5K9CA

Crystal structure of human dihydroorotate dehydrogenase with ml390
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
362
structure length
354
Chain Sequence
ERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Development of ML390: A Human DHODH Inhibitor That Induces Differentiation in Acute Myeloid Leukemia.
pubmed doi rcsb
source organism Homo sapiens
total genus 139
structure length 354
sequence length 362
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2016-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5k9cA00
4Q32A 3O6DA 1U83A 4HN4A 4UFHA 2BSLA 3KOFA 3LXAA 3T78A 1ZJIA 3F4WA 5LGZA 2Q3RA 4OV9A 4FHAA 4XZ9A 4UTJA 3NQ8A 4JS3A 4TX9A 3SI9A 3W83A 3BLIA 5K9DA 3THAA 3P67A 1YPFA 5D33A 1IXPA 4NJHA 3ABOA 1TJPA 2E6DA 1EA0A 3EWUA 4Q4KA 3IVTA 3NM1A 3GB6A 3BV4A 2OJPA 3W88A 1KFCA 3C2FA 4ORIA 3TSMA 3DXIA 5DELA 4LS0A 1LTDA 1LRTA 4JY8A 3M9YA 4LRSA 3GIYA 3NQGA 4JXCA 3QRHA 3LM7A 1P5BA 2EF9A 1FDYA 3G8EA 1F7BA 3LRMA 3SW6A 3PAJA 4MZYA 3G18A 1GEQA 1TTIA 3TMQA 2V2CA 1OFDA 3A5FA 3NQVA 3NL3A 1O5XA 2X1SA 4C1KA 1NEYA 1ZAIA 3W71A 2X16A 2ZBTA 4UNLA 1NVMA 4LWWA 4LU0A 5H2ZA 3NO5A 1QNVA 3C2OA 1IXNA 1R2RA 2KZHA 4H3DA 4OBTA 2WJZA 1H7NA 5U4NA 4O50A 3LTSA 4I7UA 3CM4A 2TMDA 5CG7A 4EIVA 3PS7A 3C0JA 3C56A 3B4UA 3IVSA 5CZTA 2DZUA 1WOAA 3NR0A 4UFKA 4UTUA 3P62A 3TXZA 5EY5A 4BK9A 1JUBA 3CPRA 3CU2A 3UWWA 3JR2A 4HT3A 1F2JA 2YX0A 1QPNA 1DJNA 1K03A 4EF9A 1OFBA 4JX5A 3V1PA 2Y70A 1HG3A 4A22A 2VFDA 2PRLA 1FWWA 2YXGA 3M0ZA 4OWGA 5BMWA 4AB4A 2GJLA 3O05A 1I8JA 1GQNA 1P0NA 3UPWA 1LP6A 2A1YA 2YFNA 1TTQA 3LI0A 1MEWA 2R91A 4R34A 5G4WA 1CW2A 2JGQA 2Q8LA 1TTPA 3LHWA 3HOJA 1NSJA 2A85A 5C55A 3TV8A 3LOTA 3O15A 4HSOA 3FA5A 4AWSA 1TPB1 2XN0A 2BX7A 3KRSA 3O1NA 3WK3A 1A5BA 1TCDA 1WV2A 2B7QA 1I2RA 4LS2A 2PURA 4O1BA 2A2IA 3DFPA 4YLWA 3CWNA 3U2OA 2WSQA 5G1YA 4JDYA 3DENA 3NDOA 1OF8A 2B7PA 1SSDA 3QPZA 1L2UA 3BO9A 4P2VA 3U6WA 2Y7EA 2H8XA 3W7JA 1QO2A 3TSBA 3WFAA 1MO0A 2H3DA 3PWAA 1K7FA 2XFWA 2E6AA 1ZHAA 1UB3A 3GVGA 3W2JA 2ZA1A 1GTEA 3EKLA 3G3DA 2YZRA 2AGKA 6TIMA 3PUDA 5CSRA 3IRDA 1Y0EA 5F2LA 5KZDA 1QOPA 3NAVA 4M6PA 2P1FA 4O13A 3P7YA 5HQEA 4CQAA 3M41A 3S5OA 1B57A 4CNPA 3NM3A 2D73A 1XFBA 5AHLA 2C14A 2YDAA 2FB2A 5EYWA 2C0AA 2AAMA 3F4NA 3MHGA 3O63A 3STEA 4QQ3A 1F76A 1MXSA 1IIHA 3TNOA 2NWRA 1WDWA 1JQVA 5G1TA 4HNVA 3A22A 3W7CA 4OGZA 2DZWA 3EB2A 3UPBA 2CZEA 4AEOA 1LBFA 3ABQA 4LVGA 3DKJA 4DPPA 3M43A 3USBA 1X1OA 3UXDA 2NLIA 3BW2A 3IGSA 4DF2A 2RH9A 3RLVA 1OX4A 2EPHA 4JYDA 5AC6A 3G0XA 3W2KA 2ZZ1A 4MYAA 4XKYA 1PHWA 3CC1A 1AL8A 1M7PA 4O11A 2ZRXA 3W73A 4WQ6A 5DLCA 1K8ZA 1SZNA 1QAPA 4XBSA 1XBXA 1WOBA 3G0UA 3QZEA 4NU7A 1FBAA 1LOQA 1JRCA 3QEZA 4O15A 1HUVA 4JGDA 3UY7A 4IXXA 4IMGA 5AHNA 4X9SA 2DP3A 4O1CA 5AN7A 3I7SA 2LLEA 2ZRWA 3I6RA 1P0KA 4N4PA 4O1AA 2A7PA 4RK8A 2OMAA 1LDCA 4HNNA 2BXVA 1X6UA 3PR2A 1VRDA 2NZLA 2CLMA 4JNMA 1KW1A 5FF3A 3W7HA 4MFEA 3WJXA 4OHQA 1KFJA 1FDJA 3PBWA 3IIOA 4Z1BA 4MY1A 1VQTA 1QR7A 3HMJG 3QSTA 1QMLA 1OYBA 3MYOA 4LRTA 2A6NA 2DZSA 4ZL1A 4AVFA 2WQPA 2YYUA 4NZJA 2RDUA 3HG3A 5D2YA 3NG3A 3S1UA 3MBFA 3S5ZA 4Y96A 4LTSA 3QMTA 4JEQA 4K7YA 4I7VA 3O16A 3S0CA 3W1NA 1O5KA 3IEBA 4O57A 3HGSA 2VEKA 3OA3A 4FNTA 3QSRA 1LLWA 4S2BA 4ZZ9A 3I68A 5KZMA 1XBZA 1JCMP 3LB0A 3I65A 1JJKA 4WY0F 1KM6A 5K9XA 1TPC1 1W3IA 3E96A 4QISA 2Y6ZA 3LHVA 2G96A 5FF4A 3L0NA 3LV5A 3PVFA 3DHFA 4JTFA 4OT7A 4MUZA 1DBTA 1DQXA 1Q6LA 3DGRA 5T26A 3NL6A 1ICQA 1OFPA 3UWQA 2YFOA 1H7WA 4JTHA 4YCPA 3BVJA 2J6XA 2HSAA 4POCA 2QCHA 2QJIA 4DELA 3KX6A 4O28A 1KM2A 4DBEA 4EF8A 1ALDA 2DZPA 4GUJA 3DFQA 1D3HA 1JCLA 3PB2A 4JD4A 3HIJA 4GFSA 4XUGA 1H7OA 4XTDA 3LTPA 2YSWA 5DY3A 3IGUA 2JKAA 3W2MA 3O8AA 3B0PA 3DFSA 2ZRVA 2C6QA 4O19A 1BWLA 4AMAA 5LZLA 2V5BA 2Z1BA 3PSWA 4UFLA 2WNZA 1OX6A 2VELA 1RQEA 4LVDA 4ADUA 2C1HA 3STGA 3G1HA 3NQCA 2E77A 4GUIA 3TMLA 1RR2A 4KFOA 2JGYA 1C8VA 1S5TA 3W84A 4NVTA 3W1AA 1R30A 4BWLA 4UFIA 4KKXA 3NQEA 2ISSA 2WPBA 5CZ0A 4Z1CA 5J5DA 2NXHA 2B0MA 1X1ZA 3P81A 1G4TA 4E2BA 5HULA 4XTIA 2J9ZA 4LVFA 3LHUA 4AH7A 2Q8ZA 3M5VA 5D02A 1LBMA 2CZFA 3TC7A 1W5MA 3GAYA 3THQA 5KTLA 2W0UA 2CLHA 4ZQMA 1DV7A 3VNDA 3PM6A 3MUXA 1KV8A 1FXQA 5HWMA 1EUNA 1C9DA 1PE1A 2RDWA 3NXFA 2ALDA 2W6RA 1NF0A 1X8FA 3W1TA 4IMFA 2GVLA 1GG0A 1OJXA 4GUGA 1K8XA 2OT0A 3P8JA 2DJLA 3OG3A 4RZ5A 1TPH1 4UMCA 2ZA2A 1KV5A 4JTTA 4LVAA 3MYPA 1RZMA 5LNVA 3GKAA 4FX8A 3LCWA 2V30A 3F03K 1H63A 5C5YA 3OVQA 3NL2A 5D2XA 2QKFA 1HL2A 3KRUA 1B4EA 3L0KA 2NV2A 2NX9A 1OFRA 2CLIA 3P84A 2TPSA 2NUWA 3W7EA 1H62A 5KITA 3N73A 5LHFA 4K6AA 1L9WA 4MY8A 3FJ6A 5FEXA 3S8HA 4M5PA 3UWVA 2WV8A 4NZFA 3UWZA 2FTPA 4UMBA 1T96A 5FF2A 1ZAHA 2DJXA 4JIQA 4JTEA 1JUKA 2GUUA 4MZ1A 4IJBA 4UIOA 4FNPA 1OG0A 2A7NA 3UD6A 2ZZ6A 4NQ1A 1NAL1 4FXRA 3S1XA 4IPJA 1LM1A 4NXKA 3VFLA 1F74A 2W79A 1PV8A 2J9XA 5CZSA 1SPQA 1E51A 1R47A 2E09A 1DVJA 3SR7A 4IGHA 5FF7A 4E0CA 4A29A 2GQAA 2ZRZA 2VEMA 3CQ0A 4GRSA 3N2XA 3LCHA 3L5LA 3GNDA 4TO8A 4PODA 1I2NA 3W1RA 2YR1A 3W1UA 4JIPA 4FXSA 4XWUA 1FQ0A 2DORA 2FPTA 4K38A 5K9CA 1W8SA 3KVKA 4HIBA 3U8GA 3IIZA 1PL9A 1KA9F 3WK2A 2E6YA 1DL3A 4RV8A 1YDNA 3NZRA 1TPVA 1G67A 3CT7A 2E5CA 3GXNA 2H6RA 2P10A 5HR7A 