3QQ0A

Crystal structure of a deletion mutant (n59) of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
275
structure length
243
Chain Sequence
MDIKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKARSSISVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLARQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLQRAQALDLALAGMATRLAGLFLESLHLLEDFLIRIKALDDLIKSQPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase
publication title Targeting the role of a key conserved motif for substrate selection and catalysis by 3-deoxy-D-manno-octulosonate 8-phosphate synthase
pubmed doi rcsb
source organism Neisseria meningitidis
total genus 73
structure length 243
sequence length 275
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2011-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qq0A00
4A3UA 3ELFA 4UXDA 4CLMA 4HT3A 4JTSA 3S1VA 3S5OA 1QO5A 4X3ZA 2YW3A 3EXRA 1OX5A 3NM3A 1JUBA 2BXVA 3NEVA 5DELA 5HWMA 3PR2A 3KHJA 1FCQA 4I7UA 2YXGA 5HINA 1QPQA 3LHZA 3LV6A 4Y6GA 1FQ0A 5F4SA 4S2BA 1GT8A 5HUOA 1JCXA 1GVQA 4O14A 4XBSA 5D32A 2JBMA 1C8VA 1EWDA 2NV1A 4O10A 1DORA 2C18A 4RZ6A 5D04C 1OG0A 3DFOA 1LOLA 1FWSA 1QPRA 3PBYA 1S5WA 1UBSA 2ISVA 2GUUA 3L68A 4PEKA 2HTMA 1UASA 4MLRA 2ZRYA 3B05A 5I3HA 4H3DA 1SO4A 3S5ZA 4J9JA 2QUVA 1K7FA 1YTKA 5CGQA 2X2GA 1FWRA 4K6AA 2CLLA 2E6DA 2TYSA 4NZFA 5LNVA 4DF2A 4MFEA 2WSRA 3LHTA 3P67A 1W3TA 1I2NA 1G7VA 2Z6JA 2RDWA 3IEBA 1W3IA 1GVRA 3O16A 3LM7A 3A9IA 4CCEA 1OYCA 1RV8A 3UD6A 5AHEA 2JKEA 3S6DA 1TREA 5CPLA 2Y7EA 1QWGA 3KXQA 4ORIA 4OGZA 2Y6ZA 4JX4A 3TAOA 4AB4A 5G5IA 2CLHA 2QAPA 3IRDA 3QYQA 1EP1A 1UCWA 1YYAA 4YWIA 1CI1A 3E49A 2GPTA 3W7NA 1JUEA 5DBUA 3TV8A 2FPVA 2HSAA 3M43A 1PV8A 4PCFA 4UTHA 1I2QA 4O8RA 4ZQOA 4FF7A 1ADOA 3WJXA 4EOUA 1PHQA 4FO4A 1OFEA 2X30A 3ANYA 5BRBA 2VEKA 1Y0EA 1H1ZA 5E93A 3IVUA 1SZGA 4NXKA 1JVNA 1IXPA 3IGXA 1EUNA 5A5WA 3W1LA 4H6KA 3TSMA 3BK0A 1IIGA 1I45A 2YR1A 3RF9A 1K8YA 2Y89A 2V81A 3PBVA 1PE1A 3W7QA 5FEXA 3MHUA 2E68A 3UWUA 4NJKA 3NGJA 4N4PA 3BLIA 4IGHA 4EF8A 4IPJA 1P4CA 1K02A 3TR2A 3ABRA 1LOQA 3N73A 2A7RA 4O4WA 1Q6LA 5LSMA 1OFDA 1H7WA 1H7XA 1KM1A 1LLZA 3R89A 1WOBA 4ICNA 1ALDA 1LTDA 1P0NA 1ZJIA 4M6PA 4O15A 4LV9A 3HQ1A 3GDKA 4JIPA 2V82A 5LGXA 2ISSA 1TQJA 3NPWA 4XBKA 4ONVA 1KBIA 1LCOA 3GB6A 4UIOA 5CKSA 1TPB1 4KFPA 2ZTKA 2AAMA 3TROA 5H2ZA 3CQ0A 4GUGA 4MY1A 4ADUA 3NQEA 5HULA 3WJZA 1F7BA 2JKPA 2WSQA 3V75A 4MUZA 3GYEA 2HMCA 5I3IA 1M5WA 3TU9A 3IVTA 4WXZA 1KM4A 3W3OA 3FJLA 5LHEA 1JCMP 3QRHA 2CZFA 3HG4A 2CLIA 3W70A 5LKYA 2G96A 4WY0B 2A85A 3DHFA 3OHIA 3TQKA 3A21A 3B0PA 3CIXA 1C29A 3EX2A 2E6AA 3G1DA 4MOZA 1W56A 3W84A 2J9YA 1EB3A 1IIHA 2DZTA 2WQPA 1UUOA 3LXBA 1N55A 1A5SA 4AAJA 2WJZA 3W2LA 4MYXA 3SY5A 2E6FA 1RD5A 3OEXA 3LHYA 1R2RA 2V8ZA 2NLIA 4JICA 4JTKA 1MSSA 4KFOA 2GQAA 1SW3A 4FNSA 3QC3A 1ICSA 4UFHA 2NX3A 1V7YA 1SFJA 2ZQ0A 1TIMA 1OFBA 3EKZA 2QCLA 5KINA 4GE8A 4ZMGA 1KBJA 5CSSA 3M0ZA 2X16A 1KV8A 3FS2A 4O16A 1KTBA 1JCNA 2V2DA 3L9CA 5D2VA 1MEIA 1W5MA 4DO4A 4MY9A 4O18A 1X7FA 3D0CA 1H63A 5BW6A 1GVOA 4O0KA 4UMAA 1A5AA 1OVDA 3W1XA 3I7SA 3DAQA 2FFCA 3W7GA 2FB3A 3MP3A 4UFMA 4M6QA 3MI3A 2ZTJA 2ZZ2A 2CLMA 2YZRA 3W1AA 1R47A 3KRZA 1G4EA 2D73A 3DXIA 1OF8A 2H6RA 4NJIA 4IX0A 1BEUA 2RDTA 1OYBA 4AEOA 3WJSA 3C6CA 2DZXA 1RQEA 2YW4A 3LCIA 3PUOA 2RFGA 5K3VA 3W2KA 2E5BA 1GG1A 2QCGA 4FX6M 1FXPA 3KRSA 2X1RA 4WZHA 1JRCA 3TC7A 5LGZA 3GIYA 4QQ3A 1G4TA 1T8XA 1PIIA 3OVQA 1QAPA 4NZJA 4MIMA 4UR7A 3USBA 1SO5A 2ATMA 5AHLA 3TSBA 4LC8A 4JN6A 4Z1DA 1DVJA 3QPYA 5AN7A 5KITA 1SO6A 3DBPA 1SZEA 2NUXA 4B5NA 4EF9A 1N7KA 5HQEA 1F6KA 5TIMA 3BG9A 3NL3A 5DN1A 1LBMA 3NQ2A 1KLZA 5AHFA 5D2TA 4P2VA 4LVAA 4DPPA 3BG5A 2RH9A 2ABBA 1J5TA 3CWNA 3NYZA 3L66A 4NNCA 3QQ1A 2Q8ZA 4JXCA 3CC1A 3CPRA 1EUAA 1I8JA 1TTQA 6TIMA 2Q8LA 1C9DA 5K4ZA 4WJEA 8TIMA 1SPQA 1LRQA 1SZNA 3UPBA 5F2IA 1IXQA 2P10A 2Z0IA 5D2WA 1LYXA 1K8XA 3NXFA 1I2OA 3TXZA 4XTDA 2NWRA 1BWKA 3HG3A 1LORA 1TSIA 4MVAA 1HL2A 4K7YA 2B0MA 1Q6RA 5E1QA 4Z0SA 3SJ3A 2Q3OA 4Z1BA 3LERA 1YDNA 2FDSA 4U4MA 3B06A 4CQAA 3W07A 4O12A 3FIGA 3T40A 4JDYA 3PBUA 3NQ6A 5EKYA 4YLWA 1JQVA 2NXHA 3BPWA 2YCEA 4IMGA 4XUGA 1GWJA 1SZFA 3LTPA 3G3DA 2A21A 2RKXA 3NA8A 2GVGA 3NZRA 4OWGA 1XL9A 3ABQA 4EVZA 3HF3A 4IPIA 4Q32A 1HTIA 2YYUA 4DBEA 2C1HA 4WQ6A 3DU0A 3HG2A 3UNDA 1WXJA 4RXGA 2ZZ5A 1B4EA 4PA8A 4TX9A 4UCGA 3W7IA 1FUYA 2WNNA 1HFBA 3Q58A 3WK2A 2QR6A 1W5NA 1OF6A 2J9ZA 3CM4A 3G3MA 4DF0A 5FF3A 1MEHA 2ISWA 3EXSA 1WV2A 3HPSA 1GEQA 4K39A 1G4SA 4CNPA 1TPC1 3FA5A 1SUXA 2G95A 3QQ0A 4UMBA 5BMXA 5J5DA 1EWEA 5C5YA 3SR7A 4D2JA 1JJKA 4AF0A 3RLUA 1Q6OA 2GJNA 1IGSA 2V30A 3IVSA 4FXRA 4K7VA 4MYAA 3T55A 1XUZA 3W1MA 1UB3A 5AB3A 4PL2A 4LC6A 4ML9A 4FNPA 3W7DA 4AH7A 5DY3A 1F73A 3HMJG 3GAYA 1L6WA 2ZZ6A 2EF9A 2BSLA 2Y88A 3A22A 2A7NA 3B03A 2W79A 3DFSA 4CCCA 2CLFA 5G1YA 1NFBA 4IMFA 4UC5A 4BF9A 2GVLA 1MO0A 3O8AA 2GJLA 3W73A 5G2HA 4YCOA 4JTTA 1H7RA 3S5YA 2BWGA 5LNUA 1LBLA 4S2CA 5AOUA 3W2UA 3PBWA 1W5QA 3TXVA 2A7PA 4JD4A 3VE9A 4E38A 4LOCA 5I3FA 1PS9A 5KZMA 3C8FA 4ORMA 4Z1AA 4ZZ9A 3G24A 5F2LA 4Y8FA 3PM6A 1GYLA 2PRLA 2YYTA 1IF2A 4A22A 3B0UX 5F1VA 1SFLA 3CLMA 5AHNA 3U2OA 1K8ZA 1VYPX 3SGUA 1UJPA 2VC6A 