3QQ0A

Crystal structure of a deletion mutant (n59) of 3-deoxy-d-manno-octulosonate 8-phosphate synthase (kdo8ps) from neisseria meningitidis
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
275
structure length
243
Chain Sequence
MDIKINDITLGNNSPFVLFGGINVLESLDSTLQTCAHYVEVTRKLGIPYIFKASFDKARSSISVGLEEGLKIFEKVKAEFGIPVITDVHEPHQCQPVAEVCDVIQLPAFLARQTDLVVAMAKTGNVVNIKKPQFLSPSQMKNIVEKFHEAGNGKLILCERGSSFGYDNLVVDMLGFGVMKQTCGNLPVIFDVTHSLQRAQALDLALAGMATRLAGLFLESLHLLEDFLIRIKALDDLIKSQPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-dehydro-3-deoxyphosphooctonate aldolase
publication title Targeting the role of a key conserved motif for substrate selection and catalysis by 3-deoxy-D-manno-octulosonate 8-phosphate synthase
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Transferase
total genus 73
structure length 243
sequence length 275
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.55: 3-deoxy-8-phosphooctulonate synthase.
pdb deposition date 2011-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00793 DAHP_synth_1 DAHP synthetase I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3qq0A00
1GZGA 3SGZA 3NQGA 3O15A 2DZVA 1R2RA 2JKEA 4AXKA 3W86A 1TSIA 4JTLA 5CZ0A 4AB4A 4JYDA 1EPXA 2FQIA 2ZYFA 2LLEA 4LS0A 5AHEA 1JCJA 2VFGA 3GDKA 5HWNA 5A8GA 2QCGA 3W84A 1OYBA 2CLOA 4YMZA 1K8YA 3NQAA 2X30A 3M41A 3MI6A 3MP3A 1ZHAA 4ADTA 1M7OA 3NEVA 1GG0A 3MJYA 4LUIA 1O5XA 3THAA 2X1UA 1LM1A 3IIOA 4NXKA 3W1AA 5BNKA 5HUPA 1SZFA 3G1FA 3HPSA 4PCFA 2E77A 4GJ1A 2ZQ0A 3PM6A 1VZWA 1VCVA 4NNAA 4Y90A 4O28A 3B0PA 3S9YA 5D2WA 2DORA 4GWEA 2VFHA 3W7LA 1XUUA 2J9XA 5EBUA 5KINA 4J9JA 1KBJA 1RQBA 1VCFA 1Q6RA 2JK2A 4TO8A 3LOTA 3WJSA 2R94A 2A5HA 1LBFA 3TIMA 2I14A 1X7FA 1TMHA 2P10A 5D05A 3GXTA 3LV6A 2QCFA 4AWSA 3MHGA 4H3DA 2H3DA 2Q3OA 3HPZA 4NZFA 3QSTA 4OT7A 2GPTA 4IX0A 2G96A 4LRSA 3CEUA 4IGHA 4QNEA 5AC7A 2E6FA 3W83A 3W75A 3GKAA 1LBMA 3EXSA 1DL3A 1I2PA 2V2HA 1OF6A 1EX5A 4BF9A 1K03A 2J24A 3EKLA 3SZ8A 5D32A 4JGDA 2AAMA 2OJPA 1QPRA 3HJZA 1NSJA 1G4TA 1FX6A 1FWTA 3P8JA 3PG8A 4CCDA 2CLEA 4FNUA 3OEXA 1GVSA 5I3JA 3W7EA 3EB2A 3NZRA 4FX7A 1G4PA 4LC6A 3BV4A 1KV5A 3GXNA 4OQVA 3W71A 4UCGA 3P7YA 5HNRA 4WY0B 3STCA 3W85A 1QAPA 3O16A 4IXHA 2Y7GA 4ZQPA 4BR1A 2YXGA 4JICA 3E96A 3W2NA 4NUWA 4AAJA 2E5DA 5HR6A 2WJZA 1I2QA 4JYEA 3M44A 4P2VA 1GQNA 3HF3A 1OABA 4P61A 5C2XA 3DZ1A 1Q45A 2G5WA 5EMUA 1OFAA 4JIQA 1FCUA 4ZQCA 3W7PA 4QIUA 1ZAJA 3GVGA 5KMYA 3EXRA 2E5CA 2OMAA 2FB2A 4E2BA 4CNPA 3HGJA 4XTIA 2DZXA 3IIVA 5DBUA 2A6LA 4I7UA 3I65A 5TIMA 2C0AA 4RJEA 2ZTJA 3KRSA 3OVQA 4PL2A 4A2SA 2DZPA 1LOQA 3M5VA 2VOMA 1YTEA 2QJHA 3STFA 3W88A 3NZ1A 3HO8A 4ADUA 3TW7A 4E0CA 2RDUA 4KWVA 3DU0A 3DFQA 1H1YA 1G67A 2Y89A 3HQ1A 3W1UA 3H53A 4CQ9A 5D2XA 1O95A 4JX6A 4NXSA 2WV8A 1F6KA 4A22A 3HB9A 3T44A 4WOQA 3SECA 3JRKA 3ZWTA 2KZHA 1WOBA 1P0NA 2H8XA 1RPXA 4IPJA 4DF0A 3M47A 3NO5A 4G1KA 4ZQNA 3UWWA 3TSMA 4JNMA 1MXSA 4JTFA 2QUUA 5CPMA 4M6QA 5DXXA 3DAQA 4AEOA 3HBLA 1QMLA 5EKYA 2QKFA 4JDYA 2GVGA 4C1KA 2PRHA 1TRDA 1ZAHA 1YXCA 4JN6A 2Z6IA 1JQXA 2QCMA 1QPNA 2DP3A 1YXDA 3A23A 2W79A 3GKFA 1PHQA 4WOZA 3PSVA 4Z0SA 5L9FA 3LTYA 1H1ZA 4QSHA 4NX5A 2X1TA 5D04C 2H3BA 3TKFA 3PBWA 4GFSA 2B7PA 2FTPA 1OHLA 3CT7A 5FEZA 4FHAA 5F1UA 3M5ZA 4ZQRA 2ZRVA 5CPOA 1P5BA 4R7JA 1H7OA 1K7FA 1N55A 1TV8A 1W5MA 1RR2A 4JDBA 5BOOA 1K7EA 3W70A 3W1MA 3L67A 2E5BA 1GT8A 1AL8A 4RZ5A 1TPEA 2CZEA 2AQWA 4I7WA 4O57A 1XM3A 1X1ZA 2VENA 1QNVA 1H7RA 3NQ7A 1QFEA 3M7WA 3PC0A 4M7SA 5HR7A 3GDMA 1VQTA 1HO1A 4ZQOA 2TMDA 1W1ZA 3EX1A 3PBUA 1SFJA 3L5AA 4UC5A 5KZDA 4BWLC 2ISSA 1VHNA 4QM1A 2E09A 3I68A 4EVZA 1FXQA 4N02A 5BMXA 2GQ8A 1YXYA 4Z08A 2VEMA 3TA6A 2B0MA 1A5SA 1G7UA 1JCYA 4K7YA 3LLFA 4LUJA 5DBTA 2EPHA 4TX9A 5LZLA 3JS3A 5F1VA 1XBXA 3ATZA 2Z6JA 4RCXA 4UMBA 3SIZA 3SW6A 3WK2A 3S1VA 4R53A 2J9YA 3W2LA 3NVTA 1IXPA 4MPQA 1MEIA 3O06A 1KFCA 2D73A 3S5ZA 2OT0A 1VCGA 2ZZ7A 3KOFA 4DF2A 4Y6GA 2C6QA 3R5EA 3CQ0A 2IQTA 3G1VA 4NU7A 1SFLA 4BWLA 4XUGA 3NAVA 3D0CA 1KLYA 2FLIA 1XBYA 1XXXA 1ALDA 3S5NA 5DN1A 5CZTA 3GR7A 3CM4A 4PODA 4U4MA 2C19A 3LCFA 1FWNA 1EP2A 3CPRA 2BWGA 3EEGA 5IBXC 3W23A 3ZR4A 4N9DA 4W9TA 3O63A 3I7RA 2NV1A 3I6RA 3TX9A 1H61A 5E1QA 5CPLA 3OBKA 4NJGA 3G1YA 2NXHA 1XKYA 5LNSA 1SZNA 3G18A 1OFBA 3MBDA 3O8AA 1KFEA 3F4WA 1A50A 3S1WA 5DELA 1KFKA 1OFEA 3N14A 2EGZA 4LVAA 3A5FA 1UASA 2EF9A 1VR6A 4LS2A 3P62A 1GOXA 2B7QA 1JRBA 4DO4A 2G97A 2NWRA 3S5YA 1DJNA 1YYAA 1H50A 3CTLA 3W2UA 4Z0JA 3TXVA 1HG3A 3QJAA 1G6CA 3C2FA 4Z1CA 1KM2A 1FXPA 3W2JA 1JCMP 3W2MA 3N19B 4RXGA 3PUEA 5AYXA 3QW3A 2QCCA 3IVTA 3P80A 4ALDA 2PRMA 4HNNA 1ICQA 1YPIA 3MHFA 3LB0A 5EY5A 2ZZ2A 4CQ8A 2DZWA 4WUIA 3UPWA 2QCNA 3JR2A 2X1RA 2CLIA 2GUUA 1TQXA 5LNWA 2FJKA 3FKRA 3GNNA 4OWGA 3NQ6A 2QR6A 2CWNA 3M6YA 2ZRXA 2Y70A 3TFXA 3WJZA 3SY5A 3PSWA 4UNLA 1P0KA 1W5NA 4FNTA 3LM7A 3GIYA 3NOEA 4S2BA 3L0GA 4X9SA 3S1XA 3P61A 3G0XA 1B9BA 3IIXA 5D09A 1DQWA 4PL1A 2A7NA 3SSJA 4UFKA 1SUXA 2HS8A 2X16A 3DXIA 4O4VA 5A5WA 3VE7A 4LS1A 2H6RA 1J4EA 3E49A 3UYCA 3S0CA 4O18A 3Q2DA 2Y63A 3IIZA 1WA3A 3T55A 4UTMA 5FEWA 5F4WA 1R47A 3OVRA 2XN1A 3W7HA 3M5XA 3W7CA 3LCXA 4A3UA 1C29A 4ZMGA 4I9AA 2O7QA 3GDTA 4RZ6A 3T40A 3RMJA 3W7NA 1K8XA 3ABOA 