3M64A

Human aldose reductase mutant t113v complexed with idd393
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
316
structure length
316
Chain Sequence
MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPVGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldose reductase
publication title Ligand-induced fit affects binding modes and provokes changes in crystal packing of aldose reductase
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3m64A00
5LIKX 4LAZA 4H7CA 3ONBA 4JTAA 1JEZA 1GVEA 3DN5A 4JIHA 1YE6A 4PR4A 2PD9A 4ASTA 1M9HA 2INZA 2PDMA 2HE8A 3LENA 4LBRA 2HDJA 4JIIX 3CV7A 4HBKA 2A79A 4PMJA 2ACUA 2BGQA 4DBUA 1PZ0A 1IHIA 3UFYA 2PF8A 5LIWX 3WBXA 3V0TA 3UZXA 2PDJA 4XAPA 2CLPA 3V0SA 2PDWA 1VP5A 4WRHA 2WZTA 3BV7A 1AH3A 2HVOA 1HQTA 1RY8A 1S1RA 2INEA 4GA8A 1T40A 4PUUA 4MHBA 2P5NA 1QWKA 3GUGA 1S1PA 3M64A 1AZ1A 4JQAA 1ZSXA 2VDGA 1AH0A 3RX4A 4XVDA 3CV6A 3GHTA 3FJNA 2IPJA 2ISFA 1SM9A 3V36A 1PYFA 1J96A 3MB9A 1YE4A 3R43A 2IKJA 4L1WA 2DUZA 4ICCX 3LNMA 4I5XA 2HEJA 1RALA 2PDPA 3RX2A 3Q65A 2PDCA 4JQ1A 5HNUA 4GIEA 4FA3A 3EAUA 4YVXA 4JTRA 4WDUA 1Z8AA 3F7JA 2PFHA 5DANA 4AUBA 2HV5A 4DBSA 1ZUAX 2AGTA 2NVDA 1MI3A 2R9RA 3MC5A 1A80A 2I16A 3V35A 3H4GA 2PEVA 3RX3A 1C9WA 4XO7A 3P2VA 3T42A 1UR3M 4XZIA 5HNTA 4GQGA 3BUVA 3O3RA 1US0A 2C91A 3R7MA 2PDUA 3UZYA 2PDLA 4JTQA 1XJBA 4IGSA 4GABA 1T41A 2PDGA 1S2AA 4XVEA 5M2FX 3LN3A 4L1XA 3LBOA 1XGDA 2PDNA 5LIUX 3UWEA 1PZ1A 5JH2A 2IQ0A 4FZIA 3VXGA 2HVNA 4PRTA 2ACSA 2FZ8A 3COTA 1HW6A 2PDIA 4XK2A 4LB3A 2QXWA 4Q7BA 4G5DA 3WBYA 4XZLX 3UG8A 1MRQA 4DBWA 2FVLA 4ZFCA 3GHSA 3H7RA 2IPWA 1MZRA 2IPFA 3Q67A 2PDHA 3H7UA 3CMFA 2IQDA 4IJCA 2WZMA 2PDKA 3LD5A 1EL3A 3UGRA 4LB4A 4EXBA 3CAVA 1X98A 5LIYX 3S3GA 1QRQA 3GHRA 1EXBA 4YU1A 2BP1A 5AZ1A 3CAQA 3V0UA 2PD5A 4XZNX 1S2CA 2HE5A 2DUXA 4QX4A 3QKZA 1YNQA 3ERPA 3WG6A 3EB4A 4LBSA 4XZHA 4JIRA 3M4HA 2DV0A 1OG6A 3LZ3A 5HA7A 2PDBA 3C3UA 1ZQ5A 4JTDA 1Z89A 4LAUA 3U2CA 4H8NA 2IS7A 2I17A 2PZNA 3N2TA 1X97A 1LQAA 2F38A 1RY0A 3LQLA 2IKGA 3EB3A 3CASA 1K8CA 2F2KA 4RPQA 4JQ4A 3LUTA 4XZMX 4NKCA 1X96A 3R8GA 2PDYA 3UZWA 4WGHA 3B3DA 4DZ5A 4JQ3A 2BGSA 4PRRA 3ONCA 1FRBA 3DOPA 4FAMA 2IPGA 4IJRA 2PDFA 4XO6A 4GACA 5KETA 3O0KA 5JH1A 3BCJA 5C7HA 4R9OA 2ACRA 3LQGA 3N6QA 3G1RA 3R58A 4YVVA 1Q13A 2R24A 1Q5MA 2FGBA 2ALRA 4Q3MA 4FALA 4WDTA 4GQ0A 3UYIA 3R8HA 1IEIA 4QBXA 4F40A 1PWLA 4JTCA 1AFSA 3KRBA 3R6IA 4WDXA 1PWMA 3GHUA 3WCZA 3NTYA 2J8TA 4QXIA 4HMNA 1EKOA 4PUWA 3M0IA 1Z9AA 1EF3A 3UZZA 4WDWA 2IKHA 3FX4A 1VBJA 4WEVX 2NVCA 3LZ5A 4EXAA 5AZ0A 1Z3NA 2FZBA 3BURA 3D3FA 5LIXX 2ACQA 3R94A 1ADSA 2FZ9A 3LEPA 2FZDA 1AZ2A 1YNPA 2PDXA 1XF0A 4YS1A 4QR6A 2PDQA 4GCAA 3UP8A 4JQ2A 3G5EA 2IKIA 4OTKA 4YVPA 1R38A 3WBWA 1ZGDA 1AH4A 1LWIA
chains in the Genus database with same CATH superfamily
3LM7A 2NXGA 2J9XA 1VQTA 5C55A 1GUVA 3OBAA 2X7VA 3BAKA 1IIGA 2I14A 2EPMX 4DJDC 1HT6A 1T6MA 2ANUA 4C6LA 4PC8A 2GDQA 2P8CA 5F4SA 2ZC8A 3MMWA 2VEGA 3UFYA 3CZGA 3C56A 3PBGA 1BQCA 2ZICA 4GKTA 3RJXA 4K8EA 5C2GA 3ZT6A 2ZRVA 4A8NA 3VOJA 1EJTC 1EA0A 3TX9A 1LF1A 1EC9A 4GX8A 2QVNA 3MP4A 4DWSC 1T40A 2XH4A 2YSWA 4MHBA 2HSAA 1EB3A 1IEXA 4HHHA 3K8LA 3AISA 1S1PA 4IQJA 1AZ1A 4I7UA 4BR1A 2VDGA 3KZSA 4ACZA 3LB0A 4AD2A 1LQ2A 3T05A 5AFDA 5FEZA 2FZNA 1VENA 2EPNA 3SGZA 4UTMA 2ZXQA 2POZA 4A4AA 4M6UA 4O10A 2FKPA 2FHBA 1O5KA 4JBRA 4BF7A 5I78A 2HMCA 2BMBA 1JYNA 3O16A 4C6QA 2I56A 4Y2WA 3QOMA 1KGXA 1NDYA 3N3TA 4DUVA 5LSMA 2GSEA 2W27A 5HWNA 1EQPA 2NXHA 3CLMA 3NUKA 3ZOAA 5H8MA 1EQCA 6A3HA 4JZ5A 5CJNA 5DANA 4AIEA 1Q6LA 2HV5A 1XCFA 3GAKA 4OV4A 2W67A 3MWCA 1MUMA 4TOQA 1JUEA 1XKJA 2FPYA 4E5TA 5CKSA 2X7WA 1ONXA 5D2VA 1DXFA 1UWSA 4O12A 1VCFA 2E8YA 2O0TA 2ZRUA 1C9WA 3OQ8A 1X6NA 1J8VA 1QNPA 2W3ZA 2F2HA 1UOKA 4OZOA 5BRQA 1DTUA 5C8BB 1AD4A 1E73M 2Y88A 1UR2A 2FMOA 4LVAA 3A6OA 4XVEA 4JXCA 4A8RA 5LIUX 2IQ0A 1KQZA 3N9SA 3CZLA 5FJTA 2A3BA 2NV2A 1LG2A 1RD6A 2GK1B 3RRXA 3KEHA 5BU9A 1I0BA 4R7WA 1FQ0A 1K1DA 3WBYA 3CQIA 4QLJA 4U28A 3GG0A 2V3GA 4HNVA 3GZ3A 1AJ2A 2QHAA 4DRSA 2PTWA 1Q63A 1SUXA 4LF2A 1E3XA 4ATWA 3B8WA 4O1FA 2J27A 2X0YA 1EX1A 1O4UA 1MFVA 4AD5A 1ZAIA 3QZ6A 4HA1A 3S3GA 3FHAA 4FLSA 2WCSA 4NNCA 4I6KA 3G6LA 3BH4A 2HISA 1R46A 3VGEA 4LX4A 1DQWA 1TV5A 4GYPA 3M0VA 5IBXA 3SQMA 4K38A 1TB3A 3EXTA 3QKZA 3QQWA 5IFPA 1M3UA 2F7FA 3GD6A 2PP3A 3BAWA 4L61A 3OJGA 5I02A 1VKFA 4WJ8A 4UTFA 4R27A 3WK0A 5HA7A 1EBHA 4ZQCA 1BWVA 1C8XA 4IT1A 3VD4A 3W2UA 2GVYA 1NIUA 3VNYA 1OFQA 3TJIA 1QOXA 2DT2A 2YCJA 1KRBC 2WZIA 3ME3A 3U4AA 3STPA 1VPYA 5HQEA 2EG6A 1L2UA 3KWSA 1XDJA 1K8CA 4O8RA 2QJGA 4KCVA 3ALGA 1H7WA 2PLKA 1XCWA 3NXLA 5FD0A 3FKKA 1TTQA 4J3ZA 1TX2A 3UU0A 3K1DA 4QTGA 3EEZA 3H2NA 4HYRA 4D6IA 3RR1A 2HCVA 4RNJA 3WENA 4B5TA 1GEHA 4JHOA 3QXBA 3GE7A 4FAMA 1Q2SA 4FHAA 1NF7A 4D1IA 1SYTA 5EGRA 2X42A 3L68A 3R4IA 1R85A 3GR4A 3GH7A 3TZNA 1BF6A 2ZQ0A 3VIMA 5HJXA 1EZ2A 2V3DA 3MO7A 2Z29A 3LBMA 3KL3A 4JTSA 4JCLA 4Y9NA 3M0JA 2I5GA 4GZJA 1ME8A 1XSIA 3MHGA 4KEZA 2Y6ZA 3MYPA 3TYBA 4XKYB 1K8YA 3MT1A 2ISWA 3B9DA 3UD6A 3AROA 2X1IA 1US3A 3THQA 4AY7A 1S39A 2YXOA 2OZ8A 4FS9A 3FY1A 7ENLA 4LUYA 4GY7A 3T55A 5MHBA 4PL2A 4HMNA 