2VFFA

Crystal structure of the f96h mutant of plasmodium falciparum triosephosphate isomerase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
247
structure length
247
Chain Sequence
ARKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHHERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRIOSEPHOSPHATE ISOMERASE
publication title Biochemical and Structural Characterization of Residue 96 Mutants of Plasmodium Falciparum Triosephosphate Isomerase: Active-Site Loop Conformation, Hydration and Identification of a Dimer-Interface Ligand-Binding Site.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 98
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2007-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2vffA00
4IGHA 4TU1A 3T4CA 3TSMA 3C4UA 1OFBA 3W1PA 3S9YA 2X30A 3GYEA 4OU1A 1I2PA 5T26A 1FXQA 4LRTA 3W1AA 2YZRA 2C14A 3NO5A 1M6JA 4O8RA 4UUIA 3DI1A 5BMWA 3BLIA 5AYXA 5HWNA 2ZTJA 4S2CA 3HGRA 3PAJA 2QCEA 4XZ9A 3SR7A 2RDWA 1WX0A 1Z48A 5FF0A 2V82A 4K39A 2FB3A 3CWNA 2Y62A 3I68A 3LCLA 3BVJA 3W76A 4O10A 1K3UA 4AVFA 4OQVA 2V2CA 1YTDA 2AGKA 2WSRA 3E0IA 4MLRA 1W3TA 2X1TA 3W23A 1OFAA 2ALDA 1ZCOA 1YADA 4A22A 1I2QA 1H63A 3DGRA 3W7GA 1M7OA 4IPIA 2VEIA 3TC7A 4PL2A 2JKPA 3LM7A 1VRDA 4N6FA 4LC6A 2ATMA 1LTDA 4MYXA 1EUNA 4NJHA 1X7FA 2Y88A 4DF2A 3HPZA 4FO4A 3TQVA 3W1MA 4XTIA 5AHNA 3Q2DA 3O06A 2Z6IA 1WOBA 4N9EA 3W7EA 4O54A 4X3ZA 3E96A 3BK0A 4NU7A 4NX5A 2BX7A 2DP3A 3GVGA 2J6XA 4UMCA 1WDWA 1YDNA 1DV7A 3AO0A 2WNNA 4JYDA 1DQWA 3O6CA 1OYCA 4JX4A 1TCDA 3TQ0A 3OVQA 4UNKA 1F2JA 3WK3A 1YDOA 4PL1A 4FIQA 2V5BA 4DBDA 3UQNA 2YPIA 4JN6A 4Z1AA 4MYAA 1FWRA 3MI2A 4O52A 2Q3OA 2R94A 3L5LA 1OYBA 1Q6RA 3QW3A 2E77A 1K7FA 4W9TA 4GJ1A 1OK6A 5F4XA 4DXVA 5J5DA 4AF0A 3DFPA 3TW7A 2VEMA 1DBTA 1GG1A 3OA3A 4IWWA 3UWYA 3V1PA 3PBYA 4UMBA 1FWTA 1GWJA 3QMSA 4QSHA 2JBMA 5BOOA 3W88A 4HPXA 4O15A 4NQ1A 4PODA 2V0TA 2QCGA 3FEMA 3QSTA 3EXRA 5K9CA 3OBKA 5LNVA 4ORMA 5K4XA 1QPRA 3WJZA 1OFEA 2A6LA 3PSWA 4MZ8A 4BWLC 1TO3A 4WD0A 4WZHA 4Z1BA 5CSRA 3L5AA 3LCFA 5I3JA 3W1XA 4LUJA 2VOMA 2Y85A 1VJIA 4LS2A 2VEKA 4JEQA 3F4WA 3BV4A 3PBUA 1B9BA 2C6QA 3ZS4A 4JY8A 2YYUA 2ZZ5A 4LOCA 4XBSA 4AWUA 3CB8A 1TQJA 4KKXA 3UPWA 2OCZA 5K9XA 3W7KA 4OWGA 5I3GA 4LU0A 1KLZA 3LI0A 4HNNA 4JIPA 1OX4A 3NQAA 3STCA 4JNMA 2HTMA 5FF7A 2GPTA 3R12A 2NX1A 4L4MA 4POCA 1F6PA 3GKAA 4JX5A 4AH7A 2QCMA 1SO4A 4AF0B 4BWLA 5F1UA 3NPWA 4R53A 3A21A 3IV3A 1X6UA 4K7VA 4BFAA 3LXBA 4HSOA 1O95A 3G1AA 2A0NA 3TUUA 3EWUA 1QAPA 3LXCA 2E1DA 1AG1O 2VELA 4UFLA 3A23A 3QMTA 4UFMA 3G1DA 1XKYA 3U2OA 2DZSA 2QUTA 3R89A 5DCDA 1W5QA 3NZRA 3WJYA 1N7KA 2J88A 2WOQA 3KOFA 4RJEA 1QMLA 4K37A 2X1UA 4LVFA 1XI3A 1O5XA 3LRLA 4M19A 3UXDA 3S5YA 3NEVA 5AC6A 3LRKA 1LBFA 3LLDA 3BW3A 4AHPA 3BW4A 5CPOA 3ABOA 1PL9A 1VQTA 2WQPA 3GR7A 1EB3A 4DF1A 1TSIA 3NQFA 3CT7A 5A8GA 1XC4A 5L9FA 3UZ5A 1FY6A 2E5DA 1OJXA 1OX4B 1VLWA 4I7UA 3M7WA 1X8FA 3MHUA 4H6KA 1LOSA 3IGSA 3NQ6A 3USBA 4HNVA 1B57A 4FHAA 3VI2A 4EWND 5D09A 1L2UA 3L0GA 1OX6A 4CNNA 1JRBA 3A9IA 3P84A 4LTSA 4TMBA 5EA9A 2JK2A 1G7VA 3K30A 5LKYA 3NA8A 2B7QA 4JR5A 2DZXA 1G4SA 1SQ7A 2DZTA 3VKJA 1F76A 4MVAA 5KSWA 3PVFA 4L4LA 1A53A 3G1SA 1FWSA 3HG2A 2ZA3A 1S5WA 3O05A 3TNOA 1KM6A 3EX3A 2D73A 1T96A 2OMAA 1SW0A 3S1XA 4UTIA 3HPXA 3A5VA 3IIZA 3W2UA 1SFJA 3LV5A 5E0KA 1DVJA 3TMLA 1H61A 2KZHA 1AK5A 2V2DA 1THFD 4UC5A 1GG0A 3ABSA 3PB0A 4M7SA 3S1VA 3P82A 1YXDA 4IMGA 2NXHA 3TJLA 1RR2A 4WY0A 1GEQA 4UR8A 4GFSA 2YW4A 5KINA 3SSJA 2HS6A 1NAL1 2E5CA 2H8ZA 2Y6ZA 5D05A 5FESA 1KFBA 5HQEA 3MBDA 3W7CA 4C1KA 1I2OA 3NQEA 5AYZA 1HO1A 2W79A 1W54A 3FJLA 4GXMA 3PF3A 2QAFA 4CNPA 4X2RA 4CQAA 1TPUA 2NX9A 2ISWA 1FQ0A 2YFOA 1YPFA 4AHQA 5GVJA 2J9YA 4IMFA 1G69A 2QJIA 2P0OA 4IQLA 4RCXA 4ADTA 3N9RA 1UUOA 3TDFA 2G5WA 1DHPA 3SJ3A 1PCWA 1OVDA 3M43A 5E93A 1JCXA 1SW7A 4EIVA 1TPB1 3LHZA 3C0JA 4JTEA 1WAUA 2Y70A 5LNUA 1K7EA 3SFKA 5HINA 5I3KA 5DY2A 2JGQA 3VNDA 1F05A 3NL2A 2OX1A 2ZZ6A 2ZDRA 4S1FA 3W7HA 3NQDA 4O1AA 5LHEA 1YTKA 3FYPA 2NLIA 4WX2A 5DBTA 3LTSA 5HR6A 4YCPA 4C1LA 1RZMA 3SGZA 2PURA 2B4GA 3NQ2A 1KBJA 4QM1A 1FCQA 2DJXA 2ZZ3A 4NNAA 5C5YA 5TBOA 3EEGA 4FB7A 3QFEA 3T44A 4LVBA 2WSYA 4OT7A 1Q45A 2NXIA 3ATYA 4CCCA 3IVTA 1VPXA 3NZ1A 4UFHA 2VFFA 1H7RA 3PUDA 3MP4A 4JTFA 2EKCA 1LOLA 4N4QA 3DH7A 4DQWA 2C13A 2NZLA 1JCNA 1ZAIA 4KFNA 3P67A 5CSSA 3B8DA 3DENA 3I7SA 1KM2A 1F7BA 2TRSA 3EKZA 3LX9A 5D2TA 3STEA 3TROA 4RX0A 1J5TA 3MYOA 1AW2A 4FX7A 1OF8A 1QFEA 2WJZA 4DO6A 3NM1A 4Q4KA 1EA0A 2Q8ZA 1XDLA 4G1KA 1NF7A 2GVJA 2I1OA 4PA8A 3W7RA 2CLMA 4ZQPA 4KFOA 4IMEA 3THAA 2P1FA 1YXCA 2E6AA 1MEHA 3NQGA 1FDYA 5KTLA 1LOQA 3GNNA 5D2YA 2W6RA 2VFHA 2YCEA 1LRNA 1ADOA 2ZCGA 3L66A 2QKFA 2JKEA 4RLIA 3HPSA 3TFXA 4LVGA 3BLEA 4O18A 3KXQA 4XTDA 3UWUA 3G3MA 2C1HA 4UTMA 1ZY9A 2H3DA 4MY9A 1MZHA 4ONVA 3HIJA 1LROA 3LCIA 4IJBA 1SSDA 4LS0A 5FF3A 1IF2A 2ISVA 8TIMA 3UY7A 1KFCA 2DJLA 2FFCA 5DCEA 1MXSA 3DI0A 1G4EA 4CCDA 5BRBA 3NL5A 3G1XA 3LGEA 3DFQA 3HOJA 3LCGA 3P8JA 2X16A 5D38A 4XQ6A 3T7VA 1W37A 3W7LA 3CU2A 3W72A 3B05A 4GUIA 3BG3A 5K3VA 3QH2A 1KFKA 1A5SA 3O8AA 4ICNA 3W83A 4ZZ9A 3O16A 3I7QA 1ZHAA 2V30A 1TTIA 3DFTA 5AC7A 3TE9A 2IQTA 1GTEA 3EX4A 