4AD1A

Structure of the gh99 endo-alpha-mannosidase from bacteroides xylanisolvens
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
349
structure length
349
Chain Sequence
NNLGTELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Mechanistic Insight Into N-Glycan Processing by Endo-Alpha-Mannosidase.
pubmed doi rcsb
source organism Bacteroides xylanisolvens
molecule tags Hydrolase
molecule keywords GLYCOSYL HYDROLASE FAMILY 71
total genus 128
structure length 349
sequence length 349
ec nomenclature ec 3.2.1.130: Glycoprotein endo-alpha-1,2-mannosidase.
pdb deposition date 2011-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ad1A00
1W9XA 3CZLA 3CPUA 4TVDA 3WDQA 3SCWA 3TTYA 2GUYA 1A3HA 3MMUA 1A47A 2WVVA 3VIJA 4AIEA 4W5UA 4QP0A 2V5CA 2X09A 1E6NA 1M7XA 3T2OA 3AMDA 4GO8A 4D71A 3DC0A 1VJSA 3EYPA 3W37A 5A6AA 1WAWA 5IHSA 1DWGM 3EDEA 3TA9A 5I6SA 2WWCA 4TTGA 3T0AA 2BVTA 3AQUA 1BPLB 2QLYA 4JIEA 1HNYA 1UYQA 2WBGA 5CPQA 2G4FA 1XH1A 5D9PA 3SEPA 4W85A 1DWJM 5ABEA 1E6PA 3OGSA 4Q7NA 3WNLA 1NWUA 1BYAA 2XGBA 3SCTA 1VJZA 3WDPP 4C7FA 4JKKA 4M1RA 4TX8A 1J0HA 2ZUUA 3KL0A 2WLYA 1V6XA 1E4MM 2VVSA 1OB0A 1UWTA 1ITCA 1MWOA 1GOOA 1H11A 2RGLA 1JAEA 1QVBA 1B3XA 1VFOA 3K46A 5TD4A 2TAAA 3NYDA 3VIIA 1HKMA 1Q6FA 3AXIA 5M5DA 3WBEA 2NSXA 1E6SM 3KE0A 1H1NA 2WZIA 1E9LA 5JBFA 4EE9A 1JYNA 1W2PA 2BY3A 2EPLX 1HKKA 2WHMA 3UERA 3VDCA 2GJRA 1ZU8A 5LA0A 2DT2A 4AWEA 1E1EA 4KRTA 3CUIA 5CPTA 1G1YA 1JZ2A 4GZJA 3MU7A 4URIA 5ABFB 2X0HA 1F4HA 2FGZA 3A47A 4KMQA 2JE8A 4JHOA 1PJ9A 2W4XA 3MMDA 1C8YA 2XFYA 1ISYA 4CN6A 4D6IA 4CD5A 1NH6A 2F8QA 3KWXA 2PWDA 5BROA 4QAWA 4MPKA 2J7FA 3TTSA 1WB0A 1JD9A 1TA3A 4GQQA 4HA1A 1BVNP 2ZX6A 5I2UA 4E8CA 4MJ2A 2C8NA 1UH2A 5IHRA 2EBNA 4PCSA 4X0VA 1CXEA 1LG1A 1OINA 2AMGA 2PWGA 3AHTA 1K9TA 4WSJA 3AISA 4M8UA 1UWQA 2ZUNA 5HPOA 2ZWZA 3SCVA 1GVIA 3MANA 2ZXDA 3MUZ1 3VIGA 3F4VA 3VD9A 5IFPA 1GVYA 4M82A 3CGTA 1KR0A 1TE1A 1UWRA 2W62A 3WH8A 5JUVA 2WHKA 3L4VA 4YPJA 3VGBA 1OGGA 2PWFA 4W7WA 1K9EA 2DIJA 4Z2LA 2WHJA 1MYRA 2BXYA 1QPKA 2OYKA 3FW6A 1KBKA 3NJ3A 4PUEA 4V27A 2WANA 3L4ZA 3AIQA 4H8UA 4PMRA 1FA2A 2BNJA 5D9OA 1Q6DA 3RDKA 1SFSA 1W1PA 3OLDA 3VU2A 2WVVB 2D1ZA 4D6DA 2ZUWA 3VD5A 1JAKA 4HZ7A 4E2OA 1UHVA 1PX8A 3L4TA 4HTYA 4V2XA 2VRQA 4IPNB 3VGHA 3DYOA 3GNPA 5BYWA 1BSIA 1VB9A 1RD6A 4TX6A 3UG3A 3EDKA 3ARUA 3AICA 4BA0A 1MQPA 1V0MA 1WCGA 2D0HA 3W27A 4LQ1A 4PTXA 3LPPA 1D7FA 4GO9A 4M29A 1E73M 1FH8A 1E3XA 1WZKA 4AZHA 1C3FA 1CEOA 3T09A 4CN4A 5BXTA 1DWIM 3OA5A 3W28A 3WKZA 2FH8A 4MADA 1Q6EA 4MAVA 3PTMA 4UOZA 1E4LA 4DWSD 3QR3A 1AQHA 4JFVA 3TTOA 2Z1SA 2J75A 4GZEA 5D8ZA 3M07A 1CBGA 1GPFA 2JIWA 3E1F1 1GOWA 1B3ZA 1OBAA 4HP5A 2A3HA 4W8BA 4HMDA 2O92A 5E09A 3B9AA 1NQ6A 1GZJA 1V02A 2IXUA 4ZXOA 5AYBA 1UR8A 4ACZA 3W81A 4ACZB 2WLZA 4H7VA 4FLQA 2AAAA 4GXPA 1BYDA 1J0KA 1JL8A 2QF8A 3IJ9A 2QMKA 2E3ZA 2PI6A 1JI2A 2YLLA 3QHNA 3SCUA 4JFTA 4AZCA 1PIFA 1CGYA 1ZJAA 1AVAA 4KGJA 1GOQA 2PF0A 3OB8A 3ZSSA 5A8QA 1UR9A 3F5JA 3SUUA 1OT2A 2V3DA 3PZMA 1VBUA 1NOUA 4B9YA 4U5KA 3CZKA 3HJEA 2YA0A 3OLGA 4PUDA 4PYSA 3SCSA 5A94A 3AROA 3BAKA 1JNDA 4A3HA 1OD0A 4H2CA 3AYRA 1R7OA 2VCAA 1IT0A 2D23A 4UFHA 1QI4A 2O9OA 3W25A 1V6WA 3CMJA 2WMHA 5I5RA 2A3BA 3VO0A 1UA3A 2XIIA 3AHYA 2C0HA 2CERA 3AHXA 4NZCA 1ZBKA 3VM5A 1EO5A 1E15A 1BTCA 1XC6A 2WVSA 1V0LA 3OIHA 2CHOA 5CPSA 1XSJA 3VX0A 5M03A 2WVTA 1PZ2A 3B9DA 1BF2A 1ZJBA 7CGTA 2XVNA 1V03A 4PSPA 3VNYA 2BY0A 3WL1A 3WUBA 3EBVA 1EQCA 1G9HA 3DHUA 2VQUA 2EEXA 3F5LA 3WDHA 4LXFA 4UOQA 4QFUA 1QW8A 2W91A 4W8LA 3AMKA 3WDIA 3WUGA 1WP6A 3VTRA 5IXEA 2EPMX 3T0DA 4AISA 2E4TA 4E4PA 5FL0A 1W9PA 4PCTA 3CUHA 4UFJA 2GFTA 1UD8A 4HPGA 3W6LA 1X1NA 4PBGA 3VGEA 3QGVA 1R8LA 2BHYA 3CZJA 2J7DA 4J3UA 5AYIA 4W7UA 5BCAA 2E9MA 2WMKA 2CCRA 1FP8A 1GHRA 3CHDA 1QI3A 4W88A 4Z2GA 4GIAA 4RE4A 2WMGA 1GJUA 2XFFA 2G8ZA 1CNVA 4YHGA 2OWXA 2ZX7A 2OYLA 2CKRA 3UCQA 4BQ2A 1CXHA 4PMQA 2D3NA 1QHPA 1JZ8A 3U5YA 1LLOA 4MB5A 5E9AA 1DHKA 3BAJA 3W29A 2GJXA 4WIWA 1HP5A 1E0XA 3WFZA 3GDBA 2QPSA 3AIEA 1XD0A 4U2ZA 2CETA 4CVWA 2Y5EA 1UUQA 2XVGA 5HXMA 1JFHA 1K9DA 4CU6A 3MMWA 4Z2HA 5BXSA 4KH2A 1NWTA 3GH5A 4AZ5A 3GBDA 4PMZA 2FDMA 3K8KA 1WZLA 2ESCA 2YBUA 4LPCA 2VR5A 3AZTA 4S3KA 1LWHA 1FHDA 5AY7A 1MW3A 2X2YA 3ZR6A 5FKYA 1HKIA 2ZOXA 4JKLA 2ZUSA 4V28A 5E6ZA 1V0KA 3UETA 3EDFA 1D3CA 4N42A 1U30A 3S2CA 1KB3A 2RGMA 1OT1A 1CXKA 1P6WA 2CBVA 1E6ZA 1EDGA 4W5ZA 6A3HA 2VOTA 3GH7A 1DEDA 2Y8VA 4XV0A 1M03A 1JXJA 1I1WA 2F61A 2VZUA 3WQ4A 2WKLA 1EOKA 2EJ1A 1IZJA 2VZVA 4H41A 4MNMA 1W3KA 3VD7A 4MTVA 1R87A 4CD8A 4CU8A 2G3MA 1KCKA 4C7GA 5HOSA 1HJXA 3WD3A 3CLWA 1LL4A 4DWSB 5HNNA 2VJXA 3NSNA 3ZJ7A 3ALFA 5LA1A 1UD3A 3BAWA 5D8WA 3RILA 3ARYA 4DM2A 5FD0A 3K8MA 3T2QA 1PPIA 3ZJ6A 1R7AA 4PMUA 4UZSA 3VILA 1B3WA 1H41A 4MAZA 3NUKA 3VDHA 2VX7A 2DT0A 4MB3A 3AXXA 3VD3A 2AOSA 3WDJA 1UR4A 4BZYA 2ZUTA 4MNKA 4X9YA 3WIJA 4JHZA 3AI0A 3VGDA 3RJXA 4NSBA 2WXDM 1RP9A 4F9DA 2OYMA 4EANA 3FHQA 4W87A 1GQLA 4PMXA 2GK1A 1M01A 5GNXA 5F7UA 5M3WA 2DIEA 1VAHA 1JZ5A 3A6OA 2WMIA 5EMYA 1GNXA 1W1TA 3NDZA 3NSXA 4M81A 5CQ1A 4PMOA 3HU7A 3VPLA 1E70M 3N9KA 1EQPA 4AC1X 1ECEA 1GOMA 4D1JA 4FF5A 3BLKA 1BHGA 1MVYA 4PRWA 4J28A 