1J2WA 4NJKA 5LNWA 3W86A 2VFHA 3R5EA 5K7JA 4BF9A 4UMAA 2NUXA 2H90A 4ZQCA 3HGJA 4N02A 1SFJA 2CZDA 2ZCGA 3BK0A 3Q58A 1ICSA 1PIIA 1R2SA 2Y7FA 3W2NA 3E02A 3A24A 5C6MA 4XQ6A 5A5WA 3D0CA 5F2GA 4MLRA 3W7NA 3LTYA 4N9EA 3M16A 2J27A 4O17A 3STFA 3PUOA 4NT0A 2FLIA 4FIQA 4QAIA 1O95A 4O0KA 3GDTA 3TFCA 3UQNA 4QJ1A 1K8YA 1AW5A 3M44A 3W1MA 4ZQNA 3T7VA 1Z41A 2HS6A 4LVBA 1H7XA 1YXDA 3DHDA 2EAWA 1CX9A 3W2UA 1VYPX 1KTBA 1QDSA 3NPUA 3T55A 2VENA 5I3KA 5HJLA 4FNSA 3W76A 3MI3A 1YPIA 3QFEA 2C18A 2NUYA 3HGRA 3EWZA 2WO5A 4LW7A 5KINA 4MIMA 3CB8A 1LBLA 3EX2A 2WSRA 4UTKA 3A21A 4UTWC 1KFBA 1T99A 3E0IA 3WJWA 3KHJA 4N6EA 1VZWA 4RXGA 2VC6A 2V9DA 1LRQA 1SQ7A 1XL9A 2VFFA 5D2WA 4K7VA 3NQ2A 1QPOA 2FPYA 3BG5A 5BOOA 2OZ0A 3W7OA 2QCDB 1SZEA 4W9TA 1WBJA 2OX1A 4FEZA 1OK6A 1Q6OA 3P60A 1GT8A 4DPQA 3OEXA 1JCXA 2BZNA 1U5JA 2WOQA 3S1VA 4LS1A 3LCIA 3W7LA 1G4EA 4O16A 1XDMA 1YXYA 4FNUA 2QJGA 1AG1O 3ATZA 3E49A 3TW7A 3W22A 4IX0A 3DBPA 4GNJA 3GR7A 5F1UA 1SW3A 3MWAA 1QPQA 2A6LA 3OVRA 1T0OA 5FI8A 5ABTA 2J9YA 4IPIA 4FO4A 4ZVJA 1JR1A 1JQXA 5EMUA 3L0GA 3TAKA 1UCWA 2NX1A 3ELFA 5D32A 3P5ZA 2C19A 4CNOA 2YCEA 3UWYA 4KFPA 2ZZ5A 5DCDA 1H5YA 1KFEA 2Y63A 5I3HA 3IIPA 3UWUA 4FIRA 3TE9A 1W5NA 1JCYA 4RJEA 4M6VA 4N9DA 5FEWA 1VH7A 1GYNA 4HNUA 4O54A 4MOZA 3W87A 3R13A 1W3TA 2X1UA 4PTNA 4BWLC 3EWXA 2I1OA 4GUHA 3TIMA 3O07A 3LERA 4MLJA 2PC4A 1EX5A 3FFSA 4UTIA 1F5ZA 1OX5A 3FKRA 5HR6A 2PRHA 1XBYA 4WY0A 2ZZ2A 4K39A 4MYXA 1KBIA 3NOEA 4JTGA 5J5RA 4MKNA 3L66A 4AF0B 4M7TA 1KTCA 4B5NA 1SFLA 2FIQA 1O60A 3R2GA 4JYFA 2CFFA 4KWVA 5C2XA 1ICPA 4UTLA 2JBMA 1JVNA 3QQ0A 1G6CA 1W5QA 3N19B 3V75A 4RZ4A 4ADTA 3LBMA 1VGAA 3TKFA 3RFAA 2BTMA 4CNNA 3GXTA 1TPEA 5KMYA 3W3OA 4TIMA 5A8GA 3W7IA 3B8DA 3M5YA 2VFGA 4GBUA 4S2CA 5TQLA 3TROA 3VKJA 5SWUA 3EWWA 3PF3A 4LV9A 1SSGA 5BNKA 1WA3A 1W37A 1M7OA 4AAJA 1OABA 2WNNA 3C8FA 1SO3A 3HBLA 5BMXA 4UXDA 4RXFA 2V0TA 1ZFJA 3EX6A 2P0OA 3W7RA 1OHLA 2VEIA 3GAKA 2AQWA 5AYXA 2NWSA 2O7QA 3C2RA 5DXXA 3LRKA 4ALDA 1F6PA 3M6YA 2RDTA 1GVRA 4E2DA 1DHPA 4BI5A 2ZQ0A 5G5IA 5IBXA 2HMCA 1YTDA 1YLVA 2QUUA 4FX6M 3NPWA 3FOKA 1DQWA 3HQ1A 3B03A 5FESA 1AW2A 2Y85A 4JTUA 5U7SA 1EPXA 3FEMA 3W23A 1DORA 1B3OA 4O14A 2GQ8A 1F73A 3LRLA 3TA6A 4JTJA 2OT1A 3R12A 5LNSA 2C16A 4GXMA 4U28A 1MSSA 1TSIA 1OYAA 2ABBA 2B4GA 3HPZA 3EX3A 1MEHA 3C3NA 3O6YX 3QF0A 2NX3A 3TCEA 1SW0A 3TQ0A 3GZ3A 3M7WA 1B4KA 4R33A 3W1LA 1PVNA 3L5MA 3P8IA 3DFNA 3PC0A 1FCUA 1JCJA 3PUEA 3GDLA 2B7NA 4XBKA 3PSVA 2VXNA 3TQVA 3FJLA 2QCMA 5G4EA 3EX1A 3W7PA 4R53A 3SFKA 2Y7DA 3N9RA 1I2PA 2E5BA 4IOTA 3C4UA 1H60A 3T4CA 3MP3A 3TU9A 1SU5A 4UTWA 3B06A 1D9EA 3MMTA 3TK7A 4WXYA 3W6YA 4ZQRA 2Y7GA 3SIZA 1FWSA 1GVOA 1OK4A 3G3MA 5HWNA 4L4MA 3CIWA 3SGZA 1LCOA 3C2EA 3HG5A 3KXQA 1VHNA 1N55A 1SR9A 1OFQA 3PBUA 3OIXA 4DO5A 4Y9AA 4MJMA 4O18A 3L21A 5D38A 4AHOA 3GR8A 4FB7A 1IXOA 1QFEA 4N9BA 4PH6A 3LXBA 2WKJA 2G95A 2RFGA 2X1TA 4CCDA 3SY5A 4OV4A 2WNQA 3VE9A 2EHHA 3DAQA 3FYOA 1EWDA 4NUWA 1LLZA 3W70A 4O12A 4I7WA 1LZOA 4I9AA 1L6WA 3GDKA 4EVZA 3CEUA 3I7QA 3ZS4A 1TTJA 2ZZ7A 3RNDA 3LHZA 4IXHA 2EGZA 4A3UA 4H4IA 1SZGA 1Z44A 1FXPA 3P80A 5LNRA 3NZ1A 1V5XA 3LCGA 3G8RA 5D04C 1RD5A 3TSDA 4QNWA 2FJKA 4NJGA 1PCWA 1XKYA 1TPFA 3S5NA 2TSYA 4GUFA 1RPXA 1PHQA 1VCVA 2X2GA 3DZ1A 2ZTJA 2ATMA 4WZHA 3NGJA 4YCOA 4K37A 3IIVA 4LY8A 1A50A 4FNRA 1EP2A 1J4EA 5BW6A 2ATSA 4Z1AA 1N8FA 4NJIA 3KVLA 4ZMGA 4HNTA 3NNTA 1ME7A 1QWGA 4WOQA 1ZNNA 3W7KA 2ISWA 1LOLA 4A2SA 1GJPA 3HPSA 3QJAA 3QMSA 1XC4A 3P61A 1TO3A 4IWWA 1A5AA 1GVQA 3TC6A 1GPWA 1AMKA 1XUUA 1GTHA 5G2HA 1RQHA 1ME8A 4GE8A 2ZZ4A 3G1FA 1H1ZA 3B0VC 1O4UA 4BI7A 5I3FA 4C1LA 4PFMA 4YXGA 4TU1A 4RCXA 1VC4A 1ZCOA 2QCNA 3HF3A 2OCZA 4MVAA 3AO0A 1S5VA 4N4QA 5I3IA 3LI1A 4OQVA 2A21A 4AHQA 2Q3OA 3W2LA 4PL1A 1AK5A 4UFJA 3F1QA 1ME9A 1FY6A 3MHUA 1Q45A 2C15A 2J24A 2QF7A 4TMBA 1H1YA 1OX4B 1KM1A 1VLIA 1TREA 4DXVA 4WOZA 2E6FA 2V82A 3B0UX 3MI2A 1I4NA 3N9SA 1XDLA 2FPVA 4LC6A 5DN1A 1TIMA 2FDSA 2IQTA 1TQXA 5K2ZA 1G4SA 3EKZA 3G1YA 4MJZA 3N34A 2VOMA 5HINA 3RK8A 4K8EA 4FX7A 3NVTA 2YW4A 1QPRA 3GXPA 5KSWA 4UUIA 2VFIA 4P61A 4QITA 1IIGA 1XUZA 2FB3A 1UUOA 3NL5A 1FCVA 2Y61A 2YGYA 5DY2A 3N14A 1SO5A 1VHCA 3SZ8A 1VJIA 2CLFA 2TRSA 5DBTA 3ANYA 2QJHA 3QH2A 1HO1A 1TJRA 3STCA 1A53A 6ALDA 1S3HA 5D37A 4JTIA 1ONRA 1Q3NA 4YWIA 4LUJA 4M19A 3ZR4A 2H3BA 3PULA 4G1KA 3W7QA 1G69A 3QQ1A 3TJXA 1PS9A 1G7VA 1EIXA 3T40A 3KVJA 3WK0A 4X2RA 3LXCA 5D2VA 4K36A 4HHPA 4DQWA 4WXZA 1Z42A 4UC5A 4JTLA 3UZJA 1FWTA 1S5WA 1UUMA 1C29A 4DO6A 1IXQA 4CCEA 2QCLA 3G22A 1J5TA 3MJYA 2QEZA 5AB3A 1VPXA 3NA8A 2X1RA 3PB0A 1FCQA 3SGUA 4RX0A 3R8RA 2Y62A 1TV5A 3ZWSA 1W56A 4QIUA 4UR7A 2HTMA 3R89A 5E1QA 1YTEA 1FUYA 1O94A 2QAFA 5IBXC 3SECA 3B05A 3P5YA 4QNEA 1NF7A 5TIMA 1MZHA 3UY8A 5I3GA 4UTTC 2DZTA 5L9FA 3S42A 4O8RA 1KM4A 2ZFAA 2X30A 4RLIA 3FS2A 4A2RA 2ZTKA 2G5WA 2V8ZA 4IQLA 4E38A 1B9BA 4O4WA 5F2IA 3EWYA 2ZRYA 1GG1A 2NV1A 2YW3A 4MFDA 5AFDA 2E1DA 3LX9A 1WQ5A 1H7PA 3LHYA 1W5PA 5K4XA 3DH7A 3BW3A 3ATYA 1N7KA 2JKPA 1H50A 2BLEA 4KWWA 3QM3A 3E12A 4X22A 1RV8A 4LT9A 1V7YA 4AXKA 3PY2A 3CLMA 1DOSA 1Z48A 5HNRA 3TDFA 1UBSA 3PG9A 2I14A 5F2MA 4N9CA 1VS1A 3P82A 5CSSA 5CPMA 3W74A 1R46A 