2R8WA

The crystal structure of dihydrodipicolinate synthase (atu0899) from agrobacterium tumefaciens str. c58
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
297
structure length
297
Chain Sequence
DMATRFKGLSAFPITPADEAGRVDIEAFSALIARLDAAEVDSVGILGSTGIYMYLTREERRRAIEAAATILRGRRTLMAGIGALRTDEAVALAKDAEAAGADALLLAPVSYTPLTQEEAYHHFAAVAGATALPLAIYNNPTTTRFTFSDELLVRLAYIPNIRAIKMPLPADADYAGELARLRPKLSDDFAIGYSGDWGCTDATLAGGDTWYSVVAGLLPVPALQLMRAAQAGNAEEAKRLDATFQPLWALFKEFGSIRVIYAAANILSLTVSEPPRPILPLTSAERQRVEEALEALS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of dihydrodipicolinate synthase (Atu0899) from Agrobacterium tumefaciens str. C58.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Lyase
molecule keywords AGR_C_1641p
total genus 104
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2r8wA00
1Q3NA 3DH7A 3WFAA 4RKAA 4AB4A 3OVPA 4LUIA 5LHFA 5I3GA 1G69A 3S1XA 2WSQA 5C2XA 4HNNA 1VC4A 3BV4A 3PBWA 1L2UA 1TPC1 4UFMA 1GTEA 4FNTA 1YDOA 2RH9A 3LHWA 3TU9A 4K38A 3NQ6A 3L68A 3B4UA 2ALDA 3G1FA 2E09A 3FYPA 4JDYA 1LORA 1LOLA 4M6QA 3HGSA 3KVJA 5DCEA 1FXPA 3TJXA 1HL2A 4C1KA 4XWUA 1LDCA 1G6CA 1QDSA 2JGYA 2CLIA 4CNNA 2PE4A 1O4UA 3UQNA 1H61A 3DFTA 1A5CA 3BO9A 1DJQA 5SWUA 2WSRA 1PV8A 3DI0A 1TTIA 3UWUA 1PHWA 1SZGA 3DZ1A 1O5KA 2YX0A 4Q32A 5D37A 4Y90A 3PB0A 4MY9A 5D09A 5LZLA 1A50A 2NXHA 2QCEA 3W86A 2Y63A 3O6CA 2BX7A 4O1BA 3STEA 4FF7A 1UB3A 2DJLA 4LS2A 2NLIA 2ZBTA 4N9DA 3W2UA 2E6FA 1OVDA 1FQ0A 1R46A 4NT0A 1KLYA 5C54A 3LBCA 5EKYA 1VH7A 1HG3A 2FB3A 5LGXA 4O10A 3JRKA 3WJXA 1H7OA 3P82A 3B05A 3L5AA 1X7FA 3P8JA 4HHPA 4BWLC 2ZZ6A 2TRSA 4R7JA 2CFFA 2C19A 1ZY9A 1GG0A 1KM6A 1W5QA 3TA6A 3Q37A 1VLIA 2Y62A 3NZ1A 4LTSA 5D2YA 3USBA 1VLWA 1S3HA 3TSMA 4RZ6A 5AHMA 1K7XA 5DELA 4BI6A 1NVMA 1DV7A 1IXQA 3M44A 4K6AA 2BSLA 1VS1A 2G97A 2QAFA 3W2KA 2V2CA 2YCEA 1JULA 3B0PA 4HSNA 3RLVA 1OFBA 3FEMA 3LRLA 4UNKA 3STCA 1KM1A 1SSGA 2GUUA 3GDLA 5H91A 1X8FA 4OE7A 3DGRA 3GR7A 1K8ZA 3UNDA 1YPIA 5G5IA 1T8XA 3W2JA 3M5XA 4UFIA 4ADUA 1ME9A 1ZAJA 2X1RA 3W7MA 4FNUA 1G4SA 3QYQA 1F76A 2FLIA 3A9IA 3HIJA 4X3ZA 2VEKA 3IIXA 2JGQA 3W73A 2CLHA 3LHUA 3W7GA 5K3VA 1C9DA 4XTIA 1SFJA 3U8GA 5K7JA 3LCWA 1KA9F 3TDFA 3W7HA 3LERA 4FEZA 4UTTC 1XFBA 2NX9A 1TREA 2BLEA 1BTMA 3ABSA 4MZ1A 1M7OA 4A2SA 3W7OA 4W9TA 3W7JA 4MFEA 3KRSA 4DO6A 3S9YA 4ZMGA 2FQIA 3EXSA 4O1CA 2OZ0A 5J5RA 4E2DA 1EUNA 3LRKA 3NQFA 4PFMA 2A7RA 3TROA 3W7CA 5ABTA 4LU0A 3WJYA 1VZWA 2RHGA 4ADSA 1GQNA 3TCEA 1QO5A 3LCXA 1KFJA 2QF7A 3WJZA 4MKNA 1Z48A 2Z1BA 4BI5A 1H50A 2NXIA 2V81A 2JKAA 2VENA 3SY5A 2DZTA 2QDHA 1OX6A 1TV7A 3WK3A 1B4KA 3BPWA 3VFLA 3TC7A 3LDVA 3M16A 4UTMA 2J6XA 4O11A 1TQJA 3GR8A 1CX9A 5LNVA 1DJNA 1DHPA 2LLEA 3LV5A 4UMAA 3B8DA 1AMKA 1WBHA 4A22A 4WOZA 4O1AA 2H8XA 3LLDA 3IVSA 2GPTA 1W37A 3W23A 4GUHA 2J24A 4N6EA 3S1WA 3T55A 1S5TA 3NAVA 3GLCA 1JCMP 2PRHA 3DFSA 3NQ2A 1VYRA 2FPTA 4HPJA 2WNQA 5CPMA 3IEBA 4CNOA 3VCRA 1N7KA 1H5YA 1ML1A 3OBKA 8TIMA 3CC1A 4IX0A 2XFWA 2NV2A 4TR9A 1UBSA 4PL1A 1KFLA 5EY5A 3SW6A 5AHIA 3A22A 1WDWA 2R8WA 5DN1A 4UTKA 3QF0A 4YCOA 3FKKA 1F74A 3EWWA 2Y89A 1FWRA 5FEPA 4IMCA 4ALDA 1HO1A 4AAJA 5EYWA 3LXBA 3P8IA 1LRQA 3LV6A 3NQ7A 4EF8A 2XN0A 3G18A 3MJYA 4PODA 1K7EA 4LC8A 1DL3A 2C6QA 3TIMA 4N9BA 1FCQA 3M5YA 1SW7A 3FFSA 4XKYB 3L67A 4OV9A 3R5EA 3NNTA 4GXMA 4FB7A 1K3UA 3KRUA 1I4NA 4AVFA 1Z44A 4O15A 5D2TA 1TQXA 4EOUA 4IXXA 4JTKA 3EWYA 3DFQA 4O13A 5LGZA 1O5XA 3M43A 1PIIA 1OF8A 3HF3A 2V8ZA 4JS3A 2FJKA 1TRIA 3TFCA 1I2QA 3W75A 1RQBA 4O28A 4ONVA 3RNDA 5AYYA 3NQEA 3G8RA 2A1YA 3L0NA 4R34A 4JX5A 3BK0A 5BOOA 3MYPA 4XTDA 4FNPA 2G96A 1LLZA 1SZFA 3I68A 3NM3A 5HR6A 3LI0A 4C1LA 3TR2A 4O16A 1TPUA 3IIZA 4LVDA 4K37A 3GKFA 3QW4B 1A53A 2X1UA 4L4LA 2A7NA 1T96A 2QCHA 2Z0IA 3ANYA 3KRZA 3GZ3A 4O14A 5D2XA 4O0ZA 1EA0A 4ORIA 3UPWA 3P74A 1U83A 1PVNA 1FBAA 1YXDA 5BMXA 1B57A 5E93A 1R47A 4I7WA 3KVMA 2E5CA 1I2RA 1LLWA 4YMZA 5C55A 1FWTA 1W8SA 1YTDA 4XQ6A 1EP3A 3QZEA 2ZQ0A 4A21A 2VEMA 1VCFA 2YFOA 3LI1A 3W7DA 4KFPA 4QISA 3U2OA 1D3GA 4IMGA 2ZA1A 3N2XA 1WYIA 5LKYA 2BZNA 1QOPA 3GX9A 1I45A 5FEZA 3PUOA 1K02A 4EF9A 3C4UA 2Y7EA 2ZFAA 2V0TA 3B0UX 5U7SA 5K2ZA 1EEPA 4FXRA 1W54A 2QR6A 4P2VA 4PC8A 1IXOA 4OQVA 4UFKA 4M7TA 3B06A 3EWXA 4KWVA 1FUYA 1K03A 1G4TA 1DOSA 1OFRA 1WOBA 1IXPA 1BEUA 3G1AA 3NL6A 5FF4A 3TUUA 3I65A 1AW5A 2QUUA 4FIRA 1GWJA 3LCGA 3S6DA 4AHOA 1VHNA 1ZENA 3FYOA 4JX4A 2CW6A 4WD0A 2A0NA 4B5NA 4GC4A 2YGYA 4HIBA 1TJPA 1Q6OA 1L9WA 1OFPA 3TH6A 2NWSA 4DELA 1OX4A 1VYPX 3NQCA 4O17A 3BARA 4ADTA 2C13A 3MI3A 4MPQA 5D03A 4NZFA 1NF0A 3GIYA 3NL5A 2QCMA 3WK0A 2OCZA 5H2ZA 2G95A 2ZRUA 3DAQA 1LM1A 3W2MA 4ZQRA 4FNSA 2NX3A 5D05A 5BMWA 4NXSA 2A5HA 1OK6A 2WNZA 3DI1A 5EL1A 3R13A 2E68A 1VPXA 4JTEA 3CIWA 3IIPA 3TC6A 4HT3A 4LS0A 1DORA 4NJKA 2CZFA 1K7FA 3OHIA 3R2GA 3M5ZA 2FDSA 4M6PA 4FX7A 2GOUA 1DBTA 3QMRA 4LV9A 4UC5A 4DPQA 5FF2A 3NQ8A 1OFEA 4ZQCA 1KTNA 2E1DA 3N9RA 4O52A 2PCQA 1E51A 4Z0SA 2AAMA 1H63A 7TIMA 4K7YA 3LGEA 1TPB1 3QW3A 4I9AA 3VKJA 4MIMA 1TPH1 1F2JA 3CTLA 3SSJA 4UTIA 1W31A 1VJIA 3HJZA 4AF0B 3W2LA 3TKFA 4D2JA 1FCVA 5HQEA 1H62A 5D33A 1QFEA 3UD6A 3TE9A 3C2RA 4AMAA 1K8YA 3INPA 1LZOA 1CW2A 2ZRZA 4K8EA 3G8EA 2V2DA 2WKJA 4ZQMA 3O05A 