4AD1A

Structure of the gh99 endo-alpha-mannosidase from bacteroides xylanisolvens
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
349
structure length
349
Chain Sequence
NNLGTELDYDTFCFYYDWYGSEAIDGQYRHWAHAIAPDPNGGSGQNPGTIPGTQESIASNFYPQLGRYSSSDPNILTKHMDMFVMARTGVLALTWWNEQDETEAKRIGLILDAADKKKIKVCFHLEPYPSRNVQNLRENIVKLITRYGNHPAFYRKDGKPLFFIYDSYLIEPSEWEKLLSPGGSITIRNTAYDALMIGLWTSSPTVQRPFILNAHFDGFYTYFAATGFTYGSTPTNWVSMQKWAKENGKIFIPSVGPGYIDTRIRPWNGSVIRTRTDGQYYDAMYRKAIEAGVSAISITSFNEWHEGSQIEPAVPYTSSEFTYLDYENREPDYYLTRTAYWVGKFRESK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords GLYCOSYL HYDROLASE FAMILY 71
publication title Structural and Mechanistic Insight Into N-Glycan Processing by Endo-Alpha-Mannosidase.
pubmed doi rcsb
source organism Bacteroides xylanisolvens
total genus 128
structure length 349
sequence length 349
ec nomenclature ec 3.2.1.130: Glycoprotein endo-alpha-1,2-mannosidase.
pdb deposition date 2011-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16317 Glyco_hydro_99 Glycosyl hydrolase family 99
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4ad1A00
4BZYA 3EDDA 3N17A 1QW8A 3DHPA 3TTYA 5C71A 2UWFA 3WNPA 1CXIA 2WMJA 4AW7A 4OKDA 5FCZA 3U7BA 3RIKA 1TG7A 2QLYA 2BY2A 1JZ4A 2YLLA 2EPOA 3AIVA 3ARZA 4ACZA 2XHYA 4A4AA 1DWAM 2D20A 1J11A 2VZSA 4D6CA 1OT1A 3WH5A 2ZX9A 3VKKA 3MV01 2O92A 4MNLA 2DH3A 2CBVA 1VFOA 1FHDA 2D2OA 1KGXA 2WB5A 1EO7A 2XM2A 5HBFA 1CGUA 1DWGM 5DO8A 1LWHA 3VGFA 1HKIA 1UD2A 2FHFA 4HMEA 1MFUA 5E6YA 1DWJM 5BXPA 2BV9A 2JFEX 2WZIA 1VEPA 3BH4A 4TXEA 1WNOA 3KL5A 3BAIA 2G3MA 3M07A 2Y8KA 3T0BA 4YHEA 3CLWA 3AXXA 3L4YA 4AEEA 3BCDA 1ECEA 2ZXBA 4OIFA 3WD2A 1SMDA 4AXNA 4J7RA 3WELA 2WCSA 4W86A 4BQ3A 4GI9A 1OM0A 1V3HA 3VDHA 3VINA 4W5UA 1JYNA 3UCQA 3AIBA 1KR1A 1NOFA 4JZ5A 3K8LA 4D1JA 4AD4A 1JAKA 2OYLA 4OUEA 1VBRA 3OLEA 4M56A 3ARRA 3SCVA 3SUUA 3VGDA 5GQBA 1K9EA 1J0YA 3BLKA 3TTOA 3ARSA 1CGXA 1R8LA 3TOPA 1CLXA 5DFAA 2O9RA 1WE5A 3ARPA 1H5VA 2YIHA 2ESCA 1UD8A 5C70A 1C92A 3GH7A 4J28A 2D0FA 1QHPA 2WVUA 3ECQA 5KEZA 1C8XA 3CMJA 2XWDA 4GZEA 3EDJA 2V3DA 5D9NA 3W53A 2O9TA 2YDRA 2XM1A 3T2OA 2GDVA 1CGWA 4H04A 4UFMA 2J8FA 4U2YA 4WKHA 1W3KA 2J7DA 1K6AA 4PMUA 5IFPA 2Y2WA 3EYPA 4PTMA 4H8UA 1V02E 1W91A 2V3EA 4UFHA 4CCDA 1O6IA 2ZXQA 4PTWA 2GVYA 1XSJA 3CGTA 2C0HA 1U33A 1ISYA 3GXMA 5DF0A 1W9UA 4PSPA 4PRWA 4PTVA 1MXGA 3WL0A 4W84A 1AQHA 1AQ0A 5AC5A 2ZUTA 1U2YA 4JCLA 1CDGA 5GPRA 3FW6A 1E6NA 3MUAA 5A6KA 2Y8VA 1V02A 2QHAA 3CUGA 1H1NA 1KWGA 2VX7A 5CGMA 4HPGA 1JZ7A 3L4XA 1E70M 4ZEPA 4W89A 1KGWA 1CEOA 3CZEA 3W4RA 3B9AA 1G01A 1E15A 2D23A 4U5IA 1NWTA 3AHZA 4UNIA 1IZJA 1E0XA 1HJWA 1J01A 5CLWA 4HMDA 2EO7A 1U30A 3MANA 3VIHA 5A6BD 1J0ZA 2WHKA 1KXTA 4MNMA 2D0GA 2NT0A 2YL9A 5A2AA 1GOMA 3BXWA 4Q22A 1WZKA 1W1TA 1OIMA 4MB1A 1B9ZA 2CNCA 2WPGA 4HA4A 4XZWA 2XYLA 3AHVA 4R27A 1R7AA 3T09A 3WUGA 2D3NA 2XFYA 3ZQ9A 3OA5A 3K46A 1J18A 4AIEA 1E0VA 2EPMX 1J10A 2EBNA 2VR5A 1H41A 1HN1A 4NRSA 3MUY1 2JIWA 3IAPA 4U33A 2Y5EA 3CHEA 5EFFA 3WDJA 4TTGA 3VMNA 1XSKA 2J7GA 4U3AA 2J77A 4AZBA 2UY2A 1UYQA 3PHAA 1R86A 3NJ3A 2EPNA 1L8NA 1EHNA 5CPSA 3KL0A 4KRUA 4KWUA 3WY1A 3EDKA 3U57A 5ABEA 2GJXB 4QDMA 3UETA 2VR4A 5JBEA 1OINA 1CYGA 2XFFA 1WZLA 2X1IA 3BGAA 4FMVA 2NW0A 1MWOA 2W67A 3NYDA 1C8QA 3LPPA 1UR0A 2GJXA 1PBGA 3L4WA 2ZWZA 1OSEA 3ZR6A 1BVNP 2A3HA 5AC4A 3GXFA 1OB0A 4CCCA 2VCAA 3BMWA 3GNPA 3VNZA 2OSWA 1VJSA 1V3IA 2J75A 1Y7VA 3ZJ6A 2F2HA 1MQPA 2W62A 3T0DA 3WDQA 1ZBKA 5A2BA 3NIYA 2ZWYA 1QW9A 3PZGA 4W8BA 3T0AA 1C93A 2J7HA 3F5JA 1XYZA 4D1IA 4M80A 4CU6A 1WDRA 3E1F1 8A3HA 1HKKA 4UQBA 1VJZA 4LGXA 2WW5A 4C7DA 3KWXA 5D9PA 1UR1A 1CPUA 1E71M 1G1YA 3LMYA 1GQLA 3WUFA 1EDTA 2CIPA 2GJRA 1AMYA 2C8NA 4PN2A 4AZ7A 3TONA 1W9VA 4F9DA 4P7RA 3WQ5A 4PMRA 3WD3A 4GKLA 4MAZA 2ZE0A 5A6MA 1UQYA 