3TR2A 5LKYA 3AJXA 1W31A 4U4MA 5K4ZA 4UFMA 1XCFA 3S9YA 1P4CA 2ZZ3A 1Q6RA 3EXRA 4UCGA 2QDHA 3E9AA 1HFBA 2GQ9A 2XN2A 4JDBA 5LGXA 4NXSA 3W7MA 2QR6A 3NPXA 5E93A 3G1XA 1H51A 5G2WA 4J9JA 3L68A 5F1VA 3FKKA 4JX6A 5D05A 4WJEA 4RZ6A 3FYPA 1G4PA 5CPNA 2H8ZA 1EEPA 2DZVA 4LC8A 4O1DA 4FF7A 4RR4A 4CQ9A 3BLEA 2E5DA 1OF6A 3TUUA 2GVJA 2F84A 1DKWA 4DBDA 3WJSA 3CTLA 3H53A 4QSHA 5FEPA 4JTKA 4Q33A 5E0KA 1A5CA 5AYZA 1TYGA 3UYCA 5D09A 4PC8A 4JN6A 3BW4A 3C6CA 3G24A 3H54A 3S1WA 2ABAA 2DU2A 4GC4A 1K7XA 3NQMA 3M1ZA 4NNCA 3W1XA 2G97A 3TFXA 5KZEA 3MHFA 3L65A 2BWGA 4GWEA 1JCNA 1JRBA 3H55A 1LYXA 3C61A 2J88A 4TMCA 2FQIA 5CZJA 3K30A 1TRDA 2HS8A 3B04A 7TIMA 1UASA 4DF1A 3GDMA 4LV4A 1SUXA 3PBYA 1BKSA 3MI6A 4O53A 1YDVA 3YPIA 5HUPA 2CWNA 3NYZA 5AOUA 1KM5A 3L2IA 1TPUA 2VKZG 1EB3A 3KAOA 4PA8A 1BTMA 4X3ZA 1CI1A 5K3VA 1YADA 3GYEA 5FF0A 4UTHA 1FWNA 3SSJA 2DZXA 3CIXA 2QUVA 2VEPA 5HWJA 3ZWTA 3DU0A 5LNUA 1YYAA 1EP3A 3ABSA 3TAOA 1WX0A 1KBJA 3NQ6A 1P1XA 2CU0A 3VE7A 1GYLA 3JRKA 1BWKA 1WXJA 4BI6A 1ZY9A 3C2VA 5LSMA 4NNBA 5F4WA 3VI2A 1F05A 3C52A 3G1VA 3KFTA 1KTNA 3INPA 2QCEA 4EWND 2ZA3A 3RF9A 1TMHA 2PRMA 3EXSA 4CLMA 2O7SA 1QCWA 1T8XA 2JK2A 4IMDA 3TW6A 4O0ZA 4FNQA 4YL2A 5EL1A 2I9EA 4Z08A 1ADOA 4UTTA 3LBCA 2A0NA 3DFTA 3NQDA 1KLZA 1SW7A 4CCCA 2Z2UA 5HMSA 1L6YA 1GWJA 2CLOA 3GK0A 4IMCA 3MP5A 5C54A 2QDGA 4MY9A 3FLUA 1AW1A 3A5VA 2C3ZA 3TXVA 3FIGA 3ABRA 4O10A 4DEFA 1IF2A 1OYCA 2V5LA 1DJQA 2A5HA 4WD0A 4MPQA 3VCRA 3TH6A 5CPLA 5HUOA 3QYQA 3BG3A 4N2YA 2PE4A 4EOUA 4Y8FA 3MP4A 3S6DA 1FX6A 4BR1A 1ZALA 4AWTA 3Q37A 5AYYA 4PEKA 3HB9A 2V81A 5CPOA 5G2IA 3NPVA 2A4AA 3T44A 3W7GA 4JX4A 3MW7A 3W1QA 2CZ5A 2CLEA 1F6KA 1X7FA 1TPDA 3BG9A 4A21A 3NQFA 2YPIA 3Q94A 5I3JA 1NFBA 1W3NA 1OFOA 5BRBA 5F4XA 3UZ5A 2Z6IA 1I45A 1GVFA 3LCXA 2YYTA 1KFLA 1K7EA 1TQJA 3UNDA 1QO5A 4ONVA 3BLFA 3TX9A 1RVGA 2QCCA 4DF0A 1HTIA 3LDVA 2PCQA 3ZFHA 2R14A 1WYIA 1IGSA 2E68A 1TRIA 3O06A 3SJ3A 2QAPA 3A23A 1YDOA 1MEIA 1OFAA 3G0SA 3G1DA 1SZFA 3IGXA 5DBUA 4UTMA 3BPWA 4HPJA 2NXIA 2TYSA 3HGOA 1UJPA 3UXAA 2XN1A 2QUTA 2ZYFA 5F4SA 3GNNA 3TJLA 1A5SA 3HG4A 5CKSA 2WSYA 3W85A 1EUAA 1KFKA 4ORMA 3BARA 2QCFA 4Z1DA 3W75A 1R2TA 5AHMA 4KFNA 4AHPA 1K3UA 3W9ZA 5IM51 5EBUA 3WK1A 5EA9A 1JUEA 1LROA 4HPXA 5L6UA 1PCKA 3DFOA 3O6CA 3GX9A 4OE7A 4QM1A 4GJ1A 1OVDA 1JULA 2EKCA 4NX0A 3CHVA 3HG2A 5EKYA 1K02A 1XM3A 4LUIA 4PL2A 4WUIA 3RMJA 1VCFA 3JS3A 3KRZA 5AC8A 2QCGA 3LCLA 4UNKA 2B7OA 3IIXA 3WJZA 3M47A 5D30A 2JKEA 3WJYA 3M5ZA 3A9IA 3GDRA 3CWOX 4RKAA 4TR9A 4JTSA 1ML1A 1VCGA 5CGQA 3OHIA 3W72A 4JY9A 3MO7A 4Y90A 3QC3A 3I7RA 1TPWA 3MBDA 5EPDA 1VYRA 1ZENA 1FCBA 4ML9A 2QCDA 2ISVA 5AHIA 4ICNA 1EP1A 2NXGA 3EXTA 1LOSA 3P74A 1W1ZA 1LORA 3EEGA 2CW6A 1KM0A 2V2HA 5GVJA 3OVPA 4WY0B 1EWEA 2R94A 3NEVA 1KM3A 1XXXA 3QMRA 1TV7A 5D2TA 2F7FA 2V2DA 4O52A 3KVMA 4IX2A 4LNYA 3G1AA 8TIMA 4Y6GA 2CLLA 1YXCA 3DKLA 1H61A 3BGGA 2R8WA 3BGJA 1RQBA 1W5OA 4HKPA 1SO6A 4IMEA 1G7UA 5AC7A 4DO4A 1I2OA 1LRNA 4M6QA 1SO4A 1M5WA 3QW4B 1BEUA 2GOUA 4XKYB 4NX5A 3TQKA 2ZDRA 4CQ8A 4L4LA 3IVUA 3HJZA 2Z6JA 4O4VA 1M6JA 4LOCA 1GOXA 4HSNA 4H6KA 3G1SA 3RLUA 3N2MA 3LLDA 3N3MA 4JYEA 3W07A 4ADSA 1GZGA 1XBVA 3EX4A 3OBKA 3W7DA 4R7JA 1TB3A 3CEPA 1HO4A 4K8HA 5MHBA 3HPXA 2VFEA 1WBHA 1I2QA 5LHEA 4AF0A 3LLFA 4YMZA 4JICA 3W1PA 5D03A 4ZQOA 3Q2DA 4NNAA 3PBVA 1ZAJA 4BFAA 5DCBA 1KLYA 3DI1A 2ZRUA 3M5XA 4AWUA 5AHEA 2UV8G 5AHFA 1XI3A 4IUOA 2Y88A 4S1FA 4D2JA 1AL7A 3L67A 3PG8A 5FEZA 2GJNA 2CLKA 4NJJA 2RHGA 4MZ8A 5TBOA 1W0MA 1OFEA 1VYSX 1FDZA 1D3GA 1FWRA 3HO8A 1Q6QA 3QW3A 4N6FA 3GKFA 3S5YA 1TV8A 4WX2A 4Z0JA 4PCFA 2Z0IA 1WAUA 5H91A 3RU6A 1VLWA 1GVSA 3GLCA 1H7RA 3L5AA 1W54A 1THFD 3LGEA 1YTKA 3EWBX 2C13A 4Z0SA 4JR5A 2Y89A 2RKXA 2FFCA 4M7SA 3NQAA 3DI0A 3L9CA 3LCFA 5DCEA 3IV3A 1VR6A 2A7RA 3LHTA 3LV6A 2GVGA 4ZQPA 4OU1A 4UR8A 1QOQA 5DXYA 3NQ7A 1L6SA 2GPTA 3QPYA
chains in the Genus database with same CATH superfamily
4LYPA 4CEUC 2QPXA 3RPDA 3LS9A 4UFHA 3G6MA 5HPCA 3KOFA 3W27A 1ZJIA 3F4WA 5ABFB 1HJQA 4FHAA 3SI9A 1NDYA 3NQ8A 1S2WA 4FMVA 2EKGA 2W4XA 3THAA 1V3HA 1VJSA 1EPVA 4UTFA 2ZX6A 1MFVA 5D33A 4NJHA 4HPNA 1E6NA 3RRXA 2E6DA 4WEVX 1MW3A 1XYLA 3GDBA 4P8UA 1IHIA 4F9JA 1BFNA 5I5RA 3OGVA 4Q8PA 4B9ZA 2YL5A 1J6OA 1NWUA 3BV4A 2OB3A 2YL6A 2CLPA 1MRQA 4JY8A 3PJUA 3BXWA 3NQGA 4JXCA 2ZOXA 3PPGA 4Q4RA 3G8EA 1F7BA 3LRMA 3SN4A 2BY1A 4TTUA 1MXDA 4G1NA 5I24A 3WQFA 1OFDA 3A5FA 3IK4A 1O5XA 4C1KA 1NEYA 4PMDA 2ZWYA 4LWWA 4KEMA 3V5OA 1H11A 3IACA 1E40A 3N6QA 4H3DA 2GDUA 5C9XA 2GJXB 3LTSA 3PS7A 3C0JA 3IVSA 2DZUA 1WOAA 1BQCA 2QV4A 1P0DA 1U30A 1JUBA 2PDMA 3CU2A 3UWWA 4J2MA 3FXYA 1YPXA 1K03A 1U1HA 3ITYA 4D8LA 1BWVA 3P6LA 2VFDA 2PRLA 3AZRA 2YXGA 3XIMA 4OWGA 2GJLA 1S38A 1GQNA 1CBGA 3UPWA 4B5WA 2A1YA 5PTDA 1V6XA 4YIWA 1MEWA 5G4WA 4C90A 3L7RA 2Q8LA 1TTPA 1ZSXA 3HOJA 5CC5A 2O56A 4AZIA 3TV8A 3WLIA 2FZ9A 1SJCA 2PDLA 3T42A 2OQHA 2AL2B 4AISA 2B7QA 4J27A 2ZX7A 2XSAA 4P7NA 3K4WA 4PMNA 3HPAA 1KD0A 4Q8WA 3BUVA 1L2UA 3BO9A 2H8XA 3VCCA 3TSBA 3QY6A 3WFAA 3PWAA 3WENA 1IT0A 2ODOA 2J62A 1M53A 2XFWA 4A05A 3W2JA 1RK5A 2QGHA 2VR4A 3G3DA 2YZRA 4KWOA 6TIMA 2XSBA 3NAVA 4M6PA 4O13A 2GSHA 3CLWA 1B57A 1GKQA 3S5OA 