2R94A

Crystal structure of kd(p)ga from t.tenax
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
286
structure length
286
Chain Sequence
b'MEIVAPVITTFRGGRLDPELFANHVKNITSKGVDVVFVAGTTGLGPALSLQEKMELTDAATSAARRVIVQVASLNADEAIALAKYAESRGAEAVASLPPYYFPRLSERQIAKYFRDLCSAVSIPVFLYNYPAAVGRDVDARAAKELGCIRGVKDTNESLAHTLAYKRYLPQARVYNGSDSLVFASFAVRLDGVVASSANYLPELLAGIRDAVAAGDIERARSLQFLLDEIVESARHIGYAAAVYELVEIFQGYEAGEPRGPVYPLDPEEKAWLRAAVAKAKSQLRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-Keto-3-deoxy-(6-phospho-)gluconate aldolase
molecule tags Lyase
source organism Thermoproteus tenax
publication title Crystal structure and stereochemical studies of KD(P)G aldolase from Thermoproteus tenax.
pubmed doi rcsb
total genus 111
structure length 286
sequence length 286
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.14: 2-dehydro-3-deoxy-phosphogluconate aldolase.
pdb deposition date 2007-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2r94A00
4FF7A 4LVGA 3IIVA 2V5LA 4C1LA 1XM3A 3G1AA 5DCBA 1GTEA 1BWLA 3LCWA 1KFKA 2BXVA 1LP6A 2ZZ2A 3MW7A 3RU6A 3MO7A 4LC8A 1OX5A 2ZRVA 2QR6A 1J5TA 4K7YA 4O1AA 5K7JA 1KBJA 3G3DA 1GZGA 2HS8A 4FXSA 1K8YA 4GUHA 4K8EA 4M6PA 3LCLA 3OVPA 3W71A 4MZYA 4A21A 1MEIA 3W07A 3PSWA 1GYLA 3W1TA 3WK1A 1G6CA 4MPQA 5F4WA 2GVLA 3W1MA 3DKLA 2Q8ZA 4NXKA 3W2UA 1H7RA 4CQAA 1LOLA 3D0CA 3UY7A 1V5XA 4RR4A 4ZVJA 3W6YA 1VCGA 3I65A 2OCZA 1FDJA 2VFHA 3LB0A 3UQNA 4R7JA 5C6MA 1OVDA 4AWSA 3L66A 3NZ1A 3LI1A 3IIXA 4GUFA 3HQ1A 5EYWA 4LTSA 2EHHA 3DI0A 4RZ6A 2VXNA 3LTSA 3C2EA 4UTLA 2CLOA 3PUDA 1L6WA 1OX4B 3SJ3A 3G3MA 5CZSA 2Y62A 3PBYA 4O4WA 4X22A 4EVZA 5CZ0A 3CHVA 4N9CA 1P1XA 1WBJA 1JR1A 1M7PA 1GG0A 2A2IA 2ZTJA 2E5DA 3NQFA 1ZAIA 3OVQA 1HO1A 1XUUA 3L0GA 3NPWA 1EUNA 2NXGA 3PB0A 4O19A 4QJ1A 4WOQA 1TIMA 2F84A 3C61A 3HPXA 3F03K 4WJEA 2X1TA 3CIXA 2ABBA 5D2VA 5F4XA 3W7CA 4Y8FA 3TUUA 5LZLA 2ZA1A 3THQA 4YCPA 5TBOA 3INPA 2GQ9A 3TMQA 4FIRA 4IMEA 4NU7A 1W8SA 1WQ5A 1IXNA 3SGUA 1H1ZA 3USBA 4MUZA 1H63A 4FNTA 5I3KA 2Z2UA 1QAPA 5H91A 3I7SA 3NM1A 4LWWA 3PG8A 3PM6A 1W3NA 2GUUA 2NUWA 1TV8A 2ZRZA 3P61A 3TJLA 4RZ4A 5EKYA 3A9IA 3PUEA 6ALDA 2YZRA 1TPB1 3B04A 4AHPA 4JR5A 1YTEA 5H2ZA 2QCDB 3R12A 3W7HA 2QJHA 1VPXA 2VFIA 3O6DA 3W9ZA 3DFPA 4R33A 2NV2A 3S8HA 5FI8A 1JCNA 3M41A 5TQLA 4DF2A 3O1NA 1R47A 3FKRA 4CNOA 3PG9A 3W7GA 3NQDA 1VC4A 1VCFA 3IVSA 3MP4A 1B9BA 2V82A 4PEKA 3W83A 2H6RA 1LRTA 3C52A 1QWGA 3DFNA 3G1SA 4HHPA 2TMDA 4K36A 3W2MA 4CNPA 4YMZA 4XTDA 3GIYA 3QPZA 4GJ1A 4EF9A 3RLVA 5ABTA 4RX0A 5C2XA 3G22A 1EB3A 4PL2A 3LCFA 3S42A 4HT3A 4UC5A 3EWXA 4WY0A 4TX9A 3E96A 5SWUA 4LNYA 3H54A 2PRMA 3KAOA 1FXQA 1XI3A 2WKJA 3P5ZA 2ZZ5A 2C19A 3U2OA 2V5BA 4GFSA 5TIMA 4O8RA 4H4IA 3TIMA 3RLUA 3DKJA 4UUIA 3LV5A 5CG7A 2QCLA 2R8WA 3CQ0A 1NEYA 3Q94A 4TMCA 1TRDA 5J5RA 3HO8A 3G0XA 2R14A 4GBUA 1LRQA 3T40A 3OIXA 1BEUA 2NXHA 3GVGA 5I3GA 4I9AA 3GX9A 4H6KA 3WK3A 3TH6A 2Q3RA 1LTDA 4XUGA 3OVRA 4ZQCA 4FB7A 3K30A 1N8FA 3EX1A 4M6VA 3FYOA 4JEQA 4QISA 3L0NA 4YLWA 4HN4A 3W7KA 3SW6A 1GJPA 1DV7A 1SW0A 4IMCA 4IGHA 3SSJA 3TMLA 1TTIA 3IGXA 4N2YA 1W1ZA 1F2JA 1P4CA 3P67A 1WV2A 5KTLA 4O11A 3QYQA 1J4EA 4XTIA 2VEMA 3S5OA 3LXCA 3G1FA 3M47A 4RCXA 2ZDRA 3TW6A 1OHLA 4ADUA 4MYXA 1DVJA 4O1CA 1G4PA 1HFBA 2Z0IA 1VYRA 2QUTA 1H7WA 2XN1A 1Z48A 3L68A 3NQGA 2JGQA 3FKKA 1I8JA 2QUVA 2ZTKA 1TPDA 4UTWA 1JCMP 2ABAA 4Y90A 1GYNA 1VCVA 1LLZA 1Z44A 4K39A 2I14A 3LRMA 4DO4A 3WK2A 3P74A 2DU2A 4O0KA 3UWZA 4O0ZA 1W5NA 1W5QA 2OX1A 4XBSA 4ZQOA 1FCBA 3VFLA 5IBXC 1PE1A 1S5TA 3EEGA 1L6YA 3EWWA 4UCGA 1GQNA 4HNNA 4ALDA 4UNLA 4N6FA 4JTSA 4RJEA 3G8RA 3TC7A 1OYCA 1VJIA 4HSNA 4NNBA 1JULA 1WXJA 3IEBA 4TO8A 4Z1AA 1K3UA 2E5BA 4JD4A 3TJXA 3A22A 2B0MA 1AW1A 5CPNA 1H60A 1JRCA 3EXRA 2P0OA 3HMJG 4Z0JA 1X8FA 1KM3A 4UTTA 1GVQA 1EPXA 3UZ5A 1W5PA 1YXDA 3TQ0A 1GEQA 4UIOA 2Y6ZA 1R30A 1TV7A 1A5CA 3NQVA 2DZTA 3UXAA 1N7KA 3B0VC 5HULA 3CPRA 2J9ZA 3C0JA 1CI1A 5CPOA 5KSWA 1WDWA 1ONRA 3CEPA 5BRBA 1ZAJA 2YPIA 1ZCOA 4GXMA 4DEFA 3HBLA 1B4EA 1L2UA 3M5XA 4N6EA 5KMYA 2Y63A 3HG4A 3N73A 1UUOA 3B4UA 5I3IA 3I6RA 2A0NA 1O95A 2DZSA 3M0ZA 3R89A 4GRSA 5I3JA 3G0UA 4A22A 1GVFA 2YXGA 1OFAA 4JYEA 1QPOA 3DU0A 4RK8A 5T26A 3DFQA 1S3HA 5HMSA 4PL1A 2Y7DA 2Z6JA 1MSSA 2A6LA 3FJ6A 3ZWSA 4IQLA 1VS1A 3NL2A 3LXAA 3UWQA 3HPSA 3CTLA 4QAIA 1RR2A 1K7FA 3W7MA 4LV9A 4MJMA 1FQ0A 2C14A 2Y88A 3N34A 5CZJA 3TXZA 4ZMGA 1G4EA 1GTHA 1MXSA 3M1ZA 1W5OA 2JKPA 3EWBX 2G96A 3PC0A 3HF3A 5D2YA 3L5AA 4N4QA 3W88A 4GUIA 5LGZA 3M43A 5I3FA 5DCEA 3UPBA 4XQ6A 3BLIA 1JUKA 4P61A 1I2PA 4AAJA 4O15A 3W1PA 1OFOA 3NA8A 2QCCA 4L4LA 1WAUA 4AH7A 1F05A 3BLFA 1EP1A 1ZHAA 3C2FA 1ICQA 3GR7A 5LHFA 2FB3A 1AW2A 3S1WA 3Q37A 4NQ1A 1H7NA 1I2RA 3SGZA 4IXXA 2E6AA 3PR2A 3BG9A 2WNQA 4WXYA 2NX1A 5AHEA 3DHDA 4LY8A 3T4CA 4BI7A 4M5PA 2ZQ0A 1HUVA 5AB3A 1AW5A 5AYXA 4ZZ9A 3FIGA 4O16A 3LI0A 2DJLA 1TPC1 3QQ0A 3TAOA 1G7VA 2ZRWA 2YYUA 2X1SA 1OX4A 3SZ8A 4WXZA 3V1PA 4O18A 1TB3A 1ME9A 4UFMA 3PF3A 1LLWA 4W9TA 2FJKA 3NYZA 1WYIA 3NL5A 2VEKA 3L5MA 1L6SA 4DELA 2WSYA 1XL9A 3YPIA 4IMDA 3LM7A 2QCFA 5FF2A 3M6YA 3KVMA 3PUOA 1RZMA 1O4UA 3PAJA 4WOZA 3VNDA 3W2LA 3JR2A 3IGSA 1G7UA 4RXGA 5LKYA 1ZAHA 3HG2A 3R5EA 3NQCA 5C55A 1P0NA 4PTNA 