1OJXA

Crystal structure of an archaeal fructose 1,6-bisphosphate aldolase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
250
structure length
250
Chain Sequence
NLTEKFLRIFARRGKSIILAYDHGIEHGPADFMDNPDSADPEYILRLARDAGFDGVVFQRGIAEKYYDGSVPLILKLNGKTTLYNGEPVSVANCSVEEAVSLGASAVGYTIYPGSGFEWKMFEELARIKRDAVKFDLPLVVWSYPRGGKVVNETAPEIVAYAARIALELGADAMKIKYTGDPKTFSWAVKVAGKVPVLMSGGPKTKTEEDFLKQVEGVLEAGALGIAVGRNVWQRRDALKFARALAELVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords FRUCTOSE-BISPHOSPHATE ALDOLASE CLASS I
publication title Crystal structure of an archaeal class I aldolase and the evolution of (betaalpha)8 barrel proteins.
pubmed doi rcsb
source organism Thermoproteus tenax
total genus 88
structure length 250
sequence length 250
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2003-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ojxA00
5HR6A 2NX9A 3UWQA 5DN1A 1W56A 2DORA 5G1TA 4OE7A 5FF3A 4S2BA 5C54A 3W87A 1L9WA 2ZA1A 3W72A 1I2NA 2B7OA 2CW6A 3LRKA 2VEIA 1U83A 5LNUA 4IMEA 3NGJA 5D2VA 5EA9A 1X7FA 2QAPA 4RCXA 2AQWA 1UASA 4WD0A 3P81A 5CPLA 3RLVA 2J9XA 2A6NA 4OV4A 2ALDA 1D3HA 1D9EA 4RXFA 3HPXA 1WQ5A 3HG3A 3W7KA 4QSHA 1TYGA 3W84A 2YR1A 4JTHA 1ADOA 3CEUA 3B03A 3WK3A 3M9YA 1A50A 1KTCA 2NXGA 3KVLA 4BFAA 4FHAA 1B4EA 5K9XA 1QWGA 3NYZA 2OCZA 3TAKA 3ABOA 4ORMA 3VKJA 2FFCA 3M43A 4N9EA 3QPYA 4J9JA 2XN0A 3GXNA 5AYZA 2JK2A 1VCGA 1EX5A 3IIXA 4UNKA 4UTUA 4AWUA 3L0NA 1PIIA 3TV8A 3W70A 4DBDA 3S1WA 3A21A 3BLIA 3GX9A 3V1PA 3M5VA 4LT9A 3VI2A 3PBVA 3IGSA 1G67A 4WZHA 4IQLA 3G8RA 1EB3A 1A5AA 3EKLA 4WX2A 1C29A 1TV8A 1Q6QA 3PBWA 1OFQA 1KM0A 3MUXA 4OU1A 5F2LA 3PM6A 4NQ1A 1ZAJA 1VZWA 3CHVA 1W31A 2CU0A 1WA3A 3DBPA 3QSRA 5F4SA 1IXQA 1ZCOA 5H2ZA 2RH9A 1OX6A 1SUXA 3E49A 2DZXA 3L2IA 4S2CA 1WX0A 2WQPA 2DP3A 1OHLA 1QPOA 3F4NA 5A8GA 1TQJA 5LGZA 5L6UA 3GK0A 2ZA2A 4A29A 3CEPA 4DF0A 3W07A 4U28A 3IIVA 1SZFA 3A24A 4IJBA 3NL6A 1DOSA 2E09A 2Y70A 3G0XA 2QCCA 4ALDA 1P1XA 5I3HA 2QDHA 3GLCA 3LHTA 3BO9A 3EWWA 2B4GA 4GXMA 5L9FA 2OX1A 4O52A 3NL3A 4MY9A 5BOOA 3W22A 3KFTA 1TO3A 2ZZ2A 4OHQA 3EWXA 4N4QA 2FDSA 5I3GA 3S9YA 2EAWA 2A6LA 1NVMA 1B57A 1H7WA 1O5KA 2ZDRA 1LDCA 3ABQA 4WY0B 4MY8A 4ML9A 3PUOA 3W1RA 5E0KA 1WV2A 4B5NA 1GVQA 3M7WA 2VFHA 3GDMA 2VELA 4Q32A 4Y8FA 1H1YA 1W5MA 2A7NA 3LXBA 1X6UA 4ZQMA 1W54A 5D33A 4K6AA 4NUWA 1YDNA 3Q58A 1ME7A 3KVJA 4JX5A 2CLMA 2A5HA 2VC6A 3LHVA 5F2IA 3EX1A 1ZY9A 3MP3A 4R53A 4JDYA 5MHBA 1XBVA 1YLVA 1QR7A 3S1VA 2X1RA 1MEWA 1TSIA 2QCHA 2GVJA 4NNCA 3G8EA 5AB3A 2RFGA 3UXAA 1OFRA 4ADTA 4FNQA 1G4TA 4N9CA 4AHPA 1SO5A 1F2JA 4Y96A 1KM2A 2DZVA 4Z08A 4AAJA 2A7PA 3CU2A 4R34A 1W3TA 1XXXA 3O63A 4O10A 3BK0A 2X1TA 4N6FA 3EX3A 1EWEA 4LVAA 2Z2UA 4GUJA 4UIOA 5D03A 5U7SA 2GQAA 1TPFA 5AC6A 2C18A 1O60A 5EYWA 1CI1A 4MFDA 3GDTA 3UWVA 1GOXA 2E77A 3C56A 3CPRA 1TPC1 2H8ZA 4IPJA 5D09A 4ZQRA 5AYXA 1I2PA 3NQCA 4UC5A 2HS8A 3NQGA 4CCCA 2BLEA 3L67A 3P80A 2QUUA 1YDOA 2G95A 2YFOA 3W1LA 5LGXA 2NX3A 2QAFA 3QJAA 1DORA 5FEZA 3HO8A 1XI3A 5DCBA 3OIXA 1T96A 3LLFA 3WK0A 3TJXA 3QH2A 3QZEA 1KM1A 1LLZA 2CLIA 3E12A 3W2LA 4LU0A 2V0TA 4JTSA 1FUYA 5CGQA 1OFEA 2E6FA 2GJLA 2Z6JA 3ABRA 3O1NA 2W6RA 2Y88A 3G24A 1Z41A 5D04C 1JQVA 4RJEA 3W7NA 1AL7A 4NX0A 2VFGA 4JTKA 2V9DA 1JUKA 1J4EA 4LRSA 5G5IA 3W1TA 1JUEA 4OWGA 3W2JA 3WK2A 1TB3A 5K2ZA 3QC3A 3FOKA 4M6PA 3W88A 3B0PA 1YADA 2NV1A 3M5ZA 2H8XA 3SGUA 3THQA 3B06A 4JIPA 4FX6M 4YXGA 4JYDA 4JY8A 1O5XA 3RLUA 3SR7A 1YTDA 5BMXA 3PF3A 1MO0A 4DPQA 1JQXA 5EKYA 5I3IA 4O1BA 3HBLA 1TIMA 3EX2A 2A1YA 4NNBA 3OVPA 4L4LA 3NPVA 3T4CA 4NZJA 3LLDA 5AYYA 2NLIA 3FYPA 5DBUA 2A4AA 3IRDA 5LNVA 2V5LA 2NWRA 3TUUA 1VCVA 4FNTA 4MZ1A 1W37A 1M7PA 3NPXA 1Z42A 3GZ3A 1R47A 3BVJA 4JXCA 2YW4A 2CZ5A 1F5ZA 1H1ZA 1IF2A 3DI0A 1EWDA 4JN6A 3EKZA 4P2VA 3EXTA 1TV5A 4GUHA 3UD6A 1Q45A 3BW2A 3MI2A 1KTNA 3OEXA 5LNRA 4Q4KA 3ATYA 3R89A 4N2YA 2XN2A 4FIQA 1N55A 1G69A 2V81A 4PC8A 4NT0A 3DHDA 4ICNA 2EGZA 1P0NA 1N8FA 2I1OA 1DKWA 1TRIA 3NPUA 3WJZA 3GIYA 2Y7GA 5FEWA 1Q3NA 4FB7A 1SO4A 5FF4A 3O8AA 3L9CA 1BWKA 3W1PA 1NFBA 3GR7A 3RFAA 2NUYA 4HNTA 3IVUA 5G1YA 3QRHA 3OHIA 3WK1A 1VH7A 1KFKA 3STCA 1L6SA 2ZA3A 2YX0A 2FPTA 5KINA 1XKYA 3P60A 2DZTA 3UXDA 3PWAA 1IGSA 2QDGA 2VEPA 1H62A 3NQDA 2VOMA 3GKFA 5HUPA 3HPZA 3C2FA 1DL3A 2CLFA 5TIMA 3O06A 1SZGA 2CZEA 2ATSA 1MSSA 2Y7DA 3QW3A 1LBFA 2JKPA 3QQ1A 3NQMA 4WOQA 4ZVJA 1P5BA 2B7NA 1PHWA 7TIMA 1SFJA 3HG4A 3QF0A 1ZNNA 2GOUA 4A2RA 1SR9A 1SO6A 2A2IA 2YSWA 3LOTA 1RD5A 2I9EA 3RNDA 3DHFA 5K7JA 4BWLC 4XUGA 3EWZA 3MHGA 4R7JA 3KVMA 2H6RA 5HJLA 4K39A 3P74A 3B0UX 2CLEA 1FXPA 4FO4A 4EF9A 4LTSA 4O28A 3C4UA 4O15A 3BW3A 1SW7A 1KM6A 1JCXA 3LDVA 3TW7A 1FWNA 3LXAA 1KM5A 5LNSA 3O6CA 4UTTC 3LV5A 2OJPA 4K38A 5C5YA 2GJNA 3PY2A 2Q8LA 4AHQA 1G7UA 3QSTA 3LHUA 1FCUA 5DCEA 2HSAA 4UTJA 4ADUA 3DFOA 4A3UA 3G0UA 3E02A 3TXVA 3QPZA 1OFOA 1W0MA 1LORA 3WJYA 5AHLA 1JRCA 1O94A 3TMLA 3ANYA 5CPMA 3BG5A 1TPDA 1GEQA 2ZRUA 5CSSA 4PEKA 3R2GA 3LBMA 4NVTA 1ALDA 4IOTA 3M6YA 2PE4A 2ZRZA 2CFFA 1AK5A 3E9AA 4TO8A 2X16A 4RLIA 2WNQA 3WFAA 1W3IA 1FQ0A 3L65A 3KRZA 4P61A 3G22A 3LCLA 4RK8A 1DQWA 4FNRA 1U5JA 2H90A 3M47A 1H60A 3DKJA 4MOZA 2GPTA 4RXGA 1I2OA 2J9YA 4O1CA 1T8XA 