4GI6A 4BCEA 2R1MA 1C91A 1OCQA 4EX4A 3MCNA 3PJUA 3LZ5A 4S3CA 5AZ0A 2BHYA 1QHZA 3RILA 3M47A 3L0KA 3AICA 4YYFA 4QJ3B 4P7NA 3LHVA 4AVNA 3CIWA 3SDOA 1IWAA 2VCAA 2FDSA 3C0QA 4H2CA 4QR6A 1F3TA 1BGAA 2FPTA 2FTYA 3O06A 4UQ9A 2QDGA 1OF8A 3FEMA 4A05A 1HJQA 2XZ9A 1R38A 3AS1A 1ZGDA 4KRUA 2Y5SA 3STEA 4MYAA 4JFVA 3I7QA 1LWIA 3ABOA 1AG1O 4WXZA 1OX5A 2QCGA 1GYMA 3WUEA 2WHLA 4IIGA 2V38A 3F5KA 1TV7A 4M24A 2DZBA 4DWSB 1HKKA 4M6QA 4E3VA 1VLWA 3NIYA 5IXEA 5BMWA 3W7OA 2C7FA 4LBRA 1GW1A 3S0CA 5AC8A 3FJ6A 4QQUA 1JDDA 2ZWZA 3SCQA 4K68A 1KTBA 4MJ4A 1SR9A 3H24A 5E0CA 4DAFA 4YWIA 4UWMA 3KVJA 4YJ5A 1FWAC 1NWUA 2IXUA 1TIMA 4GI4A 3UNDA 3IIPA 3OODA 1UPPA 1YMYA 1AH3A 3C0JA 1PZ3A 4XKMA 1KBIA 1O6IA 3WDPP 1OFDA 1LM1A 3GKAA 1TMLA 3O6YX 1R2SA 4MADA 3A13A 4Q8WA 2VC9A 1FHLA 4JX6A 3WJZA 2PUZA 2DIKA 3EDJA 5HR6A 5J04A 4F2TA 1DWAM 3T08A 2XIMA 1GJWA 3M43A 5EMKA 5TAOA 9XIAA 3RM8A 5EMJA 2RGLA 3WNOA 2J13A 3F2CA 3ZM8A 1SO6A 3N34A 4O11A 5AVHA 4O57A 4DAIA 3AS2A 4AZ7A 3ZJ7A 1DIOA 4W88A 4MSSA 4EWND 4PTMA 3OG2A 4GIEA 3LGDA 3U8GA 3EDDA 4JTIA 4YVXA 1JFHA 3GZAA 3HF3A 4DNMA 1MW2A 3BV4A 3EYPA 1KLZA 3TLLA 2VFIA 1A49A 1KWKA 2W66A 1XG3A 2QCDA 4DBSA 3R10A 1F3XA 3GXNA 4LCQA 5CPSA 4OE7A 1RV8A 4JTUA 4GH3A 3VE7A 3UPBA 4IIHA 1H11A 3IIXA 2PEVA 3VGGA 3TTEA 4CD7A 3AZRA 5I7GA 1HJWA 1O5RA 5LZLA 5IRPA 3KTSA 3R7MA 3UZYA 4Q33A 1KFEA 3AFBA 2PDGA 4PA8A 3IGHX 4L6HA 3L66A 4DXXA 1CGVA 1IXQA 4MKVA 3UG4A 1EDGA 3M5ZA 2YBTA 2GWGA 3JW7A 1R3WA 3RM9A 4CU8A 1VCVA 5D03A 5D8WA 2XU2A 4HOZA 3HMJG 1VIZA 3QZEA 3IJ6A 1CXKA 2A3AA 2YKKA 3MSGA 3NL2A 5EMMA 4QJ4B 1BFNA 1FDYA 2BY1A 1V6TA 1SSGA 2QQ6A 5A69A 3W7IA 2JF6A 2QJNA 1NSJA 5HNNA 1G6CA 2Q8LA 1LOSA 4F8XA 4LB4A 4DZIA 1CXHA 1TPFA 3M7WA 1MW1A 3S9YA 3S1UA 1V3LA 1R3TA 2ZUSA 3BQ5A 4DWSA 3B40A 5CZ0A 1X1NA 2XFRA 2RHGA 2XIOA 2J8GA 5FAJA 5CGTA 2DQWA 3AMGA 4JY8A 4TXEA 4CCCA 4NZFA 1RD5A 2XVLA 3SR7A 3ENLA 3BWWA 4UZSA 1NM9A 3OPSA 3VINA 3S2JA 1I2PA 1QI4A 1KM6A 4INFA 4UCGA 4D6HA 3QZAA 1B4EA 2W9MA 5HWJA 3DKJA 1UIPA 2ZUMA 2Z1VA 3TCSA 4MJMA 2QJJA 3TQ0A 4K36A 4MWAC 2E3ZA 5U4NA 1I2OA 2EJAA 3BW3A 1XWYA 1LQAA 3W26A 4LC8A 3OVQA 4EAYA 3DFOA 1TR1A 3BANA 1TMHA 3H2MA 2VZOA 5AYXA 4CCEA 1AW5A 4PZVA 1Q6GA 2YFOA 1E4LA 3OZYA 2G5WA 2QUNA 4Q7NA 1FFQA 4GIAA 1H51A 2NWRA 3PNZA 3CJPA 4J4KA 2D3NA 1X38A 2PDFA 4GYJA 3NYZA 1C8QA 3K13A 4IWWA 4GYFA 4CKQA 2C6QA 3O0KA 1SW0A 4AAJA 1GYLA 1SGJA 4Q32A 3ZXWA 3QY6A 3ARZA 5CXPA 4DM2A 1HTIA 1E0WA 1JCJA 3VYLA 4S38A 3HMCA 4LJ3A 4GO9A 2QNEA 2OPJA 4P8XA 3FGCB 1Q13A 4LEFA 3RN6A 3RM4A 1Q5MA 1V3KA 5JVLA 5M5DA 1WP6A 1F07A 2GLKA 3FDKA 3DECA 3FOKA 4UXDA 2MUCA 3R8HA 4WSJA 2WSQA 4HNUA 5FF4A 3PTQA 4WOQA 3BLPX 1SMDA 4AWUA 2ZZ1A 1Q2RA 1KA9F 4GYKA 4EACA 1GW9A 1MUWA 1N82A 3B0YA 1W17A 5DX7A 3ZWTA 3F03K 3U7BA 1EP3A 5DO8A 1THFD 1U33A 2DVUA 3VKCA 4DELA 5IOBA 4GI9A 5IFTA 2QUUA 2OX4A 3FX4A 3VUPA 1C29A 4JN6A 2PU1A 1UD8A 3PNUA 4WEVX 3WK2A 2WOQA 3W37A 1DWIM 4EPBC 1P43A 3GLCA 3RLGA 2P76A 1TJ0A 2CXEA 3WJYA 4O13A 1TVNA 4B5XA 5BU6A 4IXHA 2DJLA 4J3WA 3OZPA 2XINA 4W7UA 3PZTA 3EEGA 4O0QA 1DWGM 2VWTA 3BAXA 4XISA 3APYA 4QGCA 1LQ0A 4ZENA 3L23A 5HJLA 1KM0A 1JZ2A 2DSKA 5C6MA 4XAZA 3S5SA 2OQYA 5FJJA 3DFNA 4JIHA 1QK0A 4ASTA 2Q6ZA 3C2RA 4B3KA 2VEIA 3N6JA 2Q3RA 5JU6A 4RNIA 5AHNA 3I6TA 4PMJA 2QYGA 1G67A 5CC6A 3HM7A 4LY4A 3QGVA 4CD8A 5RUBA 3MPGA 2WLYA 1E5NA 3A9IA 4E8GA 3WUBA 1ECEA 3G1DA 5G2HA 1DJHA 4GG9A 3ZLFA 1QPQA 1AK5A 1CB2A 3HQ1A 2ZYFA 1S3HA 5AHFA 5FF3A 1JGIA 1G0CA 2CHNA 3PWGA 1JF6A 2FTPA 2E9MA 5EA9A 4PMXA 5LNSA 4GI8A 5T9CE 4PN2A 3NO3A 5FOOA 4NZCA 1A0DA 4KCWA 3LLDA 3RITA 1FWJC 5H8PA 1DWFM 4DUWA 1XSKA 3RX4A 2DY3A 3BLIA 4Q8NA 3L4WA 2V5JA 3TIMA 2WCGA 3G1AA 2FZMA 2H3DA 4JIEA 5C9ZA 1FWCC 4J9JA 3GIYA 3ES8A 1OFPA 3HG4A 1F4AA 1M41A 1G4TA 1KRAC 3PPGA 1Y5VA 6ENLA 1QVBA 3SIZA 1FVPA 3CUJA 1JPHA 3RX2A 3I3EA 4M0XA 1GOIA 1NFPA 4ALDA 3T6CA 1XYMA 1R3QA 2BY0A 3W75A 3HV8A 2CHRA 3WK1A 3F1QA 5FL0A 1YKWA 3VOHA 2FHCA 2A6LA 1WDPA 2YOCA 4WR3A 1U1JA 3HN3A 4I8DA 5BXPA 1OY0A 4K8GA 4UOQA 2V5LA 4JHZA 1W91A 4QLLA 5HUOA 2BB0A 5FA5A 3VMPA 3M46A 1J18A 1YPFA 4Y6GA 1VCGA 4HVXA 3TSBA 1A80A 3C2OA 5FCZA 2HWGA 4W89A 3VCCA 3A3HA 1W1YA 2SFPA 2QDEA 5E6YA 3RU8X 3TNBA 3N9RA 6PTDA 2ZTJA 4YL2A 1YBQB 3POCA 4D9PA 2DH3A 3GFZA 2PDNA 4ATDA 3OW1A 4LVGA 5JH2A 1E3ZA 3MSYA 2PGWA 3WQCA 3DFPA 1FWFC 3NZGA 1V6XA 4LRTA 1R3RA 4ZR8A 2YCLB 2UY5A 4BWLA 2IUZA 1RVGA 1UR4A 3KOYA 3CWOX 4OFCA 3GHSA 1H0GA 3H7RA 4QROA 1VAHA 1QW9A 3FN9A 3RPTA 4NXSA 3HU7A 3S5YA 3CH0A 3KFTA 4C5YA 2BWGA 2WZMA 1EJUC 2XVKA 2FH8A 4KBXA 4E8DA 3OGVA 2Z7GA 5A2AA 1T99A 4UUIA 3GC5A 1M03A 3TE9A 4GUFA 3BZJA 5HPOA 4MWAB 1S38A 4I7VA 5H8UA 1VHNA 1POKA 2NSXA 3ITGA 1JL8A 1XSJA 5FSDC 2DVXA 3MU7A 3LM3A 1A5OC 3WK3A 3QHOA 4QAIA 1NF0A 2DT0A 1TJPA 3R13A 3T4WA 3I68A 4URIA 4Z2KA 1OX4B 2XN0A 2VR4A 2D3LA 3PPHA 1XYBA 3ARYA 3MSRA 1TQJA 3BLLA 1CXFA 4NZ5A 3U2CA 1QPRA 1XPGA 4J3SA 3QYSA 3TR2A 1MFUA 4V33A 2OODA 1H63A 3V7PA 1NJJA 2H9AB 3KHDA 4Q6JA 2ISSA 4HMCA 2Y8UA 2YXXA 1R30A 3II1A 1CWYA 3SGUA 3L4TA 1V51A 1TA3A 3R8GA 2QPXA 4RW3A 4C7DA 3H12A 1YTKA 3GG7A 3ZMRA 2XYLA 1E0XA 2VFDA 1L6SA 1RR2A 3MO4A 2C1IA 3QMTA 3L0NA 1BYBA 3HPFA 3VDCA 1ZU8A 