4AD1A

Structure of the gh99 endo-alpha-mannosidase from bacteroides xylanisolvens
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
349
structure length
349
Chain Sequence
NNLGTELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOSYL HYDROLASE FAMILY 71
publication title Structural and Mechanistic Insight Into N-Glycan Processing by Endo-Alpha-Mannosidase.
pubmed doi rcsb
source organism Bacteroides xylanisolvens
molecule tags Hydrolase
total genus 128
structure length 349
sequence length 349
ec nomenclature ec 3.2.1.130: Glycoprotein endo-alpha-1,2-mannosidase.
pdb deposition date 2011-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ad1A00
3CO4A 1WZLA 4LPCA 1ZBCA 3HU7A 4OBRA 1H1NA 2A3BA 3WQ8A 3IJ8A 2Y8KA 3ZIZA 1VRXA 4QLLA 3EDDA 5AYIA 4P8WA 1JXKA 2BY1A 3SIMA 1W3KA 5M17A 1B3YA 4H04A 1KGWA 3MUAA 1V08A 1QW9A 4ZFMA 2YDRA 4IPLA 1HIZA 5BXRA 3CBWA 2WMKA 5D8WA 3VX0A 5A1AA 2ZUWA 3A4AA 5HNNA 5A6MA 2XTKA 1IT0A 4DUWA 1W9VA 1MW1A 3WNPA 4PBGA 4XZBA 1QHPA 4FK9A 5CLTA 5A8NA 5KEZA 2CKSA 3BAJA 4HTYA 2D2OA 1B3VA 3WD0A 1CXIA 3PHAA 3WDJA 3VMPA 2BVYA 1XSKA 3GNRA 3WNMA 2XWEA 4MB3A 4YHGA 2XIIA 2YBTA 2NT0A 2CBUA 1VEPA 2CERA 3WMCA 2UY3A 1R87A 1GOKA 1TZ7A 3B9DA 2WSPA 3BMVA 2FHCA 1EQPA 2DT1A 5LA0A 3W82A 5FL1A 1EGZA 1OGSA 2DSZA 2QF8A 3NUKA 5BXPA 1TVNA 1HJVA 3ZMRA 2JEPA 3WQ4A 3SCOA 1UR2A 4ML4A 1EO5A 2ZXAA 3FXYA 2FH6A 1E40A 1E0WA 1MWOA 4NF7A 1FHDA 4JZ5A 1UKOA 4PTMA 4ATWA 1ISZA 1JF5A 3SCQA 2NW0A 4V28A 4BS0A 3MU7A 2VC9A 3L4XA 1DWFM 1FOBA 1WZMA 4X0VA 4J27A 3T2PA 3AIUA 1HJXA 4UQDA 3GBEA 3TONA 4W5ZA 1PIGA 3BAKA 4Z2LA 3VGGA 3AXHA 1WZAA 3AIQA 1V0MA 1GVYA 3QHNA 3UG5A 2J78A 1QW8A 1V3HA 3BSHA 1J18A 4AZHA 4MPKA 1XCXA 1GJUA 1GORA 2WPGA 5GNXA 3VIJA 3M6DA 2CKRA 4CUCA 1JDCA 3I3EA 3SUWA 3RJYA 3WDHA 3WDQA 1WDRA 2WMGA 3UERA 1UWIA 1JD9A 2XVNA 2EPKX 3ARTA 2FGZA 1GOOA 5M5DA 3AYRA 4AIEA 1C90A 1CWYA 3ZT5A 1QBAA 1W2PA 1WE5A 4UQBA 3GNOA 4PSPA 1CYGA 3RJXA 4A4AA 3L2MA 4M80A 4HPHA 5A2AA 3AXIA 1U2YA 1MXDA 1AMYA 3CUHA 4F9JA 2WC4A 4UOZA 3VO0A 3ZJ7A 4AD3A 3K8LA 3VMNA 1HVQA 1FH8A 4WIWA 3VIGA 1JYNA 4FLRA 4Y7EA 3WH6A 3LPFA 1PX4A 1PZ2A 1GQLA 2DSVA 3HN3A 3OGSA 5AYBA 2X0HA 4QAWA 2XWDA 4QDMA 3W26A 3T2QA 5FD0A 3WH7A 1JZ4A 1J0ZA 1XRVA 3RILA 3DHPA 3AIBA 2X8RA 2VQUA 2EO7A 3KL5A 5F7UA 4RE3A 3AHVA 3KL3A 2BVTA 2Y2WA 3K8KA 3M46A 2VQTA 3W81A 3POHA 2JF6A 3WQ5A 4Z2JA 5M03A 4D1JA 3LPOA 5A6JA 2WYSA 2YDSA 3VPLA 3MO4A 5IDIA 2YA2A 1W1VA 2Q8XA 3WNNA 1C92A 1U30A 4QFUA 3AIEA 1J12A 4CN4A 1HKKA 1JZ2A 2TAAA 4AEEA 1TVPA 3AMDA 3VD7A 1NQ6A 4QCEA 2VZOA 1JZ8A 4GKLA 2CCRA 4D71A 3PBGA 1GOMA 2V3FA 4M29A 2PI6A 3OLEA 2G8ZA 3N18A 4HZ7A 5GNZA 3W6LA 2JIWA 5FIPA 1VIWA 4B9ZA 1R86A 3NSNA 3WSUA 1XD0A 4F79A 4H41A 2UY2A 3ECQA 4CCDA 3CMJA 1MW3A 1M03A 1FH7A 4XV0A 5D4YA 3MSGA 3ARSA 2V5DA 2D0HA 4HZ8A 5HXMA 4CN1A 4R5EA 1XYFA 2FHFA 5C70A 3AOFA 3WENA 1E4MM 3PZUA 3ARQA 3M07A 4E4PA 4GZIA 3BMWA 1V6XA 2BHYA 3ZO9A 1UD5A 3VD5A 2QLYA 3VD3A 3ZJ6A 3MUIA 3FAXA 1VJSA 4X0NA 4AXNA 4UFHA 4JHOA 3WFZA 3W37A 4UZUA 3U5YA 3VM7A 2BVDA 1US2A 4CVUA 1NARA 4WLCA 3OGVA 2YBUA 6CGTA 3S6TA 3FNDA 2YL8A 4D6EA 4LX4A 2JE8A 1K9DA 1WPCA 5DFAA 5LA1A 2B31A 3SUUA 1VFOA 3A4WA 1L8NA 2PF0A 4W88A 4ATLA 1KWKA 4MNKA 4RE2A 5D9OA 2WZIA 3WF1A 5GNYA 1ITCA 4EAMA 1G1YA 1N82A 1XHGA 4LYRA 5CLWA 4LYQA 4DWSC 4PMZA 1GQIA 2DH2A 2VJXA 4AD1A 3PZVA 4HMEA 4CCCA 2DT3A 3AHTA 2D22A 1HF6A 1UKPA 3RM8A 1C8XA 1EXPA 1H2JA 4XX6A 3EDKA 4UQEA 7CGTA 4P8VA 1JF6A 3PTKA 1XH2A 4J28A 4UOJA 1EDGA 2GSJA 2WMFA 1HP5A 1E73M 3ZQ9A 2Y24A 3FAWA 5AC4A 2IUZA 2VT0A 3PTMA 2YJQA 1LWHA 1OCQA 1JAEA 3CZLA 2OWCA 4MB5A 3CPUA 1D2KA 1UHVA 1V6UA 1UKTA 4CU6A 1LG1A 1Q6FA 1BHGA 1HL8A 2IXVA 1BG4A 1E4NA 3I3BA 3W38A 3CHDA 3WH5A 1KXHA 3CIVA 1C91A 1KCKA 2W63A 2X2YA 1H3GA 3N04A 1UKSA 1IZKA 1WAWA 1KGXA 4PTXA 1UR9A 1H4PA 3VMOA 2C8NA 1ITXA 1SR0A 3CZ8A 1XSJA 4J3TA 5D9NA 3WY1A 2GDUA 3BCDA 4Z2HA 2VX7A 4ATDA 2W67A 1W9PA 4J3SA 2PB1A 1V02A 4GQQA 3ZSTA 3AI0A 1CDGA 4AYSA 4Q22A 4CD8A 5IXEA 1CXKA 1RH9A 3QHOA 3SUSA 4HOZA 5JBFA 5E0FA 2ZWYA 2A3CA 1M01A 4WJXA 5BXSA 2WC7A 1V03A 1WO2A 2GDVA 3SCUA 2QPUA 1JXJA 1EH9A 2Y4SA 2XGIA 4MAVA 4ZE4A 2WB5A 2BY0A 2QV4A 5LYRA 3T0BA 4ZEPA 2VCBA 1LL4A 3WN6A 1W3HA 2VOTA 1JZ7A 3WFLA 3NSMA 1QNOA 1E6SM 1C8YA 5E0CA 3L2LA 1CXLA 5C8BB 1QOXA 2GK1B 2XSBA 4TX8A 1HT6A 2YLAA 2PWFA 1E55A 5D9MA 1WKYA 1OIFA 2DPEA 3G6LA 1BYDA 1HN1A 5BXTA 4UQAA 4TTGA 2ZX5A 3SUVA 3QGVA 4C7FA 1KR0A 5A6KA 1B31A 4HP5A 1QBBA 3W29A 2XM1A 4A3YA 1UOKA 1MVYA 4J3UA 2WHMA 1ESWA 3NIYA 2WMIA 3VIHA 3WUBA 2WMIB 5ABEA 1JDAA 3VKKA 3WNKA 4UZSA 2WLYA 2V3GA 4M82A 3VIOA 4AZ6A 1PEZA 2UY4A 1CGYA 2DSKA 3NYDA 1GQJA 1H0GA 4OOUA 1PIFA 3JUGA 1F4HA 4U33A 4P7QA 2J8GA 1EOKA 1CECA 1R8LA 2DGAA 1ZBVA 2W4XA 1BF2A 3T0AA 2WVVA 3L4UA 2WVVB 2CBVA 2UY5A 1JI2A 1B1YA 1M53A 3AS0A 5DMYA 4NZCA 1VJZA 4YPJA 3O9NA 1V3JA 1GJWA 1UYQA 1H41A 1OIMA 1VAHA 3NDYA 4MADA 3RM4A 1KWGA 3UR7A 4CU8A 3O6AA 4D6CA 4A3HA 1LL6A 3CMGA 3M7SA 1UD2A 4B3KA 1OGGA 2BY2A 2ZXQA 4P7RA 1UD4A 3QHMA 4UCFA 3W6MA 1GHSA 2XFYA 3CHEA 1NP0A 3VDAA 1HJWA 6A3HA 2ZIDA 4MAZA 4CN6A 3ARPA 2GJRA 3IK2A 1V0KA 3AHXA 4MB1A 4EE9A 2EPMX 2XHYA 5A8MA 1UR8A 4PMUA 1WDPA 