2A1YA 2FTPA 1ZY9A 3LTYA 4XBKA 3MYPA 1TMHA 1K02A 1I2OA 1FWNA 3MI6A 1TTJA 2ZZ7A 1YDVA 4UFHA 1F5ZA 4HPXA 4O57A 1V7YA 4LVAA 4K37A 4FX6M 4MKNA 4CCDA 1F74A 2GPTA 4E2BA 3TK7A 1DQWA 2E5CA 5F2LA 2BSLA 3HOJA 1FCQA 1I2NA 3DXIA 2FLIA 1O94A 3EB2A 2CLHA 5KINA 2YW4A 2C1HA 4O13A 1IXPA 3O07A 4AXKA 3N9SA 3MBDA 4Q33A 1W5MA 3IIPA 4WX2A 2VC6A 2GVGA 4X9SA 3RMJA 2I1OA 3S1UA 3LDVA 4NZJA 5BMWA 1KFJA 1PS9A 2A85A 2CFFA 5AHMA 2QAFA 3P5YA 1OK6A 3I7QA 3S5NA 3IVUA 3L5LA 1WOAA 1ZENA 1RVGA 2B7QA 2H8XA 1LBLA 4Y6GA 2RFGA 3TV8A 3BARA 1M7OA 3KVKA 2YYTA 3GDRA 4I7WA 4MY1A 5G2HA 5BW6A 2DZPA 1ALDA 5LNRA 5EBUA 1LORA 1VYSX 2FFCA 1F6KA 3N2MA 3NQ7A 4JGDA 3IRDA 4IJBA 5BNKA 3W7QA 4CCEA 1SZFA 1LCOA 4LUJA 2LLEA 2RDWA 3P80A 1OG0A 1X1OA 2CLIA 4R53A 3G24A 1XBYA 2E68A 4M19A 4TMBA 3FYPA 3TROA 2VELA 1YTDA 4JX6A 2FB2A 3E12A 2GQAA 2Q3OA 1QOQA 3P81A 4Y9AA 2G5WA 3CLMA 4AMAA 8TIMA 3GB6A 4CNNA 2VFDA 5HUOA 4C1KA 1AMKA 1RV8A 4DXVA 3STEA 3CM4A 4Z1CA 2Y61A 3VE9A 3MHGA 2FQIA 4JX5A 1P5BA 6TIMA 3JRKA 3TXVA 2WSRA 1XFBA 2F7FA 2VFGA 5U4NA 3KOFA 1LYXA 5G4WA 2ISWA 2WQPA 3IIZA 2CZEA 5D30A 1D3HA 1TCDA 4JIQA 4U28A 4TU1A 3DENA 3U6WA 2EKCA 3G18A 3QW3A 3QC3A 5K9XA 4L4MA 1A5SA 3TSBA 2HMCA 3F1QA 1LDCA 4A29A 4UTTC 2CWNA 1A53A 4QM1A 1UUMA 3W76A 5LGXA 5LNVA 4GC4A 4KWVA 3O15A 2WSQA 3RNDA 1PIIA 3DZ1A 4AWUA 2V2DA 5CPLA 1SFLA 3IGUA 4KKXA 3STCA 1KTNA 1JQXA 3B05A 3BGJA 1SSGA 4CQ9A 3TE9A 2A21A 3LHTA 2V8ZA 1JVNA 3LGEA 2UV8G 2DJXA 5DBTA 1DQXA 3DGRA 2QCMA 5IBXA 4DBDA 3LHUA 3W2KA 4FIQA 1QO2A 1S5WA 4WZHA 3LERA 1OX6A 2DZWA 2HTMA 3UNDA 1T99A 1VGAA 4IPIA 5CGQA 3T55A 2WNNA 3ABQA 4N9EA 1KM1A 1I45A 4DF1A 4OQVA 2TPSA 1OF6A 2Q8LA 1YTKA 1OFPA 2WJZA 1YPIA 5D05A 3WJXA 4U4MA 5E0KA 4YL2A 1ML1A 1SSDA 1A5AA 2NWRA 4IXHA 3BK0A 3ATZA 2Y7EA 3PVFA 4TR9A 3W1UA 1TQXA 1YLVA 5EPDA 1LOQA 1TPH1 1QFEA 2EF9A 2YGYA 4MFDA 1VHNA 1H62A 4PA8A 1KM0A 2WPBA 2C3ZA 2PRLA 4AF0B 2TSYA 4CLMA 3GZ3A 3I68A 4O28A 5G4EA 2GJNA 3W73A 1CX9A 1G69A 3BW4A 1ADOA 2XFWA 2VEIA 1O5XA 4LS2A 1NAL1 1Q45A 3T44A 3BLEA 3NQEA 4S2BA 3MMTA 2QDGA 3Q2DA 1VHCA 5C5YA 3PY2A 1XBXA 4Z08A 3TC6A 1EX5A 3QW4B 3VI2A 5EMUA 1CW2A 3EX3A 4NNAA 2TYSA 1FWTA 3NDOA 1FXPA 4I7VA 3GLCA 5A5WA 4EIVA 3TAKA 2QKFA 3WFAA 3ABOA 3B0UX 4UTKA 3VKJA 1EP2A 4O10A 5EL1A 1H1YA 4A2RA 4GUJA 4DQWA 4S1FA 4YWIA 1ZALA 5G1YA 1PCKA 2GJLA 1QDSA 3NPUA 2P1FA 2Y7FA 4ADTA 1RD5A 1JCJA 1TJRA 4M7TA 2KZHA 2DORA 1B4KA 4ONVA 3TFXA 3HGSA 4K7VA 1TPVA 4WUIA 2VFFA 3LTPA 1IIHA 1K8ZA 3LRLA 4ZQPA 1DBTA 4ZL1A 2ZA3A 1JUEA 2ZBTA 4UTHA 4PODA 2W79A 5FEXA 2E77A 2AGKA 2BZNA 4OE7A 4HIBA 1W3IA 4MFEA 3OEXA 1SU5A 2OJPA 4YCOA 1X7FA 2CLKA 4I7UA 4Q4KA 2ZRUA 3O6YX 4A2SA 4LUIA 3LHYA 1VYPX 1D9EA 3W72A 5FF3A 3GXPA 5HWNA 4O1BA 3NG3A 2VKZG 2QF7A 1TREA 1KA9F 3A5FA 3WJWA 1LM1A 1KV8A 3AJXA 5D04C 2AQWA 3LCXA 3MHUA 3MI2A 3N2XA 2HS6A 3M16A 2QJIA 1BKSA 2YR1A 5DLCA 4JDYA 2NXIA 3GKFA 4MZ8A 4XZ9A 3FJLA 4GNJA 3A24A 1QO5A 3MP3A 1F76A 3E9AA 4OV4A 3LX9A 2X1UA 4O1DA 1KFEA 4GUGA 4KFNA 4BFAA 4JN6A 3LV6A 1W0MA 3W2NA 3GDTA 3OBKA 4LVFA 3TX9A 1EUAA 2QAPA 3BVJA 4RLIA 2J88A 4Y96A 5EA9A 1WBHA 1KFCA 2J9YA 5DXYA 4QSHA 3S5YA 3NL3A 1HO4A 5F2IA 5A8GA 5C54A 2ZYFA 1DHPA 3OG3A 4S2CA 3EKZA 5F2MA 4B5NA 4JTIA 2Z1BA 1UCWA 2D73A 4WY0B 4FX8A 4AWTA 4PC8A 3HGOA 1K8XA 1JUBA 3MWAA 4DO6A 3O6CA 1N55A 4CQ8A 4IOTA 2NX9A 4MLJA 4HNTA 4FHAA 3W7PA 3FOKA 4NJJA 2B7PA 5GVJA 1QR7A 1K7EA 1QPRA 1SQ7A 2OZ0A 3EKLA 2DZVA 2IQTA 2ZZ3A 3GDMA 3S1VA 3W70A 1GVSA 1L9WA 3PSVA 4AEOA 5D03A 3S5ZA 1EWDA 4LT9A 2JKAA 3VCRA 2V2HA 3MI3A 4UMBA 3QMTA 1HTIA 1KFLA 2NV1A 4NZFA 3DAQA 4ORMA 3GK0A 5AHLA 4N4PA 2DP3A 2V9DA 4NXSA 1XCFA 3KXQA 3LHZA 4OT7A 3TNOA 3NNTA 2R94A 4ZQRA 4Z1BA 1KBIA 4LVDA 4JS3A 2JGYA 2NUXA 2GVJA 4O52A 1R2SA 5HJLA 1KM6A 1W31A 1KM2A 2J6XA 1IGSA 1W56A 3LBCA 4BWLA 2ZCGA 4JTEA 4WD0A 3LCIA 1MEHA 3GNNA 3O16A 2DZXA 3T7VA 1TPFA 5I3HA 3MUXA 1J2WA 2QEZA 1FUYA 3VE7A 3HJZA 5FESA 3O8AA 1C9DA 3GXNA 4LRTA 1ZNNA 1PL9A 2YW3A 4K8HA 1QOPA 3STFA 4UFJA 5AC6A 3HB9A 2X1RA 3P60A 1WA3A 1KLZA 1MO0A 1SUXA 2RDTA 3HG5A 4JTJA 3QM3A 5DBUA 1B3OA 1UASA 3E0IA 3NQMA 3HIJA 4DPPA 1XDMA 3W7NA 3P84A 1ICPA 5DY3A 1O5KA 1HG3A 2WO5A 3O06A 2A4AA 4RZ5A 1OFQA 4GWEA 1H50A 1FWWA 3W23A 2E6FA 4JTKA 2W0UA 1TO3A 3C3NA 5DELA 3GDLA 3NO5A 2ZA2A 3NPVA 3M7WA 3P82A 3L9CA 4LC6A 4O53A 4QQ3A 3ZFHA 4FXRA 1T0OA 1VQTA 1X6UA 5AFDA 1RQEA 3O05A 2ATSA 2E6YA 2R91A 3NM3A 4UFIA 5F2GA 4YXGA 2HSAA 5HR6A 5LNUA 3PWAA 1H61A 3GAKA 3W2JA 3FEMA 3T78A 4N9DA 1JCYA 1SO5A 2EGZA 5AC7A 4UXDA 4IWWA 1KM4A 1SW7A 2NX3A 5FF4A 3F4WA 2V0TA 4LW7A 1LBFA 1SZEA 3GAYA 3W87A 2FDSA 3NR0A 1PV8A 5L6UA 1AK5A 1ZJIA 2EAWA 3GR8A 3QSTA 5D38A 5D2TA 3PB2A 5K9DA 3UZJA 1LOSA 2H90A 4UTIA 4MY9A 3KFTA 2ALDA 3C4UA 5BMXA 2CLEA 4PH6A 1JRBA 3NOEA 4ORIA 1SR9A 4NJKA 3N9RA 3FA5A 3R2GA 3R8RA 1C29A 3H55A 2CZFA 2W6RA 3ELFA 3M5ZA 2RDUA 3DHFA 4LU0A 3NGJA 5HWJA 2A6NA 3NQ6A 1FBAA 3W75A 1PCWA 4AF0A 2V2CA 3QF0A 3ZS4A 1XBVA 4X3ZA 4AHQA 3BW3A 3ATYA 1S5VA 3GNDA 4AVFA 3L0KA 5BOOA 3NPXA 5FEPA 1FCVA 1H7XA 5KZDA 4FO4A 3M5VA 1DKWA 2E09A 3FFSA 2WV8A 1DOSA 1Y0EA 2YX0A 4JTTA 2C18A 1NF7A 2XN0A 4OV9A 4XKYB 4Q32A 3I7RA 1FCUA 3O63A 2YCEA 5J5DA 4Z1DA 3FLUA 3BG3A 1G4TA 3QMRA 2A7PA 2CLLA 2QUUA 3LLFA 3SECA 4UTUA 3NQ2A 3EX4A 4M6QA 