2VFFA

Crystal structure of the f96h mutant of plasmodium falciparum triosephosphate isomerase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
247
structure length
247
Chain Sequence
ARKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHHERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRIOSEPHOSPHATE ISOMERASE
publication title Biochemical and Structural Characterization of Residue 96 Mutants of Plasmodium Falciparum Triosephosphate Isomerase: Active-Site Loop Conformation, Hydration and Identification of a Dimer-Interface Ligand-Binding Site.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
total genus 98
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2007-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2vffA00
4NJJA 3TCEA 1K8YA 2GOUA 1KFBA 3ZR4A 1UASA 1LP6A 3G1AA 2QCDA 4QQ3A 1JUBA 1VCVA 3GVGA 3TROA 3LTSA 1VGAA 4PEKA 1LTDA 1LOQA 1OJXA 1C8VA 1FBAA 4TMBA 1QOPA 2V81A 4K7VA 1W5PA 4IGHA 5F4WA 3NOEA 3MO7A 4AWUA 3SFKA 4ZQOA 2NWSA 4AMAA 5D30A 1DORA 1FUYA 3E96A 3SI9A 4M6PA 1OK6A 1F74A 3IGUA 3GNNA 4BR1A 3LDVA 5GVJA 3NAVA 3P5ZA 3NQCA 1OFQA 1PIIA 1Q6RA 3P8IA 2NV1A 3G0XA 5KTLA 3OVPA 3TSBA 4A3UA 5FF3A 4GNJA 5K9CA 1ZAHA 3ATZA 4IQLA 5LSMA 1P1XA 4GXMA 3EWUA 1TJRA 1EEPA 2CW6A 4XZ9A 5AYXA 3KXQA 3FJLA 1M7PA 4RJEA 4K7YA 2I14A 1QOQA 3C8FA 1LLWA 4B5NA 1VJIA 3QJAA 3L21A 2Y7FA 2FB2A 1YPIA 1A50A 1YYAA 2B4GA 4FNUA 2V0TA 2FTPA 2ZRUA 3A22A 3W23A 4DBDA 4JS3A 3N2MA 2CLEA 3T44A 2ZBTA 1GVRA 1V5XA 3MW7A 4NJIA 4MJZA 4UTTC 3W7PA 1LOSA 1SFJA 4QAIA 4Y96A 2YGYA 1B3OA 1WOBA 4O54A 4U28A 3W85A 1WXJA 5AYZA 5DLCA 3S1VA 4CCEA 1PE1A 5LZLA 3DHDA 3FA5A 1GVQA 1IF2A 5EL1A 3HGOA 2JGQA 4CCCA 2NXHA 4LS0A 4GUHA 1UBSA 1ZALA 3NL3A 4DBEA 3EWZA 3NZRA 3DKLA 1ZENA 2YR1A 4JX4A 3PULA 3LCGA 3PSVA 1BEUA 3SJ3A 2Y88A 3B05A 3W9ZA 3OVRA 4MPQA 1H1YA 1AW2A 5AC7A 3SR7A 1OX5A 1U83A 3R8RA 2IQTA 1W5OA 3RF9A 4HNNA 3NGJA 2V2DA 5HUPA 4Z1BA 1O60A 1XM3A 4OGZA 1JCMP 3MUXA 3NR0A 4IMGA 4YMZA 1I4NA 3O6YX 2TPSA 1QPOA 3W6YA 3O16A 3M5VA 3OEXA 3WJSA 4NQ1A 4O17A 1IIGA 3TNOA 2YX0A 1W3IA 4MYAA 4HPJA 4XTDA 1GQNA 3WJYA 4ML9A 1W5QA 2ZA2A 1TREA 5J5DA 1FY6A 2BWGA 4A21A 3KVMA 4M19A 2HSAA 5LGZA 2BXVA 3TQ0A 3UY8A 3TU9A 1FWTA 3PSWA 3W84A 3S8HA 1YXYA 4R53A 4FF7A 1T96A 4O18A 5F2LA 5CZTA 1SFLA 1T0OA 4LY8A 4X22A 3EXTA 2CFFA 3MJYA 1KFEA 4O19A 4BI7A 5I3JA 1BWLA 5D2WA 2QKFA 3KFTA 3FYPA 1SSGA 3EX6A 2VXNA 3EWBX 3PR2A 3SGZA 3UPWA 3NZ1A 2E6FA 3NQGA 3G0UA 4Z1DA 2C6QA 1DQXA 4IMEA 3P8JA 2E5DA 2A85A 4A22A 1R47A 4O8RA 1PHQA 1YDOA 1N8FA 3BARA 3IIVA 3MP5A 3G8RA 3I7RA 3TA6A 1G4PA 1H60A 1LBLA 2TMDA 2X1SA 4UCGA 2PE4A 2EF9A 2W79A 4O1DA 1MSSA 4N4PA 1DOSA 3NPVA 5DCEA 2CLOA 3G1YA 3IIOA 3QSRA 4AF0B 3GDRA 3W2JA 3YPIA 3I65A 3GR8A 4UFKA 1KBJA 2XN1A 4IJBA 1KFJA 2A7PA 4JTJA 3P84A 1MXSA 1G4SA 4ZQCA 2QF7A 1TCDA 3BVJA 5AB3A 4X9SA 2I9EA 1X7FA 4ZQNA 1H7WA 4UMCA 4RZ6A 3C3NA 4E38A 1I2NA 2R8WA 2X1RA 1EA0A 4MZYA 1HFBA 1IXQA 4JYEA 5D04C 3W74A 2JKPA 3CB8A 2PURA 2Y7DA 1OX4B 3O06A 3W7EA 4QITA 5HR6A 3LLDA 1ALDA 2AAMA 1LZOA 3DBPA 2YFOA 3W22A 4YXGA 3A23A 5D09A 1GTEA 3S9YA 3O8AA 5CPNA 4A2SA 2OT1A 4C1KA 4JTHA 1K8XA 5I3FA 1OK4A 2DZTA 3MI3A 4WX2A 4KFNA 4LVDA 3PWAA 1ADOA 1I45A 3M41A 4AHOA 1MEIA 2VFFA 4L4MA 1F5ZA 4UFLA 1AK5A 4ZMGA 5IBXC 3S1XA 3O1NA 3C2EA 3W7IA 3LCHA 1TV5A 2BX7A 1L6SA 1SU5A 1IXOA 3GDTA 3ATYA 2TSYA 1TQJA 1HO1A 1G69A 4N9EA 3MP4A 2QDGA 1FCBA 3QH2A 2C13A 4H3DA 5F1UA 3E12A 1K7XA 4MUZA 1W3TA 5LNUA 5EY5A 1F05A 1X8FA 3UWWA 2ISWA 3LV5A 1VH7A 2DJXA 1J4EA 5D02A 3MHFA 1GG0A 2FJKA 3JRKA 2GUUA 3O6CA 4HSNA 5FEPA 3GAKA 4PFMA 3F4NA 4WOZA 2JGYA 2J9YA 2O7SA 2QEZA 4JTGA 4RR4A 4UTUA 3S42A 2WQPA 1EWEA 1FCQA 2E68A 3QMRA 4ZQPA 2Q3RA 3HMJG 1W8SA 3ABQA 5FF0A 5G2WA 2VEIA 4Y9AA 4CQ9A 3LBCA 2ZA3A 3GX9A 4CQ8A 4JXCA 1H63A 1T99A 3LTYA 5LGXA 2DJLA 3ELFA 3TH6A 4IPIA 5FEXA 1XBXA 4LC6A 3IIPA 2A6LA 2C1HA 2P0OA 1TPC1 4NZFA 3PBYA 3TDFA 3UNDA 2PCQA 4UTWC 3C61A 4UTIA 4FXSA 5D2VA 1G7VA 1WYIA 1XI3A 2W0UA 2NUXA 3G1HA 3H53A 3C2VA 3T4CA 1JCYA 3BLIA 3F1QA 3N9RA 1RD5A 1PCWA 1TPEA 2R94A 4QNEA 1FXQA 3OA3A 4DO4A 3WJZA 3I7SA 1VR6A 3DFQA 3STFA 5ABTA 2VFDA 1VYRA 2YSWA 1NFBA 4EWND 3NL2A 4DO6A 4K8EA 2VFHA 1YTEA 2GVGA 4JR5A 1L6YA 2B7QA 3DKJA 3UY7A 5CG7A 2NWRA 3INPA 1A5BA 3S5ZA 3TJLA 2AQWA 1DJNA 4K36A 4UTJA 1B9BA 2PRMA 1OHLA 4UTLA 1YDNA 3MI2A 3BLFA 3NQ8A 3I7QA 3DFTA 4GFSA 3BV4A 1TPVA 4Q32A 2Y70A 2GQAA 4WJEA 4X3ZA 4KFOA 2YFNA 3LM7A 4IWWA 4LVFA 1D3HA 3ZWTA 4KKXA 1XC4A 2VOMA 5K2ZA 5KINA 3OBKA 3HB9A 5CKSA 3TIMA 1ICSA 3W2KA 3IVTA 3W7NA 1F7BA 4GBUA 4O11A 3FJ6A 2ISVA 4IX0A 3CWNA 5KZEA 3S5YA 3H55A 1KFKA 1H51A 1B4EA 4JNMA 4UUIA 1JQVA 2FLIA 2Z6IA 3O63A 4AVFA 1X6UA 3Q37A 4NJGA 1OYCA 3E49A 3HGRA 5H91A 4YWIA 3NL6A 1WQ5A 3M47A 2G96A 4O15A 4FX6M 4EOUA 3IIXA 3M6YA 4ADUA 2B0MA 3O05A 2C14A 4LTSA 3U2OA 3L65A 4PCFA 1G7UA 3A21A 4BWLA 3CQ0A 5MHBA 3A24A 1IXNA 1R2RA 2V2HA 1FCVA 5BMWA 3C52A 3P80A 2H8XA 3Q58A 2ZQ0A 1VLWA 3EX2A 3UWVA 2QR6A 3FFSA 4MKNA 3G24A 3MHUA 1LCOA 3M44A 3TQVA 3DHFA 2GPTA 5G4EA 5AHMA 1OYBA 2J24A 3MBDA 1KTCA 3PG8A 3PS7A 1TPUA 2ZCGA 4OE7A 3LCXA 3TC6A 3P62A 1WOAA 3N9SA 4XUGA 4DF2A 2B7PA 4NX0A 2VFGA 1LRTA 4FNTA 5IM51 1UJPA 