2R94A

Crystal structure of kd(p)ga from t.tenax
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
286
structure length
286
Chain Sequence
MEIVAPVITTFRGGRLDPELFANHVKNITSKGVDVVFVAGTTGLGPALSLQEKMELTDAATSAARRVIVQVASLNADEAIALAKYAESRGAEAVASLPPYYFPRLSERQIAKYFRDLCSAVSIPVFLYNYPAAVGRDVDARAAKELGCIRGVKDTNESLAHTLAYKRYLPQARVYNGSDSLVFASFAVRLDGVVASSANYLPELLAGIRDAVAAGDIERARSLQFLLDEIVESARHIGYAAAVYELVEIFQGYEAGEPRGPVYPLDPEEKAWLRAAVAKAKSQLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and stereochemical studies of KD(P)G aldolase from Thermoproteus tenax.
pubmed doi rcsb
source organism Thermoproteus tenax
molecule tags Lyase
molecule keywords 2-Keto-3-deoxy-(6-phospho-)gluconate aldolase
total genus 111
structure length 286
sequence length 286
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.14: 2-dehydro-3-deoxy-phosphogluconate aldolase.
pdb deposition date 2007-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2r94A00
3UXDA 1K02A 2WPBA 3LLDA 1GVRA 2Y7GA 4WOQA 5DBTA 3G1SA 4JTKA 4OU1A 3W2KA 1EA0A 1KM0A 1W3TA 3B05A 3NZRA 1PCKA 1ZNNA 1R2RA 3W7EA 3LTSA 2ZCGA 1M5WA 2ZA2A 2Q8LA 4AMAA 2ZZ3A 4GE8A 3LBCA 2ZBTA 3G1DA 1VRDA 1H7OA 2C1HA 3G18A 4JN6A 3EWYA 3N2XA 3BW2A 5HMSA 5HNRA 1F73A 4GUIA 3M9YA 3PULA 3BW4A 3T55A 5LZLA 5TQLA 1JULA 1SO6A 1PV8A 2TYSA 1AMKA 2J24A 5KITA 3KVLA 4KWWA 4O15A 3W7KA 1G7VA 4JIQA 3P8JA 5IM51 2VKZG 2BLEA 1JCXA 2VEIA 3UWWA 3FEMA 3O1NA 2R8WA 1YPIA 4JICA 2BSLA 2VEKA 4FF7A 3ABSA 5C5YA 4A2SA 4A29A 1JQXA 5BMXA 3S0CA 3TK7A 5HWMA 2X1RA 3MHFA 4FNTA 4IXHA 2C18A 5G2IA 1JVNA 5DCEA 4AWTA 1LORA 1G69A 3C52A 5AB3A 1KM5A 1I2PA 4UMAA 3VE9A 2GQ8A 3C4UA 3HPSA 3PUOA 4LNYA 4ZL1A 2V9DA 2X1TA 1S3HA 3PAJA 5CSSA 1G4PA 1AW2A 2QJIA 2QF7A 5KTLA 5K9XA 3EXSA 1TPFA 4BWLC 4K37A 4QITA 3UYCA 2NX9A 3HGJA 1R46A 3G22A 3NO5A 4IPIA 5D2YA 1KFEA 4DBEA 4Z1AA 4JS3A 1L2UA 4O52A 4S2BA 3QRHA 3PUEA 1W54A 2H90A 3W1LA 2VXNA 2YDAA 3HBLA 1QPRA 1BKSA 2TMDA 1EX5A 2Y7EA 2JGYA 2Z2UA 1D9EA 3O16A 5DXYA 1TQJA 3FLUA 4XBKA 4Y8FA 4NT0A 4O1BA 4FX7A 1MZHA 4Z0SA 4TIMA 2Y6ZA 2CLKA 5J5DA 3LI0A 1OFOA 3G8RA 3HG3A 5KZDA 3YPIA 1VCGA 4CCCA 2DZPA 1G4TA 4GNJA 3G3MA 1GOXA 4Q4KA 3NM3A 1S5VA 1P4CA 2OJPA 1FWRA 4NJIA 1TPVA 3E9AA 4AWUA 2QUTA 4GUHA 1D3GA 3C2EA 3WK1A 5EPDA 5KZMA 1Z44A 4G1KA 1WA3A 3BK0A 1KLYA 1ZENA 5CPMA 2QAFA 4RXFA 3Q94A 3LXAA 3C8FA 3O6CA 3MMTA 1DQXA 3VCRA 3SR7A 5HULA 2KZHA 4IQLA 3NVTA 4UMCA 2G97A 4E2BA 4UFKA 2NV1A 1H7NA 5G4WA 2YYUA 4X22A 1H7RA 2RHGA 3SSJA 3U8GA 1KBIA 1GTEA 1B4KA 1ALDA 3IV3A 2HMCA 3CWOX 1PE1A 1DJNA 2G96A 2Y62A 1W5PA 3LCIA 3O15A 4N2YA 3L68A 4GBUA 4UTKA 4GUJA 2G95A 3TH6A 1BTMA 4O4VA 5D33A 3Q37A 4MY1A 3QF0A 1EUNA 3DAQA 3EX3A 1T0OA 4GUFA 2QCFA 3ZWSA 4JX4A 3N73A 3ATYA 3EKZA 3DFOA 3SY5A 4CQ9A 3P5ZA 2DZTA 4O12A 2ATMA 3ZFHA 2D73A 3W7CA 4EOUA 1N55A 3G24A 2ZTKA 1LP6A 3HMJG 4O0KA 3W2LA 1KV8A 3LOTA 5EMUA 2GOUA 2CW6A 3USBA 3GNNA 3B03A 3JRKA 1T99A 1PIIA 2DZSA 4Z1CA 3GKAA 4UFLA 5F2LA 3EKLA 4R34A 4ZQRA 1X8FA 5LNRA 3MHUA 1C29A 3KAOA 5U4NA 5LNSA 1IIGA 1VLWA 1JUKA 2GQAA 1FWWA 1SR9A 4JTHA 5F4XA 4BR1A 3B06A 2DJLA 3S5NA 4AAJA 3TUUA 2Y85A 2PRHA 1TJPA 1TV7A 3T78A 4PA8A 3EX4A 1F6KA 1KTBA 4M19A 2V30A 1OK6A 3W7OA 4K8EA 3N19B 1JUEA 2ATSA 1VHCA 1FUYA 2FPTA 4O53A 1SZGA 4ZQNA 3UPWA 2CLMA 4WJEA 1NAL1 1RD5A 3TC7A 1FCBA 5IBXA 1YDVA 1K7EA 4PFMA 4O16A 1DJQA 3HJZA 5DLCA 3W22A 1KFKA 3NQGA 2NXIA 1MO0A 3CQ0A 3VI2A 5BNKA 5K2ZA 5EKYA 5LNWA 2ZRXA 1SSDA 3GXPA 2F7FA 3W07A 3UZ5A 2J6XA 3GDRA 4A22A 3A21A 1M6JA 3W3OA 2HTMA 1GVOA 3UWYA 3CM4A 3S1UA 5MHBA 3S9YA 2DJXA 1F2JA 4PL1A 3P60A 3QMSA 4R7JA 3EXRA 2GPTA 3BG5A 3P84A 3N9RA 3WJYA 1QPQA 2A6LA 4UTLA 5K7JA 2ABBA 5DN1A 4JDYA 2EGZA 1QCWA 1FDYA 4JIPA 3CEUA 3W7LA 2DP3A 5AHLA 2Y70A 2ABAA 1WQ5A 2A85A 1OFQA 4OT7A 1DOSA 4UTWC 2UV8G 3E12A 1VJIA 3VNDA 4BI6A 3DKLA 2BXVA 2YR1A 1NVMA 4HIBA 4OV9A 4FNSA 1TB3A 4MLJA 4XUGA 4O18A 3DI0A 4JTEA 1EB3A 1F74A 1VR6A 2PRLA 3WK0A 1GJPA 1WDWA 1H51A 3LBMA 3W72A 1PHQA 3U6WA 2VFIA 3EX2A 4WY0A 3NGJA 3T7VA 2P1FA 1E51A 4X9SA 1A5AA 1FDZA 4RCXA 2E6FA 3NL5A 2ZRYA 1IIHA 4DBDA 2H8XA 3CC1A 3G0XA 2QJHA 1XKYA 3S6DA 1N8FA 2CLOA 4K39A 3W71A 3IGXA 4IMDA 1FXPA 5AHEA 4NXKA 3KHJA 3ZR4A 1W5MA 1AW5A 4NQ1A 2ZFAA 1QMLA 1I4NA 2OCZA 2VFEA 4O14A 2AQWA 4N4PA 2NX1A 5D05A 3TQVA 4IMGA 5D09A 3UXAA 3TROA 3STGA 3B0VC 1R30A 2FDSA 2VFDA 3W1XA 1L6SA 4RV8A 1LCOA 2QCDA 3NNTA 3W84A 4LVGA 1YXDA 4MJMA 2RDUA 5FEWA 4E2DA 3G8EA 1AL8A 1Q6QA 2BWGA 3W7MA 2ZZ5A 3JR2A 1RZMA 3LRLA 4ZQMA 1JJKA 4YXGA 4JTGA 4J9JA 1KLZA 4LVFA 5AYYA 2G5WA 3O63A 1SO4A 4LC6A 4TX9A 1HFBA 5J5RA 4AWSA 3RNDA 5K9CA 1G4EA 4A3UA 1ZCOA 5CZTA 4BI5A 5GVJA 3NXFA 1QR7A 3H53A 4NXSA 1FCQA 1OF8A 1W5QA 3WK2A 3LHVA 3HB9A 1XDMA 1H63A 5CSRA 4FXSA 2NWRA 1M7PA 4U28A 3TC6A 5TBOA 1KTNA 3ZS4A 3M44A 2XN1A 3PSVA 5G1TA 1HO4A 2Q3RA 3HQ1A 3T4CA 3Q58A 3DXIA 4LVAA 2O7SA 4GXMA 3TIMA 3W1QA 3TE9A 3M1ZA 1OX6A 3HGOA 6ALDA 1GYNA 5D2XA 1D3HA 3LCWA 4LC8A 1DBTA 3S5OA 5E1QA 2EPHA 2X1SA 2CLEA 3NA8A 3PWAA 1IF2A 4UTHA 1XXXA 3I7SA 3CPRA 3LHWA 5AOUA 1DV7A 5HR7A 4WX2A 3QW3A 5AC7A 1GEQA 5A8GA 1OFRA 2QEZA 3PG8A 2OMAA 4RLIA 1UJPA 3FA5A 5HR6A 4YWIA 3TW6A 4JR5A 2E5CA 2JKAA 3R89A 3WJZA 4P2VA 1AW1A 4ORIA 4K36A 5LNUA 2I9EA 