5K9CA

Crystal structure of human dihydroorotate dehydrogenase with ml390
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
362
structure length
354
Chain Sequence
b'ERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Development of ML390: A Human DHODH Inhibitor That Induces Differentiation in Acute Myeloid Leukemia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 139
structure length 354
sequence length 362
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2016-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5k9cA00
2OJPA 1GYLA 1JCYA 4JY9A 3HMJG 4IOTA 2QCFA 2E6DA 2E5DA 1WA3A 4FX8A 5CZJA 1VCGA 3UWQA 3VE9A 4UTHA 5ABTA 1UASA 1IIGA 4MZ1A 2OMAA 1H1ZA 2DZVA 5KINA 4UTJA 3EXSA 3GZ3A 4X22A 2CZDA 3PB0A 2WSRA 3STCA 2ZA2A 3YPIA 3Q94A 1XL9A 3LLDA 2HMCA 3P8JA 2QUTA 3LHVA 4QJ1A 1XDLA 3G8RA 5IM51 3DHDA 3G3MA 2W79A 2KZHA 1LBFA 3TFCA 4Z1AA 3R2GA 3W7DA 3HG3A 1ICPA 1GJPA 5F2GA 1ME7A 4FIQA 2BX7A 2ZZ3A 1W5QA 3QM3A 3W7CA 2QF7A 2C0AA 1KV5A 1SSGA 1PE1A 3E96A 2FB2A 4IXHA 3WK1A 2X30A 3ELFA 1AW2A 4LRTA 3CHVA 1VC4A 1SSDA 4JTIA 2GJNA 1SO4A 3P5ZA 2ZZ7A 1CW2A 1L9WA 1GOXA 1SZGA 1JCXA 1YLVA 3A24A 1YDNA 3TXVA 3U8GA 1H7WA 1TMHA 1BWLA 1YXYA 1XUZA 4JY8A 3WJWA 1GVQA 3NQCA 4N9BA 3SI9A 3IVTA 1KTBA 3A21A 5LHFA 1VCFA 4NU7A 1F74A 1X7FA 2JK2A 3G1DA 5G5IA 1G69A 4IUOA 2R8WA 3TK7A 3NNTA 3G0UA 4BWLA 2FPYA 2BXVA 3VI2A 5U4NA 2CZFA 1O5XA 3PG8A 4OT7A 1DL3A 5AYZA 1S5TA 4RXFA 1EWEA 5FEWA 5D04C 3NL2A 3L21A 3EX6A 1VR6A 4Y8FA 1VHNA 3AO0A 3KRZA 3C4UA 2YFOA 1F73A 3LBCA 2NX1A 2O7SA 3LXCA 4WXYA 4JX4A 1Z48A 4JNMA 1EUAA 1D9EA 4AHQA 3ZS4A 3L9CA 3PG9A 3EX1A 1FUYA 5D09A 4KFOA 1UUOA 3W1UA 2WSYA 3NVTA 1SO3A 3P81A 4XKYA 4LV4A 3ABSA 4N4QA 4QM1A 2TSYA 4N2YA 1QAPA 1K02A 2VC6A 4FX7A 3DKLA 1KBJA 3EWUA 4A21A 3IIPA 5CSSA 3IIZA 3IV3A 4ZVJA 2Y70A 3TIMA 4EIVA 5AC6A 3FLUA 4LVFA 3ATZA 3W7RA 1MO0A 1VHCA 3L0NA 4RX0A 2WNQA 4N02A 1QFEA 5HQEA 3EWWA 2CZ5A 4KWVA 2PE4A 3LHWA 3PAJA 3BK0A 1HUVA 5AHLA 3TXZA 2A85A 4AWTA 1OYBA 3NQMA 3VE7A 1DVJA 3W07A 4AWSA 2ABBA 3B0VC 1R30A 1JRCA 3R13A 5FEZA 5KZMA 3QYQA 3TKFA 2OT0A 3PWAA 4FEZA 4GUIA 2JKAA 2VEMA 4UCGA 1H61A 5C5YA 2YW3A 4IX0A 1KM0A 4DF2A 1TPFA 2NXHA 4IJBA 2DZXA 4P61A 4MYXA 3QJAA 1B9BA 1SPQA 4NX5A 3W70A 4MPQA 3ZWTA 2QCDB 2ZRYA 5DY3A 2RDTA 5AYYA 2QJGA 1TSIA 4RV8A 2J88A 5LNRA 3A22A 4JDYA 5LHEA 2HSAA 1XXXA 4FNQA 3LHTA 4JS3A 2EPHA 3LCHA 1OF6A 3P5YA 2P10A 3SECA 5AFDA 2XN2A 2Q3OA 3TMQA 4A3UA 1AW1A 4LVAA 1W0MA 1U5JA 4TX9A 1XKYA 4CQAA 5DBUA 1P0NA 2FTPA 1HTIA 3QW4B 1X1OA 2GQ8A 1TV7A 2DZSA 3NA8A 4OWGA 5D33A 3R8RA 1XBVA 4GUHA 3NZ1A 1B4KA 3EXTA 1T99A 3KFTA 1LOLA 2NWSA 1HO4A 1QO5A 1RQEA 4JTKA 2FFCA 3W9ZA 3UY7A 2BZNA 4AMAA 1ZAIA 5HUPA 5BMXA 2QDGA 3MI6A 1FCVA 3EWYA 3QC3A 1TPH1 5BW6A 3W71A 3MYOA 2QAFA 1QO2A 2ZRZA 2C14A 5L9FA 4IMGA 1WAUA 4YL2A 5IBXC 2NZLA 2V5LA 1TJRA 3LCGA 4PH6A 3GX9A 3W72A 4GC4A 3W1LA 3B4UA 1CX9A 4Y90A 3P8IA 3WK2A 3GNNA 3TAOA 3ABQA 3PUDA 3T4CA 1GTEA 2PRLA 4QISA 1C29A 3FEMA 4NJGA 3NPXA 1OX6A 1F05A 1Z41A 1Q45A 3HGOA 3CWOX 4JTTA 1A5CA 4JX5A 3GDTA 4LRSA 1ZY9A 2C15A 1DQWA 4HSNA 4UFMA 2GVLA 1M7OA 3JR2A 2FPVA 4DBDA 5LGZA 2VFDA 3W1MA 2V30A 3BO9A 5TBOA 4UC5A 1GTHA 4HNUA 2D73A 4NNAA 1H7XA 4WJEA 4W9TA 1MEHA 1FBAA 5U7SA 1F5ZA 3AJXA 3L5AA 3I7RA 2QCDA 2P1FA 2H8XA 3HG4A 3CEUA 1DOSA 2EAWA 2PURA 5CZTA 3BG5A 1VS1A 3W1RA 2EGZA 2GJLA 1TQXA 4YLWA 5EBUA 2PC4A 2YPIA 1Q3NA 3PM6A 1YDOA 1G4PA 1QOPA 2VEKA 5K9DA 3B0PA 4UNLA 1C9DA 1LDCA 5HWJA 1PV8A 2ZZ4A 3FKRA 4DO5A 1UB3A 2ZYFA 3LGEA 1RVGA 4M7TA 3M1ZA 4LUIA 2E6AA 3DFOA 1ZFJA 3MUXA 3QFEA 1L2UA 5HINA 3W22A 5KZEA 1IF2A 1ZJIA 4JICA 4M19A 4GE8A 1EIXA 2NWRA 3QMRA 2ATSA 3KVJA 3M9YA 1PS9A 1LLWA 2OT1A 2G96A 2VXNA 3BVJA 3PUEA 2NXGA 1A5SA 3V75A 1R46A 3LLFA 4OU1A 2XN0A 3UY8A 1P1XA 3P61A 3W1AA 2RDUA 2QJIA 3KOFA 5E93A 2B7NA 3LHUA 3PS7A 5I3IA 3MI2A 3SGZA 2W6RA 3UQNA 2CFFA 1P4CA 3FYOA 3EWZA 1QOQA 1W5PA 1VYRA 3UZJA 4NNBA 4LV9A 4I7UA 3SY5A 3GK0A 4UTWC 2JGYA 3MW7A 3IRDA 5KTLA 2J24A 3HB9A 3LBMA 5AYXA 1SZNA 1WYIA 1GVRA 3PUOA 3S1UA 3TJXA 1RZMA 3GDRA 3IGUA 4NJIA 3B03A 4O1DA 3NQDA 5AHFA 1TTIA 3MHFA 2H6RA 3LX9A 3R12A 3M41A 3W2KA 4LC6A 3WJZA 1OFAA 1WV2A 1NVMA 5AC8A 1XI3A 5HUOA 1J5TA 1SW3A 1W56A 4FHAA 3V1PA 1U83A 4CNPA 2E77A 1B4EA 5LSMA 2CU0A 2ZZ1A 4XWUA 1WXJA 4JTUA 1H60A 3S5NA 5SWUA 3GDKA 3UWZA 1WOAA 3C61A 3G1XA 3G1FA 2X1RA 3W2NA 4FF7A 1J4EA 3R5EA 4ORIA 1YXCA 4MOZA 3P60A 1X6UA 3U6WA 1JCJA 4O19A 4HNVA 5CPNA 1QPQA 4PL2A 1R2TA 1VYPX 3TH6A 5F4WA 2Y89A 5EKYA 3JRKA 3S42A 3UYCA 3QSTA 3IEBA 3W7PA 2CLKA 4IMCA 3TE9A 5HJLA 4MLJA 4TIMA 3W7KA 4JX6A 2YXGA 1FWRA 5HWMA 3SIZA 1K8ZA 1TPB1 1T0OA 3MJYA 4N4PA 1TPWA 3LDVA 3USBA 4MZYA 4QITA 4O53A 2RH9A 2NUWA 3C56A 4TMBA 2CZEA 1I2NA 4ZL1A 4Z1DA 4BFAA 4P2VA 2GOUA 2DP3A 4BK9A 1Q6QA 2ZRUA 4AHPA 4BR1A 1JULA 4XQ6A 1UUMA 3NQEA 4Y9AA 3S5ZA 1KFBA 4UR8A 1ZAHA 4BF9A 1HG3A 1HO1A 1RQBA 3W76A 3MI3A 4BWLC 3OVRA 1AL8A 4UTWA 3LTSA 3BG9A 4FX6M 5DCEA 3W85A 4GUGA 2EF9A 4CCDA 2Q3RA 1ONRA 2X1UA 3EX3A 4FNTA 4K39A 1V7YA 1W8SA 1W3NA 1UBSA 2QAPA 3W7LA 4AF0A 4ONVA 3DHFA 4MVAA 1A5AA 2AGKA 4DELA 4R34A 5LGXA 2C19A 1X1ZA 4AEOA 3TU9A 1IXQA 3I7SA 3M5YA 3N14A 