4A 5D9OA 5CBJA 1EHAA 2QDDA 4R9OA 2UWFA 3GHUA 1I9CB 3DYPA 4B3LA 3VNLA 2DW7A 2D2OA 3WEZA 3WQDA 4ZL1A 4JN8A 3W2JA 3EWBX 1Q6QA 2X41A 3IPWA 1SJCA 2PD9A 2QPSA 3VGHA 2E6AA 4LQ1A 4EAYA 3TR9A 3ZYZA 2X05A 6ALDA 4Y7EA 4LOCA 1R85A 4HU3A 2C6QA 2PDFA 4BHYA 2WANA 3K46A 1DQXA 3TJLA 5CXPA 3L0KA 3DYOA 3B0UX 2ACQA 5FACA 3R7MA 5M2FX 2ZADA 1H7XA 2OU4A 3CMJA 5CSUA 3VOIA 2QCFA 3SRHA 2XPKA 4OUEA 3VMPA 4ERIA 1L8NA 1R0MA 1GZGA 3WLMA 2J7DA 3UR7A 2DIEA 1JL8A 4JEQA 3H2AA 1K4HA 3IUIA 1MUCA 1U5VA 3TU9A 3WLSA 4I8YA 1X96A 2BXVA 1W5MA 4J3ZA 2I16A 1MRAA 1SR0A 4PTMA 3TE9A 4EWND 3AICA 2VCAA 4BI7A 2IPGA 3FCPA 4JTEA 5TF0A 3RFAA 1JZ2A 4ZFCA 4M29A 2V81A 5CJ5A 2VFIA 3Q37A 5D8ZA 4YXGA 1RZMA 2V67A 3L4ZA 2ZIDA 3W73A 1XIEA 1W1VA 5F1UA 3PPFA 1TVPA 3BG5A 1KCXA 3FHQA 2ZZ4A 1EYEA 1B1YA 2QEZA 3NXLA 3K30A 3W1NA 3WLRA 5FF4A 3QJAA 4I6VA 5LNSA 3W7CA 2YKKA 4HQVA 1ME9A 1A0EA 5IOBA 5C2GA 4JIRA 3EXRA 1Q8JA 4MNJA 2YDQA 2C1HA 3WNOA 3AS3A 3WLKX 4PUJA 1MQRA 3F4DA 4D6DA 3QQ1A 3AQUA 3NZQA 1UPPA 1V7YA 4L6HA 4LBSA 3A3XA 2GVLA 1XLKA 1MMFA 1NDZA 2WC7A 4QP0A 5XIMA 1EDGA 3VGDA 3BANA 3VKAA 4OWGA 1QNVA 1RQHA 4PMDA 4ZCWA 2DQWA 3CV7A 2NVAA 3TN5A 4CQBA 3T2QA 4Z1CA 1S2AA 1DWHM 1JYXA 1QATA 2P1FA 3H4WA 5GQBA 4B3KA 4OBTA 2Z24A 2YA0A 3EB4A 5AYZA 2OQLA 1VFMA 3N04A 3GTXA 3VVGA 3GVGA 1SPQA 4ONVA 1PZ1A 4CD7A 4PMNA 3PWAA 1E55A 5FSDC 5E1QA 1FP8A 4AIBA 4BCEA 1SZNA 4XZMX 3VC5A 5CZJA 3T8LA 3N3TA 1LJYA 4KMQA 3IWPA 3KW3A 3T8QA 1E73M 1WXJA 1R3YA 1VBUA 3K8KA 2XINA 3M41A 4DJEA 4GUHA 1A5MC 2B7OA 3F7JA 5AC5A 2E8ZA 3GNDA 1EKOA 4AHPA 3STCA 4IXXA 4KERA 5I02A 1XIIA 2R1KA 3DAQA 4H2CA 3G1XA 4AVNA 4IIHA 1XPGA 2B7NA 3S2LA 3TTSA 2V5DA 3FSTA 4O15A 1KM1A 1S1RA 4U33A 4E4FA 2E4TA 1J0JA 2H90A 2JGYA 3KUMA 4UTWA 2QS8A 5CPSA 1V8EA 4BZYA 3D46A 3HJEA 5KZEA 2WWDA 4CNOA 1XP3A 1F3XA 3SCWA 4H83A 5HMEA 2QPXA 1JDFA 1PO9A 3LCXA 4ZOAA 3GH7A 5FJRA 1GQKA 3SUWA 3EOOA 3S47A 1WDPA 2PI6A 4N6FA 3AUOA 5FIPA 5G2IA 3LEPA 4HJWA 4FR6A 4GKLA 2WMGA 3UNTA 1XH1A 3R1ZA 3T81A 3R58A 2Z1BA 3WNKA 1GW1A 1OF8A 3LPFA 4JQ1A 2G41A 4CD5A 1E15A 5DMYA 4K36A 3I6TA 1G4TA 5FA5A 1TMLA 3MMWA 