5BMXA

Crystal structure of t75n mutant of triosephosphate isomerase from plasmodium falciparum
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
247
structure length
247
Chain Sequence
ARKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYNGEVSAEIAKDLNIEYVIIGHFERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords Triosephosphate isomerase
publication title Probing the role of highly conserved residues in triosephosphate isomerase - analysis of site specific mutants at positions 64 and 75 in the Plasmodial enzyme
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 98
structure length 247
sequence length 247
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2015-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5bmxA00
1PHQA 1VJIA 5EKYA 3W7NA 1VCFA 4OGZA 2Y62A 5FEZA 3S1XA 1OX4A 3LXAA 4HPJA 2V2DA 2DJLA 3T78A 1W5NA 2QAPA 3P81A 1OFRA 3PUEA 1XBYA 3S6DA 3OBKA 1KFLA 2E6AA 3C2VA 3PG8A 3TR2A 3EEGA 3W23A 2YFOA 2DU2A 2E09A 2ZRUA 4KFOA 3MYPA 1QPRA 1KV8A 3QPYA 2ZTKA 1O5KA 3QSRA 4Y8FA 2FLIA 1G6CA 2E1DA 2R94A 3WJXA 4OE7A 3S5NA 2WSYA 3B03A 1JRBA 4NQ1A 3LV6A 3LCLA 3HBLA 2NX3A 3TXZA 3GKAA 3R5EA 4NJIA 3KRSA 3DZ1A 4K36A 3PAJA 1LZOA 1HO4A 1YTEA 1FWSA 1PE1A 1XM3A 5FF7A 1SO3A 5I3GA 1GVSA 2R91A 5F4XA 1TRDA 2WSRA 3B0PA 3N19B 4AXKA 4RR4A 3TQKA 3B4UA 3DFNA 3W7DA 4UCGA 3WK1A 4XUGA 2DP3A 4CQ8A 3KOFA 4I7WA 2Y7EA 4EF8A 3O07A 3OVQA 1GQNA 3V75A 3G0XA 5C54A 4R53A 1Q6OA 4KWVA 1JCXA 4LS1A 2J9XA 1K03A 4DO6A 4HN4A 4S1FA 4FEZA 4EF9A 3C61A 2CLHA 5HR6A 3WJYA 1U83A 4ORIA 3QF0A 3I6RA 5D2XA 3UPBA 3G18A 4LC6A 3EXRA 2B0MA 3W7RA 3MO7A 3NG3A 3A21A 3L0GA 5HINA 1YPFA 3VCRA 1IF2A 1P0NA 3OA3A 3PBUA 1ICPA 1H63A 3R89A 4LV4A 3TCEA 1ALDA 1OFDA 5CZJA 1I2NA 2QCNA 4WQ6A 1H50A 5L9FA 3IGSA 3P84A 5D37A 4I7VA 4JTIA 1WV2A 2J27A 3C2OA 5IBXA 4UTWA 1OFEA 1GVFA 2XN2A 3G1HA 3MI6A 2RDTA 3E0IA 1W5MA 2X1SA 2ZZ1A 5D38A 3FKRA 5D05A 4RV8A 1C29A 3GB6A 2JKPA 1N8FA 3C2FA 3WJWA 3LV5A 3LLFA 2E5BA 2V0TA 4UTLA 3GXNA 3L5LA 1UCWA 3UD6A 5I3IA 3FA5A 2NX9A 2ZZ6A 1KM0A 3EWXA 4UFLA 5HQEA 3W7PA 1A53A 2WPBA 4UR8A 1C8VA 3KFTA 4UIOA 3G3DA 5DY2A 3U6WA 4HNVA 1L9WA 3M44A 4H6KA 5D03A 3C6CA 4MYXA 4IMFA 4CCEA 1YXDA 2ZDRA 2RH9A 3ZS4A 1HL2A 2C16A 4I9AA 1BWKA 1VYRA 2Z1BA 4WXYA 2QEZA 4NJHA 4HPXA 1HG3A 1SZNA 3F4NA 2DJXA 4JTJA 4QIUA 5CG7A 1XUUA 1B4KA 2FDSA 1W8SA 1LM1A 2F7FA 1SSDA 2GOUA 3O16A 1DV7A 3MP4A 4RJEA 5T26A 1TJRA 4QNEA 1QCWA 1XFBA 3TJXA 2YW3A 4FB7A 4PFMA 1TRIA 4FHAA 5C55A 2VELA 4UFIA 3F03K 3NOEA 1QMLA 4M7SA 4CQ9A 4E38A 1JR1A 2G95A 2JBMA 2YGYA 1TV7A 4IUOA 3BGJA 2W0UA 1MXSA 1WOAA 5LHFA 3B06A 3O8AA 2EKCA 1OG0A 3NL2A 1B4EA 4JXCA 4YLWA 3NDOA 5LSMA 4I7UA 4Q4KA 4MJMA 3S0CA 3MBDA 3M5YA 3NA8A 4PC8A 4XTIA 3G3MA 3LM7A 2VKZG 3HG2A 4QQ3A 3G1SA 2ZZ5A 4IMCA 1TQJA 1S5WA 2X30A 1KW1A 2G5WA 3M5ZA 4P61A 4UTTC 2WNQA 1V5XA 3MI3A 1LRTA 1B57A 3N2MA 4NNAA 2ABBA 4MZ1A 4UFJA 4WJEA 1P5BA 2XFWA 4O0KA 3W2KA 1VR6A 2ZRYA 4FO4A 1F73A 1YXCA 4NX0A 1I2RA 4K39A 1JQVA 3LHZA 1W31A 4Y9AA 3TA6A 4Z0JA 5D09A 4DEFA 3SIZA 4AAJA 1YXYA 3DFOA 2FTPA 1S3HA 3P67A 1JJKA 5G2HA 4BF9A 3GAYA 5AHIA 2ZTJA 4AVFA 1TTPA 3CB8A 4IX2A 4IXXA 2E68A 3SGUA 4JYEA 1IIHA 4AMAA 4O18A 4AF0B 5FEWA 5DELA 4OV4A 2J9ZA 3KRZA 2ZRXA 4MY8A 4Z1AA 4KWWA 1RV8A 3NQVA 3TSDA 4YMZA 1K02A 1TMHA 2BX7A 3SGZA 3FOKA 1OF8A 3HG4A 3KXQA 5G5IA 5TQLA 3EXTA 3BARA 3B04A 2JGYA 1YDOA 4J9JA 1KTBA 4TMCA 3GVGA 2A7PA 5KZMA 3O05A 3EWYA 3LTPA 2NXGA 3LCWA 2RDUA 5DCDA 1R46A 4YWIA 5LZLA 1Q3NA 1T0OA 1F2JA 4ADSA 3ZR4A 4A2RA 1YDNA 3LCXA 1W5QA 3TIMA 4ONVA 3AJXA 1A50A 4LT9A 5E0KA 3G1XA 4MIMA 1W5PA 4LS2A 4UFKA 3W75A 4N6FA 1ZY9A 1WYIA 4O8RA 5TBOA 1EWDA 4XZ9A 4OWGA 4RZ5A 1EB3A 2CZFA 1S5VA 5HJLA 3L9CA 4MY9A 3N73A 2QCEA 2P10A 1QPNA 4IMGA 1OYBA 3UQNA 1JULA 2J6XA 3ANYA 5G2WA 3VNDA 1DL3A 1GTEA 3FYOA 3TSBA 1HTIA 4OV9A 5BW6A 3T55A 1YTDA 1O5XA 3GDLA 4UTHA 1I2QA 4TR9A 2Q8ZA 4X3ZA 1EP1A 3MHFA 3QC3A 3W7IA 3TKFA 1U5JA 1I2OA 4IWWA 4DO4A 5I3HA 1L2UA 3GZ3A 3STFA 3LHTA 5AHLA 1RR2A 2C0AA 3HPZA 4QNWA 4O1AA 3P8JA 3W73A 2VEPA 1SR9A 1VRDA 4ML9A 1EUAA 3S1VA 4UNLA 1G4PA 2PRHA 1KM3A 1EEPA 1E51A 1K7XA 2BXVA 2ZRVA 3MHGA 4IPJA 1Q6QA 3CTLA 4RLIA 1NEYA 4GUFA 2V9DA 3W7OA 5F2GA 4ZQRA 3C4UA 5KZEA 2H90A 2V30A 3UWQA 1Z42A 1O95A 3PC0A 1VLWA 4XBSA 1P0KA 3UNDA 3VE9A 2FPVA 2R14A 2PRMA 1ZNNA 5HUPA 3CC1A 3LXCA 4IXHA 4H4IA 2DZTA 3P61A 3SY5A 5ABTA 3HIJA 4LRSA 3R13A 1FWRA 4UR7A 4JDBA 4NNBA 4K38A 1T99A 2JGQA 4O13A 1EP2A 1TJPA 1H7OA 3LXBA 5BRBA 3DENA 4WOZA 4RZ4A 4N6EA 3DU0A 3THQA 4D2JA 3INPA 4NZFA 3QMRA 1B3OA 2TPSA 3SI9A 2VOMA 4O1BA 2FIQA 3STEA 4LVFA 1GZGA 4MUZA 3OVPA 3O6CA 5FI8A 3EWWA 1AW2A 4PODA 1WA3A 1N7KA 1OFPA 3CU2A 4DF0A 1J5TA 3M1ZA 1KFCA 2C18A 3KAOA 3IIPA 3CM4A 4A2SA 2Y89A 1KV5A 4R7JA 2E6DA 3ABQA 3L66A 2VFEA 1SUXA 4BFAA 4CNNA 1TTJA 5BOOA 3H53A 4JTKA 1F7BA 1FUYA 1XBVA 1OABA 2ZA3A 3B8DA 3L65A 3P74A 4AWSA 3RNDA 2QCCA 1MEIA 4JIQA 2OJPA 5D32A 3LCHA 3TQ0A 4X9SA 1YLVA 5K7JA 4UC5A 4WX2A 1H61A 1M5WA 3LI1A 3T40A 2A5HA 2C14A 2UV8G 1VS1A 3TQVA 1GTHA 4JTFA 1K7FA 4EWND 4LV9A 1JCYA 1OFBA 1P4CA 4NJJA 3W1NA 3CEPA 1KLZA 1OK6A 5HWMA 4E2DA 2XN1A 3CPRA 3M5XA 4IMEA 1RQBA 1S5TA 3T44A 3KVJA 4Z1DA 3NPVA 