2VFFA

Crystal structure of the f96h mutant of plasmodium falciparum triosephosphate isomerase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
247
structure length
247
Chain Sequence
b'ARKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHHERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRIOSEPHOSPHATE ISOMERASE
publication title Biochemical and Structural Characterization of Residue 96 Mutants of Plasmodium Falciparum Triosephosphate Isomerase: Active-Site Loop Conformation, Hydration and Identification of a Dimer-Interface Ligand-Binding Site.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 98
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2007-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2vffA00
3TV8A 4TU1A 3LHUA 2A7NA 1GQNA 4NJHA 1DHPA 4UUIA 3TMQA 4IMEA 3GXTA 3EEGA 1KW1A 4E2DA 4HNNA 1F7BA 1F6KA 2ABBA 4OWGA 4GE8A 1KBIA 4S1FA 3NG3A 3ATYA 1PE1A 1TPUA 4UFLA 3TSMA 3MHUA 1G7VA 1XBVA 1UUOA 2QF7A 3G1XA 1SZEA 4QNEA 4K8EA 4AF0A 4CCCA 3LTSA 4Y96A 4GUJA 2ZZ1A 3W7IA 4FHAA 2ZRXA 3IGSA 1VQTA 4XBKA 2NWSA 3TJXA 2H8ZA 5HINA 5FEZA 5I3JA 3P84A 1V5XA 3TFCA 3W7QA 4HSNA 3M16A 3HGJA 4Y8FA 1AL8A 3C0JA 4DO4A 2TRSA 4R53A 2DP3A 1SFJA 8TIMA 2B7PA 4DEFA 1Q6OA 2DORA 4FF7A 1AG1O 4ORMA 4HNUA 1TTPA 2A5HA 3MI6A 1F05A 2JKAA 1KTNA 1YDOA 1OJXA 3BGJA 3QJAA 3EX3A 1H5YA 3PWAA 2HS6A 5D2VA 5D03A 1JUBA 3WK0A 1DV7A 5D02A 2A0NA 1YPIA 1FCQA 4OBTA 3WJWA 4AHQA 3NQAA 3MHGA 3OBKA 2VEPA 3F03K 3TAOA 3A5VA 5MHBA 4JYFA 1WOAA 1D3GA 4IUOA 3KVKA 3I7QA 4XBSA 3GNDA 3QMTA 4CQ8A 3ZWTA 1MSSA 4DF1A 3B0PA 5KINA 1SO6A 4EIVA 2ZZ5A 4UTJA 7TIMA 2V8ZA 3C4UA 3GDKA 1KLYA 1MEHA 1T99A 3QPYA 5LNSA 4N9CA 3LHTA 3TR2A 4UFJA 1ONRA 3C56A 2QKFA 5D33A 2VEKA 1FWNA 1YTDA 2Z6IA 3TXVA 3RF9A 1TPH1 4TIMA 1Z42A 3L66A 1FDZA 2GVLA 1ICSA 2J6XA 4YMZA 3W07A 3T55A 5AOUA 3TUUA 3FS2A 4MFDA 4Q32A 3ZR4A 1LRTA 2YYUA 1VR6A 3PY2A 3M1ZA 2ZRWA 4AMAA 2NV2A 2C1HA 4KFOA 3PB2A 2WO5A 5CZTA 1TQJA 1GVQA 1P0KA 4JYEA 1IGSA 1PCWA 2Q8ZA 3W7MA 2CLMA 5FEPA 4MYAA 4ZL1A 2V2DA 2Y7FA 4M6QA 5FF0A 1WAUA 1QMLA 3FJ6A 4LRTA 3HF3A 4GUIA 4FNSA 2ABAA 3FLUA 3IVUA 2Y61A 1G6CA 4BR1A 1H7RA 1YDVA 5U7SA 1TTIA 3M7WA 3NGJA 2ZA3A 4YCOA 1P5BA 3A22A 3G0SA 5KMYA 3HGRA 4UFHA 1IXQA 3GYEA 1TV8A 1ZALA 5EPDA 3B03A 1ZAIA 4AAJA 2CLHA 3RMJA 5T26A 3MI3A 4RR4A 2RHGA 3DBPA 3LOTA 2BWGA 3N73A 4WXZA 3F1QA 4GC4A 3V1PA 1FDJA 2VENA 3N34A 1G7UA 4IX2A 3ELFA 4O18A 3W6YA 5F2IA 1LYXA 1GOXA 3W1XA 4ONVA 4UTWC 4O0ZA 1SZGA 4LT9A 4LV4A 4PA8A 3W83A 3U8GA 3QSTA 3NDOA 3IIZA 5G1YA 4R33A 1VZWA 3LI0A 4MFEA 4Y6GA 3USBA 5KTLA 3NA8A 4UR7A 1HFBA 3BG5A 2WNNA 3N2XA 3S1XA 3L67A 3R8RA 4N9EA 4R34A 3VFLA 3H53A 4AEOA 3DENA 3W2LA 2RKXA 5F2MA 1JCNA 5KITA 1M7PA 4NJIA 3NVTA 1W31A 3W2NA 4I7WA 1R2TA 4ADUA 1KA9F 3EX6A 4ORIA 2QCDA 1KFJA 4HSOA 4TMCA 3GDLA 1GYNA 4DELA 1JRBA 5HR6A 3RU6A 3UD6A 5CG7A 2YDAA 2QAFA 2NXGA 1UASA 1I4NA 1RD5A 2XN2A 3S8HA 4AWTA 1M7OA 2FPYA 5HULA 1NAL1 1IF2A 4MVAA 1KTBA 3G8EA 1W0MA 4QNWA 1Q6LA 1O94A 3LGEA 4FNPA 4N9DA 3PSVA 3WJYA 4XUGA 4JICA 3IV3A 3PB0A 1B57A 4HPJA 5DELA 1YDNA 2CU0A 1K02A 3EXTA 5EBUA 3EX2A 1H7WA 2W0UA 4AB4A 3MI2A 1LRNA 1Q3NA 3B05A 3LXAA 4NNBA 4ADTA 3UXDA 3T7VA 2V5LA 3O6YX 2ZRUA 2R91A 3NPWA 3M5VA 4AF0B 2I1OA 4X9SA 2CW6A 5F4WA 2V30A 2CLEA 1DORA 2AQWA 3GZ3A 3QW3A 4DQWA 5IBXC 2NLIA 4O19A 4ML9A 4XTDA 3PM6A 1XDLA 2ZTKA 3DAQA 4XQ6A 5D37A 5LKYA 5LNRA 3NQ6A 3C2EA 5AC6A 4O1AA 1SSGA 1SQ7A 4DPQA 2I9EA 2V0TA 5IM51 3LHWA 3LRMA 4MY8A 2OJPA 5FF2A 3NYZA 5K2ZA 1XBXA 3L65A 3QC3A 4MKNA 1XCFA 1LP6A 1XBYA 1SFLA 3UY8A 6TIMA 2EHHA 4NUWA 5D32A 1YADA 2O7SA 2WQPA 5EKYA 1FCVA 3BK0A 3JR2A 3SI9A 1EEPA 1EP2A 4CNNA 2V2CA 4O53A 2Z2UA 3TA6A 3O05A 4KFPA 3W9ZA 4JIQA 3STEA 4Q33A 3CC1A 4WY0A 4HKPA 4AXKA 5D30A 3PG8A 2WKJA 4X3ZA 3W2MA 5K3VA 3L68A 2E5BA 1ME8A 1NF7A 4TO8A 3INPA 3PUDA 4IWWA 3L9CA 4K8HA 4UTMA 2A7PA 2CZEA 4MOZA 2ZRZA 4M6PA 1TJRA 5FESA 1QPOA 1TCDA 3M6YA 5DY3A 1KFCA 4OQVA 3DI1A 4DF0A 1EWEA 2A2IA 2NXHA 2Y88A 1R2SA 2I14A 4M19A 3NQGA 3H54A 4LUIA 3PBUA 4K39A 5F1VA 3NQCA 5DXYA 3LTPA 3O15A 4XWUA 3N14A 5G4WA 1UCWA 2R14A 2YSWA 5FEXA 4UCGA 2A6LA 5KZDA 4KFNA 4FEZA 2CZDA 5KZMA 5C5YA 1F74A 1LORA 1L2UA 4WX2A 3UQNA 2LLEA 3FKRA 4NZFA 5L6UA 5H91A 4DXVA 1TPWA 1YXYA 1ZHAA 3TQ0A 5CZJA 3RLUA 3Q94A 3MYPA 1OK4A 3LCIA 4RLIA 1IIHA 4IMFA 3LCXA 4WJEA 3RK8A 1HO4A 2HTMA 3G8RA 2FPTA 4JTGA 3LCGA 3ABRA 3S1WA 5LHFA 4GUHA 2RDUA 2BXVA 2PE4A 1AW5A 3NM3A 4PFMA 1VYRA 3BGGA 1JQVA 5BNKA 4LV9A 1FBAA 1ZJIA 1H7OA 1NVMA 1FDYA 5KZEA 3W7EA 1AW2A 4WQ6A 1FX6A 2E5DA 3W7PA 1QDSA 4JTHA 2JGQA 2DU2A 2W6RA 3R89A 4ZQCA 5LHEA 3HPSA 3TSBA 2VFGA 3EKZA 3JS3A 4K7VA 4O50A 2VFHA 3S6DA 3HJZA 2WSQA 1KM6A 3D0CA 1OF6A 3DFTA 3MP3A 2NUXA 5HWMA 3LB0A 1EUNA 5ABTA 4MIMA 1VYSX 3HGSA 2PRLA 2TMDA 3TQVA 3S42A 3GR7A 4CCDA 2E6DA 2YW4A 4OE7A 2NX9A 3G3MA 1O4UA 4NZJA 1YXDA 2E77A 2Y63A 2DZXA 4FXSA 5HUOA 3C2FA 3NZ1A 5BOOA 3M9YA 3P5ZA 1ADOA 3IVSA 5HJLA 2ZRYA 3W7JA 1WDWA 2QCLA 3A21A 4UTTA 1K8XA 4XTIA 1B9BA 5U4NA 4JDYA 5C55A 1G4PA 3L2IA 1W5MA 1W5OA 4LVBA 3OEXA 3QRHA 5AYYA 1RV8A 2YCEA 1I2OA 1QPRA 4JNMA 2WSYA 1DJNA 3CIWA 5FEWA 4LWWA 4GBUA 1JCMP 3EX4A 3GAYA 4UMBA 3M5YA 1X6UA 3BLIA 