4UR7A 5DXXA 1XDMA 1JQVA 1VRDA 3BGGA 4BI7A 1H1ZA 5BRBA 3EX4A 3S1VA 4DEFA 2WJZA 3OA3A 1WX0A 3NGJA 4JYDA 4DF2A 2ZZ2A 4AHQA 4XKYA 4BF9A 3A5VA 1OHLA 3LHTA 1TPWA 2VFFA 4Y9AA 3W1MA 3S42A 1JCNA 3TK7A 4LW7A 3YPIA 3CEPA 2WSYA 4IXHA 3RF9A 3O06A 3SGUA 5G4EA 4AHPA 3NQGA 1M7PA 2CLOA 1TRDA 4JEQA 5I3KA 3W2NA 2Y85A 3TMQA 3W7LA 3PWAA 3PVFA 3MBFA 3ABRA 1V7YA 1TO3A 1WQ5A 1F6PA 3MUXA 1P0NA 1O60A 3T78A 3QM3A 4PEKA 3G3DA 4JTTA 3TMLA 1A5SA 5EA9A 3BW4A 4ORMA 4R33A 1OABA 2CU0A 3G0UA 2J9XA 1KM5A 2X1SA 2JKEA 4O12A 4N4PA 3E9AA 1QWGA 5FESA 1LBFA 4NU7A 3NXFA 4S2CA 3BLIA 4Y96A 4Z1AA 3ZS4A 5FF7A 3FLUA 4Q33A 1OFAA 4N2YA 6ALDA 2WV8A 4O54A 3W1RA 1VCGA 4MYAA 1VGAA 1RVGA 3L5MA 2Y6ZA 5HWMA 4K8HA 2B7OA 3VE7A 3W7RA 4JY8A 1AW1A 4RXFA 3L65A 3KFTA 3W84A 1GOXA 1AW2A 3UWZA 1GPWA 3W7IA 2Q3OA 1PS9A 2TMDA 4UTWC 1G67A 5CPOA 4A2RA 4CQAA 1W3NA 4NUWA 3LRMA 3NL3A 3CLMA 3LCIA 4AWTA 1HO4A 3O6YX 4X2RA 2ZZ1A 4CCDA 2ZYFA 4PL2A 2B7QA 5D32A 3C61A 3GXPA 1L6YA 5D02A 3M5VA 4WUIA 1HUVA 4A29A 4KFOA 4LRSA 4XZ9A 3NPWA 3M6YA 4MYXA 4N9CA 5AYZA 5AHNA 1NFBA 3PBVA 1FCUA 3U6WA 4AWSA 1XBZA 4AEOA 3W7PA 4PH6A 2TYSA 3FKRA 4MJZA 4GRSA 3W70A 2C14A 3W1AA 3W7QA 1R2TA 1TPDA 1ZJIA 3P5YA 3RU6A 5G4WA 1TPVA 1KFCA 2QCLA 3C6CA 3UZ5A 2DP3A 4GJ1A 1DVJA 2PC4A 4K7VA 3PUDA 3DKLA 3B04A 3W71A 4DF1A 2DZVA 1ICPA 3OVRA 3FJ6A 1JUEA 2H3DA 2NZLA 1I2OA 3EX6A 4K36A 1Q6QA 4DF0A 4E38A 3GAKA 3W7EA 5CSSA 5HWNA 4UIOA 2NV1A 5CSRA 3VNDA 3L2IA 3C52A 3BW3A 3SECA 2JBMA 3LTYA 2JK2A 3G1XA 4HPXA 1GVOA 4O0KA 4RCXA 3GNNA 1KFKA 3RLUA 4ZL1A 4JTJA 1MXSA 3W6YA 5AC8A 1XUUA 5F4SA 1ONRA 1KM0A 1NEYA 2VEIA 3CHVA 5KMYA 1V5XA 2NUWA 4EVZA 2V5BA 4UTLA 4FNQA 1NSJA 2A6NA 2B7PA 3S1UA 2P0OA 2BXVA 2Q3RA 4JTIA 1QO2A 3HG2A 1WAUA 2YW3A 1XI3A 4HN4A 3C3NA 3Q94A 1T99A 2WO5A 3M41A 3DBPA 5FEWA 2VFGA 1X6UA 1YPFA 3N73A 5KTLA 4LWWA 5DCBA 1ZFJA 1SUXA 4LC6A 5U4NA 2NXGA 1LOSA 1N8FA 3CT7A 4NJGA 1QAPA 3OG3A 1LROA 1TPEA 5KITA 3N2MA 5BNKA 3MHGA 1GVQA 1VHCA 2OMAA 5E1QA 1FX6A 5KZDA 3W1UA 3QQ0A 3MO7A 3O07A 4JX6A 1P4CA 1VCVA 5D30A 2CZEA 1SFLA 2X2GA 3LCLA 5AN7A 1RQEA 4QNWA 1VR6A 1YTKA 4NX5A 2DJXA 3PSWA 3A23A 1CI1A 3HG3A 3IIOA 4IPJA 3L0KA 1GT8A 3O8AA 1IGSA 1IXNA 1N55A 1SW3A 1TTPA 1EX5A 3B03A 4JR5A 4LVGA 4GUJA 3NEVA 4PA8A 2CWNA 4IWWA 1UCWA 3W1NA 2QCGA 3HBLA 4G1KA 4KFNA 2H90A 3P5ZA 3IRDA 1SO5A 5CGQA 3VI2A 4LUJA 2DU2A 1MZHA 3ZR4A 3NVTA 2J27A 5LHEA 4N9EA 3T7VA 2QKFA 6TIMA 3HPXA 4JIPA 3W85A 2F7FA 1GYLA 2F84A 4I7UA 2ABAA 4QSHA 3DU0A 4MZ8A 3HGRA 2Y61A 3DHFA 1W3IA 2E5BA 4FNRA 2ZCGA 3QFEA 3H54A 1L6SA 2FIQA 3NOEA 5LNSA 3QPZA 3DXIA 2ZRXA 1ZCOA 3PSVA 3UWWA 3NR0A 1TCDA 3HO8A 5F2LA 2DZPA 3E96A 3ABQA 4X9SA 4TX9A 1JCJA 1OFQA 3DFOA 3PC0A 4JTHA 3NA8A 4IGHA 5G2WA 2Z2UA 3HG5A 4JIQA 1LBMA 1YDVA 3E0IA 2QCCA 5AHEA 3BVJA 3UWVA 2FPVA 2B0MA 1TPFA 3NG3A 2OT0A 2UV8G 1TIMA 1YXYA 2EF9A 1NAL1 1X1OA 3GXNA 3QRHA 4I7VA 3C0JA 1TYGA 2E5DA 4NQ1A 5LSMA 1OFOA 1SQ7A 5CZTA 2Q8ZA 3TW7A 3G0XA 1FXQA 1OJXA 1ADOA 2CLKA 1OK4A 4AF0A 2CLFA 5IBXC 1O95A 1XL9A 2CLMA 5HULA 3A24A 2GJLA 2ZA2A 4IMEA 1Z42A 2YXGA 4OV4A 3W22A 4DBDA 3A21A 4YCPA 3E02A 1FDJA 3P80A 4IMDA 1W5MA 4KWWA 5CZJA 1ICSA 3GAYA 1B9BA 2EAWA 3QMSA 2WPBA 5IM51 3DFPA 1EIXA 4NJIA 3SI9A 2Z6JA 1A5BA 1JQXA 1H7NA 1TJRA 4ZZ9A 1TB3A 3QPYA 3UZJA 3S8HA 4AWUA 3W7NA 2ZTJA 3OEXA 1LCOA 1G4PA 1DQWA 3T44A 4LY8A 5AHLA 2V5LA 1AK5A 4WY0F 3EX1A 2A2IA 2H8ZA 3WJSA 2ZZ4A 3DHDA 5I3JA 2DORA 3MP4A 3MHUA 3N19B 5LNRA 4UMBA 4JNMA 3KOFA 3W1TA 1YTEA 3TAOA 4NNCA 1HTIA 2RDUA 2DZXA 1YDNA 1GVFA 2G5WA 1SO4A 1H7PA 4UNLA 1S5WA 3O15A 3QC3A 5HR7A 2A6LA 4H4IA 2J9YA 3GVGA 3S5NA 1WXJA 3MHFA 1TV5A 2A7PA 3CWOX 4OWGA 2GVLA 1TMHA 2QUTA 3HPSA 3R89A 4N6FA 5G2IA 4M5PA 2H6RA 4WXYA 3R8RA 2HTMA 3EWBX 4UTHA 2VC6A 2ZRVA 4LVBA 5EPDA 2QCFA 3K30A 5DY2A 4RV8A 4RK8A 3VE9A 3BGJA 1W56A 4LT9A 4WY0A 3CEUA 5F2GA 1FCBA 3W9ZA 1ME7A 1A5AA 4HNUA 2ZRYA 2ZZ5A 3EWZA 1EUAA 2Y70A 5AHFA 3O1NA 5HJLA 1WV2A 1WOAA 1PCKA 4DO4A 2GQAA 3KVLA 2NX1A 1THFD 1GVRA 5G2HA 3O63A 1PL9A 3HGOA 1EP2A 1R30A 2OJPA 1JRCA 3P67A 4MY8A 4OHQA 1C8VA 5F4XA 4MVAA 4UTJA 4Y8FA 2YSWA 5LNWA 4Z08A 4WX2A 3P60A 4TIMA 4ZVJA 1F7BA 1W0MA 5CG7A 2VXNA 2ZZ7A 5AYXA 3I7SA 3PAJA 1SZEA 2Y88A 4JN6A 3ZWSA 4UFJA 4U28A 4RR4A 3H53A 1TTJA 4M7SA 1UUOA 5GVJA 3LHZA 5K4ZA 3TQ0A 4H3DA 4IQLA 1JCYA 3ATYA 4E0CA 1RPXA 5AC6A 2C15A 4NJHA 2E77A 3G1SA 4YXGA 1VYSX 3NPVA 4Q4KA 3LCFA 3PULA 4MUZA 2ZA3A 3EX3A 3I7QA 3G1HA 3O6DA 4DPPA 4UTTA 1XCFA 5MHBA 3M7WA 4JICA 2QEZA 1OF6A 1TSIA 4UMCA 3SIZA 3JS3A 1P1XA 3TJLA 2Y7DA 4IJBA 4O53A 5FEXA 1W1ZA 3WK2A 4N4QA 3F4WA 2JKPA 1R2RA 1EP1A 5FF3A 3IVTA 5C5YA 2R91A 1KM4A 2W79A 3M1ZA 5AB3A 3UWYA 2OX1A 1KFBA 1Q6LA 3W76A 4OU1A 2YPIA 5BW6A 1ZAHA 3LB0A 4MZYA 3NL2A 4WZHA 3TQKA 4LNYA 2RDWA 5TIMA 4FHAA 2I1OA 5HUPA 1UASA 3LHVA 3EEGA 3STGA 3EKLA 1H1YA 1Y0EA 1MEHA 2VFIA 1RQHA 2GVJA 4GWEA 1QPNA 2ISWA 1KBJA 1PE1A 3GDKA 3S5YA 1LRNA 1XDLA 3NPUA 4UFHA 3SJ3A 4QJ1A 4E2BA 4P61A 3NQMA 2E6YA 4GBUA 1W5PA 4JY9A 1M6JA 4CCEA 1OX4B 1IF2A 2J88A 3OIXA 1G7VA 3CQ0A 2VOMA 1KV5A 3V75A 3GDMA 2O7QA 1BWKA 1QCWA 1RV8A 2BTMA 5A5WA 5D04C 3PB2A 1ZHAA 3GB6A 3THQA 4N02A 5K4XA 1GEQA 2C1HA 1F05A 4BFAA 3GXTA 2W0UA 1SW0A 1FDZA 3C56A 5J5DA 3UYCA 2GJNA 2VFEA 3C2EA 