3KE0A 4UQBA 1A47A 4CEXC 2D73A 4AQLA 5AHLA 5EYWA 5E9AA 2DW7A 1QHZA 1OY0A 2C0AA 2PDGA 3STEA 2HROA 3LLXA 2WVUA 2CBVA 1IIHA 1BYCA 4U2ZA 3TNOA 3A4XA 2DZWA 4WJXA 4OJYA 3TVAA 3ABQA 3DKJA 4KF1A 4O1EA 4URIA 3OU8A 4HYVA 3BW2A 3FNDA 2EPHA 3BURA 3G0XA 2QS8A 5TAOA 8CGTA 4MNKA 2NQ5A 1EHAA 1E9LA 2AQOA 2XIJA 4DWDA 3LNPA 2D3LA 1M7PA 4O11A 4ZBCA 4PBFA 2HPIA 2DZAA 1SZNA 4DJFC 2XWDA 4NU7A 4M3PA 1JRCA 4NZCA 1HW6A 3SCUA 4K3ZA 4IFKB 2BHZA 4IMAA 4XIAA 5MKGA 3I6RA 4KCUA 2JEPA 2A7PA 3EGJA 1TKKA 3MJMA 1D7KA 1US3A 4JNZA 3QGAC 4JNMA 3WNLA 3WJXA 1KFJA 3CGTA 3EMZA 1FDJA 5ENLA 4MY1A 1QR7A 2PF0A 4JL1A 1QMLA 4PULA 3MYOA 4XV0A 2YYUA 4NZJA 2RDUA 3HG3A 3OJGA 3FHQA 3IRSA 5D2YA 3KBWA 3T0TA 3S5ZA 2GVEA 4JEQA 3PAOA 4K7YA 1PKLA 4I7VA 2WZIA 3AALA 3W1NA 2QPUA 1L6FA 3QLDA 3WBWA 4YU1A 2EPMX 3WY1A 4ZTXA 2OGYA 2OGJA 4ZZ9A 3QC0A 3WEOA 3I68A 3W53A 1E6QM 1Y65A 1JCMP 1JYVA 2PDNA 3SFWA 4U31A 2IS7A 1H4PA 4JHZA 5K9XA 2Y6ZA 3LHVA 1UP0A 4CU8A 3NXLA 3VGFA 3OIHA 4OT7A 5F7UA 2QUNA 1LG1A 2I7GA 1EH9A 1QHPA 2YDQA 3LGGA 2OXNA 2VC7A 3KM8A 3N1AA 2YFOA 3HZ3A 4JTHA 2PB1A 1M1BA 3ZLFA 1PIFA 2QCHA 1C8YA 3DX5A 4EXQA 2QJIA 3T1GA 3RYSA 1ITXA 4O28A 1TV2A 4EX4A 4DBEA 3SUUA 1Q8JA 1ALDA 1XLHA 2DZPA 3DFQA 1D3HA 3HIJA 2I5GA 2Q6ZA 1YQ2A 3VU2A 2FDMA 2WHKA 2C6QA 3I3DA 3AIUA 4AMAA 3ARQA 3PSWA 2Z1BA 3R94A 3H12A 3UP8A 2VELA 3STGA 4HOWA 3G1HA 3SCNA 4DWSC 2PDWA 2J8TA 2JGYA 3OG2A 1S5TA 1C8VA 3W84A 2WM0A 1KCZA 3TTEA 4BWLA 4UFIA 3NQEA 1PSCA 2ISSA 3PFMA 3NFUA 3QZAA 1OCNA 4V1YA 4Z1CA 1I9CB 2NXHA 1E9ZB 1XV8A 1GK8A 1G4TA 1VFSA 2CNCA 5DO8A 5ABEA 1EJ7L 1W5MA 3H2EA 5KTLA 4ZQMA 1DV7A 3APYA 3PM6A 1FXQA 3UBPC 2W66A 1UP2A 4PB4A 1EBHA 1PE1A 2FZBA 3NXFA 2W6RA 1R87A 3OOQA 3CPUA 1GG0A 4Z2HA 4NILA 1CXFA 1OJXA 4GUGA 2V38A 5HOSA 2OT0A 1V6WA 3P8JA 3QHNA 3TZFA 4JTTA 3MYPA 2X42A 4B16A 4HA4A 4FLSA 3GKAA 4FX8A 4DJFA 4ERGA 5EFDA 1H63A 5C5YA 3FA4A 5CXPA 1VKFA 3AHXA 3A64A 1A3WA 3K4DA 2PGRA 4X63A 1UWSA 1B4EA 4NYYA 1R7OA 3L0KA 2NV2A 1M65A 2CLIA 5FKYA 3C2YA 2NUWA 3W7EA 4DIAA 1H62A 3T9PA 1L9WA 3GNRA 1KKRA 2EG8A 2R1MA 1JZ7A 4AIUA 2XFRA 3WH6A 4DJEC 4JIQA 2BNJA 1JUKA 4GI8A 1I0DA 4C6KA 5TD4A 3SRFA 2A7NA 2DVUA 2ZZ6A 4CQCA 2PGEA 4A8RA 2W79A 4A4AA 4IGMA 1VENA 4WKFA 1E51A 1R47A 1T8QA 1DVJA 2FGBA 2X8RA 3K46A 5FF7A 4E0CA 4L4PA 1KQYA 4IH3A 2ZXDA 2VEMA 3A12A 1UWQA 1UPMB 1WKEA 2VEFA 4QROA 4PODA 4JZ5A 1WXZA 2VRJA 1W8SA 3VD9A 1UR2A 1UQYA 1FHUA 4J3UA 1DL3A 2ADAA 4RV8A 1BVZA 4B91A 3VOFA 4GYJA 3EA1A 1RJPA 3CT7A 3GXNA 4ZFMA 1E71M 4NJKA 1W1TA 5LNWA 3W86A 3FYYA 2VZVA 1PX8A 4GVIA 1LF1A 1QI4A 2FGLA 5I77A 1WDSA 5FJJA 3UESA 1B3XA 4PCTA 1R2SA 2EG6A 3W2NA 4HU3A 1E1CB 2PLMA 2AQVA 5A5WA 3D0CA 5AC5A 4MLRA 2DSZA 3M16A 2J27A 3FA3A 1ZGDA 4O17A 3STFA 1P43A 4J1OA 4GACA 4GZEA 4EP8C 1IEWA 1ITUA 4O0KA 4L6HA 3WBEA 4QGCA 1K8YA 3M44A 3CXOA 4DWSA 1M68A 1W3JA 2V63A 3DHDA 4GA8A 3WBXA 3NPUA 1TWSA 5HJLA 1BYBA 2NUYA 1HKVA 1W9UA 1OZQA 4K8GA 2EXOA 1US0A 1GOKA 4MIMA 3PP7A 2ISFA 1VZWA 3KDNA 2V9DA 2IPJA 1XL9A 4H2HA 4K7VA 3WN6A 3BLDA 3CUZA 3DIPA 2BY3A 3GW3A 1M7XA 4JBRA 4W9TA 2OX1A 5GJMA 3AIVA 1OK6A 3VGEA 2ACQA 1JCXA 2BZNA 2PDHA 1DJIA 1U5JA 3A3XA 4LS1A 1TUFA 3LCIA 3ERPA 1G4EA 3TLQA 3UPMA 2D69A 5A6BD 1HQTA 4ZO6A 2GZXA 2XVPA 3GC5A 2A6LA 1E6XM 1LL7A 1T0OA 5FI8A 4IPIA 2Y8KA 3CZJA 3ELFA 1MQQA 5D32A 3P5ZA 3W02A 3OBAA 2PD5A 2OZTA 3UWYA 4KFPA 1UWTA 1YDYA 4LBRA 3PPFA 4QE1A 5I03A 3TE9A 1JCYA 3ARYA 4RJEA 3NTYA 4N9DA 1GHSA 5FEWA 1VH7A 4HNUA 4O54A 1RUSA 4HCHA 1BVWA 3VKKA 2X1UA 4PTNA 4GUHA 1XIEA 4F0HA 1FH9A 3DEQA 4MLJA 4X0VA 2PC4A 1EX5A 1JDDA 2PRHA 1GKPA 4YTRA 4WY0A 5I78A 5CGMA 1XLCA 3NOEA 5J5RA 3EWDA 2P8BA 1XSJA 2G41A 4C6EA 1O60A 3R2GA 4M1RA 4H8HA 2CFFA 4D1JA 1ICPA 1UUQA 1PDYA 1UD6A 3QQ0A 2GK1A 3IUHA 3LBMA 2ZX5A 4LX4A 3GXTA 5KMYA 3W3OA 3WEZA 4DZIA 3M5YA 2XISA 4S2CA 5TQLA 5SWUA 1EC9A 1SSGA 2VZSA 5J04A 4Q7IA 1WA3A 5HQMA 1Y8BA 5C0QA 1EF3A 2PODA 4UXDA 3PBGA 4GZ7A 3EX6A 3OLEA 3W7RA 2REQB 4S3EA 2VQUA 2ZE0A 4S3DA 3LQGA 4ENLA 2QDDA 1ELSA 4IISA 1JPIA 4M6UA 5DMNA 4ALDA 4DBWA 4PTXA 5G5IA 5HMEA 5REQB 1XIIA 1YLVA 2QUUA 1M01A 3VNYA 2WLZA 1DORA 1B3OA 4O14A 2GQ8A 4LGXA 1F73A 3GRIA 3MUAA 1W1VA 2YBTA 3VIHA 3I4KA 4ZO7A 4L6OA 4Q8TA 2P0IA 2ABBA 2WMGA 5T9BG 4MTVA 1MI3A 2NX3A 4J3VA 4XAFA 1W1A1 4FAMA 2D2JA 3L5MA 3P8IA 1FCUA 1NFPA 3PSVA 2VXNA 2QCMA 4HJWA 3OVGA 2VOTA 3BOXA 3SFKA 1RCOB 3WQ5A 4GH3A 3ITLA 3C4UA 4NAFB 1H1NA 1CEOA 1H60A 4HA0A 1SU5A 5A6AA 4WDXA 4LSBA 2C71A 4V1XA 4PMZA 4OBSA 3SIZA 2AAAA 1OK4A 1P7TA 4L4MA 2ISDA 3C2EA 4D1IA 3QOMA 1N55A 1SR9A 3OIXA 2Y4SA 4Y9AA 4MJMA 3VKCA 3BLLA 1QFEA 3FY1A 4IQEA 1E3XA 2X1TA 6A3HA 4JIEA 2WNQA 4KMQA 4RE2A 3FYOA 4MWAE 3WQEA 2PWEA 3SUTA 2O55A 1JDFA 5DX7A 3RNDA 2PU0A 2PFHA 3LHZA 4IXHA 2EGZA 3OO2A 1XYZA 3IGHX 4H4IA 1Z44A 4OUEA 3P80A 4C6OA 3C5QA 1V5XA 3L23A 3TSDA 3GH7A 1PCWA 1OB0A 3HFYA 3QR1A 1QNRA 4H9XA 2DQXA 4PSRA 2WKLA 2X2GA 3CUJA 4FNRA 3NZPA 3E0LA 4Z1AA 4NJIA 3KBNA 1RY0A 4HNTA 4UQ9A 1ME7A 3CO8A 5B7ZA 3RG6A 3SUWA 3W7KA 2E9LA 1JDEA 5EB8A 2BXZA 3QMSA 1GVIA 3RX3A 2WANA 4F2TA 3RMEA 3WLNA 1G5AA 5HNUA 1PO9A 1XYBA 2ZZ4A 1O4UA 1JZ4A 4KETA 3QOKA 1JL8A 4PFMA 3BCJA 4TU1A 1REQB 4MVAA 3VM5A 1S5VA 4N4QA 5I3IA 3U4FA 