1LROA 1YDNA 2YFNA 1MEWA 4I7WA 1MEIA 3B0PA 5G5IA 3W6YA 3M0ZA 3HGRA 4DF1A 4ZZ9A 1VYRA 4PCFA 2BTMA 3G3DA 3LX9A 3OVQA 4PH6A 4QIUA 3A22A 4LT9A 4EF8A 3G1HA 3NR0A 4DPQA 1LRNA 2QDGA 1GYLA 3F03K 1W56A 1NF0A 3BVJA 1VS1A 3LM7A 2GVJA 2PC4A 2V5LA 2Z6JA 2RDTA 1WXJA 4LS1A 4UTUA 4QJ1A 3C2OA 4UFIA 5EBUA 5DY2A 2CZDA 1ML1A 1Z42A 4LU0A 1KBJA 3C6CA 3GKFA 2CFFA 3PB2A 2QR6A 3TV8A 3R13A 1NF7A 1KTCA 1X7FA 1CI1A 1HTIA 2J9ZA 1U5JA 2E6DA 3QSRA 1T8XA 2JBMA 3MP4A 1EPXA 3NQCA 3HF3A 4AVFA 3QH2A 3MYOA 4IMCA 3DENA 1G4SA 3FJ6A 1FDJA 3RLVA 3L67A 4MLRA 1YTKA 3NQFA 1K03A 3PG9A 5FF3A 3W76A 2YYTA 2DZVA 1TYGA 4ONVA 1C8VA 2Q3OA 3V1PA 5K4ZA 1PS9A 1M7OA 3GK0A 5HWNA 1YDOA 4QNEA 3ANYA 1ICQA 1QNVA 3UWVA 1DVJA 3BLEA 1LTDA 4WY0F 4DPPA 1H62A 1YTEA 4MFDA 2TPSA 1TPDA 3C56A 4JNMA 2YX0A 7TIMA 3M7WA 5D32A 3HPXA 3W83A 1ZAJA 1HO1A 1ZJIA 1FXQA 2NUWA 2WNNA 2VFHA 5FF7A 2X2GA 3E02A 3TX9A 1PCWA 4CLMA 4CCEA 4M6VA 4M5PA 5HWJA 5C55A 3W7HA 2V2CA 3EWXA 3ABOA 4UFHA 2GUUA 4ICNA 4OV4A 3ATZA 2C14A 2C15A 3QMRA 3UPBA 3M43A 1DL3A 2A4AA 3NL6A 1ZHAA 3KVKA 4OE7A 1H60A 4N6EA 4K7YA 1FCVA 4AF0B 2A5HA 4XKYB 2Z6IA 3I68A 1KV5A 3B04A 1RR2A 4UFJA 1W5OA 3TJXA 4LTSA 1VCFA 3W9ZA 1H7XA 1O5XA 4GWEA 4MPQA 1TPH1 4UTTC 5CPOA 3W85A 3PM6A 4O1CA 3HGSA 4JYFA 3IIVA 1FWNA 1TO3A 3BG3A 3E49A 4Y90A 5FESA 1I2RA 1FCUA 3TCEA 4HPJA 4IJBA 2JKEA 3LV6A 2V0TA 1QOQA 3EWZA 2BZNA 2H6RA 4BK9A 1W37A 3P61A 2CZFA 1SQ7A 5FF2A 2B4GA 1SW0A 4DO5A 2WSYA 3RLUA 3LCLA 3W73A 3LRKA 3QMTA 3G1YA 3CWNA 1BWKA 3L0KA 1X1ZA 3P62A 5F2GA 1KFJA 4EWND 3QJAA 4IPJA 3AJXA 2B7PA 3IIXA 3GYEA 5F1VA 4MOZA 1O4UA 2C19A 4POCA 3RMJA 1YXYA 3HO8A 3NL3A 4NZFA 4GJ1A 4O0ZA 3B8DA 2X30A 2I14A 4I7UA 3KFTA 5AHIA 4QQ3A 3FS2A 4FHAA 4WXYA 4TO8A 4DF0A 3W2UA 1KM4A 2TRSA 3LCXA 3TW7A 1N7KA 3LCFA 3W2MA 4UCGA 3I7RA 3TSMA 4CNOA 1TSIA 1SSGA 1XBZA 1QO5A 1OHLA 2V2HA 4UMBA 3UWQA 3RFAA 5I3KA 1XCFA 2QCGA 2E6AA 4GC4A 4H3DA 3W7GA 4MFEA 3W70A 1ADOA 4DEFA 4TMCA 1ICSA 1UB3A 4UUIA 1HL2A 4DO6A 1J4EA 3FYPA 5T26A 3M41A 3MP5A 4D2JA 3C2VA 4NJHA 3LHZA 3BO9A 3PBVA 3L5LA 5D38A 1KFCA 2DZWA 1I2NA 3SJ3A 5K9DA 3W1UA 4DELA 1GPWA 4CNPA 2CLHA 3BLIA 3FKRA 5AC8A 3QQ1A 4NZJA 1B3OA 4ALDA 1JCMP 1OG0A 4JTLA 2WSQA 3UWUA 1ME9A 3C61A 3EWUA 5CPLA 5BMWA 3O05A 3OVPA 2LLEA 5AHMA 1FWSA 3CLMA 1CX9A 4NJJA 1FX6A 4O11A 1DKWA 4UTJA 1JCNA 4NNBA 5DELA 2B7NA 3A9IA 3LGEA 4MZ8A 4MZ1A 4B5NA 1XUZA 2C13A 2J9XA 3NM1A 4IX0A 3DBPA 3ELFA 3W87A 4Q32A 4IUOA 4YMZA 5FEPA 4M7SA 1WV2A 1F5ZA 1SZEA 3MYPA 4QNWA 3IRDA 4QM1A 1A5SA 3GAYA 2Z1BA 2IQTA 2A6NA 2A21A 1H50A 5I3FA 4MKNA 4C1LA 2QKFA 1LRQA 2V5BA 1QFEA 4KFPA 2JGQA 5HUOA 5C6MA 2ZQ0A 3W1NA 4OQVA 3OA3A 2E68A 2GJNA 4WY0B 3D0CA 3FKKA 3P82A 1JCYA 2YFOA 4LS2A 1I2QA 3M5VA 1J2WA 3P80A 3LB0A 4MVAA 4XTDA 3W7PA 3CHVA 2QCLA 2E5BA 4HNNA 4DQWA 1SUXA 4NUWA 3H55A 4WOZA 4N02A 4RKAA 2FFCA 5I3GA 3STCA 2DU2A 3CIXA 3WJSA 3EWBX 4BF9A 1B57A 2W0UA 4HSOA 1WX0A 2FLIA 3U2OA 1SZNA 4NJKA 3G0UA 2NLIA 1QPOA 5ABTA 1TRDA 1VH7A 1LBFA 2R91A 3G1VA 1XBYA 4XZ9A 4TU1A 5LNVA 4RJEA 3W2JA 1C9DA 1SU5A 3DFNA 5KZEA 1O95A 5FEXA 4JX6A 1ZY9A 2C6QA 5D30A 4BWLA 4EIVA 4O57A 3TAKA 1TCDA 1KW1A 1Z41A 5D2WA 2C16A 1JCLA 5LHFA 1OYCA 3PBUA 1LOQA 3W2NA 1JRCA 4OGZA 3MJYA 1K7XA 3OBKA 4UFMA 5G1YA 2AGKA 1XL9A 3KOFA 1R2SA 2YXGA 3W1RA 3P81A 2O7QA 4AF0A 2OT0A 5U7SA 2RDWA 1OFPA 2Q8ZA 2DZXA 3O6YX 2FJKA 5HJLA 3OEXA 5DY3A 4Z08A 4PTNA 3KRUA 3NQ2A 4XTIA 2PURA 2A7NA 4UC5A 1FQ0A 2Z0IA 2RKXA 1RQHA 3AO0A 3W1PA 2ISWA 5KINA 2ZZ6A 4JTJA 3EWWA 2FPVA 4OBTA 1K3UA 4FNRA 4LV4A 1NEYA 2B0MA 1KM6A 1I45A 1JUBA 4PEKA 3IIZA 4XKYA 2W79A 4M6PA 3VE7A 3GDMA 1V7YA 3LV5A 3P5YA 1AG1O 3MBFA 3P8IA 1LYXA 2NXHA 4FNUA 3DU0A 3W7IA 1A5CA 1LLZA 1P5BA 1LM1A 2OX1A 3C2FA 1GVSA 1OJXA 4AEOA 2HS8A 3FFSA 4HHPA 4N9EA 1J5TA 2ZA1A 2ZRWA 4O4WA 4HNUA 5CGQA 4KFNA 5LGZA 2Y63A 1EP3A 2ZDRA 1AL7A 3SIZA 4LWWA 1I2OA 2YGYA 2QAPA 2X16A 3E0IA 1U83A 2YW3A 1TTIA 3MP3A 2V2DA 4ORMA 3P7YA 1OFAA 3IGSA 3N3MA 4A2RA 4HNTA 4MY9A 2HS6A 2TSYA 2QJGA 3G1AA 3LHUA 4W9TA 4MY8A 1RPXA 1ZAIA 1L9WA 3HIJA 3CEPA 3NPXA 3MUXA 1OK4A 4S2CA 2WJZA 2ISSA 3HOJA 4JEQA 4LS0A 4HSNA 2VEMA 1F6PA 2ZZ4A 3M16A 2FTPA 1L6YA 2I1OA 3PB0A 5L6UA 1H7WA 3LLFA 4E0CA 3I65A 1SZFA 3IVTA 3W7DA 1KM1A 2BX7A 4RZ4A 1QDSA 1G67A 2NWSA 1F7BA 5BOOA 5D2VA 3S42A 3GNDA 3KXQA 1RQBA 4PODA 3N34A 2B7QA 5CZJA 1W3IA 1LLWA 3GX9A 3N14A 1TRIA 2CWNA 3NZ1A 5FF0A 3LCHA 3R5EA 2ALDA 4GRSA 1TPB1 2E5DA 4WQ6A 3MBDA 4ADSA 1RQEA 3TR2A 1Q6LA 3FOKA 3M47A 4L4MA 3W7NA 3O8AA 3UQNA 4JD4A 3THAA 4MYAA 4O28A 1W0MA 2C0AA 3NQMA 5C54A 3IVSA 4YLWA 3LERA 1TTJA 3QPYA 5EYWA 3GIYA 1H5YA 4O8RA 2Y89A 4I9AA 3G0SA 1KA9F 4FNPA 5AYXA 2GQ9A 3HG4A 1XI3A 5E93A 3LHTA 5AHNA 2VEPA 5D2TA 1Z48A 5K3VA 1SFLA 3NEVA 1VQTA 1CW2A 3UWZA 3TU9A 4QISA 3DHDA 3SI9A 5EL1A 4LUIA 1GVFA 1ZFJA 4WUIA 1ZAHA 3NQ6A 1WOBA 2FB3A 2RFGA 4JTTA 1VC4A 5AHFA 1Q6OA 1IXNA 3EEGA 1SO5A 4YCOA 2EKCA 4L4LA 1A50A 1ICPA 2E09A 3Q2DA 1PVNA 4IOTA 2XN0A 5H91A 2WNQA 2E77A 3THQA 3NDOA 2QUUA 3TAOA 4JDBA 3W7RA 3QSTA 2YCEA 2EHHA 4YL2A 4ZQOA 3P74A 1YADA 1TTQA 3GZ3A 2CLLA 1GWJA 3EB2A 1OF6A 3M5XA 3MI2A 5DCBA 3PR2A 2Y88A 3DI1A 4EVZA 4IXXA 4CQ8A 4LRTA 4BFAA 3PUDA 1LBMA 1EWEA 1IXPA 5IBXC 4X2RA 4LW7A 1OABA 4JGDA 5AN7A 1ONRA 4FO4A 2DZUA 5G2HA 