2R94A

Crystal structure of kd(p)ga from t.tenax
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
286
structure length
286
Chain Sequence
MEIVAPVITTFRGGRLDPELFANHVKNITSKGVDVVFVAGTTGLGPALSLQEKMELTDAATSAARRVIVQVASLNADEAIALAKYAESRGAEAVASLPPYYFPRLSERQIAKYFRDLCSAVSIPVFLYNYPAAVGRDVDARAAKELGCIRGVKDTNESLAHTLAYKRYLPQARVYNGSDSLVFASFAVRLDGVVASSANYLPELLAGIRDAVAAGDIERARSLQFLLDEIVESARHIGYAAAVYELVEIFQGYEAGEPRGPVYPLDPEEKAWLRAAVAKAKSQLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and stereochemical studies of KD(P)G aldolase from Thermoproteus tenax.
pubmed doi rcsb
source organism Thermoproteus tenax
molecule tags Lyase
molecule keywords 2-Keto-3-deoxy-(6-phospho-)gluconate aldolase
total genus 111
structure length 286
sequence length 286
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.14: 2-dehydro-3-deoxy-phosphogluconate aldolase.
pdb deposition date 2007-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2r94A00
3L5AA 3TSDA 1VR6A 1SZNA 4I9AA 3R12A 4K36A 4MOZA 4UUIA 1P5BA 4ORIA 3PS7A 4HNUA 3O1NA 3QF0A 1M5WA 4YCPA 2E6DA 3O63A 5TIMA 4UR7A 3RFAA 3A22A 4HSOA 3MP5A 1VLWA 4TMCA 1B4EA 5AHMA 1TV8A 1VRDA 4IQLA 1R2TA 1SW0A 3UNDA 4H4IA 3N19B 4S2BA 1XFBA 1AK5A 5J5DA 3W1MA 4PCFA 1FUYA 1TMHA 3TQKA 3GK0A 4TMBA 3CT7A 3BG3A 3EWBX 4O1DA 4IGHA 3GKAA 3BGJA 2V0TA 4FXSA 2LLEA 3FA5A 1G4EA 3DHFA 1LRQA 5F4WA 2W79A 1KTBA 1TQJA 3B05A 3VI2A 2EF9A 2ZZ1A 4ORMA 5DCBA 1XBVA 4Z1AA 3F1QA 5D38A 5G4EA 4O11A 5AHIA 3W75A 2E68A 3DI0A 3QYQA 2NWRA 2X1RA 3BLFA 1TJRA 3QSRA 3OVRA 4AVFA 5HUOA 3GYEA 2YFOA 4O8RA 2E77A 2AQWA 1ME8A 4YWIA 5DY2A 4LUIA 5LGZA 2J24A 5CZSA 3HF3A 2EKCA 2DZTA 3Q2DA 3NQMA 1AW2A 3BG9A 4IMFA 3UXAA 4ICNA 1H7XA 3TX9A 1A50A 3M1ZA 2WNZA 3TJXA 1PL9A 3BARA 5LNSA 4MKNA 1G6CA 4X3ZA 5F2MA 1EB3A 1P0NA 3STFA 4O28A 3GNDA 2A7PA 3CTLA 3O15A 1UBSA 2OMAA 3A23A 2B7OA 4K38A 4FXRA 1JUKA 3NR0A 4HHPA 1H7PA 4NQ1A 4UTMA 3VFLA 2RHGA 1KM3A 4Y9AA 1OF8A 5F4XA 1VPXA 4Y6GA 5J5RA 2I1OA 2Z6JA 3NM3A 1H50A 1JQVA 3PM6A 4FNSA 2W6RA 2ABAA 1FY6A 3DXIA 2PURA 3WJWA 4HNNA 2NV2A 3LOTA 3NA8A 3P61A 3L65A 4MYXA 2CLMA 1F74A 1UB3A 3B06A 1B3OA 4HT3A 3W7GA 4RXGA 3UWZA 1FDZA 1OABA 4JTIA 3SFKA 3UWQA 1TJPA 3OG3A 4I7UA 3BW3A 5I3KA 4N2YA 2NWSA 1SW7A 3NM1A 4WY0B 2BXVA 2QCGA 1MXSA 4NJKA 1H7OA 2YYTA 1LRNA 3LBCA 1DORA 4BR1A 4DF0A 3DU0A 2BTMA 1DQXA 3CWOX 3W7CA 4A21A 4O19A 1HG3A 2DZVA 2VELA 3WJSA 3HBLA 4N9BA 3Q58A 1UUMA 3HGOA 4CNNA 3QM3A 3IIZA 1FWTA 3S5NA 3CLMA 3LXCA 1H62A 3IRDA 4N9EA 2ZRUA 3CQ0A 3LCLA 4RR4A 3LHYA 2A4AA 3NG3A 2JBMA 3M41A 3O6CA 3H55A 5G1TA 4LVFA 2X30A 3G24A 3B0PA 1U83A 2D73A 4GJ1A 4K7YA 1ZENA 4KWWA 2AAMA 1LROA 1XCFA 1IF2A 4IPIA 5D2WA 2H3DA 1Q45A 3UZJA 1K7XA 2QR6A 5LHFA 1TRIA 3ZWTA 3TK7A 3G8RA 3PG9A 8TIMA 1WAUA 3PBUA 4MIMA 2ISWA 4DQWA 3U2OA 3W2JA 1UASA 3GAYA 5IBXC 3IIOA 3HPZA 5HR6A 1RPXA 2NXGA 1QWGA 1TO3A 2OCZA 4AWTA 5DCEA 4WY0F 2G95A 4Y8FA 1RR2A 2ATSA 2FB3A 4IMDA 3EX6A 3GR7A 4HPXA 1SR9A 4JYFA 1LOQA 1OYAA 2ZA2A 4O16A 1TIMA 4JTHA 3STGA 1I45A 5HWNA 3CEUA 4CNOA 4OE7A 3SW6A 2QCLA 4NJHA 3V75A 4AMAA 5A5WA 1L6YA 3P62A 1EA0A 2EGZA 1GT8A 2CLHA 3W2LA 3HPXA 4ZQPA 4O0KA 1VYSX 1YLVA 4WUIA 1AG1O 1SO5A 2E5BA 3MI3A 3O6YX 4D2JA 1O95A 2VOMA 1RVGA 5CGQA 3T7VA 4YMZA 1Z44A 1VHCA 1BTMA 3N2MA 1RV8A 1R2RA 4WX2A 1C8VA 3LRMA 1G4PA 2VFHA 4UMBA 4PODA 2Y85A 1SU5A 3QQ1A 4CQAA 1PHWA 2HSAA 1KFLA 4LU0A 1EWEA 4HN4A 5FF3A 2V2CA 1N55A 5CPNA 4XTIA 3I68A 2X2GA 1LYXA 1OFQA 1SPQA 2NX3A 2YR1A 1Q6LA 2WKJA 1YTEA 2FQIA 2WNQA 2XN0A 3MMTA 5LNWA 5FF2A 1ZAIA 3TSMA 3N9RA 3TFXA 4XKYA 2NX1A 3P74A 1LM1A 3JR2A 3L0GA 1JCJA 4MJMA 3ZWSA 3LHZA 3PG8A 4N9CA 3HG3A 3UZ5A 4O52A 1JCYA 2TPSA 3ATZA 1QMLA 4ZQMA 5D2YA 4RV8A 1C29A 3NQCA 3QQ0A 3TCEA 2A1YA 5CZTA 2VFIA 3W7NA 1I2QA 2OT0A 3RMJA 4NJIA 1LTDA 4ZQRA 4O15A 3L21A 1XKYA 3NEVA 1V7YA 1ZAJA 3FLUA 4QITA 2VKZG 4RX0A 5AYXA 3NQDA 4HKPA 2WSQA 2YW4A 1OFRA 1SW3A 1VHNA 3BK0A 3EEGA 4UMCA 4MUZA 4LRSA 5FF0A 3NQFA 5EMUA 2OJPA 3P80A 5G4WA 1TPEA 2FB2A 2E5CA 1KFJA 5D30A 1QR7A 1NF7A 1NFBA 4K37A 1O5KA 1YTKA 5G2WA 4JX4A 2HS8A 1KM2A 4Z0JA 1OFDA 1ZNNA 2ZA1A 3GLCA 3W7IA 1GVRA 1KFKA 3LCFA 4QNEA 4H3DA 1TV7A 1GEQA 2FPVA 3W7DA 3M47A 1FQ0A 2BX7A 1DQWA 3PB2A 2XN1A 3O05A 5LNVA 1KM1A 3W2MA 1NAL1 3P60A 3GXNA 4IMCA 1R47A 3KRSA 4NZFA 1K03A 4QNWA 5HQEA 1KTCA 3L5LA 4LV4A 4O50A 3F4WA 2NXHA 1W31A 5EPDA 4LT9A 3LTPA 2G5WA 5I3HA 5C6MA 1W5QA 1QNVA 4LVBA 2E6AA 4CCCA 3TAOA 5EY5A 4MLJA 3PB0A 3KRUA 4NU7A 4YXGA 3CM4A 4LY8A 5CPMA 5E0KA 3E9AA 1JUEA 1W5PA 3P5ZA 4O4WA 4GWEA 1AL7A 2QJHA 3LI0A 1IXNA 4JS3A 5CZ0A 2E6YA 3P5YA 3LX9A 1JULA 1LOLA 1G69A 3W83A 1BWKA 4JTEA 3G1DA 4UFJA 1MEIA 1JUBA 4PTNA 1RQBA 1WA3A 2PCQA 3M16A 3UWYA 4OQVA 1FXPA 4MPQA 4WOZA 3MYPA 1DV7A 3BV4A 2JKPA 3L0NA 5DLCA 1YDOA 2Z6IA 3W2UA 2GJNA 2OZ0A 4Z08A 3M5VA 1QPQA 1SSDA 2DZUA 1MZHA 1TPH1 3SR7A 2CLIA 2NUWA 4GC4A 1IIGA 4KFNA 1KM4A 4FF7A 3R2GA 1WYIA 4JX6A 3TSBA 1Q6RA 2A21A 2WPBA 2ZZ2A 2CZEA 3W1PA 3DHDA 3C2RA 2YXGA 4K8EA 3W1QA 2WNNA 1VH7A 1KA9F 4AF0A 1VLIA 1WQ5A 4FHAA 4DO4A 1K8ZA 3G3DA 1H7RA 4O18A 4JR5A 1PIIA 2WV8A 2DZPA 1JCNA 2Y89A 4NJGA 2W0UA 4UTLA 4NT0A 1VS1A 3EWYA 4JTTA 2FDSA 3ELFA 3DFSA 3TW6A 3AO0A 4R34A 4FX6M 3LERA 2VFFA 1P1XA 2TRSA 5AYZA 