1QDSA 3TV8A 3W22A 3NPWA 4O1AA 4Z1BA 1AW2A 2NX9A 1LBLA 1QPQA 4BFAA 5D02A 3S6DA 5K4ZA 2FDSA 1ML1A 3RFAA 1H5YA 1H7PA 1D3GA 1VC4A 1K7XA 2DZUA 1M5WA 2WNNA 3B04A 5TBOA 2NWSA 4JY9A 4JX5A 1LLWA 1S5VA 4AMAA 1MO0A 2V2DA 3BO9A 3R8RA 1JVNA 3NL5A 1A5AA 5MHBA 3QQ1A 3TW6A 6TIMA 1FQ0A 1DHPA 4IUOA 1F05A 4GE8A 2VEPA 1FDZA 1KM5A 1VPXA 3UY8A 3LHYA 3PBVA 3ZS4A 4UTJA 5IM51 4POCA 4TIMA 1TTIA 1W56A 1Q6QA 1W5PA 3UNDA 3ATYA 5G2HA 3GLCA 1WYIA 3U2OA 4O12A 4DQWA 4Q33A 4Q32A 1Y0EA 4GUGA 5LSMA 1EB3A 2VFIA 4A2RA 1FUYA 3LHWA 3MI2A 2NV2A 3IVUA 1ZCOA 3O07A 2DZTA 1LLZA 3NL6A 1RZMA 1I8JA 4N4QA 3LCHA 4TU1A 3G1XA 4FIQA 5AN7A 2P0OA 1IXQA 2NZLA 4JXCA 1NVMA 1PE1A 3LHZA 4CCCA 1FDYA 1H7WA 3PBYA 2CZ5A 3IGUA 3W2KA 3PF3A 2VKZG 3PAJA 5HINA 5HJLA 1O60A 1S5TA 3EX4A 1QCWA 5K9CA 1IXNA 3TDFA 1T8XA 2Y7EA 3C2VA 1I45A 1Q3NA 4K38A 3C6CA 4O0ZA 4O17A 3LXBA 3W3OA 1OYCA 1BKSA 4MFEA 5K9XA 3TJLA 2ZA1A 4AF0A 4UTUA 1W37A 5DLCA 2C18A 1JRCA 5LKYA 3DENA 3LRKA 1F5ZA 3TCEA 2ZZ1A 4N4PA 4HSNA 2JKAA 3VCRA 2NXIA 1LYXA 1LOSA 1J2WA 5CGQA 5AYYA 3I7QA 4IPIA 5H91A 3LCLA 3H54A 3EWUA 3NGJA 4UFMA 4DPQA 2QCLA 3ANYA 3PY2A 4H4IA 2R14A 3B0VC 2FIQA 3TNOA 4DBDA 3M0ZA 2A21A 4GXMA 5DCEA 1YLVA 2FPTA 1J5TA 1AW5A 3BPWA 1JQVA 1SSGA 3ABSA 5I3IA 1EUNA 1CW2A 3LBCA 4FEZA 2JGQA 2PURA 5C5YA 5ABTA 2G95A 3UWVA 3LRMA 1ME8A 2XN0A 2Q3RA 2QEZA 3L5MA 4MJMA 2QJGA 1L9WA 1XC4A 3NQCA 4RX0A 2DJLA 5EL1A 3UWQA 1K8ZA 3G3DA 5AHIA 5U7SA 2GVLA 3L0NA 3A21A 2V0TA 4M19A 5FEXA 3UWUA 3TMLA 5AFDA 5FF3A 3FJ6A 3W7DA 5I3GA 3GZ3A 4JTEA 4JTTA 3N2XA 2TPSA 4GRSA 4R33A 3HGOA 5CZJA 3PULA 3HG2A 1QOQA 1ZY9A 1Z42A 4GUJA 4FNPA 3G1HA 3LDVA 4O0KA 3EXTA 1OYAA 3H55A 4ONVA 3BGGA 4WXZA 2CLHA 3MHUA 1EIXA 3HGSA 2WSQA 1U5JA 1HFBA 3VE9A 3W1RA 3L65A 1DQXA 4JTKA 4FXSA 1X6UA 4XZ9A 3EX2A 3VI2A 3C2RA 1Z41A 5F2LA 1VGAA 3M1ZA 5D33A 1JUEA 1H63A 3UZJA 1CX9A 5FI8A 4UMAA 2H8ZA 2VEKA 3LRLA 3SJ3A 3TH6A 1UUOA 3W7GA 2ZA2A 3NQ8A 5LGXA 1BTMA 3QEZA 4YCPA 1AMKA 3G3MA 3W1NA 4EOUA 1WAUA 1OVDA 3F1QA 4LV4A 1F7BA 4YXGA 1FWRA 3KVKA 1OFQA 1OK6A 2B7OA 3W7OA 1T96A 2ABAA 4RR4A 4UTIA 2CU0A 3A9IA 1BWKA 4GNJA 2QDGA 1MZHA 3MYOA 4EF9A 2E6YA 4UXDA 2H90A 3NQ2A 4JD4A 1Z48A 1EEPA 1OX4B 1KTBA 3M5YA 4MY8A 3NL3A 2XN2A 3LGEA 3MI3A 3HGRA 2HMCA 1FCBA 2QDHA 3EKZA 3C0JA 3N9SA 4PA8A 3EWZA 3S5OA 4AHOA 1UUMA 1HL2A 4A29A 4GUIA 4JTIA 4YLWA 4JTJA 4FX8A 1EP1A 5KTLA 5DCDA 4WD0A 1SW3A 1YTDA 3FA5A 3O05A 5TQLA 3LCGA 4LVBA 5J5RA 3A22A 2YW3A 5U4NA 3IGSA 5K9DA 5C54A 3C61A 2C16A 3LXAA 3G24A 4HT3A 1PL9A 2NX3A 5EA9A 4O52A 4NQ1A 1KM6A 3QC3A 4M7TA 5SWUA 2CLLA 4YCOA 3BW4A 3CC1A 3VNDA 4WY0A 1ZFJA 2FB3A 5CKSA 4OHQA 3FYOA 1LTDA 2ZRZA 3V75A 5LHEA 1UBSA 4BK9A 1FDJA 3W1PA 3GDRA 3VKJA 2YW4A 1TPVA 2CW6A 1VYSX 2FFCA 4GUFA 3G1DA 3W1LA 4CNNA 5LNUA 4KFPA 3DFPA 3S1UA 3NXFA 2A85A 3W73A 3DKLA 2X1SA 1GVRA 3ABQA 4FNQA 2V5LA 4RKAA 1TTPA 1AW1A 3KRZA 2PCQA 5AOUA 1OX6A 3GXPA 4ZZ9A 4UFIA 3KHJA 2X2GA 2BX7A 1LOLA 3DH7A 4RV8A 1ME7A 3W7RA 3FEMA 3TSBA 2ZRUA 1ME9A 2Z2UA 3TE9A 2QJIA 3E02A 3R12A 3QQ0A 1KFJA 4L4MA 3K30A 1CI1A 1L2UA 1KFLA 3LHVA 3LCWA 4WY0F 5AHMA 1GYNA 2ATSA 2ZA3A 2ABBA 4D2JA 1S3HA 4IX2A 2OX1A 4MLJA 4O16A 5FESA 3V1PA 1F76A 4H6KA 3TC6A 1TPUA 1OX4A 1YDNA 4S2CA 3W07A 3UXDA 4NVTA 3U6WA 2BSLA 1V5XA 2BXVA 3QFEA 3LTPA 1XFBA 3L66A 5I3FA 1LZOA 4AVFA 3FYPA 1RV8A 1GPWA 4YWIA 4IMFA 5G4EA 3E9AA 1TJPA 2WOQA 2QAPA 1F2JA 3FIGA 5EPDA 3WJWA 2Y88A 5AB3A 4IMDA 1LRQA 1VS1A 3TMQA 4KFNA 1F74A 1NF7A 1EUAA 1OFDA 3LCIA 1YPFA 3CU2A 3DFSA 3O6YX 1KV8A 1TV7A 5D30A 4I7VA 4K36A 1XDMA 3OG3A 1IIHA 3P82A 3MP4A 1KTCA 2TRSA 3PR2A 3OIXA 1PCKA 3NQVA 1XDLA 3DHFA 2R8WA 2TSYA 3DFOA 5AHFA 3BARA 1TYGA 3MW7A 1NEYA 5FF4A 4NZJA 2QCDB 2Y7FA 4QNWA 8TIMA 1YDOA 1B4EA 3GDLA 3KVJA 3T78A 4UIOA 1GYLA 4MVAA 3DHDA 1W5OA 3LBMA 1EA0A 2A7RA 4NJIA 2YPIA 4JTSA 1DORA 4MJZA 4WQ6A 5DY2A 2C1HA 4O1DA 4LOCA 4N6EA 4NJKA 4UR7A 3T7VA 3M43A 2C3ZA 5GVJA 3S8HA 1MSSA 3BG5A 4NJJA 5DCBA 7TIMA 2ZBTA 5HWJA 1I2NA 3NQEA 3T4CA 5K7JA 3UZ5A 3C8FA 3RNDA 3KRUA 5BRBA 3Q94A 4KWWA 4NJHA 4N9EA 5I3HA 4NX0A 1DV7A 1SO5A 3PUDA 2NX1A 3LHUA 3FLUA 4E38A 4XKYB 3DKJA 4UTLA 4RZ4A 3QZEA 2YYTA 4DPPA 1UJPA 1DOSA 5FF2A 4KFOA 4JY8A 3TUUA 4K8HA 2VFFA 1WX0A 4O4WA 4WX2A 3MWAA 2UV8G 3AJXA 2XFWA 4O1BA 2F84A 3QPZA 6ALDA 2Y62A 1VRDA 3NNTA 3TROA 3P60A 4MIMA 3HG5A 2YDAA 4ORIA 2I1OA 1TQJA 3MO7A 4GBUA 1A5BA 1TPB1 1ONRA 4IWWA 4NT0A 1VH7A 5E0KA 3L0KA 3DGRA 4N2YA 3ELFA 4ML9A 2V82A 2E6DA 3W74A 4QAIA 3PB2A 3MUXA 3ABRA 1W3NA 4IMGA 3BVJA 3WJXA 3YPIA 1GG1A 2W6RA 5H2ZA 5K2ZA 2W0UA 2A1YA 1BEUA 1TJRA 5I3KA 2Y61A 4UNKA 3QMTA 3EX3A 1TPDA 2WNQA 4O54A 4QJ1A 2VC6A 1XL9A 1C8VA 1LCOA 4DO5A 2E68A 5LHFA 1FCVA 2QUTA 1Q6LA 2JBMA 3L2IA 1GTHA 5CSSA 3E12A 1KM1A 4MFDA 2WPBA 3OA3A 1THFD 3RF9A 3GAKA 4O10A 4LY8A 3N3MA 2YFOA 2J27A 1O94A 4X22A 3N73A 4MY9A 1FBAA 3HPXA 3W6YA 4WXYA 2Q8ZA 1I4NA 4LU0A 3N34A 4OU1A 1PV8A 1X1OA 1R46A 1P1XA 1T99A 4ZVJA 3NPUA 3BG3A 4EWND 2GJLA 3G22A 3G8RA 3GX9A 2HTMA 1TB3A 4BI7A 3P8IA 4X2RA 1KTNA 1HTIA 1G7VA 4LC8A 4U28A 4HIBA 1AK5A 1QO5A 4Y9AA 1OJXA 4S1FA 3C2OA 4HNVA 2DZSA 3PS7A 1LP6A 4ORMA 1ZJIA 1LRTA 4IJBA 3SR7A 3NQMA 1XBZA 1GVOA 1OFOA 3RLUA 4WZHA 1DBTA 5FF0A 3USBA 1RVGA 3TU9A 2VFDA 3VFLA 1KM0A 1PIIA 3CB8A 1IIGA 2YX0A 3I7SA 4M6VA 1L6SA 4DO6A 