2R94A

Crystal structure of kd(p)ga from t.tenax
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
286
structure length
286
Chain Sequence
b'MEIVAPVITTFRGGRLDPELFANHVKNITSKGVDVVFVAGTTGLGPALSLQEKMELTDAATSAARRVIVQVASLNADEAIALAKYAESRGAEAVASLPPYYFPRLSERQIAKYFRDLCSAVSIPVFLYNYPAAVGRDVDARAAKELGCIRGVKDTNESLAHTLAYKRYLPQARVYNGSDSLVFASFAVRLDGVVASSANYLPELLAGIRDAVAAGDIERARSLQFLLDEIVESARHIGYAAAVYELVEIFQGYEAGEPRGPVYPLDPEEKAWLRAAVAKAKSQLRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-Keto-3-deoxy-(6-phospho-)gluconate aldolase
publication title Crystal structure and stereochemical studies of KD(P)G aldolase from Thermoproteus tenax.
pubmed doi rcsb
source organism Thermoproteus tenax
molecule tags Lyase
total genus 111
structure length 286
sequence length 286
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.14: 2-dehydro-3-deoxy-phosphogluconate aldolase.
pdb deposition date 2007-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2r94A00
1X8FA 4L4LA 2X1SA 4WY0F 1X6UA 4K7VA 2NX1A 1W54A 4I7VA 1JQVA 3QQ1A 2E6DA 2YYUA 2EF9A 1Q6RA 4YMZA 3C2FA 4JEQA 2DZUA 2E5DA 4O17A 1SO3A 4X22A 3W71A 4OHQA 1TMHA 1OHLA 3BG5A 2PURA 1SPQA 4K39A 2Z0IA 4NT0A 4LUIA 2CZFA 3CIWA 1WBHA 4WXYA 1N8FA 5HUOA 1DJQA 3W1QA 3M5ZA 3TQKA 2H8XA 4IUOA 5LNRA 4CCCA 4JTLA 1IIGA 4UTHA 5SWUA 2G95A 5CZJA 2ZDRA 1H5YA 5A5WA 1UJPA 1I2RA 2DZXA 1SUXA 4O52A 4LS1A 4P2VA 1F7BA 4NJJA 2QCHA 1CX9A 5FF0A 5TQLA 3BG9A 2A7RA 5CPOA 4UNKA 5AC6A 3VI2A 4LVBA 4TO8A 3USBA 3PF3A 5GVJA 3FOKA 3PM6A 3QF0A 1NF7A 3MHGA 1TTPA 2C16A 3CB8A 2C19A 1TV8A 4FO4A 1H1ZA 3HQ1A 4HN4A 4LVGA 1T99A 1IIHA 1W1ZA 3NM1A 3VE9A 4EOUA 3FEMA 4MKNA 5HINA 3L5LA 1VCFA 3GDLA 5FF3A 1TV7A 1NF0A 3M5YA 2A2IA 1KA9F 1I2OA 1TQXA 1Q45A 1QFEA 3G1FA 1QR7A 4DF0A 1Z41A 3EWBX 2V5LA 3F4WA 1KFCA 4JICA 2EGZA 3DFSA 1GVFA 1KTCA 1DHPA 1T8XA 4UIOA 3W1RA 2E68A 4NJIA 4WJEA 3KRSA 2YYTA 1ALDA 2FB2A 1MXSA 2HS8A 3N9RA 4GRSA 1DBTA 2ZZ3A 4MJMA 1FCBA 2QCCA 4FHAA 3BLIA 4WZHA 3NQ7A 3MP5A 3TX9A 3W1MA 4RZ5A 1NEYA 2DZPA 4LU0A 3MYOA 3M0ZA 3DXIA 4ADUA 3LLFA 2E6FA 3TAKA 1YPIA 1QPOA 1DKWA 5LNWA 3L0GA 3NQAA 2R8WA 1LOLA 3FYOA 1SO5A 1JCNA 1W5PA 5KZEA 1T96A 3TJLA 2VEIA 5FEWA 3M5XA 5U7SA 1XDLA 3O6DA 3W07A 1KM4A 1B4EA 3IIXA 1P1XA 5FESA 3GXTA 1W3NA 3LHZA 4NJKA 1KM3A 2PRHA 4D2JA 4Q33A 3HB9A 4I7WA 3G1VA 1OVDA 3S0CA 4UTWA 3BPWA 4AF0B 2QAPA 3A22A 3HGJA 2QUTA 1VYRA 3NAVA 1W5QA 2C6QA 3GNNA 1PCKA 1PHWA 3W2UA 3H53A 1OX5A 3LTYA 1W5OA 3LHVA 2Z6IA 3TNOA 1XC4A 3ZR4A 3N9SA 4IXHA 4H3DA 4M6PA 1AMKA 3L67A 4K8HA 2LLEA 3UY7A 3YPIA 1H1YA 3ZS4A 1W31A 1G4EA 5CPNA 3W72A 1LBMA 4BI6A 3NQMA 2QR6A 5L9FA 4ICNA 4O8RA 4AAJA 3KVJA 3RF9A 1PVNA 5BOOA 3TJXA 3T7VA 2C13A 1YDVA 2P1FA 3OEXA 4FNTA 2QJHA 3I65A 2WSYA 4JTKA 3A21A 3QMRA 2VFFA 1QOQA 2A6NA 1FCUA 4FXRA 1CI1A 3TCEA 2WNNA 1NVMA 3P62A 5BNKA 4BR1A 4O0ZA 4IJBA 4O1DA 5G2WA 3C61A 4DF1A 1D3HA 3I68A 3BLEA 4K36A 3GNDA 2FFCA 1ONRA 5EA9A 5FEXA 3DBPA 1ZAJA 2CZEA 3KVLA 5DBTA 3PS7A 1SW0A 1TJRA 2ALDA 3MHFA 2E6YA 3UQNA 1LOSA 3EX2A 1RQEA 4AVFA 4AHPA 3LI1A 4M5PA 5I3FA 4O19A 1VHCA 3I7RA 3LV6A 1OFDA 4IWWA 4QISA 1TSIA 1F2JA 1ADOA 2X2GA 1W56A 4H4IA 2FPTA 1OFPA 4RZ6A 4LC6A 2V2CA 1OG0A 4WY0A 1GPWA 1FXPA 2QCDA 4AH7A 5LGXA 1K7FA 3L65A 1JJKA 3R2GA 3ZWSA 1HL2A 2VOMA 1SU5A 1VLWA 5HWMA 2NXGA 1ZFJA 4KWVA 3W70A 1KFBA 4UC5A 2NV1A 1AW1A 1NSJA 1JR1A 1NFBA 1PS9A 3RLVA 4PL2A 5DXXA 5EKYA 6TIMA 5I3HA 4XKYB 2WJZA 3H55A 3PBWA 4HPXA 2E1DA 3SFKA 1YXDA 1L6YA 3F03K 5D38A 1KM0A 4TR9A 5CG7A 3T4CA 4GE8A 4RR4A 5AYYA 4GFSA 4QITA 3N34A 3KX6A 3FIGA 1JCYA 4NU7A 3QH2A 3L0NA 2P10A 5D37A 4O54A 4YWIA 3MBDA 1SW3A 3W6YA 1XUZA 3LXCA 2QJGA 3QC3A 3WJYA 1TIMA 2YDAA 2W79A 3MP4A 2YPIA 3S8HA 1T0OA 3R8RA 3LCGA 1K8YA 1XBVA 3UD6A 2Q8LA 2E77A 1LLWA 3EKZA 1JCMP 2EPHA 1W8SA 3ATZA 3FS2A 3W87A 4O4WA 1YDNA 1X1OA 1GTHA 3M1ZA 3HGSA 5AHEA 3LHUA 4QJ1A 3O05A 3M47A 5CKSA 5F4SA 3BW2A 1ZJIA 3M9YA 1DL3A 1FDJA 4N02A 5AHIA 4NNAA 3LHTA 3KFTA 3LOTA 1H7RA 3O06A 4AHQA 5T26A 2WPBA 4O53A 2Y88A 4Z0JA 5TBOA 2WSQA 1A5SA 3KOFA 1IXNA 2D73A 3HGRA 3QSTA 2HMCA 4JNMA 4JR5A 1CW2A 3QEZA 2JKEA 1N55A 4KFPA 1EUAA 3O63A 2A85A 3W84A 4C1LA 3BO9A 1Q6LA 4HNUA 2X16A 4WXZA 3OVPA 1GWJA 1LM1A 2BTMA 3S1WA 4KKXA 1G4PA 2E09A 2GVGA 3LDVA 5FF7A 2CWNA 5C5YA 3NR0A 4LVFA 4DELA 4O12A 1ICPA 1FX6A 2Y7DA 3NDOA 3JR2A 4IMFA 4LTSA 4S2BA 4NQ1A 1R2SA 5F4WA 1YTKA 3G1XA 3O16A 1KM2A 2NWRA 3GVGA 3M43A 3W74A 1OFEA 1R2RA 5LNSA 3JS3A 1KM6A 1WDWA 3BW3A 1SR9A 3OVQA 4M19A 2H3DA 4MVAA 1OYCA 1RVGA 4N9EA 1KLYA 4H6KA 3G8RA 1Z48A 1H7XA 2PRLA 3TMLA 3GAKA 4UMCA 1QO5A 4L4MA 4LUJA 3EWWA 1VHNA 3P84A 5F2MA 5HJLA 3G1HA 3DGRA 4M6QA 3EXSA 4LRSA 5DELA 2YR1A 1ZALA 4JTFA 1OX6A 3B4UA 5C2XA 4UFJA 4OV4A 4NVTA 4NZFA 2NUYA 1G6CA 2C1HA 1THFD 2B7OA 4X9SA 3ELFA 1LRQA 1VQTA 1GYLA 3EX1A 4OV9A 3LHWA 3FJ6A 5HWJA 4Y96A 1G69A 4CQ8A 2GQAA 1OABA 3R5EA 2J9XA 4TMCA 4JIQA 3BGGA 1RQBA 1H60A 3R12A 1BWLA 1KV8A 3STFA 3TIMA 1KLZA 2NXHA 3KVKA 3RK8A 1MEWA 4IPIA 1E51A 1NAL1 1ME9A 4MFEA 1WAUA 1MZHA 1GVOA 4HPJA 1GEQA 3UYCA 1S5WA 1XCFA 4JYFA 3IIPA 2VKZG 4HHPA 3HIJA 3CU2A 1VCGA 3UWYA 3HG5A 3V1PA 1AL7A 1VC4A 2QCLA 4R33A 3CC1A 2YCEA 1IXPA 4K7YA 4UXDA 2Z1BA 3B06A 3KHJA 4IOTA 4RXFA 3NA8A 2FPYA 