4AZ7A 1CZ1A 3W2LA 3F1QA 1ME9A 3MHUA 1JDAA 3MVIA 1US2A 2C15A 3W01A 3VVGA 2QF7A 4ZXOA 3ZIZA 4G7FA 4FSAA 1OX4B 1W9VA 1VLIA 2XVLA 5JH2A 3RR1A 3LN3A 4WOZA 4HPGA 1I4NA 4C6BA 4B5SA 3EWCA 4XD3A 4LC6A 2YDRA 1VBJA 2IQTA 2Q8XA 1JIBA 1TQXA 1UD2A 3VOIA 3GNPA 4MJZA 2VOMA 3MTWA 1KWKA 3PWIA 2RJHA 2Z2AA 1SM9A 1IIGA 4D8AA 5FD0A 4M24A 3S3GA 2R24A 1KBBA 1EOMA 1JEZA 1XUZA 2WMFA 3ECQA 3E38A 3NL5A 1TWZA 3KWSA 5HXMA 1SO5A 1VHCA 1K77A 3SZ8A 3W25A 1UOZA 4MF4A 3KDOA 4AZ5A 1LQ0A 5DBTA 1TR9A 5HJXA 4UNIA 1TJRA 5C7VA 6ALDA 1MUWA 3SY8A 3TTOA 3CT2A 1R9YA 3RX4A 4JTIA 3EYPA 4LUJA 2H3BA 4NRSA 4L7ZA 2ZXAA 4F4RA 3WK0A 2OZ8A 1E6SM 1R3SA 4X2RA 3LXCA 5C7HA 3W26A 4HHPA 4QEHA 2VRQA 3WUFA 1Z42A 4LUTB 1FWTA 1UUMA 3DERA 3GTXA 3FK4A 4CCEA 2QCLA 3G22A 1VPXA 2WNWA 4KWSA 3LGDA 4RX0A 3R8RA 2WCGA 4HZ6A 3ZWSA 3H21A 3RXZA 5E1QA 4KQNA 3VGGA 1C8XA 2QAFA 2WBGA 4GHRA 3SECA 7XIMA 5TIMA 4YTQA 4UTTC 2DZTA 3W6MA 3BL3A 4WLCA 4D6FA 5BOFA 3FS2A 4X0NA 2ZTKA 3W81A 2YXOA 4E38A 3UGRA 5A1AA 4GIEA 5M2FX 4NSBA 4PUWA 4YS1A 1BVNP 2DIJA 3E5BA 1X96A 3LHYA 2HEJA 3DH7A 1RCQA 3BW3A 3ATYA 3FDGA 1QNOA 4W88A 3E12A 4X22A 3W00A 4LT9A 1TJ1A 4BF7A 1POJA 3TDFA 2I14A 1VS1A 1JAKA 3V3WA 5CSSA 2R1PA 3S1GA 1W31A 1MDRA 3DYOA 3GU1A 3MO4A 2WLYA 5A94A 3EXRA 4UCGA 1XYMA 1K9FA 5LGXA 4IQJA 3NPXA 4Q8VA 4GVGA 1E56A 3ABZA 3G1XA 4NP7A 2DIKA 4XBJA 1H51A 5G2WA 4J9JA 8XIAA 3KOYA 2YCJA 4JX6A 4YWSA 4NI8A 4XIMA 2PDBA 4KIRA 4JKLA 4UZUA 4WKAA 4LC8A 4H7ZA 1ZL1A 4RR4A 3PZNA 4FI4A 2J7EA 4TV6A 3SCTA 3TUUA 4MB3A 1B9ZA 3PTQA 3WX7A 4EPBC 2WHMA 3VDAA 3LZ5A 4Z2GA 4YTTA 5JH1A 5E0KA 3AMLA 1GVYA 3C0QA 4CCZA 4QS6A 1JXKA 3CPGA 3S1WA 5CJ5A 1K7XA 3A4AA 1ISXA 1RP8A 4NNCA 1AQHA 5I02A 4H8VA 3LMYA 3MHFA 4JHOA 2J88A 1KRCC 2HS8A 2VZOA 4DWSD 2WVVB 4JOMA 3GDMA 2HE5A 1SUXA 2O0TA 3MI6A 3R25A 4O53A 4H9MA 3FCPA 2JIEA 3TJIA 4Q4PA 1NP0A 1XHGA 3T0AA 3TA9A 4DAIA 3NOYA 5LXXA 3MMWA 3M0XA 4JNYA 1RPKA 3VOCA 4OZOA 4MM1A 3GYEA 4UTHA 4S3FA 2DZXA 3DU0A 1EP3A 3ABSA 3TAOA 1GYMA 4Q8OA 1MMFA 5C9WA 5CAHA 4JTQA 4XD5A 3PJTA 3NQ6A 2NQHA 2BOEX 2FZDA 1ZB5A 3NO3A 2YCKX 3VE7A 4PCSA 1GYLA 4P5UA 2BGNE 1TZ9A 1HJSA 1UWIA 1WXYA 1KTNA 3INPA 4N42A 2D22A 2ZA3A 3SCWA 3RF9A 5HPOA 5FOOA 1B3ZA 3EOUA 2JK2A 4MGGA 3TW6A 4X60A 4O0ZA 1PZ2A 2VWSA 5EL1A 3M46A 1C9WA 3LPFA 1M04A 4UTTA 1MFUA 2A0NA 2FHBA 3BH4A 3VDGA 2Z2UA 4C1NB 1PKMA 1GWJA 3AOFA 1YIXA 2D2OA 4AD0A 3MP5A 4Y9PA 5C54A 3VPLA 2D2HA 3FLUA 4LCRA 2F6KA 3ITXA 4JQAA 3TXVA 5HJYA 4B4HA 5C70A 1IF2A 1SJBA 2PF8A 1X6LA 2V5LA 2V69A 2GGHA 2VI0A 1OT2A 5CPLA 5T8GA 1T7LA 3SCOA 1DTNA 3MP4A 3S6DA 1VD6A 3AS0A 5AC4A 2CIPA 4J40A 1MDLA 2PD9A 2V5JA 3HB9A 3BOLA 4FOJA 4OTKA 1NTHA 1S5MA 3BCFA 3W1QA 4Y2WA 2VR2A 3V35A 1X7FA 1ZQ5A 3WQCA 3NQFA 3D5HA 3Q94A 1W3NA 2HXUA 2VJXA 4I8YA 4QDPA 3UZ5A 1I45A 3UETA 3GFYA 4IPLA 3BLFA 2B31A 5FAJA 5CGTA 3TX9A 4OOZA 1WYIA 1IGSA 2E68A 1TRIA 3O06A 2QNEA 3QQWA 1RAKA 3DFYA 1EKOA 1FFQA 3A23A 1O68A 4CUCA 2PLKA 5DBUA 3U3HA 5EMKA 3ALGA 3IPWA 3WDQA 2XN1A 2QUTA 3ARRA 5F4SA 3ENLA 4XZHA 2QIIA 3DG6A 2PWGA 3CHDA 5CKSA 1EXBA 2WSYA 3PNUA 3W85A 2FJUB 2WW5A 3QTGA 1CGXA 1JG9A 1HP4A 3EMQA 1KFKA 3W75A 2HZGA 3SJNA 3NGFA 4CKQA 5GJNA 3AISA 1K3UA 2ZDSA 5MF5A 1PYFA 2IXVA 3JU2A 4Q8UA 1PCKA 3TEVA 2P76A 2XTKA 1UKPA 4XVEA 2P5NA 4DI8A 1OVDA 2EKCA 3DFHA 3HG2A 3RMJA 4GFIA 4WUIA 2CHNA 4RE3A 1BPLB 2B7OA 3AC0A 1JD7A 2X2YA 5D30A 4LAUA 3UW6A 1H0IA 4M8UA 3WJYA 4YTSA 1DQUA 3AUJA 1GQIA 4RKAA 4GD0A 4TR9A 4JY9A 5H8MA 3ZLHA 4Y90A 4Q4SA 1CCWB 1J0ZA 1TE1A 1ONEA 5EPDA 1VYRA 1ZENA 3U2ZA 1UKOA 3MUCA 1PUDA 4ML9A 2QCDA 2QDEA 1MXGA 3KUMA 3BMWA 1B1YA 8RUCA 1EP1A 1P6BA 1JCTA 4W84A 4LEFA 4LALA 1OIMA 2Y8VA 3VD7A 4C6QA 2FH8A 4ZSUA 4AX6A 5BOEA 4BQ4A 1KM3A 2ZUUA 4ATWA 2Z00A 2F7FA 3WYZA 2V2DA 3BJTA 4O52A 2XFFA 4IX2A 1TELA 5M1TA 4E6MA 1XGEA 4FPSA 4JIRA 4W5UA 4RNJA 3BGGA 3BGJA 4GY1A 4GC3A 4IMEA 2WHJA 1LRNA 1XGZA 1VRXA 1GHRA 1SO4A 2OEJA 2E1WA 3ITVA 1XD0A 1Z9AA 4L9YA 3WDIA 4D6HA 2KAUC 3PBMA 5I2UA 1H41A 4H6KA 4JYEA 3LLDA 1HIZA 4R7JA 2VO5A 1HO4A 3V36A 3SN0A 4C6CA 3CL6A 4L1WA 1W3LA 3HPXA 2VFEA 4PUNA 2DUXA 3W1PA 3Q2DA 4ZE5A 1XLMA 4NNAA 4WHBA 1GGOA 1ZAJA 9CGTA 1JXJA 2WB5A 3M5XA 4AWUA 3IARA 2XIMA 4WJ8A 4IUOA 5XINA 3AUOA 4GI6A 2PTYA 1JF5A 2J6VA 2RHGA 4HK6A 1OADA 1BAGA 5C9UA 2VD9A 1XLBA 3BCDA 5GQBA 2IPWA 1HJWA 3URQA 2W27A 1E4NA 4ZB0A 3N18A 3GKFA 4A3QA 3S5YA 2PDQA 1F3TA 2Z0IA 1GVSA 3GLCA 1SJAA 1O7AA 1THFD 3LGEA 1ISWA 3AMDA 5I3DA 1YTKA 1BG9A 3UA4A 7ENLA 4Q4OA 2C13A 1UZDA 4JR5A 3GHSA 2Y89A 4GG9A 4TVDA 5FJRA 4AY8A 3I10A 3C8NA 3UT0A 5DCEA 3IV3A 4ZQPA 1QI3A 1LT8A 4INFA 4PFHA 3RIKA 1YRRA 2JIWA 3ARSA 3NQ7A 4LH8A 2HV5A 2Q02A 1U83A 1CXHA 1E55A 1UZ1A 3AS2A 4JQ4A 5LGZA 3BZGA 4JS3A 1HN1A 4JN8A 3W83A 4J5NA 3P67A 3NURA 1KQZA 2IPGA 3KOZA 4JQ3A 3LUTA 1XCXA 3IVTA 1DJZA 3GB6A 4L64A 5ECUA 3C2FA 3DXIA 4LS0A 3WLRA 4LRSA 3GIYA 3ZVHB 3NIYA 1Q63A 3FVDA 3S6OA 1FDYA 2HK0A 3PAJA 2VVSA 2ZKMX 4MZYA 1QASA 2WJDA 3R0UA 3AIEA 4G7EA 3NL3A 4YYCA 3THCA 1Y5VA 1R38A 2X1SA 3LD5A 1PAMA 3D3AA 3VINA 4UNLA 4WK9A 1NVMA 1XIJA 1AD4A 3L4UA 3VIFA 3EMCA 1IXNA 1D3CA 5FA5A 5IOBA 3WF4A 3R4IA 4OBTA 3EZ4A 3W82A 2YLAA 5U4NA 5JUVA 4ZA0A 4O50A 4I7UA 2TMDA 1MW1A 2R1LA 3WQ8A 