2O7SA 3EWBX 3CLMA 3EWXA 1KA9F 4UTTC 1GVFA 4JR5A 5HWMA 1QR7A 2Y7DA 3Q37A 4HKPA 4AHPA 1L6WA 3BG9A 1C9DA 1BWLA 3QF0A 1TIMA 3PG9A 1FY6A 2B4GA 4LVDA 3CIWA 4O15A 2Q8LA 4AHQA 1G4EA 4AWUA 1VHCA 3RLVA 4FNSA 5FF7A 1GWJA 5C55A 5KZEA 4PEKA 1TV5A 3W7IA 1GTEA 4UUIA 4O19A 5FEPA 2ZZ5A 3PVFA 3NYZA 3TJXA 2HSAA 4K37A 4HNUA 5AC8A 3B05A 2V5BA 2ISVA 4LTSA 3LX9A 2CLKA 3CWOX 2E1DA 4WJEA 4JTGA 2YYUA 4JX4A 5KSWA 3TSDA 3MP5A 4XQ6A 3WK1A 1VJIA 4QQ3A 5G2WA 4Z1DA 2P1FA 1M7PA 1KM4A 4LVFA 2V9DA 3IIPA 3N2MA 5G4WA 3UD6A 3B0UX 1JCLA 3G8EA 4UTTA 2YCEA 3ZWSA 3QH2A 3TK7A 2C14A 4LT9A 1SU5A 4EIVA 3KX6A 5EYWA 3N9RA 1XCFA 5LGZA 3G0SA 3NM3A 3M16A 4YL2A 3QPYA 1SO3A 3UQNA 4RK8A 1GJPA 4MY1A 1ZALA 4MZ1A 2ZRWA 1NFBA 2ZZ4A 1H7NA 5F2GA 2WSYA 1XI3A 4QITA 5HULA 1SPQA 4XTDA 4JTUA 3L9CA 5L6UA 4DXVA 4IOTA 1OFRA 1JCNA 4PH6A 3GYEA 3TQVA 5AC6A 3BLFA 1ZNNA 1HUVA 2E6AA 3NR0A 3KFTA 2YFNA 3QRHA 3L21A 5D03A 1QPOA 1MEWA 1TPH1 2WKJA 2C15A 4MLRA 2GVJA 4CLMA 1OG0A 5BW6A 4OV4A 1H62A 3P84A 4IQLA 3STGA 1DVJA 4O8RA 1M6JA 3W7JA 4UR8A 2WQPA 3KVMA 4GC4A 1H60A 1KLZA 4X3ZA 3DFTA 3GB6A 1LORA 1SQ7A 4O1CA 3F03K 3BLIA 4ADSA 5F2IA 4HPJA 3TQKA 1TPC1 3W1XA 3UWZA 1B3OA 1P4CA 1TREA 1A53A 3IEBA 1SW0A 5DXYA 5CG7A 1TPWA 1W31A 2RDWA 4DBEA 3PB0A 2DJXA 2ZDRA 4PFMA 3FFSA 2PC4A 4IMEA 2QAFA 3NQDA 1N7KA 2ATMA 1JUBA 1UB3A 2A6NA 3OHIA 3NPVA 3O1NA 4LRTA 1X8FA 3WFAA 1F73A 1LROA 2V30A 4RLIA 1TRIA 1SO4A 3IGXA 4K7VA 2Z1BA 3CEPA 3SI9A 1KW1A 3QYQA 1Q6OA 4OV9A 3P74A 4OBTA 3FKKA 4FXRA 2C13A 4AH7A 3R2GA 4ZL1A 5T26A 1GVQA 1PHWA 4UTHA 3B03A 2Y6ZA 3G1AA 1JCXA 2DU2A 2QCEA 2ZZ6A 3C2EA 3NPXA 1SO6A 4DELA 1S5WA 3U8GA 2CZDA 4LVGA 4MZYA 4L4LA 1N8FA 3UPBA 3PWAA 3BW3A 2R91A 2Y85A 2RFGA 2YSWA 2ISWA 2VFEA 3C52A 4IMCA 2ZTKA 5HMSA 4FX6M 2J9ZA 3CIXA 1A5CA 3QW4B 3STEA 4TR9A 3PUOA 4O53A 2BTMA 2PE4A 5CZSA 1WDWA 1O5KA 5G5IA 4BI5A 5K4XA 2QF7A 3B4UA 1SZGA 2CZFA 1WV2A 2A7PA 4NNBA 3EWYA 4HPXA 2V81A 4RXFA 2V8ZA 4OGZA 1GEQA 2RDTA 1DKWA 1SR9A 3LI1A 2WO5A 4UFHA 5G1YA 3IRDA 1E51A 1I2RA 3BK0A 4DF1A 4BI6A 3DBPA 2CLFA 4B5NA 3TC7A 4N6FA 1O4UA 1SZEA 4TMBA 3UWYA 2NUWA 3QMSA 3W7MA 4UTWC 3NQFA 3GAYA 4ZQMA 4O13A 2Z0IA 2JGYA 3RU6A 4LNYA 1RD5A 5BMWA 2QUVA 4FIRA 2NXGA 1V7YA 4JTHA 1PS9A 4O50A 3HOJA 1K3UA 3W1QA 5F4XA 4M6PA 3HIJA 5AHNA 2CFFA 4HHPA 1W3IA 3QMRA 1TCDA 4HSOA 3W7QA 3R13A 4AWTA 1EP3A 1XBVA 3P81A 1VLWA 5D38A 1XUZA 1G69A 2BZNA 5C6MA 3THQA 1H7XA 3TAOA 3MYPA 3KXQA 1YADA 3EWWA 3TAKA 3C3NA 2EKCA 1JULA 3TR2A 3IV3A 1WXJA 4MYAA 4JEQA 3HMJG 2F7FA 2ZZ3A 4O11A 2GQAA 2J88A 4MUZA 2FPYA 4C1LA 3DFNA 4UTWA 1ICSA 3LLDA 1W5QA 2GJNA 4XWUA 1TTQA 4HNTA 2B7NA 3CWNA 2VELA 1AG1O 4IXXA 1W8SA 2QCHA 1OFPA 4KKXA 1SW7A 4N9BA 5G2IA 4R34A 5HQEA 2EAWA 2HS6A 1ZENA 3W1TA 2OZ0A 4Y96A 3M9YA 1LRNA 3RK8A 2RHGA 3P5ZA 5K3VA 3NDOA 2CLMA 4XBSA 3W76A 1Z44A 3Q58A 3NG3A 2NLIA 1L6YA 5AYZA 3W72A 2RH9A 4FB7A 3NL2A 5D2TA 1VYPX 3LERA 1QO2A 4MOZA 3ZFHA 1WBHA 3HG3A 4O14A 1TTJA 5J5DA 3SFKA 3IVSA 4UFLA 1QWGA 3INPA 4FF7A 5LNRA 4PTNA 3DI1A 2WSRA 3UXAA 1IXOA 1WOAA 1MEHA 2VEIA 2PRLA 5CSRA 1FCQA 3B8DA 3NA8A 4HN4A 1YTKA 2A4AA 3WK0A 3WK3A 4MKNA 3CHVA 1OX5A 2A2IA 4TMCA 3W9ZA 4A21A 2ALDA 2OCZA 3GR8A 3P5YA 4FNRA 1WBJA 2EHHA 1EWDA 4MYXA 1I2OA 1ADOA 1NAL1 2ZFAA 1KM3A 3SGUA 3E0IA 3TFCA 3MMTA 1JJKA 2YGYA 3BLEA 5IBXA 4XBKA 4MZ8A 1SSDA 1ZAIA 1QOPA 1TPFA 3GK0A 2YZRA 3OVPA 4CQAA 3W7KA 3LXCA 4PC8A 1IF2A 4OE7A 1RQHA 1RQEA 1R2TA 1PVNA 5KITA 3B06A 2FPVA 3LTSA 4K39A 3LI0A 1B57A 3C4UA 1R2SA 4Y8FA 4JIPA 2NUYA 3WJYA 3NM1A 2J6XA 1UCWA 2BLEA 5F4SA 3G0UA 1D9EA 5D37A 3A5VA 4ICNA 3TXZA 3UY7A 3DI0A 2ZRYA 4JS3A 1D3HA 3GNDA 1NF0A 3W87A 3MBFA 5F2MA 1W3TA 5D2VA 1H51A 5G1TA 1B4KA 4Q4KA 4CCEA 3LHTA 1VLIA 3EX6A 2NUXA 3O6CA 3C56A 1WQ5A 5KZMA 4E2DA 1KFBA 2QCDA 4GUHA 4QISA 4UMCA 4LV9A 5HUOA 4AF0B 2TYSA 3KAOA 4DEFA 4JYFA 1R30A 1TO3A 1EWEA 2VXNA 4CNOA 3P67A 2ZCGA 3QM3A 1W54A 2I9EA 5D2YA 2WNZA 3BW2A 1LDCA 3O6DA 1DJQA 3FS2A 5CPNA 2V2CA 3FJLA 3AO0A 1ICPA 1HO4A 1OF8A 1PCWA 1IGSA 3F4NA 3QSRA 4FO4A 3BGJA 3LV5A 2JKPA 1FWSA 1VYRA 1KBIA 2OT1A 4NNCA 1YDVA 1JUKA 2GOUA 4XKYA 2AGKA 3R89A 4LWWA 5E93A 2A0NA 1W0MA 3L5LA 4UFJA 4UTKA 1T0OA 2RKXA 4K6AA 1U83A 3KVLA 1JR1A 3HG4A 3L68A 3A24A 1AL7A 3FOKA 2GQ9A 4Z1AA 5AHLA 1K02A 5DY3A 4K8EA 1OK4A 1FWWA 1G4SA 5LNVA 3TQ0A 4N9CA 2YR1A 1F6PA 4EF8A 3G1SA 3S42A 4LW7A 4M5PA
chains in the Genus database with same CATH superfamily
1GZGA 2J77A 1NP0A 2VYOA 1R2RA 2E9LA 2V3FA 3P0XA 3CQKA 3M0MA 1BLIA 3H2OA 5I79A 4I5UA 2ADAA 2FHBA 2QCGA 4OUIA 1OYBA 5CSUA 3KWSA 2O4MA 4BY3A 1ZHAA 1K9FA 2HNHA 1GG0A 3E3HA 2WLZA 3UT0A 3IIOA 5BNKA 3BAXA 1GOQA 2Z25A 1QUMA 1RUSA 3TYZA 2HBVA 1NDWA 4NNAA 2VM8A 3KUMA 5D2WA 3AWOA 3W7LA 2J9XA 1PWLA 4OJYA 5EBUA 4QR6A 4NAFB 3QR0A 2OYMA 4XVEA 1NM9A 4OBRA 2R94A 1E1CB 1OQFA 4QSFA 5IFPA 1TMHA 1QI5A 1AZ2A 3GXTA 3LV6A 4ZTXA 3XINA 2H3DA 3HPZA 3K4DA 3QSTA 2OB3A 4OT7A 1JYWA 2G96A 3U5YA 5AC7A 4P7LA 2E6FA 3M0JA 4Q3MA 3B0YA 4LCSA 3GKAA 4OKDA 3MKCA 1AQMA 3B4YA 1AQHA 2J24A 3SZ8A 5C9ZA 2VX5A 5FJTA 1CXFA 3ITVA 3VD7A 5IDZA 1QPRA 3WMBA 2QVNA 1EGMA 1FX6A 1ZP3A 1CYGA 1RXOB 2CLEA 1HXJA 1AD1A 2XVNA 2ZUNA 2V69A 1MVYA 4BHYA 3P7YA 4IFKB 3CZLA 1ZP4A 3QKZA 4C7FA 1EGVA 4BR1A 2YXGA 3SQMA 4XSMA 4G1NA 1UPPA 2WJZA 2X40A 3M44A 3IARA 