1OJXA

Crystal structure of an archaeal fructose 1,6-bisphosphate aldolase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
250
structure length
250
Chain Sequence
NLTEKFLRIFARRGKSIILAYDHGIEHGPADFMDNPDSADPEYILRLARDAGFDGVVFQRGIAEKYYDGSVPLILKLNGKTTLYNGEPVSVANCSVEEAVSLGASAVGYTIYPGSGFEWKMFEELARIKRDAVKFDLPLVVWSYPRGGKVVNETAPEIVAYAARIALELGADAMKIKYTGDPKTFSWAVKVAGKVPVLMSGGPKTKTEEDFLKQVEGVLEAGALGIAVGRNVWQRRDALKFARALAELVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an archaeal class I aldolase and the evolution of (betaalpha)8 barrel proteins.
pubmed doi rcsb
source organism Thermoproteus tenax
molecule tags Lyase
molecule keywords FRUCTOSE-BISPHOSPHATE ALDOLASE CLASS I
total genus 88
structure length 250
sequence length 250
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2003-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ojxA00
3B0PA 2E5BA 5DBTA 4WX2A 3M47A 2Y7FA 3QW4B 4IX0A 1UB3A 3QF0A 2ZZ6A 3HB9A 3TFXA 4GE8A 4A3UA 4ADUA 1K8XA 2E1DA 3E96A 4CNPA 2QCGA 1YDOA 1VR6A 1Q6OA 1EUAA 1VCFA 3P80A 2WSQA 2ZZ3A 4LT9A 3BARA 2QF7A 4YL2A 3STCA 4MJZA 1OK6A 1DBTA 1GWJA 2FJKA 3UPBA 1VYRA 4K7VA 4BK9A 4QAIA 3WJSA 3I68A 3LCGA 4UC5A 1B4EA 1LTDA 3ABSA 1U5JA 3IGXA 3SI9A 2WQPA 3MHFA 4I7VA 3IIZA 5K4ZA 4LWWA 3NGJA 4M6QA 4UTWC 2X1UA 5KTLA 1Q6RA 3VCRA 1H7RA 4Z0JA 1DV7A 1M6JA 4UMAA 4M6PA 1YTEA 4ICNA 4WY0B 4JIQA 1I2NA 4I9AA 5AC7A 3GXNA 3EXRA 3MP4A 2GQ9A 2B0MA 2LLEA 2DZSA 4BI5A 4UR8A 2F84A 3E9AA 1GVQA 4QNEA 3TV8A 3A23A 4N2YA 4WOZA 3L66A 3W9ZA 2QCMA 2CLHA 2VEKA 2QCEA 5I3IA 2A21A 2A4AA 4AMAA 4R33A 1WBJA 2VELA 3SJ3A 2A85A 2CZEA 1EUNA 4UTHA 2R94A 2OZ0A 4AWTA 3OA3A 5LSMA 4IMGA 1TPC1 4HNUA 1SFLA 1X1ZA 3O05A 5AC6A 4XZ9A 3FA5A 3KRSA 1F73A 3S1VA 3M0ZA 2VEMA 1A5AA 4X3ZA 1ME9A 1SO6A 3INPA 4A21A 5D2XA 3M5YA 1S5TA 2YDAA 3W2JA 4Q32A 5F1VA 4NXKA 1QDSA 2VOMA 3HGRA 4EVZA 5DXXA 3A24A 3ANYA 2RHGA 4Z08A 5J5RA 3OIXA 2BLEA 4FHAA 4DF2A 1XDLA 4XUGA 4UMBA 1SFJA 1L6YA 3WFAA 4ALDA 4OU1A 1TRIA 2H3DA 2V9DA 1H7PA 4WD0A 3GK0A 5GVJA 4K7YA 1SU5A 2QEZA 5FF4A 4O14A 3W23A 3IVSA 3P8JA 2J88A 3G1AA 2Y61A 4Y9AA 3TE9A 1RPXA 3W1QA 2J9ZA 3W1RA 2V8ZA 4FNQA 1J5TA 2QJHA 3W7KA 1W0MA 3EEGA 1QPNA 3AO0A 5LNWA 3IGSA 2OX1A 3IIXA 2PRLA 5CSSA 3G1DA 3NG3A 4RZ6A 1W3TA 3M5ZA 3HG4A 4UTJA 1GVFA 3G0XA 3HQ1A 3G1XA 3TQ0A 4XKYB 1TIMA 2A7PA 3TROA 3TJLA 4IXHA 3THQA 3GB6A 4UFIA 5C5YA 1VCGA 3T44A 3EXTA 5IBXA 5C55A 1MXSA 1BWKA 4GUFA 1A5BA 3KRZA 2CLIA 4LC6A 3T55A 5BNKA 2JBMA 4QITA 1BKSA 1YTDA 1A5CA 2HTMA 1O95A 4O1AA 4FX7A 4B5NA 2G95A 2QDHA 3QH2A 4JYEA 3MYOA 3IRDA 2X2GA 1O5KA 3GDRA 3LLDA 3E0IA 5AHLA 5HQEA 5CPLA 3TNOA 4MYAA 4KFPA 3LBCA 1JRBA 1WX0A 2KZHA 2WV8A 3GX9A 4O52A 3JR2A 2PRMA 5FEPA 5H91A 4Y96A 2RFGA 3QSRA 3E49A 1O60A 2X1SA 3KAOA 3TC6A 2FFCA 2HS6A 2ZCGA 3FJ6A 1SO3A 4GUJA 5T26A 4OBTA 1F6PA 1NSJA 4FNTA 4RZ5A 3WJXA 4JTFA 2ZRXA 4K38A 3PB2A 4DO6A 3A21A 1UBSA 4JEQA 1OX5A 3NM1A 4PFMA 4QSHA 1QPRA 4XTIA 4FX6M 3C6CA 1JCLA 2E5CA 5LNRA 4PH6A 1LBFA 3MBDA 5LNSA 3H54A 3W7GA 4O13A 2WSYA 3OHIA 1WQ5A 2NV2A 3W7JA 2V81A 5G1YA 3NL6A 1JCJA 5HJLA 5DY2A 3L2IA 4NX0A 2NV1A 3R2GA 1OABA 5IM51 4GC4A 1FCBA 2VEPA 1AG1O 1HL2A 4JTJA 3G1VA 1OYAA 5EA9A 4L4LA 1P5BA 4DO5A 3W85A 1JCNA 3DFOA 4O1BA 5D2WA 5FI8A 1PS9A 1W31A 5A5WA 4ZL1A 4E38A 3ZS4A 3W3OA 3GR8A 2NUYA 1RR2A 4WXYA 1H5YA 1H62A 3IIPA 3GNNA 4RX0A 3NXFA 4UTTA 4LTSA 4JYDA 3LHYA 3C2RA 2DJXA 2DZUA 1TPVA 4CQ8A 3O16A 2CU0A 3DAQA 4OWGA 2YW4A 1GOXA 1B57A 3GDLA 1J2WA 1W1ZA 1YDNA 3S0CA 1QWGA 4NX5A 3FEMA 2EPHA 3CTLA 1SUXA 1JRCA 4QIUA 1DJNA 2BX7A 3NVTA 2PC4A 1X8FA 4OQVA 1KTCA 3KVJA 2DZXA 1KM5A 2E77A 4JTUA 5CZJA 4GUHA 5HINA 3W72A 2PURA 4N9CA 3GVGA 3UXDA 1F6KA 1HO4A 1VLWA 4R53A 1XCFA 3TCEA 2DU2A 1WOBA 1UUMA 3EWBX 3GKAA 2ZA1A 4MOZA 4N4PA 1XBVA 3NR0A 3GXPA 4DELA 1W8SA 4KWWA 3G22A 5KMYA 2RDWA 1PV8A 5AHFA 3TJXA 1HTIA 2FPTA 3N34A 3UNDA 1R46A 3N9SA 3TXVA 4X22A 3W87A 4DBEA 4IWWA 3LHVA 1TV7A 3NPXA 4M7TA 5G2HA 5DCBA 4O8RA 5FF3A 2BZNA 2JK2A 1VQTA 3P5YA 2BTMA 3OEXA 2QUVA 1RQEA 3S6DA 3G1HA 1FX6A 1TV8A 2E5DA 3MWAA 1TYGA 5EPDA 4NJIA 4OE7A 4TU1A 5AFDA 3FYOA 2C1HA 4PTNA 3SGZA 3USBA 4GWEA 2PE4A 3VI2A 3UXAA 1IIHA 3SSJA 3SW6A 2FLIA 3ZWSA 2DP3A 1XDMA 4IPJA 3DHDA 3O6YX 1YLVA 2NX9A 1GG0A 4RXGA 4QNWA 2GVJA 4NNBA 1F76A 2FDSA 4FB7A 4GJ1A 4ONVA 1C9DA 1ICPA 4RCXA 4JY8A 5DY3A 3LHUA 3W70A 1UUOA 1R2RA 4TO8A 3LXBA 3TQVA 2J27A 1LDCA 2G96A 3HG3A 3M7WA 1F2JA 3LCLA 1NEYA 3W7EA 3W71A 4K8EA 4RXFA 4E2DA 3L9CA 3Q2DA 2NX3A 4NZFA 5F4WA 3STFA 3GXTA 3WK0A 3C8FA 3TX9A 4JIPA 4K37A 2BXVA 2ZQ0A 3MI2A 1OFAA 1LBLA 2OJPA 1OFBA 4O18A 4LS1A 3L65A 3GLCA 4NJGA 2E6DA 3M9YA 4N6EA 2A7NA 4JTIA 1A50A 1TV5A 3MP5A 2ZDRA 1F7BA 1KFBA 1LBMA 5ABTA 1W5QA 1OG0A 3DFPA 1MO0A 2GQAA 4AF0A 2Z0IA 3IIOA 3JS3A 5D02A 4N4QA 5G1TA 3G0SA 3KHJA 1OF8A 1T0OA 3L5MA 3BO9A 3QPZA 1X6UA 1FXQA 3LV6A 3QMTA 4K8HA 4NJKA 1YXYA 4Z1BA 3WK2A 3W74A 1FWNA 1MEIA 4WXZA 4IUOA 1UASA 3HOJA 4YCPA 4JY9A 4KKXA 1VPXA 4ZMGA 1L9WA 1NAL1 4Y90A 1TQXA 3C2VA 1IXQA 2JKAA 4LVDA 4DEFA 2Y7DA 3TSDA 4JTTA 1KM1A 3CLMA 3LHWA 2NZLA 4FIRA 3ZFHA 1EP3A 2GJNA 3DGRA 3LDVA 1YPIA 1JQVA 1IXOA 1VHCA 4HNVA 3IEBA 4JYFA 2Y6ZA 1LROA 4FEZA 2J6XA 2YFNA 2YGYA 5AHIA 1ICQA 3I65A 