1TQXA 1TV8A 2QCCA 2A2IA 1THFD 4NNAA 2NX3A 3GVGA 1VZWA 5D02A 3BLFA 3NAVA 2F84A 1XM3A 3O6DA 4GUGA 3S5ZA 3NQ7A 3ABRA 2VFGA 3NPVA 1HUVA 2YW4A 1YXCA 4O19A 3IIPA 1QOPA 4HT3A 1XC4A 1XDLA 4UTTA 4O54A 1H7PA 2ZRZA 1VHNA 3UY7A 5I3HA 1IXOA 4HN4A 3QPZA 4IMEA 2VELA 3N2MA 2NV2A 2CU0A 1AK5A 3SGZA 4FIQA 2V8ZA 3L66A 3VFLA 4QSHA 4LVDA 1OVDA 4RR4A 1EP2A 4KKXA 3NG3A 3QW4B 5F2IA 4Y6GA 2J27A 3SFKA 1TTPA 2NUYA 4AXKA 1S5WA 3GXTA 4IX2A 3SW6A 4MIMA 1JCJA 4XBSA 2FQIA 4NU7A 5G2WA 3V75A 3KVJA 1YYAA 3GB6A 5D03A 4ADTA 1UUOA 5I3JA 2ZRVA 3EX1A 1YLVA 2QCNA 1RVGA 2Y7FA 4CCDA 3NQDA 1OFDA 4M6QA 4N4QA 2J9YA 1LBLA 3PBWA 2WV8A 3CIWA 4N9CA 1R2TA 3WK3A 3TNOA 3LRMA 4EF9A 1K7FA 3HG5A 2A7RA 5E0KA 4GFSA 4UTWA 1GT8A 4TR9A 2GJLA 4MZYA 4Y96A 3G1FA 4P61A 3TQ0A 3KVMA 4ML9A 5BW6A 3DFQA 3DKJA 1O60A 1LDCA 2FB2A 3NQAA 3QM3A 1W5NA 1O5KA 4N9BA 3LCGA 3OG3A 4CNNA 4LV9A 3LTPA 3C3NA 4FNQA 5FI8A 8TIMA 3QYQA 3EX6A 3SZ8A 3LXBA 1NSJA 1R47A 4AHPA 3PY2A 5EY5A 5TIMA 4PL2A 1K8XA 4N6FA 3CU2A 4O1AA 4Z1BA 4UNLA 3DFPA 3NPWA 2R94A 2PE4A 3L2IA 1EWDA 3GAKA 1EUAA 3CTLA 4MYXA 2H8ZA 4FEZA 1KFBA 3LDVA 5EA9A 3BG9A 2E1DA 1VGAA 1X6UA 3GDTA 3KX6A 3PF3A 3TSBA 3MI3A 4K6AA 2PCQA 3WFAA 2VFFA 3NQVA 2QCEA 1YTDA 4DF2A 2ZTJA 1PHWA 3LHYA 5D37A 3RK8A 1X1OA 5D04C 2A7PA 4Z1DA 4JTFA 1VYSX 5CZSA 3PSWA 3I7QA 2V82A 1ZALA 1PL9A 4UNKA 1V5XA 1VPXA 3QEZA 3TMLA 1SFJA 3E96A 2EAWA 3FYOA 4OHQA 4FIRA 1KM3A 1P0NA 3GXNA 1H61A 2ZYFA 3UZJA 4R53A 2H3DA 5F2MA 4JYEA 3DFTA 2Y61A 3OHIA 3KRSA 2ZZ7A 2WNZA 5DCDA 1TPWA 3TFCA 1DHPA 2VENA 1QAPA 1GG0A 2C3ZA 2ZZ1A 3ZWTA 1OX5A 3T44A 3MI6A 1G7UA 2AAMA 5BRBA 3LTYA 3O07A 1T96A 1JRBA 4AHOA 1K8YA 3R12A 2XFWA 4H4IA 3TDFA 1OX4B 1QWGA 3O06A 4JY9A 5KMYA 3TXZA 4FX8A 2WOQA 3IVUA 2RH9A 1HG3A 1WAUA 3W88A 4DO4A 2OZ0A 1O94A 3W86A 2DORA 5CKSA 5SWUA 1YPFA 4AH7A 2P10A 4UTIA 3W1MA 6TIMA 5F4WA 1P0KA 3MWAA 4NJGA 3P67A 2WQPA 2NUXA 1TPC1 4LOCA 5CZ0A 4OWGA 1P1XA 1DQWA 2FIQA 5DXXA 5K4XA 4FX6M 3DZ1A 3R8RA 5CPNA 1EP1A 4YCPA 2QCHA 3UY8A 3TFXA 5HUPA 1VCVA 3SECA 1W1ZA 1JR1A 2FPYA 3BV4A 1G6CA 3NPUA 4JXCA 4LVBA 3BW3A 4I7VA 2ZA3A 5C2XA 3LXCA 1RV8A 2NZLA 4R33A 1GG1A 5L9FA 3WJXA 4K38A 4RX0A 3PVFA 1A5BA 2E6YA 1UCWA 4RZ6A 3TXVA 1TPUA 5A5WA 1GTHA 1KFLA 1K8ZA 4RK8A 1Q3NA 2CLIA 1VYPX 3QQ0A 3I6RA 3N9SA 2GVGA 3NYZA 4Z0JA 3NQ8A 4JYDA 5LHEA 3RU6A 3OIXA 4NX5A 3QZEA 3TMQA 4KFOA 5HINA 3GDKA 3L5AA 3B4UA 3W7JA 3NQEA 2QDHA 1WYIA 4K7VA 4XWUA 2W6RA 5FF4A 3INPA 1XBXA 3W74A 1L6WA 3C2RA 1SO3A 3UD6A 3L5MA 4NNCA 4BI7A 3SGUA 3BGJA 1IGSA 3BPWA 1A53A 3W7QA 3CT7A 3DHFA 1ME7A 3IEBA 4LRSA 1BWLA 5AYZA 2XN2A 3IGUA 2WKJA 2GVLA 5G4EA 5HQEA 1EIXA 3CB8A 3PBYA 1DORA 1Q45A 3GLCA 3W75A 1GZGA 3GDLA 3HG2A 2ZZ2A 4H6KA 4JX5A 1QO2A 1TV5A 4Y9AA 3MO7A 1SPQA 2WSRA 1GQNA 3OVRA 3A23A 3TQKA 2JKPA 3L21A 3L9CA 1UUMA 1XFBA 3A5VA 1B4EA 1W8SA 3S5YA 3C0JA 1EEPA 3B0UX 4MUZA 4JY8A 1UBSA 1H1YA 3WJWA 4DXVA 5DBUA 4AHQA 4TMBA 3TJLA 4XQ6A 4LUJA 3UNDA 3GR7A 5FEZA 1Y0EA 3M5YA 4ADUA 1LZOA 2YPIA 4Q33A 2YZRA 4U4MA 4C1KA 5AFDA 1TIMA 1SW7A 2EF9A 5LGXA 1LOSA 4JTSA 4MJZA 3TKFA 3S1WA 3GR8A 4K8HA 2P0OA 1H1ZA 4O10A 3TA6A 1TMHA 3ABQA 1B9BA 2NXGA 4UR8A 1LRTA 4N9DA 1WOAA 4WZHA 2ZRUA 4ZMGA 2CZ5A 1JQVA 1W3NA 1MXSA 4NX0A 1BEUA 4QAIA 4IWWA 3A24A 2X1UA 3R2GA 3NL2A 1TPEA 2H3BA 2QUVA 1FY6A 5F4SA 3F4WA 3STEA 4UXDA 5CG7A 1OYBA 1TREA 2A0NA 3RF9A 3DH7A 4UR7A 3FJLA 1XBVA 5LKYA 4WXZA 3S1XA 3K30A 2HSAA 3BARA 4A21A 3W1AA 1IXQA 3T40A 3W23A 2QCDB 3F4NA 4O17A 3STFA 2QCMA 3BGGA 3JS3A 4O50A 5KSWA 4X3ZA 1XUUA 4PC8A 4AB4A 2OT1A 2Y7DA 4HPXA 2YSWA 3L0NA 1FWTA 3VKJA 4IMFA 3DGRA 2CLFA 4ZQCA 4IGHA 3PC0A 3QFEA 1MEHA 3H54A 4RZ5A 2JK2A 1F76A 1Q6RA 2WO5A 1W31A 4ZQPA 4HNVA 3NOEA 1OFBA 1WBHA 5LSMA 1VLIA 2B7OA 1QPNA 1OYAA 4M7TA 1TJRA 4LY8A 2VC6A 5H2ZA 5AC6A 3DFSA 1I8JA 2ISVA 4FXRA 3G1XA 2R14A 3S8HA 1S5TA 1OFEA 2CZEA 3FIGA 4WD0A 1F05A 3L65A 1ME8A 4CQAA 1WBJA 4O1DA 4ZVJA 2V81A 3IIOA 5F1UA 3L0GA 4JTUA 4HKPA 4O13A 3F1QA 4UIOA 1MSSA 3HPZA 4NVTA 3MHGA 4FB7A 1GVQA 1SW3A 4KWVA 4UTMA 3M5ZA 3QC3A 5I3IA 3M6YA 4E38A 4RXGA 3W1TA 2PRMA 3S1VA 4JTIA 1KM2A 1LOLA 1FBAA 4S1FA 3MW7A 2J88A 3EXTA 3TSDA 3A5FA 2A1YA 2VOMA 3LI1A 3PS7A 1UASA 1NFBA 1OX4A 3KRZA
chains in the Genus database with same CATH superfamily
1K02A 2NQ9A 3G1SA 3QR0A 4WF7A 3W2KA 1ZNNA 1R2RA 3W7EA 3DN5A 5A8PA 3RN6A 4AMAA 3LBCA 4CU8A 1LWJA 1H7OA 3VDCA 4BQ3A 4JN6A 5LIKX 2DSKA 3QGVA 1S2UA 3GYCA 4D71A 3PULA 4PSRA 2TODA 1E4IA 3VKBA 1JULA 1PV8A 2GVYA 3U4FA 5DMMA 4IHCA 1AMKA 1FHDA 3UGVA 4RUBA 3TLLA 1GNXA 2QUNA 4JIQA 3HJEA 2BLEA 2PDBA 1E15A 2R8WA 4HJFA 1YPIA 2VQUA 3E0WA 2WJDA 4GYJA 5CC5A 4FF7A 1K4HA 4A2SA 2GFTA 2OOGA 1XP3A 4QX4A 4GFIA 2DGAA 2VO5A 3VD5A 2WKLA 3T4WA 3WCZA 2C18A 4DNMA 4QRNA 1Q8JA 4HD5A 4KEUA 3C52A 5AB3A 4E2VA 1I2PA 2PPGA 5HQMA 3BAWA 1QI5A 4LNYA 3UGRA 5JIWA 2D24A 1TMLA 2VGGA 5CSSA 4IG2B 5C9ZA 1NARA 1V0LA 3VM5A 4BWLC 4K37A 4HPGA 4GCAA 3U5UA 3HGJA 1XLGA 3NO5A 4IPIA 5GNYA 1UR4A 1L2UA 4O52A 3AI0A 3R7MA 3MKCA 3QRHA 3IARA 4U5IA 3S5SA 2YDAA 1UZ4A 3ZJ6A 4NHVA 3EGJA 4Z2HA 1XIIA 3E0LA 4NT0A 4FX7A 4J3WA 4Z0SA 2Y6ZA 1PKMA 1UG6A 4Z2GA 3LI0A 1OFOA 4NI8A 5KZDA 3YPIA 4DZHA 3G3MA 2VI0A 1S5VA 4TXEA 4RW3A 1F9CA 1TMQA 3E9AA 1D3GA 1H5VA 3DYPA 3BK0A 1KLYA 2V5CA 5CPMA 