5H2ZA 4K8EA 4K7VA 3W76A 5LNSA 5MHBA 3TC6A 3OIXA 2VFGA 1C9DA 3CIWA 3JR2A 2ZBTA 1QAPA 1AW5A 3TXVA 3EX6A 2ZRZA 4JTUA 3BG3A 1SW3A 4AWUA 3W1UA 3GYEA 1FXPA 2DZWA 2RFGA 3NXFA 3E96A 3L67A 4ORMA 5LNRA 4IOTA 3N2XA 3PM6A 1FCBA 4O4VA 3QRHA 4JTTA 3NQDA 1KBIA 1DQXA 4O54A 1TV8A 1OYCA 3E12A 2O7SA 3NQGA 3UXDA 3SJ3A 3KVMA 3GIYA 2NV2A 4ZL1A 1OYAA 1LTDA 4GFSA 3GAKA 2BWGA 3TFCA 3OVRA 1TB3A 4HKPA 4M6PA 4Q33A 3HGSA 2D73A 2EAWA 5D2YA 1H1ZA 3MBFA 1W0MA 3G0SA 5D02A 2FQIA 2Z6JA 2YCEA 3Q37A 2Q3RA 2X16A 3BVJA 4JTHA 1O4UA 3TNOA 1DHPA 2NLIA 3IVUA 4POCA 5AHNA 5A5WA 2BSLA 2YDAA 1KBJA 4FNTA 1KM2A 3LI0A 2W79A 4MLJA 3UWUA 4C1LA 4NXSA 2VFFA 3CT7A 1R2TA 3Q58A 4K6AA 1N55A 1GPWA 4FXRA 4O15A 2NXHA 4JEQA 4FNSA 3W1LA 5EPDA 3TUUA 4N4QA 2VENA 4FX6M 2GQ9A 4O17A 3FKKA 4CCCA 4B5NA 1SZEA 4XWUA 1SZFA 3P5YA 2DZVA 4R34A 3PSWA 1F5ZA 3CEUA 2G96A 4ZQMA 2F84A 3CQ0A 4M5PA 3W2UA 2NWSA 4YCOA 5DLCA 3DI0A 2EPHA 2GQAA 3STGA 3G1YA 1LOSA 1MZHA 2QDGA 5D30A 3L0KA 3HGRA 4MFEA 1H7XA 1W37A 3U8GA 3G8EA 4FXSA 2PCQA 2Y6ZA 4WY0F 2XN0A 1K8YA 3G24A 4N9EA 3RK8A 1RQHA 3L0NA 5AOUA 4O19A 3S8HA 2Y85A 1FBAA 1SQ7A 3LHUA 4A3UA 2V5LA 4NT0A 3K30A 3LCGA 1V7YA 5BMWA 5LHEA 2Y7GA 2Q8LA 1ZJIA 1L6SA 4N9BA 1GG1A 1KM1A 4HT3A 1QR7A 3PF3A 3TFXA 4BWLC 3F4WA 4LS0A 4QM1A 4O52A 5K9DA 2ZA1A 3BW3A 3NPUA 1X7FA 5G2IA 3NVTA 3BPWA 3HJZA 4JN6A 4ZMGA 2GJLA 4JX6A 4CNPA 3NPWA 1VZWA 2DZSA 3B0VC 1XC4A 3NQ6A 3HG5A 4NXKA 1TREA 5E1QA 4AH7A 4MPQA 5G4EA 3ZWTA 1WX0A 3IGXA 1K3UA 3MMTA 1I4NA 3W85A 2V5BA 3HF3A 4CQAA 3HGOA 3G22A 4ALDA 4WOQA 3UYCA 3BK0A 1FDYA 4FX7A 1BKSA 5CPMA 1MEHA 2X1TA 1JUKA 1GEQA 1IXNA 3G1AA 2QCLA 3S5ZA 5HR7A 3DFPA 1WBHA 1WXJA 3NL3A 2JKEA 1FX6A 1TSIA 3G1VA 2Q3OA 4MFDA 1M6JA 2PRLA 1PHWA 2E5DA 4JNMA 1GYNA 5CZSA 2E77A 3W70A 4RXGA 1K8ZA 2ZZ2A 1JRCA 3N14A 4NUWA 2YXGA 1LLZA 4HNUA 1GVOA 4DBEA 4UMBA 1F05A 1KM6A 3Q94A 4L4MA 1LP6A 4HIBA 1QNVA 3HGJA 5F2IA 3W87A 1EPXA 2J24A 1O60A 2QJHA 3FLUA 4XQ6A 5BNKA 2ATSA 5EBUA 4G1KA 4XKYA 4AWTA 2DZUA 4X22A 2A2IA 3W74A 4XBKA 4DPPA 1PIIA 1GT8A 1X1OA 1TCDA 3LBMA 1W5OA 4IJBA 4JX4A 3PBWA 3W7QA 3M47A 3PS7A 1BTMA 3PB0A 2WO5A 3OHIA 1WBJA 2OX1A 3B05A 1D3HA 3NO5A 4LVGA 2VXNA 4Q32A 5DBUA 4AHQA 3TJLA 2DZPA 3IIXA 3KRUA 5G1YA 4LUIA 3W2JA 3ABRA 3O1NA 2YR1A 3TU9A 1OFOA 3OEXA 3NQAA 4MOZA 2Y61A 2OT1A 1SO5A 3Q2DA 3D0CA 3MI2A 3C8FA 3S42A 4PCFA 3L21A 1FDZA 1KA9F 3GDKA 4DF1A 3NM1A 2FPYA 3KHJA 2A85A 4XTDA 1LRNA 1MSSA 1TIMA 1TTQA 3JS3A 5U7SA 2VEMA 1SW0A 2NUXA 1XBZA 4M6VA 2VEIA 4TU1A 5CPOA 3PUDA 1JCMP 4WXZA 1TPUA 3P82A 4UTIA 3MWAA 1LBFA 4N2YA 1GWJA 1CX9A 3QW3A 2VC6A 2YX0A 1VGAA 1AK5A 2W6RA 3C3NA 2NWRA 3UWYA 1DBTA 4FNQA 4M7TA 4RXFA 5IBXC 4UTWC 4GJ1A 3VI2A 3TROA 4DELA 1Z48A 3LCIA 1A5AA 2CLMA 3E9AA 4GBUA 3LDVA 1VHNA 3JRKA 2OCZA 1NFBA 1KFEA 3TH6A 4UMAA 3S1WA 4LWWA 3W7KA 4GXMA 4AB4A 3S5OA 5I3KA 2H8ZA 3U2OA 1YYAA 5KZDA 1VYPX 2FJKA 4NX5A 2NUWA 5K9XA 1A5SA 2ISWA 1ZAHA 2CWNA 3P62A 2Y70A 4M6QA 1D3GA 3CIXA 4N9CA 2Z2UA 4NVTA 1DJNA 1RQEA 5AN7A 3W72A 3FJ6A 5CZTA 1IXQA 3W84A 3G1FA 3GR8A 3USBA 3NZ1A 4MVAA 3A9IA 3PR2A 4FX8A 2ISSA 5K2ZA 5K9CA 1W54A 5LNVA 3O06A 4UXDA 1ZAIA 4S2BA 1A5CA 1G7VA 3M41A 3V1PA 3IV3A 1H7PA 3W1MA 3H54A 2QDHA 3LB0A 4GUGA 1UUMA 3GDTA 2TRSA 3W3OA 3I7QA 3VKJA 2YFNA 3W1QA 2Y88A 4DBDA 3M7WA 5HWNA 4BK9A 2HTMA 1ZHAA 3MJYA 3TMLA 5AFDA 1R2SA 4PL2A 4UNKA 3FS2A 1LYXA 3IGUA 4JX5A 4PEKA 3GXPA 2YPIA 3IRDA 1VHCA 5F4SA 3W22A 3W6YA 4KFNA 2A0NA 1VPXA 3KX6A 3MP5A 3CLMA 2A7RA 3I65A 1QWGA 1ZCOA 3W7JA 4O10A 2H8XA 3KVKA 4Z1CA 4EVZA 3NQEA 3TX9A 4O1DA 2OMAA 1SU5A 3EX3A 3S1UA 2C15A 2I9EA 3TAOA 2Y7FA 3RMJA 2CZ5A 2HSAA 4HNTA 1W3NA 1XI3A 2C19A 4JGDA 4ZQCA 3C52A 3FFSA 3NGJA 2EHHA 3GDMA 2ZA2A 3W1XA 1BWLA 4HSOA 4JICA 2AGKA 3E49A 4K37A 1Q6LA 4ADTA 3BGGA 3MUXA 2QKFA 4FNPA 2H6RA 2A6LA 2WV8A 1SSGA 2GVLA 3N9RA 1JCNA 2X1UA 4JS3A 3CWOX 2Y7DA 5HUOA 3W7MA 5D2WA 3WK0A 1WDWA 5CSRA 1FXQA 5U4NA 2CW6A 4RCXA 3W71A 4CNOA 3NAVA 3NNTA 4PTNA 1XUZA 4UTUA 3HOJA 1FCQA 2P1FA 2O7QA 4LTSA 4CLMA 1H60A 1TO3A 5CSSA 3UY8A 2VFIA 5DCBA 3TAKA 4IPIA 1R30A 2CLLA 3W2NA 2QUVA 4JTLA 3QM3A 1QO2A 2C1HA 5I3FA 3EB2A 3QMTA 2A21A 3DGRA 1PS9A 4AHOA 3I7RA 4BI5A 5H91A 5HULA 4MZ8A 3GR7A 1XXXA 5AC6A 1RZMA 4YXGA 2ATMA 3EX1A 1P1XA 5FEXA 3HPSA 3PVFA 1PL9A 3EKZA 3N9SA 4KFPA 3PBYA 2GVJA 3EKLA 2E6FA 4WZHA 1ICSA 4LOCA 1ME9A 4FNUA 4LUJA 1LDCA 3FJLA 1QPOA 1G4EA 4TMBA 3WJZA 3PBVA 2BLEA 3ABSA 3DI1A 2LLEA 3GNNA 5EMUA 6ALDA 2ZYFA 4E2BA 1F6KA 1FCUA 2V81A 2CU0A 3AO0A 4GC4A 3EWBX 3W7EA 2FB3A 2OT0A 3NQ7A 4QISA 5F4WA 1D9EA 3C56A 4O4WA 3ELFA 1ZENA 4N4PA 3W7CA 3PY2A 3FIGA 2RKXA 1A5BA 4MZYA 3M43A 3DFTA 3WFAA 4HNNA 4BR1A 3QZEA 1TPH1 5AYXA 2Z0IA 4XKYB 5EY5A 1VC4A 5LNUA 2A6NA 2KZHA 2C6QA 3GDRA 5LGXA 3LLDA 1Q45A 3UWZA 3I7SA 1QOPA 4JYDA 1F74A 3EWZA 5FF2A 3DH7A 4M19A 1SFJA 1VQTA 4MYAA 3P7YA 4S2CA 3W7LA 5HMSA 1HUVA 3QSTA 1EP3A 2WQPA 3S9YA 3W86A 1NSJA 3G0UA 3BV4A 1AW1A 2NX1A 2WJZA 4WY0B 4LVDA 2V82A 3ATZA 1LBMA 4ZZ9A 1AL8A 1OVDA 5HWJA 3LX9A 1NF7A 4QAIA 2TYSA 5KINA 2VFHA 3SW6A 5AHMA 7TIMA 2I1OA 1W3IA 1WOBA 1OJXA 2PC4A 4JTSA 2BZNA 1ZAJA 1NVMA 2V2CA 1CI1A 2X1RA 3BG9A 3MYOA 4DF2A 1MO0A 3TE9A 1R47A 2NXIA 4LW7A 1O94A 3O6YX 2ZZ7A 2FPTA 4NU7A 5F1UA 3VE7A 3QYQA 