3DKJA 1ZCOA 3ABRA 2BZNA 2NWSA 3LCWA 3MI2A 3W85A 3BLFA 4ORIA 4UTWC 2VEKA 3L0KA 1ICQA 1EUNA 1FWSA 3QMSA 3NOEA 1TPC1 4ONVA 1A5AA 1OF8A 4JY9A 1K02A 4BF9A 3MYPA 3UWQA 5KZMA 1TPFA 3NL6A 2NXIA 1LBLA 3LM7A 1ZHAA 2PCQA 4CNOA 4R7JA 3IVSA 2OT1A 1QWGA 3WJZA 1JULA 4QM1A 4UR8A 4O18A 5DY2A 1VGAA 2C18A 3U6WA 1I2QA 3PB2A 4QNEA 5C55A 3BG3A 1FDZA 2Z2UA 3EKLA 1F76A 2Q3OA 5I3IA 2DU2A 4MY9A 3EXRA 1RR2A 3LHYA 4QAIA 5C54A 2PC4A 3WJWA 3STCA 2DZSA 4UFHA 1LBFA 3G0SA 5BMXA 1WBJA 2TSYA 3FYPA 3LBMA 3UPBA 3GZ3A 3THAA 3HOJA 2A0NA 3W7KA 5J5DA 1K7XA 3B8DA 4K8EA 3VE7A 3QYQA 4IMGA 3G22A 4WOQA 1B3OA 1G67A 2ZZ5A 3MI3A 3HJZA 3CT7A 3U2OA 2Z6JA 4CNPA 2WSRA 5G2HA 1YTDA 3C6CA 5AHFA 1VPXA 2CLEA 3FKKA 4PH6A 3BVJA 4UTTC 1W5MA 5G2IA 3Q58A 2B4GA 1OX4A 3SIZA 2YGYA 3G3DA 3P8IA 5H91A 3HPXA 1EWEA 1MEHA 2YX0A 2YW3A 5E0KA 4XTDA 3IIOA 3PSWA 3E96A 1OYAA 4P61A 3R89A 2PE4A 3F1QA 3GIYA 3C52A 3B05A 3H54A 4PL1A 4FB7A 3LRMA 3QFEA 5AN7A 1H51A 1KM1A 1EB3A 1FWTA 3W7EA 3OHIA 3G18A 2NX9A 3P61A 4MYXA 1LORA 3S9YA 3IEBA 3BV4A 1A5CA 4Y9AA 4O28A 3LRKA 3TSBA 3LV5A 3LB0A 3N2MA 3GDMA 3ZFHA 4ZZ9A 2J9YA 1N7KA 3L5AA 3VNDA 3QSRA 3NPVA 2NUWA 4ZQCA 2ABBA 3UXAA 2F84A 3LERA 4MOZA 5IBXC 2BX7A 3M7WA 1TCDA 2ATSA 3VCRA 3CLMA 2O7QA 4NUWA 2Y61A 2H90A 6ALDA 2R14A 1H63A 1RV8A 3O6YX 4O1BA 3O1NA 1FWRA 4GWEA 3T40A 3W76A 4I9AA 3PG8A 3UY8A 3I6RA 3W1XA 1JVNA 1Y0EA 3CWOX 3O6CA 2QDHA 4A22A 3I7SA 3CM4A 1H7OA 2V2HA 3QZEA 3S42A 1JRCA 5HR7A 1V5XA 3DKLA 4FF7A 3WJXA 3TW7A 3LBCA 3W7HA 2GJNA 1WOAA 4W9TA 1WYIA 3MWAA 4YXGA 1RZMA 3WK0A 3TC7A 2Y7GA 1QDSA 1VR6A 3S1VA 1KW1A 2P0OA 3DFPA 5DN1A 1LP6A 4QQ3A 3PBVA 4JYEA 4N2YA 1I8JA 3ABOA 4UNLA 3TFXA 3B0PA 5DBUA 4U4MA 2Y63A 3EX6A 4PODA 5D2XA 3HBLA 1B4KA 1R30A 1SSDA 4OWGA 1XXXA 4K37A 4ADTA 4GBUA 5EY5A 2V2DA 4ORMA 2B7QA 5BW6A 2V9DA 2A7PA 2UV8G 5LNUA 4UR7A 1EX5A 1VLIA 2H6RA 3LXBA 2ZRYA 1OFAA 5FEZA 3W1LA 3LI0A 3W9ZA 4FNUA 3W7LA 1BKSA 4MPQA 4AWTA 1VZWA 2HS6A 3M44A 3PG9A 5AOUA 1UASA 2PRMA 3GXPA 5K2ZA 2I9EA 1EEPA 1EP3A 4LS0A 2ZRZA 3IIVA 4UTUA 4RX0A 4QNWA 3E02A 4LVDA 2CZ5A 2WOQA 1SO4A 1O94A 3E49A 4TIMA 1VYPX 3LTSA 3NPWA 4YCPA 5LHEA 4JGDA 3T78A 3PBYA 1UB3A 2RDWA 3P7YA 4JD4A 1VCVA 4WY0B 4UTMA 5D30A 5FEPA 2ZZ4A 1YTEA 3NQCA 2W0UA 3NYZA 3HG2A 3PY2A 2FTPA 2QCDB 4YCOA 4QIUA 3TQVA 3W1PA 3P74A 4FNQA 4GUFA 1YDOA 1ZNNA 3IRDA 3Q37A 5LGZA 1EA0A 4PEKA 3TMQA 3P5ZA 3R13A 4S2CA 1R46A 5G1YA 2TPSA 2ZTKA 2EHHA 5TIMA 3W86A 1F05A 1LLZA 4UTTA 4FEZA 1D9EA 3TA6A 1H7WA 5DCBA 5KTLA 1J4EA 4TX9A 5K9DA 4DF2A 1W37A 1C9DA 4LVAA 3GR7A 3CPRA 3SR7A 4O0KA 3LCXA 4EF8A 1LDCA 1QNVA 1QPQA 5K3VA 3NQGA 1F74A 1UUOA 4ZVJA 1MEIA 3GB6A 3W75A 4XBKA 2QDGA 3QQ0A 5C6MA 3G1YA 3CIXA 2VFHA 1TTQA 2CU0A 3SZ8A 4IX2A 3TQ0A 5HUPA 4FX6M 4IPJA 3I7QA 4N4PA 2XN0A 1QPNA 1UUMA 1LCOA 1KFJA 3P60A 3TK7A 1HUVA 4O4VA 4O16A 1QO2A 5IM51 4CQAA 2VXNA 3L66A 4JN6A 3W2LA 1Z42A 5K7JA 3QRHA 1EWDA 4FX8A 2R91A 3PR2A 4UMAA 2A7NA 1TPVA 3PAJA 2RHGA 3B03A 3CHVA 3UWWA 2ZYFA 5IBXA 5DCEA 5K9XA 3EB2A 3FJLA 2CLLA 4HSNA 4LV4A 5G1TA 4GUJA 4JYDA 1KFEA 1IGSA 3TUUA 4JXCA 1L2UA 4KFOA 3G24A 5AYXA 4NNCA 2DZWA 1PL9A 2Y70A 4HNNA 1AG1O 4DQWA 3B0VC 4DO5A 5CGQA 2YFNA 3C2VA 5E93A 4FX7A 3G3MA 3P8JA 4KWWA 2BXVA 3NG3A 1I2NA 3TXZA 1FCQA 2QJIA 1OYBA 4FNRA 3AJXA 3W7DA 3E0IA 3TXVA 3PUEA 5EL1A 1WOBA 3F4NA 3UXDA 4HKPA 4NX0A 2BSLA 1LTDA 3CTLA 4FNSA 3BW4A 2V0TA 1GOXA 2JBMA 4UFIA 4LC8A 5EYWA 5J5RA 5HWNA 3NZRA 2R94A 2ZQ0A 4HNTA 1QMLA 4ADSA 1TV5A 3LCFA 2TMDA 3IV3A 4JTUA 4N4QA 1ICSA 1O5KA 2B7PA 3CQ0A 1Q6OA 4AWUA 4O13A 1GG0A 4MIMA 1WX0A 3DHFA 4Z1AA 3UNDA 4EIVA 5AB3A 4G1KA 1OFRA 2GVJA 1TREA 2OZ0A 4TMBA 3W7CA 3Q2DA 2GVLA 4K38A 4RXGA 4FXSA 1PV8A 5K4XA 2VC6A 2A5HA 3S5YA 2CLKA 4MUZA 1SFLA 1K8XA 1K7EA 2NUXA 2RDUA 4DPQA 3NQ2A 4XQ6A 1G4TA 3IGUA 4NXKA 5LNVA 5LHFA 2CZDA 3EWZA 3NGJA 2KZHA 1R47A 4MYAA 4IMDA 5EMUA 2QAFA 4OE7A 4UMBA 3E9AA 4Z1BA 1AL8A 1S5TA 3P80A 2J9ZA 4HSOA 3NEVA 1QCWA 3OBKA 2VFIA 1EIXA 4WUIA 2ZA2A 4U28A 5U4NA 3EXTA 3UWUA 3RMJA 1ZAHA 3C2OA 5F2GA 1AW2A 3ANYA 3KVMA 1W3IA 2ZZ6A 3C56A 3G1SA 2GJLA 3SJ3A 4JX6A 1SSGA 2FJKA 3QMTA 1G7VA 2ABAA 3P82A 2Q8ZA 3OG3A 1KFLA 3W2JA 5D32A 3GYEA 3STGA 1F5ZA 4PA8A 1SZNA 2RFGA 4NJGA 1PHQA 2JKAA 2B7NA 4RCXA 1LROA 4O50A 3A24A 3T44A 2GQ8A 3LXAA 3RFAA 3S1XA 2O7SA 3TU9A 5AC7A 1B57A 1M5WA 1W5NA 4IXXA 3U8GA 2J27A 3DENA 4NXSA 3TV8A 3PSVA 1IXQA 4LRTA 2VELA 1TJPA 5MHBA 2VFEA 3NPXA 3IGXA 4GUIA 1F73A 1YPFA 2X30A 2QF7A 1PE1A 3SECA 4Q32A 3C3NA 2WV8A 3EX3A 3NQEA 2WNZA 4N6FA 4M6VA 5D2TA 3KXQA 3CEPA 3SW6A 4X2RA 3NZ1A 4O1CA 3NVTA 4R34A 3GAYA 4MLRA 5FF2A 4PCFA 1VH7A 4LWWA 1UCWA 5BRBA 3EWUA 2Y62A 3W7MA 2YW4A 1DQXA 5AFDA 1H61A 1V7YA 3EEGA 1MSSA 5EBUA 2A6LA 3NXFA 1LYXA 2GQ9A 1XBXA 3HF3A 4ZQNA 1GG1A 1P0NA 1B9BA 2BWGA 3W7GA 1GVQA 4O11A 4BWLC 4J9JA 3N19B 2H8ZA 3TSDA 4UFKA 5HQEA 1U83A 2X1TA 3KRUA 1PIIA 1TPUA 4M7SA 1SW7A 1G7UA 2XN2A 3L5MA 1ZY9A 3N2XA 1SO6A 4WX2A 3IGSA 1OX4B 1QAPA 3NPUA 4HT3A 5G5IA 2QCGA 5AYZA 5F2LA 3A5VA 4JTSA 1S3HA 4NZJA 2Y7FA 4E0CA 2A1YA 4MZ1A 3SI9A 4DPPA 3D0CA 5DXYA 2FDSA 4RLIA 3W7JA 1LZOA 4DBEA 3DFQA 4PTNA 5CZSA 1JCLA 3W7RA 2ZA3A 3W3OA 1JRBA 3ABQA 1TO3A 1ME7A 2VFDA 4GC4A 1SZEA 4OGZA 3BGJA 2V30A 2OT0A 3G8EA 1VYSX 3WFAA 2V8ZA 2NLIA 3MW7A 5KMYA 3C0JA 