1JR1A 1XDLA 2QCHA 5DXXA 4AWUA 1TV5A 2EAWA 3B4UA 1FX6A 5LZLA 4ML9A 3L68A 3ABRA 1JRBA 3BGGA 3G1YA 1W3NA 3TJLA 4JTSA 2NXIA 3UPBA 1OFAA 1TPWA 5F1UA 2BWGA 3QPYA 3HG5A 2V30A 4X2RA 1QOQA 3STEA 1LLZA 2ISVA 5FESA 5K7JA 3QC3A 3W1XA 3LCHA 2RH9A 1SQ7A 1G7VA 3HG2A 3W72A 4AHOA 3O16A 1D9EA 4JEQA 3W23A 3W1NA 2PRLA 3GDLA 4AAJA 1AMKA 2C14A 1DJNA 3B8DA 4YL2A 2CZFA 3B0UX 1T96A 2YCEA 3VE7A 1I2RA 4QM1A 3PBVA 2Q8ZA 1SUXA 1A5AA 1E51A 3LRLA 4JYEA 3NZRA 2ALDA 3M7WA 3LHUA 1GTHA 3GR8A 3DH7A 4LNYA 4JIQA 3FYOA 4K8HA 4C1KA 2VEMA 1Z41A 2WQPA 5ABTA 1QFEA 3KVLA 2NX9A 5KSWA 1TREA 2H90A 5HNRA 1W54A 1S5TA 4DO5A 3W7QA 3NZ1A 3IIVA 5T26A 4XUGA 3LHVA 1F76A 5BOOA 2RDWA 4WY0A 4XQ6A 5D09A 3R5EA 4XWUA 4IUOA 2YW3A 1OFOA 4MFEA 3C8FA 1TCDA 3TMLA 4GUHA 1FWNA 1TTIA 2TYSA 2GPTA 3OA3A 3TQ0A 2RKXA 4LRTA 2CZ5A 2DJLA 4K39A 4AHPA 1FCUA 2GQ9A 5H91A 2ZRWA 4E38A 4O54A 2C3ZA 1DKWA 3NOEA 3CIXA 4PC8A 1PE1A 2CFFA 3R13A 2Z1BA 5CSSA 1ZJIA 3INPA 3CHVA 1TRDA 4LS1A 2R8WA 1CX9A 2VFDA 4K7VA 3NQ8A 1ONRA 4OU1A 1SZGA 2KZHA 2ISSA 2G96A 5LNRA 2NUXA 4U4MA 2YPIA 4KFPA 3QH2A 4R33A 1ML1A 2JKEA 4OV4A 3W1TA 3H53A 4JX5A 4E0CA 3FIGA 3KVMA 4FNRA 3MHGA 4A3UA 2DP3A 2V82A 1B4KA 2JGQA 2QCEA 2EHHA 3F4NA 3G18A 3W87A 3HJZA 5K9DA 3UY7A 3E02A 3TQVA 3B03A 4DBEA 2X1SA 2Y63A 1HO4A 1W1ZA 3W85A 2Q3OA 3WK0A 1X1ZA 3EKLA 1EIXA 1IXPA 1JCXA 2P0OA 4R7JA 3C52A 1B9BA 4LS0A 2DZXA 5U7SA 2A2IA 1I2NA 4YLWA 4JIPA 1GVOA 1UUOA 1XDMA 3I7QA 3OVPA 5BMXA 1LOSA 3M9YA 2VENA 2Y7DA 3HGJA 4BI7A 3GZ3A 3DFPA 1R30A 4ADUA 3ATYA 3LM7A 1W0MA 3L9CA 2Y62A 3CC1A 1K3UA 3TR2A 1X1OA 3BW4A 3GIYA 2QF7A 1P4CA 3TH6A 1ZY9A 5EBUA 1TPVA 1H61A 3TXZA 4QJ1A 4JDBA 1W37A 1MSSA 2H3BA 3QJAA 1OYCA 5G1YA 1QDSA 5C55A 2A6NA 5CSRA 1LZOA 4CLMA 5KMYA 3RLUA 1QPOA 2HTMA 3G1VA 2J27A 4OGZA 1NVMA 1ZAHA 3PVFA 4HSNA 1GOXA 3TAKA 1BKSA 2RDTA 1WXJA 1F2JA 4JY8A 2XN2A 2J6XA 4ZQCA 1TQXA 3LV6A 3MP4A 1B57A 4O1AA 2P1FA 4CCDA 4NX0A 2GVLA 4JNMA 3NQAA 4DXVA 3FYPA 4IPJA 1FCVA 5DBUA 2VXNA 1XUUA 3P8IA 2Z0IA 3PWAA 4NJJA 3TW7A 1GWJA 2NZLA 3EKZA 3WK3A 1GZGA 4TX9A 3W22A 3SGZA 4FNQA 3NXFA 1S5VA 3LCXA 1VGAA 3CPRA 1G4TA 5HWJA 5GVJA 1IXQA 3NL6A 5EL1A 1X8FA 3SI9A 5IBXA 1N7KA 3M6YA 4LVGA 2DORA 4ALDA 2C18A 2E6FA 1I2PA 3PUDA 4EF8A 3USBA 3E0IA 3GXTA 1MO0A 4J9JA 5LNUA 5HINA 3DBPA 1PVNA 3EXRA 3TIMA 3W2KA 3LI1A 1DL3A 4UC5A 1PS9A 4CQ8A 1HO1A 4JICA 2ZRVA 1JCMP 1G4SA 4UFLA 3G1HA 3IIXA 3O8AA 1TPB1 4FNUA 3BPWA 3S1VA 5LGXA 2FPTA 1EUNA 1Y0EA 2WO5A 4MY9A 4AF0B 4FNPA 3IIPA 3NPVA 1HUVA 4LOCA 3NO5A 3PSWA 3G0SA 4RK8A 3PY2A 5DELA 5HUPA 3PBWA 1FBAA 1T0OA 3PR2A 3L0KA 2GVGA 2ZTKA 4L4LA 2FJKA 1J5TA 4WXZA 5F2IA 3M5YA 1JJKA 1EWDA 7TIMA 4G1KA 2ZCGA 3GVGA 1I2OA 3HIJA 3TDFA 1W5OA 3ZFHA 4N02A 1YXYA 3NQVA 2F7FA 3LV5A 4O1CA 5AB3A 5KINA 3O06A 5AHNA 5D03A 3KOFA 1DOSA 3WJZA 3VKJA 3KXQA 4LV9A 2A6LA 1GG0A 1ICPA 2ZZ6A 1Z42A 3IGUA 3BLIA 4M6VA 3W7LA 3W7KA 1CW2A 1A5CA 4LC8A 1YTDA 4GXMA 1A5SA 1EP1A 2E09A 3KVKA 3W1AA 4QIUA 2H8XA 2CU0A 3T44A 2E1DA 3PULA 5EYWA 3NL2A 2YX0A 1FCBA 3TMQA 3UPWA 3YPIA 3G8EA 1S3HA 1MEWA 4JXCA 3LDVA 4AHQA 4PL1A 2ZFAA 4JTFA 4Q4KA 5FEWA 3KRZA 1BWLA 1NEYA 2A0NA 4FB7A 1L2UA 4MLRA 5TQLA 3ZR4A 4RXFA 3DAQA 1VCVA 3BVJA 3N9SA 3W9ZA 4TR9A 4GUGA 2E5DA 2JGYA 4RKAA 4H6KA 1WOBA 3MJYA 1PCWA 1M7PA 4O13A 1QCWA 1XUZA 5FF7A 2QEZA 4OT7A 3UY8A 3V1PA 3FJLA 4UTWC 1W5NA 3EX3A 4ZZ9A 5BNKA 2FTPA 3A5VA 2GUUA 1TYGA 3QMSA 4Z1BA 3P81A 2JKAA 4EWND 3C2EA 1F73A 2ZDRA 5DCDA 3W74A 4NX5A 3DZ1A 4K6AA 1WOAA 2ZRXA 3STCA 1QO5A 3HPSA 3LCGA 2V5LA 2R91A 1NF0A 5SWUA 3PSVA 3WK2A 2Y7FA 4UTTC 5HMSA 3MBDA 2O7SA 3PAJA 5KZDA 3H54A 2JK2A 6TIMA 3GDRA 3OIXA 1J4EA 1OFBA 3TU9A 3LB0A 3S5YA 3LBMA 3TROA 4LVAA 2ZZ7A 4JY9A 4L4MA 4O14A 3JRKA 4RZ5A 3THAA 4O4VA 1K7FA 2C0AA 1WV2A 1RQHA 4PA8A 4N4QA 3C6CA 3S1UA 5CPOA 1QO2A 4B5NA 2B7QA 3T40A 4X9SA 2TMDA 4JTUA 4W9TA 2B4GA 2NUYA 4LTSA 5C2XA 3E12A 3SY5A 5TBOA 1G7UA 1SZEA 3N73A 3NPWA 3LLDA 1H63A 4OBTA 3OEXA 1XL9A 3NQGA 4LVDA 4O0ZA 3LHWA 3EWXA 3IVSA 4QQ3A 4A29A 1RD5A 1Q6OA 5AOUA 1WBJA 4FO4A 2C6QA 2QDHA 3GDMA 3GNNA 3UXDA 2FLIA 4M6QA 2J9ZA 1KLYA 2GOUA 3NQEA 3LXBA 2DZWA 2O7QA 3IGXA 1H51A 2YDAA 3UQNA 3W3OA 4N6FA 3HG4A 1QPRA 2H8ZA 3TFCA 2J9YA 2BZNA 2G97A 4UXDA 5LSMA 3I65A 1L6SA 3SIZA 3UD6A 4GBUA 2ZRYA 1RQEA 4Y90A 3TE9A 4R53A 3DENA 5FEXA 1ZHAA 3FKRA 3ABQA 3NQ7A 1OX5A 2CWNA 1KTNA 2ZYFA 1M6JA 1KM0A 3P67A 1XBZA 1TPFA 3UYCA 3W6YA 2C16A 4DPPA 4EF9A 3IGSA 3NL5A 3P84A 3NNTA 1Q3NA 2QAPA 1U5JA 2B7NA 1YPIA 3N2XA 3EWUA 2Y6ZA 4O57A 5BW6A 1JVNA 3QRHA 4WOQA 3DI1A 2J9XA 4UTJA 1ZALA 2NV1A 1DVJA 1TTPA 3S1XA 3L2IA 5AHFA 5CG7A 2PC4A 2J88A 1F5ZA 3L66A 2Q8LA 1THFD 2I9EA 4I7WA 4DBDA 4WZHA 5HJLA 3BG5A 5D2VA 5H2ZA 3NPUA 3A9IA 3TNOA 1D3GA 4FNTA 4IMGA 2Q3RA 3LGEA 1XI3A 2WJZA 2WSYA 3RF9A 3P7YA 3LHTA 3EX4A 4M7SA 1O5XA 3LCWA 1F6PA 2YYUA 3QFEA 2GJLA 2QUVA 4O12A 1LRTA 3EXSA 4ZMGA 1ME7A 3LTSA 4IJBA 5AC6A 5D32A 1JCLA 3UWVA 3NAVA 4RZ6A 5D02A 1SSGA 1IIHA 3G1FA 1KM5A 3QW3A 1KLZA 2UV8G 3I7RA 4AEOA 2ATMA 3Q94A 5AFDA 1YXDA 3G22A 1G67A 1T99A 4JTGA 1YDNA 2PRMA 4POCA 2CLKA 3DKLA 4EOUA 4OWGA 4UFMA 4GE8A 3SJ3A 1LBLA 1K02A 2V81A 3FKKA 2PRHA 1FDYA 1H60A 3IEBA 1GVQA 5K9CA 3PF3A 5D2TA 1DHPA 4JN6A 3GB6A 1PCKA 4NUWA 1VYPX 3QMTA 6ALDA 3G0XA 3JS3A 4MJZA 