3NFUA 4LYRA 4RXFA 3LXAA 3C8FA 1JDEA 2E28A 1DQXA 2AQOA 4R9XA 4IQLA 4M80A 1QK0A 2Z24A 3L4ZA 3BH4A 3M0VA 2G97A 4E2BA 3IACA 2PGEA 2NV1A 1RHCA 2P3EA 4W85A 4LY4A 1ZU8A 1H7RA 3CMJA 1SMDA 3SSJA 5JBDA 1KBIA 1GTEA 2ZX8A 4C6NA 1ALDA 2HMCA 4GKLA 5A6JA 2G96A 2Z4GA 4PMZA 4HP5A 1X6NA 1K1DA 2J8TA 2G95A 3KS6A 2WHMA 1A5NC 1NQ6A 4O4VA 1E0XA 4JFVA 3DAQA 3RCNA 3ZWSA 3ATYA 2HPIA 4W5UA 1EXPA 4CQ9A 1ESWA 1HL8A 4XUYA 1AODA 1V6YA 2D73A 3PPFA 5A94A 3B8IA 3NGFA 3LPPA 1GPFA 3HMJG 2FHFA 4AC1X 3W2LA 2GOUA 4AXNA 1X98A 4H6RA 1PIIA 3GKAA 3UYIA 1QI0A 3LNPA 1U1UA 5I2UA 5HMDA 1V79A 5U4NA 1I1WA 2VC7A 5I7GA 2V63A 3SCWA 4DM2A 3OVGA 2DT0A 4G2DA 5AYBA 3LSBA 4XAYA 1F6KA 3OGVA 1XLLA 2V30A 4M19A 1OK6A 3PAOA 1KC7A 2ATSA 4HA0A 1PDYA 2BXYA 2AL1A 2VZVA 4MUPA 3RUBL 2X05A 1J0YA 1SMAA 2FPTA 2BY2A 2V5JA 4GZ7A 4ZQNA 3UPWA 2CLMA 1WXZA 4WJEA 1NAL1 1FCBA 4PFMA 4A3YA 3QHOA 5DLCA 4LBRA 2NXIA 2O56A 4Q8UA 4U31A 2WC4A 1QHOA 1GW1A 4US5D 4LCSA 4PMXA 4RDWA 3UZ5A 3GDRA 1BAGA 1M6JA 3E74A 3W3OA 3CM4A 4WDTA 3S9YA 1F2JA 4HK6A 3MKKA 3EXRA 3BG5A 3N9RA 3WJYA 5K7JA 3MPGA 5DN1A 4MMWA 1QCWA 3GG8A 4GG9A 2JALA 3ZT6A 2Y70A 1J0IA 1ONWA 3ZIZA 3WENA 4OT7A 3RPDA 4BI6A 2YR1A 4S3CA 4MLJA 1TB3A 3U48A 4O18A 1IEWA 3ARVA 3DI0A 1VR6A 4GYKA 3QZAA 3LPFA 2P50A 4PUDA 3W72A 3V1HA 5JQ9A 2UY3A 5RUBA 4WY0A 3DHPA 3SN4A 3T7VA 1A5AA 4RCXA 3TLQA 3FA3A 4YWSA 3AUOA 1FVPA 4DBDA 2H8XA 2G50A 1DWGM 3IGXA 1Q6DA 4D6DA 4C6JA 1GOMA 4E8GA 4JN7A 1RLDA 2WHJA 3ENLA 2BBFA 1MNZA 3IRSA 4HSHA 1AW5A 4NQ1A 1NIUA 2G3IA 3CUXA 5H8UA 3ISIX 5C8BB 2NVAA 3O9NA 1I4NA 2OCZA 4O14A 2AQWA 1JD9A 1GYMA 1ISVA 3NIYA 5I78A 1U5VA 5D09A 3GE7A 3HFYA 3STGA 3B0VC 3W1XA 1L6SA 2PWGA 1IWPA 1HJWA 1AL8A 1B3VA 1W2VA 5CEWA 3W7MA 5BOFA 5TF0A 2D0FA 3PK7A 4J9JA 3BE7A 1SO4A 5BOEA 4LC6A 3SADA 1PUDA 4AZGA 2RGLA 3H4WA 2PDWA 4D8LA 2JQXA 1QR7A 1W5QA 2OEMA 4PUKA 4REQB 3WK2A 1XDMA 5CSRA 1JI2A 4U28A 2VDIA 4PMNA 4XD3A 1H41A 3M0MA 4HU0A 2XN1A 4MG4A 2F6XA 2PWDA 1XIDA 1ECQA 3T4CA 4B9YA 1GONA 3FGCB 4C6CA 1JF6A 1NM9A 3M1ZA 1X97A 1XX1A 1O1ZA 3HGOA 1VD6A 4J3UA 3S5OA 1I6NA 2EPHA 3AXHA 1E9ZB 4UTHA 3K1DA 3LHWA 3GRIA 5CSYA 3QW3A 1EBGA 1OFRA 3PG8A 2XYLA 1VBGA 4L6OA 1GQJA 2BVYA 4P5UA 3WMSA 4XD5A 4Z1YA 4AZ6A 3R89A 5T91A 3VMPA 4P2VA 3HURA 4ORIA 4K36A 5LNUA 1CXFA 1PX3A 3HV9A 3SN0A 4QCFA 3OP2A 3OJGA 1QT1A 4I90A 3M0ZA 3S9IA 4PCFA 3G3DA 4QIUA 4LT9A 3G1HA 3HPFA 2OLAA 2QDGA 4MAZA 1XC6A 3ZLFA 2BOGX 1VS1A 3V18A 1EFZA 2F2HA 1YE6A 4LUYA 2GVJA 2Z6JA 4GYFA 1Y5WA 4LS1A 3C2OA 3LA4A 4UFIA 5EBUA 5DY2A 1KB3A 1ML1A 1M1BA 3PB2A 4IGSA 3CPGA 1NF7A 1KTCA 1E6PA 3H2EA 3EA3A 5I09A 2E6DA 3MP4A 3SUVA 1QBAA 3DG6A 3GIQA 5MF5A 4ENLA 3N4EA 4S38A 4N0RA 4EKJA 5A69A 2E9BA 5FL1A 4PMYA 3QH2A 4J2PA 3F4CA 3DENA 3FJ6A 2FVMA 3RLVA 3N4AA 3L67A 4MLRA 3NQFA 4YN5A 3K4AA 3SFWA 1XW8A 3VPLA 1QTWA 1H49A 3AHZA 3AICA 3MVTA 2OVLA 1M7OA 1EC8A 2E1WA 1YDOA 4QNEA 1G01A 3ANYA 1ICQA 3W37A 3H2MA 3URQA 4H9UA 3PBGA 2TPSA 1TPDA 3C56A 1W3KA 1KGXA 1A47A 1AVAA 3W83A 2RDXA 3RJXA 1HO1A 1FXQA 2VFHA 2X2GA 1PCWA 4XSLA 3MUY1 4CLMA 3SY8A 3MS8A 2XVLA 1QJWA 3W7HA 1V0NA 4GISA 3EWXA 4HOWA 2GUUA 2C15A 4S3GA 3KVKA 1H60A 1Q13A 1A0EA 4N6EA 4TUFA 5CAKA 1ZS2A 2CXGA 2VD8A 4AF0B 4C6KA 3ITGA 3AZRA 4LYKA 1H7XA 2XG9A 1QUMA 1UP0A 1TPH1 3K8KA 1PWLA 3PM6A 1K6WA 4J5NA 4JYFA 1NDZA 4Y90A 2X41A 4B91A 1HP5A 1QOQA 3U3HA 3VX1A 2CZFA 3W4RA 2ZICA 3T2OA 4LYPA 4DO5A 2DSWA 3M6DA 2WHLA 4Y9NA 3CWNA 5I06A 1O7AA 5AKQA 3U0HA 3BAIA 4EWND 1KO0A 2B7PA 3PFMA 3PN8A 3OZOA 4KWUA 1O4UA 2EKGA 1ZGDA 2D23A 4QEEA 3B8DA 2X30A 4I7UA 1ADSA 4L64A 2VJXA 3ERPA 3FS2A 4FHAA 3CH0A 1OC6A 3ONCA 4WXYA 2ZKMX 1KM4A 3LCXA 4DUOA 1AMYA 1OHLA 2E67A 4GIRA 3URAA 5I3KA 5XIAA 2QCGA 4DJFD 4GC4A 4H3DA 1ADOA 1HIZA 4GQRA 4DEFA 4DJFC 4TMCA 1HN1A 4MWAE 1KCKA 4QAWA 4DO7A 5ECVA 5T26A 4BQ4A 3AIUA 3M41A 3C2VA 3LHZA 3BO9A 4EXQA 1JNDA 2YCLB 3GDBA 5AC4A 1UW9A 3H26A 3LENA 1Q8AA 2F9RA 3PHAA 2PWFA 4CNPA 3U2CA 2CLHA 3WQ4A 3BLIA 2CBVA 3ZVHA 3FKRA 4PUWA 2YZ5A 2XH7A 1AA1B 3RYSA 4FP1A 3QQ1A 3T8LA 1B3OA 4PRRA 4JTLA 1LL4A 2WMFA 5CPLA 5LYRA 5AHMA 3CLMA 1DJWA 4NJJA 5CBIA 1DKWA 4W88A 4F8XA 3H7RA 4UQDA 4NNBA 3LGEA 4MZ8A 4B5NA 4IX0A 4GI9A 3TYDA 3G77A 3DBPA 3ELFA 1OZQA 3LUTA 1KBBA 4ZENA 4YTSA 1X96A 4Q32A 4IUOA 5FEPA 5IRPA 1WV2A 4Y9OA 4HMCA 1SZEA 1TA3B 4P8UA 3GAYA 4W7WA 3PJTA 4HBKA 3ID7A 3WDHA 4K2SA 2P8BA 2PD9A 3M0HA 5JBFA 3NWRA 1NWUA 4RV3A 4KFPA 4PBEA 2ZQ0A 1UBPC 1ZBVA 4OQVA 2E68A 3MUAA 4YTTA 5A2CA 4TV6A 3D0CA 4E3TA 3P82A 1I2QA 1J2WA 2OYMA 4XTDA 3QV7A 4IUGA 5HNUA 3GG0A 5IXEA 3KRBA 1RBLA 4HNNA 4DQWA 1SUXA 3VOHA 4WOZA 3H55A 1AH4A 2DU2A 3WJSA 4BF9A 1W32A 2JE8A 1B57A 1OIFA 2W0UA 3ZT7A 1WX0A 4J28A 1G94A 5C7VA 3U2OA 4HMEA 3G0UA 2PP1A 4DRSA 2GYIA 3G1VA 1XBYA 2WXDM 2WLZA 2YXXA 1FWJC 1KWKA 1Q6GA 1AQFA 3F4DA 2QMJA 8RUCA 4U3AA 1O95A 4TQTA 5FEXA 4JX6A 4PCTA 4ZB2A 1J93A 1S39A 4O57A 2EPOA 4LAOA 5LHFA 1OYCA 4KRUA 3QHNA 4MB5A 4Q8MA 1VENA 3OZPA 3MJYA 3OBKA 3TZFA 1OD0A 2WMJA 3N11A 3WBYA 2INEA 1MFVA 3WDIA 1G9HA 3ANVA 2JEPA 3GH5A 1CT5A 1XYCA 5E70A 1PIGA 3P81A 4AF0A 1ZZMA 3M0KA 1C8YA 2DZXA 5HJLA 2FYMA 1WO2A 3NQ2A 1XGDA 3EDJA 3AIEA 3AO0A 5A3HA 5AYIA 2HV5A 3UERA 2ZZ6A 1XYFA 1A49A 1K3UA 2DQXA 4E8DA 1REQB 2D3LA 4PEKA 3IIZA 3N15A 3N18A 3ZM8A 2W79A 