2R8WA

The crystal structure of dihydrodipicolinate synthase (atu0899) from agrobacterium tumefaciens str. c58
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
297
structure length
297
Chain Sequence
b'DMATRFKGLSAFPITPADEAGRVDIEAFSALIARLDAAEVDSVGILGSTGIYMYLTREERRRAIEAAATILRGRRTLMAGIGALRTDEAVALAKDAEAAGADALLLAPVSYTPLTQEEAYHHFAAVAGATALPLAIYNNPTTTRFTFSDELLVRLAYIPNIRAIKMPLPADADYAGELARLRPKLSDDFAIGYSGDWGCTDATLAGGDTWYSVVAGLLPVPALQLMRAAQAGNAEEAKRLDATFQPLWALFKEFGSIRVIYAAANILSLTVSEPPRPILPLTSAERQRVEEALEALS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AGR_C_1641p
molecule tags Lyase
source organism Agrobacterium tumefaciens str.
publication title The crystal structure of dihydrodipicolinate synthase (Atu0899) from Agrobacterium tumefaciens str. C58.
rcsb
total genus 104
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2r8wA00
4ORIA 2B4GA 5IBXC 2E09A 3CPRA 5G5IA 1YTEA 3KVMA 3KOFA 4LS2A 4AWSA 2PRLA 1ONRA 3LCLA 4RR4A 5SWUA 1SZEA 3NVTA 3Q94A 3I68A 3W1QA 3W7NA 3R8RA 3CU2A 4FIRA 4JYFA 4FF7A 3TFXA 2QDHA 1OVDA 3W7OA 3UNDA 3LI1A 1DQXA 4L4LA 1C29A 3LX9A 1O95A 3HOJA 3HQ1A 8TIMA 3TKFA 1TPEA 4HPJA 5U4NA 4LU0A 1B4KA 4OBTA 1LORA 1MXSA 2J9YA 3W75A 3F4NA 4UTKA 5HWNA 5K3VA 1PCWA 3SI9A 4JN6A 1Q6LA 3TMQA 5AHMA 3NL6A 1AW5A 5F1UA 1D3GA 4NVTA 1TPWA 4CNNA 4YL2A 2WNZA 4N6FA 5FI8A 1BEUA 1T0OA 3GKAA 3EEGA 1ZY9A 1TB3A 1Y0EA 3SJ3A 1T96A 2ISSA 5KMYA 3N19B 3C8FA 5BOOA 1TCDA 3G0UA 1YXCA 2TPSA 1W5OA 1FWWA 2VC6A 3BLIA 1W3IA 1BKSA 5HMSA 4EVZA 1UASA 3SW6A 4GUIA 4O12A 3TXVA 5H91A 1OHLA 2NX1A 5LNUA 1SUXA 3M5YA 5BMXA 3IRDA 2GVJA 3GNDA 2V5BA 3CEPA 4AAJA 3FYOA 3IIPA 3W1MA 3BO9A 1JVNA 3HGSA 3W1XA 3DFSA 5CZSA 4ZQOA 1U83A 3W86A 4QSHA 4U4MA 3TW6A 4ADTA 4Y8FA 3N3MA 1Q6QA 3NQVA 1KBJA 2X1RA 1NVMA 1W8SA 1ADOA 4UCGA 1VCVA 3IEBA 4UTHA 2B0MA 1F6KA 1B57A 1O94A 2F7FA 5CZ0A 4D2JA 3TC7A 1SU5A 2JBMA 3O06A 4Y96A 7TIMA 1XL9A 2Y88A 1EB3A 1H50A 3Q58A 3QEZA 3WK2A 4QITA 3P5ZA 2V81A 5FEXA 2RDTA 2VEKA 5C2XA 4K6AA 2E5BA 4E0CA 5J5RA 3ZS4A 1I2OA 3O6CA 4S2CA 1GYLA 5HQEA 4X9SA 1G4EA 1KLZA 1QNVA 1FDJA 2AGKA 5D30A 1X1ZA 3NZ1A 4UTJA 3KVLA 1GVFA 2WV8A 5FF7A 3TIMA 3P8JA 4IGHA 1X8FA 2J88A 4O28A 5K4ZA 5IM51 3GXPA 3DFNA 4OHQA 4NNAA 3AO0A 2QJIA 3IIXA 4DELA 4JTIA 4UFJA 4NQ1A 5AHFA 2C13A 6ALDA 2J27A 2GQ8A 3TW7A 3I7RA 5DY2A 1SO3A 1VQTA 1P4CA 3QMSA 1P5BA 5EA9A 3TK7A 1NFBA 3HGOA 5LNWA 2RH9A 3L0GA 1JCNA 1NEYA 2ZDRA 3LOTA 4L4MA 3PB2A 3LRLA 4PFMA 4UTLA 3FIGA 3GAYA 4LS0A 2Z0IA 5DY3A 3LRMA 1YPIA 2YW3A 3PBVA 3VE7A 4H3DA 2XFWA 1WXJA 2BZNA 2X1SA 4AWTA 3CQ0A 5D2VA 3N2XA 2V8ZA 4ZQPA 5AN7A 2JGQA 4LOCA 3WJZA 3ZR4A 3NPWA 2EKCA 2WNNA 1YXYA 3MI3A 2O7SA 4TX9A 3CWOX 3NQEA 3NG3A 2W6RA 4RV8A 3W73A 2ISVA 1E51A 3EX2A 3GDKA 2ATSA 2C16A 2A7RA 3DU0A 5D2TA 5AHIA 4UC5A 3TAOA 3ZFHA 2QCDA 2VKZG 2OX1A 2J6XA 5F2IA 4DPPA 2WKJA 3S9YA 3DHDA 1W31A 3V75A 1AK5A 2Y6ZA 4IX2A 1W1ZA 2DP3A 5D05A 3DFOA 3FS2A 1LBMA 3S5ZA 4K38A 5HJLA 1SW7A 2Z6JA 1FWRA 2J24A 3M6YA 3QYQA 5LKYA 3CEUA 3GXNA 4EF9A 3EX1A 2QUUA 1PHWA 2UV8G 4QIUA 1KFKA 4K8EA 4NJHA 4BI7A 5AFDA 3LCFA 3W2UA 5K9DA 3TFCA 3MP4A 3FJ6A 5LZLA 2HS8A 1DBTA 1HO1A 4NX0A 1J2WA 3EWBX 4MZYA 1TPDA 5C5YA 1JCJA 3R12A 2FPYA 3USBA 2Y70A 1L9WA 5F4WA 4ZL1A 2TMDA 1Q6RA 1K03A 1AW1A 5D38A 3Q37A 1EP1A 4XBSA 3LBCA 4RZ4A 1Z41A 3I7QA 2TSYA 5DLCA 3W1NA 3T55A 4RX0A 1L6WA 3L21A 4JX4A 4DO5A 1H7WA 5LSMA 1TPFA 4K39A 3G1YA 1UBSA 3TE9A 4LV9A 1SZGA 4DBDA 1H60A 3ANYA 1GEQA 4OV4A 3BGJA 4ALDA 2VFHA 3FOKA 4XTIA 4DPQA 5CZJA 1O4UA 3N9RA 1P1XA 3SR7A 3TJXA 1QR7A 2YYUA 1YDOA 3BK0A 1FBAA 2H3BA 3HB9A 4IPIA 4AH7A 1JULA 4LRTA 2FB3A 2E6DA 2VEIA 3B4UA 2P1FA 4ML9A 3G0XA 1TTQA 1VR6A 3VKJA 5G1TA 1F2JA 4XTDA 1IXPA 5CG7A 4YCPA 3L68A 3QC3A 1KLYA 1H51A 2Q8LA 2E6AA 2QF7A 4PC8A 4O57A 1FWNA 4CLMA 4JX5A 1OYAA 1SZNA 3I6RA 4IX0A 3G18A 2CLMA 3M0ZA 3LV6A 5I3IA 1LM1A 1W3TA 1QPRA 3F03K 1DVJA 1XI3A 4XQ6A 5BW6A 1DV7A 2DZWA 1N8FA 4UTWA 4A22A 4QAIA 1TJRA 4DF2A 2V30A 3M47A 2YCEA 3GAKA 1EP2A 1WV2A 4CNPA 4ZQMA 1JRBA 2QUVA 2GQAA 4UTTA 3UD6A 2B7QA 3BG5A 4BK9A 1XBZA 4XKYA 3M1ZA 3G1VA 3GYEA 2RFGA 1OFPA 5E1QA 3MP3A 4QQ3A 3W1AA 5F2LA 3W87A 1F6PA 1NF0A 3LLFA 4E38A 3W07A 3NXFA 1WA3A 2QAPA 1YDNA 4M19A 2EF9A 4GXMA 3WFAA 1LOQA 2V9DA 3W1PA 1JUBA 2G97A 2BWGA 3B0PA 1KBIA 4FX7A 1UUMA 3STCA 4K37A 4PL1A 3EXRA 3BW2A 4O0ZA 3NAVA 4GE8A 1GG1A 3C2VA 1OFDA 2C0AA 4MPQA 4LC6A 3OHIA 4GUGA 2FFCA 3TROA 3WK0A 1TPC1 1DJNA 5HULA 3W71A 1SO4A 2R14A 2A4AA 2DZTA 3WJYA 2CWNA 2VXNA 4O17A 3O05A 1GT8A 3G22A 2V2DA 5D33A 4RZ6A 1NF7A 1GZGA 1ZJIA 2ZTJA 4YMZA 4MFDA 1WX0A 1OK6A 1A5SA 1TQXA 3SECA 3O6DA 4R7JA 2A0NA 5G1YA 3PVFA 3KXQA 3NQ2A 4JIPA 4XUGA 2FJKA 3TAKA 3QSTA 3EX4A 1RQBA 1ZALA 4N4QA 3LHWA 3GIYA 4JTJA 3PUDA 1Q3NA 4Z1AA 1EPXA 1LROA 3UWWA 1ZCOA 1ZNNA 3PWAA 1I45A 3GKFA 3W72A 3I7SA 4W9TA 4JNMA 4IPJA 2EAWA 1QOPA 3HGJA 2J9XA 3CT7A 3WJSA 4IMFA 2FLIA 1FCBA 3OG3A 4LVGA 1KTCA 2CLOA 2DJLA 3IIOA 3W6YA 4O10A 2QCLA 1KM3A 3B05A 1XKYA 2WJZA 3GLCA 2CLEA 4GUHA 3LLDA 2Z1BA 1Z48A 4UIOA 2YGYA 3NQDA 3W2MA 4FXRA 1LRQA 3DENA 4WZHA 3FJLA 3LHVA 4B5NA 5EL1A 1F5ZA 3B06A 4XKYB 1H5YA 2DZSA 3VNDA 2ISWA 1AL8A 3ATYA 1T99A 4CQAA 3LI0A 2ZRWA 4WOQA 4CQ9A 1OFQA 2F84A 4UMAA 3KRUA 