4TMCA 1N8FA 1KFCA 1L6YA 1TPH1 4LVDA 1FDYA 3PY2A 1TRDA 2WKJA 3W1QA 3A5VA 2ZRWA 1LP6A 1ZAHA 4N9DA 3DFPA 3LGEA 3C2VA 4CQ9A 1KM2A 3NQMA 3GDTA 1OABA 3HG5A 1XDLA 3EB2A 4ZQPA 3P8IA 1FWTA 3UY7A 3O63A 3ABSA 2A5HA 1EIXA 2I1OA 4AWSA 2ZRVA 1AL8A 4Z08A 4KFNA 1ZFJA 3G1AA 3CTLA 3JS3A 4DELA 1TPFA 1WX0A 5AC7A 3UWQA 3EEGA 3LRKA 3F1QA 4H4IA 3WJYA 3L5MA 4ZQMA 3PULA 2EHHA 2OZ0A 1LLWA 4MZYA 1DQXA 4AMAA 3MP5A 3HGSA 1JCJA 4TO8A 3WK1A 3MBDA 4OQVA 4XKYA 4HIBA 4FNQA 3EX3A 3W7PA 3NPUA 5CZSA 3HOJA 3MUXA 3QSRA 3ZR4A 3B4UA 3UZ5A 2E5DA 3W1UA 3N34A 3NAVA 1A50A 1SQ7A 4ZL1A 3GDRA 4N9EA 3O07A 1AW5A 3EWUA 3MP4A 3TFXA 2NXGA 5AC8A 2Y63A 2Y61A 3CWOX 1NSJA 3A24A 4UTUA 3W7LA 1LRNA 2OMAA 4OBTA 4O53A 5C6MA 3TW6A 2C19A 5SWUA 1NF7A 2BTMA 2P0OA 2ZYFA 1ZAIA 4KWWA 3RLVA 1G69A 4FX7A 3P61A 3G18A 3S1WA 4IXHA 2QCEA 1LOSA 1THFD 3OVPA 1XBXA 1EP2A 4HNUA 3RMJA 1GOXA 4WX2A 4HPJA 1G7UA 5IBXC 5HWJA 4KKXA 5T26A 2WNQA 3VNDA 4O19A 5A8GA 3S1UA 1W31A 4DQWA 1KW1A 2ZDRA 3MMTA 1LZOA 4AXKA 3DGRA 1F5ZA 4A29A 3TNOA 4YMZA 4RXFA 3P5YA 4MFDA 3GZ3A 2NUWA 3IIVA 4NX0A 1AL7A 5U4NA 4LRTA 5G2WA 3P5ZA 3LLDA 4FNRA 3E96A 2QEZA 2NX1A 3P84A 3W1NA 1ZENA 3SIZA 4MLJA 4JY8A 3W7HA 2Y7GA 5DCDA 3L2IA 3L5LA 1OK6A 3G1HA 2FB2A 4UTTA 5U7SA 1GZGA 1YXDA 2QF7A 3NZ1A 1A53A 3EXTA 1NEYA 1TJRA 3NQFA 4WOQA 4DO6A 3NQVA 4RLIA 3G1YA 4PTNA 4X22A 4RK8A 3M9YA 5K9CA 3RU6A 1EP3A 4X2RA 1OYAA 4EIVA 5AHIA 3W1PA 3TC6A 3HGOA 4GFSA 2C0AA 4CNNA 2FIQA 4C1LA 4IUOA 5FF4A 2R14A 5L9FA 1FX6A 3G1XA 2XN0A 3L0NA 4JDBA 5F4XA 1ZY9A 2KZHA 1T99A 5F1UA 2BZNA 4ADTA 3DI0A 4O4VA 1F6PA 3LHVA 3W7KA 3FJ6A 2G97A 3NPVA 4HHPA 4E0CA 5K9DA 3M47A 4HN4A 2TSYA 3CU2A 4O1DA 1RR2A 2ZRXA 4DEFA 1H60A 1DV7A 2H8ZA 3MJYA 5CPOA 2G5WA 3GXTA 4DBDA 3BW3A 3LTYA 3NL6A 3E12A 2B7NA 1H7NA 3E9AA 3C2OA 2O7SA 3NR0A 4MY8A 4LNYA 4IX2A 3W75A 3BLEA 1Z42A 5EPDA 1XDMA 5DBTA 3T7VA 1YADA 4EWND 1JCYA 2QCHA 3Q37A 4P61A 1J4EA 4U28A 1QPNA 2WPBA 3G8RA 1X1OA 1F74A 3EKLA 1ZAJA 1VYSX 2EKCA 3DFQA 5D2YA 3QZEA 2NXIA 3O6DA 1S5VA 3LCXA 4JTLA 4CQ8A 3GLCA 4L4LA 4N02A 5C55A 5DLCA 3NQ8A 3VI2A 2PRMA 3PC0A 4QSHA 2DJXA 4JTGA 2PRHA 4O11A 1K7EA 5EY5A 3W22A 4FXSA 4AF0B 3LCFA 4O1AA 2I14A 4JX5A 3IGSA 3TMQA 4YL2A 4R53A 2LLEA 3W23A 3GNDA 4N6EA 2C15A 3G0UA 3G0XA 4OV4A 5D09A 1EEPA 1WBHA 2CZ5A 3GK0A 5GVJA 1ZNNA 4UNKA 3DENA 1QDSA 2J88A 4GUFA 2ZZ4A 3PB2A 4JS3A 3EX1A 2V5BA 5DCEA 1VHNA 3AO0A 3PF3A 2E5CA 3MW7A 1X6UA 4UNLA 4LUIA 5LNWA 5FI8A 2ZZ3A 5KZEA 1KTCA 3KAOA 3N3MA 3I6RA 3TIMA 5G1TA 2A6NA 2WOQA 2J6XA 5FEWA 1WAUA 4Z1CA 3QMRA 3W7RA 3TX9A 4N2YA 2GOUA 5KZDA 3TK7A 3EWBX 1XFBA 4PL1A 3UZJA 3N2XA 2CLOA 3I7RA 1VC4A 1L2UA 5HMSA 2VEMA 3UWWA 3BVJA 2QKFA 1VS1A 3C0JA 4ADSA 3UXAA 1GTEA 3STFA 4TU1A 4TR9A 4WXYA 1QOPA 2Y70A 3W7JA 3T4CA 1W0MA 1YLVA 3UPWA 2WNZA 3W86A 1LROA 3LHWA 3PSVA 2BX7A 5TBOA 2J9XA 4HNNA 2JGQA 1R30A 3W88A 5D37A 2QDGA 3NM1A 3BO9A 4RZ4A 1L6SA 3TQ0A 3INPA 4WY0F 1G6CA 1SO3A 3GXNA 4ZVJA 3HJZA 2ZFAA 3KX6A 5FEPA 4QM1A 2IQTA 2DZSA 4UTWA 4UTIA 3UYCA 4BI7A 3M6YA 1H5YA 3PSWA 2B7PA 2VEPA 3NG3A 4QNWA 1YXCA 3BG3A 4M5PA 2YGYA 4UMCA 1FCBA 4LS1A 3WK0A 1B57A 1AMKA 3UWVA 4UTTC 1NVMA 3LCGA 1IXOA 4PFMA 1TV8A 3LLFA 4JYDA 4G1KA 1FDJA 4LTSA 5EYWA 1W8SA 4ALDA 5CG7A 3W7CA 3IGUA 2W0UA 1VJIA 1XBZA 3W72A 3HPXA 2TRSA 3Q2DA 4XKYB 2Z1BA 2CZEA 3OBKA 3R13A 1TYGA 4M19A 2B7QA 3TCEA 2QUUA 1T0OA 4ZQCA 1OK4A 4N6FA 1XXXA 2Z6IA 5FF0A 4TIMA 5IM51 1ICQA 4OV9A 3DKJA 1YDVA 3LX9A 4BWLA 1NF0A 4WY0A 1B3OA 5MHBA 4NVTA 3TJXA 5LHFA 1FWWA 3SZ8A 1JQXA 4LVGA 2QDHA 2EPHA 5IBXA 1H61A 3RFAA 1OX4A 3W2MA 3R2GA 4AHPA 3B04A 2X1SA 4K38A 1U83A 3DKLA 1DOSA 3KOFA 2FPTA 1KFKA 3LHUA 4RCXA 2C3ZA 3BARA 4JTJA 4E2BA 4O13A 1LM1A 2C14A 1QMLA 2OT1A 3GX9A 3ZS4A 1FY6A 3F03K 3S9YA 1M6JA 2R8WA 3NVTA 4QJ1A 4GC4A 5D02A 3M7WA 3QH2A 2V9DA 5I3JA 1KM6A 1SSGA 2DP3A 3CB8A 1P5BA 3FEMA 4UFIA 2CZDA 3MI6A 3KFTA 5L6UA 3MO7A 3NQCA 2JGYA 5HR6A 3I65A 3N19B 3W85A 1X1ZA 1JCLA 2CU0A 4AVFA 3LCHA 3PG8A 4FEZA 4JR5A 3PB0A 3M5ZA 3E02A 1DHPA 1ZHAA 4KWVA 1XM3A 1KM0A 1TCDA 3MI2A 4LRSA 4MJMA 2OJPA 1LRTA 1VZWA 2VOMA 3STEA 4UTJA 4OT7A 5AYYA 4JX6A 4Y90A 3A5FA 1OJXA 1RQHA 3C2EA 5ABTA 1K7XA 4UUIA 1QFEA 4IMEA 1TMHA 1H50A 3EWWA 1ME7A 2B7OA 4O50A 1VLWA 3DZ1A 4IXXA 4RX0A 5AYZA 1HG3A 5DXYA 3BLFA 4MZ8A 1FXQA 1FCVA 3LXCA 4BFAA 2QJHA 1SR9A 1W37A 1TB3A 2QCDA 3CHVA 2CLKA 1F05A 3M5VA 3G0SA 2E77A 4TMBA 1VPXA 2EAWA 4Q4KA 1G4PA 4NXSA 3HO8A 2FLIA 3GDMA 3LOTA 1KFJA 4GUIA 4GXMA 3TSDA 3HGJA 1TPDA 2JK2A 4PC8A 4RZ5A 1I4NA 2DJLA 2JKAA 3MYPA 3OA3A 1Z48A 3L67A 1KFEA 1BWLA 3HGRA 4ZQRA 4WOZA 3THAA 3HBLA 2TMDA 2RDUA 3DH7A 3MBFA 4UFKA 4NNAA 4HPXA 3C4UA 2GQ8A 4UTMA 4JGDA 3M41A 4RJEA 5HUPA 3TUUA 4WD0A 3SSJA 2OT0A 3M5YA 1QO2A 4AWUA 4UTKA 2ZA1A 4QISA 4GUJA 2PE4A 1XBVA 1PCWA 3TAKA 4O54A 1W5PA 1E51A 1VCVA 4AWTA 1Q3NA 2OX1A 3CIWA 1WOAA 2YX0A 2B4GA 5HR7A 4LUJA 2YFOA 3HPZA 3P81A 4JTIA 4O0ZA 4UTWC 1SW7A 4K8HA 5G4WA 2F84A 1F76A 2YDAA 3PAJA 5KTLA 3EWZA 1JRBA 4IJBA 3EWYA 3OIXA 3TW7A 1YTDA 3QW4B 3SI9A 1QCWA 4DXVA 3W71A 3T78A 3TA6A 3E0IA 4O1CA 4CCDA 1WDWA 3LDVA 4WUIA 1G67A 1H7OA 3O6CA 5BOOA 3LV5A 3O6YX 2NZLA 1KFLA 5H91A 5EMUA 4YXGA 1VR6A 1YXYA 3UQNA 1H51A 2WV8A 4I7WA 3L65A 3G8EA 4UFJA 2H90A 1AW2A 2H3BA 3HB9A 