2R8WA

The crystal structure of dihydrodipicolinate synthase (atu0899) from agrobacterium tumefaciens str. c58
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
297
structure length
297
Chain Sequence
DMATRFKGLSAFPITPADEAGRVDIEAFSALIARLDAAEVDSVGILGSTGIYMYLTREERRRAIEAAATILRGRRTLMAGIGALRTDEAVALAKDAEAAGADALLLAPVSYTPLTQEEAYHHFAAVAGATALPLAIYNNPTTTRFTFSDELLVRLAYIPNIRAIKMPLPADADYAGELARLRPKLSDDFAIGYSGDWGCTDATLAGGDTWYSVVAGLLPVPALQLMRAAQAGNAEEAKRLDATFQPLWALFKEFGSIRVIYAAANILSLTVSEPPRPILPLTSAERQRVEEALEALS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords AGR_C_1641p
publication title The crystal structure of dihydrodipicolinate synthase (Atu0899) from Agrobacterium tumefaciens str. C58.
rcsb
source organism Agrobacterium tumefaciens str.
total genus 104
structure length 297
sequence length 297
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2r8wA00
1FDZA 1GVOA 1YTEA 4XBKA 3MI6A 4UTTA 2DZWA 3TW7A 3I68A 2EHHA 2DZPA 4EWND 2ZZ7A 2I14A 3W2KA 3NPUA 1GYLA 4AEOA 4HPXA 1Q45A 3FFSA 2JKEA 1S5TA 1IGSA 1I2RA 2WV8A 1ONRA 4WJEA 3BPWA 5CZSA 2E77A 3EKZA 1AL7A 1VZWA 2NXIA 2R91A 3STCA 2A85A 3HJZA 5LSMA 3USBA 1BEUA 2HMCA 4O8RA 3RLUA 4JY8A 3C0JA 2NV1A 2Y89A 4O17A 1LBMA 2QCMA 2ZBTA 5D2WA 4UFHA 3W7MA 1FX6A 4UIOA 3SY5A 2PRLA 4WXZA 2A6NA 2V2DA 2Q8LA 4MPQA 2EAWA 5U7SA 4MFEA 4DELA 3T78A 5AHIA 1DJQA 1QCWA 2E6AA 1P5BA 4JTIA 3DZ1A 1VLWA 1ALDA 4FXRA 3R89A 4ML9A 4RZ4A 3DFNA 2YZRA 5I3HA 5AHNA 1EWEA 5LHEA 3M47A 3UD6A 1S3HA 2P1FA 3LDVA 5U4NA 5DN1A 4FNSA 3P84A 1GWJA 3BARA 4D2JA 1TRDA 3HOJA 1W5QA 4WUIA 1V5XA 3BG3A 3UXAA 1OX5A 2ISWA 2ZQ0A 1B3OA 5I3GA 1Y0EA 1GQNA 1Z48A 2DORA 4ZQMA 2J27A 1C29A 2E68A 1OFQA 3I6RA 2CLOA 2DZTA 1JCNA 3RFAA 1H62A 4AXKA 5F4WA 2A6LA 4C1KA 3A21A 3IGXA 2QKFA 2F84A 4FNPA 4ZQCA 2NUXA 1P0KA 2ZRVA 4H4IA 5IBXC 3NVTA 4NJJA 1OHLA 3EWWA 3DU0A 4LS2A 3LM7A 3HF3A 5LNUA 3PG8A 1OF6A 3TA6A 3EX3A 2TMDA 4HSOA 2EPHA 4RKAA 3QPZA 1FDJA 1EPXA 3LV6A 3IRDA 4RK8A 3PUOA 2ISVA 3W1QA 3PY2A 1H1ZA 2YDAA 1B57A 2DZUA 1H50A 5KZDA 1TCDA 5F1UA 4IPIA 4DBEA 3GXTA 4YWIA 4Y8FA 1I2QA 2NV2A 4HNVA 4Z0JA 3QZEA 3DHDA 2FPTA 4ZQRA 4N6EA 2WNNA 5D33A 4MLRA 2V9DA 4MZ1A 3MBFA 5AC8A 5DCDA 3DH7A 3UNDA 3GYEA 4MJMA 3TNOA 2ATSA 4O1AA 3NAVA 2BX7A 3LHTA 4QSHA 1PHWA 3P5YA 4JX5A 1GVRA 4M6QA 6ALDA 3L0KA 4UFIA 3M44A 4UNLA 2ZDRA 3MMTA 3O07A 1EP2A 1KBIA 1Z42A 4BF9A 3WJZA 5D03A 4CLMA 3NQDA 1C9DA 3Q37A 5CPLA 3W2NA 5F2MA 3ZWTA 4MZ8A 1TJRA 1SW7A 4WY0F 4O50A 4JTKA 1LOQA 3R8RA 3W1AA 2CZEA 2CLHA 2QUTA 2QR6A 1Q3NA 2X1UA 3WK3A 3NM1A 5AYYA 1SFJA 1W56A 3RLVA 4AHOA 3UZJA 1KFJA 1T8XA 4XTDA 3MHUA 3P61A 3W75A 1LYXA 1ZAIA 1KM6A 1W0MA 1H7XA 3H54A 4XQ6A 1JR1A 5FI8A 3G1VA 1XDLA 3L0NA 3QMRA 1VJIA 4TIMA 3VCRA 1L9WA 1F7BA 4XKYB 3TIMA 2J24A 2B7OA 2OZ0A 3G1HA 3LTPA 3CLMA 4FIQA 3KVMA 1KBJA 2QCEA 5T26A 3DXIA 4AWSA 2WSQA 5HINA 3L2IA 1WQ5A 5KTLA 3SECA 3LOTA 1MEHA 2CWNA 4UTUA 3WK0A 3PUEA 1G4TA 5F2GA 1IXNA 3GK0A 4JY9A 2RKXA 3PG9A 5AFDA 3PUDA 1H7NA 1LRNA 1ME9A 1XCFA 1VGAA 4MYXA 3W7RA 1OFDA 5K3VA 1UUOA 2ZZ2A 2NUYA 3HG2A 4LW7A 4HSNA 2ZZ5A 3NZRA 3GR7A 5AC7A 3B4UA 5L9FA 2H3BA 3IIOA 3W73A 2DZSA 3C8FA 4LRTA 3SGZA 1X8FA 3G1XA 3VI2A 1AL8A 1TB3A 4HPJA 5HMSA 1ADOA 3BO9A 5DXXA 4S2BA 2J9YA 4CCCA 4O53A 2A7RA 5EY5A 3LX9A 4HT3A 4NUWA 4UTWC 2RHGA 2VFIA 3C6CA 3G1AA 5GVJA 3S1XA 1QOPA 4TO8A 5AYXA 4Q32A 2TRSA 3V1PA 3S6DA 2ABBA 3TKFA 2W0UA 1S5WA 5ABTA 2VEPA 1QDSA 2NX9A 4XBSA 4K6AA 4QISA 1D3GA 1W3NA 3TSBA 5AHMA 5TBOA 5IBXA 3HB9A 4NVTA 2DJLA 1FCVA 3DI1A 1G4EA 2G95A 1AW5A 1AMKA 2A5HA 4OWGA 1EIXA 4PODA 4WX2A 3W23A 3B06A 2X30A 3O6CA 4ZVJA 3UY8A 3MO7A 3PBYA 3U6WA 1LTDA 2YFOA 4MFDA 4MKNA 4XKYA 2X1SA 4Z1DA 4ORIA 2WNZA 3WK2A 4LV4A 3LCWA 2KZHA 2ZYFA 1VS1A 3L0GA 1J5TA 5KZEA 3NL3A 3ZWSA 3TE9A 4E0CA 2GVLA 3GX9A 4JTUA 3WJSA 3M43A 4JEQA 3W9ZA 3LCFA 2C1HA 1KM3A 2JBMA 5BW6A 4RLIA 2WSYA 2Z6JA 1KM1A 4K7VA 2YYUA 3BLEA 3HG5A 3A9IA 3BW2A 3GDMA 3P7YA 3OVRA 4JYEA 3S42A 3S9YA 5I3FA 1N8FA 4JDBA 3M41A 3SFKA 4FX7A 2QUUA 4MVAA 4BI6A 4UR8A 5FEWA 3W7JA 2NLIA 4K8HA 3CWNA 4GWEA 4O13A 5K9CA 3NQFA 1RVGA 4I7VA 1XI3A 4NXSA 3DBPA 3R5EA 5E93A 1LOSA 3Q94A 2ZZ4A 1GT8A 1SU5A 5C6MA 2X1TA 1KFEA 1YLVA 3KRZA 4ORMA 1OFPA 3CU2A 2ZRUA 4OE7A 1HFBA 4UTLA 4LS1A 5I3IA 1F6KA 3RK8A 1DBTA 3KVLA 2YXGA 4NJGA 1WDWA 1TRIA 4EVZA 2BZNA 2WNQA 4FIRA 3MBDA 3KX6A 5DCBA 3TMQA 4GNJA 3OEXA 4JGDA 1VYPX 3WK1A 1FCBA 4QITA 3BGJA 2G96A 2ISSA 2GUUA 1EUNA 2BSLA 4NNBA 3STEA 4PA8A 3KVKA 2VXNA 4S2CA 3ELFA 4KFNA 4IJBA 2GOUA 5I3KA 3UQNA 3W3OA 3QMSA 1L2UA 5KINA 4QAIA 1JUEA 3W86A 3OBKA 2GQ8A 1OABA 1IXQA 3NQ6A 1XUZA 4O1CA 3O6YX 3WJXA 2V2CA 4JTSA 1HTIA 2A21A 2VFFA 2G5WA 1TTQA 3GR8A 2V8ZA 2ZFAA 1JCXA 1JJKA 4UCGA 4DXVA 3C52A 1MO0A 1W5NA 3P81A 4O1DA 4O18A 1H51A 2A0NA 3P8JA 1K8YA 3TUUA 2CLIA 4NXKA 2P0OA 3BK0A 4IQLA 4MJZA 5AHFA 3PULA 1OYCA 1NEYA 4Q4KA 4JNMA 1LBFA 5DY3A 2QJHA 3MI3A 4FX6M 3BLIA 1VCGA 2FFCA 4JIQA 3M1ZA 3PR2A 2ZA2A 1UJPA 3HGJA 3QRHA 5MHBA 2YGYA 2ZRWA 3UPWA 3PBWA 1GVQA 3LHWA 4BWLA 1W37A 5BRBA 1FWSA 1GZGA 3FA5A 5DXYA 4B5NA 3N9SA 3LB0A 3P60A 3L21A 2H3DA 3FKRA 3QJAA 3EWBX 4P2VA 2YX0A 3TROA 2Y62A 5G4WA 3UZ5A 4O28A 1OK4A 3U2OA 5FF2A 4GUFA 3KOFA 3W7PA 3QW4B 2H8XA 2JGQA 3GVGA 