1WP6A 3ZT7A 1L0PA 5JUVA 4QP0A 1BPLB 4F9DA 3N1AA 1JIBA 1C7TA 1B3WA 2DT2A 3TOPA 4KGJA 1JZ3A 4GZEA 4GPNA 3F5KA 4NRRA 1V02E 2EEXA 5A8PA 3WUGA 1E4IA 1VFMA 3W53A 2J7EA 1E0VA 1FFRA 4MDOA 3IAPA 1CXHA 1NOWA 2ZX6A 3MMUA 3WBAA 1CGUA 1EA9C 2PWGA 7TAAA 1GNXA 2QPSA 2DDXA 4W8BA 3WBEA 4GQRA 4TVUA 1W9XA 2F8QA 2YA0A 5FCZA 5CGMA 3WEMA 1QI5A 3A3HA 4TVDA 2DT0A 4X9YA 1JYVA 3DC0A 3GH7A 4HOWA 4C7GA 3VGDA 3ZR6A 2E8ZA 5BRQA 3EMZA 1WZKA 1YHTA 1DEDA 2OYMA 4AMCA 1K9TA 1BTCA 4E8DA 4CD5A 3CUGA 1VF8A 4JFWA 3PZTA 3SCNA 2PBGA 4P7NA 4JFSA 2D1ZA 4N42A 4AD2A 1Q6EA 1M04A 1ECEA 2XGBA 2EXOA 4U2YA 5BROA 5BWFA 5A2BA 1E15A 5A3HA 3QOMA 1BAGA 2E4TA 1ZBKA 2O9TA 3VUPA 1VFUA 3PZOA 3II1A 1B3ZA 2DQXA 2VZTA 2CBJA 3RMEA 1GQKA 3AHYA 1Z32X 5D8ZA 1GPFA 1VEOA 3T08A 2OSYA 4URIA 2OYLA 1QHOA 2D0FA 4KGLA 1UD8A 1WDSA 1YQ2A 2G4FA 1CENA 1OM0A 1UR1A 4LGXA 5EBAA 3OBAA 4AEFA 2XPKA 4E8CA 2BHZA 5CPTA 3K1DA 2VCAA 2WM0A 3FHQA 1NWSA 4EKJA 4HA1A 1W1PA 4HU0A 1UH3A 5IHRA 4ZXLA 1UWQA 2VL4A 1H5VA 1R7OA 2VX4A 3WELA 1C7SA 2J7HA 3FY1A 1QHZA 4Z2KA 3VD9A 3UEQA 1JD7A 5I5RA 1UD6A 2W92A 2ZUTA 3RM9A 1CXFA 3CH9A 3I3DA 5HOSA 5ABHA 2WBGA 5CGTA 4WKAA 2PBOA 4M1RA 4OOZA 2X0YA 2NT1A 1PBGA 3F5LA 1E3XA 1V3LA 7A3HA 1BYAA 3B9AA 4H8VA 4MB4A 1UR4A 2E40A 8CGTA 1K6AA 1GCYA 5I3DA 2CHOA 4EANA 1LF1A 3WMBA 5EFDA 4CD7A 1QI3A 3VGFA 4Z2GA 2HVMA 2XVLA 2J7FA 3MANA 1H49A 4D6JA 1W1TA 5EFFA 3QOKA 4LYPA 1V6VA 3IJ7A 4U5KA 4JFVA 1KBKA 3VGEA 2YL5A 1GHRA 2BY3A 3UETA 3T09A 1NOFA 2WKLA 3E1F1 1QPKA 2FDMA 1C93A 1QI2A 1C8QA 2EPOA 3RCNA 1X6NA 2DSWA 4EK7A 1KFWA 3CTTA 1MW2A 2CYGA 4PMDA 8A3HA 4CU7A 2CBIA 1J10A 3KL0A 1XSIA 4PTWA 3BAYA 3ARRA 5I77A 4U31A 1K9EA 1NWTA 1ISWA 4OUEA 5IFTA 2V38A 2O92A 1VBRA 1ZB5A 2FGLA 3GXIA 5IFPA 2VX5A 1SFSA 3AS3A 4AZIA 2RGMA 1PX8A 3QR3A 2G3MA 3AMLA 4E2OA 4M81A 3LMYA 3OLIA 3VNYA 1W2VA 4AISA 4YHEA 4NRSA 4BQ3A 4MJ4A 4JHZA 4KH2A 1VENA 3CZJA 1RP9A 5I2UA 3BC9A 1MFUA 4QCFA 1RD6A 2DH3A 4IM4A 2WMHA 1TG7A 4TXEA 5CQ1A 2XIBA 1G0CA 4JL2A 4M24A 3VIPA 3U7BA 1HL9A 4BQ2A 1SYTA 1W3LA 1E1EA 4QLJA 4D6GA 5CSYA 3WL1A 4CGTA 3AQUA 1HJUA 4XB3A 3MKKA 5CPSA 1KXTA 2CITA 3CZKA 5I23A 1ZJAA 2ESCA 1QI0A 1O6IA 3THDA 4N0RA 4TVCA 1UH4A 2XSAA 2YKKA 5A95A 4V27A 4AZCA 5CPQA 3ALGA 2ZX8A 1TMQA 3NSXA 3TTQA 1J0KA 4U2ZA 4AZCB 3OA5A 4JIEA 3VGHA 3OLDA 1JFXA 4D72A 1JDDA 1V0NA 2ZUUA 4WSKA 3NJ3A 3IJ9A 3T0DA 4PMYA 1TR1A 1ODZA 3WH9A 3AS1A 3BGAA 2ZUSA 1KCLA 2PWHA 3VVGA 4AIUA 4BCEA 1V6YA 4BQ5A 2VR5A 3VIKA 3WDIA 5A8QA 5DT7A 1EHNA 3VDCA 3WD4A 2VURA 4UR9A 2PC8A 3MSDA 3A4XA 3WEOA 3GYCA 2XVGA 1G9HA 4PSRA 5FL0A 3W0KA 4BQ4A 2GJXA 5AC5A 3AHZA 5ABGA 1G5AA 2GJXB 1LG2A 4H7VA 1ZU8A 4W8AA 1MYRA 1US3A 1E43A 4CVWA 5E6ZA 4PYSA 5DEZA 3WMSA 5TD4A 5I78A 5CXPA 3GXDA 3AMGA 4WK9A 3VU2A 1R85A 1W9UA 3APGA 1ODUA 1GUVA 2OWWA 4W7WA 4MDPA 3DYPA 3ALFA 4PTVA 4PMXA 2YL6A 1J01A 3MMDA 1UQZA 1HVXA 4PMVA 1OGBA 1E6NA 3THCA 1RPKA 1DP0A 1UZ4A 3CZEA 3CUFA 2DIJA 1JNDA 5I24A 1CLVA 4KWUA 2CNCA 3OZOA 2ZE0A 3PZMA 1EDQA 2E3ZA 2O9OA 3BXWA 5BCAA 4W8LA 3PZIA 1KXVA 5A94A 3PZNA 1QVBA 4AY1A 5C71A 1NH6A 4LXFA 4FLQA 4CKQA 2FHBA 1VFFA 4GIAA 3TTOA 3LPPA 1DWAM 2WBKA 2D23A 2VCCA 3GZAA 5ABFB 1M7XA 4CCEA 4MNLA 4U3CA 2W62A 1EO7A 1W91A 1AQMA 3BSGA 5ECUA 5LA2A 3J7HA 3BH4A 1Q6DA 3W27A 1XCWA 1CGXA 1TCMA 2E8YA 3FN9A 1V0LA 4PRWA 2WVTA 4J7RA 1MFVA 2BXZA 1A47A 2GK1A 3VIIA 4F8XA 1KR1A 3GBDA 3BAIA 1E56A 3AMKA 2X05A 3WF2A 2WWDA 1E9LA 1IZJA 1KXQA 2Y8VA 3IAQA 1V3MA 1AVAA 2V3EA 2W61A 5BYWA 3GXFA 5HDRA 2J8FA 1B0IA 2WCGA 2WXDM 4H8UA 2CIPA 1J11A 1TE1A 3WD2A 1AQ0A 1MW0A 3WQWA 3SCWA 3ARYA 1QI4A 3GDBA 2JEQA 2V3DA 2OSXA 1BGGA 1I1WA 4MTVA 3L4TA 4JKMA 4P7LA 3EDEA 4J3VA 1QNRA 2JALA 1U33A 1CIUA 2VUYA 1CGWA 2OWXA 1BLIA 4PMRA 4D6FA 4NSBA 3AJ7A 3SCVA 3OZPA 5A2CA 3FHAA 2WCSA 3WQVA 4P7OA 5FKYA 2Z1KA 2BV9A 3PZ9A 5E70A 2J77A 3SCSA 3GM8A 2GFTA 3HMCA 3VOCA 3D3AA 3CLWA 1CGVA 3WL0A 2Y5EA 2D3NA 3VIMA 1UQYA 1KQYA 1NWRA 2O9PA 3WF3A 3TTSA 3OG2A 2CPUA 3BLKA 1HJQA 4AZ5A 4IPNB 2VZUA 5E9AA 3WNOA 1CNVA 5GQBA 3DYMA 1DTUA 1XYZA 1ISXA 3TTYA 1FP9A 4KRUA 3W24A 1WDQA 4L4OA 3WF4A 5HPCA 3EYPA 5D9PA 3UESA 2ZWZA 4AD5A 4HA3A 1V3IA 2J7DA 1CBGA 1DWIM 1JYWA 1NP2A 2HISA 3GH4A 4OBSA 4W87A 1X1NA 3AFBA 4NI3A 5I79A 2VNCA 4AIOA 3WNLA 1KQZA 1JYXA 5CZKA 2AMGA 2ZX9A 3A6OA 4HU8A 3WUEA 3EMCA 1WB0A 4MJ2A 1OD8A 1OB0A 1XC6A 3AZSA 1UKQA 5DT5A 2PWDA 1CZ1A 4B16A 1B90A 1NWUA 2OSWA 2CEQA 3PZQA 3ZSSA 4U3AA 3PN8A 1KBBA 1UA3A 2BXYA 3WH8A 1E6ZA 2WWCA 5KZ6A 3BAXA 4GI6A 4RE4A 4Z2IA 4AZBA 3VILA 3L4VA 2G3NA 1I75A 2VVSA 3VX1A 2GUYA 4PUEA 2XUCA 3CHFA 2J79A 3GH5A 5CSUA 1O7AA 5BRPA 1R7AA 2CETA 3DYOA 2E9LA 3KZSA 3N17A 5AY7A 1J0IA 2VRKA 4P8XA 4AZGA 2C0HA 2WANA 2WZEA 1VB9A 2XFRA 2D24A 3AIRA 3AZRA 4WSJA 1OD0A 4UTFA 4UNIA 1JAKA 1H09A 1ZJBA 1QNPA 3RDKA 1ISVA 2G41A 5A6BA 2OYKA 4YN5A 2D20A 4JKKA 1UWTA 2EQDA 1UWUA 1WCGA 4UFJA 3DECA 2CHNA 2DEPA 4D6IA 1LL7A 3WF0A 3UCQA 2J7BA 1MXGA 3SEPA 4HMCA 3NDZA 3VTRA 3EMQA 5EB8A 1JZ6A 3N11A 1XGZA 4XUYA 4KRTA 3WD1A 3VINA 5GPRA 3A47A 1OWQA 2CXGA 2J75A 4ZENA 3K8MA 4HPGA 1XV8A 4FF5A 1V6WA 4JFTA 3CUIA 4GI9A 5CG0A 2V5CA 2RGLA 1E4LA 3L4WA 3GTNA 2X09A 1UWSA 4UFKA 1E5JA 1E6QM 4PMOA 1C3FA 1GOIA 1AQHA 1PPIA 1Y7VA 1JGIA 3EBVA 