1XD1A 1E55A 1TVNA 3AXHA 1ZBWA 5LYRA 3WD1A 5DO8A 2VL4A 1NM9A 3EDJA 4AD1A 1US2A 4LGXA 1V08A 1B2YA 2VI0A 1KGWA 2ZICA 4U33A 2GDUA 4HU0A 2VCCA 1MW2A 3VIMA 2ZIDA 4FLRA 4JFWA 4LX4A 1K6AA 1J9YA 2ZUVA 3A3HA 3EMZA 1H0IA 2G41A 4B3KA 4AIOA 1CGVA 2BY2A 5C70A 5A2BA 2J7BA 3W4RA 4PTMA 2CNCA 2JIEA 3CZ8A 2XSBA 2JALA 5DT5A 5ABFA 2E8ZA 3FXYA 2WC7A 2BY1A 4IISA 3KEHA 3CBWA 1WDQA 1VENA 1D2KA 3EMQA 1EHAA 4ZENA 4F66A 3OLIA 4UQBA 1MQQA 2VZTA 3UEQA 4OOZA 2PBGA 1HJVA 3CUGA 4XZBA 2YLAA 2XM1A 3WD4A 2ZE0A 3ARZA 4P7RA 2E9BA 1C7TA 1UD4A 4IUGA 1FP9A 2EPKX 1BQCA 4ZXLA 4X0NA 3BMVA 8A3HA 1QNSA 3O9NA 1UD2A 4P7LA 2DQXA 3AHZA 4J3SA 2PWEA 1JFXA 1KR1A 1JF5A 2DT1A 3SCNA 2Y24A 5A8OA 2YOCA 3SURA 4D72A 1UH4A 2NT1A 2OWCA 3DHPA 3W6MA 2FHCA 2VC9A 1E0WA 2EPNA 4CGTA 5A6BA 4QCEA 1GONA 2J7EA 1XH2A 4AXNA 1UKQA 1XV8A 1E6XM 2VRJA 1CECA 2Q8XA 4MB1A 4MDOA 2FHBA 4PMVA 1KGUA 1C92A 1HX0A 1QHZA 1BFNA 2V38A 4TTUA 1B30A 3MUIA 2YBTA 3DYPA 1F4AA 1EXPA 5ABGA 1CLVA 1GJWA 4KGLA 2CPUA 3OZPA 4GZIA 4UZUA 1E6RA 3K1DA 4ZFMA 2X0YA 3T0BA 1HL8A 1GORA 1JI1A 2BFGA 2DPEA 4RE2A 4OUEA 4N0RA 2D3LA 1BYBA 3BAYA 1DWHM 1GHSA 3THDA 3UG4A 2WZHA 1UKSA 3GYCA 1OIMA 3ZOAA 4AEEA 3PN8A 1ISZA 3ARRA 4JFSA 2VZSA 1V02E 1BLIA 1EH9A 2VURA 1LF1A 3AZSA 3IAQA 5E6YA 4DWSC 1CWYA 4H8VA 4U31A 5DT7A 2VCBA 3WNKA 4UFLA 3SUVA 1Q6CA 3CTTA 3PZ9A 4UQEA 1NWRA 1VFFA 3ARQA 5GQBA 3WQ6A 5C71A 5M17A 1DTUA 4H8HA 7A3HA 4W7VA 2JEQA 2GJPA 1VFMA 1XCXA 2B31A 1KBBA 4GI9A 1C90A 3K8LA 3AS0A 2UY3A 3MS8A 1VBRA 3VKKA 2XVPA 1XCWA 4UR9A 3AMLA 2X05A 4YHEA 2BS9A 1CIUA 3FY1A 4OKDA 1JZ7A 1J0JA 3ZJKA 1UG6A 5ECUA 4OIFA 2E8YA 1QI5A 3M6DA 1HT6A 5A6KA 3LPFA 1V6UA 1K9FA 1H09A 1HVXA 1X6LA 4NF7A 2WAGA 4P7QA 5JBEA 2W63A 4BQ5A 1O7AA 4CCDA 1HKJA 4Z2JA 3D5HA 4D6HA 3AIVA 2WHLA 1US3A 4JKMA 2ZX9A 3IAPA 2WWDA 1IZKA 4U3AA 1M04A 1TG7A 5CLTA 3WFLA 3ARWA 3MUAA 2VVNA 1NP2A 3B9EA 2HVMA 2XPKA 3SUSA 3ZT7A 5BXPA 2W61A 3RM9A 2X1IA 1GQJA 1KCLA 1YHTA 1WZMA 4CN1A 1J0IA 1UKPA 1BG9A 3W38A 2JEPA 1JYVA 4KWUA 2XTKA 2CYGA 2VX6A 1B90A 1VFUA 4ATDA 3OZOA 1FOBA 1HJQA 2DSKA 2FHFA 4JCLA 3VIHA 1JXKA 1CGWA 1PZ3A 4OOUA 1R85A 3N17A 2VX4A 2UY4A 1HVQA 3ARXA 5D9MA 3WY1A 2IXVA 3ZQ9A 2J74A 1CXIA 1GCYA 3VIFA 4GPNA 3W53A 3ZMRA 2YJQA 1B1YA 4Y7EA 1B9ZA 2XVLA 5DEZA 4Q22A 5I23A 1J01A 4J3TA 1QNOA 4AZBA 1C7SA 2WK2A 2ZX8A 3N12A 1E0VA 3L4YA 2V3FA 1W3HA 3BLPX 3A4XA 3OLEA 1UD6A 3EMCA 3WF0A 1MQRA 2BVYA 1JDAA 2IUZA 2BV9A 4GINA 3TP4A 3SCPA 3GXMA 3BAXA 3L4XA 1MFUA 1ODUA 4MNJA 4W93A 2CESA 3CZGA 1I1XA 3W26A 1E72M 2W67A 1QNRA 5BRPA 1UWUA 2DDXA 4UFKA 1ZB5A 3N13A 4M80A 4W84A 4FMVA 3GXIA 2YIHA 1WZAA 4K68A 3T2PA 1C8XA 4HPHA 1KXTA 4AD0A 3VD4A 1HP4A 3DYMA 3NIYA 3AMGA 1I75A 2DH3A 2HISA 1HJUA 3BCDA 3POHA 3OGRA 1ZS2A 2J8FA 1KXVA 1E40A 2J8GA 4GI8A 5A6LA 3L4UA 4EK7A 1U2YA 5JIPA 1ZBCA 1BAGA 1H4PA 8CGTA 3CHEA 2ZWYA 3U7BA 4IPLA 3GBEA 4D6GA 1IV8A 3F5KA 1TZ7A 1XGZA 5CGTA 1OSEA 3WL0A 3ECQA 4J3XA 3CHFA 1FH7A 3WQ8A 5A2CA 2V3EA 2UY2A 3WUEA 1E56A 1QW9A 3WNOA 2F2HA 3VDBA 1XHGA 2WNWA 3TTQA 5I78A 3ZIZA 2VTFA 5A6JA 3O2LA 2DSZA 3LMYA 4F79A 4WKAA 3CZEA 4MDPA 1CTNA 2XWDA 1DWFM 3ARVA 3WDRA 3RJYA 1LG2A 5E70A 1TVPA 1LQ0A 3M7SA 4UNIA 2J79A 2W66A 4HMEA 1TR1A 1XYZA 1EA9C 3IJ8A 3NSMA 4CD6A 1BG4A 4J7RA 5D4YA 1HJWA 5CJ5A 3N11A 4D6CA 4CCEA 1J0ZA 1C8QA 1N82A 1EDQA 3WMBA 2D0GA 3OG2A 1UA7A 4A3YA 5FIPA 4AYSA 1KXQA 4DUXA 3DECA 1EIBA 2V5DA 2YL5A 3G6LA 4GI6A 3NCOA 4L4PA 1DWAM 4W86A 2VR4A 1L8NA 2JF6A 1J11A 5A8MA 4JL2A 3NDYA 4HMCA 4KRUA 1JNEA 3AMCA 3VM7A 2VO5A 1HL9A 3RO8A 1LL7A 2G3NA 2MANA 2DT3A 5BWFA 1TFVA 1PAMA 1H3GA 4GQRA 1B0IA 1WPCA 4F9JA 5D9NA 2GDVA 4WF7A 1MFVA 2J7HA 2YDQA 3GZAA 2DH2A 2J47A 4L4OA 1C91A 3BMWA 3PBGA 1Q6GA 4QLJA 3L2MA 2VX5A 2DEPA 1CGTA 4BF7A 3AYSA 4A4AA 2BVDA 4S3JA 2XUCA 2J25A 5A8NA 2VQTA 1CGXA 5A6SA 3AZRA 3WD0A 1AMYA 1O6IA 5A3HA 1EO7A 3BXWA 2CITA 3POCA 4UOJA 1WE5A 5C8BB 4AD5A 4HOZA 3WH7A 2YA1A 3FHAA 2WMIB 1KGXA 1E5NA 4ML4A 2XFRA 3FAXA 3ARPA 5ABHA 1CXLA 1SR0A 3WELA 7TAAA 3CMGA 4H04A 2VMFA 3VDAA 1H2JA 2DSUA 3WH6A 4P7NA 2OSWA 4RL3A 1PX4A 1CZ1A 4AZ7A 1E6QM 2D20A 4B9ZA 1XSKA 4HU8A 2VT0A 3PZIA 4D6FA 4CD7A 1V3IA 4W89A 1UWSA 3LPGA 3WBAA 4B3LA 1J18A 3PZNA 1H0GA 2CBUA 1G5AA 1GW1A 2J4GA 3N1AA 4W8AA 1BGAA 1W32A 1PBGA 1VEOA 3LPOA 1UR2A 1PIGA 4QLLA 1WDPA 2UY5A 2YKKA 2W5FA 3ZR5A 3I3EA 2PB1A 5AC4A 1YQ2A 5A6MA 1J12A 1RP8A 3PZTA 5IDIA 4B15A 5FL1A 1NP0A 3VOCA 3ZO9A 1VEMA 4BCEA 2DSWA 1OCQA 2O9RA 4Z2IA 5E0FA 4AZGA 3GXDA 2WMFA 4WKFA 4PTWA 4FLSA 4OBSA 1G01A 3VVGA 3ARTA 2WCSA 1AQ0A 4XUYA 1V3KA 3GNOA 4CVUA 1GOKA 1WNOA 4UQAA 3TOPA 5LA2A 3PZGA 3ZT5A 3CH9A 5CSYA 2BHUA 4AD4A 4CKQA 3K4AA 4LYPA 2WM0A 4ZEPA 2A3AA 3GM8A 1RH9A 3OBAA 3QHOA 1G94A 4U5IA 4AZ6A 5EB8A 3UG5A 4E8DA 4BQ4A 1M53A 1J10A 4P8VA 4MJ4A 2XGIA 3HN3A 4BS0A 3MO4A 4J3VA 3AIUA 2OWWA 2XG9A 4ZE5A 4D6EA 3CO4A 4ZE4A 3RM8A 1H5VA 4RE3A 1QOXA 1V6YA 4DM1A 3WENA 1W91A 4AY1A 1TMQA 5I79A 3AOFA 1SYTA 3GTNA 1W3JA 5GPRA 1ITXA 1MXGA 1DP0A 1ESWA 1V3LA 2WPGA 4R27A 1KWKA 3L4WA 4OZOA 2DSVA 4UFMA 2YL9A 1X6NA 2YDRA 4AIUA 1UR0A 4M56A 4F8XA 3U7VA 3RMEA 1EDTA 1UD5A 3FNDA 5HPCA 3EDDA 5HDRA 3ZM8A 1JYWA 1B31A 2E0PA 4YN5A 3CHCA 4TXEA 6TAAA 1VRXA 5GNZA 1JZ3A 4WK9A 1RPKA 