2FB2A 3L66A 1AL7A 4ML9A 2FTPA 5D2WA 1QR7A 3N34A 4O50A 4O1DA 4WJEA 2RFGA 3IGSA 4LOCA 3H55A 4S2BA 4LRTA 1OYCA 1RR2A 1KTBA 4UFLA 1K8XA 3AO0A 1W5OA 4CQ8A 4LVFA 4XBKA 2HS6A 5E0KA 2PRMA 2CLEA 3KX6A 4JD4A 1KW1A 2GQ8A 4OBTA 3TX9A 2VEPA 4FX8A 3SR7A 2NUYA 5KINA 4O18A 2C0AA 1UJPA 4WOQA 4OGZA 2HS8A 5LNUA 1H7RA 4U4MA 3C2VA 3RFAA 2XN2A 3N14A 1W5NA 1KTCA 1IIHA 2H3BA 3G0SA 3CM4A 3G1VA 3G24A 2B7NA 1OFDA 3L0GA 3P84A 3S5ZA 1OG0A 3BG3A 1H7XA 1U5JA 5C6MA 4JTLA 1GZGA 2VFDA 1ICQA 1TV8A 4PCFA 2V82A 5DXYA 4RZ5A 3EX2A 3TSBA 3RMJA 2Q8LA 2QCNA 4WXZA 4DO5A 1EWEA 1C29A 5K9DA 1MO0A 2ATSA 2QJGA 3M47A 5AOUA 3PM6A 1FDYA 1QPRA 2YR1A 1P5BA 2AQWA 3MI6A 4JXCA 5CPLA 2DZWA 3G3MA 5K9XA 1TTQA 1FWSA 1QNVA 1B4EA 5TQLA 3N3MA 4LS1A 2W6RA 1Z41A 2FPYA 4UUIA 4QQ3A 3UY8A 1D9EA 2PRLA 3NQDA 4IUOA 2YW4A 1MEWA 1OX5A 5F2IA 4UR8A 2VKZG 3MI2A 4H6KA 3UPBA 1QOQA 3EXTA 3Q58A 1SSDA 1AL8A 3NO5A 3NYZA 4FO4A 1JVNA 3HPZA 1JUKA 3I7RA 4HNVA 3A5FA 2QUVA 2GQ9A 3MWAA 4IMFA 1GYNA 2YYUA 3PS7A 2D73A 3NDOA 3SZ8A 4CNPA 3L21A 3LHYA 4DXVA 1F73A 3MYOA 4O4VA 5DBUA 5TBOA 1J5TA 3LTPA 5FI8A 3D0CA 1T0OA 3CU2A 4Z0JA 4ZQNA 4Z1CA 2QCDA 5I3HA 1ZAIA 4DQWA 2KZHA 1H60A 3IIVA 3LOTA 3PR2A 3W88A 2NUXA 4JDBA 3NPXA 2R94A 2CLLA 2YZRA 1J2WA 3IGXA 2XN1A 3ZFHA 4UCGA 4OT7A 1SPQA 1GTHA 3QH2A 1Q6RA 1XBYA 3SFKA 1GJPA 3TQVA 1I2PA 1LYXA 1JCLA 1PCWA 1QMLA 3DKJA 3W87A 4MFDA 5DY3A 4NZJA 1YXCA 2VFHA 3PY2A 4L4MA 3PBYA 3KAOA 3BG9A 2EHHA 3C2FA 1H51A 4WQ6A 3WK1A 4A3UA 5F1UA 1MSSA 3LTSA 1GVSA 2PURA 3FS2A 2HMCA 4O57A 3NZRA 3CIXA 1JR1A 3IGUA 4GNJA 2J9ZA 1IIGA 2QJIA 1BKSA 3W1XA 1MEIA 4NJJA 1EB3A 1ALDA 2E6AA 2TSYA 3LX9A 3QSTA 2Y7GA 3MP5A 4GUGA 2FFCA 2BWGA 3TSDA 4J9JA 2A21A 1XBVA 4NXKA 3F03K 4BWLA 2X30A 3M9YA 4QNEA 3CWNA 5HUOA 4PTNA 1FY6A 1EPXA 3SGZA 1EWDA 3FJLA 4AXKA 5G1TA 3EB2A 3ELFA 1GG1A 3GNDA 5D2VA 3AJXA 1F6KA 3ZWTA 3UY7A 4GUFA 2B4GA 2AGKA 4NNBA 5I3FA 4TMBA 2QJHA 3PG9A 5CPNA 5T26A 3STFA 3EKZA 3G1DA 4S1FA 1G4EA 5G1YA 1XBXA 4QIUA 4NVTA 5KZEA 1M5WA 1YYAA 5CZSA 2ZTKA 3W7KA 3V1PA 2YDAA 3KXQA 3O16A 4CCCA 1RZMA 5F2MA 4BR1A 1D3HA 3FA5A 3IVUA 3GDTA 4O8RA 2YYTA 1SR9A 3P61A 5HMSA 1FWNA 3G1YA 3LXAA 3QSRA 4Y6GA 2X1TA 4GFSA 5AFDA 2ZDRA 3OVQA 1NF7A 5DLCA 3NQVA 1S5VA 3UXDA 1OYBA 4O4WA 1QPOA 4RJEA 3W74A 3DENA 4JTGA 5L6UA 2I9EA 4JTFA 5HINA 2ISVA 1WBJA 3BLEA 3G22A 1QPQA 1DQXA 1XKYA 1W3TA 2QCDB 4GE8A 3UXAA 3THAA 3HOJA 3KHJA 4IX2A 2QAPA 1XC4A 3QMTA 1KFEA 3CPRA 3KVKA 3CB8A 1LBLA 4JTSA 1XUZA 4LVAA 2V2HA 5AC7A 3JR2A 5D38A 3PF3A 1I8JA 2ATMA 2GVGA 3HGJA 1J4EA 1JCXA 3I6RA 3W72A 2C16A 5DCDA 4MLRA 3F4NA 4JGDA 3N9SA 3UWQA 4JYEA 2WQPA 3C2OA 4M19A 3MBDA 4QITA 2A4AA 2V30A 3TFXA 2V9DA 4Z1BA 1ZALA 4M6VA 5EBUA 1HFBA 1LP6A 1Q45A 3QQ1A 2WNNA 3E12A 4ZQPA 4RXGA 4FIQA 3GYEA 3ATZA 1SU5A 4ZQOA 2TPSA 2I14A 4IPIA 3T40A 2ZRWA 5KZMA 5I3IA 2DZUA 2A85A 1AG1O 1WA3A 3P7YA 1G7UA 3BW2A 4O19A 4R53A 1B3OA 2C18A 1KV8A 5CKSA 1KLZA 4YWIA 1XXXA 5K9CA 4TU1A 1XM3A 3TXVA 3TXZA 4IOTA 4Z1DA 3L9CA 3R12A 3BG5A 4K39A 1KM3A 4YLWA 4MY1A 2QDGA 3Q2DA 3GKAA 1LRTA 4TO8A 1VQTA 5HNRA 3PBUA 4AH7A 4EWND 1I2NA 2C3ZA 2VELA 3GDRA 3LM7A 3C8FA 3S0CA 3W83A 4UTUA 1ZNNA 3BLFA 3TAKA 2CZ5A 4QAIA 4ICNA 2ISSA 3M0ZA 3LXCA 3P81A 1YLVA 1X1ZA 2IQTA 2RDTA 3EWUA 5F4WA 3RK8A 3TNOA 1JJKA 2R14A 2HSAA 1PHQA 1KBIA 2P1FA 5HWJA 1SO3A 1SO6A 3FOKA 3NM1A 2P10A 4RLIA 2ZZ3A 3P62A 5KSWA 4UXDA 4POCA 1YADA 5F1VA 4BK9A 3PG8A 4DBEA 3W1LA 3EXRA 2OT1A 1KM2A 4RZ4A 2RKXA 4TMCA 4NNAA 2EPHA 4MOZA 2EKCA 4FX6M 4CQ9A 4QM1A 4FXSA 4MJMA 4YL2A 3MW7A 5FF0A 3QEZA 3PUEA 2Z6IA 4MLJA 1JUBA 2DZSA 1OYAA 2O7SA 1FWWA 4HKPA 4LV4A 1UUMA 4XBSA 3E49A 1H7WA 3MMTA 5L9FA 2CZDA 3T4CA 3F1QA 3NQAA 2Y7FA 2X16A 5EMUA 4KKXA 2WOQA 1DKWA 3ABOA 3DFNA 3TV8A 3W1PA 2NWRA 4HNTA 1O94A 1SZNA 1ME8A 3LBMA 3LCHA 1JRBA 3GK0A 5CZ0A 2ABBA 3HG4A 3B0VC 3WJWA 3S5OA 4NX0A 3W07A 1LOQA 1L6WA 2EGZA 3L5LA 3TW6A 4CLMA 3FIGA 1F5ZA 2E6DA 4GUIA 2YFNA 1BWLA 5A8GA 3IV3A 4JYFA 3HMJG 1RD5A 4UTWA 1R2SA 3W1QA 3HQ1A 3MP3A 4X22A 3HB9A 4EIVA 4RX0A 4WY0B 1LTDA 4HSOA 5IBXA 1P0KA 4JTUA 4XUGA 3W3OA 3QJAA 5DBTA 3LLFA
chains in the Genus database with same CATH superfamily
1Y5XA 4AB4A 3WBAA 5LHFA 4D1JA 1EXPA 3GIPA 4HNNA 3N2TA 3PBWA 1GW9A 3KLLA 4DZHA 1ISVA 3TU9A 1QATA 3B4UA 1LOLA 4M6QA 2OYMA 3L23A 4HZ6A 3HGSA 3NSNA 4AUBA 1FXPA 3LYEA 1CXKA 1AVAA 4C1KA 4XWUA 4AXNA 1BRLA 1NOUA 3GHSA 4HOWA 4CNNA 2PE4A 1O4UA 3UQNA 2CKSA 1Q6EA 2WSRA 3WN6A 1XSKA 4HK6A 3UWUA 1UC5A 2YX0A 3PFMA 5D37A 1UWTA 5DEZA 2NXHA 3WLQA 2QCEA 2Y63A 4FXJA 1IV8A 5G4HC 4LS2A 2NLIA 5DANA 3N3TA 1XH0A 2PGRA 3HV8A 1S2CA 1OVDA 1R46A 2W62A 1ZCCA 3L2MA 3UG8A 1KLYA 4DB7A 3B97A 3I10A 3KTXA 3KZPA 1J0KA 4XIAA 3WJXA 1H7OA 5HK4A 3P82A 3N2CA 4AIBA 4HHPA 4QDPA 1L0PA 2ZZ6A 3LUTA 4R7JA 3U2ZA 4S3JA 2CFFA 1GG0A 1KM6A 3UJRA 2Y62A 1GHSA 3NZ1A 1S3HA 3TSMA 5AHMA 2QMKA 4W7WA 1WNOA 1IXQA 4CNUA 1FA2A 1VS1A 2V2CA 1JULA 5CC6A 2F9RA 1KM1A 4F79A 2GUUA 1RCQA 4F0MA 2XIIA 1K8ZA 4C6PA 2O4MA 1YPIA 4IIFA 2D3NA 2E9MA 3IS4A 5AC5A 1CNVA 4ADUA 1ZAJA 2X1RA 3A9IA 5JBEA 4X3ZA 2PDHA 2WHLA 2VEKA 3I3BA 1P48A 3R25A 3AJ7A 1C9DA 3BCFA 3TQPA 1C92A 5M1TA 4ZO7A 1XS2A 3PZOA 4XV0A 3P93A 2NX9A 3R7MA 2BOEX 3L4ZA 3ABSA 3W7OA 4W9TA 1J12A 4MFEA 4DO6A 3S9YA 4ZMGA 