5LNVA 1G67A 2EGZA 1ZAHA 4HT3A 1I2OA 4MUZA 3LTPA 4O50A 2GQ8A 3PG8A 2EHHA 2CLKA 2J9XA 4PODA 1ZAJA 3TUUA 2Q8ZA 2A7RA 3DZ1A 3GZ3A 4POCA 3HBLA 2O7SA 4CCDA 3DBPA 2CFFA 1A5SA 1ME7A 3PUEA 3LB0A 3DENA 3PBUA 2XFWA 4BF9A 3C3NA 2C15A 4TMBA 4RLIA 4JNMA 3LV5A 2ZRYA 4KWVA 1SO5A 3ABOA 3LCFA 2ISVA 5F2LA 1VYPX 2YFOA 4NJHA 1JULA 3EWZA 5LKYA 4FNSA 1MZHA 3E12A 4TIMA 5C6MA 4IMCA 3W2LA 1NFBA 3QZEA 3HG5A 4DBDA 2ATMA 5LZLA 5G4EA 3CIWA 5CPMA 4O4WA 1H61A 1QMLA 1M7PA 3UYCA 3W2KA 4UTIA 1HUVA 3NQ6A 2Q8LA 4JX6A 4UTKA 1G4TA 2UV8G 4JDBA 4G1KA 3MP3A 5DCDA 4K6AA 3PS7A 1ZNNA 1TJRA 4MY1A 5L9FA 3MUXA 1SW7A 1ZCOA 3KX6A 1ZY9A 2NLIA 2QCNA 3UWQA 4H6KA 5LHEA 3OVQA 3FJLA 1XC4A 1QNVA 3ABQA 3DI0A 4NQ1A 4O11A 4UR7A 1VH7A 3Q37A 1LLZA 4FXSA 4ORMA 5FEZA 5LGZA 1GTHA 3I7RA 1SPQA 3P61A 1SO4A 1KBJA 1OVDA 4LS0A 5AYXA 4XQ6A 1FWRA 3CWNA 3HO8A 4O28A 4PL1A 1N55A 2YW3A 3SECA 4ADSA 2V82A 2FB2A 3QRHA 3T4CA 1GZGA 1OX4A 4WY0A 3W7QA 1NF7A 5D2VA 4LUJA 1TO3A 3IVTA 2QDGA 4RR4A 1OK4A 2R14A 2Y88A 3IGUA 3U8GA 2AAMA 1B4KA 3QJAA 1GT8A 4GNJA 1OFRA 2GPTA 2WNNA 1FCQA 3TXZA 2Y89A 5CZTA 1TPH1 5AC8A 1OFOA 2W0UA 3TMQA 5U7SA 3L5LA 3S5YA 2CZ5A 3NDOA 3EWUA 1FDJA 2EKCA 3W07A 2QUTA 1I45A 4LUIA 1OX6A 4UMCA 1I8JA 2DZPA 1FQ0A 2V2DA 1FXPA 1ZALA 1QPQA 2NWSA 1D3HA 3UZJA 1S5WA 3VKJA 4MJMA 2Y62A 4JTLA 3LGEA 1TSIA 3GDMA 1GTEA 3U2OA 3IIVA 4MY9A 3WJWA 3R13A 5E93A 3LRLA 3DFNA 2A2IA 5D09A 3LBMA 3UPWA 2PCQA 2FB3A 2ZZ1A 1OFDA 1AW5A 2B7NA 5L6UA 2I1OA 2QKFA 1W5MA 4N9EA 5FF2A 1K8ZA 1QPOA 1JUEA 4QQ3A 4O1CA 1WDWA 1KM4A 4CLMA 2QJIA 4LNYA 2Z6IA 3NO5A 4XBSA 3A5VA 4LVAA 3C2OA 1MEWA 1PCWA 3PBWA 1HO1A 3NL3A 2Y85A 5EKYA 1K03A 1FCVA 4EOUA 5LNUA 4Q4KA 2XN1A 2Y70A 3TC7A 3NQDA 3N73A 3G8RA 3EKLA 5SWUA 1QAPA 4IX2A 4R7JA 1AW1A 1YTKA 5K4XA 4BI6A 3EB2A 4UFJA 3MO7A 3SGUA 1ZENA 2DZVA 4LRTA 1SSDA 3HPSA 2VXNA 3FFSA 5HULA 1QO5A 1S3HA 3W75A 5BRBA 1RQHA 3EWWA 2WSRA 1FWWA 2ZTJA 3TR2A 3QYQA 4IMDA 1G4EA 3DKJA 3HGJA 2YYTA 1V5XA 2AGKA 4A22A 4BI7A 4MYXA 4JTSA 4XWUA 3NOEA 4X2RA 4HIBA 5KZEA 4CQ9A 1M7OA 1QCWA 3EKZA 5F2MA 4AHPA 2QJGA 4H4IA 4LOCA 1R30A 1AL8A 5FESA 3VFLA 2VFGA 4BFAA 3VNDA 3SR7A 3B06A 4DO4A 3NA8A 1SW3A 2DORA 4LS2A 4O54A 1DHPA 1G69A 3W6YA 3M6YA 3RF9A 1NF0A 1I2RA 2YR1A 3P5ZA 4OT7A 1KBIA 4FNRA 1SW0A 3A9IA 1SR9A 1ALDA 3G18A 2BSLA 1DOSA 1PE1A 1KFLA 4CNNA 2I9EA 4PA8A 5FF0A 6ALDA 1OX4B 4MFDA 4GXMA 3DHFA 1EEPA 1JCMP 1RD5A 3HG2A 1P4CA 1DVJA 3C61A 3F4WA 3ATZA 3QMSA 1LYXA 3NAVA 1XBZA 1Z44A 4BWLC 1THFD 2V2CA 4CQAA 3PAJA 3CEPA 5C54A 2NUWA 1H7OA 1AL7A 4LY8A 1GJPA 3FLUA 3TKFA 2Q3RA 3PSWA 2WNZA 4AVFA 1TPDA 3TFCA 2JKPA 3I7QA 1FBAA 3W84A 1BWLA 2ZZ4A 4Z0SA 2VEIA 1DORA 2H6RA 4C1KA 4A2RA 2VENA 3RNDA 4FNPA 3M43A 2Y7EA 4NXSA 4JTKA 1K7FA 5K3VA 3S1WA 1I4NA 2CZDA 4IOTA 5E0KA 4UCGA 1P1XA 2CLEA 4FXRA 3ABRA 4NJJA 2OT0A 2B7QA 3G24A 3O15A 1TPFA 4MY8A 4BWLA 2C14A 2H8XA 2ISSA 3L0GA 3O6CA 3RLUA 4CCEA 1H51A 3LI1A 1OF6A 1H7NA 4HPJA 2CLFA 3HPXA 4IMFA 1K7XA 5LGXA 4ZQRA 2G97A 2WJZA 2QCDB 4IQLA 3W1NA 1D9EA 2A0NA 1K8YA 2Y7GA 4UNLA 3G0UA 3I6RA 1GVSA 2Z1BA 4P2VA 4UFMA 1U83A 4JD4A 1FWSA 3A22A 1GPWA 4LW7A 4ORIA 3W76A 5D33A 1SSGA 3STGA 5D05A 3MJYA 2YPIA 3U6WA 1D3GA 2YCEA 4O0KA 5D32A 4MZ1A 3LRMA 4Q33A 3B4UA 3E02A 5CG7A 1XL9A 3TW6A 4O19A 1RQBA 4NUWA 4AEOA 2R91A 1FWTA 3NYZA 3WJZA 3SFKA 3EX1A 3D0CA 4LVFA 5CPOA 3MYPA 3HPZA 5DLCA 5I3FA 5BOOA 3BLEA 2ISWA 3LCXA 4AWSA 1EWDA 3NQEA 2P10A 4EF8A 1H7WA 3EWYA 3LLFA 3LRKA 2ZA2A 3W7PA 3NQMA 1XM3A 2JGQA 1E51A 1OYBA 1S5VA 4LU0A 3KFTA 2I14A 5G2IA 1VC4A 2DZTA 2ZZ7A 2ABAA 3L5AA 2O7QA 4AB4A 2C3ZA 4CNOA 5KZDA 3NQAA 4EWND 3DI1A 3JRKA 1GVOA 1K02A 2V2HA 4S2BA 3NQCA 3ATYA 1LOQA 1TTPA 2YZRA 2H90A 3S42A 1TJPA 1W54A 2DZWA 1RZMA 2B7PA 1MSSA 1IGSA 1N8FA 2HSAA 3T40A 3P67A 5D04C 1H1ZA 2VFDA 4DPQA 3THAA 5FEWA 4JDYA 3BW3A 1O4UA 3HIJA 2V5BA 2QAFA 3C56A 5C2XA 3UZ5A 4YLWA 4UFLA 5K7JA 7TIMA 1G6CA 2NX1A 4GBUA 2J24A 3BLIA 3TSMA 1KW1A 3LI0A 4UTMA 3BG9A 1Y0EA 1FUYA 1LRNA 3P81A 3DFSA 2OMAA 1Q6LA 1JVNA 3EWXA 4KFNA 2ATSA 3W1LA 5TBOA 4ZVJA 1JUKA 1C8VA 2ZYFA 3W7HA 3BW2A 3Q94A 4RKAA 2YX0A 4MZ8A 4H3DA 1I2QA 2QCFA 4QISA 4ZQNA 3SZ8A 1XUUA 3N2XA 4RK8A 6TIMA 3L68A 1RVGA 5TIMA 4OV4A 2RKXA 2XN2A 4NZJA 1ICSA 3QEZA 3TK7A 1TTIA 3HMJG 2GVGA 1TMHA 1F74A 4FX8A 3O8AA 3M16A 2Q3OA 1R47A 4NVTA 5I3GA 2P1FA 3NM3A 3C4UA 3MW7A 2HMCA 1EP1A 3BLFA 4WUIA 3LCIA 1H60A 1OHLA 3HF3A 1F05A 1DJQA 1AK5A 2YXGA 4LVBA 4AHOA 1GYNA 5HUPA 5I3KA 2TPSA 1TREA 4AXKA 4PC8A 3KVLA 2AQWA 4FO4A 4RV8A 2RDUA 4FNUA 2QAPA 4YXGA 4EF9A 4JR5A 4PEKA 3IVUA 1W5PA 5EYWA 3GNDA 1BEUA 5BMWA 4CCCA 5AHNA 1P0KA 1LP6A 3BGGA 3V1PA 4C1LA 1GYLA 1VCVA 1XBYA 3N14A 3EX6A 4S2CA 3P84A 4WY0F 2BWGA 1Z41A 2NWRA 3WJYA 2QUUA 2W79A 4HPXA 5F4SA 4UTTC 1B3OA 4XBKA 5MHBA 3W7IA 1CW2A 3N2MA 2PRHA 1KLYA 3B04A 4TMCA 5HWNA 3TAKA 3NNTA 4UTWA 3WK3A 2JGYA 3P82A 2EF9A 3PB0A 1GVRA 4O4VA 1NVMA 3RLVA 1KLZA 2CW6A 2NXHA 3PR2A 2W6RA 1LRQA 3FIGA 4UTUA 4M19A 3P7YA 5TQLA 3LHZA 3W1XA 3AJXA 4MZYA 3GIYA 2WNQA 2VFEA 4LVGA 3PM6A 2X30A 4GFSA 3CT7A 2A6NA 1OYCA 2ZA3A 1DKWA 4A2SA 1H7XA 3M44A 4IJBA 5CGQA 3T7VA 1ONRA 3NPWA 2EAWA 1JR1A 3KOFA 4Y8FA 2A6LA 3RFAA 3LERA 1LZOA 4Z1DA 1A53A 4N9DA 4OV9A 3K30A 2FPVA 1HG3A 3W1PA 3NQGA 4IMEA 5HR7A 1ZJIA 