2VFFA

Crystal structure of the f96h mutant of plasmodium falciparum triosephosphate isomerase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
247
structure length
247
Chain Sequence
ARKYFVAANWKCNGTLESIKSLTNSFNNLDFDPSKLDVVVFPVSVHYDHTRKLLQSKFSTGIQNVSKFGNGSYTGEVSAEIAKDLNIEYVIIGHHERRKYFHETDEDVREKLQASLKNNLKAVVCFGESLEQREQNKTIEVITKQVKAFVDLIDNFDNVILVYEPLWAIGTGKTATPEQAQLVHKEIRKIVKDTCGEKQANQIRILYGGSVNTENCSSLIQQEDIDGFLVGNASLKESFVDIIKSAM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and Structural Characterization of Residue 96 Mutants of Plasmodium Falciparum Triosephosphate Isomerase: Active-Site Loop Conformation, Hydration and Identification of a Dimer-Interface Ligand-Binding Site.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Isomerase
molecule keywords TRIOSEPHOSPHATE ISOMERASE
total genus 98
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2007-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2vffA00
1W3IA 2RDUA 1K7EA 4XTDA 3LB0A 4GUFA 4RX0A 4I7VA 3L2IA 2E6AA 1GG0A 2QJIA 2B7PA 2NV1A 4DELA 4IMCA 1GZGA 5DCBA 5DBTA 3G3MA 2CLHA 4DBEA 3W1PA 4HNUA 5IBXC 2QCNA 4X3ZA 2V5BA 1VPXA 1JRBA 2PRMA 4XQ6A 2Z0IA 1W5OA 2O7SA 4XWUA 2ZRZA 1TO3A 2VEKA 5EA9A 5HUPA 1SO5A 2ZCGA 2YW4A 1QPOA 3FFSA 3M41A 1JCMP 2RFGA 3SW6A 1OFBA 1FWRA 5F4XA 3IEBA 3FS2A 4LUJA 4O28A 4WXYA 3IVTA 1WDWA 3HG2A 4RLIA 1DVJA 1JCNA 3UY7A 4BR1A 3BG9A 1A5AA 2FPVA 4NXKA 4FB7A 2XFWA 4S2CA 1VYPX 5A8GA 4TMCA 4GNJA 3FLUA 2ZZ5A 1JCXA 3O6YX 4JS3A 2X1SA 4K38A 4KFOA 1ZHAA 4ADSA 5AHLA 2ZZ7A 3NG3A 3NQMA 4CNPA 1DJQA 3M47A 5D02A 1IIHA 3UWZA 2A0NA 1KLZA 5KZDA 4DF2A 3P62A 3NPXA 4IPJA 3EXTA 5FEZA 4UIOA 3GDTA 3KVLA 1G4TA 4NUWA 1FCVA 1QCWA 5HR6A 1VZWA 1O5KA 3FA5A 4BFAA 3NR0A 1I2PA 3BARA 1YDNA 3T78A 5I3GA 1UUOA 1UBSA 2NX1A 3CWNA 4Z1AA 3PSVA 3Q94A 1L6YA 4WY0A 1Q6QA 1TV8A 2ZQ0A 2X1TA 2DZXA 4LC6A 3TUUA 3GX9A 1YDOA 1EUAA 3QZEA 3W1RA 4JTLA 1IF2A 1WYIA 5HQEA 3R5EA 3ANYA 1XM3A 1W1ZA 3CIXA 4JY8A 3NQGA 1OABA 2BXVA 4AHQA 4UTLA 4FO4A 1T0OA 4ZQMA 1UUMA 1ZALA 2NZLA 3F1QA 2PCQA 4JTUA 1OK6A 1OYCA 1XBZA 2Y63A 1O5XA 1H51A 5D09A 3MI2A 3N34A 1ME7A 2J9XA 4Y6GA 5CG7A 3HF3A 4RZ5A 2YX0A 2A6LA 3PUOA 3JS3A 3RNDA 3CIWA 1ZAJA 2GQ9A 5D33A 2CLIA 6ALDA 3PSWA 3UWYA 4Y9AA 4EWND 1P4CA 2G97A 4PL1A 2GVGA 3DI1A 4RR4A 3ZWTA 3W1TA 3BW4A 4H3DA 4HNNA 3G0XA 3LCHA 2Z2UA 4N9BA 2QCFA 3L66A 3QSTA 3G8EA 3QMRA 2ZTJA 3LXAA 3TMLA 4LUIA 3EXSA 1FCBA 1K7FA 4ONVA 4PTNA 2Z6JA 3ZS4A 3P67A 5K9CA 1G7UA 2A1YA 4QSHA 4UR8A 1OFEA 3ABOA 5AYYA 3CQ0A 3LHYA 3MMTA 1ZY9A 4Z0JA 3OVPA 3P82A 3W1AA 1RQBA 1GPWA 2Y7EA 1OFQA 3RFAA 2NX9A 3L0NA 1LRNA 1BWKA 1KA9F 3W2KA 4IMDA 4P2VA 4A2SA 3VE9A 5I3FA 5IM51 2QUUA 2JBMA 2Y70A 1PIIA 3DH7A 1IXNA 2A7PA 1VHNA 1OF8A 1XDMA 5LZLA 5EY5A 1SO3A 2C19A 1KTBA 3G1FA 5LNSA 3NQEA 4PL2A 2UV8G 4UFJA 4KFPA 5KSWA 1VH7A 3B8DA 3ABQA 3HIJA 3M0ZA 3QYQA 8TIMA 1KW1A 5SWUA 1B4EA 1KLYA 4EVZA 5G1TA 2ZRXA 1P0NA 2E5DA 2NV2A 3TH6A 1R2TA 3LXBA 2CLOA 3L0GA 3UWUA 4Z1BA 3E9AA 2CZFA 4N9DA 4JD4A 3OA3A 3B0UX 3OBKA 3P74A 3W71A 5DLCA 4YCPA 3STGA 4DF1A 4X9SA 5D05A 1YXCA 3ABRA 3L67A 1EUNA 3CPRA 1SQ7A 4CQ9A 5LKYA 4N2YA 1AW2A 4NJIA 2DZVA 4UTJA 2QCDA 1K8YA 5T26A 4QAIA 3TR2A 3B06A 2YZRA 3EX6A 4JYDA 1GJPA 6TIMA 1H60A 4GUGA 1D3GA 5FF0A 2HSAA 2V5LA 3DFQA 1CW2A 3W7OA 3TFCA 4O17A 1GYNA 2GOUA 3RMJA 2WSRA 3HPXA 3NPVA 1Q3NA 3VFLA 4K8EA 3W6YA 2FPYA 3IIZA 3W7IA 3WFAA 2ZA2A 4MLJA 4A21A 1ICQA 1D9EA 4O1DA 4B5NA 1T8XA 1N7KA 2FB2A 3OEXA 3IRDA 4PODA 4CLMA 3W7PA 1I4NA 1G67A 4PCFA 4YLWA 4HNTA 3O07A 4HN4A 2DZPA 4O14A 5I3KA 3W7JA 1GVQA 3A22A 2C18A 3WJYA 5CSRA 2R94A 4UR7A 2VXNA 1M7OA 4ICNA 3S1UA 1R47A 5E93A 1TCDA 1LRQA 1WOAA 3STFA 3FKRA 1SU5A 2YYTA 3NA8A 4M6VA 4EF9A 1VYRA 5HWNA 3IVSA 4LVFA 1JUBA 3NL5A 4WOQA 5E1QA 1KBJA 5D2WA 1WAUA 1YADA 2HS6A 2CLFA 3QPYA 1WV2A 1YXYA 4UUIA 2GJNA 2WJZA 1VLIA 3I6RA 4IOTA 3S5ZA 2ATSA 3QJAA 3EX1A 1KFLA 1VQTA 4MPQA 4O18A 4XKYA 4YMZA 3W72A 2Y7DA 4ALDA 1FWSA 3KAOA 4RXFA 4YCOA 3I65A 2JK2A 3QQ0A 1UJPA 5K7JA 4R53A 3LTSA 5LHFA 4O54A 3N9RA 5D2YA 3S5NA 1IGSA 1JULA 5HWMA 1XUZA 2AQWA 2BSLA 2JGQA 3WK2A 1FX6A 2RKXA 1WQ5A 2J88A 1S5TA 1LM1A 1X8FA 5G4WA 1F2JA 3W1MA 3FJ6A 1P5BA 3WK3A 2AAMA 3E02A 2V9DA 2A21A 3O6CA 4ZQCA 1DQXA 3TMQA 4ZVJA 3SR7A 2DU2A 3HG3A 1OK4A 2V8ZA 1V5XA 3O06A 2WO5A 1RZMA 1VRDA 5C6MA 3GK0A 3HG4A 1Z48A 5F2IA 5EYWA 3LRKA 3LCWA 3UYCA 1VYSX 4UTHA 2QKFA 1H61A 4IMFA 4NJGA 1NFBA 1H5YA 1QMLA 2NXHA 3NVTA 3UWQA 1SZEA 3LM7A 4CNNA 4JEQA 2VEMA 3N3MA 4AAJA 3F4NA 1JQXA 2EKCA 4O4VA 5BW6A 4TO8A 3QW4B 5FF2A 4JTEA 2DZWA 3A5FA 4HHPA 1O95A 3L9CA 3SGUA 1LBFA 2VELA 4O15A 3UXAA 4POCA 3HOJA 3G3DA 4IQLA 3GXNA 4GXMA 4K7VA 1K8XA 3KFTA 4Z0SA 3CU2A 1GOXA 4MZ8A 4TR9A 3TXVA 1QPRA 4FIQA 3TJXA 5K4XA 2QUTA 3EXRA 3FIGA 2P1FA 1ZAIA 4JTGA 5MHBA 2OMAA 5HJLA 3K30A 4O19A 1WXJA 3BG5A 3W2MA 5FESA 4YWIA 4LC8A 4YXGA 2CW6A 4ZZ9A 2ISSA 1HL2A 5DY3A 1FCUA 1LROA 1F76A 5D38A 2GJLA 3W23A 3TNOA 5U4NA 1EEPA 2GQAA 4GFSA 4ORIA 3N19B 2O7QA 1R30A 4WY0B 5BOOA 3FKKA 3MP3A 5KINA 3W1UA 4JTKA 3BGGA 4YL2A 2RDTA 5HUOA 1TPC1 3TA6A 4WZHA 3G0SA 3Q37A 4ZL1A 4E2BA 4LOCA 4BI6A 2ZZ3A 3TW6A 2EPHA 3E96A 4LRTA 1AL8A 1Z42A 1FXQA 2E6DA 3W7NA 1ICPA 2VC6A 4WX2A 1O4UA 4IMEA 