2Y63A 3LXBA 1OF8A 3ATZA 3RLUA 4MZ1A 4O14A 2WSRA 1KFJA 1GVRA 4KKXA 2QUTA 1X6UA 2BLEA 4NZFA 1FDZA 4I7VA 4S1FA 4TU1A 3LXAA 3G24A 4HIBA 3IIZA 3G0SA 2ZRYA 3P80A 1G4SA 3EX6A 5C54A 1S5VA 5L6UA 3SY5A 3EWZA 3FA5A 2RDUA 5MHBA 4OE7A 4UNLA 3LHTA 1THFD 1VRDA 3LDVA 3TSBA 2OZ0A 1ZENA 1JCXA 3RU6A 2QCNA 1OJXA 1LRNA 3STEA 2DZXA 3O6YX 4RXFA 4ZQNA 5D2YA 2GJLA 3NM1A 1RR2A 4GBUA 1BWLA 1XUZA 4O54A 4AF0B 2WQPA 4FB7A 1L6YA 3HPXA 1LCOA 2Y89A 2NX9A 3IVTA 4IMDA 3S0CA 2CW6A 3CM4A 4UMBA 2VOMA 1RZMA 5F2GA 2QAFA 4MIMA 4PODA 3T78A 1NSJA 3P8IA 1OFRA 1VH7A 4DBEA 2FTPA 4O15A 6TIMA 1C9DA 3PF3A 5DXXA 2VFIA 2Z2UA 1H7OA 4RJEA 1RQHA 2DZPA 1H61A 2Z6IA 4LV4A 3C2RA 1OYBA 1O5XA 1PHQA 2XN2A 1UJPA 5DBTA 3DAQA 1FCUA 4WD0A 3JS3A 3DFPA 1FDYA 3CHVA 4K36A 1PS9A 3GB6A 2ZRXA 3KHJA 2ZZ2A 5HNRA 3DI0A 4DQWA 3B0VC 3PSVA 2YFOA 4MVAA 4FO4A 1XBVA 3JRKA 4FX6M 1LP6A 2Y7FA 1K7XA 2W79A 4IWWA 3NQ7A 3C2EA 4LVFA 3QF0A 2YPIA 1KM1A 4WY0F 3A24A 3QZEA 4UFHA 2ABAA 1I2PA 2RKXA 2CLKA 3FEMA 1O60A 3N2MA 2A1YA 4N9CA 2Y7DA 3DH7A 3P84A 1SFJA 3HF3A 4ZQCA 3UWVA 4N9DA 1C8VA 1JCMP 2YZRA 3M43A 1WBJA 1HO4A 3O16A 1VCFA 4MYXA 5DELA 3H54A 3DFTA 5LGZA 2HMCA 2VEPA 3QPYA 3W23A 2GQ9A 1OX5A 4LTSA 3L0NA 3P74A 1FQ0A 3BPWA 4WX2A 4JY8A 3TXZA 2CLFA 3GDTA 2H90A 4TO8A 3A21A 3UYCA 3UPBA 1FWTA 3KRSA 1I2RA 1KFBA 1ME9A 4JTEA 3UZ5A 3LCHA 2I1OA 1F05A 1DKWA 1H1ZA 4O52A 4POCA 1ZFJA 1PV8A 2O7QA 3E0IA 4I7UA 4G1KA 1SW0A 1JJKA 1CW2A 1GYNA 1H63A 4Z0JA 1KTNA 1LZOA 4PH6A 3A9IA 1H62A 2ABBA 3NA8A 3V1PA 3TMLA 3O07A 3L9CA 3LCWA 2Q8ZA 1TTJA 4MY8A 3EWYA 3PAJA 1BWKA 1XUUA 4WUIA 2V5LA 3P82A 3O63A 1OX4A 1FCVA 1F7BA 1QO5A 2NUXA 1PL9A 1TRDA 1B4EA 1GWJA 4GRSA 4OU1A 4BWLC 2DORA 3Q2DA 4O1AA 3PBYA 3KVJA 3WJXA 5H2ZA 1K3UA 2HSAA 1SZFA 3DFQA 1M5WA 1WYIA 2HS6A 3C61A 3L5LA 3CWNA 2E5DA 5CGQA 1OX6A 5ABTA 5KITA 4TIMA 1JCYA 1TTPA 4RK8A 5TIMA 1LOLA 5K9XA 1DHPA 2WO5A 3W2KA 3A5VA 4FNRA 4UTMA 2VENA 3B03A 4ORMA 1MEHA 4OT7A 3CIWA 3MUXA 2R91A 1I2QA 2CFFA 3DGRA 4N9BA 4ZQRA 1XC4A 5U7SA 3LCXA 1F76A 2YYTA 5KZDA 1ICSA 3PBUA 4CCDA 3G1AA 1TO3A 1FXPA 1J5TA 3UZJA 2XN1A 4O53A 1KV8A 3GNNA 2B7PA 2NWSA 2C18A 4WQ6A 1F74A 4BFAA 2YX0A 1W56A 4WOZA 2NUWA 2PRHA 1VJIA 3THQA 4M6PA 1B3OA 4HSOA 1VHNA 1R2SA 5G2IA 5HUPA 5FF3A 2TRSA 5LGXA 5DCDA 2NXHA 3WK1A 4DF1A 3VCRA 1TPVA 3LHYA 2Q3RA 1DOSA 2QDGA 3TH6A 3FFSA 2ZRUA 3QM3A 3TJLA 2OT1A 3MBDA 4NT0A 3TQ0A 1G7UA 3NQ6A 4JS3A 3DBPA 5FF4A 3NQCA 1TIMA 3LM7A 3LERA 3BG9A 5EMUA 4UTUA 5IBXA 1SR9A 4JIQA 3UY7A 5J5DA 3EWUA 3TSDA 3EX3A 3TNOA 3QRHA 1QPNA 4UTIA 4Z1CA 5K2ZA 3W84A 3ABSA 2ZA2A 3P67A 3THAA 2V82A 3OIXA 1VYPX 4A2SA 2ALDA 3NL5A 3PG9A 2ZTKA 5C55A 1OYCA 1OFEA 1S5TA 2V2HA 3STFA 3W22A 2BTMA 3N73A 2G96A 1GPWA 3O8AA 5AYXA 1JUEA 3YPIA 3TU9A 1PCKA 3AJXA 5E0KA 4PEKA 5CZTA 4CCCA 5D03A 3BW4A 3RMJA 3OEXA 3TDFA 4LUJA 3HO8A 4DO4A 4Q4KA 3S5OA 3PB0A 2CU0A 4YXGA 1HUVA 3LHUA 1XXXA 2H3DA 2X16A 4N2YA 4JDYA 2QKFA 2C1HA 4ZMGA 4N6EA 5TBOA 4MUZA 3OVRA 3W2LA 2Y7GA 2QCDB 1PIIA 2ZZ7A 1I4NA 5K4XA 1GVQA 1V7YA 2A6NA 5D09A 1YXDA 4LW7A 4J9JA 3HG5A 2GVGA 1TPUA 2Y7EA 1TV7A 4N02A 1LBLA 1W54A 4PA8A 1W0MA 1JQVA 3GVGA 3NDOA 3E9AA 1VCGA 3DI1A 3G1DA 1NAL1 2GPTA 3NQFA 4O50A 1IGSA 2E77A 3B8DA 3EKLA 3GDMA 3M5VA 4O11A 1YTKA 4YLWA 3G8RA 3LTSA 4MLRA 3QQ1A 3W74A 3QH2A 5CKSA 3U8GA 3W83A 4O0KA 3S8HA 2OMAA 3QW3A 3C3NA 1HG3A 4BI5A 3TSMA 3MP5A 5F2MA 5HR7A 2A7PA 2VFFA 3SZ8A 3W70A 4HNUA 2DU2A 4FNTA 1IXQA 1KM4A 4A29A 1TYGA 3MI2A 3CLMA 3M7WA 1OFBA 2FPTA 2QCFA 1G67A 3NOEA 2VEMA 3UWQA 3RNDA 5AB3A 1XDLA 1KM2A 5F4XA 4GUJA 4LRSA 4BI6A 4OGZA 4AMAA 4RLIA 1TV8A 5G2HA 3UXAA 2QR6A 1Z42A 5CPNA 1DJQA 2EGZA 5DBUA 1VPXA 4XZ9A 2Y61A 5AC6A 3FYPA 1H1YA 4O13A 5EBUA 3H53A 3P5YA 2E5CA 2Q3OA 3H55A 4Z1DA 3LTYA 4MY9A 4GWEA 4FHAA 1KV5A 2C6QA 4A21A 5KINA 3L5AA 4AXKA 1ME8A 4I7WA 1TV5A 2ZQ0A 5I3JA 1TRIA 1QOQA 1SW3A 3HPSA 4BR1A 1WAUA 4S2BA 1L2UA 1EUAA 4AB4A 4GC4A 3L67A 4KFNA 3TX9A 1XBXA 4NXSA 4U28A 4RKAA 4E2DA 3R13A 5HWJA 3N14A 2WSQA 4EF8A 2Y85A 4OWGA 1WQ5A 3F1QA 4TR9A 1WOBA 1MEIA 2WSYA 2PE4A 1P0NA 1MEWA 3IVUA 3PC0A 2QCHA 2X2GA 5EY5A 3N9SA 5G4EA 1KFEA 3QFEA 1JQXA 3EXTA 4N9EA 3W7GA 3NPVA 3RFAA 5A5WA 3U2OA 3T4CA 3S5YA 4Z08A 5C6MA 3W88A 2LLEA 1W5PA 3MBFA 2B7OA 3NZRA 5DXYA 3BVJA 4GUFA 3PUOA 2P10A 3O15A 1ICQA 1FCQA 4UFMA 1LLWA 4UUIA 1RQEA 3GR8A 5K7JA 4KWVA 3TUUA 3TC6A 1KM0A 4TMCA 4M7SA 4EOUA 5I3HA 5HINA 1A5AA 3NPXA 2FPVA 3C2OA 1EUNA 1ML1A 3UWZA 1IIHA 3M16A 3C2FA 4AWUA 4Y90A 1TJPA 3HBLA 4MOZA 4NU7A 4DEFA 2VFDA 3R5EA 1FWSA 3W3OA 4M7TA 4HT3A 4QISA 3O1NA 1XDMA 2NWRA 3T44A 3U6WA 1T8XA 2NXIA 5F4SA 1LTDA 4NNCA 2YR1A 4MKNA 5D37A 3A5FA 1A5CA 3GXTA 3NL2A 3WJWA 5KZEA 1VLIA 3G1XA 3P61A 4JTGA 4AHQA 1W5NA 1XCFA 3I65A 3NQ8A 4NXKA 3W1RA 1SPQA 4BWLA 2W0UA 3KAOA 4JYEA 1K02A 1P0KA 2YXGA 3W1LA 4EIVA 1LBFA 4BF9A 2PRMA 3NYZA 1DORA 4JTSA 1U5JA 1GQNA 3WK3A 4MYAA 1W5QA 3S42A 4NUWA 4HN4A 4JD4A 4HNNA 2FQIA 2QCGA 4FEZA 2RDWA 2PC4A 5FF0A 5HWMA 2A7NA 1R2TA 1R47A 3SGZA 3W7MA 3NQAA 3S1XA 3NPUA 4K8HA 3KX6A 3G1HA 4XWUA 4FNQA 1IIGA 1K8ZA 3DKLA 3IGUA 3LBMA 3OA3A 4O4VA 4UXDA 3W7RA 4FX8A 2PCQA 2ZZ5A 5LNVA 4OQVA 3W7HA 4GNJA 1YLVA 3FKKA 1YYAA 1IXOA 3T40A 3OVPA 2XN0A 4LUIA 4X3ZA 3MHGA 4DO6A 2CZFA 3K30A 4JGDA 1OK4A 5K9CA 5EPDA 