2PP1A 3TXZA 4BK9A 4AW7A 2CHOA 4PYSA 3AXIA 2YX0A 3ARXA 2DH2A 2YDSA 2E4TA 4A22A 2VVNA 4RV3A 2WJEA 3U4AA 4YVVA 5I00A 2PTWA 1LWJA 3RDKA 1I8JA 4R85A 1P0NA 2W67A 1AQ0A 2YFNA 1TTQA 2J8GA 2JGQA 1TX2A 4XX6A 3LHWA 1BYDA 1PTDA 4QE5A 1ZCCA 1TPB1 3MSDA 1QATA 2BX7A 2XN0A 1VEPA 3KRSA 2X1IA 5I0DA 1Q65A 1V51A 1WV2A 1I2RA 4LS2A 5CBIA 2PURA 4G2DA 1ITCA 3DFPA 4YLWA 3CWNA 3ZLGA 3OLGA 2MNRA 4JDYA 2OTDA 1OF8A 1UKQA 1UC4A 4CU7A 5RUBA 3WLPA 1UA7A 3UG4A 1K7FA 1JYWA 3BANA 4HHHA 5GJPA 3E2VA 3EKLA 4RL3A 4DI9A 3SQSA 4NIRA 2VGBA 3AXMA 4G6CA 5HQEA 1N8IA 2BOFX 4GLEA 4KEZA 1JI1A 5BU6A 3NM3A 3QGVA 1XFBA 2FVMA 4GJJA 2FB2A 2PDFA 4JTAA 1RLCL 4J4KA 2AAMA 2DH3A 3F4NA 3MHGA 3UJRA 1MXSA 4LAZA 2WVTA 5DT7A 2WC4A 5G1TA 3A22A 1S2VA 4WDUA 4DXXA 3UPBA 2J7DA 1B3WA 4CN1A 4LVGA 4JIHA 4QCFA 3UXDA 1IWAA 3R43A 4DF2A 3RLVA 3SIMA 3B4YA 3EPMA 2YBUA 2X05A 2BP1A 1QU4A 4XKYA 1L8NA 2A3CA 2PU1A 3CC1A 3GD6A 4R5EA 3QKZA 4XAPA 3W73A 1HJXA 4WQ6A 3T09A 2PC8A 2YA2A 1ZP3A 1PKNA 4NASA 1YE6A 1LG2A 2YIHA 4O15A 3UY7A 4KS0A 1EO5A 4RPPA 5AHNA 1Z69A 2ZVIA 1CENA 4O1AA 3TYUA 1CXLA 1X6UA 2OG9A 3PR2A 2W61A 1YNPA 1I60A 5FF3A 1V0MA 1XC6A 2IKJA 3IIOA 2X0HA 4Z1BA 4ICMA 1AJ0A 1VQTA 4DUWA 3HMJG 2ZICA 2DZSA 4C7DA 3ANVA 2UY2A 3E0FA 3P0WA 2WC7A 3MBFA 4Y96A 4Z2IA 4LTSA 3FV9A 5LIKX 4H6RA 3TTYA 3BSGA 3ZJ8A 3VNLA 3IEBA 4O57A 2PTZA 3S2NA 1ZZMA 3QHOA 3E5PA 4JFUA 3WFLA 1N8WA 3ZSSA 3I65A 1CGYA 1QJWA 1JZ5A 3GTFA 3A4WA 1KM6A 4LAOA 4QISA 6PTDA 1QHOA 4U3AA 4J28A 5FF4A 4NZ4A 3L0NA 3PVFA 3DHFA 4H1ZA 4JKKA 3RJXA 1J93A 1Q6LA 4GIYA 3DGRA 5T26A 1OFPA 2F9RA 3ZYZA 4H9ZA 2VCAA 3MV01 4QLJA 2OZ3A 1Z32X 6REQA 4S23A 3M0LA 3KX6A 1L0PA 3IJDA 4Q6XA 3WH8A 3AXHA 1JCLA 2GFTA 4E8CA 1QUMA 1EBGA 2Y24A 3HN3A 4XUGA 4XTDA 5LA2A 1H0GA 5DFAA 2JKAA 3G5EA 3SRDA 5LZLA 2V5BA 4UQDA 1OX6A 1UR1A 1LT7A 3H70A 1RQEA 2C1HA 3TOYA 1P1MA 2E77A 4GUIA 3WD2A 1EZWA 1J11A 3TMLA 3WF1A 4CD5A 2R82A 1NOFA 1H5VA 1EX1A 2PZNA 3AHYA 4GQGA 4XD4A 2D2GA 1DWAM 5J5DA 1X1ZA 3PTKA 2IKIA 2J9ZA 4LVFA 3AMGA 2Q8ZA 1LBMA 3VZXA 3TC7A 3UVIA 1X98A 1A4LA 2CLHA 4RZBA 1K1DA 3NSNA 3VNDA 5HWMA 1TR1A 2NVCA 1EUNA 2RDWA 2ALDA 3URNA 1NF0A 1X8FA 3W1TA 4IMFA 1LWIA 4JTDA 3AROA 1JPHA 1GVEA 3S46A 2J74A 1EO7A 4WGXA 3GBEA 4PCNA 4ZB5A 1KV5A 1QW7A 3P0XA 1HP5A 5D9PA 3R1ZA 5C9RA 5JXQA 1C3FA 4M80A 1QW8A 3NL2A 2QKFA 1ZPTA 3KRUA 3DESA 1E72M 4US5A 3VIOA 1OFRA 3P84A 2TPSA 3LSCA 1V3JA 5LHFA 3CQHA 3WSUA 3S8HA 2J4GA 4GKLA 5E0FA 5IHSA 3UWVA 2FTPA 2YA1A 1T96A 3UA3A 1XPYA 4JPGA 2DW6A 3BWWA 2DJXA 1UD8A 3EOOA 2GUUA 4LANA 1OG0A 3GXMA 2VDGA 5CLTA 3UD6A 1RH9A 1NH6A 3MS8A 4FXRA 3S1XA 1OT1A 3CZLA 4NAEA 4NXKA 3VOJA 1V02E 2J79A 2HXTA 2BG5A 3DOPA 3IJ8A 1E4MM 3SR7A 2ZUMA 2V68A 4A29A 2RGLA 2ZRZA 3E2RA 3N2XA 2QUMA 3WD0A 4H41A 3KRBA 3GNDA 5FACA 3U2CA 3GXIA 4TO8A 1DJGA 1I2NA 3W1RA 1QT1A 4JIPA 3U5YA 3GYCA 4FXSA 4XWUA 1HVXA 2FPTA 4FP1A 4K38A 3TR9A 4HIBA 1HZYA 1PL9A 3UG8A 4ZE4A 1KA9F 3RO6A 1ZBWA 3NQBA 2VUYA 3DG3A 3NZRA 1G67A 2P10A 1ESWA 5HR7A 1J2WA 4RPQA 2VFHA 2CXGA 1OSEA 5DEZA 3EEZA 1SFJA 2CZDA 2AL1A 3BK0A 1ICSA 1PIIA 3BV7A 2Y7FA 1PDZA 1XJBA 4NL1A 4XQ6A 2A3HA 3H7VA 5F2GA 4N9EA 4F0LA 1MWOA 5HQLA 4PB3A 4FK9A 3R10A 2FLIA 3S2CA 7REQA 3GDTA 1VBRA 4QJ1A 1R85A 1AW5A 5A6MA 2VRKA 1Z41A 2HS6A 4LVBA 1H7XA 5A6SA 2Z7GA 1W32A 2OR2A 1DYSA 3E2QA 1DTUA 3W2UA 1VYPX 2OX4A 3T55A 3FAXA 3MI3A 4DJDD 3N15A 1E0TA 4LW7A 1LBLA 3FXGA 3RILA 3EX2A 1YBQB 3A21A 3ZM8A 3E0IA 4GBDA 3WJWA 5FAGA 4PN2A 3FAWA 2YCLA 4RXGA 1LRQA 4LUSA 1MW0A 3WQ6A 3MSYA 3CH0A 4GYPC 4AYSA 1XLAA 1TE6A 1LUCA 2PDJA 2FPYA 3BG5A 3T0BA 4Q8NA 3VNZA 1V0KA 4FEZA 3N6HA 2VEGA 3OEXA 5IFTA 3K5XA 1A5KC 2WOQA 4J2PA 2DUAA 1PXGA 1XDMA 1YXYA 4FNUA 1JYNA 3MVTA 3QFWA 1EQPA 3B40A 3G1RA 5I06A 5GNZA 1SW3A 1QPQA 1T6MA 2OELA 4FO4A 3L0GA 3TAKA 2NX1A 1B30A 4C91A 2C19A 3PNZA 1DJXA 1NOWA 5E6ZA 2W91A 2YCEA 2ZZ5A 1KFEA 2P3EA 2Y63A 5I3HA 4FIRA 1KNWA 4H04A 5CPTA 1Q85A 1GYNA 5HK4A 5KETA 3EWXA 3S47A 1CXKA 2I1OA 2MUCA 3CMGA 1F5ZA 4QCEA 3FJNA 3IJQA 3EA2A 4HGXA 6TAAA 1AA1B 2H9AB 4JTGA 3TYDA 3L66A 4AF0B 1XLFA 1J2BA 3VDBA 2ANUA 4B5NA 4F3HA 1SFLA 4KWVA 2JBMA 2FTWA 5AVHA 3WQ4A 1L8PA 3TKFA 1DE6A 2BTMA 2VC5A 1VBHA 1TPEA 4REQA 1HL8A 3EDFA 1TIWA 4LY4A 3TROA 3EWWA 3PF3A 4AY7A 3PZOA 3KBMA 2GGGA 1W37A 1M7OA 4AAJA 5BXTA 2E3ZA 3C8FA 1SO3A 1JPDX 5I07A 4FZIA 5BMXA 3KL0A 4OOUA 1A80A 2Z4GA 3C2RA 1NIUA 3LRKA 4YHEA 5C9ZA 3BMVA 2OYMA 3AYTA 1DHPA 3GG1A 3PK7A 1UH2A 3E1F1 4MDPA 3RO8A 1EDQA 4US6A 4FX6M 1DQWA 3HQ1A 1AW2A 2Y85A 1EPXA 3FEMA 3RUBL 3R79A 3SGGA 4QS5A 3CMJA 5G1MA 2BXYA 2Z29A 3A6OA 1W17A 4IZGA 3ABXA 2QYGA 4JTJA 4HZ8A 2OWXA 5LNSA 1W6TA 4U28A 4HYWA 3B9OA 3EX3A 1MEHA 1OZMA 3O6YX 4L61A 2QULA 1K9DA 3GZ3A 4J3WA 3W1LA 1BXBA 1W1IE 2EJAA 1JCJA 1MRAA 2BBFA 1V7AA 3TQVA 3JUGA 1BYAA 2GDVA 3EX1A 3PZ9A 3K1GA 3T81A 2PDXA 5AZ1A 2V67A 1I2PA 1ECEA 4NYUA 3UR5A 2PDUA 1F61A 5FL1A 3UCCA 4I8DA 2WJFA 3W6YA 2Y7GA 2QPSA 3F4VA 1FWSA 1GVOA 1BSLA 1R5YA 1OGBA 1FVPA 4GQRA 1LCOA 5ABFA 4PRWA 1OFQA 2A3LA 2XFYA 3PBUA 5EMLA 3L21A 3V16A 3GR8A 4A6GA 1OEPA 1K6AA 4PH6A 3LXBA 2OLHA 2WKJA 4IHCA 4HU8A 5LIYX 1ZJBA 1J96A 2J7BA 3DAQA 3APTA 1EWDA 4NUWA 4CNSA 5M3WA 4BS0A 4O12A 4LPCA 1LZOA 3SN1A 1L6WA 