5K9CA

Crystal structure of human dihydroorotate dehydrogenase with ml390
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
362
structure length
354
Chain Sequence
b'ERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Homo sapiens
publication title Development of ML390: A Human DHODH Inhibitor That Induces Differentiation in Acute Myeloid Leukemia.
pubmed doi rcsb
total genus 139
structure length 354
sequence length 362
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2016-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5k9cA00
3PG9A 2ZZ7A 2J88A 3RU6A 3S42A 2I14A 1G7VA 1K7FA 4ML9A 5DN1A 3CEPA 1JCLA 2GJLA 2Y62A 3WJYA 2DZXA 4DBDA 1SO4A 2FIQA 3M47A 4GBUA 5BRBA 1OYBA 4LNYA 3S5OA 4UTTC 4DF0A 3LRMA 1X1OA 3HO8A 3S1VA 4HPJA 1NVMA 2YGYA 4FO4A 5CPNA 2HSAA 4XZ9A 1KFKA 2VEPA 5FEXA 4GRSA 5EY5A 1I45A 2GQ9A 2QCFA 1PV8A 1MXSA 5F2MA 3O8AA 3TH6A 2D73A 1J2WA 3EXSA 4UXDA 4Z1DA 4EIVA 4LWWA 4MVAA 5FI8A 3C0JA 1OFEA 2H6RA 4IMCA 1TTJA 1W1ZA 4HNVA 5F1UA 4RKAA 1W5OA 5KZEA 1WYIA 4UTWC 3QMSA 4RZ5A 3MMTA 5CPLA 3UXDA 3EX4A 4UFIA 1SSGA 4Y6GA 1WX0A 3SFKA 3LRKA 2E09A 3M5VA 4BF9A 3LCHA 2YFOA 3M5XA 4TMCA 3OVQA 1J4EA 4UMAA 2QCMA 2A0NA 3LLFA 3IEBA 1BWLA 4DQWA 1I4NA 4BK9A 2C16A 4ORIA 3HGRA 5I3KA 4LTSA 3QW4B 3W1NA 4HNUA 2WNNA 4W9TA 4A2RA 1I2PA 4E2BA 3C2RA 1H62A 4QM1A 3C2OA 5L9FA 3ABSA 1BKSA 3EX3A 5I3HA 5FF4A 3GYEA 2DORA 1H61A 5LNVA 5HMSA 4N02A 5TBOA 3LV5A 3FIGA 1K7XA 1OFQA 3P5ZA 5MHBA 1QMLA 3W22A 1CI1A 1W54A 4TU1A 1MZHA 3KFTA 3U6WA 2FPTA 2NV2A 2TPSA 1YXDA 1ZFJA 1AG1O 3GDKA 1YDVA 2J9XA 1AMKA 3P84A 3UXAA 3WJWA 3LHWA 4NJGA 1DV7A 2E5BA 3B0VC 4X9SA 4JDYA 2PCQA 4N2YA 4ZQNA 3MP4A 4QJ1A 2P1FA 4UR7A 2E77A 3IGUA 1OYCA 4L4MA 1QDSA 4Q33A 1VCFA 3HG4A 1GJPA 4K38A 1KM6A 3NQFA 4NUWA 2VFDA 4ZVJA 3G8RA 3L67A 2R14A 2GVLA 1F74A 1FWSA 2V2DA 3HJZA 3TDFA 1KM3A 5IBXA 3CHVA 1XBYA 3GZ3A 4PEKA 4O14A 5EL1A 2E5CA 1ICPA 3IIXA 4WY0F 3THQA 2QJIA 2VEMA 3P62A 3QC3A 1B4KA 4IOTA 1QO5A 2OJPA 1P4CA 1TQXA 1W31A 2CLOA 4UTJA 1KM4A 1XBXA 4P2VA 3UQNA 5FF7A 3S1UA 4JD4A 1T8XA 2OX1A 1LOSA 1AW2A 1M5WA 1TPDA 3TX9A 4WXYA 4O28A 5FEWA 1HL2A 1HG3A 4PC8A 1W0MA 1OJXA 1VCGA 4MIMA 5LGXA 4QITA 3L5MA 1OFAA 2H3DA 2VKZG 3HPXA 4O52A 4MLJA 5D2XA 2A2IA 2OMAA 2ZRXA 3TSMA 3OBKA 4UTMA 3QPZA 1VRDA 4H4IA 3LLDA 2P10A 3DBPA 1LCOA 3CEUA 3EKZA 3W84A 3G1AA 3W7PA 4K6AA 1KBIA 3W7DA 4BWLA 3D0CA 1O5XA 3W7EA 2BLEA 2OT0A 3TSDA 5BMXA 2GQ8A 4D2JA 3NAVA 2DZWA 2CZFA 2PRMA 2VFGA 1XM3A 5H91A 1DHPA 3GNDA 5K9CA 1B57A 2VFEA 3E0IA 3VE9A 5LKYA 1H1YA 3EXRA 3LXAA 4LS2A 4AEOA 4K37A 5AOUA 1E51A 1XCFA 1QOQA 3IIPA 1EB3A 1FWTA 1LZOA 5CZ0A 5HWMA 3LI0A 4NJIA 1TJPA 1O4UA 3PB2A 3TXZA 3W1TA 1P0KA 4O19A 1PHQA 5G2IA 4UTKA 2Y89A 3F4NA 1ONRA 4NZJA 2NZLA 1R2TA 3GKAA 2ZZ6A 4UFMA 1SFJA 4AAJA 2QAFA 4HHPA 4XTIA 4IPJA 3G3MA 3IGXA 3FYOA 5F2LA 4HNTA 1F6KA 1FUYA 2FPVA 3C56A 1K03A 3E49A 3O05A 3W2UA 1TPB1 3SY5A 1TYGA 4O1DA 5LHEA 3NQGA 4AHPA 4UUIA 1VYPX 3MI3A 2ZRUA 4XBKA 3WFAA 3LCIA 2Z2UA 1QO2A 1MEIA 4RX0A 3W9ZA 3EX1A 4LV9A 1RD5A 3TAKA 2V0TA 4MFDA 2DJXA 1ZNNA 1C29A 3LXBA 2A7PA 2J6XA 4AWTA 1QPQA 3T7VA 4NJJA 2ZCGA 1SR9A 3GIYA 3C3NA 3NZ1A 1DOSA 3STFA 4O4WA 3W73A 3A22A 4DXVA 3QW3A 3H54A 2EPHA 1H60A 4B5NA 1TPWA 4GUJA 3LCGA 1YYAA 2ABAA 3JS3A 3Q37A 3B04A 3MHUA 2OCZA 1XC4A 4IMFA 4DELA 3PF3A 3STEA 4XKYA 3W85A 4Y8FA 2TMDA 1FQ0A 1QCWA 1W3TA 3T78A 5LGZA 4R33A 1RQHA 4DF1A 4JTJA 4M6PA 2BZNA 1Q6LA 3E9AA 3TC7A 3TSBA 1N7KA 4FB7A 4ICNA 1K8XA 2QCGA 3G1SA 1FDJA 5HWJA 3SGZA 1A5SA 3MP5A 2QUVA 4O1CA 2WSYA 1LBFA 2V9DA 3NNTA 3NPXA 4LVAA 3NPVA 2Z6JA 1OX5A 5J5DA 3VE7A 3OA3A 1LYXA 3DI1A 4GNJA 1L2UA 4FNSA 1JCNA 4ZQCA 4Z1AA 3DH7A 1W8SA 5CGQA 1HUVA 2X1RA 1G4SA 3EWZA 1QPRA 4O0KA 4PCFA 4O11A 5BOOA 1H50A 2ABBA 3MHFA 4IGHA 4CCEA 1EP2A 4L4LA 1G4PA 3P80A 5CG7A 4I9AA 3UPBA 5LSMA 5AYYA 3KHJA 4ZL1A 3W7OA 4FX6M 3L9CA 3UWYA 3IRDA 3P8JA 3M6YA 5EMUA 2IQTA 3GLCA 3JRKA 1SPQA 3MI6A 1P5BA 1YPFA 3QM3A 1CW2A 3GXPA 3NL6A 4RXFA 3BV4A 4RXGA 3DFPA 3LCWA 1QFEA 4IX2A 3TW7A 4CQ9A 1XL9A 3INPA 3MHGA 2FPYA 3LX9A 1DJNA 5DCDA 4FXSA 3C2VA 1Z42A 1DQWA 5E1QA 5HNRA 3IIOA 3VCRA 3BO9A 3RK8A 3OG3A 1TV5A 1JQVA 1KLYA 4MZYA 4DEFA 3PAJA 3LHYA 1G4EA 3PWAA 4JYEA 1EP1A 5D30A 1M7PA 4LUIA 4IXHA 1F5ZA 4IPIA 3CWNA 4NZFA 5G1TA 2JGQA 4CQ8A 3NQ2A 3QPYA 1TSIA 5DY2A 1IIGA 1KFEA 2Y61A 2V30A 4NXKA 4JDBA 3IVTA 4BI7A 3KOFA 2C0AA 2X1UA 1KFCA 3DGRA 1EPXA 1NFBA 3S6DA 1ME7A 5SWUA 5U4NA 1GVQA 4K39A 5F4SA 1L6SA 4DO6A 3G8EA 2QAPA 1L6WA 4U4MA 1SUXA 4G1KA 2A5HA 2RHGA 1J5TA 1T99A 2E6YA 3N19B 1PVNA 4ADSA 2X2GA 1ALDA 1A50A 1VJIA 3A9IA 4UFLA 4A22A 1R30A 4MYAA 1QPNA 5A5WA 3TQKA 2YR1A 3N2XA 2TRSA 1UUOA 3G1VA 4UFJA 1PL9A 2Y70A 1W3NA 5EA9A 4S1FA 1F76A 1WAUA 4AF0B 4X2RA 2DZPA 3JR2A 1SO3A 5AYXA 3GDLA 1L9WA 5K4XA 1LRNA 3W88A 1WXJA 4KWWA 5K4ZA 4N6EA 2TSYA 4Z1BA 4AXKA 5D2TA 4U28A 1GVOA 1WDWA 1GVFA 4QNWA 3C2FA 5G4EA 1SZFA 4HIBA 3S0CA 2B4GA 1Z41A 1LLWA 1C9DA 4BI6A 3KXQA 4UMBA 4PFMA 2XN2A 4WXZA 3FS2A 1EWEA 3UYCA 4YL2A 4CLMA 3TFXA 3PSVA 5C55A 2PRLA 4BWLC 1TV8A 1DQXA 3G22A 3P74A 4NNBA 3GR8A 2YPIA 2FDSA 2QJGA 4NQ1A 5AHMA 3P67A 3CIWA 4M6VA 3RF9A 2NUWA 4ADTA 2HTMA 2Z1BA 5DBTA 3W7NA 