4JTEA 3SJ3A 1D9EA 4LVDA 3DHFA 4IMFA 3N14A 2WOQA 4MY8A 1H63A 4OGZA 5FEZA 1KM2A 1PV8A 1VLIA 2WO5A 3HPZA 5F4XA 3L5LA 4O19A 2C16A 5G5IA 3OIXA 3TW6A 1I2OA 4LRSA 1XBVA 3W1TA 2ZCGA 1ZCOA 4WXYA 4QJ1A 4NNCA 1XM3A 3SSJA 1I45A 2NUWA 7TIMA 4KWWA 5HJLA 3GKAA 5CSRA 1EP3A 2RDTA 3EEGA 1WXJA 3EXRA 4IWWA 4IXHA 5C54A 2Y7DA 3L5AA 4GUJA 1FDYA 2JGYA 3G24A 1A53A 4LV9A 1IIGA 5D09A 1WV2A 3W7GA 4UTIA 3M5YA 2CU0A 1P4CA 1Q6RA 1SZFA 3P5ZA 3KHJA 3IVTA 2FLIA 4DPQA 1TV8A 1RR2A 1C8VA 3BGGA 4FNUA 3QQ1A 4ICNA 2QEZA 3OA3A 1RZMA 4JYDA 1JQXA 1NAL1 3W2MA 4ZL1A 2C19A 4KFOA 4QNEA 3GDLA 5CPNA 5FF7A 3TXZA 4U28A 1MXSA 2BTMA 5FEXA 3PSWA 4PEKA 1W3TA 1P1XA 3UWYA 4CNOA 3N34A 1VCFA 4M19A 4OT7A 3PAJA 1OFEA 2E5DA 1RD5A 3C2OA 4EIVA 2OJPA 4O1BA 1S5VA 1TTIA 3G0UA 2HS8A 3O8AA 2E1DA 5BNKA 5BOOA 3CHVA 4NZFA 1VRDA 3C2EA 1DQWA 2Y70A 1G4SA 4K38A 4OHQA 1KM0A 1KM5A 4GXMA 4CCDA 4GC4A 4MIMA 4N4PA 5K9XA 1XDMA 2A7NA 1T0OA 4MY1A 1Q6LA 3QC3A 4TU1A 2DP3A 1FCUA 3OVQA 4DPPA 3QSRA 2E6YA 3W1PA 5LHFA 3IIZA 2GJNA 2C18A 4OV9A 5L6UA 3TQVA 1JCYA 3F1QA 2OX1A 4JTLA 5EMUA 3MJYA 4NZJA 4UC5A 1CW2A 5K4XA 4DBDA 2Z1BA 3C61A 1X7FA 4K36A 4HNNA 1TQJA 3GDTA 3BV4A 2A1YA 1GJPA 1XBZA 2DZVA 4A21A 3G8RA 1DJNA 1OX6A 2XN2A 1M7PA 3NOEA 8TIMA 3B0VC 3KRSA 3W7IA 1LOLA 4XUGA 2NWRA 3THAA 1H61A 3EWYA 3E9AA 1G6CA 3OVPA 3NA8A 2NXGA 1IXPA 2H90A 4LVGA 5HWMA 3CWOX 3EX2A 5D05A 3LXCA 5TIMA 4R53A 2O7QA 2ATMA 3UWZA 1QO2A 3FLUA 3M5ZA 1WA3A 1ZENA 1OFOA 2B0MA 4YXGA 2W6RA 3EX6A 2Y6ZA 3NM3A 4OBTA 5FF4A 5K2ZA 4NU7A 2DJXA 4P61A 3S5ZA 3UWQA 4EF9A 2VEMA 4NQ1A 1A5AA 3LCIA 1I4NA 3GLCA 2GVJA 5LNRA 1FWNA 4JIPA 2QF7A 1YPIA 4A2SA 5KZMA 3CIXA 1TO3A 1UBSA 5D2YA 4LT9A 1TV7A 1GVSA 1A5BA 4AMAA 3FJLA 4ALDA 3WJWA 1TTJA 3W1XA 2HS6A 4N9EA 1KA9F 1E51A 2Z0IA 4X2RA 3LBCA 1TJPA 5HWNA 3BVJA 3E0IA 3Q2DA 1T96A 4PL1A 1ME8A 3LGEA 3GNNA 2IQTA 1VH7A 5D32A 3BLFA 1XFBA 4JTJA 1LLWA 3VE7A 3MP4A 1F6PA 4IMGA 1QPOA 3QMTA 3IIXA 3VE9A 1YDVA 3C2VA 3QQ0A 2FIQA 2VKZG 2RDWA 3DGRA 3TCEA 5LNVA 3NNTA 1TREA 4ZQOA 1JCLA 4PC8A 3NDOA 2FDSA 2O7SA 1MZHA 4UNKA 5LNSA 3HPSA 3EX4A 4RZ6A 3NL2A 2E6DA 3SZ8A 3INPA 3TH6A 3GAKA 1O4UA 3L5MA 1OX4A 1QPRA 4N9BA 5LGXA 5K9DA 1HL2A 1PE1A 5G2WA 3GIYA 3SGUA 5LZLA 3W7OA 4L4MA 1XC4A 2VEKA 2TSYA 3FOKA 3CPRA 4E2DA 3M6YA 2QJGA 1ZY9A 4AWUA 1B9BA 4HHPA 4HN4A 3A22A 2PCQA 2Y85A 4DF0A 3LTSA 4UMCA 1OFRA 4IOTA 1VR6A 3EX1A 5CG7A 2E5BA 4LWWA 3MYPA 2QCDB 3LHZA 2WJZA 3E96A 2BWGA 4IPJA 3O15A 2ZA1A 3FYPA 3LERA 3O6DA 3T40A 4DF1A 2QCNA 1GTEA 3UY7A 1ME7A 3YPIA 1OG0A 1Z41A 3UWWA 4XWUA 4Y96A 3N73A 1SO6A 2VC6A 3G1SA 3MW7A 2FTPA 2WQPA 1H7RA 3K30A 2E09A 4Y90A 1KV8A 1WOBA 1SFLA 4FEZA 3EWUA 3EKLA 2EF9A 4E38A 4U4MA 1DVJA 3W1NA 3ABSA 1RQBA 1F5ZA 1NF7A 1G7UA 1VHCA 4KWVA 3G3DA 5CPOA 1VPXA 2NX3A 2J88A 3E02A 3G0XA 4LVBA 3TX9A 3ABOA 3QF0A 4A29A 1QWGA 4UFJA 1LZOA 1K7FA 3PSVA 4A3UA 1SPQA 1W3IA 1YDNA 2Z6IA 4POCA 3NQVA 5LNWA 3TQ0A 3WFAA 1ZALA 5HQEA 5DY2A 5LGZA 2FB3A 3F4WA 4O15A 2VFGA 1F73A 1VYSX 1PCWA 3D0CA 1DORA 2B7QA 3E49A 1Q6OA 1SO4A 2ALDA 3UXDA 3R12A 1R2SA 3W7LA 2OT1A 2Y7EA 4UTTC 2VENA 3T44A 5BMXA 3MP3A 1OJXA 4M6PA 1ZJIA 1YXDA 1ZAJA 2XN0A 1SW3A 2FPVA 3LRMA 3S1WA 3CC1A 3EXSA 2NWSA 4ADTA 3P62A 3BW3A 3HBLA 3NPXA 3M0ZA 2VOMA 3LLDA 4PTNA 2F7FA 5F2LA 3SR7A 4UR7A 3PC0A 1EUAA 3DI0A 4ZQNA 4C1LA 2NX1A 5FEPA 1OYBA 2CZ5A 2H6RA 3B0PA 3C3NA 3G8EA 4M5PA 3QPYA 1GG0A 3G0SA 2XFWA 3TSDA 3IGSA 2C6QA 1TQXA 5HR6A 1SO5A 2A4AA 2QCDA 1T99A 3IIPA 3C2FA 5A5WA 3G18A 5BMWA 5LKYA 1W31A 4O12A 2NXHA 2CLMA 3NEVA 3KXQA 1GEQA 3LTYA 4NJHA 3B05A 1TPFA 3R13A 3NPVA 4N6FA 1PHQA 3Q58A 1DV7A 3L68A 4YL2A 1LP6A 3H55A 1VQTA 2HTMA 3BW4A 1XUUA 2V5LA 3MYOA 1G69A 4DF2A 3MI2A 3U8GA 3B0UX 4OV4A 4Z1AA 4CQ9A 1L6YA 4RZ5A 3S1VA 3S8HA 2ZTJA 3N3MA 1WOAA 2V2HA 1TIMA 3A5FA 3TV8A 4M6VA 3NXFA 2V5BA 4QIUA 1OK6A 2ZZ6A 3ABRA 4I7UA 1KM4A 3R2GA 1THFD 4NNAA 4ZQPA 2VFEA 3HIJA 4RX0A 1EB3A 2J9XA 4JDYA 3W6YA 1IXOA 3HGRA 1I8JA 4IX0A 1IF2A 4XZ9A 5J5RA 2Y63A 3NQMA 4ADUA 3G22A 3M16A 1MSSA 3TFXA 2V82A 3PBVA 4MUZA 5G4EA 4BI5A 1VHNA 4QNWA 4KKXA 3I7RA 2YYTA 3W72A 3KVJA 3TC7A 1HO1A 4O16A 1HO4A 3CEUA 3W85A 3LHYA 3L9CA 3GXNA 3P8IA 1EP1A 1SUXA 3HG3A 3ATZA 3B04A 4FNTA 4YLWA 4RV8A 1YTDA 5D2TA 3LI0A 5D38A 4UTWA 2WPBA 3TXVA 3JR2A 4K8EA 2AGKA 3QSTA 5CZ0A 1X6UA 5DBUA 3VKJA 4LU0A 1IIHA 3LLFA 1LRQA 5FF3A 3GKFA 3G3MA 1N7KA 1X1OA 3M9YA 3O1NA 4O0ZA 4UXDA 1OF8A 3STGA 3TK7A 3TU9A 2QAPA 1W1ZA 4OQVA 1SSDA 4O14A 4TMBA 1NF0A 4LVFA 1DQXA 1RQHA 2GJLA 3NL5A 3NG3A 1SZNA 2BXVA 2C0AA 1GG1A 3DENA 5AC6A 1LLZA 1FWRA 4RJEA 3SIZA 3V75A 1ICSA 3M5XA 1G4PA 4LC8A 1TPEA 1FUYA 4TX9A 5HWJA 4FXSA 4UFLA 5HNRA 2VFDA 5SWUA 3ZFHA 1UASA 2CLLA 3NO5A 4WOQA 3I65A 3HO8A 1O94A 2ZRXA 2A7PA 3IEBA 3KRUA 4YMZA 5H91A 5KITA 4BR1A 1QPNA 3LXBA 4X3ZA 4HNTA 4IGHA 3W7CA 2P10A 3EWZA 4L4LA 1VC4A 4WY0B 2C14A 4W9TA 3S5YA 2C13A 4J9JA 4DQWA 2ZZ3A 2CZDA 3W76A 4HNUA 4HKPA 1QFEA 2PE4A 2ZTKA 2ZRZA 3NZ1A 1R2TA 3NPWA 1LM1A 4X9SA 5EYWA 2OMAA 3W84A 1KLYA 5EBUA 1KFLA 3TMLA 1OFBA 1FXPA 1TPVA 4CNPA 4UTHA 1JCMP 2RDUA 2QDHA 1A50A 4GUGA 3OG3A 1TYGA 3CB8A 2C3ZA 3NQ2A 4RXFA 4LVAA 3MUXA 3L65A 3W83A 5CGQA 3TJLA 1AW2A 2R8WA 1KFKA 1AG1O 1WBJA 3THQA 2CLFA 3BG5A 1F74A 3PWAA 2B4GA 1LDCA 3B03A 1NSJA 2Q8ZA 