1XBYA 2NUXA 4NVTA 4LS1A 2E5CA 1B57A 1H1YA 8TIMA 1KBIA 1GYNA 3LOTA 3M6YA 2DORA 1TPDA 3NQ2A 2DZTA 4HKPA 4PC8A 5K3VA 1TB3A 3ABOA 1F2JA 1XCFA 1KM3A 4ZQRA 1K7EA 4GRSA 4DF0A 3THAA 1FCBA 4YCPA 4IWWA 4M5PA 3BGJA 2E09A 3PBYA 2EKCA 3G3DA 1NF0A 3C8FA 1ZHAA 3W88A 2Z2UA 4O8RA 5FEXA 2TRSA 3HF3A 1SW0A 3IIXA 4TO8A 1ZCOA 3TR2A 3TAKA 1DJQA 2V2CA 5AHEA 3C2OA 1FWTA 1DQXA 4O13A 2E6FA 3NM1A 2A21A 3CT7A 5D2YA 4PEKA 2ISVA 5AOUA 1H7OA 3E9AA 4A2SA 1H7PA 1O5KA 3M44A 3DU0A 5LNUA 4G1KA 5AB3A 1FXPA 5K4ZA 1H62A 3WJXA 4IQLA 5D02A 2RDWA 3KVMA 1QCWA 3CTLA 3BG3A 3O63A 2CLIA 4XTDA 5HNRA 4LTSA 3DKJA 1KM1A 4HT3A 4I7VA 1PCKA 3NQVA 2EHHA 3CWNA 5H2ZA 1KM6A 4H3DA 3QQ0A 5D03A 2ZRVA 1SFLA 1AK5A 3HIJA 1SO6A 1RD5A 1GWJA 3WFAA 3W1NA 2C16A 4FNSA 2H3DA 3ATYA 2YW4A 3FJLA 3H55A 4I7WA 3QSRA 4I9AA 1KFJA 1I4NA 2I1OA 1PHWA 2R94A 5G4WA 5KZDA 4NZJA 1TTPA 4Z1CA 1KA9F 3N9SA 5K7JA 1T8XA 3SR7A 1VPXA 2QCNA 2G5WA 1LLZA 3W7JA 1TRIA 2UV8G 1R2RA 4M6VA 3BPWA 2DZPA 4RLIA 1WBHA 5E0KA 5FEPA 1YDVA 1A5BA 3B8DA 4O0ZA 1DKWA 4WD0A 5CGQA 1F7BA 5AN7A 1OK4A 3S5OA 5BNKA 1EEPA 4KFPA 2QUVA 4AAJA 4YMZA 2WNNA 3DH7A 5G1YA 1ME8A 2AQWA 3QQ1A 2C18A 3TMLA 5G4EA 4MFDA 3ANYA 1W5MA 2VENA 2FIQA 2ZTJA 3I6RA 1FWWA 3SGUA 2AAMA 2YFNA 3W2UA 4MY1A 2B7OA 4DF1A 2HTMA 2A6NA 1I8JA 1S5WA 4TR9A 4MIMA 4QAIA 3P84A 1H51A 4JTLA 3W7IA 3LCIA 1FWSA 3PB2A 4EWND 4O50A 1SQ7A 2F7FA 1QMLA 4RR4A 1GPWA 1O4UA 2CLLA 3RF9A 2RFGA 4EF8A 1SZFA 1YTEA 1LYXA 3PBVA 4JD4A 4QNWA 5KMYA 3M43A 1Q6LA 3FJ6A 3FIGA 1O60A 3GVGA 6TIMA 2G95A 1GG1A 3SFKA 1G4TA 3W87A 5BRBA 5F1VA 4FNUA 3HOJA 3A23A 3TQ0A 4DBEA 5D2VA 4LC8A 2C6QA 3W84A 5FF7A 3CEPA 5MHBA 4O4VA 3MO7A 1R2SA 1EX5A 1JQVA 2Z1BA 3IVSA 3LI1A 3WK3A 1OYAA 2Z6IA 4N6FA 2A0NA 1QPRA 2VFEA 1VLWA 4O15A 4NXKA 2NV2A 4GWEA 1QR7A 2DJXA 4LNYA 1OFRA 5HMSA 1RQHA 4O18A 4RXGA 2GPTA 1KV8A 3L66A 1EWDA 1K7FA 1XFBA 3Q58A 3Q2DA 4IPIA 3FYPA 3I68A 4O1AA 1OYCA 4RCXA 1VQTA 1LROA 1FCUA 3PR2A 4B5NA 4Z0SA 1AL7A 3N2MA 4NJJA 3U2OA 4JDBA 4IMDA 5KSWA 4DO6A 5I3HA 3ZFHA 3EXRA 4RZ4A 1LCOA 4Q32A 2B0MA 1NSJA 4CLMA 1OX4B 3GB6A 3UWUA 4DPQA 1OFBA 4NNCA 3NL6A 3W7OA 1GEQA 2O7QA 2QCLA 3O8AA 3LRMA 2HS8A 3BGGA 1TO3A 1O94A 1KFKA 2XN1A 2ZCGA 3C6CA 2ALDA 3GXNA 2OZ0A 1N7KA 3QRHA 3UNDA 4OHQA 4ZMGA 4O54A 3I7QA 5D2TA 3NEVA 1YPFA 1K7XA 1OHLA 2YDAA 4QNEA 2RHGA 4DXVA 2Y7FA 1RV8A 5HULA 1KLYA 4Q33A 2JKPA 1LBMA 1TTJA 1KFCA 3HG5A 4FIRA 2BTMA 5AHIA 1TCDA 3MMTA 3NPUA 3KRUA 1JQXA 1VRDA 4ZQPA 1TJPA 1FQ0A 3N73A 3NPVA 2Y7EA 2ZA3A 4C1LA 3TROA 5LKYA 3M5VA 5EL1A 5FF4A 4HN4A 3CLMA 4XTIA 2A6LA 3QH2A 4JTGA 3OEXA 1WDWA 1NFBA 2X1SA 2ZRXA 1JUKA 3M47A 1OFOA 3IGXA 4UXDA 1E51A 2V2DA 3HPZA 2R14A 1XM3A 3W74A 5DLCA 3TCEA 1OFDA 4WQ6A 2W0UA 3PY2A 4O0KA 7TIMA 2Z6JA 4MFEA 1EPXA 2ZZ6A 2QCGA 3NL5A 3G8EA 4U4MA 3DFNA 3G1YA 2WQPA 2QCHA 2OCZA 1X8FA 2VFGA 3KXQA 1N8FA 3STFA 2Y85A 1OABA 3W6YA 3HG2A 3PBUA 3W86A 1A53A 1SU5A 1ICQA 3NZRA 1SUXA 4Q4KA 3PF3A 3W1PA 4FO4A 3UXDA 3DFPA 4JIQA 1QPNA 5G2IA 4FXRA 2FLIA 3H53A 1W3IA 1JCNA 3LB0A 3LTYA 1VLIA 3W1XA 3EB2A 1FCQA 4KFNA 3G18A 3FA5A 4PTNA 3OBKA 3M0ZA 3PSWA 2VFIA 1FDJA 4WY0B 3BARA 3HGSA 3HJZA 5J5RA 1MZHA 4O28A 3W2MA 4HSOA 4K7YA 2YSWA 3NO5A 5AC7A 5I3KA 4S2BA 2FJKA 3RNDA 4HPJA 4WOQA 1YPIA 4QSHA 3T78A 5LZLA 4K6AA 2VEIA 5EYWA 3VFLA 3VCRA 4LVGA 3SZ8A 3PVFA 1TYGA 3QMTA 3T44A 2Y62A 2WSQA 2QDHA 4LVDA 3S1XA 4UTMA 2A4AA 4N6EA 1UCWA 1LZOA 4M7SA 3WJSA 5G1TA 4BI5A 3W7NA 4A22A 3THQA 3TQVA 2Y63A 1I2OA 4MJMA 1VCVA 1GVOA 4Z1BA 4BI7A 2GQ9A 5F2IA 5CPMA 3SW6A 4UTLA 3STGA 3MP3A 4OE7A 4RZ5A 3W75A 3QF0A 3HPXA 5I3GA 3OIXA 3IIVA 5DCDA 4UFHA 4O12A 2RKXA 3LXBA 6ALDA 3C52A 3RK8A 2I14A 2NX9A 3RLVA 4AB4A 4OV4A 3DGRA 1HFBA 2G97A 5DELA 4YXGA 5LNVA 2C1HA 4JTFA 3KVKA 3G1HA 4FNRA 3OVQA 4DQWA 1XC4A 3PSVA 4JYEA 1P5BA 4ORMA 4ZZ9A 2A5HA 3KAOA 3KRSA 4KWWA 4RKAA 4A2RA 3MBFA 1H50A 4R7JA 3EX2A 4JXCA 3TC7A 3L68A 2NXIA 3N9RA 5L6UA 2Y6ZA 3GXTA 2ABAA 2FB3A 3GR8A 5K2ZA 2JGQA 2H3BA 4UTKA 1KW1A 2A7NA 3W2JA 4LWWA 1NAL1 1F6PA 3CB8A 4U28A 1BEUA 3FS2A 4E0CA 5DY2A 3OHIA 3GIYA 1IXOA 1OFQA 1KM4A 4OGZA 3RLUA 3MYPA 1YTKA 3NQAA 5BMWA 4OQVA 1CI1A 1JCLA 3GKAA 5FF0A 1DV7A 1NF7A 1KTNA 2GVJA 3HGRA 1IGSA 3DI0A 3JS3A 3W7QA 5D2WA 1MSSA 3NYZA 4GJ1A 3TFXA 3LCLA 1TPC1 3IGSA 3UPBA 4H4IA 4JTSA 3NM3A 2ZQ0A 3NL3A 1UJPA 3L5LA 4LT9A 4O11A 4EF9A 3A5VA 4UUIA 3W1QA 1K3UA 4K37A 4O4WA 3G1SA 5E1QA 1DORA 3UWWA 3KHJA 2X1TA 1GQNA 3BW2A 4GFSA 1M5WA 2ISSA 3F1QA 4WZHA 3OA3A 1I2PA 4L4LA 2BLEA 3S6DA 4NQ1A 5C6MA 4XBSA 1PCWA 3O07A 2CWNA 4LY8A 1VZWA 2TMDA 4M6QA 1SR9A 1H5YA 4ZQMA 1THFD 1TPVA 1FWNA 2E68A 3SSJA 4QQ3A 1TV5A 3KVLA 4ZQNA 4IXXA 2QCEA 4LOCA 3LCFA 5FI8A 4NJHA 2ISWA 4BI6A 1H63A 1W1ZA 1LRQA 1VJIA 1W31A 3NQ6A 5G2HA 3G1VA 4JN6A 3IVUA 4LVBA 2BWGA 3W23A 3S5YA 3Q37A 5J5DA 5D32A 1VGAA 1AW5A 5DXYA 4LU0A 3QMSA 2YGYA 3EWBX 3TQKA 2J9XA 2VOMA 3BW3A 1ML1A 3DFTA 3G24A 4DO4A 1G4SA 1EB3A 1F6KA 1ADOA 2A1YA 4NXSA 1G6CA 1IXNA 1O95A 1S5VA 1G7VA 2NLIA 4LS2A 4UNKA 4XKYB 3S1WA 1PL9A 4UTTC 3VKJA 2Y7DA 3BLIA 3L67A 3HGJA 3K30A 1L6WA 5TIMA 4D2JA 1L6YA 5H91A 5FESA 2YX0A 3C0JA 1I2RA 4CNOA 4MZ8A 4PODA 3S8HA 3F03K 5HR7A 1OF8A 5G2WA 4CQ8A 3W7GA 4ZQCA 1Z44A 3LRKA 3CM4A 5TQLA 3LI0A 