3FKRA

Structure of l-2-keto-3-deoxyarabonate dehydratase complex with pyruvate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
304
structure length
303
Chain Sequence
TPRHRGIFPVVPTTFADTGDLDLASQKRAVDFMIDAGSDGLCILANFSEQFAITDDERDVLTRTILEHVAGRVPVIVTTSHYSTQVCAARSLRAQQLGAAMVMAMPPYHGATFRVPEAQIFEFYARVSDAIAIPIMVQDAPASGTALSAPFLARMAREIEQVAYFIETPGAANKLRELIRLGGDAIEGPWDGEEAITLLADLHAGATGAMTGGGFPDGIRPILEAWREGRHDDAYARYQAWLPLINHENRQSGILTAKALMREGGVIASERPRHPMPELHPDTRAELLAIARRLDPLVLRWAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-2-keto-3-deoxyarabonate dehydratase
publication title Structural analysis of L -2-keto-3-deoxyarabonate dehydratase an enzyme involved in an alternative bacterial pathway of L-arabinose metabolism in complex with pyruvate
rcsb
source organism Azospirillum brasilense
molecule tags Lyase
total genus 110
structure length 303
sequence length 304
chains with identical sequence B
ec nomenclature ec 4.2.1.43: 2-dehydro-3-deoxy-L-arabinonate dehydratase.
pdb deposition date 2008-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3fkrA00
2X1TA 2E68A 5D37A 2Z2UA 4MKNA 5FEWA 3KFTA 4Q33A 1OYCA 3W70A 5SWUA 5D03A 1YLVA 3CTLA 4UMBA 3UWYA 1IIGA 2QCEA 2W79A 4I7VA 4ICNA 1C8VA 3LOTA 3SGUA 2WPBA 3IRDA 1LLZA 3EX4A 1AW2A 3QFEA 1A50A 2J9ZA 2CWNA 1M5WA 3FKKA 2Y88A 2CZEA 3UYCA 5G4EA 2A7NA 4UTTA 4UUIA 2OMAA 4LS0A 3RLVA 5HWJA 3PF3A 2Y7FA 3DFOA 4FB7A 2TSYA 3LLFA 4UFLA 3PBUA 3MMTA 5FF0A 4XKYA 1FCQA 1ZAHA 1TQXA 2ZTJA 5LGXA 5G1TA 3HMJG 3G1YA 2R8WA 4I7WA 4O52A 2R14A 2J24A 2EHHA 2ZRYA 4GNJA 4UFKA 3W6YA 3HGJA 3BLFA 4RR4A 3LBMA 1BWKA 4UTWA 1YYAA 1GPWA 5KZMA 5D2VA 4XTIA 3TCEA 1W8SA 3ABSA 1WV2A 1KFLA 4X2RA 1E51A 1FWWA 3VKJA 2GOUA 4ZQPA 4XQ6A 3L9CA 2BZNA 3E96A 3F4WA 1N7KA 3W7MA 2Z6JA 1AG1O 5K7JA 1H7NA 4PC8A 2ZTKA 2V2HA 4NX0A 3KRUA 1KFEA 4K38A 4ZQCA 4NU7A 1UUOA 1RPXA 4MJZA 4GE8A 1O5XA 2FB3A 5FF4A 1KM3A 3NNTA 3QQ0A 4IWWA 5AHNA 1V5XA 5F2LA 3PBWA 3IGXA 3IGUA 1T0OA 3CB8A 1OFRA 4LVBA 1A53A 1VGAA 3NM1A 3W7GA 4TMBA 1X8FA 4JNMA 4M7TA 5G5IA 1D9EA 3W1XA 4NJJA 1KM4A 2C15A 5HMSA 5AFDA 1T96A 2HMCA 1TPB1 2ZZ1A 3SY5A 6ALDA 4UNKA 2NV1A 2R94A 2Z0IA 4DXVA 4UMAA 3IEBA 1YTDA 3S0CA 2KZHA 1K02A 3T4CA 5EPDA 1L6WA 2V0TA 5FEXA 1YTKA 3O8AA 3ABQA 1LRNA 3LHUA 5H91A 1KFCA 1Z41A 3W76A 3PR2A 4MLJA 3P5ZA 2QAPA 2WKJA 4O15A 4X22A 3CHVA 1OFAA 1JQVA 1XKYA 1TRIA 3CEUA 4O1BA 3LRMA 4UR8A 3W23A 5C5YA 2QCGA 5CG7A 3EXRA 1DJNA 3P7YA 2CU0A 4FXSA 3SI9A 4MJMA 4WXZA 3VNDA 5DELA 4XWUA 3C0JA 4W9TA 3HB9A 3FEMA 1I2QA 1FUYA 1P4CA 3DZ1A 3BW2A 3UXAA 3S1VA 3VI2A 4LVDA 1SO5A 3IIXA 1YXYA 2RH9A 2XFWA 3EX2A 1QDSA 2DU2A 1SFLA 3QH2A 1W5PA 3GLCA 1FWNA 3TXZA 1VCVA 3M6YA 2Q3OA 4HNVA 3STGA 3NO5A 2YW4A 1LOQA 2GJNA 4NJHA 3V75A 5BRBA 1ALDA 2O7SA 1EIXA 3JRKA 4GJ1A 4LNYA 4OU1A 3BVJA 4ZQNA 3LHZA 1F6KA 1LYXA 1H60A 1DJQA 4ADUA 4R34A 1FWTA 3NL2A 3LDVA 3WJSA 5I3JA 3TH6A 4GUIA 3BW4A 3PUEA 5HR7A 1L2UA 1ME9A 3GDTA 4LU0A 4GUGA 3KRSA 3G3MA 3INPA 3M41A 3EXSA 4GUHA 3B0VC 1IXPA 4PEKA 2PCQA 1GYNA 1TSIA 3EEGA 2BTMA 3SFKA 5D2XA 4LVFA 1RQHA 3KRZA 4EWND 1AW1A 2Y70A 3W2KA 2B4GA 4S2BA 3N9RA 1I2PA 3NG3A 1TMHA 5LNSA 3ABRA 5AC6A 5AC7A 3CC1A 4FNUA 3EWXA 2P10A 3DXIA 3TR2A 4A21A 2VEMA 2C0AA 2FQIA 3Q37A 1X7FA 3EWZA 3FIGA 2GVGA 2YGYA 1F6PA 1VQTA 3C8FA 1K8YA 1B9BA 2V9DA 4UR7A 1TPUA 5LNWA 1IXNA 1K3UA 1DKWA 1Z42A 1WQ5A 3PG8A 1B4KA 1FQ0A 1TPEA 2V8ZA 1LOLA 2H8XA 3QM3A 1O5KA 5LGZA 5EKYA 1SSDA 5HULA 4FNPA 4CNNA 1BWLA 3MBFA 1F7BA 1MSSA 4HSOA 1VYRA 5D04C 3HPSA 3NPUA 4ML9A 4XBSA 4CNPA 3QSTA 3HQ1A 1TV5A 3TFXA 5D38A 2ZZ2A 1KM1A 2WNZA 3HG4A 2A0NA 1B57A 5CGQA 2DZPA 3MYOA 2VFHA 4JIQA 3R89A 1LDCA 1MEWA 4O28A 3TC6A 3KHJA 2AGKA 3RK8A 4JYFA 2NX9A 3W7OA 1JCXA 2OCZA 3QMSA 5KINA 3G1FA 2TRSA 1GOXA 1VYSX 2AAMA 3RMJA 3DHDA 5MHBA 4K8HA 3HGOA 4JICA 3T55A 4E0CA 2YCEA 5GVJA 4B5NA 4AWSA 3W83A 1XBZA 4OWGA 4IOTA 2A1YA 3ZFHA 1N55A 4HKPA 5HJLA 4H3DA 1X1OA 3P60A 3NR0A 1T8XA 1LTDA 3O1NA 4DF2A 3DFTA 3B05A 4UTJA 3DFQA 3G8EA 3BPWA 3CLMA 4IMEA 4JTTA 5AHEA 4CNOA 2DORA 4IXXA 2VENA 3CWNA 4YCPA 2CZFA 3LCFA 1GVQA 4FNSA 4IUOA 1TQJA 3MBDA 5CPLA 3L0KA 3GKFA 3NQCA 1H50A 2NXIA 3IIPA 1MEIA 4N9CA 3PSVA 3W3OA 4DBEA 4TMCA 4JEQA 2WQPA 5L6UA 2DZXA 1LZOA 4MY8A 4JTKA 2GQAA 4BI5A 3W7RA 4AMAA 5EA9A 3T44A 2FJKA 4N2YA 3QJAA 5LSMA 4A2RA 4BI7A 1HO1A 3DFNA 3P67A 4RJEA 1ME7A 4WY0F 1XI3A 1I4NA 5TIMA 3KXQA 3EKLA 1GT8A 5F2GA 1WBHA 5KMYA 1UJPA 1FDJA 3TC7A 4DQWA 4CQ8A 4FIRA 3NL3A 3H55A 4HPXA 3GDLA 4C1KA 2DZTA 2A6NA 3A22A 1OX4A 3I6RA 3C4UA 4CCCA 3GDKA 1W5MA 4N4QA 2DZVA 2OX1A 2V82A 2ZZ3A 1QOQA 4UMCA 3W85A 3P8JA 2I14A 1JUBA 3FS2A 1Q6RA 4CCEA 4M6VA 1ADOA 1H61A 1GG1A 2E09A 3EX6A 4KWWA 2VFIA 5EL1A 3TW7A 2A7RA 3G8RA 1F5ZA 4LRTA 2CZDA 3NOEA 3NAVA 2WJZA 4U4MA 5E1QA 3PBYA 5EY5A 3HOJA 5DXXA 1QPRA 3C3NA 1KFKA 1ZALA 3BW3A 4LWWA 1UUMA 1AMKA 3HGSA 5CKSA 4E2BA 3I65A 1FXPA 3P62A 1P0KA 3W1PA 1TRDA 5D2YA 2J27A 3DAQA 1ZY9A 4LOCA 4UTLA 5D2TA 3B0UX 1M6JA 1Q6QA 1K8XA 1LRTA 1JUEA 4JS3A 4IPJA 5HINA 1AL7A 4HPJA 4JTJA 5K4XA 2O7QA 4AF0B 5LNRA 4X3ZA 4BK9A 2XN2A 1PL9A 1N8FA 1WOBA 2YW3A 1FDZA 1TPVA 3N34A 3P61A 3S6DA 4FX8A 3UWWA 1Q6LA 1FCUA 3LHWA 3TNOA 1EP3A 2ZRZA 4N6FA 5DXYA 3FJ6A 3CIWA 4KFOA 1G4SA 3W1NA 