2VFEA 3NOEA 2V81A 3O07A 1WOAA 1F6KA 4UNLA 3BW2A 3C2FA 4UTTC 1I4NA 3STGA 3WK1A 3CIXA 3PG9A 1MSSA 1DJNA 1OYAA 4UTKA 3UWVA 2NV1A 3S1UA 5AC8A 4XKYA 4MZYA 1LCOA 2ZYFA 3HO8A 5CGQA 1GYLA 3W6YA 2V2HA 1MO0A 1LP6A 2G97A 1HO4A 2F7FA 3HMJG 3DKJA 3NNTA 4Y96A 1JCJA 3C52A 2RDTA 3DXIA 3OEXA 3G22A 1EEPA 4ZQOA 1OFRA 3NQMA 2QCLA 1I2RA 1H7XA 4BK9A 2C16A 1P0NA 1KTBA 1IXNA 1JQXA 1TV7A 4UTTA 3G8EA 2CLHA 5BMXA 2GJNA 2C0AA 1JUKA 1K03A 3FKRA 3STFA 2RH9A 2CLKA 1DKWA 1KM1A 4FX8A 3W7NA 4DELA 2EHHA 4ZQNA 3NQVA 3KVJA 4Z0SA 2ZA1A 4ADSA 4HNUA 5F2GA 3EX6A 1L6SA 3KAOA 3CQ0A 3GDLA 4Z0JA 2QCCA 4BI6A 4JY9A 4Z08A 1SSGA 5D37A 3GNDA 1PV8A 1LRQA 3W73A 3C8FA 3QMRA 4JTKA 3FKKA 2EGZA 2YW3A 4I9AA 2TYSA 5D2VA 4UTUA 2CU0A 3CM4A 4WOZA 3FLUA 1JJKA 1LYXA 4HNTA 4J9JA 4H4IA 1KBIA 4KFPA 4FF7A 2J24A 4K6AA 1XFBA 1FUYA 2PCQA 4AEOA 1ML1A 1EP2A 3BGJA 1C29A 3DKLA 4IOTA 4Y9AA 2A6NA 4QJ1A 1TQXA 3TA6A 4NJJA 3W07A 3GR8A 3G1HA 1J2WA 1XBXA 3EWWA 4UMAA 1Q6QA 3W71A 3HQ1A 1GVQA 3M5XA 5I3HA 3UPBA 3W86A 5FEZA 2ZRWA 4U4MA 1Q6LA 4MJMA 1FX6A 3ANYA 3LXAA 2J27A 5G5IA 4TIMA 4UFIA 3S1WA 3VE9A 2BXVA 3LB0A 1IXOA 3OIXA 3NL6A 4N9DA 3TV8A 3MUXA 3W7PA 3NYZA 2OJPA 5HWMA 3O15A 1G67A 1EP1A 3LDVA 2X1SA 5F4WA 5G2IA 1H7WA 4UIOA 2E6DA 4B5NA 1TPVA 3AJXA 3B04A 3N9SA 1EWDA 3SECA 3TXZA 2O7SA 4JTHA 3YPIA 1I2NA 2R91A 3W1UA 1LZOA 2QCDA 5BW6A 1AL7A 2DZVA 4QISA 3C61A 1WV2A 2B7OA 3EWYA 1NF0A 4NUWA 3FYOA 3NAVA 1CW2A 4DPPA 2PC4A 4O16A 3M47A 4M5PA 7TIMA 2GQ9A 1H7OA 2H8XA 3GX9A 1B4KA 3P5ZA 4JXCA 2QF7A 1XUUA 1Q3NA 3B0UX 3MHFA 4E0CA 3W2JA 5KZMA 4WXYA 5A5WA 1TTQA 2NWRA 4AHOA 4CQ9A 4FNRA 2FPTA 1VS1A 3W2NA 1RQEA 3W2KA 5AN7A 4E2DA 3H53A 1ZFJA 4JDBA 3R5EA 1IIHA 4M7TA 2B7PA 2A1YA 3E49A 2QUVA 2NUXA 3LERA 4I7WA 1KFJA 4PTNA 2E5BA 4AXKA 4O0ZA 3MYPA 2F84A 3NPUA 4DO5A 5F4SA 4WUIA 5BNKA 1H51A 3W7OA 4JTSA 1TPDA 4JIQA 1EWEA 3CTLA 2ZFAA 3GDTA 3W1RA 3S6DA 3W7IA 3WFAA 4JTLA 1OHLA 1C8VA 5CPMA 5CG7A 4M6VA 1KFLA 2YGYA 2ABAA 1PCKA 1VYPX 3GXTA 1QPQA 3NQ8A 4O4WA 3EXSA 1R2SA 1B4EA 1L9WA 2DU2A 2B7NA 4EF9A 3S5NA 4U28A 1H7NA 4O1DA 2JKAA 4N02A 4OV9A 4O50A 5HJLA 3LBCA 3GDRA 3O6YX 4O4VA 3O63A 3RFAA 1AMKA 1LDCA 4LWWA 2GVLA 3EWBX 3EXTA 3D0CA 1WBHA 1SZEA 2O7QA 4BR1A 1S3HA 3E12A 3ZFHA 2ATSA 1G6CA 5TQLA 3W87A 1SZNA 4JICA 3M6YA 4Z1CA 3FJ6A 1ICQA 5H91A 3T78A 1ICSA 2TPSA 3GKFA 1QR7A 4WXZA 3RLVA 5C6MA 1JQVA 2CZFA 3HBLA 2EPHA 5LNWA 3M9YA 1SUXA 4PH6A 4FXSA 2QUUA 4IXXA 3TR2A 4S2BA 3LCHA 5LSMA 4ALDA 3INPA 1BEUA 2ZZ7A 4NT0A 2C3ZA 1JR1A 5C2XA 6TIMA 3HGOA 3KX6A 2CLLA 4HPJA 5EY5A 1SZGA 4UTWC 3IGXA 3TSBA 2VXNA 2DORA 1DL3A 2VFGA 1PE1A 1P4CA 3DAQA 4IUOA 3HJZA 5D2WA 1OG0A 2RFGA 3CEPA 4PCFA 5EPDA 2J9XA 3TKFA 3KVMA 2XN2A 1WYIA 4RK8A 3S42A 5I3FA 3F03K 3W1LA 2P10A 2G95A 3RF9A 4EVZA 5KMYA 2Z1BA 4YWIA 4O1BA 1H1YA 3MMTA 4FNTA 2C15A 1Q6OA 3TH6A 1TV8A 3U8GA 1GVOA 4HN4A 1AL8A 1QPNA 4ORIA 3KFTA 4ZVJA 2A7PA 4OGZA 1Z44A 4UTWA 1QOQA 5IBXC 1MEWA 1VCFA 4RV8A 3RK8A 4MKNA 2VFDA 5LNRA 1M7PA 3GXNA 5DN1A 3L0NA 4QIUA 1KLYA 1Z42A 4MUZA 2CZEA 2A7RA 1TPC1 3F1QA 3M16A 4CQ8A 4ZQMA 1SFLA 3NGJA 1A50A 2C19A 3H55A 1VHCA 5K7JA 1YXYA 2A5HA 1K02A 3PULA 3LCXA 3KHJA 3CLMA 4NXSA 4GBUA 1I8JA 2A21A 2FQIA 5G4EA 5EL1A 1H50A 1DQXA 2H3BA 4O17A 1IXPA 4A2RA 3PWAA 1UB3A 3FA5A 3A22A 3C2RA 5F2IA 3O1NA 2H90A 3T55A 3LRMA 2CLFA 2WNQA 5IBXA 2BWGA 1QNVA 3C6CA 4ML9A 3TX9A 2V9DA 4RZ5A 2YSWA 4X22A 2VEPA 3CC1A 4OE7A 3SY5A 5LGXA 3PY2A 3QW4B 4CLMA 1VYSX 2Y7DA 2VKZG 5SWUA 4WY0B 5AB3A 4DEFA 2OZ0A 3MJYA 4AB4A 1KTNA 4E38A 1TPH1 3GK0A 3C56A 1GVFA 4BI5A 3SIZA 1VCGA 3KVLA 2DZPA 3EX2A 2ISSA 2FIQA 2FTPA 3IVSA 5C54A 1YDVA 3ZR4A 5AOUA 1H62A 4IPJA 2A85A 3GB6A 3QQ0A 3IRDA 5FI8A 2QCHA 2ZRVA 4TX9A 4DPQA 4NVTA 3BARA 3LCWA 2QDGA 3HGJA 3TCEA 3KRUA 4NX0A 2Y63A 4GE8A 1KV8A 4IMDA 4H3DA 3QPYA 4QQ3A 5F2LA 5EMUA 3W70A 1GVSA 2GVGA 1XBVA 1QCWA 2GUUA 1TTJA 1N55A 5LZLA 2FB2A 3NR0A 4O13A 5HMSA 1W56A 3L67A 1TRDA 4IX2A 5FF2A 3ELFA 3PM6A 3RMJA 1JCMP 4O0KA 2AAMA 2QEZA 3M5ZA 2FLIA 1W5NA 1R47A 4LW7A 1B3OA 1G7UA 2QJGA 1W3IA 4O53A 4HSNA 1DOSA 3ABQA 3W22A 3EWZA 4RZ4A 5DXXA 3TAKA 3A5FA 3JS3A 4FNQA 4Z1DA 4Y8FA 2Y7FA 3RU6A 3MO7A 3GAKA 1SO6A 1FBAA 3MP5A 3QSRA 5D03A 4DO4A 5CZJA 4FEZA 4X9SA 1TJRA 4K36A 1F74A 1R30A 2Z6JA 1UUMA 1ME9A 3QQ1A 2I14A 2BZNA 5HUOA 5D02A 2Y89A 1K8ZA 3M5YA 1TPFA 3W1TA 4FXRA 1ZALA 1DORA 4LT9A 1XBYA 2ZZ2A 4YLWA 2VC6A 4QITA 3W7MA 2YR1A 3DBPA 2J9ZA 3HF3A 1PHWA 3BGGA 1F73A 3G1FA 3GDKA 5HNRA 3RNDA 1LBMA 4JTUA 4CCEA 5FEPA 1RV8A 3TK7A 2ZRXA 1FCBA 1VCVA 5IM51 5CZSA 1WXJA 3TU9A 3P80A 2UV8G 1HL2A 4UFKA 4FNUA 1O5KA 3MI6A 3A24A 4JTTA 1RD5A 1ALDA 3G0UA 4JDYA 4MFEA 3QZEA 1LM1A 1EIXA 2CW6A 3QM3A 1GTHA 1QOPA 1MEIA 3UYCA 1VYRA 3W1NA 1KTCA 4HIBA 3WJWA 3M1ZA 2CZDA 1CX9A 1FDJA 4MPQA 4NNCA 1G4TA 4P61A 3IIVA 2B0MA 1R2RA 2Y7GA 2VFIA 3NQ7A 3LTYA 1E51A 5EYWA 4JYEA 5K9DA 3LHTA 1M5WA 1UBSA 1TPEA 4BF9A 5F2MA 3KVKA 1VC4A 2FJKA 2HS8A 4OV4A 4BI7A 2XFWA 3M0ZA 5G4WA 1QPOA 5AHIA 1ICPA 2QDHA 3PS7A 2Z2UA 4RXGA 3Q58A 1A5CA 1H5YA 1PIIA 5LNSA 1XUZA 3W7DA 2ZBTA 5G2HA 1O4UA 3C2OA 1D9EA 3P7YA 1W8SA 3FOKA 5K4ZA 1GPWA 2ZQ0A 2GQ8A 3UWZA 5ABTA 3NVTA 2WO5A 3E9AA 2ZRZA 4LV4A 3LLFA 2A4AA 4RZ6A 4NJKA 3PC0A 1LBLA 1XXXA 1XM3A 3B03A 3W2LA 