4JKMA 1HJQA 2E40A 3K1DA 4WLCA 1OT2A 4B16A 4GZJA 3PZ9A 3ZM8A 1XC6A 5BXRA 4HPHA 2A3AA 5BCAA 1NOUA 3GTNA 1HP5A 3SCPA 4DWSC 3OZOA 1KQYA 1NQ6A 1H11A 4AD1A 1BYCA 3MMUA 4P7LA 3VD9A 1B0IA 2NSXA 1EQPA 3EMZA 3SCNA 3RM4A 5I0DA 1UH2A 3CPUA 4J3TA 8CGTA 1MFVA 4KRTA 1LL6A 3CO4A 2QMKA 2ZICA 1W1VA 1B30A 2Z1SA 5EBAA 3VGGA 4HOZA 1QOXA 1X6LA 1C91A 3FY1A 2A3EA 4GQRA 4ZE5A 1E4IA 5HPOA 1EGZA 4XX6A 5BROA 2WMFA 1UR9A 1VF8A 4B3KA 2WM0A 3SUTA 3VIKA 4URIA 2V5DA 3EMQA 3WF4A 2EJ1A 1ISZA 5CLTA 2IXVA 3WD0A 1ISWA 1WDQA 3CZJA 1VIWA 4D6EA 4DWSB 5CSUA 4H2CA 1GHSA 1B3VA 4V2XA 4QLJA 3N9KA 3WBEA 3WNLA 1OGSA 2VI0A 2EQDA 5DEZA 2ZUNA 2BHUA 1ODZA 3II1A 4BA0A 1E6SM 1CECA 3B8SA 1ZBVA 4PEEA 2FH8A 1HJSA 5A69A 4Z2HA 2X09A 4QCEA 1E43A 4A3HA 4CU7A 1VFMA 4D6IA 1E73M 3UG5A 2G4FA 4K68A 5M5DA 2Y24A 1LWJA 2J8GA 1W2VA 2D0HA 4WJXA 5HOSA 2CCRA 1CIUA 1E1EA 1HL8A 2XVGA 2DPEA 2ZUWA 2G3IA 3AIUA 5AYBA 1E55A 3RM8A 4D6JA 2HVMA 1QI3A 1B90A 3SCQA 2WKLA 3SCWA 2GJPA 4HA3A 5A6LA 1M04A 4PUEA 5LA0A 1W1PA 1WDPA 2UY5A 3ARWA 4W8LA 3TA9A 3WH6A 1CXFA 4JKKA 1J0JA 3PZIA 2QPUA 1UD6A 1XRVA 3MUZ1 2DH2A 7CGTA 1TA3B 1V6UA 4WK9A 4B3LA 1VFFA 2ZX6A 3WFLA 1PJ9A 2B31A 1BTCA 5I2UA 4ATLA 3FAWA 1TA3A 1BSIA 1GONA 3TTSA 1E4MM 4TVDA 5A8OA 2TAAA 4F8XA 3VTRA 2W92A 2VX4A 2V3FA 4AZGA 4AIUA 4U2ZA 5E70A 1M01A 3T2QA 3AISA 1EXPA 4XB3A 4MJ4A 3VX1A 4X0VA 3W29A 1E6ZA 4AISA 3VD7A 4JAWA 1W1YA 5A1AA 3B9DA 4NZCA 3THDA 3ZOAA 4D6HA 4JFUA 1E6RA 1FP8A 2CXGA 4ACZB 5I24A 3OLGA 3A6OA 4BCEA 1P6WA 2BVTA 1UZ1A 3VIIA 5I77A 3VOCA 3J7HA 3NDYA 5TD4A 4CU8A 2ZOXA 3AHYA 1LJYA 5F7UA 5IXEA 2DQXA 4DM1A 1UWSA 3VDCA 4MNKA 5DMYA 3OIHA 3VMPA 2BY3A 3CHDA 1ODUA 3AMCA 1ISXA 5JBDA 3UESA 3TP4A 4L4OA 2V3GA 3T2PA 3VX0A 3VPLA 1V0LA 1D7FA 3WQVA 5IFTA 4HA1A 2WHJA 1W3HA 4HMCA 3BLPX 4XUYA 1KB3A 2CESA 1K9TA 1Q6FA 3GM8A 4OOZA 4MB5A 3WMSA 3QGVA 4XV0A 3KZSA 4J3XA 3GZAA 5BYWA 1UUQA 2BVDA 2WNWA 1JD7A 1JGIA 3WIJA 3A4AA 2WAGA 4NI3A 5D4YA 3S6TA 1TMQA 4HZ8A 2VQUA 4JFVA 1FH9A 2VVSA 1WB0A 5JBFA 3PZUA 1KCLA 5I23A 1JXKA 2DDXA 4QFUA 1HVQA 4H8HA 3ZSSA 1CGYA 2XJ7A 3ZJ8A 1HXJA 1QNRA 2WC3A 3AMDA 3KE0A 1GOIA 3T08A 4TUFA 2QF8A 3ARXA 4Q7NA 3AHXA 1J0HA 1JF5A 3W27A 3I3BA 4QLKA 3VIGA 5GNYA 1F4AA 2OSXA 1LLOA 2ZIDA 1AQMA 3IJ7A 1RP8A 1BF2A 4AMCA 4TVUA 3L2MA 2IXUA 2WHLA 3BSGA 3LPFA 4DWSD 1HVXA 4X9YA 2J47A 2PWDA 2J25A 4TOQA 2CYGA 2W66A 5M3WA 3VIPA 3L2LA 4UQCA 1UR2A 1MXDA 3ZR5A 4YPJA 5CSYA 1C90A 2C7FA 3VDBA 4FK9A 1WP6A 4DM2A 3AS1A 2OWCA 1GPFA 3VGHA 3N13A 4MAVA 2ZUMA 1XV8A 4UOZA 3IK2A 3ZT7A 2BNJA 2QV4A 3RO8A 3F5KA 1AVAA 3WQ4A 3SCOA 2G41A 5AY7A 4X0NA 4KGLA 3ALGA 1QI4A 4JFSA 4AC1X 1W9XA 2YL5A 3DHUA 1HT6A 3WQ6A 3O2LA 2BS9A 3OGSA 3VUPA 4GQQA 2YA1A 4W8AA 3WDIA 2VX6A 3MMWA 3GNRA 4D6GA 1UA7A 4GO9A 4F66A 4GO8A 4AWEA 1OCQA 1QNQA 3ARYA 2JF7A 3PTMA 4JCMA 5A94A 2YBTA 4W5ZA 1UQZA 2J74A 1BQCA 2CBJA 2Y4SA 3OG2A 3AZRA 3CBWA 3D5HA 3SUWA 1RP9A 3W0KA 1UA3A 4BQ4A 5AYIA 2UY3A 1E1FA 3AQUA 4GZIA 1VAHA 4E8DA 1H0GA 5LA1A 1RPKA 4UQDA 3N1AA 4QP0A 3K8KA 1JYWA 1W32A 2BXZA 3VMOA 2V38A 1C3FA 1OGBA 2VT0A 2FHBA 2W91A 1V0NA 1HKMA 3W81A 1XYFA 3WD1A 2DSKA 4LYPA 3CZGA 1ZBCA 3AHTA 4LQ1A 3IAQA 1I1XA 2WK2A 2EXOA 1SFSA 1TR1A 3HU7A 3OB8A 1ESWA 4FLSA 2IUZA 3WN6A 4AEFA 5CQ1A 3RMEA 1GOWA 4ZXOA 3AFBA 3BAJA 2X05A 5JIWA 3IANA 1G9HA 1KGUA 2CHNA 1E6PA 2VZOA 2DT3A 1FOBA 2F8QA 2WZEA 2PWHA 2XGIA 1J9YA 2XTKA 5A8NA 1D3CA 2PWGA 1GZJA 2VCCA 2ZX5A 4R5EA 3TTQA 5D8ZA 4HU0A 3GXDA 2PI6A 1HIZA 1V3LA 3SCRA 1GOKA 2X0HA 3MS8A 1QI0A 5A6JA 3U7VA 1W3JA 1YHTA 3G6MA 1JYVA 1JZ5A 3WDHA 1XCXA 2EPLX 2E9MA 1GOOA 4W85A 2VJXA 3SCSA 1HX0A 3CTTA 1CGTA 1KR0A 3VDAA 4JKLA 3AI0A 2XPKA 4JHZA 1CGVA 4ACYA 4P7QA 4IUGA 1L0PA 3BSHA 4UOJA 4BS0A 1NH6A 1JAEA 4CD7A 2DIJA 1QNPA 3O6AA 4AIOA 2W61A 1OBAA 1M03A 2OYMA 2EEXA 1NP2A 3CZ8A 1EA9C 3VIOA 3VILA 3FHAA 3PZMA 4BQ2A 1BFNA 2WWDA 4CN6A 