4OKDA 3VM5A 4D6HA 3ARXA 2G3IA 1CTNA 1EIBA 3WD3A 3CGTA 2ZUNA 4OJYA 4GZJA 1PAMA 3BCFA 1TA3A 1E3ZA 1TA3B 3UG3A 4PN2A 4H8HA 3ZJ8A 2QMKA 3MUZ1 2J7CA 2WVSA 4AW7A 1BG9A 3B9EA 4B15A 1E6PA 4GI8A 3FW6A 5A6AA 1EOMA 1K9FA 3DHUA 1J0HA 4WKFA 4BZYA 1E1FA 3MV01 1HKMA 1GONA 1B9ZA 4V2XA 1KGUA 3RIKA 4AC1X 2QMJA 4FLSA 4UQCA 4DM2A 5HBFA 1JZ5A 4PMQA 4QLKA 3TP4A 1D7FA 1NOUA 4L4PA 3AIVA 2EPLX 2WHLA 1LJYA 1WNOA 3WIJA 3ZOAA 1DWHM 2VO5A 3OGRA 4LQ1A 2E9MA 1B30A 4GINA 4HA4A 1OT2A 4UQ9A 2VZVA 3RPMA 2ZUVA 5IHSA 1CEOA 1FP8A 4OIFA 3L4ZA 2WMJA 3UR8A 1H0IA 1GZJA 3KWXA 4UFIA 2YL9A 2EBNA 2YDQA 3ZT6A 2WVUA 2WW5A 2EJ1A 2F61A 3NCOA 3EDJA 1XD1A 1SMAA 1BVZA 1CXEA 2ZICA 4JFUA 3PZGA 2ZOXA 3EDFA 2BS9A 1MQQA 3KE0A 3POCA 4PMNA 1TFVA 2WLZA 1BVNP 1TUXA 4TUFA 4W7UA 3ZM8A 1PZ3A 1EDTA 2C7FA 2EPNA 2XG9A 5CJ5A 1ISYA 4XZWA 9CGTA 4DM1A 4BF7A 1MQPA 4TOQA 3U57A 2X1IA 1XH1A 4W85A 2ZXBA 3OB8A 1LLOA 2WNWA 2J7GA 2ZXDA 5A8OA 1W32A 4WKHA 5EMYA 1H11A 3SCTA 4R27A 5E6YA 1ZL1A 2W66A 5DF0A 4BA0A 4S3KA 1EQCA 4PEEA 4WF7A 2FH8A 2PWEA 4AWEA 4W89A 4ACZA 1PJ9A 4ACZB 1V3KA 3W25A 3SCRA 1DHKA 2WK2A 1W1YA 4MNJA 1OSEA 1IV8A 5A6BD 3K4DA 2QHAA 3VD4A 3KEHA 1FFQA 4TX6A 1VBUA 3AICA 3F4VA 2YLLA 3U5UA 4DUVA 3AS2A 3MMWA 3CHCA 3ARUA 1G94A 4ZXOA 4DWSA 3OLGA 1MQRA 3UG4A 1ZBWA 4DWSB 6TAAA 4JAWA 3MS8A 3RO8A 2AAAA 3ARVA 1UA7A 2A3HA 2XYLA 4FMVA 3S2CA 3AYSA 3D5HA 1W9BM 2BHUA 2WCAA 4W86A 1PX3A 4UOQA 2J25A 1LWJA 1BSIA 2J74A 3ZR5A 5FOOA 2E0PA 4JCMA 3BAWA 1W9DM 2JF7A 2VI0A 3N12A 2ZUMA 3AISA 5I0DA 4JCLA 2O9RA 1FH9A 1HXJA 4S3JA 5HPOA 3L4YA 3MUY1 2Z1SA 4W5UA 2VRQA 2VR4A 2XVPA 1HKJA 5JBEA 4PCSA 4M8UA 1XH0A 2W5FA 5E09A 1QNSA 3AXXA 3N9KA 1FA2A 1B2YA 2G3JA 5DO8A 2GVYA 1HX0A 3N13A 1F4AA 1CGTA 3W4RA 1DWGM 5M3WA 1GOQA 2E9BA 4P8UA 1BGAA 1ZS2A 4GO9A 2OLHA 3ARWA 3VDBA 1D3CA 3CUJA 4CD6A 1HNYA 1E72M 1SMDA 2W91A 3CZGA 2F2HA 4GXPA 1QNQA 1A3HA 4W93A 3LPGA 2WZHA 2XM2A 3AROA 1BYCA 4GO8A 2BNJA 4F66A 4M56A 1E6RA 1BQCA 2J62A 4B9YA 1CLXA 1VEMA 1UG6A 4PCTA 3W28A 3PTQA 1CPUA 3ZJKA 2JFEX 3VGBA 1I1XA 4W7VA 3SURA 1JFHA 4KMQA 3SCPA 1Q4NX 2WC3A 4J3XA 4UFMA 1JNEA 3G6MA 3MV11 1G01A 1E70M 2J47A 1J0YA 1HJSA 1HP4A 4IISA 1UUQA 4D6DA 3HJEA 3SUTA 1E6XM 1B3XA 1RP8A 3VIFA 5I6SA 1J9YA 4J3WA 5ABFA 4CD4A 1KB3A 4MNMA 4C7DA 1Q6CA 1Q6GA 3BLPX 4B3LA 2XJ7A 4Q7NA 1LQ0A 2UWFA 4PUDA 3K4AA 1P6WA 1BYBA 1UH2A 3U7VA 4JL1A 1NM9A 2BFGA 2XFFA 3AMCA 4U5IA 1S46A 2WSKA 3VDHA 2YOCA 4DUXA 5A69A 3F5JA 2DSUA 3WDRA 1BFNA 4HZ6A 4AD0A 2J4GA 1E5NA 1OBAA 2GJPA 2VTFA 4TTUA 5JBDA 2VRJA 5A6LA 4UFLA 1UR0A 4ACYA 4IUGA 3OIHA 2A3AA 1JI1A 2DIEA 4ZE5A 1UZ1A 2D3LA 3GNPA 2A3EA 1HKIA 4HOXA 3TA9A 3WQ6A 5JIPA 2AOSA 4K68A 3T2OA 5JIWA 2XVKA 1UD3A 1J0JA 3IANA 4AD4A 3O2LA 3WDPP 4DWSD 1OT1A 1FHLA 4OZOA 1DWJM 1GW1A 3B8SA 1W3JA 2VZSA 4H2CA 3WUFA 3GXMA 3WEZA 4D1IA 2WKGA 1E0XA 1X6LA 3K46A 3ARZA 5A6SA 2VMFA 4JKLA 4W84A 1E71M 2MANA 2JIEA 2WAGA 2WHKA 1JG9A 1OINA 2VVNA 3AIWA 3AZTA 2D0GA 1JL8A 2NSXA 4FLOA 2VX6A 4AZ7A 3WKZA 4HMDA 1EHAA 1GOWA 2ZX7A 2WHJA 1UWRA 1GVIA 3VNZA 4RL3A 2IXUA 2YIHA 3N15A 2YA1A 2CESA
chains in the Genus database with same CATH superfamily
3CO4A 1XLKA 4EP8C 1AW5A 1ZBCA 3UZWA 3L5LA 1H1NA 1KRAC 1YDYA 2Y8KA 3DH7A 5AYIA 3EDDA 4KEZA 3VYLA 5HJYA 1W3KA 4D8AA 1B3YA 4QDWA 4H04A 1TJRA 3OZYA 3R0KA 3MUAA 3TYEA 1HIZA 1S2CA 4GH3A 3M43A 1HG3A 4L65A 2V82A 1M1BA 2GPTA 1J6OA 3LCWA 5A6MA 1SZNA 1PO9A 4ERAA 4HK5A 3LB0A 3WNPA 3I6EA 4FK9A 1PTAA 3RRXA 5KEZA 4BI6A 2CKSA 1DKWA 3S5NA 2BVYA 1XSKA 3GNRA 4MB3A 4YHGA 2OEJA 2CBUA 4GIEA 4O10A 1D3GA 1Q6QA 1TZ7A 2VR2A 3B9DA 3BMVA 3L12A 3W7LA 2FHCA 2WQDA 1YBQA 2YB4A 4KEMA 5FL1A 2DSZA 3NUKA 4Z08A 1X7IA 1EUAA 4D2JA 1N7KA 1Z48A 1O94A 3GNDA 5CCZA 3FVMA 5C5YA 3TXZA 4B2DD 4C6JA 1M5WA 1E0WA 1MWOA 2ISWA 2B4GA 4HK7A 1TMLA 2H6RA 1UKOA 2V63A 3WMLA 3WLIA 2REQA 1KD0A 2VC9A 5LNSA 4AY8A 3IIXA 4DBWA 3N4AA 3N4FA 1F07A 3M4HA 1HJXA 1W17A 4NXKA 4LUSA 1W8SA 1ENUA 4UQDA 4QG6A 4YTQA 3W2KA 3VGGA 3AXHA 3WBWA 3AIQA 1V0MA 3P84A 3UG5A 3QPEA 2J78A 4AZHA 4GHRA 1SR9A 1JDCA 4NT0A 3SUWA 1W1ZA 2FFCA 2OQHA 3CQIA 3GZ3A 4WD0A 3WDHA 8TIMA 3CO8A 2HS6A 4QNWA 2INEA 2WMGA 9XIMA 3ICJA 3EX3A 1UWIA 2A3LA 2R8WA 2XVNA 4YTUA 3NL3A 3ZT5A 1KTNA 4IGMA 1EA0A 5HJXA 1AUSL 2BGSA 3JS3A 1SZRA 3QH2A 3GNOA 3E96A 4PSPA 2B7OA 1U2YA 5J8LA 4NQ1A 1Z3NA 1G67A 5CZ0A 4F9JA 3VO0A 1Q8AA 1F3EA 3KOYA 3K8LA 1XLFA 4TV5A 4WIWA 4PB3A 4LRTA 5K4XA 3FJNA 1F8MA 5EY5A 2XN2A 2DU2A 3IIPA 3JW7A 2ONEA 2HJPA 5AYBA 2X0HA 4QDMA 2NQJA 3T2QA 3WQFA 2XINA 1JZ4A 1J0ZA 3RILA 2EO7A 4RE3A 3A9BA 3AHVA 3KL3A 3HF3A 4GYKA 2Y2WA 2XH7A 3CNYA 2VQTA 1VLWA 3POHA 1OG6A 2WJDA 4GIYA 2BP1A 4YWSA 1YPIA 3FA5A 4CQAA 4ZSUA 5A6JA 5G1MA 4H6EA 1AL7A 4LF1A 4L9ZA 1OX4A 3MWAA 2YA2A 2VHLA 2Z1VA 4WXYA 3UG8A 2OX4A 3WNNA 4BI5A 3RK8A 3EPNA 4QFUA 4CN4A 3DBNA 4BF9A 4NAEA 1P6BA 5HNUA 1IYXA 2PAJA 2OXNA 4J2PA 5L9FA 1JZ8A 4E0CA 3TW9A 4D71A 1GOMA 2CLPA 4O14A 2V3FA 1LBMA 2Q3OA 4DBEA 3OLEA 3WO8A 4FA3A 2Q02A 1W56A 1JRCA 4F79A 2UY2A 3HQNA 1MW3A 4XV0A 1S38A 5D4YA 3MSGA 2IS7A 3V18A 3EWDA 2E1WA 5I07A 3ARSA 2V5DA 2D0HA 5HXMA 2J27A 1QPOA 2PP3A 1W1A1 1UWAA 3SN4A 4O50A 3WENA 4XO7A 3PPCA 5DY3A 4YTTA 1R2RA 4TIMA 1F2JA 3B8WA 4GZIA 4KBXA 2P50A 