2R94A

Crystal structure of kd(p)ga from t.tenax
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
286
structure length
286
Chain Sequence
MEIVAPVITTFRGGRLDPELFANHVKNITSKGVDVVFVAGTTGLGPALSLQEKMELTDAATSAARRVIVQVASLNADEAIALAKYAESRGAEAVASLPPYYFPRLSERQIAKYFRDLCSAVSIPVFLYNYPAAVGRDVDARAAKELGCIRGVKDTNESLAHTLAYKRYLPQARVYNGSDSLVFASFAVRLDGVVASSANYLPELLAGIRDAVAAGDIERARSLQFLLDEIVESARHIGYAAAVYELVEIFQGYEAGEPRGPVYPLDPEEKAWLRAAVAKAKSQLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords 2-Keto-3-deoxy-(6-phospho-)gluconate aldolase
publication title Crystal structure and stereochemical studies of KD(P)G aldolase from Thermoproteus tenax.
pubmed doi rcsb
source organism Thermoproteus tenax
total genus 111
structure length 286
sequence length 286
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.14: 2-dehydro-3-deoxy-phosphogluconate aldolase.
pdb deposition date 2007-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2r94A00
3UZ5A 3MYPA 3LERA 3BGGA 3LHYA 4FX8A 3NPUA 4JICA 1ZAHA 2VFDA 2ABAA 1IGSA 1I8JA 1ZHAA 3C0JA 3QEZA 1QPOA 2BXVA 3A23A 5CSSA 3QMSA 3L66A 3L65A 5BOOA 4O57A 3NQGA 2OX1A 1K02A 3G1VA 5E1QA 3ZFHA 3DENA 5DY2A 3TIMA 3WJYA 4DEFA 4NU7A 4O0KA 4QISA 4RXGA 3TCEA 3STEA 4FX7A 4LRTA 4R53A 1Z42A 1ZALA 2EPHA 4R33A 1WBHA 1X6UA 5K9CA 4OGZA 3M47A 4UXDA 2FPYA 3OVQA 1GOXA 3PM6A 1P0NA 1Q6LA 5E93A 2CLFA 5AHMA 2YDAA 2FJKA 4IMDA 1V7YA 2BWGA 5G5IA 3LHWA 2X1UA 3IGUA 2ZRVA 2ZTKA 4LVAA 2Z0IA 2ISWA 3OIXA 1FCVA 2RH9A 1OFBA 3W1TA 1QNVA 1TTPA 3WJZA 1WA3A 3STCA 1VCGA 2GJLA 4S2CA 3HG3A 1JVNA 3W75A 2E68A 4O4VA 1JCJA 5G1YA 3H53A 3KVJA 5LGZA 5G2WA 4M19A 3R2GA 5AYXA 3W7RA 3TU9A 3UZJA 3MP4A 1SZNA 2Z6JA 3BG9A 3BLFA 1IXNA 1TCDA 1UJPA 3W7KA 2Q8LA 1EUNA 2QCHA 2UV8G 1KM3A 4MFEA 4TU1A 3S42A 4CNNA 3A5FA 2J9XA 3SECA 1GZGA 1VQTA 1VR6A 3I65A 2NXHA 1ZAIA 4BI7A 5AC6A 1TB3A 5CSRA 3KX6A 3ELFA 1A53A 1F74A 3PVFA 3EWWA 1LRNA 3VE9A 2ZQ0A 1ICQA 3HB9A 1RZMA 2H3DA 4A21A 3A22A 4UIOA 3W7QA 2C15A 5CZSA 2AGKA 4AF0B 1QPNA 4FO4A 5L9FA 1X8FA 5BMWA 1UUMA 1LYXA 3NM1A 5EYWA 1ICPA 1YXYA 2WNZA 4N4PA 2ZZ3A 1K3UA 4N6EA 3TX9A 4FNSA 3EX2A 1VC4A 3LRMA 4AEOA 3IVSA 2E5BA 4MZ8A 3P74A 4MYXA 1OF6A 3KOFA 3N2MA 1TPWA 1FUYA 1OF8A 2E09A 2XN2A 1ML1A 4ZQRA 1C9DA 3NAVA 3P60A 5DXYA 3O6DA 3W2KA 1YPFA 2E6DA 3SSJA 1VZWA 2E6AA 2RFGA 4JR5A 1BEUA 3N73A 5AC8A 2ZYFA 4N02A 3R12A 3CWNA 2WSYA 5AC7A 1S3HA 1UB3A 1JRCA 4DQWA 4LY8A 5ABTA 4UNLA 2VFFA 4E2DA 2H90A 1VRDA 3TFXA 1KBIA 3W1UA 3W07A 4MY8A 3TKFA 3M16A 3ABQA 4NZFA 1TTIA 3KFTA 2YFNA 4NJGA 2QCEA 1LBFA 4O12A 5DXXA 1SFJA 1YTEA 1KFBA 1LM1A 3WJWA 4UTTC 1F6KA 3TXZA 1THFD 1K8ZA 2WO5A 1W5NA 3HG4A 3GR7A 4DBDA 2ZRYA 3B03A 4RXFA 1XUZA 3BARA 1ME9A 4J9JA 2HS6A 4ZQOA 4AHOA 1QPRA 1OYCA 1NFBA 3W76A 3S5YA 4QJ1A 1LOSA 3P67A 4BF9A 4GUIA 5KZMA 1JUBA 5D2TA 3S1UA 1EWEA 1NVMA 4GUHA 3TAKA 1FBAA 1D9EA 2P10A 2E5CA 1QDSA 3L0NA 1A5SA 2QCMA 3DI1A 3LX9A 3R13A 4O1BA 3GKAA 1KLYA 1ZNNA 2CLEA 4YWIA 3LM7A 3TJLA 4LNYA 2A0NA 1I2PA 3W9ZA 3BLEA 3A24A 4ZL1A 3HG2A 2PCQA 2V2CA 3L68A 1YDOA 3RMJA 4A22A 3KRZA 3O6YX 4O1DA 4RK8A 1BTMA 1PV8A 1FY6A 4UR8A 1Q45A 1F05A 3TA6A 4JTHA 4H4IA 4FNQA 4ORIA 3WK1A 3G1DA 2C1HA 2H8XA 4FNRA 3LI1A 4Z1AA 1RQHA 5D05A 1SO3A 4KFPA 3T44A 1KTCA 1B3OA 3TXVA 4DPPA 2GQ9A 3EKZA 2A6LA 1OFQA 2QAPA 5A8GA 4JN6A 3OA3A 4WXYA 1G6CA 5AB3A 4UTTA 3W1MA 5I3JA 2FB3A 4GUFA 3CT7A 3SGZA 4BWLC 1MO0A 4DF0A 2CLKA 4H3DA 1NSJA 1RV8A 1VCFA 3E0IA 1NAL1 2I9EA 3ABSA 1TPDA 1K03A 3DGRA 4PFMA 1Q6QA 5I3FA 4RX0A 1EWDA 2V82A 3W2MA 3NOEA 5LNVA 3P8IA 4QIUA 2GUUA 3NXFA 5AN7A 3V1PA 1YXCA 1VHNA 3AJXA 1TRDA 3W73A 1H61A 1ME7A 3W71A 3LCHA 3DHFA 4NNCA 3VKJA 5FEWA 2V5BA 3EWZA 5F2MA 4I7WA 4WXZA 2D73A 4TR9A 4GBUA 1XL9A 3W3OA 3UWUA 1PIIA 4O4WA 1EPXA 1GT8A 3W7NA 3G3MA 3HMJG 1CW2A 3CPRA 5FF7A 2Y70A 2C0AA 3MP5A 4JDBA 4OU1A 2Y7EA 3IIPA 1G7UA 2QCGA 2G5WA 2C13A 5EL1A 2QEZA 1LLZA 1OX5A 3NQ6A 3W2UA 4LT9A 2IQTA 4TMBA 4I7VA 3DZ1A 2BTMA 2X16A 1A5AA 4ADSA 2ALDA 3QMRA 2NZLA 4XTIA 4HNNA 4JIQA 2DORA 3B8DA 4BWLA 1NEYA 3W7OA 2XFWA 4LOCA 1TMHA 1OK4A 4IOTA 1G4PA 4ALDA 2EGZA 5AOUA 3UWZA 1GVQA 3L5LA 4ZQMA 1XXXA 1IIGA 4UTWC 2I1OA 3CIWA 4UTMA 1ZAJA 1XBXA 1Y0EA 1FWWA 3E96A 4NJHA 1QOQA 4LUIA 7TIMA 1MEIA 2G95A 3W2LA 2Y85A 1KFKA 1TV7A 3VNDA 1I2QA 1SUXA 4OBTA 3HGSA 3W1AA 3TJXA 2ZFAA 1GQNA 2F7FA 4AF0A 4IWWA 1LTDA 2R14A 2A7RA 4Z1CA 2A1YA 1T0OA 5K9DA 1YADA 3DFNA 4AHPA 4XUGA 2CLHA 1PL9A 4LW7A 2WSQA 4GJ1A 2DJXA 2J88A 3U2OA 2B4GA 2X1RA 1W3IA 4WX2A 2DZPA 5HUPA 1W37A 3W1LA 2FTPA 4AH7A 4TIMA 1TPH1 5LNSA 3UY7A 5CZJA 3PUDA 3R89A 4UMAA 3B06A 1M5WA 3VE7A 2NUXA 5I3GA 1R46A 1G4TA 1FXQA 3KHJA 5A5WA 3GDTA 3M1ZA 3TMQA 3L0GA 1M7OA 2ZDRA 4O15A 2ZRUA 2FDSA 3CIXA 4CNPA 4JTKA 2VELA 3HJZA 4O19A 3MW7A 4NZJA 3FEMA 3IIZA 3CTLA 3M7WA 3HF3A 3LOTA 3QF0A 1IXQA 1M7PA 3RK8A 5D2VA 5HWNA 3TSBA 4O18A 2WKJA 1FCUA 3PG8A 2VEIA 3G8RA 1KM4A 1MSSA 1I2OA 5G4EA 3QYQA 4N9BA 2FQIA 1Z48A 2XN0A 3TC7A 3HPXA 1DQWA 3W1QA 4PL2A 2ZZ1A 3W86A 3C2FA 4ONVA 1GG0A 5AHLA 1I4NA 3NL3A 2OZ0A 4E0CA 1UBSA 3QQ0A 4MOZA 4NX0A 3TW6A 2PE4A 3TV8A 1P0KA 1TREA 1MXSA 3N14A 1YTKA 3BW2A 5BNKA 4K38A 2NLIA 1H60A 3FOKA 4HNVA 4X9SA 4S1FA 2FB2A 4MLRA 2A2IA 5TIMA 3P80A 4LUJA 3KVLA 2X2GA 