2Z6IA 2NUWA 3TQKA 3USBA 3IV3A 2RDWA 4YWIA 4BR1A 4MJZA 2C0AA 5C2XA 1SW0A 4AB4A 3CQ0A 5G2HA 1QPQA 1AG1O 5HMSA 1SQ7A 3BGJA 3WJWA 4KFNA 3W74A 4K36A 4JTLA 1LOLA 3VFLA 1V5XA 1K03A 4AVFA 1FWWA 3DFTA 5CZTA 3TQ0A 5FF0A 3T55A 2ZZ4A 2Y7FA 5HUOA 2NV2A 3W7DA 3GXPA 3PAJA 4POCA 4O8RA 5K9DA 3NQ7A 3P62A 3M16A 2C6QA 3P61A 2Z0IA 4NU7A 1KW1A 3GNDA 3M41A 3BW4A 2AGKA 4O17A 4W9TA 1QOQA 2V82A 1FDZA 1H7NA 3S5NA 2VENA 3NOEA 1IIHA 5BMWA 3W1QA 2EKCA 2WSYA 4QM1A 3P8IA 3LERA 2CLKA 1PCKA 2YPIA 2GQ8A 1I2QA 4ZQOA 3GNNA 1KV8A 1VRDA 3I65A 4K37A 1TJPA 1A5BA 5TQLA 1FDYA 4JX4A 1PCWA 5K9CA 3NM3A 3SFKA 4Z1BA 3R12A 2QCEA 5AN7A 3UWUA 3TX9A 4OV9A 4JY9A 2ZZ3A 2YYTA 4AF0A 3SECA 3INPA 1M7OA 4M19A 3SJ3A 4DO6A 4PA8A 4IMCA 3MP4A 4UFHA 4YCPA 1OFBA 2WSRA 3O6DA 2QJIA 1VYRA 4NXKA 2NXHA 3MYPA 2Q3OA 2QR6A 3PBUA 2ZQ0A 3F1QA 1EUNA 4LS0A 4WUIA 2ISWA 3BPWA 3L66A 2EPHA 3TSBA 4MYXA 1R2TA 1FDJA 4LUJA 2ZTJA 1L6YA 1T0OA 2FB3A 3P67A 1OF8A 3TFXA 1TPVA 2FLIA 3C3NA 1VS1A 3TK7A 2WV8A 3W7RA 1UJPA 3LRMA 5AFDA 1ZENA 3GR8A 3M5YA 2DJLA 2RDTA 3O05A 1KFLA 3B4UA 2C3ZA 3CM4A 5G2IA 1LRNA 3NQ6A 2KZHA 1D3GA 5BW6A 1OYAA 3EX6A 2PURA 1XBXA 3UWWA 4MY1A 3W1AA 4ORIA 5G2WA 1SZEA 1H63A 1AL8A 2JKAA 4YCOA 4FNPA 3FJLA 3IGUA 2FB2A 3FLUA 5LHEA 3KRSA 1RQEA 4MJMA 3W83A 1X8FA 4TIMA 2ZBTA 4AEOA 1XUZA 3IVSA 3N3MA 4NJHA 3TNOA 4KWWA 1HO4A 3W73A 1QOPA 4S1FA 4D2JA 4BI6A 4PL2A 2QCGA 5DCDA 3TXZA 2WKJA 5CZ0A 4O18A 3ELFA 2WSQA 4IX2A 2R14A 3LRLA 3W1XA 1TPWA 3DU0A 3OG3A 1ML1A 3W7GA 1XL9A 4LUIA 3BARA 3N2MA 4RV8A 3R5EA 2B7QA 4R33A 4DEFA 1G4EA 5KMYA 4LC6A 3NQEA 1FX6A 3EEGA 4PH6A 4ZQNA 3THAA 4Y6GA 1E51A 5H91A 4UTMA 1H51A 3PBYA 1G6CA 3B05A 4JYFA 1K8YA 2ATMA 3OVQA 5AHMA 1B3OA 1RZMA 3PUEA 1SU5A 2QKFA 5C6MA 3LCFA 2PC4A 4CQ8A 4Z0SA 1THFD 5FESA 3NG3A 2TRSA 2JKEA 5K4XA 1AW5A 1F05A 2DJXA 4PCFA 3PSVA 1LBMA 1TPEA 5KTLA 4QNEA 1L2UA 2QUTA 5HR7A 1VHCA 2JBMA 3K30A 3IGXA 3P8JA 4U4MA 3CWNA 1H61A 4LOCA 2Z1BA 1JCNA 5FI8A 3SIZA 4A22A 3LV6A 1YTKA 4LY8A 1TRDA 3SY5A 2ZTKA 3QMRA 4Z0JA 3SGZA 3VE7A 1R30A 1K3UA 1NF0A 4UMAA 2JGYA 5CG7A 1Y0EA 3G3DA 3GB6A 4KFPA 2QF7A 5FEPA 1UBSA 1FCVA 4FXSA 3W7LA 1XDMA 3IVTA 1GVFA 5CZJA 3PSWA 2C19A 2CLOA 3LI1A 4EWND 1P4CA 4O1DA 2B7PA 4O4WA 2XN1A 3S1UA 1GG1A 2YYUA 1YPFA 3G1YA 3DAQA 3N19B 3TE9A 2VEKA 1JCYA 2NZLA 4YLWA 3N73A 2A21A 1I8JA 1P0KA 3AJXA 4X2RA 3EB2A 2V2DA 4Z1DA 4K8EA 1B9BA 2HS6A 3GDKA 4AWSA 2J24A 4E0CA 1RVGA 3ZWTA 3LI0A 4UTTA 1CX9A 3G3MA 4WXYA 2ZRWA 4Y9AA 4UNLA 1J5TA 3HGOA 3TW6A 1IXPA 4MIMA 3W1MA 4JTEA 4LW7A 4H4IA 2YGYA 4JR5A 4X9SA 4N4PA 3G1SA 4IPIA 1SSGA 2YXGA 3LCWA 3L21A 3KAOA 3O6YX 2V8ZA 5T26A 6ALDA 4XZ9A 3MJYA 4Z1AA 1VC4A 3S0CA 2J9ZA 1DQXA 1KA9F 3PVFA 4UTWC 3LHZA 5IBXC 3Q94A 3TSMA 2NXIA 4LRTA 2TSYA 1DV7A 1JVNA 1KFJA 3I7RA 1Q6RA 2FIQA 2F7FA 5D2YA 1A5SA 3W2MA 2A7RA 3R8RA 4K7VA 5HQEA 5BRBA 3JS3A 2LLEA 3M0ZA 4I7VA 4O53A 3ZWSA 4DO4A 3KVKA 2PCQA 2RKXA 3SW6A 2NUXA 4HSOA 4UTLA 4ZL1A 4XQ6A 4IGHA 5FF7A 4FX7A 5DBTA 3G1XA 4GBUA 4XKYA 1EUAA 2EF9A 3DFNA 4JDBA 3W2NA 3PULA 3W71A 1G4PA 1L6WA 4E38A 1EP1A 3RF9A 3NL5A 4UMBA 2C15A 1EEPA 4UFKA 3C6CA 1SSDA 4CNNA 4QQ3A 3ATZA 4CLMA 2QCDB 4M7TA 1TREA 3GAYA 4CCDA 4ZQCA 3OVRA 5DELA 5E93A 1OABA 3LHWA 2C14A 3MO7A 4I7WA 1RQBA 4KKXA 3ZS4A 4A2SA 1VQTA 3L68A 2QCNA 3MP5A 4FIRA 2X30A 3DFPA 3HG2A 2ABBA 2Q8ZA 4I9AA 4O50A 1OYBA 4JD4A 5F2MA 4LVGA 1LYXA 2BTMA 5IM51 2BZNA 3YPIA 1YTEA 2ABAA 4JIQA 3MHFA 1QAPA 4M6VA 2GUUA 4HPJA 3W1UA 1R2RA 5F2GA 4MPQA 3CIXA 2ZZ6A 3PG8A 4NZFA 4O0ZA 2QCDA 3TQVA 4A21A 5I3FA 3BLEA 2WPBA 1WBHA 3NNTA 3NQAA 4LWWA 1VR6A 3UZJA 3IIOA 2I14A 4O57A 4TR9A 1Z48A 1OFPA 2DZUA 1TQXA 1WXJA 2QEZA 3P84A 5FF2A 4O14A 1HFBA 2QUVA 5TBOA 3MBDA 4FNUA 1LRTA 3AO0A 3Q2DA 2BX7A 1LLWA 8TIMA 1EP2A 6TIMA 2TPSA 3SSJA 4LS2A 4O11A 1JCJA 1JJKA 2W0UA 4AHOA 3GYEA 1UCWA 5DY2A 2Y89A 1QO2A 2FPVA 4NNAA 4NJKA 4Z1CA 1EPXA 1KBJA 1K7FA 2VFIA 3LTSA 3KRUA 1SZNA 1W5QA 2VXNA 1TTIA 3L0GA 3MYOA 4DELA 3TCEA 4M5PA 4L4MA 3HF3A 5HWJA 3BG9A 5ABTA 1F7BA 3O15A 3EWBX 4LC8A 1MEIA 3RK8A 2V2HA 2CZDA 4CQ9A 4IUOA 5D02A 3P7YA 3UY7A 1NSJA 3KOFA 5HWMA 3NPWA 2VKZG 1H7XA 3FFSA 4JEQA 4QIUA 5AHFA 4IMFA 1ZHAA 4CNOA 2FQIA 1ME8A 5EBUA 1XFBA 5GVJA 1W1ZA 5A5WA 3EWUA 5G4EA 4I7UA 4IXXA 1FCBA 4UCGA 1GPWA 1GYNA 4BF9A 1K02A 4QAIA 3LB0A 1LRQA 3TU9A 3NAVA 2YFNA 1DJNA 2C13A 1R2SA 2TYSA 4FNSA 1GTHA 2WJZA 1OX4B 2YCEA 2GQ9A 5D38A 5LKYA 1PE1A 2W79A 3CB8A 4O16A 1BKSA 3HG5A 3EWYA 5AOUA 4UTKA 4XBSA 2O7SA 3W1NA 3W7CA 5AC7A 4CCEA 4IWWA 3M44A 1T99A 3PR2A 4UR8A 5J5RA 1KFEA 1K7XA 3UWZA 4FEZA 3CT7A 3S1XA 3CIWA 2UV8G 4HHPA 1DHPA 5CZSA 1TTJA 5AHIA 2WO5A 5F1VA 4AWTA 4LV9A 4O54A 1GYLA 4MYAA 1GVSA 1KM3A 1H5YA 1F73A 1OX4A 3D0CA 3TIMA 2R94A 2YDAA 3LHYA 3C8FA 1ICPA 2P1FA 4MLJA 3HMJG 3BGGA 3IIZA 2BXVA 3S8HA 3G1VA 2HTMA 2R8WA 4GNJA 2E5DA 1RR2A 3C61A 4MZ8A 2HMCA 3TA6A 1ZALA 1I4NA 1PHQA 1KFCA 1Z44A 4RZ4A 3W75A 5K3VA 1TJRA 3G1HA 3EX4A 4AF0B 1DVJA 1RV8A 1TPUA 3LTPA 4IMDA 1OK6A 2C16A 4N6EA 1Q6LA 1OYCA 3ZR4A 3LXCA 1UUOA 3FIGA 3PG9A 3DI1A 5KZEA 1ONRA 1YXYA 3LCIA 4C1LA 4GUFA 4MUZA 3GAKA 4EIVA 1RPXA 3A5FA 4DF1A 5F1UA 1OVDA 3KHJA 2XFWA 4E2DA 3R13A 5EPDA 3CC1A 3KX6A 2OT0A 3M5XA 5C55A 3BLFA 3HGRA 1SFLA 3FA5A 1FCQA 1FWTA 1QNVA 2ZCGA 2CLLA 