4O53A 2V2CA 1MO0A 3BGJA 5KZMA 3W83A 3H55A 1XBVA 3CT7A 3W07A 3W2LA 3S1XA 5CPMA 3P60A 3EX3A 1WOBA 5J5RA 1PV8A 2Y62A 3TV8A 4NNCA 1TPVA 4DO6A 1JUKA 5FI8A 1SFJA 1THFD 1I2QA 5F2MA 2I9EA 3LERA 1JCLA 4AHPA 2FQIA 3A5VA 1NVMA 3LXCA 4UFHA 1ZFJA 4IXXA 4DXVA 1VJIA 3LHWA 1HO1A 1ZJIA 2ZBTA 1W37A 3CB8A 3NL6A 4Y90A 3W85A 4QJ1A 2PC4A 1OX4A 5AYXA 4FNPA 1J4EA 4BK9A 1W0MA 2YGYA 3UWWA 1B9BA 3W2NA 1R46A 1IXOA 3B04A 3T55A 3T7VA 1YTKA 3GDKA 3W9ZA 4XBSA 5KZEA 5LNWA 4UTWA 1AL7A 2C16A 1MXSA 5KITA 4W9TA 4DO5A 1W54A 4FXRA 1G4SA 1EIXA 1K8ZA 4OQVA 1QO5A 1ICSA 4JTSA 1XDLA 4MZYA 1RV8A 1L2UA 4LRSA 1OYAA 4X2RA 4QISA 2ABBA 2XN1A 3HB9A 2LLEA 2DZUA 5G1YA 3UPWA 3O05A 4P61A 1QPNA 3BLIA 4DBDA 2BZNA 1AW1A 3A21A 3GDMA 1Q6RA 2OX1A 3LBCA 1HFBA 3LV5A 4D2JA 4O12A 5G2WA 3R89A 1HUVA 2CLLA 1VGAA 5CZSA 4WXZA 3HJZA 3I7SA 4QIUA 3TE9A 3G1VA 2ZDRA 3PUEA 3PB2A 3A24A 3GZ3A 3IGUA 4O1AA 4UMAA 1H62A 4O8RA 1U5JA 2A4AA 3DHFA 2FPTA 4C1LA 2HMCA 2OT1A 4I9AA 5HR7A 3W1NA 4UNKA 4IX2A 4JX6A 3DAQA 4NZFA 1OF6A 4AEOA 1RQHA 1L6WA 3W7RA 3PG9A 3YPIA 3AJXA 5F1UA 4EF8A 4M7TA 4GUIA 2NUYA 5DN1A 2Y7GA 2B4GA 4MJZA 2G96A 4MZ1A 1BKSA 4Z08A 3TX9A 1MEIA 2XN2A 4XBKA 2NWRA 1PL9A 1QOQA 1ONRA 3LGEA 3KRSA 5DY2A 3CWOX 5F1VA 1K03A 1GVRA 3HPSA 3W74A 3P80A 1OX6A 3LLFA 3NYZA 5F4WA 3SFKA 1X6UA 3M5XA 1LRTA 3G22A 1JCYA 3M9YA 2FLIA 1QFEA 1G7VA 3ATYA 3DXIA 1XL9A 1EP2A 3O16A 4NNAA 1U83A 3S1VA 3VKJA 4HPXA 4RZ4A 1F6KA 1JVNA 5D30A 2Y6ZA 5DCDA 4R33A 3BW3A 4UTTC 1YPIA 2C13A 2ZRWA 4IX0A 3HG5A 3DGRA 2JKPA 3L0KA 5LNUA 3EKLA 4NZJA 3DKJA 3NEVA 4N02A 2WOQA 3S5YA 1ALDA 3S0CA 2A7NA 3BV4A 4I7UA 1K02A 2R14A 4WD0A 4IJBA 1DV7A 3W86A 2G95A 2E68A 3KVJA 1RPXA 2I14A 1PE1A 1GQNA 4JDYA 5HINA 1ML1A 4H4IA 3NGJA 5LHEA 3PC0A 1KM3A 1W3TA 1KFJA 2CZEA 4LVGA 4LVDA 2VFIA 4CNOA 1VS1A 2WNZA 1W5NA 5AB3A 3FJLA 1I2NA 1X1OA 4DO4A 3E12A 1YTDA 5CGQA 1I8JA 4TX9A 2YSWA 2FDSA 5K9XA 4AXKA 1YDVA 1TIMA 1GTEA 2CLEA 1Q45A 1YXDA 1W56A 1EP1A 1EB3A 2YXGA 1KM4A 1MZHA 3LHVA 3IIPA 4HIBA 2F7FA 2QCHA 3DKLA 4NVTA 3LOTA 4O50A 2NXGA 4BWLA 2E77A 5LNVA 1AG1O 5D03A 2E5CA 5AHMA 1S5VA 1JRCA 2JKEA 1H50A 4UC5A 4GJ1A 3DI0A 4FNTA 3OHIA 3CTLA 1VC4A 3HQ1A 3B03A 3AO0A 3NQ6A 1OHLA 1SZFA 3PULA 3GNNA 4LTSA 2PE4A 5F2GA 2WNNA 3NPUA 4JTIA 4PC8A 3S8HA 4DF0A 3R12A 3D0CA 3ATZA 2YCEA 3FYPA 1H7PA 2G5WA 3G1AA 2CU0A 4UXDA 4XUGA 3W1XA 3T4CA 5G5IA 3SSJA 4M5PA 1QO2A 4JYEA 3BK0A 4C1KA 3I7QA 4AHOA 3R8RA 3EEGA 1KV5A 4E2DA 1TV5A 1S5WA 2YPIA 2EAWA 3O6DA 5CPNA 4MKNA 2QCDB 1GVOA 2GQ8A 3M16A 3P8IA 2B7NA 2QR6A 1JUEA 3BLFA 3N2MA 1LYXA 4J9JA 2H90A 3LV6A 4I7WA 4LWWA 3H54A 4IUOA 3SY5A 4UCGA 2FIQA 5AYZA 1I45A 5TQLA 5AC6A 3O15A 5DXXA 3KOFA 4DPQA 3B0VC 2HTMA 5AOUA 4M19A 1VCFA 3TFXA 5D2XA 2ZRVA 1O94A 4K6AA 3P5YA 1TSIA 4O1CA 4UFIA 1H7NA 3GB6A 3C61A 2W6RA 2VENA 4UTIA 5CZJA 1SZNA 4JGDA 3A23A 4MIMA 3MUXA 5H91A 3PBUA 1W3NA 3WJWA 4N4QA 3DU0A 1NSJA 5BRBA 1UCWA 1OFAA 3KVMA 3VI2A 2C1HA 4E0CA 3TKFA 1S3HA 4MYAA 3WJXA 4NJHA 4UTKA 3G1XA 3S5OA 3W87A 1NF7A 1WBHA 3GAKA 3NXFA 5DCEA 2CLMA 3W22A 3G8RA 2J24A 1KTCA 3MHFA 1BEUA 2ALDA 3DZ1A 4NJKA 5C55A 3HGOA 1DQWA 5EBUA 2VFGA 4IXHA 4ZQPA 1LBLA 4L4LA 3NQDA 1KM6A 3QF0A 2ZZ1A 1OX5A 5L9FA 1QAPA 4DEFA 2QCEA 4MOZA 2D73A 1X7FA 2VEIA 1EWDA 1DBTA 1A5BA 1F74A 2HS8A 5DELA 3Q58A 1N8FA 2GVLA 3SZ8A 3H53A 3W2JA 1WA3A 4GUHA 4JTTA 1DJNA 1H1YA 2BWGA 4NU7A 1C29A 3EWYA 4AF0A 4JIPA 2V2DA 3MWAA 3G0UA 2CFFA 1ZNNA 3S1WA 1CI1A 1IXQA 3IGXA 3P61A 1KFBA 4RK8A 1KBIA 4OGZA 1B3OA 1GG1A 3QMSA 4A3UA 3PG8A 1VLWA 2TMDA 3W7MA 1H63A 4LV4A 4FX6M 1OVDA 4UTWC 2YFOA 1XFBA 3RK8A 1KTNA 3MHUA 1KM1A 3OIXA 4GC4A 2R8WA 3TROA 1YYAA 3GAYA 3THAA 3LHZA 2E09A 4BF9A 3LCIA 1H7RA 2Z1BA 3W7QA 3ABSA 1JJKA 4GWEA 1M6JA 4FNRA 4K36A 1F05A 4X22A 2ZZ4A 3RF9A 1EX5A 1XKYA 3PF3A 1LORA 1XBYA 1FWNA 2QAFA 2P0OA 1SUXA 3C52A 4HSNA 3JR2A 1VR6A 2QCCA 4WUIA 3HO8A 2FJKA 4UNLA 4G1KA 1ZAHA 2E6YA 4JTHA 3W7KA 3TDFA 2P10A 1QPQA 4K7YA 4MLRA 4O4WA 1K7XA 1RD5A 3IIOA 3NQ7A 3C2VA 3GR8A 2VFHA 4FX7A 1I2RA 4UFKA 2I1OA 3BVJA 1K3UA 5K3VA 5H2ZA 4AB4A 1TQXA 2DJXA 2H6RA 1TRIA 4TMBA 1P1XA 1SW7A 5LNRA 3UZJA 4NT0A 4N9CA 3L5LA 2ABAA 3BLEA 1KM0A 3CEPA 1G4EA 5LGZA 2Y85A 3FOKA 3GLCA 2DZTA 1WBJA 4AMAA 2QUVA 3CC1A 3BG3A 1LCOA 1LOLA 3IV3A 1TPFA 1FXPA 2A2IA 3MYOA 1SO6A 4IGHA 2BTMA 4WOZA 5C5YA 3MW7A 1Q6OA 1XI3A 5K4ZA 2ZYFA 4N6FA 5BNKA 4OV9A 3LBMA 5LSMA 1QDSA 2EF9A 3MHGA 4RXGA 5D04C 3A9IA 3HBLA 1ADOA 2ZFAA 5CZTA 3G1DA 3NAVA 2NUWA 3IVUA 4JR5A 3LDVA 3MYPA 1F73A 2QCMA 1JR1A 5A5WA 4FIRA 4MFDA 3EKZA 1FUYA 3M1ZA 2W0UA 5I3IA 1KFKA 2EGZA 2VKZG 4K39A 1A50A 4K37A 4M6QA 2NX3A 5HMSA 2TYSA 3B0PA 3S42A 4ZQOA 3TJLA 4GBUA 2YDAA 3UWVA 4AWSA 3GR7A 3M5VA 4OT7A 2QF7A 2QEZA 2Y89A 2Q3RA 4AH7A 3W7EA 3C4UA 3W76A 3EX4A 1QOPA 1DL3A 2QAPA 3R13A 4FXSA 4UMBA 3PVFA 3USBA 4JDBA 1ME8A 2ZZ6A 1XCFA 2V0TA 2BX7A 2YR1A 3P81A 3Q2DA 3M5YA 2C3ZA 2PRHA 1FWWA 3LI0A 1KFEA 3GXPA 3VE7A 1TB3A 4RV8A 2GVJA 2VOMA 3PR2A 2V82A 2PURA 1W8SA 3STEA 1W5PA 5U7SA 1HO4A 4NQ1A 3P7YA 3UZ5A 1A5SA 4MY8A 5CSSA 1W5QA 1SFLA 2Y7FA 3LTYA 3LX9A 2A7RA 3EX2A 3IGSA 1YPFA 4MJMA 4JTJA 5I3JA 2C15A 2DJLA 1TTQA 4Q4KA 3QMTA 3LHTA 4JX5A 3C0JA 1OG0A 2A5HA 1FDJA 4RKAA 4Z1CA 5EMUA 4UFLA 2NXIA 4U4MA 4PH6A 1Z44A 3C2FA 1L6SA 3UD6A 5IBXA 