3VI2A 4HPXA 2BSLA 4RCXA 4NX5A 4JICA 3NGJA 2R94A 3E12A 1ICPA 3LGEA 1FX6A 4MJZA 1SQ7A 1EX5A 1XBYA 4OV9A 3L0KA 3F4WA 1QMLA 3M5ZA 1TQJA 4UR8A 3W7EA 3GR7A 4JXCA 2ZZ6A 3BLFA 1LOSA 2NZLA 4O1CA 4AHOA 1KTBA 3EB2A 1QCWA 5GVJA 3L66A 4ICNA 4ADUA 3HG3A 1W5MA 3W7LA 3RK8A 1N55A 4Y6GA 3W7DA 5CPLA 2E68A 4FIQA 1SO6A 4NZJA 5EKYA 3ABQA 3W7CA 5TQLA 3MJYA 2ZFAA 4JTFA 2E1DA 3BG3A 1G4TA 3EWWA 4O1DA 1XM3A 4JTKA 3S1VA 3W1UA 3IIVA 1K7FA 1TTIA 4P61A 4UFKA 1TREA 4R33A 1VGAA 3S1UA 3LRKA 1R2RA 3NQMA 3TV8A 3P62A 2A21A 3BV4A 4FNSA 2ZA3A 1WDWA 1KFCA 1M7OA 2QCEA 1K7EA 1CI1A 4LNYA 1HL2A 3TR2A 5FESA 4IJBA 1AW2A 5I3KA 4IMCA 1VYSX 4K7YA 3NO5A 3W85A 3QSRA 3B0UX 1GG0A 3LHZA 4PCFA 1GTHA 4HSNA 3W7QA 4WXYA 4P2VA 5D2WA 4JDBA 5KSWA 4A3UA 4A2RA 3E49A 3C0JA 1ZAJA 3BARA 4I9AA 1H7RA 4JY9A 2ZZ4A 2C15A 3A22A 3S5NA 5D04C 1CX9A 3KVKA 1DQWA 4AHPA 3UY8A 2AAMA 3CB8A 4JEQA 3PUEA 4QNEA 5FEPA 2G5WA 2ZCGA 5HUOA 5AHEA 1UB3A 2DZUA 3HJZA 2C14A 2CLLA 1VZWA 1TMHA 1PE1A 4UFLA 4JTLA 3NR0A 3M5XA 1N7KA 3C56A 1LYXA 1V5XA 3L65A 3QQ0A 3OVQA 4FNPA 4IOTA 4JR5A 1ZAIA 1L6SA 1UUOA 2DJXA 1LLZA 3MYOA 3EWXA 1JRCA 4MY1A 4RZ5A 4UR7A 1SSDA 3RLVA 4GJ1A 2NV1A 3PBWA 4KFOA 2J9ZA 3MHUA 4M6QA 4O4WA 1QWGA 4IMGA 3HMJG 3W2JA 3TQVA 2I9EA 4O18A 2NXGA 4RXGA 4LY8A 4YWIA 2C3ZA 1JR1A 2CZ5A 2GUUA 4X2RA 1SO5A 1OG0A 3G1SA 1VHCA 2JKPA 2CZDA 4NJGA 4WY0A 3GDRA 5AHLA 3MWAA 2JGYA 1OFAA 5HR6A 3T7VA 2E6FA 1EA0A 3HGRA 4M5PA 3E02A 1PVNA 2H6RA 1SFLA 1VC4A 4HKPA 1VLWA 2V0TA 1H7PA 3SFKA 4IXXA 5L9FA 1MSSA 3W7IA 4LS1A 3MYPA 3NL3A 1KM5A 1WBHA 3CIXA 5EYWA 1OF6A 4LVAA 3IGXA 4MFEA 1TSIA 5AYZA 1S5WA 3BLEA 3NM3A 4LT9A 4C1LA 2I14A 4HNVA 5G4WA 3NEVA 3STGA 2R8WA 1A5BA 3GX9A 2B7NA 4MZ8A 3ABOA 1RVGA 1FXQA 1KM6A 3IVSA 4Z1BA 5AC8A 2ZYFA 1FY6A 3HG4A 5CSRA 3W1TA 1HTIA 4O8RA 1M7PA 2IQTA 3BGGA 3LV5A 1OABA 5KTLA 4WXZA 1Q45A 2V2CA 2BXVA 3MI6A 4NJIA 2C19A 3R2GA 1WOAA 1I2NA 1W37A 1AL7A 5D32A 4N4PA 1EP3A 4K7VA 1K8XA 3LTPA 1YDVA 2ZRVA 5CPMA 4JTHA 2QCCA 3D0CA 4DXVA 3L5MA 3PR2A 1QO2A 4IUOA 5LHFA 1R30A 1ZAHA 2WPBA 2JKEA 1K8YA 1RD5A 2ZA1A 4XBKA 1IXNA 2YSWA 3VE9A 3JR2A 3IGSA 5DCEA 1EIXA 3MO7A 3OBKA 1QFEA 2NV2A 3MHFA 1LDCA 3G1FA 3DXIA 2ATMA 5KZMA 4ONVA 5LHEA 5FEZA 5LNSA 1QPOA 2BX7A 2H8XA 1G6CA 2X30A 3QW4B 5F1VA 4HHPA 3DKJA 1MO0A 2NX3A 1GVOA 3EXSA 4WY0B 5FF2A 3GZ3A 5BMWA 3INPA 5I3GA 3NQGA 1DL3A 4QNWA 5DCBA 1RPXA 3VFLA 4NJKA 5AOUA 3ABRA 4TMBA 1EWDA 4EWND 3TQKA 3SGUA 3CC1A 2E6YA 2G95A 2Y62A 1YADA 4CNOA 1OX4B 3KRZA 3P7YA 2ZRZA 1GOXA 4H6KA 4UFIA 2HTMA 5D02A 3QJAA 1R46A 3PS7A 1M6JA 2YFNA 5FEWA 4AF0A 5CPOA 3GK0A 4O19A 3UWYA 2RHGA 5CSSA 4WJEA 4NNBA 1AMKA 3FKRA 4HNTA 1H7NA 2CLIA 2DZVA 1KW1A 3IV3A 4X22A 4ZVJA 4Y9AA 5I3FA 3DHFA 1YPFA 1XFBA 4M6VA 3G8EA 4LVDA 1W3NA 4LC8A 1GJPA 5G2WA 1F73A 2EHHA 2QJGA 3ZWSA 3PULA 1G4PA 3W7KA 2X1UA 2JKAA 1QDSA 1QPQA 2ZBTA 5BNKA 1TPB1 1TPH1 5DN1A 1B9BA 1A53A 1G7VA 2FDSA 4O1BA 3UQNA 3RF9A 1J4EA 2FIQA 4QM1A 3W76A 5AC7A 3W9ZA 3P81A 3LB0A 3G3MA 5AHNA 1Q6OA 3P60A 4H4IA 4UTWC 3PM6A 4DF0A 4Z0SA 1ZHAA 3M9YA 4QJ1A 1FUYA 3MMTA 3B04A 4KFPA 4YCOA 5LNRA 3BW3A 2YDAA 1GVSA 4KWWA 4PTNA 3SIZA 1QAPA 2A85A 5T26A 4NJJA 5BRBA 4MLJA 3N34A 4R53A 3KFTA 4UTTC 3UXDA 2QEZA 1SSGA 3HIJA 1O5KA 4JTTA 2QCMA 3S6DA 2A5HA 2GOUA 3NNTA 2OCZA 2QJHA 3W7JA 3LXCA 2CZEA 1A50A 2NUYA 3LCIA 2TYSA 3UWUA 1UCWA 2YW4A 1HFBA 2WNQA 3TCEA 1KFLA 4ZZ9A 1S3HA 4Q33A 1LRTA 2H8ZA 1ALDA 3TA6A 2ZZ3A 2JK2A 1RV8A 3QPZA 1BTMA 2A6LA 2VELA 1EEPA 4R34A 1OFOA 4FXSA 3FLUA 4JTUA 4O16A 3CTLA 2OJPA 2AQWA 1KA9F 3QMTA 4GFSA 2FB2A 1X7FA 4IQLA 4C1KA 3DZ1A 4E2BA 3PSWA 3ZWTA 2KZHA 2CLHA 1H7XA 5E93A 3C52A 4LWWA 1YTDA 2OT0A 3ELFA 4LVBA 3C4UA 5D2XA 3A23A 3E96A 5AYYA 1VYRA 2VFGA 3EKZA 1ME7A 2VFEA 4MJMA 2P0OA 1X1OA 4ADSA 3W7PA 1EWEA 4Q32A 3UPWA 3PY2A 3S1WA 4CQ8A 1VS1A 2NLIA 3QMRA 4AVFA 1G69A 2GJNA 1I8JA 3LCGA 3MW7A 4UNKA 2ZZ1A 1GTEA 2WOQA 3PG8A 3M41A 3C6CA 1D9EA 4FNUA 2D73A 1JUKA 2GVLA 4CCEA 2PURA 4JYDA 4JX6A 1JCLA 5A8GA 4IXHA 2X1TA 1Z44A 4UMCA 3W2NA 1D3HA 3HG2A 1IF2A 1MZHA 3M44A 1AG1O 3L2IA 4IMEA 3HPZA 3SSJA 3GDLA 3G3DA 4PL2A 2EPHA 4AEOA 2A2IA 3R89A
chains in the Genus database with same CATH superfamily
1R7OA 1JI2A 3EEZA 5SWUA 4C6MA 4RR4A 3I68A 3BJFA 2EG7A 3R8RA 3CU2A 1TV2A 3M0XA 4FIRA 1PEZA 4FF7A 2FKPA 2E4TA 3W7OA 4H6RA 1O5QA 4L4LA 3LNPA 4LJ3A 1EZWA 3VOCA 1XD1A 1JZ3A 1TPEA 1XCWA 1M41A 1UD6A 4LU0A 1CBGA 3W75A 4ZSUA 5TF0A 3ZR6A 3WNPA 1Q6LA 3ARYA 5AHMA 1TWSA 4LUTB 4Q6XA 1JCTA 1V93A 2R9RA 4HZ7A 3N15A 4YL2A 2WNZA 1BEUA 3RU8X 3GKAA 3EEGA 4PUJA 3LA4A 5KMYA 5BOOA 2TPSA 1PWMA 1W1TA 5I23A 2VC6A 3CQJA 1UASA 2YCLA 2NX1A 2RGLA 1CNVA 5LNUA 1SUXA 3M5YA 3EOLA 2FGBA 2O9OA 3IIPA 1XLJA 1JVNA 1W9XA 1MUCA 5CZSA 1XFCA 4AD5A 3WBXA 4U4MA 3TW6A 4JBRA 3NQVA 4GXPA 1ADOA 4L1GA 1XLGA 2CHNA 3IEBA 1YIXA 4CUCA 4TUFA 1HVXA 5IOBA 3A3WA 1O94A 1Q13A 4L1WA 1SU5A 3O06A 2HVNA 3D46A 1YRRA 4MDPA 3UGVA 5JUVA 3Q58A 1FWGC 4QITA 1ZB5A 3P5ZA 1TX0A 3SGGA 3DIPA 4LCQA 1HJXA 3C0SA 1HF6A 4X9SA 2VJXA 4LUTA 1XYFA 1FDJA 5D30A 4EAYA 1FWAC 1ZBVA 2WK2A 2WV8A 4IL2A 2D1ZA 4D6HA 5CC7A 1JAKA 2XM1A 2NV9A 4O28A 5K4ZA 3BCJA 1UKOA 4NNAA 4XISA 4NQ1A 5FCZA 2WC4A 2XH7A 6ALDA 4GOAA 5DY2A 3OGVA 1P5BA 5EA9A 4L6DA 2XSAA 1NFBA 3VTRA 2UY3A 