2R94A

Crystal structure of kd(p)ga from t.tenax
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
286
structure length
286
Chain Sequence
MEIVAPVITTFRGGRLDPELFANHVKNITSKGVDVVFVAGTTGLGPALSLQEKMELTDAATSAARRVIVQVASLNADEAIALAKYAESRGAEAVASLPPYYFPRLSERQIAKYFRDLCSAVSIPVFLYNYPAAVGRDVDARAAKELGCIRGVKDTNESLAHTLAYKRYLPQARVYNGSDSLVFASFAVRLDGVVASSANYLPELLAGIRDAVAAGDIERARSLQFLLDEIVESARHIGYAAAVYELVEIFQGYEAGEPRGPVYPLDPEEKAWLRAAVAKAKSQLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-Keto-3-deoxy-(6-phospho-)gluconate aldolase
publication title Crystal structure and stereochemical studies of KD(P)G aldolase from Thermoproteus tenax.
pubmed doi rcsb
source organism Thermoproteus tenax
molecule tags Lyase
total genus 111
structure length 286
sequence length 286
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.14: 2-dehydro-3-deoxy-phosphogluconate aldolase.
pdb deposition date 2007-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2r94A00
3G1AA 1YPIA 4YMZA 2ZZ7A 4D2JA 3IVTA 1SU5A 4I9AA 3WJWA 1W31A 1TPC1 1FWRA 3WK3A 2NWSA 5I3GA 1WA3A 4NZJA 2DZTA 2WSQA 1UBSA 1PHQA 3RK8A 2BWGA 3TH6A 4FXSA 3O63A 3UQNA 1W8SA 3W73A 3FKKA 1TPUA 3S9YA 1GPWA 4ZMGA 1GG1A 3LGEA 3H55A 4JR5A 3M9YA 4NJKA 3D0CA 3INPA 3W1QA 1H7WA 2E68A 3MP3A 4Z0JA 1KTCA 4KFOA 3KRSA 3A5FA 4LNYA 1BTMA 4JDBA 3LXCA 2G96A 4AHPA 2AQWA 2V2DA 2DZXA 5G4WA 3Q2DA 2VOMA 1EWDA 5FF7A 1U83A 3L0GA 4NX0A 4UFIA 4IMFA 1QMLA 5CPNA 2OX1A 3ZS4A 4E2DA 4ZQPA 2B0MA 4IGHA 4UXDA 2W79A 3MW7A 5G2HA 4TO8A 1QPNA 3QW4B 1FXPA 4MKNA 1BKSA 4HKPA 2QCDB 3UXDA 2VEKA 2G95A 1HL2A 3NQGA 5TQLA 3MO7A 4XKYB 2CFFA 5HNRA 3S5YA 4NNCA 4E0CA 3QYQA 3E02A 5D2WA 5LNUA 1R2SA 4NJHA 1ZJIA 3W7JA 2YGYA 4LVFA 4GUGA 3LHUA 1QNVA 3O07A 5L6UA 1OFOA 1C9DA 3FLUA 3UZJA 2Z0IA 1T0OA 4R33A 3DU0A 4AB4A 2H8ZA 3CC1A 3TW6A 1Y0EA 3W7OA 1VLWA 3N19B 5I3JA 5BRBA 1FWTA 1WX0A 2ZZ2A 3OVQA 4L4LA 1WOAA 5T26A 5CSRA 1DVJA 4ALDA 4UNLA 2B7OA 2R94A 1MEIA 3N9SA 3HQ1A 1NSJA 3OBKA 1VJIA 1G6CA 5D38A 2YDAA 4RZ4A 3EKLA 4OHQA 4IMEA 1IIHA 4NUWA 4GUJA 3M41A 4O15A 4WJEA 1OYCA 2I1OA 3GNDA 1O5KA 1G4EA 3N14A 4LRSA 3PB0A 3HJZA 3SJ3A 3TX9A 3IGUA 4RZ5A 1J5TA 4Y96A 5FF4A 3W76A 4UC5A 3S1UA 2YCEA 3NPUA 3MHGA 1ZHAA 3P82A 3TV8A 3L5MA 4X3ZA 4C1KA 3LHTA 4WQ6A 3S1WA 3GLCA 4FNPA 1GYLA 4NXSA 4DQWA 1DOSA 1TV5A 1TPEA 3S5OA 4Z1DA 3GR7A 2ZZ3A 4P61A 2X16A 3SW6A 3W1PA 4WD0A 2Y89A 4BK9A 1HUVA 1QFEA 3E49A 3IIVA 3R12A 3LI0A 5G1TA 1OHLA 2FIQA 2E1DA 1FBAA 2V9DA 4WZHA 1GVRA 3NZRA 4Z0SA 3DAQA 1YTEA 1BEUA 4GNJA 3G1YA 2QDHA 4WX2A 1YXDA 3BGGA 4PTNA 3ZWSA 3W2KA 1WOBA 4NNAA 2Y63A 3M16A 2ZYFA 5DCEA 2YYTA 2E6YA 2G97A 5FEZA 4DF0A 2ZA1A 3A24A 2WQPA 1AW5A 4LVAA 5AHLA 2CZEA 2OCZA 1KM6A 1ICQA 4K36A 3E12A 5F2LA 2V30A 3GR8A 4QJ1A 1ME7A 3C52A 2ZBTA 4RJEA 1R47A 4O54A 2Q8LA 4CCDA 1Z42A 2Y6ZA 2Z6IA 4TIMA 3SGZA 3BG5A 3GXTA 5FF2A 1RQHA 4FO4A 1VCFA 1EP1A 3TSDA 2NUXA 4JY9A 3W1MA 1W37A 3HMJG 5LHEA 4MZ1A 5AHEA 3W71A 3MI6A 1KM4A 4I7WA 1F5ZA 1SFJA 4GWEA 2FLIA 1LYXA 1RVGA 4HPXA 1E51A 4ZQCA 2I9EA 1LORA 1H60A 3C2OA 3M43A 2FJKA 1TV8A 5D04C 3W74A 5DELA 4OT7A 1W1ZA 3TQKA 1W5OA 1PHWA 1G4PA 3LRKA 5CGQA 3PF3A 3GB6A 2E5CA 4P2VA 3GDMA 1F73A 4O0KA 3ANYA 4MZYA 2FPVA 5L9FA 4XZ9A 3W22A 3P84A 2BXVA 4UMAA 3RMJA 5DCDA 1V5XA 4O16A 2KZHA 3OHIA 3BW2A 1YDNA 3KVMA 4LC6A 4LT9A 4C1LA 4WY0B 3DI0A 4NZFA 1VHNA 4PC8A 8TIMA 3T55A 1F74A 3IRDA 1H62A 4UTJA 3YPIA 2CLIA 4UIOA 5AYZA 1LBMA 3A9IA 4CLMA 1ZNNA 1I4NA 3TQ0A 4JD4A 4NNBA 1KFBA 4DO6A 3ZWTA 3MI2A 1TPWA 2LLEA 3DBPA 1TRDA 3M44A 5EBUA 1GT8A 1TV7A 4CQAA 3UWWA 1G67A 1GVOA 2QCEA 1ICSA 4Q33A 4N6FA 2E77A 1F05A 4O53A 3CIWA 3TC6A 4FHAA 4OWGA 3PSVA 3B04A 1HO1A 3HG2A 2NV2A 3GIYA 1TPVA 3HIJA 1OG0A 3TJLA 4LU0A 5H91A 5C5YA 3R8RA 5HUPA 4S1FA 1KFKA 3SR7A 2RDUA 3H53A 1KFLA 2GUUA 1VS1A 4IPIA 5EMUA 3ABRA 5I3KA 4JIQA 2EKCA 1YPFA 3CPRA 3KRUA 3GDRA 3VI2A 3TROA 5K4ZA 1PL9A 4JS3A 1P1XA 3L66A 5LGZA 2GOUA 3T7VA 4E2BA 1KM0A 1O94A 3BLFA 2C18A 3DH7A 2Y85A 5FF3A 1VYPX 1FCQA 3G0SA 3B8DA 1FXQA 1TSIA 1SR9A 3QEZA 4UTMA 1QOPA 4JTSA 3FYPA 3G3MA 4ICNA 4JICA 3W3OA 4QAIA 2A7PA 3HBLA 3EWXA 3K30A 2CLOA 4JTTA 5LNVA 2VFHA 2H8XA 2W0UA 3TJXA 3HPZA 3A22A 3UWVA 3THQA 1YTDA 1T96A 5HR7A 1JRCA 1EUAA 1RV8A 1TPDA 3WJXA 2V8ZA 2F7FA 1FWSA 2DORA 2H90A 1OFQA 1IIGA 1GOXA 3HPXA 5EA9A 3HPSA 2XN0A 4X22A 3C0JA 2V82A 3BO9A 3GXNA 4O10A 4JTJA 3N2MA 3LLDA 2BSLA 3W84A 4MFDA 4IXHA 4LS2A 4GE8A 5D09A 1QPOA 5G2WA 3DFSA 2G5WA 4LY8A 3ZFHA 3DFQA 1H5YA 3LB0A 5CPOA 3KXQA 3QJAA 1S5WA 4FX8A 3PR2A 2JGQA 1A53A 3LRMA 3EX6A 1GTHA 3FEMA 3R5EA 1OVDA 5LSMA 3NPWA 1JCXA 1B57A 1BWLA 1GZGA 4UTIA 4Q32A 4NVTA 3TKFA 3DENA 2XFWA 5DY2A 1SSGA 3KOFA 3WFAA 1RQBA 1IXOA 3B03A 1KM2A 2ZZ6A 3W2MA 2ATMA 1DV7A 2ZRYA 3L67A 5AFDA 2E5DA 5CKSA 3EWYA 3DKLA 5D2YA 4K6AA 1GVQA 2NLIA 3JS3A 1PV8A 1NF0A 2JKAA 4LW7A 1KFJA 1PCWA 1A50A 2ZRVA 4O17A 3VE9A 2Y62A 3L0NA 2Q3RA 4HNNA 3KFTA 1NF7A 2E6DA 1W5NA 2CLMA 4O8RA 3C56A 1JQXA 3N3MA 1ZCOA 1T8XA 3G8EA 3N73A 4JY8A 2QUUA 3TFCA 3WJZA 3UXAA 3G1HA 1M5WA 4KFPA 3SI9A 1KLZA 4BI7A 4EIVA 3QMTA 4QSHA 3G8RA 4EVZA 4UFHA 1FDYA 1OFBA 1PIIA 3NG3A 3UD6A 1FWNA 3C2VA 4FIRA 2JGYA 4IMGA 2VEPA 5BOOA 4ZQNA 1LRNA 3STFA 1FCUA 4ADTA 3TA6A 2CWNA 3LERA 