1UUMA 4HNTA 3O63A 2NV1A 2QCDB 2X16A 3NQVA 1S5WA 4ALDA 5CPNA 1LCOA 1LOQA 3G22A 2C13A 4FIRA 4OHQA 1OX6A 3CWOX 1YLVA 3CTLA 4NU7A 1I2QA 3M0ZA 4IX0A 1ZAHA 4QJ1A 1KFLA 5CZ0A 2Y6ZA 1VRDA 3OVPA 3EXSA 1FWRA 3BW3A 3GAKA 1SO5A 3W23A 1KFBA 3KVMA 2Q3RA 1TV5A 2GQ8A 3L0KA 3MHFA 3QZEA 4PL1A 3WK2A 1X7FA 2QUUA 3GIYA 3WJSA 4LUJA 1F76A 3QM3A 1QOPA 1H1ZA 3ANYA 4LVGA 1HG3A 1X1ZA 4JN6A 3S0CA 5FF4A 3NL2A 4LC8A 1ZAJA 1VYPX 5I3GA 1N8FA 5GVJA 4DO6A 4EWND 1GZGA 5G1TA 3C3NA 3GLCA 4RK8A 5G2WA 3R2GA 3KRZA 1SUXA 1EIXA 3W87A 1GVOA 4RKAA 3SFKA 3B0VC 3F4NA 2X1SA 1SPQA 3UWWA 1K7EA 4O13A 1YTEA 3BG9A 1JULA 5BRBA 4ZVJA 4IMGA 3EWUA 3TIMA 3W2KA 2R8WA 1Z41A 1KM1A 3LBMA 4H4IA 1LM1A 4AVFA 1TPEA 1U5JA 3P8JA 2QUVA 3AO0A 5AC7A 2F84A 4WY0B 2G97A 5AHLA 1PIIA 3HB9A 4GFSA 1VLIA 4B5NA 2H6RA 2BSLA 1TTQA 3HG3A 1Q45A 4ZMGA 3CU2A 4JEQA 4N4PA 2P1FA 3ZS4A 1OYBA 2ZZ2A 1TRDA 4NJJA 3W7HA 4MY9A 1JQXA 5DLCA 1F2JA 5AFDA 3DHFA 2NXIA 2QCNA 3WJZA 4DF2A 2VFEA 3NL6A 3W1NA 4BF9A 3S1VA 1FXQA 4UMCA 4O17A 4IXXA 1EWDA 3PUEA 2ZTJA 3W76A 1ZFJA 3STGA 1OYCA 1J2WA 2ZBTA 1LBFA 2CLIA 1KBJA 3G3DA 3WK1A 3KX6A 1SW3A 3ABSA 2BZNA 1W56A 5F4SA 3G1AA 1DQXA 3PULA 2PCQA 5K9CA 3TQKA 3GXNA 4C1KA 1OF8A 4UNLA 1A5SA 3LRLA 4GJ1A 1U83A 4WXYA 2HS8A 3O6CA 4U28A 2DJXA 1A50A 4JIPA 4UFMA 4AHOA 1JRCA 5TBOA 4IGHA 2J9YA 3GDRA 1W3IA 3M5XA 1G4EA 4BWLA 1DL3A 2V5BA 5CPLA 1IXOA 5LNWA 2NUYA 1FWTA 1EUAA 3MMTA 4M6VA 2Y7EA 2ZZ7A 2WOQA 4JTSA 4JTUA 3TJLA 1PHWA 1XI3A 3O6DA 4LVAA 1W5PA 2ZZ4A 3F4WA 3NQMA 3PG9A 3W74A 3UPBA 1FCBA 4KKXA 4M7TA 3TNOA 3EWWA 1R47A 3TMLA 1S5TA 3DI0A 5EA9A 3NL5A 1R2RA 4FXRA 2Y89A 4MPQA 3UYCA 4AH7A 2CLFA 3LRKA 1I45A 5FI8A 4HN4A 2JKEA 4BI5A 5AN7A 1GPWA 5LGZA 1M5WA 3GB6A 3OVQA 1P4CA 3NPVA 1BWLA 4LS1A 1SU5A 5AB3A 5K9DA 5BMXA 1OG0A 4S2CA 1ZCOA 3TAKA 1WXJA 3A9IA 3UNDA 1VPXA 1OFQA 2OZ0A 3VKJA 1K03A 1EP1A 4JDBA 3M5ZA 3LI1A 1DQWA 3T44A 2JK2A 4CLMA 3T40A 4JTTA 3MUXA 3M43A 5EL1A 2DZPA 4UFKA 3CEPA 2ISVA 4BI7A 4Z0JA 1BEUA 3B4UA 1UBSA 3UWZA 4Z1CA 2GQAA 5I3FA 3VNDA 3NQDA 3P81A 4FO4A 4EF8A 1R46A 1OFOA 2Z0IA 2QR6A 2Z6JA 3QH2A 3W86A 3A23A 1NFBA 4UIOA 4CQAA 3TROA 3THQA 4PH6A 3GXPA 2F7FA 4EVZA 3FOKA 1KFKA 1SW0A 3GKAA 4O8RA 4O10A 4Y9AA 1L6SA 1BTMA 1TMHA 4K7YA 5DCBA 1C9DA 1JJKA 3EXRA 4UTLA 1L9WA 4LNYA 2X30A 3NAVA 4Z1DA 3SR7A 3BARA 2B7OA 4KWWA 4IQLA 3U6WA 3LX9A 4IMDA 2VOMA 3HBLA 3UWYA 4FX8A 3W72A 3W73A 1G4SA 2C19A 3S5NA 1Q6RA 4NJGA 2E09A 1H7XA 4RZ5A 4UTHA 2A85A 4KWVA 1JR1A 2ZQ0A 4HNVA 1VCVA 4IJBA 1GVSA 3VE7A 1H50A 4JTEA 4CCEA 2C0AA 1TQXA 3M47A 3TC6A 1VHCA 2UV8G 3GNNA 4RZ4A 4IXHA 3S5OA 5HWNA 3NQFA 3IVTA 3MJYA 2R94A 3EWZA 3SIZA 5G2IA 5EMUA 1OFBA 1PL9A 2A4AA 3LV6A 2A6NA 1PHQA 3CLMA 4JS3A 1OX4A 2E6FA 5E93A 3SZ8A 3R5EA 1VS1A 3MWAA 4JTFA 3NR0A 4UTIA 1TJPA 5AC8A 1YXCA 2P0OA 2YW3A 3G0UA 1SZNA 2J9ZA 4PL2A 1DKWA 1HUVA 4MLRA 3BVJA 4O54A 3G0XA 4MZ8A 5DXXA 5K7JA 1OFRA 2GUUA 3QEZA 5HNRA 1W5QA 3QYQA 3LERA 4K38A 5CPOA 4AWSA 5CGQA 2QDHA 3IGXA 1Z44A 1K7FA 4JR5A 3STCA 1THFD 4NJKA 2GJNA 1FUYA 1RQHA 1WV2A 2CZ5A 1GG0A 3S9YA 2ATMA 4I7UA 1P1XA 3FKKA 4GNJA 4RX0A 5FF3A 3WJXA 2PRHA 5FF7A 4GWEA 3G1FA 1OHLA 3N2MA 3LCFA 1W3NA 3P7YA 5CZSA 4O28A 1TPC1 2B7NA 1JCLA 3QF0A 3I7RA 1FWWA 3Q58A 4LRSA 3EWYA 1LOSA 3S1UA 1KTCA 3KOFA 1F5ZA 3PR2A 1PV8A 4N9BA 3NZRA 2XFWA 6ALDA 1S5VA 1DOSA 2ZDRA 3B06A 2CLLA 2C16A 5A5WA 4A2SA 2E6AA 4Q4KA 2C14A 1RZMA 2QJGA 2E1DA 3NXFA 1I2RA 3C2RA 1J4EA 3HOJA 4GXMA 1AW1A 3DGRA 4OGZA 1HO1A 3T78A 1S3HA 1H1YA 1TPFA 2CLOA 4O16A 1PCKA 3W1AA 5K4XA 3OIXA 3R12A 3T4CA 3W71A 3CPRA 2V2HA 4E0CA 1KLZA 4XKYA 3QMSA 2OX1A 2V81A 1H7NA 2WV8A 3DFQA 3CIXA 4UMAA 3W1MA 4BFAA 2X2GA 3R13A 4MZ1A 4XZ9A 2VFIA 1OFEA 1J5TA 2FB2A 5D2XA 4GUFA 4P2VA 4JD4A 2QCFA 3VCRA 3H55A 1OX5A 3UWQA 3HIJA 3W7NA 4K6AA 3NL3A 3LTYA 4NVTA 3C61A 4UTTC 2YFOA 1NEYA 3SY5A 1E51A 3WFAA 4WUIA 1MEWA 4RXFA 1IXPA 2VXNA 5HMSA 4FNRA 1TSIA 2E68A 2FDSA 1GTHA 4UNKA 2CLKA 2B7QA 2RH9A 2GOUA 3G1HA 2H3BA 2PC4A 3M41A 5AYZA 1D3HA 2JBMA 5DCDA 3KVJA 4D2JA 2G95A 4LU0A 5D2WA 2WNQA 1YYAA 4AWUA 1JCJA 4N2YA 1RQBA 2O7QA 2XN0A 3L5MA 1C8VA 1GWJA 1LLWA 1I2NA 3S5YA 4ZQPA 4PTNA 5D05A 4RV8A 3E9AA 3L0NA 3PBVA 1KFEA 2DZSA 4H3DA 2J27A 3TSDA 1XL9A 1TRIA 4O0KA 2ZA1A 5F2LA 2CZFA 3W3OA 4ZQNA 4HPXA 4JX6A 1TB3A 3YPIA 5HUPA 1PVNA 1B3OA 4N6FA 2QCHA 1WOBA 4UFIA 3C52A 3K30A 4O1DA 4LY8A 1CI1A 2Y62A 2QUTA 4O1CA 1ZY9A 3UZ5A 1GG1A 2FLIA 3W7KA 3EX1A 3QW4B 1VCFA 1RR2A 3G1DA 3G18A 3LM7A 3P80A 4YWIA 1OK6A 3A24A 4I9AA 1VCGA 1OYAA 3C8FA 4LOCA 1CX9A 3LXBA 1LLZA 2WJZA 4TX9A 5G2HA 2GQ9A 3UWVA 5EYWA 2YYTA 2W79A 1MEIA 1ALDA 2WPBA 3TU9A 3DKLA 2ISWA 3C2VA 3PVFA 2C3ZA 4DBEA 3W1QA 4ZQOA 3AJXA 4LS0A 4OT7A 5AYXA 5F1UA 3N19B 5LZLA 1A5BA 3BG3A 1K3UA 1SW7A 1NSJA 1W5NA 3IGUA 3BW4A 3CB8A 3BLFA 1XM3A 3SW6A 4JX5A 1EP3A 2HSAA 2OT0A 1JUEA 5G5IA 1GVFA 2BLEA 1OX4B 4A22A 3N9RA 3W7DA 1H7PA 3CEUA 1IXNA 1D9EA 4EF9A 4LC6A 4U4MA 3UZJA 3Q37A 2G5WA 4N6EA 4FNTA 2XN1A 3QQ0A 1KM3A 1R30A 5K4ZA 2GVJA 3DU0A 1G4TA 1EX5A 4Z0SA 1SO3A 3UY7A 4CNOA 2WSRA 1TV7A 4Z08A 3RNDA 3L5LA 4RCXA 1OFPA 1QWGA 5A8GA 1TTJA 4UTUA 3Q2DA 2YFNA 3TKFA 2B0MA 2Z1BA 5J5RA 3HPXA 4JX4A 5DCEA 3C6CA 4YLWA 3W1UA 4EOUA 3NQ7A 1EB3A 4ICNA 3W7LA 1ME9A 1OVDA 1W1ZA 