5A5WA 4F40A 2WSYA 5I00A 3VD3A 4DY1A 3MUIA 1MZRA 1VJSA 3FAXA 4HCDA 5FSDC 4JHOA 4NP7A 3U5YA 3VM7A 2PGFA 1ME7A 4ZFCA 3HQPA 3W7DA 1O12A 4NKCA 4L4MA 4D6EA 1OX5A 1EP3A 4LX4A 4MJZA 5TIMA 3B4UA 1BF6A 1TPB1 3A4WA 3MSYA 4HCHA 1L2UA 4MNKA 1F74A 4EAMA 3KBSA 3SSJA 1CI1A 4LS2A 1XRFA 5CLWA 4LYQA 4DWSC 1YDVA 1GQIA 2DH2A 1MMFA 2CLKA 3PZVA 1LORA 4K1WA 1FWWA 1UKPA 2JKAA 3I7RA 1TELA 2AGKA 3S42A 3EDKA 4RV8A 1AK5A 4UQEA 3S4TA 2VP8A 4GKTA 5EGRA 1OQFA 4FALA 2I5QA 2Y70A 2Q6ZA 3GIYA 2PDIA 4LV9A 2QCGA 2Y24A 5K4ZA 2FVKA 2VT0A 4XK2A 3PTMA 4I8DA 1OY0A 4QJ4B 5AOUA 4MB5A 1KRMA 1XC4A 1RBAA 2J6VA 1LLZA 1MEWA 1BHGA 4HPJA 1BG4A 3BOLA 4IQJA 3CHDA 3WH5A 5BRBA 4JNZA 1KXHA 3CIVA 4PMJA 4A29A 3HZ3A 3TJXA 1H4PA 2ASHA 2OVLA 1W6TA 2YGYA 1X6UA 4H3DA 1ITXA 1FHUA 3WY1A 4J3TA 3QRHA 2DZXA 4HU4A 1AQFA 1GVQA 3QV7A 4J3SA 1QUMA 4GQQA 3ZSTA 3FCPA 3AI0A 1CDGA 4AYSA 3CAWA 4Q22A 4CD8A 1B5TA 1BRLA 3CV6A 4HOZA 1XLCA 5E0FA 2ZC8A 3RLHA 1M01A 5EKYA 2WC7A 1H7XA 4HZMA 4J2MA 4A21A 1A5KC 3HQOA 1IHIA 1RJPA 2Q01A 7TIMA 1EBHA 1AG1O 2YXGA 3UWUA 2BY0A 3T6CA 2QV4A 3T0BA 3STPA 3S3GA 4DBDA 1LL4A 3CAVA 1QO5A 4KCWA 1TB3A 3STFA 1W3HA 2VOTA 3OYZA 4C6IA 4GGBA 1QNOA 1E9IA 5AHNA 1C8YA 5E0CA 4B5XA 1CXLA 2ZRVA 3U48A 2GK1B 3CHVA 2R91A 4TX8A 1HT6A 4DXKA 1OIFA 1BYDA 1Q66A 3RU6A 1HN1A 2CZDA 4GOAA 3Q67A 4HSHA 4XUGA 3TJ4A 3CV2A 1KR0A 4L1WA 4UWMA 4GK8A 1UOKA 3DHFA 1XFBA 5D30A 4QEEA 1FWFC 3T9PA 2QW5A 4EPEC 2BGNE 4A8RA 5FSEC 3DERA 4ZQCA 4AZ6A 1DJYA 1PEZA 2UY4A 1CGYA 1EP1A 4MWAC 2DSKA 3NYDA 4UNLA 1R3SA 3UT0A 3JUGA 1YADA 1F4HA 1WUEA 1TJPA 3GFXA 3ONCA 1SZEA 2E67A 1D8WA 4S3EA 4U33A 4P7QA 1OC7A 2EG7A 2C13A 2J8GA 1EOKA 1R8LA 3A12A 1ZBVA 3EKGA 2W4XA 2FJKA 2WVVB 1RLDA 4F4RA 4IQEA 5LXXA 1H7WA 2XZ7A 1M53A 1IEVA 3KHJA 4NZCA 1K03A 4YPJA 3ZYZA 2J9YA 3HGRA 1OYBA 4CEXC 1IXQA 3VC6A 3NDYA 3NQDA 4MADA 5TAOA 4D6CA 4FS9A 4A3HA 2PLJA 2Y88A 3M7SA 1UD2A 4JQ4A 3RRAA 4B3KA 5BMXA 4ZA0A 4QNEA 3NXFA 2EAWA 4AHQA 3QHMA 3W6MA 1GHSA 2F84A 3MVIA 7PTDA 4H19A 2GJRA 1YXCA 3IK2A 3W2JA 3AHXA 4MB1A 5F2GA 1FBAA 2Y62A 3F7JA 3MUXA 3NQEA 1UR8A 1WP6A 3ZT7A 2QULA 1ICPA 4UTWC 2VFDA 3MBFA 1VYSX 2P10A 4K36A 4BK9A 3ZLHA 3MKCA 3N1AA 1B3WA 4DZHA 2RAGA 3F2DA 1XL9A 5A8PA 3WUGA 1GVRA 3TMQA 3W53A 3ZWTA 1M7JA 4MDOA 1DIKA 3A4JA 4Y9OA 4GA8A 3MPGA 7TAAA 4GCAA 4GQRA 5AHIA 3QN3A 1W9XA 3QQ0A 1MO0A 3SFKA 2PDFA 3VZYA 1JYVA 4RNIA 1Q63A 3B8TA 2QIWA 8RUCA 3GH7A 1VKFA 4C7GA 1AZ2A 3ZR6A 5BRQA 3N29A 3EMZA 1DEDA 2VYOA 4L6OA 4AMCA 1T96A 2QJMA 1V77A 3CUGA 5M2FX 3GG0A 3C2EA 1GVOA 5DY2A 3UZ5A 1U5HA 1AD4A 2PBGA 4NX5A 1I2PA 3HBLA 4GBUA 2VD8A 3NEHA 1Q6EA 1M04A 1ECEA 2XGBA 3GWQA 1E15A 4Q8MA 3HA1A 1TV2A 1BAGA 1LQAA 5FEXA 2O9TA 1VFUA 2QGHA 2ZE3A 3II1A 1A50A 4H01A 2VZTA 2CBJA 2I5IA 3RMEA 4Z1AA 2QT3A 1Z32X 3KVJA 3CWOX 1TVLA 2PDBA 3PJUA 1XUZA 3QC0A 3VCRA 1YXYA 2OR2A 2D0FA 3MBDA 4KGLA 2NXGA 3UJRA 1YQ2A 1QNVA 2G4FA 4FR6A 5EMUA 2R1KA 4LGXA 3ITGA 2VEMA 3K1DA 2WM0A 4GVHA 2NQHA 3V35A 1NWSA 4XVEA 3W22A 1H5VA 1W1B1 2PCEA 1Z44A 2YZ5A 4Z2KA 1I4NA 3UEQA 5HUOA 5I5RA 1UD6A 2ZUTA 2KZHA 2C0AA 3EA3A 3STGA 2GVLA 3GE7A 3DFOA 3O6CA 3UW6A 4OOZA 2ZA3A 1LLWA 3LQLA 1X38A 4X2RA 2NLIA 1BYAA 3W7EA 1GCYA 4Z0SA 4AH7A 3GB6A 3VGFA 3AC0A 3RX3A 5DCEA 1U22A 3LENA 3ABRA 4U5KA 1YTEA 4I7WA 3ANVA 3I65A 2BY3A 3TYDA 3MT1A 3PAOA 2XISA 5I03A 1TZ9A 3HG2A 1W5QA 2QDDA 1QPKA 2FDMA 3QGKC 3OZMA 1C8QA 3DX5A 3KUMA 3NQ8A 1KFWA 1K8ZA 5E1QA 1D9EA 2VEIA 1OZQA 1JQXA 2QVHA 3CIXA 4PTWA 1Y5WA 3BAYA 3G77A 4BWLC 1AJ2A 1VBRA 2FGLA 5CSRA 1R3QA 3F4WA 2VEPA 1SFSA 1YLVA 1RK6A 3AS3A 4UUIA 5DX7A 3MDUA 3RGTA 2G3MA 4MM1A 2JBMA 1PWMA 2V5JA 3B0PA 4GUJA 4BQ3A 3MP3A 3CWHA 4DO5A 4KH2A 1RP9A 5I2UA 4JICA 5D04C 4QCFA 3KLLA 1QMLA 3EKLA 3TYAA 3LGEA 4TXEA 5CQ1A 2XIBA 4JL2A 4C1KA 3H70A 4IMAA 3QQWA 3FGCA 2FTYA 2G96A 1E1EA 1M9HA 4QLJA 4D6GA 4LW7A 5CSYA 4CGTA 1FDZA 1HJUA 4LUIA 3PNUA 1KXTA 1DJQA 2CITA 2RUSA 3CZKA 1ZJAA 3LYEA 3BW2A 4UMCA 3GX9A 1TIMA 3OVRA 4CQBA 1FRBA 2DZUA 4XKYB 4UC5A 2XSAA 4WDXA 4V27A 3E74A 3ALGA 3BANA 1J0KA 1IGWA 3OA5A 4JIEA 3VGHA 1JFXA 3RHGA 4WSKA 2OJPA 1G4TA 4BKNA 1IR2A 3T0DA 2H9AB 4HVXA 5KINA 3VABA 2V5LA 3UA4A 3RO6A 3FEMA 2PWHA 5DLCA 4AIUA 3VK5A 1Z69A 3T7VA 2VR5A 3OQEA 3QQ1A 2BVWA 1UZDA 2GUUA 1EHNA 3VDCA 2NQZA 3HO8A 1UMLA 4UR9A 3WEOA 2O56A 2INFA 4H9TA 3W0KA 1GG1A 1UIOA 5ABGA 5J5DA 1D7KA 1O5XA 2CU0A 1KA9F 3THAA 5TD4A 4JIPA 1QT1A 1XUUA 5CXPA 2V2DA 3GXDA 1XWYA 1RQBA 3CH0A 3KX6A 3W75A 3LXBA 4GUHA 4FXRA 3DYPA 3ITOA 4PMXA 2BSLA 4B5SA 1C29A 3SECA 3V5CA 1KM4A 2DV0A 3RAOA 4FXFA 3THCA 3ABSA 1UZ4A 4S3AA 4I9JA 3QLDA 3CL8A 1ICQA 1CLVA 4KWUA 2CNCA 3OZOA 2ZE0A 2E25A 4H7CA 5AN7A 1DJWA 2ZZ3A 4YJ5A 1PYMA 1K1DA 3PZNA 1QVBA 1HFBA 4AY1A 1NH6A 1Q7QA 4LXFA 2VGGA 1SW7A 1Y5XA 4Q6JA 4R85A 1W3NA 3VCNA 4UTJA 5G1YA 4HHMA 3QFEA 3ZVHB 1M7XA 3GNNA 5FACA 4U3CA 3LHTA 3BSGA 5ECUA 1GZ1A 5LA2A 4FX6M 2MUCA 3J7HA 2ZDSA 4HYRA 4XBJA 1RR2A 3W27A 1TCMA 2E8YA 3FN9A 3NZQA 1KBIA 2GWGA 1GG0A 1A47A 2C3ZA 3GBDA 4KIRA 1RK5A 3UWZA 1VR6A 4JTEA 2WWDA 1E9LA 1T8XA 4G9PA 4KWWA 2RJHA 2W61A 5BYWA 3T44A 2WCGA 2RH9A 4O17A 1XQLA 3EGJA 1TE1A 1JVNA 3RXZA 3H12A 1QI4A 1UUOA 1KFLA 2XDFA 3H2AA 4ZB2A 3FK4A 2V3DA 1XX1A 4CNUA 4JQ3A 4QJ3B 4JQ1A 