3L4YA 3DHPA 3HQPA 1J6PA 3N15A 4FK9A 3NFUA 3VDAA 2BVTA 3Q65A 1XX1A 4WDUA 3SCSA 2G5WA 4QQUA 1OFAA 1FCUA 2Z29A 3MZ2A 1SJDA 4KEVA 2FB2A 3EOOA 2V5CA 2DZXA 1OT1A 3IIVA 1E0UA 3I65A 3ZT7A 4AZIA 4D1JA 2WC4A 4ASTA 5CPQA 2VZSA 2QJHA 1DJIA 3W88A 3HO8A 4ADUA 2XG9A 3BICA 4XAYA 4E0CA 1CXKA 1XLCA 3PP7A 4KWVA 2O4QA 1H1YA 1G67A 2Y89A 4BF7A 1DEDA 3HQ1A 1TUFA 3QY6A 4CQ9A 2O9RA 1O95A 2I5GA 2DQXA 1HW6A 2IPFA 4A22A 3VD5A 4LBUA 4Q4QA 1O12A 4AZ6A 3POCA 5A8PA 3M47A 2WHLA 3T0BA 3UCDA 5CPMA 5BCAA 4M6QA 4M24A 1VFHA 2VVSA 2BGNE 4JEJA 3BSMA 3MANA 5EKYA 2QKFA 1ZAHA 1YXCA 2Z6IA 4RNFA 2OKOA 3DHUA 1JFHA 2DP3A 1YXDA 2OWCA 3PBWA 3T2QA 4A05A 3R11A 5FEZA 4AC7C 5F1UA 4ZQRA 2MNRA 2FZDA 3TTQA 3M46A 2NSOA 3UJEA 4FOJA 3QV6A 4PE8A 4ZEPA 1RR2A 3GZAA 4JDBA 1K7EA 1J0HA 4GMEA 3W1MA 1GVIA 1WKYA 1C7SA 3DG6A 4RZ5A 1RA0A 1TPEA 4O57A 1RCXB 1ONEA 3WD1A 1XM3A 4W87A 2VENA 1HIZA 1QNVA 3SDOA 2OX4A 2ZWYA 4M7SA 4XD4A 5HR7A 1BG4A 4FR1A 5M5DA 2CHNA 1VQTA 4C6NA 1HO1A 4BWLC 3L5AA 4PUKA 2E25A 4XB3A 2ISSA 4QM1A 2E09A 4RV3A 4N02A 1YXYA 4Z08A 3TA6A 1A5SA 1JCYA 1E6XM 3LLFA 4LUJA 1EHNA 1TVNA 4QP0A 3OYZA 3C5QA 3ATZA 3SIZA 2XTKA 3T42A 3EA2A 2J9YA 1QNSA 3AYTA 1CLKA 1RK6A 1W9PA 3CO8A 5FJUA 3O06A 1BYCA 1QW9A 1XR2A 4ZA0A 2J7BA 4QTGA 2OEMA 4DF2A 1AJZA 4MB4A 5LYRA 3ITOA 2VZUA 4RDVA 4RNJA 1HP4A 3CQ0A 1OC6A 3BDKA 1E1EA 4NU7A 4BWLA 4XUGA 5A95A 3NAVA 1UWAA 3EPMA 3D0CA 4TX6A 1XXXA 3S5NA 3OOQA 5DN1A 2YBUA 3CM4A 5HXMA 1CGWA 5AY7A 3LCFA 1FWNA 2BWGA 3EEGA 3UW6A 3AYVA 4PRRA 3O63A 3I6RA 2QQ6A 3UZXA 5ECUA 3DBNA 3FEQA 4NAEA 3G1YA 4YYCA 1SZNA 5GPRA 4YIWA 5A94A 5I3DA 4S3AA 3H4GA 1A50A 1L8PA 2PLCA 2XVGA 1OFEA 3A5FA 2EF9A 4O1EA 4W8BA 1UC5A 2P88A 3UA4A 2GJXB 1J2BA 3ARRA 3HA1A 1PZ3A 2DSWA 4DO4A 3KL3A 1VBHA 3N6JA 1DJNA 2E9BA 3UBPC 1G6CA 1V8EA 3LPGA 3GW0A 3M07A 4R7WA 3W2JA 1J0ZA 1V3MA 5AYXA 3K13A 1WKEA 4ALDA 1YPIA 4AD2A 4CQ8A 3UPWA 2QCNA 2GUUA 4L64A 2NSXA 5LNWA 4X61A 4OWGA 3NQ6A 3M6YA 3G77A 1XYAA 1NH6A 4UNLA 2ICSA 1QXLA 4TVCA 4FMVA 1HL9A 2FVMA 3P61A 3G0XA 1B9BA 1XSJA 3T05A 3DXIA 1K9TA 4X63A 4MJ4A 3ID7A 3VE7A 2H6RA 1FKWA 3H2FA 4MB1A 2Y63A 4KGJA 2VGIA 3T55A 2YL9A 5FEWA 1R47A 1MXGA 1S2CA 1Q4WA 2XN1A 3M5XA 3LCXA 2D0FA 4INFA 3WQ5A 4ZMGA 2WZIA 3GDTA 4H2CA 3T40A 4LY4A 3DESA 4HOXA 1K8XA 3SCRA 1M04A 3FV9A 3W22A 3NPWA 1ZL1A 3N2OA 4Z1BA 4GJIA 2FH8A 1CZ1A 3H2AA 2NX9A 1LBLA 4BFAA 1DJXA 4KESA 3S6DA 5K4ZA 3T0DA 3WFZA 2X05A 1ML1A 4QLLA 3RFAA 1D3GA 1VC4A 5JBEA 1W1VA 1XICA 3S6OA 4JX5A 1S5VA 1MO0A 4PCTA 1UOZA 1JD9A 2DGAA 1JD7A 3TW6A 3TLLA 1DHPA 1ZJHA 2X8RA 4MAZA 4YTQA 3VNZA 1JPIA 3TN5A 3PJWA 1KM5A 5JXQA 1HNYA 2PGWA 3U2EA 4N0RA 1UD6A 1GQIA 5IM51 4DM2A 4POCA 2AQOA 1EF3A 1VIZA 4FAMA 1WYIA 3U2OA 3WZ0E 1Y0EA 4Y9NA 1UWQA 5C2CA 1NFGA 2E1WA 1FUYA 3REQB 1EGZA 2NQJA 1CLXA 1TV4A 1HKIA 4A3HA 3O07A 4R85A 4C60A 4EXBA 1LLZA 1RZMA 3TTSA 1JG9A 3M0XA 4FIQA 1IXQA 3V5CA 2P53A 1NVMA 3GTFA 4ZOCA 3VOHA 4DWSB 3W2KA 3DUGA 4LNCA 3VKKA 2YJQA 3RHGA 3WN6A 4LBSA 4B5XA 1QCWA 5K9CA 1GYMA 1RJPA 4DXKA 3WLRA 2Y7EA 2FTYA 4XZHA 3GW3A 4O17A 2F6KA 5FAJA 1EHAA 3WLMA 3T9PA 1W32A 2WKGA 3W3OA 3F4VA 4YNGA 5K9XA 3RIKA 1XLKA 4AF0A 4TUFA 4Z17A 4TXEA 1JRCA 1OINA 1JZ2A 3CUGA 5I23A 1PBGA 2ZZ1A 4N4PA 2ZWZA 5CGQA 4JTDA 1OADA 3LCLA 4GFIA 4LW7A 3T1GA 4UFMA 3CHEA 1BSLA 3THUA 4AD1A 4XAFA 2REQB 1WPCA 1HJVA 1PUDA 4C6FA 2Y2WA 2FPTA 2NQHA 3BMXA 1G5AA 4NY2A 1J5TA 3BPWA 3MDWA 2GWGA 1SSGA 1AD4A 1CB7B 3LBCA 2JGQA 5ABTA 2G95A 2YCIX 4TV6A 3NJ3A 3LRMA 2FHFA 2QEZA 3T2OA 3BLLA 3KW3A 1TG7A 3MUAA 4RX0A 1XS2A 1K8ZA 2WCAA 5AHIA 3OLGA 2P50A 3UXLA 3VGGA 2Y5SA 5M03A 2DUZA 4FOKA 4M19A 1XLGA 1E0XA 1J18A 3GG1A 4GYKA 2OZ3A 2PDGA 4JTEA 3URQA 4V2XA 1CGXA 1DTUA 1QOQA 3JUGA 3G1HA 4ONVA 1L8NA 2ISFA 1VENA 3V18A 5C9UA 2WSQA 3VE9A 3HFYA 3W1RA 4IPPA 3B0XA 3CL7A 4HNLA 2BHZA 4XZ9A 3EX2A 4JPGA 4PMVA 4L7ZA 1DTNA 4S3DA 4FP1A 3UEQA 1VGAA 5MKGA 3UZJA 1H63A 4C6DA 4XZBA 4GO9A 4UMAA 5H8PA 4K68A 3LM3A 2BBFA 3NQ8A 2YDRA 3FVDA 3QEZA 3H8AA 3VDGA 2CIPA 4W85A 3ARQA 3QLDA 4J3TA 4AYGA 1M3UA 1BAGA 1OFQA 1H0GA 1Z89A 3DYPA 2VRQA 4EE9A 4RR4A 2XIMA 2QDGA 3RLHA 1MZHA 4EF9A 1XISA 3COTA 4AUBA 3NQ2A 1Z48A 3LPFA 1BVZA 1S1RA 1KTBA 2OSYA 3M5YA 1TIWA 3A3XA 4PTWA 3CZEA 3HV9A 1J6OA 3WEOA 3NQBA 2QDHA 1GJUA 3N9SA 2ON3A 2JQXA 3EWZA 3S5OA 4D6JA 2DIJA 4GUIA 2CC0A 4XX6A 4YLWA 4GH3A 4JTJA 3K5XA 5DCDA 4WD0A 1W1IE 2FDMA 2OQYA 3O05A 5C2GA 3S9ZA 5J5RA 4O0QA 5LIYX 3C61A 2C16A 4YVXA 4CN1A 2C1IA 3UR8A 1PL9A 2NX3A 3GFXA 5EA9A 3DFHA 3A4AA 2OWXA 4H1ZA 3K1DA 3WBYA 5LHEA 1UBSA 3DFYA 5KZ6A 1FDJA 4QFUA 1FWDC 3GDRA 3VKJA 3W1PA 3W01A 1JXKA 1TPVA 2CW6A 5JBDA 3G1DA 2WMIA 4ICCX 3LSBA 3R6IA 2X1SA 4YTSA 2IKJA 2OU4A 4MHBA 2V5LA 1L6GA 3T4WA 4Y2WA 3KRZA 2PCQA 3UESA 2BX7A 2XIIA 2Z2UA 3R12A 1Q66A 1KFJA 2DDXA 4G6CA 3HTWA 3LHVA 1V6YA 3UP8A 2ZA3A 4HZ8A 4IX2A 2TODA 1CGTA 1F76A 4AEFA 3SB0A 4AIBA 3QR3A 1TPUA 2I16A 3EWCA 4S2CA 5A6BA 3W07A 1V5XA 2OWWA 3IS4A 4G7EB 3WF0A 3NSNA 3L66A 3E2RA 4AVFA 3GNPA 3A13A 3N04A 4IMFA 4AC1X 1TJPA 2NLYA 3WJWA 4US6A 5AB3A 4IMDA 4IIDA 5T91A 1XG4A 1FWJC 1W9UA 3DFSA 2VUNA 4HHLA 1KV8A 3OZPA 3VILA 3W02A 4DJDD 3VIFA 1XDMA 2ACUA 3P82A 1OIFA 2PF8A 3B9OA 2VC9A 2VUYA 3OIXA 2CNCA 3HPFA 2QLYA 1XDLA 3DHFA 2TSYA 4WSHA 5M3WA 3MKKA 3W24A 3MW7A 4L4PA 5FF4A 4JTRA 