3WH5A 1JZ4A 4XX6A 1NOWA 5DMYA 3VIPA 5FOOA 3IJ7A 2ZX5A 3QOMA 3W82A 4U2YA 2D22A 3SUTA 4CU7A 5CLWA 3WEOA 2OSXA 1E71M 1GQKA 1ISXA 3VNZA 1JGIA 3PZOA 1W9DM 3MSGA 3VGGA 2YA2A 4HOWA 4PN2A 1QNPA 1G0CA 4UCFA 3THCA 1B3YA 4QDMA 3SCRA 1W3LA 3WH9A 4DUWA 1UH3A 1W2VA 3AJ7A 2D24A 1HIZA 4OJYA 2A3CA 4JAWA 1V3JA 2J78A 3WQWA 1ZBVA 1R86A 4JZ5A 4EAMA 3KL5A 2CBIA 5DF0A 1FFRA 6CGTA 1UOKA 2XYLA 3N04A 3BC9A 4AD3A 4BQ3A 4UTFA 1UKTA 1CENA 4M24A 1OD8A 3JUGA 1JZ6A 5I3DA 1JG9A 1JF6A 1E3ZA 3WSUA 1KQZA 5KZ6A 4MB4A 2WC4A 4ATLA 5A2AA 1VEPA 3I3BA 4R5EA 1JDCA 2VNCA 4WJXA 1ISWA 1MW1A 3BSHA 3A4AA 1MW0A 4PSRA 5A69A 4LYQA 1E1FA 2XIBA 2WC3A 5CG0A 4HZ6A 2GJXB 2EO7A 2Z1KA 2XWEA 4J27A 3KZSA 1BVZA 3OGVA 1HN1A 4UQ9A 2VRKA 4AD2A 1FFQA 1CXFA 2WSPA 1FHLA 3PTKA 2Y8KA 2JF7A 2ZXQA 3ALGA 1PX3A 1BYCA 3VINA 4D1IA 2NW0A 2ZUMA 2WKGA 3N18A 2J62A 1SMAA 3BSGA 3WMCA 3AIBA 4HA3A 1GQIA 1E4IA 1PEZA 1OWQA 1Q4NX 2C7FA 2ZXAA 2OLHA 2J7GA 3ZSTA 4AZIA 1H49A 4P8WA 4XB3A 3FAWA 3UR8A 3VMNA 1QI2A 3O6AA 3VMPA 4NRRA 3WNMA 3UESA 2X8RA 3VGFA 3SCOA 5GNYA 3W0KA 1JD7A 1ZL1A 3WF3A 3CIVA 4AW7A 5CGMA 3AS2A 1NARA 1KWGA 2E40A 2GSJA 3AFBA 4JL1A 3QHMA 2CKSA 3ZJ8A 1U33A 3WMSA 2QPUA 1GUVA 3VX1A 5I24A 4D6JA 3KL3A 2XSAA 9CGTA 1TCMA 2BHZA 4QCFA 2Y2WA 3WNPA 3MV11 2EXOA 1QHOA 2WCAA 2J77A 2WSKA 5A1AA 4WSKA 3RPMA 1V0NA 3BH4A 3TONA 4PMYA 1TUXA 1CDGA 2WZEA 1UR1A 4OBRA 1NWSA 2G3IA 2EQDA 2NT0A 3A4WA 4IM4A 3MV01 5CXPA 1W9BM 3M46A 4TVUA 4WKHA 2WB5A 2WVUA 1TA3B 1W1VA 4NI3A 4JFUA 1GOIA 4PMNA 4LYRA 4GKLA 4TOQA 1QNQA 2WCGA 3T08A 1OGSA 3ARSA 3I3DA 1FH9A 4ACYA 3ZT6A 2XVKA 3WQ5A 2UWFA 1W9UA 1E43A 3CUJA 4J3WA 1V3MA 3BCFA 3AS1A 1WO2A 4XZWA 4UQDA 4DUVA 2CIPA 2JFEX 3GNRA 1V6VA 2D2OA 4TUFA 2QMJA 3AIWA 4C7DA 4EKJA 3VIKA 5I0DA 4JCMA 4PTVA 1MXDA 3VUPA 4DWSA 2QHAA 4QLKA 5JBDA 1E4NA 2CEQA 2EPOA 5EBAA 2BXZA 1KFWA 1UQZA 3WUFA 2OSYA 1UWIA 1XH0A 1OM0A 1KXHA 1XSIA 1EGZA 1SMDA 2VZOA 1UZ4A 3MUY1 3L2LA 2WYSA 3BAIA 2FH6A 1JDDA 1UQYA 3IK2A 1OIFA 3GH4A 1EOMA 1UZ1A 1EHNA 3WF2A 4CD4A 3AS3A 5CZKA 5A95A 1E5JA 5AC5A 4AZCB 3B8SA 2CXGA 3N15A 1VIWA 1Z32X 2GK1B 2CBJA 2XHYA 2YDSA 2O9PA 1B3VA 5EFDA 2GVYA 3AIRA 3PHAA 4MNLA 1ISVA 3RCNA 3GXFA 4PEEA 4AEFA 4CCCA 3CUFA 1WKYA 3W24A 3WEZA 3PZVA 3RIKA 1BGGA 5BRQA 3S6TA 1LL6A 3HMCA 2DGAA 1CGUA 1NOFA 1Y7VA 2G3JA 5A6BD 3AHVA 1C93A 3II1A 2ZXBA 1AQMA 2D0FA 2YL6A 4HZ8A 5E0CA 3SIMA 4TVCA 3U57A 5HBFA 1XYFA 1WDSA 3WEMA 2WW5A 1OGBA 1HXJA 3PZQA 5FCZA 1J0YA 2V3GA 4Z2KA 4HOXA 4UFIA 2FGLA 3SUWA 2E9LA 4WLCA 3VMOA 3WNNA 2A3EA 3WF4A 3WD2A 2O9TA 3U5UA 2XM2A 1S46A 5IFTA 1W9VA 4ATWA 3J7HA 4AMCA 1QBBA 1V3HA 3G6MA 3PZUA 3UR7A 3WN6A 1JYXA 2PC8A 4P7OA 4UQCA 4U3CA 5DFAA 2WMJA 3VIOA 1LWJA 1CPUA 3WQVA 1QI0A 1JIBA 4NRSA 5BXRA 4HA4A 3K4DA 2XJ7A 2VUYA 3BGAA 5JIWA 4B16A 2WBKA 1LJYA 4P8XA 1W1YA 5A8PA 2CHNA 5KEZA 3PTQA 4PMDA 4FLOA 3MSDA 5EFFA 1XRVA 2J7CA 1WDRA 2YL8A 2PBOA 4FK9A 1QBAA 5CSUA 3WF1A 1CYGA 1CLXA 3QOKA 1ODZA 3FN9A 3APGA 1KQYA 1UKOA 2QV4A 3IANA 5I77A 1L0PA 1HF6A 1HJSA 4P8UA 2Y4SA 1VF8A 2W92A 3MKKA 3RM4A 3SCQA 3D3AA 4CUCA 2PWHA
chains in the Genus database with same CATH superfamily
1O12A 1XLDA 2P3ZA 4NY2A 3CZLA 1HZYA 1TPVA 3TTYA 4KFOA 3BO9A 2GUYA 1A3HA 2YYUA 3NQVA 3VIJA 3G3MA 4KWSA 3DI0A 3BQ5A 4JTKA 4ECLA 2DFAA 4UTUA 2ZYFA 2VC6A 1DWGM 3EDEA 5FJIA 1H1ZA 4PFMA 2WWCA 3AQUA 2WQDA 3KRZA 1XIDA 7XIMA 1DWJM 3OGSA 5C0QA 1QT1A 1TPUA 2XGBA 4E2BA 5DMNA 4RDWA 1OFDA 3TYUA 3MP3A 3KHJA 3VK5A 4B5NA 2QUUA 3ZYZA 2WLYA 3IJLA 1E4MM 4N6FA 3SFWA 3W7DA 4F0MA 5EKYA 1ITCA 2ZZ4A 2DZBA 4HZMA 1QVBA 3SQMA 4BFAA 1XYMA 4WCJA 3GVGA 4CQ8A 4EOUA 1TYGA 5M5DA 1E6SM 4J5NA 5G4EA 3G22A 2FJUB 1HG3A 2WZIA 4LJ3A 1E9LA 4JEQA 4C6LA 3S9YA 4O17A 4JTTA 1K4HA 4DQWA 4CQCA 4B2DA 4QTGA 1E1EA 1DPMA 1XLAA 4PBFA 3URQA 1JZ2A 3KLKA 5HJYA 1P48A 1H60A 1JUEA 1F4HA 3A47A 1RQEA 4C6FA 2E6FA 2Q8LA 4F40A 1QMLA 2F8QA 2NV2A 2QS8A 3F4WA 3V75A 4MPKA 2J7FA 1WUEA 3TTSA 4HA1A 3QQ1A 5CH9A 4JOMA 5FEPA 3CPRA 4E8CA 4MJ2A 2C8NA 5AZ0A 7REQB 2BZNA 5IHRA 1QRQA 1GVSA 3GXPA 2PWGA 3R0KA 4WSJA 1K9TA 3AISA 3AUJA 1K8CA 3OODA 1QATA 2ZWZA 1GVIA 4QIUA 4FIRA 2ZXDA 1EYWA 3MUZ1 2ZRWA 1GVYA 4B5VA 4MY1A 1UWRA 5JUVA 1X96A 2WHKA 3VGBA 2PWFA 2VFFA 4ZO6A 3M6YA 2ODOA 1L8PA 1QPKA 3KDNA 3FW6A 4NZ1A 4QM1A 2PGEA 4GQ0A 1X38A 2RKXA 1R38A 1EJTC 3GU9A 2FB3A 4PMRA 2NUXA 2HEJA 3VU2A 4JIQA 2Q3RA 1V6TA 4E2OA 1UHVA 4IGMA 4HTYA 1PUDA 4IPNB 4S2CA 2PWVA 3GNPA 1BSIA 1RD6A 3UG3A 3ARUA 3JW7A 3YPIA 4BA0A 4C6MA 2HVOA 3T44A 2D0HA 4LQ1A 1D7FA 4GO9A 4M29A 2QDEA 1KM5A 4Q8NA 3GIYA 1CEOA 1H7OA 4Z1AA 3OVGA 5HR6A 2OXNA 3KCLA 3BGGA 3P2VA 4RK8A 3S5YA 2DORA 4LVBA 3DKLA 1BEUA 5G2IA 7TIMA 3QR3A 4U4MA 1TV2A 2Z1SA 5AHLA 1OX5A 3VUSA 1VPXA 3SN1A 2BLEA 2Y5SA 5D8ZA 1CBGA 2JIWA 3KVJA 1M7JA 3E1F1 1B3ZA 4EXBA 3NPUA 5E09A 3RNDA 3M4HA 1NQ6A 3CWHA 2QCNA 1V02A 5D2YA 3UZXA 1I0BA 2QUTA 4WQ6A 4ZGYA 1M7PA 3W81A 3MTWA 4RJEA 4WXZA 2XN1A 2VWTA 4PB4A 1KLYA 1XIIA 1BYDA 3NQGA 4DAIA 2QF8A 3IJ9A 3WK0A 2PCEA 2PI6A 1JI2A 2YLLA 3SCUA 1US0A 2IMRA 1KC7A 4PE8A 4DRSA 3OB8A 1YLVA 1K8XA 3LN3A 1VBUA 1J4EA 4GOAA 4B9YA 2W3ZA 3OLGA 4S23A 5BMXA 8TIMA 5A94A 1JNDA 4A3HA 1LYXA 3FKKA 5FAGA 5H6HA 4KIEA 2JKEA 4YXGA 4HHMA 1QI4A 3U2CA 3CMJA 