5K9CA

Crystal structure of human dihydroorotate dehydrogenase with ml390
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
362
structure length
354
Chain Sequence
ERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase (quinone), mitochondrial
publication title Development of ML390: A Human DHODH Inhibitor That Induces Differentiation in Acute Myeloid Leukemia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 139
structure length 354
sequence length 362
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2016-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5k9cA00
3LCHA 3P82A 3GDTA 3BV4A 1VC4A 4DPPA 1OYCA 4IMGA 2H8XA 3TV8A 5DBUA 2V5BA 4CLMA 2BZNA 1T99A 3DFSA 3E49A 1F2JA 3B05A 3W2UA 4NJIA 3ZS4A 2RDTA 3F4WA 1JCMP 3FJLA 5G1YA 1WOAA 3OEXA 5F1VA 2R91A 2QCDA 3W88A 4NJJA 1TMHA 2E6DA 5D33A 1TREA 4TR9A 5K9XA 1P4CA 4NX0A 3ZFHA 1H5YA 1ICQA 2J24A 2BTMA 1AMKA 2B7QA 4DBEA 3CB8A 3DFNA 1ZY9A 3QFEA 1GJPA 5E1QA 4JR5A 4JTTA 3HG5A 5HMSA 3UY8A 5K3VA 1PCKA 5HQEA 1LOQA 4UIOA 1NFBA 5FF4A 5F4XA 3BW3A 1AL7A 5EMUA 3KVMA 1XDMA 2TRSA 4KKXA 2GVLA 4EVZA 3DI0A 4RK8A 4BWLA 3TQVA 2ZZ5A 2YZRA 2FPTA 2J9YA 4XUGA 2QCCA 1NF7A 1QOQA 1AW2A 4K7VA 2CLLA 3CT7A 4LTSA 1TQXA 3LOTA 1KV8A 3SFKA 1QFEA 4UFJA 5AHMA 3G1VA 3W23A 3CIWA 3TXVA 3PC0A 4R33A 4WY0F 3PAJA 4N9EA 3NYZA 1YLVA 1F05A 1LRNA 5HWJA 5F2GA 5CPLA 3S1VA 1OK6A 2QAFA 5DXXA 2Q8LA 1RPXA 3HBLA 3NZRA 3SR7A 4YCOA 2H6RA 3HGRA 5SWUA 4KWVA 3CLMA 3O07A 2ISSA 1K02A 2QEZA 1HL2A 3R2GA 3N2MA 3MYOA 3QZEA 3LGEA 4E2DA 4GJ1A 4O13A 1GPWA 5CZTA 1LBLA 2ZZ1A 3NQCA 2HMCA 3KXQA 3LXBA 4GUFA 4AWUA 5G1TA 1KFCA 1TB3A 3QQ0A 3WJSA 2NLIA 3M1ZA 3A24A 1PHQA 3DENA 2V82A 3B0UX 1X1ZA 4CQ9A 1LLZA 4JTUA 1KM2A 4I7VA 3DI1A 1WX0A 3ZWSA 3QM3A 3I68A 3W7PA 3GAKA 2ABAA 4UTWA 4DF1A 2V2HA 3W2NA 3NPXA 4LW7A 4UTTC 4IOTA 2E5DA 3G1XA 2FB2A 1FDYA 3GKAA 4UFKA 1OG0A 4LRTA 3FIGA 3SIZA 2XFWA 1K7FA 3W6YA 3IIVA 2NV2A 3NM1A 4MJMA 4POCA 5HUPA 3L21A 3QW3A 4PA8A 3PBWA 3T78A 4E2BA 1KFEA 1RD5A 3QW4B 4LUIA 3NL3A 4RKAA 4CCCA 2DZPA 1VCGA 3T55A 4NT0A 3W7OA 2HTMA 3MP3A 3W71A 5LHEA 3N73A 5LZLA 1EIXA 3NEVA 1XBXA 3KVLA 1SFLA 3WFAA 4OBTA 4S1FA 3WK2A 1XUZA 3CEUA 3NXFA 1W3NA 4O54A 3M41A 3O06A 4GE8A 3CHVA 3GR8A 2ZA3A 4OQVA 5HJLA 2V30A 3N3MA 4JY8A 1KLZA 4UC5A 5AYZA 1W31A 1GT8A 2JK2A 2ZRXA 3Q94A 4WZHA 1PV8A 1XFBA 4PTNA 4FNUA 3FFSA 1DQWA 1TV8A 2ATMA 5MHBA 2A1YA 4ONVA 2DJXA 1BWKA 3LRMA 1MEHA 1JUEA 1KBIA 3EX6A 3EX1A 4ZQPA 1H62A 1Z44A 2EGZA 3G1FA 3W1XA 2Z6IA 1QCWA 3W3OA 5U4NA 4O28A 5D2XA 2CLFA 4MOZA 3G18A 2X2GA 1XBYA 3NQAA 4X2RA 1FCBA 3C2OA 3DZ1A 3A5VA 4W9TA 3QMSA 3G1YA 1VLWA 1TQJA 1CX9A 1VRDA 2J9ZA 4JTHA 3DHFA 5G4WA 3DBPA 4LU0A 4HKPA 2D73A 2X1TA 4LV9A 4PODA 5D2WA 1FWRA 4ZL1A 4GBUA 4OE7A 3T7VA 4JTFA 2GPTA 1UASA 1FUYA 4O0ZA 5I3JA 4PL1A 4OHQA 3P67A 3CWNA 4AMAA 2ZRYA 4TU1A 3LHTA 1PVNA 3KOFA 1J5TA 4IQLA 4UNKA 1EUNA 3C52A 1R46A 1P0KA 2GUUA 2PRHA 4LS2A 2V81A 2R14A 4ZQCA 1SQ7A 2YFOA 4UUIA 5LNRA 4ORIA 4A29A 3LI1A 5C55A 3L5LA 4M6PA 4O1CA 1ZNNA 4YXGA 1SU5A 5EL1A 3LXAA 3RU6A 4LNYA 3GNNA 4NUWA 4DQWA 3NQEA 4FX6M 4CNOA 3LHWA 1S5VA 4I7UA 4RCXA 3G8EA 4JNMA 1JCLA 3LCFA 3W7EA 3E12A 3TU9A 1WA3A 2XN0A 3NG3A 1T8XA 2C18A 3W2MA 4GUGA 4IMDA 3JR2A 3STCA 3R5EA 1XDLA 4PFMA 1H7NA 3TR2A 4JXCA 3NNTA 4WXYA 1ME9A 2GQAA 3LI0A 1Q6RA 5L9FA 5LGZA 1KM1A 4E0CA 4LUJA 3TMLA 4A2SA 3HPXA 3T44A 3EWBX 4QIUA 5AHLA 1J4EA 3G0UA 3BG3A 1GTHA 2KZHA 3LTYA 2BWGA 2X1SA 3BG9A 1ALDA 4O17A 2E68A 2Y61A 1BTMA 4ZMGA 3W7NA 3SJ3A 3LXCA 4IUOA 5HNRA 4ADTA 1VS1A 2CLKA 5AYXA 3GZ3A 5U7SA 4OWGA 3UWWA 4HSNA 4UTTA 1LOLA 4U28A 5A5WA 2Z6JA 3BLFA 3KAOA 2GQ9A 1JQVA 1GVOA 3PY2A 1W1ZA 2WPBA 1W54A 4MFDA 1PHWA 4UCGA 4O1AA 1QPOA 3M6YA 1KTNA 3NQ2A 2A4AA 3MP4A 4JN6A 5L6UA 1D3HA 3W2JA 3MHUA 3O6CA 4BI5A 4ZQNA 3W75A 2W79A 3NA8A 3GYEA 1PE1A 1W5OA 1LTDA 1OF8A 1I2PA 5AC7A 2C15A 1T96A 5CKSA 1F73A 5D04C 5FEXA 3S5NA 1KFJA 5FF2A 5D30A 1L6YA 3HJZA 3HG2A 5I3IA 5LHFA 5LNSA 2PC4A 3CM4A 4IGHA 1JCJA 1TCDA 1JVNA 3BW4A 2C3ZA 1PIIA 3W7KA 3M9YA 3RLVA 2W0UA 4TIMA 3EEGA 1QMLA 1U5JA 4YCPA 1OK4A 5G5IA 4A21A 2DZUA 3LCWA 1UJPA 4GRSA 4XBSA 3KVKA 3W76A 3P8JA 2V2DA 5J5DA 1THFD 3LRLA 4WOZA 4CQAA 5K2ZA 4AVFA 1LLWA 3P60A 3LTSA 1TRDA 3IIPA 1W37A 3S1UA 3P74A 2C19A 5FESA 3OBKA 4UTUA 4K36A 3HPZA 3TDFA 2ABBA 2YCEA 1ZALA 5LNVA 2VEPA 5D03A 3SSJA 1WDWA 1Q3NA 3M7WA 4WD0A 3EKZA 2YPIA 1QR7A 5H91A 1H1YA 3EX2A 2NXGA 4QNEA 3NM3A 5G2HA 1RQHA 4I9AA 4QITA 4UTHA 3P7YA 4TMCA 1W5PA 3GKFA 5C2XA 5DN1A 1EUAA 2V9DA 3ANYA 4JTLA 2WSYA 3QSTA 3GXTA 2GJNA 1Z48A 3DFTA 1ZFJA 3S8HA 4RJEA 3NPUA 3F03K 4MZYA 1H1ZA 1TPVA 5KTLA 3W7JA 3PSWA 7TIMA 3K30A 3B06A 2P0OA 3D0CA 4FNQA 3I7RA 3QQ1A 5AN7A 2A85A 2JBMA 4LRSA 1GOXA 3P8IA 1PCWA 3WJWA 4UTWC 3NQ8A 4AXKA 5I3GA 3LHZA 2G5WA 2CWNA 2Y7EA 5DY3A 3L2IA 2YR1A 2CZFA 1OHLA 1TPUA 1X8FA 3KVJA 3GXPA 3HO8A 3CIXA 6TIMA 1S5WA 5D38A 1Q6LA 4TX9A 3OVPA 1HO4A 2YGYA 3AO0A 2ZCGA 4OV4A 3DKJA 4DO6A 4IMCA 5DCBA 2V5LA 3G0SA 4EOUA 1PS9A 5HWMA 2ISVA 1YPFA 2WNZA 3A22A 2BSLA 2QR6A 3VFLA 2ZZ6A 3ABRA 1E51A 1QNVA 1JQXA 3IVTA 4NJKA 4P2VA 1R47A 2CLMA 3LDVA 3EXSA 1FWTA 2Z2UA 3HG4A 3N34A 5EBUA 1ADOA 3A23A 4JYDA 1O94A 4UXDA 