2ZYFA 3S1WA 3PS7A 4LS2A 3PM6A 2EPHA 3ZWTA 2F84A 3AO0A 4UFMA 1G4PA 2WOQA 1OFDA 4TR9A 3DHFA 2X30A 1W31A 3LERA 3B4UA 3T7VA 4ZZ9A 1NF0A 1VLIA 1R30A 2J6XA 1KM5A 5U4NA 3TQVA 1W1ZA 3G18A 1QO5A 4Z0JA 1EP2A 5I3HA 1TV8A 3L68A 1YADA 1JCYA 5G2WA 4OGZA 1WX0A 4O50A 3B04A 2QDHA 1PV8A 3A5VA 3RU6A 2ABBA 1OX4B 3TSDA 5KTLA 4WUIA 5J5DA 3S8HA 2Y89A 4IGHA 3QSRA 2V2DA 3ZWSA 5FF2A 1P1XA 4QAIA 3S42A 3ABOA 3LCWA 1TO3A 2NUXA 2ISVA 1OYAA 1RVGA 2QCDB 1I45A 5T26A 2I1OA 3R2GA 3L0NA 2CLFA 1ZCOA 2FB2A 4R53A 3TSMA 2YR1A 3N73A 4ADTA 3UY8A 3L0GA 4DPQA 1S5VA 3U6WA 1G6CA 3GDRA 4NJKA 3NGJA 5FF7A 3EWBX 4FEZA 5D30A 3MI2A 3D0CA 3MHFA 4UTIA 3HIJA 5G2HA 2QUVA 4DO6A 1SQ7A 3QRHA 4AXKA 5DCEA 1BEUA 3STFA 5I3KA 5BNKA 2V5BA 2WNQA 2GJLA 1G7UA 1A5SA 4LW7A 1TPC1 2BX7A 3LLDA 3O6YX 3G1HA 3KOFA 3W87A 1DL3A 2JKAA 4NT0A 7TIMA 2W6RA 3NL5A 3TAOA 4S2CA 3S5OA 3IIZA 1ZHAA 2C14A 2V2CA 3W84A 3P80A 4FNRA 3BG3A 5C2XA 1TTPA 2OT0A 3QW3A 1I2OA 1W56A 2A7PA 2DJXA 3ATYA 1JQXA 4Z08A 3ZR4A 4UCGA 1TYGA 1C29A 1YXCA 3W1LA 4O14A 3M5YA 1EPXA 2BXVA 3R12A 4DF0A 3BLEA 3JS3A 4QQ3A 3DI1A 3RFAA 4GBUA 4BF9A 3DFSA 1ZFJA 4JY9A 1GTHA 1QCWA 3W7JA 3RLUA 1H62A 2UV8G 3V1PA 3E0IA 4HIBA 3B06A 1UB3A 2FTPA 1DOSA 1AK5A 3A23A 4Z0SA 3OA3A 4K7VA 1K7XA 4UFJA 4A22A 4HNUA 1DQXA 3N9SA 3W7PA 3HPZA 3C2VA 3STCA 1SZGA 1L6SA 3NQ6A 3QPYA 2J9YA 3UWVA 1FX6A 2CFFA 3RNDA 4FO4A 2EAWA 4UNLA 1QMLA 4AB4A 2PURA 1TJRA 2Z6IA 3KVMA 5E0KA 2CW6A 2CLIA 4JX6A 3C56A 1LRQA 5D32A 3GDMA 3LI0A 3A9IA 4PL1A 1VLWA 5HNRA 3MI6A 4AAJA 2YDAA 4O1CA 2VEKA 4JTLA 2HS8A 4O53A 4AHPA 2DZWA 1W54A 3GK0A 4Y6GA 3W7IA 4FNQA 3M44A 1DORA 1YDVA 3FJLA 2VC6A 3O05A 1LP6A 3KAOA 1HTIA 2JGYA 4MY9A 3UWUA 3L5LA 3LHTA 4WJEA 3LTSA 2X16A 4IMFA 3PUDA 1R46A 4P2VA 3PWAA 1LM1A 1W3TA 3A5FA 4KKXA 4Q4KA 4XKYB 1ML1A 4OBTA 5IBXC 4BR1A 4K39A 1U83A 4PTNA 3U2OA 3CM4A 4AWTA 4M6PA 5DBTA 1EWEA 1HUVA 5AYZA 5TQLA 4IMDA 4N9DA 1TTJA 3LV6A 3N3MA 3OVQA 2CLMA 2Y85A 4YMZA 2ZA1A 4WXYA 3EWUA 4GRSA 4UIOA 1VHCA 4WD0A 4AH7A 1KA9F 1K7FA 3B03A 1KFBA 2DZSA 4K36A 3I68A 1DQWA 3OIXA 4DPPA 3HPXA 3S9YA 1DHPA 3TSBA 4IMCA 4AVFA 2QAFA 2QCFA 3W74A 3O6DA 1P5BA 4BWLC 3G1VA 5J5RA 3LTPA 3BG5A 3W2JA 4R33A 1JCLA 5AC8A 3EKZA 4IQLA 4X9SA 1TPWA 4TO8A 2YFOA 3GAKA 1JCJA 1EWDA 3BARA 4JY8A 2RDUA 1EB3A 3TA6A 4Z1AA 1TJPA 3WJZA 3NEVA 3SZ8A 5CZJA 2RHGA 1VCGA 3GNNA 4YL2A 1NVMA 3BK0A 1PIIA 3G1XA 1PCWA 4DO4A 4CLMA 1SW3A 1T99A 3P8IA 3TFCA 4CQAA 1R47A 4ZVJA 1AW5A 4ALDA 4K6AA 3G0XA 1GEQA 3M7WA 1EUNA 2VOMA 2I9EA 1A5BA 3G22A 5F2MA 4ZQMA 3ANYA 3NQ2A 4D2JA 2NWRA 1NFBA 3QMTA 4EOUA 3P82A 1P0NA 3MP3A 2ZQ0A 3L67A 3STEA 1FBAA 4AHQA 4NJIA 1GZGA 1KV8A 1YDOA 4O13A 3LCIA 2GVLA 1JUKA 1UCWA 3QMRA 3LB0A 5I3IA 5D05A 2FIQA 2YX0A 4GC4A 2ISSA 1B3OA 1QNVA 1F76A 3GXTA 3I7SA 5K3VA 3LXBA 3P81A 1SZEA 2QJIA 1DBTA 4NUWA 3UY7A 5BOOA 1L9WA 2A4AA 1FWRA 1JVNA 2ZDRA 4JD4A 3MO7A 1XXXA 2BSLA 3GAYA 3NQFA 5LNVA 4YLWA 2Y6ZA 2H3BA 2ZA3A 2Q3RA 3DH7A 3QW4B 1OFOA 1LBMA 4JTUA 3TJLA 1XC4A 5I3FA 5IM51 2BWGA 3UNDA 4O1AA 3S5NA 4ORMA 3DU0A 4FXRA 2CLLA 1W3IA 3SGZA 3TE9A 3H54A 1SSGA 3PULA 1PS9A 1M7PA 3JR2A 4O0KA 3UWZA 3LCLA 3G24A 4LC8A 2FPTA 1GWJA 3W1QA 4LT9A 1VC4A 3O16A 3WFAA 4UTTC 1HFBA 5A8GA 1JRCA 3W1MA 4O19A 3PVFA 1FY6A 5AYYA 2V81A 4JR5A 1TTIA 2WV8A 4L4MA 1FDYA 2A2IA 5LZLA 1Z48A 1ZAIA 1WYIA 3S5YA 1X1ZA 3TXVA 3NQAA 1K8ZA 2FPYA 4UTWC 4N6EA 4FX7A 4IX2A 4IPIA 1RV8A 3DKJA 1W5QA 1CI1A 4RX0A 3CU2A 2CLKA 1Y0EA 4NX5A 2V30A 2TPSA 3ZS4A 1ZNNA 1EP1A 2H6RA 1W5NA 3LCHA 4O18A 4HSNA 3DGRA 3MHGA 4P61A 1KM0A 2QUUA 5FEZA 3W7NA 3A21A 4AEOA 1UASA 4HT3A 3WJYA 2ATSA 1QFEA 3GXNA 3OEXA 5L9FA 1TIMA 2GQ9A 4XTDA 4UTKA 1JRBA 4MY1A 1ME8A 4UTMA 3TU9A 3L5MA 1Q45A 4UFHA 5I3GA 4PH6A 4JYEA 4ZQRA 5U7SA 2Q8ZA 3NM3A 4JIPA 2FFCA 1FWSA 5D33A 5DY3A 2NZLA 1H7OA 3BLIA 1FXQA 4LC6A 4O17A 3NPVA 5HQEA 2QKFA 1OK4A 3LRLA 3LI1A 4JTFA 1QPQA 2DZUA 4FIQA 3F4NA 4O0ZA 3Q2DA 4ZMGA 1NSJA 1KTCA 4TIMA 4NJGA 1R2RA 1SO4A 3PC0A 3C6CA 4CQ9A 5K2ZA 3O6CA 2CZ5A 3L2IA 3TV8A 4Y90A 3NL6A 3W22A 2PRMA 2QEZA 1VH7A 1XCFA 3C2FA 1O95A 2B7PA 3GIYA 1IXOA 3I7RA 3EB2A 2ZRXA 1OF8A 4G1KA 3UQNA 2Q8LA 5K9DA 2NLIA 5DN1A 4JTIA 1GQNA 1U5JA 2C13A 2HS6A 3PB0A 1GJPA 4WQ6A 3R8RA 4J9JA 2Y7GA 2VFDA 3QC3A 3HO8A 4Y9AA 1CX9A 4JTSA 4WOQA 1NAL1 3W86A 2A6LA 4GWEA 3QZEA 4FX6M 3MP4A 5HUOA 2NV2A 1RD5A 2PRLA 2B0MA 3L66A 5HWMA 2J88A 5HUPA 3C2OA 3S1UA 5AN7A 2C19A 3WK1A 4DELA 4O4VA 3PY2A 1RQBA 3VFLA 1ZJIA 1SR9A 1OABA 3B8DA 5FESA 3P84A 1LORA 1VZWA 4HN4A 3QPZA 3E49A 4U28A 1WOAA 2ZZ5A 3NA8A 3W2LA 5EYWA 5LKYA 5LHFA 3NQ8A 2IQTA 3MI3A 4RXGA 4TU1A 3TDFA 3TK7A 4O12A 1TPDA 3M5XA 4RZ5A 4WZHA 2E6AA 4XBKA 1YXDA 2VFGA 1SO3A 1F73A 1H7WA 3M5ZA 3L21A 4ADSA 2VEPA 2F7FA 3LHYA 4NXKA 3Q58A 1DVJA 1MO0A 1A5CA 1MXSA 1K03A 4BFAA 1SZNA 4Z1DA 5DY2A 3W2MA 3N2XA 3OVRA 3CT7A 2ZBTA 2YPIA 2ZCGA 1F2JA 1SO6A 3PBVA 4QSHA 2ISWA 4MOZA 2Y63A 3C2EA 3W75A 1XFBA 2QJHA 5CPOA 4XUGA 1LBFA 4RLIA 2X1SA 3LV5A 1WA3A 3FYOA 3NQMA 5G4WA 4WOZA 2GVJA 4QNEA 3MJYA 4OQVA 5D09A 3T78A 3THQA 2QJGA 1LROA 3TMLA 1SU5A 1OVDA 1KM2A 3QF0A 5CSSA 2VKZG 1RQEA 4S1FA 1FCBA 2FDSA 1OX5A 1SUXA 2P1FA 3E02A 4MVAA 3DKLA 4O8RA 3PB2A 3TMQA 3IIVA 2HSAA 3WJXA 3NZ1A 4M19A 2VFEA 1CW2A 5BMWA 2FPVA 3OVPA 4I9AA 4MFDA 3NQDA 1YDNA 2YFNA 1VCFA 1QR7A 