4QJ1A 4L4LA 1AL7A 1AMKA 1F76A 3HPXA 3A23A 3BLFA 1ML1A 2TMDA 4OBTA 4KKXA 2CZEA 2CLOA 4K7YA 1SO4A 1YTKA 1TPC1 1KM4A 3NPXA 1KFBA 3GX9A 1OX5A 2RHGA 3OG3A 2OZ0A 1HO1A 4EOUA 3L68A 4NJKA 1OF6A 2R8WA 2ZCGA 6TIMA 1I45A 3LBCA 1LBLA 3BLEA 1DQWA 1ME8A 3IVTA 3C2RA 3CHVA 3S5YA 3GKFA 4OT7A 4UTTA 1EIXA 3I68A 2QUUA 4QITA 1VYSX 3LRKA 1W3TA 3PWAA 1H1YA 4ZVJA 2B4GA 4TX9A 3TW7A 1KFJA 5EYWA 4JTEA 1FWNA 3RF9A 3RFAA 3QJAA 4GE8A 4RK8A 3DFQA 4YL2A 4O14A 1AG1O 1DJQA 1IIGA 1JQXA 1LROA 3UZ5A 4O1CA 1G4TA 1PCWA 3UWVA 3R2GA 5FF3A 5CPNA 4R33A 2B7PA 2GUUA 5D2TA 1SO6A 2I14A 4FNRA 1X1ZA 2PE4A 2FFCA 3LRMA 3NQ8A 4ICNA 1W56A 2FB2A 2WOQA 5DXYA 3N34A 3A24A 2QAFA 4NZJA 5KTLA 3MW7A 3L5AA 5IM51 3P60A 4GUJA 4U28A 4FIRA 5GVJA 3QPZA 3LHYA 4RZ6A 4RX0A 4LVAA 3M5VA 3LTSA 3PUOA 4O16A 3IIOA 2AAMA 2GPTA 1KFKA 4O50A 4GNJA 3UY7A 4OQVA 1RVGA 1TPB1 1XKYA 1H62A 1H5YA 3TK7A 2CLKA 2V2HA 3QQ1A 5I3JA 4Y90A 2GVGA 1F6PA 4GWEA 2CFFA 1G67A 3PG9A 4AEOA 4PH6A 2ALDA 5D2VA 3A22A 3LRLA 3IIZA 2HS6A 3O15A 3SR7A 3BW4A 4TO8A 2JK2A 4DPQA 3MP3A 1XL9A 2E5CA 4UTKA 3LHWA 2CLFA 4JDYA 2ZFAA 4BI6A 2DORA 1VH7A 5DBTA 5DY3A 3R8RA 4HSNA 5EL1A 2B7NA 1W1ZA 4NNCA 4PA8A 3DXIA 4UUIA 1TPDA 1OFQA 4GUIA 5C6MA 3M16A 2A7NA 1QPQA 1XDMA 4U4MA 5D33A 1LOQA 1TTIA 2HS8A 4E0CA 5D04C 1SW7A 3BG5A 1Z41A 2CLIA 3DFSA 5KSWA 5FF0A 2IQTA 4DQWA 3W7GA 4IX0A 1K7EA 3TSMA 5LNWA 3LERA 4JD4A 5CGQA 4LRTA 1GOXA 5L6UA 1SFLA 3LCFA 2A4AA 4OU1A 5DN1A 4JIPA 3CWNA 2ISVA 3NQ2A 4RKAA 2QCFA 2JKAA 5G1TA 5K4ZA 4UTJA 1B9BA 2CLEA 3QMSA 2QCMA 4BI7A 1UBSA 2WKJA 4MKNA 5J5DA 5CKSA 3NQFA 2AQWA 1Y0EA 1FWTA 4N02A 2Z6IA 5AYYA 3E02A 5DCEA 1QO5A 1BEUA 2J88A 1GG0A 5C2XA 1TYGA 4WY0A 2QJIA 1ZFJA 3C2EA 3W2LA 4PL1A 5C5YA 5K3VA 4GRSA 3LHVA 4C1KA 2QCGA 3HMJG 3UWWA 3W2MA 4O53A 1FCVA 2WNZA 2Y63A 5AHEA 3QQ0A 1CW2A 1JUBA 5SWUA 2EF9A 3W1PA 1UASA 4LU0A 4TIMA 3O6DA 1I8JA 3UZJA 3WJSA 1ME7A 3EXSA 1LORA 2QCHA 3GNDA 4MJZA 4A29A 3M9YA 1DVJA 1YPIA 1FWWA 1ONRA 4UMCA 4UFMA 3M6YA 5DXXA 1RPXA 3FEMA 5J5RA 2QF7A 4W9TA 4H3DA 2CZDA 4LNYA 1OK4A 2NV1A 3THAA 3PB2A 1IGSA 1VLIA 1L6WA 3KVLA 1IXOA 1TPVA 4UFHA 3DHDA 4JTGA 4JYFA 5F2LA 1QFEA 4JY8A 4ZQOA 1XCFA 2QCDB 3GLCA 3F1QA 1R2RA 1WAUA 1UUOA 1FY6A 2A1YA 3O63A 3STCA 2YSWA 1GVQA 3DKLA 2G97A 3LOTA 4Y6GA 5E93A 3P80A 3FYPA 3LTYA 3IVSA 3EX2A 2HMCA 1OX4B 4JY9A 4LY8A 3A5VA 1QDSA 3ATYA 5G4WA 3UPWA 4O12A 1ZALA 2V8ZA 1JCLA 1PVNA 3WK2A 4Z1BA 1X6UA 2E6YA 3W1AA 3PSVA 4DO5A 4UTMA 3RU6A 4CCDA 4O11A 1OFAA 1FQ0A 1G4SA 1Q6RA 3RLUA 3HO8A 1VCGA 1QOQA 3N3MA 1FDJA 2PURA 4Z08A 1GJPA 3UXAA 4Y96A 3A5FA 5LGZA 1KM5A 5HNRA 4IMDA 3WK3A 3T4CA 1JCJA 3ABOA 1DORA 2GQ8A 1H7NA 1KLYA 5FEPA 1ADOA 2YZRA 1EWEA 1H7RA 3W83A 2QR6A 5AHFA 1K8XA 1KTNA 1SPQA 3TV8A 5TIMA 4Z0SA 5AC8A 4HHPA 4A21A 5AYZA 3SECA 1TPWA 1T96A 3P8IA 3BW2A 2WNNA 1LLWA 3GXTA 3TDFA 1H51A 5A8GA 3W1TA 5FESA 3TMQA 2QUTA 5EA9A 1TPEA 3GK0A 5F2MA 4WD0A 4JR5A 3HG3A 1YDVA 1GYLA 4NJGA 1M7PA 1HFBA 3NR0A 3BLIA 3HB9A 3NQCA 1EA0A 2C13A 1TV5A 1OX6A 3ZFHA 3TW6A 3QEZA 4A22A 4P2VA 3PULA 3W07A 1G7UA 5CZ0A 3IIVA 1JVNA 4EIVA 3ZWSA 3W88A 1T8XA 5F1VA 2B7OA 3DKJA 3TC7A 3HQ1A 4YCPA 3NL5A 8TIMA 3C0JA 3W7HA 5KITA 2ZZ4A 3NYZA 1X8FA 3QFEA 1XBXA 2YYTA 2QJGA 3T7VA 1H7WA 5K4XA 3MHUA 1LRQA 4AHPA 3LGEA 3M0ZA 2H3DA 1TQXA 5FF4A 4MLRA 4O57A 3DHFA 1TPFA 5AC7A 2P0OA 3VFLA 1THFD 2ZRWA 1J4EA 1NAL1 5CPLA 3R12A 4QSHA 2NUYA 4FF7A 4X2RA 2YYUA 3DBPA 3SFKA 2X2GA 1L6YA 3B0UX 1ICQA 2WSQA 1SZGA 3SSJA 4ZQNA 1VCVA 1DOSA 3G8RA 1EUNA 2ABAA 2H3BA 4IQLA 3L5MA 5LKYA 3P5ZA 1WQ5A 2VFDA 4WUIA 1G69A 3NZRA 2NZLA 1PV8A 1M7OA 2VEKA 3NL6A 4DXVA 1I2PA 4LC8A 2DZXA 2B7QA 3NM3A 2C3ZA 3QW4B 3W9ZA 3NQMA 1EX5A 1JUEA 2BTMA 3DAQA 3G1DA 5AB3A 1GVRA 1PCKA 1UJPA 3BO9A 1XDLA 3SZ8A 1LOLA 4LVBA 2J9YA 2RDWA 4IGHA 1J2WA 2YW4A 4N9DA 1LCOA 3L2IA 4BWLA 1IXPA 4O28A 4GUHA 4AF0A 1NF0A 3EX4A 5BMXA 4O0ZA 2EGZA 1RD5A 1Z44A 2ZZ3A 3EWUA 3W1RA 2GJNA 1KTCA 3NEVA 1MEWA 1YADA 2TSYA 3YPIA 3IEBA 2ZQ0A 4MY1A 4ADUA 4K8HA 3RLVA 1UB3A 1OHLA 4ZQPA 3H55A 5KMYA 4OHQA 3QH2A 2QCDA 1DKWA 4FIQA
chains in the Genus database with same CATH superfamily
4ZB0A 3BDKA 5EKYA 2PD5A 1I1WA 4OGZA 1SZRA 2Y62A 3BLOA 4HPJA 3VD5A 3T78A 3N12A 1W5NA 2D2JA 3U7BA 4HQVA 4ATWA 1TV2A 1E55A 2IPJA 2D24A 4H00A 3PK7A 1JIBA 2VWSA 2DU2A 2E09A 2J25A 5BXRA 4RW3A 1YNYA 1HKMA 2REQA 1KV8A 3QPYA 4CNTA 4UOZA 1O5KA 3QSRA 4M1BA 3RO6A 3AU6A 1G6CA 2R94A 3GG7A 3ZT7A 2V69A 3WJXA 4OE7A 3S5NA 1HF6A 1P7TA 1JRBA 4RPQA 4NQ1A 1DJGA 1BTCA 2NX3A 4NJIA 1NIUA 1Z89A 3DZ1A 4K36A 1PE1A 1ZRQA 5F4XA 3B0PA 2DH2A 5REQA 5DQPA 3W7DA 1QHZA 4XUGA 2POZA 3ALGA 5F7UA 4HMDA 3MMWA 3AIQA 1Q6OA 2YCIX 4XZNX 3U9IA 2QGHA 4HN4A 5C2CA 3WF1A 4EF9A 5E70A 3C61A 2CLHA 5HR6A 1BGGA 4ORIA 1AJ0A 3CJPA 2WC4A 1QW7A 2PEVA 4C6IA 3LUTA 4LJ3A 3W7RA 1HL8A 3MO7A 3NG3A 3A21A 4NKCA 3SCOA 3NWRA 3PBUA 1H63A 3DN5A 4ZFMA 5MKGA 3LBOA 2W67A 4NRRA 4TQTA 1V93A 3ANVA 4LV4A 4H9XA 4WHBA 1W9PA 2CHOA 3I3BA 1XLAA 5DMYA 2Z4GA 4C6NA 3C2OA 1ZBCA 4UTWA 2DT0A 3P0XA 5HJXA 3WQ4A 1W5MA 1O68A 4LBRA 3QR1A 1PAMA 3LGGA 2V0TA 3UD6A 4AZ7A 2AGTA 3FV9A 1KM0A 1J0IA 3W7PA 2HE8A 1A53A 3KOXA 4W7VA 3GNOA 2BDQA 2WPBA 3ONBA 5I23A 4DUVA 3QOMA 1KNWA 1L9WA 1XKJA 4H6KA 3C6CA 5JU6A 1YXDA 