1LDCA 5C2XA 3PS7A 1JR1A 4BWLC 3BW2A 2CWNA 3P82A 3H54A 3T44A 5E0KA 4NUWA 3LCWA 3HIJA 4M7SA 4A2RA 5LNSA 1X8FA 1H62A 1AG1O 3O05A 4Y96A 3GAKA 3L0GA 1ME9A 3P80A 4MPQA 4O52A 4XQ6A 2J24A 2QCMA 3NL5A 3QW3A 5K2ZA 1TO3A 3SW6A 3ZFHA 7TIMA 1YTEA 1ZCOA 3KVLA 4S1FA 5FF2A 3NQ7A 3MHGA 1B4KA 4NJJA 4NX5A 4QAIA 2QCCA 2XN2A 5KSWA 3KVMA 2BLEA 3W1TA 1DJNA 1TPVA 1LBFA 4FX8A 4K37A 4XTIA 1QPOA 3C2FA 1V5XA 3VKJA 3WFAA 3WK3A 3L21A 5CSRA 3AJXA 3A23A 4AHQA 2WSYA 2ZRUA 1ME8A 3KVJA 3NL2A 2Q3RA 3LI1A 2RHGA 1DQWA 5FEZA 3G1FA 3IV3A 3MYOA 1WYIA 1O94A 4BR1A 3DI1A 3CT7A 3V1PA 4IWWA 2CW6A 4FB7A 3UXDA 5C54A 1BTMA 1O60A 3S8HA 2ZA2A 4HSOA 1KFBA 3FOKA 4UTLA 2O7QA 1H7PA 5I3GA 3H55A 4OU1A 2Y62A 5BNKA 1GVSA 3S5NA 5G2IA 3FKRA 3IIZA 1WA3A 4JTFA 2R94A 2CLEA 5EL1A 2DZWA 5D38A 3TKFA 2NV2A 2VKZG 1R2SA 2ALDA 1I2RA 3FYOA 2QUTA 5AHMA 1OFRA 2WO5A 4GWEA 3IIXA 3NQGA 1ZALA 4QNEA 3O1NA 1H1YA 1Q45A 2VFFA 1ML1A 3JRKA 3QPZA 4NU7A 2VFGA 4QITA 3S42A 1VH7A 3EWXA 1K03A 3LTSA 5BMWA 1KM5A 4LS2A 1I2PA 4N4QA 3B8DA 1KTNA 1ICPA 2ZBTA 4MZ1A 2H8XA 3N9SA 1QR7A 3LRMA 3STGA 3S0CA 3GR8A 3DHDA 5AFDA 1VRDA 4JTUA 3OG3A 3TMLA 1BKSA 1T96A 2C16A 4Z0JA 2NX9A 1XBYA 3C56A 1OX4B 3BV4A 1UUMA 5CPMA 5CPNA 1A5CA 1SSDA 3SGZA 3VFLA 3F4NA 3LRLA 3YPIA 1S5TA 5K4XA 3P8JA 2C13A 3ZWSA 1FCUA 4O1BA 2A6LA 3C52A 3W7MA 2VXNA 1D3HA 2ZZ1A 3QFEA 1GVFA 3LI0A 1VQTA 2Z2UA 4W9TA 2ZRZA 2VFEA 3NOEA 3JR2A 1PVNA 4LW7A 1J2WA 1HO1A 4L4MA 1S3HA 1OFPA 1W5OA 1WQ5A 1AW1A 2ZCGA 3UY8A 1O5XA 4LVBA 2ABAA 4UR8A 1B9BA 2Y7DA 3BW4A 4M6VA 4IMDA 3VE7A 1VGAA 3G1SA 1GYNA 2DZUA 4FIQA 1D3GA 3EX4A 2GQ9A 3FKKA 1O95A 3ATZA 3W9ZA 5HJLA 4NJGA 1FDZA 2A4AA 3ABOA 3TQVA 3LBCA 1YPFA 4JEQA 3M44A 1PCKA 5F2GA 1DL3A 4JTEA 1KM3A 2VFDA 1XKYA 3PVFA 5DXXA 2QCFA 1Z44A 3R5EA 4JYEA 1CW2A 4O17A 4LS0A 2ZA3A 3N2MA 1VYRA 3QJAA 3NNTA 3LBMA 4RR4A 3W1RA 1FWNA 3RK8A 5EA9A 5D33A 2QJGA 4MKNA 4CNOA 3B0VC 1TPWA 2VFHA 2YSWA 1YDOA 3K30A 5DCBA 1JULA 1RQBA 1KV5A 4N9CA 2X1TA 1W1ZA 4A2SA 4PODA 4GNJA 4M7TA 3W2JA 3FFSA 3TDFA 3SECA 5LZLA 3S1XA 3STCA 1M7PA 5D05A 1PHWA 4ZQNA 3M1ZA 2YPIA 3L0KA 1SU5A 3CEUA 3I68A 3GKAA 4HKPA 2PCQA 2QCDB 3BGGA 3P60A 3QSTA 5K9XA 1TTPA 1O5KA 4FIRA 5HWNA 3M16A 2XFWA 1CX9A 1Q6QA 2A1YA 3QF0A 4DPQA 3N9RA 4R33A 4JNMA 3LCLA 3F4WA 3QMSA 4HNTA 3P7YA 5F4WA 1W54A 4K8EA 5D2XA 4C1KA 2PC4A 4XZ9A 4PH6A 1D9EA 1YPIA 3KVKA 1KLYA 4E2DA 2UV8G 2QJIA 3LXAA 4HNVA 2VFIA 4OE7A 3BGJA 3I7QA 1GG0A 1KA9F 3GKFA 3W76A 4N9BA 4JYFA 3TFCA 4NJHA 4POCA 1XCFA 3ZWTA 4LV4A 2V0TA 3UWZA 1IXNA 4O28A 5TQLA 1OX6A 2FPYA 1MEWA 3N14A 2EGZA 3PUDA 3W6YA 3NDOA 3THQA 2TPSA 4Q33A 2W6RA 4BI6A 4UFLA 1Z41A 1VCGA 2V2HA 2E1DA 1K3UA 2XN1A 5FF7A 3VCRA 4FHAA 1OFOA 5DY2A 1GPWA 4I7VA 3G1VA 2VENA 2V5LA 3C3NA 4IQLA 1ONRA 2AQWA 3IIOA 3CEPA 1JUKA 1PL9A 2VEIA 3FYPA 5D03A 3PUEA 2DZVA 3PWAA 4NQ1A 2A2IA 3GDLA 1OFAA 3KRUA 3QM3A 4BI5A 1TPUA 1RZMA 3FLUA 5F2MA 2DZPA 1QNVA 3W83A 1L9WA 3M5XA 4MJZA 4BK9A 2FTPA 4LU0A 4R7JA 1U5JA 1F2JA 3PG9A 3R8RA 4DF1A 2QCNA 4GRSA 1TV5A 4JIQA 2DORA 4FNTA 3RNDA 2P1FA 1TPEA 1DKWA 2VELA 3NQAA 4YCPA 5CZJA 3WJWA 1GQNA 3GR7A 3H53A 5HNRA 1TJPA 5J5RA 3MHFA 2PURA 1TV7A 1DJQA 4NT0A 1FBAA 1OFQA 3EX6A 4JY9A 4XWUA 1TTJA 2CFFA 3GXPA 1M7OA 1SW0A 3LB0A 2A0NA 2FJKA 3C2RA 5D30A 2FQIA 4GUHA 5AYXA 3W7OA 4K36A 1P1XA 3NPXA 1O4UA 4HSNA 1XI3A 2GVJA 1W3NA 5CZ0A 5KMYA 4LY8A 4R34A 3QEZA 4RKAA 3W74A 2OCZA 3U6WA 1GTHA 2R91A 2NWSA 3UWYA 3P62A 4X9SA 4I9AA 1HO4A 1RPXA 3ATYA 1VHCA 3TE9A 3R12A 1TTIA 4O57A 5I3KA 4IOTA 3W7EA 4JTHA 4A21A 2X1UA 3GVGA 1NAL1 2HS8A 2Y7FA 3O15A 2AGKA 1VCFA 4LT9A 3OVRA 1TRIA 4Y9AA 2I9EA 4AHOA 1WBJA 4QIUA 1GJPA 5G4EA 3DFNA 2NUYA 4DO5A 1HUVA 1P0KA 1EPXA 3MWAA 4LWWA 1XC4A 4GJ1A 2H3DA 1DBTA 3GNNA 3P74A 2YFNA 1TQXA 4LVFA 1R46A 3NQDA 3QMTA 1XUUA 3NO5A 1VLIA 4FNUA 2J27A 2F7FA 3SFKA 2HS6A 5LNRA 5CZTA 4NNBA 2Y85A 3G22A 1RVGA 5EBUA 1R2TA 2ATSA 3O06A 2E09A 2ZZ7A 2C6QA 1MXSA 3TJLA 1AK5A 3TH6A 5AC6A 5K7JA 1EA0A 4GBUA 3U8GA 1A5BA 3DFTA 3IIPA 4OHQA 3W87A 3C61A 1QOQA 2QAFA 6ALDA 5FESA 2E6YA 2DU2A 3L5AA 4IMCA 1EX5A 2V2CA 1MZHA 3Q94A 4RV8A 1OHLA 3W2NA
chains in the Genus database with same CATH superfamily
3ELFA 4UXDA 4ZO8A 1BXCA 2DY3A 1JYWA 2ZX8A 1QO5A 3F5JA 4X3ZA 3U2ZA 4A3YA 3MO4A 2Q09A 3OZOA 4J1OA 2Z24A 4YTSA 2HVMA 3AU6A 1K70A 2INFA 4I7UA 3T6CA 3AALA 5HINA 1EDTA 3LHZA 1OGBA 5CCZA 1FQ0A 4DWSA 1VFSA 4W89A 3CPUA 4AIUA 1EC8A 4V1YA 1TVNA 1EWDA 4O10A 1BVNP 3DG7A 1ZBVA 1S5WA 4I8YA 2GUUA 1AH3A 2VZUA 3O2LA 1UASA 4LEFA 4NAEA 3CUJA 3MUAA 4J9JA 1GK8A 4F0SA 2QUVA 1MW3A 1WCGA 4UBPC 1FWRA 2E6DA 1REQB 3UXLA 4DF2A 4MFEA 2EO7A 4UCFA 2GFTA 2Z6JA 5M5DA 2RDWA 3TA9A 1PKLA 1EYEA 4CD6A 5E9AA 3LM7A 3A9IA 5DMNA 3BLKA 1RV8A 3MSRA 1RPKA 4QG8A 1HGWA 2A79A 3KXQA 4D6CA 3ZXWA 4HTYA 3FDGA 1M9HA 5I00A 4LH8A 2Q6ZA 3PJTA 1CI1A 1B90A 3TV8A 2FPVA 3WDHA 1PV8A 1N8IA 4FF7A 4UQCA 1ADOA 4FLSA 1CGVA 4FO4A 2X30A 3ANYA 1JFHA 5A2BA 1EH9A 1JG9A 1Y0EA 1SZGA 1OCNA 9RUBA 4QGCA 1IIGA 3HZ3A 1I45A 3EMQA 2YIHA 2Y89A 3GNPA 3SSZA 4QEEA 2WJEA 4XK2A 1PE1A 3XISA 3UWUA 2HJPA 5LA2A 3NGJA 4EF8A 1E3XA 2NSXA 3ABRA 5I02A 2Z27A 1OFDA 1KM1A 3AHZA 3R89A 3CZLA 4M6PA 4J2MA 3GDKA 3HV8A 3BQ5A 5LGXA 4ERAA 4NP7A 5H2ZA 5IHRA 3R4IA 3A64A 5DANA 3V75A 