3CIXA 5FEPA 2ZZ7A 3F1QA 3W07A 3H53A 2YYTA 5H2ZA 2BLEA 4Z1CA 5DLCA 3O15A 5KZDA 4JTEA 3NQVA 4IXHA 4A2SA 1GYLA 4ZQOA 4N02A 2RDWA 4MYAA 1K7EA 1I8JA 1XBYA 5AHIA 1QPNA 4MIMA 3W88A 1VPXA 4KFPA 3O07A 4NZFA 3WK2A 4JTHA 1GVOA 1B4EA 4QISA 1JJKA 3LBCA 1JCNA 3N19B 1Q6OA 3FFSA 4RK8A 1OF6A 2E6YA 5AHFA 2ZFAA 1SFJA 3I7QA 4M7SA 2Y7EA 1H51A 4ZL1A 1LLWA 2WNNA 3YPIA 3NDOA 4GUFA 1JULA 2A5HA 4NZJA 1G4TA 2VFFA 1H1ZA 3GR7A 2NX3A 1F05A 2P0OA 3G3DA 3K30A 3L65A 3AJXA 3ATZA 4KWVA 1QOPA 4MZ8A 3CPRA 4OHQA 4UTUA 4JTGA 4O16A 3HBLA 4N9EA 4OV4A 3PUOA 3SECA 3TIMA 1QPOA 2WSRA 1O60A 1KLYA 3LRKA 3CEPA 4PODA 2NUWA 1I2RA 5EBUA 3DFPA 3UZ5A 2EKCA 3C2RA 4NNBA 1GTEA 1IF2A 2C1HA 2PRHA 1YPFA 4FF7A 3UPBA 1PE1A 4K8EA 4LVGA 1H7XA 5C54A 2QCLA 3VE9A 4QNWA 5F1UA 4CCDA 1KBJA 4L4LA 4Y96A 3G0SA 3KVLA 4MUZA 4ORIA 5F1VA 4A29A 1EX5A 2QR6A 3KVJA 3WJWA 3EWYA 4O54A 5CPMA 1EUAA 3GKAA 1ZENA 3TX9A 5HR6A 4EF8A 1VYPX 4FNTA 2Y62A 1LOSA 4JDBA 5CPNA 3UXDA 3W1UA 5F4XA 2JBMA 1KTNA 2TMDA 3GB6A 4PA8A 1IGSA 1R2SA 1WBJA 4DBDA 1J5TA 2E1DA 3W7KA 3W7HA 1C9DA 3LCXA 2C16A 4GXMA 4NVTA 2ZA2A 3VCRA 3M1ZA 5KITA 2GPTA 2H3DA 1ICSA 1V7YA 1F74A 1VR6A 3GZ3A 2AQWA 2G95A 5TBOA 1D3HA 2QDGA 3QEZA 4LV4A 4JX4A 1OYBA 3HG2A 2ZRWA 3IGSA 4QM1A 5K9XA 2RDTA 3BV4A 1WDWA 1G69A 3O63A 4NNAA 4EF9A 1S5TA 1LBLA 1SW7A 1PHWA 2VEIA 4RZ4A 1TPFA 1S3HA 1A5AA 3NQ7A 1OFPA 1W5OA 3B0PA 3MYPA 4RXFA 3FOKA 3LXCA 4YCOA 4A3UA 4RKAA 1YTEA 3W9ZA 3KX6A 3MHUA 3M0ZA 4LVAA 3KVKA 2ZZ6A 3NQEA 1XUZA 4FHAA 4QIUA 1KBIA 2TYSA 3C52A 3S1XA 2ZRVA 3SSJA 4M6QA 3M47A 3TJXA 3GXPA 3L5AA 1Z44A 3FLUA 3W1AA 3WK0A 5K4ZA 1IXQA 2EF9A 2LLEA 2YYUA 3EX3A 3W2UA 2G97A 4MPQA 1ICPA 5BMXA 4LUIA 1O94A 3TQ0A 5F4WA 3SR7A 5G1YA 5G2IA 4QJ1A 4WX2A 3THAA 1H63A 1L6YA 1GG0A 1KFJA 4H4IA 8TIMA 3RF9A 2YSWA 2X2GA 4N9BA 1JR1A 1XDMA 2YZRA 3C61A 4N4PA 2JKPA 3E9AA 4KFNA 5K9CA 3HJZA 3U8GA 4BI6A 2B7QA 1ZAJA 3W2NA 1KTBA 1FCVA 2JKEA 4AHOA 5EMUA 4RV8A 1KW1A 2W0UA 3M5VA 5DBUA 3W7LA 1OFBA 3W1RA 3GX9A 4NQ1A 3O06A 1WXJA 2ABAA 1KM6A 2YXGA 3LGEA 1DV7A 5ABTA 1XBXA 4GUJA 3P74A 2A85A 5AYXA 3HF3A 4JGDA 1TB3A 4RZ6A 3UZJA 4OT7A 5F4SA 2E5DA 3T40A 1OX6A 5CSRA 3TKFA 2PE4A 3F03K 4E2DA 3GYEA 5DCDA 1H5YA 3PSWA 1G67A 4O11A 2E77A 5CZTA 4R7JA 3W72A 4UFIA 4OE7A 1PVNA 3QQ1A 1QO2A 4I7UA 5CZSA 2ALDA 2RFGA 3LCGA 3LX9A 2OJPA 2G96A 1TCDA 4K7YA 4HHPA 3BGJA 2NWSA 5AHMA 3FKRA 1QAPA 1S5WA 2E6DA 3R13A 1THFD 2H8ZA 1KV5A 1OFQA 1MZHA 3G1DA 1OJXA 2Y7DA 3QYQA 4POCA 3IVTA 3LHVA 3MUXA 1HG3A 1TREA 2WSQA 5AOUA 4ONVA 1G4EA 2C3ZA 4AWUA 2JK2A 3ELFA 3TAKA 2VELA 3W1TA 3M43A 3IIOA 3NVTA 5D2WA 2VXNA 3OBKA 3SIZA 2V5LA 3WK3A 4AF0A 1BTMA 3E12A 3UD6A 2XN1A 3S5ZA 4O57A 5KSWA 3Q94A 1AL8A 4YWIA 3W7CA 4K37A 1I2NA 4NNCA 3NQGA 3GVGA 1W0MA 4WY0A 4HNTA 1ICQA 2QF7A 3FYPA 3HGRA 1W3NA 1OHLA 1H1YA 1J4EA 4EIVA 2CLEA 2B7NA 3BO9A 1VS1A 2HTMA 2DP3A 4IMGA 2QCHA 3EX1A 1O4UA 4EVZA 2FLIA 5BW6A 3HG3A 4H6KA 4TX9A 2G5WA 5AB3A 4OV9A 4MFEA 1EA0A 1BKSA 3DBPA 1W37A 3NYZA 2CLOA 3BG9A 4O10A 4GFSA 3R5EA 3EXTA 3EWWA 1HO4A 2X1RA 4YXGA 4O1DA 3A24A 5LNUA 1TTQA 1HL2A 4JYDA 3W73A 3OG3A 1XM3A 3LXAA 4MZ1A 4JN6A 1QWGA 4JXCA 3NPWA 4MYXA 2GUUA 3SJ3A 4LUJA 3GR8A 1TPH1 4LTSA 4PCFA 1SW0A 2OZ0A 3DENA 4HNNA 3LM7A 4XZ9A 5IBXA 3TQKA 3TROA 1M7OA 5F2IA 4DO5A 3PG9A 4QITA 1SPQA 2H90A 4Q32A 4JX5A 3N14A 3NZRA 1H7RA 1KLZA 1XBVA 2QCDA 2ATMA 3IV3A 4RCXA 3W7QA 5D02A 1JCMP 4E38A 1GVRA 1RR2A 4IX0A 2ZZ4A 5A5WA 3DI0A 3CWOX 4UC5A 2EGZA 2DJLA 4IJBA 3G1AA 3SW6A 2Y61A 4O4WA 3TW6A 2XN0A 2PC4A 1SZFA 2WO5A 1XL9A 4BWLA 2Z1BA 5LHEA 2X1UA 3UWQA 5KZEA 4LY8A 3LTYA 2NXHA 1PHQA 1LCOA 3MP5A 5HWNA 2A21A 4M5PA 1GVSA 1EEPA 3G1SA 3TUUA 4JDYA 4MLRA 3IVSA 1VJIA 1OFEA 2OT1A 2QCMA 4LRSA 4NXSA 5FF3A 5CZ0A 5C55A 2RKXA 3W7EA 1WAUA 4UTHA 2D73A 3CQ0A 2C6QA 4DF1A 3IVUA 3NPXA 2E5BA 1NEYA 1GVFA 1YPIA 1NF7A 1RZMA 4WY0B 4PFMA 4LS1A 1XDLA 1J2WA 1OK6A 3P5YA 1UBSA 3MWAA 4UXDA 6TIMA 3M9YA 2NXGA 3G0UA 3UPWA 4Y8FA 5C6MA 1H7PA 2E6FA 4PL2A 2B7OA 1PCKA 1ONRA 3W7DA 3NXFA 3BGGA 1IIHA 4MZYA 2QCNA 3FA5A 2R91A 5AHLA 2QUTA 1TV7A 1D3GA 3VE7A 1Q3NA 1XUUA 4C1LA 4Z1BA 3GNDA 4LV9A 3OHIA 2QCCA 5DCBA 2ZRUA 3W71A 4DEFA 1VRDA 5FI8A 2WSYA 3N2MA 1OG0A 1X6UA 2E5CA 2NX1A 5E93A 3M16A 2J9XA 3MW7A 1VHNA 2JGQA 2NUYA 1R2TA 2C18A 1MEHA 3USBA 2CLHA 3HG5A 3PAJA 1G7VA 2GQ8A
chains in the Genus database with same CATH superfamily
3L2LA 4MNJA 2X1TA 1NDVA 3SEPA 4XD4A 1UR9A 2E68A 2Z2UA 3RAOA 3W70A 1IIGA 1R8LA 2QCEA 3VDGA 3R8HA 1C8VA 4HU8A 1AW2A 5BXTA 1EDGA 4PUDA 4JBRA 4PSPA 1R3QA 1EJ7L 1M5WA 1T8QA 3CUJA 1E0XA 2WMKA 1E55A 1QRQA 4UUIA 4Z2KA 5HWJA 3PF3A 2J8FA 4UFLA 1B31A 1EO7A 5FF0A 3NURA 5IHSA 1TQXA 4C1NA 2R8WA 4LAUA 1GKQA 1RCOB 2J24A 2D3NA 4UFKA 4ZOEA 3W6YA 4RR4A 1JZ4A 4J4KA 5D2VA 5A3HA 4XTIA 5I6SA 1W8SA 3B8IA 3KM8A 2GOUA 3FW6A 4XQ6A 4ZQPA 1O5RA 5EMMA 3VNMA 4A8NA 2Z6JA 1AG1O 3CMGA 3H2OA 4H00A 2BY2A 1DWIM 1KFEA 4ZQCA 1RPXA 2FB3A 4HCDA 8XIMA 1KM3A 1WB0A 3QQ0A 1V5XA 3IGXA 3WLNA 1T0OA 4OUEA 3ITCA 3QGKC 1RA5A 3A3XA 1A53A 2XISA 4LVBA 4TTGA 5FIPA 3NM1A 1IV8A 1X8FA 4IF2A 3S46A 3AZRA 3MC5A 3W1XA 1NFGA 1T96A 3GNRA 6ALDA 3HTWA 1E5JA 3WF1A 3IEBA 1YTDA 1EKOA 1ESWA 2KZHA 3T4CA 5EPDA 1XLJA 4ZCWA 1RLDA 4L56A 3SQMA 4BA0A 3DUGA 2CIPA 2WKJA 4O15A 5BXPA 2V5JA 1TRIA 3CEUA 