1ALDA 1FDJA 5A8GA 1KFEA 4IXXA 3TC6A 2PE4A 3I6RA 3W1UA 1SFJA 3C61A 3KAOA 3W1RA 3IVUA 3O6DA 1VQTA 3S1WA 4Z1CA 3EXTA 1W3TA 4GUFA 1IXOA 1PHQA 4MYAA 1ZCOA 4S2CA 1OK6A 1YDVA 4M19A 3O07A 2RFGA 4M5PA 3MBFA 5I3JA 1KBIA 2ZZ3A 3G1XA 4LC6A 3NPXA 3NVTA 4WD0A 5BMWA 4UFHA 1W5MA 4PFMA 4MY8A 3VCRA 3UWWA 4UTIA 2CLEA 2R94A 1ME9A 2B0MA 3G3MA 4IWWA 3WK1A 1YYAA 4UTHA 4UR8A 4NNCA 3MYOA 2EPHA 2V2HA 4LUJA 3LRKA 1R46A 2ZTJA 4N9DA 3N14A 4NNAA 1SO6A 4UCGA 3L5MA 3MP3A 5F4SA 3U8GA 1W3IA 1Q6QA 4O10A 4U28A 4X22A 4ZQNA 3K30A 1YPFA 1EPXA 3C2VA 1QAPA 4PEKA 3GKFA 3KVJA 3W7JA 2QKFA 4ZL1A 3C2OA 1YADA 1FWWA 4CQ9A 5K4ZA 4UNKA 3TXVA 1SZFA 1SFLA 2Y61A 3PUEA 1O94A 3CIWA 4HNVA 2OT1A 5K4XA 2VEPA 2ABBA 2V5BA 2ZQ0A 1OX6A 4IX2A 5CZJA 4WQ6A 3E96A 5FEZA 1OX4B 3R89A 1TPC1 4UTTA 2GQAA 4GRSA 4LWWA 3MWAA 3NQ6A 4TO8A 1GJPA 5FI8A 2QAFA 1OG0A 2NLIA 4ZQOA 2A7RA 4A22A 3MHFA 4ADTA 2VEKA 4S1FA 4IXHA 3EB2A 3ABSA 4HPJA 4Q32A 5D2XA 3THQA 5BRBA 4RJEA 3W7PA 3VNDA 1HTIA 1F6KA 4NVTA 2QUUA 5AHEA 2QCNA 4AXKA 4DPQA 1SO4A 4LS2A 5FEPA 1J2WA 2OX1A 1KBJA 3WFAA 2C1HA 4BK9A 5AC8A 3B0VC 5D05A 2QCDB 4LW7A 1GQNA 5AYYA 4JYDA 5F2LA 2CLOA 1T8XA 3KFTA 3F03K 5E93A 4MZYA 1YXCA 2HMCA 1LBFA 3DFOA 3CEPA 4MY1A 5DY3A 2WSRA 4UNLA 3N34A 2BLEA 5L9FA 3QZEA 2BSLA 2VFGA 4N4PA 2Y7EA 2GQ8A 5E1QA 2X1TA 4EIVA 3OHIA 3GX9A 2Y7GA 1CI1A 5AN7A 2HS6A 4DF2A 1QOPA 5G5IA 2X1UA 1LCOA 3W73A 3HB9A 4JTKA 3W2NA 1D3HA 1X7FA 1KFBA 2A5HA 1ADOA 1TB3A 3C4UA 3W7HA 3W7EA 3W84A 1VJIA 1L9WA 1M7OA 3M44A 3RU6A 3EWZA 2YFNA 2YSWA 3MI2A 4GNJA 2QDGA 1WBHA 1MEHA 3MUXA 5MHBA 2ZZ5A 2DU2A 2YZRA 1BEUA 1V5XA 3W7OA 4ADSA 4DEFA 3SGUA 4OV9A 4JGDA 2QCMA 1S5WA 3T55A 4BWLC 1K8XA 4GUJA 3W7RA 1Z48A 4TU1A 2YGYA 4I7VA 5HWMA 5LKYA 3Q37A 2Z2UA 1P0KA 5K2ZA 5L6UA 1GYNA 1R2SA 3S6DA 4JTLA 4UTWA 2WOQA 1KM6A 1VC4A 3RK8A 3M5XA 3LLFA 4MZ1A 4QAIA 1LORA 1OVDA 4WJEA 4IOTA 3M0ZA 3TA6A 1TPDA 3U6WA 2ZRZA 1F7BA 5KZMA 3C3NA 2QJIA 4MVAA 3TUUA 4WXYA 1K7EA 5F2GA 4CNPA 3FEMA 1SO3A 2CLLA 1GG1A 3IV3A 4YCOA 4ZVJA 3G1AA 2CZDA 5U4NA 1XBYA 3D0CA 1XBXA 4XKYB 4EVZA 4UTKA 3HQ1A 3DGRA 3MW7A 1FXQA 4KKXA 1O4UA 3CU2A 5D33A 3PBYA 1GPWA 1UCWA 3W86A 2FFCA 4ONVA 5DN1A 4XBSA 1RZMA 3HMJG 1OFPA 1L6WA 4HNTA 4AWSA 1TPUA 4C1LA 2C13A 4JTJA 1FWRA 3NL3A 1I4NA 3ZS4A 2F84A 3QEZA 3DFTA 3LTYA 1KV5A 1AW1A 4E2BA 3C0JA 1TTQA 3QSTA 3G0UA 4PL2A 5FF4A 3TKFA 1VYRA 2QCDA 1GVFA 4NZJA 2B7PA 1UJPA 3PUOA 2ZA3A 4Q33A 3DFQA 3WJYA 5IM51 3C2FA 4QSHA 4P2VA 2CLFA 1AL8A 3HGRA 3P8JA 3KHJA 1EP3A 3DKJA 1FCQA 1NSJA 2GVJA 1F05A 3R8RA 4HIBA 2C19A 1VCGA 2IQTA 3IVTA 1HL2A 3G1SA 3GXPA 2I14A 2ZBTA 5CKSA 4UTUA 1GTEA 3AJXA 3HGSA 1EEPA 2V2DA 3W07A 1HFBA 4QISA 4PH6A 1XM3A 4NNBA 5I3FA 3KX6A 1QPNA 1W8SA 1WDWA 1A53A 4BWLA 2RDUA 1LP6A 4CCEA 3S5OA 2QCCA 3MHUA 3L67A 3A21A 1OYBA 1LLWA 5I3GA 5CPLA 4O1BA 4NXKA 4TIMA 1TSIA 3UWUA 3GDKA 1N8FA 1IGSA 4XBKA 3EX2A 3I7SA 3A24A 1H7NA 3B04A 2VEIA 4AH7A 3RLVA 2AGKA 3VE9A 5KTLA 1I8JA 3FFSA 3T78A 4UIOA 3CWNA 5LHEA 4M7TA 3WJXA 4A2SA 3S5ZA 3EX1A 4IX0A 1H7WA 4Y96A 4FX7A 3M5ZA 1KFCA 3ANYA 4A2RA 5I3IA 3N3MA 3SECA 4BI6A 4JD4A 1JQXA 4BI5A 5EKYA 3T4CA 1PV8A 2FPYA 1OHLA 3HOJA 4FIRA 3NYZA 1OJXA 5D04C 5D37A 3BLEA 4DELA 1KV8A 3DFNA 1H1ZA 3NQ2A 1X6UA 1OX4A 2A85A 5DXYA 3OVQA 2DZSA 2V8ZA 1AW5A 4MFDA 4XZ9A 1FWSA 2C15A 4FIQA 5F1VA 4E2DA 5KZEA 2X16A 3S0CA 4UFIA 3RNDA 2ZZ4A 3FJ6A 4RLIA 3M43A 3TC7A 2XFWA 4P61A 2VFEA 4FX8A 2Y70A 4FEZA 3BO9A 1LDCA 1H1YA 4OHQA 1VZWA 1TTJA 3W76A 3QW4B 1GYLA 4UFKA 2FIQA 1EX5A 1ICSA 4RCXA 2A7NA 3MO7A 1KW1A 3FOKA 1OK4A 3NDOA 4XTDA 4Z1DA 3S9YA 3QPZA 2Y88A 4NXSA 1O60A 5K3VA 5C5YA 3QMRA 3TV8A 1XC4A 1GVSA 1DBTA 1K8YA 3C56A 1EP2A 5EA9A 4BF9A 5KITA 2QCFA 3BW2A 3W1LA 3W7MA 1JRCA 5AC7A 1W56A 3CB8A 1OF6A 3SSJA 4GFSA 3P82A 4IMEA 1LBMA 3W70A 4RZ4A 3EWWA 4UMAA 5K9XA 4BFAA 2CW6A 4KWVA 4O53A 3ABOA 3HO8A 1OFEA 3GDTA 3PC0A 5HULA 5G2HA 2DJXA 4MZ8A 3LCIA 4JDYA 4AB4A 4DF1A 3W71A 3OBKA 5AHLA 3MI6A 5C54A 2V9DA 1EUAA 3A5FA 2TSYA 2R14A 1A5BA 1WX0A 3NGJA 4N6EA 4KFOA 1XXXA 4M6PA 2P10A 5G2IA 4GUIA 1VCFA 2H6RA 4O17A 2VC6A 3W88A 1H5YA 2QUTA 3GAKA 3E49A 3LXAA 4Z0SA 3SZ8A 3S8HA 3FS2A 2QJGA 1C9DA 1ICQA 5HR7A 1ZFJA 3S42A 4DO6A 5DBTA 1DJQA
chains in the Genus database with same CATH superfamily
4K36A 2WC4A 4HNOA 3ZM8A 3SY8A 4NAEA 4PMVA 1YE6A 2D3NA 4LUYA 5TIMA 2OG9A 2WCGA 5IFPA 3D46A 4YYCA 2EBNA 3MP5A 3CLWA 5JBEA 1JIBA 4TMCA 4NZCA 2VDHA 1GCYA 4IPNB 1XD1A 3BV7A 1SW0A 5M2FX 4DY1A 3PBGA 3APYA 2OYKA 5ECVA 3T2PA 1EDTA 3NZGA 3TQKA 5ECUA 3CT7A 1NJJA 3BXWA 4O1DA 3VOCA 4FXSA 2LLEA 1G4EA 4EANA 3DHFA 2FH6A 4Z42C 2YXOA 1MI3A 4E6MA 2EF9A 4P8XA 5DCBA 4QDPA 2Z25A 4O11A 4D6IA 3AZRA 5HUOA 3M0YA 3MCOA 3OVGA 3AYVA 4QG8A 1ME8A 4CVUA 4GI4A 4LUIA 5LGZA 1QI5A 3AXKA 4HMCA 1R0MA 4IMFA 3UXAA 3H7RA 3XIMA 3M1ZA 3BARA 5LNSA 3VNLA 3SO7A 3STFA 1XYBA 5XIAA 2GSEA 3GNDA 2A7PA 3JU2A 3OA5A 3O15A 5PTDA 3SEPA 2XUCA 3WKZA 3WQ4A 3NR0A 1HKKA 3B9AA 4NZ3A 4NQ1A 3W82A 2DV0A 4QX4A 2BY2A 3WLSA 2RHGA 4NHVA 1P7TA 1SFSA 9RUBA 3DC8A 1VPXA 2I1OA 2WMFA 1EIBA 5CGTA 1Q7QA 4FNSA 4DXXA 4IIFA 3COTA 3ZOAA 4WEVX 1V0LA 4GQ0A 3WJWA 4PSPA 5I7GA 1V02A 4IIHA 4WRHA 4E5TA 4H2CA 4PUMA 4IGNA 3B06A 5A8OA 3UWZA 3G1RA 3LU2A 1UD6A 5BXRA 3U0HA 3SFKA 3RILA 2YCJA 4CKQA 1TJPA 