2VOMA 3S9YA 3OHIA 2DU2A 3NQMA 1H7RA 1ZCOA 5IBXA 3BK0A 1K7XA 1VYSX 4UR8A 3R13A 4FO4A 1W8SA 5D32A 3BO9A 1XUUA 4K7YA 1S5TA 1IXNA 2TPSA 5AHIA 2VKZG 2NX9A 2J6XA 4UMBA 4MKNA 3GLCA 2HS6A 1F74A 4OGZA 5A8GA 4LY8A 1I2OA 4NNCA 1G7UA 3C56A 3RMJA 2JGQA 3IGSA 3TK7A 2FDSA 1DL3A 2OT0A 2YFNA 3KHJA 2TMDA 4DELA 1F76A 3OVQA 4NU7A 1DJQA 3L9CA 3W07A 4HNNA 3O8AA 1OX4A 1L9WA 3RK8A 5D05A 1N7KA 1ZAJA 3W2LA 1WOBA 3W1MA 2CZ5A 5EKYA 3CTLA 2CFFA 3W7HA 4LS0A 1DQXA 2A7PA 2OMAA 2VFGA 3EWWA 4DBDA 4A2RA 4L4MA 1QOPA 4N9BA 3I6RA 1AG1O 4K37A 2JKAA 4BI6A 1OF6A 2EAWA 3W7IA 1SO5A 3QF0A 3F4NA 3LBMA 3TSDA 3S0CA 1GVFA 4HHPA 4RXFA 1TPEA 3O1NA 3GNDA 5FEZA 1K8ZA 5EYWA 1GYNA 1LBMA 1M6JA 1IXPA 1SO3A 1XBZA 3SW6A 5BMXA 3DU0A 2AGKA 3W1AA 2R94A 3M43A 4NX5A 2NWRA 1VJIA 1QO5A 2NXIA 3HF3A 4HSOA 5CG7A 4N02A 4GC4A 3LHUA 1G4PA 2Y63A 3RFAA 3OA3A 3S1WA 1DHPA 1IIHA 1O60A 2RFGA 2A6LA 1GVRA 1Q6QA 2QCLA 5G2WA 2QKFA 1OFDA 4B5NA 4PC8A 1W3TA 3H55A 4K8HA 3TA6A 1FQ0A 2VELA 3MW7A 1AK5A 2A6NA 3TH6A 3UD6A 3BGGA 3F1QA 2TSYA 3HGJA 3SZ8A 3GR7A 1KA9F 3W87A 4M7TA 1KM4A 2DZWA 3TE9A 4K38A 1JCNA 2ZTJA 1LP6A 3ZWTA 2RDWA 4Z0SA 3P84A 4HPJA 4P61A 4AWTA 2Z1BA 5H2ZA 1WYIA 2ZZ4A 3HG3A 3T4CA 1NEYA 3B0PA 1SZFA 4G1KA 4WUIA 2ZRZA 2A2IA 4PCFA 1F7BA 5LGXA 3FJ6A 1DBTA 1YYAA 3QEZA 3S1XA 3C61A 1EWEA 4A3UA 2B7NA 2VXNA 3TFXA 4JY9A 5EA9A 2EHHA 4NNBA 1W5QA 3ABQA 3BGJA 2Y6ZA 5CZJA 5LKYA 3LM7A 3UPWA 1RR2A 3GX9A 4FX7A 1JRBA 4BI7A 1HG3A 4UTJA 4LVGA 4IWWA 5F2MA 5AC6A 1G6CA 1ICSA 1D9EA 1XL9A 3QH2A 5BW6A 5KMYA 1A5SA 1W0MA 3NDOA 2JKEA 3THAA 3ATYA 2Y7GA 3TQ0A 1A50A 3TW7A 3LX9A 4RZ4A 3QMRA 4DPQA 4EF8A 4Q32A 2WKJA 4JTIA 4CNPA 1XI3A 5F4SA 3PF3A 4WX2A 1RZMA 1UB3A 1UCWA 2FFCA 5DBTA 1IGSA 3W72A 3B03A 4Z1AA 3UWUA 3PR2A 4LVBA 1WBHA 3BG5A 3W7MA 3ABOA 1OX4B 2CU0A 2X16A 2QCDB 3I65A 3O15A 3DGRA 3C4UA 1L6WA 4GUIA 3IIXA 1VPXA 4O16A 3WJZA 5D02A 2E6FA 4JTJA 2Z0IA 6ALDA 2FTPA 3PB2A 4JTKA 3UY7A 1VCVA 3L68A 1TIMA 4MY9A 1SZGA 4Y8FA 2R8WA 4MY1A 4YWIA 1A53A 2ZDRA 2ISWA 1O4UA 3GXNA 3PUDA 3C8FA 3P61A 5HINA 2DZTA 3GDLA 2Y70A 1IXQA 1VQTA 2Y88A 2C13A 3EWZA 1EEPA 5EPDA 5D09A 3STGA 2E09A 4FXSA 3P80A 4FIQA 3FYPA 3MI6A 3LLDA 3FYOA 2NXHA 1OJXA 1C8VA 4AHOA 5DLCA 2WQPA 3W86A 5D37A 1TPC1 5AFDA 3Q37A 3LCGA 4IX0A 4JEQA 4NZJA 4O1BA 1F5ZA 2PCQA 2NX3A 5KZDA 3UYCA 4QJ1A 2QUTA 1QPNA 1SW3A 3O6DA 2B4GA 3V1PA 4HN4A 4JX4A 4O10A 2ZFAA 1D3GA 4AAJA 3W7GA 1KM6A 1P1XA 4DF2A 1TPDA 4QSHA 3W70A 2NUYA 4L4LA 2C0AA 1W3IA 1KLYA 2A7RA 4Z1CA 1OX6A 4GXMA 5FF3A 1L2UA 2YDAA 3W1NA 1A5CA 2GJLA 1RV8A 4N6FA 2C1HA 2CLHA 2ZZ2A 3W1QA 4HNVA 4I7WA 1UUMA 1H7XA 1SSDA 1YXCA 5FEWA 1EPXA 4H4IA 2WNQA 1VR6A 4CCEA 3TAOA 4MFEA 4ALDA 3BARA 3A9IA 3OIXA 1TTIA 4ORMA 2OZ0A 4O1DA 3UWQA 1GTEA 4QM1A 1FDJA 3LHYA 2IQTA 3IIZA 5FF7A 4JIQA 2QCNA 3BLEA 4E38A 3QJAA 4XKYA 1O95A 4LOCA 4AF0A 1N55A 3IVSA 5IBXC 4DO5A 1EWDA 4N9CA 1JUKA 2YYUA 4UMCA 4JTEA 3R89A 4M6VA 2WNNA 1FCQA 4NJHA 1KBJA 3O05A 5HR6A 3TMQA 1SZNA 3W74A 1FCVA 1A5AA 1B4KA 4X9SA 4LS1A 1TTPA 1IF2A 5EY5A 1FBAA 1FY6A 2VFIA 2WV8A 5F2IA 3PBUA 1Z41A 5CSRA 1GZGA 2QJIA 3L0GA 4CCDA 1YXYA 3OVRA 4Z0JA 1VZWA 4RR4A 2C6QA 2F7FA 3C2FA 1OX5A 4QAIA 3KX6A 5C6MA 4XTIA 3W1LA 1TO3A 2V0TA 3M16A 3W83A 2ZBTA 5CZ0A 2P10A 2A7NA 4HNTA 5CPNA 2ZRVA 1H7WA 4UTKA 2P1FA 1X1OA 3DHDA 4LWWA 4O19A 2HSAA 3O6YX 4FF7A 4IJBA 4O4WA 2PE4A 2QUVA 3L0NA 4O15A 4MY8A 1LORA 3E02A 5CPMA 5CSSA 2OJPA 2CLEA 1SO6A 4YMZA 1SR9A 5AHNA 4JICA 5I3FA 3W1RA 3I7QA 4FB7A 3MHFA 4ML9A 2HS8A 3TX9A 1SZEA 1JR1A 4LT9A 3FLUA 3USBA 1M7PA 3B0VC 3S5YA 4FXRA 5C54A 3CC1A 5AB3A 3C3NA 2Y7DA 3ELFA 3MWAA 2ZQ0A 1I8JA 2QDGA 1XKYA 1GVQA 5GVJA 5J5RA 1KM5A 3W1PA 4AH7A 3BW2A 3NQ7A 3Q2DA 4NQ1A 2I1OA 1TTQA 1EX5A 4XWUA 2CZEA 3HPSA 3TNOA 1KM3A 4DO4A 3SGZA 2OCZA 4BFAA 4XBKA 2X1RA 1U83A 3DXIA 4MZ8A 3H53A 5AHEA 5G2IA 1H60A 2A5HA 4JDYA 4JTSA 1GG0A 4AHQA 3BPWA 3VE7A 1FWWA 4YL2A 1EB3A 1DV7A 2FQIA 4Y9AA 2JKPA 1OFAA 3CU2A 1V5XA 4O50A 3S42A 1AL8A 4R7JA 3P5YA 5HR7A 1SW7A 3GDRA 2F84A 5FI8A 1KTBA 4RLIA 5I3HA 2JGYA 4TMBA 3DFOA 1H50A 2CLIA 3HGSA 4FHAA 4QQ3A 2LLEA 3G3MA 3GK0A 1TV5A 5E0KA 3W2KA 1ONRA 1MXSA 5LNUA 2RKXA 5K9DA 1FCUA 2CZDA 2WJZA 4ZQOA 4KWWA 3PBYA 1OFBA 3N2XA 4S2CA 2EF9A 1KTCA 4LC8A 5TQLA 2ZA1A 4J9JA 1OFRA 2VC6A 1SFJA 5K9CA 4LC6A 4FNTA 4QNWA 1TTJA 2V8ZA 4RX0A 1OFPA 3L5MA 1FDZA 4DXVA 4HT3A 1MSSA 2Q3OA 3N9RA 1MZHA 1H63A 3LCIA 1OYAA 1G7VA 3IRDA 2A0NA 3E0IA 4K8EA 2Y89A 1HTIA 4BR1A 4K39A 3NL5A 2QJGA 1K7EA 3L66A 3PB0A 2QJHA 4RV8A 3W9ZA 1OFQA 2BLEA 3STEA 2FIQA 3NZ1A 3UWYA 4DEFA 3FKKA 2WO5A 1G69A 3FOKA 2H3BA 2AAMA 3M47A 2NV1A 2X30A 4O12A 4QISA 3S5OA 4WQ6A 3O63A 3TIMA 4IXHA 4LVFA 1G4SA 3DFPA 4O14A 3W7QA 4NJGA 3GAYA 2ZZ7A 3DAQA 1XBVA 4H6KA 4OV9A 3P81A 1VHCA 3CPRA 4XZ9A 3P5ZA 1XXXA 5C5YA 3PBVA 3EWUA 3MUXA 4YLWA 1Q45A 1GEQA 3VKJA 3NPVA 3QMTA 4C1KA 3M5XA 2E6AA 4FNPA 4JIPA 4MJZA 3G1SA 1NAL1 3TSBA 2DZSA 1ZENA 4Q33A 3TJLA 3WK3A 2GVJA 3L67A 4H3DA 2A21A 2YW4A 3IV3A 4GUJA 2YXGA 1LOSA 1KW1A 2Y7FA 3LHVA 5LSMA 2G97A 1UUOA 2H8ZA 3RNDA 1O5KA 1S3HA 1WAUA 1IXOA 2GOUA 3N9SA 3TQKA 3MHGA 4GNJA 3SY5A 3NL6A 3PVFA 1Z42A 3MBDA 4JX5A 1RQBA 5AOUA 8TIMA 5FF0A 5K4ZA 4C1LA 2UV8G 1JCXA 3THQA 3MBFA 2YYTA 4KFPA 