3VNDA 1P0KA 3BW4A 2DJLA 3W7MA 3QPYA 1JRBA 2ZA1A 4O10A 5EMUA 4UMAA 2QCMA 4K38A 4ALDA 4R33A 4WUIA 1WQ5A 3GKFA 4AXKA 3RFAA 5D05A 5AHMA 2YR1A 4XZ9A 2QEZA 2WJZA 4S2CA 3GAKA 3N2XA 3EEGA 3F4WA 3LCWA 1L6SA 3ZR4A 1I45A 3LM7A 2ZBTA 3TA6A 1K8XA 1KLZA 2TYSA 4GBUA 1TREA 5D37A 4JR5A 1XUUA 2DU2A 3CIWA 3OG3A 1SZEA 3MP5A 3MHGA 1HL2A 1Q6RA 3PBWA 1BWKA 1D3GA 1TPEA 4NX0A 1LP6A 4GUFA 2B4GA 1GVFA 2WPBA 5K4XA 4JEQA 1PVNA 4X9SA 3CC1A 3P74A 3TSMA 4H6KA 3TNOA 1W5NA 3UWYA 3TDFA 4XBKA 4E2BA 4N9CA 1A50A 2ATMA 4OBTA 2V82A 2ZDRA 3HPSA 2WNZA 3P62A 3FFSA 2X16A 3N3MA 3BV4A 4QIUA 4NT0A 3TX9A 1JR1A 2ZZ2A 3INPA 5C55A 5D30A 2E1DA 5FF2A 2NX3A 3TJLA 4FNPA 4MYAA 3B05A 5T26A 3FOKA 5DCBA 3LHYA 2C3ZA 3DENA 2QCCA 1OK6A 4UTTA 1ZALA 2VKZG 1DBTA 1VH7A 2JKEA 2DZUA 4C1KA 3P80A 2QR6A 1JVNA 2Y88A 2ZZ5A 1EP2A 4ADSA 1LRTA 4GXMA 3P67A 1KM2A 3EX4A 3O15A 1JUEA 4AWUA 3QZEA 1LOQA 5AHNA 4WY0F 4Y96A 4WOZA 2YZRA 4K7VA 4WX2A 3NAVA 4ICNA 3E0IA 1OJXA 3W2LA 3LV5A 1R47A 3T40A 4YWIA 3O6YX 2V5BA 3NDOA 4TMCA 5F2MA 2C13A 3O06A 4PL1A 3NXFA 3FKKA 3EKZA 5FF3A 3C2EA 1SFJA 4NZFA 3NQ7A 4NUWA 3LXAA 3C3NA 5EY5A 3TV8A 4O16A 5LNSA 3GNDA 4S1FA 1ALDA 1I2QA 3T7VA 1KFEA 5F2LA 3ZWSA 3BLEA 4MKNA 1BTMA 1FY6A 4J9JA 3C2VA 3E12A 1LM1A 4MLRA 3N34A 1GZGA 4UIOA 1ZAJA 4GNJA 3M5XA 5F1UA 3LHZA 1S3HA 1N55A 5DN1A 2H90A 4TU1A 1EP1A 1K03A 4K8HA 2CLHA 1PIIA 1AG1O 1QNVA 2Z0IA 1YTDA 4IMEA 1QWGA 4CQ9A 3DFQA 2QKFA 1SO5A 3B06A 4JTJA 5CSRA 1V5XA 1FDYA 5I3JA 5DBTA 4UFKA 2E6YA 4PA8A 5CG7A 1M6JA 2ZTKA 1QPOA 4M6PA 4UFIA 1AMKA 3QPZA 2Y61A 3D0CA 3DXIA 5CPLA 3NQ8A 5F4SA 2J6XA 3S1VA 3NGJA 1H7NA 3GAYA 3LV6A 3R89A 2TPSA 3W7EA 4HIBA 1RR2A 1FXQA 2YCEA 4MJZA 2CLMA 1YADA 2H8ZA 5HR6A 2J9ZA 3DFSA 3MHUA 3UD6A 4FB7A 1H7RA 4ZQOA 1ME9A 1W54A 4O17A 3ABRA 1QDSA 4JTEA 1G67A 3G0SA 1J2WA 3E49A 3NG3A 4UFLA 3L0GA 4LW7A 2LLEA 3N19B 3DI1A 2CW6A 5D38A 5K9CA 3WJYA 5EPDA 2CLEA 2Q8ZA 2IQTA 3P82A 1M7PA 2X2GA 1XDMA 3F4NA 5BOOA 3UPWA 4UTUA 3TSBA 1SW7A 3S0CA 1FX6A 5I3FA 3L5MA 3EKLA 4E2DA 4UFJA 3NQGA 2VFFA 1W3TA 3WK0A 2VFHA 3M5ZA 1EUNA 4JIPA 4MY8A 2ZRWA 1D3HA 1LTDA 3M7WA 5C2XA 3TW6A 1WBJA 1KM5A 3UWVA 3W83A 1LRNA 4R53A 1W5OA 1WX0A 1GVSA 2VEPA 1K8YA 2QUUA 2V9DA 3GYEA 4Z08A 3G1AA 5LNWA 5D2XA 2PRHA 3GXPA 3QEZA 1PHQA 2YYTA 3LRLA 4Z0JA 3A9IA 1OFPA 4GUJA 1WOBA 2GUUA 3KX6A 5HWNA 1ICSA 3NPWA 2GQAA 4CCEA 4EVZA 1MEIA 2WOQA 4RK8A 1OG0A 2V81A 2GVGA 2V8ZA 1YYAA 3TUUA 4RJEA 4IMFA 3M16A 2XFWA 4DEFA 2P0OA 2B7QA 3G0XA 3GDMA 2V2HA 3PC0A 4A29A 5CKSA 3O6CA 4LS0A 4UR7A 1BKSA 2J9YA 1Q6OA 3MP4A 3UXAA 3L2IA 1NEYA 1OX4A 4LUJA 4CCCA 4O57A 3W73A 4X3ZA 1T96A 2WO5A 1LBLA 4L4MA 4JYFA 1MXSA 1F76A 3I65A 5EA9A 4WXZA 3GLCA 4ML9A 3STEA 4IX2A 2Y7GA 3CIXA 3DAQA 1DHPA 3IIOA 4N9DA 2Q8LA 5A5WA 2R91A 2A7PA 1LORA 1JCMP 4MUZA 5IBXA 1G4EA 3L65A 1C8VA 4AVFA 3LERA 4Y6GA 1ZENA 2E5BA 1XBXA 1FDZA 1GT8A 3DBPA 3SJ3A 3EWXA 1ZNNA 1MEWA 4POCA 1Z42A 1IIHA 4KKXA 4HNTA 5CZSA 4OV9A 3L0KA 2CLFA 3GDLA 3HO8A 2V0TA 1KTCA 2NUYA 2VELA 1DJNA 4X2RA 2A2IA 2F84A 1JUBA 4UMBA 3O05A 4O1CA 3W3OA 1YXDA 1EA0A 4HPXA 1XBZA 4UTIA 3O6DA 3TW7A 3B0UX 2A7RA 4PFMA 5KITA 2J27A 3C2FA 2BSLA 4AF0B 3GR7A 3O16A 4DPPA 3A5FA 3RU6A 1TPUA 3G22A 2QJHA 1TQJA 4PCFA 3O1NA 3CU2A 4MY9A 1OVDA 1TV8A 3C2RA 3UZ5A 1RPXA 4JYDA 1IXPA 4O1BA 3MBDA 3W7HA 4CNNA 2CLOA 3B04A 1VYSX 2PCQA 1TTQA 3MWAA 5K9XA 4O14A 3PULA 3T55A 5F4XA 2FDSA 5CZ0A 1OFEA 4N9EA 3TC6A 3NR0A 1TRDA 5C54A 1G7UA 1W37A 2ZFAA 2WV8A 3W1TA 1GG0A 5GVJA 2YYUA 3QW3A 4JTHA 2NV1A 1KFLA 1Y0EA 4NJKA 3CQ0A 4K36A 3P7YA 4HHPA 4IPJA 4ADUA 2B7PA 5A8GA 2I9EA 4O52A 2OX1A 3TSDA 3E02A 4RZ6A 1OX5A 4UMCA 4EOUA 2FPTA 1B3OA 3LCXA 4WY0A 3DZ1A 3OVPA 4AH7A 3CPRA 3RMJA 1LOSA 1JJKA 2DZWA 4K8EA 3NQFA 4JGDA 2WKJA 3BLFA 2FQIA 3HBLA 4ADTA 3S9YA 5CPOA 4E38A 3HQ1A 2HS6A 1TIMA 5DXXA 1EP3A 3NOEA 4YCOA 3LTPA 4IGHA 4AHOA 4XUGA 4FXSA 3H54A 2JBMA 2PRMA 4HNNA
chains in the Genus database with same CATH superfamily
2OJPA 3P93A 2O56A 3HMJG 3RJYA 2QCFA 1QHPA 2E6DA 1A5MC 1UBPC 2ACUA 1AJZA 2E5DA 2YZ5A 5CZJA 1VCGA 2WYSA 3VE9A 4UTHA 3LS9A 3GW0A 1IIGA 3OZPA 4UTJA 3RCYA 4V1XA 1EQPA 4RPPA 1L8PA 2WSRA 2ZA2A 1T41A 1XL9A 3H24A 3TJ4A 3MSRA 3MMDA 3OIHA 2QUTA 4AZ6A 2R82A 5BXRA 3LMYA 1E70M 1YNQA 1LWIA 3G3MA 3WH9A 3GXFA 3AC0A 4JNYA 4PTWA 1VBGA 1LBFA 3N9KA 4Z1AA 3Q45A 3N4EA 3HG3A 4V2XA 1GJPA 2E4TA 2Z4GA 4PMNA 4FIQA 4DYJA 2BX7A 1W5QA 1FKWA 2C0AA 2R6OA 4F3HA 1SSGA 2JFEX 2FB2A 5BOEA 4IG2B 4WDTA 2ZZ7A 1CW2A 1EJWC 3PPHA 4S39A 2PDIA 4X9YA 5I09A 2OKOA 5JUVA 4LUTB 4MWAB 3TXVA 3WKZA 1PEZA 4HZ7A 3VZXA 3TTQA 1YXYA 1XUZA 1B3YA 3NQCA 2WVVB 1XHGA 4N9BA 3IVTA 1KTBA 2F2KA 4HA1A 1FA2A 1WUFA 4W5ZA 1UC5A 3W38A 4L80A 3KDOA 2HROA 4W93A 4BF7A 5DT5A 3T6CA 5I5RA 5T9CE 2QV4A 4BWLA 3HMCA 2BXVA 3VI2A 3RAOA 1O5XA 4IPLA 3V36A 3TYCA 3PG8A 1AUSL 3EDDA 3TN4A 5REQA 1BTCA 1EWEA 3AIVA 3FCPA 4ENLA 3HPAA 1REQB 3EX6A 5FD0A 2PODA 3AO0A 1DJZA 4GHRA 4E4FA 2CCRA 3LBCA 5BXSA 1V0LA 5LA0A 4R7WA 1WDSA 1OWQA 4XV0A 4JX4A 1UPMB 1Z48A 3GBEA 4Q7BA 3EX1A 5JBDA 3GVVA 3OYZA 1T40A 3UJRA 4XKYA 3G6MA 4OJYA 3ABSA 4N4QA 3GG0A 5DQPA 3WBYA 2GVYA 4A21A 5DMYA 3NDYA 1XIBA 3TIMA 1XJBA 5AC6A 3FLUA 3ZQ9A 1LT8A 1MO0A 1Q7ZA 3LGGA 1RCXB 3QVQA 