4M6VA 3C2RA 4NSBA 1R0MA 2OCZA 1Z6KA 4GYPC 5A2CA 3DI0A 1O68A 4GABA 4XG1A 2O7SA 2PRLA 1ITQA 1W0MA 2PDYA 4XAGA 2QJNA 3GG8A 4LJ3A 1Q6RA 1CGVA 3A64A 2Y5EA 2D3NA 3KAOA 5LHFA 2X1UA 1NWRA 3LV5A 3OG2A 1BSLA 3S5ZA 1HJQA 4AZ5A 4IPNB 2ZRXA 1SVDA 1VYPX 3RPDA 1ISXA 3BICA 3TTYA 4HJFA 1ZGDA 1FP9A 4H9VA 3W24A 2PRHA 1SFTA 2DZTA 5HPCA 3LGGA 3P67A 4JGDA 4AD5A 2B7NA 4M19A 5CBBA 3SY8A 4FX7A 5U7SA 4XZHA 4W87A 3T55A 4NI3A 3WNLA 5HQMA 3DG3A 1F8IA 4Y6GA 4MJ2A 3TAKA 4IOTA 2W79A 1PZ1A 1ZLPA 1GJPA 2PWDA 2NV1A 1NWUA 4FF7A 4S3BA 2CEQA 2Z6JA 4U3AA 1QTWA 1L6WA 3PN8A 1KBBA 2RDTA 1UA3A 2BXYA 4FO4A 3NZ1A 7XIMA 1Z42A 4GI6A 5MKGB 2QYGA 4DIAA 1RV8A 4AZBA 3VOHA 3BURA 2GUYA 5FJTA 2A7PA 3CHFA 1PKNA 1Q8JA 1W5NA 3GH5A 1O7AA 3MTWA 2CETA 1P5BA 3TJLA 3KZSA 1UASA 2PU1A 4RLIA 1K77A 1SSGA 4AZGA 2V69A 3AZRA 4ORMA 1OD0A 4C6CA 1H09A 1ZJBA 2J6XA 3P5ZA 3C8NA 1ISVA 3FYOA 2G41A 1XCFA 3XIMA 4IZGA 4LUSB 1GEHA 2D20A 2ZRWA 1UWTA 2EQDA 4JKKA 1WCGA 3NPXA 5BOEA 4NVTA 2C91A 1YTKA 4CLMA 2J7BA 3WCZA 3TSMA 3LTPA 3NO1A 2YCEA 3R89A 1JZ6A 4HN4A 4DI9A 4NZ1A 3VINA 1UBSA 3A47A 1RBLA 1TR9A 3NQAA 4ADSA 5EA9A 1OF8A 5CG0A 2V5CA 3ATZA 2RGLA 1E5JA 2O4QA 4XZNX 2OOGA 2O55A 1KFEA 1I2OA 1Y7VA 4EWND 2E6YA 2OT0A 3C3NA 1CTNA 3WD3A 3P81A 3KS5A 3BCFA 4DB7A 4X2PA 3EWWA 2XH0A 1E3ZA 4RDVA 1TKKA 4PN2A 2NWRA 3GIPA 4XBSA 3MUZ1 2J7CA 4G7EB 1CLKA 4AW7A 1EFZA 1BG9A 4B15A 1E6PA 3I6RA 4I8YA 4J3ZA 3FIGA 3NPUA 5A6AA 1EOMA 1J0HA 4WKFA 4BZYA 4PGLA 2HVOA 2FIQA 1GONA 4V2XA 3VCCA 2WPBA 2GQ8A 4GXWA 2HDJA 1IEQA 4PMQA 4R7JA 3TP4A 1NOUA 2F38A 4MKNA 5T91A 4W4QA 2WHLA 1LJYA 3ZOAA 2A5HA 2Z2BA 3OGRA 3AU6A 1VHCA 2E9MA 3EWBX 3T1GA 5JQ9A 3A5VA 3RPMA 3IJLA 1FWNA 4C6NA 1U1UA 2A6LA 2FDSA 2YCKX 3TN6A 4GFIA 3HPAA 2QCCA 4H6KA 3TTEA 1H0IA 2C15A 3UWWA 2WVUA 3BLDA 4YMZA 2DJXA 1XIMA 4HIBA 3NYZA 5EL1A 4ZB0A 2P0IA 1BVZA 1OX4B 2O0TA 2ZOXA 3QPYA 3EDFA 1W5OA 6ALDA 3KE0A 1MQQA 3VZZA 4Y9MA 3H4XA 1TFVA 1CX9A 3CV1A 4O19A 4W7UA 1TUXA 4TUFA 1C9DA 3ZM8A 3TK7A 1PZ3A 1R38A 1ME9A 4WSHA 1ISYA 2GVJA 4XZWA 9CGTA 1OFRA 3URBA 4CQ8A 6PTDA 1MQPA 2AMXA 3U57A 2X1IA 1Q3NA 2WNWA 3KS6A 1IEXA 2J7GA 1HO1A 1W32A 4WKHA 3SCTA 3ABOA 5E6YA 1K8XA 1ZL1A 1WA3A 1XRSA 1RQHA 4WF7A 3BK0A 3G3MA 1RCQA 4IXXA 3PF3A 3LBMA 3DXIA 4Q8UA 3HQ1A 4I6KA 4ZO8A 4RV3A 3H24A 2X40A 3ORWA 1IXOA 1PVNA 5I3JA 4FB7A 3IJDA 1IV8A 2AAMA 3VD4A 1FFQA 4TX6A 4XTDA 2ISSA 3AS2A 3W02A 4DWSB 3MS8A 1TREA 1UA7A 2A3HA 4EACA 3S2CA 1XW8A 3WJYA 3D5HA 2V9DA 2X0SA 3PAJA 2J25A 1LWJA 4IL0A 3B0VC 5FOOA 3ZR5A 4F0SA 5I3IA 3GTHA 1SW0A 3QLLA 4FAMA 1F7BA 3N9RA 2VI0A 1PKLA 3N12A 4AVFA 1DL3A 3AISA 2P88A 4JTJA 4H1ZA 3S1GA 4JCLA 3M44A 2O9RA 3PPFA 4JY8A 2QV5A 1FDYA 2Q8ZA 4W5UA 3Q37A 5JBEA 4PCSA 1XKYA 1LUCB 3RCMA 3UU0A 3K5XA 5XINA 1QNSA 2E7FA 3RCYA 5DO8A 3N13A 1TV8A 4Q8QA 4UTKA 5M3WA 2J24A 4YCOA 3D3FA 4XD6A 5DBTA 2BOGX 4C1NB 3ANYA 4GO9A 2OLHA 1SMDA 1QATA 1ICSA 3NZPA 4PL2A 4GXPA 3PPGA 4PUNA 1A5AA 4Q6XA 4YCPA 4WQ6A 2Y61A 5J04A 1US0A 3UWEA 1AA1B 1O4UA 2DUXA 4B9YA 2QCMA 2B81A 1CLXA 2AL2A 5LIWX 4N7QA 3W1TA 3PTQA 4PUMA 3ZJKA 1RQEA 4IGHA 1Q4NX 2WC3A 1XQKA 1PXGA 3GY1A 3G6MA 4YYCA 5K9DA 1G01A 3R13A 4N6EA 4E2VA 4UMBA 3NQFA 2R9RA 4DJDA 3IEBA 3STEA 4IISA 1NF7A 3HJEA 1E6XM 4MLRA 1J9YA 3RFAA 2Y7FA 5ABFA 1Q6GA 4RCXA 2XFWA 1R6WA 4Q7NA 4MIMA 1LQ0A 1CT5A 4KEVA 3C52A 3R7MA 3SJNA 3V36A 3P93A 2A0NA 1P6WA 2TMDA 1UH2A 4NZ4A 4JL1A 4R7WA 2YOCA 4XZLX 1DJHA 4S1FA 2WNNA 3KVKA 5M1TA 1BFNA 2GJPA 3E5BA 4X9SA 3MJYA 4PTDA 4HKPA 4FNTA 1UR0A 4RJEA 3OIHA 1JI1A 1QFEA 3LTYA 4MWAB 1HKIA 2ACUA 4WDUA 4O1DA 1IIGA 2XVKA 1WXYA 1VIZA 3KCLA 3RLGA 2AGTA 1FHLA 4XSLA 1PIIA 1DWJM 1W3JA 5KMYA 4H2CA 3WUFA 3GXMA 3OIXA 4D1IA 3PJXA 3WLKX 2VMFA 4WJEA 4W84A 4K6AA 1YNYA 1YYAA 5GJPA 1PTDA 3W1LA 1LBLA 1JL8A 1VBGA 2ZX7A 3PWGA 1OCNA 1UWRA 5G4HC 4DJFC 2IXUA 3TFCA 5LNVA 2YA1A 4LVAA 4WJXA 3HPSA 3E2VA 3E0IA 1WZLA 4JYDA 3LU2A 1KFCA 4DJED 2A3BA 4LBSA 3H2MA 2TODA 3ONBA 4D8LA 4P8WA 2BY1A 3SIMA 2FTWA 2DUAA 2SFPA 4R33A 1S39A 4GNKB 3IUHA 3CBWA 1KBJA 1AD1A 3ZS4A 3CEPA 2PS2A 5A1AA 3MHFA 4CNSA 4G1KA 4BHYA 4ENLA 3G8EA 1S2VA 4XZBA 3NQ7A 4OVXA 5IOBA 1KV5A 5CLTA 5A8NA 4JIIX 3T8LA 2I9UA 3BAJA 4KETA 1KCXA 1CXIA 3PHAA 3WNMA 3QJAA 1I2RA 2XWEA 3U0HA 1F61A 2XIIA 3QR1A 3W7NA 1VEPA 2CERA 2UY3A 4B4HA 1R87A 1GOKA 3PUOA 3S8HA 2WSPA 2JQXA 4AWSA 1RCOB 3WK1A 2QF8A 2QXWA 3ZMRA 5F1VA 2YPIA 3VNMA 2JEPA 1EKOA 3BOXA 1H62A 3OVPA 1CB7B 1UR2A 4FNQA 4US5A 3FXYA 2R1LA 3EX6A 4JZ5A 4ATWA 1JF5A 3S1XA 2NW0A 3TLLA 3TC6A 1EWDA 1QOQA 4AIBA 3SRHA 3O05A 4UIOA 3EEGA 4PC8A 1DWFM 1TPUA 5KZDA 1FOBA 3Q45A 3BG5A 3T2PA 3AIUA 5D2TA 5F2MA 1S2UA 3GBEA 4ZOAA 3TONA 4A3QA 1PIGA 3BUVA 1LT8A 4Z2LA 1WZAA 4RZBA 4UCGA 1R2SA 4QAIA 1V3HA 3P7YA 4MPKA 1XCXA 2VFEA 1GORA 1L6SA 1NTHA 2Z1WA 3I3EA 3KHDA 3RJYA 2HXUA 2PDGA 3UR2A 1AMKA 2BOFX 3UY7A 3WJZA 2EPKX 3JR2A 4NYUA 2FGZA 1GOOA 1YRRA 3SDOA 5M5DA 3AYRA 5D38A 3WK0A 1QXLA 1C90A 3UXKA 1CWYA 3B8VA 3TYUA 1Q5MA 1CYGA 1O1ZA 3RJXA 4M80A 2FVLA 3B8IA 5A2AA 3AXIA 4GLEA 3MZ2A 1AMYA 1V93A 2GOUA 3ZJ7A 4LNCA 4JY9A 1X8FA 3VMNA 4IFOA 3LUTA 3RLVA 4FLRA 4LS1A 4AFYA 4KESA 3C2OA 3BJTA 4K38A 4S2BA 3WH7A 3Q65A 1WOBA 1XRVA 3DHPA 2X8RA 5F7UA 5G1TA 3KTSA 5AB3A 3CAKA 3W81A 4QHRA 