3KRUA 3G1YA 3NEVA 2X16A 4JX5A 1YXCA 2R8WA 3YPIA 4AF0B 4OGZA 3GAYA 3GYEA 4GUIA 1Q6QA 4ADTA 5EY5A 2VC6A 3NL2A 1VJIA 4JGDA 4JS3A 2G5WA 4HSNA 1ME8A 2GJLA 1TPB1 3S5ZA 3BGJA 3H55A 2JKEA 2ALDA 3CIXA 2TYSA 5DXYA 1IF2A 4JTHA 1AW2A 3UD6A 3EXSA 4U4MA 3PBYA 5K2ZA 3OVRA 3ZWTA 4N6FA 3QPYA 3B05A 3BG3A 5LHFA 1XI3A 1K7EA 1QO2A 4ZQOA 2WPBA 5F1UA 3EX3A 3DKLA 1OFQA 4LV9A 4O0ZA 1WA3A 1L6SA 1LOLA 3TMLA 2ZRVA 3SY5A 3NQ8A 1YXDA 1KFEA 4WOQA 4UXDA 5AYYA 3L0KA 3MBFA 1EIXA 4P61A 3UWZA 3TSBA 5I3HA 1H1YA 3KXQA 5KITA 1KFCA 3KVMA 2YSWA 5D2YA 1DQWA 3P60A 3R8RA 3EX4A 1XXXA 4MLJA 4UNKA 4HN4A 5F4XA 4K36A 1LM1A 5DCEA 3W22A 3HGSA 5EL1A 4MKNA 1XUZA 4MLRA 1TPEA 2E68A 3G3MA 4LRSA 3S5OA 3R12A 3QM3A 3PG9A 2V30A 1PCKA 1O5XA 3MI6A 1SQ7A 3BW4A 5D03A 1R2TA 1ZAIA 3GKFA 5AHEA 1Q45A 3PUDA 3P62A 5D30A 3R89A 2E6AA 1CI1A 5K9DA 3BG5A 4RJEA 3S8HA 1VYSX 1KV5A 5AB3A 3BV4A 2A1YA 1B9BA 1IXNA 3OBKA 5CKSA 4I7UA 4ZQCA 3C52A 4ML9A 1T8XA 1KM6A 2C0AA 2GOUA 3KVKA 3DU0A 1KM3A 3M41A 4RZ4A 3B8DA 3TIMA 1GG1A 3O6DA 1OFPA 1HFBA 1LCOA 1ZHAA 1YYAA 1K3UA 2CLLA 3BVJA 3LCWA 4UTLA 5D2TA 4JICA 5KSWA 2J9YA 3VE9A 1PHQA 3UWWA 3C2EA 3W7MA 8TIMA 1SZEA 3W88A 2CLOA 4IXXA 4MFEA 4DPPA 3GAKA 3MHUA 3N9RA 5J5DA 2ZFAA 2H3BA 4UFKA 1UJPA 1EA0A 2QCHA 1VZWA 3V75A 3B0UX 3QC3A 2TRSA 3NZRA 3W7OA 2QCDA 1W3NA 4K39A 3WK1A 2GUUA 4LC8A 4LV4A 1LOSA 4MPQA 3F03K 5H2ZA 1Z42A 1PIIA 3LHTA 4PCFA 5K9XA 4O15A 4AWUA 3G1SA 5A8GA 3NQ7A 3CB8A 5EMUA 2E09A 3R5EA 3L21A 5AYZA 1Q3NA 1W37A 3F4NA 1F5ZA 1T99A 3GR7A 3W1TA 4R34A 4Y6GA 5DBUA 2FPYA 1FDZA 1IXPA 2OT1A 4QJ1A 3UWUA 2V0TA 1KM0A 3LX9A 5DELA 4UFHA 4IPIA 3LOTA 4HSOA 4JXCA 3ZR4A 3QFEA 5G2WA 1T96A 3NQVA 5FEXA 3W2NA 3LTYA 2H8ZA 3W1MA 2D73A 3P74A 1KFKA 3PUOA 1O94A 3NQFA 4AH7A 4M6VA 4XTDA 4N9BA 3W7RA 4TX9A 3NPVA 2GVLA 2ZRZA 1SZGA 4MIMA 3W7LA 1N7KA 4U28A 3IV3A 4JX4A 2QCLA 2FQIA 5AOUA 2ZZ5A 1TCDA 3NPUA 1WBHA 1XFBA 3FOKA 4WZHA 2X1RA 4A29A 3O1NA 5CZSA 1DQXA 3BK0A 3UWVA 2P0OA 5CZ0A 4M7SA 1PVNA 2ZBTA 2YYUA 3G8EA 4O57A 3LM7A 4ZQPA 2CZFA 1IIGA 3M1ZA 1JQXA 2E6YA 5HR6A 5FF7A 3W83A 3W86A 1QOPA 2C18A 1WAUA 3N19B 5F2IA 1Z48A 2ZTKA 1VGAA 5AHMA 4YCOA 2QR6A 3CQ0A 2C16A 4HNNA 3L0NA 4TR9A 1ML1A 3NL5A 5D37A 4DQWA 3OVPA 2DJLA 4WQ6A 1G4SA 4DF0A 1FDYA 3LTSA 3CEUA 3S1XA 3P8IA 4X9SA 5D38A 1V7YA 5CPNA 5HNRA 1QOQA 3T78A 4ZZ9A 5EBUA 2NXGA 1H63A 2RDTA 3W73A 1WOAA 3PVFA 1GEQA 2Z2UA 4QM1A 2ZRUA 3PC0A 5KINA 1VRDA 2VFHA 4NNCA 3O07A 4GRSA 1L6WA 5G5IA 3LXAA 5AN7A 2VKZG 2RH9A 5G4WA 3TH6A 4BR1A 1WXJA 3O06A 4O53A 3DFQA 3QSTA 5F2GA 3EX2A 1W5OA 3I7SA 1QFEA 1L2UA 1XKYA 3A5FA 3RK8A 5E1QA 2C13A 1X7FA 2WKJA 1FCUA 3FKKA 3MHGA 3BPWA 3TW7A 3CM4A 3CHVA 3TA6A 4PL2A 1TPUA 3QMRA 3CWOX 4DF1A 1KFJA 1W5NA 3PY2A 3B0VC 4YMZA 1G4PA 1EP2A 3TAOA 4NNAA 1XBXA 3PULA 3TQKA 4MVAA 1WV2A 4Z1CA 1SZNA 1VHNA 5K9CA 1PHWA 2E6FA 1TTQA 3SIZA 2HS8A 3HGOA 1EPXA 2OCZA 3FYPA 3Q58A 4GUGA 3UY8A 3HJZA 3M5VA 4YWIA 1LORA 1GQNA 4DXVA 3UWYA 2WOQA 3RMJA 3L67A 3TU9A 1KM2A 4O1DA 1R2SA 2VFFA 1FY6A 3W2MA 1G7VA 3CPRA 4JTGA 1KTNA 1RV8A 4O10A 5HMSA 4XKYA 4I7WA 4M5PA 4UIOA 3S9YA 3H53A 3UY7A 5IBXC 1AMKA 4L4MA 1JJKA 4HHPA 3FKRA 3CU2A 1ADOA 1WYIA 5HWJA 5BMXA 4E2BA 3PSVA 3F1QA 1C29A 4E0CA 2ABBA 3PF3A 2ZZ2A 1MEHA 1G7UA 1UCWA 3QW3A 5I3JA 4O12A 1EX5A 1DL3A 5HUOA 5U4NA 3G1FA 4N02A 3MI3A 1TB3A 3QQ0A 2TMDA 1YDVA 3W2UA 3TDFA 3DFTA 3RU6A 4S1FA 3W7DA 3W1AA 1YPFA 2C19A 4NU7A 2Z6JA 2F7FA 1TRDA 4J9JA 4WJEA 1KV8A 4W9TA 4Z1AA 1H50A 2FIQA 1JCYA 2NXIA 2B7OA 5BW6A 2ZRWA 1EWEA 4HNTA 3ELFA 1W3IA 2VFIA 3O63A 4UUIA 1JCXA 5HWMA 5CSRA 1ZFJA 1TQJA 4AAJA 1VLIA 3PWAA 3LCHA 1KA9F 3MMTA 1X1OA 3C0JA 3STEA 1YADA 3UQNA 2Y63A 4JTEA 1TTJA 1OFEA 3S1UA 2X1TA 3VE7A 4AHQA 1LLWA 1SZFA 5DN1A 3PBVA 4OHQA 2A5HA 2B4GA 2CLMA 3C2FA 3W1UA 3DH7A 2TSYA 2IQTA 4IGHA 3DXIA 1KTBA 1W56A 4FF7A 3QQ1A 1J4EA 1P0NA 1TPWA 4O17A 3G3DA 1OJXA 3OG3A 4D2JA 1JUBA 3FS2A 4FIQA 4NT0A 3GDTA 4EIVA 5KZMA 1LRTA 3CC1A 4HKPA 1VS1A 4JN6A 2QCCA 3M5XA 2CWNA 1EB3A 3W7NA 2NUXA 4ZQMA 2XN0A 2V5LA 3NZ1A 4KFOA 3NQ2A 3LXCA 3W7CA 2FTPA 1PL9A 3GDKA 3S5NA 3N3MA 1BTMA 3B03A 2C6QA 4O16A 1CX9A 1I2PA 1QR7A 1M5WA 2WO5A
chains in the Genus database with same CATH superfamily
1XCXA 3OLIA 4WX2A 2Y7FA 1OBAA 4G1NA 1BQCA 1UB3A 2QNEA 2X2YA 2Z27A 2ZZ6A 4GI9A 1PKLA 3TFXA 4LY4A 4GE8A 4D6CA 1QHOA 4ADUA 2DVXA 3E96A 4CNPA 4CQBA 3VKBA 1NM9A 5A69A 4YL2A 1E40A 2IKGA 3IJ8A 1VYRA 2XSBA 3N4EA 3WJSA 4UC5A 1SJBA 4ZGYA 4NP7A 1GOKA 1W1YA 3GHUA 4I7VA 4NAEB 7TAAA 4LWWA 4XK2A 1Q6RA 5H1WA 1M6JA 4RZBA 4ZB5A 1E0WA 1L8NA 5TD4A 3GXNA 3EXRA 3MP4A 2Z00A 3D47A 3GNOA 4BI5A 5CLTA 2HWGA 3AS0A 2AKZA 1WKEA 3A23A 4N2YA 4WOZA 3L66A 1UR2A 4Y9NA 5A6TC 5MKGB 1PKNA 2CLHA 4NILA 2QCEA 5I3IA 2A4AA 3H2FA 3N17A 1Y5WA 5HATA 2A85A 4Q8WA 4CKQA 2O9OA 1VFUA 1FWCC 1NQ6A 1VBHA 3CYVA 3ZIZA 5H8UA 2DW6A 3RR1A 1OC7A 3O05A 5AC6A 2VD9A 3KRSA 5EMJA 3MV01 4H7ZA 3DFHA 2PMQA 1AQ0A 3GW3A 1A5AA 3PWGA 3INPA 1SO6A 2QVNA 4JOMA 3GHSA 4WIWA 4Q32A 2O4QA 1U1UA 2YB4A 1OC5A 1FWEC 2W5FA 4N0RA 2PWUA 1WP6A 1JPKA 3VOIA 3HGRA 4EVZA 3USZA 2E67A 3AMKA 3ANYA 2PUZA 2BLEA 4GIAA 4DF2A 2NT0A 1I9CB 1OCQA 4IPLA 4WD0A 2V68A 3WELA 3ONCA 4K7YA 2E9MA 1BG4A 2NVDA 4O14A 3P8JA 3TW9A 4U5IA 3D3FA 1T40A 1W32A 4XD3A 3ZT6A 