2P10A 4KWWA 3GK0A 3WK0A 1TPH1 2Z1BA 5LNRA 3BGJA 1VCFA 1ZFJA 3KRUA 4JTLA 3T78A 3H54A 3CC1A 1GPWA 3QZEA 4MVAA 3LCIA 5K9XA 3JR2A 3TUUA 4CQAA 1JCLA 1QO5A 1W3NA 4NNAA 2JK2A 3MHGA 1NEYA 3OIXA 4JIQA 2ZRWA 4NVTA 3TMLA 1FDZA 5G5IA 3NQ6A 4RKAA 3LLFA 4FO4A 2Q8ZA 5AHNA 3EWXA 4POCA 5DCBA 3G1DA 1GVOA 4RV8A 2NX1A 1QDSA 3FLUA 3P61A 1LBFA 1H7XA 4G1KA 5K4XA 3G1VA 3ABRA 3KRSA 4WY0F 3HO8A 3GKAA 4DF1A 3M5ZA 3HG4A 4AEOA 5EA9A 4S1FA 4H4IA 3UZJA 1QFEA 2HS8A 3P74A 4FNRA 1H7OA 4OHQA 3TV8A 1JRBA 3STEA 1KM4A 1PV8A 1L6WA 1VHCA 3DFPA 3EKZA 4KWVA 1QR7A 4R7JA 3NQ2A 3G18A 4Z1AA 5FEZA 5HULA 1C9DA 1VLIA 2WJZA 4DF0A 1DKWA 3BG3A 3S6DA 3AJXA 1THFD 1H7NA 1YXCA 1KM2A 3QRHA 3CWOX 2ZZ3A 1QCWA 4P2VA 5EYWA 5C54A 4ONVA 5C6MA 3A5VA 1XDMA 4IXHA 3W76A 2E6DA 3W71A 4LU0A 3TK7A 2X1UA 2RHGA 2CLFA 2DZPA 1WA3A 3W7CA 3DU0A 2PRLA 5G2IA 4N9CA 4GWEA 3GB6A 1J2WA 5D32A 2H90A 3THQA 2CWNA 2W6RA 2WSYA 4GE8A 1SZGA 3TAOA 1LRQA 4O13A 2YXGA 5HQEA 2DORA 3R12A 3NVTA 3TXZA 4O16A 1SR9A 2RDTA 4JTTA 5C2XA 4TO8A 1SSDA 3LHYA 5J5RA 1B57A 1G4TA 2JKEA 3C2FA 1ME7A 1QO2A 4N9BA 2C0AA 5BMXA 1EP1A 1K3UA 3I6RA 4N02A 2HS6A 4Q4KA 2F84A 4WXYA 3NEVA 2EGZA 4AH7A 4O12A 2CLIA 3S5NA 2DZUA 4AWTA 5BRBA 1TPB1 3ZS4A 1W0MA 1ME8A 4BF9A 1UB3A 1LM1A 2OJPA 3C0JA 1FXPA 3KVKA 1RR2A 4FX8A 2OX1A 3BW4A 4JTSA 1ZY9A 2X1TA 2Q8LA 1KM0A 1F6PA 1TTPA 2XFWA 2YYUA 3G8EA 4IUOA 3NA8A 2QJHA 4AAJA 2CLHA 3SECA 4Z08A 5LKYA 4I9AA 5U4NA 2GVJA 3IGSA 1OFPA 2A7RA 3PBUA 3W1XA 4JDBA 2NXGA 4O1AA 5F1VA 2LLEA 4LC8A 1BKSA 2QUUA 4MZ1A 4D2JA 4O0KA 4HNUA 1A53A 3W7QA 4DEFA 1S5TA 3JS3A 4JEQA 4IMFA 5C5YA 4PH6A 4AXKA 1TYGA 3HG5A 2DZWA 2QAPA 3VE9A 3G0SA 2NLIA 1SZNA 4IPJA 2CZFA 1FCUA 1NF0A 4GJ1A 4ZL1A 3QPZA 1AW1A 3B06A 5EKYA 3L66A 5D2XA 5FI8A 2Y62A 5U7SA 3HGJA 1AMKA 1KM3A 2QAFA 2ZTKA 3KHJA 4X2RA 3TQKA 3HPZA 1JUKA 1LYXA 1A5CA 3QFEA 1YLVA 3NQEA 2GQ9A 3DENA 4AB4A 3CHVA 4UTTA 3DAQA 3LERA 3PF3A 5TQLA 3CLMA 3CEPA 3P7YA 2YW4A 1XXXA 5SWUA 4I7VA 2ZZ1A 4MY9A 1H1ZA 3TFXA 2EHHA 1FDYA 3F4WA 2ZZ2A 3UZ5A 1Z48A 2ISSA 1RPXA 1WAUA 5F4SA 3LXCA 1SUXA 4MZ8A 3UPBA 3EXRA 4WZHA 1VYPX 4UTMA 4JYDA 2QCGA 2A7NA 2DU2A 5AFDA 1D3GA 1KLYA 4MLRA 1OABA 1YTKA 2UV8G 4XBKA 2FPTA 2PRHA 3VCRA 1E51A 4O4WA 4WD0A 3QEZA 2B7OA 2ATSA 4XTIA 5KZMA 4N6FA 1ZJIA 3VNDA 3M5XA 1YADA 1OVDA 2GJNA 2E5BA 4PA8A 1AL7A 1P0KA 1ZNNA 2FQIA 2JKAA 2V30A 3NPWA 1VCGA 4FX7A 1VS1A 3O6DA 3QC3A 4LS1A 5DBUA 4UTHA 1G67A 4S2BA 4DO5A 1FWSA 1QPRA 1P5BA 1D9EA 3CIXA 3P60A 3HPXA 1AW5A 4PC8A 2OT0A 3LCLA 3PUEA 3CTLA 3W75A 4NUWA 5K3VA 3KVJA 4MYXA 3GXPA 3LI1A 3Q2DA 2A2IA 1LRNA 4K38A 3W1TA 2D73A 2FIQA 4WY0A 3IIZA 4FB7A 1S3HA 3F03K 3MMTA 3B03A 2VKZG 1AL8A 4IMDA 3WK1A 1TTIA 3BPWA 1FX6A 5BOOA 1TIMA 1EPXA 3L0KA 5DN1A 1I2PA 1MO0A 1RQEA 1I8JA 4RZ4A 1N55A 5F2GA 1LOLA 1TJPA 2V82A 3QMTA 3PUOA 4QM1A 3FKKA 2Y89A 1F73A 5FF7A 3WFAA 1R30A 2V5BA 3E02A 4GUJA 2WPBA 2RDWA 4A2RA 4UMAA 1OFDA 5LNSA 3QQ1A 1NSJA 3MWAA 5CSSA 3TE9A 3W87A 2HMCA 4LVBA 5HMSA 3WJWA 1IXPA 4ZVJA 1KV8A 1QPQA 2QCNA 1FDJA 1MEWA 5EPDA 3W72A 3STGA 1NAL1 1SO4A 1Z42A 3EWYA 3DZ1A 3M43A 2ATMA 4BWLC 2YDAA 3NQFA 3FOKA 5AHLA 2QCHA 1XDLA 1PL9A 3SGUA 4LOCA 1BWKA 3EKLA 1MEHA 4QNWA 1FWWA 4XKYA 4ICNA 2DP3A 3E9AA 3PB2A 5C55A 4GUIA 1XUUA 1PS9A 2P1FA 3W1PA 4OV4A 4YCOA 2EAWA 4MY8A 3KOFA 3N73A 3LRMA 4O10A 3TKFA 4BI6A 4NJKA 3MI6A 4M6QA 1Q3NA 1QWGA 4Q33A 3NQ7A 3UD6A 3LGEA 3TMQA 3W2NA 1KA9F 3CM4A 3LCFA 2QJGA 3DFNA 4LRSA 3Q94A 1JCXA 3P5YA 1KFLA 3IGXA 3LCWA 2V2CA 3PBVA 1I2QA 5AC8A 2GQ8A 3HBLA 5CZJA 1EWDA 2C16A 1KTNA 3B4UA 5D33A 1O95A 3UXDA 1TB3A 2ABBA 4FXRA 5KZDA 5EMUA 3W1QA 5DY3A 1G6CA 4HT3A 2BZNA 3NO5A 2X2GA 2J88A 3L67A 3NXFA 3W7KA 3W1MA 1TMHA 3K30A 4DXVA 5D05A 1WX0A 4JX6A 2OZ0A 3EX3A 3IV3A 4QISA 1LDCA 1WBHA 1ZCOA 4PL1A 4TR9A 1W37A 1VC4A 3BK0A 2QCEA 3FEMA 1EUNA 3NDOA 2QCMA 1SQ7A 2G95A 1LORA 4QJ1A 3R2GA 3M7WA 1JCNA 2QCCA 5BNKA 3RLVA 3EX1A 3N19B 3SIZA 3KX6A 4JX5A 3OG3A 4O53A 4LUIA 5AN7A 3W70A 4CCDA 5FESA 3V1PA 2ZRVA 3N3MA 4DELA 3GXNA 3O15A 2B7NA 3NQMA 4JGDA 4UNKA 5HR7A 2G97A 5D2YA 4LWWA 1GWJA 3STCA 3S0CA 4MFEA 2XN0A 2Z0IA 3NM3A 4OT7A 4LUJA 1KBIA 3LXBA 1HL2A 5L9FA 2C3ZA 2ZZ4A 2Z2UA 1L9WA 2E1DA 1JRCA 3GDKA 3L9CA 5DBTA 4GRSA 5E0KA 3W88A 1PCKA 2WV8A 2FPVA 5DXYA 3W86A 1AG1O 4TX9A 5K7JA 2J27A 2WSQA 3GDLA 1UCWA 5DCDA 4RK8A 1DV7A 3PM6A 1V7YA 4DQWA 1K7EA 4EF8A 2YPIA 3SW6A 3IRDA 4MFDA 1S5WA 4QIUA 4JDYA 4ADSA 1J5TA 4I7UA 4RXFA 2FB3A 3QYQA 3EEGA 4ADTA 4HNVA 1Z44A 4GUGA 1VPXA 3R89A 3QF0A 2R14A 2BSLA 4GC4A 3P81A 1I2RA 2ZZ5A 3LRKA 1H5YA 4N9DA 1SPQA 1SW3A 1TO3A 1O4UA 4XWUA 3PBWA 5HWMA 3N2XA 4LRTA 3TAKA 2Z6JA 4WXZA 3QW3A 2FDSA 4NT0A 2EPHA 4LNYA 4NX5A 1PHWA 2VFEA 3QQ0A 1M7OA 5HWNA 4NU7A 2V8ZA 2CLKA 1WDWA 1RQBA 2A5HA 1GZGA 3CU2A 3PB0A 5D37A 2V9DA 4TU1A 3DI0A 3N14A 2E09A 2H3BA 3G1FA 3MBFA 3LXAA 3NL5A 3KVLA 3HG3A 1QMLA 2Y7GA 1OG0A 4UFHA 3EWWA 2C18A 2TRSA 3ANYA 1O5KA 3DXIA 2NX9A 5CGQA 3A5FA 2NUWA 3BGGA 1DBTA 2VEMA 2WNQA 2WO5A 3BG5A 5LHFA 2F7FA 3QM3A 2Y61A 1CI1A 4IMCA 4KFPA 1Q6QA 2PC4A 1DHPA 1JVNA 1ICQA 2WNNA 3TW6A 5K9DA 1GG1A 1H62A 1ZAJA 5I3IA 3FYOA 3CPRA 1K03A 3HQ1A 1SO5A 2QUTA 4CLMA 5F2MA 3HOJA 1KM5A 4O50A 3NPXA 1OFRA 3GDMA 5TIMA 3VE7A 3OHIA 4ZQRA 2OMAA 2A0NA 4I7WA 