1KLYA 3GVGA 3DGRA 3TFCA 5E1QA 3QW4B 1X1ZA 1GG0A 4GWEA 3L5LA 3HGJA 2G5WA 1EP3A 3I6RA 4UTIA 5SWUA 4JTTA 1DJQA 1FWSA 3HB9A 4TMCA 4DPPA 3C2RA 3CTLA 1YYAA 2EHHA 4IXHA 2JGQA 1VCFA 1QCWA 4LVBA 3NEVA 3P82A 3F4WA 3GDRA 5K4ZA 4ZZ9A 4GFSA 1WYIA 4LNYA 3IEBA 4UTHA 1IXNA 4H3DA 3T7VA 1S5VA 2DZPA 3W7PA 4DXVA 1HTIA 4UTWA 5U4NA 1YDVA 5IBXA 3CLMA 1BTMA 4RZ6A 3C52A 4JTJA 3SI9A 2GVGA 2TMDA 3TC7A 1XUUA 3HIJA 4GJ1A 2ZRXA 1ZFJA 3HOJA 4JYEA 1FXQA 3HPSA 3MI6A 2Y63A 5I3KA 3MWAA 3BV4A 1H7OA 4CQAA 3CWOX 2QCFA 1F6KA 1VHNA 2DU2A 3PS7A 4LVFA 2NX1A 4XWUA 1TPH1 2ZZ7A 1QDSA 2RHGA 1QMLA 4WY0F 3B8DA 4UFJA 3NXFA 3W2KA 1PVNA 2BSLA 1VPXA 4IMGA 4DQWA 2X2GA 3FS2A 4RZ5A 1FY6A 3LCGA 3UZ5A 4X3ZA 3U2OA 1C8VA 4HIBA 1W3NA 1G4SA 2H3BA 1Q6OA 3G1AA 1QPNA 3Q37A 4RX0A 1KV5A 1H7PA 5CPOA 2OMAA 3MHUA 2OZ0A 5D2XA 3JRKA 3W7JA 3UYCA 5LNWA 1LP6A 3VNDA 2A0NA 4OT7A 4Y90A 1HL2A 3W2UA 3UQNA 4UFLA 1ZJIA 2WNNA 3W6YA 5BNKA 1OFAA 5HULA 3EXSA 1LROA 3N9SA 3A5VA 5F4WA 4BI5A 1FWRA 1LOSA 2Y61A 4FF7A 3W7OA 4N9DA 2B0MA 1S5WA 4NJGA 3W3OA 5KZDA 4M7SA 2GVLA 3STGA 3DFSA 4DO5A 4XBKA 4C1KA 1G7VA 3LM7A 2C1HA 1A5CA 4LVDA 3A23A 2QCMA 4GUIA 4XTDA 4WJEA 3OA3A 3JR2A 3RU6A 1I45A 5D37A 5CKSA 3M1ZA 1OG0A 1XBZA 1MEHA 3TJLA 2CZFA 3S5YA 3HQ1A 1JUBA 1MZHA 4OQVA 2D73A 3G18A 4GRSA 1J2WA 5J5DA 3H53A 4PFMA 3VCRA 4AXKA 4UXDA 3W85A 4WOZA 3NQ2A 3IIPA 3U8GA 2P10A 2J88A 1AW2A 1R46A 4WY0A 1W8SA 3L5AA 3LBCA 1KFBA 5CPNA 1GVOA 4QISA 1S3HA 1KTBA 3G1DA 2QJGA 4YMZA 1EA0A 1TTQA 3LCXA 3DENA 4CNPA 1HUVA 3T78A 3PB0A 4AMAA 4WQ6A 5HNRA 4GUGA 1GQNA 4PL1A 3WJXA 5AHNA 3W7MA 4HT3A 4BWLA 2DZWA 3L5MA 2NWSA 3NM1A 2PRMA 4ZQPA 4NXSA 2J27A 2OT1A 1AW1A 3MI3A 3S5ZA 4LS1A 3C2VA 3NZRA 1IXOA 1RQHA 3A22A 4JTFA 5D2TA 1H50A 2AAMA 3UY8A 3N14A 1OF6A 3NR0A 3GKAA 1NAL1 5HWNA 3TKFA 4MLRA 3NQ8A 3LCHA 1LOQA 4HSNA 4BK9A 4XKYB 1WAUA 5LHFA 4JNMA 3T44A 1SPQA 1LBLA 1N7KA 3A9IA 3STEA 5KZMA 1WDWA 3TC6A 2V2CA 2VFEA 3LTYA 1K8ZA 1UB3A 4MFEA 2PRLA 4HN4A 2Y7EA 5DXXA 2X1UA 5G4WA 3PUDA 4O4VA 5LZLA 5DY3A 3ABSA 5D30A 5EMUA 4PODA 1GWJA 1O95A 3W86A 4FXRA 1JCLA 4GC4A 1NEYA 4QITA 4DBEA 3L0KA 4PTNA 3W9ZA 4O19A 3TROA 1QFEA 2Y85A 4QNWA 2ZZ5A 5CSRA 1F76A 3UWYA 4UR7A 3G1FA 1LCOA 1VJIA 3MBFA 3NA8A 2VFDA 2V30A 1B4KA 4ADSA 2VEMA 4JTGA 1XBYA 3TMQA 3S6DA 1GTEA 1ZAHA 3S42A 2J6XA 1C9DA 2V5BA 1ME9A 2FJKA 3NQFA 4JGDA 1NF7A 3QYQA 2E6AA 1TCDA 1OX5A 4IX0A 3NL2A 2G97A 3DFQA 1PL9A 3STFA 4HNUA 3TH6A 4XTIA 5I3JA 1HG3A 2FTPA 3NVTA 5DXYA 1VLIA 4NX5A 1XC4A 3QMTA 4MKNA 1VYSX 3RMJA 2ZRVA 4EF8A 5D05A 3WJSA 3N2XA 3GXTA 1WOAA 1YPIA 3G0SA 1I2RA 4EVZA 2E68A 2X1SA 3PB2A 3UPWA 1BEUA 4K8HA 2H3DA 3SZ8A 4O0KA 1PS9A 1LM1A 4JTUA 3E0IA 3QQ0A 5KSWA 3O16A 1LZOA 2RDUA 1W5NA 3FJ6A 4FX8A 4MZYA 2Y62A 4AH7A 3HGSA 3BG3A 3MMTA 4NJJA 2WOQA 3B0VC 1VLWA 2F84A 1KM4A 2YW3A 3DH7A 1IIGA 3N9RA 1A53A 3C2EA 4HKPA 1ICQA 3LGEA 4RR4A 3E96A 1O4UA 2CWNA 1JULA 5LSMA 1BWLA 4KWVA 2ISVA 2P0OA 1JRBA 1M5WA 3ZFHA 1WOBA 1H7RA 3HJZA 3S5OA 1F6PA 1LTDA 4UFMA 2VFFA 3W7HA 1JCMP 1QO5A 2G96A 2ZRYA 2CLHA 3H55A 1FBAA 1TV7A 3TR2A 5HINA 3W76A 4QJ1A 1VYPX 2R91A 1S5TA 3O07A 4WXZA 1YXDA 4LV4A 1OFDA 2DZSA 4K7YA 1MXSA 4TMBA 5KITA 3QFEA 2E5BA 3F03K 3TDFA 1GZGA 4BI7A 1V7YA 2Q3RA 2ZYFA 1JR1A 4JICA 1XDLA 3FEMA 5FEXA 3NQVA 4DF2A 4UUIA 3NZ1A 1K7EA 2ZZ1A 4Q33A 5AC8A 2QCLA 2E6DA 1XCFA 4M6QA 5DLCA 3C0JA 5AHEA 1YXCA 3P5YA 1W5PA 5F4XA 1GVRA 3V75A 3W7EA 2PRHA 3N34A 3C2OA 2Y6ZA 1AMKA 3I68A 1DBTA 4N9BA 4KFOA 3LX9A 3QM3A 1GT8A 3FKKA 4TX9A 2IQTA 2A85A 2E5CA 4N02A 2E1DA 3T40A 4ONVA 3VE9A 4E2BA 3I7SA 1ZAIA 3DZ1A 1SW3A 1TPB1 4JTIA 5EY5A 2YZRA 4UMCA 3I7QA 1M6JA 1XM3A 4RKAA 3TAOA 2QJHA 4MVAA 1TMHA 4YL2A 4JX6A 3MW7A 3OBKA 1ICSA 1QPRA 3DXIA 4HNNA 2ISSA 4O1AA 3DKLA 4TU1A 3UPBA 1CW2A 2WNZA 5D2WA 3U6WA 4G1KA 1WBJA 4GE8A 1OJXA 3W23A 3B04A 4EOUA 1GJPA 4NJIA 3GDLA 4HPXA 1F74A 4UFIA 4HNVA 2E6YA 3TSDA 3UNDA 3PC0A 3QEZA 3EXRA 3W7IA 5EL1A 1UUMA 3QMSA 1VGAA 4H6KA 1PV8A 1KBIA 3FKRA 4O13A 5D32A 4JS3A 3P5ZA 1HO1A 3NO5A 3NDOA 1SO3A 4O12A 1X1OA 1K8XA 1W5OA 3KXQA 1EIXA 2ZFAA 4OBTA 3FYOA 3H54A 4OGZA 1KLZA 2BWGA 4ZMGA 2FPYA 1TTPA 2O7QA 4X22A 1OK4A 3W7QA
chains in the Genus database with same CATH superfamily
3WF0A 2NX9A 5DN1A 2OLAA 3MWCA 3RGTA 1EDQA 1QRQA 2W63A 4AEFA 4J3VA 2W91A 1S2TA 2RGLA 3ZVIA 4H6RA 3W72A 2E4TA 1UA7A 2VEIA 3KP0A 3VX0A 5D2VA 2BXZA 3H6OA 2QAPA 4Z2KA 3P81A 5CPLA 2A6NA 2ALDA 2QVNA 3WQGA 4RXFA 5F7UA 1SMDA 1W6TA 4IQEA 4QSHA 3A3WA 3W84A 1A47A 1OCBA 3NDYA 1AJ0A 4W84A 3QGKC 3KVLA 1XSJA 2F9RA 5XIMA 4UR9A 3TAKA 4ORMA 4RNJA 4AWEA 2X40A 3M43A 3R11A 2VC9A 1JZ3A 4E5TA 3GXNA 2VR4A 2VEFA 4R3UA 1EJVC 4UNKA 5CAHA 2OVLA 5A2AA 1XD0A 2J25A 4MWAB 3A21A 3GX9A 2UY5A 4LT9A 3D6NA 4FSAA 3IGSA 3PK7A 1XIGA 7A3HA 3G8RA 3W38A 1KM0A 4OU1A 1NOFA 3PJTA 4NQ1A 1UQYA 7XIMA 1VZWA 5D8ZA 3VILA 4V1YA 5F4SA 3H26A 1QWKA 1QPOA 1ISZA 1LG2A 2C0HA 4P8VA 3A4XA 5LGZA 5A6TC 4J3TA 4MWAA 1K9FA 2VO5A 1A5KC 2E09A 4IPNB 2QCCA 4ALDA 3CB3A 4MNMA 4GXMA 2OX1A 4O52A 3WEMA 3NL3A 1GZ1A 3KFTA 3W22A 3EB3A 3D3AA 4KH2A 3EWXA 3SN0A 3MUAA 4HZ7A 3W6MA 3DDMA 4FMVA 4DUVA 2BP1A 2VUYA 1B57A 1UKQA 1RAKA 1V0NA 1LDCA 4MY8A 4KS0A 1PKMA 1WV2A 4LXFA 3B9OA 5B80A 1HJUA 1JYXA 3M7WA 1E1EA 1EXPA 1W54A 3ARZA 3NZGA 