3NQ8A 4LUIA 2GPTA 3N2MA 1K8XA 1B4EA 1KFCA 3NQ7A 3PVFA 1FY6A 1O95A 1KLZA 1J4EA 3FS2A 2YR1A 3W7KA 3EXTA 4NX0A 4H6KA 2YPIA 3KFTA 1HUVA 3CEPA 4O4WA 4JS3A 1TPWA 1K02A 2EKCA 4KFPA 4CNNA 1R47A 3SW6A 5DELA 2WSRA 1MEWA 5EL1A 3TFCA 1WYIA 5D04C 3HMJG 1LRTA 4FB7A 2A2IA 1FWWA 1WBHA 4AB4A 5CPMA 4DO4A 5AHLA 5FESA 1WAUA 3QH2A 3W87A 1O5KA 3O05A 4JD4A 1HG3A 3G1YA 3G1DA 4LY8A 4AF0B 3HGOA 3ATYA 1FBAA 3W22A 1QPQA 5C55A 3A24A 2ABAA 2Y61A 4PCFA 2Y7GA 4AAJA 4BI7A 1W5OA 1SR9A 1JRBA 1B4KA 1TPH1 3LCHA 1BWLA 1V7YA 5AHEA 5AN7A 1A5CA 3F4NA 3IVSA 5IM51 3G1FA 2VELA 1RPXA 1G7VA 3S5NA 2QCHA 3O63A 1NFBA 4WY0A 4XTIA 3LHVA 5CSSA 1OX4B 1XBYA 1CI1A 4Q33A 5D37A 2FJKA 4O11A 3W2UA 3N19B 4QM1A 3S0CA 4O57A 4CQAA 2CFFA 4JN6A 4ZZ9A 5G1YA 1K7EA 5K4ZA 2PRHA 3CIWA 6TIMA 4GUHA 1W8SA 4M7SA 1OYAA 3T55A 4NX5A 4UUIA 3LCXA 2TYSA 4E2BA 3FEMA 4FX8A 3LHUA 4QQ3A 2YW4A 4LUJA 3I7SA 3NQCA 1RQEA 4S1FA 3A23A 3UWUA 5G2IA 4GFSA 2EGZA 3NQEA 4WD0A 3OHIA 2Q3OA 3VFLA 1MEIA 1QR7A 1YADA 3RU6A 4AH7A 1H1YA 2Z2UA 3PBUA 2X2GA 5KMYA 3PB2A 3AO0A 4OU1A 3LV5A 3M5VA 1YYAA 4K39A 3CTLA 2E5CA 1JCJA 2E6FA 5D02A 2JK2A 4MY9A 2LLEA 1XBXA 1PVNA 3MP5A 1BKSA 4JX6A 1QNVA 3DKJA 2DU2A 5A8GA 1Z44A 3CQ0A 1ICQA 4LNYA 1F05A 3DAQA 1GOXA 5AB3A 3E12A 1EWDA 2B7PA 2TPSA 1JRCA 4I7WA 3DKLA 3QYQA 3VNDA 3GAYA 3CM4A 4AF0A 1SW0A 3LCLA 1I2NA 4AHQA 3M7WA 3W1LA 4NJKA 3W1UA 1LCOA 2PRMA 3RMJA 4PH6A 2OCZA 3STFA 3HGSA 3W74A 3NGJA 1LORA 1EA0A 2I1OA 4EF8A 1VCVA 1TTPA 1FWTA 2QUVA 1O5XA 1K03A 1KTCA 4N9CA 1JUBA 4FF7A 5H2ZA 5HR7A 3P82A 4G1KA 1G67A 4Z1BA 5K7JA 3W71A 4AHPA 1SQ7A 2C15A 3TC6A 4Z0SA 2H8ZA 1H60A 3NR0A 1K3UA 3GNDA 3PB0A 3EWXA 3P80A 4K7YA 1LBLA 5HUOA 4HIBA 1FXQA 3BG9A 4K37A 1DHPA 2QAFA 5DCEA 3QFEA 1KTBA 3MHFA 2OT0A 2PC4A 1PCKA 2X1RA 1JULA 4WZHA 4GUIA 4BFAA 1SZGA 3LI1A 3LRLA 2ZRYA 3W7HA 3JRKA 1ICPA 1YPFA 2G97A 2YSWA 3AJXA 4EOUA 4AWTA 3TDFA 1FCQA 1K8ZA 4ADSA 4ONVA 4LOCA 2V0TA 4UTMA 3UWVA 4IMCA 3W88A 1R30A 2V30A 2GQ9A 1XKYA 1PIIA 4ZMGA 3S1UA 1PS9A 2FB2A 1YDOA 3LXAA 3C2RA 3N9RA 2QCFA 5I3JA 1L6WA 4LC6A 1SZEA 4IMEA 1ML1A 2VEIA 2FPYA 5TQLA 5G1TA 2ZA3A 3UPBA 3GXPA 2ZZ1A 4MYAA 4RCXA 5CZTA 4YCPA 1AW1A 5F4SA 5EKYA 4BWLC 4GJ1A 3P67A 2I9EA 4TR9A 3W1RA 1ZHAA 4IX2A 3PF3A 1SSGA 2NZLA 3A5VA 1SO3A 3GZ3A 5AYZA 1U83A 4CCEA 4JTFA 3W7QA 4UTJA 1DKWA 1QOQA 1TPC1 2RH9A 2WKJA 2QCCA 3P74A 5E1QA 2CLEA 5KSWA 1N55A 3QW3A 3DFSA 3TAOA 3NQGA 2Y88A 3IV3A 1ZAHA 2X16A 4IXXA 3WJYA 3RF9A 3MHGA 2QJIA 4CQ8A 1Q6QA 3TSMA 3CT7A 1DOSA 5E0KA 2R94A 1M7OA 3FJ6A 5C2XA 1JQVA 3W70A 1W54A 1M5WA 3NL6A 1TPUA 1QAPA 3QM3A 1UB3A 3DFOA 1KTNA 1H7OA 2JKPA 2W79A 4UMAA 3IIVA 2FQIA 4DEFA 4N9DA 1QMLA 1KV5A 2Q3RA 4YCOA 2DZXA 3KAOA 5F1VA 3TR2A 3IVUA 4JXCA 3HPXA 4O4VA 4UFKA 2QCLA 4LTSA 4O52A 2V81A 5DBTA 3GDRA 1JVNA 2AQWA 3ZS4A 4JICA 3TQKA 4A2RA 3EB2A 4UMBA 3PS7A 1A5SA 2YFNA 1F76A 4N02A 3IGUA 2BLEA 1XXXA 4UFMA 4H3DA 1K7XA 3FKKA 3DFPA 1TPDA 3W2JA 1F2JA 2YCEA 4M7TA 3RNDA 2CLKA 4JTGA 1EEPA 4MOZA 4LS0A 2PURA 5D2XA 1D3HA 1VYRA 3ZR4A 1BWKA 3B8DA 3DFQA 2XN1A 4FO4A 5HULA 4R33A 5F2IA 5AOUA 4O10A 3LCGA 3L67A 2QCGA 4WQ6A 4DO6A 4N4QA 1YTKA 1UUMA 1W5MA 2AAMA 2GVGA 1U5JA 2QDGA 4DO5A 4FNRA 3C56A 5D30A 3W1MA 4IUOA 2CZFA 2JKAA 3GB6A 1XL9A 4GBUA 4IMDA 5DLCA 3DFTA 1JUKA 3L66A 2CW6A 4BK9A 1TPB1 5J5DA 1GVFA 2GQAA 4UTKA 1OVDA 3LRKA 1TMHA 1M6JA 2D73A 1GYNA 1PL9A 4TMCA 3NYZA 2YW3A 1L6SA 4NT0A 3NQAA 1CX9A 4I9AA 3W7NA 1X1ZA 3FYOA 3W7DA 4PFMA 4Z08A 4O0KA 2HSAA 1YXCA 1QO5A 4X22A 1AK5A 3I7QA 4FHAA 3LBMA 4WOZA 3SI9A 2VFHA 2B7NA 3O16A 4MZYA 4Y9AA 3FIGA 3TJXA 3UYCA 3C4UA 3QEZA 1RV8A 1R46A 3H53A 3W7EA 4GE8A 4R7JA 4Z1CA 3PM6A 3W2LA 5EA9A 2R14A 3W07A 4MLJA 3JS3A 4RR4A 2Y7FA 1P0NA 1GTHA 4R34A 4AVFA 4RXGA 3F03K 3HG4A 4GRSA 5CKSA 3TAKA 1YXYA 1ZFJA 1GPWA 1TV5A 3ABQA 2J6XA 1UCWA 1R2RA 1ZNNA 4JTTA 4JR5A 5HUPA 4O54A 1H7PA 2J9ZA 3MWAA 3GDKA 5C5YA 3ANYA 5CZJA 4JYFA 3T4CA 3HQ1A 1FQ0A 1NVMA 4FNQA 1EX5A 4JX4A 4A22A 1OFAA 1J2WA 3N2XA 5FF0A 4NJIA 5G2HA 1KFBA 1TSIA 1LROA 4JTHA 4N2YA 1I2PA 1KW1A 1WX0A 2RFGA 5EPDA 1DL3A 3T7VA 3S5OA 1O60A 1H7WA 2UV8G 1BTMA 1H5YA 5D2VA 4Y6GA 3O06A 4PL2A 1W5PA
chains in the Genus database with same CATH superfamily
1FDZA 1Q7ZA 4I6VA 2WB5A 2PWEA 1PSCA 2ZZ7A 2I14A 3K4DA 4FPSA 5G1MA 3ITTA 4AEOA 4W8BA 1MQPA 2YZ5A 1IGSA 1I2RA 1E9IA 1S2UA 4DBUA 5CC5A 3OYXA 1JDDA 3GTHA 4L6HA 4GYPA 3EKZA 4MDOA 2Y4SA 4QG8A 2R91A 3STCA 4A3YA 1R3QA 4W86A 3USZA 3O3RA 3USBA 1BEUA 1T8QA 3CH0A 2HMCA 3HPFA 4O8RA 1EJTC 3C0JA 2NV1A 4CVUA 4O17A 3PP7A 4CVWA 3SY5A 2PRLA 2R1MA 2V2DA 4GABA 4J7RA 3RX2A 4DELA 3T78A 1V0LA 1DJQA 1KWKA 2ACRA 4QJ3B 1V03A 1ALDA 4FXRA 1VP5A 4RZ4A 3M47A 3UD6A 5DN1A 3BARA 4RDVA 3M4HA 1VEPA 1SMDA 4D2JA 3ZJ7A 2VTFA 1J0IA 2FH8A 2XIQA 2FMNA 2BXYA 4QXIA 3E2SA 4DO7A 3UXAA 4QJ4B 1CECA 3WQFA 1OFQA 1YQ2A 3VX0A 3I6RA 1EQCA 1H62A 1XLDA 3HN3A 4ACZA 1JCTA 4ZQCA 1DE6A 1P0KA 4BZYA 1OCNA 4NJJA 3OJGA 1AQHA 1OF6A 2JE8A 2EPHA 2XH4A 3I10A 1J6OA 1EPXA 1V4YA 3L4ZA 4INFA 1AH4A 1U1JA 3OYZA 4LYKA 1UD3A 2VGGA 1B57A 1NOWA 2DZUA 2WJDA 4AU0A 2ISDA 5DMNA 3WUGA 1H50A 3GXTA 5IOBA 3ES8A 4YWIA 4NZ3A 3GYCA 4IGSA 3VMPA 2BP1A 2IPFA 4Z0JA 2WMFA 1OCQA 3AMGA 4KIRA 1CXIA 4KERA 4PTDA 4D6IA 1DHKA 4B3ZA 4GISA 5BYWA 5FSDC 