3U8GA 4EOUA 3LI1A 4O0KA 5HNRA 2CZDA 5E0KA 3QM3A 2OT0A 3PUDA 4FX8A 4LS0A 1CX9A 3O8AA 2B0MA 4LS2A 2WPBA 4WY0F 4LVBA 5F4SA 2J6XA 4O13A 1EPXA 1FY6A 1TPWA 1FQ0A 1LP6A 5CPLA 4DQWA 4NX5A 5DXYA 3MBFA 3M44A 1DORA 1FDZA 4GUJA 1OX4B 4LU0A 3UNDA 1N55A 1SSGA 3U2OA 2V2HA 2AGKA 3C3NA 5LGXA 4PFMA 1W5MA 1DOSA 3M6YA 1PCKA 3LRMA 3DFNA 1KV8A 3WJZA 4FHAA 4JYFA 4Q33A 1LDCA 3ZFHA 1LZOA 4CQAA 3C2OA 4O1BA 2E5BA 4AWTA 1OFDA 1P0KA 3UXDA 1PVNA 2RHGA 3G24A 3LCLA 3STCA 4KWWA 2VFFA 3L5MA 1F7BA 3EWZA 3M7WA 2X1RA 3HPZA 4QNEA 5HWJA 1TTJA 2B7QA 1C8VA 2TSYA 3HGRA 3GVGA 1JQVA 2DP3A 5G2HA 2ISVA 5FF3A 2B7OA 1NF0A 3CEUA 3TQ0A 2J27A 4OWGA 5AHNA 2CZ5A 4N9EA 4ZQRA 3BO9A 1L9WA 3MBDA 3NM3A 3TIMA 4JICA 4QITA 2IQTA 3W88A 4FEZA 3DENA 1OFOA 5BMXA 1ZCOA 2ZRYA 4UFMA 2F84A 3NQVA 4ADTA 4AF0B 4UTTA 1JCJA 1LTDA 3WJSA 4MFEA 3MI6A 5C2XA 2DZSA 5FF4A 1GYLA 3G1YA 4DPPA 4CCEA 4PEKA 1A5CA 2QJGA 3GIYA 4MYXA 1E51A 3GYEA 3NL3A 4CQ8A 4LY8A 2QDHA 2TRSA 3FEMA 4O57A 3G1HA 2TPSA 2C6QA 3QSRA 1PCWA 1TPDA 2JKAA 4WJEA 1LOQA 2Y88A 5KTLA 3L68A 4IWWA 2ZZ2A 5L6UA 3W70A 4KFNA 3NM1A 3RLVA 3QFEA 3DHDA 3ZWSA 3TSMA 1RR2A 2CLKA 4HNVA 2A6NA 3CHVA 4OV4A 3W75A 3DFOA 4O16A 1AMKA 3TK7A 3OVRA 1A53A 3NDOA 5CKSA 3S6DA 3UQNA 4TIMA 3TCEA 3TW7A 1LBMA 3T44A 4CCDA 3MJYA 1TJPA 3MP4A 1XUUA 1GVSA 1LLWA 2BLEA 2H3DA 3V1PA 4UTUA 5AC8A 3UY8A 1GEQA 2PRLA 3G1SA 1VHCA 1QWGA 2QJHA 1H1ZA 3EWWA 3W1QA 3NOEA 4O0ZA 3TC7A 3IIVA 3TU9A 3OG3A 1TPH1 2FTPA 3WK0A 1FCQA 3ELFA 3V75A 3E49A 1OJXA 3DBPA 3PM6A 2ISWA 4L4MA 3G18A 3R2GA 2RH9A 2C14A 3OVQA 1YTEA 4N4PA 5TBOA 3BW2A 2Q3OA 3N14A 3NZRA 1DKWA 2OZ0A 1GWJA 5J5DA 1H7XA 3KHJA 1TTPA 3N73A 1SW3A 1NEYA 3KXQA 3W7LA 4N6EA 3KRUA 5G2IA 2VFDA 3NQAA 1B4KA 4A29A 3EWBX 1OFRA 2FFCA 3IIXA 3O63A 5D37A 1Y0EA 3PWAA 3KVKA 1LLZA 2H8XA 3PB0A 2WV8A 5F2LA 4HKPA 1LOSA 3N2XA 1UB3A 3TSBA 5D2VA 4LW7A 5AN7A 4O10A 4LS1A 1TV7A 2J9ZA 4O52A 5K9DA 3CM4A 3MO7A 3LTPA 3VCRA 5BMWA 2YYUA 1RQEA 3PY2A 3LCXA 1SW0A 3GNDA 3QW3A 1KFCA 3C56A 3DFTA 4MVAA 4JN6A 4XKYB 1EA0A 3FYOA 3W1LA 4UTMA 1DHPA 4KWVA 2W79A 1ZENA 3C8FA 4NX0A 1F6PA 3BPWA 1XXXA 4LNYA 4R7JA 2WSQA 1FBAA 1NAL1 1Q6LA 1VCVA 2FB3A 3TXZA 3QRHA 4A22A 4Y8FA 1GTHA 1PHWA 2E6FA 1I2OA 2ATMA 2NLIA 4FNQA 4LVAA 3C2RA 3LLDA 4JNMA 5AHEA 3SGZA 1F5ZA 5EL1A 2WQPA 3QPZA 3MI3A 3GDRA 3TAOA 3TQVA 3NQ2A 3SJ3A 1R2SA 4JXCA 3LRLA 3W7HA 2RDWA 4JY9A 1WX0A 4NXSA 5K2ZA 3P5ZA 4QM1A 2Q8LA 3CLMA 2Z6IA 3GDLA 3VNDA 2JGYA 4HPJA 1TYGA 4AVFA 5FEWA 3M43A 2WSYA 2WKJA 1BWLA 4ZQNA 3LCGA 4CCCA 1AK5A 1T96A 2X2GA 3EB2A 3QEZA 2VFEA 4S2BA 5GVJA 4LV9A 4OHQA 1TREA 2VEPA 1M7PA 3NQ8A 4MY9A 1V7YA 5TIMA 1QR7A 4MUZA 3PBYA 1MSSA 3KX6A 2J9YA 2A85A 2KZHA 3W7CA 3C2EA 5EPDA 5CPOA 2V81A 3GXTA 1TPEA 2GUUA 3LHUA 3T40A 4OU1A 1SPQA 2ZTKA 3S9YA 4FF7A 2OJPA 3GKAA 4LT9A 3B05A 5D2TA 3F03K 3MP5A 3SECA 3EWXA 1TRDA 3I7RA 5AHIA 1G69A 4O11A 3TC6A 3KRZA 1M5WA 4ZMGA 1MEWA 4JX4A 3QC3A 1PS9A 2OCZA 2ZRUA 2V30A 1T99A 2Q8ZA 4FNUA 2YW3A 3TQKA 3UPBA 1HG3A 1TQJA 4HSOA 3QH2A 3HGSA 3QQ1A 4Z1DA 1YLVA 2E1DA 4TU1A 3W73A 1AW5A 1BTMA 3PAJA 4ML9A 4PA8A 4HT3A 5KMYA 2R91A 1VCGA 1PHQA 1OFPA 1XBXA 4S1FA 1ME9A 3U6WA 4IPIA 3W7DA 4RZ6A 1J2WA 3E0IA 2WNQA 4ORMA 1FWTA 3NNTA 5FEXA 4XZ9A 1O60A 5AFDA 4ADUA 1SSDA 1SO4A 1G6CA 4BI5A 5FEPA 2Y61A 1HTIA 7TIMA 4Q32A 3F4WA 1TJRA 2NUXA 3W84A 1TPB1 1UASA 2DORA 3NZ1A 4NNBA 3RU6A 3RLUA 1R2RA 1MEHA 3PS7A 1EP3A 4BI7A 3L21A 4WQ6A 4U28A 3O1NA 3SI9A 3NO5A 4RCXA 5AC7A 4OBTA 3EWUA 4EIVA 4XTIA 3THQA 3I68A 3PBWA 1D3HA 4KKXA 1GT8A 4M6PA 3W3OA 1KM5A 4QNWA 2X16A 1RVGA 1SZGA 1SR9A 3L5AA 4RJEA 5G4EA 1TPUA 4R34A 2CWNA 1Z41A 3NQFA 2X30A 3TAKA 4E38A 4A2RA 4IMGA 2XN0A 2ZA3A 3L65A 4OE7A 5CZ0A 1H7WA 2X1UA 3GKFA 4QQ3A 2H8ZA 4K8HA 3LCFA 3TSDA 1IXPA 4GE8A 5EKYA 5AHFA 3W2UA 1X1ZA 4H6KA 3P8JA 2C0AA 5C54A 4Y96A 1KM2A 4AWUA 4BWLC 2ZA1A 1FDYA 5D32A 2QDGA 1J5TA 3W7GA 5DBUA 2EHHA 2YFNA 4NJJA 1W31A 1GVFA 4JTFA 5ABTA 3INPA 3WK1A 3SIZA 1TTIA 2NWSA 3NL2A 3NQCA 5I3HA 3HGJA 3M5ZA 3PBVA 3ZR4A 2QCGA 3NPWA 4MY1A 2QCLA 3DFSA 1H7OA 1OYBA 5HULA 1QNVA 4UMCA 1EWEA 1TMHA 1C9DA 3B4UA 1IIGA 4JIQA 3HMJG 1G4PA 2GPTA 4GRSA 5FF7A 3DFPA 3C6CA 3P84A 4M7SA 1B57A 3N9SA 1XC4A 2H3BA 4FNSA 3JRKA
chains in the Genus database with same CATH superfamily
3C0SA 3UFYA 1K7EA 3B0YA 4ENLA 1VEPA 1EYEA 4UZSA 1FVPA 1JAKA 3WNPA 2ISDA 1VKFA 5EMJA 2C0HA 4GIYA 5LA2A 1UW9A 3KCJA 2B7PA 5EFFA 1AJ2A 3WDQA 5DCBA 3OZYA 3H7VA 3KL0A 4IFRA 4IZGA 4F0KA 4CQCA 4DWSD 3B8VA 3W1PA 4BEUA 2QCNA 4LUSB 5BWFA 5HANA 3AYTA 4E4UA 1X39A 1UZ4A 2Z0IA 2Z2BA 5HMEA 4J35A 4PRWA 1EGMA 2IS7A 4WDTA 1TO3A 4IPLA 5AECA 4GBDA 1MW1A 1UZHA 3U3HA 1Z89A 2X41A 1R9XA 3GHRA 1H09A 4L5ZA 3CUIA 2PBGA 3BLPX 4XVEA 3ZR5A 4O28A 4UQ9A 3WUEA 5HDRA 1JCNA 3BG9A 4FS9A 1C8YA 3WLKX 1JDDA 3F2DA 4WKAA 2Z1SA 2ZZ5A 4XAGA 3WQFA 1Q4NX 3GS6A 3O6YX 4IPNB 1EGVA 4PFHA 4LFYA 3ZMRA 3M47A 3UWZA 5CLWA 2PD5A 1GZ1A 1XIEA 3L2MA 4JTRA 4UIOA 3KVLA 1XLKA 3PBMA 1W32A 1U1HA 2X7VA 3GO2A 4DLFA 2GLKA 5HR6A 1OCBA 4PB3A 1T8QA 4F9DA 2P53A 1PIGA 3NR0A 3T78A 3VUPA 1FHUA 1TKKA 1L6YA 3MPGA 3BL3A 2RAGA 2Z00A 2X1TA 1ELSA 1JGMA 2MANA 3WENA 3QZEA 4IG2A 4HA4A 1FWEC 3O6AA 4JTLA 3PZUA 4AFYA 5HQEA 3MCOA 3ANYA 1XM3A 1W1ZA 3RXZA 5A6BA 2PGEA 5A1AA 1VEMA 2BXVA 