1QNOA 1JF6A 4M82A 1PAMA 1XD1A 1EIBA 1JYXA 5BRPA 2AAAA 3NSXA 4M24A 5I79A 1VEMA 4B9YA 2RGLA 1V6WA 5LYRA 1ITCA 4JL2A 4CN4A 3GNOA 1JIBA 1BLIA 1B1YA 5IHSA 5EB8A 4OBRA 4PUDA 3WQWA 2ZUUA 4TTUA 3SURA 2WMIB 4W87A 2D24A 3WNMA 2ZXAA 3RJYA 2XIIA 2GSJA 4WF7A 1GQKA 1UR4A 1JDCA 2DT2A 2WBGA 4JFWA 4UTFA 2WMIA 1OD8A 1SYTA 2DT1A 2ZX7A 1CZ1A 4PMZA 1Q6GA 2OLHA 3SCTA 3AIQA 4D71A 2NT1A 1W3LA 4D72A 2D1ZA 2FGLA 3N04A 4CUCA 4DUVA 1BGAA 2RGMA 4JL1A 4CD5A 1EDGA 4OBSA 2E0PA 5CGTA 2XGBA 1H3GA 4MDPA 1XH1A 4HZ7A 1JXJA 3ARTA 4HTYA 1GJWA 2X2YA 3L4VA 2J7FA 2D22A 1WO2A 4LXFA 4B9ZA 1QBBA 1PEZA 1IV8A 1QVBA 1E5NA 1GNXA 3DYPA 1ITXA 3AZSA 4RE4A 2ZXDA 3EDEA 3W38A 2OYKA 1J0IA 1W9PA 3PZTA 1V0KA 2DSVA 3AS2A 3JUGA 3OGRA 1FFQA 3W37A 4LPCA 4MB3A 4PYSA 2DEPA 4AZIA 2PBGA 5M03A 1EHAA 1UKQA 2GK1B 3SIMA 1ZB5A 4UQEA 3QHMA 3F5LA 3I3DA 3PTKA 1CXEA 2PBOA 2BY0A 1A3HA 2YL6A 4P8WA 2GK1A 1QBAA 2UY4A 2XSAA 2YDQA 3ALFA 2J78A 1JI1A 3AIRA 4QLLA 4H7VA 4NSBA 1C7TA 3CUIA 3W24A 2WLYA 2AMGA 2QPSA 4FLRA 1ZL1A 4CGTA 3WL1A 2EPKX 6A3HA 1SR0A 1UH3A 3AIEA 7TAAA 4MTVA 1Q6CA 3WH9A 4CVWA 1PZ3A 2VCBA 5A6AA 2FGZA 1BG4A 4FF5A 5ABHA 1E6QM 3NSNA 4M29A 1J0KA 3OLIA 1B3WA 4YN5A 1MW2A 2WC4A 3WNOA 4UFKA 4U31A 4GINA 1GCYA 1WDSA 1V03A 2XVKA 2G3JA 3IJ9A 4PMXA 4U3CA 4XZBA 2CKSA 3I3EA 1VFUA 2MANA 1OWQA 2W5FA 2VQTA 5EFDA 2Q8XA 5FD0A 3UG4A 3VNYA 3N11A 5I3DA 1KQZA 2V5CA 2E8ZA 3AXIA 3WH8A 3AICA 3WUBA 6CGTA 1W9DM 1ZBWA 4MJ2A 1UWUA 1UWIA 2VRJA 5CXPA 3WFZA 5FL1A 3DC0A 3OZPA 1NP0A 3W6LA 2WANA 3PZQA 3L4ZA 1PZ2A 1E4LA 5A95A 4W7VA 3ZIZA 3VO0A 1B3ZA 3PZOA 4PMVA 1DTUA 1XGZA 1FP9A 4WSJA 1UKSA 1XD0A 2O9PA 2XVPA 5I5RA 1MQRA 2J7EA 3AMLA 2BXYA 4EAMA 1M7XA 1VEOA 4M81A 4D6FA 2OWXA 3CHFA 5C8BB 1C7SA 2J79A 2XVLA 1TCMA 5A6BA 1EH9A 2XWEA 2GDUA 1EQCA 3WKZA 3WF2A 1DWFM 5I6SA 2YOCA 1E40A 5CPTA 1A47A 2VZVA 1VBUA 3MSGA 3W82A 3GH5A 1TFVA 1WKYA 1V6XA 2WVSA 4JIEA 1FH8A 1B3YA 4AY1A 4TX8A 4GI8A 4RL3A 5DT5A 1BGGA 2WBKA 3HJEA 3AOFA 3GBDA 4P8UA 3VIMA 2G3NA 2X8RA 4IISA 1XHGA 2ZUSA 4S3JA 5E9AA 1QI5A 3M6DA 4WKFA 3VM7A 2WLZA 7A3HA 1KXVA 1CXHA 3W26A 2DSUA 2YLAA 1TZ7A 2J62A 4UR9A 3PTQA 3UR8A 3RCNA 4MNJA 3ZT5A 4P8VA 4UZSA 1TUXA 3WDPP 2CBUA 3MKKA 3O9NA 3PBGA 1XCWA 1J12A 2G8ZA 3RILA 5IHRA 5E0FA 5IDIA 3CZLA 3N18A 1ZJBA 3OBAA 5ECUA 5BWFA 1HL9A 1MW1A 2VC9A 3GDBA 5HXMA 3F4VA 3FHQA 3SUVA 1DEDA 1JZ2A 4KGJA 4J3SA 1PX8A 1HJXA 4CD4A 3MSDA 4IM4A 4GPNA 2CITA 3WEOA 1UZ4A 1W2PA 1E9LA 2WXDM 3AS0A 1E4NA 4RE2A 1JZ6A 1CTNA 1WPCA 4MB4A 1V6VA 3WBAA 1QHZA 5FIPA 2YA2A 1HJVA 3RM9A 1VENA 2PWFA 2YKKA 3EDFA 5CJ5A 1MQQA 1JD9A 5BRQA 4P7NA 4MDOA 1V3JA 1GVIA 4V28A 2CPUA 1KFWA 9CGTA 5A3HA 5FOOA 4MPKA 1GORA 1DHKA 1FH7A 3UERA 3WMBA 3THCA 4Z2IA 1UWTA 4GXPA 3FAXA 4ZXLA 4CD8A 3BC9A 1V3MA 4AZHA 3DYOA 1UD4A 3L4UA 2A3CA 3QHNA 5E09A 1KXHA 2WMHA 5CG0A 3SCUA 1MYRA 1R85A 2WC7A 4F79A 4PCTA 5A8QA 4D6DA 2YJQA 4ATDA 3CH9A 4AD0A 4IPNB 1US2A 1UWRA 3POCA 3VD3A 1E3ZA 1WAWA 4WKAA 1XH2A 2JE8A 2YL8A 1EOMA 4W93A 1ISVA 1FA2A 3MV11 1LG1A 1GHRA 4Y7EA 2VZTA 1PX4A 2VOTA 2WKGA 6TAAA 5D8WA 3N15A 1KBKA 1KBBA 1Q6DA 3ARVA 1JL8A 3POHA 1V6YA 1H09A 2W4XA 3FXYA 2WSKA 2XUCA 1I75A 5GNZA 4CKQA 3LPOA 2PF0A 1B3XA 1CLVA 1CWYA 3WEMA 1HNYA 3AMGA 4RE3A 1RH9A 4AZ6A 4HZ6A 5CPQA 1LF1A 2FDMA 4N0RA 3ZJKA 1UOKA 1H49A 4UOQA 1SMAA 1UWQA 1LL4A 1V08A 3NUKA 3AROA 3DECA 2OWWA 3WF3A 3UR7A 2YDSA 3CHCA 4U5KA 2AOSA 1E0WA 4OJYA 4ZE4A 4QCFA 5BXSA 1WZMA 2Z1KA 3AYSA 3VD4A 2JEPA 1GJUA 1DWHM 2JEQA 3AJ7A 2VRKA 3PZVA 3PZNA 1ZS2A 3MO4A 2XFRA 1BHGA 2O9OA 1BG9A 2WCAA 1NARA 4PMYA 3WNNA 1TVNA 4H8VA 4AZCB 4A3YA 1PPIA 3QHOA 4TX6A 3WF0A 1QHOA 4NRRA 1BYBA 3A47A 3CMGA 4LYRA 1JNDA 5ABFB 4AZCA 1D2KA 4W7WA 5D9MA 3B9EA 4JFTA 2WYSA 1LG2A 3K4AA 4FLQA 5ABFA 3LPGA 1LQ0A 1KWKA 3M7SA 2J4GA 1H2JA 2VUYA 4PCSA 3QR3A 4PSRA 2XIBA 3W25A 4BF7A 4LYQA 4P8XA 1DP0A 2XSBA 4OZOA 3AMKA 