3M64A

Human aldose reductase mutant t113v complexed with idd393
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
316
structure length
316
Chain Sequence
MASRILLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPVGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Ligand-induced fit affects binding modes and provokes changes in crystal packing of aldose reductase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 107
structure length 316
sequence length 316
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2010-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 3m64A00
4GIEA 2WZMA 4JIHA 3R8GA 4Q7BA 1ZSXA 3R8HA 4F40A 4JIRA 4LAZA 2ACQA 3EB3A 3LD5A 3ONBA 1YE6A 2IQDA 1X96A 4QR6A 3LQGA 1ZGDA 2INZA 3CAVA 4L1XA 2PD9A 5LIKX 2PDIA 5JH1A 4WDTA 1EKOA 4FZIA 3UZYA 1S1RA 5KETA 2PDKA 2F2KA 5AZ1A 3BCJA 2HE5A 4JQAA 4PR4A 4IGSA 1YE4A 4IJRA 3H7RA 2PFHA 2BP1A 3LENA 3M4HA 1HQTA 1A80A 2F38A 4ICCX 4Q3MA 2PDGA 4GA8A 3UYIA 4HMNA 4WDWA 2IKIA 1YNPA 4FAMA 4LBSA 3WBXA 2ACRA 3LBOA 4JTDA 4XO7A 1ADSA 3CV6A 2FZBA 1T41A 1RY8A 2R24A 3R7MA 4XZHA 1ZUAX 4NKCA 2C91A 3GHTA 3MB9A 4L1WA 2PDXA 3DOPA 2BGSA 4PUUA 2I17A 1M9HA 3DN5A 3H4GA 3RX2A 2PDYA 4GCAA 3UWEA 2FGBA 1UR3M 1ZQ5A 2IS7A 4IJCA 4JQ3A 2PDFA 1AFSA 1GVEA 2VDGA 1T40A 4RPQA 3F7JA 4DZ5A 3WBYA 2IKHA 4YU1A 3V36A 4XVDA 3R58A 1AH3A 5M2FX 2PDMA 1MI3A 5HNTA 3RX4A 2IPJA 3ONCA 4LB3A 1S2AA 1SM9A 2FZDA 1PWLA 1XF0A 1XGDA 5LIXX 3GHRA 2HV5A 3UP8A 1QWKA 1LQAA 2PD5A 4OTKA 4LBRA 1AH4A 1HW6A 4JQ4A 3UZZA 4QXIA 2NVDA 4XZLX 4DBUA 4JTAA 3M64A 4QBXA 3Q65A 2FZ9A 1QRQA 1LWIA 3QKZA 2J8TA 1X98A 2PDQA 2IPFA 4XAPA 3G1RA 4YVXA 1EF3A 4GQ0A 3N2TA 4WEVX 3O0KA 1EXBA 1PWMA 2PDLA 4PRRA 4LAUA 5HA7A 3GHSA 1S1PA 3LNMA 4WDXA 2P5NA 2CLPA 3B3DA 4FA3A 4YVVA 2PDPA 3EAUA 3RX3A 4AUBA 4JTCA 3O3RA 1Z9AA 3UZWA 4FALA 3BV7A 2PZNA 4MHBA 3T42A 3Q67A 2FZ8A 4DBSA 3M0IA 2FVLA 2ACSA 4QX4A 3G5EA 3R6IA 4I5XA 2I16A 4WRHA 3S3GA 1XJBA 3VXGA 2PF8A 1PZ1A 2AGTA 4H7CA 1J96A 2A79A 4XZNX 4GQGA 3V0TA 4YS1A 1YNQA 5LIYX 4HBKA 4XZIA 3MC5A 4EXAA 3C3UA 1AH0A 4JTRA 5DANA 4ZFCA 3V35A 2BGQA 4XZMX 5LIWX 3CAQA 3UGRA 3LZ3A 4R9OA 3R94A 4LB4A 1PYFA 2IQ0A 3COTA 3D3FA 2PDWA 3BURA 4G5DA 2DUXA 4H8NA 3V0UA 3WCZA 1RY0A 3GUGA 3CASA 2PDNA 2DV0A 1OG6A 3H7UA 3ERPA 4PUWA 3BUVA 1VBJA 3WG6A 3P2VA 1IEIA 1K8CA 1Z89A 1X97A 2ISFA 4JQ1A 2WZTA 5HNUA 3EB4A 2NVCA 2PDBA 4JTQA 3LZ5A 4JIIX 5LIUX 4WGHA 5C7HA 2IPGA 3U2CA 1Z3NA 3R43A 2PDJA 1MZRA 1Q5MA 2PDUA 3LN3A 4DBWA 1Q13A 1EL3A 4EXBA 3FX4A 1RALA 2PDCA 2DUZA 2PDHA 1AZ1A 4XO6A 2QXWA 4PMJA 4XK2A 2IKGA 4GABA 1IHIA 2HDJA 3GHUA 2HE8A 2HVOA 1S2CA 1AZ2A 3CMFA 4YVPA 2INEA 2IPWA 5JH2A 3WBWA 2HEJA 2PEVA 4JQ2A 1MRQA 1R38A 2ALRA 3LUTA 3LQLA 4PRTA 3UFYA 3V0SA 5AZ0A 2IKJA 4XVEA 3LEPA 2HVNA 1Z8AA 4ASTA 1PZ0A 2ACUA 3KRBA 2R9RA 1US0A 3N6QA 3UG8A 1VP5A 4WDUA 3FJNA 3UZXA 1FRBA 4GACA 3CV7A 3NTYA 1JEZA 1C9WA
chains in the Genus database with same CATH superfamily
3GW3A 4UFHA 1EZWA 4TXEA 3BLDA 3A22A 1TPFA 3VOJA 3WKZA 3BG9A 3EB3A 3KWSA 1KRAC 9CGTA 4QR6A 4PODA 3A24A 1NWTA 2OKTA 3OLGA 4GH1A 4NIRA 3TJ4A 4A35A 2PD9A 1YDOA 2PDIA 2FJUB 5EFDA 2QUTA 2EG8A 4ZOBA 4GUJA 2J13A 4WY0F 2QCHA 3QGVA 1GG1A 4F2TA 1FWNA 1QT1A 1I2OA 2ZC8A 1N8FA 2BBFA 3NNTA 2PDGA 1KBKA 1E9LA 3O2LA 3VX1A 1TIWA 1EF2A 5E9AA 3S2JA 2X1UA 2YDAA 5H1WA 3RPTA 1U30A 3CUGA 1XLBA 1DHPA 3LHWA 4PL2A 4QJ1A 2J66A 5KZ6A 3OZYA 1XYMA 3H4GA 2ATSA 3KTSA 1Q6LA 1TO3A 4LUJA 1R3QA 1TMHA 1VFHA 2QVHA 2QDHA 1PX3A 1GKQA 2OEJA 3UA3A 4H19A 1GVEA 1OG0A 2VDGA 4LUTB 2CETA 4RPQA 1GQNA 3MV01 5AOUA 1IT7A 5K7JA 3LB0A 5A8GA 4YCPA 4JEQA 2F6XA 1MI3A 3MBFA 3OZMA 3DIPA 1TQJA 1FHDA 4B15A 5D09A 1VPQA 1S2AA 1UJQA 3STPA 3MUAA 2Z1KA 1JYXA 5AECA 4FX7A 4BI7A 3WDPP 3SR7A 4MDPA 4ZL1A 4X9YA 3BLEA 2UY4A 2PB1A 1A0EA 2X16A 4YCOA 2BY0A 2J8FA 4DEFA 1ZTVA 4R5EA 4LBRA 2Y8VA 4JEJA 3RCYA 3CV1A 4ES4A 1RP9A 1PHWA 3B8IA 4QXIA 4D6EA 3LDVA 4YJ5A 3T8LA 4F0RA 3GD6A 4UZSA 3I6TA 4IFOA 1I0DA 3ZJ6A 3KVMA 1QTWA 3IJ7A 1OYCA 4EPKA 2C14A 3GX9A 4KEMA 2A7RA 3SN0A 3TYUA 3GR8A 5KTLA 3FA4A 2GK1B 3W7HA 2IPFA 1CLXA 4WF7A 1V0KA 3NQ6A 3QH2A 4J28A 3KOWA 1JUEA 2Y8KA 3BC9A 1K8YA 2YLAA 1J01A 2VR5A 4PULA 4UTWA 4DLFA 3BOXA 2VOTA 3KRZA 3NEHA 5IHSA 5GQBA 2BHUA 1JCTA 2DZTA 2OEKA 5K9XA 1TMQA 5BMXA 2FHBA 3GFYA 3A4JA 2XGZA 4MZYA 4GVHA 4MHBA 3T42A 2PGFA 3LXAA 4Q4PA 3P5ZA 4AX6A 3ENLA 2ZUUA 1Q7QA 5H8MA 4QX4A 1V3HA 3WH5A 1D8WA 3SUTA 2H90A 3ZVIA 2OQHA 4MKNA 1EQCA 5JBFA 2OPJA 1J96A 2RDUA 1JCYA 3L4WA 3L9CA 5A8NA 1LM1A 1DJIA 5DT7A 4HBKA 2VVNA 5T26A 1YHTA 2I5IA 4QFUA 2YL9A 1UZHA 2WKGA 3ABSA 3QC0A 2WM1A 1K1DA 1ICSA 2WHLA 1B4EA 3I3DA 3ALGA 4PTDA 4WK9A 5EYWA 2E8YA 1HN1A 3AALA 4RKAA 3GXFA 4P7NA 4LT9A 2HNHA 3D3AA 1RZMA 5DANA 3W7PA 2ZKMX 3LHYA 2PBGA 4GZEA 1POJA 4XZMX 3NO3A 5LIWX 3MVTA 1FWWA 1DKWA 1ZU8A 2EBNA 3SQSA 3U2EA 5HULA 1EGZA 3C2YA 1CGUA 3UU0A 5FD0A 1C92A 1U1UA 5IBXA 3RM4A 1VF8A 3O9NA 2OKOA 2ZZ6A 4LXFA 4RXFA 3S6OA 4G5DA 3C2RA 3W6LA 1Q7ZA 4KH2A 3KRSA 3PSVA 4KWUA 1XLDA 4I9TA 3TFXA 1T8QA 6ENLA 1RPKA 1E71M 3QZ6A 2YFNA 5F4WA 4R88A 2O7QA 2VEMA 3NQFA 4EPEC 3VNDA 4TV5A 3LI1A 4LY4A 1A5OC 5EPDA 1KTNA 3HM7A 1IEXA 3KWXA 1RALA 1BXCA 4DJFC 