2QAPA 1YTKA 1IIGA 1B4KA 4BWLC 4FB7A 2VFFA 3DH7A 3NQ2A 1VGAA 1GVRA 5EY5A 5BW6A 2NX1A 2JKPA 3G1SA 1LRQA 3PUOA 3MBFA 4JTJA 1JCXA 1UB3A 1GJPA 4P61A 1FWSA 2TYSA 3LCWA 1DVJA 3W1PA 5H2ZA 3CWNA 5L9FA 2VKZG 4N02A 3N3MA 2H3DA 3W88A 2A21A 2YR1A 4YXGA 4UC5A 3TC7A 4E38A 1KV5A 1ZNNA 4LS2A 1KV8A 2J24A 1ML1A 3C2OA 3DFSA 1HTIA 3CM4A 1SSDA 3VI2A 3FYPA 1QCWA 1FXPA 1BKSA 3PBWA 4XKYB 1KM0A 4QITA 4GRSA 1VC4A 4PC8A 5HQEA 1LDCA 4R7JA 4H6KA 3DFPA 1A5CA 2Q3OA 5DN1A 2Y85A 3NPUA 5KSWA 4IPIA 3OVRA 4BI6A 5F4XA 3BW2A 2TPSA 3IIVA 1MO0A 3KXQA 3QSRA 2ALDA 3IEBA 4WY0F 3G24A 2FB3A 4ZZ9A 5AHMA 3MYOA 3TE9A 1JVNA 1A5AA 1QAPA 4POCA 3B04A 4Z1BA 3TCEA 1LBLA 4IMCA 2C18A 2VC6A 3V75A 3LV5A 3GDMA 4A3UA 1O95A 2QCEA 3I65A 2DZUA 3PC0A 1OFDA 4QQ3A 4A2RA 2YGYA 2H8XA 4HIBA 3THAA 4NNCA 1ME7A 3P82A 3DFOA 5I3HA 4UR8A 2CFFA 2FQIA 2ZZ6A 4K36A 2A7RA 2QDGA 2QJIA 5DBTA 1B4EA 3GK0A 3W1TA 3W7OA 3GR8A 4BK9A 3W7CA 2ZYFA 4JY9A 2HMCA 1AMKA 1K7XA 3N9SA 1X8FA 3VE9A 3IIPA 4S2BA 2ZZ3A 5HR7A 3DHDA 4QIUA 4GUGA 2Y7GA 2YXGA 3LBCA 1TIMA 3LDVA 3HQ1A 1WBJA 2ISSA 3IIXA 5C6MA 1SZFA 1C29A 1P0NA 1TYGA 3PF3A 2IQTA 3P5YA 1Z48A 4NQ1A 1H63A 1LZOA 4O1BA 3E49A 4FIQA 1WX0A 1W54A 1TO3A 3ABQA 4LVDA 5J5DA 4DPPA 4A21A 1XXXA 3PS7A 1G67A 1WQ5A 3O8AA 4N4QA 3W7RA 5LGXA 4JTKA 4W9TA 3DXIA 3ZFHA 4M5PA 2PRMA 3NQ8A 4IOTA 4Z1AA 2RDTA 3UXAA 1TPDA 1KM4A 4L4MA 1QOQA 4JTIA 5CSSA 1BWKA 3OG3A 3ATZA 1I8JA 1ZENA 2FFCA 3LHYA 1XUUA 1GT8A 1Q6QA 1G69A 5HWJA 1GEQA 4ZQRA 3BLEA 2D73A 3O06A 1QNVA 2OMAA 3DZ1A 2KZHA 4FX7A 5TQLA 4LW7A 5I3KA 1T96A 2E6YA 1K8ZA 1QO5A 4UTWA 4LTSA 4OU1A 4PCFA 2VEIA 1K8YA 3MP5A 4O15A 3W75A 3KRUA 5DBUA 4C1LA 2A1YA 5D04C 1VLWA 1PS9A 2EPHA 3E12A 3SGZA 4NX0A 3MP4A 3HMJG 4MUZA 3KVLA 4JGDA 1XFBA 4MZYA 3DKJA 1I2PA 3TXZA 2EF9A 2ZFAA 1H51A 3HG2A 1MXSA 1DJQA 5F2GA 3LXCA 3IRDA 2C15A 3PSWA 4RZ6A 1A53A 2J88A 1LTDA 4PODA 1WYIA 3CHVA 3CT7A 4MLJA 5D09A 1XKYA 4X22A 2QEZA 4DBDA 4UTKA 3G1YA 1QPNA 2NZLA 4ZQMA 1FY6A 4PEKA 4QISA 4RXGA 3FA5A 2QJHA 3IIOA 4IPJA 1LROA 2V82A 2Q8LA 2E5CA 3EKLA 2GJLA 1W37A 4O12A 1O5KA 3PBYA 3LLFA 5DY2A 3LHVA 5AHNA 2VFDA 2ATSA 2GPTA 1L6WA 3EWXA 3KAOA 3GDTA 1NF0A 5D2YA 3W22A 1WA3A 2FPVA 3L21A 1KM5A 4QM1A 4TMBA 1TPVA 1VJIA 3EWBX 3TH6A 3STFA 2BX7A 2VEMA 1V7YA 1EPXA 1KM2A 3KFTA 3P74A 3MW7A 3BV4A 3FIGA 3OA3A 2X1TA 3QMRA 2DZWA 1RVGA 2OT1A 3P61A 4NNAA 3QQ1A 1N7KA 5IBXA 4FNUA 5AHFA 4QAIA 3NOEA 2QCMA 5LNUA 3FJLA 5TIMA 2GVGA 1MZHA 4UXDA 2H90A 2OCZA 4YCPA 1H62A 1T8XA 4MY1A 3SGUA 3HPZA 4NX5A 3TX9A 2RDWA 3I6RA 3KRSA 1GYLA 5C54A 1F6PA 3KHJA 1VH7A 1T0OA 2JGYA 4CQ9A 3LCLA 3L5AA 1X1OA 3NPXA 4TR9A 3W2JA 3GKFA 3W84A 2NWRA 3HGOA 5LSMA 2FTPA 1N55A 3LLDA 3CQ0A 2DJLA 4G1KA 3S5ZA 1EA0A 3MBDA 3TFXA 3W7GA 3W70A 2EKCA 5LNVA 4WZHA 3O07A 1TPB1 3GX9A 4OV4A 2V9DA 3UWUA 2J9XA 4MJMA 3UPWA 2DZVA 1XBZA 1RQEA 4JXCA 3SECA 1FQ0A 1OABA 3E96A 4J9JA 4K37A 4HHPA 2FJKA 4O52A 1F73A 1XDMA 1W3TA 2VELA 3P62A 3M44A 4QSHA 2EGZA 3RFAA 2NX3A 3P8IA 2PURA 3L0GA 1XUZA 3W85A 3ABOA 3W2UA 1QR7A 4O14A 2YPIA 3LCHA 2AGKA 1SR9A 5D2TA 1CW2A 1H61A 3DFNA 4M7SA 3W1RA 3RLVA 1O5XA 3P60A 2YZRA 4NT0A 3NNTA 3B0UX 4WD0A 2QCCA 1ICQA 2WNZA 5CSRA 1YPFA 2Y70A 3WK3A 4OV9A 1M6JA 2TSYA 3O1NA 3PAJA 3A5FA 4CNPA 3TDFA 2AAMA 4HT3A 4O4VA 5K9XA 4Y90A 4NXKA 1H60A 4LVFA 3NM1A 5I3IA 5C2XA 3HG4A 4YL2A 1XC4A 5BMWA 3TW6A 2B4GA 1LOLA 3NO5A 3BPWA 4WOQA 4O11A 5CPMA 3E02A 4NXSA 3JRKA 4AHPA 2P10A 3NEVA 2FIQA 3U2OA 2G96A 5CKSA 2DZTA 4O4WA 5SWUA 1VHNA 1JUKA 1AL7A 4MJZA 3I7SA 4DO5A 2NUWA 3G1VA 4JY8A 1UJPA 3LHZA 1QPQA 2X1RA 3FFSA 1DBTA 4O57A 5E1QA 3P67A 4ADSA 3GVGA 2X1UA 4JYDA 5E0KA 3SJ3A 4FX6M 1JCYA 3NQEA 5D38A 1GTEA 3FYOA 5AHIA 4X2RA 3SSJA 3W1LA 3E0IA 2ZCGA 1RPXA 4RJEA 1HL2A 2EAWA 2ZA2A 4A29A 3O16A 3TK7A 4WOZA 1W8SA 1FCUA 1LBMA 2ZRVA 1L6YA 3OHIA 1O60A 2BTMA 1WBHA 2Y7DA 1QO2A 1ICPA 2CWNA 2QCGA 4L4LA 4MYXA 5AHEA 2YX0A 3TW7A 3I68A 3ZWSA 4E2BA 3QPZA 1AK5A 3FEMA 2C6QA 3BO9A 1OFAA 5G4EA 3MO7A 3B8DA 1TREA 4I7VA 1SO4A 2RFGA 3HG5A 3QFEA 4JTLA 1Y0EA 1QFEA 3EB2A 4FNQA 3HO8A
chains in the Genus database with same CATH superfamily
4TU1A 1GQNA 3W29A 4GYKA 1UH4A 4WVXA 4E2DA 1R3VA 2BODX 4FR6A 5JXQA 4HNNA 1F7BA 3K5XA 1F6KA 2ABBA 5M17A 4GE8A 3IGHX 4UOQA 3ATYA 1TPUA 4UFLA 1RA0A 3MHUA 3HU7A 1IT7A 1UUOA 5LXEA 4K8EA 3LTSA 4ENLA 1Y5VA 3CNYA 3OVGA 4FHAA 1DEDA 3RX4A 3TOPA 2UY3A 4C60A 1VQTA 1DJHA 5HPOA 2PEVA 1UP0A 3BJSA 1EXBA 1J9YA 2G50A 3P84A 3AWNA 4G6CA 3ENLA 5D8WA 4LANA 1UZ4A 4I3GA 1MXDA 2Z29A 4DO4A 1EA9C 3H2MA 4EE9A 4S3DA 1CGUA 3VOFA 2DORA 2ZUNA 4I6VA 4Q3MA 3CTTA 3K4WA 2CESA 1BF6A 1US0A 2VR2A 1I0BA 1YDOA 3S6OA 3BGJA 1FWJC 2PDNA 2OFJA 1JUBA 3WK0A 4JTRA 2A0NA 4Q8QA 4AZGA 2G4JA 1FCQA 1XQLA 2UY4A 4AHQA 2MANA 4D6GA 3NQAA 3BMWA 3MHGA 4HP5A 4JYFA 2ZX7A 1S2WA 3QMTA 4LB4A 4Q4MA 4V1YA 5CEWA 1HGWA 5FSDC 1AA1B 4DF1A 4QRNA 4URIA 2GVEA 2V8ZA 3E2VA 3NOYA 1KLYA 4FF5A 3TR2A 4ICCX 4DZ5A 5CBIA 1ONRA 3C56A 5I2UA 1FWNA 2JALA 3R0DA 3L4TA 1F4HA 1S5MA 2AMXA 1FDZA 4YMZA 2J6XA 2O9PA 1WZLA 2WVSA 4MG4A 3WDHA 4XSMA 2YYUA 1SFTA 3PY2A 4HOZA 2DIKA 2EPMX 1Q13A 2A3AA 2NV2A 5B7ZA 3RN6A 1E1FA 3C0QA 4J2MA 1P0KA 1X6NA 2WB5A 1PCWA 3AAMA 1YNQA 2V2DA 1R9XA 1BYAA 4HOXA 1WAUA 5CC3A 1P6WA 1F8IA 