2R8WA

The crystal structure of dihydrodipicolinate synthase (atu0899) from agrobacterium tumefaciens str. c58
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
297
structure length
297
Chain Sequence
DMATRFKGLSAFPITPADEAGRVDIEAFSALIARLDAAEVDSVGILGSTGIYMYLTREERRRAIEAAATILRGRRTLMAGIGALRTDEAVALAKDAEAAGADALLLAPVSYTPLTQEEAYHHFAAVAGATALPLAIYNNPTTTRFTFSDELLVRLAYIPNIRAIKMPLPADADYAGELARLRPKLSDDFAIGYSGDWGCTDATLAGGDTWYSVVAGLLPVPALQLMRAAQAGNAEEAKRLDATFQPLWALFKEFGSIRVIYAAANILSLTVSEPPRPILPLTSAERQRVEEALEALS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of dihydrodipicolinate synthase (Atu0899) from Agrobacterium tumefaciens str. C58.
rcsb
source organism Agrobacterium tumefaciens str.
molecule tags Lyase
molecule keywords AGR_C_1641p
total genus 104
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2r8wA00
2QCHA 3W7RA 3S1WA 4I7WA 1U83A 5CZTA 2TRSA 3G1XA 4TX9A 5LHFA 1PVNA 4MFEA 2LLEA 3W3OA 4GE8A 4Y9AA 1J5TA 3BK0A 3TDFA 1QAPA 4K37A 3B03A 1RQBA 3T44A 1W0MA 3W7NA 2NV2A 5AB3A 1SZGA 4UTTA 1P0NA 3WJSA 4QAIA 1FY6A 3THQA 1SFJA 1OG0A 4FF7A 3W2JA 5CSSA 2YSWA 3EXTA 2RFGA 2ZZ5A 4X2RA 5TIMA 1RZMA 4WXZA 1X1OA 3JS3A 3PVFA 1AL7A 2BWGA 4QSHA 5SWUA 3KVKA 5LNRA 3QW3A 2Y88A 1M7OA 1IXNA 2E6DA 1TQJA 1U5JA 1GYNA 4LWWA 2Y7DA 4LS1A 4AXKA 1B57A 2RHGA 3W7KA 1LBLA 5AFDA 3GXNA 1C29A 1GTHA 5KTLA 3W7OA 3ABSA 3LERA 4IXXA 3QMSA 4PH6A 4DF2A 2J24A 3TQKA 3M43A 3IVTA 4DQWA 4LUJA 3HG3A 3OEXA 3LGEA 4JX4A 4XKYB 5G2WA 2IQTA 4RZ6A 1XM3A 1JCNA 3LXBA 1W54A 1Q3NA 1QNVA 2V2DA 5F2MA 3UWWA 3IIVA 4AAJA 5I3IA 4GUFA 1TPUA 2QCMA 5D2VA 3I6RA 1LLZA 3CB8A 1ZNNA 3LM7A 4GJ1A 4PFMA 1ADOA 4D2JA 1EIXA 1EWEA 5CPLA 5TBOA 4A22A 2YR1A 5FF3A 4RCXA 4RXFA 3HF3A 6ALDA 4O0ZA 2VFDA 2FTPA 1ZAIA 5IBXA 5C6MA 2C13A 3W71A 2NXHA 3HG5A 2C3ZA 5F1UA 1DHPA 4LRSA 3TH6A 3GKFA 4LVBA 4CLMA 3LCGA 4AWTA 1P0KA 1FCVA 3KHJA 4ORIA 4CQ8A 4U28A 4KWVA 1F76A 4IQLA 5KZEA 1ALDA 3VFLA 3P62A 3OVQA 1KTBA 3DI0A 4TO8A 2BTMA 4KKXA 1KM6A 1BEUA 1VR6A 2XN2A 5LZLA 1T8XA 4HT3A 1C8VA 3S5YA 3W1TA 3DFNA 4KFNA 3TQVA 2V5BA 1JCXA 1DL3A 1TTJA 1P1XA 3KVLA 3LXAA 4HKPA 3SECA 2X1SA 3GKAA 1O5KA 3W1LA 2FPYA 4OV4A 3TAKA 1XKYA 4GWEA 4FNQA 2ABAA 1GG0A 5BRBA 4MOZA 4DO5A 3M16A 3LI1A 3O8AA 3DAQA 2X1UA 1DQWA 4NZFA 1WXJA 4UFMA 4WZHA 3GR8A 3T78A 1JCMP 3UXAA 1H51A 4S2CA 1RV8A 2DU2A 1W56A 3UPWA 2QAFA 1G67A 2OCZA 1DQXA 4NVTA 1GG1A 1EP1A 1VLWA 4AF0B 4DPPA 3PB2A 5LKYA 3UD6A 4HHPA 4O57A 3CIXA 4A29A 3CHVA 2J9ZA 2FB2A 3A5FA 3SGZA 4DPQA 1GVFA 3E96A 2FQIA 3O07A 5DELA 2QCFA 4LY8A 2A7NA 3U6WA 3GDKA 4IX0A 3TSDA 3KVMA 3T55A 4JR5A 2VEMA 4NT0A 3LHTA 1SZEA 3NQGA 2Y7EA 4NNAA 1ONRA 4IMCA 2DZWA 4U4MA 2Y7FA 3GZ3A 5HJLA 2WNZA 3NQ7A 4UFKA 2GPTA 3NPVA 3FKRA 1SW7A 2EF9A 2ZBTA 3P8JA 3LTSA 1TJRA 3MP3A 3G1SA 5FF0A 3Q58A 4FHAA 3O63A 2GQ8A 4WY0F 2TPSA 1JQXA 1H61A 4Z08A 4PL2A 3TA6A 3ZS4A 3GB6A 1AW5A 1WQ5A 1W3TA 3M6YA 3PAJA 1GVRA 4NNCA 2ISWA 3NAVA 3GX9A 1NEYA 2Z2UA 1HO1A 2OJPA 4K8EA 2V5LA 3W75A 3C52A 4O14A 4JD4A 5G4EA 1K02A 3TK7A 4S2BA 4UTTC 3SGUA 3HOJA 4MZ1A 3HPSA 4P2VA 2QUVA 1OABA 3W1QA 3IIPA 1FX6A 3L68A 3A5VA 3OVPA 4O50A 2Y89A 1XBZA 1SU5A 2ZZ1A 3G1AA 3TW7A 2UV8G 3MP4A 5K3VA 1QPOA 3PF3A 1N8FA 1JQVA 2EKCA 4O4WA 4UIOA 5DCBA 1RQEA 1WV2A 1LTDA 3NL5A 3QFEA 2F84A 4LT9A 3L5MA 2CLLA 3W1PA 4RZ5A 3BW3A 3IRDA 4L4MA 4NXKA 1O94A 2HS6A 5AHIA 5G1TA 2CZFA 3WJWA 3W7LA 1R47A 1TPH1 1OVDA 1OFEA 4TU1A 1K03A 1TTIA 2ISVA 2XFWA 4UCGA 3DU0A 4JTTA 1W31A 1YXDA 1KM1A 3V1PA 1X7FA 2ATSA 5KZMA 5F2GA 2A7PA 4WOQA 2QUTA 4Z1BA 3L66A 3H55A 5FEPA 2Q8LA 4WY0B 3OG3A 3PBWA 3EB2A 1FWTA 2Y62A 2YZRA 1ICQA 1G4SA 2RDTA 1KLZA 4M7TA 5D2WA 1SQ7A 3LCFA 5DLCA 1XUZA 1SW3A 2BLEA 3MHFA 3NYZA 2YPIA 3NZRA 1TPC1 1WAUA 4TMCA 1G4EA 2Y7GA 2RKXA 4FNSA 1GYLA 1GVOA 1TPVA 1GQNA 2YFOA 3NQCA 2B7OA 2WNQA 2JKEA 3CM4A 3KRSA 1QR7A 4AHQA 3FLUA 1I2OA 1TTQA 4IPJA 2OZ0A 1OK4A 1IIGA 3THAA 1A5SA 4WD0A 4O19A 1H7WA 3N9SA 3IVSA 2JBMA 4RX0A 5D33A 4HIBA 3BGGA 1BWKA 2R94A 4N02A 4JTEA 2ISSA 5C55A 5K4ZA 4LRTA 3W70A 4Y96A 1NFBA 3DHDA 3G0SA 1ZHAA 1NF7A 5D2TA 2ZZ4A 4IMDA 3MUXA 5FEWA 1ZCOA 1YDOA 3DHFA 2VFEA 2YXGA 3ABQA 5LGXA 1HUVA 5EBUA 5G2HA 3TU9A 2QCDA 4XUGA 2CLEA 4LVFA 1SUXA 3HIJA 3O6DA 4UTJA 4FX7A 2GQAA 4HN4A 3M1ZA 1SSGA 5BMWA 3MHGA 2ZZ6A 1SW0A 3O05A 3USBA 3R12A 3LHVA 1AW1A 1XCFA 5DXXA 1I45A 2X16A 1M7PA 2A0NA 3TC7A 4GBUA 4HNTA 3I65A 2J27A 1LZOA 2QJHA 1GEQA 3ZR4A 1KA9F 3ANYA 4NJIA 4DEFA 3T4CA 1W3IA 2Z6IA 4O18A 3PUDA 3O15A 3NQAA 3LCWA 4LV9A 4HNVA 3U2OA 4LTSA 3PY2A 2Y70A 5K4XA 3E0IA 3HB9A 3PM6A 1VLIA 3KRZA 2Q3OA 5J5DA 5AYYA 5F2LA 1LORA 5AN7A 3WK1A 2CZEA 3HJZA 3TCEA 4UMAA 3EXSA 3BARA 3TFCA 3B0PA 1CX9A 2NV1A 1XFBA 3PC0A 3P81A 4FNRA 3HGJA 1KBIA 3TFXA 4AHPA 1NVMA 4DF1A 3ELFA 2YCEA 2VFIA 3EWBX 4LW7A 3PBUA 3VNDA 1QPQA 3NL6A 4LC6A 3GXTA 3W7IA 3BG9A 2YYUA 1SO4A 1B9BA 3LXCA 4O11A 4M6VA 3EWWA 1I2RA 2H3BA 4WX2A 4CQ9A 3W6YA 1LOQA 1DJNA 4Z0JA 3N73A 3PUOA 2A6LA 3KRUA 3CWNA 4PTNA 4OV9A 3RFAA 1KW1A 3AO0A 1PV8A 2ZA3A 1Z44A 3VKJA 1AG1O 4A2RA 2VFGA 3G8RA 3NEVA 3KX6A 2YX0A 3TE9A 4UMBA 1B4KA 3MI2A 4UUIA 2G95A 1JCJA 1YPFA 5AC8A 2DZUA 2E68A 3C2EA 1NAL1 2QCCA 1KFKA 3C6CA 4K8HA 4UTIA 1UB3A 1R2SA 3Q94A 2Y85A 4UR8A 2NZLA 3IIXA 1LRNA 