2PDHA 3GXDA 2FVKA 3ZJ8A 3WQVA 2QXWA 3E2QA 4WQ6A 5SWUA 3W6YA 1XLIA 1E40A 4EOUA 4C6IA 1QOQA 1UUQA 2FH8A 1UWIA 1NP0A 4H9ZA 4JQ2A 4LS1A 1GW1A 1MRQA 2AL1A 2OTDA 3APYA 1PO9A 1XGEA 3HGJA 4EF8A 1A5SA 4ZZ9A 2FHFA 5LNVA 3V0SA 4PCTA 3R11A 3UBPC 3ITOA 1WP6A 1OFDA 1M01A 3BPWA 3MUCA 3FW6A 2BXYA 3HV9A 5JIPA 5FJJA 3G24A 4DJED 3O0FA 1GEHA 1MRAA 5C2GA 4CQ8A 2WMKA 3GXPA 4JIRA 4A3RA 2ACQA 8XIMA 2UY5A 1KXHA 3M07A 2D3NA 4W88A 2X1IA 3V18A 1FFQA 3URQA 2VC9A 1L6WA 5LHEA 1E1FA 4Q8MA 3PP7A 1DJXA 2ZDSA 1W91A 3WLLA 1WAUA 1H3GA 3UPBA 2CZEA 3EOOA 4L4OA 5D2XA 1TTJA 4HQVA 3RMJA 1PKLA 4YWIA 2QDDA 3V1HA 3VDGA 4OQVA 3NSMA 1SR9A 3M47A 4C6NA 1OFOA 1IXQA 3MZ2A 3FNDA 2R24A 4ML9A 3CWOX 1W1ZA 4F9DA 1A5MC 4XZHA 3V5FA 3H7VA 4L4PA 4PN2A 3E2SA 3N4FA 4B2DA 2DVUA 3TW7A 1HIZA 3BLLA 1VFFA 2E6FA 4PUUA 3WQ6A 1WXZA 5BRQA 4Z08A 1GOQA 2BDQA 3W38A 4AD1A 4KBXA 3ATZA 4UTJA 2I5GA 2BVYA 1OSEA 3F2DA 1PL9A 1HT6A 3UY8A 2V2HA 3DBPA 4DI9A 4J7RA 5C9ZA 2D0FA 1FWHC 5E0KA 2JALA 1V6VA 3KRUA 4D1JA 1JG9A 3H26A 2W27A 2Y70A 3WF2A 1ICPA 2J62A 1KBLA 2IKHA 3KTCA 1P0BA 3V36A 3O6YX 5BCAA 3B4YA 1K7XA 2OFJA 5ECUA 4MJ2A 1KBJA 3TVAA 3W1RA 2W5FA 1V6XA 3VU2A 2AMXA 3N9KA 2Y61A 4O11A 3UT0A 3RXZA 3UVAA 3BQ6A 1J4EA 3LTSA 3HPXA 4UUIA 1JZ3A 1TPH1 4PTMA 1Z44A 1FXQA 3S2CA 1W1YA 1KRBC 1OYAA 2ZX5A 1U5JA 1NM9A 2VFGA 4XD3A 2B4GA 3UF9A 1NY1A 4Q33A 5K3VA 3VIFA 3FJ4A 2HV5A 3UP8A 3B8WA 3IV8A 3GVRA 3P3BA 1EC9A 3IWPA 4ORMA 4O0ZA 3P14A 4BHYA 4D8LA 1X38A 1VEMA 4UTTA 1GVIA 2PTDA 1GYLA 3U6WA 3QF0A 4QBXA 4N9BA 1XIEA 5TQLA 1V6UA 3LCIA 2FYMA 5AHNA 4S3DA 1F8IA 3BLPX 4PUDA 1OHLA 4XD6A 5EFFA 2DZSA 3NO1A 4GXPA 1UUOA 1SZRA 4LS0A 4Y8EA 4QG9A 1DPMA 2Z1XA 4IGMA 3URBA 1OM0A 1XUUA 5DBTA 3N14A 1AUSL 4TTUA 3WNMA 3PB0A 3SCSA 1YDVA 2PWDA 4CU8A 1MW1A 5FJIA 3U4AA 5D2TA 3N73A 5GJPA 1T0OA 4BI6A 2MANA 4GQQA 2JKEA 1JDAA 3DG7A 3AIRA 4C6CA 2HS8A 4FOKA 4J3VA 1Y8BA 4Z2JA 1GORA 5J5DA 1BPLB 1TV3A 4HNNA 2VM8A 1WDQA 3BGGA 3AS2A 4KFNA 3TAKA 4DXVA 4Y9MA 3ITCA 4ZB5A 3MKVA 1U5VA 2XVNA 3W3OA 1QWGA 1TRIA 3BANA 4X0NA 1Y5VA 3OBAA 4HP5A 1T6MA 3CUJA 4UNLA 4L56A 5JU6A 1TR9A 3GVWA 3MDWA 2PGWA 2DSKA 2P8CA 3MW7A 4IIHA 2PC4A 3KXQA 2PWHA 4WLCA 4QDMA 4F0KA 3MDUA 1CGYA 4J9JA 3R0KA 1A5LC 3B0XA 1K6AA 5DMMA 5XIMA 3IGHX 3TN5A 3CMJA 1F3EA 3R94A 2YDSA 2HVMA 4OZOA 5FJOA 2RDWA 4HMEA 1M6JA 4QHRA 3QVQA 3NXFA 5CPOA 3L2IA 1DXIA 4H9TA 2GWNA 1BVZA 3WCZA 4GYPC 5LNRA 1PV8A 3BWWA 1TTIA 3Q37A 3CUXA 4DO6A 2Z29A 1XCXA 1OG6A 4PUWA 1MUWA 4CD7A 4EX4A 2Y63A 1IEIA 4V33A 1BQCA 4MKSA 1XH2A 2WMGA 3C56A 3KS5A 3W7LA 4IIFA 3NQEA 1BHGA 1XQLA 4LRTA 1KFLA 2OMAA 2IPGA 2E67A 4AMAA 2JQXA 3EOUA 2FB3A 5HJYA 1EJUC 1ZY9A 3WQ4A 2PDUA 1EPXA 5C70A 3LN3A 3KVJA 3W2JA 1GOMA 1OF6A 2PP0A 2P1FA 2E9LA 5A95A 3IUHA 3FHQA 1DJHA 3GKAA 2IW0A 4PMJA 3WLKX 3UWWA 3S4TA 4QE4A 4Y6GA 3EKGA 3FYPA 5EMJA 3PTQA 5G4HC 2NLYA 3GHUA 3UWYA 4E6MA 1LDCA 3AXMA 2YCJA 4O53A 4M51A 1TJPA 2AAMA 4NZ3A 1UH2A 1LP6A 4O1EA 3AFBA 1XPYA 1ONWA 3NDZA 4MDOA 1ADDA 3WJWA 1Y5XA 1QK0A 3RU8X 3W26A 1X7IA 3WBEA 3AXHA 2D2JA 1I2NA 3TWBA 2ZIDA 2GQ3A 3L67A 1WA3A 3UZXA 4C6DA 1JEZA 3GR7A 1S3TC 2YGYA 1W5PA 1NJJA 1JGMA 1Q3NA 3CHEA 4LAZA 3W7IA 4MPQA 4RL3A 1YE6A 3PPGA 1F4HA 3IPWA 1QW9A 4I6VA 5A6BD 4E5TA 3JW7A 4GKTA 3EDJA 3CYJA 3UJRA 1US3A 2VL4A 4DAIA 2JGQA 3OG2A 3DC0A 3SJ3A 3WK0A 2INZA 1OCNA 3BLFA 4EAYA 5CPQA 3P0XA 1ZBKA 4DJDA 1DL3A 5KZMA 2Q02A 1B4KA 2PDKA 3QV9A 3LLDA 5AYZA 5I3HA 3TJIA 3TJXA 4X3ZA 4MWAA 2ZA1A 4IJRA 4A05A 2PFHA 1VB9A 2AKMA 1O94A 3NZQA 3LENA 1NDVA 1Z69A 3AYVA 1W9PA 2ZX6A 3IJLA 4LVDA 1AW2A 3P82A 5DY2A 3KAOA 2BOGX 5I03A 2VOMA 3FXYA 4ERAA 3GDRA 3N2BA 3L66A 1WXYA 1AODA 3ZLFA 3DFOA 2DGAA 2E3ZA 2WC7A 4AIBA 2DZVA 2E1DA 1WX0A 2HQAA 4GY7A 3M6YA 4N42A 3PUDA 4IG2A 3RG6A 1KNWA 4GX8A 4IJCA 4NP7A 4WKHA 2HXTA 4S2CA 3BQ5A 3IVUA 4S3EA 2WQPA 2R6OA 3Q4DA 2QCFA 4A3HA 4DZ5A 3WBYA 2HZGA 3NEVA 4WOQA 3B04A 2ZZ1A 2J9YA 4XVDA 3T07A 3W24A 1V03A 4W87A 3DCPA 1NDZA 2I56A 3B0PA 3UERA 3U7BA 1J12A 3EWXA 4C6PA 4E4UA 4N4QA 1OFQA 2OX4A 3KLKA 2Y7EA 3DGRA 2NXGA 3EWUA 2O9PA 2CPUA 5GJNA 4MB1A 1J9YA 2CZ5A 1E6NA 3E6EA 1VBRA 1NQ6A 3NOEA 2Z0IA 1P6BA 1EX1A 9XIMA 4B3KA 4FR1A 4MSSA 3PJUA 2WMJA 2XVGA 2YW4A 1AQMA 5HR7A 3SEPA 4AY1A 6CGTA 2HK1A 2EPNA 4HKPA 4M3PA 4ZB0A 3EOEA 4Z1DA 4GNVA 4OFCA 3S1GA 1EJTC 1KXVA 4XQ6A 1K8XA 4EWND 1YBQA 3W37A 2EGZA 4XBKA 1TREA 4JNMA 1WB0A 4YVXA 2VZUA 4GUFA 4GQ0A 1EJWC 2P0IA 5DX7A 1E0UA 3LNPA 4UCFA 5AC7A 2WMIA 4HCHA 1JDCA 2OELA 2WNQA 5FACA 3RU6A 4FS9A 1TPC1 1MEWA 3ARWA 3V5CA 4S39A 3OZOA 2Q71A 1WOAA 3S5SA 3E0VA 4RLIA 2DT1A 3CXOA 1CB2A 4C6BA 3WN6A 1ONXA 4JTSA 1XJBA 1PJ9A 4LVGA 4GXWA 3ABRA 3SGZA 3CZLA 1Q7MA 5H6HA 3P74A 5G2WA 1CENA 1ZAJA 5LKYA 2P53A 4YIWA 1JAKA 3QJAA 5HANA 1KXQA 1SZGA 3QW4B 1VLWA 1GPWA 4ZTXA 1RBOB 3K8LA 1H1ZA 5GNZA 4H3DA 2CWNA 4MJMA 5T8GA 1KCKA 3VUSA 2Q09A 4OT7A 1KFBA 1TYGA 3HV8A 1PUDA 3NPUA 1P4CA 4PUEA 1BGGA 1TX0A 3W88A 2WSPA 3VOIA 3P81A 1KFKA 3QZAA 3WH7A 3TTOA 1ZALA 2YZRA 3VI2A 3N9SA 1HFBA 2PC8A 4QAWA 4GNKB 4N7QA 3KOYA 5CJMA 3ARZA 4BCEA 4B5TA 3HBLA 3L4ZA 1XISA 2DORA 2VCAA 2D23A 4MWAB 1FCUA 3GWQA 3UPMA 1JI1A 1U22A 4ML4A 3ERPA 4A3UA 2Y88A 2WJFA 3P2VA 2VWSA 2E40A 3GC2A 2WZTA 4H6RA 4ZFMA 