2VFFA

Crystal structure of the f96h mutant of plasmodium falciparum triosephosphate isomerase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
247
structure length
247
Chain Sequence
ARKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHHERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords TRIOSEPHOSPHATE ISOMERASE
publication title Biochemical and Structural Characterization of Residue 96 Mutants of Plasmodium Falciparum Triosephosphate Isomerase: Active-Site Loop Conformation, Hydration and Identification of a Dimer-Interface Ligand-Binding Site.
pubmed doi rcsb
source organism Plasmodium falciparum
total genus 98
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2007-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2vffA00
4HN4A 4AWSA 5DLCA 3HGJA 3PM6A 3HMJG 2R14A 3LB0A 4MY9A 2QKFA 4AVFA 4O18A 3NQVA 4RLIA 1Q45A 4O1BA 4IXXA 4JN6A 4XZ9A 2C14A 3DFTA 1I2QA 3BV4A 1GT8A 3PF3A 1KTNA 1GVQA 1PCKA 4JR5A 3RLUA 2Y7EA 5CPMA 3MYOA 4S2BA 3NOEA 3NL3A 3TUUA 1TPH1 5BMXA 2BTMA 5FI8A 3L0KA 1CI1A 2VENA 3DZ1A 1G67A 3G22A 4RK8A 1THFD 3CWOX 1VLIA 1FWWA 4QQ3A 1JCYA 1YTDA 3B03A 4K38A 4MLRA 2W0UA 1ZALA 2BX7A 3G18A 1W3IA 3W7CA 1TTQA 4QIUA 3CHVA 3MHGA 4LVGA 2ZZ5A 2ATSA 3TAOA 5FESA 2VFHA 3GDRA 3AJXA 2Y7FA 4UTIA 1MEIA 1VYPX 1UB3A 1N8FA 2GQ9A 3LI1A 1GTHA 4E0CA 5CSRA 3BLFA 3LRKA 3MP3A 4LUIA 4JYEA 1OX4A 4K7YA 1LRTA 3P84A 4PA8A 2A5HA 4IQLA 3IGUA 3GAKA 4NJKA 2R8WA 1H1YA 1F74A 1IXNA 4FIQA 1TB3A 2QCDB 4UFMA 3M44A 4YXGA 1VCGA 4N9EA 3NQMA 4NXKA 1H60A 5U4NA 1IIHA 3NQ7A 4AHOA 4QITA 3CU2A 1SQ7A 2QDHA 5AOUA 5D33A 1IXPA 3W7QA 1VQTA 1YXYA 3W7PA 3P60A 1KBIA 4GRSA 1XL9A 3MUXA 4FNPA 3IGXA 4O0KA 3BLEA 1YPFA 1HG3A 2Y88A 4FEZA 4XBKA 4X3ZA 3W1LA 4QNEA 4Z1BA 3TKFA 3G24A 3G0UA 1W3NA 1QFEA 1IGSA 4UNKA 4MZYA 1Z41A 3NEVA 1G7VA 2YXGA 5FEZA 3W76A 2ISSA 3O1NA 4N9DA 1PCWA 4LS1A 2PRLA 2J24A 5AHNA 1MEWA 3LXAA 3L0GA 1SW7A 1VCFA 3QYQA 1UUOA 2A6LA 1ME8A 1JJKA 3C2VA 3RLVA 1PIIA 3Q2DA 3TROA 3E96A 1W56A 5AHIA 1GPWA 2JGQA 3QQ1A 4JTFA 1JQVA 1VCVA 1ICQA 3QQ0A 3CEPA 4I7VA 3H55A 3NQ2A 3B06A 3TV8A 2A7RA 3UWYA 1RVGA 3LTSA 3S1XA 1XFBA 1OFBA 1H7RA 1XBZA 3FS2A 2Y7DA 5TBOA 2ZBTA 3P74A 1J4EA 1LOQA 1SFJA 2CLEA 2Z6JA 5CPOA 4HSNA 3A24A 4IMDA 5FEXA 3MI3A 3UQNA 2A7NA 5DCBA 1GVSA 3V75A 7TIMA 3G3DA 2ZDRA 1V5XA 2FFCA 3PUEA 1ZY9A 4UFLA 5AN7A 3LTYA 5D30A 3W7DA 5HR7A 1KFCA 5FF7A 1OJXA 3M7WA 4NJGA 1XM3A 3I6RA 3LCWA 4LOCA 3EKZA 4JX4A 4PH6A 1OYCA 3C6CA 3W1NA 5K9CA 4HNNA 1JULA 3HIJA 2QUUA 2PRHA 1RQBA 3ABOA 5G2IA 1SFLA 3O6DA 1VH7A 5AHLA 3EB2A 4WY0B 1W37A 1JCXA 5U7SA 4O16A 4WQ6A 3I7RA 2RFGA 1Q6OA 4NNAA 1V7YA 3W2KA 1EIXA 2C6QA 3DI1A 3P5YA 3PY2A 2CLOA 1G6CA 3IV3A 3FA5A 1EX5A 4MKNA 3W9ZA 5F1VA 4M19A 3B0PA 4MJMA 3O05A 5D2VA 2OT0A 5H91A 3WK3A 3GKFA 1LROA 3OHIA 2X16A 3M5YA 1Q6RA 2WSQA 1UBSA 3PR2A 4WOZA 2VFIA 4XKYA 4E2BA 1LLWA 3CT7A 3TW7A 5BNKA 4NU7A 5MHBA 4JIPA 2QCNA 1W0MA 3OA3A 2WKJA 4GNJA 4KFOA 2P0OA 3L68A 3LXBA 4Q32A 2G5WA 2FQIA 5C2XA 3W7RA 1ICSA 1K3UA 2YDAA 4OE7A 3R2GA 4PL2A 3VCRA 4LY8A 3B0VC 1ZHAA 2VFDA 3LM7A 4ORMA 3BK0A 1G4SA 4XWUA 1GWJA 4AMAA 4YCOA 1VZWA 2B7QA 5D02A 3ZWSA 4JTLA 2A85A 4AH7A 1LORA 3G1VA 4AWTA 4O1CA 2E1DA 4IMGA 1OFRA 2DP3A 1XBXA 1W5OA 3CTLA 4ZQPA 1B9BA 2DZWA 1QPQA 4S1FA 5DY3A 5HJLA 2J9YA 3UY7A 4MYAA 3P81A 1TPUA 5TIMA 1EWDA 5DBTA 3OIXA 4DBEA 4C1LA 3TXVA 4O50A 4XTDA 1CW2A 3IVUA 3LLDA 1R46A 1VYSX 3STFA 2GVLA 2Y63A 2VFEA 2HTMA 2V2CA 3STEA 4UUIA 1H5YA 5K2ZA 3TAKA 1M7PA 2TMDA 4UTWA 2C3ZA 1JVNA 4OV9A 3N2MA 4U4MA 3UWWA 3SZ8A 1VGAA 1A5BA 2JGYA 3AO0A 3W7EA 2YSWA 3B8DA 1ALDA 2VKZG 1QAPA 2R91A 3UPWA 1J5TA 4DEFA 1H63A 4DF1A 1H7OA 2QCMA 1YXCA 2ALDA 5IM51 1KLZA 2V0TA 4GE8A 4MUZA 1ZCOA 3ABQA 2Q3OA 2HS8A 2V82A 1EPXA 5LHFA 3WJZA 3M9YA 1GG0A 1TPC1 1UUMA 4XBSA 3RU6A 3HBLA 3M0ZA 3MHFA 1GVFA 3PVFA 4C1KA 4O10A 4UTTA 3S1VA 5I3JA 3NZ1A 2GJLA 2B0MA 1T99A 4GUFA 1EP2A 4AHQA 1FCQA 3W6YA 4N02A 2RHGA 3JR2A 1FXQA 3W23A 3W1MA 2ATMA 3W2UA 3SIZA 1W1ZA 5AHMA 3PBYA 3G3MA 3VI2A 3PB0A 3CM4A 2D73A 4NNCA 3NM1A 3KAOA 3ZFHA 3LV6A 5F2MA 5EYWA 3MO7A 3MI6A 4JTEA 4DPQA 1LDCA 3L67A 2ZYFA 2DJXA 2FPYA 4I7UA 1I45A 2RDTA 3IIVA 3GAYA 3G1HA 1DL3A 4OGZA 4IPJA 4HPXA 3A23A 1XKYA 4H6KA 4FNQA 4FNTA 3W86A 2CU0A 2JBMA 3DI0A 3NQFA 5DXXA 5L6UA 4M7TA 1TSIA 3GK0A 3THAA 1T8XA 5CKSA 2TRSA 2CLFA 2NX9A 4OBTA 2QJIA 4MY1A 2QCDA 1SU5A 3UPBA 4RR4A 2QCGA 5CZSA 4GUJA 5G1TA 1WBHA 1P4CA 4O17A 1Z42A 3GNDA 3B0UX 4Z0JA 3OEXA 3RMJA 3P7YA 2BWGA 4GC4A 3O06A 4Z08A 1F6KA 4BK9A 3GDMA 3LHTA 2V81A 4H4IA 2ISVA 5K9DA 1R2RA 3BARA 2HSAA 4HT3A 5C54A 4QAIA 2VFGA 1GTEA 2FB2A 1JR1A 5AHEA 3M5VA 3MMTA 4LC8A 4UCGA 3KVLA 3M5XA 5AYXA 2KZHA 2QCFA 1TYGA 5H2ZA 1F7BA 1WYIA 1DHPA 4BWLC 3DH7A 4BR1A 3HGOA 5CSSA 1EUNA 3W72A 1T0OA 2PURA 1TV8A 3H53A 2A1YA 1H7WA 3LCFA 2E5CA 4LV4A 2XFWA 3T78A 3N73A 3ATYA 3P5ZA 3TCEA 3QM3A 3M41A 2ZZ7A 3WK1A 4CNOA 3WFAA 4YMZA 1IF2A 1Z44A 4JTHA 2H90A 4LW7A 3W73A 3FLUA 3SGZA 4N9CA 3C3NA 4NJJA 3F4NA 3VE7A 4ZQOA 3W7IA 1AMKA 5BOOA 3E9AA 2UV8G 3Q37A 1PE1A 2V2HA 5LNSA 3HGRA 2H6RA 3IIZA 2PCQA 3ABSA 4N6FA 3O8AA 1K8XA 4O19A 3W88A 4S2CA 3SGUA 2QDGA 3P8IA 1I8JA 3CC1A 2WJZA 3SR7A 3STCA 3UYCA 1FWTA 1TV7A 