1PTAA 4GACA 1EEXA 1RPXA 4PB4A 2J9ZA 3CXOA 3LBOA 4J2PA 2AMXA 4UCFA 2XH2A 2L5HA 1J5TA 3WD0A 3AXXA 2PRLA 2PDPA 3G1DA 4H2CA 1W3TA 1F4AA 1J0ZA 4LCQA 4XZNX 1KGXA 4BJHA 3TQ0A 3VDGA 3DHPA 2WW5A 3TJLA 2J75A 4IXHA 2XIJA 3NDYA 2X7VA 3DECA 2UWFA 5IBXA 2FVLA 3VMOA 1QNPA 5BNKA 4B3KA 3V0UA 5I78A 4KPLA 1BKSA 1VENA 2TAAA 1OWQA 3U7VA 1W1PA 3KHDA 4B5NA 2QDHA 3QH2A 4PBEA 1WZAA 4R88A 3MYOA 3TONA 2GDVA 1XV8A 1E0TA 1RXOB 3TNOA 3CNYA 1I0BA 4PMXA 3LBCA 1JRBA 3GX9A 4HTBA 3GH7A 2GDQA 4Y96A 3AYTA 4QCFA 4L1GA 1KBBA 3E49A 3THCA 4IZGA 5A1AA 3FJ6A 1SO3A 3FA4A 4JPGA 2E25A 3BAJA 4OBTA 5REQA 3UESA 4HMDA 3KTCA 1A5KC 3E5PA 3U57A 2XTKA 1ZGDA 4DO6A 3A21A 1WKYA 5AC5A 4FX6M 1JCLA 1KKRA 4H83A 5AYBA 4TUFA 2WSYA 4I6VA 2V63A 2NSOA 3WLOA 1FWGC 1BG9A 1JCTA 4NX0A 5AVNA 4XD5A 1OABA 4GY1A 2VEPA 3G1VA 2F6UA 1EBHA 2YL5A 4DO5A 4HK6A 1TE1A 4W8BA 5FI8A 1W31A 4GO8A 5A5WA 4G7EB 4Q6XA 4E38A 4IHCA 3W3OA 3WNNA 3MQTA 1PZ1A 3RLGA 2F2KA 4D71A 1EC8A 3GNNA 4RX0A 1UZ1A 4PMQA 5LXEA 3CMGA 2FTYA 4PFHA 3C2RA 1G5AA 4CUCA 3ARSA 3O16A 1GOXA 1JL8A 4DI8A 2WVVB 4A3QA 3CTLA 1ZTVA 3WENA 2OQYA 1KTCA 4IIGA 3R11A 3KVJA 4NIRA 3W72A 2PURA 3DESA 1VLWA 3S2JA 3RMEA 5C71A 2OQHA 1WOBA 2PSNA 4CU6A 4MOZA 4N4PA 1W8SA 4KWWA 2VGGA 2ZUUA 1VBRA 2HJPA 4RV3A 7REQB 4PTVA 1MW2A 3WLQA 3UNDA 1BHGA 3TXVA 1RHCA 4DBEA 4J28A 4B16A 1RCXB 3UEQA 2GUBA 4L61A 5G2HA 1Y5VA 2BFGA 4GQBA 1O1HA 2BTMA 1W17A 3I3BA 1RQEA 2HXTA 1FX6A 1TYGA 3PPFA 4Q8UA 2UBPC 3UXIA 1R3VA 1BF2A 1BPLB 2IW0A 1L2QA 3UXAA 4C1NA 2AOSA 1S39A 2FLIA 2DP3A 3KRBA 1XDMA 3OIHA 2NX9A 1K77A 4RXGA 3RCMA 2VR5A 4EXQA 4FB7A 4GJ1A 2PZNA 4JY8A 1JPDX 5DY3A 4PGLA 3LXBA 4W93A 2IXUA 5A6MA 4IP5A 3HG3A 3M7WA 5JH2A 3MUZ1 4AD5A 4HNLA 3A3WA 1RSCA 3L9CA 2NX3A 4NZFA 1GOOA 2WQDA 1KNWA 4L9YA 3GXTA 3WK0A 2Q8XA 3AAMA 1J11A 4UQCA 1Q63A 2BXVA 3OU8A 1EH9A 2A3HA 3GZAA 1XRSA 2Q6ZA 3Q4DA 3W82A 1ITCA 2OJPA 1OFBA 2OEMA 2PEVA 4JKLA 3ZJ8A 3HA1A 4AW7A 3NZPA 3GTIA 2HZGA 1Y5XA 3DG6A 3DC0A 4WJXA 3HTWA 4JIEA 1XYMA 1KXTA 3MWCA 1T8QA 1QPKA 4ACZB 2E7FA 3TYBA 4HN8A 3EOEA 3OZYA 3LPGA 1ZPTA 1W9VA 2Z0IA 1MW3A 5AY7A 1I1XA 4ZB0A 2ZXAA 3G0SA 4Z1YA 2PDNA 3HV8A 3KHJA 4KQNA 1OF8A 1T0OA 5H6HA 4K8HA 3QHNA 3ITXA 1FWNA 4WXZA 1ONWA 4IUOA 4D8ZA 3M4HA 4YCPA 4DJEA 2PC8A 2Q02A 2YA2A 1R8LA 3UR8A 2J8FA 4NZCA 3C2VA 4W84A 5BYWA 4LBUA 2GJXB 2VZTA 3OHMB 2ONEA 4L56A 1V6VA 3CLMA 3BUVA 4S38A 1L8PA 1EP3A 1XIJA 3TJ4A 5CC6A 3RCYA 1TKKA 4DI9A 1Q65A 2PDHA 4FEZA 3VNKA 2YGYA 1SMAA 1QW8A 3WQPA 5T9BG 3RPDA 5BRQA 3WLRA 3MZ2A 1OIFA 3ZLFA 2CETA 1HL8A 3FN9A 4GGHA 2ZXQA 4WGHA 3PG8A 3CWHA 4H2HA 4PODA 4ZENA 4H8HA 2DV0A 1A5SA 3LB0A 2PTWA 3N15A 3D46A 2OWCA 3C3NA 1UOZA 4JNMA 4H9MA 4KRTA 2QV4A 3CUFA 3TZFA 2X7WA 3BCFA 5JH1A 1J0IA 1S2CA 2ISVA 3LGGA 3EWZA 2DZBA 1W1IE 2G8ZA 4FNSA 4G5DA 3CBWA 4TIMA 3E2QA 1NFBA 4GY7A 2A3CA 4HA4A 3QZEA 3HG5A 3SN1A 2XGBA 2OPJA 5CPMA 1QMLA 4PUUA 1Q2SA 3W2KA 1OB0A 4IFRA 3NQ6A 4JX6A 4K6AA 5BXRA 4ML4A 1YEYA 4QHRA 1ZNNA 3LMZA 3MUXA 1SW7A 1ZCOA 1ZY9A 3UWQA 4H6KA 2CESA 1GW9A 4FP1A 4PCSA 3S9IA 1LLZA 4UQEA 4ORMA 5FEZA 1MXGA 3I7RA 3ABXA 1UR0A 1SO4A 2WHMA 2VWSA 1P0DA 3M64A 4GI8A 3UT0A 4GVIA 4O28A 7XIMA 2ZDSA 2YW3A 1LG2A 4ADSA 3OLGA 2FB2A 1DJYA 1OINA 3G6LA 1J18A 1KC7A 4Q4OA 5D2VA 3ZO9A 3WQEA 4B2DA 2CLPA 2E9BA 4RR4A 1OK4A 2OZ3A 3VM5A 2EPNA 1B4KA 1GT8A 2WNNA 3OYZA 2XFFA 3VYLA 5AC8A 2JE8A 2ZC8A 2PGEA 4RPPA 2CWXA 1E1FA 2E8ZA 3URQA 3K4AA 2DIEA 5MKGA 3N2TA 4GINA 1PIFA 2EKCA 3EMZA 3VKCA 1B54A 3W01A 1FHLA 4MB5A 3B9NA 4UMCA 1H4PA 5A6SA 1FQ0A 4J35A 2V2DA 3K5XA 1FXPA 1JZ3A 2WMIB 2Y62A 4GMEA 4TX6A 3CMFA 1YKWA 4JTLA 1TSIA 5EMKA 1GTEA 2HXUA 3IIVA 4MY9A 3R13A 3WJWA 3W6MA 2ASHA 1R86A 5IFPA 3LBMA 1UR3M 3DX5A 3WFZA 2ZZ1A 1AW5A 1NOWA 2XDFA 5EFDA 4ZCWA 5L6UA 2QT3A 1SJDA 3KE0A 4E8CA 1QPOA 4QQ3A 1IT8A 1WDWA 1KM4A 4CLMA 3WQDA 3CUJA 3NO5A 4XBSA 3A5VA 3PBWA 5HNUA 3WL0A 2Y85A 3TEVA 4U10A 3TC7A 3NQDA 3N73A 4H7VA 4E4FA 3G8RA 4CU8A 1QAPA 4S3AA 3R0DA 3OQEA 3MO7A 3P0XA 3WO8A 2DZVA 1JZ7A 3BL3A 1SSDA 3HPSA 4MDOA 5HULA 1D7FA 4M1BA 1S3HA 4F0HA 2XZ7A 3RX2A 1EOMA 2WSRA 1CIUA 3W25A 5BXTA 2D24A 2GSEA 4C6JA 2YYTA 4A22A 4C7DA 4BI7A 2XG9A 1US3A 4HBKA 3HN3A 3VIKA 4HIBA 3EPMA 3KDOA 4W89A 3EKZA 2D1ZA 4AX6A 4QEHA 2AMGA 4AHPA 4IJRA 5FIPA 3W37A 3FA3A 4BFAA 2Z4GA 3SR7A 2P8CA 4US5D 4V27A 1A49A 3A64A 3M6YA 3RF9A 2VVSA 1DWGM 2YR1A 3P5ZA 1KBIA 1SW0A 1ALDA 2TODA 1DOSA 3W81A 3VKDA 3ZR6A 3NCOA 5FF0A 2BY2A 1FKWA 1E5NA 3MKVA 1QI5A 3EEZA 1EEPA 4QRNA 3AJ7A 3V1HA 3IJDA 1J96A 3C61A 3ATZA 3NAVA 4KESA 3WBWA 1XBZA 4DYKA 4BWLC 1XLMA 4CQAA 3QY8A 3PAJA 3E74A 4FZIA 4Q8PA 4WDTA 3G77A 2NUWA 1R3SA 3OBAA 1H7OA 1QI3A 4PUEA 1A4MA 2OGJA 3MSYA 3VIFA 1WDDA 1QNRA 1UC4A 4PCPA 5J8LA 3POHA 1TPDA 4L4PA 4HCHA 1MWOA 2R1LA 4DBSA 3UG3A 1CGTA 3FXYA 2E4TA 1YNQA 3I7QA 3W84A 5DRCA 4PMYA 2EKGA 2ZZ4A 2VEIA 3H24A 1DORA 1JDCA 2H6RA 4KCTA 1E5JA 2J7DA 3RNDA 3UW6A 2PCEA 4NXSA 1TUFA 5K3VA 3HPAA 4GVGA 1I4NA 2JQXA 2CZDA 4QLJA 2CCRA 5E0KA 1P1XA 3POCA 4WSKA 3GC2A 4HCDA 3O15A 4BWLA 3PK7A 1NH6A 2VT0A 1XLJA 2F61A 2G3FA 3O6CA 4CCEA 1H51A 4AZ5A 3FK4A 1K7XA 4PE8A 3B40A 1JPMA 1J0YA 2QPUA 4UNLA 1K8YA 4DAIA 2Y2WA 1GVSA 2Z1BA 4REQA 4UFMA 1U83A 4IQEA 4DBUA 3A22A 1GPWA 3W76A 3OGVA 5TAOA 1XLFA 1IR2A 