2ALRA 1Q7ZA 3SUSA 4NZJA 4QNWA 2QV4A 2NVAA 3KZPA 3T78A 2IXUA 4Q8QA 1GYLA 3LBMA 4WKHA 3SFWA 1EA0A 4DJED 4JTSA 4P8XA 2D2HA 1DORA 4MJZA 5DY2A 4O1DA 3FYYA 1XLAA 3M43A 2C3ZA 5GVJA 3S8HA 1MSSA 4GYJA 4NJJA 5DCBA 7TIMA 3OU8A 1LUCA 5EMYA 4KEZA 2PTDA 2DPEA 4QG9A 1TVPA 5CBIA 3RNDA 3BQ5A 5I3HA 1SO5A 1KRCC 3PUDA 4V1YA 4XZIA 2FKPA 3D3FA 4UTLA 1UW9A 4RZ4A 3R7MA 3QZEA 2YYTA 1FWIC 3EMQA 4RL3A 1W1B1 1W2VA 4K8HA 5TD4A 1WX0A 3TUUA 2DW6A 2CKSA 4WX2A 2P5NA 4B9YA 1C7TA 3QPZA 4C7DA 2QZRA 3TROA 3P60A 3HG5A 2YDAA 1DWAM 4ORIA 1V03A 4GBUA 1RJRA 2VC7A 2G8ZA 3LMZA 4NILA 1TPB1 2OO6A 4URIA 1TUXA 1QU4A 3I3DA 4AXNA 1GW9A 2ZVIA 5D9PA 3RLGA 2OXNA 4XZNX 2V82A 1DJWA 1EO7A 4IMGA 2PTWA 3YPIA 4L56A 2A1YA 4EP8C 1TJRA 3KS6A 3RR4A 3EX3A 1UD4A 2PDCA 3VKAA 2ZXAA 4KS0A 1C8VA 4AX6A 5A8NA 2E68A 2XGZA 3UZWA 1IHIA 2PBOA 2JBMA 1B5TA 4FS9A 3E12A 3F2BA 3RPTA 4C7GA 2FVLA 2YFOA 3HPXA 2Q8ZA 3L2LA 3WLKX 3RCMA 4LAZA 4IL2A 3NPUA 4D6HA 1HN1A 5FSEC 2GJLA 3G8RA 4IZGA 3GX9A 1TB3A 3P8IA 1OG6A 1Q6EA 3OODA 1UZ4A 4U28A 1OJXA 1ZUAX 4S1FA 3C2OA 3W00A 4ZGYA 2OOGA 1ZZMA 1X6LA 1XBZA 4U5IA 5DMNA 4WZHA 2WZEA 2BP1A 3IGHX 3BJSA 1VRXA 1A5KC 3EWXA 4A35A 1OWQA 5HWMA 3WD3A 1QR7A 3AHTA 1PKLA 5A6KA 3OGRA 3VU2A 3PG9A 1FY6A 3W82A 8CGTA 3CIWA 3ITLA 1LG1A 5XIAA 4O15A 4ECLA 3RLVA 1E72M 4JFSA 4PEKA 5CC7A 4KCTA 3PBGA 4C6CA 4O19A 3NYZA 4HNUA 1IYXA 1LLOA 4C6EA 3WG6A 4LTSA 2UY4A 3TTOA 4DBWA 2CLKA 2C7FA 4IT1A 3ES7A 5CAKA 3H4WA 4Z1DA 4LVFA 1POKA 4H00A 3IIPA 5G4WA 3ALGA 3O9NA 1KRMA 3UD6A 3HURA 3B0UX 2YCEA 3ZWSA 3TK7A 2C14A 5EYWA 2DT1A 3N9RA 1XCFA 3EDEA 3UGVA 3NM3A 1R3VA 3B8IA 3QPYA 4EPDC 1SO3A 1GPFA 1GJPA 4CGTA 4ZXLA 4JFUA 1NFBA 3NDZA 1H7NA 3WIJA 1FFQA 1SPQA 3GQYA 4Q8VA 4DXVA 1T6MA 3C2YA 4PH6A 3PWGA 3GYEA 3IJ8A 1ZNNA 2YFNA 3ORWA 2DZBA 5HPCA 4X0NA 5D03A 1J11A 3I3EA 2KAUC 3LGGA 2W5FA 4AWEA 4J28A 2C15A 5C7HA 3FAWA 4MLRA 2HK0A 1OG0A 4B91A 3W0KA 3VDBA 3SCTA 1H62A 4PMOA 3RX3A 3STGA 3SUTA 2UY3A 4UOZA 1UR1A 4H04A 3DFTA 3TP4A 1SQ7A 1KC7A 4KIEA 5F2IA 3SCNA 2PTYA 1XDJA 4HPJA 3E0VA 1TPC1 3UWZA 1F8IA 3NO1A 1B3OA 1P4CA 1ZQ5A 4CN6A 2QULA 5BOEA 4H8NA 5DXYA 2VDGA 1W31A 5B7ZA 4O8AA 1KFWA 4DBEA 3PB0A 2ZDRA 1UQZA 3FFSA 2PC4A 1E3XA 2IKHA 2QAFA 1N7KA 2A6NA 1HP5A 2PDQA 2WM1A 3GR4A 1W3JA 3RXZA 1QI0A 4RLIA 1CGYA 4XD3A 4F3HA 4AEEA 2PGEA 4H9UA 2R1MA 4MDPA 4AH7A 4MGGA 1GVQA 3B03A 2BVWA 3KBNA 2Y6ZA 3G1AA 2QF8A 2TAAA 3S3GA 4DELA 2DSKA 3U8GA 1CLVA 1WAWA 4LVGA 4QJ4B 1VBUA 2R91A 1YKWA 2YSWA 2BGQA 2ZTKA 4EAYA 3AOFA 5DANA 4L1WA 4Y7EA 3QW4B 3VKBA 5A6AA 2INZA 1XWYA 3TYCA 3TTEA 1TJ2A 1VP5A 4DO7A 4ZOAA 4WDWA 3ZT5A 1O5KA 4IQEA 4NI8A 5K4XA 1F6YA 3AU2A 3CT2A 1NWSA 4XG1A 2ZUMA 2VWSA 2HPIA 1WV2A 4DUVA 3W29A 4OGZA 2J7DA 1DKWA 1SR9A 2R1NA 5I2UA 3CZKA 3WELA 3P0WA 4AY7A 3BK0A 1EDQA 5FD0A 3EA1A 5ABGA 3EWDA 2CLFA 1UKSA 2PWFA 4UCFA 3EZ4A 4NAEB 2Z28A 1GW1A 3TEVA 4LB3A 2DW7A 1SZEA 3QMSA 4JKKA 3GAYA 3SCVA 3VFCA 2OTDA 1R3YA 2Z0IA 3RU6A 4LNYA 3CH0A 4X9YA 3SRKA 4HYVA 5GJPA 4FIRA 4HK5A 5A2CA 1UD5A 3SY8A 2RJHA 4LSBA 4ATWA 4ES4A 2CFFA 1TCDA 4AWTA 1XBVA 1O1ZA 3P81A 1VLWA 5D38A 2BY3A 4JOMA 4W7VA 3THQA 2EPLX 1YADA 2CWXA 3FCPA 2CKRA 2V3EA 1R7AA 4PGLA 4JIIX 3UJRA 2EKCA 2FMOA 4PMJA 1HF6A 3HMJG 4ZCWA 3PHAA 4L6DA 3SRHA 3UG4A 3DFNA 3HQNA 4IGNA 3D46A 4GNKB 4ZR8A 4PMDA 1W5QA 2PD5A 1TTQA 1UBPC 3WH9A 2RAGA 3CWNA 2ASHA 1W8SA 3JVAA 5H6HA 2Q6ZA 4N9BA 4HU3A 4X60A 5TF0A 5I5RA 3S2MA 3P5ZA 3CAVA 3NDOA 4GCAA 4XBSA 4H6RA 1L6YA 3W72A 5HATA 4FB7A 1VYPX 3LERA 4IUGA 3TJ4A 2CERA 1E6QM 3LQLA 3IJLA 4O14A 3AS2A 4IFOA 3ZJ6A 3R43A 2Y1HA 4UFLA 4H6QA 1MYRA 3UXAA 1IXOA 2PRLA 4Q8NA 1FCQA 5JH1A 3CGTA 3VXGA 1YTKA 3LA4A 1JZ7A 4CN4A 2IPGA 4H7VA 2XISA 1O5RA 2OCZA 3KL5A 3GR8A 4GKLA 3P5YA 3I6TA 2PWDA 4MYXA 1S38A 4V33A 3SCOA 2IUZA 5CCZA 4EXQA 3MMTA 3CXOA 1E6ZA 1ODUA 5IBXA 4L6OA 2IPJA 4QROA 3ARTA 3W7KA 4CQAA 2CCRA 5CBJA 3CV7A 2WM0A 3RO8A 1A80A 2YA2A 3N6QA 3QHMA 5TAOA 1PVNA 5KITA 3B06A 3ARSA 2FPVA 2P3EA 2PDXA 3WQ4A 4Z42C 2AAAA 3ONBA 1EZWA 5HK4A 4Z2IA 3BLKA 3IJ7A 3BOLA 2ZRYA 3W87A 3MBFA 1W3TA 3CS2A 4CD5A 5G1MA 3ZQ9A 2D20A 5G1TA 4M1BA 4CCEA 3QY8A 4IM4A 3KBMA 3SCUA 5KZMA 1IZKA 1PYMA 4E2DA 4GC3A 2QCDA 3GRIA 2VVNA 4GUHA 1AFSA 3THCA 4DNHA 5HUOA 4AF0B 3H21A 2X41A 2RDXA 4DEFA 2VP8A 1R30A 4CNOA 2ZCGA 3WKZA 4YU1A 4C6QA 2C91A 2PDLA 5A6TC 2WNZA 1E4NA 3O6DA 3ZYZA 4QEHA 1XIEA 4ACZB 4AG0A 3BGJA 3FAXA 4GQBA 2OT1A 1KBIA 4NNCA 1JUKA 3H70A 3OZMA 2PP0A 3R89A 4IQDA 1W0MA 2XSBA 2JIWA 1E73M 4UWMA 3AUOA 2WVSA 4K6AA 3HG4A 3L68A 3FOKA 1SM9A 1M65A 5AHLA 2DT0A 3MA8A 3MUIA 2YR1A 4EF8A 1YQ2A 3K4WA 4H9YA 1JF6A 1VB9A 3SGZA 3NQGA 5DQPA 3QKEA 4MUPA 3GYCA 1P7TA 1K70A 2ZYFA 3F4DA 3MSYA 4QXIA 3USZA 5A8GA 4L65A 3M0IA 3MP3A 3RR1A 1HKKA 4ADTA 4ZO6A 1JDDA 1UROA 4Z2KA 3THAA 2BY2A 4ZFMA 3BH4A 4NXKA 1YHTA 3UXKA 1SZFA 2YXOA 3G1FA 3HPSA 4PCFA 1V3LA 2E77A 4GJ1A 2ZQ0A 5BZAA 3FXYA 3RPDA 1VCVA 3ZVHA 3O3RA 3WF3A 4Y90A 2BVYA 4IGSA 2HDJA 1ZBWA 4K1WA 3S9YA 1TKKA 3WUFA 3NXLA 2VFHA 5MKGB 1US3A 1KBJA 1RQBA 4C6KA 1Q6RA 2VMFA 4RDZA 1BRLA 3LOTA 5CH9A 2A5HA 4WHBA 1LBFA 4MAVA 5CGTA 2I14A 4I3GA 2VEGA 3B97A 1R8LA 3EYPA 4F4RA 3SM0A 4PUEA 2WLYA 2QCFA 2RGLA 3CB3A 3UR2A 3PAOA 3FGCA 1BKHA 4IX0A 3CEUA 4IGHA 3SIMA 1EEXA 1P43A 3W75A 1GZJA 4H8HA 1LBMA 3C0LA 3EXSA 