4A8IA 2JF6A 3WQ5A 4Z2JA 8XIAA 5M03A 3LPOA 4ILSA 2BASA 3H26A 3S2LA 1W54A 2YDSA 3TKFA 3MO4A 4NU7A 2QUVA 3QR0A 2Q8XA 1SPQA 3QVQA 1RXOB 3ZLGA 1YEYA 1U30A 3AIEA 1BKSA 3GDMA 5IDZA 2PDJA 5C0QA 1AH0A 2FFIA 4ZODA 3OHMB 4D9PA 4AEEA 1RCXB 1TVPA 3AMDA 4GKLA 3FS2A 3PBGA 2FZ8A 5AC8A 3ERPA 3NA8A 2Z25A 4O4WA 5GNZA 1AW2A 2F9RA 5FIPA 4B9ZA 3SFWA 1WOAA 4FP1A 5U4NA 4AF0B 3OOQA 3C86A 3BG9A 4E3TA 1F76A 3GRIA 1M03A 3EOUA 1FH7A 3N25A 3LCXA 5D32A 4US6A 1XIJA 5D2XA 4HZ8A 1N55A 4C5YA 1EYEA 1KM2A 2FHFA 4J40A 2FB2A 2TPSA 3PZUA 2IW0A 4OV4A 2VC5A 3VKDA 2BHYA 4B5UA 3ZO9A 3VD5A 3ZJ6A 3A13A 2OGJA 3WFZA 3L66A 3W83A 2R14A 3W7GA 3W1QA 1EP2A 3NM3A 2BVDA 1OJXA 3KWSA 4WLCA 3OGVA 5H91A 3FNDA 2BTMA 2YL8A 2JE8A 4XISA 1E0UA 5AVNA 1WPCA 2B31A 3SUUA 5CPMA 3K4WA 4I7UA 2PF0A 3EWZA 2OG9A 4ATLA 2WZIA 1PUDA 5GNYA 3TNOA 3UNDA 4JR5A 4UTIA 1I6NA 2XZ9A 1BWLA 4AHPA 3R5EA 3H2EA 4E6MA 4LYRA 4DF2A 2OTDA 1VPYA 4AD1A 4NAFA 2AL1A 3AHTA 4YVPA 4KERA 3IIZA 2PWUA 1UIPA 3WQGA 1EXPA 1H2JA 4XX6A 1KTCA 4ZOEA 4UNKA 1EEPA 1RAKA 1FWRA 1I0BA 2GJNA 4P8VA 3QYQA 4O0QA 1EDGA 2GSJA 4A2RA 4FEZA 2WMFA 3V1PA 2BXVA 1HP5A 3RN6A 1E73M 1IWAA 1SFJA 5AC4A 3BO9A 1ZTVA 3NAVA 3SQLA 1KFJA 1OHLA 2ABBA 3CPUA 3L65A 2Y7GA 1V6UA 1UKTA 2GQ9A 1FWHC 1IGSA 2F2KA 1AODA 1E4NA 3I3BA 4EPBC 4Y90A 4GI4A 1PHWA 3HURA 1SO5A 2W63A 2X2YA 1RD5A 3O63A 2FZMA 2V2CA 3BV7A 1UR9A 2Q09A 1VBJA 3LZ3A 4MY1A 3CZ8A 4H9UA 1XSJA 2CXEA 4ATDA 2W67A 1A3XA 3HM7A 6REQA 3ELFA 2PB1A 1V02A 3L0NA 3KDNA 3IARA 1QWGA 5IXEA 3QHOA 3SUSA 2Z2UA 2GGIA 3HG4A 2OB3A 1XYMA 1V03A 2X7VA 2YYUA 3EWCA 2GDVA 2I56A 2X1SA 1QPQA 1J96A 1XRTA 3VOFA 2DZAA 2XGIA 4MAVA 2WB5A 3QW3A 5LYRA 4ZEPA 2DVXA 3WN6A 2FZNA 3GVGA 3JZEA 3A3WA 1JZ7A 2ZZ1A 2HWGA 2Q3RA 3O06A 4I9TA 1DOSA 3KBMA 1E6SM 3RU8X 4LANA 5C8BB 2WJEA 3KBVA 1G4SA 2YLAA 5D9MA 4I5RA 2DPEA 5CH9A 4WGXA 2YR1A 2X1RA 3DBPA 3CIWA 4UQAA 4TTGA 5C2CA 4XIMA 3SUVA 3QGVA 3BLEA 1TWWA 2NUYA 1B31A 4NJJA 3W29A 1G69A 4A3YA 4JXCA 4O11A 4J3UA 5PTDA 2G5WA 1Q45A 3EXTA 3WUBA 3THQA 2WMIB 3WNKA 3WLTA 2NXIA 2Y6ZA 1EX1A 2AQVA 2X2GA 4NZ3A 3SRDA 3VIOA 2KX9A 1EF3A 1GQJA 4OOUA 1IIHA 4JTTA 3M0HA 4IGNA 2PDWA 4O15A 3GTXA 1RPXA 1MI3A 3LCIA 1CECA 2WVVA 3M0KA 3W84A 4CNTA 3M16A 5CBJA 1POKA 3LGDA 3AWNA 1SM9A 2DIKA 3O9NA 1EJXC 3PWIA 2GUBA 3ITVA 1ECQA 2D2JA 4FOUA 4CU8A 3NQBA 4UTTC 1LL6A 1YE4A 3EB3A 5H8UA 2PDUA 5BOFA 1OGGA 1UOZA 3TQKA 2ZXQA 4ROQA 4P7RA 1KLYA 3OTRA 1Z8AA 4A3UA 1ZSXA 4LRSA 3W7JA 2XFYA 3RLUA 2ZIDA 2DW7A 3ARPA 1TPWA 3TR2A 4ZVJA 3M0VA 2CW6A 3F1QA 3NL2A 3EPOA 2XHYA 1ZCOA 4PMUA 1WDPA 2PDNA 4Y9PA 1L0PA 5JUVA 4QP0A 4F9DA 2PRMA 3TE9A 1EJVC 3OODA 4MOZA 3GFZA 1HKVA 1JIBA 2OKTA 1A5NC 4KWOA 4KGJA 1JZ3A 4GZEA 4NRRA 4Q32A 1JULA 1ZALA 3UVAA 1VFMA 6ENLA 4YU1A 1DBTA 2FJUB 1TO3A 3WBAA 1XBXA 1YTDA 4NI8A 2XN0A 2QPSA 2DDXA 3WBEA 1K4HA 2F8QA 5CGMA 1UB3A 1NQKA 3DC0A 3TW7A 2GVEA 3IIOA 2V2HA 1I2QA 3KRBA 1BTCA 4K8EA 4CD5A 3B06A 1VF8A 5HJLA 4JFWA 3O0KA 1MNZA 4MWAE 3UJ2A 3EXSA 4NJGA 4P7NA 2D1ZA 1NFPA 5A2BA 3S6DA 4HD5A 3QOMA 5FAJA 1DYSA 2NVDA 4MYXA 4AG0A 4XZMX 3LRLA 3P0XA 3VUPA 4DI8A 3VOJA 4Q8OA 4FIRA 3DEQA 3AHYA 3MO7A 4A2SA 2QR6A 1VEOA 3T08A 1NDYA 5FI8A 1WV2A 2OYLA 5LIYX 1TTPA 4Q4RA 1QHOA 5H6HA 3C5QA 4K37A 1XG4A 1NELA 3M41A 1ZAJA 2QGYA 1UP3A 3OBAA 2BHZA 2NWSA 2FKPA 3DKJA 1V7AA 4IP5A 3H7VA 3IV3A 3Q58A 3DG6A 3TW6A 3VI2A 3CMFA 4HA1A 1W1PA 4HU0A 4YVXA 3H23A 1JUBA 3N73A 2VL4A 3APYA 4IL2A 1ML1A 4LAKA 1BEUA 1C7SA 2J7HA 3VD9A 2C79A 1KCZA 5I3KA 3OO2A 1LROA 2VUNA 3GW0A 3W2UA 1LRQA 1CXFA 2A7RA 5JU6A 2PEVA 1TJ0A 2WBGA 1FWEC 5CGTA 4WKAA 2PBOA 3BPWA 3R0DA 7ODCA 2X0YA 2IMRA 3FKKA 1ZP3A 1PBGA 1SJCA 2GQAA 4H8VA 4MHBA 4MB4A 2BMBA 3P8JA 3EB4A 5I3DA 1XYBA 4EANA 1LF1A 4EXAA 1QPRA 2H3DA 3INPA 4YTSA 1QO2A 2Z28A 3I10A 4CD7A 3R58A 1QI3A 4Z2GA 1XFCA 2J7FA 3MANA 2ZBTA 1H49A 3UWQA 4OBTA 2HXTA 3IJ7A 3R12A 4WX2A 1W5PA 1GGOA 3E0LA 1GHRA 4DPPA 3W1XA 2A21A 4GACA 3WQOA 4LUTB 5ABTA 2WKLA 3ITTA 1S5TA 2JKEA 3ME3A 3CB3A 1C93A 1BVWA 3GC2A 3P60A 3M5XA 3VKCA 5ECVA 1H7OA 3CTTA 3GR4A 2R24A 3ITXA 4NJIA 3CPRA 2CBIA 3FSTA 4ZQPA 2O4MA 1J10A 1XSIA 2TYSA 4J5NA 3ARRA 1A5LC 1OEPA 4R53A 1K9EA 3K1GA 3URAA 5F4XA 1ISWA 4OUEA 5IFTA 2HROA 2O92A 4QX4A 1KM3A 5CC3A 3CB8A 2DZBA 4AZIA 4MUZA 3AMLA 1TRDA 4DVOA 4LCQA 4E2OA 3LMYA 4Q4OA 3PSWA 4FNPA 3OLIA 3VNYA 4DNHA 4AISA 3M47A 5AZ0A 2DZSA 4MJ4A 1VENA 1XIIA 3ES8A 4WGHA 3DFQA 2DH3A 4IM4A 2QDGA 3B04A 2HZGA 4UR7A 3RF9A 2NQ5A 3R8HA 1XIBA 3UWVA 3U7BA 3P6LA 1XGDA 3USBA 4XTIA 5HMEA 3V3WA 4Z1DA 4I7VA 3WL1A 4XB3A 5CPSA 1J4EA 2VDIA 2Q8LA 3OVGA 2ESCA 4REQB 3WLSA 3GR8A 1O6IA 4XKYA 1TIWA 3TSBA 4LS0A 4F2UA 1UH4A 5AHLA 5A95A 5CPQA 3TTQA 1TMQA 4U2ZA 3URNA 4ZZ9A 2ZUUA 3HG5A 2QPXA 6XIMA 4JTLA 2YBVA 3VOGA 2H9AA 4PMYA 4QR6A 1LBFA 1ODZA 4ZOBA 4B5TA 2W9MA 2ZUSA 3H53A 2DW6A 3WDIA 4DZ5A 1EJUC 3NG3A 5A8QA 1ZUAX 3QBUA 5DT7A 2VURA 4M1BA 3A4XA 1XICA 2XU2A 1V51A 3F2CA 1XINA 4QROA 5AC5A 3OPSA 2GJXB 1LG2A 1ZU8A 3WLRA 1MYRA 3R6IA 2J8TA 4CVWA 4PYSA 2G4JA 4GVGA 1IQ8A 4C6MA 4M51A 1Q6OA 1JUKA 3AMGA 4WK9A 1LP6A 2FB3A 4O1FA 1O95A 3D46A 3QF0A 5FESA 4V33A 1GUVA 4CQCA 4W7WA 4MDPA 3CWNA 2ZTJA 2AKZA 2P8CA 4PTVA 4GVIA 1J01A 5AHFA 4PMVA 1OGBA 1E6NA 5HR6A 1DP0A 