5MHBA 4HT3A 3MHGA 3TC6A 2JKEA 1TPB1 4DF2A 5BRBA 5DCEA 4Z1BA 1LDCA 2ABBA 5LHFA 5CGQA 1A5CA 1JRBA 4JIPA 3W2JA 1SFLA 1GJPA 5CPLA 3DXIA 4EIVA 4UTIA 1JCYA 2OJPA 3FYPA 3HO8A 3FLUA 3SI9A 4O8RA 1DJQA 1PCWA 1OFPA 3O07A 1SZEA 4ORMA 1KV5A 2ATMA 3PBYA 4NXKA 2HS8A 4AWSA 4R7JA 2TMDA 3QMTA 1BWKA 1LLWA 5FF4A 4FX6M 1UUOA 1W5QA 3O15A 4LC6A 1KM6A 1SZFA 1VJIA 4HNTA 3W7GA 1X1ZA 4JTSA 4FNPA 1QPQA 4LWWA 4X3ZA 5CPNA 1L6WA 5FF2A 1D3HA 1R30A 2GPTA 1GTEA 2RKXA 3BG5A 4OT7A 4UFIA 3M43A 3QPZA 4U4MA 3G1SA 5HJLA 5U4NA 3PUOA 3TQVA 2YW3A 1KV8A 2J9YA 1XKYA 2VFGA 4IPIA 1T8XA 2JGQA 2Y7FA 1OFEA 4NNBA 2I14A 3S6DA 4UTHA 2ZRXA 1FWTA 1XCFA 2AQWA 2RHGA 2Z1BA 2C14A 4K7VA 3W84A 3WK2A 5K4ZA 3EEGA 8TIMA 3PULA 4JTIA 1XFBA 4M5PA 2J24A 3ABRA 1B4EA 3S8HA 2F84A 5G4WA 1O5XA 5CPOA 4XKYA 1KBJA 3FKKA 4O53A 3EX6A 1I2NA 5IBXC 3KVKA 1W8SA 5FESA 1TJPA 4CQAA 3RU6A 3C2EA 3GLCA 4GWEA 2JK2A 3QQ1A 4IXXA 2H8ZA 2Y7DA 3CEPA 1XI3A 1XUUA 3DKJA 1VYSX 1YDVA 1KM2A 1VYPX 4Q32A 4Y96A 4M7SA 4WY0B 5AFDA 3QSRA 1KFCA 1LCOA 4NT0A 3PY2A 5I3HA 1QMLA 4O54A 2VFEA 1L9WA 5BMXA 2VENA 4LVGA 3LBMA 1W5OA 5G2HA 5LHEA 3GNNA 1EX5A 4IGHA 1K7EA 3W1PA 2DU2A 2C16A 2QJIA 4YL2A 1TPUA 3LV5A 4EOUA 4AWTA 3H54A 4GNJA 3WJSA 1QCWA 1FQ0A 4Y6GA 1I45A 4Z08A 1BWLA 3M9YA 3NEVA 2HSAA 4O17A 3W7LA 1B4KA 3ZS4A 2YX0A 3L21A 3N3MA 1GVOA 4QITA 1OYBA 3HPSA 3W22A 1TPC1 1H62A 2NX3A 4EF9A 4IMFA 1SSGA 5DELA 3N2XA 1KTBA 3NA8A 1H7PA 2V2HA 1VH7A 3HG5A 1OABA 2DZSA 5FI8A 3TDFA 1PHQA 4B5NA 2Z2UA 1QOPA 5HMSA 4N9CA 5U7SA 4MZ1A 3E49A 3C2VA 1XDMA 4IPJA 4LS0A 3NQEA 3G0XA 2V2DA 3EB2A 2Q8ZA 2VXNA 2EAWA 1T99A 3THQA 4AHQA 1OFOA 4AVFA 1KFJA 1Z41A 4N4QA 1H7XA 2QJHA 1JCLA 3LI0A 1SO6A 3S0CA 1U83A 3W70A 5EMUA 4K6AA 3IIOA 4TMCA 1QO5A 3O6CA 4JNMA 5DBTA 3EX3A 4UTJA 3TFCA 1K7XA 3MJYA 2WNQA 4G1KA 3C56A 3DFOA 5FEXA 3M44A 1TYGA 4ZQCA 1O95A 3UYCA 2B7PA 3W7IA 1TTQA 4LTSA 3WFAA 4O11A 1VGAA 4MIMA 4M6QA 4W9TA 4PTNA 3ZWSA 2YZRA 3AO0A 3NGJA 3C61A 3G24A 3T7VA 2Y63A 3IIVA 4QQ3A 4FB7A 1LBMA 4HKPA 1H1YA 2V0TA 1RD5A 1JCNA 3YPIA 1TTJA 4DO5A 1XBVA 5CPMA 1ZJIA 3WK0A 1OX4B 3QFEA 1WDWA 3C2OA 1HTIA 1ALDA 1YLVA 4YCOA 3DBPA 4MLJA 3MBFA 2VFIA 2VOMA 2NUWA 2FLIA 3MBDA 1EP1A 1W31A 1SZGA 3NR0A 2DZUA 3KAOA 1W0MA 1MZHA 3INPA 5C2XA 3GNDA 4FF7A 3EWXA 3BVJA 3O63A 1AL8A 3Q94A 1X7FA 5DBUA 1WV2A 5J5DA 1A5BA 5LNRA 1RPXA 3CM4A 4M6PA 1H7WA 2W79A 1TIMA 4HPXA 4O52A 2JGYA 2QUVA 4AB4A 3O16A 4TX9A 1ZY9A 3U8GA 4PC8A 2WJZA 3P84A 3PB2A 3LGEA 4PH6A 2X30A 1AW1A 2QCDA 3EKLA 3UWQA 1QFEA 3GDMA 3UY8A 1GYLA 3IVUA 1SW7A 4A2RA 1F73A 3MO7A 2RDWA 4AWUA 1S5TA 4MVAA 1B9BA 3IVTA 3R8RA 2ZZ7A 4HNUA 4LC8A 2R8WA 1DVJA 1WYIA 5LZLA 3LHZA 1TQJA 4UNKA 3TQKA 2KZHA 1EEPA 2EHHA 3L67A 2TPSA 4XBKA 2X1SA 4DELA 1GVSA 4N2YA 2YSWA 3G3DA 4L4LA 2FPTA 3G1XA 2CLOA 2P0OA 2R91A 4WJEA 2Y88A 1KW1A 2PURA 3LCWA 3HGJA 2VEPA 1QR7A 2BSLA 4XBSA 1RQEA 2ZA3A 1WOAA 2YFOA 3O06A 4NJJA 1ZCOA 3NQ2A 1WXJA 3NQMA 1W5MA 4NX5A 2VKZG 4QAIA 2FPVA 2QKFA 3LRKA 3B0VC 3I7QA 3TSMA 3NQVA 3EXTA 3I7RA 3M6YA 3LRLA 2CZDA 3VCRA 5E0KA 2GVLA 2DZWA 3UWVA 2OT1A 3GAKA 1GG1A 5F2GA 1W3TA 2H3BA 1RR2A 2E5DA 5C55A 3KXQA 2GQ8A 5CZ0A 3NL5A 2Q3OA 2WOQA 3NQ7A 4MUZA 5HINA 2H6RA 3LBCA 4GUGA 1VHCA 6TIMA 2QDGA 4UR7A 3L5AA 2QAFA 5L6UA 1H1ZA 1N7KA 1U5JA 4XZ9A 3Q37A 4OV4A 3O05A 4YXGA 3PUEA 1DV7A 3NNTA 3SGUA 1JCMP 1OK6A 4QSHA 3G8EA 1EIXA 1FCQA 4O10A 1OG0A 3ATYA 3B04A 4OQVA 1CI1A 1OJXA 4O16A 3LCGA 2B7NA 3BGJA 3I6RA 3LTSA 4CQ9A 1RVGA 1W3NA 4E2BA 3NG3A 1D3GA 4GE8A 1HG3A 1G7VA 4IX2A 4UFHA 1R2RA 3FFSA 3C52A 3V75A 1W54A 2Y61A 3PAJA 1VLWA 2QUUA 2ZZ6A 3EXRA 5K3VA 1FX6A 4O1CA 4ADTA 3NYZA 1F76A 2PC4A 4Y8FA 4IQLA 5D38A 4EF8A 5KTLA 3GK0A 1S5WA 2C6QA 2NWSA 1OX6A 3BO9A 2X1TA 3LCFA 3BK0A 1TQXA 4K7YA 2Q3RA 2J9ZA 4FHAA 1HFBA 4HIBA 3W88A 3DU0A 3TK7A 4O14A 4N9EA 4KFNA 3LLFA 1H63A 4JTJA 2HMCA 3CEUA 3MHFA 4UCGA 5BW6A 5D2XA 1KA9F 3F4WA 5TQLA 1QWGA 3ANYA 4Y9AA 3LHVA 1SQ7A 3DI0A 5AHIA 3PBVA 4LU0A 5AHEA 4JXCA 1TO3A 2V81A 3MI3A 3S5ZA 5HR6A 2G97A 2GVGA 1NF0A 3CC1A 5SWUA 3JR2A 1O94A 1J5TA 4WOQA 4K36A 4AMAA 1FXPA 4GXMA 2ATSA 4I9AA 3HPZA 4UTWA 1KFEA 5D32A 1KM0A 1DQXA 3P62A 1EA0A 3GDLA 5I3KA 2E6YA 3S5OA 3NQCA 1FWNA 3FJLA 4X2RA 3STGA 2OCZA 3DFQA 2VFHA 2LLEA 1N8FA 1C29A 3QH2A 2J6XA 4JDYA 2W6RA 3LLDA 5F2LA 4R34A 2CW6A 2DZXA 3G1AA 1GEQA 2VC6A 2ZZ4A 1T96A 4FXSA 3C4UA 5GVJA 1ZFJA 3K30A 3UPWA 4ADUA 1W56A 3TW7A 1GYNA 4A3UA 1FDYA 4KKXA 4WY0F 3HBLA 1EP3A 3EX4A 3LCIA 1K8YA 1O60A 5AHFA 3QC3A 3W87A 3G1FA 1XM3A 1L2UA 3W1RA 3NQDA 1WQ5A 3HOJA 3DHDA 1R47A 1KM1A 4TO8A 5HQEA 5C6MA 1XC4A 5KITA 1GVRA 2ISVA 5DCBA 4HSOA 4A29A 1G67A 1O5KA 3UD6A 5H2ZA 5LNWA 4CLMA 2JKAA 4CCEA 4AAJA 5D03A 1SO5A 3OBKA 4UUIA 4UC5A 5HR7A 1LORA 3W72A 1OVDA 4LVDA 4MFDA 4X22A 1Q6RA 5DY3A 3W7EA 3E02A 1YTDA 3NPWA 3PC0A 1KM5A 4K39A 3NPXA 4MKNA 4RZ6A 3GVGA 1LROA 3GIYA 3TROA 5IM51 3NL2A 3LHTA 5F1UA 3FKRA 3OHIA 2GVJA 1CX9A 2ZZ2A 1AL7A 5F4WA 1G4SA 3N34A 3TAOA 5K2ZA 4GUJA 2DZVA 4RJEA 5KZDA 1ICSA 2NV1A 4Q4KA 3RNDA 3TR2A 4MJZA 2B0MA 3THAA 1F5ZA 3E12A 4LVFA 3NO5A 4L4MA 4Y90A 3C8FA 3W23A 4OWGA 4UFMA 3WK3A 4M7TA 4RZ4A 3EXSA 3GB6A 2WV8A 5EKYA 3HGOA 3H55A 3A5VA 4CCDA 3U6WA 2YYUA 4KWVA 1WX0A 4LV9A 3NQFA 1FDZA 2WPBA 3SR7A 2YPIA 3FS2A 3S9YA 5HNRA 4HSNA 2QCLA 