1OJXA

Crystal structure of an archaeal fructose 1,6-bisphosphate aldolase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
250
structure length
250
Chain Sequence
NLTEKFLRIFARRGKSIILAYDHGIEHGPADFMDNPDSADPEYILRLARDAGFDGVVFQRGIAEKYYDGSVPLILKLNGKTTLYNGEPVSVANCSVEEAVSLGASAVGYTIYPGSGFEWKMFEELARIKRDAVKFDLPLVVWSYPRGGKVVNETAPEIVAYAARIALELGADAMKIKYTGDPKTFSWAVKVAGKVPVLMSGGPKTKTEEDFLKQVEGVLEAGALGIAVGRNVWQRRDALKFARALAELVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FRUCTOSE-BISPHOSPHATE ALDOLASE CLASS I
publication title Crystal structure of an archaeal class I aldolase and the evolution of (betaalpha)8 barrel proteins.
pubmed doi rcsb
source organism Thermoproteus tenax
molecule tags Lyase
total genus 88
structure length 250
sequence length 250
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2003-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ojxA00
2WO5A 3A5FA 2C0AA 2YW4A 3W7LA 1DJNA 3LRKA 3L66A 3W7NA 4EWND 3G1HA 4O19A 3UXAA 1LRNA 1M7PA 2E77A 3C61A 2PURA 4E2BA 1LTDA 2Y88A 3H53A 1FWWA 3MBFA 4FX8A 2XN2A 1XI3A 4WOZA 1H7OA 4FNPA 1SUXA 2FPVA 4QAIA 2CWNA 4IXHA 1FQ0A 1GVSA 4UTKA 3G8EA 2VFDA 4JIPA 4M19A 2C15A 2X16A 4C1LA 1SZFA 4QSHA 5CZSA 2OX1A 3MP3A 1DOSA 3L0NA 1VYPX 3KVJA 1GZGA 3LTPA 1ZAHA 2ZZ1A 4Y8FA 4NZJA 3GXNA 4M5PA 3PG9A 3P81A 4O8RA 3BARA 3PC0A 1P0NA 3JS3A 2CLEA 3UZJA 2R14A 1QAPA 5HINA 1M6JA 2Z6IA 1TREA 3CU2A 1EUNA 1TMHA 1HL2A 2G96A 3KOFA 3QSRA 5F4WA 3EWYA 2QDHA 4I9AA 5AHFA 1H7XA 4IMDA 3OG3A 3PR2A 3W1TA 4UXDA 1TPC1 4O15A 4CNPA 4KWWA 1OFRA 3PBUA 3W7JA 1O95A 3O16A 3A21A 4H3DA 4UFHA 2FB3A 3LERA 3NQFA 3L5LA 1SQ7A 3HO8A 4FNTA 4DQWA 1JRBA 1KFLA 3FYOA 1L2UA 2ZRUA 5LZLA 1IXQA 5LHFA 3KAOA 3G1FA 1C29A 2CZDA 4AHQA 1FCBA 5D38A 1OF6A 3LI0A 1K8YA 3PM6A 5EY5A 3GYEA 1R2RA 3EXSA 1LBLA 4JTJA 3DFPA 4IXXA 3P60A 4K37A 1YDOA 1G4EA 1TYGA 4IMGA 5E0KA 2NZLA 5DXYA 4O52A 1QOPA 2B7QA 5EPDA 1F2JA 3P8IA 5D2WA 2WSRA 3C56A 1TTPA 3SSJA 3W86A 1GPWA 1RR2A 4EOUA 5K7JA 4J9JA 2FB2A 3DH7A 4FIRA 3LHUA 3LM7A 3LCXA 2HTMA 3C2OA 5CSSA 1WA3A 2RDUA 3C2FA 4LY8A 5I3HA 5BMWA 4PODA 5DLCA 4UFIA 4LS2A 3UXDA 4AHPA 2G97A 4IMFA 1TPWA 5LNUA 1H50A 1R2SA 4WD0A 1LOSA 1PV8A 1LOLA 1O5XA 4LT9A 4QIUA 4X3ZA 3IVTA 2EF9A 5E1QA 3FLUA 4JTFA 4O53A 3P5YA 5F4XA 3UPWA 3GLCA 1PIIA 5I3KA 4AHOA 1VZWA 2VC6A 4XKYB 3GVGA 2BX7A 1I8JA 4ADSA 1VYRA 1SZEA 2R8WA 5LNVA 2ZQ0A 1OX4A 2QEZA 2VEMA 1I2OA 2A7PA 3G24A 2PE4A 2DJXA 3NA8A 4R7JA 3P74A 3HMJG 1B4EA 2OZ0A 3WJZA 2YYTA 1UUMA 4BWLC 1O5KA 5CZJA 4NU7A 2EHHA 1TPDA 4UTJA 3HJZA 5LHEA 2ZRYA 3P61A 3CWNA 2CLKA 4NQ1A 4ZVJA 1F6KA 3M0ZA 4AWUA 2GQAA 4ZQOA 1QDSA 4RCXA 2NXHA 3W6YA 1Y0EA 4RK8A 4NX0A 1OG0A 2Y61A 3TJLA 3MI3A 2E6AA 4EVZA 3TDFA 2DZPA 4NT0A 3QM3A 4KKXA 4LVAA 1P4CA 3CHVA 3H55A 1A5SA 3S0CA 2WNZA 3TAOA 3MUXA 5FF3A 1FX6A 1W1ZA 4JY9A 3PBVA 4N9CA 4PTNA 3BLIA 3MP5A 2QKFA 5HUPA 4PCFA 2ZTJA 3C8FA 1YXDA 3NPXA 1UASA 4XKYA 4LRTA 1VYSX 3PG8A 2C16A 4UFJA 5TBOA 5EKYA 5F1VA 4YMZA 1ICSA 4XQ6A 1BKSA 2QUTA 3NXFA 4AAJA 1SW0A 4I7VA 3LTYA 4TR9A 3SGZA 3LOTA 1UBSA 3KVKA 1H5YA 4JX4A 3IIPA 2Y7FA 3GDRA 3T40A 3GIYA 2CLHA 3QMSA 3C0JA 4DELA 3GNDA 1TJPA 3E0IA 2WKJA 2Y85A 3TSDA 1EWEA 4JDYA 3CB8A 4UNLA 1KBJA 1AW1A 2YFNA 2B7NA 2E1DA 1FCVA 1OFAA 4OE7A 4RLIA 3LRMA 3TMQA 2AAMA 1ME7A 1WBJA 1PE1A 1KLYA 1JJKA 2X1SA 3NG3A 1XKYA 5K3VA 1F5ZA 4HIBA 4IUOA 2QCGA 4O1BA 3CIXA 2DZSA 3T44A 5FF4A 1ZJIA 3HOJA 5L9FA 2P1FA 3NZRA 3NQ6A 4MY1A 4ZL1A 4M6VA 5LGZA 1Q45A 4ZQNA 1M5WA 3PULA 4XBSA 4LC6A 5CKSA 1C9DA 2WPBA 2OJPA 4RJEA 3LCFA 1T96A 4MFEA 5CGQA 2RDWA 3GR8A 4ORMA 5F2GA 3DBPA 3QPYA 3IGXA 4JS3A 4JTIA 4Y96A 3EKZA 2A5HA 2ABBA 3SJ3A 3CM4A 2B7OA 1QO2A 2ZRZA 2FDSA 1G7UA 2ALDA 1G7VA 4MJZA 1I4NA 1FBAA 1W3TA 3LTSA 4JTEA 2GJNA 4HSNA 4ADUA 3EX1A 2Y6ZA 1KM5A 1RD5A 5DBUA 3EWXA 1EP1A 3IRDA 3W1MA 1RQBA 3VE9A 2ZA3A 4MVAA 2TMDA 4NJIA 1XBVA 3W2NA 1XUZA 4BI7A 1EUAA 3E12A 2V5BA 3NAVA 1NAL1 2Y7GA 3STGA 5KINA 3UY8A 4AWTA 2J9YA 2C18A 4O11A 1LDCA 2GOUA 1JUEA 4LUJA 4Z08A 2QCFA 2E5CA 1S3HA 1TSIA 1KFEA 1X7FA 2NXIA 2YFOA 4OWGA 1KV8A 5E93A 3DHFA 2IQTA 4WOQA 3LV5A 4HNVA 3W87A 3VCRA 5HWNA 3NNTA 3B8DA 1J2WA 4UTIA 4BFAA 3UQNA 4CCDA 1K8ZA 1ZFJA 5CPNA 3TNOA 4R53A 1HG3A 4YCPA 5TIMA 1QPRA 2Y7DA 2C13A 1OJXA 4Z0SA 3M43A 5BRBA 4CQ9A 3W7GA 5AHLA 3M41A 2QCNA 3EB2A 3A22A 3GX9A 4JYDA 3W76A 4LC8A 4YL2A 3N14A 4O13A 4MUZA 5G2HA 3PAJA 3NQ7A 3W7PA 2B0MA 3W1UA 1TRDA 3W7DA 3GDLA 3I6RA 5C55A 1J4EA 1SW7A 2CLFA 3P80A 2TPSA 2ZBTA 2QAFA 1LLWA 2NUWA 4RXFA 4HNTA 3N19B 4DEFA 1DKWA 3A23A 2ZYFA 1W8SA 1ZHAA 1O94A 2QF7A 4K7VA 4RXGA 1ZAIA 1KM2A 2QCDB 1JUBA 4AMAA 1GYLA 5DXXA 3QFEA 2UV8G 4MZYA 4GBUA 2AGKA 3B05A 1PS9A 3NL2A 1UJPA 4H4IA 3S9YA 2QJIA 1ADOA 4TU1A 2ZZ5A 2WJZA 3TFXA 2HSAA 3F4WA 1OX6A 5AB3A 3ABOA 1VLIA 3D0CA 3IV3A 3FOKA 4XBKA 3BW4A 4YLWA 1CW2A 3MI2A 4GUFA 2O7QA 4IMEA 2C6QA 1DL3A 1NVMA 1Z44A 3MW7A 4FX6M 4YXGA 3BLFA 4MZ8A 6TIMA 5D32A 2YXGA 4JTSA 3QW4B 3NPUA 4KWVA 2A85A 3TE9A 3STFA 4WXYA 1AL7A 3NGJA 2NLIA 4LOCA 4FO4A 2PRHA 2Y70A 4EF9A 3VNDA 3Q94A 2NUYA 2BWGA 3HF3A 4HSOA 4MZ1A 1FDZA 1G67A 2OT1A 2QCDA 3INPA 3PS7A 3OEXA 3MMTA 3EX6A 1S5TA 5HUOA 5J5DA 2QUVA 3Q2DA 1X1OA 3T78A 4UTLA 1WOBA 3G1AA 3F1QA 5LSMA 4ZQRA 