2FQIA 4U3AA 3FX4A 3EXSA 3B9DA 3LNMA 5J5RA 4E2DA 3M0KA 4CVUA 3LRKA 1TIWA 4DWSA 5HDRA 4LU0A 3WJYA 2E3ZA 2OFJA 1IE7C 4ADSA 1GQNA 3WMBA 3VMNA 1QO5A 4DJFA 6TAAA 4QJ4B 1H50A 1P0BA 4LUTB 5A2CA 3SY5A 3IAPA 1QOXA 3ID7A 4M51A 2DFAA 2XJ7A 3T07A 1HNYA 3TNBA 1OADA 4RW3A 3TTSA 4UOQA 2UY3A 2FVMA 1DHPA 3LV5A 1E15A 3B8DA 8CGTA 3EMZA 1WBHA 3CV7A 3WQ4A 2VGIA 2WJEA 2XUCA 2DUZA 1QTWA 4PMOA 1S5TA 3NAVA 1FWGC 1EDTA 3DFSA 4C5ZA 1VYRA 2FPTA 3H6OA 3S2NA 1H5YA 4C7DA 1W91A 8TIMA 4IX0A 3VDGA 2VC5A 1GQJA 2NV2A 3OGSA 4TR9A 3SW6A 4IL2A 1UC4A 1A4LA 3A22A 1WDWA 2R8WA 2YBUA 5JIPA 3WF3A 5LA2A 1KGWA 4DX3A 1K6WA 1PO9A 3FKKA 2Y89A 2O55A 4WVXA 1NFPA 2XIBA 5FEPA 3FCPA 1GNXA 5EYWA 4AAJA 2OKOA 3M7SA 4PGLA 3BDKA 3BJFA 4K1WA 2XN0A 2D23A 4PODA 4LC8A 4N9BA 4H9TA 4QG9A 1E5JA 3K4AA 3EWDA 1ZRQA 5MKGA 4CN4A 1I4NA 2E9LA 2QJNA 5D2TA 2J25A 1RAKA 3EWYA 3AIQA 4O13A 5LGZA 2Y2WA 1H1NA 3HF3A 5AVHA 4A8RA 1PTAA 2HBVA 2WC7A 3TR9A 1E71M 4JHOA 3W75A 1JCTA 1RQBA 1XISA 1EA9C 3TC3A 1R3WA 4ZA0A 4R34A 4A3YA 5BOOA 4FNPA 2AKMA 1LLZA 1SZFA 3NM3A 4GQBA 4KESA 4KIRA 1KRAC 2OU4A 4M6UA 1DXIA 5D2XA 4O0ZA 2GDVA 4ORIA 3RPTA 4B92A 3K5XA 3MB9A 2VVSA 4HB7A 5BMXA 1B57A 5C71A 1U5VA 2E5CA 4YMZA 3SN1A 1XV8A 4DJDA 1ELSA 1YBQA 5XIMA 2ZQ0A 1JI1A 4A21A 2VEMA 1VCFA 1DXFA 4AIOA 3BL3A 1WE5A 3VIJA 3LI1A 2C79A 1EFZA 4US5D 3ORWA 1C8QA 1D3GA 1EX1A 1PX4A 2ZA1A 2ZX9A 3HN3A 3N2XA 5LKYA 3VOIA 1XRTA 3PUOA 1WXZA 4F2TA 2QV5A 1K4HA 5U7SA 4ZCWA 1EEPA 5ABHA 2WB5A 9CGTA 1QHOA 4UFKA 3SCVA 2VDIA 3S2JA 1SYTA 4PZVA 2QUUA 5A6BD 1KNWA 4OECA 4AHOA 1ZENA 2CW6A 4WD0A 4B5NA 4GC4A 1EJVC 2HVOA 4GIYA 3MV01 1W9BM 1OFPA 3CL7A 3MU7A 3DFYA 4ADTA 2YCLB 2C13A 5D03A 4NZFA 1V6TA 5F7UA 5H2ZA 2G95A 1WZAA 3WD4A 4HMNA 2ZRUA 1FWDC 1LM1A 3BZJA 2C71A 1WKDA 2R1PA 4RE4A 5BMWA 2XU2A 4B2DA 3DI1A 5EL1A 3R13A 3B8UA 3VGEA 4RDYA 5KEZA 2O92A 2GK1A 2NVAA 1XD0A 4NHVA 5PTDA 4LS0A 3ZYZA 2CZFA 3ARWA 4DUWA 4PTDA 2BVTA 3LQGA 3M5ZA 4M6PA 5CXPA 3CL6A 1UD5A 1GVYA 4GY7A 2X42A 2GOUA 1UROA 3IJIA 5FF2A 1KTNA 1X96A 2BOFX 3GU9A 1E51A 1M03A 3M64A 1OG6A 3LGEA 1TPB1 2D0GA 4U3CA 5A94A 2PWHA 1WUEA 1PDZA 4PUMA 4AF0B 3GU2A 1VEMA 2E8ZA 1QFEA 1TVLA 3TE9A 4OUIA 1C8YA 2BGSA 3INPA 2ZRZA 4MWAE 3LPPA 2V2DA 1Q6FA 4RNHA 3BGGA 1OCQA 4AZ5A 1YEYA 3S1VA 2WJFA 4JYDA 2QGHA 1F3EA 4QE4A 1XLAA 1TPWA 3EMCA 3K4WA 4FR6A 2J8FA 3FVMA 4L56A 3S42A 1JCNA 1WZKA 4US5A 2WSYA 4HP5A 2VHLA 5HOSA 5C9WA 1TRDA 3O3RA 4JEQA 1QHZA 2R24A 4ZOEA 3W2NA 2Y85A 3TMQA 3ES8A 2ZVRA 3PVFA 4JNZA 3ABRA 1WQ5A 4EXAA 3MUXA 1P0NA 4PRWA 4W5UA 3G3DA 3UXIA 3TMLA 1S38A 5EA9A 4NZCA 4ORMA 4AMCA 2CU0A 3G0UA 5CC3A 3UJFA 3E9AA 3KL5A 1EC8A 1LBFA 3WD3A 2DIJA 3NGFA 4MM1A 2VR4A 4Q33A 4YN5A 4GY1A 2NLYA 6ALDA 4MAZA 3GD6A 3VVGA 2VT0A 1K9DA 1RVGA 2Y6ZA 3W7RA 2B7OA 2B31A 4JY8A 1HJSA 1AW1A 4EWJA 3ZZ1A 3BJTA 3ZOAA 3HA1A 4ZSUA 3W84A 1GOXA 3WDHA 3OLEA 1V08A 1ZBVA 1GPWA 1BWVA 1DQUA 4UTWC 5CPOA 4FMVA 4A2RA 1C7SA 1W3NA 2PBOA 4NUWA 4ZB5A 1QRQA 2HVNA 4GZEA 3CLMA 4QX4A 2ZZ1A 4Q8PA 3RO8A 1YE4A 4MWAA 4PL2A 1JXKA 1L6YA 4G56A 4KFOA 4XZ9A 2VZUA 2P53A 5AYZA 4J3ZA 4QLJA 1FCUA 3PBVA 4AWSA 4AEOA 4RL3A 4W8LA 3ARSA 2QPXA 5JBDA 1TPVA 4HNCA 1RLDA 3C6CA 1GCYA 1UOKA 3DKLA 4DF1A 5C7HA 3QOMA 3U2EA 2VJXA 4IIEA 2H3DA 2YL9A 2XIQA 3EX6A 4DF0A 3S6TA 5CSSA 1UKOA 7TAAA 3C52A 3BW3A 2HK0A 3FGCB 2JBMA 4DM2A 4HPXA 1GVOA 4O0KA 2BODX 3H8AA 4I9JA 2GGGA 1TFVA 1XUUA 4MJ4A 2VEIA 2DT1A 2YA1A 3CHVA 3KCOA 2NT0A 2BXYA 2XIJA 4FNQA 1R0MA 2A6NA 4P8UA 3S1UA 4HZMA 1V6WA 1OBAA 3NSMA 1XI3A 5C9RA 3Q94A 2WO5A 3M41A 4JTCA 2CPUA 4IICA 4J27A 3N73A 3TYUA 1VF8A 3UGRA 4TX6A 2WPGA 1QAPA 3MUZ1 2NVCA 3SY1A 4N42A 3N9KA 4AZBA 4PTWA 3QQ0A 3LCLA 4DAFA 2PTDA 4NX5A 1FKWA 1XKJA 3LEPA 2PC8A 3AMLA 1N55A 1SW3A 1EX5A 2VRQA 4G1NA 2BHYA 4L65A 4JR5A 4LVGA 4PA8A 1UCWA 4KCVA 3LA4A 2FHCA 2PDLA 5E6ZA 3OB8A 1NWSA 4MB4A 2OGJA 4TVDA 4C6DA 1H0IA 3CZKA 4GKTA 1EJ7L 3QY7A 1DJXA 4JKKA 3VI2A 1EPVA 3NVTA 1IR2A 3SAZA 1ECEA 2AL1A 2WK2A 1GYLA 2AOSA 4JZ5A 3HGRA 1W3IA 4EPEC 5EMLA 3CMJA 2ZCGA 3QFEA 2WLYA 5LNSA 3WQGA 2R1KA 3AIWA 3PSVA 1XGEA 2CBIA 2OLSA 4FPSA 2WKGA 2DZPA 3ABQA 1UWUA 4TX9A 4MWAB 2FYMA 3NA8A 1TX2A 2CERA 1QI0A 1YDVA 5AHEA 3TONA 2FPVA 2V69A 3PZUA 1P1MA 3UA3A 1J6OA 1V3LA 4I7VA 5GJMA 2YB1A 4CEUC 1LJYA 4O1EA 2G0WA 2E5DA 1KD0A 3ENLA 5LSMA 1OFOA 2OWCA 3RPDA 5HBFA 1PX3A 3SCWA 4H01A 3PPCA 4AF0A 1O95A 5HULA 3OBEA 4ACZB 1WDDA 1T40A 4IMEA 1RHCA 2VEFA 4OV4A 3E02A 3V0SA 1TR1A 4G2DA 5FL1A 2DDXA 2Y5JA 1XPGA 1DJWA 1A3HA 3A4JA 3RYSA 2POZA 3DFPA 3FVDA 3WNLA 1EIXA 1ZJHA 3CZLA 2WHJA 4DUXA 2Z6JA 1TZ9A 3ME3A 1A5BA 1JQXA 2YB4A 2NVDA 4U5IA 3ITLA 2G50A 1XSIA 3UJSA 4AQLA 4B16A 1G4PA 4LY8A 3WJSA 4GCAA 4FLRA 5HMDA 1EQPA 4QG8A 3DHDA 3M0LA 5I3JA 2GGJA 3MP4A 3MHUA 5LNRA 1V3MA 4AEEA 1V6VA 3WIJA 5BOFA 4PMRA 3W1TA 3B9EA 1XYBA 1US3A 4YVPA 3NO1A 3CV6A 2D22A 1B90A 2G5WA 1SO4A 5M3WA 3U7VA 3RR1A 3MHFA 1XYFA 3I3EA 1X98A 4OWGA 2GVLA 1CLVA 3R89A 4M5PA 1EHNA 2H6RA 3VZZA 3DCPA 4UTHA 4JFSA 3WKZA 4LVBA 3K30A 1UQZA 3VE9A 4HU4A 3F2DA 1RUSA 3VC5A 4WY0A 3K8LA 4JCLA 2CETA 2FZNA 2ZRYA 3ZVHA 2Y70A 3L4VA 5HJLA 4KQNA 3E2VA 1WO2A 1OGBA 3KVLA 1PPIA 5G2HA 1GVRA 2XH2A 1PL9A 2OJPA 4JEJA 4GYPC 4OKDA 1W3JA 2X1IA 4MY8A 1C8VA 5F4XA 4Y8FA 2NQZA 