2JBMA 5D33A 4CCCA 4H6KA 3MMTA 3L9CA 3SZ8A 3S1WA 1MEWA 3IRDA 3GYEA 5EBUA 3MI6A 3JS3A 3T78A 1GWJA 1J4EA 3LV6A 2QCFA 4POCA 2C19A 1GVFA 2CZ5A 1V5XA 4BI5A 3M5VA 3SY5A 3OVPA 5TBOA 3LCXA 1EB3A 1SW0A 2QUTA 3LCLA 4N9DA 4CQ8A 1H7OA 5D09A 1DL3A 4DBEA 1IF2A 2GOUA 1H7NA 5K7JA 4I7UA 1SPQA 4E38A 3Q58A 4IXHA 3SJ3A 3W74A 3OEXA 4PEKA 5LNUA 1S5VA 1B57A 4YLWA 4PA8A 4UFLA 4UFJA 4Q33A 4JTEA 3OVRA 5D04C 3M41A 1AK5A 1EUAA 3NQ8A 1A50A 4FIQA 3KRSA 5KINA 4HPJA 1KTNA 1PS9A 3BG3A 4WZHA 3MHUA 2J27A 1OHLA 3GXPA 3IGXA 4JTLA 3BW3A 4FEZA 4JYFA 2WSRA 2O7QA 4JEQA 4HHPA 3QRHA 4MYAA 2NX9A 4ML9A 4UTKA 2QCNA 3QM3A 3UQNA 5T26A 4LS1A 1QAPA 2ZBTA 1TRIA 2B7OA 1G4EA 1YYAA 4IX0A 2CZFA 5IBXA 2QDHA 3GAYA 2YYTA 3BW4A 5D2YA 1XBZA 2CWNA 4RZ5A 3M5ZA 3UWWA 3EWYA 3I7SA 1LOQA 5CG7A 1AMKA 2DZTA 3UXAA 2B7QA 4DPQA 5DCDA 2ZZ5A 3C2RA 3NZ1A 3FA5A 3M0ZA 1HUVA 2PRMA 3FJ6A 4NJKA 2O7SA 5D37A 3GX9A 5HUOA 3ABOA 2V5LA 1AW5A 5KZEA 3L2IA 3QW3A 4JX5A 3N9SA 4NUWA 3BV4A 2BX7A 4P61A 1JJKA 4Z0JA 3E9AA 4O28A 4MJMA 4FNTA 5G1TA 4ZQNA 5D2WA 1SU5A 3W6YA 4LS2A 1XDLA 3WJXA 4N6FA 3F4NA 4WQ6A 3ATZA 1FWRA 1PE1A 3P8JA 3FIGA 5F4XA 3B0PA 2OT0A 3GDRA 2QJGA 1VPXA 1EP2A 3W2NA 3TUUA 4WD0A 2V8ZA 3GXNA 3DH7A 2A21A 4Z0SA 2A6NA 4K8EA 1JULA 3UPBA 1WBJA 1YPIA 3W7JA 2V30A 2AAMA 3CQ0A 3GR8A 1OFAA 3FYOA 4FNUA 3RLVA 3L5MA 3PSVA 4BFAA 3GKFA 4M6VA 3CLMA 4BK9A 1JQXA 4JTGA 3LXBA 4UTLA 1GTHA 2TRSA 4MPQA 3IV3A 3I68A 1ME8A 3PB0A 1H50A 3LB0A 2E6FA 2ISSA 2WNNA 4JD4A 1F7BA 3IEBA 2QF7A 4PL1A 4YMZA 3NQAA 1ONRA 5KMYA 2P1FA 1K8XA 4RCXA 4OV9A 4QNEA 1IXPA 3W7HA 1VS1A 2BZNA 2FIQA 3W7CA 4NVTA 3B05A 1H51A 1AG1O 3P81A 1W5PA 3CU2A 2E77A 1DHPA 4K37A 1TPFA 4NQ1A 2OMAA 4GC4A 2Y62A 3G1YA 5CKSA 3G0UA 3C3NA 1TV8A 1H5YA 5G2IA 1AW2A 4UFKA 4OE7A 3OG3A 2NXIA 4JTTA 4Z1DA 5AYZA 5DN1A 2EKCA 2G96A 1OFDA 1JR1A 3N19B 3TQ0A 3DKLA 3BLIA 1DOSA 3UWYA 3QW4B 3QZEA 5LSMA 3KVMA 4OHQA 3PWAA 3W7PA 3EX1A 4JY9A 3USBA 3T40A 4D2JA 3S1VA 5H91A 1OYAA 1L6YA 1SW3A 3O1NA 3IIXA 1HO4A 4NNAA 4DO4A 2YW4A 2TYSA 1BKSA 3NDOA 4GRSA 3TMLA 4DF1A 4XWUA 4LRSA 1SR9A 3EWUA 2RDTA 2VEMA 3NZRA 2NXGA 1YDNA 1HO1A 2ZRZA 1JQVA 4ZVJA 3HGRA 1WAUA 3G18A 5C5YA 3Q2DA 2CZEA 3MWAA 1Q6OA 5I3IA 4O50A 4MZYA 1PCKA 3UNDA 3O8AA 3P5ZA 4U28A 3TSDA 2PRLA 3CB8A 2XN1A 3PBUA 4JX6A 3QSTA 3G0SA 2R94A 2BLEA 1TSIA 1FCBA 3RFAA 5EPDA 1C8VA 3HIJA 2A85A 3MYOA 4JX4A 4JYDA 2W0UA 4XKYB 5K9XA 5F2IA 4ZMGA 4RR4A 5HWJA 4BR1A 4C1KA 2Y89A 1X1OA 3P7YA 3TE9A 3EWBX 2DJLA 3RF9A 3LXCA 3NM3A 3P5YA 4AXKA 4O1AA 4WY0A 1KFLA 3F03K 4O13A 3M5XA 1R2TA 1VLIA 1LP6A 1LBLA 1DKWA 3B0UX 3TH6A 1DJNA 3KRUA 2DP3A 3DFTA 1DORA 5DLCA 3VFLA 2NWRA 4O0ZA 3PG9A 3NPVA 3W1XA 2RDUA 3PF3A 5C54A 5FEPA 1O4UA 4IUOA 1XBYA 1UCWA 1VCVA 2Y6ZA 4KWWA 3A21A 1E51A 3LTYA 4MY9A 4P2VA 4IMCA 3ZR4A 3PBWA 2GJNA 1TV5A 3PS7A 5D30A 4ZZ9A 4QNWA 3C6CA 5CZTA 4XQ6A 5F4SA 4CNOA 2CLIA 3TNOA 3DFSA 5K4XA 3NVTA 4IJBA 4UMBA 2CFFA 2TSYA 5FF3A 5J5RA 1NF7A 2A7PA 4JYEA 4WUIA 1ADOA 3T55A 2E1DA 2QCCA 3S1XA 3D0CA 2CLLA 5HULA 2Y7GA 4DXVA 2ZCGA 3L0KA 1WOBA 1SSDA 3SFKA 1JUEA 3PSWA 3G22A 2PRHA 1H7RA 6ALDA 3MI2A 1F6PA 1JUKA 4PODA 3SIZA 2YXGA 3CHVA 3S5NA 1Z44A 3PR2A 5AHNA 1LRQA 3LTPA 2YCEA 2C3ZA 1PVNA 5HWMA 1R2SA 5FF0A 2EF9A 3GZ3A 2YR1A 2ZRWA 4RV8A 2FFCA 5KSWA 2NV2A 1JCXA 4IMEA 2NX1A 4HN4A 1PHWA 3R5EA 1DBTA 2C18A 3W7MA 1K7FA 3QJAA 4UTUA 3MUXA 2ZA2A 2HTMA 3UXDA 4YCPA 4FIRA 1FWSA 3LHUA 2A4AA 4C1LA 4MY1A 4A2SA 1F2JA 1MEHA 2CU0A 4XTDA 1IXOA 3G1HA 5EY5A 4RKAA 4ICNA 3LXAA 1OX4A 4S2BA 3VI2A 5FEZA 3W85A 4BI6A 2ZA1A 1TPEA 3BPWA 1YXDA 4LVBA 5F1VA 1OFRA 3DFPA 4K8HA 4JY8A 1UASA 4QM1A 4DO6A 2V9DA 3W1NA 4EWND 3CWOX 1LOLA 1ZENA 2WQPA 4UMCA 1KLZA 2NUYA 2YGYA 3HQ1A 3JRKA 4WOZA 3SW6A 3ZWTA 3A9IA 1SO4A 3F1QA 5LKYA 5LGXA 3GXTA 4FXRA 5AYYA 4ZQPA 3LDVA 3W83A 1J2WA 1W1ZA 4JS3A 3GDKA 2JKPA 3M5YA 3P82A 2QR6A 3STFA 2A7NA 2Z6IA 1HL2A 1Q3NA 1RQBA 1P4CA 1QO2A 4KFOA 2A5HA 3MP3A 3P61A 1TPVA 1VYRA 1LRTA 3T4CA 2GQAA 2CLMA 1TJRA 3W7DA 1LZOA 4NXSA 4NJIA 4EVZA 4IMGA 3NL6A 4RLIA 3B4UA 4JTUA 3IGSA 1P5BA 2ZTJA 4LV4A 3RLUA 1FDJA 3N9RA 5EA9A 4JGDA 2QCDB 2VEKA 1IIHA 1M6JA 1G69A 1I2RA 1P1XA 4JTFA 1L6SA 1N55A 1GPWA 3DAQA 4GFSA 4PCFA 5D02A 3QPYA
chains in the Genus database with same CATH superfamily
3FDKA 4QE5A 3LHYA 1PIFA 3GFYA 4JICA 1UG6A 4PBFA 1ZAHA 1YKWA 4AD2A 2VFDA 4JL2A 1IGSA 1I8JA 1QPOA 4CEUC 1OCBA 3L65A 2PPGA 2OX1A 5CH9A 3CMJA 1A49A 3ARPA 3G1VA 2FZNA 4OOZA 3MSDA 3ZFHA 1XYAA 2OGJA 3AIRA 3TZFA 4F40A 3WJYA 4NU7A 4RXGA 1S2TA 2FZ8A 3H2CA 4FX7A 5IFTA 1AQMA 1ZALA 4LSBA 2VX6A 2C8NA 1WBHA 1GK8A 1CENA 4YU1A 2VMFA 3L2MA 5C71A 1XG3A 5E93A 4JQ1A 2CLFA 2FJKA 4IMDA 1V7YA 5C7VA 1JG9A 3VGDA 2X1UA 3IGUA 2ISWA 5T8GA 2WCGA 4HYRA 3W1TA 3WJZA 3GFXA 4S2CA 3MV01 4GZJA 3TC3A 2YB1A 3CL7A 4O4VA 4JHMA 1UD4A 3U2ZA 1ZJHA 4AD1A 1JXKA 3H53A 4I5XA 1KQYA 1BRLB 2NQHA 2ACQA 4R7OA 1IEIA 1X39A 3UZJA 3MP4A 3EYPA 2Z6JA 3T07A 2DVTA 3BG9A 4O1FA 2I16A 3BLFA 4QG8A 3W7KA 1EUNA 2J9XA 4AZGA 3E0LA 3I65A 4CD4A 5AC6A 1CXHA 1TB3A 5CSRA 3KX6A 1IZCA 3PVFA 4ERIA 2YL9A 3QOMA 1GW9A 3EDDA 3W7QA 1QPNA 2HWGA 4C60A 4XSMA 2PWUA 5BMWA 2VC9A 5EYWA 2IXUA 3EWCA 3B8TA 1K3UA 2GUYA 4GIYA 3HQPA 3IVSA 1UKQA 3N2MA 1FUYA 1BVWA 1W6TA 4ZQRA 3BH4A 4PTXA 4LYKA 2ZUWA 1WKYA 