3E2SA 3N12A 2CZ5A 4PTXA 3PAJA 3BK0A 3SCNA 2ALRA 5AHLA 3TXZA 1CXFA 1JD9A 5BOFA 4ACZB 1DVJA 1F8IA 2BGQA 3B0VC 9XIMA 1R30A 4GISA 2OOFA 4H2CA 4LUTA 4MWAA 4E2VA 1R3WA 4JIHA 2BVTA 4FLQA 4B5XA 2JKAA 3UF9A 2YW3A 3MY9A 3TC3A 4QG6A 1NH6A 3VUSA 4DF2A 1H0IA 4P61A 2ZWYA 3LZ3A 1B9BA 1UR9A 3IJ6A 4NX5A 2NT1A 3NOYA 2INZA 4CQDA 1CYGA 5DY3A 3T0DA 2Z27A 5A8OA 5LHEA 2PDUA 4JS3A 3SY8A 4GK8A 1OF6A 2XSXA 1IR2A 2VGFA 4G5DA 1J0ZA 3WLKX 1UKSA 1REQA 3PZNA 3BSMA 1W0MA 4FLRA 3H7UA 2FZBA 1XLCA 4ICCX 4TX9A 4J3TA 3KDNA 1P0NA 1ODUA 2PDHA 1GORA 3ZM8A 1H0GA 4Z2GA 3NO3A 3GHSA 1QW9A 1WDRA 1XR2A 3W9ZA 3TYAA 3AS1A 1GGOA 1U5HA 1ZAIA 5HUPA 4FXFA 2QDGA 3MI6A 4NZ1A 4UTFA 5FL0A 2C14A 1BRLB 3L4YA 2XH4A 3M0VA 2YCLB 1OT1A 4E3VA 4E6MA 3F4DA 1L6FA 4H9ZA 4GC4A 5HAOA 1CX9A 3P8IA 3WK2A 2VD8A 3ABQA 1UKOA 4M24A 1JDAA 4ACZA 2WKLA 1UH3A 1YE6A 3NPXA 4ZO9A 5HJYA 1DJIA 5CJMA 3QR0A 3GDTA 3M7SA 3FDKA 1XWYA 4J35A 4V28A 1SJDA 1JI1A 3FA4A 4B16A 1RY8A 1AZ1A 1RK6A 4DBDA 4JL1A 2ZOXA 2VFDA 1XIFA 3ZLHA 5LGZA 4DY1A 3ZJ6A 4M1BA 2ADAA 4ZTXA 4HNUA 2X05A 1H7XA 4WJEA 3FHAA 5U7SA 3I7RA 4YS1A 2E25A 1E4MM 1X6LA 2NVAA 1K1DA 2YDSA 2PURA 3AYVA 3LM3A 1E0WA 3W1RA 3STPA 1UZ1A 3WIJA 2EGZA 1BG4A 4HOZA 4YLWA 2PMQA 1NU5A 3QOKA 4PMVA 3E2VA 4ATWA 5C71A 4AC1X 1G4PA 3OVGA 4D6FA 4JHZA 1ZU8A 3B0PA 1C9DA 1LDCA 1PV8A 1DQUA 2KAUC 3FKRA 2BY3A 3LGEA 1RVGA 2ESCA 4LUIA 1J0YA 3DFOA 2YB4A 3QFEA 4WKAA 5KZEA 1IF2A 2NWRA 4KRTA 2NQ9A 4TXEA 3ZJKA 5EFDA 4TVCA 2ZXDA 4DJFA 3GO2A 2VXNA 2XUCA 4WVXA 4ZSUA 1OADA 3PUEA 1A5SA 1I0DA 1BRLA 3P61A 5A3HA 4X0VA 4MAVA 2YCLA 3CUGA 3SGZA 5CCZA 4Q3MA 4UQ9A 1P4CA 1QTWA 1QOQA 1W5PA 3CK5A 4LV9A 3TTYA 6A3HA 3H6OA 3WDPP 4UTWC 1BVWA 5I2UA 2W27A 3MW7A 4JIRA 1A47A 3VNKA 3IRDA 3LBMA 1GVRA 1ZBCA 5IXEA 4GVGA 1Y7VA 3GDRA 5LIYX 3NQDA 5AHFA 1TTIA 3CUXA 1FWHC 1HQTA 3BC9A 2E9BA 3LX9A 3WJZA 1OFAA 3VAVA 5CLWA 5HUOA 1SW3A 4JKKA 2P3EA 3V1PA 1U83A 1Q6CA 4DNMA 2E77A 2NQZA 1B4EA 2CU0A 1A5NC 4JTUA 4QLLA 5SWUA 1UA3A 4DJEA 3UWZA 4J2PA 3AJ7A 3C61A 3WQGA 1L8NA 3U4AA 3R5EA 3R1ZA 3OJGA 2Z25A 4ORIA 4XZMX 4MOZA 3KTCA 1QPQA 4G7EA 1VYPX 1KBKA 2WB5A 3BGAA 3P3BA 2DH2A 3QSTA 3IEBA 3W7PA 4IMCA 3MV11 5BROA 3W7KA 2YXGA 1FWRA 3GG8A 1T6MA 1TPWA 5TAOA 3AIWA 5FAGA 3USBA 4MZYA 3T2PA 4TMBA 2FGBA 1W1PA 1OB0A 3DYOA 5TNVA 4B4FA 3IUIA 3OB8A 3TR9A 3GU9A 6XIAA 4BZYA 4AHPA 1JULA 3C0LA 3NQEA 3GDBA 3CO8A 4BF9A 1RQBA 4KEZA 3NFUA 1W9PA 3MI3A 4BWLC 1XIGA 4ZEPA 1E6RA 4I8DA 4GUGA 2Q3RA 1ONRA 2X1UA 4YTTA 1BYCA 2VR4A 1W3NA 1UBSA 2YL9A 3NSMA 3E5PA 3F4VA 1QNOA 1NDZA 3DERA 4B2DA 1W3HA 1A5AA 2AGKA 1W6TA 4PUJA 3THUA 4XD4A 2C19A 1U33A 2QJNA 1IXQA 2BOGX 2H9AA 3C2YA 3M6YA 2DORA 2BHZA 3HURA 2DT1A 2DGAA 3NQ2A 1WDPA 2A3LA 1VF8A 1XSIA 4GYFA 1IZJA 4MB1A 5BCAA 5I0DA 5KETA 1E0UA 4IWWA 4TTGA 2E09A 4BHYA 1VD6A 4O8RA 1QK0A 2J77A 4TO8A 1H41A 2V2CA 5AHEA 2CEQA 5D2YA 2GK1A 1Q63A 5AOUA 1X97A 2BG5A 3NZPA 3DYPA 4MWAC 1VAHA 2ZXQA 3DU0A 5LNUA 4G1KA 1FXPA 2NT0A 5LXXA 1H62A 3WJXA 4XD3A 3LGDA 5D02A 2HK1A 4FXJA 2OSXA 1QCWA 3RLHA 1F3XA 3BG3A 2AMGA 3DN5A 3O63A 3SCSA 2CLIA 5HNRA 1KM1A 3NQVA 2WCGA 3EOOA 1BFNA 1WDQA 4H3DA 2V6AA 4OTKA 1SFLA 2EXOA 1GWJA 3P0XA 3GTHA 2C16A 1XH1A 1PYFA 4W87A 5HPCA 3QSRA 4P7LA 2I1OA 5KZDA 4JL2A 4NZJA 2WNWA 5K7JA 1T8XA 3EMQA 3E0WA 3QY6A 3VU2A 3AHYA 2G5WA 1B90A 3W7JA 3CASA 4PTDA 4DWSD 2PEVA 4AG0A 1WBHA 5E0KA 1VFOA 1EH9A 3SCRA 2IKJA 4H9MA 3B8DA 4O0ZA 1DKWA 1QUMA 5HQMA 1V79A 1F7BA 5BNKA 3GY1A 2V5KA 4AAJA 3MC5A 4S3GA 3CPUA 4AZ5A 4H41A 3QV8A 1FWWA 1T7LA 2EJAA 4IJRA 1U2YA 1H51A 3HJEA 1GQLA 1T8QA 3QXBA 2XVNA 1KCKA 4IUGA 1CIUA 2FZ9A 4INFA 4D6GA 1B1YA 1ODZA 3S2NA 3LBOA 1FTXA 2OXNA 4Y9PA 2QNEA 3ISIX 4LJ3A 1HKWA 2VRQA 1Q6DA 4CQCA 1VFTA 4NZ4A 2HRWA 1YTEA 1O12A 3PBVA 2EG6A 5J04A 1YKWA 3FJ6A 3FIGA 1O60A 3WMLA 3P6LA 3A23A 4DBEA 4QP0A 3W84A 3PJTA 5FF7A 2W62A 3CEPA 2JIWA 4GABA 1R2SA 3KHDA 3T05A 5I24A 3WK3A 1E1CB 1FWEC 4IICA 3R8HA 2A0NA 4U5KA 4NXKA 1P7TB 1C7TA 1OFRA 2I5GA 2C7FA 2VR2A 4GIAA 5HMSA 4O18A 4RXGA 2GPTA 3Q2DA 3FYPA 1KR0A 2CLPA 3UZXA 4QRNA 1LROA 3VGFA 3PR2A 2PTYA 1AL7A 3KS6A 4NJJA 4JDBA 3KE0A 1YIXA 5I3HA 4RZ4A 2POTA 1PPIA 3DDMA 1XYLA 4PCTA 1HZYA 3VIGA 3GB6A 4U2ZA 4DJFC 4DPQA 1OFBA 3PTKA 3W6MA 2PDXA 1X6NA 2WMFA 2O7QA 2QQ6A 1PX4A 1XGEA 2HS8A 3WLOA 4GC3A 2XN1A 1KFKA 2ZCGA 2C8NA 3IJ9A 3UNDA 1AD4A 3NEVA 1K7XA 1ZS2A 3N17A 3VIJA 2RHGA 4DXVA 2F2HA 1B0IA 3ABZA 4KEMA 2VDHA 4PCPA 4Q33A 1LBMA 1TTJA 4AD3A 4N7QA 4HN8A 4FIRA 1R9XA 3BOXA 1TCDA 2WMHA 4K68A 3MMTA 1XGZA 3ITLA 3NPUA 2QVHA 1JQXA 1VRDA 1TJPA 2ZA3A 2GDQA 1WAWA 5C2GA 3SEPA 2VCCA 1E4IA 1E9ZB 1CGUA 1SGJA 1EPVA 2CXEA 2ACQA 2GSEA 5IHSA 1R38A 3MUZ1 4BKNA 4RW5A 5GNZA 1NFBA 4YHEA 3WH5A 2WVUA 1KXHA 3IGXA 1IYXA 2V2DA 4UXDA 3HPZA 3JZEA 1XM3A 1YQ2A 4GI6A 1E1CA 1YX1A 4WQ6A 2W0UA 2DIEA 4EACA 1IWBA 2Z6JA 1US0A 2ZZ6A 3G8EA 2XIQA 4U4MA 3DFNA 4E4UA 2O9PA 2OCZA 4A05A 2VFGA 4HNCA 3KXQA 1N8FA 4B92A 1OABA 1ISVA 3WDHA 4DIAA 1E4LA 5EB8A 1SU5A 4GVIA 2ZX8A 3PF3A 1C90A 1NELA 1MWOA 1QPNA 3JZUA 5AYIA 4FXRA 2FLIA 1PSCA 5BRQA 3H53A 4PUUA 1GJWA 1VLIA 4TVUA 1GQIA 3EB2A 3CHCA 5D8WA 4KFNA 4H8HA 4U31A 3CJPA 3PSWA 4Q4OA 4US6A 4WR3A 3BARA 2D2GA 3TYZA 4HSOA 3RR4A 3NO5A 5AC7A 