3MWAA 3S42A 3NR0A 5G2WA 4E38A 3LCGA 4R33A 4UR8A 4OV4A 1FQ0A 4EOUA 3C0JA 1KM2A 1TTPA 4KWVA 3DFSA 1C29A 1Q6LA 2I14A 3TW6A 3DKLA 4PEKA 1OF8A 3L5MA 1AW5A 1HL2A 1TREA 3P62A 3W7LA 4HIBA 3W1QA 3O07A 2ZA3A 2DU2A 2VFFA 2WNZA 1HFBA 1TPFA 4ALDA 1ADOA 4UTMA 2FPVA 2W79A 2X1UA 4DXVA 3PBVA 1KM5A 4ZZ9A 3R8RA 3UY8A 1G4EA 2XN2A 4NNBA 5DXYA 3W07A 2GPTA 1SO4A 3LI0A 3CB8A 1A50A 4BI5A 3W7OA 1KA9F 3HG5A 1M7OA 3W1AA 5FEWA 4DELA 3MYPA 3N9RA 3L0NA 1K8YA 4NJHA 4AEOA 5D2XA 3GX9A 4NZJA 4JTKA 1QCWA 4UIOA 2ZZ4A 1XCFA 4EF9A 3TIMA 1H7XA 3GDLA 4FX8A 2A0NA 1FWRA 3TSBA 1P0NA 4N6EA 3USBA 3W2JA 5KINA 3NA8A 3V1PA 5FF0A 5G4EA 3QZEA 3NL2A 3DHDA 4RXFA 4ZL1A 1O60A 5AB3A 4NQ1A 3ZWTA 2DZSA 1K8ZA 2C0AA 2ZFAA 3G8EA 3PUDA 1UASA 2EAWA 5IBXA 3TMQA 4N2YA 3C56A 4GUIA 2V30A 1QNVA 3LCIA 5FF4A 1SPQA 4OT7A 1KFJA 4KKXA 1RZMA 1FCBA 4UNLA 2CZFA 4POCA 3GYEA 2YX0A 2QCCA 4XQ6A 2GUUA 2NXIA 3L5AA 4K8EA 5LGXA 1T96A 5DCEA 1SW0A 3C52A 3MBDA 4CNPA 1HTIA 3OVRA 1F2JA 3BG3A 4HPJA 3NQCA 4JTSA 5L9FA 3A21A 3DKJA 4ONVA 4WXYA 1MZHA 2QJHA 3UWZA 3UWUA 5SWUA 3MP4A 3LERA 4Y90A 3R13A 3GZ3A 2YYUA 3P8JA 4UTHA 1YPIA 1QPOA 4ZVJA 3HB9A 5CPNA 3KVKA 1WAUA 1H1ZA 1SO5A 3QMRA 3EX1A 1DJNA 3MI2A 3W7MA 3DFNA 4N4PA 4JX6A 4PCFA 3CLMA 2FB3A 1F5ZA 4OHQA 3SFKA 1BEUA 1NEYA 2B4GA 1OF6A 1OFEA 3PS7A 1KTBA 2VEPA 3STGA 3LHZA 4IPIA 4X9SA 4LU0A 3LCXA 4LWWA 4CQ9A 2F84A 3N9SA 1O94A 5LZLA 4Z1CA 2YZRA 1WV2A 3EWWA 3LCLA 4AF0B 3G1YA 2QJGA 2C13A 3LLFA 3C61A 5AHFA 4YLWA 2WSRA 2CZEA 4R7JA 3SJ3A 3GIYA 1DVJA 1FDZA 3TMLA 5LGZA 3TSMA 4N4QA 4JD4A 3KRSA 3FJ6A 2EF9A 3G1AA 2DZPA 4JY9A 3TSDA 2NXHA 1S5VA 4HNVA 3M16A 4RZ6A 5F1UA 3WJYA 2VEKA 1DQWA 1GJPA 3TR2A 2CZ5A 1ZFJA 2ZA2A 3R89A 1LBFA 4AWUA 4Y8FA 3G8RA 4JXCA 5F4XA 5FEPA 1QMLA 3PG9A 2B7NA 4IX0A 3G1DA 2CLHA 1LOSA 2CLLA 2VEIA 4EVZA 4GUHA 1KFLA 4N9BA 4LTSA 1O5KA 1LLZA 2Y89A 1ME9A 2CFFA 2A2IA 3JRKA 1TMHA 1ZJIA 1YLVA 2ABAA 1L6YA 1OYBA 4LUJA 2IQTA 3TA6A 3UNDA 1R2SA 3HG4A 4HNTA 3L9CA 1A5AA 2CLIA 2C1HA 5A5WA 3K30A 2FLIA 5CZJA 3F1QA 3G1FA 1SZNA 1LRQA 5I3HA 1LCOA 3EXTA 3HPSA 4QJ1A 2ZZ3A 5EY5A 3UZ5A 5K7JA 4L4LA 4WZHA 3EWUA 3ABRA 3R5EA 1KFBA 1PVNA 4MOZA 4YWIA 1WBJA 2VXNA 2CW6A 2V5LA 2QEZA 2WSYA 1LBLA 1G4TA 3TQ0A 4WXZA 3U8GA 2P1FA 4EIVA 3KRUA 1FWSA 1TJPA 2CZDA 2Y62A 1EB3A 1F76A 3W7NA 3S0CA 3C2FA 1XI3A 4QM1A 3E49A 2GQAA 2J27A 1FBAA 2YR1A 1M6JA 5LSMA 4JS3A 3LXCA 4MFDA 1IXOA 1UJPA 3DBPA 3INPA 5D32A 5HMSA 3NG3A 4TU1A 2NV1A 3WJWA 4AXKA 1PV8A 3EX3A 4PTNA 1GYNA 2Y70A 2HS6A 4O1AA 2JKEA 4O0ZA 5EKYA 3U2OA 1Q3NA 3QC3A 3B04A 1H62A 1N55A 2JKPA 1WA3A 4WJEA 3BGJA 3NQGA 5D37A 4A22A 5KZDA 1R47A 5HQEA 3W3OA 4X2RA 4UTLA 1FWNA 2E5DA 1LRNA 1WQ5A 1VS1A 1EWEA 3W1PA 5HWMA 4Z0SA 3NM3A 1C9DA 4IGHA 1XC4A 2GVGA 3W7HA 5EMUA 3UZJA 3NPWA 4JYDA 2A7PA 3ZR4A 1OFOA 5CPLA 1O95A 3C8FA 3M47A 1KFKA 4X22A 1OX6A 4ADUA 3BLIA 3PAJA 6TIMA 3DHFA 3NQEA 3O16A 1AL7A 4WD0A 3B05A 3W83A 3IIXA 4CLMA 2QAPA 3NVTA 2RDUA 1DBTA 3GDTA 3P82A 4BWLA 2YCEA 3TX9A 1OHLA 1S5WA 3GVGA 3PB2A 2EHHA 3BPWA 2X1TA 4WY0F 4LC6A 3M6YA 3NL6A 5E0KA 3W2NA 3E02A 3NQ8A 1P1XA 1DORA 5BMWA 1EEPA 3UWQA 3W7JA 1QPRA 3RFAA 4KFNA 3IIOA 3S5NA 3ANYA 5E93A 3QW3A 3SY5A 3S5ZA 4M7SA 5KZMA 5AC6A 4R34A 3JS3A 1B4EA 2NX1A 1K7XA 4HKPA 4NVTA 1CX9A 3IVTA 1WDWA 3OBKA 3MHUA 2JKAA 4TX9A 3TU9A 3BG5A 3P61A 3T44A 2NUYA 4UXDA 3A9IA 1L6SA 2RDWA 2C18A 4TMCA 4O12A 3NQAA 1FCVA 4DO5A 3EWYA 1Q6QA 2TSYA 4RX0A 1YDNA 5FF2A 3W84A 1X6UA 3CIXA 3NQDA 2YPIA 2EGZA 3SSJA 2B7PA 3QJAA 1KM3A 4JGDA 2V8ZA 1H7PA 5K3VA 1GVRA 5DELA 2ZRVA 3NL5A 1PL9A 4MZ1A 5KITA 1ZAIA 2E77A 1E51A 2CLKA 4O8RA 1SZFA 2RH9A 4JIQA 3M5ZA 5LHEA 4NX0A 2V5BA 2NUXA 3DXIA 1VRDA 1OYAA 3A5FA 3GDKA 1OFPA 1XXXA 3RNDA 3EEGA 1NAL1 2WNQA 3A22A 3NPXA 2F7FA 1YYAA 3SECA 3IIPA 1PHWA 1X8FA 1MXSA 1OABA 1KLYA 3W1UA 1BWKA 4OU1A 5LNUA 3GXTA 1H50A 2WPBA 4JTUA 4Z1AA 1GQNA 1I2OA 2FJKA 3BW3A 3HG2A 1EUAA 2WQPA 4Y6GA 4Y96A 3QSRA 3S6DA 1LZOA 3N14A 4M6QA 4RCXA 1O5XA 4O4VA 5C55A 4TR9A 3GR8A 3MBFA 3GKAA 3VE9A 3M1ZA 5BRBA 3T7VA 2BLEA 4OWGA 1XBVA 4K39A 1WOBA 5TQLA 1RQEA 2ABBA 2ZZ2A 3LHWA 4Q4KA 2VOMA 2YW3A 4O13A 3QH2A 1F05A 4EF8A 3HPXA 2I9EA 1FCUA 2HMCA 2NXGA 1YDVA 2E6AA 5G1YA 3B4UA 3TQVA 3I7QA 4D2JA 3IGSA 4LS0A 4EWND 5HR6A 3L21A 4JX5A 2BSLA 4M5PA 1B57A 1OK6A 1G4PA 3G1SA 3NPUA 1XDMA 3S5YA 1SUXA 4HSOA 4UTJA 4AF0A 2FDSA 1MO0A 4IMEA 2FPTA 4DO4A 1ZAJA 2O7QA 5HWJA 3TQKA 4LV9A 4NJIA 2ZRZA 2GJNA 4O54A 1AK5A 2J9XA 5DBUA 4P61A 1QO2A 3LHYA 1TRIA 1SZEA 4ADSA 2CWNA 4I9AA 3LBCA 5AYZA 1HO1A 2EPHA 2E6FA 3KFTA 3TDFA 3MW7A 5D05A 4ML9A 2DJLA 4XTIA 1VR6A 3W70A 5D09A 1FXPA 1ME7A 1KBJA 2E6YA 3N2XA 4K37A 3NO5A 2OT1A 1Z48A 3FKKA 1W8SA 4ZQNA 4UMAA 3PBUA 2EKCA 4BI6A 3NXFA 1AW1A 5EPDA 2X30A 4JTJA 4HNUA 4K8HA 4JYFA 1W5NA 3QEZA 1LM1A 4FNUA 1QO5A 4M6PA 2X1SA 4WY0A 1NF0A 2YFOA 5F2LA 5I3GA 1TPEA 1B4KA 3W2MA 5F4WA 1KV5A 4B5NA 4WX2A 4MIMA 1N7KA 1SSDA 2NX3A 1W3TA 3MP5A 3TK7A 2Z0IA 1KW1A 2I1OA 1TPVA 3R12A 2DORA 1PS9A 4O11A 4GWEA 3KVMA 5HULA 2A4AA 1OVDA 2VELA 1VHCA 2G96A 2WV8A 3LHVA 3N3MA 5ABTA 3LBMA 2E6DA 4DPPA 1S5TA 4DF2A 5LNRA 1YXDA 3W71A 3C2RA 1I2RA 4LVBA 1FUYA 1KM6A 1GG1A 2RKXA 1D3HA 3EX2A 4IX2A 3WK0A 4NUWA 1FDJA 1RR2A 3O6YX 5LNVA 1JCLA 5HWNA 2TYSA 3FFSA 