2Y24A 1N8FA 1T0OA 4O8AA 3SCRA 3R79A 2W61A 1EWEA 3UWQA 1QAPA 5AYYA 1A5CA 1ODUA 3LQGA 4C6IA 4AHOA 4GJIA 2Y5JA 1HJSA 1L2QA 1P0EA 2FJUB 4A3QA 4RE3A 5DY2A 5K9CA 3DC0A 3WLMA 2E7FA 1JPDX 3CUHA 1QUMA 1E5JA 4UFKA 2XN2A 2FH6A 1KBKA 2YR1A 3HG3A 4CVUA 1EUNA 4G7EA 5D04C 4OT7A 3MS8A 4Y9PA 4A22A 4QBXA 5GNXA 3AC0A 1UZDA 3BSGA 2DZXA 3A12A 3R6IA 4I8YA 1Q6FA 3N1AA 4YHGA 1O12A 2X0SA 4LAKA 1PIFA 2FB3A 1Z44A 1S5NA 3G18A 1K8XA 3R0UA 3A3WA 3CM4A 1XXXA 2WNZA 4YTRA 1AQHA 1AA1B 3FS2A 2V81A 2YCIX 4JYFA 3ANYA 2O4MA 1EUAA 4L80A 4HMEA 2PRLA 2ZADA 2JKPA 3TN3A 4AB4A 5DT5A 2D0HA 1M53A 4D8ZA 5BOEA 1J10A 3I3DA 3P3BA 2FGZA 3USBA 2FZ9A 2DFAA 1XIBA 4CQBA 4XBSA 3VDHA 3VILA 4MB3A 2PDQA 1TZZA 3DENA 4F0RA 3WF3A 1VPQA 5DBTA 2J47A 3AZSA 5B80A 4J3XA 3W1NA 3GS6A 3H6OA 4ADTA 4YVPA 4GY1A 4E38A 2O9RA 3ZJ6A 5CG7A 5KEZA 1KM4A 2QPSA 3GK0A 3G0XA 5CPNA 1Y5WA 4N6FA 3O07A 2CITA 4EPKA 3VPLA 3WH5A 2VGFA 3ECQA 2YGYA 1J93A 1OF6A 1PKLA 2A79A 2RDWA 2BGQA 3L9CA 1D2KA 3UWYA 1J0YA 1H49A 3HB9A 3PR2A 3TKFA 3UZXA 4IPPA 3WX7A 4PTNA 1UKQA 5C9UA 5H1WA 2VRKA 4IX2A 4WRHA 1TX0A 3BV7A 2UY2A 1HQTA 2QKFA 2F84A 2ZX5A 1V3MA 1DIDA 1JZ8A 3CXOA 5AB3A 3SUSA 4GVHA 4E2DA 4IIFA 5AKQA 1ZALA 3G1VA 4UZUA 5EMLA 4IP5A 2HTMA 3OHMB 1US2A 4QG9A 4RL3A 3MB9A 3ZSSA 3AOFA 3N4FA 4D2JA 3F2BA 4AHQA 1TWDA 3WNPA 3GVRA 4B4HA 2PWHA 1YX1A 1E6QM 2V9DA 1JUBA 4HA0A 2OTDA 4DYJA 5TBOA 2G50A 3ICJA 4R34A 3BG3A 3TYDA 3EAUA 3ZR5A 3DIPA 5MKGB 5KSWA 3BSMA 5EY5A 3UVIA 4MF4A 3MZNA 3DYPA 3WDIA 5ABGA 3T8QA 5H2ZA 4H04A 3GH4A 4AH7A 1XHGA 3WJXA 1TYGA 1XLBA 3PFMA 2C15A 5AN7A 4LWWA 2UY3A 1S2TA 5E93A 1X6LA 2RGMA 1KW1A 1BXCA 3L12A 3UGVA 1OINA 2NQJA 4B3ZA 3W7GA 2WZEA 3HOJA 4XO7A 1QCWA 3W6MA 4US5A 3N13A 1CGWA 1LYXA 4WY0A 4IMEA 1ITXA 2QIWA 1QNRA 4BQ4A 1SZNA 2QW5A 1KR0A 3TW9A 2CKRA 1XIMA 4N2YA 4NXKA 3WDRA 1SFSA 1EIBA 2CZEA 1VPXA 3EOUA 4H2HA 1GONA 3MUAA 2VURA 4V27A 3RLVA 1UD3A 2QCEA 3FAXA 1JQXA 4CD6A 3VNIA 3CU2A 3SY8A 4RV3A 4ERAA 2NQ5A 3BGJA 4LSBA 1GVIA 2ASHA 1GQNA 1P6WA 1Z48A 4LVBA 4HPXA 3QPZA 3ZFHA 1GNXA 5I79A 4N42A 9XIMA 4HPHA 1QRQA 1EXBA 5FJPA 2Y89A 1B9ZA 4A8LA 2Z7KA 1UD4A 1FHDA 4XZNX 3L65A 1UUOA 2BOEX 1WXYA 1XLEA 2Z24A 3VK5A 3MI3A 1G1YA 4PMOA 4ORIA 2REQB 1FFRA 4RUBA 4LY8A 5CPQA 1E6RA 2DV0A 3VGBA 5KZMA 5HOSA 1OGBA 2OQHA 3BPWA 3LPFA 3SEPA 4AMCA 4HNOA 4AZCB 1TFVA 4WKHA 3QTPA 4WY0F 3N3MA 1BYCA 3KVLA 1E1CA 3SCTA 1A47A 4IX0A 2GUUA 4LV4A 3F4WA 3Q58A 3CHCA 2C71A 1RY0A 3ITCA 3TN6A 4C6MA 3DZ1A 3M0LA 2G96A 4NKCA 3W1TA 1WAWA 3OLIA 4ENLA 4LS1A 3VIGA 1I8JA 1ICQA 1OBAA 2QV4A 3M5YA 2VZSA 4MB1A 3C8NA 3BJSA 4HNLA 3GDRA 1FY6A 5I03A 4CNUA 4E4UA 3E02A 4EIVA 3B9EA 1PUDA 3UR8A 4PUKA 2IPGA 4IFRA 3IJQA 1S46A 3B0UX 4UR7A 1PDZA 2D20A 3C2VA 4Z2LA 5MKGA 2NUYA 2W63A 2YB4A 3IK2A 3LSCA 4XZWA 4MNMA 4MG4A 3LV5A 4O28A 3WLOA 1L8PA 4YVVA 4ZQNA 3W72A 1LP6A 4OUEA 2CEQA 4G56A 5D2YA 3S1VA 2OXNA 2FGBA 3G2GA 1JJKA 1DQUA 1K7FA 4N4QA 2OU4A 1D8CA 4IPIA 1W3NA 4KQNA 4EAMA 3TYCA 3P8JA 4NL1A 2X05A 1ICSA 3WEMA 1EJSC 2BS9A 3T78A 1I2QA 4U31A 3VOFA 1ONRA 3CTTA 1KM2A 1V3HA 1TKKA 3WQ5A 4DBEA 5BMXA 2V5DA 4PSRA 1HKWA 1ZP3A 2C79A 2P50A 1B5TA 4JTHA 3PZMA 1G4PA 4EKJA 4C7FA 3FYYA 1IT0A 5G1MA 5CPTA 1W8GA 1KRMA 5CC7A 1H1YA 1TJ2A 4WOZA 3ITLA 1C93A 2O56A 3P80A 1CLVA 3EGJA 2DSUA 3G5EA 5KMYA 2ZZ3A 4FX8A 4R33A 4H9MA 4GK8A 3PM6A 1R3YA 1E4IA 2Q8XA 4LCRA 4KT2A 1FXPA 4QLKA 1B57A 1JCLA 1SMAA 2E9BA 3KS6A 1AL8A 7TIMA 3VNZA 4IIDA 1LRNA 4N9DA 5LYRA 2DIJA 3I65A 5GJNA 4ATLA 2GOKA 1X6UA 1KFJA 4EK7A 4PUNA 2HDJA 3N73A 1OYCA 1E9ZB 1E1FA 3BOFA 1E9YB 1UMYA 3NYDA 1NAL1 5HWMA 2WHKA 4JTFA 5D9NA 4AG0A 4US6A 3ZVHA 4MLRA 4CU7A 2PBOA 2B0MA 1SJBA 3U5YA 4AZCA 2NLYA 1LBFA 1XIEA 3POHA 4XAFA 3GTIA 3GUWA 5A6MA 4W5UA 4NZ1A 4DJFA 4W8AA 4HN4A 2A7RA 1QNOA 3IS4A 2ZUUA 2ZE3A 1MNZA 3IANA 2JK2A 1ITUA 3BW4A 4Y9MA 3M64A 4NASA 3TMLA 5PTDA 1ZSXA 2XJ7A 3KBNA 4GFIA 3NSXA 4FLOA 1QTWA 3TK7A 1GOWA 1WZLA 3G8EA 4CNOA 3L0GA 4LVDA 1FWRA 1R7OA 5M03A 1GG0A 5I3KA 3H7VA 1OFOA 2C13A 3ITVA 1W1VA 3GYCA 4LBUA 4DF0A 1XDLA 3FCPA 4JDYA 1EYEA 1WDQA 1JNDA 1SZFA 3A3XA 2NSOA 2XFYA 4JKKA 4ERIA 1GQKA 3MWAA 3BAIA 4XTDA 4CD4A 3MBDA 4UQDA 4OVXA 4LCSA 1ZY9A 2Z28A 2X1TA 1J0ZA 4JKMA 1SJAA 1M7OA 1V0MA 1UR8A 3CYVA 2CLIA 5HMSA 3AS0A 3GR7A 4OKDA 4Q8UA 1V02E 3AI0A 3GW0A 4O54A 3QSTA 1V93A 1ELSA 4NI3A 3KTCA 1CXLA 1PX4A 1B31A 3AWOA 3D6NA 3MC5A 4LF1A 1KM5A 5A2BA 4JY9A 2Y7DA 3CIXA 1PE1A 1BSLA 3AYVA 4LUSA 3DYMA 2PAJA 4PB3A 1YPIA 1P4CA 3T42A 3AXKA 1DBTA 4ZE4A 4GUHA 1YLVA 4V15A 4NX0A 1QI3A 4BS0A 1M6JA 4AIUA 2Z2BA 3G1YA 5ABEA 1WZAA 1G7VA 2JGYA 1PZ1A 4MPQA 3EKZA 4ZXOA 4FMVA 3B06A 3WQ8A 2D2OA 4BQ5A 4Z2IA 4Y8EA 5FJUA 1FH9A 2WHJA 3CC1A 3OA5A 1HN1A 2G41A 4Z1CA 1W5NA 3W7KA 3KVKA 4YNGA 2DW6A 3H2AA 1MZRA 1QWGA 1WDDA 2B7QA 3KBWA 4PODA 1GQLA 2PLJA 1EP1A 3APTA 2FVMA 2WZHA 1UC5A 1L6FA 1FBAA 2VEKA 3MVTA 5A8MA 4O18A 1P0DA 1WZKA 3BJTA 1X98A 4PBGA 4XG1A 3PZQA 1PL9A 2O9TA 3VM5A 5BCAA 1XUZA 1VHCA 3ARRA 3U57A 2FMNA 3K2GA 1FH7A 4KRTA 4ZO8A 3OA3A 4C90A 2G3JA 3EB4A 4O16A 1JD7A 3M4HA 4F79A 4Z2JA 3NQMA 1XC6A 3A23A 4PYSA 3RCNA 2VX5A 4PGLA 1ZAJA 1GHSA 4J35A 1W1IE 3SM0A 4CUCA 5KITA 1G4SA 3EMCA 4FOUA 3MUIA 4Z0JA 4DJFD 3H2FA 