3CHCA 1HKMA 2V2HA 2G3FA 3RAOA 1PKNA 2V38A 4L4OA 5D32A 2AAMA 3PZOA 1JPMA 3HJZA 1G4TA 1YE6A 1BWVA 2G3NA 1FWTA 4NI3A 1OEPA 3EEZA 3PG8A 3FJ4A 3BSHA 4FNUA 4GYFA 1EJRC 3EB2A 1QOXA 3CL6A 4KCUA 2AKMA 4LC6A 4RW5A 4GGBA 1LG2A 4WLCA 3WEMA 1QAPA 3CPGA 1BYAA 3TN3A 2G41A 4KWOA 3GFZA 2PDHA 1GEHA 3GG7A 1CCWB 4PEEA 1I2QA 4JYEA 4P2VA 4J5NA 4TVDA 2HV5A 1Q45A 4JIQA 4QIUA 1ZAJA 1T5AA 3OZOA 1E5NA 4E2BA 2A6LA 4LALA 1W9BM 4XAPA 4RJEA 2ZTJA 3KRSA 3OVQA 1WXYA 1LOQA 3M5VA 3PBMA 1E0WA 3N2TA 1BQCA 1PTGA 1HJWA 2RDUA 3DU0A 1UH2A 4HPNA 3JZEA 1QI3A 3DCPA 4J2MA 1YPXA 3R0DA 2PCEA 4AYSA 3VPLA 4V27A 4BQ2A 5A69A 3SECA 3JRKA 4HA0A 3VA8A 1TWWA 4Q8MA 1WZKA 1WOBA 4I8YA 4V28A 3BWWA 3E74A 3W27A 1RPXA 2BDQA 2YIHA 4JNMA 4JTFA 4KW2A 2QUUA 1XRSA 3URAA 4E4PA 2PWUA 3WQDA 5DXXA 3DAQA 5BXPA 1LL7A 5CLWA 1PYFA 1JQXA 2QCMA 9XIAA 1AUSL 3AS0A 1MMFA 5CPSA 3NSMA 3A23A 2W79A 3GKFA 1PHQA 2IPWA 4WOZA 4Z0SA 3KOZA 2DH3A 2OGYA 1H1ZA 4NX5A 3TKFA 2FTWA 4CQBA 2B7PA 5CXPA 1BXBA 4M80A 2ZRVA 2WPGA 1ISYA 5BOOA 2OSXA 2ACSA 2E5BA 1GT8A 2VCAA 4HMCA 3STPA 1I6NA 2CZEA 2AQWA 4JIEA 1BYDA 4DB7A 1VPYA 2D23A 4D6EA 1QFEA 2WMJA 3M7WA 3PC0A 2XSAA 4L9YA 3GDMA 1GOIA 3VX0A 3KCJA 3PBUA 5KZDA 1SFJA 4UC5A 4QS6A 4UR9A 3VDHA 3I68A 1QI4A 3HPAA 5BMXA 2VEMA 2B0MA 2VQTA 1R3WA 1LUCB 4AIEA 4H9VA 4OTKA 4U10A 5LZLA 4UMBA 5M17A 3VUPA 2V5JA 4R53A 4E3VA 3H4XA 4WSKA 1IXPA 1EZ2A 3L4WA 1MEIA 4RE3A 1DXFA 2D73A 2OT0A 4HSHA 2ZZ7A 4DBSA 4DWSD 5DEZA 2BASA 2EKGA 5DFAA 2C6QA 1DP0A 3R5EA 3WQVA 2ZUUA 2WMHA 1A4LA 1GJWA 2YCJA 1SFLA 1VPQA 2DT3A 2E67A 1W3LA 1ALDA 2WQDA 3GR7A 1Y5WA 2XFFA 5LIKX 2B31A 4DI9A 1MNSA 4HZ7A 3K2GA 5FL1A 1JZ4A 4B90A 4IJRA 4NZ4A 3W23A 3ZR4A 4C5YA 4UNIA 4M51A 3R0UA 4AZCA 3AZSA 4IF2A 3UU0A 4JL2A 4RE0A 2NXHA 1XKYA 5LNSA 3F4WA 3LEPA 3ME3A 3S1WA 1KR0A 2ZUWA 4HJFA 3V3WA 2EGZA 2YKKA 3LUTA 1UASA 1EF2A 5JH2A 3VKDA 2PDNA 2B7QA 1JRBA 4IICA 3PK7A 3W2UA 1YYAA 3FNDA 2VGFA 3TXVA 1T7LA 4ENLA 2CZVA 3QJAA 3PZTA 5DRCA 5C71A 2GOKA 3CAKA 1JNEA 3BOFA 3MC5A 4M81A 2OLSA 4RXGA 3P80A 4DZIA 3C8NA 3L4VA 4H6EA 2PRMA 4A3YA 1WKFA 1ICQA 1XLBA 4KRZA 2Y4SA 2ZZ2A 2DZWA 5GNYA 3JR2A 2X1RA 2FJKA 3JU2A 1XC6A 2GK1A 2V68A 2CWNA 2ZC1A 1QATA 2VD9A 1RP9A 3SY5A 1P0KA 3N18A 3GIYA 1JFXA 2WB5A 3M0HA 3NOEA 1FHDA 4S2BA 4XD5A 2QVHA 4P7OA 2QYGA 5D09A 1DQWA 5HMFA 1R3SA 1SVDA 2X16A 3UNTA 3FXGA 3MCMA 1UP3A 3UYCA 4O18A 1WA3A 2WHMA 2FMNA 5F4WA 1XKJA 4GVIA 4E2VA 4LBRA 1UKQA 5MF5A 4A3UA 4QCEA 2O7QA 1B3ZA 3DERA 5ENLA 1J0JA 3S6TA 3BZGA 4D8AA 1PZ1A 1EKOA 2OGJA 4TVUA 4QLJA 1MFUA 1H7PA 4W8LA 1K7XA 2WNNA 3WNMA 1LLWA 3T0AA 3GM8A 3H2CA 3TNBA 2J75A 3V35A 3GNOA 3NL5A 1A5AA 2WBKA 4HK7A 2VRKA 1V3IA 2QJNA 4DWDA 6TIMA 1B3YA 3WMSA 2GQ3A 3PBVA 4UTJA 1FH8A 3GVRA 3UG8A 2D2GA 1J5SA 3ATYA 5G2HA 5I02A 3MCOA 5D9NA 4O12A 1C8YA 3ZO9A 4IIBA 1EB3A 2VFIA 1PKMA 2VOTA 4KBXA 3M0KA 1TE6A 4RUBA 4Q4MA 5IFTA 3IVUA 2AOSA 3MMWA 1Z7AA 3B9DA 1IEIA 1MQPA 1I8JA 1QJWA 4TU1A 2PU0A 3ANUA 3P14A 1VIWA 4NZ1A 1ISZA 2NZLA 3VTRA 4JXCA 1Q2RA 1PE1A 2ZXBA 3T0TA 1PIFA 1HVXA 1H7WA 3TWAA 1H49A 2CZ5A 3PF3A 5HINA 3PAJA 1VJSA 1V51A 1S5TA 3FA3A 1A4MA 2EPNA 3TDFA 3C2VA 3KLLA 1I45A 1E6PA 5A3HA 1KNWA 3PJXA 1EH9A 1Z9AA 2DFAA 1M41A 1IE7C 1OYCA 1BKSA 3LNPA 3OVGA 1E5JA 2Q71A 3I4KA 3TJLA 3GXFA 3IPWA 1KXHA 1DHKA 5LKYA 1V6VA 3AU6A 3TCEA 4HTYA 2OEJA 1A3HA 2JKAA 4HSNA 2ZX6A 3VCRA 3BAIA 4GX8A 3MWCA 2J8TA 3I7QA 3EOLA 2OQLA 3EWUA 1DJGA 1FH7A 3FX4A 4GA8A 2QCLA 3ANYA 3K1GA 3PY2A 4H4IA 3GHRA 1S2WA 1Q6CA 3M0ZA 4DJDC 2A21A 3AIWA 1MRAA 1WDQA 2PWGA 4JTCA 1N82A 3ABSA 5I3IA 4FEZA 1EJTC 1YMYA 4UOQA 4WEVX 3UWVA 2IW0A 1IR1A 3QQWA 3NVDA 1EQPA 3V36A 4MJMA 3RJYA 1L9WA 2ZUSA 3SUUA 4LYKA 4CEXC 2Y5EA 1S3TC 4HNOA 2WHJA 2GJRA 3SBFA 4PUMA 3A21A 2V0TA 5FEXA 1JPKA 5AFDA 2P8BA 5EMLA 4GRSA 3LDVA 4O0KA 2ZX9A 3EXTA 1OCBA 2UY5A 3BGGA 4WXZA 4DJDA 1EIXA 3HGSA 1U5JA 1HFBA 2HVOA 3KOWA 3LZ5A 2FH6A 3L65A 2INFA 1XV8A 3U7BA 3WLIA 3ARPA 3H7RA 3F7JA 2AGTA 4B16A 2WMFA 3VI2A 1Z41A 4MNJA 4U2YA 5D33A 4NYUA 1CX9A 4LF1A 3B9NA 5FI8A 2G3MA 2PB1A 2H8ZA 3B8TA 3LRLA 1UUOA 3AXHA 1S2UA 4ATLA 3CHFA 4YCPA 3E0WA 2MANA 3VC5A 4NIRA 3T8QA 3WH8A 2GFTA 1KO0A 1AMKA 4LV4A 4P8VA 5A6SA 4CD6A 4Q6XA 1T41A 1T96A 3PZNA 1QBAA 2ABAA 2E6YA 4UXDA 3SN1A 1JZ8A 4IHCA 1OX4B 4DYJA 3MI3A 3HGRA 4JQAA 3PPHA 4PA8A 3SGGA 3VIMA 3L2MA 3KBSA 1SW3A 2VR4A 1PKYA 2GGJA 3FA5A 3LCGA 3A22A 2YW3A 5ABFA 1XYBA 3MO4A 5K9DA 5C54A 4AD3A 4AD4A 3SN4A 3NSXA 2CXEA 1FHUA 1J96A 1P6CA 1C9WA 1WZAA 3AMGA 5SWUA 4M7TA 2CLLA 2PGRA 5HANA 4WY0A 1ZFJA 2W9MA 2JF7A 3O0FA 1Q8JA 3FYOA 2Q02A 4CD4A 1K4GA 1B31A 2PGFA 4PULA 2FFCA 3ICJA 4GUFA 2Z7GA 3DFPA 3VCNA 4GLEA 4PCSA 2C71A 3DKLA 2PFHA 2X0HA 3UPMA 4FNQA 3OQEA 3LPPA 3H2NA 4DYEA 1OX6A 4ZZ9A 1EYEA 4UFIA 3GTXA 4RV8A 4LUTA 4PUNA 4IP4A 3W7RA 2BY0A 3FEMA 3TE9A 4OOZA 2QJIA 3ZLGA 2BFGA 3J7HA 1KFLA 4WY0F 1E0VA 4ICMA 5AZ1A 4H8VA 1GYNA 3IJ9A 3VABA 1S3HA 3RM4A 4MLJA 1O1HA 4H2HA 5D4YA 4H6KA 2GZXA 4IGMA 4JIRA 4U2ZA 4LPCA 2Z1WA 3UXDA 2ZE3A 3CUHA 1W3HA 2RGMA 3ZLHA 4MPKA 7ENLA 1YNYA 5RUBA 2A3BA 1S46A 4FR6A 3TZNA 9RUBA 4CD8A 4I9JA 4DAFA 1Q6DA 1VKFA 5KETA 2Z1KA 1GPWA 1TA3B 3FIGA 5CEWA 1Q85A 5FCZA 1VS1A 2FGBA 2J7CA 1NJJA 1SMAA 4IIHA 2OEKA 1EUAA 3ZM8A 1M7XA 3CU2A 3PPFA 1S2AA 5M1TA 5HJXA 3VOIA 3QOKA 1D2KA 4GOAA 