3EPNA 3FGCA 2ZDRA 4HMNA 2C16A 4I9AA 1FWBC 2QEZA 1PX8A 4NJHA 1MQPA 1HG3A 1TUFA 1XUUA 1MDLA 1E6RA 1OCJA 4J3SA 3T81A 1DV7A 4Q8QA 2R82A 2WSPA 3TJXA 4W88A 2J7BA 5C55A 1A5UA 2VELA 4PTVA 2TAAA 1RBAA 2YGYA 4I5RA 2GL5A 4L1GA 2AL2B 3B06A 4M0XA 3AMLA 1B4EA 4YLWA 3UW6A 5LSMA 1ZJAA 2WHKA 4I7UA 4Q4KA 3D46A 4MJMA 3S0CA 3MBDA 3M5YA 4XTIA 4DLFA 3WD4A 1UD2A 4A3HA 5IDIA 4L61A 2ZZ5A 3DEQA 3S2LA 3W82A 2X30A 4P61A 3M5ZA 2WNQA 4LYQA 1V5XA 3N2MA 4LALA 3RHGA 4DYEA 4HU3A 2XFWA 4DXKA 5C8BB 4MDPA 1FHVA 1B1YA 2Y4SA 3W2KA 1VR6A 1YXCA 4QLLA 3LHZA 4GY7A 3TA6A 4ROQA 2OODA 5JBDA 2FTPA 1S3HA 2PWFA 4B4HA 1C3FA 4PRTA 2JF7A 4BF9A 3TWAA 1WE5A 3EDEA 2ZTJA 4AVFA 2QJJA 2RJGA 1TTPA 4DBSA 2Y5JA 3CB8A 4IXXA 2C8NA 4J27A 4HOWA 1IIHA 4C6MA 1KRBC 1A4MA 2EJAA 3NQVA 2GGEA 3SGZA 3PJUA 5TQLA 3EXTA 3UEQA 2JGYA 4J9JA 3GVGA 3JZEA 4F2TA 5CH9A 1DWAM 5DCDA 4YWIA 3FA3A 1ZBWA 1A5LC 4GZ7A 1ZUAX 4JKKA 2Z1WA 3LCXA 5I02A 3N2TA 1W5PA 4EXBA 3GSMA 1LG2A 4C6CA 2PLCA 3ZSTA 3VC6A 3AWNA 3CL6A 4E2VA 1R0MA 1VFHA 1WZKA 4OWGA 3K8MA 4RZ5A 2CZFA 3L9CA 2QCEA 1QPNA 3LYEA 1OYBA 5M1TA 3ANYA 3TTEA 4C6JA 1DL3A 3FYOA 5AZ0A 1HTIA 5BW6A 1VP5A 3H7RA 3GDLA 1YDYA 3KW3A 3I6EA 4TR9A 3CWHA 1P7TB 1EP1A 3QC3A 1P0EA 3W7IA 3TKFA 1U5JA 1I2OA 4IWWA 4DO4A 2WMGA 1RR2A 2VUNA 3HPZA 3BQ6A 4EWJA 4O1AA 4DNHA 2JF6A 1PZ1A 1SR9A 2HJPA 1GW9A 3S1VA 1ESWA 3UR7A 2V3EA 4XZWA 4DWSC 2ZRVA 4IPJA 3H22A 2EXOA 1BXNA 2V9DA 3T42A 4PULA 4G7EA 5KZEA 5JBEA 4H9YA 3VD3A 1Z42A 3PC0A 1VLWA 4HNLA 4JHZA 3TTOA 3BLPX 3LXCA 1M01A 3K2GA 1UWQA 3WQVA 1PX4A 4M1RA 3SRKA 5ABTA 3DERA 3HIJA 1UWRA 1P0BA 3GR4A 3R13A 4UR7A 4Q4OA 2Z7GA 1QI0A 1REQA 4MWAA 2BFGA 4RZ4A 3DU0A 4NZFA 1B3OA 4O1BA 1UWAA 1UIOA 5FI8A 1TZ7A 5GQBA 6REQA 1AW2A 1OFPA 3CU2A 3GYCA 1DXFA 3M1ZA 1KFCA 4UOJA 4F0LA 3IIPA 3S2NA 3TZNA 3BSHA 2Y89A 4A2SA 1KV5A 2VFEA 4BFAA 5HNUA 3M0HA 1RK6A 3QY7A 1MNZA 1TTJA 5BOOA 1D2KA 3WNPA 1MDRA 4JTKA 1F7BA 4B3KA 3L65A 4A8NA 3OOQA 1KB3A 4AWSA 4K2SA 3WBXA 2EEXA 3TQ0A 5C9ZA 2FMNA 1M5WA 3T40A 2D23A 2C14A 2UV8G 2I5GA 1GTHA 3QFWA 4IGSA 1K7FA 1E5JA 3BAIA 2EBNA 4LV9A 1WO2A 3KBWA 4UQ9A 5I2UA 1OK6A 5C7VA 4RNFA 2XN1A 4IMEA 1RQBA 1S5TA 3V5CA 6XIMA 3IK2A 5H2ZA 5HANA 3W76A 4QQUA 4S39A 4Y7EA 2ZBTA 1HX0A 2WJDA 2I16A 4IGMA 3TXVA 2YXXA 3KCLA 5FJTA 2GGHA 4BJHA 2YCLA 3VIIA 1XF0A 1A3XA 4LB4A 3B8TA 1BQGA 1J93A 3ARYA 1W91A 4IOTA 3N2XA 1IYXA 3V5FA 1TWZA 1JPHA 2IW0A 4RZBA 4JFVA 3AZRA 1NJJA 1I60A 4WVXA 1A5NC 1OYCA 5CC7A 4LANA 2ACQA 3UXDA 4MNJA 4OECA 3BV7A 3GAKA 2BWGA 1J5SA 2G3NA 3TFCA 1FP8A 3EBVA 1P48A 2VD8A 3BLDA 1R3TA 1PUDA 2D73A 1H1ZA 3B9AA 3MBFA 1W0MA 3MV01 3O2LA 4F0SA 3ZO9A 5ABEA 4IQJA 4WDUA 2RGMA 2YCEA 3Q37A 1XRSA 1IR2A 4PMQA 1K70A 4JTHA 4ACZA 4ILSA 3WUEA 1O4UA 1PDYA 1DHPA 2NLIA 3HURA 4POCA 1GKRA 5BRPA 1BYDA 1QW8A 4FNTA 3NQBA 4O1EA 3LI0A 4MLJA 3UWUA 1K9DA 4K68A 3A3XA 3FCPA 2VYOA 3AYRA 3UG4A 4OZOA 5AECA 4K6AA 4FXRA 3PHAA 5AC4A 4JEQA 1YX1A 3LQLA 1SZFA 3LQGA 2DZVA 3VDBA 2EG6A 1VJSA 2IQ0A 1XD1A 4XD6A 2F61A 1CZ1A 1NP2A 3TTQA 3CQ0A 3WLJA 4Z42C 2NWSA 3SCSA 3IACA 3TTSA 3CZLA 2VURA 1LOSA 1MZHA 5D30A 4LQ1A 5BOEA 2ZUVA 1GUVA 2PCQA 2Y6ZA 2XN0A 3KUMA 1XJBA 2YA1A 3RK8A 1AH4A 1RQHA 3L0NA 4XZLX 3F2BA 1G01A 3K30A 1V7YA 5LHEA 4B2DD 1ZJIA 5BU6A 1KM1A 4HT3A 5IFPA 1R9XA 4BWLC 3U7VA 2X42A 2Q8XA 4I8DA 4P7NA 1QK0A 1CGTA 4C91A 4XK2A 1U1UA 1P43A 5K9DA 5FAGA 3BW3A 4H41A 3GIQA 2W62A 3APGA 3HJZA 3ES7A 5JUVA 4ZMGA 3V0SA 4QE5A 4CNPA 1IHIA 4K3ZA 4G7EB 1V3JA 1I0DA 1UKPA 2OWXA 3ISIX 3OGSA 3N1AA 1SJAA 3HG5A 4J7RA 3GY1A 3UNTA 3QGKC 3MS8A 3OIHA 5G4EA 5DO8A 5ECUA 3UCDA 4AW7A 2V5BA 3HF3A 4CQAA 2Z1VA 3MUY1 2X1TA 3TYZA 4DM1A 1CEOA 3VIFA 5HR7A 3W25A 4QTGA 1WXJA 1TR1A 4MWAB 3NL3A 3KCOA 1FX6A 3C3UA 3G1VA 2Q3OA 2PRLA 1KRAC 5CZSA 1A5KC 1B30A 3WLKX 3VINA 2ZZ2A 6REQB 3N14A 3B97A 1LLZA 4Q8NA 4W8AA 1F05A 4KCVA 4L4MA 5HPOA 1BVZA 2D3NA 1EBHA 3HGJA 4QDWA 1O60A 4CVUA 3WCZA 2ATSA 5BNKA 4G1KA 4XKYA 2QDEA 4AWTA 4GXWA 1UZDA 1YW1A 1JDAA 3K4WA 4QP0A 3SCVA 3TN6A 2IPWA 1OT1A 4DPPA 1PIIA 1GT8A 1TCDA 2V38A 3CS2A 3W7QA 1GONA 1K9FA 1FP9A 1NOUA 1WKFA 1QI3A 3RCYA 4V15A 3URAA 2QIWA 2VOTA 4GJJA 2IKIA 5C2GA 2NQ9A 2J66A 1EJUC 4RDZA 4LUIA 4GABA 1E6ZA 3DFYA 4MOZA 1V8EA 2Y61A 3Q2DA 4V33A 2O4QA 2Z28A 4YWSA 4V2XA 3L21A 4DF1A 3NM1A 1PDZA 4NILA 1V02A 4XTDA 3VXGA 5U7SA 1S2CA 3W29A 5CPOA 2R1NA 1TPUA 4Q6JA 3L4UA 4HOXA 4UTIA 1QTWA 3EDKA 1JZ8A 1LBFA 3CT2A 4N2YA 2CYGA 1W2VA 2VRQA 2OVLA 1GNXA 3SCTA 3QW3A 2YCLB 1UROA 1VGAA 2YX0A 1AK5A 2W6RA 3C3NA 3UWYA 4GJ1A 4N7QA 1TV3A 1A5AA 3AWOA 1PKYA 2JFEX 5CQ1A 3RUBL 3JRKA 4UMAA 4LWWA 1U5VA 3TN3A 1FWFC 2I7GA 3CYVA 3H12A 3EKGA 3UZXA 4AB4A 3FEQA 3U2OA 4BQ2A 1YYAA 2FJKA 3UCQA 2V67A 2NUWA 5K9XA 3W6MA 4YYFA 1C92A 4G9PA 1D3GA 3CIXA 4C1NA 4H8NA 4L7ZA 3G1FA 3ITLA 3SURA 5K2ZA 3AAMA 3ITYA 4UXDA 4ACZB 2UZ9A 4KCTA 4YTQA 3WD1A 3HTWA 5CC3A 1GKPA 2DUZA 3WEMA 4GUGA 3C2YA 3PTDA 1CPUA 2J4GA 3W3OA 1WXYA 2Y88A 4BK9A 3VUPA 5C70A 1ZHAA 5AFDA 1R2SA 4AXNA 4NZ4A 4NP7A 4D8AA 1XH1A 1WZMA 3GXPA 2Y8VA 1EDTA 4A8RA 1VPXA 4PUNA 3I65A 3WD3A 2HBXA 3CV2A 4O10A 1XGDA 3F5KA 3MDWA 2VTFA 5LXXA 2C15A 1GGOA 4L56A 2DUAA 3EOEA 2CZ5A 4S3GA 1M7XA 3C52A 5A69A 3H6OA 4DJFD 3NGJA 2EHHA 4MB5A 3RJYA 5CLWA 2F6XA 3KTXA 