2FJKA 3MI3A 1G67A 3W22A 5I3KA 5AHFA 4BK9A 1TPB1 3LTPA 4PH6A 4GUHA 4IPIA 1ME7A 3G1DA 3LBCA 1VYPX 4S2BA 4AB4A 3W84A 3LV5A 2VFDA 4MYAA 5F4WA 2YW3A 3W7RA 3UXAA 1ZJIA 3KRSA 1GYLA 1JJKA 3PS7A 3PULA 1XC4A 3FA5A 4JD4A 1I2NA 4O11A 1OFEA 4JGDA 1GG1A 1TV7A 3UQNA 3IVUA 1KM0A 4PL2A 1QPQA 1J2WA 1TRIA 3TSMA 4ICNA 4DF0A 1JULA 1NF0A 2O7QA 3LERA 3GDKA 3B8DA 3NPWA 1F6KA 4HIBA 2ZYFA 1DVJA 1FWSA 5CPOA 1WV2A 3MO7A 1ZAIA 1RQEA 4JYFA 4GFSA 4AWSA 2YSWA 2EKCA 1NVMA 3M0ZA 1VCFA 4RZ5A 4WOQA 1GWJA 4UTLA 1H61A 2B7PA 1SPQA 2B7OA 4MLJA 1B9BA 3G3DA 2J27A 3G8RA 4ADUA 3HOJA 1BKSA 3HB9A 2OT1A 4FIRA 3NAVA 4Y96A 2E77A 3O16A 4WY0A 4FNSA 2PRLA 4FNRA 3KRZA 5FEPA 4X3ZA 3WK0A 3UXDA 3FKRA 3M5VA 3QYQA 3UZ5A 3QPZA 3JS3A 2QCMA 1TSIA 1B4EA 3EKLA 2ZRWA 3KFTA 3VE9A 2B0MA 4Z08A 3S6DA 2W6RA 1WXJA 2NZLA 1OABA 2X1UA 1EP1A 5KITA 1V7YA 1DOSA 2I14A 2V2CA 1MO0A 3EWYA 1XCFA 3IEBA 4M5PA 4MUZA 3SI9A 3B4UA 3MP5A 1H7PA 3EXTA 1AW5A 1LROA 4Z1DA 1CW2A 2GVGA 1LRTA 3LB0A 1YDNA 3GDMA 3HMJG 2J88A 3DFQA 1TYGA 2FPYA 2XN2A 2E5CA 3PWAA 4RXGA 3INPA 3MMTA 2QF7A 4IXXA 2ZA2A 1PL9A 1I2QA 5E93A 2GQ8A 2VEIA 5KZMA 3TFCA 3W7CA 2NUWA 3M5YA 4M6QA 1JCYA 3VI2A 3H54A 4ZQRA 1YTKA 3MJYA 1K3UA 1I45A 5F1UA 4N4QA 2C16A 3G1HA 1C9DA 3EB2A 3VCRA 1SW0A 2VENA 2NUXA 4MZ1A 4O0KA 1BEUA 3DKLA 3PG8A 2WOQA 2QAPA 1A5BA 3BVJA 2VFHA 5DXYA 4O53A 2ZZ3A 2H3DA 3CWOX 3TCEA 1JRCA 4ZZ9A 2VFFA 2Y85A 3PUOA 3GIYA 3G24A 3EX3A 4UFHA 1W5NA 2BXVA 2G95A 3GB6A 3N14A 3E9AA 2DP3A 5HULA 3L0KA 2VFEA 4M7SA 4NZFA 5AYYA 1Q6OA 2FB3A 1P5BA 3AJXA 3TC6A 3UNDA 3WJYA 1LRQA 5BMWA 3WK1A 4Y90A 4UTMA 1YDOA 1KFBA 2ALDA 3PUEA 1W56A 1K8YA 1LBFA 1HO1A 3NO5A 2NWSA 4N2YA 4WJEA 2QUUA 1YTDA 2PRMA 5CZSA 4MVAA 1TPFA 3A21A 2Q3RA 1Y0EA 3TC7A 2RDUA 2AQWA 1QO2A 3ATZA 3BLIA 1MEIA 5LNWA 1R2TA 1FX6A 3W1UA 1M7OA 5KSWA 3S5ZA 2RH9A 1FXQA 1TJPA 5TBOA 4UTIA 4O52A 2WSRA 3HQ1A 4K6AA 2NX1A 4LVAA 1LM1A 3M5ZA 1TJRA 4JYEA 3TROA 4IPJA 1O5XA 3W85A 2DORA 3YPIA 1TPH1 4WY0B 4AEOA 3UZJA 1CI1A 3RLUA 3W1TA 1VHNA 3QC3A 2QCHA 1F6PA 2VEMA 4JTGA 5T26A 3TKFA 2XN1A 2DZVA 1N8FA 1QPRA 4WXZA 1YXDA 1R2RA 3NQDA 3W7DA 2J9XA 2FPVA 4O4VA 2E1DA 4XTDA 4MPQA 4FX8A 4Y6GA 3PG9A 1K8XA 5KINA 3NL2A 3NQ6A 2DZXA 1T0OA 1DKWA 4BF9A 1X6UA 3NR0A 1WQ5A 3LCLA 3MI2A 3V75A 5BNKA 3TJXA 2EPHA 1MEWA 1KV5A 1WBJA 1YTEA 3Q58A 3U6WA 3C0JA 3QRHA 5DELA 4UNLA 4R53A 4EF9A 1W5MA 1GQNA 1VH7A 3G0XA 4MLRA 4NVTA 3QSRA 1DJNA 3UWZA 2QCEA 1OFOA 1VLIA 5BRBA 3G1AA 3UWVA 3STFA 1H51A 5CGQA 4KFOA 3B04A 1VGAA 3QPYA 2FLIA 3EWXA 2Y62A 3VNDA 4IMFA 5DCEA 4EIVA 4OU1A 1HUVA 2CW6A 4TO8A 4UFLA 1SO4A 3LV6A 4LV4A 4CNNA 1LZOA 3EXRA 2H90A 3C6CA 3I7SA 4NXKA 3LLFA 1LDCA 2ATSA 1UBSA 4GWEA 4BWLC 1VYRA 5DCDA 4ADSA 3C2EA 2I9EA 4A22A 5D2TA 4UMAA 3NVTA 5HWNA 3UPBA 3C2VA 4AHPA 1TPWA 3KRUA 1OVDA 2Q8ZA 3NQFA 1LCOA 3NQVA 2QCFA 1B3OA 1SSGA 3NGJA 4O57A 3W7LA 3L5AA 3JRKA 1FWNA 5ABTA 3OG3A 3LRKA 3NQGA 3C2RA 1L6SA 3IGUA 4RZ6A 4M19A 1EP3A 1GVSA 4FEZA 4UR7A 5IM51 3HIJA 4IX2A 4X22A 4MYXA 4U4MA 3TXZA 1ZAHA 3LCXA 5D2YA 1DORA 4O18A 3SGUA 1ZHAA 2ZRUA 4HNUA 1R2SA 1XM3A 3R8RA 1YDVA 3NOEA 5G4EA 3U2OA 4PEKA 4JX6A 4NNAA 1RVGA 1KFLA 1BWLA 3ABSA 2RHGA 5TIMA 4ZVJA 1YADA 1M5WA 2O7SA 4O8RA 1AW1A 4R34A 5D2VA 4D2JA 3FS2A 3MYPA 5BOOA 2E5BA 3M44A 4LVDA 3U8GA 1H7OA 2OX1A 3TW6A 4JS3A 1ML1A 3DH7A 4KFNA 4N4PA 5HUOA 1R30A 4ZQMA 1IIGA 3P62A 4XKYB 1HFBA 1KFKA 5DY2A 3ZR4A 1I4NA 5KZEA 4AF0B 1I2RA 3A5FA 5AC8A 4Q4KA 3TUUA 4IMEA 1G4TA 1B57A 1EP2A 4N6EA 1JUBA 3CQ0A 4MIMA 3SECA 4Z1BA 3GVGA 4UFMA 4NXSA 2ZTKA 2E6YA 1OYBA 3HGOA 5F2LA 1C29A 1SUXA 2BX7A 3E96A 4JDBA 4N9DA 3L65A 2WSQA 2TYSA 2VEKA 3RF9A 3WJXA 2C14A 3TAKA 3T40A 1NSJA 4CQ8A 3CEPA 1LYXA 4UFIA 2CLOA 4EWND 3PM6A 1G4EA 1QAPA 2YX0A 1ICPA 4HPXA 2QDHA 1P0NA 2QCGA 1QWGA 2DJLA 3FEMA 2PURA 3W73A 1ME8A 5K4XA 3IIOA 1EA0A 1K03A 1FXPA 3G22A 3N19B 3PSVA 4OT7A 1YPIA 1QDSA 3EX4A 3R12A 4XQ6A 2G96A 5K7JA 3IGXA 1X7FA
chains in the Genus database with same CATH superfamily
3GDTA 1FH9A 2PDHA 4DPPA 3CQKA 3CZGA 3NSMA 3WO8A 3KE0A 3SO7A 2V5BA 4AIBA 4HHLA 4P8WA 1H5VA 3GHUA 1PAMA 1RY8A 4O0QA 1C8XA 3FJLA 5FL1A 5G1YA 4YYFA 5I09A 3DECA 3W88A 2ASHA 1R9YA 3LPFA 4W8BA 1TREA 4TR9A 1UA3A 3MV11 3SCQA 2Z00A 1H5YA 1ICQA 2BTMA 4XZHA 2B7QA 1VKFA 1ISWA 3CB8A 1ZY9A 3QFEA 1ESWA 1C7TA 1CXEA 4JR5A 3HG5A 1J96A 3F2BA 3CH9A 3UY8A 1LOQA 3K4DA 1NFBA 1NDVA 1FWHC 2UY4A 3BW3A 2VYOA 2PDGA 4DBSA 1UG6A 5E5CA 3DI0A 3TQVA 2ZZ5A 2YZRA 1DP0A 2FPTA 4C6DA 4B16A 1TQXA 3LOTA 1Z7AA 4JPGA 3ZJKA 4UQEA 5A6SA 2R24A 1QFEA 1NDYA 5AHMA 3G1VA 3WMCA 3CIWA 3TXVA 2FGLA 4EAMA 3IV8A 4G5DA 1CGXA 4W5ZA 1YLVA 1F05A 1TX0A 3DX5A 4GYPA 3S1VA 7A3HA 6A3HA 2PDKA 1KKRA 2D0GA 4EPKA 2GJXB 1OM0A 1MUWA 3MUAA 4ZFMA 4GY0A 4XZNX 3NZRA 3SR7A 1S1PA 4HD5A 4YHEA 5I78A 3CLMA 1OCQA 1TR9A 3N2MA 2VEGA 2GZXA 2IPJA 3QZEA 2PU1A 2PBOA 4GJ1A 5CZTA 1LBLA 4GUFA 1JYNA 3KXQA 4ZB0A 4XV0A 3ANUA 2NLIA 3A24A 5ABFB 2PU0A 1X1ZA 4CQ9A 1LLZA 3TYEA 3WQ4A 1KM2A 4I7VA 2DVTA 2AQOA 3QM3A 3W7PA 3W2NA 2YIHA 4D6EA 3QVQA 2ACRA 3WQVA 2E5DA 3M4HA 2GFTA 2FB2A 3OA5A 4GPNA 1HIZA 4LRTA 2WMIA 4F0SA 1DE5A 2XFWA 3ONCA 3W6YA 3DC0A 5HNTA 3WZ0E 1O12A 4IF2A 2FZBA 2YZ5A 4PA8A 3PBWA 1XPYA 1S2AA 4LUIA 3CV1A 