4ZQMA 3VDGA 3WNPA 4KCUA 4YHEA 3SCQA 2WJFA 4NUWA 4L9ZA 3VDCA 2BVWA 3KVJA 3EX1A 3REQA 3P0WA 1K1DA 3UERA 5FKYA 1XBVA 5A6BD 2QCHA 2BOFX 2GVJA 3QHNA 5AB3A 1AJZA 2EBNA 5E70A 1GOMA 1KBKA 4N9CA 1SO5A 1F2JA 5C2CA 2YBUA 4Y2WA 4WCJA 1KRCC 1YKWA 1REQB 2PLKA 3DN5A 3BK0A 1UG6A 3SDOA 1RY8A 3WO8A 2C18A 3QBUA 3GNRA 1FHVA 4L61A 1MW3A 3POHA 3PFMA 3C56A 1TPC1 2XGBA 5JIWA 4JKMA 1QJWA 1I2PA 3NQCA 3APTA 1XYCA 4ERAA 4JQAA 4DAIA 3P80A 1BLIA 2QUUA 3O6AA 3HO8A 2O4MA 3FJ4A 3H70A 3WF3A 2AQVA 1JDDA 2W4XA 3QZEA 3C2YA 1XYMA 2AOSA 3E12A 3VNKA 5D9MA 3COTA 4BQ4A 5CGQA 2E6FA 1XC6A 4Q3MA 1VAHA 4O1FA 4HTBA 1POJA 3PBGA 3UA4A 4JL1A 2C8NA 1AL7A 2NQHA 4NX0A 4JQ1A 2VFGA 4JTKA 1DHKA 1XIJA 1WZLA 2V9DA 3VGDA 5A8PA 3BLPX 2V5JA 1JUEA 2ZKMX 4OWGA 2HNEA 4C6PA 3QC3A 4LY4A 4ZFCA 3M5ZA 3IPWA 4IL0A 1MQPA 2H8XA 4UOQA 3FK4A 1EJWC 2J8GA 4XKMA 2B31A 2QPUA 2MNRA 4Q8OA 1QNPA 1O5XA 3VIOA 5A1AA 3SR7A 1YTDA 1UP3A 3VAVA 3UJ2A 4H19A 4PTXA 5EKYA 1DWHM 4O1BA 2HCVA 3SRFA 3HBLA 2WCAA 1V6TA 1CGVA 4NNBA 2NLIA 2AGTA 4L6HA 3IRDA 2PP3A 3WNLA 4D6JA 1EPVA 3EDKA 4IFKB 4FK9A 4IL2A 1W37A 2WW5A 3PJWA 3ANVA 1E0UA 1BHGA 3BVJA 4Y9MA 1RCXB 1F5ZA 3N18A 1UR8A 3UVIA 1QW9A 4P2VA 4JQ3A 5I0DA 2NQ9A 3OP2A 3UD6A 5J04A 3MI2A 4U10A 5LNRA 1JZ7A 3ATYA 2XN2A 3HQOA 1SR0A 3ARYA 4FIQA 5CC5A 4GGHA 4GHRA 3WUBA 4PB4A 1G69A 2ZUSA 1MDLA 2V68A 3WQOA 1WUFA 4GYPC 1CGWA 2XJ7A 4WRHA 1KCXA 4IFKA 2I16A 2VZOA 1GONA 1SM9A 5A6JA 3NPUA 1J8VA 3WJZA 1Q3NA 1SO4A 2NUYA 1ITQA 3ZYZA 1J2BA 3VIPA 2HDJA 2E1WA 1J12A 2Z28A 4C6IA 5C9UA 2OX4A 1L6SA 3BAWA 2ZA3A 2YX0A 3DX5A 2FPTA 2JEPA 3QR0A 4HNCA 1JF5A 3K1DA 5C7HA 3PWAA 4QS6A 4FR6A 1IGSA 1NH6A 2PWFA 4H7VA 1J93A 1BQCA 1PWLA 3ITCA 1UD2A 3HPZA 4QHRA 4NYYA 2CLFA 3S1GA 1HKVA 3QW3A 2OYKA 3WELA 4WOQA 1P5BA 3H4GA 4LEQA 4ZENA 4HHHA 1SFJA 4QG6A 1SR9A 1ZGDA 3W00A 3DHFA 4CCZA 2DW6A 4C90A 1E1FA 4I8YA 3EWZA 3SRDA 2XVPA 4K39A 2F8QA 1FXPA 4LTSA 3ARUA 3C4UA 1V6UA 2OQHA 2ZOXA 2BODX 1KM5A 3WLQA 5LNSA 3O6CA 4UTTC 5CBBA 3AS2A 4B5UA 4HZMA 1SVDA 2GJNA 3WG6A 2Q8LA 4V27A 2BGQA 3QHMA 3RYSA 1J18A 3LHUA 2G4FA 1FCUA 5DCEA 3KL5A 3ZM8A 3BJTA 4GXWA 1GHSA 1PXGA 3WJYA 3PBMA 3FAWA 2DUXA 1CBGA 2NT1A 3TMLA 1GEQA 2ZRUA 3B0YA 3R2GA 3PN8A 4YVVA 3WLSA 1WZMA 3LS9A 2FGBA 2CFFA 4CD7A 1ITXA 2PU0A 4TO8A 4ZO7A 3E0WA 1BWVA 2DQXA 4PEEA 5JBEA 2VZTA 3VK5A 3P6LA 1HL8A 1DXFA 1UH4A 3L65A 5E09A 3KRZA 4GZIA 4P61A 3G22A 5G1MA 3LCLA 4B92A 1NELA 4Q8PA 4UCFA 3DKJA 4JNYA 4I6KA 2CEQA 4MOZA 3MY9A 3USBA 3IV3A 2RDWA 4H9MA 1IR2A 4BR1A 2C0AA 2DT2A 1QPQA 5HMSA 5D4YA 4CD5A 1PZ3A 1VEPA 4K36A 5A95A 2XIQA 2VP8A 1W2VA 1Q65A 2D2GA 5HATA 4NKCA 2BG5A 2WWCA 1FWWA 2PGRA 4F3HA 2WYSA 4KCWA 2Y5SA 1UPMB 3CV1A 2C6QA 2GYIA 2Z0IA 2W67A 4NU7A 3VDHA 2GSEA 4W9TA 1QOQA 2V82A 2OQLA 2D0FA 3S5NA 2YXOA 2O4QA 3FSUA 3W1QA 2WSYA 4QM1A 3OU8A 4YVXA 5J8LA 1QPKA 1I2QA 3RG6A 3CS2A 4JCMA 3W29A 2VCCA 3BC9A 3EAUA 4CNTA 2XGZA 1FDYA 2D2JA 5LIUX 3SFKA 3R12A 3P2VA 2QXWA 5REQB 5IDZA 3IJLA 3Q67A 3RMEA 1PIGA 3SECA 1GW1A 4YCPA 2WSRA 4DBSA 2QJIA 2OSYA 1VYRA 2NXHA 3TZFA 3PBUA 5BWAA 3V7PA 4OVXA 3F1QA 1EUNA 3OVGA 3IV8A 3TSBA 1R2TA 4HNOA 4E4PA 2WLZA 2QQ6A 1B3YA 3P67A 1F4AA 1LWJA 4PTVA 1W8GA 1UA3A 3C3NA 4X63A 3B40A 1JI1A 3PANA 1N2VA 4JHOA 3M5YA 3CM4A 5G2IA 2DVUA 1OYAA 3APGA 2HNHA 1ITUA 4Z17A 3M0VA 4JHZA 3MV01 3W1AA 4H6QA 2YL8A 1GORA 5LHEA 3C0SA 1RQEA 4DBWA 1XLBA 5IFTA 3IVSA 2P8CA 4AY7A 5CAKA 2H9AA 4PL2A 1QHPA 1XKJA 4Q8QA 4Q8UA 4O18A 3MSYA 3VD7A 4DUOA 4AZBA 2R14A 3E2VA 2PDPA 3LRLA 1V02E 2JF6A 3KTCA 3OG3A 1ML1A 2VVSA 4PUWA 1YRRA 2WVTA 1M1BA 4C6BA 4E8GA 3WH6A 2B7QA 1W3LA 1J10A 5KMYA 3RM8A 2PEVA 4PMJA 1ZQ5A 5I24A 4ZQNA 3T07A 2GWGA 3WQFA 5H91A 1H51A 1K8YA 2ATMA 5AHMA 3E1F1 1NDWA 1RZMA 2ON3A 4GYPA 4HA3A 1TA3B 3WY1A 3LCFA 4Z0SA 1THFD 4H9UA 5JBFA 2XISA 2JKEA 1AW5A 3PSVA 3W28A 1CGTA 3NZPA 2QUTA 3VIHA 1VHCA 3QV8A 3XINA 3VNZA 4U2YA 3IGXA 3P8JA 3RIKA 1SGJA 3CO4A 3ARVA 1JCTA 4LOCA 1IEXA 3HM7A 3H2AA 2VI0A 3SQLA 4YN5A 4X0NA 2ISFA 1R8LA 1VBRA 3TN5A 5HJYA 2BGSA 4YTSA 4XO7A 3GB6A 2NLYA 4UQ9A 1O7AA 3IVTA 4CNUA 5D9NA 3A4AA 2B7PA 2CESA 5PTDA 1S1RA 1BTCA 3GHTA 5DRIA 1V08A 2POZA 3G1YA 3LUTA 3N19B 2YZ5A 1JCYA 3GH4A 2NZLA 1G94A 3I3EA 3WKZA 5CEWA 3UCQA 1I8JA 2CIPA 1J0YA 4K8EA 3B8SA 2HS6A 3GDKA 1LG1A 3FGCA 2PP1A 3BAXA 4LJ3A 2P3ZA 4UTTA 5DMYA 4M82A 2XIMA 3G3MA 4R9XA 4Y9AA 2ZRWA 3CBWA 1E1CB 3VGEA 1J5TA 3HGOA 3N25A 4DZHA 1MRQA 4JTEA 2DFAA 1XSKA 4DWSC 1EX1A 4M3PA 3S47A 4TTUA 2YGYA 4X9SA 3G1SA 3AICA 4WDWA 3MJYA 4IIEA 1VC4A 5M5DA 3PVFA 4UTWC 3LHZA 2EPMX 1OWQA 3U5YA 2Q8XA 2J13A 3RRAA 4K7VA 2E28A 2LLEA 1Q6GA 3GG1A 2YLAA 3PZGA 3SW6A 1WDRA 4F9DA 2W66A 4LCQA 3F2BA 1C92A 5FF7A 5DBTA 4XKYA 1WDDA 4IGNA 2CHOA 3FSTA 3IAQA 3PULA 3W71A 4PCTA 3QR3A 9XIMA 1EF3A 1EYEA 4TVCA 3NL5A 1XLGA 4UMBA 5GJNA 1GOKA 1YHTA 1EEPA 2VRJA 4QQ3A 2VURA 4CLMA 1MFVA 5E93A 1OABA 3LHWA 3MO7A 4AFYA 4A2SA 3L68A 5BOFA 2EPLX 1ZL1A 3HG2A 4I9AA 1LJYA 4IIBA 4E3TA 5HNTA 4L9XA 2FGLA 4LVGA 1LYXA 5FCZA 3T4WA 4M1BA 3GC4A 2BZNA 2DDXA 2OWWA 1YTEA 2G50A 4CEUC 1TR9A 3SGGA 5F2GA 4OZOA 3WQEA 3BCDA 4PUJA 1UQZA 2CXEA 4O0ZA 4A21A 5LYRA 2GJPA 5I3FA 3NNTA 3B8TA 3NQAA 2ZVRA 3UZJA 4O57A 1OFPA 2DZUA 5T9BG 1HN1A 1TQXA 1U2YA 3GTNA 5FF2A 3BV7A 1Q66A 3MBDA 2NQ5A 