4I7VA 3KOXA 4PTMA 1GKRA 1OGBA 1F8MA 1KCKA 2TRSA 5I6SA 3NQVA 4L6HA 4CNTA 1NARA 3DFOA 1FWAC 2GDQA 1TYGA 1X8CA 4M0XA 5HAOA 1U5VA 4PBGA 5JUVA 2QCDB 3GHUA 1ZJBA 3GDLA 2A3CA 4Q8TA 4XZWA 5XIMA 2BXZA 3VMNA 4F2BA 2A7RA 4NJIA 2YPIA 4E8DA 2PLMA 4HZ6A 4F0MA 4LOCA 1V93A 4N6EA 1PTAA 3PN8A 5EMJA 4J3UA 3ZXWA 2NW0A 3APYA 4P7QA 2PDUA 4AD5A 1IR2A 3UZ5A 3C8FA 1V0NA 4GBDA 3Q94A 1DV7A 1W9VA 3OA5A 3LHUA 1PSCA 1PDZA 3BAWA 3GG8A 3BC9A 5BU6A 5CJNA 1YNQA 4DPPA 3UZYA 2JF6A 1LJYA 3L4UA 3IANA 1J01A 3VOFA 4IFRA 3KP1A 3MY9A 6ALDA 2Y62A 3URNA 4DN1A 4XKMA 1A5MC 2EG7A 1CGVA 3V0SA 4XUYA 3MO7A 1A5BA 3FJNA 1ITQA 1U30A 1OY0A 3JW7A 2YB1A 1EC9A 5E0KA 1NY1A 1V3HA 5I24A 3L0KA 3FK4A 4ILSA 3Q45A 3DGRA 1LF1A 1E6RA 3BXWA 4ML9A 3F4CA 3SQLA 3XISA 3PB2A 1I1XA 3MUXA 1G9HA 1TZ7A 1P7TB 1W3NA 4NRSA 4W5ZA 2W6RA 5H2ZA 4G5DA 2C8NA 1OZMA 5I3KA 3U5UA 2Y61A 1UMLA 4G9PA 2XWEA 3CIVA 2W61A 5REQA 2J74A 1CDGA 3S1GA 1CWYA 3ES8A 2XIBA 5LHFA 1FCVA 1XINA 2RJGA 3SUWA 3H24A 5CSSA 4EX4A 1KM1A 4MFDA 3ZVHB 3EMCA 1QWKA 5EU9A 3M7SA 1A5OC 3WSUA 4EPBC 4Z2HA 4X22A 4MY9A 1FWHC 3NCOA 1I4NA 4PBEA 4DXXA 3N34A 4OU1A 1GQJA 1BRLB 4H83A 1AH4A 3AYSA 3G22A 3NWRA 4AZ5A 4LAOA 1XD0A 3IAQA 3N2CA 1KTNA 2BNJA 1G7VA 4E4UA 3R25A 5BXRA 1V7AA 1ECQA 3ZT6A 1QO5A 3FGCB 1OCJA 3PS7A 1FVPA 4F8XA 1LRTA 3SR7A 3NQMA 4A3QA 1GVOA 3FHAA 3RLUA 5FF0A 3UJFA 4DUWA 3USBA 4WSJA 3AAMA 2VFDA 2VDHA 1PIIA 4M3PA 1IIGA 3I7SA 4DO6A 1DWJM 3EMZA 3EWBX 3BJFA 5FIPA 3VIHA 1A3WA 4UTTC 4KF1A 2E3ZA 1L0PA 3UF9A 4P8UA 2VR2A 4HU0A 3WDPP 4HOWA 4AHPA 1V02A 3BG9A 1C9DA 4LX4A 4W4QA 1XIMA 2F6XA 4C65A 1TIMA 1KR1A 2VC5A 4S3KA 3L23A 4HGXA 1U1UA 1HKVA 2C79A 2YCLA 4LYPA 2OG9A 1DIKA 3DYMA 4JN8A 1E40A 4Z2GA 3OB8A 4GI9A 4I6KA 3KZSA 3PNZA 3LX9A 5I0DA 3WLHA 2PC8A 1M9HA 4JTGA 3SEPA 3WMLA 3EA3A 4NZ3A 5B80A 5KSWA 2QGHA 3WK1A 1A0EA 3RU8X 2V9DA 3N2MA 1JCLA 4UTTA 3QH2A 1O68A 1SU5A 3MSGA 4G7FA 1NWRA 4Q7BA 3G0SA 2EXOA 4Y8EA 9XIMA 3N3TA 4NZCA 3WLNA 3DDMA 2ZRWA 3NUKA 3HV8A 2ZZ4A 3R79A 1I1WA 2FHCA 2WSYA 5BYWA 1OT2A 4PBFA 1IEXA 1GORA 2XH4A 5HNTA 5AKQA 2XH7A 3HM7A 4FZIA 3WQFA 1I0BA 1QPOA 1WDDA 4FSAA 2Z1XA 3WO8A 3APTA 1UC4A 4RE2A 5AZ0A 1V4YA 3N1AA 5BW6A 1F61A 3N6HA 1DWGM 5LIUX 1M6JA 2WQPA 2XZ9A 1TWSA 3MS8A 3NGFA 1H60A 4XD6A 4HB7A 2ZX8A 1LORA 4O1CA 3F03K 5A2BA 3TQKA 3G5EA 3TTYA 5CLTA 4Q8WA 1TREA 1A53A 2YL8A 3B3DA 5CG7A 1TMLA 2DJXA 2OKTA 3GXMA 4CCZA 2PEVA 4PFMA 1OGGA 2BOGX 1UB3A 3NPVA 1D7FA 4LRTA 4WJ8A 3KDOA 1T40A 1F73A 1RA5A 4PMNA 3VGFA 3V16A 4G8TA 2VT0A 4XIMA 2J7HA 1V6WA 3IGXA 2XSXA 4K7VA 2F8QA 1QBBA 3U57A 3U3HA 2WAGA 1VFSA 3R2GA 4ZL1A 5T26A 1V08A 4UTHA 1MNZA 3NPXA 3NOYA 1SO6A 3F5LA 1PX8A 4QE4A 1N8FA 4L9XA 3PWAA 3DEQA 3BW3A 1V6TA 3L7RA 2Y85A 2RFGA 3F2DA 2PDBA 4M82A 2VFEA 3MV01 5HMSA 1RBOB 4ERAA 3CIXA 8XIMA 1XLDA 1OM0A 4X0VA 4TR9A 4HPHA 3PUOA 2PDYA 1CXHA 3VM5A 1KKRA 3WCZA 3DN5A 4WIWA 1RSCA 1R5YA 2PE4A 1WDWA 1F4AA 4BI5A 1HKJA 1MUMA 1LT7A 1CXEA 1HJXA 4US5A 1SZGA 3S47A 3RGTA 4NNBA 3EWYA 4C6LA 4HPXA 3VOGA 3LLXA 2XIQA 3IACA 4FPSA 2W91A 1XHGA 3GXDA 2FZ9A 2A3EA 1I2RA 1RH9A 4I9MA 4DF1A 1XLFA 2CLPA 3M0VA 4BI6A 3DBPA 4AZCB 1OC7A 1KWGA 3TC7A 3IUIA 4N6FA 4Y9OA 2QPUA 3UWYA 1QW8A 3NQFA 1XIBA 4P8WA 4HA3A 1E70M 4GQ0A 4PTVA 5A6LA 2JGYA 1C8QA 1E43A 1GHRA 2QUVA 2X09A 3LGDA 2NXGA 2X1IA 2E8YA 2J66A 3HOJA 5F4XA 3GWQA 2I17A 3HIJA 5AHNA 3R13A 1OGSA 3H7VA 4IPNB 1XUZA 5C6MA 4WK9A 1NDVA 1EBHA 1H7XA 3OG2A 3TAOA 2PZNA 4TV5A 3TAKA 1RY0A 2A3HA 4MADA 3OYXA 1FA2A 2G4FA 3TR2A 3ONCA 3SADA 3PPGA 4QRNA 3ARYA 3MQTA 3UGRA 3TWBA 2ZZ3A 2GQAA 3RRXA 4S3GA 3PJTA 1VEMA 1D8WA 1EC7A 3HQOA 2GK1B 4DZ5A 3VNLA 2VL4A 1ICSA 3LLDA 2GJNA 4KEMA 3IJDA 2B7NA 4LEQA 3OBEA 4CEUC 1IZJA 1SR0A 1SW7A 1XLIA 3KOYA 3L4XA 3WH6A 3CV6A 5G2IA 1V02E 5GJMA 3U4FA 1ZENA 3LG3A 1KRAC 1XIIA 3IRSA 5K3VA 1KCZA 2CLMA 2Y0FA 1Z44A 3PANA 4B5TA 3SO7A 4JKMA 3AXKA 5D2TA 1NTHA 3IUHA 4KT2A 4PUDA 1H2JA 6A3HA 4GG9A 1BD0A 2ZX7A 1QASA 2QPXA 3HG3A 4C6OA 2E7FA 4R88A 5LNRA 4FF7A 2WSRA 3R8GA 1SJAA 1EJ7L 2VEIA 3BOXA 4WKAA 3NA8A 4CVUA 3GY1A 3R1ZA 6XIMA 1PJ9A 1GOMA 2VRJA 1OX5A 3FA4A 4WRHA 2A2IA 2VZTA 1KCXA 2XM2A 2FZMA 1GKQA 1UR2A 5HBFA 3R94A 3VGBA 2VD8A 1DJYA 1O5QA 1NQ6A 2JIEA 2PODA 1TR1A 4B5UA 1HX0A 3SGUA 4PCPA 3P6LA 3BLEA 3CNYA 4XBKA 1SSDA 2YZRA 4P5UA 3ZIZA 4PC8A 1O6IA 1WDRA 3U2ZA 3LTSA 4ZO7A 3P3BA 1PX3A 3LI0A 3C4UA 4X2PA 2NUYA 1QNPA 2QDDA 3NM1A 2J6XA 3N25A 1D9EA 4DYKA 4ATDA 1XCXA 3TXZA 4Q4SA 3UY7A 3DI0A 1UR8A 1NF0A 2XJ7A 4GD0A 5D2VA 1P0EA 1H51A 1UG6A 2D22A 4LEFA 2ACRA 3TYBA 5FOOA 1SYTA 3CQIA 3O6CA 3C56A 1V0MA 1UQYA 1QHOA 4JQ3A 1UKOA 5CSYA 3WNOA 1MWOA 4DZAA 3L4TA 2Z1VA 3QOMA 4QISA 4F9DA 1REQB 2GWNA 3PPCA 4FI4A 4JYFA 1TO3A 4CQDA 1EWEA 3P67A 3IK2A 1W54A 1ZPTA 2I9EA 3PZIA 3W53A 4RW3A 3FS2A 3AICA 4D9PA 1HO4A 5AC5A 1OF8A 2R1PA 3ARUA 1IGSA 4FO4A 1AH3A 2JKPA 1U1JA 1K8CA 4XKYA 1TV2A 1FHVA 2J47A 4B9ZA 4LWWA 4XAZA 2J13A 2SFPA 5A6BD 4UFJA 1T0OA 3IJQA 5A8QA 3KVLA 1JR1A 3ZOAA 3A24A 1AL7A 2GQ9A 2IKIA 4Z1AA 1IQ8A 1K02A 5DY3A 1OK4A 2WZTA 3K46A 1FWWA 1HJSA 1XLHA 3TQ0A 4JBRA 4KCWA 1F6PA 3G1SA 2GGHA 3VD4A 4M5PA 4IP5A 2F2KA 3I4EA 4A8NA 3O15A 2VEFA 2DZVA 2JKEA 3W86A 1TSIA 4JTLA 5CZ0A 4AB4A 3ARVA 4JYDA 1EPXA 2Z7KA 2FQIA 4LS0A 2CHRA 3GDKA 5I7GA 3W84A 2D2JA 1J8VA 3DG7A 2CLOA 