3KRSA 1W54A 1EEPA 4IMFA 4O17A 2NZLA 3PS7A 1Q6OA 1GOXA 4LV4A 1K7XA 1VH7A 3RK8A 3S6DA 1R46A 1TJPA 4FEZA 3C8FA 3UWWA 3IIOA 3LCGA 3SI9A 2EPHA 1W37A 2O7SA 3TR2A 3PULA 1OFRA 5AHFA 1FY6A 2H3BA 2PURA 3H53A 1ICSA 3HGJA 4QITA 3UWYA 3C2RA 2QCHA 2PCQA 2P10A 5FEZA 1GWJA 3ANYA 4IX2A 2C15A 3W22A 3W85A 3L65A 3S1XA 3THAA 3KVLA 4P2VA 5AHIA 5G2WA 2H3DA 3QZEA 1R2TA 2CW6A 1RQBA 3W86A 1KW1A 3MBFA 5G2IA 4O14A 1YDOA 2H8ZA 5HNRA 3N3MA 4ZQNA 3QSRA 2O7QA 4FNSA 3LHVA 4AB4A 2CZDA 3BPWA 3JS3A 4OHQA 3M44A 3W7RA 5CZTA 5LHEA 3B03A 5CKSA 3P8IA 4Z0SA 3NZRA 3TCEA 2AAMA 1PHWA 3DFOA 4JTHA 5D09A 1Q3NA 3G8EA 5AYYA 4DO5A 4J9JA 3CWNA 3W7IA 1NVMA 3S9YA 2C13A 1TRIA 3PBUA 1ME7A 1JQVA 1BWKA 3TQVA 3BGGA 3QQ1A 3WJSA 3TSMA 5K3VA 4ZQMA 3IVTA 4RV8A 4UR7A 4N02A 3NAVA 1SFJA 5AC8A 2ZFAA 3UPWA 3W3OA 4JIPA 4NJHA 2A7NA 5E93A 3ABRA 2E6DA 3TDFA 1XBZA 4O50A 4LRSA 1DJNA 3UYCA 3PBVA 1FDYA 3KX6A 3CC1A 5G5IA 1PVNA 3EXSA 4MYAA 3M5YA 1SPQA 2I9EA 2CLFA 1YPFA 2CZ5A 1XUZA 4WQ6A 3W1RA 2A5HA 5D2XA 3RF9A 4OU1A 3A5VA 1KTBA 1OFBA 3DBPA 3L67A 3U8GA 3CWOX 3UY8A 4MIMA 2OMAA 3LRKA 1Q6RA 3C2VA 5MHBA 4KFOA 1H7OA 4JY9A 2GOUA 4EF8A 5D37A 5HWMA 3QPYA 3BG5A 1IXQA 1WOBA 4MOZA 1IXOA 3P7YA 1YXCA 1BTMA 3FS2A 3NVTA 4RKAA 2WNZA 5E1QA 1P0KA 2FIQA 3LOTA 3G0SA 2CLMA 1KM5A 1EIXA 1F6PA 2Z6IA 3EWYA 4E2DA 4JDBA 3UXDA 2JKEA 4JTGA 4UNKA 4JTFA 4OWGA 1I2QA 1PHQA 3NQAA 4FNPA 4UTJA 1TPEA 1FWRA 1FWSA 3GDKA 2NWSA 4GE8A 2G95A 4A3UA 4TIMA 1TQJA 2JK2A 3CT7A 3L21A 3G1YA 3IV3A 4NJGA 3SY5A 1U5JA 5D2WA 3EWZA 4BR1A 3W1XA 3RFAA 5DY2A 2PC4A 3F4NA 4POCA 3GKAA 5K9CA 3UD6A 1ME8A 1D3GA 5AHNA 3A21A 4X2RA 1JCXA 4FX7A 4MY8A 4R34A 5DXXA 1QPNA 4UR8A 3W1AA 4HNVA 4G1KA 1MZHA 4XWUA 2QDHA 4JY8A 3GXTA 3NL6A 4BK9A 1IF2A 5D33A 1XXXA 2Y85A 2JBMA 4DBEA 1UJPA 3TW7A 3W7OA 3P62A 3PBWA 4BWLC 3LBMA 5KZMA 1RPXA 3QFEA 5EY5A 1M6JA 1TTQA 5L9FA 1M5WA 4XKYA 4UFKA 1EP3A 4QIUA 5LNWA 2QJGA 4KWWA 1OK4A 3L2IA 4MLRA 1LROA 7TIMA 3LLDA 1AG1O 2BWGA 2XN2A 3CEUA 5F1VA 5HINA 3W1NA 1YDNA 1F7BA 5HR7A 1TSIA 5LSMA 3TFCA 3R13A 3E49A 2C16A 2ZZ4A 4ICNA 5CSRA 3HG3A 3DI1A 5FF0A 5D32A 3G1VA 3N14A 3S0CA 4OBTA 1UBSA 5G1TA 1R2RA 1SO6A 3W7LA 2ISVA 5D02A 1UB3A 1YADA 4ML9A 4NX5A 2DZUA 2QCDA 3DH7A 4NJIA 2QCNA 1LRNA 1NFBA 3BO9A 1B57A 3UWVA 3C56A 5IM51 4FNUA 3KHJA 1GT8A 3TA6A 4JYFA 2ZRYA 3EX6A 3P8JA 5F4SA 2X2GA 3GYEA 2OT1A 4IUOA 4LS1A 2FPVA 4LS0A 2FPYA 2X30A 5FEWA 3NQ8A 1SZNA 1WX0A 4K38A 2Y7GA 2VENA 2B7NA 1K03A 3DFSA 1H51A 3B06A 4AHOA 1XDLA 3TQKA 3KRUA 2RKXA 1F73A 1OABA 4O12A 3TU9A 4JTUA 4IPJA 4PFMA 4QNWA 1QNVA 3TKFA 3W1LA 1W3TA 4UTWC 2J9XA 3MHFA 1OFEA 2NUYA 2YFOA 3MJYA 3DFTA 3ZWTA 2BLEA 1Z42A 4FNQA 5CPMA 2J24A 3WK0A 2YSWA 1O60A 4LVBA 1DJQA 3C2OA 4E38A 3OHIA 2YFNA 1GG1A 1TPUA 1ZFJA 1Q6LA 4KFPA 3LXBA 1G67A 4MZ1A 2A7RA 3W7EA 3W74A 1DORA 2Y89A 1SW3A 4HSOA 4UFLA 4FNRA 4BI6A 3ZR4A 4BI5A 1AL8A 2FPTA 5FF7A 2YDAA 2ZRXA 5KITA 4IMGA 1SO4A 3CB8A 1TYGA 3W7DA 2CU0A 1U83A 1KV5A 3TSDA 2V30A 4EWND 2QCGA 3B8DA 1QCWA 3LCHA 3SFKA 5U7SA 4JTLA 1TV5A 3STGA 1SZGA 1KTCA 1KFBA 1JJKA 2B4GA 1NF0A 1FX6A 4K6AA 1OYBA 1FDZA 2VOMA 1GVOA 3W7JA 2OT0A 1OYAA 2BX7A 2G97A 4NX0A 4JXCA 3EWUA 4PCFA 3ABSA 1HL2A 4EOUA 4MJZA 3UWUA 1RQHA 3BV4A 3EXTA 3LHWA 3W84A 2PRHA 1OF8A 4O54A 5K2ZA 3MYOA 5KZEA 5K4ZA 1VR6A 2ATMA 3QRHA 2ZZ1A 3HGRA 1TTPA 4NUWA 3Q58A 3KVJA 5F1UA 4WY0F 4LOCA 3N19B 1LZOA 2V81A 2QCEA 3C6CA 4JX4A 4E0CA 2PE4A 2ISSA 2X16A 3NEVA 3CU2A 3CIWA 1VZWA 2C6QA 1T96A 2Y70A 3MP5A 4N9BA 3G1DA 1QMLA 2C0AA 1E51A 5AYZA 3G1XA 2J27A 4ADSA 4M7SA 5CSSA 1DL3A 1VLWA 4BF9A 3QJAA 3WJZA 4D2JA 1X1ZA 2E1DA 3V75A 3NXFA 1VRDA 2RH9A 1NSJA 1A5BA 4IX0A 3AO0A 5LNSA 1GVRA 4H3DA 4MVAA 3B0PA 4JICA 2B7OA 2NLIA 4DF0A 4NVTA 1LBMA 2GQ8A 4NNCA 4HNUA 1H5YA 1QPQA 3G1HA 1I4NA 1GPWA 2TRSA 3M9YA 1YXYA 1VLIA 1Z41A 3EX2A 2BTMA 2RHGA 5HUPA 5DN1A 2WOQA 1OFDA 4UMAA 1Q6QA 1MEWA 3SR7A 4QNEA 5AOUA 3E02A 1A50A 4HPJA 3SIZA 3OA3A 1TPWA 5DCDA 4NT0A 2ZZ6A 3QH2A 4JYDA 3KRZA 4JNMA 1AL7A 5K4XA 3A23A 3QMSA 1G4SA 2VEPA 4UTMA 3WJYA 1THFD 3BW2A 1XKYA 1YYAA 1JCLA 4UMCA 1IIGA 3W1QA 1EA0A 4HKPA 4DPQA 1H7PA 1EWEA 1KLYA 2VFEA 1C8VA 4OGZA 5AN7A 4O4VA 1SO3A 3HPZA 4RXFA 1OJXA 4CCCA 1XC4A 1T8XA 3QEZA 5HQEA
chains in the Genus database with same CATH superfamily
3KS5A 4FF7A 4LVGA 3IIVA 1MUCA 3OZMA 3M0XA 1R3WA 3IS4A 3ZJ8A 3G1AA 1EBHA 1BWLA 5DRIA 1CB2A 1TA3A 1B3ZA 2VOTA 2I9UA 1GKRA 1OX5A 2QR6A 1P0BA 3G3DA 3CAKA 2HS8A 4GUHA 1JDAA 5FL1A 3OVPA 3APYA 4MZYA 1VFMA 1QT1A 4QHRA 3W1TA 3UCCA 3SN0A 3WQGA 5F4WA 3W1MA 2HVOA 3KE0A 1H7RA 4IIHA 3RRAA 3H2OA 1HJWA 3I6EA 4RR4A 1OEPA 1VCGA 3N4EA 1TMLA 3I65A 2OCZA 3DGBA 1UH3A 4IIDA 3WBWA 7TAAA 4LCQA 3LI1A 3WF4A 1T7LA 5EYWA 3D3FA 4RUBA 1KRAC 2EHHA 1WKEA 2GJPA 3K46A 2XZ7A 3H7RA 2VR4A 2AKZA 3CQJA 3SJ3A 3OQEA 3G3MA 3SUUA 1M3UA 4PBFA 1UIOA 1W3KA 2V67A 3PBYA 4X22A 4CNTA 1M7PA 2ZUSA 4QE4A 3WIJA 4HP5A 3S83A 1DIOA 3NQFA 5AYIA 1VJSA 4AD4A 1ITCA 5CSYA 1EDTA 1V02A 4QJ1A 1XFCA 2VGGA 4H04A 2X1TA 3CIXA 5XINA 4B91A 3H2AA 1XLBA 1V02E 3W7CA 4PEEA 2X1IA 2GDUA 5LZLA 4F0RA 3PFRA 1Z32X 1UR4A 2GQ9A 4JHMA 4IMEA 4NU7A 1W8SA 1EJ7L 1SGJA 4MADA 4AX7A 3FXYA 3USBA 3CHDA 4L6DA 3P0WA 1DPMA 2WPGA 3IJ8A 1UR8A 2Z2UA 1QAPA 2WK2A 3NM1A 2ZRZA 2QIWA 5C9UA 4LH8A 3GU2A 