1SJAA 4EXAA 2ACQA 3WZ0E 2HMCA 2OEJA 3MMUA 5ECVA 3FJLA 1JCMP 2V3FA 1NDZA 2CZFA 4D8AA 3PN8A 3SDOA 2CLIA 3WBYA 2PLMA 2EPMX 2W9MA 5CSYA 4NI8A 2QIIA 3N6JA 4C6NA 2DZTA 2WQPA 1UUOA 3LXBA 4F79A 3AJ7A 3H4GA 2V8ZA 1ZBCA 2J7GA 2NLIA 5EMJA 4JICA 1QJWA 2DSUA 4IP5A 4WKHA 1DQUA 3V5OA 3VAVA 3WY1A 3QC3A 4GC3A 2EPLX 4B5WA 2NX3A 1OFBA 4JKLA 3W01A 5KINA 4CU6A 2X16A 1VB9A 1KV8A 1KTBA 1UKPA 4P8WA 2XDFA 1C8XA 2NQ9A 3JVAA 1I0DA 4URIA 3CQJA 1H63A 1GCYA 3W1XA 3DAQA 4CNUA 2FB3A 2MUCA 3MP3A 3WQCA 4MNLA 4M6QA 1E6XM 1UKSA 4PTDA 4HOXA 1R47A 1XLFA 3DXIA 1W3LA 2J74A 2WLYA 2WC4A 2ODOA 1N82A 3C6CA 4NYYA 1ISWA 3NSNA 2YW4A 3LCIA 3PUOA 2RFGA 4EACA 3LNPA 2QCGA 1JAKA 1FXPA 1QI2A 4Q4RA 3SAZA 1TFVA 4LFYA 1JRCA 4WDWA 3NTYA 3TC7A 5AKQA 4INFA 3M0HA 3QVQA 3BTNA 1I9CB 2HPIA 3NCOA 2RGMA 1W1YA 4FXFA 1UR9A 1V03A 2JIWA 5KITA 1SO6A 4CNTA 1SZEA 1Q63A 2NUXA 2VGGA 3GVVA 4B5NA 1TZ7A 5DN1A 3WQ6A 1LBMA 1KLZA 2BGNE 1F3WA 9XIAA 2OSWA 2VRKA 3NIYA 3BG5A 1DJHA 1OC7A 2ABBA 1K6WA 3WF0A 3U5YA 3LSCA 3BANA 2EPOA 4JXCA 3ZSSA 1EUAA 1I8JA 3M0JA 4DRSA 4FOKA 4DJEA 3F2BA 1TTQA 3M0KA 1R6WA 4PBGA 2Q8LA 3ZT7A 1UC5A 2MNRA 2VX7A 3UPBA 1YKWA 2VMFA 4DWSB 4HA0A 1UD5A 2Z0IA 5D2WA 1WPCA 4GZEA 3NXFA 1QK2A 5LIYX 3W6LA 3MMDA 4OKDA 4RPQA 3MCOA 1HL2A 4R9OA 3SJ3A 2Q3OA 5FJOA 3LERA 3PBGA 3N13A 4O12A 3V18A 1T6MA 5I0DA 3BPWA 1BYCA 4XUGA 5HDRA 1HJUA 3G3DA 1S2AA 2RKXA 1VFUA 2VZSA 3NA8A 5FACA 2BFGA 4OWGA 1XL9A 4EVZA 1HTIA 4DBEA 3UNDA 3N6QA 1VEPA 4DAIA 4MB1A 4JTRA 2HISA 4I5XA 2YDQA 3FVDA 5I79A 4RE3A 4C1NA 4MSSA 3W7IA 2OSYA 4NF7A 1TWSA 4GI9A 1EEXA 3S9IA 4D6GA 2IXUA 4DF0A 5FF3A 3R10A 1S2UA 3VGFA 4H9YA 3VIKA 3HPSA 4K39A 1G4SA 1TPC1 3FA5A 2VJXA 3R8GA 4UMBA 3ITTA 1EWEA 3SGGA 3SR7A 1YNQA 2HK1A 1HKKA 3AQUA 4UR9A 4AX6A 2PDJA 4K7VA 2VP8A 4HMEA 3T55A 3WKZA 4MKVA 2PSNA 5AZ1A 2ONEA 3RYSA 2XGZA 4PMUA 3BMWA 3H21A 3GAYA 1BFNA 4FS9A 4HOZA 2A7NA 1KKRA 4U3AA 3UA3A 2W79A 4EANA 4KCUA 4CCCA 3SEPA 2QLYA 3GTHA 4LALA 3DHUA 4IIBA 1GZJA 3BQ6A 5G2HA 2PDWA 4JTTA 1H7RA 2J7BA 3FHQA 5LNUA 2ADAA 1RCXB 3MKCA 5AOUA 3EDFA 3TXVA 3VE9A 1BSLA 5C2CA 4LOCA 2XH2A 3G24A 1KRAC 4Y8FA 2OWXA 4QP0A 1EO5A 2Z1XA 4FI4A 1E1CA 1AA1B 2PWVA 5AHNA 3V36A 3SGUA 1U22A 2VC6A 1MDLA 2WHJA 1N8FA 1C7TA 4LSBA 4W8BA 3PY2A 2BXZA 2WKJA 3TTQA 3BAYA 1UD4A 4QE5A 3GC4A 4N9DA 5DT5A 4CQ9A 3GDTA 4AZBA 1C8QA 3VMOA 3HG5A 1BF6A 3BCJA 5I78A 1FWTA 3UY7A 2A5HA 3IJDA 3E0FA 1AFSA 2ZRVA 4Z08A 3JZUA 2DIJA 4GYKA 4DELA 4TXEA 3TN6A 3BWWA 4YVVA 2WPGA 3MV01 3UWQA 3EEGA 3L5MA 5HOSA 3OLGA 4MZYA 1DQXA 3MP5A 1OGSA 1JCJA 4TO8A 2XYLA 4MF4A 3N2OA 4M82A 3EX3A 4UZSA 1XINA 3GS6A 3KBSA 1A4MA 4WJXA 4LXFA 2C71A 2D69A 1J93A 3W1UA 1A0CA 1A50A 4CQDA 4EAMA 4CD7A 3AWNA 3VOCA 4PB3A 2NXGA 1PX8A 3PZVA 1MWOA 1LRNA 1DIDA 1DJWA 4PZVA 2CEQA 3TW6A 1S2TA 5I24A 2F6KA 1ZAIA 4KWWA 1TMLA 4L4PA 3NFUA 3KBNA 4FX7A 4D8ZA 5FJIA 1QNRA 4RDYA 2QCEA 3R8HA 1E70M 2BHUA 2PUZA 4LNCA 3RMJA 3PZQA 1G7UA 1EJTC 4A3HA 4LAZA 4O1FA 4YU1A 1NDWA 3IAPA 5CC7A 4WKAA 1EA9C 1E0TA 4FXJA 4JNYA 4YMZA 4RUBA 3P5YA 4NX0A 1S2WA 3RJYA 1RK6A 1R85A 4K8GA 3VCCA 5DRIA 1BGAA 3AZTA 4ZR8A 1GW1A 3E96A 2QEZA 3S6TA 2FH8A 4V33A 2PWFA 4MLJA 4JY8A 1TMQA 1TKKA 4D71A 1OK6A 3G1HA 5DF0A 5U7SA 3P2VA 3WN6A 1GZGA 1YXDA 2QF7A 4GISA 5HJXA 1J01A 3SN1A 3W37A 4RLIA 4X22A 3AIVA 3CUXA 2PODA 1UMYA 1QI0A 3MU7A 2C0AA 2XJ7A 4CNNA 2FIQA 1C9WA 2X05A 2GGHA 2R14A 4ICCX 1FX6A 4M1BA 4Z1YA 4KQNA 5F1UA 1DE6A 4H01A 4KEUA 3DI0A 1UPMB 4WIWA 1U1HA 3OBEA 1V51A 3TC3A 4HYVA 1RR2A 2OX4A 5PTDA 4AQLA 3NZPA 1WB0A 3GXTA 3NL6A 1J11A 3EDKA 3LQGA 2B7NA 3E9AA 3AHYA 4MY8A 4NZ4A 3VX0A 4LNYA 4Y9NA 4S3GA 2FFIA 3LGGA 2WCAA 1R5YA 1YRRA 2E25A 3EMCA 4Q3MA 3LUTA 3HQNA 2X8RA 5GJPA 1JCYA 3Q37A 4C1NB 4AY7A 2NQLA 1F74A 2JALA 3DG6A 3LNMA 1ZAJA 2XWEA 2NXIA 3GTFA 3K1GA 1S5VA 1VBUA 1G1YA 2JE8A 4TUFA 1JPIA 3GLCA 1ZP3A 4L4LA 2IMRA 3PC0A 2WSPA 5JVLA 4GABA 3WF3A 1AQMA 4ZODA 3GFYA 4FXSA 2G3FA 4GGBA 1RBOB 4J3WA 2VD9A 1UH2A 4R53A 1MDRA 3E5PA 4N6EA 4D6FA 1XIIA 3G0XA 2ESCA 1XYAA 5D09A 1K9EA 4K2SA 4ZOCA 1ZNNA 3ZT5A 1XSIA 2ZZ4A 3PB2A 2W62A 2V5BA 2BOGX 2J7CA 2E5CA 3ZZ1A 1X6UA 1ECQA 3VDHA 3SO7A 3PFRA 1FHVA 1KTCA 4QG6A 4IGNA 2WOQA 1C92A 2PDIA 2F38A 2P8CA 3BXWA 4ECLA 3BAKA 5D9NA 3UZXA 2GJPA 2PZNA 4Y9PA 4MNMA 3WX7A 1Q6CA 5ABGA 3EWBX 4YS1A 4PL1A 3UZJA 1JD7A 2P88A 1ONWA 1X39A 3WYZA 2VL4A 5HMSA 5EMLA 3BVJA 4QLKA 1E1CB 1VS1A 3STFA 4WSKA 1QOPA 4LUTA 4DJFD 2WZEA 3PSVA 4RE2A 2BX7A 3NO1A 3BAIA 2J13A 2J9XA 3B8TA 4HNNA 2JGQA 3WUFA 3MDUA 2ICSA 4RZ4A 1XLBA 3UG5A 1EYWA 3INPA 4WY0F 1VRXA 4PBEA 3SCUA 2DZSA 4UTWA 3VIJA 3WQDA 4AW7A 1XSJA 2Z25A 4B5SA 2B7PA 3KZPA 3MVIA 4M5PA 5FD0A 4ASTA 1KCLA 4UMCA 1RJRA 4LS1A 4C7FA 2V38A 3L4ZA 3UWVA 2XIIA 3SUWA 4UTTC 1NVMA 3LCGA 3SCQA 4JIIX 2NQHA 2CC0A 3GBDA 3ITXA 6CGTA 2C8NA 3CZJA 1LF1A 2OGJA 3W72A 3CTTA 3OBKA 2EEXA 2DQWA 3PZNA 3R13A 3WF1A 1TUFA 4F3HA 1DWAM 1DTUA 4G56A 1W9UA 1XXXA 2Z6IA 5IM51 4HZ8A 1JZ4A 1JDCA 1NF0A 4PGLA 3TJXA 1VBRA 4PMVA 5REQA 4F9JA 4LVGA 2QDHA 2OYLA 1IZCA 1H61A 3BMXA 3CH0A 3RFAA 4IP4A 3L4TA 4JOMA 3B04A 2O9RA 4Z2KA 4F66A 1A3XA 4GVIA 3IAQA 3LHUA 1B3YA 3ZMRA 1X1NA 1EJUC 3TCSA 1BGGA 3DG3A 4F0KA 3ZS4A 3F03K 3NVTA 4QLLA 1PYMA 1EJVC 4D6IA 5I3JA 2DP3A 3VOJA 1X38A 