2V2CA 1VYSX 1PHWA 3W83A 1OX6A 1ZENA 2WV8A 3CC1A 2Y88A 4JY9A 4DBEA 2QCHA 4ALDA 4WZHA 4JIQA 5I3GA 1OVDA 1B3OA 4AVFA 3B4UA 3NA8A 4JNMA 3SIZA 4HNNA 3CLMA 4BFAA 1RPXA 5D2WA 3BARA 1OFBA 3S9YA 4GXMA 3TW6A 3TUUA 1B9BA 3IVUA 2QF7A 4UCGA 4UTTA 2WNZA 3L5AA 1TV7A 1NEYA 4UNKA 3IIZA 4ZQPA 1JQXA 4N9DA 4PH6A 2FTPA 4JTEA 1L6YA 1O60A 3KVKA 1AW1A 2CLFA 5HR7A 2ZTKA 1KFBA 4O16A 3LHZA 8TIMA 1FX6A 4KFPA 3QFEA 2OT1A 4PODA 3P7YA 2DZUA 4O57A 2PRHA 4WQ6A 3P8IA 1OX4B 1VS1A 3LHTA 3TK7A 1GOXA 5D2VA 4TO8A 4S2BA 4FNTA 2ZFAA 3ATZA 2Y85A 1ZAJA 2YDAA 1TREA 3NQ6A 1EUNA 1TPVA 2CZDA 3FFSA 3UNDA 2E68A 1FY6A 3NQVA 4ORMA 4QSHA 3W86A 1RQBA 1XFBA 3N2MA 4JS3A 2C14A 5DELA 3TJLA 3CTLA 3L68A 4HT3A 2A85A 3CU2A 1GVRA 4LU0A 5FEZA 4HN4A 4EOUA 2WO5A 2WOQA 4M6QA 1YXCA 3T55A 3CT7A 2C18A 4OV9A 2VENA 5D03A 2ZA3A 5ABTA 1GVSA 3LRLA 1FWNA 1DORA 2CLEA 3LI1A 4ZQRA 3G18A 1MSSA 1A5AA 5LNUA 3MJYA 2J24A 3W1QA 3A24A 3NL3A 4NVTA 3MBDA 1SO5A 4K8HA 1AL7A 3QSRA 2CLHA 3GNNA 3T44A 3CWOX 5LHFA 2XFWA 3W2KA 1VH7A 2YSWA 1H7XA 4QQ3A 3GAKA 1KBJA 3NQMA 2AGKA 3BG3A 3NQ8A 3R13A 1YLVA 2A4AA 4LVDA 5CSSA 1TPUA 1FWRA 1BEUA 1RQEA 3W1AA 1TTPA 5C5YA 4LRSA 3OVRA 2C15A 1VLWA 1ME9A 3O6YX 4JICA 3GX9A 2ZZ1A 2PC4A 4O0ZA 1MEWA 1OABA 1EX5A 1FCUA 3UWUA 3W1RA 2WQPA 3WJXA 3TMLA 3T4CA 1DL3A 2YXGA 4JTIA 1OFOA 5DXXA 4YCOA 4R34A 1A53A 4KWVA 3KRUA 1SZGA 2YW4A 3UY7A 2GQAA 3N9RA 1GEQA 2X16A 5HQEA 3AJXA 3CB8A 2B0MA 3DENA 3LV6A 4J9JA 1LOQA 2VXNA 3FEMA 3GK0A 4DO5A 1P0NA 1W3IA 3MYPA 1IGSA 3G1HA 4FEZA 4JTGA 2QCDA 4GUGA 5BNKA 2E5DA 3A21A 2UV8G 3BLEA 5GVJA 2J9YA 2Z6IA 1SU5A 2KZHA 1K3UA 2WSRA 4LVBA 5DBUA 4WUIA 5K2ZA 1H7WA 4KFNA 4POCA 3W23A 3LTYA 5AHEA 2EAWA 7TIMA 4XQ6A 1PS9A 2NUXA 4Z0JA 3HGSA 3BW2A 3EX6A 4JYFA 4N4QA 3LCLA 2J9ZA 1NF0A 5BMWA 5F2IA 2AAMA 5HULA 4Y9AA 3L65A 1G67A 3H53A 2ZA2A 4LVFA 3SZ8A 4DO4A 4JTKA 3EWYA 2ISVA 4YMZA 3O15A 4CCCA 3PBYA 2J27A 2Q3RA 3QRHA 4O18A 3C61A 3DXIA 5K9XA 4CNPA 3F1QA 3GDMA 3DFQA 3KVMA 3TNOA 4MUZA 4OBTA 3P81A 3L0GA 4JX6A 2F7FA 4LC8A 4Q4KA 4PL1A 3P82A 1M7OA 3WK2A 3W7RA 1EEPA 3WJSA 1GT8A 5D05A 1HTIA 2A21A 3P61A 5BW6A 3DHFA 1PCWA 3PSWA 1WV2A 5HUOA 1W56A 1ZAIA 4EVZA 2O7QA 2NWSA 2VOMA 1XDLA 4AWUA 2V5BA 2Q3OA 1I2QA 2CZEA 2GPTA 2ISSA 4A29A 5K3VA 5AHIA 1QOPA 3L21A 4CNOA 3DKLA 2DZSA 3UWWA 3HGOA 3L66A 3UY8A 2NXIA 1XUZA 1LRTA 1ZHAA 3PS7A 3USBA 4CNNA 3W7LA 2V5LA 2NV1A 4NX0A 3V1PA 4LC6A 5FF0A 1JCYA 2JKPA 4EF9A 4K7VA 3W7JA 3S1XA 4NJHA 3S5ZA 1FDYA 1H7RA 2Y7FA 3DFOA 3IV3A 3VFLA 3G1DA 1K8ZA 1DBTA 3BG9A 3UPWA 2CLMA 4FNQA 4AH7A 5EBUA 2B7OA 1D3GA 1TPH1 2Y6ZA 2CZ5A 6TIMA 3M0ZA 2H8ZA 2ZZ4A 3IIVA 3LXCA 5AC8A 2YYUA 4RCXA 4IUOA 4O1AA 3RLUA 1Q6OA 2C6QA 2JK2A 3DHDA 2I9EA 2ZRYA 3S5YA 1YTKA 3MO7A 3W2MA 3O63A 3G0SA 5HJLA 4MJMA 5K7JA 1OX4A 4FIRA 1K8YA 3SI9A 3O16A 3O06A 4O10A 3M7WA 3NG3A 4OWGA 3HG3A 2V81A 3S8HA 1KV8A 1TPFA 1KA9F 2G96A 4MOZA 5F4XA 3BPWA 3GKFA 1JCJA 3W07A 3HG2A 3M9YA 1ICQA 2QCEA 3NGJA 3GAYA 3QZEA 4OHQA 1RV8A 2V82A 2WPBA 4RZ4A 1LM1A 4IMEA 5HWNA 1N55A 1H7PA 3R5EA 3LB0A 2ZRZA 2VC6A 3TJXA 5F1VA 4X22A 1GPWA 3EWUA 1FBAA 2Z0IA 4UIOA 3NO5A 1SO6A 4OV4A 2RDTA 2DU2A 4NT0A 1O94A 2ATSA 5D32A 1S3HA 3NPWA 3W7HA 4N9BA 3NM1A 3C4UA 4FX7A 1F6PA 2Q8LA 4WOZA 3NPUA 3W1UA 5G5IA 3L5LA 5AHNA 3MI2A 4JTLA 1QAPA 3W2NA 1A5BA 3BLIA 4IMDA 4RV8A 3KAOA 1VPXA 4ONVA 1AK5A 1TTIA 1R2RA 1TQJA 1H7NA 2E1DA 5AN7A 1I2RA 3ZFHA 3ZR4A 3B05A 1Q45A 2CFFA 1LORA 4E38A 2VFFA 3M44A 4OQVA 5IM51 4LUJA 2R91A 3E02A 3S5NA 2ZDRA 5FF3A 4MKNA 1FCVA 3W87A 3KVLA 1SW3A 3R8RA 4ZQMA 3NL2A 1KTBA 3G1YA 4AMAA 1GG1A 5KZDA 1Z48A 3K30A 4NXSA 4TR9A 1JUBA 5EYWA 2HMCA 4JXCA 2W79A 1XXXA 3O6DA 3PUOA 1GZGA 1ZY9A 3L0KA 3MUXA 4O17A 3DAQA 3NQDA 3AO0A 4A2SA 1KM1A 2G97A 4CQAA 4PTNA 1PCKA 1R46A 3ZWTA 2TYSA 5I3FA 4PL2A 2V8ZA 3G0UA 3WK1A 1YADA 4MYXA 1Q6QA 4K8EA 1YDOA 2CU0A 1KW1A 2EF9A 3CPRA 3PBWA 3W1MA 2VFIA 4UMCA 3QQ0A 4UTLA 5D37A 1UUMA 5A8GA 4UTIA 3A5FA 4LW7A 3SGUA 1LRQA 3H55A 2LLEA 4JX4A 1H51A 3O6CA 2G95A 4LOCA 1FXQA 1GTHA 3E12A 3FJLA 4KKXA 4P61A 3PBVA 1LTDA 4NJKA 2ZRVA 3IVSA 4IXXA 2QEZA 5G4WA 3W1PA 3ATYA 4GJ1A 3RFAA 1OF6A 1ZAHA 1XBVA 2NLIA 1GQNA 5LNSA 1UCWA 2DZTA 2XN1A 1GTEA 4YXGA 5LZLA 1JCMP 3BGGA 5C54A 5G2HA 1XI3A 4H6KA 1ZJIA 3ANYA 3OHIA 2AQWA 5KMYA 3TXVA 2C1HA 3LBMA 3EXTA 3UD6A 5H2ZA 3ABQA 3E96A 3DFTA 3P60A 1ZALA 4GWEA 1KFLA 3B0UX 2EKCA 1NF7A 1LROA 3NQ7A 3SR7A 4OE7A 1F73A 3A5VA 5G2WA 2WNQA 1FXPA 3W3OA 2VELA 3EB2A 2BX7A 4LS0A 1QNVA 3EWBX 5HINA 1O95A 1G69A 3I7RA 3PBUA 2RDUA 3FA5A 3BGJA 1IXNA 1KTCA 4E0CA 3W6YA 2B7PA 3Q2DA 3NXFA 4JGDA 2QCCA 3G24A 3EWWA 1BTMA 2Y7GA 4K36A 4XUGA 4IMGA 3LHVA 1C8VA 4RZ6A 1XUUA 2B7NA 3DFNA 2QCLA 4GFSA 2ZTJA 2B7QA 5KZMA 2X30A 4ADUA 3QF0A 4MPQA 4LVGA 3W2LA 1EP3A 1W5MA 1LLZA 4WD0A 1H63A 4XKYB 5TQLA 5D04C 2GJNA 3I6RA 3W2JA 3BW3A 3HPZA 2OZ0A 3LTSA 3HG5A 3U8GA 5I3IA 3W7IA 2P0OA 1ML1A 4E2DA 1JULA 3G1FA 4FNPA 4MFEA 3TR2A 1M6JA 1DKWA 1VQTA 5AFDA 3W70A 1LOLA 4JX5A 4IWWA 3DZ1A 3SSJA 1S5TA 4UR8A 2QCNA 1UJPA 5CKSA 5HR6A 1VHCA 5C6MA 3I68A 3EX2A 4YCPA 1OK4A 2JKAA 3B8DA 3TROA 3HBLA 3M16A 2PE4A 3DU0A 3G1XA 4Z0SA 3HF3A 4N6FA 3LTPA 4DPQA 3GXNA 3QH2A 3TV8A 2RFGA 5LNRA 1VC4A 2ZQ0A 2C3ZA 3QJAA 5EPDA 4O8RA 