1LJYA 4UNKA 5KZEA 2BFGA 2GVYA 3E02A 3D5HA 5DF0A 2DT0A 3R43A 4KF1A 5AHIA 1KXTA 2E77A 3E5PA 4MB5A 1CGWA 4ZSTA 1IZJA 2VZOA 3STCA 4XO6A 1P7TA 2H9AA 3C3NA 2E1WA 3L4YA 3GFZA 2GOUA 5K9CA 2QUVA 4XK2A 3PULA 4AD0A 3BZGA 3IV3A 4IG2B 4UMCA 1UR8A 5CGQA 3B8TA 5A2BA 1GPFA 1SR0A 1Z48A 3GUWA 1C93A 1XINA 3HIJA 3N6HA 1BVNP 1TKKA 3B0VC 2OYLA 5I09A 1DIKA 2YL6A 4CVUA 5EMUA 1HKVA 1ZB5A 2YA2A 3MP4A 4H1ZA 2EQDA 3KOXA 4P8VA 2NQJA 5HQEA 2J88A 1IV8A 4F3HA 2FKPA 2FDMA 4ZO7A 3DFNA 3ZS4A 1UR0A 4X9SA 4KFPA 3WQGA 4UQDA 3BLIA 4JYEA 5J8LA 4UQCA 5HPOA 1ZLPA 2QJNA 4TIMA 2X40A 1EIBA 1LWJA 1RA5A 3LQGA 1GT8A 5BXRA 3CUIA 1GVOA 3MMUA 2WOQA 4NZ5A 3TIMA 3TTYA 3EXSA 3W84A 3UJSA 2X05A 3T08A 2HE5A 3BE7A 2R8WA 1NSJA 5D9PA 3CS2A 3TXVA 1UIPA 1LLOA 2QUUA 2Q8XA 4F4RA 1BFNA 4O18A 3TAOA 2V2DA 3WBXA 1AW5A 2JF6A 5HUOA 1BKSA 3BAYA 4GX9A 3CV6A 3KM8A 4FEZA 5L9FA 4GFSA 1UZ4A 3PJTA 2V5BA 2C91A 1LROA 1UMYA 3NR0A 4UTHA 2WMIB 2I9EA 3T09A 2O56A 1ZNNA 4W93A 5I77A 3VKBA 1OQFA 1G4TA 1AG1O 4UOZA 1KR1A 1A49A 3CIVA 4NRRA 1JRBA 5A8OA 1DQUA 3WUFA 1K9EA 3ZLHA 1P48A 3H4WA 2G3NA 4P61A 1GJUA 1X6NA 3CHCA 1IXNA 4J2PA 2O92A 3LGGA 3CL7A 4DYJA 1GUVA 4OUEA 4MJZA 3ZO9A 3W53A 1PVNA 4WX2A 1J5SA 1T40A 4ALDA 2G50A 3THQA 3UJFA 1NTHA 4YU1A 2WCGA 3B06A 2QF8A 5LHFA 2B7OA 3HG2A 3M5XA 4ZO9A 3TEVA 3FYYA 2GQ9A 3W2UA 1J0IA 3VO0A 4F0LA 2P50A 5I2UA 3M41A 4Q7IA 2QMKA 3TZNA 2AQWA 2LLEA 3ARYA 2P76A 5DFAA 4OV4A 1M7XA 2BOFX 3HPFA 1QNOA 1SO6A 1PPIA 4RE2A 4YYFA 3OA3A 4Z2HA 3GTXA 1QWKA 4LEFA 1W17A 2WLYA 1FA2A 1RR2A 3NSXA 2OXNA 1PTAA 3S42A 1XWYA 4A8RA 2ZRWA 2ZRZA 3QY7A 3TFCA 2QPXA 3AYSA 4DUXA 1F3XA 4R7WA 2CHOA 4Z42C 3RLHA 3W75A 3M64A 3S1XA 1DV7A 3CB3A 3WQWA 3UCQA 4HZ8A 1SO5A 3RR1A 1W1B1 4AVOA 1LQ0A 1LLWA 1V51A 5IHRA 3C0LA 1XYLA 2OB3A 1YNYA 2PBOA 1GWJA 1ZJHA 4AX7A 1AMKA 1KCZA 4H6EA 2QCCA 2DSVA 1JR1A 2REQA 1K3UA 5KINA 2QCGA 1LQ2A 2DSWA 4W8LA 2W91A 1XP3A 3AC0A 2J4GA 4C7GA 1A5CA 2XFWA 3UR7A 4C6FA 2ABAA 1S2VA 2ZUWA 4IFRA 4JTCA 1P7TB 3RJYA 2ZUVA 1MEIA 3N2MA 4RJEA 1JYWA 3F2BA 4LEQA 3AWNA 3F5LA 3RMEA 1ENUA 5E6YA 3NQ7A 4GBUA 5HAOA 4GY1A 3WQCA 3M0HA 2DU2A 3UR8A 1UOZA 4FB7A 3PFRA 3TSBA 3V0TA 4YS1A 3SCUA 1SZEA 5CC6A 3DESA 3F4CA 2VENA 4OECA 5EMMA 2PRMA 3BGJA 1UWRA 2XFYA 3SDOA 4U4MA 4LGXA 3GDKA 4E8CA 1J8VA 4YTRA 4JN6A 1TWZA 1EHAA 3CPGA 3IEBA 1S5VA 1CXHA 4K68A 2OZ3A 2AKZA 3HPAA 3BK0A 3CH9A 2H8XA 3G18A 2AL2A 3KBJA 4NNAA 1O4UA 1XYAA 2W66A 3LU2A 4NNCA 1VBGA 3ANVA 3LZ3A 3B8DA 2QCEA 3H53A 2YL8A 3R89A 1US2A 1W1VA 3GZ3A 2YPIA 3W1TA 4DWSA 1OD0A 3D3FA 5IXEA 3K4AA 4W85A 8TIMA 2C15A 4RDWA 4RNIA 1HF6A 2QGHA 5HWJA 1X97A 3O6CA 5HNUA 4H2CA 1EA9C 1JPDX 5D9OA 3OODA 1XRFA 1FKWA 2FTWA 4GWEA 5FKYA 2XWDA 2OLAA 3PPFA 5C7VA 3H6OA 3H2EA 1DTNA 1WBHA 1V3IA 1XFBA 4I5RA 3TR2A 1NARA 3SY5A 4MF4A 3MMTA 2WJZA 1MZRA 1DWAM 3PBWA 1EL3A 2HROA 1E6RA 2PDCA 5HNRA 3VKCA 4I3GA 4JFVA 2QCNA 2EAWA 1J6PA 4RDYA 1NEYA 1UPMB 2P3EA 2ESCA 1W9UA 3W71A 4IPIA 5XINA 3MMWA 3LHUA 3BMXA 1JVNA 3PY2A 3GG7A 1IE7C 3E0WA 4B9ZA 1S2CA 7TAAA 3USZA 4MFEA 4H01A 1LT8A 1VYRA 3L4XA 1H0GA 3SY8A 3G1XA 5ABGA 2ZICA 5BOFA 3UFYA 4I5UA 3MVIA 4GISA 3HPZA 1KKOA 1IIHA 1RH9A 3L65A 3GW0A 1IWAA 3MV11 4I9JA 2NT0A 2Z27A 4CNPA 3TJLA 1ISWA 4WDUA 3ZMRA 4GACA 1JI2A 1AJZA 4C1LA 1SU5A 2W62A 1AD1A 1OX4A 3LPOA 4F40A 4BQ5A 5M03A 1O1ZA 4QG8A 2FLIA 2Z25A 3T1GA 4A3QA 1PX4A 3E9AA 1MW0A 1LRQA 4S3JA 1PDYA 4H8HA 2Y24A 1YIXA 2H8ZA 4PSPA 1EKOA 2EPOA 3LRKA 2R94A 4U2YA 1GZGA 4AY8A 4S23A 2F2KA 5CXPA 4C91A 3MS8A 3FN9A 4NI8A 4DY1A 3GNNA 1CGTA 3UG5A 3C8NA 3AU2A 4Z1YA 1HP4A 3SUWA 5AKQA 1TA3B 3K13A 5GNXA 4FNUA 1B3VA 1M68A 5K9DA 2X8RA 3VCCA 1HVQA 1TB3A 2Y0FA 3L4UA 1X8CA 1J18A 1KW1A 3OYXA 1Z42A 2UV8G 5CH9A 3WNOA 1ZHAA 2PS2A 2REQB 3PPCA 4NKCA 4PBEA 1RXOB 2SFPA 1VBHA 3MB9A 2YXOA 2W63A 1O12A 5FEPA 1IGSA 1G6CA 3QEZA 4AF0A 3GYCA 3OLDA 1M7PA 4UTFA 1Q8JA 1H1NA 1ODUA 1NWUA 2F8QA 4H8VA 1QCWA 5D38A 4XBJA 1XSKA 1L6SA 4DF0A 3W23A 2AOSA 3CZGA 3THDA 4QIUA 4AWEA 3GTNA 2TYSA 3PHAA 1JF5A 3MKKA 1JZ5A 1HNYA 2XU2A 2J47A 1UR2A 3M0MA 4PTWA 1IWPA 4J27A 4ZQCA 3U5UA 3AMKA 3R5EA 4ZBCA 3CZKA 1PWLA 4IPJA 3UG3A 3BO9A 1THFD 1E6QM 2WHJA 3CAKA 1XCFA 4LH8A 1JCMP 1DTUA 3WENA 1XGDA 2PGEA 2AL2B 3WNKA 3S1VA 2OODA 4UTWC 2ZX9A 2J24A 4F2UA 3FDKA 4PUNA 2OSXA 2OZ0A 3ZSTA 1AH4A 3O63A 1J6OA 4XZ9A 1TPWA 3EWWA 2AGKA 3VGEA 3W7CA 1UD5A 4UFIA 3ZZ1A 1E70M 4F2BA 4YTTA 1D7FA 2YBVA 1K7FA 2CLIA 4DWSB 4MJ4A 4HU4A 1PS9A 3R8RA 4CD8A 3QPYA 1OBAA 3LK6A 4YWSA 1AQ0A 3MCMA 1S5MA 2E28A 3EX3A 3LI0A 1X98A 1XC6A 4MWAE 3MHFA 1JYNA 2WPBA 4IUGA 5B7ZA 4NNBA 4KGLA 2CFFA 3DX5A 5D30A 4WEVX 5G2HA 4JGDA 3NAVA 3KEHA 1ISVA 3OA5A 1GJWA 4DUOA 1GZ1A 3HF3A 4HJWA 5CZKA 3RX3A 3QTPA 1DYSA 1XBXA 3MY9A 3O3RA 4B90A 3A9BA 1TUXA 3ZM8A 4HOWA 3VNJA 1VHCA 2VWTA 4HB7A 3SZ8A 4DBSA 3BMVA 5FJUA 2NQLA 1JPHA 4FIQA 2I16A 2PMQA 1SQ7A 3C6CA 5U7SA 4O4VA 4AEEA 4IPNB 2F9RA 4H7CA 5IBXC 4XZNX 4IMFA 2E8ZA 4GQRA 3IUDA 2YB4A 1RCXB 2HS6A 4OV9A 2OYMA 3TTEA 4MUPA 1Q6DA 1QAPA 1TMLA 4IISA 1FBAA 1XL9A 2HK0A 4DJFD 4XG1A 5F1VA 1GVFA 4EPDC 1K4HA 2Q8LA 3TYCA 4W4QA 1OX4B 4Z2GA 3DKJA 3EB2A 2WSYA 2ZTJA 3JS3A 1MXGA 1MNSA 3H54A 3AIEA 4RW3A 1V0NA 5AYIA 3PZVA 5G4WA 2BV9A 2RH9A 4QCFA 2VCBA 