2EJ1A 5DCDA 1JZ5A 2VURA 3GYEA 3AS0A 1UPPA 1GNXA 1HKMA 1OQFA 4O1FA 2CXGA 3FAXA 3LHTA 2ZUVA 3WLSA 3VM7A 3P5YA 4JX5A 3HJEA 2ZDRA 1Z42A 3WNMA 2GK1B 1HKIA 3WJZA 3OGRA 2NQ9A 3NQDA 5C9XA 3FEQA 3W2NA 3ZWTA 4MZ8A 1TJRA 2CCRA 1DE5A 2X7VA 4O50A 4PE8A 1Q2RA 2R24A 2CLHA 1AZ1A 3H24A 1SFJA 5I2UA 4A05A 3UZJA 3WD2A 4XV0A 1I1XA 3ONCA 3H4XA 1L8PA 2OWCA 4AYGA 1LYXA 4RL3A 3KTXA 1RCOB 1LQ2A 5JMUA 2QUMA 1JR1A 3G1VA 3QMRA 1F7BA 1RK6A 1Q4WA 4XKYB 4Q4QA 4MGGA 3TIMA 2OZ0A 3TR9A 3RPDA 4XAYA 1ZPTA 4AWSA 2WSQA 3MUCA 3SECA 1ZU8A 5CXPA 4K1WA 2BMBA 3SCSA 3VGEA 4Q8OA 1IXNA 1U33A 3O6AA 1YX1A 1ME9A 1XCFA 3VUPA 5K3VA 5ABHA 4B2DD 3HG2A 3NZGA 2E3ZA 4HSNA 1YKWA 3NZRA 3GR7A 2XWEA 5AC7A 1R0MA 3AHYA 3T8LA 2H3BA 3UF9A 3N18A 4HZ6A 3EPNA 3G1XA 1TB3A 3V0UA 5H8MA 3BO9A 2J9YA 4DAFA 1OINA 2WMIA 4CCCA 5HBFA 2A7RA 4MG4A 5EY5A 1AQ0A 1JNDA 4NAFB 1KQZA 1XIEA 4NUWA 1POJA 3W29A 2ASHA 2J7FA 1HP4A 3G1AA 1XS2A 2XYLA 3T6CA 1XRVA 2Z27A 1AH0A 3ARPA 3QVQA 2ZIDA 5LA0A 2ABBA 1EHAA 1S5WA 3O2LA 3UZWA 2ZADA 1QDSA 2JIEA 3MCNA 4XBSA 1UKOA 4ERIA 1FCVA 1VEMA 4H01A 1LUCA 1EIXA 3W23A 7REQA 1X8CA 4DAIA 1WB0A 1FWGC 3VIHA 3GW3A 1LTDA 2YL6A 2YFOA 3RDKA 1EC7A 4MFDA 3U0HA 2X1SA 1YHTA 1E5NA 3IJ6A 1GZ1A 4MWAC 3L2LA 1W2PA 4CN1A 4IIBA 1DWAM 2KZHA 4I9JA 1VS1A 5JXQA 3L0GA 1J5TA 5KZEA 4JFSA 4X0VA 1NQKA 4UQCA 1EF3A 2GVLA 3GX9A 1EXPA 3AZTA 4JEQA 3TC3A 2DPEA 2PSNA 3WNNA 4K7VA 4LAUA 3ORWA 3ARZA 3GDMA 3P7YA 4JYEA 3G6LA 5FJTA 2G41A 3QGVA 5FEWA 2OX4A 3HZ3A 2BXZA 1LWIA 5JU6A 1RVGA 5LXEA 4PSPA 1XI3A 4NXSA 3QTPA 3BDKA 3CK5A 5E93A 2OXNA 2X1TA 4L61A 2BV9A 1YLVA 4C7GA 1FHDA 1QI4A 4ORMA 3W53A 4OE7A 1ZGDA 4LS1A 2CC0A 3AISA 1PKLA 1DBTA 3AIQA 4PR4A 1TRIA 2BZNA 2WNQA 4UZUA 3NGFA 3KX6A 3TMQA 5A6TC 3LD5A 1F3XA 3OEXA 1VYPX 4L4OA 3N6QA 5DANA 5DMLA 3BGJA 3NCOA 3VIIA 4LEQA 2BSLA 4NNBA 5EFFA 3PTDA 2CHRA 4S2CA 3ELFA 1DWJM 1BG9A 3W3OA 1L2UA 5KINA 3CQJA 1JUEA 1XLGA 4IP7A 3W86A 3OBKA 5ENLA 1IXQA 1XUZA 4ZENA 3VKCA 6PTDA 4ZSUA 4EANA 1P48A 3KW3A 1TV3A 3GR8A 2ZFAA 3AXMA 3V5CA 1CGUA 1UH2A 1MO0A 1W5NA 2XH7A 1H51A 3P8JA 1UD5A 1E15A 2ZE3A 3KBMA 2KAUC 2ON3A 4MJZA 2F2HA 5CLWA 1H0IA 4Q4KA 5DY3A 2QJHA 4UTFA 3CAKA 4JIQA 3M1ZA 1XPGA 1KXHA 4PYSA 2ZA2A 3GH4A 2WC4A 3H7VA 3CWHA 3PBWA 1WUEA 1UD6A 4HA3A 2NVCA 5BRBA 5AZ0A 2NQLA 3WMLA 1U2YA 3LB0A 4PMOA 4XZLX 5HNTA 2HV5A 1EJ7L 8CGTA 3L23A 4P2VA 3KBNA 4DRSA 2VWTA 4QX4A 3UZ5A 6ENLA 1B3WA 1E0VA 2D24A 1OK4A 1UMLA 1TMQA 1IV8A 3SJ3A 1VIZA 1D9EA 4LVDA 2QS8A 3SBFA 1BQGA 3N14A 4KCWA 1BYCA 4MY8A 4OGZA 3KBVA 1VLIA 1J0JA 1DJZA 3QY7A 4L1XA 4F0MA 4O19A 5IHRA 5G5IA 4OIFA 2HZGA 2Z7GA 3BCFA 4D71A 3W1TA 4Q8PA 4WXYA 1R3WA 4QJ1A 1RXOB 1XJBA 1JDCA 4NNCA 3U7VA 2NUWA 3E0FA 7TIMA 4DUXA 1FP8A 4GIRA 1EP3A 2RDTA 1TJ2A 4EXBA 1FWJC 3EEGA 1WXJA 4HCLA 5C54A 4FP1A 3VILA 4IF2A 3GFZA 3WBXA 3MZNA 1CBGA 3M5YA 4XUYA 1P4CA 1Q6RA 3KHJA 4L9XA 1TV8A 4RW3A 1MVYA 2VEGA 3TZFA 4FNUA 3QQ1A 2QEZA 1MI3A 4XD6A 2XGBA 4AZHA 5CLTA 4JYDA 3W2MA 1GEHA 4Y9OA 4KFOA 1KRAC 3TXZA 3IGHX 4U28A 2X0SA 1KBKA 1V0KA 1JNEA 1W1VA 1OT1A 4PEKA 3S9IA 1EJUC 4FMVA 4GY1A 3N34A 1VCFA 4HPGA 5DRCA 3PAJA 3AFBA 2OJPA 1S5VA 1TTIA 3G0UA 3SQMA 4A8RA 3REQB 2E1DA 3CHVA 4NZFA 1VRDA 1E3XA 5CZKA 4K38A 3LYEA 4OHQA 4HP5A 4CCDA 3ABXA 4ZO9A 4N4PA 2PLJA 3VGDA 1XDMA 4JKMA 1TJ0A 1WZAA 2EPMX 9XIAA 3TEVA 4F0HA 3QC3A 4JHOA 4TU1A 3KS6A 3OVQA 5EMMA 3QSRA 1T6MA 1EJVC 3IIZA 4AEFA 3F1QA 1TFVA 5DMYA 5E6ZA 2NW0A 5BROA 3MMWA 3IAPA 4V1XA 2YXOA 4NZJA 3WLQA 2VZVA 1IWPA 3E3HA 1XLHA 5AC4A 5BOEA 5JIPA 4K36A 1XC6A 4IFRA 1TQJA 4F48A 1ECEA 2A1YA 3CZEA 2DZVA 1EDGA 4A21A 4H9TA 1E6XM 1NDVA 2D2OA 2E9LA 2FGBA 3S2JA 1M7PA 3NOEA 8TIMA 2G3FA 3E74A 3L4WA 3DBNA 1BWVA 4WHBA 4IICA 3L4YA 2O4QA 3EWYA 4FAMA 4CU6A 3VOJA 3E9AA 3NA8A 3GC4A 1GQJA 2NXGA 2YLAA 4YVVA 5D05A 3UGRA 3GU9A 5TIMA 5RUBA 3RCYA 1AUSL 3QYSA 1SZRA 1QO2A 3FLUA 4GJIA 3FVDA 3L4UA 1WA3A 3B9NA 3HURA 1GJUA 1O1ZA 2CWXA 4OBTA 5FF4A 3UWQA 3OZOA 3T1GA 2XWDA 2VEMA 3HV9A 4NQ1A 4IMAA 3LCIA 3BSHA 4H7VA 1UR0A 2GVJA 4Q7IA 1FWNA 3JU2A 5BXPA 1OD0A 2YCKX 1BXBA 5BZAA 1TO3A 1RSCA 5D2YA 5HQMA 2X1IA 1GVSA 4LUSB 1LL7A 4XD4A 3FJLA 1RPKA 1I1WA 4GX9A 1HP5A 5I7GA 2Z2BA 4UCFA 4BHYA 3KTSA 2PP3A 1XFBA 3BAWA 1LLWA 1J8VA 3HQOA 1SGJA 3QMTA 1K9DA 1LQAA 3VE9A 1YDVA 3W6LA 4AIEA 3APYA 2VCBA 2FIQA 1F6YA 2Z2AA 1MQQA 3ISIX 1JCLA 1QNQA 2GLKA 4LB3A 5BRQA 2FDSA 4UNKA 3WLNA 4XZMX 4ZO8A 4PUEA 3NL2A 2AL1A 3HMCA 4JQ4A 1EHNA 3GAKA 4MNKA 1OC6A 4N9BA 3NDZA 5B7ZA 1PBGA 1QASA 2CYGA 3SGUA 2VEKA 2TSYA 3FOKA 4NYUA 3IJDA 3FK4A 5JUVA 3W28A 5KETA 3N6JA 3VC5A 3M0MA 3EOOA 5FL1A 1DPMA 4ZODA 2WSPA 3VNIA 4DF0A 1VEOA 1OFRA 1R85A 4AYSA 2A3HA 5CG7A 4LWWA 3N25A 4NIRA 4DBSA 3LHZA 2I57A 3W0KA 3T05A 3KBJA 4DJED 3O15A 2ZA1A 2QCNA 1GTEA 3UY7A 4F2TA 1OG0A 1G94A 3PHAA 1Z41A 4UQAA 1A0DA 3CAWA 4XWUA 4Y96A 2DEPA 2VC6A 2EPOA 3B8SA 3MW7A 4IFKA 3VIMA 3MSGA 1AH3A 2DDXA 2PDKA 2E09A 3SCNA 2V6AA 1OT2A 4MSSA 3WMCA 4AWEA 2EJAA 4E38A 4KF1A 5EMJA 1B54A 1F5ZA 3TYBA 3G3DA 5CPOA 2NX3A 4LVBA 1S5MA 4V33A 3ABOA 1QWGA 4WSJA 4HHMA 5HXMA 2Z6IA 4DJFA 5HQEA 2NSOA 3AC0A 1J79A 5LGZA 2VT0A 4EPBC 3DIPA 3D0CA 1ITCA 1VFSA 1SO4A 4UTTC 2YL5A 2R1NA 3GD6A 2VENA 1EO5A 1OCBA 3MTWA 2PDXA 3VIFA 4BA0A 1YXDA 2PDLA 1TX2A 3IJ7A 3TOPA 