1IEWA 3CAVA 3CV6A 1K4HA 4WKHA 4GD0A 3OW1A 4QLLA 3GC5A 4ASTA 2D69A 1E6RA 1H41A 1XLIA 1F4HA 3E02A 5FAGA 4O19A 4AEOA 1FWTA 4GNVA 3WJZA 2BNJA 3SFKA 2ISFA 2BOFX 5DLCA 5I3FA 4GOAA 1EWDA 3NQEA 2CXGA 4EF8A 4LUSA 3GU9A 2G3MA 4CD7A 1XM3A 1T7LA 3GVRA 3ARQA 1S5VA 4LU0A 3T0BA 2I14A 3VGGA 3VC5A 3MVTA 2V3FA 3RM4A 2DZTA 3GYCA 1JFXA 3RIKA 2O7QA 2G4JA 3N25A 4JBRA 4CNOA 4JZ5A 4UWMA 3NQAA 3RRXA 1XDJA 3JRKA 1GVOA 5AKQA 4GX9A 3ATYA 1LOQA 2UY4A 1S38A 1W54A 2DZWA 4CN6A 4L1WA 1RZMA 1F6YA 2B7PA 3GIPA 2HSAA 1RAKA 2YLLA 3AS1A 3FDGA 2XIQA 4DPQA 3THAA 4J3TA 3PTDA 3TWAA 4FPSA 4D6HA 4V33A 3ZJKA 5AECA 1EQCA 3UZ5A 1YNYA 7TIMA 1Q5MA 1UKPA 1TZ7A 3RPTA 4B4HA 1R3RA 4UTMA 3NURA 3BG9A 1LRNA 3WDRA 2GVEA 3EWXA 3W1LA 1NDYA 1GYMA 2ZYFA 2WVUA 4MZ8A 3TOYA 4U33A 4PRTA 4GLEA 3L68A 4ZBCA 1ICSA 3KEHA 2EO7A 4KIRA 1TMHA 1F74A 9XIAA 1R47A 4UR9A 4C90A 5I3GA 2REQA 1S1RA 2VDHA 4WUIA 3LCIA 3CT2A 2Z1KA 3BE7A 1Z6KA 3R6IA 3HF3A 1ITUA 4IIFA 4A8IA 4D6JA 4FOUA 4FS9A 1TREA 4PC8A 3ZVIA 2D3LA 4HJWA 3ABZA 2QAPA 1IGWA 4EF9A 3IVUA 4DUWA 1W5PA 2PPGA 5EYWA 4GJJA 3H2CA 2EJAA 1BEUA 5BMWA 1P0KA 2HDJA 4MB4A 3M0IA 3V1PA 1XBYA 3F2BA 3NUKA 2HCVA 5CJNA 3P84A 3WQ6A 1O5QA 3SCPA 3MT1A 5H8PA 4CNTA 4S3EA 4HZ7A 4XBKA 4LAMA 3GVVA 3BAYA 4YWSA 4G56A 1CW2A 3N2MA 1LQ0A 3CPGA 5DT7A 4KETA 3IUHA 4WSJA 4PZVA 5HWNA 3TAKA 3NNTA 3H4GA 3VDAA 4UTWA 2PDCA 5D9MA 1KXVA 2EF9A 4XVDA 2IPGA 4Z2KA 2CW6A 2REQB 1C90A 1TWDA 4JEJA 5TQLA 3LHZA 3W1XA 2WCSA 4EXAA 3PM6A 3A47A 4GFSA 3CT7A 2A6NA 3ES7A 2ZA3A 3ITTA 4KS0A 2VVNA 5CSUA 4LAKA 3MVIA 1JR1A 3KOFA 2X0YA 1KWKA 4Y8FA 1A53A 4N9DA 3ZLGA 1ZP4A 1SVDA 3FAWA 3TLQA 3WLSA 1BD0A 3WFLA 4YN5A 1RA0A 1HG3A 3I10A 1R9ZA 2XVLA 4MKVA 3VOHA 3KRUA 4Y9MA 3RM8A 3YPIA 4HK7A 1EO5A 4GUIA 3ZMRA 4H01A 1VJIA 2DSZA 4JS3A 4RW3A 3T9PA 1ITQA 3ARXA 1IF2A 2F6XA 3AUOA 4UZSA 3EXSA 4U4MA 1WZKA 3PBYA 5K2ZA 1V93A 1C3FA 3QPYA 1XI3A 1J0KA 4PMVA 1NWTA 4H00A 3EX3A 3DKLA 2ZADA 1OFQA 1V6TA 4DJEC 1Q8AA 1LOLA 4B2DD 4IISA 4UNIA 4WCJA 8A3HA 1ZJAA 3MBFA 3H2AA 1W3JA 3KXQA 3KVMA 3RGTA 1DQWA 1POKA 3R8RA 1WXYA 4DM2A 9RUBA 2P53A 2J7HA 4HN4A 1TV3A 1LM1A 4NRRA 5A2BA 4HZ6A 2OYMA 2DSUA 5A94A 3R12A 4LEFA 2V30A 1KQYA 1O5XA 4HMNA 1AJZA 1ESWA 1R2TA 1XLLA 3R89A 4I5RA 4Z2GA 2A1YA 1HZYA 3OBKA 2F38A 4I7UA 4ZQCA 1ZBVA 1UKTA 5DF0A 1LG1A 3WQOA 3KVKA 2WVTA 1KM3A 1J5SA 1KB3A 1ZQ5A 3B8DA 3GO2A 1G01A 3QKZA 1OFPA 1YYAA 4ACZA 3APTA 3L2LA 2CLLA 4HU4A 4UQ9A 1U30A 3ALFA 4IL2A 2FZDA 3UWWA 3C2EA 2JFEX 1MRQA 3IJ9A 4A8NA 3WUFA 2XYLA 4IXXA 4QE5A 3NZQA 1R3TA 3GAKA 3N9RA 3AALA 3V75A 5IHRA 3QC3A 2TRSA 1ZL1A 3LQGA 4CVUA 1Q6GA 4LV4A 1XKJA 4MPQA 3QGVA 2PWEA 1Z42A 4FALA 5K9XA 2PDJA 3NQ7A 3CB8A 3BWWA 3R5EA 4MG4A 1XC6A 2GYIA 4YTUA 3WMCA 5G1MA 1XIMA 3F4NA 3N2OA 1T99A 3W1TA 4Y6GA 5AYIA 2FPYA 2QZRA 2OT1A 4DN1A 4XB3A 1KM0A 5DELA 2XWEA 4HHLA 4UFHA 3WQ4A 3ZR4A 4RUBA 3QFEA 4QE4A 2Y8VA 2GUYA 3NSXA 1DE5A 1PIGA 2D73A 4CD5A 2DVUA 3SQMA 3RN6A 1QASA 4N9BA 3PTQA 5HANA 4AY1A 2PTYA 4U28A 3MS8A 3KWXA 1C9WA 1TCDA 1XFBA 4NAFA 3RAOA 3VDHA 3KS5A 3O1NA 5CZSA 3UWVA 3B9EA 3E2SA 4IP7A 2BGNE 3BLLA 2PP1A 2ZBTA 4B4FA 3G8EA 3LM7A 3M1ZA 4GPNA 2XGIA 3SY8A 3WEMA 5HR6A 3VO0A 4H6RA 1V0KA 3W86A 2I5IA 4PUNA 2WNWA 4ROPA 5LA1A 2BY3A 2HEJA 3UG5A 3URBA 2O92A 4FI4A 4Y9PA 2QR6A 4TVDA 5JBDA 1VFLA 3CQ0A 1TZ9A 1FWIC 1ZBCA 2EEXA 4P7LA 4HNNA 1QNOA 2Y4SA 5FJOA 2I7GA 3W00A 3NL5A 5D37A 5J04A 1SJAA 1FH9A 4HZMA 1IR1A 1FDYA 4D6EA 1A3WA 5GJMA 4B91A 1ZP3A 2VD8A 4Z2IA 2V5CA 4ZZ9A 1QU4A 4YTQA 2NXGA 3W73A 1WOAA 2DSWA 4QM1A 1EJVC 2VFHA 4NNCA 4GRSA 1AJ2A 1E6SM 5G5IA 1VAHA 3LXAA 1CDGA 1UD8A 4RDZA 3AIVA 3ONBA 4DJDD 5M2FX 4O53A 3DFQA 3U4AA 3EX2A 1QFEA 4OVXA 4DWSA 4ATWA 2C13A 1X7FA 1PZ2A 4RNHA 2DT0A 2W67A 3AU2A 2ZUNA 1KFJA 1DWFM 1G4PA 2YL9A 4XAPA 1XBXA 3PULA 3EWCA 3B8SA 1UR8A 3E0VA 1KR1A 1H0GA 3V5CA 2E6FA 1EPXA 1I6NA 2D22A 1JIBA 3FYPA 4GUGA 3KL3A 4TXEA 1MFVA 2WOQA 3PFRA 4GZJA 1CGWA 1KCZA 1KM2A 3WLNA 4KRUA 4LB3A 5M1TA 3SSZA 3W2MA 1FY6A 1KGWA 2MNRA 3M0KA 1RV8A 3VX1A 4CN1A 1AMKA 2QUMA 2FHBA 3SUVA 3RG6A 4JHMA 5HWJA 1KD0A 4E2BA 4HB7A 4DJFA 4E0CA 1LLOA 3PF3A 4O12A 5HUOA 3MI3A 4X61A 1YHTA 4BEQA 1FFRA 3W2UA 3TNBA 5LIUX 1FKXA 3TDFA 3RU6A 1B9ZA 5LIWX 1XFCA 3TN3A 4WJEA 4N7QA 2ACRA 2G4FA 3VIOA 3LA4A 3E0FA 3T42A 1JCYA 2J7BA 4XO7A 5JQ9A 2NXIA 3VZYA 2B7OA 4U2YA 3KOYA 2ICSA 4F0LA 3ELFA 4S3DA 1FP8A 3FSTA 5GPRA 1VLIA 2QULA 4AC7C 3Q67A 4IJCA 2YZ5A 4OFCA 4OZOA 3SCOA 1YADA 2Y63A 5CJMA 4XISA 1TFVA 1TTJA 1C7TA 1OFEA 1LLWA 5DN1A 4PUMA 2WM0A 7ODCA 5ABEA 2BHYA 4JAWA 3DH7A 4G6CA 4XX6A 3EMQA 4IGMA 4FF7A 5EBAA 4RDWA 4IICA 4O17A 1HJWA 3OG3A 3FS2A 3GDTA 1EPVA 4HKPA 1ZSXA 2QCCA 3PPCA 3S2MA 2NUXA 4L65A 4DUOA 3NZ1A 1UOKA 4A6GA 2RAGA 4KFOA 3GTHA 5DMNA 1E3ZA 3IUDA 3V4BA 4HU0A 3B03A 1V6UA 1V3MA 1XISA 3P0WA 3AZTA 3UETA 2XGZA 5DBTA 1E9LA 3XIMA 1IT0A 3M47A 3VD9A 3SCNA 4ES4A 3QW4B 4QDMA 4DNHA 1CLKA 2HK0A 2YDSA 2E1DA 2QCGA 3I3DA 1YDOA 1R5YA 4OBSA 4JHOA 4WEVX 4I5XA 1HT6A 3P80A 1V0LA 2QF7A 3T05A 1PX3A 3MZNA 3PFMA 1GWJA 3L4ZA 4QAIA 4JTAA 4OECA 2IPJA 3N4AA 3SI9A 3MHFA 2MANA 3ARWA 3IIZA 2IPFA 4IMAA 1S2WA 1NTHA 4H1ZA 4UTWC 1XLCA 1H7RA 1JD7A 3VCRA 2HK1A 3CO8A 4UMAA 1AJ0A 4JIQA 3GVWA 4GZIA 1Z3NA 2B0MA 2LLEA 4AVNA 2F84A 4OUIA 