5F2IA 5I3KA 1O94A 3TJXA 1KFCA 3L5MA 2VC6A 4YCPA 1SW7A 4K6AA 1HUVA 3LHWA 2ALDA 3B0UX 3T7VA 4MLJA 4Z1CA 3W7MA 5LHEA 4UFJA 3A9IA 4TMCA 3TW7A 5I3GA 1W56A 1GYLA 2DZVA 1W31A 3CEUA 4JYFA 2Y6ZA 2C15A 4BFAA 3FIGA 1Z41A 4JTIA 4JICA 4O0ZA 3USBA 3QMSA 1K8ZA 4O1CA 2ZRXA 2RFGA 4O1BA 4LV4A 2H3DA 3M9YA 5G1YA 2Q3OA 2J9XA 4JY9A 2A21A 1G4EA 4Z0SA 1HTIA 4O4VA 4ORMA 1KTBA 3DI1A 5CPLA 5AHIA 4RCXA 1TPFA 4Y90A 4OQVA 2EKCA 1LROA 1FWRA 2E6YA 2VELA 4OU1A 4UC5A 4E2BA 1O5XA 3T40A 2YYTA 1K7FA 3W7DA 1XFBA 3NYZA 3GLCA 3HF3A 4R33A 1ICPA 2ZRZA 3L5AA 3LTPA 5CPOA 1YXDA 4Y8FA 1VHNA 2ZTJA 3UYCA 5EBUA 4J9JA 4WY0B 1A5AA 4S2CA 5BW6A 5HINA 2AGKA 4N6EA 4O14A 1R46A 5A8GA 3M0ZA 3W1UA 4WOQA 3EXSA 2ZYFA 1SZEA 3RNDA 1F2JA 3UWZA 2QCFA 5HWJA 4CNPA 3L0NA 4ORIA 4OV9A 2WKJA 5HNRA 4O57A 3THAA 3W1LA 3AO0A 3HGSA 2NV2A 1TV8A 1W54A 4JD4A 4Z0JA 1W5NA 3U8GA 3RLUA 4JY8A 1DQWA 3G1SA 1X1ZA 3B0VC 4K39A 2R91A 2J9ZA 5KITA 5KMYA 3GR7A 3NPUA 2RH9A 4HPXA 4E2DA 3PY2A 3GXTA 3IVUA 4EF9A 3DGRA 5L6UA 8TIMA 1OX6A 4O52A 3FKRA 3M5YA 2E77A 4RX0A 3G3DA 4ZZ9A 3GZ3A 3B04A 2YZRA 4UIOA 1OFOA 4JN6A 3NG3A 5D03A 1OYAA 4NJHA 5AHFA 1R2TA 4UR7A 5CZSA 1X1OA 1OF8A 5FF2A 1B4KA 4LS2A 3RFAA 1SO6A 4XKYB 3VI2A 3LB0A 1VRDA 3NQAA 2GVLA 2X16A 3CIWA 1JQXA 4ZQMA 2X30A 1H7RA 1N7KA 4M7TA 4L4LA 1ML1A 2XN2A 3GYEA 3L0GA 1XUZA 2DZSA 4YLWA 4N2YA 4Y6GA 3S1UA 4QSHA 3R13A 3TSMA 3RMJA 4FIQA 3MYOA 1GOXA 3HJZA 1XL9A 2JBMA 1GJPA 4IX2A 3DFOA 3SZ8A 1JCJA 4LW7A 3L2IA 1HO4A 2FPYA 1TQXA 1WBJA 4LVAA 4HIBA 3ZFHA 2QUVA 4TIMA 4AWSA 3L5LA 4WUIA 3DH7A 2VFIA 1Q6OA 3P67A 1KM6A 2OCZA 1R2SA 1ZAIA 4CNOA 4XQ6A 5E93A 5HJLA 2QDHA 2RDUA 1XBVA 4AHQA 1H61A 3WK2A 1RQHA 5F4XA 4K8HA 3MYPA 4O28A 1TPDA 2QJIA 4JTUA 4HN4A 3B0PA 2H6RA 2TYSA 1IIHA 3G1XA 3P82A 3W3OA 2Y63A 3W2LA 3TX9A 4JTKA 3W7RA 4BI5A 3W2MA 3UWUA 5HUOA 3QSTA 4C1LA 1GT8A 1EIXA 1FWNA 2Y85A 1SZFA 4RLIA 1EX5A 3RU6A 5G2HA 3VKJA 1XCFA 3EX4A 4NXKA 4RZ5A 1UUMA 3LHTA 1RV8A 3IVSA 3UQNA 4N4QA 3T55A 5DELA 1HG3A 2I1OA 2ZRYA 2G5WA 4JTEA 4OBTA 3KAOA 1F6KA 2NUYA 5E1QA 1M6JA 1LBMA 4HHPA 3UWQA 1M5WA 3LV6A 2NZLA 3VFLA 1NF7A 4NZJA 1Q6LA 1JJKA 4HSOA 4MOZA 2J6XA 4CNNA 1A5SA 2CLLA 2BLEA 4UNLA 5AYYA 1EB3A 4PODA 2CZ5A 1KW1A 1JR1A 1H7PA 2A4AA 4MJMA 3NQDA 4W9TA 1QNVA 5DY2A 1FQ0A 3W83A 1T8XA 3C4UA 3SSJA 2ZA1A 5AHEA 1H50A 3E0IA 3BLEA 4FHAA 4IXXA 3BW2A 7TIMA 1TV7A 1XBZA 3HPSA 1EUAA 1VYSX 3I68A 1Y0EA 1XBYA 2ZZ7A 3W07A 1YTDA 4YL2A 3RK8A 1EP3A 3G3MA 4MIMA 3HIJA 3BW3A 1OFEA 4LT9A 3C6CA 3WK3A 1KLZA 4MY1A 1U5JA 1DVJA 2Y7EA 5TBOA 4A29A 1QPNA 3TR2A 1OF6A 3MP3A 3PUDA 3SY5A 3W7LA 5CZ0A 3PAJA 4EVZA 3HG2A 3LHVA 1TRIA 4GUFA 5AOUA 3UWYA 5DXXA 1JULA 3TC7A 1L2UA 2H8ZA 5K4ZA 1MZHA 3NNTA 1BTMA 3WJXA 3ZWSA 1ME9A 4HKPA 1GEQA 3S1WA 1SW0A 1YPFA 1UUOA 4HNTA 1NVMA 2QCDB 2E6AA 4OWGA 3U6WA 2QCLA 1OFAA 2BTMA 1EP2A 4JTFA 2CZDA 4JIPA 5FEWA 4IOTA 1OFBA 4NNCA 5G4WA 1LLZA 1I2OA 1KM1A 3C56A 2WSRA 4FEZA 3LRLA 4UTKA 1S5VA 4DPPA 3W1NA 4ALDA 3S5OA 5D38A 1CX9A 5H2ZA 4LVGA 3NM1A 4FIRA 1TTQA 1YDVA 4E0CA 6TIMA 1W1ZA 3PG9A 5I3HA 5A5WA 2YCEA 2VENA 1SO3A 1TTJA 5LNVA 4H6KA 1DL3A 1XKYA 3LI0A 3QPYA 1IGSA 2NXIA 3W7JA 1QAPA 4AF0A 4PTNA 1KV5A 1RZMA 3GIYA 4NNBA 3TXVA 6ALDA 2ZDRA 1GVSA 5CPMA 5AC6A 4FNQA 5IBXA 3GAYA 4BK9A 2O7QA 3C2RA 3M1ZA 2VEKA 3GNDA 3ABSA 2V5LA 1TSIA 3NQVA 3FS2A 3OVQA 5D2TA 3UXAA 3W7GA 2GJLA 4U4MA 4P61A 5KSWA 3TSDA 2FFCA 3D0CA 5T26A 3EB2A 4EIVA 5G1TA 1VZWA 1DJQA 1OX4A 4LV9A 4RXGA 4FNSA 1GVFA 4UXDA 3M16A 2YW3A 3N34A 3PVFA 3G22A 2NX3A 3W1RA 4UMBA 3W73A 2RKXA 4XBSA 3ABOA 2A1YA 3LOTA 4WQ6A 3DFSA 3W7OA 2ZFAA 1GYNA 1TRDA 4M5PA 3BO9A 3LX9A 3LBMA 4K37A 2ABAA 3KRZA 3W7HA 2WNZA 3B8DA 3R5EA 4UFMA 3W1AA 4DPQA 1P4CA 1K02A 3GKFA 4UFIA 2C19A 4R34A 1ZHAA 1CW2A 1WV2A 3C2OA 3BG9A 2ZZ6A 3CT7A 2E5CA 4M7SA 1PVNA 4PL2A 4UR8A 1VQTA 1ONRA 2A6NA 3O07A 2DZXA 5CSRA 1Q45A 4UTWA 2WOQA 1C29A 3V75A 4AHPA 2KZHA 2CU0A 5LNWA 1JUEA 1RVGA 4FNPA 1P0NA 3L68A 5FF4A 3LHZA 4NXSA 3IEBA 3QW4B 3LHUA 1TPWA 3PC0A 4M6VA 1GTHA 3W2UA 1F76A 1W5MA 2CZEA 2CLMA 3TFCA 2VEPA 2HTMA
chains in the Genus database with same CATH superfamily
2ZX5A 1ECQA 4NJJA 3PHAA 1P0DA 3VCCA 3VDAA 5CXPA 1UASA 3H21A 3T42A 3MDWA 3F7JA 1XP3A 4W7WA 4H83A 1M1BA 4NSBA 4PTMA 4PEKA 1V08A 1BRLB 1FBAA 1JGIA 2V81A 2Q8XA 4K7VA 5E70A 5F4WA 5A6SA 4ZQOA 4GIAA 3W02A 3SI9A 2WNWA 5BXPA 1WAWA 3EOLA 2PC8A 4IIHA 1KXVA 1H3GA 3THUA 3QY6A 2NQ9A 1Q6RA 3G0XA 4C65A 3OVPA 4FALA 1XIIA 1PSCA 3WF1A 4L1XA 5DT5A 2QVNA 3ATZA 4IQLA 3AIBA 4DLFA 4RL3A 1E3ZA 1ZL1A 2CW6A 1EEPA 1TJ0A 4RJEA 2J74A 2I14A 1QOQA 1VJIA 2Y7FA 1L6GA 2Y2WA 4RV3A 5TF0A 2WWDA 2ZRUA 3B9DA 1A5OC 2CLEA 1E9IA 3OQ8A 4F66A 3QQWA 4DHGA 2ZBTA 4GGBA 4RUBA 1V5XA 4Q8OA 3MW7A 3WNOA 4UTTC 3W7PA 3TN6A 7REQB 3TNBA 4OECA 3COTA 2X42A 2YGYA 1B3OA 3BAWA 3WQ4A 4XVDA 3IV8A 3LNPA 3CMFA 4NP7A 5B7ZA 5AYZA 4KCTA 3WDJA 4CCEA 3AHTA 3WQDA 3FA5A 5A6MA 1V6WA 4CCCA 4MAVA 2NXHA 5TD4A 4KEZA 1I6NA 2YA0A 3WX7A 4DBEA 3NL3A 2ONEA 3T0CA 1ZENA 4GVFA 5HPOA 1TZZA 3SJ3A 4IIDA 2XFFA 3OVRA 4L1GA 3OHMB 2XVGA 2FHFA 1YQ2A 1VFFA 3S1GA 3NGJA 5HUPA 1XINA 1XLEA 4A3HA 3MUXA 3PP7A 1XGDA 4NAFA 2C0HA 5M03A 4GACA 4NQ1A 2YX0A 2C91A 4MYAA 3QKZA 1GQNA 2KAUC 4HTBA 4GYPA 1LWHA 2ZA2A 1DXFA 