3QLDA 3WBXA 3CT2A 2XVGA 5IRPA 5LIUX 3I65A 3BE7A 1WO2A 1JCLA 1NFGA 6PTDA 1FOBA 3OGSA 4JR5A 3PB0A 1UC4A 4IUGA 1RP9A 3E02A 3OYXA 4C6IA 1K1DA 1ZHAA 3WEZA 4N7QA 2CPUA 2OYMA 3MI2A 4LRSA 4MJMA 1RLDA 3STEA 4UTJA 1IHIA 1K4GA 1B3VA 4Y90A 2WHKA 3URBA 5ABTA 3CAQA 4UUIA 3VD3A 4DWSD 1TWIA 1H50A 1ME7A 4OOUA 3VDAA 4RZBA 1VLWA 2E40A 4F0MA 2XIBA 3B8UA 2VCAA 3U4FA 2XIMA 3VMNA 2FHCA 3S2MA 1ODZA 2GDUA 4L5ZA 3PWGA 2E77A 2TODA 1QI4A 3GWQA 1W1PA 2PLCA 1V6VA 2WCSA 4NXSA 2FLIA 1KFJA 2SFPA 3CHDA 4GXMA 4BCEA 4Q4SA 4RZ5A 1I4NA 2JKAA 3OA3A 3QYSA 4NIRA 1JYXA 1BWLA 3HGRA 4PMDA 3THAA 3HBLA 2TMDA 4H2HA 3DIPA 3A3WA 4HU0A 2E7FA 1CLXA 3BLLA 4AWUA 4HTBA 2D3NA 4QISA 3TTSA 2PE4A 1BG4A 1PCWA 4EKJA 4O54A 1VCVA 4IL0A 4J3VA 4IT1A 2EPKX 2YFOA 3HPZA 4A8RA 1KKOA 4Z42C 1IZKA 2G3JA 4AEFA 1V6UA 1XLJA 4D6EA 1BF2A 3MUY1 3BOFA 6TAAA 5KTLA 1U30A 1G0CA 2PBOA 1XDJA 3D46A 1LG2A 3K4AA 3WNMA 2FKPA 1K77A 3GHSA 5H1WA 4HHHA 2XH7A 3LZ5A 4M6UA 1EC9A 3LDVA 1ZRQA 1O1ZA 1PIGA 1H7OA 4ICMA 3WNKA 4PSPA 4AZ5A 1VR6A 3WLPA 1O68A 1YXYA 3SCOA 2XG9A 2Z28A 3RX2A 3G8EA 1DXFA 2H3BA 1LDCA 5C2XA 5D9OA 1O66A 5C9WA 1CYGA 2NV9A 2CWNA 2X09A 4M81A 1I6NA 1ZB5A 2PDNA 3DHPA 1YHTA 1OBAA 4A2RA 4A8LA 2FGBA 2PTYA 4W8AA 1H62A 4TTUA 1GVEA 4IJCA 4U3CA 1ME9A 4MPQA 5I03A 4OFCA 4XQ6A 4Z17A 3ZFHA 1QASA 1ZCOA 3KBJA 1CBGA 1GGOA 2IPFA 4H83A 4QAIA 3Q4DA 5H6HA 1R3RA 3TWBA 3D5HA 2OWWA 2PDBA 4K37A 1V5XA 1NOUA 3DUGA 3EA3A 4MTVA 3VKJA 4C6FA 1XIBA 3AJXA 3B3DA 4LUTB 1XHGA 5FCZA 2ZRUA 3RCNA 2YCIX 1ME8A 3OB8A 3DI1A 1UA3A 3AUOA 1WZAA 2NQJA 1BHGA 1RD6A 2D23A 2OODA 5CBBA 4F40A 1A5LC 1H7PA 4LBSA 5I3GA 4TOQA 3H55A 4OU1A 4BJHA 2Y62A 5BNKA 1GVSA 7REQA 1VJZA 2DSWA 3RO8A 4TX8A 3IIZA 2RJHA 2OPJA 2CLEA 2ZE3A 5EL1A 4JKMA 2VKZG 1R2SA 1KFWA 2OSXA 2PP0A 5BOFA 3MJMA 1A5NC 4LYRA 5AHMA 3WDRA 3IJ7A 4U33A 1OFRA 1YEYA 3UETA 4DX3A 1XWYA 4JIEA 3IIXA 3OGVA 3R25A 1J9YA 2V3GA 1W9DM 4XO7A 4HU3A 5TNVA 3ARTA 4WLCA 3S42A 3I10A 2QULA 5JMUA 4L7ZA 4DM1A 5C2GA 3WF2A 1QR7A 3STGA 1PTAA 3GR8A 5REQB 2ZX7A 4KCWA 3RLGA 4W5UA 5CJNA 4R7OA 1UJQA 3C56A 1IEQA 1VBHA 5FIPA 5CPNA 4DB7A 3V5FA 5A2AA 3VFLA 3F4NA 3K8LA 1UQYA 5K4XA 4C6KA 4C90A 2DSVA 4O1BA 2VXNA 3WCZA 1GQIA 1HF6A 1D3HA 1CXIA 1O1HA 2ZZ1A 1GVFA 4W9TA 5KETA 3JR2A 2RAGA 4A4AA 4HB7A 3HQOA 1AW1A 3OLIA 3QKEA 3ZVIA 3OLDA 3W02A 4M6VA 3BW4A 2WSKA 3VE7A 1WZKA 3IUIA 1TJ2A 1JNDA 2Z00A 3O0FA 3NWRA 4PMOA 1O95A 3GUGA 3W9ZA 4B3LA 1FDZA 2A4AA 3KCLA 1YPFA 3KDOA 2OVLA 2PD9A 1DL3A 3PPCA 1KM3A 2VFDA 1XKYA 2WM1A 5DXXA 1Z44A 1Q5MA 3R5EA 5RUBA 1CW2A 3EWCA 3N2MA 3ZQ9A 3QJAA 4HVXA 3LBMA 5EFDA 3W1RA 3KL0A 4UTFA 1FWNA 5FA5A 2A3EA 3R11A 4MKNA 3MCNA 1TPWA 3LYEA 1YDOA 1OM0A 2BVWA 2X1TA 4LAMA 1J0JA 1E4MM 2GVEA 2YA1A 1MNSA 1M7PA 1PHWA 2QMJA 4KGLA 3AC0A 3B9DA 3CEUA 1AVAA 4LBUA 3VGGA 2R24A 1UWUA 4ENLA 1TTPA 1TG7A 1QHOA 4FIRA 1CX9A 1Q6QA 1R3TA 1S2VA 2J7DA 3QF0A 4R33A 4JNMA 3E0LA 3F5KA 3TWAA 5A6MA 1W54A 4FP1A 1O7AA 2QMKA 1D9EA 3IJLA 2DIEA 4E2DA 1FP8A 5IFTA 2UV8G 2QJIA 5JIWA 8XIAA 4XD5A 2DUAA 4GCAA 3ZR6A 4IF2A 1PZ0A 4GQQA 4Q7BA 4GIAA 2GDQA 4N9BA 4JYFA 3TFCA 4POCA 4NJHA 3MWCA 3ZWTA 2QZRA 2OO0A 3KLKA 4QS5A 3GG7A 1JPKA 4AIBA 2XU2A 2VCBA 5G4HC 2CNCA 4MUPA 4Q4OA 3G1RA 1HJSA 2TPSA 4Q33A 1XIEA 1Z41A 2Q71A 4GOAA 1CIUA 4FHAA 1OFOA 1DJYA 2ZXDA 2ZE0A 2V3EA 4IH3A 5HAOA 3G1VA 2VENA 3IIOA 1UBPC 2VTFA 3CEPA 3BSMA 2FHFA 3DYMA 3IANA 3KHDA 2DZVA 4NQ1A 2A2IA 3KRUA 3KTCA 1KR0A 4Z2LA 3QV9A 1RZMA 3FLUA 5F2MA 5EGRA 1QNVA 1L9WA 4F0LA 4R7JA 1F2JA 3PG9A 3R8RA 4DF1A 5EMMA 4JIQA 4G7EA 4CVUA 4M51A 3RILA 1TPEA 5HBFA 3WJWA 3GR7A 4FMVA 4GNVA 4XSLA 1A0DA 2VWSA 5D4YA 3WIJA 4NT0A 3K8KA 4EP8C 4GY1A 2CFFA 2CCRA 3PTDA 3LA4A 1SW0A 3LB0A 3BZGA 4CN1A 4GUHA 5AYXA 3DCPA 4K36A 4DUXA 2HK0A 3NPXA 1EOMA 4Z2JA 3S9ZA 2YCLA 5IHSA 4M29A 2XISA 4ZOBA 3VNMA 4PRWA 2R91A 3ABZA 4QCFA 1BQGA 3P62A 4I9AA 3AS1A 1H0IA 3U2CA 1A5KC 1VEOA 2VM8A 1NAL1 2Y7FA 1ISYA 3O15A 2AGKA 3GXDA 3VGEA 1TRIA 4I9TA 2YBTA 4QIUA 4QCEA 2QHAA 3M0IA 3UR7A 3LZ3A 1P0KA 5HQLA 1DBTA 7REQB 3NQDA 1XUUA 1LQAA 1POJA 3NO5A 2HXTA 4FNUA 4GH1A 3SFKA 2HS6A 3NJ3A 3NDZA 4KIEA 2WAGA 5KZ6A 3NEHA 3FSTA 1IE7C 1RVGA 2I16A 1R2TA 3DFYA 4EAYA 4GACA 2XH0A 1X98A 2C6QA 3TJLA 1AK5A 3TH6A 3C0QA 2CIPA 1E73M 5AC6A 5K7JA 2QXWA 1EA0A 1A5BA 3DFTA 3W87A 1H5VA 1XRFA 5JXQA 4IMCA 1J0YA 2V5JA 1UWQA 2V2CA 3Q94A 1OHLA 4AISA 2BASA 1C8YA 1RCOB 2EKGA 4BEUA 4HCLA 3ARPA 3TR9A 4PMZA 1NQ6A 4XZWA 2YW3A 1OX5A 4LAUA 3TTEA 3NEVA 5DELA 3A4XA 3PR2A 5HWMA 1FCQA 2YXGA 4YIWA 5CGMA 4OZOA 1GOIA 1QPQA 3LV6A 1W1B1 4ZFCA 2I56A 4S2BA 4QX4A 5HUOA 3IPWA 4O14A 3TTYA 3CUZA 4Q4QA 3HM7A 4LANA 4HMCA 2NV1A 4HU8A 1DORA 1OIMA 3FK4A 2C18A 1PO9A 5D04C 2Y8UA 4PUDA 3ZJ8A 1LOLA 1FWSA 2IKIA 2VC7A 3PBYA 4XZBA 1KBBA 3IJ8A 2ISVA 3MUZ1 3RM4A 2WMJA 3B05A 4C6CA 5KEZA 2Y8VA 4ATWA 1SO4A 3GG8A 5D9PA 4NKCA 1W3KA 4BQ4A 4ES4A 5B80A 2X2GA 2QW5A 3T8QA 2TYSA 1G7VA 1YE6A 1NM9A 2XIOA 3H7UA 3O16A 1X8CA 4OJYA 1ZPTA 3VNKA 3CASA 2DT3A 3S6DA 1JDAA 1QWGA 4LUYA 3ALFA 4ORIA 2Y6ZA 2YA2A 3TAOA 5G5IA 4PUJA 3MANA 3QYQA 2W67A 4S23A 1UCWA 1YYAA 3CB3A 1TJ0A 2C1IA 2GPTA 4LX4A 3WNPA 2HSAA 4PCFA 4UTHA 1ISXA 2VVNA 2V5CA 4O8RA 3AYSA 4PYSA 2DEPA 1KCXA 5A94A 4QSFA 1I75A 3DECA 1XFCA 5E93A 1E0VA 