1NEYA 1IT8A 3VUPA 4AVOA 3OB8A 4F0KA 2Z0IA 3B9EA 3LRMA 3MTWA 3GXMA 3HTWA 3K4WA 3VE7A 1WXJA 5A8QA 3VMNA 4XG1A 3WDHA 3LQGA 4GLEA 2IKIA 4AWTA 3AZTA 1GQLA 5D2VA 2Z00A 1YPXA 1KCLA 2WNNA 3WQ8A 1XSIA 3H23A 4QJ5B 2RUSA 4PSRA 2W6RA 2ISVA 1E51A 2E25A 3GDKA 4EXQA 1UJQA 3DU0A 4GIEA 3TAOA 2VEGA 3ZFHA 2QCDA 2VKZG 2OX1A 2OO0A 1VP5A 5CCZA 2HVMA 2R1MA 1W31A 3QGKC 4B92A 2FFIA 2Y6ZA 4CU6A 4IX2A 3FS2A 2Z6JA 1FWRA 3M6YA 3QYQA 3MA8A 4EF9A 4HZ8A 3K4AA 3WMLA 3VGBA 2X09A 3TFCA 3KM8A 3P6LA 4BJHA 1DBTA 1BXCA 1E6XM 1HO1A 3GE7A 1TPDA 1B0IA 3W81A 2FPYA 2ZX8A 3USBA 2VT0A 1ZCCA 5CGTA 4PTXA 1NY1A 1S1PA 1I60A 5D38A 4RZ4A 2OYKA 2HK1A 5DLCA 1IZJA 1OSEA 3T55A 4RX0A 3K8MA 4JX4A 4QP0A 4S3JA 5LSMA 1Q2SA 1TPFA 3WQPA 3RM4A 3GIQA 4GXWA 1E9LA 2ZXBA 3VNYA 4LV9A 3N12A 1WUEA 1TCMA 3H4WA 2PDIA 3NQBA 3BK0A 4LF1A 3U2EA 3TYZA 1WKDA 3QZ6A 4GCXA 3UJSA 4EPDC 4LRTA 4FXFA 4CCZA 1XYCA 1JL8A 1F2JA 1Q7ZA 2CEQA 2J7EA 4XTDA 5CG7A 1YBQB 1EO5A 5CLWA 1M7JA 2XWDA 4PC8A 3OZMA 1E9YB 3WF1A 1GW1A 4AMCA 1SZNA 3G18A 1Z6KA 3M0ZA 1GZJA 1O1ZA 5EFDA 5IFPA 1DVJA 5BW6A 3LBOA 5MKGB 1N8FA 4QAIA 4A22A 1TJRA 3N3TA 3TYCA 4DF2A 1DIKA 2V30A 3MMWA 4QDPA 1RBLA 3QOMA 1J96A 2C71A 4D9PA 4V1YA 3W01A 4BK9A 1GJUA 3M1ZA 3LG3A 1KRAC 4C7GA 5E1QA 1HJQA 5IFTA 3W1AA 5F2LA 1TVLA 2J8TA 3LLFA 4I9MA 3NXFA 2ISDA 3PN8A 3IACA 3SJNA 1EJRC 1KBIA 4FX7A 2DDXA 2HWGA 1UUMA 2E8ZA 5C2CA 2VX4A 4PL1A 5KZ6A 4O0ZA 2BBFA 4GE8A 3VKKA 3C2VA 2XTKA 2VO5A 4ICMA 1H49A 4CD6A 1XIFA 2PWUA 2C0AA 5I5RA 1B5TA 1IGWA 3OHIA 3P2VA 3WK0A 5BU9A 3WJYA 3O05A 1M7XA 3T09A 3G22A 2V2DA 3KWXA 4RZ6A 1ZJIA 4YMZA 3EOOA 4B5WA 3ORWA 3SRHA 1UQYA 1ISYA 3NQ2A 3NYDA 1ZALA 1KXVA 4N4QA 3PUDA 5BOEA 4CN1A 4IFRA 1XIMA 1ZNNA 3N29A 3D3AA 1E70M 3PWAA 4IQDA 1R3WA 2XHYA 3NZGA 1EGVA 3GKFA 1QI4A 1J0IA 5BZAA 4Q8TA 4IMFA 3LMYA 3IPWA 4PGLA 3LPFA 4AZ5A 2PLKA 3W6YA 4LALA 4O10A 5FJTA 3V5FA 3GLCA 3OYXA 3LLDA 1Z48A 3BSGA 4KBXA 4CEXC 3W2MA 1LRQA 3KEHA 3FJLA 4G2DA 1F5ZA 5JMUA 3AU2A 4DO7A 1DXFA 5JH2A 1F3TA 1AL8A 1GOKA 2ZRWA 4W89A 1U5VA 1WKEA 1KFJA 1BGAA 2QUTA 4HPGA 1X6UA 1LT8A 3HQPA 1FDZA 4S1FA 3G24A 3IIZA 3G0SA 3H2OA 1G4SA 2QS8A 2PDYA 5FJIA 3CQIA 3CTTA 3LHTA 4DYEA 4K2SA 3LDVA 3RU6A 1LRNA 2DZXA 1EF2A 4RXFA 3E3HA 4LCSA 3NUKA 3VGGA 2PDKA 2XVKA 5FL0A 4GBUA 2ODOA 3H2FA 1T41A 4AF0B 1E6RA 5ABFA 2WQPA 1GVIA 3BZJA 2E9LA 2OOGA 2Y89A 4HOWA 2NX9A 3S0CA 3CM4A 4P7QA 2GVEA 4GQGA 2ZIDA 3P8IA 4LB3A 4I3GA 4DBEA 3IWPA 1LUCA 2FTPA 4JIIX 4CD7A 3ALFA 3CMFA 5A94A 3PF3A 2Z2UA 2GK1B 3WLLA 3QPEA 3H22A 1JXKA 5TD4A 4H7VA 4NILA 3C2RA 1MYRA 3AHVA 2OODA 3H2CA 4QG9A 1SGJA 5DBTA 3UEQA 1FDYA 4TVUA 2PTXA 5HNRA 4DQWA 4XV0A 3PSVA 1XBVA 4QEHA 4V33A 4FX6M 2CBJA 4UWMA 1CB2A 2Y7FA 4DUVA 4LUSA 5FL1A 2XGBA 1Z32X 3C2EA 2OO6A 3QF0A 3VDAA 4J40A 2E9BA 3A24A 5MF5A 4UFHA 1YDYA 3DC0A 3P93A 1KNWA 4EPEC 4ZQCA 3M43A 1VCFA 3W28A 1GKQA 2BB0A 3W23A 2GQ9A 4LTSA 3L0NA 3ITVA 2PDPA 3TXZA 1POJA 3PNZA 4I5XA 3SFWA 4BZYA 5AECA 1QXLA 3UPBA 3LCHA 2I1OA 1F05A 2PDMA 4I5UA 3H2NA 4AYGA 4MHBA 1PV8A 2O7QA 3QQWA 2B31A 3WQCA 4Y9MA 1Q2RA 3UT0A 3RCMA 3ABZA 3N4EA 1KTNA 2F61A 3KL3A 1DEDA 5LIKX 4P7RA 4R27A 2OU4A 2ABBA 3NA8A 3TMLA 3O07A 1K9TA 1S2CA 2TODA 3ZZ1A 2PWHA 1PKYA 1BWKA 1XUUA 1JDDA 2V5LA 1KGUA 3UBPC 3WQEA 1CZ1A 1A5UA 4TVDA 1F7BA 1PL9A 1TRDA 1B4EA 1GWJA 3Q2DA 3A47A 1WXYA 5EMKA 1PKLA 3WJXA 4S39A 3CUFA 3CV6A 3QKZA 2VVSA 4H6EA 2YCJA 1SZFA 5HNTA 1S38A 3WNLA 1OGSA 2HS6A 3L5LA 1XYAA 3AMLA 3GNXA 5LIXX 3A4JA 2CITA 1TTPA 5LA0A 1LOLA 4Q22A 3MKCA 3UW6A 2H9AA 3OZYA 3QHOA 4ORMA 3AFBA 1YE4A 4GVFA 1I2QA 4ICCX 1UP0A 3WENA 3A4AA 3V16A 4DZHA 1ADDA 1TO3A 2YB4A 1J5TA 3UZJA 2IMRA 4GYKA 3EA2A 4C65A 1MVYA 1UWUA 2C18A 2PRHA 3WH5A 4C1NA 3FVMA 1QUMA 4LAOA 1E3XA 4AIOA 2ZUSA 2VGBA 3RITA 5LGXA 5DCDA 2NXHA 1VFUA 3WK1A 1BHGA 4PRWA 3TNBA 1DOSA 1GNXA 2QDGA 3TH6A 2ZRUA 3U2CA 3Q4DA 3QM3A 2OT1A 3BOFA 4JS3A 3NQCA 4WRHA 1JDCA 1TIMA 5EMUA 2WSPA 1CXLA 3ZJ8A 2PA6A 1TV3A 2WBGA 5J5DA 3EWUA 1ZS2A 4PMUA 3GFZA 1TWWA 3EX3A 3FSTA 5I79A 4LPCA 1DXIA 4RUBA 4UTIA 2PD9A 2ZADA 3E0WA 2ZA2A 5LA1A 3F2DA 4FOJA 4R7WA 3KTSA 3VOIA 2ZTKA 4PUMA 3N18A 3STFA 4DWSB 3N73A 3WNOA 3H12A 3O8AA 2PP1A 4HA4A 1XINA 3AJXA 3C2YA 4PUUA 2PP0A 3BQ6A 3RMJA 3OEXA 4LUJA 3ARQA 3GSMA 2CU0A 1UH3A 1V0NA 4JTCA 3GRIA 1EJWC 1NDYA 1BQCA 4F3HA 4JDYA 5D8ZA 2WZTA 4MUZA 4NHVA 3SCQA 2XVPA 5CQ1A 3W2LA 2E28A 2YLAA 3AIBA 2E0PA 5K4XA 2A6NA 1K8CA 1HGYA 1YXDA 2QV5A 3HG5A 4J9JA 3VDBA 3XIMA 4FOKA 4PA8A 1JQVA 3E9AA 1TIWA 2WYSA 1VCGA 2P8CA 3DI1A 3NQFA 4O50A 3B8DA 4O11A 2V3DA 4DN1A 2PDUA 2ZX6A 4YLWA 4RDYA 4MLRA 1KGWA 3QH2A 5CKSA 3U8GA 3V7PA 3W83A 3QW3A 4XZWA 2YCIX 4BI5A 5I00A 2EPMX 5HR7A 1XSKA 1R3RA 3SCSA 3TEVA 1KM4A 3KLLA 3UZZA 3MB9A 5GQBA 1TYGA 1DJIA 3WMSA 1GW9A 1PBGA 4ERAA 3OU8A 1HKVA 4NRRA 1TUFA 1XDLA 4LRSA 3RX3A 4BI6A 4K1GA 4AMAA 1J0ZA 3QGVA 3HPAA 3UXAA 4LAZA 1Z42A 4L64A 4CQBA 4QS6A 2EGZA 3ISIX 3PPFA 5ABFB 5DBUA 4XZ9A 3NZQA 4H9XA 4GVGA 5EBUA 1JDFA 2DEPA 1JF6A 3EDEA 2X0SA 3KLKA 1CGYA 4TX8A 3LTYA 3FXYA 4MY9A 4FHAA 1KV5A 2C6QA 1B3ZA 4AXKA 1RD6A 5I6SA 4RDWA 4I7WA 1TV5A 3L12A 1SW3A 3WMBA 1WAUA 3WSUA 4DRSA 4MWAB 3H70A 1QI2A 4NXSA 3KZSA 4PMYA 3N14A 2WSQA 1J2BA 4OWGA 3ZVHB 2UWFA 1HL8A 1T6MA 1MEIA 4AY1A 2J6VA 2FVLA 