1WXYA 5I3KA 3ERPA 3WLSA 4WOQA 1BF2A 3T78A 1PTAA 3VFLA 3VCRA 4WK9A 2CNCA 3KLKA 3GSMA 3QMTA 2WHJA 2Y62A 4J3SA 4P5UA 4DJDA 4W7UA 4JCMA 3S1XA 4UTMA 3I10A 2A4AA 3S9ZA 3H12A 4ZXOA 1CXLA 3W7NA 3WQVA 3ZXWA 4OKDA 3THQA 1GKPA 4MJMA 1I2OA 1VCVA 1TWSA 4BI7A 2ZUVA 2Y8VA 5CPMA 1EFZA 3VM5A 2R1MA 4RZ5A 3KP1A 3W75A 5XIAA 3AFBA 3OIXA 4UFHA 2I56A 4QG9A 6ALDA 2XVPA 5DELA 1JF5A 3LK6A 3WDRA 4F9JA 4RZBA 4DQWA 4HOWA 1P5BA 2PTWA 2V68A 3VD4A 3V18A 4L6OA 5A6SA 3EX2A 2IPJA 3RM8A 4FA3A 1LG2A 1GVEA 1PWMA 4NSBA 2OEMA 3W2JA 1F6PA 4NF7A 5GJPA 4AD2A 3FGCA 9CGTA 5DY2A 3OHIA 1EA9C 2C1GA 3RLUA 3WYZA 3V35A 4OQVA 5FF0A 1IGWA 1P0DA 1NF7A 1KTNA 1ZGDA 3DI0A 3MVIA 1MSSA 4JQ4A 5JIWA 4O0QA 3LCLA 1PB0A 1NWSA 3IGSA 4H9UA 4R88A 1XQLA 4H4IA 1KQZA 2VC9A 4LPCA 1EJXC 5ENLA 4EF9A 3W1QA 2A3EA 1K3UA 2ICSA 3OLGA 4WKFA 3G1SA 3O0FA 3UG4A 3BW2A 4GFSA 4WSHA 3SCVA 1I2PA 2QGYA 3S6DA 2OGJA 4GQGA 4NQ1A 1PCWA 2CWNA 4G2DA 4LY8A 4M6QA 4TUFA 1SR9A 4ZQMA 1THFD 4LOCA 1FWGC 4NJHA 1VJIA 4C6FA 7ENLA 1MW0A 4F48A 1FWFC 4WLCA 3CUJA 3MMWA 3W23A 4REQB 1M41A 3C86A 1XS2A 4IJCA 2NW0A 2ZC8A 1SM9A 4C7GA 1OIFA 3BW3A 1BAGA 4DO4A 2G3IA 1EB3A 3ZO9A 3GD6A 1ADOA 2VGIA 1XIHA 4IFKB 3BE7A 3F5LA 4C6KA 2NLIA 1S2UA 1HKMA 2E28A 2AAAA 2XIMA 1YHTA 1L6YA 5BXPA 3C0JA 1EOMA 4LUSB 3N25A 4PODA 2D20A 5HR7A 1E0VA 3BXWA 4IIFA 1OF8A 4CQ8A 5E9XA 2J25A 1ONXA 4JIEA 1V0MA 2RUSA 3CM4A 4G6CA 2PLMA 3PZQA 3U5YA 4ZR8A 3KCLA 2VVNA 3WUFA 4GLEA 4ALDA 5LIXX 3BQ6A 3BWWA 5AHMA 4DAIA 2Z1XA 3AXKA 1XYBA 4QEHA 2VMFA 1V3HA 1V02A 5KEZA 2YCJA 3F4WA 1EJUC 1YNPA 2Z1SA 1HKKA 1RALA 3B9OA 5A2AA 3ZR4A 5DMLA 2ZBTA 3TA6A 1K8XA 1KLZA 4JR5A 4JFTA 3CIWA 3OG3A 1CPUA 1SZEA 2ZDSA 3MP5A 1HL2A 1Q6RA 3NSXA 3PBWA 4KIEA 3LD5A 5H8MA 2B4GA 1BQGA 2WPBA 4GI8A 2PU0A 4X9SA 3P74A 4MADA 3APYA 3TSMA 3BANA 3KBJA 5C9UA 1UWUA 2PU1A 3GNXA 1NP0A 4PEEA 1RLDA 4N9CA 2WM0A 4XZBA 4REQA 4J1OA 4IP7A 3UG5A 4CD6A 2WNZA 3CWHA 1O1HA 2X16A 1S2WA 3BCJA 2GQ3A 4QIUA 4NT0A 1H1NA 2ZZ2A 2E1DA 1DE6A 4Q8UA 3TJLA 4HU8A 3ITTA 4H00A 4JN8A 4KPLA 3SIMA 1ZTVA 3LHYA 2C3ZA 4WF7A 2VRKA 2QCCA 4IFKA 4UTTA 3WNKA 1DBTA 3IWPA 2DZUA 4C1KA 3P80A 2QR6A 1PDZA 2VP8A 4L56A 4ADSA 2G50A 3P67A 4H1ZA 5AHNA 2HNHA 1JDEA 3N2TA 4MG4A 2YLAA 3GUGA 4LAZA 3BLOA 1J18A 3FN9A 3W2LA 1US3A 1QVBA 3LV5A 4Z2IA 4YWIA 1TKKA 3I4EA 3UBPC 2IW0A 1JZ5A 2G4JA 4PL1A 3FKKA 3C2EA 4AXNA 1SFJA 3ZT5A 3LXAA 3TV8A 2EG7A 4O16A 5LNSA 3P14A 4CNTA 2XSAA 3TA9A 1KFEA 1FWJC 3O2LA 3WQFA 4H8VA 1ZBWA 4J9JA 4J2MA 4MLRA 3THCA 4GNJA 2BODX 1DJHA 4OZOA 1NQKA 2NQLA 1N55A 1SJCA 1EJRC 2WZMA 4K2SA 3SRKA 1AG1O 1QNVA 1YE4A 2Z0IA 1QWGA 3W02A 4Q4QA 4JTJA 5CSRA 3FW6A 3WDIA 5E6ZA 2QLYA 1GOMA 4J40A 4GIRA 1BSLA 2Y61A 2FZMA 4D8AA 4OBSA 1CWYA 1R5YA 1NFGA 3S1VA 1A0DA 3R89A 3NZQA 4I8YA 4WGXA 1LJYA 7REQB 3W7EA 3QHMA 5LA1A 2HK0A 2YCEA 4MJZA 4CU7A 4FOJA 4O17A 3PP7A 1FP8A 3ITXA 3VDGA 4X60A 1G67A 4JQ2A 2GGEA 4D8LA 3NG3A 4G1NA 4DJDC 3DI1A 1W9BM 5DMMA 5CQ1A 2IQTA 1CXIA 3VGGA 3BCDA 3LUTA 1RA0A 3ARXA 1XYAA 4YPJA 3VIIA 3VOGA 3L5MA 4E2DA 4UFJA 3NQGA 7TAAA 2VZUA 2VFFA 1W3TA 3N4AA 4PSRA 4JIPA 1D3HA 1LTDA 4XZLX 5CBBA 2GJXA 4JQ3A 3W83A 9XIAA 1AA1B 1XKJA 2FVMA 1IE7C 3GXPA 5D2XA 1OY0A 1PHQA 4PMDA 1OFPA 3SUWA 1WOBA 2GUUA 2GQAA 4EVZA 3BL3A 1S38A 4F40A 3LLXA 2WMJA 2X41A 2YBVA 4ZFMA 4IMFA 3M16A 1F4HA 2V2HA 1V0NA 3PC0A 1U22A 3O6CA 1PIGA 4IGMA 1K9FA 1BKSA 4HD5A 1QASA 3MP4A 4L9YA 2A79A 2QVNA 1NDVA 3WLHA 4MAZA 3MSYA 2ZICA 3W73A 4X3ZA 5I77A 1UHVA 4GZEA 1WKEA 2PP0A 3GLCA 4ML9A 7REQA 2Y7GA 1DHPA 4N9DA 4RE4A 1ZBKA 4HMEA 4MUZA 3ZYZA 1JIBA 3MV01 2R1LA 1L6GA 1C8VA 4AVFA 5H6HA 4Y6GA 1MDRA 2V3DA 2VQTA 3RCMA 4E5TA 2XFRA 4KKXA 1UUQA 5CZSA 1Q8JA 3VCNA 3GC5A 1OD0A 3HO8A 1KTCA 2NUYA 4PBFA 4YHGA 4GO8A 2A2IA 3OPSA 3HFTA 5LXEA 3CAWA 1JUBA 3PPGA 3KTXA 4HPXA 4Y8EA 1XBZA 3UJEA 3ID7A 3AMCA 3OA5A 4PFMA 5KITA 4ZBCA 1AFSA 3N18A 3GR7A 4FMVA 4AF0B 4DPPA 1V93A 3G22A 2RDXA 3O1NA 2DW6A 3LENA 5AZ0A 1JYVA 1OINA 2BDQA 1IXPA 4RDWA 2D0GA 4CNNA 2CLOA 2V3FA 4D6CA 4FPSA 2PCQA 2Z2BA 1TTQA 2VEFA 3TYDA 3KL5A 2P50A 3PULA 5F4XA 1B9ZA 2JF7A 3ARYA 4DUWA 3E2QA 4LCRA 1GG0A 2YYUA 1ADDA 4LUYA 1ISYA 3W82A 1KC7A 1H4PA 4ADUA 4BY3A 4QG8A 3GXIA 3LYEA 4O52A 2BASA 3RMEA 1W1B1 1TUFA 4UMCA 4EOUA 4J7RA 1B3OA 3LCXA 4XAZA 4WY0A 3T81A 2W3ZA 3DZ1A 1H2JA 3APGA 3OVPA 3RMJA 1LOSA 3BSHA 4QDPA 2DZWA 3K8LA 2YB1A 3UR5A 2EPOA 2FQIA 3HBLA 3B4YA 2GGIA 2G3NA 2XM1A 5CPOA 5AECA 3LPPA 4E38A 3K8MA 3N6JA 3BAJA 4GGBA 4S3BA 1TIMA 2MNRA 3GG1A 5DXXA 4D6IA 4YCOA 3LTPA 3T4WA 2E67A 2WMIB 3GHTA 4FXSA 3LNMA 2UBPC 1JCYA 4JY9A 4D6DA 4IOTA 1ZJHA 4WHBA 1RA5A 3NIYA 1UR1A 3E5BA 4PE8A 2C79A 1ZP4A 2VCAA 2XFYA 1UASA 1CB7B 4P7RA 1H1ZA 2DZVA 5HMFA 3KOYA 1QT1A 3NCOA 2D69A 4X22A 1NOUA 3PB0A 4XX6A 2XYLA 4GIEA 4QAWA 3W81A 2J7DA 1J0KA 1Q7QA 5I06A 4FALA 1GQKA 4QS6A 2YA0A 3VOFA 5A8PA 4HJWA 2W79A 1GOOA 1TE6A 2VZVA 2G37A 1M7JA 3W7DA 1ICPA 3JVAA 1WZMA 3K1DA 1A3XA 2EO7A 4PRRA 2CHOA 2DIKA 3IUDA 2UY2A 5H8UA 2O55A 3E96A 4XD6A 2FZ8A 2HV5A 3M0XA 3ELFA 3S2MA 1B3ZA 2PPGA 3CHVA 1VC4A 1SO4A 1XW8A 3DHPA 3HZ3A 2NV9A 4IL0A 2OPJA 1YLVA 3A24A 1YDNA 2ZC1A 1H7WA 1TMHA 1DIEA 1OC6A 2ZVIA 4JY8A 2GUBA 3H2FA 1A0CA 4YWSA 1BLIA 2IPWA 3OBEA 1LLOA 