1E3ZA 4MZ1A 5RUBA 1SZNA 2J6VA 3FV9A 4UR9A 4CCEA 3TCEA 4QS6A 1X6UA 1XR2A 3BURA 3G3MA 4WKFA 1UA7A 1RY0A 3MKCA 1XD0A 4DNMA 3TU9A 2JEQA 2ZBTA 2PTYA 1E0WA 5DRCA 5A6KA 3PG9A 3AU6A 4ZO6A 5JXQA 3EDKA 3S0CA 3EOSA 3F5KA 4CN6A 3K2GA 4Z0JA 3EA1A 4K8HA 3BCDA 1VEOA 3U2CA 5PTDA 4HHHA 1I2QA 4QJ4B 2ABBA 3L0KA 3RN6A 2ISDA 4DO5A 1VR6A 1R87A 4HU3A 2V3GA 1ECEA 4I6KA 2J25A 3W7NA 4AF0B 2PODA 2CNCA 3H12A 2DVXA 1FVPA 1WZLA 1IHIA 3VOFA 4OBRA 3DUGA 4N0RA 4Y2WA 3SCOA 4NJJA 2VHLA 2BNJA 2TODA 1Q6FA 2FTPA 3E3HA 1WV2A 6TAAA 4HD5A 4BWLA 1LYXA 3FKRA 3GDMA 3CIXA 1OK6A 1ZJAA 1TPVA 4ERIA 2O55A 3WMBA 2YSWA 3LEPA 1HKKA 1Z8AA 1N8IA 4HPNA 1SW3A 1R3TA 1CZ1A 1GK8A 3B0UX 1XIMA 4IZGA 4PMDA 3R0UA 4W84A 1YKWA 2E4TA 1R47A 3TN3A 3NTYA 3B03A 1E43A 1DE5A 2PPGA 4GIEA 5TIMA 3PR2A 1DWGM 4LY8A 1OT2A 2X1TA 3M6DA 1FWBC 2WB5A 4W7UA 3QOKA 3RAOA 1OX5A 5BNKA 2XIQA 4J3SA 1UC4A 3E0LA 2ZOXA 3L4TA 3W1AA 3HGOA 4HNLA 3W0KA 3MI6A 2V6AA 3G1SA 3P93A 3KTXA 4X2PA 3O1NA 5G5IA 4UXDA 4AEOA 2YZ5A 1LBFA 3R12A 5JH1A 2XN1A 1NWRA 5BZAA 5DXXA 4ZQMA 4S3AA 1PYMA 3VIJA 4EIVA 1S5TA 4RCXA 4TVDA 1R86A 4M1BA 3STEA 4W7VA 1XIIA 4TV6A 5HMSA 3WLRA 3M4HA 2V81A 2CCRA 3JZEA 3WEZA 3AS0A 5LA0A 4HMNA 2VZSA 3I3EA 4UMAA 3WF4A 4LPCA 2XFFA 1QK2A 2X42A 3VVGA 2O4QA 2E09A 1BQGA 1OZQA 4HZ7A 2XHYA 3M7SA 4IP5A 3WJXA 4F0MA 2FPYA 3VIKA 1SUXA 3NQVA 2QV5A 3OOQA 2D22A 1UKTA 2VC6A 4YHEA 3F2CA 2E5DA 4X0VA 6ALDA 1E4MM 4J35A 4NHVA 4O50A 1ECQA 2VEFA 2Z6IA 4BQ4A 3UQNA 5G4EA 2GVLA 2QAPA 1F7BA 4ZQOA 3QY6A 4AXNA 3IACA 1UR3M 1WAWA 3H2CA 1DP0A 1J2WA 3KBVA 1V7AA 3WJSA 1HJSA 3DFTA 5FJTA 8XIAA 4U3AA 1Q65A 2XFRA 4NVTA 3HO8A 2R91A 1W3HA 4B5NA 1ZRQA 4UTTC 4IT1A 3W81A 4O1DA 4KWVA 2XDFA 2ZZ3A 5ABHA 2IPJA 1LTDA 5G1TA 5TBOA 1W9XA 4ZA0A 3CTLA 2BOEX 4YN5A 1ZENA 1SM9A 5F2LA 5FSEC 4DYKA 1SO3A 1KTBA 1KQYA 1PXGA 5GPRA 4ADSA 4HNVA 4N9DA 2WCSA 1W3NA 3ZR5A 3O6DA 2J8GA 3RPDA 3ANUA 3WH8A 1CLKA 3V7PA 4RV8A 1LF1A 2FZNA 1JCXA 1B57A 2C3ZA 5DLCA 5KEZA 4RZ4A 4US5A 3AYRA 2PLCA 4ZEPA 1FKXA 4AD4A 2CLLA 3CZEA 4ZXLA 1KGUA 3W4RA 3WFAA 3TR9A 4MGGA 2A4AA 1U1JA 3QYSA 1DEDA 1MFVA 4Z1AA 4DELA 3POHA 1EH9A 3WQ5A 1ISYA 1LWHA 6PTDA 2NUXA 4UIOA 1HXJA 1WE5A 1ZP3A 1A53A 3N11A 4KKXA 1H41A 4R3UA 3HURA 2CBVA 3NQ2A 3H8AA 1VYPX 1FDYA 3GNOA 3GE7A 1QDSA 2Y5SA 2ISVA 1S1PA 5M17A 3HTWA 3LNMA 2CLPA 1UOKA 1BWVA 3BLKA 4NY2A 5MHBA 3FYOA 4FXRA 1QJWA 1F05A 3NXLA 3WQOA 3LV5A 4AUBA 3E49A 5JVLA 3NYZA 4GHRA 4A29A 2CBUA 1TX2A 1H1YA 3HG3A 1OC6A 4PL1A 6XIMA 3F4VA 3KCOA 4H7ZA 4AZBA 2FZ8A 2JBMA 3TC6A 1EYEA 1OX6A 1H60A 1GHSA 4GBDA 3SRFA 4WRHA 3LLXA 3NPXA 3GVQA 1Q6CA 2AGTA 5CSUA 3PNZA 1VAHA 3PFMA 3KHDA 3BDKA 3OHMB 1V3KA 4RDZA 3GZAA 1GTHA 1YNQA 5LIYX 4QCEA 5ENLA 4HSNA 1DWHM 3VYLA 4I8DA 1E51A 1ZS2A 2NWRA 4UQAA 3C3UA 3PK7A 3HJEA 2W6RA 1RLCL 2YW3A 1DQWA 2GSHA 1M65A 4M24A 2CW6A 1YLVA 2PWGA 1C8YA 4AYGA 4D6DA 4JICA 3WJZA 4P7QA 3CH0A 2YJQA 3V35A 4HN4A 1RHCA 1PCWA 3F5JA 2ZADA 1Z32X 4MVAA 1C8VA 4M80A 4DPQA 4C5ZA 3A4AA 5G1MA 2BGNE 1GOXA 2Y7DA 4DRSA 1A0CA 4DX3A 1E72M 7TIMA 1UWSA 4I7UA 1PYFA 1H7XA 4L4MA 4D71A 1MMFA 4NRSA 3OU8A 1F76A 3V0UA 3G0SA 3ISIX 3WMLA 2I5QA 3A21A 1BYCA 3WYZA 3AWOA 1S38A 2ZX7A 1MEHA 3OZPA 1TWDA 5M3WA 2ZQ0A 2NX3A 2PAJA 4LYRA 1K8CA 3WL0A 3NYDA 5BU6A 1G01A 3IJ9A 3WH6A 1KBIA 4E2DA 4P8XA 4S3GA 1L2QA 3MYPA 2GJPA 2GJRA 1KCXA 4GCXA 2QIWA 4M6QA 4U2ZA 3ARRA 3LG3A 1VRXA 1POKA 4TX8A 2XGIA 4IXHA 3IRSA 1QNRA 1RCQA 3W73A 4JTKA 2QHAA 3AXXA 2PTWA 3BAKA 1PKNA 3I4EA 1KD0A 3AYTA 3C2FA 3I7QA 1S5WA 2CKSA 2CXEA 3P67A 1I8JA 4ICNA 3CMFA 4CQ9A 4YVPA 4O13A 1ISZA 3BOFA 3QRHA 3ABZA 4XZWA 1JZ4A 1W2VA 4IQEA 4DJDC 3ZT5A 4C6JA 3LM7A 5AC4A 4XVEA 3LMZA 3CQIA 1NWSA 1KKRA 1CLVA 1MO0A 1PCKA 1FH8A 4MWAC 1PZ0A 2ON3A 1DJYA 4JS3A 5CLWA 3N2CA 4WIWA 4DZAA 3DERA 1GVRA 5DT5A 4AW7A 2X2GA 3HG4A 4L6OA 4OIFA 3W7EA 3HMCA 4LQ1A 3GYEA 2XIOA 4FLSA 4JYDA 5A6AA 3P6LA 4M5PA 4TMCA 3LD5A 4Y9AA 4HA4A 2IUZA 3DFHA 3S2LA 3G6LA 1OCJA 3N18A 3W07A 3WEOA 2V3DA 2VC7A 2P8BA 4QSFA 2H6RA 2CC0A 4HZ6A 3L4VA 1ZGDA 5IFTA 3TNOA 4Q8NA 3BAJA 5LIKX 1EP2A 2J74A 2YOCA 4O15A 3NDOA 4W89A 3W22A 1R9YA 1IIGA 1QW7A 3II1A 4LV9A 3ZT7A 3N17A 4XD4A 3OW1A 4GYJA 2CEQA 3QQWA 3SB0A 1O95A 3M43A 3H7RA 3NZGA 3GDBA 1IR1A 5FF2A 4MY9A 3F1QA 5FSDC 3OP2A 1TIMA 1R85A 3R2GA 1EO5A 1RBAA 3T0DA 3KVKA 3LGEA 1YNPA 5CPSA 4HPHA 4Z1CA 1XLMA 3WO8A 5AFDA 1B0IA 4GJ1A 4R7JA 4ZXOA 4V28A 1N55A 1RY8A 3GBEA 3Q94A 4QEEA 3KL0A 1CXIA 4O10A 3GO2A 4HU8A 1PX8A 1WPCA 2QMJA 5FJPA 2XIIA 4IMDA 1IR2A 4JY8A 1XX1A 4GIAA 1ZP4A 3MYOA 4C7DA 2DJLA 4LOCA 3CIWA 1DQXA 2HBVA 2CIPA 2FGBA 3NFUA 1UROA 1XS2A 3MP3A 1DIOA 4U33A 1AW1A 5A5WA 5AYBA 1TWSA 2PDFA 3WNPA 2PGRA 3M9YA 4QRNA 1GW9A 3U5YA 1QMLA 1UD6A 3YPIA 1Q4NX 2QCMA 4XZBA 1R7AA 3T2OA 1QNVA 1JUBA 1EHNA 4HOXA 5I06A 3MI2A 4WXYA 4V1XA 3SO7A 3SRDA 4JY9A 2GGJA 4UTMA 2C8NA 1OVDA 1NFPA 1DXEA 4Y9NA 3VE7A 1OWQA 3AXIA 3T6CA 1R2SA 4IQLA 1CECA 2V5JA 3WQ8A 4A2SA 3NDYA 1XG4A 4WY0A 3CV2A 3OJGA 4HHLA 3WDJA 4Z17A 3ELFA 3H22A 3PJXA 2WM0A 3RCNA 4PC8A 3LA4A 4PZVA 3T0TA 1WUEA 2YL5A 4HSHA 1W1A1 5CCZA 1J2BA 3SECA 3FKKA 2OGYA 1OF8A 3IAPA 3LRLA 4A3YA 1BWKA 3KP1A 1CGVA 3N4EA 4JQ4A 3Q58A 3GAKA 4PFHA 4QISA 7ODCA 3VCNA 2AQVA 5T91A 4E38A 