3CZEA 3CUFA 2QEZA 4O1AA 4RZ5A 4DPQA 3DFPA 2IKJA 5LXEA 3O3RA 1RY0A 3T0CA 4N6FA 2FHBA 3TTOA 3LPPA 3ZVHA 2VCCA 5ABFB 1RA0A 2DUZA 3MHGA 1W91A 1LTDA 3WK2A 3OYXA 3MYPA 1KM5A 1HW6A 4RZ4A 1FKWA 3OA3A 2CZ5A 1XCWA 3WBYA 3TNBA 1UMYA 1KLZA 3BGGA 4PRWA 1V7YA 3BZJA 2E6AA 4RX0A 4IPPA 3VIIA 1KR1A 1A5SA 2KAUC 3BAIA 3UWYA 2VGBA 3HFTA 3AMKA 3TZNA 2X05A 4FOKA 1QJWA 3MSRA 4HB7A 3C2YA 1XYLA 1KXQA 3OBKA 1WXJA 1J5SA 3W1NA 1SJAA 2DORA 3P0WA 3PBWA 1DORA 3GXFA 5HDRA 5C6MA 2ABAA 4ZGYA 4XZIA 1J11A 4N4PA 2VWSA 4H4IA 1MW0A 3RR4A 3SCWA 2PTXA 1YDNA 4NUWA 2JEQA 4OU1A 5HWJA 1TE6A 4IX2A 1BGGA 2QDHA 3NURA 4ES4A 1OX6A 1YE6A 3FFSA 2BG5A 1U33A 2RFGA 4D6FA 3AJ7A 3OZPA 1ZY9A 2V30A 4O0KA 3FHAA 3WQVA 4P7OA 2QZRA 3GNXA 3F03K 5DANA 3MHUA 5E70A 8XIMA 1EC7A 4ZR8A 1JEZA 4E2DA 1F05A 1JPMA 3FA3A 2IKIA 5HA7A 4E4UA 3TUUA 1KQYA 2RJGA 2Z29A 4EPKA 4DLFA 2CPUA 3BLKA 4X22A 1TSIA 4XAFA 1CNVA 5LNWA 4JTIA 4YTRA 4N9DA 4F0LA 1P48A 1ELSA 3WF4A 1OFEA 2CFFA 3UESA 3A22A 3W7MA 1AH3A 4RZ6A 5FF7A 1CBGA 1JYWA 1NP2A 3CXOA 5BU9A 3G1RA 4ZL1A 4AIOA 2VNCA 5CZKA 2AMGA 2NUXA 4KWSA 3WUEA 4LCSA 5C54A 1W3IA 5DBUA 3SM0A 1H5YA 4Y9AA 1ZRQA 2BB0A 4LEFA 4B16A 2OSWA 3QZ6A 3HPXA 3QMSA 3N6JA 4FNSA 1W8GA 3ZSSA 4KIEA 2GGGA 3PG8A 3WH8A 5E5CA 4XD4A 5HANA 3LM7A 2VC7A 5KZ6A 5MKGA 3BAXA 4NG3A 1IR1A 3HB9A 3IWPA 4A05A 1OVDA 4PL1A 2VVSA 3VX1A 1YPFA 2HNEA 5CSUA 3APTA 2DJLA 3PSVA 2E9LA 3FX4A 5AYXA 3N17A 4Q8PA 3N2TA 3PBVA 1A4LA 1A5UA 2WZEA 4IFKB 3AIRA 2QKFA 4UNIA 1JAKA 4O13A 2HK0A 3MMTA 5A6BA 4YN5A 3EX4A 2AKMA 2DEPA 4D6IA 3UQNA 4KEUA 3UBPC 3WF0A 3JU2A 3BLOA 3LCLA 3SEPA 3NQ6A 4HMCA 3SRKA 4EX4A 2RHGA 1FXQA 3N11A 3HG3A 3SW6A 1YIXA 4LB4A 3WD1A 2VDGA 2CXGA 2J75A 3K8MA 2A85A 4JFTA 3CUIA 4N9CA 1VC4A 1UWSA 4O28A 3LK6A 4PMOA 1C3FA 3A5FA 1GOIA 4WY0F 1JGIA 1SO6A 4QGCA 3V0UA 1FCBA 3GR7A 1EIBA 2E6DA 3Q94A 2ZUNA 4OJYA 3A23A 4GZJA 1TUFA 5HMDA 3A3XA 3TLQA 4LB3A 3UGVA 3R43A 3WLOA 3CU2A 1S1PA 1TA3B 3G1SA 4HYWA 4MY8A 3UG3A 4G7EA 4WJ8A 3NQ2A 1XP3A 2YB1A 3QC3A 1UZHA 1ZNNA 3FW6A 1NY1A 2IPJA 5K9CA 4WVXA 4I90A 1K9FA 2VD9A 3GAKA 1HKMA 1B9ZA 3TC7A 4LVGA 1KGUA 1K3UA 3PUDA 3TU9A 2YX0A 4FLSA 4UQCA 4XZ9A 3MYOA 5HBFA 1JZ5A 4XIAA 1FTXA 2OLAA 3I4KA 3MCNA 4C90A 3AIVA 1V79A 4DZIA 3WIJA 3TFXA 2A7NA 5I3GA 2F6KA 4LQ1A 4IJCA 3KBWA 1B9BA 1WXZA 1M68A 2ZUVA 5T9CE 3SGZA 1FWBC 3N14A 4OIFA 1DIOA 1S2TA 4O57A 2PLCA 4JDYA 4ICNA 4HGXA 4TU1A 2BOEX 3PFMA 4X60A 4UFIA 1RVKA 2WW5A 2EJ1A 3S1WA 3W1RA 1I2NA 4DELA 2LLEA 3GAYA 4ZO7A 1DQXA 2BS9A 2A1YA 3SADA 3POCA 1EDTA 2C7FA 2XG9A 5CJ5A 4JX4A 4W9TA 3NQVA 4DXVA 4FSAA 4QG8A 2ZZ7A 3OB8A 2UZ9A 4EVZA 3G1HA 4N4QA 5K2ZA 5EMYA 4R27A 4S39A 3IGXA 4MGGA 4NY2A 4S3KA 4PEEA 5GVJA 2FH8A 3S2JA 3SAZA 4PE8A 3W2LA 3W25A 1TPC1 2WK2A 1BXBA 1H1YA 4MNJA 2PTYA 5IBXC 4G7FA 3KEHA 3OEXA 1TV5A 4AAJA 2VFGA 3LV6A 5D2YA 3EOOA 4ERGA 1VS1A 3ARUA 1G94A 4DWSA 1MQRA 3UG4A 1ZBWA 4PRRA 6TAAA 3DGBA 3RO8A 4B3ZA 4RK8A 1TX0A 4FMVA 4IIFA 1W9BM 1S3TC 1YX1A 2BHUA 4W86A 3KTXA 1XR2A 1P0KA 2POZA 1R3WA 1MDLA 2CLIA 4JCMA 4IMFA 5I3HA 1T5AA 1W9DM 5K9XA 2WOQA 3HIJA 2ZTKA 3MW7A 4DRSA 2HE5A 3MUY1 4LAUA 1LUCA 2ZRZA 4WY0B 4M8UA 1XH0A 3BGJA 2W5FA 3GC4A 1Q13A 1VPQA 2I7GA 1FA2A 1B2YA 2P8BA 3M0LA 3QTGA 3B0XA 4NAFB 1GOQA 5DXXA 1DXFA 4P8UA 2NUWA 4C1NA 3GQYA 4GZ7A 1RBOB 3SO7A 4ZMGA 3ARWA 1D3CA 3CUJA 2ZCGA 2OZ3A 3CZGA 2F2HA 3L21A 1Y65A 2Z00A 4JTKA 1A3HA 3B8DA 2QCDB 2WZHA 2XM2A 3H2CA 4N02A 1E6RA 1BQCA 1HGWA 1A5BA 1VEMA 1UG6A 1KFKA 2I5GA 4RDWA 1CPUA 3LCFA 2JFEX 3BARA 4LT9A 3VKBA 4Y9NA 3SCPA 1NDVA 3SQMA 4O8RA 3G1XA 1YKWA 2OQLA 3NPVA 1XJBA 3MV11 5FJRA 2XSXA 1E70M 4TX9A 1Q2RA 3DIPA 1RP8A 3VIFA 4QXIA 2OLSA 3JRKA 4AWUA 1DE6A 4J3WA 2ZVIA 2P76A 2QUMA 4CD4A 1KB3A 1OC6A 1XLJA 4MNMA 6REQB 4POCA 3USZA 1NDZA 1YPXA 1MZHA 4JTGA 3BSMA 3S46A 3PP7A 5TF0A 2UWFA 4GGHA 3K4AA 1BYBA 4LAOA 1GKRA 3U7VA 4KFPA 4ADUA 1EC9A 4DO7A 4DUXA 2PWVA 4HN8A 3TH6A 3F5JA 3UP8A 5KZMA 1OBAA 4TTUA 4K7YA 4UFLA 4ACYA 4IUGA 1PDYA 1ADOA 3B4YA 4MWAA 2J88A 3N2XA 4HOXA 4AEOA 1H63A 3T2OA 3IANA 1MUMA 1OT1A 1NU5A 2VFFA 4OZOA 2IQTA 1L6YA 4BF5A 1LOSA 1KNWA 4NZ5A 1E0XA 1H50A 4XSMA 5EMKA 3WQPA 4NNAA 4XD5A 5A6SA 4ZQMA 1E71M 1W1IE 2MANA 2WAGA 4EF9A 3AZTA 4H2HA 2D0GA 3PC0A 4HMDA 1ZCCA 3R94A 1PCWA 1WDWA 1SQ7A 4XO6A 5DXYA 1F6KA 1A5OC 1FCQA 3KLKA 4RL3A 3N15A 2Y89A 2CESA 2DVTA 4L9XA 4LPCA 1EUNA 2ON3A 4OBRA 2BZNA 3IJ8A 1VRXA 4QLLA 3LTSA 4MSSA 2I16A 4JOMA 4JEJA 4TR9A 3G3DA 1V08A 1ALDA 4IPLA 2GGEA 2FGBA 1H51A 2WMKA 1S1RA 1S5VA 5D8WA 3AO0A 4UTWA 3VX0A 4R9XA 1HUVA 1F3XA 2ADAA 3QSRA 4MJMA 1IT0A 4PBGA 3MP4A 1S3HA 3KP1A 2HBVA 5JMUA 3O0FA 2CLOA 4HTYA 3NO5A 1B3VA 3WD0A 3VMPA 3LRMA 4WR3A 3WMCA 1OC5A 1SJDA 3TX9A 2HSAA 4F2TA 3UD6A 2DT1A 5LA0A 4IMDA 1OGSA 2B0MA 1P6CA 5F4WA 4QQ3A 1TVNA 5BXPA 1EGMA 3W88A 4DJDD 5T9BG 5LKYA 3SCOA 2ZZ5A 1PV8A 3SBFA 2ZXAA 3O1NA 1E40A 4L56A 2NQLA 4D8ZA 4AMAA 4HMNA 1JGMA 4A22A 4PTMA 1ISZA 3L0GA 3V1HA 3S5SA 4BS0A 3MU7A 3VE7A 5LZLA 5GJNA 3G2GA 3L4XA 3NR0A 3STCA 3O16A 3LHZA 3WX7A 1K7XA 5F2LA 1JCLA 2H8ZA 3BAKA 4MKSA 4QIUA 1EX5A 2VFIA 3W7HA 3PJWA 3BW4A 4BEQA 1RJQA 2GGJA 3SN1A 3E9AA 1U83A 3B9OA 1J18A 2XH4A 1L6GA 4L4LA 4NZFA 5GNXA 2PD5A 5BU6A 4DO4A 4CUCA 3BZGA 2TRSA 3GDKA 