4DELA 4JNMA 3P8JA 3GDLA 4IJBA 4IX0A 2ISWA 5KMYA 5D2VA 3B0UX 3SIZA 3TC7A 3IV3A 1OFEA 1GJPA 4JYEA 1ONRA 1JCMP 2WPBA 4HHPA 4GJ1A 1KM3A 3L2IA 4FNUA 3MI3A 3QPZA 1OX4B 1I2PA 4JIPA 3LCGA 3W1UA 1VQTA 4FX6M 3CTLA 4G1KA 4LS1A 4ZQRA 3W1AA 1OK4A 3MHFA 4IX2A 5D03A 3TCEA 1W3IA 5I3IA 1OX5A 2ZA2A 4AWUA 1OFDA 3PUDA 1MO0A 2QCGA 4H4IA 4O12A 1TYGA 3NPXA 1ME9A 4JTUA 2FDSA 2E5BA 1SFLA 3M0ZA 3LTSA 2J27A 2Z1BA 4A2RA 2H6RA 4GUFA 1WQ5A 3O6DA 3KVLA 3P80A 4OGZA 2PCQA 4JEQA 2WOQA 5CPLA 4M19A 4JGDA 4HSNA 1QWGA 1ZAIA 3L5AA 5C54A 1D3GA 2Y7EA 2GJLA 2AGKA 3QPYA 2QCNA 1H7RA 1LRQA 4QNEA 4AEOA 5F2IA 3PG8A 2A6LA 1F76A 3N2XA 3MWAA 4IQLA 1OX6A 2QR6A 4IXXA 1IXPA 2X1SA 1H7XA 4ML9A 2A2IA 3DKJA 1QO5A 4PODA 3P5ZA 3FJ6A 3G1SA 4ADSA 2V5LA 4FB7A 3BW4A 3LCIA 3EXTA 3GKFA 4FNQA 2EPHA 1ZAJA 3BK0A 4M6QA 4A29A 3QMSA 4LUIA 4LTSA 3O05A 4OQVA 3CM4A 3VCRA 2CU0A 1OK6A 3NPVA 4RZ6A 2ZRWA 3L21A 3HGOA 5F4SA 3QMRA 1P0KA 4Z1CA 3W88A 4LS0A 4QIUA 3SFKA 3LDVA 4PFMA 4RXGA 2VEMA 2RHGA 2E6AA 3C2FA 1VYSX 1XM3A 4HNUA 3W7QA 1JCNA 2DJLA 3W07A 5GVJA 1WV2A 4H6KA 4LRTA 3DFOA 3W7GA 4JTLA 5AN7A 3W9ZA 4ONVA 5AOUA 1LM1A 3F4WA 3F03K 4EF9A 2H3DA 1L6SA 3SGUA 3W7IA 1UB3A 5DBUA 2YXGA 3NQCA 3BG9A 2ABAA 2J6XA 3CU2A 1JVNA 2B7QA 1TO3A 1FY6A 5HWJA 3LCHA 1OFPA 5BNKA 4N9BA 4RLIA 3EXSA 4FX7A 1LOLA 1TTJA 1I45A 3ABOA 4XUGA 4JDYA 4Q4KA 5K9CA 1FCVA 2BTMA 4ZL1A 1ML1A 3AJXA 3ELFA 1G69A 3HO8A 3P81A 4R34A 4HNVA 3CB8A 2A0NA 4A3UA 3PY2A 3KHJA 3AO0A 3TMLA 5HWNA 5H2ZA 2ATSA 3PC0A 4XQ6A 5LNSA 3P7YA 4O18A 4CNNA 3P61A 2OJPA 3EWUA 3RNDA 1W54A 1I2NA 2BZNA 1A5SA 3MBFA 4WOZA 3W72A 4FEZA 3CWOX 2B7PA 1J4EA 3CWNA 1EX5A 2PC4A 1S3HA 1A5CA 2FPYA 1FWWA 1UUMA 1IF2A 3Q94A 5F1VA 3TK7A 4HNTA 1O60A 2CLLA 4NX5A 3W7PA 3M5VA 3W7CA 4OU1A 1AK5A 3CHVA 3LCWA 2VC6A 2A4AA 1VR6A 4DPQA 3BVJA 2EHHA 2F84A 4Z1AA 1H61A 1OABA 3NDOA 2CLHA 1YDVA 2WNQA 4RV8A 4GUHA 1M6JA 2ISVA 3C2EA 4X9SA 1YADA 4NXKA 3O16A 4GC4A 3IIPA 5K9XA 4JTIA 3P62A 1VCVA 1VC4A 1TQJA 1SW7A 3S1XA 5K2ZA 2P10A 3LHWA 3MP4A 3IIOA 1AW1A 3B0PA 3U8GA 3BARA 1YLVA 4UTUA 2J88A 1XCFA 2YX0A 4O50A 2WKJA 3M5ZA 3W2NA 3LX9A 4MLJA 4ZZ9A 3OG3A 3UWUA 1TTIA 1WDWA 5AHIA 1SZEA 1Q6RA 2ABBA 5G5IA 3QRHA 3PWAA 1GTEA 1SO4A 3FFSA 2QUTA 4XBSA 4BR1A 3STCA 2QJGA 3JR2A 4O1DA 3F1QA 5MHBA 4AVFA 3QW3A 1XBZA 1NFBA 5AC6A 3L68A 7TIMA 4DO4A 2C14A 2FTPA 1P4CA 1VRDA 2V0TA 1H7OA 5DXXA 1LBFA 1W0MA 5TIMA 5I3HA 4O4VA 3QF0A 2XN2A 3STGA 3W86A 3GVGA 2QCCA 1H63A 3V1PA 3GYEA 4ZVJA 4DXVA 1EPXA 5D05A 1YXCA 2QDGA 1SW0A 2WNNA 1XDLA 3GKAA 1TJRA 3SZ8A 3B06A 1W5MA 2O7QA 1NEYA 4O1CA 5CZJA 1EWEA 3NM3A 3EKZA 1W5PA 2QCFA 3T4CA 1J2WA 5DLCA 1SO3A 1ZAHA 4AF0A 2A6NA 1OF6A 5BMXA 4FIQA 1MEHA 1WBHA 3LBCA 1SSDA 4MY8A 5J5RA 4I7VA 4Y9AA 2YW4A 3MYOA 4LVDA 2B7NA 3QZEA 3EWBX 3VKJA 1G7VA 4LV4A 4MUZA 4BI6A 1ALDA 1CX9A 4TX9A 2EGZA 3G3DA 2O7SA 1KBIA 5IBXC 4JTEA 3W6YA 3FIGA 1R2TA 1BWKA 3PG9A 4TU1A 3O6CA 1AL7A 2H3BA 1JCLA 3EXRA 4KKXA 1L9WA 1EB3A 4GRSA 5D2TA 1VLIA 1PCKA 5AB3A 4YL2A 1X7FA 5KZMA 1DQXA 4PH6A 3CEPA 3MHUA 2JK2A 2C0AA 3PSWA 3WK0A 2VELA 3H54A 4QQ3A 4RR4A 5K3VA 5EKYA 2Y88A 5C2XA 4N2YA 1THFD 5EYWA 2P0OA 2I14A 4UTTC 2PRMA 1AL8A 3A21A 3G18A 1JJKA 1XC4A 2QCHA 3NXFA 3W1LA 4K8EA 3ATZA 3G24A 1N8FA 2E6FA 4O4WA 2ZDRA 3KX6A 3L9CA 3TSBA 3SECA 3DFNA 3JRKA 5LNWA 1WBJA 4NT0A 4NQ1A 3TE9A 4MJZA 1XBXA 3NL2A 5KINA 4WY0F 3ZR4A 5IM51 3LV5A 2HSAA 2FB2A 1OFAA 3O06A 4JX6A 4QM1A 5G1YA 4O14A 2ZTJA 4MZ8A 5DBTA 5E93A 1CW2A 1MEWA 3PVFA 2FFCA 3DHDA 5G4EA 1R46A 5HWMA 3QFEA 1TIMA 1VPXA 5A5WA 1QPQA 2W6RA 3HG3A 4QITA 4N4QA 4AAJA 3UWQA 1U5JA 1DQWA 3DXIA 2GQAA 1OYAA 4GBUA 4UFMA 1EEPA 2DZUA 1F6KA 5D2XA 2R14A 4B5NA 1JQVA 1P5BA 1XUZA 1YYAA 4RKAA 3W87A 5CG7A 3HG4A 5D37A 2CLKA 4UMCA 3RU6A 2X2GA 4DBEA 3T40A 3W1RA 2P1FA 1IXNA 2QF7A 4JTGA 4N6EA 1D3HA 1W3NA 3MP5A 1LOQA 3LXBA 1CI1A 3TXZA 4KWWA 1GG0A 2PURA 1DBTA 1EP2A 2C13A 1TPB1 2NWRA 1IXQA 3Q58A 4FNSA 1SO6A 1QAPA 1RZMA 2E09A 2GVLA 5CZSA 5IBXA 4DPPA 3W7NA 3BG3A 1XBVA 4IWWA 4K39A 2TPSA 2JBMA 1KTNA 3FOKA 2OZ0A 3PUEA 4K7YA 1W5QA 5BMWA 3GDKA 3CQ0A 3T44A 1XBYA 1JUKA 3W7LA 2GQ8A 1B4EA 3IEBA 1X1ZA 3LI1A 5J5DA 4Y90A 4AXKA 1LROA 3LCXA 1K7FA 1LCOA 4N9EA 2ZRUA 4O11A 1Q6OA 1TRIA 4CNOA 2OMAA 3TDFA 4MFEA 3W85A 2X1TA 3C61A 4UTWA 4UR7A 2A5HA 4XWUA 3NNTA 4IMDA 3NYZA 5HJLA 2ZTKA 4JN6A 3DI1A 1KW1A 1H50A 3W7MA 3LCLA 4UTTA 4MVAA 4W9TA 4AMAA 3I7SA 3E0IA 1RR2A 5FEWA 5AC8A 1JUEA 2IQTA 4CCCA 2CLEA 2X30A 3P5YA 3NQFA 1QO2A 4O0ZA 1JR1A 4Z1BA 1DJQA 4YWIA 1WAUA 1O4UA 3NM1A 1C29A 5EPDA 4JXCA 1MZHA 2GVGA 2QJIA 2R91A 5HULA 3EB2A 3CIXA 4IMCA 3UY7A 4RK8A 4WUIA 3MBDA 3I6RA 3LCFA 4POCA 1QOQA 3TNOA 1ZALA 2Y61A 4K8HA 4FNRA 1I2RA 3GK0A 4O1BA 2C19A 2YR1A 5K4XA 3IVSA 6TIMA 4BF9A 4QISA 1F6PA 4GUIA 1LLZA 3PUOA 4CNPA 1H7PA 4JTFA 1TREA 1G7UA 1F7BA 1TTQA 1KM5A 2C3ZA 3LV6A 3S5ZA 5D30A 1XXXA 3LLFA 3P74A 3UWZA 5HMSA 4YCOA 2PRHA 2R8WA 1ADOA 4M5PA 3QQ1A 3GNNA 1KM1A 2JKEA 4JTHA 3PBWA 4MYAA 2RFGA 3P67A 4A22A 5E1QA 4LVBA 4JX4A 2HS8A 4MY9A 3KVKA 3NR0A 5ABTA 3OVRA 2A21A 3B05A 3FS2A 1H7NA 2A7NA 1K8XA 5I3FA 2V81A 2A85A 3W1NA 3S0CA 1R30A 4ORMA 4BFAA 3EWZA 3A23A 3HG5A 3IGSA 2GPTA 3I7QA 2QAFA 4PEKA 3QSRA 3W7DA 3OVPA 4HN4A 5FEXA 1H51A 4LUJA 3O6YX 1G4TA 2FQIA 3QSTA 1KV5A 3TUUA 3FA5A 