2XH2A 2DQXA 2WVSA 4HYWA 4Z08A 4AEOA 1H62A 4AMAA 4B5VA 1NQKA 4H7ZA 4YYCA 2GWNA 4H9VA 4O14A 2G97A 1OHLA 1K6AA 1BHGA 4GJ1A 1L6YA 5LA2A 2D23A 4JEJA 4H8VA 3XIMA 2BHUA 3G0SA 2QF7A 3ONCA 3MBFA 1KGWA 5ABFB 4QS5A 1O68A 3G22A 3THAA 2QJHA 4ZZ9A 3U48A 2IXVA 2KZHA 1XICA 2J9YA 2WKJA 2PRMA 2YA1A 1DKWA 4NNAA 4IFOA 2EPLX 2QT3A 2E5DA 3QSRA 1BXBA 2NXIA 3SY5A 4E4PA 1KTNA 1HFBA 4CQCA 2VT0A 5A6KA 2ZOXA 3WLQA 1ME9A 1Q8AA 4JFTA 3L4UA 2ALRA 2WMJA 3TROA 1FHUA 2DW7A 1ZJBA 2EEXA 2TYSA 1FCBA 1TE1A 4JTCA 3ZVIA 1AFSA 4OIFA 4AZBA 3W25A 3GHUA 5KZDA 3P8IA 1GWJA 4E8CA 4DYKA 4MM1A 3GX9A 5FEWA 3ARVA 3CPGA 1BEUA 1FHVA 4PUWA 3M0IA 3GYEA 1Z9AA 2J7EA 1KCKA 4IH3A 3EX4A 2IKHA 3A5FA 1KCZA 4LV9A 2PGFA 4KETA 3UJFA 3WFZA 4WKFA 1K77A 1GOOA 3U3HA 5E9XA 4MWAE 3DFQA 2HXUA 1JDAA 3PHAA 5EKYA 5G2IA 1RCXB 3LU2A 2BBFA 4E6MA 3IRDA 4NZ3A 3PB0A 2GVGA 1P7TA 1VFHA 2Q8ZA 2G37A 4DNHA 3TONA 2BFGA 1S2WA 1XRVA 5LIKX 1PZ2A 4R7JA 2ZFAA 2WLZA 4C60A 1VYPX 1A5MC 1UJQA 3W7QA 1I2NA 1M9HA 1E4NA 1L9WA 1X7FA 3KDOA 2YBVA 1P0KA 3GR8A 2EKGA 1EF2A 3WF0A 4ZQRA 4S3KA 4WSHA 2QCMA 4AEFA 3DHFA 2E77A 2ZVIA 3BICA 3RJYA 1ZCOA 4X63A 4H9ZA 3KBMA 1ISWA 1JVNA 3O63A 4S23A 4KEUA 3UETA 3M6DA 4DO6A 2ZRWA 4XAPA 4UTWC 2V5CA 4G1NA 1VP5A 4CVWA 4LYPA 4Q4KA 7ODCA 3N6HA 4U3AA 1CGUA 3E5BA 4DPQA 1WQ5A 4UFLA 4V28A 3WLHA 2CPUA 3ANUA 4OJYA 1MEIA 1PHQA 4JQAA 1VEPA 1DIKA 4MY8A 4H6RA 4MZYA 1ZPTA 1PTGA 4NZ4A 1CGXA 1YRRA 2ZRYA 4XAYA 3QTGA 5AC5A 1VJZA 1FDZA 3AYRA 1OT2A 1C7SA 1G5AA 3WD1A 2WVUA 3SZ8A 1E40A 3W2JA 4JQ1A 4NU7A 1G69A 2HRWA 3TUUA 1WKYA 1C92A 3FW6A 1V08A 3IIZA 1KR1A 1XM3A 3VOCA 3BSHA 4PSPA 3WH9A 3W76A 1UKOA 1KC7A 1CPUA 1W5MA 3F7JA 2NUXA 1F8MA 3NL5A 4M19A 4RLIA 3B0XA 4OBSA 1DWHM 5A8PA 1EO5A 3LCWA 2Z6JA 5DQPA 3KBJA 2DSZA 4RJEA 2Y7EA 2R9RA 4MFEA 3K4DA 1XRSA 1JZ6A 4L6DA 4LS2A 4IP4A 2E28A 3EWBX 4KWOA 4P7OA 3RX3A 3UWZA 1TVLA 1TPVA 3LX9A 5E0FA 3E0WA 2OWCA 4TQTA 2NQZA 4AC1X 4YTUA 1QPNA 4RDZA 1NWSA 1WXZA 4HD5A 5CPMA 5M2FX 5BXSA 1RLDA 3C0LA 3DFHA 3ZJKA 3GIQA 4EANA 4M5PA 4L9ZA 1QATA 3U9IA 2CLLA 1EDTA 1MRQA 2QDHA 2WMFA 1LBMA 3Q45A 1S5VA 1Q7ZA 1FKWA 2IQDA 2R91A 3LD5A 4Q8PA 1NELA 3PZNA 3W0KA 4WHBA 3FXGA 1XQKA 4ZODA 1W3IA 3WD2A 5J8LA 1H4PA 2GGHA 4J27A 2Z2AA 1SW7A 3TOPA 4IIEA 4HA4A 4LUIA 3O8AA 5T8GA 2ATMA 3SURA 4HCDA 1XLFA 1ZB5A 2G3MA 3E2VA 1D7FA 4PL1A 1N7KA 2EXOA 1RK6A 1NOWA 3ERPA 1TPH1 1RBAA 3IJ7A 1AMYA 4S3FA 2G0WA 4MYXA 3HFTA 2WSYA 2IMRA 4F2BA 4NYUA 5GNYA 4DO5A 4I9TA 3KM8A 4EF8A 2OGJA 3FA4A 3W7EA 1PSCA 1M5WA 4LAUA 1KD0A 4B9ZA 1CX9A 5HDRA 1X1OA 3HBLA 1BSIA 2WBGA 4N7QA 1K9FA 3QLDA 1IR1A 4Z0SA 3VKBA 5FJIA 3CYJA 2QGHA 3CQHA 3PBWA 1RQBA 4FSAA 3BG9A 4GZIA 3LQLA 1UWRA 5ABHA 2F2KA 1NOFA 3S4TA 3NCOA 4NILA 4I7WA 4LEQA 4GGBA 2PDYA 4O52A 3KP1A 3SCWA 4ZQOA 5BZAA 4DZ5A 2BGSA 1F76A 2ZDSA 4REQB 2WANA 1VJIA 3APGA 3TQVA 3MP5A 4XD3A 3IAPA 2J7HA 4F0SA 2D0FA 4LANA 4KWUA 3ARQA 1VFLA 1EFZA 1JG9A 4QSFA 2YDAA 2VENA 5JH1A 5C7VA 4YTQA 2YIHA 2PODA 3PZOA 3NWRA 1KBLA 1R2RA 4LALA 3W24A 3N6QA 3UXAA 4MB5A 1F6PA 4GZ7A 3DGBA 2D24A 2H3BA 2QV5A 4C6KA 5I06A 3EWCA 4E4FA 3L67A 4K1WA 4L7ZA 4BJHA 3IACA 2GDVA 2CCRA 4HIBA 4R9XA 3ZR4A 1UQZA 1VBGA 1J0IA 4JYEA 5LHFA 1V6VA 5CZTA 3S2CA 3NTYA 3TAOA 4HK7A 3A4AA 1HKIA 1XGEA 2QMJA 4XX6A 3PZIA 2RFGA 5GJPA 2EJ1A 1VRXA 5DCDA 3Q2DA 2ZRZA 4LNYA 3EKGA 5DRIA 2XSBA 1Z3NA 2J7CA 3NXFA 3E96A 1NDVA 3AIUA 3VIOA 3WMCA 2WNQA 2PGEA 1UCWA 3LEPA 8CGTA 2FZDA 1GEQA 1XV8A 2W6RA 4X2PA 3MV11 3P67A 2A5HA 2C0AA 4UNKA 1W2PA 4QE5A 1DOSA 1XW8A 1Z6KA 1H60A 1EJXC 2Z25A 1EOKA 1Z7AA 1AH4A 1O1HA 1WV2A 2G4FA 3NZRA 3GXFA 1U5JA 3M7SA 3ONBA 3GXTA 3B03A 2QF8A 3KCLA 3DN5A 2I57A 1FWIC 4U4MA 2I9EA 2UWFA 1GVRA 4JIIX 4BF9A 2YW3A 5EMUA 1NDWA 2Z6IA 3PN8A 3CV7A 1J11A 3MP3A 4LTSA 1OYBA 4TV5A 3OGRA 3PTDA 3KWXA 1JYVA 1RP8A 2R8WA 4H83A 3IUHA 4RE0A 1GKQA 2VRJA 4JN8A 4HZ6A 1XQLA 3CAWA 3W1XA 4IFKB 3CO4A 1T96A 4I5RA 4UMAA 1TRDA 2P10A 1VEOA 1IWPA 1EO7A 1UJPA 1TWZA 4PB5A 3AHVA 3QR1A 1O94A 2R1LA 2CLHA 2GL5A 2DORA 3DCPA 4QE1A 4GVGA 5C71A 3L5MA 1EGVA 2B7PA 1AH0A 3EOEA 3OU8A 3UYCA 3CV6A 2Z1WA 3W81A 2WQDA 1NH6A 3NQ7A 5AYBA 4DY1A 1EBGA 1AL7A 1RA5A 4F48A 2X0HA 5D32A 3PBMA 2BSLA 7CGTA 2I5QA 2H8XA 3C52A 3CL8A 2O7SA 3BVJA 3LNMA 3B8DA 3EOOA 2QCNA 4NAFB 4D6GA 3ABSA 3A4JA 1MW3A 3TOYA 2RH9A 3URAA 2FDMA 2DZTA 4HNCA 1LWJA 4TO8A 4D6FA 1W3TA 3TMQA 3J7HA 4ADUA 3U2ZA 2JGQA 2A7PA 4MDPA 1OVDA 4MTVA 4W84A 1P1XA 3MUXA 3CZKA 4HHPA 4JTJA 3NQVA 4ONVA 1XYZA 3NM3A 3RCMA 4AZ5A 8XIAA 4FK9A 1IV8A 3TA9A 4YWSA 2WWDA 3ID7A 4H41A 3UBPC 3VI2A 4ERGA 2OLSA 1V6YA 3G8RA 1F7BA 4HK5A 1UR3M 3NDOA 3OQEA 4F9JA 4IUGA 4F0LA 1TZ9A 3EA1A 3OVRA 1E55A 3U7VA 4JNMA 2NV9A 4POCA 4QG6A 2H90A 4V1YA 1S2AA 5I5RA 4QE4A 4L1XA 4K7VA 1XL9A 3TDFA 3VXGA 2HVNA 3PJTA 3MDWA 4LXFA 1P0BA 2PDIA 2CETA 1EC8A 1UHVA 5D2XA 4GE8A 1QW7A 1MNSA 1R9XA 1UMLA 3NOEA 1SSDA 3UG8A 3ARWA 4J3UA 1R87A 4S3AA 2V3EA 2IPFA 2CKSA 1EOMA 1JXKA 5E70A 5A6SA 3HGJA 5I3GA 3H7UA 2HS8A 3W2MA 3CB3A 2E6YA 2ADAA 3VC5A 1IF2A 1QHOA 4IM4A 3DFSA 1ODZA 3GHRA 5AZ1A 2A85A 1XLAA 1Q45A 5CPLA 1VFOA 4PULA 2I1OA 2PGRA 4GNKB 4X9YA 4B5NA 1REQB 5HBFA 4NNBA 1ONWA 4PUDA 1WOAA 3NA8A 3F4CA 3I6RA 3O15A 4G7FA 3D0CA 