1YPFA 3SSJA 1VZWA 4ACZB 2RFGA 3AFBA 2G4FA 1AFSA 3E5BA 4GACA 1UR3M 5AC7A 4DQWA 2W4XA 1DIEA 3PFRA 4E2DA 1NDWA 1KBIA 4FXFA 1OADA 4K2SA 4PN2A 2J7FA 4NZFA 1TTIA 3ZT7A 1MXDA 1LBFA 3C8NA 1XC6A 4HK5A 3S5SA 3GG1A 2VRQA 4GABA 5DXXA 1SFJA 3ID7A 3UGVA 3DFHA 1IV8A 4FOKA 3OYZA 1J6OA 1XD1A 4M0XA 4ICCX 4HU8A 2OXNA 1XSIA 5B80A 2B81A 4GX8A 5H8PA 1XUZA 3VNYA 3VD3A 1J12A 1QW9A 1NFBA 3RJYA 3WNKA 4XZLX 4BF9A 1XG4A 3MT1A 1D3CA 4QS6A 1FBAA 4JIEA 5A2AA 2BXZA 3OTRA 5BXTA 3WH8A 1NWSA 3WLOA 3GWQA 3ORWA 4EPEC 2A0NA 3PK7A 4AW7A 3HG2A 2PCQA 3VIKA 4RK8A 5EFFA 1WZKA 1PV8A 5A8MA 2PDKA 1Q45A 1S5MA 4FNQA 4PMYA 1UW9A 3WK1A 3FVDA 3ZM8A 2H8XA 2BB0A 2XWDA 1RQHA 3VC5A 1PZ3A 3TXVA 2VVSA 3WN6A 2QAPA 1TZZA 4JN6A 4BS0A 1G6CA 4J3XA 1S2VA 5I3JA 1QHPA 4U3CA 4LQ1A 3SGZA 2DT3A 4BWLC 3VD4A 1MO0A 4W8AA 3CQIA 1OM0A 2GK1A 1U5HA 1VCFA 3FY1A 1TPDA 1UP0A 3EB4A 4RX0A 1YW1A 2V82A 4HVXA 4NRSA 4QIUA 3NXFA 3CV7A 3OJGA 1YXCA 2OEMA 3URBA 3AJXA 1H61A 3W71A 1FP8A 3WQ8A 1DJYA 3WQ5A 4K68A 5IXEA 3U9IA 5LA1A 4GBUA 4OTKA 3WLJA 1HKJA 1K9EA 1EEXA 1IWAA 1AJ0A 1GT8A 4XO7A 3SCQA 1UC4A 3ANVA 2DSKA 4BF7A 3OBEA 4WVXA 1KWKA 5PTDA 1WDRA 4QDPA 4HNOA 4I6KA 1IQ8A 1D7KA 3EOSA 2C13A 5EL1A 3FHQA 2QEZA 1G9HA 3G6LA 3CO4A 3SM0A 4AIEA 4XIAA 3W2UA 1BVZA 4H9MA 4I7VA 1ZB5A 2ZE3A 3DZ1A 2F38A 2NZLA 4XTIA 4Q8QA 2VL4A 3A3WA 3BOLA 4HNNA 2DORA 4JIQA 4J3WA 5GQBA 4U5KA 2PUZA 3G6MA 4AZHA 1TG7A 1EL3A 1V3MA 4LOCA 3OQEA 4ZE4A 1HX0A 3B9NA 1OK4A 4HOZA 5JVLA 1GVQA 1CXIA 1KBBA 2E9MA 4W7VA 1W2PA 2PBGA 2PGWA 1IIGA 2Q01A 1EDQA 2I1OA 1Y0EA 3MTWA 3WLPA 4C90A 7TIMA 3T2PA 2G95A 3W2LA 4GH3A 2VZTA 3IJDA 4OBTA 4IFRA 3TJXA 2PDXA 3PJUA 1CGXA 3TYCA 4U33A 1XH1A 3GE7A 1E3XA 4RL3A 1KNWA 1PL9A 2EBNA 1UD2A 2WSQA 4JQAA 5TF0A 3UJEA 2DJXA 4OIFA 4X9YA 2X1RA 1Q4NX 4UQ9A 4WX2A 1W37A 3T8LA 3KS6A 4HYVA 5LNSA 2QF8A 3B06A 1M5WA 5CJ5A 4PUUA 1R46A 1G4TA 3UVIA 4R3UA 5FJTA 3L0GA 2ZDRA 4J27A 4L65A 2VC7A 4H9YA 4UQDA 1A47A 4WDUA 1PUDA 4O19A 3L4YA 2VDGA 4NZJA 2JF7A 3H4XA 5IHRA 4CD6A 2HVMA 3IIZA 3Q67A 3LOTA 3KWSA 3QF0A 4DAFA 1IXQA 1BYDA 5E0CA 1R3RA 2O4MA 4O18A 2WKJA 3PG8A 2VEIA 4CN1A 1DJXA 4GIAA 1MSSA 1UP3A 1I2OA 2VOTA 4A8LA 4F0MA 2ZZ1A 1VBUA 3C2FA 3W01A 4MB5A 1NJJA 2VZSA 2Z4GA 3NL3A 2QGHA 1EJ7L 4MOZA 4IQEA 3WBXA 3GG7A 5I79A 1A5MC 5A6TC 3IK4A 1B3ZA 4K38A 5BRQA 1H60A 1TKKA 3FOKA 4HNVA 4X9SA 2FB2A 2ZVRA 2A2IA 4KEUA 1V3LA 3P80A 4P8VA 2VD9A 2X2GA 5H1WA 2VGFA 2YCLA 2DV0A 3OYXA 1AD4A 3W2JA 2J75A 1QNQA 3R1ZA 2OJPA 1TJ2A 3T4WA 1UPMB 3HO8A 1WCGA 4O8RA 3MSGA 1JDCA 3O07A 4S3EA 1J18A 4ORMA 1H1NA 1UWTA 5KZ6A 4AWSA 4R7JA 1VBJA 1ZBWA 1P0EA 1HP5A 5M17A 3I6TA 3UFYA 4FX6M 1W5QA 3O15A 2YL6A 4LC6A 1E6ZA 1SZFA 2IW0A 4DB7A 1TELA 1X1ZA 5CC7A 1W9UA 4M80A 3AYSA 1C91A 4AG0A 3WNLA 4I3GA 4D6GA 4DXKA 1ZU8A 2V38A 3GC5A 1NQ6A 2JEPA 4WSHA 1XIEA 5U4NA 3EMCA 1JDAA 2VUYA 2J9YA 3QY6A 2DZBA 1SYTA 1EJWC 2Y7FA 1TWIA 1SGJA 4UTHA 1U1JA 3UCDA 4F0KA 4B4FA 2RHGA 2Z1BA 1FA2A 3PHAA 4GNKB 4X0NA 4AIBA 4K7VA 2GOKA 4A3QA 1CXFA 5I78A 1CT5A 3T0TA 2PWDA 3ABRA 5CJNA 3H2OA 2F84A 3S8HA 1C8QA 1O5XA 1LLOA 4XKYA 3RCYA 1R9YA 1KBJA 4V1YA 3GUGA 3TCSA 5IBXC 3I3DA 1W8SA 3RU6A 3C2EA 3GTNA 3UYIA 4GWEA 5FOOA 3AWOA 2D2OA 2H8ZA 1XGDA 3FAWA 4MAVA 1XUUA 2R1LA 1YDVA 3DC0A 4C6BA 2XWEA 3R8HA 1K9FA 1UD5A 1GONA 1VYPX 5IFPA 3U0HA 4WY0B 3QLDA 1GOKA 4MB1A 4XB3A 5HPCA 3QSRA 5JH2A 3LZ3A 4GVHA 5I3HA 2VFEA 5BMXA 2VENA 1W5OA 3F7JA 3HN3A 1GCYA 4RDVA 2DSVA 2R6OA 2FMNA 2C16A 3BE7A 2BOEX 1TPUA 2VR5A 1L6FA 4EOUA 2W61A 2OPJA 4AWTA 1QCWA 3VNLA 3DYMA 4X60A 4Y6GA 5E6ZA 1ZTVA 4F9JA 3KBVA 4H2CA 4WCJA 1BWLA 2HSAA 3LMYA 3ZS4A 2J7GA 4IF2A 4JHOA 1H62A 3KUMA 4B92A 1SSGA 5DELA 3N2XA 4V1XA 1H7PA 4H8VA 2DZSA 1UWRA 3POHA 1PHQA 1QOPA 5HMSA 4LAKA 3B8IA 4GO9A 3T8QA 1V6WA 4JOMA 2NVAA 5EB8A 4IQJA 4KCUA 3U5UA 1XLDA 4NILA 3N2BA 2VTFA 4GI6A 3BSHA 4EAMA 2Y5JA 4HZ6A 4WKHA 3CS2A 3THQA 2AMXA 3N6HA 4FZIA 3LI0A 1SO6A 4PMQA 2BOFX 3QGKC 3AAMA 3W70A 4K6AA 1JI2A 1QO5A 3TFCA 3H2MA 1K7XA 4F2UA 1XH2A 1GKPA 4C65A 7REQA 1X6LA 2XZ7A 3MZ2A 4EP8C 4F0SA 5I0DA 3WUBA 3UYCA 2B7PA 3W7IA 2DUAA 4WDXA 1VGAA 1L2QA 3K2GA 4M6QA 4EXBA 1E6PA 1KCZA 3N2CA 3KOZA 3AO0A 3CUHA 1AQ0A 1FHUA 2WSKA 4FPSA 1J0KA 1J5SA 5C8BB 3VOCA 4HKPA 4M1BA 2V0TA 1HQTA 1JCNA 1TTJA 4L6HA 4DO5A 1W9XA 1KC7A 1NP0A 1JYXA 1ALDA 3VGGA 4MLJA 3MBFA 1JFHA 1W3LA 5EMJA 3CHFA 3NR0A 2DZUA 1L8NA 3SCNA 2Z1KA 1DHKA 1QBBA 3F5LA 2ZDSA 1XX1A 5HQLA 3FJ4A 3O63A 2GLKA 4KF1A 3QGVA 3M0JA 1WV2A 5LNRA 4AFYA 1LG2A 4M6PA 3FYYA 2Y5SA 2VT0A 5TAOA 4AYGA 3VKCA 1K4GA 1H41A 3THUA 4CNTA 3AI0A 1W9PA 2XIJA 3AYVA 4PC8A 3P84A 3PB2A 4E3VA 1AW1A 1E3ZA 2V5KA 3H7UA 3L23A 3IVUA 1GJWA 1SW7A 3WEOA 3TTYA 3EA2A 3EBVA 2RDWA 4MVAA 4DI8A 1DTUA 2ZZ7A 4LC8A 3PBMA 3MUZ1 1IT7A 1WYIA 5LZLA 4H41A 1SVDA 4N7QA 2KZHA 4W85A 1U1UA 2EHHA 2TPSA 1TX0A 3TYAA 1ISVA 3CK5A 4IGSA 4AZ5A 4L4LA 3B9DA 3IAQA 3VDAA 4GMEA 4FR1A 4X61A 4GG9A 1E70M 4IG2A 1S2WA 4A8RA 1HP4A 3OGSA 4L9XA 4MDPA 5AC4A 4XBSA 1NIUA 2ZA3A 4NJJA 4LNCA 3UBPC 4F4RA 4DI9A 3NQ2A 3AHTA 2E3ZA 5HNNA 4GGHA 3W00A 2MNRA 3U2EA 3I7QA 3AOFA 3EOUA 3EDKA 4DWSD 2YIHA 3DESA 3MUY1 1M03A 2OT1A 1GG1A 5F2GA 2E5DA 4QDMA 5C55A 3UW6A 4A3YA 5HPOA 3NQ7A 4GUGA 1VHCA 1H3GA 2YDQA 2J13A 5A6AA 2XFFA 3BANA 4GZ7A 4C6NA 2QJJA 