3BZGA 6ALDA 2YZRA 3P93A 2OO0A 1TPB1 4JR5A 1YTEA 5H2ZA 4HSHA 3R12A 1UUQA 2QJHA 1VIWA 1XRSA 2PODA 3TEVA 1PBGA 5FI8A 1KCXA 3SO7A 5TQLA 4DF2A 1C91A 4CNOA 1G01A 1F8MA 1VC4A 1CBGA 1VCFA 3HM7A 3IVSA 2OLHA 1RJPA 5LYRA 4P8VA 2AL1A 3G1SA 3II1A 4RE0A 1KCZA 1OCNA 3R25A 1PO9A 4YMZA 4WRHA 1GQKA 1UC5A 5ABTA 1EIBA 1AZ1A 3S42A 4HT3A 4UC5A 5SWUA 5LIUX 4RDVA 3KAOA 3P5ZA 3OJGA 3GFXA 2ZZ5A 2C19A 2BNJA 1D3CA 1Q65A 2V5BA 4GFSA 3WUGA 4ZSTA 4HZMA 4H4IA 1UKTA 3LV5A 5CG7A 2QCLA 1WKYA 1B3VA 3Q94A 5BWFA 3DESA 3T40A 2INZA 3IUHA 1V6XA 3M64A 4XO6A 1QWKA 1V0KA 3LM3A 3NIYA 4H6KA 4I9AA 4QFUA 1CGTA 5DEZA 4KMQA 3BLOA 3OVRA 2FHBA 1TUXA 5BXPA 1XIJA 4M6VA 4JEQA 1S3TC 4L6OA 4CD5A 3W7KA 1NM9A 3SW6A 5CC3A 4H41A 1Q7QA 1TR9A 4W85A 3CQHA 4ZE5A 3IGXA 1W1ZA 1F2JA 4O11A 2VEMA 3UR2A 2E40A 1OD0A 3G1FA 1GHSA 3M47A 2OLAA 4HHLA 4PZVA 3PZTA 4PTDA 1G4PA 1TFVA 2Z0IA 3BSGA 4XZIA 1VYRA 4LEFA 1Z48A 3L68A 1EXBA 2QUVA 1BLIA 4W8AA 1PAMA 4DM1A 4Y90A 1VCVA 4IH3A 4DO4A 4Q7BA 3WK2A 1CXLA 3P74A 2DU2A 1C7TA 3VFLA 1O1HA 4FLRA 4D72A 4ALDA 4AZ5A 4N6FA 4WF7A 2J8FA 5A6JA 3IEBA 3WDQA 4Z1AA 3ZSSA 4JD4A 3ARZA 3A22A 5CPNA 1H60A 4HZ8A 2V5CA 1YRRA 3VOFA 3V0SA 1GVQA 3BCJA 3UZ5A 2XU2A 1W5PA 3GNOA 3VIOA 2W5FA 2XWDA 1XQLA 1R30A 2QMJA 2QXWA 3UXAA 1GKQA 3QN3A 2DH3A 4HA1A 3F2DA 1WDWA 4C6QA 1ONRA 2YPIA 2IS7A 3HBLA 1B4EA 4L56A 1J8VA 5KMYA 2Y63A 3HG4A 4OFCA 3VU2A 3USZA 3RJYA 4B92A 2QV4A 4B5UA 5H8PA 1O95A 1EL3A 3CH0A 2FZ9A 1BVNP 1SFTA 2JIEA 4D1IA 1OFAA 1R9YA 4JYEA 5T26A 3IWPA 2Y5SA 4PL1A 3QHMA 2Y7DA 1MSSA 2A6LA 2YDRA 4B4FA 1YKWA 3MUY1 1CXEA 1ZBCA 2WMJA 4MJMA 2C14A 4KWOA 5EU9A 2Y88A 5CZJA 1VEMA 3U7BA 3EWBX 1TE1A 4C7FA 1KXVA 1XIGA 4Z2GA 3FHQA 4AISA 3W82A 2BASA 4N4QA 4IGNA 3CUHA 2XFFA 5LGZA 5E0CA 1XIEA 4GOAA 5I3FA 4MB1A 1JZ6A 3KP0A 3PZIA 4IHCA 1NOWA 3QGKC 1YIXA 3IJ9A 4A8LA 4O15A 1OFOA 1FHLA 4ZODA 2ZX7A 1N8WA 2WCAA 3WLIA 1EP1A 1LUCB 3G6LA 3WMCA 3S1WA 2VGIA 3Q37A 3BMVA 2OSYA 5HMFA 2FDMA 3PR2A 3BG9A 3UR5A 3RLHA 1XD0A 4M5PA 2Z7KA 5FSDC 2ZQ0A 3Q67A 2PFHA 1AW5A 5AYXA 4ZZ9A 4O16A 4UQEA 1CGWA 1TPC1 3SZ8A 5TF0A 2FKPA 2IW0A 4WDUA 3CT2A 3KTSA 4WVXA 1ME9A 4ZBCA 1LLWA 1DWFM 4W9TA 1JXKA 2VEKA 3PPFA 1L6SA 3ZYZA 4W7WA 4DELA 2WSYA 4KW2A 1M65A 4C6JA 3UG3A 1LG1A 3A3WA 3M6YA 3KVMA 1RAKA 3PUOA 3THDA 4UQ9A 5BU9A 2VO5A 4WOZA 1UP3A 4LANA 1WZLA 3M0VA 4D6EA 1ZAHA 3BSMA 5ENLA 4NRRA 4PTNA 2A1YA 4HA3A 3EDDA 4Q4SA 4X2PA 2PI6A 4AEFA 2BY0A 1QI5A 1IZJA 1NTHA 3EMQA 1F5ZA 4OTKA 2X09A 2PEVA 2RJGA 9XIMA 1H3GA 3ZT7A 4FX6M 4MKNA 3TK7A 1DQWA 2OZ3A 3M0IA 4Y7EA 5HOSA 1FCQA 1AA1B 1I2NA 1O94A 1E73M 2C1HA 4O13A 2YA0A 4Q33A 3IIPA 5D9PA 2GVGA 3D47A 1LWIA 2FZNA 2QAFA 3NYDA 3CUXA 5T91A 2VI0A 1JXJA 2EXOA 4IJRA 2PDMA 3WH5A 2H8XA 4EPDC 4W93A 3TV8A 4MG4A 1V8EA 1QI2A 1YHTA 2X0HA 2YYTA 5J04A 4GI6A 1W32A 2ZICA 3WNOA 3IRDA 1SZFA 4GISA 1LCOA 4LUJA 1X1OA 4JTDA 4MNKA 5FD0A 3G24A 4FOUA 2D23A 5FIPA 5HANA 3VIHA 2O4MA 1TWSA 4CQDA 2VELA 1YTDA 2FB2A 3E12A 5A6KA 1R0MA 2GQAA 1QOQA 1D7FA 5IHRA 3IAPA 4Q8VA 5HUOA 3ITGA 4Z1CA 2Y61A 3RG6A 4YIWA 2WSRA 1TUFA 4IUGA 2F7FA 1GOOA 4TTUA 2FGLA 2ISWA 2WQPA 3OU8A 1PZ3A 2YB4A 4YTQA 4TVDA 1XIHA 4J3TA 2BBFA 1WUFA 3QC3A 4RNFA 2E1WA 1JFHA 1ODZA 4UTTC 2CWNA 1E6QM 1UUMA 5LGXA 1TZ7A 3EOLA 3ID7A 3QV8A 4MB5A 3STCA 1KTNA 3S1GA 2YLLA 3N9KA 2VDIA 3GG0A 3EOOA 3T81A 3GG8A 3PN8A 5HATA 3KOYA 3MCOA 3TE9A 3LHTA 4NY2A 1JDFA 3F4VA 1JVNA 1TV4A 5DBTA 1DQXA 3DGRA 5IBXA 3LHUA 4FIQA 2UY5A 3MV01 1S5WA 2VZVA 1OX6A 3ES8A 3WNNA 5LIWX 2HTMA 3T9PA 2V3EA 1NQ6A 3MUIA 1RD6A 2D3LA 3LPPA 3QGAC 4OQVA 2KAUC 2TPSA 2ODOA 2BOFX 1OF6A 2VUYA 1I6NA 4N0RA 4GO8A 5I6SA 2WJZA 1F3XA 1XCXA 3WJXA 3P6LA 1SSDA 4JQ1A 2QQ6A 5I77A 3MCNA 2MNRA 3UXKA 2UZ9A 3GXDA 1YLVA 4U5KA 2WBGA 1JPDX 4YYFA 1VHNA 3WH6A 4H1ZA 1KM0A 1K4GA 1UJQA 2VJXA 2PDIA 3T0DA 4O28A 3W73A 1ZRQA 3GVWA 3MPGA 1ADOA 4KWSA 2XFWA 1E0UA 3TZNA 2VEIA 2D0GA 3K4WA 1V0MA 1D2KA 4GY1A 3BLEA 4HMEA 5BU6A 4YVVA 4GY7A 4D8AA 2PTYA 4UOJA 2AMGA 2ZVRA 3VZYA 3VYLA 3N13A 3PY2A 7CGTA 1Z89A 5LIYX 4BQ3A 4PUUA 2AKMA 1EX5A 3DOPA 6XIAA 4WCJA 2HXTA 1UC4A 1AH4A 2D2HA 5DX7A 3NDOA 2J8TA 2D2JA 3TAKA 2XH2A 3WFAA 3ABOA 1KGUA 4ZEPA 1B54A 4UTKA 3B0UX 4FK9A 1EP2A 4O10A 2XVKA 2ANUA 4DQWA 5LIKX 3E74A 4WSHA 4S1FA 2VQUA 5G1YA 1KO0A 2W66A 3NPUA 2UY4A 2V68A 1BRLB 4PUDA 2BMBA 1RD5A 1JCJA 1TJRA 1YMYA 2V5KA 4MGGA 2DORA 3UCQA 3H2EA 5GNYA 4ATDA 3M6DA 3CL8A 1A5UA 1OWQA 5EB8A 3ZLGA 1K8ZA 2RAGA 3LRLA 4FXFA 1UD5A 2PDNA 2ZBTA 1HKVA 2W79A 3QR0A 2AGKA 2ZXDA 3AHXA 2X0SA 3MT1A 1W3IA 3VZXA 2F9RA 2OJPA 3CPUA 4QX4A 4YCOA 4I7UA 4Q4KA 2ZRUA 4A2SA 2XGZA 3ZO9A 5FF3A 1P1MA 3J7HA 3AFBA 1IWAA 3N12A 4E2OA 2PF8A 3TWBA 3Q45A 1KV8A 3N18A 5HK4A 2YDQA 4XAFA 5MF5A 2Q01A 2J7DA 4C6CA 3M16A 4DX3A 2QJIA 1J96A 5DLCA 2WB5A 1QHPA 2CPUA 3BL3A 1FFRA 1RJQA 4MZ8A 3MP3A 3RX3A 4UQBA 4UZUA 1DYSA 2WWDA 4OV4A 4LSBA 2X1UA 2VQTA 4I6VA 4F0MA 2E9BA 4M6UA 1QRQA 2OKTA 1LJYA 5ABGA 4RLIA 4A8NA 5EA9A 3ARQA 3LBOA 5DXYA 3V3WA 3T1GA 3WDJA 3VILA 2X0YA 3NL3A 4QEHA 4ZA0A 3N04A 3S47A 5IDZA 3EKZA 3ZXWA 1ADDA 2J7GA 4QCFA 4MHBA 4BS0A 4WY0B 4PB5A 2WNWA 3CTTA 3N2OA 2VNCA 1JUBA 1H41A 3MWAA 3UT0A 4AU0A 4IOTA 1U1JA 1P48A 3IANA 2TAAA 2WC3A 3H4WA 4JN8A 4P8UA 3TYAA 2KX9A 1F8IA 3AZSA 1SQ7A 1F3TA 5M2FX 4FLOA 2ZZ3A 