2QUVA 2HNEA 2WB5A 4JAWA 3I3BA 4DXKA 4JX4A 4YPJA 3ZLGA 2GJPA 1S5MA 4L64A 4HN8A 4GJJA 2CBUA 5BROA 3W87A 3N2MA 4L1GA 4E2BA 1F6KA 4AD4A 1Z89A 4G6CA 3ALFA 2BLEA 1ISYA 2P0OA 2PZNA 1O1ZA 1EEPA 3N2TA 2Y4SA 4QAWA 3RLHA 4HOWA 4QCEA 3RGTA 1Y0EA 2Z26A 5LNUA 2E9LA 2YXGA 5F2MA 4CN1A 3LUTA 1EGZA 4C91A 4FO4A 1X96A 2OEJA 5CSYA 3KL5A 3VIJA 3PG8A 3PANA 3HQPA 3QV8A 4HZMA 2FIQA 1BAGA 1VBHA 4ZFMA 4PCFA 1KXQA 3VO0A 2VJXA 3SUUA 1JAKA 1LLZA 3TH6A 1J2WA 3LTYA 4ROQA 3M0ZA 2HQAA 1EHNA 1WA3A 1BLIA 1DYSA 4L9XA 3IJ8A 2OLAA 3QW3A 2B7OA 2YA0A 2ZX8A 1QOPA 3ZZ1A 3NR0A 1OK6A 2XDFA 2OO0A 3U5UA 2FFIA 1Q7MA 3WD0A 3GNOA 1W56A 3MQTA 5G4WA 2TMDA 1LUCB 1KXVA 3UY8A 3GU9A 2NW0A 4Q8QA 4CNSA 4IUOA 3ITYA 4ZCWA 1OFEA 2YL6A 2XZ7A 3UG3A 1JUKA 3P60A 4UMCA 4AZIA 1A3HA 1X1ZA 3KTXA 3VGDA 4JS3A 5ECVA 1XI3A 5FI8A 4C1NA 2AQVA 3NEHA 1H41A 6REQB 5EYWA 3NL3A 4QXIA 5REQA 4X22A 5LKYA 3EX6A 3TLQA 4GQBA 3B8SA 3GVQA 4IF2A 4EPEC 2YX0A 5A94A 4H3DA 3IJDA 2I5IA 3THCA 3R2GA 4JL2A 1PXGA 1QI0A 1XKYA 3T8LA 1NP2A 2FZBA 4FNPA 2QCCA 2Y8KA 2RAGA 5LIXX 2ACQA 3R94A 5AC7A 3VOIA 2EQDA 4GVIA 4AWTA 4KWSA 1HO4A 2HXTA 4NVTA 4WF7A 4W7VA 4PTDA 1BVNP 2A4AA 4DVOA 4M51A 5BXTA 3MI2A 3KDNA 4H7CA 1NP0A 2BNJA 1ENUA 2UBPC 4GD0A 1JEZA 4E2OA 3BMXA 7REQA 1UR9A 1A50A 2TODA 1XBXA 1DTNA 3W6LA 4AFYA 4UIOA 3L4YA 3SRFA 3UNTA 2HE8A 1RPKA 3NFUA 1VGAA 1YXYA 2YL8A 1O7AA 4CCZA 2ACUA 2QAFA 3REQB 1PZ0A 4DBUA 1DJNA 4GIYA 3JUGA 4WUIA 1BPLB 1S5WA 1GQJA 3CB8A 3T0AA 5I00A 1W0MA 2DU2A 3WBXA 3MUCA 1X7IA 3EWWA 4HPJA 3PZVA 1JFXA 2PDJA 4YN5A 4ZQPA 3IJIA 3EZ4A 2AQWA 1AD1A 3A64A 3FK4A 3V0SA 3VD5A 2PDWA 2WZTA 2BVTA 3N9KA 3WQ6A 1RY8A 2UZ9A 1S1RA 2INEA 4GA8A 3CUZA 5EPDA 1I60A 2VC7A 1Q85A 4IHCA 2P5NA 3IK4A 4IJBA 3LYEA 1UB3A 1F6YA 1TV8A 4NRSA 4J2PA 1SJCA 3LHUA 4DPPA 1UASA 3N14A 1Y65A 4KFOA 3V36A 1TV2A 1GVSA 4XZBA 4QP0A 2DUZA 3D46A 1D3HA 4L4LA 4MZ1A 4KEMA 4B3LA 4AD1A 4QDMA 2VFHA 4IMCA 1C9DA 2E8ZA 2ZA2A 3T2QA 1WAUA 2J74A 2TSYA 3WH6A 3KOXA 1GCYA 2ESCA 4C5ZA 3N4EA 4JIPA 1U30A 1KRCC 4MJ2A 1J9YA 2VD8A 1CGYA 3BARA 1J0JA 2Z0IA 4BEQA 3SRKA 4AUBA 1FWTA 4QSHA 3UT0A 1VYRA 2PB1A 1HJVA 3M0XA 3S9ZA 1MI3A 3DX5A 2CLOA 4RNFA 2BXVA 2OEMA 3OP2A 3WNMA 3V35A 3AHZA 1TELA 5I07A 3GIPA 2Y63A 4HMDA 4WX2A 3GXMA 3ARXA 3LGEA 3G3DA 4IQDA 4PMRA 3BUVA 4D72A 3STGA 4GABA 5DMNA 3W2KA 3QPYA 4UR8A 3A4XA 2OYLA 3C86A 2EPKX 4KWVA 4RZ6A 2VELA 3CEPA 1K8ZA 1JYXA 4AX7A 5D09A 3GVVA 3T0BA 1WKFA 5DBUA 1K7EA 1OCJA 2PC8A 3MSDA 1FCUA 3FJLA 4IGNA 3GXIA 1OJXA 4H6KA 2CLMA 5EBUA 3THUA 2FVLA 3CK5A 1AODA 3PK7A 1P1MA 3FA3A 5AECA 4JCMA 4TV6A 4WIWA 4QDPA 4C6CA 3HFYA 4UTJA 1VR6A 2PDHA 3CMFA 3OIHA 4GWEA 1KXTA 3K8MA 2QJMA 2NUWA 4UCFA 4EXBA 3NVTA 4DLMA 4U3CA 2Y7FA 4R3UA 4LUTB 1NWTA 3BLOA 1EP2A 1UWQA 1Z32X 3IPWA 1VC4A 3GW3A 4Z1YA 3D3AA 1LRQA 1UG6A 4HPNA 1JR1A 3G1HA 2A7NA 4IG2B 2ONEA 1O95A 1KV8A 5CLTA 3REQA 1QOQA 1CECA 3WLNA 2TAAA 2WV8A 1E1EA 4JIRA 2WJEA 1OG6A 3W73A 4ZB0A 3JZUA 3LZ3A 3LHZA 1XBZA 3OLEA 4JDBA 1XLGA 1BG4A 3M41A 1BVWA 4E0CA 2GK1A 4QHRA 4GC4A 1HKMA 5DXXA 4QNWA 3WLIA 1E6XM 2I17A 3EXRA 4GISA 1RJPA 1XIIA 4C65A 1PV8A 3SCNA 3W82A 1X97A 4M56A 2AKMA 2OT1A 4RPPA 3CS2A 3EB3A 1TPB1 3ES7A 1XYFA 1KNWA 1W1PA 3UPMA 3LK6A 1TV3A 4IQEA 4XD5A 3MUZ1 2GFTA 1WNOA 5CH9A 3GNXA 5GJMA 3G77A 3NQCA 2Z4GA 3STFA 3A22A 4AXKA 2O92A 3NDZA 3W1AA 3HGSA 4GACA 2PS2A 4N9CA 4NJJA 3AJ7A 3S2LA 1AW1A 2XGIA 3VNLA 3W53A 4FNSA 4PUMA 4R53A 1MO0A 2WVVB 3ZIZA 2OSWA 3ZJ8A 1IXNA 4YXGA 2VX4A 1E6SM 2YZ5A 3S1GA 2V2HA 4WSKA 3GC2A 3CNYA 4FOKA 3ZWSA 4ORMA 4QIUA 3UJEA 1CDGA 3DI0A 1B3VA 3WQ4A 3VUSA 3PUOA 1KWGA 3UY7A 1ZBKA 4OWGA 1DWJM 3V5OA 4UTKA 4AF0B 2PU0A 1GTEA 1A3XA 1HKJA 2Z1XA 3UXIA 1QT1A 2QUTA 7XIMA 2DZVA 1B3OA 4HJFA 1BVZA 4R5EA 1SFTA 3IARA 1ZLPA 2R1NA 3SN0A 1DJQA 5LA0A 3ZO9A 2BOFX 1NTHA 3WF4A 4FEZA 5F7UA 1JPMA 4YTSA 2ZA1A 2DZSA 3AS3A 3B8UA 1NQ6A 1RZMA 2VM8A 4LUJA 1BRLB 4UTTA 3KLLA 1DIEA 1OADA 5F2IA 1E0TA 3H23A 4O15A 1FWEC 1DV7A 4OTKA 3WD4A 5ECUA 4U5KA 1TG7A 2J77A 4FNUA 1OB0A 4LUTA 3LPPA 1I2RA 3H55A 3T0DA 4XKYA 3PUDA 2PD9A 1WKEA 4A3YA 7A3HA 3TC3A 2ZC1A 3L2IA 2XGBA 4CQDA 2XG9A 1K9TA 3W28A 3CV2A 2INZA 4H1ZA 2NZLA 3LENA 3H2EA 3ZS4A 1XYAA 1AQMA 1SFJA 1WPCA 3B9AA 4I9JA 4MJZA 3WN6A 1D8WA 4DJEA 2J6VA 4NY2A 3EB2A 3M1ZA 3RIKA 2Y70A 3WLJA 1UZ1A 2NX9A 2W92A 3OZMA 4MKNA 1XIFA 4IICA 3TXVA 2YDRA 1A5BA 4LS0A 5G4EA 2DIEA 4DJDA 1XS2A 4K3ZA 5LXEA 2WAGA 3IUIA 1GTHA 2HS6A 3E1F1 5H91A 4DZHA 2XN1A 1IXPA 3NL6A 1J4EA 2VQTA 1W6TA 3TJ4A 1CXIA 1DJWA 4JN7A 4S3BA 3E0FA 2X30A 3P93A 2WWCA 5HULA 4QJ1A 4XVDA 1QJWA 3GHTA 1SM9A 2A0NA 4I90A 3NAVA 1GZJA 3AIRA 3V4BA 3GG8A 4NJKA 3UJSA 2DT3A 1X39A 2CBJA 4NUWA 2ZUWA 2UY4A 1FWGC 2VHLA 2VGGA 1PVNA 4GUGA 2ZRXA 4QQ3A 5TIMA 3Q65A 4WJEA 3N04A 3VX1A 1FH8A 2AOSA 3DC8A 4JTRA 1HNYA 5IHRA 1UPMB 4DB7A 2ZIDA 2VYOA 1R5YA 3SQLA 3N2CA 4AVFA 2VZVA 3WFAA 3RMJA 1A0CA 2WVVA 2PFHA 1N8WA 2ZTKA 1E6ZA 1V0NA 3QLLA 3QM3A 4F2UA 1W37A 4AWEA 2VGBA 3MKKA 2RUSA 3WQWA 5BXRA 1GQIA 2BASA 2I16A 4RZ4A 2EBNA 2Z1SA 3U2OA 1NARA 1TPEA 4PTVA 1PCKA 4JICA 2AGKA 3LMYA 3TWAA 5JBEA 1QXLA 3G24A 5HNTA 4GQGA 1WUEA 3O3RA 1US0A 2C91A 3CPRA 5JIWA 1AJZA 3FYPA 1E6NA 3RU6A 3LN3A 4H7VA 5M1TA 3JZEA 