3KZPA 3DGBA 4EVZA 4RW3A 1ZTVA 3JVAA 3I7QA 2C79A 2ZZ7A 2QVHA 1A5NC 5CC3A 1T41A 4AXNA 1SZGA 3TQPA 1EXPA 3RLGA 3IWPA 5HATA 3LCGA 3G8RA 3T2OA 1XIMA 1RD5A 5D04C 4QNWA 4ZOCA 1U1JA 2FJKA 1XKYA 1TPFA 2PWVA 1RPXA 5D8ZA 3AQUA 2XH0A 1QVBA 2V3GA 3DZ1A 2J75A 2UZ9A 2ZTJA 2ATMA 2WBKA 5AYIA 4QXIA 2NW0A 4YCOA 4LY8A 4HCDA 4ZR8A 1QNSA 2GJXA 2ACSA 3KTXA 4IG2B 1UHVA 2ATSA 1NFGA 4E3TA 1A5UA 2AKZA 2JFEX 3WD3A 5IDZA 4M29A 3CV6A 1IZCA 2D24A 3SCRA 3GUGA 1KBKA 2ISWA 1F07A 3BLOA 3HPSA 3QJAA 3P61A 4CU6A 4HTBA 1TO3A 4AG0A 3CNYA 3TC6A 4ML4A 3PWGA 3A9BA 4HD5A 2W63A 1AMKA 5G2HA 2NVDA 1RQHA 5LIUX 4GE8A 1GZJA 4BI7A 2R9RA 1K9TA 1XCWA 2B81A 4HHMA 1VC4A 1S2UA 1ZCOA 2QCNA 3HF3A 2OYLA 3LI1A 4OQVA 3V1HA 3D46A 2A21A 1SJDA 4QEEA 3CB3A 2Q3OA 1EJVC 3M0MA 2AL2A 4LUYA 4S3GA 1F8IA 4HP5A 1ZJHA 1SGJA 3T2PA 1QOXA 1UQZA 1BQGA 1H1YA 2DQWA 3MC5A 1KM1A 1TREA 3A47A 3B0UX 2NQZA 3BSHA 4Z42C 3BICA 1JDCA 2BS9A 4P7LA 2GGEA 3EKZA 2V6AA 3G1YA 2QT3A 3KS6A 4MWAD 4ACYA 2G4JA 3RK8A 4K8EA 4ERAA 2E9BA 1AQFA 3NVTA 5BRQA 1QPRA 3GXPA 3PANA 4QITA 4GQ0A 1PB0A 5FJTA 1UUOA 4TVCA 3VXGA 5M03A 3VGHA 3CZGA 3N14A 4JQ2A 3UXIA 1VJIA 1Z7AA 2TRSA 4V27A 3ANYA 4LXFA 4ATDA 1GQJA 2VQTA 1HO1A 3STCA 1R8LA 1A53A 2HVOA 2V3DA 5D37A 4WR3A 1ONRA 6XIMA 3ZR4A 1G69A 3BTNA 1R3WA 2WXDM 3QQ1A 3TJXA 3UWEA 2V3FA 4MAZA 1G7VA 1WO2A 3GFZA 4DYKA 4LF2A 3MZNA 3PJXA 2F38A 1S5WA 2BVYA 1C29A 5E09A 3UYIA 3TONA 3T08A 2QEZA 1LLOA 1FCQA 1K4HA 4XAYA 1TV5A 1TZZA 1XIGA 3QYSA 1W56A 3K2GA 4QIUA 3GVVA 3VNKA 7PTDA 2HTMA 4X9YA 3R89A 1FUYA 1O94A 5IBXC 4IF2A 3IK2A 3B05A 1FH8A 3CYVA 3P5YA 1NF7A 3UY8A 5L9FA 2ZFAA 3CH9A 4RDZA 6XIAA 4RLIA 2EPKX 3BAWA 3S9IA 4US5D 3EWYA 4WGHA 3H26A 2ZRYA 5A95A 4DRSA 2NV1A 4D6GA 3CV2A 2E1DA 4AFYA 2ZXQA 3QY8A 1FWIC 3MWCA 2WZEA 3PZGA 4KERA 4XZWA 2YOCA 1DIEA 2JKPA 4KWWA 3QM3A 3EPOA 4Q22A 1QBAA 1DOSA 4O1FA 5HNRA 3PPCA 1BF6A 2DVXA 4RNIA 3I6TA 1JFXA 4F9DA 1XIDA 2E9MA 5CPMA 5LKYA 1RBAA 1A0EA 4UFMA 1XCFA 3ZT6A 3WH9A 1XLLA 1V0NA 1YNYA 3H2NA 1IEXA 5BXSA 2QDHA 2JALA 1HFBA 1E6PA 3L4XA 3ZT5A 2X09A 3W7MA 1PKYA 5E93A 3ITCA 3CTTA 3HPFA 1MZRA 1PEZA 3CAQA 3WD4A 5F1VA 4D8ZA 3QKEA 3FKKA 3N13A 1R9ZA 2XIBA 2H8ZA 1HT6A 4O1DA 2XVGA 3TYZA 4I6VA 4CQ9A 4AEFA 4U5IA 3ZJ6A 1QXLA 3BLEA 1MUMA 4H9TA 1OF6A 1XIFA 1DKWA 2VP8A 4DBDA 5FEPA 1CB7B 5CSYA 4Q33A 1GZ1A 3EA3A 1A5CA 5AYZA 1DXIA 3KW3A 4IL0A 1BKHA 1TYGA 1OBAA 3UYCA 1G9HA 5E0CA 5D09A 3A13A 4G8TA 1EQCA 2YB4A 4JN6A 3BW4A 3ZT7A 3C6CA 4P8XA 4E2VA 4J3TA 3G24A 3DHUA 3M1ZA 5JVLA 3WQGA 2HE8A 1R3YA 3B0YA 3SM0A 3W1XA 3TFXA 5KZEA 2J7CA 3DC8A 1UMLA 1XLEA 2HDJA 4DX3A 2BWGA 4GWEA 1JCNA 4BCEA 4L4OA 3H55A 4FR6A 5D4YA 3K30A 3N11A 4ZOAA 3TYEA 3BJSA 1HXJA 1PWLA 4U3CA 3AXXA 1UASA 2IKHA 3T4WA 5J8LA 3OLIA 2HISA 3IJIA 4JKMA 1BKSA 3TWAA 3YPIA 3NYZA 2GUYA 4LQ1A 1XWYA 3BAYA 5AOUA 3SEPA 2XHYA 1KM5A 3WQWA 3L2IA 1TPUA 2VKZG 1EC8A 4D6EA 2XIOA 3KAOA 4HK5A 3QY7A 1BGGA 4L1GA 1RBLA 5K3VA 4QG8A 2NT1A 5B7YA 3B9NA 1UBPC 3SSJA 3CIXA 3HMCA 3UJFA 1XS2A 1ZRQA 4LCSA 3I3EA 1KBJA 1XIHA 2HCVA 2VX7A 2RGMA 1P1XA 4RUBA 2FTYA 3O2LA 3JRKA 5EGRA 1WXJA 4LYRA 4BI6A 1ZY9A 4NNBA 5F4WA 4AD5A 4K2SA 3G1VA 3KFTA 3URBA 4GXPA 2QCEA 1TMHA 2O7SA 1HKIA 4QDWA 4Y9OA 4Z08A 2QIWA 3OP2A 2O9TA 3BLKA 4GCXA 3EOEA 3NQDA 1V77A 3ID7A 3H2OA 3EOSA 4HNLA 4IIEA 3H22A 1YE4A 3UXLA 5DMYA 1AW1A 4E5TA 5C2CA 3ARTA 2PAJA 3OQ8A 2XSXA 3GG7A 4ACZB 4WD0A 1JYXA 4L65A 4MPQA 4E4PA 3VCRA 4HYRA 3BG3A 4Y8FA 4BR1A 5A2AA 3WMLA 5D9NA 3Q37A 1K4GA 1AH0A 2V81A 2W62A 5CPOA 4BJHA 3W7GA 1EJRC 4JX4A 4MG4A 1OCJA 2CZ5A 4KGJA 1TPDA 2YPIA 3M0VA 1D8WA 2EG7A 1JNDA 4C6PA 3EKGA 3KS5A 4F40A 1TQJA 3UNDA 3W6LA 5TF0A 3BE7A 1RVGA 2PDYA 4DF0A 1HTIA 2OQLA 3GU2A 2R14A 1CXEA 3V0TA 1R3VA 5AY7A 3P14A 3SJ3A 2Y0FA 2QAPA 5BYWA 4HMEA 4B2DA 1SR0A 2PDCA 2XU2A 3SURA 3BPWA 2VHLA 3HGOA 2XH4A 2YCIX 3UXAA 1EF2A 3GNNA 3WEMA 4B90A 1A5SA 3HG4A 1FWGC 3PFRA 3II1A 3WQOA 2ZX9A 4NG3A 1P0BA 1LJYA 2CITA 2CHRA 4AWEA 1H49A 1D7FA 2IKGA 4C6DA 3GTIA 1JUEA 3DFOA 4A3YA 2W3ZA 1JULA 4GIAA 4NX0A 3CHVA 4LUIA 4PL2A 3UR2A 3JS3A 3KRZA 1P6WA 5AC8A 2CEQA 4AD4A 4AZCB 3MPGA 2JKEA 3WBYA 3M5ZA 3A9IA 4Y9NA 1NWTA 4JTSA 1ML1A 2A3EA 3DUGA 3MO7A 2V5DA 3M6DA 4HZ7A 4PGLA 2A79A 3B8VA 4XZIA 2VZTA 1EYEA 4ZFCA 5AHIA 4ICNA 3CHEA 3AHVA 2NXGA 3N25A 4HN8A 1HF6A 1UC5A 1LORA 3IJLA 2V2HA 4UB9A 3MB9A 2JEQA 1Q7ZA 1PX3A 1XXXA 3QMRA 5CEWA 4IIGA 4V2XA 4EPEC 3KVMA 5CH9A 2Y8UA 1BF2A 3F5KA 3WUGA 2P8CA 4Y6GA 5A8NA 1XIBA 4F2BA 1SMDA 3ITTA 3VMNA 1FFRA 2R8WA 2X41A 4TX8A 2Z1XA 1SO6A 1A5OC 1S1PA 5BWFA 3MDWA 4GI4A 4CQBA 4GMEA 4ZXLA 5AC7A 4M81A 1FH7A 1WE5A 1DWHM 4XKYB 3SAZA 4M56A 1WAWA 3PZUA 2YXXA 4FOUA 4B92A 3GXDA 4O4VA 5AVNA 3WMBA 2NVAA 1OINA 3WIJA 4PMOA 2G37A 5C2GA 1F3EA 3G1SA 3OBEA 3OZMA 4H9VA 1GZGA 1RP9A 1WZKA 1XBVA 3VIIA 3CEPA 1EA9C 4K8HA 1OD8A 1IR2A 2VD8A 1J0JA 3LLFA 4FOKA 3MZ2A 5BROA 1V79A 4ZOBA 4GQQA 4AC1X 3PBVA 4GGHA 2BVWA 1Q6DA 2QQ6A 1XR2A 2WCSA 5DCBA 1GW9A 1NJJA 4L5ZA 3WZ0E 1SVDA 2QLYA 3NCOA 4S1FA 1AL7A 3L67A 3K8MA 5FEZA 3G2GA 1FWJC 2GJNA 2VNCA 2OSWA 1OFEA 4C6NA 4W4QA 1E73M 3HO8A 2REQA 4MSSA 4H83A 4Z0JA 1V02A 5H91A 3RU6A 2QZRA 5EMJA 1H7RA 1ISYA 3NZGA 4PUKA 4WIWA 2VDIA 4Z0SA 4ATLA 3M0YA 2FFCA 