4PMJA 3RRXA 2HEJA 4J2PA 4IPNB 3SDOA 1KD0A 5FJIA 3S2MA 1CBGA 4GLEA 3KBMA 5FACA 3PSWA 3W84A 3S8HA 4FF7A 3QOKA 1CGYA 4AYSA 1PTDA 4ZO8A 4KIRA 6A3HA 4HNOA 3NTYA 4KEUA 4K8GA 1YW1A 5I3JA 3SADA 3U2ZA 1BWLA 3ZXWA 1WPCA 3FYPA 1Q7QA 3UPWA 3NYDA 3VDHA 4ENLA 4HK6A 3ZJ8A 1YDOA 3BARA 2CIPA 3ZT6A 3I7RA 1R3TA 2PU0A 1H60A 1HP5A 1UP2A 1R9ZA 4UCGA 3CJPA 2PE4A 4QLKA 4LUTA 2EF9A 1M01A 4A3QA 4O1DA 1MSSA 1CXKA 3RPDA 4PUNA 3EA2A 1F3WA 3CMJA 3M64A 3BANA 3GDRA 1ONEA 4CU7A 3CYVA 1KBJA 1GORA 2OWXA 2FZBA 3EYPA 4IJBA 2A7PA 1HKJA 3FCPA 4ZQCA 4FI4A 4X9SA 2I9EA 1VEPA 1X7FA 1TJ2A 1GHRA 3EDDA 4E38A 3QYSA 4IL0A 1HFBA 4Q8VA 1IXQA 1UR3M 3CQHA 3PZTA 4H8UA 4PRWA 4CD7A 3FYYA 1LZOA 1WKYA 3UYIA 2YFOA 1UD6A 3W22A 4YXGA 5CAHA 5D09A 3O8AA 1SFTA 4C1KA 3GTFA 5M17A 5I3FA 4MF4A 3T08A 4ZOEA 3WCZA 1V0MA 1ADOA 4JKKA 2XTKA 4MKSA 1I0BA 4IGSA 2BY0A 5IBXC 2Y8KA 2BHZA 3F4VA 1OY0A 3LSCA 3GUGA 1Z3NA 3BZGA 3GXFA 3S2LA 4OBSA 3B0XA 3ATYA 2ZC1A 3FJNA 1HO1A 1UG6A 4N9EA 3MP4A 2QDGA 1K7XA 4MUZA 4TXEA 1W3TA 1POKA 1EO5A 1X8FA 2F8QA 1VH7A 2G3JA 3KE0A 3F5KA 5C9ZA 3URBA 3JRKA 2VMFA 3CB3A 3LPPA 4PFMA 1V3LA 2JGYA 3KZPA 1UJQA 4US5D 3ZT5A 5FSDC 2O7SA 2PDHA 4W89A 3RM4A 2P8BA 3QMRA 1O1ZA 3C0SA 1W8SA 3ABQA 1KKRA 5FF0A 2VEIA 1KGUA 3GVRA 3CHEA 4JPGA 1H63A 5LGXA 3ELFA 3QGAC 5FEXA 1XBXA 4LC6A 3WLJA 2C1HA 4NZFA 3PBYA 2X7WA 4IIBA 4UTIA 2VOTA 4ZO6A 1ZTVA 1JCYA 1OIMA 2VDIA 1CECA 1FXQA 4ATLA 4NF7A 3I7SA 2QIWA 4C1NB 4EAMA 1H41A 1QATA 5ABTA 3FA3A 2G4FA 1W9UA 3UCCA 4EWND 4K8EA 2KX9A 4H6EA 1X6NA 5CG7A 1J79A 5FAJA 1M68A 3TJLA 3KDNA 4A8IA 4V2XA 1NP0A 4FOKA 1B9BA 4GNVA 4Q8QA 1OHLA 4WSJA 5LA1A 3VU2A 4GFSA 3E0LA 4JQ3A 2WZHA 2JIWA 1TPVA 1UP0A 4QE5A 4Q32A 2GQAA 1JI2A 3ES8A 3LM7A 1MYRA 4IWWA 1M7XA 4CN1A 2E40A 1R38A 3OBKA 4M29A 1ICSA 3W2KA 3IVTA 3DFHA 1F7BA 4GBUA 3CWNA 5KZEA 1DJHA 2FLIA 1EC9A 3M4HA 4AVFA 4NJGA 3Q37A 3NL6A 3DC8A 4QJ4B 2INZA 4O15A 3M6YA 4ADUA 2R1MA 4LTSA 3Q45A 4PCFA 1G7UA 4BWLA 3CQ0A 1R9YA 4F0HA 4B16A 1XWYA 2BODX 4AX6A 4QQUA 1M7JA 3MO4A 4EXAA 3EX2A 2QR6A 3FFSA 1QI5A 1P43A 2B31A 4KRUA 2FHCA 1Z69A 1LCOA 4WDTA 2GPTA 3LUTA 4LF1A 2ZCGA 1L6FA 3TC6A 3RU8X 3OLIA 3N9SA 4NX0A 4QLJA 2VFGA 4JTCA 1RLDA 2X40A 4OJYA 4KWWA 5LNRA 3T78A 3H54A 4LEFA 3GRIA 9XIAA 4ZOCA 3JVAA 3FX4A 3N11A 1NEYA 1IYXA 2DW7A 4NVTA 3FEQA 3R7MA 3M0YA 1TWDA 3LLFA 2FGZA 4FO4A 3EWXA 5CLTA 4POCA 3C86A 1TIWA 4YWSA 3UU0A 4DBSA 2HROA 1X96A 1OGBA 3OVGA 4QTGA 3FLUA 1KCZA 3MDUA 1LBFA 2VGFA 2DSUA 3ABRA 1FHDA 4XVEA 2HQAA 4RNHA 5EA9A 3PPHA 1QFEA 3RR4A 3GTXA 2GFTA 3EGJA 3TV8A 1EFZA 1JRBA 3STEA 3WUFA 2IKIA 4J7RA 4XAYA 5H8UA 1RJRA 3U4AA 3EKZA 2FH8A 2GJXA 3F5JA 5FEZA 1C9DA 3VOHA 3BG3A 1UR4A 2IKJA 1KM2A 3DYPA 3BGAA 3CWOX 1R6WA 3SCQA 1UKPA 3A5VA 1XDMA 4ICMA 3W76A 1WCGA 3W71A 3TK7A 2RHGA 5AYIA 2CESA 3WBAA 1IWBA 2AOSA 4U3CA 3VD9A 1WA3A 3W7CA 2BVTA 2PRLA 5G2IA 1UBPC 2XDFA 4N9CA 3UG5A 4GWEA 1QWKA 3BAIA 2CWNA 2W6RA 4GE8A 4QSFA 1YE4A 4QLLA 1SZGA 3FHQA 5HQEA 1E5NA 3F2BA 5ABEA 1QNSA 3WFZA 1F4HA 4QX4A 5T8GA 5J5RA 4IP7A 4NRRA 4E4FA 2G8ZA 4LX4A 5HQLA 3S6TA 1MVYA 4B92A 4N9BA 1UWUA 1MRQA 4S3DA 2F84A 2EGZA 3KS5A 3GS6A 4O12A 3S5NA 1NWSA 2OGJA 3ZS4A 3AMKA 2HNHA 5H8MA 4XV0A 5AKQA 4BF9A 1UB3A 3PWIA 1E1CB 1JZ6A 2DVXA 1RR2A 3BW4A 4EXBA 2X1TA 2Q8LA 3VNJA 1UP3A 1MZRA 1TTPA 2XFWA 2ZX9A 4IUOA 2J6VA 4RDZA 3NA8A 1A0CA 5JBFA 4Z08A 5LKYA 2IQDA 1HJVA 3IGSA 2OZ3A 2HVNA 3PTMA 3APTA 1KBKA 2WM0A 3GC5A 2VHLA 2NQ5A 2PTWA 2RDXA 4BF5A 2WC4A 3ALGA 4LC8A 2QUUA 1FVPA 2J13A 4Y7EA 4YHGA 1KGXA 1OZQA 1XIGA 1A53A 3W7QA 2V5CA 3ARSA 1S5TA 1H1NA 4JEQA 4PH6A 1CGTA 4GY1A 1ITQA 2WVSA 1S2CA 4ATWA 3M0IA 3G0SA 1UR2A 4PTDA 2NLIA 1SZNA 3V5CA 2ZXQA 3ZSTA 1EJ7L 1NF0A 4ZL1A 3QPZA 5EKYA 5D2XA 1YBQA 3H2AA 4DJFD 3O2LA 2VM8A 2ZTKA 4CQBA 3TQKA 3VGFA 3OIHA 3QFEA 3NQEA 5JIPA 4TVDA 3CHDA 4XK2A 3AXMA 3DAQA 3A4JA 1XXXA 3D3AA 5SWUA 4MY9A 1H1ZA 4JKLA 2WHKA 1FDYA 5JUVA 1Z48A 4DUVA 1RPXA 1BXCA 4F48A 3UP8A 5F4SA 3T0AA 4C6CA 4S3BA 3UPBA 4UTMA 4IP4A 3L7RA 1AD1A 2J79A 2A7NA 3WEMA 1BKHA 1KLYA 2PEVA 1E51A 3SCPA 3UW6A 3QEZA 3QR3A 3SRHA 1XF0A 4B3ZA 2OSYA 4N6FA 2BB0A 4AWEA 1JD7A 3VNDA 2CHOA 1YADA 2WMFA 5AY7A 4PA8A 3CO8A 2FQIA 2JKAA 4Q4QA 1VCGA 4FX7A 1LG1A 1BYDA 4LS1A 4DO5A 1P5BA 1D9EA 1E0XA 2QZRA 3DG6A 2I57A 4PC8A 3WQEA 2OT0A 3LCLA 4HNCA 4MYXA 2YA1A 3Q2DA 1LRNA 2GLKA 3AIRA 3RXZA 3AS0A 2J8GA 2VKZG 3TVAA 3VKBA 2GGHA 4Z2LA 3SCRA 4H9YA 4QDWA 4FZIA 4LCRA 4JBRA 3GC2A 1E1CA 1VF8A 1I2PA 2YJQA 1DJZA 1TJPA 3ARTA 2Y89A 1F73A 5FF7A 3BZJA 3KW3A 4Y8EA 2V5BA 1MQPA 4X2PA 3VUPA 4B3KA 2ISDA 1FWFC 1CXHA 4OOUA 3GBEA 3GIPA 2DZAA 3QPEA 3VK5A 1OFDA 2OFJA 4LAOA 5CSSA 1E9YB 4MJ2A 4MNLA 1XIHA 2W92A 3TC3A 1IXPA 3EEZA 1FDJA 3W72A 3CAKA 3T0BA 4AD5A 1Z42A 5C0QA 4R27A 1LUCB 3FOKA 2FZMA 1O5QA 4M51A 4C90A 3PZIA 5C7HA 3MCMA 1FWWA 4DIAA 1E4NA 3XINA 2GK1A 4XKYA 4H7CA 3PB2A 2XZ7A 2F38A 4F8XA 3KOFA 1PTGA 3WBWA 4M6QA 4P7QA 4Q8TA 4F0LA 3ARUA 1E4IA 5A6BA 2QJGA 4V15A 4LRSA 1JCXA 3P5YA 3PBGA 1KFLA 3PBVA 1VFTA 1I2QA 4KCUA 1RUSA 4AZ5A 3LD5A 4Q3MA 1KTNA 5D33A 5EMMA 2D2OA 2ABBA 3E5BA 3VM7A 5DY3A 1G6CA 4F79A 1GCYA 2BZNA 2X2GA 2J88A 4XBJA 3W1MA 2A3BA 1TMHA 2WHLA 4QISA 5CG0A 1ZCOA 4PL1A 4TR9A 3O0FA 3WNPA 3KBVA 2OEKA 1LORA 3W0KA 