2Q01A 3NL3A 4CCCA 1SJCA 3W7OA 3MKCA 4Z1YA 3L4YA 3WQ8A 3PNZA 3W71A 2PAJA 2DZBA 3UZXA 3E3HA 1UQZA 1EIXA 1S46A 2HPIA 3KVLA 4OBTA 4S1FA 1XUZA 3R58A 5AC5A 1W3NA 4GE8A 3GR8A 4OQVA 5GNYA 3N3MA 4AFYA 1AFSA 4JY8A 4M8UA 4H41A 5AYZA 1RJRA 2I7GA 1BGAA 2ZRXA 2A3HA 3T2OA 1XFBA 2AKMA 4DHGA 1W1YA 3PTDA 3UG3A 1WUEA 4XZMX 1KBIA 4ZQPA 3W1XA 4Q8VA 3V0TA 4QEEA 3W3OA 3WN6A 4O28A 2CLFA 3EMQA 4GYKA 4L80A 4RZBA 3RO8A 3EWCA 4X2RA 2R82A 1FCBA 2QDDA 3LENA 3OU8A 4JCMA 3QMSA 1E6RA 3BMVA 4MJ4A 3OZOA 3WEOA 3HQOA 5G4WA 2OWCA 4LV9A 4PMYA 4ZXLA 3WUBA 4ZL1A 4GBUA 4LBSA 3CQHA 3AMGA 1UASA 4AZCA 4OHQA 3FSTA 3VZZA 5LIWX 3GE7A 1ADSA 3N11A 4M1BA 3KOFA 1ZBVA 2C79A 3WH7A 5BZAA 4ZQCA 3TNBA 3BJFA 4KESA 1IZCA 3TYUA 4DVOA 6TAAA 4HP5A 4O1CA 3IJQA 1MRAA 4NUWA 4QCEA 4DQWA 3K4WA 1UC4A 3IGHX 4I7UA 3G8EA 4JNMA 3ZR5A 3GTHA 2RJGA 3QQWA 4LALA 2L5HA 1S5NA 1WA3A 2XN0A 4WKFA 5BXTA 3NG3A 3OLEA 2C18A 5AY7A 4RDYA 4IMDA 2ZADA 3WYZA 3UFYA 2Z1WA 3EOOA 1VFLA 4JXCA 4WXYA 1ME9A 1Q6RA 1AQ0A 5L9FA 2Z1SA 1EEXA 4E6MA 5JXQA 3G6MA 5AHLA 5JBEA 3QTPA 1B5TA 1T7LA 2GSJA 2BWGA 1X1NA 4ZMGA 1QASA 5E0FA 4UTTA 3SDOA 1UA7A 5IDIA 1SJBA 2GQ9A 1JQVA 3RMEA 1GVOA 1WCGA 2J8GA 1PHWA 4O1AA 4AZBA 1KTNA 3NQ2A 2A4AA 2Z29A 1UIPA 3G2GA 4W89A 1AZ1A 3NA8A 3PZUA 1XH0A 1J0JA 3CL7A 3S2CA 1I2PA 1T96A 5FEXA 4S3BA 1ZJAA 2OOFA 3HG2A 4X61A 5I3IA 1VP5A 1EQPA 2PC4A 4NRSA 4ML4A 1JVNA 1QNOA 3GBDA 4UQDA 2W0UA 4MWAC 4TIMA 3EEGA 2G50A 2WLZA 3RG6A 3WQDA 3AMCA 3G6LA 4YU1A 3OLGA 2W61A 3LCWA 1DEDA 4PMJA 3T0CA 5EFFA 1ZSXA 1E4LA 1PX4A 4MWAD 3VDCA 1THFD 3GG7A 5GPRA 4CQAA 4AVFA 3IIPA 4DO7A 4HK7A 3IUHA 3HPZA 2ABBA 2ZC1A 5LNVA 3GNPA 3UCDA 1WDWA 1KRAC 2IW0A 3RR4A 3GTFA 3THCA 2PP3A 4WD0A 2VT0A 1FVPA 1L8PA 3VIIA 1TJ1A 4G2DA 1H1YA 3EX2A 1B3VA 2NXGA 1YNYA 3MSGA 1YMYA 3LSCA 3GVWA 4UTHA 2HK1A 2WC4A 4DX3A 4CNUA 1EUAA 3GC2A 3ANYA 4GJJA 3VMPA 3NURA 3VNJA 4DAFA 1SMDA 2WSYA 2GJNA 2QXWA 4JZ5A 1A5MC 2X09A 1ZFJA 3UXKA 3S8HA 1XKJA 4NZ1A 3NPUA 4E2OA 1HP5A 3FN9A 2ZICA 3B06A 3E6EA 2P0OA 3D0CA 4PBEA 2A85A 2PCEA 1MUMA 2IXVA 1TCMA 1VFHA 5DY3A 2IMRA 3CZEA 1R3SA 2WB5A 1V3LA 3UP8A 1RH9A 3MQTA 4ASTA 2POZA 1H41A 2CZFA 3WDJA 1PWMA 1FP8A 1D2KA 5XIMA 4HNLA 4TX9A 2VL4A 4IP4A 3LNPA 4I9TA 3AO0A 2XG9A 4OTKA 1Q4WA 1XYAA 5CBJA 5DCBA 2V5LA 3G0SA 4YTTA 2CZVA 3VFLA 1TFVA 3ABRA 1E51A 3H26A 3VABA 3BGAA 4NZ5A 2CLMA 4LUSB 5AZ1A 1FWTA 2Z2UA 3A23A 2XH7A 1UR8A 4FR1A 4A3YA 4GI8A 4MDPA 5I02A 2VOMA 3FK4A 3S9ZA 3OHIA 2JEQA 3VOCA 2G3MA 1UBPC 3BK0A 1ODZA 1HJWA 5AVHA 1H0GA 1MNSA 1AJZA 2G0WA 4Z17A 2NX9A 2J6XA 4UMBA 5HAOA 3CWHA 5D9PA 4OGZA 1L0PA 4X60A 2XUCA 1SZRA 4YTUA 1E6NA 3RMJA 4B5WA 3IGSA 3TK7A 4QLJA 4J2PA 3A4WA 1DJQA 3ZVHA 3M7SA 2D3LA 4H2HA 3U5UA 2JEPA 3W2LA 5A69A 3FV9A 1Q65A 4J40A 4ERIA 2I5IA 3QOKA 3POCA 2VGFA 3MUCA 3TYZA 3EWWA 3QY8A 1QOPA 1BFNA 1AG1O 3I6RA 1OF6A 2FHBA 3UR7A 4D9PA 3F4NA 4GQQA 3S0CA 4GNVA 1Y5VA 2WMJA 3ME3A 2JALA 1K8ZA 3TYAA 1M6JA 3ALGA 1E5NA 3CPGA 2AGKA 2BXYA 1EDGA 2NXIA 4A8NA 3EB4A 2VX5A 2FHFA 2XDFA 5A6JA 1DJWA 1BVZA 4GC4A 3LHUA 2CPUA 4U33A 2Y63A 4RDVA 1JAKA 3WUEA 1JPMA 1XYZA 1L8NA 1XINA 2RFGA 4HTBA 4JIHA 1Q6QA 3OO2A 5TNVA 5IRPA 5CAKA 4B5NA 4RW5A 4PC8A 4K8HA 3TA6A 4HU8A 2UY3A 3GM8A 1M41A 2HEJA 3V16A 1IT8A 4A35A 3HGJA 1EXPA 4JFUA 1KA9F 2DZWA 3R1ZA 4CD5A 2ZTJA 5DRCA 3TVAA 4AWTA 5CC6A 1WYIA 2OOGA 1PKMA 4UQBA 1XLLA 3MKKA 1JZ3A 1ONWA 1A0CA 2OVLA 6CGTA 3R10A 1FWJC 3OTRA 1CNVA 3S1XA 4AW7A 3C61A 2FMOA 3UG5A 1XLEA 2O9RA 4JY9A 3PWIA 5CBIA 2EHHA 1BQGA 1W5QA 2BOGX 5LKYA 1TV3A 2VMFA 3BGJA 4IPNB 1VFMA 2F2KA 4HK5A 2BNJA 1XR2A 2ADAA 3AZRA 4A3QA 1JG9A 2QDEA 4WSJA 4C6CA 4LVGA 4KERA 1TJ0A 4HBKA 1EHNA 3A3WA 3VOHA 3AXXA 1G0CA 4RPPA 4HA1A 1IZJA 4P8XA 2JKEA 3QY7A 4IPLA 2ZUNA 1JI1A 3EOLA 2P3EA 3TQ0A 1KR0A 4MKSA 1DTNA 4ZE5A 1UR4A 3QMRA 4DPQA 4OBRA 1LL4A 4HJFA 1J12A 1QBAA 1UB3A 5DBTA 2Z2BA 2FH8A 4Z1AA 4MAVA 1EIBA 1WBHA 3CAQA 1O1ZA 2CU0A 4S38A 1LL7A 2QCDB 2WJDA 4IUGA 1UR1A 3BLDA 3QGVA 3EDDA 6ALDA 1MQPA 4J3WA 1XLMA 4FPSA 2DW7A 1K1DA 3QV9A 4M81A 4KWUA 3FHQA 4HYRA 3PK7A 2RAGA 1TMQA 4I5UA 4Q7IA 1A3XA 2R8WA 4F9JA 3S2NA 2ISWA 2PUZA 3GXNA 1U5VA 7ODCA 3C8FA 4H9XA 2ACUA 3N2BA 2Y70A 1EL3A 2W3ZA 3H7VA 3BE7A 3AXKA 1IR2A 4FXSA 1FWFC 1L6GA 5A6BD 4GC3A 2JE8A 1V4YA 3MI6A 3LLDA 2NXHA 1OJXA 3TWAA 2WQPA 3V0UA 1MMFA 2PP0A 3DFHA 4GA8A 4GISA 3M0HA 1TMLA 3EDEA 1UH4A 3CZJA 1XV8A 5KZDA 3MVTA 5HK4A 4QJ1A 4JEJA 2GDQA 2XINA 1DTUA 5FA5A 2DSKA 4KIRA 1TPDA 4QSHA 5G1MA 2Z7KA 1G1YA 3UCCA 2C0AA 1GKRA 1BF2A 1OADA 4MB5A 1L2UA 3RITA 2YDAA 4CEUC 4HNVA 3SB0A 4RNHA 2ZUSA 1H7XA 1YXCA 3USZA 1W3JA 1EPXA 2WNQA 3NZQA 4CCEA 1DJHA 1Q7QA 2Z26A 2ALRA 4ALDA 5MKGB 3ICJA 3IK2A 5DF0A 1MUCA 1KCLA 5DO8A 1BXBA 4ORMA 1SFTA 4L56A 1CCWB 1EC9A 3UWQA 3E0WA 2PWUA 4IJCA 2VR4A 3IIZA 4Y9NA 4KWSA 1H0IA 2QCNA 1AJ0A 4E38A 4KETA 4XKYA 4K1GA 3IVSA 5IBXC 1X6NA 4JTEA 2ZE3A 4FI4A 2D24A 3OQEA 2ISFA 1XX1A 4NJHA 1NH6A 1KBJA 2FVMA 3ITGA 3JU2A 1SZNA 1FCVA 3U4AA 1B4KA 2OU4A 3K13A 4GFIA 4MM1A 2XTKA 4AYSA 4L1WA 3IUDA 3GXMA 3KWSA 5EY5A 2ICSA 1FBAA 1FY6A 3HJEA 2VFIA 2WV8A 4XX6A 2IPWA 3L0GA 4ZBCA 4PULA 1LWHA 3OIHA 1EJ7L 4NZ4A 1YXYA 2PLJA 4Z0JA 3J7HA 1NP2A 2F6XA 1JNEA 1A49A 3VC5A 3ZO9A 3AIVA 5C6MA 