2HV5A 3ARWA 2QLYA 4V1XA 1L9WA 1ZBVA 5EMYA 3S5ZA 1W9DM 4B5SA 2R6OA 1S5MA 3MI3A 4GH3A 2QYGA 4MNLA 5TD4A 3EYPA 1GQJA 2DQXA 4NYUA 3DAQA 4ORMA 5AHLA 5HNNA 1HL8A 4NXSA 3TOPA 5C0QA 5CLWA 3GE7A 4GD0A 4TX8A 2R94A 2ZADA 1ISVA 3UEQA 3MS8A 3WLJA 4MAZA 4LVDA 5EGRA 1R2SA 2HISA 5G1MA 1W31A 2J6XA 3CASA 1W56A 4BHYA 1V3LA 4CD6A 4IMAA 2DZXA 4JKKA 4AMCA 4GG9A 2Z7GA 3CUZA 2QEZA 2Y1HA 3HJZA 3O8AA 3GXNA 1ZNNA 2JIWA 2PP0A 4KIRA 3AIVA 3N25A 4FR6A 3VAVA 2X1RA 3P60A 4NI3A 1WA3A 3GUWA 1SUXA 3LGGA 5DBUA 2C1GA 1Q4WA 3ZIZA 1UASA 3NQMA 4LAOA 3W7NA 1ICPA 1EGVA 3NZPA 5DY3A 4NILA 5FL0A 3NWRA 3QV6A 4RZ5A 2W0UA 1TELA 5DELA 5CPTA 3ZFHA 1VQTA 3BLDA 1E5NA 2ATSA 4UFIA 1PX4A 1S1RA 3VGHA 5HMEA 3DEQA 4YXGA 1AQFA 5M03A 1UD2A 5LNUA 1MUWA 3GAKA 4Y9MA 5T9BG 3H21A 3FEMA 1JCYA 2EGZA 3SSZA 4HOXA 1FKXA 1KM4A 4YNGA 3F4WA 4HMDA 5E6YA 1B3WA 2HWGA 3ENLA 3GAYA 2FDSA 3PZQA 3AQUA 3ICJA 3RCNA 2E8ZA 5D38A 5D2TA 5K9DA 3UZJA 1LOSA 4MY9A 4PCNA 4S3GA 3M07A 4V27A 4GMEA 2VHLA 3C4UA 4JHOA 1CB7B 4HCDA 4BCEA 1MZRA 3FN9A 2JEPA 1BVZA 3HURA 4TXEA 3ELFA 3UYIA 4OOZA 3M5ZA 1J10A 1JZ8A 6PTDA 1DJWA 3DHFA 2P3ZA 1C9WA 1J0ZA 5FOOA 4PTWA 5JMUA 2I16A 4MDPA 4S23A 5HWJA 4AF0A 2V2CA 4DVOA 1V6VA 4X3ZA 3UBPC 3G2GA 4AHQA 4AYSA 3WL1A 3GNDA 1PTDA 3L0KA 4IIBA 3NPXA 1FCVA 3M5VA 4QS5A 1G5AA 4AQLA 3ONBA 1DOSA 1IHIA 4JTTA 3NCOA 5C9WA 4FI4A 4XKYB 4BEUA 3AXHA 4FS9A 2HCVA 2P50A 4XVEA 5J5DA 3VD3A 2A7PA 3C5QA 4C6IA 2GDQA 2QUUA 1AODA 5DMMA 3NFUA 3EX4A 3ORWA 4GY0A 1VBUA 5T8GA 3R0DA 3GM8A 3APGA 1UQYA 1K1DA 4LV4A 5LA1A 4H7VA 4KS0A 1BFNA 3RK8A 3MKKA 5ABHA 3E3HA 3MANA 3LCGA 1W37A 5LA2A 3UG8A 2TODA 1UBPC 1OFRA 2Y5EA 3NURA 3HGJA 1V79A 5DMNA 1YNQA 2P10A 3ANYA 1MQRA 4IX2A 4W89A 2GK1B 1J6PA 3AZRA 1E3ZA 3L65A 3S1XA 5ECVA 3A4JA 2J25A 3W0KA 3DIPA 1R2TA 1RH9A 1EJUC 3BUVA 4ZGYA 4PMXA 3SADA 1YDOA 2H8ZA 3KP1A 1E5JA 1G0CA 2G3MA 3EPNA 3SCVA 2DIJA 4FNSA 3LHVA 1AH0A 3JS3A 5I00A 4F3HA 1LWHA 3M44A 3W7RA 3UW6A 2PD9A 2Y0FA 3UG4A 3E1F1 1ENUA 3DFOA 4JTHA 1E9IA 2QULA 3E0FA 2IXVA 1TKKA 5AYYA 2YCIX 2WZHA 4QDMA 4J3UA 2IXUA 4HGXA 4AZGA 3QKZA 1ME7A 2CITA 3BWWA 1BWKA 1DP0A 4AD2A 3TQVA 2HPMA 3RM9A 3QQ1A 3TSMA 2PSNA 3FEQA 3W24A 2PS2A 3NAVA 4DNMA 1UA7A 1U1HA 3W3OA 3W00A 4JIPA 4LYRA 1KGWA 2OEMA 3TDFA 1XBZA 4UQDA 1CGXA 1KKRA 1AQHA 4LRSA 2R24A 2XFYA 2INFA 4NSBA 2Z4GA 4MYAA 4O1EA 3M5YA 4PCTA 4IQEA 2CLFA 5XIAA 2CZ5A 3W1RA 3GNPA 4ZO8A 3A5VA 1KTBA 2XH7A 4XB3A 3U8GA 3CWOX 3UY8A 5CGMA 4I5XA 5BROA 3WEMA 4MIMA 4XZHA 2YXOA 3T8QA 1US2A 2XIMA 2NSXA 3UR8A 4A35A 2Z1XA 1K77A 1T41A 4FZIA 3BICA 5CXPA 1W9VA 1WOBA 2W61A 4EAMA 3N2CA 1BTMA 1XIIA 1US3A 2XVNA 1P0KA 2EEXA 2FIQA 3LOTA 2CLMA 4UOQA 1F6PA 3EWYA 2JKEA 4IP7A 4A6GA 2WVUA 1NH6A 1UG6A 1OY0A 4V2XA 4AZCB 4Q8PA 1FWRA 3AMKA 3GDKA 3LY0A 3MC5A 4HOWA 3QLDA 2OQYA 4GK8A 2ZOXA 3D6NA 4NJGA 1ZP3A 3EWZA 1D3GA 5AHNA 5H6HA 3AXXA 1GVEA 2PA6A 4EPEC 2XUCA 1QPNA 3ITOA 3W1AA 4AZBA 4J2PA 3RHGA 8A3HA 3UERA 4LAMA 4D8LA 1HNYA 3ANUA 2JBMA 1NARA 3TW7A 3W7OA 3QFEA 2AL2B 5L9FA 3V0TA 1A5MC 1EP3A 4QIUA 1AQ0A 4F4RA 2QVNA 1OK4A 2VC7A 1L2QA 4IZGA 3G1RA 3LLDA 2BWGA 5F1VA 1DHKA 4YTRA 5A6BD 1YDNA 3D3AA 5HR7A 4MUPA 1OQFA 4ZXLA 3HV9A 3TFCA 3ALFA 2ZZ4A 3MY9A 4ICNA 5FF0A 1J0YA 1CXFA 4TVCA 4DN1A 4Z2KA 1EA9C 3PZMA 1UB3A 2DZUA 1EDGA 1UKSA 2FGZA 3DH7A 3KZSA 1POKA 4WLCA 3RAOA 1UZ4A 4LCSA 1B57A 3IUIA 4FNUA 4LB3A 4DI8A 4JYFA 1FH7A 2Y4SA 2ZRYA 3L7RA 4C5YA 1XPGA 5DT7A 4IUOA 1BF2A 2ONEA 1DJXA 3GTIA 2FPYA 2X30A 3MUZ1 3CV6A 3NQ8A 2W3ZA 2Y7GA 2VENA 1U5VA 2B7NA 3RJXA 3AMDA 1K03A 2GJXA 4PFHA 2HXUA 4L1XA 3KRUA 3ZT6A 4AFYA 4O12A 3TU9A 3H7VA 3HQNA 4JTUA 4F0KA 4QNWA 4H9MA 3W1LA 1W3TA 1JNEA 4W7UA 2NUYA 3ZWTA 5HQLA 4PRWA 3V35A 2HPIA 7ENLA 1KRBC 4INFA 4IT1A 4S3EA 1JIBA 1QNPA 1EJSC 4LVBA 1DJQA 3SM0A 2YCJA 3C2OA 3AIWA 6XIMA 3VDBA 4GCAA 4DJED 1KKOA 3AHTA 3V16A 1TPUA 4KFPA 2A7RA 3BURA 3VGDA 2PWUA 2BFGA 3GHUA 2CKSA 4UNIA 4JFVA 1GONA 1PIFA 1V0NA 3VUSA 5RUBA 3PZVA 3AI0A 3VKKA 3AUOA 2I5IA 1OGGA 4D8ZA 3H8AA 1EJVC 1U83A 3LSCA 3TSDA 3UNTA 3AS0A 3V18A 3W26A 2QCGA 3LCHA 1W1YA 3KBVA 3OB8A 1XIMA 1TV5A 1I0BA 3OIHA 3TONA 1KTCA 4QLKA 1KFBA 1JJKA 2QIIA 4LNCA 4AXNA 1Q8AA 2BGNE 3VCNA 1REQB 4J28A 4S39A 3W7JA 2OT0A 3EPMA 1OYAA 4Q7NA 2BX7A 1GNXA 4K68A 3PJWA 3AAMA 4C65A 3OODA 4MNMA 2YL6A 4PCFA 4G7EA 3ABSA 3R79A 2PGWA 3BLPX 4CU8A 4O54A 5K2ZA 5B80A 5K4ZA 2ATMA 3GG1A 3HGRA 1TTPA 4NUWA 1EHAA 5F1UA 1XLFA 1LZOA 3VKBA 5A2BA 3C6CA 4JX4A 3A64A 2FZBA 5EMJA 2PE4A 2ISSA 3NEVA 2X40A 1VZWA 2C6QA 4XZBA 2Y70A 3MP5A 4N9BA 1C8QA 1QMLA 3G1XA 3TZFA 1ZJHA 2OO6A 4FOJA 5KEZA 3TTEA 3QJAA 3WJZA 5LXEA 2E1DA 3DN5A 3TJ4A 4GVGA 1B3XA 2RH9A 5LNSA 3GFZA 4JICA 1BSLA 3ZLHA 1QPQA 3G1HA 2TRSA 3M9YA 2QJJA 1VLIA 4XD3A 3EX2A 3NSNA 4WDWA 2BTMA 4M51A 3FV9A 1HN1A 4ACZA 3ZVHB 4GH1A 1OFDA 1G9HA 4DWSA 4DZAA 3N1AA 4G2DA 5HQMA 3SIZA 3OGVA 1CENA 4JCLA 1WE5A 4L5ZA 1K6AA 3QMSA 1XV8A 2YA2A 1XKYA 1JCLA 1W1B1 4HKPA 1YE4A 2PDGA 3HQOA 2VFEA 1C8VA 5KETA 4PR4A 4O4VA 4RXFA 3AXKA 1XC4A 5HQEA 1BYCA 4S3FA 4C1LA 1WDDA 3T2OA 1O7AA 4HVXA 5I2UA 4HZ6A 4LB4A 3KW3A 4QDWA 3OYXA 4QTGA 2FH6A 3SY1A 4ZO9A 5IFTA 1LP6A 3GBEA 3RU6A 4ZO7A 4F0LA 5TAOA 3OQ8A 2ZRVA 1J5TA 4O1AA 1TV2A 1GZGA 1IE7C 4FXSA 1K8YA 4FLQA 4F2UA 4M6PA 2PWVA 3LCLA 3W71A 5IOBA 