5I3JA 4JS3A 4CCDA 1D3GA 4Z08A 1H50A 2VENA 1C29A 3IVTA 1BTMA 4A2SA 1FUYA 2G96A 5KSWA 4FIRA 1JQXA 4JDBA 3NNTA 1FDYA 3O8AA 4DBDA 4JTEA 4PC8A 1U5JA 3HG3A 1JUKA 1DORA 2CLFA 3HPZA 4O15A 1JCJA 3PB0A 4N6EA 4FNPA 4Y90A 3W7QA 3W7OA 3DAQA 3THQA 1KTBA 4CNNA 3P5YA 4AXKA 4JX5A 4I7UA 4C1KA 5D02A 1GT8A 4FIQA 4UTJA 2ZZ1A 1TPWA 2WQPA 3UZJA 2NZLA 1SZGA 4K6AA 1FBAA 2X1RA 4HNVA 4Z0SA 3HO8A 4E2DA 3MUXA 1KV5A 1O95A 2C3ZA 5KITA 4LY8A 1W3TA 5CZ0A 3W1UA 1UBSA 1K8ZA 4KFNA 1SZFA 4TU1A 3A23A 5CPMA 3MJYA 2CLMA 3RLUA 1P5BA 3UWZA 3W2MA 3W73A 4RZ4A 5A8GA 2Y7EA 1M7PA 2Y89A 4WQ6A 4AEOA 3DZ1A 3GR8A 1TRDA 2CFFA 4X3ZA 3P67A 2VEPA 1OK4A 1HO1A 2ZRXA 1JUBA 3PWAA 2HTMA 3FFSA 2W6RA 1K03A 2FLIA 1OK6A 3S6DA 3DI0A 4IQLA 4NNBA 3TW6A 2F7FA 1A53A 1FCVA 3DFTA 1X7FA 1TQJA 2RDTA 3TAOA 3K30A 5AC8A 4ZQRA 4ZL1A 5K9CA 5LSMA 4S1FA 3QM3A 1FWNA 3L9CA 1H7PA 3SGZA 1XBZA 1Q6QA 1TPH1 5KZDA 2Y6ZA 3WK2A 3GKFA 4DO6A 3NQ8A 4A21A 8TIMA 1EP2A 2QKFA 1O4UA 3DH7A 1QOPA 1TYGA 3PULA 5CPLA 4Q4KA 3GKAA 1S5VA 3M41A 3B04A 2ZRVA 4BK9A 1OFOA 5DY3A 1DV7A 4A2RA 4E38A 4UFLA 3PBUA 3GXNA 4GNJA 1W0MA 3GDKA 3G1AA 1QPRA 3IIZA 2V81A 4M7TA 3TDFA 3ZWTA 1ZAIA 1XKYA 3UWVA 4RV8A 4NJHA 1MO0A 3P81A 4LT9A 3T55A 3PUDA 3S5NA 1DVJA 4A29A 5K4ZA 1GTEA 4BWLA 3LLDA 2DZTA 1EPXA 3CWNA 2H3BA 3JRKA 4OT7A 1JUEA 5HULA 2EAWA 1KFKA 3W88A 4DEFA 3G0XA 3QPYA 4O57A 1ZENA 4EWND 3A5FA 4OBTA 2ZTJA 3GDTA 3PVFA 4R53A 5AHNA 4GUHA 2GUUA 4ZQMA 2G5WA 1XUUA 5G4EA 4GUGA 4MJZA 3TROA 3PUOA 4JTJA 4AF0A 5KINA 3O07A 1LRNA 3TC6A 4UUIA 1M7OA 2CW6A 1XM3A 4MZ8A 5FI8A 4Z1DA 3INPA 1HTIA 5BMWA 4GJ1A 3A9IA 2V5BA 2CLIA 4OQVA 4POCA 4JTTA 4XWUA 3UPWA 5D2WA 1RPXA 3DHDA 2ZZ7A 5D09A 3W1AA 5G4WA 3S5OA 3WK1A 2ZFAA 1VS1A 1X1ZA 1ME8A 4B5NA 4Z1CA 1EP1A 1XFBA 1XI3A 4CQ9A 1XBYA 2A21A 4JDYA 2TYSA 5D2YA 3MI6A 1VJIA 3TE9A 2I1OA 3SY5A 4QSHA 2YZRA 3NQ6A 1TTIA 4O10A 2CLHA 4JIPA 2ZCGA 3AO0A 1HO4A 1I4NA 3MMTA 5L6UA 3NL5A 4YL2A 5F4XA 1KTNA 2C0AA 3DI1A 2X1UA 1I45A 5LZLA 1LRTA 1IF2A 1F6KA 2DP3A 3LCLA 5D05A 2NV2A 2VFGA 4ZMGA 3W2KA 1YLVA 1G4SA 2Q3RA 3SSJA 2G97A 3LGEA 4EF9A 4N9CA 4NX5A 4DO4A 1WV2A 1FQ0A 2J6XA 1WA3A 1TPB1 1YXYA 3M6YA 1GVSA 1TPDA 2A4AA 5H2ZA 2B0MA 2ATMA 3QW4B 4N9DA 3FKRA 2OCZA 3EX4A 1OJXA 3VKJA 3STEA 3S5ZA 1DJNA 5F2IA 3WK3A 2TRSA 4ZQPA 4XKYA 5F1VA 4O1AA 4XZ9A 3NQDA 1RQHA 1L9WA 3HPSA 2QUUA 4XBSA 5CSSA 3ABSA 1FY6A 3UZ5A 4MZYA 5D04C 1O5XA 2C15A 1H7NA 5LKYA 3HG4A 1L6SA 1SQ7A 2QCEA 4LW7A 5AHMA 2JK2A 5CZTA 4XUGA 1YXCA 1DOSA 3B0UX 3C8FA 1JCXA 4N9BA 4Y8FA 3W7PA 4AHOA 1AK5A 3TKFA 4WOZA 3TSMA 4MLJA 2I14A 3IVUA 4XTIA 5HR6A 1J5TA 4IMCA 3GK0A 3QJAA 1OFBA 1J2WA 2Y85A 2JGQA 1Z44A 4A3UA 4MY1A 1OFQA 3S1UA 3W2NA 4BFAA 2ISVA 3E12A 3LTPA 3W23A 4IGHA 2DZVA 2GOUA 3LRLA 2E6AA 4IX0A 1DQWA 4UTIA 4WD0A 1HFBA 3V75A 5HNRA 2RH9A 3DU0A 1WQ5A 3W1TA 1TRIA 1YYAA 4ML9A 3Q94A 3N73A 2WO5A 1KBIA 1L6WA 1PCWA 3FLUA 4DXVA 5HMSA 2AAMA 2ISSA 3G0UA 1IXOA 4LV9A 3GLCA 3SGUA 4RK8A 3LCIA 2YXGA 3C2EA 5DCDA 4JX4A 4IMEA 4JTGA 4AB4A 2HSAA 1GZGA 3W22A 3FA5A 1XDMA 5FF4A 1KBJA 1I2PA 4RJEA 2ZRWA 1RD5A 3ATYA 1R2TA 3OIXA 4AMAA 1HG3A 1K3UA 2VEMA 4Y6GA 2AQWA 1GJPA 4ALDA 2YSWA 2BLEA 3LCHA 3NO5A 2FB3A 3HGOA 4LOCA 4E2BA 2NX3A 1KM5A 1H62A 3N14A 2J88A 1C8VA 5I3KA 2WKJA 4CCEA 3GDRA 1ML1A 2FPVA 2DJXA 1Q3NA 3W83A 1O60A 3EWXA 3RNDA 1FWWA 1TTJA 1OF6A 4UTKA 1A5BA 3NQVA 2DORA 2QEZA 4JY8A 2ZA1A 4AWSA 2YFOA 2V82A 1M6JA 1TB3A 5DLCA 4RKAA 3BARA 3MP3A 3MO7A 1FXQA 2RKXA 3NM3A 4UCGA 4UFMA 4BI5A 3RU6A 3L68A 4MY8A 3TH6A 1P4CA 2WNQA 3NL2A 3OVRA 3KRZA 3N3MA 3BK0A 7TIMA 3M16A 2C14A 1P0KA 1TPEA 2JGYA 1VRDA 3WJSA 2FQIA 3L21A 2JKPA 2OMAA 3O15A 3W7IA 2XFWA 3W1NA 2OX1A 3M5VA 3QW3A 5EPDA 5I3GA 2ZBTA 4YLWA 2FIQA 2QUVA 2ZZ2A 4JTHA 2E5BA 1GQNA 3TFCA 1XL9A 3OA3A 3C2RA 3NL3A 5AHLA 2EKCA 2QCFA 4MFDA 4LNYA 3C4UA 3L2IA 2QCNA 1SFJA 3NQFA 4CLMA 3HMJG 1WXJA 4PFMA 2OJPA 1LOQA 4LS2A 5D03A 1A50A 2XN1A 4JTIA 5E1QA 1F6PA 5ABTA 5CSRA 3TR2A 3PC0A 4ZQOA 5D33A 1AW5A 2ZRUA 4O14A 2CLOA 4EVZA 2GPTA 3DFOA 3VFLA 4GXMA 3GX9A 2J24A 4OU1A 4UTLA 2DJLA 1GYNA 3G1DA 5F1UA 5D2VA 2ISWA 4BI7A 1GVRA 3CEUA 2QCMA 1BEUA 1YADA 2AGKA 1BWKA 3LX9A 3DFNA 3W7NA 3MBFA 3MHUA 3EWYA 4HIBA 3QPZA 2IQTA 3KAOA 2E5CA
chains in the Genus database with same CATH superfamily
2J75A 4WY0F 4MJ4A 5A6AA 2PTZA 1BRLA 1DWJM 2I56A 1ZS2A 1PTDA 3C2FA 4LUYA 1DXEA 4W5UA 1W1PA 4REQA 1TUXA 2ZADA 3APYA 4PUMA 2INZA 3B97A 3T81A 1SJDA 3AXIA 2GK1B 2DZAA 3WLJA 2PDWA 4GI4A 5C71A 1AODA 4JTLA 5SWUA 2G95A 3NVDA 2WW5A 5CBJA 5H1WA 2WJEA 1HZYA 3U5YA 1YNPA 1ZJHA 4UB9A 4GGHA 5C9UA 4C90A 3VIMA 4DLFA 5TQLA 2A7RA 4PUUA 2HNEA 1MUWA 3KTCA 4AD2A 1GUVA 1NF7A 3MHGA 1TTPA 1XIBA 2IMRA 3WLSA 2VWTA 2C19A 2J25A 3N4FA 3URNA 4HN4A 2VC9A 4E4UA 3V7PA 3GDLA 3M5YA 5LIKX 1TQXA 2V3FA 3I6EA 3LBOA 2XVLA 1UH3A 1JF6A 3WQ6A 3F4WA 1BG9A 4DUXA 2WNWA 4GX9A 1S1RA 4YPJA 2PDIA 1GNXA 3DFSA 5HJYA 1DHPA 1ENUA 4UZUA 1J6OA 1W2VA 3KRSA 2FB2A 4AZ7A 4MNLA 1TVLA 4GRSA 3EA2A 3FX4A 2IPJA 4OJYA 4MJMA 1K6AA 4Q3MA 5E6YA 3K13A 3BLIA 3MP5A 4PN2A 3TX9A 4RZ5A 1QT1A 3R8HA 1NEYA 2DZPA 1TMQA 4WK9A 3QLLA 4P8VA 3LLFA 4DYKA 2AMGA 5E5CA 1U1JA 4OUIA 1XRTA 4OKDA 1DEDA 1W3LA 2E40A 4JHZA 2R1MA 1T96A 2ZICA 3KBWA 1QW8A 1CGYA 3B8IA 3O6DA 3R94A 1KM4A 1B4EA 1PXGA 