1I9CB 3DC8A 2R8WA 1RLCL 2WMIA 4LBSA 1XH2A 2FPYA 1NDYA 3U57A 4NI3A 2EG8A 2DUAA 4ZODA 3QKZA 4E2OA 2DT3A 5FEWA 3ZIZA 1PZ1A 3C4UA 5CBJA 3QQWA 4JBRA 1F73A 3KS5A 3UR2A 4FOUA 1OGSA 3VDHA 1E6ZA 5BU9A 4DLMA 3MKKA 4RDYA 4JNMA 1EUAA 1D9EA 1W32A 1YDYA 3L9CA 3PG9A 1FUYA 4KFOA 3UWEA 1E9YB 1XRTA 3W1UA 3NVTA 5FKYA 1UKQA 3CS2A 3H8AA 3VD5A 1QRQA 3KBVA 3RJXA 4PMZA 1K02A 2VC6A 3A13A 1KBJA 5CSSA 3IIZA 4HA4A 3IV3A 2QXWA 1HKJA 4LVFA 4AD5A 3ATZA 3BJTA 1CLXA 4N02A 1QFEA 3BTNA 1JDFA 1FWIC 3KBWA 1Q4NX 3WQ4A 4L1GA 2R24A 3AUJA 3VE7A 3W07A 4AWSA 4CD4A 2ABBA 4C60A 5FEZA 1G5AA 3QYQA 3TKFA 4UCGA 2E9LA 5C5YA 3BURA 3KWXA 4IX0A 3UR8A 1XV8A 2TAAA 3UP8A 3FVDA 4MYXA 3QJAA 3N2OA 1XLHA 1OZQA 2QZRA 3WQWA 3GTNA 1IEQA 3ZWTA 4BJHA 3R4IA 5AYYA 1JPKA 1R86A 2J88A 2PDJA 1NTHA 3A22A 1ZRQA 2HSAA 1XXXA 3LHTA 1Q65A 1J01A 1QBBA 3P5YA 4R3UA 4TOQA 3GHRA 2XN2A 3QHNA 4AZBA 3SGGA 2ZIDA 2XM2A 3R25A 1V51A 3GXDA 3QW4B 2GQ8A 2YL8A 1TV7A 1VENA 2ASHA 5D33A 3R8RA 1B31A 4IIBA 1WKDA 3S6OA 4GUHA 1P0EA 3ITYA 3AAMA 4AD0A 4B9ZA 1LOLA 2NWSA 1UWRA 3L4WA 2PDGA 5BU6A 2BZNA 4P8UA 4YVXA 1ZLPA 1UQZA 3WF4A 3NYDA 5BMXA 4O1FA 2V5CA 4LYPA 3WBXA 3PTDA 4AD1A 2QAFA 3MYOA 3PAOA 1WAUA 2NZLA 2FGLA 5C70A 1CGVA 4DYKA 3LCGA 1AQ0A 3GX9A 4HQVA 1GVYA 3W1LA 2OZTA 4Y90A 3GNNA 3TAOA 1XRVA 4FLOA 4XO7A 3AYRA 4QISA 3WLNA 2PF8A 5I03A 1R7AA 1F05A 3B8VA 3HGOA 2P53A 3CWOX 1QW7A 4JTTA 1A5CA 4JX5A 4LRSA 5A8QA 3V3WA 1DQWA 4IHCA 4U10A 1M7OA 3GQYA 5CG0A 3JR2A 4W7VA 1TJ2A 2GUYA 3BO9A 4UC5A 3PNUA 3K4AA 4NNAA 1FBAA 4WJXA 3AJXA 3L5AA 3ZZ1A 4PMUA 1H49A 3MSGA 2I57A 2W67A 2EAWA 5CZTA 5A6BD 3BG5A 1ZPTA 1S2TA 2GJLA 4GZIA 2Z7GA 3WG6A 3IV8A 3TN6A 1Q3NA 1FHUA 2PZNA 1G1YA 4GACA 3NJ3A 3Q67A 3BAKA 4UNLA 5HWJA 4XVDA 4DO5A 4DWSB 3M1ZA 4CEXC 5HINA 4KF1A 4JICA 2D3LA 4B5UA 4QDMA 4Q4MA 3BOFA 3CIVA 1DWHM 1PS9A 3N13A 2G96A 2FH6A 1NFPA 5A95A 2NXGA 3V75A 3A4XA 1P1XA 1TWWA 1VJZA 3GC2A 3W1AA 2QJIA 4DWDA 1BWVA 2F6UA 3PS7A 2W6RA 1BYBA 3UQNA 3VUPA 1UR4A 4DB7A 3UZJA 4NNBA 4I7UA 3SY5A 1HKIA 2FHCA 2DH3A 4C91A 1UR2A 2OQLA 3HB9A 3GHUA 4QE5A 1V3LA 1Q7MA 1FWAC 3IGUA 1HJUA 2PB1A 3E1F1 1XLFA 4H9XA 4KIRA 1S46A 3M41A 3IGHX 1K6AA 1WV2A 1EBGA 2CHRA 2Y5EA 1J5TA 5HMDA 4FHAA 4JNZA 4KWOA 2QUNA 2E8ZA 1G94A 5LSMA 2ZZ1A 3R0KA 4XWUA 1IT8A 2IPGA 2PCEA 2NVDA 4A35A 1O66A 3GDKA 1B2YA 5FJJA 2OWXA 1WOAA 3G1XA 5FA5A 3UJFA 2ZX5A 3EDJA 5DRCA 3GVQA 1LF1A 1X6UA 3U6WA 5HBFA 1JCJA 3H21A 4O19A 1R2TA 2Y89A 1PX8A 1KD0A 3AZRA 1XYFA 4Z2JA 3IRSA 4MLJA 4TIMA 1CT5A 5HWMA 4DWSA 1TPB1 1E4NA 5HPOA 3LDVA 4QITA 2NUWA 3C56A 2CZEA 1I2NA 3AXHA 4Z1DA 3E0FA 3ZT7A 2GOUA 4UCFA 3WNLA 2ZRUA 4PMJA 3H22A 1EIBA 4XQ6A 8RUCA 3S5ZA 1KFBA 3QGAC 3RM4A 2WZTA 3T9PA 1E1FA 4GXPA 3VNIA 1VBJA 2A3BA 4BQ3A 3OVRA 4IMAA 3BAIA 3H7RA 3CAKA 1I6NA 1ZZMA 3LG3A 3WDJA 2EF9A 3MCNA 3E74A 4CCDA 4AZCB 1ITXA 3ZSSA 3EX3A 4P7QA 4UBPC 2GJRA 3KCJA 2P5NA 4S3KA 3WY1A 4MVAA 1GYMA 4R34A 2VO5A 3WF0A 1W3KA 3N14A 1K8CA 2PDYA 2NUXA 4FP1A 3WD0A 4JKMA 4RUBA 3VM7A 2AL2B 1KBIA 1GYNA 1I1XA 3LOTA 1J6PA 2E3ZA 4AC7C 1UH4A 2O4QA 4BQ5A 2OKTA 1TB3A 3ABOA 4IIHA 3U2ZA 2OR2A 3VK5A 1E6PA 1Y5WA 3C3UA 4HB7A 1O6IA 4PSPA 4OBRA 5FJIA 2FTYA 1JD7A 3NGFA 4M5PA 2DVUA 3PBYA 2EKCA 1S5MA 3QGVA 3BLKA 4EXAA 3R6IA 3C8FA 1ZHAA 3W88A 2VX5A 2Z2UA 3AXXA 4GG9A 5FEXA 2TRSA 3HF3A 3LU2A 3IIXA 3ZR5A 1ZCOA 4AIBA 3K46A 3C2OA 2GSJA 1MNSA 4O13A 2E6FA 1ZP3A 2VZSA 3NM1A 2VHLA 1NWRA 3G5EA 4M29A 4B9YA 3TZFA 3ZLFA 5AB3A 3WF3A 4IQLA 1ZBVA 2ZX9A 3KVMA 2O0TA 4O8AA 2BVYA 1IEWA 4ZSTA 4XTDA 3DKJA 4I7VA 1LWHA 1DIDA 3WD2A 3RX2A 1GVIA 4IL2A 4V27A 2VI0A 2Y0FA 3HIJA 2GWGA 2WKGA 1D7KA 4Q4PA 3WFAA 4LEQA 1ZJAA 2O9OA 3WEOA 1Q13A 3S83A 4AZCA 4AMCA 2H3DA 3FJLA 1MI3A 3CNYA 4I9AA 1K6WA 3NXLA 1I4NA 1PHWA 5G4WA 1R3VA 4Z1CA 3N9SA 5M17A 1WXZA 4HCDA 4MWAE 4NRRA 3V4BA 2UV8G 1R2RA 3PZGA 4JPGA 3WD1A 2ZE0A 2DZPA 1ZSXA 4MKVA 2OQYA 3VMNA 4WD0A 5CGQA 5AN7A 2F6XA 2Z24A 2CZVA 3SCWA 2QUVA 3DH7A 3NZGA 1KNWA 5G1YA 3H7VA 1PIFA 3QQ1A 3ANYA 1W5MA 1VBUA 2ZTJA 3DCPA 3W2UA 3WO8A 4LGXA 3T09A 2A6NA 4MIMA 1J0IA 1E1EA 3LCIA 3VZZA 3GM8A 4D71A 1FWSA 1OG6A 3PB2A 4H83A 2CETA 5CAKA 4RR4A 4L9ZA 1O4UA 2QIIA 3LQGA 1WDDA 3SFWA 2RFGA 4YVVA 3TP4A 3CL8A 1LYXA 4JD4A 4PCSA 4F0MA 3T0BA 1GG1A 1KKRA 3SFKA 1G4TA 3W87A 4AISA 3S2CA 1IEXA 6REQB 3USZA 4J3XA 4LC8A 3VIHA 3GU2A 1TUXA 7PTDA 4W84A 3RRAA 1J2BA 5AC5A 1WE5A 1EX5A 2BXZA 1MFVA 3IVSA 3DECA 1OYAA 4DM2A 2Z6IA 4OUIA 2NV2A 4GWEA 4JQAA 2DJXA 2YL5A 1F4AA 1RQHA 1ZL1A 3W01A 3N2BA 3EBVA 3Q58A 4IPIA 1JXKA 1VB9A 2ZUWA 3I68A 3VIKA 3OG2A 1IR1A 3ZLGA 1N2VA 4Z0SA 2CBUA 1TZZA 3U2OA 4PUNA 3GWQA 2J7GA 3OU8A 3ZFHA 3K5XA 5LIKX 4CLMA 4PULA 4ZENA 4A8NA 3WMCA 3PBMA 4BQ4A 2WHKA 4NNCA 5FL1A 4DZHA 2QCLA 4MSSA 5C2CA 3BGGA 2BHUA 1TO3A 2X2YA 4X2PA 3RO6A 2ALDA 1J11A 3GXNA 1GONA 3QRHA 2ZVRA 4MJ2A 2DT0A 4S3EA 5D2TA 2YDAA 2PDMA 1OHLA 3VOCA 3WLRA 2Y7FA 3RX4A 3ITCA 4JTRA 1TIWA 3MMUA 3HG5A 3GVRA 2F6KA 4YTUA 2BTMA 2G41A 3TN5A 4YTSA 5BWFA 4ZQPA 1OCQA 3NPVA 2HZGA 2Y7EA 1UKPA 1TVLA 1I0BA 4C1LA 2OZ3A 2I17A 2WLZA 5D9MA 2XGZA 3M5VA 2WBKA 4HN4A 1QW8A 3ECQA 4C5YA 6REQA 4JTCA 4MDOA 2A6LA 3CTTA 2GWNA 3QH2A 2ZUUA 1HP5A 3OEXA 5HNNA 1C8XA 1YPXA 4NKCA 2DVXA 3M47A 3U5UA 