4FNUA 3UZXA 4HMCA 4P7QA 4QBXA 1BSLA 1RA0A 1V02A 1LLWA 4LAMA 3P3BA 3E6EA 1EP2A 1IHIA 3SSJA 3KM8A 4AHOA 4I5RA 1SJDA 4HGXA 1RVKA 1M41A 3HU7A 1QO2A 2FPVA 4F0HA 4FA3A 1KBJA 3ZXWA 1SZNA 2FVKA 2VXNA 3L0GA 3GXMA 5GPRA 2PD5A 3HF3A 5HWJA 3ITXA 3BG9A 4LC8A 4HOXA 2CZDA 4CQ9A 2ODOA 3VIIA 4IJRA 4CVWA 1A0CA 3FFSA 1D7KA 1TJ2A 5I5RA 1XGZA 3N29A 3MV11 5GVJA 3TJ4A 3WMCA 4K3ZA 1KWGA 4OIFA 5BZAA 3VGBA 1GPWA 1GYNA 4BF9A 2Y8VA 3KBMA 3LB0A 1RLCL 1OY0A 1EF2A 4RDZA 3QN3A 2YCEA 1GW9A 3MMWA 4NZ1A 4QDWA 2W79A 3CB8A 4O16A 4P7OA 3HG5A 3SCWA 1NWUA 1VEMA 2O7SA 5AC7A 1DWAM 3UWZA 4Q7BA 5BRQA 3TYCA 4ZODA 4N7QA 1HKMA 2QIWA 4MKVA 2WO5A 3WFLA 4O54A 3WQ8A 1XPGA 5JVLA 5A8QA 2O9RA 5BU9A 1KM3A 3IACA 3WLMA 3IUDA 5A6KA 3C8FA 3VGHA 3SUUA 3GTIA 4H8VA 2HK1A 4DI8A 1Y65A 2BXVA 2HZGA 3G1VA 4EXQA 2XVKA 4GNJA 1G9HA 1RR2A 3RLGA 3C61A 4UZUA 1R3VA 3TA6A 3WYZA 3P14A 3CL6A 2IUZA 4K68A 2W61A 5K3VA 2X7VA 1TJRA 1EH9A 3G1HA 1UR3M 1JD7A 5E9XA 1ODUA 1DVJA 1RV8A 3M46A 1RJPA 2EJ1A 4IMDA 5E6YA 3MS8A 3ZR4A 3BGAA 2OPJA 3PG9A 4IGMA 1DWGM 3PAOA 4D6HA 1YXYA 3GBDA 3LCIA 2WKLA 2OYMA 5AVNA 2Z1WA 1U30A 3GAKA 4EIVA 4JHMA 1HJVA 2YL5A 4DF1A 1E4NA 2BY2A 2VX5A 5F1UA 1I0BA 1OVDA 5I06A 1UC5A 4ASTA 1CXEA 4K1GA 2IW0A 4E2DA 3CQIA 5EPDA 5FSDC 1XGDA 1IE7C 1SFLA 2WSPA 1FCQA 2PDHA 3AQUA 1EO7A 1AQHA 1QNVA 1V3JA 2OGJA 4XIAA 1DWJM 1YPXA 1AMYA 3GXIA 4ZB5A 1UZHA 4I6VA 2G5WA 1EP3A 3I6RA 1IEQA 2VRQA 3WIJA 1UD3A 3V0TA 4ZTYA 1ZJAA 1ZSXA 4A3YA 2PAJA 4DWSA 4QEEA 3A47A 2JGQA 3WBAA 4A05A 2QGHA 3NEVA 3P82A 1F4HA 3NYDA 3T81A 2PDJA 4UTHA 3LM3A 4UTWA 3I4EA 3CLMA 1IZJA 3U57A 3SADA 4JTJA 1GKQA 3SI9A 2E67A 1B54A 3TC7A 3HIJA 3WN6A 3GC5A 3KRBA 1OIMA 2DY3A 2ZRXA 4YU1A 3HPSA 2Y63A 3BV4A 1H7OA 2J7EA 2QCFA 2FJUB 4XWUA 4ZO9A 3SUTA 1QMLA 1A3HA 3B8DA 4CU6A 4PSPA 1FY6A 1XJBA 4TV5A 3ECQA 1E70M 1Q6OA 3N2OA 4MB4A 4REQB 4RX0A 1KV5A 3WLJA 4KRZA 1H7PA 4B2DA 2OMAA 4GFIA 4Z2GA 2RGMA 4OUIA 5ECVA 4LAUA 1BVZA 4TQTA 2ZE0A 4OT7A 4LYPA 2REQA 4AIOA 3W2UA 4O0QA 4AD0A 2WNNA 3ES8A 3T09A 5HULA 2PGWA 2XSAA 5F4WA 2Y61A 1MI3A 5I7GA 3SN1A 4NJGA 3GR4A 4HTYA 3R25A 4I3GA 3STGA 1EXBA 3DFSA 4XBKA 1JFXA 2IKJA 4X9YA 1MUCA 1EGZA 1U1UA 4REQA 5TD4A 1A5CA 1BGAA 2J77A 3A23A 3K13A 3SRHA 3B8VA 3JR2A 4U5IA 1W9DM 1QATA 1OG0A 3KCJA 3TJLA 3ALFA 2CZFA 1EEXA 3HQ1A 2INZA 3BMWA 2GJXB 2ZUWA 1MZHA 4Q4PA 3G18A 4U2ZA 3VCRA 1S2CA 3W85A 4WOZA 1UD5A 3CYJA 4ML4A 4WY0A 1PKYA 1W8SA 3BSHA 3K1GA 1TV2A 5CPNA 1S3HA 2PDUA 1KTBA 3E2SA 1EA0A 3LCXA 2XSBA 3DENA 4AIEA 4J3UA 3T78A 4GC3A 1KWKA 3UJFA 3AHVA 3H7UA 3UXLA 4PMZA 3TTSA 1E0WA 3E38A 2DZWA 2D0GA 4AD1A 4NXSA 1UP2A 3S5ZA 4Z42C 4LS1A 3C2VA 1PYMA 3AHZA 4FLOA 2YXXA 1H50A 3UY8A 2G8ZA 5HWNA 3TWBA 2OO6A 3W27A 3VMOA 1XD1A 3AALA 3SY1A 1EJSC 2ZWYA 2NVAA 1PX8A 1KRBC 4AC7C 3ITOA 3L4YA 1G0CA 5JH2A 1N7KA 4LAKA 1XIHA 4I9JA 3EKGA 2QS8A 4CQBA 3VKDA 4PUKA 1UB3A 1E3ZA 2PLCA 1R7AA 1NQ6A 3N6HA 2VC5A 5G4WA 3M4HA 1JGMA 4MMWA 3HFTA 4NAEA 3ABSA 5D30A 3TYZA 1O95A 4FXRA 1JCLA 4GC4A 4QITA 4DBEA 3GE7A 1ONXA 3QKEA 3W9ZA 3MB9A 4X0VA 4O19A 3TROA 3GFXA 2GDVA 4S3KA 2XGIA 9CGTA 1NOUA 4NSBA 5T8GA 3R10A 1T40A 4QNWA 2ZZ5A 1AUSL 1IEVA 1F76A 3UWYA 4RV3A 4UR7A 3QTPA 3R4IA 3MBFA 5KETA 1UIPA 4CUCA 1B4KA 4JTGA 1FWAC 3TMQA 2OWCA 3QPEA 3AZTA 3S6DA 3S42A 1PO9A 2V5BA 1ME9A 3BOXA 1NF7A 2TODA 2ZX6A 1BVNP 4YTQA 2ZX8A 4AZ6A 2E3ZA 3LLXA 4DZAA 1F3XA 2L5HA 2FTPA 5IDIA 1QW7A 1BYDA 2ZRVA 3T42A 2DSKA 2F61A 1R3QA 4AQLA 3SIMA 3B3DA 4QJ4B 1X39A 4K2SA 2RUSA 4PCPA 1PS9A 3E0IA 3LNPA 1LZOA 3BCJA 2CERA 4S38A 4AH7A 3H2MA 2PWDA 1KM4A 2YW3A 2XIBA 1W9VA 2BVYA 3OLEA 4HHLA 1A53A 5MF5A 2FMOA 1XRSA 4H01A 1V79A 1JULA 3RJXA 2GGJA 2P0OA 1GZJA 1M5WA 3ITYA 1WOBA 1AH0A 1H7RA 3CZLA 2ZRYA 3BSGA 4RE2A 3RPTA 3JZEA 3VFCA 1MW1A 3FHQA 3W76A 1VYPX 2F6XA 4DJEC 1SFTA 1AFSA 2Y24A 3O07A 3CO8A 3CH0A 4P7RA 4K7YA 5CZKA 5LA0A 1GJWA 4GIRA 4TMBA 4ERGA 3F03K 3TDFA 3GS6A 3N13A 1V7YA 2ZYFA 2PDXA 2XIJA 3THDA 3FEMA 1FWJC 2ZC1A 4UUIA 4DF2A 3MSRA 2ZZ1A 4UQAA 2VR2A 3VIGA 5TF0A 4LAOA 2FH6A 2XM1A 5TAOA 4M6QA 1ECQA 5DLCA 1Y7VA 4IFRA 3CAQA 4YTTA 1GVRA 2Y6ZA 3GRIA 3LX9A 3QM3A 1RBOB 2E8YA 3KTSA 2A85A 4GGBA 4E2BA 3I7SA 5FAGA 1SW3A 1TPB1 4UMCA 4CN6A 4UWMA 3TAOA 4MVAA 2VOTA 4YL2A 3IJIA 1OD8A 1D7FA 3DERA 2F38A 3UWEA 4FP1A 1CW2A 2WNZA 3HA1A 1ZLPA 4C6OA 1C91A 3W23A 4EOUA 2PDIA 2I56A 2DSZA 4DM2A 2CYGA 1F74A 2WSKA 2A3BA 2E6YA 3AIUA 3QMSA 2JF7A 2GK1B 1LWIA 3CAWA 2EXOA 4IIDA 1UWIA 1XIIA 3GDBA 5D32A 1HO1A 1NM9A 3NO5A 2J8TA 4ZR8A 3TTQA 4O12A 3KXQA 4H8HA 4GQBA 2CHNA 1AH4A 1PUDA 1A4LA 3H2NA 2BWGA 4ZMGA 5DO8A 4X22A 3VOFA 1EJXC 4DJDC 3GWQA 1P6BA 1XS2A 2DORA 3OYXA 3NXLA 4ILSA 1DPMA 4UNIA 5H8PA 3VKAA 1Z3NA 4A6GA 2GK1A 3MKKA 2VGIA 1ISYA 3RAOA 3NFUA 5LNUA 5EA9A 3MUIA 3B9EA 2BY1A 1N8WA 2AQWA 1HIZA 1UASA 2UBPC 3W26A 4WD0A 4QCEA 1QBAA 2J9XA 3LSCA 1S2UA 1HF6A 4MTVA 1WKEA 3G1RA 3HQPA 3HPXA 3WFZA 4Q8VA 3IAPA 2G0WA 2YR1A 4JTHA 2G41A 1YMYA 1A50A 2XFRA 4BFAA 5C71A 2BS9A 3ZJKA 5CBIA 4RDYA 3TQPA 1YNPA 3DYMA 3QPYA 2O0TA 2POTA 5AYZA 1X7IA 1RBAA 3AUJA 4GVHA 2WMHA 2Z24A 3ZVHB 1VCGA 1ITCA 3PJXA 1PDYA 3IIXA 4FLSA 4LYKA 2ZE3A 3L0NA 2IXUA 5EFFA 2P0IA 4DBDA 1ZP3A 3AWNA 2QJNA 3MUY1 3BLIA 4MJ4A 4KERA 1TWWA 2VGGA 1EB3A 3DIPA 3EKLA 4WX2A 3TYDA 