4HB7A 1XD1A 3NO5A 1BKHA 3NQFA 3MJYA 2E5CA 1DE6A 4JTTA 4PRTA 1YIXA 3W01A 4D1JA 2ACSA 1ME7A 5JIPA 4XK2A 3W7JA 3EWZA 3PAOA 2BXZA 2J4GA 2OR2A 3GRIA 2EG7A 1DQXA 4K37A 1E71M 3LCFA 4KERA 1QDSA 2BV9A 4MIMA 1QBBA 5HINA 3M0YA 4GYPC 5IBXC 4Q4QA 3SRHA 2V67A 1EJWC 3WLPA 4X3ZA 2AL2B 4H8UA 2Q09A 4K8HA 3DBPA 3QR3A 1AW2A 4QRNA 1LROA 3XISA 1M7JA 3VKJA 1H1ZA 5AOUA 2GSHA 1XRTA 5D30A 1LZOA 5T91A 2B7NA 2WPBA 2J7FA 2GGJA 2CLFA 2J7GA 5F4XA 2Y2WA 3CUFA 1WDWA 1R3SA 2X1RA 5CJ5A 1V77A 4Q4PA 4EP8C 1YNQA 2O9OA 4UFJA 1WYIA 1H3GA 2ISDA 1CLKA 4BK9A 3F5JA 4FNRA 5DRCA 3RMEA 5E6ZA 1JPIA 2PDBA 3QFWA 1XIHA 2YDQA 4JTDA 3WD3A 5TQLA 3TXZA 1CB7B 4MMWA 2XWEA 4GUIA 5A8QA 5A8NA 4NYYA 4ZOAA 3GFXA 4L6OA 4DJDD 1D3CA 1G4EA 1SPQA 3W70A 1E0VA 4BQ2A 2O55A 1UBPC 1HJUA 4JPGA 4D6JA 3CMGA 2JKEA 4PRWA 4J2MA 3M5VA 4MNKA 3TVAA 1MSSA 3WNLA 5TD4A 5HATA 4RPQA 4GVFA 3WL0A 2WNNA 5SWUA 2CZVA 4BEUA 4XD4A 3BK0A 2YCEA 3B3DA 1UP2A 2J7BA 4IZGA 5XIAA 3ZQ9A 4DWSD 3DOPA 2V0TA 1SU5A 3GSMA 4IJRA 2BG5A 3PY2A 3R1ZA 1W54A 3U2EA 3KLKA 1EGMA 1O5XA 3LTPA 1WUFA 4RDVA 1F61A 1W3JA 5C2CA 4ML4A 3VU2A 4FOJA 2QULA 4Q7IA 1SZRA 3VX0A 1YDNA 1UKSA 4ILSA 1SO3A 1ZCCA 3KXQA 1FOBA 3W7RA 1MVYA 2Y1HA 1UP0A 4QDWA 1JDFA 3AAMA 4M3PA 2JQXA 3LCHA 3SADA 1CT5A 2PCQA 1HKVA 2GGGA 4S3GA 1UW9A 3WYZA 5C5YA 4HK6A 1OZMA 3UVAA 3VM7A 4OBTA 1R7AA 1JRBA 3QY7A 4GOAA 2EO7A 3DFTA 2X41A 3WO8A 3T2OA 4WDWA 3OLGA 3W7PA 3KOWA 3H4WA 4UR9A 1QPOA 2GUYA 4GIRA 1B9BA 2YW4A 2NV1A 4X60A 3AXXA 2O4QA 1RCOB 3BURA 3TQKA 1EX5A 2R14A 1ADSA 1TIWA 3W7DA 3DG6A 1RQEA 4S2BA 4WJXA 3WDQA 3H8AA 4W9TA 1OC6A 3CO8A 3E5PA 1R6WA 1K4GA 2RJGA 1EJRC 1MQPA 4UC5A 4XIAA 2V6AA 4ACZB 3FGCA 1PHWA 3CIVA 4GFSA 4I6VA 2HJPA 3RG6A 4LQ1A 4AD0A 1RJQA 4HJWA 4NJHA 4ZL1A 1YE6A 2W62A 4PEKA 4A2RA 3W07A 3CWNA 4FNQA 1HZYA 3DKLA 3UZ5A 4N4PA 4GCXA 4UTIA 4IL2A 3S47A 1U1HA 3SRDA 4DEFA 3LXAA 3VNJA 1FWDC 4CD5A 3SSZA 3QGAC 2DT1A 1GKPA 4KCTA 5FL1A 3TFXA 2X09A 1B3WA 2GOUA 3WUFA 1H61A 2DPEA 3V16A 1ONEA 3NQGA 4XAGA 1Y5XA 4GQQA 3TTSA 3GUGA 1FWHC 1J6PA 2CIPA 5DCBA 4UMBA 2P3ZA 1IEWA 2V82A 1VH7A 2WC7A 3PSWA 1H7RA 4UOJA 2INFA 3R43A 1GOXA 1ZBWA 5E5CA 2Y7GA 1IGWA 3HGOA 2QIIA 2YA2A 2EKCA 4I5XA 7TAAA 1BTCA 2R1KA 3VZZA 5D4YA 1W8SA 5JQ9A 4GH1A 4RDWA 5HNUA 4QNEA 3M16A 1ML1A 2OEKA 2OWXA 1F5ZA 1A5SA 1H2JA 3VZXA 2OO6A 4AQLA 2E1WA 3OO2A 5JBDA 3V3WA 3WLKX 1VYSX 3QC3A 3W2NA 2E1DA 3JU2A 1EIXA 3MV01 1ZUAX 1TUFA 2AGTA 1JZ4A 5CBIA 4HGXA 1CTNA 2NVDA 3Q94A 4N9EA 3T0TA 2H6RA 4H19A 1YW1A 3NVDA 3DERA 5CBJA 2FTWA 4S1FA 3LCXA 2YJQA 3KHJA 3W7MA 2OZ0A 3NQ2A 4DBDA 4LRSA 1GORA 4ZMGA 4WQ6A 4DIAA 2PDLA 4ZSUA 3GNDA 5L9FA 4ICMA 3F5LA 1RVKA 5BW6A 1KCXA 2VGIA 1ISZA 1HW6A 4LB3A 3BE7A 1OEPA 3QBUA 3HGRA 4JX5A 4QG8A 3KCJA 1HP5A 1QR7A 1S2UA 3UR2A 4Z1AA 4TVCA 2VZTA 2XIJA 3PZ9A 4L4OA 1FUYA 1T5AA 2WC4A 4MPKA 4MDOA 2VMFA 2ALDA 1Q6CA 3NSMA 3GDKA 2FFCA 1PIIA 1MDRA 1LWHA 4ZA0A 4P8WA 3K4WA 3INPA 5HMFA 3UWWA 3W88A 4Q8MA 1H5VA 1MEHA 3BLDA 1FP8A 3FSUA 3CAQA 2G4JA 4BFAA 3LHYA 1AVAA 1J5SA 2HE5A 3LLFA 3KP0A 3BMWA 3LHWA 4DUOA 4QX4A 2C14A 4AU0A 4D6EA 1IE7C 3AIVA 1YBQA 1OK4A 1GZ1A 4LPCA 5KINA 2WXDM 1OM0A 1FKXA 1F74A 3AZTA 1ZQ5A 2PE4A 5KTLA 2PRHA 1QW8A 4X61A 1ZFJA 1ZRQA 3KOFA 3SUWA 2YCLA 2J7DA 5J5DA 1FA2A 5HQMA 2WQPA 5DCEA 4P5UA 4B92A 1E0UA 1G94A 1XLCA 2ZVRA 4FXRA 1XP3A 2HNHA 1WE5A 1L8NA 2F38A 3CHEA 3QEZA 1E43A 4O53A 2P1FA 4JGDA 5A8OA 1BQGA 3S6DA 3WL1A 4EF9A 2WM1A 2NQ9A 3M0MA 3DG7A 3LG3A 4DN1A 4MB4A 2FHFA 4F0KA 1UD6A 2YDSA 1MYRA 1R9YA 3NZ1A 4MWAA 2NVAA 3D5HA 2KAUC 3AU2A 3W84A 3CGTA 3FVMA 1GHRA 1KCLA 5BRBA 3MHFA 1BYAA 3TWBA 2Z00A 3EPNA 3VD3A 1JIBA 3MDUA 2Q01A 2V5KA 3ISIX 3KW3A 2DP3A 5LNWA 3BJFA 4JNZA 5CGMA 2OFJA 3MVIA 4MOZA 3BOXA 2QMKA 4W7WA 5C54A 1IIHA 1DXIA 2BXYA 3I4EA 3QRHA 1OX4A 3SO7A 4YCPA 3G1RA 4JNYA 2F6KA 3UA3A 4TU1A 2V30A 1UA3A 5DFAA 4GXWA 2CWNA 2R24A 4MNLA 2HK1A 4LYKA 4AYSA 4EWJA 3E2SA 4GQ0A 2V2CA 5CJMA 4WGXA 4CQ9A 1VRDA 4HZ7A 3EOLA 1NDZA 3QHMA 4S39A 3P82A 2VCCA 1Q6RA 2H9AA 1PWLA 3KRBA 4P8UA 3GWQA 3U6WA 1SW3A 1W9UA 2WSRA 1EHAA 1TO3A 5HAOA 2P53A 3OIXA 3HO8A 1EKOA 1E9IA 2VP8A 2QAPA 2XIBA 1UUMA 2VC6A 1UQYA 2BODX 1H7PA 2NWSA 2Y8VA 3UR5A 5EL1A 5CCZA 4P61A 3RLUA 5A6BA 4QM1A 2ZZ7A 1KLYA 4JOMA 4HCLA 3RHGA 5F2GA 4ZB2A 3TYZA 2QUMA 2YLAA 1AUSL 2OOGA 1TTJA 2YB1A 2WCAA 1TWWA 2XPKA 3AJXA 1VFTA 2V8ZA 3G1SA 3SAZA 4Q4RA 1Q4NX 1DVJA 2OT0A 3VMOA 4Q8OA 2VRQA 4PR4A 4G8TA 2D1ZA 2OCZA 3N25A 4ZGYA 2ZZ4A 3O05A 3S2MA 2PSNA 2EPHA 4JTGA 1I45A 1S5TA 3E38A 3KVMA 1LJYA 1VBUA 3IGUA 4UFHA 2GJRA 1F8IA 1J79A 3AIEA 2PF8A 4C7GA 3ITTA 2PMQA 3LRMA 3HG5A 1RSCA 4C6DA 3IUDA 5CQ1A 1B30A 4HTYA 1JPKA 5C2XA 2OX1A 2QCDB 4ZTYA 1L6WA 2CBVA 1YDYA 3USZA 5CZSA 2XFWA 2ZUVA 2PZ0A 3NPVA 3NNTA 4IXXA 3M5XA 2VEPA 3G3MA 4JKLA 1QWKA 4Y9OA 3N29A 1YDOA 2ZX7A 3W23A 3FAWA 2VO5A 2CHOA 4P7RA 2F6XA 1A53A 3R8RA 1GT8A 1TTPA 4CLMA 1J96A 3LXBA 5HR7A 2AL1A 4UQAA 4ZXLA 3TYAA 3C4UA 3P14A 3CV1A 4EVZA 4ICCX 1GPFA 2VR5A 2CZFA 1E51A 1DHPA 3C0SA 3U0HA 4N9BA 2E40A 2PDPA 4MWAD 4IQLA 3GDMA 2X2GA 4XD6A 4LC6A 4P7QA 5I09A 1XDMA 4GNJA 3CMJA 2VX7A 3T09A 4LH8A 2I7GA 2JFEX 4C6EA 3TA6A 3E6EA 3LV6A 1MXSA 3PTKA 2BY2A 1QFEA 1OIFA 2ZUNA 3AMLA 