1E0WA 2CXGA 1P0NA 1RUSA 5HJXA 4G6CA 1IT7A 2VCAA 3IVUA 4BQ3A 4IMAA 1JPKA 5EY5A 1UD3A 5BOFA 1PKMA 3QFEA 2G4JA 3E2SA 2ZKMX 1TR9A 4QX4A 1J6PA 3OPSA 1N8IA 1P0BA 3AIQA 5C6MA 2LLEA 3MBFA 4GMEA 2WMGA 5DXYA 3PZIA 1MNSA 3PZQA 2P10A 2WVUA 1ICQA 4HU3A 4UUIA 1RQEA 1KM0A 1NARA 5AVHA 3NPXA 2FPVA 4EANA 5HBFA 1EUNA 3M16A 3C2FA 3VX1A 2DZBA 4Q4OA 4Y90A 5HPOA 4DEFA 3POHA 3VUSA 1CENA 4M7TA 4GG9A 4LCRA 1G94A 3VOHA 1T8XA 1VFFA 1JYWA 1G5AA 4PBFA 1LTDA 2J7BA 4PMJA 1A5CA 1VLIA 3WLOA 1SPQA 4PFHA 2YXGA 4IIBA 5FJRA 1J79A 4D8LA 1U5JA 1GKPA 4JFTA 2OZTA 4HN4A 2FQIA 2PC4A 3Q45A 3ARWA 1UR4A 2G3IA 4ROQA 3OA3A 4O4VA 1UD8A 1B3WA 3UR8A 3CZGA 2ZZ5A 2XJ7A 4GNJA 2GDUA 1YYAA 2AAAA 4J3SA 1A3HA 4X3ZA 5RUBA 2PZ0A 2CZFA 2GJRA 4GJIA 3EDKA 1VRXA 5EPDA 1YNPA 3CH9A 5AC5A 3IUIA 1EH9A 3HA1A 3OZPA 4RCXA 1EDGA 4FALA 2FYMA 3QHMA 4FK9A 1ZJHA 2IS7A 4D8AA 2P0IA 4NIRA 5I06A 2ZZ6A 1ZBWA 4AHOA 4D6DA 3R0KA 3AMDA 2OXNA 2POZA 5GNZA 4M6UA 1R5YA 1I1WA 1E73M 4PCSA 4F0MA 4QCEA 3OQEA 4Y6GA 5C9ZA 4KQNA 5JU6A 1WKYA 4ZB2A 4NZJA 3OYZA 1JF5A 4Q7IA 4GINA 3ABQA 3WDJA 2CXEA 2ZFAA 2E1DA 3MDWA 1G4TA 3VNIA 4O1DA 3HPFA 1XGDA 3S1VA 3IIVA 4P61A 3AJ7A 4RDZA 1E5JA 1GOQA 1EBGA 1BQGA 1BRLB 4F0HA 3WLKX 2A21A 3BV4A 3MZ2A 1AW2A 3OLEA 3W85A 1F8IA 1AQ0A 3QSRA 3B0UX 5J04A 2ON3A 3QC0A 3FJNA 4HSNA 3W7QA 2F2HA 2WC3A 3IJ9A 5ECUA 3UZXA 4ZOAA 5I24A 2VDGA 3WCZA 1RK6A 4Z2KA 2PDJA 4A3UA 3T0AA 1K9EA 4L80A 3PJWA 3WQ6A 3E49A 3N9KA 1K4GA 2R1KA 5CJMA 2VRJA 4U33A 3WLJA 1C90A 4U10A 2C15A 1C7SA 3RPTA 3S5NA 5HMFA 4IJRA 1MW0A 5B7YA 1NWTA 1NH6A 1BWVA 3PZMA 3T8LA 4AHPA 4W8LA 1XLIA 5T8GA 1UG6A 3COTA 2WW5A 2BVWA 4KEMA 4PMDA 3C0QA 5AHEA 3TYEA 4JZ5A 1BYBA 1W9DM 1XYZA 2Z2BA 3C56A 4D6CA 3L65A 4IOTA 1OT1A 3B0XA 2GSHA 2VX7A 3TN3A 1JRCA 2JALA 2KX9A 4RZ5A 5HQMA 5A6MA 3TN5A 3TLLA 1ODUA 2MUCA 1SSDA 5E6YA 4GJ1A 3PBWA 2BXYA 2J9ZA 4LYRA 3LMZA 3PFRA 1GOMA 4JCLA 3PHAA 1PX3A 3MHUA 4LY4A 3QTPA 2A3BA 3RCYA 3TQVA 4O18A 4DAIA 2QJMA 2NXGA 4LY8A 1JXJA 3GU1A 3RN6A 4AQLA 1VHCA 4DXKA 3QZAA 2CZDA 3CZ8A 5AYBA 1UMYA 4NJGA 3PZOA 4WY0A 3GDRA 4IFKB 1OFAA 4XUYA 5B80A 2J13A 4TTGA 3F5JA 4FF5A 2CLPA 2Z26A 3E02A 2H6RA 1VC4A 4J3UA 1VLWA 2BY0A 4C7FA 3KDOA 1RCQA 2WLZA 5L9FA 1MSSA 3W7IA 3NL3A 4MDOA 1HP4A 1OF6A 3H4GA 3AIRA 1VFMA 4MFEA 1TSIA 2I14A 1V3KA 1RJRA 2PDQA 1A0DA 3NEVA 4ACYA 2FHFA 2OEKA 4MZ8A 5A6LA 2VD9A 1FXQA 4UCFA 1U1JA 3IVSA 4NAEB 4Z1BA 1VIZA 1FY6A 5HDRA 3W1TA 4DJDC 1FHDA 3BGGA 4A8LA 1GHRA 1CGWA 2WVVA 4YNGA 3LV5A 2VR5A 5GNXA 5KTLA 5BXTA 5DX7A 4Z1YA 3OJGA 5JH1A 2PDGA 1EYWA 3MI6A 4NJIA 3IJIA 1W37A 4DYKA 4N4PA 4L6HA 2IKHA 1ZSXA 2G4FA 2DT3A 1AZ2A 2ZRVA 5CPMA 2D0HA 1YEYA 2INZA 1IQ8A 3H2EA 1QO2A 1OEPA 2DVUA 3S5SA 1BVWA 4U31A 1CXFA 1RD5A 2ZA1A 1LJYA 4HPHA 2J75A 1RSCA 4MMWA 5DCEA 3MHFA 1LDCA 3G1FA 4A4AA 3DXIA 5KZMA 4ONVA 4PMRA 2QZRA 3ES8A 4DWSD 4DYJA 4ZO7A 2AGTA 4B9ZA 1KCKA 1MO0A 3S2JA 1EXBA 3O6AA 3EXSA 4WY0B 3GZ3A 1DL3A 4QNWA 4F0LA 3ABRA 1DE6A 3QGAC 3GBDA 4EWND 3UXKA 2DSKA 4CNOA 3FGCB 3R1ZA 1SJBA 1XPYA 1UD2A 2HTMA 3QJAA 1M6JA 3CV2A 2YFNA 4AF0A 4XO7A 1KR0A 3K4DA 3RR1A 2RHGA 2VURA 3VPLA 3UZYA 3HM7A 5CPQA 1EJXC 2ZX9A 3FKRA 3WH7A 4UZSA 3POCA 1S2AA 1UPMB 2GUBA 2X8RA 3IV3A 4O1EA 4GI4A 5PTDA 4LYQA 3PZTA 1V3JA 1V3MA 2PLMA 3M6DA 3DHFA 1YPFA 4M6VA 2ICSA 4H8NA 1W3NA 4HZ6A 4BS0A 3ZWSA 2Y1HA 1G4PA 4IFOA 3W7KA 2X1UA 3VIIA 2PDXA 1TX2A 3CJPA 1G7VA 4DBUA 3DDMA 1HKIA 4QE1A 3OTRA 4ES4A 4Y2WA 1ZLPA 1SJDA 2QIIA 4MADA 1KD0A 3CV1A 1KBBA 3MUAA 3R0UA 3IK4A 1E6PA 3G3MA 5AHNA 2DVXA 1Q6OA 4H4IA 4UTWC 1Q6FA 1GHSA 1OZMA 2NQHA 4PTNA 3SIZA 2X7WA 5T26A 3N34A 4M29A 4R53A 3QOKA 3FAXA 3CO8A 1SSGA 3RLGA 2QCMA 4RDVA 3S6DA 2GOUA 3E2VA 2QJHA 3LXCA 1QOXA 2NUYA 4RW3A 3LCIA 3AUJA 3UWUA 4DNHA 4DWSC 4GO9A 2YW4A 1SFTA 1TE1A 4J3TA 1ALDA 1A4LA 4JHOA 2JK2A 2HE8A 4GQQA 3WX7A 5D9OA 3UPMA 4ZENA 4O16A 5CBIA 5KEZA 3DG3A 4GFSA 4HYVA 4S3AA 3W26A 3MSRA 4C1KA 3CZJA 4AISA 4RL3A 3ZWTA 1H7XA 1KRBC 4WK9A 4QROA 4B5UA 1NQ6A 1YTDA 2OT0A 3ELFA 2GWGA 5AYYA 2BDQA 3EKZA 1ME7A 2YZ5A 4MJMA 3KL5A 4ADSA 4P8VA 4AVFA 1GTEA 2WOQA 4AUBA 1YX1A 3BLDA 4NG3A 3GTIA 1R3QA 3PPGA 3GYCA 1JUKA 2RAGA 2FZNA 4FMVA 5A8GA 1O66A 5HQLA 2DFAA 2VDHA 4DJFD 1XR2A 4IP5A 3VOGA 1FA2A 3CPUA 4PMZA 1D3HA 1IF2A 3GNRA 1MZHA 4ZO9A 1F4HA 1N82A 3WNKA 5A2BA 5CAHA 3HPZA 3G3DA 1YBQA 4PL2A 2EPHA 1MZRA 3NJ3A 3QLDA 4ORIA 2E09A 1XPGA 4LS2A 4AWSA 2PLCA 1SZEA 3GIPA 2V68A 3W7NA 3VNJA 4JYFA 1H3GA 4JHMA 5CEWA 1EC8A 3LI1A 4IGMA 3OODA 3LX9A 2XIBA 3HOJA 3WN6A 4AZBA 4E3VA 3VD3A 2B81A 3AQUA 4HPJA 5H8PA 3JUGA 1B4KA 3K46A 3URAA 1LORA 2AL2B 2J9YA 3F4NA 3I3EA 3S2MA 5HWNA 1B9ZA 1PIFA 1XC6A 1PCWA 1E0TA 2G37A 1AW5A 4FLRA 1D3GA 3BAYA 4AG0A 1RY8A 1CDGA 1K4HA 4YTRA 3KBMA 5H8UA 4N6FA 5FI8A 4X0VA 4HSHA 1Y0EA 2PDCA 5LYRA 1XIGA 5DF0A 1XLLA 3SJ3A 4IP7A 3CHDA 1EFZA 1YXCA 2XVLA 4Z2IA 5HMSA 4PTDA 4EVZA 3WFLA 3WQFA 3SW6A 4GUIA 4O12A 5H91A 3WD4A 2PLJA 1S46A 1BG9A 3ZSSA 3IRDA 2GVJA 3VD5A 3GNDA 2V5BA 4AAJA 3T1GA 2PF0A 3W1MA 3BO9A 4FLQA 1J18A 1KKRA 4MAZA 3P0XA 3BJSA 1Q6QA 4PRTA 1KBJA 3NGFA 1W8SA 4DJFC 2CC0A 1RJPA 2E8YA 4WF7A 5CJ5A 3KUMA 1XQLA 4KCWA 2VR4A 4PMXA 1HP5A 5CZ0A 4D2JA 4Y96A 4PRRA 2BVDA 1GQKA 1R85A 1KQZA 4GX8A 4PR4A 6PTDA 3WK2A 3QR0A 3A12A 5LIWX 1QNRA 4QEEA 