4TV6A 2EPMX 4WX2A 2PTYA 3H12A 1Q2RA 4ZVJA 1XYAA 1MW3A 1H09A 5CG7A 1ZBWA 4C7GA 3BJSA 2QF8A 1YDYA 1RD6A 1UUOA 2GYIA 5K4ZA 3TQ0A 1FOBA 2XISA 3BOFA 4R9OA 1RPXA 2YDSA 5AC6A 1E1CA 3NPVA 3SQSA 3GC2A 3GZAA 4MUZA 3SB0A 4DPPA 5MHBA 4QE5A 3KOXA 5HXMA 3UZZA 3D6NA 4AC1X 3SIZA 3JS3A 1HKJA 2Y7DA 3E1F1 3SY8A 2ZUTA 1R2RA 2A3EA 2DIEA 2R91A 1BF6A 2BY1A 1BVWA 5AZ1A 4C6EA 1VAHA 3REQA 2OEKA 3W76A 1K4GA 1A47A 1ZAHA 3LB0A 1UZ1A 3NL2A 2PTWA 4ERGA 3FV9A 4LNYA 3OBAA 2YBTA 1TMQA 1XDJA 1UASA 3EEGA 1BTCA 3AZRA 1SJAA 3I4KA 4JN8A 4DLFA 4CQDA 2VFIA 1JD7A 1HL8A 2GVJA 2ISWA 1KBJA 5HMFA 4H41A 1PE1A 2XVGA 3AAMA 1XDLA 1PXGA 1I75A 1AJ2A 4E2BA 3W29A 1JDDA 1W5PA 4JY9A 5IFTA 1JD9A 4XD3A 1P43A 4CCEA 2PLKA 2J74A 2J88A 3WEOA 1KV5A 3GDMA 3B9AA 3V5OA 3M6DA 5E70A 3PB2A 4CEXC 5JVLA 1R3VA 2ZXQA 4OZOA 1DWFM 3UR7A 5ABEA 1Z6KA 1N2VA 4LCQA 5GNZA 1H41A 2RJHA 5J5DA 3CO8A 3CO4A 4BKNA 2FB2A 1XSJA 1FWIC 2VD8A 4J3UA 3T0DA 1LL6A 2Z1VA 3SEPA 3N34A 4GC3A 1GOKA 2RFGA 2VC7A 3A4AA 3H55A 2UY5A 2PLCA 4LRTA 3VGFA 3WQWA 4GFIA 1VBHA 2Y8VA 2PD9A 5E0KA 2CLEA 3R8HA 4JD4A 1K77A 3EOEA 3ONCA 2GQ8A 1XPYA 4GISA 2V3DA 4FX8A 1HQTA 1VFOA 4A05A 4GJJA 4KGJA 2NUYA 5KINA 4O18A 2C0AA 5T9BG 3RM4A 2HS8A 1XP3A 4B15A 4U4MA 4LCRA 3C2VA 4JTDA 1IIHA 2IUZA 3CM4A 3MSRA 3UZYA 3CZGA 4GKLA 1XLFA 5CGMA 3EBVA 3S5ZA 1OG0A 1MXGA 4G5DA 3KOYA 4FZIA 4QQUA 3B8VA 3OVGA 4UB9A 2VFDA 1ICQA 1TV8A 4PCFA 3EX2A 2HXTA 3D46A 2TAAA 3PANA 3BXWA 1C29A 5JUVA 5K9DA 3RM8A 2J7HA 2ATSA 3WD2A 3H4GA 1IHIA 2I56A 4QCEA 3TCSA 3VDCA 2XHYA 2DZWA 3T08A 2GSEA 4LS1A 2W6RA 7A3HA 1V7AA 1J0ZA 3NQDA 2PRLA 2YW4A 2F8QA 1MEWA 3AU2A 3DYPA 4H7CA 3MI2A 3UPBA 4M29A 3S9IA 1SSDA 1JVNA 1XHGA 2PDWA 3B0YA 3VC6A 1E3XA 1T6MA 1Q65A 2W92A 4HNVA 4REQB 1BVZA 3WF0A 2GQ9A 4AY7A 2Z25A 1QI2A 3MWAA 4IMFA 3AFBA 2YYUA 4P5UA 3N15A 3PS7A 1E6NA 4XX6A 2D73A 1WZMA 2BGNE 2QDEA 2F2KA 1S3TC 3KBWA 1S2AA 4LAUA 1XIDA 3QXBA 4DXVA 3MYOA 4ECLA 1J5TA 1EYEA 4Z1CA 2J79A 3OW1A 5I3HA 3A3XA 1EO5A 1H60A 5I2UA 2CKRA 4FR1A 3WLTA 1NDYA 2NUXA 3NPXA 1MXDA 2CLLA 1J2WA 3TN4A 4UCGA 4OT7A 1SPQA 4J5NA 1Z3NA 3PTDA 4W8AA 1KCZA 3KLKA 3DKJA 1QMLA 4I6VA 3W87A 3T2OA 3VIOA 1HKWA 3PJUA 1V8EA 4L4MA 1E9YB 1XLGA 1MUCA 2EHHA 1MW1A 5F1UA 3LTSA 4O57A 1EBGA 4QEEA 2G37A 4GNJA 5D8WA 2J9ZA 5A6BA 2QJIA 3QV8A 1MEIA 2ACSA 1W9XA 1KFWA 4NP7A 1ALDA 1XIJA 3QSTA 2TSYA 4GUGA 3AYTA 4YTQA 2A21A 4KEZA 4PCTA 2Q01A 4BWLA 2X30A 4CVWA 4WR3A 3WG6A 5HUOA 4M80A 5E9XA 1WUFA 1FY6A 3GVQA 1EPXA 3W6MA 3UGVA 3EB2A 5I23A 3ELFA 2GJXA 5D2VA 1TZ7A 1NWTA 4J3WA 2B4GA 3N12A 3NVDA 5I3FA 4TMBA 2QS8A 4B3KA 5CCZA 1MW0A 4E5TA 4DN1A 1XBXA 1DE5A 1M5WA 2EPNA 4HBKA 3NYDA 5CZSA 2ZVIA 3TTYA 1P6WA 3G6LA 1RZMA 3I4EA 4BR1A 1R8LA 3APYA 2AMXA 3FA5A 4HZ7A 1CPUA 2BS9A 3P61A 3NZPA 4B5UA 1FWNA 4F9JA 1KXTA 2E28A 2FGBA 3G1YA 4IMAA 1G94A 3QC0A 4GFSA 2ZDRA 4NAFB 1OGGA 1P0DA 5DLCA 1FWAC 2VZVA 1ZGDA 1S5VA 1E1EA 1TA3B 1EJRC 1OYBA 3PP7A 4PBGA 1QPOA 2Q8XA 2WZMA 5HINA 5CPTA 1NWUA 2ISVA 1W1A1 3WQ6A 3FW6A 1XYCA 3W28A 4GE8A 3THAA 3NEHA 1XLBA 4IX2A 2VP8A 1KFEA 4NZ1A 1XUZA 2V2HA 3M0YA 1UP3A 2J62A 3IUIA 4PMXA 1JF5A 3PF3A 4XSLA 2BMBA 4INFA 1JCXA 5DCDA 2GFTA 3F4NA 1XQKA 3UWQA 1H4PA 4Z42C 3C2OA 3MBDA 2A4AA 2ZUUA 1J93A 2V30A 1YNYA 2V9DA 4L4PA 4Z1BA 3ARYA 3T0BA 3MV11 3BZGA 3QQ1A 1K9EA 4ZQPA 3GYEA 5MKGB 3VNMA 2BY3A 4X60A 2TPSA 5CJ5A 6CGTA 3PTQA 2IXUA 1BQCA 1EJXC 3PHAA 1ENUA 4C6NA 2ZXAA 3S47A 5A8PA 4R53A 3T2PA 1F3TA 3QR1A 1XXXA 4S38A 2GUYA 4TU1A 1XM3A 3DECA 1LUCB 4IOTA 2PU1A 4F48A 4Z1DA 1C3FA 4WGHA 3R12A 1F9CA 4YLWA 4Q7BA 2QDGA 1HJQA 3GKAA 4PMVA 1LRTA 4GD0A 2D24A 1XIMA 5CBIA 2C3ZA 1J01A 2P3EA 3GDRA 4QFUA 1ZNNA 4M8UA 1E4NA 2NQ5A 3TAKA 4ICNA 4E8DA 3M0ZA 3GG7A 4IPNB 3P81A 1XLKA 1UPPA 2IQTA 2RDTA 3OOQA 2HSAA 2V5JA 3PBGA 1KBIA 4PCNA 4V27A 1S2VA 3WZ0E 3V5FA 4XG1A 1JFXA 4PBFA 4C6OA 3WMLA 1BYCA 3T6CA 1VBUA 4H8NA 5HNNA 1CXFA 1XLCA 1KM2A 2RKXA 1LWIA 2EKCA 4CQ9A 3WD1A 2XM1A 4YL2A 3QEZA 2Z6IA 4MLJA 1JUBA 1OYAA 1FWWA 4XBSA 3ALFA 4V33A 5L9FA 4XBJA 2REQB 3F1QA 3WY1A 1UH3A 3MUIA 2Y7FA 4UQEA 3OU8A 3TV8A 3W1PA 1O94A 1JAEA 2FFIA 2DV0A 3UG5A 3WCZA 5CZ0A 4CU8A 1RCXB 3WJWA 3S5OA 3W07A 3IAQA 5FSDC 3TVAA 2E6DA 2YFNA 3R0UA 1XGZA 3CHEA 4KGLA 3IV3A 4XO6A 2PU0A 3AHXA 1GKRA 4LBRA 4YVVA 4HU0A 3WH8A 3SCTA 3EDKA 2WM1A 1P0KA 1HF6A 3SRKA 1PJ9A 5CG0A 4AY1A 3VTRA 1GKPA 1IZJA 1Q3NA 3NWRA 3GG0A 3WFAA 4RKAA 2VX4A 1WDSA 3IJ8A 4AWEA 5I3GA 1G69A 3EA1A 3S1XA 2WSQA 6ENLA 3PBMA 1VC4A 1H0GA 3BV4A 1S2UA 4UFMA 1GTEA 1J9YA 1YDOA 3LHWA 3OIHA 2ALDA 3G1FA 3FYPA 1U22A 3KHDA 3L4TA 3UCQA 2BOGX 3TJXA 3E0FA 1Q4NX 4XAGA 4DUOA 2IKHA 1QDSA 2JGYA 3MUCA 3DEQA 1SM9A 5JQ9A 5AC4A 2VWSA 4IPLA 1EYWA 4PUDA 3DI0A 5J04A 1PHWA 1SZGA 3N13A 4Q32A 3XIMA 2F6XA 1R3RA 3PB0A 4TV5A 5D09A 2GLKA 1EOMA 1UR0A 5BYWA 4ZB0A 2D2JA 5HJXA 3CL8A 4O1BA 4FF7A 1UB3A 1OEPA 2YJQA 4I5XA 1MW2A 2E6FA 1HXJA 1SJBA 3AIEA 1CBGA 1NARA 3LBCA 5EKYA 1HG3A 2W5FA 1Q63A 4K3ZA 3BURA 1GOQA 2Z7KA 3JRKA 2D3LA 3CUGA 1X7FA 5E0CA 3MCMA 1AUSL 4XKMA 1VLIA 3QTGA 5D2YA 3CASA 1TZZA 4CD6A 1VLWA 3GYCA 4BI6A 3QV6A 1QNRA 2QAFA 2X7VA 3W2KA 1V6YA 3AC0A 4HSNA 3LRLA 2VR5A 3GDLA 5H91A 1TELA 4OE7A 3GR7A 1GPFA 3H2MA 2GZXA 1T8XA 4EPBC 3W2JA 4UFIA 4CNSA 4LF2A 2PBGA 4FNUA 2R9RA 