4ZXLA 1I9CB 4UR8A 2PTXA 2G3JA 3VD7A 3EXRA 3GIPA 1YNQA 5DRIA 4M29A 3SI9A 3URBA 3S2CA 5DELA 4PTXA 3HB9A 3FEMA 3ZLFA 1FFQA 2QIWA 4DNMA 4DJDA 1SO5A 4K3ZA 4RW3A 3C86A 1W5PA 3VINA 1FWNA 1V4YA 1VCVA 4QCFA 1PDZA 1Y8BA 1UR1A 2YA1A 3V75A 4P8VA 4LCSA 5A6JA 4LNYA 4OTKA 4I8DA 4L1WA 1F6KA 2AL2B 2GK1A 4HCLA 3WJSA 3TH6A 2HQAA 4GVIA 1ME9A 3INPA 1N8WA 2E8ZA 2PCQA 3W37A 3EEGA 2DSKA 1RQHA 3KRZA 5FJPA 4UQDA 3W82A 2B4GA 1P1MA 1I2PA 1CGVA 1TMHA 4K8GA 1IE7C 4B5TA 3TONA 5AC6A 3BV7A 1EJVC 3LU2A 3CC1A 3AYRA 3UETA 3PBMA 2C91A 2PI6A 3CYJA 4IIGA 4JNYA 3CHEA 3EKGA 3WLQA 3NSMA 4JTCA 2PU1A 2GVGA 4AZBA 1VQTA 1J9YA 4F9JA 3C8FA 4YHEA 3N6HA 3SUVA 1K8YA 4UR7A 3M0YA 5LNWA 4B5XA 1K3UA 4HPGA 3H70A 1GJWA 3UXKA 3GZAA 1QW9A 5EKYA 1E43A 4ZE4A 4FNPA 4CNNA 3MBFA 1F7BA 1VIWA 1B90A 1WO2A 2WCSA 4E4PA 4HSOA 3GTHA 5D04C 4ML9A 2Y24A 3KTCA 4XVDA 1TV5A 4BQ4A 2ZZ2A 1M53A 4GD0A 3UA3A 3VCNA 3PZOA 2A0NA 3XIMA 3R89A 4GBDA 1XLDA 1Z8AA 2WMIB 2DDXA 2AGKA 4H9UA 1E5NA 2YBVA 2BHZA 4A3QA 4L5ZA 4AY1A 4M24A 1A0EA 3OP2A 3K8KA 2OGJA 3DHDA 1ZJBA 3HGOA 5C70A 4AWSA 4OWGA 1X38A 3IANA 4H3DA 3O1NA 1V02E 1LT8A 3DFHA 3B05A 2VCAA 3S1GA 1JPHA 2YDQA 1XLKA 2VENA 3CWNA 1NQKA 2FGLA 3LCFA 1J12A 1KBLA 1FVPA 4WGHA 1XWYA 4LYKA 1H50A 1UWRA 1TMLA 3W3OA 3PSVA 2WQPA 5L6UA 2DZXA 4NRSA 4JTKA 4BI5A 4AMAA 1A4LA 2E9LA 3T44A 2FJKA 3NWRA 2VZVA 1B30A 2BXYA 3QFWA 3TTOA 1IT8A 3QJAA 5LSMA 2VC7A 3GUGA 3ITTA 3DFNA 4ZTXA 4RE2A 3OLIA 1GOMA 5TIMA 3KXQA 4IIHA 4WJ8A 1TVPA 3WKZA 5KMYA 3ZIZA 2NQZA 3FAXA 4CQ8A 1GNXA 4FIRA 3RJYA 3RDKA 1H5VA 4RDVA 3I6RA 3RYSA 3GDKA 2DZVA 1XKJA 1TA3A 2I14A 1JUBA 2QF8A 3WNNA 3N6JA 1GG1A 4TOQA 4KWWA 4WSKA 1UD2A 2VFIA 2QDEA 5A6SA 5EL1A 1MVYA 2A7RA 3G8RA 2BVTA 3NOEA 2I17A 1HGYA 2WJZA 4PMNA 2G4JA 3G5EA 1AMKA 3ZVHA 1DHKA 3R4IA 4CQBA 5CKSA 4HA3A 3I65A 4Q4RA 1JYVA 4X63A 5I06A 2V5KA 3W27A 3BTNA 1JUEA 3KZPA 1AL7A 4HPJA 4JTJA 2PLMA 4AD0A 5DMMA 1CPUA 1OC5A 1U5HA 4JCMA 3S6DA 4FX8A 1UKPA 2PMQA 4ZB2A 2PDPA 2XIQA 3TNOA 3RLGA 1U2YA 1O6IA 1Z69A 3FJ6A 4EPKA 1G4SA 4C65A 2ZYFA 3HJEA 3PS7A 2Z1VA 1TKKA 3OGVA 1E1CB 1XG4A 4KETA 1G4PA 4RDZA 3WIJA 2OZTA 3DHFA 2X30A 3LERA 3T7VA 4US5A 3O3RA 1K6AA 3HZ3A 1I6NA 3APYA 1NF0A 1U1HA 4Q7IA 2J6XA 1W1ZA 5LA0A 4V1XA 4K2SA 4I5RA 1HKIA 1TV8A 4UQEA 5G2WA 3TN3A 1YRRA 3B04A 2QDHA 1UWTA 3RU6A 1VFHA 1Q6EA 4WUIA 1NM9A 3ZWSA 1P1XA 4WDTA 3W81A 3VPLA 3ABOA 4JPGA 5JIWA 2NUXA 2ISVA 3CHCA 5FSEC 4RE3A 3M0MA 2I1OA 3R2GA 3AXMA 4PMRA 2FB2A 4QAWA 3IUDA 1J79A 2R82A 1BHGA 4IHCA 3E0WA 4A8LA 4JFVA 3U6WA 5BXRA 3RIKA 1G6CA 3GDRA 2AL1A 3NGJA 5FF7A 4LEQA 4FEZA 4JTAA 1BWVA 4OVXA 4W93A 4GCAA 3HIJA 4DO6A 1BXCA 1SQ7A 4EWJA 3QRHA 4UQCA 5BNKA 3CAVA 4LX4A 4CD4A 2REQA 1H4PA 2GJLA 4LW7A 2YCIX 1NWUA 2D22A 4Q8QA 7TIMA 2VDIA 3IIZA 1ZHAA 2C14A 3P80A 1KR1A 3BG3A 2OX4A 3AHYA 1YBQB 3JVAA 1UUQA 2DJXA 3ATYA 1DIEA 1VB9A 2RJHA 2DPEA 3W24A 1YXCA 3W1LA 3RILA 3M5YA 1EGMA 1EA9C 3NFUA 3UVAA 3CUGA 1NOFA 3UR2A 4RW5A 1ZFJA 3H2NA 3MY9A 4JY9A 3UPMA 3KHDA 3RLUA 6CGTA 3BH4A 1W9DM 2RUSA 2UV8G 3V1PA 1EYEA 1HKVA 1BYBA 1CXHA 3WN6A 3D46A 3EOUA 2WC4A 3FSUA 4A22A 1K7XA 4H1ZA 3W01A 1C91A 1C9WA 4KEUA 2XYLA 1L6SA 2O9OA 3NQ6A 3QPYA 1BRLB 2F61A 3WF0A 2J9YA 3E6EA 4Q22A 2CFFA 3H2FA 1E9LA 1EJUC 4AB4A 2PURA 4ACYA 1TE1A 1A0CA 5AC4A 4FOKA 4JX6A 3F2DA 1TZ7A 3PPFA 1LRQA 1PTDA 3VM7A 5LYRA 4WHBA 4AAJA 1XS2A 2E3ZA 3GK0A 2Y5EA 3JZUA 1LP6A 3BAIA 3KAOA 4AZ6A 2JGYA 4MY9A 3PJUA 2FZMA 4ZO6A 3SCSA 2QVHA 4IMFA 1OIFA 2Z28A 5LA2A 4KKXA 2BOGX 4Q4KA 3OJGA 3VKKA 4XKYB 3WQ6A 4YTTA 1ML1A 3SUSA 2Y0FA 2NSXA 3RM4A 4PTNA 4FZIA 4PMXA 3VTRA 1Y5WA 5TQLA 1HX0A 3LV6A 2GDUA 2PDWA 4WXYA 4GRSA 1V6TA 1DQWA 3OIXA 1O12A 1CEOA 5FL1A 3S9YA 2FMNA 3E74A 5H8UA 1DHPA 1HVQA 4U5KA 3W74A 3O6DA 1P5BA 3EOOA 1F61A 3LTPA 3VKBA 2VR2A 5BRPA 3OQ8A 3SCRA 5HPCA 5JIPA 1KKRA 1PXGA 4X9SA 1VRXA 4XAFA 1GKPA 2GFTA 1GQLA 4MM1A 3BARA 1ITXA 3AWOA 3DG7A 5FKYA 4DJFC 1RY8A 3WJZA 4AZCA 1SFSA 3FDGA 3NEVA 6XIMA 3SZ8A 1AFSA 4WDWA 2X42A 4V15A 1NVMA 3OHMB 1PCWA 4CLMA 2EQDA 3VD9A 2AMGA 3P8IA 3VD3A 4PMZA 1DWHM 4QROA 4MMWA 3G0XA 3M7WA 2VD8A 3WQFA 2EO7A 4IG2B 3L7RA 2W67A 3P82A 1UQYA 4LYPA 4PUKA 3L67A 2C1IA 5KETA 1YNYA 2QGHA 2GSEA 3DERA 1W1IE 1GZGA 4NAEA 2C0HA 4Q4MA 2VQUA 2WHMA 3S2JA 1Q7ZA 3VGDA 2XIBA 1OB0A 1E71M 3GVWA 3LB0A 1ZP3A 4HU4A 4JIEA 1AJZA 4CEUC 1PEZA 5FL0A 1F76A 2PD5A 1IWAA 2J7GA 4F2BA 3PZQA 1HJQA 3I7SA 3CYVA 3KBSA 3AHXA 1S39A 1DBTA 5BOOA 3RR4A 1W91A 2G4FA 2R6OA 3UGVA 1MFVA 2UY4A 3WLIA 4FXFA 4QQUA 3NOYA 6REQB 4Z2IA 3WLJA 3UESA 4YLWA 1VFMA 2ZA3A 3KL0A 1LG1A 3QW4B 1LWHA 1V79A 3ABZA 3S5NA 3LUTA 2CLLA 1W3IA 1M7PA 4E2OA 2B31A 3W1QA 4MJ4A 3GY1A 4AYGA 4UTTC 1HFBA 4PMJA 3F4DA 4OZOA 5HMDA 4HYWA 1FY6A 3PUGA 3H2EA 1XCWA 5M2FX 3QV9A 3GXDA 2WV8A 1UMYA 4L4MA 2A2IA 3S5YA 4ERGA 3NQAA 3BSMA 3QGAC 4UTWC 4N6EA 2PP0A 2PWUA 1DEDA 4EAMA 3CT2A 4J27A 5TD4A 1F3EA 3OGSA 4RDYA 4QLKA 2YXXA 3THUA 4F0HA 3ZS4A 1W5NA 4EPDC 3ARQA 3DGRA 4KIEA 1KM0A 3A21A 3BAKA 4Q4SA 1UASA 1MW0A 2GVYA 4XTDA 3BWWA 3D47A 3TJ4A 4UFHA 1IWPA 4ZQRA 5U7SA 2Q8ZA 4JIPA 4M56A 1WXZA 3R79A 3BLIA 4O17A 5HQEA 4US6A 2QKFA 1QNQA 1QU4A 2FFIA 3LI1A 3WUGA 2DT2A 3WQPA 4GNVA 4ATWA 4FIQA 3FK4A 1JAEA 1QT1A 5A69A 2QULA 4EXQA 4TIMA 4NJGA 4WDUA 1SO4A 3A9BA 3CBWA 3UR5A 3N4AA 2R1MA 