3U5UA 4EE9A 1VB9A 4EKJA 3BAYA 3IJ8A 2VNCA 5KZ6A 2VVNA 4UZUA 1KXQA 3VGBA 1JFXA 4AD5A 4GI6A 1X6NA 3BAWA 3GXIA 3AXHA 2CEQA 2FH6A 1GVYA 3RJXA 1GOQA 4H41A 1BYDA 2PB1A 5FKYA 4Z2KA 1OGGA 1UD5A 1S46A 2PWEA 2WMGA 3VD5A 2VO5A 3ZMRA 4HP5A 3UG3A 2D3LA 1X1NA 2WHMA 4LX4A 2ZX8A 2QMJA 3M46A 2DIEA 4UFJA 4GIAA 3SUSA 3VU2A 4CD6A 2BY1A 4IPLA 3WD4A 1PX3A 1JNEA 4M1RA 2J7BA 5JIPA 1HF6A 4PMQA 3MUIA 4AD3A 2DSWA 1G94A 5A6SA 4EK7A 1IT0A 3QOKA 1KCKA 3ZO9A 1E72M 3GYCA 1IZKA 1EOKA 2PC8A 4F9JA 4J3WA 1K9FA 2DSZA 3FNDA 2F61A 5BXTA 1E5JA 3ARUA 1Q6EA 2BHYA 1WCGA 3BCFA 1ZJAA 4PTXA 2VURA 4Z2JA 2E9LA 2XVNA 2WVVB 3MMDA 4FLOA 4PBGA 3CUHA 2E9BA 1GQJA 3S2CA 5I78A 1B2YA 4P7OA 2WVVA 4QAWA 2YBUA 3WMCA 4V27A 4OOUA 2CETA 3VIJA 4N42A 2VZUA 3NDZA 1B31A 3EBVA 5A2CA 2BFGA 2CHOA 3ARQA 3SEPA 1UG6A 1GUVA 1UKTA 2BVYA 4ATWA 3A3HA 1E3XA 5EMYA 1OIFA 1JDAA 3U5YA 1BAGA 1DWIM 1Q4NX 1V3KA 4CVUA 4CCEA 3CUFA 4ZFMA 4AYSA 1HKJA 4NF7A 1UKPA 2VL4A 2GFTA 2E3ZA 1GQIA 5GNXA 2GUYA 1R7OA 4BQ5A 4EANA 4E4PA 1BVZA 4UQ9A 3AS3A 1UD3A 3DYMA 5M17A 3RDKA 3EMCA 4WIWA 3ZJ7A 3HMCA 1CBGA 1EO5A 2WVTA 3CUJA 3N12A 4E2OA 4PMNA 3WEZA 5A8PA 2WCGA 1CNVA 1I1WA 4M8UA 3G6LA 4UCFA 1HP4A 5E0CA 1E56A 4UQAA 5LA2A 1H0IA 3NCOA 2CERA 4AZ5A 1NWRA 4WSKA 3BAKA 1RD6A 1NOWA 1W9BM 2VRQA 1MW0A 1PIFA 4UFIA 4JHOA 4E8CA 4J3UA 1UH4A 1JI2A 3NSMA 3A4XA 1M53A 3OGVA 3WF1A 1JZ8A 1CENA 3APGA 1NM9A 3W28A 3BAXA 4J27A 4L4PA 2E8YA 4UFLA 2WSPA 4C7FA 1US3A 3D3AA 3WENA 1XSIA 2JF6A 3CZKA 1QI2A 3K4DA 1JG9A 2DT0A 3A4WA 2A3BA 4B15A 3AZTA 3VVGA 1JDDA 4DUXA 1F4HA 2VX5A 4ZENA 4DWSA 4C7GA 1G5AA 4S3KA 2X0YA 3WSUA 3BMVA 1UKOA 4KMQA 1WZAA 2XG9A 5DT7A 1YQ2A 1TVPA 5D9OA 3WUEA 3VIFA 4MADA 4J3VA 1EDQA 5HPCA 3ZT6A 4TVCA 3MU7A 1UHVA 2W63A 3CIVA 2WWCA 3KL3A 2OSYA 3RPMA 3WNKA 2CBIA 3VGEA 2WMKA 1XH0A 2J7CA 2WZHA 3UEQA 1JFHA 1E6XM 2VMFA 5A8MA 3K8MA 2JIEA 1N82A 3HN3A 1MW3A 4ML4A 4W88A 3WH7A 4W7UA 4DUWA 3W6MA 1H4PA 1PIGA 1O7AA 1CXLA 4PMDA 1VRXA 4HU8A 3AYRA 4PMOA 1HJUA 3L4TA 1QNSA 2BHZA 1V0MA 1NWSA 1CXKA 1MVYA 4YHGA 4Z2GA 3WDRA 5E6ZA 5HNNA 4CN1A 4AD2A 4HOWA 1ZU8A 3WQ8A 5ABGA 1GW1A 1JZ3A 2CKRA 3AIWA 1R87A 3GBEA 1K9DA 1C8YA 3VM5A 2FHCA 3FN9A 1BYAA 5HDRA 1NWUA 1FHLA 1OD0A 2JALA 4KH2A 2YA0A 1G0CA 3PN8A 3OLDA 1UR8A 2DGAA 5FL0A 2HISA 4Z2LA 4HOXA 2E4TA 1Z32X 3QOMA 3ZSTA 1BPLB 3KEHA 1LL7A 1QPKA 5JUVA 2ZUVA 5CZKA 1FFRA 2VTFA 3GH4A 1TE1A
chains in the Genus database with same CATH superfamily
3EDDA 4JIHA 4DYJA 3DG7A 3DHPA 3VZYA 4AW7A 4ZOCA 3FEQA 3RIKA 1TG7A 2QLYA 1LQ2A 4E2VA 2FJUB 2QCGA 3H2AA 3N9SA 4PUNA 3EPMA 4KPLA 4ACZA 2XHYA 2D20A 4IIHA 4YTQA 3CT7A 4Q3MA 1A49A 2JBMA 3S1WA 3MV01 4O1EA 3DFSA 2FVKA 1FHDA 3M0LA 1KTNA 1QAPA 4PFMA 3WBXA 2GWGA 2XM2A 1CGUA 4QNEA 1DWGM 5DO8A 3TN5A 2Z29A 4DWDA 2Z7KA 1BEUA 1UD2A 2FHFA 3DCPA 4L9YA 3MP3A 4HMEA 5E6YA 3KP0A 5LGXA 4PB5A 2QVNA 2JKAA 2Y8KA 4DAIA 3ZS4A 1C8VA 2E1DA 3NYZA 3TWBA 1XIMA 3BCDA 4Q6XA 4OIFA 3RRXA 3QH2A 3WD2A 4AXNA 4J7RA 3W6YA 2WCSA 4YMZA 1MI3A 4W86A 4ALDA 4BQ3A 2V82A 1YXYA 4EOUA 3VINA 5XINA 3EB2A 3STPA 2JKPA 3K8LA 1JAKA 4OUEA 1M41A 1VBRA 4MYAA 1H7RA 3A3WA 1Z44A 3SCVA 2W79A 1J79A 5GQBA 1J0YA 8XIAA 4GNVA 1VS1A 1LRTA 3M9YA 1CGXA 1R8LA 2VD9A 3GAYA 5DFAA 2O9RA 4J3ZA 4MZYA 4J28A 2WVUA 4E3TA 4EP8C 3A23A 3EX3A 3CIWA 2YCJA 4O57A 4FP1A 3EZ4A 1U1JA 3U6WA 5IFPA 2Y2WA 4OE7A 3G1XA 5F2MA 3WJZA 2NZLA 2ACQA 2V3EA 3NA8A 1O6IA 4O18A 2ZXQA 1I45A 3FDKA 2GVYA 1XSJA 1U33A 1YEYA 4BF5A 1OFOA 2C1HA 2V2HA 3MKVA 1TZZA 4F4RA 1NDWA 1W9UA 3GFXA 1FHUA 1S3HA 3TU9A 2E7FA 3WLPA 4O52A 4PRWA 2QKFA 3Q94A 1MXGA 4Q4RA 1XF0A 5KZDA 1V93A 2B4GA 1AQ0A 5AC5A 1U2YA 2XINA 4JCLA 3ITGA 3UFYA 5ENLA 1E6NA 5XIMA 3GRIA 1V02A 2QHAA 2DZUA 3CUGA 4WZHA 3N3TA 2VX7A 2QCMA 4ZB2A 4CNUA 3CZEA 1TR9A 2B7QA 4Q8WA 4I9AA 1ZP4A 1F05A 1IZJA 1XIBA 4IMDA 2PDUA 4I5UA 1U30A 4FZIA 4Z17A 3VIHA 3KXQA 