1GG0A 1KR0A 2J79A 4H2HA 1W3TA 2DEPA 2R1LA 4XD5A 1UC5A 4RE3A 3KZPA 3FJ6A 2PURA 4UCGA 2XZ7A 1RVGA 3NL5A 2FVMA 1D3CA 3QMTA 4RE4A 1E6XM 4GH3A 2GK1A 4GUIA 4IUOA 3L5LA 4FLQA 2O7SA 4LUIA 4M19A 5JBDA 4LAOA 2Y5JA 3O0KA 2PDLA 4PRRA 1B3XA 4DHGA 2GOKA 1ONEA 3G3DA 2TSYA 3RILA 3JZUA 2P5NA 3BV4A 4HOZA 5FI8A 3VA8A 3M7WA 4BF9A 1RQBA 1QI5A 1UMLA 4L6HA 2WNWA 3B8SA 3RUBL 4M82A 1DJZA 3AMLA 1V5XA 1XLKA 4J4KA 1NOFA 2PZNA 4TR9A 3NOYA 3D47A 2PWEA 1KRMA 5DCBA 1FHLA 4RDVA 2RJGA 1BF2A 1UWQA 5FL0A 1KRCC 4LX4A 1PZ3A 5FF3A 4QJ3B 3CPRA 3VMPA 1EDGA 4FXFA 3S6TA 1UASA 2Z1WA 3EOLA 3WD4A 2ZUTA 4CQCA 4R9XA 3BCFA 1DIEA 1XIGA 5HPCA 4DIAA 2YDRA 1R46A 4P2VA 1HX0A 3G1VA 4LSBA 3PZNA 5D03A 3ZQ9A 4PYSA 2PP1A 5K4ZA 5C9XA 4JTRA 4R34A 2C18A 2XN0A 5D32A 3BAIA 3WLHA 4AZCA 1QI4A 1JCLA 1OINA 2BGQA 2DW7A 1A0DA 3UGRA 1GQKA 1YXCA 3FS2A 3O06A 4AQLA 4LB4A 2QQ6A 2IQ0A 2RGLA 3ZT6A 3COTA 3MHGA 3RRAA 1VFSA 1QI0A 3CL8A 2EPHA 4WJXA 4N02A 1XLJA 3W76A 2VZVA 4DXKA 1V0MA 4CU7A 1NFBA 2PDNA 4AWSA 2NQHA 1PIIA 4X61A 4HTYA 2G5WA 3GKFA 1VHNA 1U5HA 2QDGA 3OIHA 3LV6A 4NT0A 4OVXA 4UB9A 1LT7A 4BA0A 4ATLA 5D8WA 4HYRA 5C6MA 4XSMA 5C7HA 1W9BM 1MXDA 3PAJA 4Z2KA 2NX9A 3IIXA 3ZYZA 2CESA 2V5DA 1Q13A 2BODX 3EWYA 2EG7A 1AZ1A 2ZXAA 4DB7A 3P62A 5D2YA 4FXJA 2VFIA 5CSYA 3IGXA 4E8DA 3I7SA 1SW7A 5AYXA 1E6SM 2DVTA 2EHHA 4JIPA 3DZ1A 2PSNA 1RK6A 2BVWA 4LRSA 4MAZA 5BXTA 4HHMA 3GXNA 1R38A 5CAKA 5BOEA 3T7VA 1Q6EA 3UWVA 4GIRA 4E2BA 3OPSA 5BXSA 1BWLA 4MLJA 1JL8A 2XWEA 3T78A 1J0KA 4PMVA 1PE1A 1VLIA 4JTTA 3UG8A 1GVQA 3TXZA 4UZUA 1FRBA 1KFEA 2OCZA 3CV7A 5CPMA 2V2CA 3A3XA 3M46A 1DBTA 4BEQA 1XIBA 2E6AA 4WY0B 2BASA 3VKDA 4TMBA 2JK2A 1OIMA 1MQPA 3VD9A 5CZSA 4O19A 4K6AA 2CBIA 1B30A 1X96A 2DZBA 3LMYA 1EDTA 1L6FA 3AUOA 3QOMA 1E55A 4D8ZA 3ME3A 2POZA 2G41A 3AXKA 3RIKA 3S1UA 2YFOA 3H2MA 1VKFA 4AD3A 4K8GA 2YBTA 2BTMA 1P0DA 3PTDA 2XH0A 1EIXA 3MUIA 3QY8A 3USBA 4DNHA 1HQTA 4UFKA 4GA8A 4W86A 1LZOA 5LZLA 4FI4A 2JFEX 2UWFA 4HCDA 5G2IA 4HK5A 2A2IA 5HNNA 4XO7A 2P0OA 3VAVA 1O60A 4M6UA 2WNZA 4M7SA 4INFA 2OT0A 4FLRA 1VIZA 1CW2A 2PDXA 2CZFA 1KV5A 3M16A 3FSTA 3T0BA 4ENLA 1R3VA 3EMZA 5FL1A 1VJSA 3HG5A 3N04A 4C60A 1H5YA 1CBGA 4GCAA 1QOPA 1XYBA 2ZWYA 3B9OA 1DIDA 3TLLA 3L0NA 3DU0A 4MTVA 2RDXA 4O0KA 1JZ8A 1FP9A 3AZTA 1EJXC 3WD3A 2H3BA 4BS0A 3KOFA 3L68A 1ITCA 3TYBA 2W9MA 3T4WA 5DCEA 1UR1A 3W9ZA 2VD8A 3MCNA 2QEZA 3UA4A 1HJXA 2PWFA 3CQHA 1JCJA 2DT3A 2Z7KA 1RK5A 2QULA 3V5OA 5A6LA 3IVTA 1XBVA 2VEKA 3PBGA 1IT8A 4C65A 1H4PA 1B2YA 1M41A 2HNEA 1G5AA 3B9AA 2AMGA 4GYKA 1B3WA 3SADA 3SUVA 5HBFA 1P0NA 5BROA 3EX1A 1JFXA 2OOGA 3NIYA 4S3KA 3WLQA 1E0VA 1EPVA 3PS7A 4AZCB 1S2UA 3AROA 3SFWA 4F0HA 2V5KA 3ITYA 1C91A 1F74A 3N29A 2PTZA 4GGBA 1H2JA 3OBKA 1MW2A 1B1YA 5EBAA 1C29A 2GLKA 1IEQA 1PHQA 1V8EA 2O9TA 1NOWA 5IM51 1W5MA 4V27A 4QP0A 4LV4A 5FEXA 3QHNA 4LTSA 1EF3A 4MLRA 3PBVA 2NV9A 4LUSB 3QM3A 1QBBA 4ILSA 1EXBA 3UJEA 5HA7A 2WNNA 3GHSA 1JDFA 1SFJA 1DJQA 2QJMA 1R0MA 2A5HA 7ENLA 3WD2A 4PGLA 3S5ZA 4J3TA 3TDFA 4O54A 1VIWA 1HTIA 4M6PA 2DFAA 1VGAA 4FPSA 4HPGA 4W5UA 4KCUA 4PMRA 1XXXA 2L5HA 3BG5A 1WKFA 4URIA 3GBDA 1BYDA 2J6XA 1M1BA 3UWQA 3B8UA 7A3HA 1CCWB 3AUJA 5CG7A 1BG9A 1R7OA 4I8YA 2FVLA 2E9MA 3G5EA 4BY3A 3RLUA 2X41A 4MKVA 3UXLA 2VGBA 2Y7GA 4IQDA 1PZ1A 3ORWA 3U48A 4DF2A 3TUUA 4IGNA 1GOKA 4J1OA 2GSJA 4HA3A 4E4PA 3NQAA 4DWSC 2XZ9A 1UBPC 1KLZA 1ZBWA 4XZIA 1R2RA 2OQLA 4ROPA 1TWWA 2ANUA 3VC6A 1KBBA 3WUBA 3HGRA 1M04A 2FQIA 3HZ3A 4MNMA 3L7RA 3NG3A 1ITUA 1V0LA 5REQA 5I3GA 3EXRA 5D2VA 3WNNA 1FHUA 1BYBA 1FTXA 3IAQA 4DWDA 1G69A 2OR2A 3ATYA 3WFLA 2Y62A 3QV8A 5E6ZA 5BMWA 4UTUA 1K70A 3W2LA 4DZIA 1LOSA 1W3IA 1ME7A 1W56A 3L5MA 3GUGA 2YA0A 2DV0A 2VEIA 1JZ6A 3H7UA 1Y0EA 3BUVA 4NYUA 3OEXA 3T4CA 4JHMA 2F6UA 5FCZA 5E0CA 1SO4A 3E96A 1M53A 3PZUA 1QATA 2A3HA 4B16A 1EXPA 4D72A 2ZRXA 4J40A 3PANA 3HMJG 2MNRA 1XG3A 4MAVA 4HA0A 3OG3A 1H61A 4KGJA 4CNUA 1VJZA 5DCDA 3NQDA 4CNNA 4ZE4A 2Q3RA 3MSGA 4J5NA 3TQKA 2Z4GA 1VC4A 4GVGA 4FX8A 3BMWA 5D2WA 4GABA 3CQJA 2OWXA 3IIPA 4KT2A 3T0CA 1R9ZA 2PWVA 3V1PA 3WFZA 4AZ7A 2INEA 4UWMA 1CEOA 2IPWA 3WBWA 1UD8A 3TSDA 4L9ZA 2ATMA 4JBRA 2QIIA 3LQLA 3VOHA 3SQMA 3O16A 3GVVA 4CCDA 1R6WA 2J7DA 1EWDA 3QR1A 2Y1HA 4UR7A 1XD1A 2HVNA 1Q4WA 1EP1A 4PUKA 1Z41A 4B5UA 1OFAA 2GJXA 1EJVC 1VP5A 2G8ZA 4NX5A 3DI1A 4K3ZA 3W25A 1C9WA 3VILA 2ISWA 1ZSXA 4GGHA 4WUIA 1H7WA 3R8HA 3ONBA 2BZNA 2A6LA 2PLMA 4Q7NA 1Z6KA 2IQDA 5LXXA 3KCLA 5I00A 2ZZ2A 3GK0A 4ATDA 1XRVA 3VX0A 4JTIA 4ZQRA 2BY1A 4W9TA 4O1FA 1BGAA 3M0LA 5EKYA 4XV0A 5JBEA 2CHRA 3SN1A 5B80A 1A5BA 3OVRA 1P6WA 5DRIA 3M44A 2NLIA 3L23A 5BWAA 2C7FA 1GKPA 3MUXA 3LYEA 3CUHA 4PR4A 4P7OA 2C79A 3A6OA 4B5SA 3MI3A 3F4DA 3L21A 3DH7A 4GVFA 1E4LA 3TYZA 1E3XA 3HFYA 3WLPA 4ZOEA 3BSHA 4WDWA 1TCMA 2IKIA 4KIRA 3I6EA 3PZGA 1V3JA 3N4AA 2B7NA 2V67A 3AQUA 4LBSA 3A23A 2QJHA 3FEMA 2FZBA 3AHYA 3ES7A 4UC5A 3W87A 3QPZA 4OKDA 4ADUA 2QJGA 5LGXA 4ORIA 1N7KA 4DN1A 3A9IA 2WVTA 5BRPA 1VS1A 5LSMA 2O9OA 1JYVA 3XIMA 4H4IA 5CBBA 2PDYA 1F3TA 1LOLA 2Z2UA 3ID7A 1A4MA 3U9IA 3E0FA 4PCFA 2Z00A 1AFSA 2YDQA 1JF6A 3H23A 3KFTA 4RNHA 4BQ2A 1ONRA 1AJ0A 5AHFA 4GI8A 1WKEA 3FFSA 1F8MA 2G3MA 3BW3A 4IL0A 4JDBA 1GZJA 5M2FX 