2X2GA 1TTPA 5FEZA 3DXIA 3W7EA 4A21A 1KFBA 4YWIA 1R2TA 3UYCA 1JULA 3STGA 1ME7A 3M0ZA 2DORA 3MWAA 2FPTA 1A50A 4OHQA 3R8RA 3C2RA 3EX6A 3HG2A 3SW6A 3GDRA 2V8ZA 2XN0A 3T40A 1W5NA 4ZQNA 3M5YA 5LHEA 4POCA 1KBJA 2R14A 1XXXA 3S1VA 2PURA 1J4EA 3B4UA 4Q33A 1MXSA 1S5WA 3L9CA 4OBTA 5IBXC 3M47A 2WKJA 2VC6A 4XBSA 3WK3A 1FDYA 1DORA 4MZ8A 3BG5A 5D30A 3TSMA 1EX5A 4UFHA 2CW6A 4N9BA 3Q2DA 3RMJA 1G69A 3GR7A 3ABRA 1GVSA 4N9DA 4HNUA 3NVTA 3MJYA 3QJAA 2E1DA 1LM1A 3W87A 3S9YA 1IGSA 4FX6M 2E5DA 3RLUA 1LROA 5K2ZA 1QDSA 1G4PA 3NO5A 4ML9A 2R8WA 4GC4A 4JDYA 1FXQA 5KITA 4UFJA 1TMHA 4JDBA 4NX0A 3QQ0A 4NJJA 1D3HA 2GJLA 4OE7A 3GDTA 5KINA 3VE9A 3W2UA 4LUIA 5CG7A 4X3ZA 4GRSA 1NF0A 1VZWA 4IJBA 3W7JA 1C9DA 4NJKA 2B0MA 2Z1BA 3MBDA 4AF0A 5CSRA 3W85A 1OHLA 5LNSA 3STFA 2CWNA 4MFDA 1Q45A 2ZZ7A 1EP3A 2R91A 1TB3A 2QR6A 3W1MA 3EX1A 3BPWA 4AWUA 1GTEA 4MUZA 1J2WA 3FEMA 4C1LA 2C0AA 1IIHA 2AAMA 4I9AA 1O95A 1FUYA 1EUAA 1EWDA 2E6FA 4O1BA 5DY2A 2D73A 3W74A 2GQ9A 4N2YA 3TV8A 1OYCA 3MO7A 2CU0A 4LU0A 3I7RA 1MEHA 5KMYA 2FDSA 4R34A 3MBFA 5D04C 4OQVA 1X6UA 4JTUA 3G18A 3M41A 1TPDA 3CC1A 3NNTA 5KSWA 1H60A 4R7JA 4LC8A 3HG4A 3S0CA 1EA0A 4Q32A 2O7QA 5U7SA 3RNDA 4JTHA 3NQ6A 4MY8A 3TKFA 4O16A 3W1XA 2V30A 1LCOA 3W86A 1OX6A 2RDWA 5HUPA 3QSTA 4UR7A 4BI7A 1QO2A 1TRDA 4JTSA 3LCHA 2PRLA 2ZA1A 5I3KA 1W5PA 5DN1A 3UY7A 3PG9A 4IWWA 2H8XA 2EGZA 4O54A 3OBKA 4B5NA 3W1NA 2HSAA 1FCQA 2E77A 2G5WA 3GXPA 1TPWA 1G7UA 3LLFA 4RJEA 1WOBA 3JR2A 4MLRA 3C61A 4JTLA 3G3DA 1H7PA 1R30A 3QSRA 4UTLA 3LHZA 1XBXA 5HR6A 3CT7A 4A3UA 3QC3A 5HMSA 1LBFA 3NXFA 3D0CA 4XTIA 1F5ZA 5D05A 3H53A 3SIZA 3NQFA 1Z42A 3MI6A 4QJ1A 3LHWA 3TJXA 3TAOA 2J9XA 5F2IA 3LTPA 2AQWA 4ZQOA 3W2MA 3O06A 2Y6ZA 3N2MA 3P5ZA 1A5AA 1G6CA 1FCBA 1T96A 4EVZA 3MMTA 3QH2A 5I3GA 4H3DA 4UNLA 4IOTA 1LP6A 3E9AA 2B4GA 1HG3A 3HMJG 1TYGA 3L0KA 2ZRUA 2ALDA 4Y90A 3L2IA 5A5WA 3IGUA 2PC4A 3L67A 3S5NA 1WA3A 3BW4A 1VCFA 1SZNA 2V2CA 2E6AA 4O8RA 3W2NA 5G2IA 4HPJA 1O5XA 4QISA 1VHNA 3EX2A 5MHBA 4JTGA 3GDMA 5BW6A 3EXRA 3PB0A 3LCLA 1OFQA 7TIMA 1QWGA 3EX4A 4NJHA 1GPWA 1YTEA 3WJXA 1HL2A 3IIOA 3QYQA 1KLYA 2NWRA 2V81A 1QOPA 3M5XA 4FB7A 1BWLA 5EYWA 2BXVA 4FO4A 4G1KA 5I3HA 2A7RA 2VXNA 5AHEA 3IGSA 1B4EA 3W2KA 1K7FA 4NQ1A 4XQ6A 4MZYA 3L0NA 3IEBA 3HGRA 4YLWA 1L9WA 3G1HA 4JX5A 4YCOA 4MYAA 2RH9A 2WJZA 1G7VA 2ZDRA 5I3JA 2H8ZA 5BMXA 3MW7A 4CCDA 2V0TA 4K38A 3R13A 4UTWC 3NPXA 3P61A 1IXOA 1SO3A 3L21A 1JUBA 1VCVA 4GUHA 1LLWA 1EB3A 1KM3A 4O4VA 1QPRA 3LTYA 5LNVA 3F4NA 1FQ0A 3TNOA 4PL1A 1KTCA 4UXDA 4NX5A 2NX1A 2C6QA 3N3MA 4ONVA 3GNDA 4C1KA 3NM3A 4LVDA 3BG3A 3RK8A 4H4IA 1DJQA 4QM1A 4UMCA 4O15A 5HWJA 2PRMA 3C56A 1CI1A 3KFTA 4JY9A 3TJLA 2DZSA 3G1FA 4IPIA 4KFPA 4EF9A 3O1NA 2HS8A 3MYOA 3LHUA 3KVJA 4NJGA 1EUNA 1M5WA 4XKYA 1I2NA 4HNNA 1OFDA 3IGXA 4O1CA 5AYXA 1DKWA 2A6NA 1QCWA 3BGJA 2EHHA 2JKPA 4LS2A 4NNBA 4MLJA 4O1DA 1AK5A 4ALDA 2V2HA 4JS3A 2VEPA 2WOQA 1KFCA 1I2QA 1X8FA 3NQDA 3QW4B 3UWYA 1VHCA 1TIMA 1VS1A 2A2IA 3LI0A 1PCKA 1TV5A 1LRQA 1OX4A 5TQLA 3G24A 3A22A 3S1XA 4CCEA 1LRTA 3PWAA 5D38A 5DY3A 3LLDA 3FYPA 3WJZA 2TMDA 1Z48A 1H62A 4BWLC 1ME8A 2Q3RA 1F05A 1R46A 4GNJA 3W07A 3PG8A 1YTKA 4QQ3A 3B0UX 4MYXA 2C18A 4NZJA 1FWSA 4DO4A 4MY9A 4CNNA 5CZSA 3TIMA 1GOXA 2E09A 2C14A 4DO6A 4NXSA 3NM1A 4GFSA 4WOZA 3UWQA 4K36A 4BI5A 5CPMA 2C19A 3PUEA 2J6XA 4BI6A 4LV4A 5G5IA 4UTMA 1HFBA 3UWUA 2ZZ2A 4GUGA 3S5OA 4Y6GA 1MO0A 5DCDA 1R2RA 4KFOA 3TQ0A 3NPUA 1YADA 1UUMA 3G0UA 1YPIA 4CNPA 5D09A 3QPZA 2OMAA 5H2ZA 1KTNA 3G0XA 4Z1DA 3G22A 4AEOA 4MVAA 1ZFJA 4RV8A 4DBDA 2QUUA 1Q6OA 1SZFA 2C16A 3W73A 3ZWSA 4UTHA 4WY0A 1LYXA 3NL2A 1F74A 2FFCA 2DZTA 2ZA2A 3BV4A 3FKKA 3QRHA 3W83A 4FNTA 3KXQA 5AC7A 4ORMA 5FI8A 4ZZ9A 2V9DA 2JGYA 4JIQA 1UUOA 3NQEA 1W37A 2J9YA 3BLFA 3L0GA 2YYTA 1H7NA 1TPFA 2B7NA 3E12A 1H1ZA 5LNUA 1JVNA 1JCLA 3MYPA 1PIIA 3A9IA 1M6JA 2GVGA 3W23A 2ZRVA 2ZQ0A 2FJKA 5HWMA 3FIGA 2I14A 2ZRWA 3FJ6A 3LOTA 1VYRA 1N55A 4BFAA 3V75A 3P7YA 1THFD 1FDJA 1UJPA 1ZY9A 4WUIA 5A8GA 4M6QA 4PC8A 2WQPA 3NL3A 3Q37A 2A4AA 1S5VA 4O28A 1EEPA 1XDLA 4ZQPA 1XDMA 2Z6JA 1DOSA 1L2UA 1RPXA 2YW4A 4YXGA 4TR9A 5KZDA 2FIQA 5DBUA 1WYIA 5AYZA 4PEKA 1ZALA 1VYPX 3SZ8A 3LCXA 1K7EA 1MZHA 1RD5A 2JK2A 5E93A 2J88A 4OT7A 2TYSA 2WO5A 3WK0A 1WBHA 5EY5A 1BKSA 1W5OA 1QFEA 1W3NA 3QZEA 1OJXA 4IX2A 3UWVA 2WV8A 4PA8A 5C5YA 3DFTA 3TSBA 3BO9A 1T0OA 2WSRA 2ZRYA 4FX8A 3SFKA 1ICSA 4RK8A 5L6UA 4XZ9A 4ZQRA 1I2PA 1KM2A 4K39A 4M5PA 4N4PA 3TX9A 2F7FA 1JRCA 2VENA 3EX3A 3F1QA 3NDOA 1P4CA 4R33A 2YGYA 2A21A 5G1YA 4N9CA 1V7YA 1G4TA 4RR4A 3HGOA 3GNNA 1UCWA 5K9XA 2TSYA 4CCCA 2H90A 1A5CA 5EMUA 3VE7A 3QMRA 3CU2A 1A5BA 3LRLA 4M19A 1S3HA 2A5HA 1VC4A 1OF8A 4MY1A 2ZRXA 3W7CA 5EA9A 3F4WA 4I7VA 3L65A 1GVQA 1W5QA 3LHYA 4LVGA 2Y63A 2ABBA 4R53A 3CTLA 3FFSA 4GUIA 3NOEA 2QDGA 2I9EA 3CEPA 2A1YA 4YCPA 3DFOA 3NZ1A 1FCUA 4XWUA 2FPVA 2C1HA 1FDZA 2NUYA 2W6RA 3UY8A 1HTIA 5K9CA 1Q6LA 1F2JA 4O17A 1OFBA 5CPOA 3NG3A 4H6KA 1P5BA 5AHFA 3BW2A 4Y8FA 2X30A 4JNMA 3GDLA 4MKNA 4UC5A 3R89A 2WNNA 5CKSA 5LGZA 1I4NA 1OK6A 1TCDA 1GJPA 3UZ5A 3P8IA 4XBKA 2NX3A 3I68A 4WQ6A 1W8SA 2VEKA 3R2GA 3MP5A 1PHQA 1XBYA 2NXIA 3QPYA 2GJNA 1UASA 1XBVA 2O7SA 3LDVA 3B05A 4PCFA 5I3FA 1YTDA 1XUUA 4IMGA 