3WLTA 3GH7A 3EB4A 1TV8A 4GNVA 3CHVA 1W31A 1HJWA 2DVXA 1TX2A 3DBPA 1IXQA 5H2ZA 2DZXA 1WX0A 4NZ4A 1IGWA 2CKRA 2DP3A 3F4NA 3VGFA 5L6UA 1RXOB 4I5UA 5A3HA 1XHGA 3EGJA 4DF0A 4U28A 4LCSA 2V3GA 3A24A 4IJBA 1TCMA 3KZPA 3TP4A 2V69A 4L1GA 1P1XA 2J6VA 2OGYA 1Z69A 3BO9A 4GCAA 2B4GA 5L9FA 2OEMA 2AKMA 5BOOA 1OGBA 4OHQA 5I3GA 3S9YA 5RUBA 1BF2A 2EAWA 2A6LA 1TR1A 1O5KA 1VD6A 2QJJA 2ZDRA 3UJSA 3PTMA 3WDPP 3LMYA 2QPXA 4B5NA 1GVQA 3T0TA 4DVOA 1HVXA 2Q71A 2VELA 2PF0A 4Q32A 1H1YA 1E0XA 3EBVA 3TWAA 4GA8A 4HPGA 2YJQA 2VC6A 1YLVA 2QW5A 3EDEA 4GVIA 1OFRA 4QE1A 3UF9A 4ADTA 4C6QA 1HKWA 3BCFA 2WC7A 1G4TA 4L9YA 4AHPA 2A3CA 3Q4DA 3TNBA 4GYJA 3WQWA 2A7PA 3CU2A 4QCFA 1XLAA 1JYNA 1W3TA 1XXXA 5LIXX 1V4YA 1F3EA 1EWEA 4LVAA 1OD0A 5A69A 4GUJA 4UIOA 2PWEA 2GQAA 3OYZA 4DJEA 5AC6A 4A8LA 1CI1A 4MFDA 3UWVA 3AOFA 1JDFA 4DN1A 3CPRA 1BRLB 2H8ZA 5CBJA 1Q85A 3SUWA 1GKRA 1W3JA 4UC5A 4NI3A 4QAWA 4W8AA 3I6EA 2BLEA 1P6WA 1EZ2A 5CSUA 5LGXA 2NX3A 1A0EA 3QJAA 1DORA 5CCZA 1GEHA 3LLFA 1HXJA 3TONA 3WK0A 3TJXA 4UOZA 4DXKA 1J01A 3QH2A 1LLZA 1XX1A 2QMKA 2CLIA 3W2LA 3SQMA 4Y9NA 2C91A 2RJGA 2UY4A 1GOQA 1VJZA 4AD2A 1OFEA 1HJSA 4A8IA 3ABRA 3O1NA 1UR0A 1BRLA 1G01A 3G24A 4DYEA 1AD1A 1JQVA 2KX9A 1XIFA 4RJEA 1NP0A 1UWTA 3N4AA 3W7NA 2E25A 1E6QM 4HCDA 5JH1A 1J4EA 4LRSA 3CMJA 3W2JA 1H0IA 2WC3A 2GSHA 2CHRA 4M6PA 4Q7IA 3RCNA 2NV1A 2GOKA 1LT7A 3F2DA 1S39A 1UHVA 3NSMA 1J5SA 1ZU8A 3B06A 2MUCA 2ACQA 2PDYA 4JYDA 1NFGA 3RLUA 1WE5A 5BMXA 3NVDA 1BKHA 2WB5A 1QASA 5DMMA 2QZRA 2R24A 1XR2A 3DOPA 2BY0A 5I3IA 3SCOA 2P53A 1Y5VA 1B30A 3OVPA 1A3WA 3GM8A 3RU8X 2OTDA 1DJGA 3TUUA 1VCVA 2X1IA 3QR1A 3AS1A 5B7ZA 1Z42A 4GOAA 4JZ5A 1R47A 1XQLA 4GCXA 4GINA 1H1ZA 1IF2A 3UT0A 1D2KA 3FA3A 4DJDA 4JN6A 5H1WA 1TV5A 1UOKA 3AIRA 1WKYA 1K9DA 3N3TA 3BANA 4PN2A 3R89A 2O56A 4N2YA 1N55A 2E40A 3W81A 5BROA 1NTHA 2IKIA 3DCPA 1LQ2A 1UZ1A 1EJ7L 4PC8A 4NT0A 4Y8EA 2EGZA 1N8FA 2I1OA 2IPFA 5FEWA 1IR1A 4FB7A 2R82A 5FF4A 1E40A 1BG4A 3O8AA 3L9CA 1GJUA 3RFAA 4AZ5A 2HROA 4HNTA 2AKZA 4GH1A 5G1YA 2PPGA 3CTTA 1A5NC 1KRMA 3QRHA 3OHIA 3CZKA 2ALRA 4G5DA 3MVTA 4GY1A 3R43A 3P60A 3EOEA 3N17A 3UXDA 1PX4A 1EJRC 3EWCA 3BAJA 4HCLA 1SZGA 3DECA 3QQ1A 1PHWA 3QF0A 2GOUA 1SO6A 3S9IA 2A2IA 2YSWA 3WF4A 2J74A 2OEJA 3SN4A 1Y8BA 2G3MA 3RNDA 5C2GA 3TYEA 4XZLX 1UWAA 4XAYA 3MHGA 4R7JA 3WDHA 4F48A 5ABFA 1UWQA 4FO4A 1MW0A 4EF9A 4O28A 3S5SA 4MGGA 1KM6A 3JU2A 3TW7A 4EXAA 1C8XA 2IPWA 3K8MA 3BZJA 4K38A 4AHQA 3IARA 1ZBCA 2J7FA 4Q22A 1YW1A 2HSAA 3DFOA 3G0UA 1OFOA 5I03A 1RP8A 1W0MA 4YTUA 1MFUA 1JRCA 1O94A 3KTXA 3WH5A 3ANYA 3E3HA 4PEKA 1JYVA 4IOTA 1XW8A 2VMFA 4HZ6A 1XLLA 1AK5A 4IIGA 2CITA 3W6LA 4AZ7A 3BAYA 3TR9A 4M29A 4RLIA 2WNQA 4TXEA 3WFAA 1W3IA 4IP4A 8RUCA 4N42A 2CLPA 2PZ0A 3UFYA 4FNRA 1AH3A 1BYAA 2H90A 1H60A 4FS9A 2EQDA 4RXGA 2GPTA 1FHUA 2QNEA 4PYSA 3CUHA 4XD6A 1SW0A 4E2OA 2UY2A 4Z2LA 5H8MA 3W74A 2O92A 4PCSA 3AMLA 1CZ1A 1V5XA 3QZAA 3PZ9A 2VNCA 5CZTA 8XIMA 1TFVA 1CEOA 3T55A 5JUVA 2Y7FA 2Z29A 4NASA 2NV2A 5HUOA 3HMCA 3PAJA 4POCA 4O8RA 4YHGA 3UU0A 1B31A 3BDKA 3P62A 3M16A 3P61A 3VABA 3GNDA 4RNFA 2HPMA 3TTEA 3AYRA 4O17A 1FDZA 4HOZA 1IIHA 4MADA 5BMWA 3P8IA 1XLEA 3GNNA 2VT0A 4LBUA 1R3YA 3F5LA 1F07A 4JX4A 4MDPA 4Z1BA 3NOYA 2FZ8A 2QCEA 4ATDA 5CJNA 4NG3A 4OV9A 4Q6XA 3IRSA 2YYTA 4AF0A 3INPA 4M19A 4DO6A 4TUFA 4DYJA 3MP4A 2UY3A 3O6DA 4GZ7A 3UG3A 4XVDA 2QR6A 4A3HA 2Z1VA 1S3TC 3WH7A 3W82A 3BPWA 3L66A 2EPHA 3SCNA 2XINA 3O0KA 3AWOA 4MYXA 4B91A 1JF6A 4A3RA 1GVIA 1OF8A 3TFXA 5GNXA 3TK7A 1EJTC 2WV8A 3AJ7A 4DBUA 3GR8A 1KQYA 1V6YA 2PDNA 3MC5A 2C3ZA 2KZHA 1C8YA 4GQQA 1KC7A 1TWDA 1XBXA 3UWWA 5CPTA 4OECA 1SZEA 1E56A 4YCOA 4MNLA 2FFIA 3FJLA 3IGUA 4FNPA 2FB2A 1UMYA 3KBWA 2WNWA 1IV8A 3KRSA 3S2NA 4AEOA 2V38A 4GI6A 4NJHA 1ESWA 1WDQA 5MKGB 3T2QA 1QOPA 1XICA 3E0VA 4QXIA 5IHSA 4BI6A 2QCGA 4HBKA 1RBLA 2VX6A 3QYSA 2WKJA 2WVVB 5CGTA 5D9PA 5CZ0A 4DJFD 3CPGA 3F4DA 3VPLA 2GGIA 3W7GA 6XIMA 4EKJA 1QHOA 3VIJA 3BARA 3N2MA 3WMLA 1M3UA 2ACSA 1GOOA 3BLDA 2VZVA 3EEGA 1V6VA 1RLDA 4INFA 3THAA 7TAAA 5MKGA 2D2OA 1JPKA 1DE5A 4UTMA 3GVWA 3TLQA 3B05A 4JYFA 3LG3A 4MB1A 4KGJA 1B3OA 1IWPA 3PUEA 2X0HA 2QKFA 5C6MA 4D6CA 3ZLFA 1ONEA 4KMQA 5CGMA 2TRSA 4PSRA 1F05A 2AQOA 3KL0A 2JIEA 1W1B1 4QNEA 1L2UA 4OJYA 1EOKA 4AYSA 1KKOA 3ISIX 2Z1BA 3OA5A 1VBUA 4A22A 3SIZA 2YIHA 3QV9A 1TRDA 3PJUA 3OTRA 4LY8A 1R30A 1NF0A 3E0LA 4HNLA 2QF7A 3MDWA 3ME3A 3U5UA 1FTXA 4FXSA 3UR8A 1X6LA 3W7LA 1XDMA 2YBVA 1GVFA 1K70A 3ABZA 1TMLA 1P4CA 5AYIA 1UH2A 2XN1A 3FJNA 1GG1A 4HA1A 3G6LA 1YPFA 1F9CA 4PCNA 3PFRA 5CQ1A 3T2OA 2HPIA 1R5YA 4KIEA 3HN3A 2OLSA 3DG3A 3AXHA 1FA2A 1WB0A 4KEMA 3LI0A 1CX9A 4FXJA 4WXYA 3L12A 4UNLA 3UJRA 4J40A 4MIMA 1HL9A 2VUNA 4MNJA 4JR5A 1B3XA 4S3BA 2ICSA 4IPIA 2VDHA 2NT0A 3L21A 3KAOA 4MKSA 2ANUA 2V8ZA 5T26A 4J2PA 1ZTVA 4Z1AA 3VUPA 1WP6A 1E43A 1E4LA 5IBXC 3Q94A 3VKBA 3TSMA 1DV7A 4GKLA 1Q6RA 2FIQA 3GU1A 2F7FA 3LPGA 2A7RA 5E9AA 4AG0A 3BJFA 3IK4A 1A5OC 3H23A 4DO4A 3KVKA 2FHBA 4TX6A 2RKXA 3QOKA 2NUXA 2OZ8A 2VEGA 4XQ6A 2PDFA 1KGXA 2FZMA 3ARXA 3G1XA 3VIFA 2FZNA 1EUAA 3UW6A 3DFNA 3W2NA 4C65A 1L6WA 3V36A 5FIPA 3WLHA 1EP1A 1NWSA 3PPCA 3GO2A 4ZO8A 1JEZA 3RRXA 4PBFA 3F2CA 1JNDA 3C6CA 4H00A 4AYGA 1Q8AA 2QCDB 