1UASA 1FWWA 1YPIA 1Y0EA 3ZWSA 1K7XA 3NPVA 3OHIA 2FDSA 1CI1A 3QC3A 1OFPA 1QO5A 4N9BA 1NSJA 1W5OA 1PHQA 1OFDA 3N73A 1P5BA 2HSAA 1NEYA 1VHNA 2PRLA 5H2ZA 2Q3RA 5DY3A 4YL2A 4XKYB 2BSLA 2V5LA 4UCGA 3HG5A 5CKSA 3MW7A 2RHGA 1IIGA 4WOQA 5CZTA 3GDMA 3OVRA 3NPXA 3W9ZA 3C3NA 2DZUA 3FIGA 1IXQA 3V75A 3EB2A 4FNSA 3TFCA 4MZ1A 2E68A 2Q8LA 4Q32A 4AMAA 1LRTA 3B4UA 2WKJA 4HKPA 4NNBA 2HMCA 3OG3A 1GJPA 1W3NA 3HGSA 3BPWA 1RVGA 4RKAA 3OVPA 3TMQA 2GJLA 1XDMA 1ZENA 1FXPA 3W3OA 4UTJA 4JYFA 1KA9F 3TIMA 3TAOA 3R8RA 3CPRA 4K38A 4JTIA 3W84A 3WJSA 2RDUA 1QWGA 4R34A 1YLVA 1RQBA 3VE7A 2E09A 2C18A 4OHQA 4ZQRA 2CLOA 4GUFA 3DHFA 5D32A 2OT0A 2OT1A 1SU5A 5AYYA 3L68A 3C2VA 4UFJA 2CWNA 1BWLA 1JCYA 4O12A 1W31A 2AQWA 1NFBA 1HTIA 3B0PA 1U5JA 4ZQCA 3RLUA 2NV2A 1FCUA 3P5YA 4O1CA 1G4PA 3C2EA 1V7YA 4DF0A 3MBFA 4LUIA 1OABA 1O60A 2ZRYA 1NVMA 3W2MA 3SGUA 5EBUA 1XCFA 3T40A 2ZRUA 4UXDA 5D30A 1DJQA 2LLEA 5AHLA 3WK2A 3N14A 3PR2A 3G0SA 3G1YA 3TQKA 1SO5A 3KRSA 5TIMA 5DXYA 1P0KA 1BKSA 1VGAA 1HG3A 5G1YA 4Y6GA 1GQNA 3TSDA 1TJPA 1JCLA 1KW1A 5E1QA 4YCOA 3QJAA 5MHBA 5HR7A 3L21A 1GT8A 3IVUA 1YYAA 4JTGA 1ZAJA 4EF8A 4M6QA 4MY1A 2NXGA 3PUOA 3UD6A 2GOUA 2R8WA 6ALDA 3NL3A 4UR7A 3P62A 2ZZ1A 1KM5A 3UXAA 1GOXA 2ZZ4A 3N2XA 4YMZA 1JUEA 3I7RA 3W7QA 3CHVA 4MJZA 2Z0IA 4K7YA 5F1VA 2YX0A 3FFSA 2QCDB 4UTHA 2FPYA 4JS3A 3G24A 4MY8A 3W7JA 3BLFA 3G3DA 2XN1A 4LVDA 2X1RA 5KZEA 2RKXA 4XBKA 2TSYA 3IGUA 3R2GA 3JR2A 3UWWA 4A2SA 3PUEA 4HT3A 2A2IA 1PS9A 2YYTA 1F5ZA 3IEBA 4NJIA 4A29A 1QDSA 4ZMGA 1GVRA 2QAPA 3N34A 1GYNA 1W1ZA 1VH7A 3PG8A 3TC6A 3M41A 2Y7EA 3BG9A 4CNOA 4XWUA 1UJPA 1XL9A 3G18A 2YFNA 1LORA 2NWSA 1K8XA 1W0MA 2Y61A 1SO3A 1LLZA 3H54A 3N19B 4A21A 1D3HA 4TR9A 4PEKA 1R46A 1ZNNA 4FNPA 4XUGA 3EWXA 3N3MA 2EAWA 1RPXA 5LHFA 4KWVA 3WK0A 2QCNA 4O14A 2E6FA 4R33A 3LHUA 3CWOX 4QNWA 1OX5A 5G2WA 4WY0F 2G96A 5CPNA 3G1VA 1TMHA 1W5MA 4M6PA 4Y90A 1JUBA 1L6YA 1KM0A 1QO2A 3QF0A 3QPZA 1TRIA 5D04C 1EX5A 2V8ZA 1IGSA 1YTEA 1EPXA 3TXVA 3SZ8A 2A7NA 5D2XA 4FX6M 1X1OA 4A3UA 4K8EA 5FEWA 2R14A 1OFOA 4OBTA 3NQCA 1TREA 1FWNA 3CIWA 3DU0A 2WNZA 1ME8A 1KFEA 2VENA 4IXHA 4N4PA 5CPLA 3TW6A 1HUVA 3F4NA 4WJEA 1EP3A 1H7PA 1ONRA 2WSQA 3BG5A 3UWQA 3W75A 2H6RA 5AHFA 2WPBA 3W1QA 4LY8A 3P74A 5DCBA 1S5VA 3HG3A 1ME7A 2CZ5A 3G8RA 4O28A 1SZFA 2NUYA 2CFFA 4O57A 3I65A 2YDAA 5AHMA 3ABRA 4JD4A 4NXKA 1UCWA 4YXGA 2QJHA 2QCFA 2JGYA 1ZAHA 3LHVA 1H1ZA 2BTMA 3DFOA 3UZJA 1JVNA 3GIYA 1ZJIA 4JX6A 4R7JA 5U4NA 3HG4A 3LOTA 1TV5A 4GUGA 5FEXA 5C55A 5KITA 4GUJA 4O19A 4PFMA 3EX1A 3S5OA 2ZA2A 3MP3A 1FDZA 3O6DA 5HWJA 1PVNA 5EKYA 4GWEA 3L5MA 3MI3A 3MHGA 3LHYA 4LRSA 5L6UA 1KV5A 3GAYA 3IIXA 3SW6A 3UY8A 2CLIA 4LS1A 1V5XA 2FPVA 3JRKA 2PE4A 1TTPA 3DFSA 2NUWA 1VZWA 3FS2A 4AWSA 3LV6A 5DBUA 5AHEA 3TJXA 1J4EA 1OFQA 3NG3A 1LLWA 3G0XA 3NXFA 5CZ0A 1A5BA 3L65A 2NX3A 4TMCA 3PBVA 4LV9A 3PSVA 3N2MA 3M5VA 3THQA 4DBEA 1XBZA 1T99A 3SI9A 3PBWA 2DZWA 1W5PA 4NZJA 5G1TA 3QEZA 4GRSA 4E2BA 3HB9A 3DHDA 3MWAA 1L6WA 1I45A 1JRCA 1X1ZA 4MOZA 3DFNA 5J5RA 1U83A 4JTJA 1O94A 1S5TA 4MFDA 2XN0A 4O11A 3M44A 4I7VA 3GXPA 4Q33A 2ZTKA 1TYGA 4D2JA 4RXFA 4GC4A 1AW5A 5LGZA 4LVAA 4MIMA 3Q37A 3W74A 1R2TA 3B06A 4EOUA 4RR4A 1T0OA 4K8HA 3QYQA 3DZ1A 1TPWA 2X2GA 3LHWA 2I9EA 3ATZA 4N6EA 1C9DA 1SR9A 3KRZA 5DLCA 1T8XA 4P2VA 2YXGA 4JGDA 1N8FA 2PRHA 1SW3A 4IMCA 4GNJA 3LTPA 2QR6A 4HHPA 1SPQA 3Q94A 3GLCA 3CEUA 1Z41A 3PB2A 3WJXA 1BWKA 1D3GA 2TMDA 3P61A 3S8HA 1A5AA 4QAIA 3BO9A 1WA3A 4FIRA 3L9CA 4IX0A 3L0KA 4N9CA 3W85A 1TB3A 4LC8A 1GZGA 3P8IA 1KM3A 2BLEA 4NZFA 3IIOA 5HUPA 2WV8A 4LNYA 2W0UA 5I3IA 4WQ6A 3NM3A 1VR6A 1WQ5A 1KM4A 4QNEA 5K2ZA 3B0VC 3LBMA 1TIMA 1EUAA 3R13A 4AAJA 1BTMA 3IIPA 4ZL1A 3NDOA 5U7SA 5KZDA 1P1XA 3VCRA 2CLEA 4NJGA 3QRHA 5DELA 1HFBA 3P81A 1FCVA 4UTLA 4ADUA 2E6YA 3S5ZA 4GUHA 2ABBA 1WBJA 1VLIA 3ZWTA 5FF4A 1K8YA 1OK4A 5HULA 3U6WA 1H60A 3I6RA 3P60A 3VFLA 4MLJA 4AWTA 3E02A 2PRMA 3UNDA 3S0CA 2GQAA 4N2YA 5D33A 5AFDA 1RQHA 1OF6A 4KWWA 1AW1A 1JULA 3L2IA 4TO8A 4PC8A 3GZ3A 3LI1A 3EKLA 2EF9A
chains in the Genus database with same CATH superfamily
4GZEA 4ZXLA 4CNUA 2GGHA 3C4UA 4HU4A 3GYEA 4BCEA 1B3WA 4XZWA 1C90A 4PE8A 5AC4A 3NO5A 4DZAA 5BMWA 2BDQA 3BLIA 3GU2A 3C5QA 4S2CA 3V1HA 4RW3A 3HGRA 4CEXC 2RDWA 4JKMA 2PDPA 5M1TA 1HGYA 1MNSA 4DXKA 1W17A 1VFSA 2W91A 5FJRA 4OQVA 3R8GA 1HN1A 2PCEA 1WDSA 4MLRA 1W3TA 3OO2A 3TZFA 2ALDA 4A22A 2WWDA 4M8UA 3S2JA 2VEIA 1PZ0A 1QTWA 1VBHA 2JKPA 1PPIA 1JNDA 1BSIA 4GXPA 1JG9A 2JEQA 4N6FA 3KL0A 1CZ1A 3SCPA 4OOUA 5KEZA 4CD6A 3PWIA 5AHNA 2Z6IA 1KO0A 4QJ4B 2OYKA 3E96A 4NU7A 1A3WA 4Y2WA 2OLAA 4DAFA 2J6XA 4LCSA 2CYGA 1E73M 4K68A 3T09A 2PC8A 1UMLA 2REQB 4C7DA 2OSWA 4JYDA 1DQWA 1B3XA 1TCDA 4MSSA 5CC7A 1UIPA 4DBDA 1U2YA 3AIBA 5AYBA 2YIHA 2DPEA 1FWRA 4KQNA 2VEGA 1FWDC 1FWHC 3V5OA 4ZA0A 3H2EA 4YVXA 3KBMA 2R94A 3I4EA 1GOQA 1KRMA 4W9TA 2VX5A 5E9XA 5F4XA 3TC3A 4DXVA 3TW7A 4AD1A 5C9ZA 2AKZA 2O0TA 3UWYA 4HA0A 1OBAA 3PBYA 1FWTA 2JBMA 1UR2A 1E4LA 1BYCA 1R3YA 4GVHA 4HPXA 3ABZA 4V15A 4IQDA 3BLKA 1QWKA 1NFGA 1NDWA 3FEMA 1JI2A 1E43A 5REQA 2CKRA 5C9XA 4MZ8A 4WD0A 4JAWA 4Z1BA 2OEKA 4GI6A 3QY8A 3VKCA 2VOMA 3M6DA 2OLHA 2VEKA 3BV4A 1W9UA 1KGWA 3GSMA 1UZ4A 4ZTYA 