5E0KA 3NQ2A 4JY8A 3QQ1A 3P67A 4I7UA 5H91A 3QEZA 2W0UA 2WSYA 4RLIA 4DXVA 4JTIA 4JEQA 1TSIA 3GK0A 2W79A 2JGQA 1EPXA 2PCQA 3O6CA 5C54A 3DBPA 1ZAHA 1VGAA 2BZNA 3GYEA 3DI1A 2CZ5A 1E51A 3A21A 3UXDA 1TRIA 1K8ZA 3PSWA 1JJKA 5K7JA 4IMFA 1KM0A 3LCIA 2B7QA 2QJGA 3GAKA 3WK2A 1D9EA 1YXCA 4IGHA 4NUWA 1XL9A 3OHIA 1AMKA 3G1DA 3EWUA 3L5AA 2E5BA 1GZGA 3INPA 1YDVA 3W84A 3SR7A 2ZYFA 3E49A 1JRBA 3TUUA 1OFOA 4X9SA 4EIVA 4ADSA 3RF9A 3N2XA 2QAPA 3LV6A 1XC4A 5FF2A 3IVUA 4O1AA 5F4WA 2YDAA 2QCDB 2ZRZA 2X1RA 5HNRA 3MHUA 4UFLA 1ICPA 2ZFAA 3LRKA 5AHLA 4LVAA 4QNEA 3EKLA 4FIQA 3W7HA 1GT8A 2E5CA 3A24A 3N9RA 2CLHA 5D2YA 1K7XA 4LS0A 3WFAA 1O4UA 4M6PA 3S1UA 3IV3A 1JR1A 1HO4A 2NX9A 4QIUA 4IMEA 2QKFA 2H3DA 1EP2A 4P61A 2ZCGA 2VOMA 5DXYA 1TV7A 5C2XA 3EEGA 4WXYA 1Y0EA 1TPEA 2CLMA 4Z1CA 2GVLA 1JUKA 1A53A 2RDUA 3GAYA 5FF7A 4CQAA 5BOOA 5J5RA 3W7DA 2QF7A 2ZTJA 3EWZA 3W88A 1D3GA 1F73A 2DJXA 3B0VC 1AW2A 5HWNA 4K7YA 4ZQMA 2VFHA 3ZFHA 2G96A 5HULA 4K6AA 5F4XA 1BTMA 3NA8A 4J9JA 3DFQA 3GVGA 4O53A 5U4NA 1PS9A 3STEA 1PHWA 3LRMA 1QPNA 3UZJA 4MIMA 4O0KA 5CZJA 3W1AA 3P84A 3DFPA 3G3MA 2QCEA 3LB0A 3JRKA 5D2XA 3M9YA 4WJEA 4BK9A 2G97A 2OX1A 1QOQA 3P80A 2EAWA 3G1VA 3CQ0A 3M7WA 4JYDA 4PODA 1OYBA 3W1UA 3NQ8A 4Q4KA 1T99A 2Y61A 1X1ZA 1UBSA 3PS7A 2HTMA 5DBTA 3FA5A 4JGDA 2E6YA 4OU1A 3P82A 1LBMA 4MJZA 2DZPA 2FB3A 4OWGA 1W5MA 4JTJA 6TIMA 2QDHA 1KFLA 5BNKA 4JYFA 5LNWA 1QMLA 4FEZA 5HR7A 4K7VA 4AHOA 3NPWA 3FJLA 2DZVA 4JTKA 4JTFA 4UNKA 2GUUA 2BSLA 1MSSA 3NQMA 4EWND 2B7PA 1H7XA 3QM3A 5T26A 3NGJA 4AMAA 3TROA 4JICA 4JYEA 5ABTA 2I1OA 3CIWA 4W9TA 3YPIA 5K9DA 1PCWA 1SO5A 4ZMGA 3BLIA 5DCEA 3HPXA 4ADTA 3W7GA 3DENA 5F1VA 1W1ZA 2NUXA 2ZZ3A 1VYSX 1KV8A 1WDWA 3T7VA 1JUEA 4AB4A 5CGQA 2QCNA 1KFJA 3SI9A 3PBVA 4E2DA 1OF6A 3PBYA 3STCA 5D32A 1KFEA 1LOLA 4CNOA 3UPBA 1ZJIA 3C2OA 4FXRA 3CWOX 1H7OA 1YXYA 1V5XA 1F6PA 5CPNA 3PR2A 4IUOA 3M44A 2AGKA 5F4SA 1VQTA 1WOAA 5IM51 5AHMA 4EF8A 3N19B 3F03K 4AWSA 1YYAA 4O13A 3C0JA 1IXQA 2NLIA 1NSJA 1Q6RA 3NQVA 1IF2A 3KOFA 4XTDA 4ZVJA 2OT1A 2ATMA 1TQXA 3M5VA 2DZXA 3K30A 1F7BA 4YL2A 3W7PA 4HSNA 3MI3A 1PL9A 1AL8A 3NR0A 1DVJA 1FWNA 2VELA 3C3NA 3HQ1A 3OVRA 1RQHA 3SY5A 5EKYA 5FEXA 3LX9A 4E0CA 4JIPA 1YDNA 3HGSA 3PSVA 3GLCA 3I7SA 3G1YA 3W1RA 2X1TA 3W2LA 4HSOA 1KV5A 3DKLA 2KZHA 5AOUA 1N7KA 4N4QA 4UTWA 5FESA 4FNPA 3L5LA 1TPB1 3CLMA 4TIMA 3DKJA 5E1QA 1RVGA 4Z1AA 1OX4B 2JKAA 1ME9A 3AJXA 2CLIA 3S42A 1SSDA 4MJMA 1H1YA 3SSJA 2NXGA 2CLFA 2YW3A 2C15A 3DFSA 4GXMA 8TIMA 1LOSA 2H6RA 3I7QA 3ATYA 3W22A 1CW2A 1TO3A 4NU7A 1MEWA 1K8YA 5HQEA 3C4UA 2DJLA 3UNDA 3OIXA 1OFAA 4ZQCA 5GVJA 3ATZA 1ZENA 3ZWTA 4OGZA 1OX5A 3EKZA 3LBCA 4KWWA 2NWSA 2ZTKA 3H54A 3WJYA 3IIZA 1F6KA 1DV7A 1SO6A 4JX6A 1PE1A 3CPRA 4IXHA 3W72A 4X22A 4ZL1A 1VJIA 5FF4A 1H7RA 4N6EA 1YLVA 2PRHA 4LOCA 1MEIA 3FYOA 2WSQA 4E2BA 4QITA 3G8EA 5D02A 2GVJA 4RZ4A 1WBJA 5CZ0A 5D37A 4DBEA 3LBMA 3TR2A 3VCRA 1VRDA 1VH7A 5AHNA 1TV8A 1SPQA 3RLVA 1TREA 4LNYA 4O12A 2P10A 3UWZA 1OFRA 1Q6QA 1XI3A 3C2VA 2Z0IA 2PE4A 1FWWA 5L9FA 3QF0A 4FNUA 3TC6A 4AH7A 4YMZA 3R5EA 3C8FA 1ZAJA 3EWXA 4O10A 3M5ZA 5D03A 3B04A 1H50A 3N34A 3U8GA 2XN1A 2OT0A 2DP3A 1SFLA 5HINA 3S8HA 3B06A 1Z41A 4BR1A 2QJIA 4BWLA 4ICNA 4GUJA 4S1FA 3EWYA 3E02A 2P0OA 3FS2A 3PULA 4Z0SA 4N6FA 2WPBA 3SJ3A 1B3OA 4JN6A 5AC6A 3HBLA 2QCGA 1S5TA 3B8DA 3TXZA 4A2SA 3W76A 1I8JA 1RR2A 1L6WA 1H5YA 1QO5A 3CEUA 2EPHA 2CLKA 4AVFA 3GIYA 4UFIA 1FXPA 3W7QA 1L6SA 3LV5A 2CFFA 3DGRA 1JCYA 1L6YA 1K3UA 4RKAA 1GWJA 3W9ZA 4MPQA 2CZDA 2VKZG 4BF9A 3HO8A 4FXSA 5HUOA 1K8XA 5EPDA 1KM5A 1SR9A 2NUWA 1WX0A 4L4LA 2QEZA 4E38A 1FWRA 2V82A 3VI2A 1LDCA 3TXVA 2YFNA 3HPZA 2VEIA 4JXCA 3C2FA 2VFFA 2FLIA 1VCGA 2CLOA 4HPXA 2P1FA 5LSMA 4QNWA 3P74A 4M7SA 3O6YX 2HMCA 1IXPA 2QCLA 3N14A 3ABOA 3BLEA 4N9EA 4EOUA 3A23A 3S5ZA 3P5YA 3TMLA 1O60A 4RXGA 5EL1A 1TJPA 4DF0A 3KAOA 1VPXA 4TMBA 3O16A 5G4WA 1OYAA 1FBAA 4O52A 1H63A 2A85A 1KM4A 3UQNA 3S6DA 3FOKA 3RU6A 3TMQA 3BVJA 1DBTA 3OA3A 1ML1A 2BX7A 4DELA 1OFPA 2GOUA 3DZ1A 3TW6A 3DH7A 3QMTA 3W7MA 4UTKA 4ADUA 3P60A 4FIRA 2Q8ZA 4UTUA
chains in the Genus database with same CATH superfamily
4G5DA 3VKBA 3WEZA 4C1NB 2E9BA 3NSNA 5CGTA 1U83A 3G1XA 4TX9A 1JEZA 1PPIA 4MFEA 2PGWA 4FAMA 3V35A 2LLEA 1J5TA 2WCSA 3BK0A 2EQDA 1W9DM 5AB3A 3ARYA 1GOKA 1CEOA 1P0NA 1FY6A 1ECEA 1VIWA 4Z42C 2YSWA 1V6WA 5G4HC 3QY8A 4G7FA 3VNLA 2EPOA 1X1OA 5C9XA 4QSHA 1NARA 2ZUSA 2E6DA 3A12A 1U5JA 1GYNA 3AXIA 2Y7DA 1HNYA 2RHGA 3WBWA 3GXNA 5T8GA 4M1RA 3A4JA 5LA2A 3BAXA 4FLRA 5KTLA 5G1MA 3W7OA 1E0UA 4I90A 2F9RA 2IW0A 2BASA 3H70A 2QJMA 3UR5A 1FHDA 4M80A 1UP3A 4LUJA 3THCA 4FMVA 4JX4A 3THUA 1ISVA 4Q22A 2IQTA 1JCNA 4LCQA 1BYDA 5F2MA 1YX1A 2DUZA 1HP4A 2DUXA 2QCMA 4L6OA 2A79A 4TQTA 4H9XA 1ADOA 3PANA 5ECVA 2WAGA 4LY4A 4CN6A 1F4AA 2YR1A 2FZMA 5FF3A 4RCXA 2X1IA 3PFMA 4KEUA 4O0ZA 2FTPA 4QG9A 5F7UA 1M1BA 1XLEA 1XLIA 3HTWA 3XIMA 2D24A 4QDMA 3TH6A 3GRIA 4AWTA 4H6RA 4IPPA 4ORIA 4CQ8A 4U28A 1GOQA 3OGVA 1XF0A 1F76A 5AVHA 2QGHA 2HRWA 4IISA 1Q7MA 6XIAA 3A6OA 1KTBA 2CHNA 3DI0A 4PFHA 1E3XA 2H9AA 1O66A 1BEUA 1K70A 2EJ1A 4HT3A 1C8VA 3VX1A 1XLDA 2QPXA 1M3UA 3ZVIA 1LWHA 1OCNA 1ZRQA 1BVNP 1O5KA 4KGJA 4MWAE 2OPJA 2WB5A 1JYWA 3DYOA 