1FUYA 1N55A 3RMJA 4ZQCA 1VH7A 2GQ9A 2DZWA 3M7WA 4GNJA 3UWUA 4DF2A 1KW1A 4FB7A 1I2NA 3PB2A 4JD4A 3RLVA 4A21A 2QR6A 5EMUA 1VRDA 1F76A 3R13A 3TK7A 1YDNA 4X9SA 1RZMA 2Q8ZA 3P5ZA 3A5VA 4R34A 1VR6A 5ABTA 2H8XA 5F2LA 4MY8A 3W23A 1SFLA 3PSWA 4DO4A 2P0OA 4HT3A 3KRUA 1FDJA 1NSJA 3Q37A 2JBMA 5C54A 1AG1O 1MO0A 4NJJA 4OQVA 4ORIA 4S1FA 4Q4KA 4PC8A 3GAYA 3LLFA 1X1ZA 2ZZ2A 3S5YA 3STCA 3GKAA 2E6DA 2G95A 5FEZA 3GXPA 2V81A 1XBZA 3W7HA 5FI8A 3DU0A 3OHIA 4Y90A 3ZS4A 4Z1CA 3B04A 2PRMA 2Z6JA 1DBTA 2A21A 3BLEA 3W70A 1EP2A 5C6MA 1EP3A 1OX5A 4Q33A 4JICA 3S5ZA 2ZFAA 1CI1A 1VHCA 3QQ0A 1H62A 1KA9F 3NQGA 4EF8A 1GVQA 3VI2A 1TTIA 4O1DA 3R12A 1TPFA 3EX3A 5CPMA 4A2SA 1PHQA 1H7RA 3W85A 3ATYA 4E0CA 1LZOA 1P0KA 1ZCOA 3B03A 1QR7A 5KZMA 1TTQA 3W75A 4GJ1A 4HN4A 1TB3A 1GEQA 4DF1A 4JR5A 5F4SA 3TJXA 4FEZA 4DO5A 2WNQA 5KMYA 4POCA 3KVLA 3RU6A 1YDVA 3BG9A 4O1AA 1WOAA 3W72A 5KITA 4W9TA 4HPJA 4PFMA 4OGZA 3UWZA 1ICPA 3ABSA 3RLUA 2VFIA 2Z2UA 3TIMA 3WJXA 2YSWA 1YTKA 1ONRA 3RFAA 2J9XA 4ZZ9A 3KX6A 3LCGA 1BWLA 3NQDA 1RQHA 2TYSA 3EEGA 2CU0A 3LXCA 3MHFA 2FLIA 3E96A 2OMAA 1ALDA 4WQ6A 4YWIA 5IBXA 5DCBA 1H63A 4H6KA 1YLVA 4XZ9A 5DCEA 1A5CA 3QJAA 3QEZA 4HNNA 1AMKA 2PRLA 2QAPA 2E5DA 1AK5A 2GPTA 3UZ5A 1W3IA 3N73A 1GTEA 2NWRA 4DBDA 4N02A 4JEQA 4KFPA 4M7TA 3IVUA 5FF2A 5AHMA 1EWDA 2JKAA 1R46A 4RV8A 1DHPA 4AVFA 2QCCA 3W1RA 3PUOA 1K03A 1N7KA 1YPIA 3P8JA 4UUIA 1JCLA 5I3FA 3C52A 1R2TA 2ZZ7A 4NVTA 1V5XA 4N9BA 4WZHA 3P84A 3M5VA 1PCKA 4O0KA 1L6SA 1R47A 1QNVA 4N6EA 1D3HA 1WBHA 1GYNA 2H3DA 5FEWA 2YCEA 2FPTA 2ZDRA 3NPWA 3ZWSA 1KM4A 3NQ8A 5D02A 3W1QA 2XN1A 3NL3A 1J5TA 3JR2A 7TIMA 4QNEA 1K02A 3R89A 5K2ZA 3WK3A 3STEA 4NJGA 4JXCA 4LVDA 4Y9AA 3C2RA 1VS1A 2XN0A 3QPZA 4M6QA 3SGUA 1YTEA 2CZ5A 1MEIA 3M5YA 4FXRA 3TQVA 4K6AA 3I65A 4E2DA 2YPIA 4X2RA 3TXZA 5AYZA 2YZRA 4K8EA 4MYAA 4U28A 1GG1A 5D09A 2TRSA 4BF9A 4RZ6A 1XDLA 5G5IA 4TO8A 2BSLA 1QPNA 3CT7A 5D2XA 3OVRA 2ZA1A 4UR7A 1LYXA 1TO3A 2X30A 2YR1A 4FXSA 1QCWA 1F73A 3I7SA 1OYBA 2NX3A 1TQJA 2GUUA 4XWUA 5I3JA 3NPVA 4PL2A 2ATSA 1E51A 4L4MA 4UTWA 2F7FA 3IIZA 5BMXA 3M5XA 2VOMA 4IJBA 1LROA 4OHQA 1JCMP 1A5AA 3SW6A 1Z42A 1W5QA 2R94A 5G4WA 2V8ZA 3LB0A 2V2HA 4JX6A 4QJ1A 3W1XA 4HKPA 1H7WA 3PSVA 2XFWA 3ELFA 2J24A 3L68A 4IMCA 4DPQA 2DZTA 3TH6A 2V2DA 1RQEA 4UMAA 3TMLA 4N6FA 4KFOA 3DFQA 5CZ0A 3GXTA 3HPXA 4BI5A 1I2PA 1FCUA 3RK8A 1Q6QA 3HIJA 2RKXA 4I7UA 4JDBA 3NQMA 1IF2A 4UC5A 1X8FA 4DF0A 2WV8A 3GAKA 5F1UA 4RZ4A 2Y7EA 4O14A 5U4NA 3DHDA 4GWEA 3BW2A 5AN7A 3KXQA 2CZEA 1D9EA 1I45A 5BW6A 5D2VA 3W1NA 4LVGA 1TV7A 6ALDA 3WK2A 5G2IA 4WY0F 1A53A 1TV5A 1FXPA 1MEHA 3DFNA 3W2LA 2Y89A 1SSDA 4LS0A 2Y63A 3W7RA 3TKFA 2E68A 4JTUA 4RR4A 3CWOX 4UNKA 4RZ5A 1F74A 4CQ8A 3CQ0A 3HGSA 1IXNA 1B57A 4O4WA 3B4UA 3TW7A 2FQIA 1H61A 2NXGA 1G6CA 2R91A 3HG3A 3HBLA 3W2JA 3SFKA 1IGSA 4Q32A 3B06A 5DCDA 4NNBA 2FJKA 3UNDA 2A6NA 3WJYA 3TV8A 2GVJA 3KFTA 4UTHA 4NNAA 3GNNA 2FPYA 1VC4A 5IBXC 3FJLA 1KM3A 5AYXA 2JKEA 3LCIA 1SPQA 4MOZA 4O10A 2YGYA 2ABAA 5G2WA 3FYPA 3B0VC 3QMRA 4S2CA 1SU5A 3GZ3A 4FX7A 3QMTA 2X2GA 5F2MA 2HS6A 5HMSA 2VELA 3P62A 1YPFA 3ZR4A 4PL1A 5FEXA 1B3OA 1GVOA 1ZALA 1OK4A 4JYFA 3VKJA 3S1WA 4TMBA 5AYYA 3T7VA 3JRKA 3PF3A 4LVFA 3EKLA 2YYUA 4O50A 5K9DA 5U7SA 3O6CA 5A5WA 3OBKA 3M5ZA 3LCLA 4OV9A 4O18A 1LOQA 3CTLA 4WX2A 3SECA 3QSTA 2BLEA 3GR7A 2HS8A 2KZHA 1TPB1 4MJMA 3IGSA 1XDMA 4UTUA 2QCEA 1OABA 4QM1A 1IXOA 4NXSA 1QPQA 3DI0A 3O63A 4UMBA 1S5WA 5CG7A 3TQKA 3U2OA 3C3NA 5I3GA 4FHAA 3EWUA 3FKRA 2CLMA 3HPSA 3THAA 1N8FA 4L4LA 4BK9A 3DFOA 1VCFA 4OT7A 1MEWA 5EBUA 1LLZA 2NV2A 3DFSA 1PL9A 3NO5A 3G3DA 4N9EA 3TX9A 1D3GA 1GOXA 3L2IA 1ME8A 3CPRA 1SW3A 1TPEA 2J6XA 3MWAA 3NYZA 2W6RA 3CIWA 4ZMGA 3E02A 1WYIA 2G5WA 4NX5A 2V9DA 3QZEA 3KRSA 2DZVA 3ANYA 2V82A 1RPXA 3N34A 3A24A 3AJXA 3W74A 1YXYA 2ISVA 3SIZA 1YADA 3S1VA 3EX4A 3O06A 4AEOA 2E09A 4P61A 3LHWA 3C6CA 4IX0A 2E5BA 2LLEA 3BK0A 4UTTA 4BI6A 2YDAA 1B9BA 3BW3A 1GT8A 2ISWA 1KFBA 4PH6A 4GFSA 5J5RA 4A29A 1XFBA 3GB6A 3PUEA 2JKPA 2O7SA 5FEPA 2CW6A 3I7RA 1DV7A 1P1XA 2JGQA 3MYOA 3HG4A 3W22A 3NVTA 1Z41A 4OU1A 1JUKA 5HR6A 1TPUA 3IEBA 1EA0A 4JGDA 3NR0A 1F6PA 3WK0A 3LHYA 4QISA 4Y6GA 1SO3A 2Z1BA 4FNRA 5G1YA 2ZZ4A 1TV8A 4JX5A 2W0UA 3EXTA 2Q3OA 3O6YX 3PB0A 5AHIA 3O6DA 3GDMA 4K38A 3ATZA 5K9CA 5CPOA 1W5OA 1KTCA 3K30A 3L21A 5AFDA 2RDTA 3G3MA 3S1UA 5AC7A 3HG2A 3FEMA 5A8GA 4ONVA 3G0SA 4MPQA 1ME9A 3MHUA 3G18A 3TSBA 5K4ZA 3W7QA 4QNWA 5D2YA 3CEPA 2VKZG 3UD6A 1XBXA 3LHZA 2J9ZA 5HULA 3LCWA 3LXBA 3N3MA 2C14A 3OA3A 1TQXA 3R2GA 1L6WA 3NQVA 1KTBA 4ADTA 4ALDA 1B4KA 2VEPA 3TQ0A 3W1PA 2A6LA 1XXXA 2BXVA 1GVRA 1OF8A 5DELA 4O12A 1GQNA 3G22A 5CSRA 1G69A 1BWKA 3S42A 5EA9A 5D33A 3DGRA 4DO6A 4JYEA 1IIGA 3SR7A 1NF7A 4Z1BA 2VEKA 1SZGA 1SZNA 2A1YA 3MI6A 2GJLA 1C8VA 1NF0A 4K8HA 3FJ6A 1TTJA 3NOEA 3O1NA 3O15A 4O54A 4JN6A 2Q8LA 1WX0A 5D37A 2TSYA 1GVFA 1H7NA 1IXPA 2C1HA 4FNUA 4IGHA 4ZQPA 1EPXA 1K8XA 1JCYA 3HGRA 2VFGA 3GDTA 3L0KA 4JNMA 3QYQA 1K3UA 2QCLA 5DY3A 1OHLA 2D73A 5FF7A 3LHTA 2ISSA 4OBTA 3LRLA 5EYWA 3FKKA 4JTLA 3NM3A 3YPIA 2ZCGA 2W79A 1SR9A 3R5EA 3SY5A 1HUVA 2AQWA 5BOOA 1LCOA 2I1OA 4MKNA 1VHNA 1JQXA 1K7FA 4NJKA 1VLWA 3L0GA 2EGZA 1Q6RA 3LBMA 1DJQA 3W9ZA 3TC6A 5K9XA 5HNRA 