1EP1A 2GSHA 5I00A 1WAUA 1ONWA 3C0JA 3VO0A 1WXYA 3AHYA 1D7KA 2CERA 1F3EA 1EB3A 3HA1A 4GK8A 4NZCA 4IFRA 3VM5A 4WY0A 1E15A 3JU2A 3QC3A 3FCPA 1Q6QA 1XC6A 5ECVA 4WRHA 1TELA 4KCVA 4FAMA 3WJWA 3KBWA 2WVTA 2PLKA 3IRSA 3B9DA 1BF2A 2PDQA 2ISWA 4C6JA 1ZJBA 7CGTA 3VNYA 4NJGA 2BY0A 3DHUA 2VQUA 2QVNA 3TVAA 1QK0A 5D2TA 1QW8A 3DFQA 2CLFA 4RPQA 2ZRYA 3RU8X 1OQFA 2NWSA 4ZCWA 3VTRA 1TPC1 5IXEA 5D05A 2EPMX 8RUCA 5CPMA 3VOFA 5FL0A 1ZFJA 4PCTA 3CUHA 2FJKA 1MUCA 1UD8A 1M6JA 2WQPA 3HGSA 1R2SA 2PTYA 3QGVA 3VKAA 1R8LA 1P0EA 4J3UA 5AYIA 1ADSA 3FDGA 4L7ZA 3BTNA 3ZLGA 1ZQ5A 4F0LA 4GIAA 2V67A 4RE4A 1HL2A 4MWAC 2XFFA 5FACA 1CNVA 2OWXA 5LKYA 1XLLA 1Y5WA 1EL3A 1MUWA 3UCQA 1DXFA 3SADA 3OVPA 3NO5A 3N6JA 1WOBA 2ISFA 2JKAA 5HK4A 2D3NA 1QHPA 4XQ6A 3L5LA 1XWYA 4I90A 3S2LA 3U5YA 3RR1A 4K8EA 3SBFA 2YDAA 4EWND 1LLOA 1RA5A 2R9RA 3K5XA 4WIWA 1HP5A 1E0XA 2L5HA 1KLZA 2PA6A 3GG7A 2WJZA 3H55A 4U2ZA 1ITQA 2Y5EA 4MY9A 1MI3A 5HXMA 2QUMA 4RUBA 5BXSA 1B5TA 5AHEA 1P7TB 4F2TA 1QUMA 1VZWA 2OB3A 2QJHA 5KMYA 2NX3A 4S3KA 4N9DA 3GW3A 5XIAA 4GC4A 1VFHA 3TFCA 4V28A 1LLZA 5LIUX 3KOXA 3EDFA 5SWUA 4JBRA 2RAGA 4N42A 1KRCC 2XN0A 2BASA 3EOLA 4O8RA 3W84A 2VR2A 1CXKA 3VXGA 3VZXA 4H7CA 3SSJA 3UNDA 1GQNA 1E1CB 2ADAA 6A3HA 4KF1A 3GH7A 3PVFA 3CAWA 1DEDA 1ME7A 2ZFAA 3VFLA 1JXJA 4DO4A 3SY8A 4PCNA 1L6GA 3IGHX 3V5FA 5AECA 3S46A 4CU8A 2G3MA 3TAKA 4C7GA 3WD3A 1LL4A 1IF2A 3NVDA 3ZJ7A 3W1PA 5LA1A 5J04A 5HATA 4GIRA 3K8MA 4MWAB 1R7AA 4Y6GA 4UZSA 1B3WA 2GQ9A 4EF9A 3F2BA 3VDHA 3E0WA 2DT0A 1A5MC 1FWWA 5TAOA 3VD3A 4AWSA 2E5DA 3WIJA 4JHZA 4BF9A 3P67A 4F9DA 3QLDA 3GXTA 4L4LA 1X7FA 5CBIA 1Q63A 1GYNA 2GK1A 4OUIA 5F7UA 3T78A 2YZRA 3BLLA 2OMAA 2DIEA 1XPYA 2PGRA 2QULA 3PBVA 4S2BA 4G2DA 2YB4A 2WMIA 3BV7A 1QTWA 3CK5A 3KRSA 1K7FA 3DBNA 4YTRA 2TRSA 1PYFA 3VPLA 2VGFA 1E70M 3PPGA 4US5D 4H9ZA 4D1JA 5DY2A 4FF5A 3M0MA 2OKOA 1BHGA 3S5SA 5DCBA 4DBWA 1EX5A 4S1FA 5LYRA 2GUUA 5AVNA 5DO8A 2VL4A 1RV8A 1NM9A 1DJXA 5F4WA 4U33A 4X2PA 4XIAA 2VCCA 3I4KA 3GXNA 3PJTA 3VIMA 2ZIDA 2E67A 3GDMA 3T4CA 1VLIA 2ASHA 2ZRUA 4G1NA 2XISA 1J9YA 1EZWA 5C70A 5A2BA 3TQPA 4GA8A 4DYJA 3UWUA 3PSVA 2JALA 3UZZA 4GWEA 5I07A 4FB7A 3RR4A 1WOAA 3B8TA 3KOYA 4LCQA 1WUFA 3P84A 5I3HA 3TC6A 1WDQA 1S3HA 1VENA 1D2KA 3VZZA 4JTLA 3S83A 3VABA 1OJXA 4F66A 1ML1A 3W88A 1Z44A 2YGYA 3OYZA 4UWMA 1UASA 4GNVA 2PBGA 3CUGA 4XZBA 4Q8QA 3AXKA 3WD4A 2ZE0A 4QSFA 4HJWA 3M0ZA 1LTDA 2EPKX 1RALA 1QWKA 5EU9A 2ABBA 3KRBA 5E9XA 5T9BG 4P7LA 4Q4KA 4DI9A 2PWEA 3G1FA 1V79A 2DT1A 3O0KA 3WLKX 3SURA 2NT1A 3TYZA 2E5CA 3DHPA 3RK8A 2BWGA 4KESA 1W5MA 5AN7A 4XAPA 4HNUA 1VPYA 3THAA 5A6BA 3OP2A 1GONA 3GC2A 3BLEA 4O11A 4RZBA 3WQFA 1CECA 2Q8XA 3QR0A 4MB1A 2X2GA 1T41A 3ITXA 1X39A 4TTUA 4QQ3A 3GG0A 1F4AA 3NXFA 5ABGA 1CLVA 3WJSA 1SJBA 3LXBA 3OZPA 4GZIA 4KPLA 4A8LA 2VDHA 1R2RA 1TPFA 4ZFMA 3EZ4A 4YYFA 4M6VA 1GORA 1JI1A 2BFGA 4RE2A 3H12A 5AC6A 3V1HA 3A22A 3AU6A 3LCWA 4O50A 4KETA 3U4FA 3ZOAA 1TZ9A 3PN8A 4US5A 2VZSA 1EH9A 2WSYA 5E6YA 4DWSC 3CAQA 4U31A 4DF1A 2WJFA 5GQBA 3XISA 5M17A 3MWAA 4GJJA 1R5YA 3N25A 2OJPA 3OO2A 2ZZ2A 1QXLA 3W7GA 1C90A 4XZHA 1F6PA 3R8GA 1XX1A 5HULA 2IPJA 3G1SA 2P0IA 3GNDA 4F0KA 1FKXA 4A3RA 2XVPA 1XCWA 3P80A 1TWIA 4YHEA 1CIUA 2AQVA 1YBQB 1JZ7A 4XZ9A 1EC7A 2DW6A 3ZJKA 4TV6A 1QI5A 2DVUA 4NILA 1XLJA 3LPFA 1H09A 3BV4A 4FX8A 1I2QA 2WAGA 1ENUA 3UU0A 3C2FA 1U22A 4NNBA 1Z41A 1ADDA 4X61A 2W63A 3APYA 4D6HA 3PWIA 1L6WA 4JKMA 4DIAA 2ZX9A 3IAPA 4CNOA 4U3AA 5CLTA 3PC0A 4XZMX 4Z08A 2J9ZA 3TEVA 4ROPA 2R6OA 1H5YA 1SFJA 5CSRA 1KCLA 4CN1A 3LMZA 1UKPA 1BG9A 1PO9A 4QITA 3W38A 3FKRA 1OC5A 2GSEA 3HGOA 1XLGA 3P60A 4UC5A 2BBFA 2VX6A 1YPXA 1B90A 1JVNA 3OZOA 5BU6A 4L61A 1UCWA 1L2UA 1JXKA 5BOEA 4OOUA 1RCQA 3CIXA 3EOUA 1R85A 1IEIA 4GKTA 4BF5A 1HVQA 2XSXA 1RVGA 3Q58A 3WY1A 3ZQ9A 1I4NA 3Q4DA 5A8GA 1CXIA 2BDQA 4GPNA 3SIZA 5F1VA 2PSNA 1Q6OA 4HN4A 4Q22A 1J01A 1Q7MA 4J3TA 3LBOA 3EXSA 3N12A 2ZX8A 4HK5A 3L5MA 1R3WA 3L4YA 2V3FA 3T40A 5PTDA 4OE7A 1ME9A 2QCCA 4H9MA 1MZRA 3EMCA 1S5WA 5KITA 4NNAA 2QUNA 1JDAA 3LD5A 4YU1A 1ZPTA 1R3VA 3GXMA 4F48A 4FXFA 1MFUA 3M16A 4W93A 5LXEA 3KM8A 4N4PA 5T9CE 3VCRA 1TE6A 3W26A 3I7QA 3W1RA 1B4EA 3IJDA 4FMVA 1W1A1 1QDSA 3KBMA 4JPGA 5D09A 2G5WA 4LSBA 1B54A 4AD0A 3VD4A 1HP4A 3GE7A 3NIYA 5CC5A 1I75A 5LZLA 2HISA 5I3KA 2XN2A 3TUUA 2FFCA 1ZS2A 4NKCA 1E40A 1KKRA 3ORWA 2PS2A 5JIPA 1ZBCA 3EEGA 8CGTA 4M1BA 4ZODA 3GBEA 2POZA 8XIAA 2D2JA 3MW7A 3N2MA 1XGZA 3W7PA 4J3XA 3CHFA 1NDVA 3GU2A 1H51A 3B8WA 4IG2A 2VDGA 4M3PA 2PRMA 3D6NA 3SGUA 9XIMA 1XP3A 5CAKA 2OZ0A 5I78A 2DSZA 4L9YA 4F79A 1IEVA 5BU9A 1CTNA 5DBUA 4FNRA 1W6TA 1DWFM 5HANA 3M7SA 3L0NA 1VHNA 1RD5A 4JTQA 1EA9C 2OU4A 4CD6A 4I6VA 4US6A 4J7RA 1VCVA 3W85A 2O55A 3A9BA 5D4YA 4UTHA 3GKFA 3QKEA 5CJ5A 4D6CA 3PS7A 3QN3A 5DANA 5FSDC 1T8QA 3OG2A 3V3WA 4A3YA 5FIPA 4AYSA 1KXQA 3UPWA 4RNJA 2V5DA 3G18A 1O1ZA 1S2VA 1CB2A 1SM9A 3FK4A 4IMDA 1ZJIA 5CAHA 2RUSA 4XZIA 3OW1A 3NDYA 1R3YA 4HMCA 2OODA 3VM7A 2VO5A 3RO8A 4MWAA 4S3GA 1VCFA 4JDBA 3W1TA 1B0IA 3H26A 3TFXA 1UIOA 3P8JA 4HA0A 2YDQA 1UR3M 2J47A 1C91A 1Q6GA 2Z1WA 4H83A 3L2MA 4NIRA 2DEPA 3E2SA 4BF7A 4K38A 2XUCA 3NXLA 1NU5A 5IM51 5A3HA 1EO7A 2CITA 4UOJA 1DVJA 