4NU7A 5FESA 1GWJA 1WA3A 2ATMA 1Q6RA 1QPOA 4QAIA 1W5NA 3GB6A 3NVTA 2ZA1A 3UZJA 2BTMA 3C6CA 3DI0A 2JKEA 3UWQA 1RZMA 1T0OA 2F84A 3TE9A 1W5QA 5D38A 1KM0A 2A1YA 2BXVA 3I7QA 1W5PA 1OFPA 1OK6A 1T96A 4AB4A 4WOQA 5CPOA 1P1XA 2O7SA 1JUKA 4HKPA 1K02A 3G3DA 3W7GA 4M7SA 2ALDA 1F2JA 1KTNA 3KX6A 3SJ3A 3NR0A 3V75A 3PUDA 3QMRA 2HS6A 4JTSA 4LS1A 4RR4A 4IQLA 1QWGA 4O15A 5F2GA 2EGZA 3FJ6A 3B06A 3VKJA 4FF7A 1VYRA 4DPPA 1OF8A 1JJKA 4RK8A 2ZZ5A 2HS8A 4O53A 2H8XA 3TKFA 1AL8A 3KRSA 1S5WA 1BWKA 2QUTA 5AYZA 4N4PA 4JTHA 3EKLA 3BW4A 1ICSA 3Q58A 4Z1CA 1G4TA 1WQ5A 3CM4A 3STCA 1D9EA 3Q94A 4GUIA 5F4WA 5CZSA 4R53A 1D3HA 3B0PA 2V2HA 1G7UA 4JTUA 1ZCOA 3EEGA 1XKYA 3C52A 3LERA 3N3MA 2NX1A 2NXGA 4FIQA 3ZWSA 3TMQA 1RVGA 2ISWA 4O12A 1TRDA 3W7QA 1ADOA 4O50A 4C1LA 1TO3A 5KSWA 1CX9A 1UASA 3WK0A 3W71A 4WX2A 2JBMA 2EHHA 4UTHA 1I8JA 4MLRA 1F05A 1TPC1 4O13A 1GYLA 1JRBA 1UB3A 1Y0EA 3GVGA 3F4WA 5KTLA 4Y90A 2FJKA 3PUEA 3QMTA 1OHLA 2W6RA 1VHNA 2Q8ZA 1HO4A 4Z08A 3ZS4A 4HPXA 1KM5A 3MBFA 3RLVA 2FB3A 3W1XA 3ABRA 4LY8A 3TQ0A 3TAOA 2RH9A 2X1TA 2YZRA 1JRCA 1UBSA 2GVJA 3TFCA 2R94A 3NOEA 4MY8A 5KINA 1VGAA 4UTUA 4HSNA 1IIHA 4QNEA 4LV4A 1X1ZA 3BG5A 2QJHA 3L2IA 4K7YA 3HMJG 2GVGA 3STGA 1KLZA 5D2YA 1XDMA 2A7NA 5FF2A 4ZZ9A 2CW6A 1WOBA 4XBSA 1JR1A 1JUEA 3O07A 4YWIA 1N8FA 1VZWA 4UNLA 1A5CA 1H7OA 3PG8A 1YPIA 2XN0A 2WJZA 2W0UA 3PC0A 3BVJA 1WBHA 2ZZ2A 1GG0A 5CSRA 2YW3A 3HB9A 4TIMA 1OG0A 1S5VA 3QQ1A 4EF8A 1YXYA 3R2GA 1HFBA 3HIJA 4ZQOA 3NL5A 1TIMA 4PA8A 2NX3A 1FDZA 1MEHA 5DCBA 2FQIA 4LT9A 2FFCA 3R89A 3PULA 4M7TA 1XBZA 4MZ1A 1DJQA 1H5YA 2WSQA 3N73A 1TCDA 5E0KA 2QCDB 3MWAA 1H1ZA 3P5YA 3TIMA 4GUHA 4KFOA 5D02A 2ZBTA 1SFLA 3N9SA 1NSJA 3NM3A 3UZ5A 1B4EA 4JIPA 2GOUA 2BWGA 1I2OA 2C19A 4TX9A 5LNWA 3R12A 3N14A 2DP3A 2NXHA 3FKKA 5DXYA 1FCQA 3TC6A 4IJBA 3WK3A 5DCEA 2YCEA 5AHLA 3RNDA 2X1SA 3S1WA 2QR6A 3N34A 4R7JA 1PE1A 2FB2A 1FCBA 4X3ZA 1Q3NA 3MYOA 4GE8A 3M41A 3TA6A 3W75A 3DFSA 2I1OA 4FNUA 2A7RA 3L0NA 4NNCA 3W7KA 3ELFA 5AC7A 2VEKA 2YX0A 3MP3A 3TCEA 3QSTA 4GUFA 1YDNA 1X7FA 3FOKA 2PURA 3M43A 1IXQA 3GXTA 1G6CA 1LDCA 1EUAA 1QR7A 4UTWA 1MO0A 3LCFA 3LHUA 4NNAA 3A23A 3QYQA 4I7VA 3PY2A 1KV5A 4QISA 1R2SA 1V7YA 4S2CA 4LRTA 3W7MA 1GYNA 4O54A 5CPMA 2NWRA 3F03K 1IF2A 4O1BA 3W72A 3HGJA 1OFDA 3LOTA 2G5WA 4MY9A 3UWVA 1TRIA 4CCDA 5L6UA 1PIIA 3ABOA 3T40A 3W74A 2A6NA 4OGZA 5TIMA 4GC4A 2E6AA 3C2EA 3GDTA 1NAL1 1IXOA 1X8FA 2BSLA 2JGYA 3WJZA 3RMJA 4N9CA 3EWXA 1SSDA 1TJRA 1SW0A 1YTDA 3DKJA 4WY0A 4XWUA 1Z44A 5HUPA 1LBMA 4IX0A 2DJLA 4JEQA 1EA0A 4JR5A 1HO1A 3GDRA 4M5PA 1SW7A 4FNRA 4FX8A 2FLIA 5DLCA 3IGSA 1OFRA 3M5YA 3BLFA 3LBCA 5G1YA 5T26A 1F7BA 2CLLA 2CLIA 4XTDA 1VLIA 3QEZA 5I3JA 4JTFA 4A3UA 3OIXA 3O1NA 1OYAA 3TU9A 3NEVA 3I7SA 2CWNA 3PB0A 1RR2A 2GUUA 4WJEA 2VFHA 1ME8A 3NYZA 3TQVA 2H3BA 1JVNA 2VEIA 1K7EA 2Y7DA 2QDHA 3BK0A 3PM6A 5CZTA 4ZMGA 5D33A 1IXPA 1TTQA 3LM7A 4AWSA 3G0XA 5EKYA 1KFJA 4FHAA 4MY1A 4I7UA 4FXRA 1VR6A 3CIXA 4JTTA 3W76A 4BR1A 1I2NA 6ALDA 1VCVA 2R8WA 3HOJA 4UC5A 4Y96A 2QKFA 4C1KA 4HSOA 3NQEA 4AHOA 4OT7A 1TPEA 3SW6A 3M5ZA 5K9DA 1EIXA 4A21A 1U83A 3NQCA 5FEPA 1WOAA 3LDVA 3NZRA 3KVJA 2ZYFA 4I7WA 2QDGA 3UWZA 4N9EA 3C8FA 2ZZ3A 4MZ8A 3NQAA 3CQ0A 3SECA 2Y7EA 3OEXA 2NUYA 3OVPA 4DF2A 1V5XA 3PVFA 4WY0B 4M19A 4YLWA 4JN6A 2E6FA 4TMBA 5AB3A 1WBJA 5C2XA 5J5RA 2DZVA 1LBLA 4UFHA 1U5JA 3FLUA 2RDWA 1LP6A 5DY3A 2C13A 1TB3A 3VNDA 4H3DA 5KITA 3NDOA 4JYDA 4O4VA 4AF0A 4UFKA 5AHFA 4JY8A 4QIUA 3VI2A 3U2OA 2QUUA 2E6DA 2A6LA 3PR2A 4NX5A 3MW7A 3W1LA 2RKXA 3B03A 3THAA 3HPSA 4BI5A 3YPIA 3FKRA 4EWND 1SQ7A 1DVJA 1SZNA 1TMHA 1KM2A 1THFD 1X6UA 3I65A 1JCXA 2ZRWA 1R47A 2CLKA 5AC6A 1YTEA 4RLIA 2H90A 3LCXA 1AW5A 3M1ZA 5E93A 2YFNA 3GR7A 3LGEA 3FYPA 4AHQA 2Y63A 1FWWA 4RJEA 4OU1A 2YYTA 2NX9A 3KRZA 5CZJA 4Q32A 3W7CA 5IBXC 5U7SA 2WKJA 1EWDA 1SZEA 1W37A 3HQ1A 5D09A 1O5KA 4MJZA
chains in the Genus database with same CATH superfamily
3PG9A 1OC6A 5TAOA 2IKGA 3G6MA 3LZ3A 3RU6A 3BAIA 2VRQA 4Q6XA 4B92A 2Y62A 3WJYA 1TV3A 4PUNA 2XZ9A 1SO4A 4RNFA 3EMZA 3M47A 4GBUA 5BRBA 1OYBA 1XGZA 6PTDA 3S5OA 1S39A 4V33A 1QI0A 4AYGA 2WCAA 3WF0A 5C9RA 4HPJA 1NVMA 4HD5A 5BWFA 2MNRA 2VEPA 5ABHA 2QCFA 2GQ9A 1PV8A 3B8UA 2D73A 3EXSA 4UB9A 2ZUUA 4UXDA 1QI4A 3C0JA 1XS2A 4B5UA 4PTWA 1W1ZA 1MDRA 3UJEA 2X8RA 4HNVA 1NFGA 1W5OA 4L1XA 4O1EA 1E5NA 2PTDA 4P7NA 2QW5A 4I8DA 3UXDA 1OIMA 1SSGA 3ITCA 3SFKA 4H6RA 5C9ZA 1J10A 2E09A 1VBJA 3T0BA 4FXFA 1YIXA 3QR1A 4TMCA 3T0CA 4J40A 3LS9A 1BWLA 3KL0A 4K68A 2C16A 4C6CA 4Q6JA 4US5D 4ORIA 3P6LA 5I3KA 5IXEA 3RPMA 3QW4B 3CUIA 1ISYA 1POKA 4JNYA 4PMYA 4CD6A 1VBHA 5L9FA 3AYRA 2Z1XA 4HK6A 4RDWA 2W9MA 4QRNA 2O4MA 5HMSA 3LV5A 4JIIX 1K7XA 3K2GA 1I1WA 1IEIA 2YBTA 2BHYA 2FPTA 4ZOCA 4YHGA 1AG1O 3CAWA 5HAOA 4KEZA 2RJHA 4HZ7A 2PCQA 1SJCA 1MRQA 3MP4A 4R9OA 2E77A 3IGUA 1Q85A 4L4MA 1VCFA 5DEZA 2F2KA 4GVFA 4NUWA 3I3EA 4ZVJA 1MQPA 1F74A 2V2DA 1C91A 4O8AA 1KM3A 1SJBA 2HWGA 4Q22A 2E5CA 2J7DA 1UH2A 2QJIA 3UGVA 4DZ5A 2VZOA 1JAEA 3KL5A 2FGLA 1NIUA 2CLOA 4UTJA 1KM4A 3H7UA 3VDHA 3S1UA 4JD4A 5JVLA 3WH9A 1LOSA 3W0KA 4AZGA 2BY3A 1M5WA 3TX9A 4O28A 1HL2A 1SZRA 2GGGA 1VCGA 2D2JA 4EPDC 4TXEA 4FK9A 5LGXA 