1OFAA 3WJXA 1L9WA 2WNNA 1LP6A 1M5WA 1AG1O 2ZRUA 4CCEA 1SSGA 3QMSA 2QCLA 3M43A 1TTJA 5D2TA 4CQAA 4ZQMA 4JDYA 2P10A 4LVDA 3DAQA 5D38A 4WOQA 2A6NA 1NSJA 1OX5A 2G95A 2JK2A 5A8GA 2Z2UA 1S3HA 3TJLA 4MJZA 3TH6A 5K4XA 1FX6A 4MVAA 3LHUA 1EP1A 4H3DA 2FTPA 4M6VA 4QISA 3BGGA 2QCHA 3PUOA 1RQHA 1DOSA 1SR9A 3TJXA 3W7GA 1NFBA 3DGRA 3GXPA 5G4WA 1K7FA 3QF0A 5HNRA 4E2DA 1MEHA 3O6CA 1D9EA 1GYLA 4WUIA 4CNNA 1Y0EA 4ZMGA 2H8ZA 1IXQA 4JDBA 2LLEA 3FJLA 1KTCA 4AAJA 3VKJA 3W85A 2GQ8A 3E12A 3NPVA 5T26A 4DF0A 3CIWA 2H3BA 3D0CA 1H61A 2DZXA 3Q94A 1QDSA 4IMCA 3QPYA 4JTGA 2O7SA 4O14A 4Y9AA 2ZA1A 3FOKA 4ICNA 4RV8A 1VHNA 1QWGA 1WOAA 1DKWA 5KZEA 5FF3A 2OJPA 1JCJA 2WOQA 1J2WA 4UMCA 3CPRA 4YL2A 5HUPA 1WXJA 1TIMA 3U6WA 4BI7A 4RZ5A 1FY6A 3LGEA 1L2UA 4P2VA 3E0IA 1TCDA 3WK2A 4O28A 5C6MA 1VLWA 3PG8A 3L66A 2Q8LA 2AQWA 3P80A 4LVFA 2XN0A 1TV5A 2Q8ZA 5LNWA 2C19A 3S9YA 2Y61A 2R94A 2NLIA 5D2YA 4FIRA 3BW2A 4JNMA 2B7OA 3CQ0A 3S1WA 3DENA 1GEQA 3G0SA 5DN1A 3PULA 1GZGA 2XN1A 3BVJA 3KVJA 3THQA 3OVPA 4MFEA 5E1QA 5F2GA 4A21A 3UXDA 5AYYA 3IRDA 4TIMA 5CZ0A 2OMAA 3L65A 3PSVA 2ISWA 3OG3A 3S1UA 1ONRA 3T4CA 3TE9A 3PC0A 1UCWA 5AC7A 2ZZ1A 2ZTJA 3HQ1A 2VEMA 2NZLA 1GVOA 2GOUA 1A5CA 1K7EA 4U28A 1X1ZA 1JQXA 2ZRYA 1W5PA 3NYZA 4FHAA 1ZENA 3L2IA 2H3DA 1SO3A 4UMBA 3UWVA 3QMTA 4FNRA 3SW6A 1C8VA 2ZCGA 3FIGA 3LDVA 1JUKA 3KRZA 3GB6A 1F6PA 5IBXC 1L6WA 3L5LA 3DFQA 4ORIA 4FO4A 1JCNA 3I68A 4K7VA 1JRBA 3BO9A 2ZZ6A 2AGKA 2C16A 4UFHA 1TQJA 1EA0A 1VPXA 2Z1BA 4J9JA 1X1OA 1TPDA 1G7UA 4GBUA 4GJ1A 1D3GA 2E5BA 3HGSA 3LRMA 3EKLA 1XBYA 1KM4A 3BW4A 3P67A 1XDLA 1O4UA 4A2SA 3WJSA 5EBUA 4KWWA 1IIGA 2GVJA 1LTDA 3ATZA 5G5IA 3FYOA 4BFAA 3Q58A 3QRHA 3EX6A 3QFEA 3LX9A 4NT0A 4LNYA 5CGQA 3PWAA 2ZQ0A 2V9DA 1TPB1 1YTEA 1WX0A 4QSHA 5J5DA 3TFCA 3KOFA 1H51A 4MYXA 4PL1A 3TC6A 3W87A 1OFDA 1YDOA 3EX4A 3PBWA 5KSWA 1I4NA 1A53A 4JICA 4MY8A 3S8HA 1ML1A 4AHPA 5K4ZA 4LT9A 4DQWA 4LRSA 1KFEA 5D04C 1A5SA 4ZQCA 1JRCA 2QCEA 3BG9A 4UC5A 4O4WA 4CCCA 4FX6M 1TO3A 4UTKA 4UTUA 2DZTA 5I3KA 1JUEA 1TTIA 1JCMP 2X1RA 3T40A 4A29A 2YGYA 2G97A 1DQXA 1XUZA 3IEBA 2OZ0A 1OX4B 1BKSA 3CEUA 1LOLA 4DO6A 4UR7A 2ZRXA 3QSTA 2ZTKA 3W74A 2Y85A 1NVMA 2QR6A 1W54A 3EWZA 1SZGA 4LRTA 5I3FA 3F03K 3GR7A 1EP3A 2NUWA 3W1XA 1PHQA 4FX7A 1KM0A 4CCDA 4KFPA 3H54A 2QF7A 3W1RA 1R2TA 3HOJA 8TIMA 2VC6A 1TJRA 2NV2A 3N34A 4FNSA 3I65A 5CG7A 1OK4A 4GUGA 5HINA 3PSWA 1VC4A 3QW4B 3FKRA 2QAFA 4RZ4A 3DFOA 4BF9A 1G69A 1KM1A 5BW6A 1NF7A 1XUUA 4NXSA 2W6RA 1W5MA 1RPXA 1I2NA 3G0XA 4TMBA 3EXRA 1QOQA 4PFMA 2DZUA 5I3IA 3KXQA 4FXRA 3TFXA 1VJIA 3VNDA 1BWLA 1QOPA 2YFNA 1W5QA 4MPQA 1ZAHA 3NDOA 2Q3RA 4O1DA 4DBDA 3GXNA 1K02A 4PC8A 3DFPA 4UFJA 3NNTA 3LOTA 1ICPA 1QPNA 5EA9A 2J88A 1B3OA 3ZS4A 3C2OA 3UD6A 4W9TA 6ALDA 3ELFA 1AW2A 3TNOA 1DV7A 4GFSA 3W1TA 3LV5A 4K6AA 3MJYA 4G1KA 1H7NA 1HUVA 1SO6A 4JY8A 4O52A 3A5VA 4PODA 3S5OA 4MZ8A 4I7WA 4LVAA 2PE4A 4K36A 4JEQA 3QPZA 5AC8A 4QNWA 1U83A 5G2HA 1LYXA 3NGJA 4FB7A 3C4UA 4UFKA 4A2RA 4IXHA 3F4WA 3I7SA 2YYTA 4UFIA 5J5RA 3SI9A 2E68A 5D03A 5GVJA 4O57A 1HO4A 4RXGA 3EXSA 2CLMA 3DU0A 4LS2A 4TO8A 1SW3A 3TC7A 2A21A 3HF3A 3TXZA 4ADTA 5HUOA 1I2PA 4JTTA 5DY2A 3W75A 3RK8A 5KTLA 3HPZA 2QUTA 2NWRA 4HHPA 4AB4A 4Q33A 1U5JA 4NZFA 1YTKA 4CQ8A 1BTMA 1KV8A 4UTWC 2Y6ZA 2DZVA 1OFQA 2Y7GA 3LCHA 2ZRWA 4XUGA 3KHJA 3NAVA 2H8XA 3O15A 2E09A 1LBMA 5DCDA 3EWXA 4IJBA 3W22A 1VYRA 2BZNA 3OVQA 1P5BA 5EL1A 4XKYB 3UXAA 3C2EA 4IOTA 4NX5A 2WO5A 3FEMA 3W7KA 1AL8A 4FXSA 3KX6A 5KMYA 1TQXA 3LRLA 4O53A 3GLCA 1FDYA 1DJQA 2BXVA 1TRDA 4OQVA 2TPSA 4JTIA 3NQ6A 4UTTC 4Z1DA 1RD5A 4RKAA 2YW4A 5AFDA 3RF9A 4YCPA 4IUOA 4IMFA 3FYPA 4L4MA 3N19B 2PRMA 3T55A 1P0KA 3IVSA 1R30A 2J6XA 4GXMA 3YPIA 1TPWA 1ZNNA 3EWBX 3GNNA 2QUVA 1QR7A 3NZRA 1GOXA 1K03A 1JUBA 1RV8A 1W31A 5CZTA 2FIQA 1OG0A 4IWWA 1YADA 2OX1A 5F2IA 2J9ZA 3VFLA 2PC4A 2OCZA 4A3UA 5LKYA 3HO8A 3LTPA 2X2GA 4ZQRA 3HG3A 1MSSA 3CWNA 3W2LA 3HJZA 3G1XA 4FF7A 4MLJA 2V2DA 2AAMA 4O15A 5C5YA 3O63A 5D2WA 5F4SA 1F73A 5K9XA 2C15A 4RJEA 2NWSA 1X7FA 4R53A 2Z6IA
chains in the Genus database with same CATH superfamily
4GLEA 2OWWA 2WHJA 3N2OA 4AWSA 2VC5A 5DLCA 1DIEA 1DIKA 3PM6A 3HMJG 2R14A 4KEZA 4AVFA 3UJSA 4O18A 3NQVA 4RLIA 1Q45A 4O1BA 3SGGA 4JN6A 4EKJA 3HFYA 4JR5A 4ZCWA 5I79A 4S3JA 4BCEA 3TUUA 3REQA 5FI8A 1XGDA 1R8LA 4AD3A 3WLKX 4MJ2A 2W9MA 1C3FA 4PUDA 1RCOB 1G67A 4M1BA 3PWIA 3CWOX 2OELA 1XQLA 1VLIA 1H0IA 1FWWA 4K38A 1NWTA 2PWGA 2BX7A 3WH8A 1BVNP 1FWCC 3T81A 3SUSA 3CHVA 4AVOA 3ORWA 2ACUA 2ZZ5A 1GOMA 4L6DA 3TAOA 4JFTA 3M0KA 3GDRA 4YIWA 2JEPA 1MEIA 3AMDA 1V3JA 3LPFA 4I8DA 4D6HA 1PZ3A 1N8FA 2AQVA 5D9PA 1TV4A 1V0MA 1XLIA 2J47A 4FP1A 4LEFA 4MAZA 2XZ7A 1XD1A 3VOIA 3MUIA 2PUZA 4R27A 2QUMA 3GAKA 1H1YA 1IEWA 1IXNA 4FIQA 2WVUA 3BJTA 2QCDB 4UFMA 2EPMX 3BMVA 3NQMA 4AHOA 3QY8A 3NQ7A 4HOZA 2QZRA 1CGWA 4AZ6A 4ASTA 3CU2A 4D71A 1SQ7A 2QDHA 4H9YA 5D33A 1CXLA 1YXYA 3W7PA 4EK7A 1VD6A 1XL9A 2J7BA 1XIHA 1UH2A 1EFZA 3LYEA 4P8XA 2G50A 8CGTA 1JZ3A 3N3TA 4HNCA 3URAA 4XBKA 1BF6A 5E6ZA 3AUOA 2XSBA 4YVPA 3ZYZA 2VZSA 2HJPA 3FHQA 5I5RA 3N6HA 3TN4A 1TE6A 3J7HA 4MZYA 3WO8A 4CD4A 3OVGA 5FEZA 3W76A 1EJWC 1XH1A 4N9DA 4ERAA 2JF6A 1V0NA 4PUKA 2AMXA 1DWIM 2J24A 