1YKWA 4XD6A 2F6UA 1ZZMA 3MVTA 4DJDD 1RY0A 4Q33A 1RY8A 3JVAA 1E3ZA 1TCMA 4UTWA 4QHRA 4AF0B 3WF4A 2QAPA 3A22A 3XINA 4MAVA 3BAXA 3VZXA 2DIJA 4I9TA 4NY2A 5E70A 3GNNA 4NIRA 1M9HA 3W2UA 3H53A 1OX5A 1CGXA 1FP8A 1W5OA 3LHVA 4J1OA 3RLGA 2ZX7A 1J01A 1QI2A 4NKCA 4LANA 4RPQA 4U10A 1B0IA 4HCDA 3E1F1 1PDYA 4RNHA 2EJ1A 4ICNA 4O8RA 4AAJA 1CT5A 2PWVA 1NFGA 3TJXA 1ZP4A 1YDVA 2WSKA 1H3GA 4A3YA 2WSYA 4JTKA 4FALA 3BC9A 2RJHA 4UWMA 2WZHA 3AOFA 1IZKA 3USZA 1AJ2A 2W66A 4W87A 3PZNA 2RAGA 5DF0A 2WNNA 5BNKA 4O0ZA 4J27A 5G2WA 5T9CE 3IPWA 1ONRA 5EA9A 1Q6DA 3KVLA 1T40A 4M29A 4AX6A 3F5KA 3IUIA 4L9YA 4CGTA 2E6YA 2DVTA 4DYJA 3UQNA 1D8CA 2V68A 3IV8A 5J8LA 3E2SA 4CD6A 1F2JA 2X2GA 3TYUA 1W56A 3WDIA 3WNPA 2FPTA 1OFPA 1W9UA 4LC6A 2V2CA 3KWSA 1TWDA 1VPYA 1LG1A 4WLCA 4D72A 1K7FA 1VEMA 1KXHA 4AY7A 5LA2A 3WD1A 2DQWA 4DI9A 4S3KA 3UR2A 5C7VA 4MWAB 2PDYA 2JF6A 2OEKA 4BF7A 1V0LA 1O5RA 3EYPA 3VGHA 1PS9A 1HXJA 3UG4A 5I3HA 4XKYB 4GGBA 4IF2A 3GTNA 4WCJA 3WFLA 1KM0A 1WDSA 1PX3A 3UERA 4GE8A 4RR4A 2VMFA 3RITA 1RXOB 4C7GA 3OJGA 4QITA 1IWAA 1JCYA 4NU7A 3QH2A 3KRBA 5AVNA 5D37A 4O54A 4K3ZA 2NQJA 1SW3A 2ZX5A 4GPNA 3LXCA 2QJGA 3QC3A 3WJYA 2YDAA 3P2VA 4UCFA 2ZXQA 1FWIC 3O0FA 4S3DA 3EA3A 3WDQA 1N8IA 3UD6A 4H6QA 2V69A 1REQB 4EPEC 4AZHA 3IUHA 2ESCA 1EGVA 1HL9A 5DRIA 1X1OA 1GTHA 3M1ZA 1Q5MA 2BS9A 2Y8VA 3O05A 3M47A 8XIAA 3S3GA 3UFYA 1DL3A 1FDJA 4N02A 4C6NA 1ODUA 2VT0A 4V1YA 1AJ0A 4AHQA 2ZKMX 1A0CA 5C70A 1P6WA 3SBFA 1REQA 3RCNA 2CETA 2WSQA 3VX1A 5C0QA 1IXNA 3HGRA 4YHEA 4JNMA 2HWGA 4JR5A 3WKZA 3QEZA 2QT3A 2OLAA 1EYEA 2JKEA 4WKHA 4H6EA 1DE5A 5PTDA 3WLQA 2GSJA 1H2JA 4E4FA 1IE7C 5TF0A 4C1LA 4DIAA 3EOSA 4HJFA 1UR2A 2X16A 4ZENA 4A8LA 1GWJA 1K1DA 1LM1A 1VFLA 1IT8A 4KKXA 5A8QA 3LDVA 3NR0A 4DELA 3KDOA 2Y7DA 2JEQA 2PD5A 5A2BA 2J7EA 3GC5A 3G1XA 5A6BA 2EO7A 2NWRA 4JN8A 4HP5A 3W74A 3N2OA 4KF1A 4XZLX 1MQQA 3BW3A 3OVQA 4MG4A 4ICCX 4MVAA 1JD7A 1OYCA 3TMLA 3DHPA 4N9EA 1Z48A 1JXJA 3ES7A 4K8GA 4UMCA 4LUJA 3NZPA 4TVDA 1A47A 5C2XA 4YNGA 3Q4DA 1RALA 2X2YA 1JAEA 1G6CA 2C1HA 1THFD 4CNUA 4X9SA 5BOEA 4TV6A 3RU8X 2OGYA 5I06A 1JDFA 3FA4A 3TIMA 1EEXA 2NXHA 2ZXBA 4IPIA 1AUSL 1UD4A 1WAUA 1MZHA 1GVOA 5EMMA 1BSIA 3UYCA 3AXXA 2ZUWA 1XCFA 1MYRA 1H41A 7XIMA 4HHPA 2P50A 3HIJA 4E3TA 3CU2A 1LT8A 4DO7A 3V1PA 2YKKA 3ZLGA 4Z2JA 2QCLA 1TJ1A 2OYKA 3IK4A 2YCEA 5JVLA 1HKKA 4K7YA 2HK0A 4FZIA 5MKGB 1BD0A 3B06A 3DX5A 5IFPA 3KHJA 4IOTA 4XIAA 2VUNA 3WD0A 4MKSA 4NAFA 3SAZA 2FPYA 3DKJA 1BHGA 1ZCOA 3ABRA 4ERAA 3MI2A 3BLFA 2E67A 3N4AA 4AZCA 3L0KA 3N4EA 1EUNA 2WAGA 4EANA 4JY9A 1K02A 3MYPA 2V63A 4DWSC 4JBRA 1IEXA 3LM7A 2XH0A 1ZHAA 4NP7A 4F0HA 4R7JA 5I6SA 2OT1A 3A4JA 3WJZA 1VGAA 4LB4A 2C18A 1XHGA 4HK5A 3UNTA 3L7RA 5C55A 1UPPA 1OWQA 1EXBA 4CQCA 3BH4A 4H7CA 3EXRA 1YQ2A 2QUMA 2PC4A 2DZSA 2OO0A 2RGMA 3H70A 2PTXA 5BMXA 1WBJA 3PANA 3FYPA 3QYSA 1Z7AA 5J5DA 2DH2A 3B8DA 3VE7A 4QCEA 3VNJA 2WCSA 3L4YA 2BHZA 3PP7A 3FK4A 3VIKA 2Z1VA 3C6CA 1LWIA 3FA3A 2J7CA 4U33A 4PH6A 3BVJA 1NOFA 4F3HA 3BZJA 4XO6A 1CZ1A 3G3DA 3CK5A 3P8IA 4B9ZA 3E96A 2FKPA 2CPUA 4B15A 1DWAM 2PE4A 3GIYA 1Y8BA 3C52A 3H54A 3LRMA 1ZP3A 2E9LA 2WZEA 3CWHA 1KM1A 3A3HA 3W7EA 3BLLA 4XIMA 1J11A 4MNMA 3TCSA 4GVHA 4E2VA 4UTFA 3VGBA 1OGSA 3IEBA 5MF5A 3LRKA 4B3ZA 5M17A 3ZFHA 4ZZ9A 3NCOA 2XSBA 3GG7A 2J9YA 3MO4A 3QZ6A 3VNDA 3QSRA 3NPVA 4D6FA 1K9TA 2YBVA 3M7WA 4C6OA 3VCRA 1RBOB 3CLMA 3WLKX 4JNZA 6ALDA 3CQIA 2R14A 1H63A 1RV8A 3O6YX 2DIKA 4O1BA 3O1NA 4DBWA 1GHRA 1EKOA 1FWGC 3PG8A 4I9AA 3CB3A 1Y0EA 3CWOX 4A22A 1H7OA 2V2HA 3BV7A 1XYMA 2PWFA 3DHUA 1XLCA 1S46A 1XINA 2WHLA 2AQVA 1PDZA 1WOAA 1WYIA 1ODZA 3L23A 3WK0A 1DYSA 2G3IA 4GABA 3S1VA 1KW1A 4X9YA 5I78A 1LP6A 3OYZA 3IJDA 4UNLA 1GZJA 3RLHA 4U4MA 3UYIA 4PODA 1WKFA 3HBLA 5DMMA 1QPKA 1SSDA 4IPNB 4ADTA 4K37A 9XIMA 5EY5A 3PJXA 2OWWA 2ZRYA 1PJ9A 3QLDA 1WXYA 1NOUA 1JI1A 2HV5A 3LI0A 3PNZA 3S83A 1VZWA 2HE5A 2VCBA 3IK2A 5AOUA 3TVAA 2PRMA 1WDDA 4DNMA 3BLKA 1F3XA 4KS0A 4C1NB 1V6YA 2AKMA 2V3GA 4LVDA 2CZ5A 1SO4A 3WQ8A 3LTSA 1KO0A 5LHEA 4H9ZA 3PBYA 2RDWA 3BDKA 4JD4A 1MUCA 3FAWA 1N2VA 3MA8A 3NQCA 4QIUA 1XSJA 3AHTA 3U9IA 4FNQA 3FDKA 2VD8A 4LYPA 4MB1A 2IKHA 3TMQA 3P5ZA 4S2CA 2FGBA 2ZTKA 1R6WA 2EHHA 3W86A 1L6GA 4FEZA 4GYKA 3THCA 1H7WA 5DCBA 2DT3A 4Q6XA 3KLLA 5K9DA 5BWAA 3TOPA 2PWEA 3LCXA 1XLGA 2D0HA 4P7RA 3NQGA 4ZVJA 1W9VA 1FOBA 3PZQA 4IL2A 3QQ0A 3G1YA 3CIXA 2VFHA 4HMEA 1VPQA 4H7VA 1TV4A 3TQ0A 3CBWA 1L8PA 5HUPA 4IPJA 2ZIDA 1QPNA 1UUMA 5IDIA 1V6VA 1KFJA 1UWIA 4KT2A 3P60A 4G7EB 2G50A 4A3HA 1C3FA 1EJTC 5CJMA 3TK7A 4O16A 2YXXA 1QO2A 4AG0A 4CQAA 1J18A 5CEWA 5I09A 3PPFA 4Q22A 3VILA 4CN1A 3VIJA 5CAHA 4K1GA 2BFGA 2TODA 5IBXA 3EB2A 1IWBA 3UCCA 4LV4A 4GUJA 3TUUA 4HSHA 4G7EA 4KFOA 5AYXA 2Y70A 1AG1O 1B54A 4DQWA 3H4GA 3GFZA 3C2VA 4C7FA 1Q63A 2XFFA 4FX7A 4PRWA 4KWWA 1EDTA 3NG3A 3DG6A 3TXZA 1OYBA 3VNYA 1QVBA 3PUEA 1WOBA 4PBGA 4NX0A 5A69A 4NZ4A 3VIHA 2Y4SA 3UZWA 1NOWA 1X96A 4NL1A 1XG4A 1J0HA 2JBMA 3FEQA 4UFIA 5HWNA 4HNTA 1VB9A 1O1ZA 1GEHA 1QMLA 3M0HA 4ADSA 3P0WA 3RMEA 1UROA 2OYLA 1O5KA 5DMNA 2B7PA 4B3LA 4AWUA 1XFCA 3ARUA 1IGWA 2EQDA 1AZ2A 1B3WA 2R1KA 3UNDA 1R8LA 4F2TA 3KEHA 4JKMA 1P7TB 4BHYA 1JPKA 3Q2DA 2GVLA 3H2OA 1PV8A 4WKFA 1A5LC 3B3DA 2A5HA 3S5YA 1SFLA 