1K6WA 2EPKX 2NWSA 4ADTA 2CPUA 2BOGX 1NELA 4Q7BA 3O0FA 3LLDA 4PTNA 3GNXA 4C1LA 2NX1A 2H6RA 3S3GA 1NWUA 2ZX6A 1HL9A 3WF0A 1RH9A 4K3ZA 4QLKA 2ODOA 2C6QA 2ZXBA 4U10A 4JZ5A 4F4RA 4GZEA 1T99A 3C2FA 1CT5A 4Y9MA 1W31A 3FW6A 3H2AA 1WE5A 2CLMA 1XISA 3XINA 1XQKA 3KXQA 2DVTA 3B05A 4WJXA 3NOYA 3WQEA 5LIXX 1UKSA 1C8QA 4CCZA 4I5XA 2FKPA 1BRLA 2QDEA 4YL2A 3L68A 1LP6A 2HTMA 3BW4A 4DF2A 3PBGA 4OV4A 4CKQA 2J7CA 4MWAB 5IHSA 3PZVA 2ZTJA 3PZGA 2XVNA 1QNSA 1JGMA 3R0KA 3V35A 1XP3A 2GSHA 1ISXA 4QIUA 4KIEA 2OEJA 3ABRA 2DIKA 3R2GA 3VDGA 3LMZA 4CNUA 4NNAA 2VFEA 3HIJA 3CPUA 4RX0A 1EB3A 4N7QA 1DJYA 3S46A 4E6MA 3HGRA 1I8JA 3WLLA 4IX0A 3W27A 1JZ7A 4ADUA 1K8CA 3M16A 1MSSA 2F6XA 5G4EA 4TTGA 3H21A 4PUWA 1C8YA 1VHNA 1KB3A 2OQLA 2OYLA 3W72A 1E0XA 2YL8A 4WLCA 3GTXA 3G77A 2OSWA 3GXNA 1SUXA 5HJXA 4RV8A 3P0WA 4UTWA 5CZ0A 3RO8A 3KM8A 4PBFA 1EO7A 5FF3A 3R1ZA 3G3MA 1N7KA 1X1OA 3VIKA 3O1NA 1MFUA 1OF8A 3RR1A 1JPKA 3STGA 3TU9A 1SSDA 1ZP3A 3KDNA 2BY1A 2D2GA 3LPPA 2WM0A 3K8MA 3NL5A 4ZXOA 5M2FX 3NG3A 3DENA 5I06A 1FWRA 1E4LA 4WJ8A 5E9XA 3M5XA 1G4PA 1R9ZA 3TLLA 1TPEA 4TX9A 3R94A 3ZFHA 4QE1A 1UASA 1V6TA 3A9BA 3NO5A 4ATLA 1PB0A 4WOQA 3I65A 5TF0A 2A7PA 3IEBA 3RMEA 3CPGA 5DMMA 5AZ1A 1K9EA 2A3AA 2F61A 2Y5JA 3LXBA 5IXEA 3IJLA 4HNTA 2P10A 3ZSSA 3R7MA 1P7TA 1GW9A 2Q01A 2ZUTA 3OZMA 3EMQA 2C14A 4WY0B 4L65A 2ZZ3A 3TN5A 3W76A 5C9RA 3NZ1A 2YJQA 2ZRZA 3NTYA 3U4AA 3GXFA 2BY3A 3W84A 1ONXA 5EBUA 1KFLA 3TMLA 1OFBA 4GK8A 4U3AA 1Q85A 2RDUA 3R25A 4BKNA 1A50A 2W92A 2Y24A 1H5VA 2PDJA 2C3ZA 3G2GA 3MUXA 2UY2A 4S38A 2J62A 4L5ZA 4QJ5B 7CGTA 3PWAA 4HU3A 3VKBA 2IQ0A 1VFMA 5M3WA 1LDCA 3C3UA 1NSJA 4BF5A 5CBJA 3KBWA 2DZBA 2GJXB 2GPTA 3ZVHB 1HJXA 1QPKA 4JFWA 1KFCA 1FY6A 1A5UA 2CLPA 4NZ1A 3KFTA 4JS3A 1TPWA 3BJSA 1EFZA 1A4MA 3DUGA 1MEWA 5EL1A 3LPGA 5HNUA 3JUGA 1GYMA 2GFTA 3EAUA 1FWWA 1FWFC 2Z25A 3QKEA 3VPLA 3ID7A 2Y7GA 3MO4A 4G7EA 4HA4A 1SR9A 4YYCA 1VPQA 2FZ9A 4IGMA 1TPH1 2HQAA 4JN7A 1MDLA 1BWLA 4H9UA 4MKSA 2KX9A 4DZHA 3B40A 3DYPA 4JHMA 3MDWA 4ATWA 1GZJA 3QV8A 1RPXA 2VCAA 3M0HA 2QCHA 3O63A 4WF7A 2D0GA 1OX4B 3W2UA 1VKFA 2PD5A 1BGAA 1OY0A 3F5KA 1X97A 3EA1A 4WCJA 3L4TA 3TNBA 3S0CA 1PX4A 4P7LA 1NDWA 1OM0A 1W8SA 1O1HA 1EGMA 1OYAA 1CXLA 2OSYA 3HFYA 1CGVA 1OEPA 4UUIA 2TYSA 1PO9A 4PCPA 2E8ZA 3GZAA 3BH4A 4XAZA 3NQEA 4GY7A 4WD0A 4MJ4A 2QVNA 4HMDA 4I8YA 1HIZA 1QR7A 3WBWA 3IV8A 2UWFA 5KMYA 3M5VA 2VMFA 1PZ0A 4K39A 2E5CA 1JCJA 4E8GA 8RUCA 3QOKA 4FK9A 4DUWA 1XBXA 4HOZA 1BKSA 4JX6A 4LXFA 1LWHA 3NXLA 1WKEA 2DU2A 3FVMA 3TOYA 1N8WA 3CYVA 4NRSA 3CQ0A 4LNYA 4PMZA 2WVVB 1EWDA 2B7PA 3CIVA 1GOWA 4HCHA 4H7ZA 4I7WA 1SJBA 3PWGA 3VNDA 4AF0A 1XG3A 4AHQA 4W87A 3M7WA 2NQ5A 2PGRA 4HCDA 2I1OA 4AZIA 4GKTA 1IT7A 3MVIA 1O5XA 1K03A 1KTCA 4FF7A 2V38A 1RK5A 2OOFA 4Z42C 4Z1BA 4B15A 1WO2A 4AHPA 4KWUA 4ML4A 1H60A 4X63A 1KBLA 4C6CA 1LBLA 5AVNA 1KBBA 3QBUA 3Q67A 4K37A 1BQCA 1DJWA 2EO7A 3FX4A 2QAFA 3H22A 4MB5A 3R8HA 4YPJA 3UWEA 3MHFA 2OT0A 4PFHA 4YTSA 2PC4A 1BSLA 2EBNA 3QHMA 3WQPA 4LNCA 1JULA 4GUIA 3VD3A 1T7LA 3U5YA 1RJPA 2YSWA 3N2OA 3WQGA 3TDFA 4ZBCA 4AZ5A 4FA3A 2V67A 1Q8AA 3LN3A 3UR7A 3SJNA 4FR6A 2CIPA 2OZ3A 1K9FA 3AI0A 3UWVA 3WUBA 3W88A 1M7JA 1MXGA 4KPLA 2V30A 3H2EA 1QRQA 2WZMA 3C2RA 3OTRA 2QCFA 4XZHA 1P0BA 2Q02A 3LPFA 3F2BA 1S2AA 1KQYA 2VEIA 5TQLA 1NP2A 1RBOB 1W32A 1KD0A 2ZZ1A 4E2VA 1HQTA 4YCPA 5EKYA 3W1RA 4C5ZA 2WMKA 2XZ9A 3QFWA 2NZLA 1BF2A 3L12A 4G6CA 1X38A 2VYOA 1H3GA 3D6NA 1SO3A 2PP0A 1NP0A 1TPC1 4LPCA 3UR5A 5A2AA 1JL8A 1N55A 3VINA 2GWNA 3DFSA 3UJEA 3BUVA 3RX4A 4YTQA 1I0BA 2Y88A 3IV3A 5J04A 4B3LA 1Q6QA 3CT7A 2PDNA 2I17A 3B0XA 5E0KA 3I3DA 3LUTA 1IHIA 3FJ6A 3F4CA 1Q7MA 2OSXA 4B9ZA 3VNKA 2PBOA 1W9PA 4ASTA 1REQB 5ECVA 4KETA 2JKPA 2W79A 4UMAA 4N9DA 1QMLA 4ZFMA 4AD4A 3TR2A 3IVUA 4UZSA 1E6NA 4O4VA 3W6MA 3LG3A 4O52A 2ONEA 5DBTA 1FKXA 1OZMA 1V51A 4JICA 4A2RA 3BURA 2INZA 1UWAA 3WUFA 4IT1A 3KLKA 1U22A 4UFMA 4H3DA 4GZJA 4AZ7A 1TPDA 4XISA 3C2YA 4W7WA 1F2JA 2HXTA 3PZQA 3RNDA 4MOZA 3AOFA 4LS0A 2PURA 3AU2A 3CBWA 3GWQA 4K68A 3RRAA 4HYRA 5MF5A 3S6OA 1QJWA 1T5AA 4HZ8A 3QLDA 3L67A 2QCGA 4N4QA 1KKOA 1CXHA 2QDGA 4DO5A 5D9MA 1W6TA 3IS4A 1QNRA 3L66A 4YWSA 3HQPA 3FDKA 2DIEA 5J5DA 2GQAA 4A8LA 1OVDA 4GJJA 2D73A 1GYNA 4W8LA 4NT0A 3NQAA 4U5IA 2VEFA 3W7DA 3W02A 5E9AA 1VFTA 4Z08A 3WENA 4O0KA 1UKPA 1YXCA 1E5JA 3ANVA 4X22A 3VD7A 3B9OA 3QXBA 2B7NA 4S3EA 4S3AA 3O16A 3BICA 1ZRQA 5E0FA 3WF1A 4D6DA 3TLQA 1W3JA 4GE8A 4MNJA 3W2LA 1XCWA 3AAMA 3EYPA 2R14A 2XISA 1RA0A 3LA4A 2V69A 3CUFA 3PPGA 4J40A 1TVPA 2J8TA 3F03K 3OHMB 1HJWA 1ZFJA 2VX5A 1JYXA 1ZNNA 1QHOA 3AIUA 5I5RA 5HUPA 3BXWA 1H7PA 2J9ZA 4IJRA 5C5YA 2WZHA 4OVXA 3KP1A 4QTGA 1J5SA 4IH3A 3UA4A 2AOSA 3T8QA 5CCZA 4A22A 1OFAA 4C6BA 1TSIA 1KFBA 4AIBA 3ZYZA 2VGFA 1LROA 4N2YA 1I2PA 1L6FA 2RFGA 1DL3A 3BSGA 4NL1A 3CZKA 3RITA 4AZCA 5D2VA 3CASA 3RILA 1WXYA 3V0SA 3GM8A 1BPLB 4GI9A 4GQQA 4S23A 4B4HA 2ZWZA 4GQBA 2OLSA 3TYAA 4ICCX 3K13A 3KOYA 4EWND 4ILSA 2YDQA 3NPUA 4LYPA 5HPOA 1PX8A 1GYLA 3ECQA 2Q6ZA 1K4HA 4CEXC 1Q45A 2W61A 2VJXA 3FFSA 2QJNA 4TOQA 1FHLA 1GHSA 1ONRA 1C7TA 4WJEA 3SCQA 3BPWA 5CZSA 2E77A 3EOLA 1CLXA 1UROA 4RW5A 2NXIA 2J77A 5FKYA 5D4YA 1JZ8A 4ZFCA 4C6LA 1HJSA 3OW1A 2Y89A 1LBMA 2QCMA 