5AHNA 4I5XA 5HQMA 2QGHA 1FP8A 4R88A 1E3ZA 1SW7A 2VGGA 1QTWA 1VCFA 1ME8A 1S2UA 3V5OA 3O2LA 1UZ1A 3RLVA 3R1ZA 4CEUC 3Q2DA 1UR3M 5HMDA 1K9DA 3SN4A 4BQ4A 4HZ6A 2WKLA 2E9MA 4TTUA 2GDVA 4JTFA 3E38A 3QQ0A 4YTTA 2I9UA 3CEPA 4ES4A 4Y8EA 3KTSA 1E1CB 5A69A 1Q66A 4Q8UA 1IT0A 1XFBA 3PZTA 1OFBA 1SZRA 1M1BA 2R1PA 3FS2A 1KQZA 1FWEC 2E9BA 3P74A 5EMLA 5CPOA 1FHVA 3A24A 5FEXA 4ACZA 3UQNA 5DCBA 1GVSA 2W61A 4KS0A 3WQFA 3G3DA 4HSHA 4IFRA 2J74A 1KFCA 5FF7A 1OJXA 4NJGA 3V0SA 3EKZA 1VBHA 4JX4A 1S1PA 4HNNA 3OW1A 3ABOA 4JKMA 3O6DA 2OSWA 3OLEA 4NI3A 1NJJA 2BV9A 1W9XA 4WGHA 4AZIA 2YDSA 1UZ4A 4NNAA 2WJFA 3UERA 3TTSA 2GK1B 3P5YA 1IQ8A 3PY2A 2CLOA 1G6CA 1PUDA 1BD0A 1F8MA 4B3LA 1P48A 4D8ZA 4C65A 4EXQA 3C86A 1V6YA 3WK3A 2X16A 1OIFA 1EF3A 3HN3A 4AZ5A 3BCFA 4LYQA 4HK5A 2DSVA 4IP5A 2QCNA 3R25A 3IJ7A 4XK2A 1W0MA 3OA3A 2C1GA 4GNJA 5KETA 3L68A 2CLPA 3H2OA 5A2AA 4PUJA 4Q32A 3S2NA 3W7RA 1ISYA 2YDAA 4OE7A 1ZHAA 4BF7A 3GG8A 1AH4A 2VFDA 3LM7A 1G4SA 4MNJA 2WHKA 2ZUNA 3EBVA 2A85A 4AH7A 4GIYA 3O6AA 5JH2A 3VZXA 3AXHA 3NZQA 1JIBA 3HMCA 1EHAA 2VUYA 3G1VA 2GGIA 4IMGA 1CLXA 2DP3A 2GJRA 1W5OA 4QG9A 3AMKA 4QJ4B 3UY7A 4G7EB 1TPUA 2ZVRA 2W92A 3WCZA 3K4AA 5LXEA 3LLDA 4GX8A 4Q8QA 1TR1A 3PJXA 2J77A 2X8RA 3MCMA 4K3ZA 3UWWA 1W9PA 2EPKX 2JGYA 4C7DA 5MKGB 1V08A 2UZ9A 3W7EA 3OB8A 1P0EA 1ZZMA 2R91A 4HZMA 3BOLA 4S3EA 6A3HA 2QCMA 3ZLFA 2B31A 1YXCA 5IM51 2V0TA 1QNPA 3ABQA 2O9TA 1EPXA 1I1WA 3RRXA 5LHFA 3CNYA 1UQZA 2J13A 2A79A 3HBLA 4E2VA 4YVXA 1GNXA 3ZT7A 1PTDA 3UXLA 4AQLA 2NLYA 3SADA 4GUFA 3W53A 3WLPA 2D3LA 4KCVA 2J7EA 3N2TA 3ZJ6A 3BV7A 1FXQA 1OY0A 1FFRA 3UCQA 3IK4A 4JIRA 1FA2A 5AVHA 3C0LA 1MRAA 5BXPA 3VI2A 3B9NA 4LUTB 4H83A 2D73A 1SJAA 3LV6A 3LMZA 5BYWA 5C7VA 3MI6A 3VKDA 3TNBA 4UQCA 2Y5JA 4E4PA 4RW5A 1QI5A 2WCAA 4B5TA 4IPJA 1TWWA 2ZC8A 1XKYA 4H6RA 4FNQA 3TWAA 2VURA 3DI0A 1JZ7A 3THAA 3GK0A 2TRSA 2CHNA 2CLFA 4OBTA 1DE5A 4MY1A 2QCDA 1W1B1 1P7TB 4RR4A 2CITA 5CZSA 1WBHA 4N0RA 3OEXA 3RMJA 2ON3A 1RJQA 4AX7A 3FJ4A 4RV3A 3TJIA 1W1YA 1GGOA 4H4IA 1JF5A 2HSAA 2XIJA 1LJYA 2G41A 2WMIA 2VFGA 5BWAA 1GTEA 2FB2A 5AHEA 4DIAA 5M03A 4UNIA 1QK2A 3ONBA 4US5D 3LGDA 2W66A 3U7BA 1TYGA 1WDSA 3ARXA 1VF8A 2WMKA 1VFOA 3IWPA 2V5KA 3XISA 1VEPA 3FV9A 1JZ6A 2OQYA 3H53A 1H7WA 5C8BB 2KAUC 2E5CA 3AZTA 3I6TA 2HWGA 3ATYA 3DEQA 4D1JA 2ZZ7A 1LLOA 2X2YA 4JIIX 4RDWA 1UKQA 1Z44A 1KXTA 1PKYA 2H90A 2WB5A 3W73A 1DQUA 4N9CA 3EWDA 2I5QA 4JQAA 3SEPA 3S83A 2O9PA 1W3JA 1JPKA 5BOOA 2ANUA 2UV8G 3UZZA 1QASA 1E1CA 3RM4A 7ODCA 2ACQA 5I03A 1TJ1A 2PCQA 2FFIA 3ABSA 4G1NA 4O19A 3D3FA 3IK2A 3MWAA 4JQ3A 3LG3A 3RX3A 5G2WA 5BRPA 1DXEA 3LCGA 3A4AA 4QRNA 4R33A 4IGMA 4NRRA 1CZ1A 3H12A 3COTA 3WNMA 3PTKA 4PN2A 3TW6A 1HKVA 3QY7A 2UY2A 1HL2A 1TREA 1XFCA 3W1QA 3O07A 2ZA3A 3WUBA 1MWOA 1TPFA 3E3HA 3HJEA 2X1UA 2PGEA 4GO9A 2PDFA 1UP3A 1V6WA 4CU8A 3S2LA 4IIBA 1A3HA 3TYDA 1G4EA 2X1IA 5DXYA 2WWCA 2FH6A 3WQCA 1Q8JA 3M7SA 5FEWA 1DJGA 3FYYA 4OFCA 4DELA 4W85A 4JN7A 1NELA 4AY8A 1CB7B 4JTKA 1QCWA 1XIFA 1XSJA 3OQEA 1H7XA 3K4WA 3ZOAA 2A0NA 3TSBA 2GQ3A 3USBA 3W24A 5DMYA 4O0QA 3V1PA 2WZMA 1ITQA 4AZHA 1I0BA 3N29A 3WF4A 3WQDA 4D6IA 4Z2JA 1K8ZA 1PIFA 4L64A 2C0AA 2P3ZA 3GUWA 2ACRA 2Z7GA 3MV01 5DMMA 5IBXA 2E0PA 2D3NA 3LCIA 4R5EA 5BU6A 4UNLA 2CZFA 4A6GA 5LGXA 5CBJA 1XQKA 4NZ1A 1SW0A 5H8PA 1E15A 3OVRA 1GKQA 2HNHA 1F2JA 4HPJA 4Z2HA 4JTSA 4ONVA 1F4HA 4WXYA 3DIPA 4R7OA 3R13A 2YYUA 1EX1A 4UTHA 1QPOA 2GSJA 3LQGA 1AJ2A 8XIAA 1SO5A 3QLDA 3S9ZA 1H2JA 3WNPA 2OWXA 3BLOA 4N4PA 1W2PA 4JX6A 3B4YA 1HVQA 1F5ZA 5E09A 2YZ5A 3MCOA 1OBAA 2Z4GA 1OFEA 3PZNA 3N13A 3STGA 4QQUA 4PRWA 4MG4A 4EACA 2XVKA 3Q67A 4LWWA 2P50A 5FKYA 5J04A 3UVAA 1J2BA 4ZO8A 5LZLA 4Z1CA 4AD0A 2YZRA 4O1FA 1ZB5A 3G1YA 4PMOA 2QJGA 3ARPA 4FMVA 3LZ3A 1YHTA 4D1IA 5AHFA 4P7OA 1UH3A 1XP3A 4LUTA 1SJBA 3WKZA 1V02E 1ODZA 5FJRA 2NQ5A 3QN3A 1A5KC 1XD0A 3KRSA 4HNVA 4NSBA 1DQWA 1GJPA 2OZ8A 3TR2A 3WMCA 4L6OA 4H7VA 3R89A 4H6QA 2DT0A 4OZOA 1W2VA 2AL2B 2B7NA 4KRUA 4ZFCA 1R7AA 3GS6A 1TELA 3T2QA 1P7TA 3M0LA 2UWFA 3DFHA 4AYSA 2Y89A 3FW6A 4MNLA 1V4YA 2R6OA 2A2IA 2ABAA 1RY0A 3TA6A 3C0QA 4JNYA 3TLQA 2CLIA 2C1HA 2OSXA 2PP0A 2FLIA 3U5UA 4UQAA 2XPKA 1O6IA 4DJFA 3T09A 4QJ1A 3A6OA 5EY5A 1KR1A 5K7JA 4H7CA 4GXPA 4WIWA 4WZHA 1PVNA 4RE3A 4YWIA 2QEZA 2QIWA 3PPCA 3QV8A 1G4TA 4L9XA 1KWKA 3WLQA 2ODOA 3TN3A 3TQ0A 1EL3A 1LF1A 5CPSA 1EB3A 1F76A 3ZIZA 1FFQA 4QM1A 2GQAA 5LIUX 2J27A 3H21A 2YBVA 4HYWA 4W86A 3LXCA 1XLLA 4QAWA 1UJPA 3INPA 5GPRA 3CUFA 3KL3A 4XO6A 3POHA 3EX3A 5JU6A 4C6PA 1GYNA 2Y70A 3VX1A 2JKEA 4DAFA 2CXEA 2JKPA 3Q4DA 1WA3A 3GVQA 3BGJA 3VNKA 1IZJA 5D37A 2HEJA 4A22A 3O7UA 4X2RA 3B8IA 4UTLA 3WL1A 3NQBA 3SSZA 3GIPA 1XGZA 4Z0SA 5HJYA 4UCFA 1XC4A 3W7HA 5EMUA 3UZJA 3ZR4A 4JYDA 2V38A 3D6NA 4TQTA 3RU8X 3MSDA 3BLIA 4KEVA 1J6OA 3O16A 3ZR5A 1AL7A 4WD0A 3OOQA 3UR2A 4CLMA 2DIJA 5D8WA 4FLRA 4CQBA 4DAIA 2BNJA 4LSBA 4EAMA 3GDTA 4BWLA 2YCEA 1JEZA 1S5WA 3PB2A 3BPWA 4MJ4A 1OD0A 4YHGA 3GHTA 3M6YA 3NFUA 3ES8A 4FS9A 5BMWA 3DYMA 3M46A 4GZIA 1UBPC 2X40A 4KFNA 2CIPA 4HCLA 3IIOA 4HA1A 2VR4A 1Q6CA 1X38A 5AC6A 1B4EA 4HKPA 5IFTA 3IVTA 3H4GA 2JKAA 3BG5A 4AY1A 1HKJA 5A95A 4Q7IA 2Q6ZA 4M0XA 1Z3NA 4LF2A 4V1YA 3A64A 2I57A 1FCVA 