3REQB 3A24A 1CLVA 1D3GA 1YKWA 2V3FA 4Z1BA 2LLEA 1GZJA 4JIEA 1LBLA 3U7BA 4JZ5A 1LM1A 5AB3A 2ZZ1A 4QAWA 4ZFMA 1Q63A 1EPXA 3HFYA 2WC3A 4KFOA 3LI0A 3DEQA 2Z2UA 4O28A 3S1VA 1WKYA 3HV8A 1R7OA 1VFFA 3O05A 1UUMA 5CGQA 4Q6XA 1M04A 3TCEA 2WSQA 2XFRA 3KBSA 4MKVA 5BCAA 3GUWA 3B4UA 2Y5SA 2VD9A 1H61A 3K4WA 1XRFA 2RGLA 4FOUA 3OBAA 4IOTA 1L8PA 4GGHA 5A6AA 3BWWA 1US2A 4PUDA 4IX0A 3PWGA 1Z9AA 4OIFA 1VLWA 4G6CA 1WDRA 4Q4KA 5I3JA 4C6CA 3KL5A 4XTDA 3IRSA 3SN1A 3S6DA 4S39A 1U1JA 1RQEA 4MY8A 2HS6A 3BLEA 4RDWA 1O5XA 4D71A 1VJIA 3DG7A 1CW2A 5HJLA 5U7SA 5E0KA 1O60A 1UJQA 4AG0A 4CLMA 3ZWTA 2BXYA 4RZBA 1EEXA 4C6PA 3KAOA 4IF2A 3XISA 2GJPA 3VIKA 1KXHA 4QR6A 3TN6A 3KRZA 2OTDA 1XIGA 5LIYX 4H9UA 1NF7A 1RH9A 2PCQA 3NAVA 4B3ZA 1CXEA 3LLDA 3PZUA 4RV3A 4H04A 3VO0A 4XKYB 5I78A 4OV9A 2EPKX 1HJWA 4HMNA 2OKTA 3K4AA 3RU8X 3WLTA 3UR8A 2QULA 5DMLA 3LYEA 4QDMA 5CCZA 4Z2IA 4E3VA 1XDJA 4P7RA 2GJRA 1ZNNA 3C56A 2WMJA 3L4WA 4FNSA 5BXTA 1KFKA 1E6RA 4R33A 5I7GA 2XM2A 1KBIA 4M1RA 3CIXA 1C92A 1BHGA 3G3DA 3MVIA 4ZSUA 1UKQA 1EXPA 4CUCA 3S8HA 4DYJA 2DUAA 2Q3RA 3E3HA 3VIJA 1P1MA 4BF5A 4BQ4A 1AW5A 4R88A 3ZQ9A 4A4AA 1ECEA 3LTSA 3FDKA 1A53A 4JTGA 3U8GA 1XL9A 2O7SA 4GXPA 1BRLA 4Q4QA 3U57A 3W26A 1VBJA 2WXDM 4EXBA 3S2CA 2Y5JA 2FTYA 5DY3A 1P1XA 1TUXA 4IX2A 2Q02A 2G3MA 3WQCA 2GDVA 1QPQA 3KVLA 4KFPA 3W7OA 1S38A 4GG9A 4HU4A 1HXJA 2C71A 2B7QA 1AODA 5LKYA 2XGIA 4XVEA 5A69A 2NVDA 4KBXA 4C60A 4D8LA 1Y65A 3P62A 3IJDA 1TKKA 2AL1A 4NX0A 3ARRA 3W86A 7TAAA 3GTHA 3L7RA 3T2OA 1QW7A 3G1AA 4DM2A 4PUUA 2FGBA 2J6XA 3IARA 4E5TA 3G3MA 5CZ0A 3H22A 4POCA 1VKFA 4CD6A 4AEOA 1LUCA 3UP8A 4K7VA 1O4UA 2WSYA 1JULA 3VOGA 3Q67A 1W3IA 5CSSA 3VZYA 4GYPC 1FH8A 2QGYA 4A3QA 4QNEA 3IJ6A 2VEGA 3ID7A 3NZ1A 3S1WA 4NJKA 2PDLA 3WELA 1C9WA 3WH6A 2CLMA 2AKMA 3CZLA 1E3XA 3W1PA 2D73A 1A5SA 1Q6RA 2QDEA 1LWIA 4EK7A 3RIKA 4DI9A 4Q8UA 1EF2A 1AQHA 2X8RA 2QCCA 4J3XA 2PPGA 4YLWA 4GUJA 4M5PA 3PTQA 3PZMA 1RBAA 2FJUB 1XLBA 4KCUA 4WK9A 2WLZA 4IIBA 2PDKA 2A7RA 1EPVA 1LP6A 2EEXA 5GJPA 5FJTA 3RMJA 4Z2KA 3BOFA 2OWWA 3ZZ1A 2RKXA 4QISA 3VNYA 1GONA 4KRTA 2GYIA 