2VD9A 2WJEA 2YL5A 4KCTA 1AG1O 3P8IA 1LYXA 3AXIA 3M0JA 3W7IA 1LLZA 3Q45A 1P5BA 2HNHA 2OX1A 3C2FA 1Z9AA 4AEOA 2HS8A 4ZB0A 5CZKA 2CWXA 2QGYA 1P0BA 3VIJA 3HQOA 3K8LA 4YTRA 3IJ9A 1EP3A 3OQ8A 4R85A 4UOQA 2OELA 3SIZA 6TAAA 2C0HA 3AIQA 2QAPA 1MYRA 2X16A 1U83A 2J79A 1TTIA 3MP3A 4ORMA 3RRXA 3P7YA 4HNTA 4NASA 3LHUA 3VZXA 3VFCA 1RPXA 1BYDA 3FAWA 3LSCA 4AD1A 3AHTA 1UR1A 3NPXA 3O0FA 1W3JA 5DX7A 1UD3A 2WJZA 2ISSA 3S2CA 1JXKA 3ZQ9A 4JEQA 2OR2A 1WDDA 1XSKA 3M7SA 3VDAA 2VEMA 3EB4A 4FXFA 1L6YA 1XYBA 3WD4A 4MNKA 2DT3A 3VIIA 3CL6A 2ZOXA 5DFAA 4HCDA 3M0IA 1QDSA 1NP2A 3RDKA 1XG3A 2B7QA 5CPTA 1W3IA 3KP1A 3AAMA 1LLWA 1ISXA 3RILA 3NZ1A 3LCHA 2I5GA 1TPB1 4WQ6A 4ADSA 1RQEA 4YHGA 4O1FA 3W7NA 3U9IA 2VEFA 5DO8A 4FLSA 3BOXA 2DIJA 2WW5A 3IVSA 3SSZA 4OECA 3KOZA 1T6MA 3GIYA 4HQVA 3REQB 5AYXA 2VGFA 4J40A 1PJ9A 3VDBA 3FVDA 3AFBA 1P6BA 3LHTA 5AHNA 2VEPA 4AD5A 5D2TA 5ECUA 3VGDA 2VUNA 1S2TA 4NZ5A 1CECA 5EL1A 1ZFJA 1FWEC 2RFGA 3VNJA 1B9ZA 1IXNA 4F2BA 1SO5A 1XQKA 1Y5VA 1ICPA 3Q2DA 1OEPA 4B5WA 1PYFA 1KGWA 4UQEA 5H91A 4BEQA 1ADDA 3QPEA 2V3DA 4EPEC 3NDOA 5IFPA 3FDGA 3S4TA 2NSOA 4ZQOA 1YX1A 3P74A 1YADA 4L65A 3UF9A 3EB2A 3M5XA 3FAXA 3MI2A 3CWHA 5A8NA 2Z1KA 4EVZA 3PNUA 4LRTA 4BFAA 3PUDA 1LBMA 3G6MA 1EWEA 1HF6A 5FA5A 4AD4A 3FJ4A 4GIYA 4X2RA 1CGWA 4LW7A 2V69A 2OXNA 2Y24A 3RJYA 2VOTA 4J35A 5G2HA 1TQXA 4V1XA 3TVAA 2A2IA 2FKPA 4Q4RA 1YIXA 3G2GA 1XM3A 4GUGA 3NQ7A 5HMEA 1MRQA 3EBVA 5A6SA 1G1YA 1QOPA 1XC4A 1XDLA 4AY1A 1F8IA 3EYPA 1IXOA 4IMEA 2CCRA 3B9NA 4W93A 4MSSA 2JIEA 4NAFA 1WNOA 2IKHA 4K3ZA 4GYPA 3PZMA 3CMFA 5T8GA 3VFLA 1JD7A 2VWSA 4RR4A 5BU6A 4UCFA 3NG3A 2J13A 2J27A 3WQDA 4ML4A 4IX2A 4AXKA 4I6VA 1V6WA 3SW6A 1IE7C 3GH7A 4PMQA 4UZSA 5AZ0A 3KCOA 3BC9A 1H11A 5CXPA 3TN4A 2E3ZA 1RVGA 1Y8BA 4AEFA 4HN8A 3VXGA 2J9YA 1HW6A 2WV8A 3CIWA 4LQ1A 3M46A 3TTYA 4PE8A 2BNJA 5E0KA 4UTWA 1GT8A 3RM8A 3KWXA 2F6UA 4CNTA 2X0YA 4IL2A 1MXDA 4V28A 1GJUA 4P61A 1F07A 5BW6A 3OU8A 3DKJA 1ZP4A 4A8NA 1S1RA 3NURA 7CGTA 3SM0A 3LCGA 4CNNA 3T0BA 5CPQA 1E6QM 8TIMA 3EWDA 1W1TA 1EJTC 3LQLA 2BHZA 3COTA 4IQEA 3LXBA 3PY2A 5TIMA 4MTVA 2Z27A 3UR5A 4O1AA 4ROPA 4Z1BA 3NPWA 4MAVA 4MKVA 1TE1A 2I16A 3R0KA 3CTLA 3AU6A 1CTNA 3LDVA 1VGAA 3W6MA 3TN3A 1US0A 4WJXA 3KX6A 5EFDA 1V3KA 2AKZA 1QATA 1MQPA 1LWHA 3NQVA 4WDUA 4JTDA 1PHWA 4HHHA 3LHYA 3RK8A 2WZEA 2A7PA 3MKVA 1BG4A 3MC5A 3WLNA 3I7QA 3BDKA 2V82A 1MXGA 1GGOA 3E96A 2EAWA 3FYOA 2ESCA 3CHEA 2XM2A 3RG6A 4H00A 4Q6XA 3KDNA 1JZ4A 4J27A 1MVYA 4JYEA 2XM1A 3WF4A 2CEQA 3RX2A 4NG3A 3MY9A 3ABXA 3IAQA 1M3UA 5CLWA 2HEJA 2Z26A 2HPMA 1K77A 1Z7AA 1GG0A 4DZIA 2C3ZA 3E6EA 3WH9A 1XH0A 1Q5MA 5BRBA 1HT6A 1T96A 1KNWA 1Z3NA 4DIAA 4DX3A 4H4IA 4ZB5A 3VCNA 5KMYA 2NVDA 5DEZA 2GUYA 2XH0A 2RH9A 4MJ2A 3W88A 4JQ1A 3DYMA 2P10A 5F4WA 4UWMA 5I5RA 1B90A 3P67A 1ZPTA 1UR3M 2BASA 5CZ0A 4UR9A 5CG0A 1P1XA 3LM3A 1CB7B 1AJ2A 5DXXA 4A8RA 4FX6M 4HMDA 2J8FA 5CPNA 1UKQA 2V3GA 1WZMA 5HUPA 2PI6A 1G6CA 1IR2A 4ZGYA 2Z7GA 3BW3A 2VMFA 4I7VA 6PTDA 2XTKA 4I9MA 4D72A 4R33A 1GG1A 4IG2A 3PVFA 1UPMB 3E0FA 3J7HA 1GTHA 4L9ZA 1Q3NA 2JIWA 2CLIA 3QQ0A 3N9SA 3CUHA 4JYDA 3RU6A 3UW6A 1J5SA 1OC7A 2R9RA 2XIJA 3OLDA 1ELSA 5REQB 1PTDA 5KZ6A 3O7UA 2QDHA 3B3DA 4XWUA 2DW6A 5FF4A 3W74A 5CCZA 3AXMA 4HZMA 4G9PA 3LK6A 1MUCA 4XZHA 1F61A 2YB1A 3W7QA 5XINA 1ME7A 4LRSA 4MDOA 5G4EA 3SQMA 5HQEA 4A6GA 3VC5A 3PBYA 1DORA 4R3UA 1VFOA 5ABFB 1P7TB 1Q45A 3W75A 3B9EA 2UWFA 1TUFA 4L1GA 3OYXA 1QO2A 1TV5A 1DWFM 4D9PA 2HK1A 4L80A 5CGTA 1FWIC 3A23A 3UXKA 3WD3A 3L9CA 4DI9A 2BVWA 3A5VA 1W8SA 3BGAA 3B0UX 3VNKA 3BOLA 4D1JA 4QCEA 1UBSA 3BLOA 3QY6A 4LPCA 5E9AA 3WJWA 2PDFA 3N04A 4AHQA 4IIEA 4XQ6A 1VFSA 2WBKA 4C7DA 2Y0FA 2WK2A 4ADUA 5FAGA 3ZZ1A 1R6WA 4X60A 5AFDA 1HVXA 3M0LA 4XAZA 1BVNP 5M1TA 5LGXA 1LOSA 4EK7A 3S1WA 3VU2A 4K8HA 3WLSA 1W2PA 3WF3A 3ABQA 1B9BA 2QMKA 4PUJA 3GVVA 2DVUA 4N9DA 4ATDA 4XZMX 3LGDA 2CZ5A 3AZTA 3TWAA 4NRRA 4NX0A 4QAIA 1XIGA 5LIUX 2CYGA 2X1UA 4MNLA 3R2GA 2PDKA 4Y2WA 4K1WA 2W92A 2Y8KA 3F5JA 1OGBA 2G3JA 3F4WA 3EA2A 3FGCA 1E9LA 3EDFA 3SRDA 3RF9A 4UR7A 3KBWA 1XBVA 5LKYA 3POCA 5I6SA 1EO5A 5FSEC 1DJYA 2HSAA 5GJNA 1YDYA 4DM1A 1B1YA 3W23A 4F2UA 4MADA 4JFSA 2QCMA 3BGGA 1WKFA 4AB4A 1HKMA 2Q09A 3KBJA 4PTXA 3SUUA 2CLFA 1E9IA 3PC0A 1MEHA 3H54A 3VDGA 3W00A 4RZ5A 4ZXLA 4Z2IA 1YBQA 3VO0A 3WF1A 1UKOA 4ZBCA 4ZQPA 2J77A 1VJSA 3NOEA 1OFBA 5HATA 1GVIA 4QJ3B 1QPNA 4ROQA 3OGRA 3GW0A 1TJRA 1BRLA 1I8JA 4H01A 2XGIA 2VRJA 3G1XA 4AU0A 2DY3A 1J11A 2EBNA 2R14A 1SR0A 1S5TA 1OFEA 1F05A 2ISFA 1UWSA 3L65A 4CQAA 4JKMA 3SO7A 3UZWA 3W28A 3CQHA 4ZVJA 1GKRA 5FJOA 3KOWA 2EPNA 4MWAD 4FB7A 3M5ZA 1X39A 3W1TA 1KM2A 1FBAA 2WVVA 4QDWA 2ZUWA 3LZ3A 5IHSA 1KXVA 5IDZA 4OIFA 2O9TA 5T9BG 3GVRA 1ZJBA 2DH3A 4JTKA 3N25A 1BQGA 3RCYA 3NZRA 3TW9A 4BHYA 4FLOA 4UBPC 4CN6A 2FGZA 2PB1A 2ZCGA 1M5WA 5CGMA 2Q8LA 2ZZ3A 3D6NA 3QTGA 8XIMA 2C1HA 3N2XA 4LF2A 5HMSA 5FCZA 1F4AA 3SN1A 5CBBA 4GUIA 3M9YA 2X8RA 1ZQ5A 2GDUA 3GC4A 2XSXA 4IIBA 3P2VA 4KWWA 1G7VA 2OPJA 1XR2A 3P8JA 1JPHA 2OOFA 1JCXA 2VEIA 3UWWA 3JU2A 1HKWA 2BSLA 3QXBA 3GNRA 5C5YA 2PBOA 2VGIA 2HXUA 2X1RA 1B30A 3UEQA 4AWTA 3TTQA 1DWHM 3APTA 4GHRA 2Z25A 5FJIA 1KM5A 3CTTA 4UMAA 1UQZA 3C4UA 3W38A 4B90A 4C1NA 1U1JA 4ZL1A 1L8NA 2AAAA 