3UR5A 1TREA 3A6OA 4LYRA 4I8DA 2C14A 3VM5A 4A8RA 4KKXA 4QS5A 1VBGA 2Y8UA 1BFNA 3MP5A 1LLOA 4LANA 3BH4A 2X30A 3CQHA 2QGYA 4WKFA 1QOXA 4ZCWA 4O50A 1GUVA 1OYBA 2GZXA 1QI4A 4YS1A 1UR9A 1EQPA 3YPIA 4G7EA 4OOUA 5T9CE 4JIQA 3MHFA 2GUUA 3H7VA 1J0HA 1CXHA 1TV3A 4MPQA 5EB8A 2E9LA 5I78A 2ZZ6A 3AXXA 2QUMA 3G77A 1R38A 2QCDA 3TQVA 3BLEA 1WBHA 4LWWA 1VR6A 3IIOA 4TR9A 3M0MA 1Z48A 2QEZA 4O14A 3V35A 3F4VA 3ANUA 2E7FA 4GVFA 1OZMA 3BICA 1J0ZA 5LXXA 4GLEA 4JQ4A 2BX7A 2G3NA 4LYQA 1H41A 1J0IA 4FF5A 6TIMA 1AJ2A 1A4MA 1CB2A 4EPDC 2OODA 1JJKA 5DY2A 3RUBL 2PTZA 2Y89A 4WSKA 4J7RA 4NJKA 4R7WA 1EPXA 3A64A 1K7FA 2VFIA 1M03A 1V6XA 3KRUA 1W5QA 4WJ8A 1UKOA 4ROPA 2Y8KA 3QVQA 1CNVA 4L4MA 1I75A 3GG0A 1F7BA 3OB8A 3TOYA 3O15A 3EWBX 3QKZA 1ONWA 1DJIA 4E8CA 1FWBC 1MEIA 5D02A 1NSJA 1JI2A 5I09A 3NPWA 1H7XA 4KEZA 1H5VA 5AHFA 3AI0A 4IMFA 1A80A 5I23A 1XFBA 4LQ1A 3EWUA 4ZE4A 3CIVA 2DZBA 3WH8A 3ITLA 1TE1A 2A3EA 1K02A 1MW2A 2VCBA 2QDEA 3NAVA 3QZ6A 2AMXA 4FNSA 3H4XA 5AC5A 4AD5A 5E0CA 4XBSA 2PLMA 1VJSA 3S2CA 2Y1HA 3M0LA 4GY0A 1KFEA 1K7XA 2YCJA 4FEZA 5M03A 3CT7A 4QR6A 5CH9A 4US6A 1ENUA 1TTJA 4OBSA 1YBQB 3N11A 1QT1A 5AHIA 1X98A 3L2MA 5HQLA 1R3WA 4LV9A 4MSSA 4MYAA 4GIEA 2NVCA 2GJRA 2R94A 1ICPA 1O1ZA 2BHUA 2D2HA 4KEUA 1M04A 2PTWA 5BRPA 4ICMA 5D8WA 4G7FA 5EMYA 2R8WA 4M51A 2E5DA 5DMNA 2ZX9A 3FW6A 2QV5A 3B8WA 1ZALA 2ZDSA 2VQTA 2NQLA 1PHQA 1Z44A 1QNRA 1YBQA 4K1WA 1B3WA 1D8WA 2I5IA 3EX4A 3BQ6A 3QLLA 3OG2A 3UESA 1LF1A 1Q6LA 4WK9A 2BHZA 2FTYA 3H21A 4GUFA 1UP0A 3URAA 2YKKA 3WQPA 1RPXA 3A5FA 1C90A 4HMNA 3V4BA 3KHJA 4XD4A 4C6JA 1NARA 5HBFA 1X6NA 5C55A 3BLFA 3HGRA 4URIA 3FA5A 1C3FA 1XWYA 1OC5A 4IHCA 2QJMA 4EK7A 2PDWA 3WQ6A 1KLYA 3GVGA 3S46A 4XZNX 4DY1A 2WK2A 3DGRA 5E1QA 3QW4B 3STPA 2A79A 3S2LA 4GWEA 3HGJA 3WDJA 1W9BM 4JTTA 3T9PA 3PZOA 3WNKA 5C9RA 1FWDC 4TMCA 3OHMB 3WLIA 4IUGA 4HN8A 1S46A 1HKKA 1RA5A 4IXHA 4LVBA 3F4WA 1W17A 3GDRA 5K4ZA 4GFSA 3IEBA 1UR4A 1VIWA 1K4GA 1EKOA 4R27A 5HOSA 5IBXA 1BTMA 3C52A 2GVGA 1PYFA 2TMDA 2XIIA 4GJ1A 1EJUC 1FXQA 3MI6A 4W7UA 4GZEA 4L6DA 3PS7A 2NX1A 3BAIA 1QDSA 1P0BA 4PMDA 3W2KA 1SJBA 4IJCA 1PAMA 2BSLA 4QGCA 3SAZA 2X2GA 1FHLA 1Z8AA 3LCGA 3UZ5A 2WZEA 3U2OA 3VD5A 2OU4A 4YTRA 3G1AA 1QPNA 2Q6ZA 1TIWA 4KPLA 3GBEA 1PZ1A 2D1ZA 5CPOA 5LIWX 2BFGA 5D2XA 2BNJA 1M68A 4DJFC 2YA1A 4GH3A 2A0NA 1TKKA 1JDEA 1J96A 2QIIA 2YCIX 3EMZA 1J6PA 4FLRA 1ZJIA 4IP5A 1OFAA 1HKJA 3A5VA 3UR7A 4KBXA 5FJTA 1LOSA 3RILA 1S5WA 3KCLA 3W3OA 4M7SA 3WSUA 1E6SM 2GVLA 2WC4A 5HMDA 2BY3A 1G7VA 3LM7A 3N6QA 2C1HA 4LVDA 2QCMA 2VL4A 3OGRA 3RU6A 1S2WA 2EG6A 5D37A 3VNIA 5CKSA 3M1ZA 1MEHA 1OB0A 5DF0A 3C8NA 2D73A 1V0MA 2WCSA 1DTUA 1XLFA 1J2WA 4D1JA 3WCZA 1OADA 3AIWA 3P0XA 2AAAA 3ALGA 4PFMA 3GG7A 4UXDA 3MUCA 3RXZA 5ABEA 3IIPA 2P10A 4PRRA 4QLKA 3GZAA 3DFYA 1R46A 3UEQA 1T8QA 4JBRA 1GVOA 3RX2A 1V77A 3M0JA 2QJGA 3FCPA 1UH3A 2P88A 1HUVA 3PB0A 4AMAA 4HB7A 5HNRA 4GUGA 1OBAA 1GQNA 4PL1A 3CWHA 4M81A 3WJXA 1VPYA 2J62A 3PTKA 3W7MA 4QEHA 4BWLA 4F0SA 3L5MA 4US5D 2WPGA 1M7XA 2I17A 4TV6A 4ZQPA 1P48A 4LBRA 2J27A 2UWFA 1KO0A 3L4ZA 4AIUA 4JTFA 5D2TA 4Q8NA 3MCOA 2CZVA 2AAMA 1OF6A 3GKAA 2VWSA 4DRSA 3U2CA 1REQA 3NCOA 4MLRA 3RCYA 3NQ8A 4D6EA 4S3DA 1QTWA 3A4JA 1JZ6A 2OWXA 3S6OA 2IXVA 1WAUA 1UIOA 5LHFA 3NSXA 3A9IA 3STEA 1EGVA 3TC6A 1K8ZA 1E5NA 1FKWA 4LUSB 4A3QA 3MKVA 2X1UA 3OIHA 3AMCA 4O4VA 3A3HA 3CMFA 3ITVA 4PODA 3W86A 3SCUA 1VENA 2VCAA 3S2MA 3KOYA 4L56A 1OEPA 1ZUAX 3TYAA 3B4YA 1RJQA 3B8UA 1FH8A 3J7HA 2EPNA 1GQJA 3DFHA 1VJIA 5CXPA 2VFDA 2V30A 3IANA 1TWSA 1T6MA 3VKKA 2VEMA 1UW9A 3U4AA 3LQLA 1MZRA 1GTEA 3I3BA 1W9XA 5ECUA 1C9DA 3PPHA 2FDMA 4JGDA 3QYQA 5CJMA 2E6AA 1PBGA 1TCDA 4H83A 4IX0A 2G97A 3CQJA 4L80A 3STFA 3LNMA 4HP5A 4HNUA 2EG8A 3N4EA 2WZMA 1DJHA 3PZIA 4PGLA 1VLIA 4NX5A 3U0HA 1XC4A 2X2YA 1EO5A 4H9VA 4XZBA 3RMJA 2BOEX 4DB7A 4TVUA 3ARPA 4ZB0A 5D05A 2GUYA 3N2XA 3GXTA 3G0SA 2E68A 1V0LA 1M65A 1BEUA 4K8HA 2J66A 2H3DA 5EFDA 2FTWA 2P3EA 1W5NA 4MZYA 2Y62A 4LAZA 3HGSA 4GO9A 3MMTA 4NJJA 3UP8A 2WOQA 1VLWA 1UUQA 3C2EA 4HKPA 1ICQA 3LGEA 4H2CA 4YWSA 1O4UA 2CPUA 4RW3A 5LSMA 1R87A 4PMOA 4WDXA 2ISVA 1RSCA 2DPEA 1CXIA 3ZFHA 3I4KA 4PMYA 1SZRA 2G3IA 4BF7A 3HJZA 3U2ZA 1JPHA 4MNKA 4UFMA 3H55A 3Q65A 1E5JA 1DIDA 3TR2A 4QJ1A 3L7RA 1Q6EA 1S5TA 2ONEA 4WXZA 4LV4A 4FALA 1LUCB 2YL6A 5IHRA 2W3ZA 4HU3A 4ACZB 4BI7A 2G4JA 1XDLA 1Y5XA 3NQVA 1K7EA 2OXNA 2XWEA 3KDOA 2QCLA 1PJ9A 2W27A 1DXEA 1XCFA 3T05A 3SCVA 3KE0A 1S38A 2INFA 5AHEA 3BL3A 1YXCA 1CENA 4RE4A 5CJ5A 1E6XM 3V75A 2GFTA 1AMKA 3W25A 4JPGA 1GT8A 1LUCA 3FKKA 1DIOA 2P76A 4TX9A 2IQTA 3R6IA 2E1DA 3VE9A 4ONVA 1GGOA 4EXBA 1KB3A 4ACZA 2YZRA 3GIQA 4HPHA 1X1NA 3I7QA 1GOWA 4D8AA 2WZTA 2QJHA 1QVBA 2CBUA 1TMHA 3MW7A 5M3WA 3DXIA 4HNNA 4CKQA 1U5HA 2PB1A 4DJFA 1XLCA 3NWRA 4LUTB 3TLLA 3DKLA 1XIEA 4PMNA 1SMAA 2PC8A 1WBJA 4GE8A 3B04A 3VDAA 1JXKA 1P6CA 4J1OA 4UFIA 1ISWA 4JOMA 3ZJ6A 2JQXA 2OKOA 3QEZA 1DJYA 3EXRA 3W7IA 5EL1A 1UUMA 4B15A 1TMQA 1VGAA 4HMEA 3QV7A 3FVDA 3NDZA 1B0IA 3EA2A 4H9YA 4HA0A 2VWTA 3P5ZA 3NDOA 1SO3A 1H3GA 1X1OA 3AISA 1EIXA 3FYOA 4GK8A 3RJYA 2WMFA 3QLDA 1KLZA 2GVEA 4D9PA 3VD4A 2FPYA 1LT8A 1OK4A 3W7QA 3CAVA 2GQ3A 5HR6A 4M24A 3SO7A 5GJMA 4WLCA 3B9DA 5G1TA 4JIEA 4OE7A 