1X1NA 1R9YA 5BROA 3BW3A 2QPUA 5I3KA 1RXOB 3GH4A 2NWSA 5LIWX 4PMYA 1MDLA 4AZHA 4AZBA 2YCLB 3LY0A 2QCGA 3VGFA 2YYTA 1LRNA 5I07A 2QV4A 1R7OA 4QLLA 3LMZA 4PYSA 4O19A 4AY8A 2VELA 4IGMA 3WJSA 4N9BA 4CNNA 3QM3A 2G37A 1FWTA 3S5NA 4BA0A 4N9EA 1H62A 3RJYA 2ZX8A 3ARQA 3LCLA 2YDQA 4WJ8A 4WDWA 4Q22A 5T9BG 4PBFA 2JBMA 3CS2A 2PDBA 3OU8A 4L9ZA 5G1TA 2FHBA 5HAOA 3B0PA 4XD5A 1E4MM 1UHVA 1WNOA 4KWWA 1LROA 3GXMA 4AIEA 4QR6A 5D2WA 4ZODA 1XLAA 2H3DA 4UWMA 1C7SA 1Q45A 1K7XA 4XKMA 1TRIA 3ZWTA 5IDIA 2FZ9A 2Q01A 3G8RA 2VVSA 3WY1A 3U2OA 4PTDA 4PB5A 1FOBA 2FZDA 3VDHA 2OOFA 2G0WA 2ATSA 4IMDA 5C71A 4JYFA 1TIMA 1TV2A 1D3CA 1I45A 2PMQA 3T05A 2QV5A 3N1AA 2PZ0A 4G1NA 3SW6A 5HA7A 1XRFA 3V75A 1F3WA 1BTCA 3FVMA 5A5WA 2WKLA 1D7KA 3UG3A 2Z1WA 1UMLA 3QHNA 3AZTA 3AAMA 2UWFA 3CMFA 3CH9A 3VKCA 2ACQA 1EXPA 5C2GA 1ITXA 3T7VA 1QI3A 4E8DA 1BTMA 3WLOA 3RUBL 1AQMA 1GOKA 4Q8QA 4C6LA 4UMBA 1JGIA 4CQAA 2ZUTA 3GH7A 4FMVA 4LU0A 4GXWA 4IIGA 4HN4A 4I3GA 4CQCA 5FF3A 3RR1A 5CPNA 2PDCA 3USZA 3V0UA 2P8CA 2F38A 2X0SA 1DXIA 2PBGA 2DSWA 2XN0A 3SM0A 1PKMA 3SGGA 4REQB 1RPKA 1QNRA 3HFTA 1LM1A 1R3QA 3L0GA 4MJMA 4GISA 1UPPA 4L65A 1ZL1A 3TR9A 1O7AA 5A8MA 4ZQMA 1C29A 3TCEA 2VFIA 4NILA 3WNOA 4O15A 3WL0A 4P5UA 3ZT5A 4GABA 2YW4A 4RW5A 4S3GA 3ITCA 5GNXA 2OJPA 1ECQA 5E70A 3CZEA 1UKPA 4J3SA 1B0IA 5G4WA 2FB2A 3RU8X 3EB4A 2NLYA 1O5KA 3SCWA 2WHKA 5G2WA 2HS8A 1OFDA 1IT0A 3SY1A 1GVRA 3RXZA 3LCFA 4E4UA 4H3DA 4R27A 3TLQA 1RLCL 2BDQA 3VIGA 2XN1A 5LNVA 2HBVA 2P3ZA 3TYZA 3M0LA 3RX2A 1DIDA 4WGHA 2QDEA 3KRSA 1TIWA 3O9NA 5A6SA 4W87A 3BC9A 1K03A 4QNWA 1V0MA 2F61A 4IHCA 5I23A 3WMLA 3TWBA 4QP0A 4YYFA 3BQ5A 1KTCA 4O50A 3F4WA 2NXHA 1W31A 1P7TB 4LT9A 5CXPA 4HPGA 4Z2IA 3TAOA 5KEZA 5EY5A 1V02E 4L7ZA 4Z2LA 4PULA 2ASHA 3PJTA 1ZZMA 4JS3A 5CZ0A 1JYNA 3WQVA 3WBEA 1LOLA 2WSKA 1JZ2A 3H70A 4GX9A 4JTEA 1M04A 4OQVA 2VQUA 3SADA 2D24A 1E0WA 1DV7A 4B16A 3BV4A 1PTAA 1MQQA 3OP2A 3SR7A 1VFHA 2CLIA 2NUWA 4KFNA 4IP5A 2ZKMX 1OT2A 4H9YA 1WYIA 1IR2A 3TSBA 1Q6RA 2A21A 4C6EA 2ZXAA 1GYMA 1EGMA 2XFYA 3C2RA 5M5DA 2XJ7A 4JZ5A 1DE5A 1MMFA 2VC9A 1VLIA 2E9MA 4FHAA 1K8ZA 1UA7A 2XWEA 4U10A 3D6NA 3ZVHB 3AJ7A 4UTLA 2W0UA 1RBAA 4NT0A 1BQCA 1NWRA 3H2MA 3EWYA 3WG6A 1PX3A 4LEFA 3DFSA 4FX6M 2FDMA 2GJPA 3LERA 3WH5A 2Z1SA 3MSRA 3WDPP 1HF6A 3WH9A 2VVNA 1S2VA 3T0TA 4FZIA 3VABA 1FVPA 3LMYA 4S3BA 5DXXA 4AWUA 1QNPA 4C90A 4S3KA 1DWIM 3IJ9A 5AYBA 1TV5A 4S38A 4DO7A 2F6UA 4GG9A 3RN6A 1NTHA 1UWSA 3K1DA 1W3LA 3QGKC 1VEOA 1KRCC 2Z24A 5F1UA 6XIAA 1E9YB 4CU7A 4J40A 1LLZA 4S3JA 5K7JA 3NWRA 1G7VA 3HG2A 3W72A 1C92A 1ZSXA 4YVXA 1CNVA 1XDJA 4NZ4A 1EPVA 4J27A 1IEIA 5HQMA 2XH2A 2NSOA 4WJXA 2CZFA 3URNA 4ZEPA 3B0UX 5D9NA 4ZB2A 4GMEA 2Q8ZA 1PX4A 4U5KA 2ALDA 3GR8A 4LNYA 4WKHA 3BLOA 3FGCA 1AJZA 2POTA 2NX9A 2WMIA 5LXEA 1W54A 2QNEA 3ZR5A 3BAYA 3NZ1A 4GIAA 4XUGA 3LHVA 4MKSA 4W8BA 3PWIA 2RDWA 3OBAA 3R5EA 1ZQ5A 1TV3A 2YW3A 1VPQA 3T9PA 2GWNA 3AIEA 4GUHA 3W02A 1FWNA 5AZ0A 2TYSA 2DJLA 3HTWA 4LBUA 2Z27A 2IPGA 4M81A 3GXIA 1DKWA 2EJ1A 1JXJA 5IFTA 3FJ4A 4PC8A 3N25A 3R0KA 3INPA 4IQEA 1CX9A 1SYTA 3NQ8A 2YCIX 4OU1A 1C7TA 1MW2A 1SZGA 4QLKA 1B2YA 1TWWA 3MA8A 1XP3A 1KRAC 5LNRA 3CTTA 4L9YA 3ARPA 3AIWA 4JN7A 4R33A 3ZSTA 1ML1A 1XPYA 3W1TA 1LUCA 4JX5A 4E0CA 3FIGA 3KE0A 1V6VA 4NY2A 4HD5A 2V82A 1NQ6A 2QCEA 2EHHA 1J0ZA 3HJZA 3TOPA 4DUXA 4ZXOA 2Y63A 4G5DA 4CEXC 3UERA 3W85A 2Q3OA 2UZ9A 3WK0A 3CUJA 2HK1A 1EIXA 2DZXA 2GWGA 1WUFA 2DIKA 1XIGA 1I2NA 5JQ9A 4JIPA 4DWSD 3S2LA 3M9YA 2VENA 2Y7DA 1XR2A 4GI6A 4Q3MA 5I3DA 2DUZA 1X6LA 2C7FA 1IE7C 3TR2A 3BW4A 3HPFA 1ZY9A 3CL6A 3OZYA 4LGXA 4PRTA 1H61A 4QJ1A 4S3CA 2H3BA 3QJAA 1OYCA 4GYFA 3UJEA 3V5CA 5D4YA 3TA9A 4JCLA 2GZXA 1ZAHA 2J13A 3NSMA 1V3HA 5BXPA 3QR0A 2EXOA 2W4XA 2FZ8A 1RLDA 2DT1A 5M3WA 2PI6A 3NQAA 1CGUA 4YPJA 3UT0A 5BWFA 4KW2A 2EEXA 3PWAA 2IXVA 3NJ3A 4FS9A 3T4WA 3WK3A 1ONXA 4TV6A 2P76A 4TX9A 3GVQA 4FNQA 3VZXA 2CHRA 4PMZA 3CPRA 5HWJA 1X8FA 4UQEA 3SI9A 3GW0A 5IBXA 1CIUA 3VNYA 1I1WA 4YHEA 3CUGA 3V5OA 1V6WA 4H04A 4ALDA 2J6VA 2C18A 3I4KA 2E6FA 3PUDA 2E25A 3GXTA 3VMNA 1MO0A 4L5ZA 1PTGA 3TIMA 1RUSA 1OZMA 3LI1A 4MPKA 1TWIA 4CQ8A 4TX8A 2ZRVA 1P6WA 1POKA 8CGTA 1CXFA 1UKQA 3O8AA 1WDDA 3GIPA 3S1VA 5LGXA 1ZPTA 3IUIA 4FNPA 3H21A 2XVKA 3KBWA 3NPVA 2A3BA 3C0QA 3DERA 1HZYA 2PLKA 4OUIA 3G0SA 1Q2SA 2AL2A 3ENLA 3F4DA 4AD3A 1KCKA 4H9UA 4XSMA 4XAGA 4L4LA 5B7YA 3QR1A 3EKGA 4F2BA 4XAPA 4C6JA 3HV8A 1W5OA 3MY9A 3ZFHA 4GCAA 1LF1A 5H8MA 2F7FA 3GG7A 2Z28A 2X0HA 1J6PA 1M7JA 3WJZA 5C70A 3VKJA 1AQ0A 3KXQA 5LIYX 5A6BA 4A05A 5JBFA 3R8HA 3OODA 1VFTA 2A6LA 1GG0A 1ICPA 2ZZ6A 4N7QA 4AX6A 4RE0A 3ISIX 3WFZA 1A5CA 4GXMA 1EP1A 5AVHA 4QIUA 3AZSA 3T44A 3NL2A 1JYWA 3YPIA 4C1NA 3M6DA 2YDSA 2XIMA 3ITGA 1UWIA 3U9IA 4NI3A 1NFGA 3PNZA 4MWAB 4RE2A 5FEWA 2O56A 4LUSA 3VGGA 3VMOA 5TQLA 2KX9A 4RXFA 1E3XA 1XYFA 2BFGA 2PB1A 3OO2A 4ACZA 4GKLA 2JGYA 1PCWA 4O13A 3UPMA 1QCWA 3LENA 1XUZA 3WH6A 1OCNA 1XH1A 4UTWC 2J47A 4WLCA 3EX3A 3SCVA 4AY1A 3KM8A 5BNKA 1OB0A 4JPGA 4Z1BA 3P81A 1E0TA 3MB9A 1R6WA 2VWTA 1FWFC 4FLRA 3R8GA 2V5LA 4P8UA 1FWCC 2PTXA 4IPLA 5H6HA 4BKNA 1TZZA 4LF2A 2XIIA 3MBDA 5KZDA 3EBVA 1Z89A 2E3ZA 1JPMA 3AWNA 6TIMA 1XHGA 3S2CA 4BF5A 1J4EA 2EG7A 3TU9A 3LB0A 1YDYA 3TROA 2BXZA 4DUOA 