2OOGA 5D2WA 3W7MA 3EPOA 1ECQA 4UIOA 2Q8LA 5KZ6A 5GQBA 4HK5A 5A6AA 5U7SA 5AHIA 1Z89A 3WNKA 2P53A 2QQ6A 3RU8X 3LBOA 4ML9A 1VJZA 3DFNA 4JQAA 3MPGA 3WFZA 1I75A 5LHEA 1TX0A 4AISA 2QLYA 3LDVA 3S2CA 4FNSA 3P84A 1GWJA 3MB9A 2J7EA 4L4PA 3H70A 3WDPP 1HJVA 1GUVA 1V5XA 3BG3A 2ISWA 1B3OA 5I3GA 2PFHA 3WQ4A 1JYNA 1OGGA 2RGLA 1JCNA 3VABA 4BY3A 3FSTA 5F4WA 2XHYA 2A6LA 3A21A 1K70A 2QKFA 2F84A 3IGXA 2ZRVA 4H4IA 4XB3A 4MAZA 3B8TA 1NY1A 4W88A 4LS2A 3PG8A 3TA6A 4KCUA 3EX3A 2TMDA 4RKAA 4RDYA 1V3IA 3UT0A 3PUOA 2ISVA 3IUIA 2YDAA 1E72M 4HA1A 5KZDA 2TAAA 2X41A 5F1UA 4IPIA 1K9TA 4PMUA 1XLMA 4ZCWA 1XLFA 5JBEA 3W24A 4D6HA 1I2QA 2GDVA 2NV2A 4HNVA 3QZEA 4C6NA 2YDRA 1QW7A 5D33A 3CV1A 3SEPA 3RPTA 3CUIA 3DC0A 5AC8A 4MJMA 3TNOA 3CHCA 2ATSA 4A3RA 4ZO7A 3VOCA 2G0WA 3NAVA 2ZX7A 2OVLA 1PHWA 3UXLA 1DXEA 6ALDA 1VBJA 3AZRA 4UFIA 2DV0A 1EP2A 1KBIA 5AKQA 4YIWA 4J5NA 2Z7KA 4CLMA 1E4IA 3LSBA 3QQWA 1HZYA 3ZM8A 4KMQA 3FAWA 4WY0F 3Q45A 1LOQA 4PBEA 2GOKA 7XIMA 2QUTA 2QR6A 1W17A 4PUDA 1Q3NA 2X1UA 1AQFA 3GG1A 4GIEA 3RLVA 4AHOA 1KFJA 4H83A 3UJFA 4F2BA 3P61A 3SURA 2CXEA 1KM6A 1H7XA 1WKFA 2Z1SA 4NF7A 3KEHA 2B7OA 2QPXA 3G1HA 3CLMA 3P2VA 2WHMA 3CUJA 3G1RA 1JZ3A 2E7FA 5T26A 3DXIA 3CTTA 1WQ5A 1U5HA 5KTLA 3F7JA 3BAJA 3LOTA 3EOEA 1MEHA 4M51A 1H41A 4KRZA 1TG7A 2FHBA 2PC8A 3PUEA 5F2GA 3KRBA 4H04A 4EX4A 3GK0A 4JY9A 4Q4PA 3PUDA 1LRNA 1VGAA 4MYXA 4EP8C 1UUOA 1UD4A 2NUYA 2CESA 2WZEA 4S3KA 3OLIA 4CD4A 4UB9A 2HCVA 1QI2A 3W73A 2DZSA 4LRTA 1CEOA 1JPHA 5HMSA 3LX9A 4HPHA 4RNIA 2FHFA 2SFPA 4P7QA 1UR1A 5DRIA 3SN1A 4HMCA 1GQIA 2CBVA 3K8LA 4MB4A 4IG2B 4W4QA 2GK1A 6CGTA 3SB0A 2YCLA 3S6DA 2XINA 1QOXA 4IIDA 2WHJA 2OWWA 5ABTA 2VEPA 3E38A 2NX9A 4REQB 4QISA 1D3GA 4DXXA 4A4AA 2J66A 3GE7A 3G6MA 5IBXA 3KS5A 3FY1A 2DJLA 2PDIA 3DI1A 1G4EA 4GVIA 2G95A 1AW5A 3W26A 3WIJA 5E09A 5CJMA 4QRNA 1YDYA 3B06A 1XGDA 3PBYA 1EH9A 2BVWA 4XKYA 3N1AA 1V93A 3POHA 4Z1DA 1E1EA 3PZ9A 3EDKA 3ZWSA 2XIIA 3TE9A 4JTUA 1OIFA 1Z8AA 3CL6A 3WJSA 3H12A 4LAMA 3W9ZA 2C1HA 1R9XA 3ALGA 4RLIA 2WSYA 2YYUA 4AZBA 4U31A 3VDAA 3JZEA 3A9IA 4TQTA 1KRCC 1ZLPA 2R6OA 6XIAA 5IDIA 3S42A 1QW9A 1E6RA 4GINA 4QROA 5I3FA 4MVAA 4BI6A 3B3DA 3U48A 4R7WA 2VGBA 2ZXAA 4O13A 1F8MA 3H7RA 4I3GA 3DBPA 5CAHA 2VI0A 3R5EA 4E4PA 1BF6A 3VTRA 1GT8A 1SU5A 4W85A 3WBEA 2WC3A 4NI8A 4YHEA 3V3WA 2ZRUA 5F7UA 3RM8A 1HFBA 2PWFA 4UTLA 1F6KA 3RK8A 3TP4A 3KVLA 4UQEA 5FJRA 3BAKA 4U2ZA 3WF2A 5BWFA 2BB0A 1V3KA 3P3BA 1XRFA 3ABZA 1F8IA 4Y9NA 4JGDA 3JW7A 2PWGA 1FCBA 3APGA 2G96A 2VZOA 1FA2A 1SYTA 3SCVA 4WDTA 4IJBA 5I3KA 1GQKA 1Q6CA 4F79A 2YLLA 4C6PA 3WQDA 4C6QA 4Z17A 4O1CA 1F61A 4RPPA 4JTSA 1QVBA 3HM7A 4M80A 2Y8VA 3GNOA 2VFFA 4PMRA 1DWFM 4DYEA 2V8ZA 1A5KC 4DNMA 3VGGA 3RX3A 1LLOA 1BVWA 1W1TA 4O1DA 4J35A 2VRQA 4O18A 2D0FA 2A0NA 3TUUA 3RCMA 4W93A 2HK1A 1O7AA 2HBXA 2G3NA 3I3BA 4OOUA 1EC8A 2XSAA 4JNMA 2ISFA 4DYKA 1O5QA 2VZUA 2XIBA 4P8WA 1VCGA 4W89A 3NUKA 4RDWA 3QRHA 2NQJA 2ZRWA 1GVQA 3LSCA 4JN8A 3C5QA 3TYUA 4GQGA 3B9EA 2V3GA 3KBSA 2VC9A 5DXYA 4B5NA 3CT2A 3FKRA 3QJAA 3EWBX 3TROA 4ACZB 4KEMA 4O28A 2IXVA 2FDMA 4GUFA 1PKYA 4L6OA 2H8XA 2WZTA 4D72A 2DSZA 4JTEA 1OSEA 1SFSA 3BAIA 5FEZA 2VRKA 3VGFA 1KM2A 1PV8A 4I5RA 3TW6A 1I2OA 4GQ0A 5TD4A 4AVOA 1UA3A 4EPDC 1KWGA 3T9PA 3TN4A 2QNEA 5LA1A 3LGDA 4H1ZA 5CC6A 4IXHA 4LEFA 4CEUC 3R11A 2G3JA 1YE4A 1FDYA 1A53A 4J3TA 1IIGA 5D09A 1SZFA 3JZUA 4DPQA 4PUNA 1TR9A 1C8VA 3BGGA 1XYLA 4Q8WA 4JQ1A 3U2CA 3DESA 4GIYA 1JQXA 1EYEA 4AFYA 3VVGA 2C19A 4QNEA 3GDLA 5FF7A 1R6WA 4D6FA 2I5GA 4N42A 3ITGA 2BTMA 5FEXA 2GDQA 1MQRA 1RHCA 3H7UA 2PDYA 1KCXA 3N15A 3VOHA 1JF6A 3M0XA 2C8NA 1XYAA 2E5DA 3C2OA 1NDYA 4O1BA 4OBRA 5FCZA 5D9OA 4NKCA 3C2EA 4DM1A 1W3KA 1EYWA 1KM5A 2Q71A 1QK0A 2J8GA 1KGWA 2A7NA 1ISVA 1T0OA 1Q6LA 1KGXA 4S3CA 3FDGA 3W1PA 5LHFA 3CUGA 2QGYA 5GNXA 2C18A 4OV9A 2OKOA 5L6UA 3V1HA 5EMUA 4OJYA 2PWDA 4DZIA 2WZIA 4UC5A 4HGXA 4DBDA 1OGSA 3C61A 3VIGA 1Y5WA 3BLKA 3A3HA 3GO2A 4H9MA 1AQMA 1XLCA 2E28A 3BV4A 3WQVA 4DJFC 2GYIA 1W1B1 2CNCA 1HL8A 2BGSA 3FSUA 3SCPA 3B0VC 3KRSA 1LOLA 4Q4OA 4XUGA 1Y5XA 4H8VA 2OGYA 1H61A 4FLQA 3EBVA 2VWSA 5LXXA 4XAFA 3PZMA 3LXCA 2HPMA 3QTGA 1OG6A 4R53A 5TAOA 4CQBA 3AS1A 2PF8A 3B8VA 3M5ZA 5ABFB 3NFUA 4JTQA 2X40A 2ACQA 1E56A 5C7HA 1DP0A 2O9RA 3SUWA 3EPMA 1J18A 2DJXA 4GIAA 8A3HA 4P61A 3V5OA 3EB4A 4J3VA 3O9NA 1R8LA 3L7RA 4LYRA 1UW9A 4AZ6A 1YMYA 5LNRA 2BHYA 3DOPA 5XINA 4PGLA 5KZMA 1EBGA 4X0NA 1JZ6A 4LT9A 3MA8A 4DLMA 4M82A 3ITCA 3VFCA 4ALDA 3WJWA 7REQB 3BJTA 1E51A 2Z0IA 4Q22A 1TJPA 4E4FA 4E2OA 1UR2A 3CUXA 3Q2DA 3GNNA 3AXIA 5D32A 3MDUA 1UZDA 1GPFA 4JTJA 3MP4A 5REQA 4IMGA 3GFYA 1QPOA 2PLKA 3IIXA 3QQ0A 2VKZG 1D2KA 2HDJA 1NH6A 2ZUNA 8XIMA 3NNTA 1JFHA 3WO8A 4PMYA 3EX4A 4RZ6A 3SZ8A 3QV7A 4PULA 1B3ZA 1NOUA 4JOMA 1O4UA 3L5MA 1OGBA 3OP2A 3DN5A 5G2WA 2POZA 3W7OA 4Q7NA 1KR0A 2RDXA 4RNHA 1ZY9A 1DIEA 3UPMA 2Y85A 2BY0A 3OIHA 3C86A 4RV3A 3NSNA 3EX1A 3WBYA 2E5BA 4GHRA 3MYPA 3A4JA 3E96A 1YRRA 3SADA 3GRIA 3FYPA 3LERA 5BW6A 1BVZA 3CMFA 1Z69A 4QS6A 3UWWA 1O5RA 4GVFA 1YW1A 3BAYA 3N73A 1SO6A 1EOKA 2CKSA 4NZ4A 2H9AB 2FTPA 2GL5A 2OYMA 2OKTA 3K30A 4Y90A 1KV8A 4LB4A 1M01A 2IKIA 2O4MA 1Q6EA 4CN6A 1QXLA 2OQHA 2ANUA 2PLMA 3CZ8A 1VPXA 3E02A 1PWMA 4LUSA 