3C4UA 2PC4A 2EPHA 5KZEA 1ICQA 3TUUA 3W07A 3UY7A 2RFGA 1JCJA 3FA5A 4AWSA 2ZZ6A 1MSSA 4ML9A 1UCWA 4UFMA 4K39A 1W54A 1OFQA 3ZWTA 2V30A 3MHGA 3L65A 1NEYA 1F7BA 1LP6A 3EXRA 4RX0A 4S2BA 5G1TA 1A50A 5KZDA 3G1DA 3QW3A 3IGUA 1R30A 4WJEA 3HGOA 2Z0IA 1Q3NA 3QH2A 1EEPA 1KM1A 2WOQA 4LV9A 1AW5A 4UTMA 5CPLA 1U5JA 1W5PA 4FNSA 3THQA 2V5LA 4LUIA 2QCHA 3OIXA 4JTKA 1OVDA 1GJPA 3P67A 4JIQA 2GQ8A 2J27A 1DQXA 3LGEA 5DN1A 5LNRA 4NNCA 1OX4B 8TIMA 3LBCA 3EWWA 3GKFA 3M44A 3NQCA 4WY0B 5AHEA 3DZ1A 1LRQA 4CNOA 1RV8A 1KFJA 1SO6A 4GUHA 5LNSA 4DXVA 2BZNA 4E38A 4MLJA 2A4AA 1O4UA 4TMCA 3ZFHA 2ZTKA 2WNNA 1HO1A 1ZNNA 3HG5A 2GVLA 3FFSA 1DVJA 3HB9A 5D03A 2V0TA 1JR1A 4FIQA 3BG5A 3QQ1A 3PVFA 1YYAA 2P10A 4N2YA 4GUGA 3WFAA 3G1VA 2C19A 3USBA 1LBMA 3R8RA 3DENA 1L6YA 1VPXA 3G1XA 5EL1A 4CNNA 4WXZA 3VE7A 1OFBA 3TFCA 2QCMA 4UTTC 3AO0A 2NX1A 2VENA 1H1YA 2NV1A 2RHGA 3DKJA 1LBFA 1SO5A 1VCVA 5K4XA 1VQTA 3UWWA 3LLDA 4LW7A 1OFDA 4UR8A 1FWSA 1G4SA 4M7SA 5CZTA 1FWRA 3TA6A 1I2RA 1SO4A 2V2CA 3S8HA 4A3UA 4O0ZA 4LVBA 1ZAJA 2FFCA 3HQ1A 1OFEA 3QRHA 4WY0A 5LGXA 3BG3A 4WUIA 2CLLA 5F2IA 4KFNA 5GVJA 4AB4A 2ZZ3A 3N9SA 4Z0JA 1L9WA 2Y62A 3NL5A 3W2UA 1THFD 4JY8A 4K7YA 3QF0A 1OYAA 3CEUA 2X1TA 2B7PA 1BEUA 3ABRA 2HMCA 3LCHA 1KLZA 4CCCA 4JTGA 3G1SA 4XTIA 3HGJA 4HHPA 1JULA 4IX2A 3PWAA 1XL9A 1RVGA 3M16A 4MLRA 3KRZA 4I7WA 4NUWA 2QJGA 5AOUA 3UWQA 2X1RA 4GC4A 4IPJA 3WJWA 2OCZA 2CFFA 3RF9A 5MHBA 4K36A 3B0PA 3FIGA 3DI1A 5AC6A 2C3ZA 4AH7A 2A7RA 3FS2A 3TROA 3UYCA 1TCDA 1O60A 1W0MA 4NXKA 4B5NA 4NJHA 1H7PA 1DQWA 1FWNA 4BR1A 2A2IA 4Z1AA 2VFHA 4IQLA 1DORA 3OVQA 5D05A 4C1KA 3LI1A 3W7KA 4UFKA 3U8GA 3NQ2A 1OFPA 4O17A 3TCEA 4A22A 3BO9A 2OT0A 3C2VA 3W7CA 1TIMA 5DBTA 1LORA 4JTTA 1U83A 1AL8A 3IVSA 4CLMA 4LS1A 2DP3A 1H1ZA 3V1PA 1FXQA 1LRTA 1ZENA 4DPPA 1KM0A 3W88A 3NL6A 3GK0A 3W3OA 3NZ1A 3EX2A 3LV6A 1W31A 4AF0B 4DBEA 2QUUA 5H91A 4MYXA 1WV2A 3UWVA 5T26A 4AXKA 1TPVA 3V75A 3L67A 4YCOA 5FESA 1JCXA 2H90A 3W7EA 1KM6A 4QQ3A 2VXNA 5HWJA 1W5NA 1JQVA 5TQLA 1XBYA 5LKYA 1H51A 2H6RA 4OV4A 2NUXA 3P82A 4NZFA 1GTHA 1W56A 4GXMA 2A0NA 1X6UA 3NM1A 2WSYA 4IOTA 4X22A 3W84A 2ZRVA 2DORA 1FY6A 1VCGA 3KVMA 3WK1A 2EAWA 2CLIA 3G1YA 3RNDA 5AC8A 1OYCA 2JGYA 4LU0A 1KFKA 2CZFA 1A5BA 3KHJA 1XUUA 5H2ZA 4O1CA 1CX9A 3O07A 4O57A 3H54A 3WJSA 3W73A 2FTPA 3W2KA 4UMCA 5HR7A 3M9YA 3LDVA 1PVNA 1QOQA 3TR2A 2ATMA 3G0UA 1EIXA 3MJYA 2E6FA 4IPIA 3MP4A 3P7YA 5LNWA 4AF0A 3L5MA 1Z48A 3MO7A 3U6WA 4D2JA 4LWWA 2RH9A 1HTIA 1WXJA 5DY2A 1TRIA 2DU2A 3T4CA 1FCQA 3ABQA 1ZY9A 3M6YA 1P5BA 5C5YA 1EB3A 3E9AA 3N2MA 3S6DA 2DJLA 2EKCA 1W37A 1ML1A 1MZHA 3DFTA 3W7MA 1JVNA 3PUDA 2VEIA 1M7OA 1G4PA 1W3NA 4LTSA 4IWWA 2B4GA 2Q3RA 4GUIA 4XTDA 3TSMA 3TW6A 4JTHA 3TAKA 5D30A 1HO4A 5C2XA 1F05A 3N2XA 3M47A 2DZUA 3UPBA 1QFEA 4O16A 5SWUA 3BV4A 2CLOA 3W2MA 1KFCA 1W5MA 1KTNA 3LX9A 1QPOA 1AW2A 1H60A 1OK6A 3EWZA 1SFJA 5G4EA 2H8ZA 3W71A 1V7YA 2E6YA 3NQEA 2GVGA 1TJRA 1Q6LA 3EWBX 3N9RA 4CCEA 4FNQA 1XCFA 2I14A 5KTLA 1LM1A 3MYPA 2ZA2A 1T0OA 4XUGA 4A2RA 5IM51 3L9CA 5L6UA 3W7OA 1NFBA 1JCNA 4RKAA 5D2TA 1WDWA 1WQ5A 4M6PA 2X1UA 3DKLA 1UUOA 3E49A 3IIOA 3L5AA 2NWSA 3NQAA 3W7IA 1MXSA 1T8XA 3VFLA 2J88A 5FF0A 3A9IA 1QMLA 5D04C 3CC1A 4GE8A 3CLMA 1PCWA 2I9EA 2VFFA 2JK2A 3OVPA 1K7XA 1G4TA 2QJHA 3NDOA 4HPXA 3F03K 5I3IA 5BNKA 1K7EA 4TIMA 1VJIA 3PY2A 3HPZA 1WAUA 4N4QA 2NX9A 3PBYA 3G0XA 1GWJA 4HNUA 2ZRXA 4UTWC 4GUJA 1QO5A 1T99A 3QC3A 1KV5A 1VGAA 4PA8A 3BGJA 3B0UX 2BTMA 3BPWA 2PCQA 2F84A 2WSQA 2YX0A 4UFLA 1FWTA 3LHVA 4LV4A 3O05A 4FF7A 3SZ8A 2VFEA 3BGGA 4TX9A 1Q6OA 3IIXA 1XM3A 1PHWA 1S5VA 2WQPA 2YW3A 3PBWA 2DZXA 3Q58A 4G1KA 4P2VA 3I7QA 1HFBA 4LNYA 4ZQMA 4MFDA 3LXAA 4ICNA 4R33A 1GG0A 3W83A 3DXIA 1KBIA 5HWMA 1BTMA 4EIVA 3SI9A 3S1XA 4PEKA 1JRCA 3TU9A 4MIMA 3S5NA 1OFOA 4LRSA 5HQEA 1YXCA 1IIHA 2FIQA 1QWGA 4BWLA 5HJLA 2A7NA 1TPH1 3GDKA 3C2EA 1YTDA 4O28A 3NEVA 1EX5A 5KSWA 3BVJA 3T55A 3O8AA 1I2QA 3S5OA 3W1LA 3DAQA 3G8RA 3M1ZA 5AHNA 3TC7A 4Z1DA 3MBDA 4UCGA 3TXVA 4N9DA 4O4VA 2QDGA 2H3BA 3W1AA 1FDYA 1XC4A 4QITA 3IIVA 4GRSA 1SSGA 3I68A 1UB3A 3UWYA 3F4NA 4UIOA 4N4PA 4U4MA 4MY9A 4CQAA 2ZRWA
chains in the Genus database with same CATH superfamily
2WO5A 4QEHA 6TAAA 5CBJA 2INFA 2YW4A 4L9ZA 5EMJA 4PMRA 2VR4A 4J27A 1XYAA 2EJAA 3W7NA 4OUIA 3UXAA 1XKJA 1N82A 2E77A 3SRHA 3H53A 3GW0A 3MBFA 4QTGA 1XI3A 4FNPA 7CGTA 3TQPA 3FSTA 2FPVA 3FA4A 3FVDA 2CWNA 3QN3A 1VFTA 3K13A 3G8EA 3U2ZA 1CT5A 2VFDA 1BWVA 1HXJA 4NASA 4XD3A 5E9AA 3R8GA 5HMEA 2R82A 2X8RA 1TA3B 4OBRA 4HMEA 3LTPA 4Y8FA 4NZJA 1PWMA 4Q8NA 4B5XA 4O8RA 3BARA 5FACA 1F07A 2CLEA 4IIEA 2NSOA 2Q02A 2YA0A 3GE7A 4NYUA 2ZDSA 2QDHA 1TV3A 2J7CA 4I9AA 1B1YA 1MRAA 1V3MA 4O15A 1KO0A 4KWWA 1HKIA 4QRNA 5I7GA 5CG0A 3CYJA 4ERIA 4RE2A 2A3BA 2DEPA 4DQWA 1JRBA 1KCLA 2ZRUA 4C6LA 1IXQA 3QLLA 1TA3A 3VOJA 3K8LA 4JTJA 1EYWA 4AEFA 4D6EA 4B9YA 5LIKX 1PXGA 3CHCA 4O52A 4FZIA 1T5AA 1WNOA 1TTPA 3P93A 4ML4A 1GPWA 1O68A 3SN4A 4B2DD 2Z29A 3WUEA 3E0VA 4PCTA 2GJXB 4LNCA 1WA3A 3ENLA 3ZT6A 2QV5A 5RUBA 3C2FA 4YIWA 5I3HA 2GSJA 3VPLA 5BMWA 3D3FA 1NDZA 2WLZA 3UXDA 2PTZA 2QF8A 4DYEA 3VKDA 5LNUA 1R2SA 4BCEA 3FNDA 1PV8A 4Q8OA 3VO0A 1SJCA 1ZSXA 3HFYA 4X3ZA 3NSMA 2EF9A 1XRVA 4B5TA 3VKBA 