1NELA 3V18A 2UY4A 1REQA 2O9PA 4QCFA 2R1LA 3R5EA 1RLDA 1XG3A 2QF8A 3IIPA 1JD9A 4DVOA 5D30A 5DBUA 5G1MA 1XC6A 3A4XA 1P7TB 2H9AA 2EF9A 3FY1A 4I7VA 1FWEC 1VCVA 4HT3A 4WY0B 1TWSA 2V2DA 3TFCA 1KLYA 2OSYA 1TO3A 2OX1A 3CJPA 3N9SA 1KFLA 3GNOA 3AOFA 1YPXA 4JDBA 4W7VA 5A8PA 2OYKA 1SZGA 3WLNA 5HR6A 5CC6A 5AC8A 2PMQA 5DCEA 4PUKA 3KEHA 1CYGA 1LRTA 4LVBA 1AD1A 1E0WA 4AHOA 3WLJA 4QCEA 4OFCA 2O92A 3P6LA 1IEIA 4B9ZA 3B8IA 1VZWA 1UR2A 3CUJA 2OT0A 1JYWA 3CHCA 4LANA 5H91A 1CEOA 1PCWA 1IGSA 2Z1VA 2NSOA 2IXUA 1FCQA 3AZRA 2RAGA 5HK4A 2OSXA 2RDWA 4P7OA 2XN0A 3UYIA 3EEZA 4BR1A 1K9FA 4K8GA 1K9EA 3PHAA 4HJFA 4X63A 4G7FA 1P0KA 3LPGA 1ADSA 2Z1XA 2WHKA 5FESA 2XH0A 4KQNA 3PWIA 2YLAA 1W9PA 4JY9A 1QPNA 4GY0A 3DECA 3MHGA 1IEQA 3CHVA 1E1FA 3WK1A 3ITOA 5CSRA 2E09A 3M43A 5HQMA 1LOSA 4MIMA 2GSEA 4MYAA 1R3QA 5C7HA 3WBAA 2GFTA 3PZ9A 2VZVA 3GB6A 3KDOA 3RGTA 4C5YA 3LHWA 3T2PA 4Y8EA 4N9CA 3QC3A 1VEPA 3U2EA 4G7EA 1XS2A 1NIUA 3VDHA 4M6QA 5G4HC 3HTWA 1CGYA 4XIAA 2WVSA 3O6CA 4DBEA 1B9ZA 1XDMA 1HJUA 3CB8A 4IUOA 3O07A 3IIZA 4KRUA 3KTSA 3BAIA 1EGZA 4G1NA 5LXXA 2YXGA 1M7XA 1R87A 4WZHA 1GVFA 3INPA 1G94A 1J2BA 1L6FA 2OO0A 4JYEA 5DY2A 3FAXA 1LLOA 4RZ5A 1RD5A 1MQPA 5LXEA 1DXFA 3RPDA 2Y5EA 1JGMA 4N4QA 4O4WA 4D8ZA 1UC4A 4H3DA 2QGHA 4OV4A 4WDWA 1RVGA 1Q13A 2BGNE 4EOUA 3WUEA 3VABA 2PS2A 4LUTA 1JXJA 4Q33A 3TXVA 1PIFA 2NXGA 2WSKA 2NLIA 3G1SA 1GQIA 1K8CA 3NL5A 3BCFA 5D9PA 3VOCA 3W22A 1DWGM 1DJWA 3UPWA 2QUTA 3S2JA 2ZDSA 3SSZA 4IPPA 2Z7KA 1TJ2A 2NX3A 1KBBA 1CGTA 2OGYA 3LHUA 1W9DM 3W1LA 1OFAA 1TA3B 5AY7A 4KETA 3KRSA 1XG4A 1LDCA 1TJRA 2A21A 2CERA 2NX9A 3S6OA 2WMIA 4AIUA 2QYGA 5DRIA 1ADDA 4M82A 1DIOA 2XYLA 3ONCA 3CASA 3OGVA 2OZ3A 3NYDA 4NYUA 5DF0A 1UZ4A 1HIZA 1BWVA 2YZ5A 4Y9MA 3W3OA 2D2GA 4LF2A 1NOFA 4PL2A 4J1OA 2NQZA 4HOZA 4ICNA 1TWWA 5M3WA 2Y88A 1YNYA 1MXSA 4A3RA 1EWEA 2ACUA 2ZZ3A 2WBGA 5BU6A 3IRDA 4K68A 4MGGA 4GXWA 3R8HA 5CLWA 1ZJAA 2WHJA 5BOFA 1KM0A 1HKWA 3MUY1 3AXIA 3QRHA 3VKBA 1QUMA 2XJ7A 2CWXA 1CXIA 4HHHA 3ZVHA 1VLIA 2JE8A 4UMAA 4XK2A 2ZXDA 1V0MA 2BG5A 2I9UA 4CKQA 1MXDA 3GO2A 3HF3A 3VNMA 1WZAA 