1NDZA 1PDZA 4GUIA 3BLPX 2E3ZA 3QXBA 3IVUA 1Q7ZA 4GIYA 1UKQA 4E4PA 3M7WA 3NGJA 4YCOA 1P5BA 3G0SA 4ZO6A 1H41A 3SCQA 2PDMA 3GG7A 1RJRA 1WCGA 4QE4A 3HTWA 1IXQA 3MUCA 5EPDA 1F3TA 2CLHA 5T26A 2QMJA 2CC0A 2RHGA 1OADA 1DIDA 1Y65A 2DY3A 3VGDA 2J7HA 3DBPA 4PMOA 3GVVA 3EPNA 3F1QA 1HJXA 4XAFA 3TTYA 1FDJA 3ELFA 1SMDA 1JXKA 3ITCA 1GOXA 3W1XA 4UTWC 3A4WA 1SZGA 4IFRA 3WLKX 5CC6A 3WH8A 3NDOA 3IIZA 3IJ7A 3S1GA 1E6QM 3GM8A 4IGNA 1VZWA 4EANA 4MFEA 4NI3A 4MNJA 7A3HA 3TTSA 2WNNA 3S1XA 1E6PA 2HRWA 4R34A 3VFLA 3HA1A 4LPCA 4FALA 3HM7A 1KBKA 1XYZA 7REQB 1JCNA 3F2DA 3CUGA 4AD2A 4PUJA 5LYRA 3P0WA 1KA9F 3UGRA 4MWAD 4QJ3B 1KFJA 2EPKX 4HSOA 1GYNA 1TKKA 2E1WA 4V28A 3RU6A 3UD6A 5EMYA 5CG7A 2YDAA 5JH1A 2NXGA 1UASA 2YXXA 4C6FA 3M0HA 3GFXA 5T8GA 1BLIA 4A8IA 2XN2A 3ICJA 3S8HA 1N8WA 4AWTA 1VBJA 1LL6A 4IT1A 4ATWA 5GJPA 2HROA 4D6JA 3MS8A 1JZ6A 3RX2A 4C6BA 3LGEA 4N9DA 3GU9A 2PWUA 3PSVA 3WJYA 2VZVA 3CAQA 3H4XA 4JICA 3PB0A 3RPMA 1V8EA 4W4QA 2WBGA 1ZBVA 2PSNA 1K02A 4W84A 3EXTA 1XJBA 5EBUA 1V3JA 1H7WA 2W0UA 4X61A 4IL0A 3KL3A 3B05A 3WBEA 2BXZA 1S3TC 2GK1B 3O6YX 4GFIA 1EL3A 2ZRUA 4WKAA 3VOJA 2XWEA 3LEPA 2I1OA 4ZO7A 1E72M 3H8AA 2CW6A 1QJWA 4M24A 2VX5A 3OGSA 3CJPA 1XDLA 2ZTKA 3DAQA 5LNRA 3NQ6A 4O1AA 1ISWA 1SQ7A 3LRMA 4GC3A 4ZB0A 2QDDA 2JEPA 4Z17A 1W3LA 1XCFA 3H2OA 2HBXA 1XBYA 1SFLA 3M0MA 2EHHA 3FSUA 5EKYA 3FV9A 3BK0A 3SI9A 1UQYA 1EEPA 2HNEA 5BWFA 9RUBA 5B7YA 4KFPA 4DIAA 3T4WA 4JIQA 2D69A 4WY0A 4EPDC 2ICSA 4Z2IA 4AXKA 4X3ZA 3LGGA 3BLLA 4AFYA 3L68A 2E5BA 3W0KA 4QDMA 4TO8A 1XH0A 3L9CA 1MDLA 1QTWA 1J0KA 4IIEA 2A7PA 4MOZA 1AUSL 2XZ7A 2PGWA 3N13A 3T2OA 4IFOA 3VGEA 1NOUA 1POKA 4J5NA 4M6PA 3PZUA 1DWFM 3U5UA 3VU2A 1FKXA 1TCDA 4L7ZA 1KKRA 1KFCA 4KRTA 4H9ZA 3VGHA 1EWEA 2A2IA 2GZXA 4OFCA 1M03A 1WXZA 3UJRA 3WF0A 3LG3A 2Z1WA 1FHDA 4JL2A 3PBUA 5F1VA 4AX7A 3LTPA 1UCWA 2INEA 2DT0A 1CWYA 3EOSA 1PUDA 2PDUA 4AY7A 2A6LA 2VDGA 4HK7A 5REQB 4PMNA 5C5YA 1B3VA 3I4KA 3FKRA 4ZOEA 4AY1A 5L6UA 3UP8A 2GJRA 4DXVA 3ONCA 4H7CA 5CZJA 3AALA 4RPPA 1EGZA 3DX5A 1OK4A 1IGWA 3GXDA 4ZCWA 5IOBA 2HTMA 3G8RA 1S5NA 4HA0A 3QVQA 1E5JA 3ABRA 1JZ7A 2X8RA 2BXVA 1AW5A 4LAMA 1JQVA 1VEPA 3UESA 5BNKA 1XYFA 1FBAA 1F9CA 4YS1A 1FDYA 5KZEA 1AW2A 2YCLB 4H9MA 5BXSA 1QDSA 2DU2A 1UR2A 2W6RA 1UZDA 1V0NA 4JTCA 3TSBA 2XGBA 3MCNA 4O50A 4YWSA 5GJNA 4PGLA 3HJZA 1KM6A 3D0CA 4CEUC 1OF6A 4NHVA 1VJZA 2CBUA 4S3CA 5AVHA 4MIMA 1W1B1 1XLEA 3GH7A 4GZ7A 1QNPA 2E6DA 2YW4A 2ZUMA 2NX9A 3G3MA 1NQ6A 3KOWA 1YBQB 2VRKA 5LA1A 3MCMA 2BNJA 4KRZA 4UTTA 3E2RA 4YTUA 2ZUWA 1DWHM 4S3BA 4LY4A 1W5MA 1R5YA 4U2YA 1EQCA 1QPRA 2WSYA 2XINA 1DJNA 3VGBA 4LWWA 5I00A 1V0LA 4CD5A 3IPWA 3FY1A 4GCAA 2QCDB 3TW9A 3TYDA 1EX1A 1S5WA 1OCBA 4WLCA 1LOQA 3MJMA 1NQKA 3D5HA 4FIRA 4GISA 4OHQA 2VC5A 2PC8A 3GW0A 3RCYA 1O5QA 1I2QA 4NY2A 4UB9A 5A6JA 1TUXA 2Y6ZA 1VRDA 3CK5A 3GW3A 3EXSA 4ZXOA 1IWBA 4XK2A 5HJYA 1BSIA 2Q3RA 3L0KA 3MHFA 6TAAA 3AIVA 1B54A 3QZEA 2X7WA 5GJMA 1K9DA 3GIYA 3M0LA 3IK4A 4LUJA 4J4KA 1F76A 2A3CA 2WCSA 7PTDA 1QOPA 4B5UA 4LCQA 1X1ZA 3NWRA 5M2FX 1ZPTA 4E2OA 4LC8A 1KWKA 3MDWA 5F7UA 5GVJA 1ZSXA 4IG2B 1GZGA 5G1TA 1KR0A 3GLCA 3GVWA 3HV8A 3SQLA 1GVOA 1ZTVA 3SFKA 1M04A 4O13A 4HNLA 3BG9A 2QV5A 1JULA 4ZVJA 2R8WA 4AC7C 1Z41A 5M5DA 5FOOA 4J3ZA 3GY1A 3SRHA 1U1UA 1V02E 3GH4A 2YIHA 1TTQA 2VR5A 2O0TA 4ECLA 4HHLA 4JEQA 1OGGA 3FX4A 1UC4A 3IUIA 4NJJA 1TRDA 4MY9A 5KZ6A 2YXOA 1Q66A 3VC6A 1F2JA 5AFDA 1DIEA 3N6HA 4B92A 3GG1A 4L65A 1FXQA 4G56A 4JIHA 4O17A 1EWDA 2ZTJA 3WYZA 1ZP4A 1OYCA 3RGTA 3WK1A 1ECQA 3B4YA 2ZUSA 1FH7A 4HQVA 1SW3A 3ABSA 4GPNA 2BZNA 4C5ZA 5F4SA 1G0CA 3M07A 3G1AA 2IPGA 3PULA 3THUA 2YKKA 5A2AA 3ORWA 4CKQA 2J6VA 4UNLA 4LAOA 3BAIA 2FHFA 4GJ1A 4WXYA 3O6CA 5BYWA 2DJXA 1KO0A 3GTNA 3V5CA 4JIPA 5HANA 1JRCA 3M5XA 1EC8A 4BWLA 1DL3A 4Q4SA 5T9BG 3DERA 1F6YA 1UKOA 2EEXA 1MQQA 1EUAA 3WKZA 4M6VA 3SEPA 4US6A 1E56A 1PHWA 3NSNA 1WUFA 2G37A 3PG9A 1XCXA 3R43A 3TNOA 1EJSC 3HN3A 5EA9A 4H04A 4B3KA 1ESWA 1I45A 5FI8A 1EJWC 3EB4A 3GB6A 3W24A 3OVQA 4KEZA 1P4CA 3NPVA 1JYNA 4JFWA 4LS1A 1SU5A 4QCFA 1OG0A 3GNRA 3QZAA 2FDMA 4D8LA 1VPXA 4PSRA 1CDGA 4X60A 4GI9A 4YYFA 2JK2A 3R0UA 4W5ZA 4JCMA 1KCKA 3W27A 1C92A 1Z3NA 2NQLA 1WE5A 3DIPA 3ZJ7A 1UBSA 3UWZA 4Z1CA 5CH9A 2YB4A 4XO6A 2E40A 1P7TA 1RY8A 4H9UA 5JBDA 1R46A 3AZRA 1OFOA 3IUDA 2Z0IA 3F4VA 4IIBA 3C0LA 2FMNA 4ATDA 5FACA 4U5KA 3AS3A 1XRSA 2OWXA 3BSGA 1HW6A 4HN8A 3TROA 1XGEA 2J7GA 2DUXA 3E1F1 2IKHA 4EACA 1TMHA 1NDYA 5CCZA 3ARUA 2WLYA 3CV1A 3R94A 4KWWA 2QW5A 4D1JA 4L80A 3LX9A 1D2KA 2V5JA 4AY8A 1KB3A 3W72A 1G4SA 3UG4A 2C19A 2ZC8A 5BOEA 3KWSA 1JF5A 3GNPA 4HNVA 4NAFB 1VCVA 2QZRA 2XUCA 2OR2A 3LLXA 2XISA 4PCNA 1CENA 1TQXA 1TWZA 3MSRA 3TC6A 2VM8A 4JQ1A 1XLDA 5HWNA 1AQ0A 2XH7A 1QT1A 4DO7A 4KEUA 3V36A 4UQ9A 3GHSA 5H8UA 2OELA 3WIJA 4LBSA 2J7CA 4B15A 3ARTA 4JTFA 3GU1A 4UZSA 2EG6A 4UTIA 1TJPA 2X1IA 3VDAA 1KWGA 4P7QA 4I9TA 4H9XA 4LYKA 3URNA 1DKWA 2EPLX 5DT7A 1A3XA 2WKLA 2IS7A 1OFRA 2J78A 1W1PA 4GVGA 5HNRA 1W5QA 3AI0A 4JZ5A 2XM1A 1QWKA 5DO8A 1GQJA 2I16A 2QGYA 3B8VA 3N6QA 2HK0A 2PDGA 5HK4A 1DWJM 4F2TA 2QDHA 3VIPA 3GNOA 4Z1YA 1THFD 4E4FA 2L5HA 4NJKA 2GJNA 4F0HA 3WLIA 1GG0A 4HJWA 2ATMA 1B1YA 4I7UA 2YCJA 1TR1A 1P1XA 