3CUJA 4GVIA 4PN2A 1V0KA 5D9MA 2NX9A 3TYUA 5HMFA 3G22A 1MW1A 1KFEA 4Z1AA 4BJHA 4J3XA 1SZRA 1W54A 4AUBA 3NQBA 1ISYA 2VXNA 3HBLA 1QPRA 3SBFA 5DMYA 1S2CA 1D9EA 3O16A 3PTMA 5DXYA 1TQJA 3FLUA 4Y8FA 3S2JA 1UR9A 1OIMA 2ZE3A 4TIMA 3IAPA 2CLKA 3HG3A 1VCGA 4KRZA 6A3HA 4GNJA 4GY0A 5H1WA 2MANA 3B8WA 3FY1A 1FWRA 4QLJA 4IIGA 4ZSTA 4H2CA 1PKLA 4ICCX 2BG5A 4IJRA 4B16A 3WK1A 3WN6A 5KZMA 1AUSL 2Z1VA 1ZENA 1A5UA 2J7DA 3Q94A 1KXQA 3MMTA 3OW1A 3GNXA 3SR7A 5HULA 2KZHA 4DBSA 2C7FA 5G4WA 5EMJA 4XG1A 3TA9A 3PZUA 4MWAB 3UJRA 3HM7A 2Y62A 3LCIA 3O15A 2A3AA 4URIA 2AGTA 3QZ6A 4GUJA 2YCJA 5D33A 3KZPA 4MY1A 4IGMA 5JXQA 4JX4A 1PAMA 3DFOA 1E6XM 3HN3A 2J7EA 4O12A 2ATMA 5C9WA 2P0IA 3CK5A 5DF0A 3W7CA 4EOUA 4J3TA 3G24A 3U57A 3VOFA 4MPKA 4O0KA 3V5CA 3OHMB 3O3RA 5M2FX 3GNNA 1IT0A 2WLYA 4MDPA 2WB5A 3GHRA 1WKDA 4XAGA 8XIAA 2PDNA 1XLEA 3PFRA 4R34A 3BZGA 1TWSA 3CV7A 1X8FA 3MHUA 5D9PA 1Q2SA 2OB3A 3B8TA 4PMJA 1KGUA 1JUKA 3VKAA 4BR1A 3KM8A 3B06A 2DJLA 5TNVA 4B5UA 3TUUA 2PRHA 2DVXA 1TJPA 3T78A 3E5BA 5EBAA 3EX4A 3D3AA 3G6LA 3SRKA 4QG9A 1VPYA 4HYWA 4QJ5B 2F2KA 1B3YA 2C1IA 4RDVA 4KF1A 2YDQA 1QPKA 2PSNA 2DIKA 3UCQA 1VEOA 3HJZA 3BCDA 3UXIA 3NQGA 1WUEA 3S6OA 1IZJA 1RY8A 3CQ0A 3VI2A 5E5CA 3T07A 5EKYA 3F2BA 1VRXA 2ZRXA 3LYEA 1SSDA 3OZMA 2F7FA 1DJZA 2PLKA 2J6XA 2IKJA 3KTSA 9CGTA 4MB4A 3THDA 4S3AA 4PL1A 3P60A 3H4GA 1GORA 3G5EA 2GPTA 3P84A 1QPQA 3L2MA 2XFYA 4JDYA 2OTDA 1FDYA 1SJBA 2OSWA 3CEUA 2DP3A 5AHLA 1EKOA 1YE4A 1M53A 1WQ5A 3K1GA 4UTWC 3E12A 1VJIA 3RRAA 1B3XA 1MW2A 3OPSA 1NVMA 2PWUA 4HIBA 1CLVA 4IP4A 4AZ5A 4JTEA 1EB3A 5CQ1A 3ZMRA 1F74A 2O55A 4WR3A 1IT8A 2X7WA 2PRLA 2NQ5A 3WK0A 1V6XA 1E0TA 2G4JA 2EPMX 1PHQA 4YHEA 3WELA 1XYZA 3BJTA 3LN3A 3IANA 2P1FA 3RPTA 3WLHA 4YYFA 1FDZA 4J3SA 4IJCA 2E6FA 3SUWA 1C90A 3AISA 2WJFA 3CGTA 2X0SA 3G0XA 1XKYA 4B3ZA 1N8FA 2CLOA 2J6VA 3CQKA 4K39A 3BURA 2QJNA 1N8WA 4NXKA 3PZVA 4IQJA 4Q4PA 1HKJA 3M0XA 4JIEA 1MI3A 2ZFAA 3DFYA 1H2JA 3GW3A 3WD0A 2WMHA 4WEVX 2W61A 2FZNA 2ON3A 4XISA 2DSUA 1EJ7L 2HBXA 2J78A 4KIRA 4RV8A 2QCDA 3NNTA 4MJMA 1YXDA 3EKGA 3SEPA 1QXLA 5FEWA 1Q7QA 5CJNA 4WDXA 3KCLA 3ZR5A 4J4KA 3TYCA 1OY0A 3NDZA 2ZZ5A 3LRLA 4ZQMA 2D20A 1RPKA 1RLCL 3RO6A 1KLZA 5AYYA 3O63A 4Q7NA 1HFBA 4DHGA 3RNDA 4AFYA 5CZTA 2YA0A 4QBXA 4BI5A 3IJIA 4AW7A 3H53A 5AC5A 3NO1A 1FCQA 3L23A 2VP8A 3ARQA 3DC0A 1H63A 2NWRA 3WUBA 1W9PA 1WDRA 3M64A 1BXCA 5TBOA 3M07A 4DJDD 1FKWA 2PU0A 5G1TA 1HO4A 3ALFA 1XLCA 3HQ1A 3RCMA 2VL4A 3Q58A 2PC8A 4G8TA 4O8AA 3TE9A 2NSXA 5D2XA 2QJJA 1D3HA 4B2DD 4LFYA 5TAOA 3THUA 2X09A 2CITA 1KRAC 1IF2A 3I7SA 3LMZA 5AOUA 1HZYA 4GVFA 1UMYA 3E2QA 1UYQA 1GEQA 5A8GA 4HZ6A 1ZP3A 2OMAA 4RLIA 3WIJA 1UJPA 4YWIA 4C6BA 3WJZA 1AW1A 3GHSA 4UOJA 5JUVA 3KS5A 2I9EA 3WQGA 3C8NA 2GZXA 4XVEA 5DRIA 2UY5A 1MEIA 3K13A 4I7WA 4UTFA 3B0PA 2PUZA 3HGRA 3THCA 2OFJA 4FK9A 4ZZ9A 4Q7BA 2BTMA 3QN3A 3LX9A 3OVQA 3VUPA 1LWIA 3A22A 1WZLA 2QT3A 3NR0A 4DPQA 3CYJA 1LRNA 1GYLA 1NF0A 4ZEPA 1QWKA 2ZC8A 5HJXA 5I24A 2OGYA 2V5LA 2R82A 4NIRA 2HZGA 2VCBA 1R7OA 2RDTA 1WXJA 2VNCA 5D8ZA 4H04A 2CZDA 1Z42A 2XIMA 1KBJA 1UR0A 3RX3A 4GIEA 1SJCA 2NQLA 1CI1A 1HTIA 2J9ZA 1EYWA 1T8XA 2JBMA 3GR4A 3NQCA 3HF3A 2XIOA 2YA2A 3SCVA 4IMCA 3ABZA 1YTKA 4CN1A 2V5DA 3APGA 1E73M 4FI4A 2PBGA 3W76A 3WEMA 4GD0A 3U4AA 3UR7A 5K4ZA 4R7OA 5HWNA 5HK4A 3UWVA 1DVJA 3BLEA 4WY0F 4DPPA 1YTEA 5CC6A 2QHAA 4MFDA 1XD0A 4LEFA 3TN5A 4AZCA 4NYYA 1F3TA 1ZJIA 4DLMA 1RUSA 2WNNA 3POHA 4X0VA 1F6YA 2I5QA 4AYGA 5HOSA 3VKDA 4M6VA 3G1RA 2X42A 4M5PA 5HWJA 5C55A 4XB3A 4U2ZA 4HNLA 4DWDA 1FWAC 2V2CA 4Z17A 4UFHA 2VWTA 4OV4A 3QMRA 3UPBA 1RAKA 5HANA 3M43A 3CZEA 1XIHA 4H8HA 2J7CA 1FCVA 4OUIA 4WSHA 2A5HA 2CLPA 2Z6IA 3B04A 4UFJA 2VR5A 4LTSA 4H9YA 3W9ZA 3UA4A 1O5XA 1G0CA 4GWEA 3CPUA 4MPQA 5A8MA 3W85A 4QDPA 5JMUA 1J6PA 4IMAA 1TELA 2XINA 4JOMA 3IIVA 4IIFA 4KBXA 3VIHA 2A3LA 5FESA 1I2RA 4HPJA 2DUZA 4IFKB 3EPNA 1TE6A 3EWZA 4ZFMA 4BK9A 3GUGA 1W37A 5FF2A 2B4GA 1KBLA 3LCLA 5J8LA 3QMTA 1DJGA 3L0KA 1X1ZA 2GVEA 3P62A 1KFJA 2HXTA 3QJAA 2ZE0A 4JL1A 4L5ZA 3IIXA 4HZ8A 1RJQA 1H09A 1EJVC 3PTKA 4MOZA 4JAWA 1N8IA 5CH9A 4PTVA 2QPXA 4POCA 3RMJA 1YXYA 3HO8A 3NL3A 1GCYA 1EJSC 4GJ1A 1FWHC 1ZSXA 5AHIA 1JI1A 3KP0A 3KL5A 2GJPA 2EJAA 4TO8A 4H41A 2VR4A 3WNLA 2I17A 4CCZA 3LCFA 3I7RA 4ZE5A 4CNOA 1SSGA 3QV6A 1OINA 1QO5A 3UWQA 1XCFA 3SQLA 4GVHA 4Z2LA 3IUDA 3W7GA 3W70A 3N9KA 1UB3A 4UUIA 3E3HA 1J4EA 5BWAA 3E2RA 2DDXA 4NJHA 1ZJHA 4JIRA 3PJUA 2W66A 5A2AA 3CAKA 3VK5A 1E6ZA 5D38A 1KFCA 1I2NA 3W1UA 4DELA 3AS2A 1GPWA 2GJXA 2VEGA 4TVUA 3VKCA 4NZJA 3CJPA 2W27A 1N2VA 3MT1A 2FGLA 1OG0A 4B9ZA 2EEXA 2WSQA 3BMWA 1ME9A 3C61A 3EWUA 3R43A 3SDOA 4CVWA 5E9XA 1CX9A 1ECEA 1FX6A 4O11A 1US3A 1GOQA 1Q7ZA 1SVDA 1JPDX 1J2BA 1XUZA 3NM1A 2GDQA 3R6IA 5I79A 1CXEA 3CUFA 4YMZA 4M7SA 5HNTA 1F5ZA 2P5NA 1YNPA 1E0VA 1GW9A 1A5SA 4XO6A 5D8WA 4B5XA 1QI3A 3ITTA 1J12A 4MKNA 3BTNA 3D47A 3KTCA 3NYDA 1GVEA 4WSKA 2QKFA 1MWOA 2ZUNA 1WXYA 1QFEA 2HNEA 5HUOA 3W1NA 1T40A 1A3XA 4UQ9A 3CUIA 3UJSA 3SJNA 1JPMA 4MWAC 2QULA 3CHVA 2QCLA 3GTXA 4NUWA 5A6MA 3AJ7A 4RKAA 2FFCA 5I3GA 3CIXA 2XVKA 4L9XA 2PTDA 1JPIA 4HSOA 3ECQA 1OZMA 4F66A 1SZNA 4NJKA 1QPOA 5ABTA 4LXFA 1UZHA 3SCQA 2AKMA 1S46A 2H9AA 1LBFA 2R91A 3WFZA 3ARSA 2PWVA 