4XTIA 1N8IA 4K8GA 3FA3A 3S2LA 2FH6A 5FSDC 3B9OA 1H11A 3FVDA 3M46A 1CXLA 1DJYA 2BODX 3AUJA 3QV8A 1V8EA 3OBEA 1X39A 4MB3A 4IM4A 5CPNA 2ZRVA 4V33A 4UWMA 2WVTA 1KC7A 5BXRA 1EOMA 2HSAA 3PTMA 4FF7A 5EMKA 2QUVA 3L0NA 4NASA 4O15A 1W2PA 5C9XA 4MY8A 5CPMA 1XYBA 4LEQA 1SO6A 4HA3A 4B5TA 4PUMA 1SR9A 4HVXA 2XIBA 4JICA 1K6WA 2G41A 3MHFA 3R4IA 4LT9A 4A05A 4OBSA 5C9UA 4EXQA 3RAOA 5REQA 4FXRA 5AB3A 4AISA 3C3NA 4JN8A 2ODOA 3GU9A 1V08A 2Y24A 1KM5A 4HB7A 4AXNA 2UY5A 3BW2A 1TX2A 1KXQA 3NQ7A 1Q6CA 4DYJA 4D1IA 1EX5A 2BG5A 1K9TA 5JUVA 3QN3A 2W67A 1R9ZA 3H6OA 2HV5A 2WHLA 2OCZA 2X1RA 1LT8A 1FKXA 3H53A 5E09A 1ISZA 2I57A 3T0AA 3O0KA 2PTDA 1GG0A 4AHQA 5FAGA 3VE7A 3VZXA 4U5IA 2XIMA 2RUSA 3WF4A 4HPNA 3CPUA 3CU2A 2YDQA 1V5XA 4O50A 2PMQA 1XD0A 3KBSA 3D47A 2D1ZA 2BVYA 1XGEA 5A8PA 1KTBA 1PWLA 4PMRA 1X98A 1GK8A 4R9XA 1XLKA 4F3HA 3G3MA 2XFRA 3H2OA 3W2KA 3H21A 1ONRA 5LNUA 2HISA 2WJZA 3QV7A 1XC6A 4S2CA 4V1YA 4AD2A 3SRFA 2EF9A 5A6MA 2F38A 2QHAA 3QGAC 1DQUA 5A94A 1Q2SA 1OFRA 4FNTA 1E1CA 1CWYA 3U2ZA 3UXLA 1OFPA 1CYGA 4DXVA 3RM8A 1IWAA 1MSSA 4MWAE 2Q3OA 1F6YA 3E2VA 1F3WA 3LCIA 3OGRA 1MDRA 2A0NA 3UT0A 1O1HA 3GQYA 1HTIA 2PDPA 2QJGA 1HJXA 1K7EA 4Q8QA 4N42A 3AAMA 2QJHA 2P88A 4RV8A 3PPFA 5TAOA 4UZUA 3WQ6A 4HNOA 1D7KA 1EX1A 2BLEA 5HPOA 3HQPA 4DEFA 1NELA 5I03A 1G69A 1JGIA 1C92A 3PJXA 4O12A 4WQ6A 3O63A 1XLAA 4LVFA 4J3UA 3AS3A 1UP3A 4O14A 2HXTA 3GAYA 3DAQA 3ZM8A 4OV9A 3GW0A 4IG2B 1EDQA 3CPRA 4X0VA 4XZ9A 4A8RA 1CEOA 5C5YA 3QMTA 4C1KA 2O4QA 3M5XA 3EBVA 3M0LA 3H7UA 1NAL1 4UB9A 4Q33A 3U4FA 2XIJA 5CJMA 3WK3A 1XIGA 2HZGA 3L67A 2A21A 2POTA 2YW4A 4RE2A 2YL9A 1XDJA 2YXGA 1LOSA 2Y7FA 9CGTA 2PDYA 3RNDA 4RNJA 4QJ5B 4NF7A 1IXOA 3QGKC 3EPMA 1HGYA 1WXZA 3MHGA 1Z42A 4GNKB 1W2VA 4JX5A 1RQBA 4MAZA 8TIMA 4PMNA 3MI3A 1T5AA 1G67A 3HPAA 5I3KA 3TOPA 4BK9A 3QV6A 1MDLA 5BRPA 1ME7A 3VX0A 3N17A 3VD7A 4IFRA 3KRSA 4UCFA 1GEHA 1QNPA 5ABEA 1OFEA 4BEUA 1GG1A 3IVUA 4PL2A 1J2WA 3IK4A 5FCZA 4DF0A 3LERA 1F6KA 4HIBA 1DVJA 2ZYFA 4CU7A 3ARWA 3MT1A 4JL2A 3P14A 5JMUA 1AVAA 1UKQA 2B7PA 2VVSA 2B7OA 4O8AA 4MLJA 3G3DA 4OIFA 3RDKA 3UWEA 2JFEX 4AC1X 3T0DA 1UROA 7REQA 1BKSA 2OT1A 3CJPA 4Y96A 3NCOA 4V28A 4JKMA 2WNWA 3ZIZA 5M03A 3MCOA 4K2SA 3UXDA 1E9LA 4GOAA 3FKRA 3UZ5A 4LB3A 1UJQA 2H9AA 1OGSA 4JQ2A 3KFTA 3VE9A 2B0MA 2NZLA 2X1UA 1EP1A 5KITA 1RSCA 3ENLA 2Y4SA 3WQCA 4W86A 1MO0A 1QHZA 4AEFA 1KD0A 1P48A 2GL5A 4HHHA 4GIAA 3IEBA 3SI9A 1RD6A 3T1GA 1F8MA 2DH2A 1B54A 3CLWA 2CHNA 3B4UA 1XG4A 1LQAA 1H7PA 1LROA 1CW2A 2GVGA 3E2RA 1YDNA 3AJ7A 1J2BA 4BHYA 4YTSA 2J88A 2GJPA 4IPPA 3RILA 2FPYA 1NFPA 3INPA 2QF7A 4NAFA 2ZA2A 2VEIA 3TFCA 1HKIA 3W7CA 1ITCA 4M6QA 3MY9A 1JCYA 3VI2A 2OSYA 1YTKA 1BXCA 1I45A 4N4QA 2C16A 3WQOA 1C9DA 3EB2A 4GH1A 3LBOA 1RCXB 3VCRA 4MZ1A 2ZX7A 3PG8A 4GH3A 2WOQA 3ARXA 3BVJA 2ZZ3A 3C2YA 3CWOX 3U7VA 4ZZ9A 2VFFA 3IRSA 4TVUA 1E3ZA 2W66A 4KGJA 5I07A 3EX3A 1BTCA 2BXVA 1EHAA 4H6QA 4NZCA 3E9AA 2DP3A 2VFEA 2CEQA 4XAGA 4YVXA 1HKJA 1Q6OA 2BGNE 3M07A 2XSXA 1H2JA 1CDGA 1LRQA 1TVNA 2OKTA 4Y90A 3B40A 2YL6A 1TZ9A 3PUEA 3BUVA 4EKJA 1DIKA 1KXVA 3NO5A 1SFSA 1OIMA 2NWSA 2VZVA 3LM3A 2AL1A 2ZVRA 5M5DA 1YTDA 1UR9A 3C0QA 3FHAA 3VILA 3BAXA 2VR5A 4F4RA 4DYEA 3U3HA 1QO2A 1DIEA 3R25A 3ARRA 4JIRA 4QLKA 4U3CA 4YNGA 3W1UA 3IJ8A 2Q8XA 1M7OA 5KSWA 1XIHA 1I6NA 1TJ2A 2RH9A 1FXQA 3PZVA 1W1IE 3KW3A 4W88A 1V0MA 2QGHA 4H9ZA 3WDHA 4HOWA 4LYQA 4IPJA 3W85A 3GHRA 3NZPA 1TPH1 4WY0B 3GU1A 1VHNA 1CGVA 4ZO6A 1F6PA 3TTOA 5BU6A 4JTGA 5T26A 4E4UA 4MNKA 3UR2A 5HQLA 2WK2A 1VPQA 3E5PA 4LCSA 3VD3A 3GH4A 3W7DA 1FWIC 2E1DA 2X7VA 1R87A 3BAJA 3NQ6A 3NR0A 1HKWA 2YL5A 3LCLA 3U2CA 1WZAA 4S3GA 2EPHA 3WSUA 1K4GA 1KV5A 1P7TA 1A4LA 4A8IA 3I3BA 2QVHA 4R53A 4ACYA 1V0LA 1TWZA 2W27A 5D9OA 1VH7A 1Y7VA 3A3XA 3EDJA 3SCPA 1DJNA 4Z2IA 4BQ2A 3LG3A 4CNSA 5LA2A 3BLPX 1JYWA 3OYZA 3VGHA 3PPHA 1BGGA 4XAFA 1V6XA 6XIAA 2Y62A 4LAKA 4IMFA 1HUVA 2CW6A 3L4VA 3LV6A 1XIEA 3ZLFA 3TCSA 2YDSA 4Q4SA 3C6CA 2WM0A 3L2MA 1LDCA 1VJSA 4NIRA 5IDZA 4BWLC 1MXGA 4HZMA 4ADSA 3LUTA 2WCSA 4IQJA 4D6DA 2VC9A 4UMAA 3GC4A 4GLEA 3NDYA 3V35A 4JBRA 2Q8ZA 3NQFA 4HZ8A 1XRVA 4AEEA 4PB3A 1LLOA 3AZSA 1SSGA 3MSRA 1R8LA 1FWNA 5ABTA 2CYGA 1A5KC 3LRKA 3IGUA 5HA7A 1X7IA 2VM8A 1XCWA 2PWDA 1F3TA 1BAGA 4UR9A 3AOFA 1GQKA 4U4MA 2Y5EA 1M7XA 1DE6A 1RCQA 2XSBA 1FFQA 4CN1A 3DUGA 4MADA 3A3HA 2GJXA 4XD5A 4C7FA 1US0A 4PEKA 4JX6A 3K2GA 4NNAA 1RVGA 2BB0A 4O8RA 1AW1A 2HCVA 3L4WA 2XU2A 5CSYA 1U30A 3EMZA 3KOYA 2WVVB 4N4PA 3NIYA 4ZQMA 1IIGA 2R1KA 2ZIDA 5ABFA 3ZR4A 3SUTA 2VZTA 1PSCA 5CSUA 5AC8A 4Q4KA 1G4TA 3VFCA 1V0NA 1O5QA 3CMGA 1JUBA 3SECA 1MZRA 3FX4A 3APYA 2YCLB 4HOXA 1TWDA 3UNTA 2PLMA 3E96A 4JDBA 3WFZA 4TTGA 5FOOA 1W91A 2NSXA 4AIEA 3H2CA 1HKKA 3T40A 4XIAA 1NSJA 4R85A 4CQ8A 3CEPA 2DPEA 4EWND 3PM6A 1QAPA 4HPXA 1ICPA 4IJRA 1GYMA 1RA5A 1HJSA 2CKSA 4BA0A 2HQAA 1K8CA 3W73A 1EA0A 1QPKA 5I24A 2VHLA 4D72A 4TV6A 3IGXA 2YA0A 2WJFA 3H23A 3LCHA 4HU4A 3P82A 4IMGA 3GSMA 3VMNA 2HROA 2H8XA 3UZWA 5AECA 5DBUA 3DFSA 3AIUA 1XF0A 2V38A 3W4RA 1CPUA 4G7EA 3F4WA 4MF4A 3OZYA 3OEXA 4QDWA 5F1VA 4WGXA 1S2VA 3WNNA 4C6OA 5D33A 3F5JA 5K9XA 1P4CA 4IIBA 3TOYA 3B0YA 3L2LA 2WAGA 2J24A 2D20A 1AMKA 2IPFA 