3THAA 1XLCA 1HP4A 1K7FA 1GW9A 1ISYA 1NP0A 1JFHA 2J62A 4PA8A 3QKZA 3T40A 2B4GA 4ZOEA 5C2XA 5TBOA 5BYWA 1SZEA 1H63A 4WIWA 3RDKA 3P14A 4IIBA 1M3UA 3KP0A 4QQ3A 4Z2JA 1Q6OA 2V3FA 2WJEA 3EPNA 2WM1A 4Q8WA 3GNNA 2IW0A 2FLIA 2J9ZA 1KBKA 3TTQA 3LXBA 1MW1A 2DZWA 3MVTA 5T8GA 1UR3M 2E28A 1ZRQA 3W3OA 3HG4A 2J66A 3HJEA 4OTKA 5B80A 1QPRA 4NAEB 3TFCA 2J9YA 4H2HA 3WH7A 1WDQA 1RQEA 3TE9A 2PTYA 5FEXA 1GHRA 2WBKA 4HZ6A 1Z6KA 3ABQA 5H8UA 1KM0A 4GJIA 2DW7A 3IGSA 2W63A 3P84A 3NNTA 1FP9A 1Q3NA 3MKCA 2B7NA 3WUEA 1WAWA 1NU5A 4XBJA 5BW6A 3IACA 3QRHA 3FXGA 4WOQA 5EMJA 3CAWA 3V1HA 1XGZA 3LSCA 4FI4A 2IKGA 4I7WA 2VMFA 1AZ2A 4FNTA 3UCDA 4KF1A 1REQA 1XS2A 2Q3RA 1Q6CA 3VNJA 2QLYA 4KCWA 4MWAC 7ENLA 1L8NA 3C0SA 2JALA 2CETA 1F6PA 3QFEA 2GJLA 4O12A 1LRTA 1ME7A 4LAUA 1IWBA 1RCQA 4GY0A 3ZIZA 2L5HA 2VX5A 3NAVA 4TX6A 1DWJM 3WENA 4B5TA 1AODA 2VEGA 2QJNA 4JKLA 1IIHA 3G1FA 3THCA 1KM5A 1FTXA 3QW3A 3I7RA 4UQCA 4C6KA 4CD4A 3ALGA 1OCQA 1YXDA 2CXGA 4DLMA 3GU9A 4JTGA 2PDNA 1YDNA 4HZMA 4X61A 1TA3A 1WE5A 1H5VA 3EPOA 4GE8A 1K1DA 2Q09A 1JDFA 1LBLA 5XIMA 2V81A 5IDZA 4HHLA 1ZBWA 4LANA 2PRHA 4PB4A 3IEBA 5K9CA 5D2TA 1ITCA 5CC6A 5A3HA 4GC3A 1F4HA 3GFXA 2WM0A 1QBAA 4MJZA 2QUNA 3MSDA 4XUYA 3KAOA 3W1RA 3VVGA 4CU6A 1IR1A 3RM4A 1HQTA 1MWOA 3PPCA 3OGSA 4H83A 5CLWA 2VCAA 3KLKA 3AS3A 3O07A 4PRRA 3TWAA 4DUVA 1RHCA 1UR9A 4Q4SA 3BCFA 2ZZ3A 3NVTA 1J9YA 2YBUA 5BMWA 1V6XA 2J8GA 1PO9A 2OLHA 2PDPA 2QIWA 2OYLA 1M65A 3A6OA 4UTIA 4GVFA 1JYXA 4H9ZA 2R94A 4XV0A 1LL7A 4DYJA 4G2DA 3G3MA 1GONA 2CBJA 1CXLA 3GM8A 4NNCA 1N82A 2EPHA 2ZTJA 4UCGA 1J0JA 3MP3A 4D71A 4W88A 1JI1A 4O10A 1CLKA 4L4PA 1IHIA 3C2VA 4PEKA 1TWSA 4TTUA 3C2OA 2FMNA 3WLIA 3DDMA 1SFLA 4H19A 2Y61A 1EZ2A 2OODA 4CQBA 5DF0A 4KPLA 1K70A 2ABBA 2AL2B 2V5BA 1OX6A 4GACA 4IX2A 4WQ6A 5FEZA 4NAFB 1OX4B 3PZOA 1I0BA 5A6AA 1VJSA 1ISZA 4LUTB 5FI8A 4MNLA 5LIXX 3GDBA 4TUFA 4AVNA 2VEKA 1RALA 1J18A 3GVRA 5BRBA 3T0DA 1HNYA 2R24A 1Z3NA 4D6FA 3H24A 3L2MA 4DZ5A 1SJAA 3FHAA 4QJ4B 3UR2A 3M07A 1KWKA 2F8QA 7A3HA 1AH0A 3BLPX 3K4WA 4ATDA 3UJ2A 4JFVA 2QCDB 4D8AA 4DB7A 4UNIA 5AYYA 4JYDA 2CLOA 3VILA 1T8XA 5LXXA 3ARRA 1IWPA 4C5ZA 5A8QA 1DTNA 3V4BA 2HMCA 1F3EA 2G3MA 4MY1A 4UNLA 1V3KA 3N34A 5G1MA 4HMEA 1R9ZA 4US6A 3PZUA 1WKFA 3OHIA 3U5UA 2V69A 5AN7A 3QC0A 2HS6A 1B9ZA 5G5IA 1GK8A 2ZUSA 1LCOA 1F6YA 3W2NA 3WQCA 4HTYA 4QS5A 3W7EA 1MUWA 3W84A 2VC7A 1L9WA 1O68A 3EWZA 3MI2A 1VBGA 1PSCA 2Y5SA 1EA9C 3PNUA 1X38A 1XYCA 1K4HA 2G8ZA 4FLQA 4IG2A 1WZKA 2QCMA 4BWLC 3TC3A 3SCQA 1Z48A 4TU1A 2YGYA 4I7VA 3WIJA 4U3CA 5HWMA 1Y65A 2Z2UA 1XX1A 5K2ZA 2CC0A 3HQPA 3V0TA 3S6DA 3RK8A 1VC4A 4ML4A 4MZ1A 2WZIA 4GYJA 4MG4A 3AYSA 4GQQA 2QMKA 2XH0A 3C3NA 4AFYA 4MVAA 1DJGA 1B3YA 3E3HA 4KETA 2WMKA 1K7EA 3MT1A 1ZBVA 1R3RA 3EMQA 1DPMA 3S83A 2BB0A 2CLLA 4DJDD 4ZVJA 4JCMA 3G1AA 1TJ2A 1V93A 2GGGA 4PUJA 4XKYB 4JNYA 3HQ1A 4ZFMA 4KKXA 3CAKA 1VF8A 3CU2A 3CL7A 3NSNA 1W1TA 1GPWA 3O3RA 2FFCA 1X98A 3VDGA 1RZMA 1GVEA 3WSUA 3RCMA 1OFPA 4HNTA 3NXLA 4JKKA 2C13A 1WO2A 1S46A 4HP5A 3DFTA 3ARSA 3LTYA 1H11A 1R5YA 3QN3A 2Y5EA 1TTQA 3G0UA 2P88A 3UJSA 5FF4A 1XLGA 1F8MA 4Q33A 3WJYA 3DFQA 4JFWA 1EJRC 1AL8A 1F3TA 3KHJA 1FCQA 2GVJA 1T41A 4B91A 4RPQA 1MFUA 1C8QA 3M4HA 3QPEA 2VZSA 3JZEA 4QBXA 3GXPA 2I14A 2YLLA 2GGEA 1E40A 2WK2A 1E6PA 3HGSA 3IK2A 1Z9AA 3W07A 5BOFA 3C5QA 1EZWA 5GJNA 4BWLA 2RDUA 4CCEA 2PF0A 4QE4A 4YWSA 4XZMX 4NXKA 3SUSA 5JIWA 1N8FA 1IGSA 1XSJA 1EXBA 4XBKA 3EX2A 1JZ5A 3A24A 3OB8A 5KTLA 3VKDA 3S5ZA 5DO8A 2OO6A 4IX0A 2EKGA 4R7OA 4GHRA 1H7WA 1J5SA 2IMRA 2XVNA 1Q2RA 5EKYA 3CK5A 2V5KA 3OPSA 5REQA 2V5JA 2OOGA 3HOJA 3N6JA 4LEQA 3BLEA 1IEXA 4DELA 3HQOA 4GPNA 3DFNA 3QR3A 3Q45A 5DXYA 2PP0A 3KWXA 2DZSA 1TZ9A 2WKGA 5CC7A 3WZ0E 4FIQA 3TVAA 4E2DA 1HVQA 3S0CA 1H0IA 1ZP4A 4UFIA 3FJ6A 5CSYA 3M43A 2XFWA 2VFEA 1UR1A 1TR1A 4AUBA 3BO9A 5ENLA 1W32A 2D2JA 1E72M 1KXHA 3DN5A 1VZWA 2WC3A 1TTJA 3QW4B 4ZSTA 4K1WA 1R9XA 3WQDA 1CPUA 4E8GA 1FRBA 3NDOA 2PU1A 4V33A 1UZ1A 3QPZA 2R6OA 3GXFA 1O60A 3RX3A 4GOAA 5K3VA 2ZUUA 3LM3A 1K8YA 1M41A 4EXBA 5KITA 3W37A 4ZOBA 4JHZA 5LIUX 4IMEA 3W70A 4QJ3B 3ABOA 4LCRA 1RJPA 2XIOA 3AS2A 5HULA 3KCJA 4EPDC 2DJXA 1DE6A 4MZ8A 3LCIA 3SCPA 2D1ZA 5FL1A 4F66A 4S3DA 3OBKA 5AHLA 3MI6A 3A5FA 2TSYA 4ZENA 1A5BA 3NGJA 4O1FA 3BCDA 2C0HA 4M6PA 5G2IA 1EO7A 1XRVA 3CYVA 2D22A 1VCFA 2H6RA 2ZC1A 2Y1HA 3BAJA 1H5YA 3MKKA 3U57A 2QUTA 3GAKA 3E49A 3S8HA 4ZE4A 1JPDX 4CGTA 5IRPA 1C9DA 3S42A 4ZFCA 3IJLA 1VR6A 1K9TA 1BWVA 1P5BA 4ORIA 4MB1A 1CGXA 3QF0A 3O63A 4HNLA 3SRDA 1Y8BA 3AXHA 1B4EA 1FA2A 1BYDA 1VRXA 4IQLA 4H4IA 1HJUA 4S2BA 1XFBA 3TTEA 1PZ1A 5J5DA 1TMHA 4TMBA 3BG3A 2QW5A 4IGHA 1V8EA 3BGJA 3HMCA 5ABGA 2OLSA 5DT5A 4M6UA 2W79A 3N29A 6TAAA 1TQJA 3CAVA 1HL9A 2DSZA 3QY8A 4XO7A 2F6KA 2Q8XA 3F1QA 3WQEA 4OECA 5G4EA 5AHIA 3BLFA 4AY7A 3QSRA 3OVRA 3WLRA 1O66A 2E77A 3EGJA 4XZWA 3EOLA 2DUAA 5A94A 4CN4A 5DY2A 3W24A 2J24A 4IP4A 3Q2DA 1H09A 2DEPA 4ICNA 1H7XA 4CN6A 1IT7A 1A50A 1PL9A 4MKNA 1G6CA 1EB3A 3RM9A 3PJXA 3CTLA 2B7OA 3NQBA 3PZGA 1GPFA 4HHPA 1YHTA 4AG0A 3WLMA 1H7PA 1A4MA 2XM1A 1HL8A 2D0HA 1OF8A 4Y6GA 5J5RA 2W6RA 2NVCA 1BYAA 4ZSUA 1PYMA 3UZZA 3L65A 2XTKA 5HDRA 3WNKA 4ICMA 4Q7NA 3W7GA 1U1HA 3UWQA 4XIAA 4MAZA 1JDCA 4F3HA 3VD7A 