1WE5A 2VC7A 1SZGA 4HOZA 5I3JA 6REQB 3E2QA 3FHAA 1EFZA 1KGXA 2YBVA 4RCXA 1CXLA 4E3TA 4HHHA 4EVZA 1FWEC 2TODA 1XBYA 4U28A 3G0SA 2D20A 1XSKA 2ZE3A 2VT0A 1DOSA 4D6FA 4CD7A 5XIMA 2YFOA 3QY8A 1UWSA 3PZNA 4IGSA 2CBUA 1YYAA 3UWEA 1VEOA 3WQGA 4O53A 1AL7A 3NQ2A 2P1FA 3HQ1A 3UD6A 1OC7A 2QJMA 3WLQA 4E4FA 1IEXA 1OF6A 3P0WA 1RP8A 2BB0A 4Q4SA 4E3VA 5FL1A 3CUXA 5LIXX 3VOCA 1MUMA 2DSWA 3V0UA 1OCQA 4Z2IA 3R94A 4JEJA 3KW3A 3MCMA 1LRQA 2ISSA 4PTWA 4OBSA 4LB4A 2PDLA 2OQLA 1B4KA 3L67A 4G56A 3FDKA 3B4YA 3GNOA 4GG9A 1OC6A 1GOKA 4N7QA 3UG8A 9RUBA 3PAOA 4XK2A 3ZT5A 1EX1A 4IZGA 4WDXA 3T1GA 2YCIX 4H6EA 2GYIA 3W2MA 2Q8ZA 4ZTYA 2A3AA 3M44A 4H9VA 3NEHA 3OBAA 3NPVA 3P5ZA 3QHOA 4U5IA 4AZ6A 4BQ4A 3ANYA 4MJ4A 3KHDA 2ZVRA 3EWXA 3MO4A 2PDXA 4HK7A 2XG9A 1TQXA 1NEYA 4GMEA 3ZWTA 4D6EA 1KM6A 1GKPA 1QOXA 2A2IA 3PBMA 4NASA 1V6YA 4LBSA 5HJLA 1UROA 4MYAA 2QYGA 5I06A 2RFGA 2PC4A 3INPA 1UW9A 3LYEA 1YTDA 1SUXA 5K3VA 1SYTA 2H9AB 1EP3A 4YTUA 2X1RA 1ESWA 3CEPA 2R94A 5I7GA 5I3IA 4UFMA 3KTSA 1UR0A 2IQTA 4F8XA 1DJHA 4S3FA 4PB3A 3W1AA 1B31A 2GJNA 1W1B1 4ONVA 3CQKA 4FR6A 4YN5A 4TXEA 4YCPA 2HBVA 2OZ3A 2A79A 1JZ3A 2IPFA 2QQ6A 1KM4A 3L5AA 1VGAA 3AYVA 5FOOA 2ZX5A 3QOMA 1E9YB 5FF2A 3G1VA 1TV3A 3ITOA 3LY0A 3M0HA 1ZLPA 4CU7A 5CLWA 3W71A 1ISXA 4XKYA 2VEPA 1JGIA 3ITTA 3LHUA 2XIMA 3MSGA 2NVCA 3S5ZA 2CZ5A 1FBAA 4C90A 4HOWA 4PN2A 1V5XA 3V35A 4WOQA 1G0CA 4UCFA 1YE6A 3LNPA 1B3YA 4NQ1A 4QDMA 1BD0A 2D24A 4I5XA 4JAWA 3WQWA 3UXIA 3PPHA 2BOEX 2Y61A 1CT5A 4EAMA 3DGRA 6CGTA 4H6KA 4I9TA 3B40A 2Y62A 3SGGA 3BC9A 4BQ3A 4UTFA 3L68A 3VNIA 2AGTA 5AZ1A 4GY1A 3FJ4A 1OD8A 5AHNA 2ZZ5A 3N4EA 2ACRA 6ALDA 4RZ4A 1E3ZA 3B9NA 4GYFA 5KZ6A 3R8HA 2R1PA 3TLLA 3TSDA 2WV8A 3N6QA 3MUXA 1R3SA 3TCSA 1Q2RA 3HG4A 1F7BA 2QJJA 2VGBA 4G7FA 1JDCA 3A4AA 3S47A 1RQHA 4PSRA 1EWEA 1IE7C 2XIBA 4HHLA 4I7WA 5EBUA 2CZFA 3GD6A 4HZ6A 4AC7C 2PDJA 3KZPA 3A5VA 1CXFA 1AA1B 1T96A 1XS2A 5IOBA 1PX3A 3IK4A 5E5CA 1VIZA 3VINA 1PL9A 2J88A 4D1IA 2ZUMA 4LRSA 1B9BA 2WKGA 4DBEA 1SMAA 4R9OA 4QISA 2ZTJA 3CL8A 3DFSA 3TXZA 2C7FA 3Q2DA 3QW3A 1OF8A 4AZIA 1X1OA 4WHBA 3FJNA 4IMFA 3O6AA 2Y5JA 1F61A 1VS1A 3GFZA 4NRRA 3VMPA 1A5LC 2X8RA 3VGFA 3W0KA 3TQVA 3VFCA 3W76A 1JD7A 3WF3A 4AX6A 5CGMA 4TU1A 3KVKA 1KWGA 3A13A 1U33A 2QPUA 1XBXA 3VX1A 4A2SA 4D6JA 2QT3A 3UNTA 1IQ8A 4DUOA 4GYJA 5C9ZA 2Y2WA 3BLDA 3R2GA 3GFXA 2WCAA 4DVOA 1OG6A 1YIXA 1RHCA 1Z89A 3C6CA 4LF2A 4AHPA 3BH4A 3TONA 4LU0A 3KVMA 4PMYA 3F2CA 6PTDA 2CWXA 1IEWA 1HTIA 1UR1A 4HPNA 5KZEA 3FEMA 4ZA0A 3A4WA 1W9BM 4RDYA 3M46A 4TVUA 4WEVX 2WB5A 4NI3A 1W1VA 1J93A 4LYRA 1UMLA 4IP5A 4WR3A 5TQLA 1QNQA 4IH3A 1SZEA 1XBVA 1AFSA 4TMCA 4RXFA 3SN4A 4L65A 2XVKA 3WQ5A 3CH0A 1EJWC 3V7PA 2OT0A 3W2UA 3CUJA 1SU5A 4HNLA 5DMLA 1A50A 5AYXA 3BCFA 2X1TA 3NVTA 1WO2A 4UQDA 1WBJA 1V6VA 1GVRA 2F38A 3S2NA 2J9XA 4FNQA 3VUPA 3I6EA 4QLKA 1UJPA 2EPOA 2BXZA 2R1KA 2ATMA 4GY7A 1XSIA 1SMDA 1A0DA 1V93A 3O6CA 3PTDA 1RBLA 5FJTA 1OIFA 2MNRA 1KFEA 3LCXA 1EOMA 3UXKA 1F6YA 1EHNA 4CD4A 3AS3A 5CZKA 4AZCB 4NAEA 3B8SA 2PPGA 4JTDA 2DW7A 4PRRA 1Z32X 3V18A 3KBNA 4HNNA 4JX6A 1B3VA 5EFDA 5AOUA 3UJRA 3PHAA 4AEFA 4DJFC 1XINA 3WK2A 3LTPA 1Q8JA 4IIHA 2C91A 4WZHA 2NQLA 3GTFA 4HB7A 2DGAA 3OVQA 1CGUA 3HV8A 1DQUA 2DZXA 1NY1A 1PKMA 3AHVA 3MMTA 3TC3A 4PCPA 4XVDA 3UJSA 3NQFA 3E9AA 5C5YA 2YL6A 3SIMA 5E0CA 3JR2A 4TVCA 5HBFA 3MWCA 1XYFA 4DZIA 2WW5A 1HXJA 1S5VA 4Z0SA 3PZQA 3AUOA 3QRHA 3A23A 1DORA 3H23A 1A3XA 2VFGA 3VE7A 4X63A 3VMOA 1E0UA 1P0DA 4JIRA 1SZNA 3UZWA 4LTSA 1EJVC 4C6CA 3H24A 5BMWA 2NVDA 4IIDA 4FZIA 5LNWA 3MJYA 4ATWA 4BI6A 4AMCA 3GUGA 1Z9AA 3FLUA 3CYVA 3LCFA 4G7EB 4DAFA 4UQCA 4U3CA 1FCUA 3EWWA 1A0CA 2DQWA 3C86A 5BXRA 3N2BA 2NUYA 1UBPC 1EUNA 3K4DA 4WY0F 2VUYA 3BGAA 1UPMB 2F84A 3VOIA 1KD0A 4P8XA 4QE5A 5HWNA 5G2WA 3DFOA 4FLOA 3MSDA 2BSLA 3PB0A 4AAJA 4O4VA 2J7CA 3GO2A 5ENLA 3CQIA 4UTWC 1QBAA 2WZTA 1CLXA 3FN9A 1YADA 4QJ5B 1KQYA 1R6WA 2QV4A 4O16A 3CV7A 3DENA 1L0PA 3Q67A 1HF6A 4Q8MA 4RW5A 4I3GA 2FPTA 4IIGA 1YNQA 4O54A 3GUWA 1YPFA 4HCHA 1FX6A 1W17A 1YX1A 3DXIA 1B3OA 1LZOA 4TVDA 3SZ8A 2CC0A 4DJDC 2ISVA 2V5CA 2PU1A 1M7XA 3N2XA 4EPKA 3AMDA 4D71A 3R58A 2HXTA 3DC0A 3W72A 1VJSA 3W37A 1WAWA 5IHSA 3N3MA 4TTGA 2BVTA 1BPLB 2QLYA 1HNYA 1UYQA 2WBGA 5CPQA 2G4FA 1XH1A 3SEPA 2HZGA 4W85A 2B0MA 1E6PA 1JGMA 3CMFA 4JS3A 3W86A 4Q7NA 3FX4A 3ERPA 1BYAA 3VKCA 4GRSA 1W0MA 4PH6A 1JRCA 1SW3A 2VVSA 5G1TA 3C4UA 3G2GA 3OZYA 2E68A 3S1GA 4XTDA 1F6KA 1GOOA 1H11A 1IEQA 1F74A 5TD4A 6XIMA 1XG3A 4OECA 1LORA 1GVOA 4GI4A 3NL6A 4WY0B 1RBOB 1H50A 1TUFA 1LBMA 1LQ2A 3TYCA 3N9RA 1JUKA 3PUGA 4XAFA 1S2CA 4FA3A 1O5QA 4E2DA 2GJRA 1Q6RA 4DZ5A 5LA0A 3CWOX 4HHPA 1W5PA 3W2LA 2DT2A 1ICPA 4AWEA 2HWGA 2V30A 5CPTA 5F2GA 2WM1A 2DUXA 1G7UA 2PDIA 4URIA 1XIBA 4NG3A 2X0HA 4O13A 1R46A 2FGZA 4KMQA 3G1YA 2W4XA 3EPMA 1ISYA 4CN6A 4D6IA 4CD5A 1XC4A 5E0KA 3DDMA 2PWDA 1XYBA 2OR2A 4JTHA 4R88A 1TA3A 4GQQA 4I5UA 1BVNP 3Q45A 4XZLX 1UH2A 2EBNA 1CXEA 3W7IA 1OINA 2AMGA 3A24A 1OHLA 3RLUA 3N73A 4O52A 3TSBA 2PDHA 5D2WA 2OO0A 3DFHA 1SGJA 4JD4A 1UWQA 1OADA 5MHBA 3F4VA 3E02A 4LUTA 4YIWA 5IFPA 1KR0A 3CGTA 2W62A 1DJYA 2Q01A 3DG3A 3CXOA 1OGGA 4W7WA 3MDWA 4QAIA 1KTNA 1MYRA 3MVTA 2F2KA 