3M64A

Human aldose reductase mutant t113v complexed with idd393
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
316
structure length
316
Chain Sequence
b'MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPVGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Ligand-induced fit affects binding modes and provokes changes in crystal packing of aldose reductase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 107
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3m64A00
2R24A 2HEJA 2FZ9A 1Z8AA 3V35A 2PDMA 3V0TA 4XK2A 1MRQA 3UZWA 4XZHA 2PD5A 4G5DA 3RX2A 1RY8A 2PDJA 5DANA 1J96A 4ICCX 3EB3A 4PMJA 1AH4A 1X97A 1HW6A 3LZ5A 3CMFA 3UFYA 5HA7A 3GHUA 1R38A 1OG6A 4JTQA 4PRRA 1ZUAX 3H4GA 4JIHA 2A79A 4F40A 5AZ1A 1MZRA 3R58A 3LNMA 3DOPA 3ONCA 3V36A 1VBJA 3CV6A 5HNTA 4QX4A 4IJRA 3GHSA 1MI3A 3G1RA 4XO6A 1GVEA 3UP8A 1EXBA 2IKIA 2PDWA 3GHRA 2PDIA 3COTA 5LIWX 2HE5A 4XZLX 1XGDA 3WBWA 1XF0A 2HVNA 2PDPA 2PDLA 3R43A 3DN5A 4GIEA 3R7MA 1X98A 3FJNA 3R6IA 3CASA 3LQLA 1AZ1A 3D3FA 4ZFCA 2J8TA 2HDJA 1Z89A 4GACA 5JH2A 3UWEA 4JTAA 3NTYA 1S2AA 2AGTA 2PD9A 1Z3NA 4JTRA 2NVCA 2I16A 4DBSA 3FX4A 2WZMA 2NVDA 4LBSA 2ACSA 1XJBA 1PZ1A 2PDUA 4YVVA 3BV7A 1EL3A 2WZTA 4GQGA 1AH0A 5AZ0A 3O0KA 3H7UA 3LN3A 2CLPA 3Q67A 3LUTA 4XO7A 1A80A 3Q65A 4WDWA 3N2TA 3UZYA 3R8HA 2IPJA 4WGHA 4LAZA 4XZIA 2ACQA 3UG8A 1LWIA 4Q3MA 1AH3A 2F38A 2BGSA 4JQ4A 3C3UA 2PZNA 3G5EA 4XZNX 5LIYX 2IKGA 2PDCA 2ALRA 1US0A 3GUGA 2PDGA 4XZMX 1LQAA 1RY0A 3UZZA 3V0SA 1UR3M 1ZSXA 4L1WA 1PZ0A 4AUBA 1YE6A 1EKOA 2DUXA 3WCZA 3MB9A 2ACUA 4LAUA 4EXAA 3BURA 4WRHA 3UYIA 2VDGA 1YNQA 3R94A 3B3DA 4IGSA 1YE4A 2DUZA 4GQ0A 4HBKA 4YVXA 1RALA 4LB4A 4JTCA 4YU1A 1T40A 1VP5A 5KETA 3N6QA 2PDYA 4QXIA 4FZIA 3F7JA 3H7RA 1QWKA 4IJCA 2FZ8A 4WDTA 4WDUA 1EF3A 1ZGDA 1HQTA 4DBWA 3V0UA 2IS7A 2HV5A 3S3GA 4RPQA 2PDKA 5C7HA 3CAQA 4JQ3A 2PEVA 3MC5A 4GABA 2ACRA 2INZA 4XAPA 2R9RA 2PDBA 4WEVX 1S2CA 4JIRA 1YNPA 3BCJA 4EXBA 2IKHA 4PUWA 4YS1A 1IEIA 1FRBA 4HMNA 2QXWA 4FALA 3WBYA 4PUUA 2IKJA 3CAVA 2IPGA 1IHIA 1AZ2A 4FA3A 1S1RA 4JQ1A 4Q7BA 2FVLA 4YVPA 4JQAA 4I5XA 4PRTA 2IQ0A 1M9HA 1T41A 3CV7A 2PDHA 2HVOA 3U2CA 4H7CA 1ZQ5A 2P5NA 2F2KA 1S1PA 5JH1A 3BUVA 4GCAA 4JTDA 2I17A 4PR4A 2INEA 1Z9AA 3RX3A 4JIIX 4FAMA 2FGBA 3RX4A 3ERPA 2IPFA 4XVEA 4QBXA 4DBUA 4L1XA 4DZ5A 2PDXA 2BP1A 4R9OA 4JQ2A 1PWMA 2BGQA 1JEZA 3VXGA 1Q13A 2ISFA 4LB3A 3R8GA 3UGRA 3M0IA 2PDFA 3UZXA 3LZ3A 1X96A 3LBOA 3T42A 1AFSA 3EB4A 5M2FX 3ONBA 2PF8A 2PDNA 4H8NA 1QRQA 5HNUA 5LIXX 1PYFA 4ASTA 2DV0A 4MHBA 3LD5A 2C91A 3QKZA 1PWLA 3LEPA 3LENA 3LQGA 3KRBA 4LBRA 1ADSA 3GHTA 4WDXA 1SM9A 4XVDA 3P2VA 2FZDA 3WBXA 3M64A 2PDQA 1C9WA 2HE8A 4NKCA 3WG6A 3EAUA 2FZBA 3O3RA 2IPWA 4OTKA 5LIKX 5LIUX 1K8CA 2PFHA 3M4HA 1Q5MA 4GA8A 2IQDA 4QR6A
chains in the Genus database with same CATH superfamily
4JFWA 2VYOA 2QUNA 3AOFA 4RNFA 2P3EA 4E4PA 3LCLA 1OX5A 3OEXA 5FESA 1DHPA 4CCCA 4FHAA 3P93A 3PF3A 3LGDA 4L1GA 4TX9A 2VFFA 2DZWA 3O0FA 1E73M 1YPFA 4XK2A 1S2UA 3LHZA 3QHMA 4W87A 2PD5A 1CB7B 2DT0A 4KESA 1RY8A 1XCFA 4DYKA 4JTUA 4LY4A 1XLEA 1RA5A 4YMZA 1YDNA 2G4FA 1QBAA 4NX5A 1VLIA 3G18A 3RMEA 5HA7A 1H7OA 4Y96A 1ZUAX 1LUCA 2GVLA 2CETA 5EMLA 2QCLA 4O12A 3OG3A 3NQMA 3V36A 1Y5XA 5A6LA 1I8JA 2H9AB 2JALA 1SJDA 4DEFA 1QCWA 1GVEA 1J01A 4UTKA 1OGBA 4N9EA 2X7WA 3W7PA 2OT1A 2W6RA 1V0KA 4LANA 5DMNA 3L4VA 1UW9A 4A21A 3GVWA 1B90A 3TR9A 4RJEA 4I7WA 3F4DA 3FYPA 2Z2AA 5C5YA 3EPMA 3NL6A 2ZWYA 4ZFCA 2YLLA 1XSJA 3L4TA 2X0SA 1IWPA 1JCTA 3C3NA 2E7FA 4AZGA 1XIEA 3MMTA 2YR1A 2NVCA 2I16A 3KLKA 4OUEA 3PWGA 5C9ZA 2NXHA 2VCBA 5AHFA 2WZTA 4HHLA 2I56A 1AH0A 1KXHA 1T6MA 2POTA 1QPNA 2VO5A 4ZA0A 2BV9A 3WLNA 1KXTA 3ANVA 2JQXA 2QCFA 3G0XA 5F7UA 3HIJA 4KGLA 1MQPA 5ECVA 1FKXA 5J8LA 3I4KA 3VI2A 1C8VA 3G8EA 3QMTA 4PSPA 4GYJA 1OFQA 4JQ4A 3MP3A 4PSRA 2ZVRA 4H9YA 1MO0A 4QJ3B 1BVWA 2GGGA 4R5EA 4U3AA 1FWRA 3NSMA 1FP9A 4DM2A 3UWVA 3BLIA 3WJWA 4HMEA 1F3TA 1XCXA 1TRDA 5EPDA 3BE7A 4NZJA 5A8OA 2QQ6A 1UD2A 1IXOA 1HN1A 4TVUA 1JJKA 1TV2A 2O9PA 3BOFA 1P0DA 1QATA 3AWNA 3AIVA 3NWRA 2NUWA 4DWSA 5M5DA 3AMDA 1HFBA 1YNQA 3NDZA 4BWLC 3R94A 1ZZMA 2KAUC 3AJXA 3BG9A 3IWPA 4LB4A 4W8BA 5ENLA 3TIMA 3QXBA 3E96A 2WANA 1FY6A 1E9YB 2VM8A 3L12A 1DOSA 3WQOA 3E0VA 1OYCA 2V69A 4QLJA 4LTSA 3WNLA 3CPRA 4BQ4A 1EJWC 3HG4A 1SQ7A 1XIGA 4S3KA 1EEPA 3TTQA 3FGCA 5AC6A 3DI0A 3PR2A 1MXGA 3KTCA 4E38A 3P62A 1PIIA 1UIOA 3A6OA 3SZ8A 5FF4A 1GTHA 1ZRQA 1ZAJA 1KM3A 4UFJA 4RDZA 5GNXA 3QPYA 1GVRA 4PMZA 3NO5A 2ZUVA 2E9MA 4F0LA 5FEPA 4D6EA 4ERAA 4AD2A 4EXBA 4J5NA 4JNYA 4GIRA 3EPNA 4NUWA 2CZEA 2Y8VA 4ZE4A 1VFSA 3W1MA 3WN6A 1DTNA 1XH2A 1FWEC 4X2RA 5D02A 4UFLA 1XIJA 3H2EA 4KIRA 2Q8LA 3WNNA 3GVRA 1OX4B 1KCKA 1ZAHA 3VC5A 3PZOA 5D09A 4IPNB 1BRLA 3L4WA 1H3GA 2TSYA 1A3WA 4TX8A 4DBEA 2X7VA 3NL5A 1F05A 4O1AA 1H5VA 3QZAA 3CV7A 1BTCA 4HB7A 4XD3A 1PDZA 5IDIA 2HRWA 1EH9A 3IUHA 1WDQA 3WF2A 1I4NA 1NP0A 1TG7A 3NSNA 1UBSA 3IIPA 3TN5A 5CC6A 1E3XA 2IW0A 3E2VA 3WQGA 4LYRA 4I6KA 1IGSA 2Y0FA 3VIJA 2NQ9A 4A3UA 2PDXA 4IHCA 4UMAA 4UQBA 3HM7A 4GG9A 4C6MA 4FB7A 3H7VA 3VTRA 2BVTA 1AQ0A 3ZVHA 1B4KA 3C2OA 1ADOA 1E0XA 1EA0A 4FF7A 4FMVA 2QPSA 