3FK4A 4F40A 2AGKA 4K37A 3GFYA 4FXFA 1PKLA 3KBMA 2INFA 1IT0A 1CGUA 3MUXA 2QKFA 4X61A 3N2CA 2GVLA 4AIEA 1JCNA 3WY1A 3OLIA 3W7MA 2Y7DA 3WK0A 5D2WA 1WZAA 3C5QA 3TCSA 3QV7A 4RCXA 3W71A 2DIEA 3E1F1 4PSPA 4XG1A 4CN4A 4D9PA 2ZKMX 3HOJA 1WAWA 3SUUA 2J8TA 2AKZA 1TO3A 5CSSA 1R30A 5FJOA 3SGGA 3EOOA 2PZNA 1EPVA 5I3FA 4DJDD 5HNTA 3BAWA 3DGRA 2R9RA 3I7RA 5H91A 2XFYA 1TWSA 1FA2A 3BTNA 1TZ9A 4JKMA 2IKJA 1RZMA 1M04A 1XCWA 2ATMA 3EX1A 4V1XA 4TVDA 5FEXA 4X9YA 3HPSA 3PVFA 1DE5A 1PL9A 3EKZA 1Q6DA 3N9SA 3NDYA 3PBYA 1PBGA 1ICSA 2WMIA 1ME9A 4HD5A 4LOCA 3WQ5A 2O9OA 3TLQA 4B2DA 3PPHA 1E4IA 3DI1A 3L2MA 4PMJA 3T1GA 4E2BA 2I5IA 5HQMA 1F6KA 2V81A 4GIYA 1DIOA 3NQ7A 4DI8A 3C56A 1XRFA 3F4DA 1N82A 4XVDA 4MM1A 3PY2A 3E3HA 3FIGA 1GJUA 1FH8A 1OC7A 3OYZA 1JD9A 1GZ1A 3SIMA 4BR1A 3QZEA 3WLPA 2POTA 3WDHA 4XKYB 4ERIA 5EY5A 4C6KA 3TYCA 8A3HA 5DX7A 3EAUA 2NT0A 5MF5A 2QPSA 4Q8PA 2NW0A 1HP5A 2PDBA 3ZJ8A 2D1ZA 1MI3A 3UWZA 3B3DA 3EWZA 4QGCA 3D5HA 3RRXA 4ZXOA 1A80A 3QSTA 1EP3A 1XYMA 4GO8A 3S9YA 3BV4A 3J7HA 3URQA 3ATZA 1LBMA 5EGRA 1NF7A 5E6YA 3LLXA 2TYSA 3QHOA 2J74A 7TIMA 1L8NA 3ZJ7A 1Z6KA 4KWSA 5C9UA 4ZE4A 1TZZA 3EDFA 3WF4A 1NVMA 2YL9A 4CEUC 1MUWA 3TE9A 1R47A 1O94A 1O6IA 2XU2A 5IHSA 1AMKA 1SO4A 1YTKA 4W85A 3NPXA 2P8BA 2OZ0A 2ZXAA 1W9XA 4QLJA 4XO6A 4OT7A 1EIXA 4F0MA 2QQ6A 3A64A 3LRKA 3ICJA 1W3TA 5J04A 4ZVJA 4KEZA 3VMOA 3ORWA 3RFAA 1F4AA 3IJQA 3WBEA 3EOLA 4KIEA 5CGMA 1E56A 3QTPA 4YL2A 4O14A 3UZ5A 4O1CA 4FXJA 1GJWA 4R33A 3KDOA 1SO6A 1X1ZA 1DJXA 2PE4A 4C1NB 3NQ8A 3D3AA 4LYPA 4ZOEA 1PTGA 5CZKA 4GNKB 2QAFA 5A6JA 1QNQA 3UR5A 3M5VA 3PUOA 1UC4A 4L6DA 4H7CA 3VILA 4O50A 1GHRA 4GNJA 4ERGA 4OQVA 4OUEA 3WF3A 1XKYA 1PPIA 2QVHA 1XQKA 2XGBA 2CLKA 2WCAA 2CFFA 2FMOA 1POJA 3SN4A 2PWDA 1SJBA 5D2VA 1ZBKA 3SR7A 3BW4A 4H6QA 3LA4A 4L80A 5CCZA 4I9TA 2E5CA 1XV8A 5BXSA 4Q7NA 2OWCA 4XAZA 4BI6A 2DORA 3AYSA 4DYKA 3N3TA 5DY3A 2HNEA 9RUBA 3R8RA 4HSNA 5EL1A 1I6NA 4WF7A 1TPDA 3GBDA 4MKSA 4L65A 2RGLA 3WH7A 4W5ZA 1Q7QA 1NQ6A 2HS8A 4HA3A 4E0CA 3AS1A 3SFWA 1GVIA 2YIHA 3VPLA 3KTCA 3TN4A 3RPMA 3WDPP 1SJCA 5E09A 3VFCA 4HZ6A 1K7EA 1FRBA 1EJWC 1RSCA 3TSMA 3H2FA 1C8XA 3ABXA 3AIUA 4LRTA 1SFLA 5D9NA 1N2VA 3A3HA 5D4YA 2QCFA 3UZZA 5K4ZA 2E28A 3OJGA 1XLFA 3WUGA 1W1IE 3O0KA 1B3YA 2G41A 3IGHX 4FLQA 3NQFA 2BB0A 1FWTA 1H4PA 5AYYA 2Z6IA 5GNYA 2OGYA 3WIJA 1DTUA 1QO5A 3MUCA 3BAXA 1U1HA 2XVLA 1GG0A 2YDQA 3W2LA 1C8QA 5K3VA 2QCGA 2WMIB 4O53A 3SQSA 4XISA 2WZHA 3QQ0A 4C6OA 3CPGA 1OEPA 1Y65A 7A3HA 4FP1A 2EF9A 1HP4A 3O6DA 1V3MA 3WJSA 5GPRA 2QCHA 1BG9A 3M0KA 4A29A 1E6QM 2GWGA 5XINA 4IJCA 1ONRA 2QIIA 1XC6A 3VOFA 1AQFA 2YLAA 4M29A 1E0TA 3PB2A 3THAA 4AMCA 8RUCA 1UD3A 1VJZA 4D6DA 1MXGA 5F2LA 1UYQA 2FDMA 1R2RA 5EMMA 3CL7A 3E5BA 3O63A 4D6IA 4E3VA 2PWVA 1EH9A 1FWIC 3QZAA 4Y6GA 3QV6A 5I79A 1CGYA 4LY8A 4JY9A 3A5VA 1F3TA 3WDJA 4KEUA 3EA1A 4PMYA 4Z1BA 4XZIA 1QK2A 3W1AA 3PSVA 2GJXA 4O11A 4K1GA 4DYJA 1G4SA 1PIGA 3HO8A 3DFHA 4IQDA 4GI8A 1UR9A 2PURA 3BJSA 3R79A 3S4TA 1JYWA 2D2GA 1QI2A 5HNRA 3WK3A 3T4CA 4LAKA 1DORA 2GQ8A 3T09A 1P6CA 2YXOA 3LU2A 3WNNA 1QNRA 1H7RA 3OGVA 3W83A 5AHFA 1K8XA 4JQ3A 1P0DA 4GBDA 4Z0SA 5AC8A 3SECA 3AC0A 1EX1A 1T96A 1TX2A 3OP2A 2QUTA 1GOKA 3PZOA 1TPEA 2CXEA 1ZCCA 1S3TC 2XIMA 3PZMA 2FHFA 4NJGA 1QT1A 3BLIA 3HB9A 4RNJA 2C13A 2ZUSA 1OX6A 3UCCA 1UIPA 1EA9C 4QX4A 3QEZA 4A22A 1EO5A 1KCXA 4WDXA 4AD4A 3GNPA 4X63A 4DJFC 4NI8A 1H49A 4PUDA 3IANA 1DJZA 5EB8A 1ZS2A 1FH7A 4NYYA 3W7HA 5KITA 1IWAA 2ZZ4A 3NYZA 3QFEA 3QHMA 1XBXA 3QLLA 4GGBA 1TE6A 2PZ0A 4M6UA 3VUSA 4AHPA 5DMMA 3I6TA 2WM1A 4MGGA 3EOUA 4L1XA 3DESA 4YTUA 4Q7IA 4J5NA 2Y8KA 4JL2A 4CGTA 3ZT6A 3UR2A 1O66A 1J4EA 2ZRWA 1NM9A 4O0QA 1SR0A 1KR0A 2NUYA 2C1GA 3DYMA 3SFKA 4DJDC 1H5VA 3FA4A 1XLBA 3UF9A 4ZO8A 1SZGA 4GI9A 1J79A 4ZQNA 3B0XA 2W4XA 3AYVA 2FZNA 3QC0A 4PMOA 3G8RA 2QV4A 2UWFA 4XKMA 4LBSA 4L64A 5I24A 3IAQA 2VEKA 3VD7A 4KF1A 3NL6A 4DXVA 1I2PA 4JIIX 2DZXA 1QBBA 2B7QA 3UJFA 2WVUA 5T8GA 2HE5A 3PWGA 3W9ZA 3NQMA 5CC6A 3FDKA 3AFBA 2PUZA 3BO9A 3SZ8A 2J9YA 2H9AA 4L9YA 3OG2A 1VEOA 1LCOA 3B9EA 4OFCA 1NF0A 4H04A 1W1A1 1XS2A 3CPUA 9XIAA 2HK1A 3EWUA 4H8UA 4PUWA 4JKLA 1MEWA 2TSYA 1EO7A 4TXEA 3S47A 3IEBA 4DHGA 2ZQ0A 4K8HA 2CHNA 3MSDA 1OHLA 1JL8A 4TUFA 1Y8BA 1GEHA 5KMYA 4OHQA 3WLQA 1DKWA 5GNXA 3H7VA 3CQJA 1XYZA 3ZSSA 3JW7A 2WLYA 1VJIA 2DDXA 3DUGA 3W7NA 1W1B1 2WJFA 5FEZA 4W87A 1OWQA 2RUSA 8XIMA 2V2DA 2DJLA 3MC5A 1ZJHA 4F0HA 2B31A 1Q6CA 2WC7A 3MWCA 3OBKA 1KFLA 2E6AA 3PG8A 4YHGA 3TR2A 5A2AA 3AS2A 3W23A 2ZRUA 4IT1A 3MYPA 1QPRA 1EDQA 1AA1B 3PZTA 5D9OA 3GHSA 4Y8FA 2OZTA 4GHRA 4P7OA 4Q8UA 3HBLA 3TXZA 4IGNA 3CAKA 3R5EA 3KRSA 1LZOA 1NOWA 1FWSA 4QE4A 1SO3A 5I3GA 1GVSA 2NSOA 4GVFA 2WSRA 4Z2HA 4RR4A 3CUHA 3B4UA 2W5FA 1HKIA 4RNIA 4DO7A 1EXPA 3KOFA 2Q01A 3D6NA 3L7RA 4X0VA 1GQNA 1UR0A 1Q7ZA 5C54A 2P88A 3N25A 2NV9A 4KETA 3BZJA 1JCXA 4Y9MA 2J9XA 2J7DA 3LZ3A 4H19A 5GJPA 1AZ2A 2FGLA 4S1FA 4EAYA 3WF0A 2BV9A 5A8PA 4E4UA 1G5AA 1PYMA 1U83A 2GJXB 3QF0A 2G4FA 3I6RA 1E5NA 4FLSA 2R1KA 3UPBA 3G18A 4C5YA 3AIVA 4LC6A 4GOAA 5GJNA 1IF2A 1P0NA 3NO3A 1XHGA 4E8GA 3FW6A 2GZXA 3CH0A 5GJMA 5IXEA 5CZJA 2QCNA 1JYNA 3VDCA 5L9FA 3IGSA 3P84A 2EJ1A 4I7VA 4UQAA 1DYSA 1WV2A 2FH6A 