4BF5A 2CC0A 3V18A 2XVLA 3SUSA 1I6NA 2O9PA 2VDIA 3S47A 3CL8A 2OR2A 3N29A 4P7RA 1EIXA 4O10A 1C8YA 3B04A 5B7ZA 1CI1A 4CGTA 1OJXA 4CQ9A 3AXMA 3M0YA 5CBJA 4CN4A 4E2BA 4D9PA 1HG3A 4UFHA 4IX2A 1R2RA 3C52A 3LBOA 3NYZA 4C6FA 2PC4A 3KBJA 4Y8FA 9XIMA 1SM9A 4Q6XA 2ACSA 3GK0A 3R6IA 4DJED 1S2UA 2X1TA 1TQXA 3BAYA 3T1GA 2J9ZA 3ZYZA 3GHTA 3DU0A 3RM4A 5LA2A 4GK8A 3RITA 4DZ5A 4KFNA 3K4WA 4JTJA 3O6AA 4HOWA 3VNKA 5TQLA 1QWGA 1MDLA 5DF0A 5C2GA 1CB7B 2PD9A 5REQA 1KXTA 3WSUA 2G97A 1NF0A 3AS3A 3CHCA 4WOQA 4GXMA 4PCNA 2ATSA 4I9AA 3HPZA 1KFEA 5D32A 1EA0A 3GTXA 2ZX7A 3F4VA 1HL9A 2X0SA 3S5OA 1QW7A 2GGGA 2LLEA 3DG3A 4KCWA 2E25A 1B3VA 3LPOA 3UJ2A 2D69A 2I56A 3LU2A 5F2LA 4R34A 1XP3A 3A9BA 2J74A 4HBKA 2IQ0A 2ZZ4A 3RO8A 2F6UA 1W56A 4OVXA 1EHAA 1GYNA 4BHYA 1O68A 3VILA 2CERA 1H49A 1KBKA 1MFUA 3EX4A 1XCXA 1Q7QA 3W87A 1R3TA 1YBQA 5CXPA 1EGZA 3NQDA 1XRSA 4PB4A 1B54A 1R47A 1KM1A 3N2OA 1W32A 2YCIX 1GVRA 1S1PA 2AQOA 4MWAA 1O5KA 1Y5VA 3UD6A 2XIQA 4WJ8A 4AAJA 1Z8AA 5AZ1A 1SO5A 1V51A 4UUIA 1OVDA 4X22A 2OB3A 3ZIZA 3L7RA 5ABHA 3NPWA 3H12A 3NPXA 4U5IA 4GIRA 2IUZA 4A8NA 5IM51 2HK0A 3LHTA 2CCRA 3FKRA 3WLTA 3L12A 4IJCA 1CX9A 3SFWA 5BCAA 5F4WA 1RCXB 4RZBA 3TAOA 5K2ZA 5KZDA 1ICSA 3GQYA 3S2MA 2UBPC 4JNYA 1UPPA 4H83A 3TR2A 4D1JA 3M0IA 3R25A 3IJ9A 2W66A 3C8FA 3CAWA 5H8UA 3C86A 3EXSA 4A3RA 3HGOA 1UR9A 3TYZA 4H7VA 1E5JA 5AY7A 1PIGA 3SUWA 3KL3A 4CCDA 2W63A 4IIGA 1FDZA 4B3KA 1PXGA 3RMEA 3FS2A 2L5HA 3RX4A 4H9ZA 1LL6A 2JBMA 5D33A 3T0CA 1R3SA 3MMTA 3WQGA 3UG5A 1NWRA 4DJDA 3JS3A 1T7LA 4G7EB 1GWJA 4NZ1A 1J4EA 3HPFA 4POCA 5E0FA 2C19A 4Q3MA 2O4QA 4QJ4B 1GVFA 4AY8A 4BI5A 1OZMA 3OVPA 2VJXA 4RV3A 3W37A 2ISDA 4N9DA 3AYRA 4HNCA 1DL3A 3ZJKA 2GOUA 1H7NA 2JFEX 1E6QM 4IIHA 4E38A 4U31A 4IXHA 4L4OA 1KQZA 3OEXA 3H2AA 3D46A 5I09A 3BJSA 1S5VA 2VO5A 3SRHA 3OVRA 3QVQA 5D04C 3CUFA 1PX8A 5I23A 4FIQA 5IDIA 4EPDC 4HPJA 3BG3A 1PS9A 4GY0A 2R24A 3VKBA 1LQ2A 4C1NB 3IGXA 4UOQA 5XIMA 2O7QA 3WYZA 4HHPA 4MYAA 3EOEA 1PPIA 2DSZA 1US2A 1QAPA 1TRIA 1G4EA 3VGBA 2I9UA 4OFCA 2CZFA 3ICJA 1BTCA 4PTMA 3ZT5A 3GAYA 1UH4A 1KRAC 3AQUA 2P53A 2BFGA 4CUCA 3O0FA 1F3XA 1GOMA 3I6EA 3I7SA 4DPQA 4Y9MA 2ZZ5A 3C2RA 3NZ1A 3M0ZA 3V35A 2PRMA 2O7SA 2I17A 1A5KC 5HUOA 2V5LA 3UT0A 3MKCA 2WBGA 1HKIA 2WLYA 3PZQA 1REQB 2ACUA 1CLKA 3E9AA 4MJMA 5C9ZA 5D8WA 4E5TA 2NQ5A 4LCRA 4Z2IA 1Q65A 2EPMX 4LS2A 5CGMA 4ZOCA 3RR1A 3SBFA 1VIZA 2PP1A 3B0PA 3WL0A 3GDRA 2YDRA 1CYGA 3O2LA 3TUUA 3DH7A 2EKGA 2QV4A 4B2DD 3JVAA 1US0A 1YPIA 3H2NA 2AAMA 1H4PA 4GVGA 3GR8A 3TOPA 2AL2B 3QR3A 3A3XA 4PMRA 4BFAA 2ZOXA 4M6VA 3CLMA 5DRIA 3ENLA 2X41A 2BGSA 3SUVA 2WVVB 3I68A 2REQB 4NP7A 3LB0A 2E6FA 2ZUTA 4JD4A 4LEFA 2J79A 4PL1A 4LANA 2BY3A 3NQAA 5HAOA 1ZS2A 3CUJA 2P1FA 2D22A 4UQEA 3W7HA 2BZNA 3IAPA 4B15A 1H51A 4Q8OA 4I5UA 4ROPA 5HATA 3CU2A 1B3YA 2E77A 1DHPA 2HQAA 2QVNA 2OMAA 2Y62A 1MWOA 3G1YA 3GVVA 3K5XA 3V0UA 3ES7A 3B3DA 3PZVA 1AW2A 1XIMA 1MXGA 3OG3A 2NXIA 5DN1A 3WDRA 2EKCA 4M6UA 3RM8A 2YBTA 1OFDA 1JR1A 2HDJA 5C70A 4WHBA 1DOSA 3FEQA 1PO9A 3OOQA 5LSMA 3KVMA 4QXIA 4XK2A 4AEEA 3EX1A 1V3JA 4FS9A 3USBA 3PBGA 1OYAA 1OC7A 4MDOA 4PBEA 1OINA 4MUPA 4DF1A 4XWUA 3WLQA 1FH9A 4GC3A 1HKVA 2IKGA 2E8ZA 2ZUVA 3HGRA 1WAUA 4ZOEA 2H9AB 3ZSSA 3V16A 2NLYA 4C6KA 9CGTA 2D2GA 4O50A 3IJQA 1Q5MA 2E67A 3P0WA 4U28A 1BSLA 3I4KA 3TSDA 2PRLA 3QHOA 5BOEA 4XZWA 2X2YA 4JTQA 1AQHA 3RFAA 2HXTA 1WAWA 3GO2A 4HCHA 3SB0A 2VGGA 5EPDA 3ZR6A 1C8VA 3HIJA 1EC8A 2ZUUA 3E3HA 5HNTA 1T41A 5F2IA 1WDQA 4ZMGA 4RR4A 3IARA 3VZXA 2Y89A 2V69A 4YHEA 3NOYA 4ZOAA 3F03K 4O13A 3M5XA 1F4HA 3RIKA 2OYMA 2PTWA 3NZGA 1LP6A 4US5D 1LBLA 1DKWA 3B0UX 5FJJA 3TH6A 3AZSA 5DLCA 3VFLA 4AEFA 3PG9A 3NPVA 3VX0A 1R85A 3VZZA 4GKLA 3W02A 2GSHA 3ZO9A 3N6JA 4LAOA 1E51A 5LYRA 3PJXA 4PTWA 4J3TA 4AZ7A 5FJUA 2QUMA 1TV5A 1IR2A 4XQ6A 4FP1A 2XVPA 3DFSA 3NVTA 2PDLA 4HB7A 3V5FA 4UMBA 4P5UA 2TSYA 3RO6A 3UP8A 3DIPA 2DPEA 2A7PA 4H9VA 3S1XA 3D0CA 2BBFA 5ABFB 4F0HA 2NVDA 1HKKA 1X97A 7ENLA 4P7QA 3WH9A 1KCXA 2CWXA 1DJZA 4ZO8A 2WZEA 1WOBA 2PGEA 4Q7NA 3NZPA 1GHSA 1H7RA 2DT0A 3RILA 4JKKA 3WLSA 4PODA 3CHVA 5AHNA 1JZ3A 1LRQA 2C3ZA 1X96A 1PVNA 2ZX5A 1R2SA 2F9RA 2EF9A 4XAPA 3UCCA 3ZJ8A 5FF0A 2VZUA 4HA0A 3TYBA 5D9PA 5KSWA 2NV2A 2XSXA 5C9WA 3FDGA 2VYOA 3M0HA 4MB4A 3PTKA 2G50A 3MUXA 2J66A 4HMEA 4YCPA 1KD0A 4FIRA 3ZVHA 3FJNA 1Q6FA 3LHUA 4MY1A 1MEHA 3S3GA 1R0MA 4QS5A 4O1EA 1MQPA 4R7WA 4ICNA 1OX4A 1GQIA 3B0YA 3RCNA 1S2AA 1IGWA 5F1VA 1T40A 4XZMX 2V9DA 4YVXA 1E73M 3W1NA 1LOLA 4NAFA 2D0HA 3GXIA 1FOBA 4UMCA 2QMKA 1KLZA 4WOZA 2Q8XA 3ZWTA 1QI2A 1M68A 3TN3A 4WKFA 2ZC8A 3CPGA 1PYFA 5AYYA 3DHUA 2JIWA 4H9TA 2PDWA 3M5YA 3T9PA 4IIEA 3STFA 4UQBA 2Z1XA 4C6QA 3MQTA 1P4CA 1W1VA 1VYRA 1LRTA 3T4CA 3W7DA 1LZOA 4JTUA 1EKOA 1FWIC 1ONWA 2QCDB 4DY1A 4ZB2A 1G69A 1P1XA 4H8NA 3SN1A 5A2BA 4XD3A 3LENA 4WGXA 1GPWA 5E70A 4GFSA 2OZ8A 4QJ5B 5D02A 3QPYA 1W1IE 3G2GA 4MPKA 3MYPA 2EG7A 1AD1A 3ES8A 4RNJA 2VR2A 3VGEA 2C91A 3NPUA 1AQFA 1ZHAA 1X38A 2DQWA 3QMSA 3EAUA 2QDEA 1Z89A 4Q8UA 4QCFA 1VJZA 3DENA 1BF2A 3AJ7A 4DEFA 1LL4A 4R53A 1Z42A 4IL0A 2WCAA 2YA1A 1ISYA 1N82A 1W1YA 1WPCA 1GOXA 4WSJA 1P0NA 1VPQA 2Z26A 4PB3A 1R7OA 1V7AA 2YDAA 3UJSA 4V2XA 2RJHA 1XR2A 1QUMA 2PGFA 1MVYA 5G5IA 3LHWA 1FHVA 3HV8A 