3SCPA 3NQDA 4IIBA 1A5KC 1XINA 1HF6A 5IDIA 2ZWYA 4AC7C 1C7TA 5HPCA 1PAMA 5EBAA 2AKZA 3CPUA 4BWLC 1LOLA 2PDUA 1VJSA 1HVQA 1XJBA 1VS1A 1UZHA 3I4KA 3EDFA 4YCOA 3BO9A 3QMSA 1TMQA 4GQRA 2VTFA 2WC3A 3UWEA 2WMGA 2AAAA 5DY3A 5I3JA 5A95A 1LT8A 4XB3A 3FLUA 4Q7BA 5A6BD 1L6GA 4Q4OA 4CGTA 3GXPA 3W1PA 2D22A 3GNRA 3OBKA 3P0XA 4NHVA 3THDA 3H53A 2IPWA 3RPMA 3VTRA 1BKSA 2GQ9A 4O50A 3EBVA 3OLDA 3MYOA 2HK0A 1B2YA 5IHSA 2GQAA 4HCHA 3WELA 4TR9A 3A5VA 1HL8A 5AYIA 1GPWA 3GBDA 2PLMA 1W1B1 2R6OA 4KFNA 4YMZA 4HU8A 8A3HA 2BP1A 3BMVA 2VFEA 3SCOA 3WY1A 3AXIA 5HANA 3E2RA 2PD5A 2X1UA 5DN1A 2Y85A 1W3LA 2WSKA 2W5FA 1B0IA 7PTDA 3IJ9A 1J2BA 1XPYA 1HIZA 1GKRA 3MKCA 4KIEA 4US5D 3H22A 3RRAA 3TTQA 1TCDA 3LLXA 1XH2A 4CN6A 2PC4A 3HTWA 4G9PA 1I1WA 4I5UA 4XZHA 4B5SA 4MAVA 2PWVA 4JL1A 3DAQA 5CSRA 4ZOBA 4XV0A 1W2VA 3WLSA 1KTCA 5DXYA 4B16A 5ENLA 4FX6M 9CGTA 5DMMA 1A3WA 1K4HA 3LXCA 1OFRA 1LDCA 6CGTA 3EX3A 1LORA 4ZO7A 2DUAA 5G4HC 3V75A 3UW6A 2A3EA 2DZPA 2J9ZA 1UIOA 4Q8TA 2XVPA 5G1TA 1JZ7A 3MTWA 2IKGA 1PTDA 4M81A 5BWFA 4B4FA 1DJIA 3M0KA 4XZMX 1FWWA 3LPOA 3NSNA 4DXVA 5I0DA 5BRPA 4O1DA 3O0FA 3P84A 2WKGA 3BW2A 3WLTA 3B05A 2F9RA 1PCWA 3V18A 1VFSA 4R7OA 8RUCA 3UJ2A 4RX0A 1TJRA 3R25A 4M6PA 1RJRA 4B91A 1M68A 1XYCA 1PX8A 2REQA 4L9YA 1JI2A 3HG2A 1TWSA 5EU9A 3HIJA 3AHXA 5DF0A 3TP4A 1SZGA 1JCNA 1GJUA 3R0DA 3K8KA 1P5BA 4Y90A 2WJDA 4GGHA 1POJA 3B9NA 1RAKA 4S3EA 3GKFA 3HPZA 2W4XA 1UKPA 2X40A 1IEIA 3SB0A 1P6BA 2Q02A 2XHYA 1IYXA 3HJEA 3P6LA 1NWRA 1XD0A 2J8TA 3BOLA 1W31A 4RKAA 2CESA 3H70A 2DZWA 4C6NA 1EH9A 2WBKA 4N0RA 1J0KA 2Z27A 3I7RA 3W9ZA 1VBJA 3LHTA 3B8TA 2OSXA 3T7VA 4Y96A 3RDKA 2Y61A 1A0EA 5AY7A 1P6CA 3P0WA 3D3FA 2XIQA 1J6OA 1JRCA 5AYZA 3QMRA 4DX3A 1CIUA 5HK4A 3AHTA 4XSLA 1DJZA 2ISVA 5LHEA 1DXEA 4F66A 2QLYA 5HXMA 3E74A 3TSDA 4HSHA 2CLEA 3WMLA 3FFSA 1KGUA 5HQLA 3WBWA 4ADSA 2EF9A 4DZAA 3W27A 3N2XA 1KKRA 1RP9A 4UFMA 4DWDA 2XH0A 3GQYA 3K5XA 5I3FA 1JF5A 3WIJA 3TTOA 1TRIA 3W7NA 3OTRA 3BZGA 3B4YA 3WSUA 4AZHA 4J7RA 1CEOA 3N2BA 1JCXA 1YDVA 3EWUA 4I3GA 5CPOA 2VFFA 1AQFA 5JBFA 5B7ZA 4JHMA 3V5FA 2WJFA 2BY3A 3BLEA 3EDKA 4ZQMA 5FJOA 3FVDA 2QS8A 2E5BA 3V0TA 4C1KA 2CZDA 3WNNA 1XIJA 4IP7A 2LLEA 3GG1A 1EC7A 2J79A 4B9YA 2HVOA 4E3TA 5FEPA 2BGNE 4KPLA 4J40A 4Z1BA 4M7TA 3W1RA 5CZJA 8XIMA 4C6OA 3N18A 3H2OA 5IDZA 2VI0A 3S2NA 2BOGX 1UH3A 5FEXA 3AXMA 3U4FA 4KESA 2C3ZA 4HYVA 4AVOA 1Z69A 2RDXA 2A3HA 1LOQA 2QCFA 1V0KA 2IPJA 3EXSA 4Z1DA 2FYMA 3PG9A 5D38A 1YE4A 4O0ZA 2B81A 3WLRA 1A5AA 1IQ8A 5K7JA 2HEJA 1TPWA 1RALA 2C18A 4NZJA 1OX6A 1E9LA 4FA3A 1WBHA 1HXJA 3GTHA 3WF2A 5F4WA 4K2SA 3VIFA 1SR0A 3C3NA 4P7LA 1A5UA 2WNWA 4O0KA 1LLOA 1QPKA 3ABZA 3NOYA 1F73A 4ZO9A 4KFPA 2WKLA 4AZ6A 5AVNA 3CQJA 4GXMA 4UNIA 4JEQA 2GVJA 1ADDA 4FF7A 3E2QA 1LL6A 4CNTA 3V1HA 3H4GA 2CYGA 1XGZA 1Y8BA 4DLFA 4YTTA 2PTDA 3A47A 1GVQA 5FIPA 1TPDA 2VQUA 3SFWA 1VB9A 2CFFA 4XZIA 5GQBA 2TRSA 3QJAA 1XLDA 4LYQA 3RR4A 1F4HA 1UOZA 4IGSA 3EX1A 5J5RA 1HGYA 1ALDA 2QGYA 5FKYA 3LBOA 2DEPA 1LL7A 1RLCL 3WQEA 4FZIA 2CERA 2GJXB 1DJGA 1J5TA 2JIEA 3COTA 2DSWA 3RO6A 4GXPA 3KBVA 1JULA 3BLFA 5D2TA 1QNSA 4IMGA 5D33A 3PWAA 3NURA 3LSBA 1W9BM 2ZKMX 2YYTA 1MUCA 1T8XA 1IGSA 2BX7A 2A1YA 1EL3A 1SVDA 1WO2A 5CZKA 1TA3B 3DEQA 1IEQA 2PI6A 1YEYA 3AHYA 2QR6A 2GUBA 1XH0A 1H7XA 2EAWA 3SECA 4XUYA 1XBVA 3LRKA 1I4NA 1XIDA 4F0HA 1JDEA 4MVAA 3PTMA 4NF7A 4TMCA 3NZPA 3B9OA 3HURA 2VEFA 3QHNA 2G3FA 3MMDA 2OELA 4J1OA 1CCWB 4HHLA 5LGZA 4QFUA 2B31A 3I6EA 4QEEA 2V5BA 1UZ4A 3WEOA 4ICNA 3C2YA 4H8NA 1NFGA 2IS7A 2NQHA 4K7YA 1V7AA 3TC6A 3EMQA 3VD7A 4QITA 1OABA 2J62A 3EWXA 5D9OA 2VNCA 1PO9A 4G7EB 2AMGA 3FSTA 3NGJA 2HZGA 3P74A 2Z1KA 1BGGA 3VOGA 3WBAA 2ZZ6A 1MQQA 2ZBTA 1F05A 2V68A 2ZX9A 3IVSA 2OOFA 4H00A 4AHPA 2YLLA 1BYDA 3DHPA 4F9DA 5CAHA 3QV9A 5XIMA 2XSAA 3CUGA 4JTEA 5BYWA 3W1UA 2CC0A 1H50A 4WCJA 1F3EA 3EX2A 1QASA 1FRBA 4LAOA 3UR7A 3F2DA 3IIOA 4Y9AA 1QBAA 2D2HA 1V3JA 3HPXA 2RDTA 5A6TC 3RFAA 3VKKA 4BHYA 4OBRA 3VIIA 4MY9A 4PUJA 1CGTA 3VKDA 5KETA 3WQOA 1UKTA 3M0HA 4DQWA 3LMZA 3ATZA 3GH5A 4CEXC 4AZGA 1IWBA 1I0DA 1F2JA 3N11A 4PCNA 2CXGA 4ZB5A 2Q71A 3AYSA 3W38A 3E9AA 1PJ9A 3CT2A 1K9DA 3HPAA 4EPDC 2J66A 1OFBA 1W9PA 4OOZA 5C9WA 3UESA 2DDXA 5K9XA 4HNTA 5FACA 4LT9A 4JYDA 1BXNA 3D47A 2VWSA 4PTWA 2JEQA 1V5XA 4ZOCA 4M6VA 3KX6A 1U83A 2HPMA 1UWTA 1SO5A 3MKVA 3ANVA 2C1HA 4K6AA 5EB8A 3UXLA 4LU0A 3RF9A 3F4DA 4XWUA 1OD8A 2QCLA 4NJIA 4O1CA 1P48A 4HSNA 3W6YA 1OFAA 2VVSA 4FIQA 1W1ZA 3UZZA 4PMNA 3OB8A 1W1A1 2PP0A 4O4WA 1MEWA 5TNVA 2NLIA 1XBYA 5ABFA 1QK2A 4XQ6A 2VDIA 4XZ9A 3EWYA 2E67A 2GJXA 1KKOA 1C90A 2JKAA 3ATYA 1U1UA 1ESWA 1H5YA 1CNVA 2P0IA 3NQEA 4YS1A 1O5QA 3UP8A 3W1QA 3WF1A 4DYEA 3SJ3A 1OWQA 3BC9A 4X0NA 5I2UA 2ZZ2A 3M07A 1GOMA 4DM1A 5G2WA 4JFWA 5A2CA 1IZJA 5C70A 4LAZA 4H9XA 4MLJA 5HMDA 1GVEA 1RUSA 4FR6A 5H6HA 3TJXA 2C1GA 1A4MA 4NX5A 3CZEA 3IWPA 5CLWA 3B8IA 3EA3A 1FCQA 4DJFC 3IVTA 3S1XA 5D9MA 4OOUA 1HX0A 4PCSA 2JIWA 1IHIA 2RDUA 4D71A 5LXXA 5LIWX 4LW7A 2G8ZA 2PWEA 2NT1A 2BDQA 3O6CA 3TV8A 4DI9A 1ITCA 4O17A 4WKAA 3KCOA 2YCKX 4RZBA 1W3KA 3ARTA 4E2VA 3KRSA 3AUOA 2P8BA 5U7SA 1MRAA 4HPGA 1D7KA 2OKOA 3WH8A 1V7YA 4ZVJA 3EKLA 1V0LA 