4H9MA 1PIIA 4XKYB 3GVGA 2BX7A 4ADSA 3VAVA 1I2OA 3P74A 3HMJG 2ZC8A 4QS5A 2YYTA 1UUMA 1O5KA 1RA0A 4NU7A 1LWJA 2REQA 3OIHA 4ZO9A 4LJ3A 4UTJA 1OEPA 1L0PA 4KETA 4HD5A 4ZVJA 1F6KA 4DYKA 2GQAA 4ZQOA 3M0KA 3UR5A 2NXHA 3VDAA 3ZSSA 1Y0EA 4RK8A 2GJXA 2FZ9A 3TJLA 4KEUA 2QPXA 2DZPA 2VDGA 1R6WA 4HYWA 1S1PA 3VM7A 1FKWA 4QR6A 3BMWA 3CHVA 3H55A 3TAOA 1NDVA 1KGXA 1DJXA 3L2MA 2XUCA 5C9XA 4XD6A 3MP5A 2BASA 4PCFA 2ZTJA 3ANVA 3C8FA 1AVAA 1F9CA 3DC0A 4XKYA 1XLCA 4LRTA 3CH0A 4UOQA 3WLSA 5TBOA 2OEKA 5F1VA 3RRAA 4Z2KA 4XVDA 1QBBA 3VUPA 2FZMA 4AAJA 1SW0A 1SJAA 2FZ8A 1GQIA 3NIYA 4AW7A 2F61A 2Y7FA 3GDRA 5JBFA 3WKZA 3QMSA 3SRFA 5M2FX 1WO2A 2WKJA 3KWSA 4JDYA 1VEPA 1AW1A 1DIKA 2YLAA 2YFNA 2B7NA 3NZQA 1K6WA 2E1DA 1QBAA 3LRMA 3TMQA 3GXMA 1XQLA 4DUXA 1PE1A 3A47A 2J7BA 1XKYA 4JQ1A 1F5ZA 4IUOA 4NI3A 3WCZA 1PTDA 3GYCA 4O1BA 2BY0A 2QS8A 3R8HA 3T44A 3WH7A 3HOJA 3DBNA 5L9FA 3NZRA 2UY3A 2VURA 2VL4A 2QDDA 2GSHA 1M5WA 4IFOA 4XBSA 4M1BA 1GQKA 5C9WA 1B54A 3V5OA 5HBFA 4M80A 4MFEA 1CB2A 4AY1A 3GR8A 3T0AA 3PPHA 4ORMA 5F2GA 1UR8A 3CAVA 3VZYA 1CBGA 5GNZA 2Y5SA 4JS3A 1KC7A 4ZO6A 2A5HA 3LNPA 3CM4A 2B7OA 1QO2A 1XX1A 2ZRZA 3H4WA 4MNKA 1G7UA 4INFA 2ALDA 4S3FA 4MJZA 4FXJA 1SJBA 4ATDA 5AYIA 4JTEA 1RD5A 1RCXB 1PTGA 3EWXA 1E9LA 4X61A 1I60A 3ARTA 4RDYA 1RY0A 1EUAA 3E12A 2OWCA 1J79A 1QNRA 5KEZA 1UA3A 3NAVA 1JIBA 2XIJA 4ZB0A 2J66A 2ISDA 4B4HA 1B2YA 4O11A 1TWZA 1MW0A 4AIBA 1X7FA 1E55A 2YFOA 4TX8A 4OWGA 3AHVA 2DGAA 3E2SA 1V6UA 4QDMA 3DHFA 2YCJA 2IQTA 3SEPA 1V79A 3B8DA 2XYLA 1WKYA 2BVTA 1FWEC 1ZFJA 5CJMA 4AUBA 1S2CA 2Y7DA 3EOUA 1OJXA 4Z0SA 1BYDA 4TQTA 2YB1A 2WVTA 3B9NA 1GONA 4JYDA 3RAOA 4YL2A 3FK4A 1M1BA 3Q67A 1DWGM 1F8IA 4JFWA 3BLKA 4U5IA 1TRDA 3AFBA 1OD0A 4DO7A 1BTCA 3EDDA 3MZNA 2L5HA 2VI0A 2WBGA 1ZUAX 3VIKA 4UQDA 1CGVA 1JDEA 4MJ4A 2VDHA 2V5JA 2GOKA 2NUWA 4RXFA 4E4PA 3P3BA 2V69A 1O94A 2QF7A 4GI4A 4RXGA 4IF2A 1XR2A 3UVAA 1JYWA 2Y8VA 2QCDB 5C9RA 4YPJA 4PRRA 2UV8G 4B5WA 2AGKA 4JFTA 1AODA 3NL2A 2DT0A 1SGJA 3PTQA 5LA1A 1KKRA 1ONEA 2QMJA 3IV3A 2J7GA 3BW4A 1IEXA 3URQA 1CW2A 4GUFA 3USZA 4IMEA 2BOFX 2PDJA 1YDYA 1MI3A 3WNLA 3AXXA 2G3MA 2GFTA 5T91A 3CQKA 5AVNA 3M0HA 3GU1A 1G1YA 1AL7A 3CUIA 3A3WA 1K4HA 4N7QA 4CGTA 5XINA 3W28A 3OBEA 4MJ2A 4FO4A 1YRRA 2BWGA 2QCDA 1B5TA 3M0JA 2FHFA 4GYPC 3EB4A 3OEXA 3MMTA 3CHEA 5HUOA 1YE6A 5A6MA 5J5DA 1X1OA 3E2VA 3G1AA 3LA4A 3EA3A 3GHUA 2OKTA 3WF1A 4EPKA 1XLLA 3M7WA 4GNJA 3HM7A 4ZTYA 1WXYA 1CGUA 4X9SA 1H11A 5A6SA 4N42A 2BY2A 3ARPA 3M46A 1V02E 4W7UA 1UZ4A 1DXFA 2PGRA 1XFCA 3SCNA 1SFLA 3PSWA 1ISXA 2JBMA 5C54A 4NJJA 1CLXA 3RPTA 3CL6A 4Q4KA 3SGGA 4D6JA 4HK7A 4LAZA 4AZ7A 2VUNA 2BMBA 1J12A 5FEZA 3GXPA 1XBZA 2DZBA 4R7OA 2WC7A 4Y90A 1RY8A 2PRMA 2A21A 1F3WA 4KEZA 1EP2A 1OX5A 3U5UA 1ZPTA 3CXOA 5AYBA 2V6AA 4PYSA 4B92A 1C91A 8XIMA 3TOPA 1XIBA 4A8IA 1A5MC 4EF8A 4LEFA 1TTIA 3NOYA 1E6XM 2V67A 4X60A 1TPFA 3EX3A 1PHQA 1ZCOA 2PD5A 3WY1A 1QR7A 1Q6EA 1TTQA 1XV8A 3N13A 5CGMA 1GEQA 4DF1A 3WUBA 4IIDA 3TJXA 4FEZA 2EG8A 4J3UA 4S3JA 2FTYA 3KVLA 1NWUA 1SMAA 5KITA 4I5RA 1V02A 2IPFA 4H6EA 2PDHA 4PFMA 1ICPA 2VFIA 2Z2UA 2VVSA 3ZMRA 1TJ1A 3RMEA 4PMXA 4I6VA 1M04A 3E74A 2J9XA 1BWLA 4JFUA 3SFWA 3IJ9A 4RPQA 2PDFA 3DERA 3EEGA 4M1RA 3IJ8A 1XSIA 4YWIA 5IBXA 5DCBA 1H63A 3GIQA 3QJAA 1HGWA 3QEZA 4HNNA 1AMKA 1OB0A 3F4VA 2PF0A 2W66A 2PLKA 1ZS2A 2QAPA 4AZCA 2GPTA 3UZ5A 3N73A 3H24A 4UQCA 4JEQA 3V36A 4KFPA 4M7TA 3IVUA 4MF4A 3QLDA 2PDUA 4AVFA 5B7ZA 4UBPC 1K03A 1YPIA 3HQPA 3P8JA 1R2TA 4TTUA 2VMFA 1JZ2A 5D9PA 3P84A 1W6TA 1L6SA 5JXQA 4J2PA 1TZZA 2ZDRA 1HKMA 4I5XA 2XM2A 5D02A 2PZ0A 2XN1A 1J5TA 7TIMA 1NTHA 4YJ5A 3WLTA 4FR1A 4LUSA 1ITQA 3QHNA 1NWTA 5AKQA 1G0CA 3SGUA 2X42A 4C6JA 4FXRA 3TQVA 4K6AA 2WJFA 2XIBA 4X2RA 4H8HA 3O3RA 5DMYA 1D8WA 1RUSA 2TRSA 4RZ6A 1XDLA 4W7WA 1OBAA 2OX4A 3CT7A 5GJMA 2ZA1A 4UR7A 3M0VA 1XLAA 4YTQA 1CXKA 2X30A 2J7FA 2RAGA 3I7SA 1E4IA 3S6TA 3F2DA 4PL2A 4DJEC 1E51A 5BCAA 3IIZA 3M5XA 2VOMA 3S2CA 1JZ5A 4IJBA 2EJ1A 3PNUA 4H7CA 3UJEA 2WHJA 4L56A 5DRIA 4DUWA 1W5QA 2R94A 2V8ZA 5BOFA 2Y2WA 4XO7A 1H7WA 5ECVA 1CGTA 2YLLA 3OLEA 5I6SA 5A6TC 1T8QA 1K8CA 4CVWA 3FVMA 4JL2A 3ARWA 3BLOA 1TZ7A 4G9PA 1RQEA 1CZ1A 3SB0A 4GX8A 2GJPA 1XLEA 3R7MA 1S2UA 4GZJA 1RK6A 3RK8A 3WDQA 3U57A 4AFYA 4DIAA 1QPKA 2GDQA 3U7VA 3CIVA 3MT1A 3U4FA 1X8FA 4DF0A 2WV8A 2H9AA 1PB0A 4O14A 3LUTA 4FLRA 3TN5A 1GOOA 3VVGA 3BW2A 5AN7A 4GMEA 3DG6A 5IFTA 5D2VA 4LVGA 3GO2A 4XAFA 2WWCA 3VZXA 2BVWA 4H9XA 4WDWA 1YPXA 1AJ2A 2PWUA 2ZUNA 5C2CA 1MEHA 2Y89A 4M82A 4LS0A 4P8WA 3W7RA 1KBLA 2AKMA 3N6QA 4DWSD 2G3NA 3HGSA 1VPQA 1LG2A 4GA8A 1B57A 4H00A 5M5DA 3VD7A 2FQIA 4NAEB 3QOKA 2NXGA 2Z1KA 1G6CA 1HP4A 3PANA 3EOOA 4UWMA 2WPGA 3IUDA 1ZZMA 5JIPA 3B06A 3GR4A 1PKMA 1VJZA 2Y24A 1UWQA 2VQUA 5IBXC 1XYLA 3TA9A 1P6CA 3AROA 2ZVIA 2NT0A 2CITA 3AIRA 4CNUA 3WD3A 3LCIA 3WL1A 1SPQA 3VCCA 2ABAA 5G2WA 2R1MA 3GZ3A 3LMYA 3S5SA 3IUHA 3PFMA 4WKHA 1H2JA 1PTAA 4G7EB 5F2MA 1L8PA 3UG5A 1TWSA 3CL8A 4L1GA 1J6PA 4RDWA 1W17A 5CSYA 1MUWA 1OK4A 2DW7A 3PF3A 4LVFA 3V18A 4Q8QA 4NAEA 4ICCX 3NURA 5U7SA 1G01A 2YCKX 4US5A 3QSTA 3GR7A 3QGAC 3CMJA 1E4MM 1TR1A 2KZHA 4JNYA 2QMKA 3H26A 4XZNX 3ARQA 3DI0A 1S5WA 2O0TA 3C3NA 4H1ZA 2DVTA 1FP8A 2ALRA 4DVOA 