3KDNA 1K8YA 1LWIA 3M41A 3MI6A 4XAGA 3RX4A 3CZGA 1M7OA 1LWJA 3TONA 1E56A 1V0LA 1OCQA 2W66A 1W3KA 1E71M 1H0IA 3N9KA 1IV8A 5FJOA 1RLDA 1NOFA 3CV1A 5BOFA 1PO9A 3EPNA 1BYBA 3UZZA 2DORA 4GWEA 1XUUA 4WF7A 4PZVA 5KINA 3FW6A 4NYYA 6ENLA 1IEWA 4IIEA 2CEQA 4PMUA 4G2DA 3MDUA 2JK2A 4J35A 1YNPA 4YTUA 4ACZA 3DOPA 1TCMA 4DJFD 5D9OA 1XLEA 1VFOA 4GZJA 3NZPA 4KQNA 3W81A 1X7FA 2P10A 5AVHA 1EFZA 1S39A 4AWSA 1Q13A 3MHGA 1VFTA 4NZFA 2GPTA 2XH0A 2Y8KA 1A47A 2PDWA 4LRSA 1P6WA 1Q6FA 2QGYA 1BHGA 3W25A 1IEVA 5C9XA 4M29A 1DL3A 1XIHA 1I2PA 4LAKA 1OF6A 1EX5A 1UA7A 3EKLA 3VZZA 3C0SA 3BLPX 4REQA 1TJ0A 1JZ5A 4LFYA 1NSJA 1FWEC 1HZYA 4H7CA 4HU8A 1XQKA 3GE7A 5ABFB 3P8JA 3N4EA 2AL2A 4CCDA 2PWHA 2HBXA 3OEXA 5ABHA 5I3JA 3W7EA 3NZRA 1G4PA 2GL5A 3MPGA 1KV5A 3GXNA 3VNJA 4OQVA 3W71A 2XUCA 1ZGDA 3H2MA 4UCGA 5GJNA 4WY0B 2J7FA 3GIQA 3STCA 1IWAA 2PAJA 4Q8PA 3O16A 4IXHA 4J3VA 3PTKA 4ZQPA 2WWDA 2FVKA 4RNIA 3MB9A 1OCNA 4B5WA 3W2NA 4QE1A 4AAJA 4F0LA 1OIMA 2OODA 1AVAA 4F40A 1EBGA 3VDCA 7ODCA 1GQNA 3VKCA 4E6MA 4WCJA 1OABA 1UUQA 4P61A 5C2XA 3RM9A 4QAWA 5EMUA 3SCWA 4HYRA 4ZQCA 1V77A 1JAKA 3EXRA 1UA3A 3HGJA 5DBUA 4LUTB 2XU2A 4I7UA 1UD2A 3HFTA 3BLOA 4QX4A 2VOMA 2A3LA 4Q22A 4RZBA 2Q09A 1CB2A 4DLFA 3DFQA 3S4TA 1BGGA 3DECA 3W1UA 3AHZA 3NTYA 3XIMA 4MM1A 3VC6A 4NXSA 3GS6A 4CU7A 1F6KA 2MUCA 1EJVC 3T44A 4WOQA 1R87A 3ZWTA 2VJXA 2KZHA 1O7AA 5BXSA 2H8XA 3CQHA 3OZYA 4G1KA 4ZQNA 3TSMA 1MXSA 2I56A 5E6YA 1F3EA 2XFRA 4AEOA 3HBLA 1QMLA 4NG3A 4JDYA 2GVGA 3ECQA 1H41A 1YBQA 4JN6A 5D9MA 4H41A 2INEA 1QPNA 2WC7A 3QY7A 4I5RA 4AX7A 2HK1A 1C93A 4ZOEA 3LTYA 3IAPA 4QSHA 1UWTA 5D04C 2H3BA 2XHYA 2HQAA 4GFSA 1JZ3A 1OHLA 3CT7A 4FHAA 2BODX 5BXTA 2F9RA 4UTFA 1TMQA 1S1PA 2WVVA 1DJHA 3HJEA 1P5BA 1H7OA 1K7FA 3CMFA 2F6UA 1TV8A 1N55A 1W5MA 3DC0A 5EBAA 4GI6A 3L67A 2PDMA 2QV5A 3CK5A 1W91A 1ECEA 1X1ZA 2O9TA 4HPGA 2G50A 4F0KA 1MXDA 3NQ7A 4MDOA 4EAMA 4GH1A 1XJBA 4MTVA 4AW7A 4GKTA 3AROA 2PWVA 4F2UA 1LQAA 4ZQOA 4KERA 1PWMA 2TMDA 1W1ZA 2PPGA 3VIJA 1WE5A 1JI2A 3OW1A 1FWGC 1UD3A 1VHNA 4EVZA 3QGAC 2GQ8A 1TWDA 1E15A 1WXZA 1PIGA 1G7UA 2D3NA 5HA7A 4K7YA 5DBTA 1W1YA 2EPHA 3WLTA 1BG9A 1E4IA 3S1VA 4FLOA 1JDFA 3KTCA 4PMZA 3W2LA 3NVTA 4MPQA 2DVTA 1DIOA 3QLLA 3CO4A 1KFCA 3ZLFA 3S5ZA 3V0UA 4CVWA 1IT8A 4Y6GA 4QJ5B 2B81A 2IQTA 3T09A 2XGIA 3G1VA 1XF0A 1QW7A 2FLIA 2D69A 4MJ2A 5CZTA 4BCEA 2CESA 4PODA 4U4MA 1C92A 1J93A 4S3CA 4HN8A 4LANA 1EP2A 3BMVA 1M7JA 4S3JA 3WD0A 2YB4A 1AMYA 4L9ZA 2EG6A 4DIAA 2NV1A 3I7RA 3TX9A 1H61A 5CPLA 7TAAA 1C91A 3G18A 3MBDA 3LPOA 5AC4A 3QVQA 3S2LA 5DELA 3N14A 3BCDA 5REQB 2UY2A 2QIIA 2X0SA 1J12A 1VR6A 3CHDA 4D8LA 2E8ZA 4LS2A 3N13A 3P62A 2XVPA 4GIAA 1GOXA 3H2EA 5FL0A 5I00A 2G97A 1H50A 3CTLA 3EDDA 3WL1A 2ZADA 4Z1CA 1KM2A 3AHVA 1HQTA 1JCMP 3FY1A 3UCQA 3N19B 3W2MA 1M01A 4QG6A 1WZLA 3E38A 3IVTA 1XRTA 1Y7VA 5C7VA 3LB0A 4B5VA 5EY5A 2CLIA 3NZGA 3GBDA 3GNNA 1A5NC 1W1TA 4KRUA 2ZRXA 3VGDA 2Y70A 3TFXA 5I07A 1GHSA 4ZFCA 3H12A 3KBWA 5I78A 3LM7A 2BXYA 2BGSA 1PB0A 4AZBA 3L0GA 3O0KA 3S1XA 3IIXA 4BKNA 4YHEA 4PL1A 2A7NA 2F38A 1SUXA 4Q4OA 2DIKA 5A5WA 3AMCA 2QPSA 4JHOA 4LS1A 3E49A 2BOFX 1QVBA 3S0CA 1F3XA 1P0DA 3IIZA 5EB8A 2WZHA 1MW2A 4D71A 4W86A 1LL4A 2HPMA 4U31A 3ARZA 1LL6A 3IK4A 4GVFA 1NELA 3W7NA 1QDSA 3EOUA 4WJXA 3LS9A 2DSZA 1QPQA 1B0IA 5AYBA 5XINA 3PFMA 3B9AA 4S3EA 4ZO9A 1H5YA 1Y65A 2YCLB 2DZUA 3R58A 2GVYA 2NWSA 4JY9A 4AMAA 4C5ZA 1S2TA 3R8RA 3MZNA 1XP3A 2XYLA 1JVNA 5MHBA 3QQ1A 1FQ0A 4IUOA 1F05A 4GE8A 2VEPA 2OLHA 1G0CA 1VPXA 3UY8A 3W26A 4QHRA 3ZS4A 4TIMA 1V3KA 4YTTA 2G0WA 5IHRA 1EOKA 4GQRA 4DQWA 1XGEA 5FJPA 1B9ZA 1XQLA 5LSMA 1X38A 1U33A 4A2RA 3TCSA 1FFRA 3LHWA 3AXXA 4HA1A 3VD9A 3GU2A 3MI2A 5T8GA 1PEZA 3WNPA 1OBAA 4XISA 4TX8A 4DLMA 5JIWA 3BE7A 2DZTA 3NL6A 3H22A 5C70A 3G1XA 3VIKA 2P0OA 4B92A 3GNRA 3RRAA 3IV8A 1W1A1 2J8GA 4BF5A 4CCCA 1FDYA 1NOWA 1R6WA 1EPVA 5T9BG 2VKZG 5A8MA 4FF5A 1O60A 3EX4A 3MVTA 1F9CA 1IXNA 4O0ZA 3O6AA 1RVKA 3LXBA 1W1PA 1GGOA 4MFEA 5DMLA 1W37A 5DLCA 5DT5A 3LRKA 1F5ZA 2OPJA 4XZMX 1KBBA 1J2WA 3VGEA 4IPIA 5H91A 3H54A 3NGJA 5CQ1A 3ENLA 3SUVA 2VI0A 4QDPA 3B0VC 1RBLA 3ABXA 2E28A 4IH3A 2QJMA 3TNOA 2BS9A 4DBDA 4GXMA 2PD9A 2CYGA 4MWAC 5DCEA 3E1F1 4LAUA 1YLVA 3H26A 1X6NA 4JNYA 1XYCA 5DX7A 3BV7A 3BLDA 2FZBA 3WUGA 2WZMA 3VK5A 4Y9MA 4J3XA 1ME8A 3WH7A 2Q3RA 3L5MA 4KWSA 4DRSA 3NQCA 2DJLA 5EL1A 3G3DA 3WLOA 1H4PA 1VFMA 5U7SA 3VNKA 4MNMA 3L0NA 1JGMA 3TMLA 2HCVA 2G3JA 3FJ6A 4GXPA 5J8LA 4JTTA 4D1IA 4R33A 3VIPA 3PULA 4GUJA 2VDIA 1OYAA 2QT3A 3TLQA 3OQ8A 2PDJA 2G37A 4MWAA 3E2VA 1EA9C 3WDQA 4RDWA 1US0A 2RUSA 3BANA 1X6UA 4S3FA 2HXTA 1MUWA 3GH4A 3UG3A 4HMNA 1Y5VA 4KEUA 4UQCA 5F2LA 3V5OA 1W9DM 1JUEA 4A4AA 2V63A 3T2PA 2OFJA 4LAMA 3SJ3A 4DVOA 2ZA2A 3AFBA 4C6IA 5LGXA 2AQVA 4FXFA 3GTHA 3WNLA 3CASA 1UMYA 3G3MA 1GOWA 3W1NA 2PBGA 1OVDA 4GIYA 5ABEA 1F7BA 4XK2A 4YXGA 1FWRA 4GQGA 1OK6A 2Z4GA 3W7OA 4H7ZA 4UTIA 2CU0A 3A9IA 1BWKA 4GNJA 3VCCA 5FJIA 3U4AA 2H90A 3S83A 2YDQA 3BURA 4S38A 4MY8A 3NL3A 1L2QA 2XN2A 1XRFA 1X97A 3RCNA 4B15A 1UKPA 4B2DA 1Q6GA 4HNCA 3BL3A 3AZTA 3GC2A 4B5SA 3B8SA 2IMRA 5A2AA 5TQLA 3S5SA 1JEZA 3RO6A 4IISA 3BAJA 3IGSA 2VCBA 3GHSA 4ACYA 3LXAA 3AIQA 5FJJA 4HT3A 2W4XA 2GSEA 4NQ1A 3V7PA 4YCOA 3RX2A 3BW4A 3S2NA 3VNDA 1TELA