3IVUA 3BH4A 1EUNA 3W1LA 2ZUWA 3TSMA 1OCJA 2XSBA 3TW9A 4I3GA 4WKFA 3RF9A 1K8YA 3PBVA 3MHUA 3EDEA 2E68A 4KESA 3WD0A 2A3AA 4XAFA 2CXGA 1P4CA 3BAXA 1SM9A 3P6LA 4J28A 1ZJBA 5EBAA 1Q6LA 5LSMA 1LLZA 1WOBA 3OA5A 5F7UA 1LTDA 4O15A 1IT7A 3HQ1A 1X7IA 4JIPA 4GX9A 2FHBA 2RDXA 4REQA 2ISSA 3TNBA 1Q2RA 4TV6A 2R82A 4ONVA 3D47A 4JBRA 3URNA 1ZP4A 5AC5A 3EPOA 3GB6A 5CKSA 2ZTKA 2VNCA 3HURA 3CQ0A 2DUZA 4MY1A 4ADUA 5LYRA 2F8QA 3R79A 1F7BA 2WSQA 2OZ3A 2IUZA 3GYEA 5I3IA 3M6DA 2ZUTA 3TU9A 5LA0A 1KM4A 1U2YA 1B0IA 2R1MA 4RDZA 3VDGA 3FHAA 2NT1A 4G2DA 4LEQA 1DIKA 2G96A 4KERA 3CIXA 3DERA 5C9XA 1C29A 2XM2A 3RR1A 1MI3A 3STPA 2MANA 1W56A 4B3KA 3PPFA 1MNZA 4GQBA 3SY5A 4G7EB 3UXIA 1LWHA 2CBJA 2XFYA 1J2BA 3LHYA 5C9ZA 3FJNA 3CAVA 1CNVA 2J8TA 1D8CA 4JFTA 1SW3A 3VD9A 1NQKA 1TR1A 4UFHA 3VOGA 3K4DA 3EKZA 4ZMGA 4PCPA 1KBJA 5CSSA 2PPGA 3WMBA 1E71M 3ID7A 3GM8A 2I5GA 3ICJA 2YCLB 3BLOA 3K5XA 2VUNA 3OPSA 3THUA 4GIEA 3AIQA 4W4QA 2EXOA 4UMAA 3IS4A 1PZ1A 3I7SA 2J62A 2FFCA 3W7GA 2FVMA 2ZZ2A 3MI3A 3W1AA 5IDZA 3KRZA 3ZVHA 1V02E 4YTUA 2H6RA 4NJIA 4MDPA 1B2YA 1EX1A 1OYBA 1KBKA 3FN9A 4ZE4A 5LXXA 1QBAA 1GG1A 3E0VA 3ES7A 4Q8UA 3AWOA 2W92A 5LA1A 3RX4A 3XIMA 1G4TA 4QE4A 3QBUA 1W9XA 3UFYA 3TEVA 1J0HA 4NZJA 4MIMA 4UR7A 3USBA 2ATMA 1Z69A 4LC8A 3TJIA 5I7GA 2Y0FA 4JN6A 1DPMA 4AD0A 2Q02A 1DVJA 3QPYA 3WD3A 5AN7A 5BZAA 1MRAA 2HVOA 2FZMA 1TCMA 2VVSA 4BF5A 2Z7KA 4JEJA 3BG9A 2IS7A 1V6WA 4DAFA 1WDDA 3NQ2A 1ITXA 3D3FA 3MMWA 4B2DD 5D2TA 4P2VA 2PDFA 3C3UA 4LVAA 1R7OA 1J5TA 3CWNA 3L66A 1YE4A 2UY3A 2Z29A 2NSOA 4HQVA 3VFCA 3B9AA 4H9ZA 4DM2A 5K4ZA 4WJEA 3MDWA 4XUYA 1LRQA 1SZNA 5F2IA 4GKLA 1K8XA 3TXZA 3GNXA 1BWKA 3HG3A 3U0HA 4K7YA 1EGVA 2B0MA 1QBBA 2DT1A 4U4MA 2E4TA 2OQHA 3GTIA 2YBVA 3AZRA 4P8XA 3LG3A 4JDYA 3A12A 3PBUA 2YBUA 2NXHA 4HJWA 3C0LA 4IMGA 4J3SA 1M7JA 5EMKA 1GWJA 1SZFA 3LTPA 1ONXA 3U2EA 3DYOA 3N15A 3LMZA 3ABQA 1FH8A 1U5HA 4IPIA 1SJCA 4WQ6A 3HG2A 1WXJA 5FKYA 1QW9A 2PB1A 2WVUA 4JQ3A 4RXGA 4PA8A 1NWTA 4L9ZA 2PCEA 3L2LA 2WNNA 3GVQA 1MW1A 5AC4A 1OF6A 3CZ8A 2OWCA 2PDHA 2IKGA 4H2CA 1J12A 2ISWA 2QJMA 4ZA0A 3LY0A 1M7XA 4XX6A 3CH9A 4A3RA 1SUXA 4E8GA 1VF8A 4GY7A 2ZUNA 4GLEA 4D2JA 3E2SA 4J35A 1GZ1A 1PDYA 4IFRA 4QXIA 3IVSA 4MKSA 1XLCA 1PDZA 4HA1A 2DT0A 4DJDD 1E56A 5C70A 2BY3A 3OLEA 4AG0A 3CV7A 1DXIA 3ARWA 2VHLA 2PS2A 5DY3A 1F73A 3O0KA 4N42A 3HMJG 1PBGA 2OYKA 2OELA 5GQBA 2ZZ6A 2BSLA 2Y88A 2D0GA 3A22A 4J27A 4IFKB 3ALGA 3SJNA 3DC0A 1XLIA 2QT3A 3VNLA 5G1YA 5GNYA 1NFBA 3MKKA 5GNZA 1OD8A 4H9XA 2VX4A 4H9VA 3IUDA 4PSRA 3VNJA 4DBSA 4YCOA 2W5FA 3FCPA 2PA6A 1A49A 1ZZMA 4S2CA 4REQB 3W2UA 1W5QA 2Y2WA 2A7PA 4JD4A 1PS9A 3BCFA 3C8FA 4PCNA 3U48A 4Z1AA 4ZZ9A 5F2LA 1XIHA 4DZIA 4A22A 4ZGYA 3GH5A 1SFLA 3U2OA 1BTCA 3VM7A 4MMWA 1HW6A 1ITQA 3ARXA 2BOEX 2ZRWA 1Q7MA 3DFPA 3CLWA 3LGEA 3WDPP 3WBEA 1R3QA 2D1ZA 1OABA 2PDCA 3VGBA 1Q65A 3MZ2A 3WF4A 3EB2A 2G4JA 4ZQPA 3P8IA 3O63A 1EIXA 4AWSA 2WQDA 3EEZA 4KFNA 3GBEA 3CTLA 2ZWZA 4LUSA 3LRKA 4H4IA 1EFZA 3OBAA 4NZ3A 4GKTA 4AYGA 4EX4A 1W32A 4MJ4A 4OQVA 4XKYA 2CETA 3AS3A 3A3XA 3UG4A 4FNQA 4AUBA 5B7YA 4I6KA 3SIMA 3CQHA 4JQAA 3BAWA 2V3DA 3WQWA 3ZR4A 3PAOA 3UZ5A 4LAOA 3NAVA 3ITLA 4JFUA 3MP4A 3QKZA 3H6OA 1C93A 2OOFA 3KS6A 1XGZA 2Y61A 3UZYA 3A24A 1IEVA 1HKIA 3W7LA 4HGXA 3U3HA 4O53A 1EC7A 3PTQA 9CGTA 4GQGA 1NF7A 2BTMA 5SWUA 2OLHA 1FWCC 4CEUC 3KE0A 1AD4A 3ITGA 1J8VA 4H7ZA 3AIWA 1V0MA 1FWHC 1PZ3A 3ZVHB 4IJRA 3S1WA 3BOXA 4QROA 1XBXA 2HRWA 4AZIA 4HNUA 4IQDA 3SY1A 4HPJA 5HWJA 4AZCA 1Z8AA 3QFWA 2WNQA 4ERGA 3RU8X 3VNDA 5A8GA 2XZ7A 3GD6A 3DGRA 4H41A 3CL7A 1AL7A 1FKXA 2BY1A 2G3MA 1ELSA 1ISVA 2R9RA 5A8QA 1NOWA 4HN8A 1A5UA 4KCTA 3W1NA 1X6LA 3RXZA 3SIZA 3W7HA 4J5NA 5FL0A 4UTTA 4PR4A 1MYRA 4PUMA 2OTDA 1TJRA 3VM5A 5CPSA 4S3CA 3G1YA 3M9YA 3RU6A 3WD2A 5D8WA 3T0AA 1W1VA 3MB9A 1W3JA 3SCWA 1NDVA 3R6IA 1W2VA 2BVYA 4GFSA 4V27A 3OQ8A 5CZKA 4HA3A 5FF4A 5L9FA 3L0NA 4XIMA 3TONA 5CJ5A 1OC6A 2J8FA 1ZY9A 2BZNA 4O4VA 3BMVA 3LHVA 1QNOA 1VPYA 2G97A 3FJ6A 3DGBA 4HHPA 1C7SA 4E0CA 4KW2A 4KBXA 3MA8A 2A3HA 3IJIA 1IZJA 4O1DA 2PBGA 2ZRXA 3SN0A 1DV7A 1OZQA 2H8ZA 2G5WA 4DBDA 3BW3A 2YXOA 1QU4A 3KTXA 3E12A 1UR8A 3OHMB 3MUIA 3WG6A 3C2OA 5JBFA 3S46A 4QBXA 3KBMA 4MB4A 2PTZA 1XDMA 5DBTA 4H9TA 1XGEA 3W6MA 1YADA 4HA4A 4BQ5A 3G8RA 1X1OA 3EKLA 3CMGA 5JUVA 3CHCA 3DFQA 2I5QA 3QZEA 3NO3A 1F3XA 3U9IA 2QF8A 4JTLA 3A6OA 4N02A 2QV5A 5C55A 1XH0A 3NQ8A 1EIBA 2VWTA 3VI2A 4QSHA 4JTGA 1UR3M 4O11A 1K7EA 5EY5A 3W22A 3LCFA 4O1AA 2AL2A 3SCPA 4GHRA 4JX5A 2OEMA 3IGSA 3TMQA 1REQA 4HZ7A 2O4MA 3AYVA 2VDHA 2C15A 2VO5A 4MGGA 3DEQA 1WBHA 3GK0A 4UNKA 3PANA 2DH3A 1CXFA 3PZTA 2J88A 1ONEA 1R0MA 3EX1A 1XIDA 3WNOA 3LSBA 1VHNA 3AO0A 3PF3A 1DJZA 4UNLA 4ATDA 4LUIA 1FWEC 5LNWA 4BY3A 5KZEA 4YNGA 3N4AA 3AIUA 3I6RA 5GJMA 2J6XA 4P8VA 4ROPA 5E5CA 5JH2A 3TYCA 1DIEA 4Z1CA 1ENUA 3QMRA 2Z1WA 4N2YA 1PX4A 2GOUA 2DW6A 4PTMA 4HU4A 4B91A 1E6PA 2VC9A 4MWAA 4R5EA 2CLOA 4E4FA 3AXMA 3C0JA 3DYPA 1GTEA 4NG3A 2Y70A 3O7UA 3VO0A 1BWVA 1MFUA 4K1GA 4JHOA 2HEJA 3AMGA 3I6TA 1CTNA 2BG5A 3TQ0A 3GXNA 3HJZA 2ZFAA 2FMNA 3T08A 3WLMA 3AYRA 4UTIA 3GH7A 3PFMA 3VD4A 3UYCA 4BI7A 3M6YA 3QY7A 4WDTA 2GUYA 2WZTA 2VEPA 3M0YA 2D3LA 4PN2A 4W5ZA 2YGYA 2PD5A 2VRJA 2VOTA 