4B3ZA 4M56A 1R3SA 1Q6QA 5JH1A 4RX0A 3AZSA 1B3XA 1X6UA 1EIBA 4JGDA 2OO6A 1GVRA 3IJIA 4DWSC 5DELA 4MZ1A 1XYLA 1ZAIA 1TE1A 4XSMA 1E51A 3VIFA 2VO5A 4FOKA 1SZFA 2EPNA 5A3HA 1OC6A 4LCRA 4PSPA 1TMLA 2OX4A 5LHEA 2VM8A 4JFUA 2NUXA 1VEOA 3WF0A 1IT8A 4DZIA 3RNDA 3EOSA 3A22A 3ZJ7A 1OABA 1XRVA 1CGVA 4HMDA 2PAJA 2D22A 3JW7A 1HJXA 1KNWA 4MWAA 5CBBA 3UETA 2WQPA 4Y6GA 5E70A 4GZ7A 5AC4A 3E2QA 3H26A 2QJJA 4QX4A 4M6QA 4RCXA 3T42A 3OG2A 4O4VA 2WAGA 1R3WA 3M1ZA 4K39A 2ZZ2A 3HTWA 2VOMA 1OINA 1VJZA 3FSTA 4J5NA 4BKNA 4IHCA 3ZT5A 4AISA 3GU2A 3F5JA 5REQB 3ZMRA 3C2YA 3UCCA 4GINA 3TQVA 3I7QA 5HR6A 3GG0A 3PNZA 1BYDA 4H9XA 2BSLA 3G1SA 1N2VA 2FDSA 1UOKA 1UR0A 3OBEA 5HPOA 4LUYA 3U5YA 4LV9A 1ECQA 4O54A 1EYWA 2GL5A 4K2SA 4P61A 3LHYA 2EPHA 1RJPA 3KFTA 2PDJA 3MW7A 3AIVA 4OUIA 1VFUA 4ML9A 4XTIA 5D05A 1VR6A 5D09A 4NASA 1TZ7A 3NOYA 2OT1A 1X6LA 4ZQNA 4I5UA 1XIDA 1UKPA 3PBUA 5CCZA 3RGTA 5RUBA 4V1XA 2EKCA 4BI6A 2AL2A 2QQ6A 4FNUA 3DHUA 2X1SA 1NF0A 4HA3A 3L23A 1TPEA 1J9YA 4MDPA 1PKNA 4JL2A 3NUKA 1N7KA 4PRRA 3CO4A 3ECQA 2DUXA 1FKWA 3KE0A 3C5QA 5CJ5A 4XIAA 1PS9A 4GWEA 3W6LA 1A49A 4GIEA 4C5ZA 1OVDA 2G96A 4IICA 2PBGA 2ZE3A 3S6OA 3M0XA 1E9LA 1VENA 2HVNA 5FJIA 2JIEA 3VX0A 3CXOA 2I5IA 2RGMA 1S5TA 4DPPA 3C0SA 5JBDA 4DF2A 5LNRA 1CDGA 2AL1A 3T05A 4CEXC 1I2RA 4LEQA 4RUBA 2X0HA 3HV9A 4LVBA 1C91A 2XSAA 1KM6A 3VOFA 2RKXA 1D3HA 3EX2A 4ZB2A 2IMRA 3WK0A 4QEEA 5AKQA 1K77A 4IUGA 1C8YA 3GXIA 3N4FA 5HWNA 2TYSA 5G1MA 2WW5A 3TTYA 3CL7A 2EBNA 1M5WA 2ZRUA 5D2TA 1KXHA 4CQAA 3ARWA 3ITOA 2W3ZA 5E5CA 2Z2UA 3MVTA 5HBFA 3LHUA 1EP1A 1K1DA 2QCHA 1RQHA 1DOSA 3ITYA 5XIAA 5G4WA 4J3SA 3H7VA 2OOGA 3OLDA 2C91A 3B8VA 3QF0A 3UU0A 3SUVA 1AH0A 4X2PA 1MEHA 2YA0A 3VINA 1GUVA 5CJMA 4ZMGA 1KTCA 1Y8BA 5T26A 3B9OA 2H3BA 2PP3A 1D3CA 3D0CA 3THCA 2HK0A 3QPYA 1K9EA 4O14A 3KEHA 2ZA1A 3FOKA 1VHNA 5I23A 1U2YA 1WOAA 3ZVIA 5E9XA 3U2CA 3CPRA 4BI7A 1TIMA 2QV5A 1BXCA 2BVYA 3LNMA 1ITXA 1VLWA 2NT1A 3MPGA 2I5GA 2G3IA 5LIXX 5LNWA 4QJ3B 4NZCA 2PWDA 5CBIA 3CQ0A 1W9BM 2IPFA 3S1WA 3DENA 2YOCA 4GI9A 4RNHA 3G0SA 1GZGA 3MUAA 4GI4A 4GX9A 3THQA 4LYKA 2GJPA 3OVPA 4MFEA 3GBDA 5F2GA 3UPMA 1A0CA 3VGGA 1QHOA 4HU8A 3L65A 4ZBCA 5A6MA 2P5NA 3L2MA 4MB1A 3R79A 3KL0A 4QEHA 3VILA 2X7VA 5AC7A 1R0MA 2QJNA 3HQ1A 2VEMA 2GVEA 3VGHA 1HX0A 3TYCA 1QI4A 2VZTA 2GOUA 4U28A 4GKLA 4V2XA 2Y4SA 4GH1A 1J0ZA 4PMUA 1RLCL 3L2IA 4HVXA 3SW6A 3FIGA 3RYSA 1UC5A 2PMQA 4MB3A 3L5LA 2WSPA 4YJ5A 3OBAA 2OG9A 3FAXA 1ENUA 2XWDA 3W38A 4L1XA 2YBUA 2OZ3A 2HQAA 3KL5A 1G7UA 3LRMA 3HGSA 3VDAA 3L4UA 4G56A 3SN1A 3I3BA 1XDLA 1O4UA 5EBUA 4H9ZA 1IIGA 5HANA 1US0A 2W27A 3FYOA 4Q4PA 1XPYA 3H2EA 3LX9A 4LNYA 3PWAA 3NVDA 4B5SA 1X6NA 3KZPA 4AZGA 1H51A 3K1GA 4GACA 4PL1A 3ITVA 3UYIA 4JHOA 4DZ5A 3W87A 1OFDA 2CNCA 3KLKA 4LH8A 4HMCA 1KGXA 2X09A 3PBWA 5REQA 2OTDA 1A53A 1H0GA 3AMGA 3DHPA 1HJUA 3WNLA 2JQXA 5K4ZA 4LT9A 3AUJA 5D04C 3UA3A 1ZSXA 1OC5A 2PWHA 1PTGA 4O4WA 3EKGA 1TO3A 3KP1A 4UTKA 2YA2A 3CQHA 4L4PA 1Z6KA 1EQCA 3TZNA 3AISA 4A29A 2DT3A 2YGYA 2G97A 3VIKA 1XCWA 1XUZA 2OZ0A 3FX4A 3GQYA 4ZO9A 3ALGA 1I0DA 1OEPA 3NSNA 4F8XA 2VEGA 4KQNA 3E0LA 4JFVA 4UQEA 1WZAA 5A8NA 1W54A 2A3LA 3OQ8A 3GR7A 1V6XA 2NUWA 3VNLA 3W1XA 1NDYA 1YPXA 2DSUA 7A3HA 4CCDA 2WXDM 3W1RA 2XIMA 5C9XA 1WE5A 3AWNA 1SMDA 4L6HA 5CG7A 4GUGA 5HINA 3PTDA 3EDFA 3BCJA 4BF9A 1WDQA 4F0SA 1NF7A 3CYVA 2W6RA 3V18A 1QOQA 5I3IA 1UD3A 2ZUMA 3KXQA 3VNDA 4MB4A 2Q3RA 4O1DA 3GXNA 3WLOA 4W8BA 3MC5A 4UFJA 3LOTA 4NZ3A 1FH8A 3CZGA 1XLGA 3DDMA 1JPMA 2W91A 4US5A 3ME3A 5FOOA 6ALDA 1UR1A 5H8UA 4LCSA 1QPKA 4G1KA 3OLGA 1EHNA 3CMFA 4PODA 1SO6A 2P3EA 4D6EA 4I7WA 1FH9A 2PP1A 4HBKA 1VBJA 1LUCB 5I07A 2PDNA 4QNWA 1U83A 2D20A 4BS0A 1E0UA 1BVZA 3VIGA 4A2RA 3SRKA 2YYTA 1RP8A 3AHYA 4ACYA 3SI9A 2HE5A 3VO0A 3B8TA 4FPSA 1E6SM 4RXGA 2PSNA 1GKRA 2CLMA 1RK6A 1SW3A 2OGJA 2OVLA 4DBSA 3T0CA 1LT7A 3H2CA 2YL5A 1L6FA 1NOWA 1CEOA 1CYGA 5KTLA 4CGTA 6ENLA 4XG1A 5B7YA 4AYGA 1RY8A 4Q33A 3UGRA 4NZFA 1PPIA 1KV8A 2Y6ZA 2REQB 1QHZA 4UTFA 4XUGA 3NAVA 2PDHA 3EWXA 1VYRA 2BZNA 3TYAA 1P5BA 2CPUA 4CU7A 3WH7A 3QR3A 3FVMA 3VPLA 3MMWA 4ROPA 4XSLA 3VKCA 3PZGA 2VQTA 2OGYA 2AGTA 2WMFA 2GGJA 3PZOA 4IJRA 5GJMA 1GHRA 4G9PA 1RD5A 4XAZA 5JMUA 4QDWA 4DO7A 1EQPA 4IMFA 3K8MA 4MDOA 3N19B 1CCWB 2WCSA 4F40A 3IVSA 1WNOA 4GXMA 3YPIA 3EWBX 3GNNA 1K03A 1OGGA 1A3WA 4IWWA 1YADA 1Q2RA 3BLLA 4C6JA 1F4AA 1B0IA 2J9ZA 1NDVA 3GNXA 4A3UA 1ZJBA 1G1YA 5A6LA 2C79A 3LTPA 1WZMA 3JZEA 5AYIA 1MDRA 5IDIA 1DJXA 4FF7A 2Y2WA 1BFNA 5AZ0A 1JNDA 3RHGA 2NWSA 2EJ1A 3GU1A 3SUUA 2AKZA 1LWHA 3B40A 5LA0A 4WK9A 3WENA 4LNCA 3HGJA 1V0LA 2FJUB 4MY9A 1KGUA 3KW3A 1K8CA 1GQKA 1IYXA 2XYLA 3DFTA 1S39A 4P8VA 1GT8A 3PF3A 1KTNA 3RLUA 3GHSA 4A8RA 1LG2A 4S2BA 1OCJA 5JIWA 3NL3A 5DRCA 5BMXA 3B8UA 2BTMA 3PJWA 3L4XA 1DJWA 2W62A 3L0KA 5HQLA 2F9RA 2VENA 3DZ1A 3URBA 4XISA 3G22A 5HJXA 3GTNA 1MXGA 2O55A 3GVRA 1JCYA 1YTDA 3B03A 4MPKA 2W0UA 1ZALA 3G18A 1W3IA 3BGAA 1KD0A 4FLQA 2WPGA 1W1A1 4UTIA 2Y5SA 3TP4A 2PLKA 1TVPA 4DHGA 4QLLA 1TJ2A 1EC8A 4RZBA 4E0CA 3LRKA 1EPVA 2DUAA 4S23A 5DMNA 2ZUUA 1BGAA 1LRTA 1QT1A 2A5HA 4IQLA 1EJSC 4ILSA 3GH4A 5LA2A 3AXXA 4XZBA 5E9AA 2BMBA 4YXGA 4N9EA 4GQQA 1RXOB 4V15A 1EXBA 4NXKA 1M65A 