1K8XA 8CGTA 1LL4A 1CXIA 2RDUA 4DPQA 1QOXA 1XLHA 5CCZA 5LHFA 4IIFA 3EOOA 1HJXA 5G1MA 2OB3A 1CGTA 4DJFA 4DBSA 4MMWA 1JPIA 1JL8A 4UMBA 2FH8A 4HMNA 1XW8A 2D2JA 2XZ7A 3BSHA 3QY8A 3OB8A 4F9JA 3NEVA 3OBKA 2VFIA 1EIXA 1XRVA 1UUQA 3N12A 2KX9A 3CTTA 3EXTA 1OC7A 2QGYA 4FOKA 4KMQA 3A4XA 1Y65A 2E9MA 3P93A 1J12A 3C56A 3G1SA 2GJLA 3ZVHB 4JX6A 2FJKA 3P82A 1TZ7A 1KFLA 4HPGA 2VM8A 1F5ZA 3B8SA 4NJGA 1Z89A 4V15A 3GY1A 4IIEA 4IIGA 8RUCA 2B7NA 4RCXA 1WDPA 1LROA 1Z6KA 1K9EA 3RFAA 2O7SA 2EBNA 4H41A 4ASTA 4FOUA 1CLXA 3HA1A 4GQBA 5ECVA 4NXSA 4TVCA 1TJPA 5MHBA 4DWSD 3IGXA 5BU6A 2AMXA 2R82A 3P3BA 5CC7A 3LU2A 5D2TA 3GVVA 3KBNA 1JDEA 3NZ1A 4R34A 1XLKA 2CBJA 3WLLA 1R38A 4H8VA 1VH7A 1BYAA 5BRBA 3EWUA 2Y62A 2INEA 1UWRA 5AFDA 4M8UA 2FZ8A 5I24A 3NXFA 4RUBA 3WF0A 4RNIA 4IH3A 1B9BA 1GVQA 4BWLC 3S2NA 1E0XA 3C3UA 3WEZA 2X1TA 4JPGA 4PMYA 1ECEA 4M7SA 1MDRA 2XN2A 4UZSA 3CUIA 1AA1B 3N2XA 1M1BA 1WZAA 1QAPA 3NPUA 4NG3A 5HOSA 2QCGA 3BLPX 2D3LA 4NZJA 4F48A 3CUHA 2X05A 3U2CA 3SI9A 2FMNA 4DPPA 3PZIA 3F2BA 2CCRA 1WXZA 3ZJ6A 4BA0A 4MKVA 3CZGA 3OLIA 4WDTA 4ZB0A 1MUMA 4INFA 5M3WA 2ZXDA 2ZA3A 4JNYA 5EMLA 1ME7A 1N82A 4GC4A 1SZEA 1M7XA 3ZQ9A 2V30A 1MW1A 1KCXA 3WFAA 1PWMA 4ACYA 1CXEA 4L1XA 2BOEX 5KMYA 3UJEA 1D3GA 3E0FA 1H50A 2VENA 3T0AA 4CQBA 4A2SA 1B5TA 3ARZA 3LPFA 5A2AA 5EMKA 3PNUA 4L1WA 3UJFA 5LA0A 1JCJA 3V1HA 3VD9A 4FNPA 2V5DA 4M51A 1EGMA 1KTBA 4CNNA 4AXKA 4JX5A 4I7UA 3VIFA 4H9VA 1OIMA 1GT8A 1YDYA 2Q09A 1T7LA 4HCHA 3MCMA 4A3RA 3UZJA 1SZGA 3R43A 5C9WA 4H2CA 4TV5A 4U2ZA 2POZA 4E2DA 3U7VA 3ZMRA 1U30A 1YE6A 4OTKA 4LY8A 1AZ1A 1FH8A 5CZ0A 4KFNA 3A23A 2Z00A 3N6QA 1OY0A 3MJYA 1YEYA 1OD0A 3W73A 4KGJA 4IQDA 4RZ4A 1GKRA 2Y7EA 4IP4A 1L8NA 4WQ6A 3DZ1A 4BQ5A 1TRDA 2CFFA 1XIGA 1HO1A 3PWAA 4GIYA 2DUAA 4B4FA 1RP9A 3DI0A 1A53A 3VGDA 1HP5A 6TAAA 3DFTA 4NILA 3URAA 1X7FA 4W93A 2WM1A 3TAOA 3K30A 1FA2A 4ZQRA 4ZL1A 3VKDA 4DM2A 5K9CA 4GHRA 3QM3A 4Y7EA 4H8NA 4HTBA 3SQLA 2OLHA 3SGZA 1Q6QA 4AD4A 3EPNA 1JZ3A 4IISA 2G37A 3NQ8A 1XIJA 3GIPA 5HJXA 1EP2A 4LUTA 2BY0A 1QOPA 1TYGA 5CPLA 2AOSA 3AXHA 3MANA 4BK9A 1W1B1 4A2RA 1PZ2A 2EJAA 3VGGA 3M0MA 3V0TA 2FJUB 1UR8A 3GDKA 4UQEA 3SQMA 2G3FA 1U5VA 3T8QA 3UETA 4Z2GA 3IIZA 5I00A 4Q8VA 3T08A 1ZAIA 4JHMA 3VNKA 4ZO6A 3THUA 4NJHA 4LT9A 3KS6A 4Q8WA 3ITTA 4I6KA 3PUDA 4QLKA 5K4ZA 1GONA 3PZUA 4ZSTA 3CWNA 2H3BA 4GKLA 1JUEA 1X7IA 2EPLX 4DEFA 3G0XA 1ZENA 4QFUA 3A12A 3W0KA 4GUHA 3S46A 2GUUA 4F0KA 4MJZA 3LPGA 3TC6A 1HW6A 4FA3A 2D2HA 3KCLA 2HDJA 2GQ3A 2XISA 2DH3A 4MZ8A 3EMCA 3MMUA 1QNPA 1PEZA 3MMDA 2CLIA 4OQVA 4POCA 3F7JA 4XWUA 3PZ9A 3UPWA 4GZJA 1LWJA 3DHDA 4F0SA 2ZZ7A 2DVUA 3SO7A 5FOOA 4PUKA 2H9AA 2ZFAA 4FS9A 1X1ZA 1FH9A 4B5NA 3SJNA 3F2DA 4Z1CA 1EP1A 4KRUA 1ZLPA 3AIRA 1A5OC 2HQAA 4JDYA 2TYSA 5D2YA 2PBGA 1ZTVA 2ACSA 1XKJA 3MMWA 2YZRA 1CNVA 1BLIA 4O10A 3TW9A 4YL2A 5F4XA 1W9XA 3UZYA 5LZLA 3QGKC 1F6KA 5IFTA 1MZRA 2NV2A 1D8WA 2VFGA 1QHPA 3WD2A 5EFFA 3V0UA 1E1EA 3SSJA 3AMCA 3MCNA 1TJ0A 3UT0A 2XWDA 4D8LA 4LPCA 4U3AA 1WV2A 2ACQA 4Q4SA 2WHJA 2J7FA 1TPB1 4C6FA 1ITUA 3MV01 1UR0A 4N9DA 1M68A 1LG2A 3STEA 1CLVA 1WKYA 7A3HA 4JFWA 1UC4A 1UD5A 3HPSA 2A3AA 2QUUA 1RSCA 3W00A 1E71M 2GGGA 1ZL1A 3UZ5A 4MZYA 3BOLA 2REQA 3HG4A 1GQIA 2CEQA 1SQ7A 1KBBA 3CUJA 4PMJA 3B40A 4I8YA 2HXUA 1BGAA 3EDEA 3GC4A 1E6XM 3GRIA 4A35A 4HZ6A 4AHOA 3BLDA 3LGGA 4WOZA 4MLJA 3QR0A 3OLEA 2PFHA 3L2MA 3SFWA 5HR6A 1J5TA 3GK0A 3WLHA 3FXYA 1TWWA 3TR9A 2E9BA 1TZZA 2JGQA 2XPKA 1Z44A 4HA0A 1WO2A 3E12A 1BQGA 3ALGA 3ICJA 5M1TA 6A3HA 4YVXA 1B2YA 3AAMA 4ZGYA 1EL3A 1ZJBA 4F79A 1WQ5A 3W1TA 2VTFA 3GDBA 1RPKA 3RPDA 1KBIA 1L6WA 4DVOA 1V02A 3FLUA 5HNUA 1NDZA 1IXOA 4DB7A 1HJVA 4RV3A 3K46A 4J7RA 2YXGA 4ZOBA 3O3RA 3AHZA 1VENA 1GZGA 4GQGA 4LUSB 3LQGA 1I2PA 2FTYA 2ZRWA 1RD5A 3ATYA 4M56A 1QHZA 1HG3A 1GPFA 1EC9A 2YXOA 1K3UA 1OM0A 1UP0A 3VKBA 3A64A 3U57A 4LALA 1ONXA 2YSWA 2BLEA 3NO3A 3H2EA 1RJQA 4CD5A 3WX7A 4E2BA 4UQ9A 4Y9NA 1KM5A 3CZKA 1H62A 3GZAA 3N14A 1C8VA 3LQLA 2FPVA 4XZWA 1Q3NA 2BVDA 2F9RA 4LUSA 3MWCA 4JTQA 4PMOA 1NWTA 3F4CA 4XG1A 4YYCA 2P0IA 1XLFA 1JYWA 3VD3A 3UXIA 2QEZA 4MB3A 4AWSA 4JQ4A 3AHYA 2G3JA 5DLCA 2X1IA 5JU6A 4I9JA 4XAYA 1FXQA 2J62A 2JALA 3RU6A 3L68A 1P4CA 2TAAA 3NL2A 3M16A 4Q8PA 4E8DA 1TPEA 4BJHA 4C6PA 4M1BA 4PRTA 2OVLA 2PWUA 2FQIA 3WJSA 1UP2A 1XLDA 8A3HA 2OMAA 3O15A 1KKOA 4RE2A 4W7VA 3RIKA 1EGZA 2J4GA 4UOQA 1PZ3A 3QTGA 2PMQA 2CESA 3KE0A 5AHLA 4Z2HA 2EKCA 4ZOAA 1WKDA 2QCNA 3W82A 4I8DA 1WXJA 1LOQA 2P5NA 4LS2A 2XN1A 3GNOA 4RDZA 3FCPA 4ZQOA 1UZHA 4O14A 4AW7A 1RHCA 4NSBA 3DFOA 1XJBA 3UPMA 3URBA 5D8WA 3G1DA 3MSDA 1CLKA 2ISWA 4BI7A 1HJSA 2OQLA 1GVRA 1YPXA 4IIBA 2AGKA 1BWKA 2PWHA 1OZMA 1WUEA 3MHUA 4PMDA 3L4VA 3GBEA 4NYYA 2GL5A 2FHCA 4K1WA 1X8FA 2W5FA 1J0ZA 3N9KA 4QE5A 3ANUA 2NX1A 3R0KA 4I7VA 1I1WA 1JQVA 5JH2A 2DGAA 2EF9A 4YMZA 5GJNA 2DZUA 2E5DA 2ZUUA 4O17A 4ZXOA 4MNJA 1E0UA 3BG5A 2OSYA 1SPQA 4K39A 2CHRA 4WDWA 3AS1A 1YW1A 5AECA 4WXYA 1N8FA 3CAWA 3W1QA 4WIWA 4AEEA 4IUOA 1ZBVA 1IIGA 2V5CA 3WQWA 4UTHA 1EJUC 3IGHX 4LF2A 5A5WA 1UMYA 5D9MA 1I2RA 1KCLA 4O52A 3W25A 3LSBA 2WZTA 4P2VA 1F7BA 4IJRA 4NJJA 1POJA 3R6IA 4L5ZA 1A5MC 5IXEA 3Q65A 3B8TA 4W8LA 4UNKA 3AJ7A 4TUFA 3MZ2A 4X63A 5D9PA 5AC6A 1AQFA 3AQUA 3USBA 3FOKA 