4PMOA 3ANVA 1ISZA 4M6UA 2EPMX 4PCNA 2GJXA 4KGLA 3PZOA 4WDUA 3WDJA 4D6GA 2F2HA 2GSJA 3WH9A 1E9IA 2DSKA 2ANUA 1EUNA 4UTHA 2R94A 4IMGA 3FX4A 1TPC1 4TOQA 1HNYA 1XGZA 1DIDA 5BROA 4L4OA 3CASA 3MKKA 3IK2A 4ZR8A 3PNZA 2E3ZA 1XLKA 4XD6A 1PZ0A 2CHOA 3M0ZA 3K1GA 4W86A 3WCZA 5F1VA 1ODZA 4B5SA 4HOWA 1Q66A 2VOMA 5DXXA 2DH3A 1HP4A 4QJ4B 1F9CA 1WB0A 2RHGA 3DYPA 5EMLA 2EJ1A 4Z08A 5J5RA 3OIXA 3H6OA 4FHAA 4XUGA 5M17A 1SFJA 3WFAA 3D5HA 5I2UA 3AIEA 3C5QA 4AZCB 2DT1A 3H21A 1XG3A 3QV7A 1SU5A 4P8VA 3IVSA 2J88A 5A2AA 3H12A 3RITA 2WC3A 4XD4A 3W1QA 3W1RA 3WDHA 2V8ZA 3GTFA 4GVHA 2QJHA 1UBPC 3KBMA 1QPNA 3AO0A 2Z28A 3IGSA 2OX1A 3IIXA 5HQMA 3M0MA 4F0KA 3RU8X 5CSSA 3GW0A 3M5ZA 1DIKA 4UTJA 1ELSA 3CZKA 5CPQA 3GXIA 1OIMA 3FGCB 3HQ1A 3G1XA 4XKYB 3ARRA 4E5TA 5A8MA 3R79A 3OG2A 1GZ1A 3B9DA 4UZUA 1VCGA 3MUIA 4E3VA 1BWKA 2CLIA 3PN8A 1CGYA 4D72A 1UA7A 3IJQA 4QITA 1V8EA 3M7SA 1TWSA 1A5CA 2CBUA 3L2MA 4WLCA 3W26A 2G95A 1HF6A 4KCWA 1GUVA 4LB4A 3W29A 1E1CB 3IRDA 2X2GA 3UR5A 1O5KA 1W1A1 4M82A 1XGDA 5HQEA 3E0IA 1BYDA 4P7NA 3BDKA 1GOIA 1WX0A 2KZHA 1K9EA 2PRMA 3VCCA 1KBKA 4PULA 5FEPA 3Q65A 3NSNA 2OXNA 2C71A 3CUZA 4HHHA 1O60A 1L6FA 2ZCGA 4GUJA 3ZZ1A 5T26A 2GSHA 3A3HA 5E5CA 1Z9AA 1CXHA 3VTRA 1V6XA 2EPLX 3UCQA 4QSHA 3WNKA 1E43A 1LUCB 3SCVA 5LNRA 4U3CA 5LNSA 1JG9A 1UMYA 5FJJA 1CEOA 3OHIA 2NV2A 3LNPA 3NL6A 3WLTA 3PZNA 2D2JA 4GC4A 4IQJA 4JTJA 5EA9A 2VGIA 4P8WA 2OOFA 3LSCA 4B3ZA 4O1BA 4XSLA 1PS9A 4GYKA 3ZS4A 2NUYA 3ANUA 2D2OA 1H62A 3IIPA 4LYRA 1Y65A 1SZRA 1B5TA 3LHYA 1YMYA 1VFFA 2DJXA 4C6QA 4W88A 1WZMA 3VNIA 4UOJA 3IACA 2YW4A 1B57A 1YDNA 3S0CA 4NAFB 1JRCA 4QIUA 1O12A 1DJNA 2BX7A 3NVTA 4JQ2A 2CHRA 2E8YA 4JTUA 5CZJA 3AHYA 3KBNA 5HINA 4N9CA 3XINA 3UXDA 2P0IA 1F6KA 3LYEA 1QBAA 3ARTA 1IZCA 5I77A 4NF7A 3O7UA 4IH3A 3T08A 3GKAA 2ZA1A 1AH4A 3G22A 5KMYA 2RDWA 3WLIA 1SYTA 1B3YA 3LLXA 3MUCA 1HTIA 3N34A 3NIYA 1R46A 3GXMA 3N9SA 4QG9A 3FYYA 4OTKA 4F2BA 1NFGA 3DC8A 4IWWA 1NOFA 3KLLA 4M7TA 2JK2A 1VQTA 2WJDA 2W91A 2QUVA 1R87A 3AU6A 4RPQA 3R4IA 3MWAA 5B7YA 4TU1A 3VD3A 3PBMA 1PTGA 4GWEA 5FA5A 3ARVA 2PODA 1IIHA 5HBFA 3SW6A 4JFSA 2PA6A 1FWFC 2AL2A 2HV5A 2CBIA 3DHDA 4Q4QA 1FWDC 1YLVA 4G7EA 1RD6A 4QNWA 4AY8A 4YVXA 4NNBA 1JI1A 3GXDA 1HVXA 1C9DA 4RCXA 4LUTA 1GKQA 3LHUA 4LAUA 4EKJA 1LDCA 4WDXA 2G96A 4MWAD 1NEYA 2C1IA 1JZ2A 4JQ4A 4K8EA 1NFPA 2GGGA 4RXFA 5HJYA 1BSIA 1EFZA 5F4WA 5HQLA 4JIPA 4K37A 3HFYA 7A3HA 2DFAA 4YPJA 2ZQ0A 1R3WA 3RR4A 3T81A 1PAMA 2R1PA 3QV9A 2RJHA 1BRLA 4LS1A 2FDMA 3CZJA 1M68A 4DXKA 3M9YA 1VF8A 4JTIA 4XZIA 1UD2A 3MSGA 3MP5A 1V3HA 1KCXA 5GNYA 1KFBA 1PWMA 3VZZA 3VU2A 3CH9A 3LD5A 4WHBA 1NDWA 2WMJA 2ACQA 3IIOA 5ECUA 1C92A 4N4QA 3QR0A 4XZBA 1NOUA 3QHOA 5CSYA 1TV2A 2BHZA 4GQQA 1NP0A 8XIAA 3WK2A 1MEIA 3MPGA 2CEQA 2P8BA 4KKXA 3TYZA 2HVOA 3GNXA 4ZMGA 4Y90A 1LQAA 4E6MA 3TSDA 1W2PA 3VIHA 3VXGA 3LHWA 4ECLA 3O9NA 3TTSA 4MM1A 4FIRA 3ZFHA 4AISA 2W92A 2C7FA 4NHVA 1JQVA 4DWDA 3IEBA 2Y6ZA 1LROA 3NFUA 4IFKB 1PB0A 2W9MA 2EGZA 3ZR5A 1B3XA 4MUZA 2I16A 4O50A 3TCSA 1EIBA 3N2CA 2EHHA 2CLKA 2J9XA 3TUUA 4I9MA 3ORWA 2ISDA 3DZ1A 2OODA 4POCA 4CCDA 2CFFA 1ME7A 3BOFA 3PJXA 1CZ1A 1M7XA 2C15A 4RLIA 4Q6JA 1A5OC 3U2EA 4KWVA 6XIAA 2F8QA 4F2TA 3QFWA 2DPEA 5F2LA 2YFOA 1RCOB 4AZCA 3QQWA 1W9BM 1N2VA 3F4VA 3CIWA 2WK2A 4O4WA 1H61A 1M7PA 3UYCA 4LF2A 1UD4A 4UTIA 5BWFA 1XH1A 5DCDA 3CQJA 4H04A 3PS7A 1TJRA 3A12A 4GQRA 3R8GA 4I3GA 1HGWA 2J6VA 3KP0A 2QCNA 1XS2A 3FJLA 2PP0A 2XH7A 1KQZA 1QNVA 3DI0A 4NKCA 5I06A 1VH7A 1IEXA 3NXLA 5CPTA 3CUHA 2DIJA 2FGBA 5LGZA 1GTHA 2XUCA 1JZ5A 1SPQA 3RPMA 3PZIA 4XQ6A 3CWNA 3V0TA 1RUSA 2HVNA 2WHJA 2V82A 4U3AA 1IEVA 2CZVA 3QRHA 1GZGA 4WY0A 3AYRA 3ZQ9A 1AZ1A 4S3JA 3IVTA 1VFTA 1LWHA 4ZSTA 4LUSB 3FHAA 1U5VA 1PO9A 3DERA 2GPTA 2PTZA 4ACYA 1KRCC 3MJMA 2Y89A 1TPH1 1Y7VA 1OGGA 3PTKA 1YPXA 3R0KA 5A6BD 2WSKA 3EWUA 3LENA 3AHVA 3MSDA 3W07A 2ZXBA 2QUTA 3PUGA 1I45A 1OX6A 4X0NA 2VR4A 1I8JA 2DZPA 5EGRA 2OSYA 3WD4A 2PZ0A 1ZALA 2QHAA 1QPQA 4AZIA 3QGKC 4HD5A 3VKJA 4ZODA 3LGEA 3VNJA 4Q4RA 1TMQA 3G5EA 3U2CA 5E93A 3DFNA 1XPYA 1JPIA 1CNVA 2A2IA 4GNKB 3S1GA 3UPWA 2PCQA 2FB3A 3VNLA 3EDEA 4P7RA 1W5MA 3RILA 1QATA 1JUEA 4O1CA 3TYAA 1GQIA 4MTVA 2Z6IA 1KCKA 4LVAA 3C2OA 1MEWA 3RX3A 1HO1A 1MDLA 1FH7A 1EKOA 4GXWA 4YTRA 3WH8A 1FCVA 3V7PA 2ZWYA 1E9YB 3VNYA 1WUEA 2XN1A 4H9YA 1QW9A 3A4WA 5BZAA 2BY1A 2WWCA 4F2UA 1B2YA 1A5MC 1AW1A 1IEQA 4PTWA 2VO5A 1XIIA 4BI6A 3IJLA 3EB2A 5K4XA 3WEOA 4ZOAA 3GNRA 2VXNA 1IZJA 3B0YA 3W75A 3TN4A 1RQHA 5C7VA 3NDZA 2IXVA 4M51A 1FWWA 4CEXC 3TR2A 3QYQA 3OZMA 1Q85A 1G4EA 3DKJA 1X7IA 1V5XA 1GJWA 2AGKA 3W24A 4XWUA 1PXGA 5HNNA 4A8RA 4I6KA 1UKSA 5F2MA 4D6FA 2QJGA 4LOCA 4DZHA 3UZZA 2CKRA 1X6NA 1AL8A 4FLRA 5ABGA 3RJXA 1CCWB 1W2VA 3CQKA 1PZ3A 1F61A 4O54A 1MW0A 2X8RA 1NF0A 4JIRA 1TUXA 4ZO7A 4OT7A 3IJ7A 4K3ZA 1SR9A 3R7MA 4BQ2A 4MGGA 4A05A 1W9PA 1YE4A 3WDPP 3LMYA 1E0VA 1B3WA 1M1BA 2VRKA 1OX4B 1ADDA 2CNCA 4PRRA 4GXMA 3K4DA 1NDZA 1JCMP 1P4CA 1YQ2A 4AMCA 3F4WA 2WVSA 1DP0A 3QMSA 3W53A 2IKHA 4C5YA 4CNSA 3L4VA 1Z44A 1R85A 1F8MA 2V2CA 3WNLA 2PDUA 3CEPA 3FHQA 1H0IA 1E1EA 4AVOA 1D2KA 4LY8A 1GJPA 3FLUA 4HPHA 4FOJA 3KBWA 3TKFA 3PSWA 3QPEA 2O55A 4AVFA 4GK8A 1A47A 3MB9A 3EDJA 1TX2A 4FLQA 