5HMEA 1JD7A 4EK7A 2WPGA 1CCWB 4I7UA 1ENUA 2ZE0A 1CENA 3NM1A 2OGYA 5D9OA 4M29A 2DW6A 4DF0A 4A35A 1P43A 4KRZA 3VGBA 2RJGA 2BTMA 3DOPA 1DQXA 4EPBC 4A21A 1HG3A 3WNMA 3HBLA 4GYPC 3HV9A 3HGOA 2DZBA 3IIZA 3EOOA 1UOZA 3C86A 3FK4A 1UWRA 3CZLA 4DNHA 2VX4A 1EJVC 2YJQA 4B5XA 2PC8A 4JFSA 1JZ4A 2A4AA 2PU0A 3NG3A 3A4JA 1PKYA 3IUDA 4JIHA 2I5IA 3LNPA 2AAMA 4H7ZA 2GJRA 3K4AA 3VOJA 1UWAA 3UZJA 1CB7B 1WKEA 1A49A 1VFMA 1WAUA 1E4LA 3BZJA 1UASA 3SRFA 3GAYA 1PBGA 2VTFA 2HBXA 4PUDA 5I6SA 3IIOA 1B54A 1UA3A 3BCJA 4R7WA 1E5NA 1OGGA 4GVGA 5HR6A 4ZB5A 1OIFA 2OCZA 5DCEA 4Y8FA 2FB3A 4PCTA 3EX6A 1SR9A 2RGMA 3STGA 4HJWA 3FA4A 1AQFA 5HWNA 4XAZA 3WF3A 6PTDA 3FJNA 4OE7A 1M9HA 4A3QA 1H0GA 3ITVA 4HGXA 5CQ1A 4QDMA 4PUNA 1DEDA 1PJ9A 1WPCA 3SN4A 3JZUA 2D3LA 2BV9A 3P62A 1EA0A 3WMBA 3BJTA 3W2LA 3HPXA 1VYSX 1D7FA 3O6YX 1YBQB 4YMZA 1Z44A 1OC5A 3GR4A 7CGTA 4IP7A 1G4PA 8RUCA 3G2GA 1SU5A 4P7OA 2IXUA 2HSAA 3U2EA 1UD4A 2V2CA 1E0VA 3E2RA 3A64A 3ARTA 4Q8NA 3TQPA 2VGFA 1LYXA 1SPQA 1MFVA 2NX3A 2WKJA 2AMXA 3UG4A 5FOOA 2OQHA 3AXXA 5LNWA 4LYPA 4M51A 5HNUA 2X40A 3TFXA 1XLJA 2NX1A 3P74A 4XD4A 3ZWSA 3GG8A 3PG8A 3QGVA 5FIPA 3UZ5A 4H8VA 4O52A 4F0RA 2TPSA 3ATZA 5D9PA 5CZTA 2WLYA 3QY6A 3RO6A 3S4TA 5C2CA 3AUOA 3GTIA 1J0HA 2YA2A 2XPKA 4ZXLA 5E5CA 2FKPA 8XIMA 5AYXA 3NQDA 3BK0A 2WSQA 1OFRA 4PGLA 4MUZA 3LPGA 3NQFA 5EMUA 1S5MA 1Q63A 1KKOA 1LT7A 3KBVA 4HJFA 3GIQA 3QOKA 4LUSB 2E5CA 2OPJA 2I9UA 1NFBA 1O1HA 1UR4A 1YTKA 1L6FA 3STPA 1KM2A 4GNVA 3CHEA 3R25A 2YCLA 3TTOA 3NDZA 5AYIA 3W7IA 1XISA 2W66A 4QNEA 2OXNA 2PBOA 3MTWA 3M47A 1FQ0A 3UF9A 2BX7A 2V67A 2CEQA 1RA0A 2VUYA 4LBRA 3W2MA 4L1WA 1NAL1 2ZXQA 4S3FA 3ZLGA 4IMCA 1R47A 3TONA 3L12A 5HQEA 1C8YA 3L5LA 4AX7A 4URIA 2VZTA 5I3HA 5AC4A 3N9KA 1QNVA 4LVBA 2FMOA 4UOJA 3PB0A 3KRUA 3GQYA 3K8MA 3VX1A 4LY8A 4Q4OA 5CPMA 5E0KA 2X2YA 2I17A 4GWEA 1AL7A 1Y7VA 1IXNA 5A6KA 4H00A 2CNCA 2E6YA 1PAMA 1JULA 2J75A 1G69A 4DZIA 1OEPA 2VR4A 1JUBA 3TEVA 3WQFA 1HN1A 3M16A 3UWYA 3CO8A 4C6FA 3AICA 3QGAC 3P0XA 2HNEA 2PDIA 2JKPA 1YDOA 1W17A 1QVBA 1E6SM 2EPOA 4XZIA 1UH3A 4J28A 2OZ0A 3M5VA 1QBBA 1SSDA 1VBJA 3SQLA 1IIGA 2FFIA 2R82A 4F0HA 1VFOA 2WPBA 5T9CE 1L2QA 2CZEA 3WQPA 3W1QA 1H3GA 1GJWA 1CGVA 4JIEA 1WQ5A 4DO4A 3WFLA 3UVIA 1Y5XA 3ZVIA 3M0KA 3SDOA 2HVOA 4O18A 1RJQA 4I9JA 4Z17A 4NJGA 3EDFA 1U22A 4MDPA 4GIYA 4D8LA 2D20A 2ZUMA 3AO0A 2KAUC 5TNVA 4JOMA 1W1IE 1EBGA 3C3UA 3FX4A 3UZXA 1JZ7A 2P5NA 3FNDA 3T0CA 2TRSA 4TQTA 4ZO6A 1VEPA 3AMGA 3EYPA 4A3RA 4F9JA 3GTNA 2ANUA 2ZWZA 3CPUA 2EAWA 3B4UA 5BRQA 1FX6A 2Z00A 4ML9A 1Z69A 3ABRA 1UP3A 3BGGA 3BE7A 3G1YA 4H01A 3AWOA 4PTMA 3TJLA 2BGQA 2VJXA 2BWGA 2WHLA 2V30A 2ISVA 1W3HA 3QC3A 2XVGA 1SQ7A 2O92A 2DT0A 1YE4A 3LD5A 4AHOA 1S1PA 1PDZA 4JEQA 3W23A 3W1NA 1NM9A 3GDLA 3FSTA 4GNKB 4AAJA 4D1IA 2WZHA 1DJNA 3B8DA 2V6AA 2R1MA 4GYKA 3RX4A 3VE7A 3APGA 1SUXA 1KBLA 4UQAA 2AKZA 3M7WA 5HNNA 2GUYA 1GTHA 4JIQA 2JF7A 1EJTC 4C1KA 2WQPA 2CHNA 4R9OA 1QFEA 2H90A 1ZUAX 1S5TA 4DO5A 3IIVA 5T26A 1XSIA 4REQA 3TJIA 1F76A 5BOOA 4XQ6A 3NFUA 5D09A 4LH8A 1LQ2A 1UP0A 4XWUA 4IUOA 2PP1A 1JDEA 3C8FA 1PZ3A 1TCDA 3TMLA 2PWEA 1TTIA 1JDAA 1EQCA 2CZ5A 4AHPA 4F48A 5H91A 4E38A 4F0KA 2GFTA 5FSEC 3H7UA 2CFFA 2Z1BA 1XKJA 3F5JA 3CHVA 4LS1A 3KTCA 1OY0A 1JXKA 4RDWA 2ISSA 5HPCA 2G96A 2PGWA 2NUXA 2YPIA 3VK5A 4H1ZA 5A8NA 3SCOA 1A0DA 2TAAA 3POHA 2QYGA 2DP3A 1MZRA 4GA8A 4QDWA 2JGQA 1TX0A 3W87A 8A3HA 3AC0A 3TQVA 3LZ3A 3VNKA 5JXQA 3S3GA 1UP2A 4B90A 4F8XA 1X1ZA 1HGYA 3QFWA 2QQ6A 3J7HA 1BLIA 1NDVA 1ZBKA 2VRJA 1B9BA 3C8NA 4LS0A 5U7SA 2INFA 4S23A 4DIAA 4J5NA 1M68A 4PMNA 3WBAA 3SSZA 3SCNA 4V1YA 4CCZA 4MHBA 1R30A 4ADUA 1E6NA 3VZYA 2Y62A 1XLLA 4EXQA 5AECA 4UTFA 1LWHA 4S3EA 5A6LA 4Q7IA 4HSHA 2QF7A 4B3ZA 3TH6A 4CQDA 3BDKA 4K3ZA 3V0SA 3PZTA 5DQPA 4AVOA 2A6NA 3BL3A 3MJMA 2EO7A 4U3AA 3RLUA 4OGZA 4M1RA 1J01A 3PVFA 1X6NA 3K4DA 2RDTA 1WXJA 2XN2A 2J6XA 5M03A 1QI4A 4RDVA 4AQLA 3A13A 3CNYA 3LV6A 1SJCA 3MP4A 3BMVA 3NDYA 1B57A 1RH9A 4CCDA 3VOGA 2VZUA 4IPJA 4B2DD 4WF7A 2HRWA 2VXNA 4MWAE 2HE5A 3AISA 1JD9A 2NZLA 1TG7A 1GKRA 4AEEA 1GZGA 3W27A 5I79A 3QOMA 1S5VA 3DHPA 3W6LA 4V15A 1VGAA 1G4TA 3DIPA 3AHXA 4P7LA 5EL1A 1DJZA 4WDTA 4A8IA 1PTDA 1DJHA 3P0WA 1U2YA 4JL1A 4BQ4A 2W5FA 4J9JA 5HINA 3LZ5A 1ODZA 1DL3A 3BICA 4UC5A 2Y4SA 3KUMA 4C6BA 1QXLA 4JICA 1JCMP 5A6BD 2PWHA 3IIXA 2E67A 3SCRA 1JYVA 4UZUA 3T07A 2WO5A 4AF0B 6REQB 4YNGA 1DIEA 3PSWA 3FCPA 5HUPA 3PY2A 5DELA 1JL8A 3H2NA 3PBWA 4PSRA 2DVTA 4L64A 5H1WA 1QWKA 2VC5A 3L0KA 1GKQA 3IJQA 4QTGA 2P8BA 1QI2A 3K8LA 5I09A 1W9DM 3LGGA 3HQNA 4MSSA 1I2OA 3CWHA 1VFFA 3HIJA 3TDFA 5FJRA 3GFZA 1YXYA 3NQVA 4DYEA 1D2KA 4O1CA 5KINA 3HPAA 3NOYA 2XGBA 1WXYA 3ZLHA 3KOFA 4ASTA 4P7RA 4Y7EA 4GVHA 7TAAA 3NYDA 3IUHA 4A8RA 3IGUA 3BLIA 5DEZA 3W4RA 3W7LA 3WD3A 1CW2A 3G6LA 4R5EA 1YTDA 1A5SA 4DBWA 4GD0A 5E09A 2VYOA 3PANA 2CU0A 2ZUVA 4M56A 2YX0A 1KGXA 1GQJA 2NQZA 1MVYA 4JXCA 4PL1A 1O6IA 2ZFAA 1IEQA 4B92A 1W6TA 1KR1A 2A0NA 4MLRA 1FKWA 1NOWA 3W9ZA 2E5DA 4RKAA 5I24A 1MXGA 4HHHA 5CC5A 2QEZA 1E3ZA 1ZU8A 3W28A 2FTPA 3AIBA 1TYGA 1HKJA 2JKAA 1V0NA 3WBXA 3W74A 3DZ1A 1BKHA 4XK2A 3SRKA 3STCA 3E1F1 3LCGA 3XINA 1NF0A 3I4EA 3PJUA 3WK2A 2Y7FA 5CLTA 3WLQA 3OYZA 3PAJA 1HJQA 1GORA 2XIBA 4XVEA 3ZSSA 