2ZTKA 4LVAA 3BMVA 1M01A 3OIXA 4E8DA 3VOHA 3DX5A 3U48A 1WA3A 1VCGA 2GJLA 4JTCA 3WF4A 1BQGA 3W75A 2E68A 5C9XA 3BCDA 4Z2LA 2OVLA 2DIJA 3M0VA 4F66A 3WMLA 1K1DA 3LPFA 3W7RA 3TU9A 3EDFA 4HMCA 1B3WA 1SZNA 2CESA 3LQLA 5CCZA 3V1HA 4UZUA 1B0IA 2PDHA 2ALRA 4MFEA 4TU1A 4CNNA 1KB3A 1O6IA 3SECA 3DECA 1DWJM 1ZAIA 1F74A 1KKRA 1LRNA 2ZQ0A 1LQAA 3HB9A 1RZMA 4DWSB 3BSGA 2H3DA 3A22A 4UIOA 4MKVA 2AGKA 2QMJA 1KGUA 1XYBA 1E9YB 3WELA 1UUMA 3OB8A 1ICPA 3BZGA 2ZZ3A 1GVYA 3EX2A 1VC4A 3AYTA 1ODUA 4GJIA 3RHGA 1QPKA 3KL0A 3WG6A 1OF6A 3ITCA 1TPWA 4Y9PA 1AH3A 2GGHA 5AVHA 1XISA 2GVYA 2E09A 3NAVA 3C3UA 3P60A 1V02E 1FFQA 3O6DA 1XSKA 2E6AA 5CJMA 4JR5A 1BEUA 5AC8A 4QGCA 3CWNA 4CQDA 1S3HA 1R3QA 4UNLA 2H90A 3TFXA 1NWTA 3W07A 1H5VA 4MY8A 3TKFA 4NJGA 2J7CA 3IJ6A 2OYLA 2Y2WA 1RA5A 1KFBA 5TNVA 1DXEA 2V5CA 1AMYA 4QLLA 3VUSA 2RAGA 3B9EA 2D20A 3WMBA 1K8ZA 2DUXA 3SCUA 2NT1A 4DYKA 3NO3A 3TQPA 3HG4A 1R9ZA 4ZFMA 3ZJ6A 1ME9A 2HS6A 4ZQOA 3PZNA 1QPRA 2P3ZA 4NSBA 2XIIA 3BJTA 3W76A 4DWDA 1FHLA 3CUZA 3P67A 5KZMA 1JUBA 2ICSA 3TAKA 1Q85A 2XIOA 1VBGA 3LX9A 4ML4A 2OU4A 3QXBA 1CECA 2CLEA 3LM7A 3TJLA 4LNYA 3VIJA 1DYSA 1XYCA 2I7GA 4GI8A 3LSCA 2V2CA 1UZ1A 1KRBC 2BY1A 3PTDA 3QHMA 1FY6A 4UR8A 4H4IA 3GBEA 1TWSA 2X42A 2HE5A 2X05A 3WH6A 3LI1A 4V27A 1VFHA 3N04A 4KFPA 3EDJA 3VDCA 1B3OA 2EPLX 4DPPA 2GQ9A 5GPRA 3REQB 3NCOA 2A6LA 2ONEA 4S39A 1YIXA 2VX5A 3W1MA 5A94A 2OWXA 3CH9A 3ECQA 2BODX 2WMJA 4LAMA 2CLKA 1ZBCA 1RP9A 1RV8A 5DX7A 1NAL1 2I9EA 1K03A 3DGRA 5MKGB 1Q6QA 3DG7A 4Z42C 5A8QA 1JNEA 5LNVA 1RJQA 5AN7A 4DZIA 4JFVA 1VHNA 3W73A 1ME7A 3NZQA 3LCHA 5FSDC 2YOCA 5BWFA 3QZ6A 5F2MA 3B4YA 3W3OA 3UWEA 1PJ9A 1PIIA 4O4WA 1QJWA 3VGHA 3FSTA 2GZXA 4IIDA 2ON3A 3IUHA 3HMJG 1CW2A 3KBMA 1TE6A 4TXEA 4PUKA 3MP5A 1CLXA 2BGNE 3RR4A 4JDBA 5BZAA 5I2UA 4KBXA 5DT7A 1OX5A 2ZX8A 2P88A 4LT9A 2IQTA 3APGA 5HDRA 1A5AA 1RBLA 3K13A 3R8GA 2WQDA 2XGIA 3VFCA 2JIEA 1NEYA 3W7OA 5C2CA 1TMHA 2HISA 4JIIX 4IOTA 1G4PA 2WMIB 4ALDA 3PZIA 4J3UA 5AOUA 3L5LA 4YPJA 3FGCA 4ZQMA 1EX1A 1XXXA 3SCSA 3BURA 5BOFA 3CLWA 4IPPA 4Y7EA 3CIWA 4UTMA 3GNOA 1ZAJA 2YZ5A 3E96A 1UD8A 4LUIA 4GH1A 2YKKA 3T0AA 3VNDA 4QJ3B 5XINA 1GQNA 3AHZA 3M46A 5M1TA 5BRPA 3OHMB 1T0OA 4OBRA 3DFNA 4JIHA 4XUGA 1BG4A 3CAVA 1CNVA 2IQDA 3DDMA 2DZPA 1E4IA 5HUPA 3FVMA 3W1LA 1NFPA 2WKGA 3K1GA 4AH7A 4TIMA 1Q6EA 3UY7A 2OG9A 3PUDA 1E71M 1DP0A 1HJQA 2UY5A 3VE7A 3AIUA 1FXQA 4HMNA 1NARA 5A5WA 3TYUA 3GDTA 2PDIA 1M7OA 1UMYA 4O15A 1NH6A 1JFXA 3MW7A 2DFAA 2V68A 1IZKA 3M7WA 1B2YA 4AU0A 3H4GA 3MC5A 1M7PA 1O1HA 1XLJA 3TSBA 1FCUA 4GY1A 3UJFA 5G4EA 4CCZA 3H4WA 3MKVA 3TC7A 3HPXA 4AD4A 4PL2A 5J04A 3UZZA 1GG0A 5AHLA 4NZ3A 2OZ0A 4E0CA 3QQ0A 3ARSA 1W1PA 4MAZA 1D2KA 3W82A 1TWDA 1P0KA 3M0MA 3BW2A 4MB3A 4W7WA 3UR8A 1A0CA 3QOKA 4GX9A 2HXUA 4YNGA 4MLRA 1DPMA 3MPGA 1WE5A 1UKPA 3N18A 3KVLA 4S38A 1YPXA 1XINA 1CGWA 3MHGA 4DF2A 1TPB1 5DCEA 5I00A 4Z1BA 2PDGA 8XIAA 1LDCA 2ABBA 1A5CA 2P5NA 1JRBA 4JIPA 1TUFA 3DXIA 2XGZA 3TN6A 5DMMA 4UTIA 1FWAC 4GI9A 3H7VA 1PX3A 1EJVC 3FYPA 3FLUA 3RAOA 1TFVA 1V0NA 1DJQA 2EJ1A 1FVPA 1SR0A 1SZEA 1E6XM 4GXPA 4NXKA 4FLOA 3WNPA 3QMTA 1XQKA 4W84A 1UUOA 2PP3A 2UY3A 2XIMA 5LA0A 4JCMA 2X1IA 5AKQA 5CBBA 1BYBA 4JTSA 4FNPA 4NZ5A 7PTDA 2PF0A 2W27A 2RKXA 3M64A 3QPZA 4ZO9A 5CGTA 5CSYA 3G1SA 5HJLA 9XIAA 4WKAA 4JN7A 1SJAA 3PZOA 3LN3A 1CWYA 4KESA 1T8XA 1AVAA 1Y65A 1VKFA 3W0KA 1OFEA 4IIBA 1UH3A 3S6DA 2VEFA 2ZRXA 1QOXA 2XU2A 1XCFA 2AQWA 4Y8EA 2C14A 2VQTA 2PAJA 4RDWA 3W84A 5K4ZA 1A3HA 1EDTA 3EEGA 4JTIA 4ATWA 1XFBA 4M5PA 4Q8NA 2FH8A 2J24A 1B4EA 3AIEA 4AZ6A 5G4HC 2XSBA 3FKKA 1I2NA 1K77A 4CEXC 4CQAA 3E38A 4YTSA 3KZPA 3QQ1A 4ERGA 2YBVA 3A4AA 1B3XA 2Y7DA 3CEPA 3WDQA 1JZ5A 4PE8A 3DKJA 4C6OA 1FWEC 3OZPA 5DQPA 3D3FA 2F2KA 4YYCA 1FP9A 1P1MA 4Q32A 4WDWA 4M7SA 4FI4A 1HJXA 5HNUA 4WSKA 2QLYA 1R3VA 3VD9A 1KFCA 4Z2GA 5I07A 3PY2A 1T6MA 4O54A 4CNUA 1L9WA 1E0XA 4LVGA 1GVEA 5G2HA 5LHEA 3GNNA 1EX5A 3TEVA 1OD0A 5BROA 2WMFA 2BOGX 4BQ4A 1RH9A 3A12A 4R85A 4KS0A 3VU2A 3LV5A 2INZA 3GDBA 3R0KA 2ZUMA 4FF5A 3WJSA 1GQLA 1LG1A 2YX0A 1V0MA 2PWFA 3HPSA 4RE0A 5CPQA 1TPC1 2DZAA 4F2TA 2NX3A 4EF9A 2AKZA 5C9UA 1VH7A 5FAGA 1JF6A 5FI8A 4EXQA 3TDFA 3EOLA 4B5NA 2Z2UA 4MZ1A 4PRWA 3E49A 2YA0A 4IPJA 1ZRQA 3NQEA 4WDTA 1FFRA 3BAKA 2V2DA 3S2NA 3MMUA 4C7FA 1A5NC 4BZYA 3AS1A 1T99A 3H2EA 4AVFA 4N4QA 4YVPA 3OLDA 1HN1A 4TMCA 2PDJA 5I03A 2IPGA 4YTTA 2WNQA 1RY8A 1FTXA 4EPKA 4AXNA 5FEXA 3MUAA 4ZENA 4DLFA 5KETA 4ZQCA 3WFAA 2CYGA 3B8VA 4PSRA 4W9TA 3ZWSA 1HL8A 3C61A 3G24A 2G3NA 3T7VA 3NURA 4GPNA 1GGOA 1OY0A 1CXLA 1LBMA 1TUXA 1H1YA 1RD5A 4J28A 3C0LA 4IP7A 1V08A 3YPIA 2X0HA 1ZJIA 3T0BA 3VOJA 3QFEA 3C2OA 1HTIA 1YLVA 4GY7A 3DBPA 2VFIA 2VOMA 4DZHA 5FJOA 1S46A 3MBDA 1Z69A 3NQBA 1E72M 2POTA 3KRBA 4GLEA 1EJXC 1TCMA 3HV9A 1MZHA 1NFGA 2C1IA 3G5EA 3EWXA 1AL8A 4REQB 1X7FA 3R10A 1F3TA 2PDCA 1BYAA 5A69A 1RPXA 2WMKA 3BAJA 3ZSTA 1H7WA 1UWQA 1ITUA 4F48A 4E4FA 5DRCA 4AB4A 7XIMA 4IICA 1ZY9A 5I7GA 3A64A 2R1KA 3EKLA 4KMQA 2QQ6A 4RUBA 3GDMA 3SADA 1GYLA 2O56A 4L64A 1DIKA 4U10A 4A2RA 3E6EA 3BL3A 4AWUA 1S5TA 2HNEA 3TONA 4HNUA 2R8WA 1GORA 5HMEA 3TWAA 1PZ2A 3PZ9A 3WDPP 1UP2A 3B0XA 2BXYA 3VAVA 3L67A 3WNMA 4F2BA 5H6HA 5BXRA 2VGIA 4XBKA 3H22A 2X1SA 