4LC8A 1KV8A 4TMBA 1S5TA 3L0KA 1T99A 2YZRA 1GQNA 4WOQA 2NXHA 5CZ0A 3DHFA 5AYXA 2ZFAA 1Z48A 1LP6A 1OX4A 1W56A 1FQ0A 3P60A 3L5LA 3LTPA 3V75A 3C2RA 1F2JA 3ABSA 1GVFA 1R2RA 3EWWA 2YSWA 4JX5A 2NXGA 5FF0A 1AW2A 3STEA 2ZA3A 1Z41A 1DHPA 4WXZA 2YFOA 2RH9A 3MYPA 3B0VC 1PVNA 3NQ6A 4L4MA 2VFGA 1JUBA 1ICPA 2WNZA 2NXIA 1H1YA 1K03A 2TRSA 3S8HA 3EX2A 1Q3NA 2Z6JA 1IGSA 3M5YA 3O8AA 2VFIA 1WYIA 5D33A 1HO4A 3F4NA 2J24A 4CQ9A 1HFBA 1Q6QA 2ZZ4A 2YFNA 3HGRA 3NOEA 3NVTA 4MJMA 3DZ1A 3UPWA 4A21A 4CCEA 4MLRA 1M7PA 5C6MA 5LNRA 1YTKA 1W3TA 4JTKA 3ATYA 2FPTA 4UR8A 3W75A 1O95A 4PL2A 1QPRA 5EL1A 3P8IA 3NQ2A 2QCDA 1OJXA 2ISSA 1TB3A 4PCFA 4XKYA 5DN1A 1TJPA 1UUOA 1DJNA 4GFSA 3BW3A 3RF9A 1VHCA 2X1UA 2V2CA 4OE7A 5F4XA 2QAPA 1VGAA 3NA8A 2HS6A 3TFXA 3NQAA 4LV9A 3N9RA 3MUXA 3LM7A 3CEUA 1L2UA 1SW3A 2HMCA 4ZQOA 2BLEA 1K3UA 2RDTA 2ZCGA 2VFFA 3C8FA 3UYCA 4O1AA 1LOSA 4S2CA 3E96A 4U28A 4RX0A 5E0KA 3KVJA 1TMHA 1Q6LA 2QUVA 4N9DA 3UZ5A 3IGXA 4ADUA 1XL9A 5G2IA 4XBKA 3QH2A 3HGSA 3L65A 1DKWA 1VH7A 1AG1O 2DP3A 3KAOA 4N9CA 4DF1A 1LZOA 1KFCA 3PBVA 3PB2A 3VNDA 3VFLA 1HG3A 3PAJA 3O1NA 3A5VA 4TMCA 2C16A 1C8VA 1K8YA 3W70A 6ALDA 3CLMA 2Z2UA 4Y6GA 2NX9A 3GX9A 3W7RA 3W23A 1X1OA 4QNWA 3LRLA 3TAKA 3U6WA 1UASA 1K8ZA 1PS9A 3BPWA 1XDMA 1KFEA 1SO5A 2ZZ5A 5AYYA 4FNTA 5C55A 2ZRXA 4UTLA 1TPFA 1JULA 2A1YA 2XN1A 3W1TA 3TMQA 3GAYA 2QCMA 1SZFA 5LGXA 3UNDA 5AHNA 4AH7A 3WK2A 2DZWA 2D73A 3B4UA 3DGRA 3EEGA 4KWVA 1X8FA 3W2UA 1SUXA 2YYUA 1FDJA 2JKPA 3OIXA 2A7RA 5KZEA 3W2JA 5DY3A 3USBA 1EP3A 4M7SA 3G0UA 4FF7A 2HTMA 2Y7FA 2VXNA 3RFAA 3NQEA 2GJNA 2VKZG 3WK1A 5HINA 3LXAA 4EWND 4UMBA 1N7KA 1EA0A 2DZVA 2Y7GA 4DF2A 2AAMA 3G1DA 1UCWA 5AHFA 3BLEA 3LHVA 2CZ5A 3TR2A 3MJYA 2CLFA 3R89A 2QCLA 4OV9A 3CT7A 4YLWA 3G0XA 2V2HA 4IOTA 1SPQA 1M7OA 3NEVA 4AF0B 3BV4A 1ZENA 4O28A 2WJZA 4S2BA 5LKYA 3SSJA 2Q3OA 1G4SA 4O57A 4N02A 1DL3A 1I8JA 1FX6A 2RKXA 3BGJA 3PS7A 3M6YA 5D02A 2EAWA 2WV8A 3UY8A 5F2GA 5LZLA 1QCWA 3NQ7A 2Y7DA 3DFTA 2GQ9A 1O5XA 1FUYA 3DFPA 2WO5A 1JCYA 3O15A 2CW6A 4DO5A 3TU9A 1RPXA 1L6YA 3IIXA 3BLIA 5DCBA 1D9EA 4PL1A 4K38A 3U2OA 3PM6A 1KBJA 1P0NA 4CQ8A 4LVGA 2NUYA 1K02A 2BX7A 2DZPA 2TMDA 2J9XA 5U4NA 3QC3A 4X2RA 1RQEA 4YCPA 1TCDA 4Y8FA 1XI3A 1UJPA 3GXPA 4MY1A 2CZFA 4R7JA 2ZZ1A 5EY5A 3RLUA 3IVUA 5CZTA 3LTYA 4UUIA 5U7SA 3S5NA 4EOUA 3MMTA 4AHOA 4HPJA 3S42A 2WSRA 3W7EA 3G22A 1ZY9A 2V5BA 4WY0A 2YPIA 3GDTA 5KSWA 1GWJA 1HTIA 4TR9A 3UPBA 4BWLC 5HQEA 4U4MA 4H3DA 2J9YA 4AWSA 4UTWC 4ZQMA 3HOJA 5SWUA 4WXYA 3PULA 1KTBA 1H1ZA 2DU2A 3NL5A 3R13A 4OBTA 3E9AA 4K37A 4HT3A 2YW3A 3NZ1A 3S1VA 3R2GA 4R53A 1XFBA 1QR7A 1FCBA 2Y70A 3C3NA 5A8GA 1L6WA 1AMKA 2NX3A 2VENA 1PE1A 1SZGA 3W83A 1LTDA 3FKRA 3C6CA 1B9BA 1QDSA 3VE7A 3PBYA 4GXMA 2VFEA 3Q37A 1TPH1 3EX1A 3GZ3A 1JRBA 4O52A 2VFDA 4Z08A 5KTLA 3G1XA 4UNKA 4HIBA 1N55A 2QJHA 2UV8G 3TXVA 2OT0A 2WSYA 3EX3A 5HR6A 1GYNA 1S5VA 4UCGA 4LOCA 3S6DA 1OFRA 1TQXA 1XKYA 3FJLA 4NJIA 2ZQ0A 3RLVA 1SZNA 1K7XA 1TTPA 3W2LA 3TSMA 3ABQA 3NL3A 4NJJA 4UTKA 2GVJA 2NV1A 3KRZA 4EF8A 3G1VA 3TIMA 5LHFA 4O13A 1LBLA 2EF9A 2DJXA 3UWYA 2Q8ZA 5BW6A 3THAA 3NGJA 2QKFA 1NAL1 1ZFJA 1GVSA 3OA3A 4M6VA 5D32A 3W7KA 2CZDA 3WJYA 1YXYA 3NO5A 4UFKA 5KZDA 3I65A 3M47A 1KA9F 4E38A 1Z44A 3NQDA 2PE4A 2J9ZA 5F2MA 4XTDA 1DORA 1A5AA 4I7UA 1I2QA 3QM3A 3M1ZA 3W1XA 5K7JA 2X1RA 4UTHA 4BI5A 4LWWA 1MXSA 3SY5A 4MYXA 5TBOA 3QQ0A 1LDCA 5F1UA 2TSYA 2ALDA 5FI8A 4MPQA 4JYDA 2C6QA 4JYFA 4M7TA 3C4UA 3N34A 2NZLA 3T78A 1WXJA 2VEIA 4BWLA 4MIMA 4RXFA 1MSSA 1OF8A 3LHZA 4PA8A 4K7VA 2FB3A 4N4PA 3TAOA 3M5XA 2NX1A 3EX4A 4OV4A 3NQMA 3NQ8A 3LHYA 4UFJA 2C15A 4DEFA 5DXYA 4MOZA 3GAKA 1ME8A 1B4KA 3IIZA 5F4WA 5FESA 2NUWA 4UFLA 4AWTA 4A2SA 5CPMA 4DBDA 5CSSA 4HSOA 1VYRA 3NAVA 3HB9A 2DZSA 5K9DA 4J9JA 2C1HA 3FYOA 3NL6A 4AHQA 1RD5A 1VCGA 3PBUA 1EUNA 1OYBA 3TQVA 4IPJA 3G1FA 3NQVA 1SQ7A 5KITA 4M6PA 4KFNA 1EIXA 1VZWA 1NVMA 4IUOA 1YDOA 1I2OA 1Q45A 3HF3A 2RDWA 1JCJA 4O19A 3LBMA 2B4GA 4RCXA 3I68A 3I7RA 4XTIA 1XUUA 4YXGA 3M7WA 1K7EA 5AHMA 1KLYA 3OEXA 2TYSA 2OT1A 3TW7A 1V7YA 5HUOA 1LRTA 3WJSA 2PRLA 2ZRZA 4NU7A 3W7HA 2QEZA 1FDZA 4FXRA 4ORIA 1X6UA 4NJGA 1B3OA 1GEQA 3HGJA 1A5BA 5AC7A 1LLWA 3LOTA 5FEPA
chains in the Genus database with same CATH superfamily
3G1AA 1I9CB 4YMZA 4D2JA 1YBQB 3VM5A 2IKHA 2PDBA 5A2CA 1W31A 1FWRA 1EGZA 2DZTA 3EDFA 3RK8A 2OSXA 3IPWA 3TH6A 3UQNA 1W8SA 4FOKA 1CT5A 3ITCA 3QHMA 4LGXA 1C8XA 1XH0A 4RV3A 4JR5A 3M9YA 5M1TA 3HTWA 1TZ9A 1E15A 3UBPC 1WKYA 4KETA 3ZIZA 3LA4A 4LNYA 1BTMA 3LXCA 1IZKA 4H6QA 4AHPA 2NQ9A 1R3WA 2V2DA 2DZXA 3MSDA 3Q2DA 2FZMA 2VOMA 3K46A 2PPGA 5FF7A 2G3IA 4UFIA 3RILA 3DCPA 2VZUA 4KCWA 4UXDA 2W79A 5G2HA 4H9MA 3RIKA 2IPGA 1QPNA 4J40A 2ISDA 3VDCA 4AC7C 4GNKB 4S3EA 3WMSA 2G95A 1GKPA 1J0JA 1JPKA 4ZTYA 3XISA 1A4MA 3S5YA 2BB0A 4E0CA 4L6HA 3GNXA 3PJUA 1ADDA 3F5JA 1QK0A 3LHUA 1QNVA 3GVQA 3TVAA 4V1YA 5L6UA 1SM9A 1OC5A 4GOAA 3K4AA 3TC3A 5FJIA 4AB4A 3FVDA 4NI3A 1QI4A 1M7XA 3BJFA 3SRKA 1Y0EA 2PC8A 4IPPA 3WLIA 3SQLA 5I3JA 3HJEA 1CGTA 1FWTA 1S46A 1WX0A 2WC4A 4ZEPA 5BRBA 4F0HA 3VIFA 3VZYA 5CSRA 1JPIA 5I23A 3VD7A 4ALDA 2P76A 3M0KA 3VGFA 1JDAA 1MEIA 1NSJA 3MT1A 3VX0A 4ZGYA 1VJIA 3EKLA 2G3FA 4OHQA 4IMEA 4GY1A 1ODZA 3FSTA 2I1OA 4PB5A 1PZ2A 