3HPXA 1RXOB 2CKRA 3GWQA 2PWGA 1OM0A 2A2IA 2P10A 3CXOA 4YTSA 3CEUA 3EKZA 4HOXA 1DJIA 4HCDA 3K8KA 2OODA 1KBIA 3W7DA 1UC4A 3LENA 4BWLA 2HXUA 1O5XA 4KGJA 3BSMA 3MB9A 2IPGA 1FHUA 2CZFA 2VFGA 1H0IA 4PMNA 4QBXA 5K9CA 3E0IA 2GWGA 5LKYA 2QNEA 1P6CA 4AZCB 5CXPA 3LXAA 3ZJKA 3B9EA 3MT1A 4ZEPA 1E51A 2WWDA 3PPCA 2WMJA 1BVWA 1FWTA 1LZOA 5HWMA 1FHVA 3COTA 3AZTA 1O4UA 3BJTA 3KEHA 1E3ZA 3K8MA 3PB2A 1UKTA 4MAZA 2XINA 4GQQA 1D8WA 3VIIA 4G56A 4QLLA 4G1NA 5G2IA 4UTKA 3S2NA 3UXIA 4KS0A 4Z2JA 1R2TA 4DYJA 4CVUA 3HM7A 1EZ2A 5F2LA 1K03A 1WE5A 3W2UA 2CBJA 2OWXA 3E3HA 4DB7A 3VNYA 1V3LA 4UUIA 1VYPX 3MI3A 2ZRUA 3F4VA 4AX7A 1S38A 3AYSA 1EL3A 1PJ9A 2WVVA 3LCIA 2Z2UA 4C6EA 2KX9A 2WBGA 1ZNNA 1GPFA 2J6XA 4D6DA 4L56A 3QHOA 3QTGA 1GZ1A 4GGHA 2DZAA 4DXVA 2VYOA 5HXMA 3CH9A 3VDCA 4FOJA 1YYAA 4CN6A 4HOZA 3S2CA 2ABAA 3Q37A 3ANUA 3B04A 3RJYA 2OCZA 4GZIA 3GZAA 3AS2A 3UZWA 4PBGA 1XYCA 2V67A 3AXXA 3U0HA 1W3TA 4UOZA 4AY1A 1Q2RA 1ECEA 2BZNA 1Q6LA 1ITCA 1BYDA 4ZO7A 3TC7A 3TSBA 4CQBA 4HYRA 1GQLA 3SGZA 3LMZA 1XICA 1X6NA 2QXWA 4O1CA 5HBFA 2WSYA 3T05A 4Z17A 4AD0A 2P76A 3LEPA 2WMIB 1KKRA 1LYXA 3EPOA 3R79A 3WLOA 1JCNA 4ZQCA 3L7RA 5FIPA 2X1RA 3EWZA 1QPRA 3TJIA 1TA3B 4NI8A 2WLYA 2ABBA 4Q4MA 3IWPA 1OC5A 1FWHC 3P14A 5AYYA 4QQUA 1XYLA 2YDSA 5EMUA 1H3GA 2O9RA 3MI6A 4D8AA 4TV5A 2X05A 3WQ5A 3N4AA 4RXGA 3SADA 4NZ4A 4IX2A 3AZRA 1WKDA 2FPYA 3LX9A 1DJNA 5DCDA 3ZXWA 1A0EA 3SCSA 3E0VA 2F6UA 5E1QA 3IIOA 3RK8A 3W53A 3CB3A 1TV5A 3CUZA 3CZJA 2AMGA 2A3HA 1DJGA 1JQVA 4DEFA 1R3QA 3OHMB 4FS9A 3PAJA 3LHYA 2J7HA 1I0BA 3STPA 4GXWA 4IXHA 4IPIA 4FLQA 1KFEA 4NKCA 4MJ4A 3UGRA 3KOFA 1GOMA 1RCOB 2AKZA 3CZGA 2C0AA 3DGRA 1N2VA 1J9YA 4CGTA 1ME7A 1JDAA 2CIPA 5HJYA 1GEHA 1OINA 4K39A 2E1WA 4DO6A 2REQA 4G1KA 4U4MA 3RU8X 1V02A 2X2GA 4G9PA 1WNOA 3A9IA 4MYAA 1FWBC 1QPNA 1IV8A 3TQKA 3N2XA 2VZUA 1JDFA 3G1VA 1PL9A 3AIBA 5CAKA 2Y70A 4H00A 3GVRA 2VR2A 4UQ9A 1JDCA 1BSLA 1F76A 1WAUA 1VD6A 5I23A 3JR2A 3AYTA 4AZ6A 1LF1A 1XLEA 1JIBA 1L9WA 1YKWA 3JZUA 4DBUA 3PJWA 1FFRA 4OFCA 2TSYA 4WDXA 4AXKA 4FLRA 1QVBA 1GVOA 1GVFA 1IR1A 4QNWA 2QS8A 5G4EA 3UZXA 1MQRA 2B4GA 1LQ0A 1UD8A 5GNZA 4BI6A 3KXQA 1BAGA 2AL2B 4IUGA 3RPTA 1BVNP 2DT3A 3KTXA 3TFXA 5C55A 3REQA 2XVLA 1DQXA 4JCLA 1QXLA 4H8HA 3GR8A 2YPIA 3KW3A 4D6FA 4Z42C 2FVLA 4M6VA 3LK6A 3DGBA 1RAKA 2A3LA 5DBTA 2V2CA 1IT0A 3W83A 1ZENA 3CC1A 2Y88A 1W1PA 1XSJA 4WEVX 1WXZA 5I3GA 3AUOA 1B3OA 2VX4A 5HQMA 3GXDA 2WK2A 3SIZA 1MW3A 3VNZA 5D2WA 4U33A 2PDLA 2PDQA 3E1F1 1Q5MA 2WNZA 3L5AA 1TV7A 4PH6A 3FDGA 2FTPA 3BZGA 2NV9A 1XKJA 3KVKA 4E4UA 2Q09A 4FAMA 2W27A 1KFBA 1U22A 4EX4A 3QFEA 5HPOA 1JYNA 1W3HA 4C6IA 2DZUA 3BMWA 4WQ6A 1OX4B 3TK7A 4TO8A 2HBXA 3WFZA 1EUNA 2E68A 3UERA 4C90A 1XFBA 3CTLA 5JUVA 3GTHA 4LU0A 4DJDD 3FHAA 4V15A 4M6QA 3T55A 4OV9A 5D03A 4OJYA 5ABTA 1FWNA 3N04A 2WZIA 5LNUA 2KAUC 4O1FA 3MJYA 4XG1A 3MCOA 4CD5A 4NI3A 3HU7A 3MBDA 4K8HA 1S5MA 3T44A 5LHFA 2CCRA 4J7RA 3H2EA 4D6IA 4I9JA 3QHMA 2JFEX 1XIJA 1R3SA 3GAKA 4M8UA 2F2HA 2YKKA 3DBNA 2AGKA 3BG3A 1DXFA 1YLVA 5CSSA 3NSNA 1FWRA 1W3JA 1BEUA 1BYAA 2AAAA 3OVRA 4IPNB 1KRCC 2VZVA 1VLWA 3V5OA 3NWRA 7XIMA 1EX5A 1FCUA 3R58A 3W1RA 3WJXA 3MY9A 4DBSA 4R34A 2J4GA 4KWVA 3GG8A 2YW4A 3DEQA 1PKMA 1ZS2A 3N9RA 4YWSA 3UJRA 3DENA 5GPRA 4XK2A 4QSFA 4Q8PA 1CXKA 3GK0A 1VBGA 1XIEA 1W3IA 4JQ1A 1IGSA 3G1HA 4NF7A 2QCDA 1S5NA 3A21A 4LEQA 1PDZA 3UZZA 1Z8AA 1XLBA 1SU5A 4PTMA 4WUIA 3RYSA 1YE4A 4XQ6A 3ZT6A 1JD9A 3NVDA 1XLLA 1TUFA 3AHTA 4CCZA 3CZKA 4N4QA 4H04A 5BMWA 5F2IA 4GHRA 4GD0A 4FR6A 3L65A 1NP2A 1G67A 3H53A 4HNLA 4M3PA 3TYCA 3ALFA 4GBDA 3A12A 3FGCA 3GXMA 3WH8A 4CCCA 1TR9A 5K9XA 3E74A 3F1QA 3DFQA 3IRSA 3KVMA 1ELSA 2VD8A 4LC8A 1A4MA 3HA1A 1WAWA 2ON3A 4B90A 5HNUA 1HTIA 2A21A 5BW6A 3DHFA 5I3DA 1PCWA 3PSWA 2DSZA 5HUOA 1W56A 1ZAIA 2UY5A 3OIHA 4LJ3A 4TTUA 3MU7A 2Q3OA 3H4XA 4A29A 5K3VA 3GE7A 3L66A 1LL7A 1XUZA 3TTYA 4GO8A 1QNOA 2CESA 1A49A 2CWXA 4CNNA 5CBBA 1ZBKA 5EMYA 4C1NA 2V68A 1J93A 3QHNA 4E2OA 3CGTA 4A3RA 4AD1A 2TAAA 2HE5A 5FF0A 3P0XA 2JKPA 4NILA 3R4IA 1UP3A 1QUMA 4PMDA 3W7JA 3S1XA 2REQB 2FJUB 3DFOA 3IV3A 2PWEA 2HZGA 3MDUA 5GJPA 2VHLA 1DBTA 4HMEA 4F2BA 4EWJA 5G4HC 5C0QA 2CLMA 3AXMA 3RO8A 4FNQA 4AH7A 3GNRA 2NQZA 2CZ5A 4HPNA 3GG0A 3IIVA 3ENLA 1HJWA 1XINA 2CERA 2ZUMA 1FTXA 1F3EA 1XIFA 5AC8A 1J79A 3QY6A 5C7HA 3SIMA 2CITA 5A94A 3WQEA 4MB4A 1J96A 2JK2A 4X63A 2R82A 4EAYA 2BMBA 5FAGA 5A8NA 2OKTA 2NSXA 3O63A 4MJMA 1K8YA 4ZXOA 2JE8A 2V81A 1UWTA 1F07A 5FOOA 3S8HA 1TPFA 4DJFD 1UR2A 3CZ8A 2PDJA 4MB5A 3BPWA 4W5UA 2CYGA 3A64A 3B9AA 2GK1B 2GGJA 4H7CA 5PTDA 1AQ0A 3L4VA 3WUGA 4RZ4A 1VJZA 4HA3A 1H7PA 3R5EA 3LB0A 1IT8A 5BWAA 4X22A 2XDFA 1UR4A 1B30A 2XTKA 1FBAA 1TIWA 4HCLA 5M03A 3IAPA 2GZXA 3AMDA 1KCKA 4OV4A 1XIIA 1UP0A 1O94A 4PMOA 3BE7A 1SM9A 3NPWA 4F4RA 4PCTA 4FX7A 1F6PA 1RH9A 4WOZA 5DT5A 4JTLA 2D69A 3M6DA 2V5CA 3GNXA 1JD7A 2ACRA 1TQJA 1A0CA 1H7NA 1UZHA 3B9NA 2E1DA 1I2RA 2FMOA 1EBGA 5JXQA 1EQCA 1VENA 1Q6CA 3U4AA 1J0HA 2R91A 3E02A 1RBLA 4MKNA 2PWUA 3KVLA 2DY3A 3WLRA 2OXNA 3BQ6A 4JFTA 4AMAA 3SO7A 1GG1A 2EPMX 1XGDA 3K30A 1D3CA 4FA3A 1KR1A 2BY0A 2VM8A 3PUOA 3T8LA 3MUXA 4OVXA 3FN9A 4O17A 1NOWA 1HT6A 1KM1A 3OZOA 