3ARXA 4A35A 5C7VA 3PTMA 3JR2A 3MZNA 3NQAA 3LCHA 4IQJA 2VZUA 2OO6A 2UY2A 2V5BA 1YX1A 3KDNA 3VK5A 3D3AA 3N11A 1GJWA 4YCOA 1K02A 2EGZA 1E0UA 1V3HA 3RHGA 1QW9A 4LWWA 4P2VA 4FPSA 3IIOA 2CLKA 4A8LA 1ZU8A 1MUWA 1GVEA 2FMNA 3RM9A 4GQRA 4Q4OA 3EDDA 2INEA 3Q58A 4S2CA 4MYXA 1N7KA 4GKTA 2AL2B 1EDQA 2FHFA 3SZ8A 9XIAA 4ZB5A 1SO3A 3EDEA 3RMEA 4LB4A 1OFBA 4AISA 2PCEA 5AVNA 2ZC1A 2OOGA 1TPC1 4AXKA 3RK8A 3WUFA 4GYPA 3GG7A 2HNEA 3B4YA 3NDZA 4LEFA 3KZPA 4OGZA 3C2FA 1GHSA 1DIEA 1LWJA 2WJDA 4AAJA 3UJSA 2R8WA 4I9MA 2ZUMA 3F5JA 4W85A 2FKPA 4O1AA 4MF4A 4JIPA 5ABGA 3CU2A 3UU0A 1JCJA 1OD0A 1FWHC 1NARA 1KCKA 2J88A 3W2LA 1Y5WA 1H0GA 2VR2A 2RFGA 4M7SA 4JD4A 4WXYA 1QO5A 2PDYA 2XIOA 3CL7A 2EPHA 4PRWA 3N4EA 1V3KA 3UY7A 4RKAA 2IKHA 4GQBA 1AQMA 2CLHA 3S9YA 4US5D 3HMCA 3Q2DA 1L6WA 4EWJA 1JDAA 4LUIA 1POKA 1OY0A 3KWSA 2BGQA 5FL1A 1IHIA 5E6YA 4ZQCA 4I3GA 3RPMA 3ORWA 1XLMA 1EC8A 4LAUA 3GU9A 4TOQA 2RJGA 1GUVA 3LCGA 1KFBA 2D20A 4ZO8A 3NSXA 5AZ0A 3USZA 3DBPA 4J27A 4DJDD 4RPQA 2QIIA 1XUZA 1TMQA 5M1TA 2X1SA 4KF1A 3PZGA 1J01A 3OGSA 2DQXA 4JTJA 3BOLA 2D2HA 3EA1A 3W83A 3CPGA 2C15A 4LT9A 5FJJA 3UWUA 1YTKA 4M3PA 3W53A 3IV3A 4RDVA 3EPMA 3ARTA 1S5VA 2YPIA 4Q4SA 3WNPA 4GC3A 3MCOA 1E0TA 5LIWX 4J4KA 3H8AA 3N4FA 3E0FA 5CC5A 3OYXA 4H6RA 1BF2A 3HM7A 4D6HA 4D8AA 1EOKA 3EBVA 1RLCL 2P3ZA 4IUGA 3D3FA 5I3FA 5GNYA 4UFJA 1X1NA 3PB2A 4EF9A 2JIEA 2W63A 3S46A 1W3TA 2X30A 1VIWA 1J6PA 4Q8WA 2WCSA 2YL8A 4XO7A 1MW1A 3MC5A 4RNJA 4HNTA 1TJ1A 4P8XA 1GORA 4DNMA 3CIWA 1SZEA 5D2XA 4U2YA 3AJ7A 4HVXA 1WBHA 4IXHA 1EUAA 3MT1A 2BMBA 3UJRA 1PYFA 5JIPA 3RJYA 1V51A 2WK2A 1FHVA 2R6OA 2DUZA 2XSAA 1Q8AA 3TP4A 5AHIA 3UERA 4QEHA 4JIHA 4MAZA 2V38A 1FWDC 2Y2WA 2ZTJA 1QU4A 2A7NA 3L23A 2XIMA 1I1WA 4L4LA 5F2MA 5EYWA 3VD4A 2DZWA 2X40A 3RR1A 4WKAA 4B92A 1OQFA 1ZFJA 4C6MA 5A8GA 3O06A 1LF1A 2J66A 3S4TA 2CLPA 4LCRA 4CVWA 3ABRA 1GOQA 1PAMA 2EJ1A 3TYCA 4D9PA 3SCRA 2CBVA 1JPKA 4G8TA 1G69A 1S1PA 1LUCB 1UB3A 2CLLA 1Z42A 1IIGA 4BI6A 1Z3NA 4D1IA 2DEPA 5ABFA 1XIMA 2D69A 4DO6A 2PU1A 2WNQA 1KFCA 4A2SA 3GVQA 2NV2A 3B9OA 4QDWA 3T0CA 2PWGA 4UOJA 