3W24A 4FHAA 3EWUA 1BSIA 1N8FA 4Z2JA 3F2CA 4OT7A 5MKGB 1MEWA 5EBUA 1LLZA 3SAZA 3DFSA 5E70A 1MXGA 1Z3NA 3L2IA 4G7EA 1P43A 3GHSA 1UWAA 4CNTA 2J6XA 1UD3A 3MWAA 3NYZA 1TV2A 4GZEA 2XWEA 1N8WA 2CIPA 3EB3A 4NX5A 3SUUA 3KRSA 3ANYA 4BJHA 2V82A 3N34A 4A4AA 2WB5A 1E6ZA 1BGGA 2ISVA 3SIZA 3S1VA 4MWAC 3OW1A 2XFFA 2BHZA 2E09A 3UF9A 2PD9A 3LHWA 1EJUC 4QE1A 1NDWA 2W9MA 2LLEA 1QK2A 3SM0A 2YDAA 3N4AA 1B9BA 1W2PA 1GT8A 2ISWA 4PH6A 3WLNA 3U48A 4C6BA 2CW6A 3W29A 1P1XA 2XH2A 1EDGA 3BQ5A 3GDBA 1Z41A 4OU1A 4QJ4B 4ES4A 2O56A 5I02A 2E4TA 3LHYA 1G9HA 2BVYA 2BY3A 5F7UA 1SO3A 1XS2A 1XSKA 5A6BA 2Q3OA 1DXEA 3O6YX 3PB0A 5AHIA 4CUCA 5CPOA 1Q7ZA 5AFDA 4GXWA 1XIGA 5AC7A 3HG2A 3G0SA 1GK8A 3TSBA 4C7GA 4IFKB 5D2YA 3UD6A 1XBXA 3FYYA 3LHZA 3MVTA 3LXBA 2C14A 3R1ZA 1GKRA 5AC4A 1L6WA 3L4TA 1KTBA 1PSCA 4ADTA 2CXEA 3UVIA 1B4KA 2CXGA 3ZSTA 1GVRA 4PBFA 3RN6A 1UKPA 1OF8A 3RDKA 4QG8A 3AMKA 1G69A 4ZOCA 4Z1BA 1C7TA 1XH1A 3MI6A 3QTPA 1PZ2A 2J6VA 3K2GA 4K8HA 4L6DA 4JN6A 5D37A 1JYNA 2X0HA 3RX4A 1GVFA 3SCTA 2C1HA 2PDBA 4E3VA 2INZA 4ZQPA 1K8XA 5GPRA 1ZBVA 4JNMA 2JQXA 3A64A 1OHLA 3MMUA 3RILA 1J93A 3XINA 4IL2A 4IJCA 4C7DA 5XIAA 2X41A 1B3VA 3FW6A 4GQ0A 3KUMA 4ACZA 3OGVA 1XIJA 2KX9A 3MDUA 4IFKA 4S3AA 1SR9A 4XV0A 3TC3A 3IGHX 2AQWA 5BOOA 1ZLPA 1LCOA 4MKNA 6CGTA 3AIBA 3L0GA 1Q6RA 3I10A 5K9XA 4IQEA 1JF6A 1RVKA 3FEQA 4EACA 5HNRA 4LFYA 3LN3A 3N2OA 4NYYA 5KZEA 1TWDA 4H9VA 3V3WA 1EXBA 3KDNA 1MSSA 2FZDA 1UCWA 3L4YA 3AUJA 1W54A 2X05A 3MHGA 1SFSA 1QNQA 3L65A 4GG9A 1UPMB 2CETA 1LP6A 4EKJA 5G1TA 2WMFA 1CEOA 4HA1A 3QH2A 1KCKA 3MUZ1 4M6UA 2B81A 3EAUA 4DNMA 3AMDA 4Z42C 1Q65A 4LV9A 4UTMA 5CPLA 4GINA 2QCHA 4DY1A 1Q6DA 3MKKA 1GJPA 1OCJA 3P67A 4JIQA 2GQ8A 4MDPA 2OLSA 1DQXA 4HU8A 1TG7A 5LNRA 4NNCA 3GXFA 8TIMA 8RUCA 3T1GA 2VOTA 4YVPA 1LRQA 1RV8A 4GUHA 2WVVB 1VIZA 4E38A 1O4UA 4TMCA 2ACRA 3B4YA 3WBWA 4H7ZA 1NOUA 3ZFHA 1SZRA 2P53A 4MADA 3MJMA 1MQQA 1EBHA 2OU4A 3HJEA 3WNKA 3TONA 3QQ1A 2WM0A 9RUBA 1OCBA 4N2YA 3G1VA 3DENA 3UG4A 1L6YA 3MCNA 5EL1A 1RP9A 4XZHA 4ATWA 3TN3A 2DPEA 4H04A 1LWIA 2NX1A 3PZNA 1H1YA 2ACSA 3VDHA 1FWBC 2PZNA 3NO1A 2J77A 1M9HA 3VABA 2AAAA 4QE5A 1UG6A 1SO4A 4REQB 4O0ZA 5HATA 1ZAJA 2FFCA 4LUTA 4LB3A 4M29A 3OOQA 2ZZ3A 3N9SA 2DT1A 3H23A 1J0KA 1EJSC 3SCWA 1W1IE 3RCNA 4G56A 4JY8A 3QF0A 1OYAA 4HNOA 2I5GA 2X1TA 2P8BA 3ARXA 4WKFA 2WW5A 3VINA 4DBUA 4JTGA 1BYBA 4KESA 3G1SA 3WNMA 3HGJA 5CPTA 3N2BA 1XIDA 3NFUA 3M07A 4AD0A 3K1GA 4W88A 5FJJA 1Z89A 3TYEA 1RVGA 3M16A 4DRSA 4GC4A 3WJWA 2CFFA 2GUBA 5MHBA 4K36A 3B0PA 3S46A 1XHGA 3ZT5A 4HOZA 1R0MA 1SR0A 5BZAA 2YDRA 2VJXA 3FS2A 4NXKA 4M56A 3ZJ6A 1Q85A 1UD5A 3WD1A 1FWNA 1G5AA 2PWDA 3C8NA 3F5LA 4PE8A 4FMVA 1SJDA 4IQLA 4REQA 4P7NA 2ZXDA 1W91A 1QNSA 4Z2LA 3ZQ9A 2NQHA 4DJED 2X2YA 4JTTA 3O0FA 3IVSA 2FFIA 3APGA 1SVDA 1H1ZA 3S47A 1UR4A 3CBWA 3RM4A 5EMYA 9XIMA 1PKYA 3NZ1A 3DYMA 3LPFA 4LY4A 2QUUA 3N6HA 5H91A 4MYXA 2VZOA 4AXKA 3GTIA 3W7EA 5CQ1A 3QV9A 4DXXA 4XZWA 3KHDA 5HWJA 1W5NA 2FVMA 3M6DA 1JQVA 4GI6A 2H6RA 4OV4A 2Y0FA 2NUXA 4HYRA 3P82A 1W1A1 1IEQA 4JBRA 3NM1A 4CU7A 3BH4A 1KXQA 2ZRVA 3J7HA 4PTDA 3LNMA 3NZPA 5AZ0A 3WK1A 1OC7A 2PP1A 2GUYA 5AC8A 4HMNA 5H2ZA 1TFVA 3IWPA 1V7AA 4O57A 1UP2A 1JZ3A 1XCWA 4EANA 3H54A 1FWCC 1RSCA 3ICJA 4CNSA 3AIEA 4UMCA 3B8TA 4XISA 2R9RA 3R25A 3RX2A 3KZPA 3W53A 4ERGA 3BCJA 2E6FA 3MJYA 3RX3A 2FGZA 2NW0A 1CGWA 4WIWA 4ZO7A 1UIOA 2HXTA 2OSYA 2F6XA 1HZYA 1WXJA 2PPGA 2DU2A 2X7VA 3M6YA 2QJJA 1JPKA 1LL6A 4JIEA 3S6DA 1ZJAA 4F40A 2DJLA 1MZHA 3W7MA 3PUDA 2VEIA 3GD6A 3CO4A 2B4GA 4WGHA 4XTDA 1XIHA 3CV7A 3TYUA 1US3A 3UCQA 2CESA 3WYZA 2UY2A 3AUOA 2DZUA 1QFEA 3MB9A 1EZ2A 3KWXA 4LF2A 4U3AA 4XG1A 3DCPA 4HGXA 3BV4A 1A4LA 1KFCA 2VZSA 1R7OA 3LX9A 1QPOA 5JUVA 4GK8A 1SFJA 2H8ZA 3T0CA 1V7YA 1LUCB 2C91A 3P14A 3EWBX 3MWCA 1FH9A 2J8TA 2I14A 5KTLA 4E8DA 5GJNA 3CQJA 1T0OA 4H2HA 3GXDA 5TD4A 4XUGA 4F2UA 2D0HA 3MUCA 3BSHA 3MSYA 4NHVA 5D2TA 1WDWA 4C6OA 2QUMA 4YNGA 3OP2A 4D6IA 2NWSA 3NQAA 4ZB2A 3CZJA 3AIVA 1QMLA 3GXIA 4GE8A 1AH4A 3LMZA 3MSGA 2I9EA 3VNLA 2Z27A 5E0CA 1IYXA 2OEJA 3BV7A 4GFIA 1IV8A 1WPCA 5B80A 1R7AA 2J79A 1K7EA 1ELSA 4TIMA 5DMLA 2D2OA 4ZE5A 3I6EA 3CUJA 1F3TA 3N25A 2BXZA 4H9UA 1VBUA 2BTMA 3EMQA 2PBOA 1NDYA 4PMDA 2WSQA 3ONCA 1LUCA 4I8YA 3H2NA 2OODA 1PWLA 4LV4A 2OG9A 1GKPA 3CZEA 1Q8JA 1CNVA 5CCZA 3O05A 4Q4OA 3LS9A 4ZENA 1GVIA 1Q6OA 2HEJA 3IIXA 2WQPA 3WH5A 2YW3A 3Q58A 4G1KA 4P2VA 1VJSA 3TYBA 4LNYA 3TLLA 5A8NA 1OINA 4TVDA 2PA6A 1R3WA 4R33A 2F9RA 3A13A 5CEWA 4MB3A 4MWAD 1BTMA 4EIVA 1BKHA 1SFTA 3VIOA 2PC8A 3TWAA 5TNVA 3MV01 2QZRA 2FIQA 1XIIA 3G77A 3U2CA 1XQKA 1E0VA 3NEVA 1EX5A 4ILSA 4MSSA 3WQCA 4D6CA 5E6YA 3S5OA 4RNJA 5AHNA 3TC7A 3IUIA 2XU2A 3WLMA 4JEJA 2H3BA 1LJYA 1XC4A 4GRSA 1S2VA 3FSUA 1UB3A 3NDZA 4E6MA 4MY9A 1YHTA 3WENA 1DJGA 1WCGA 3A5FA 3KTCA 3ITLA 1LL7A 1RAKA 4Q8UA 4EWND 1UKQA 1TR9A 5CLWA 1E6RA 2PURA 2Z2AA 2VGFA 8CGTA 4QAIA 4IXHA 4TOQA 4UTKA 3UG3A 2DSKA 2CNCA 3F2BA 1DIDA 3VDGA 1X38A 1W32A 1YEYA 1R3VA 2C15A 2BFGA 4C1LA 4GCAA 4JQ3A 4QSHA 5I03A 2OX1A 1DOSA 3VIIA 5HMDA 1VYPX 3MQTA 3LSBA 3GXNA 3PG9A 2ZADA 3MUIA 2GWGA 2POTA 2GGHA 1P0NA 2WZTA 3JS3A 3CYVA 5CAKA 4B90A 3UZJA 2R14A 1HP5A 1QAPA 3BLLA 2Q8XA 1RXOB 1WDSA 1C8XA 5HINA 