5HAOA 2ACRA 4LU0A 3LI0A 1N82A 2RJHA 4DUXA 3WQWA 3OTRA 4JNMA 1S2TA 4GY0A 4L4MA 2DSVA 2EQDA 4M56A 1T6MA 4AF0B 1JIBA 4RDVA 3A21A 3IV3A 3HMCA 4BFAA 3A3WA 2PWEA 3TUUA 2VELA 3M0HA 3G1DA 1XKYA 4UQAA 3SQSA 1JFHA 4XIAA 1C8QA 3A3XA 4G5DA 3WJYA 4IIHA 1EJSC 2J88A 3GVQA 3KOFA 4O0QA 2ASHA 4GIAA 3N04A 4LVFA 1XI3A 5H1WA 3PTDA 1ZLPA 4LNCA 3S5YA 3KBJA 1SJBA 3LRKA 4EK7A 3BW3A 3NSXA 5D9NA 3H2CA 4TUFA 1E6PA 4AHPA 4DJFD 2OGYA 2VD8A 1F3WA 4QX4A 5CPOA 1TWWA 3ABOA 3ABXA 2OLSA 2QW5A 4DF1A 3CT7A 4V2XA 3SY1A 1J0KA 4MB3A 1Z6KA 3PWGA 1FY6A 3IJ6A 1AQMA 3KBWA 1TZ7A 2Y2WA 1Z69A 2JEPA 4DWDA 5D09A 4NZ3A 1L2UA 3ZVHB 4OUEA 3A9IA 3ZIZA 1V0LA 3GW3A 5EA9A 5LXXA 1E0VA 3E2VA 1W3JA 1NQ6A 1XWYA 2PWGA 4E3TA 4RUBA 4WSJA 3QHOA 3LPFA 4FPSA 2VURA 4HOXA 2WXDM 3G1SA 1FWSA 2ZA3A 2XSAA 1E9LA 2WMJA 3PN8A 2J7FA 4Q6XA 3VCCA 2D73A 1T96A 1WXYA 4MWAD 4PTVA 3HPXA 3W2UA 4DUWA 2G8ZA 3TJIA 3AXXA 3TMLA 2HXUA 3VUSA 1XLCA 3HM7A 4NAFB 4EANA 1O5QA 4PUJA 1YXDA 2XINA 5B80A 1GEQA 3UJ2A 1L0PA 2HS6A 2E3ZA 1XLAA 1ZRQA 2Y6ZA 3S4TA 5D05A 1EXPA 3A4AA 1I2OA 3NQEA 5A2BA 2W79A 3FJLA 4GXMA 3E2SA 4X2RA 2NX9A 5LA0A 3QZ6A 1Q66A 2YFOA 4KGLA 4IQLA 4RCXA 2OPJA 3TDFA 1RALA 1DHPA 3WUFA 5E93A 4EIVA 1TPB1 3LHZA 4JTEA 1AD1A 2YA2A 2D2GA 2DT0A 5DY2A 1BF6A 1L2QA 4Q8PA 3QGAC 3ZMRA 2PPGA 1XC6A 3GUGA 5BXRA 3W7HA 1Q7MA 3R79A 1SMAA 2HPIA 4H9ZA 1OCNA 2XIMA 5DBTA 4GI8A 3GU1A 1QATA 3WDIA 4DJEC 5HR6A 3BAXA 1NOWA 4C1LA 3BAWA 3SGZA 2X1IA 3NO1A 4MMWA 1E9IA 2FMOA 1KBJA 4QM1A 4DN1A 4DYKA 5C5YA 3XINA 3EEGA 2AAAA 3QFEA 4LVBA 3IVTA 4H2HA 3R58A 3NZ1A 1DXIA 1FH9A 1OCBA 2EKCA 4D71A 3AS0A 4N4QA 4UTFA 1KBKA 4XSMA 2GSEA 2P5NA 1ZAIA 4KFNA 3CH9A 5CJMA 3DENA 2NQLA 4P7NA 4OJYA 2TRSA 2ZUWA 3M0XA 3S46A 3STEA 4RX0A 1J5TA 4B91A 4DJEA 3K4AA 3H23A 3KLLA 1REQB 1VRXA 1EO5A 5CBJA 3OG2A 1I1XA 3RPDA 2WJZA 4Q4KA 1R7AA 1KCZA 2Q8ZA 1NF7A 2EG7A 4KFOA 2PWHA 1US2A 1E0WA 5CH9A 5KTLA 4JBRA 2VD9A 3VKBA 4QDWA 5A2CA 1LRNA 1ADOA 3CASA 3N2BA 5C9UA 1JPHA 3HPSA 3TFXA 3BLEA 3KXQA 3HQOA 3GNPA 4BJHA 1RCQA 4UTMA 1ZY9A 1HP4A 4ONVA 3HIJA 3BICA 1P7TA 4IJBA 5GNYA 4LS0A 2ISVA 1MXSA 2Y5EA 1UQZA 1U1JA 3G1XA 3LGEA 3DFQA 4RDZA 3EAUA 5D9PA 4YS1A 2NV9A 3BGAA 3W72A 1TUFA 3B05A 5HPOA 1XH1A 3GHTA 1FWIC 5K3VA 3QH2A 3P2VA 1GKQA 3O8AA 1I6NA 5ABGA 2D1ZA 3MTWA 3O16A 3AIVA 1Z89A 4YTSA 5AC7A 2YL5A 4ZFMA 4F2BA 3O07A 1WOAA 2PF0A 4QE1A 2E4TA 3R10A 2ZKMX 1Q6GA 4H6RA 3STGA 3WK1A 1VIZA 3SUTA 2VDHA 3BCFA 4B5SA 3WNLA 4J5NA 1BF2A 1NWRA 2NV1A 1CB2A 4XKYA 1LCOA 4XZMX 1YEYA 4CUCA 1LP6A 2G97A 3HMJG 3DKJA 1GZJA 1UZDA 3DXIA 4C90A 3E1F1 3G22A 1J0YA 2DGAA 2I16A 1JI1A 3UZZA 3P14A 1KGUA 3NQMA 4C6DA 1I2RA 1H7XA 2W3ZA 1S38A 4DUOA 2C16A 2GUYA 1KTBA 3W26A 1C9WA 3VNIA 1TV7A 3LA4A 3G8EA 2BG5A 1XIFA 2FVKA 4EXBA 2RH9A 3TYDA 3LGGA 3WQ8A 4AZIA 2BGNE 4LAZA 3W7NA 4C6LA 3UESA 4ATWA 4DELA 4ZQNA 1H09A 2R82A 3NQVA 3XIMA 3EX6A 1GOOA 1UPPA 3QOKA 2C0HA 1YHTA 4CN6A 1XIJA 1WB0A 4L56A 1HJUA 8A3HA 1PV8A 3K5XA 1LRQA 3S5SA 1J0IA 4UTUA 2CU0A 3CM4A 3OB8A 4JQ4A 1JJKA 3ITCA 2OOGA 1LYXA 3QBUA 4ECLA 4KFPA 2PD9A 4Q7IA 3SCRA 3BLOA 1VIWA 1FUYA 4PMYA 1E9ZB 4AEOA 1T41A 1XCXA 2XIOA 1K6WA 2VQUA 3AHTA 2PA6A 1TQXA 1AQ0A 4HD5A 3W07A 1V79A 3G1HA 4UMAA 3W71A 4S39A 3UPBA 1WAWA 5XIMA 2ZRWA 3TZNA 1YMYA 3V35A 4FF5A 3ANYA 5JH2A 4HJFA 2ADAA 3LPGA 4UFIA 3S1WA 3WEMA 1PBGA 4XSLA 1IR1A 1UYQA 1XHGA 3JUGA 2DT3A 4ZTXA 5J8LA 4N9DA 4B3ZA 3OA5A 2OJPA 1G67A 1EP1A 1RA0A 1TPVA 3AJXA 2VP8A 2OZ3A 3AMKA 4JTHA 4ZCWA 4F66A 1CNVA 1QJWA 2X41A 1E0XA 1AL7A 2DZVA 2D20A 2XHYA 2PEVA 1YQ2A 3PZIA 1T8QA 3ARTA 2VVNA 4FLOA 1NY1A 1BQGA 2H9AA 4O16A 3A3HA 3R7MA 5DRIA 4E4PA 4J3XA 4V1YA 5FJTA 7TIMA 4FLSA 2H8XA 2VC5A 1B4KA 3D47A 3GX9A 3L4XA 4FOJA 4CEUC 3MHFA 3BSHA 2G0WA 3W2JA 4WXYA 5A5WA 3BE7A 5GJMA 3TYBA 2VCAA 3DOPA 4BEQA 4D72A 1ZU8A 1RQEA 3W2KA 4E2DA 3H53A 3CUZA 3R5EA 2B7PA 1XS2A 3E49A 1QNOA 2BFGA 3LERA 4I7WA 1W1IE 5BNKA 2X8RA 4JTSA 1A3XA 1H4PA 3GDTA 2DSUA 2BS9A 3W1RA 4XAGA 3W7IA 4L65A 5CG7A 3GIPA 3GXTA 3NQ8A 3PZNA 4JOMA 4U33A 4CQCA 1L9WA 2DU2A 2B7NA 1BYDA 3AZSA 4OUIA 5BWAA 3TNBA 4N02A 3VC6A 4PUEA 5HJLA 2Q8XA 4Z2IA 3O63A 1R0MA 5A1AA 1LDCA 3MJMA 4GQBA 1SZEA 3RILA 5I6SA 1S3HA 2P3ZA 3E12A 3FV9A 3UG5A 4AEEA 3IJDA 4GQ0A 2ATSA 4C91A 1G6CA 2ZDSA 2QV4A 3VX0A 2POZA 3RX3A 2WVUA 3O3RA 2J79A 3AMLA 1M68A 3TR9A 2BVTA 3KBNA 2TPSA 5JXQA 1S46A 1Q4WA 1SUXA 4BF7A 2QUUA 4IXXA 4LAOA 1ODUA 4DJDC 5LSMA 1EC7A 4C6BA 4NT0A 2C3ZA 4HPJA 3QTPA 5EY5A 1SZGA 4XO7A 2DORA 4DI8A 1DL3A 2VFGA 4C6IA 3DAQA 4IUOA 2RFGA 1BYAA 5A6JA 3KVMA 4RK8A 1WYIA 3S42A 3CV1A 2YB4A 4YTQA 3RYSA 3WUBA 3SUWA 3WD1A 2ACUA 2AQOA 2J7CA 4H7VA 4F79A 3N2TA 3OW1A 4NZ5A 2PDFA 2PWFA 1FA2A 4O1BA 2BVWA 4FNTA 1Z7AA 4DJDA 4HN4A 3E0FA 4ORIA 3QKZA 4CD8A 3TN6A 1QOQA 4RV8A 2BXZA 3EDJA 4MKNA 5LNRA 3GXIA 1KXVA 2A7RA 1AH4A 1SFLA 3NGJA 1A50A 3EA1A 4MNMA 4TTUA 3S6TA 1VHCA 5K7JA 2J8GA 3VK5A 4F3HA 2CESA 2A5HA 1K02A 3ZSTA 2KAUC 3PULA 2DH2A 3LCXA 3O0KA 3EWDA 3VDCA 1H50A 4QJ5B 3DBNA 3BLPX 1UB3A 3FA5A 1RSCA 4L9XA 1LL6A 3A22A 4F0HA 2H90A 4GO8A 2CLFA 2BWGA 2V9DA 4RZ5A 2WMFA 4X9YA 3CC1A 4OE7A 4KIRA 4ATDA 2FYMA 4AVOA 3SY5A 4LYRA 3PY2A 1VEPA 3QW4B 4CLMA 2Y7DA 5SWUA 4DEFA 4AB4A 1TPH1 4PBEA 1VCGA 2ISSA 2OZTA 2QNEA 