3GNDA 2TMDA 3OIXA 3H21A 1FFRA 3TONA 1QHZA 4GY0A 3TW6A 5BXPA 1V6YA 4JKLA 3JVAA 1XLCA 4YMZA 5DEZA 5D04C 5FF0A 1JD7A 2I57A 3WK3A 3NL3A 2D2OA 5KMYA 1PKMA 4Y90A 1SFSA 4AIOA 2Z2BA 4JTJA 5REQB 3H24A 3MANA 5A3HA 4OBSA 3NL2A 1PTGA 3NURA 4D6CA 3AIQA 5LIXX 3CHVA 4Q22A 1B9BA 2GPTA 4F79A 1PIFA 2C71A 3GIQA 3KHJA 3LXBA 4O17A 1AK5A 2DH3A 3WQPA 1FH7A 4A21A 4XZLX 4NG3A 4QAIA 3G8EA 2E6YA 4GQBA 1G7UA 4BI5A 1UD4A 2OYKA 1WOBA 2FZ9A 3E1F1 3W82A 3AISA 4Y9PA 2XSXA 2DW6A 1TV8A 1KGWA 4H6KA 3T2PA 2WPGA 1PWMA 1KC7A 3W02A 3D46A 1I9CB 1IQ8A 1GCYA 5I5RA 2GJLA 3WDRA 1TV4A 2YR1A 1OT1A 3A3HA 4FA3A 2Z24A 4TOQA 1GQIA 1E1CA 3EPNA 1UP0A 4UQBA 4IL2A 2ZUSA 3T2QA 1HUVA 4JAWA 2V5CA 4NILA 2NVAA 4QGCA 1H7NA 4HN8A 5A8PA 3PZQA 1XIFA 1P6CA 1RQEA 1EA0A 2YX0A 3WNLA 3S1WA 2D0HA 4FF5A 3FJLA 3MO7A 5AYYA 3WUGA 3A4WA 4PB3A 3I7RA 1B90A 2XH4A 2VO5A 5CSSA 3LCFA 1E9ZB 3PZMA 1EJRC 4IMAA 4XAFA 4NXSA 3UJ2A 4DZHA 4MUZA 1TVNA 1FWEC 3AHZA 4ZQPA 2GUBA 4RK8A 2HJPA 2F6KA 2GJXB 3CLWA 3VIHA 2A3AA 5DBUA 5TD4A 1GTEA 3G22A 2FFCA 3T44A 3UVIA 2PZ0A 3M5VA 2AAAA 1OYBA 4IXXA 5F1UA 3PB2A 4RNFA 3SCPA 1W3LA 3AIVA 2Q3OA 5F2MA 1OD8A 2HXUA 3DGBA 4EANA 5A1AA 1FCVA 1VCGA 3VD4A 2WJEA 2XVLA 5E0FA 4LW7A 3CAQA 4PUJA 4P5UA 4N9CA 1CXEA 3P7YA 1J79A 2ODOA 3OVQA 3A4XA 3CGTA 1R3YA 3G8RA 2WO5A 1DWFM 2VX7A 5LXEA 4FNPA 1QNSA 1XPGA 4Q8WA 2OJPA 4M81A 4ZMGA 3N12A 7PTDA 1FX6A 3QC3A 1E5JA 1RCOB 1T99A 4R33A 4LC8A 4UFJA 2FPTA 3KP0A 4KFOA 4BWLC 4YHGA 1P1XA 3LZ5A 1QPNA 4JIEA 2WKLA 4ZE5A 2WXDM 2KAUC 2QDEA 3AS3A 5LIUX 3QQ1A 4HK6A 3GTHA 4NQ1A 1OABA 4B2DD 4EXBA 3BW4A 5CZ0A 2R1KA 3VDBA 3C86A 1H7RA 2A3BA 1F3WA 2JEPA 4HGXA 1O7AA 1PZ2A 1OB0A 4CNOA 1JDDA 2W67A 2HE8A 2DQXA 2X0HA 3ARQA 3LY0A 1FWIC 3PZOA 5I3JA 3TOPA 4FIRA 4C6KA 9XIAA 1AA1B 1ALDA 3DBNA 1LL7A 3IK4A 1GHRA 3R13A 2NQZA 4QS5A 3SQLA 1V6TA 4EKJA 2R1PA 3P60A 3S83A 3K8MA 1QVBA 4ASTA 4QSHA 5E70A 3UD6A 1GEQA 4BQ3A 3EA3A 2WLZA 3KRBA 1AL8A 1C8XA 1US0A 3W86A 4MB4A 3FJNA 3CZJA 3L5AA 1B9ZA 2GWGA 3AOFA 1MQRA 1GOIA 2WZMA 4JIHA 3NJ3A 4HA1A 1TV2A 4D9PA 4DBEA 2ZXQA 1D9EA 5C71A 2IXUA 2RKXA 4L1XA 3A12A 3MU7A 1R2TA 3K4WA 4D6HA 1IXOA 2X0YA 4JTHA 4U5IA 2GSEA 4IGHA 4IX2A 3ZVHB 2Y89A 4REQA 4FZIA 3P0WA 4ATWA 4O16A 5AZ1A 1V3MA 1VJIA 5GVJA 2EJAA 4ZVJA 3SCWA 1XLLA 5C55A 4ZODA 4RZ5A 1A80A 4E3TA 3MO4A 1IEWA 3TMQA 4Z0SA 4FOUA 1VFUA 4G2DA 3KDNA 4WXZA 3RYSA 1LCOA 3LBOA 1ADSA 1Q6QA 1L0PA 3VIGA 4M8UA 3FK4A 4DI8A 2PRLA 2VDHA 2IXVA 5CLTA 1CIUA 3OVPA 3MBDA 4AYSA 2JIWA 4QG6A 3CAWA 1E1CB 1ZBCA 1M9HA 5A94A 3RX2A 3WY1A 4FSAA 3V75A 4Q8OA 4D1IA 4O1AA 5I24A 1U2YA 1S3HA 5H2ZA 2HTMA 5AHMA 4UR8A 1XBZA 2EG6A 2VUYA 4ERGA 4GI6A 1XM3A 1FY6A 3HGSA 4YLWA 5ECVA 3IANA 5A6TC 1HO1A 3R58A 2PLJA 3HOJA 5A6JA 1H0IA 4QNEA 1XYCA 1EC7A 3BSGA 2R1NA 4IFKA 4HHPA 2PF0A 2BWGA 3QW3A 2PWUA 3VGFA 3UXIA 2WBKA 1YPIA 1UKPA 4FOJA 6XIAA 4DJEA 4OU1A 1NQKA 3HQNA 1LL4A 5E1QA 3W00A 1Y65A 3R10A 2OO0A 1NFGA 3W83A 1FP8A 3S9YA 2E6DA 1P1MA 1F5ZA 1UBSA 4NZ4A 1UD2A 4QM1A 4K38A 1HW6A 4A6GA 1KLYA 2DIJA 1B3ZA 3NGJA 2YCKX 1WZKA 3UR2A 5DMLA 4DVOA 4IH3A 4LYPA 3VDCA 3H55A 4E0CA 4M7TA 4GKLA 1QW8A 3WLNA 4C1NA 1HJWA 4N6FA 5AC6A 2VFDA 2D73A 3N19B 5F4XA 1UWAA 3C2VA 3FCPA 3DYMA 3VCRA 3PUGA 1B3OA 4R27A 1MWOA 4QITA 3I3BA 4WDXA 1B54A 4YL2A 5IFPA 1TJ1A 3NSNA 4DLMA 3K4DA 1J0ZA 1I1XA 1QPKA 2J9XA 4EACA 6TIMA 4GXMA 2Y2WA 3KDOA 4F66A 1A5KC 3VPLA 2QKFA 1K9FA 1ZPTA 3LOTA 4J3XA 5TNVA 3R6IA 1ZJBA 3VXGA 3GNRA 2QCDA 4TX6A 1P5BA 1FWSA 1N8WA 5JMUA 3CZ8A 4XTIA 2ZC1A 2OLSA 2QUNA 4KMQA 2HRWA 3I65A 3EEGA 4IX0A 1GYMA 2VC5A 4KIEA 2V8ZA 3CWNA 5EBUA 3M0KA 1OFBA 3THUA 4Q4KA 5DMNA 2C16A 3PG8A 4LAKA 4Q8VA 1OEPA 1GQLA 2QW5A 5LYRA 3ITXA 4HZMA 1OC7A 3IJDA 4IPPA 1J0YA 1VCFA 5D4YA 3B9DA 1GNXA 2GZXA 3MSDA 2C1HA 5I02A 4R9OA 3GAYA 2WZHA 5LGZA 4OUIA 4E2VA 4DJDD 1W9VA 3EX2A 3VNLA 4NZ1A 4REQB 3CPUA 3GH7A 3GU2A 3SCVA 3GDTA 2ZX8A 4AWUA 4MWAD 3O07A 1NAL1 2XSBA 1UP3A 4H7VA 5BRBA 1EUNA 1MDLA 3EX4A 2QS8A 3GG0A 5HJLA 2QGYA 3PTMA 3DG3A 4F0SA 4JTQA 5CZJA 3LCHA 5K2ZA 2V68A 1XQKA 4FNSA 3M5YA 5HJXA 8A3HA 3W6MA 4S2BA 2A85A 4Q8TA 1FWAC 2EKCA 4P8UA 1KA9F 1SJDA 3FXGA 2A0NA 1V79A 4FF7A 4XKMA 2J7GA 4Q6JA 4GO9A 3OQ8A 1O1HA 3SIMA 3QHMA 5MKGA 2CERA 4X63A 4JN8A 1KV8A 1VFMA 1F2JA 3ABQA 3A3WA 1DORA 1M5WA 3CUFA 4JHZA 4DXXA 1U83A 1ZCCA 2G3IA 3G77A 3SGGA 4X60A 3SRKA 1H49A 4JFWA 1Q2SA 4PB4A 3V3WA 1C9DA 3AIBA 4D6IA 1YX1A 4IFKB 4YTQA 2ACUA 3AI0A 1UKSA 3VZYA 3WDQA 3W1MA 3C0JA 3SCQA 2Z7GA 3VOGA 1XRSA 2ZFAA 2MUCA 4YNGA 1S39A 1TJRA 4H8UA 4WSKA 2YCLA 1IZKA 4IICA 4GK8A 4HK7A 1OGGA 4GINA 2INFA 1A3WA 2FGLA 2YB1A 2ZA3A 3TK7A 1DJNA 3GXTA 5HK4A 4NJGA 3VIIA 4XKYA 3VFLA 3PPHA 3EA2A 4IJBA 4I7VA 3UZ5A 4DM2A 1UKOA 2VGFA 1ITXA 4IGSA 4O14A 3IGUA 5LNWA 5EY5A 2CLKA 2BS9A 2F38A 1UW9A 1DWJM 4RX0A 1TZ9A 4N4PA 2DZAA 4C1NB 4CLMA 1LLZA 3WL1A 2PU0A 4JTDA 4RE0A 1TA3A 4L80A 1YADA 3ARPA 3PWAA 3U8GA 1J0JA 3KBNA 1HL9A 1XLFA 3R7MA 3DFSA 4TVCA 1UH3A 3DYPA 2OOFA 4CD6A 2TPSA 4O1BA 3FVMA 2JE8A 4L1WA 3SBFA 3I68A 1EWEA 2DSZA 5U4NA 9RUBA 3WUEA 2BGSA 4O8RA 4FNQA 2VQUA 3O7UA 2PLKA 1PKYA 4AHQA 1KM4A 1L8PA 1G94A 1RLDA 4JDYA 2ZXDA 1CXFA 2QR6A 4AG0A 1ZQ5A 2QF7A 4N2YA 2WAGA 2EJ1A 3GXMA 3P80A 2EF9A 1R8LA 