2XSXA 4QBXA 1LQ2A 4WLCA 3M0YA 1OFEA 4PMXA 3MI6A 1O12A 3DC8A 2RDTA 2XM2A 3RCMA 2ZZ1A 5D05A 1KXTA 1W3KA 1N8FA 4FALA 3C2FA 3LLFA 2E5BA 1R86A 3L5LA 3P0WA 5I3IA 1XIFA 3KWSA 2ZZ6A 3VNIA 3EWXA 3L4ZA 1GPFA 1A5MC 3RYSA 1UG6A 4LH8A 4KRZA 3H2OA 3U5UA 2WB5A 4P5UA 3SN1A 5DY2A 4C60A 3RGTA 3U6WA 3H4WA 3UXLA 1UH4A 1NU5A 4AIUA 2F6KA 1BRLA 3SCWA 2RH9A 1D7FA 1UZHA 3CHDA 4WXYA 4HPXA 5A6SA 2J77A 3BOFA 5FAJA 3F4NA 2DJXA 4QIUA 5CG7A 1B4KA 1W8SA 3FXGA 2F7FA 5BRQA 2XIOA 2GOUA 3O16A 1WDPA 3LG3A 3U4AA 5T26A 1E9LA 1PZ2A 1XG3A 1RLCL 1GOWA 1XFBA 1RY8A 1F6YA 4YU1A 3GNRA 4BF5A 5J8LA 1SVDA 1QHOA 4UFIA 1ZL1A 1CCWB 4NG3A 3NOEA 4M7SA 3NYDA 1JR1A 2JBMA 3LNPA 1TV7A 4Z2LA 4IUOA 3VABA 4I90A 3AIEA 3WLOA 5LHFA 1WXZA 4QFUA 1OG0A 4JXCA 5A6BD 2EPMX 1EOMA 1Z32X 3NA8A 1NOFA 1PIFA 3LM7A 2VKZG 3SY8A 1W3JA 1E1CB 3T4WA 3H4GA 2GUBA 1S5WA 1CT5A 1KW1A 5DMNA 4K1WA 1X8CA 1LRTA 1B57A 3FXYA 3U2CA 1E4LA 3FHAA 1XYBA 4UFJA 4O0KA 3T8LA 1IWPA 4NX0A 1I2RA 4Y9AA 1EGMA 1XWYA 4OOZA 1YXYA 4CQCA 3DFOA 4GYKA 3F5JA 1V3LA 5B80A 4B5TA 4FMVA 3GAYA 5BWAA 3A4JA 3MA8A 1CIUA 1IEWA 3GWQA 4MPKA 1ODUA 2H9AB 1OZQA 2E68A 4CUCA 4AMAA 4O18A 4IL0A 2DT1A 7TAAA 2G8ZA 5I0DA 4IIEA 4Z1AA 4YVXA 4M8UA 1SJDA 1K02A 1VIZA 1OF8A 3KXQA 4H9VA 4RL3A 1LG1A 3KBJA 4AD3A 1KTBA 2A3AA 4B91A 4TMCA 1VPYA 2PGWA 4B5WA 1CXIA 3HU7A 1WP6A 1R46A 3TP4A 4IFOA 2DV0A 1T0OA 4PCTA 3MPGA 3E6EA 1W5QA 3TIMA 4WSKA 5E0KA 3G1XA 4MIMA 1QPKA 2E67A 4IPNB 4GXPA 4MADA 4N6FA 3BZGA 3WENA 4XZ9A 1J11A 3AIWA 3VCNA 5HJLA 1AQMA 4MY9A 1PZ3A 3UQNA 1JULA 3VNDA 1GTEA 3TSBA 3VDAA 3TTYA 3BGAA 1IZCA 3T55A 1YTDA 1O5XA 4UTHA 2IQDA 3AZTA 1I2QA 2ZICA 3MHFA 3ARXA 4KRUA 5I3HA 1RCQA 2D0GA 2PBGA 1JDDA 3WUBA 4TVUA 5A2CA 4JFSA 2V5JA 4QJ4B 1NY1A 4R7OA 4ML9A 4QCEA 4UNLA 2PRHA 2PGRA 3P2VA 1E51A 3E74A 2QPUA 2PDWA 2WQDA 4CN6A 1UBPC 4HOZA 4I8YA 2DW6A 1UA3A 5F2GA 4PUUA 4KERA 2HXUA 4JQ2A 2XH4A 1O95A 3TNBA 4UR9A 4WK9A 3VE9A 2FPVA 1RJRA 2R14A 5HUPA 3S6TA 4IXHA 1RY0A 4H4IA 3SY5A 5CJMA 2QXWA 3CUZA 2YDSA 4WGHA 4K38A 1T99A 3MY9A 1EP2A 1OCBA 1TJPA 3GIPA 3LXBA 3UG8A 3DENA 1KGWA 1XLGA 5D8WA 2GSJA 1W9VA 1OSEA 3VIPA 2TPSA 5CLTA 2VOMA 3H23A 3SI9A 2FIQA 1CGXA 3STEA 4LUSB 3CMJA 3OVPA 3O6CA 3EWWA 4PODA 1M3UA 1EC7A 1MRAA 1OB0A 1N7KA 4DF0A 3CM4A 1X38A 5ABGA 1R7AA 4R7JA 2Y8UA 3ABQA 4JBRA 3UA4A 1SUXA 4Q7BA 4CNNA 3CV7A 3LMZA 3WQFA 2FVMA 4GY1A 2XJ7A 3NSNA 2ZA3A 3B8DA 1BSIA 1BG4A 3P74A 4EK7A 1M65A 1MEIA 1LQ0A 2OJPA 5D32A 3LCHA 2PDUA 5K7JA 3KHDA 3LENA 3MMUA 2R6OA 4XIAA 1BRLB 3WNMA 1DWFM 1XIIA 2MNRA 1I75A 4OVXA 1T40A 5HNNA 2VGIA 3POHA 3M64A 4DBWA 4EWND 2R1MA 1JCYA 2YL5A 3CEPA 1R85A 1KLZA 4Q8WA 5TD4A 3CPRA 1RCOB 3M5XA 3VNMA 1F3XA 1BHGA 3VGGA 3NPVA 9XIMA 4B9YA 5LNSA 5MHBA 3TC6A 2VFGA 1C9DA 1TWDA 3UZYA 3CIWA 3JR2A 4GCAA 2VP8A 4S3EA 3EX6A 4JTUA 4IIHA 2FTWA 1SW3A 4NRSA 4S3KA 1DJIA 2WBGA 2XVGA 4MJ4A 1JPMA 4WR3A 2KAUC 2BODX 2DZWA 3ZZ1A 3L67A 3RR1A 3CZGA 4AEFA 3A4AA 3PM6A 2A79A 4Z1YA 3NQDA 2WCGA 3H2AA 1KBIA 4XAPA 4J4KA 3CHFA 4H9TA 1DQXA 1TV8A 1H3GA 3VX0A 4IUGA 4ZR8A 1BYBA 2Z1KA 4GFSA 3UFYA 3OVRA 2HDJA 4HKPA 2BHZA 4M6PA 3E0VA 2C0HA 3KDNA 2EQDA 3VYLA 4HNOA 3M0MA 3G0SA 4JIEA 3W02A 3HM7A 3V18A 2FQIA 5DF0A 2Z6JA 5A6BA 2NVAA 3VDGA 4C6PA 3KS6A 1ITQA 2NQLA 3QTGA 1BAGA 1QUMA 4B4FA 3FDGA 3IVUA 3VAVA 2UY5A 4MMWA 1KM2A 5I78A 3EA2A 2A3HA 2BASA 1XSJA 2OSXA 2Q71A 4YTSA 3UERA 3W01A 1R2TA 1ITUA 3WLIA 4HYVA 4LNCA 4O15A 4FNSA 2P50A 3G1RA 3HQPA 2VENA 3IV8A 4CCCA 4B5NA 1JZ6A 4XIMA 1IEXA 3S6OA 3M0VA 1J96A 3P5YA 2QMJA 4IFKA 1QNOA 4ZB2A 3CEUA 3UA3A 5H8PA 2DVXA 2G96A 4GIEA 3QV9A 3W2UA 2BG5A 3I4EA 3DI0A 1EBGA 2VR4A 2QDGA 3H26A 2XIBA 1WPCA 5C71A 3B9OA 3ZLHA 3U8GA 3G8EA 4N9EA 2FZ9A 2Y85A 3VC5A 4A3UA 4NT0A 1KQYA 2ADAA 3LCGA 2PPGA 5T91A 4HGXA 2Y7GA 1L6SA 4N9BA 1QR7A 2PP1A 4IH3A 5G2IA 3AHXA 4W5UA 1QI5A 1N8WA 3S5SA 2GJLA 4JX6A 1VZWA 4BZYA 1VFTA 1PXGA 4KPLA 1MXDA 3VGFA 2DT3A 5HDRA 3BAKA 4AH7A 5HJYA 1WX0A 1KGUA 3L2LA 4E8DA 1ZP3A 3OW1A 1B0IA 4ALDA 3ZQ9A 3UYCA 1CLXA 4WKFA 1FDYA 4FX7A 5CPMA 1JUKA 1JPIA 1E15A 2NSXA 4W8BA 1WBHA 3SQLA 1TSIA 4MFDA 3WO8A 4PBFA 1EC9A 2E5DA 3I4KA 1GYNA 3TYBA 4RXGA 4NUWA 5T9CE 4V28A 2INZA 4UMBA 1KM6A 3Q94A 4HIBA 1QNVA 1ISYA 5F2IA 2J24A 3FLUA 4F9JA 2QVNA 5EBUA 4UTFA 2A2IA 3ITCA 3LBMA 3WLRA 2OWWA 3ID7A 1GKQA 3PBWA 1GQLA 3SQMA 3PS7A 3PB0A 2OX1A 3B05A 2PDXA 4JTQA 2GWNA 1CXEA 4G2DA 2R1LA 2BY0A 3TYAA 1VFFA 4NZ3A 2YR1A 1OM0A 3GXFA 1FHUA 3OEXA 3VGDA 3S1GA 4AX7A 5A1AA 4PCFA 2OTDA 3T9PA 1E70M 4HU8A 3KHJA 2A85A 1MSSA 1TTQA 3JS3A 4CD8A 2J7HA 3GZAA 2BHYA 4JL1A 4DAIA 2C71A 4KEMA 2J8GA 4TU1A 3PUDA 4EPKA 2YZ5A 4WXZA 3P82A 4B92A 3VIJA 1GWJA 4DB7A 2Z1SA 2CC0A 2GK1A 4GKTA 4DLMA 4RXFA 5IBXC 4V1YA 3VI2A 3TROA 3LCIA 3CXOA 3E9AA 1PWLA 4C90A 4GGHA 4MG4A 2IXUA 1A5OC 3DYPA 1HKVA 3S1WA 3HN3A 4AY7A 1TUXA 5D9MA 1N8IA 4LCQA 3H2EA 2H8ZA 1UR4A 5KZDA 2PLMA 3OBAA 4NHVA 4I9JA 3VMNA 3HFTA 2ISWA 2XH7A 3EZ4A 2CWNA 4DZIA 3IJ8A 4QE1A 1KWKA 1S2WA 4QDMA 4AIOA 4BQ5A 2OQHA 3GBEA 1DJNA 1RQEA 5DRIA 3CV6A 1JZ7A 2XUCA 1MW2A 4RDYA 1IXQA 5CZTA 2P8CA 2PDMA 3USBA 1DXIA 5HMEA 3G2GA 4MVAA 3KP0A 2ISSA 2WW5A 1A5CA 1XSKA 1E9YB 1SMDA 3V1PA 3OHMB 3IV3A 1XH2A 1H7PA 1DHKA 3LSCA 3H54A 2QDHA 3EA3A 3LB0A 4IG2B 3W27A 