4GIRA 3N14A 4LUYA 4LRSA 3W28A 1XF0A 2J25A 1J5TA 3H2FA 5FF4A 3W76A 4UC5A 3AC0A 3NPUA 4LYRA 5HNTA 1UR8A 4NRSA 5CC5A 3LHTA 1GYLA 1C7TA 1DOSA 1TV5A 2Z7KA 3WBWA 4DQWA 5I24A 2NQHA 3S5OA 4Z1DA 2TODA 1GZJA 3T42A 3SB0A 2X16A 3SW6A 4WD0A 4BK9A 3LI0A 1JNDA 2FIQA 3RG6A 2E1DA 1UIPA 1GVRA 3EMZA 4Z0SA 5FJTA 2GVEA 1YTEA 4GNJA 2QDHA 4IP4A 2D22A 2BGSA 3EKGA 3ABZA 5DEZA 2J74A 2ZYFA 3RRAA 5DCEA 2G97A 5IOBA 2O0TA 5XIMA 4NY2A 4AXNA 1K9DA 2DVTA 4LVAA 5AHLA 2OCZA 2V5DA 2VCBA 5C9UA 3UG5A 4K36A 1J9YA 2AL2A 2IPWA 3GR8A 4F0SA 3L2LA 3AXXA 3BLLA 4HZ8A 4PB4A 2QYGA 1ITCA 2J8TA 2Z6IA 2W9MA 3CPUA 4TIMA 3SGZA 3BG5A 4C6MA 4A8LA 1XYBA 2W67A 1HJWA 2ZC1A 3FDKA 1RSCA 3BANA 4GQ0A 4IISA 4UOJA 1M41A 4RW3A 1DWJM 4QP0A 4CNTA 2HEJA 4MZ1A 2OLSA 1MVYA 4GWEA 1ODUA 4Y9OA 1RVGA 4Q8NA 5D04C 3W74A 1W1ZA 4XUYA 4MB5A 1A5MC 4P2VA 1TWWA 1XG4A 2WPGA 5L9FA 1JXJA 4XZ9A 5HNUA 1TWZA 3RMJA 5DCDA 5MF5A 1A47A 1DTUA 4D6IA 4IG2A 3OHIA 3KVMA 2PDFA 4LT9A 3AICA 4UTFA 5LIXX 2DQWA 3GZAA 4ECLA 1VHNA 3R6IA 4PC8A 1BRLA 2XH2A 3T55A 1F74A 1HKKA 3AXHA 2Z27A 1LF1A 4UTJA 4JZ5A 5AYZA 7PTDA 4CLMA 3A9IA 1E4IA 4C7DA 4FSAA 3ZWTA 2OXNA 1PSCA 4EXBA 2LLEA 3U5UA 3PK7A 4EKJA 3UWWA 1Z9AA 1GVOA 3GNRA 4OOZA 1F05A 4P8VA 3CIWA 3TC6A 4DUWA 3BL3A 1HO1A 1TPVA 2YXOA 5G4HC 4GD0A 3HIJA 2OQLA 2XIOA 2ADAA 3R8RA 3SR7A 1X7IA 5GJNA 2WVTA 3KP0A 5I3KA 3ZZ1A 4KS0A 2JF7A 5M5DA 3CPRA 2RAGA 2XSAA 4QROA 5K4ZA 3AFBA 3GTIA 1MDRA 1P1XA 3E0VA 1Q66A 3L66A 3WFZA 4D6DA 1KM0A 4J3SA 5B80A 1B54A 2XIJA 3W26A 4C1NA 1SR9A 3QEZA 3QY6A 3LMZA 4PUEA 4UTMA 2OWCA 4D8AA 1Q2SA 3G3MA 4ICNA 4HOZA 4QAIA 2A7PA 1W9BM 3HBLA 3HN3A 3MV11 4AD4A 5LNVA 5A6BD 1Y7VA 2H8XA 3TJXA 3AIEA 2I7GA 4I5XA 4OUEA 3THQA 2YDSA 3UWVA 3V1HA 1YTDA 1X8CA 4GQGA 1T96A 2P50A 1J5SA 1JRCA 3QOMA 3CUZA 3MANA 1IQ8A 4J28A 2DSUA 3DIPA 1U5VA 2A3AA 2V8ZA 4KEUA 3O7UA 1NWTA 2F7FA 4XZBA 1UKQA 2DORA 1IIGA 1BAGA 5D9PA 2XN0A 3QPEA 3GXNA 4JTJA 2BSLA 5D9OA 2CLPA 4US5D 4LS2A 4GE8A 5D09A 1D2KA 5JIWA 4R9XA 1MI3A 4AY1A 5CPOA 1K6WA 1ECEA 1A53A 4HZMA 1BKHA 4H83A 3CMFA 3CPGA 1GTHA 3WUFA 3CHEA 4WIWA 1FH7A 5LSMA 3V16A 3NPWA 2NV9A 1B57A 2ZE0A 2XVNA 1OGGA 4R88A 4TTGA 5GNXA 9CGTA 4NVTA 2Z2AA 3DENA 3WKZA 2FGBA 1RQBA 4Z2LA 1KM2A 2ZZ6A 3L67A 1PJ9A 3MUZ1 5D2YA 4K6AA 2NW0A 1KFJA 3VE9A 1EHNA 2DIKA 3KP1A 2Y62A 2CBUA 1UOKA 3L0NA 2GK1A 5E6YA 3OVGA 2E6DA 3KOZA 1WZAA 3A13A 1QOXA 1T8XA 4LAMA 4S3DA 3G1HA 4BI7A 4EIVA 2VEGA 4QSHA 4CD4A 4YTRA 1MXGA 4L9XA 1MQQA 4UFHA 5HANA 3NG3A 1F6YA 2VEPA 1BHGA 3M0IA 2P3EA 3DDMA 4ADTA 2BY3A 3LERA 1V79A 4YVXA 3T8LA 2R24A 2VWTA 4IX0A 2WZTA 1WZLA 1BSLA 5KMYA 1W2PA 5CGTA 1GEHA 3B0UX 1VFSA 2WVVA 4Z2IA 5I00A 3N1AA 4JIRA 1KM3A 3L2IA 4FNUA 2BGQA 3QPZA 3FK4A 4A05A 4HN8A 3LCGA 2J66A 3W02A 3CTLA 4G1KA 1K6AA 1E6PA 1OK4A 4HPNA 3MHFA 4DNHA 4IX2A 2D1ZA 1JI2A 1W3IA 5I3IA 1RALA 4M24A 1KWGA 2C8NA 3PUDA 4EE9A 4PMUA 2I17A 1EQPA 1ME9A 1YHTA 3M0ZA 3W25A 2J27A 2H6RA 3GHSA 4JTQA 2O55A 2HBXA 1TX0A 4JFWA 2VZVA 3KVLA 1XQLA 3AS0A 4JEQA 3H2CA 5CPLA 4JGDA 4GIYA 4Q8QA 4ZB2A 2Y7EA 2GJLA 2AGKA 3QPYA 2PDGA 2G50A 2QCNA 4QNEA 1C90A 2A6LA 4WSKA 3MWAA 3O9NA 2QR6A 4PZVA 2X1SA 2FMNA 3SQMA 3GQYA 2RGMA 3GG8A 1XH1A 2A2IA 3PZ9A 1JYNA 4PODA 3WEMA 1W9UA 1QATA 3G1SA 2V5LA 3N4AA 4FB7A 2VZOA 3TONA 3BW4A 3OOQA 3ZXWA 3AOFA 4QS6A 4I90A 3KCOA 3QMSA 4LUIA 1DP0A 4LTSA 3Q45A 5I06A 1EZWA 1V0LA 4OQVA 2WHJA 4BHYA 2CU0A 3GDBA 3GU1A 4E8DA 3WF1A 2OKOA 3W88A 1W3KA 2PODA 5J8LA 3EB3A 1XLDA 2WJFA 4I8DA 2B81A 5FL1A 5HK4A 2RHGA 1VD6A 3C2FA 4QDWA 2D0GA 3GU9A 1XM3A 3W7QA 4DUVA 1JCNA 3UFYA 1PO9A 4NHVA 2WHKA 4H6KA 3KBWA 4B9YA 1X98A 1UR3M 1V51A 2H9AB 5GPRA 1L6SA 3W7IA 3GS6A 3S2LA 4AD5A 4P7NA 2ABAA 1OC6A 2BOGX 5I09A 2J6XA 3CHCA 3CU2A 2B7QA 5HWJA 1V4YA 5BNKA 3OB8A 2IPFA 2HROA 4RLIA 1P6WA 4FX7A 1YKWA 3N6HA 1I45A 3ABOA 4Q4KA 1QNPA 2WB5A 1UA7A 2GL5A 3P81A 4JOMA 4HNVA 3CB8A 3TYDA 1PDZA 5ABGA 3PY2A 1R86A 3WLHA 2ACSA 2PLKA 2BFGA 1UG6A 3VMPA 3PC0A 3IJIA 3P7YA 1BYDA 1CXEA 5IXEA 4MNKA 3GHUA 5J04A 3SN0A 1A49A 3MSYA 4Q8WA 5FKYA 1PUDA 2BZNA 3LU2A 3VZXA 2DW7A 3W72A 4FEZA 4J4KA 4F79A 1U1HA 2PC4A 4GYFA 1R38A 4AD0A 4A8RA 1A5CA 4B2DA 1UUMA 2CWXA 1QNQA 2HISA 3K8LA 3CHVA 2VC6A 3L4ZA 2POZA 3ITYA 3BXWA 2A3EA 2EHHA 3R0KA 4PTDA 2ZUMA 1XPYA 1DE6A 4DWSD 4AX7A 1XCWA 3E0LA 3OQ8A 1YADA 3TTQA 1VIZA 4F66A 2E8YA 2EG8A 2HWGA 3GFXA 2P10A 3L4XA 3MCOA 5E09A 2XDFA 1RA0A 1X1NA 4UTUA 2YX0A 2WKJA 3R94A 2GGJA 4ZO9A 1F4AA 1TTIA 2NVDA 3WNLA 2PDQA 3WL1A 3PWAA 1XIMA 1GTEA 3FFSA 1HGYA 3STCA 3JR2A 4O1DA 1KRAC 4AVFA 4HU3A 1NFBA 7TIMA 1XIGA 1ELSA 5E0FA 1LBFA 3QF0A 1P48A 5TNVA 3UCQA 3W86A 2QCCA 1H63A 3BE7A 4DXVA 3KCJA 1BYAA 4F40A 1E6RA 1XDLA 4KWSA 3GKAA 2FHCA 3RXZA 1W5MA 2O7QA 3QY7A 1VBJA 3QTGA 3TWBA 4AEEA 2G3NA 3T4CA 4G1NA 1J2WA 1WNOA 2I56A 2IKJA 3NSMA 1SO3A 2A6NA 1OF6A 1GYMA 1C9WA 1J18A 2OEJA 1AZ1A 2XVKA 4I7VA 2QF8A 4OBSA 4QS5A 1CGUA 2YW4A 4UZSA 3XINA 4LVDA 2OOFA 4LV4A 1QNRA 3DYOA 4MUZA 1BXBA 3AYSA 2P8BA 3OLDA 4MAVA 4H9ZA 1BWKA 3H7VA 3UJFA 1OT2A 3O6CA 2H3BA 5T8GA 4YIWA 3LSBA 1L9WA 3WLPA 5D2TA 1GGOA 3WD3A 1X7FA 1DPMA 1DQXA 4PH6A 5CXPA 1V6WA 3AIQA 4Q8MA 4C6PA 1C91A 4NF7A 1MZRA 3S2CA 3WK0A 4JIIX 4D72A 1W32A 1J0YA 3ZYZA 4EACA 3GG0A 2J7HA 1Q6DA 5EYWA 2P0OA 4LY4A 2I14A 1EKOA 