1DHKA 2OKTA 2INFA 3KDOA 1C9DA 3VA8A 3DFNA 2WANA 4YYCA 1YKWA 3AWOA 4DUVA 1VFHA 2C6QA 1TCDA 2J7FA 1KW1A 4RDZA 5D2WA 3HU7A 3VMNA 3GVWA 1LOQA 2ZUTA 4FR6A 3W2NA 1AQHA 1JRCA 4QROA 4UFMA 5G1YA 1E4NA 2F61A 7TAAA 2BB0A 1D7FA 2PDLA 2O92A 4MJ4A 2YXGA 1WUFA 1UWRA 4LB4A 1B5TA 2OT0A 4YIWA 5U7SA 2Q8ZA 3CL8A 2VGBA 3VAVA 2GLKA 3CV1A 3OEXA 5DY3A 3WQWA 2PURA 1REQA 3AWNA 2I56A 1IWAA 5I77A 3APYA 4TVCA 2KAUC 2Z2AA 3VDHA 3UR2A 5I0DA 2F38A 4OBTA 3ARWA 1V3MA 1NEYA 2B0MA 1I45A 1A4LA 2DSVA 4PFHA 4XKYA 4M6PA 3ZT5A 1A3WA 3W81A 1OT2A 2VX6A 3QYSA 2NXHA 1ZBCA 3BICA 4C6OA 1A5CA 5I23A 1OJXA 3QC0A 3FFSA 4JTCA 3I6TA 1XH1A 1TFVA 2ZRWA 4OBSA 2Y63A 1JDAA 1AL7A 2W9MA 3T2PA 1TZ9A 4ZODA 1EDGA 1K6AA 3UNTA 1I2OA 5CJ5A 2JFEX 1CLXA 4HMNA 1UH2A 1C7SA 3UJFA 2ZXDA 3WZ0E 2PDCA 1OFAA 3IGSA 3NVDA 3SCSA 4A2RA 4MY9A 2HS6A 2QJGA 2IPJA 4D6JA 4RZBA 1L9WA 3HIJA 3SGGA 3CEPA 4B4FA 2WSPA 3EA1A 2WYSA 1OK4A 1RH9A 4V27A 3WG6A 4ICMA 4IF2A 2WSKA 1F6PA 3M16A 2FTPA 3H7VA 3PB0A 4RNHA 4CD5A 1M65A 1Y5XA 3A4JA 3IVTA 5EMMA 1PEZA 1G67A 4PEEA 4ECLA 5BOOA 2RJHA 5XIMA 3AMLA 4XIAA 5D2VA 3GNDA 1NWTA 1RQBA 1TX2A 4E3VA 2G3FA 1XV8A 3CT2A 1XPGA 3D3FA 5FD0A 2WC7A 2E5DA 3MBDA 4U5KA 3TR2A 1Q6LA 1CXKA 1QBBA 1Q63A 4JD4A 3UQNA 3THAA 4MYAA 3LD5A 4O28A 3GBDA 1ZRQA 5BWFA 3SY1A 2W3ZA 4JFTA 3QPYA 1JAEA 3PPGA 1KA9F 2CETA 1EF2A 3AMGA 4B2DA 3HG4A 3Q4DA 1M03A 2PCEA 3GUWA 4ZOAA 1PZ2A 2V3EA 1KQZA 1CW2A 2ZX7A 5A6KA 4XV0A 1SJAA 4WUIA 3NQ6A 3ITOA 1UD8A 3QY8A 3K8MA 1K9DA 1VC4A 5AHFA 3ITXA 3EEGA 3VIOA 1A50A 1VF8A 1TJ2A 4IOTA 2XVPA 3HPAA 1HQTA 1NOUA 2WNQA 2E77A 2EG7A 2QUUA 3TAOA 3W7RA 1BF2A 1FFRA 2VURA 1TTQA 2YKKA 1DWAM 5EMYA 4GJIA 4RE4A 3DI1A 1RJPA 3S9ZA 4CQ8A 4GQQA 4RL3A 1HL9A 1UR8A 4HB7A 1IXPA 2J7HA 3RLGA 3TONA 3ME3A 2C8NA 4JCLA 5C0QA 2DZUA 2PMQA 3ARYA 2NX3A 3GVGA 1HJUA 6REQB 4H2HA 1IEXA 2Y5SA 5D02A 4HU4A 3NAVA 2F84A 3AC0A 3T0CA 3O6DA 4PUNA 1FWBC 3S5ZA 3WLJA 3ABRA 4LSBA 3CIVA 1E55A 2D2OA 4Q4SA 1YXCA 4O19A 4ZO9A 4F9DA 4HT3A 4QXIA 4US6A 4UTTA 2ZRZA 4HN4A 4U2YA 4NILA 2VELA 3N2MA 1DJIA 3SGZA 1XRFA 3T0TA 4FIQA 4ERIA 2G3MA 3PUGA 1I60A 1OVDA 3BCJA 4RNFA 1EP2A 3KHDA 3VZYA 3KOXA 1PKNA 3QW4B 3U7VA 5JIPA 1XLKA 1TTPA 2NUYA 4W8AA 1AJ0A 3W53A 3IUIA 3KVJA 3PTQA 5D03A 1BGAA 5ABGA 5I3JA 4H8VA 3EX1A 4CCDA 3NQDA 4M6QA 4N4QA 4Q7IA 4GINA 4RPQA 2E9LA 4N9CA 4WGHA 5B80A 4YTUA 3BANA 2GQ3A 3FK4A 7XIMA 2GJLA 2PDPA 4HK7A 4R5EA 1I1XA 1QHPA 3SIMA 1MZRA 4DXKA 4H9XA 3KVMA 4ML9A 1ONEA 2QZRA 3HMCA 3L4YA 2OWXA 4N9BA 3DESA 1E4LA 3C3NA 4FNQA 5G4HC 1NJJA 4HJWA 1NSJA 1WB0A 4D1IA 3AS0A 1R47A 4AHPA 6CGTA 3EOLA 3JZEA 2DT1A 2HCVA 3CU2A 5IFTA 3T08A 2NQHA 2PE4A 3L2IA 1EWDA 2GGHA 2CZVA 5I02A 1NFPA 4RNJA 1JPKA 2H8ZA 2Z1SA 4FEZA 4PB4A 2QF8A 1EL3A 1W6TA 4L6HA 3MI3A 3U2ZA 4PCSA 2D69A 2XVNA 2VFFA 3JZUA 4DF2A 1Z8AA 2ZTJA 3DUGA 3W0KA 4UB9A 3AXXA 4XD4A 4Z1DA 3O6AA 3BSMA 3R10A 3PSWA 3VIFA 3WDJA 1TWWA 7REQB 1V5XA 4TTGA 1VPXA 3QEZA 1SFJA 3IK2A 4OHQA 1OGSA 1KM3A 1EZ2A 1K9FA 4LJ3A 4R53A 5F2MA 5HQLA 1A4MA 2E8ZA 3GSMA 3N2TA 1E5NA 2Y61A 3OHIA 3KRSA 4UQBA 3FVMA 1R5YA 2ZZ1A 4A05A 3T44A 3VD3A 3LTYA 3NDYA 3PPCA 1JRBA 4ZOEA 1ZL1A 2XFWA 1XICA 4L9YA 3ONBA 3TDFA 1QWGA 4JY9A 2PDHA 2WOQA 1KCZA 1W9DM 4GJJA 3OYZA 4W87A 2OWWA 3MMUA 1HG3A 2OYLA 1WAUA 3V16A 3W86A 1YPFA 4AH7A 3W1MA 5FJUA 6TIMA 1WKEA 5BRPA 2FVLA 1DXEA 2PTWA 1TPC1 5JBEA 2W67A 4LOCA 3GQYA 3NSXA 3IGHX 3TTOA 2X2YA 1IEIA 2WZMA 5MKGB 5C2CA 2WWDA 5K4XA 1RA0A 1W1A1 3DZ1A 4JFUA 1QVBA 1EP1A 4YCPA 2QCHA 1E9YB 2IXVA 1M01A 2WPGA 2PLJA 3SECA 1W1ZA 1JR1A 2FPYA 3PZIA 4LVBA 3NZQA 1V3HA 4WKHA 2HBVA 2NZLA 5L9FA 1X8CA 4K38A 4N42A 1QW9A 3TN6A 4RX0A 2E6YA 4KIEA 1KXTA 3TXVA 1K8ZA 4LH8A 3UZZA 3RMEA 1NY1A 4GY1A 4Q4OA 5A95A 1Q6EA 2D2JA 4TV5A 1BKHA 1EGMA 3WLRA 5LHEA 3QZEA 3TMQA 1K8CA 4L1XA 3L5AA 1Q7MA 3B0YA 1LQ2A 3PZGA 2WZTA 1VBRA 1QI2A 3W02A 3CUGA 4I5UA 3INPA 3C2RA 2ZDSA 1SO3A 2YL8A 3L5MA 4NNCA 3UD6A 3WNPA 3SGUA 5ABFA 3C3UA 5A6BD 1IGSA 3BPWA 3DHFA 1Q6FA 4A3HA 2XJ7A 3CQIA 1BWLA 5AYZA 2XN2A 4QFUA 4GO8A 2GSEA 1EIXA 3CB8A 4IQDA 4KEMA 5EGRA 3TTEA 1E6NA 3CZLA 3RM4A 3GDLA 2ZZ2A 4H6KA 4IFOA 3NO3A 3FNDA 3VZZA 4Y9AA 4GCXA 1YW1A 1SPQA 1JDDA 1UH4A 3NEHA 1V51A 2BHYA 3B97A 2JKPA 3L21A 1UUMA 3UWEA 1B4EA 3C0JA 1EEPA 3P6LA 4HCLA 3QR3A 2HISA 4MUZA 3QGAC 1GEHA 4AD2A 1HXJA 1H1YA 1NDYA 2J47A 4GZEA 4IFRA 2D1ZA 3VNYA 4LUSB 5DBUA 1NQKA 1CGTA 4LUJA 3B8UA 4IICA 2YZRA 5HPOA 4H7VA 5H6HA 3OTRA 3LLXA 2JF6A 3F5KA 2F6KA 3UJ2A 1Q66A 4CKQA 1UWIA 2XDFA 4AD3A 1RALA 4OJYA 3H2CA 1E56A 2P0OA 4O10A 3TA6A 1TMHA 1V93A 1L6GA 2R6OA 4F4RA 4UR8A 1LRTA 4WZHA 4ZMGA 2CKSA 1DXFA 3H2OA 3AROA 2DSZA 3FSUA 3MTWA 5ABHA 4K1GA 1D3CA 2H3BA 2EPLX 1FY6A 2R1KA 1E5JA 2JF7A 3TCSA 2REQB 1UQYA 2POZA 3DH7A 2VDHA 3UESA 1EOMA 4WXZA 3W29A 1NP0A 1V08A 3K30A 4IL0A 1FWCC 4M1RA 2BGNE 3QQWA 4AIUA 4C6PA 1Q4NX 4ZA0A 1Z6KA 4BCEA 3W1AA 4XIMA 3STFA 4GH3A 5KSWA 2WMIB 1JFXA 1HP4A 4WK9A 4O1EA 1R0MA 3LS9A 4HPXA 3L0NA 1BGGA 1DP0A 1I75A 3FX4A 2AOSA 5AY7A 3VKJA 3D5HA 3BUVA 3WLQA 4JN8A 1K70A 3FA4A 3GFXA 1Q6RA 2WO5A 1BWVA 1IEVA 3ARZA 3GD6A 4DWSB 1LL6A 2P53A 2XGBA 1VEPA 3IWPA 3ZYZA 1W31A 4HNVA 4IZGA 2B7OA 3ZVHB 4M7TA 3DX5A 4S3KA 3W01A 1AZ1A 2KX9A 4LY8A 1LQAA 1XLMA 2VC6A 3DFSA 5DT5A 1ISZA 1XIMA 3VABA 