3FKKA 4ZXLA 5A2CA 4GWEA 3G1FA 1UJQA 1H0GA 3MVIA 1TPC1 5A3HA 3QF0A 3I7RA 2GJXA 2X0HA 4QLLA 1FFQA 3RRXA 4D9PA 3KOFA 1L8PA 3CASA 1F5ZA 3PR2A 1PV8A 1XLHA 2NV9A 2GUBA 3CT2A 3BLOA 3V4BA 1YMYA 3VK5A 4FR1A 3EZ4A 2WCGA 3K4AA 2C16A 1AJ0A 2QJGA 3RLGA 1I2RA 3KW3A 4GXMA 1QBAA 1PB0A 3HOJA 1AW1A 1XH1A 4PEEA 3DGRA 4O16A 1PCKA 4YVVA 3ZYZA 3W1AA 5K4XA 1TR9A 2DSZA 2NQZA 2OX1A 3K1DA 3DFQA 4UMAA 1NJJA 3U4AA 4XZ9A 2VFIA 4JHMA 3WQGA 1J5TA 3EWCA 5D2XA 1B9ZA 3L4YA 4DAFA 3VCRA 4M56A 3UWQA 3W7NA 3LTYA 4PR4A 3C3UA 1RXOB 3VKKA 4UTTC 2YFOA 1GQLA 1NEYA 5G4HC 1LG1A 4J3UA 1MEWA 1NWSA 1CXIA 5GPRA 4RXFA 1IXPA 1TSIA 5I23A 4UNKA 1DJXA 1U2YA 4NIRA 2B7QA 1K4GA 4PMYA 1X96A 2GOUA 1LF1A 3G1HA 1DE5A 2PC4A 3KZSA 1PSCA 3NDYA 2G95A 2RGLA 2OU4A 3BICA 3L5MA 1C8VA 1GWJA 2AKMA 2QUNA 1I2NA 3S5YA 4ZQPA 3WX7A 3PZTA 3SGGA 1R3TA 1EF3A 2W5FA 2VZTA 1V3LA 1BF2A 3E9AA 5DMMA 4HYVA 4A4AA 1WKFA 5LIXX 1TRIA 2QGHA 4E5TA 4O0KA 1NP2A 4QXIA 3ITYA 4YIWA 1FWCC 3QGKC 4EP8C 1V6TA 5FA5A 2HZGA 3WNPA 4AU0A 3I6EA 3UG8A 3M6DA 3UZ5A 3TCSA 3UZWA 2FLIA 3W7KA 3EX1A 3QW4B 1JPMA 6ENLA 3ARXA 2PDKA 1VBGA 2REQA 1SFSA 1CX9A 3F5KA 2WJZA 2OO6A 2ZWYA 5G2HA 3CL7A 1PKYA 4L5ZA 1HJUA 4CQDA 3U2CA 1MEIA 4PUMA 2WPBA 2IKJA 3PVFA 2C3ZA 4ZQOA 3AJXA 4BQ4A 4OT7A 1C8XA 1UQZA 2QDEA 3BTNA 2DFAA 4LFYA 5CZKA 3CB8A 1Z9AA 3WG6A 1XM3A 3SW6A 5C9XA 2HSAA 1BGAA 1GVFA 3L4VA 3N9RA 4QFUA 2C71A 3VGGA 2G3NA 1D9EA 4LC6A 1EF2A 1XIMA 3K8LA 2OSWA 2Z1VA 3Q37A 4FNTA 2XN1A 4ZODA 1TV2A 5MKGA 1Q8AA 4U3CA 4DZAA 5A8GA 4DJDA 2AL1A 4ZA0A 2YFNA 5J5RA 1P6BA 4KESA 2C1GA 2XZ9A 1EYWA 3AICA 4JX4A 3VOHA 3N9KA 1S46A 1REQB 3C6CA 1MFUA 1FWAC 4G7EA 4Y9NA 1GHRA 4I5UA 4ZGYA 3GG8A 1YTKA 4BWLC 1EHAA 2DQWA 5I03A 4PYSA 1AQFA 1SJBA 5A8OA 4GO8A 3PFRA 3PUOA 3POHA 4DBSA 3D3FA 1FWIC 4G1NA 3P93A 1FWSA 3LCWA 3CWNA 3U48A 1FRBA 3N3MA 2HXUA 3MUAA 4HU4A 4I6KA 4IP7A 5HJXA 1KV8A 1VFOA 2J24A 3C2OA 3DFSA 2F9RA 2QLYA 4GIEA 1TJ0A 1HTIA 3BGAA 1RCXB 4UR9A 2OG9A 1QCWA 1BKSA 4XKYB 4A05A 2ZE0A 4GRSA 3T9PA 3ZT7A 1UROA 1D3CA 2Y85A 5KSWA 2ZVRA 4IPIA 5F4XA 4GQBA 4H9YA 4GYJA 1E4LA 3K8KA 4KGJA 4AZIA 3P6LA 3N4AA 3QYSA 3EOEA 5JBFA 5CPTA 3G24A 8CGTA 2P3ZA 1JAEA 3AIUA 3MYOA 1XDJA 5A6MA 3VO0A 1RALA 2C18A 4JQ3A 3SFWA 3GDMA 2WVVA 2QCEA 2DZUA 2YGYA 4H8NA 2CHRA 2CXGA 2DGAA 3P82A 3H6OA 3WBYA 3DFOA 5E0CA 2JE8A 2FQIA 2A7RA 2QDGA 3ANUA 1B4EA 1A3HA 2VQTA 4QS5A 3TN6A 3AIQA 4AD4A 1MW1A 4ZR8A 2YA1A 2D2GA 4GY7A 4AZ6A 2HMCA 4L4PA 3UR5A 3WY1A 2V69A 3DHDA 1KRAC 4GUGA 3RAOA 3GVRA 2YXGA 3LBCA 2R1PA 1WO2A 4R85A 1SZFA 1C29A 4RL3A 5EBAA 3ZLGA 3U57A 3MANA 1JZ3A 3TP4A 1QU4A 4D6CA 3M64A 1VEMA 2INFA 3F5JA 4A21A 1XXXA 1E1EA 3AU2A 1MQRA 1WQ5A 3O8AA 3VKAA 3MV01 4I90A 4XZHA 3ZFHA 4M5PA 2PRMA 3NQ8A 4IOTA 3WDIA 2PDHA 1WDQA 3VKDA 1DXIA 4Z1AA 2RDTA 1DJGA 2QPSA 2PDFA 3NJ3A 3UXAA 1QOQA 3QTPA 5CC5A 2GFTA 4DBWA 4Q7NA 1GEQA 4ZQRA 1CLKA 4BEQA 2D73A 1BVWA 1QRQA 3CXOA 2QQ6A 1J6OA 2E6YA 1XISA 1UMYA 1A80A 1K8YA 4HPNA 4O15A 5DBUA 2A1YA 2WWDA 3AXIA 2GWNA 2P0IA 4ZFCA 1PS9A 3SGZA 3HMJG 1XFBA 1F3XA 4GNVA 1TZZA 3TXZA 3OA5A 1FWDC 4QBXA 4Z2LA 3GFYA 3WD4A 3VD7A 1NY1A 3WENA 1F3WA 5F2GA 3E0VA 4PODA 3CT7A 9XIMA 5JH2A 4KRUA 3KBVA 2XVNA 5D09A 3ZMRA 4BKNA 2GOKA 4Y9PA 2CXEA 5HA7A 5HNTA 1K77A 4UTKA 1H11A 1QPNA 2NZLA 2J7BA 4QISA 3P0XA 2PDJA 2VWSA 1VFUA 4W7UA 1GHSA 1W1IE 4O8AA 4O12A 4C5YA 5AHNA 3GDTA 3A47A 2V3GA 5D2YA 3VNYA 4AVOA 1KM5A 4QM1A 4XZLX 3TH6A 1V7YA 1KM2A 3FIGA 2G3MA 3QMRA 2DZWA 1IT8A 2OT1A 2Z25A 3UZZA 2X40A 4PTDA 1OT2A 5IBXA 1XR2A 1I9CB 3JZUA 1CGXA 3WN6A 5LNUA 5DF0A 2VOTA 4YCPA 4GYFA 1DWAM 4WKHA 4ZO8A 3I6RA 2P8CA 5C54A 1MRAA 1EQPA 1VH7A 2JGYA 1UWTA 4GA8A 3NPXA 4TR9A 3RUBL 4CU8A 5LSMA 3TTOA 4AVNA 3S5ZA 3MBDA 3W7GA 3CH0A 4X2PA 4WZHA 4NL1A 1OB0A 2HPMA 1Q6FA 5EMLA 1UPPA 4C6NA 2YL6A 5C9RA 3O6AA 2V9DA 4DYEA 3OGVA 3QR0A 2VMFA 2DSVA 1UWUA 3SECA 2OKTA 3HMCA 1MMFA 4FSAA 1LJYA 3H24A 3AIWA 3P62A 3M44A 4L64A 2ZUUA 4AIUA 4F0KA 2PURA 2FVKA 1KCXA 3W85A 2VEFA 3ABOA 4GKLA 3TLQA 4O14A 3WMSA 2FTWA 1XX1A 3VCNA 1E73M 1VFMA 3WEOA 2R1NA 1RCOB 2YZRA 3KP1A 4NT0A 3NNTA 4PTXA 1E15A 4H8UA 5KETA 1SJCA 1M7XA 2TSYA 1H49A 4Z42C 1JD9A 3I4EA 1NH6A 4O4VA 1MUCA 4LVFA 4YL2A 2DVXA 2B4GA 1LOLA 2Z00A 1HNYA 3NO5A 5CPMA 3N2OA 3I3DA 4RNFA 3TYCA 1M9HA 1A47A 4H2CA 4AHPA 3SSZA 1KCZA 2GGIA 5SWUA 3EMCA 5BXPA 4EAYA 4CN4A 4I9JA 3ZZ1A 1KGXA 3W28A 1DBTA 1PWMA 2X1UA 4W8AA 3NQEA 3E6EA 5D38A 4EPKA 3URQA 4KCWA 3RCNA 1XLKA 3TA9A 7REQA 3E0IA 2WSPA 2Z7GA 4RJEA 1RPKA 1HL2A 1JNDA 3PP7A 1XH2A 3BAKA 1FCUA 1QI2A 3QC0A 3OTRA 1W17A 2KX9A 1WBHA 3UETA 2QCGA 1EO5A 1XG4A 4L4LA 4R27A 5AHEA 3I68A 4LGXA 1KFWA 3ZWSA 3R4IA 1OCJA 2HXTA 2C6QA 3L4ZA 1UWSA 4EKJA 3TZNA 1TREA 3GHRA 4GZJA 3HG5A 1BYCA 1CYGA 4E6MA 3KP0A 4NJHA 1DHPA 3TMQA 2VQUA 1LWIA 4IMEA 3EEGA 1S2CA 1KW1A 4DJEA 1XLBA 1KBIA 2BHZA 3CUJA 2VRJA 4GKTA 1PE1A 2GK1A 3U3HA 3UCCA 2WMIB 3G1XA 1SZEA 3TOYA 4CCCA 1WUEA 3FSTA 4Y96A 1ZP3A 2R1LA 3R1ZA 2DSWA 2FZNA 4XVEA 3QV8A 3SDOA 4XBKA 1ENUA 1IEWA 5I3JA 1V5XA 3RMEA 2F6UA 1RLDA 3M16A 2H9AB 2YL5A 3HGJA 1AQHA 4ASTA 1AL8A 1TE6A 4GIAA 3WH9A 1E55A 3NO1A 8TIMA 4DY1A 1IT0A 1E0VA 1B2YA 4ORMA 4D6IA 1TTPA 4GGBA 3MI6A 4GJJA 1LL4A 4HA1A 3TYUA 1I0DA 1KTNA 4J3WA 1H5YA 3VDGA 