3LSBA 1FH8A 2YSWA 4Y9OA 4Q4PA 4A35A 4M51A 2P0OA 3N9KA 1SJCA 3QY7A 1EHNA 1UQZA 1C90A 4P8UA 1RQEA 1R6WA 1EF2A 2GGJA 3NQMA 1W5MA 4S3FA 5T9BG 2VKZG 4FK9A 3ARUA 4QAIA 2FPVA 4G2DA 2DY3A 3CYJA 1KCLA 3EXTA 4INFA 1EOKA 5CAHA 3LRLA 4LF2A 3R7MA 5E0KA 5A8PA 3OQ8A 4YVVA 3WBWA 2PWHA 3UWVA 3UZWA 1BVNP 3D5HA 1W3TA 2H3BA 4GQ0A 1RR2A 4QROA 3SRDA 3KXQA 2GQ8A 3GG8A 3NL5A 2H6RA 4O8AA 1LL7A 1Y7VA 2GWGA 4L61A 6TIMA 2QDGA 2QAFA 3FX4A 1BRLA 4HCDA 1N7KA 1U5JA 2C79A 1M1BA 3CV1A 4YXGA 3F5JA 3PUEA 1DV7A 3VM7A 3D47A 4OUIA 1JCMP 3SGUA 2FHBA 5F7UA 1OK6A 4DAIA 3G8EA 1E9IA 1FCQA 1MZRA 1UIPA 4OQVA 3WMCA 4GO8A 3TYDA 1OIFA 3LCGA 5GJMA 2FGLA 2B7NA 1RVGA 2DT1A 3CMFA 4ILSA 3NDYA 4GE8A 1U33A 3PAJA 2VM8A 1VLWA 1KKOA 4J1OA 1FX6A 4ADTA 1UD6A 1F76A 1ECEA 4IQLA 2CKRA 3IGHX 4EF8A 5KTLA 1FRBA 4GZEA 2PTYA 1LWIA 3OVGA 2NWSA 3BO9A 4XVEA 3LCFA 3BK0A 3QBUA 1J0ZA 4K7YA 2QIIA 2OOGA 4HIBA 3TK7A 4BEQA 4O14A 4ACZA 1F6YA 3LLFA 2HMCA 3CEUA 3MHFA 4UCGA 4E6MA 2XH4A 3F4WA 4Y9AA 2QPXA 1ZGDA 3DI0A 5AHIA 4MWAC 4QG6A 4LU0A 5AHEA 4JXCA 3WQ4A 1TO3A 3MI3A 1E9ZB 1XLMA 1O94A 3PPGA 1FXPA 3LGGA 3VDBA 3PPCA 1DQXA 3QKEA 4XZNX 3HTWA 4CD5A 1RK5A 4XAYA 1R3WA 5I3KA 3NVDA 3ZLGA 4GQQA 4I8DA 3NQCA 4IPNB 1A0EA 2OCZA 3DFQA 1B1YA 2VFHA 1D8CA 4BJHA 3T0DA 4PCPA 1N8FA 4EACA 2J6XA 4JDYA 1V0LA 3SQMA 3BOXA 2CW6A 4FR6A 2DZXA 3WY1A 3RLGA 2ISFA 2VC6A 3UERA 5BU6A 4HTYA 3C4UA 3CYVA 5GVJA 3K30A 3UPWA 1NOWA 1J11A 4ADUA 5EGRA 1HVQA 5CZKA 3DN5A 4PR4A 4JBRA 1NP2A 2XVGA 3HBLA 3H8AA 4GVFA 4ZB5A 1HIZA 3LCIA 3VINA 3OZMA 5CG0A 4CD7A 1BWVA 3QC3A 3G1FA 1XM3A 4YIWA 3HOJA 4IISA 3AALA 3DHDA 4CVUA 4TO8A 5C6MA 3M6DA 1XC4A 5KITA 3QZAA 2ISVA 1ENUA 3CPUA 5I24A 4DX3A 8XIMA 2JKAA 4CCEA 1J0HA 4DJDC 5D03A 6TAAA 5HR7A 2A79A 3W72A 4LVDA 2WW5A 4V28A 3BGAA 1RJRA 5DY3A 3W7EA 4HMDA 4L56A 3PC0A 3KHDA 4K39A 3BOFA 4ZE5A 3GVGA 4W5UA 1LROA 4S3KA 3E0VA 2O9OA 4AD3A 4Z2HA 1R3YA 1CIUA 5CAKA 1I0DA 1G4SA 2Q09A 1R7AA 3MCOA 3N34A 2RDXA 2DZVA 4EWJA 4EKJA 3IWPA 2XISA 4UCFA 4Q4SA 2YBUA 1F5ZA 3E12A 1B31A 3SSZA 4Y90A 4EK7A 2C1GA 4Z1YA 3W23A 2D3LA 4OWGA 2V3FA 4KEMA 3G1RA 4M7TA 3PAOA 3N11A 3FAXA 1VFLA 4C6CA 4I9JA 4KWOA 2GJXB 1SFSA 4I9MA 2XFYA 2WPBA 1LUCB 1V6UA 3S9YA 5HNRA 4HSNA 3LNMA 4CCCA 4B90A 4H6KA 3SZ8A 1WKEA 2QZRA 1MEWA 2OFJA 3CV6A 2WHKA 3GYEA 5EBUA 3MI6A 3P14A 1KR0A 3GZAA 3LV6A 2X7WA 2PB1A 2ANUA 2A3EA 4UZSA 2QPSA 4TX8A 2F61A 3O9NA 3LCXA 1EB3A 3EB3A 5FJIA 4D6EA 4NYYA 5T9CE 5M2FX 5K7JA 1EJSC 2WK2A 5GJNA 3S2LA 3QFWA 5ENLA 4FLQA 3RG6A 5LNUA 1B57A 4W5ZA 1JZ7A 5C7HA 3K8KA 3NQ8A 1EUAA 4TV5A 1IT8A 2J27A 3BLDA 2HV5A 7CGTA 3PN8A 3GXPA 1U2YA 4JTLA 4JYFA 3MS8A 2WSRA 4G1NA 1TV4A 4J5NA 1QRQA 3WF0A 3QM3A 3UQNA 5T26A 3EZ4A 2PODA 3U7BA 2ZBTA 2PDBA 1YYAA 4LPCA 4IX0A 5IBXA 3ZR5A 5D2YA 5HA7A 1UR2A 3WZ0E 1K6WA 1XCWA 3M5ZA 4ZSUA 3JZEA 3EWYA 3WX7A 3ONBA 3LGDA 4N42A 1POJA 1AMKA 3UXAA 2B7QA 1XKJA 3I10A 3FA5A 5LIYX 3DHPA 4NJKA 2OKTA 1PKYA 3CL6A 4AIOA 2YDSA 3N9SA 3BV4A 4P61A 5HJXA 3S6OA 3ZVHB 2O9TA 4EXAA 1X6NA 2EPOA 1SU5A 2G3FA 2XM2A 1P7TB 4G9PA 3F4CA 4G56A 3FV9A 3F4NA 1RALA 3ITOA 1FWFC 1VB9A 1PE1A 3N3TA 3P8JA 3FIGA 4H19A 1Y5XA 1Z32X 2OT0A 4HTBA 2QJGA 2GFTA 3R43A 1EP2A 2J8GA 4WD0A 3KP0A 4Z0SA 2A6NA 1JULA 3UPBA 3MZNA 4W93A 5FAJA 2FJUB 1NOUA 1IEXA 4DM2A 4FNUA 3RLVA 4WRHA 1JYWA 4RE3A 4UR9A 3WO8A 4ZA0A 3LXBA 1GTHA 3IV3A 4MNMA 4FOJA 2QNEA 2ISSA 1F7BA 3IEBA 2FFIA 2QF7A 4YMZA 1BF6A 3WMSA 1E1CA 5KMYA 2QVHA 2BHZA 1JCTA 4C7GA 1Z7AA 2WLZA 2CEQA 4HU0A 4KIRA 3PTQA 4M82A 3MV11 3B05A 1Q8AA 3UVAA 3URNA 3P81A 4DO7A 1DIDA 1M7XA 4CU8A 4K37A 1TPFA 1RD6A 1F07A 1OGSA 3H26A 4GC4A 4HK7A 5CKSA 4JFUA 1H5YA 3WLKX 3TZNA 2PTZA 3UG8A 4GQBA 4IUGA 5E5CA 1TWZA 4M8UA 3TQ0A 1I60A 1PSCA 2J8FA 4CVWA 4EANA 1MUWA 1MMFA 3PWAA 4XZIA 3W7PA 2WM0A 3EDEA 4D2JA 3S1VA 3AMKA 5RUBA 5H91A 5D9NA 1BGAA 2C71A 2PF8A 3O1NA 1WXZA 1HO4A 1XIFA 2YW4A 3P6LA 2J62A 3EWUA 3GM8A 3OIHA 2VEMA 3NZRA 4LCSA 4U2ZA 2ZRZA 4IT1A 5C5YA 4PMZA 3MWAA 5I3IA 3UNDA 3O8AA 2J6VA 3CB8A 2NSOA 2R94A 1TSIA 2E1WA 3VMPA 4XV0A 3MYOA 4JX4A 1EO5A 3SCWA 2W0UA 2X40A 2WB5A 1BKHA 3WLNA 1MI3A 2YCJA 4C1KA 2QULA 1X1OA 3VC6A 2HVOA 1TMQA 5EMMA 2EPKX 3P5YA 1AODA 4AXKA 2VQUA 4WY0A 4LUTB 1R2TA 4Q8TA 1PKMA 2JF6A 1J93A 3DEQA 1DJNA 1G94A 4Q7BA 3WD4A 4L5ZA 2DP3A 1EBHA 1DORA 4O0ZA 3W1XA 3PF3A 5C54A 5J8LA 4IUOA 3VZYA 1UCWA 2Y6ZA 3ZR4A 5A6BA 3PS7A 4X2PA 1UOZA 3N4FA 3MB9A 3TR9A 3W25A 5I06A 2PDFA 2NSXA 3FCPA 2OLHA 4IJBA 4Q4MA 4LEQA 2ZVIA 2GWNA 2INFA 5J5RA 1NF7A 2Z1WA 3F5KA 2CHNA 4PMVA 1VRXA 5JIPA 3BZJA 2CLLA 1A5LC 5HULA 2HRWA 4Q8VA 2ZCGA 2ESCA 1SSDA 4KH2A 1JUEA 4AUBA 1POKA 4HSHA 2OWCA 3GH5A 3AICA 3G22A 1ZCCA 2BASA 2FVMA 3OZYA 3WD0A 1JUKA 3TP4A 3NJ3A 3S5NA 2YCEA 1N2VA 3S1GA 1XSJA 3GZ3A 2YR1A 3ARYA 2XG9A 2IPJA 3N6QA 4W8BA 1PHWA 2UY2A 3GC2A 3B40A 1DBTA 2EQDA 1GOWA 3CZ8A 1ZBVA 3EPNA 1K7FA 3O0KA 3T08A 3SUTA 8CGTA 3MMDA 1ITQA 2EXOA 1FWSA 1JDEA 4C1LA 4Q7IA 1E15A 1IEVA 5I5RA 1L8PA 1P6WA 5IHSA 1K9DA 1IXOA 2WZTA 5AYBA 5FL0A 5EY5A 3RN6A 3ZMRA 3HFTA 3LXAA 4S2BA 3W85A 1QHZA 2FYMA 4AC7C 2ZA1A 1EPVA 1GHRA 3BPWA 1YXDA 2OEKA 4R27A 4IL2A 2G3MA 3DBNA 4QM1A 4EWND 1YNQA 1XGZA 1ZENA 1EIBA 2OYKA 1JPKA 3WD2A 3QV8A 2NUYA 3QTGA 3A9IA 4AZIA 2CHRA 1LWHA 4KRTA 4QCEA 3TVAA 1UR4A 