3K46A 3EWBX 4GUGA 3NWRA 3P84A 2QCDB 2NW0A 3EBVA 5I23A 1JQVA 2VCCA 1UKQA 3UW6A 2WV8A 5D9NA 4HYWA 1F6YA 3U57A 1AH3A 2YXGA 4PBFA 4LCSA 5HNTA 4MNJA 2W0UA 1F6KA 2WQDA 3ONCA 2BXZA 3DHDA 1CXKA 2VNCA 2VRQA 2GUUA 4OOUA 2HBXA 1IYXA 3UYCA 2WWDA 3I10A 1XF0A 3NO5A 1EGVA 3RLGA 5A6BA 3AHTA 4BJHA 1D7KA 4I9AA 2PD5A 1RV8A 2Y7FA 4PCSA 1CXLA 3W28A 5CC7A 1FHVA 3MSRA 4ZSUA 3STGA 3NZ1A 3MP5A 4CQBA 1ISXA 3EPMA 1E6ZA 2NZLA 3WLTA 2E5BA 1YW1A 2QLYA 3TYDA 1O5XA 4U3CA 4KESA 4XSLA 1S46A 2P3ZA 4DBUA 1XHGA 4GUHA 4JTFA 4LVFA 4CGTA 3QGAC 3PN8A 2FB2A 3CEPA 2B7PA 1QRQA 4MY8A 1PSCA 2NT1A 4PCPA 4A4AA 5HDRA 3GU9A 4PB5A 3O15A 1BXBA 6REQA 1V02A 4L61A 3PBYA 4YTUA 3GH5A 1XLEA 2R14A 4FX6M 3N2TA 3NVTA 3MMDA 5A8QA 5EL1A 3S6DA 1PIGA 3KBWA 2DT2A 2C19A 1O5RA 3U4FA 3RGTA 1RJQA 3U3HA 3B3DA 4YVVA 1S2TA 4IIEA 3UR5A 1HKIA 4CEXC 3E0IA 2C6QA 3L2LA 3ARSA 1TCDA 1A50A 5MKGB 1WDPA 2J7BA 1Z9AA 4HPXA 3ZWTA 2V30A 1XLGA 3S47A 3KW3A 1N82A 3TC3A 1A47A 1TJ0A 1KQZA 4PRWA 4KW2A 3TA9A 2AQOA 1M3UA 2A79A 1AQHA 4JR5A 1XIJA 3W27A 4M56A 2F84A 1H09A 2FMNA 1TPB1 3OGVA 2J75A 2X30A 5BWFA 1XW8A 3ABOA 3ARXA 4C6MA 3RLVA 4EXAA 1BLIA 3VIMA 4AIUA 1W8SA 2VELA 4GPNA 5J04A 2P10A 4C1KA 1JQXA 3NQ8A 4PTXA 4YYCA 5I0DA 2YCLB 3WBAA 3BOLA 3W7OA 2VRKA 3BG3A 4EE9A 3KVLA 3LCWA 4CUCA 8RUCA 5CEWA 1SPQA 4CNSA 2HSAA 4XKYB 4LUYA 5AY7A 3W70A 4HT3A 3KL5A 2XPKA 4PTNA 2CLFA 3BJTA 2HISA 3AHVA 3GB6A 4K37A 3DEQA 2OZ8A 4AISA 3B05A 1YPFA 4NXKA 1GONA 2C1GA 3VK5A 3WZ0E 4DF1A 3TYEA 1T8XA 4XX6A 4NZJA 2GVGA 1EOKA 1VBJA 1XV8A 3BL3A 4D6GA 4EVZA 1Z89A 2J9ZA 8CGTA 2GGIA 4WSHA 5AB3A 5F4SA 4PSRA 5F2IA 3FEQA 5CJ5A 1Z3NA 2XGBA 2PDJA 1WZMA 3LTYA 3K30A 3I6RA 1V93A 3QBUA 2DUAA 4JZ5A 5A6SA 5FOOA 2VVSA 4GZ7A 4OOZA 4DM1A 2UZ9A 3N2OA 2E9BA 3OTRA 4E2OA 3V16A 2PA6A 4IIDA 1UCWA 1AJ2A 1NU5A 4C6OA 4PMZA 1EO7A 2VRJA 4ROQA 4QQ3A 3CB8A 3DG6A 4DO7A 4WR3A 3JUGA 4O4WA 3H2FA 5C9RA 1E1EA 5IOBA 3PUEA 1KM5A 2JKPA 2OO6A 3UEQA 2D20A 3GQYA 3APGA 1QUMA 1E0TA 4AIEA 4MNLA 2BY2A 2VX6A 4S3BA 1AQFA 3AICA 3RRXA 1PEZA 3RO6A 1SMDA 4IF2A 2FDSA 2J7CA 2FGZA 4H9VA 1YXDA 1RJRA 4BF7A 2OX1A 2WYSA 4XUYA 4FNRA 4TU1A 2VD9A 1XYZA 2NUWA 3WDHA 1BF6A 5T9CE 4R53A 3SW6A 4LCRA 2OT1A 1V08A 3URAA 1XSIA 4X22A 1MYRA 3B4UA 5CQ1A 2OGJA 3G1YA 2D0GA 4JQAA 3V4BA 3JRKA 3W1PA 1H51A 2ZRVA 1WQ5A 5DMYA 4XB3A 2XINA 1I75A 5HMEA 3O05A 2BP1A 2PUZA 1TUFA 6REQB 1GVSA 3IVSA 1Q6RA 4FAMA 3MQTA 3MHUA 1K03A 2F61A 1MFUA 2BVDA 2GQ8A 3CHFA 4M6VA 2WK2A 4ZQNA 2GJNA 4PBGA 4QROA 3SGUA 3E2VA 1L8NA 4JKKA 5CGMA 2ZE3A 3CT2A 1BKHA 3F4WA 1KM2A 3KE0A 3TC7A 3ZR6A 2WW5A 3PBUA 2VUNA 1GKRA 1XKJA 2TRSA 3CU2A 4ZTYA 3N1AA 4JN7A 3UWEA 3B8VA 2Y8UA 4AEFA 2D69A 2C1IA 2PU1A 2CKRA 5C8BB 2BVTA 1WDDA 3AMGA 4PH6A 1SGJA 1W5NA 1XLAA 4EWJA 3NQBA 5KITA 5BW6A 4FXSA 2EEXA 2Q8ZA 4DUWA 3N34A 2A7PA 2A6NA 5BOOA 4LB3A 1OADA 3E38A 1TPUA 1XFCA 3LS9A 4JPGA 2Y4SA 1WYIA 7CGTA 3VGHA 3OLIA 1BYAA 5EMLA 2POTA 1CWYA 1K7EA 1QHOA 2Z1SA 4WHBA 3LHTA 5A2AA 4NI3A 4A22A 1BEUA 4H83A 3TSMA 3GR4A 1ODZA 2OQYA 3WF0A 4DQWA 4IQJA 5HXMA 3N3TA 4JL2A 3FY1A 3W7MA 1I45A 3B9NA 1J0HA 3QSRA 4DWSD 4CQDA 1CT5A 4JTAA 1W5OA 2RAGA 4ZB2A 2VGIA 3BVJA 4IP7A 4GO8A 3LCXA 4IMGA 2EKGA 4MY1A 1JGIA 2G4JA 3PWGA 3HB9A 4IIGA 4B5VA 2PDQA 1FOBA 2X09A 3GNPA 5M1TA 3D0CA 3VGDA 1KGXA 4JX6A 4U31A 2X1RA 4ZR8A 1C7SA 4ZCWA 4QLLA 2WVVA 3H2AA 4EF9A 5I78A 2BLEA 3MWCA 1W37A 5E5CA 3KL3A 2ZWZA 1VD6A 4WJ8A 4FK9A 4FHAA 4JFUA 4LWWA 4UTIA 5TF0A 3GG8A 5B7YA 2DZWA 3GDLA 5AC5A 4CKQA 4AMCA 4E4FA 3KZSA 3HQ1A 3FHAA 4G1KA 1XUZA 3SN4A 4LNYA 3WX7A 3DKLA 1B3YA 3Q2DA 2BG5A 3ARVA 4W8AA 4QEHA 4FO4A 1XYFA 2XIMA 1CPUA 3GXIA 4I5XA 1EGMA 1EX5A 3QV7A 1JAEA 1X7FA 4DBDA 4F48A 4GQGA 1PDZA 1FWFC 1DHKA 3VD3A 1W1IE 1W3KA 1C8QA 1DXFA 4LYKA 4Z2LA 5FIPA 1RSCA 3ZR4A 1WUFA 1DJGA 4LFYA 3KX6A 3IARA 1VCVA 2BB0A 1JNEA 3RPMA 3DECA 3W1UA 1P43A 4KETA 4G56A 5CPNA 3VTRA 3QFWA 3OQEA 2J7FA 4XISA 5H8UA 3H2NA 1UP2A 4L7ZA 1GGOA 3NM3A 1V3LA 1CYGA 3ARUA 2CWXA 3A47A 3O8AA 4U28A 1NIUA 3MT1A 4HPJA 4ZENA 2DP3A 1AD4A 5DN1A 4FLOA 1VEPA 2DZPA 1Q6OA 1G1YA 5BU9A 1TV7A 4N9EA 1WDSA 3OYZA 2NQ9A 1TV5A 4C5YA 4NL1A 4MB3A 1HL8A 2VDIA 1XCWA 2Z6JA 1XI3A 2G37A 3VIPA 1F9CA 2O4MA 4AHPA 1VYSX 4HNTA 5M5DA 2ZXBA 1ITQA 1SYTA 3C8FA 4DO4A 1VH7A 3XISA 4KRZA 3A64A 4CD4A 1FWGC 2WKJA 1H50A 2F7FA 3BH4A 1PAMA 4HMDA 4YTSA 3VNIA 4DBWA 1SFLA 3QR3A 1EBGA 4JX4A 4GIYA 1LUCA 4J3UA 2CLEA 3CC1A 3UETA 1NDYA 2ZUMA 4LVAA 4V2XA 3RFAA 1W31A 1JRCA 4GMEA 1QPOA 4NJKA 1FWTA 3DFPA 1S2WA 2FZMA 4DAFA 5JUVA 4EPBC 2J77A 1C7TA 4EP8C 5JQ9A 3B40A 4HSOA 2QVNA 3W1LA 1QU4A 3HU7A 5KSWA 3ARTA 5C9WA 3LPGA 4OWGA 4R7OA 5AZ0A 1Q85A 2V3EA 4NX0A 2D24A 1H62A 3AHXA 4GG9A 3MJYA 1LBMA 2OSWA 3NPVA 2Z1BA 3AJ7A 4JCLA 3TTSA 1UJPA 4CN4A 2ZVRA 1JPKA 5D02A 3VKJA 1FWDC 3QYQA 3M0XA 1FDZA 3IIVA 3NQCA 3M0VA 1YXYA 1TVPA 3JU2A 3TN6A 2YXXA 1ZAIA 4QTGA 1TJ2A 3G2GA 4PFMA 3CAVA 2Y85A 3N13A 3ALFA 4G7EA 2VEGA 4AZ5A 4V15A 1G4EA 2WJDA 3CQKA 3HFTA 4RZBA 1K4GA 1YPXA 3EPOA 4JNZA 4XWUA 1UWTA 1S1RA 3PF3A 5KETA 1B5TA 5F2GA 4J2MA 2YYTA 3WK2A 1YE4A 1JPIA 3PJWA 1Y7VA 4CVWA 3UYIA 4XAGA 3CLMA 2UY2A 3FSUA 3FAWA 2VKZG 1BD0A 1Q66A 2VXNA 3IJQA 4XIAA 3SI9A 1MQQA 2DPEA 3CL6A 1F61A 2ACRA 5ABFA 