1E4NA 3OLDA 2BNJA 2RDUA 2DH2A 4OE7A 5HMDA 4GQGA 3MO7A 1GKQA 1X6UA 3MI6A 3TA6A 3UXDA 1XYZA 4QXIA 2PF8A 4S2BA 2D24A 1OIFA 2FVKA 3FJ6A 2VGFA 3OVQA 3BLKA 3UCCA 2XN1A 5I3GA 4S3BA 4F9JA 1F6PA 3HGJA 3A64A 3BXWA 1IEXA 3LCFA 3CEPA 1LQ2A 4ZZ9A 2R1NA 2NT0A 4ALDA 1EJUC 1A3HA 4YNGA 4M1BA 3W07A 3QOMA 3T44A 1UZHA 3NDYA 1Q3NA 3LBCA 2OLAA 4MB1A 2DT2A 1T7LA 5T8GA 3WBEA 2VRQA 4XB3A 1DE6A 3TC3A 4JN6A 4HU8A 2H9AB 1X7FA 2W67A 3GNNA 4A21A 4JNMA 5DN1A 3S5NA 3GD6A 3O6AA 5D09A 1QOQA 7ENLA 4YN5A 3EWUA 3MWAA 2EPMX 2R91A 3UQNA 3V16A 3WH5A 4GUIA 4GISA 5TBOA 4PH6A 4AZHA 5C55A 3XIMA 4UNIA 3AIUA 4TVUA 1XLJA 5HR7A 3BPWA 3QQ0A 1TTIA 4PL1A 1VBHA 4IGNA 4XWUA 3WMBA 1BTMA 4R27A 2DVTA 1EUNA 3HQ1A 2P50A 1WA3A 2D0FA 3TC6A 3OLIA 3UWYA 2XIJA 3ARSA 3S9ZA 2PZNA 2QAFA 3BV7A 4Z2GA 5CLTA 1KM3A 2XIIA 3BSGA 3EX4A 4ORIA 3SCQA 2XFFA 5C8BB 3L9CA 2QDGA 4BF9A 3OLEA 1FX6A 3APGA 3TW7A 3KX6A 1FWGC 2YLLA 3CLWA 2B7PA 1M7OA 5LIUX 3TSMA 1EJTC 1KB3A 4HNOA 4MLRA 4FK9A 1L9WA 3WG6A 7A3HA 3VFLA 2GQ9A 4TX8A 3CWHA 3KOFA 4AZBA 3CQ0A 2ISFA 4GINA 3QN3A 2OR2A 3F4CA 4CU6A 2WVVB 4FXRA 1PKLA 1EP3A 1XIFA 4I9TA 5A8MA 1FTXA 4MNMA 2EPNA 1TV7A 1ME8A 4FAMA 4MVAA 3B8WA 4EP8C 3P84A 4ZBCA 3GIYA 3UA3A 1EJWC 4IFKB 3VIOA 3GDTA 2PURA 2BLEA 4H9VA 3ARYA 4KCWA 1W2PA 7REQA 4HHMA 3TC7A 4G7EB 4JN7A 2ZRXA 4IM4A 4UTUA 2VDHA 1HZYA 4Q8TA 2BXZA 3F1QA 2FB2A 4F3HA 4IGMA 4QG9A 4FLSA 5CZKA 3LLFA 3QXBA 4B5NA 3WD0A 2BY3A 2YDSA 3VDGA 4HA3A 3NL3A 3IVSA 3RCYA 4Z42C 2NV1A 4EPKA 1XYAA 1V3LA 1MNZA 1RBLA 3ANVA 1TE6A 5AFDA 2WQPA 3M7SA 5AECA 3N34A 4MLJA 3DFPA 2E40A 1QTWA 3TMQA 1PS9A 3VAVA 3ZJ6A 1K77A 1PTGA 2GGJA 1IE7C 2GQ3A 4DIAA 3EPNA 1WP6A 4V1XA 3GVRA 3NCOA 3QGKC 5LNVA 1NWRA 4M7TA 2B81A 4E2BA 4PB5A 1KGWA 3IJ9A 2E8YA 2A2IA 3LN3A 1IWPA 4MUZA 1BQGA 3GH4A 3KTXA 3L0GA 3VCCA 7XIMA 3O7UA 4HPHA 4R85A 4Q6JA 2JIWA 4CNTA 3KP1A 4X9SA 4QE5A 3VI2A 5I3DA 2DGAA 3BJFA 4M51A 3LMZA 3NSNA 4XTIA 3S0CA 3FHAA 2EG7A 1VYPX 4AZCB 3N17A 2JKPA 2WM0A 3GXNA 3QMRA 3HG4A 3ATYA 2YIHA 4XZLX 5IRPA 1SJAA 3I68A 2DY3A 2DDXA 1PX3A 1ZB5A 5A6KA 1H60A 2WMIB 2O0TA 2E7FA 4O50A 1CB2A 3B0PA 3W7RA 