4P8UA 2ZC8A 4LUSB 4O1EA 4PFMA 3LLFA 4G1KA 1Y5WA 5EYWA 4PMXA 1W8SA 4ALDA 3UZWA 5CG7A 4D1IA 3Q2DA 4YVXA 1NJJA 5CC5A 4XKYB 2DGAA 1NWSA 2Z1BA 5A6BA 4GNKB 1LWIA 4M19A 3BC9A 2B7QA 3E38A 2VDGA 2QUUA 4JL1A 1OK4A 4N6FA 5A6KA 3DKJA 5ABEA 3LX9A 4XZMX 5MHBA 1B3OA 5HMDA 1JZ3A 5GJNA 1JQXA 5LXEA 5A6LA 1JYVA 1H2JA 5HK4A 5IBXA 3WENA 4JFWA 4UQEA 4P7OA 1HL9A 2ACRA 1EBGA 2BHYA 3UG3A 4K38A 1PEZA 2VRQA 1DOSA 3CPGA 1KFKA 2EG8A 3UG8A 3BARA 4E2BA 4PE8A 1LM1A 2C14A 2OEKA 1B9ZA 1IR2A 1QMLA 2HWGA 3GX9A 1FY6A 1XPGA 1M6JA 4QJ1A 4AZCB 3CUHA 2BGQA 3M7WA 3QH2A 2OGYA 2V9DA 2PDQA 1HL8A 4B5TA 4ZTXA 4MB5A 4JTDA 1V8EA 3MI6A 1L6FA 5L6UA 5HPCA 4IPNB 3M0MA 3WEMA 1XS2A 2J75A 2Z1VA 4A05A 3CAWA 4M3PA 3P0WA 5JBDA 2X0YA 1X1ZA 2VEGA 3U4AA 2CU0A 2FTWA 1E4LA 3PG8A 1FHLA 4B90A 5JBEA 4FOUA 4Q22A 3C8NA 1XM3A 1KM0A 4US5A 1QXLA 3GVRA 1LRTA 3B40A 4UQDA 3VIGA 3CL8A 3AI0A 5EB8A 5XIMA 5AYYA 3A5FA 1OJXA 1RQHA 2ACUA 3MKVA 1AJ2A 3ARYA 1WXYA 3KWSA 1UH3A 3MSYA 1HT6A 3GC2A 2QUNA 2YL8A 3PZMA 3W81A 4IXXA 4RX0A 4S3JA 1CENA 5DXYA 3BLFA 2DVUA 1NIUA 4JQ4A 4LB4A 1UUQA 2QJHA 1TB3A 2QCDA 2CLKA 2EAWA 2INZA 4TX6A 2W27A 1E1EA 5T9BG 3GDMA 3UJFA 4GUIA 3TSDA 3HGJA 3PZIA 1M01A 1TPDA 1RUSA 2JK2A 2YLLA 2DJLA 1Z48A 3L67A 3EB3A 1KFEA 2Z26A 2RDUA 3BJFA 4KMQA 2VR5A 3DH7A 3WNNA 4YTTA 2BGSA 4UTMA 3F4VA 4JGDA 4RJEA 5HUPA 3SSJA 4UTKA 3M5YA 1QO2A 2D20A 1O6IA 1OB0A 1DJIA 4XSMA 1M68A 2YX0A 2YKKA 2PDLA 3P81A 1W9BM 1NY1A 4O0ZA 1RVKA 3ZOAA 2F84A 2ZICA 1HKJA 1VFFA 1BQCA 1FH7A 3T2OA 2X1IA 2Y5JA 1IV8A 4BZYA 5I77A 2WHMA 3WL1A 1YTDA 3QW4B 4ZBCA 3S83A 4GCXA 2NLYA 3T78A 3SRFA 1O5QA 3KL5A 4US6A 4CCDA 1G9HA 1WDWA 3C86A 4WUIA 3O6CA 3I3BA 3LV5A 4GH3A 2CHRA 4NHVA 2AL2B 3UPMA 1KCKA 4F9DA 3UQNA 3L65A 4D1JA 1V7AA 3C2YA 4E6MA 1DWHM 1DP0A 1MZRA 4XV0A 3P82A 2HBVA 5E0KA 1QPKA 5A1AA 1EF3A 3KCJA 2WBKA 1OQFA 4RW5A 3G5EA 3NDYA 3L0GA 3G77A 3K1DA 3V0SA 4GYFA 4S3AA 3SW6A 1SFSA 1CB2A 1KO0A 1YTEA 7TIMA 4A8IA 4BQ2A 5FF2A 3NQ7A 3MHGA 4NX5A 3VDCA 4Q6XA 1POKA 3WUBA 5KSWA 3WLTA 1E9ZB 4XZLX 2BLEA 3BV7A 3AS2A 3WO8A 1TPVA 1LBFA 4MWAB 4XTIA 3DN5A 1QPOA 1B30A 3WFAA 3EOLA 2PTWA 1TWWA 1NWUA 4B5UA 1B5TA 2WKLA 1V0LA 1WKYA 1XGDA 1XV8A 5JH1A 1XRSA 3KVJA 2CERA 2C91A 3G1FA 3UJ2A 1O94A 4IIEA 3CT7A 3V1PA 5A3HA 3VU2A 2FZDA 1W1A1 4XVEA 1LLOA 3UXDA 3WFLA 4HSOA 3FOKA 1K9DA 3LU2A 4ZTYA 5G2IA 4DBUA 2CHOA 3GXFA 1GOOA 1Q7QA 2BODX 5CQ1A 3UR2A 4MPKA 5AVHA 4JNZA 1V6TA 4QNEA 1H1YA 3UERA 3H4XA 3JRKA 1YIXA 1GKPA 1VH7A 1UG6A 4JHZA 3WQGA 5BMWA 3I6EA 2D0HA 1I2PA 4N4QA 4FSAA 2H8XA 3B9NA 1CT5A 2Z2BA 2WJFA 5AVNA 3QQWA 4E3VA 2VGBA 4GZ7A 1M3UA 3SUTA 3VX1A 5AFDA 4JTUA 3T09A 1MVYA 2WNWA 1BKSA 1T96A 1UUMA 4YN5A 1A5CA 1SSDA 3LRLA 3CMFA 1S5TA 2XVLA 2CKSA 4PMYA 3S2CA 2C13A 1KRCC 2QPSA 4IICA 2A6LA 3C52A 3W7MA 1SMAA 4CQBA 1Q66A 3H4WA 1HP4A 4ZXOA 3LI0A 4NYUA 3NOEA 1RK5A 3G6LA 1J2WA 4DWDA 2F6UA 3CXOA 1E40A 3UY8A 2UWFA 4QDPA 4L6HA 2QDEA 4LVBA 2YCJA 2BVDA 3QC0A 1TZZA 2Y7DA 4MB3A 2GJRA 3PTMA 3G1SA 4L1WA 2QVHA 4R3UA 4E8CA 4Q8OA 4A3QA 4FIQA 1IWPA 3AFBA 2GQ9A 1XIMA 5HJLA 4DZ5A 3ABOA 3TQVA 1ZQ5A 4AIOA 3AROA 4JTEA 2ZX5A 4LAKA 4WVXA 4EPKA 5DRCA 1R3VA 5MF5A 4JYEA 5FJPA 4CD8A 3L7RA 2ZA3A 2XUCA 4RR4A 3PWIA 3GO2A 5TF0A 1NDYA 4CNOA 1WDPA 1JULA 1UKQA 1KV5A 4N9CA 4GNJA 3VIHA 4YJ5A 3IARA 4RNJA 5E0CA 3FFSA 3SECA 5LZLA 1H09A 2G41A 1B3XA 5C9RA 3F4DA 4ZQNA 1BRLA 2O0TA 3KWXA 1DEDA 1HGYA 1Q8AA 3EWDA 4AD3A 2QGHA 2PCQA 2QCDB 1V3MA 3QSTA 5K9XA 1OSEA 5AYBA 4L6DA 3R0UA 3M16A 5G1MA 4H00A 1AQHA 4DPQA 2P76A 3KL3A 3N2CA 1Q6GA 3QMSA 4WR3A 5HANA 4LCSA 2PDKA 3APTA 4G8TA 4PH6A 2G0WA 1YQ2A 3VABA 1KLYA 3IJ6A 1W2PA 4HNVA 3QXBA 1VFTA 2W66A 3VIMA 1XYLA 3BGJA 3I7QA 4DYEA 2F2HA 1NP0A 3W76A 3NVDA 4ZSUA 1XCFA 3SUSA 2YDRA 2V0TA 1E6RA 1PX3A 1IXNA 3SM0A 2O9OA 1V3HA 2DUXA 1KRBC 2GSEA 4HPNA 3CAKA 1VFHA 5CBJA 2FPYA 1MEWA 2WCGA 2ZUSA 1GQKA 3THQA 1WXZA 2DT2A 2W6RA 4BI6A 4UFLA 3LPOA 1B31A 2V2HA 3GXMA 4DI8A 2E1DA 2XN1A 5E70A 3F5LA 3VCRA 1GPWA 3GSMA 4AIEA 2V5LA 4HMNA 3GIQA 3C3NA 4Q8QA 4QHRA 1ONRA 3AMCA 3S6OA 3FYPA 1NOFA 3PUEA 2J8GA 3GDLA 4Q7IA 4UOQA 3KW3A 3XINA 8RUCA 3VIIA 2BS9A 3W83A 5BXPA 3NSXA 4MJZA 3VVGA 1DJXA 1U5JA 3GG0A 4W7UA 1XW8A 1M1BA 3GRIA 4JIRA 4JIHA 2D2HA 2QCNA 4GRSA 1TV5A 5C9UA 1N2VA 3GU9A 4WSJA 3RNDA 3AZSA 5CZJA 1U5VA 3V5CA 1GQNA 3WH6A 1XYMA 4EPEC 2POTA 3MHFA 1TV7A 3JW7A 3W29A 1DJQA 3S4TA 1OFQA 4CQCA 1DWIM 4JY9A 3H7VA 2E67A 1FWDC 1TTJA 4QR6A 4I5UA 3W26A 5DMYA 3C2RA 3N3TA 1GYMA 3GVWA 2G3NA 3SCNA 1XI3A 1AD1A 2GWGA 2GVJA 4I8DA 1W3NA 3W0KA 4LY8A 3QR0A 4J3UA 4F48A 5E6YA 2BY0A 4X9SA 1ZBKA 1IWAA 1HO4A 3WLKX 3TE9A 2P0IA 3FYYA 1ADSA 2C1GA 1OADA 3W7EA 2X1UA 4Q4MA 3VKAA 3CZKA 4QDWA 4KT2A 4Y9AA 1BYDA 4BHYA 1SJDA 1GJPA 5G4EA 2NUYA 3MWAA 1EPXA 4LWWA 1XC4A 1Z3NA 4CKQA 4GJ1A 2H3DA 1JF5A 4AZ7A 1FWIC 1QI5A 4GVGA 1R46A 1XLAA 3RJXA 1VLIA 2J27A 2F7FA 2XZ9A 1PTDA 2CXEA 1J0ZA 2VYOA 4CUCA 2FGZA 5I2UA 5EBUA 3O06A 3WEOA 1W9VA 3HJEA 4RNFA 3E2QA 3RPTA 2DH2A 3IIPA 4OHQA 3OQEA 4E3TA 2E6YA 2DU2A 3MT1A 2VGFA 4XO6A 3A47A 1MZHA 4RV8A 1ZTVA 1PXGA 4ATLA 4CLMA 4HT3A 3WQFA 4JTSA 3S1VA 3S5OA 1T40A 3NM3A 1JUBA 3S2NA 1W3HA 4IQJA 1JGIA 4FF5A 1W9PA 3GG1A 4C91A 4MHBA 5F4SA 1HIZA 5CPTA 1XPYA 1XLGA 1E0UA 4XBSA 3DC8A 