4FXRA 2V63A 4ZQPA 3WLLA 2JKPA 3P82A 2QR6A 4DXXA 1HGYA 3A4WA 2Z6IA 1Q3NA 1RQBA 3VMOA 4KFOA 1UA7A 2A5HA 3SY1A 2GQAA 4AZCB 2CLMA 3GW3A 3NL6A 3B4UA 3OW1A 1DJHA 1P5BA 4BQ5A 4LV4A 6XIMA 1V02A 3RLHA 4KEZA 3F2CA 1XGEA 4FLSA 1X98A 1N55A 2WHLA 4GYFA 1JF5A 3UZ5A 2Z7GA 2VRKA 3OLEA 3M4HA 4L1GA 2E40A 2ABAA 3ANUA 3QEZA 3ITLA 1MW0A 1XIJA 3L66A 2VR4A 4O57A 1XIBA 3NQGA 1E1FA 1K02A 1P6BA 3L4UA 2PDMA 3WENA 3ARXA 3SY8A 3TIMA 3CB3A 2VZOA 3RPDA 3PJWA 4QE4A 2HNHA 4QISA 4MG4A 3QR1A 4LRTA 1LT8A 2WPGA 2EPHA 5JMUA 3OBAA 4R33A 1SJBA 5G1MA 2NQJA 1X6UA 5IRPA 3M47A 4UXDA 2FPYA 3V36A 3OVQA 3WD3A 3JU2A 1OGBA 1A3XA 2Y1HA 1JNDA 3VIIA 2CIPA 1MUMA 3PNUA 3D6NA 4KT2A 3B8WA 4MJ2A 2ZRVA 4JQ2A 1QWKA 2XHYA 1FCVA 2RH9A 1OFBA 1QNVA 3STCA 3U4AA 5DANA 5DEZA 3CASA 1V0KA 1BSIA 5G1YA 5LGZA 3KVJA 4M19A 3R2GA 3FSUA 3UZYA 3W6LA 5E6YA 3C0QA 4GZIA 3AIQA 1JPHA 2XGBA 5I6SA 3VTRA 1UJPA 2Q8LA 2EG6A 2QCHA 4ZB0A 2J7HA 1KM3A 3S42A 3A5FA 1GZGA 1VQTA 2D1ZA 1VR6A 3APYA 2NXHA 4BI7A 1EGMA 3EWWA 2J7EA 5I3DA 4FMVA 1ICQA 4MTVA 4C6DA 5CEWA 4M24A 2C15A 5CZSA 1CGTA 2J7BA 2OOFA 2P76A 1F3WA 3DFYA 1IZJA 1LYXA 3MA8A 1YXYA 3ONCA 4JQ4A 4N6EA 4OECA 4FNSA 1Q66A 4AEOA 3VABA 3P74A 4H9UA 4J3ZA 1WKFA 3ERPA 3KOFA 4QRNA 2QPUA 4G8TA 3ARVA 2XN2A 1ML1A 2ZXAA 1C9DA 4WF7A 1UIOA 1VEOA 1W3JA 7TAAA 3N73A 4RE2A 2WSYA 3SAZA 1UB3A 3Q45A 1JRCA 5ABTA 2PWGA 4UQAA 2VFFA 4B9YA 4QBXA 3W1UA 1VBHA 3M16A 2D0FA 1TJ0A 4AD5A 3FK4A 3KFTA 2YFNA 3PNZA 3SRFA 5LIXX 1FKWA 1LM1A 1JPMA 3T42A 3WJWA 4HZMA 1THFD 3AUOA 3UXIA 2FH6A 1W5NA 2AGTA 3GR7A 2GGEA 3B03A 3BARA 4J9JA 2FKPA 3WDHA 4B5XA 2CZVA 1OYCA 3ZVIA 1R86A 4E4UA 3S5YA 4B5WA 4GUIA 2CBUA 5D2TA 2ZC1A 3S1UA 1EWEA 1SFTA 2ZKMX 1D9EA 1J01A 2DIKA 1CXEA 2P10A 2E5CA 1QDSA 1WXYA 4QLJA 2FVKA 4LF1A 3DI1A 5HOSA 4O1BA 3GKAA 1KLYA 1ZNNA 1JAKA 3PUGA 2XUCA 1E4LA 1JGIA 4DZAA 3VYLA 1W8GA 4ZL1A 1XLGA 1AUSL 4DJFC 3RMJA 4F0RA 4HHMA 3KRZA 2XVKA 1BTMA 1U30A 4CKQA 4JTHA 1B9ZA 4ORIA 3VOGA 2C1HA 1EC9A 4Z1AA 1QNPA 2FZ9A 4W86A 1SO3A 2DSUA 5IOBA 1MQQA 3CHDA 3EKZA 3VCCA 3VIFA 2BHUA 1OFQA 5A8GA 3OA3A 4KQNA 2PTXA 5AB3A 4UTTA 4YJ5A 1NDZA 3V5CA 2FB3A 4GUFA 4P7LA 4DF0A 4GCAA 4KGLA 1A5OC 3N17A 3WEMA 1JL8A 1PAMA 1YMYA 4PFMA 3WBAA 1TZ7A 5JBDA 1EWDA 3NOEA 2R1NA 3EMZA 4W89A 1FWBC 4J3VA 4NZ4A 4J2MA 3DHFA 4NNCA 2V5BA 3F2DA 2PP0A 1TVPA 1U22A 4WLCA 1B90A 2D73A 4TR9A 1XL9A 3T2OA 3UWUA 1HJSA 1EPXA 4PZVA 3W7NA 3WF3A 1E40A 1A80A 3WQCA 1BXBA 2C0AA 4G7EA 3ARTA 5LXXA 2OQLA 3OLGA 2Y7EA 3A47A 2G5WA 2HPIA 4TOQA 2IKIA 1I1WA 1Q6CA 4LB3A 2G4JA 1QI3A 3NQ6A 4RNFA 2R1PA 4TMBA 3MCMA 2AQVA 2BTMA 2HBXA 2ALDA 3QMRA 4B9ZA 3B8DA 2XFWA 2OELA 3H6OA 5LIWX 1SJDA 5A6SA 3UWZA 4QEEA 1PTGA 4UTWC 6XIAA 1YX1A 3PANA 2Y8UA 4C1NA 1OZQA 3NSNA 1XBXA 3VOIA 3AC0A 1KRMA 1QOQA 1XLHA 2PDQA 3E2SA 4BEUA 1DWHM 2Y85A 1I2QA 1QI0A 3BV7A 4EE9A 3HGSA 3W1AA 1V03A 2ZFAA 2F7FA 3CQJA 4AF0A 4IWWA 2PWVA 3WF2A 2EEXA 1VP5A 4Z1CA 2A1YA 5K9DA 1YADA 3OA5A 5BYWA 4DVOA 3IJIA 4LW7A 1RJPA 4PUEA 2B4GA 1RCOB 3CV2A 1EO7A 2DW7A 4GVIA 2XJ7A 4JCLA 1TPH1 5CZJA 1F8MA 1UZHA 3MVIA 4ZOBA 4UMAA 4MMWA 2PZ0A 2NUXA 4AVOA 4FSAA 3TMQA 1CGUA 1RVKA 2ZRUA 2FDSA 2G37A 3CIXA 1IEQA 4FALA 2VELA 3M0KA 1REQA 4W8LA 2Q02A 3HF3A 3RK8A 5D2VA 4E4PA 4NL1A 1CXKA 4H04A 1NELA 1E6SM 3H23A 4IP4A 3PPHA 3QYQA 4N9BA 1GPFA 2DH2A 4QLKA 1DQWA 1RSCA 3W86A 1UJQA 5HXMA 4ONVA 4DBWA 4FOUA 1I1XA 2FVLA 4Z2JA 1GEHA 1I4NA 4HQVA 3WDIA 1UBSA 3T09A 1RUSA 3GRIA 3TW6A 2JALA 3VXGA 2PE4A 3WNNA 4L80A 1TREA 4PEEA 2AL2A 3S46A 3N14A 1KXQA 3GNXA 2XYLA 3GVWA 4IZGA 4S1FA 5E9XA 2WVVA 5TIMA 1PTDA 4HT3A 4DM1A 3TC6A 2JKEA 5BRBA 1ZJAA 3KCJA 4D6JA 5CGQA 1LT7A 1SFLA 1RY0A 4EIVA 3GNPA 2R9RA 1F9CA 2YL5A 3BLKA 1JCYA 1BYCA 2QJMA 2AKMA 2VUNA 3LUTA 3KDNA 1UQYA 2FHCA 4NRRA 4H7CA 1PCWA 3HZ3A 1OFPA 1V6YA 1KO0A 3NEHA 1KV5A 2ATMA 3PBYA 5DO8A 1GQJA 1KRCC 1BWKA 3RDKA 5FF4A 3VMNA 1KM6A 3XISA 5EFDA 2W67A 4CNSA 4Q4RA 3MCNA 3SCTA 1TMLA 1QPQA 4X3ZA 5CPNA 1GTEA 1WZMA 5DT5A 2E0PA 3BG5A 4D8ZA 4OT7A 3UCQA 4U4MA 1UWUA 5JQ9A 1HKWA 4NHVA 4JAWA 2KX9A 3TQVA 2GQ3A 2YW3A 1JZ8A 4C6PA 1XKYA 2VFGA 3T81A 4ICMA 2H9AA 4HCLA 4WEVX 1FWTA 1US3A 3HURA 1VFOA 3RUBL 5DMYA 4RW5A 4QAWA 1M04A 3O7UA 5BU9A 2A3BA 4UOZA 2YL8A 3USZA 1F8IA 1XLKA 2V3GA 4O53A 3EX6A 3KVKA 4H00A 1EBGA 3VA8A 5FESA 3S2CA 2JK2A 4IXXA 1HXJA 4H6RA 4ZCWA 3AHXA 4RNIA 3MANA 4OOUA 1XHGA 4PGLA 3TLQA 1XI3A 5C0QA 4J40A 3R94A 4TTUA 4Y96A 3XINA 5AFDA 4Z2KA 3PJTA 1M7JA 1LCOA 3BAWA 4JL1A 1XICA 2X8RA 2FTWA 2FDMA 1XLLA 3IJ8A 4M3PA 4IHCA 3LPGA 4E8GA 4IGHA 1K7EA 4KIEA 1VFSA 3W1PA 4AD0A 4CU7A 2QJIA 4YL2A 4AYSA 2BHYA 3UNTA 1I45A 3NEVA 1CBGA 4PUMA 3W7LA 1B4KA 1TA3B 4QITA 4XZHA 4PUDA 5ABFA 1YEYA 3L2LA 1VFUA 1EJRC 4IMFA 2BGQA 4Z17A 1KTBA 2ZWZA 4AMCA 2XVNA 1OABA 2OO6A 4CU6A 4N9CA 5U7SA 5FACA 3C2VA 3TTQA 1V8EA 1DWFM 2OSWA 3P93A 5JH1A 3G0XA 3EB2A 1JPIA 4F8XA 4W87A 2GSEA 1OFOA 3OG2A 1Z41A 1H7XA 2QJHA 3OGRA 3UJRA 3S0CA 4MJ4A 4FXJA 1QXLA 3MY9A 3IIOA 1JDDA 3TJ4A 5LIKX 3HM7A 3O6CA 4DUXA 4JNMA 1TR1A 5DBTA 3MJYA 2HEJA 1K4HA 3DFOA 2JQXA 4KWUA 4QTGA 4LBSA 2PEVA 3M44A 3BICA 1TTQA 4MIMA 3FXYA 4PTNA 1DWGM 1XYFA 1C3FA 1S2CA 3QV7A 1HT6A 4HJFA 4Q8PA 4XD5A 1OD8A 1Q13A 3DGBA 4RPQA 1E55A 2Z2BA 3N4AA 4XAGA 1XBVA 5CPMA 1WDWA 4H8UA 3WBEA 2E9BA