4BKNA 3CYJA 3GDTA 1C90A 2YBVA 1UUQA 4NF7A 3VKJA 5HWNA 3M7WA 2GGJA 4GH1A 1V51A 1R3YA 2HTMA 3MJYA 3TMLA 2R24A 3VK5A 3FS2A 1ZZMA 1LYXA 1EJVC 3BJFA 3RM8A 4FZIA 3GE7A 4IIGA 3EB4A 2CBVA 3PZ9A 3QLDA 4KFNA 3WD0A 3KX6A 3MP5A 3CLMA 4LXFA 2FVKA 2BOEX 3W7JA 2GDVA 4DWSD 5KETA 3QPEA 3BOLA 2ON3A 1UD5A 3NQEA 4FS9A 4O1DA 2OMAA 1SU5A 3EX3A 4KH2A 1GVEA 3TAOA 3RMJA 2HSAA 1FHLA 4MF4A 5CBJA 2DH3A 2OO6A 2ZE0A 1W3NA 2C19A 4JGDA 1IGWA 4ZQCA 3FFSA 2AL1A 3W1XA 4GQGA 4AZHA 4XSMA 1XYLA 2EG7A 3RN6A 2H6RA 2A6LA 1SSGA 2D2OA 2X1UA 3T6CA 3ARZA 1WNOA 4JS3A 3CWOX 1WDWA 1GOIA 3D3FA 2IKGA 1NDYA 3UPMA 2HPIA 3NAVA 3WLTA 3CL8A 2OYLA 1W8GA 4GKLA 4XAGA 2O7QA 4CLMA 1H60A 1HL9A 3CO8A 4IZGA 3TAKA 2J47A 3W2NA 2QUVA 4NSBA 1AVAA 2X8RA 1QO2A 3WQWA 2QMKA 1PS9A 5HULA 2YDRA 4YXGA 5AYBA 3WFLA 3PJWA 4KFPA 3U2ZA 2GVJA 6A3HA 1Y5WA 3AUJA 1J0ZA 2QW5A 3FJLA 4AUBA 4TMBA 1ISWA 1LL7A 1H41A 3LY0A 1Q6FA 2PDGA 2PP3A 4Q8MA 5EMUA 6ALDA 1ISVA 1K6WA 2ZYFA 3BANA 5DMLA 1V6WA 3W7EA 2FB3A 2XH2A 4UQDA 4EE9A 1FHDA 5AYIA 1Q7MA 3ELFA 4N4PA 3W7CA 4XZBA 1EF2A 3TJ4A 4AVOA 3M43A 4DWDA 1YRRA 1TPH1 5AYXA 4H6EA 2Z0IA 2XM1A 3W0KA 2BY2A 2YJQA 1FWDC 5LNUA 1TCMA 2GJPA 1WKYA 4PUJA 4S3BA 4ZBCA 3LLDA 5EFFA 5FF2A 1KBBA 1WB0A 3TYUA 1SFJA 1VQTA 3P7YA 3W7LA 1HUVA 2WZTA 3ECQA 2ZUTA 3S3GA 3W86A 4F0RA 3G0UA 1AW1A 2NX1A 2WJZA 4LVDA 1W1YA 2FZ8A 3ME3A 3W24A 1AL8A 1OVDA 3LX9A 2F6UA 3BCDA 4Y9NA 1EHAA 1J12A 4FLRA 2I9UA 1OJXA 3GHUA 1X98A 1JCTA 2GVEA 2BGQA 4JTSA 2BZNA 1XIDA 1CI1A 2X1RA 1H11A 3QGVA 3BG9A 1M1BA 1XLKA 3O6YX 1NFPA 1O1HA 2DIKA 5F1UA 1VBHA 3QYQA 4L4LA 2A3EA 3WDRA 2UY4A 3HPXA 3A23A 5IOBA 4KKXA 2W66A 2CLOA 4K7YA 3U0HA 1AODA 2XFFA 1EL3A 3GX9A 5A8OA 1OX5A 3OYXA 1XLHA 2GK1B 3GU9A 2OYKA 3LBCA 3BLEA 1DQWA 3KL5A 4PTXA 4JPGA 1XYAA 4GPNA 4UWMA 3ZR6A 2V3FA 2QUUA 4F79A 2VX5A 1LUCA 1K1DA 3AROA 4ML4A 4QG8A 3AMKA 1LT7A 2DZAA 1EJTC 1H1YA 4Z17A 3PPCA 5EYWA 1FWNA 2XSBA 3RF9A 4BF7A 1R87A 4GE8A 4RK8A 4JFTA 1AG1O 1UZ4A 2PWEA 1ZGDA 4MWAE 1G4TA 1WKEA 4JEJA 3RDKA 1UWSA 5HBFA 2B7PA 3LK6A 4LBUA 4Z2KA 4B90A 2FB2A 2WOQA 5DXYA 1D7KA 3A24A 2V5CA 2QUMA 4ZODA 3BQ5A 3L5AA 3RRAA 1A0CA 5JXQA 2XVKA 4U28A 1XSIA 5GVJA 5ABFA 4RX0A 4LVAA 4ZGYA 1UPPA 4L4PA 2AAMA 2GPTA 4QG6A 3APYA 5JMUA 3V7PA 5E6ZA 3CUIA 1H62A 3GTHA 1H5YA 3AHZA 3R0UA 4AWEA 3QQ1A 2O9PA 2CBIA 3V5OA 3K13A 4H9MA 1XGZA 1F6PA 3QOKA 4Q8VA 4UB9A 1FWHC 3CMFA 1G67A 4D6EA 1E40A 1UKSA 5FACA 5A2BA 4PUMA 3LRLA 2HS6A 4DX3A 3FY1A 1ENUA 2Z7KA 3N2BA 3W6LA 2ZFAA 1UH2A 3GH5A 4AQLA 2GSEA 1W1TA 5DBTA 2CBUA 2FYMA 1UR8A 3OZOA 1TR9A 1W1ZA 2FH8A 1L6GA 4RV3A 3ZJ6A 2CEQA 4GUIA 5CJ5A 3EWCA 1S39A 1FWJC 5JBFA 3LPPA 1A3WA 1QPQA 1OGSA 1RPKA 4U4MA 3VNJA 1LOQA 1YPXA 2GDUA 5D04C 2F8QA 1UD4A 4B3ZA 3T0AA 1CWYA 1Z41A 4QDPA 3R10A 4FPSA 4BA0A 2VDIA 1NFGA 4IX0A 3W7GA 1HQTA 2QF8A 1JYXA 3MQTA 2OPJA 3LERA 3WH8A 1XH0A 1DXEA 3COTA 5CGQA 4LX4A 5L6UA 3LCFA 2A4AA 3F7JA 4OU1A 3RX3A 4XV0A 2HROA 3ZLFA 2JQXA 3CWNA 3RLGA 2DVUA 3NQ2A 1V6XA 4DWSA 2JKAA 5G1TA 5CSYA 1FH9A 2ZC8A 4EPDC 2CLEA 1S2AA 2GGIA 2QCMA 4BI7A 4XAYA 3N6HA 4NZ1A 1Q8AA 3T2PA 5J5DA 5CKSA 2GJRA 1Y0EA 3VIKA 3ITTA 4BS0A 5G4HC 2X09A 3SAZA 3THCA 1W9BM 4UZSA 3C0SA 4WY0A 1ZFJA 3UU0A 3ZVHA 4GRSA 3M07A 3HMJG 4LSBA 4ES4A 4GISA 1C91A 2WNZA 1JAEA 1JPKA 3WLNA 1CW2A 3K46A 1JUBA 2XVNA 2XINA 1X6NA 5SWUA 3W1PA 3VCCA 4P7RA 1I8JA 4KGLA 1LORA 5G1MA 4CQBA 4EPBC 1UKTA 1A0EA 4UMCA 3M6YA 4PTMA 3PPGA 3POCA 1RPXA 4PBEA 1R3VA 3H4XA 2QF7A 2CZDA 2X40A 4F48A 1OK4A 2NV1A 3RR4A 1IXOA 1S2VA 3DHDA 3NZQA 3N9KA 4JTGA 4XSLA 1QFEA 3CZ8A 1XCFA 4JNYA 2SFPA 4B9ZA 3APTA 1UUOA 2YSWA 1GVQA 4GCXA 3AALA 2G97A 3R11A 2WJEA 5CPSA 3IVSA 3EX2A 3UPWA 4O12A 2PDLA 1JCLA 3WK2A 4AY1A 3H70A 1W32A 2X41A 4CVWA 3SB0A 1JXJA 3W37A 1FQ0A 6XIAA 1QOQA 1HN1A 4Z08A 4F8XA 3FYYA 2REQB 4GQRA 2KX9A 4Y96A 4FI4A 1QI4A 3WNLA 1XLLA 3B9DA 2EPKX 4GZJA 1MRQA 2QPXA 1ADOA 3CQIA 2YZRA 2QR6A 2YA0A 1S38A 3TV8A 5TIMA 3WMCA 7ENLA 3PFRA 1B31A 2VEGA 4UCFA 3VNYA 1LUCB 1ONEA 3P8IA 3BW2A 5REQB 1AQ0A 3GXTA 1H51A 2D2HA 3M0JA 3W1TA 3TMQA 5FJJA 2X7VA 1FTXA 4CNSA 3BCFA 3GK0A 4WD0A 3RM4A 3HG3A 5HATA 1YBQA 1M7PA 3NQCA 1TV5A 4EACA 1MVYA 5A94A 1H2JA 4GMEA 2ZIDA 3PULA 3W07A 3P14A 4GI4A 3IIVA 1EGZA 3QQWA 3AMCA 3MKKA 1OZMA 5TAOA 4CCZA 3L4YA 1T8XA 2B7OA 2PF8A 1T5AA 1JI2A 1NWUA 3TC7A 4LAUA 1VAHA 4YCPA 4M82A 5ABFB 8TIMA 3C0JA 1JZ5A 3LPOA 1PYFA 4E6MA 1R3SA 4J1OA 1Q13A 3T8QA 4Q4QA 2YYTA 5MKGB 2Y24A 1H7WA 2J7GA 2G3JA 3MHUA 3MSRA 5BXTA 1MQRA 1V6UA 2BGNE 3DHFA 1SFSA 1TPFA 2P0OA 3VFLA 3VKKA 1THFD 5I00A 1JPDX 1YQ2A 3R12A 2FKPA 4FF7A 2BVDA 1CLVA 1L6YA 1HVXA 2A3CA 2WSQA 3NUKA 4DZAA 3S2CA 3SSJA 1A47A 4PN2A 1JYVA 1V02E 5ABHA 2H3BA 1DPMA 3CZEA 3L5MA 1V79A 3P5ZA 1WQ5A 4QROA 4FR6A 2VFDA 4WUIA 1LJYA 1V3KA 1PV8A 1M7OA 2CLPA 3FGCB 1OCQA 5H8UA 1XLEA 5AKQA 2C3ZA 2VX4A 4P7LA 3N04A 3G1DA 2ONEA 4DZHA 1GK8A 1PCKA 1UJPA 1LOLA 4Q8TA 2P5NA 1AFSA 1QASA 3EWDA 3R25A 4IGHA 2YW4A 3AHTA 4N9DA 4BY3A 4BWLA 4AF0A 1FVPA 4TX6A 3MKCA 4LPCA 1RD5A 1Z44A 5FJIA 5FJUA 5HAOA 2OXNA 3E2RA 1YADA 1B3ZA 4MY1A 4ADUA 1UPMB 3E0FA 4ZQPA 3H55A 4S3JA 2X05A 1P1MA 2QCDA 4H2HA 1PHQA 2OB3A 1VCFA 8XIAA 3MUIA 1XIMA 5EMLA 3ZVHB 1OX4A 3IARA 3LXAA 3WQ8A 4AG0A 1EKOA 2QAPA 2FZMA 