1YDYA 8RUCA 1IIHA 3V5FA 1JFXA 1XSKA 4DUXA 4XX6A 4ZSTA 2WZIA 4HK6A 2ZWZA 1VFMA 5A6BD 2O0TA 3MUXA 1B3VA 1QJWA 1EYEA 4C7FA 3LPPA 1HG3A 4ML4A 2VX4A 4JIHA 1A0DA 4MADA 3ITCA 1NOUA 4GYPA 4QNEA 3W1LA 4IP4A 3G0UA 4KGJA 1W3NA 1QFEA 4IQEA 4UNKA 1NFPA 2GGEA 4EPBC 1NFGA 1E0WA 3C8NA 4OJYA 2W63A 4LS1A 2PRLA 3LUTA 1GQJA 2XVPA 4IL0A 2CESA 3MZ2A 4U33A 3BLPX 2FZ9A 4IL2A 3FDKA 3ARSA 1JJKA 3C2VA 4P5UA 1V6TA 2Z7KA 1C7TA 3TROA 4KWUA 3EAUA 2JGQA 4JTRA 3AI0A 3LPGA 3QHOA 3NQ2A 4DYJA 4UOZA 2BB0A 3SQLA 4V33A 4H8UA 4DWDA 2HDJA 1D8CA 3VCCA 3WH9A 4XAYA 2EXOA 5M2FX 1UA7A 5CAKA 4HSNA 2J8GA 1LUCA 1B3ZA 3IJ8A 1ODUA 3MZNA 1UP2A 3WUEA 4JHZA 4IT1A 1ZY9A 3U2EA 4F0RA 4FLOA 1XM3A 3I6RA 1NDWA 4PH6A 3BOXA 6TAAA 6XIMA 1TX0A 1UA3A 1SFLA 2VEFA 4RL3A 3SM0A 5B7ZA 6CGTA 5AHLA 3GFYA 4HPHA 4WY0B 2YCKX 5ABHA 2YCJA 4PB5A 1M04A 2RFGA 1Z32X 1V7YA 1JDCA 1EIXA 2C6QA 3KUMA 3KTXA 4GOAA 2VCCA 6XIAA 1PWLA 4MKNA 4MHBA 3W9ZA 5F1VA 4M19A 3B0PA 2REQA 5CEWA 1E4MM 4MJMA 1GONA 5H91A 3AROA 3M5YA 4CN6A 5EFDA 1Y7VA 1UBSA 3WH5A 4ZXLA 1XYFA 1HIZA 1LLWA 3CT7A 5CSYA 3CO8A 5BNKA 2XIBA 4H1ZA 4NU7A 5MHBA 3T1GA 1PIGA 3E0VA 2W5FA 4JNZA 2P0OA 2FZMA 3LXBA 4CVWA 1ICSA 1K3UA 3VCRA 1OT2A 3B0VC 4ORMA 4H2CA 5EFFA 1KGWA 1GWJA 4AMAA 4YCOA 3OP2A 2VVSA 4JTLA 3A4XA 2YB1A 3BMWA 2PDKA 4GO8A 5HXMA 4DBUA 2A3EA 1OFRA 1R9ZA 1XBXA 2AAAA 4G5DA 4UR9A 3PK7A 4ZQPA 1JPIA 1B9BA 3ZVHA 1QPQA 4UOQA 1FH7A 2J9YA 4MYAA 3P81A 3SDOA 3GXMA 1S3TC 3KTCA 1F3WA 1RP9A 3OODA 4LAUA 3G6LA 4HJWA 4O50A 4XTDA 3IVUA 1VYSX 3STFA 2GVLA 3URNA 2Y63A 1AMYA 4RNFA 3FA3A 5FIPA 3U57A 2V2CA 2FVKA 3KBNA 1IEVA 5LIWX 4UUIA 4L56A 2V69A 3TAKA 2RDXA 2TMDA 4Q8OA 2QGYA 2PTWA 3BAXA 3WDPP 1IWPA 1VGAA 2G3JA 1R3RA 3B8DA 1ALDA 1QAPA 2PD9A 3UPWA 4M80A 3DGBA 1K4HA 2QMJA 3AYSA 1H63A 4XAFA 3P6LA 5A6KA 5CLWA 5KEZA 5EMKA 2OU4A 3AICA 2Q3OA 2HS8A 3SUWA 4QCFA 4B9ZA 4OBSA 2D2HA 4UTTA 3S1VA 4DJFC 2R24A 4REQB 3NZ1A 2GJLA 3CMGA 5I3JA 1K4GA 2B0MA 3WEMA 1XGEA 1FCQA 2PDXA 1FWAC 2ACSA 2RHGA 3JR2A 3FXGA 4LBSA 3SIZA 2CERA 5AHMA 2AMGA 2FZDA 3PBYA 5C0QA 9XIMA 3HV8A 3R6IA 3NM1A 3KAOA 3ZFHA 5F2MA 3MO7A 1VJSA 4JTEA 1LDCA 3WFLA 4Q8PA 1FWHC 5HAOA 2DJXA 2FPYA 2RDTA 3LD5A 3GAYA 4OGZA 2QF8A 1F6YA 2VX5A 1CXKA 5BROA 4W87A 3OTRA 4YTSA 2JBMA 5L6UA 3SRHA 1TSIA 5CKSA 3FXYA 2NX9A 1HQTA 3UPBA 2WZHA 1JZ8A 2QCGA 4R3UA 2ISDA 5G1TA 4I6VA 3QYSA 3EZ4A 1Z42A 1E5NA 1LWJA 2PWUA 4XKMA 1YNYA 3OPSA 2BWGA 4GC4A 4BK9A 4AEFA 2AQOA 2QUNA 1R2RA 2ZX8A 2BY2A 5C54A 4IFKB 1JR1A 3MMDA 3M5VA 4LC8A 3WMLA 2KZHA 2QCFA 4GI8A 2VZUA 5BWFA 1DHPA 4BWLC 3HGOA 5CSSA 2Z29A 1EUNA 3WELA 1I75A 3RPDA 1E4NA 3WZ0E 3MA8A 4YVVA 4CNOA 3GH5A 3NSMA 4YMZA 3MSGA 2ADAA 3CL8A 4G6CA 4U5IA 5A1AA 3FLUA 2FMOA 3SGZA 3C3NA 4H19A 3VE7A 2D2OA 3W7IA 4IF2A 1PE1A 1S2VA 2V2HA 2DW6A 1HNYA 1I6NA 5HDRA 4PMZA 1K8XA 5T8GA 3SGUA 3P8IA 1JYNA 1I8JA 3CC1A 4PCSA 2WJZA 3UYCA 3S42A 3UZXA 4IM4A 5FL0A 1NIUA 2GYIA 2WZTA 3A3WA 4OBRA 3LQLA 3W4RA 1JD7A 1C29A 1Q6LA 2FMNA 2I14A 4PEKA 2ZUWA 3WLRA 1OF8A 2HVOA 3FCPA 2OXNA 3IPWA 4KCWA 1PXGA 2VFFA 4ALDA 1ADOA 2FPVA 4I6KA 2PZ0A 4HNLA 2Y8UA 3QVQA 4DXVA 4JN8A 4PB4A 1ZCCA 2PDCA 2VCBA 4ZZ9A 3R8RA 1QNRA 4Q4MA 3BCDA 4IPNB 2GPTA 3LI0A 2GSEA 3T0BA 3M4HA 4BI5A 3F4CA 3W7OA 4AIBA 2BOEX 4U2YA 1M7OA 3W1AA 4BA0A 4H9VA 3CJPA 4JTDA 2VVNA 4JQ2A 3L0NA 4KEMA 1YKWA 3CH9A 2W67A 3VDGA 2NV9A 4OUEA 1UIOA 1FRBA 5D2XA 2QPUA 1TMQA 1E9YB 1GOQA 1XCFA 4EF9A 3CV1A 3GDLA 4N6EA 1IE7C 4J35A 5FF0A 2OEKA 3QZEA 1IR2A 5CPTA 4PUEA 4S3FA 3DHDA 4RXFA 4ZEPA 2G3FA 3K1DA 3QV9A 4H8VA 1V6VA 3G8EA 3QOKA 1UASA 3CQIA 1DP0A 4N2YA 3TMQA 4E8GA 1GW1A 4GUIA 4ZB5A 1Z7AA 1QNVA 1TZZA 4H9UA 2PODA 4OT7A 1KFJA 4KKXA 3IAPA 4POCA 3IARA 5AECA 2YX0A 1MMFA 2GUUA 4K8EA 1C8QA 1MUCA 3KZSA 1VIWA 1T96A 4ENLA 3QZAA 3C52A 2C8NA 1HTIA 4ZO6A 3NQCA 3QR0A 3KOZA 2EO7A 2QJHA 3MP4A 4Y90A 2FZNA 3GZ3A 2XINA 3P8JA 4ZVJA 5HNTA 4WHBA 3SRDA 4MMWA 3ITLA 1H1ZA 1OSEA 3SUTA 2CKSA 1DJNA 3MI2A 3ARZA 4A05A 2QDDA 3NDZA 5I02A 2DT1A 4OHQA 5EBAA 2VWSA 2B4GA 1OF6A 3GC5A 3PS7A 2OLSA 4MAVA 3W6MA 1MFVA 4NG3A 2Z1WA 4IPIA 4X9SA 1ZP4A 2BFGA 1GOIA 1J18A 4CQ9A 5FD0A 2F84A 1BRLB 4NYUA 1WV2A 3EWWA 3WBXA 3VOHA 1XRFA 3LLFA 3M0HA 1TWSA 3VGFA 5I00A 4DUOA 3C61A 1LQ0A 4GI6A 5ABGA 3TMLA 2WMGA 3GBEA 4F79A 5LGZA 1UC4A 4FZIA 1JYVA 4N4QA 5CPQA 3JUGA 1AODA 3IAQA 2VDIA 1NQKA 1EO5A 5C71A 4GJIA 5I06A 2CZ5A 3B9DA 2WJEA 2DT2A 3AOFA 4JTAA 3CS2A 1O7AA 1R86A 5FEPA 3EB3A 4IX0A 3G1DA 2CLHA 1UHVA 4QDPA 4WJXA 1JZ5A 3WQEA 4GUHA 5FJPA 3F4VA 4LTSA 3RMEA 4Z42C 1LLZA 2XUCA 3SCQA 2CFFA 3QTPA 3QQWA 3A47A 3UJFA 2XJ7A 4F9DA 1L6YA 3RAOA 2IQTA 1EH9A 3HG4A 1XV8A 4HNTA 1DJHA 2VDGA 5A5WA 4IFKA 3K30A 4Q8NA 5CZJA 3F1QA 3G1FA 4NP7A 3LY0A 3EXTA 4V27A 3HPSA 1CTNA 2ZZ3A 3F2CA 1T5AA 1A47A 2DQWA 1DEDA 1ZJHA 3EWUA 3ABRA 1BGGA 3SCTA 4F66A 3REQB 2PWFA 2CETA 2VXNA 2CW6A 3PANA 3HQPA 4S3BA 4QXIA 4ATLA 2P1FA 2XVNA 3KRUA 2I7GA 1XHGA 1P0DA 2Y62A 4B92A 1XI3A 3E49A 2PDWA 1O1HA 1M6JA 2R9RA 1IXOA 2QVNA 3DBPA 5D32A 1R5YA 3NG3A 2NV1A 4XD5A 1MW0A 2DW7A 3WDHA 1RALA 5EKYA 1X1NA 4L80A 3U2OA 2BVDA 3B04A 1N55A 4QLJA 4WJEA 3PFRA 3NQGA 4IISA 5DF0A 2EPLX 2H9AB 4BJHA 4AEEA 4HU0A 2XGZA 2J7HA 3CV2A 4HMNA 4L61A 1WQ5A 1VS1A 1EWEA 3WUFA 2GVYA 1Z69A 