1C7SA 4Z2HA 4MWAE 1LZOA 4A3UA 2WMJA 5CGTA 2VR4A 1NIUA 4AVNA 4DUOA 4POCA 4PB4A 3BCDA 3F4WA 3AMCA 2F8QA 1F73A 3FNDA 2CZVA 2B7QA 1GOQA 1Q6OA 3W7LA 1I0DA 2VX7A 4WDUA 3MV11 3T44A 5BMXA 1US3A 3S2NA 3CS2A 1O66A 1VJSA 3ZT7A 1ZAJA 2FPVA 3LRMA 3S1WA 1NFGA 3EOUA 2J78A 2XPKA 1WZKA 4XSMA 2RJGA 4GC3A 4LQ1A 4PUJA 5HMEA 3GHRA 1RJQA 2F7FA 2X0HA 1ODZA 2BY2A 1EUAA 3DI0A 3MC5A 1TWIA 2CZ5A 1JIBA 3G8EA 4M5PA 2OODA 3QPYA 1GG0A 2DY3A 4GQRA 3VOFA 4TX6A 3IGSA 1DXFA 2AQOA 5HR6A 3VKAA 1Z6KA 2WCAA 5A5WA 3G18A 2R9RA 4JNYA 5AVHA 3SRDA 1H09A 4O12A 2NXHA 5ABGA 1UJQA 3T42A 1VBUA 1ZS2A 3KHDA 1CB7B 4ZOBA 3Q58A 3ZJ6A 4F66A 4LUTB 2D22A 3H55A 3WEZA 1A5LC 4XIAA 3MI2A 3U8GA 1U5VA 4LAOA 3S8HA 1WOAA 5EMLA 2JEPA 2V2HA 1IEIA 3WQOA 4D8LA 4M6VA 3NXFA 2V5BA 2X8RA 3V5FA 2WAGA 1UKTA 2XG9A 2V63A 3MVTA 5JVLA 1THFD 4XZNX 4ZQPA 1XH1A 4JDYA 3W6YA 4P7RA 1IF2A 2JFEX 4XZ9A 3FXYA 4W7VA 4HZ7A 3VO0A 3G22A 4H6EA 1HJUA 3TFXA 1ESWA 1C9WA 2XFFA 1C3FA 3AJ7A 4KKXA 4XAPA 3I7RA 2PLCA 2YYTA 4E8CA 5CSYA 3TYZA 4JCMA 3CEUA 3ZR5A 4ZTXA 1X39A 3LHYA 4WKHA 1D7FA 4FNTA 1GK8A 3B04A 3BWWA 1EGVA 2PODA 1S3TC 4YLWA 1VBHA 1AODA 1YTDA 5D2TA 1XIHA 3LI0A 2EXOA 4C1NB 1XSJA 3JR2A 1X6UA 1ZUAX 5DBUA 1P1MA 4UXDA 4IQJA 3SQSA 3ARXA 4G7FA 2QAPA 1W1ZA 4OQVA 4P7OA 5MKGB 2GJLA 2PD9A 3AS2A 2P8BA 5AC6A 3SIZA 3E5PA 1Q4NX 3V75A 3A64A 3DC8A 5C0QA 1JPIA 1TMLA 1XYMA 1FHUA 1GVEA 3GW0A 1MXDA 2RUSA 3HA1A 4PTXA 2VX4A 1MYRA 2HNEA 3WFLA 3HO8A 4QDWA 1O94A 1XICA 1B31A 3LS9A 4YMZA 5H91A 5KITA 1QPNA 4L56A 1B3XA 3ZLGA 2D2HA 3PPHA 4IGHA 1CGTA 1RAKA 4MWAA 4A3HA 5JBFA 3S5YA 4DY1A 1OBAA 2ZUMA 3GIQA 1RCXB 4HKPA 2PE4A 3SO7A 1R2TA 5EYWA 2OMAA 4C6FA 1TPVA 6REQB 1BD0A 5I07A 4S3DA 4GUGA 2CHOA 1JYVA 1F3WA 1JI1A 4GACA 1UUQA 4I8DA 3L65A 5FACA 2P76A 4C60A 1SR0A 4CN4A 1C93A 4CD6A 2B4GA 3B03A 2ZXDA 1K8XA 1B4EA 1WKYA 4MDPA 3NQ7A 4HHHA 2FGLA 3PVFA 4H9ZA 1JGIA 4H6KA 4ZEPA 1HUVA 1MRQA 3CEPA 4O4WA 5XIAA 4M1RA 1K02A 3GXMA 1DQUA 1R47A 3A3WA 2YXXA 4DJDA 1PUDA 1ZJBA 5C2GA 4NILA 3T0DA 5AHLA 1O5KA 1DJGA 3TJ4A 1TELA 4DIAA 1DIOA 1TZ7A 3GR4A 1MW3A 3W22A 5H1WA 3UETA 3H6OA 2ABAA 2Y61A 4AAJA 4OFCA 2X05A 1W5OA 1B4KA 5GJMA 4X61A 5AHEA 1UH3A 1XIBA 3IVSA 2HEJA 3R4IA 3S5NA 2IPGA 2DQXA 4WY0A 4XTIA 3LHVA 5CSSA 4BQ2A 4Q33A 1XBYA 4NP7A 4O11A 2HNHA 2D3NA 4O57A 2CFFA 4JN6A 4UBPC 4ZZ9A 1K7EA 3EA2A 3G5EA 6TIMA 4C5YA 1POKA 4RPQA 3LCXA 3GS6A 1O68A 3FEMA 4QQ3A 4LUJA 3T2QA 2QW5A 2YCJA 4S1FA 3GNRA 5I23A 3DGBA 1DIKA 2DUZA 2DVUA 3NYDA 5BRPA 3VZYA 2PMQA 3R58A 1HN1A 1KCZA 1EKOA 3RU6A 2EPLX 2X2GA 3ZVHA 4QCEA 3BQ5A 3CTLA 4O1EA 3B8WA 2CITA 3QZAA 2E6FA 1R7AA 2ZDSA 3IUDA 2JK2A 2LLEA 3WKZA 2WWDA 4KS0A 3RR4A 1YPXA 3PTKA 4DVOA 3PPFA 3BLPX 1Z44A 1B9ZA 1F05A 2IQDA 3DAQA 3E12A 2FGZA 3GG0A 3CV6A 3VKKA 3M0YA 1PKMA 1SW0A 3LCLA 3PWIA 2O9TA 2C1IA 3A4WA 3GC2A 3W1LA 3GU1A 2GSJA 2OCZA 3AZSA 2F9RA 3UBPC 1LORA 4H9XA 1VCVA 3WDQA 1QTWA 1FWTA 1KXTA 1EEXA 3SM0A 5JH1A 3BMXA 4MNLA 1SQ7A 4CQCA 4B5TA 3M46A 3TC6A 2YA2A 1XF0A 1U1UA 3RRXA 3UVIA 3WH9A 1P6BA 1K3UA 1EA9C 4GPNA 4MNMA 3EWXA 3P80A 4LCQA 4HIBA 3BG9A 1EXBA 3UJ2A 4PUMA 1DJHA 4N0RA 1W2VA 3MCOA 3QY6A 1W91A 2X1RA 2PDWA 3LQGA 1JDAA 1SZGA 3LI1A 2DT2A 2ZRYA 1M68A 3W7HA 1ICPA 3AJXA 1BLIA 4AWTA 4DX3A 2GGHA 4JTDA 4F0SA 4ADSA 3U9IA 3PNZA 4LOCA 1FP9A 5HA7A 1RBAA 3E2RA 1JZ4A 3S1UA 5BXSA 1US0A 3AIEA 1YDOA 3LZ3A 3LXAA 2WJFA 1L6WA 4QEHA 1SZEA 4KWOA 4IMEA 4LX4A 4C91A 3GY1A 3MSYA 2FPYA 4MPKA 1RCQA 2ZA3A 1UP2A 2DH3A 3GXPA 2XJ7A 1XD0A 3BGAA 1J93A 4GG9A 2PGEA 4BWLC 1V3LA 3P67A 1VFOA 1ZHAA 1FWIC 3OB8A 1RJRA 3WMBA 1X96A 2WVVA 5BOFA 5CGMA 4QE4A 3A3XA 1U83A 3VIJA 4KQNA 5I79A 2RH9A 2WBKA 1QUMA 3N29A 5KSWA 1LF1A 1S2CA 2GZXA 1W1YA 3TAOA 2ZX5A 3ME3A 1ZAHA 2X16A 1ONWA 4ZOCA 3RF9A 2QJIA 3RHGA 4CQ8A 3TSMA 4F3HA 1HVQA 4WKFA 3UR2A 2R94A 4JQ3A 4KWSA 1V6XA 1XIJA 4Q8MA 3TYCA 1JQVA 3W70A 1W54A 3B9DA 1E4MM 2G50A 3QM3A 2WNWA 1JYWA 1KTNA 1XYZA 1E3ZA 1C90A 3BANA 3KAOA 3K1GA 1X6LA 4UFKA 2I5QA 1VF8A 4LTSA 1XLIA 3GDRA 1HKJA 3R0UA 4RE2A 3PJXA 3TQKA 3PS7A 7A3HA 4OUIA 4D6EA 1GKPA 1RP9A 1F76A 3IGUA 3EEZA 1XXXA 2J4GA 4ROPA 1K7XA 3VUSA 3ZR6A 1B1YA 3DFPA 1JDFA 3W2JA 3R0DA 5C9UA 2YCEA 1DJXA 2CEQA 5D2XA 1VYRA 1BWKA 1E1CB 2WC7A 2WVTA 4MM1A 4BJHA 2HVNA 1B5TA 4NZ5A 4R33A 4HA0A 5F2IA 5M5DA 2HVOA 2PCEA 5A8PA 2AAMA 9XIMA 1U5JA 2XFRA 4S39A 3C56A 1TA3B 4UWMA 4IMDA 4OBSA 5DLCA 1JUKA 1F4HA 4OTKA 3TA9A 4BK9A 5A8NA 4K8GA 6A3HA 3FA4A 2BVDA 4GA8A 5A6MA 3LRKA 4C6IA 3FHQA 1XHGA 2AL2B 4H8NA 3DEQA 4TMCA 1VENA 2O0TA 5IFTA 1C91A 1CX9A 1DJIA 1C92A 3CAVA 2HSAA 4Z2IA 3M64A 1AK5A 5I03A 3K46A 1F07A 1H0GA 1W3HA 4MZYA 4QG6A 3NO3A 2J7GA 3FIGA 3UYCA 3B8UA 3VMNA 3QEZA 1RV8A 3EGJA 2PGWA 2GVEA 1OWQA 4DHGA 2GGIA 1REQA 4RE4A 4US6A 1ZBKA 5EA9A 2V3EA 4MLJA 3JS3A 2DQWA 1GVIA 4AVFA 4QEEA 5EU9A 1UWSA 3RN6A 4GRSA 2XSBA 4CGTA 3ABQA 1PPIA 4O54A 1V6UA 4KRUA 4S3GA 1FQ0A 1QI0A 4R88A 1J2WA 4G7EB 4V27A 1WX0A 4P8XA 1O60A 2UV8G 1LG2A 1BTMA 4WEVX 3OGVA 4XX6A 2A79A 1NM9A 4PL2A 1W5PA 4XBKA 4LBSA 1V3MA 4UTTA 2DZWA 3TW7A 4GY0A 4R9XA 3TTQA 2DUXA 5DF0A 2EHHA 2DZPA 2XVLA 2HPIA 4Q8TA 3W2KA 5CPTA 4EKJA 4C6JA 3EDDA 2JKEA 4A8IA 1S1RA 3MV01 4EPKA 1VPYA 2V5JA 2BBFA 3C8NA 1AL7A 1LL4A 2CERA 4FI4A 1VZWA 4AW7A 4DWSD 3HJZA 3OPSA 