1OFOA 2F38A 3IS4A 1EL3A 1R3QA 5DLCA 4HOXA 1RXOB 3TCEA 4RDZA 1UROA 1OFDA 1UD2A 4O0KA 7TIMA 1V6YA 1DIKA 2QCGA 3K2GA 5A6AA 2QCHA 3CB3A 1RUSA 3W86A 1ICQA 3CZEA 3VIOA 4C6LA 3KUMA 4Q4KA 4RDVA 4IFOA 3MJMA 3UXDA 1KXQA 3U7VA 5G2IA 4MWAD 4DWSC 1A49A 2J8FA 2WZIA 4DBSA 3IK2A 1JCNA 4M8UA 4PUEA 2HE5A 3G18A 1VBHA 1VIWA 2VTFA 4UR9A 4HHMA 3I3BA 3HJZA 1MZHA 3W2MA 4L9XA 1AVAA 4HZ6A 1E71M 4L6HA 4QDWA 1K77A 5LZLA 4NYYA 5EYWA 3R0DA 1RPKA 3RUBL 3SZ8A 4AZIA 3B8UA 3PVFA 1OGGA 1TYGA 3T44A 4LVDA 4S3FA 1XD1A 1UCWA 1LZOA 5AZ1A 4M7SA 3WJSA 4W7WA 1UWAA 5ABGA 2O9TA 4A22A 5GNXA 1XG4A 3SCTA 4AX6A 1RJQA 4OE7A 1EF2A 4O12A 3S2JA 1A3HA 3WD3A 3PPFA 3RLVA 4OV4A 3PWGA 3PNZA 3WLIA 2WZHA 2C1HA 3ITGA 2YLLA 3TQPA 2HWGA 1XC4A 3FSUA 4JYEA 4EANA 4ZZ9A 2A5HA 3KRSA 3CQHA 4A2RA 1XIIA 1V03A 3DUGA 3MBFA 4TV6A 1SMAA 1AD1A 3VXGA 2NXIA 3N9RA 1XYCA 3H2OA 2Y6ZA 3GXTA 5L6UA 3ZT6A 2J7HA 3A3XA 2H3BA 2A7NA 2QPSA 4LWWA 1NAL1 3BZGA 4U28A 3FS2A 4HCLA 1S1PA 1UD5A 3GIYA 3VCCA 1IXOA 1OFQA 4OGZA 2VWTA 3AMGA 3B0YA 5BMWA 1JCLA 1UWQA 3EYPA 2P8BA 2GVJA 3HGRA 2BXYA 4DYEA 5D2WA 3NYZA 4U3AA 1RAKA 4C6MA 5HANA 2YXXA 1NIUA 5JU6A 4Q8NA 3NM3A 2ZQ0A 5KZ6A 1UJPA 3L5LA 3TZNA 2ZXAA 1I60A 4K37A 4O4WA 1XICA 1DORA 1HGWA 3EWCA 4XIMA 3N29A 1PZ0A 4AY7A 1XLLA 2QF8A 1HJXA 3OGVA 3CHFA 3IARA 4M6UA 1K4GA 4W8LA 1H5YA 1TPVA 1FWNA 1KGUA 1FWBC 2QCEA 5FI8A 3LCFA 2ISWA 2DSWA 1H63A 3KTSA 1W1ZA 1W31A 3FJ4A 2EPKX 5REQB 3NQ6A 4BI6A 4CCZA 4LANA 3G1VA 1UWIA 3TJIA 1R85A 2BWGA 2PLKA 3Q37A 5D32A 1VGAA 4XIAA 1AW5A 1RD6A 5XINA 3MCMA 4LU0A 3GVWA 2VUNA 4HYRA 3TQKA 4DXXA 3G24A 2X0YA 4PB4A 1G4SA 3QTPA 1UR0A 1S5NA 1HVQA 4NZCA 1S5VA 1N82A 4WDUA 1PUDA 2UY3A 2Z29A 4LS2A 4XKYB 2PP1A 3HGJA 3K30A 3VC6A 1L6WA 5TIMA 4D2JA 5FESA 4XISA 1QXLA 4MZ8A 3UXIA 2ISFA 3B9AA 4N42A 2CBVA 3OO2A 2D22A 5HOSA 3VNDA 4RPQA 3W7MA 1JRBA 3LSCA 2BV9A 4R33A 4XZHA 1XRFA 3B9EA 1GNXA 1OEPA 1XLIA 2PTZA 2WJZA 1L2QA 1D8WA 3GAKA 4HU3A 4RNIA 1J0HA 1OD8A 3CZLA 4I5RA 3UW6A 4MNJA 5EU9A 1TZ7A 4ZGYA 4IISA 1EGMA 4GBUA 5D37A 3A3WA 4ZO8A 1AH3A 1PAMA 3MHGA 4NX0A 2GDVA 3T42A 4R9OA 1JL8A 3H2NA 2E9MA 3PZVA 4GUFA 1GHRA 4KW2A 3CV7A 5K4XA 4DUXA 3G1RA 3PUGA 1HKVA 2X0SA 4H6KA 3TDFA 3MDWA 4JTDA 4KCVA 2HVNA 3W4RA 2PS2A 4RW3A 2ATMA 2XH7A 1C92A 3VGEA 3N3MA 4UQDA 3BV4A 2NQHA 3GH7A 5C55A 1DIOA 2XZ9A 5FF2A 3A47A 3LPGA 2GDUA 3PTMA 4L1XA 4LF2A 3ONBA 5T26A 2J6VA 5DCBA 3UERA 1ZALA 1KRMA 3W53A 1VH7A 2JKEA 1UPPA 2V5JA 1JVNA 1EP2A 1NARA 4GXMA 3M0MA 2AOSA 3TTSA 3EA1A 4HZ8A 2PBGA 4WOZA 4K7VA 4WX2A 3NAVA 3XISA 4CN4A 3E0IA 2J75A 1R47A 1T5AA 2C13A 4AY8A 1CECA 1KCXA 3NXFA 4XG1A 5FF3A 5I02A 2VC7A 4NZFA 2UWFA 4ROQA 1XLBA 3KLLA 3MZNA 3BAXA 3N15A 3AALA 2W4XA 1KBLA 1CXEA 1I2QA 4S1FA 3ZWSA 1JFXA 5F2LA 3BLEA 2VQUA 3TYUA 1DEDA 1BTMA 4RE2A 3EAUA 3C2VA 4B15A 3W29A 1BQCA 1KWGA 4J3WA 4DO7A 1MW2A 1ZAJA 3B8WA 3CQJA 3M5XA 4PR4A 1PZ3A 3E3HA 2PGRA 1G0CA 5C9XA 2H90A 3O9NA 4HSHA 4TU1A 3S47A 1EP1A 3GG7A 2CLHA 1PIIA 3DBNA 1YTDA 2B81A 4CQ9A 5DF0A 2YCIX 1P6WA 3DGBA 3R58A 1EO5A 5ABHA 5GPRA 1V5XA 4JFVA 1FDYA 5AC4A 3ME3A 1CZ1A 2FZNA 3AROA 3Q65A 3CMGA 5CG7A 3WQOA 1M6JA 2ZTKA 5CEWA 4KCTA 4UFIA 3D0CA 4R85A 5CPLA 4IP5A 5F4SA 3W24A 4M0XA 3UFYA 1F3TA 1V8EA 1XQKA 3F5JA 3GAYA 1MUWA 1VJSA 2TPSA 2XIBA 4HIBA 4LSBA 1QI3A 1RR2A 1FXQA 5HR6A 2J9ZA 4FR1A 1H7RA 3ABRA 2PWEA 3UG8A 3G0SA 1J2WA 4OVXA 1UA7A 3GR4A 1GEHA 1EXPA 3KL0A 1FWCC 4E8GA 3AHZA 2CLEA 2Q8ZA 1XDMA 2PF0A 3UPWA 4OOUA 4UTUA 3FYYA 1FX6A 5CBIA 7XIMA 3VD7A 3NSNA 4PN2A 1BYAA 4AFYA 3M5ZA 1C7SA 2ZRWA 4ERAA 2JQXA 3RPDA 1XLMA 3QC0A 2E0PA 5C2XA 3QFWA 1WBJA 4H2HA 1LRNA 3IUHA 2VEPA 3XIMA 3L2MA 1K8YA 2QUUA 2PUZA 1D7FA 1FVPA 1HP4A 1Z6KA 3GS6A 4V1YA 5I00A 2XG9A 1JDCA 2J8TA 3IAPA 3TWBA 2YYTA 3LRLA 4Z0JA 4GUJA 2XWEA 4GJJA 1GOKA 2VDIA 5HWNA 2AMXA 4ZB2A 1RSCA 1MEIA 5IFTA 1W2PA 4GH3A 4MUPA 4E8DA 3EPOA 1OG0A 2FJUB 2TODA 2IKIA 1UD3A 1YYAA 4PFHA 2ZUSA 4F0SA 3H2AA 2HPIA 4ILSA 5EMLA 5T8GA 2J13A 4CD5A 2WANA 2QMJA 3GDMA 4A29A 4G7EB 1RJPA 4DM1A 4LS0A 2Q8XA 1J6OA 3ALGA 3UZZA 1R8LA 4ASTA 4CD8A 1OX4A 1BSIA 4CCCA 4PUKA 4O57A 1X1NA 1NP2A 4A3YA 4Q7IA 1T96A 4IIDA 2QW5A 1MXSA 5FJOA 1YEYA 3GIPA 5EA9A 2Q8LA 5A5WA 4Q7NA 4JTQA 1JCMP 2VCBA 2YIHA 4RNJA 4PZVA 2WWCA 4PMQA 4C6DA 1UP3A 1ZNNA 5HJXA 4POCA 1Z42A 2A3CA 3L0KA 5C9ZA 3GDLA 2KX9A 2XIJA 3UCQA 2V0TA 2DIJA 2VELA 1DJNA 1F6YA 4O1CA 1YXDA 1EA0A 4QEEA 2GGGA 2W91A 4MNKA 1MW3A 3O16A 3RU6A 3UG3A 4PCFA 1TV2A 4KQNA 4LAMA 3THDA 4GGHA 1RH9A 3R10A 2H9AB 5E6YA 4YTQA 2E8YA 1KB3A 4GYJA 3UA4A 3W7HA 3EPMA 4D1JA 1XPGA 3VINA 1VYSX 4PYSA 2ZUMA 4O14A 1EZWA 3UPMA 1R3RA 4EPKA 4QJ4B 5CZ0A 1WB0A 4JHMA 3PPCA 3NR0A 5CPTA 2OGYA 3VYLA 5C54A 1HL9A 3W1TA 5GVJA 4JTHA 5CXPA 3CUZA 2P76A 4NJKA 3VIMA 2BY2A 3IJ8A 4LB4A 4HHPA 2OWCA 2CYGA 4H19A 3SJNA 4K8GA 1MMFA 3H70A 4QJ3B 3N04A 2OX1A 2OB3A 1DWGM 4LF1A 2SFPA 3E02A 4B5SA 2FPTA 3WEZA 3VOIA 4AH7A 4HPNA 1JJKA 2GK1B 1JPMA 4K8EA 2PD5A 4JGDA 5T9BG 2WKJA 4HK6A 3HQ1A 1IT0A 3H4XA 1A3WA 1QJWA 4LYQA 4IGHA 3BAYA 4LAKA 5ECUA 3FA3A 1KRBC 4HNNA 3QPEA 1JEZA 1GYLA 3CH9A 2WZEA 4WJ8A 4DUVA 3CH0A 5D4YA 4QHRA 4XSLA 1WA3A 2VX4A 4QQUA 4FX8A 5C0QA 3UWQA 4Q6JA 3V0TA 5A69A 1JZ4A 3ANUA 1LUCA 3OZMA 2OMAA 