3C2YA 1V03A 4GI9A 4LBRA 3CUXA 3H26A 1U2YA 4FO4A 3HQ1A 1D7KA 1T99A 3GHSA 3VE9A 5HINA 2IKIA 5GJMA 2D23A 2YLAA 4CQDA 4YIWA 5BXTA 6REQA 1Q45A 3GIQA 4ZXLA 1QR7A 2PZNA 1RH9A 1W3JA 4AUBA 1KB3A 1KFCA 1M65A 4MWAC 1Q6GA 2ACUA 3BOFA 1V6XA 1T8XA 2E68A 4WJEA 1RCQA 2YYTA 1ALDA 1DE6A 1U33A 2HS8A 1DBTA 1US0A 3JW7A 1FCBA 1X6NA 2BBFA 4WZHA 2PDFA 9RUBA 3NQ7A 3W1MA 2ISFA 3TZFA 1W1A1 4G7FA 1F9CA 3JZEA 3M0ZA 3GHRA 4ADUA 2C1GA 1QPOA 1NM9A 3L0GA 1LOLA 3HFYA 5CH9A 4F9DA 1Q85A 1DJYA 1W3HA 5M5DA 2VL4A 3M5XA 5U7SA 3TYZA 2Q71A 1XDLA 2PDHA 5E6ZA 3VA8A 1ITXA 4C6EA 1UW9A 2WJFA 3SM0A 1P1XA 3GXTA 1W3NA 3N11A 4E5TA 4NJKA 4GKTA 1KM3A 3TN4A 1Z8AA 4PZVA 4I7WA 4A4AA 1OVDA 3S0CA 2V5JA 3PJTA 3BPWA 3V5FA 5CSUA 3U7BA 3HGJA 4ATWA 2QUTA 1F3TA 4DWSA 1PCKA 4B5VA 1PHWA 2NSOA 3LTYA 1FHLA 1GCYA 2DW6A 3WL1A 3ZR4A 2XIIA 3BSGA 4G8TA 5REQB 3L67A 3YPIA 4K8HA 3UY7A 3ZR6A 3ZS4A 1W31A 2WVVB 3KP1A 3CNYA 3K5XA 3NQMA 3CV7A 3AFBA 3KVJA 3RF9A 5BOOA 4XVDA 3TJ4A 1CXFA 4FNTA 3I65A 2CZVA 1UPMB 3T8LA 1GW9A 4Z2IA 1NP2A 1A0EA 1HT6A 4H9YA 4LAOA 4CD7A 1IHIA 5REQA 2QUNA 3TCEA 3VOIA 4O1DA 3C61A 4DF1A 1D3HA 3I4EA 1BTCA 2BY2A 2YCJA 3DBPA 2VGBA 2CZEA 2XINA 3PS7A 4TXEA 1XH0A 3MHFA 1S2TA 1D2KA 4AVFA 3TP4A 3KOZA 5DX7A 3DOPA 3N18A 5I3FA 1UKTA 1VHCA 4J3SA 3LV6A 4HU4A 3ES8A 4H9TA 4R9XA 2Y5EA 2WM0A 1XIHA 4H4IA 4RZ6A 1SVDA 3NZGA 3A3WA 4WY0A 1J96A 3H7RA 2PCEA 2BY3A 3EWDA 1S2UA 4AZ5A 4AH7A 3OQ8A 1JJKA 1QI3A 2X7VA 5HWMA 1ZFJA 1YNQA 3W70A 4RE3A 4JIHA 1J6PA 3L2LA 4X60A 1NSJA 1EF3A 1JR1A 1NFBA 2FHBA 2CKRA 3N17A 4PL2A 1H49A 6TIMA 1GOMA 1PX4A 1V3MA 1YXDA 3CV2A 3SUVA 3SRFA 1JYXA 1XSKA 2OPJA 1U22A 3K1DA 5LA1A 3KOXA 3NURA 3T4CA 4TQTA 4BQ2A 1OCBA 3DC8A 4GFSA 2X7WA 3N34A 3KX6A 3NGFA 1UZDA 3L0NA 2WKLA 1E9LA 3ARTA 1XUZA 3BOXA 3KWXA 2W79A 1PZ0A 2EPKX 3S8HA 1AJZA 3R8RA 3PBMA 3EMQA 2I57A 1XIFA 3M0LA 5T91A 3N15A 2VJXA 4RDYA 3BQ5A 3RR4A 2IQDA 1XYZA 3WEMA 4G2DA 3EKZA 2EPHA 2B81A 3M46A 1EA9C 5DT7A 2IPGA 5E0CA 4JQ3A 3WQFA 5AHEA 3LHUA 3M0XA 3BW2A 4A3QA 3M9YA 2QS8A 2HK1A 5AHIA 1JG9A 3B9NA 1I6NA 2FZMA 5T26A 2WPBA 3OA5A 1F8MA 2BHUA 4C6MA 5TBOA 1A5SA 4MHBA 2VUYA 3QSTA 2HMCA 3IRSA 1CDGA 2AKZA 4KFPA 2PF0A 3W84A 4QP0A 3BO9A 1GQKA 3JUGA 2BASA 2FVLA 1O12A 2FZBA 4JL1A 3F5JA 4UR9A 1CGVA 3OVPA 3T07A 3DIPA 2DSZA 4Q8QA 1G4PA 2GVGA 4HHMA 5FF7A 2CWNA 3ARWA 4QLJA 1X8CA 3OO2A 4QQUA 1CBGA 1XLIA 5C9RA 3JR2A 4IMFA 4NQ1A 1YTKA 3LM3A 1R87A 5C2GA 1KM2A 1Q7ZA 3GVGA 1AVAA 3U5UA 1R2RA 5LNSA 3CMJA 1WDWA 2IUZA 3MUAA 2XJ7A 1RVGA 4L6DA 1H7XA 1X6LA 4L4MA 1A5KC 3HN3A 4OVXA 2PP3A 3P84A 1YBQB 3EXSA 4LQ1A 4UFJA 4PMRA 4NVTA 1AH4A 3KL5A 1XD0A 4I6VA 1WCGA 3MUIA 1GYLA 4CVUA 2G3NA 3LHWA 4L65A 1TMLA 4CQ8A 1JZ8A 3R5EA 1P6BA 1PKMA 4RZBA 1H60A 1Z9AA 3AWOA 3WBYA 1V0NA 1BWLA 1AFSA 1KV8A 2O56A 1KLZA 4XISA 3RK8A 1NAL1 1ME9A 2PLKA 3AHVA 3PAOA 4R5EA 3HPFA 3H23A 2PAJA 4GNKB 3MJMA 4ACZB 3UJSA 2CWXA 1VF8A 4QTGA 2WBKA 4PTVA 4YVPA 4UXDA 3PUGA 2XVKA 2BODX 2BZNA 4J35A 3W85A 1PKNA 4ORIA 2HEJA 3W24A 2YIHA 2ZC8A 1TPC1 4ONVA 4OOUA 1A5AA 3N04A 4PMUA 1TPFA 1C8QA 4HBKA 1EHAA 3IVSA 3WENA 1XGZA 3B9AA 3ISIX 4O18A 1BXNA 3SGGA 1MWOA 4HD5A 5I03A 2PGEA 3SN0A 3EKLA 3FHQA 3CPGA 2HPIA 5I3IA 4LJ3A 1RR2A 2A3BA 3WJWA 2Z7KA 3WBEA 3D3FA 3PZTA 1AQHA 1Y7VA 3G0SA 2ZX9A 5DANA 1UD8A 3LBMA 3UPBA 1ZBCA 3HOJA 3W7KA 1J0YA 3QYQA 4IM4A 4WOQA 2E8YA 4IICA 2W4XA 1C7TA 3MI3A 3VMOA 3WELA 3ZJ8A 3CT7A 3U2OA 3K4DA 3CV1A 2DEPA 2Z6JA 5FJRA 1MW2A 3O6AA 4R7OA 1YTDA 1QU4A 3ANVA 3FKKA 4MPKA 4L6HA 5G2IA 3MSYA 2B4GA 1OX4A 1K4HA 2YGYA 3PPHA 1Q66A 4H04A 4ZFCA 4IP7A 3CUFA 2JEPA 5H91A 2F61A 2YW3A 1OT1A 4ZE5A 4P61A 1OYAA 1VFMA 1DJXA 3GFYA 4PL1A 3BAWA 3QHOA 1FTXA 4MDOA 3MKCA 3ZSSA 4XKMA 4MWAD 2PTDA 2YCLB 4KEVA 3OHIA 3P61A 2Y8UA 4MYXA 1LORA 1XLEA 4C5ZA 1BF2A 1QASA 1A5CA 3T42A 1VFUA 4DNHA 3E0LA 5KEZA 3LV5A 2DFAA 1E9IA 3GDMA 5BOFA 3LEPA 3S5SA 3L5AA 2F6KA 1QW9A 1E6QM 1KBKA 1HQTA 3I3DA 5CLTA 1SYTA 4PMNA 3LERA 5IBXC 3GXFA 2BX7A 1A4MA 3GG0A 2ATSA 2CYGA 3G5EA 4P7OA 1TR9A 3EWCA 1MNZA 4NUWA 1CGUA 2FH6A 3W4RA 1EZWA 4XZIA 2GGIA 4US5A 1B31A 3W76A 1G5AA 3HU7A 3GG1A 9XIAA 1JVNA 4GLEA 3O6CA 3T2PA 2QDHA 1Q4NX 1Y5VA 2WCGA 1TUFA 4GO9A 4J3WA 3EEZA 5HR7A 3R10A 5CLWA 3TW7A 3U0HA 3GG8A 4I90A 3W7HA 2GJNA 3DG7A 4MDPA 1VEOA 4F0RA 2C0HA 4W7UA 3KP0A 4MWAE 3TC7A 1QDSA 3BANA 1VR6A 1GVIA 2P0OA 1BQCA 4LSBA 3PBVA 1BF6A 3SCSA 3DGBA 4DX3A 1XWYA 1E70M 4DAFA 2NVAA 5DBUA 1XLJA 4D6CA 4GVGA 1R30A 4OWGA 2Z27A 4DZHA 3VDHA 1QI0A 2V9DA 1GOKA 4PMZA 4UR7A 1EX5A 3UF9A 4GNVA 5FEZA 2J66A 4J3UA 4PEEA 1XIDA 4GJIA 2HS6A 3PG9A 4HA3A 1EFZA 3EB4A 3V5CA 4FXJA 1V0KA 2I9EA 3SUUA 1XG3A 4W4QA 5D4YA 1O94A 2PTYA 2J7DA 1BWVA 4V33A 4JGDA 3T78A 5ABHA 1CB7B 1CIUA 2ZVIA 4GH3A 1RK6A 3P7YA 1S2WA 4DJFC 2J6VA 2OKTA 3OG2A 2QPSA 1ISVA 3H4XA 2FTPA 2QCDB 4YCOA 2QW5A 1FWEC 1CB2A 3P74A 1XIEA 3VINA 2WHKA 1ZNNA 3IRDA 3Q37A 3R13A 1R46A 4GIRA 2YJQA 3ZLHA 3N6JA 1F05A 1K70A 4KETA 1E43A 1HVXA 3GXDA 3TA6A 3AS3A 5KTLA 1J4EA 4ZEPA 4TX9A 4DF2A 1LL7A 1VBGA 1A80A 5I79A 1QPQA 2PP0A 3A9BA 3VD4A 1MEIA 3GB6A 2QDGA 4FXFA 2GWNA 5C6MA 1UD6A 3GR4A 1TTQA 2CU0A 4PCNA 2VP8A 3NZQA 4N4PA 1LQ2A 4KQNA 4AY1A 3EKGA 4O4VA 3S6TA 3WDRA 1HVQA 2VXNA 3L66A 4JN6A 2W9MA 5K7JA 4FX8A 1OD8A 1TPVA 3ERPA 2RHGA 1R3YA 