1BWLA 3VX0A 1XWYA 1G9HA 5EMMA 1ISVA 4C6LA 1UD3A 2DSVA 2VENA 3CZ8A 3BTNA 1W9XA 1RP8A 4XSMA 2PTDA 4FXRA 2B7QA 2X42A 4MY8A 3BZGA 3WNPA 2C14A 3L0GA 2ISSA 3RLUA 1OG6A 5BCAA 5RUBA 4R7OA 4GKTA 2PDBA 4XVEA 2CLFA 4IMFA 2G97A 6REQA 2QCDB 4IQLA 2BY0A 2A0NA 2Y7GA 4QR6A 4BA0A 4P2VA 3RXZA 4ZA0A 4BS0A 1Q7QA 3H70A 1WDQA 4S3GA 5D33A 4E8GA 3STGA 3GH5A 4IFKA 1S5MA 3AICA 3MJYA 3FV9A 1D3GA 4O0KA 3N29A 1Z69A 1FP9A 2IKJA 5CG7A 4LCRA 3AI0A 2INZA 2R91A 4ZXLA 4JL1A 4DJFD 2B81A 1FWAC 5JIWA 3DG3A 4LVFA 5KZ6A 5BOOA 3AXMA 4O8AA 3AIUA 1GKPA 3VD4A 3EMCA 4FSAA 4C60A 3KBSA 4JTDA 2IPWA 2P10A 2P3EA 2VCBA 2ZA2A 1E0UA 4QTGA 3CPUA 3VIJA 2JGQA 4XKMA 1E51A 1UROA 3EPOA 1TJ1A 1OYBA 2UY5A 1TG7A 1VC4A 3QY7A 1J6PA 2ABAA 4AB4A 2C3ZA 1UUQA 1JZ8A 3RM9A 1ISYA 1XIBA 4CEUC 4WKAA 2CYGA 4J3SA 1R6WA 4EWND 3DI1A 2Z2AA 1K02A 3NQCA 3B0XA 4TV6A 4CCZA 3WDQA 1MDRA 3GG0A 2BB0A 2YXXA 3N1AA 1IGSA 4ZTXA 1BVWA 3T40A 3P67A 1EA9C 1H1ZA 5KETA 1VEMA 3VC6A 3KL5A 3AXIA 1TWIA 3BW3A 3ZVHB 2QPSA 1O4UA 4CNUA 3SQLA 3H4XA 5DRIA 3D6NA 3C8NA 3HIJA 5C2XA 2ZVIA 4YLWA 1XCWA 3EB4A 1LWIA 2WCGA 3BMVA 1XP3A 1G6CA 2NX1A 3T09A 3BLIA 3RCNA 1JF5A 2ZOXA 4OKDA 2OMAA 3UZWA 1G1YA 1Q6LA 2ATSA 4ZVJA 1JUKA 2FFIA 4RKAA 1I2QA 3GSMA 2QCFA 1F3WA 1K6WA 1XUUA 2RGMA 3N2XA 5HK4A 4OV4A 5DO8A 2RKXA 1RA5A 3QEZA 3TK7A 3GFXA 4FX8A 3O8AA 2XVNA 2WKLA 2P1FA 3IK4A 1W3HA 3MW7A 3BLFA 1ZUAX 3K4WA 1OHLA 1H49A 1YIXA 4C65A 3BXWA 1AK5A 2HVMA 4B90A 4AHOA 1K4GA 7REQA 5I3KA 2UY2A 4ZSUA 4AXKA 4EP8C 3S6TA 4RV8A 3RUBL 5CBIA 3GNDA 4H8NA 3B4YA 5G4HC 3BGAA 3BGGA 4YTSA 2OZTA 3W6LA 1WXZA 1FFQA 4Z2HA 2V69A 1EJWC 1U22A 4S2CA 1K9TA 3WLJA 1P7TA 4WY0F 2BWGA 1Z41A 2HBVA 1B1YA 2W79A 4UTTC 3WH6A 3VUPA 4GH3A 3AHZA 5A8NA 2ZUMA 5A8QA 3KP1A 3ITLA 1DXIA 3W7IA 2J8TA 1FHUA 3B04A 4QSFA 4DB7A 4GYPA 1RP9A 3P82A 3PB0A 1X8CA 5JBEA 5MF5A 1V77A 3WBEA 1LRQA 4M19A 4AIBA 3AJXA 4MZYA 3GIYA 4C6FA 4LVGA 1DWHM 1OYCA 4GCAA 4L5ZA 3AHXA 4A2SA 1H7XA 3PJWA 3T7VA 1RLDA 1J2BA 1ONRA 3WLPA 1KRAC 1SGJA 1E72M 3RFAA 4OV9A 4GY0A 1BSLA 2FPVA 2PU0A 4KEZA 3L4UA 3AIWA 3DHUA 4TX8A 3W1PA 2OG9A 5C2GA 4IMEA 5HR7A 3QVQA 1NY1A 2ZWZA 3I4KA 4JNZA 4XV0A 3VIGA 3ICJA 2BODX 2VC6A 3SGGA 1IQ8A 4JGDA 4NZ1A 1FHDA 1P0BA 2GJLA 3H55A 5I09A 2ALDA 3H22A 2PLJA 1DJGA 4JTHA 1YE6A 4J3XA 3QOKA 4KERA 1B31A 4GYFA 3OVRA 3ZWTA 1Q7MA 3AMLA 5LA2A 3B05A 5LXXA 4FF5A 3GUGA 1QO2A 2WPBA 4HYWA 1CXIA 4DUVA 2YB1A 3V16A 4FXJA 1HW6A 1WA3A 1L6SA 2E28A 3SURA 3AOFA 1EQPA 2WSPA 4AZGA 2PAJA 3SY5A 3S6OA 3EOUA 3L0KA 1RJQA 1GOWA 3APGA 3DUGA 5D2YA 3EX4A 3R8HA 1XXXA 5F4XA 3HGSA 4MKNA 1XUZA 3QYSA 3AZSA 2GQ3A 1TIWA 3VNMA 2P76A 1M7JA 3GNPA 1OGSA 3MI6A 5D03A 3GKFA 5C9WA 5FCZA 2WLYA 3PUDA 5D30A 1JGIA 2V5KA 4PTDA 2E6AA 5IHSA 4RJEA 4GZEA 1XIGA 2EG7A 1V0MA 1B9BA 1IXNA 1XLHA 5E9XA 1UH2A 2GOUA 1DTNA 3DU0A 3U2ZA 3M41A 4I9TA 1SMDA 1MUMA 4GCXA 4EACA 2D0GA 1ZHAA 5I79A 3BVJA 4W7VA 4GHRA 3BLKA 3EB3A 2XJ7A 5KSWA 4O1FA 2WJFA 2XSAA 3W7MA 3ERPA 1CGXA 8TIMA 1SZEA 3W88A 5B80A 2VRQA 3P93A 3AMDA 4DPPA 1EA0A 2QCHA 1VZWA 3E0WA 3VMNA 4AG0A 2QCDA 1W3NA 4K39A 3WK1A 2GUUA 4D8AA 4ZFCA 1LOSA 2ZX7A 5H2ZA 4H9TA 4TV5A 4AWUA 2PLKA 5A8GA 3DEQA 4BCEA 5EMUA 5LIXX 4JHZA 1H3GA 2WB5A 2QJMA 2CPUA 2Z26A 2VC9A 4R27A 3SCRA 5DBUA 3M0HA 3VGEA 1RBAA 1FDZA 1IXPA 3F5JA 3UWUA 2GWNA 1LT8A 4Q7NA 1XQKA 2BXYA 3GBEA 2XU2A 3WKZA 1XF0A 1K1DA 1T96A 1DXFA 3NQVA 3TA9A 1OM0A 2H8ZA 4DWSB 3P74A 2Z1VA 3HQPA 5I0DA 4TX9A 2PGRA 3VGBA 2GVLA 2ZRZA 4MIMA 1N7KA 1QK0A 1TJ0A 2FQIA 4C6KA 3PZVA 1OCBA 1C93A 4EPBC 4A29A 3TVAA 4ZEPA 1CXLA 1X98A 2YL8A 1UPMB 2CERA 4PYSA 2YA0A 2PGWA 4O57A 4M80A 2Z1XA 2E6YA 5FF7A 2C18A 3N19B 1WAUA 1Z48A 1IHIA 3JU2A 3MCOA 1YBQB 2VJXA 5CBJA 2O4MA 1OADA 5I5RA 1MVYA 2ALRA 4MB3A 2HQAA 1OCJA 1V08A 4LANA 1MNSA 4HQVA 3OVPA 2DJLA 4DF0A 5GQBA 4MWAC 3IJIA 1E15A 4CD8A 3LK6A 1EGVA 1PPIA 1VFHA 4HU8A 2VTFA 5D38A 8CGTA 3CV7A 5CPNA 3VILA 5HNRA 4BHYA 4I8DA 2A3BA 5FSEC 3KZPA 3N9KA 1GEQA 4D9PA 4AIOA 3GVQA 1AH3A 1L6WA 3N04A 3MSRA 3AXKA 3TH6A 4BR1A 1WXJA 4J2MA 4AD2A 1N8WA 5F2GA 2Y8KA 3MDWA 1XKYA 1WDRA 3RK8A 3GIQA 1KFWA 1FCUA 2DW7A 3VABA 3QMRA 1L0PA 3CWOX 4DF1A 3PY2A 3BOLA 4IG2A 5CAKA 4YMZA 1EP2A 2XHYA 5D4YA 3WH7A 5HPOA 5C7HA 4Z1CA 2XM1A 4LEQA 5K9CA 2HS8A 4PB3A 2VX5A 4KT2A 3HMCA 3HGOA 3N6JA 3SCSA 1EX1A 1UWAA 3BLOA 1EHNA 3LU2A 1ISXA 1CGVA 1E0XA 1HX0A 4LAOA 3M5VA 2ESCA 1GQNA 3UWYA 3HZ3A 3RMJA 4QG6A 1R9XA 3TU9A 2FHFA 3T1GA 3A4AA 3BAIA 3TLLA 1A0EA 3RRAA 2DDXA 3TWBA 4MMWA 3FKRA 3CU2A 2RJGA 1QI0A 1UMLA 3AFBA 2ZZ2A 2X05A 1U5HA 3QW3A 3C0LA 3A4JA 2WWDA 1EX5A 4UBPC 1DL3A 1JYNA 2YKKA 3PZ9A 1FWJC 1YDVA 3DFTA 1KRBC 2V6AA 4NU7A 3IWPA 3U7BA 4A3HA 2NQLA 4Z2LA 4YYFA 4K8GA 1V7AA 4Z1AA 5BW6A 1W3IA 4UUIA 1WUFA 2QDDA 3KUMA 4JIHA 5D8WA 2OSXA 3UJEA 3LCHA 3MMTA 3C0JA 4DM1A 1NQKA 3STEA 3VD5A 4B5XA 4LUYA 3UQNA 1QK2A 4JTEA 5I00A 2VOTA 3F5LA 2DQXA 2X1TA 1SZFA 1EGZA 1QOXA 3PBVA 4OHQA 1U33A 4GABA 3C2FA 3FJ4A 4H9UA 4L9ZA 1F07A 1Q6DA 2GWGA 1FA2A 3DXIA 1W56A 4IGHA 3QQ1A 3GG7A 1X39A 4M3PA 1OJXA 1JUBA 4RL3A 1F3EA 2EG6A 4NT0A 1XH0A 5KZMA 1VS1A 2GZXA 1MI3A 2IMRA 3WQFA 1K9FA 1KBLA 1TWWA 3SRHA 1QXLA 3L23A 1TE6A 5E9AA 3AIBA 2FTPA 3S5NA 3LM3A 2WKGA 1P1MA 1ZU8A 2WYSA 4F40A 3EOSA 3B0PA 5CC7A 1EO7A 2QJJA 3HB9A 