3EAUA 4GMEA 3MJMA 3BAKA 2BV9A 4YVXA 3S8HA 7PTDA 3FIGA 2CZEA 3WNNA 5FSDC 1AFSA 3QR1A 4QHRA 4U3CA 5HNNA 4O13A 4HKPA 3F1QA 1MSSA 5C9UA 4JTRA 1GZJA 3HFTA 4A3RA 4YJ5A 3QC3A 5EFFA 5EMLA 4E38A 3S1VA 2BP1A 1UA7A 1LOLA 4XVDA 4S1FA 2J88A 3TSDA 1XH2A 1CGYA 1Y7VA 1OC5A 4M56A 1E6RA 3NXLA 5EMKA 3S3GA 5JH2A 1OX4A 4HNOA 3LLDA 3UZXA 1GVRA 2XSBA 4DJDA 3VOGA 2Y7GA 4WOQA 3CB3A 2AL2B 3HA1A 1S1PA 1W3TA 3B05A 1IV8A 1R87A 3AS1A 4I3GA 3LTSA 4M24A 3OQEA 3EDEA 4GE8A 3WH8A 4EAYA 1W9BM 3G1DA 1ITUA 5EB8A 1VRDA 4FS9A 4AYSA 1RJRA 3EWYA 3BW2A 2GWNA 5HNRA 2VHLA 1F73A 3AHYA 4QSFA 5CAHA 4DUWA 4M3PA 4GQBA 2GSHA 4NZ3A 1V6UA 3S2MA 2TYSA 4LAUA 5KITA 3AMCA 3VCCA 4ACYA 4EWJA 4L56A 1POKA 3W26A 3WQOA 5IM51 3FEMA 4QS5A 1SYTA 2VEKA 3A12A 2VDGA 3T9PA 3MHFA 3EPOA 4QQUA 4FNTA 1PX8A 6XIMA 4IXHA 4NYUA 5G2IA 1JVNA 5DCEA 5LIYX 1LORA 1G69A 2D22A 2GQ8A 3HPSA 3PUOA 4LBSA 3WLTA 2V9DA 1S3HA 3PAJA 1AW2A 2QJIA 5KTLA 3A6OA 2A3CA 3GHUA 5K9XA 4G1NA 3VGEA 1CEOA 3EXSA 1TPFA 3FJNA 4QITA 3UYCA 1BRLB 1UKTA 1YNYA 3TZNA 3OO2A 4H8UA 1GOKA 4WRHA 4RE0A 1XIJA 3L4UA 1IT7A 4S2BA 4NZ4A 4IT1A 3SAZA 4QE1A 1BKSA 3MV11 1EX5A 2YOCA 2VZOA 2PTYA 1SFTA 1MZHA 2GGEA 1WDSA 3DECA 4DZAA 2WMKA 3G8RA 3EOSA 3VX0A 3N13A 4Q4KA 3NM3A 2QVHA 2A3HA 3PNZA 4XBJA 3DGBA 2OLSA 2Z7KA 4AWUA 2AQVA 2QUTA 2Q6ZA 1UKSA 3C2EA 4WGXA 3PJXA 1TWZA 4A8IA 2QAFA 2YL6A 3O6CA 1A5LC 1HJSA 3VCRA 3S2NA 3MDUA 3NVTA 4UMCA 4HU3A 4M0XA 1OCQA 4UFKA 1H7NA 2YYUA 1GOOA 2RHGA 1OADA 3SCTA 3U8GA 1VKFA 2GJRA 4NSBA 3IV3A 3CWOX 2PA6A 1DJNA 1R9ZA 1W5PA 1SJDA 1UA3A 4N2YA 4F0MA 3L68A 3RU8X 3CXOA 4UTKA 3REQA 3R1ZA 3QF0A 3MU7A 2PF8A 3N73A 3GNOA 3B8SA 3SY5A 1NFGA 1RBOB 1RY0A 4PSPA 3ZFHA 3UR8A 4M82A 3CHCA 1N55A 4Q6JA 2ZTKA 1LP6A 3MO4A 1KV8A 3LOTA 2CW6A 3S46A 3USBA 3JRKA 3B03A 4H19A 2XFRA 2DZSA 3WQEA 1VFMA 3UA3A 3L4XA 4Z1CA 1C7TA 5F2LA 3EKLA 3B40A 4ZQRA 5LNRA 3KAOA 3EOEA 1XSJA 1EGZA 1VLWA 2GQAA 3IK4A 2H9AB 4JTHA 1X1NA 5F4XA 5AZ1A 5GQBA 1DJXA 2Y2WA 4PGLA 4AAJA 1UHVA 1GOWA 2QW5A 2ZUSA 4TTUA 2Y85A 4C6LA 3MZ2A 4FOKA 3GXDA 4K8EA 4REQA 3OLGA 1FUYA 3I4EA 4E8CA 1P6CA 4QLLA 1V7AA 5JVLA 1Z32X 4L4PA 4C6QA 1RD5A 5H8PA 4JTAA 4O16A 1DJQA 2OWCA 1O12A 4PCPA 2YIHA 2G37A 4AY8A 5BXTA 3CO8A 1UP3A 2GSJA 4HA4A 2PTXA 1LG2A 5BNKA 2QDEA 2VVNA 3U5YA 1UWQA 3W07A 1J6OA 4A22A 3A21A 1XLHA 1VIWA 1F3EA 1GVOA 3S1UA 2DJXA 2QYGA 3WLKX 2C1GA 4R7JA 3R94A 4UTLA 1QU4A 4H7ZA 4Z2KA 3SB0A 4BY3A 1E0WA 2ABAA 1DOSA 4Q22A 2UV8G 2PS2A 1DWIM 1DQUA 2BY1A 4AIEA 3DKLA 2BXVA 2PZNA 7ENLA 4OV9A 2EXOA 4FNSA 2BY3A 1ENUA 4HTYA 1GJPA 2XZ9A 4NI3A 1Z69A 1JZ6A 2NLYA 3LBMA 3NZPA 3U6WA 2VFIA 1XIEA 2HVOA 5C70A 3NGJA 1R86A 2GK1B 3UBPC 4QTGA 2CKRA 1EH9A 1EOKA 4P7QA 2PLMA 3OBEA 1G5AA 3NL5A 2ZRYA 4JHZA 3SCOA 4MWAA 3H23A 5JU6A 3EWCA 3CC1A 3R25A 2GL5A 1TX0A 3W71A 4IMDA 3JUGA 1V3IA 2BY0A 1OCNA 3GNPA 2YB4A 1HKVA 4L6DA 4DLFA 4INFA 4JQ2A 1YMYA 4JPGA 2VFEA 4N4PA 1XIBA 1XD1A 2NX1A 2WWCA 4GZJA 3TQVA 4IMGA 4TX8A 1ISWA 4UQAA 1EHNA 1B0IA 3UXAA 3URBA 1EJXC 1TA3A 3AQUA 3GU2A 1R30A 2EO7A 1LCOA 3UZYA 4P7LA 2ZADA 5HDRA 2RDUA 2QV4A 2OQLA 4E2DA 1XSIA 2BWGA 3QLLA 3AOFA 1KRBC 4E4UA 2WNWA 4AD0A 4YXGA 4I8YA 1K4GA 3BCFA 4JTGA 4LVFA 3AXKA 1M68A 4TX9A 4MKSA 4OTKA 4AWSA 1RP9A 2PAJA 4A3UA 1ZCOA 3NXFA 2NT1A 3GZAA 4F0HA 2IS7A 2WVUA 1JAKA 4NXSA 1OF8A 2TAAA 2W4XA 4IPNB 4AZBA 3ITLA 2YCLA 4EE9A 4KEZA 2VX4A 1OB0A 3TC6A 1KTNA 2HE5A 3H2FA 3PSVA 4ZCWA 2DV0A 1UMLA 5DMLA 2MNRA 2FGBA 4GXMA 3TIMA 3W1QA 4PCNA 2ZWZA 3KBSA 1QNRA 2OYKA 3CQJA 3I6EA 4JCMA 3LCWA 3NOYA 4LC8A 1DBTA 4ACZB 5E1QA 2C79A 2PDUA 2X1SA 4HK5A 3CPRA 1DV7A 5LXEA 4WX2A 1FHVA 3KBVA 5AC7A 1W9VA 4S3EA 1TCMA 1POJA 1UC4A 3FA5A 1E72M 1XIFA 3AIRA 4KETA 2V6AA 1FTXA 4PTMA 3AYTA 2E5CA 5IHRA 4RPPA 2JKAA 3PPHA 1E1CB 1HJQA 3HV8A 3VNZA 3ZVIA 2Y1HA 1YDNA 4P8WA 3WLIA 4MB1A 1EQPA 5DMNA 1CXIA 4KCWA 5DQPA 1DIOA 4DF1A 5JH1A 4PH6A 3F03K 3WEOA 1TIWA 3BVJA 3TYAA 2PD5A 3LM7A 3KEHA 2DH2A 1H4PA 3WMLA 3V36A 3GIPA 1LL7A 1BYAA 1BVWA 3FHQA 5AVHA 4LU0A 4NZCA 2QR6A 3TV8A 1J0JA 2P8CA 3N1AA 4CUCA 1LUCA 4NAFB 3GC5A 1X7FA 3BMXA 4C6IA 4I9TA 1J0ZA 1J10A 5BCAA 3WLLA 1EPXA 1W91A 4D6CA 1G4SA 4ZTYA 1P0DA 3N2BA 4S23A 1K03A 4ZO6A 2R1LA 5FF3A 2DZVA 1AQ0A 4L7ZA 1TYGA 1C8VA 2Q3OA 3V1PA 4EXBA 1L8PA 3GK0A 1XYMA 4PUUA 3VMOA 4NAEB 3QBUA 3P0WA 1QNVA 3GG1A 1JL8A 1DPMA 3IJQA 1HJVA 1N82A 2GWGA 2VRQA 1BQCA 3CAQA 1H62A 3ZXWA 4NRSA 2YX0A 3HPXA 1ZAJA 4GY7A 2NUWA 2ADAA 3MUIA 5FF7A 4OVXA 3RM9A 1ZBKA 3QGKC 5HJYA 2ONEA 2WM0A 4CCEA 1EJUC 3ZR6A 4CU7A 2GGIA 2BGQA 1W1YA 1S5MA 3ABOA 2XIBA 3ATZA 2VC9A 1DYSA 2NQJA 2A4AA 4P7RA 1ZHAA 3T05A 4W89A 3WDQA 5C9XA 4XKYB 4DJEA 1RR2A 4YTQA 5E09A 2OZTA 4QR6A 3IJDA 4X61A 1W5OA 5EU9A 3TJXA 4C91A 1RCXB 1VCFA 1TVNA 3AHXA 4JL2A 5CPOA 4JQAA 3DERA 3F4VA 3HGSA 1CXLA 1IQ8A 2PDJA 3C0LA 4D8AA 3UT0A 1DEDA 3TCEA 4IJBA 3LV6A 1H0IA 3FEQA 2H6RA 3CL7A 3P61A 1R3YA 1SQ7A 2WSYA 5A6BA 5A8OA 1XFCA 3RIKA 4JNZA 1R3RA 1FP9A 4W7UA 4IPJA 2BHUA 1XRSA 1EC7A 2GGGA 4M8UA 5F1VA 3OBAA 1I0BA 1S2VA 1Q85A 4NZFA 4O0ZA 4G7EA 4NF7A 3KFTA 2FDMA 3SURA 3WNMA 4F79A 2NW0A 4DF0A 2ZUVA 2TRSA 3TW7A 1A0DA 1KWGA 1O66A 4DN1A 1GQLA 1XBZA 5FJPA 2V2HA 3KL0A 4I9JA 2E0PA 3RFAA 1HVQA 2ZWYA 1J0KA 1FWFC 2V38A 1ICSA 1HL2A 2OU4A 4LEQA 4JTQA 4DO6A 4PMUA 3MP5A