5C54A 3ZR4A 2BGQA 3GB6A 3QQ0A 2ZRVA 4DPQA 1XH0A 5DRCA 1A5KC 1RH9A 4PMDA 2QDGA 3CAKA 3K4WA 3TCEA 1YRRA 1BVWA 1WKDA 3WEZA 1DWFM 3GHRA 1W9PA 2Y8KA 2XIQA 5EMUA 2C91A 3UFYA 2GUUA 1IT7A 1TTJA 1GONA 3WNPA 3CUJA 4O13A 1JD7A 1KRCC 3WZ0E 1ENUA 2QV5A 5HMSA 5CLWA 3L67A 4B5VA 4B3KA 4XV0A 2D2JA 4V33A 3PM6A 3RMJA 4O0KA 2QEZA 2FLIA 3QGVA 2FTYA 2R1NA 1US0A 1XR2A 5I79A 5DEZA 2WYSA 3RU8X 1GQLA 4HHLA 4Y8FA 3AIEA 3MO7A 3GAKA 5D03A 4DO4A 4CGTA 4Y8EA 3KP0A 4PMJA 3WLRA 1VBJA 4K36A 1F74A 4AQLA 4RE0A 3SFWA 4LALA 2FGZA 3KLKA 2QS8A 3I3BA 5HUOA 4JTCA 1CWYA 4D6FA 1K8ZA 1HQTA 3PTMA 1ZALA 4RNFA 1VJZA 1L6GA 3PJXA 4DI9A 1ITCA 1Y7VA 2VC6A 4QITA 2GVYA 2YR1A 2WZMA 1PHWA 1XYZA 1DJZA 2YCKX 3G1FA 4TXEA 3OLGA 3UCCA 1PX3A 2PDXA 3AS1A 1FCBA 1EJRC 3KZPA 2YA0A 4XK2A 4JTTA 3CHDA 1ALDA 3EMCA 3G0UA 4MFEA 1LM1A 3SB0A 3QM3A 4DZHA 3ZJKA 1QOPA 1VYRA 2XYLA 1KTCA 1UR4A 4UQ9A 3UCQA 1FDJA 2HBVA 4G9PA 3IIVA 4IG2B 2NT0A 1E51A 1DWHM 2OYLA 3VIIA 2V3GA 3QY6A 1HJWA 1EYWA 4PCTA 3EOSA 1RY8A 1TELA 2FJKA 4OV4A 3L4ZA 2REQA 2XFWA 3M0ZA 1ICPA 4LEQA 7TAAA 4RXGA 3WN6A 5I0DA 2Y0FA 1SZRA 1MW3A 4RV3A 1PIIA 4QJ3B 5LNSA 3PNZA 4L1GA 2O55A 2E8ZA 1K1DA 4D6HA 3VGGA 4WGHA 3T0AA 3DHUA 2V5CA 1SJDA 5A8PA 1XLDA 2ZRZA 4LV4A 1V02E 4NJKA 4QTGA 3UXKA 3ZZ1A 1X98A 4PUKA 2F6KA 3ZWSA 5JUVA 4KS0A 1CI1A 1IV8A 3T05A 1NSJA 1PHQA 4XAFA 2VCCA 2PRLA 5H2ZA 3L4TA 4P7RA 2BSLA 1XIIA 3USZA 5CKSA 3ITTA 3GDMA 3OVRA 3C3NA 3VPLA 4NSBA 4UZUA 3H6OA 3QKEA 4MZ1A 2ZUUA 2Q8LA 4AMAA 3H70A 4AY8A 2AL2B 3HGSA 3CZGA 3BPWA 1J12A 1EFZA 3AXKA 1RVGA 3TMQA 3WBXA 3WBWA 4CQDA 4HZ8A 2J7BA 4UTJA 4LGXA 4LBUA 3PNUA 5BYWA 3R8RA 3W84A 1A49A 3D6NA 2VWTA 5CJ5A 2V68A 5PTDA 2GDQA 4Q8OA 3VABA 5A95A 2E09A 2C18A 2VX7A 4I3GA 3DHFA 1U22A 5LIWX 9XIMA 3CUFA 3VOJA 4LF2A 1JCYA 3LG3A 1W31A 3VD9A 4ZXOA 1IEWA 2AQWA 5IHSA 4Q4SA 2ZE0A 2VC7A 1UWTA 3IK2A 3H8AA 1XD1A 1UOKA 1G4PA 3C2EA 1V7YA 3BZJA 1I1WA 3AZRA 3REQB 2JFEX 3VOGA 4IHCA 4C5ZA 3LUTA 4XAZA 2EPNA 1J0JA 2ZRUA 4A3HA 2LLEA 3WK2A 1UWAA 3TQKA 1SO5A 2ZWZA 3S2MA 2GYIA 4QR6A 2E40A 1HG3A 2DUAA 3QV6A 5BRPA 1RK6A 4JFVA 1TJPA 3WQFA 1JCLA 4Q4OA 4AXNA 5MHBA 4UBPC 3MMUA 2ALRA 1YYAA 3RRXA 3DC0A 4M6QA 1FWCC 4MY1A 3UWEA 2NXGA 3GBDA 3UD6A 2GOUA 3SY8A 1P6BA 3N4FA 1XP3A 3VOIA 1OM0A 1QBBA 1NOUA 3ZVHA 3NGFA 4P8VA 1KM5A 4B3LA 1HX0A 2ZZ4A 1JUEA 4MJZA 1XLLA 1SM9A 2J78A 3I6TA 1QI0A 2FPYA 4JS3A 3G24A 3W7JA 3BLFA 1XJBA 3KUMA 3CMJA 2FDMA 3WNOA 1TUXA 2CC0A 4US5D 3JR2A 3II1A 3PUEA 2A2IA 3IEBA 1OG6A 4OOZA 5FIPA 4MNLA 3N34A 1W1ZA 1VH7A 2EO7A 3M41A 3UJEA 1ONWA 1Y8BA 4L7ZA 1N2VA 1Q6DA 2YFNA 1LORA 3OBAA 5IRPA 1EHNA 5EB8A 1JYNA 1GZ1A 2WC4A 3CMGA 2W67A 2DSKA 4NAFA 3BOLA 2DV0A 5A8QA 4W8BA 1ZNNA 3N3MA 2EAWA 3AHXA 2WMHA 1FWJC 5HMDA 1W3KA 2QCNA 2F61A 3WBYA 3LHUA 1J5SA 1TMQA 4XVDA 1KQYA 1OX5A 4WY0F 3LQLA 3PTQA 4E2OA 5CPNA 1TMHA 1X6NA 4HZMA 1RCXB 3QF0A 4GFIA 4KF1A 4I5UA 1EX5A 1IGSA 2R1PA 4PFHA 4K8EA 4R9OA 1NM9A 3OQEA 5HDRA 1OFOA 2XGBA 1KFEA 4H8UA 3K8MA 1V7AA 4IGMA 5A6LA 3S47A 2WSQA 1OIFA 1E0TA 3AWNA 4AD4A 4HOWA 2EG8A 3W75A 4AZBA 2QIIA 2DT1A 1I60A 1J01A 5EBAA 5TF0A 3GNRA 5A6SA 2JGYA 1E3XA 1ZAHA 3LHVA 3DFOA 2PP0A 3WLLA 4R7JA 5U4NA 1GPFA 2UY3A 2WVSA 5FEXA 1DJGA 1UP2A 1M7XA 1EQPA 4CN1A 3EX1A 3S5OA 1P6WA 2VYOA 3GFYA 5HWJA 4GWEA 4GD0A 4QDMA 3MI3A 3U9IA 3MHGA 3LHYA 3PFRA 4NL1A 3GAYA 2W5FA 3D3FA 4LS1A 1V5XA 4C6KA 5M03A 4GJJA 3JRKA 1TTPA 2NUWA 1GYMA 5BROA 1VZWA 2GL5A 3PTKA 5AHEA 1REQA 3GRIA 1V6TA 4AYGA 4FALA 2NX3A 4TMCA 3PBVA 4LV9A 4DBEA 3M5VA 4DYJA 1T99A 3PBWA 4XAPA 3C2YA 3T6CA 2XVLA 1W5PA 4AIUA 1HF6A 3QEZA 4E2BA 3MWAA 1L6WA 3RM4A 1JRCA 3V0UA 1XX1A 1U83A 2XSBA 4H7CA 1S5TA 5J04A 1Z3NA 2HEJA 3T4WA 3H2FA 4DZIA 3OODA 2HE5A 4X60A 3GXPA 4KEZA 3MSRA 2FZBA 1AW5A 4IM4A 1OCJA 4MIMA 2ZXBA 4UNIA 4EOUA 4QG9A 3QYQA 4F4RA 1PWMA 1TPWA 3CQIA 4N6EA 3VOFA 1QASA 4JGDA 1N8FA 2J7DA 1SW3A 3FNDA 4KEMA 2ZC1A 5HBFA 3DX5A 1PDZA 2VGGA 4H8NA 2QR6A 2E1WA 1QXLA 4PMNA 3WJXA 2VVSA 2Z28A 4Z2JA 3S8HA 1A5AA 3CUIA 4G7EB 4FIRA 1GK8A 2WQDA 2QIWA 3B9AA 7REQA 2TAAA 1GZGA 2FVLA 2BLEA 1IYXA 2Y4SA 4RE2A 2X40A 4OIFA 2DW6A 1QNSA 1MDRA 5K2ZA 4EXQA 3B0VC 1TIMA 3GH7A 3UZWA 1BTMA 5KETA 4MJ4A 3IIPA 3NDOA 3KDOA 3F4VA 4RE3A 3WQPA 4NJGA 5DELA 8CGTA 2ONEA 1HFBA 3P81A 4V28A 4XUYA 4GACA 3B0XA 3E5PA 4E2VA 1QI2A 5FF4A 3S2CA 3P60A 4J3SA 3UNDA 3VMOA 5CAHA 1A80A 5D33A 2VL4A 1X96A 2RGMA 1OF6A 1ECEA 1ZL1A 2PSNA 3VOCA 1JULA 3L2IA 4XD5A 2YJQA 5A6AA 2A3AA 1WUEA 3LI1A 1LT8A 1H2JA 3TA9A 1HGWA 1V08A 3WELA 1IZKA 2PDWA 3T4CA 5I09A 1OFBA 4MJ2A 1HP5A 4BQ2A 5LYRA 3S9YA 4OU1A 4HSHA 2VHLA 2V69A 1PZ3A 5DT7A 3RHGA 4PSRA 4A6GA 1EHAA 1WNOA 4LAMA 4UUIA 3DI1A 4IGSA 3U7VA 5BXPA 4JIIX 5JMUA 1VFMA 3MS8A 3VUPA 3AIRA 5C7HA 2V82A 3BDKA 2FB3A 4L64A 3BVJA 1PTGA 4PB3A 3W76A 1K3UA 3I6EA 1ZJHA 4HB7A 2WSRA 5DX7A 1RBOB 5BOEA 1OFAA 2FZMA 4E8CA 3VGBA 3T8QA 4FI4A 2HQAA 3DGRA 3W7GA 4IPIA 4B4FA 3LM7A 4DLFA 1UC4A 2UY2A 5FSDC 1VRDA 2G41A 2ATMA 1LTDA 1FWAC 1EUNA 1U1UA 1X7FA 2Y88A 3E5BA 3TQVA 4XTIA 1UKPA 2POTA 3F4DA 4P7OA 1JYWA 2OFJA 4X3ZA 3V16A 1W3HA 2QVHA 2DP3A 1H1NA 3WQ4A 1UD5A 1TV4A 3AIUA 1DV7A 1EDQA 2OQLA 2WCAA 3AO0A 2OOFA 3O6CA 1OYCA 4JX4A 3RAOA 1BG9A 3FSTA 1XIHA 5EGRA 1YDOA 1HJVA 3MKCA 2NLYA 