4HA3A 4A3UA 3WG6A 3PPGA 3B8IA 1VR6A 1Q6OA 2WSQA 3BARA 2WZMA 1XQLA 4AZBA 3STCA 4MJZA 1OK6A 1GHSA 1DBTA 4PB5A 3ME3A 4YJ5A 4BK9A 4CD6A 3LCGA 1LTDA 3LG3A 2XVKA 3IGXA 2WQPA 2WZIA 1W8GA 3M6DA 3KTXA 2X1UA 3AC0A 5I7GA 3WQCA 5KTLA 2INEA 4Z0JA 5EMYA 4M6PA 2POZA 4WY0B 4CD4A 1I2NA 4I9AA 5AC7A 1EYWA 4UR8A 1L6GA 1XH2A 1GVQA 3UWEA 3TV8A 3QLLA 5CG0A 3B8TA 1W1TA 3TN5A 3NO1A 1GKRA 2VCCA 4NRSA 3W9ZA 4AX7A 1VFSA 1O66A 2VEKA 1CWYA 3OVGA 4R85A 2J77A 3SN4A 1WBJA 2G3JA 5DEZA 4BQ4A 2CZEA 6CGTA 2D23A 3S4TA 5LSMA 2PDFA 5E0FA 1MXDA 2QS8A 2J47A 1P6BA 1ZB5A 4S3FA 1XIEA 1SFLA 3PNUA 2XM2A 4DRSA 3BH4A 2EPKX 5CH9A 3WN6A 3U5YA 2EQDA 3S1VA 2VEMA 3UBPC 4DZ5A 3M5YA 3A9BA 2J7EA 1S5TA 2YDAA 3NO3A 3UCDA 3BOXA 3OGSA 5AC4A 2OWXA 2VI0A 3A24A 2FZNA 1FWHC 2Z29A 3BMWA 3I6EA 1XDLA 4UMBA 3CMJA 1L6YA 4ALDA 4OU1A 2CHNA 3E1F1 4IIBA 3AYSA 4DYJA 8RUCA 1TRIA 2V9DA 3HQNA 5GVJA 2QW5A 2XINA 9XIMA 1UQZA 5FF4A 3CGTA 3W23A 3CZLA 4K68A 5BU9A 1VKFA 1VPYA 3H7VA 2VWTA 1WDSA 4FNQA 4IM4A 3W7KA 4KWUA 1W0MA 4KF1A 1JI2A 5BOEA 3VM7A 3NG3A 3HG4A 1EYEA 1GVFA 3AIQA 3NWRA 3QR1A 3MC5A 2ZX6A 1TIMA 2A7PA 3TROA 1XYBA 3THQA 1FOBA 4UFIA 2Z1WA 2OFJA 4KWSA 5C5YA 1QW7A 3EXTA 1CTNA 3G6MA 5C55A 3HV9A 4GUFA 1A5BA 3KRZA 4LC6A 4PEEA 1CLVA 1F8IA 2FZ8A 3H2EA 3R58A 1AQMA 2J7CA 1WPCA 2HTMA 1GJUA 4IGSA 2CBJA 3KOWA 4TTUA 4O1AA 4FX7A 4AQLA 4CU7A 2QDEA 4L6HA 2BBFA 3VOJA 4B5TA 3KL0A 5GJNA 1EJUC 1PX8A 3MUAA 3ENLA 3GDRA 3LLDA 5AHLA 5BWAA 2C1GA 5CBBA 1M3UA 1CECA 2WV8A 5H91A 2YCLB 3T2QA 4DJDA 3UU0A 3KAOA 2FFCA 2HS6A 3N12A 5EU9A 1QNQA 4C7FA 2BGSA 1F6PA 2XVPA 1NSJA 3WLMA 2ZRXA 2E1WA 3EOOA 3PB2A 3NM1A 4PFMA 1QPRA 4MUPA 2AQVA 3C6CA 1LBFA 3MBDA 5DMYA 3H54A 3W7GA 4WDWA 4O13A 4QP0A 1WQ5A 3ARZA 3W7JA 3CS2A 2WMGA 2V81A 2YCKX 2YOCA 5A95A 3VZXA 3L2IA 3R2GA 5IM51 4OUEA 4C6MA 1AQHA 1OYAA 5E70A 3BSMA 4L4LA 2CIPA 2VGBA 4E8DA 4K1GA 1JCNA 1DE6A 3DFOA 5D2WA 3B8WA 4ZL1A 4XAZA 1RVKA 3GR8A 3EBVA 1RR2A 5FKYA 4AEEA 2E40A 4JQ1A 4QGCA 4GGBA 3VIPA 4JYDA 4BZYA 2DZUA 2OLAA 4CQ8A 1LF1A 3KS6A 4HHMA 4NY2A 3DAQA 4OWGA 3CAKA 3GDLA 1J2WA 3B3DA 1QWGA 4NX5A 2P88A 3FEMA 5HDRA 4EAYA 2CKSA 1UP3A 4QQUA 2OO6A 4OQVA 2PDKA 1KM5A 3GVGA 4YTTA 2I9UA 3VDBA 1HO4A 3H2MA 1BLIA 2GGIA 4R53A 3CTTA 2IKIA 4A4AA 1WKDA 2O9RA 3EWBX 3NR0A 3GXPA 2BOEX 4DELA 2NV9A 4IIDA 5GNXA 2JF7A 1JDEA 3WQ8A 1PV8A 5AHFA 1VRXA 2FPTA 3BZJA 3W87A 1JYVA 3NPXA 1S5NA 4ERIA 2ZX5A 5DCBA 4O8RA 5FF3A 4WVXA 3M0JA 3G1HA 2X09A 4JN7A 2E5DA 4CQCA 1ZBWA 4WKFA 3LN3A 1HJSA 3P14A 3EPNA 4NJIA 3SGZA 4GQGA 2ZICA 3VI2A 3SSJA 1XLBA 4PR4A 3ZWSA 5CXPA 3O6AA 3B9OA 3E5BA 2H9AA 2FDSA 4ONVA 1ICPA 1H1NA 2E9LA 2X41A 1R2RA 4XBJA 2J27A 5A6LA 5D8ZA 2Y24A 3AMCA 3FXGA 3W7EA 4RNFA 2FGLA 2PB1A 4E2DA 3Q2DA 3STFA 2AGTA 3WBAA 3UVIA 3S83A 4JQAA 2I17A 3C8FA 4GYJA 3O0FA 3CZGA 2OOGA 4E4PA 1OFAA 1LBLA 1PEZA 3FEQA 4X9YA 4DX3A 3L65A 3GU1A 2POTA 4NJGA 2E6DA 1ZLPA 2G41A 2A7NA 2C91A 2J66A 2AQOA 2PFHA 1BVZA 3WQWA 3T2PA 5ABTA 1W5QA 1DJZA 3QGAC 6XIMA 2VHLA 5I6SA 3DOPA 3CIVA 3CZEA 3SUUA 3BO9A 4DAFA 2BDQA 1X6UA 3LV6A 4NJKA 4O0QA 1GONA 2NQZA 1C91A 1R3QA 5REQB 3DDMA 4DZAA 1WZLA 3HOJA 3IPWA 4DYEA 3ZT7A 1VJSA 2QV5A 1L9WA 4V15A 4X2PA 5CZKA 2XPKA 1NAL1 1AVAA 2BGQA 1TQXA 2EPOA 3CV2A 1IXQA 2JKAA 4LVDA 1RY0A 2Y7DA 1UYQA 4QDWA 4DJFC 3DBNA 4JTTA 2JIEA 2OLHA 3GHTA 2Y5JA 2QPXA 4EANA 3LDVA 1YPIA 3HJEA 2W4XA 1IXOA 4HNVA 1UWTA 2J6XA 4XG1A 1G94A 3BJTA 3VGFA 4QBXA 5LNVA 1G67A 4MAZA 2O9PA 1PDZA 2GQ8A 2Q8ZA 1VFOA 4DNMA 2WMHA 3BICA 3MUY1 3GZ3A 3HBLA 3DBPA 3UGVA 1JXKA 3PUEA 3PBUA 4B9YA 4TMBA 1AD4A 4JFVA 1QRQA 3LV5A 2ZRYA 1SO5A 3ABOA 3DIPA 1VYPX 2OKOA 4NJHA 5LKYA 3KZSA 4M81A 3TQPA 3E12A 5DMLA 2NT1A 4DBDA 5LZLA 3WMBA 3U3HA 2Y1HA 3ISIX 1VB9A 1HUVA 2Q8LA 1CB7B 4XZLX 1G4TA 2UV8G 3O3RA 4JDBA 4UTKA 1TCMA 3S2NA 3MP3A 1TVPA 4YYCA 3N11A 1AH0A 3UZXA 1RBLA 3KX6A 1HGYA 2NLIA 5LHEA 4JTCA 4C6CA 3OVQA 1XC4A 2VMFA 3ABQA 4NQ1A 3Q37A 1JDDA 4NASA 4U31A 4FXSA 1PTDA 3F5KA 1I75A 4F48A 1CT5A 1V6WA 3P61A 4FR6A 3N4FA 4IIEA 5ABFB 1HJUA 5AYXA 3WDIA 1WO2A 3HO8A 2NVCA 4PL1A 1N55A 4AUBA 3SECA 3BAKA 2Q71A 3SUWA 3ARYA 3WUBA 5M3WA 1ZCCA 2XIMA 1NF7A 3ES8A 4FR1A 2QDGA 2OELA 3OZPA 4P5UA 2PF0A 5CC3A 3U8GA 2AAMA 2PWHA 4W87A 2XIIA 2F9RA 1FCQA 1H2JA 3PBGA 3WF3A 3C0SA 2PLCA 2W0UA 1HXJA 1E71M 5U7SA 2YJQA 3W0KA 1E4NA 4J40A 2W66A 2W27A 1A5LC 3FDKA 3KW3A 4H6EA 4LUIA 1HL9A 1GHRA 4NI3A 4UQDA 3VIIA 3T6CA 5FACA 4QE1A 1PSCA 5C9RA 2NWSA 1J12A 1D3HA 1R3YA 2WZEA 3AWNA 3GDMA 3U2OA 3LRLA 4H8UA 1RK5A 2PDYA 1V3KA 2X40A 1M04A 3NTYA 4DHGA 3JZUA 2QIWA 1W3KA 1POJA 2VQUA 1OFDA 2QMKA 4LQ1A 3F4CA 4W4QA 4XUYA 2B7NA 2I1OA 4NYYA 2QKFA 2ACUA 2R82A 3A6OA 5FF2A 4QJ5B 2WBGA 1GW1A 1BRLB 1QVBA 2QJIA 4LNYA 1IEIA 3SUTA 5XIMA 4R5EA 4RNIA 1PCWA 4F79A 5C2CA 4DZIA 1K03A 4J3VA 1YRRA 2GL5A 4EOUA 3ZSTA 5LNUA 3SCWA 3VINA 3EKLA 5SWUA 4PSRA 1GZJA 4LPCA 4JCLA 4IX2A 5I24A 1YTKA 1UPPA 3VOFA 3SGUA 5IOBA 2D0FA 4LRTA 4V28A 3MO4A 3CUGA 1PJ9A 3KCLA 4FLOA 4O1EA 4JQ3A 4HNCA 3EDDA 1JPHA 3EWWA 4LXFA 3ZXWA 3HGJA 4Y8EA 4MYXA 4B5WA 1E6ZA 4QS5A 1BXCA 3WY1A 3WZ0E 2I57A 4H4IA 4OOZA 1ITXA 1R30A 3BCJA 5FESA 3VFLA 3N6QA 5FOOA 5EB8A 3S9ZA 1REQB 1VFMA 2YL6A 2GGEA 3NA8A 1SW3A 2DORA 3L4WA 4ZOBA 2OZ8A 1I2RA 4FNRA 1M9HA 3A9IA