2GVEA 2YB4A 1E6NA 2Q02A 4PTNA 3UXLA 1R46A 4PCNA 1IZCA 2TYSA 2V8ZA 2E9MA 1YADA 3M07A 1E55A 4K8EA 4B3KA 3FY1A 4YU1A 2BOGX 5FSEC 4LB4A 9XIAA 4NP7A 2EF9A 3W38A 1H41A 1DWJM 2YL8A 3QQ0A 4UTLA 1UUMA 4GY1A 4UTIA 3VNJA 1HKVA 3H55A 4JX4A 4LOCA 1QTWA 1KXTA 1GTHA 5LA1A 3WBYA 4LYKA 4E6MA 4KKXA 4P61A 1FH7A 3SRHA 1M65A 1E9IA 3U48A 8XIAA 5G4WA 1LQAA 1OF6A 2VRKA 4OKDA 4UR9A 9XIMA 1GQNA 5C70A 1CB2A 3TYEA 2XG9A 5LZLA 2Z7GA 2R1KA 4WCJA 3CO8A 3RRXA 3WLNA 1MUMA 2DIKA 3LBMA 3ITOA 1W1VA 5JBEA 1JXJA 5IDIA 4GWEA 4XISA 5HMFA 3SR7A 5FKYA 4OE7A 2WZTA 3VGHA 3RG6A 5XIAA 4LS0A 1Q7QA 3EWBX 5HINA 3SUWA 4BEUA 1O95A 7PTDA 1CGXA 3I7RA 3BGJA 4DM2A 3K8LA 1KTCA 3W6YA 1GCYA 3NXFA 1LUCB 4AQLA 2Y7GA 1NOUA 4QP0A 4EXBA 3GVVA 3K4DA 3A6OA 4DWSC 2WC3A 4KRUA 2B7NA 3RN6A 1ADDA 1RJPA 2C7FA 3W29A 1GJWA 4ADUA 3RX3A 3IPWA 3WIJA 1WDDA 4LVGA 3W2LA 4C6PA 4Q8TA 4OBSA 1EP3A 2WLZA 2ZVRA 4GI9A 3PK7A 3CNYA 2OQYA 4N7QA 4XKYB 2GJNA 5GJMA 4G7EA 1OBAA 4P7RA 2BG5A 3D46A 5I3IA 5I06A 1ML1A 5I03A 2P8BA 7REQA 1E6RA 1VQTA 2ZXBA 5A6BA 3K1GA 4LF2A 8A3HA 2PSNA 4IWWA 3W25A 3SSJA 4CN1A 3ARRA 1S5TA 3KCOA 1UJPA 4L6HA 4X9YA 4CQCA 2UY2A 3M16A 3HF3A 3IACA 4DPQA 3V3WA 4NYUA 1RALA 2ATMA 1Q8JA 4WRHA 1QPOA 2YOCA 4W87A 3GB6A 2BTMA 1YX1A 4CU6A 3SN0A 1T0OA 1KM0A 3ABXA 3RUBL 1L2QA 1OK6A 1R7OA 1T96A 3CQIA 3W02A 4WOQA 1HZYA 4BY3A 4NAEB 2ALDA 1F2JA 3SJ3A 3PUDA 4LNCA 1XIMA 4UQAA 4JTSA 4O15A 1QNQA 3RM9A 3VKJA 4E8CA 1UD3A 4DPPA 2HROA 1CLKA 1OF8A 3EDDA 2PGRA 3M0KA 4O53A 3C3UA 1J12A 2H8XA 4H7VA 3G5EA 3KRSA 2QUTA 4J3XA 4L6DA 1EDQA 1F8IA 4N4PA 1D8CA 4JTHA 3EKLA 3W6LA 1XQLA 4A8LA 3WD3A 5TD4A 1PX4A 2VGBA 3TNBA 1R87A 4GUIA 2ZWYA 5F4WA 1HGWA 3N9KA 2PDHA 1DQUA 2V2HA 2R24A 3EGJA 3EEGA 4EPEC 3N3MA 4BF7A 2NXGA 4FIQA 3LN3A 3BUVA 2WXDM 4H9TA 3U57A 1CECA 4KETA 3W7QA 1OADA 1JPMA 1KRMA 2QUNA 4CN4A 1EYEA 5BXPA 4MLRA 1F05A 4WKFA 1MUWA 2CZVA 1TPC1 4NYYA 4O13A 2G50A 1JRBA 1US3A 1YDYA 5BU9A 2XSAA 4Y90A 3ORWA 2FZ8A 2FJKA 1T7LA 2EKGA 2W6RA 1AA1B 3N13A 1IZKA 3DG3A 3WL0A 3LPPA 1ECQA 3W1XA 2PTWA 3VK5A 3TAOA 1OZMA 2YZRA 1UH4A 3DHUA 1UBSA 4HA4A 3SBFA 2R9RA 3UYIA 3NOEA 1O1HA 5BU6A 4RE0A 3ZM8A 5HANA 1OY0A 3MDWA 4HSNA 5J8LA 4LV4A 3ES7A 3BG5A 2A3EA 3L2IA 3WNNA 3HMJG 3QOKA 1J0IA 4BA0A 2INFA 2I5GA 2Z00A 3AMCA 2CBVA 2CW6A 2E9LA 3EWCA 3TJ4A 4YWIA 3WEMA 1VZWA 3AIEA 5HA7A 1RCXB 1H7OA 1AH0A 3AMLA 2WJZA 3UXKA 3PC0A 2XGIA 2ZZ2A 4PMJA 4W7WA 4TIMA 3CYVA 4D1JA 1S5VA 3RAOA 4DLFA 4EF8A 1YXYA 1B3ZA 2XM1A 1HFBA 3HJEA 4ZQOA 3NL5A 3CS2A 1TIMA 2BXZA 3SCOA 2NX3A 4E2VA 2V5JA 2UY3A 1JZ2A 2FQIA 4LT9A 3R89A 4IQJA 5JIWA 1VPQA 1R9XA 4M7TA 1MZRA 1UBPC 2J47A 3ITLA 1J0JA 3UJFA 1H1ZA 4B5SA 3RMEA 4GUHA 1A4LA 1NDZA 3TZFA 3EDEA 3KRBA 4C6DA 3ZLFA 4HZ8A 1F4HA 2DH2A 4TX9A 1E6XM 5E70A 4MPKA 1MXGA 5A6TC 4I6KA 5DXYA 2IMRA 5DCEA 5AHLA 4GI6A 4RL3A 4NAEA 1XHGA 2FB2A 4F2TA 3O0FA 1Q3NA 4MHBA 1O12A 2A3CA 3TA6A 1HVQA 2I1OA 2A7RA 2J7GA 3KZSA 4NNCA 3ELFA 1UMLA 3H6OA 3QKZA 1EC9A 4GCXA 2G3IA 1OSEA 3C2YA 1G9HA 3FOKA 4JL2A 3GIQA 3VNMA 5B7ZA 4XAZA 1J6OA 1LDCA 2PU0A 4Q8UA 1QR7A 2DT1A 3UBPC 4UTWA 1IWAA 4JKMA 4I7VA 3PY2A 3N15A 4MKVA 4UQCA 3PZGA 1V03A 5CPMA 1IF2A 2C0HA 4O1BA 1OFDA 3LOTA 1MNZA 4MM1A 1REQB 3D3AA 4OGZA 3VPLA 1AODA 3GH7A 5TIMA 1GHSA 1VRXA 1NAL1 1X8FA 1F3TA 4DM1A 3D5HA 3PZVA 2Y2WA 2JGYA 3WJZA 3RMJA 2P5NA 2HISA 3EWXA 4I5UA 4CD4A 1SSDA 2A3AA 1V79A 1YTDA 3CLWA 3I4KA 1J8VA 4IX0A 2DJLA 1EJTC 3SEPA 1X39A 2NVDA 1BF2A 2B31A 4M5PA 5DLCA 3LBCA 3R1ZA 4Z2KA 1HP4A 2HK0A 4V1YA 4XTDA 1VLIA 1LT8A 4JTFA 4A3UA 5FJUA 5ENLA 4YVVA 3SN4A 1VEPA 1V3HA 3HV9A 2W63A 4WJEA 5C2GA 3AHXA 2VEIA 2QDHA 3GHSA 3N2OA 3LGDA 1TTQA 3LM7A 3O6AA 3FVDA 4NY2A 1SR0A 1VR6A 4S3JA 6ALDA 1TE6A 2WJEA 1W6TA 3HOJA 3QBUA 4UC5A 2QKFA 4HSOA 3NQEA 1Q4NX 4OT7A 3U9IA 3BURA 3M5ZA 3MUY1 5K9DA 2ICSA 1WOAA 5BXTA 1HKMA 4REQB 3KVJA 2ZYFA 2XISA 3UWZA 4PEEA 4DRSA 3SECA 2Y7EA 3OEXA 2NUYA 3KBNA 3ARYA 3NFUA 4WJ8A 4UTFA 3PVFA 4WY0B 4AC7C 5JU6A 4PGLA 4IG2A 4JN6A 4WDWA 3B3DA 4TMBA 2GDUA 5AB3A 1WBJA 3FJNA 1ZPTA 4N0RA 1LBLA 5HATA 2OB3A 3FLUA 2RDWA 3WQGA 3BSHA 3ZVIA 2C13A 5AVNA 1TB3A 2R1LA 3A3XA 3OB8A 1T41A 3NDOA 3MSDA 1A5MC 4RV3A 4F48A 1CXIA 1EHAA 3KUMA 3RXZA 1WUEA 3E0FA 4AF0A 5AHFA 3IJIA 2QUUA 4HU3A 2A6LA 3PR2A 2BGQA 4WHBA 4LBRA 3D3FA 1GONA 3SRFA 2DH3A 3PWIA 4C6QA 3HPSA 1WPCA 4D8LA 1LWHA 1DJWA 2VI0A 4J3TA 3KOZA 4AZBA 4W7UA 1VFSA 5FL1A 2CLKA 1QI3A 4LSBA 5C9WA 4RLIA 4EPBC 1FRBA 5A8MA 2DW6A 1QRQA 3M1ZA 2XU2A 2YFNA 1D2KA 3LGEA 3M7SA 4AHQA 1XFCA 3WF2A 2XVPA 4RJEA 4W89A 1J0YA 3UR7A 4Q32A 3W7CA 5U7SA 3CMGA 1EWDA 1SZEA 1O5KA 2RGMA 4ZO8A 2ZZ7A 4ASTA 2FVMA 4KESA 4D6CA 2OZTA 5D4YA 1KKOA 1G01A 3CEPA 3AROA 1JCLA 3BQ5A 3GBDA 2FIQA 1BG4A 4DF0A 3LRMA 1KR0A 3GU2A 1X1OA 2YA1A 5CPNA 2HSAA 3E2RA 5GJNA 1KFKA 4UOJA 3RCMA 2O9TA 3O8AA 3GC4A 2Z1WA 3ARUA 5FI8A 1XLGA 1X8CA 3FA3A 1OFEA 2H6RA 3IV8A 4IMCA 1NWUA 1TTJA 1RVKA 2PP1A 1BF6A 5F1UA 3AHVA 1WYIA 4HOWA 4RZ5A 3TVAA 3MMTA 5CPLA 2HRWA 3VMNA 2ZC1A 4UFIA 3UP8A 4ILSA 1L8PA 3LRKA 2YFOA 3M5XA 3N2TA 3XISA 2E4TA 4PMUA 3SQLA 4UMAA 4XUYA 3C5QA 4BK9A 1UKSA 4L7ZA 4H83A 3VINA 3QGAC 1M3UA 3H4GA 4PTXA 3PZIA 3W1NA 1KXVA 4HNUA 2WNNA 3N1AA 4A2RA 4E2BA 2HK1A 1FWJC 2HEJA 