3WQOA 1KBKA 3LQLA 2Z1BA 4V27A 2WANA 4ERGA 2JKPA 5RUBA 3AIQA 3FA3A 5D9OA 4LV9A 1SFSA 1W1PA 5LGXA 5HMSA 1OYAA 1CB7B 2G95A 4D6DA 3VD5A 1JAKA 4HZ7A 4HNTA 1HO1A 1PX8A 3AAMA 3L4TA 2FZDA 3D3FA 3QTGA 3VGHA 5HAOA 1X98A 1KFJA 3AICA 5XINA 3BDKA 1AZ2A 2P5NA 5E1QA 3O1NA 3TH6A 3OQ8A 1FH8A 3P6LA 2C1HA 1E3XA 3MQTA 4KS0A 4AZHA 1C3FA 3I65A 4KWVA 3N2OA 3OA5A 1Q7ZA 3W28A 3WKZA 3RCMA 2FH8A 2BOFX 3IJ6A 4MADA 4XVEA 4GH1A 3PTMA 4UOZA 4HCDA 1E4LA 2P8CA 4XKMA 4ICNA 1ONRA 1REQB 4PL2A 1AQHA 1GOXA 1U1UA 5C9UA 3SQLA 4GZEA 3HG5A 1GTHA 3WJZA 2NX9A 1CI1A 3UF9A 2C14A 1R9YA 4IIFA 2ZBTA 2A3HA 1R30A 3B9AA 1TJRA 1ZUAX 2DV0A 3TX9A 4KBXA 4K39A 1LBFA 1HQTA 3IUHA 1KV8A 2QDGA 1BKHA 4H9TA 4ACZB 2JGQA 2YXGA 4YVXA 4FLQA 3ES7A 3GW0A 4L1XA 3HGJA 1JL8A 3BANA 1I0DA 1GGOA 4HBKA 2UV8G 3QHNA 3T7VA 4HPJA 4AZCA 1ZJAA 1P6BA 3P81A 3HTWA 2Q6ZA 3W3OA 1NDWA 2PTDA 1OT2A 3SB0A 1NOUA 4C1NA 4U5KA 3MKVA 5HMEA 3HJEA 2YA0A 1GVFA 3DU0A 2CHRA 2VFDA 4KEUA 3K4WA 1OD0A 3VZYA 3AYRA 3BLFA 1THFD 1RJRA 2QV5A 3W25A 4QSHA 3DX5A 1IIHA 3SW6A 4A3QA 3T42A 2Y7EA 1XGDA 3QPZA 1KM1A 1L6YA 1DE5A 2C0HA 3G24A 4A2RA 4JIHA 3URNA 3RAOA 1EO5A 2PLCA 1F3XA 1JCJA 1YMYA 4MM1A 2WVSA 4PCFA 3OIHA 1CCWB 1TPDA 3HPXA 1OFQA 2PD5A 2H3DA 2FQIA 3B0VC 5K4XA 4CNPA 2XVNA 2E77A 1EQCA 1G9HA 3F5LA 1XRTA 3EB4A 4LXFA 2G97A 2W91A 1NAL1 2C0AA 4FX7A 3U2OA 2I56A 2Z6JA 3Q94A 4AF0B 3T0DA 3T0TA 1VYRA 1XIFA 3D0CA 2A3LA 2R1LA 3F2DA 2E4TA 3JZUA 4R85A 2WSQA 4RNFA 2X7WA 1XKYA 1I2NA 2GFTA 1V7YA 1IXNA 3W6LA 1JULA 4PBGA 1MDLA 2A7NA 2HSAA 3PBWA 2WMKA 1ZALA 2CCRA 1GHRA 4AXKA 2YCLB 3CHDA 2F6KA 2IPGA 3NURA 4W88A 4Z2GA 1YXDA 4UTTA 2WMGA 3UWYA 3RXZA 1GKQA 2Y6ZA 1RK6A 2ZX7A 2OYLA 4YVPA 2CKRA 1A4MA 4BQ2A 4PMQA 1LRNA 3TE9A 3GDTA 3UWZA 5K9DA 2CLOA 2DZTA 3LZ3A 5E9AA 3BAJA 4HJFA 1LBLA 1XL9A 3EOOA 4YWSA 1M7OA 3WFZA 5LIWX 1BF6A 4EWJA 3APTA 3NR0A 4B5WA 3AIEA 1XD0A 3ANVA 2VD9A 2CETA 4CVWA 3AALA 1UUQA 3DIPA 1AODA 1K9DA 3TJXA 4ZSUA 4CU6A 5LNSA 3MP4A 4AZ5A 3M5ZA 4C1NB 3P62A 4DB7A 1CW2A 5J5RA 2ESCA 3PM6A 4UR7A 1C9DA 4CQAA 1XIHA 3EPOA 1TIMA 2VP8A 2A1YA 4HCLA 3SN0A 3ZVHA 1ALDA 4HD5A 3PPCA 4R7JA 1HKIA 2ZUSA 2F6UA 4LNYA 1HFBA 3S6OA 2OOFA 3QY7A 1XRSA 1DJZA 1TRDA 1D3CA 3E0FA 4QRNA 4Q3MA 3W83A 4ZQRA 1AD4A 2I57A 1KB3A 2RGMA 2NQJA 3ZXWA 2CBVA 4ORMA 1EDGA 4S3CA 1BKSA 1VQTA 1A49A 1M03A 3EWYA 1I1WA 2F61A 3STPA 3WQ4A 1ZY9A 1EOKA 4LC6A 4E5TA 4EACA 4H41A 1E9ZB 3VD7A 1DV7A 1I9CB 4C6DA 1KCKA 3WBWA 1ECQA 1HJXA 3CLWA 4DWSB 2NQ9A 2CZDA 2WPBA 4K36A 1KRBC 3NSNA 4Q7BA 5D8WA 1GVEA 3G3DA 3RILA 5EPDA 4DM2A 5F2MA 1S2UA 1AH0A 4GGHA 3T2QA 1PPIA 3ZJ6A 1TO3A 1YTKA 4PMUA 1EP2A 3QY6A 3VILA 4DLMA 4INFA 4MAZA 3G77A 2VX7A 4ASTA 3LHTA 4MB3A 2X7VA 3M0IA 3WDJA 4NP7A 4BZYA 1O95A 3W70A 4NZJA 2OZ8A 4FF7A 3RJXA 4NSBA 2WXDM 3QV6A 1RP9A 2OYMA 3IGSA 1GQLA 2OG9A 5ABTA 4PMXA 3C2YA 1M01A 2H9AA 2A7RA 4WD0A 3PJUA 2OGJA 3W00A 2JK2A 4QJ3B 3TXVA 1GNXA 3NDZA 3K13A 4AF0A 2V68A 4ZTXA 1XD1A 3DFYA 1HUVA 1E55A 4AQLA 1ZBWA 3KVLA 3EA2A 3HG3A 3E38A 3GNXA 4GJ1A 4LAMA 4CQ9A 4ERIA 3QEZA 4LBRA 3DFPA 1EIXA 4AD1A 2AKMA 1KGWA 2GDUA 4HU0A 2QCHA 5AYZA 2XH2A 3M0XA 2HXUA 2ZUVA 2FPVA 1H0IA 2G41A 4B3KA 3HM7A 1CGVA 4IX2A 2PWUA 1H7RA 2OLAA 3W4RA 4LUSB 2XSBA 5DT5A 3BPWA 4DF2A 3N3TA 4PUJA 4PTDA 2WC7A 2BY1A 4O28A 1O5XA 3BARA 4IISA 1AQFA 3P14A 4OV4A 3CBWA 3H7UA 3HQPA 4HTBA 4IMGA 3QYQA 3OLIA 4UQBA 1MQQA 2VZTA 4PGLA 4OOZA 1HJVA 1IYXA 4P7RA 2E9BA 1KFKA 1BQCA 3A21A 4S39A 4B5XA 2NSOA 3M0LA 1UD2A 3AHZA 4J3SA 4MHBA 4P5UA 3EA1A 3SCNA 2YOCA 2C1GA 3NO3A 3S5OA 2PURA 1EJRC 4U10A 3W7QA 4CGTA 1E51A 4QCEA 2J7EA 4NJKA 1RQBA 1UKQA 1XV8A 4MJMA 4YTSA 1XF0A 2DZUA 4B4HA 3I7SA 3ME3A 1A3WA 1C92A 1UP3A 1HX0A 2QCFA 2GVGA 3ABQA 5MF5A 4KGLA 2GUBA 2Z7GA 3LCHA 3WQCA 2P88A 2X0YA 3T0BA 3G0UA 2DPEA 2DZPA 4N0RA 1BYBA 3NZGA 1GHSA 1LT8A 2X16A 3OHMB 3GYCA 1ISZA 4REQB 3ARRA 4JFSA 4L9XA 1BLIA 3IAQA 4JICA 1CWYA 5GJMA 2ZZ1A 4HSNA 3NG3A 1O1HA 3U9IA 3WNKA 4UFLA 3BZJA 4OHQA 3CTTA 1TJ2A 3LXAA 3RU6A 3PZ9A 3NQMA 1NWRA 1VFFA 3SECA 2QVHA 5C71A 2WJDA 4H8HA 7A3HA 3DERA 3L65A 2JEQA 2GJPA 1VFMA 3GR8A 2W79A 4HT3A 2Z24A 3HPFA 1I2RA 1EGVA 4DI8A 5DQPA 1DJNA 2UY3A 1VBRA 5B80A 1DTNA 1UMYA 3W2KA 1XPGA 2V63A 4UR9A 3AMLA 2X05A 2B7OA 2AL1A 4IMAA 2BS9A 4C6QA 1SO3A 1I2OA 1SW7A 1UG6A 5ECUA 4OIFA 4UBPC 3M6DA 1YKWA 4IXXA 5A6KA 3F1QA 1RJPA 1K9FA 1X6LA 4NF7A 3SRKA 1LUCB 4H7ZA 3V1PA 4HNVA 1EJSC 2B4GA 4ZOAA 3S6DA 5AB3A 2GOKA 4ES4A 3G1XA 3M0VA 1ZNNA 3NL5A 1TCDA 3B8VA 3W7CA 1US3A 2FIQA 4P2VA 1IZKA 3P61A 1ZJHA 1OK4A 4LVDA 1VYPX 2H90A 2VVNA 3B9EA 4LALA 4I5RA 3SUSA 5BXPA 2W61A 2X1IA 1DBTA 1WZMA 3MC5A 3TYDA 1J0IA 1K77A 2JEPA 4RNHA 4FPSA 2HPIA 2XTKA 1TJPA 2GGJA 1N8FA 2V6AA 2R1MA 3TR9A 2J66A 2BTMA 2R24A 4ATDA 1HJQA 2DSKA 1J6OA 4N4QA 3EOSA 5K2ZA 1CGWA 1FKWA 3QM3A 1O66A 3E12A 1RA0A 4Q8VA 1GCYA 3CB8A 3TYBA 3ZMRA 2YJQA 3STCA 1QCWA 4UTLA 3HZ3A 4Y7EA 4UUIA 1PIIA 2XVLA 1PCKA 4RV3A 1ONEA 3M7WA 1QNOA 1QFEA 1AMKA 1FUYA 3ITLA 1FTXA 2YW4A 3A4XA 3OLEA 3WLTA 4B2DD 3OU8A 3N4AA 3AXMA 3WF0A 3GRIA 1GKRA 4OVXA 3BW2A 2BV9A 5D02A 3TP4A 2CU0A 3W02A 4KWOA 3L4XA 1ODUA 4MNJA 4DXXA 2DUAA 5FAJA 2FLIA 1I1XA 4JN6A 3B06A 5B7ZA 5BRPA 3FGCA 4HYRA 1DE6A 1DJGA 4UFKA 3N13A 4W84A 