1M01A 4GYJA 2WCSA 4GI9A 5DMMA 2YBUA 3GU1A 2NZLA 1OYCA 3PP7A 3N34A 2EEXA 4Y6GA 4EPEC 1O66A 1AA1B 4Z2KA 2YX0A 1N82A 5D33A 2CLIA 1V4YA 4B9ZA 5BRQA 4GCAA 1P4CA 2G97A 3I4EA 2OOGA 3W1TA 2R6OA 1ZGDA 1M3UA 1OEPA 2OZTA 2QCFA 3WL1A 3QMRA 3AIVA 3LXAA 3TMLA 5H8MA 4LUIA 3EXSA 1K7FA 2FGBA 3ZS4A 1HW6A 1G7UA 1OFEA 1S2CA 5C70A 1RQBA 1XYZA 1FWFC 3SURA 4DUXA 2NX9A 3L0NA 3MZ2A 1BWKA 1GHRA 3N6HA 2PB1A 4GYFA 3TZFA 4F4RA 2VP8A 3NSMA 2A7PA 3KEHA 4WGHA 1VHNA 1XDMA 5LZLA 3FXYA 3AUOA 1QW9A 1ITQA 1OT1A 3WQVA 4UFJA 4KFPA 4C6DA 1VH7A 3ABQA 3QYQA 3SCRA 1R9YA 1KW1A 2V63A 2NW0A 2X2YA 4C5ZA 2NV2A 1P0EA 3LXBA 3E9AA 2CZFA 3OA3A 4INFA 4A3QA 1XFCA 3ANUA 2JFEX 4DF1A 4E4FA 3U57A 2PWDA 1EQPA 1YXCA 3L67A 2OWWA 3CHDA 4S3AA 1SQ7A 5LKYA 3KRBA 3VAVA 1NDWA 2DZVA 2D3NA 1K8YA 2HE8A 2Y5SA 2YZRA 6TIMA 2OXNA 3B8IA 1V3KA 2IXUA 5FF0A 2HSAA 1DJXA 3DFQA 4LYRA 4QCFA 4M1RA 1QASA 2JE8A 3HU7A 1GYNA 7CGTA 3U7VA 2WSRA 4ROQA 3VFLA 3IIZA 4A21A 4PSPA 1D9EA 4QE1A 4DUWA 5CAHA 3V16A 4B2DD 4OUIA 4ZB5A 4JZ5A 4QDMA 3ZZ1A 1H5VA 2WANA 1A5LC 1OCJA 4BY3A 3M6DA 4HN4A 2DZPA 1XLBA 3W7JA 2IQDA 2R94A 4JIEA 9XIMA 3S2MA 3HV8A 4Z2LA 5E93A 4Q4MA 1RY0A 1LRQA 1WOAA 3OVGA 1O68A 3H24A 3NA8A 1VYRA 1GQLA 2J62A 4J1OA 1JD9A 1JUBA 3HN3A 2FKPA 3AYSA 2CLFA 4H9YA 1WV2A 1YXYA 2GJNA 1KNWA 4C7DA 1KFLA 3QFWA 1BGAA 1XIFA 3W72A 1KCLA 3VNMA 2XZ7A 4KGLA 2J7FA 3I65A 3R25A 2NT1A 3TN3A 1FHDA 2GK1A 3N9RA 5HJYA 3AXHA 2JGQA 3LD5A 3WK2A 2QJMA 2J88A 3BSHA 3TYAA 3OW1A 1GPFA 3W1MA 4R85A 3CUXA 3V0TA 3BURA 2WSPA 4NY2A 1DPMA 5AC5A 1V6YA 2A21A 3O6CA 4ZQCA 1IZJA 3SR7A 2DU2A 1AUSL 1UMLA 5EMKA 5IOBA 1V5XA 3RPDA 1WO2A 1RZMA 5C6MA 1RXOB 3GK0A 1GHSA 5F2IA 3TWAA 4IQJA 3UYCA 3IJIA 3QXBA 2HPIA 2XDFA 2ZXAA 4IISA 4LEFA 1J0ZA 1QMLA 1DWAM 1UHVA 2NXHA 1SZEA 4JEQA 3GNXA 2VEMA 3IS4A 3VABA 5BW6A 1JQXA 4O4VA 1YBQB 3M0MA 4TO8A 4S3FA 2J8TA 3GNRA 2ZUTA 1C8XA 3QW4B 5FF2A 3M07A 2DZWA 2Z1WA 4HHPA 1O95A 3G2GA 3L9CA 3L4UA 3WLTA 5REQA 1BTCA 1S38A 3ISIX 4TTGA 2GVEA 2DIJA 3GXNA 2J78A 5CBJA 1BYDA 3KCOA 5J8LA 1GVEA 4Z0SA 3VIJA 4TR9A 3I10A 4M81A 4UQCA 4EP8C 1GKRA 1EBGA 3EOOA 3RHGA 1XGDA 2OMAA 1ECEA 5C0QA 3C8NA 1UWAA 3UR8A 1UUQA 3FDKA 2CW6A 1YPXA 1I9CB 2QV4A 5A6LA 2PA6A 1FCUA 3ME3A 4IGMA 1W3JA 1AJZA 2AMXA 4LXFA 1QHPA 2CBVA 4GFSA 3N19B 1DJHA 1HP5A 4QEHA 2XIBA 5BOOA 2X40A 1Q7ZA 1NDVA 4MMWA 4CD7A 4MDPA 4P7QA 3TA6A 3N6JA 3G0SA 3Q37A 4XBJA 3NEHA 2ZZ3A 2J7CA 4J3XA 2EPHA 3EMZA 3ARRA 4LRTA 2FH8A 4G5DA 2NVCA 3QBUA 3N2TA 1FXQA 1ICPA 3FGCB 2NQHA 2VC6A 4WX2A 5KZMA 4HQVA 1MDLA 3H55A 2HDJA 3QTGA 3N11A 2TODA 5CPMA 1WOBA 4NNCA 2I9EA 3ABXA 3HTWA 2Y5EA 3LXCA 4UFHA 3W01A 1W37A 5ABHA 2VURA 1Q2RA 4Q8TA 2VOTA 3KUMA 4QJ1A 2PC4A 3CNYA 4BK9A 3QGAC 4QLKA 1WZKA 7TAAA 4I3GA 3WNOA 1A5MC 1B9BA 3BOFA 4XZMX 2OO6A 4L64A 1R46A 3GVVA 1JI1A 3I4KA 2OZ3A 3TN4A 3GDKA 3PAOA 3ZVHA 5LNWA 1CYGA 2C16A 5KITA 4D8LA 4DO5A 1KRMA 1EIXA 1PJ9A 1K8ZA 4NF7A 1RV8A 1K70A 3ZJ7A 1QW8A 4X2RA 4QISA 5G1YA 2DZUA 3UPWA 3IUHA 4P61A 2PDBA 3PWGA 3PTDA 4P8WA 1Q6RA 2OQYA 3LV5A 4D2JA 4O12A 4S23A 3QPEA 5A2AA 3R89A 1HUVA 5CZSA 3UR2A 2XGIA 3CUJA 1UKOA 1AD4A 4P8VA 4LGXA 3A24A 3PB2A 3GZ3A 3H26A 4J3ZA 3WLMA 4O8RA 3IGHX 2F61A 4C1LA 4H7CA 2UZ9A 4ML4A 3PN8A 4KCUA 3MANA 1EXPA 4W8BA 4GHRA 5H6HA 1MI3A 4J27A 3DAQA 4AEOA 2ZDSA 3PG9A 1J18A 4L80A 5F1UA 1JXKA 5KEZA 2AOSA 4H9UA 3WDHA 4V28A 4GUIA 3AHVA 2G96A 4MZ1A 1BKSA 5JU6A 1C3FA 1E15A 2XN2A 3NTYA 4DUVA 5DY2A 1XLMA 3CWOX 1PKLA 2D20A 3ITXA 1F4HA 2J7DA 3BQ5A 3P80A 1OX6A 1S2TA 1X6UA 1HNYA 1XL9A 1IT8A 1IV8A 3AXMA 3VM7A 1HKJA 3A12A 1RY8A 2PDCA 3LQGA 4J3WA 5AYBA 1B3XA 1Y5XA 1XIHA 4RZ4A 1OD0A 5A6SA 3CGTA 1DTUA 4LF2A 1TJ0A 5D30A 4TVDA 1VFMA 3I3BA 4R33A 2PP3A 3BW3A 1BAGA 2C13A 2ZRWA 4WSJA 3GH5A 3HG5A 2PC8A 1Q2SA 1TUFA 2JKPA 2ZX9A 3NEVA 3GW3A 1ONWA 4ZOCA 2A7NA 3BV4A 1BG9A 2R14A 4IJBA 2NV9A 2G95A 2E68A 3KVJA 1RPXA 2BGNE 2I14A 1XINA 4JDYA 4NYYA 4PN2A 5HINA 3WQPA 1UD6A 2BFGA 1ONXA 3PC0A 5HMDA 2BVTA 2YBVA 5G1MA 2WHMA 3T8QA 3ZJKA 3H7UA 2WNZA 2XFRA 4W93A 3WF4A 5CGQA 2BHYA 2IUZA 2IKGA 3M0JA 2BASA 1R3WA 4CVUA 1YDVA 3FDGA 2CLEA 1Q45A 1TV2A 1YXDA 1EP1A 2XGBA 2YXGA 1SJCA 4HIBA 3DKLA 2QIWA 3G1RA 2BG5A 3UA3A 2PGFA 2I7GA 1JRCA 3APTA 2OKTA 3AISA 4LF1A 3E0FA 3UG8A 3QR0A 4FNTA 4IIEA 3HQ1A 3L12A 5FJRA 3AO0A 3NQ6A 3BH4A 2WZTA 2PE4A 3S8HA 3RCNA 4GI6A 2OWXA 3FYPA 3W1XA 2G5WA 4XUGA 3V0UA 3H2FA 4G2DA 3KBSA 3SSJA 1GQJA 3WDIA 3MVIA 4C1KA 3R8RA 3U9IA 3EEGA 1KV5A 3AROA 1IT7A 1TV5A 1QK2A 3VILA 2F9RA 3LY0A 4MKNA 3LLXA 2QCDB 1GVOA 2Q71A 4I8DA 4LCSA 1JUEA 1WZMA 3BLFA 3IJ6A 1MMFA 1E4NA 4REQA 2H90A 3LV6A 3H54A 1MQPA 4IUOA 4Q8WA 4UCGA 1W3HA 4AVNA 3WDRA 1RUSA 1I45A 3M46A 4RDWA 1UZDA 2VRQA 1CLVA 3B0VC 3UXIA 1BHGA 2HTMA 1FWHC 3SB0A 4HOWA 2W92A 1VCFA 5CCZA 1YDYA 3SRKA 1X7IA 1W9PA 2ZRVA 1CXIA 4GY0A 5FA5A 3C61A 2W6RA 2VENA 3U48A 4RDVA 4C91A 5C9RA 1J12A 3WQ6A 3A23A 1JYNA 1VBHA 1ADSA 3WG6A 3SGGA 1R6WA 2CIPA 2UY3A 1HXJA 4E0CA 1S3HA 3V0SA 2G3NA 1NF7A 1WBHA 3VNJA 2FHFA 1XQLA 3W22A 1UKPA 1FHLA 2DH2A 1QPKA 1BEUA 4YTUA 2ALDA 1UH3A 4NJKA 5EBUA 1E3XA 1ISXA 4ZQPA 1LBLA 4DJEC 2QV5A 2PP1A 5ECUA 3VZZA 3QLLA 2G0WA 1KM6A 3TP4A 2ZZ1A 1OX5A 4DEFA 1US3A 2QCEA 1KR1A 3VC6A 1B3ZA 1X7FA 4H8NA 3S2NA 1DBTA 1A5BA 1F74A 4CN6A 3NJ3A 