1GUVA 2VX7A 2WJZA 3CO8A 2YSWA 1WUFA 1H62A 4U5IA 1K6AA 2PF8A 3SCOA 2A6NA 2VWSA 2DW7A 3CH0A 4P7NA 1WPCA 4MWAA 3MHFA 3LOTA 4NAFA 1PTGA 3QRHA 3N14A 1PWLA 4U2ZA 4JPGA 3VKDA 4D6GA 1JULA 3GC2A 3UJRA 3LQGA 3LTSA 1D3CA 3S1VA 2VVSA 1JL8A 2DZUA 2CLFA 1W9PA 3DECA 3BJTA 5HK4A 3JW7A 1W1VA 2PGEA 4A3RA 4MF4A 4ZE5A 1LLWA 3USBA 3EAUA 5EMMA 3O3RA 1NAL1 4JX5A 7TIMA 3N17A 2O0TA 3SFKA 3WLMA 4PB5A 4ICMA 5CBIA 3ITOA 3T4WA 3NDYA 4R53A 5TAOA 2XSAA 2CERA 3POHA 3D0CA 4YL2A 3VAVA 5I3DA 2QYGA 5H1WA 3SJ3A 4NZFA 2A3CA 4S1FA 5AHNA 5AKQA 1GYLA 1HKJA 3EEZA 3TZFA 2Q3OA 4RE0A 1Q66A 1KLZA 1UWUA 1US2A 3MBFA 4R34A 2YXOA 3LV5A 3IVTA 4JEQA 1TWZA 1AH4A 3IJDA 5CJ5A 3CMFA 1UOZA 4RV8A 3K13A 3ARPA 4DXVA 1ECQA 3S2LA 4ZB5A 2AMGA 2J6XA 3QSTA 1WE5A 3B97A 2WPBA 3UXAA 4LQ1A 4S23A 4Q4QA 3IAQA 3F4CA 3DFOA 4QX4A 4PL2A 3GO2A 4NHVA 4GI8A 1W1IE 2V5KA 3G1RA 2CWNA 1GHSA 4FI4A 5CPOA 1O66A 2V8ZA 3WYZA 2J9XA 2WOQA 5LIWX 3SAZA 4GIYA 3WQ8A 3VD9A 3H26A 4MY1A 4OOZA 3UERA 1E0UA 4XKYA 3O6YX 1MNSA 2DQWA 4MYXA 1A5KC 3AS0A 3RU6A 4M29A 4CQ8A 3NNTA 1MUCA 3ZJKA 2GGEA 4KFPA 4JNZA 3RNDA 3PANA 3UCDA 3W7EA 3Q67A 4JTHA 3PN8A 1G69A 2W9MA 2EXOA 4PTMA 4IGNA 2J7HA 4WGHA 4KFNA 1XV8A 3CEPA 1OCJA 1EQCA 2OG9A 4N9CA 4YYCA 2EPNA 3GU1A 3LXAA 2V9DA 3PAOA 4U28A 3EWWA 4XB3A 3RLVA 2ZZ4A 3RO6A 5FEZA 1U5HA 3QQ0A 1IXNA 1FWAC 2ODOA 3LRKA 3AIWA 4FNPA 3KVJA 4B92A 4C6PA 3BGGA 2BVYA 1EKOA 4ZB2A 3U2ZA 1HG3A 5H8MA 4C6LA 5EKYA 3RR1A 2JBMA 3CL6A 3MT1A 3H12A 3LNPA 3TSDA 4QE4A 5CJNA 3PFRA 4AVNA 1NDYA 4DJEA 3W73A 4NJGA 1RR2A 4GQ0A 2VNCA 3LS9A 4H2HA 4DXKA 3DDMA 4W93A 3DGRA 4GJ1A 4C6DA 1Y65A 1JZ2A 1NDVA 1WZLA 4HYWA 1S2WA 1V6XA 3FK4A 1NARA 4GUFA 1AMYA 3QM3A 4IJCA 2VVNA 3BC9A 5A1AA 3C61A 2VENA 2FFCA 4QFUA 1E5NA 1XGEA 1NELA 4Y7EA 2MUCA 1YDYA 2XM1A 3NYDA 5D04C 5DMLA 4ZOBA 1EX5A 3PG9A 3QLLA 2ZBTA 2C1GA 4WKFA 1UIPA 4HHPA 3BJSA 3TSMA 1W17A 4GO9A 3GDLA 2CLLA 1GEQA 4ZQCA 1GW1A 1CGUA 2Q71A 3W00A 4G8TA 1S2CA 2VURA 5EBUA 4Q8QA 5G4HC 1XS2A 3XISA 4JICA 4QAIA 4YS1A 5AB3A 2Z1SA 1IZCA 1RXOB 2NQ5A 2ZICA 3WBYA 4ML9A 3TTYA 3B0UX 3K1GA 4C6EA 1JDCA 1TQXA 1U1HA 2ZIDA 5DO8A 3W9ZA 3E5PA 1A5SA 2Z00A 1J5TA 2CITA 2Y70A 3IGHX 2OODA 1T8XA 3DG7A 3T44A 1G5AA 1OC7A 3W2MA 1IZKA 4CVUA 1ZHAA 1ITQA 3T2QA 1A5OC 3UXKA 1XIMA 4LS0A 4US5D 4Z2KA 4OE7A 3SCPA 5D38A 4QG8A 2CIPA 3VD5A 3P84A 4P8XA 2R1PA 3WK2A 3U2OA 4NVTA 1A47A 5I6SA 3ERPA 3KDNA 1BXNA 4D8LA 3CUGA 4X2PA 1KKOA 1NVMA 2OCZA 3UXIA 4L9XA 1RBLA 2E5BA 1JEZA 2RDWA 4H9VA 2OT0A 1S3TC 3HB9A 4Q6XA 4AF0B 5L9FA 3LBOA 3T42A 4FEZA 3VE9A 4EE9A 3NQ8A 3GG8A 1AQMA 1PX4A 1JFHA 4QS5A 1M65A 1QRQA 1E9ZB 3BLKA 5LIXX 5I00A 3R25A 1NDZA 4PMQA 3APTA 1W9DM 3RO8A 4FK9A 1JCMP 3GM8A 3QKZA 1X6NA 4F79A 4H6RA 3IS4A 4JTEA 1HP5A 4AIOA 2E0PA 3PUDA 1FWTA 1K9DA 3B4UA 2RFGA 3C2YA 4RK8A 5ABFB 3QTGA 3ITTA 1CXLA 3KL3A 2V3EA 3H22A 5FCZA 3SQSA 2XIOA 4GINA 1JXJA 1JZ8A 1FQ0A 3W1QA 4XIAA 3FDKA 3OA5A 5DT5A 3BQ5A 2YCKX 2VZTA 2FZ9A 1KBBA 4ZEPA 4PUNA 2ZTJA 3EOLA 4PMNA 3C0LA 1FHDA 2BS9A 1QI4A 3EWBX 1UR9A 2JKAA 4HTBA 3K4DA 5HMFA 4JY8A 5MF5A 4HMDA 1SO4A 3GAKA 3F03K 5H91A 1UB3A 1F4AA 4Q6JA 3PNUA 4JY9A 4TUFA 1T99A 3R8RA 4BS0A 3EWZA 5FIPA 1PVNA 2W4XA 2WSRA 3GHUA 1GKRA 3HPAA 2HWGA 4CEXC 2PMQA 4F40A 4Z2HA 3PJXA 2C8NA 5HWMA 3L4ZA 1EWDA 3ONCA 3RJXA 1OD0A 1Q6QA 3GXFA 3CV6A 4D2JA 3W76A 3AHVA 4AWTA 4XO6A 4ADTA 2QJMA 1DJGA 1IEXA 2Z24A 4XZBA 1ZY9A 2IKIA 1BWVA 2GJRA 2PDIA 3URQA 4YCPA 4LVDA 1VKFA 4YTTA 1EDQA 2HVNA 3MVIA 4GKLA 1ONEA 1PKYA 1W3JA 1X98A 2FGLA 3GC5A 4KQNA 3W71A 2QJIA 3WEZA 2ZA2A 4FXFA 3QQWA 1R5YA 1CDGA 3FEQA 2Z4GA 1OZQA 2IXUA 3LRLA 1ECEA 3VDHA 2QDEA 4JTAA 2EAWA 4C1KA 3NTYA 3E49A 2YBVA 1DL3A 3TQPA 4DBSA 3VILA 1KFWA 1A5UA 1OYBA 2GGIA 1K03A 3WLHA 1FCVA 4H9ZA 1MRAA 2OB3A 3UR5A 3Q37A 2PRLA 1BVNP 4Z2JA 5AYXA 4XO7A 2OOGA 3HQPA 3NUKA 4UUIA 1E40A 3UJSA 5EA9A 4M6QA 1KM5A 1VCGA 1H7WA 1CPUA 3RPDA 1E1CA 5T9BG 2OEMA 3EB2A 2Y1HA 5E9AA 1LUCB 4J7RA 1A0DA 4DZHA 4I9TA 2QJHA 4UB9A 2A7PA 1WAUA 5FI8A 1ZB5A 3I7SA 4AIEA 2PZNA 1KFKA 1W3IA 2DJXA 4ZTXA 4PA8A 1O5QA 4S3CA 1HJUA 1Q7QA 3RAOA 1E1FA 1G01A 3TW9A 4C6CA 3T1GA 4NG3A 1XBYA 1PZ0A 2FGZA 3PHAA 2GVJA 4QGCA 4DJDD 2W92A 4LAUA 4JYEA 2DSUA 3BURA 2J6VA 3TKFA 4AX6A 3GXTA 1V5XA 2PODA 1N7KA 4ZQNA 1KNWA 3UY7A 4DAIA 1S2VA 4CVWA 2QVNA 3B3DA 4V15A 4H9UA 5CSUA 3A13A 3MHUA 3NEVA 1IXPA 3SUSA 3B8TA 2BWGA 2GJPA 4AMCA 5CPLA 2D0GA 3MMWA 1P1XA 3GDRA 1EPVA 2JFEX 3R0KA 3IIZA 2FZ8A 4N9BA 4L64A 1W91A 1M03A 4ZO7A 2BLEA 1UWIA 3IIVA 3B8VA 5M1TA 4UTWA 3P5YA 1M5WA 1UD3A 4HIBA 4X60A 4HK7A 3TXVA 5FA5A 3RXZA 1H51A 1VQTA 3G3DA 2ZUUA 4DI9A 4RPQA 4H41A 4NT0A 1LL7A 2FJKA 4IGHA 1KCLA 3TA9A 2QMKA 5F1VA 3M5YA 2NT1A 3ZJ7A 3MC5A 4GABA 3BSGA 3ALFA 1KV5A 4PCFA 1Q8AA 3IGXA 3SM0A 3TC7A 1UR8A 3MWCA 3AS2A 1JPMA 3K4WA 1YEYA 5D33A 4IL0A 3T8QA 2DT2A 4IMAA 1FRBA 2GGJA 3VYLA 3S8HA 1KFLA 5ABTA 5DLCA 2JF6A 1UYQA 1IZJA 3CAVA 1DORA 2FVKA 3A4WA 3DFNA 4DWSB 1QOXA 5HXMA 1J0JA 4PFMA 3LK6A 4DJFC 3KZSA 4PFHA 5I3IA 4NJJA 4FR6A 1TVNA 4IFRA 4IT1A 4G2DA 1PV8A 5BCAA 5GNZA 3HBLA 1Q8JA 4CD6A 1T41A 1E0WA 4BJHA 2GWNA 4ZENA 2F2KA 2PLJA 1EJTC 1C8YA 1I45A 3SECA 1Z42A 2J24A 4LT9A 3PBMA 4JIIX 3FGCB 3RUBL 1POJA 1U30A 3BSMA 