3H2AA 1VIWA 2JBMA 1C8VA 1ZS2A 4RZ6A 2XVPA 4HD5A 1OG0A 3GHTA 5FJTA 4KRTA 1UBSA 3GHRA 4PEKA 2HTMA 3HTWA 1IGWA 1Y8BA 4MLRA 2ZRYA 3V1HA 4NAFA 3S5ZA 1K7FA 4KGJA 4KWSA 1XJBA 5CGQA 5CC3A 4K6AA 1J79A 2D0FA 1I0BA 4NZFA 5H8UA 3KLLA 3W82A 4C7DA 3LHTA 1I2NA 1T41A 1XF0A 2AL1A 3ITVA 4QRNA 4E2OA 3IEBA 1W3IA 1GVRA 1P6BA 1X96A 1OYCA 3UD6A 5BXRA 1TREA 2Y7EA 2OZ8A 4OGZA 1M53A 3A4AA 4NY2A 1P0EA 2CLHA 2QAPA 3IRDA 4PEEA 1L6GA 2EG7A 1EP1A 3E3HA 4P7LA 2FVLA 4YWIA 4HNCA 1IT8A 4IG2A 3SUUA 3UXKA 3WD1A 3II1A 1HX0A 1NFPA 3M43A 4LB3A 3PJUA 1I2QA 4ZQOA 2A3LA 1QK0A 1BRLB 4EOUA 4CGTA 2ZXBA 1OFEA 2VR4A 1R38A 5BRBA 2VEKA 3E1F1 5M3WA 4NXKA 1JDDA 1IXPA 1JVNA 3IGXA 5E0FA 4H6KA 3T8LA 3MSDA 4EE9A 2PEVA 2D2GA 1Z89A 3MCMA 3W7QA 1FWJC 2J66A 1YBQA 1ZUAX 3NSMA 5FEXA 3WD4A 4AU0A 1CXEA 4NJKA 5H8PA 4IGHA 4Q4PA 4IPJA 4KIRA 2J7HA 3MV11 3TR2A 1UR2A 4JL2A 1CGWA 3CUIA 4ICNA 4W86A 1ZJIA 4CN4A 2V82A 2HQAA 4DLFA 1TQJA 3NPWA 5M17A 1KBIA 3FXYA 4FLRA 2WVSA 2ZDSA 3WNLA 3WLIA 3TROA 2JKPA 4CNSA 1DXEA 4MUZA 3PUGA 5FOOA 4KS0A 2D2OA 4F0HA 4AZHA 1M5WA 1JPHA 4WXZA 3W3OA 3CYVA 5LHEA 3EDJA 1UH4A 1BAGA 4TV5A 3RO6A 3W70A 2PLKA 4WY0B 2A85A 3OHIA 3B0PA 4LCRA 3ZM8A 3DX5A 4KRUA 3EX2A 3AS0A 2E6AA 3G1DA 4MOZA 3W84A 1YNYA 2J9YA 1EB3A 3W2LA 1Q4WA 1JZ8A 2E6FA 3N17A 3USZA 1E9YB 5A69A 4MDOA 1Q6DA 3AXHA 3UBPC 3AMDA 3CGTA 4C6LA 4C5YA 2DW7A 5CXPA 3E5BA 2GQAA 1Y5XA 4C6BA 4FNSA 4DUOA 1ICSA 1V7YA 1SFJA 1Q4NX 2Z2AA 2QCLA 4GE8A 1QI3A 4H1ZA 1MXDA 3FS2A 4RE0A 3ECQA 3NGFA 1W5MA 5J8LA 4DO4A 4MY9A 4O18A 1X7FA 2OOGA 3D0CA 4IIDA 5BW6A 1GVOA 2AGTA 4O0KA 3UF9A 2OU4A 1Z6KA 4UFMA 1GUVA 1BPLB 2CLMA 2YZRA 1KRMA 3B8WA 4JQ1A 2EBNA 3GTXA 3TQPA 1XISA 1OF8A 3HPFA 4JZ5A 2RDTA 3WJSA 3ZLHA 1RQEA 4C5ZA 5J04A 2HE8A 2HPMA 2RGLA 3WMCA 3KRSA 5CGTA 4WZHA 3TYUA 4EXBA 1R9XA 1D7KA 4K1WA 1P6WA 1T8XA 3WDIA 1PIIA 3K4WA 4RL3A 1GNXA 3U57A 4IP7A 3W4RA 4WDUA 5AHLA 3TSBA 3PZUA 1I60A 4GY0A 3QHNA 4DXKA 1QT1A 3V0TA 2ISDA 4PTXA 4NILA 4EF9A 1N7KA 2PZ0A 5A6SA 8A3HA 3F4CA 1DWJM 4B3ZA 2DV0A 3GQYA 1US2A 3FNDA 5B7ZA 1EO7A 4DPPA 3FJ4A 2XFRA 2RH9A 1S2CA 2EQDA 5ABFA 4MAZA 3EYPA 3QQ1A 3RUBL 4XZIA 1WZLA 4WHBA 1J6OA 1U1JA 3N18A 2XSAA 4GXPA 1C9DA 4J2PA 4Y7EA 8TIMA 4UNIA 1VFMA 1IXQA 4BQ3A 3R94A 1LYXA 2UY2A 4GI6A 4LF2A 3KBWA 4XTDA 3ARVA 3OG2A 3H26A 4DUWA 1EJSC 5E1QA 4Z0SA 6REQA 3PNUA 3UT0A 1GJUA 1YDNA 2FDSA 3WLOA 5A8OA 3B06A 4CQAA 4TQTA 4ZEPA 7A3HA 3T40A 1P0DA 4DUVA 2J6VA 5EKYA 4YLWA 4DJFA 2GQ3A 4OBRA 3TOPA 1JI1A 1Q7ZA 2YCEA 2OXNA 4NAFB 2BXYA 3E2VA 1KXVA 2A21A 2QIWA 1M65A 1HKWA 3THCA 1BD0A 2HXUA 1E1FA 2PGRA 2YYUA 1UHVA 3DU0A 2AMGA 2A3BA 1LQ0A 5HATA 2BDQA 1B4EA 2V63A 3SCRA 1FUYA 3EAUA 4AD1A 3Q58A 2B31A 3WK2A 4D9PA 4I9MA 3S3GA 3UW6A 2J9ZA 2GWNA 3CM4A 4DYJA 1HNYA 3N25A 1MEHA 4IG2B 3EXSA 1WV2A 3ENLA 4CNPA 3L12A 1JXKA 2NQ5A 2G95A 4YWSA 3T0TA 3UCCA 3QQ0A 2WANA 3B8SA 5C5YA 1JJKA 4AF0A 3OGRA 3RLUA 4YYFA 2GJNA 3FV9A 4RDWA 1XRVA 5ENLA 5CLWA 1WDQA 1JDFA 1XUZA 2EJAA 4Q7NA 5AY7A 2CZVA 3O9NA 4ML9A 3W7DA 4AH7A 5HMFA 2Z7GA 2CBIA 1L6WA 4AD2A 1V3IA 2EF9A 1YBQB 4Y9OA 3B03A 4OECA 4XBJA 3D3AA 1GOQA 1XLHA 2WC3A 3HA1A 4QTGA 4L56A 1PTGA 2CESA 4IMFA 1ITUA 4UC5A 4YVPA 3VOHA 4BF9A 1XLDA 2GVLA 2YXXA 3O8AA 1WKFA 2GJLA 3OP2A 4PBFA 3AMKA 3W73A 4DYKA 3FDKA 2BWGA 2QDDA 1LBLA 4GIYA 1KXHA 4X60A 1HXJA 5I3FA 3VDBA 2ZUUA 2G50A 3NZQA 3WQ8A 3CS2A 1IF2A 1UR1A 5E09A 3B0UX 1R9YA 1UJPA 3ARZA 3L4XA 1TPH1 6A3HA 1FDYA 1TRDA 2OB3A 3GY1A 3W1QA 1JI2A 1LP6A 1ZAHA 3VOIA 3BUVA 1PKYA 3C2VA 1VBJA 4KEZA 3ARUA 3BURA 1JF6A 4MWAC 1XDLA 2IPGA 1UD8A 3EA2A 3PHAA 2I9UA 3ABSA 2I1OA 3R7MA 3G1AA 1MUWA 3JS3A 1WX0A 4JFSA 5AC7A 1H41A 3F1QA 4U5IA 3WJYA 3FW6A 4ZQMA 3N2BA 1KQYA 3HGSA 4B5XA 2FZNA 1TVLA 3FSUA 3MBDA 4S3KA 4HIBA 3R43A 4QJ4B 2OKOA 2BHZA 2HDJA 3QSRA 1E72M 1QNQA 4DXXA 3B4UA 3RPDA 4AFYA 3N34A 1QATA 4ZL1A 3GDRA 1E0WA 3CQKA 3ZSTA 4GO8A 4I90A 2FYMA 3TFXA 1WKDA 1JEZA 2IKJA 4GYJA 1OGGA 2Y63A 3CWOX 1NSJA 1JAEA 2INEA 4GJIA 4OBTA 4BF7A 1VFLA 2ZYFA 3OZMA 3GDBA 4CU8A 1G69A 5DFAA 3GW3A 3UVIA 4IXHA 1THFD 1EP2A 1J0IA 4JQ2A 4DNHA 4GBDA 5IBXC 4NRRA 3HFYA 4PMQA 1IEWA 3PK7A 4O19A 3S1UA 1A80A 4DQWA 1KW1A 4GZIA 5M1TA 1A3WA 4A29A 3TNOA 3H2FA 3EGJA 4B4FA 4MFDA 3GZ3A 3IIVA 1XYFA 5U4NA 4GZJA 4LRTA 2VI0A 3FX4A 5G2WA 3P5ZA 3LLDA 3QV8A 4NRSA 4FNRA 3QY6A 3PBMA 3GFZA 4HCDA 4IIHA 3RM9A 1XKJA 2YLAA 1XQLA 3HU7A 3P84A 3LEPA 3IJQA 1ZENA 1I1XA 5EMYA 2WVVA 1ITCA 2Y7GA 3L2IA 4WCJA 1UIOA 2EPNA 2FB2A 3NZ1A 1A53A 5HPOA 5DX7A 1NEYA 5ABFB 2WWDA 1EXBA 3TN3A 3NQFA 2UY5A 2O9PA 4PTNA 4CEXC 1EP3A 1ISZA 4X2RA 3U5UA 3RM8A 3W1PA 3CO8A 4PTVA 3TC6A 1V0KA 3HGOA 1TELA 2VX6A 2VT0A 1FFRA 4C1LA 1SR0A 4IUOA 4G1NA 1R86A 3G1XA 3OYZA 4KEMA 4Y9MA 3WUEA 2XN0A 2GZXA 5F4XA 4AYSA 1T99A 6REQB 4ADTA 4RPPA 1F6PA 3W7KA 4AEEA 4F2TA 3REQA 4HN4A 4S3FA 2KX9A 4XZNX 4DEFA 2QQ6A 4LQ1A 5FSDC 3MJYA 5CPOA 3VC5A 3S2LA 3LTYA 3KP0A 5MKGA 2O7SA 3NR0A 2R6OA 3LM3A 3W75A 5DEZA 1Z42A 5EPDA 2X7VA 3E0WA 4EWND 1J4EA 1QVBA 4U28A 2YZ5A 3UWEA 3SQLA 1QPNA 2WPBA 4TTGA 2VGIA 1LUCA 1VYSX 1EGZA 2TAAA 5D2YA 1L8NA 2Y5EA 2PDXA 2ZKMX 3TYZA 4ZO7A 3ZO9A 1J6PA 3LCXA 2HROA 4CQ8A 2ZUVA 4KPLA 1TZ9A 2PU0A 1R3WA 3C5QA 4H8UA 3SQMA 2PWEA 3POCA 4AF0B 2OFJA 4G9PA 2I14A 1QHZA