2YDRA 3H53A 4P5UA 3GYCA 2VDHA 3EWYA 1UR4A 3G0UA 2ZUVA 3IGXA 3P61A 3OG2A 3U7BA 4HMDA 1KFBA 4RK8A 4OGZA 1B3OA 2VRKA 2E9MA 3QMSA 1A49A 2EO7A 4EKJA 1V08A 2TMDA 3W7MA 2DFAA 1H63A 4FX6M 1K9EA 4UTWC 1ZBWA 2YFOA 1KM1A 1I75A 3OIXA 3IJDA 2OX4A 3THAA 2E9LA 2E09A 1HX0A 3LCIA 3JZUA 2FZ9A 1OGGA 4NZ3A 2VR2A 1JJKA 3AC0A 4FNRA 3CV6A 1EX5A 2WCAA 4YIWA 3FAXA 3PF3A 3AU6A 2GZXA 4TUFA 1FWNA 4YVPA 4XZIA 3LYEA 3UXLA 3MSYA 3SUTA 1EH9A 2J77A 2R1LA 3CS2A 4YHEA 4G1KA 4JCLA 2P10A 3LK6A 1QPQA 4GYKA 1ZP3A 4R3UA 1K7XA 3H12A 3GR8A 4XIAA 4D8AA 4H7ZA 1V6TA 1I2RA 5EBAA 3BVJA 1K3UA 1EOKA 1RK5A 4JHOA 1XYLA 4RW5A 4KQNA 5CGTA 4TMBA 1P1XA 4UCFA 4N9CA 1GCYA 1KKRA 2WZMA 1KM0A 2QW5A 3DHPA 4CNUA 3FOKA 3W82A 3FHQA 1V0MA 3PFMA 2VRJA 1XIDA 1RA0A 1LOLA 2XFFA 2A2IA 1VFOA 4DNHA 3RM9A 3CUHA 4DJDA 4IGHA 1PKMA 2BTMA 5C5YA 3H23A 3WNMA 3N12A 4N6FA 3E3HA 5D04C 4KRTA 2P3EA 3PJXA 4KWUA 1E6NA 3DG3A 3GVQA 2QVHA 1DEDA 1EC8A 3IVUA 4JR5A 3LDVA 1X98A 2QCMA 4FIRA 3L4ZA 2PUZA 3H6OA 5T91A 2WHLA 2WMIA 3T9PA 2V5DA 3S47A 5ABGA 3WX7A 1M7JA 2YA1A 2I17A 4ZQOA 3VUSA 4YTRA 1IZCA 4AWSA 4HPHA 1SVDA 3NURA 2XHYA 3GNPA 1ZRQA 5TAOA 2PZ0A 2BY0A 1DIOA 1V3JA 1H49A 3W76A 3GXMA 4A05A 1FH9A 2NQ5A 1DL3A 2QAPA 2XGZA 4UMBA 2ZZ6A 3VOJA 2CXGA 2V0TA 3CJPA 1S1PA 2YR1A 1FWWA 3GXPA 1K4GA 4ROPA 2IPGA 1J93A 2PURA 1NJJA 1QHOA 5U7SA 1HO4A 4DO7A 2J79A 4OVXA 5CSSA 3GTIA 1R3YA 3CK5A 3II1A 4B4HA 1V0NA 2VZTA 4L7ZA 2HE5A 5C9WA 5PTDA 2XH4A 1TTQA 1ISZA 2G3IA 3PNZA 3RO8A 4JCMA 3GZAA 5GNXA 3EBVA 8A3HA 2FYMA 1OG0A 2Z4GA 5EMUA 2PFHA 1QI5A 1F3EA 3UD6A 1WDPA 1CXFA 3TC3A 1V3MA 4B5WA 3EDDA 3W81A 3E2VA 5E0KA 3QM3A 4FX8A 1CX9A 1RCQA 3O8AA 4PUJA 4JFSA 1Q8JA 3GC2A 4RUBA 4WY0F 5F4SA 2WM1A 4O13A 4DYEA 1EPXA 3TTQA 3LMZA 2PTXA 4DQWA 5DXYA 2PWEA 3XISA 3M44A 4R7WA 2WWCA 1LWHA 2VNCA 2D69A 4XG1A 4YVXA 1SSGA 2P76A 5LGXA 1DWHM 1W5MA 3M6YA 2OFJA 4LYKA 4A8IA 4FHAA 4Q33A 3ZFHA 1KFWA 1BVWA 1JDEA 4O1BA 3ICJA 4UZUA 2C8NA 2E4TA 4N42A 4KWWA 4AG0A 2OEKA 2CHOA 1FWAC 2BS9A 1N8IA 4QLLA 1F7BA 3EWZA 1TELA 1E1CA 1U1JA 2B7QA 4QJ3B 2PDHA 1EJUC 2ISVA 2B7OA 3HQNA 4HMCA 4OWGA 4N9EA 5AC4A 1L9WA 2O9PA 1P48A 3TIMA 1X6LA 4YVVA 1AQHA 3MV01 2XH2A 3IK4A 2J7GA 1OFOA 1ZCOA 2ZX6A 5FJPA 1XV8A 2F84A 2GK1B 3KE0A 5DANA 4W4QA 3VMOA 3SUWA 1CDGA 2GL5A 4UTTA 1LTDA 2DZSA 3VIMA 4DPPA 3QOMA 1ZBCA 2PSNA 1T40A 4PEKA 3WYZA 2QJGA 4TV6A 1ONEA 2CZVA 3KDNA 2GGGA 4LY8A 2QDHA 3EA2A 4CNSA 1UR0A 3BLOA 4GYPA 2I57A 3W28A 3QY7A 2TPSA 1EF2A 2C6QA 1EXBA 3QSRA 1F3WA 3WQOA 1A3HA 4E4PA 1UR9A 5GQBA 3P93A 3HFYA 1LOQA 3QC0A 3L68A 1BG4A 2ZZ2A 4KFNA 4N7QA 3RLVA 3QFEA 3SSZA 3DHDA 4H1ZA 1Y5VA 1RR2A 3CAWA 3DIPA 2A6NA 1C7SA 2ISFA 3OZPA 1UKQA 2VD9A 3VX0A 3NDOA 5CKSA 4DN1A 3B3DA 1RK6A 1FP9A 1TJPA 4MF4A 1AH3A 2H3DA 2WCGA 3OO2A 2A3LA 4NILA 3S4TA 4MADA 2IKIA 1K8CA 2QJHA 3W1QA 3NOEA 1Z6KA 3TU9A 1TPH1 1X96A 3ELFA 3V75A 4HK7A 1OJXA 1GJUA 3DBPA 3PM6A 4L4MA 4HB7A 3UWEA 2RH9A 3SCWA 1VP5A 2QGYA 4QDWA 3OVQA 1YTEA 4N4PA 4GGHA 4W84A 3STPA 4DUOA 3GTHA 3LM3A 1RA5A 4IP7A 2Q3OA 3N14A 3NZRA 1TTPA 4CD4A 1HKIA 2AAAA 2VFDA 3EWBX 1OFRA 3RIKA 1L6FA 3O63A 1TMLA 1YE6A 2H8XA 1LOSA 4DRSA 4V1XA 3N2XA 3TSBA 4P7NA 2DT1A 1TV7A 1VRXA 2XIJA 3A47A 4MNMA 4DAFA 1IZKA 3AXXA 1KXHA 1T6MA 4PMJA 4EANA 2X05A 1KFCA 3C56A 3E6EA 5D9OA 3ERPA 2D0HA 4KWVA 2ANUA 4MAZA 4LNYA 4R7JA 1E72M 4U5IA 2V5KA 2QT3A 3VOIA 2R82A 3QRHA 2VT0A 4Q7NA 4MUPA 1AD1A 2E6FA 4QTGA 2QDDA 3ABZA 4P7RA 1A0CA 3LLDA 5EL1A 3QPZA 4QJ4B 1POKA 3TAOA 2BMBA 4JN7A 5FJIA 1KQYA 4JXCA 1AQ0A 1S46A 2PDQA 3S46A 3K4AA 1BGGA 2OLHA 1FFQA 1TX2A 3Q4DA 1W9XA 1FH8A 4KESA 5EMMA 2PWVA 2X2GA 3TW9A 1YNYA 2VFEA 3K8MA 4LV9A 1TREA 1H41A 3NQ8A 3PPFA 2QPXA 1AH4A 3PNUA 4UOQA 3UZZA 1D7FA 1LL7A 1QR7A 3PBYA 1IR1A 2GYIA 3WZ0E 2HXTA 4HOZA 4IIHA 3C2EA 2ACQA 1E0WA 1U33A 3GXTA 4FLRA 1TPEA 3T40A 4OU1A 3HQOA 4Z17A 1YW1A 3IACA 3ARQA 5D2TA 4C6PA 3UYIA 3VD3A 4HMEA 5AHIA 4O11A 3TC6A 3KRZA 4JX4A 2JIWA 4IJRA 1NP2A 2OCZA 2R1KA 4QDPA 4I8YA 3VOFA 2Q8ZA 4GVGA 3VNKA 3QQ1A 3W73A 1AW5A 1CXHA 3DDMA 3G6MA 2GJXA 2VCAA 1I1WA 1VCGA 4XD3A 1OFPA 1OG6A 1XBXA 3WBYA 2DUZA 4GOAA 3OGVA 4IPIA 3W7DA 1J2WA 3OA5A 2Q6ZA 1FWTA 1WAWA 4Z2GA 1E6RA 2Y8VA 1E9YB 1O60A 1V6XA 1M04A 1QK0A 2Z1XA 4WEVX 5AVNA 3A13A 5E6ZA 1IWBA 4Q32A 3F4WA 4LNCA 3W38A 2WYSA 4NI3A 1TPB1 1V93A 3RLUA 2DVUA 1UD4A 2HVNA 3RMEA 3WBAA 4PMOA 3ZO9A 1BLIA 3L21A 4RDYA 4WSHA 2ACSA 3SCVA 3WUGA 3EWUA 4XTIA 3THQA 3I68A 5HNNA 1AZ1A 5I79A 4A4AA 3CWHA 3LG3A 4PMYA 1GT8A 3LGGA 4KPLA 1KM5A 3M0KA 3VNZA 3WN6A 4RDZA 3CHCA 1PYMA 4R34A 4E38A 1Z41A 1RH9A 3OZOA 4FXJA 1E9ZB 5CZ0A 1H7WA 1MNSA 3T0BA 2H8ZA 3EGJA 4K8HA 3MUIA 1HJSA 7REQA 2ASHA 2V3DA 4M8UA 3B8SA 4H6KA 2Y8UA 3P8JA 2C0AA 4PE8A 3AIQA 1KM2A 4AWUA 5A2BA 1JPMA 2QDGA 3TN5A 1J5TA 1BRLB 2EHHA 4LJ3A 2YFNA 4NJJA 1UH2A 3ONBA 3SCPA 1E71M 2FMOA 5FSEC 1XS2A 1WKEA 1TTIA 4HTBA 3ZR4A 3NPWA 3DFSA 1TWDA 3GG8A 5HULA 1QNVA 1X38A 1IIGA 3R11A 2GPTA 4JIRA 1BXBA 3CPGA 3DFPA 4M7SA 5HATA 1QI2A 1AFSA 3GBEA 2PTZA 5I5RA 1W3IA 2RDUA 3UJRA 3LB0A 5A6TC 4I7VA 3LA4A 2WMGA 1JZ5A 3PZVA 4BQ2A 4DELA 1GZGA 5I2UA 1GK8A 1U30A 4CNTA 2CLHA 1DIDA 1MVYA 3ARTA 2XVKA 3S9ZA 1XGZA 2PRMA 3QQWA 1XLDA 2BXZA 4L61A 1WKFA 3PK7A 2DUXA 5CBIA 4HCHA 4PTWA 3C0QA 4LBSA 2O7SA 2ZRZA 