4IZGA 2VEKA 4CKQA 2DUZA 4E0CA 3WO8A 3AMKA 5J5RA 3EOEA 1KCZA 4RE0A 4S2CA 3ERPA 4B3LA 3A3HA 3SUSA 2VGGA 1N2VA 4OZOA 1G4EA 4MNJA 3RXZA 2AGKA 3AYSA 3IJ7A 1X1ZA 3HU7A 1GVFA 5FF7A 3GUWA 4KIRA 3TIMA 4CQDA 4JQ1A 2NLYA 3P8JA 2O92A 4IGHA 3HV8A 3RO8A 4MTVA 2INFA 2OOFA 3BAJA 3GXDA 4HNOA 4OHQA 3ARZA 3AO0A 2QJIA 2OYMA 4GZEA 1K9DA 1NFPA 4YYFA 1F6YA 4IIGA 4WDWA 5LNWA 3L0GA 1UZHA 3BGAA 4UQDA 2DY3A 4L4MA 3KW3A 3Q67A 4AIUA 1W3LA 3RX4A 4UTLA 3FIGA 4AZ6A 2GJPA 4GYPC 3PBVA 2OG9A 2BZNA 4FP1A 4NYUA 1A5LC 4IFKA 5A6BA 5M1TA 2R24A 2V8ZA 4US6A 1X6LA 4ZQPA 3MUCA 4UQAA 1J0KA 6ENLA 3P14A 3WJZA 2CESA 2EKCA 2C1IA 3MI3A 2O7SA 4TX9A 1SR0A 3SUVA 1ECQA 3N13A 3NG3A 3W73A 4F79A 3EPMA 2Y8UA 4A3HA 1M3UA 2GUYA 2IPGA 3OLGA 3PWGA 5F2IA 2UY4A 3ZJ6A 3GXFA 3N1AA 5GPRA 3S9YA 3V75A 5J8LA 1AK5A 4JFSA 5BYWA 1GK8A 4R9OA 2TAAA 2DP3A 2HPMA 3S5ZA 2PUZA 4K38A 5HJLA 2I7GA 4H19A 3CQKA 2BMBA 1RLDA 3EX1A 3S9ZA 2UV8G 4QIUA 5D9NA 5H6HA 4BI7A 1B90A 4QQUA 3LCFA 5K9DA 3FJ6A 3ZYZA 3F2CA 2HS8A 1GYMA 5A2AA 4Z2JA 3EWBX 4C6CA 5C5YA 2JEPA 2QDDA 3R12A 1FKWA 1GJWA 3BLPX 3B40A 5F4WA 3MMDA 4GI9A 1A80A 4ZL1A 3MSYA 3SUWA 2ZWZA 4B3ZA 1K03A 1AW1A 3CAVA 4XBSA 4O0QA 1US3A 3BMWA 3W1NA 4Q8UA 3PPHA 2X2YA 1DIEA 2VZVA 4MG4A 2EPKX 1EJVC 4Q8OA 3G1YA 3K1DA 1SZGA 3ANYA 4GGHA 2PB1A 1O4UA 4AZ7A 2W91A 1XIDA 1P1XA 5HATA 1YDOA 2IXUA 2H3BA 4IPIA 1ZQ5A 4HMNA 2G3MA 1DXEA 2OYLA 3K1GA 1W9VA 4YIWA 4QJ3B 4GIAA 2P1FA 3G0XA 1TTQA 1FKXA 4WKHA 1VR6A 1EHAA 1IXPA 3E5BA 2JF6A 2AMGA 1KLYA 1H51A 2FZ8A 2QF7A 5HAOA 2OEJA 2Z7KA 4XAYA 4LANA 1OYAA 3N11A 3SADA 1PZ1A 2XDFA 3L4VA 4IX0A 2CLMA 1DQUA 1W1B1 5I3IA 1LM1A 3PZVA 3VNMA 2WHKA 4XQ6A 3S47A 2DZWA 5ABGA 2YCEA 4J35A 4ZQMA 3QV7A 1Z3NA 1PKNA 1QRQA 2OKOA 3BG5A 1XBZA 4QLKA 3T0TA 3G1VA 4WLCA 2RFGA 3MP3A 3MV11 2WQDA 4EX4A 1VEOA 3W87A 1M53A 4H9YA 1NF0A 3STPA 4ACZB 3IS4A 4ASTA 3W07A 2OELA 3CUXA 1ESWA 2XINA 4M19A 4GXMA 3WFAA 1LOQA 2UBPC 2G97A 3CV7A 3GWQA 4CN4A 1GORA 4P7OA 1W2PA 4K37A 3EXRA 3WD0A 1U5HA 1IWPA 4WDUA 1GG1A 3LLXA 1TVNA 4I9JA 1JPMA 4LC6A 4GUGA 2FFCA 3GFXA 1TPC1 2QYGA 3LNMA 1SO4A 4LFYA 3TJ4A 3FW6A 2CWNA 1GT8A 3ONCA 4H2CA 1GZGA 2ZTJA 4MFDA 3MCNA 4XX6A 1A5SA 2REQB 4J3XA 5A3HA 3OQ8A 3O6DA 4OOUA 1B3VA 5G1YA 4XUGA 1Q7QA 3F5LA 2DQXA 3S4TA 2Z27A 3TAKA 3LHWA 3GIYA 1V02E 4Z1AA 1ZCOA 4QTGA 3PWIA 1I45A 3W72A 2GK1A 4N0RA 3I7SA 3GY1A 1FFRA 4IPJA 3R43A 2J7DA 3WJSA 4AW7A 4W8BA 2QULA 4B90A 2GWNA 5CSYA 3LPPA 2CLOA 4HP5A 3WH9A 1GCYA 2QCLA 2V3EA 4EWJA 1V0KA 4WDTA 1XKYA 2NQZA 4GZ7A 2CLEA 4GUHA 1C8QA 1NWUA 2YGYA 3OG2A 2WBKA 1MRAA 1V79A 3AICA 3DENA 3QFWA 3LHVA 1B30A 5EL1A 4YVPA 3SCOA 3B06A 4XKYB 1KXQA 1H5YA 2ISWA 4YTQA 2F38A 1T99A 1WB0A 2FZBA 2O4MA 3KTXA 3ATZA 3RLUA 4MZ1A 1P7TA 2PTDA 1S5MA 1VEMA 4NZFA 2DW7A 5FA5A 5CXPA 4YS1A 4CVWA 4HIBA 5EU9A 3LGGA 3IK2A 2ZRYA 3P80A 4K68A 3IRSA 4IP4A 1BXBA 1E6SM 3SY5A 4ZE4A 2RDUA 1HKWA 2NQJA 3A9BA 1E6ZA 1HNYA 2DH3A 1VRDA 3TSBA 2PDLA 3R7MA 3STEA 3O6YX 1B2YA 2ACRA 3GUGA 4GVHA 3TQPA 1BWLA 4O54A 4S3BA 3OO2A 3GS6A 1L6YA 1PYFA 2D2JA 4GGBA 2VDIA 3UJEA 3A13A 3MVTA 4UMBA 1XIIA 3NFUA 2VOMA 4AD2A 2CZVA 2QAFA 3T78A 3OVGA 4DX3A 1NSJA 1YQ2A 1OFRA 1VH7A 4A3QA 4JEJA 1XG4A 2W92A 3TC3A 1H7OA 1A3WA 5I03A 2ZE3A 1EC7A 5C7VA 1UJPA 3DAQA 4Q4PA 4WD0A 3CAWA 3CHVA 3ZXWA 1PS9A 3PZGA 3T0DA 1FHUA 4PTMA 4MVAA 1CXHA 1LP6A 4XZHA 1ITUA 2OZ8A 4C5ZA 1K7XA 2W79A 4LVFA 2YPIA 2HISA 3S3GA 2QGHA 2ZICA 2ABAA 3PZNA 4XKMA 3EKGA 3AWOA 2A1YA 2OSXA 4XAGA 4Z2HA 4N9DA 1C8VA 2EEXA 1V7AA 3QY6A 3E0FA 5DELA 3V18A 2DUXA 3VYLA 4LEQA 4YYCA 3PTQA 3QPYA 4QE4A 1JDAA 1FQ0A 3P74A 2J66A 3FSUA 4WX2A 4NL1A 2CLFA 3GDTA 2H90A 3H6OA 1UP2A 4C6NA 3UYCA 3UZ5A 1I2RA 5JBDA 3JZUA 4WCJA 2Y5SA 4QLLA 4WSKA 2OWWA 1U22A 4G1KA 3KBVA 3ONBA 3ENLA 4BQ5A 2V3FA 1GYNA 3UA4A 1H63A 3B0YA 1XLDA 3A9IA 1LG1A 2XGZA 1PTAA 2GQ3A 4UNIA 3T07A 1MXDA 3L4YA 4MY8A 3PAJA 2DGAA 1OX4A 1FCVA 3H7VA 2VZUA 3TTYA 2NUXA 4OU1A 1Y7VA 2DT0A 1TZZA 2J78A 4HN8A 3KVJA 5AC4A 1K3UA 3SN1A 1XG3A 5HMDA 1XLKA 4C91A 3CWNA 5CGQA 4ZEPA 1OX6A 3RCNA 3TZNA 4ZO8A 3T0BA 4NYYA 3WDQA 3D47A 1KKOA 5K9XA 3N6QA 5A6AA 3A5VA 4UTMA 1LQ2A 4BEUA 4OIFA 2PDBA 3ECQA 2R91A 1V3IA 3DGRA 4N9BA 1SVDA 3LCXA 1F76A 2HCVA 1JDEA 5I02A 5KZDA 3ZJKA 3G1AA 1FXPA 2YDRA 1Z7AA 3TTOA 3R8GA 4W5ZA 1V4YA 3GNNA 2B7PA 2NWSA 2VRKA 1W56A 2NUWA 2EQDA 4M6PA 4P7LA 4H7ZA 2DUAA 1R2SA 3R11A 4V2XA 2WC7A 4D6EA 4M24A 4MSSA 1OT2A 3HN3A 1DWGM 1CGVA 4OUIA 4PEEA 4XSLA 4XAZA 4H8HA 2BXZA 1XRTA 3GG1A 3TJLA 3MBDA 1R9ZA 5HPCA 5FF4A 4UOQA 2NVDA 3LERA 2FHCA 1ITQA 4UTUA 1SR9A 1NOUA 3N4FA 2WZIA 5FSEC 1JPDX 1X8CA 4Z1CA 1TR1A 3L23A 3ABSA 3P67A 4KH2A 7CGTA 3BLOA 1OGBA 3NL5A 1UWSA 3PG9A 4L56A 3O7UA 3RYSA 5D8WA 5LIUX 4QSFA 2IPWA 1PCKA 4E8GA 4DI9A 2PTZA 4PEKA 1RA5A 4GQBA 3BW4A 3TDFA 3WQGA 3HO8A 4HK5A 4J2MA 3S5OA 3NWRA 1DJHA 3LHUA 4YXGA 1UOZA 1XXXA 3BTNA 2X16A 1WDDA 2QMJA 3TZFA 2EJAA 2QKFA 3OHMB 2P8BA 2WKLA 1PYMA 3SCPA 5TBOA 3OVRA 1F4AA 4G1NA 3ARSA 1F8MA 1XYBA 2QJNA 5TAOA 1V7YA 3VD7A 9RUBA 3OP2A 4W85A 4R85A 2PDWA 3GVGA 3W37A 1HJVA 3RGTA 3G1DA 1DWFM 1XRFA 4HGXA 2J74A 3VKBA 4PCTA 2DIJA 2ZUVA 2VOTA 4IF2A 4WEVX 1XLMA 3UCQA 1MQPA 5F2MA 3VA8A 1D7FA 1A0CA 3SZ8A 4IUGA 4HNUA 3KRBA 2YA2A 1IXQA 3ZLFA 1QBAA 2W61A 1FWIC 