3W1PA 1UD6A 4PFHA 1C9DA 1KXVA 3T9PA 2GVGA 1V77A 3W29A 5CPLA 5C9UA 3CMJA 3C8FA 3KM8A 1OX6A 1H11A 1P6BA 2J6VA 3OZOA 6TIMA 4GY1A 1VFHA 3B05A 5M5DA 2X0YA 3CAWA 4E6MA 1ZS2A 1A5UA 2DY3A 2FHCA 3ABXA 4CNTA 3P82A 2YCLA 5ENLA 1OHLA 2X1TA 4LC6A 2TAAA 3NL6A 3W2NA 3NQ8A 1W8GA 4ERIA 4J3TA 3ZJKA 1P1XA 2VC7A 1DORA 3KWXA 3LU2A 1DYSA 3RFAA 3NYDA 3QW3A 1PX4A 3CZEA 4YS1A 4C5YA 4UZSA 1XF0A 3BMXA 2NX1A 1S5MA 4O1EA 1GHSA 4NVTA 3QLLA 3TU9A 1WKYA 5EMYA 4UXDA 3A9IA 2RDWA 2OYMA 2C18A 1FHLA 2J7GA 2R82A 1ZJAA 4DO5A 2TSYA 3EWCA 3CIXA 1CNVA 2EGZA 4HZ7A 2B7PA 1H7PA 2OFJA 4NZ4A 4F2TA 3RX4A 3SQSA 2ZRVA 3NL5A 5KITA 4AC7C 3GSMA 1X96A 1JL8A 4WDUA 1OD8A 3AALA 3KDNA 1J96A 3P2VA 4PTMA 3DXIA 1VRDA 4ZR8A 4HOXA 2WK2A 1XXXA 3EEGA 2VD8A 1YYAA 2V3FA 5EMJA 3WLNA 2PGWA 2OYLA 1BWKA 2ZUSA 3GXTA 3NURA 3WD3A 4JTUA 3BLDA 4Z1AA 1GQNA 4GVGA 2FJKA 4DNHA 3HG2A 4F48A 2E7FA 3UJRA 1HW6A 4JKLA 1IWBA 4PYSA 5C9RA 2YCIX 1ZRQA 3N14A 4JQ4A 1O5XA 4F9JA 1YNQA 4ZOAA 3GR8A 5E6YA 3GTFA 1EA9C 3T7VA 4OWGA 1XIJA 5T9BG 1RQEA 2ABBA 4Q4KA 2Z26A 3G2GA 2UY3A 1E55A 3A3HA 1IR1A 3HPXA 4KCTA 4PULA 3MQTA 4U10A 2NXGA 1YDVA 3IJDA 2BGQA 4PCTA 5DFAA 2OKOA 2IPWA 3L21A 4J28A 3CBWA 1BRLA 1B57A 1G4PA 1DJIA 3NPUA 1EJXC 1SUXA 4HSOA 5DQPA 2FPTA 4DO4A 2ZUTA 2GJNA 4ROQA 3KBMA 2DSWA 1AK5A 2J9XA 2OKTA 3EDJA 5DBUA 1SZEA 4ADSA 2GUBA 3QGKC 2VZOA 2PDLA 2HVMA 3MKVA 1ME7A 5DX7A 3AYVA 3UP8A 5DRIA 3FKKA 1DXIA 3SY8A 4PMXA 3H2NA 3EOEA 2BY0A 4DM2A 2P0IA 4JYFA 3UF9A 1LM1A 4IGNA 2VOTA 3BSMA 4P7NA 1PEZA 1G5AA 4F0MA 1SGJA 2A3CA 1HJQA 5F4WA 3VU2A 4B5NA 4B16A 4MIMA 1XW8A 2PDBA 3NCOA 2NVCA 3U7VA 3R12A 1BG4A 2DORA 3SCUA 2WVVB 4LCQA 3UZYA 2YXOA 3M64A 3RUBL 2VELA 1VHCA 3VGDA 1EKOA 3WF3A 1MYRA 3LHVA 4C6CA 5ABTA 3S5SA 5ECVA 3LBMA 3BQ6A 3QBUA 5LIYX 1HN1A 2HNEA 3P93A 1MQQA 1K70A 2E67A 5A6BA 3C2RA 1EOKA 1GOWA 1BXBA 1ZPTA 3SCRA 1GG1A 3CZ8A 3BQ5A 1RR2A 4PMYA 4GYJA 1PZ1A 1U22A 1OFAA 1E0XA 2WLZA 1LP6A 1AG1O 2C71A 2QCLA 3M43A 3GTHA 4XD3A 2DDXA 2J7FA 4HGXA 4C6KA 4LVDA 4WOQA 5D9OA 2CBVA 1OX5A 5A8GA 1W9DM 4S3KA 1XLCA 1NWUA 3TJLA 3TH6A 1FX6A 2INFA 4E2OA 5ABFB 1HXJA 4KW2A 2H9AA 4QISA 3ENLA 3WQ6A 3W7GA 2BBFA 3PUOA 3TJXA 1MI3A 4CN1A 1OB0A 1OADA 1RAKA 1OT1A 4MSSA 2EG6A 1Q2SA 4IGSA 3WDJA 4E2DA 1HP4A 3KWSA 3N1AA 1EZ2A 3O6CA 4CNNA 1UWIA 1XLKA 4HN8A 3GHRA 3FJLA 4M3PA 3W85A 5IFPA 2GQ8A 1E1EA 3NPVA 2VT0A 4A8LA 2DGAA 1O12A 3WG6A 1H61A 4JTQA 1RCXB 2Q71A 3Q94A 4QFUA 1NTHA 2PFHA 2DZBA 2WMIB 1UJQA 4Y9AA 3LEPA 2ZX5A 1QWGA 5FF3A 1ZGDA 3CQKA 4ZB0A 4UMCA 1J2WA 1VFFA 3MKKA 1FY6A 2FZBA 1TCDA 1B3YA 2BP1A 1PYFA 2Q8LA 2AQWA 2XHYA 3P80A 2XN0A 2Q8ZA 2F2KA 3ALFA 5D2YA 1CXIA 4YPJA 1J12A 4JNMA 2B7OA 4C6QA 2PTXA 3PULA 1W1TA 3ITTA 2XN1A 1GJWA 3BVJA 3KVJA 3AU6A 3QGAC 3KOYA 1V02A 2VRJA 4GA8A 1VEMA 4UB9A 1FWDC 1KC7A 1JXKA 2OMAA 3OG3A 1IWAA 1ONRA 2OEMA 3Q45A 3T4CA 3TE9A 2RAGA 4Z2GA 2ZZ1A 3VKKA 2ZTJA 4DN1A 3EOUA 2J8FA 3HFTA 5LIKX 4IFOA 4EANA 2E4TA 3NYZA 5EGRA 1ZENA 2NQ9A 4XZHA 1UKTA 2H3DA 1SO3A 4UMBA 4FNRA 9XIAA 3NIYA 2AOSA 3IANA 1L6WA 1Q6EA 2C0HA 3P0WA 4JOMA 4K7VA 3BO9A 1CXHA 4LF1A 2AGKA 4UFHA 3EGJA 3HPFA 2QPXA 2WMHA 2Z1BA 4J9JA 1TPDA 3BW4A 4KCUA 3B8WA 3TYZA 4A2SA 1POKA 1XIGA 3WLIA 1FWFC 2GVJA 3CAKA 5G5IA 3QRHA 3EX6A 3QFEA 4AWEA 5CGQA 1W1IE 2ZQ0A 1YTEA 5JQ9A 3VMPA 3R43A 4QSHA 5J5DA 3KOFA 1EZWA 4GYPC 1CGXA 4ZA0A 1B31A 5HMFA 5KSWA 2Z1VA 4JICA 2RUSA 2VHLA 3O3RA 4AHPA 1B9ZA 2NSXA 2YL6A 1A5SA 3VOGA 4C6MA 1JRCA 3BG9A 3I3EA 4XVDA 4CCCA 3MMUA 4PTXA 1HP5A 2NQHA 1JUEA 2X1RA 4A35A 3T40A 3FA4A 1NOFA 4M24A 5IDZA 4QHRA 3EDKA 1LOLA 4DO6A 3QSTA 3W74A 1H4PA 2OYKA 1SMAA 2Z28A 3HURA 3CAQA 1NVMA 3M0VA 1OG6A 4GPNA 3AIEA 4WKHA 3ICJA 1ZUAX 3QFWA 4LRTA 5I3FA 3BAYA 3RRAA 1Y5XA 3SRFA 4AIEA 2C1IA 3VIOA 3W00A 4KT2A 1PHQA 4FX7A 3TN6A 4Q8MA 4GIRA 3LGGA 2XG9A 1EGZA 2VR5A 3ANUA 1R2TA 3DBNA 1TJRA 4FNSA 2GDQA 1OK4A 3TN5A 1DJYA 2J66A 2WVVA 3AHZA 3E0WA 1S2CA 4GVFA 1E6ZA 3CYJA 3WD1A 1XUUA 3G6MA 4Y9OA 2P76A 1QNSA 3EXRA 2DZUA 2Y8VA 3E5PA 1AD1A 4MPQA 1ZAHA 3ARYA 4D6CA 5FCZA 3NDOA 4DBDA 3L2LA 3VD9A 1K02A 5JUVA 3NO1A 1QPNA 3CUGA 3ZS4A 3C2OA 4W5UA 3UD6A 3ELFA 5IXEA 3KBSA 1TR9A 4GFSA 3OO2A 3P3BA 2X05A 4AUBA 3GNOA 3ONCA 1J93A 4ZE4A 4XBJA 3UR5A 4JY8A 3GVVA 3K5XA 3PP7A 4MNKA 4O52A 3UG8A 2VGFA 3PHAA 2L5HA 1RUSA 2MNRA 4JEQA 2J4GA 1E0VA 1DWHM 5AC8A 4LY4A 4QGCA 1LYXA 3TJ4A 3NGJA 5ABFA 2R1KA 4LB3A 3IV8A 4UFKA 2CCRA 4PSRA 1BYBA 1KCKA 3AU2A 4QR6A 2XM2A 4X0VA 5J5RA 4LBRA 2E68A 4W93A 1ZBKA 4L9ZA 1E6PA 3O0FA 1P0BA 2PDIA 3DU0A 1DWFM 2A21A 3EA1A 3TXZA 3NXLA 1R3QA 1KRMA 1I2PA 2Z24A 4WDTA 4TVDA 5DY2A 1SYTA 1TWIA 1UR9A 1EJUC 4FOJA 4S3AA 3UCDA 2NWRA 4HHPA 3GO2A 4MF4A 1U5JA 3RJYA 1BTMA 4CQ8A 2ZX6A 3VDCA 3LCHA 5EB8A 1BSLA 1ISXA 4PTWA 2E09A 3VD4A 1LBMA 3W22A 4IJBA 4XKYB 1UYQA 2WO5A 2VD9A 4NYYA 4XIMA 2WVSA 3KX6A 3CUZA 1L8PA 3TR9A 4ZE5A 2PPGA 1DJQA 3URQA 1TRDA 4OQVA 4JTIA 4OTKA 4UTTC 4QTGA 4RKAA 2V68A 4L9YA 4IUOA 3LK6A 5A8QA 4L4MA 1RD6A 1POJA 2F61A 3GH7A 1ZTVA 3VC5A 2Z2BA 3WMSA 1J0IA 1R30A 1AA1B 1TPWA 1ZNNA 4G2DA 1J11A 2QUVA 1GOXA 3D5HA 2NQJA 1W31A 5CZTA 2FIQA 4GNKB 1TFVA 3WEOA 2OX1A 1PKMA 2OCZA 1VP5A 4P8WA 1Q7MA 3HO8A 2YA1A 2CBJA 3W2LA 1J8VA 3L4WA 4U2ZA 4MLJA 2QHAA 1R9YA 4TOQA 5D2WA 