3V16A 2FPYA 2WMGA 3SURA 4HJFA 3TAKA 1PEZA 1LWJA 1GOOA 4FNQA 3L2LA 5B80A 3WNKA 4DO5A 2PDNA 2NQ9A 3M16A 4UOJA 5BXPA 5C9WA 4J28A 4Q8QA 1HVXA 1NU5A 3MU7A 5DMMA 3SEPA 3N04A 1WXJA 4PMQA 3VD4A 1PYMA 3UXAA 1E0XA 2DU2A 2OCZA 3VFCA 4NVTA 3SM0A 3CUZA 4AD0A 4O57A 3CIXA 2WZMA 4A29A 1GJWA 2OLSA 4IJRA 4YPJA 4DPQA 3BMWA 1SJCA 2QCFA 4U5IA 1A5LC 2DT2A 1SFSA 1A5KC 4UCFA 3P0WA 3KVMA 4L61A 1S39A 2JF7A 3T08A 3QGVA 1RAKA 4B5UA 3LHTA 2IQDA 3NQGA 1RLDA 2Y7EA 4NNAA 1QJWA 2J7DA 2VM8A 3GZ3A 2PGRA 4L80A 1EJTC 4H7VA 5HJLA 3N2TA 3CAVA 1PUDA 1MDLA 3MP3A 5FF0A 3Q58A 4FHAA 3GW3A 4K3ZA 3O63A 4WY0F 1UOZA 2ZXAA 2D20A 4HVXA 3GB6A 3M6YA 3NUKA 1W3TA 3C5QA 1GVRA 1V0LA 1BTCA 4BEUA 2R1PA 3GX9A 4UQ9A 4QE1A 7REQB 5G4EA 3ITTA 3RCNA 3SGUA 1G9HA 3NZPA 2XFRA 2BY1A 3HPSA 3IGHX 3W1QA 1FX6A 3A5VA 4AD3A 3MP4A 5K3VA 1QPOA 1HP5A 4HA0A 2EKCA 1EDTA 4WF7A 1LTDA 3QFEA 3LSCA 3LPGA 4ZOBA 4MUPA 2A3AA 5AVNA 3BW3A 3IRDA 4J4KA 3ABXA 4NXKA 1O94A 3W7LA 1OVDA 1OFEA 1U1JA 2HK0A 2ZUTA 1K03A 1TTIA 2ISVA 2XFWA 2BXZA 3DU0A 4NYUA 3V1PA 4QXIA 4XZNX 1R7AA 4M24A 2Q8LA 5FEPA 5AC5A 3OG3A 1R85A 1I1XA 3SFWA 2RDTA 2WWDA 1GJUA 4PCSA 2FYMA 2UY4A 1AQHA 3WDPP 4NHVA 1JD7A 1G4EA 2Y7GA 2RKXA 4KCVA 2B7OA 2WNQA 4UZSA 3KRSA 1QR7A 4AHQA 5C9RA 1W9BM 3A13A 2OZ0A 4DX3A 5HBFA 4J1OA 3TTQA 1ITCA 1WB0A 1H7WA 3VOCA 3IVSA 1N2VA 2JBMA 3MCNA 3BGGA 4HIBA 1BWKA 3VGFA 3R79A 3CIVA 2I16A 4JTEA 5C55A 3W70A 1NFBA 3G0SA 1ZHAA 4FPSA 3F5KA 1S2WA 2DZAA 4ZBCA 4CEUC 5FEWA 1ZCOA 3PNUA 4HA3A 3UJ2A 2FZ8A 3ABQA 2P53A 1HUVA 2PGEA 1K6AA 3TU9A 2CLEA 1IEXA 1SUXA 3CQKA 2Z24A 4LNCA 3M1ZA 1E6SM 3AICA 3MHGA 5BMWA 2ZZ6A 1W9VA 3LY0A 2R1LA 2VX6A 1XCFA 1AUSL 3EWCA 4G1NA 2J27A 1H41A 2QJHA 5KEZA 3ANYA 2ASHA 4NJIA 4DEFA 3MZ2A 4L4PA 3GHSA 2O4QA 3WF3A 3O15A 4E6MA 1UC4A 3U2OA 3V1HA 3EPMA 1BVWA 3HZ3A 2QPUA 5HJYA 1YBQA 3ARSA 1VLIA 4KWOA 1VEPA 5J5DA 4DLFA 2NSXA 4L6DA 5F2LA 3ABZA 3WK1A 1V3LA 2D69A 3ZIZA 1Q7QA 2CBJA 3ZM8A 4W88A 3BARA 5I02A 2E4TA 1KD0A 4AZ7A 3TFXA 1OSEA 2OLHA 3IJ7A 5ABEA 3EWBX 3URBA 3PBUA 1QPQA 4KWSA 3N4EA 3VDAA 4LC6A 4O11A 4M6VA 2BGNE 6PTDA 1W6TA 1LL6A 1I2RA 2A3BA 3GG0A 2RAGA 3OGSA 3WMCA 3MSGA 2OKOA 1ADDA 2AAAA 5HPOA 3VKJA 4A2RA 2CBUA 2VFGA 3G8RA 3KX6A 5M2FX 4S3DA 4UUIA 1VIZA 2G95A 4NP7A 1DIDA 1JFXA 4UTIA 4GCXA 4DJED 1R2SA 3Q94A 4GYKA 2A3LA 4UR8A 1GVIA 1I75A 2NZLA 4QCFA 2F38A 1E72M 2INFA 4B5VA 3G2GA 2UY2A 3I3BA 4MNKA 3OIHA 2WC7A 5IDZA 3M0ZA 2P8CA 4OHQA 3WLIA 4M6UA 1TZZA 3GDRA 5C2CA 2XN0A 4DLMA 3VOJA 2YL8A 4HGXA 3G6LA 3A4AA 3MA8A 2R14A 1XH2A 1J4EA 1TELA 3TYZA 5I0DA 3CMGA 2BHYA 2VC6A 3ISIX 1GKPA 3CJPA 3ARTA 4MZ8A 5CQ1A 2OQLA 2PDBA 3PZGA 3MSRA 2IKIA 1RCXB 4XZHA 4E2OA 1GVSA 4N9DA 4HU4A 3OU8A 3VDCA 4OBSA 3W87A 1IGSA 1VRXA 1FFQA 2YBVA 3PTMA 4BA0A 3W53A 1SZRA 2WMIA 2WKLA 1DJIA 2J8FA 1VFFA 2Z7KA 4ML9A 4RDZA 3CZEA 4JDYA 1X8CA 4NASA 1TMHA 4RNHA 3GXFA 1FWJC 2YBUA 1JI1A 3OZYA 3VE9A 4S39A 5CG7A 3REQB 1S46A 3IK4A 2HQAA 3O0FA 3VC5A 3MMDA 3H7RA 1EOKA 2QVNA 3MBDA 2YL9A 2CXEA 4MM1A 5LNSA 6CGTA 4MFDA 1Q45A 2GVYA 2ZZ7A 2R91A 2CESA 2W5FA 5BROA 4XZBA 4LH8A 4RDVA 1CB2A 1TWWA 4DWSD 1US3A 4LAMA 3CHFA 4I9AA 2E6FA 2D73A 1VFOA 3W74A 2DUAA 1UZ4A 4WVXA 3MO7A 3B9OA 3UG4A 1TVNA 3FJ4A 3E0WA 4D6EA 3M0HA 4OQVA 2ZICA 2X8RA 1TPDA 3EOUA 5KSWA 1ISYA 3RJYA 3KHDA 1Q63A 3DBNA 4LYKA 4DRSA 1MW0A 4Q32A 4GD0A 5U7SA 4PCPA 3U5UA 1V8EA 4F9DA 1DE5A 4PMVA 4JNZA 3NQ6A 4FK9A 3LEPA 3LBOA 3Q45A 2DEPA 4O16A 1Q66A 3NJ3A 3MC5A 4LUTA 3ZLFA 2RDWA 1FHVA 2ZA1A 5I3KA 1W5PA 4QG8A 1X6LA 4I6KA 4H8VA 4IWWA 4HB7A 5LIKX 4QRNA 2EGZA 3ZZ1A 3PBGA 1KGWA 1KBKA 1XYCA 2G5WA 1J9YA 3NCOA 3C61A 3G3DA 5A8QA 1H7PA 1R30A 3SJNA 1I0BA 3FAXA 3WD3A 3DERA 4S3CA 1AQ0A 5HMSA 1LBFA 3L2MA 1W1TA 3UCQA 4XTIA 2OFJA 5A2AA 3SIZA 1WZAA 1IEIA 1WCGA 2J79A 5C0QA 4FLOA 4UR9A 1XLBA 4YHEA 1IWAA 3P5ZA 3K8KA 1G6CA 3EKGA 2DSKA 4HTYA 2SFPA 3WEMA 4HOZA 5PTDA 1E71M 4EVZA 3QH2A 4H3DA 1R0MA 2B4GA 2QUNA 3QKEA 3L0KA 4DBSA 3VUPA 1V79A 4Y90A 3L2IA 2I56A 2PC4A 3L67A 3S5NA 2EPKX 1SZNA 4MJ4A 4O8RA 3ARXA 3SADA 1UD4A 1ITUA 3AYVA 1U5HA 2O92A 3G77A 3CUFA 3ZSTA 1HL8A 5MHBA 2WVTA 4PR4A 4D6HA 1OFQA 4YVVA 1I0DA 7TIMA 3EX4A 2MNRA 1CXFA 1HL2A 3IIOA 3VCNA 3HU7A 4CD8A 1GCYA 3G5EA 2OYLA 3ZT7A 5EYWA 1UPMB 3FSTA 1OCBA 4HOXA 1XIFA 3E38A 2BXVA 3C3UA 5I3HA 3IGSA 3LSBA 1Y5XA 1R3QA 4NQ1A 4XQ6A 3KTXA 4ENLA 3VMNA 4M51A 4F79A 3WMLA 1PKLA 3EB3A 1YW1A 1F8MA 2HDJA 2WJZA 3OJGA 2P0IA 2ZDRA 2GDVA 4JL2A 5I3JA 4J3SA 4HU8A 5BMXA 2X0HA 2VCCA 4GYPA 2D2OA 3EAUA 2GQ3A 3GU9A 1S2TA 1QI0A 3V5CA 3NPXA 3AXXA 5BWFA 3L21A 1JUBA 1TE1A 1EB3A 1KM3A 4O4VA 3LMYA 4HHHA 2KX9A 1FQ0A 4EX4A 1J0IA 3WD1A 4GK8A 3GNDA 3NM3A 3BG3A 4OECA 4UMCA 3CZLA 1CI1A 4G8TA 3DHUA 1F07A 3RM8A 1E6PA 4EF9A 1PKNA 3WH7A 3MYOA 5M1TA 2VWSA 1B54A 1EUNA 1CZ1A 3ITOA 1I2NA 1QNRA 4IICA 1OFDA 3IGXA 5AYXA 4CD5A 1PO9A 3EGJA 3WLTA 4LS2A 2HZGA 2VC7A 1AK5A 3D6NA 3WLKX 4Z17A 2V2HA 1IE7C 1N8IA 3TLQA 4AEFA 4JS3A 4ACZB 2VZTA 3QW4B 4EANA 1TIMA 2A2IA 1H49A 3A9BA 2PWHA 1OZQA 4HA1A 4JQ1A 3TYAA 1P7TB 5TQLA 3S1XA 3ARQA 3CK5A 4K68A 1EO7A 1KXVA 1BVZA 4XZLX 5D38A 3LLDA 1JD9A 1M03A 1WDDA 3WJZA 1Z48A 1H62A 1US2A 4BWLC 1IGWA 3ZR5A 5HNTA 3D46A 1L8PA 4US5A 1F05A 2PDKA 4GNJA 1CWYA 4MMWA 1XYZA 3VOIA 3L12A 3C86A 