2D3LA 3EKGA 4UTTC 1CENA 2QUNA 5E09A 3MV01 4W5ZA 4NI8A 4IG2A 4IGHA 4RW3A 3G0SA 3VNKA 4LUJA 2V2CA 3DG3A 3ZS4A 4D6FA 1JGIA 4PCFA 1UJPA 4PYSA 2PE4A 2CC0A 3LTYA 3ABOA 4MFDA 5BW6A 3LM7A 4L6OA 3M0JA 1T8XA 3KS5A 1A3XA 3I65A 3ITCA 3DERA 3LB0A 4E8GA 4TQTA 2JEQA 1O1HA 1P4CA 2OYMA 6ENLA 4K6AA 1GG1A 2ASHA 4WIWA 4DJFC 3ALGA 1E43A 4PSRA 3CQKA 4ZE4A 4FP1A 1Z8AA 3KBNA 4TX9A 2GVEA 3QBUA 4UR7A 1HVXA 4XD5A 3ZVHB 2PRMA 3W01A 3V36A 4PFHA 2WCAA 4HSOA 4UTHA 1YTDA 1A50A 3GH5A 1H7RA 3POHA 4XBJA 6REQB 3VOHA 1KM5A 2E6YA 1KBLA 1Q7ZA 1Z48A 4KT2A 4NAFA 1GCYA 1ZHAA 2DVXA 1DWJM 2DZVA 4H8VA 1R30A 4JKMA 5JUVA 2QCGA 3QZEA 3KHJA 3P82A 4IFOA 1A3WA 3CH9A 4M80A 3WDPP 3G5EA 5C9RA 5C2CA 4Y2WA 3LGDA 1E5JA 4QITA 3B9AA 1HX0A 2WPBA 2BODX 3CZEA 5FOOA 2W61A 2VEMA 1BSLA 4GY1A 4N0RA 4B2DD 3PC0A 3BQ5A 1DBTA 4ZQNA 4IJCA 2F9RA 1E0VA 4AVFA 3GVVA 1Q4WA 4JQ4A 1ZJBA 1J96A 1M9HA 5GNXA 4ZB2A 2BVWA 4MADA 3P0XA 1OYCA 3MW7A 5D38A 4C90A 2J8GA 4H8NA 1VC4A 2F8QA 2J6VA 5D04C 2VUYA 3NL2A 3NQCA 3C6CA 1JDEA 3CO8A 3UETA 3BTNA 1KQYA 1AQFA 3WQEA 4PCPA 1KGUA 3LMYA 4JIQA 4UCFA 5B7YA 2V5KA 2YZRA 3GDLA 1OZMA 4WF7A 3M64A 2BS9A 3IIXA 2JF6A 3NWRA 1YE4A 3ABQA 3UXAA 1TRDA 5AYIA 2VELA 4UFKA 3GFYA 3R2GA 4XUYA 2QXWA 1VIZA 4HPNA 1YNQA 3TZFA 4S3GA 3WQPA 3PR2A 4JTHA 1W31A 4DY1A 1B3ZA 3L5AA 2V3GA 3NQFA 2KZHA 4UIOA 3QFWA 4O8RA 3CT7A 3H2NA 5LNUA 4HTYA 4FIQA 1JCNA 1NAL1 2Q8LA 4QRNA 2P8CA 3C2OA 1HO1A 1X98A 1WUFA 3K4DA 4WX2A 1JCTA 4ZTXA 4WUIA 3BMXA 2ALDA 5AYXA 1MDLA 4K39A 5EMKA 1TELA 1WO2A 3IK4A 1W5NA 2P53A 3W1UA 4US6A 4FXSA 1TVNA 4A6GA 1OX4A 1C9DA 1VEMA 3MKVA 4CCZA 5F2GA 4EPBC 3DG6A 1UWAA 3ME3A 1Q45A 1E70M 1JNDA 3WLOA 4JFWA 2FZ9A 3AWNA 4D6GA 4FX6M 1JZ6A 3OLGA 2VQTA 1XIBA 3WK0A 5IDZA 4KFNA 1YDYA 3VU2A 1ADOA 2PFHA 1HFBA 1EFZA 2W27A 1YBQA 1Y7VA 3MI2A 3TNOA 3SCTA 4NVTA 5FEZA 2XVPA 3HGRA 1GEQA 3RLGA 1KFWA 5F1VA 3LM3A 3P61A 4O16A 4R7OA 1B4KA 1UH2A 1XJBA 2REQA 1GJPA 3URQA 4ZXOA 5C54A 3L0NA 4YU1A 2X0YA 3M5VA 3P81A 1H11A 3QEZA 5AHEA 3DZ1A 2PWVA 4FF5A 4I90A 6XIAA 5CPMA 4OZOA 2ZYFA 2ZA1A 2FZDA 4L4PA 3KVMA 2YCJA 1RA5A 5KZDA 1EEPA 3KM8A 