1FH7A 2ZDSA 5JXQA 1X8FA 5FL0A 3TAOA 1LBLA 5IHSA 2W66A 4XD5A 3NVDA 4DZ5A 4UXDA 4AISA 1KC7A 2F2HA 3AU2A 2B4GA 1I1WA 1NWUA 2X30A 1HL9A 3MI2A 3W1RA 2PDFA 1GHRA 2ZUSA 1UPPA 1E1EA 3UBPC 4JHMA 3NCOA 4LUSA 4PTWA 3VKAA 3CS2A 4E5TA 5HNUA 1AW1A 3G24A 1KGUA 2C6QA 3IGUA 2V82A 3FEMA 4H8HA 4QDWA 1VBHA 3GNDA 4Z1CA 3KRBA 3VX0A 1BRLB 4NRSA 2OQHA 1HKWA 1TUXA 3VGBA 4AY7A 3M44A 2VL4A 3GBDA 4JAWA 3WLSA 4GKTA 4JD4A 5I03A 1YYAA 4PC8A 1DIEA 3VA8A 4N4PA 2DW6A 3ABRA 4LUJA 1HO1A 5T9CE 1F8IA 1BGGA 1Q5MA 1UWRA 2Z1WA 1TCMA 3LY0A 3SUVA 2Q01A 3CBWA 1JZ4A 3B0XA 2VRQA 4H01A 1A5AA 1ML1A 2DJLA 1YXDA 1UOKA 2FTWA 3IJIA 4LYQA 5DRCA 3ZVHB 1V6TA 2FYMA 3L65A 1ZBKA 1C8XA 3GY1A 3PAJA 3LYEA 1JYVA 5CPSA 1TO3A 1J96A 2WXDM 4K7VA 2WPGA 1X97A 1G7UA 1A0CA 4DUOA 1JZ3A 4DZAA 1VPYA 3L5AA 4TV6A 1UKOA 5XINA 5CH9A 3EDEA 1G94A 1ME7A 3P7YA 4NAFB 4ZOCA 1S2TA 3E0LA 4CCEA 4W85A 4Q4SA 4KH2A 1S46A 2JF7A 4HK5A 1CGWA 4GE8A 3LGGA 3SADA 3NR0A 1GTEA 5CBBA 1R9ZA 4GBUA 1CXHA 3F4NA 3N9KA 4MKNA 1RV8A 3WL0A 3WFLA 2G8ZA 5JBDA 3LV6A 4UMCA 3VM5A 4LCSA 4UQEA 1RQBA 3W4RA 1MYRA 4P8WA 2FTYA 3CHVA 5GNYA 4MDPA 1TKKA 4DO4A 1O95A 3B05A 4M7TA 2OWXA 5KEZA 4ORMA 5DBTA 3VM7A 3E3HA 2BZNA 3BOXA 4C6FA 2P76A 2XHYA 2YXGA 4WHBA 3W2JA 3WH7A 1OIFA 3SIMA 1O5KA 3F5LA 3WLLA 4B90A 5B80A 3R79A 3VIKA 1P0KA 3Q2DA 3H7UA 4OIFA 3LN3A 2PRMA 1LRTA 1PBGA 4EPDC 4Y9OA 3GNXA 3W29A 2EPOA 1XCWA 3PBGA 4E4UA 4CQDA 2PRHA 3UZ5A 1XQKA 4RKAA 3OB8A 2VEIA 4FXRA 1R46A 3GDKA 2OEKA 3ICJA 1G1YA 3P80A 4MZ8A 3XINA 3ECQA 3L0NA 4H7ZA 5E09A 4MB3A 4UOQA 1TE1A 3OQEA 5M17A 2YCLA 4UTTC 1SVDA 4FIRA 3U9IA 2C0HA 4O0KA 4PEKA 2D2JA 4IIDA 4E2OA 2J7GA 2VR5A 3KX6A 1V3MA 2O4QA 1CTNA 3BICA 3DAQA 2PGWA 4XZNX 5DY2A 2J75A 4Z1AA 4F0RA 1IT8A 1M1BA 1HKVA 4U2YA 3GH5A 4XZMX 2RKXA 1E9IA 1J9YA 3VOJA 2X2YA 4G56A 2V5DA 1YE6A 2BXYA 1DJWA 1P48A 5EFDA 1CWYA 3V75A 5D32A 3WEMA 1CLXA 4H00A 3G1HA 1GEHA 3H54A 1O1HA 5A6TC 4HU0A 2DUZA 2EKCA 1H63A 4XKYB 5BWFA 3G1YA 1IR1A 4DM1A 3E1F1 5KETA 1KM6A 3GRIA 4QXIA 3H7RA 4IL2A 1XHGA 1W2PA 3SFWA 1FVPA 3H2CA 1VH7A 1SFTA 1TTPA 5EGRA 3RHGA 3V3WA 4YHGA 4FNTA 1V3IA 3OP2A 3DYOA 3IVUA 2OGYA 4M82A 3IJLA 3PBUA 1MMFA 4I9MA 5LGZA 1QASA 4NJIA 2XZ9A 3S3GA 1OFBA 1X6LA 4H19A 1VZWA 3BWWA 3FHAA 4TQTA 5A8MA 3UCCA 1H1ZA 2L5HA 2DVUA 3LCGA 3VMOA 3CZGA 2HQAA 2C1HA 4WLCA 1EDGA 1NDWA 2X41A 4W88A 3GB6A 3HG3A 2J27A 4GGBA 2PDBA 1FXQA 3AMLA 1JGIA 3NQFA 2BOFX 3B8WA 1RLCL 3T08A 4MVAA 4CNSA 3BCJA 1S5NA 4F48A 3RR4A 1E4MM 3S5SA 3SQLA 2J78A 5DX7A 3OVGA 2NQJA 4IM4A 4H6QA 1WDSA 1D2KA 2WBKA 3U3HA 3W83A 1OYAA 2AL2A 1R9XA 4HZMA 2WVSA 3R13A 2CHRA 3ITVA 4N42A 3GU9A 9XIAA 4A6GA 1K7XA 5I3FA 4JHZA 5BMXA 8A3HA 4GUHA 4CN1A 2FH8A 3MPGA 4HOZA 2R1NA 5JIWA 4IGMA 3U2CA 1CX9A 5IDZA 4NU7A 2PAJA 3I3BA 2YDSA 2V3DA 3M0HA 3PZVA 3RX3A 3FXGA 2AGKA 1MDRA 2BHYA 4B3KA 5AY7A 1BYAA 2JE8A 1KM2A 4TMCA 5J5DA 2PWUA 2WSQA 3ZLFA 2FB2A 3W38A 3TQ0A 4KCWA 3V7PA 2OR2A 3BGAA 3QPEA 2P53A 4CNPA 2Q3RA 4B5SA 1OC6A 3K8KA 3LPOA 2G4JA 2OSWA 3STFA 4V28A 3FA3A 1Q4WA 5D8WA 4MMWA 4H8NA 2AKMA 4W8AA 1PYMA 4J3TA 4ASTA 2H90A 2VRKA 3N4FA 3UF9A 1EHNA 1FKWA 1OZMA 3S9ZA 4P8VA 4C6KA 3KVLA 2BSLA 4W7UA 1JR1A 3D46A 2XN1A 2ZUWA 1TE6A 2BB0A 3ABOA 3QHOA 4PUJA 4WXZA 5HINA 2EEXA 4PTVA 1ADSA 3DGBA 3ZWSA 3RITA 3UVAA 2J25A 3CEUA 2D20A 3P2VA 2FZDA 3ATZA 3SN1A 2V81A 2EPLX 1H41A 1EHAA 5I0DA 3SRDA 3F2BA 3UNDA 2EG8A 5TQLA 3V16A 5LIUX 1FWCC 2ZCGA 1WXYA 1US3A 4CQAA 4OT7A 2Y7EA 1V02E 5D9NA 1NWSA 3I3DA 4GVHA 4GA8A 2DY3A 1QTWA 3LGEA 3KWSA 9RUBA 4C6NA 2ICSA 3TU9A 1XLDA 3V1PA 2VDIA 3AXIA 3FV9A 1LM1A 4MDOA 3V35A 1K1DA 4ACZA 1X1OA 2NV9A 1U5JA 1R2RA 5HUPA 2F6XA 3FCPA 3KXQA 3PZIA 4CEUC 2VFIA 4K2SA 3L66A 5TIMA 4PBGA 1WV2A 5C71A 1EFZA 4KCUA 5DANA 3M0XA 2QCGA 4JN8A 2YW4A 2XFRA 1V7YA 4PMJA 4W84A 1MEIA 3GR7A 2WBGA 2V0TA 3OQ8A 4PUMA 3AHYA 3NOEA 1DXEA 2DZPA 5TD4A 2A21A 3VMNA 8XIAA 3BAYA 4YWSA 2E6FA 2HK0A 2R1KA 4LRSA 1VBJA 3W1UA 3AWOA 4FX7A 2WKJA 3ZWTA 2HSAA 4HSNA 2XSBA 4LWWA 3WIJA 3QPZA 5H8UA 5FD0A 1KGWA 4ERIA 3D6NA 3GHRA 4UR8A 4DXXA 1AD1A 4C7GA 1QPOA 1SO6A 1TYGA 1QXLA 4J35A 3WELA 3R7MA 1Y5VA 4R9XA 3FJNA 3A3XA 2QNEA 1BXCA 3CASA 5U4NA 3WY1A 3FAWA 4QLKA 2ZYFA 1QW9A 3NPVA 3ITLA 1R3QA 3BLDA 4W8LA 4OVXA 2E40A 3H2NA 3UGVA 1TPVA 2Z7KA 4FNQA 3RF9A 1HZYA 1NY1A 3WJZA 2X05A 3HPSA 2NQLA 3GXMA 2NVDA 5LA2A 1TJ2A 3FA5A 5IXEA 4XAYA 2P8CA 1C29A 5K9CA 1EUNA 3BMVA 3T4CA 4IP4A 1G4SA 1XLIA 4W7VA 3Q65A 1GPFA 3FHQA 4F3HA 1IEWA 2A85A 3BW4A 1XD0A 4PBFA 3BAIA 3VD7A 9XIMA 1CXIA 1AW2A 1OM0A 3DIPA 4YXGA 4IPLA 3TR2A 3TEVA 1FA2A 2VD9A 1LWIA 3B8IA 2VGIA 3AYRA 3W07A 5AHLA 4JYDA 4ORIA 5LIYX 1V0NA 5PTDA 2F6KA 3N34A 2ALRA 3BAJA 2G96A 3VE7A 5F2LA 3GUGA 4IX0A 1UR3M 4AYGA 3E12A 2XGZA 4AUBA 3PC0A 4MUZA 2DUXA 3WCZA 3VUPA 2WMFA 5HQLA 3GYCA 3RPTA 3EBVA 4DIAA 2YX0A 4IGSA 3HURA 1DJXA 1I9CB 2PGRA 1YQ2A 1JDEA 1BTMA 4AYSA 3EGJA 2OYKA 1VP5A 3DCPA 3PTMA 4TV5A 2H8ZA 1XIBA 3DX5A 1UHVA 2GSJA 4J3UA 4Z1BA 3U4AA 3FOKA 3ZR5A 1B30A 4I90A 3HG2A 2X2GA 2OTDA 2I1OA 1KRCC 4DBWA 2P8BA 3S46A 5HOSA 3WFAA 2J66A 2VFDA 3ITGA 1HKMA 3EX1A 4AD1A 1EJVC 3PZUA 3OHIA 3V4BA 2VDHA 1LZOA 5T91A 4QE1A 1E1CB 2YBUA 3TW7A 3B8DA 4AAJA 4DJFD 5REQA 3M5VA 4O17A 