2HS6A 1W9VA 4H1ZA 5D2VA 1DV7A 5D02A 1YPIA 3WJWA 3CUIA 5BRPA 1G9HA 3VM5A 3TAOA 1YE6A 3A5VA 5MHBA 2J47A 1VAHA 4CVUA 3KVKA 4XBSA 2FVLA 4MNLA 1HL9A 2VHLA 3M46A 1E9ZB 5I79A 4EIVA 3KM8A 4UTJA 5I09A 3S5SA 2GL5A 2V5KA 1HJVA 1GVYA 2VDIA 3GDKA 1R3WA 5LNSA 1XP3A 3RO8A 1GZJA 4QG6A 1QI3A 1A0CA 2Z6IA 1Q2RA 2POTA 3BAXA 5A2BA 5REQA 2GVLA 1ICSA 3W07A 3AHVA 1OGSA 5A8NA 3TUUA 4Q32A 3U5YA 3VD4A 2PWFA 1VR6A 3EDJA 5TAOA 3WNMA 3M1ZA 1F8MA 2HE5A 3PB2A 1TQJA 3B9OA 2V63A 4JYEA 2Q8ZA 2O92A 5A6AA 5FEPA 4MYAA 3TYEA 4M6QA 3GBEA 1QI5A 4W86A 3NYDA 1ZUAX 3HF3A 1H3GA 4JTQA 2ABAA 5BRQA 2P3EA 1NIUA 1VIWA 1YDVA 2V68A 4TVUA 2C0HA 2E9BA 2YCLA 4JNYA 4V1XA 3CWHA 2F2KA 3BZGA 3GYEA 4R9XA 1WZMA 2R9RA 5IDZA 2XSAA 4RR4A 4DNHA 4C6PA 4PMJA 1CLVA 4X0VA 2POZA 2VENA 3CZGA 5F2IA 1E0TA 1LYXA 4M3PA 4R9OA 5A6SA 1A3WA 4O0ZA 3UJSA 3L23A 2J75A 3U8GA 2FZMA 1AH4A 2PU0A 4IGMA 1HKVA 1YBQA 4X9YA 3RITA 1RH9A 3S2LA 3RIKA 3W25A 4L9YA 3L2MA 1XF0A 4N9EA 3SUWA 4AEOA 3DENA 1WDDA 3W2LA 3OPSA 2ACRA 3GS6A 4PBGA 1TA3B 4ADUA 2ACQA 5JUVA 2QCDA 3SADA 3GXIA 4NZCA 1W2PA 3VIIA 1H0IA 4F0RA 4O1EA 2XIMA 2DW7A 1KRCC 1PYFA 5HULA 2IPJA 1KTBA 3G8EA 5DMLA 2PD9A 1X7IA 4FNPA 5A94A 2WZTA 4IH3A 2G3IA 2VC7A 4XAPA 1PZ1A 3XINA 1ZBKA 2CU0A 1ITCA 4R7WA 3OZOA 3WQDA 1KXQA 3WLQA 3NSMA 1Q3NA 3SIMA 3K46A 4NNBA 3MVTA 3T7VA 2V5LA 1B3XA 1UR0A 2PTYA 3NPWA 3WMLA 3M5VA 4AF0B 1W9XA 4G2DA 1EZWA 4DZIA 5F4WA 2CLEA 4DQWA 3BLKA 3KCJA 2OWWA 5IBXC 4JAWA 4D6DA 4ML9A 4XTDA 4XQ6A 5D37A 5LKYA 1SJAA 4IG2A 2XYLA 1P0DA 2I9EA 5IM51 4MY8A 1KQZA 3KLLA 5FF2A 1HP4A 3NYZA 4A8RA 5K2ZA 3L65A 4QJ4B 1ITXA 3FAXA 3GC2A 4TTUA 1YADA 2WQPA 2AGTA 1WDSA 3GYCA 1EP2A 4CNNA 5FJIA 1QW9A 3PUGA 5FJPA 1WKYA 1C9WA 2Y24A 4HKPA 3W2MA 3DECA 1U1HA 2DT3A 1RBOB 1CXLA 1BXBA 2XHYA 4UTMA 2QYGA 1WPCA 2BMBA 2XIJA 5BXRA 4IP5A 1ZS2A 3SCOA 1ZBCA 5FESA 4HMCA 2PBOA 4XZMX 3N12A 1QPOA 1S38A 3EA3A 2PLJA 3UG3A 3SN1A 4OQVA 3DI1A 1TE1A 1J79A 2NXHA 2Y88A 2I7GA 1DXEA 3NQGA 3N18A 4MHBA 5IHSA 1R3YA 3NQCA 3EAUA 5G4WA 4XWUA 2YA2A 1GQKA 1WXYA 4IF2A 1EGVA 2ODOA 3QGAC 1V77A 1LORA 4WX2A 4WDUA 4B5TA 3T6CA 1YXYA 1ZHAA 3ZJ6A 4G8TA 3RLUA 4UZUA 4HNOA 1W3JA 4RLIA 2D3NA 4QROA 4J7RA 4IMFA 4JTGA 5AZ0A 3GIPA 5LHFA 4FLSA 2WC7A 1UZ1A 2OOFA 3NM3A 1VYRA 3BGGA 4LV9A 3A4AA 5CG0A 1NVMA 4WQ6A 2UBPC 4HJFA 4JTHA 2JGQA 5E6ZA 4ZQCA 1V0MA 4HSHA 4H9TA 3KRBA 4LH8A 3JS3A 5DRCA 3S6DA 3MT1A 1RK5A 2GSHA 1O5RA 2OZTA 3DFTA 2EKGA 1J96A 3GR7A 1R3SA 2E8ZA 4NI8A 4CCDA 3SN4A 4J35A 3UF9A 4NZJA 2Y63A 4LF2A 1GKQA 4FXSA 4DNMA 3NZ1A 3M9YA 2QCLA 1XLMA 3A21A 1K8XA 4XTIA 5U4NA 4DJEC 2OSXA 5C55A 4GQ0A 3BCJA 1FWBC 4LVBA 3QPEA 2YCEA 4JNMA 3KL5A 3CIWA 5FEWA 3ZVHB 4GBUA 1JCMP 3VVGA 2W4XA 1ADSA 4LCRA 1CZ1A 5CGTA 4XZBA 3NQVA 1BYDA 1FWFC 3HURA 3TTEA 2XSXA 1E4MM 2OOGA 2OVLA 3C8NA 3M0VA 2I5QA 1Q85A 4C6EA 1YLVA 1I1WA 1KXTA 1R38A 3M0ZA 5ECVA 3HZ3A 4QJ1A 2ZUVA 3KLKA 4GACA 4NAFA 3OVPA 3RLHA 3V0UA 1FWRA 3BW3A 1KFBA 2DUZA 4UOJA 4KGLA 3FXGA 4PL1A 3WK2A 2QUUA 4HK6A 4DJDD 4KCTA 4GG9A 3QTGA 3AMDA 3ALFA 4XZWA 1H1ZA 4UQEA 4LVGA 3QHNA 3VDBA 1K9FA 3ZJKA 4C6CA 3KBSA 3S0CA 3NL2A 1N8FA 2VVSA 2I17A 4OTKA 5CC7A 3N2CA 2CHNA 4RK8A 3RO6A 2YDQA 2A3HA 4PUUA 2BS9A 3KRZA 2ZUTA 3IS4A 4YTTA 4RKAA 3A12A 1SPQA 2VCBA 4M0XA 5E9AA 1K7EA 3M0KA 4W8BA 1K6AA 4P8VA 4IMGA 3EWUA 4KWOA 2CETA 4PTMA 3RDKA 4DXKA 3F4CA 3RJYA 4RE4A 3WLHA 1Z32X 4AVFA 1U5JA 3P8JA 1IR1A 2QUVA 3A3WA 2F84A 1BSLA 1AZ2A 1L6GA 5AHLA 2DZBA 5LA2A 4GFSA 4CN6A 2BSLA 4RDYA 1Q45A 1TZ7A 4ZMGA 3CU2A 1A0EA 1CGVA 1PX8A 1RSCA 4GQGA 2ZX5A 1RY0A 4GLEA 2QHAA 1OYBA 2ZZ2A 3W7HA 3P2VA 2BY2A 1MNZA 1XLFA 1JQXA 1MXGA 2BFGA 5ECUA 3IV8A 2NXIA 2QCNA 4YHEA 1BTCA 1EOKA 1E43A 5T91A 3QN3A 4CCZA 4QEHA 6A3HA 1TV4A 4IXXA 1JDEA 1HJQA 3FJNA 3WLRA 3PUEA 2PGFA 2ZBTA 1LBFA 3KX6A 2HEJA 3PHAA 3RM9A 5DX7A 1W56A 5C9ZA 2PLCA 3ES8A 5LIUX 3GXNA 2PWVA 1OF8A 1L8NA 4DM2A 3LRLA 1U83A 1VBUA 3MDUA 1TELA 2HS8A 3IJLA 1A50A 2DIJA 4HZMA 4AHOA 4ZE4A 4IGHA 4JNZA 2J9YA 3CAVA 3GDRA 3THDA 1W3IA 2ZX8A 3LMZA 5E70A 4C90A 2NUYA 3WLLA 3QLLA 1FWTA 4WIWA 3WELA 6REQB 1SVDA 4D6FA 2WAGA 4JCLA 2WOQA 2OSYA 1QHZA 1GJWA 4AIOA 3O6DA 4LVAA 1W5PA 1IWAA 2R1MA 2ZZ4A 3F4WA 3NQMA 4AXNA 1J5SA 3W74A 1R47A 4AG0A 1S5TA 3DI0A 4K8GA 3EDDA 3FAWA 3NL5A 5CLTA 4LEFA 2DT2A 2BB0A 3OHMB 3LRKA 4BI5A 3NZGA 3GH5A 3KTXA 2ZC1A 3LZ3A 5AB3A 4M1RA 1R9ZA 4FXJA 2VJXA 1ZCOA 3TAKA 3BLDA 3UNDA 2VEGA 1K03A 1EP1A 4S3AA 2VX7A 2XVPA 1DQWA 4KMQA 3T40A 4JTTA 2WVTA 5JU6A 3MZNA 1O66A 4QX4A 4UFKA 3CEPA 4WR3A 5D9NA 3O3RA 1UKTA 2Y4SA 1X6LA 4GXPA 1V02A 3BAWA 3K8MA 5HMFA 2QR6A 2VGGA 2Z6JA 3TC3A 3QH2A 3W86A 3VDCA 2Y8VA 1NFBA 3B8WA 4CQAA 3S4TA 4B3ZA 1QK2A 3GXPA 2F7FA 4UQDA 3FOKA 1KFKA 3GKAA 3WFZA 1TWWA 1L6SA 1BTMA 4K7YA 4A3YA 5AY7A 1OEPA 4L1GA 3EPOA 3CUFA 2X30A 1L6FA 4DUXA 2G0WA 1J0IA 4JKMA 4B5XA 3UWYA 3KEHA 1K9EA 3UG5A 2NSXA 4H6QA 2D0GA 4R7OA 2ISFA 3OBEA 1H7XA 4RZ5A 4IM4A 1JR1A 3G2GA 2ZQ0A 3WCZA 1YPXA 3WDPP 3WQCA 4LYQA 1GOIA 4JTEA 2WMJA 4Q8VA 2C1IA 4ROPA 3MCOA 2HVMA 4CCEA 1UG6A 1VP5A 2C0AA 3M47A 4DLFA 4JQAA 1IZKA 3S5OA 3IVTA 3SIZA 1F3EA 3WDRA 1OFBA 3E0FA 1IZJA 2A6NA 5DFAA 1PHQA 3RR1A 3KCOA 1H4PA 5E93A 4EAMA 2VX4A 3R5EA 3MWAA 3NR0A 1V6WA 1Q6DA 2ESCA 4FLRA 3BC9A 