1UR2A 3DFNA 4I9MA 1XRTA 2Y5SA 3VUSA 3NVDA 4C6BA 3XINA 1ZBCA 2BV9A 6PTDA 2P3ZA 5FF4A 2VGGA 3KVMA 1XDMA 3KEHA 2GVLA 4RK8A 2J9YA 2QCCA 1XIIA 1QOQA 2GOKA 4LTSA 3URAA 4XUYA 1KV8A 3JZUA 3SQMA 4ACZA 4WJXA 2WWCA 4R33A 5E0CA 1BD0A 4CNTA 4PTMA 2V5DA 5F2GA 1LJYA 4XSMA 4UOQA 4US5D 1KR1A 2Q8LA 1RPXA 1EPVA 3HBLA 1JCTA 4IISA 1BVNP 3T9PA 1KNWA 3MYOA 4U2ZA 4E2DA 4DJED 4O13A 1GPWA 5T9CE 3NQCA 4AWUA 2F6KA 3Q4DA 5BYWA 1UOKA 3DENA 1IEQA 1PHQA 5CQ1A 5DMLA 3HPFA 4JKKA 3B0UX 1B90A 1X97A 4JTUA 4DXKA 3DI1A 4J7RA 4H8HA 3I68A 3AS1A 3GAKA 3KOZA 3U7BA 1PJ9A 3K8KA 4S3CA 2V69A 3NZGA 4LW7A 2E1WA 3FGCB 1P6BA 1RALA 4WDWA 3G1XA 1FDYA 4KCWA 4UFKA 1Q13A 3FIGA 4DJDC 4M56A 1K9FA 1K7FA 1V77A 2NV2A 3CGTA 5HUPA 3L21A 1PDYA 4E2BA 3I4KA 3PN8A 4DJDD 3V36A 3WLHA 2HTMA 2YBTA 4DY1A 3N73A 3NEVA 3WFAA 1XJBA 3CEUA 5JBDA 1UWTA 3BCDA 4O54A 3O06A 3SBFA 1JXJA 1CLXA 2ZA3A 3N04A 2V30A 4REQB 4B9YA 1HJVA 1FWGC 2AKZA 2BFGA 3GTXA 4IIDA 2JK2A 3Q94A 4WZHA 1XIMA 4PTNA 1SMAA 1EJRC 5MHBA 2CWXA 4C5ZA 2XVNA 3SURA 4NYUA 2EO7A 1XD1A 5M3WA 1MEHA 3URNA 3B9NA 3BC9A 4Q8PA 3EX6A 8CGTA 3KTSA 4Q4PA 1MFVA 3G1FA 3H22A 3O2LA 2Z6IA 4LUTB 5FJJA 1ECEA 3WQEA 1QCWA 1LWIA 4MOZA 1XLCA 3G18A 2X2GA 3PJWA 3DZ1A 3A5VA 3LPOA 4W9TA 2WM1A 2XIOA 3NQBA 3CV2A 4AWEA 2G4JA 2VGBA 1C9WA 4HKPA 2X1TA 4PODA 4BF5A 1TWIA 4GZEA 1Q6GA 1FWRA 2VP8A 5E70A 1E70M 3T7VA 1HW6A 3QKZA 2GPTA 1AMYA 2ZRYA 5FJTA 2MUCA 4UNKA 1J0HA 4OECA 4XO7A 4S3FA 1S3TC 1RLCL 2WHKA 2YCIX 2YFOA 2GDVA 5AZ0A 3T0BA 4ORIA 5C55A 1XSIA 1ZNNA 3ID7A 4YXGA 1NIUA 4CN4A 4C6MA 4PE8A 2GGIA 1S5VA 4RCXA 1J93A 2ANUA 1JCLA 5LYRA 3W7EA 3GXIA 2RGLA 4C90A 1EJWC 2WXDM 3W2MA 3DIPA 2DV0A 3GHTA 4QGCA 3CV7A 1BPLB 3TR2A 4B9ZA 1BG4A 4TOQA 1QUMA 4PSRA 1JL8A 4W8LA 1KM1A 1Z8AA 1WDSA 3SM0A 3AISA 4QIUA 3BG3A 3RJYA 3S2JA 3S5SA 3EOSA 4UOJA 2VRQA 3W7NA 3SJ3A 3GR4A 3UXIA 2C1GA 3NYDA 3AICA 4J3TA 3EDKA 1NJJA 2EPMX 4HSNA 3QR3A 1LOLA 4YTRA 4U28A 2Z6JA 3KAOA 4JOMA 3QZAA 2V3GA 2WPBA 4DN1A 2EQDA 1ZQ5A 2ZC8A 3M6YA 4LUSA 1QW8A 4J5NA 5L6UA 1D3HA 2GQ3A 3AZTA 4ZQNA 3WLJA 3KL0A 3GYEA 3UVIA 1LTDA 2C15A 1MFUA 1ZUAX 5D04C 1L2QA 1O68A 5CLWA 4GCAA 3QTGA 5BOFA 1ZTVA 1GVIA 3APGA 5LHFA 1FFRA 4C6IA 1TCDA 4IIFA 4LEFA 3BW4A 3W7KA 1XH2A 2F9RA 3RLVA 1JIBA 4OVXA 2TODA 2ZUUA 1U5JA 1T6MA 5G5IA 4A21A 3F2CA 1K9DA 2DZUA 3ARQA 4GVIA 1YNQA 4QTGA 3GNRA 4IGMA 3LRLA 4WOZA 4XAYA 5K2ZA 4D8ZA 3FSUA 3R43A 2NLYA 1W37A 3II1A 3S1UA 5FESA 4UTUA 1FWBC 3H7RA 4K36A 1E1FA 3LQGA 3TDFA 4QQUA 3LLXA 4Q8WA 2XH0A 1CLVA 3SSJA 2PGEA 3N3TA 3WL0A 3W37A 1OGGA 1W9PA 4Q4OA 3GG0A 2J13A 1NOUA 4S3KA 1QWKA 1QNRA 4GYPC 3GY1A 1TUFA 3GH5A 1RQHA 1OINA 4I9AA 4TMCA 2IKIA 1CXFA 4JTLA 4CQBA 4PUKA 3GXTA 3ONBA 2VZUA 3TTEA 3BXWA 1GW9A 1H1ZA 3EKGA 4NI3A 1H4PA 5KTLA 4XSLA 7TIMA 3W81A 4KIEA 4FNQA 3N1AA 5AN7A 4XKMA 2CBIA 1GOXA 4AY1A 4M3PA 1HT6A 2WZHA 3OQ8A 4R5EA 2CWNA 2Y7EA 2Z1XA 4ZSTA 3L2IA 4F8XA 3CIXA 3VIJA 4CD8A 1S5WA 2J7DA 4DI9A 1JYXA 3DKJA 1DXEA 1VIWA 4IMCA 4EOUA 1ZU8A 2ISVA 3VD9A 2WNZA 3PBGA 1QNVA 5CJNA 4PCPA 1W1TA 3VPLA 1R47A 3VD5A 2OFJA 3LDVA 3HG4A 3N34A 3KBWA 5EBUA 3DC8A 1ADOA 3CUFA 4QX4A 4WR3A 4EPEC 4KWOA 3SUSA 1AJ2A 4GZIA 3N6QA 2OO6A 3S2MA 1H7RA 1ZCOA 3E0LA 3GD6A 1VYSX 4UR8A 3MSDA 3R13A 4BF7A 5D32A 1UD6A 4PUUA 1S5TA 5AHIA 5AC4A 2JIEA 1WPCA 2G3JA 3GLCA 4HMCA 1F74A 3NXLA 5A8GA 4ZFCA 3C56A 4GQGA 2E9LA 2FDSA 1DL3A 4B4HA 1PYMA 2DGAA 4IGNA 2Y2WA 2F2HA 2OWXA 1ZAJA 1WOBA 1OEPA 1J0IA 3W1MA 3CTLA 4GI4A 2CFFA 2CCRA 1AD1A 3WLSA 3GTNA 3W7HA 1ZL1A 2OMAA 4L5ZA 3N2OA 1E0XA 4N9BA 1SO5A 3QF0A 3ARVA 5DEZA 4HHPA 4KRUA 1E6SM 3RLHA 3M0JA 1TPEA 4Q22A 1E73M 5EYWA 1LBMA 2VUYA 1IXPA 1SO3A 1XBZA 1IV8A 3VUPA 3DU0A 3W1AA 2XVPA 2NWRA 1QO5A 3HF3A 3S6OA 5CG7A 3URQA 5LA1A 2R1LA 3B3DA 3MCMA 1E71M 1G4PA 1E4NA 2OYLA 2KX9A 3OA3A 1DHPA 1IIHA 2A6LA 1R86A 4QROA 5G2WA 1Y5XA 1JDAA 1W3TA 4Y2WA 3LGGA 3OZPA 1FQ0A 3MW7A 2A6NA 1WNOA 4QCFA 4QEHA 1HVXA 3SZ8A 4IMAA 5BROA 4M7TA 3OOQA 3TE9A 2D2JA 4K38A 5CPQA 3V18A 4GACA 3ZWTA 1Q2RA 2RDWA 4HPJA 2R1MA 4P61A 2X1IA 3RHGA 5HATA 4AD1A 3ARZA 1NEYA 1KGWA 4GXWA 1SZFA 2W62A 5A8OA 3POHA 1OCBA 2OEKA 5MKGA 1EYWA 3QEZA 4EK7A 5AKQA 4A3UA 4AZ7A 2B7NA 9RUBA 2VXNA 1Q6FA 3SY8A 3HU7A 1RJPA 5EA9A 3BAKA 3ABQA 1XSKA 2W5FA 3ORWA 1OT1A 3LM7A 3GX9A 3QR0A 1JZ4A 4BI7A 3AS0A 1E6ZA 5BWFA 5F2MA 2HXUA 2C91A 5XINA 1D9EA 4H7CA 1R7OA 1A5SA 3GNXA 4K68A 4WEVX 3ATYA 2Y7GA 1OZQA 3TW7A 1IGWA 4RZ4A 4Q32A 2WKJA 4CNPA 1AA1B 3PF3A 4WX2A 3H2MA 2FFCA 1IGSA 3B03A 1US3A 3CHFA 1B31A 1E43A 3PR2A 3UWUA 3ABOA 1R9XA 2NQJA 5KEZA 1US2A 4L6OA 1L6WA 3BMXA 3DHUA 1VPXA 5H8MA 2Z0IA 1NM9A 2CITA 1M01A 3PB2A 5DQPA 4US6A 3VD4A 1SGJA 3OW1A 5E6YA 2QIWA 5CC3A 1LUCB 4MY1A 4YWIA 1A53A 1UH2A 3BQ5A 1O4UA 3HV8A 3M0KA 2DZTA 4PMQA 4H8VA 1W3KA 1IXQA 2Y88A 2C13A 3FW6A 3EWZA 3KS6A 1EEPA 3ITCA 5EPDA 2CC0A 1NWUA 2E09A 3P80A 4FIQA 3FYPA 1JZ8A 2OG9A 3IJLA 1TPC1 4EPBC 3Q37A 1BYBA 4IX0A 3OODA 1F5ZA 3DN5A 3OLDA 3UJEA 3ZT6A 2PTWA 3U5YA 4DZ5A 4HN4A 4JX4A 4O10A 1IE7C 7ENLA 1D3GA 2ZX9A 3W70A 3H24A 3VIKA 1VEPA 3F2DA 1FRBA 4L4LA 4M0XA 4QP0A 4J2MA 3W1NA 2VR2A 3VIHA 1KO0A 5CZKA 3AROA 2C1HA 2CLHA 4GY1A 3T4WA 3W1QA 4K3ZA 1AH0A 1ZP4A 4DBUA 2OEJA 2OZ3A 2J7EA 4JL1A 5GNZA 