2VGIA 4LUSA 3ZR6A 4XZBA 3SIZA 3OG3A 1WZAA 1BYCA 5AN7A 4CCDA 5FESA 3KHDA 4DELA 4GQBA 3O15A 5A6TC 4JGDA 4U5IA 3LPGA 2YXOA 3KBWA 4P8XA 5D2YA 1JZ7A 4BA0A 2XN0A 4JNYA 4K3ZA 1ECEA 1ZBKA 4I8YA 1UD3A 3IJ8A 3NM3A 5LXXA 5ABFB 5L9FA 1Q6GA 4AXNA 3PFMA 4RNFA 4CU8A 4WLCA 3B8SA 1MW1A 3A6OA 2WV8A 2FPVA 3W86A 4R88A 4MDPA 3L4YA 2WSQA 1JIBA 5DCDA 4UZUA 3TR9A 4RK8A 4DQWA 2UZ9A 4A3YA 3IRDA 4QIUA 4MFDA 1WXYA 3VYLA 1PWLA 1J5TA 4RXFA 3QYQA 2GJPA 3EEGA 1HJQA 4GUGA 4NZCA 2HDJA 2ZX6A 2I9UA 2FVLA 1MW2A 1JZ4A 3FK4A 3DHUA 4I5XA 1OCJA 3LRKA 3HQPA 4CEXC 1E5JA 1TO3A 4AZGA 3CUGA 3PBWA 3N2XA 1FKWA 3USZA 4LRTA 2GVYA 2NQLA 4H19A 4R7OA 4WXZA 3BCFA 1FOBA 4QEHA 4BQ5A 1PHWA 4IFKA 1M7OA 1HZYA 3AHYA 2CLKA 1WDWA 3B0YA 4UNIA 3MMWA 1JDAA 3DX5A 3CU2A 4KF1A 4KWSA 2E09A 2H3BA 4MWAB 2ZX7A 4JFUA 4GQGA 3ANYA 3WDPP 5DO8A 1Y5WA 1XSJA 5I5RA 3A5FA 4IMAA 2PDYA 1JXKA 3QM3A 3SSZA 1BF6A 2Y61A 4GYPC 3WEOA 1CLXA 3LZ3A 1ZUAX 1Q6QA 3CXOA 5BRQA 2RGLA 3SURA 4FAMA 1ZAJA 5I3IA 2HNEA 3CPRA 1VFMA 3HQ1A 4DAFA 1SO5A 2O4MA 1A3WA 4FOUA 2GDVA 1TVPA 4IIFA 3V4BA 2A0NA 2F2KA 4I7WA 3IUHA 5CEWA 3E38A 2XGZA 5I3KA 2Z1SA 1KFCA 3L5MA 1GOMA 5I07A 2VC6A 4GX8A 4WKHA 2FFIA 2VEGA 1HIZA 5XINA 4MWAC 3KTSA 2OVLA 5I3GA 3R79A 2DZVA 3UF9A 4BFAA 3QY7A 4WDXA 3M0KA 5BRPA 1EYWA 1PX4A 1CCWB 1HL9A 4ILSA 1L2QA 1EX1A 4CGTA 2Q3OA 1IEQA 3MMDA 3A4XA 4Z0SA 1KTBA 3DI1A 3K8KA 5CPLA 4Y90A 3KL5A 3W4RA 4WCJA 1HJUA 3GYCA 4GIRA 2EKCA 1LROA 4OOZA 2EO7A 3M07A 1O5XA 1K7FA 1AVAA 3NYZA 3GLCA 4H9MA 2ZRZA 5JBDA 1K4HA 2ZTJA 3UYCA 5EBUA 2E0PA 4S2CA 2DVTA 1K6AA 4O14A 4WOQA 3RNDA 2I7GA 3UWZA 3UXLA 2EPNA 5HWJA 9CGTA 1U30A 3I10A 4OV9A 5HNRA 3THAA 3UGVA 3HGSA 2NV2A 4QJ5B 4HA3A 3VD5A 1W5NA 3LGGA 3U8GA 4JHOA 1DQWA 4K39A 5KITA 2J9ZA 1OC5A 4E2DA 3H26A 3MJMA 2J75A 5L6UA 1RJPA 1OX6A 2XM2A 3HV9A 2RJGA 1J0IA 3M5YA 4QS6A 1XD0A 4H41A 5CZKA 3KTXA 2AL1A 2HISA 4JOMA 2YZRA 3H4XA 3N29A 2QVHA 6ENLA 1AQHA 1EXPA 3NG3A 5D03A 1BSIA 2ODOA 4NJHA 2AQOA 2PWGA 4UR7A 4C7FA 1NDYA 4MHBA 2YCKX 4JCMA 2HCVA 3NQAA 4AY8A 2GVLA 5HNTA 2VP8A 1IR2A 4CQDA 3CIWA 2ZC8A 4LF2A 3H7RA 4L4LA 3W27A 3L0GA 2GGJA 4N2YA 3R13A 3TSMA 2D1ZA 1IZJA 4OBRA 3HJZA 2GOKA 1ISZA 4AD3A 3DFOA 4GA8A 4WK9A 2XHYA 5E6ZA 3CL7A 4HMDA 4LW7A 1JPIA 4A8RA 1C8YA 3R25A 1QHZA 1TMLA 1Q7MA 1V8EA 4ROQA 3GFXA 4WUIA 1Q6OA 4MSSA 1DXIA 1R2SA 1JI1A 3RM8A 4Q7IA 1U1JA 1H61A 1AH4A 4C6NA 1DWHM 3MYPA 3IJQA 4PMZA 2ZUSA 2EPOA 4JTUA 3NZPA 3GG0A 1WKFA 4OKDA 2Y63A 3W2LA 1LF1A 4BI5A 2OSWA 4TQTA 3W2MA 5HUOA 2PDWA 3QSTA 1GT8A 4G7FA 2Y85A 1FWNA 4RLIA 1EX5A 5G2HA 3VKJA 1BXNA 2PZNA 4NXKA 3LSBA 1UUMA 3LHTA 3U7BA 2V67A 3T55A 4L80A 4LQ1A 5CC3A 2BY2A 4YVVA 4HU0A 2NUYA 5E1QA 1M6JA 3GZAA 3UWQA 3VFLA 3R0KA 1GW1A 2HPMA 1RCQA 2ZUNA 1MFVA 2C1GA 2R1NA 4KESA 2J6XA 5GNXA 3N3TA 3MC5A 4PODA 5I00A 1FA2A 2ZWZA 2A4AA 4AIOA 4GQQA 1AH3A 3W83A 1J18A 3SSJA 2ZA1A 3E0IA 3CGTA 1EOMA 1R3RA 1TV7A 3ARWA 3PUGA 3WD0A 2H9AB 1Y0EA 2Y8VA 2PFHA 4JIHA 4AIBA 2HZGA 1TWIA 3ZLGA 3BW3A 1OFEA 3C6CA 1QHPA 3BH4A 1EA9C 1NWTA 1DVJA 2G3FA 4WGXA 4A29A 1QPNA 4M1BA 4U33A 4YU1A 3PAJA 2DW6A 3H7UA 4YVPA 3IWPA 2IKHA 2IKGA 3TC7A 1H0IA 1Y65A 2VC9A 1TVNA 3NNTA 3ZWSA 1SW0A 3OGSA 4YHEA 3N2TA 1K9FA 5D8WA 2IW0A 4WJ8A 3MV01 2BTMA 4H8NA 1PPIA 4GCAA 2CZDA 4JTFA 4JIPA 5FEWA 4IOTA 2ZUMA 4V33A 4X61A 2YCLB 2EXOA 5G4WA 1I2OA 1S5VA 4ALDA 4PMYA 3CUZA 2PTDA 4NI8A 4ZB0A 5J04A 6TIMA 1UIOA 1RBLA 1TWWA 2YCEA 1TTJA 5A8OA 1WB0A 2PWDA 1XH2A 1XKYA 1ZS2A 3LI0A 2JFEX 3MS8A 4Q6JA 3W7JA 1QAPA 3DBNA 1RZMA 1EPVA 2QJJA 3MANA 2PCEA 2O9TA 1TA3B 3ANUA 3SCTA 3GAYA 3M1ZA 2EPLX 5LA2A 3ZZ1A 3GUWA 6REQB 2QULA 2G3IA 4M81A 5CJNA 1NQ6A 4H9TA 1EOKA 4S38A 4Z2IA 2ZX8A 1GYMA 1OX4A 2A3EA 1PKLA 2PAJA 1HKIA 3WQOA 5LIYX 2VGBA 3E2QA 3IAPA 3I4KA 3AIUA 4UMBA 2X0YA 3W73A 1GONA 5EBAA 1XLGA 3LYEA 2GZXA 4NL1A 2ZFAA 2ZVRA 4M5PA 1Z6KA 3LX9A 5IRPA 4PUUA 2ABAA 3W1AA 3IACA 3T8LA 3CPGA 1VIWA 1ZHAA 2OTDA 1CW2A 5E0CA 4P5UA 3TTSA 4HHMA 2H9AA 3Q4DA 1Q4WA 5GNZA 1Q45A 2P8CA 5FAGA 4P7RA 2XFRA 4RE2A 3GG1A 3LHZA 3ONBA 3QW4B 1B54A 3LHUA 3PC0A 3QZ6A 2DT3A 1LQ0A 5E6YA 4JTDA 3TCEA 1K8YA 1MWOA 4PN2A 4MKVA 1CGWA 4QQ3A 1GPFA 1VCVA 3GVGA 3TROA 3LTSA 1VGAA 1LTDA 3T2PA 3AIVA 3WLSA 2G0WA 4HCDA 3NOEA 3SFKA 3DERA 1RP8A 2NWSA 4AMAA 3RJYA 4H8HA 3UT0A 2EBNA 2PWEA 1XIMA 4M6PA 3PTKA 4ZODA 1WDSA 1ELSA 1OGSA 3LDVA 3P5ZA 3NQCA 3RM9A 1KQYA 1OFQA 2OO6A 2OQYA 3TSBA 1J0HA 4KRZA 1V3JA 1V02E 2J8TA 5CBJA 3L12A 5K9CA 3H6OA 1ZAHA 3LPOA 5LSMA 3ORWA 4W8BA 1XC6A 4GXMA 4IH3A 3EWUA 4FSAA 1TJRA 4LPCA 3WNKA 1GVYA 5AYXA 2BP1A 3QTGA 3RCYA 1UD5A 1ADSA 4A8NA 3AJ7A 1E0TA 1LLWA 2ISFA 4B5NA 3L21A 1S1RA 2XYLA 4LEQA 1A50A 2I5IA 4JQ4A 1YYAA 3DFYA 2XPKA 4LAUA 1VPYA 4FNUA 1YMYA 3R8GA 2QYGA 3E74A 4K2SA 5ECUA 2VZSA 4NJIA 3VNIA 3WELA 3MSGA 5DLCA 3BXWA 5CC5A 3S1VA 3TZFA 5LZLA 3T2OA 4GD0A 1WKDA 3QHOA 5EL1A 3HGOA 2BBFA 4PUMA 3T2QA 4Q4OA 2YR1A 2XIMA 5HNUA 1BEUA 4REQA 2ZOXA 3A3XA 2Y88A 2Z26A 3W9ZA 5HQMA 3NO1A 2W91A 1AW2A 3W81A 3R8RA 1W5OA 3WLIA 4HNNA 3ZSSA 1XM3A 4H01A 1E6SM 4J2MA 2YL8A 4G6CA 1RH9A 1XIDA 4YMZA 2TPSA 4Z17A 3T6CA 3O16A 1IIGA 3TNOA 1W1TA 2QQ6A 1ADDA 4DX3A 1RA0A 4OTKA 1TREA 3RO6A 5E0FA 4M19A 1HVQA 2BXVA 3C2YA 5AVHA 4W87A 3TU9A 5KZ6A 3UZZA 4G2DA 