1FP8A 3BJTA 4KCUA 4LAZA 4GY0A 1HZYA 1QK0A 3NCOA 4MLRA 3BVJA 3POCA 3DBNA 3G0XA 2VP8A 5HOSA 2GUUA 2PZNA 3OQEA 1UOKA 3LBOA 4K38A 4KIRA 3QKZA 1REQA 4XUYA 1WKEA 3VGFA 5CGQA 3VNIA 2J7DA 1V3HA 1Z44A 1V7AA 3WNKA 3STCA 1M53A 5E6YA 2VL4A 3AS0A 2E8YA 1K9TA 1RQHA 2R82A 3MMUA 1T5AA 4PN2A 1OC5A 2CWXA 2CZ5A 3EMQA 3JU2A 4RX0A 4Y7EA 5ENLA 3HPAA 3P7YA 3FYYA 2B7NA 3E2SA 1AMYA 3SBFA 4U10A 3EWYA 3VNJA 1TUFA 4N9BA 6ALDA 1S5VA 2ZDRA 5C0QA 3WH5A 5I78A 4FPSA 1EKOA 3B06A 4G5DA 3V0SA 1JYVA 2E6AA 4Q4KA 5I07A 2E1DA 3C2RA 4UCFA 5DMNA 3T78A 3B8UA 1S3HA 1H1YA 4V33A 2CKSA 4KERA 3R12A 3T4CA 3CPRA 3VD5A 2V2HA 4E0CA 1FWGC 4XKYA 3QMSA 3AHTA 3W1MA 2IW0A 3R13A 2X09A 3V5OA 1ISZA 3SUVA 1DPMA 2EPOA 2PWHA 4GUFA 1A49A 2EG7A 4JD4A 1UKSA 2QCFA 3GDBA 3WLNA 3HIJA 5EMKA 3TEVA 3T8LA 3GUGA 4NVTA 4FLQA 1O1HA 2HPIA 3CV2A 1US3A 2YDSA 5H1WA 1R3QA 3SY5A 1XICA 4AEEA 1EGMA 5PTDA 1XLAA 5HMSA 2VUYA 2V67A 4I5RA 1RBAA 5CLWA 3OB8A 5AYZA 3NIYA 4BQ2A 2JBMA 2VGFA 1UBPC 3OW1A 4BA0A 5D2WA 1XIEA 3T2PA 4AWUA 2GGHA 3PPFA 1RQBA 2DH2A 2O7QA 4Y8EA 1BD0A 5DQPA 4CEXC 5I02A 3DYMA 5D05A 4RV8A 3PBVA 3BOLA 4H3DA 3QV9A 3TSDA 1XL9A 3T07A 1B5TA 4MJ4A 4GVHA 2CZFA 5T9CE 3CUZA 4HPXA 1TB3A 1N82A 1B3OA 3UXIA 3ZIZA 2QCHA 2ZIDA 3CS2A 1KGUA 3C52A 4LUSB 4LY8A 2PDIA 3CZLA 2BGNE 2QUTA 1QUMA 1ZY9A 2F38A 5IDIA 8XIAA 2Q71A 1V6VA 3O9NA 1I60A 2C79A 2Y1HA 3P80A 2CITA 1XIJA 3MPGA 4WKFA 4HCDA 1OK6A 1ISVA 4PCSA 4I9AA 3NFUA 3BSMA 3UNTA 4DJED 1JFHA 4NASA 1WDPA 2GQ9A 4XAZA 3TVAA 4AD5A 4AUBA 3IRSA 3P14A 3AWOA 4OIFA 1ALDA 3C2VA 4DBEA 3TONA 4LS0A 3H7UA 2RGMA 3MZ2A 5F1UA 3N19B 3MUIA 5JBEA 1GYMA 2UWFA 3W53A 4EPBC 1W5NA 4BF5A 4JL1A 3BW4A 1CB2A 2UY2A 2Y0FA 4C6MA 2WKGA 1EP3A 4K1WA 2OT0A 3CO8A 5J04A 5G5IA 3OIHA 2UY5A 4A22A 2EPNA 1H7PA 2O9RA 3TR9A 4EF9A 4KCVA 4KT2A 5CBBA 3QQ0A 1KM3A 1R30A 8RUCA 3DU0A 2FYMA 5D9MA 4Z08A 3RNDA 1O12A 3A4XA 1OFPA 1QWGA 1XCWA 1TTJA 1BG4A 4C65A 5TNVA 2QJMA 4MKSA 4LCSA 3WF4A 5DCEA 2F2HA 3W1UA 3WBXA 2YBTA 1SJDA 2B31A 2BOGX 4Q8UA 3CYVA 4GI6A 2BV9A 5XIAA 3H2EA 1WB0A 3DH7A 4TXEA 5EU9A 5HMDA 4DRSA 1VGAA 2D2JA 1US2A 2NLYA 1MW2A 2XG9A 3VOIA 1N8IA 4UQBA 1EJXC 1GJPA 4P61A 3QQWA 1HKWA 4KEVA 3BQ5A 3KOZA 4QGCA 1J6PA 4GOAA 1J93A 1E71M 2Z2BA 4F2BA 4ZE5A 5I06A 2H3DA 4YXGA 3TC7A 2WK2A 3B0XA 4TUFA 1P0EA 3FGCB 5DANA 3PN8A 3NURA 1KM0A 4QITA 1OBAA 1ELSA 1UMLA 4H6KA 2CERA 3E0LA 2Z4GA 3VCCA 2VTFA 4KQNA 2TPSA 1OSEA 3R6IA 3RM8A 3IIVA 4HHHA 7ODCA 5HQMA 3KUMA 1D7FA 2CBVA 4WY0F 2QULA 3EPMA 3CUHA 2FB3A 3LSCA 3PPCA 4HA3A 5HNNA 1RK6A 1V93A 2J66A 1KGWA 1QAPA 3T0DA 4IMCA 1V08A 1XIFA 2VC6A 2Z1KA 1XRVA 1AODA 2OPJA 1TMLA 1O95A 3KDOA 3UZXA 4Y9MA 3LMYA 1X38A 2DH3A 3XISA 3DFYA 1X39A 5I3HA 3LNPA 4AZBA 2CFFA 3BAJA 3BOXA 3BUVA 1FH9A 3VXGA 1AD1A 3F5LA 3KBWA 4F0LA 1OCQA 3GK0A 4F40A 4G7FA 1Q6CA 5I5RA 3GR8A 3WLJA 1S2AA 3A3HA 4OKDA 2EBNA 3W7CA 4JY9A 5LIWX 3VE9A 2ZZ3A 5HR7A 3V0TA 3SQSA 3E3HA 4QIUA 4RDWA 1ONEA 3H4GA 3ARVA 1TFVA 3HQ1A 3LM3A 4K2SA 3DHUA 1TYGA 1P0NA 4AW7A 1Z48A 3VIGA 4P8UA 4O1BA 3FDKA 2DV0A 1TIWA 4J2PA 2PPGA 4ERGA 1TO3A 3ITXA 5J5DA 3MU7A 3GWQA 2PD5A 3WD0A 3PS7A 4XZNX 1G67A 1E70M 3BJFA 3PTKA 1GKRA 4JTKA 1JZ8A 3DXIA 1BHGA 1SR0A 4JPGA 3AU6A 3DYPA 3D6NA 1TPDA 4AZ7A 1KM4A 3PZ9A 4L4MA 4JTIA 4GYPA 4GGHA 2QIWA 1I8JA 1ZENA 4ERAA 3GC5A 1XUUA 1P0BA 1K4HA 3H26A 1BQCA 4YTSA 1G69A 5HWJA 2HBVA 3BLEA 1MZRA 2OMAA 3DZ1A 2QJNA 2KZHA 2OODA 1E9IA 1K8ZA 1QO5A 1UP2A 4LTSA 3WQWA 4OU1A 5EFFA 2PMQA 4C1LA 1Q5MA 2RJGA 2Z1SA 4AD0A 2F6XA 1BXNA 5D04C 1VLWA 2FGZA 3H2AA 3V35A 4PB4A 4NX0A 4I8YA 2KAUC 4GHRA 2RDXA 2CCRA 1Y7VA 3JUGA 2HVOA 4AMCA 2YL8A 4MZYA 1PZ3A 2QNEA 4JTAA 2ZFAA 1CLXA 3CHEA 1MXSA 3U7VA 3QBUA 4FXFA 2WMIA 4RE3A 2WNWA 3FNDA 1MUMA 4RZ6A 1A53A 5HATA 6PTDA 1WYIA 3CHVA 5I3DA 3BURA 4MLJA 1JPHA 4IFKB 1XKYA 2QEZA 4DBDA 1FY6A 2H9AA 3ARYA 3FA5A 1E6NA 4N42A 2PDPA 1R0MA 2V82A 2PDQA 3EKLA 4J40A 2HK1A 1O5KA 2IXVA 3PBYA 3A64A 5DY2A 3LHVA 2CZVA 2VURA 3WLTA 2GPTA 3MC5A 3OLGA 1L6WA 3QR1A 3KAOA 1S1PA 4HPHA 1NF0A 3W22A 1B3YA 2FPVA 1F07A 2PDYA 3L21A 1NM9A 2WXDM 1UIOA 3STFA 2VEMA 2AL2B 2BVWA 2VC9A 3DCPA 2O4QA 1VENA 4AZHA 1N7KA 4MAVA 3ZSTA 4FNUA 1TMQA 3NOEA 2AMGA 4Z2JA 2HWGA 4ZSUA 2GVGA 5TIMA 1MZHA 4UXDA 1EJTC 2EXOA 1T8XA 1FVPA 1DIOA 4MY1A 3LYEA 3KRSA 1GYLA 3TWAA 1KXVA 5MF5A 2YCIX 3LCLA 1TWSA 3F7JA 3GKFA 2O9OA 4QG9A 4I5XA 3PZIA 1N55A 2QV4A 3STPA 2PP0A 5D4YA 2WZHA 4A8LA 2DSUA 5H8MA 4XZIA 1QNQA 3GX9A 3W01A 3UA3A 4OV4A 2GGEA 2W61A 2DDXA 2DZVA 1XBZA 4JXCA 3T8QA 4HYRA 1YRRA 1XYBA 1QI0A 2XIOA 4HHPA 2FJKA 4OVXA 1R7AA 1E5NA 1XDMA 5H8PA 1W3TA 4QSHA 4DXXA 2VYOA 4J27A 3RFAA 4ZB2A 2JF6A 2NX3A 3M4HA 7TAAA 1UD4A 4WDWA 2YPIA 3R0KA 2AGKA 1UC5A 4M7SA 3WQFA 3AJ7A 2VZOA 4MADA 3B0UX 1XIIA 1Y5XA 5CSUA 2WNZA 3FHAA 4OV9A 1M1BA 3O1NA 1V6XA 3A5FA 3TDFA 4HT3A 1R85A 3DOPA 4CN1A 5DMYA 3CL8A 3OYXA 3NM1A 1IWPA 3HG4A 5BMWA 3TW6A 3UCQA 5IFTA 4O11A 4XSLA 4NXSA 2P10A 3NEVA 3U2OA 4L6HA 1UP3A 2FJUB 4O4WA 1JUKA 1CNVA 3I7SA 2Y8UA 5DRIA 2NUWA 3UBPC 3G1VA 1ADDA 4JY8A 3VX0A 3LHZA 4O57A 4XD4A 3P67A 3AFBA 4ADSA 1NOFA 5E0KA 4JYDA 3SJ3A 4PMUA 5AHIA 3SSJA 5C8BB 3QLDA 2ZCGA 2RJHA 2J7FA 1S2TA 1OINA 2EAWA 4GZIA 4QQUA 4A29A 1J11A 1TA3A 1W8SA 3RPTA 1L6YA 3RILA 1O60A 