2QF8A 2NSOA 2QCFA 3NOEA 2HBVA 3UWQA 1LWHA 1XKJA 3RNDA 1OINA 3HFYA 3GC2A 3N25A 3PZUA 3BV7A 1TV8A 5G2HA 4A05A 1E4NA 3NOYA 5CPNA 4CNSA 1NIUA 2J62A 3GH4A 3ABXA 2VC5A 2Y61A 5AC6A 3FYPA 1X7IA 4DLFA 4Y9PA 2Q3OA 3H55A 4Z1DA 2PTWA 1LQ0A 3UG8A 3BLLA 3BAXA 4A21A 3EBVA 3ARXA 2W62A 3I4KA 1TRIA 2BY3A 2XIQA 4RW5A 1L2UA 1EUAA 1D8WA 4YN5A 3L67A 4KFNA 1QBBA 3ARRA 3VKDA 4EF8A 2Y85A 1TZ9A 1ISWA 4M0XA 2OSWA 3F1QA 5IHSA 4TR9A 2P3ZA 1K9FA 3EA1A 5DANA 3EB4A 1MEWA 3PC0A 2QCHA 3WFZA 2WAGA 3N9SA 5LIYX 2PI6A 1KFEA 1JQXA 4ROPA 1MDLA 4AC7C 3FA4A 1A47A 4AZIA 4Z08A 1TJ0A 4J4KA 3W88A 3N2OA 2B7OA 5HOSA 3NZRA 2J4GA 3K5XA 3CH0A 2CETA 4CNTA 1LLWA 4ZOEA 3GR8A 5K7JA 2MNRA 3TC6A 5I3HA 2Z1VA 6XIMA 4IGNA 1ML1A 3LYEA 5EFFA 3NDZA 2FZMA 4MOZA 4DVOA 4JCMA 4HT3A 4B16A 1JZ5A 2IQDA 1HW6A 4OUEA 2YCKX 3GD6A 2QT3A 1XDMA 4G9PA 3U6WA 3GM8A 4Z2LA 5C7HA 2YR1A 3A5FA 3B8VA 1P6CA 1E6NA 3G1XA 4KS0A 4AHQA 1XCFA 3I65A 3MT1A 4NXKA 3W1RA 4BWLA 5CBJA 4JYEA 1LBFA 1XCXA 4JTSA 3TA9A 3EAUA 2QVNA 1T8QA 4KCTA 4MYAA 3WLRA 1R3YA 4QE5A 4FEZA 4XB3A 5HWMA 1R9XA 2A7NA 2C79A 3T2QA 2DZAA 3S1XA 3AS1A 2D0FA 3KX6A 1IIGA 1K8ZA 3LBMA 3IGUA 3P3BA 5A6TC 3BURA 3W7HA 4B15A 1IXOA 2GJXA 3EPNA 3GVRA 4GCAA 1MMFA 4ERIA 3BE7A 1PWLA 4C1NB 3QKEA 3VGEA 2WKGA 2HEJA 3QLLA 1QNPA 1H0GA 4P8UA 5JBFA 2VP8A 2J7FA 4NX5A 3FAWA 4JICA 2WMKA 4L7ZA 1XLCA 2VUYA 1FX6A 4MJZA 1SQ7A 1XICA 1EX5A 3IAQA 1QMLA 3URQA 2CCRA 3W7EA 2D3LA 4AFYA 3W0KA 2NZLA 3UXLA 3V1HA 3WF3A 2GL5A 5GVJA 1PTGA 2PU1A 4MNMA 3HG3A 1ONWA 4ZXOA 1VPYA 4W7WA 1NJJA 3W7DA 1TMLA 5CPLA 5IXEA 2DSVA 2E68A 3THDA 4JOMA 4Q8WA 3BG3A 1A5KC 2OGJA 4B2DA 1IT0A 4HTYA 1UYQA 2GZXA 5XIMA 3VIPA 1CT5A 3W82A 1TREA 4R33A 1VGAA 3S1UA 2G41A 3LRKA 2YL6A 3TV8A 4J2PA 4JFWA 3AXMA 4HJWA 1K7EA 1CI1A 4LNYA 3TR2A 1AODA 4IJBA 1D7KA 5E70A 4Q8PA 3NO5A 1M68A 1KC7A 1GG0A 3N2TA 4IM4A 4LAUA 4P2VA 2AMXA 4JDBA 5D9MA 4E5TA 3HV9A 4A2RA 4ECLA 3UVIA 4K3ZA 2V5DA 4DJDA 4GA8A 1XP3A 3TOYA 4JY9A 3RIKA 4AD1A 3A22A 2ACSA 1CTNA 3HMCA 1V0LA 1H41A 3NEHA 5A8OA 1QWKA 4E8DA 3KVKA 3V35A 1EF3A 4UBPC 4HU8A 4JEQA 1L8PA 4QNEA 5FEPA 2DV0A 5T91A 2EO7A 3ARTA 3PJXA 1J0HA 1UB3A 2BY1A 3E6EA 1VZWA 4JN8A 1PE1A 4V28A 3NR0A 2V6AA 4LGXA 3M5XA 1V5XA 3OVQA 1T5AA 4M81A 3SRFA 1PSCA 2OR2A 4IL0A 4J3VA 4JQAA 2A79A 4QR6A 3RJYA 2BOEX 2I5GA 2NV1A 3GHRA 4KFOA 3T05A 3V0SA 2YBTA 3F4DA 2PC8A 1PO9A 4M6QA 4IMGA 2I9EA 3VNLA 4YWIA 2D69A 3EWCA 2CZ5A 4X2RA 4MB4A 3G1SA 2JKPA 2G3NA 3GQYA 4IQJA 2QPUA 1UIPA 1P7TB 3FA3A 1EA0A 2FZDA 4FSAA 2ZVRA 1GQJA 4HKPA 2YCLB 2V0TA 5C9UA 3T42A 2NQLA 1CPUA 2YOCA 4KCVA 4JL2A 4PULA 2PTYA 1NOFA 1JPIA 1I0DA 1OWQA 1DJWA 1WBHA 3CIXA 5EYWA 4LVAA 2O9RA 4LT9A 3BLEA 4HNVA 4C1LA 3VGHA 3ITYA 3D3FA 4REQA 2HK0A 2WJDA 1WDQA 3ARUA 1RVGA 4I8YA 3WQDA 5FD0A 5H8MA 1KM6A 5CSRA 4A8IA 4KRTA 1XQKA 3E0VA 4A3YA 1JD9A 2X7VA 1Q45A 4F8XA 3PANA 2VX6A 2V2CA 7ENLA 2BXVA 4RNJA 3R2GA 4ACZA 1IR2A 5D32A 1EP3A 2WM1A 4IIEA 3VC5A 3LTPA 1YDVA 2QCCA 4DXVA 4B5VA 3T8QA 4G7FA 6REQA 1R30A 1AZ1A 4TOQA 2QW5A 5FKYA 3IGSA 2W27A 2WHMA 5C0QA 2W3ZA 1JFXA 3RJXA 3CMGA 2A3LA 1VPQA 2VUNA 3ZJ7A 2VMFA 2NQ9A 5LHEA 1A5NC 5FEZA 5LNSA 4LYPA 1KR1A 2BX7A 2H8XA 2X30A 3I10A 4U2ZA 3GTFA 2XM2A 1V6UA 4HHPA 2JIWA 3IV8A 2G3FA 4L1XA 3NQGA 1XD0A 1RPXA 3AIWA 7ODCA 1LWJA 2D2GA 2XSXA 4IPNB 3SGUA 3AAMA 4V15A 3CC1A 3WD1A 2XH4A 1C92A 2Y62A 1HKMA 3W6LA 3KRZA 1K1DA 1UBPC 2DSUA 2WVSA 2ZRZA 4B5XA 4H6KA 2V38A 4UFIA 3UJRA 3O3RA 5D02A 1R46A 2NSXA 4HCDA 4DIAA 3BCDA 2EG6A 3EMCA 2QNEA 5CPOA 3UWYA 5CSSA 3DFYA 4NNBA 1E9ZB 2CPUA 3GHTA 1AMKA 2QPXA 4JQ3A 3HQOA 2VRQA 4KESA 2IPJA 4KEVA 2DZVA 4OKDA 3AHYA 2E1WA 4HOZA 3SB0A 3UZWA 5I3FA 1XFBA 4LVDA 3WQVA 5G2WA 1A5MC 3PULA 2OTDA 3DGBA 1QPQA 2ZBTA 5BNKA 1KWKA 3A64A 2FDSA 4O1BA 3UQNA 3LZ5A 3RF9A 4QLJA 4RZBA 3BUVA 4JPGA 5AC7A 1BAGA 3LB0A 1OC5A 2AOSA 1HZYA 1SJCA 2X41A 3DCPA 2AQVA 4Z0SA 3M9YA 5LNRA 3VO0A 1GVSA 4KWWA 2A85A 2DSWA 1VIWA 2QEZA 3UXDA 1O5KA 5A95A 4JIRA 4OBSA 3WUGA 3AXXA 1HFBA 4W7VA 3TCEA 1KFLA 4FI4A 1S3HA 4Q33A 1LRTA 2H8ZA 4QBXA 3TA6A 2FMOA 1J0YA 1BVNP 2DSZA 1YHTA 4MWAE 2VELA 1OFOA 3WD3A 3FLUA 4IT1A 4C6JA 3V5CA 3MU7A 1KA9F 1X7FA 4IQLA 1Q8AA 1XLHA 2I57A 3IARA 2EPLX 1WZAA 4C7DA 3WELA 3FNDA 2PGRA 3C52A 4HHMA 1F3WA 3FGCA 2D2HA 3ZVIA 1OGGA 3ZT7A 3TTSA 5GJMA 1PZ3A 3VILA 4TTUA 1J0JA 2GJNA 1I8JA 3LCGA 3MW7A 4UNKA 7TAAA 5JQ9A 1CWYA 3M41A 3C6CA 1D9EA 3N2CA 4Q7BA 4CCEA 2PURA 4JX6A 1UWTA 2IXVA 4GI6A 1KBLA 1XGZA 1CIUA 1EGZA 4IXHA 2WCAA 2AKZA 2X1TA 3HG2A 2DQWA 4MWAA 3L7RA 1QNOA 1ZU8A 3L2IA 2PDHA 2ASHA 2XFRA 1NP0A 4AEOA 3R89A 4OFCA 3V36A 4X63A 3ITGA 1B3XA 3CPRA 5G5IA 6XIAA 4S3CA 1XWYA 3M07A 4ZTXA 2CKRA 4B5TA 3XINA 4QCFA 3Q94A 2QV4A 3CZEA 3W1QA 4US5D 3THUA 3T4WA 1H0IA 2QDHA 2C91A 5REQB 3UNDA 1DQXA 1CYGA 2BODX 3NTYA 1O95A 3NIYA 1TE6A 4QGCA 3HQ1A 3M0VA 8TIMA 5ABHA 3PUGA 1E1CA 5U4NA 3FN9A 3LSBA 3VDGA 4HYWA 3AUOA 1UHVA 1L2QA 4OBTA 4UTKA 3NSNA 5DMNA 3SI9A 1E71M 3C8NA 4JN6A 2ANUA 3WH8A 3ES7A 5HNNA 2CNCA 5F1UA 4JTAA 3N04A 3AROA 1HXJA 4CNNA 4C6QA 3WQ5A 1QTWA 3GC5A 1F07A 3LUTA 3H8AA 1ZY9A 2PMQA 1T96A 3APTA 3N19B 1TCDA 3G0UA 1NELA 1FWWA 3BLIA 1W3IA 1BKSA 3WBYA 1JIBA 1P6BA 1C7TA 4RE2A 2P53A 3TXVA 4AX6A 1CGTA 1OHLA 1HJUA 1JAEA 3S1GA 5E0FA 2F9RA 