1L9WA 1R9ZA 5K3VA 4AVOA 1PDZA 3WDQA 3N2OA 2WNQA 3CC1A 1P0BA 2E68A 4P61A 3TSDA 2GZXA 4KF1A 1K02A 4GUGA 3N3TA 2OZ0A 1QBAA 1WE5A 1O1HA 4XAZA 4UQBA 2QVNA 3EB2A 4OE7A 3CJPA 2ISFA 3LZ5A 3L2MA 1RA5A 4JN8A 4FX8A 2G37A 4HPHA 3UXIA 3B03A 4UOZA 4C6DA 3W7CA 3SY5A 3FV9A 3TWAA 4L6HA 4LC6A 1LYXA 2RDWA 3PB2A 4IIHA 4AD3A 1FH8A 1JYNA 3P80A 3WH6A 6XIAA 1PX4A 2BODX 1E9ZB 1PZ2A 1GQLA 3F4NA 1KRBC 3AAMA 4X3ZA 3DESA 4LH8A 1ZJHA 3HN3A 3OGSA 1UP2A 2XWDA 1X1ZA 3LA4A 3W26A 1LRNA 1EEXA 1Y0EA 4UTMA 2UBPC 1J79A 1P43A 1M65A 4IIBA 3K8KA 3M46A 1JDFA 1TRIA 4HHLA 4PBEA 1L6FA 2YW3A 2R82A 1MDRA 4D1JA 5FF4A 2WYSA 3QV6A 2OQYA 1KW1A 3VPLA 5IDIA 1VBHA 2WZTA 3PULA 3AYTA 2J9XA 3TQ0A 4I9AA 3DFTA 1J12A 4BWLA 4C5ZA 3BG3A 2IKHA 1HKKA 2TAAA 3VD7A 4O0ZA 4QCEA 1VRDA 2VZOA 4GD0A 1UJPA 5F2IA 3MJMA 1S5WA 1VJIA 4M29A 4IP7A 2R1MA 2ALRA 2G8ZA 4HZ7A 3W6LA 2JIWA 3SGUA 1R86A 3NSNA 2OEKA 4US5D 3WLHA 4AF0A 2P1FA 4L64A 3RX4A 3PB0A 4O8AA 1CB2A 3ECQA 4CCDA 4U10A 2FZDA 2FZ9A 3Q2DA 4EPDC 4PTNA 1YW1A 2R1PA 3GVVA 3VFLA 3U2ZA 4CN1A 1XYFA 3AOFA 1PSCA 1SZFA 1ZHAA 1QDSA 1E4MM 4LEQA 3ARQA 4E4PA 2NX9A 1KV8A 3FYYA 1BD0A 1V6XA 1UD5A 4DF1A 3S5OA 4X0NA 3VDGA 4QQUA 2QJJA 3PK7A 3W37A 4UZUA 2H8XA 1TWIA 1NARA 2EF9A 2P5NA 3SJ3A 4IQLA 1TWSA 1XS2A 5AHEA 3O6DA 3LEPA 1K9DA 2E28A 2FPYA 3FSUA 4PCFA 5DFAA 5LA1A 1FCVA 3URQA 4ADTA 1VFOA 1RVGA 3U4AA 1QASA 4RE2A 1N82A 3W71A 1Q65A 3OW1A 2PE4A 4V15A 1VYRA 2O7QA 1P7TA 4HMEA 4LV4A 3PNZA 3BVJA 3RM8A 3FKRA 3MWCA 1BQGA 3KOXA 2OPJA 4BEUA 1JF6A 4UOJA 1SGJA 3E2RA 3ZQ9A 2ZZ6A 1FQ0A 3FAWA 2QCNA 2GJLA 3U2CA 2YJQA 3O15A 1E1CB 1OCQA 3CZLA 1TWDA 4ZBCA 2FTPA 1FWJC 3DKLA 4EF8A 1FX6A 3WLNA 4CU6A 1LG1A 2B7PA 1O5QA 3PUEA 4WUIA 4PULA 2IXVA 3W38A 5LGZA 2PGEA 1C9WA 1DQUA 1MUWA 1NFBA 4F0KA 1H3GA 3N04A 1Q6LA 3VNLA 4YYFA 1WAWA 4PTXA 1TV7A 3P61A 4OUIA 3QZAA 1GEQA 1JJKA 2R94A 5I06A 5D9NA 3UNTA 4Z2HA 2NV2A 5B7ZA 1WX0A 1W9PA 2DVUA 2W27A 3W07A 4ECLA 2PDPA 3SZ8A 4AU0A 4H8NA 4E3VA 4O4VA 3W70A 7REQB 2NX1A 3IS4A 2ZWYA 2CZEA 5BXSA 1SJBA 4HHPA 1LWIA 3B0YA 3FDGA 5XIAA 3UR5A 5G2HA 2QPUA 2YCLB 3MCMA 1JPIA 1JXJA 1EH9A 1S2WA 3GIQA 5FJPA 1T99A 3M64A 3CASA 1B54A 1N8IA 3UCDA 2VCBA 5LIXX 3H4WA 4UTUA 1PHQA 3VNJA 5DMLA 3U2EA 1R9YA 3P74A 4Y2WA 4F0HA 4K3ZA 3BWWA 4GYPA 4KPLA 2XSBA 3HJZA 3TAOA 2PWFA 5AHMA 3IVTA 3G6LA 4RDYA 4HPXA 4JIRA 1ONWA 3N6HA 3GKAA 5BXTA 3G1FA 4LVFA 1GW9A 1XDJA 4ZO9A 5A6KA 4HP5A 5CC5A 2XM1A 4NL1A 1A3WA 1XF0A 1MVYA 4GUFA 2WHMA 1DQWA 2WMIA 5K7JA 5CPNA 2PURA 4PBFA 1F73A 4S3GA 2PC4A 3ZLFA 2WQPA 4LFYA 2V3GA 4M82A 1DIEA 5D33A 4UMAA 1Q2SA 1H60A 1LT7A 4HNOA 4GNJA 1PIFA 1F9CA 3LLXA 1K70A 4XBKA 3BE7A 4DN1A 5AECA 2QQ6A 2QS8A 3VZXA 5LGXA 3NQCA 2DGAA 1BF2A 1RUSA 4QE4A 3FJ6A 1EJWC 3L4UA 4AHOA 2UY5A 1JI2A 2VWTA 1B1YA 4NX0A 3AS0A 2HPMA 4NJHA 1U5VA 2GVGA 4AB4A 1V3JA 4H7ZA 1GJWA 3EA1A 1UYQA 1H41A 3FLUA 1KWGA 3UR7A 3P62A 2C1HA 4F3HA 2Y5JA 3TN4A 2QIIA 2CWNA 3HV9A 3I7QA 4UCFA 4ZO6A 3GUWA 4N9EA 2Y7DA 5EMLA 3G1YA 1NP0A 3VDAA 6A3HA 3HGOA 4MAZA 2W3ZA 4XWUA 4DAIA 2Q71A 1V0KA 3U6WA 4EE9A 3CT2A 3AXMA 4GQGA 4F0RA 1T7LA 1XBZA 1P0DA 3WLMA 1DJGA 1BPLB 4L1XA 2NVAA 4V1XA 4C6QA 1OZMA 4M6UA 5CAKA 1W3TA 2DT2A 4HPNA 3F5KA 5FEZA 1V02E 1LM1A 4EXQA 2IPWA 1E4IA 1MXSA 4BJHA 1WKDA 2J7EA 1E0VA 3IAPA 3QKZA 1CXHA 2ZX6A 5FA5A 1GNXA 4W8BA 3L7RA 1EBGA 4TVUA 4GYJA 2V5BA 2YA0A 4A8NA 5BZAA 1QI5A 2FMNA 3RPTA 2DT0A 4KW2A 3WBXA 4X9YA 3CUZA 3SB0A 4HOWA 1TTJA 3RITA 3VC5A 1VCGA 1AJZA 1WZKA 1YHTA 2OYMA 4PCNA 5HWNA 1MEIA 2OU4A 4PR4A 3PZTA 3SCNA 1R9XA 2A79A 4MZ8A 4UB9A 3O6YX 4U2YA 5BROA 2EXOA 5BWFA 2YXOA 1RHCA 1A0EA 5FEWA 4F48A 2E4TA 1EZWA 1ZBKA 3H21A 1O66A 1QK0A 3TYZA 4BY3A 1B3ZA 3L0KA 3PPHA 5D8ZA 4JX6A 1GVFA 4L80A 4URIA 4BI7A 1T41A 4LCRA 3QV8A 2V5KA 1WDSA 2X7WA 3BDKA 1J2BA 1CENA 1OM0A 3PS7A 2A2IA 3EEZA 3ITYA 1REQA 5EBAA 2Z0IA 4E8CA 4X61A 3QPZA 4JTHA 4KQNA 3AU2A 3G1VA 1AFSA 5CPTA 2VCAA 1VFHA 1ZP4A 4EKJA 2FPVA 2D2GA 1R3TA 2FQIA 3O07A 4MZYA 3GU9A 5JXQA 1R7OA 3DFHA 3WELA 1AH4A 1XLBA 3EWYA 1CW2A 1TZZA 3ES7A 3FY1A 1QHZA 1JD7A 3AUJA 3GDLA 3VA8A 3NQGA 4HK6A 2PUZA 3SIZA 3RM9A 5FJUA 3CH9A 5G2IA 4WCJA 5ABHA 3PFRA 2WM1A 4MFDA 1WDDA 3OQ8A 2Z1BA 4IG2A 7A3HA 3B9AA 1UR4A 2E40A 5CC7A 8CGTA 2Y8UA 3W7RA 5AC6A 5EFDA 3EWUA 3IVUA 1P0NA 2XVLA 1JCTA 4S3FA 3BOFA 4AY7A 3W74A 2Z26A 4D6JA 5EFFA 4RNFA 4WXZA 1V6VA 2R6OA 3VNDA 4JFVA 4NNBA 3VGEA 4PUJA 4INFA 1QK2A 3FVDA 4LC8A 3M0IA 5E93A 5REQB 5C9XA 4LUTA 3DENA 1OG0A 2VENA 3T09A 1NOFA 3NL6A 1MRAA 3GU1A 4XQ6A 1QI2A 1DXIA 3TCEA 3MZNA 1X6NA 2WV8A 4EK7A 3KCOA 2QUUA 2Z6IA 1T6MA 1NIUA 3KRUA 2CYGA 3FJ4A 4MZ1A 4CU7A 1W31A 3KL0A 3LCHA 4DBUA 3LXCA 2WJFA 2GGHA 5I77A 1Z7AA 4U31A 3K2GA 3H7RA 4KS0A 1A4MA 3W85A 4O12A 3VAVA 1VH7A 3S2MA 3W1AA 1BXCA 3GXIA 4M0XA 5CC6A 5BMWA 1GPWA 1T0OA 4HNCA 2RGMA 1PX8A 5C7HA 3SR7A 3QMTA 5T26A 4M81A 5FF3A 5TQLA 2C1GA 1KC7A 4L9YA 4H6RA 1G4PA 1TPH1 4JS3A 2PP1A 4HHHA 3PWAA 3U8GA 1RD6A 4JBRA 3TOYA 1MUCA 2WMHA 1TG7A 3NTYA 1G0CA 4M24A 3WQDA 2PPGA 4PFHA 5BW6A 2P53A 3GDRA 1KM1A 3M0MA 3MUCA 4BQ2A 2AQOA 4M7TA 4KT2A 3B3DA 1SUXA 3AQUA 4REQA 1QI0A 3B40A 3KDOA 3WQEA 3THDA 2YKKA 4M3PA 3NSXA 4AZCB 3OLDA 4D72A 2D2HA 1ME8A 3CQKA 1JDDA 1V0NA 3IJ9A 3W73A 3W2MA 2ZVRA