3IV8A 3QF0A 5A6BD 1KXTA 2R1LA 1GOMA 2Q3RA 1B9ZA 2OFJA 5CZJA 1UC4A 1DE6A 1R7AA 3WUGA 4DLFA 4GYJA 3K46A 3ENLA 4JIRA 4AIEA 4Q8MA 1QW7A 2EAWA 1SJDA 4RR4A 1HN1A 1Z6KA 3M0JA 3IAPA 4U33A 2Y5EA 2HTMA 3NDOA 2CLPA 4TTGA 2QJMA 3VMNA 1K8YA 1XSKA 2HSAA 4U3AA 3S42A 1VKFA 2J77A 1M7JA 4H01A 2XH2A 4TO8A 1GK8A 4AHOA 2ZBTA 4GUJA 4HN4A 2BGSA 2TMDA 2Z0IA 3UETA 5C9RA 2XFFA 4GH3A 3QLLA 2VEIA 2W6RA 7ENLA 2TSYA 1RZMA 2W67A 4FSAA 3LPPA 3LHTA 4PZVA 2FZMA 4DI8A 1PBGA 3V5OA 1N55A 4MKNA 4MFDA 2ZA2A 3DBNA 4N9CA 1GWJA 2QYGA 1OFBA 1LOQA 3GXFA 4IMCA 1OB0A 4AUBA 2H8XA 1W3IA 2ZKMX 1TTPA 3ZWTA 2Z6IA 3ZVIA 3P5YA 1VJSA 3ID7A 3EX1A 5HNTA 2PDMA 4NJGA 3HPFA 1GGOA 2V5KA 4C65A 4XAYA 1JCMP 1ZBKA 5A2BA 3KCOA 3NIYA 2YFNA 3PZGA 1C93A 3L23A 4ZO8A 2PDCA 1XYBA 4RPPA 5TQLA 4UBPC 4QISA 5AYYA 4C5YA 1HKKA 3TYCA 3QC3A 1UOZA 2PP3A 3SR7A 4IG2B 1ZSXA 2P88A 4S3EA 3WUFA 2ISSA 2HBXA 3CMFA 2Y7EA 3B97A 4IG2A 3TONA 5J04A 4HQVA 3P0XA 1HGWA 2PZNA 2NVCA 2ZE0A 1OX4B 4XKYA 1XIDA 4WLCA 1OT2A 4B16A 3TLQA 3KLLA 1OX4A 4DEFA 5BXRA 2ZCGA 1K6WA 2DVTA 3GTNA 4I5XA 1YPIA 3SCPA 1GJPA 4DWSC 3OZOA 4HHLA 3E6EA 1MUCA 4AD1A 4P7LA 5CJNA 3V0SA 5FA5A 3WCZA 1KTBA 1XUZA 3EMZA 3SCNA 4N02A 4LC6A 1QPNA 1YBQB 4JTSA 4KRTA 2QMKA 3GNXA 3ME3A 5EBAA 1GEQA 4XVDA 3VNJA 3LXCA 1YBQA 2PWUA 3MA8A 4XX6A 1UR9A 1VF8A 2NQ5A 3VIKA 4TQTA 3TJXA 3KOXA 3WF4A 1BXBA 5LKYA 3SQLA 1CB7B 1ISWA 3UZ5A 1Q6OA 1YNPA 3APYA 3CZJA 1IT8A 2WOQA 2NQZA 3G0SA 3JS3A 4UB9A 4H2CA 1KFEA 2W0UA 1B3VA 2RUSA 1EUAA 2Z27A 3N9KA 2NWRA 2FIQA 4QDWA 2VWTA 3II1A 1E6SM 2FLIA 4PEEA 1EF2A 4Z2HA 3EPOA 2OEKA 4CU7A 1E73M 3UG5A 5AECA 2G4FA 4K68A 3S46A 5M5DA 2G5WA 3RRAA 1AL7A 1X98A 3TDFA 2IW0A 3D46A 2J8GA 4GNJA 2D0HA 2CCRA 4Y9PA 5REQB 3HIJA 4LRSA 4B5TA 3OVRA 2G3IA 5AYBA 1EGMA 4LUTB 3L5MA 5REQA 1QI3A 5KITA 3SRHA 1PZ0A 3IRDA 4QJ5B 2WKLA 3SCWA 4LUTA 2QR6A 5A6LA 2DFAA 1WKEA 3E0LA 3K4WA 4MJZA 3GIQA 1M04A 2YB1A 5C55A 1Q63A 1W1PA 3IIZA 3WH6A 1CXFA 5LNSA 4IWWA 1XRVA 4K1WA 3V35A 1TA3B 1B5TA 4FIQA 4R53A 2OOGA 1BTCA 1XG3A 3FAWA 1TA3A 3C8FA 3THUA 1DJQA 2HBVA 3NVTA 4B5SA 3LNPA 2V3FA 3V7PA 4U2ZA 1GG0A 3LCIA 1F61A 3HF3A 1XBVA 1CX9A 1UASA 3VD7A 2I57A 4WY0B 4ILSA 1EC8A 2PDIA 2TPSA 5A1AA 1SO6A 4WY0A 1PZ1A 4NYUA 1R3QA 2W3ZA 4AQLA 4BCEA 2QJGA 2HXUA 3R43A 1W6TA 1UP0A 3AHYA 1LJYA 5IXEA 1EBHA 1XLJA 3VMPA 2BY3A 3CHDA 1ODUA 3AMCA 3FJ6A 1WYIA 1TPEA 1RBOB 3WJXA 3QEZA 4GXWA 4NJIA 3UWZA 1V0LA 1L9WA 2GYIA 3ES8A 3U3HA 3BLPX 2CESA 1I2RA 4X2PA 4MFEA 1HL2A 2EHHA 3QGVA 3BDKA 5K2ZA 3KZSA 4IGMA 3HPSA 4S38A 1S2WA 3CL6A 3C0JA 3KX6A 1XIEA 1L6FA 3KTSA 1JGIA 4H6KA 4ZQCA 1M65A 4A3UA 3A4AA 1B57A 5D4YA 1LYXA 2DW7A 4HZ8A 1YPFA 1FH9A 1UPMB 2VHLA 2XU2A 3NQ7A 3PZUA 1KCLA 5I23A 3DBPA 3SN1A 3EEZA 2FMNA 2VGGA 3S1XA 5L6UA 3EA1A 4H9TA 1RQBA 1SU5A 3RO6A 1HXJA 4Y8FA 3W1MA 1RA5A 5G2IA 3UZXA 2P0IA 5EA9A 4JX6A 3AHXA 1J0HA 1JF5A 1X1OA 3A12A 2DW6A 3BCJA 5GNYA 1F4AA 1LLOA 1JDEA 2QT3A 2ZIDA 3IJ7A 3TQVA 2V2CA 2V69A 1BF2A 4PE8A 3F1QA 4AMCA 3RAOA 3L2MA 1EJUC 3BSGA 4E5TA 3LUTA 5AHLA 2PDPA 2J47A 2J25A 3NQVA 1IWBA 2A6NA 1H61A 1US0A 1CB2A 1MXDA 3PJUA 5CSYA 3W74A 1WP6A 4DM2A 3A4JA 2OWCA 4AVNA 4HNTA 2ZUMA 3UZWA 2BNJA 1Q13A 3RO8A 2DZWA 3SCOA 3VKJA 2IPJA 3B04A 3O2LA 4OVXA 4F0SA 3VUPA 3UJ2A 2YA1A 9RUBA 4W8AA 3WDIA 3PY2A 3GNRA 3L65A 4F66A 1W5NA 4GO8A 4DAFA 2H3BA 1L8PA 4MF4A 2JF7A 1ZUAX 4QDPA 1DJGA 1BXNA 1SSDA 3WLKX 4RDWA 4FXJA 3MSYA 4W5ZA 4WOZA 3KLKA 1E9ZB 2ZDRA 3CBWA 4BR1A 4U10A 3E96A 5AYIA 4AY8A 5HWMA 4Z1CA 3GG1A 4E8DA 1H0GA 3FJ4A 3R10A 1JYWA 1W32A 3P84A 5ABTA 4RW3A 3S6DA 2PWVA 2V38A 1H60A 3BLLA 1RSCA 4I3GA 2G95A 3VKDA 3KOYA 4G2DA 3R8RA 4RCXA 3PB2A 1U22A 4LQ1A 1SFSA 3NQGA 5I3FA 4WJEA 4AEFA 3SDOA 3OBEA 3IANA 3RITA 1WXZA 3C8NA 1E6PA 4YS1A 1FOBA 1RALA 1P6CA 3QR1A 3RPTA 3TN3A 1J9YA 2XTKA 2HQAA 2ZX5A 4R5EA 3C86A 2FZNA 1ITQA 4Q4SA 2YPIA 1J2BA 