4DYEA 4NZJA 4QX4A 1FWSA 2WVUA 4EXAA 4KIEA 3LS9A 2NT1A 4DO6A 4QJ5B 4NXSA 4GX8A 2AL2B 2ZUVA 4BI5A 4AYSA 1AA1B 1HFBA 4H9UA 4JNYA 4M81A 1MO0A 5DCDA 3G0UA 1YPIA 3VD3A 4CNPA 2I9UA 2OMAA 1WDSA 1KTNA 3G0XA 4H6EA 4Z1DA 4AZCB 2QXWA 1XCWA 4MVAA 1QNPA 1ZFJA 3CH9A 4PB5A 4DBDA 1Q6OA 1NDZA 3W73A 2XZ7A 3ZWSA 4UTHA 4IIDA 3NL2A 3MJMA 2DZTA 4JEJA 7ODCA 3DX5A 3QRHA 3W83A 5AC7A 2NQZA 2V9DA 3D47A 2GGHA 3L0GA 4E8DA 3MTWA 3M4HA 1TPFA 1JVNA 2P5NA 2VGBA 3POCA 1JDFA 1M6JA 3KOYA 2ZRVA 5HWMA 1G94A 5EMMA 2ZRWA 3LOTA 3T8QA 4XD5A 3UXIA 3WQWA 4Q8WA 1D2KA 1QU4A 1FDJA 1UJPA 4GGBA 1ZY9A 5A8GA 2GDUA 1KRCC 1RPXA 4WCJA 2CWXA 1EHAA 2FIQA 4IP4A 4PMRA 3GZAA 3SY1A 5AYZA 1ZALA 1FH9A 3UW6A 4R85A 1R87A 3VKKA 4F9JA 1K7EA 4Z2JA 1A80A 2J88A 1EC8A 2ZC1A 2ZKMX 1BKSA 2WHLA 1OJXA 4FXFA 2E40A 4E2VA 2WV8A 5C5YA 1WXZA 1K9EA 1T0OA 4K1WA 4AEEA 4C6NA 3M0KA 2WSRA 4AZCA 2R1NA 5CC3A 4RK8A 1U5VA 4AISA 5FD0A 5L6UA 1QW8A 5D9OA 4ZQRA 3KL5A 2WMKA 3CS2A 3TX9A 5CJNA 2F7FA 2UY3A 1LT7A 2PP1A 3EX3A 3H23A 1JAEA 3WG6A 5G1YA 4N9CA 1V7YA 1IZKA 1G4TA 4RR4A 3GNNA 4NAEB 2HNHA 4Z2LA 3T8LA 2H90A 3VE7A 3NFUA 4H9VA 4GIAA 1POJA 3LRLA 1JPHA 4KERA 3T1GA 2XIQA 1VC4A 1OF8A 1PJ9A 4NYYA 5EA9A 4I7VA 1JPDX 1J0HA 2YL6A 1NDVA 3DHPA 3L65A 3UFYA 1NWRA 3LHYA 4LVGA 5H6HA 4Q8MA 3OGRA 1WKYA 4B3ZA 3WH9A 2I9EA 2ZUNA 4ZB0A 2DIJA 3NZ1A 4J40A 1F3XA 1FDZA 2NUYA 1DJZA 3GM8A 3UY8A 1XSJA 1HTIA 1VP5A 2F61A 4NRRA 3H2NA 1L8NA 3AMGA 5AHFA 3BZGA 2BHUA 4MKNA 4UC5A 1KB3A 4C7GA 3R89A 2WZEA 1OK6A 1HJQA 3UZ5A 2QNEA 4QCEA 4GI8A 1W8SA 3R0KA 3SCSA 3RPDA 3U2EA 3MP5A 1PHQA 3GVRA 3V36A 1JI2A 1R3RA 1EIBA 1UASA 2O7SA 3LDVA 5I3FA 5FAJA 1BF2A 4IL2A 3THDA 4IMGA 4L65A 4I7UA 4IH3A 4Q4RA 2E8YA 2GZXA 1REQA 4GINA 4JTIA 1MFUA 2QVHA 1SMAA 2JGQA 1K4HA 3DI1A 1E51A 3A21A 3EMQA 3UXDA 2V3DA 1JJKA 3LCIA 2QJGA 3GHRA 3WK2A 3SY8A 1YXCA 5AC4A 1XL9A 2I5QA 1EQPA 3WYZA 2EG6A 2PZ0A 3PTQA 5AECA 3DYMA 3INPA 2P76A 1WE5A 1DJHA 1UD5A 2INEA 4IQJA 4DBUA 3TUUA 3T2PA 1NP0A 1H0IA 4XIMA 1TJ1A 3N2XA 1XJBA 3LV6A 1VEOA 1NDYA 3EDFA 2G3FA 4JCLA 1RVKA 3PN8A 3RRXA 2C0HA 5AHLA 4B92A 3MANA 3DG7A 2E5CA 4C6QA 3QV9A 1S2VA 4UOZA 2Y5SA 4TVDA 3S1UA 3K4AA 5A6MA 3AUJA 5GNYA 3UGVA 2YB4A 3EEGA 1KR1A 3VDHA 4HHLA 2RDUA 1DPMA 3W7DA 2ZTJA 3AHXA 1F73A 2DJXA 1JNDA 3BMVA 5HWNA 1JGMA 1YPXA 3ZFHA 2VX5A 5AYBA 1PIFA 5HULA 1GZJA 1QNOA 2I57A 4K6AA 5F4XA 3GVGA 1NWTA 5A6LA 3S5SA 1CBGA 3FDKA 2QJNA 2W9MA 1QHOA 1MXDA 1W2VA 5CZJA 3NDYA 3P84A 4WDTA 2QCEA 4DY1A 3JRKA 3P80A 1EXBA 2EAWA 2JIWA 3WBEA 1IEVA 2VEFA 4PODA 1OYBA 4LALA 3KTCA 4Q4KA 4C6KA 2QHAA 3PJUA 1BRLB 2PD9A 1ZBWA 1XDJA 4OWGA 2DZPA 1W5MA 2PUZA 4O1EA 4PGLA 1WDPA 4HP5A 1RALA 1KFLA 5LNWA 3EDDA 2AQVA 4EKJA 2BXYA 3DFHA 1WO2A 4AHOA 1PX3A 1XGEA 3FJLA 3T0CA 2ACRA 4JTKA 1PTDA 5FAGA 4Q7IA 4JTFA 1NY1A 3HFTA 5XIAA 3KZPA 5KETA 4GOAA 3NGJA 4Q6XA 4MPKA 4BEQA 2YDSA 4JYEA 1Q4WA 4AIBA 1RY8A 2VGIA 4W9TA 1OGGA 3ARZA 3EMCA 3BLIA 3RX4A 5CJ5A 4HZMA 3W7GA 3RPMA 1VJZA 3E2VA 1ZL1A 2XISA 2ZZ3A 5IFPA 3DG3A 4AIUA 1JUEA 5C7HA 4OIFA 2PDUA 3WDIA 3STCA 1KFEA 1LOLA 2ODOA 4CNOA 3WQEA 1ZJIA 3CWOX 3PPCA 1XX1A 1F6PA 5CPNA 3PR2A 4OFCA 4ROPA 4IUOA 3IJ6A 1WOAA 5AHMA 4J5NA 3N19B 2ZVIA 4LSBA 3SRKA 1NSJA 1M53A 2QV5A 3AS2A 3KOFA 3SIMA 1R3SA 3OQEA 1TQXA 3DCPA 3KTSA 2ICSA 3VM5A 1YNQA 3W7PA 4HSNA 1LG2A 1AL8A 1DIEA 2VELA 4IT1A 3TZFA 4JIPA 3DYPA 3WL1A 3KDNA 3GLCA 1S1RA 1VBJA 4U31A 3W1RA 3DKLA 5AOUA 1CCWB 2QS8A 1N7KA 5GPRA 3GQYA 4N4QA 1L6GA 3FCPA 3GTFA 1P7TA 1ME9A 2CLIA 1BXBA 2YW3A 3ZT5A 3AIUA 1RJPA 3VD9A 3AHYA 3OOQA 1CW2A 1ESWA 4NU7A 4CNUA 5HQEA 4PUUA 3TJIA 3UNDA 1OFAA 1XD1A 2JE8A 4ZQCA 2J78A 3WLRA 3RHGA 4OGZA 3EKZA 3DECA 3LBCA 3OB8A 2WK2A 4YTQA 5JVLA 2EPMX 5HMEA 4GHRA 4JX6A 1PE1A 5GJMA 1HJSA 1Q5MA 2CHOA 4ICMA 1DJYA 1MEIA 1RP9A 4CN4A 5D02A 4RZ4A 3P14A 2CHRA 4Z2KA 5D37A 3PZ9A 4DBEA 3T81A 3AHZA 4GIEA 4A3HA 1VRDA 2DDXA 4EAMA 4CUCA 1Q6QA 1XI3A 5DEZA 2Z0IA 4FNUA 1A5NC 3UGRA 2CBIA 3R5EA 4V1YA 2W92A 1ZAJA 2J47A 3TONA 3MO4A 4H9YA 1P6CA 5D03A 3U8GA 1SFLA 4BR1A 4GUJA 2W4XA 2DV0A 4S1FA 2P0OA 3FS2A 5GNZA 1C8YA 1BRLA 4K8GA 4IJCA 4GYPC 1VEMA 3QKZA 2OZ8A 4XAZA 3HV8A 2IS7A 4PMDA 4O8AA 4A2SA 3BAJA 5CZKA 2D2GA 1H5YA 1SM9A 3CEUA 2EPHA 3ES8A 1FXPA 3CUXA 5LIXX 2OXNA 3DGRA 2PU1A 1MW2A 1XIEA 2ZADA 1NDWA 4RKAA 3UR2A 2CLPA 1KGUA 4X0VA 5A2BA 4Y9OA 2UWFA 5HUOA 4E3TA 3GU2A 3DUGA 5EPDA 4QROA 1SR9A 1WX0A 1XRTA 2QEZA 3QLLA 4IIGA 1BQGA 4E38A 4EWJA 1JYVA 1LDCA 3VVGA 3HPZA 1EC9A 2VFFA 2FLIA 5HAOA 4HPXA 5LSMA 3P74A 4GQ0A 5C7VA 5H8UA 3PTKA 1GQLA 1IXPA 2PDWA 4N9EA 3ABOA 3A23A 1K6WA 3P5YA 3URNA 2W91A 3FSUA 4BQ5A 1XISA 1ZCCA 3AROA 1JF5A 1KM4A 3DN5A 2GUYA 1QI4A 3EWDA 4IGMA 2J62A 1QI5A 1JZ4A 3BVJA 3OA3A 1ML1A 2BX7A 2GOUA 3APGA 3TW6A 3QMTA 1E5JA 1KRMA 3P60A 4UTUA 3GXIA 1KNWA 3S1WA 1P1MA 4I7WA 2Z26A 5CZTA 2YKKA 3IUDA 1YIXA 4AD4A 5I23A 1EJXC 2Y24A 3M0VA 2IXVA 4WKAA 1QAPA 3LD5A 3FK4A 4CQBA 2NT0A 3T44A 1W0MA 2VZSA 2FDMA 1XW8A 1SZGA 1EBHA 2D2JA 3THQA 1SFJA 2ZOXA 4FF7A 3W2JA 4XB3A 5CSSA 2ZZ5A 4X2RA 5B7ZA 5TIMA 2GL5A 1XLFA 4NZ1A 3PVFA 4D8LA 4GI4A 4OBRA 1UA7A 1QBBA 5LNRA 3SSZA 2Y88A 1T41A 2EEXA 4OVXA 1IXNA 1V3KA 1SR0A 3BLLA 1TR9A 5CSUA 5AFDA 4AD2A 1MVYA 1XPYA 2XPKA 5IHRA 4QFUA 4GI9A 3LERA 1POKA 4IXXA 