2XSXA 1OIFA 2FLIA 6PTDA 5A95A 2PUZA 4AFYA 3IIXA 2GJXB 1OCNA 3FJNA 2XVLA 2Z24A 3F5LA 4CN6A 2CLHA 5CAHA 4UR9A 2DUAA 4M1BA 4XTIA 4BQ5A 5K7JA 3LCWA 2VQUA 5I5RA 2L5HA 3FXYA 4XZWA 5E6YA 1NY1A 4FEZA 3WFZA 4MKVA 3BAIA 1TREA 4DZAA 2BLEA 5T8GA 4MZ1A 1M7OA 2QIIA 1A0DA 1WZLA 3KRSA 5TF0A 3A13A 2GGEA 3K8MA 4E8GA 2OZ0A 3U2CA 3W27A 2PDMA 3TROA 3W7CA 1L6GA 1E73M 3GVWA 2VD9A 3SRDA 3TCEA 1KFJA 3O9NA 2OSYA 4MKNA 4HYRA 5I3DA 1Q66A 5JMUA 2XH0A 4QR6A 1KBLA 2DZTA 1U30A 1TV7A 2B81A 3VFLA 3REQB 4O11A 3ITVA 1TQJA 1CX9A 2LLEA 4UMAA 3E38A 2P0IA 3SUTA 4WOZA 3LLDA 2GPTA 4XD5A 3W23A 4GUHA 2ADAA 3TN5A 3UCDA 3OHMB 4N6EA 3SCPA 3S1WA 1KXHA 1AA1B 5IDIA 3NQ2A 5CPMA 2WNQA 4CNOA 3EEZA 1N7KA 4AW7A 2XFWA 4IFKB 4TX8A 1M53A 3UVIA 1W3LA 2XVKA 1KFLA 2Z29A 4J3TA 4KCWA 1H3GA 4YCOA 1GORA 3F5KA 1F74A 2AAAA 1FWRA 3NZQA 1UPMB 4ALDA 1HO1A 3LXBA 5EB8A 1LRQA 3KDNA 3NQ7A 5A1AA 2GDQA 1DL3A 3TIMA 1MDRA 3PPFA 1VPYA 1KBKA 3M5YA 1SW7A 3FFSA 1LQ2A 1UD3A 1JZ6A 1XIHA 2H9AB 3R5EA 3NNTA 1POJA 4FB7A 3KRUA 1Z44A 1E43A 5C9UA 4EOUA 3JVAA 5A6SA 3DFQA 3UFYA 2FH6A 1PIIA 3MSGA 5IOBA 4V1YA 4JS3A 2FJKA 3QHMA 1TRIA 4B5SA 5LA1A 1TWSA 4JHZA 3RNDA 3NQEA 3G8RA 1VFFA 2Z27A 4GJIA 1W2VA 3KOWA 4JX5A 3BK0A 2HZGA 2XH4A 5D9OA 1TUXA 5HR6A 3ZT5A 1TPUA 4LVDA 4MF4A 2AL2A 2PDGA 4K37A 5GNYA 3MUY1 3QW4B 2X1UA 2HROA 2XTKA 4L4LA 2A7NA 2QCHA 2Z0IA 4S23A 3AMGA 5GNXA 1UP0A 1Y8BA 1I0BA 1B0IA 1EA0A 4C7FA 3P74A 4PUKA 1YXDA 2X2YA 3CYJA 4Q8VA 1W9VA 5E93A 1R47A 1I2RA 1FH8A 1GQKA 1HKIA 1W8SA 3MANA 3S3GA 1YTDA 3VX0A 5CEWA 3VNKA 3E0VA 2NQLA 3E5BA 4WSHA 1UKPA 2V68A 4US6A 4H6RA 4KFPA 3U2OA 1JZ3A 4IMGA 1NQ6A 3JW7A 3W02A 2FHBA 4A8NA 3VIIA 3ARPA 3GX9A 5FEZA 1K02A 3QHNA 5DQPA 1G9HA 3QKZA 5K2ZA 4FXRA 2QR6A 4C5YA 4LAMA 1C9WA 4PC8A 1HX0A 3TUUA 4GQQA 1IXPA 1BEUA 3G1AA 3NL6A 4UTFA 3T42A 1AW5A 3AI0A 4FIRA 2ZUNA 3UEQA 2A0NA 2YGYA 4J35A 3EPNA 3N4FA 2BG5A 2WJDA 4DELA 2OQLA 3AQUA 2R1NA 4O17A 3PNZA 4BEQA 1XJBA 3CQJA 4ATLA 3WBWA 5ABFA 3MI3A 4MPQA 3KOZA 4LY4A 2OCZA 3DAQA 2YL5A 3LNPA 3W2MA 3AS1A 4FNSA 5HMEA 5D05A 2GSJA 2V3EA 3IUHA 4JKMA 2E68A 2ZADA 3EA2A 2Z1KA 2J7CA 6XIAA 3B3DA 4NJKA 1PYFA 3OHIA 2YA2A 3WQPA 4FX7A 3ZVIA 1Q8JA 4V2XA 3QPEA 4QRNA 1Q7MA 4GBDA 4Y7EA 4FLQA 1RVKA 1NM9A 5JXQA 4QLLA 3EPMA 4Z0SA 3PTMA 4GHRA 4NSBA 3VYLA 2AAMA 2G3FA 1FHVA 3AYRA 4C6MA 7TIMA 4K7YA 4WKFA 4XAFA 4QP0A 4S3EA 4MIMA 3E0LA 1E3ZA 1TPH1 3Q67A 5CJNA 3EMQA 1F2JA 4UTIA 3ARZA 4EKJA 1X7IA 3H23A 3VAVA 4IIDA 4MADA 1TE1A 2OSWA 3LSBA 4GABA 4D2JA 2VOTA 2OLHA 1H62A 1VB9A 3UD6A 3C2RA 3PWGA 1W1TA 1LZOA 2IW0A 2WKJA 5C0QA 3EDFA 3O05A 1XDMA 1JQVA 1EBHA 5BRBA 2ZKMX 4DEFA 5FACA 3NGJA 1NH6A 2AQVA 1ZTVA 1Q8AA 4J3XA 3S2CA 4BCEA 4KRUA 5IXEA 2VFFA 3T4WA 4Y9AA 4YWSA 1TVPA 5FJJA 3K8KA 4PMQA 2WSKA 4WSKA 4DIAA 1TVNA 4IXHA 5G4EA 1M7PA 3F4DA 4Z2GA 1JDCA 2CLOA 2GDUA 3HFYA 1SGJA 1QK2A 4YTUA 1UR2A 1R6WA 2P50A 1BHGA 1O60A 3QM3A 4PEKA 1A5SA 1HL9A 1ZBKA 3BW4A 1F3WA 4R33A 1OABA 1QNQA 1KQZA 2X1SA 1A5OC 3SGGA 2W66A 5FESA 3BLIA 4Y96A 2JEQA 4Z1AA 2BBFA 4GI9A 1UHVA 3MZNA 5A3HA 4N2YA 5BRQA 3APGA 3ITXA 2WV8A 4JFVA 3ONBA 3SJNA 3O2LA 3WQVA 5FAGA 4RXFA 5E09A 1AW2A 1GZJA 5I09A 1FH9A 2G41A 7CGTA 1K6AA 1F07A 1FHDA 3H7VA 1G67A 1P0EA 1T8QA 3NL3A 4ROQA 4HJWA 3UERA 4AWTA 1HO4A 3LMYA 3O6YX 1UUQA 4CCDA 3XINA 5LA0A 4AZ7A 3M5VA 2BB0A 4WUIA 1HUVA 3WQCA 4A29A 4LRSA 3SCSA 2XH7A 3I6TA 4DYKA 1UQYA 5BWAA 4H9ZA 3LENA 1DWGM 4DJFC 1CCWB 2TYSA 3BLDA 4GRSA 3GU1A 1IWAA 3P5YA 1RK6A 2Z28A 4WEVX 4CD4A 2PA6A 1QXLA 4E2OA 2WNWA 4E3TA 2PC4A 3W71A 4PYSA 4K2SA 3ZR5A 1JUEA 1I2OA 5A6LA 1Q6QA 4E38A 5FL0A 4UIOA 4IFOA 1FVPA 3CAKA 2JK2A 5T91A 3GNNA 1VEPA 3VKCA 4A3QA 4AD0A 3U57A 1MXSA 5AC8A 5HAOA 4W84A 2PP0A 4AZCB 3T8LA 2V67A 1V5XA 3BSHA 3S1GA 4GX9A 2NUWA 4UTLA 1EGVA 2D20A 3DG3A 3VNYA 2P0OA 3N2BA 1IT0A 1US2A 3AICA 4JTIA 4KEUA 4JIIX 1WAUA 3C3NA 3PN8A 1T99A 1B5TA 1JG9A 3DBPA 2VFGA 2WANA 1DWAM 3C3UA 4W7VA 5KTLA 5DCBA 1S1PA 1MNZA 1ZFJA 3BAWA 2HPIA 2NXGA 5U4NA 1LOSA 2VWTA 3CT7A 3C5QA 1XIEA 1RBLA 3N2MA 5BNKA 3MHGA 1VHCA 4BA0A 2OMAA 4W89A 3M4HA 5KZDA 3W1UA 5HQLA 1P4CA 4KEVA 2X2GA 3R58A 5AN7A 1RQEA 3GO2A 3ERPA 2J7DA 4QNWA 1VR6A 1YTKA 3URAA 2DJXA 3PSWA 1ZUAX 3IIOA 3L0KA 3AU6A 3C8NA 1IXNA 1TTPA 3ARQA 4FLSA 5AY7A 2PS2A 3H26A 4IL0A 4ZGYA 3W1NA 1ECQA 2QCGA 1WPCA 4YU1A 5ENLA 4UWMA 2EEXA 2NV9A 1E9LA 3GXDA 4O1FA 4OVXA 4LUJA 1MZHA 2J27A 3N11A 4Q7IA 1KC7A 4CU7A 4DZIA 3W85A 2F7FA 2ABAA 2FH8A 4D8AA 3S83A 3DU0A 1SFSA 4L6HA 2PDJA 2BP1A 1L8NA 1L6SA 3GNOA 1ZCOA 2EQDA 1UR3M 3HO8A 3E96A 1V79A 3CUZA 1RK5A 3UPMA 3N17A 5I6SA 4F0RA 2Z2UA 4JIQA 3E0IA 2QCCA 4U5KA 1Y65A 3OQ8A 2OODA 2VGFA 3UWVA 3ITOA 1UR8A 2HK1A 3NG3A 1H2JA 4XO7A 1TIMA 2IKJA 2EF9A 3QRHA 3F2CA 4NQ1A 2J8TA 5FSEC 2Q8ZA 3WNOA 5IHRA 4GYFA 5GJPA 1XCWA 4H7ZA 2CLKA 1OK4A 3P6LA 3A3WA 1GK8A 2CLMA 2R82A 3L2LA 2GJLA 3KEHA 3CB3A 3GTNA 2W61A 1FDJA 4IMDA 5CZJA 5EGRA 1QI3A 3GAYA 4Q4OA 1K8CA 2EAWA 3ANVA 3LK6A 4GX8A 3KW3A 3AXHA 2EG8A 3EOLA 4HQVA 1TJRA 3PAOA 2OEMA 4ZOCA 3S8HA 2ZTJA 4D6IA 2E4TA 4HOXA 1DQWA 3BQ5A 3ZSSA 1AK5A 2A2IA 2H8ZA 2ZZ4A 3AXXA 1S39A 2F6UA 4UMBA 4GPNA 1YTEA 4PCSA 1XIBA 2DZXA 1GW1A 1YDNA 3ZVHB 1GVFA 2A79A 1H7PA 4UNLA 3GQYA 3O15A 3VCNA 5HR7A 1Z89A 3GVGA 3S5NA 1UD4A 