2VD8A 2PDYA 5A6JA 2Y88A 2I56A 2J8TA 4GG9A 3NQDA 1W3JA 1YHTA 4BK9A 1TRIA 3W1TA 3GTXA 3NEVA 1JYVA 1FWSA 4XZ9A 3WDHA 1XCXA 4V15A 3THAA 1GOOA 4JYFA 3UWEA 4W85A 2VJXA 1B9BA 2QDEA 3MYPA 4JKLA 2XPKA 4ACYA 4P7QA 4JN8A 1L0PA 3E0FA 3VFLA 1D8CA 2YCKX 2NUXA 1OBAA 1NP2A 2GWNA 3CZ8A 1EA9C 3MVIA 3WK3A 1WBHA 4CN6A 2E09A 5JU6A 4FNSA 4M82A 4LWWA 1L6GA 4M24A 2AAAA 4C1LA 3FYOA 5I79A 3W70A 1VEMA 1XYLA 3TYBA 3BTNA 1ITCA 3ICJA 1FWCC 1KV8A 2PTZA 2QCNA 2OO0A 3L0NA 2OJPA 2ZUUA 3PFMA 2D24A 2ZXAA 5K9XA 2GSJA 3WLOA 1TJPA 5T91A 1GQKA 4E3VA 2DT1A 3FOKA 2PRHA 3W7PA 3TTEA 1Q6GA 5JVLA 6XIMA 2NT1A 1DJWA 4CUCA 4DUVA 4HT3A 4JL1A 4OBSA 4M7TA 5CGTA 3W7KA 1H3GA 1QCWA 3TKFA 3P80A 2CWXA 4GCXA 1K3UA 4HZ7A 1X6UA 1GJWA 2X2YA 1XIIA 1IQ8A 2QNEA 4LXFA 5KZEA 3ZR4A 4B9ZA 3IWPA 2C14A 4IMAA 1ONWA 2CWNA 3LTSA 1ITXA 3W38A 1J0IA 3H7RA 3PZTA 2QULA 2DSVA 5D33A 4B5WA 3OGRA 4IL0A 1FFQA 4K39A 3W7MA 4E38A 4X63A 2DEPA 4PRRA 2NVDA 4AZIA 4DO4A 1T0OA 1VHCA 1UKQA 3N34A 4CNNA 3E0VA 4PRTA 4HCDA 4UQEA 3QHMA 4Z1DA 2CLHA 3LCWA 1JR1A 4QXIA 4QG6A 2PBOA 2BY0A 5MF5A 2HE5A 4OGZA 4P8WA 2YL6A 2GOKA 1QBAA 1OZMA 3ALFA 2ISDA 1XRFA 1R3RA 3AIRA 4XD5A 1BKHA 4NSBA 1C7TA 3CUIA 3ONCA 1R0MA 1ZL1A 2DZAA 4LUSB 3KCJA 4O4VA 1SR0A 7TAAA 1SZFA 2VCBA 2FGZA 4R3UA 3KVKA 1L6WA 1PUDA 4BI6A 1GYLA 1GW9A 1TX0A 4G56A 4KERA 1MW2A 5CBIA 4DELA 1WDSA 3IJ9A 1TZ9A 4WR3A 1VFUA 2MANA 1GPWA 1JPKA 3W3OA 2W5FA 1H7OA 5FD0A 3UG4A 2V5CA 2E8ZA 3LA4A 1ZZMA 3EAUA 1UWUA 3DC0A 3OZPA 1JPMA 1NP0A 4OECA 5CC5A 3PK7A 1PZ2A 1Q85A 2J6VA 2XN2A 3PUEA 1AZ2A 1TX2A 5A95A 4O28A 3ZIZA 2EKCA 4HU4A 3VO0A 5FJTA 1DTUA 5LGZA 5I7GA 1PKYA 1UKSA 2O9PA 3T44A 3GXNA 3ANUA 3TMLA 4RPQA 4M81A 2HNHA 4A35A 2PGWA 3EOLA 5A6BA 2XWEA 1FWJC 4LYKA 2GDUA 3RF9A 1DJYA 2HROA 5I6SA 4C6DA 4ZA0A 1UJPA 3TWAA 2A5HA 4N9BA 2FYMA 5F1VA 1VBUA 4P5UA 1SO5A 3I4KA 2ZZ1A 4KRZA 3FEMA 1TFVA 1WKYA 5DY3A 1EL3A 3OVPA 1TB3A 2WVSA 1U83A 4AY1A 3ITYA 2B81A 3LQGA 4HHHA 4IMFA 4P8UA 3GBDA 3UU0A 1ZTVA 2G3NA 4IISA 1XHGA 4S3JA 5E9AA 5CBJA 3VM7A 1MXSA 2HNEA 3IJQA 4HZMA 1CXHA 3PNUA 2YLAA 1JJKA 2J62A 1I0BA 3VOHA 4P8VA 3KHDA 2QCLA 2CBUA 3TQ0A 1XCWA 3VDGA 2OVLA 3H4XA 4RE0A 4LVFA 3VKBA 3L66A 1HL9A 1MW1A 1RCOB 3F4VA 3T40A 1VFHA 3PTDA 1DEDA 4WXYA 2OZTA 3AJXA 1SFJA 4IM4A 1DBTA 2CITA 2I9EA 1UZ4A 4E4FA 4GA8A 3LRLA 1IEQA 2P0OA 3R4IA 5EL1A 4GVIA 1JZ6A 2NQJA 4I6KA 4CLMA 4IMGA 3N4AA 1R3SA 1CTNA 1K02A 1XLHA 3EWZA 3WBAA 4RXGA 2YA2A 1OFPA 2YKKA 2Z1BA 2CLEA 2GPTA 3KRZA 2ZRZA 3P8IA 3OZYA 1JPHA 1EUNA 4JTRA 4AHQA 1GVIA 4V28A 2CPUA 1XL9A 9CGTA 4MPKA 3M5XA 3OU8A 4GIEA 3THCA 3UR5A 4GQ0A 4GXPA 1FCVA 2DJLA 1FDZA 4AX6A 3DOPA 4CD8A 2VDIA 4MUPA 4AZHA 3L4UA 3QHNA 5LZLA 3SCUA 4DBSA 4UTTA 1MYRA 1OG6A 5A8QA 3LHVA 1GYNA 3CH9A 4GC4A 4IPNB 1US2A 1UWRA 3UXIA 3Q58A 4PUWA 1ISVA 1XC4A 2V6AA 4WHBA 3T9PA 3ZVHB 2WKGA 2ZZ6A 4R85A 5D8WA 3N15A 3B0YA 3ZVHA 3LHUA 1ONEA 4QE1A 3I68A 2YZ5A 1V6YA 1H09A 3FXYA 2WSKA 1PCKA 3S5SA 5LIKX 3WLTA 4D9PA 1X7IA 4HBKA 1RJPA 3K1GA 4CKQA 1WOBA 1R30A 3AMGA 4JNMA 4RE3A 4AZ6A 2V9DA 5LIYX 3K2GA 1XGEA 1QRQA 4JN7A 1H49A 3AROA 3DECA 3BOLA 3TC6A 3WF3A 3U2EA 1VYSX 3QV7A 3CHCA 4MIMA 3BWWA 3TEVA 4I7VA 1CW2A 3M16A 4PCPA 1WZMA 2Z1KA 3VD4A 1GJUA 2VELA 3FSTA 1DWHM 1X7FA 2JEQA 5FESA 2VRKA 1BVWA 3T05A 5JH1A 3FLUA 4RNFA 2XFRA 3S5ZA 1BG9A 5FEPA 4LEFA 2OR2A 4XSMA 4V33A 4NNBA 4LYRA 2RDUA 4W7WA 3VCNA 3GU9A 3MCNA 5D9MA 5CC6A 5C6MA 1SO4A 3OODA 1LQ0A 2BSLA 3M7SA 1X8CA 5AZ1A 1H2JA 5HWJA 1HW6A 4PSRA 3W25A 1M3UA 1Q66A 4LYQA 1E0TA 3U5UA 2XSBA 4OZOA 3AMKA 4WY0F 5DBUA 3WYZA 2XZ7A 4LNCA 3BAYA 5FSDC 3R0UA 3VGBA 2WJFA 3EWDA 2HVOA 3NAVA 3B8VA 2EPHA 1KO0A 2INZA 1W1A1 1KCZA 1H51A 3S6OA 3IGSA 5CH9A 2VFDA 3RJXA 3QYSA 3LTYA 1BYDA 2ABBA 5D38A 4Z2KA 4A05A 2G96A 3LY0A 1XDJA 3GXPA 1G7UA 3M41A 3VD5A 2VO5A 4HP5A 2WHMA 3M46A 2QMJA 2DIEA 4D2JA 4QE5A 2HMCA 3LGEA 2G37A 