5REQA 4D72A 1W8GA 4WDTA 3L9CA 3LCFA 4F2UA 5HA7A 2GVGA 1G94A 5D9OA 5DXYA 4IFRA 3KP1A 1L6SA 2VX4A 5A2BA 4FF5A 2BSLA 3LXAA 2Q3RA 4OV9A 1EIBA 4XZ9A 4UTJA 4PE8A 3TW9A 3BLIA 4W93A 5K9DA 2QW5A 1YPFA 2I56A 1IXPA 4Z1YA 1RCXB 5JBDA 2VMFA 4GX9A 4Q4KA 1Q2SA 5T91A 3CZEA 3J7HA 3THUA 1ZLPA 1KCXA 3NM1A 4KW2A 3KCLA 1EFZA 2OJPA 3W88A 3BZJA 4ORIA 2VYOA 3TSMA 5DELA 1LTDA 4YPJA 3LM7A 1P5BA 4CD8A 3U0HA 1XYCA 4Q6JA 4NAFA 2TODA 4MWAB 4GI9A 3G18A 3TMQA 5H1WA 1A3HA 1ZAIA 1CB2A 3W71A 2X16A 1TVPA 2GWGA 4XD6A 4W7VA 5A2CA 5H2ZA 3NO5A 1D2KA 2ZC1A 1QNVA 5A6LA 1R2RA 1J79A 1XICA 2KZHA 2C7FA 2ZUWA 4ERIA 1H7NA 4RDWA 3CM4A 4EIVA 1RSCA 2F2HA 4UFKA 3XISA 4AD2A 4JN7A 5EY5A 3VKDA 4HNCA 1E0VA 1ZS2A 3JR2A 4HT3A 1F2JA 1LL4A 2BFGA 2XGZA 5AZ0A 1OFBA 3BDKA 2Y70A 1HG3A 1KR1A 5E9XA 1WP6A 4GYFA 1R3TA 1FWWA 5BMWA 1V03A 2EO7A 3WLHA 3RRAA 3ZOAA 1HKWA 3GHRA 1LP6A 3CL8A 3OZPA 1R3QA 4W7WA 3RR4A 3LI0A 2R91A 1CW2A 1DWFM 3VIGA 4Q7NA 2A85A 4Y8EA 3MUZ1 1I6NA 1Q13A 4HSOA 3FA5A 2GGIA 3WK3A 1TCDA 1AZ1A 2DY3A 4MHBA 4O1BA 2A2IA 5G1YA 1W1B1 1TA3A 3UZZA 2B7PA 5CAKA 1SSDA 1VPYA 3W7JA 2PBOA 3HJEA 1UR3M 1XQKA 2E6AA 3GVGA 4LAMA 2ZA1A 1OIFA 4DHGA 3I4EA 5A8PA 2AGKA 3IRDA 5CCZA 5KZDA 3F2CA 1JPMA 1XG3A 4DJEA 1ONWA 4KIEA 3WQDA 3GS6A 5IDIA 4CNPA 2YDAA 3U7BA 4Q7BA 1FWAC 3S5SA 3O63A 4QQ3A 1F76A 1REQA 3UF9A 3VNIA 4HMCA 3RN6A 1J5SA 1JQVA 4LYQA 4HB7A 3W7CA 4OGZA 3EB2A 2CZEA 1C93A 1X97A 1LBFA 3U7VA 1QNPA 2A3AA 3VUSA 2CZVA 2YJQA 3WH5A 2NLIA 2RH9A 2VDHA 1AH3A 4ZENA 1OX4A 3W2KA 1WUEA 1PHWA 3VD3A 1H3GA 1WDDA 5KZ6A 2IQDA 2FZMA 4HU0A 1WOBA 3G0UA 3OYXA 1VB9A 2BB0A 4GJIA 1E9IA 1HUVA 3OZYA 6ENLA 3PZTA 4IXXA 3MCOA 1HL9A 1AODA 4IMGA 1BXCA 3N6JA 3VO0A 2DP3A 2OFJA 4O1CA 5AN7A 3I7SA 2LLEA 4N4PA 1P0KA 4RK8A 1WDQA 3Q65A 3CUFA 2OMAA 1CECA 4QLLA 1H09A 3KHDA 2CLMA 2CBIA 1KW1A 3W7HA 4MFEA 4OHQA 1E5NA 2QVNA 3TYCA 2AGTA 1XISA 3A3HA 4LRTA 4HOXA 2A6NA 2PUZA 4AVFA 4IT1A 7CGTA 4ASTA 1XD1A 3REQB 3BAJA 3OYZA 1RALA 4LUTA 3S1UA 1VEOA 3GBDA 1CIUA 3QMTA 3ONBA 4W8LA 2EPLX 1O5KA 3HGSA 2VEKA 3OA3A 2J7GA 4FNTA 4S2BA 1GONA 1VAHA 3AI0A 5KZMA 1X39A 2Y1HA 3MSGA 1JJKA 4HMNA 3WD1A 1TPC1 3RPMA 4LUSB 5EMMA 3M0JA 1HGWA 3IJ6A 3MUIA 4QE4A 1AZ2A 3NL6A 3UWQA 1H7WA 1ZBKA 4YCPA 3BVJA 2J6XA 3IS4A 4POCA 4DELA 5HANA 2D1ZA 1KM2A 4EF8A 2FVLA 2A3BA 5XIMA 1WZMA 4JD4A 4BQ5A 2PTXA 4LF1A 3E3HA 4GFSA 1UPPA 3T0CA 1H7OA 3ITOA 3O7UA 3LTPA 2WZHA 1IZKA 5DY3A 3O8AA 3H4GA 3B0PA 3DFSA 2ZRVA 4O19A 1BRLB 4H6EA 4UFLA 1E6RA 3AU2A 3AZSA 5BU9A 3NQCA 4D6CA 4GVHA 2J7FA 1QPKA 2XVNA 2CCRA 2JF7A 3CMFA 4KFOA 1K6WA 1EHNA 4F79A 3T0DA 3W1AA 4KEVA 4IP7A 4KKXA 2EJ1A 2WPBA 3L4VA 2YBVA 2B0MA 3WNKA 4WF7A 5A6JA 3MY9A 5HULA 1OWQA 4OECA 4XTIA 1K70A 2ACRA 3LHUA 4AH7A 1RJQA 4C5YA 5D02A 4GY7A 3GAYA 2AOSA 1XYAA 3DN5A 3DBNA 3MUXA 1KV8A 1XH2A 3VKAA 3MKKA 1J12A 3ARPA 1MVYA 4C60A 5FSEC 4B2DD 3AZTA 3ZR6A 1K8XA 3OG3A 4RZ5A 1TPH1 1VFFA 3UCQA 2HBVA 3APGA 1RZMA 4GH1A 5LNVA 3I6EA 4B3ZA 1Q6CA 2E28A 2HWGA 4QG6A 2V30A 3F03K 3AYVA 3GXFA 4S3AA 3VZZA 4I9JA 3OVQA 1B3VA 3S4TA 1VFHA 3BAIA 5LIWX 4L1XA 1KXTA 4AEEA 4DY1A 1E0UA 3CUXA 1FTXA 5IHRA 3N2BA 2WVVA 5KITA 3N73A 4K6AA 4KRUA 1XRFA 3H7RA 1G01A 4CNTA 2IXUA 1EJTC 1RHCA 3VMPA 4UMBA 1J0HA 1TX0A 1EOKA 5FF2A 1WZLA 4JTEA 5AECA 2JQXA 4MZ1A 3QXBA 4IJBA 4UIOA 2XDFA 2R1NA 3VFLA 3SQLA 2J9XA 3N2OA 5LA0A 5EFFA 1SPQA 4ZCWA 5M5DA 4S38A 4B5UA 4IGHA 1R9XA 4Q4MA 1GUVA 1TFVA 4F0MA 3CQ0A 2YZ5A 4LB3A 3QLLA 1VFMA 4AIOA 3F4CA 3W1UA 1FQ0A 3CHCA 2E25A 3H7UA 3KVKA 3U8GA 3W29A 2GQ3A 2E6YA 2GSEA 4G9PA 5FIPA 1G1YA 4C1NA 1TPVA 5A6BA 2H6RA 1FWCC 3MCMA 4IQDA 4W85A 4GKTA 2XGIA 5FJUA 5BWAA 1Q7MA 4ICCX 3KZSA 4K1GA 4DJFD 4BF9A 3K4AA 2NUXA 4PTVA 5CC7A 4PZVA 3AWNA 1V3MA 3WMSA 2ZCGA 3Q58A 2C1GA 3P93A 3WUBA 1UD4A 5C6MA 3W7NA 1OGGA 2ZUVA 1X7IA 1PBGA 4FIQA 3H2CA 2DGAA 3WBAA 3V0SA 2PS2A 5AYBA 1IYXA 2WMIB 1XRVA 3W1MA 4ZQNA 3S2LA 4P8WA 1XPGA 2EAWA 2PP3A 1Y5WA 4KT2A 5DRIA 1QDSA 3WLKX 2VENA 2NQJA 2YB1A 4FNSA 1QBBA 1YPIA 3QFEA 2C18A 1RVKA 1O1ZA 1N82A 3HGRA 3EWZA 2WO5A 4RE0A 5KINA 4PRTA 1GJWA 3CB8A 3VYLA 2WSRA 1JGIA 1KFBA 1U22A 1T99A 1XKJA 3KHJA 4GPNA 3RM9A 2RAGA 2VC6A 1SMAA 2X0SA 1SQ7A 1EC7A 1NU5A 1W1PA 5EBAA 3NQ2A 2OZ0A 3IUIA 4FLOA 1KRAC 2ZX8A 3LEPA 4X2PA 1XLJA 1GT8A 3ITGA 2Q09A 4DPQA 1UMYA 3RX2A 3BMXA 3S1VA 2INFA 4O16A 4EACA 2GSJA 2QJGA 4GY0A 1AG1O 3ATZA 1DHKA 3E49A 3TW7A 3W22A 4IX0A 3CHFA 3DBPA 2XZ7A 1K8CA 4EE9A 3WLLA 1TV4A 1JZ8A 5ABTA 3CUGA 1JR1A 5EMUA 2CERA 1UKTA 4GISA 4B5XA 3W28A 4CNOA 1YHTA 1CGWA 5DCDA 1H5YA 4LJ3A 4CD4A 4Z2KA 3UWUA 4PUMA 1EEXA 5DRCA 3FVMA 4LEQA 5DQPA 4MOZA 1W3TA 4N0RA 4BWLC 3L4WA 1RA5A 3TIMA 3O07A 4MB1A 4L9ZA 4IPPA 3VIJA 2E8YA 3FDKA 3FFSA 4UTIA 1OX5A 4NKCA 1TJ2A 1R6WA 4IGNA 2ZZ2A 4ZODA 4PR4A 5H8UA 1UR0A 3M64A 4CD6A 2XGBA 3KOWA 2OWCA 2NV9A 1KTCA 2FIQA 4JYFA 4C6FA 5C2XA 1UD3A 4P7OA 1JVNA 4BQ3A 1W5QA 4KRZA 2ZC8A 3NWRA 3V75A 4RZ4A 3AXKA 4ADTA 3RFAA 4CNNA 3GHUA 4TIMA 5JBFA 3VKBA 3W7IA 4PCPA 4A8LA 4GBUA 1OC7A 3N2TA 1J6PA 1G0CA 3VKJA 5BNKA 3CASA 2WNNA 2WC3A 1FWBC 3CBWA 2VCBA 4TVUA 5I79A 4RXFA 2G3IA 2V0TA 4DNHA 3KP0A 2P0OA 1LQ2A 3GAKA 5DXXA 3SCPA 2OO0A 4IUGA 1F6PA 3M6YA 4E2DA 1GVRA 5D9MA 1UW9A 3UZYA 1V3KA</