4N2YA 1ISXA 1VF8A 2ZUNA 5FL1A 3CGTA 4XAPA 3DKLA 2JEQA 4Z2IA 3THDA 4M80A 1J79A 4GZJA 4Y9NA 4S2BA 4GMEA 1M68A 1SFLA 3PWAA 3KOFA 3KAOA 2BTMA 1FCBA 2HROA 3TTSA 5HR6A 3ZS4A 4B5WA 3SUWA 1TWWA 3W6LA 4BHYA 4M6PA 3EA1A 1I75A 3W7IA 2X1UA 3A47A 4L80A 4FO4A 4REQA 4FA3A 1UBPC 2ZZ2A 1XPGA 2I7GA 1UWAA 2X09A 1GOXA 4AC1X 2CZVA 2J4GA 3STGA 2W0UA 1TA3B 1RZMA 2WYSA 1TREA 4E3VA 3O63A 1L6YA 3NYZA 4DAFA 1AMKA 2YIHA 3RCNA 1EIBA 2YPIA 3KOWA 3KBMA 4WUIA 1JUKA 4XUGA 2Z2UA 1U33A 4D1JA 5AVHA 2BASA 3ARXA 3GTXA 4GCAA 1K02A 3VNLA 3PUGA 4PEEA 3P8JA 3A3HA 3LMYA 3W85A 1I2RA 1Z69A 2P3ZA 1L8PA 2XIIA 2O7QA 1DQXA 3WF4A 2YYUA 3WJXA 2FHFA 1VFUA 4M3PA 2GK1A 2VEMA 2Z1KA 3C8NA 3HZ3A 1OGSA 4L6DA 4XISA 1JPDX 4N0RA 3UA4A 3VIHA 2OJPA 3ATYA 3EOOA 3PNZA 2GUBA 1X96A 3SSZA 5CSRA 4QEHA 3I68A 2O92A 1IYXA 1PDYA 2OYLA 3TMLA 2BOEX 3C0QA 2A4AA 1O94A 3W2KA 1C93A 2OZ0A 3C2RA 4GI9A 3DFTA 5AYZA 1MWOA 3PK7A 3V5CA 3D5HA 3VCNA 3LCFA 4GZEA 4GPNA 2J62A 3BLOA 1OQFA 1TVPA 2C19A 1OFOA 1QJWA 4E0CA 5HPCA 3W28A 3MP5A 3P61A 3QC3A 1SSGA 5E0FA 4EWND 2QJJA 3VIIA 3CL8A 3T0CA 5BRPA 1A3HA 1BXBA 4AZ6A 2HE8A 2EPMX 1QK0A 1E15A 3GVGA 4P7RA 1MNZA 2DFAA 3P74A 3GDMA 4DUXA 4XBKA 3WUFA 1ME9A 1YHTA 1VBGA 1Z8AA 3ARWA 6REQA 3AZTA 3DU0A 4C7FA 3L2IA 2PDMA 3SGUA 3ZYZA 1V4YA 1OC5A 5BMWA 1BYBA 1PIGA 3H6OA 4GVFA 1WP6A 3W2NA 1PZ3A 4WIWA 1RUSA 4Y2WA 3WQ4A 4Q8OA 1BYDA 1NWRA 3OBEA 2PDJA 3T07A 4NZ5A 4OHQA 2FB3A 2XIJA 3M47A 1ZP4A 4BQ2A 3F2CA 3LZ5A 4LUSB 1YXYA 5KZ6A 1SW7A 1AL7A 1J6OA 3ZIZA 1AW5A 4JTIA 1MZRA 1QPRA 3CMJA 4B15A 4MB4A 1OHLA 4ERGA 1J2WA 2ANUA 4PYSA 2KZHA 4JKLA 3W27A 1JCJA 2OZ3A 5DN1A 5CXPA 5CKSA 3GDTA 4MJMA 1IF2A 1EXBA 5CZJA 2ZZ7A 1GZGA 3SCQA 4I5UA 1ISZA 1FDJA 3BPWA 2AKZA 1MEHA 3N4AA 4O10A 2DGAA 4LAOA 3ITXA 2QS8A 3QR0A 1BHGA 2HZGA 4QDMA 4AMAA 2OFJA 3UR8A 4Z1DA 5DELA 4LPCA 1S2AA 3V5FA 3AUOA 3FX4A 3GNRA 3S5ZA 3LCHA 4Q8VA 2V3FA 4NZ3A 1S3HA 4GVIA 2HMCA 1ITCA 2H3BA 5LNRA 3MCOA 2CLPA 2ON3A 1UJQA 3LUTA 2YZ5A 1O7AA 3EEGA 5LGXA 3S9IA 3HGJA 3PM6A 1I2NA 4JHOA 3AIQA 3U48A 3UU0A 1SYTA 3WNMA 2Q02A 2YLAA 4IMEA 3DFQA 4I6VA 2PP1A 4Y9PA 5MHBA 5LNVA 1S39A 2NZLA 3NM3A 2X42A 1EZ2A 4YN5A 4LC8A 1YADA 4W5UA 1O12A 1AVAA 2TPSA 4WR3A 1W8GA 4AD5A 1QDSA 1C3FA 2DZXA 3SW6A 4O57A 4PODA 1HP4A 3TNOA 2YCIX 2P10A 2PP0A 4H9TA 3FY1A 4U33A 1OABA 5EMKA 2RDUA 4TVDA 3AIRA 3EOUA 4O54A 3UA3A 4H6KA 2PWDA 4YU1A 3O15A 4CNUA 3KCOA 3SRHA 1F3WA 4RXGA 1VGAA 3KWXA 5IM51 3DYMA 1QWKA 3TQKA 1TIMA 1NFBA 3LBMA 1RP9A 2DIKA 1LBMA 3W86A 4QROA 3ABQA 3KFTA 2VGBA 3ES8A 3GUWA 1H11A 4RCXA 3OBKA 1MW1A 4AIBA 3W7RA 3VX1A 3TJLA 1LL4A 3DFHA 4NYUA 4GQRA 4KCVA 5D2YA 1KV8A 3WJYA 5FJPA 1IT7A 3SO7A 1GZ1A 1UH2A 1XD1A 2YCLB 6PTDA 1RCXB 2ZRUA 3KTSA 4JXCA 1M7JA 1X7FA 2OLSA 4MIMA 4PMRA 4K36A 3VD3A 5E6ZA 3PSVA 1L6WA 2F7FA 3FDGA 4RZ6A 3F4WA 4B5TA 1RCOB 3GX9A 2BY0A 4JFVA 5KITA 1EGVA 3WLJA 3H2OA 4ADUA 1TUFA 3STCA 1XBVA 2TYSA 2WHLA 5A6SA 3N25A 1H7NA 5G4EA 4F8XA 4B2DA 5CPTA 1BQCA 2GUUA 1UD8A 4G7FA 1J11A 3U4FA 4PCNA 3ZZ1A 1UZ1A 5DY3A 4P8UA 1K9TA 2CKSA 2ISSA 3VNMA 1J2BA 4YVPA 4GD0A 4GNVA 3ARSA 1SZFA 4FX8A 3S2CA 2IQ0A 2GSEA 2HNHA 2DORA 5LYRA 4QE5A 5BOEA 3POCA 3UWUA 2GQ3A 5JBFA 5DF0A 2WLYA 2X40A 4HYRA 4US6A 7XIMA 4GY0A 4WSHA 1YRRA 8TIMA 1Z9AA 5G1TA 4LXFA 3TROA 4FAMA 3PY2A 3FVMA 3R0UA 1KXVA 1R6WA 3R10A 3VINA 3W74A 2ONEA 2WMHA 3EOSA 3BXWA 4QSFA 4IQJA 3N15A 2ISFA 4LB3A 4MB1A 4PUDA 4K8GA 1E6RA 1U1JA 3BW3A 4MNJA 1XX1A 1VCFA 4FNUA 1REQA 3UESA 4CU6A 1BD0A 1VYPX 3LI1A 1KFBA 1CIUA 1C7SA 1W3NA 1VC4A 1F6YA 5T8GA 1V7AA 2XSXA 3MHGA 3PSWA 2QDHA 2ISVA 3N2BA 1KR1A 2AL2B 3URAA 2A6LA 4HD5A 2CXEA 3ANYA 4EF8A 4P5UA 1P0NA 2YJQA 3JR2A 2OLHA 1B0IA 2H6RA 4J4KA 4XAZA 5DMMA 4F9DA 2ZA3A 4IXXA 5D2XA 3BQ6A 2PDQA 4HNLA 1NH6A 5TNVA 4DX3A 1QI5A 3PPGA 4C7DA 1LTDA 2B7PA 1F4HA 3O9NA 3H55A 4LVBA 4NXKA 4Q32A 3G2GA 4IMCA 2F84A 3B8UA 1UASA 2BMBA 2C14A 1OFEA 2H8XA 3M1ZA 4JBRA 4H9XA 2RH9A 3WO8A 3IACA 2ZRYA 4AIUA 3STEA 4IJBA 4EANA 2ZKMX 5AYYA 1LRNA 2IMRA 1KR0A 4EPBC 3CM4A 3LXCA 4C1LA 5LA0A 3A9IA 3F1QA 1WAWA 1XXXA 1IIGA 4IZGA 1RK6A 1TMHA 2ZX5A 3PBWA 3NFUA 3SY5A 3REQA 1U5VA 1XFCA 3T81A 1FWNA 1Z32X 1WDWA 2R91A 1XLHA 7CGTA 1OJXA 3W26A 1QI3A 3I4EA 4LY8A 1XLBA 3VUSA 1KQYA 2HVMA 4PZVA 1YIXA 1W6TA 3N2MA 2QCDA 3MZNA 4O1DA 1G6CA 1EJ7L 2PBOA 5BRQA 4D8AA 1KXQA 2UY5A 1QAPA 3FIGA 1XUZA 3LU2A 4U4MA 1UC5A 3EZ4A 1QW7A 2NWRA 4DWSC 3TN6A 3WDIA 4I8DA 3VCRA 3ME3A 4E8CA 2J7FA 1EP1A 4QJ5B 4NRRA 1ICQA 4GACA 3M7SA 4DPPA 4Q4MA 2X0YA 1J12A 2QULA 4C6QA 2WZEA 1JZ5A 5JU6A 1E72M 4EF9A 1EL3A 5DMYA 2WWDA 2D3LA 4Z2GA 5IHRA 1VS1A 5TF0A 4XD6A 1NSJA 3P3BA 2E68A 3MY9A 1LORA 1G4EA 3K8MA 3WD1A 3GIQA 1OVDA 1NU5A 3EMQA 4U5KA 3WMSA 1H09A 4WVXA 4IFOA 4A3HA 3Q58A 1RD6A 2XG9A 5HNNA 2ACQA 3GFZA 2OXNA 4FR1A 3W81A 2VZVA 3NGJA 1TMQA 3M0ZA 1PZ2A 5HULA 3NAVA 3QYSA 2D22A 2X1TA 4JIQA 3LLDA 1GOMA 4GI6A 3C86A 3H53A 2V5CA 1W9XA 3SUTA 3VC6A 1K7EA 1EPXA 2IKGA 5CJMA 4AHPA 4O0ZA 1WKEA 1Q45A 1EQPA 1MFVA 4OBTA 5C2XA 1LQAA 1RY0A 2V30A 3KW3A 3SGGA 3W7MA 1ZBCA 3A9BA 3OW1A 3G6LA 4EXAA 3O16A 1K8ZA 2D2HA 5F1UA 4J3XA 1IWAA 2JEPA 3M16A 4NILA 3B06A 2B81A 2CW6A 4J40A 4L4LA 1U1UA 5MKGA 5CAHA 1AQHA 4BF5A 4WJXA 