3QW4B 4U5IA 2DZUA 1GOKA 3FJNA 4C6FA 1CYGA 3FYOA 4WY0B 3V1PA 2P3EA 3EA2A 1PYFA 3E12A 3VGHA 3GNNA 1AJ0A 3GTFA 4GC3A 2XTKA 5GVJA 4QS6A 1A5NC 3ZLHA 2VOTA 4KGJA 3MJMA 2D2JA 5GNZA 3MMUA 1CBGA 1ZENA 3E0IA 3QQ1A 3W3OA 3UCDA 2V3FA 2VCBA 5I77A 3EMZA 2ZX6A 1XG4A 3QYQA 1I6NA 4Z2HA 4TIMA 2MANA 3QPEA 2VDHA 4Q4MA 3S9IA 4FXJA 3IEBA 3EPMA 2ZE0A 4LYRA 4M82A 3AWNA 1Q6OA 5E0KA 4V2XA 4ZSTA 1CI1A 3ARPA 1W5PA 4O1AA 4BY3A 3DI1A 3IJLA 1OYAA 1WZMA 5A8GA 3DHDA 2FPVA 1K02A 1QI2A 3SCVA 4JFUA 1LBLA 2WMKA 4CU6A 1OT1A 3OZOA 4TMBA 1SFLA 2H8ZA 1YTDA 3WNKA 1EZWA 3GXDA 4D6CA 3WQDA 3JRKA 1KV5A 1T8QA 3ITOA 3QR0A 4FI4A 2BHZA 1VZWA 2WSPA 3B97A 2NT0A 1E72M 1LCOA 4TX8A 4XTIA 2E25A 3CH9A 3MI6A 3W1LA 4G5DA 4KIRA 2YPIA 3QV7A 4DBWA 3T9PA 1E1CB 2ZXDA 4A29A 1UWUA 1VD6A 2AAMA 3DDMA 3Q67A 2TPSA 1UR0A 1KBJA 1N2VA 4Q6XA 1NFBA 1WXJA 1GVFA 3ARSA 2PWUA 2OMAA 3TAKA 2X1SA 3PJXA 3UGRA 2OLHA 3CAVA 3LDVA 3Q37A 5LIYX 4XSMA 3QF0A 4S3JA 3AMCA 1XRFA 1DHKA 4TUFA 4ES4A 4LAMA 4K39A 1XLMA 5AC4A 2ZXBA 3KL0A 3VE9A 2O9PA 3HPSA 3VIKA 3BLKA 5GPRA 4H9YA 1YTEA 4KF1A 4ZBCA 5E1QA 4CQ8A 1Z41A 5HJYA 4X2RA 3DXIA 1V6UA 3OHIA 3C5QA 1IEVA 3S5NA 5DMYA 3QC0A 4UB9A 3A4WA 5I3IA 3LCLA 2BVYA 3TYEA 2VXNA 3GNPA 3RK8A 1ZJIA 3LI0A 3DH7A 2DZAA 3P7YA 1EA9C 5F1UA 3SIMA 2ODOA 1M65A 1R2TA 4X0VA 1Q6QA 4Q8VA 4GINA 3WQVA 1YYAA 3PZUA 4P2VA 3GY1A 4DO7A 4EOUA 4KRZA 4TX9A 4C6BA 1HGWA 4KEVA 3TR9A 3PJWA 3VAVA 4GZEA 4WGHA 3T1GA 4AYGA 3PFRA 4MUZA 4PCTA 3S6OA 4PRRA 1EEXA 3PBYA 4DI8A 1KXHA 4FF5A 1XYLA 3MZ2A 1QMLA 1M1BA 2F6UA 3WQPA 3JR2A 3UZJA 2QEZA 3S6TA 3SN4A 2CZ5A 4C1LA 3GAYA 5D9PA 5C7HA 2PA6A 2Z1BA 2VKZG 4OHQA 3EDEA 4IMFA 1XISA 1KQYA 1ZS2A 1D3GA 3GTXA 1UUQA 3VFLA 1ZJAA 1YXDA 2J24A 3RCYA 4C6JA 3W86A 4PBEA 4FALA 5HNRA 1B54A 2DGAA 2C19A 3P5YA 1G9HA 4GNVA 1GK8A 1B4KA 4WD0A 2GVLA 3HZ3A 3MY9A 4OV9A 1PWMA 3LBCA 3R12A 1DJYA 1OG0A 1KFWA 3T44A 5AHIA 2W0UA 4NJGA 4REQA 5B7YA 3BGAA 3KUMA 3ZVHB 3L2LA 4BZYA 2XM2A 1O60A 4EXAA 3TQPA 3OOQA 6XIMA 2FB2A 4A6GA 4AX6A 1PX3A 4HSOA 4V1XA 1AZ2A 1XIGA 3UERA 2WJZA 1NEYA 1VEMA 2WPGA 4I9MA 4HQVA 4O19A 1Q66A 3O6AA 4XBKA 4QISA 5BWAA 5M17A 2QDDA 2GVEA 3SY1A 3KE0A 2ICSA 3N15A 4NQ1A 3PF3A 1H7OA 1WB0A 3NQ8A 3JS3A 5BOOA 1BF2A 4AD3A 2W91A 4TTUA 1TPUA 1MW0A 1DP0A 2OQLA 3UWVA 2FGLA 2XVGA 3HQOA 3RXZA 3FA5A 3RNDA 5FF0A 1LT7A 1UWIA 3NPUA 4H8HA 2PCEA 1WBJA 4RE2A 1W5OA 3BGGA 3M9YA 2OKTA 4S3DA 1JD9A 3AUJA 3LRLA 8TIMA 1JZ5A 2RKXA 2OJPA 5L6UA 2E6FA 5G1YA 1UH4A 1TREA 5T9BG 4RXGA 4BI6A 4PCPA 2ATSA 3ZR6A 2VZUA 1YNYA 4IPNB 3DHUA 3KRUA 1EJ7L 3LTSA 4PUUA 5A6LA 4KKXA 4NT0A 3VFCA 3SJNA 4O4VA 3C8FA 4A3RA 1IT8A 1GYNA 4DF1A 5LNVA 2ZUTA 1M7XA 4LUSB 3TFCA 1D9EA 3VCNA 4LGXA 4GY0A 2CLKA 2XGZA 4L4PA 5KZEA 1KO0A 4UTWA 3P81A 3QH2A 3SBFA 1WCGA 1C8VA 2DSVA 4W8LA 2XUCA 2BVDA 3DBNA 4L56A 5A6AA 3L4XA 2YBUA 3W74A 2Y62A 2IKJA 3C61A 4YIWA 1XLJA 4IPJA 1ZNNA 4H9UA 1QNQA 1JNEA 3O2LA 1XLKA 1MDLA 2WHMA 4HOXA 2PDCA 2D0GA 3PUGA 4HP5A 1ISVA 1YHTA 4ZTXA 1JAEA 1G01A 2O7QA 3T4CA 1CZ1A 2J75A 2OZ3A 3MCOA 1XLLA 4IFKA 3IVUA 4KS0A 9RUBA 5K3VA 4AWSA 1UROA 3BTNA 1YADA 4R88A 4IGMA 1CXEA 4CNNA 2PTZA 3QOKA 2I9UA 3WZ0E 2YZRA 1UR1A 1V6WA 2C0HA 3H54A 4RW5A 4W85A 1O66A 3E0LA 5D02A 3H21A 4AXNA 1EXPA 4NIRA 4MAZA 2UV8G 1E56A 2OYKA 3TW6A 3P2VA 4HU0A 3SFKA 2GJLA 4YLWA 2VEMA 1TE6A 3WMBA 2BTMA 4GUJA 3GFYA 1ZTVA 2EGZA 1OIMA 2OB3A 1T41A 2NX3A 1WX0A 2X2YA 2A3CA 3IV8A 3P5ZA 3CQKA 2G3IA 2Z2UA 3E0VA 1TPC1 4NAFA 3QN3A 2BZNA 4EE9A 3NEVA 4FXFA 3LS9A 3O1NA 3VNDA 4A35A 4GRSA 2E09A 4N6EA 4NRRA 1M7PA 4XZLX 1RBOB 4M8UA 1GVYA 4GX9A 2KX9A 1HUVA 2IW0A 1R47A 3CHVA 3WJSA 4ZOEA 5AC6A 2XH7A 2VOMA 3FHQA 3T0CA 4IJCA 1DJXA 2PDKA 3YPIA 5LNRA 1S2VA 3WH7A 1Q8JA 3IGSA 2OGYA 4RCXA 3O9NA 2WMHA 1OD0A 4ACYA 1JI1A 3PS7A 1WOBA 3CUIA 5T26A 5C0QA 2D73A 1AQ0A 3QVQA 2Q3OA 1KBBA 2DUXA 1MQRA 3H26A 4AISA 1V03A 1EPVA 1I75A 4Z42C 3VIPA 4U2YA 4HT3A 1X8CA 4CN4A 1W3HA 3SQSA 1RK5A 1ZAHA 4HTBA 4U2ZA 2Y0FA 1QO2A 2ZDRA 4RK8A 2WW5A 2X8RA 1EDQA 4HHMA 4PMDA 3NDYA 3IGXA 3A9BA 4UNLA 3PP7A 3CZJA 5BNKA 4HZ8A 4J28A 3UQNA 4IGHA 1BWLA 3ZT5A 5I6SA 1IR2A 2HPIA 3AMDA 3MANA 1Z42A 1MWOA 3CL7A 4XIMA 1NVMA 3HV9A 3A21A 3RYSA 5JMUA 4JQ4A 2V2DA 5I3DA 1VFMA 1EWDA 1Q65A 2PF0A 5FAGA 2R82A 3AMKA 4JQ3A 5HUPA 2ON3A 4XUGA 2R94A 3VDGA 1VLIA 1EPXA 5LA1A 3CHDA 4K1GA 5K9DA 3FV9A 3UJRA 1YPXA 3ZT7A 1REQA 4HKPA 4H9TA 3BAJA 3GVGA 2C8NA 4KGLA 2V63A 4R9OA 3V5CA 3HJZA 3KRZA 2ACRA 5A1AA 3AXHA 1XR2A 1UC4A 2OVLA 3UXKA 4W5ZA 1XH1A 4M1RA 2EHHA 1P7TB 5LGXA 2OZTA 1TWIA 1U5HA 5DEZA 1Q6DA 4MKSA 1B3XA 5BOFA 2GPTA 2A21A 3KAOA 3LI1A 1GGOA 3LOTA 5CG0A 1WDSA 3OGSA 2GSJA 4FNTA 3C6CA 3PZGA 2G95A 4BA0A 1DPMA 2GGIA 1HJXA 3BQ6A 5AHLA 5JXQA 3G1FA 4FLQA 4AEEA 4BQ3A 1K70A 3NQBA 1H1NA 3PB2A 1PBGA 3B4UA 1PEZA 4TTGA 4Q22A 4KMQA 5DMLA 1B3YA 3RPDA 3PSVA 4GBDA 1M04A 2VL4A 3RUBL 1HP4A 3DFYA 1V79A 3UCCA 3S83A 2XFFA 1K6WA 4HU3A 5XINA 4AY8A 4KW2A 3XINA 4Z2GA 4CNPA 1ECQA 3UPWA 4GCAA 2GYIA 2VUYA 4OECA 3TZFA 4MY1A 3WEZA 3PPCA 2JEPA 4A21A 3DUGA 1I1XA 2PWFA 3W7LA 1LUCA 3M6YA 3N2OA 1C8YA 3S8HA 4RR4A 2JF7A 4WVXA 6XIAA 3GDBA 5K4XA 3URBA 3WFLA 3SI9A 1W9VA 3GM8A 2PDMA 1LLWA 2YL9A 2AQOA 3QKEA 3E49A 1IT7A 1SQ7A