1SSGA 1Y5XA 3E6EA 4F0LA 2VDGA 2TODA 2DORA 2PLKA 2XG9A 4H9YA 2GJXA 1J0YA 1UR0A 3PK7A 4OVXA 4JFTA 4J28A 3HQNA 4IISA 5GPRA 5LNRA 1IXNA 2WSRA 2OKOA 3DFHA 1DHKA 4RNFA 4DJED 3HZ3A 4GVIA 1NDYA 3WQ6A 4JTKA 3MP4A 4O0KA 1WZMA 3WQOA 4GMEA 4XD4A 1WQ5A 4FA3A 1B2YA 1EJSC 4G9PA 3BAXA 4C6KA 3W7HA 2CESA 2NXIA 2YCLA 3I6RA 4FX8A 6CGTA 4DZHA 3GNPA 4B5WA 5BXSA 2CBJA 3CZJA 4IWWA 3T6CA 3W70A 1YNPA 3AIVA 3USBA 4QHRA 5H8PA 2C7FA 3WK2A 3BG3A 2BOEX 1O95A 5A6BA 2DFAA 1VRXA 2PBGA 3MO4A 1RA0A 3ONBA 3WD2A 2DUXA 4QGCA 3FOKA 3EMQA 4RDYA 1Y8BA 3PSWA 3PZVA 4I6KA 5A95A 5CPNA 1T40A 4PTVA 3UR5A 2ANUA 5LHEA 5BU9A 3AHXA 1JFHA 3CV1A 3SUVA 3MY9A 3H21A 2J62A 1LWHA 4NNBA 3RF9A 1EJ7L 1E1EA 4I7UA 3TW6A 4A2RA 5KZMA 4MDPA 3N2BA 3SQMA 3B9EA 4UNLA 3OU8A 5DMNA 3WSUA 1YIXA 4HIBA 1JPHA 2E9LA 2HBVA 3TSBA 4RPPA 5I0DA 2Z2BA 1FWTA 2DJXA 1F2JA 1QNRA 3KTCA 4YL2A 4UR9A 4HK6A 2F7FA 3IVTA 2GK1B 2QJMA 3Q4DA 1XRSA 3L68A 4F66A 3WYZA 3WH9A 5D02A 4UTTA 4H9ZA 4KWOA 1FCUA 4L80A 3BAKA 1UP2A 2C1GA 5TIMA 4GJJA 1E4LA 9RUBA 3SFWA 4Y96A 1RV8A 5A5WA 4O54A 4DUOA 4DXVA 2HS8A 4ZQOA 1TV8A 1WZLA 1KBJA 4BF7A 5C5YA 1LBMA 2Y8VA 5HPOA 3HU7A 2DZXA 1BWKA 3FS2A 4C6QA 3NQ6A 1ZALA 2YA1A 4TV6A 3R89A 3L2LA 3ZSTA 1VEOA 3TQKA 5MKGA 3T0TA 3E5PA 1EP2A 3P80A 3TV8A 3VZZA 4DJFA 3M4HA 3GC5A 1UUOA 1YXDA 4YWSA 2QVNA 1EA0A 3GG8A 3W7QA 3RR4A 3C2EA 2F84A 4OJYA 3W7JA 3CUZA 1UH3A 4QJ4B 4C1NA 4AD2A 4TUFA 3KBWA 1XIHA 3C8NA 3FSUA 4HZ6A 1A47A 4D2JA 3LGGA 4P7QA 1L0PA 5AN7A 3RLUA 4PUNA 5E9XA 2JEPA 4GYFA 4HYWA 3CT2A 3M47A 5D9NA 4HZMA 4MWAE 2WNZA 2EG8A 3HA1A 1WKDA 1J18A 5I6SA 3U4FA 3G1DA 4B91A 3DIPA 2XZ7A 4CQAA 1UKSA 3MBDA 3ERPA 1RALA 2Y8KA 4IP4A 3P8JA 2D2JA 4OUIA 1Q6CA 2UBPC 3G24A 3ICJA 4FZIA 4E2OA 4DYKA 3CBWA 2PP3A 1FWCC 1IXPA 4YHEA 1E72M 3SEPA 4BEQA 4G1KA 3SRFA 1XINA 3ABSA 4GCAA 3KOZA 2VC6A 2TSYA 4WSHA 2ESCA 3LXCA 4PBFA 3ITGA 4PN2A 3TQVA 2IXVA 5JH2A 4JKKA 4ZVJA 3DHPA 3HBLA 1MW2A 2PGWA 3FLUA 1C93A 3U6WA 1IT7A 3AHTA 3GFZA 5JMUA 1GVIA 3CHDA 4CCDA 1QPKA 3WQ5A 3LU2A 4UFLA 3EXSA 2WB5A 3ANUA 2WSPA 4C7DA 2ZZ5A 1E1CB 4LYKA 4MJMA 4Q4PA 3Q65A 1T8QA 3VM7A 