2V5CA 3LENA 1W8GA 1IEWA 2OLHA 4AU0A 3CEPA 3I6TA 5CLTA 4UQBA 4TQTA 2QPSA 2VD8A 4I8DA 3HGSA 2ZUTA 1U83A 4FLSA 4YWSA 2GGIA 2QLYA 1EHNA 4QSHA 3W86A 3BOLA 3N3MA 2J79A 1NVMA 3AXKA 4IIHA 1CXKA 3AC0A 4LAMA 1VCVA 4UTHA 2B0MA 3EOSA 1F6KA 4LBUA 3W6MA 1B57A 2F7FA 3F7JA 2PAJA 2OWXA 2JBMA 4DM2A 2Y88A 1EB3A 3DEQA 4HNLA 4H01A 1DPMA 1H50A 1RBAA 4AZCB 1WNOA 1P0DA 5FEXA 2RDTA 5C2XA 4K6AA 1IHIA 3ZS4A 4G7EA 1I2OA 3O6CA 1GYLA 3SCVA 3UG4A 4FXJA 4KMQA 3GG0A 1KLZA 4W84A 4WKFA 5FACA 5EMMA 5ABEA 1FWJC 4RV3A 1J5SA 3KVLA 5BU6A 1UR0A 4MB3A 3HZ3A 1BPLB 3B8IA 1X8FA 2J88A 2WJEA 3GXPA 4YJ5A 1XYMA 4C6BA 4UR9A 2YLLA 3OGRA 2XVNA 1FWEC 5AHFA 2C13A 2J27A 2GQ8A 1S1RA 1NDVA 3DX5A 1P4CA 2ZWYA 3SEPA 4V27A 1XV8A 3HGOA 2C0HA 2RH9A 2YL9A 1WCGA 2ZDRA 1GZ1A 3LOTA 5CPTA 4PFMA 1REQB 4TV6A 1BLIA 3OLDA 1YPIA 3SUUA 1MFUA 2IQ0A 3L4WA 2Z29A 1JGIA 4H3DA 2JIEA 4QFUA 1Y65A 3CQ0A 1XLAA 1AJ0A 2SFPA 1VBRA 5AN7A 1P1MA 2JGQA 4LOCA 2OQLA 3NPWA 2VZSA 3VIKA 1YE6A 1BGGA 4F2BA 1YXYA 1UWRA 3VAVA 1JG9A 3VXGA 1XRSA 4CU8A 4G7EB 4JIHA 2NW0A 2C16A 1FVPA 1W1IE 4U3AA 5D2TA 5AHIA 2XU2A 4UC5A 1UWAA 3CAQA 4H2HA 4DPPA 3O0FA 2WKJA 4GO8A 3B9AA 1BF2A 5D05A 3CNYA 1Q66A 3DFOA 1TJ1A 5LKYA 3CEUA 4PSPA 2Z1SA 1X98A 1KFKA 3S2LA 1MQQA 3WLTA 2R6OA 1UUQA 5LA2A 1ITXA 1J2WA 4S3GA 4MZYA 4MKVA 3BH4A 3MUY1 1KB3A 4H9TA 3VNZA 4EK7A 2Y70A 1A0EA 2O0TA 4HK7A 1BVZA 1EP1A 4XK2A 3LBCA 4JFVA 4W93A 3RR4A 1Z41A 2J8FA 3I7QA 1G9HA 2TSYA 3NURA 3CO4A 4IPPA 3L21A 4DO5A 2E40A 1H7WA 4GYJA 1XW8A 4EAMA 1EX1A 3C3UA 3AMGA 1E56A 1GEQA 4HHLA 3BGJA 4OV4A 2VFHA 3FOKA 1DJYA 5CZJA 1RCOB 2EBNA 1UMLA 3GTHA 4LF2A 1XSJA 1QR7A 3NO1A 2YYUA 3HB9A 4ZO6A 4AH7A 1E9IA 3L2LA 4Z17A 2PEVA 5DMMA 3SUTA 4L65A 2VEIA 3B4UA 4ML9A 2PFHA 3BAIA 3L68A 2E6AA 3B9DA 1YNQA 4RNIA 1VFTA 3I6RA 1XX1A 2G8ZA 2DT2A 1J8VA 1QPRA 1XI3A 1S2VA 3F03K 1DV7A 2WMIA 3DYMA 4UTWA 4Q4SA 1EL3A 3EGJA 4GX9A 2R82A 4E4UA 1PPIA 4CNPA 2BASA 2X40A 2QUVA 4HCHA 2GQAA 4UTTA 5CH9A 3WNNA 4XKYA 1VFSA 4WVXA 4Q8MA 4ML4A 3WH6A 1OFPA 2IPFA 5BRQA 4H41A 3GTXA 3ID7A 1F6PA 2I17A 3CYJA 1VJZA 1OBAA 1FOBA 3OA5A 1YDNA 2V9DA 2OQYA 3W1PA 3VDCA 1TV4A 2BWGA 3ZVHA 1XRVA 3STCA 2WPGA 4ZCWA 1RHCA 2XIOA 1RJQA 4KWUA 3BW2A 4HMCA 4EXBA 3NAVA 1R7AA 1ZRQA 4US5A 1IE7C 1RK5A 3TROA 1DJNA 3LSCA 5HULA 3W71A 2R14A 2A4AA 1TA3B 1VBJA 2VXNA 4O17A 3BLKA 2FVKA 4EE9A 3WF0A 1WX0A 3BMVA 1OK6A 1V51A 1DE5A 1TQXA 3EDDA 1FWFC 2NVAA 3SN4A 3SECA 1UKTA 4R7JA 5CBBA 1I6NA 3G2GA 4MJ2A 3PVFA 2P3EA 3M0IA 1FH9A 4RE3A 1HKKA 1WO2A 2FJKA 3EX4A 2OEMA 1Q3NA 2PU0A 3BWWA 1OG6A 3LY0A 1G01A 2FZ9A 1KBKA 4E8CA 2P76A 1Q5MA 3HGJA 1QOPA 1BG4A 2J9XA 3CT7A 1C8YA 3QV8A 5BXRA 2FLIA 4B5SA 1VB9A 4PTVA 3OG3A 1KTCA 4R7OA 4ZOBA 3OLIA 1W91A 4YHEA 1KM3A 3B05A 2J7CA 4XAPA 2OLSA 3WYZA 1R3VA 4UIOA 4ZFCA 3S2CA 4UQ9A 2Z28A 2O9PA 4MWAD 3MPGA 1GPFA 1BSIA 4TVCA 2VVNA 4B5NA 1A49A 1IEIA 4QJ4B 1OY0A 5AY7A 2XYLA 2Y24A 3RX2A 5DRIA 2DZSA 4GY0A 4E4PA 3ZOAA 3ATYA 1W3JA 3MDUA 4CQAA 2ONEA 3CHFA 4WOQA 4CQ9A 2VTFA 2F84A 3KRUA 3LXBA 3SQSA 4DLMA 3WQWA 1GVRA 4KKXA 2ZUNA 2WSKA 1ELSA 1LQAA 2QXWA 3R8HA 3EX6A 1FWCC 4WSHA 5C54A 5C9WA 1S5VA 1MFVA 4OE7A 4UNLA 4RNFA 3DERA 5B7ZA 4LAKA 1UR2A 3GVVA 1ZENA 1JCXA 4LX4A 4XZLX 1HKJA 4GFIA 5A8MA 2VGIA 1RR2A 4RNHA 3SRDA 1XUZA 4Z42C 2WNWA 2XSBA 1LCOA 3IVTA 4YTUA 2DT1A 4PODA 3WF4A 3BSMA 2Q8XA 4O15A 6TIMA 2RJGA 5DXXA 2VFIA 1M9HA 5DQPA 1P6WA 2DZPA 4BA0A 3H7RA 1O5XA 2XN2A 3JS3A 3GB6A 3KHJA 5IDZA 4ZR8A 4DM1A 2QQ6A 4ZBCA 1VF8A 4FO4A 4HQVA 3GZAA 3C0LA 4IWWA 3NQ7A 3BOXA 4QDMA 1RLCL 2OKTA 3QZEA 1I2PA 2RKXA 4HMDA 2Q71A 3N2MA 4NKCA 1R87A 3GNOA 4N9CA 2Y7DA 3DH7A 3P84A 1SFJA 3WLSA 4IPLA 4OTKA 5CGMA 1LWIA 2YZRA 1HO4A 3U48A 5I0DA 1E72M 4MYXA 3VIMA 3DFTA 2Z1WA 2HMCA 2VEPA 1OX5A 2QUMA 4WKAA 1TZ7A 3MWCA 4JKLA 2HQAA 3U2ZA 3JZEA 4JY8A 3REQB 4CGTA 3CPGA 1L0PA 4TO8A 2PWEA 1E43A 5AZ0A 1FWTA 3G77A 1KFBA 1ME9A 1R8LA 1DKWA 1H1ZA 1ZFJA 3TVAA 4GC3A 3EDFA 3E0IA 4I7UA 3TWBA 3AHTA 1IWBA 1SW0A 1JJKA 1CW2A 2EXOA 1K77A 4PH6A 5FOOA 1H62A 3V1PA 4KCUA 1RPKA 4HOXA 4WUIA 1V0MA 3P82A 1UH4A 4BWLC 3E1F1 4GRSA 1RALA 1EJUC 4JTQA 3F4VA 1AH3A 5H2ZA 4X0NA 3R79A 1U30A 2PF8A 3R4IA 3W29A 1M5WA 3C61A 1DTNA 4D71A 4QAWA 2E5DA 1XH2A 4F4RA 3RG6A 5A1AA 3TYDA 1NFGA 1UP3A 1EBHA 1UW9A 4TXEA 1DHPA 3W2KA 4FNRA 2VGFA 3CL6A 4S3KA 4J1OA 3R0DA 3CIWA 1R0MA 1Z8AA 2CFFA 4DXXA 3BXWA 5U7SA 1F61A 2YYTA 2RJHA 3UF9A 3PBUA 4CCDA 1W9PA 4B4FA 2OLAA 4HK6A 3S83A 3W00A 1I9CB 1KV8A 1OD0A 3EYPA 3VABA 2EJ1A 4WQ6A 1F74A 1UKSA 5BWFA 2YX0A 4WOZA 1B3OA 4HSOA 1VHNA 4PTWA 4AIBA 2ZXDA 3REQA 5HUPA 5FF3A 1Q85A 2TRSA 2I16A 3E5PA 3GW0A 3AOFA 2D20A 3RAOA 2Z7GA 4C6KA 4MUPA 3RRXA 1MUWA 4YTSA 1B3YA 2ZC8A 4NT0A 3CUHA 1W3HA 3DBPA 1XIBA 1AH4A 2F6UA 3SY1A 1E55A 3CAKA 4BF5A 4DAFA 5IBXA 4WGXA 4ZOCA 4JIQA 4HA0A 3UY7A 3TNOA 1QPNA 5CSUA 1O1HA 3SIMA 5K2ZA 3THAA 2V82A 3B8TA 3OIXA 1CLKA 5C55A 1OFEA 1S5TA 3E2QA 1GPWA 1I75A 4INFA 1JUEA 3YPIA 3WY1A 3GH7A 5E0KA 2BGNE 1EC9A 2HJPA 5CZTA 3VVGA 4CCCA 5D03A 1D3CA 2V5KA 4AC1X 3MS8A 3CL8A 3PB0A 4FAMA 2QJJA 1JI1A 1HUVA 1ITCA 3H2MA 2H3DA 1QHOA 4WGHA 3W25A 1W3KA 1P43A 3SURA 3WUEA 2XG9A 1FP8A 3N6JA 1PZ2A 1PIIA 4XZMX 4N7QA 2ZZ7A 1I4NA 6A3HA 5D09A 3XISA 4LW7A 2VZTA 1RCXB 4JKMA 3RHGA 2FHBA 1LBLA