1TA3B 3TAOA 3DHPA 4MFEA 3A9IA 3HTWA 4X63A 3UESA 3ITOA 4INFA 2O9TA 1JAEA 1UWAA 2WMIB 3UG4A 3K46A 1GJWA 3BURA 1GTEA 2YLAA 2WMFA 2ZXAA 1UPMB 5FF7A 1GQIA 3BLEA 3KRBA 1O95A 3GHSA 1HN1A 5C9ZA 3AIQA 8RUCA 4ZB2A 4N9CA 1JUKA 4UMCA 3SCRA 3R89A 4W7VA 1KGUA 2FZDA 3O05A 3CTTA 1YW1A 3SCSA 4X9SA 4U31A 3CO4A 1IF2A 4NYYA 2PDIA 5A8MA 3TP4A 3PBUA 2INEA 2W91A 5CSRA 1GZGA 5I2UA 2ZX8A 1P1MA 4CCDA 4C91A 3OVRA 5HOSA 1YIXA 1S5MA 3I10A 4GBDA 2C6QA 1B30A 4Q6JA 2PI6A 3CAWA 3PNUA 4PUWA 1TO3A 1JZ5A 3M16A 1JPIA 3PJTA 5CPSA 4IG2A 2A7NA 1WZMA 3KBJA 4HNTA 4UTKA 3D5HA 5C9RA 2OZTA 1MW2A 4IJBA 4O4WA 3AU2A 3P3BA 3CXOA 4MB4A 1LORA 3ITYA 1W17A 1P6WA 4C1NA 1M9HA 1UP0A 4YMZA 1LT7A 5A6BA 3VGDA 3W25A 3DYPA 2OSWA 1WKDA 1R85A 1RAKA 2VD8A 4R27A 4ML9A 4YIWA 1GZJA 3BCFA 3FLUA 3USBA 3VYLA 3S5YA 1UR3M 3CC1A 3VDAA 4AD3A 2INZA 2OODA 1MXDA 2ZQ0A 2JF7A 1BSIA 4QRNA 5KZ6A 1Z32X 1DWHM 4AH7A 3UJ2A 4NQ1A 4RNFA 3W0KA 4XWUA 1XHGA 4HNCA 4D8AA 3SGZA 4GX8A 1KQYA 1U83A 1XIFA 5G2IA 1H60A 2A5HA 4JTSA 5M17A 5DT7A 3WCZA 1FWWA 3FEQA 1EB3A 2FQIA 4Y9AA 2XVLA 2VJXA 2WWDA 2WYSA 4R7JA 5HR7A 2PWVA 5FI8A 3HFTA 3R6IA 2NQ9A 5I3HA 2CLIA 5FIPA 4FHAA 4JIIX 4WKAA 4BQ4A 4QQ3A 2LLEA 1Q4NX 2GUBA 1TIWA 1JGMA 4NI8A 1V3MA 1FCUA 4KWWA 2YBUA 3N2XA 1UR0A 1W9DM 4G56A 3VGFA 3QOMA 4LC8A 1EC7A 4H9MA 2G3IA 3EOEA 3WDIA 2XWDA 2VC6A 3NO3A 5C2GA 1H49A 4LC6A 1TTJA 2V8ZA 4RX0A 1MYRA 3V4BA 1FDZA 3BSHA 3G5EA 1FH8A 2J79A 1M1BA 1WZKA 2I56A 1MZHA 8A3HA 4M6UA 1OYAA 4WIWA 3IRDA 2P0IA 1K4HA 1OT2A 1VEMA 4BR1A 7PTDA 1VBRA 4C65A 4ZR8A 4K39A 3NL5A 1EC8A 3W9ZA 2PB1A 3STEA 4GIYA 5FJIA 2FIQA 4AD0A 3NZ1A 3UWYA 1GOMA 2J7GA 4KEZA 2AAMA 2FZNA 1ZP3A 2X30A 4QISA 1PIFA 1V6YA 4IXHA 3W7QA 4H6KA 1O5RA 1A5OC 1VHCA 4GX9A 1RLDA 3P5ZA 2FMNA 2QLYA 2CXGA 3EWUA 4ATWA 4YLWA 1Q45A 3VKJA 3EA1A 3GH7A 3N18A 3N6HA 3GXFA 4LQ1A 5FJRA 1F07A 3BQ6A 4TV5A 4MJZA 3G1SA 3U57A 3MV01 4NRRA 2GVJA 1WB0A 4MTVA 3MDUA 1WDRA 4CVUA 1KW1A 2G97A 4DAIA 1J6PA 1KGXA 1GKPA 1AUSL 1W9XA 3TQKA 3L4TA 3KUMA 4WDUA 3UR5A 2G3NA 3VA8A 1UZDA 4AZ6A 3H8AA 1S2UA 2UV8G 2FHCA 3MBFA 2YYTA 2FJKA 3TYCA 2XIQA 5ECUA 2PDBA 3RIKA 5LIKX 3VNIA 4S2BA 4AB4A 4UNIA 2D22A 2JQXA 4XISA 3LV5A 2VFDA 5H8UA 5F4WA 2Z7GA 3H4XA 1GYLA 4ZEPA 3PS7A 3FA5A 3UQNA 4JAWA 3VDGA 1QT1A 1BHGA 1TRIA 4ICNA 2O7QA 3B8DA 1QJWA 5CPOA 4XO6A 2A79A 4F0LA 2Y8KA 3GFYA 1RQEA 2WCGA 3L4ZA 4KCVA 1NVMA 3M0ZA 4RZ5A 3WF3A 4JN7A 4LUYA 4XD3A 4UTLA 4E4PA 2GDUA 4M24A 3G8RA 4EACA 3VIOA 2FZ8A 1UKSA 5T91A 1Q7MA 3RPDA 3HB9A 4IHCA 5CCZA 4WLCA 4QG9A 1EKOA 4BJHA 2O9PA 1NWTA 2E77A 4WY0A 4FNSA 2PRLA 4FNRA 3TYBA 4RE3A 3M5VA 2D0FA 1LQ2A 1XLJA 1EZ2A 3CHCA 3TZNA 1TSIA 4YWSA 4AZGA 2PGRA 2W6RA 1WXJA 4KEVA 1OABA 5JVLA 3VCNA 4FZIA 2V2CA 2XHYA 4AU0A 2WMGA 1XCFA 3RJXA 5A6LA 4M5PA 2J6VA 5HNNA 2WZTA 1V3HA 4MKVA 4BEQA 4CVWA 1UWSA 4AD4A 3TLQA 2I5QA 4CD7A 1LRTA 1KRBC 3LB0A 1G9HA 4URIA 3WNLA 1HJQA 1HXJA 3R0UA 1EH9A 2XN2A 2E5CA 3PWAA 1E6QM 3MMTA 1F4AA 2Q71A 3BANA 1PL9A 2Y5JA 1J8VA 3MUIA 2GQ8A 1PZ3A 4WRHA 4QE1A 3D3AA 1REQA 3WLOA 5C71A 2NUWA 3M5YA 1WKEA 3NOYA 3OZMA 2CXEA 4DUWA 3GU2A 1SM9A 2Z25A 2GWNA 4MNJA 3G1HA 4C5YA 3EPOA 2NUXA 3WLNA 4ZTYA 4J1OA 3DKLA 2J74A 2QAPA 3FXGA 3SUVA 4FP1A 4O53A 2H3DA 4ZO9A 2UBPC 2X2YA 3G24A 4GJIA 1B3WA 4BY3A 1CGTA 4UFHA 5FKYA 1W5NA 2G95A 3N14A 5CG0A 5LIYX 5HULA 5BWAA 2Z1VA 2XSAA 7CGTA 1IEIA 5AYYA 1IHIA 1NDZA 1RCOB 2FB3A 4GVFA 1E5JA 3WK1A 4EANA 4RE0A 1V02A 1OD8A 1W9BM 3WQPA 3CIVA 4GMEA 2YBVA 2QUUA 1EO7A 4C7GA 1XIJA 2C1IA 1BYAA 1POKA 2WBKA 3UZZA 5CZSA 4MVAA 5M1TA 1TPFA 3A21A 3UJSA 4H7ZA 3QHMA 4MHBA 1ISXA 3REQB 4ZXOA 3BLIA 2XGZA 1BKHA 1MEIA 3JVAA 4IP7A 4FLOA 4O1FA 1ZLPA 1R2TA 3WENA 1FX6A 2QPXA 2UY2A 2BDQA 4CGTA 1KRCC 3U0HA 2GJRA 4XZIA 1TJPA 2WVVA 1X6LA 1HQTA 3FXYA 3ZR6A 1WUFA 2WSRA 4K6AA 4TVDA 4LVAA 5CGTA 2QVNA 4TXEA 2GK1A 1HZYA 3M5ZA 2FVLA 2DORA 1VENA 3YPIA 1QOXA 4DNHA 2QCHA 4LJ3A 4ROPA 2YCLA 3GG8A 1V0KA 4PTXA 2XM1A 3KS5A 4BKNA 5I5RA 1N8FA 1AZ2A 1QPRA 1UQYA 3D3FA 1YXDA 1ZRQA 2PWHA 3N15A 4RE4A 3NQDA 2QV4A 3EA3A 2J9XA 4MUPA 5ECVA 2FPVA 3E2QA 1QTWA 4XTDA 4D6CA 1ITXA 4MPQA 3PG9A 2ZKMX 4NZ3A 1LQ0A 4V15A 1XYCA 3NL2A 4ZTXA 2OLHA 2V3DA 2VTFA 3WQFA 4M82A 1F4HA 2ZUMA 2P76A 1EA9C 1BXNA 3Q58A 3VGBA 2PD9A 2Z1KA 3CS2A 2PP1A 4LGXA 4QG6A 4I9JA 4IL2A 4EF9A 1W5MA 1GQNA 3DEQA 1PTAA 4GK8A 3QSRA 2BOEX 2YB4A 2QCEA 4P7NA 2A3BA 1OFOA 3VNZA 3STFA 2OSXA 5CGQA 3O3RA 3OJGA 3UGRA 2IUZA 3GUGA 3WL1A 3NTYA 4UOZA 1VGAA 4YPJA 2VDIA 4LY4A 4L64A 4HA0A 3GS6A 3I4EA 3VNDA 1BSLA 3FJNA 1GUVA 4ILSA 3IJ7A 5FJPA 4UFLA 4Z2LA 5CEWA 1K77A 1HKVA 2ATSA 1UBSA 3I6EA 4GWEA 1VYRA 4AQLA 3KCLA 5DCDA 5ABGA 3C2EA 2I9EA 3UR8A 1E6XM 1WAWA 2PDNA 3NVTA 4WVXA 1W1PA 1VAHA 3E1F1 1FTXA 2QCFA 4C6LA 1B3OA 1QU4A 3CMFA 5M2FX 3W7LA 1DWIM 4O57A 3TONA 2HJPA 2FKPA 4NILA 3OG3A 3C2RA 3BOFA 1EP3A 4EAYA 2PF0A 1MW1A 3L23A 2E8YA 5IM51 3HIJA 3ZT5A 3S46A 4KBXA 1KXHA 1AQHA 3CZ8A 1V3JA 3TXZA 1E0WA 3LCXA 5D2YA 1DORA 2V3EA 3GFZA 4O18A 4Q8TA 3LPPA 4HNUA 1I0DA 2EG6A 1XM3A 2OELA 5G4EA 3U2OA 2WVUA 3BJSA 3DFYA 1J11A 1KFLA 5TIMA 4ZVJA 1YADA 1W6TA 2O7SA 4R34A 1JZ6A 5BOOA 4RNIA 4AZHA 3M44A 3OPSA 4LVDA 4WDTA 4V1XA 4JS3A 1ML1A 1DPMA 3AMDA 5HUOA 2OQHA 2J7FA 4E3VA 