2PTZA 4MPQA 2ACQA 3DKLA 3E5PA 4CQAA 3UY7A 4ZVJA 2BVYA 1FDJA 2QVHA 2VFHA 3T08A 1KCLA 2C0HA 4R7JA 5C6MA 3A13A 3L66A 3NZ1A 4GUFA 3HQ1A 1Q6FA 3XISA 3DI0A 1XF0A 4RZ6A 4OVXA 3ARTA 2VXNA 4A3HA 3Q65A 2W4XA 3C2EA 4JTQA 4ZOCA 3WQ4A 4NYYA 2BOEX 1OX4B 4E4PA 2EJAA 3CBWA 5BRQA 1BRLA 3GIQA 3CHVA 2VURA 1XG3A 4JQ4A 5DFAA 1UP2A 1BQCA 2ZTJA 4EPKA 1XUUA 3AMLA 2NXGA 3PB0A 5A6MA 1TIMA 5FKYA 3C61A 1E9YB 1R9ZA 5D2VA 3QTPA 3ITCA 3O9NA 3V5FA 4Y8FA 2NVCA 3L12A 3TMQA 4M81A 1WQ5A 3F2BA 2GSHA 1Y5XA 3E2RA 4W88A 1PZ0A 3I7SA 4IQJA 5B7ZA 1W3NA 2NUWA 1ZBKA 3PK7A 1AJZA 4GIRA 4RZ4A 1NELA 5EKYA 3A9IA 3PUEA 3WBYA 2VVSA 3B04A 5A6AA 3COTA 3O6DA 2CBJA 4DJDA 4EE9A 4LUYA 3S8HA 3UVAA 1KRCC 1JCNA 2VT0A 2VEFA 3R1ZA 1CWYA 1XHGA 3MP4A 1SR0A 2V82A 3W83A 3C52A 3WELA 3B8TA 1LLOA 1KD0A 2ZX5A 4K36A 1KNWA 1O12A 1U33A 3REQB 3UJRA 3VNIA 4GJ1A 3RLVA 5CBBA 4PL2A 3AIBA 3FXGA 3LCFA 4WY0A 1ONXA 3E96A 3VPLA 4LNYA 3BQ5A 3H54A 1FXQA 4LF2A 1T6MA 1EC8A 2WKJA 4Z2JA 4HK7A 4XD5A 4LYPA 1DJGA 1S1PA 2PDXA 4B5TA 3TIMA 3PTMA 2XSAA 4UUIA 1K9FA 4GGHA 3CQ0A 1W2VA 1NEYA 4TMCA 2AQOA 4DIAA 3G0XA 2R14A 1FVPA 5CPSA 3CZ8A 4RW5A 3VK5A 1C3FA 4FAMA 2NXHA 5I3GA 3GX9A 3WK3A 2Q3RA 1LTDA 1QNOA 2GUYA 3H70A 4PGLA 4GVIA 3AS1A 2J7BA 1GYMA 2ZWZA 3SFWA 5BXTA 4ZQCA 4FB7A 5JBDA 3K30A 3HJEA 1UA3A 1YW1A 4DAFA 4ZB2A 1ESWA 1GJPA 2AMXA 2W9MA 2JFEX 1XGEA 4AIUA 2IQDA 3SSJA 3TMLA 1TTIA 2C1IA 4N2YA 2WZMA 1P4CA 3P67A 4WSKA 4AC1X 3QYQA 3S5OA 3LXCA 4RCXA 3MZNA 2ZE0A 4HYRA 2DUZA 1VIZA 2G3NA 1MXGA 1UHVA 1A5LC 3D46A 1LG2A 2JGQA 3EOEA 3LGDA 1TPDA 4IFOA 4UTWA 3AIQA 1JCMP 5BRPA 1PKLA 1ELSA 4G8TA 3RM4A 3LRMA 2OZ8A 4O0KA 1Y5WA 4KIEA 4O0ZA 2OX1A 5C9XA 1S5TA 3EWWA 3N17A 4E5TA 1C90A 1GQNA 1QNRA 3SCUA 3W01A 1U2YA 1W9PA 4RJEA 1XX1A 4PUMA 4HSNA 1JULA 1UWUA 1K3UA 1Y8BA 2OWWA 1AW1A 5I02A 4JCMA 2P0OA 3T2QA 2OSWA 4KEUA 2HROA 5JU6A 4UTTA 4MB3A 3CV7A 5D9NA 3BTNA 1QATA 1PKNA 2Y6ZA 4DXKA 3H2FA 1X97A 1TV7A 1A5CA 2DT2A 2DZTA 3B9EA 1J93A 2I7GA 1N7KA 2CLPA 3VIMA 1AVAA 8CGTA 4J3VA 3PBMA 5CPOA 1ZAJA 3VINA 5JVLA 1OZQA 3CV1A 3MMWA 1W9BM 5I3IA 1YQ2A 3BSHA 2A0NA 3UZZA 4J4KA 1NOUA 3CPGA 3R89A 4GRSA 1B31A 2ISFA 4A22A 2QW5A 4GLEA 2YXGA 5IRPA 1QJWA 1ZP4A 3DFQA 3MDWA 4B2DA 2Z6JA 1ZGDA 3VDHA 3ZWSA 1VS1A 3UWQA 3HPSA 4QAIA 1RR2A 4QGCA 2ZXQA 4I5UA 2G3FA 3P14A 3TXZA 1FWGC 4ZMGA 1OCJA 1GTHA 1MXSA 3M1ZA 1W5OA 3DERA 3E5BA 2PB1A 1WP6A 3HF3A 3SBFA 3CQIA 5D2YA 3L5AA 3W88A 3AYTA 4GUIA 2ZUTA 2E8YA 3M0JA 4U10A 4IPLA 4IL2A 1I2PA 4Q4RA 4AAJA 3QLLA 3MA8A 3K5XA 1WAUA 4AH7A 1F05A 3BLFA 3C2FA 1EPVA 1ICQA 1I9CB 4BJHA 2NT0A 2FB3A 2V63A 1HL9A 1AW2A 4GJJA 4LAZA 3SGZA 3WD1A 1IR2A 2VD8A 5A8MA 3AALA 2NX1A 1CT5A 5AHEA 4LY8A 1WO2A 3T4CA 1DIEA 4GNVA 2HQAA 1AZ2A 3F7JA 3F5KA 2OEJA 4E8CA 4ZFMA 3V1PA 2WLZA 3CHEA 4O18A 1TB3A 1FKWA 3GXIA 1ISYA 1E3XA 2FJKA 1SMDA 2FMNA 3A3XA 1HKIA 3YPIA 1J11A 2GVEA 3LM7A 3TYZA 3K8MA 1Z7AA 1O4UA 2Z1SA 3VNDA 3IGSA 4U3CA 1G7UA 3GTNA 4V15A 3HG2A 3EDKA 3NQCA 2EBNA 4I8DA 3RR4A 4AIOA 4QJ5B 3GHTA 1P0NA 4DZHA 2GZXA 4JIHA 3ZVIA 1ZY9A 4XIMA 3MYPA 4DJFC 1XSKA 4AG0A 2ZWYA 1K02A 2UWFA 3URQA 1PPIA 4IL0A 1TTJA 1YDVA 1FWJC 3RPTA 3MWCA 1Q66A 4CCDA 5E5CA 3QV7A 1R3TA 3DXIA 3S2CA 4ATLA 1XSJA 3DUGA 1U5HA 3EB2A 1K70A 1IEQA 3O07A 1V6TA 3PWIA 1BD0A 4X63A 3UZYA 1CEOA 1W5MA 3GHSA 2OKOA 3MJMA 3EPOA 4UTFA 4GA8A 3S1UA 3HFTA 1KFJA 5AHMA 2Z1VA 2CFFA 3IJ7A 1OK6A 4RW3A 3S5NA 5FAGA 2OLSA 1ZENA 4Y6GA 1LBLA 2RFGA 4WJXA 3BARA 5A8OA 3KVKA 2YL9A 5G2HA 1R9XA 1FHUA 1TE6A 1XLJA 2EPMX 2DZPA 5BW6A 3LMYA 3NDYA 1LORA 3LU2A 5CEWA 5I03A 1VYSX 2HBXA 4IJBA 5A8QA 4CCEA 1KWKA 2RDWA 3M0KA 1OG0A 2DIKA 2CLIA 3QR3A 4R53A 4GYJA 1EYEA 5DQPA 4ERGA 3UFYA 4TMBA 3GSMA 4JX6A 1UIPA 1W17A 2Q3OA 4NF7A 5IFPA 3WO8A 2E4TA 3SCPA 3K1DA 3UR7A 4C1KA 2WZEA 2E0PA 3CM4A 1P0EA 3VE9A 3TXVA 1XFBA 1NDVA 1PDZA 2VYOA 5D4YA 1LYXA 4JKLA 1NFGA 3FW6A 1CLVA 5D30A 2CZEA 5EMKA 1D3HA 1TCDA 4U28A 1XLEA 1DWJM 4RE4A 3DENA 1V4YA 5K9XA 3WLPA 1A4MA 3TSBA 4AY8A 3F1QA 1LDCA 2BHZA 2P53A 4E3TA 4PCSA 4GC4A 8XIAA 3EB4A 2VDGA 3O15A 1AJ2A 3BE7A 3DZ1A 1PTGA 5CPLA 3CNYA 4MWAC 1HGWA 3ABZA 4YN5A 1U1UA 3B05A 1E70M 4BQ5A 4IG2B 3B9DA 3WMBA 1Q13A 2PC8A 2A21A 4JFSA 1EF3A 1K4HA 3AWNA 4DBDA 3W2KA 1QO2A 3B8WA 4ROQA 1T99A 1FHDA 1I45A 3QY7A 4JTCA 4JNYA 2OZTA 5D05A 4OUEA 1M04A 4XZLX 2INEA 2OR2A 4MM1A 2J6VA 2NWRA 3ATZA 3N3TA 2GGHA 2BG5A 4GI4A 1XLKA 3PVFA 4TR9A 1TQXA 3UPMA 4DZ5A 4R85A 4ENLA 3A9BA 2YGYA 5PTDA 1JDEA 2IPFA 1TWIA 3FDKA 2YCLA 2XWEA 2C3ZA 2OWXA 2PRLA 4E3VA 4ZOEA 1V93A 4H9UA 2J79A 5G4EA 1JZ5A 4HCHA 3T2PA 2PMQA 3N4FA 2WC7A 2X8RA 3B4YA 4LS2A 1NAL1 3T44A 2PWFA 3GVRA 4C91A 3DDMA 2YKKA 4EPBC 4S2BA 1E6ZA 3OZPA 2CYGA 1A5OC 3V36A 2Y8VA 5C5YA 1OIMA 1GVIA 3TTSA 1A5NC 5C7HA 1TVLA 1RVKA 4KETA 1E43A 1CW2A 3EX3A 4NNAA 3NZQA 1FWTA 4Q4QA 1FXPA 1P7TA 4I7VA 3GLCA 5A5WA 3IJLA 2D0HA 4MMWA 3GVQA 4JTAA 2PBGA 3WD0A 4GUJA 1DJZA 4YWIA 3WLSA 2PUZA 1RA5A 4W7VA 1ZALA 3NXLA 1T40A 3WKZA 4DWSD 3WQOA 1CIUA 1FWHC 3EA2A 3W4RA 4ADTA 3GTHA 2XSBA 4M7TA 4MWAE 5M17A 1MRAA 3POHA 1B4KA 3B8VA 3VD4A 3HGSA 4K7VA 1TPVA 2VFFA 5HDRA 1MVYA 1H1NA 4QBXA 3PUGA 4ZQPA 4BA0A 1DBTA 2ZA3A 2CEQA 4UTHA 4PODA 5FEXA 4ZR8A 2WSKA 3PZ9A 4HIBA 1QI0A 3IV8A 1SU5A 1QVBA 3T05A 4OUIA 3UJFA 3O6YX 3PTQA 4LUIA 