4LF1A 1P7TA 2FTYA 5E9XA 4V27A 3IWPA 1X6NA 4RDWA 1AJ0A 2ZDRA 4CU8A 2CC0A 1E56A 3BOXA 3L7RA 3SECA 4NT0A 3TE9A 4MJZA 3WF0A 4WY0F 3LV5A 1H4PA 4S3FA 1JD9A 4JX6A 1OFAA 3O06A 4DXXA 3ABXA 1CW2A 1XRTA 2DT1A 3PVFA 3CASA 2FFCA 3DHDA 5G4EA 1R46A 5HWMA 1TIMA 4LYPA 5A5WA 1JDDA 2W6RA 2HE5A 2YCKX 4N4QA 4GHRA 1PX3A 1L2QA 1Q4WA 3WLNA 2DZUA 2R14A 3W87A 2R1PA 1KRCC 3QKZA 3PN8A 3RU6A 4DBEA 4S3BA 1IXNA 1V93A 1LOQA 4KGJA 1A5LC 1HJUA 3RJYA 4GJIA 1SO6A 2GVLA 1LG1A 1XD0A 3W7NA 1XBVA 1A3XA 4K39A 4K7YA 3CQ0A 3C2YA 5J5DA 5ABFB 1LROA 8XIMA 4HYRA 3N9KA 2XFYA 4O11A 3D6NA 4U31A 5BXTA 1Q6OA 4CNOA 4C6CA 2OMAA 4J3ZA 1H3GA 4FZIA 4CD7A 4ACZA 3QKEA 4XWUA 4C6OA 5HJLA 3ONCA 2ZTKA 1KW1A 3LCLA 4W9TA 4AMAA 3I7SA 3SUUA 2PI6A 4JNYA 1E0TA 2X30A 3P5YA 3NQFA 5BYWA 4O0ZA 1JR1A 3ARTA 3PBMA 1HXJA 4YWIA 3BWWA 1YE4A 4JXCA 2GVGA 5HPOA 2QJIA 5HULA 1PX8A 3EB2A 3CIXA 2DFAA 4RPQA 1IR2A 3DC0A 2E4TA 1ZALA 1R85A 1I2RA 1EO7A 2C19A 2IMRA 2YR1A 2Y4SA 3IVSA 2HCVA 6TIMA 4BF9A 4QISA 4G2DA 4GUIA 1LLZA 4LNCA 2EQDA 1KQZA 2DSKA 1TTQA 5D30A 3P74A 2R8WA 1ADOA 1KR0A 2FZ9A 4DZ5A 4CEXC 7REQA 3F2CA 4NZCA 3PBWA 4HTBA 3F7JA 3KOYA 4A22A 3CAWA 1R8LA 1GQLA 3VIJA 4JX4A 2HS8A 3S9ZA 3NR0A 4XISA 3LQGA 5DX7A 5CCZA 1C3FA 3DERA 2A85A 5CQ1A 4BFAA 2W66A 3A23A 1UJQA 3WUGA 5BXPA 4RE4A 4ICMA 3GHRA 2D3LA 1JYXA 2XPKA 2CZVA 1QI2A 3QXBA 3LUTA 2FQIA 1KV5A 3N11A 3TUUA 1NFGA 2YBUA 1Q5MA 2UY5A 4HHMA 5JBFA 1UPMB 2R1MA 5CZ0A 5AYXA 1VPQA 2QXWA 3GU2A 2YL8A 3VTRA 1PIGA 4UCFA 5CJNA 3E74A 3EB4A 1F2JA 4X9YA 3ABSA 1R2RA 5EB8A 5FF0A 4I9JA 1UKOA 4E6MA 1QTWA 4HMEA 1M53A 4AX6A 5H8UA 2X05A 2YB4A 3HA1A 1R3QA 2EKGA 3B0VC 4L4MA 3PBGA 3WLOA 1D8WA 1R3TA 1H1YA 4TXEA 5A6BA 2Z6JA 2JIEA 3VGEA 2WKLA 5D33A 2ZZ4A 2YFNA 3NOEA 3CUFA 4LUTA 1YX1A 3UPWA 2OSYA 4CCEA 4AZ5A 2Z00A 1ZTVA 3S2NA 5C6MA 3FAWA 2D2OA 1W3TA 4GYKA 4UQAA 3ATYA 2QNEA 1TA3A 5E5CA 3W75A 1XYAA 1O95A 4R27A 2ZE3A 3RO6A 2YA2A 1QPRA 3T0DA 1DJYA 5EL1A 1Y5VA 4US5A 2QCDA 5MKGA 4MNLA 5I2UA 3E5PA 4PCFA 5DN1A 1UUOA 1DJNA 1F07A 4DB7A 2F6XA 1AA1B 1GVEA 2V2CA 1V02E 4OE7A 5F4XA 1PKNA 1WUEA 3M07A 2GJRA 2OGYA 3DECA 1UKPA 2BLEA 4M82A 2RDTA 4O1AA 3BUVA 3T09A 1SR0A 1ZBCA 3E96A 3I3BA 4RX0A 5E0KA 3WNKA 5HDRA 3N6QA 3SN1A 3WF2A 1TMHA 1CXKA 5KZ6A 3IGXA 3O3RA 1VEMA 4XBKA 3QH2A 1DKWA 4XAPA 4IQJA 4DF1A 1KFCA 2EJ1A 4P8WA 1HG3A 2VGGA 3O1NA 3A5VA 3M4HA 5GNYA 3CLMA 4GI9A 1GORA 4Y6GA 3KL0A 2C7FA 2NX9A 1X1OA 3DFYA 4QNWA 3TAKA 6CGTA 1K8ZA 1OZQA 2PWHA 1XDMA 2EG7A 2ZZ5A 5AYYA 4ZFMA 4XV0A 2X1IA 3D3FA 3W38A 3WDPP 3K4WA 4B9ZA 1W3JA 5C9WA 1JULA 2A1YA 3MPGA 4XZWA 3TMQA 3LLXA 3GAYA 2ZC8A 3UNDA 5AHNA 6A3HA 3PTKA 2KAUC 1J6OA 1P6BA 1S2UA 3GNPA 1YPXA 3UYIA 3EEGA 2WZIA 4KWVA 3JVAA 1SUXA 2YYUA 1FDJA 3N2OA 3VNZA 4CD5A 4QJ5B 4ES4A 4FA3A 3AYRA 3G0UA 2A79A 1HJSA 3QLDA 4GX9A 3V18A 3A3WA 1LT8A 2GJNA 3L4TA 4MADA 3WK1A 5HINA 3LXAA 2V68A 4UMBA 2CESA 4LUSA 4ZO7A 1FH8A 3RLHA 2DZVA 2Y7GA 2WCSA 3PNUA 1G5AA 5DF0A 1EXBA 3MJYA 4OV9A 3S9IA 1CYGA 3DHPA 1ZENA 5LKYA 3ZOAA 4RNJA 3ITTA 1XYFA 4O57A 1DL3A 1I8JA 3UEQA 1Q6FA 3CV1A 3M6YA 4LAUA 2EAWA 3UY8A 3VCCA 1QCWA 1UWTA 4P8UA 1FKXA 4DI9A 3MUCA 1K77A 3DFTA 1IEIA 3IJDA 2J8FA 3ARXA 3UG4A 4F9DA 3NZPA 2CW6A 4KEZA 2DH2A 4DO5A 3CV2A 1L6YA 3BLIA 5DCBA 3SCWA 2HVOA 2W92A 6TAAA 2ISFA 1DEDA 1ZZMA 1P0NA 3B0YA 4ZSUA 2TMDA 3AMLA 3B9AA 4YCPA 1L0PA 3WLSA 3BDKA 3EOSA 4WRHA 1SMAA 3R7MA 1FWAC 2PDYA 3B9NA 2ESCA 4MY1A 5XIAA 2ZZ1A 3RLUA 1HF6A 5CZTA 1CXLA 2VRJA 1OT1A 4EOUA 4PEEA 1O7AA 4HPJA 1IGWA 2OZ3A 2WSRA 3W7EA 3G22A 1RXOB 2IXUA 2V5BA 4Y9NA 4HOXA 1RP9A 4DWSC 3UPBA 4FAMA 3EMQA 3HQNA 4H3DA 4AWSA 3KCLA 4UTWC 4ZQMA 1S2TA 3H2EA 5EGRA 4MMWA 4WXYA 3VNIA 4H01A 4C7GA 2QDEA 1A80A 2D23A 3URBA 2YA0A 2YW3A 1S1RA 4CN4A 3WYZA 5A8GA 1AMKA 3QLLA 1TELA 1SZGA 5JBDA 3C6CA 2RJHA 4WK9A 3WQ8A 1NP2A 3KW3A 3T05A 3TLLA 1EDQA 1JRBA 3MO4A 4DWDA 3ZLFA 3OLEA 3UG3A 1O1HA 1S5VA 4JHOA 2OKTA 4NJIA 3FJLA 3RDKA 1XYZA 2JE8A 3RITA 1E72M 3KRZA 2PSNA 3TIMA 3A4XA 4GVHA 2DJXA 3TYUA 3UWYA 5BW6A 3FNDA 1ZFJA 5I03A 3OA3A 1ZL1A 3W53A 1XDJA 3A4WA 1ZUAX 1VJSA 1US3A 1R9XA 1XIFA 3NQDA 3MUY1 1I2QA 4RE2A 3M1ZA 4ZBCA 4E4FA 5K7JA 3QBUA 3DYPA 1MXSA 5TBOA 3QQ0A 1EBHA 1H0GA 2ALDA 5FI8A 4JYDA 2JEQA 1IWBA 3DUGA 3EA2A 4DWSA 4GQQA 3MCMA 4H00A 1WXJA 4D9PA 9RUBA 1VF8A 1PTGA 4K7VA 3REQB 4AIBA 4N4PA 1KCKA 2NX1A 3A47A 3LHYA 2C15A 4MOZA 3VGBA 2XU2A 3E2SA 3IIZA 4E4PA 4AVNA 2NUWA 1PKLA 2G8ZA 3QHNA 2J6VA 1VFHA 4A2SA 5CPMA 2JIWA 1UZHA 2V3FA 2DZSA 1CGVA 5K9DA 2WZEA 1XRVA 4J9JA 2C1HA 5D8WA 3AWNA 4AHQA 4PBEA 1RD5A 4W93A 3TQVA 2FZNA 4C6NA 4IPJA 2XTKA 3G1FA 2EO7A 3O2LA 1K70A 3IGHX 2V63A 3P2VA 3OIHA 4AZBA 4M6PA 3GW0A 4FLSA 3L12A 1OCBA 1YDOA 1Q45A 3M0XA 3HF3A 1JCJA 1A0CA 4O19A 3SM0A 3H4WA 1ZJHA 1Q2RA 3FGCB 1CLVA 1XUUA 3WD4A 2VCCA 3MJMA 1K7EA 1KLYA 1DIDA 3TW7A 1V7YA 3LPGA 1IZJA 1MUCA 5PTDA 1H0IA 4FXRA 4YHGA 1RK6A 3CLWA 1X6UA 4WHBA 4NJGA 4B4FA 3HGJA 1E4NA 2XH7A 4JQAA 5CPSA 4DUOA 5AC7A 1D7KA 3ZLHA 5HMFA 4EPDC 1XS2A 5GQBA 2GWGA 1YPIA 3RM4A 2ZZ7A 1UP2A 1G94A 1SU5A 3GBDA 3S4TA 3WJWA 1TPC1 3H7UA 2VHLA 3TYAA 5I3GA 1XINA 2O56A 3KM8A 1U5HA 4I9MA 4GKLA 1CENA 2PD9A 4ZOEA 1JZ7A 3FKKA 1TPUA 1Q85A 1E0UA 1R3VA 3H55A 4NJKA 4QBXA 2HDJA 1O1ZA 3INPA 1H7WA 1D3CA 3MP3A 3H2OA 4AMCA 3KRSA 