5AC7A 2QDDA 4N7QA 1H4PA 5CZKA 3WMLA 3LLFA 5AC4A 1QO5A 3O07A 3MUY1 3TP4A 2E67A 2PU1A 4I9JA 2GQAA 2XVLA 4MG4A 1FFQA 4S3BA 4M7SA 4EWJA 4LVAA 2J9YA 4ZZ9A 5FF0A 5HWNA 4LH8A 4F2BA 1KRAC 2EJAA 4DF0A 3TVAA 1XLMA 1UWSA 2OOFA 4O8RA 4UOZA 2OU4A 2ZXBA 2QCMA 1K4HA 7REQA 2QUTA 2Y62A 2FPVA 3MSDA 1UMLA 1XGZA 1ZBWA 4NI3A 4LAKA 2INZA 2HBVA 1JNEA 4J27A 3WUGA 5A6BD 1VJZA 4CU7A 1B9ZA 3EPOA 4JIRA 1E70M 1ZP3A 1YNPA 2CXGA 4M19A 2J7CA 4MNMA 1T0OA 1UC4A 1CXEA 4F0KA 4MWAC 4Y90A 4XTIA 1QBBA 4GYPA 3H23A 1VBRA 3TK7A 2XUCA 2VX4A 1GOKA 2QV5A 3GLCA 1JDAA 2EPHA 3MDUA 3MUCA 4KEUA 2A2IA 5A2AA 1R2SA 2FVLA 3DHUA 3QW3A 4O13A 4JQAA 3UXDA 1V6UA 2WNZA 2WVVA 2OX4A 4EXQA 4AEFA 2PDHA 3W2UA 4FXSA 3V5OA 3HFTA 4I5RA 4QNWA 1Y0EA 3DH7A 1UJPA 3L0KA 3WLTA 3OTRA 1F73A 2P5NA 2EHHA 4K37A 1KBLA 4JTDA 2XN0A 1JXKA 3OYXA 1X39A 2V5JA 2YBTA 1IEQA 4L7ZA 1XC6A 1V6VA 4FSAA 4AY8A 1TV3A 1VPXA 4UQDA 2QDGA 1RHCA 2IPFA 4LNYA 3MQTA 4RX0A 3TOPA 4X0VA 3DYPA 4L61A 3UPMA 4JQ2A 5DFAA 5LNSA 1JDDA 1W1TA 4MWAE 4NX0A 1H1YA 1NP2A 5REQB 5LHEA 1J5SA 1K8YA 1V03A 1GVQA 4R7JA 5K7JA 2BXZA 5I77A 5BXSA 4PTDA 1FWHC 3N9SA 3ZT7A 2GOUA 3T78A 1W1A1 1FH8A 3BLFA 4GWEA 3Q45A 1MW3A 1FHUA 4CN4A 1XH1A 5BWAA 1DTUA 2J7BA 3ES7A 1H2JA 3P14A 4MHBA 2XIQA 1EBHA 5HDRA 1QI0A 1RBAA 3O8AA 2TODA 4REQB 1J10A 3TE9A 1OFAA 2QUVA 2Z0IA 3P0WA 3SCTA 1P4CA 1GG0A 1IT0A 4KW2A 4MPQA 3UPBA 1F8MA 3EX6A 1OGGA 2XH2A 2GJXA 4IUOA 3O7UA 1HVQA 1C9WA 3P8IA 4Y6GA 3UR7A 3QR1A 3VZXA 3HTWA 5LIKX 1K8CA 4L9ZA 1E4IA 3GC4A 4PMDA 2WM0A 3NPWA 4QR6A 3S6OA 3NQVA 2G0WA 1EO7A 3WQ5A 3SN0A 3CHEA 3TWAA 3PVFA 4LBUA 2JKPA 3T0AA 2GK1B 3U8GA 2E5CA 3NG3A 1MRQA 4ENLA 4X9SA 2VEKA 3MSGA 1R0MA 3UZWA 2AL1A 1PKMA 1E56A 4G5DA 1ONXA 1AD4A 4IIHA 3PWIA 4UNKA 3LDVA 3WH8A 5F4XA 3IV3A 2CLMA 3EXRA 3CPUA 1GVYA 3GXPA 2RDXA 3OLIA 1F3XA 4ZQOA 3KRZA 3DHPA 3LB0A 4FX6M 3AYSA 2EQDA 3FSUA 3R58A 3OLGA 4XAGA 4UTUA 2XGIA 3WQ6A 2G5WA 1QMLA 2R94A 3BSHA 2YKKA 3RLGA 1MI3A 3UP8A 4Z0JA 1ZAIA 4HKPA 3PUEA 1TTQA 4E4FA 4AH7A 4IG2A 1PKNA 4S38A 5HQEA 3NO1A 2NX3A 4UR7A 4L5ZA 1OK6A 4MJZA 4DJEC 1XIFA 4EOUA 3RCYA 2TAAA 4G9PA 4P7OA 3R12A 4PUEA 3D3FA 3GW0A 4GH3A 4QLLA 3TV8A 1Z89A 2RGMA 4YWIA 3KE0A 3F5KA 4ZL1A 4FLSA 1ZJAA 3GS6A 1DJNA 3H2FA 4JTRA 4V1XA 2XINA 6REQB 1I2QA 4LBSA 1G67A 1UCWA 3CHDA 3CC1A 1UR4A 3VK5A 4DELA 2GFTA 2DVXA 2YA1A 3OVPA 2O9TA 3VNYA 2D2GA 2NQHA 3T8LA 4RXFA 5D2TA 3TYCA 3RMJA 4JTJA 1MUWA 5JMUA 3VO0A 4PMOA 2WCGA 2E3ZA 1E71M 1DHKA 4HTYA 2C7FA 4C65A 4HHMA 1K6WA 1M04A 3IJ7A 1XIIA 5FJTA 5GJPA 4ZOEA 5AFDA 3HF3A 1HXJA 1CLKA 4C6JA 4F66A 1PHQA 3AU6A 1Q2RA 1I1XA 1S5TA 2ABAA 2BGSA 3LRMA 4B16A 3TLLA 3Q4DA 2UY4A 5LXEA 3AXHA 3I6RA 3NIYA 4AHQA 1XLGA 1ZSXA 3HOJA 3V1HA 1OWQA 1Z48A 4C5YA 6ALDA 3T55A 5I3HA 5EU9A 3W22A 1I2PA 1UUQA 2QCEA 2CBUA 3VIFA 1V93A 1ZNNA 4UZUA 2VC6A 2Y7FA 1DXFA 3WQPA 1K7FA 4AXKA 1PIFA 2WJDA 5DCBA 3N73A 4J2MA 3W1XA 4MY8A 1IXQA 4KWOA 4LCQA 2WKLA 4FOUA 3USZA 1HQTA 3SCSA 4LJ3A 3P81A 1LOLA 4UQCA 3WUBA 1DWFM 3A23A 2JKEA 2UBPC 4RZBA 5A69A 5E0KA 1FDYA 1Q3NA 3MYOA 4IX2A 1PL9A 3QH2A 3AIBA 1JYWA 1OIMA 2CC0A 3G6MA 1DE5A 1TMLA 1HL8A 3UETA 3IVSA 5C54A 4IOTA 1VBUA 1XKYA 1ZS2A 2VC5A 2HPIA 3THUA 3CUXA 2R9RA 3A22A 2CCRA 4H04A 4M81A 4YIWA 1FWJC 4R7WA 2DSWA 3SY8A 2OQYA 3UWZA 1AJ0A 3CPGA 2VOTA 2Z6IA 4MPKA 4FPSA 1JCXA 3G1FA 2QXWA 2YFNA 1CW2A 4PUUA 1KFJA 1S5WA 1JD7A 5A2BA 1FWIC 5J5RA 3UJ2A 1XYBA 2XDFA 4CKQA 5BOOA 1OF6A 1OG0A 2B0MA 4I9AA 1EIXA 1P7TA 4XBSA 4XTDA 2WO5A 3RK8A 1HGWA 1Z6KA 4X63A 2HVOA 1H61A 1W31A 3LMZA 4Q8PA 3IPWA 3DESA 4YYFA 1OFDA 1VFOA 1MUMA 3MKCA 2YL5A 4JX4A 4C6IA 3UJEA 3GU2A 4HNUA 3BZJA 1R7AA 1ZJBA 3CXOA 4ZFMA 2PP3A 4MKSA 5C6MA 1HTIA 4D72A 3M0JA 4JL1A 3QQ1A 1LG1A 2WVUA 3U7BA 1L9WA 3SRKA 4CQCA 1MQQA 1Q13A 4GO8A 4IP5A 2WNWA 2G41A 2PCEA 5I79A 4MFDA 3C4UA 3KEHA 4AC7C 4YTSA 4MJ4A 5IFTA 2HS8A 3CIXA 2INFA 2J47A 1ZBVA 4CLMA 3W7KA 5M2FX 4JFSA 1TJ0A 4HVXA 3AALA 2PC8A 3L5MA 2P0IA 4K6AA 4QG9A 1HNYA 2WK2A 1ICPA 2V5LA 1B2YA 1TB3A 2GPTA 1KM0A 4F2TA 2ZVIA 3FJ6A 2O9RA 3II1A 4GVGA 2P0OA 4LBRA 1GVOA 3RRXA 2QF8A 1W3KA 4RE4A 4KWWA 5D2VA 5C2GA 1SM9A 2OGJA 1JDFA 1CLVA 1LRQA 2RGLA 3BO9A 5LSMA 1HJWA 4GC3A 2YW3A 3BLPX 4ZQRA 3QY7A 2I9EA 4IF2A 3VKKA 3IJ6A 1VCVA 1NF7A 2VD8A 3FKRA 1A4MA 1RA0A 1YPXA 2OELA 2NV1A 1TQJA 1P43A 1DWHM 4DN1A 2Z6JA 1K9FA 1OX6A 5CBJA 5CG0A 1G4TA 5AYIA 3EOEA 2ZOXA 4DQWA 4IXHA 3KLLA 4J1OA 4QHRA 4MUPA 1E4LA 3SN4A 5HJYA 3MP4A 4XWUA 2NLYA 3CL7A 3UEQA 4DY1A 4NZ1A 2VUYA 4A22A 2X1RA 3EWXA 4DWSD 1REQB 2ZX6A 5I78A 3EX4A 3WSUA 3BW2A 4CU8A 4S3EA 4Z1YA 3TJ4A 3C0SA 4DYEA 5I07A 3JRKA 4XSLA 3NQAA 3C2FA 3ZSTA 4DLFA 4ZMGA 3E0IA 3QHNA 3R5EA 1VHCA 2GDUA 1R3RA 2YZRA 3IEBA 1FCQA 4Y8EA 2OX1A 3FLUA 4WY0A 4AZHA 4D6JA 4X9YA 1J93A 4K39A 1UWQA 3BG5A 1F74A 2GVEA 3W0KA 4PH6A 5DCEA 1CXKA 1N82A 2NLIA 3KOZA 2JIWA 4LVGA 2WNNA 2QCHA 2UWFA 1M41A 1D8WA 1O6IA 1SW0A 2W91A 1QPQA 4NL1A 4HZ8A 3NQCA 2WSPA 4RW5A 4ZB0A 1P1MA 3TLQA 3DBPA 3OLDA 2VOMA 2A3HA 4YPJA 2ACSA 1HJQA 4DF2A 4M56A 4UTWC 4DUWA 1IE7C 4GY7A 1G7VA 1WOAA 3C6CA 2C16A 5ABGA 4PBEA 1JI1A 2HISA 4I7VA 1B31A 1A80A 2ADAA 2F6UA 1TELA 3B9EA 4DRSA 3WF0A 2ZADA 3UZYA 3REQB 3VGHA 1J0YA 3QVQA 4HQVA 1Q6DA 