2CZ5A 2FVLA 2PDFA 1JPKA 3MUZ1 3SCUA 4JHOA 1XCFA 2IKHA 2CNCA 3ARRA 1NARA 3QBUA 4LSBA 2WM0A 4JFSA 3OPSA 4WF7A 4F0RA 3UQNA 9XIMA 1FWEC 4IICA 2RGLA 1EO5A 5DN1A 5EB8A 5FJIA 2Y7GA 1UH3A 3HO8A 5JBDA 1MXGA 3LQLA 4JTSA 1NAL1 3CPUA 2YZ5A 4P5UA 4O0QA 2A6LA 1CECA 4V2XA 3W86A 3P93A 3AIUA 3I4KA 4F0LA 4GCXA 4HHMA 1OSEA 2J88A 5D9NA 4QS5A 2CXGA 3C2OA 4GQRA 4ZA0A 5AN7A 4PRRA 3U7VA 3VUPA 3VM5A 3WX7A 4AY8A 3QPZA 1XIMA 4U28A 1WOAA 3NA8A 1Q7QA 1P6WA 2GWGA 3TDFA 1TPDA 3LSCA 3H2MA 4QDWA 3AMKA 4XBKA 1CXLA 5A2BA 1F73A 2TAAA 5MF5A 4H41A 4ADSA 2VEPA 3C0SA 1W9VA 3Q58A 4NXKA 1DVJA 1XLGA 1MO0A 4RUBA 1A5CA 1K03A 4JCLA 4ZSUA 4BFAA 2QW5A 3W2MA 4IFRA 3ITYA 1KGXA 1DIOA 1GHSA 4OJYA 1PIGA 3U3HA 1XFBA 2QJHA 3IARA 4XD5A 5C9UA 3CV2A 4XUGA 1B0IA 2X1SA 4YTQA 3HQOA 2WBKA 1PZ0A 2XU2A 3T1GA 4WOZA 4X9YA 3KCLA 2PCEA 4OQVA 5D09A 3H7VA 3GNOA 4LBRA 1OVDA 4KCVA 1MNZA 2VKZG 1KRAC 1FCBA 2P1FA 3GM8A 2J8TA 3TMQA 2W3ZA 1QBBA 3IIVA 3G6LA 1NQ6A 1XLHA 2XINA 4M19A 2VFEA 1CW2A 3UU0A 2FPVA 1NP2A 1YDNA 2XH7A 3CIXA 6XIAA 3R58A 1CTNA 3H53A 2YYTA 1VFOA 4ZENA 1HVXA 2WNWA 3NQVA 3N9KA 1GYLA 2RDWA 3ANVA 2CPUA 4Y9PA 4NZFA 2I5GA 1X96A 1JJKA 1ISZA 3I3DA 4QX4A 2A3LA 1MDRA 1OF6A 1J0ZA 3FN9A 3GG7A 2ZFAA 2WC3A 4Z1YA 5JVLA 1SFJA 1P0DA 4H8HA 3I7QA 4GNKB 3LK6A 4M7SA 3RU8X 1F8MA 2OXNA 3H2AA 3FXGA 3OQEA 1GVIA 3P6LA 1UP3A 4O1EA 4NZJA 4S3DA 1G4TA 2VFFA 2WMGA 3MA8A 1HP5A 2NX3A 4AD5A 1FHLA 1XF0A 2YDRA 2VVSA 4KWVA 4MZ8A 1KCZA 3P3BA 4JTGA 4O16A 3HBLA 4N9EA 1V6YA 4TQTA 3SECA 4HU0A 2WSRA 1R0MA 1KLYA 3HMCA 1JYNA 4GIEA 4PODA 1I2RA 2XGZA 2ADAA 4FMVA 1I1WA 4PB4A 4NNBA 1GTEA 2C1HA 3AALA 1PE1A 1P0EA 1H7XA 4QNWA 4L4LA 4Y96A 4A29A 3KVJA 3TA9A 1EUAA 5HOSA 3GKAA 4HZ8A 3TX9A 1UYQA 2Y62A 3EMQA 4GABA 1HJXA 2J66A 5HNTA 5F4XA 1KTNA 4IMAA 4DBUA 2OQLA 2YL9A 1W3KA 4TX8A 3UGRA 1S2TA 1V0MA 3Q4DA 5KITA 2H3DA 1VR6A 3QHMA 2ZIDA 1K1DA 1D3HA 2QDGA 1S2VA 4TV6A 4L1XA 3UERA 4UR9A 2ZRWA 4QM1A 3BV4A 3TP4A 3OZPA 1UD8A 1G69A 3ZJ8A 3VNLA 3KWXA 1S3HA 3UG3A 7A3HA 3PBGA 4ZB5A 1D3CA 5JQ9A 3K4DA 3HA1A 4B3ZA 1MUCA 4RKAA 1XJBA 1YTEA 3BLOA 1KBIA 1KNWA 3M0JA 5HMFA 3E2QA 2P3EA 3QVQA 1PTAA 1Z44A 5K4ZA 2J75A 4FS9A 2INFA 3A64A 3NDZA 4IT1A 1E1FA 3W2UA 4MPQA 3U5UA 5BU6A 1O94A 3R0UA 2GUYA 4EAYA 3IJ8A 1SGJA 4H4IA 7REQB 2YSWA 2X2GA 4H7CA 5M5DA 4YTSA 3OU8A 1QWKA 3WQVA 1BYAA 1DJWA 2B7QA 2WZIA 3V0SA 1ZAJA 4MAVA 1KTBA 2IUZA 4C6OA 3H23A 2ALRA 4AHOA 4RV8A 3M5VA 5DBUA 4NQ1A 3WELA 3O06A 4QDPA 4WR3A 3V0UA 2YXGA 1NWSA 4D6JA 1XBXA 2A85A 4QE5A 4AC7C 4G8TA 1FWAC 4G7EA 4MG4A 1OX6A 4KERA 5CSRA 2PE4A 3S83A 4E2DA 3GYEA 1Z7AA 1HJUA 4TVUA 4J7RA 4RDWA 3QZ6A 3T4WA 3QQ1A 1QO2A 3SRFA 4W89A 2OJPA 2VCBA 4K7YA 2OODA 3S2LA 2NWSA 5HAOA 1OC6A 3EDDA 4G9PA 2E6DA 1TZZA 4F9DA 3QYQA 4JQ3A 3LHVA 3H2CA 5E9AA 1X7IA 1J0HA 5AC5A 2EEXA 5HA7A 2VELA 4W5ZA 4L6HA 3ARUA 2ZUUA 2VXNA 3FA3A 3GWQA 1H3GA 4B5WA 3SIZA 7TAAA 2PWFA 4DJED 1VBGA 1BTMA 1RK5A 3BMWA 3E12A 3W25A 4O57A 3V18A 4WVXA 3Q94A 4YWIA 4NNCA 1W0MA 1ICQA 3WBEA 2XHYA 4LCRA 1ZPTA 4V1YA 1OZQA 2HRWA 4MB5A 4EVZA 1E6XM 4MKSA 4TX9A 2G5WA 2Z1WA 1BKSA 1SJAA 2CC0A 3VAVA 3EXTA 2PBGA 2Z24A 4IIEA 2WHKA 3EWWA 4YXGA 3A24A 1NTHA 4CQCA 1ISWA 2ZX7A 3FHAA 1HL2A 3FYYA 2VD9A 3PZUA 4K1WA 1M01A 1WE5A 1F3TA 4UBPC 2KX9A 4CKQA 3KRBA 4JXCA 2EXOA 7PTDA 3M0LA 4MYXA 2F2HA 2G3IA 2VX6A 3GR8A 1P7TA 1GKRA 3U2CA 1EOMA 3W0KA 1SW0A 3DENA 4GI9A 4GQQA 3RCYA 5F2IA 1SPQA 2FZ8A 2YB4A 3N14A 3NVDA 3NZRA 1IQ8A 1XBVA 2J7EA 3VVGA 1KWGA 4RCXA 1XIEA 2YCJA 5D02A 1ITQA 3MDUA 4E38A 1RR2A 2HCVA 1SFTA 3TYZA 4IX0A 3VNZA 2A3AA 2XUCA 5HXMA 5XIMA 3CWOX 3UA4A 4IJBA 4G2DA 2Y61A 3V5FA 2B81A 1SZFA 1X97A 5CBJA 4V28A 4L6OA 2GSHA 2E4TA 3KL3A 3UFYA 2X1UA 2AGTA 5C9WA 2EPMX 1OT2A 3ZSTA 4AEFA 4NKCA 3MP5A 5HWNA 4M5PA 1NWTA 3TUUA 1MQQA 4S3GA 3MDWA 1HKMA 5D9MA 2QCMA 2RKXA 1X6LA 4W7WA 4KEMA 3T42A 3IVUA 1BG4A 1YHTA 3CL7A 3BSGA 4PGLA 1YPIA 2G3NA 2QPUA 1OK6A 1UBSA 4PCPA 1V77A 5M3WA 1TUFA 4UXDA 2NXGA 1I0DA 2B7OA 4IP4A 5HMEA 5JH1A 1NH6A 1PWLA 4Y7EA 1ZJAA 4F4RA 4Q4PA 3K8LA 3BGGA 1XLMA 2GGJA 4MZYA 5AY7A 2UY5A 1Q2SA 3CUXA 2R91A 4TTUA 1KXHA 4BF5A 3QR1A 2FHBA 4S38A 1Q3NA 3A3WA 3T05A 2FZNA 1UP0A 4L4PA 1EOKA 4J35A 5FI8A 5H1WA 2WSYA 3B8VA 2NX1A 3M16A 3NTYA 3MW7A 3FSTA 1W3JA 3USBA 1CZ1A 3HG5A 1F07A 4CN4A 3PAJA 1G7VA 1EJWC 1HZYA 3WDIA 2QS8A 1JDCA 1POJA 4PB3A 4HHHA 5D37A 5FEWA 3VD4A 4IQDA 1YLVA 3CTLA 4J1OA 2O4QA 4NRRA 4UMBA 3DYOA 1EF3A 2VWSA 4ICNA 1UKQA 3VDCA 3SGUA 2WPBA 1B3YA 3NYDA 4PMYA 4DXKA 3EX4A 3QFEA 2PLCA 2IQDA 1A50A 1IR1A 4M8UA 4Q8VA 5EMJA 3FKKA 2Y88A 1CLVA 2NQLA 3GXMA 2OMAA 1AD4A 4LS0A 1RP8A 2CHOA 1JDFA 4Q7BA 4JFUA 1ZU8A 1UD6A 3PBUA 3MMTA 1HGWA 1ZAHA 3GG1A 4LH8A 3QQWA 1KO0A 5G1TA 3HMJG 3S4TA 3M6DA 2Z26A 2R14A 4DHGA 4CGTA 1EPVA 2ZRYA 3HGJA 3BLFA 3LBMA 1YYAA 1J96A 4GX9A 3IWPA 3N1AA 1KRMA 6TAAA 3ITXA 1LWIA 2BZNA 2AL2A 4MKVA 1H7NA 2ACSA 3BJSA 4NX0A 4K38A 3OZOA 4I9TA 4NU7A 1UUOA 1DWAM 1RCQA 1O5XA 1FKWA 3NNTA 5AHNA 5F2LA 4PMOA 2GL5A 3KBJA 4IP5A 2J25A 3IGUA 3GW3A 2O55A 1OFRA 3WG6A 3N2TA 4QSFA 3LG3A 1FHVA 3ZR5A 3WH7A 4M7TA 5G5IA 4M51A 1D9EA 2F6KA 4NJJA 5HMSA 2HMCA 1ZLPA 4UNKA 2R94A 8XIAA 3EOLA 3QOMA 3AIWA 3E0FA 4XSMA 4F3HA 4DUWA 4D71A 5CAHA 2Z7KA 4U5IA 3GC4A 1A80A 3AS0A 5A8MA 1L6WA 4E8DA 4HNLA 1E56A 3LZ3A 