5AZ0A 2W62A 3B03A 4DYEA 4A05A 2PDJA 3VPLA 1HGWA 1KFEA 2VC7A 3RM8A 2P8BA 3ARPA 3G24A 4O8AA 1JDCA 4NNCA 4HNNA 2FDMA 4DRSA 4D6JA 3B0VC 2YFNA 4HYVA 1O5QA 2BXVA 1PO9A 3WMSA 3CYJA 4FNRA 2G0WA 5GNYA 4KIEA 5EL1A 3ARRA 3UXDA 1W3KA 4HA4A 4L61A 3EPMA 3CTLA 2V5KA 3VNMA 3BCDA 1WAWA 5EYWA 3UGVA 2ZQ0A 1JFXA 1TV5A 3IV3A 4C5YA 1KGWA 3BZGA 3VM5A 2DIEA 4CKQA 1W1IE 1T5AA 4B5XA 4MIMA 3WDHA 3A47A 1F3WA 4IFKA 4HNLA 4Z1AA 4EIVA 5AB3A 1JDDA 1TREA 4E3VA 3W7CA 3GBDA 4Q7NA 1J8VA 3S2CA 4FXSA 1BVWA 2VC6A 1SJBA 2HXTA 4D1JA 2CLKA 4PB3A 3AALA 1K7EA 3M6DA 2NUXA 4NXKA 4QGCA 1E72M 2DQXA 4MB5A 1OB0A 2CZDA 4LF1A 4HZ7A 2XIQA 2KZHA 1R47A 5EMUA 4UNIA 3FNDA 4WJ8A 4OE7A 2IKJA 5DQPA 3VAVA 1AL8A 1S5TA 2MANA 3AIQA 5HDRA 2J9ZA 1JFHA 1MMFA 4AC1X 1E9ZB 1H4PA 4KWUA 4H00A 3ENLA 4FI4A 2ZA2A 3N2CA 2PSNA 4U28A 2EG6A 1S2VA 3S2MA 3RMJA 5F2GA 3UJRA 3TNBA 3D47A 3HTWA 1GOWA 3WH8A 1DQUA 2X41A 3TWBA 1V6TA 3IWPA 4ILSA 4AMCA 1SSGA 4CD8A 4H7ZA 1EC7A 1E6SM 1L0PA 3OG3A 2ZUSA 3W2JA 4GA8A 3H2FA 3WUBA 3STGA 2OTDA 5A6TC 3TN5A 3LXAA 3TU9A 2QXWA 3GVRA 3LZ3A 3KCOA 3WH7A 1M5WA 1Q8AA 1W5NA 3LZ5A 1TVPA 2J27A 5I5RA 2VELA 3ITXA 2UY3A 2VFEA 4GUIA 1F73A 3GFXA 3W6LA 3SECA 2QF7A 1RD6A 1UKSA 2WV8A 4RL3A 1E1CB 1FHUA 1VEPA 1SMAA 1EX1A 2ZUNA 3CEPA 4X2RA 5C7HA 3NVTA 5IHRA 1S3TC 2PZ0A 3OZYA 3C0LA 1UCWA 1TFVA 3AYVA 1H61A 1KRCC 1H11A 3B9DA 1LYXA 1IYXA 2GQ9A 3UXLA 1XBXA 4YTUA 4ZQNA 4AEFA 1GG1A 4QEEA 3W7GA 4O11A 4J9JA 3N19B 2WCAA 2H8ZA 3TSDA 3KRUA 2F2HA 1G7UA 1BKHA 3W37A 4EPBC 3L5MA 3EPOA 6CGTA 4WX2A 3IGSA 4GZ7A 3MC5A 4H1ZA 4WSJA 5G5IA 4C6DA 2P3ZA 4DUOA 3A5VA 3V35A 1S3HA 5ABFB 2Y7FA 4E0CA 3WH5A 1EXPA 2EPMX 2A1YA 1NQKA 3D0CA 4NF7A 2VI0A 5DXYA 2FDSA 4RLIA 4DUVA 1ZSXA 1LZOA 2F38A 1KXTA 5I02A 4DBEA 5XIAA 1KBLA 4PTNA 1JCLA 4C7DA 3W3OA 1JRBA 1X1NA 3VMPA 3PWGA 3KL3A 2YB4A 3BGJA 3G8EA 4PTXA 4L56A 4RW3A 5I3JA 2PU0A 4JS3A 5M03A 1C29A 1LQ0A 1NWRA 1VFFA 4JDBA 2C79A 1FDYA 4PC8A 3HG3A 1JUKA 2CLFA 4LBSA 4O15A 2J8GA 3AICA 3LPOA 4N6EA 2VX6A 4Y90A 4QE1A 2GK1A 1NU5A 3THQA 2PWDA 3BMVA 4UTJA 3RRAA 4A8NA 1C93A 2ZZ1A 2WQPA 5LXXA 2NZLA 3SIMA 4K6AA 4C6KA 1VP5A 4Z0SA 1O95A 4O0QA 3UXKA 5KITA 4PMXA 3W1UA 3N13A 3EAUA 1XSIA 2CLMA 4HMCA 4YYFA 3IJLA 2Y89A 1OGGA 1J0KA 3GYCA 3OVGA 2VEPA 1RCOB 2HTMA 4HA1A 1GJUA 1OK6A 4IQLA 3ARYA 4KEUA 2JQXA 4B2DD 5LXEA 2RDTA 5BRQA 5AC8A 1GGOA 3RO6A 4S1FA 3TYBA 4MGGA 4AZGA 2Y6ZA 3SDOA 3WK2A 3GKFA 3AC0A 4UQCA 3DFHA 2YCKX 3RHGA 2BNJA 3MPGA 4MJ2A 3DH7A 1S5VA 3M41A 2ZRVA 4XZMX 2JF7A 1IEIA 3QR3A 4E38A 4G1NA 3GXNA 4LGXA 3TTQA 2INFA 3FV9A 3KOWA 3VGFA 3VZYA 2V81A 1ZPTA 1VRXA 3G6LA 3ZWTA 1SJCA 3F4DA 4IGNA 1MO0A 4JAWA 4LXFA 3MKKA 4OOZA 1MXGA 3CZEA 4DJFD 2WMIB 3LLDA 3UP8A 1OT2A 2PDPA 2GUYA 2QV5A 3JRKA 3PZMA 2EAWA 3TOYA 3A5FA 3KBSA 2P3EA 4ZQMA 4DBUA 3PUOA 2PA6A 4AF0A 1LRNA 3AUJA 3QV7A 3KBVA 3NSXA 4PULA 5FI8A 3OZMA 1WZMA 2YDQA 2V5BA 1MXDA 4E4PA 4JTTA 5D2WA 1RPXA 1RLCL 3N2TA 3JU2A 1QXLA 2Z2AA 3ARVA 3WK1A 3PPCA 2PC8A 3BCJA 2QPXA 1CCWB 5FJPA 3IJ9A 4KWOA 2WC7A 1VBHA 1XFBA 4R3UA 5CJNA 4CQ9A 2A21A 5JH1A 1IQ8A 4LEFA 1HL8A 3EB3A 1VJIA 1Q7QA 5AC5A 4QSHA 4CU7A 1ESWA 4IPPA 3WO8A 4QSFA 3LSCA 1PUDA 1TTIA 1ZUAX 5HAOA 2CLHA 4M1RA 3AO0A 1I4NA 3MMTA 5L6UA 1BVZA 2Z7GA 3VIIA 1R86A 3ECQA 3LCLA 5D05A 4C91A 3AISA 4ZMGA 4DJEA 1V3JA 2WWDA 3W2KA 5ABEA 4GYPA 5CC6A 3VUPA 4NZCA 1TKKA 2VVNA 3EZ4A 4CUCA 1JGIA 4N9CA 1PX8A 1E9YB 1M01A 2PLJA 2O9OA 4MWAA 3WQDA 1YXYA 1GVSA 1W32A 1L2QA 3BUVA 4M82A 2ATMA 3HM7A 1HKVA 1NJJA 4GI8A 3EX4A 2ZVRA 3UG3A 3OYXA 5F2IA 2PODA 4AIUA 3CO8A 4XKYA 3BCFA 5BXRA 1J10A 2E28A 1RQHA 3WQ4A 4XBSA 1DWIM 5CSSA 1FFQA 1FY6A 4H83A 5D04C 5LIUX 3WL0A 5LKYA 3VGEA 3BL3A 5AKQA 2RJGA 4ZB5A 4L9XA 5AHMA 3CHFA 4Q6JA 4AVNA 1DOSA 3B0UX 1UWAA 3W7PA 3H8AA 3TSMA 4CU6A 2I5QA 2J78A 3IVUA 3AZTA 3SRDA 3ZJKA 3COTA 3QJAA 4GH1A 1J2WA 1F4AA 3H7VA 2WJDA 4A3UA 4MY1A 4OECA 5A3HA 3LTPA 4S3GA 5B7ZA 3TTEA 3EDJA 1OSEA 2GOUA 3II1A 2E6AA 7TAAA 1V79A 4B5TA 2IXVA 1DQWA 2J47A 2WVTA 3PJWA 3QN3A 3N73A 2WO5A 4IPLA 3GU9A 2OODA 2QVHA 5HMSA 1I9CB 3BMXA 3QHMA 4WDUA 4YVVA 3NEHA 3OQEA 5GQBA 5I77A 3LCIA 5A94A 2GFTA 4JX4A 5DCDA 4IMEA 4AB4A 2HSAA 1UWQA 2FVMA 1O66A 1R2TA 4AMAA 1J2BA 4WSKA 5DMLA 2O92A 1FWFC 4ALDA 1EQPA 1V3LA 3B8UA 2WPGA 2FB3A 1TWZA 1ZU8A 2NX3A 1UYQA 4QXIA 3CUZA 4LAMA 1ML1A 3AROA 1NDWA 2DJXA 1AD4A 1FWWA 4JFVA 1US2A 1IT7A 2GSEA 3RCYA 4HOZA 3NSNA 4N0RA 4UTKA 4IGMA 5DMYA 3DECA 3NQVA 2L5HA 4JY8A 3UU0A 3WQVA 1UZ4A 4KW2A 3MP3A 1PTAA 3OIHA 2WMFA 3VUSA 4DN1A 1V4YA 2WSPA 1ELSA 2YL8A 3TN3A 2C14A 1V77A 1MNSA 3GW3A 1P0KA 4D6HA 4W5ZA 3CMFA 3PTMA 2WKGA 1ISZA 3IANA 1W6TA 1VRDA 2JKPA 4B5WA 3WSUA 3W7IA 3E5BA 3UWEA 5FJIA 2WK2A 5I3GA 3JZUA 2ZZ2A 1TJ2A 2BY1A 2DSVA 3TFCA 4QRNA 2CNCA 3PTQA 3WLIA 5FSEC 3H2AA 1K4GA 2QCFA 3RUBL 4MFDA 4LNYA 2P53A 3L2IA 4XZNX 3WLPA 3NQFA 1AQMA 2GJXB 3FY1A 3FYYA 3IARA 3RX2A 4PFMA 2OZ8A 3N6HA 3H4WA 2VDHA 3VABA 5CSRA 3WNOA 2J7HA 3TR2A 5CGMA 4F0MA 5D33A 2G4FA 2ZRUA 2CLOA 2V67A 3GE7A 1QBBA 3LD5A 4GXMA 5AYBA 4OU1A 3L4ZA 2DJLA 3TC3A 5D2VA 1WPCA 3FVDA 3ZYZA 3THDA 1DWHM 2QCMA 5MKGA 1BEUA 5FJUA 3MCOA 3DFNA 3RJYA 4V2XA 2PDMA 3E3HA 3KAOA 3OGSA 3SUWA 4L4LA 2X1SA 4QG8A 2W91A 3APTA 3EOEA 2E6DA 4B91A 3W81A 4JEQA 5TD4A 3U2ZA 1SO3A 2PDKA 4X22A 