2BOEX 5KINA 3EXSA 5B7ZA 1V02E 3UZWA 3FJNA 5CJNA 3FAXA 4XO6A 3STCA 3YPIA 2FH8A 4US5D 2QPUA 1WP6A 2HMCA 3P8JA 1JNDA 3P2VA 3ITOA 4BS0A 1XDLA 3G8RA 4XAPA 3M0IA 5IM51 3DHDA 2KZHA 4IQEA 1UYQA 1PBGA 3R2GA 1E73M 1S3TC 4CVWA 3VABA 3BOLA 4FF5A 1FWDC 2WHMA 3O7UA 1ME7A 4B3LA 4OECA 4D6HA 2CESA 2QT3A 2V38A 1KV5A 3S5SA 4IXHA 3WK1A 2X30A 4FI4A 3FNDA 2GJNA 4Z17A 5HQLA 1L9WA 5H8PA 1EHAA 1JCXA 1TMLA 4ZB0A 3ZVHA 3WJWA 2REQA 1U1JA 1AQHA 3A21A 1VCFA 3N3TA 2X09A 3GH4A 3NQBA 1F74A 1XP3A 1X7FA 1PKNA 5G5IA 1G69A 3VD3A 3NNTA 3G0UA 1VBRA 2CZFA 3LSBA 3EOUA 2VC5A 1YNYA 5JMUA 3S1GA 3HQPA 1DL3A 4RXFA 2XIIA 3K4WA 4GYKA 1E6SM 3NL2A 2BGNE 4JIIX 4M81A 3KRZA 4C6QA 2X42A 4C6NA 2YFOA 3I4KA 2NX1A 3W37A 2O7SA 3TYEA 3EDKA 4FR6A 1UIOA 2WCAA 4AIUA 1GK8A 4M1RA 3BJSA 3P81A 5MF5A 1HJVA 3CT2A 4QM1A 2TSYA 4N2YA 1QAPA 2VYOA 2IMRA 4FX7A 3SBFA 3EWUA 4BEUA 5A6BA 4QGCA 1E0XA 4EIVA 3WH7A 3EPNA 3L0NA 4RX0A 2WNQA 1DJGA 3EWWA 4M82A 1MZRA 1PJ9A 4KWVA 3FK4A 2PE4A 3LHWA 3APTA 1O7AA 1CENA 4FOKA 4W85A 2J7EA 5I07A 4R27A 3EWDA 3M46A 1ZCCA 3OLDA 4AYSA 1TA3A 5KZMA 4GMEA 4LCQA 3V7PA 3CAQA 1W1VA 3PWAA 2F61A 4FEZA 2VEMA 3WLTA 1DWIM 2OZ8A 4U3CA 1VPQA 4W4QA 2IXVA 1X96A 4AY1A 3HPFA 1UD4A 2NXHA 4IJBA 4QTGA 2DZXA 4EKJA 4TVDA 1TJ1A 4EXQA 3A64A 1SPQA 3W70A 1NQ6A 2HBVA 4PUWA 2QCDB 1PTDA 4TV5A 2QJGA 1TSIA 4GKLA 5LNRA 1HT6A 5DANA 4C1NB 3LCHA 2P10A 3WQ6A 3SECA 2GLKA 5AFDA 1WNOA 2Q3OA 3SUUA 2DSKA 3KP0A 4LVAA 1F9CA 2Q01A 3ANVA 4P8XA 1U5JA 4X0NA 2FTPA 1S1RA 1VFFA 4OWGA 3VNMA 1R3YA 3B9NA 3CMFA 1MFUA 3WZ0E 3NZ1A 3KFTA 1EX1A 4DBWA 3J7HA 1MVYA 3SO7A 1QO5A 2FFCA 3KEHA 1SVDA 3CUHA 3WQCA 3LQLA 3CHEA 4GCAA 1FCVA 2ZRZA 1QO2A 4ZOCA 3N6QA 4QS5A 3HA1A 4IMGA 1R3SA 4YL2A 3RX3A 4F79A 5C8BB 1EEXA 2J7CA 4PH6A 3ORWA 3DX5A 1GZJA 2R1PA 4XAYA 4HTYA 3SRDA 3PUDA 1UG6A 3T4CA 3B8SA 2WBGA 1KCLA 3PFMA 3ARPA 2FHBA 2QDDA 2VUYA 1Z41A 2BY0A 1S39A 1SMDA 1Y5XA 1ZY9A 2C15A 4UFMA 3M0LA 3UESA 1EDTA 3OTRA 1R0MA 2POZA 1A80A 1PYMA 3HU7A 5TBOA 4HYVA 1GTHA 2CITA 4GD0A 1Y65A 4W9TA 4E4PA 1MEHA 3ES8A 2QCDA 3GC4A 2P1FA 5A8NA 3CEUA 4OUEA 1X7IA 1DOSA 4C1NA 4DJEC 1ITUA 3AMLA 1LQAA 1TQXA 4LCSA 4IQJA 2HEJA 3WFZA 2YPIA 1XIJA 4NASA 4LYRA 4LXFA 1FFRA 3QLDA 1YDOA 5A2CA 1VRXA 1KXTA 2VEKA 3KBNA 5HDRA 4RE3A 3FGCB 1UB3A 2ZYFA 3CBWA 4GNKB 1XPYA 2E6AA 4I3GA 3MUXA 3AU2A 4C90A 3PZ9A 3NURA 1EIXA 3PZTA 1W17A 2GL5A 1V6WA 1IZKA 2FYMA 1XLEA 2QHAA 4GX9A 5M03A 3M9YA 1LLWA 1UH2A 3WQPA 3BVJA 4R7OA 1R46A 1WZKA 2XN0A 2RDUA 5E93A 1CBGA 3AWOA 4F2BA 3LHUA 3MUIA 3EWZA 5I23A 2ZWZA 1J0JA 5I6SA 2INEA 5EBAA 4GOAA 4QE4A 2RAGA 2J24A 5KTLA 4HU4A 5AYXA 1SZNA 1WYIA 3M0KA 3PUOA 1GPFA 1JAEA 2IUZA 3AUOA 1PZ2A 1H3GA 1VP5A 5FJUA 3VMOA 3R12A 3W2KA 4LC6A 4PBGA 1DXEA 1V6TA 4GBDA 1NVMA 2HJPA 1XI3A 3AI0A 3BZJA 1W56A 4CNPA 1QPKA 1DP0A 4V15A 1WXJA 1WUEA 2VEGA 3VNZA 1H60A 3BJFA 4ERIA 3H2MA 2PP3A 2ZADA 3W2NA 4FF7A 1HGYA 1YXCA 3P60A 3PWIA 3SM0A 1JPHA 4PL2A 2V5DA 3TH6A 5F4WA 3AXIA 3JRKA 3WL0A 3UYCA 2VZTA 3MA8A 2CLKA 1KGWA 3WFLA 3GIQA 1QHZA 3V5FA 3SIZA 1K8ZA 1R6WA 2CHNA 3PN8A 4O53A 2VDGA 4F9DA 4A4AA 3N2CA 4ZL1A 2PGWA 3N1AA 1AJ2A 4P2VA 3SQMA 4HK7A 2DP3A 1Q6QA 4BR1A 4JKLA 4I9JA 5EMMA 4UR8A 1OCNA 4LALA 1HO1A 1BD0A 4Q8PA 1ESWA 3II1A 1AL8A 2BOFX 4UTWA 3VX1A 2PDQA 4C6PA 3LTSA 4PB3A 1HNYA 1HVXA 2X1IA 4GZ7A 5DCEA 2PLCA 3PTQA 2PWFA 3HM7A 3VD9A 4FNTA 4K39A 3KZSA 1UP0A 4ONVA 3DHFA 2I5QA 4DELA 2JEPA 3I7SA 3M5YA 3IK4A 3A3HA 1DJWA 4NVTA 1B57A 4QFUA 2RJHA 2DZBA 3WF1A 1PX3A 4KERA 3UEQA 4PRWA 5K3VA 3U2EA 4J27A 4XAGA 2WJDA 4MF4A 4UNIA 3MTWA 2PDFA 4MGGA 1X38A 4YCPA 3BGJA 1XLKA 3MT1A 1NF0A 2X0HA 4YJ5A 2JF6A 1SW0A 4L1WA 3EMZA 3MUY1 1DJQA 1FWTA 1DQXA 2XISA 7A3HA 5MKGB 2A21A 3CT7A 4PMRA 7ODCA 1H7OA 1HN1A 5K4ZA 2ANUA 4JCLA 4UQAA 2JIEA 5DRIA 4LTSA 4HT3A 3L4VA 2DFAA 8A3HA 2EHHA 3CWNA 2DQWA 5H2ZA 4ZE5A 3WMBA 3L23A 4AD4A 5D03A 1O5RA 2J79A 3TYBA 1A4LA 1AK5A 4KEVA 2HBXA 1EQCA 1SO6A 3UGRA 3QGKC 4G9PA 3W1NA 3ATYA 3H55A 4I7WA 3WL1A 4LY4A 3PZOA 4A3HA 4NAFB 2OTDA 1KA9F 2FGZA 3ONCA 2Y5JA 2R1NA 3SR7A 1VPXA 1OSEA 1LLZA 1TMQA 1TRIA 4B3KA 5TF0A 3BPWA 3ZVIA 4RLIA 2P88A 4UB9A 3NTYA 1EDGA 1A5BA 4F2UA 2OLAA 1HIZA 3BAWA 4W5UA 4ZE4A 2OODA 4IH3A 1EEPA 4GO9A 3KW3A 2WNNA 2C18A 4MM1A 4I90A 3ICJA 5G4EA 4U33A 1CGWA 3OZOA 2XGIA 3EA2A 2VENA 1EC8A 2FIQA 2RGLA 2OSWA 4Q4SA 3WBWA 3SGUA 2YFNA 1DTUA 3U3HA 4DF1A 4DZ5A 1QBAA 2HTMA 4NHVA 1DPMA 1S5WA 1I8JA 3EEZA 5A6TC 2X7WA 4IG2A 3TEVA 3GNRA 3SUSA 5FCZA 2PWGA 5HXMA 1POKA 2BNJA 2D2HA 3AHTA 1K9TA 2F7FA 1AZ2A 5FJRA 1OIMA 5MKGA 3M64A 4GQ0A 5D9PA 2CLLA 3D46A 3RF9A 2WVVA 1JAKA 4WRHA 4EF8A 1SZFA 2MUCA 1PKYA 1BVNP 5IRPA 1Q6LA 1XH0A 5FAJA 1Z9AA 5DFAA 4KGLA 3GVGA 2G95A 4GH1A 2FMNA 1XSKA 5BRBA 4FNUA 3HOJA 3TQ0A 5D2VA 2GJXB 4HNLA 2FHFA 1SR0A 3Q4DA 4L6DA 1JQVA 1UC4A 2Z1BA 4GA8A 2QJJA 1MXDA 1XDJA 4N6FA 2VFEA 4O15A 1QR7A 3A9BA 1OC5A 4AWEA 4NAFA 5CC6A 1KV8A 3WSUA 2HDJA 3L66A 1K7FA 1XFBA 3AYSA 1GW9A 1OYCA 4RCXA 1FCUA 4B5NA 1V4YA 4IZGA 5EFFA 4MMWA 2J78A 5AVHA 1CGTA 3CL7A 3KCOA 4CNSA 2G3JA 1JZ6A 4DO6A 4HA3A 3EXRA 3TONA 5AY7A 1LCOA 4Q32A 2B0MA 3FVMA 3OODA 1MXGA 1A4MA 4AQLA 2YXOA 3ARVA 3UWUA 5CC5A 2WCSA 4LBUA 3D3FA 1GEQA 4YYFA 3EOEA 3LRMA 1YBQB