4NRRA 2IKIA 2PTWA 3ZLFA 1QO2A 1ICPA 4QDPA 3IANA 3VNKA 2YX0A 3TW7A 3U2EA 1F4AA 3UT0A 2C91A 1O6IA 4LUYA 5I24A 1CT5A 5BU6A 3BO9A 1OFAA 3BSHA 5G4EA 3R10A 1RUSA 1BVNP 2YLAA 4GBDA 4MGGA 2A79A 3AXMA 5I7GA 4HN4A 3TV8A 1UA3A 4H7ZA 1CGWA 4QS6A 3K2GA 2HV5A 4LXFA 4L1WA 4B9ZA 3FA4A 4HCLA 3GSMA 3ERPA 3H12A 4OWGA 1R87A 3WUEA 3TSMA 3DUGA 2PDCA 1QOXA 4HYWA 3AXHA 1EJRC 4AF0A 1OZQA 4L61A 2ZZ1A 2FVMA 3W7IA 3MKCA 4TVDA 1M65A 2P5NA 3IGSA 3RX3A 5HINA 2PGEA 5FEZA 2F6KA 1Q7QA 4EXQA 1RP8A 4Y8FA 1IEQA 3U0HA 3C0JA 1JDDA 4R53A 2DP3A 3MB9A 3B9EA 1SFJA 4JOMA 3IACA 2B7PA 1Q6OA 4FF7A 1AG1O 4P5UA 4OUIA 4HNUA 2O56A 1YNPA 2A5HA 1QXLA 2JKAA 4OZOA 4PMRA 1FA2A 1HKKA 2Z26A 3T08A 3RYSA 1XYAA 3MMWA 4XD3A 4HTBA 2BVDA 3EX3A 4F8XA 8XIMA 1RBLA 1GW9A 2NVDA 4OBTA 2NVCA 3EOLA 1KRMA 1OG6A 2VEPA 3F03K 4IJRA 4IUOA 3I7QA 4LUTB 2P88A 4ZO9A 1TG7A 2IKGA 5BOFA 4A35A 3W6LA 5KINA 1SO6A 2ZZ5A 4V2XA 1K6WA 7TIMA 3VNLA 1ZB5A 3C4UA 4ZOAA 3G1RA 4KWSA 3EWDA 4Q4OA 2ALRA 3SQMA 2XPKA 1MEHA 1T99A 4DVOA 4N9CA 3LHTA 2D2OA 2QKFA 1Q4NX 2VEKA 4J3VA 4XB3A 1OIFA 3TXVA 3MKVA 3RF9A 3CAWA 4TIMA 1Z42A 1W6TA 3L66A 4HZ8A 4R5EA 3L4UA 1DJYA 5AOUA 3VUSA 4MFDA 3ZR4A 1LRTA 1SGJA 3DGBA 4AMAA 4C6IA 2WO5A 4MTVA 1GVQA 3K13A 1IGSA 3W7MA 1XSJA 2CLMA 3GD6A 5FL0A 2X05A 1XD0A 4DJFA 3FJ6A 4LRTA 3NSXA 1W8GA 3MA8A 4WEVX 1XLCA 4IQJA 1JGMA 2Y61A 1G6CA 1XFCA 1IYXA 4QP0A 4ZFMA 4ZBCA 1TTIA 4JFSA 1XIBA 4WDXA 4Q8TA 3DESA 2CLPA 4REQB 3S2JA 3HGRA 4LJ3A 3VUPA 1DWIM 4UFHA 1E6RA 1LT7A 1TV8A 3B03A 4GYPC 1ZL1A 3RMJA 4N7QA 5A6KA 1C8YA 3MI3A 2PUZA 3CO4A 3LOTA 4PMVA 2BWGA 4WXZA 1EHNA 1Z6KA 3I10A 3V1PA 3B0YA 4INFA 1G7UA 4O18A 3W6YA 4Z2HA 1XRTA 1VRXA 4ONVA 3HV9A 1NWTA 3OG2A 4LV4A 4PA8A 3SAZA 3VD9A 3CV6A 2NT0A 3K4DA 3QSTA 5G1YA 1GGOA 2ON3A 2WJEA 4Y6GA 5KTLA 3W37A 1HFBA 3N2XA 3L67A 3R8RA 2G4FA 3D46A 3RG6A 2RKXA 5F2MA 4W89A 3AQUA 1YEYA 1M7PA 5IXEA 4NJIA 3ZVHA 1U5HA 2VDHA 4IGSA 3W2NA 1R2TA 2J25A 1AJ2A 4TMCA 1KQYA 5C7HA 4LBUA 1P6CA 1NU5A 5HR6A 3UU0A 2QAFA 4CD4A 3BE7A 3BAYA 1M7OA 5EGRA 1VFFA 3UCDA 1UWIA 1W0MA 4QNWA 1Q6LA 1A5KC 4AISA 4IIHA 2GDVA 4PCTA 5C70A 1XPGA 1HP5A 3IV3A 2Y8KA 3VABA 1B57A 3R58A 1YDNA 1BXCA 1UR4A 2OGYA 4DUOA 4BF7A 4DI8A 4AB4A 3FK4A 1H1NA 3ID7A 1LRNA 4CD6A 3LXAA 3N6JA 2J62A 2DVTA 4X9SA 3V3WA 1DORA 3GZ3A 3EOUA 1GCYA 2OYLA 4AD1A 2NLIA 4NZ1A 3VNZA 2BVYA 4C6OA 4CNSA 1FFRA 1XQKA 4O19A 3PM6A 4NYUA 1Z69A 4JFUA 5FJRA 4F4RA 3C2EA 2YOCA 3VKCA 2NQJA 1YW1A 2ACUA 2NQ5A 1V3MA 2A3BA 4MKNA 4O0QA 2XH4A 4HMEA 4DUWA 4JN8A 4AIEA 2O7SA 5E0FA 3JR2A 3PWIA 4UWMA 1EC7A 2OQLA 4OUEA 1EDTA 3TA6A 1J0ZA 3W9ZA 3BOFA 2PWEA 3STEA 4C6QA 3FEQA 5D30A 5K3VA 3PG8A 2WKJA 4E8CA 3CZJA 3WL0A 3INPA 3USZA 4Q8NA 2ZRZA 3M0JA 3GR4A 3BMVA 1UWAA 4AYSA 3M6YA 5DY3A 3S83A 5HXMA 4KEMA 3LN3A 1A5NC 7XIMA 3F4DA 2I14A 4CQCA 2OZ3A 2YJQA 1KD0A 1WZAA 4LUIA 1VJSA 4K39A 3H22A 1TJ1A 2YSWA 5FEXA 2E9LA 3E0WA 2W66A 4Y9OA 1D8WA 1EH9A 2CZDA 4FEZA 4H01A 1F74A 2BBFA 2I5IA 4NZFA 4DI9A 5H91A 2WC3A 1TPWA 3WDQA 2HCVA 2NVAA 3Q94A 4WSKA 3CMGA 3LCIA 1IIHA 2J8FA 4PSPA 4WJEA 3RK8A 3OYZA 2FPTA 6REQA 3LCGA 2PDXA 2PE4A 2BGQA 5J8LA 4PFMA 3IJ6A 4WF7A 1VB9A 1ZJIA 1GEHA 1GOKA 5AYBA 2E5DA 3W7PA 1PJ9A 3ZJ8A 4JBRA 3R89A 5LHEA 4IUGA 3HPSA 4E2VA 2JFEX 4H83A 2VFGA 1RP9A 3EKZA 5FSEC 4K7VA 3SCVA 2FFIA 5C9WA 2BHUA 5M03A 2WSQA 3T0BA 3NDZA 3C86A 2TODA 1TX2A 1C93A 3GZAA 5HWMA 3LB0A 3NGFA 2O4MA 1VYSX 3HGSA 1V4YA 2PRLA 5KEZA 4ACYA 4RV3A 4OE7A 3N2TA 3CPGA 1PWLA 1O4UA 3AMCA 1YXDA 2E77A 2DZXA 1T7LA 3C2FA 5BOOA 4NILA 5H6HA 1ADOA 3IVSA 5HJLA 2ZRYA 3TN4A 3W7JA 5D8ZA 1LL7A 1B9BA 4JDYA 3L2IA 1J0JA 1TCMA 1QI4A 1W5OA 2BASA 3QRHA 5AYYA 3ZT6A 2GSJA 5A8MA 3VKBA 1C3FA 2DEPA 3ONBA 3EX4A 3GAYA 4MUPA 4UMBA 1K8CA 4HNTA 1MQPA 1VEOA 2FGLA 2NV1A 2PTDA 2X16A 3AMLA 4ALDA 5CPNA 1LCOA 5CXPA 3G22A 4BQ5A 1UD6A 3S47A 4DWSB 2WQDA 3KHDA 5A6LA 2NT1A 3CTLA 4J3SA 1ZAHA 2VNCA 1KFLA 2PF8A 2J4GA 5CZ0A 5LA0A 1BG9A 2OEMA 3W23A 2X2YA 4YVPA 4DBUA 1HGYA 5HMEA 1TV5A 2QPXA 3AIRA 2XFFA 1ZJBA 3K1GA 4GO9A 3AYTA 4Q6JA 1B90A 2V5CA 2BOFX 4H9VA 1WKDA 2W91A 3ANYA 1HG3A 2XJ7A 1S2VA 4JN6A 5FF4A 1ZAJA 1KKOA 4ACZB 4DO6A 4IPLA 4EWND 4MDOA 2CNCA 3C3NA 3WSUA 5G2WA 3N3TA 3WQ8A 2WWCA 1EIXA 4F3HA 3NVDA 4LEQA 2X1SA 3Q65A 2ZWZA 1YTEA 4TX6A 4MB5A 3WO8A 1K70A 3TIMA 3O0KA 1DE6A 1KM1A 3BH4A 5A6BA 1LM1A 1UYQA 5CAKA 1TPEA 3AO0A 4G9PA 3SY8A 2G97A 4KF1A 1PIIA 3DG3A 3HB9A 1W9UA 1VLIA 2H6RA 3HG3A 1CBGA 2X42A 4N4PA 1RLCL 1XYMA 4GQRA 2Q8XA 2D3LA 4EXAA 4DJFC 5DLCA 3DHFA 3WJZA 1M41A 4DF2A 4AEFA 3RXZA 4MB4A 3W1NA 3WH6A 4BF9A 3S1VA 3E2QA 1UR8A 2MNRA 5XIMA 3H21A 5B80A 4FAMA 3WF1A 3AYRA 2XGZA 1J2WA 3VFCA 2XIBA 3MTWA 1UOZA 4H8HA 3KWXA 4M1BA 3RRAA 1XG3A 3JW7A 4PE8A 3T2QA 4HVXA 3ZQ9A 2WCAA 5K9CA 3TQKA 4LB3A 3FN9A 1YDYA 4C1KA 2Z1XA 1A5SA 1JAKA 3FHQA 3ZXWA 1YE4A 3QZ6A 4UFMA 1W3KA 4PUDA 5TBOA 3GNXA 1E6SM 1W9DM 1NDVA 4PRWA 4MWAE 1G4EA 2V5BA 2JF7A 1IXOA 3RHGA 5LNWA 1I6NA 3UERA 5ABEA 3MMTA 2Y7EA 4GJIA 3UJ2A 1LLOA 2ZZ7A 2OEJA 3J7HA 4W8LA 1A4MA 1PO9A 1NDWA 4X0NA 4CGTA 4WSHA 3CB3A 1BVZA 3UPBA 1FCBA 4KKXA 3TMLA 3PZQA 2QIIA 4FXRA 4MPQA 5CJNA 4AH7A 2ZX9A 4TQTA 3N4EA 5AN7A 4MM1A 1M5WA 3OOQA 5HAOA 4HB7A 4PRTA 5GNYA 1M68A 2W62A 2E25A 4C6LA 1OFQA 1JGIA