1M6JA 2Z6IA 1TREA 5E5CA 1EUNA 2IKHA 1HL2A 3S9IA 1W1PA 4R5EA 3EWYA 4V15A 3EKGA 5FJPA 4R3UA 3AI0A 1SYTA 1QW9A 3PR2A 4X63A 1U2YA 3VOGA 4CNPA 3C0LA 1XIMA 4PUEA 3W7JA 1PX3A 4ZEPA 3AAMA 4WDTA 4FR6A 3S9ZA 4HSHA 3A3XA 5D8WA 4GH1A 5TAOA 3CO8A 1Q66A 4J3SA 2DQXA 1C29A 4AHQA 3WF2A 2OWXA 3FDGA 2BVDA 3UYIA 1TMQA 3LI0A 5EY5A 2PU0A 1R2RA 2D3LA 3EXSA 1LBLA 3VNIA 3DFPA 1YDOA 1G4EA 1TYGA 2ZICA 1XYMA 3P0XA 2JIWA 3ME3A 5DXYA 1IT0A 2J78A 2CC0A 1GYMA 4QEEA 2B7QA 4F8XA 1F2JA 3P8IA 2WSRA 3C56A 4NI8A 4GOAA 1EXPA 3AALA 3SSJA 3GM8A 1RR2A 4EOUA 4LPCA 4FIRA 3LHUA 3SURA 4Q7BA 3LCXA 3WMCA 2BOEX 4PUMA 2XH4A 5FCZA 2RJHA 2HBXA 4PODA 4P8XA 3WQVA 5BRQA 4UFIA 1VD6A 3DIPA 3MC5A 3LZ3A 4WD0A 3RCYA 3MCOA 1O5XA 4QIUA 1QRQA 1S1RA 4K3ZA 3MSDA 4IISA 4JTFA 3CAKA 4O53A 3P5YA 4EPDC 1XLJA 3N3TA 3BMVA 4OFCA 1U1UA 4AHOA 3Q65A 2Q71A 1VYRA 1SZEA 2IMRA 2R8WA 2WSKA 4Y8EA 1F3XA 2QEZA 1CECA 3G24A 4KGLA 5FJRA 4A05A 2FMOA 1Q7QA 3M64A 1B4EA 4Y2WA 3COTA 3G2GA 3ZT7A 1E9YB 3RG6A 3AZSA 5IRPA 2EHHA 1TPDA 4HOXA 1UIPA 3AYSA 2KAUC 3P61A 2CLKA 4NQ1A 3AHYA 5DRCA 2IQ0A 3CK5A 3HQOA 4AWUA 2WHLA 1QDSA 1V93A 5BXPA 1XLKA 4KQNA 4QBXA 5A6KA 3EPNA 1WUEA 1BVZA 4EVZA 3TDFA 1BXCA 4LVAA 3OHMB 3GG7A 1JGIA 3WNOA 3KE0A 2ZE0A 1M03A 3KP0A 3BTNA 4LANA 1AQ0A 2P50A 1XH0A 1FX6A 3PUGA 2RGLA 3PBVA 4PMNA 2QPSA 3QQWA 3TR9A 4ZOEA 4NG3A 4DB7A 2QKFA 2WHMA 1P0BA 2XH0A 3GSMA 4A8NA 1X7IA 4C6EA 2C16A 1XYFA 4UFJA 5CPSA 3OTRA 1RPKA 3IRSA 4HA0A 4XQ6A 1BKSA 3QKEA 3OLGA 3NXFA 4TR9A 3SGZA 6PTDA 2Z28A 1UBSA 4KCWA 4LX4A 3KVKA 3DDMA 4AIEA 1XG3A 1SM9A 5LYRA 4HYVA 4B5UA 5M3WA 3L23A 1OT2A 2CLHA 1BG9A 4I6KA 3C0JA 4DELA 1JDCA 3E0IA 2X0YA 4GIRA 3TSDA 2D2JA 3TP4A 1EWEA 1UQZA 2XTKA 3CB8A 2WM1A 4ZODA 1OFAA 4OE7A 5KZ6A 3N17A 3OYZA 4MAZA 3MMWA 2FJUB 4UQ9A 3CPGA 4HIBA 2PDGA 5I78A 1R5YA 2PDPA 2FDMA 2P1FA 4HPHA 4MY1A 5JBDA 4NZ1A 4ZL1A 4PUWA 4M6VA 5LGZA 3W6LA 5GNXA 6ENLA 1XRTA 2PDQA 2CWXA 2G50A 3BDKA 5CGQA 2RDWA 2VRQA 2VT0A 1OM0A 6XIMA 1RJPA 3EKZA 3TJIA 3VMPA 1DWFM 2D2GA 1QW7A 5CXPA 2XFYA 2GVEA 2OSWA 3WDRA 1GQJA 4WKAA 2GJNA 4HBKA 1KM5A 1W2VA 1WDRA 2AKZA 4JIIX 3W1MA 1QHOA 4F0SA 1E9ZB 2ZA3A 1Q13A 4MVAA 1JAEA 3SSZA 1XUZA 3ARZA 2V5BA 4H8NA 3VD4A 1HL9A 2Y7GA 3M0LA 4V27A 3STGA 1KFWA 5KINA 3UY8A 2BODX 4DN1A 1NFGA 5JH2A 3VNZA 4AWTA 4AC7C 2C18A 1LDCA 2GOUA 2DY3A 5HPOA 1CENA 4Z08A 2QCFA 3BCDA 3N4FA 1Y5XA 1KV8A 1EA9C 4I3GA 5E93A 1CGXA 3OZYA 4FP1A 3W4RA 1JNDA 1EKOA 4HNVA 1UWRA 3VCRA 3W87A 3NNTA 3WMSA 4I8DA 1J2WA 2HVOA 1JI2A 3H4GA 4CCDA 4PUNA 3TNOA 4R53A 1HG3A 5TIMA 3SCQA 1QPRA 1IZJA 1BYAA 4DM1A 2C13A 4LAKA 1K6AA 1GEHA 3EB2A 5DF0A 3DYOA 3GX9A 3PZMA 3W76A 3CQIA 4O13A 4MUZA 4DAFA 1UMYA 1MW3A 1HKKA 3NQ7A 2B0MA 2WSPA 4IH3A 3GDLA 3SDOA 2IUZA 3I6RA 1UZ1A 4EP8C 3CZKA 3O2LA 2R24A 3PBGA 3RCMA 2QAFA 1LLWA 2Y1HA 4B2DA 5C8BB 2ZYFA 1ZHAA 2YBUA 1TUFA 3T4WA 1ZAIA 1KM2A 2PGEA 2QIIA 4J3VA 4WEVX 2HVMA 4GBUA 4Q6JA 4H4IA 1BAGA 1R9XA 1D7FA 1UWTA 2ZZ5A 2WJZA 4GJIA 1OX6A 3ABOA 5E09A 1OWQA 3N18A 1S5MA 1IWBA 3O7UA 4YLWA 2YB4A 3TTEA 3MI2A 2O7QA 4MB4A 2C6QA 1DL3A 3MW7A 3FX4A 4Y9OA 4FX6M 1XICA 3H7UA 4GLEA 4H83A 4IPNB 3BLFA 4MZ8A 6TIMA 5D32A 4L65A 3C5QA 2OXNA 3QW4B 2D69A 4KWVA 3WQ4A 3PJUA 1NP0A 1IGWA 1XCXA 1HNYA 1FDZA 4W8BA 2FZBA 3VDCA 1G67A 4PMUA 3B40A 1S5TA 2G3IA 2DSVA 4UZUA 3Q2DA 3T78A 4GX9A 1UR1A 4UTLA 3V16A 1VB9A 1OG6A 3F1QA 4ZQRA 3THUA 1FUYA 4DZHA 1N55A 3VIGA 1VH7A 5T8GA 2E25A 3UWUA 3IJQA 1BRLB 1I2NA 3PB2A 4JD4A 1OY0A 4IIFA 5EMUA 2PDCA 1VRDA 1QHZA 1RLDA 2DIEA 1F76A 3R13A 3TK7A 1RZMA 4BY3A 3AYVA 3P5ZA 1HF6A 3KM8A 3NUKA 3QR0A 4X0VA 3ZYZA 3W23A 3LQGA 1FDJA 3Q37A 1VF8A 4J4KA 4J2MA 1MYRA 4QX4A 3S6OA 3ORWA 4D72A 4F9JA 1V08A 1X1ZA 3VIPA 2ZZ2A 1Q2RA 4QXIA 3S5YA 1HT6A 3STCA 4CD8A 3ES8A 2G95A 3KCJA 5FI8A 4DUVA 4Z1CA 3BLEA 4Q8WA 3ZR5A 3POCA 3RU8X 3FCPA 4NILA 3NEHA 2VEGA 4PTXA 2UBPC 1RLCL 4FOJA 4Q33A 3BURA 3T0DA 1CTNA 1V77A 4WJ8A 2VX7A 4MKVA 3VXGA 2VX4A 1FHVA 5EMKA 1CI1A 1VHCA 3NQBA 1KA9F 2VEFA 2WKLA 3BSGA 3OZOA 3R12A 2VVNA 3MUAA 1H7RA 1M7JA 3W85A 4E0CA 1P0KA 4MB1A 5KZMA 3CHFA 1TB3A 5BXRA 5F4SA 5FD0A 4DO5A 5KMYA 5M03A 3VOHA 4B16A 3RU6A 1YDVA 3BG9A 3VKAA 1ONXA 3QV7A 4GXPA 4HPJA 3U4AA 1WKEA 4QDPA 4OGZA 3UWZA 1WP6A 2RUSA 1ONRA 3RFAA 2Y5JA 3KX6A 4C60A 1RQHA 5D4YA 2FLIA 4QLLA 5EFFA 4IHCA 4B3ZA 3QZ6A 3BAIA 5DCEA 4GNKB 4QP0A 1QNPA 3PZGA 1PIGA 3DC8A 2PRLA 2E5DA 1AK5A 1W3IA 1QI0A 2EPNA 4N02A 1UJQA 5FF2A 4C6KA 3PPCA 3SCRA 3VM5A 4RV8A 5BWAA 1DHPA 2QCCA 1F4HA 3W1RA 2J74A 4UUIA 1PZ1A 4DM2A 2G4FA 5I3FA 3C52A 3T0BA 1WDDA 2ZZ7A 4N9BA 1PCKA 4O0KA 1QNVA 1EOKA 1D3HA 2ODOA 5FEWA 4CU8A 3JZUA 4QG6A 3W1QA 3JR2A 3UGVA 1HKWA 4YYCA 3WMBA 5A1AA 5BRPA 4NJGA 4JXCA 3WBXA 4LVDA 1WZKA 3C2RA 3QOMA 1VS1A 3Q4DA 3G6MA 3QPZA 3UCDA 4QQUA 3ITVA 4ZFCA 2XM1A 2WCGA 1A3HA 3M5YA 2YPIA 4WGXA 4XBJA 4K8EA 6REQB 4MYAA 3TLQA 3GC2A 5D09A 4DI8A 2ON3A 3KP1A 1E72M 3R43A 4GYKA 2DT3A 2CBJA 1EJVC 1TO3A 1V6TA 1QCWA 2PBGA 1UD4A 1B3YA 4XWUA 4PN2A 1JD7A 2JEPA 2PTXA 2ATSA 1YX1A 2PP3A 3AMGA 5BMXA 1EFZA 5AZ1A 1F4AA 3NCOA 4OHQA 3SW6A 5G4WA 5A2CA 2V2HA 4QJ1A 4PCNA 1JZ4A 2RJGA 5EU9A 3CWHA 2DDXA 3VGGA 3ZM8A 3G6LA 4M3PA 1KCZA 2J24A 4IMCA 3VILA 2DZTA 4PMQA 3AWNA 5ABHA 3TMLA 4N6FA 1PJ9A 5CZ0A 4IM4A 3GXTA 1AH3A 