3ANUA 5D9NA 1UG6A 5H1WA 4PH6A 4DF2A 3LN3A 2EXOA 3V0TA 3HG3A 3M0XA 4QR6A 1HXJA 4FOKA 4PZVA 5G2WA 1XRSA 4RZ6A 1XM3A 1W54A 3S83A 4C65A 3VO0A 2OZTA 2GJXB 1BGAA 3UWWA 3IIVA 1LQ0A 3ONBA 3S3GA 5I5RA 5BYWA 3I6RA 3VOHA 1LLZA 1ZNNA 4DJFA 3QZAA 1EIXA 4Y9PA 1EWEA 5CPLA 3FJNA 2E9MA 3WBXA 4DUWA 3IV8A 1UBPC 4RXFA 1DIKA 3SCWA 3SCRA 2VFDA 3EA1A 5C6MA 3HG5A 1HGYA 4LRSA 3GKFA 2ZWYA 2WVVB 3M07A 1KFWA 2P3EA 3IRSA 3S6OA 3VFLA 3P62A 3OVQA 5ABGA 4DAFA 4CNTA 1QTWA 2BTMA 4KKXA 1KM6A 3ZO9A 1ZJAA 2POZA 2YL5A 3KOWA 1MQQA 3W1TA 1H1NA 1YDYA 4KFNA 4LPCA 2V5BA 3TQVA 1JCXA 2AMGA 1DL3A 1R3WA 4YVPA 3I4EA 1NFPA 1U2YA 1TJ2A 5I6SA 3W26A 5GQBA 4GWEA 2TODA 3LMZA 4LUSA 1RBAA 1PWMA 3LI1A 3DAQA 4WKHA 5HK4A 1TUXA 3WEOA 2G0WA 4HU3A 5EFDA 4NZFA 3Q4DA 1E0TA 4XVEA 1BYCA 2WJEA 4WZHA 2DW6A 3GR8A 3T78A 4S2CA 1RV8A 1UOKA 1W56A 3UPWA 3KBVA 1X38A 5HANA 3JZEA 2DIEA 2FMNA 1EP1A 4DPPA 3PB2A 3UD6A 5E0CA 3RCYA 3TOYA 4ERGA 1QK0A 3WMSA 3A5FA 2F6XA 5I00A 3COTA 4R9XA 3ZYZA 4UQEA 2FQIA 5DELA 1C93A 2A7NA 1EYEA 2NSOA 4GX9A 3GDKA 4IX0A 1V0KA 3N2CA 4J3VA 4MNJA 3CH0A 4FS9A 4BJHA 5BWAA 1W1A1 4NT0A 4AIOA 1SZEA 1IV8A 4WIWA 3WQOA 5HNUA 4IMCA 4TVUA 4G2DA 4U4MA 1AJ2A 3AIQA 4JN8A 4D6CA 1XLMA 4UFKA 3NPVA 3FKRA 3WQ5A 4UQBA 2EF9A 3EPOA 3HMCA 4MB4A 3CYJA 3LTSA 3WH6A 1JQXA 1EJUC 4PL2A 2YLLA 5A6TC 1E4MM 3H12A 2ONEA 4NNCA 4NL1A 2Z2UA 2QLYA 4DJEC 2NVCA 5DT7A 1WZLA 4YYCA 2FHFA 1GKRA 3W75A 4O14A 4JD4A 3FHQA 5FIPA 4DI8A 3IWPA 1ZJHA 5A6BA 3HOJA 3UJRA 4PUDA 3BOXA 2CERA 3L68A 1EYWA 4O50A 2ZZ1A 3G1AA 3SQSA 2UV8G 4WJXA 3CUGA 3PF3A 4KIRA 1N8FA 1JQVA 1WV2A 4LT9A 3L5MA 3VDGA 2HS6A 3STPA 1XCXA 4GFIA 2CZFA 3WJWA 1R47A 4TTGA 2OODA 5A6BD 4TU1A 3H22A 3NOYA 4KBXA 5I78A 3BAYA 4JTTA 1QWKA 3VIOA 1YXDA 3QR1A 3HN3A 2ATSA 5KZMA 5MF5A 2A7PA 2QUTA 3AHTA 4IFKA 2A3HA 1GGOA 2YZRA 1G4SA 3L7RA 3R11A 5CGMA 1W17A 4H1ZA 4CD6A 1SQ7A 4C60A 1OT2A 3MHFA 3NYZA 2QV4A 1CT5A 3RG6A 3NZRA 1TPC1 4CN1A 1GVOA 2REQA 5EFFA 3FLUA 4W8BA 1OBAA 1OK4A 4TOQA 4M29A 3THAA 4MB1A 1UH4A 4PMZA 3CGTA 4RX0A 1R9YA 1TZ9A 2R94A 4N02A 4LRTA 4Y96A 1UIOA 4WEVX 2CC0A 4AX7A 5D2TA 2ZZ4A 2X05A 3VNYA 1UMYA 2VURA 3MUXA 1JZ6A 2Z4GA 1V6TA 2XTKA 2YXGA 3GC2A 4GXPA 4FLQA 5LXEA 3KLLA 2VCBA 1W8GA 4FX7A 3U4AA 2GQAA 4HN4A 5DT5A 3O05A 4RNIA 3LHVA 5DXXA 4L4OA 2PWGA 3TC7A 1UR4A 1H0GA 4GBUA 3I65A 2FHCA 1GEQA 3ZR4A 1AH4A 1W3IA 4O18A 1Z9AA 5LIWX 3NQAA 4R27A 3GY1A 4UOQA 4ACYA 2PP3A 5FJJA 4I6VA 4KEZA 3E0IA 4EPKA 2W63A 3PM6A 1JZ5A 3KRZA 3H4WA 1YQ2A 4XSLA 3N18A 4WSKA 4I3GA 5FJTA 3AQUA 1UP0A 4AWEA 3C8NA 1Q8JA 2DQWA 2WANA 1GQIA 3ALFA 3PZNA 3TCEA 4JIHA 2FHBA 2ANUA 3TFCA 3B0PA 2NV1A 1XFBA 3P81A 1KC7A 1P0EA 1TV4A 4LCRA 1NVMA 3NWRA 4KEVA 2VFIA 9CGTA 3H2EA 2OWCA 4LW7A 1U1HA 1NOWA 5CPTA 1CGVA 2JALA 2GOKA 3BG9A 4L9XA 2YYUA 1A5MC 3URAA 3GFZA 3EWWA 3WQ4A 2IPFA 4CQ9A 4B16A 1R3VA 5CC5A 4Z0JA 1H2JA 3N73A 3PUOA 2YCLA 2XGZA 3GIQA 3KRUA 4H2HA 3CWNA 5J04A 4EACA 3RFAA 4ECLA 2J74A 2XSAA 2ZA3A 2YX0A 4GISA 1TWZA 3MI2A 2BDQA 6XIMA 3BUVA 2V3FA 5A94A 5AC8A 2E68A 1NAL1 2QCCA 1KCLA 5GJPA 3C6CA 4JFVA 3OODA 4P8XA 4J3UA 2Y85A 2XSXA 6A3HA 1AVAA 3SGGA 1TTPA 1IHIA 4UQCA 2ZC8A 1NQKA 3DXIA 1KFBA 4YWIA 1V6XA 1V4YA 1EA9C 2X09A 3MWAA 2PDJA 3K8LA 4WKFA 1V93A 2FPTA 1A50A 3M0MA 3MKVA 3C2RA 1VB9A 3EX6A 4ZOCA 2G4JA 1RJRA 3H7UA 3SW6A 3RRAA 4D8ZA 3T40A 1W5NA 4QJ4B 3IANA 4AZIA 4A3QA 1KBJA 4H9MA 3S1VA 4Q33A 2PCEA 2QYGA 4PTXA 5EMYA 3KUMA 2HBVA 3M47A 5HXMA 3AISA 2WKJA 2OKTA 2WW5A 1GW9A 4XBSA 4PTDA 3WK3A 1FDYA 3MVTA 4O0QA 1DORA 1V6UA 1XRFA 1EX5A 4UFHA 2GJRA 3RMJA 5FSEC 2IPJA 3NVTA 3MJYA 1ZSXA 1LM1A 1CPUA 2Z2AA 2E5DA 3MQTA 5FOOA 2W61A 4E3VA 1GVYA 1LL4A 4Q4OA 1QDSA 3NO5A 2R8WA 3M46A 1XPGA 1OADA 5E09A 5KITA 3PZVA 3SO7A 4MNMA 1ONWA 4JDBA 4NJJA 1D3HA 3GW0A 3GDTA 3BGAA 5KINA 1NF0A 1EJSC 1VZWA 1HKMA 2XVKA 3UERA 4WGXA 1F3EA 1C9DA 4NJKA 3AWNA 1BF6A 4HMCA 3VGDA 1OHLA 1CXIA 3UESA 2PLMA 3STFA 2CWNA 1J18A 1TB3A 3IJLA 4MHBA 2BFGA 2QR6A 3B97A 3EX1A 4IQDA 2C0AA 2C79A 2AAMA 3R94A 4GBDA 1EWDA 5MKGA 4O1BA 2E25A 1E1CB 3CV6A 3BC9A 3W25A 2YCJA 1L6FA 4O1FA 4NAFA 1CECA 4R34A 4WR3A 3W28A 4FP1A 5D04C 4PMJA 3NNTA 4LC8A 4XIAA 2PDFA 2XM1A 4JN7A 1W3LA 2O7QA 3BQ5A 3RNDA 3WO8A 5CBJA 3N6QA 2Q71A 1E0WA 2V30A 3GHTA 1LCOA 1FFRA 3LM3A 3W86A 1XQLA 5AKQA 1OX6A 3LPFA 1GQKA 5HUPA 4UR7A 3WH5A 1TRDA 3PG9A 1VFMA 1J0KA 3OBKA 3W1NA 3WLQA 1MUCA 1XYLA 3AIVA 1PDYA 3GBDA 4RPPA 2HSAA 3RM4A 1FCQA 2OX4A 1R38A 1TPWA 3LLFA 1HKIA 2R9RA 4MLRA 3G1RA 4DWSA 3PBMA 2H9AB 2PB1A 1XBXA 4QJ3B 3CT7A 2J25A 3CV2A 3QC3A 2FMOA 4ZCWA 3NXFA 3D0CA 4AVNA 2Z1XA 3W38A 2RJGA 4XD4A 4JTCA 4DAIA 3MI6A 2V67A 4HK6A 1JCTA 2DGAA 3LHWA 2DSZA 1UMLA 3TJXA 5F2IA 2ON3A 2G4FA 3W6LA 1ISWA 4ZQOA 3O06A 3N2MA 4QEHA 1A5AA 3BJFA 2WMIB 3CUHA 4K2SA 2Z1WA 1WKDA 1SGJA 4UNLA 4IOTA 3ZJKA 5C9ZA 4GC3A 3E9AA 4UQDA 1Q6FA 2X42A 5E6ZA 3WFZA 3CPGA 2ZRUA 4Z2IA 1RUSA 3E0LA 3PUGA 1B9ZA 3UYIA 1XLCA 3CLWA 2WCGA 1V08A 5G2IA 1O5XA 3GO2A 3LENA 4P8UA 2XHYA 2E3ZA 3FYYA 3GDMA 4JTGA 3QHMA 5BW6A 4I9MA 3LCLA 1TWSA 4LX4A 4PB3A 1QWGA 1XIIA 4NJHA 1GOMA 3CXOA 3RYSA 1YTEA 1LQ2A 3U7BA 3QYQA 4H00A 1KLYA 2BOGX 2V81A 1QOPA 4GGHA 1GONA 4G1KA 2C71A 3BQ6A 1B4EA 3W2KA 4KRTA 4MZYA 1QW7A 2UBPC 1V03A 3IEBA 4JX5A 4YCOA 2Z25A 