2XVPA 2HQAA 1SO5A 1F3TA 2ZCGA 4B3LA 2YW4A 1QPOA 4Q3MA 3FFSA 3UXKA 2DV0A 3M41A 3QZ6A 1ESWA 1OFBA 1U22A 4U10A 3GH7A 2FTYA 1HQTA 5XINA 2NLYA 1WDWA 3HG2A 3BAXA 3AHTA 1DVJA 4JFWA 1QRQA 4BR1A 1A5AA 3KHDA 4UTFA 2DDXA 2F2KA 1WPCA 2IXVA 3VCNA 3FLUA 4GZJA 1WKDA 2X0SA 1Z7AA 1L0PA 4QG9A 1OM0A 4KFOA 4Q22A 2FZBA 3EOEA 3ZQ9A 1RALA 4ADSA 5AHLA 3A3WA 2QNEA 3NG3A 3T2OA 4CNPA 1IIHA 2ACUA 1UD3A 4GNKB 1MW2A 3AMLA 5FEZA 2XPKA 1G4TA 3CUFA 1FCVA 4NUWA 1E6SM 1VZWA 1SMAA 1O5KA 1IHIA 2AQOA 2VM8A 3BARA 1YDNA 4ZENA 3K4WA 4FOKA 1MUMA 2NX1A 3PSVA 4WY0A 5A8PA 2Q01A 1TV8A 2CESA 2DZXA 3UF9A 4DYKA 3S2JA 3NFUA 3IJLA 3W1RA 1JEZA 1UR2A 1IF2A 3OPSA 3R5EA 4JY8A 2PCEA 3VGBA 1QOXA 3NQGA 3LUTA 1GW9A 4AHQA 5A8QA 2DUAA 4M51A 4UTLA 4FO4A 4YN5A 5ABFB 3F1QA 2PCQA 4JTUA 1OK6A 2H9AB 2Y63A 1LJYA 1ME7A 2VX6A 2J9XA 5CG7A 4IQDA 1OT2A 2A6LA 1V0LA 3JS3A 3RNDA 1A5KC 2GQ9A 4PBGA 2C71A 3RJXA 1R38A 3MKKA 3EPNA 7A3HA 2WBKA 3DI1A 1R7AA 4XV0A 5CLTA 4PBEA 1AODA 2F8QA 2JQXA 4H3DA 3H2NA 2GGHA 3RU8X 1E6ZA 3QSTA 4OIFA 2ZUUA 4DZIA 1JPHA 1S3TC 3CZJA 3BV7A 3VK5A 4ONVA 1UWUA 4HNCA 1QNQA 4A35A 4Z0JA 3W1AA 4QP0A 3RFAA 1LRNA 2ZC1A 1KA9F 3GHSA 3W2KA 3VX1A 3ZSSA 2QUUA 1SR0A 2PDLA 3QV9A 3E38A 1IXNA 1OF8A 1SO3A 1KTBA 3AIWA 4UOZA 4P8XA 4EX4A 4NYUA 2UV8G 4C6BA 1VBUA 3CL8A 3HIJA 3PBGA 2I56A 1TFVA 3J7HA 5SWUA 4F2TA 1W8GA 5G1TA 3KBJA 2E5DA 2P3ZA 1EGZA 3FEQA 5LIYX 1R2TA 2XIOA 2CLOA 4Z1BA 4WJXA 4N9DA 3OBKA 3P74A 3W71A 1VAHA 3BTNA 3VGHA 3BCDA 2Z26A 4X9SA 3VVGA 3CIVA 5D05A 1Q6FA 3GXFA 1CGWA 4DAIA 2WZIA 3GE7A 3NOYA 3AI0A 3WF2A 1D3CA 1QI0A 3PJWA 3GC4A 4H9VA 1M65A 1P6CA 4NJIA 4UTJA 2QCDA 4QAIA 5T26A 3S1GA 1W1YA 1CCWB 3TR2A 3FY1A 4JYDA 4L6DA 4AZ7A 2CHRA 3IJ9A 4GUGA 1D3GA 5GNZA 4Q7IA 3CAQA 1CW2A 1XSKA 3EWDA 3U5YA 4O17A 2GOUA 1Q3NA 3UETA 2FPYA 3W7IA 3WFAA 2EXOA 4O1DA 3UZYA 3ZR6A 3IRDA 9XIAA 1SYTA 3LNMA 3CZEA 4PODA 1G67A 2Z24A 4TTUA 1E0VA 5I3KA 4Q8UA 5CSRA 3S1UA 2OYLA 1ZB5A 1TCDA 3UNTA 4M6VA 4LVFA 3NL5A 1KBJA 5D2WA 3GUGA 2DVTA 2HS6A 3REQA 3CASA 2WPGA 3S5ZA 2WJZA 3I6RA 2ATSA 3FVMA 3QJAA 2BVWA 3EX1A 1C91A 5C8BB 3TCSA 3WF0A 1QW7A 2BBFA 4O18A 3WQ5A 4YMZA 2BNJA 2Y7DA 1FWSA 3KAOA 4RXFA 2O9OA 1PUDA 2PTWA 4GD0A 1O5RA 2CBUA 2IPJA 1TX0A 3S5NA 5HWMA 2BSLA 1FX6A 1WQ5A 5M17A 1S5TA 1LM1A 1X8FA 1QBBA 3HFTA 5FACA 5CC5A 4X0VA 1F2JA 1XDJA 4IJCA 3OGRA 1OC7A 2AAMA 3E02A 4YTQA 2V9DA 4DX3A 3KP1A 7XIMA 2OSXA 2PDJA 1TR9A 2PWHA 3OGSA 5AKQA 4IG2B 2PLJA 2VWTA 3L4WA 3ARZA 1Z9AA 1Z48A 3E2SA 4O0QA 2CWXA 5HNTA 5CXPA 4DZAA 1F07A 3LCWA 2VC5A 4F2BA 4UTHA 4IMFA 1EZ2A 4NJGA 5JIPA 3PPCA 1H5YA 4DBSA 4JEJA 3BJTA 3NVTA 1ITXA 1GOKA 2VWSA 1H3GA 5LYRA 4XZLX 3NUKA 2FHBA 2ZOXA 3A5FA 1FP8A 3B4YA 2YL6A 4W7WA 1LBFA 4O15A 4H8UA 1OB0A 4IQLA 4K7VA 1OINA 4AZBA 1PTGA 2DQWA 1GOXA 4MZ8A 2XIQA 3QV7A 1TUXA 2QUTA 4IFKB 3FIGA 2BOGX 4FZIA 5MHBA 4Q8OA 1POJA 2NSOA 2REQA 5HJLA 1QNPA 1J6OA 4KRZA 3W2MA 2D3LA 3PTQA 4LC8A 4YXGA 4IFKA 1HKWA 3WDPP 1HL2A 1ZTVA 1JNEA 3DC8A 4OOUA 1LROA 4QAWA 1F76A 2GJLA 3W23A 3TNOA 1EEPA 2GQAA 3EB3A 6A3HA 1FTXA 4JFUA 2PGRA 4F2UA 3W1UA 4JTKA 3BGGA 3W0KA 2OODA 4BI6A 1B0IA 3E96A 3F2CA 2RJHA 3B8WA 1AL8A 2F6XA 1U5VA 2E6DA 4H2CA 3PWIA 5KZ6A 3W7NA 2Q02A 1O4UA 1TR1A 3SQSA 2V2CA 5I0DA 2HNHA 4DWSC 3BGJA 1OGBA 2E25A 2QYGA 3ITTA 4W88A 3S1XA 1RAKA 3C86A 3F4CA 3UW6A 1V79A 1PV8A 3TV8A 7ODCA 1JUKA 1DJZA 2G4FA 4FLOA 1DWJM 3CZLA 3LERA 1NVMA 4IXXA 4JNYA 1S2VA 4WDWA 1ZJIA 1DWIM 3NL6A 3MV11 2WLYA 3S2LA 4L1GA 3W85A 3WDJA 2E8YA 4GX9A 3GTXA 4D1IA 4KCWA 3N25A 4FNPA 1J4EA 2ZE0A 1MQRA 5E9AA 1IXOA 3H2CA 4IF2A 3SRHA 3T7VA 1GKQA 3KOWA 4XBSA 4KW2A 1AL7A 3QTPA 1MXSA 5T9CE 1GONA 1W54A 4FXRA 3WMSA 1NQKA 1MRQA 2VR4A 4JTSA 4GIRA 3QZAA 1OYAA 1QWKA 2ABBA 1Q5MA 5DQPA 3O05A 1QPNA 4PMDA 3A21A 2OLAA 2OX1A 4W5UA 5DX7A 1HVQA 2A3HA 1MDRA 1VGAA 4PUUA 3AALA 4G6CA 1EBHA 5C9ZA 2GDVA 1ISVA 2X0YA 2WHJA 1TZ9A 4O1AA 3MCMA 1DJGA 3MDWA 1XICA 3DHFA 2HMCA 4AUBA 2OT1A 4HJWA 2WQDA 3FHAA 1TVPA 4UNKA 4GZ7A 4WR3A 1GOOA 2VCBA 4ZODA 4AIUA 3FXGA 4H6EA 3W7RA 3YPIA 4EF8A 4M7TA 4UQAA 2NUYA 2Y7GA 2B4GA 3NVDA 2Y8KA 3DBNA 2PDKA 4OJYA 4Z08A 3M0VA 1PL9A 3LGEA 4GCXA 2HCVA 4H83A 5F1VA 1GVRA 2MUCA 2GFTA 3LLFA 3NYZA 3SFKA 1JCYA 2YIHA 1G7VA 3ATYA 3T0CA 3UJSA 2G37A 3O16A 2POZA 3B9NA 4EK7A 1US2A 4UNIA 4QS6A 1F6KA 3M0YA 4ECLA 4I6KA 1SMDA 4MG4A 5DCDA 3VIGA 4PUMA 1FWGC 1YPIA 4J3UA 4IMAA 3DGRA 3L0KA 3PJUA 1R0MA 3EKLA 3ECQA 4U2ZA 3T09A 3S3GA 2E7FA 1ALDA 2F6UA 5FIPA 3S0CA 5XIMA 4V27A 1CGUA 3D46A 5M5DA 4C6JA 3GC5A 4WD0A 2HWGA 4FALA 4BEQA 1BYCA 2IPWA 2Z7KA 3NGJA 5LHEA 3KLKA 1EQCA 1C93A 2V38A 2XWEA 3U2CA 4ZA0A 4I5UA 3WLQA 2C79A 4CNOA 1VS1A 1QNOA 1W5NA 1I2NA 2W67A 1I8JA 4JTQA 4D71A 2R24A 4GMEA 4HN8A 4E2VA 3WLPA 4HZ6A 1HGWA 1OY0A 1KM4A 2PAJA 4JTAA 3L4TA 1RCXB 3GSMA 2F7FA 1TZ7A 2QCHA 3UG5A 3WFLA 3AZSA 4CEXC 3RGTA 2DW6A 3HV9A 4D6FA 3CL7A 1J0YA 4ERAA 5D03A 2E5CA 1PX8A 5AHMA 3ZLGA 3RRAA 4GJ1A 3RPMA 3E5PA 3BMWA 3OHIA 3KBWA 1W1PA 3B03A 3THCA 4LTSA 1QBAA 1SZFA 3PULA 3GNNA 2J6VA 2WNNA 3NPUA 4JTIA 4O1FA 3AS2A 2PGWA 3A9BA 3OLIA 1DIEA 1B1YA 3DFHA 4M0XA 3R12A 1H7PA 1YBQA 3G1AA 4JL2A 5A6AA 3T4CA 1W6TA 3R10A 1TWWA 2O9RA 4M5PA 3VGDA 5I3DA 2X42A 4KCTA 4ZOAA 3I7QA 3U0HA 2W4XA 3POHA 4D6IA 4F0HA 3M7SA 2WVTA 