1FWTA 1RALA 2D24A 3NURA 3V1HA 1T96A 5F2LA 4GVIA 3TN4A 2PS2A 3ITOA 1X38A 2WQDA 1CXIA 3MJYA 2Y5SA 3RLHA 2ANUA 3AC0A 4NASA 1Q66A 3TYBA 5A6KA 2QKFA 4IL2A 1SSGA 4GYKA 3EX6A 2VXNA 2XSAA 3L4WA 1US3A 5DMYA 3UEQA 2E6FA 2C6QA 3KCLA 2RAGA 3IAQA 1QPKA 1NOUA 2GQ3A 2YDRA 2VURA 4XZHA 4O8RA 1PHQA 3HFTA 3IIVA 2OELA 1YKWA 1G4PA 1LBLA 2TMDA 2Z00A 1EJRC 1XRVA 2QMJA 2PDXA 2W79A 1DEDA 4N4PA 1DOSA 2CLOA 2PLMA 2V5KA 1H11A 1OBAA 1R0MA 3N13A 5HDRA 3W2JA 1SJDA 3AQUA 4KMQA 3GR8A 3QR0A 3NIYA 2XN1A 4YYCA 1KFJA 3PWGA 3VNZA 1MXSA 1G4SA 4LANA 5FJOA 2QF7A 2HBVA 4ZCWA 3CQKA 1BHGA 1H7WA 4RZ6A 1BVNP 2X8RA 4DM2A 4ZO7A 4C7DA 4XD3A 4WGHA 3H23A 4UOQA 3VMOA 1UC4A 4TTUA 2DT1A 5D04C 1NH6A 4OIFA 4B90A 1F8IA 4J3SA 2PURA 2INEA 1JNDA 4NAEB 3W7EA 4QITA 2P88A 5HR6A 1XSKA 3LLDA 3NQBA 4IIGA 3DBPA 3GG7A 2Z4GA 1V6VA 2MUCA 3XIMA 2ZUUA 3S9YA 5CPNA 3ICJA 1EH9A 1M65A 1FWCC 1B3VA 3OZMA 4JTHA 4W88A 4WX2A 3PJUA 3W00A 4LVDA 2W66A 3MVTA 3GXIA 2WJDA 1RAKA 1ZPTA 1VBGA 3T1GA 4AG0A 1F5ZA 4NILA 2WMKA 1AK5A 1E9ZB 1XLLA 2WANA 1ZB5A 2BX7A 1L6SA 1SU5A 3A4AA 4GQ0A 3GDTA 4NZ1A 4JIIX 1EQPA 3QH2A 1V0KA 2C13A 3E12A 4E4PA 1XYMA 5EY5A 4GY0A 3GVQA 2D69A 2DJXA 3MHFA 3AXXA 3PPCA 5FJUA 2DSWA 3RG6A 3O6CA 4HSNA 5FEPA 2XIOA 1XLIA 4W85A 2PZ0A 5PTDA 4BQ2A 5BXRA 2DVUA 1CWYA 1H2JA 4C6MA 2QEZA 4FOJA 1FFRA 3S42A 2E68A 3F4CA 4AD1A 1CGVA 2ALRA 2Y4SA 2Q3RA 4Y9AA 3GSMA 3LBCA 2W63A 3CUHA 4A05A 4CQ8A 3OA5A 3AICA 1GHSA 1K9EA 4Y9MA 1PIGA 1T99A 2HXUA 3LTYA 3KBJA 4QDPA 4IPIA 2OODA 1EHNA 1TPC1 3OBEA 3URQA 4UTWC 3C61A 4FXSA 2OWCA 3P0XA 2BFGA 4YYFA 2NUXA 4BY3A 3H53A 3C2VA 3PFRA 3AS2A 3CZ8A 1NP2A 1L8PA 1PCWA 2CNCA 1PZ1A 7A3HA 4JFTA 4QNEA 1W3HA 4GH1A 3L2LA 3CH9A 1FH7A 3DFQA 3SO7A 5LIKX 4ICCX 3BLKA 1KQZA 1VYRA 4BKNA 1KBBA 2NVCA 1NFBA 1BVWA 3NL2A 1EKOA 2VFHA 2B7QA 3B8WA 3UY7A 2NWRA 2BASA 3WSUA 3B8UA 2DDXA 1N8WA 1DJNA 4K36A 3UXIA 1YDNA 2NSOA 3MI2A 3LG3A 1UQZA 1W1PA 3BV4A 4WJEA 4X3ZA 1OGGA 2YFNA 3M0VA 2FZ8A 2D20A 1D3HA 4KT2A 1XC4A 3U2EA 3TYZA 2VOMA 2HWGA 3IPWA 3HB9A 3TIMA 1P6BA 4JFVA 2VQUA 3PPGA 3FJ6A 2ISVA 4HYVA 3S5YA 3H55A 1H51A 5E09A 4RZBA 3VOGA 4JNMA 1JQVA 1V77A 2Z6IA 4GVGA 3O63A 4F9JA 4S3KA 5H91A 3E2VA 4MNMA 3M47A 1V6XA 4Z42C 4IG2A 1LJYA 4QHRA 3EZ4A 2C14A 3A21A 5MHBA 1R2RA 2V2HA 2DH2A 4K1WA 3UESA 5BMWA 3DC0A 1VBJA 3P80A 3Q58A 3TP4A 3ZO9A 2ZQ0A 4L6HA 3KDOA 3E0WA 4WRHA 3G24A 2VDGA 3MHUA 5E5CA 3TQVA 3DHFA 3WZ0E 3IJ7A 5AHMA 1PKYA 3PS7A 2CITA 3PJWA 2E9MA 4B5WA 4DF2A 2B7PA 3FAWA 3UJSA 4ZTYA 5HA7A 1GGOA 4B9ZA 1P7TB 2P3EA 3WK0A 4C60A 1TPH1 3MWCA 1YE6A 3N6QA 1V6UA 3AIEA 1VCFA 4KQNA 3UJEA 4MVAA 1N82A 1GPWA 3CC1A 3QZEA 3RX2A 3VDGA 4BJHA 1EC8A 4WSKA 1JCLA 1EEXA 4DJDA 4DWSB 3GHUA 4NNAA 2JK2A 1CPUA 4GCXA 2ZRWA 2V5DA 2WZEA 1OT1A 3N4AA 1RK5A 3AXKA 3NQ6A 4RKAA 2EEXA 2CEQA 4QAWA 1JPHA 3MY9A 2IS7A 3EDKA 1FWDC 3WQGA 3P61A 3WLHA 1H7XA 2QHAA 5K4XA 5E9AA 1VBHA 4KWUA 2Y24A 3H4WA 4ACZB 1I0DA 3AIWA 1UWTA 4DF1A 3M5ZA 3HG4A 4AEOA 1A3HA 3UZJA 2V6AA 3P74A 2D2JA 4OHQA 3DYOA 4Q22A 1XLKA 2IQ0A 4EPDC 1R7OA 4NY2A 4F4RA 4P8UA 4DVOA 3L4VA 3DFPA 3GD6A 1QR7A 1ZJAA 1TG7A 4DF0A 1CLKA 3S6DA 4W8AA 2Q6ZA 1WE5A 1THFD 1H7NA 1YXCA 4JTAA 3U4FA 2ZZ3A 1UR9A 2FHBA 1A3XA 1TR1A 4ONVA 3VDCA 5HPCA 3JU2A 1KCXA 2X1UA 4BQ3A 3QVQA 4XSMA 3VCNA 4B15A 1UR1A 1G9HA 5I3DA 3NUKA 1XKJA 2DZPA 1Q2SA 1OG6A 4ZB5A 2DT2A 2W3ZA 3VNKA 3RITA 3KP1A 5D32A 2WSYA 3WQ6A 4P7LA 2WZIA 3RGTA 2OOFA 3TAOA 3WBXA 4ZA0A 1MQQA 2HVMA 3SM0A 4TO8A 1XIJA 1R7AA 3LHYA 1FHUA 4JIEA 3C2FA 2PDKA 2AL2B 3MVIA 3MUZ1 3VKCA 5JH1A 2HS6A 3R4IA 4Q4KA 2YIHA 4WXYA 3R8HA 3JW7A 1OC7A 3TONA 3OBAA 2REQA 5MKGA 4WDWA 2OJPA 4D8ZA 1FXPA 3T07A 1QNRA 4HN8A 1DYSA 3CUJA 1XLMA 3VGDA 4JTSA 1BVZA 1ZY9A 3ARZA 4MTVA 1CGXA 3G8EA 1P7TA 1F6YA 2CLHA 3SECA 5U4NA 2GVJA 2E9BA 1J9YA 3ABZA 3PBUA 4JDBA 4U31A 2ZE0A 3GTHA 1BKSA 1QU4A 2PDBA 4HYWA 4MZ1A 3JS3A 3RLGA 2EQDA 1XD1A 4IMFA 2F6UA 2OYLA 1TYGA 2QAPA 3VE9A 1S46A 2SFPA 4F40A 4W84A 3WMSA 4GJ1A 4XG1A 3TEVA 3FDKA 3LEPA 1W9PA 3L66A 3AMGA 3W25A 3LNMA 4ACZA 2HPIA 5U7SA 4DRSA 3P6LA 1KM3A 1UD8A 2QAFA 4IZGA 3KHJA 4X2RA 3AFBA 4H04A 2YB1A 1A5CA 1VD6A 2C7FA 1C92A 3OZPA 4S3AA 3OPSA 2A79A 3P7YA 4PBGA 5KETA 5I2UA 1JDCA 3IS4A 1QI2A 4I7VA 2PODA 3CQIA 1S2AA 3PZUA 2EHHA 1LQAA 3PN8A 1CDGA 3ES7A 3N9KA 2ISSA 3WNNA 1WAUA 1Q63A 1S5NA 3LXCA 4WZHA 4JYDA 2QCGA 3ENLA 2JF6A 3REQA 2DU2A 3IJDA 3TQPA 1D3GA 3RRAA 2UV8G 2PRHA 1UROA 3VCRA 1J0YA 4GKLA 2QJMA 4O4WA 9RUBA 3CZEA 4XTIA 5KZMA 1ZJIA 3P14A 2HK0A 1AL7A 3WLQA 1P0KA 1ZNNA 1AJZA 2FTWA 2HE8A 4UTHA 4S2BA 2AKZA 1FWSA 3CIXA 2J7DA 3CWHA 4W8LA 3HPXA 4GO9A 3WD2A 5K3VA 3KVJA 4K38A 1L8NA 2J7FA 2JF7A 3MMTA 3B03A 1XQLA 4IICA 4ERGA 1MFUA 1ZRQA 3CYJA 3RIKA 1FX6A 1I1XA 1U1UA 1TIMA 4PMUA 3V0TA 3CAVA 2X0SA 3UFYA 1I8JA 3PPFA 2EKGA 4ZXOA 1N55A 5F2GA 3QMTA 4R9XA 1DXEA 3P0WA 1P6CA 5CCZA 2CBJA 1XIBA 4KRTA 3OYXA 1MMFA 2R1LA 4GUJA 3TOYA 2RDWA 3ZVHA 3UVAA 2Y0FA 3W87A 5HMSA 4ZVJA 2E3ZA 1X8CA 1MEWA 2E9LA 5EPDA 2Z1XA 1Q8JA 1NAL1 3M43A 2ATMA 1GOQA 3EPMA 1PL9A 3SGUA 3SEPA 3S4TA 2FZ9A 1PDZA 4QNWA 2R6OA 4HOZA 2DP3A 2YCIX 3E9AA 2WMIB 1RY0A 3W1PA 3ZLHA 3L4TA 2NV9A 5DF0A 4U10A 3H2EA 2EPMX 3N73A 5DEZA 1NDZA 3TTQA 3TKFA 1JDFA 3P93A 4IUGA 4Q33A 3UD6A 5B7YA 