5LA1A 1XIDA 4RNJA 4TX9A 2WVVB 3U2OA 4QDWA 1ZUAX 4C90A 3THAA 4MYAA 4XAYA 1F73A 2OWCA 3ECQA 1UH4A 3GIPA 1XKYA 4QDPA 4AB4A 3CMGA 2NXHA 3CJPA 1EBHA 2I17A 3STFA 1KM0A 4K2SA 4G9PA 2CZDA 5HOSA 3VGBA 3ANYA 1E0XA 3DFQA 4IIBA 1P0EA 3CT7A 1QNQA 4TO8A 4KWSA 3Q45A 3WLIA 4JTUA 4KS0A 4B4FA 1Q8AA 1LRTA 3S9ZA 1WCGA 2ZZ7A 1E15A 5CGTA 2WC4A 2EXOA 4H9UA 2PDMA 4AD5A 4Y8FA 3W7QA 1HO4A 1O66A 3NVDA 3QMRA 3N3MA 3G1DA 2QNEA 1IF2A 1NELA 1TE6A 3W85A 4R85A 2I1OA 4LALA 4KWOA 5AHLA 4AC1X 2QAFA 3CNYA 1VFLA 3DI0A 1LQAA 2BY3A 1XSJA 4H04A 1YDYA 4ZGYA 3EDEA 3SCRA 4PE8A 3AIWA 1L9WA 3KLLA 4QE1A 1FXPA 6A3HA 3B97A 2G4FA 3W2MA 2VYOA 1MXSA 1YBQB 4U10A 1ZBVA 5LA2A 1BRLA 3IRDA 4J3WA 3CYVA 4Q4QA 2DJXA 3VMOA 3C4UA 1UR9A 3P8JA 3SIZA 4QQUA 1A3XA 1JZ2A 2E0PA 3G1RA 3TE9A 3GIYA 1EFZA 2WVUA 5F7UA 3K5XA 2OEMA 1HL2A 1D8CA 3W2NA 4HIBA 3ITVA 4B5XA 4JNYA 3LHVA 1R3SA 3CWHA 3EMQA 1FCBA 3E5BA 2ZZ5A 3LRMA 3F03K 5EMYA 2WHMA 3MUZ1 2BHYA 1LUCB 2V5LA 1I6NA 5H8PA 3TNBA 4CEUC 4K39A 1X6LA 3GFXA 4WD0A 5HWNA 4NJIA 1NF0A 1WDWA 3UZWA 3ZJ7A 2FIQA 2PP3A 1H7OA 4OHQA 3Q67A 5AN7A 1RUSA 2GFTA 5CKSA 5FAJA 1F6PA 4U5KA 2ACSA 3G1HA 3QSTA 1UUMA 4DYEA 2VI0A 4GOAA 4L9YA 3UCCA 1GOOA 3TH6A 2DZXA 4V1YA 3S2MA 2A1YA 4NZFA 1WDRA 3BTNA 4S3FA 5BYWA 5FJRA 2B81A 4Q6XA 4HJFA 3L0GA 3D6NA 1SJBA 3GTIA 3ITTA 3G6MA 4LANA 1GYNA 3A5FA 2YCIX 4IHCA 3TN4A 4ZFCA 4BKNA 1EJ7L 1OFRA 4KCWA 1SSDA 3EXTA 2C0HA 2G3FA 1TTQA 2ZRUA 1K02A 2VX4A 3FIGA 3LPPA 4G7EB 3W7GA 3ZXWA 4NASA 4LBUA 4A2RA 2C0AA 3UGVA 2EO7A 1RVKA 3G1FA 1XGZA 4H8NA 1CDGA 1PB0A 2XM1A 3M0YA 2QJJA 4Q4RA 2D2HA 2G97A 2GQAA 3BAWA 1FH9A 4ACZA 3AZRA 4N6EA 1J10A 2Y6ZA 2WC3A 4G6CA 2VFEA 5ABFB 3LCLA 1TPEA 3DHUA 1G67A 1W6TA 2G3JA 5I3DA 4JIIX 1LRNA 3VINA 1V02E 3LLFA 1L6GA 3PNUA 1V4YA 1Q63A 2Q01A 3IJ8A 3AIUA 1HJUA 4BEUA 1Z7AA 2H9AB 3FX4A 2VR4A 1HKWA 3W29A 3RITA 3ZLGA 4YXGA 3EKLA 3NUKA 4WGXA 5KZDA 3UG4A 3KUMA 1V6WA 3RCMA 4GC3A 4A8LA 3QV6A 3OB8A 5IDIA 4O0QA 5JIWA 3LM3A 3PSWA 1TQXA 4L9XA 2HDJA 2ISSA 3UNDA 3UXDA 5C2CA 1BTMA 2WMFA 3GTFA 4JCMA 2RFGA 2R1MA 4Q8PA 3RDKA 1AZ2A 1KO0A 1K9DA 3H70A 2H3DA 5JH2A 2Z26A 2Z2AA 4LAMA 2PEVA 2CXGA 4NZCA 1DVJA 3MJMA 3LHZA 3T40A 4RUBA 1R3RA 3QXBA 5CC5A 3TLQA 3LERA 3OHIA 1T5AA 3WEMA 4DJFA 3N6JA 4AVFA 1UA3A 1REQA 4BK9A 3VFCA 3UY7A 1LG1A 3QLDA 4CD5A 4LS2A 1QBAA 1E56A 3DXIA 2IMRA 5HUPA 2V63A 2BX7A 2W3ZA 3UWZA 4KCVA 5CSRA 4US5D 4JD4A 4PMUA 4FP1A 3VM7A 1EUAA 3TP4A 4K7YA 5EGRA 3W1QA 2KX9A 4B5WA 2DY3A 3CO8A 3POCA 5C9UA 3N15A 2RDTA 1D3HA 1BRLB 2P88A 1WZAA 4FNTA 4S38A 2WVSA 2ZYFA 3U7VA 4QLJA 3TYAA 4AZIA 1C90A 1UYQA 1TFVA 3H4XA 4Q3MA 1JPMA 1KFWA 4ICCX 2W79A 4M1RA 5MF5A 2I9UA 4WKAA 4GNJA 4O28A 3UZJA 4P7LA 2E68A 4C7FA 3B9EA 1OGSA 4WZHA 4B4HA 5E09A 3UPWA 2QYGA 2QPUA 4QJ5B 5I6SA 3BICA 1RD6A 2GGEA 3S9IA 4GLEA 3NQGA 2VQTA 1YQ2A 1A5AA 1HZYA 1HG3A 3DOPA 2NSOA 4DJEC 1WXJA 2QPSA 1EZ2A 3BLOA 3DN5A 3GU1A 2JGYA 4MOZA 3T81A 1O68A 1RAKA 5HATA 3WELA 1UPPA 2IS7A 3S5YA 3LSBA 1D3GA 1QOXA 2JF7A 1CI1A 3GVGA 2VX5A 1E5NA 1ZL1A 4MPKA 3VDAA 2XYLA 2W61A 2E5CA 4ZOCA 1ZAHA 1E6PA 2HWGA 3RO8A 2G96A 4K36A 4XTDA 1DWIM 2GUYA 1ME9A 3GG1A 4Q4OA 2XVPA 2OWWA 5HWMA 1W32A 3TQPA 4UFMA 4GJJA 1Q6GA 4MNKA 4QE5A 2NV2A 3S5OA 3W2KA 4C6QA 3AMCA 1JJKA 3FLUA 1XLHA 1W9DM 3RF9A 1X1ZA 5CPLA 1W2PA 2XJ7A 4EAMA 4LF2A 3SCNA 2A3LA 1A5NC 3GHRA 3QFEA 1XIHA 3LSCA 4KWWA 1K77A 3W7JA 1O5QA 4PCNA 2QV4A 4BFAA 2W92A 4G8TA 3SFKA 3NL6A 3UZZA 4MYXA 2ICSA 3PUOA 5D05A 5HR6A 4MFDA 5LNSA 2VR2A 1HKJA 3VZXA 3W72A 4TUFA 3WD0A 3M0JA 4UNIA 3RR4A 3SJNA 4ACZB 4GI4A 1TZ7A 2J8TA 1IZCA 1LBLA 1T96A 4PMOA 4QNWA 3TQ0A 3W74A 3DDMA 3DENA 3IK2A 1LG2A 1PBGA 3DHFA 1LORA 4LUSA 3U0HA 4PMNA 4K1GA 3C2EA 3W1XA 4H9XA 4US6A 3MSYA 4NAEA 1IWBA 1W0MA 1HP5A 1TWIA 2WHKA 3SUUA 2ZUNA 2RUSA 3E12A 5IRPA 3HQPA 4POCA 1JUKA 2CITA 4K8EA 2VURA 3OBEA 5FAGA 3K8KA 2BSLA 2WZIA 5FEZA 3GRIA 3O6AA 4WOZA 3CUZA 3KBMA 3JR2A 1E9IA 4JKMA 3G1AA 1JNDA 2VGGA 3WMSA 4K7VA 1QFEA 2DDXA 3ZFHA 1SJCA 1KM3A 4JTGA 2XG9A 4S1FA 1REQB 3CTTA 2JKAA 1BXNA 2Z28A 3RNDA 1SW0A 1XDMA 2WSRA 4RR4A 4D6JA 2PCEA 1MUCA 3PWIA 3PBMA 2FJKA 3EYPA 3BZJA 1KB3A 2GGGA 3ZJKA 5EA9A 2HPIA 4J3ZA 4PA8A 2VJXA 4JX5A 1VENA 4D6FA 2I14A 1EJSC 1UQYA 4ECLA 1OCBA 3UNTA 3EDDA 3PZTA 1VPYA 1CB7B 1A4LA 5GJMA 5EB8A 3QPEA 4Q4MA 3W7RA 5K4XA 4UMBA 2ADAA 3WG6A 1DOSA 4Y9OA 5ABEA 3U2ZA 4JQ1A 4IM4A 4TTGA 4ZO8A 3BJFA 3T55A 1DJWA 2GYIA 5CC3A 5I3FA 4WGHA 3WF3A 3GSMA 3WQDA 1EEXA 3KOZA 4AC7C 4KPLA 3EWCA 1H5VA 1I2RA 1K6WA 3ABXA 1E73M 2ZTKA 4F8XA 1H11A 2GL5A 3C61A 1AVAA 3N2XA 1J93A 1Y5WA 2F2HA 1OY0A 2DUZA 4OJYA 1F07A 1UR4A 5C54A 3P8IA 1OJXA 1YTDA 2GVEA 4GYPA 2QUMA 5AC8A 1NVMA 4RXGA 2E7FA 5D8ZA 3EGJA 3DYOA 1P0KA 4KQNA 1X39A 2DH2A 3VMNA 4UBPC 3WLOA 1FCQA 4W8BA 3WK1A 1XICA 1M7OA 1VFOA 3UWUA 4Q32A 1ADOA 1GOWA 1M03A 3NA8A 3QZEA 2IKJA 3OO2A 2X7WA 5CBJA 1CGXA 1S5NA 1A5UA 4QLKA 3QTGA 1E4IA 1JXJA 1WKDA 1X1NA 2I7GA 5AHEA 3VIOA 1I0BA 2R9RA 5C5YA 5EU9A 4WVXA 4PMYA 3N6QA 3RK8A 4EK7A 1KWGA 1OZMA 3ZWSA 2EPMX 2NX1A 4RV3A 1K8ZA 2WZEA 4WSJA 4MMWA 2A21A 1SMAA 4XBSA 1G4SA 5A69A 2KZHA 3APTA 4AZHA 3MA8A 3WLMA 4JHOA 5GNYA 1M7JA 4KERA 2ASHA 3AAMA 1MSSA 5DY3A 3N25A 5DQPA 3FOKA 1TR1A 1Q2RA 1JXKA