4HHLA 3O8AA 1LRNA 5H91A 4MWAE 2ANUA 2WZEA 3W76A 4GYJA 5HANA 4BQ3A 2QAPA 3UF9A 3BZJA 1BYDA 4O1BA 3W23A 5C5YA 4E5TA 5G1MA 2OWXA 3TOPA 2CU0A 3NJ3A 2W92A 4WXZA 3VNDA 4ZO8A 5DRCA 1FOBA 1I2QA 1FUYA 3S1VA 3GH4A 4LVDA 5ECVA 1RY0A 3GTNA 8A3HA 3EX2A 1JXJA 1QDSA 3GLCA 3TXZA 3AIBA 2YW4A 3APGA 1GGOA 4H01A 4EKJA 4NJHA 2IQ0A 3SJNA 1ALDA 1EIXA 4HBKA 4RNJA 4GJ1A 4OU1A 1PZ3A 1GVEA 2HK0A 2HV5A 3LHZA 5AZ1A 3Q67A 4R88A 1DJQA 4R34A 5I03A 2VX5A 3PP7A 2PTZA 1CLKA 3M7SA 4GUIA 3PUEA 5HR7A 1L2UA 3GDTA 3KRSA 3L4YA 4JIRA 3EXSA 4GUHA 4PEKA 3WQOA 4HD5A 2BDQA 1D8WA 4PMDA 2BTMA 3K4AA 4G7FA 4EWND 4F48A 4MWAB 2Y70A 1W8GA 3W2KA 4ACZB 4ROPA 5LNSA 3CO4A 4XD3A 5EMYA 4UWMA 1RH9A 2I5IA 1U30A 2P10A 4PUWA 3DXIA 4JL2A 3TR2A 4W5UA 1IZKA 4DAFA 1OEPA 1YQ2A 3ERPA 2DUAA 3MWCA 3EWZA 2YGYA 1F6PA 1XYBA 1EC7A 2CEQA 3I10A 2BOEX 1B9BA 1IXNA 1DKWA 3PG8A 2H8XA 1H49A 4HVXA 4MTVA 1M7JA 3POHA 4N7QA 4AZ5A 2AKZA 3TYCA 3HPSA 2FTWA 4QRNA 5D38A 2HK1A 3VCCA 5CGQA 3S9IA 2VFHA 3PNZA 4H6EA 1MEWA 3FVMA 1TWSA 3TC6A 2ZXQA 1ECQA 5AECA 1K4HA 3GHUA 1VBRA 3AXHA 4AXNA 4JYFA 1GQJA 3WQGA 2NX9A 3W7OA 3QMSA 2XH2A 4O1FA 2OFJA 1VYSX 4PBFA 3K1GA 3V16A 2WVVA 5MHBA 3PJTA 4K8HA 1C7SA 4UNIA 3N13A 1DYSA 2YCEA 3R7MA 3W83A 4RNFA 1PDYA 1XR2A 2PBOA 4Z2HA 1E6SM 3AWNA 1UD4A 3GVVA 1X1OA 1T8XA 3CL6A 4CNUA 3H22A 3VX0A 2MUCA 4LF1A 4AD3A 4HYVA 2Q8XA 3G8EA 3MTWA 4KRTA 4PMQA 3BPWA 4GGHA 3CLMA 3DESA 4WJXA 1K8CA 3MUY1 4U3CA 1GVQA 4IUOA 6A3HA 1TQJA 3KTSA 3DCPA 9XIAA 1JYWA 3GKFA 2WJEA 2BHUA 3NQCA 2NXIA 4DBEA 2VGGA 1LL6A 4JEQA 3U48A 3UJEA 1LJYA 4J3SA 4XZIA 3W7RA 1OQFA 1XGZA 5EA9A 1E1CA 3CZKA 3UR8A 3GDBA 3WQ4A 4N2YA 1A5KC 4M6UA 4QEHA 1BF6A 2ZWZA 4G56A 1HO1A 4AX6A 1E4IA 1ZSXA 4KF1A 1XI3A 2O92A 4DBWA 3EYPA 1OIMA 3IJLA 4XD6A 3NSXA 3TC7A 2GVEA 3NL3A 2IKJA 3H55A 4HPXA 2WWDA 2DZTA 2A6NA 4LJ3A 1W5MA 2OWCA 3VOFA 5C7HA 2V82A 2ZZ3A 1Z89A 3VXGA 1ITCA 3WH5A 3CHDA 1U1UA 2PS2A 2VMFA 1HNYA 1UD5A 1ADOA 1WDPA 3PJWA 3EX6A 2X09A 3E2VA 4JQAA 1EJTC 4LRTA 2CZDA 3NAVA 2R1NA 5E1QA 3HOJA 3TYEA 1QPRA 4LWWA 1ZALA 3NDYA 4M3PA 4PUJA 3HGSA 2QMKA 4AISA 3F4CA 5DMLA 1FXPA 3R10A 3BQ6A 1TRDA 5D2YA 1JPDX 4LOCA 3B0UX 1Q6QA 1LRTA 4NYYA 4IPJA 3T2QA 4WLCA 1CLXA 1YIXA 3WDHA 4JQ2A 5FJTA 3THCA 5CJ5A 5K4XA 2NVDA 4IFOA 1LLOA 4AF0B 4DJFD 4X3ZA 4GY7A 2ISFA 5BOFA 1WOBA 1MXDA 1XLBA 3P61A 4XSLA 5I07A 4QTGA 3CUZA 5DT7A 3GH7A 3MJMA 2W4XA 1EP3A 2ZRZA 5DXYA 4KFOA 5HQLA 2IXUA 2F2KA 4LS2A 4YJ5A 4OFCA 8CGTA 2EPHA 2WSKA 2DV0A 3CGTA 3ZWTA 1IEWA 4UFMA 4PMUA 1OFDA 3NZGA 3GG8A 3MSRA 1W31A 2XFFA 2POZA 1A5NC 3IK4A 1SJBA 1R30A 1KM5A 5U4NA 3G18A 1QO5A 4OKDA 4U3AA 3L68A 1YADA 1JCYA 2PFHA 4GACA 3RPTA 2D0FA 1PV8A 3BMXA 3A5VA 2ABBA 1OX4B 3TSDA 3FXYA 5DANA 5KTLA 1BRLA 2XIJA 3S8HA 4IGHA 1PYFA 5FD0A 4QAIA 1C7TA 3S42A 4BEUA 1TO3A 4KESA 1R3SA 4LAZA 2OLSA 2QCDB 1TMQA 4XZWA 4Y2WA 5T26A 4L1GA 3S6TA 1UBPC 1B3WA 5D9PA 4RE0A 1JZ8A 1G5AA 2YR1A 1EEXA 2XJ7A 3N4FA 4H04A 3UY8A 3L0GA 5DQPA 1S5VA 3DECA 3QR0A 1GW1A 2WHLA 3CQIA 1FP8A 1POKA 3MI2A 3DFYA 2HVMA 4O8AA 2QUVA 5DCEA 1BEUA 5I3KA 2WNQA 3RO6A 1YDYA 1FWBC 1XRVA 1G7UA 2BX7A 1UROA 1QNPA 3G1HA 3KOFA 3W87A 4AZHA 3OLGA 2XGIA 2JKAA 1XSJA 3LYEA 3NL5A 3TAOA 1Q6CA 3LQGA 3S5OA 5C2XA 4GO9A 2OT0A 4OOUA 1UWQA 1LWJA 2W9MA 1W56A 3C8NA 3H7UA 4NAFB 5EMLA 1QATA 3WLTA 3WNOA 1C29A 2OWWA 4O14A 1AD1A 3BLEA 4HNOA 4AUBA 1P48A 1H09A 4QQ3A 5FAJA 4HOWA 2C71A 4AIEA 1A3WA 1RUSA 2YDSA 4AEEA 1QCWA 1M04A 4H6RA 2ZUTA 3R43A 4PB5A 3B06A 1UB3A 2FTPA 1DOSA 3AYSA 4MWAD 4GINA 4TVDA 3H4WA 4BY3A 1KRCC 4MF4A 3UG8A 2FDMA 2TODA 2VX7A 2C79A 1V51A 4A6GA 2ZUNA 3K13A 4P7NA 4MGGA 4UNLA 1QMLA 1TJRA 2DIJA 3KVMA 2CW6A 3VNYA 1OCJA 3F5LA 4L80A 4XAYA 1Q8AA 1UPPA 4CD8A 2E67A 4D1IA 5CGTA 1TWIA 3B9NA 1UWAA 2ZX9A 1PPIA 3A9IA 5BOEA 5IRPA 4PL1A 5HNRA 3IGHX 1ZBKA 3HQNA 4AHPA 4EX4A 4XX6A 4JAWA 3CZEA 1O1HA 1DORA 1YDVA 3FJLA 2VC6A 3O05A 3H24A 2ODOA 1PSCA 3AS3A 3UWUA 3PUDA 1R46A 1LM1A 1W3TA 4ZEPA 1E0WA 3KBVA 1B3VA 1PZ2A 2AAAA 3N29A 3GNXA 2J4GA 4OBTA 3SCWA 5IBXC 2WBGA 2ONEA 1U83A 1Q63A 4F79A 3GFZA 5DBTA 5A94A 1EWEA 3QC0A 3LGDA 6REQA 3BCFA 1L6FA 1UWUA 3MKKA 3AFBA 2QT3A 1JGMA 2ZA1A 3EWUA 1VHCA 1KBBA 4WD0A 4AH7A 3ZOAA 3ARYA 1FWJC 3TWBA 3DHPA 4IMCA 4TV5A 1SR0A 3WLSA 3ES8A 4GX8A 3WENA 2J13A 3V4BA 3W2JA 4W7VA 5T91A 3EKZA 4IQLA 2BBFA 1RLCL 1TPWA 4TO8A 1JCJA 1PYMA 1EBGA 1TV4A 2RDUA 2Z7GA 1EB3A 3TA6A 4Z1AA 4D8ZA 3J7HA 1P6BA 2DY3A 5GJPA 4AG0A 3B9AA 3MVTA 2MANA 1HL9A 2BS9A 3W00A 4MJ2A 1PIIA 1Q85A 2ASHA 5AVNA 1SW3A 1T99A 2PF8A 4XUYA 3F2CA 5FJUA 5B80A 2YBUA 4ZVJA 3GHSA 4ALDA 2NLYA 3KE0A 1EXPA 1EUNA 3G22A 5F2MA 1R3WA 2NWRA 3QMTA 3C0LA 1UIPA 4PCNA 4DXXA 4NJIA 1V03A 1XH2A 4O13A 5FJRA 3RN6A 1FWGC 4PTDA 3BQ5A 2CITA 3WBAA 4OUIA 3QKEA 1V0KA 2FIQA 3PZNA 1WZMA 4I8YA 1Z9AA 1QNVA 1PX3A 3GXTA 4KPLA 1EZWA 1XLLA 2DZAA 4F0MA 4GQ0A 3I6EA 3II1A 1SZEA 3URNA 1JEZA 1JCTA 2V3FA 3UY7A 3F4VA 1FWRA 2ZDRA 4JD4A 1PIFA 4LAMA 3MO7A 3GHRA 3FEQA 4D6EA 3H7RA 1XXXA 1TFVA 1KFWA 3CUHA 2Z1XA 3DH7A 1AA1B 1LBMA 4JTUA 4Q6XA 5I3FA 4O1AA 1AQ0A 3DU0A 3GFYA 2WMHA 3DIPA 3SGZA 2CERA 3L2MA 3PULA 2XM1A 2WPGA 3GVQA 3UWZA 1EGZA 4LC8A 1XH1A 5M03A 4LT9A 1VC4A 1WZKA 3ZO9A 4KBXA 3WY1A 5GQBA 3WFAA 4Q4OA 1JRCA 3SIMA 2BODX 3AOFA 2WZHA 4OBRA 5AYYA 5BCAA 4EPEC 1MUWA 