1D9EA 1XYFA 1Q6DA 5HWNA 4O1BA 1TX0A 2CERA 2QF7A 1KA9F 1QBAA 3WJWA 2ESCA 4EANA 1QHZA 4A8RA 5DANA 4B15A 4I5RA 5GNZA 2AQWA 1SYTA 5CQ1A 2HS6A 1ZSXA 2YR1A 4IICA 4PMZA 3KBWA 5BOEA 3IPWA 3SN1A 1ZS2A 4AZ7A 1QO5A 2VC5A 1D8CA 4HB7A 4PMJA 4OJYA 4AD0A 4ZOBA 4BFAA 4JN6A 3OHMB 1H0IA 3PNZA 4DAIA 2XG9A 1W8GA 1CXIA 3JUGA 5BOFA 3ES7A 1IEWA 4QSHA 5JIPA 2F2KA 2VRJA 3LUTA 1HO4A 3GC4A 1IV8A 3TNBA 1CLKA 5F2MA 1TCMA 4UB9A 4U3AA 3PTKA 3T4WA 1GK8A 4FX8A 1EGMA 2MUCA 3KBJA 1K8XA 3TN4A 2FVLA 4DO6A 3WF1A 3O6CA 4IQDA 3KBMA 1E71M 3RPDA 1UKPA 1EC9A 4HNTA 4NZ1A 4J27A 4CEXC 5I78A 1ISZA 3W7PA 3FOKA 2PDQA 1UMYA 1POJA 2ACRA 4NJJA 2B7PA 1K7EA 3F2CA 4I8YA 2O9OA 2DZVA 3S1VA 4KEVA 1BYDA 3MVTA 2VX5A 2BVDA 5D03A 4TX6A 2CBVA 1IQ8A 1EWDA 3U0HA 4HPHA 3BJSA 1Q2RA 3ZJ6A 3K13A 1E6NA 5CPQA 2R1PA 2EJ1A 2NV1A 3PFMA 4QR6A 1BF6A 1JG9A 1R6WA 4N4PA 5E9XA 1V3JA 2V9DA 1NOFA 1NDYA 1VRXA 3NNTA 4GKTA 5HMDA 5IXEA 4QE5A 2JGYA 1GUVA 2GVJA 2JE8A 2E28A 4PUEA 1UROA 4WKAA 1IGSA 1A3WA 3E6EA 3BANA 4LGXA 3U5UA 3KL3A 4F9JA 3VX1A 3O16A 5LXXA 2XIIA 1TPFA 5I3HA 2J7EA 3MUXA 2CETA 3GZAA 5AZ1A 1FUYA 1TWWA 1ZJBA 3ALGA 4L9ZA 3CHCA 2AGTA 1QOPA 1S46A 2NQ5A 3SCRA 4JTRA 5AC6A 4D1JA 2WC4A 4W5UA 1X6LA 3I4EA 2HRWA 1B3OA 3HIJA 1XDMA 1HG3A 1J0IA 2WO5A 1SZRA 3SQMA 5DF0A 2FYMA 3B3DA 4JTKA 8RUCA 1TO3A 2GLKA 4JFWA 3C3NA 3L9CA 4FXRA 5AECA 3QBUA 1GEHA 3O05A 3EEZA 2E6YA 4H83A 3VTRA 5F2GA 2HDJA 5HR6A 2YIHA 1H61A 3W2JA 2RDXA 4I3GA 4AEEA 3T78A 1SO5A 4IWWA 4PMNA 1SW7A 2ZUUA 1W1PA 3RIKA 5I07A 1CPUA 2OYMA 1SZEA 3KOXA 2ZC8A 5EFDA 3P0XA 1PV8A 4N42A 3ARSA 4C6NA 1JPKA 2OODA 3QSTA 3PB2A 5AVNA 3VMPA 2MANA 2H90A 4UTIA 4B3LA 3KFTA 1TA3B 1JPMA 1E4MM 2WKLA 2XYLA 3FA5A 1ZU8A 4W8BA 3VGBA 2EPLX 1K9DA 4DUXA 3POCA 2CZFA 1S38A 2HEJA 1YBQB 4DZIA 2RDUA 4LU0A 2PLJA 4F2TA 1M7JA 3NGJA 4Q6XA 2OB3A 3S9IA 1PCWA 3T6CA 3QF0A 3U9IA 5A2CA 1H49A 1HQTA 3PJXA 4MKSA 3WBEA 3BW3A 3ATYA 2EPOA 5BOOA 4B5XA 5FEPA 1MW1A 5KZDA 1H7XA 1VPQA 2A3LA 3PJUA 3JU2A 3ZM8A 2PGEA 2XH0A 2DVTA 4CN4A 2YX0A 2C18A 3VX0A 4M0XA 2XN0A 3UJ2A 4LY4A 1FCUA 3O63A 3CK5A 3CZGA 4U33A 3SECA 3NQ2A 4M6QA 1PDYA 4WGHA 1S2CA 1EEPA 3FVDA 1Q6OA 4S3BA 1GOXA 4HK6A 1VH7A 1UOZA 3S6DA 3ARVA 3GW3A 4IIEA 2ZXBA 1JI2A 3C8FA 2PLKA 1UR9A 3PPGA 4GZEA 4BZYA 3SI9A 4C90A 1UWTA 2X41A 4HJWA 1LF1A 2QPXA 3ZZ1A 3Q4DA 4G7FA 2V3FA 3UWYA 1HKWA 3C2RA 4DLFA 5FEZA 1KRMA 3WZ0E 2V69A 3W22A 3QKEA 4NZ3A 1MYRA 1Y65A 3KVLA 4P2VA 2WZIA 5G2WA 1HP4A 2G8ZA 2CW6A 3LNMA 1KW1A 3MBFA 1RCOB 5HNRA 1JPIA 1E6PA 3VDCA 3H26A 1FH9A 4AB4A 3BPWA 4OHQA 3WLRA 3N6HA 4XK2A 5CZTA 5LHEA 3EOUA 4DM2A 1ONEA 4QP0A 4Z0SA 3NZRA 3P3BA 1JYWA 1AMYA 1JDDA 3N6QA 1ODUA 3G8EA 1NVMA 3S9YA 1HKKA 3APTA 1QNSA 1TRIA 1J01A 3PBUA 3UESA 4RDZA 3BGGA 5ABEA 3WJSA 3JZEA 1P6BA 5K3VA 4DXXA 4ZQMA 3IVTA 4UR7A 4N02A 4GINA 1SFJA 2YBTA 5AC8A 1Q6GA 1G94A 3UXLA 2L5HA 5E93A 3GDBA 4GQRA 3CJPA 2E6DA 3WFZA 1DJNA 3UYCA 2VWSA 2BVTA 5G5IA 5I06A 2DQWA 3WQ8A 3CHFA 2XIBA 1SPQA 2I9EA 4HQVA 3JZUA 1FWDC 4OU1A 2UBPC 1RXOB 1OFBA 3WLNA 3AC0A 3L67A 2OMAA 3LRKA 1Q6RA 3MZ2A 2J77A 1XYLA 2C7FA 3LZ3A 4JY9A 2GOUA 3BG5A 4IP5A 3TLQA 1N8IA 3TN5A 1IXOA 1DEDA 3P7YA 1YXCA 3NO3A 4KT2A 3ARXA 3NVTA 1S2AA 4RKAA 1GZJA 1DWHM 1KM5A 4RDYA 2Z6IA 2GGGA 1HKMA 4E2DA 3UXDA 4JTGA 1IGWA 5AC4A 1OT2A 1XYCA 1PHQA 3NQAA 1IR1A 1FWSA 4GE8A 1Z3NA 2G95A 1M01A 1TQJA 2JK2A 3CT7A 1WPCA 4IPNB 3SY5A 5D2WA 4BR1A 1UD6A 3C0QA 3RFAA 3F4NA 5K9CA 3L4TA 1ME8A 1TX2A 1E4LA 2ZVIA 3PZNA 8XIMA 2QGHA 4MY8A 2WYSA 3UJSA 4G1KA 4UWMA 1UR1A 1BXBA 3SCTA 1XH2A 4BK9A 1IF2A 1R8LA 5DRCA 1UJPA 3PBWA 1IZCA 4DJFA 2P8BA 5KZMA 1RPXA 2J75A 1TTQA 4AD3A 4WKHA 1MUMA 2ALRA 1KXQA 2OGYA 2J13A 3THCA 5LNWA 3HTWA 2QZRA 3NVDA 3VZZA 1X7IA 3L2IA 1NIUA 1LROA 2XN2A 3CEUA 3WNMA 5HINA 4W84A 5REQA 4ACZB 3VO0A 1Z69A 2AL2A 2C16A 4S3DA 3WH7A 4S3KA 2QUNA 2WAGA 4IPPA 4XZMX 5D32A 2A3CA 3G1VA 3LEPA 1UBSA 5G1TA 1EGZA 1R2RA 4QG9A 5D02A 2ISVA 1EJTC 4C6MA 1FP8A 2J62A 2QCDA 2QCNA 3BO9A 1BG4A 3C8NA 4NHVA 3L4WA 4LBUA 3TA6A 3EX6A 4G9PA 3CWHA 2X2GA 3GYEA 3EKGA 1PB0A 3WG6A 2OT1A 3LPFA 4LS1A 2FPVA 1R38A 4FSAA 1VFTA 3TLLA 2J7CA 3RILA 4JBRA 1KR1A 1JPHA 3DFSA 5DT5A 1VBRA 2OOFA 2VZUA 3MSYA 1H51A 4S3JA 1OCBA 1O5QA 1HJQA 2H9AB 1F73A 2Z28A 4CKQA 4CCZA 3MHFA 4DUOA 3MJYA 4XZWA 3DFTA 2CBUA 2IPWA 1QK0A 4FNQA 2J24A 1A47A 3FHAA 4A3RA 1EH9A 4RL3A 1UWSA 3WDRA 2R1LA 2Y8KA 4US5A 2Z29A 1PZ2A 1GG1A 1W1A1 3AXMA 3AYVA 3VCCA 4EXBA 1G67A 4UCFA 3W74A 1DORA 3N4AA 1Q7ZA 1FWIC 2VR2A 3UWEA 2ZRXA 5KITA 4V28A 4QLJA 1UD3A 1SO4A 4L1WA 1KV5A 2V30A 1UR2A 1DWAM 2HBVA 3VGGA 2DUXA 5I0DA 2J7FA 4LAUA 3M0LA 2Y8UA 4JTLA 1A80A 1I0DA 2I17A 2PDPA 1UZDA 3DYMA 4J3ZA 1XCWA 1TJ1A 4R5EA 1VAHA 3WEOA 3UWUA 4Z1YA 3OTRA 2PRHA 1OF8A 2G3JA 4XUYA 4ZOAA 2ZZ1A 4QE1A 1E1CB 4R3UA 1EO7A 3H12A 1UPPA 1GKPA 3VKDA 5DO8A 3WF3A 4EX4A 4E0CA 3K8LA 3WNKA 1SVDA 1OG6A 1E51A 3A6OA 4CNUA 4KCTA 4ZSUA 4PTVA 3AMGA 4BF9A 4D2JA 3L4UA 3NXFA 1EOKA 1QU4A 4J3XA 4IX0A 3KTCA 4ZB0A 1QOXA 2PTXA 3AO0A 3U48A 2BY3A 1GVRA 5C8BB 3B0PA 2NLIA 2H9AA 5CBIA 3ERPA 2GQ8A 4RNIA 1GPWA 1KBLA 2XGBA 4HHMA 4XV0A 1Z41A 1M53A 4UMAA 4X60A 3BOLA 2BY2A 2ZX9A 5AOUA 3DECA 4HPJA 3OA3A 2DIEA 4F0SA 3CAVA 3F5LA 2JF6A 3U5YA 1AL7A 1G4SA 2VEPA 4UTMA 1GCYA 4LAKA 1THFD 3BDKA 1HVXA 