5EBAA 4H9TA 1ZJHA 4XKYB 1HFBA 4ZE4A 5KZEA 3EYPA 3TUUA 4GY7A 2DVXA 4IMEA 1VBHA 4Q8OA 1EP2A 4N6EA 1MW0A 3W24A 3GVGA 4PUDA 4UFMA 2ONEA 1Y5WA 1OYBA 1OIFA 3FGCA 3VOIA 5I6SA 5I7GA 4M29A 3BH4A 4N9DA 4AZ5A 2PA6A 3V7PA 2TYSA 3PFRA 4PBGA 2CLOA 1G4EA 1P0NA 2QCGA 1QWGA 1XCXA 4F48A 2YB1A 5K4XA 1E40A 3IIOA 3ZZ1A 2VQTA 3RPMA 1Q63A 3CHDA 3MVIA 1FXPA 2BHUA 5HMFA 1MQRA 1QDSA 3A47A 4XQ6A 5K7JA 2CBJA 1MW3A 2DEPA 1CGUA 3BV4A 4LBRA 1VC4A 3LMZA 3RM9A 1OYCA 1PO9A 2REQB 4NHVA 3TV8A 1RJQA 4S3EA 1O6IA 3E49A 3EDFA 1F2JA 3B05A 4NJIA 3ZS4A 2RDTA 1JCMP 1C91A 1WOAA 2R91A 3E2SA 4I5RA 3V5CA 4NJJA 1IQ8A 3AXIA 3K1DA 4D6JA 4XB3A 4LUTA 5CJ5A 3ZFHA 4DBEA 1U33A 4QHRA 3A64A 5HMSA 2EJAA 1ONEA 3UCQA 2V68A 2OLSA 3GTIA 1PCKA 2QS8A 1KB3A 4UIOA 4YYCA 4GYJA 2R6OA 1AL7A 5EMUA 2TRSA 4KKXA 4XZLX 2C8NA 1JPHA 3B9AA 4BWLA 3MS8A 4PMDA 4DLMA 2X0HA 4XUGA 3LD5A 1NF7A 4K7VA 5A1AA 5HBFA 2J4GA 5DMMA 5DMYA 1R38A 3UJRA 3CB3A 1ITQA 2HVOA 1LRNA 5HWJA 4WKHA 5CPLA 3PP7A 3TQPA 2PDWA 3WBYA 3GBEA 5DXXA 2H6RA 3HGRA 4KWVA 3O07A 2ISSA 3R2GA 3MB9A 5E9AA 3PPCA 2ZZ1A 2HMCA 3P6LA 1KFCA 1TB3A 4XZBA 2PDMA 1G94A 3M1ZA 3W27A 2J62A 3T07A 1L6FA 3ANVA 4Y8EA 3BOXA 4UTWA 4TX8A 1UMLA 3VTRA 3WNOA 4IH3A 4QE5A 4IOTA 3Q45A 5ABHA 3GKAA 1OG0A 1M68A 1PKYA 4Q7BA 3QW3A 4IZGA 3T78A 2Y8UA 1RD5A 3QW4B 4Z2KA 1J01A 2PODA 3TA9A 1VCGA 4S39A 4H8UA 5LA0A 3GYCA 4HCHA 5LHEA 2PDXA 1XIBA 3F4VA 4PZVA 2HBXA 1SFLA 3WK2A 3NXFA 4TQTA 1ZBWA 4MPKA 3CHVA 5HJLA 4B92A 3OGSA 2ZWYA 3ZT7A 4OUEA 4UC5A 1W31A 1EOKA 1C3FA 4JTRA 2BY3A 3FFSA 1TV8A 2ATMA 4IT1A 1A5LC 4CEXC 4ONVA 2DJXA 3ISIX 1BWKA 4DIAA 3LRMA 3KCOA 4WGHA 2J78A 2AGTA 3B8VA 4D6IA 1H62A 1Z44A 1W1VA 1QNSA 4JHMA 2XZ7A 4L9ZA 4A3HA 1XBYA 1VRXA 4MWAB 3C2OA 1M7JA 2VDHA 4X2PA 1VFOA 4UTFA 4O1EA 2A3EA 1VRDA 4PRTA 4ZCWA 2J9ZA 3I3DA 1M3UA 3ARPA 3QFWA 3UVAA 3W82A 2QJMA 5A3HA 4E5TA 3DBPA 4LU0A 3SCNA 4LCQA 1XLFA 3CYVA 4JTFA 3WQWA 4O0ZA 5I3JA 4DWDA 4PL1A 3ZJ6A 3P67A 3CWNA 4F0KA 4DYKA 4AMAA 4TU1A 5C0QA 5IXEA 4GIEA 4DUVA 4IICA 2QPSA 2QF8A 3CAVA 1C90A 3LHTA 1EUNA 3C52A 1R46A 2NVCA 3T05A 4LS2A 2V81A 5I00A 1Z9AA 4Y9MA 5FJOA 3MPGA 2PSNA 2R14A 3ERPA 2QGYA 3ARSA 4UUIA 5LNRA 4A29A 4W7UA 3L5LA 4DB7A 3LXAA 3RU6A 4LNYA 1TELA 1R3WA 1PYFA 4CQCA 3LA4A 4DM2A 3NQEA 1RPKA 5CH9A 2HVMA 4FX6M 5JH2A 4CNOA 3LHWA 1NFGA 3AHZA 3SCVA 1FHDA 3LCFA 3SQSA 4GIRA 5HANA 1T8XA 2VNCA 3AQUA 1IWBA 5EB8A 4GUGA 4DJEA 3R5EA 1XDLA 4PFMA 1DJGA 4PFHA 1H7NA 1MWOA 3LI0A 5EMLA 5LGZA 4E0CA 3RRXA 3BDKA 4LUJA 4XAPA 3T44A 4B2DA 1BQCA 3ARUA 3G0UA 1A80A 2E68A 2PS2A 1BTMA 3T8QA 3RRAA 3LXCA 4B5SA 1R5YA 5AYXA 3K5XA 4OWGA 3UWWA 2ACSA 2P8CA 4JQAA 3PY2A 1W1ZA 1W54A 3B0XA 4MFDA 4UCGA 1QPOA 4GVHA 4PB4A 4B15A 3MP4A 3W2JA 1GOOA 3MHUA 2BBFA 4I8YA 3FAWA 2W79A 1PE1A 1W5OA 3UU0A 5AC7A 2PEVA 1F73A 3N2CA 1L6YA 2CETA 3T09A 1GOIA 1Z69A 4NAFB 1J0YA 4ZA0A 4H2CA 3R79A 4DXXA 1KCXA 3CM4A 4IGHA 4PR4A 1JCJA 3CQIA 1HL8A 2QUMA 2C3ZA 1PIIA 1X96A 5GQBA 4H7VA 4YCPA 5DX7A 1OK4A 1UJPA 1XLGA 5JQ9A 3W76A 3T8LA 2FYMA 2V2DA 5J5DA 4C6PA 4RDZA 1IYXA 3OP2A 3CH0A 3LTSA 1S2CA 2C19A 3OBKA 4DZAA 3LZ5A 5EMMA 5A6KA 5D03A 4PRRA 1UKOA 4FSAA 1F8IA 1Q3NA 2YPIA 2ZXDA 3SIMA 1GONA 3WDQA 4QNEA 3BICA 4QITA 4D6FA 2V3FA 4PUJA 3P7YA 4Z2GA 4M51A 3VC6A 5BXSA 2VD9A 3GKFA 1FWCC 4OZOA 3UBPC 3A4JA 4B3KA 4NAEA 2ZOXA 4DZHA 3S6TA 2E9BA 3DG7A 5CXPA 4D6HA 3EMCA 1EJTC 3FDKA 3VMOA 2QV5A 3F03K 4MZYA 1M65A 1EYEA 2ZXQA 3W7JA 3SUUA 3PSWA 2FJUB 2VCCA 3K30A 4FLRA 4FF5A 4GCXA 3I7RA 3QQ1A 4LRSA 3CUHA 4AUBA 3P8IA 1EBGA 1PCWA 4P7RA 3WJWA 1W32A 3BWWA 4AXKA 3UA3A 2G3FA 3GVVA 4CKQA 1WKYA 2YR1A 1PZ2A 1XW8A 1OHLA 1TPUA 1X8FA 3GXPA 5A8NA 1TV4A 6TIMA 3MSYA 1Q6LA 5LXEA 1M03A 2YGYA 3GNOA 2ZCGA 2GUYA 4OV4A 4DO6A 4CUCA 5IFTA 1KKOA 3TC3A 3EWDA 4BQ5A 1RUSA 1JQXA 3IVTA 4NJKA 5F7UA 1I9CB 3ZYZA 3EXSA 4FOKA 1PEZA 2Q02A 4Y9OA 4JYDA 4W5UA 1O94A 4ENLA 3ES7A 7TAAA 3IAQA 3S9YA 3VKAA 2DU2A 1K7XA 1CTNA 4FO4A 5CPTA 1V6UA 4GVGA 3K8MA 3CV6A 3ZJ8A 1GOWA 2TPSA 2VKZG 3FJ4A 3E0VA 4F2BA 2HS6A 2QZRA 4C6QA 2JIWA 4NNCA 2BP1A 3IJDA 3WF2A 2JGQA 2XGIA 3FYYA 1VFFA 2TMDA 1XLHA 4DELA 2BY2A 3BZJA 5JIWA 4FR6A 4AYGA 5I23A 3OVQA 2NQLA 3W07A 4HNNA 3O8AA 1L9WA 2IQDA 3RK8A 5D05A 2NSOA 2VCBA 4FXJA 3K8LA 3N9KA 1R3QA 2OYMA 1V3KA 2AMGA 2VFGA 5HJYA 4DBDA 4A2RA 4L4MA 3ZSTA 2YXOA 3WMBA 4K37A 4BI6A 3E74A 3RR1A 4QDPA 4HHMA 3W7IA 2FZMA 1UC5A 3LBMA 3TSDA 1LUCA 5FEZA 3W29A 2QIIA 3SW6A 3TN5A 1KQZA 1UH3A 2R94A 3WDRA 4XBJA 3SAZA 3CT2A 3WNPA 2O55A 2TAAA 3WLPA 3IJ6A 1ZZMA 3A13A 1IEXA 1H3GA 2DVUA 3CZLA 2YL8A 3AALA 3CNYA 1O60A 2QCLA 1OFDA 3RYSA 1OBAA 2VELA 1UD2A 1AK5A 4FXFA 2FFIA 3UD6A 3BGGA 2TSYA 1VPYA 3N13A 3GR7A 3W87A 2AL2B 1DIOA 2A3CA 4ZO7A 4Q6XA 2HE8A 1HP4A 1JCNA 3UPMA 2HBVA 1YPXA 1Z6KA 3DERA 2Z1BA 3WBAA 1Q6DA 2ZZ4A 3N4FA 4DWSC 3HG3A 1Z3NA 5I79A 1TA3A 3B0PA 4G1KA 3WLKX 4WUIA 1RBAA 2ZRZA 2A2IA 4QG8A 3K4AA 4Z2JA 3BLKA 3BLLA 4HYVA 4DWSD 4QR6A 3FJ6A 1EWEA 1N2VA 1JF5A 3QR1A 5DMNA 3DG6A 4U2YA 2ZUWA 5CZJA 1P43A 4ATLA 4DUOA 4FX7A 3S4TA 3JZEA 5HJXA 1FHLA 4IWWA 5AC6A 1G6CA 1XL9A 1JDDA 2VX6A 2OTDA 1DJZA 1W0MA 4JNYA 3THAA 2PWEA 1A50A 2ISDA 3LX9A 4A4AA 4JTIA 3WX7A 4RPQA 5F4SA 1RP9A 4GGBA 1RZMA 1XLBA 1UCWA 3W72A 1A0EA