2Z27A 3LMYA 4DJEA 1ZGDA 1ZAIA 1WYIA 2IKIA 5CJMA 1X1ZA 1TVNA 2FPYA 1UWIA 1XG3A 4IPIA 1BSIA 4UOZA 1E6QM 1Y0EA 4NX5A 4DWSC 3HU7A 4UTFA 5AKQA 3VNKA 1EHAA 1A0DA 3LCHA 4O18A 4HSNA 3E5BA 3MHGA 2Q6ZA 3W7NA 4NIRA 4QEEA 2XVKA 3GXNA 3OEXA 3O0KA 2CKRA 3U2EA 4MY1A 4UTMA 5I3GA 2J47A 4PH6A 4JYEA 3NM3A 2FFCA 5A1AA 4PTMA 1LUCA 1JNDA 4ZODA 5GPRA 4IGNA 3GC2A 4LC6A 3WD0A 3N3TA 3WL0A 2E28A 4M82A 1JI2A 1XRTA 2BGNE 3EOEA 1Q6GA 2PLKA 3PZMA 4O0ZA 4ZMGA 2WVTA 4HTBA 1LT7A 2RGMA 1GPFA 4GA8A 2HXUA 4FOJA 2DT1A 2P3ZA 2XVNA 2ZWYA 1S38A 1O95A 1VFLA 1IXOA 3SSZA 4CVWA 2XFYA 2W27A 2ZRXA 1T6MA 5K9DA 1GJPA 4J9JA 1FHDA 4ZFMA 3QC3A 4Y9AA 3LEPA 2D20A 1B3XA 3CO8A 1OT1A 4LUYA 2BB0A 3QZEA 3MP4A 1RD5A 4W86A 3REQA 4LBSA 2Y2WA 5HWMA 3ZJ7A 4XAZA 4AFYA 1CB2A 3S1UA 2C19A 3WK1A 1OCBA 4DELA 3ZVIA 3UZZA 1SR9A 1ZL1A 5FESA 3KOYA 3P84A 5ECUA 5DMYA 2HBXA 2VRKA 5EYWA 3L4TA 3PTMA 5LKYA 4A3YA 2VC9A 1CGTA 3TK7A 4W8AA 1ELSA 4O12A 4RZ5A 4WZHA 2E6AA 1XISA 1YXDA 1SO3A 1PTGA 2OSWA 3WD1A 3A13A 3NZPA 1VAHA 3MSGA 4YHGA 2QV4A 4QGCA 1CB7B 5DY2A 3KWSA 3N2XA 3OVRA 3IACA 3ALFA 5T9BG 1DTUA 3PBVA 1W3HA 1ONXA 4DVOA 2Y63A 1HKJA 3UYIA 2R1LA 1UWSA 4L7ZA 2HPMA 2BHYA 5CPOA 4JQ1A 4RLIA 2XH4A 1WA3A 5I3DA 3GTFA 3FYOA 4BJHA 1S3TC 4QNEA 4YIWA 1LL7A 2QJGA 2H9AB 1O5QA 2QMJA 1CXEA 4S1FA 2FDSA 1OX5A 1SUXA 3E02A 4GVGA 4J3XA 3DKLA 3MT1A 5BYWA 4H2CA 3PB2A 1RALA 3CPGA 2HSAA 3WJXA 1ZB5A 2WC7A 2PDCA 1ZQ5A 3NZ1A 1PKLA 1EXBA 1ZZMA 1VPQA 5BMWA 2VGIA 4MFDA 4IIDA 1VCFA 2UZ9A 1E4MM 4C6LA 3W07A 3F1QA 3U4AA 2PWGA 4W84A 1UH4A 5DLCA 3SM0A 4JTEA 4XK2A 3BGAA 4IXHA 4S39A 4A2SA 1I8JA 4IIBA 1BD0A 1QPNA 4IH3A 5IXEA 2D2JA 2OEKA 1BFNA 4IM4A 1EDQA 5GNZA 4KFPA 2ZX8A 3O07A 1QK0A 3D6NA 2OSXA 2YLAA 4HMCA 2YJQA 5LIWX 2BMBA 1M3UA 1Q6OA 3EDEA 4L61A 2E6YA 2WW5A 1UC5A 5A6KA 2PDUA 2Y7EA 1JDEA 3NIYA 4GYPC 3WSUA 3NDOA 1NOWA 1GOKA 4IL0A 1EYWA 5KZ6A 4GUFA 5I5RA 2A5HA 3B8UA 1DWGM 3TN4A 2J77A 3GXFA 2P0OA 1AH4A 3G3DA 1HKKA 3K30A 3AJXA 2HROA 4OHQA 4B3KA 3PUOA 5FCZA 1VJSA 3TIMA 5EU9A 4DJEC 1VENA 1PUDA 1SJCA 3LRKA 4OBSA 5JH2A 3W28A 4W85A 2O9PA 2V69A 3HV9A 1VD6A 4H8NA 3BC9A 5D8WA 3UZ5A 1VJZA 7REQA 1FWFC 1IF2A 4FF7A 3WDQA 2KAUC 4K8EA 4LVGA 4YU1A 4ZO7A 4CCDA 3FCPA 4OOZA 2DUXA 2A3EA 1XYFA 4MUZA 4ORIA 1ZRQA 3IAPA 2D2GA 4O54A 3BOLA 1TJ1A 1VYPX 4XIAA 1MWOA 1LOSA 4HGXA 2Y5SA 4DYJA 1QNRA 4AYSA 4X60A 4PA8A 2ZKMX 1EC8A 3W7HA 1EFZA 3LCXA 2DT3A 4NVTA 2ZA2A 4K68A 5AYBA 2NV9A 3VCRA 1MQRA 4GJJA 2Z4GA 1ICSA 4HA4A 2ZX5A 2FVMA 4XIMA 2G95A 5TBOA 3VA8A 3NUKA 1V0NA 3HG2A 4HJFA 4HSHA 4E8CA 4B90A 2WM1A 2RDTA 1M1BA 4F0KA 1WDWA 5E5CA 3VGEA 4NNAA 4TVCA 4L6DA 1HP4A 3PHAA 2X2YA 1JDDA 3KW3A 1XYMA 4UOJA 4ZGYA 1M7XA 3B0PA 7CGTA 3PPGA 2QZRA 2QLYA 3W9ZA 5BRQA 2CBJA 3CHFA 2O0TA 4AD2A 4J3ZA 1GOWA 4QIUA 1QUMA 3AROA 3C52A 3CH9A 3DOPA 3S1XA 3SSJA 3TJXA 3N12A 2ZUMA 4NF7A 3FLUA 3W1AA 3WK0A 4NASA 2LLEA 4QDMA 3RITA 2G97A 5BMXA 4LUIA 3W6MA 5F4WA 1H2JA 4WX2A 5CQ1A 3R11A 1L6YA 1UZ4A 3TN5A 1WKDA 4N9BA 1XDMA 2YZRA 3C61A 4HMEA 2JKPA 4N4PA 3E9AA 2ZADA 3HJZA 4XZMX 3U8GA 1XGDA 1DJYA 1BTCA 4BI6A 4HZMA 1QW7A 4AVNA 2JKEA 1VFTA 3OTRA 1QHZA 1KW1A 2W0UA 3WD2A 3TZFA 4B16A 2WHJA 3GX9A 1WXJA 3A12A 4GUJA 2BP1A 3P74A 3WLOA 5B7YA 4RZ6A 3BMVA 3WH9A 3SO7A 5C9ZA 1AUSL 3F03K 3MSDA 4GGBA 5DCDA 4JN7A 1H5YA 2GYIA 4D8LA 2E77A 5CZTA 2I7GA 5EMKA 2PEVA 3W72A 2HNEA 1VBHA 3VOHA 4JEJA 3LCGA 2G96A 3ZXWA 1TCDA 1W6TA 3BGJA 4HHPA 3WLPA 2BY3A 4E3VA 1MDLA 1VF8A 1YEYA 3S2MA 1F8IA 3HFTA 4L64A 2H8ZA 1WUEA 1KV5A 1OFQA 2Y7DA 1W9BM 5CZKA 1JAKA 4POCA 1TR1A 2V5DA 1EJRC 1HG3A 3N2CA 2PGFA 2WSQA 2XM2A 5AOUA 2JK2A 3MCOA 3W1TA 4I3GA 4CUCA 3IK2A 3M43A 3UT0A 3IIOA 4FLRA 5D2WA 4FF5A 3QGVA 1W1YA 4IQEA 1HL8A 4AZCB 1JZ5A 1B2YA 3PFRA 2WKGA 4IFKA 3WK3A 3QN3A 3UD6A 1HJWA 1K6WA 5CPSA 3N04A 3W7CA 4K37A 3WCZA 3RO8A 3NQGA 3GH5A 3SN0A 4HNTA 3FYPA 1W3NA 4J2PA 4FR1A 1F9CA 1OHLA 1H1YA 3VIMA 2CLEA 1VS1A 3BO9A 2XVLA 2DSUA 1OADA 2P0IA 4KT2A 3EX1A 3BURA 3GE7A 4D6GA 2FLIA 3LBOA 5HQMA 1R9XA 2F6UA 3BAXA 3CZJA 2ZUWA 4KGJA 4NAEB 3WEZA 3NYZA 4W88A 2CLOA 2W61A 3BG9A 2JF7A 3R5EA 1W32A 4WGXA 1N8IA 1GYMA 1XC6A 2X1RA 3H12A 4O1DA 3U2ZA 3GD6A 5LNUA 3DHUA 4JYDA 4QXIA 1S2AA 3CAQA 4WKHA 2DUZA 4NP7A 4DWDA 3PK7A 2J62A 3EDFA 3NPWA 3MS8A 4HNNA 1VFFA 3LM7A 2PDBA 2MNRA 3TQKA 3TROA 4B92A 4DO5A 2PAJA 2D1ZA 2H90A 4Q32A 5GJNA 1KLZA 4LANA 3W7QA 4DZHA 1GVRA 2XGBA 2V38A 4QFUA 1UQZA 4C6JA 2AKMA 4HA1A 1ENUA 3DI0A 3PZTA 4UC5A 4GIYA 3H8AA 9CGTA 2DJLA 4PRWA 3TW6A 3QLDA 2IPGA 2WO5A 1JNEA 2F9RA 2XSAA 3QTGA 5A8PA 4JTRA 1PHQA 1LCOA 3OYZA 5C7VA 2A21A 2D23A 3AHVA 3N18A 4I5UA 4JDYA 4DNHA 2JE8A 1VJIA 3RR1A 2OT1A 3WLHA 1E9IA 2GLKA 4DJFA 5CZ0A 2EPLX 4DF1A 3PANA 3MQTA 3KL5A 2E5BA 1GVFA 1QOXA 2PC8A 1RZMA 4KCTA 2VO5A 1XDLA 4W4QA 2XSXA 3P5YA 3MWAA 1VPYA 1V3KA 4GPNA 1NDYA 3UPWA 3SBFA 2E6FA 4PL2A 1PCKA 2DW7A 2XZ9A 3MUIA 4GI8A 3B0XA 3SRHA 1IIHA 2ZOXA 4YVPA 3FGCB 2QUTA 3AIRA 5REQB 2CETA 3VE7A 1V3HA 4C1LA 3ORWA 1YE6A 3GNDA 2QCCA 5DCBA 3W71A 2HWGA 4B15A 1E0VA 1DP0A 4M1BA 3PZ9A 3KP1A 2GGIA 3N2MA 3IJ6A 4XKMA 3K4WA 5GJMA 1J0YA 3U5YA 2JGQA 1XSIA 3ITGA 3KS6A 2NUYA 4LF2A 1R2TA 4XO7A 3T81A 1JIBA 2QIIA 1J10A 1P0BA 4KS0A 4ICMA 2GGHA 1MFUA 4AWEA 3WNMA 4PN2A 1KQZA 5CCZA 3COTA 4Q33A 1HT6A 2D2OA 3TWAA 4I7VA 