3TVAA 3D47A 3KW3A 3MSRA 2GQ8A 3ZLHA 3GNOA 2B7NA 3U5UA 5A3HA 3N2MA 1LYXA 4J9JA 1HL9A 4MJ2A 1V8EA 1CGXA 5LIUX 3CV2A 3TTOA 3H4WA 5DXXA 1QNSA 3UJEA 4DHGA 1M68A 4IH3A 4DM2A 4HNLA 3TFXA 1TSIA 3CMJA 4O1CA 4UFIA 1H7NA 2OOFA 4KGJA 3R6IA 1E0UA 4UTIA 4F40A 1MXGA 1XG3A 4JGDA 4KEZA 3TYUA 1XSIA 3PBUA 1W3NA 2XVGA 3WJWA 4IL2A 4N4QA 3DU0A 5BRBA 4PMVA 1OFAA 2XSXA 4ZO8A 2EG7A 4E2OA 4JKKA 1US0A 4D72A 2I5GA 4LAKA 4MYAA 4UTKA 4NJHA 7REQB 3GVWA 2CLMA 3SN0A 3G8RA 2ZX8A 1Q7MA 3IAQA 3MHFA 3UGVA 1MYRA 4MB4A 3CMFA 3SUUA 4KCVA 3HGOA 3CB3A 3GFXA 2C1GA 3BDKA 1TCMA 2FVMA 1DE5A 5GPRA 1R9ZA 4J5NA 3QF0A 1IEQA 4BKNA 2D73A 4HOXA 1WB0A 4UBPC 3DOPA 4V33A 3K1DA 3MJMA 3AXKA 1XYBA 3SZ8A 5C9XA 1QNRA 4GUHA 1DJNA 1H1YA 2BWGA 2V2DA 3WO8A 4XAFA 1JNDA 1JZ7A 4LUTB 1FKXA 3SY1A 2CBJA 1GG1A 4NP7A 4G1NA 3BAWA 4LV4A 1OC6A 1JZ2A 1KTNA 4GGBA 6REQA 1E4IA 3URAA 3TROA 3VOCA 1UC4A 4R9OA 2CKSA 1ZL1A 1NWUA 1H7RA 3RO6A 1RBLA 3W7QA 4GWEA 1M6JA 4K36A 1JFXA 4ZE5A 1XKYA 1LORA 3MC5A 1Z8AA 3KDOA 1WDSA 4AY1A 2QAFA 1UWRA 2P0OA 1SUXA 3C52A 1F3XA 2VX5A 3HO8A 2OSWA 3WLHA 2E6YA 2FGZA 1EA9C 4MJ4A 4K7YA 1TIWA 4HSHA 4X63A 2PDMA 2PDWA 4HCDA 2VFHA 1FA2A 5A69A 4AZGA 5H2ZA 2WMKA 3WBWA 2H6RA 4DWSA 4UOJA 3BLEA 2CHNA 1G4EA 1JI2A 2Y85A 4DJDD 4HHLA 3CC1A 3WELA 2D0GA 4NL1A 2FTWA 4RE3A 1XRFA 1FXPA 1LL4A 2ZUNA 3BLLA 4ZOEA 1V6VA 4WOZA 3MW7A 1E5NA 3NCOA 1MQQA 1PZ1A 3N2BA 1CTNA 4IP4A 1M41A 1EEXA 5BNKA 4GC3A 3LBMA 5LSMA 3GY1A 3A9IA 1VPQA 1VFTA 3HBLA 1EIBA 2UY2A 2R1NA 4DWSB 4Q8VA 3NO1A 2NQJA 4PUKA 3QKZA 1E1EA 4GQGA 4J7RA 1JR1A 3SN1A 4TXEA 2E1WA 3AMGA 3S2CA 1FUYA 5LIXX 3W27A 3H8AA 4C6KA 4ATDA 2XH7A 3RYSA 4NAEB 4K39A 5BXRA 2CKRA 3Q45A 3GR7A 3M5VA 3R0KA 1C7TA 4HYVA 4OT7A 2QF7A 2QEZA 1PIFA 3HJEA 2Y89A 4WSKA 1GVIA 2IPFA 2VEGA 4HZ8A 3W7EA 2D2OA 1QHZA 4HP5A 3SQMA 2I5QA 2XFYA 4LAOA 1QOPA 4RL3A 2V3EA 1XF0A 4ZB2A 4IIBA 3USBA 3CZKA 3URQA 4FA3A 4G9PA 3PHAA 3BANA 1JF6A 3WMBA 3UERA 2C3ZA 4NAEA 2PRHA 2WZEA 1KFEA 3VE7A 1TB3A 1XRVA 2VOMA 3B8UA 2V82A 2Y24A 3P7YA 3UZ5A 2BDQA 3KL3A 4J2MA 1SFLA 1XRTA 1IEVA 3LTYA 3OP2A 3MQTA 4JTDA 2A7RA 4MJMA 2HVOA 4ZOBA 3VKAA 4EAMA 3MWCA 5I3JA 1NFPA 2DJLA 4AY7A 2HROA 3QMTA 3URBA 1S5NA 2A5HA 1FDJA 4Z1CA 4PMZA 4U4MA 2VJXA 2NXIA 2F6KA 4GQBA 1NARA 1L6SA 1XD0A 5IBXA 2ZC8A 1TZZA 2DW7A 3LI1A 1BVZA 1TE6A 1X8CA 2CZDA 5I07A 2OT0A 3FX4A 2ALRA 3MKCA 4S39A 3OZMA 4RNIA 3BUVA 4DI8A 5JQ9A 1FQ0A 1JCTA 1K77A 3AIUA 4CU8A 4NX5A 1ZBVA 3SEPA 1A4LA 5DMLA 1BSLA 4DXKA 1Y65A 1DOSA 2DSWA 3LRMA 4CGTA 3UGRA 4FLQA 2PLCA 4L65A 3OHMB 2INEA 1UWTA 3C2OA 2E5BA 4AWTA 2WXDM 1E70M 2RHGA 3O9NA 3STCA 1LL6A 2O4QA 1R86A 1UOZA 2VFFA 3PZGA 5DRCA 3EOLA 3L5MA 4QFUA 3QR1A 4FI4A 2G3JA 3M7WA 5D8WA 1UKTA 3RJYA 3HPZA 1C90A 4L6HA 2TSYA 3HGRA 5A2CA 1JQVA 3AMDA 4PSRA 5G2HA 1NF0A 3SAZA 1E1CB 4V2XA 1UQZA 1EJVC 2WMHA 1D8WA 3TQ0A 1G01A 5RUBA 3RCMA 1T41A 2CZ5A 1MNZA 3VIOA 5ABEA 4QITA 2IQTA 1E56A 1UP0A 4AXNA 1XYMA 2ZVIA 3ARVA 3NQVA 5MKGA 1ENUA 4ADTA 1QVBA 4XKMA 3T07A 4A6GA 2YXXA 4C7FA 2VZUA 4MFEA 3MI6A 5C2XA 1SFSA 3LS9A 2VZVA 3GHUA 1A5CA 1J6PA 3AS1A 1E51A 4CQ8A 1CLKA 4Z42C 2TRSA 4O57A 3GIQA 1R3QA 1ZP4A 1Q6GA 2VVNA 1TPDA 4WJEA 3ZVIA 2WJDA 5L6UA 2GOKA 3W70A 2X1IA 3NM1A 3TSMA 2HISA 3LSBA 4HNVA 3CHVA 8XIMA 1VIWA 3W29A 3K8KA 4OFCA 4AIBA 2W61A 4H04A 4TIMA 4ZTYA 3TCEA 3TW7A 5A8MA 4NG3A 3MJYA 5FAJA 5DEZA 3MP4A 1XUUA 1P0DA 3V1PA 4GABA 3O7UA 1DYSA 1GEQA 1XYAA 4LALA 4FMVA 3G1SA 1F9CA 1QWGA 5C2GA 3TC7A 1E4LA 1J0HA 2BOFX 3IIVA 4QSFA 3OG3A 2FTPA 4DXXA 5CC6A 1FCQA 4PTMA 4C6QA 3OLEA 2C14A 4S3EA 4C6FA 1JXJA 4IGNA 1V02A 3BW2A 1RBOB 1VD6A 1KBBA 3KHJA 1SW3A 2E0PA 3U4FA 3KXQA 3W7LA 3AQUA 1MXDA 1B4KA 3ID7A 1IYXA 2J66A 2WLZA 4BHYA 2FFCA 5D37A 1J0IA 3FJ4A 3K13A 1UB3A 4L4OA 1S2UA 5D2VA 2BY3A 4JPGA 2WNWA 4KIRA 3SO7A 4DLMA 3CM4A 3LTPA 4RNJA 2YYUA 2YCKX 4QCEA 2CC0A 3LCXA 1SW0A 2VCCA 3AHXA 3AYVA 4S3DA 3QW3A 4HU8A 3CXOA 4MVAA 4JN6A 3HURA 3CHFA 3CH9A 4JNZA 1RD6A 1KKOA 2FGLA 4ZBCA 1ZENA 4NX0A 1F6PA 1XXXA 2WSQA 1W2PA 2BVDA 3PZTA 4JIHA 4LYQA 3R4IA 1VCVA 2FB3A 1VBJA 4Y8FA 1I2OA 1S5MA 2XSBA 4LVAA 4CQDA 5XIAA 5BCAA 4X61A 4JNMA 1S2AA 5AHEA 1F5ZA 3ALGA 1QUMA 3MI3A 3GDRA 4MWAD 1BVNP 3SJ3A 3KP0A 3LRLA 3Q65A 3E0LA 1NWSA 3P5ZA 2ADAA 2Z6IA 3VNDA 4B4FA 5JBFA 4HPJA 1TYGA 4GIEA 4AVFA 5FEWA 3M43A 2WSYA 2WKJA 3WCZA 2HXUA 4ZQNA 3EB2A 3VMNA 5ENLA 4OHQA 5DT5A 3WH6A 3T0TA 4JN8A 4H9MA 3BQ6A 4S3BA 3M0LA 3ITVA 4MUZA 5FAGA 3KX6A 4BZYA 1KC7A 2A85A 2KZHA 3W7CA 2CERA 1EHNA 5CPOA 5F7UA 1Q7QA 4IP5A 1V51A 1I60A 1TWZA 1CLXA 1SPQA 6XIAA 1RJPA 1K9FA 1KD0A 1Q8AA 3PZ9A 2R9RA 4BF7A 3MP5A 8CGTA 1H4PA 3I7RA 1TRDA 5BXTA 1M5WA 1Y8BA 3ZT5A 1PS9A 2O92A 1KRAC 2PF0A 1TJ1A 3IJQA 1X1NA 1JGIA 3UPBA 1HG3A 3WQWA 2DIEA 3M64A 3QH2A 1CT5A 2E67A 2CYGA 1BTMA 3PAJA 2A3AA 1PHQA 1B3YA 4CD6A 3U6WA 3GH4A 4ORMA 3VM5A 3NNTA 3CQJA 4JFVA 4GVHA 1SO4A 5GJPA 1G6CA 3VOGA 1N8WA 3TQPA 2ZUMA 3HMCA 2CPUA 2WAGA 4NNBA 3WQ8A 1X97A 3LGDA 3SCQA 1R5YA 3FYYA 4BI7A 3ZSTA 4M80A 4RCXA 4OBTA 2VGGA 4WDUA 4MKSA 3ANVA 1KRCC 3OQ8A 3DGBA 4URIA 4MNLA 4M6PA 4I5RA 4QNWA 5E0FA 2GJRA 1SZGA 4CQBA 1Q6CA 3UVIA 4RJEA 3QHOA 1TPUA 2CWNA 3NQFA 3K46A 2XN0A 2ZA3A 4IMGA 3RM4A 1B54A 1QU4A 3GKFA 4QQ3A 2QPSA 1WDQA 3WEZA 2SFPA 4C1NA 3LCFA 4ASTA 3LPOA 