2YPIA 4GA8A 3PJWA 1WP6A 2X0SA 1B90A 3MO4A 4O52A 3ITVA 3QW3A 4TVDA 2E77A 3GTFA 4EAMA 4GJ1A 1GGOA 3T81A 3LNPA 3T2QA 1D2KA 4B5UA 4Q8TA 5J5DA 3DFPA 5ECUA 4CU6A 3N2CA 3UJRA 1PUDA 1EF3A 3EMQA 3CZ8A 4QSHA 3QMSA 2AKMA 1DE5A 3EPOA 2ZXQA 5BOOA 3W88A 4NQ1A 4G8TA 1I9CB 1DQUA 5HA7A 2QCGA 3EXRA 3OBKA 1OFEA 2A6LA 3O0FA 4BWLC 1TJ2A 4WZHA 3FCPA 3C0SA 1R3WA 4WK9A 5I3JA 3F4WA 5TD4A 3PBUA 5I23A 3ZS4A 4QCEA 3CZKA 1TQJA 3SAZA 2OCZA 5K9XA 1PO9A 2A79A 2OKTA 1KLZA 1UR1A 3M0JA 2PDYA 4JIPA 1OX4A 4RW5A 3TQPA 2CETA 1V6WA 4HPGA 2GPTA 2FGLA 3GKAA 2PDBA 3S83A 3TVAA 1JDDA 2GJXB 3W25A 4BWLA 3NPWA 1TR1A 5DMLA 1X6UA 4K7VA 3LXBA 1PIFA 4PTXA 4E5TA 4H1ZA 2QDDA 2XWDA 4H9YA 3LXCA 4UFLA 2VZOA 3QMTA 5JU6A 2DZSA 3CHEA 1PWLA 3R89A 3NZRA 3WL1A 3POCA 3H26A 1M65A 1N7KA 2WOQA 4K37A 5ABHA 1B30A 4BZYA 1VFHA 3BAYA 3EA2A 3NEVA 4OTKA 2CBUA 2CHOA 3UERA 3PUGA 1OINA 2OB3A 1PL9A 1VQTA 3GR7A 1XRVA 1NDYA 4GY1A 5A8GA 1C8YA 5L9FA 1UH2A 1CXFA 2W9MA 2XU2A 4PEEA 4I7UA 1XIBA 3FHQA 1LOSA 2E28A 3IGSA 4INFA 3USBA 1B57A 3M46A 3WF0A 4FHAA 4KIEA 4CVWA 3LPPA 4CNNA 2FVMA 1JRBA 3KTCA 1IZJA 3P84A 4LTSA 3QC0A 2HK1A 2OEMA 3SGGA 5LKYA 1LQ0A 4GVFA 4JR5A 1C91A 4M29A 2AGTA 4DJFC 4IJCA 3UP8A 2DZTA 1EGMA 3K8KA 3VKJA 1F76A 5KSWA 3PVFA 3JZEA 5TAOA 4C6EA 3NUKA 3FAXA 4F0RA 2R1KA 1FP9A 2EG6A 5I3DA 1E15A 3EX3A 3LEPA 1PXGA 2E9LA 3R25A 1DIOA 3VD5A 4UTIA 3AXIA 1SFJA 5E0KA 3L7RA 4NI3A 1H61A 2FMNA 1BXNA 4DM2A 1AK5A 2IUZA 3M7SA 3PB0A 2QXWA 4M7SA 3AU2A 2PDGA 3W0KA 1BVZA 4GFSA 2PBOA 4DJFA 4WDXA 2JALA 5EFFA 1NAL1 3RM8A 2O4MA 1PDYA 4M1RA 5HQEA 2WJFA 2QGHA 3MBDA 3W7CA 1NP2A 1W54A 3UZYA 4L9ZA 3PF3A 4CNPA 2WPGA 3U5YA 1K9FA 1IZCA 1W1B1 2ISWA 4KCWA 5DANA 2J9YA 1E1CA 2QPSA 4KBXA 1YNYA 4QS5A 2CPUA 3N9RA 3TP4A 1UUOA 2RDXA 3K46A 3N9KA 3QQWA 1B3ZA 1ADSA 3E0WA 1PCWA 1OVDA 1EKOA 3M0MA 4M6UA 1WAUA 1PEZA 4UZSA 4R27A 1E6SM 1K7EA 3UNTA 5HNUA 1PTAA 2OX1A 1D8CA 1IHIA 3AISA 4QCFA 3B8VA 4S1FA 4W7WA 3NQDA 1XFCA 4O1AA 3QR0A 3FYPA 2DDXA 2NLIA 1IEIA 2PP3A 4WX2A 1KB3A 3LTSA 1RZMA 3K1DA 5I78A 3VNMA 3ARYA 2DJXA 2ZZ3A 2OX4A 4S3JA 5TBOA 3GG7A 3T44A 4OT7A 3ATYA 1BSLA 1RJRA 4NILA 2AL1A 1NOFA 1YDYA 3N4AA 4IQJA 3PUDA 3OLIA 5C0QA 3UGRA 4JTFA 1LOLA 2C13A 2NZLA 4IL2A 1H3GA 4L1WA 5CSSA 3CPUA 4A35A 1LWIA 4JNYA 3N3TA 3U3HA 4HU8A 2BXYA 3LX9A 4XIMA 3TROA 4PRTA 3ZT7A 3VM7A 1F6YA 5HK4A 1AW2A 2VZSA 4NG3A 2CLPA 4FX7A 4FMVA 2HRWA 4DO6A 3GFXA 1FHDA 2G3MA 3NM1A 1EA0A 2GVJA 3SRHA 3WLHA 1AVAA 3T0DA 2PLKA 2E6AA 4IGNA 3IACA 1FDYA 3MMWA 1LOQA 3GNNA 4IG2A 5D2YA 3EYPA 5AY7A 5C70A 4GISA 3FJNA 5FACA 3A13A 4GNKB 2ZCGA 2QKFA 2JKEA 2ZVRA 4RLIA 4AZCA 1AFSA 4O18A 4HK6A 3G3MA 2H3DA 4MY9A 1JPMA 4DVOA 1LROA 3AWOA 3IV8A 4KESA 1FKXA 2FFCA 1G4EA 1WPCA 3P8JA 1CB7B 5D38A 3BANA 4GH1A 4PUUA 3OQ8A 1MMFA 4IMAA 1XLJA 3W83A 1ZHAA 5D9OA 1TTIA 3V0SA 2VFEA 3GS6A 3NOEA 1IEQA 3EOEA 3IJ9A 1F6KA 1OT2A 1ISWA 3C2FA 1GUVA 3CIXA 3PG9A 4Q8WA 2PP1A 3NWRA 1OYAA 3A9BA 4J28A 3KL5A 4DB7A 2UBPC 4HGXA 3HO8A 1XRFA 3LSBA 3T8LA 2V2HA 1M41A 2E0PA 1OC5A 1HO4A 2WSKA 4LAKA 3NNTA 4Y96A 1JCJA 3WLTA 4H00A 2VUYA 4P8WA 1JEZA 2AL2A 4DWSC 3TYZA 3SCNA 2V5DA 4AZ6A 4Z2HA 2QCLA 3GUWA 2GJNA 1K03A 1UP0A 3CZEA 3H4XA 4EKJA 3VKKA 3LLXA 1E6QM 2D3NA 3WD4A 4LBRA 1A0CA 1UR3M 4HNUA 2ZA1A 1ZCCA 3RGTA 6PTDA 4K8GA 2C1GA 4PMZA 3GDLA 4DWSA 5D37A 1C7TA 4P7QA 3VIFA 3GNDA 1B2YA 3QMRA 4XVEA 4XG1A 3FKKA 1W2PA 2YW3A 4IICA 4QG8A 1V8EA 2BODX 1PAMA 3REQA 1KBIA 4FF7A 4K6AA 1XFBA 4IFKA 1VFUA 4J3VA 1Y5VA 1XISA 3GH4A 1EP2A 2BNJA 3IK4A 2XIBA 4IOTA 5HOSA 4PUWA 5CLTA 3TA6A 1KQZA 3GR8A 5CPQA 2ZX9A 3EWWA 4ZEPA 1Q6QA 3M5XA 4QLLA 5FEZA 4U4MA 1QVBA 1KRBC 4MJMA 2HNHA 3LXAA 4TV6A 4TIMA 2ANUA 4HMCA 3VE9A 1J79A 2BXVA 2BV9A 3MPGA 2HDJA 3OLEA 3VGEA 2F38A 4Q8VA 4HPNA 3MUXA 3T0TA 3MSGA 3NYZA 4GYPA 4Y9NA 5HWMA 3LDVA 3LU2A 6A3HA 4PMVA 1EWDA 3SECA 1EQCA 4ZR8A 4BQ5A 1I2NA 2DQWA 2WAGA 3U5UA 3SN1A 5CBBA 4QISA 1WV2A 2B7OA 3OZYA 3EZ4A 4HP5A 3WLNA 1CW2A 3MUCA 1UWSA 1R9ZA 1FWGC 2PC4A 3M47A 3EWCA 2Z29A 2GQ9A 2CIPA 3P5ZA 4PBFA 1XUUA 1Q3NA 2QT3A 3CLWA 1CLXA 3O9NA 1CGWA 2HE8A 1SVDA 2XTKA 2P50A 1TTQA 2NWRA 1ZP3A 2A3EA 3NZQA 3QYSA 1BXCA 1B9ZA 3DCPA 3W2NA 1Q4NX 2GWGA 4GZIA 5A6BD 3TCSA 3WEOA 4JDBA 1IIHA 4M7TA 3ZJ7A 2PDNA 4PTNA 5CXPA 1EA9C 3NPUA 1TVPA 4JIQA 1W9DM 2INZA 3CTLA 2ZFAA 1CDGA 1MUCA 2O9OA 3B4YA 4JTLA 3ARSA 1C8VA 5CPMA 7CGTA 1KFLA 4ROQA 1S2WA 1PCKA 2ABAA 4LFYA 3WLMA 4YTRA 3ZO9A 4PULA 2V67A 3EA3A 1EBHA 3TOPA 2XZ9A 4O4WA 1R2SA 1B4EA 4JTQA 4TVUA 4K1GA 1JZ3A 3W00A 3DHPA 4WKFA 5JBEA 4XD3A 4CKQA 2I9UA 3Q67A 1JZ8A 9RUBA 3WNNA 4O50A 5BU9A 1KXQA 3GDRA 4ZE5A 4O4VA 3PP7A 2OTDA 4E3VA 1TWZA 4KT2A 4LWWA 3EWBX 3EXTA 3C3UA 3D0CA 3BLLA 1WBHA 3WQVA 2O7QA 4BR1A 1ZB5A 2OWCA 3ZFHA 3GQYA 3UBPC 2P3EA 5TQLA 3W87A 3M6YA 4L1XA 1ICQA 5H91A 3T78A 2ZWYA 1ICSA 5DMYA 1QR7A 3TJ4A 1JQVA 2CZFA 2EPHA 3M9YA 4PH6A 3HZ3A 2JIWA 3VX1A 4JKKA 1R9XA 3LCHA 3INPA 2ZZ7A 4US6A 3P3BA 5C2XA 6TIMA 3HGOA 3DN5A 1I75A 1W1TA 2PWVA 1UR8A 4UTWC 3IGXA 3TLLA 3AQUA 1GHSA 1EIBA 1PE1A 4P8UA 3FJ4A 4M1BA 3TKFA 5CPTA 2XN2A 1J8VA 3CL8A 1JNEA 4ASTA 3W1LA 2P10A 2O9RA 1N8IA 4B90A 2G95A 2J13A 2Y5SA 3IJQA 1YW1A 2PU0A 1LLOA 1AQFA 3ARWA 4ERAA 2C15A 4L61A 2PFHA 1HKJA 3CGTA 1I0DA 