2YXOA 4KCWA 1JNEA 3A21A 2NX9A 3BLIA 4M1RA 1R3VA 4PMQA 1H7NA 4AD3A 4EK7A 1WUFA 2HWGA 1GVEA 3ZO9A 1E72M 4OT7A 3GYCA 3G1RA 1EOKA 5CPLA 2PC8A 4PL2A 2V0TA 3FNDA 3ARUA 2BHYA 3PBVA 1BKSA 3BCFA 1ZJAA 4GD0A 4PTXA 2E9LA 2XVNA 2WVVB 5I78A 3M0KA 3HV9A 4DZ5A 1E51A 2WVVA 3WMCA 4V27A 2FGBA 2BXVA 3MHFA 4N42A 2BP1A 5K9CA 3GHUA 3W1AA 3NDZA 1B31A 5A2CA 3ARQA 2DZXA 1IE7C 5DBTA 2PDBA 1MNZA 3TFXA 1Q7QA 2B7OA 5GJPA 2CZVA 5JXQA 3A3HA 3B0PA 3PB0A 1Q4NX 2DV0A 2VR2A 2O7SA 3BSMA 3QBUA 3N29A 1KM6A 1OYBA 1EYEA 3MCMA 5BU9A 4C6OA 4AYSA 3DH7A 3BJTA 1XIJA 1IEIA 3QLDA 4R33A 2GGHA 2DORA 4E4PA 2CZ5A 4UUIA 2WZTA 3HG3A 4FA3A 3D6NA 3HMCA 4UR8A 1CBGA 3BL3A 2Q02A 3CUJA 5ECVA 1OYCA 2NUYA 1TMLA 4H83A 1N2VA 1N8WA 1YDNA 3LBCA 4JEJA 3TNBA 1E56A 1GKRA 2C3ZA 2ANUA 3QSTA 1R9ZA 1NOWA 1A53A 1W9BM 3UPWA 1EZ2A 3ATYA 1MW0A 3TV8A 1Q7ZA 3NZ1A 3S5OA 3ZYZA 4O8RA 3LCHA 1JZ8A 3I10A 3APGA 1UR3M 3L0KA 4BJHA 4J27A 1IEXA 4UFLA 4C7FA 3NPWA 1XSIA 2NQLA 3A4WA 4LV9A 1D9EA 3UA4A 3PF3A 1AZ1A 1TVLA 1XPYA 5D2YA 1QO5A 2WJZA 3NQMA 4DUXA 3H2FA 2ON3A 4YXGA 4S3KA 3WSUA 3DFQA 5D9OA 4DXVA 3VIFA 3SQMA 3IJLA 5KINA 3TJLA 2C19A 1UHVA 3CIVA 3G18A 3KL3A 2OEMA 2J7CA 2P10A 4NY2A 2CHRA 3DIPA 3LLFA 2JIEA 5L9FA 3HN3A 1KLYA 2PGFA 3E2RA 4W88A 4KEUA 3GUGA 3TSBA 1TV7A 3I6TA 3H21A 1EWDA 4DUWA 3KM8A 1H4PA 5C9XA 4R7JA 3CM4A 2YW4A 3N4EA 1D3HA 3HV8A 3IUIA 5AHMA 1QNSA 3MY9A 3SRFA 1V0MA 1NWSA 1MVYA 5HWNA 2J66A 1G4SA 3DKJA 4CN1A 3G77A 1Q6LA 3LZ3A 4FEZA 1XGDA 1VZWA 3GTHA 3TUUA 3VNDA 1O12A 1VCGA 1Q65A 3VM5A 3KOZA 1TPUA 4LBSA 5HUPA 2FDSA 4N6EA 3EXSA 3AWOA 1BF6A 4QS5A 3PN8A 8XIMA 1EJRC 3GUWA 4DBEA 4Q8TA 3GVQA 5EMKA 3MMTA 4GJJA 4YU1A 4IIEA 4KCVA 3CV1A 4KETA 2UWFA 3WNPA 1CXIA 3OVQA 5FCZA 1A0CA 3P0WA 1R5YA 4WGXA 2YLLA 4LUJA 3ARZA 4A4AA 4ORIA 1TO3A 1J11A 2VZSA 3UXAA 2O0TA 4UTTC 3LERA 3SN4A 2ZX9A 3VKKA 2DIKA 2O92A 2OKTA 4MNLA 3RHGA 2DH3A 1MRAA 5TBOA 2CBVA 4EPDC 4DY1A 1E9YB 1KGXA 2WB5A 1EO7A 2XSXA 4HK5A 2DZBA 3JRKA 3BMXA 4MZ8A 3VGFA 3SECA 4X9SA 5BXPA 1DWJM 2BV9A 2JFEX 4WQ6A 3V0TA 4R9XA 4TXEA 1A5LC 2HPIA 4XTIA 3FGCB 2G3MA 3QTPA 3T0BA 3CLWA 3AXXA 2VDHA 2QW5A 1U5HA 3FGCA 3GDRA 2EJAA 5XIAA 2ZXBA 1SMDA 1UZDA 3XINA 1OM0A 5HJLA 3WBWA 4EIVA 1V5XA 1LCOA 3WLHA 4A8IA 5HULA 3UCQA 3CV2A 4M6PA 1NOFA 2CLIA 3PNZA 4M56A 3ARRA 4ZB0A 1K9EA 4N9DA 3M5ZA 5CC3A 2A7RA 3TOPA 1WE5A 4H9UA 1FCUA 2GQ3A 3GH7A 3ECQA 5KEZA 1C8XA 2PD5A 3FKKA 3MI3A 4GZEA 2WSYA 3W53A 3OG3A 2O9TA 2YDRA 4GUHA 2GZXA 2GDVA 1KRAC 4K8EA 4U2YA 3UNDA 1W3KA 2PLKA 2J7DA 1K6AA 1LBFA 4XKMA 4GBDA 1W91A 4CCDA 2GOUA 4B4HA 3CGTA 3EOOA 1C29A 1S3TC 3IUDA 3P5ZA 1V77A 4C90A 4PTVA 1AW2A 1EGVA 3C2VA 1AQHA 1KM2A 2QDGA 2A2IA 2FZDA 3RPDA 3W1UA 3VKCA 3CQIA 1CDGA 5GPRA 2DU2A 2KAUC 1CLKA 2GGEA 1D8WA 1KFJA 1FBAA 1ZHAA 2A0NA 3PVFA 5E93A 1JZ7A 1TCDA 3L4XA 4DJDD 4W89A 1KGWA 4LB4A 5HNRA 3OYZA 7REQA 3S0CA 1ICQA 4ICMA 4AMAA 3AHZA 3H2MA 1AW5A 3S9IA 1S1PA 3TCSA 3B05A 4PUUA 1YLVA 4F3HA 4A2SA 4WDTA 3MANA 4ZL1A 2X1TA 2FZBA 4JTAA 1LM1A 4FNPA 2YL9A 1UJQA 4A8NA 1VCVA 1XWYA 4HPJA 1WZKA 3EX2A 3TX9A 4MY9A 1PKMA 1W1TA 3P82A 5G4HC 2CNCA 3L5AA 5EKYA 3VABA 3SY8A 1VH7A 3SFKA 2XYLA 4R27A 1J8VA 4MWAE 3T09A 1LQAA 2I1OA 2XFYA 3ZQ9A 1EJVC 1J18A 2NX1A 2Z26A 3C3NA 2EPMX 4L1XA 3N6HA 4GOAA 2VR5A 4QJ1A 3CB8A 4NXSA 5EFFA 1FWFC 3VCRA 5A8GA 1JEZA 3C5QA 3EPNA 2J7GA 4E2DA 2UY2A 5MHBA 3NJ3A 4F0KA 4NHVA 1EHNA 3KL0A 4KRUA 2VDGA 3UWQA 3B8TA 4Z0JA 2R14A 2GJXB 3Q4DA 4I9MA 4QDMA 1UROA 1OINA 2PODA 4FMVA 5IOBA 3NYDA 5TNVA 2PSNA 3W7RA 1UR0A 2GJXA 3L4WA 4C6CA 2ZWZA 3ZR6A 3OTRA 1IYXA 4GY1A 1TMHA 3SJ3A 5AC4A 2YCLB 5D09A 4FR1A 3W01A 3F4NA 2PURA 4LJ3A 4QRNA 2YCLA 3B9OA 5AYZA 2H3DA 2Q8LA 2J75A 3A5VA 1I2NA 3OQ8A 3CYJA 2RKXA 3ISIX 3T0DA 3NURA 3WDQA 2ZWYA 1FDYA 3VA8A 1QW9A 2YGYA 3WLSA 4O17A 4L5ZA 5I03A 4Q7BA 2J7HA 3QY8A 3LMZA 4XWUA 4CU6A 8A3HA 1DJXA 4DXKA 1RCXB 