4RW5A 1UKTA 2ZXDA 1FWCC 2QUTA 1XR2A 1E9ZB 5GPRA 3R8RA 1MMFA 2VC6A 5EPDA 2QV4A 3ABZA 5REQB 5DY2A 3CLWA 4AX6A 3POHA 1W56A 2ANUA 4LT9A 3BAKA 3BLPX 1ZB5A 2WMHA 3CEUA 1JXJA 1QNSA 2FGZA 5F2GA 1ME7A 5A6KA 1A5AA 2PDNA 4HOZA 3EWZA 3OZYA 5D9MA 1EUAA 2D69A 4J2PA 4IT1A 2FHFA 3WQ8A 2GQAA 4H7VA 1DYSA 4CD8A 1E1CB 1Z7AA 4U2ZA 3RITA 4F40A 1WDPA 5H8MA 1EP2A 1CGYA 4C6CA 4M24A 3T9PA 2ESCA 3LU2A 3NZGA 4NRRA 2OOFA 4HCHA 3QGKC 4C65A 3IK2A 2YSWA 4JN7A 5LNWA 4HMEA 4Z08A 5C70A 4DY1A 4TIMA 1KXQA 2HEJA 2WCGA 2VXNA 3CS2A 5AYXA 3I7SA 3R11A 3QHOA 3B0XA 1TKKA 3H53A 1TTJA 4JKLA 1M9HA 1BG9A 3LHZA 2V5CA 1BQGA 3ATYA 3NSXA 4D6EA 4FI4A 3HURA 2E77A 4NJHA 5M03A 1GEHA 1DIEA 1W9PA 3OTRA 5BXSA 1TE6A 1ISXA 1EJSC 3AUOA 3EX3A 4IP7A 2JFEX 2WYSA 1XCFA 3VDAA 3M7WA 3CHDA 2QEZA 3H4XA 2GOKA 4UMCA 2GVYA 3T0AA 1O1ZA 4Q8UA 3DOPA 4N4QA 1E0VA 2JKPA 4E4FA 1EP1A 4XZIA 2QJJA 4Q8WA 3GH5A 4HU8A 2W79A 2HQAA 5AB3A 2OX1A 1Q6LA 4LAZA 1A5MC 5BW6A 4R3UA 1XF0A 4WZHA 2KAUC 3ITGA 1ZJBA 3FDKA 2PGEA 5TIMA 1CLXA 5HUPA 3VDHA 3EKLA 4GK8A 4PTMA 2CXEA 4HPHA 5BU6A 4HA4A 3H24A 4PSRA 4ZR8A 1CIUA 3S5YA 3DFHA 2FJUB 2VDHA 1T41A 3NPUA 4UFHA 3SJ3A 1V6UA 3A64A 3KBNA 4HPGA 4N0RA 5DRIA 1ZU8A 4KW2A 2BY2A 3NQMA 3PJTA 2Z2BA 4K1GA 1OZMA 3QOKA 5FJIA 3E6EA 4O8AA 2ZX7A 2JQXA 1OX4B 3GSMA 1IF2A 2DGAA 3OIXA 2YCKX 3PZIA 1JNEA 2Y5EA 4HSHA 2O7QA 1BWKA 3R79A 1RV8A 2BTMA 3KTCA 4ATDA 3H2CA 4LJ3A 3QGVA 4WCJA 3QVQA 4DBWA 3QV7A 2XFYA 1DJHA 3OGVA 1ISWA 1PWMA 5D2WA 4Z17A 2ZUSA 4IZGA 4ZFCA 4LUYA 2QYGA 4F4RA 4JQ4A 4NZ5A 3FY1A 2JF6A 1OYCA 1RR2A 3U9IA 4UFLA 3E2RA 2XDFA 1K8XA 1XLMA 1Y7VA 3AO0A 3IJDA 4C6JA 4OBTA 3MC5A 4DJDC 3TOPA 3SR7A 3VD7A 2OZ3A 3BV7A 2I17A 4ZODA 4HNLA 1ITQA 2XGZA 4ZSTA 1KQYA 2WSPA 1BSIA 3RG6A 2CXGA 2XN2A 3N14A 3QGAC 3OZOA 1KTCA 3GXMA 5E5CA 3G0SA 2IPGA 3G1VA 3RDKA 2VTFA 4ZXLA 1OFDA 3L0GA 3P84A 3O0KA 2DIKA 4EACA 3RIKA 1H7XA 1U5JA 4EAMA 5C6MA 3MVIA 1GZGA 2V82A 5DXYA 4RZ5A 4J28A 3TSBA 1EZ2A 1V3HA 5AYBA 3D47A 4ATWA 2QCNA 3GWQA 1JFHA 4E4UA 2D0FA 3ZM8A 5DT7A 3M47A 5AOUA 1FDYA 1P6CA 1UYQA 1FTXA 2AQWA 3MI6A 4JXCA 1DIOA 4Y9NA 4PTXA 1QNVA 1B4EA 3N3MA 2FZ8A 1QNOA 4QCFA 3PZVA 1Z41A 1RSCA 2I5QA 2YBVA 2PTXA 4QQ3A 3UY8A 1O1HA 1OX5A 3V1HA 4LEQA 1K9FA 4GZIA 3P3BA 1UJQA 1E55A 1TV4A 3NYZA 4FO4A 1AMYA 3HPZA 2OO0A 1VIWA 1JUKA 4YTSA 3A5FA 3CQKA 1V0KA 1NTHA 4OFCA 2VI0A 4C60A 2QJMA 1GYNA 1E1FA 2Q02A 1UIPA 4RDZA 2WVUA 4CNPA 4AVOA 3LM3A 3UG4A 1ISYA 1OB0A 6XIMA 5FD0A 5IDZA 5DF0A 4O4VA 4AD1A 3N2OA 5I7GA 1PKNA 5TBOA 2HE5A 5FI8A 2O9TA 1PEZA 3D0CA 4Z0JA 3U4AA 2PZNA 4QS6A 3RJYA 3D3FA 3LOTA 3W88A 1V02E 4HK5A 2R94A 3WDIA 3WUEA 9RUBA 2XN1A 3H2NA 1TV2A 4Q4MA 2JEPA 1BFNA 5RUBA 4LANA 3SFKA 1GJPA 3QV9A 3TQVA 1I2PA 5KZ6A 3OPSA 1E9IA 3HMCA 1YRRA 4S3KA 3ARXA 5DY3A 4Q4RA 1YXCA 4IUGA 4N7QA 3GFYA 3KBSA 3UNTA 3KS6A 1KB3A 4W88A 3BG9A 3C2FA 3QYSA 2CIPA 4WQ6A 3CBWA 1QI4A 1Y5WA 1GVSA 2PURA 5LIUX 3FN9A 1KRCC 4B5XA 2NQJA 2YL8A 3WL0A 3CIXA 1JR1A 3C86A 3IGUA 2GVEA 1FWBC 1BKSA 2HCVA 4NI8A 4U33A 2XVNA 1OCBA 2Y7GA 3QFWA 1CGWA 4GVGA 2BWGA 3L4UA 3APTA 3M9YA 1BPLB 4DWDA 3KDOA 4QNEA 3VM7A 5M5DA 4KEMA 3AYVA 3SGZA 4UOZA 1ITUA 1XGDA 4TUFA 4GGBA 3UY7A 4F0KA 4S3AA 2VZSA 4NNBA 2R6OA 2QJHA 2ACQA 3KBVA 3EKZA 4S1FA 3NCOA 3OO2A 2NQHA 4NVTA 2OLAA 1YYAA 4BF7A 3V1PA 1HVQA 2YDAA 4CCCA 3UR8A 5F2MA 1SMAA 1D3HA 1F3XA 1J0HA 1B3VA 3EOSA 1FWEC 1TWWA 5HMSA 3BGAA 1VFLA 1ONXA 4L7ZA 3LXAA 2X1TA 1V03A 3V0UA 5AFDA 4CD7A 2DVUA 4HYVA 3OVQA 4H9YA 3VOCA 1E0XA 4EXBA 4DBSA 3NQVA 2VX7A 3UXDA 4W8BA 4RJEA 4GNVA 4H00A 3BCJA 1VRXA 4GI4A 4WDUA 1EEXA 1RXOB 3EDJA 1QPQA 2QCDB 4LFYA 5D8ZA 4Z2HA 3KHJA 1EO7A 3WLPA 1XC4A 2FMNA 4EAYA 4KRTA 3CPRA 3WLNA 1DJYA 2OG9A 5E0FA 3FGCA 2Y5SA 4ENLA 2ATMA 2ZC8A 3SCQA 4FF5A 2A3CA 3I6RA 3W72A 1F8MA 4GO8A 3CH9A 4MLRA 5DT5A 2AMGA 1VEOA 4JYEA 4M19A 2WQPA 3H2EA 2XGIA 1REQA 4QITA 4GI6A 3TFXA 1ZALA 4MWAD 2J66A 3EDEA 1HW6A 2WNNA 3E12A 3CH0A 4M81A 4RXGA 4FIQA 2DSWA 1OC7A 3ATZA 3B8IA 4I6KA 1R3SA 2FTYA 3T40A 2ZRWA 2W9MA 4ZO9A 1WA3A 1G7UA 3M0HA 3BW2A 3II1A 4B90A 1B3OA 2AL2B 2QMJA 1B30A 5CKSA 3WLSA 3CZEA 3WL1A 4YWIA 3T8QA 3TXVA 1XLEA 3L9CA 2YDQA 1D8CA 1K70A 3BG5A 2CLPA 4L1WA 4PMYA 4TO8A 3TEVA 1VQTA 2RGMA 4RNJA 3PBUA 3QR0A 4AH7A 4EWND 2I7GA 4RE3A 4IG2A 3CUHA 3S0CA 1QU4A 1DIKA 4UTUA 3BLFA 2CZ5A 4QAIA 4EPKA 3F7JA 1EH9A 1YLVA 1X1ZA 4GVFA 2R14A 1PHQA 4NAFA 1SO3A 1SO6A 3NM1A 2P10A 2HJPA 3UU0A 5I00A 1UKSA 4L64A 4UXDA 5F1VA 1AJ0A 2RGLA 2EG7A 3WBXA 4FA3A 3EXRA 4FX6M 2I9UA 4FXSA 4MJMA 1HJUA 3J7HA 6A3HA 4WRHA 3NIYA 1UUMA 1UR1A 1FFRA 4JIRA 4EPDC 1I60A 1YE6A 3E49A 1H7WA 3MMTA 2CZDA 3K46A 1GQIA 4R9XA 2X16A 3BMXA 3TJ4A 2WOQA 3ABOA 3AROA 1BF2A 4ZTXA 1FWHC 1ZJAA 4HNTA 1EJUC 3LBMA 3WSUA 2ABBA 4MNLA 4GG9A 4XB3A 2QULA 2VRKA 1L6WA 2EGZA 3L5LA 5EBAA 4CLMA 4W7UA 4GUIA 1BWLA 2QVHA 5A8GA 4JYFA 1RD5A 3HQ1A 4UOJA 4EIVA 3GTFA 1J6PA 4X2PA 1LTDA 4HJFA 2Y8KA 3LSCA 5IBXA 1MWOA 3FSUA 2ASHA 5DBTA 1HIZA 4H9UA 2PDPA 3OVPA 4NAEA 1KCLA 4LUIA 4Q6XA 4WGXA 2YL6A 1X39A 5C2XA 1H49A 1L2UA 4FNTA 3WX7A 1HJVA 3WLLA 1JZ8A 1RY8A 1QUMA 1WB0A 2FZMA 1LORA 3KVJA 1TWZA 1PSCA 1UWRA 3RCNA 3MDWA 1HJXA 1LDCA 3ES7A 1EDQA 3ZQ9A 4AD3A 2CLIA 3DYMA 3CUIA 3DFTA 3LZ3A 1A5CA 4HMCA 3BO9A 1VJZA 1W17A 