4LAZA 5H6HA 3PPHA 1VHNA 2XIQA 2XVNA 2V8ZA 5LGXA 4CN6A 1ICPA 2AMGA 3GBDA 1QI4A 1OBAA 3WJZA 4M8UA 3QMSA 2YFOA 1T5AA 4ZOCA 1Z6KA 1BYDA 1A5OC 3KCLA 4GIYA 1KA9F 3T07A 1H50A 4HPGA 5HAOA 4F8XA 2G3IA 3A4JA 4NF7A 2W4XA 1E9ZB 1H7OA 4CQ8A 6PTDA 1R9ZA 3ZLHA 2CW6A 3GS6A 2BASA 3U9IA 4CNNA 2FH6A 4QJ5B 4WDXA 2NV9A 1GWJA 4WVXA 5L6UA 4TV5A 1IF2A 4Z08A 3FDGA 1P0EA 5DLCA 1JJKA 2PB1A 3OGRA 2YXOA 4IMAA 1ODZA 1O94A 1XYCA 3CUIA 4N9EA 3VM5A 4A8IA 4N9DA 4GD0A 1HKMA 1QPOA 1GNXA 2C13A 4JTUA 4KW2A 1NWSA 2HROA 3GTFA 3R79A 1LORA 3AU2A 3N15A 4AW7A 3E2SA 5IHSA 2VQUA 4Q8OA 3BW3A 3WKZA 4O11A 2V5JA 1W6TA 3KP0A 4ATWA 4WY0F 2MUCA 2Z00A 1A5LC 1F9CA 4W88A 2XU2A 1UWUA 1QHPA 2VD8A 3TDFA 3EOEA 1NEYA 3TR2A 3M0XA 4H01A 1BXBA 1TUFA 3VFCA 3H23A 4JEJA 5I00A 4IJBA 5I3HA 5J04A 1QT1A 4H9TA 1OFPA 1UIPA 4D1JA 3JU2A 1AFSA 3AISA 5D33A 5D8WA 4CN4A 1B0IA 2P8BA 2NQHA 3GHSA 2YFNA 4LFYA 4Q8VA 4NAFB 5CJNA 2PDNA 5DT5A 2PDUA 1P0DA 3L21A 2CLIA 3PSVA 1J79A 3MANA 1K7FA 2J8TA 1ONEA 3NM3A 1XRTA 1WDSA 3B8DA 3ARPA 3V75A 4W93A 2EXOA 2AQVA 3P74A 3C2RA 3KRUA 2NT1A 3IUHA 4QDPA 3PPCA 1D3HA 2J7BA 2HPMA 4IPJA 3TJXA 4PULA 2E9BA 1V02E 4FXJA 3QKEA 2H3BA 2JKEA 4PGLA 5DXXA 4PMXA 1VHCA 3H7RA 3SN4A 1DJXA 2G0WA 3CZ8A 3IGSA 3FAWA 1OSEA 1TX2A 4HNUA 3NO5A 4GX9A 1SO4A 3U0HA 1Z41A 3TN3A 3TYEA 4CU8A 3ITLA 1CI1A 1SZFA 3CUXA 3C86A 4JHOA 4LRSA 5FJIA 3GXMA 4ICMA 4MZYA 1AJ2A 1KR0A 3MVTA 4PTDA 4RNHA 1NM9A 3BJTA 3PBWA 3UD6A 3L65A 3VIMA 4B90A 1D8WA 1F8IA 3MS8A 2FB3A 2OYLA 1VCFA 1H7NA 3LV6A 3AAMA 4RXFA 1OWQA 4PMZA 1RJRA 3NURA 3TSDA 3E1F1 4GH1A 3EKLA 3CIVA 3PBMA 3VMNA 4Z0JA 3EX2A 1OFQA 3S2NA 5LGZA 3CWNA 3MU7A 4H6QA 1E9LA 3GM8A 4UNKA 4XD3A 5BXPA 1SR9A 4AU0A 1ZRQA 4MAVA 4W87A 4B5UA 5I79A 4XQ6A 3W84A 5DCBA 1JZ7A 3QQWA 3RJXA 1B3VA 2WKGA 3AHYA 2ZC8A 3HQPA 2HSAA 5XIAA 3KOYA 4F0KA 1KKOA 4AEEA 3UZ5A 4XAFA 3KRBA 3RILA 3UNDA 3PZIA 2FQIA 1CLXA 1M01A 3HOJA 4D72A 1OZQA 1AK5A 2Q09A 2D0GA 4XAPA 5CSYA 2ATSA 3ARZA 4HZ7A 3URBA 4W7WA 4TMCA 3LSBA 3PVFA 3SY1A 2R1MA 4DF1A 3WLHA 3E2RA 2UZ9A 2HE8A 1WB0A 3T7VA 3AS2A 1HGWA 2ZQ0A 4HTBA 1MYRA 3AFBA 1TPFA 1XH2A <