4U2ZA 1XQKA 2BP1A 1A47A 1O5RA 5HPCA 1C8XA 2VZOA 1DXEA 4E4PA 3MMWA 3MW7A 2V0TA 4K38A 2A3CA 3APTA 4GCAA 3GVQA 1BXCA 3FW6A 3QR0A 1SO3A 1QPRA 3LTYA 3U7VA 4UXDA 3EEZA 3N3MA 3K13A 4LVDA 3H2FA 7REQA 4H4IA 1DJQA 3TWAA 3VPLA 5HWJA 2PRMA 1RBLA 3KFTA 4FOJA 3WNOA 8RUCA 3W01A 4JY9A 3WY1A 3TJLA 4Q8NA 4DJDA 3KS5A 3F5JA 3GTHA 3O1NA 9XIMA 1M5WA 4XKYA 2NW0A 4IP5A 3R58A 1DHKA 1DKWA 1QCWA 1UYQA 3WNLA 4DUXA 2OB3A 1R3YA 3BGJA 5C9UA 4IMAA 4I5RA 2GFTA 3HFYA 4NNBA 4O1DA 2WBKA 1EDQA 2WOQA 4F48A 1XIGA 1KFCA 3TLLA 2FKPA 4XVDA 1UZDA 1QNQA 4PTWA 3KW3A 4L1XA 5I7GA 3AMLA 1OX4A 4J3XA 3WL0A 4DJEA 4CCEA 1LRTA 2RJHA 3S2LA 4F2TA 4MDPA 3EBVA 1VBGA 2UY5A 3GTNA 2GUBA 5JXQA 4HMDA 2V38A 4XG1A 1ME8A 3S2NA 4C6JA 1FA2A 1R46A 4W7WA 3W27A 2ZX6A 4NAEA 3PG8A 2VTFA 3B0UX 3BAKA 4DO4A 4MY9A 3CPUA 1GOXA 3AALA 1MXGA 2C14A 1NOFA 1W1B1 3NM1A 4F0KA 4GZIA 1E4NA 5CPMA 2C19A 3PUEA 3CZGA 4MB5A 4KRZA 4NF7A 3EA3A 1BPLB 3W24A 3I6EA 3MMUA 3S5OA 4CU7A 3TQ0A 4IFOA 1R8LA 2ZX9A 4Q8UA 4GJIA 2D0GA 3AXMA 4CGTA 1TA3A 3NIYA 1YADA 1Q8AA 1GOIA 2ACUA 3UZXA 5H2ZA 3E0FA 4RV8A 1PX4A 3M0YA 5I2UA 1FWFC 4RNJA 1LYXA 1F74A 2FFCA 3GYCA 2ZA2A 3BV4A 3NURA 1OD8A 3OBAA 3KXQA 2Y0FA 1ECQA 3RO8A 2V3GA 1I60A 3BLFA 5BOEA 2B7NA 5LNUA 3MUCA 4GABA 3AMDA 1JCLA 3MYPA 1PIIA 1TFVA 4JIRA 2FVLA 2V68A 3SAZA 4A6GA 2FJKA 3GNXA 3O2LA 2I14A 5I07A 4C1NA 3BSMA 2D0HA 2YB1A 3B8TA 1W9XA 2FGLA 3T2QA 3NL3A 1ONEA 2A4AA 1S5VA 4Q4QA 2YW4A 4TR9A 1C90A 1UWSA 4XAFA 4CVUA 3VIKA 1MW3A 5DMNA 3V7PA 1WYIA 4PEKA 1WAWA 3SZ8A 1IR2A 1XLJA 2WO5A 2G3IA 5AY7A 1X98A 2OU4A 2XVLA 3SRHA 1W5OA 2OZ3A 1QFEA 3QZEA 3GTIA 2PDMA 4IX2A 1J5SA 3BO9A 3ZLHA 1R9XA 3GFYA 2I5IA 1GK8A 1HL9A 1ICSA 3FN9A 3KL0A 2IKHA 4S3EA 1KM2A 2XWEA 4GIYA 4K39A 2OR2A 4M5PA 4N4PA 1JRCA 2VENA 3WQ6A 3F1QA 2PLJA 1PBGA 1V3IA 1P4CA 2YGYA 4G7EB 1K9TA 3N15A 2VDIA 4B5SA 3R6IA 4QHRA 3GFXA 1UCWA 3SB0A 3E0VA 3GC4A 3R7MA 5EMUA 4ZFCA 3CU2A 4XAPA 1A5BA 1S3HA 3HJEA 2BVDA 4LAUA 2ABBA 1P6BA 3GUWA 3FFSA 3NOEA 4GZEA 1Q6CA 2FJUB 4X60A 5TNVA 4E8GA 3ZJ8A 4ATDA 2W6RA 3LZ3A 3EMZA 1A3XA 1JYNA 1Q6LA 3QY7A 1A0CA 1F2JA 1FH7A 1OFBA 3BW2A 1WUEA 4Y8FA 2X30A 1J12A 2NVAA 3GDLA 3ITCA 5LGZA 4A8NA 4GKLA 4JQ2A 1UC5A 4QSFA 5ECUA 1DWIM 2GJPA 2VEKA 1HJVA 3HA1A 1E6ZA 4PRTA 1W1YA 4B90A 1XBVA 3B05A 4ML4A 3IJ9A 1YTDA 3GXMA 3VK5A 3VOFA 4C5YA 1GQJA 3QLDA 3PPHA 4GA8A 3BSGA 3P67A 4LCSA 3R8GA 4RLIA 1OY0A 3U2CA 3GK0A 2W79A 4I5UA 4XBJA 3O6CA 3DBPA 2PTWA 2W66A 3GYEA 2CZ5A 3T0BA 1EOMA 5DFAA 3U2ZA 1IYXA 1KM0A 4IMFA 3GAKA 2E7FA 3F4VA 2JF6A 1D9EA 4NUWA 4C7DA 1AMKA 3I10A 4LF2A 4OTKA 3L5AA 3ZR6A 4QE5A 4HK5A 3JW7A 4C6LA 2Q6ZA 2FGZA 2ZYFA 4WDUA 3FNDA 3E49A 1JRBA 1OFOA 4AG0A 1WZMA 4HD5A 4EIVA 4ADSA 1H09A 2QAPA 4O1AA 5F4WA 1KXHA 3WLOA 1U22A 3SCUA 4P7RA 3MHUA 5A6AA 4UFLA 5J8LA 2W62A 3UR8A 3LRKA 3V5OA 4CCZA 2WJDA 3NSXA 3LU2A 4GVGA 3W7HA 1GT8A 3N9RA 1J11A 1K7XA 4LS0A 1UWIA 1DP0A 3IV3A 4G6CA 5DRIA 2H3DA 4P61A 1V3JA 5C2XA 3CHEA 1Y0EA 1Y5WA 4HK7A 1WP6A 4B9YA 2CLMA 4E4UA 3Q65A 2GVEA 1XIJA 1JUKA 1A53A 2GVLA 5J5RA 4INFA 4Z2GA 3W88A 2QF7A 1F3WA 1AW2A 4K7YA 1RLCL 2XFFA 3CAWA 4ZQMA 2VFHA 4LB3A 2G96A 4FSAA 3M64A 1A5UA 1UHVA 4J9JA 4JHMA 1NIUA 2NQ5A 4O53A 1UWQA 1HGWA 5CLTA 4RZBA 3CAQA 1A4MA 4IFKB 1PHWA 2XM2A 2XWDA 1V51A 2VL4A 1KXQA 3WIJA 3QPEA 4IG2A 3OW1A 3W1AA 2XINA 3G3MA 4YVXA 1C7TA 1LLOA 4WJEA 2OX1A 1JIBA 1QOQA 1FP9A 3R4IA 3G1VA 4KGLA 3VGEA 3BOFA 3H2CA 2NLYA 4ZE4A 3HQPA 1T99A 2IPWA 2Y61A 4R7OA 4F4RA 3H7VA 3VKDA 3CTTA 1YE6A 4JGDA 3TN3A 4OU1A 5I03A 3ORWA 3P82A 5TAOA 2FB3A 2BHZA 1YE4A 6TAAA 6TIMA 2QDHA 1QMLA 1HX0A 1UD3A 5HR7A 1UPPA 2DZVA 3CYVA 1EGZA 1MSSA 3NQMA 2QPSA 1TUFA 3QM3A 1H7XA 1UD8A 4EPEC 3VIHA 2P88A 4JICA 2I1OA 2QDDA 3YPIA 5K9DA 1S38A 5IHSA 2QDEA 5DCEA 4B5TA 3WX7A 5F1VA 3TYEA 1KV8A 3BJSA 3T7VA 2QCNA 1KFJA 3SI9A 1GUVA 4PMXA 1TR1A 1Q6DA 3ARVA 4FXRA 2Q02A 3C2OA 4DJDC 4ZO8A 3M44A 1UA3A 4KCTA 2GSEA 3GR4A 5IM51 4YTRA 1LJYA 4EF8A 3NVDA 1YYAA 4QLLA 3R0UA 3C0JA 1NH6A 2NLIA 1Q6RA 3NQVA 1C8QA 2VT0A 3NSMA 4XTDA 3B8WA 4ZVJA 5JIPA 3JUGA 3K30A 2CKRA 1PL9A 1XYBA 1DVJA 1FWNA 2VNCA 2E0PA 2HBXA 1H3GA 3OVRA 1RQHA 2PDHA 1FH8A 3EZ4A 1K77A 4RV3A 1UR3M 5EKYA 2QQ6A 4E0CA 1YDNA 4A3YA 1TMLA 2OSWA 1MFVA 3PSVA 3RIKA 1FKXA 3WBAA 4GQQA 4E4FA 4HNOA 1IZJA 2X1TA 4HSOA 1KV5A 4I9TA 2KZHA 2BVWA 1PXGA 5FESA 3TR9A 1IWBA 1TPB1 5E1QA 1FWCC 3DKJA 1T8QA 3AZRA 1UP2A 1HKWA 3S42A 3QVQA 4MJMA 4Y2WA 1H1YA 3FV9A 3SQLA 2CLFA 1JXJA 3DFSA 8TIMA 1FHUA 2H6RA 3W22A 3ATYA 3VXGA 5E9XA 4DWSB 1MEWA 3B9AA 1AODA 3R1ZA 5JBFA 3N12A 3C4UA 3OIXA 4RE0A 5A3HA 4XISA 1XYAA 3ARPA 5A8NA 2J4GA 5GVJA 3ATZA 4IL0A 1OX5A 1K9FA 1JZ3A 1BYAA 2D22A 3W6MA 2GSJA 3WD4A 3IIZA 1F6KA 1DV7A 1O5QA 3L4XA 1Z7AA 1B1YA 3CPRA 4IXHA 3ZXWA 2BS9A 2GGJA 3T9PA 2C1GA 4CU8A 1EO5A 3GS6A 3FYOA 4JL1A 2WSQA 4E2BA 3BDKA 3G8EA 1V7AA 1TCMA 1J6OA 1XICA 4MGGA 3VCRA 4IM4A 3UA4A 1VH7A 1QI2A 3SQMA 1EBGA 2VWTA 2QF8A 3D3FA 4AX6A 3M0JA 3UWZA 2HPMA 2PE4A 3ES7A 5L9FA 4Q8VA 2CETA 1QHPA 1HJUA 4XD3A 4O10A 2GYIA 3B04A 3N34A 2XN1A 1Z41A 2DPEA 2G37A 3E02A 1BXNA 4ATLA 3F2DA 3PULA 4N6FA 3L4TA 1JZ2A 2WPBA 5XIMA 1ZPTA 3OQ8A 1B3OA 4JN6A 3HBLA 3B8DA 2VRQA 2ALRA 1L6WA 1QPKA 1XFCA 4KH2A 1N8WA 4AVFA 3GIYA 3W7QA 4XZIA 4C6MA 3LV5A 