3ABSA 1R3RA 4LQ1A 4LPCA 1BKSA 3EX3A 3GYEA 4ZSUA 3FXGA 2DORA 3BOXA 4F0KA 1SFTA 3FIGA 4PB3A 3P5ZA 3PN8A 4H9VA 2ZUSA 1HKJA 4TU1A 5FAJA 2PMQA 3U5YA 2X0YA 5T8GA 2TPSA 1YXDA 1ZFJA 4PZVA 3GDKA 1F4AA 1YNQA 1ZBVA 1CPUA 3UXAA 3WJWA 5KEZA 2E5BA 3B0VC 3HTWA 3QXBA 3WLIA 2P1FA 5XINA 4H9ZA 2D22A 1QDSA 4EE9A 3TCSA 3G8RA 3L67A 5C71A 4V28A 2XIOA 4ZODA 3HJZA 2WJDA 3TDFA 3WLKX 2HPIA 4MGGA 5IBXA 2ZADA 3SCTA 2IXVA 4PEKA 5EL1A 1ICPA 4CNTA 3THQA 4WY0F 4US5A 1QW8A 2FGBA 4B2DD 3WLJA 2PGEA 2PEVA 1QO5A 2OJPA 3PFRA 5HOSA 1OIFA 4IMAA 1W31A 3QOMA 5DMLA 1W17A 4BJHA 2AKMA 4GXPA 5FD0A 5E5CA 1HG3A 1TE1A 1QBAA 1OJXA 3UG3A 4MIMA 3P2VA 1WUFA 1XPGA 2PZNA 3L5MA 1OFAA 2VKZG 4LAZA 4IP4A 3QR3A 3TSMA 3OBKA 3B8WA 2VD9A 1V3IA 2HV5A 3FHQA 1M7JA 2WYSA 3O0KA 3W84A 3C0QA 2E67A 5AVHA 1UWQA 2OYLA 3LD5A 1J6PA 3D0CA 2ZWZA 3TSDA 3EYPA 2PRMA 1WXYA 2WCSA 1B57A 3EDFA 1GKPA 1H1YA 3EXRA 3WQDA 2D3NA 5AOUA 2WJFA 3V7PA 3IIPA 1X6LA 4P7QA 5CZ0A 2BXYA 3KZPA 3QR0A 1MWOA 2EEXA 1RBOB 1JG9A 1WB0A 1XIGA 4PUKA 4QTGA 3V5CA 1B90A 3TXZA 1P0KA 4XIMA 3B97A 1PHQA 4ZB5A 2IS7A 2Y89A 1W9BM 1ONRA 1N82A 2NZLA 3KBJA 4UFMA 4W86A 3FXYA 4XTIA 4EXAA 3IGXA 3FYOA 4Z2GA 4S38A 2GJXA 3O05A 8RUCA 3AQUA 1TYGA 4O1DA 3S2LA 3SAZA 4PMXA 4AHPA 3ZLHA 2WMIA 5I79A 2FHBA 2R1PA 1PEZA 4LV9A 1RD5A 2WKGA 2V0TA 5BRPA 4B5VA 1B1YA 4UCFA 2A7PA 3LXBA 5DRIA 2JF7A 2ACUA 4NJJA 1K70A 1XF0A 3NZ1A 4XAGA 1DOSA 8XIMA 4O4WA 3QW3A 3E6EA 4QHRA 2EPHA 4W8AA 4B5NA 1TPWA 4RDZA 2OTDA 3LCGA 2OQHA 4U3CA 5ABFB 4UQBA 1XC4A 3Q67A 3QY8A 1LWJA 3PF3A 2HQAA 4Y8FA 3U4FA 3PNUA 4I5XA 3T78A 1RQHA 4JTJA 6TAAA 4M6PA 4DJFC 3E9AA 3LPGA 1N7KA 2BVTA 2VOTA 1K8XA 2QCGA 4W7VA 1GZJA 3G1SA 4AU0A 3MP5A 2QUVA 1LBFA 2V9DA 3BXWA 2O92A 2BOEX 3NNTA 2I5IA 3NPXA 3LYEA 2VVNA 4GNJA 1L2UA 4ACYA 2G8ZA 3DH7A 1W8SA 4I3GA 1G4SA 4S39A 1E5JA 3PNZA 4O0KA 5BOOA 4O11A 4GKLA 3B9DA 3MKKA 3KTCA 1B9ZA 4CCEA 1OCBA 4IT1A 5CPSA 2AOSA 3MS8A 5CG7A 3V18A 4I9AA 3UPBA 2DUAA 4ZL1A 5CSUA 3UWYA 3IRDA 3M6YA 4GINA 2IQTA 3QN3A 3JRKA 1P5BA 3VOHA 1YPFA 3WENA 1CGVA 4JIRA 1TVPA 4HJWA 3DFPA 3LCWA 1UPPA 3GTXA 3TW7A 5DF0A 3MHGA 4KMQA 1VKFA 1Z42A 1KRAC 4IPLA 4IQDA 1K9TA 1GOOA 3DG7A 5A6SA 3BO9A 4LF1A 4XAYA 1P6WA 4OUEA 2OR2A 1CXEA 1QOXA 1G4EA 2CXEA 1U5VA 4YTTA 5JBDA 3N4EA 4KWUA 3WDRA 5G1TA 3NQ2A 1E4LA 5DY2A 2V30A 4K1GA 1A5KC 2X1UA 4L61A 5SWUA 2DVUA 1QASA 5U4NA 2GL5A 1KQZA 3T1GA 3CQJA 5MKGB 2PLJA 1L6SA 2QAPA 1UD4A 4V1XA 2V63A 1SUXA 2YIHA 3N19B 1PVNA 1RP9A 3S9ZA 1A50A 1VJIA 2PDWA 1MI3A 3CUHA 4NASA 1NQ6A 4UFLA 4C6LA 2O55A 3WEOA 4GNKB 1UUOA 3EA3A 3BJFA 4A3YA 4B9YA 1Q65A 1W3NA 2AL2A 1FWFC 1X7IA 4XVDA 5EA9A 3V0UA 4MWAC 5DT7A 1KRBC 1O5RA 4G6CA 5K4XA 1LRNA 2YCKX 3W88A 4LYPA 1WKFA 4D6GA 1BXBA 3V0SA 5D2TA 1M7XA 4NL1A 3GQYA 4A8NA 2FTYA 3S0CA 4GMEA 4WIWA 1LLWA 2XN2A 4WXZA 1W1A1 3FS2A 4J3SA 2VEFA 3WD0A 2CEQA 4GQBA 2PDXA 2O9OA 3II1A 1MRAA 3QLLA 3G22A 2OQLA 3UEQA 3P74A 1WDPA 2FDSA 2QJGA 3ZZ1A 1GVIA 3EBVA 1UWAA 4TUFA 4DN1A 1CZ1A 4ADTA 1W9XA 1PTGA 3TOYA 4JY9A 4ALDA 4B4FA 4JIQA 2DT0A 4AVFA 4B91A 2WBKA 3PJTA 2ZXAA 1R85A 4ICCX 4BFAA 1XLHA 3S9YA 1Q7MA 4GIYA 1QK0A 1ENUA 4JHZA 1PB0A 4F2UA 1B9BA 2QF7A 2XIQA 4QS5A 1NEYA 4UNKA 5A6MA 1JQXA 2YXOA 5EFFA 5LYRA 2HDJA 1O60A 4QX4A 2FHFA 3GVWA 5HR7A 1FP9A 3BAKA 4WK9A 3UF9A 3PZTA 1FX6A 4ZR8A 1NOFA 4IFOA 2OT1A 4PODA 4Q8VA 4O57A 3W28A 3P8IA 4WKAA 6REQB 1GOXA 1M04A 2QULA 5A6KA 3ATZA 3WLPA 2YDAA 2PDBA 3GXIA 5I0DA 1XYZA 1FY6A 3WDPP 1RQBA 1QT1A 4JS3A 5DELA 3L68A 4HT3A 3TEVA 1GVRA 1XH0A 4EOUA 4AEEA 1YXCA 5A6AA 4KCVA 3LA4A 3UR2A 2VENA 2XPKA 2CLEA 3VGGA 3LI1A 1UG6A 4ZO6A 1MSSA 2J24A 2Z7KA 3A24A 1UC5A 3WLMA 4NVTA 1R3WA 1AL7A 1UR1A 3QSRA 5C2CA 3ZVHA 2ZUTA 3CWOX 5LIYX 9CGTA 2XFWA 4G2DA 4I90A 5IHSA 1H7XA 4QQ3A 2QF8A 1BKHA 1KBJA 2ZIDA 4JFSA 3UR5A 1LL4A 2NT1A 3R13A 4XSLA 3WBEA 1TPUA 2W5FA 3WLQA 3SRDA 3ITXA 3LY0A 1V08A 5FJPA 4DO7A 3O6YX 2DSWA 4JICA 4KBXA 3EMQA 2ZZ1A 2PC4A 1MEWA 1OABA 2V5DA 1V6UA 3UWUA 5CLWA 1PYMA 4IZGA 4YCOA 1DJXA 1EGMA 2J7FA 1GEQA 3U7BA 3CB8A 1HKKA 4U3AA 3LQGA 4IL0A 4GH3A 2FZDA 3EOEA 4JTGA 4GUGA 2D2OA 1R5YA 4HHMA 2BNJA 2UV8G 3NO1A 3BLEA 1Q4WA 1D7FA 5AYBA 4TX6A 3ECQA 3TYZA 2PF8A 1P7TA 4Q4OA 3W23A 4HNCA 1PS9A 4Z0JA 4HPGA 3HGSA 3BW2A 2XFYA 1UIOA 1HJXA 1T8QA 4GQRA 1NF0A 4KWOA 4CD7A 3VIFA 2ZA2A 4KRTA 4LVFA 2D0FA 3SZ8A 4DO4A 3VU2A 1EO7A 4YMZA 3ABZA 2Q3RA 4L6OA 3DXIA 4TTGA 3EA2A 3WNKA 4KIRA 4MUZA 3TYUA 1KFWA 3W27A 1RLCL 3WK2A 3N2BA 2CHNA 3N29A 1EEPA 1GT8A 2PDUA 4WSKA 3BCJA 6ENLA 4X0NA 1WV2A 1UP2A 3CUFA 5HMDA 1FWGC 3OOQA 2VOMA 1EGZA 3KCJA 1AVAA 4AWUA 4ZGYA 2V5BA 3EOOA 1OCQA 5LIKX 2Z27A 1ADSA 3S47A 4CNOA 3M0YA 4IISA 2D0HA 2VWSA 3CT2A 2NLYA 1ZHAA 3USBA 3VD7A 1F9CA 1O1ZA 1QWKA 2INZA 2NV1A 1OQFA 4PB4A 1ZRQA 4K7VA 3WZ0E 3BLDA 1DIOA 1KCXA 3ZYZA 3WO8A 3S5ZA 1FDYA 5A95A 3VFLA 3G1DA 2Y8VA 3WMLA 2V5KA 1K8ZA 1QNSA 5A3HA 1EXPA 3UPWA 4MB3A 1XSIA 2RAGA 5EBUA 2XH0A 2B7OA 7CGTA 1P0EA 1D3GA 1TPH1 1UR9A 6TIMA 5J04A 1W32A 1KGUA 2PCEA 2HVOA 2ZUWA 3L4XA 2YYUA 1ITUA 4Y2WA 3TZNA 4H2CA 3WLSA 4YVPA 5FJJA 1V0MA 2PLCA 1EGVA 1H5VA 1IHIA 1XX1A 1YTKA 3MO7A 3W2MA 5DFAA 3I3BA 1XYMA 3O7UA 4XZLX 4FIRA 4U5KA 1KCZA 1FOBA 3SI9A 2ZDSA 1A47A 3MQTA 1E43A 