2C79A 4H8UA 3MMDA 5K4XA 4JDYA 2QCDB 1LF1A 2W5FA 1TVLA 3G5EA 3RIKA 3WEOA 2R6OA 1V6YA 2Z25A 1XI3A 1UUMA 1XLLA 3E0WA 1XL9A 3V0SA 1XUUA 3TW6A 1BYCA 2FMNA 2ACUA 1PX3A 1NOUA 5I02A 2DU2A 2E6YA 5G1MA 3UT0A 3WDRA 3EX2A 3VKBA 4Z0SA 1WBJA 3B9NA 3GR4A 3LHYA 2V5BA 5DEZA 1DWJM 4IQEA 3O1NA 1H5YA 1EJRC 1B1YA 2HBXA 4PCSA 4A8NA 1S5MA 2Z2BA 3OGSA 5M3WA 3DFPA 1ISVA 1DBTA 4LU0A 2ISDA 4G7EA 1FX6A 1JI2A 1A3XA 2WSYA 1WDDA 4WDUA 3CLMA 2Z7GA 4CN6A 2AAMA 3MZ2A 2I57A 3W72A 4OBSA 3PBVA 2VGFA 3UG5A 2QGHA 4X3ZA 4OV4A 1Q6LA 3M07A 2E8YA 3R1ZA 2ZZ5A 3GIYA 3AXMA 4N9DA 3DHFA 3L4YA 4FOKA 1J4EA 3WD0A 1HT6A 5BYWA 3NEHA 3RFAA 1OEPA 2WLZA 3W7DA 1RJPA 2YDAA 1TV5A 4HP5A 2CKRA 2QPUA 2ZZ1A 3D3AA 1W9UA 2PSNA 4Q4PA 1FHVA 4DNMA 2PLCA 5CLTA 4Q8MA 3B0PA 1R3SA 4E3TA 1TZ7A 3VIPA 1BKHA 3PUOA 3AJ7A 1R3WA 3S83A 3WZ0E 2ABBA 4LNCA 2WC7A 3CHCA 4BR1A 2VELA 2IPGA 2BVDA 2JIEA 2FPTA 3AROA 2DZAA 1I0BA 3FYOA 2VQTA 5FSDC 1G0CA 3M46A 3CWOX 1FWWA 5MKGB 2XH7A 3MKKA 1V3HA 5E6YA 3K30A 3O6DA 3TYUA 3WNOA 3MV01 3CHFA 1XDMA 4XQ6A 1M9HA 1TWSA 4C90A 1ICSA 4C1NA 3I7RA 1ZQ5A 2WHKA 3FXYA 2DZTA 3E5BA 2YFOA 4G6CA 2VX6A 5KINA 1X6UA 1BG9A 5K9XA 1BQGA 3MA8A 1SSDA 4FLOA 1JPIA 1R85A 5HANA 5GQBA 1KLYA 2D0HA 4DBUA 1P0BA 1GQLA 2W27A 3HO8A 3QBUA 5BU6A 3O6AA 3KS5A 3ARYA 1L2UA 7REQB 3ARRA 5FKYA 3GSMA 5TBOA 2ZE3A 3W6MA 2ZA1A 2ZQ0A 4MY9A 4ZXOA 1W56A 3MWAA 1UA3A 3QKEA 2CZFA 3MANA 2Y85A 3E2QA 3ONBA 1VR6A 2PWVA 1SW3A 1UQYA 4HPHA 4MSSA 2LLEA 2VZSA 3K2GA 1PSCA 4HNCA 3GBEA 3M0KA 1K4GA 2R14A 2XH0A 3W7OA 1M3UA 4ATWA 5C8BB 3NZPA 2A7NA 4HZ7A 3QV6A 5HPOA 4GXMA 4JTTA 5A2CA 1PTDA 4WGXA 1HKKA 3EXTA 4NZCA 4GJJA 4KPLA 2WVVB 4WDXA 3W37A 1PEZA 5K4ZA 4Y9AA 2PTDA 3WLOA 1G9HA 5JBEA 4L4MA 3TWBA 3DFYA 3FAXA 4Q8WA 3UWYA 1W3LA 1LBFA 5DXXA 1YLVA 2HK1A 4U10A 1CECA 4W89A 5E9XA 2XH4A 3WQEA 1J0ZA 1SR0A 2HEJA 2GSHA 1B9BA 3WDHA 4LYKA 4P2VA 3NPXA 3WMBA 3L9CA 2WMIA 1IV8A 5C7VA 1W0MA 1RK5A 1EZWA 2QIIA 1EDTA 5C70A 2QKFA 4P7LA 4GI4A 1J0KA 1OB0A 3QJAA 5BNKA 3BOLA 4H1ZA 5BXPA 3VOFA 1RCQA 4B5UA 3A21A 3EB3A 4LUIA 2CZ5A 1TZZA 3N2CA 1WA3A 4NASA 5A8QA 1SZRA 4JTQA 4KCTA 4MB5A 1CBGA 1V0MA 4HA4A 4YLWA 3TN3A 3CO4A 5D4YA 5EB8A 2ZRXA 3GTNA 4HHHA 1DV7A 4FP1A 4AZBA 4KF1A 1H7PA 4OWGA 2HNEA 3CUIA 4PTNA 4JCMA 4O28A 3QFEA 1LYXA 1TIWA 2XFYA 2I5GA 4ZGYA 2EKGA 3OIHA 3TYAA 4LGXA 1SFSA 1XF0A 2GJXB 2PDPA 5FAGA 3W1NA 2PDLA 3UZJA 3SJNA 3CZLA 1TJPA 3LQLA 3GTFA 3TUUA 3I6TA 4L4PA 4MNKA 3CTTA 1VFLA 4ONVA 3HGSA 2XIBA 1GJUA 4F0MA 4IFKA 3ZVIA 4UR9A 4DLMA 3EDJA 2VFHA 2PD9A 4CUCA 1KB3A 1ADDA 2VCAA 4HK6A 2A7RA 1YBQA 4GUJA 1PZ1A 1T5AA 4YVVA 3BCFA 4RZ5A 3CZEA 2MNRA 3QZEA 1PO9A 4EPEC 1DP0A 3KBNA 4X61A 3LHUA 3RCMA 2E6AA 4WDWA 1VEOA 3NJ3A 1VJIA 4QRNA 5A6MA 1DPMA 3MYPA 4R27A 2QJNA 2VEPA 1A5LC 1TZ9A 1ZALA 4HSOA 4Q3MA 4QSHA 1RVGA 3WF1A 3W1TA 1VAHA 2QIWA 5CC5A 3I65A 1K9EA 2JGYA 4TOQA 4HCLA 1YX1A 2OSXA 2QCNA 3WDPP 3ZQ9A 4L56A 3LSBA 3CB8A 3N19B 4ZVJA 3KM8A 4LW7A 3IUDA 2PPGA 4IG2B 4NNCA 2PU0A 4WRHA 5I24A 3BGJA 3HPXA 4XBJA 3GYEA 4RDYA 2OWCA 2VT0A 5F4WA 1NOFA 2WQPA 4JTCA 3PBYA 4N6FA 1KD0A 1EUAA 2XVKA 4K8HA 4B5VA 5KZEA 3RYSA 3SQMA 1YPIA 4QDPA 4QJ4B 4KKXA 1FP8A 2OQLA 5DRIA 3VDAA 1IGWA 1UP2A 2ZRZA 2CLKA 3FJLA 1YNYA 1E6PA 4RW3A 5A6JA 2BNJA 3V0UA 1CCWB 1JGMA 1YW1A 3FJ4A 3W02A 3G0UA 3NQEA 3A5VA 4UNLA 4AFYA 4WKHA 3CWNA 4JQ3A 2PEVA 3G1AA 4KEMA 4MJ2A 1JF5A 4A8LA 3IJ8A 4OU1A 4XAFA 2GJLA 4MGGA 1NFPA 1A49A 2FFIA 1JQXA 1S5VA 3DG6A 3T0TA 3VZZA 2QW5A 4E6MA 4O19A 1LJYA 3N3MA 3C0JA 3AZRA 2IKHA 4JYFA 1RP8A 2C13A 4PMXA 3TN4A 3MVTA 4H9MA 4POCA 1Q63A 4J9JA 3GR8A 3DEQA 1AQFA 1WDPA 1B3VA 4FALA 1EA9C 4MLRA 5H6HA 3TX9A 2DEPA 1KRMA 4JTSA 3ZR6A 4GUIA 1VRXA 4QM1A 1FFRA 3T6CA 3S6DA 3R89A 1L6GA 5JVLA 1UZHA 1VIWA 1UR0A 3RGTA 4EX4A 5AHMA 1UR2A 1J0HA 2GGHA 4UCFA 4PRTA 3LTYA 4NJKA 1W3TA 1UPMB 1Z7AA 4K3ZA 4BZYA 1RVKA 4H7CA 1M7OA 1XLCA 3M6YA 3OA3A 4GCXA 2PC4A 2XVPA 4Z42C 3NSXA 1B54A 3SCNA 2Y8UA 5G4WA 1RQEA 2PLMA 1TFVA 1L6FA 4TVCA 2DIJA 1FBAA 1F5ZA 3PZTA 1SFJA 2OMAA 1EP2A 1E6XM 4W7WA 3RX4A 2DUAA 3QMRA 2D73A 4HU8A 3OZPA 1P6CA 3VMPA 3GWQA 1PWMA 4MWAB 3N4EA 3PTDA 3JVAA 4UTLA 3N13A 3LI0A 3R8GA 3F4VA 4BK9A 3P67A 4QISA 3HMJG 1K3UA 1ONWA 2VUNA 3N11A 4DJDC 3NXLA 4NF7A 1Y8BA 4CCDA 1XBZA 4UFKA 4AEOA 4JDBA 4F0SA 4K68A 1OFPA 1TR9A 3LXBA 5BZAA 4R88A 4UFMA 1DKWA 3JU2A 3RN6A 2Z1VA 5A5WA 5HWJA 2CLHA 5CZTA 4LS1A 3CIWA 1P7TB 4HPXA 1ZL1A 3KCLA 2D23A 1Q85A 3KRUA 2WM1A 2HS6A 3VNDA 5F4SA 1FUYA 3M64A 1CXFA 2FDMA 2WMJA 1UH3A 3QGAC 4B4FA 3A3WA 2OVLA 1SMDA 3IIXA 4I7UA 1XC4A 4OTKA 2Y7GA 1O4UA 4JOMA 1C90A 1R87A 1GKQA 3C2EA 1NTHA 4O53A 1QNVA 1XYFA 5HUOA 3CK5A 2FQIA 3IK2A 3MBDA 2XPKA 4ZCWA 4B3ZA 1YDOA 1POKA 2R8WA 2ZXDA 2PTXA 2SFPA 1GT8A 4QCFA 1OSEA 4L65A 2BY3A 2OEJA 2G50A 4M1RA 2D0FA 1EF2A 2FJUB 3IARA 4UBPC 1PHWA 4D8ZA 4CCZA 4HYVA 1J18A 1LP6A 4US5A 4S3GA 3CU2A 1ZENA 3IANA 3UFYA 1E55A 3S1UA 4HA3A 1KM1A 4WCJA 1MW0A 5C0QA 3MJMA 3G1SA 4RZ4A 3PJUA 3QV7A 3W88A 2Y7DA 1CNVA 2VX5A 2GDQA 2VJXA 5I09A 3S4TA 4LAMA 4ES4A 3WK0A 3H4WA 3BVJA 3W1AA 5C2CA 3H4XA 3SSJA 2E8ZA 2CNCA 4R3UA 1DEDA 4ALDA 1XGDA 4O1EA 8CGTA 1W5PA 2EG7A 5CZ0A 3WKZA 4HNOA 2QVHA 4H7VA 3H21A 1HJSA 4J3ZA 1XYAA 1VYSX 