3T8LA 2WVUA 1FWIC 5CEWA 3PPHA 3IRDA 3UXIA 2CKSA 2VHLA 1PO9A 2XG9A 1US2A 3A47A 3U0HA 4YN5A 1MZRA 2CZEA 3AMGA 2F6XA 1GCYA 2A7NA 4UTTA 1MUMA 1QI5A 3P14A 3U4FA 1RPKA 3VK5A 1H0IA 4LCQA 2TSYA 3LLFA 2X8RA 3MUCA 2ZTJA 5LGXA 2PWEA 3EDJA 2IPWA 4EP8C 4I7WA 4D6DA 1E4LA 2EHHA 4GNJA 4J2MA 1XIHA 4UTWA 1J5SA 5I09A 5KZMA 4LUSA 1KFLA 2QPSA 3PZIA 4X2RA 4B3LA 1FWWA 3EA1A 3VGFA 4NL1A 1O1ZA 3L9CA 3R6IA 2PGWA 3F4WA 1N7KA 4IZGA 5K7JA 5I77A 2ZTKA 2V2HA 2E25A 4DYKA 3O7UA 1Z3NA 4GE8A 3OBEA 3H4XA 4IWWA 3PBWA 1UIOA 5I02A 2Q71A 3WDRA 3CB8A 4MWAA 3UG5A 4AX7A 1VGAA 2J7HA 2WQDA 2O4MA 4TMBA 3UP8A 3VIHA 1ADDA 3GTXA 4XV0A 1D2KA 1REQB 1IEQA 5AFDA 3ARSA 3SY5A 1TPB1 3CAWA 1RD6A 4P8XA 1PAMA 2Z0IA 4DXVA 3CH0A 1AJ2A 4UMAA 3E38A 2WSPA 4JN8A 3CTTA 2BVDA 5FA5A 5CAKA 2OELA 3LHUA 1KFCA 3GO2A 4GY0A 3FA4A 5XINA 1OFAA 1JQVA 4HPHA 3QHOA 4UZUA 3B9DA 5CG7A 4C6NA 1XW8A 2IPFA 1NELA 5CSYA 3P7YA 4D6FA 2ZX6A 4FXSA 4JKMA 4MJMA 4UQ9A 3C0JA 4W9TA 1BLIA 2G8ZA 1P4CA 3RGTA 3DZ1A 3AIEA 2GUBA 3RHGA 3UXAA 2YXOA 3CIVA 2P5NA 3IIXA 1E72M 3TYBA 4C60A 1MW1A 2DSWA 2DU2A 4PTWA 4KWUA 3ENLA 1EX1A 3VIFA 3A4WA 3NO5A 3XISA 3WDPP 3UNTA 5BRBA 1US3A 4DWSB 3LGGA 1BKHA 2GDQA 3JRKA 3BVJA 4ZQNA 3B97A 1DXIA 1R7OA 3H26A 4HPNA 5EBAA 1H60A 4ADUA 2RAGA 3ANUA 1B3ZA 4GXWA 4LQ1A 4H7VA 1JL8A 3ALGA 3M41A 1RK6A 2I56A 3B0VC 1IXPA 5CGMA 1GYNA 2DH2A 3SFKA 4A3HA 5LXXA 1VIZA 2CHRA 4W8LA 4JKLA 4JOMA 2QDDA 3ABRA 5AC7A 2CBUA 3GHTA 3EWXA 4C90A 2R1KA 4A21A 4DAIA 2VEMA 5DX7A 2C0AA 3GR4A 1BVNP 3RM9A 3WO8A 1X7FA 3FIGA 4GVFA 4JL1A 3PWGA 3PAOA 4ZBCA 5JBFA 4YVXA 1K9TA 2C8NA 1FQ0A 2PTWA 4GVHA 2V8ZA 1LOLA 3QM3A 3OGRA 4P7RA 3ITVA 3NSNA 3S47A 3JW7A 1BWLA 1HKWA 3ARTA 1DJGA 1VYRA 4XBSA 3WF2A 4CNPA 3QSTA 3HQ1A 5A8NA 3TFXA 3HG4A 3VKCA 2DZPA 1LDCA 2J79A 1HW6A 3RK8A 1LQ0A 3FJNA 1O66A 3NEHA 2SFPA 4BZYA 2OCZA 3C3UA 5KINA 2CLPA 1RJQA 3G1FA 5BU9A 1GOXA 2P53A 4FLQA 2AAMA 4LYQA 1WNOA 3T55A 4B5SA 5GVJA 3T0CA 4E0CA 4GH3A 1C8XA 1XBZA 2YL8A 4B4FA 2A1YA 2X0HA 3ZFHA 1AVAA 4HKPA 5HJLA 5DEZA 3NR0A 1LTDA 1ISYA 3DFTA 1L8NA 3AS1A 5DMNA 2Z29A 4WKAA 4CNOA 4IXXA 2G41A 4FNSA 1VFUA 3L0KA 1IWBA 3BOXA 2X05A 5T9CE 3WL1A 1TJ0A 1J6PA 4ZE5A 4GY1A 4M0XA 5JU6A 4XO6A 3BAWA 2Y8UA 3R0KA 1W9PA 1HF6A 4ZFCA 3CB3A 3BAYA 2EJ1A 5G4HC 2OO6A 1CGYA 4A2RA 4BI7A 2WAGA 3P67A 4RJEA 3WLKX 1ME7A 5RUBA 1F3WA 4YYCA 3EA3A 2NT0A 4RL3A 1RJPA 3EKLA 4L65A 4F2TA 5HBFA 1WAWA 4WCJA 1B9ZA 4NI3A 4G7EB 1BVWA 3GDLA 4C1KA 1OM0A 3A22A 1OX4A 3KCOA 4MWAC 4ICCX 1W17A 2YA2A 4N4QA 4KH2A 4U31A 4C91A 3QXBA 2OX1A 3QTPA 2E7FA 1QOQA 4UMCA 2GJPA 4M6VA 3UVIA 1H61A 2E09A 3HQPA 3SCPA 3TW7A 1Q6FA 4U4MA 3PBYA 5EY5A 4QG6A 3C3NA 1JZ7A 4NYUA 2VQTA 3RX3A 4E2BA 3C5QA 3VIOA 3P62A 5AZ0A 4JFWA 2Z25A 3W1PA 2J27A 4HMDA 4KWSA 1M6JA 3WYZA 1JD9A 1K8XA 1EBHA 4BKNA 2PWDA 1V6VA 1RXOB 4E3TA 3L23A 2O7QA 1HXJA 3MCMA 4MB1A 5LNRA 5CPQA 2G37A 1W2VA 4JZ5A 1FDZA 3N34A 2Z1KA 2VP8A 1SMDA 3UWWA 4LB3A 2FJUB 2VUNA 3DG6A 1FCUA 4D9PA 3LN3A 3A6OA 3UZYA 2XVGA 4N6FA 1H0GA 3CIWA 3W26A 4J40A 3W1NA 1JGIA 1K70A 6PTDA 3S1WA 3PM6A 4YS1A 1XYCA 2CBIA 1E3XA 2Z2BA 3GBDA 2F84A 3OLEA 4BF7A 2XSBA 3AYTA 2D24A 3UEQA 3IJ7A 1VLIA 3TQVA 4L9ZA 1RCXB 4GLEA 4KGLA 3MKVA 4PUNA 4Z0JA 3ITOA 3ZJKA 5I3HA 2ICSA 3CASA 3AQUA 5C2CA 4OGZA 1FWCC 4HU3A 3STPA 2WXDM 1P7TB 1RBAA 1UKTA 2X0YA 4GOAA 5M17A 3IUHA 2DIKA 5J5DA 3VABA 4RPQA 4C6CA 3LCWA 5T8GA 2QPXA 1WDQA 1Z32X 2GJXA 1OYAA 3GYCA 1RVGA 4S3BA 1I45A 3O6AA 3VOIA 3KOWA 3CZ8A 3SADA 3L0NA 4PSRA 3M07A 1ZCOA 4R53A 4QHRA 3O9NA 3TSMA 4DUXA 4BCEA 3N73A 4B5VA 2EG7A 2FGZA 4DPQA 1UZ1A 2ZXDA 5D30A 2CESA 3MHFA 1XIGA 4UTIA 5G2HA 4EACA 1R87A 1TG7A 2V5BA 2D2HA 5CC3A 3S3GA 4QCEA 4QE4A 3E2SA 3LLDA 3O6YX 1GK8A 3WFLA 1DL3A 4NT0A 3B9OA 2WJDA 3N11A 2V2CA 3W84A 3EZ4A 4WEVX 2WLZA 4CN6A 3QW3A 3ZQ9A 1I2OA 1LL4A 3MV01 1JQXA 4BHYA 4Z08A 2VT0A 4E8GA 4UCGA 4DWSD 3BCDA 1P6CA 1W1B1 3LA4A 3JS3A 2WLYA 5I0DA 3RFAA 5A2CA 2OYLA 4GBUA 4BF9A 5E9XA 2O9RA 4HOXA 1SM9A 3WMCA 1GTHA 3PTKA 3CQKA 4B4HA 5M1TA 2VEFA 4IIFA 4HIBA 1AK5A 3OA3A 4K7VA 4HNUA 2Q02A 3W7PA 1D7FA 2W5FA 1GQIA 4AVOA 3C2VA 3STCA 2OQHA 1SZGA 2YA0A 3GS6A 2Z00A 1FX6A 1WUFA 2D69A 5FJOA 4FO4A 4HTYA 2VZOA 4J3TA 3QKZA 5C9XA 2HXTA 3LNMA 3QY8A 3SUWA 3C56A 5D32A 3W38A 1EH9A 3LI0A 4Q8UA 1U1JA 1VLWA 2FH6A 5C71A 2VEKA 4JTLA 3RX2A 2HS8A 4O53A 3V1HA 4Q4QA 1W54A 2R1PA 4Y6GA 2NVAA 3C0QA 5TF0A 3KBWA 4S3FA 3WQ5A 5E0FA 3L5LA 4K1GA 3PWAA 3DGBA 1R7AA 4X2PA 3E0VA 3WLLA 3TEVA 3U2OA 3WQDA 3CM4A 4AWTA 4N0RA 2DT0A 4M6PA 2EPKX 4LBUA 4U2YA 5BXSA 1E40A 2PD9A 4IJRA 1IEVA 1TTJA 5I7GA 3N3MA 4KMQA 1FTXA 2BFGA 2CLMA 4YMZA 1UKOA 3ARPA 3ZT6A 4GMEA 2DZSA 4K36A 4M80A 4KRUA 4DPPA 3HPXA 2X40A 4W87A 5A6LA 2HEJA 5HK4A 1K4GA 1OWQA 1XX1A 4HZ7A 4BWLC 1Q4WA 3WH6A 2PTYA 4HK5A 1AH0A 3G1VA 2A3BA 1Y65A 3ZLHA 4G1NA 1UPMB 3BG5A 1ISVA 1JCLA 2PUZA 2Z1SA 5AC8A 3OVGA 3EAUA 1ZBCA 2YFOA 3GAKA 1EWDA 1J93A 4JY8A 1XYAA 4GQGA 2WANA 4AZ7A 2Q09A 2PDYA 3SUTA 1TJPA 2C1GA 1DQUA 2VC5A 4YL2A 1WZAA 3BK0A 3TOYA 2Z2AA 1L2QA 3NO3A 4Y9OA 3TFCA 4CQAA 2GGEA 1R47A 3GNPA 3UJRA 4K6AA 1GEQA 2VOMA 2I9EA 1AZ2A 1NFBA 3APTA 1AQFA 4AHQA 1HIZA 1KV8A 2OYKA 3ABXA 1RBOB 3LCIA 2IKGA 4FPSA 4A8RA 2GVLA 3QMRA 1M9HA 5D05A 3R1ZA 2G3MA 4GC4A 4QS6A 3GVRA 3MCNA 2BVWA 3ARZA 5LXEA 5JXQ