4LCRA 4KMQA 2WANA 1I75A 3OLDA 1FWGC 4B15A 4JQ4A 4UC5A 1BFNA 3GAKA 3DHDA 2D0GA 1DE6A 1B3ZA 1PKNA 2CZEA 1I45A 2B31A 4F48A 1GZ1A 4FALA 1RA5A 1A47A 1KD0A 3U0HA 5G2IA 2GJRA 2ZUWA 1EH9A 3T08A 4B5VA 5HMFA 2Y63A 4G8TA 4CD7A 2E68A 1RK5A 1F74A 2JEQA 4CQ8A 4WDXA 2NQ5A 2BB0A 2ZE3A 2QGHA 2OOGA 2HQAA 4O4WA 1XW8A 4D6FA 1H61A 1D2KA 2DVXA 2GGEA 2F2KA 4UTFA 1MW1A 3HG3A 4ATLA 2QW5A 2PWEA 4H6QA 2J8FA 3WNNA 2O92A 3SCOA 4NNBA 2FJKA 1HIZA 3TV8A 2GVJA 2GSEA 2EPKX 3KFTA 5FJUA 3V5CA 3GNNA 1KM3A 1GHRA 3ALGA 3S1GA 3FA3A 2I16A 1MNZA 3VMOA 1Y5WA 1L6GA 2J47A 3QMRA 1SU5A 1W3HA 3C0SA 4FX7A 1XRSA 3B9AA 4F0RA 2D1ZA 2X2GA 4H8UA 5HMSA 3H4XA 4OUEA 3P62A 4HPGA 1YPFA 5FSEC 5A69A 1GVOA 4DYJA 4F9DA 3WQEA 4JYFA 3G5EA 1V03A 3JRKA 4KRZA 3NWRA 3IJLA 3LCLA 3CTLA 2BLEA 1ITCA 1XDMA 4UTUA 2V3FA 3U2OA 5D8ZA 3GU2A 3LYEA 3BAWA 1DYSA 5IOBA 1UR3M 3FKRA 4PZVA 1HGYA 5C7VA 4C65A 4AIUA 3RGTA 3I3DA 3VGDA 1H1NA 3DFOA 3K1DA 4GKTA 3MCMA 3VIJA 3XIMA 1TVNA 1V6XA 1XPYA 3NO5A 3EDJA 1D3GA 1MXDA 3QY8A 1TPEA 2J13A 4S3GA 4H9TA 1RALA 3CIWA 4ZMGA 3E02A 1WYIA 3GNRA 1K9EA 4ZGYA 1QK0A 4Q8MA 3AMCA 1E5NA 1U5VA 2XGBA 3AJXA 3W74A 1YXYA 3PNZA 3KW3A 3V4BA 4AWEA 3AMLA 3O06A 3WQ6A 4AEOA 3N04A 2Z4GA 4IX0A 4KBXA 2E5BA 4AD1A 1FH7A 4FLOA 3BK0A 4UTTA 4UNIA 2QT3A 3IANA 2QJNA 4MMWA 5J04A 5J5RA 1KFBA 3PUEA 3GB6A 2O7SA 1CWYA 4Y9MA 1DV7A 3VD3A 4OBSA 3HG4A 1AQMA 4IICA 2WK2A 1VEOA 1W9XA 4ZBCA 4BHYA 8A3HA 1TPUA 3NR0A 2NVDA 3WK0A 4QISA 1LT7A 3N12A 5M17A 2ZZ4A 4JX5A 3EXTA 3AXIA 4EAYA 1POKA 4K38A 4E4UA 3WDPP 4BZYA 3TYZA 1PEZA 2MUCA 3S1UA 4XUYA 4XIMA 5A8GA 5CSUA 3V0TA 4MPQA 1ME9A 4R85A 3G18A 2CHOA 1ENUA 5K4ZA 3QTGA 2WCAA 5C0QA 2QQ6A 4HTBA 2YA1A 4E8CA 3BAKA 3GWQA 4HHLA 3OA3A 4W84A 3FY1A 4WRHA 2HDJA 4Q4RA 3R2GA 2XIMA 3OLIA 4ALDA 2Y8UA 2A6LA 4WK9A 3SUVA 1OADA 4KGJA 3N2CA 1EHAA 1S5NA 9CGTA 2E3ZA 4O12A 5CC3A 4DO6A 4LUYA 3SR7A 2HK1A 1CPUA 3DGBA 4MPKA 2GJLA 1TTJA 3FAXA 3NOEA 3O15A 3EYPA 4WSHA 4HTYA 2TSYA 3ERPA 4XVEA 1H7NA 1IXPA 1VBRA 3VNYA 3GDTA 3QYQA 2QCLA 7XIMA 4RNIA 1I9CB 2ISSA 2QULA 1L2QA 3LRLA 2F38A 5EYWA 4AMCA 3UA4A 2G8ZA 3SY5A 1HUVA 1Q7MA 2QLYA 3WLKX 1JQXA 1K7FA 3BCFA 6A3HA 5DMMA 5JIWA 3THDA 2EGZA 3PJWA 2UY5A 1DJQA 2ZVRA 4ZXOA 3ZLHA 1UH2A 1A5KC 4DWSA 3EPMA 3C4UA 1TIWA 3HQNA 3UG8A 2GGGA 3EWDA 1XLFA 4W89A 3W07A 2FHCA 4NZ3A 2ZZ6A 4ML9A 3TYDA 4K39A 2DSUA 5A2AA 3OQEA 3R58A 1F7BA 2BNJA 4RX0A 4S2BA 5KZDA 4AD4A 3GVVA 1OZMA 3G1DA 4PULA 3WIJA 1R3SA 4IG2A 3HGOA 2ISFA 1Q3NA 2VR2A 3BXWA 3GU9A 2W27A 1EEPA 1FH8A 1KM1A 2GGIA 4UQEA 7A3HA 3RJYA 2V5LA 4LUIA 4BEQA 4JN7A 1QT1A 1JD9A 4E2OA 1LQ0A 5DN1A 1MUCA 1FRBA 3LBCA 3EWWA 3M44A 3NQCA 4WY0B 5AHEA 3DZ1A 1BXNA 1SO6A 3WO8A 5LNSA 1NWRA 1GOIA 4U2YA 3IS4A 4AVOA 4PRTA 3HG5A 2REQB 3L4VA 5GJPA 3OZMA 2DV0A 5D03A 2V0TA 3RYSA 1JR1A 1XGZA 1L8NA 3L2LA 5IDIA 2P10A 5E9XA 1R86A 2C19A 3FHQA 4RPPA 4PSRA 4ZB5A 4WXZA 2IW0A 3TFCA 4UTTC 2CPUA 3AO0A 1A5UA 2NV1A 2RHGA 3UNTA 3TTOA 2C79A 1VBJA 1I0BA 4V1XA 1WDPA 4LAOA 1FWSA 2E0PA 2QPUA 1W9VA 3TA6A 2J7HA 4A3UA 4GQQA 3WBYA 4UZSA 2PLJA 3L4ZA 4P7QA 3TTQA 4WY0A 4CD4A 1CYGA 3ITOA 3FJNA 5GVJA 4AB4A 2NQZA 1OGSA 4Z0JA 1L9WA 2R1PA 1EBGA 3W2UA 1IR1A 1MQPA 2TODA 3CEUA 2ANUA 2B7PA 2HMCA 3VIMA 2YOCA 4U33A 4XTIA 4S3DA 5FJTA 3WUGA 1CXHA 3ISIX 1OD8A 2AL2A 3PWAA 4PMJA 4F79A 2XISA 2FH8A 4IPJA 3RF9A 4CD5A 1X6NA 4AH7A 4P7RA 1KNWA 1WKFA 3UYCA 1TCDA 1W0MA 3EDFA 4J3WA 4NJHA 4Q4SA 1DQWA 3HPAA 2CKRA 4Z1AA 1JZ6A 4J5NA 3U9IA 3WQDA 2WNWA 3BGAA 4P7OA 1ZBWA 3W7KA 3U8GA 3NQ2A 1OFPA 4O17A 3SCVA 4A22A 3BO9A 2OT0A 3WUFA 4ZSUA 1LORA 1U83A 1I1WA 3WF4A 1J2BA 2XVKA 1I6NA 1ZENA 4DPPA 3KRBA 3NL6A 4PBGA 1PAMA 1DIOA 2Q01A 1P1MA 3LV6A 1JPMA 3VX0A 1CXLA 4DBEA 2I7GA 1EEXA 3UWVA 1WV2A 2OQLA 5JBEA 4IL0A 3V75A 5FESA 3L4WA 3QFWA 1KM6A 3SN1A 2G41A 3M7SA 4DWSC 1IQ8A 4RDVA 3PZIA 1XBYA 5LKYA 3E5BA 4GYPA 5C70A 4MG4A 2D2HA 4GPNA 4HZ6A 4NZFA 1GHSA 3GNXA 2WXDM 4NL1A 1HKJA 1J01A 3LY0A 4GXMA 1MZRA 3JW7A 2WSYA 4AZHA 2OO6A 3W84A 3LLXA 3DECA 5LA2A 2UZ9A 1M01A 1PIFA 1VCGA 3H2AA 4NY2A 2FH6A 1OYCA 3UU0A 1KFKA 1PX4A 3KHJA 1A5BA 2OB3A 2OLHA 2QV4A 1VKFA 3O07A 2X7WA 2OLAA 3MKCA 3W2KA 5HR7A 3LDVA 3LGGA 4RL3A 4AISA 3TR2A 4LXFA 4IGMA 4GYFA 1LQAA 1KQZA 1UWIA 1UOZA 3RR4A 3MO7A 3GBDA 4LYQA 1V6VA 1JZ7A 3ARSA 1TELA 3MY9A 4JQ2A 1HTIA 5I0DA 1HJUA 1P0DA 3VKKA 4HU0A 3VIHA 2DIKA 3E9AA 3GTNA 3N2MA 1ML1A 1AH0A 2W4XA 4I9JA 1JVNA 1NFPA 1XYCA 3NJ3A 2FYMA 3HN3A 1UD8A 3WLRA 3CHDA 2Q3RA 3TSMA 5C9ZA 1CXEA 5C2XA 1F05A 2PAJA 3M47A 3EPOA 4PCPA 5SWUA 2R1KA 3NZGA 1AW2A 1H60A 1OK6A 1R3QA 1ZRQA 3R10A 3EWZA 5BXTA 3TVAA 3W71A 2PP0A 3PZQA 3UXLA 4A3RA 2V3DA 3PWGA 2E6YA 3NQEA 1Y65A 4OIFA 4CCEA 4C91A 1XCFA 2P76A 4AXNA 1EJRC 1V0NA 2ZA2A 1DPMA 3L9CA 2A3EA 3LPGA 1B3XA 1J18A 1UUOA 3ABZA 2EBNA 1HJQA 3E5PA 3AIWA 3HFTA 2WMIB 3W7IA 3CZGA 3VFLA 4XZMX 4GYJA 3IARA 3K4DA 2VFFA 2XDFA 2JK2A 2PGWA 2VRKA 3RUBL 4KF1A 3ITXA 2EEXA 2J75A 4HPXA 3QR1A 1UWUA 5I3IA 3PY2A 3HPZA 2NX9A 3MKVA 1C7SA 1GWJA 4HNUA 4BF5A 4UTWC 3L7RA 4ZA0A 4GUJA 1QO5A 4CVUA 4AU0A 3UGRA 4AZ5A 1VGAA 4HCHA 3T05A 2PCQA 1VBGA 1XLGA 2PCEA 3KCLA 2YX0A 4UFLA 4JQAA 3EOLA 3GRIA 3LHVA 3LPPA 4A6GA 5AC5A 3WH8A 3SZ8A 3A6OA 3PZVA 3K4WA 1KR1A 3PBWA 3BL3A 2IXUA 1HFBA 4AZ6A 1POJA 