3MW7A 3GD6A 1PPIA 1R47A 3EXSA 3KL5A 3PS7A 1QHOA 1HF6A 3N2OA 1CT5A 1W54A 3HPFA 3QFWA 5AVNA 3BLEA 6XIAA 2WZMA 3LPGA 4WSJA 3HFYA 4I3GA 4Q8UA 4RPPA 2W67A 3KBJA 4DO5A 2CLOA 3SEPA 1ZTVA 3C5QA 1JD9A 3NQGA 4V1YA 3VOIA 4ZQPA 2WWCA 1B3OA 3BCDA 2JGQA 3LERA 1K8XA 3RJYA 3PJWA 4B9YA 3UG3A 4H6EA 5G1YA 1QW8A 4EKJA 3OG2A 2W79A 3TYEA 1W8SA 1DJQA 3LLXA 2G3FA 3IJ9A 4GGHA 5EYWA 2X1SA 3KVMA 3ZLHA 3U5UA 4AZ5A 4JGDA 3URBA 4XX6A 1OF8A 4WY0B 1GOOA 4F2UA 3UZZA 1SO3A 3AIUA 1NWTA 4HNTA 5D8ZA 1B3ZA 4NXSA 4L1WA 1SZGA 1E4NA 2HPMA 3MB9A 4QITA 1GKPA 4IMDA 4HA1A 3MDWA 1JUBA 3E6EA 3PP7A 3TOYA 1I60A 3OODA 1C8QA 2WHMA 1VFFA 1VIZA 4WSKA 3M5ZA 3W2LA 1YE4A 5CZSA 5DQPA 3R0DA 5K2ZA 3M9YA 4CQ9A 1MZHA 3TDFA 2ZX9A 3MO4A 1TTJA 4A8IA 2AQVA 4H8VA 2X1IA 4GX9A 1QNSA 2NUXA 1DVJA 3J7HA 3DENA 1QNRA 5BXRA 3SI9A 3S2MA 1PS9A 2CESA 3F2DA 1LOSA 3CYVA 1XYCA 3N18A 3PG8A 2BVWA 1HVXA 2J79A 3THCA 2P50A 1KCXA 3LBCA 3WMCA 1MEWA 1SMAA 2WHJA 1Q2SA 2Z28A 4PULA 4UQ9A 2A0NA 2VEFA 1F2JA 1EC7A 2J7DA 2RJGA 3AYVA 3PZQA 4BA0A 3SCVA 1ZLPA 3LCWA 2DH2A 3I7QA 4AEEA 1IEIA 3AIEA 6TAAA 5I3KA 2NSOA 3R4IA 3W1PA 4MADA 3C2VA 3JZUA 1XYZA 1BF6A 4WK9A 5A6KA 3GXDA 1AZ2A 2ATSA 1S1RA 3KL0A 3A12A 2BG5A 2ZX8A 3CUJA 3U57A 2QCCA 3ARTA 3EDFA 1YTKA 3KTXA 1UKTA 1N2VA 1GVFA 4NAEA 3AXXA 1WYIA 4BWLA 4UZSA 2F61A 3DC0A 4B4HA 4HN8A 4RLIA 4MYAA 4JKMA 3IGSA 3E9AA 2REQA 4G7EB 1LWJA 1S1PA 2Y88A 2V38A 3A5FA 4D6FA 1BFNA 3AUJA 4IP7A 2OZ8A 3T09A 1CEOA 4ZSUA 3VOCA 4DJDA 3KP1A 3AYTA 1D9EA 2E28A 4QP0A 4GBDA 1B3YA 1LT8A 4WOQA 2EPKX 1GJWA 4G1KA 2FVMA 5L6UA 5C9RA 2O55A 3VGGA 4ROPA 2CBVA 5GJNA 2VFEA 5I5RA 4IIEA 3P5ZA 2W62A 1EOKA 3A64A 3M0IA 2FKPA 4RDVA 3M0VA 4LX4A 1W5MA 4C6BA 2B7QA 2PWGA 1H50A 1THFD 3K4AA 1XISA 3Q94A 5D30A 3EB4A 3R2GA 2QMJA 4B91A 4IIGA 3NQ6A 3OZMA 5D2WA 3QF0A 4Q33A 3PULA 3EMCA 3W7HA 2V68A 3HJEA 3H70A 1N8IA 3PTQA 4KEVA 3G0SA 2R1LA 3QN3A 3EYPA 4XZ9A 3GHTA 4ZSTA 1NQ6A 4XVDA 1QFEA 3WBXA 5FJOA 2FH6A 1PUDA 4HU4A 1XPYA 4C1NB 3NQ7A 1UZ4A 2FZBA 5LXXA 3BAKA 3VOGA 1XBXA 2UZ9A 4D6CA 1ODUA 3O6CA 2X8RA 3M4HA 2UY3A 3APYA 4GX8A 3GAYA 1JPHA 2R24A 1TV7A 2NWSA 2EGZA 3RDKA 3M41A 1DWGM 4AVOA 4BQ5A 4FS9A 3KVKA 4LUTA 1SZEA 4AWUA 2WMKA 3L7RA 3WF3A 5IRPA 2BY1A 4D6IA 1QHPA 4LEFA 3WLIA 1W1ZA 4XZHA 3PTKA 1MVYA 4AZIA 1XINA 2AQWA 4IH3A 4ICCX 3L2LA 4RDWA 3NZGA 3BL3A 1JVNA 1FOBA 3GZAA 3VOHA 1HW6A 3VGEA 2QR6A 4DVOA 3S42A 1JAEA 1XP3A 3GIPA 3VNJA 3GVVA 1EGMA 1ZCCA 5AZ1A 3T9PA 5LZLA 2GDVA 5CC3A 4DNHA 3PZMA 2ZE0A 4AQLA 4GXPA 3UVIA 3PZNA 3M7WA 2WJFA 5U7SA 3W3OA 3ZJ8A 2DSKA 1KKRA 4GNKB 1CGYA 2EO7A 4UTMA 1Q6CA 5CPMA 3WBWA 1GYMA 3MMUA 1XDLA 4IPIA 5AECA 3DN5A 4GIEA 5E70A 5SWUA 1XR2A 4UWMA 1A0EA 1Q6GA 5CGTA 2VHLA 4PMYA 1TV8A 1XRTA 1V0LA 1RLDA 2WKGA 3UWEA 3G1VA 1HIZA 3WENA 3BTNA 1UG6A 2Y2WA 1RJRA 4R33A 3WH5A 4M1BA 2DQXA 1DXIA 4C5ZA 2WMIB 4JL2A 5FACA 4GZ7A 4B5XA 3T0BA 4DZIA 3LTPA 4IMFA 4YTUA 3O0KA 3JUGA 4KT2A 3T2OA 2FHBA 2CHNA 3GG0A 3NZRA 1GW9A 3WQCA 1GQIA 1KBKA 2Z26A 2XISA 4LRTA 3CT2A 4HZ6A 1RPXA 2NVAA 3LM7A 1W1B1 5AHIA 3S2JA 3FYYA 4ATLA 1VEMA 4NNAA 3UCQA 4FLRA 4KETA 3C3UA 1RD5A 5A6AA 4GHRA 2O4MA 4BQ3A 1XRSA 4JFTA 3GFYA 2O7SA 4CNOA 1GORA 2Q09A 2OKTA 3C8FA 2BHUA 4M51A 1S38A 1HGYA 2Y63A 3UWQA 3I10A 1BWLA 4OUIA 2CZDA 1LQ2A 1JCYA 1Q6RA 1MFUA 2Z27A 4BF7A 1RSCA 2HCVA 2VDGA 4ECLA 3OBAA 1WXZA 4JS3A 4D6DA 4TTGA 3OZYA 3AXKA 3PFMA 4HBKA 4OZOA 1RALA 3OYZA 4FLQA 3THQA 3HA1A 3M0LA 3MO7A 4IFKB 4O4WA 1KO0A 2J13A 1WKYA 3N6JA 2CBIA 3BG3A 4D9PA 1OK4A 3LSCA 2MANA 1YBQB 3GNNA 3PB2A 5D9MA 6ENLA 3INPA 2V67A 1EF3A 4KRTA 3RRAA 1AODA 5FJIA 2ZZ6A 3NXFA 2CWXA 4DUVA 3CYJA 3LX9A 1OFRA 2YL8A 2IS7A 3WNPA 3STPA 2HV5A 4BF9A 1NEYA 1TV4A 4CD4A 1GGOA 4KBXA 1XSIA 4A3YA 2A3AA 3W7LA 4E8GA 1EO5A 4GYKA 3W7CA 3S2NA 2VKZG 2FLIA 4HMCA 1FWSA 3AMGA 5AYBA 1WO2A 4BFAA 4RV3A 5FEXA 4W86A 4CD8A 3ABZA 3TYDA 3CNYA 1IWBA 3FA4A 2EBNA 3ENLA 1TWDA 3L0GA 2CLEA 3DG3A 3GVQA 4GY1A 3ZSSA 2G3NA 3ABXA 3VNKA 2ZRVA 2E6DA 3CIVA 4AVFA 2PE4A 2G3JA 1UKSA 4S3FA 3CUZA 1Q65A 1DJHA 4YHEA 4JZ5A 3GXIA 3W7QA 4KRZA 3CZKA 2PB1A 1Q6OA 3AI0A 3LM3A 4N4QA 1JCNA 2YCEA 1SJAA 4LV9A 5HBFA 2QPXA 2GL5A 1O5XA 4PCPA 4J28A 4M6VA 4GOAA 1I6NA 4NI8A 3W24A 1QWGA 1V51A 3RM8A 5C55A 5RUBA 3M0YA 3SCUA 1GQKA 3PPFA 4ZQMA 3TCSA 4OECA 1XYMA 4ACYA 4AW7A 3QY8A 4PE8A 2HXTA 4IIFA 1TPC1 4RNIA 3CAKA 3A24A 3PB0A 2XJ7A 1TA3A 4FNSA 4XZWA 4QAWA 4S39A 4A29A 1XG3A 4R9OA 5EL1A 2I5QA 3GTHA 3TYBA 2CLIA 3PZGA 3E38A 4BI5A 1AA1B 3UGRA 5DBUA 3TA6A 5IOBA 1OY0A 4O1CA 4TMBA 3LZ3A 3FFSA 1UA7A 4MNLA 3VVGA 4CNTA 1H49A 2J74A 1E0TA 4OV9A 1QO2A 3WJSA 1B3XA 1PYFA 4NNBA 3TFCA 3QY6A 4EAYA 5JUVA 4MZYA 3A4JA 3LEPA 4IQDA 4A05A 2OKOA 3QEZA 4JTLA 4RE2A 3IAPA 3HU7A 4DBDA 1AUSL 2H3DA 4R7OA 4A4AA 3FSTA 2VZOA 3BK0A 3S1GA 1FCUA 1UWTA 4Q7IA 4IQLA 3QGVA 2DIEA 4EK7A 1WOBA 1YKWA 4PMVA 3TC3A 4U31A 3ZT5A 4Z08A 5D9PA 1FHLA 4IMGA 4NKCA 1UP3A 1YMYA 1M7PA 1OBAA 3FVDA 3N2XA 3BAWA 1ITXA 3OZOA 1X7IA 3BARA 3CUFA 1LT7A 2E5DA 1OT2A 3ZJ6A 1X1NA 1E6NA 2XN2A 1SO5A 1FWDC 2DDXA 2HJPA 5HMSA 4HCHA 1U83A 1IQ8A 1DIKA 2IXVA 3CB3A 3KBSA 4A2RA 5CGQA 4CNNA 5HQMA 1V08A 7PTDA 4H2CA 1TJ1A 2C15A 3KOYA 2CYGA 1B3WA 3WFZA 3AS3A 1MXSA 2W63A 4JIHA 