1FFQA 3LGEA 4DJEC 3QFWA 3W2NA 2AAAA 3MZNA 2WBKA 3KOZA 3Q94A 4LBRA 3LCWA 2V2CA 4H9VA 4CN4A 4LYPA 3GNOA 4CVUA 2GQ8A 2C16A 2YB4A 3KWSA 4L9ZA 5KZDA 5EMUA 2VWTA 3NO5A 3L67A 3UBPC 4HCLA 1QI4A 2EG6A 4EP8C 4YIWA 1WX0A 3EX3A 3IV3A 4LALA 1W37A 1V7AA 4M1RA 1S2TA 4NYYA 3FEMA 1EUNA 4JTRA 2QCMA 4S3EA 3WUGA 4HNLA 3M7WA 1EGMA 4ZENA 1REQB 4Q8PA 1QOXA 1DJXA 2ZRVA 3DCPA 3N3MA 4C6QA 1BG9A 4DY1A 4UNKA 3DHPA 4MB4A 4LWWA 4BF7A 3STCA 1C93A 4MDOA 4YTUA 1M53A 3BDKA 3H4GA 1RY8A 3ZJ6A 3CV7A 3TCSA 2VZUA 4LUJA 3LXBA 3VVGA 2UY2A 4ERIA 2C3ZA 2ZZ4A 3RHGA 4LY4A 2E1DA 3L9CA 5E0KA 1VKFA 4UWMA 1PCKA 2PBOA 3KOWA 5DXYA 2EPKX 4FF5A 5K7JA 1W1IE 2B81A 3PM6A 1K7EA 3GH4A 3EWCA 3SW6A 1S5WA 1DWAM 3GVVA 3WD4A 4I7UA 3TTOA 3GU9A 4ADTA 5DANA 1FWIC 1GQJA 3MU7A 4GC4A 2ZZ5A 1GKRA 2Z28A 3PTQA 3LY0A 1SPQA 4YTTA 4L4OA 4AQLA 7TAAA 2GSEA 1LWJA 5A6AA 2VVNA 4KERA 3TAKA 2OXNA 2NT1A 5I6SA 3VKDA 2Y1HA 1YDYA 5HMEA 3WH5A 4NU7A 2V8ZA 5H6HA 4L9YA 1RQBA 3TYCA 4B5TA 5BYWA 3N6JA 2A5HA 1GZGA 3GVWA 3OP2A 1DIEA 1VFLA 3ISIX 3VGEA 3DOPA 1B3YA 4TU1A 3DI0A 3JZUA 3HG3A 1QMLA 1LL7A 1OG0A 4LAKA 4UFHA 2WVVB 1J2BA 3UETA 3V5OA 5LHFA 2VEMA 2WNQA 5D9MA 2P0IA 2PC4A 4ZXLA 2BMBA 2XVKA 5K9DA 1I75A 1EQCA 2QUTA 5F2MA 1KM5A 2GGEA 4O50A 1BLIA 3I3DA 4DJED 3AWNA 5GNYA 4QRNA 2VRJA 1YIXA 1XX1A 3PZGA 4PUEA 3TJXA 1US2A 4I6VA 2J25A 3B0UX 2OX4A 3T7VA 1HW6A 3QHMA 2WSKA 4YTSA 5LHEA 1XSIA 1UA7A 1GYLA 1W56A 4JYFA 1G01A 2C15A 2Y6ZA 3WENA 1SFSA 4O0ZA 2ZRXA 3AI0A 3HV8A 4HZMA 4AD2A 2J9XA 2A21A 1G4EA 4O4VA 1RA5A 2CZVA 1JPMA 3MCNA 5AHIA 1B90A 3DUGA 5FJJA 1FWRA 4LBSA 2VELA 4OU1A 4UC5A 1EJTC 4E2BA 3ITCA 3SCVA 2VX5A 2DY3A 3S2JA 1F4AA 3MT1A 1VHNA 3S2CA 4QG8A 4WY0B 5CPTA 3N6HA 1ZSXA 1XPGA 3UG8A 1R46A 3UZYA 5A8GA 4J35A 4WF7A 2PD5A 1NELA 3R0UA 1LWIA 4KGLA 2E8YA 3L0NA 2J66A 3W1LA 3GIQA 4FLOA 1W54A 4WKAA 2VGGA 3RLUA 4JY8A 5C9RA 2VUNA 1E56A 3B0VC 5KMYA 1B3XA 2VCBA 5FL0A 1BF2A 2RH9A 4HPXA 5JXQA 4ZO9A 4EF9A 1MRAA 1VBRA 1YNPA 3FXGA 3GU2A 3MSYA 1R3WA 4D6CA 2ZADA 4DNHA 4ZZ9A 3FSUA 3B04A 1OFOA 5FCZA 4JN6A 5CPSA 4MNKA 5AHFA 2F2HA 1I9CB 5CZSA 1X1OA 2GSJA 3WF4A 3PZQA 4QJ3B 2O9PA 2P5NA 1HN1A 4H8VA 3LQLA 3KP0A 3RFAA 3E6EA 1TJ1A 1C8XA 1O68A 2L5HA 2X7VA 4ASTA 2PTXA 3O9NA 1BRLA 1JQXA 5AVNA 1EJWC 4TV5A 4M7TA 2XN2A 1XUZA 2DZSA 6XIAA 5EMJA 2GDUA 4YLWA 4D72A 3FSTA 4QSHA 1E40A 4E4UA 4HPGA 4IX2A 2X05A 1JCJA 3L2IA 3VO0A 1WBJA 1F07A 4LVAA 4DZAA 5C8BB 3BOXA 1BQGA 5FOOA 2QUVA 3AHZA 4UQAA 2WVTA 1OD8A 4AFYA 3P67A 1KM6A 1BGGA 1ZAIA 3H8AA 2VYOA 1AZ1A 5HJLA 1TV4A 2QDHA 1GQLA 1EF3A 1PWMA 2C1IA 3WK2A 1TPDA 1XV8A 3KLLA 4HN4A 1PZ0A 2TYSA 3G1XA 1IIHA 3W3OA 5A6JA 2OOGA 3SIMA 3EOOA 3TX9A 3WLTA 1V3IA 5AYBA 3BOFA 3VA8A 3UWUA 1SZFA 5IDIA 2RUSA 3RU6A 1Q6DA 3GC4A 1BYAA 1B0IA 7REQA 3ARRA 3EX4A 2IMRA 2OSXA 4JN7A 2G4JA 3DECA 3UQNA 3L4ZA 1W1YA 4US5A 5DELA 2I1OA 2ZRYA 3BQ6A 4HA4A 1E43A 2PWHA 4OBTA 3KAOA 3UA4A 1A5UA 1KXQA 1N2VA 2WAGA 1LBMA 3E2SA 1M5WA 4NZJA 2ZUVA 1Q6LA 2X1IA 4NZ3A 4JCLA 1XCWA 4KW2A 4GGHA 1JJKA 4AMCA 1ZLPA 4HSOA 4JHMA 3B9NA 3FNDA 4JN8A 2CLLA 2BLEA 1EB3A 4M24A 1KW1A 1LL4A 3K1GA 3MMUA 3HPFA 4RDWA 3NQDA 4AD0A 4HVXA 4W93A 4PYSA 1KWKA 1MXGA 1T8XA 1IQ8A 3C4UA 1UWRA 2PGFA 1RP9A 3FXYA 2D3LA 4IXXA 1DTNA 3BW2A 7TIMA 5I0DA 3ZJKA 1XBZA 3HPSA 5ECVA 2E7FA 3I6EA 1W9DM 4WVXA 3HQNA 1NFGA 3R10A 1YTDA 4YL2A 1R8LA 3RK8A 2Z7KA 1EP3A 5A6LA 3HIJA 4YNGA 2O92A 5BROA 3WK3A 1BWVA 2E4TA 2I5QA 2VNCA 3TR2A 1VPQA 1OF6A 5CZ0A 3M7SA 3LHVA 4GUFA 4C6EA 1JULA 4E2OA 1HNYA 1GK8A 2FMNA 1UWQA 3WH7A 1BTMA 1ME9A 4HKPA 4M82A 3W24A 3S1WA 1YPFA 1V0LA 1W91A 4QG6A 2QCDB 2E6AA 1P6WA 2BY3A 1GZ1A 2QCLA 4KCVA 4OWGA 4C6FA 3VOIA 3VM5A 4D6FA 3R1ZA 3P2VA 4NNCA 3ERPA 1KC7A 3C56A 4DUOA 3SGGA 4FEZA 1MNZA 1QBAA 1YNYA 3L2MA 4BQ4A 5D38A 2NW0A 4EPBC 4LVGA 4H9UA 4N0RA 3NM1A 1YDVA 2QS8A 1W1ZA 5D8ZA 3QC0A 3CL6A 2VENA 4AZBA 5LNVA 3D3FA 3HURA 1DL3A 2D0FA 3PZ9A 3QPYA 4R7WA 1IGSA 3CTTA 2YDQA 1KV5A 1AODA 1RBOB 3HTWA 3P3BA 3GIYA 3CAQA 6ALDA 1EHAA 5A2BA 1X97A 2UY4A 5IBXA 1Y8BA 3N2OA 1TV3A 5BXSA 2W62A 3UGRA 3ARPA 3FS2A 1A5KC 4P61A 4B5VA 3D0CA 1OM0A 5T26A 4Z2JA 4FK9A 5I7GA 4DO7A 3SN4A 2ZIDA 3DDMA 4DWDA 3WH8A 3GHSA 1GVFA 3M16A 2YW3A 2DIEA 3MB9A 2PF8A 3S83A 3CMGA 3MKKA 1R87A 3N34A 1FWAC 1VFOA 2CBIA 4Q4PA 5C9XA 1M04A 2A1YA 1EIBA 2VQTA 3DFSA 2O55A 1IEVA 4NIRA 1C9WA 3WLNA 4QFUA 3LBMA 1HX0A 3KRZA 1UMYA 3WBEA 3GKFA 2C19A 2WHMA 3EB3A 4R34A 3SUWA 3HFYA 3AISA 3BG9A 2CETA 1MUMA 1PVNA 1AQMA 4PL2A 3WF3A 1TUXA 1ONRA 1WZMA 3O07A 2DZXA 1YHTA 1O6IA 5CSRA 3DESA 4WSHA 3SQMA 3UCDA 5I77A 4P7OA 1XLHA 4V28A 4CN6A 1RVGA 2Z29A 4P8WA 4FNPA 1P0NA 5FF4A 1M3UA 4Q8WA 4XZLX 4M6VA 1JPDX 1KXTA 1W5MA 3IJIA 2CLMA 1QRQA 1EYEA 4PSPA 2VEPA 1ISYA 4XZIA 3NSXA 4GNKB 1KFBA 1AZ2A 3WUBA 1J6PA 1LP6A 3WNMA 2QCDA 4DJFC 1JUBA 1OJXA 3XISA 1QOPA 4WEVX 5A1AA 4AWUA 2F6KA 3FDGA 5D30A 2YL5A 3TLQA 1I60A 1F74A 1JZ8A 3IGUA 4BR1A 4D1JA 4GISA 1EBGA 3NAVA 3P8IA 2NV1A 5KTLA 5TAOA 5FF3A 4GNJA 5CGTA 4GQRA 3WL0A 2BXYA 3LLXA 1XJBA 1QTWA 2V68A 2HK1A 1G5AA 4A35A 5J8LA 4B5SA 4XZ9A 3QXBA 1J93A 3VGHA 4C1NA 4MPKA 3B8VA 1M7PA 3B8IA 1Q6CA 4K7YA 5DMMA 1BD0A 2G37A 1ONWA 2RJHA 4AY7A 5A8QA 3VD7A 1QW9A 2DPEA 2VRKA 3QJAA 2CBVA 2FB2A 2B4GA 2V0TA 2FTPA 