4ZQMA 7REQB 4MFDA 1S2AA 2WMIA 4ICNA 4MGGA 4OVXA 3W83A 3DXIA 1KBIA 2VWTA 2OO0A 3B3DA 2EPOA 4S3KA 3TU9A 5CGTA 3S5NA 1OFOA 4LRSA 3RM8A 1QWGA 3PPGA 4EWJA 4BWLA 2XVLA 3CB3A 4O1EA 1W9PA 4O28A 2G3JA 5KSWA 1I2QA 3PK7A 1UZDA 1CLKA 4Z1DA 2J7DA 4C6QA 3SCUA 3TXVA 2QDGA 1FDYA 1SSGA 3RXZA 1RP8A 3F4NA 1WZAA 3STPA 1E0UA 1W9BM 3AQUA 2A3LA 2ZKMX 3LRKA 1XD0A 4O19A 2IQDA 3A9BA 1M7PA 3C61A 3JZEA 7REQA 5JU6A 1LTDA 2F2HA 4NF7A 2F6KA 4DJEA 2ZUTA 3WQWA 4FX8A 2XN2A 4KWSA 3VIFA 1C93A 2DFAA 1TWWA 1QWKA 3T6CA 1TX2A 3CQHA 1E40A 4LAMA 2WYSA 4M19A 3F4DA 2X16A 1E6NA 3VC6A 1YE4A 5CZSA 3MP3A 3L0NA 3PN8A 4J1OA 1N2VA 1OQFA 2W67A 1GZGA 2WLYA 4M5PA 3P81A 3CUHA 3C3UA 1H4PA 2PDLA 3W6MA 3QC0A 1K9TA 2WZHA 4FSAA 1Q6FA 4JTAA 1TMHA 2G96A 3KOFA 1TE6A 3PZOA 4AZCB 3SRKA 3VGEA 2R1LA 4UOZA 4DJDC 4IMDA 1XJBA 1IR2A 4UXDA 2VC9A 1M41A 3IAQA 3O16A 3A21A 4H3DA 4Q22A 2FB3A 3LERA 1KR0A 3NQFA 3DG7A 2I57A 4FNTA 3UXIA 2GYIA 4XB3A 1KFLA 1L2UA 5JVLA 3PPFA 4U31A 1CB7B 1EGVA 5D38A 1E1CA 1OF6A 3XISA 4V1YA 3PM6A 2YBTA 3MVIA 1UR2A 5H8MA 4IMGA 4LUSB 5A8PA 2NZLA 2GL5A 1JPHA 4AVNA 4W7VA 1GOWA 2V63A 3EOSA 1QOPA 1HL8A 1Q5MA 4IP7A 1PUDA 4J9JA 2HTMA 1KXVA 3C2OA 1UKOA 5CSSA 4JNZA 4AEEA 2JE8A 4BQ3A 3W00A 2RDUA 3EGJA 4LY8A 2DUAA 2NV9A 4DBSA 3SUTA 2VRJA 4AHPA 2G97A 4IMFA 4MWAE 1DWIM 2YKKA 1LOSA 4F66A 5T9BG 1LOLA 4BQ5A 2VM8A 2PDMA 2C71A 3IVTA 4R9XA 3FLUA 3CASA 1B31A 4JKKA 2PLMA 1EF2A 5F4XA 3UPWA 4O8AA 5I3KA 2ZQ0A 1OX4A 3LG3A 3NA8A 2PE4A 4MWAB 2OZ0A 3AXMA 3WJZA 3B8SA 4BWLC 5CZJA 2X0SA 4F0MA 3K4AA 3HJZA 2ZRYA 3BJTA 5LXXA 4QROA 1J11A 1VAHA 4C6IA 3W6YA 1BF2A 4NX0A 3DHPA 1OG0A 2Y61A 1MRQA 2E6AA 4NT0A 3DFYA 5CBBA 4GVHA 4XZIA 1V3KA 1A5SA 3AYTA 1EJTC 5XIMA 4JTCA 4KRTA 5FF3A 2H9AB 4JY9A 5I06A 2RDXA 2D0FA 3VNKA 4XD5A 4IGNA 1U22A 1BG4A 1YXDA 2XGZA 4QDWA 3NPXA 2ZOXA 1UASA 3B8WA 3EDEA 4NP7A 4EXBA 1VYSX 3PG8A 4GVFA 3UR7A 4YMZA 2QUTA 4MWAA 4CKQA 4I7VA 3LTYA 1B30A 3LOTA 4IP5A 1FP9A 1JEZA 1H5YA 2W61A 3OPSA 4JX4A 2D3NA 4D71A 2WC4A 2E8ZA 2HBVA 3GNDA 3PZTA 4NZ4A 1MVYA 2DIJA 1C3FA 1FHLA 4A35A 3VD9A 3DYPA 2PODA 4UNLA 1JDAA 1KBJA 3W38A 1BHGA 3N1AA 1GW9A 1YNYA 4N0RA 3OA5A 2AAMA 1ME7A 1VFUA 1JJKA 2X1SA 5K3VA 1TZ9A 1MDRA 2PEVA 2C7FA 2Z24A 2QCGA 1GGOA 3CIXA 3AJ7A 4OOUA 2DZSA 5FF4A 1ZJIA 4AIOA 2J62A 1A3XA 1O7AA 2XIOA 4NSBA 1Q45A 3GH4A 4ZQNA 3PULA 4KRUA 4RE4A 5CKSA 2ASHA 1C9DA 2WPBA 2OJPA 4RJEA 3LCFA 3VUSA 1T96A 5REQA 3OGRA 1EZWA 3DBPA 3QPYA 1F6YA 3IGXA 4JTIA 4Y96A 3WLIA 2ABBA 1WZMA 3SJ3A 2OKOA 4HJWA 4GABA 4U2ZA 1T7LA 5DQPA 1FBAA 3TZNA 3EX1A 1J0IA 3BE7A 5EMMA 4AX6A 1FWAC 1EP1A 3IRDA 2Z1VA 3Q45A 4GO9A 2PMQA 4E4FA 1US2A 2TMDA 4NJIA 4B91A 2C1GA 4IFRA 3W82A 1XBVA 1DXIA 1OT1A 3W2NA 4BI7A 4M51A 1E4LA 4AZGA 3N2TA 2DZAA 1NAL1 1LWHA 3BAXA 4NIRA 4OTKA 1S3HA 4CQCA 4KIRA 1KFEA 2NXIA 5HJXA 2G4JA 2HV5A 4KCUA 2VR5A 3LV5A 5HWNA 1WE5A 4DI9A 1A3WA 3IPWA 4BFAA 1FWDC 5CPNA 2NQJA 1V0KA 1M65A 3P2VA 1XLHA 1KRCC 4C6CA 3M43A 1ODZA 2CEQA 4ZO8A 3M41A 3A22A 1UW9A 3K46A 1Q2SA 4LC8A 5BWFA 1OCQA 2E8YA 3RLHA 5CJNA 3W7PA 3VGFA 3H2MA 1IZKA 1XRFA 4GACA 1JL8A 1J4EA 3CH9A 3LBOA 2DH2A 7ENLA 1RBOB 1J9YA 2IXVA 1O66A 1GORA 3N19B 3A23A 1W8SA 1PKLA 3GVRA 5CC5A 2WMHA 2GDVA 3AHZA 3WLQA 1ECEA 2BP1A 1GYLA 4P5UA 3QFEA 2XGIA 2Z1WA 4MZYA 3B05A 1PS9A 3S9YA 3TTSA 3H2EA 4TU1A 4XSMA 3IACA 4URIA 1ODUA 2XH7A 4H2CA 3FOKA 4XBKA 2YL5A 3NDYA 1R9ZA 3WELA 4R27A 3H70A 4QCEA 2ESCA 4EX4A 4YXGA 2YXGA 4C5YA 3B9OA 1PX8A 1P7TB 1FTXA 1E6PA 4FF5A 3NTYA 1UUQA 2A85A 3TE9A 3WN6A 4TX6A 4KERA 4WXYA 3DHUA 5DANA 2O4MA 2EXOA 3NGJA 4LOCA 2PRHA 4RNHA 3VNDA 2NUYA 3HF3A 4HSOA 1P6BA 4MZ1A 2OT1A 1WB0A 3ARYA 1H49A 1M68A 3INPA 3PS7A 2VQTA 2XVGA 2JIEA 3PJTA 1WOBA 3OODA 2PWFA 4WVXA 3RMJA 2GQ9A 4DF2A 1TJ2A 5H1WA 1Q6CA 3PTMA 4ACZB 4FB7A 2P5NA 3RLVA 4A21A 4W5ZA 5C71A 3D47A 1V4YA 3AWOA 4HZ8A 1YDNA 2Q8ZA 2FVKA 4DWDA 5CLTA 3A5VA 4BS0A 3VYLA 3QPEA 4R34A 5ABTA 3OZPA 4AC1X 3GVWA 1AQHA 3B97A 5F2LA 3H2CA 4DJFD 1I0DA 1P7TA 5ABFB 4DO4A 2P0OA 3VGBA 1NSJA 1BGAA 1AG1O 1RJRA 4Z2HA 1E56A 3H22A 3QV6A 3GAYA 4L4OA 2VZTA 1EO5A 2E6DA 4LBUA 3SCSA 4XZLX 4WSJA 2V81A 3W7HA 3H7VA 1XWYA 3DU0A 3OHIA 1Q4WA 4JFVA 3BJSA 3W70A 2OEMA 2OPJA 5AVHA 5C6MA 2FGBA 1ZQ5A 1JPDX 3S5ZA 3CUGA 4EPBC 3AU6A 2Z7KA 2PDKA 1GVQA 3AYRA 4PTVA 1JNEA 3VI2A 4O1DA 4W86A 2YL9A 1PDYA 1UP0A 5CPMA 3S2NA 5A2BA 3SCPA 3V0SA 3SQLA 3ATYA 4S38A 4GZ7A 2AOSA 5ABFA 3W75A 4GJ1A 4HN4A 4JR5A 4HK6A 4WDUA 4POCA 2OQHA 3GW3A 1WOAA 3W72A 4L64A 3TEVA 4OKDA 3N11A 3WL0A 4IIBA 3RLUA 1ZU8A 4XK2A 3TIMA 1YTKA 3PAOA 2MANA 1TKKA 1XINA 4DJDD 3LCGA 4LYPA 3A4JA 1FFQA 2CU0A 3LXCA 3MHFA 4I90A 3KDOA 1BF6A 3UR2A 3WD0A 4YTRA 4LUTB 3E3HA 4H6KA 3MMDA 1YLVA 5FA5A 3UJFA 1A5CA 1KGWA 3WF3A 2VCCA 2OTDA 3UESA 1M53A 1GTEA 2NWRA 4DBDA 2DUZA 3SQSA 3AHXA 2OGJA 5AHMA 3LD5A 1EWDA 2JKAA 1R46A 1BXBA 3U2EA 4Y9PA 3PUOA 5LIYX 3ARUA 1UWSA 1JCLA 1GOMA 2WZMA 4WZHA 3MDWA 3CZLA 1R47A 2Y8KA 4GVIA 4N6EA 1LT8A 1GYNA 3ZWSA 2IPWA 4NRRA 3VOFA 3NL3A 3AXKA 1REQB 1B0IA 5K2ZA 5AY7A 3WK3A 3STEA 4RW5A 4CQDA 3LSCA 3S2JA 4UB9A 1XP3A 1WXZA 5ECUA 3SJNA 1YTEA 4FPSA 1MEIA 3I65A 3UEQA 1NU5A 5AYZA 1NOWA 2YZ5A 1V3LA 4LCSA 2YZRA 2OOFA 1BD0A 1R3YA 1RCOB 3S4TA 5HDRA 3OQ8A 3WDHA 3GTHA 5G5IA 4JHMA 3ID7A 3N15A