1XIJA 4INFA 1M03A 2VUNA 1J10A 3LBMA 4LVAA 3CPGA 3JRKA 4RZ5A 5TD4A 3ARYA 4EX4A 3AALA 3UZWA 1R38A 1RQHA 1WV2A 2BMBA 2BNJA 3C6CA 5CPOA 1QO2A 2CKRA 3RRXA 4W9TA 3B9DA 2NQ5A 3E12A 3SY5A 3VYLA 1PDYA 3QV8A 1V51A 3VX0A 4OBTA 3OEXA 1PB0A 4WSJA 5AC5A 4LVDA 2DDXA 5KZ6A 1UG6A 3H26A 3LHWA 4EAMA 2C6QA 2QDHA 2BY3A 4M6QA 3VIMA 2GOUA 1RY0A 2ISDA 3IGXA 4KRTA 4IISA 3UQNA 3OOQA 4MWAD 2BZNA 1UD5A 5LSMA 3SBFA 1L6SA 3R7MA 3SIZA 3BOXA 3UD6A 1EL3A 1TR9A 2FHFA 1ZHAA 1RCOB 2E8ZA 1OX5A 3NQ7A 3JVAA 1KTNA 2ZYFA 1M6JA 3URQA 4CEUC 3WF1A 1R87A 1US3A 3GVWA 1ZBCA 3DI1A 3FHQA 3MPGA 1DVJA 3OHMB 4BQ2A 2OB3A 4TXEA 1Q5MA 1F5ZA 3L66A 2Q8LA 2I9EA 4DBDA 5HJLA 1U1UA 5D2VA 3NPUA 3TNOA 1D3GA 2UY5A 4IFKB 4IMGA 4PUWA 3PP7A 4Q7BA 1FWGC 4AZCA 2VZOA 1R85A 5MF5A 3P7YA 3LHTA 4C7GA 2YYUA 4IIDA 2QUVA 4YTTA 3CBWA 4I5XA 1SR0A 1XG3A 3LK6A 2HWGA 1UR2A 5D02A 1SSGA 4LQ1A 2QXWA 4XZNX 4XZLX 3UG8A 1KCXA 3RPTA 4ATWA 1G67A 2IKHA 5BXSA 2PRMA 4B3KA 1CXHA 3WO8A 2CLKA 3PZNA 1TVPA 4EOUA 1MNZA 4FR6A 4TVCA 2WMIB 2PWFA 1K02A 3FKKA 1C3FA 3TYEA 1FDYA 3PF3A 3RCNA 1V08A 1B31A 3WD0A 3L4ZA 1PCKA 4NUWA 1VYPX 3ZYZA 5A95A 4HK6A 2BHUA 2J74A 3OLIA 1KFEA 3TC6A 1RY8A 1VQTA 1PUDA 3S1WA 1W3TA 1FH7A 1BD0A 3R0DA 4Q6XA 1PHQA 1QOXA 1ZCOA 5DT7A 2GQ3A 4JAWA 1QNQA 2VX6A 1P6CA 2DQXA 2QZRA 3MBFA 5I3JA 3G1XA 3NPXA 4WD0A 2CESA 3GUGA 2PGRA 1MYRA 3S6OA 1W5MA 1S2UA 3L7RA 4FOJA 4MY8A 5CBBA 4E4FA 1KNWA 3W0KA 3OGVA 2UY2A 3S9ZA 1UUQA 2WYSA 3B8UA 4IWWA 3EAUA 1YYAA 1TWDA 3WK1A 4M24A 4IPPA 1XW8A 3EA3A 3AYTA 2V2HA 4LUJA 1AA1B 3LRKA 5DFAA 2Y8KA 4NNAA 5F4SA 3U8GA 1W3IA 4CD5A 1XG4A 4QJ5B 2AAAA 1XLMA 4X60A 1QAPA 3GKFA 3W7JA 2QKFA 1EJSC 3V18A 1FWWA 4H9XA 4I9MA 4CQ9A 4JTCA 3U4AA 5K4ZA 1AH4A 5A2CA 1R86A 3BAWA 1Q6DA 1K9FA 4LSBA 4HNVA 4NKCA 4PFHA 3WMCA 1YNQA 2ZQ0A 1G5AA 3IANA 4CVWA 1WCGA 3E96A 4J2PA 2JEQA 3B8SA 2GQAA 2Y5JA 4GRSA 2J79A 1R8LA 2WWCA 2WC7A 1AQHA 1GJPA 1K6WA 4ZQOA 4HA1A 5F7UA 3QHOA 3TP4A 4IXHA 4K1GA 4K2SA 3THQA 3RMEA 4RJEA 1DP0A 1HTIA 1JF6A 1GQLA 3TYBA 4KWOA 3CZKA 4NVTA 4HYWA 3A9BA 1QRQA 3TTSA 3VZZA 1JZ6A 4LS2A 4MGGA 1J2WA 4UBPC 3DFHA 4BK9A 5AC8A 2DPEA 2W3ZA 4ZO7A 4LW7A 3PTMA 5T91A 1GQNA 4PMRA 5F2LA 2ZX6A 5C7HA 1V79A 1OD0A 1E15A 3UA3A 1FWJC 4ZA0A 3F03K 5CAKA 5E93A 4MZYA 4ATLA 3WF4A 5CAHA 4LAMA 5DY3A 2WSRA 3O0KA 4N4PA 1EO5A 5E1QA 3VNIA 2X1TA 4EIVA 3GX9A 2Y7GA 3BOLA 1FFQA 2IKIA 2WZMA 4Q4MA 2X1UA 4D72A 3W73A 1EDGA 1X7FA 1ADOA 1QK2A 3W7HA 2VL4A 1EJUC 1E6ZA 1VFSA 3UXIA 2YFNA 3WD4A 3ONBA 2XZ7A 1BEUA 2EPMX 3E74A 3W01A 4OV9A 3FW6A 3R11A 3T55A 1S5WA 2Z29A 3GU1A 2BGNE 2J8TA 1XLFA 3M46A 2V5CA 4GUJA 1VFLA 3MUZ1 2GLKA 5C0QA 1A47A 4PTVA 4X9YA 5L6UA 1R2SA 1WDSA 1LORA 3WD2A 3U6WA 2ZRZA 1WKDA 4YN5A 4BEQA 4RL3A 3WDHA 1FHVA 3VPLA 5E0FA 6CGTA 1MQRA 2PAJA 4WXYA 5CJ5A 3KTSA 2WZTA 1NWSA 1EEXA 4C6PA 1GVIA 2BY1A 4CNPA 3CZ8A 2XVPA 1SO3A 1CGTA 3R10A 1UWQA 2CZDA 1XBXA 1Z8AA 2JIEA 1PZ0A 1UROA 3MW7A 4J3ZA 3MZ2A 4XZHA 4R85A 1UCWA 3W86A 3GZAA 5DN1A 2BOFX 3MO4A 5I78A 1UQYA 2D2OA 3SFWA 1UYQA 4JTJA 1FWRA 3ZS4A 3NGFA 3QEZA 3RGTA 4FA3A 1KV5A 1J11A 5HMDA 5C7VA 3F2CA 2QT3A 3FGCB 4QFUA 1AW1A 3OLGA 4E2BA 3N13A 3C0JA 4MAVA 1VYRA 2DY3A 4NZJA 1UJPA 3PUOA 2ZA3A 1YRRA 1EOMA 3GBEA 5IM51 3MMUA 4P2VA 3HGRA 1UPMB 3RO8A 3P8JA 1UH4A 2D2HA 1EP3A 1NSJA 4OOZA 3R8RA 5LA0A 4HIBA 2IQTA 3IRSA 3L4VA 3CXOA 2HQAA 5CKSA 3KWSA 1AMYA 4WR3A 1TZ7A 3RPMA 2V2DA 4KMQA 4GZJA 2GGHA 1P6BA 1E56A 2Z1KA 2P50A 1O5RA 2XFRA 5I3FA 2QIIA 3KX6A 1QPNA 1BHGA 1HVXA 4PUUA 1WDWA 3RRAA 1A53A 4YTUA 1LP6A 2POZA 3S5OA 1LLWA 3EDJA 4EE9A 4O1BA 1Q8JA 1W1A1 2DIJA 2VEIA 4IFOA 3RLVA 1I8JA 1KRMA 3FFSA 3IJ8A 3KCLA 4UIOA 3T78A 4YJ5A 3NZQA 3REQA 1NP2A 3BOFA 1GNXA 2XWDA 3FYYA 3T8QA 1HT6A 4FX7A 7ODCA 3ANYA 4U5IA 3VA8A 3N3MA 1FWEC 4BI6A 1JZ3A 5C8BB 5IXEA 3T4CA 2QDDA 4JIRA 3ARXA 2FPYA 4NRRA 1R3TA 5JMUA 1PXGA 4AXNA 1F8IA 5D04C 1XLKA 2PWDA 2MUCA 2XM2A 3A12A 3PZQA 4PMOA 1KV8A 4Q4PA 3ARUA 1OX4A 1LLOA 3KHDA 4HPHA 4MFDA 4XZ9A 5KZEA 1XRTA 2QHAA 1KC7A 2RGLA 1C9WA 2X16A 1CGYA 4HYRA 4UQDA 2CYGA 3E2QA 1E0UA 4RLIA 2QMJA 1JZ8A 1QASA 3TZFA 4BQ3A 3PBMA 4QHRA 1L8PA 1CGWA 2HV5A 5A2BA 4OHQA 1RP8A 3N04A 2PZNA 2X42A 1GYLA 2FIQA 3VC6A 2A7NA 1ONEA 4FR1A 1KW1A 1NOUA 2ON3A 2YL5A 3MMDA 1OK4A 4Z1DA 2XU2A 2Y88A 1HKMA 6A3HA 3WL1A 2WZEA 3QMRA 2YL9A 5EA9A 3THUA 1GW1A 3BW2A 3W1LA 3CB8A 4DLFA 1HGWA 3SIMA 2C8NA 3OQEA 1LBMA 3EMZA 2FTWA 5G2HA 2Z26A 1RAKA 1UWTA 3ME3A 1I6NA 5GNZA 4AB4A 4V2XA 4IMAA 7XIMA 3KL0A 2F2HA 5C54A 1P0BA 4GVIA 3GYCA 4N6EA 4KFOA 1ISVA 2FGBA 3XISA 3RR4A 3SCUA 4LJ3A 4GUIA 3ID7A 4RNHA 2VP8A 2VC6A 3W88A 2WVUA 1BRLA 2QJGA 3KOXA 1F3XA 3KOYA 1ZFJA 1AW5A 5DBTA 3L5AA 4I9AA 1VD6A 4MOZA 1XD0A 3PS7A 4YCPA 2E6DA 1QK0A 4UR7A 4FK9A 3A22A 3EOEA 1VLWA 1SMAA 3PTKA 5AHMA 4H8UA 3UW6A 1VRDA 4YS1A 1R2TA 3UNDA 2HE8A 3N19B 3AOFA 4J3XA 2CCRA 4PCFA 1FUYA 7REQA 1ZJHA 3GK0A 2Y2WA 2VNCA 3GKAA 1OM0A 2GL5A 1DIOA 2V0TA 2V5DA 5F4WA 1KTBA 1DJXA 1US0A 3T09A 3VI2A 3WQGA 1Q65A 1X96A 3L4UA 3IJIA 4Z1AA 2E68A 3DI0A 3QYQA 2NWRA 2X1RA 4C6MA 3TYUA 4HU0A 2YFOA 4O8RA 3FAXA 4YWIA 4DX3A 2Z4GA 2C71A 4A3HA 3HF3A 5G4HC 2DZTA 3NQMA 3Q65A 3TX9A 2I5GA 3N2BA 2WNZA 1KGWA 4X3ZA 1F07A 4O28A 3VNZA 3U48A 2G4FA 3UYIA 1RK6A 1UBSA 3MU7A 1RVKA 2OMAA 3OZMA 3A23A 