2W61A 3A5FA 1BYCA 3OBEA 4YYCA 4K8GA 3SAZA 3VOJA 5A6JA 4OJYA 3S6TA 4CU6A 4ZOBA 1EWDA 1JZ4A 1REQB 3L0GA 1X96A 1SGJA 2ZUVA 4IMFA 3GC2A 3ZS4A 2FMOA 3GWQA 4ZQPA 5B7ZA 2WVSA 2NT0A 1G0CA 3MW7A 4TO8A 1QPKA 3QW4B 1FXPA 1HKWA 4HKPA 1O68A 2VEKA 3MO7A 4IIBA 2CFFA 2QPSA 3RRXA 1XKJA 3E02A 4D6GA 5LNUA 1VFTA 1T6MA 4LVFA 1WE5A 1U1JA 3VGDA 3EDEA 2Q71A 3FLUA 3MQTA 2ACUA 3DU0A 4XZNX 3RCYA 1V02A 3FV9A 3LNMA 3TW6A 3W27A 4W89A 3L23A 1HX0A 3PUGA 4LPCA 1ECQA 1LWIA 2ZZ2A 3OVQA 1WOAA 2FTWA 3OLIA 3MZ2A 4K1GA 3B8VA 3N9SA 1BQGA 1PTAA 3HQ1A 3MTWA 4R7WA 1J10A 3EPNA 4RE3A 3P3BA 2PDMA 2AL1A 5D38A 4JN8A 5CSYA 3BSHA 2CETA 3N25A 3QV6A 3M41A 2DT2A 4O15A 4HK7A 3MDUA 4R9OA 1OCJA 1OYCA 2WMIB 1O5KA 1G4EA 5JXQA 2Y5JA 3E3HA 1CGYA 3IGUA 4RZ5A 1LQ0A 4X63A 3MHGA 3TTEA 1ZHAA 3P82A 1L8NA 4X3ZA 4WQ6A 1JFXA 2VR5A 3S1WA 4CNSA 4FNPA 4NXSA 4E3VA 1TPEA 3OYXA 1IEVA 5FJRA 2ZZ3A 4P61A 1B31A 2Y89A 4WKHA 2PGWA 3R12A 2PS2A 5G1TA 1OHLA 3BQ6A 1FBAA 2MNRA 4ATWA 1BEUA 3G1YA 1YDYA 3H12A 2PP0A 4WX2A 4C6BA 3JZUA 1YXDA 1BFNA 4PTNA 3ZWSA 4M3PA 3VKBA 4IQEA 2AOSA 4H9XA 3V5FA 3ARVA 2OPJA 3PZNA 1AW5A 3FJNA 2CZEA 1ICQA 1JPDX 2GSHA 4GJJA 1LWJA 2ZBTA 2X40A 1R47A 4O54A 2Q8LA 4CCDA 3GE7A 4HA1A 4GKTA 4DZIA 3QGAC 1E1CA 4GCAA 3WNNA 1MRQA 1XLEA 2OLHA 5FF2A 4FO4A 4CN6A 4HU8A 1FWGC 3FXGA 2NUXA 3UCDA 2PDWA 5DMYA 4OOUA 2GYIA 1W37A 1RJRA 1TWDA 5LHEA 1TVNA 4MJ4A 5AHEA 3W71A 1KM4A 3BZGA 3SURA 1F5ZA 2FLIA 4PCNA 1LYXA 4HPXA 3BMWA 4G56A 1H60A 3M43A 2FJKA 1TV8A 1B2YA 1W9PA 3ZVHA 2IPJA 1PZ3A 1EEXA 1DJWA 3TQKA 1E9ZB 2XH0A 5CGQA 1DWHM 3GB6A 3NCOA 3TTSA 3GDMA 4O0KA 1OIFA 4CQBA 1JYVA 2FPVA 3OP2A 2BXVA 1B3VA 1LL6A 1V5XA 1HN1A 2I5GA 4LC6A 4GCXA 3ZQ9A 2X41A 3AMGA 1R5YA 4YJ5A 4WY0B 1GQIA 4NZFA 5ECUA 3BGAA 3TYZA 3VD3A 2HRWA 3DGBA 1TUXA 2CLIA 3WG6A 2OLAA 1LBMA 3ORWA 3OW1A 5LIWX 3VC6A 4B15A 3NDZA 3MI2A 1V6XA 5FL0A 4KRUA 2VMFA 3DBPA 1UC4A 3LENA 3KBSA 4QTGA 2E77A 2E9MA 3AXIA 1DXIA 3GIYA 3H2AA 1OG0A 7XIMA 3KL3A 4HHHA 5H91A 5CLWA 4CNUA 5HUPA 4LJ3A 4HNOA 3IARA 3H53A 1SZRA 3FHQA 1KFLA 4PULA 1VS1A 3WQVA 4GLEA 2QJMA 2WAGA 5EMUA 3ABRA 3CL8A 3RYSA 5RUBA 1WKEA 1ISZA 1AQ0A 5DMLA 5CPTA 2GOUA 2Z29A 4GNVA 1I1WA 3V35A 3U48A 3BLFA 2C18A 3BOFA 2Y85A 3VIIA 1KGWA 1VYPX 1FCQA 2X8RA 3B8DA 1FXQA 1TE6A 4PUWA 3RCMA 5GNZA 3C86A 4GG9A 3PPGA 3WLTA 1KXTA 3K13A 3K30A 3JUGA 1FP9A 3A22A 4B5TA 3AZTA 3EDJA 5I0DA 4PMQA 3SIMA 3H24A 2XIQA 4XVDA 1EUAA 2BXYA 3EBVA 4EWJA 1TPDA 4XD4A 3ITGA 1XCXA 4DNMA 2WLYA 4C91A 4JL2A 2H90A 2DVUA 4JIEA 1OFQA 4QEEA 3THCA 4I5RA 3UGRA 3N2MA 3LPOA 3LLDA 5A8QA 1TUFA 3W84A 3WQGA 1QBBA 4WDTA 5G2WA 1IE7C 3T4WA 4Z17A 2PU1A 1DIKA 2G5WA 4XIAA 3ZFHA 3DFQA 2R6OA 3KXQA 1GKQA 4FX8A 4Q8UA 3LRMA 1QI3A 3EX6A 1OVDA 3AIVA 1BWLA 3ZM8A 3VIOA 1HP5A 1GZGA 1AH4A 3ZJ6A 4U5IA 4UTIA 3CBWA 3KZSA 1SSGA 1YMYA 1CBGA 3B9DA 2DIEA 3NURA 2VGIA 3NZGA 1OG6A 4F0MA 2E5DA 4KH2A 3WDQA 3DKLA 3KDNA 3JS3A 2NLIA 5I77A 2JKAA 1NF0A 1PCWA 1A50A 2ZRVA 4LCRA 1EL3A 1GCYA 2ZUSA 3GXFA 4DBSA 1QASA 4HNNA 2G41A 4NAFB 1VFLA 4YWSA 4H7VA 5C9RA 4H8NA 3LN3A 4REQA 4D1IA 3TFCA 1AH0A 1K1DA 1BG9A 3UXAA 1M5WA 1KLZA 2ODOA 3QMTA 4JFTA 1HKMA 5JH2A 1EF2A 1US2A 1FWNA 3KLKA 3C2VA 3H6OA 1XLFA 4IMGA 4RZBA 5BOOA 2ZXAA 4LANA 4HBKA 1LRNA 3G77A 3KOXA 2F8QA 3GXIA 2CWNA 3GDLA 3CT2A 3IK4A 2DV0A 4HK5A 3ARRA 4OECA 4H8UA 4H7CA 5I79A 3IV3A 3SIZA 1OFEA 1ONRA 4DZHA 4I6VA 2R82A 1IEWA 2WPBA 3URNA 4GJ1A 4ENLA 1I2PA 1ITUA 1PYFA 5D9NA 2QT3A 2VX6A 5D03A 2OG9A 3TCEA 1OX5A 2ZA2A 4AWUA 2GLKA 1A5KC 3G6LA 4IP5A 2VDIA 5CZKA 1XV8A 2FHFA 3FJ4A 1XLHA 4O12A 4DLMA 4WLCA 1TYGA 1SFLA 3H22A 3XIMA 4A2RA 3MB9A 3C0LA 2WMJA 4L80A 1XIJA 1SVDA 3O6DA 1KGXA 4OGZA 3ALFA 1MDLA 4ZB5A 1FWDC 2WOQA 5BU9A 3MUAA 3AZSA 3CNYA 1K4HA 1UQYA 1OD8A 1H7RA 4AEOA 3FXYA 1F76A 3N2XA 2VJXA 1UWQA 3VKKA 3ECQA 3AYTA 4ML9A 2PTYA 3VVGA 1B90A 2VC7A 3AHXA 1QO5A 4MWAE 1FWEC 3P93A 3G1RA 1W91A 2R1NA 4OFCA 3SCSA 1HKVA 4MSSA 3PFMA 1E3ZA 3EXTA 4GZIA 3SCVA 4FNQA 3VOFA 1AQFA 1TE1A 2J79A 1T41A 3O05A 3CM4A 2GJXA 4RZ6A 3SCTA 3ARYA 1EH9A 2IW0A 2E8ZA 3VYLA 1MYRA 4QIUA 1REQA 3GW3A 4PCSA 4PFMA 4RXGA 2VEMA 2PEVA 1BG4A 5CC3A 4AZHA 4LRTA 1GHSA 4F4RA 3AIWA 1Q13A 1CGXA 2V5CA 5AOUA 1LM1A 1K9TA 1QNSA 3SGUA 2IS7A 2DH3A 3BG9A 2ZDSA 3U5YA 1JVNA 1TO3A 1H5VA 1WAWA 2NLYA 4PN2A 1MRAA 3IS4A 1F4HA 1LOLA 4G7FA 1FCVA 4ZO8A 2BTMA 3TEVA 1ML1A 1W6TA 4YVPA 3AJXA 3ELFA 3GO2A 3HO8A 1ISYA 2P8CA 4A3UA 1EPVA 3PZOA 1DWGM 4RNHA 3AO0A 3VDBA 3HMCA 4QE1A 1ZCCA 3ANUA 1UIOA 3V4BA 3W01A 3M0HA 4IJCA 4O18A 3BAWA 3UPMA 3AU2A 2AL2B 4DO7A 1FFQA 3VNKA 4ZOCA 1AZ2A 1O5QA 4NG3A 3CWOX 2B7PA 1C92A 1YEYA 3BC9A 1S3HA 4JKLA 1KKRA 1PAMA 2YLLA 2FPYA 1IF2A 1KXQA 4UQDA 1V3JA 1O60A 1DXFA 4NX5A 1KCXA 3W7PA 3M5VA 4L61A 2WMIA 1V8EA 3UA4A 4JN7A 4GQRA 3QZ6A 1VR6A 4DPQA 3BVJA 1W2VA 4W87A 1H61A 2PWGA 1U1UA 1YDVA 3PJWA 4R5EA 1XSIA 1Q7ZA 3N17A 5AYBA 1QT1A 3LEPA 4IGMA 4GC4A 1P1MA 1AUSL 3M0MA 3AHVA 1TQJA 5E6ZA 3S1XA 3E2RA 4LX4A 1B9ZA 4E2VA 3U8GA 4GBDA 3UXIA 3TZNA 2X09A 4IG2B 2AAAA 4IPLA 2O92A 2J88A 1XCFA 1U33A 2ZUUA 1JL8A 3W2NA 3LX9A 2XGZA 2WC3A 3UWUA 1WDWA 3PTQA 5AKQA 1LJYA 1SZEA 1Q6RA 2ABBA 1AMYA 4XBSA 4BR1A 1DXEA 2PWDA 4XSMA 1TWIA 1GW9A 4X2PA 2WMKA 4IGNA 1J79A 3R58A 3VD4A 1YNQA 2C14A 1P4CA 1VRDA 5DXXA 2RJGA 