4QFUA 3TCSA 2XM2A 4S2BA 5C54A 3GNPA 3W87A 3C0LA 4KQNA 4DLMA 4H9XA 2ZA1A 1OT1A 2B7OA 2CW6A 3LRKA 4IMEA 1ZCCA 1W1A1 2FMNA 3NUKA 4RCXA 3O0FA 2HVMA 3RLVA 3CV6A 4UTFA 1D9EA 3VZZA 3LBOA 1SYTA 3SEPA 3FDKA 5ABHA 4WIWA 1ADOA 3CEUA 3M9YA 1L6GA 2FYMA 2ZADA 4XVEA 4FHAA 1B4EA 1FWGC 5HMFA 2PODA 1QWGA 1OCNA 3NYZA 1E6NA 3ABOA 3ARQA 3ITGA 4PBGA 3WQ5A 2FFCA 3WMBA 3KLLA 5EMLA 3BOLA 2J75A 2YB4A 1EX5A 4NF7A 4TX8A 4A8NA 2DSVA 1HJXA 4UTUA 3TTYA 4AWUA 1PIIA 5DT5A 3W70A 2FHCA 4NYUA 3TA9A 5IOBA 5FJIA 3M5VA 2PWGA 1E9LA 4J28A 3VGGA 3PBVA 3SBFA 1G67A 4IMAA 4WZHA 3AXIA 2O9PA 1W1IE 4Q8TA 1A5AA 5REQA 1Q6QA 3PBWA 2OZ3A 1ZAJA 2CU0A 1WA3A 1ZPTA 1SUXA 3E49A 2X05A 1Z7AA 2WQPA 1ZBVA 1UZ4A 1TQJA 4R5EA 3FNDA 1ADDA 2ZA2A 1R85A 1JXJA 5EGRA 3KCOA 1OSEA 3IIVA 4OKDA 1DOSA 4O8AA 4E2VA 5I3HA 2IPJA 4L7ZA 2YB1A 4X61A 1YX1A 1UC4A 4LEFA 2FDSA 3L4WA 3OO2A 1K6WA 1NVMA 4PRWA 3TW9A 1NFPA 1KXQA 1H7WA 1GVYA 3GVVA 3IJ6A 5JU6A 3ARWA 3NIYA 3CQKA 5AYBA 4NY2A 3N12A 2YLLA 4ZEPA 2PDCA 1P0DA 2VFHA 1W5MA 4QJ5B 3LXBA 1IZKA 2DV0A 5D33A 2E9BA 4K6AA 1OM0A 1DP0A 4JX5A 1EBGA 1O66A 1BVWA 4LBSA 4R53A 4JDYA 5MHBA 1RP9A 3BURA 2X1RA 4AEEA 1TSIA 1CT5A 1GOIA 4EP8C 3IJQA 1POKA 3M64A 3WBWA 1CGXA 4FNQA 1KR0A 1OT2A 3BLLA 1QI3A 3GW3A 3GHSA 4R34A 3QHOA 1V3MA 3O63A 2X1TA 4YVPA 2HXTA 5I2UA 4N6FA 4ZTXA 1JYWA 4M1RA 5D03A 1TPFA 2GWNA 1WO2A 3ID7A 3VD3A 3GDTA 5EMJA 1GOXA 2E77A 1XCXA 1NDYA 1TA3A 4ZSTA 1Z32X 4IPJA 3LZ5A 5D09A 4XD5A 3ONCA 4ZFMA 1RY0A 4GKTA 1JPDX 3NQGA 1E71M 4CCCA 4QJ3B 5FL0A 1OCJA 3L67A 3N2TA 4PUNA 3VVGA 1MYRA 4EAMA 4WR3A 3H7RA 1XI3A 5DCBA 3OIXA 1V51A 2G3FA 3R79A 3ZO9A 4M80A 1DXIA 4P5UA 4CD6A 5JQ9A 2HJPA 1XLMA 1U1JA 2GJLA 3T0DA 2WMGA 2WMIB 1VB9A 2Z6JA 4XV0A 3OZPA 1IEWA 2PBOA 2PWVA 1Z41A 5D04C 4S39A 2WHKA 3IUIA 3KHDA 1MUMA 1BYBA 2FVMA 1JUKA 1PZ2A 3S6TA 4FOUA 3WK2A 5K2ZA 1VBHA 5I07A 3B0PA 1DJXA 1YADA 3UGRA 3WQ4A 9XIAA 2CBIA 5IFPA 1KRAC 2BMBA 4BHYA 3SGUA 1MVYA 3THQA 4BCEA 3MDUA 4E8DA 2XWDA 4FX6M 4YXGA 4IF2A 5T91A 1PDZA 5A6LA 1E1CA 3WDIA 3PF3A 1MO0A 1JQXA 1HP5A 4AVNA 3L4VA 3NURA 3EX2A 3T4CA 4NZJA 3FYPA 5DBUA 2A4AA 5EBAA 5LNVA 1B90A 2V5LA 2XYLA 4P7NA 3NPXA 1EFZA 4F0RA 4JFUA 2Y5JA 3AYTA 3E2QA 8XIAA 4KCTA 4JXCA 2CZ5A 2HWGA 4C5YA 1TVPA 4BQ5A 7ODCA 1LL7A 4E3VA 3PWIA 2WQDA 4GUHA 2Z27A 1KTNA 4ROQA 4J3ZA 2G37A 3UNTA 4ZE5A 3OEXA 5H8UA 3UXIA 3A4WA 2V81A 3DYOA 3CT2A 4FOKA 4RPQA 3KWSA 1W3KA 3DHDA 1XQKA 2XH4A 3UVAA 3KBNA 1GYMA 2WJDA 1TRIA 4JQ2A 4IGSA 3PUGA 2Y7GA 4HQVA 3WUFA 1BWKA 3W1PA 1NFBA 3GR7A 4IM4A 1LL4A 4NIRA 2V63A 1VH7A 1KFKA 3AYVA 5D9OA 2C71A 4GYFA 1XKYA 1I1XA 3WQCA 2WM1A 4PULA 1YNQA 4U5KA 3OGSA 2QDGA 2VEPA 4L65A 1H62A 1XYBA 3GKFA 3SUVA 5HUPA 2PWHA 3THCA 3O06A 4JKKA 2ATSA 2PWUA 2Y7DA 5DANA 3DG6A 1P1MA 1UWUA 1LBFA 1JNEA 2JKPA 4ZVJA 2B7NA 1I1WA 1XPYA 4W8BA 2I57A 1ZNNA 1EC9A 3LOTA 1YEYA 1V03A 4YYCA 1RCOB 2XVNA 2WXDM 3M0KA 1EYWA 3CK5A 4XUGA 1HNYA 4L4OA 2PU1A 5HJLA 1ECEA 3GYCA 1CXKA 4RNHA 4B4HA 3ENLA 2D23A 1FP9A 1V0KA 2Q02A 4O15A 5HNUA 3EPNA 1JCXA 2PDQA 1FWNA 5FJRA 4XBJA 1KXHA 4P8WA 3LV5A 2OJPA 5C5YA 3UG5A 3PY2A 4RUBA 1GQLA 1ISXA 2PGFA 1G7UA 3OBAA 3CH9A 4KEVA 4C5ZA 4UTJA 2HISA 4ADUA 3E02A 3TXVA 3QPZA 4FLQA 3UR2A 5AHLA 5CPMA 3BG5A 1B5TA 1TPDA 3O7UA 1F8IA 5GJPA 5DEZA 3KL3A 4ERIA 2PE4A 2ZRZA 2PGEA 4BZYA 3E9AA 1TWZA 3PPGA 2VRKA 1F6YA 2Y5EA 4W5UA 3DC8A 4B16A 4PMUA 1Z9AA 4XISA 4CN4A 1X97A 3N15A 1N8IA 3MSGA 1I2OA 1MNSA 2J9YA 3ARSA 1WDSA 2ZUNA 3CHEA 4RE0A 1T8XA 2NUWA 2DVTA 4GISA 3NSNA 3UXKA 1FH9A 4MJZA 1AODA 4AB4A 4CU8A 3CQ0A 5G2HA 3U4FA 2JEQA 4ZXLA 1SQ7A 3PZQA 3WJWA 4KFNA 4F79A 4G1NA 3QY6A 4JTLA 1LOLA 7ENLA 3VNYA 1DTNA 3VFLA 4AVFA 5XIAA 2IKGA 3DFTA 3TQ0A 2ZWZA 4U3AA 3AHTA 4G9PA 5A6BA 3LU2A 1NQKA 4DXXA 3NQ7A 3EA1A 1IYXA 3BW4A 4C7GA 3H2OA 2PDBA 8CGTA 2VD9A 2GLKA 3NOEA 4QROA 3SCTA 2EKCA 3LERA 2CLKA 2J7GA 1PCKA 2GQ8A 4ZQOA 3CHDA 1KV8A 3BXWA 1VRDA 2CC0A 4A4AA 3I65A 4L1WA 4WKAA 2EJAA 4BQ2A 4US5A 4HU0A 1QW8A 3FA4A 4OOZA 3CV7A 3TX9A 5BXPA 4JY9A 1WZKA 4WDTA 1G5AA 2Z26A 3W37A 5I02A 1LQAA 1AD4A 1R9ZA 5CSYA 1M7OA 3SJ3A 5A6SA 4PA8A 4IMCA 3M0YA 2F6UA 1OFBA 3WBYA 1B1YA 2GL5A 3PZVA 2NVDA 1ELSA 3MYPA 1W1PA 3IS4A 3ZQ9A 1H09A 1E4MM 3SCPA 4H7ZA 4XIMA 1JGIA 4LUJA 1R0MA 3WL1A 2ZTJA 1CYGA 1L6YA 2FLIA 2IPGA 3VMNA 3W7RA 4Q4OA 3K5XA 4PE8A 3LRMA 4PZVA 1VPQA 1ZENA 1BGGA 3GVQA 3K4DA 2YCLB 2RDTA 1KFLA 3B4UA 3SUSA 4AISA 2W92A 2D3NA 5BW6A 2PURA 2DT3A 4FR1A 4OBRA 1KKRA 3H8AA 3NO1A 4G8TA 4M8UA 4MY1A 2R1MA 2WLYA 1Q6CA 4ORIA 1H63A 1MQQA 2JKAA 3FLUA 2FZDA 4MJMA 3AIBA 2NV9A 2E0PA 3N2CA 1XUZA 4G6CA 3N3MA 3V5OA 4KWWA 3W73A 4S1FA 4AX7A 5HA7A 1XRTA 2ASHA 3DYPA 3REQB 3TXZA 2YCLA 5CLTA 3R8HA 4RPPA 3ELFA 2WSQA 4IX2A 2Z25A 2PCEA 2X0SA 3W1XA 1TPWA 3WLOA 3DU0A 4ES4A 1R9YA 2E8ZA 2F6KA 3WENA 5AC4A 2XSXA 4RV8A 3R5EA 4Q4MA 1HT6A 2OSWA 4QG9A 4DEFA 1G4EA 5G4HC 4LC6A 3KBSA 3NQEA 4PH6A 4Y6GA 1E51A 1A5UA 2G3JA 2PZNA 2ISDA 1KFWA 1X96A 4GBDA 3KBVA 2PC4A 4CQ8A 3NG3A 4AZCB 5K4XA 1UD6A 2XIOA 4Z1YA 4KRUA 2DJXA 4PCFA 4ZOBA 2XZ7A 3WNOA 5KTLA 1TPEA 3VDBA 1HVQA 4RZBA 1JCNA 3CLWA 3LV6A 1YTKA 1T7LA 3SY5A 2ZTKA 3QMRA 1C7SA 4Z0JA 1US3A 3MQTA 3SGZA 3VE7A 2PTXA 1YQ2A 3G6MA 4LFYA 1K3UA 4PB3A 5CG7A 3G3DA 3BAKA 4KFPA 3KP1A 2FHFA 3KS5A