4ZCWA 2ZWZA 1A3WA 1UPMB 1IXPA 2FMNA 4NSBA 2E40A 2G3MA 2QUNA 5C9UA 1MW0A 3DG6A 2HNEA 4X9YA 1FDYA 5D32A 3UESA 1KGWA 4S3KA 2RDXA 1NIUA 4HPGA 4IL0A 5DFAA 1W31A 3SRDA 3COTA 1KWKA 3E0VA 2YJQA 3WK1A 2HBVA 1M03A 1WZLA 4RV3A 1CXKA 1RBAA 1R3TA 1H7OA 1OYBA 4R7OA 4UMCA 4FF5A 3B4UA 4JIQA 4MGGA 3HMJG 2D2HA 4GRSA 4XB3A 5FF7A 3P84A 3C6CA 4CUCA 2VL4A 3BXWA 3LSCA 4FNSA 4REQB 2E8ZA 4XTDA 1J2BA 4RX0A 1V03A 3L2IA 4GQ0A 1GG0A 2FFIA 2QJIA 4D6DA 2NV1A 4IMCA 4IIFA 2Z29A 3UEQA 4HYRA 3G3MA 3ENLA 3VNYA 4DBEA 3GFZA 5IBXC 4X3ZA 3P3BA 3KCLA 1A4MA 1PPIA 2V5BA 1J96A 1JRBA 5GJNA 3VZYA 4XQ6A 3VD4A 3SCOA 1E3ZA 2JEQA 3UZXA 3OBAA 5EGRA 4XWUA 2EJAA 2VEKA 1XYCA 5EA9A 2AKMA 5HUPA 4L9ZA 1PXGA 3AUJA 2EBNA 2IKHA 5MF5A 1ITUA 3QY8A 1QI4A 3MMDA 4CVWA 3SW6A 2O56A 3UZWA 4GIAA 3WLJA 4WXYA 3WH7A 4S3JA 3CYVA 1EJTC 3UY7A 2FPVA 1Z32X 3OLGA 5FOOA 5A8GA 4GNJA 4R9XA 1C8QA 3GRIA 4JS3A 2X1SA 3NZQA 4GINA 3ZYZA 3RG6A 5JUVA 1ZPTA 1DJQA 2CXEA 4US6A 1CXEA 4DF2A 4PR4A 3P62A 4IPJA 3EXTA 2WWDA 1QCWA 3GD6A 3FA5A 1CGYA 3T0DA 1I2PA 1W1B1 3TYBA 5CJNA 3CPUA 2Y2WA 4PYSA 3CWNA 2PS2A 2VX4A 2BGSA 3CZGA 4TX6A 5M1TA 1Q6QA 2ZQ0A 1YRRA 4MPKA 3GX9A 1M53A 3P0WA 3S9IA 4Y2WA 3UA4A 1WYIA 1XCWA 1LQAA 2BODX 2WBGA 3FW6A 6REQB 1TA3B 3CIXA 4KWSA 4PUEA 1E6XM 4BJHA 3H70A 4U33A 3TOYA 3MMWA 1OABA 4IQEA 4LH8A 1T0OA 4ZQMA 1UUMA 3CH0A 2TAAA 1O5XA 1H51A 2PD9A 1VIZA 3POCA 1O1HA 3PUOA 3OU8A 1JD7A 1ZAJA 4OKDA 6ALDA 3PSWA 2ZIDA 4EWND 1W1TA 4NZCA 5FJUA 3B0XA 1XLAA 2DIKA 2VR5A 4PL1A 4JOMA 3CAKA 4RR4A 4H9XA 4S38A 4NRSA 3KOYA 4HNNA 3G0XA 4DJFA 1IWPA 3TWBA 1JDAA 3MZNA 1J11A 2ZTJA 4E3TA 4MHBA 1FCBA 2B31A 3TYEA 4PTNA 2Z6JA 1DE6A 4DVOA 3LZ3A 5K9CA 2A1YA 5T8GA 4UR8A 3C0LA 3ABOA 3LHYA 3MMTA 4ZO6A 1ZY9A 2OTDA 1GPWA 2Y7EA 1KGUA 1LUCB 1FH7A 4IMDA 4P2VA 4J40A 1XLLA 4IGSA 2R1PA 3VE9A 4YYCA 5IM51 3KTCA 2JBMA 3URNA 1LF1A 3SCNA 4M3PA 4Q7BA 3AIRA 4Q4SA 3BCFA 5EY5A 1I0BA 3FA3A 2HVMA 4AX7A 1RCOB 2BV9A 4EXAA 5B80A 5LNSA 4HK6A 4Q4RA 4QXIA 5KSWA 3M0ZA 3O3RA 5D9NA 4Q6XA 3WY1A 4N0RA 1B4EA 1KLYA 1FHVA 1OWQA 2C7FA 2JEPA 4EVZA 5DT7A 1P0BA 1O12A 3AZRA 2VDIA 3L0GA 3H4GA 4JD4A 1V6UA 1KWGA 1PBGA 1E43A 4YCPA 4W8LA 4E3VA 1REQA 3PPHA 2A3CA 3SADA 4YS1A 1ZUAX 1EUNA 1HGYA 3CPRA 3OBEA 4CQ9A 4RNHA 3S83A 1U1UA 1NOUA 4OTKA 1XSJA 3R8GA 3B06A 3EX6A 2O4MA 1H60A 2V5LA 1BPLB 3VIHA 3TFCA 2Q09A 3NPVA 1A47A 2R1MA 3W6YA 1VJSA 1JL8A 2DQXA 2ZA2A 1L8NA 1ICQA 4D6GA 1EZWA 4AD1A 4B5NA 1T8XA 1N7KA 4RZBA 2FB2A 2QDEA 1SZRA 3W7PA 1YMYA 4H9ZA 4LB3A 1TE1A 1L2QA 4HCLA 5TNVA 3DX5A 4DBWA 5M3WA 1WUFA 2D2GA 3ARYA 3O07A 3EZ4A 2DT0A 3BLKA 4XD4A 1NDZA 3A22A 2C18A 3WJYA 4UR7A 2Y1HA 4JHMA 1R47A 4J2PA 3UCCA 4X2PA 1WP6A 2YYTA 3MB9A 4EF9A 4ZEPA 5HWNA 2Y4SA 3IVSA 3QOKA 1YADA 3QPYA 4EE9A 1VLIA 3QGKC 2GGJA 1VQTA 2CNCA 3GTNA 4MPQA 4MKVA 4YCOA 1TWSA 4HK5A 3GUWA 4AEEA 3QQ0A 4QX4A 1YKWA 3EDFA 3LTSA 5LHFA 1A0EA 2D0FA 5D2YA 1KRBC 1PWMA 2P8BA 1REQB 1JULA 1XUZA 2RKXA 4MAVA 2D23A 4XO7A 1KCKA 3RLHA 4WHBA 3WK3A 3VKDA 1GORA 3KL5A 1DQXA 3TMQA 4ZVJA 3UVAA 1CIUA 4Z2HA 3GM8A 3I6EA 4GG9A 5HA7A 4DY1A 4LB4A 2V6AA 3EA3A 1HJUA 5JH2A 4AC7C 3HG4A 3SRFA 4KBXA 3UP8A 1H61A 3H22A 1NFBA 3DYPA 4YU1A 2XWDA 5BRPA 2WJFA 5CPSA 2OG9A 4H8VA 3UWQA 3LM7A 4NIRA 2PLKA 3B9OA 4AAJA 4GY7A 3F4NA 2EKCA 2O55A 4HJFA 3WLSA 1QTWA 3VFCA 3ITOA 1KQZA 2F2HA 3SGUA 4JQ1A 2VELA 4HYWA 3HOJA 4ICMA 4AZIA 4L1WA 2OB3A 2POTA 1XLIA 3BICA 1K8XA 3KFTA 1P6WA 2W63A 1QPRA 3TJXA 4PMQA 3FSTA 4ERIA 2WSKA 3A3XA 4D8ZA 4QG6A 2YL8A 3GR4A 1WUEA 3BG5A 5FESA 1NH6A 3ONCA 2RUSA 3B9AA 2J7HA 5D38A 1R87A 5U4NA 1VJZA 1R3RA 4ORIA 2WVUA 4LX4A 1G0CA 2QMKA 1R30A 4WY0B 3FKKA 3MP3A 5KINA 3GWQA 4GZIA 1MZRA 4EXBA 1SGJA 1YQ2A 4I5XA 2RDTA 5HUOA 4F79A 1TPC1 4ZL1A 1HZYA 4E2BA 1YE4A 1B3WA 3SFWA 4DZHA 2DVXA 3TW6A 5BZAA 2PBOA 5DO8A 3CT2A 9CGTA 2A79A 5JBDA 4IMEA 3P14A 1JYWA 1EO5A 4J28A 3W00A 3CT7A 2YLAA 3W07A 3SJNA 5BYWA 5CC3A 5J5RA 2Y62A 1TPVA 6PTDA 4FR6A 3NSXA 5FI8A 1THFD 1E9LA 1F61A 1JCLA 4AHPA 3A5VA 1P7TA 5BXSA 1ZFJA 2QJNA 3BC9A 2GGIA 3UT0A 4DXVA 3P2VA 1B3VA 3LHWA 1HO1A 2QIIA 2ZBTA 3CB8A 1HJWA 3N04A 1ITCA 4Y90A 4C1NB 1OX4A 2L5HA 3K5XA 2YGYA 3UWWA 4PTXA 1Q6EA 4AD3A 3OODA 2PPGA 1UWIA 4UTWA 4DBUA 1G4SA 3IV8A 1A80A 3V7PA 4HA1A 1XYFA 4OQVA 1QO5A 5CC7A 3PFRA 2FZNA 4MZYA 1N2VA 3HB9A 4H6QA 2BXYA 3RX2A 1YX1A 2BZNA 3LBCA 1HFBA 3FVDA 2VDGA 4OUEA 2EPLX 3D3FA 5G2WA 4AMCA 1ISYA 3VC5A 4AX6A 1PEZA 3MSDA 1PDZA 4QIUA 3TE9A 4GNVA 3G1VA 3H2EA 1UD8A 2INFA 1TV3A 1B90A 5A94A 3PUEA 2XSAA 4NAFB 4AY8A 1DXIA 2FPTA 4PULA 5FSDC 3W1NA 4W8AA 5HXMA 4B16A 1GOWA 3L7RA 4D1JA 4GXPA 4CCZA 4JX6A 4MNJA 4NHVA 4NZFA 2ZXBA 1RQHA 3TJIA 3UG4A 2PEVA 2YB1A 5DN1A 4BA0A 9RUBA 2J8FA 3WIJA 3B8TA 3OLDA 3GXIA 1CEOA 1LQ2A 2NWRA 1QOQA 2EPNA 4S3CA 3KRSA 3D5HA 5M2FX 3G77A 4GVIA 2YL5A 5CJ5A 4RPPA 1GYMA 2J13A 3HPSA 4G7FA 4F3HA 3W74A 3B9DA 5F4WA 5CQ1A 3M5XA 1LRTA 3G22A 3APYA 2FLIA 2ZX5A 3DXIA 1EP2A 4NNAA 4XUYA 3TYZA 1DWGM 3VKJA 3VIIA 1M9HA 1S1RA 4HPXA 3KBVA 2Y6ZA 4UTTC 5EB8A 1YHTA 5LNUA 3B97A 4NZJA 3O2LA 4N02A 2WOQA 3S5YA 1EHAA 2QZRA 2Z2AA 1K02A 2W3ZA 4J3SA 3FA4A 3Q67A 1DV7A 1A5UA 3N9KA 1UH4A 1PE1A 1XQKA 3UBPC 1GQNA 1PDYA 1ML1A 2PLMA 2PWUA 2CZEA 4IUGA 1XLCA 4AEFA 3IUDA 2VFIA 2DT2A 2HPMA 3ZJ8A 1KO0A 2DSKA