1A5BA 3C0QA 4K68A 2HK0A 5REQB 1H61A 1KXTA 4UNKA 3QV7A 4NL1A 3AMGA 2FZBA 4Y9OA 1NDYA 5G4WA 2PDGA 2FYMA 3C5QA 2QJIA 1D8CA 2RJHA 3TWBA 4GI8A 2Y0FA 4BEQA 3MBDA 4JQ1A 4I6KA 2FTYA 3IIVA 3CHEA 4BI5A 1TR9A 1F07A 4D6GA 3EX3A 3PJWA 3F5KA 4UTMA 1OSEA 1AZ1A 3BW4A 2V3EA 4MOZA 2GGHA 2UY2A 3IVUA 1E56A 1QW9A 4JIIX 2PMQA 2F2HA 3ZVHB 1S39A 5G4HC 2A0NA 4S3DA 1FCBA 5DCEA 3O2LA 4WKAA 1G69A 2R8WA 3B4UA 1EJ7L 5CZSA 1LG2A 3KXQA 4C6IA 4DYEA 4M5PA 4HIBA 4H01A 1TQJA 3SGZA 3K1GA 1K02A 1XYZA 3HV9A 1Q5MA 3WLPA 3NSMA 4D8LA 4WVXA 1W3NA 3M5YA 3MZNA 3ZFHA 4CCEA 1J0ZA 3WMBA 3GDRA 4JYFA 3B0YA 3HQNA 1UA7A 2FMOA 4DUXA 3DECA 2ZZ7A 3WLMA 3GHSA 4GI6A 4PTNA 4WOZA 1PHWA 2V5KA 4DNHA 2VD8A 2JF6A 3PNUA 4JL2A 1TTIA 2QEZA 3T07A 2CLHA 2HDJA 1HL9A 2HMCA 2ZDSA 1LL7A 3GVQA 2Z2AA 4LB3A 3OQEA 5BWFA 2PP1A 2Z1VA 5CBBA 2C18A 4GQRA 4F9JA 3N29A 5D9NA 2GDVA 3GZAA 3BMWA 4IMCA 2FTPA 1ME8A 2BVDA 2VQTA 1CGXA 3WD0A 1AMYA 4Y90A 1O6IA 3BXWA 1YDYA 4I9JA 1JCNA 4LCRA 3UVIA 2PP3A 5C8BB 3H2NA 1FVPA 1W3TA 3H4XA 3B0PA 3PSWA 2YA1A 4WXYA 5MKGA 4ML4A 2XFRA 3FAXA 3LSBA 3LM7A 1SR0A 3WELA 3CMGA 4H04A 4IJCA 1H2JA 3W9ZA 2DSUA 4P7NA 2OSWA 4RL3A 1G4SA 4J40A 2YSWA 1E6QM 1OFEA 4B9ZA 3CWNA 3RFAA 1V3IA 1SJDA 3BW3A 1QPQA 2Y8UA 5C55A 1PKYA 4LC8A 3C2EA 1H0GA 3CAKA 1MNSA 2A85A 3WMLA 4Q8OA 4W8AA 2JGYA 4MSSA 4X9SA 1WDPA 2YKKA 4XTIA 4GC3A 3RX3A 3M5XA 4MZ1A 3I3EA 2PB1A 5A6MA 2IKIA 1J12A 3PZTA 5AC7A 1SO4A 4EAYA 4FI4A 2NXGA 3R13A 4C6KA 3ZO9A 1C8VA 2Y85A 3LGGA 3GDLA 3PBUA 2O9RA 5E0FA 3GXDA 2WMFA 1LP6A 4WKFA 3U6WA 3VVGA 2BGSA 2WCSA 2YCJA 3N19B 4H3DA 1WNOA 3EPNA 4UQAA 3DBPA 1FHVA 3R4IA 1FRBA 4B5SA 2ZKMX 1XRFA 3CYJA 1JCYA 3K4AA 4CKQA 2WM0A 1GYLA 1XDMA 3G8RA 4D9PA 1TV7A 3FVDA 1XJBA 3NM1A 1G94A 3TQKA 2E6YA 4BS0A 3H21A 5FEXA 2J6XA 3CO4A 3QTPA 3WQEA 1GEHA 4I7UA 4DM1A 3WENA 3O05A 4AY1A 3A3WA 5G2HA 4ZB5A 4M7SA 3KBVA 1W3JA 1MXGA 2WPGA 3OIXA 4R27A 4RR4A 2AQWA 4TO8A 4O1AA 1FCQA 1X6NA 2YDRA 3TZNA 3SQSA 1P0BA 3U7VA 4CEXC 3EDDA 5TBOA 1I60A 1FWBC 1VRXA 3BURA 4KT2A 3LBCA 3AYTA 5LSMA 4K7YA 1WYIA 2V5BA 3PK7A 4Q4RA 3NZ1A 1RPKA 1XDLA 3T55A 3TYAA 5L6UA 1J2BA 3LEPA 4L80A 3W82A 2DVXA 1PCWA 2EKGA 1PZ1A 3LUTA 2INFA 2OSXA 2XH7A 1E71M 1KM2A 2E6DA 1SO5A 3PR2A 1JQXA 3PZOA 1C29A 3SR7A 4ZMGA 3LM3A 3LCGA 3SM0A 4L1WA 1MRAA 2GL5A 3O7UA 3MHFA 3WH9A 4DUWA 1ZAHA 4QQUA 1HIZA 2XU2A 4OJYA 2A3CA 5JMUA 1YNYA 2OOGA 3W7KA 4QHRA 2XYLA 2PDWA 1UKTA 4MIMA 4M24A 5D30A 3BUVA 4ZZ9A 3NQ8A 5I3DA 3EXRA 1KQZA 2V8ZA 3LENA 5TF0A 2WC4A 4C5ZA 1L6SA 3QSRA 1JRBA 4R5EA 1ISWA 4PUWA 2PUZA 1MW0A 3JS3A 2Z4GA 1K70A 2A5HA 3H7RA 2WC3A 3UA4A 1XXXA 4PL1A 4E38A 1LRTA 4J27A 4TX9A 1HN1A 1EJXC 1GEQA 1YTEA 5BOOA 2WSPA 1FHLA 3PTKA 4NXKA 1P0NA 5CJNA 4KFNA 3E49A 2JF7A 2ZXQA 2FFIA 3IACA 1ICSA 4YVVA 3LTYA 3N18A 3QV8A 3AIBA 4YL2A 1Q4NX 1E4IA 2ZXAA 3CL7A 3ZSTA 3WO8A 1T0OA 3W07A 4RE0A 1F5ZA 1P6CA 3SCOA 3R10A 3QH2A 4JTFA 4GUGA 1ZL1A 3CIVA 4AW7A 3L0GA 4QG8A 1QAPA 3W7JA 3VKBA 3S42A 1V7AA 3NDOA 4JL1A 2CKSA 3ZJ8A 1QU4A 4CEUC 5I24A 2XSAA 1TCMA 2HE8A 3S2JA 4JX4A 4XZNX 4RZ5A 3MV11 2AAMA 2EXOA 1QHOA 4DO7A 3P93A 3QKZA 3MCNA 3KCOA 1AG1O 4JTUA 3Q65A 5JVLA 1CDGA 4MY8A 1NWSA 2G3IA 2EQDA 2NT0A 4IM4A 3MV01 1QOQA 4WKHA 2WVUA 4ZQPA 3FV9A 3N14A 2ZDRA 1GOIA 1NIUA 1OFBA 3DHDA 3LHVA 3T08A 3ARSA 4XUGA 4ACYA 3ZT6A 1UP0A 4KEZA 2UWFA 5HNRA 1XLMA 1W9UA 4IFOA 3VCCA 4FXRA 4JTEA 3TJ4A 4REQA 1ZP4A 4DUVA 2JFEX 3GNRA 4A8IA 2D2OA 1SFTA 3ZR4A 2QMJA 3AIWA 4C7DA 5I0DA 2GQAA 3UPBA 1KRMA 2QHAA 3U8GA 1VHCA 4K6AA 2OSYA 2XINA 1XH0A 5DRIA 4LANA 1EGZA 1XQKA 4J3ZA 3L2LA 3AO0A 4OU1A 3A9IA 4O0QA 4N9CA 1KM3A 3HB9A 1XLFA 2Z27A 2X40A 3PBYA 1KCXA 3C3NA 2QUVA 5FF3A 4AVNA 4QBXA 1KFBA 2O9PA 2J27A 4MNLA 3IUIA 1H1YA 3RCNA 4O10A 4A21A 2YX0A 3W24A 1SSDA 4NAEB 3ITCA 3PZVA 4MWAD 5BRQA 6REQA 1UWAA 3HMCA 1TREA 3QV9A 4NVTA 3DHFA 3CT2A 5H1WA 4O1EA 2PU0A 1DL3A 4Z42C 2ZXBA 3BOFA 2D0FA 1EA0A 4XD6A 3WEMA 5I09A 3CQJA 1TSIA 2DZAA 2DP3A 2OTDA 2X0SA 4JQ2A 4RDVA 3W7MA 3QGKC 3QQ0A 5FCZA 4Y9PA 3TN6A 1YRRA 4ZO9A 4XBJA 1FHUA 2V3GA 2Y70A 1U5VA 2AGKA 4HOXA 2VHLA 4UFIA 3WJXA 3GAKA 5KTLA 1U1HA 2WJEA 2A3EA 2RDXA 3PB2A 3WD2A 2XM2A 1S46A 1W9VA 4BY3A 3PZUA 4IGNA 1NF7A 3UR7A 3W01A 4XD5A 2ZQ0A 3WN6A 3KDOA 3M0YA 4L5ZA 5DFAA 1PKLA 4DJEA 3VIOA 4DF0A 1XG4A 1JEZA 3CO8A 3WQVA 4GABA 4LW7A 2ZC1A 1LJYA 2CHNA 4DJEC 3TA6A 3SY1A 3UJFA 1EGMA 1VRDA 3VAVA 3Q37A 1TVLA 2PBOA 3NZRA 4FK9A 2VOMA 5CSUA 1RPXA 4G9PA 3QOKA 3APGA 1QR7A 1XUZA 7REQA 2QW5A 4LV4A 4D8ZA 3E5PA 3R25A 3MKKA 4DJFA 3RM4A 3D3AA 4MKVA 2PWHA 1RSCA 1W9XA 3NOEA 2GVEA 2OO6A 2VEIA 3CPUA 3SCWA 3FYYA 3MMUA 4ZFCA 1A47A 2WVVA 1SZRA 4W5UA 2X09A 2QCDA 3PP7A 1TJ1A 2BGNE 2QCGA 3T2OA 3W1LA 1RXOB 3TAOA 3EYPA 4F4RA 3THQA 3TA9A 3W23A 5I3FA 3TWAA 3AJXA 3XIMA 4JN8A 1OFOA 4JIPA 1EUAA 4PODA 3TW9A 3LCLA 4O0KA 2QCLA 1UZDA 3QZEA 1YE4A 3SCTA 4C7FA 1ZP3A 1JPIA 4NZFA 4QJ4B 4I9MA 2A6NA 2ZUUA 3DI1A 1V6XA 3HBLA 4NXSA 1UWTA 4L56A 2BGQA 4JTJA 2RGLA 3M64A 1JAEA 1PSCA 1VFOA 3K46A 1WKEA 3R11A 3B03A 3NYDA 4IPIA 4PMJA 3C0SA 4QXIA 3TIMA 1HKMA 1S2WA 3GHUA 2HBXA 3AXIA 3DKJA 1XCFA 3WLNA 3W7NA 1FDJA 4DO6A 5JBFA 2Z25A 1JYNA 3U2EA 1MZHA 2EPLX 1HKKA 3U4AA 3UERA 2J13A 3K30A 2QAPA 3VDCA 5F4SA 3H2CA 1VH7A 4IFKA 