5LSMA 2FTYA 3RLUA 4IL2A 1SJAA 1PJ9A 1UKQA 3RM9A 4BCEA 2AKMA 1JD7A 4UFHA 1V0NA 2ZUWA 2A6NA 3TONA 2EAWA 4LUYA 5LA2A 3ANUA 2E6AA 5E0CA 4J3XA 1D7KA 1P5BA 4JTIA 3DZ1A 4DZAA 4FOJA 4M24A 4HNOA 2YZRA 4WDXA 5I3HA 5AC5A 2IPWA 5AHNA 1ELSA 3SCWA 1EWEA 4Y8EA 1GKQA 2ACSA 5U4NA 4Q8UA 1TV4A 5CSUA 3S2MA 4CD8A 3THCA 1TRDA 2FMOA 4UOQA 1VBGA 5CJNA 1W5QA 2EG6A 4WUIA 2DW7A 4RE3A 4ERGA 2ZQ0A 4HOXA 3BAXA 1Y0EA 1GQNA 2DORA 4ZQMA 2J27A 1C29A 1U1HA 2E68A 5A2BA 2Y1HA 3U4FA 2C71A 1KXQA 1AFSA 1UP0A 5IBXC 3CQKA 3NVTA 1OHLA 2OZTA 3EWWA 3DU0A 2BGNE 1GJWA 4R27A 3WD1A 3MKKA 1G0CA 4MHBA 3QPZA 1FDJA 1UC5A 3LV6A 3IRDA 1B2YA 4EK7A 2VZSA 3PY2A 2XVGA 4PMDA 1TCDA 2OO6A 1E6PA 1AJZA 3L4XA 1UR4A 1XH0A 1CXEA 2O55A 2VP8A 4HTBA 3N4AA 3QGAC 1TVLA 2XTKA 3VDHA 2FPTA 4N6EA 2WNNA 3F2CA 4MLRA 5B7YA 4NAEB 1PTDA 2VHLA 2NSXA 3MBFA 3DH7A 4GYKA 2P50A 2QJMA 3C0QA 4O1AA 2BX7A 4UR9A 3M0JA 2J79A 4DBWA 3L0KA 4UNLA 3AROA 1M41A 1W9UA 3Q37A 1J9YA 3V16A 2OLAA 5CAKA 5AYBA 2ZUSA 3OO2A 3OZYA 1ITXA 4I6KA 2DH2A 3TWBA 3WH7A 1XSKA 3WDJA 1W9DM 3WK3A 1ADDA 1HKWA 3AHTA 2GDUA 1UWRA 4XTDA 5EMYA 5B80A 4LYQA 2J7HA 4U2YA 4B2DA 3W75A 1AVAA 4H6RA 1W0MA 1N82A 4XQ6A 1XDLA 3L0NA 4AX7A 4TIMA 1L9WA 4C6DA 2FFIA 2WMHA 1ZP4A 2J24A 3LTPA 1GHRA 2QYGA 4FIQA 3KVMA 4JFTA 1XFCA 1KBJA 2QCEA 1E1FA 3TJIA 5GJPA 5HINA 3VYLA 4B5XA 1M7XA 3L2IA 3VNLA 3EB3A 1QW8A 4UTUA 5GPRA 3WK0A 1NOFA 2QT3A 1OZQA 2W62A 2RKXA 3VDBA 3PG9A 5AFDA 5BCAA 5HAOA 3W7RA 1UP3A 4H8UA 3M6DA 1GGOA 2ZZ2A 1RY8A 3IK4A 4HSHA 4LW7A 4AC7C 2ZZ5A 1WKDA 3B4UA 1XQLA 5L9FA 2VVSA 3VOGA 1EDQA 3VI2A 5JBDA 3ONBA 2QV5A 1P0DA 1KR1A 2PDMA 2BODX 4HT3A 3H2FA 3AHXA 1BFNA 3FXGA 5I00A 4TVDA 2RHGA 2VFIA 2BS9A 3C6CA 3S1XA 2OR2A 1QOPA 3PTQA 1DYSA 4Q32A 2J8FA 3PAOA 2TRSA 3ZLFA 4PCSA 3AHVA 1R7OA 2R1PA 4K6AA 3S47A 1W3NA 5AHMA 3LLXA 4IISA 2VRJA 3SRFA 4Z2GA 1UQZA 4ZE4A 1GVYA 3HB9A 2ACUA 4P8UA 1YE6A 4R3UA 3M0LA 2A5HA 4PODA 4WX2A 2G4JA 3DX5A 2Z1KA 2X30A 3O6CA 3UY8A 3RGTA 5HATA 3U6WA 3C0SA 3VD9A 4PTMA 3KDOA 4W5UA 5LIWX 2D0HA 2J7DA 4ORIA 3WK2A 3QN3A 4LV4A 1JPDX 9CGTA 3LCWA 1QU4A 5T9CE 1J96A 3IARA 1BVNP 3NL3A 5HOSA 1CPUA 2E9MA 3CO4A 2BDQA 2JIWA 4E0CA 5IDZA 3QGKC 4HYWA 2YB4A 2EKGA 3CNYA 3KWXA 1UMYA 1CENA 4PRWA 2PZ0A 2VX6A 2INFA 1KM3A 3STPA 2E8YA 2E40A 3HG5A 3VNYA 3MKVA 3GUGA 5M1TA 3VKDA 1UG6A 1GCYA 3AQUA 3S9YA 4JDBA 3L2MA 3SFKA 1TR1A 4FX7A 1JXJA 3V7PA 4D8AA 4GO8A 1H2JA 1FKWA 3CWNA 1XLLA 4IIEA 3QR1A 3U2ZA 3KL3A 4I7VA 4EAYA 3TYEA 1ISZA 1LOSA 3Q94A 2ZZ4A 4TV6A 3AYRA 2PDPA 2QGHA 3KRZA 2QF8A 3CU2A 2FH6A 1J0ZA 1HX0A 4DZ5A 8XIAA 2YXGA 1XIMA 1WDWA 1ODUA 4FIRA 3PJTA 5DCBA 5EGRA 4GNJA 4QAWA 3FGCB 5ABEA 1L6GA 4REQA 5HJYA 4HJWA 3U2EA 3WK1A 3ITOA 1BGGA 2YKKA 3SUSA 4PZVA 5FSEC 1EUNA 3STEA 1CXFA 4PA8A 2VXNA 1DWIM 1PTGA 5FJIA 3BZJA 4KFNA 4ZO6A 3S1GA 4ZOEA 2GOUA 4IP4A 3UQNA 3MU7A 2J47A 4QAIA 4GZ7A 4ZSTA 3O6YX 2V2CA 4H2CA 4D1JA 2PWUA 1RA5A 1HTIA 3PANA 1PKNA 2A21A 5CBBA 3MZ2A 2XVPA 3UXIA 1TTQA 5DFAA 4IIHA 1JCXA 2PTZA 1JJKA 2VD9A 4DXVA 1UWUA 3ITXA 3P81A 4PUUA 4MKVA 3QLLA 1K8YA 2IS7A 1N8IA 3H8AA 4V15A 3GTNA 1G9HA 2EEXA 2P0OA 3BK0A 4IQLA 3PULA 1OYCA 3N9KA 1LBFA 1RP8A 1R9YA 1G5AA 2FFCA 1UJPA 3RLGA 3HGJA 2QPUA 5MHBA 1FWHC 3UPWA 4CUCA 4HQVA 3THDA 1FWSA 4PEEA 3N9SA 3SN0A 3P60A 2PI6A 2H3DA 1Q6FA 2YX0A 3WDHA 4TV5A 5G4WA 1QK2A 3U2OA 5IFPA 5FF2A 3KOFA 3W7PA 1EZ2A 3WLTA 4AIOA 4IMFA 2E1WA 3VMOA 3D5HA 3IRSA 2WOQA 1H63A 2WO5A 3HPZA 2IUZA 5F4XA 4C6MA 4TVUA 3F2DA 1FVPA 1CNVA 4LRSA 1NJJA 1XBVA 1WDRA 1E6QM 3SSJA 4E8DA 3E0LA 1I45A 4A3QA 2F6KA 4KWWA 3GKAA 5CSRA 3U57A 3NSXA 4W5ZA 3EXRA 4JTRA 4IWWA 3S2LA 2Y7DA 3L5AA 4GUJA 2JGYA 4Y2WA 9RUBA 1TKKA 3SCOA 1F9CA 1EQPA 2FLIA 2DZAA 3RG6A 4ICNA 2XH2A 1UBPC 1BXNA 3OA3A 1CGYA 1QWKA 1RZMA 1NAL1 4ZL1A 5CPNA 3PSWA 3VOIA 4HK6A 3RCNA 3ALFA 4ATDA 3E5BA 3QKZA 4OT7A 3ZVIA 1Q65A 3LMYA 1OFEA 1RD5A 2E4TA 2HS8A 3O8AA 4C6EA 4J28A 5BNKA 5BOOA 3T0AA 1DQWA 2Y70A 1KM0A 1WNOA 4KW2A 4GC4A 1VFLA 5K9XA 1BXCA 1WPCA 3IUHA 1J12A 3KOWA 4XBJA 1Q63A 4YN5A 1C8XA 1GQLA 5HPCA 2E6YA 3OQ8A 1P6WA 1RBLA 2OX1A 3BL3A 4JTLA 4C7DA 3CHFA 4W84A 3MJYA 3WLMA 2Z1BA 3ARTA 1WXZA 3NEHA 1X7FA 1FWDC 2VDGA 5E70A 2XN2A 3GHTA 1E0TA 3LNPA 3SUUA 3W7IA 2NWRA 1W9BM 3WSUA 5BWAA 2REQB 2GQ3A 1G6CA 3EWCA 3OVPA 4HZMA 4ROQA 1IXPA 2XDFA 4TTUA 4LVGA 5I78A 1ZCCA 4AIUA 3EX2A 3VC6A 4QDPA 1YEYA 3GXIA 3PZTA 1CWYA 2A3EA 1VAHA 1PZ2A 3UWZA 2OLHA 3VIOA 1XGZA 2J25A 2GSEA 3WD3A 3CV2A 1ZENA 2PDGA 2B0MA 4U33A 3MJMA 4YXGA 3EX6A 2O9PA 4NRRA 3NM3A 4NU7A 3K4WA 1UPMB 2YCLB 5IRPA 4EF9A 4D6CA 3TTEA 1A5AA 2BHZA 4Q3MA 4J1OA 3GLCA 2P3EA 3NURA 3N2CA 4JIPA 2QF7A 3I6EA 4HNCA 2PBGA 1UBSA 3FCPA 1TV7A 3QV6A 1A5BA 1EJSC 4AD3A 4B3KA 4N9EA 4X2RA 3DHPA 3LBCA 4GMEA 5HWNA 3BVJA 2OU4A 1T96A 4PL1A 1ME8A 3LGEA 1UOKA 3BLFA 3ERPA 4HTYA 1F6PA 2YL9A 1CCWB 3C2VA 3P93A 4WK9A 3SRKA 1FFQA 4W7UA 3DGRA 2WCSA 1NU5A 3TCEA 2OG9A 5LNVA 1TREA 5BU6A 4PC8A 3NDOA 1MZHA 2HVMA 4DJEA 1BYDA 4GNKB 3INPA 2WKGA 4JTAA 4P7NA 3VCCA 3WL1A 4QFUA 5EFDA 5K9DA 1MWOA 4C7FA 1HL2A 4QGCA 1D8WA 1WDQA 1V08A 1XG4A 1XC4A 3CPRA 4E2DA 1NWRA 3UA3A 1UD2A 4HHPA 3A22A 1M03A 1ZBCA 4IM4A 4CNSA 4U5KA 2PCQA 1QNPA 3CYJA 4IOTA 1VR6A 5LIUX 3E1F1 4GYJA 4AXNA 1R3RA 3OLDA 3ZOAA 1LT8A 4ZB0A 2QCDB