5F4SA 5HPCA 4LAZA 4AX6A 1UWAA 5BCAA 4BQ2A 3PBGA 4JFSA 1QU4A 2X0SA 3T8QA 4HU3A 5A2BA 1M7JA 4KF1A 4B5UA 2E25A 1WDPA 2VRQA 2CBUA 5CC6A 4YWSA 3AIRA 4LPCA 5HMEA 4RNIA 4IXXA 4XZ9A 2PS2A 2PZNA 4J3VA 1OCQA 3VGBA 1I2QA 1HF6A 3CUJA 1XYZA 3MYOA 3WQVA 1AQ0A 4Q6JA 5LA1A 4BY3A 3EOLA 4GQBA 4KGLA 4W5ZA 3VKAA 3TVAA 1THFD 4QQ3A 3RM8A 4I9TA 4M1RA 2I17A 4Q4RA 4J1OA 4QIUA 2J7CA 3MHGA 4LVGA 4TVUA 3GW0A 7TAAA 2ATSA 3LA4A 5CC5A 4NI8A 3AJXA 4H00A 4GC3A 3ZJ8A 1UB3A 4C6FA 3PPHA 4QG6A 4GHRA 1EF2A 3N17A 3LI1A 1JZ2A 2BOFX 1JGMA 5CSRA 3BLFA 3IRSA 3UR7A 3MP3A 4LUSB 4GVIA 4WGXA 4K7YA 1KKOA 3P84A 1U5VA 1V3KA 4PA8A 3IGUA 1XC6A 1FVPA 4N42A 2DUZA 3O0KA 4U3AA 3OHMB 1GVEA 3ZSSA 4PGLA 3OZYA 1R3YA 2GLKA 3GM8A 4F4RA 1DPMA 3CZLA 4M81A 1IXPA 4H04A 2BGSA 5XIMA 1VQTA 3R8GA 4H9MA 3NSXA 4O0KA 4FNPA 3IGXA 4MWAB 4TV6A 3BLEA 4C6BA 3OYXA 3WLSA 4FLSA 2Y88A 4FEZA 4BF5A 5DT5A 3TKFA 3G24A 5I09A 3CUIA 1VAHA 1IGSA 4HA4A 1Z41A 5FJJA 1SFTA 1G7VA 2YXGA 2GDUA 4US6A 4NAEA 3QGVA 1PCWA 5CAHA 3E5BA 3LXAA 4GG9A 3QYQA 1UUOA 2A6LA 1PIIA 2PDQA 4CD7A 2ISFA 4D8LA 1GPWA 1T7LA 1AFSA 3AHVA 1F3TA 4I7VA 3AS0A 5M3WA 5I2UA 3B06A 1RVGA 2PWEA 1OGSA 3MV11 3S1XA 1H7RA 1UD4A 3GU9A 2Y7DA 4MTVA 2VUNA 2ZBTA 3N2CA 1J4EA 1LOQA 2POZA 1EGMA 2MUCA 1MNSA 1YE4A 4GH3A 4B3KA 2ZDRA 3ITXA 1V5XA 2FFCA 4L65A 4E8CA 4NZ5A 5D30A 3GC4A 3SO7A 3M7WA 1QW7A 1K6WA 3WNOA 1OYCA 3W1NA 1JULA 3HIJA 2P53A 1RQBA 5G2IA 3W01A 1KR0A 1VH7A 3ARVA 3BWWA 1P43A 3EB2A 1XIEA 5U7SA 2Q8XA 5BU9A 3I7RA 1Q6OA 2VR2A 1XYBA 3OGRA 3W2KA 2J75A 4GY7A 3FA5A 3BDKA 2VI0A 1EX5A 1E6XM 3WLHA 4HYVA 2XH0A 4WKFA 3O05A 4W4QA 2ZOXA 2WSQA 4W88A 1I1XA 3PR2A 4HMEA 3WN6A 3VK5A 2VFIA 4XKYA 3OJGA 2VP8A 3GNRA 5JBEA 1RH9A 2ZXDA 4KFOA 1UP0A 3FN9A 1HT6A 1IHIA 1BQGA 5I7GA 2GWNA 5C2XA 3WD0A 3R2GA 1A5LC 3LN3A 4WSJA 3WIJA 1BYAA 4F0KA 4KMQA 4XWUA 2B7QA 5D02A 4Q6XA 4S3CA 4EPKA 1LORA 3N25A 4AWTA 4R9OA 2E1DA 3V0UA 1XG4A 4B5VA 4PRTA 3CTLA 4QG8A 2DZWA 2D0HA 3U4AA 3H4WA 5DY3A 5TIMA 1G9HA 5DBTA 3TXVA 1CW2A 3KP0A 1R46A 2VFEA 3AIWA 3WF2A 2HTMA 4GKTA 1ZU8A 1M7PA 4K8GA 4UTWA 1SJDA 1JVNA 4OV9A 3AZRA 3N2MA 4U4MA 3R11A 1NQ6A 2XFRA 4Q4SA 1US3A 1AVAA 3S46A 1EJ7L 1H7OA 3RILA 1ONXA 2ALDA 3AXIA 4DZAA 4GE8A 4MUZA 1ZCOA 2V3GA 2V82A 2SFPA 1X7IA 3KCOA 1CXFA 1UUMA 3RU6A 3M0ZA 3MHFA 4JIEA 3L4VA 3PVFA 1K6AA 3R94A 1XS2A 2J79A 3TYEA 2EG7A 1EP2A 3S2MA 4KBXA 2GGGA 3ARRA 4AHQA 4QE4A 4IIHA 3SB0A 2NW0A 3W23A 3W1MA 2ATMA 1VB9A 1A5NC 3AC0A 1H1NA 2BOGX 1ONWA 4ECLA 3G3MA 4KERA 3PB0A 5IRPA 4HCDA 4DBWA 3CM4A 3CIVA 4ZXOA 1W9UA 1OIMA 2PDUA 5FSDC 4DPQA 3PTMA 3L67A 2ZYFA 3UW6A 4I7UA 3L4YA 1I45A 1X39A 3IIVA 2HPMA 5IOBA 1UWUA 4HK7A 3G1HA 4LUSA 2OLHA 1JI2A 3A23A 4EAYA 1JYWA 4RPQA 3T2PA 3W86A 5DXXA 1F3EA 1T8XA 1F07A 1VFTA 2QJIA 4PE8A 1TA3A 2J78A 3KLLA 4GUJA 4O17A 3B0UX 4Z0JA 3GR4A 1ELSA 1XLAA 1WZLA 3ARUA 2WLYA 4Z08A 1JPHA 2XDFA 4KH2A 1F6KA 3P0XA 4JAWA 3GDMA 3BARA 4HT3A 3B3DA 3VOCA 1F61A 1S46A 5JVLA 1T6MA 2VCAA 1BYCA 4UCGA 3UEQA 4PCPA 5AYXA 3DESA 3JVAA 2IKGA 5H2ZA 3PJTA 3NO3A 3BOFA 4BR1A 4XVEA 3UVIA 1CT5A 3WBYA 3W72A 1T0OA 1B3WA 1ZLPA 2PURA 3ABZA 4TX8A 4ATDA 4LV4A 3LS9A 1E9IA 3N73A 3P5ZA 3TCEA 3M41A 3ZM8A 1W32A 1WKEA 3WFAA 1IF2A 1U1JA 4C6LA 2YDQA 4LW7A 1Y5VA 4NJJA 1GZJA 3F4NA 4B2DD 2NSOA 2Q01A 2QNEA 1YX1A 1AMKA 1MXDA 2PBOA 1XLJA 1RK5A 4XD4A 5LNSA 3RDKA 2CBIA 3HGRA 2H6RA 2VL4A 3IIZA 1P6CA 1HJWA 3GIQA 3W88A 4HYRA 3H7RA 3FNDA 3SR7A 3STCA 4H8NA 2ZDSA 1YRRA 4LBUA 3CGTA 2FTYA 3GRIA 2ZXBA 4HTBA 1UW9A 1ZBVA 4OV4A 2PGFA 4EOUA 3L4ZA 1KM2A 4XZMX 1CPUA 4PMRA 4EE9A 1UD2A 1NWSA 2VWTA 3L5MA 3CUXA 1AW5A 3W37A 3P62A 3W7LA 1RBAA 2DU2A 1PDYA 2D1ZA 2WNZA 1HFBA 3B0YA 6REQA 1V51A 4Y9MA 2GOKA 4DJDD 3PBVA 3V5CA 3GTIA 4ZOCA 3UT0A 4ZSUA 3UY8A 3TTEA 1E40A 3S6TA 3SCNA 3W07A 1V3IA 3CB8A 3FGCB 1KA9F 3HG5A 1HKWA 1L0PA 2NVDA 1EC9A 1GQLA 5HOSA 2PDMA 3VD5A 4NJHA 4QE5A 4ATWA 1E1FA 9RUBA 3GX9A 4NZJA 4CVUA 1FWIC 1SFSA 3W02A 1QOXA 3TIMA 1FWRA 2ZADA 3TQPA 3CHDA 1P0NA 2BY3A 3GXFA 1H41A 3NA8A 4YYFA 3VD7A 3W82A 2WSKA 2Z1KA 3NL2A 1GKPA 4PB3A 5I78A 5AB3A 1O60A 2PI6A 4NQ1A 4IH3A 5C2GA 1D8WA 4X60A 2E28A 2XH7A 1XISA 3L7RA 3G1RA 3UJ2A 4MGGA 2INEA 3D3AA 1EDGA 2WBGA 4IIDA 3KCLA 3KBWA 5FF4A 1SPQA 1W1VA 4AZBA 1RZMA 2YDRA 3GYEA 1V0KA 4AIOA 3WNKA 2QCCA 4J27A 4GZJA 3L5AA 3RXZA 5A8MA 3GHUA 3VIJA 3MBDA 1BG9A 4DX3A 2Y0FA 1QATA 1PDZA 1QI3A 1A0EA 3A21A 1MZHA 4Z2IA 3UWUA 3AS3A 2FH8A 4Y2WA 5CPNA 3KVKA 3AYRA 1WAUA 3CL6A 3PTQA 3TCSA 3QMRA 1KRBC 2BG5A 3EDEA 4Q7BA 3W7MA 1GPFA 2YLLA 3DFNA 1E4LA 3LPOA 1UPPA 4PCFA 2Z1SA 2GSHA 2FB3A 3SFKA 2VDHA 3WEZA 4GCXA 5C2CA 1NEYA 3KHDA 1KTBA 4QSFA 3TTOA 2DSKA 3MY9A 3LHZA 1Q13A 4YHEA 3LCXA 3OZPA 4AC1X 2OQLA 1O94A 5DT7A 3LCLA 3F2BA 1IGWA 1TX2A 4YLWA 4R7JA 3GIYA 1DVJA 3RCYA 3S2CA 2ZX7A 4JD4A 3CZJA 2EF9A 4JEJA 3KBVA 2JE8A 4JY9A 3TSDA 2NXHA 1S5VA 4RE0A 4RZ6A 1LQ2A 5F1UA 5IHRA 5D8ZA 3WJYA 4TUFA 2IQDA 1ZFJA 3ZT6A 1CWYA 1IEQA 4IP7A 1LBFA 4JXCA 4EXAA 2F8QA 5F4XA 2I16A 4L5ZA 3WF1A 4DYEA 1PZ0A 2CLLA 4EVZA 2OLAA 1KFLA 1S2WA 1O5KA 2PF8A 1QI2A 3VIPA 1V7AA 3JRKA 1X97A 2ZICA 1ZJIA 1YLVA 3ZXWA 3LMYA 1OYBA 3UNDA 3MVIA 2WC4A 2HXTA 1Q8AA 1A5AA 4UOJA 3E74A 3BTNA 3BL3A 2F6KA 2GUYA 1LRQA 3QC0A 3QR1A 1LCOA 1QVBA