3TN3A 4X0NA 1DJQA 5SWUA 1TTIA 1O5KA 4M56A 3CAQA 4GGHA 3GTXA 4MY9A 3RR4A 5LZLA 1A50A 1ZZMA 5E9AA 3WD0A 5FJRA 3WBYA 1KGXA 3BMWA 2ZBTA 3UG3A 3MCOA 4N9DA 2J4GA 2OZTA 2WM0A 1FQ0A 3O7UA 3WH9A 2I5IA 1JEZA 4H19A 4NT0A 3AS2A 4GH1A 1IZKA 3SQLA 4D9PA 2WC3A 1R38A 4O10A 3AMDA 2OYLA 3V18A 3P8JA 4XZBA 3TOYA 1Q85A 2TRSA 3URNA 1B3ZA 3LY0A 2D0HA 3TA6A 1VFUA 3VM5A 2HV5A 5AECA 3Q37A 3S2MA 2BVDA 4RZ6A 3IJLA 1K7XA 4GZJA 4PUEA 1DV7A 4IP4A 4X9YA 2G97A 1X6NA 3B0PA 3UXKA 4ASTA 4TTUA 3FEMA 4UNKA 3STCA 1SSGA 2PDQA 3WQ5A 2X41A 2RAGA 1X8FA 5LXEA 1R3TA 1XLIA 1V3KA 3M5XA 1ME9A 1VPQA 2X7WA 4LUTA 1G4SA 3VD4A 3RN6A 3ZJ8A 3HIJA 4OTKA 1E0UA 2JGQA 7REQA 3W7GA 1VBRA 3MTWA 1SFJA 3OA5A 4DBUA 3TDFA 3WNMA 2CHRA 2Q71A 1BTMA 3HJEA 3O0FA 1JPDX 4REQA 3B8TA 3CIVA 4C6KA 3GR4A 1CZ1A 5A6MA 1I1XA 4O1CA 2PMQA 3NQFA 4DRSA 2Z1SA 2A7RA 2RHGA 2EJ1A 2G3IA 1QW8A 2WWCA 3WYZA 3LCXA 3E3HA 3IJ9A 3TWBA 1Z48A 2Z1BA 1BG4A 2QUNA 4BI5A 3NDZA 5C2GA 2V81A 4B3ZA 2JKAA 2C91A 4C91A 3U7BA 3RLHA 1OX6A 1JNDA 3WK3A 4B5WA 3UXLA 1ADSA 2EJAA 3F5JA 4UQ9A 4U2YA 4DUVA 4HK7A 1DJNA 4ZFMA 2AKZA 2INEA 4A22A 4O1AA 3IVSA 4G7FA 1W37A 1D2KA 1S2WA 1JI2A 2DPEA 3T55A 3GLCA 3V3WA 4HPJA 1RP9A 3KL0A 4BQ4A 1DPMA 3VCRA 1XYLA 4LCSA 2V5DA 3LN3A 8XIAA 3CC1A 4MAVA 4ZE4A 3ABXA 4AG0A 2GWGA 5EY5A 3M07A 5AHIA 3MCNA 5DN1A 3K1DA 3CZJA 2XSAA 2EPKX 2XG9A 4B5TA 7PTDA 3SIMA 1J18A 4ZOAA 2PP1A 3N18A 1ZPTA 4IGNA 4EF8A 3SN0A 3G18A 3MJYA 4BJHA 2YXXA 2C6QA 3AHYA 4RNIA 1FCQA 3UWEA 1PKYA 2ZUMA 2J7FA 2WHKA 4XKYB 2PAJA 3L67A 4OV9A 2OSXA 1PZ2A 1K3UA 4JTAA 4AVFA 4IXXA 3E0WA 3VIPA 1KRMA 1O5XA 1EJWC 1Q5MA 3WLIA 1NIUA 3QBUA 3UETA 4F66A 3WFLA 4DYJA 1KWGA 3TFCA 1I2QA 1B1YA 3RILA 3SQMA 4O28A 2G3NA 4LBUA 2A1YA 1JGMA 4OOUA 4XTDA 4G6CA 2G96A 1B3YA 4LB3A 1E6PA 3I68A 7ENLA 3LI0A 3TR2A 3IIZA 3DBNA 4KWSA 3UR5A 3GKFA 4C6IA 1VP5A 1BXNA 4H9VA 4AZ6A 2PF0A 4I5UA 1ZS2A 3PK7A 3UPWA 3WLHA 4P7QA 4EANA 1FBAA 2XGBA 1TA3A 4JNYA 4I7WA 5FOOA 5I02A 3KVMA 1LLWA 1FP8A 4M82A 5C55A 4P7OA 3QZ6A 1A3WA 3AISA 4XQ6A 1EP3A 5CPSA 3QZEA 4KCTA 3RGTA 1PZ1A 3KCLA 3KE0A 2YFOA 1A4MA 3W7DA 3ZR6A 4QISA 3O6AA 4UZSA 1WYIA 2OEJA 2BZNA 3URBA 1QOPA 1I45A 4EF9A 2OX4A 2ZFAA 2VM8A 3B0UX 3H7RA 3S2LA 3FA4A 5BOEA 1IXOA 4OQVA 4KWVA 3PUGA 4ZE5A 3RM9A 1K03A 1DOSA 1WOBA 4YTRA 2VURA 3I65A 1REQB 2DSVA 3GBEA 1GWJA 3LCGA 3S6DA 3FYOA 4JX4A 5MF5A 4F0SA 5HJYA 1TJPA 2PGFA 2QLYA 1Q6OA 4ML4A 5HPOA 1UP2A 4W85A 1WKEA 5I79A 4BF5A 4F8XA 1VYPX 3BARA 5D4YA 1NF0A 3NL5A 2QCMA 3WK0A 3B8WA 5C2CA 3N6JA 4PSPA 2OKTA 4ZQRA 4DJED 3T09A 4NXSA 2A5HA 1OK6A 2WNZA 5FIPA 3R0DA 3TC6A 3PWIA 2E40A 3FAWA 1J8VA 3QR3A 2Y4SA 3R2GA 2FDSA 2PTZA 1A5LC 1IEIA 3LQLA 1TUFA 1QI5A 1DBTA 3QMRA 4LV9A 3CV1A 1B9ZA 1O12A 3GIQA 1QW9A 3RX2A 1MFUA 5EMKA 2J47A 1O7AA 4HHHA 2E1DA 2PD5A 4J1OA 5JH2A 3CAWA 4Q3MA 3VKJA 1PDYA 1RLCL 3SSJA 4OUEA 1W31A 1UW9A 2O4QA 3TKFA 4WKHA 1FCVA 5HQEA 4JFUA 1KCKA 5CJMA 2ZXBA 1LG1A 4QJ5B 3HV9A 5TAOA 3LGGA 4X63A 1CW2A 4K8EA 3B9OA 1JPKA 3G8EA 4ZQMA 1PX8A 1H1ZA 5KETA 1W1IE 3F4VA 4X61A 4HA3A 4DJEC 2ZZ2A 3C2YA 4WSJA 1NP2A 4XKYA 4BF9A 1OHLA 4L9YA 1GVIA 2HPMA 3W1MA 2W91A 4NYUA 1IZCA 4LW7A 3YPIA 3CEPA 4F9DA 3O06A 3QKEA 4GO9A 4AHPA 2XSBA 3NQGA 4D1IA 3CZ8A 1VFMA 4HHLA 3W7LA 3MMWA 1JL8A 1PWLA 3MBFA 1UR4A 1GQLA 4OOZA 1TO3A 4LX4A 3T78A 1IWPA 1NWRA 3H7UA 4JTTA 4R5EA 3EGJA 3WQEA 3A9BA 1E4LA 9XIAA 1R7AA 4WLCA 1KM5A 2HDJA 4Y9MA 2JKEA 1C91A 1O66A 4N4PA 5BXTA 3LZ5A 1QWGA 4NAEB 2ODOA 1I1WA 1BYAA 3NURA 4S2CA 1JPMA 2C1IA 4UNIA 1FWFC 1OFAA 4DHGA 4J40A 4PUUA 4U31A 4O54A 4MYAA 1VGAA 3XISA 3GTHA 5HWMA 3U4FA 4K8HA 4KF1A 4Y9PA 1RH9A 3KFTA 4ZO8A 1O5RA 4MSSA 2QIWA 3VKDA 2ZE0A 3F2BA 1V4YA 2TMDA 1UWSA 2V3GA 5CC5A 4CQAA 2GWNA 1XIGA 2DH2A 3VMPA 3WUGA 2EKGA 3LCIA 1QT1A 2J75A 4X2RA 4NZ3A 2ZYFA 4E4PA 4TXEA 5D32A 5D02A 1CXLA 2GGHA 4BY3A 3T0CA 1OSEA 3NPWA 3WNPA 1A5NC 4MYXA 4N9CA 4CU6A 5AHNA 3GC5A 3U6WA 3W25A 3N25A 1XBZA 4PH6A 1WDQA 3FKRA 2WMIB 4MJZA 3Q4DA 3W70A 3M0MA 2C14A 3W1AA 3ARTA 3UZWA 3W7QA 1R2TA 1TPDA 3RU6A 1TG7A 5J8LA 1KFCA 3FSTA 2QCLA 3UZ5A 2DP3A 1XX1A 4DNMA 3UESA 4GJ1A 4K7VA 1BSLA 4HU3A 1GVEA 1KXVA 3KBJA 3SURA 2DSUA 1NJJA 2O9RA 4I9MA 4NI3A 4K36A 4JTQA 2VNCA 4RPQA 2NV1A 5CSRA 1X97A 1HN1A 3L2IA 2PWDA 1U1JA 4IHCA 8XIMA 3SECA 3LTYA 3KUMA 4RCXA 1KFKA 2CBUA 2XIOA 1F6YA 3RLUA 3AWNA 1FFQA 1MQPA 3UR2A 1M3UA 5F4SA 3PZMA 1ONRA 4GVHA 1U1UA 1KM0A 1LWHA 1NEYA 4GZ7A 1IWBA 2Y1HA 4J3SA 5B80A 1DTNA 4EP8C 3EA3A 2Q3RA 1UOZA 3MUAA 3HG2A 2YW3A 3VIGA 1CWYA 5FEWA 1X6UA 4PRRA 1IEXA 1YPFA 4LWWA 3VA8A 3WF2A 4GNKB 2YOCA 3OZPA 4XSMA 1SUXA 3VNJA 1N8FA 5LIWX 3R43A 3OG3A 1TPEA 1W9DM 3H2FA 5E1QA 4IFRA 4LNCA 5CH9A 3H22A 1Z8AA 1R9XA 5D30A 3BAYA 2CZEA 1SFLA 3L12A 2VQTA 3EWCA 2D2HA 1CB2A 1CI1A 3HQPA 3O8AA 4PMZA 1J96A 1AFSA 2ZX8A 3B03A 4TTGA 2HRWA 4GUJA 3BICA 4JPGA 2CWNA 4IWWA 3HBLA 4G1KA 4KFNA 2H90A 3NUKA 3P5ZA 1P7TB 2E9BA 2OB3A 2DU2A 5LIXX 1ITXA 3ZR4A 1K1DA 3P0XA 2ZX6A 2EBNA 3RU8X 3T7VA 1MUWA 2P88A 1QBBA 3TYBA 1CDGA 3HPXA 4JIPA 6TIMA 5C9ZA 4QSHA 2EXOA 2VZOA 2Y61A 3DHFA 3L7RA 3TN6A 2E5BA 3CHFA 4RDWA 4FNRA 3BWWA 3H54A 1AD4A 3WMSA 3A12A 1NP0A 3DXIA 1Y5VA 4HTBA 5IFPA 3PZGA 3UWWA 1N8IA 1TCDA 3GS6A 3NR0A 5I03A 5F2LA 4X9SA 1C93A 5HQMA 2VX5A 3P2VA