2VCAA 1TMHA 2Z0IA 2CZFA 3CIWA 2DSKA 1WBHA 2HPMA 3HV9A 1DJQA 3SN4A 3M5ZA 2H8XA 5CSYA 5LNRA 3S9ZA 3VOJA 4MSSA 2ZDRA 2W61A 1H5YA 4ROQA 2VQUA 1TX0A 4LS1A 1E3XA 2QCHA 3V3WA 5FF0A 3BG9A 4EXAA 1UZ1A 4LVBA 4TO8A 3QF0A 3H22A 4E8GA 1TV8A 4HZ8A 1H1ZA 4LVGA 1QNOA 5BROA 1W1ZA 3GS6A 3NM1A 2OWXA 3FEMA 4MKNA 3W27A 1IWPA 3DESA 3G77A 1TV7A 1JZ6A 1I2OA 4B3KA 3G1FA 4DF0A 3CGTA 1Z41A 3EWBX 2EGZA 2Y0FA 4GQRA 1ECQA 3W1RA 4NJIA 2E0PA 5CAKA 4Z2KA 4IQJA 3SCOA 3N9RA 1KFWA 2XFRA 3MUCA 1KCZA 2XWEA 3IAQA 4HZMA 3D3AA 2QCCA 1OCNA 4HTYA 1JDAA 2XHYA 3WUFA 4FHAA 1P6CA 3O7UA 3POHA 2VEGA 3SADA 2ZC1A 3MSRA 4ZR8A 3TAKA 2HROA 1YPIA 4GVIA 2BOGX 2CBVA 1ISWA 1DKWA 2Q02A 1ITCA 3W28A 3FYOA 1JCNA 5KZEA 4HJWA 2GSHA 1UD2A 5IRPA 2VEIA 4XAGA 2OZTA 1QW7A 1HKJA 2VQTA 5G4HC 5CPSA 3ZT5A 4I9MA 3IIXA 1PWLA 2G41A 4EX4A 5FAJA 5A6JA 3HPAA 3UR8A 7ENLA 2PRHA 4YTTA 1DPMA 3HB9A 4M24A 2EXOA 3G1VA 2CIPA 4B5SA 2PDGA 2VO5A 2FTWA 1VYRA 3GQYA 5EGRA 2WANA 3LMZA 4DZ5A 3NWRA 3E0VA 4E2OA 2Z6IA 4D71A 3TNOA 3WLNA 3S2LA 4IXHA 7REQB 3ONBA 4H01A 1H1YA 1PVNA 2C13A 1NH6A 5TAOA 2P1FA 2QJHA 1FHDA 3GTXA 2XSAA 3A21A 1VFTA 3QMRA 2VFFA 1JCTA 4AC7C 3DYPA 2OR2A 4HK6A 1V02E 1XPGA 2HBVA 1WDRA 3VD5A 1CI1A 1LQAA 1DHKA 2A3EA 3P62A 4GX8A 4BR1A 3AIVA 4IJBA 1GQLA 3RAOA 5A95A 1KR1A 3I68A 3BLEA 3GNDA 2FFCA 4GY1A 5FEXA 5ABGA 1ZAJA 4QE4A 4TVUA 3BAYA 3GH5A 4C1NA 3IJIA 5A8OA 5AZ1A 1LOSA 3EX2A 1RQEA 3TJIA 2QLYA 3PZOA 4AHPA 3LI1A 4URIA 5E9AA 3CT2A 4M5PA 4O19A 5DT5A 3I7RA 1OFDA 4IWWA 4QISA 5I0DA 1RBAA 3CIVA 1ADOA 3TYCA 1EZ2A 2EKGA 2PLCA 2VGIA 3B4YA 1GPWA 1FXPA 3WYZA 4J5NA 3R2GA 4YTSA 1XQLA 1HL2A 1Z32X 3RM9A 1SU5A 2J77A 2NXGA 4KWVA 1Q6CA 1KFBA 3EOLA 4UC5A 3C8NA 3RILA 4WEVX 4HN8A 1AW1A 2QYGA 1FP9A 3RLVA 4C6JA 1W9PA 3FHAA 4L7ZA 4HYWA 5HANA 1UWSA 1XGEA 4JEJA 1NWUA 2WJZA 3H55A 3SFKA 3DDMA 3M0YA 1L6YA 3F03K 5D38A 3QZAA 3FDGA 2YB1A 5CG7A 4O1FA 1KNWA 5BU9A 5HQLA 2R24A 3FIGA 3QOKA 3U4AA 1BSLA 1NP0A 1U1UA 1Z69A 1TIMA 3MP4A 2YPIA 3WQGA 4LB3A 4V28A 2FMOA 3R58A 4J3XA 1NQ6A 3NSMA 1EDGA 3LCGA 1VFHA 2VZUA 1UA3A 1K8YA 3GNXA 3O9NA 2ZWYA 4ATLA 1EH9A 3PK7A 2DT1A 2PDBA 5RUBA 4CD4A 1RJPA 2BHYA 3KUMA 1E4NA 5IHSA 3FS2A 3W87A 4O4WA 2X09A 4GC3A 4GZEA 4NI8A 3HGSA 3SRHA 1V93A 1UQZA 3ZT7A 5CKSA 5F4SA 4H6RA 4NAEB 3XIMA 3SCUA 1S38A 4NNAA 1KC7A 3LHTA 4RW5A 3KFTA 3LOTA 1H7RA 3O06A 4OUEA 4B2DA 3MT1A 2GJPA 4EPKA 3QGAC 2UY5A 1XICA 1VIZA 4DXKA 1CW2A 4AFYA 1N55A 3VMNA 3MV11 1XLMA 1UIPA 4EXQA 2A85A 1F3EA 4F8XA 1FH7A 5AY7A 3SCVA 4HNUA 4WSHA 4MADA 2HCVA 2BTMA 3S1WA 5C5YA 1QBAA 4LVFA 4WR3A 1BFNA 4O12A 4XD3A 3MVIA 3NDOA 1UKPA 2CHNA 4LTSA 1R2SA 4PMQA 3O16A 2PD9A 3M43A 1QK0A 2R9RA 3NXLA 5HPCA 4H6KA 3G8RA 2NW0A 2PRLA 2BDQA 1P7TA 5F2MA 2FGZA 3DGRA 3IJ6A 3QV6A 1A49A 4LRSA 2UBPC 4HVXA 2Y1HA 3QPEA 3HJEA 1E56A 1LRQA 3EX1A 4M6UA 4OV9A 4EPDC 1G69A 2O9TA 5LIWX 2V6AA 3WZ0E 4JIQA 3BGGA 3R12A 3STFA 1X39A 3GU1A 1ZCCA 4MFEA 3CASA 1TG7A 1S5WA 3PN8A 3Q45A 4PTWA 3O2LA 2VKZG 1XQKA 4XD5A 5IOBA 3AZSA 4XAFA 1Y5WA 3HG5A 1VC4A 5T9BG 3A4WA 4R33A 1JPHA 3M7SA 4GQ0A 1M53A 3ZVHA 1W1TA 4GY7A 3WNKA 4RE4A 1J0IA 1LUCB 3NA8A 4Q4OA 1JD9A 2PTWA 3QV8A 1PIGA 1BRLB 1FWSA 3LY0A 4U3CA 3VM7A 2XTKA 1OF8A 2NT0A 2VGGA 4BF9A 3C0SA 3UWQA 3FJNA 5KZMA 2XVNA 4AD3A 2Z1XA 2NXIA 4HPNA 3GO2A 1LBLA 4CNOA 4REQB 2Z1SA 3VIGA 1JULA 4Y9MA 4UR8A 2FVKA 3U6WA 4GXPA 2G3MA 1RP8A 3BG3A 1FDZA 2Z2UA 4Q4MA 1F76A 4MY9A 3T2QA 5C54A 3VKCA 2X0HA 2XZ9A 3VXGA 1XISA 3GZ3A 5JXQA 3VCCA 1O1HA 1KR0A 4K8EA 4Q7BA 4IMGA 4ZA0A 2PGRA 1B3OA 2C7FA 2OFJA 3PBGA 1R3TA 3CQKA 4CNPA 1J79A 2WSRA 1VPXA 2CLEA 5A8NA 3Q58A 3SIZA 2O9RA 3ZZ1A 2XVGA 1E6RA 4FLRA 1TV2A 2YX0A 4XV0A 5E0KA 3IIOA 3PSWA 3F1QA 3AYTA 4Y9OA 3UA3A 4DM1A 1H51A 3W6MA 1EB3A 2WLZA 4BQ4A 2I5IA 2QGHA 4HNOA 1OQFA 2NX9A 3WY1A 3A4AA 2EPOA 2PB1A 3ONCA 1EC8A 4Y9AA 4FPSA 3FVMA 4W8AA 1EJ7L 3WLMA 2UWFA 3HQPA 4ML4A 1N7KA 1S5MA 4GQQA 1UP3A 1TWIA 2NUWA 2Z2BA 5DRCA 4C6QA 5LIYX 3LUTA 1Q8JA 2IPFA 4IL0A 2Y61A 5I2UA 1V3IA 1EOMA 4CN6A 3VDGA 1FWRA 2YA1A 3ZO9A 4Q7IA 4PUJA 1P0DA 1B9ZA 3SCTA 3UY8A 3W1XA 2XH2A 1XV8A 2IKGA 3I7SA 3GH7A 4L80A 5LYRA 3S42A 1K77A 1JRCA 2PDNA 3MWAA 4YXGA 1M3UA 3K8MA 1RZMA 2VZVA 3SEPA 4EE9A 1QUMA 4H8HA 3UVAA 1Q2SA 3OODA 5FD0A 3QVQA 4M80A 5DN1A 1GK8A 3T6CA 4QQ3A 2XGIA 4N2YA 1I8JA 4V1XA 1IV8A 3TLQA 3B0PA 2GWGA 3EX6A 1EO5A 2QZRA 3ZT6A 1B4KA 3L12A 1XLBA 3WNMA 4GBUA 4ORMA 4C65A 1B3ZA 1KGXA 2B7QA 3FSTA 2A7PA 1E5JA 2ODOA 2UV8G 4DI8A 1Z3NA 1VLIA 3SCNA 5T8GA 3W1LA 3UG8A 4GCAA 4M3PA 2YDRA 1G94A 3W7LA 1BKSA 4U31A 4AWTA 4ENLA 1M41A 3M44A 4IGSA 4Q8UA 2MUCA 1SZRA 3GXPA 5K2ZA 4AY8A 3VD7A 2VNCA 1W8GA 4LS0A 3AU2A 4NYUA 1V6UA 3DYMA 4QNWA 3E02A 2WOQA 1NIUA 1M7JA 3E49A 1VYPX 4YCPA 3AXMA 4GYFA 1UB3A 5LIXX 4UTMA 5FEPA 2ZZ4A 1IZCA 2W0UA 3PY2A 4AVOA 4AX7A 2E25A 3TQVA 3W1PA 3MZNA 4PTDA 3PPGA 1YDOA 3ITGA 3QQWA 3UCQA 1DJZA 4LEQA 5LGZA 1Q7MA 1EA0A 4S3BA 2J7BA 5G1YA 2WC4A 5TIMA 1OC6A 2J74A 4F2BA 4UTTA 3M07A 1D9EA 4DUWA 3ARSA 2OXNA 4O0KA 5B80A 4GIAA 4W86A 4HOXA 1LDCA 1QNVA 5K3VA 1UUOA 5HNTA 3W75A 4XBKA 2WMKA 2QJJA 1XC6A 3G1RA 4US6A 3OZPA 2A3HA 4IX2A 1HGYA 4FX6M 3WQEA 1LCOA 4GG9A 2GOKA 2Z1KA 3EMZA 1IEQA 2YBTA 2OWCA 3MDWA 3MSGA 4C6BA 1HUVA 2OX4A 2A3LA 2NQZA 1LF1A 3U48A 3W2LA 1RJRA 3KZP