2J7HA 3T05A 1K3UA 3ITLA 4U2YA 1GWJA 4U10A 2YJQA 3TEVA 1XLKA 3MKCA 2PA6A 4FXSA 2OTDA 2OEKA 3RCMA 1FWRA 2V82A 5XINA 2PP0A 3URQA 7ENLA 4JXCA 4ZXLA 1PX8A 2P1FA 3SN4A 3S47A 4ZSTA 3I3EA 2HMCA 2WMHA 3BLEA 3S5ZA 4D6JA 5I06A 1TJPA 3KAOA 1TX0A 1VPXA 3O16A 4F0LA 1FBAA 4WDXA 4PRWA 4IF2A 2CYGA 4IUGA 3FOKA 1QI3A 3AMKA 3TMQA 4PUMA 1DBTA 3VABA 3SDOA 3W7MA 4UTKA 4ADUA 3LPOA 2B31A 1YNYA 3PZOA 2QCHA 3W7RA 2VYOA 3U5YA 1DWFM 4GKTA 3AU6A 4IGSA 2WXDM 1BG9A 1GVEA 4LUYA 4GE8A 1ZGDA 3TDFA 3NGFA 4JPGA 2GLKA 2XYLA 3GBEA 3CL7A 4EAYA 2NV2A 1W3HA 4QAIA 1DWAM 3RR1A 2FZDA 1OG0A 3EXTA 2BB0A 5IRPA 1BLIA 2XDFA 2PI6A 5BRQA 3CZJA 4R3UA 3KVKA 3QW3A 2Z2BA 1M7OA 4PB4A 2CNCA 1TQJA 1FTXA 4LS1A 2G3MA 1OCJA 2J8GA 5DF0A 3FX4A 6REQA 2WHJA 2FVKA 2HISA 3RLGA 2EPLX 3ABSA 1XYFA 1TA3B 4D6GA 2J24A 3IVTA 1KQZA 4WGHA 3LGEA 1EJVC 3CWHA 4KPLA 3IK2A 2Q8XA 4XKYB 2CZVA 3LXBA 1QNVA 2V2DA 2PF8A 2V63A 5CPQA 2Y8VA 1KO0A 3UG3A 4GUFA 1TPUA 4KW2A 1PAMA 3CB8A 1EL3A 4PFMA 3QFWA 4KEMA 5IDIA 4NILA 1QT1A 2Y1HA 4PUWA 1A0EA 4LUSB 3PWIA 2D2HA 6ALDA 4V2XA 3WNNA 4PUJA 3AYRA 2BY2A 5IBXA 2WPGA 1TV2A 5F1UA 1BGGA 4B2DD 4CLMA 4Y7EA 3ONCA 4GQRA 2CKSA 3KHJA 3U4FA 1S2UA 4JTQA 4MDOA 3A64A 2VGGA 4KWVA 1G01A 4ZODA 2XSBA 5KZEA 3KM8A 1R7OA 3SUWA 1ALDA 2WHMA 4IP7A 4YS1A 1VR6A 3RO6A 2WJFA 3EB4A 1T8XA 3POHA 1OEPA 3S5YA 3FHAA 2YBTA 3WCZA 5HATA 2RDXA 1VBRA 1EZWA 4W5UA 1MI3A 3LXAA 3WUFA 3SECA 2X1SA 3GKAA 2E8ZA 3VNIA 1DIOA 1Q6EA 2CXGA 2VDHA 4F2BA 4R88A 3OP2A 3W81A 3MT1A 5DO8A 3SUTA 3W1LA 1VFLA 4IIEA 2XH4A 3K2GA 2ABAA 4B3LA 1GG0A 1Q4NX 3EOLA 4MOZA 2O9RA 3WD2A 3NZGA 1B3WA 1LF1A 1OCQA 4DIAA 3ARWA 2X1UA 3QR3A 4LBUA 3OA5A 1EXPA 3AS0A 3BTNA 4UFMA 4LXFA 1JCMP 4IIFA 3S6TA 5ENLA 3AC0A 3UP8A 1VLWA 2YXXA 4HHPA 4XO7A 4LBRA 4H7ZA 2V3EA 3AZTA 3DESA 3PZTA 4LAKA 2QW5A 3B40A 4F0RA 5EGRA 1GVFA 3VD5A 2AOSA 3GNPA 2YA2A 2YLAA 3I3DA 4HNLA 3KZSA 3TSDA 3T55A 4JR5A 3FY1A 4TUFA 3SUUA 3VYLA 4AY1A 4RDYA 4GJJA 2Y7FA 4KF1A 4JFWA 3WUBA 2WNZA 2HK1A 2GPTA 2ZBTA 4PUNA 3P8JA 1SJAA 3E2RA 4H8HA 1TJRA 3AU2A 4KMQA 3N11A 4Y9NA 2GQ8A 2WBGA 3WDHA 2TPSA 4W5ZA 5IFTA 1H61A 4Z08A 2G3JA 3TA6A 1EC7A 3ZS4A 4DNHA 1WQ5A 1SMDA 3NDZA 3PAJA 4S38A 1I6NA 1HO1A 3MUZ1 2FH6A 2ZXBA 3VIMA 3RM9A 1OGSA 3BCDA 3TK7A 4S2BA 4UTTC 2DVTA 4NRSA 4J2MA 3CMJA 3GXDA 3RN6A 4P2VA 3I6TA 3VCCA 4MWAB 1OABA 4KWUA 3OVPA 3QXBA 2Y89A 1XBZA 3TW7A 2AKMA 2PTYA 3RX3A 3UG5A 3UCCA 1C7SA 3GVWA 5DCBA 3NXLA 4D1JA 2CLLA 2HXTA 4ZTYA 4L4MA 4F2UA 4OOUA 1BSIA 4NZ4A 2OGJA 4D8AA 4AZBA 1TPH1 1S1PA 1S2AA 3OG2A 1L2QA 4HZ7A 4RE4A 4UCGA 1W31A 4B4FA 1KM1A 1TWIA 1X7FA 5F2GA 3K1GA 1A3HA 3H55A 3L66A 4WY0B 3PBWA 2VVSA 4PULA 1WZKA 4M7TA 3CASA 3PP7A 1HN1A 2YPIA 3T6CA 3ZMRA 4TMCA 2EG7A 1XIMA 1JAKA 1JF6A 1GYLA 4NG3A 3TTSA 1GQNA 2YFOA 2JKEA 3CM4A 2V5JA 1I2OA 1OIMA 1TTQA 4IPJA 3ZJ7A 3BURA 4JTDA 2JEPA 4YYFA 4JKLA 4I8YA 4WD0A 3BICA 3OZPA 4Y8EA 3R0DA 2PDQA 1MWOA 3N9SA 3WQVA 3PJXA 5D33A 3L4YA 3TOPA 3GWQA 3JVAA 3DHDA 1GHSA 1XLLA 3AHVA 5A95A 4R9OA 3AJ7A 4MKVA 1YDOA 3DHFA 5JBDA 2VFEA 5LGXA 3CQHA 2CIPA 4DXKA 4A05A 5BXSA 4XUGA 3A4XA 3BH4A 2VX7A 3HIJA 3O6DA 1OB0A 2YA0A 4D1IA 2HVMA 1SSGA 1ZLPA 3GNOA 1SW0A 3R12A 4GNVA 1AW1A 1M7PA 3FXYA 3UJSA 4ZR8A 1W91A 1E40A 2XIOA 1LZOA 1YHTA 4GACA 3MPGA 1KA9F 3T4CA 2Z6IA 3PUDA 3VTRA 3PNZA 3SBFA 3LCWA 4HNVA 2F2KA 3L4WA 3PY2A 3FVDA 1HT6A 4RE3A 2Y70A 5K4XA 3HB9A 2GGEA 1N82A 5JBEA 4A4AA 5AYYA 1XC6A 1LORA 2HXUA 1ISXA 2DVXA 3C0QA 3HJZA 4UMAA 3PAOA 2VC9A 1UKTA 3PC0A 4FNRA 2PTXA 1UH2A 4AHPA 4DF1A 2YCEA 3SN1A 3SCPA 3CAKA 3H2AA 3K46A 4X63A 1TE6A 5A8MA 2H3BA 1FWIC 3WFLA 1GEHA 3OVGA 3ERPA 1K1DA 1S5NA 4W89A 4PTNA 4ATWA 1KW1A 3AO0A 1Z3NA 2G41A 4IZGA 3K1DA 1CYGA 3XISA 4ZO7A 1AG1O 4PMOA 3A3HA 3NEVA 3TE9A 2ZVRA 4AC1X 1B4KA 3GNRA 1JCJA 3C2EA 4K8HA 4F40A 2PF0A 1B30A 1UB3A 3J7HA 4HQVA 2WLZA 4X9YA 1CXLA 1LRNA 3VAVA 1YMYA 3ME3A 3W7EA 4A21A 1KQYA 1ME7A 3Q67A 5CC6A 3OLEA 4KS0A 2QGYA 3R8RA 1ZUAX 2WKGA 3HG2A 3M6DA 4POCA 4DB7A 4GNKB 1XXXA 2PURA 4NKCA 1MXSA 1S5WA 3VMPA 4OBTA 5IBXC 1J0JA 4U33A 4JBRA 3RPTA 5DMYA 1E6NA 4TX6A 1ZBKA 4OOZA 3TSMA 1TVPA 4QBXA 1MMFA 1G69A 3GR7A 4B15A 3ABRA 4P7NA 3EOEA 2E1DA 3S9YA 3N1AA 4FX6M 1FVPA 4L9ZA 5K2ZA 1WUFA 1G4PA 3BLKA 2POTA 3M0IA 4JQ4A 4K1GA 1VJSA 3QC0A 4UFJA 3WH8A 4NX0A 2ESCA 3QQ0A 1LQAA 2GJLA 1E55A 4PEEA 5C71A 1OT1A 3W2UA 4QTGA 4X3ZA 3SUVA 1PTAA 4IJBA 2J7FA 4LAOA 4CQCA 1F3TA 3KCJA 3NO1A 2D0FA 2Z1BA 1KBLA 1UR8A 3W85A 4B9ZA 2XU2A 3WUGA 1X96A 2GGGA 3G6MA 4LEQA 4GVFA 1EQCA 3TYDA 3ZSSA 3TWBA 1US0A 1R6WA 4KESA 5CLWA 4L1GA 1J2WA 4U5KA 1IIHA 2ZXQA 4DUOA 1O95A 5IXEA 4N7QA 2GQ9A 3QHOA 3TV8A 4YTTA 2CU0A 4LU0A 3I7RA 1TX2A 3KP0A 1Q2RA 3N25A 2OQYA 3MBFA 4I9JA 1X6UA 4JTUA 3NEHA 4OUIA 3OYXA 1XR2A 3CC1A 4NSBA 1H60A 2DSUA 4MWAD 3VIPA 2AQOA 1PZ0A 1EA0A 5D9PA 3H21A 4YIWA 1DTUA 4M0XA 4EPBC 1UD6A 3VD7A 2CPUA 4MY8A 3IPWA 4MNLA 4RPQA 1XGDA 3W1XA 5CPSA 3MKKA 1W32A 3V18A 5CBBA 3VDBA 3QSTA 4BI7A 4NZ3A 4JTSA 5A8OA 4IIHA 1XLGA 3QOMA 5DN1A 3UY7A 2H8XA 1RY0A 4O54A 3NZQA 3TN6A 1LG1A 3RILA 2WVVA 2PBGA 4YU1A 4C6CA 2E77A 2HE5A 3GXPA 4RJEA 3JR2A 6ENLA 3S9ZA 3GG7A 3UPMA 1X6NA 3WF0A 2BMBA 3LHZA 3CL6A 3H53A 4GG9A 1HKJA 2V5KA 1Z42A 4QJ1A 1W9PA 1TMQA 4JIEA 1VBHA 2FGBA 3VNJA 4LYPA