1R38A 1AL8A 3GG0A 1RLDA 2QYGA 2A7PA 4J27A 4UTWA 3R1ZA 2BVYA 4G2DA 1VCFA 1MVYA 3ZT5A 2Z2BA 3WLJA 4FXJA 2VFDA 4DJED 1M7PA 5DN1A 3L0NA 3GXFA 4QIUA 1KLYA 4MUZA 2CZEA 1TPC1 2VM8A 2XPKA 4N7QA 1D7KA 1R3QA 1K4HA 1XYCA 3BCDA 2YDQA 1UG6A 3EPNA 1YXYA 3MDWA 2RAGA 4R85A 4AYSA 2PDMA 3CYJA 4RPQA 4NXSA 1I8JA 3DERA 4LQ1A 1P43A 5GNXA 4HMDA 5EL1A 3T9PA 4XD6A 3IJIA 3U48A 3D46A 4NZ1A 4O17A 5BOFA 1IXPA 1VFOA 2XG9A 3SRKA 1O12A 4KWUA 1EGZA 3O1NA 3T55A 3LRMA 3BJSA 3ITOA 2P8CA 3C6CA 2YSWA 4X22A 2VEPA 3NEHA 1W3LA 1IWBA 3ZLGA 5CGTA 1Q63A 2AOSA 4W5ZA 4E38A 3GK0A 3C56A 4WSKA 4H04A 2VGIA 2CXEA 3KEHA 3ZQ9A 1ZBCA 1YDVA 3G2GA 2I7GA 1MQQA 2X05A 3VNJA 1HKMA 3QVQA 4G56A 3BARA 4NVTA 2YBTA 1V3LA 5CEWA 3PFMA 4YVPA 3MCNA 3KS5A 4GE8A 2BBFA 1W32A 4QQ3A 4CNSA 3W70A 1TVNA 1K9TA 3TTYA 3SURA 1XBVA 1N55A 2PAJA 3NR0A 2Q09A 2QJNA 4L4PA 2R1MA 3I4KA 3NYDA 1RBAA 1JCMP 3TYCA 3M5ZA 2WW5A 3GY1A 1XRTA 3PPGA 2DUZA 1DOSA 4EX4A 3W22A 3DGBA 2DVUA 4MB5A 4RZ4A 2Z1KA 3BQ6A 4JQAA 8XIAA 3WF1A 4D8ZA 4DM1A 1Q8JA 4EXAA 5LA1A 3RU6A 2V5KA 3ID7A 1OWQA 3PBMA 4KCTA 4X9SA 5BWFA 2PLJA 1R30A 3ERPA 2PGFA 4GJIA 2G3JA 2QZRA 2BZNA 2PODA 2Y89A 1GJUA 3LNMA 3KP1A 4WDTA 3WD2A 2DH3A 4FXRA 1M04A 1DORA 2ZZ2A 1VP5A 4YLWA 2J66A 3OU8A 4FA3A 1PKMA 3W7MA 3G77A 4JN7A 1XPGA 2W4XA 4CN4A 3BGGA 1F73A 2VZUA 1UA7A 1DWAM 3RNDA 5HNRA 1LBMA 1E4MM 2YKKA 4PB5A 1WXJA 1XLIA 2OEJA 2MANA 4UFKA 1RD5A 2WMGA 3ZVIA 1CT5A 1TWDA 4JDYA 2O92A 2V5JA 4PTDA 2YXOA 3KOZA 1MEIA 1E6NA 4HIBA 3M1ZA 2CZDA 4H2CA 5JBFA 4MPQA 2FZ8A 3PK7A 4J4KA 4P61A 2B0MA 3E74A 3WDPP 3L4YA 4LX4A 1R5YA 1TE6A 4H41A 3WQOA 1JDAA 4JYEA 3LHTA 5JH1A 1KNWA 1KWKA 1PKYA 4BF9A 1RCOB 3LPOA 3WUEA 4C1NB 1VC4A 4MTVA 4BI7A 5CJNA 3N12A 4DNMA 2Z2UA 1R8LA 3HFTA 4D8LA 2WJEA 1CGYA 1Q7QA 4FXFA 3H2MA 5C8BB 2ZC8A 3CB3A 3P7YA 4GIRA 3OPSA 3URQA 4B2DD 3FOKA 2O9TA 2ZQ0A 1QK2A 4GYFA 3MDUA 1E0UA 5FJOA 3LLFA 4RZ6A 4YYFA 1VFLA 1C7SA 4RDWA 4HZ7A 1OB0A 1Y0EA 1CGTA 1K7XA 1J6OA 3FAWA 2WANA 4KRTA 4RL3A 1XLHA 3AIWA 4MG4A 2HSAA 1VHNA 1UKOA 2Q3RA 5DY3A 1MYRA 4YL2A 4BA0A 2DQXA 2OELA 1EJVC 2V5LA 4F48A 3HG5A 1F61A 4WOQA 3WQDA 3WQ6A 3W9ZA 1RP8A 1IXQA 3H4GA 2FZ9A 1XIMA 3EB2A 4FNSA 3TFCA 5M3WA 1XW8A 2PDIA 3QPEA 4HCHA 4HA3A 2HMCA 1W3NA 5A6TC 1IT8A 1UR9A 3ARRA 1UH4A 1PZ2A 4JHZA 2V3EA 2GJLA 1XDMA 1FXPA 4H8HA 1Q65A 3VTRA 2F2HA 1HKIA 4S3DA 4HA4A 4K38A 3WJSA 5AKQA 1QWGA 3W28A 1YLVA 1RQBA 2D2HA 3SM0A 4ICMA 3OYZA 1V3KA 2OT0A 2OT1A 1SU5A 2J47A 3A64A 3C2VA 2GJXA 4UFJA 3URBA 2CWNA 4O12A 3RMEA 1OT1A 1NFBA 4M81A 1F3EA 1HTIA 1KRAC 5MKGB 4REQA 3MUY1 2NV2A 4Q4PA 3P5YA 4DF0A 1Q6EA 4LUIA 4QDPA 1O60A 3OJGA 1UH3A 4FLRA 2QQ6A 2QUMA 2XVPA 3CL7A 5EBUA 1MW2A 3L4UA 3GIQA 4E8DA 4ERIA 4UXDA 1DJQA 4UOQA 3N14A 2PU1A 3PR2A 3G0SA 4PUNA 1V93A 5TIMA 4MGGA 5DXYA 3AMCA 2HZGA 4AD5A 2NQ5A 3TSDA 5E1QA 3W01A 1MXGA 4YCOA 1V6XA 3POHA 1TA3B 2NW0A 1K6AA 4AC7C 3VIMA 2D22A 4EF8A 1G1YA 1P6CA 2D3LA 2R8WA 2J25A 3QHMA 4UR7A 3BAJA 2ZZ1A 1Q2RA 1AJZA 1V0KA 3UXAA 1RY0A 1BPLB 3W7QA 2D23A 4QAWA 1VD6A 3FFSA 2QCDB 1FWEC 5FKYA 3U4FA 4AIEA 3G3DA 1J0ZA 4DJDD 2FH8A 3MSDA 5BU6A 1RVKA 4LUSA 1HNYA 3URNA 2YYTA 5HATA 5HQLA 3VIPA 2XVNA 3TC6A 1A0DA 4CNOA 4KEVA 1UJPA 4XWUA 1Z32X 4PCSA 3G18A 1V3JA 1W0MA 1LLZA 3RO6A 3N19B 3U7BA 1D3HA 4TR9A 2I56A 4PEKA 1R46A 3PZ9A 3OHMB 4FNPA 4XUGA 3VA8A 3OP2A 4Q8NA 3EBVA 6XIMA 4R3UA 3B40A 1QBAA 3SO7A 1JPKA 3VKDA 2ZE3A 1W5MA 2Q6ZA 1KM0A 3DUGA 1P0DA 3ECQA 4I90A 3CZLA 4KMQA 2ZX5A 4Q7NA 5D04C 4NF7A 3GNOA 4H83A 1EPXA 3AUJA 3SZ8A 5CSUA 2E7FA 4LAUA 3NVDA 2C79A 2WNZA 3CMFA 4NYYA 3KRBA 4N4PA 2HNEA 1VF8A 3TW6A 1W1A1 4WJEA 3VXGA 2VGFA 1JXJA 3J7HA 1BTCA 2EJ1A 3BG5A 5I03A 1NIUA 5E0CA 3ZM8A 1GNXA 4GGHA 3UWQA 3R94A 2WPBA 4LF1A 4LY8A 3P74A 5DCBA 1S5VA 3HG3A 4BS0A 2CZ5A 3G8RA 3EOOA 4O28A 1SZFA 2CFFA 3I65A 1PZ1A 1OD0A 2WBGA 3KOYA 4GK8A 1HKWA 1HVXA 1ZJIA 1YE4A 4JX6A 4I5RA 1VAHA 2PGWA 4GUGA 1S39A 5KITA 1IQ8A 1I0BA 1JPIA 1BRLA 1HXJA 2ISFA 3MP3A 3O6DA 1PVNA 2R24A 3GM8A 2XFRA 3L5MA 4AX6A 4YN5A 2HISA 3IIXA 3SW6A 5M17A 3BZGA 2FPVA 4GOAA 5RUBA 4CD4A 3FS2A 3LV6A 5DBUA 4AZGA 3OGVA 1J4EA 3NXFA 2CEQA 1GORA 1A5BA 3L65A 2DVXA 3ISIX 3MZ2A 1NTHA 3PSVA 3ONBA 1XBZA 5JVLA 1D3CA 3S2LA 4K2SA 3DESA 1X1ZA 3DHDA 4MOZA 3DFNA 5J5RA 4W93A 4W88A 4L5ZA 3L2MA 1O66A 4M82A 4AUBA 4A3YA 3ICJA 4QP0A 2XN0A 3T0CA 3N29A 4IL0A 4NI8A 2ZTKA 4D2JA 5M2FX 4GC4A 1DJIA 1QNRA 3DFHA 2G37A 5LGZA 4Y9OA 3Q37A 1XICA 3W74A 4LB3A 3DECA 1BQCA 1NFPA 1K9EA 3LHWA 2I9EA 3M4HA 1C9DA 5DLCA 3LSCA 3SDOA 4AU0A 5E6ZA 4DXXA 3RRAA 4IMCA 4ZO8A 3F2CA 1A4MA 5DFAA 3L12A 4GNJA 3LTPA 1HJSA 2BOEX 1LWHA 1TIWA 3THUA 4IISA 2GGJA 1EH9A 2QJJA 1BWKA 3PZTA 1RUSA 4QAIA 2A3HA 4IX0A 3AS2A 3AU6A 4N9CA 2IKIA 2E9MA 1TB3A 4LC8A 3P8IA 4PTWA 4KW2A 4NZFA 3EDEA 5CC5A 5HUPA 4ZENA 3N17A 3NTYA 4PMOA 2CHRA 1CYGA 2F8QA 3NM3A 3SCOA 4ACZB 1JAKA 5H6HA 2PTDA 1EUAA 3S1GA 3RX2A 4JPGA 3SADA 5E9AA 4GX8A 2CLEA 4TVCA 3QRHA 2ZUNA 3FXGA 1JFXA 3UPMA 5BXSA 1GJWA 4GUHA 1CGXA 2ZUTA 4GZ7A 3UR8A 1OK4A 2QVNA 4C6FA 1QPKA 5A69A 1IEXA 3VFLA 4MLJA 3UCDA 3QV7A 4AWTA 4UB9A 2GGIA 2DZBA 4DUVA 4NP7A 4N2YA 4R9XA 2PGEA 1RQHA 1IEVA 1NWTA 3AXHA 4IGHA 3TSMA 7REQB 1HJQA 4S3CA 4X0VA 3M0KA 1Q85A 1ZBWA 1MFUA 3MU7A 3KCOA 4LRTA 