3NL3A 4NJHA 3LRKA 3CUIA 2BX7A 3PJXA 3NQBA 2X41A 1WBHA 1QK2A 1LDCA 2E6AA 3FEQA 1FWIC 3NQ7A 4NAFA 4BWLA 2JE8A 4Z1BA 4JHOA 2Z6IA 4MGGA 1NSJA 4L1GA 2EJAA 4ICMA 1YNPA 1NH6A 1ELSA 3KWXA 2QDHA 5BROA 2I17A 5U4NA 4PA8A 1WB0A 4DBSA 5I03A 2PAJA 1W5OA 1PTGA 1AJ0A 4GXWA 4X0VA 1LG1A 2WO5A 5LNUA 2UBPC 5AHIA 3UXDA 4GGBA 3G1DA 3KS5A 5DY3A 3UXAA 1K7EA 3FYPA 4M8UA 3JZEA 2RDWA 3MANA 3CV1A 1TPB1 1PYMA 3GY1A 1NVMA 1I6NA 4M82A 4XKYB 3QFWA 4NYYA 4YPJA 2GWGA 3ITGA 1K9EA 1YBQA 5HWMA 4Z2LA 2WHJA 2BXYA 3T81A 2HROA 3NJ3A 4PUEA 1BQGA 2Y7GA 3TN4A 2V2DA 4HU4A 4H8UA 2ONEA 2VFEA 1F9CA 2BNJA 3UWQA 3LRMA 1Q6DA 4GVFA 3RDKA 3CS2A 4NU7A 1F2JA 4F0SA 1O68A 2FVMA 4Y9AA 2WVVB 2D1ZA 3IVSA 1ZGDA 4LAZA 4ZL1A 1OCJA 5C54A 2GQ8A 3RGTA 5BYWA 1VB9A 1FWRA 2VKZG 1MQPA 3V16A 1V0MA 1WCGA 5DX7A 4KEVA 3W27A 4GH3A 4PTXA 1E73M 3UYCA 4CNNA 4JTRA 1WZKA 5C7VA 3T09A 5BXTA 4RV8A 1Q6EA 4MAVA 4AWTA 3WQPA 3ICJA 3LERA 3IEBA 4DWSD 5T26A 4Q6JA 4OFCA 3TTOA 3DAQA 4X22A 2J75A 3V4BA 3R43A 2Q71A 1VKFA 3WFAA 1GOWA 3RG6A 3C2RA 1OBAA 1XFCA 3S9IA 5HR7A 1QPRA 1GZJA 1POJA 4DHGA 2IXUA 2OT1A 2EKCA 3NOYA 5AYBA 4ZXOA 3LXCA 4DELA 3WG6A 5AKQA 4ACZA 1TWDA 3IVTA 6TIMA 1EF2A 1F3WA 2EG6A 4GXPA 3HPAA 4RZ6A 3GG8A 2QMKA 3LA4A 1PIFA 2E09A 4ZB2A 5DCDA 3UP8A 2OGYA 5JH2A 3WCZA 2PF0A 1GJPA 4FS9A 4QE4A 2GPTA 3F5JA 4LOCA 3SUUA 3EKZA 3LSCA 2V3DA 3S8HA 2HQAA 4YTTA 4QJ1A 1XLKA 4PUDA 4PYSA 4FNUA 5J5DA 1NDZA 3AROA 4H2CA 4LY4A 1ZHAA 1R7OA 2VCAA 1IT0A 2D23A 4UFHA 2NXIA 2O9OA 1V6WA 3GAYA 4B92A 2O4QA 3UZJA 1IZCA 4H00A 2A3BA 3MPGA 2YPIA 1XYLA 3W22A 4MWAE 2HNEA 1L2QA 2EG8A 3FA4A 1X8FA 4R33A 1ZBKA 4TMBA 4EPDC 1AJ2A 4O18A 1BTCA 1V0LA 3WX7A 3FFSA 2CHOA 5CPSA 2HRWA 3VX0A 5M03A 3DOPA 4E0CA 1UBSA 5TNVA 2EHHA 1V03A 3WL1A 4Y9NA 3WDHA 2EEXA 1NF0A 4MKNA 1B57A 2XH0A 4LVAA 5EMUA 3L23A 3LZ5A 4TIMA 4AFYA 2PGFA 4F0HA 4Y9MA 1DQWA 4W8LA 3WDIA 1W37A 3KOZA 4FEZA 5HNTA 2NV1A 1TX0A 2IKHA 4K2SA 3EWUA 3IJQA 5TIMA 1AJZA 1W9PA 7PTDA 4AIBA 1X1NA 4TR9A 1S2TA 3VOJA 2Z2UA 4O4WA 1BXBA 3CZJA 2J7DA 2E9MA 3EX6A 4ROQA 3QMSA 2OVLA 3BOXA 1QPNA 1QI3A 1ZAJA 3ONCA 3TJLA 4YNGA 3BG9A 1P4CA 4L6OA 1GJUA 2I14A 2G8ZA 1O5RA 3BMXA 1KRAC 1J6PA 2NX1A 3P0XA 3UY8A 1W8GA 3GVWA 1JZ8A 1UJQA 1DHKA 2REQB 3EX2A 2GJXA 5H8MA 5LHEA 1DJQA 2R91A 2ZVIA 5G5IA 3GDBA 1TTJA 5D32A 3S1XA 1FWDC 5KETA 3LV6A 4QS6A 4F0RA 4Z2HA 3LCIA 1NWTA 3GH5A 3GBDA 3MHGA 2QIWA 3K8KA 4GYKA 2YBUA 1XLIA 3QMTA 3AZTA 2HE5A 4IJRA 4JDYA 4GZ7A 1G4EA 5AY7A 4KQNA 5FKYA 3VNJA 4IMEA 1O60A 1R3TA 1DIOA 4PB5A 1V0KA 3UETA 4G7EA 2ISDA 1N8IA 1T40A 4UR8A 3S2CA 1S1RA 2P53A 1OT1A 1JCTA 1P6WA 1E6ZA 4W5ZA 5CJMA 2VOTA 4XV0A 2Y8VA 4LCSA 1C9WA 4OBTA 2VZUA 1E0TA 2WKLA 3H2EA 2EJ1A 1P7TA 4MNMA 3WLIA 3A12A 4N9BA 3TN3A 5HQMA 3M9YA 4DO5A 3ZZ1A 1UOZA 1TTQA 1I8JA 4DWDA 3TYEA 4G8TA 3ALFA 3BAWA 4HKPA 3ARYA 3UT0A 3MI2A 3O6YX 1OK6A 3NQEA 4JR5A 3T8LA 4DLFA 3T8QA 3NUKA 2QJNA 3V5CA 4GX8A 3B8IA 3AXXA 2AOSA 2VGGA 4WGXA 1UR4A 2Y89A 4MNKA 4X9YA 1TPWA 3LQGA 3H7VA 4RW3A 3AI0A 3VGDA 1VFLA 2FMNA 3BG3A 4EANA 3FHQA 1ZENA 3WK3A 3IPWA 1EC8A 4H9YA 4LF1A 2NV9A 5D03A 5M3WA 2QF7A 4Q4MA 4A29A 4PC8A 2O7QA 1QPOA 3H2MA 5FJOA 5M1TA 3VOGA 1W1TA 3NSXA 5CQ1A 4GUHA 4PMOA 1EQPA 1GOMA 3R12A 2E28A 1MVYA 4PRWA 4J28A 4FALA 2Q09A 3FOKA 4Q8PA 3PAJA 3AXHA 2VC5A 3C8NA 2EGZA 4QR6A 1N55A 1US2A 4LGXA 1V08A 1B2YA 2VI0A 1WKDA 3W75A 4E8GA 3M1ZA 4C5YA 1GWJA 1MW2A 4QNWA 2XH4A 4H2HA 3OEXA 4FLRA 2CFFA 1GVQA 4NX5A 3MCOA 4ADUA 1K6AA 1WXZA 3C61A 3SJ3A 3A3HA 3EMZA 4DPPA 4KCWA 4AIOA 5I02A 3A4JA 5F1UA 3SDOA 2J7BA 1JPDX 4PTMA 5C6MA 2JIEA 3CZ8A 3KTCA 3CC1A 2ZA3A 4NAFB 1U1JA 2CLKA 3GR4A 4Q6XA 1O4UA 1G7VA 2PLJA 3MYPA 3FSTA 3EMQA 1EHAA 1HW6A 3R0UA 3UEQA 3SJNA 4EIVA 5LIYX 3ARZA 2I5QA 3W74A 1UD4A 1C7TA 4AG0A 4IIBA 1ICQA 1FP9A 4LNCA 3BMVA 4MFDA 4ZBCA 8A3HA 1GZ1A 1XKJA 3CQHA 1JFXA 3GR7A 4W9TA 3L2IA 1UH4A 3W6MA 3CIWA 2FHCA 2VC9A 1E0WA 2B7PA 4FR1A 4GLEA 4AXNA 1MEWA 3O3RA 4DBUA 1E6XM 1UC4A 4MDOA 1OCNA 4PMVA 1KGUA 4WUIA 3GKAA 3NNTA 1K8YA 1QHZA 2YBTA 3DYPA 3UY7A 2CPUA 3MYOA 1E6RA 2YCEA 4UZUA 3UR5A 1IR2A 4F2UA 2I1OA 4OTKA 4IWWA 1MRQA 1JCLA 1H7XA 4EXAA 2B7NA 1HL8A 1J96A 2C13A 2CLEA 3OOQA 3IGUA 1DKWA 2CLMA 3THDA 3FGCB 1UKSA 3GC4A 4AEEA 2V0TA 3AZSA 3DZ1A 1GG1A 4O0ZA 3IIXA 2VCBA 1UIPA 3EA3A 3KOWA 3ARQA 1BWLA 3CV6A 3GU1A 3GZ3A 4W7VA 5AVHA 4AY8A 3QC0A 4QEEA 4GI9A 2V69A 2YW3A 5K7JA 4QNEA 3AS0A 1DHPA 1JPMA 1VLWA 3E0LA 3OHIA 4HMNA 4JTAA 4QS5A 3B8DA 5MKGB 2YB1A 1DIEA 3FY1A 3C56A 5HQLA 1Q66A 1IWBA 4BHYA 2DUZA 3MSYA 1PE1A 1V6UA 1T7LA 1HVXA 2P10A 1X1ZA 3HF3A 3M0JA 4YWIA 4P7QA 1Z3NA 5HMFA 1H63A 3NTYA 4BQ5A 2Y88A 3SRDA 3UJ2A 1HKJA 3EKGA 4GXMA 1M3UA 2PTWA 4JXCA 2OQHA 2BODX 4GBUA 1TMLA 2OEKA 3STGA 3ELFA 4Z1CA 1M04A 1TG7A 4RPPA 5B7YA 3MUAA 2AKZA 1NP2A 2GJLA 1P43A 2HVMA 4MZYA 3R5EA 5BWAA 4IICA 1FWNA 5H91A 1GQJA 1YHTA 3T4WA 2ZZ6A 3N9SA 4KWUA 2ICSA 4EF8A 3C2OA 2XGZA 2OZTA 1FOBA 3ES8A 2FHFA 3VIHA 4Q8WA 4JN7A 2VX4A 2E5BA 2UY4A 3RX4A 3ARXA 3CL6A 2IXVA 3BVJA 3VIFA 3KAOA 1FWJC 3KBJA 1TIWA 1B1YA 1B9ZA 4B90A 4LS2A 4BR1A 5CZ0A 4LFYA 5I23A 4GBDA 3GLCA 2CZVA 3CAVA 1C7SA 1IGWA 2WK2A 2FZNA 4JGDA 1E0VA 4GVHA 1W3HA 3NYZA 1UUMA 3F4DA 3H2OA 3W87A 1UD6A 2VDIA 4IL2A 1YPIA 1K4GA