1GJUA 4C60A 2I9UA 3XINA 1TVLA 1KV8A 4MOZA 1QHPA 3KS6A 3BCFA 3IUHA 3NTYA 3W07A 3THUA 3HG2A 1ICQA 4FZIA 2NQLA 3GAYA 4LAUA 3ZSTA 2WPBA 1Q2SA 3ZR5A 5JIPA 1TA3A 4XD4A 3AU2A 5I78A 3QY7A 3CIVA 5F1VA 3RM8A 4HPHA 3LNPA 3RGTA 2ESCA 2Z0IA 5A6JA 4AISA 1SO6A 5AECA 2D0GA 5A2CA 2GLKA 2RDTA 7TAAA 4H2HA 4NT0A 4X61A 3T2QA 5D32A 3ANVA 3EB4A 3W7HA 4N9BA 4GH1A 4OIFA 2HE8A 2F6XA 3EZ4A 3NYDA 3W1UA 5G5IA 3MI2A 1K6WA 4UQDA 1QAPA 2XWEA 4JTAA 3W2NA 1VPXA 2PDKA 3VIOA 4ONVA 2XZ7A 1TTIA 4DJDA 1R2RA 4F79A 1ZSXA 3AS1A 2J6VA 3MWCA 3ZFHA 3ITGA 4GVIA 1Q45A 2DSUA 2IQ0A 2Z26A 5IM51 4OQVA 2GSJA 1DEDA 4NRSA 4DX3A 1E0UA 1FCVA 4RE3A 1SW3A 5BOFA 3NL2A 4GGBA 3GYCA 1XP3A 1YHTA 3WCZA 4NXSA 4TR9A 4XZBA 3MA8A 1PWLA 2WB5A 4LH8A 3M0MA 3LG3A 4KT2A 3IJ8A 3DAQA 3KOWA 4A2SA 2G97A 4QDMA 3CV1A 4P8WA 2WM1A 4L5ZA 4J28A 4PL2A 3SQMA 3WK1A 4MYXA 3VNIA 1Q6QA 1YDOA 4MNJA 4J35A 4I9TA 2CU0A 2IPWA 2F9RA 3RX2A 4RW5A 4DWSB 3KDNA 3T07A 3TYBA 1TZ9A 5D37A 5A8GA 4YTUA 2Q6ZA 3A5FA 2EBNA 2FMNA 1LRQA 4S3DA 5EMMA 5CAHA 1H51A 3O6CA 1V3MA 4JN8A 1FXQA 5H8UA 3R8HA 1KBLA 4PUWA 4PRTA 3ES8A 5H8PA 3IVSA 4WVXA 1JPKA 1CGWA 3A4WA 3C0LA 1ZAHA 4QFUA 3MTWA 2XN1A 4YXGA 1IWBA 3AJ7A 4JPGA 3VZYA 1TELA 3ARZA 4D6JA 1UZ1A 3ANYA 3XIMA 3VM7A 2UBPC 2C1HA 4J4KA 1W9PA 4M29A 3CPUA 1Z9AA 3NDYA 1DIDA 1XLMA 3MZNA 1TZZA 2PLMA 3NQ7A 1US0A 1FXPA 3W3OA 1RJQA 2E8YA 2XM2A 4B3ZA 1QNVA 2ZX5A 2GGIA 1CEOA 1UROA 4PTDA 1EFZA 4PSRA 5CZKA 3PBGA 4E0CA 4HZMA 2AMXA 1W2VA 4PRRA 3RCNA 4ATLA 4C7FA 3APGA 4GIEA 4JGDA 2QCCA 1XLIA 2FHCA 3WUEA 1PKNA 2I16A 1C8QA 1BTMA 2RJGA 2OO6A 4YS1A 4XUGA 1QBBA 4IMGA 3EB3A 2OU4A 1C8VA 4RZ6A 3SUUA 2MUCA 3DFNA 1UOKA 4F3HA 4KPLA 4H9UA 4MAVA 2EPNA 3GFZA 4NRRA 3QF0A 4MPQA 4TVCA 3VXGA 1EJXC 5HNTA 1X1NA 4WD0A 2CHRA 4DJEC 1WKYA 3ID7A 5BYWA 2ZE0A 3I6RA 3W2JA 3HPZA 1EZWA 3OBAA 4H8VA 1XRFA 2OZ0A 4DNMA 3LTSA 4GJJA 4L1GA 3W7IA 5BXSA 2P0OA 2PGFA 1JULA 3G1FA 4FNPA 4MFEA 5D9PA 2OWCA 2GOKA 4U2YA 2VCBA 1PZ0A 1LOLA 3AUJA 3F2CA 3DZ1A 1FKXA 1M41A 4YYFA 1HIZA 1X98A 2QCNA 5CKSA 5C6MA 3EX2A 1XQKA 1E1CA 2JKAA 2VL4A 3F7JA 3FK4A 2EQDA 3DU0A 4Z0SA 3LTPA 3TV8A 2RFGA 2ZQ0A 3NZGA 2YBVA 4O8RA 5FESA 1BQGA 2GJXB 1EBHA 1W5NA 2ZA1A 2DQWA 2QV5A 1IZJA 3UWQA 4YNGA 1RZMA 3TE9A 4Y9PA 1W5QA 5I02A 5AY7A 2F38A 1DIKA 3N11A 2B81A 5CPOA 4JTDA 3M64A 2O7SA 3PJUA 1SGJA 1E0XA 3NR0A 5REQB 4LB3A 3RIKA 2AQOA 4LS1A 1PKLA 1UZ4A 4IJRA 3B06A 1HW6A 4IF2A 2WVUA 3M0HA 1XLFA 3TA9A 1XRTA 3HQPA 4WJXA 3TKFA 3CAKA 1LWIA 2WMFA 3V0TA 4NZ5A 1C7SA 3N2CA 4XVEA 3D47A 4EPKA 3K5XA 1CENA 3BW4A 3CHDA 5JH1A 3Q58A 5FCZA 1G4TA 1MYRA 1E72M 5BZAA 3CM4A 1D9EA 3DHPA 1PTDA 1Q7ZA 1PX8A 3B0PA 1G7UA 3U2EA 3L23A 1XKYA 3C52A 4GZJA 2ZX9A 1LQ2A 1RVGA 3NOYA 4HTBA 2HPMA 1TRDA 1ADOA 2OO0A 3WK0A 4TVDA 4WX2A 2VTFA 2BHUA 2QYGA 2Y8KA 1E6ZA 1NWTA 1CYGA 3C0SA 3F5KA 4CVWA 1EIBA 3SFWA 3F4WA 2YZ5A 3ZJ6A 1R3VA 1TV4A 2WCGA 2ZOXA 2C91A 1OHLA 4NZCA 1VHNA 4M51A 3I6TA 1HO4A 3H2NA 1EOKA 4S3AA 4GABA 3MBFA 2WW5A 3ITYA 3BCDA 3CV2A 3PTDA 4LUTB 4LY8A 1GQIA 2OGYA 1YBQA 3TQ0A 2WZMA 3IUIA 3R6IA 2NVAA 3KTSA 1KGWA 2GVJA 1IQ8A 3VUPA 3TFCA 4HU0A 1AD1A 4XB3A 5KINA 4Z2LA 1F3XA 4HU4A 2QJHA 4V27A 1UW9A 3VD4A 5D2YA 4Q8QA 4JTRA 4QR6A 4ZZ9A 3VILA 4GK8A 3PANA 3ZMRA 3T0DA 1N8FA 5M17A 4OOUA 5E0CA 4FP1A 3MC5A 4XAFA 2PD5A 3PG8A 4DLMA 3WQWA 4J27A 3E2SA 1CBGA 2P88A 5C7VA 3HB9A 4QS6A 5I24A 3OVGA 3CJPA 3QQ1A 3T0TA 4JQ3A 5AYIA 2QPSA 9RUBA 2VJXA 3WQ6A 1JI2A 1QNPA 3CK5A 3HIJA 2UZ9A 1V02E 4PA8A 3R0KA 5DCBA 1FDZA 1MEHA 2FFCA 3GTFA 1XBZA 3TLLA 4MZ1A 1TVNA 2WSQA 3N73A 3VOIA 5BXRA 3WX7A 1B3VA 1BHGA 5E0KA 1D7KA 2QCDB 2YLAA 3WDIA 1C92A 3TTEA 1TWSA 2ZBTA 3N9SA 5E09A 1NSJA 4DIAA 1BGAA 4LUSB 4MJ2A 5KETA 1I2OA 4Q8WA 1H1NA 4UZUA 4W5ZA 4J5NA 2ZX8A 1XG4A 1M68A 3R12A 4GYPC 3FKKA 4E8DA 4IJBA 2H9AB 3RNDA 3VKKA 1U1HA 4R7JA 2RDXA 1FCBA 2R6OA 1ZJBA 1ODZA 3W75A 2GFTA 1VFHA 3OO2A 3S46A 4Q4PA 1BXCA 3W7KA 1IT7A 4YYCA 1YPXA 1IR2A 4GUFA 1YDNA 2GQ3A 1X7FA 1B54A 1JYWA 2BBFA 4KCTA 3E5PA 4LBSA 1MW1A 4URIA 2YB1A 1FA2A 4NNAA 3FJ4A 2PF0A 3QZAA 2HVNA 1KV5A 1B5TA 3ITTA 3WQVA 3W82A 4DZIA 3F03K 4JN7A 1DJYA 4C6MA 3HGJA 3UWVA 5D9MA 3N12A 3TOPA 3ABOA 3W74A 4BHYA 3GG7A 2DT2A 4PSPA 2UY4A 3VKCA 2GYIA 3GXFA 3GDTA 3DFYA 4GPNA 4FOUA 1FWAC 3KM8A 5RUBA 1EJVC 3BAJA 2IW0A 3GC2A 4QJ3B 1TJRA 2A3BA 2Y5EA 4XWUA 3T2PA 1FHDA 3UJ2A 4JEQA 1H2JA 1JYXA 3WQCA 5I7GA 3OLIA 1HO1A 1SW7A 4FNRA 2FLIA 5BRQA 2XSBA 3M5YA 3K1DA 2Z29A 1ZUAX 5M5DA 2WZHA 3FAWA 4S3KA 4W85A 2CLIA 3S1GA 1CTNA 3CL7A 3JZEA 1HJSA 3OIXA 4DYEA 3TU9A 1JXKA 5FJIA 3PB0A 1RR2A 3TTOA 3SGGA 3W37A 1OGBA 2VFHA 4IGSA 2Y7DA 2XIIA 1US2A 4PCPA 4TQTA 3A47A 3BANA 4LYQA 2BASA 4I7UA 4BR1A 1I2NA 4LXFA 1FH8A 5M2FX 1PZ2A 2W3ZA 4AHOA 1TPEA 3LBOA 1UA7A 5A6BD 2VCCA 1ZJAA 4DY1A 1JPHA 4MZ8A 1K4GA 3B8IA 3AS3A 3FYYA 4LALA 4DF2A 4BEQA 4M19A 4WGXA 2E6FA 3DUGA 1GHRA 2G0WA 1PIFA 4QGCA 2DZVA 4GYPA 1VFMA 3MANA 2QPXA 5KITA 1EC8A 2WHKA 4AUBA 3IJLA 2OX4A 4UFKA 4JY8A 1AD4A 2ZC8A 3WBAA 1NH6A 5CC7A 3MW7A 4DJED 3W1LA 4ES4A 4PUEA 3B03A 3THAA 1VIWA 4BI5A 1TUXA 4IQEA 3FKRA 2ZVIA 1SZNA 4JCMA 2ZKMX 5A1AA 1VFOA 3MMWA 1JFXA 5AC6A 1YTEA 2R1NA 3LCXA 2VDHA 5E93A 1JZ3A 2A79A 2XH7A 4XZNX 3POHA 2OSYA 3QQWA 