2GOKA 3UPWA 3G22A 4LUYA 1F3EA 2FMOA 4XD4A 3DOPA 2B7OA 3EA3A 4KWSA 4GUGA 2BOGX 5BW6A 1R3VA 4IJRA 3GHSA 4O18A 1BPLB 3GK0A 3LG3A 2NX9A 3NPUA 3OPSA 4O16A 5GJMA 5H8PA 4LEQA 4C91A 1YDVA 3TH6A 3KCJA 2O9OA 3B4YA 2A3BA 9CGTA 2PTZA 2BY2A 3H24A 3R6IA 1AZ1A 2OO0A 5A8PA 1O68A 3QR3A 3S9YA 2HDJA 2VR4A 5JH2A 4K7YA 2QLYA 2ASHA 3CQIA 5F2GA 2AGTA 1FH9A 1V3LA 2PWEA 1V79A 1FXPA 4YTRA 1JF6A 4GIAA 2Y24A 4MLJA 3WUEA 1UP0A 3U5YA 1I2OA 5EFFA 2VEGA 4KS0A 5FAJA 5FSEC 1E43A 2F8QA 1XLJA 5KZDA 2Y5JA 3N2TA 5CAKA 1GVIA 4AD0A 3B0YA 1JAKA 2G37A 3M6DA 5FF2A 1TSIA 1WCGA 2Y4SA 1BLIA 4OGZA 3JS3A 4KGJA 5GPRA 5A3HA 4JIEA 3PPHA 1WX0A 2F38A 4B3LA 4GC4A 3MS8A 1QOPA 4OFCA 2YB4A 1OCNA 2HTMA 4WZHA 2PDCA 2PURA 3ZMRA 4ZXLA 1US0A 4YNGA 1QT1A 4GLEA 5IBXC 4GYPC 3N12A 1GQJA 4JCLA 3QOMA 3FKKA 3OVRA 1GG1A 3IRSA 3SGZA 1V3JA 3E74A 4XIMA 1CGVA 3UR2A 2UY2A 4BI7A 3CUHA 3UYIA 4ZO9A 4Q22A 3WQVA 3WH9A 4NIRA 2VR2A 2C71A 3MI6A 4HOXA 2YA2A 1TCDA 3NL2A 2R1MA 3F7JA 3HV9A 4MOZA 3KBVA 4WDTA 2YYTA 2VGGA 2VFGA 3E0FA 3O05A 1M01A 2VXNA 3G3MA 3CZ8A 1R8LA 5EY5A 4UTHA 1TTIA 1EJSC 5E0CA 2NT0A 2NX1A 3BMXA 1NFGA 4Z17A 1A5MC 2A1YA 2PDKA 4ML4A 4O15A 1UROA 4HPJA 3NVTA 4O1FA 3DBNA 4NYYA 3ISIX 5HMDA 2ACRA 4KFOA 5G2HA 1F7BA 5CQ1A 4FOJA 4URIA 3N9RA 1M6JA 2A3LA 3QLDA 5CEWA 3SRFA 4W4QA 3SUUA 2ZZ3A 2ZXQA 3TONA 2WVTA 1AJ2A 1Q6EA 2G95A 1GOIA 1GK8A 3BJFA 3G8RA 2E09A 6A3HA 3OU8A 4ZO8A 2OLAA 3EMZA 3MUZ1 3ARUA 3ZLGA 1XLKA 4EPKA 2WJEA 3P60A 2V63A 1JG9A 3NOYA 3VDBA 3W70A 3RLHA 2UV8G 3S47A 3EA2A 2OWWA 2DZVA 3KHDA 4JN7A 1F6KA 3QW4B 8XIMA 2CPUA 5JH1A 2I17A 2VTFA 4BCEA 2DPEA 1NQKA 3DKJA 5B7YA 2Y5SA 1WDRA 4O50A 4WX2A 2FGBA 1QI2A 1DYSA 1XRFA 3FW6A 5KMYA 1RQHA 4QBXA 1KBJA 3UD6A 3HGRA 2VC7A 1GWJA 4O0QA 3VXGA 1QR7A 5M03A 1E3ZA 1QPKA 3N6HA 2QUMA 3IRDA 3L21A 1XFBA 3O06A 4PL1A 1VB9A 4PTXA 2ATMA 1AL8A 1UD6A 4PB4A 1JYXA 2OPJA 3L68A 1NIUA 4MM1A 1L0PA 1J0IA 2PDNA 3ZXWA 5LKYA 3CH9A 3E02A 2AAAA 2TMDA 2Y6ZA 1B57A 2GQ8A 3VZYA 5K3VA 2X16A 1JZ7A 3LCXA 1GPWA 1XW8A 1J6PA 4NAEB 4DJFA 8RUCA 1ITUA 2PS2A 1JCLA 2D2OA 1DIOA 4XV0A 1UMYA 3HPZA 6TIMA 1TX2A 4M0XA 2GJNA 2NSXA 4ACZB 1WKFA 2REQB 1SGJA 3E2SA 5JIPA 1N8FA 3UG4A 4WD0A 3AAMA 1XRVA 3WNKA 3DHDA 3O2LA 4S3AA 1FTXA 2QAFA 2PFHA 4EP8C 4IUGA 5CSYA 1HJVA 4AWSA 1HKIA 1W1YA 2BX7A 2VQUA 4IWWA 3W75A 4XKMA 1VD6A 3V0TA 5AN7A 1KWGA 2YB1A 1PE1A 3CV2A 1LWHA 1FDZA 2QHAA 1OINA 4LVFA 1XM3A 3OO2A 2XYLA 3RX2A 2WSKA 1Q4NX 4WY0F 3ARZA 5LA1A 3JZEA 1ONRA 2WW5A 4LF2A 3B04A 4UIOA 5BU9A 4MTVA 2NW0A 3TC6A 3W53A 4E2BA 4JR5A 5BROA 1VEPA 2ALDA 4LF1A 1TR1A 3EKZA 3L4XA 3LNMA 5DCDA 2Z1BA 3P6LA 3GG7A 3W7JA 3ALGA 2FTPA 3FNDA 5HNTA 4HPGA 4GNJA 7ODCA 4P7QA 3SY1A 1KM4A 3N04A 5G2WA 3DZ1A 4LS2A 3COTA 1RAKA 1OD8A 3I6EA 1QNPA 3CJPA 4TO8A 1NM9A 4ROQA 1PX8A 3R43A 1AG1O 3WLPA 1C9DA 5CG7A 3K1DA 1EC8A 1VFTA 5J04A 1VFHA 2KX9A 4HA0A 3QTPA 4XUYA 3UY8A 4EVZA 1BVZA 4DO6A 2QUUA 2EF9A 1QNQA 3L2MA 4UNIA 3AQUA 2BBFA 1RJQA 4JIPA 4LUTB 4KWVA 1YXCA 2E25A 4E2DA 1TPB1 1EYWA 2YL6A 3SB0A 2ZFAA 1UD5A 1XLAA 3SBFA 5E1QA 4AY1A 4B2DD 3MV11 2ZC1A 1WZMA 1IIHA 2B31A 3WH6A 2ZRWA 4GJIA 3QGKC 2OZTA 5IBXA 3W6YA 4C6OA 3NQBA 4JX6A 1Z41A 5B7ZA 2DP3A 1EC9A 5LHFA 1PAMA 1JZ6A 1RH9A 1XWYA 3YPIA 3GKAA 3AC0A 4H3DA 2ZUTA 3H2AA 3HQ1A 1F6PA 3HMCA 3GW3A 3HQOA 5F2IA 4U3CA 4BY3A 3ABSA 1BKSA 3M5XA 3VKJA 2YOCA 4ATDA 4Q8NA 2PDGA 1GNXA 1QK2A 2CFFA 4K38A 4N6EA 3EX3A 4MZ1A 3ZFHA 3BANA 2J8FA 1GOWA 1SR9A 4KWUA 4ZTYA 3BDKA 2E4TA 3AMCA 4HU3A 4I8YA 3OHMB 1D7FA 1O5RA 1EX1A 1W2VA 1MQRA 5CC7A 5GVJA 5E93A 4A35A 2J7EA 1I0DA 4IISA 2BFGA 5A8NA 1ZU8A 4H4IA 2PDYA 5XIMA 3CQKA 1KRBC 3G1XA 5F2MA 3VABA 1CI1A 4PMUA 2VCCA 4RUBA 1PJ9A 4WKAA 1KBIA 4TR9A 3CZJA 4INFA 5C9XA 1JRBA 3WK1A 4UTJA 2J9ZA 2VI0A 2D1ZA 1R9YA 3PJTA 3OOQA 4AZCA 1A53A 3NZ1A 4C60A 3RM4A 1B4EA 3AMKA 1OCQA 4UTTA 2ZWZA 1C91A 1E6SM 4HSHA 1N8WA 4QEEA 3LPFA 3U2EA 1IR2A 1SUXA 4BI6A 1VPQA 2ZXAA 2DZSA 4V27A 4UTIA 3W82A 4UOJA 4ADSA 4HCDA 1WKDA 4HMNA 3M43A 3CLWA 3VDCA 1EWEA 3S5OA 1A5NC 5BRBA 4QJ1A 4LFYA 4AB4A 5D9OA 2V2DA 4KEZA 3SCRA 4JQ1A 2XM2A 1TPFA 3ITYA 3HGOA 2POZA 1W37A 3UYCA 1K77A 1N55A 4JNMA 2ZDRA 3QZ6A 1G4PA 1OCBA 1TPWA 2D69A 1ENUA 2E77A 3ARQA 5CCZA 4D71A 1GJPA 1L2QA 2INEA 4HNNA 3KZPA 3CQ0A 4YTQA 3GKFA 1FWBC 3ANUA 4FXJA 5HJLA 2GQ9A 4CD5A 1DQWA 4TXEA 1M7XA 1BF2A 4WQ6A 1FWGC 3WDJA 1HJXA 2IUZA 5CPQA 3WLQA 4EAMA 2P88A 3AHZA 5T26A 1HUVA 2BGQA 4JFUA 1UUOA 1U2YA 7TAAA 4WF7A 6CGTA 3U6WA 4HJWA 1W3HA 3RU8X 1EGZA 3QV9A 1JUEA 1PCKA 2G3MA 4OBRA 1ZFJA 4X0NA 1SU5A 1GVSA 5A95A 1U22A 1AFSA 1BWKA 4QQ3A 3B8SA 4DO7A 2VRJA 1W5NA 3G1DA 3TTOA 3KHJA 4NY2A 1P5BA 3BMWA 2I14A 3LD5A 2WMGA 4JTFA 3W23A 2C91A 4AD4A 4S3JA 4HJFA 3OVQA 2H9AA 2PI6A 4LOCA 1HL2A 1W5OA 4ZBCA 1TWIA 4LALA 1Z44A 4L6OA 2WAGA 5ECUA 3ELFA 4RNJA 1VRDA 4MAVA 2BHZA 3SIZA 1W9BM 5LNUA 2R82A 3CQJA 3L23A 5AC8A 1T8QA 3DERA 3UQNA 2X0HA 4BEUA 4K8EA 2IQDA 4HN4A 4HPNA 3LHTA 1F07A 3B03A 3QOKA 3EWDA 4YCOA 1DJYA 2GLKA 3GXNA 4AG0A 5D05A 3KP0A 1JRCA 3CQHA 4M24A 1R7OA 3WLRA 4ILSA 1V77A 3FS2A 4UTFA 1R30A 2OO6A 1X38A 3CAWA 1V02A 4DWDA 3GZ3A 4K1GA 3VCCA 2FHCA 4JEJA 1XIDA 4DHGA 3TMQA 1Q7MA 4Q4RA 1DQUA 1Y7VA 2RUSA 1OG6A 1LL6A 3W25A