3PUEA 4AVNA 1Q8JA 1EQCA 2YBUA 3KBNA 3S6DA 5M03A 2PWUA 3FSUA 3KTSA 3VVGA 3C2VA 1D8WA 2I5QA 2ZC1A 2YFOA 4D6CA 3GS6A 2FZBA 2ZTKA 3PTQA 4AFYA 2V6AA 2FLIA 1OC6A 2E1DA 2ODOA 4HPNA 3URBA 4HN8A 2WSYA 1TJ1A 3B03A 3LV6A 3LCLA 3GG1A 3H2NA 3URNA 5HOSA 3PAJA 1E4MM 1HO4A 1V77A 2VX6A 3CMGA 3VIHA 1XM3A 4LCRA 1P6BA 1VFOA 2R91A 3LPGA 4NAFA 3BMXA 1HJQA 5C7HA 3N19B 2E40A 1E73M 3DFNA 3N11A 1Q6GA 3WK1A 2DP3A 4I7WA 1R7OA 1CYGA 3G0XA 4JTCA 5ECVA 4A05A 4HU0A 4DO6A 3F5LA 4HHMA 1HT6A 2VD9A 2YA2A 4FEZA 3MVTA 3WMBA 3WJYA 4Y9PA 3HA1A 3ANUA 1V7AA 1E0WA 5D2XA 3OU8A 2J6VA 3VMPA 4NZCA 2B0MA 4QEEA 4MKVA 1KXVA 1YPFA 5HINA 3VCRA 3OA3A 1Q65A 1WUEA 4Z2IA 3R89A 2D20A 1GOOA 3PBMA 1G0CA 4JIRA 3TCEA 1OFDA 1I2NA 2OEMA 3OZYA 1J2BA 1VBJA 5D37A 4Y2WA 3FAWA 4IL2A 5ENLA 3R6IA 4S3FA 2XN2A 4EX4A 1VPQA 4GVIA 1R5YA 2VCBA 3SEPA 3OVGA 1C29A 2PTXA 1F8MA 1BLIA 3KZPA 1VF8A 2JKPA 1XIJA 3CQKA 1TVPA 3GM8A 3LV5A 1XLCA 1B90A 4ZB5A 1UCWA 3WYZA 2NX9A 4KIRA 4UFLA 2D22A 4R9XA 2ZXDA 1WDSA 2X0HA 3G3DA 1F07A 5D03A 4IMFA 4P8VA 5H1WA 4HK6A 3HV8A 1HL2A 3VX1A 3WF2A 2PDNA 4FF5A 1SZNA 2FDSA 3ARWA 1SSDA 3OODA 3MP4A 4RJEA 1TJRA 4QNEA 2YLLA 1REQB 2D0HA 4FB7A 1TWWA 2AQOA 1KKOA 4FHAA 1T41A 4CQ9A 4E38A 3ZT5A 2W0UA 1WOAA 2OSWA 3PNUA 1DWHM 1I9CB 3GG0A 4YTTA 2HXTA 1Q4NX 3BOXA 3F4CA 3TC3A 1MUCA 4PC8A 1VEPA 4U3AA 3O7UA 1RP9A 3IJIA 1AUSL 3G1SA 1SYTA 1HJSA 4IMCA 2QS8A 1ISXA 4NL1A 2YOCA 2CZVA 4UTTC 1L2QA 3O6AA 4M56A 5JIWA 3MI3A 4NNAA 1GOQA 4AD1A 4WJEA 3VOJA 1P5BA 3L4XA 4X2PA 5FIPA 2ZRYA 4FO4A 5DT7A 1F73A 3LSBA 4K39A 1JQVA 4Z0JA 3SIZA 3MTWA 4ASTA 2J7CA 2DGAA 4JTRA 3P67A 5G2HA 1OCNA 2WVSA 1UKOA 3WX7A 5CC5A 4CD6A 3MZ2A 5AHIA 3CHEA 2J8FA 2JIWA 1VBGA 1A0DA 3W26A 3SGUA 1B3WA 2QYGA 4JYEA 3ITVA 4XB3A 5E5CA 4LY4A 3P93A 3LGDA 1S5MA 4AF0B 5FEWA 5DELA 3CAVA 3P3BA 2OKTA 2ZRXA 3TSDA 1TMHA 2BX7A 3FOKA 3HG4A 2JEQA 3B04A 4NZ5A 1BWVA 1R3QA 1X96A 3NDZA 1D3CA 4IPLA 3O05A 3EWYA 3LTPA 3LCWA 4L6OA 5A8NA 2RDUA 4KRTA 4D1IA 4Z2JA 1Q3NA 4ICMA 4ZFCA 1UD6A 2X1IA 4HA0A 1RLDA 1F2JA 2ACUA 2PTDA 3MJMA 4KMQA 3ZR4A 1YDNA 1JNDA 1S1RA 2VGFA 1Z8AA 4ONVA 3AJXA 1A50A 4AC1X 2CESA 1BFNA 3KRBA 3SY1A 1DQUA 2WXDM 5BWFA 2YL6A 5HPCA 3ZM8A 5TBOA 4XVEA 4QLKA 3MVIA 1XCXA 2Q09A 1EB3A 1OIMA 4R7WA 3NVDA 4W89A 5G2WA 3AOFA 1GQIA 4YNGA 1KXHA 1E1EA 1ZJBA 2CBJA 1R3WA 1F3EA 4PCSA 3VZYA 2Q8ZA 4KCWA 1TJ0A 3F4VA 5IFTA 3WLLA 3S9ZA 1L2UA 1Q66A 3STFA 3LHTA 5AHLA 1M7JA 4QNWA 2NT1A 3V16A 1VRDA 2X0SA 2ZUMA 3OPSA 1EUAA 3TW9A 1MW0A 5HMDA 3L4WA 1HJWA 3K4DA 1PKNA 1KM3A 1EEPA 1W17A 1K7XA 2NVCA 2BXVA 3MHGA 3R8HA 3RMEA 4EANA 3CTLA 2XIIA 4RLIA 1LWIA 1NEYA 3W7OA 1Q63A 1WKDA 2V30A 4B15A 3UWQA 5FSEC 1J01A 3UNDA 4AZ5A 3W38A 3IJLA 1ZNNA 3CC1A 2XSAA 1UH3A 3M0IA 1J8VA 4LRSA 3DX5A 4PB3A 1BYAA 4JDBA 2E9BA 4NNBA 4B5XA 1XIBA 2MUCA 5C0QA 3PAOA 5M3WA 1OGBA 4D2JA 3INPA 3DG6A 1FWAC 4LVFA 4IP4A 4D6GA 3N6QA 3WKZA 3UP8A 1OD0A 1WA3A 2PTYA 3M0LA 3KAOA 4W93A 2PBOA 1YNPA 2WVVA 5LXEA 4WKAA 3MCOA 3L66A 1US0A 2Z27A 4R3UA 3N4FA 3CTTA 3K1DA 2GUYA 1XBVA 1QW9A 2PTWA 3CUXA 1UC5A 4MB3A 3RNDA 3SM0A 3G6MA 2QCCA 3WELA 4JIQA 4X9SA 2YKKA 1HJXA 5D8ZA 4WX2A 2XDFA 1H61A 3SO7A 3FVDA 3IJDA 2GDQA 4JTFA 4J28A 4C5ZA 4LAZA 1V6YA 1P4CA 4NJJA 4REQA 1OG6A 4UZUA 2CCRA 3T44A 3KVJA 2VC7A 3E2QA 3B8WA 1B3XA 4K7VA 5CAHA 3TYEA 3NCOA 4JIHA 1FKXA 1F8IA 4I6KA 1QAPA 1AW5A 3NJ3A 3AYTA 2ZRZA 2BBFA 3BG3A 4YHEA 1XW8A 4AWUA 3LPFA 1B5TA 1FXPA 2RFGA 5HMFA 2D0FA 4ORMA 1TMQA 4PE8A 3U4FA 1SFTA 3QRHA 4JTTA 4LUTA 1F3WA 1MFVA 4O54A 3E12A 2O7SA 3NQGA 1L8PA 2O9RA 1EZ2A 2NV2A 4ZL1A 1OYAA 1TFVA 1G9HA 3GUWA 4ATLA 4L6HA 4RDWA 2VEFA 2VX7A 3BWWA 4Q33A 5FCZA 2PB1A 3F2DA 2QZRA 2WWDA 1KWGA 3L12A 3LMYA 5D02A 3MANA 2ACSA 2Q3RA 3MCMA 1PWMA 5FA5A 5HK4A 2X16A 2YB1A 4Q4RA 3BVJA 1C93A 4BQ4A 2XH0A 1W3HA 2RDXA 1RVKA 4H01A 2ESCA 1US2A 5AHNA 4MWAD 1KBJA 3ALFA 1RALA 2OFJA 4NXSA 1XLIA 4G8TA 1EJSC 2C79A 2OSYA 4HA1A 4LF1A 4JQ4A 1KCLA 1WDQA 2FJUB 4FK9A 2IKHA 1N55A 1GPWA 1JAKA 3UT0A 2NXHA 1GQJA 1CTNA 3CAQA 1GYMA 4N4QA 4S23A 4FX6M 2GQ9A 3MDUA 2DFAA 2E7FA 3GC5A 1FFQA 4R34A 3PSWA 1F5ZA 3B8VA 4MNMA 4ZQMA 4TOQA 3QR0A 5DLCA 1Z3NA 2GQAA 3HGRA 1W37A 2PDCA 4AIBA 2EPOA 3AXMA 4GX9A 4WY0F 2J75A 1K8YA 1XGEA 4QG9A 2V5KA 4O19A 1VIWA 2B81A 1SQ7A 3DYOA 3LHUA 1UP3A 1HVQA 2V5LA 4IICA 2WANA 5BMWA 2Q8LA 1KR1A 4U2ZA 4HMCA 1GG1A 2C91A 4B3LA 4DRSA 3F4WA 4GIAA 3A13A 4LS0A 4EXAA 4QM1A 4O52A 2Y5EA 4IP7A 2ZA1A 4UQBA 4YIWA 3OQ8A 4JN6A 3PJXA 1QNPA 3NPWA 2DZSA 3WH5A 1BKHA 3RM9A 5I03A 5A6LA 3NQ6A 4P8UA 3N2OA 4NXKA 5E1QA 4ZENA 3K1GA 3ZWTA 3AIRA 3AQUA 2XWDA 1K9TA 1OQFA 3UZWA 1I4NA 3NXLA 3W85A 1V6TA 3O0FA 3G22A 4WOQA 2BXZA 4HPGA 5A6AA 3AJ7A 1V3IA 3G1AA 5EU9A 3S5ZA 3U2EA 2HQAA 4NAEA 2BP1A 2JKEA 4XD3A 4TV5A 2PMQA 4PZVA 2F38A 3C0LA 5XIMA 1KXQA 1K8ZA 4RDVA 4HNUA 2WHLA 1OADA 1GVOA 4K8GA 1MQQA 3B8UA 1LP6A 2WVVB 1SGJA 4A8LA 1ADDA 1EPXA 2QJHA 4XQ6A 2ISFA 2DZUA 2XYLA 3T2QA 4X22A 3W74A 4XBKA 3AHYA 4R88A 2XVPA 1X6LA 1PX3A 1X1OA 1W5OA 4JX4A 3OA5A 3M47A 2ZADA 3EGJA 2OEKA 3QN3A 4WSJA 2WO5A 3OHIA 1ELSA 2PI6A 3OGRA 4DJFA 1D3HA 1S46A 1J0JA 3NO5A 4LVGA 2VXNA 1DJYA 1VFLA 3E38A 1C8YA 3TJLA 3WBWA 3PZUA 1Y5XA 1WDRA 2E0PA 2CKSA 3N18A 3E5PA 1RK5A 3TU9A 3GRIA 4OBSA 2OT1A