3SCRA 3KRZA 1V6VA 2DPEA 4MJZA 2YDQA 5LIUX 2J88A 2I14A 1G7VA 3RRAA 4ML9A 5AZ0A 4MTVA 1UD5A 4EACA 3GRIA 3FEQA 1I6NA 3AWOA 3NIYA 4LNYA 4UTTC 4A05A 4LYRA 4AFYA 4FO4A 3EOLA 1AJZA 5FEXA 2PWDA 4GRSA 1I45A 1MXSA 5F2MA 3TH6A 3R25A 1J2WA 4ZO9A 1W9VA 1XRVA 2V69A 4RKAA 3A13A 1MUCA 5I00A 4NAFA 1RPKA 3L4ZA 3AMKA 3PHAA 3EX4A 4GZEA 2E25A 1WX0A 3URNA 3DIPA 2F61A 3M5VA 1S2CA 3LCHA 3NURA 3DC8A 1J4EA 4KGLA 2QCMA 2A0NA 3LLFA 2INEA 5CJNA 3IEBA 3PFMA 4DQWA 2X09A 3VMOA 3ZT5A 1GVYA 3W4RA 4QLKA 1RD6A 2VC9A 4IP7A 1UD6A 2G3JA 4W9TA 3ALGA 1I2PA 1NDVA 4QM1A 4QCEA 3IJDA 5I3HA 5FF4A 3M0IA 1TR1A 1H61A 1ZU8A 4N02A 1BRLB 3M0LA 5TBOA 1BQCA 1OFQA 3LPOA 3RJXA 3UPMA 3W22A 1W54A 3KFTA 3AIUA 3U6WA 1YBQB 4R3UA 1FHLA 4HJFA 1YDVA 4FPSA 1AMKA 2WWCA 1QHOA 4NJGA 1DV7A 2OZ3A 4IM4A 4JDYA 1XYBA 4N2YA 2Q71A 3TN3A 4ZQNA 1GOIA 3MO4A 4UR7A 4L4OA 1OYCA 4Q33A 3QV8A 4K38A 5E6ZA 4CEUC 2VFDA 4DJFA 1KWKA 2R14A 4XD6A 1FWSA 4GX8A 3LUTA 1S1PA 3CHVA 3VD9A 1XBYA 5AC4A 3GFXA 1B3YA 1H11A 3Q65A 3CMJA 4JL1A 3IIXA 1M53A 2QVHA 3P62A 3QC3A 1B4KA 1EA9C 3LNMA 1ZP3A 4AD5A 4XX6A 4B3LA 1VB9A 1XH1A 5D9NA 4HU8A 1OWQA 2PLKA 1Z32X 2GUBA 3LSBA 3RLHA 5I6SA 4RNJA 1T8XA 4GCAA 3GSMA 2OX1A 4WXYA 1QATA 4PULA 1W0MA 4PC8A 3MUIA 4AIEA 2W66A 1UD2A 2ONEA 3URBA 1OGSA 4PMVA 2H3DA 4MLJA 4L64A 1GYMA 2WKLA 5D2XA 3T09A 2OMAA 2ZRXA 3AAMA 4H4IA 3FNDA 3LLDA 2BDQA 3DBPA 1L8NA 1F8MA 4HK5A 2FDMA 1OD0A 3W7PA 3H21A 3MCNA 1ISWA 2OT0A 4JBRA 5BMXA 2GQ8A 3EMCA 2V3FA 2CBIA 1RHCA 4GIRA 4I8YA 3M0XA 2VFEA 4V2XA 5GNXA 4D1IA 2DQXA 3GNPA 4I9MA 2ALRA 7A3HA 4NJIA 1TJPA 3IJ7A 1K9EA 1F61A 1BLIA 4BQ4A 4G5DA 3F4NA 2J78A 4NZJA 1BTCA 4XKMA 2ZZ6A 1SFJA 4AAJA 2QAFA 4IPJA 3G3MA 4I6VA 1A0DA 4C6BA 1F6KA 1OB0A 2FPVA 2XVGA 3E49A 5T9CE 2D2HA 4DXKA 4MNMA 1HKWA 3AMGA 4GYFA 1EQPA 1G1YA 3NQGA 1GVEA 3AHYA 1NP0A 4B15A 1Q63A 3BICA 2DFAA 2BODX 4HYWA 3VO0A 1MEIA 3EX1A 2VCAA 4MFDA 2DJXA 2V3EA 4R5EA 1QPQA 4U5IA 1VFLA 1CWYA 3L4YA 4RDVA 2VZSA 3U7VA 1SR9A 4GKTA 2Z25A 3GIYA 1M1BA 4Q8MA 3STFA 3OA5A 3W73A 4PR4A 3A22A 3H54A 3FSUA 1TFVA 3JVAA 1H60A 2OSWA 1Z6KA 3CYJA 1PSCA 4ATDA 3VUSA 3CAQA 1CIUA 3MV01 4MG4A 3MHUA 4DELA 4AIOA 3STEA 4XKYA 1DTUA 2TMDA 3CZLA 4R33A 4FI4A 1AMYA 4XSMA 4DF1A 3HV8A 1K77A 2HCVA 3UW6A 1VBRA 4IFRA 1TV2A 5HWJA 1LUCA 1TKKA 4GQ0A 2EG7A 5MKGA 1Z69A 5IFPA 1YNPA 5DMNA 3NPVA 4HYVA 2Z6JA 1OX5A 5J5DA 5HJXA 3OA3A 3ARXA 3B8TA 4MWAE 4ROQA 4PCFA 1H50A 3MHFA 4IGHA 1GGOA 3EKGA 3PP7A 3ZJ8A 4Z1YA 1G4PA 5TNVA 4QJ4B 3GUWA 4W84A 4XAPA 5LSMA 2G41A 1NWSA 5CPTA 4FX6M 3T2OA 3EWDA 3UFYA 3P8JA 2CNCA 3VM5A 3T42A 3QM3A 1CW2A 2H9AA 3S3GA 4R85A 3GXPA 3NL6A 4RXFA 3BV4A 3GHRA 4OECA 4WR3A 1XL9A 4UWMA 3EOUA 1S2UA 4FXSA 3F5LA 1Y8BA 1UWUA 4PTVA 1TWDA 1DQWA 5HNRA 3AXKA 3VCRA 3GFYA 3OG3A 1NM9A 5FACA 1RA0A 4JYEA 3PWAA 4BQ5A 3FSTA 4Q7IA 1WZKA 4Q7NA 1EP1A 5CJ5A 4DI9A 1F5ZA 4NZFA 3CWNA 2OLHA 4LX4A 1TSIA 2QJJA 3VC6A 4QROA 1XV8A 1E0WA 2GSHA 4JDBA 4I5RA 4BI7A 3R8GA 2DSVA 4IHCA 2GVYA 1EPXA 4INFA 3SUSA 2L5HA 3DC0A 3WQ8A 4PUUA 2PDPA 5F4SA 3G8EA 1UKPA 1XR2A 2P3ZA 1ODUA 4S3EA 1TWZA 1J5TA 4A22A 1R30A 3MKCA 5A5WA 2EPLX 2E0PA 2JIWA 2VT0A 1JEZA 2XGBA 4HA1A 3J7HA 2NW0A 4AF0B 4X2RA 3IANA 1SO3A 5AYXA 3VIMA 1WXJA 5K4ZA 4N6EA 3GBEA 4C5YA 4Z1BA 3DECA 3VD5A 1EF2A 4FMVA 4NSBA 3C2FA 1SZFA 4MADA 4HIBA 1UPMB 2IKJA 5DANA 4IP5A 1Z41A 1UKOA 1C9DA 1MVYA 4PFMA 2WHJA 3R43A 3PSVA 4FOKA 5HDRA 4L80A 5DRCA 2ZUNA 2PRLA 1E71M 2ADAA 1OG6A 1BD0A 4NNBA 3NQBA 3P67A 2BFGA 3CIWA 4RNHA 1EJUC 3RF9A 2NUWA 1KWGA 2HTMA 1B3WA 1UZDA 6CGTA 1PHWA 4AX6A 1OX6A 2WV8A 4DBEA 2QCHA 5A6LA 3OG2A 2Y0FA 4HGXA 1OVDA 4ZFCA 3B4UA 3NA8A 4HNNA 3OLGA 3M0JA 4US6A 1C9WA 3TW6A 2WZEA 4GNVA 4F0MA 3TUUA 4UCGA 2PDMA 4UTTA 5LIWX 2G3NA 4ZQPA 4B5TA 1JDEA 4N9DA 3TR9A 2CLFA 2WC7A 5ECVA 2PPGA 3WD4A 1NDWA 2ZTKA 8TIMA 4KFPA 2VDGA 1V6YA 2VZTA 2PGWA 5KZ6A 3P7YA 2PRHA 4YN5A 1VS1A 3LHTA 5D2VA 4S2BA 2ZFAA 4AZCA 4D8ZA 4L9ZA 1TREA 3NQ6A 2CZDA 2PD9A 3UNDA 4ORMA 4QSHA 3W86A 1DXIA 1SYTA 1SJDA 3B8VA 2C14A 1IEVA 3O3RA 1KO0A 1R0MA 2A85A 3CU2A 1KD0A 4Z2HA 4HN4A 1DHKA 3EDKA 2WO5A 3F4CA 1RCQA 2EJ1A 2ZA3A 1GVSA 3LRLA 4HA0A 5EBAA 4K3ZA 4H8NA 4JIEA 3B0XA 3G18A 1A5AA 1T5AA 3W1QA 4K1WA 3SQSA 4E3VA 1E1CB 2XYLA 2OOFA 2CLHA 4M56A 1WCGA 2QZRA 2VC5A 3GNNA 4NIRA 1XRSA 2JALA 1E4MM 3W2KA 2YSWA 1EJWC 3CHEA 4G8TA 3NQMA 3QGKC 2J7EA 2J8GA 3GU9A 1E6QM 4QAWA 3VOFA 3KL3A 1JF5A 4A8IA 1RQEA 3W1AA 5C5YA 2C15A 3R0DA 4DWSD 2V3DA 1E3XA 3GX9A 4A8RA 2WHMA 3M46A 1TX2A 2WQPA 3TMLA 3BAXA 3T4CA 4C1NB 5CPQA 4JTIA 5DXXA 2CXGA 1SZGA 4PUMA 2GQAA 1HKIA 4M82A 5HQEA 2XHYA 3AJXA 2B0MA 3LV6A 4DJEA 4J9JA 1LOQA 1S2AA 2WHLA 3H23A 3FEMA 5E0FA 1KB3A 1UMYA 4DO5A 1XIDA 1P0NA 3WDHA 4JFVA 2XGZA 3QLDA 1A5LC 2JF6A 4LFYA 4JQ2A 4EXQA 3WUFA 3CQHA 2ISFA 3W01A 2KZHA 1ZB5A 2WSRA 4LVBA 1ZZMA 1A5NC 2W92A 5K2ZA 1P0DA 4KFNA 4Q4RA 1TMLA 3LTYA 5AHEA 1WO2A 7TIMA 1PAMA 5T91A 5EMLA 1V0NA 2NUXA 1S2TA 4GG9A 2QPUA 1AJ0A 3LCLA 4PBFA 1WDSA 2VO5A 3MJMA 5HULA 3FGCB 4Y9AA 4L9YA 2OVLA 1V6TA 4AZ7A 4CU7A 2VGIA 2ISVA 5DMMA 1A3XA 2O0TA 3O15A 3PBYA 3TONA 3VYLA 3NZQA 3LQLA 2X0HA 5AKQA 2HXTA 4LAOA 4XZMX 3KBVA 4GACA 4OBTA 3P81A 3L0GA 4JX6A 4ERIA 2F7FA 4PCSA 4E4PA 2Y5SA 4Q4KA