4N7QA 2PA6A 3W23A 2BGSA 3N2MA 4JS3A 3VD3A 3LZ5A 1GVRA 4JHZA 4MJZA 2J4GA 1ZJHA 1SFJA 4GIYA 4Y96A 2WCGA 3V18A 3VNMA 3VGGA 3VOCA 3E2RA 3N2BA 2PU1A 3DHDA 1GVQA 1IF2A 2YBTA 5I24A 4GUHA 4L4PA 4RNJA 2D2GA 3NZRA 3FW6A 3FJ4A 2ACRA 4JX4A 1E4LA 3PULA 1JDEA 1GW9A 3LCGA 3KZSA 4L6OA 4JL2A 5REQB 2F6XA 4AIEA 3KRBA 1H1YA 3SR7A 5HMFA 1GOKA 4Z2GA 4QBXA 1U83A 2I16A 1MW0A 2AKMA 3H2CA 3AXIA 3AROA 1JZ5A 1O60A 2DH3A 1FP9A 3NR0A 2YLLA 1I4NA 3O6YX 1CYGA 5D9OA 2PI6A 3GW3A 1Q2RA 3WJSA 4O17A 3GHTA 1W3IA 3M0JA 4HPJA 3WJYA 4ML9A 4FLSA 1SJCA 1WZLA 5J5DA 2BWGA 4A21A 4AIUA 5LGZA 2IXUA 1J6OA 1MI3A 3EPNA 3BAYA 3WQ8A 1GVIA 1YXYA 1H4PA 5CZTA 4BZYA 4LY8A 2VD8A 2VX6A 2W9MA 1QI0A 2CFFA 1GEHA 4O19A 4ROPA 4D1IA 5CGMA 5D2WA 3LBOA 2X41A 2D23A 3SRDA 4W5ZA 3SGZA 3NZ1A 1MUWA 3NQGA 3G0UA 2ZKMX 3HZ3A 1OC6A 3P8JA 5I78A 2E5DA 3VGBA 2A85A 4A22A 3AAMA 4ML4A 3H70A 1A5MC 3VTRA 2GUYA 3KM8A 3MP5A 3G8RA 3TA6A 3QBUA 2ZVIA 5FKYA 5JU6A 3C8NA 1DJGA 5DCEA 3M0LA 3OODA 4LSBA 3WF0A 3IIOA 2WC3A 3QSRA 4AF0B 4F0MA 4GYJA 4F9DA 3YPIA 3I65A 4UFKA 5GQBA 4PBFA 3GBDA 3P84A 3UZXA 4GG9A 1XIFA 1TCDA 2PGEA 5GJNA 2G50A 4ZQNA 4UMCA 2WJFA 3C3NA 4J3TA 1I2NA 2R8WA 3RJXA 4PUJA 3M6DA 4MZYA 2IPJA 5FJTA 4EXQA 3CUIA 2DSKA 3SAZA 1M41A 2JKPA 1UOKA 4US6A 2Y7DA 4HMEA 5LIXX 1CXEA 1V4YA 3WDIA 1ALDA 4WKFA 2VR5A 7XIMA 2PDCA 3A23A 3VMPA 1K8XA 3AHVA 2OYMA 1OK4A 4ES4A 4KFNA 2DQWA 1DWFM 3PWAA 1I45A 3M41A 4AHOA 2HRWA 2ZUWA 3PZVA 2WMHA 2VFFA 4L4MA 4UFLA 1FWJC 3S1XA 3O1NA 3C2EA 3LCHA 1N8IA 3URAA 3ITTA 3HN3A 1IXOA 4DLMA 3BMXA 2OYKA 3EA3A 2PLKA 2TSYA 3TW9A 1G69A 3E0FA 3CZGA 3M0XA 3WH9A 4DXXA 8A3HA 1RK6A 4QDMA 1F05A 2YLAA 3BC9A 4GI8A 4JKMA 3UWWA 3LV5A 5CAKA 1GOWA 3NEHA 4W5UA 3ZT7A 2XH4A 2FJKA 1ZJBA 2GUUA 4Y9NA 3GU1A 4U2ZA 4WOZA 3BTNA 2J9YA 3FA4A 4JQAA 4IIEA 4K68A 2XGBA 4RR4A 4UTUA 1D2KA 1FCQA 4HSHA 7ENLA 4QEEA 4X60A 4LCQA 1KR1A 4ZQPA 1CXFA 3HMJG 4IQJA 3K1DA 1XQKA 1B3ZA 2WBGA 2ZA3A 3M0HA 5JMUA 2DJLA 3TH6A 1X98A 2A3CA 1XYFA 2P0OA 2EJAA 3TDFA 4TX8A 3UNDA 4E8DA 3WNLA 2XG9A 1G7VA 1WYIA 1XI3A 4FMVA 3G1HA 4XIAA 4JL1A 3T4CA 3VIJA 1RD5A 4HU3A 1QNOA 2R94A 3VNLA 3T8QA 3OA3A 3RCMA 4DO4A 2QLYA 1Q85A 3STFA 4R85A 5C2GA 5HXMA 2VFDA 3R58A 1UIPA 4O8AA 1L6YA 5DX7A 2ACSA 4ZFCA 3DKJA 5HOSA 4QCEA 4QE4A 2AQWA 1QUMA 1FHVA 1XRFA 2PRMA 4YJ5A 3NQ8A 3I7QA 1XHGA 3HPAA 2V3EA 2Y70A 3ZWTA 3THDA 1NDVA 5CKSA 1Z89A 3AYVA 3MTWA 4C5YA 1BG4A 1T40A 1UZDA 3UZWA 3WN6A 4O11A 3B40A 4L56A 4IX0A 1B4EA 1LQ2A 4NI3A 3WO8A 1T7LA 3N18A 1S2VA 1X6UA 1OYCA 3BSMA 1DWGM 2QT3A 1WQ5A 2G96A 2QGHA 1XPYA 4K1GA 5LYRA 4FX6M 4X9YA 3IIXA 1E0UA 2B0MA 3O05A 3I4EA 1OCQA 2PTZA 4ZOAA 5F7UA 1UD2A 1FCVA 3TOPA 1PTAA 3C52A 2AQVA 2JALA 3K46A 1E6NA 1VLWA 3UWVA 1UPPA 1B31A 3VILA 3R43A 4MKNA 1ESWA 1DIOA 1KNWA 3G6LA 5FJRA 5BXTA 5G4EA 2J24A 3MBDA 1O7AA 3PG8A 4MUPA 1TPUA 3B3DA 3LCXA 1WOAA 1TR9A 4NAFB 4LUYA 3VFCA 1LRTA 4CD5A 1FWBC 5IM51 4I5UA 2EJ1A 2P10A 4L65A 3IJLA 1PZ3A 3VD4A 4ECLA 3OU8A 2OLSA 3VPLA 1ZFJA 3KRUA 1ISWA 3IJ9A 3CK5A 1IEWA 1YX1A 5CQ1A 5K9XA 3JR2A 3TUUA 1HXJA 2J8FA 2E67A 1QO5A 1W3NA 1LUCA 4B4HA 1TWSA 1UA3A 3OIXA 1K70A 2XVNA 3QLLA 3S2NA 1QK2A 4MWAE 5G5IA 1KWGA 1ITUA 3MUY1 3V36A 2WHJA 1V6TA 2Q8ZA 1IT0A 5AHNA 1HJSA 3AWOA 5DCBA 2X2YA 4O1FA 2ZWYA 3D5HA 3F2CA 1GVOA 3O0KA 1E9LA 4J3XA 2NX1A 1QDSA 3BLLA 1V6YA 1SJAA 1MXDA 1PAMA 3G1VA 3KRSA 3HO8A 2BNJA 3GKAA 4KETA 2XWEA 3JZEA 1H0GA 2HS8A 1XLDA 3LMZA 1HL8A 1XLFA 3V0SA 1KM4A 1PV8A 1L6WA 3QV8A 4LUTB 3G2GA 3NDZA 3I3BA 4F2TA 3N12A 3NQ2A 3G18A 4Z1AA 1M9HA 4AY1A 1VLIA 1Z8AA 1MW3A 3QRHA 3U48A 1AH0A 5C6MA 1Z32X 3WQWA 3ARQA 1RVKA 3N25A 1KRMA 1E6QM 1OINA 4DN1A 2R82A 3VIHA 1NWUA 3SUTA 1XLCA 3DU0A 4ZR8A 2NQJA 5HMDA 3RX3A 4J3ZA 3GB6A 2Y8UA 2H90A 3THQA 3OTRA 1MNSA 1A4MA 3ZMRA 5A69A 3K2GA 5CLWA 1PXGA 3MUIA 4XIMA 1WUFA 1GOOA 1LRQA 2ZXBA 3LMYA 2WPGA 4ERAA 2DORA 4JEJA 3R12A 3NVTA 3TXZA 3UNTA 4O16A 4I6KA 2CPUA 4JTTA 1XRSA 4QE1A 5ABFA 1SSDA 5EB8A 2CWXA 1G4TA 1DJWA 2DUXA 4PULA 3PTDA 5AZ0A 5C71A 1ME7A 1QO2A 2C0AA 1VRXA 5BMXA 1EP1A 4WHBA 1YEYA 1K3UA 2P50A 4N02A 4G7EB 3L4UA 4AD4A 4J40A 3BE7A 3F2DA 3NEVA 4OVXA 4J5NA 4AH7A 4WR3A 1IE7C 1UZHA 2CLIA 4AWTA 5BRBA 3VC6A 1ME8A 1LM1A 3C0JA 3KVKA 3IJ6A 4GO8A 2E8ZA 4FX8A 5ABHA 2Q71A 3SUUA 1KM0A 1AUSL 1PJ9A 4D6IA 1EJXC 4XISA 1PB0A 2XH0A 4CQCA 4I9AA 3J7HA 3BQ5A 2A7RA 3W1XA 4EPEC 3IUIA 1V3HA 2NXGA 5F1VA 1B1YA 2LLEA 4HOXA 1KR0A 4J3UA 4PCTA 4D2JA 4O0KA 1K9DA 6PTDA 4HNUA 3T0TA 4DEFA 3THCA 5C5YA 1GJWA 3HG5A 5LXEA 1JNEA 3CQJA 4MWAA 1AW1A 3B06A 4LGXA 3F5LA 3KS6A 5AC4A 2CCRA 2PF0A 3ZYZA 4HD5A 3WH6A 1AMKA 3C5QA 1HKVA 3S47A 4HGXA 1RJQA 4GHRA 3ITXA 1R3QA 3BLPX 4AB4A 3CHVA 1AJ2A 3LERA 3PF3A 5TQLA 2YW4A 3A47A 3BAJA 2ZZ1A 4B2DA 4YN5A 3F4WA 4F0SA 3ALFA 3VZXA 4F2BA 1WP6A 1PX3A 1OCBA 3ARVA 2TODA 3EXRA 1VYPX 3EDFA 1Y7VA 2W67A 4J4KA 5AFDA 3LN3A 4MLRA 1US0A 2FPTA 3GW0A 4GPNA 3WD1A 1VB9A 1UH2A 3PAOA 2B7OA 2J7GA 1A5LC 4S3FA 1FWGC 3M5XA 1XDJA 2GJNA 3VX0A 1ZGDA 4X0VA 3OB8A 2Z27A 1VS1A 3O6DA 3QC3A 5DBUA 1UKSA 1OIFA 4XAFA 4NHVA 4Z2KA 3PUEA 3CTLA 2PGRA 3WDQA 3W75A 4NUWA 3GXPA 2A2IA 1E70M 3W1TA 2D73A 2FIQA 4G7EA 3A4WA 5FL1A 3F03K 1E6RA 2O4QA 4PMNA 3CASA 1X39A 3WK1A 4IMDA 1RBAA 1HKKA 1T5AA 1TTIA 4AC1X