3WDHA 1W0MA 3SGGA 2PDHA 3STGA 1POKA 1E0VA 1XR2A 1WDRA 3GYEA 3RX2A 2Y5EA 4ZVJA 5AC5A 4KT2A 1CB7B 2QDGA 4PTMA 2E9LA 4HPHA 4O1CA 3CAVA 3NM3A 3C0SA 2QCFA 1Y8BA 3MKCA 5DLCA 4WCJA 4TUFA 2D0FA 1XIEA 1UKTA 1E43A 1M3UA 1OD0A 3TCSA 4GIAA 3Q65A 5A6KA 4MY8A 3VX1A 5J5RA 4YTUA 1X97A 1B3XA 2B7NA 1G7VA 4BI6A 1CX9A 4TX9A 2YL9A 3G3DA 3K1GA 2XM1A 1FOBA 3W6YA 4UQCA 3L4YA 2QPXA 1R2TA 3I3EA 4HU0A 4BF5A 1CXIA 4C1NB 3EXRA 4DJEA 4Q4PA 1EB3A 4GRSA 3SBFA 4DBWA 4YL2A 4DHGA 2E67A 5BROA 2Z2BA 2JK2A 1BSIA 5IHSA 3H54A 5DRIA 4DYEA 5K3VA 5EKYA 4QEHA 3O0FA 4N2YA 1THFD 1XIHA 2PRMA 3A21A 1XC4A 2A3LA 4KRZA 3NXFA 3W1LA 4K8EA 1X38A 1R0MA 1N8FA 2E6FA 2R1KA 3WBAA 1KCZA 1FA2A 3OZOA 2ZXBA 4PMZA 3VKCA 3ZJKA 1WBJA 4KPLA 1XBXA 5KINA 3ZR4A 4QCFA 5REQA 2HSAA 2PF8A 1LLOA 1DYSA 2ZTJA 5DBTA 2P53A 4G5DA 4OZOA 3QFEA 1FWFC 4C6IA 3ES8A 3S3GA 3W81A 2YDQA 3CO4A 4AAJA 2OGJA 3UWQA 5AZ0A 5C0QA 1U5JA 1DQWA 3O6AA 4A3RA 3DXIA 2GQAA 1OYAA 4UFMA 1F6KA 4PUUA 5I6SA 1RLCL 1YYAA 5CG7A 3HG4A 3A3XA 2CYGA 1VEPA 3W1RA 4YS1A 2AMGA 2POTA 2YL5A 4KWWA 4XAZA 2PURA 1J8VA 2C13A 1OC7A 2VGFA 3BMXA 5AVHA 1RZMA 2GK1B 3CMGA 3BG3A 1KTNA 5JMUA 5BMWA 1O12A 3GDKA 1XIDA 2PLMA 2O9RA 2OQYA 3T44A 2VVSA 1XBYA 4IZGA 1JUKA 2VC9A 3W7LA 4B5XA 2GQ8A 5ENLA 3PPHA 2F61A 1UD2A 2OEKA 1R7OA 3GVVA 4N9EA 2INEA 4ZR8A 4D8ZA 2ZX9A 4MFEA 1L6FA 3NYZA 4JN6A 3W7MA 4MKSA 4MVAA 4OTKA 3E0IA 4CUCA 5CEWA 1KRBC 2CLEA 4CCCA 1QO2A 2WVVB 2WMFA 4HNCA 2XM2A 1DJQA 5F7UA 1WAUA 3NM1A 3NZQA 3TYBA 1EC7A 1MZHA 3AYVA 3NFUA 3VDGA 3UY7A 4A3YA 3ARQA 3MBDA 3LCFA 4POCA 1QOQA 4Q8PA 2Y61A 1QHPA 5K4XA 3CUXA 1F6PA 3PUOA 4JTFA 2BVWA 1F7BA 1R87A 1O66A 2WSKA 2CITA 1KM5A 3FHAA 2XIBA 3U4FA 3SADA 1HJQA 5HMSA 3GNNA 1KM1A 2JKEA 4LB4A 3EMCA 2RFGA 2J62A 2V6AA 4LYKA 4JKKA 3KVKA 4G8TA 5ABTA 2A21A 1XSKA 3FS2A 4Q8VA 5I3FA 2V81A 1MW0A 3W1NA 4DM1A 3S0CA 2XYLA 3SUTA 4J3WA 3HG5A 1EC9A 5B7YA 3IGSA 2RGLA 2QAFA 2GZXA 1W1IE 4PEKA 1Z6KA 4XAYA 1H51A 5A6LA 1XGZA 3O6YX 1VENA 4MNJA 3PJXA 1OY0A 1KBLA 2O9OA 3URAA 2VO5A 2Y24A 4NILA 2JALA 1T99A 2YZRA 1GQNA 4IL0A 3VDAA 3DHFA 3BURA 1NDVA 2UY2A 4O1FA 1Z8AA 3P60A 3L5LA 3LTPA 3PZIA 4MWAA 1GVFA 3EWWA 2PWEA 1AW2A 1W1TA 2GGEA 3T8QA 2C91A 2WWDA 4WXZA 3KS5A 3MYPA 3CJPA 3ID7A 3NQ6A 1XFCA 5CJMA 1VB9A 2FH6A 1K03A 5BRPA 4CVUA 3U57A 3UR5A 2V3GA 1IGSA 2BXZA 1DE5A 1HO4A 3F4NA 4BQ4A 3PPCA 1JIBA 3KTSA 2QVHA 1XLMA 2DZAA 4MLRA 2BNJA 1M7PA 3W00A 4INFA 5LNRA 3MV01 1EJXC 2EXOA 4W4QA 1PEZA 4AY7A 1IV8A 4B90A 4ZA0A 4PL2A 3BLOA 1A0DA 3OO2A 4C6LA 3P8IA 4YPJA 3MVTA 2ISSA 4V2XA 3VILA 4XKYA 2O4MA 4FS9A 3VOCA 2FDMA 1DTNA 2QAPA 3HFYA 4YYFA 3TFXA 1B30A 4AZIA 3LM7A 1F9CA 1JZ2A 1K3UA 3C8FA 4QLJA 4F2BA 3ZSSA 2VD9A 1RD6A 4L5ZA 1LL7A 1Q6LA 1R3RA 2QUVA 3MZNA 4H04A 1QWKA 4ADUA 3VXGA 3GFYA 2E1WA 5CC7A 2X42A 3KAOA 4PMVA 2FH8A 3PBVA 4AYGA 3VNDA 2C16A 2RUSA 1C8VA 3CL7A 2V5KA 3VMOA 3W23A 4LAKA 3TOYA 2YXXA 5BZAA 1PS9A 3P0XA 1KFEA 2XSBA 1SO5A 4GI6A 2G3MA 4YTQA 5C55A 1JF6A 1JEZA 3VA8A 4UTLA 4HJFA 4QJ3B 1GQJA 2XN1A 3W1TA 2FYMA 3ENLA 1XICA 4TX8A 4AH7A 3WK2A 3B4UA 3KS6A 3UJRA 4NYUA 3PTDA 1W1B1 3AIUA 3OIXA 1EOMA 4MG4A 4M7SA 2PBOA 2ZX6A 1FH9A 4JQ4A 3UNTA 1IEQA 1POJA 3ZT5A 3W4RA 4XG1A 1ONWA 1EYEA 5CAKA 1EYWA 4D71A 4EWND 2UWFA 4HP5A 3G1DA 1UCWA 3LHVA 3SY1A 2CZ5A 4RE0A 3R89A 3AHTA 4WKFA 4YLWA 3G0XA 4XZMX 3NEVA 4YTTA 2XIIA 3BV4A 3NJ3A 4S2BA 3II1A 3UGVA 3SSJA 3SRHA 2Q3OA 4KRTA 2P88A 1G4SA 2RKXA 4IUGA 3WLRA 2WV8A 3TJ4A 3D46A 5C8BB 1XSJA 2VR4A 4DJFC 1O5XA 1WDQA 1FUYA 2WO5A 2AGTA 3KUMA 1Q4NX 4YHEA 3RGTA 2TAAA 4GISA 3PM6A 4LXFA 3QV9A 1KBJA 2NUYA 4JFVA 5U4NA 3QC3A 4LALA 1RQEA 3MKVA 2OYLA 3JW7A 1UJPA 4K2SA 2Z26A 4OUIA 4J27A 2CZFA 1XLJA 3S5NA 3TTOA 1P7TB 2XH4A 1UYQA 1UMLA 1ZY9A 2YJQA 2PWUA 3N12A 2YPIA 5HOSA 2X0YA 1JG9A 1CECA 4TR9A 4BWLC 4Q4OA 2GJPA 1T8QA 4O0QA 2QW5A 3B40A 1M01A 2QGYA 3WDIA 3VC5A 3ZT6A 9XIMA 1KTBA 1H1ZA 3R13A 3WLLA 4OBTA 3E9AA 3IACA 4K37A 4HT3A 3UZZA 1QR7A 2Y70A 3C3NA 4HCDA 1SYTA 1L6WA 2VVNA 3CB3A 2P5NA 3N04A 4YVVA 1QDSA 3VE7A 3CH9A 1NDYA 4HTYA 1A5OC 2E3ZA 4GA8A 4Z08A 5KTLA 3WMLA 3WQWA 2UV8G 4QLKA 4Z2GA 1XISA 3EX3A 3URQA 4DLFA 4P7RA 1OFRA 1XKYA 4Z1YA 1TTPA 3W2LA 3IJ9A 4EANA 1GOOA 3RM8A 2NV1A 4TQTA 1DHKA 2DUXA 5D9MA 5BRQA 2X0SA 4O13A 3VUSA 3WQ5A 2EF9A 1KCLA 3VIMA 2Q8ZA 3T0TA 2PU0A 1UWUA 3NGJA 3THUA 1JDEA 1GVSA 1Z32X 1XIBA 3OLGA 1H2JA 3LD5A 1UD4A 3VKAA 2VC5A 2ANUA 2CZDA 2WKGA 2ZXDA 4HMNA 4U2ZA 3I65A 4Z2HA 5BOEA 1KA9F 1WZMA 2XUCA 1DORA 3BSGA 1A3WA 4ACZB 4I7UA 1J0HA 4H2HA 5FOOA 3UESA 2D2GA 2NQ5A 2EJAA 4BI5A 3SY5A 4BQ2A 1GW1A 2E40A 1A5UA 5F1UA 5CBIA 3KWSA 3AROA 4MHBA 1N8IA 3WH9A 4JYFA 4M7TA 3RHGA 3N34A 2NZLA 4BWLA 1PB0A 4BJHA 4MIMA 3QN3A 5T91A 4RXFA 3WSUA 1OF8A 4KW2A 3LHZA 4PRRA 4NAEA 5IFTA 1NWSA 2FB3A 3EX4A 1E40A 4UFJA 4DEFA 3CTTA 5I78A 3GAKA 4WDUA 2ZX8A 3UP8A 1QVBA 3KDOA 1PTDA 3HV9A 4UFLA 4HSOA 1GVIA 1VYRA 3NAVA 3HB9A 4XAFA 3P6LA 4S3KA 2HNEA 7REQB 1WDDA 1KWKA 2OOGA 2VM8A 3AJ7A 3D5HA 3VAVA 2D3NA 4PMDA 3NQVA 1K9EA 4LQ1A 3BMVA 3TWAA 4BKNA 4KFNA 1BTCA 1NVMA 4HNLA 3TYEA 1I2OA 1IT7A 1DJXA 4B16A 3E6EA 5IDZA 4F0KA 1QHZA 4BY3A 2OWXA 3OEXA 2G3JA 4FI4A 4PMOA 3OHMB 4E3TA 3B97A 5ABHA 3WJSA 4AIUA 1VJZA 4NU7A 4KESA 1JYWA 3TOPA 4PUMA 1FDZA 1Y5WA 3KOWA 3ZSTA 4ORIA 2FZBA 