2E9LA 5IDIA 4PTMA 3W1QA 1MFVA 2NQZA 1EWEA 4U31A 3LYEA 3B8UA 4US6A 4YWSA 1G1YA 1OD8A 2PDUA 5EMMA 4DJEC 2I57A 1SO3A 2PDYA 1B1YA 1OJXA 3WQVA 1T8XA 3CL6A 4P8WA 1NQKA 1LT7A 4C6DA 2VGFA 3B97A 2PDJA 5DCBA 1LL6A 3LCWA 2QT3A 4ZTYA 1UPMB 5CGTA 2PU0A 2QDEA 3MW7A 3MO7A 4LC8A 4GYKA 5GJMA 5K7JA 1KBJA 4DWDA 3WH8A 2JEQA 2AAAA 1XIDA 1MEIA 4A21A 2D1ZA 3PSWA 2HK1A 1GYLA 4HPGA 1G6CA 2IKIA 2GVLA 4NXKA 2Q8ZA 4FMVA 4K1GA 3T0CA 1M7XA 4LUTB 4L4OA 3LB0A 1Q5MA 1XGDA 1ONWA 1OVDA 1DWIM 4AWSA 2VVNA 4PMRA 4LTSA 2WXDM 2XIOA 3GD6A 2CLOA 4UZSA 3R11A 3PUDA 2Y62A 4JFTA 4O4WA 2Z00A 4GYPC 4N9CA 1P1XA 3OBAA 1WBJA 2A2IA 4HNCA 2E7FA 1NWSA 7A3HA 5J8LA 5JH1A 1B3YA 2E5DA 1ZAIA 5JUVA 1HO1A 3WLTA 1HGYA 1EUNA 3GYCA 4O19A 1E55A 3NTYA 2XHYA 2F84A 3F03K 6REQA 4WJEA 2OG9A 1GJWA 3H7UA 3RM8A 3THQA 4YCPA 3INPA 1WXZA 1IXNA 3SGUA 1W6TA 4QAWA 3M0MA 2IMRA 4Q6JA 3CO8A 5H91A 2YLAA 3OO2A 2BY1A 4J2MA 2GUUA 4JHZA 4ZENA 2E25A 4HJFA 4Q8TA 3ZOAA 4AHPA 3WBXA 2QCDB 4Y8EA 4QS6A 2VFIA 1ZZMA 3MMUA 3DFPA 2QJMA 4R33A 4XX6A 2GGJA 2X2YA 3M41A 2XIQA 3DYPA 1R47A 3FKRA 3PG9A 3W7GA 2PP1A 3LQLA 3NQDA 3TTYA 3BAJA 2Y24A 4LUSA 3IRSA 3W28A 2H6RA 1LRTA 3I10A 1X1NA 3FAWA 2PZNA 3DFNA 4QJ3B 1DE6A 3KTXA 2VRKA 3W2MA 1XH1A 1PX3A 1O5RA 4EF9A 4RX0A 1EB3A 4GPNA 3WX7A 4TX9A 2Q02A 4TVUA 1WDPA 2D20A 1FWAC 3U2OA 4NG3A 3S2MA 3LZ5A 1OINA 4O8RA 1OC6A 1O6IA 3RLUA 2PDHA 2R8WA 4KCVA 3EBVA 1A49A 2V6AA 3GXFA 4UOZA 4AWEA 4GBUA 1LRQA 3OIXA 2PTDA 1BEUA 3UA3A 3GVGA 1CGYA 3TH6A 4Z2LA 1AUSL 2BXYA 4JNZA 2FGBA 3VIPA 1N8FA 4QISA 3UJEA 1RA0A 3L0NA 3KM8A 4YLWA 4E4FA 3TN3A 2FZDA 1XG4A 1DV7A 3ISIX 1RHCA 4E8GA 4QDPA 2V5JA 3OLDA 1J12A 5KTLA 1J4EA 3VM7A 1UOKA 3TW6A 3I3DA 4JZ5A 4RNHA 4O1CA 1QBBA 3CUIA 1HFBA 1Z6KA 2ZUNA 2QUTA 2XN1A 1H7WA 1RLCL 3M0YA 5GNXA 3NQGA 3FKKA 1TZ9A 4R88A 1HJSA 1PTAA 3LQGA 1JEZA 2XDFA 5EFFA 1CDGA 1Z44A 3FGCA 4K39A 2I14A 3B0XA 2B81A 1J0KA 3UWZA 3F5JA 4XBSA 5IBXC 3WFLA 4BF5A 4HNNA 2GGEA 4UNLA 5FJJA 3S2JA 1VJIA 3IAQA 2BDQA 1EYWA 2E5BA 3TJXA 2Z25A 1JRCA 3EXRA 1HXJA 4J3WA 1KM3A 1EPXA 3TQ0A 3KWXA 1GEQA 4UIOA 2F6XA 1RUSA 3FVMA 3NQVA 2DPEA 2O9TA 2QMKA 1VPYA 1VFUA 1Q2SA 3C0JA 5I23A 5KSWA 3CL7A 3CEPA 4W86A 5BRBA 3WUFA 2FTYA 1ZCOA 4GXMA 4DEFA 1L2UA 4N6EA 1GGOA 3N73A 4JIEA 4B9YA 1UUOA 1W9UA 3B4UA 4DY1A 2DZSA 1AD4A 3ITXA 5I3JA 5H8UA 2DZBA 3G0UA 2VMFA 5GJNA 3LA4A 1GVFA 1XC6A 3MDUA 3KBNA 1QPOA 4RK8A 4DYJA 1S3HA 5FJPA 5HMSA 3GS6A 3OA5A 3VNKA 2CHNA 4WKFA 3FJ6A 3TYUA 3ZJ7A 1XWYA 3CTLA 1JF5A 1O66A 3LNPA 2WVVA 4I6KA 3FSTA 4YS1A 4KF1A 3N34A 2ZIDA 1MW0A 2W62A 2WVSA 2G96A 1TWDA 4L65A 3PC0A 1E0TA 4S3CA 3CB3A 1RSCA 3BC9A 3FGCB 1T8QA 3DCPA 2J47A 3CQKA 3K1GA 1YX1A 1QXLA 5DCEA 4XQ6A 1JUKA 4P61A 2WSPA 1XISA 3W1PA 2QCCA 4DB7A 5I09A 1ZHAA 1PX8A 5JIWA 3GR7A 5BZAA 4MAVA 4FALA 4IXXA 1IYXA 2E6AA 4WXYA 1DXFA 1HP5A 1OB0A 3T0AA 3IUDA 1HUVA 5AB3A 3KUMA 2DJLA 1EF2A 2R1NA 2OELA 2ZC1A 2ZRWA 2X1SA 4HNOA 3QOMA 2ON3A 3PF3A 4HYWA 3NL5A 3PZUA 3F4CA 1S2UA 3CGTA 4TV6A 4IMDA 1H4PA 2V3GA 4PMQA 5A69A 3WH9A 2A3BA 3PAJA 2IKGA 3JR2A 2BV9A 3I4KA 5T9CE 5FSEC 1GOWA 5LKYA 2ZUWA 4PSPA 1VFLA 2EPNA 4F2BA 4GYFA 3ZR5A 3LTYA 4XBKA 5A6TC 5C9ZA 1TMHA 1I2OA 3TOYA 4KBXA 4C1NB 3MI6A 3OZYA 4UFHA 1IEVA 4LVAA 2NQHA 3GRIA 4E2BA 1F74A 1MNSA 2GPTA 2E5CA 4J7RA 3TWAA 2OEKA 3HOJA 2F8QA 4M24A 2DFAA 2FLIA 3BJFA 2YW4A 3VM5A 3B9AA 2D0FA 3A3HA 3N9SA 4B5WA 3WY1A 1EFZA 2VTFA 2R1MA 4YTUA 4B2DD 2D2GA 4XVDA 2VC6A 3IACA 4FA3A 4X9SA 5BWAA 2I1OA 3LDVA 4M29A 4NZJA 4C6FA 2RUSA 6TAAA 3KL0A 3L5LA 1WOAA 3CMGA 1RVGA 4XAZA 4CD7A 3W02A 1M7OA 3GY1A 3CAQA 3VC6A 3GDRA 4MY1A 3N2BA 4C6BA 5LNRA 4BY3A 4L61A 1R7AA 5EBUA 2FFCA 1YEYA 1F6KA 3N2MA 3GVVA 2FZ8A 5D9OA 4JGDA 1L8NA 5BNKA 1VENA 3W7QA 4WHBA 3P80A 1EEXA 1ECQA 1HZYA 1W1IE 1XBYA 2E68A 3TROA 4H2CA 4YTSA 4E4UA 3P81A 4Y9AA 2G5WA 1LL4A 4F66A 1W1VA 3CLMA 4AMAA 3QHNA 3SQSA 2I5QA 4EP8C 4CNNA 1E6SM 1A3XA 2Z1WA 2DY3A 1AMKA 5CAHA 1JL8A 4DXVA 3STEA 4W8LA 3MHGA 4B16A 6TIMA 1D8WA 5U4NA 4GZJA 1SJDA 2WM1A 3RCYA 4JIQA 3WCZA 5JXQA 2DVXA 3G18A 4CD4A 2HMCA 3W53A 4A29A 4GC3A 3R8HA 1A53A 2G4FA 2REQA 3CLWA 2WSQA 4AWUA 1JZ2A 5CJNA 1JQXA 2DT1A 3BGJA 2PBOA 3KCOA 2V8ZA 1OZMA 3LGEA 3WDHA 3OGSA 2UV8G 3B0YA 2DJXA 2QCMA 3EMCA 4WZHA 3LERA 4PN2A 1P43A 2DZWA 3UNDA 1VGAA 3T55A 4O1FA 2WNNA 4IG2A 4JAWA 3KOZA 3KWSA 2DT3A 2VWTA 4DF1A 3ARPA 2Q8LA 1YPIA 2GJRA 3MTWA 4E8DA 3M46A 1XINA 4AZ6A 5E0KA 4YL2A 3R10A 4IXHA 1WZMA 4YPJA 3C86A 4QQUA 3W1UA 3WLOA 5M3WA 1X6NA 4QCEA 2EF9A 4MFDA 3S46A 1X38A 1H62A 1SMAA 1VB9A 4PA8A 2WPBA 2WJDA 4AF0B 4CLMA 3A47A 3I68A 4KERA 1DTUA 2GJNA 3BW4A 3PAOA 4S3AA 2CIPA 1UP0A 5TNVA 2YCLB 1Q45A 1XJBA 5FJIA 1JZ3A 2HE8A 1FA2A 3MMTA 3SUWA 2QDGA 3UU0A 4OKDA 1NDZA 5FA5A 1VHCA 1PEZA 3TC6A 1NFPA 2GUBA 2VL4A 2TYSA 3R43A 1MW3A 4EIVA 4G6CA 3K4DA 1VEPA 5EL1A 5A8PA 1H1YA 3WQDA 2GWNA 4B4HA 4Q8OA 3UF9A 5BCAA 2QV5A 1W2PA 3B9NA 1PCKA 1QDSA 3H4XA 3VIKA 2P1FA 2Y7FA 6CGTA 4KEZA 5CAKA 1KFWA 2KZHA 5EMLA 1GOKA 4HMCA 2PGRA 2QJNA 3BQ6A 4PB4A 3T0BA 1BAGA 3R7MA 4WIWA 2I56A 5C70A 1HT6A 3TFXA 3EDJA 3MUCA 3URAA 2VX6A 1JAKA 4WUIA 2BGSA 3URNA 3WSUA 2BVWA 2Z24A 1IIHA 1ZBWA 3GUGA 1QPKA 4QXIA 4ZL1A 3L4YA 1JUEA 1YDYA 2O55A 1VBGA 1XIBA 2A3HA 1V08A 4GIAA 4MFEA 3OEXA 4MWAB 3VABA 2WZTA 5A95