5XINA 4BHYA 4F0SA 1R3WA 1JUKA 3H6OA 1FHUA 3WQ5A 2PD5A 3GTXA 4UTMA 4PMDA 4BQ5A 1KM3A 4Y9AA 3VCCA 5F4XA 4QS6A 1UR8A 3ALFA 3T0AA 2DVXA 2WCAA 1H50A 2Z6JA 3NM3A 3P93A 1A0EA 4RNJA 2HVMA 4G7EB 4LF1A 3GFYA 3V3WA 3LOTA 3NA8A 4LAOA 1O5QA 2NVAA 4HT3A 3UGVA 2VZVA 1KFWA 1FDZA 1OABA 1NDYA 2VO5A 3H4XA 2E7FA 1J79A 2VR5A 2BASA 1SM9A 1NDZA 3CZJA 3OJGA 4BS0A 4US5D 1SW7A 2BXVA 1ZP3A 1MXSA 2XYLA 4JQAA 5FKYA 1TUXA 4BR1A 3BLLA 3DU0A 2EPLX 3GHUA 3W7CA 2DZVA 4HU8A 3AMCA 2OZ8A 5IHRA 3IARA 3QLDA 3CLMA 1JF5A 2OSWA 3LXCA 3IRDA 2A3LA 4D6JA 3F2DA 2DUXA 2VDGA 3RM8A 1IZKA 3B97A 2PDYA 3O6CA 3H55A 2WVVB 3G24A 1OBAA 3VOFA 1U83A 4GJ1A 3WUFA 2VURA 5ABFA 1QW7A 1UD3A 4Q8UA 1XQLA 2QR6A 3T6CA 3K8KA 5LHFA 4IQDA 3KOZA 3PG9A 4PEEA 8TIMA 3PBUA 3W2JA 1SFTA 5GNYA 4YHGA 5IBXC 3WEMA 3HPZA 4KGLA 4DI8A 4NZ5A 2ZXBA 4AZ6A 4IQJA 1QWGA 1TO3A 4AWTA 1Q66A 2Q71A 1JDDA 2G95A 1N8IA 4RDZA 6XIMA 4HPXA 2ZA2A 1H1NA 2EG6A 3VXGA 3AYRA 2BVYA 1A4LA 3IK4A 4M80A 4CNOA 4B4HA 2QCLA 3ZT6A 1U1JA 3AHTA 1J0YA 2EGZA 3BGAA 2CLHA 3KZSA 4ZQPA 1YQ2A 1M53A 4O0KA 1GOQA 1AG1O 1SO5A 2E5BA 3MI3A 5I03A 4D2JA 1XGDA 1O95A 2VOMA 3FXYA 1DIKA 1RV8A 1R2RA 3LRMA 4ZE5A 3ITOA 2Y85A 4TV5A 5A8PA 4C6QA 1KFLA 1UC5A 1J0KA 1XICA 1YX1A 4XTIA 4MB4A 3TN4A 3U2ZA 3DCPA 4PBEA 4N0RA 3VDAA 2YR1A 1Q6LA 4PCPA 2WNQA 4AW7A 3MMTA 3CV2A 5FF2A 2O9OA 1ZAIA 2PDUA 3AHVA 3N9RA 3WLLA 3SCSA 3BWWA 3NIYA 3BURA 1JCJA 4JIIX 3FAWA 3MC5A 1OT1A 3HG3A 4EWJA 4H41A 4G9PA 4I6KA 2ZX9A 3LQGA 4W86A 1I2QA 4I6VA 2WWDA 1DQUA 2QJJA 4XAYA 2DFAA 1XKYA 2OZTA 1CXEA 3NEVA 3MV11 1BYCA 1HKIA 4PMXA 4RX0A 4QGCA 1A5NC 3GWQA 4E3TA 1SW3A 4LRSA 1B1YA 2G3JA 4EP8C 3EA2A 3ORWA 2PFHA 2GYIA 3P80A 1TPEA 4QQUA 4KEVA 2ZICA 1KFJA 4IL0A 1QR7A 1LWIA 1NF7A 3OGRA 3BAKA 1EYWA 2J25A 4Z0JA 1JI2A 1V3LA 2ZA1A 3UCCA 3GLCA 3CUHA 3WLPA 1KFKA 4MB5A 4MUPA 3CO4A 1GEQA 2FPVA 3W7DA 1V3JA 1DQWA 3PB2A 2JFEX 3VIOA 3P60A 1V3MA 2PSNA 2VQTA 7PTDA 1MRAA 1AUSL 4HK5A 4W84A 4NZFA 1V77A 4KCTA 3WDIA 5EPDA 1CXKA 4H9TA 1EF2A 2G5WA 3U7VA 1WB0A 1EJWC 3ARWA 5C6MA 2E6AA 1DJIA 1W1PA 4S3AA 4YXGA 1C90A 1JUEA 2PTDA 3P5ZA 2XH4A 4LB3A 5BRPA 5DMNA 1BXBA 3LI0A 3P5YA 3LX9A 3ES7A 5HBFA 3MSGA 1B3VA 2IQ0A 3W83A 4PRWA 3HM7A 1EF3A 3GH5A 3DG6A 3G1DA 3S9IA 1MEIA 1XIIA 4KIEA 1ONWA 1RQBA 1WA3A 2PCQA 1QU4A 4ES4A 4WOZA 1HJSA 3MYPA 3OZOA 2PGFA 1N8WA 2VRKA 4KRUA 2GJNA 4U2ZA 2Z7GA 1QTWA 3RHGA 1TPH1 4WCJA 2BOEX 4GC4A 4MNKA 2HEJA 1KM4A 4FF7A 2A3EA 3R2GA 1OWQA 1U33A 2ZZ2A 3M0XA 3BSHA 3GD6A 2YXGA 1HX0A 1YBQA 4K8EA 1VH7A 1KA9F 2J7GA 3F4VA 3TLLA 5CSUA 3KBMA 1T6MA 2GVEA 4AYSA 1H7RA 4XB3A 4JR5A 1U30A 4NZ1A 2FYMA 2WV8A 1JCNA 3BQ6A 4US5A 1VS1A 4MJ4A 1DHKA 1UC4A 3GG1A 1G01A 1KXTA 1MNSA 3TW6A 2OWXA 4R34A 5JU6A 3N6HA 4AZ7A 2F9RA 2V63A 1P1XA 2NT1A 4D8ZA 2DT3A 3BJSA 5AYZA 1JR1A 2O4QA 1Q8AA 2PDQA 1VENA 3I3DA 2PDWA 1GQIA 1S38A 2HJPA 4JL2A 5C9ZA 3WELA 1UZHA 4QSFA 1WZLA 3EZ4A 1Q7MA 2EG8A 3B8WA 1E71M 1FFRA 4JTSA 3UPBA 1OFAA 3VIJA 3RYSA 3GTFA 5D9MA 1DXFA 3QPYA 3IPWA 1V6UA 4X2RA 1QOQA 3S5SA 5FESA 1QT1A 4UOQA 3W1XA 3T81A 4LALA 2CKSA 2PDXA 5CC3A 3O16A 3CGTA 3R0UA 5HNTA 1D9EA 1GQKA 3SURA 3LYEA 4KWSA 2OGJA 3VGHA 3NUKA 4QE1A 4YL2A 1UKTA 2B81A 1T96A 2PEVA 1W9PA 3WNNA 1A5AA 1E51A 2XSXA 3GXDA 3LRLA 3S2JA 4JYEA 3NZRA 4MDOA 2FTYA 1D8CA 2ISFA 2X7WA 3T42A 2WAGA 3FYOA 3D3AA 4B9ZA 2VEMA 1GOMA 1FHLA 4AWEA 5ABTA 1YW1A 4HOZA 3QYSA 5HNRA 2G50A 3W7QA 4GGBA 1E9IA 2BXYA 1P0DA 3TZNA 4QG6A 3LEPA 1B30A 1OFOA 3DUGA 3VKAA 3F5LA 4ENLA 1S1RA 3OA3A 3TQ0A 2OELA 2RKXA 2RDXA 2CITA 4QEEA 2CXEA 1V6YA 1TE6A 3OW1A 3W53A 3CHDA 3CIXA 3K46A 1KBBA 3MDWA 3R13A 1ZJIA 1TRDA 2R8WA 2VFDA 3F2BA 3S2MA 1K9DA 2CPUA 4F2TA 1EBHA 4HN8A 3TN6A 3MKVA 1OQFA 4BF7A 3QH2A 1PZ2A 3LN3A 5FJPA 2JKEA 4OV4A 3H53A 4J3WA 3KVMA 1VPYA 4A3UA 3KTXA 1B4KA 5JH2A 2GK1A 3F4NA 5K9DA 3UY7A 4DBEA 1OGBA 4NYUA 4HBKA 4YTQA 4LYKA 2YXXA 5J8LA 3L2LA 1HO4A 2CERA 3LPFA 3Q67A 4IG2B 2YBVA 1BGAA 4HPNA 1G9HA 1I1XA 1ISXA 1IXPA 4PR4A 2P0OA 4A8LA 4DJFC 3AXMA 3C52A 3B8VA 2PDMA 2HK0A 3GC5A 1GVOA 1F61A 1XDMA 3I7QA 5BMXA 1A5KC 3C2YA 3ZXWA 2WSPA 3DFPA 4FOKA 1W0MA 3L9CA 3CC1A 5CGMA 3GHSA 3FVDA 1K3UA 2GDQA 3WQ8A 1X1OA 3GIYA 3ZO9A 1FWAC 1E4IA 2OFJA 1GJUA 1P4CA 2ZIDA 2CBIA 5MKGB 3TXZA 4JDBA 2BBFA 5EMMA 5G1YA 2DGAA 4M0XA 4M82A 3VC5A 4QAWA 3A3HA 4HOXA 3H4WA 4NAFA 3W26A 1TCMA 4HSNA 2OZ3A 1HP5A 2VGIA 4QCEA 1NOFA 4RPPA 1EJXC 2X09A 1FWIC 4O1AA 1QNOA 2NQJA 3E2VA 1JG9A 4X0NA 1XCXA 3M64A 3HU7A 3H22A 3FYPA 4KESA 4JQ2A 5DBUA 5LA2A 1XUUA 2Z0IA 1LUCB 3SRHA 3EKZA 4BCEA 2J7BA 4DJED 2G3FA 3CV6A 4ZBCA 4MM1A 1T40A 3NXFA 2FH8A 2VWSA 3LCXA 4HA0A 5GVJA 1IXQA 3A4WA 4LXFA 2PWUA 3M6YA 3ES8A 3MUAA 4LVGA 2G4JA 2AOSA 4EF8A 1I2PA 3USBA 3E0IA 5LNUA 3DBPA 5FAGA 3EXRA 2GGJA 1B90A 1T7LA 1PS9A 4V27A 4LB4A 2WVVA 3GNOA 1G4SA 4KS0A 3V5FA 5H8PA 2P0IA 4FALA 4FNUA 5FCZA 2FPTA 1EUNA 3MCMA 3PZIA 1CYGA 4Y9NA 4JN8A 3NO5A 3DESA 5JVLA 1XLEA 3CQHA 3PR2A 5DX7A 2GVGA 2ZTKA 1BF6A 2FJKA 1W9UA 1EWDA 7TIMA 1TJ0A 4XSLA 4G1KA 2ZCGA 2GSHA 3GVGA 3PHAA 1G0CA 4O0QA 3NEHA 1XJBA 1DOSA 2YLAA 4GK8A 2JF6A 3SN1A 2JIWA 1V4YA 3UXKA 5CBIA 1Z42A 3W29A 3NTYA 4LYQA 3W7KA 1TV4A 3KEHA 2E09A 3KVKA 2PDHA 4MKVA 2H8XA 2PPGA 3VOIA 3EOSA 4IGSA 2E1DA 1OSEA 3PULA 5EYWA 4G7EA 1ZCCA 2FHCA 3G8EA 1S3HA