5H8MA 4JFUA 6PTDA 3OZPA 3K1DA 2F9RA 3IVTA 1GOKA 4HOWA 3R8GA 4G7EA 4PGLA 6REQA 3BAIA 1UBSA 1ZQ5A 3O63A 3ZJ8A 4ZENA 3T2OA 3W73A 4FOUA 1GPWA 3F5LA 2W3ZA 1CNVA 1GG1A 2V67A 4AZGA 3W1QA 2GDVA 1BGAA 2VQTA 4AVOA 3UWEA 2HVNA 1OBAA 4JDBA 4GY0A 2PDNA 4XBJA 4L1WA 3NO3A 4LUTB 1U83A 4AWEA 2HK1A 1JZ6A 5CPNA 3R11A 1H49A 2B0MA 4IGHA 5D8ZA 5HATA 1TA3B 1BKSA 2QCDB 5MKGB 1CCWB 4TOQA 3NQGA 4Q7IA 5HNRA 4GZ7A 4NNCA 3BCDA 3QYQA 5BCAA 3PFRA 4AG0A 5D2WA 4RUBA 1R2SA 4NJHA 3IRSA 1ZJIA 4I6KA 5HQMA 2A3HA 1GONA 2YGYA 2C71A 2NQZA 2ZOXA 4GUGA 4GI4A 4U5KA 5FAJA 2QDDA 3QR3A 5C7HA 1J2BA 2Z1XA 3GTXA 1C9DA 1XH2A 3KWXA 2DT0A 2X0HA 3M64A 4ZTXA 5G1MA 2YCJA 2PMQA 3SO7A 4NI8A 3CC1A 4EXAA 1UPPA 2JF6A 3IK2A 2O9PA 5BOFA 2BODX 3W7OA 1VLWA 5GJMA 3N19B 2X7WA 4WJ8A 4MDPA 4R3UA 4DRSA 1DVJA 1M1BA 4QE4A 4J3UA 5E0CA 1TJ2A 1UR0A 4Q6XA 3CHDA 3OBKA 4AC1X 3T2QA 1G6CA 1FFRA 1IIHA 5IRPA 1WZKA 4GUJA 4B5WA 3MU7A 4WJEA 3W37A 3GNDA 5DT5A 3SJ3A 3HJZA 5C71A 3BLPX 3KBVA 2FVLA 3RX3A 3ZR6A 3TV8A 1E71M 3IJ6A 3L5MA 1UH4A 3CZLA 4MM1A 3GLCA 1XWYA 3WQ4A 1E1EA 3B0XA 3GR7A 1B3YA 4UQEA 2QVNA 3W1PA 5TF0A 3ZO9A 1QFEA 4OIFA 1J12A 4OBRA 3QTPA 4WZHA 3NZRA 3DHUA 1JZ3A 3EOUA 1PWMA 4M8UA 3WUEA 2CHNA 5DANA 2J7DA 3BGGA 1WOBA 4NNAA 4LUSB 3M16A 1ITXA 1FVPA 1ADSA 2WJEA 2E6YA 2ZA1A 1EJ7L 2WQPA 2GWNA 1P0DA 2E0PA 4H9TA 1FRBA 1WPCA 3F5KA 1T40A 3WN6A 1KGUA 4QJ1A 4ZOAA 4PRTA 1KR1A 3C52A 4LBUA 1C8QA 1Z42A 3O0KA 3A4AA 3TJIA 3LPFA 2YBTA 2PDUA 3GXTA 4H9VA 2VT0A 2DY3A 3DG7A 1VCFA 2GGIA 3TSDA 1XHGA 2Z7GA 3W1MA 1H09A 3TR9A 2GDUA 1UBPC 3MI6A 4I7WA 3ME3A 1E51A 2HNHA 3MSGA 3AWOA 1FWJC 1W5OA 1KO0A 1G4PA 4HSHA 3Q4DA 5CH9A 4IH3A 2E5CA 2J7EA 3G5EA 1F73A 3HPAA 4W85A 3ANYA 1D7FA 4MZYA 4K3ZA 2J4GA 4UOQA 1MNZA 4ILSA 4HA3A 4UMAA 1LUCA 3WNMA 4MTVA 3J7HA 2KZHA 2Y5SA 4XX6A 1JF5A 1UKSA 3MMWA 4C1LA 3DI0A 1EJTC 8TIMA 2DEPA 3K4DA 4B3KA 4YTSA 1EJRC 4LYQA 1H62A 4L1GA 3YPIA 1TX2A 3B9EA 4UIOA 2Z28A 1DIEA 4HYVA 1ZNNA 1I4NA 3TQ0A 4ERGA 4JD4A 3H2MA 4NNBA 4DO6A 3T07A 3RU8X 4C90A 1NOFA 1TPWA 3PNZA 3EA1A 2D2JA 1S3TC 2GQ3A 1UP3A 2OR2A 3BAXA 1ICSA 1PZ0A 3CUGA 4FHAA 4OWGA 4ACYA 3BLKA 4WJXA 1GUVA 1ZPTA 2NV2A 1I0DA 1RBAA 2Z1KA 3TJLA 4LU0A 1W8GA 5C5YA 3WQPA 2BY2A 4S1FA 1KFKA 2RDUA 2BVTA 2GUUA 5EFFA 3W24A 3VCNA 3T0AA 1WXZA 1BF2A 1M68A 4JIQA 3GDRA 3TROA 1CB2A 4GO8A 5EMLA 4Q3MA 2PLJA 2OWWA 4FLQA 3W29A 1JD7A 3KE0A 3T7VA 2E28A 4J3TA 3MC5A 4OKDA 3QR1A 3CMJA 3GRIA 3AMCA 3VUPA 1KB3A 4IT1A 1EX1A 2XGIA 4JICA 3RMEA 2F2HA 2VFHA 9XIAA 3HPZA 4EX4A 1KXVA 3POCA 4H8HA 5A8NA 4DYKA 1PKMA 3VIKA 2NVCA 2QS8A 3WJXA 3PWIA 3LBOA 1ZS2A 4AD2A 1XLKA 1FWSA 3WUBA 4JFSA 4DWSB 3WBYA 1GOXA 2REQA 3HPSA 3FAXA 3RM9A 1A4LA 4X22A 2V82A 4O10A 4JEJA 5CGMA 4QJ4B 1QPOA 4GO9A 4AD3A 1H5YA 3LB0A 3OG2A 3QJAA 3PR2A 2JGQA 2XVGA 3U7BA 3TZFA 2BOEX 3FEMA 3R5EA 1LT7A 2VDGA 1JCXA 5LIUX 4Z2JA 3AAMA 2J7FA 2EPNA 4W7WA 4GH3A 3A12A 4Q32A 4HGXA 3TKFA 5DY2A 2CNCA 3KOFA 3WFAA 4H1ZA 2OFJA 3B03A 3W2MA 2GGHA 2ATMA 2ZRYA 5CKSA 3EWYA 1GOMA 1QU4A 4XZHA 4KF1A 2OSWA 1GVQA 2V38A 1PV8A 1A0EA 3USZA 3LMYA 4H41A 2Q3RA 3GYCA 2Q8XA 4AD1A 1NF7A 2HZGA 1W5NA 2CLMA 4O8RA 3C56A 5M03A 1WCGA 2YDRA 1ZCOA 3G8EA 4JY8A 3WJZA 3JZEA 1SJDA 4ZXLA 3SI9A 3RLGA 3G8RA 1V0NA 1PX4A 1PIIA 1RCOB 4B5UA 4FIRA 4N7QA 2JGYA 1I1XA 1W17A 4ZQNA 3STFA 1ZSXA 3TA6A 3P8JA 4PMNA 4Q4QA 4IJBA 1UC5A 5D2VA 3KL5A 2Z4GA 1XQKA 4I5UA 3TC7A 1GJPA 2P0IA 4JYEA 1E5NA 3OGRA 3GM8A 1JCMP 3V0UA 4HHPA 4M51A 3R25A 3W1UA 2IQ0A 4YNGA 4RDVA 3VIHA 3APYA 1KXHA 3FN9A 4Q4RA 2ZUNA 1UMYA 4GGHA 5A8MA 4FLOA 5DQPA 1EJWC 2YKKA 1XC6A 3WL0A 4CKQA 1V6VA 5A1AA 1LWHA 1OFDA 1MO0A 2QCGA 1VKFA 4F0LA 3NPXA 3ARZA 3WMCA 2FDSA 2E5BA 3CZEA 3CHFA 1R9ZA 3LS9A 3VD5A 3LTSA 4HMCA 2Z1BA 3MWCA 5FACA 4D8LA 1W9DM 4C65A 2VX7A 3BAKA 2PDPA 4GINA 2PCQA 3WH7A 4MAZA 2WHLA 1QBAA 1YE6A 4HSNA 1ZAIA 4KIEA 3L5AA 3LK6A 5C54A 1LRQA 1S2VA 5F2IA 3PG8A 3L4WA 3OZMA 1OX6A 4NKCA 2E25A 3AMDA 1LQ2A 1RA5A 4KCVA 2BVYA 2HXUA 3PANA 3P5ZA 2BHUA 1NQKA 3C3UA 1UZDA 3GBEA 2KX9A 4JNZA 4XIMA 3GKFA 1ZAJA 3NEHA 4M6QA 4A29A 3F4VA 5CLTA 3LM3A 1MW3A 1BPLB 1M9HA 3L21A 3HGOA 3LNPA 5FSDC 4LH8A 1P0KA 4Z1CA 5LA2A 3PZMA 4PUDA 2WSPA 4M1RA 3ITVA 4LS0A 4ASTA 2CKSA 4HZ7A 2PGRA 2HQAA 3GSMA 2EG6A 2VD8A 3LDVA 4LFYA 1V3KA 4JL1A 3ISIX 2OYKA 1VYSX 3WLMA 2X2YA 2DJLA 3W07A 2V5JA 3UJEA 3W7GA 1O6IA 5AN7A 3W9ZA 4BCEA 4ONVA 1EO5A 3F03K 4EF9A 3VNLA 4C60A 2H3DA 3CUIA 5DBUA 4HK6A 3NQCA 2WWCA 1XRSA 4M80A 2XINA 1FY6A 3LCHA 1OFPA 1L6GA 4N9BA 3H4XA 1MW2A 1KKOA 2OEMA 1TTJA 4XUGA 4FP1A 4JDYA 5K9CA 4PUNA 4WDXA 4ZL1A 3UF9A 1G69A 3EPOA 1OADA 4R34A 4UZUA 2A0NA 3CH0A 3EAUA 1DQUA 3KHJA 3SUVA 3VOGA 3TMLA 4PSRA 5HWNA 5EMMA 3CO8A 1Y65A 5LNSA 3UETA 4CNNA 1HVQA 3P61A 3TLQA 2OJPA 3EWUA 4PSPA 1XRFA 3VD9A 1W54A 3OBAA 1I2NA 1ISXA 3FY1A 1A5SA 4WOZA 3GUWA 1E1CB 3TN5A 1J4EA 3CWNA 4CQDA 1E6XM 1EX5A 1H41A 4LF2A 4HNTA 1FWWA 5F1VA 4URIA 1HNYA 1Q65A 2CLLA 3AXMA 3W7CA 3I4KA 4OU1A 1AK5A 3KHDA 2C0HA 2XVLA 5LXEA 2A4AA 4WGHA 2IKGA 4Z2KA 2F84A 4Z1AA 4CU7A 1OABA 2PDIA 4QSFA 1WP6A 2WNQA 5FCZA 2PTXA 3ZVHB 4Y2WA 1WDPA 4GXWA 2ISVA 2GVYA 4X9SA 2XGBA 3O16A 4J5NA 2UBPC 1VCVA 5EMKA 1VC4A 5K2ZA 4XO7A 4KGLA 5EMYA 4V1XA 3MP4A 5IHRA 1AW1A 5A94A 3B0PA 3B8WA 3BARA 1YLVA 1KD0A 2DW6A 2L5HA