3W1AA 2YZRA 2C14A 3F2BA 1B54A 1M6JA 4O8RA 3I10A 3AYRA 4NZCA 5HWNA 4C7GA 1ZQ5A 5FF0A 4IFOA 3ZJ8A 3WMBA 3CWNA 4PCPA 2Y62A 2WHMA 1POKA 3I68A 4DLMA 3CQHA 4O10A 4YTUA 1LG1A 4AD3A 1YTDA 1PIGA 2W66A 4J3WA 2X1TA 3FEQA 2ZUVA 3W23A 1FHVA 3VDHA 1YADA 2V3DA 1H63A 2HXTA 2IPGA 2YXXA 4JIHA 3UZXA 1EJXC 1FP8A 4GCXA 4YWSA 1PYMA 4I8DA 2EEXA 3DC8A 3B97A 1OZQA 3W53A 1ZTVA 2GJPA 4NJHA 1T5AA 3HPZA 3UGVA 3GU9A 3W1MA 3Q2DA 4A8LA 3CO4A 4N9EA 4S3FA 3BMWA 2EKGA 3UJSA 1WDWA 4U3AA 2BY2A 1YDNA 3OZPA 2WNNA 3TLQA 2NSOA 3TQ0A 4UNKA 3WK3A 3DYOA 5A8NA 1VBUA 2XVGA 1UZ1A 1DJWA 4MYAA 1UMYA 4HYWA 3QLLA 2Q3OA 3ZLHA 2GGEA 3GG1A 1OYBA 4X61A 3BAKA 4AZ5A 1QI5A 3GC2A 2HWGA 1JYVA 1K7FA 3RX4A 3Q45A 2VEMA 1Y65A 1GG1A 2QGYA 2INEA 4IWWA 2DZAA 2DIJA 3V1PA 3F5LA 1YKWA 1C8XA 1GWJA 4C65A 4J35A 3NSMA 1GVYA 2QMKA 4O15A 1DXFA 2V0TA 1U5HA 1E6XM 3QSTA 3WIJA 4ORMA 1TR9A 1TO3A 1HZYA 4URIA 2I57A 2I5GA 3WUGA 5CSRA 3DFYA 3L5AA 3LCFA 2YDRA 5G1MA 2WC7A 3K8LA 5E5CA 5CCZA 1KCXA 1JDEA 2MUCA 5CAKA 4F9DA 2C6QA 3VIGA 2YYUA 2ZZ5A 4PGLA 3W29A 4KKXA 3UPWA 3W7KA 2IQDA 3KTXA 5HXMA 4F2TA 2HVNA 2P88A 5ABFB 3RCYA 3NQAA 3U57A 5FF7A 4PTMA 4IZGA 1KGXA 1OC7A 3R12A 3UVAA 2NX1A 4RE4A 1F6PA 2QCMA 3PZVA 1SO4A 1A3HA 5AZ0A 4F40A 1WO2A 1WKFA 4HSOA 4D1IA 1UHVA 1JL8A 4HNOA 2A0NA 5H8MA 1QAPA 4MHBA 3A23A 3VU2A 1DPMA 1CTNA 3U2OA 3IPWA 3VZYA 3TN3A 2DFAA 1N8WA 4WJ8A 2KX9A 1W5QA 3AXMA 4RJEA 4JCLA 1QMLA 3MANA 1B31A 3VD3A 3LRLA 1GVIA 3UXDA 4UQBA 1BXBA 3C0QA 1LBFA 3LLDA 1OD8A 3VDGA 1EX1A 5EMLA 3AC0A 1NJJA 4J2MA 2WQPA 1TSIA 4PBGA 1XC4A 1BKHA 3UZ5A 3ARZA 5JIWA 3DYMA 1TE1A 2E5DA 4WGXA 2HK0A 1ELSA 1OX4B 3MY9A 4C6QA 3RJYA 1X8FA 3MHUA 5D8ZA 4H6KA 4IP5A 4HNVA 2INFA 1E55A 3L0GA 3GR4A 5FL0A 1OX6A 3Q65A 1FHUA 3IJLA 4LCRA 1UJQA 2YCJA 4DYEA 4LUTA 4LUYA 4WLCA 3IANA 3OYXA 1QU4A 3K30A 3AAMA 4ENLA 4LXFA 4F2UA 1IR2A 3GHSA 2DZXA 3WH8A 4D6JA 3PZGA 1RXOB 2PTXA 4MVAA 6XIAA 3T0BA 4W89A 3HG2A 4ZO6A 1S5WA 1XQLA 5EMMA 1RHCA 3ITYA 4HU3A 5LIXX 4WCJA 4AMCA 4MNKA 7XIMA 2J75A 3HU7A 1MW0A 3RIKA 1X7IA 3WY1A 3A5VA 3SBFA 4F9JA 3ZLFA 3ZJ6A 1RJPA 2KZHA 2GGGA 1V4YA 4H9XA 1THFD 4UC5A 4BEUA 1GG0A 2OSXA 4IMGA 5HJYA 3TJLA 1SGJA 4DRSA 3WF2A 2O9PA 2R9RA 3F7JA 2E5CA 5IXEA 3OLDA 5HNNA 3ALFA 5FESA 1E72M 1HO1A 3IAQA 1S1PA 3BJFA 2QAFA 4GABA 1MDLA 3LD5A 3CZJA 4GQRA 4CQAA 1TPUA 3WKZA 1FQ0A 3CO8A 1YPFA 5GVJA 3KWXA 3TTOA 4IMFA 1G69A 1CENA 2QJIA 1EEXA 3I3DA 3QTGA 1XPYA 4ADTA 3SRFA 3CHFA 3VC5A 1KBBA 2PWUA 3SJ3A 1CIUA 2VDIA 1JCXA 1DYSA 3B3DA 2Y5JA 5LNUA 5GJNA 3SFKA 4GKTA 3VNDA 3NCOA 1F05A 1EZ2A 1QW8A 2ZZ6A 3N11A 1US3A 1UWQA 2ZDRA 1W1PA 2Y1HA 3WNKA 4A8RA 5CBIA 1K70A 1OIMA 2XJ7A 1ITUA 1HIZA 3FGCA 2BY3A 3EB4A 4ZOEA 4YCPA 2NQHA 4J7RA 4E6MA 1M53A 2B4GA 1ECQA 4CQBA 3UXIA 1FCQA 2CHNA 4NNAA 3A12A 4IFRA 1NARA 1JCTA 1Q45A 2NXIA 1VPXA 2VFFA 4HPHA 2YOCA 3AHVA 3AOFA 1E1CB 3DH7A 4DQWA 1MQPA 1KCKA 1P48A 3P67A 4ES4A 3B8DA 1VBGA 2OODA 1F7BA 3EKZA 5D2TA 1NWSA 2CKSA 4WF7A 3FW6A 4H6QA 1OF8A 1GCYA 1S2AA 4M3PA 2BMBA 5HANA 4G1KA 4PA8A 3W7RA 1J10A 4ZQPA 4IMEA 3BURA 2P1FA 2OQYA 1YXCA 3OZOA 1E40A 1R3TA 3NQGA 2OZ8A 2C1IA 4JHMA 4IIDA 3A4XA 4JKLA 3AALA 4WSHA 3L66A 4MWAB 2VRKA 2DSWA 4LVGA 1AUSL 4Z2KA 1JAEA 4TX8A 1MZHA 4C1NA 4MAZA 3LCIA 5LIYX 3VDBA 3VNYA 3SQMA 8TIMA 5H8UA 1OSEA 1QW9A 4ZBCA 3LCGA 3HOJA 3XISA 2X16A 2VCBA 1W37A 3W7LA 4Z17A 2XZ7A 2CITA 4ZE4A 4GUIA 1A5SA 4ZZ9A 3N1AA 3P6LA 3RXZA 1ADDA 3I7QA 3DFTA 3LGDA 3WL0A 1IE7C 3TE9A 4U5IA 2IQTA 3EX4A 3GVWA 4U31A 1EC8A 3H7RA 3VZXA 4UNLA 3GW0A 3LN3A 2VR2A 2I5QA 4UTTC 1I4NA 2PB1A 2AQVA 1JPDX 1MSSA 4G7FA 1DJNA 2VGBA 4AD0A 3UWVA 1TWIA 4S3AA 5AC8A 3N25A 5CGQA 2HVOA 2JF7A 2F7FA 4LBSA 3VAVA 4AZCB 2PLMA 3C52A 2WVVB 2RDTA 3R8HA 1EEPA 1BYBA 4ZQOA 1OFRA 4RNIA 5FD0A 3MB9A 4BK9A 2WM0A 4S38A 1QW7A 1IXNA 4GLEA 4UTTA 4YVVA 4BHYA 4PRRA 2NVAA 3FKRA 3STFA 3E6EA 1IWAA 2CLKA 2J7GA 3ES7A 4FX8A 3UR5A 3COTA 3C8NA 2YA1A 2D2OA 3B9NA 3SEPA 3CQ0A 4MUPA 3EPMA 2VX4A 4Z0JA 2QCCA 3PBGA 4S3GA 3FVMA 4NIRA 5MKGA 4Z08A 3VCNA 3U4AA 5C2CA 2OSYA 1V6YA 3B8IA 3C8FA 3W73A 2SFPA 1X38A 2EGZA 3WMLA 2TYSA 5D2VA 3SJNA 1XG4A 4P5UA 3WQGA 4HNTA 1OGSA 2B31A 2CNCA 3HQNA 4J9JA 1BVNP 3RPMA 4H4IA 2YZ5A 2J24A 4YU1A 3VINA 4X2PA 2PCQA 1ML1A 3BGJA 3V3WA 1MZRA 3IJ8A 3TN5A 3GBEA 3SCQA 2CERA 3WH7A 2A6NA 1GOWA 3EDDA 5LIKX 4QJ1A 3B8UA 4NJJA 3VFCA 1J2WA 1EJ7L 3HQ1A 1GVQA 5I3HA 1V6VA 3W86A 5XINA 1Q6LA 1HKVA 1FX6A 1TA3A 1V3IA 3RM9A 2J27A 3TN4A 3CH0A 3LB0A 4KGJA 3OIXA 5FA5A 2GDUA 3HV9A 3O15A 1Z9AA 3EOUA 5F4WA 3R6IA 4UIOA 4B5NA 1AA1B 4KETA 4U3CA 3B04A 3N9SA 1LG2A 4XZIA 2J7HA 4LH8A 4DWSB 3YPIA 1K9DA 2OO0A 2R91A 1NU5A 4J3ZA 1LZOA 2QCDA 4GG9A 5BW6A 3C61A 3EWYA 2ISDA 1NF0A 4NUWA 4ZOBA 2IKHA 4S23A 2G3NA 1VKFA 2WBKA 4DPPA 4M5PA 4PN2A 1H7OA 4GIYA 1KXHA 4IFKB 2QF7A 4QXIA 3B0UX 5KZMA 2NVDA 3NO3A 2DT2A 4QROA 4AHOA 5T9BG 4E4FA 4CQ9A 1AH3A 2ACQA 2FPTA 1VS1A 2ICSA 4NAEB 2WJDA 2HBXA 2E5BA 4AXKA 4O0ZA 3MYPA 3RCNA 4DO5A 2PI6A 4LPCA 1H51A 2F2KA 4GMEA 4IPPA 2Z1XA 1EWEA 3CV6A 3MVTA 3SUVA 2YGYA 1XIGA 1VYPX 1ZS2A 3BQ5A 1WZMA 1RPKA 4ZSUA 1EO7A 3AYVA 8XIMA 1DIKA 2DIEA 4W86A 1W1YA 1IGWA 4EF9A 3FSUA 1R85A 1FWBC 3GFZA 3S5NA 1H7NA 1U33A 2JKAA 3VOHA 1RP9A 2PUZA 4OV9A 3LBCA 3O6YX 3TTQA