2R8WA 1DJIA 4DX3A 1AL8A 2WW5A 1OK6A 5J5RA 1R2TA 3KWXA 3GXTA 1CPUA 1G1YA 3LMYA 3M0ZA 3KBWA 2CIPA 2RFGA 2VM8A 2C8NA 1W9VA 2C1GA 2XH7A 4F9DA 4P7RA 3WQ5A 3EWBX 3WD3A 4MAZA 4KIEA 5A6MA 1HJQA 5CZTA 4O14A 1FWGC 1KBJA 1P1XA 3LCXA 3FV9A 3QMTA 3LLXA 5BCAA 4F2TA 5G2HA 3LXBA 2C91A 3CHVA 1W1B1 1GVFA 1Z9AA 3M0HA 4H6EA 3MMUA 3LS9A 5C9UA 3M0IA 3HFTA 3CPUA 4J3TA 1MFVA 3CO4A 4JIPA 1B30A 4LW7A 2Z1SA 2CU0A 1VFLA 3S9ZA 1QOXA 1XKJA 4RNJA 3FY1A 2A3EA 3AYTA 4KFOA 2QJIA 1EB3A 4LBUA 3LSBA 3E3HA 4B3KA 2WM0A 1WDWA 4AVOA 2WZMA 3C2YA 2V5DA 2G50A 4B4FA 1R3WA 3WLQA 3P81A 2EJ1A 3XISA 1H7XA 4US6A 2IXVA 4JICA 4HHPA 4IFKB 4RV3A 1XLDA 3VNIA 2OKOA 4FNRA 1VIWA 2GSHA 5J5DA 1FWBC 3QN3A 4IFKA 2OG9A 2FFIA 3C2EA 3ZWSA 1OYAA 4QLJA 2C1IA 4QE4A 3WNLA 1OGSA 2VI0A 2DUZA 3VC6A 2ZUNA 4BA0A 1CECA 4MYXA 4IJBA 4LTSA 3BARA 4R9OA 2XN1A 1J6PA 1X97A 2EG8A 3I7RA 4QCEA 5AHEA 1E43A 4E4UA 2R94A 4KESA 3H7UA 4QG9A 2PF8A 3E02A 4D6IA 4HSNA 4ZO9A 1K8CA 2GSEA 4ROQA 3LNMA 1LWJA 5HOSA 5KZMA 1CIUA 4OTKA 1VLIA 4HD5A 2DPEA 4NASA 3S5NA 2J6XA 1AD4A 2F6UA 3RM8A 4BWLA 3D47A 4FXFA 4N7QA 1RVKA 3LEPA 1B90A 3SCQA 3DDMA 1E1CB 2NVAA 4O16A 3PR2A 4CQDA 4IHCA 4PUEA 3PPCA 1E1CA 1XIFA 3ARWA 4H19A 4JKKA 3PZIA 3QZEA 4KQNA 4ZFCA 3MUZ1 3N2TA 1V6UA 4B3LA 4HIBA 2CLLA 3TYDA 2B31A 1W8SA 3W73A 1GONA 1HFBA 3TTSA 3EWXA 2D2HA 5HR6A 1FCQA 3VTRA 2Z2AA 3EKLA 1EPVA 1XLGA 4GC3A 4AIUA 3P93A 1OFQA 5TAOA 3MBFA 4EF9A 4NL1A 3TSDA 4X0VA 1GQNA 1FQ0A 1VGAA 3G1DA 4QBXA 4ZMGA 4AISA 5G4WA 3O15A 5K3VA 3GVVA 1W1YA 1PHQA 2ACUA 4NZCA 4B5VA 3DFYA 3ZOAA 4DLMA 4D6HA 2X1SA 1FP8A 1EJTC 2Y1HA 3OLGA 3A6OA 1UZ1A 1VPQA 3R13A 3J7HA 3NDYA 6PTDA 2ZOXA 4M0XA 2WJDA 3N2XA 3FYPA 5A5WA 4LCSA 4O1FA 1ISXA 5JBDA 3UESA 1FXPA 4J5NA 3ITXA 2V3GA 3VX0A 1FXQA 2ZZ7A 3U2ZA 4WRHA 3WQVA 5IFTA 2R1PA 3UY8A 4A21A 1A5UA 2WHJA 1KRMA 1W3HA 4XUYA 1KB3A 4KFPA 1K9TA 3GM8A 3WMSA 2B7NA 4XV0A 2YR1A 2YX0A 4J3XA 4GUIA 1WKFA 3MQTA 2BVDA 4CNTA 4JTTA 1JD7A 4S1FA 3MPGA 2HEJA 3F2DA 2X7VA 3U48A 3W00A 3S6TA 3R7MA 4L9ZA 4MJMA 2VVSA 3NZQA 5JBFA 3ABZA 4GUFA 1VR6A 4K37A 1JXKA 3GTIA 1MUWA 4FNUA 3ZSSA 1CGYA 4YVPA 2XJ7A 3ZJ8A 1QNRA 2OCZA 5RUBA 3DAQA 3C2OA 2EF9A 3AMDA 2G3FA 2WO5A 1PO9A 1T5AA 4NZJA 2HZGA 3ABQA 1RP8A 1NVMA 1KLZA 2PDNA 2VFHA 4IF2A 3PUGA 3TNOA 3VUSA 1JPDX 5B7ZA 3CQJA 3W23A 3UY7A 3LI0A 3QM3A 2A6LA 5LIUX 3WQFA 3P67A 3HURA 4TOQA 2CYGA 1TE6A 3EA3A 1JUBA 1SFTA 1UR2A 3V1HA 4QEHA 4QHRA 1C90A 2C7FA 5CPMA 3H2CA 4FK9A 5DY2A 4DB7A 3N13A 2CZEA 4UOZA 4K8GA 1IEVA 5D30A 1Q8AA 1AVAA 2P5NA 3ITTA 3ALGA 4JFSA 2YL5A 1HT6A 3WQ6A 2XIJA 1W3TA 3MT1A 4WJ8A 3WBYA 4LAMA 1O1ZA 3MMWA 4GO9A 3GW0A 1P0BA 3IGHX 1O5KA 1OCQA 2ZZ5A 1QNQA 4G7EB 3CC1A 4JCMA 3H70A 5LNVA 3M5VA 3VOJA 4G7EA 5C7HA 4O1AA 2NV1A 3DUGA 4L9XA 5LXEA 3LYEA 2VC7A 1POKA 1UQZA 1BQCA 2E5CA 3OG2A 3QW4B 8TIMA 5HNUA 2VEGA 3D5HA 1I2OA 1PSCA 1TV4A 4Y2WA 4BQ4A 3BQ6A 4PMJA 1E1FA 3AQUA 3R1ZA 1OF6A 3W02A 1U1HA 3L67A 1RPKA 3N1AA 3V75A 3K8KA 1S38A 3FFSA 3VMOA 1I2PA 3S1GA 5J8LA 3EWUA 2POTA 1C3FA 1OGBA 1F6PA 2VEFA 3UWUA 1T8QA 2FHBA 1HKMA 3WD1A 3M7WA 4I7WA 2BGQA 1XINA 1KTCA 3YPIA 3CZGA 3AHTA 3PSWA 3HU7A 3WN6A 2IUZA 1QXLA 1YMYA 5CQ1A 3RMEA 1GOWA 3LCFA 3PJXA 1TPFA 1G9HA 2CHNA 1XYCA 3MI2A 2ZA1A 4GJ1A 5A8NA 1D3CA 1G4TA 3CAKA 1GZJA 5D8ZA 2DZVA 4HU0A 3GXDA 4JTFA 1ELSA 1V3LA 1OCJA 5CAKA 3MI6A 1VYRA 3P61A 3PC0A 4IP5A 3MS8A 1ZAJA 1A0EA 4CQ8A 5C54A 3IIXA 3U7VA 4QS6A 3NZPA 3G6MA 1A4LA 3GZ3A 2XH0A 1TPC1 1Z8AA 3NQCA 4EWND 5D02A 3S83A 3CTTA 1S5VA 1RY8A 4IUGA 3BSHA 4BS0A 1HKWA 3N4FA 2D2GA 3O6AA 3AU2A 4GXMA 3DZ1A 5U4NA 1M03A 2EEXA 3VIOA 3VILA 2QCHA 2BWGA 2RAGA 3N19B 1QNOA 1JF6A 2NXGA 4ORMA 5AFDA 1JYXA 3E5BA 3NSXA 4QG8A 2FVLA 4B9YA 2DJXA 1V6WA 2VYOA 4JL2A 4CN4A 2FTYA 4ADTA 3GDTA 4WXZA 5IHSA 4MKSA 4OBRA 4PUDA 3H8AA 2VFFA 1UIOA 3L21A 4WF7A 3CEPA 3W71A 3FYYA 3SCTA 1RK6A 5AKQA 3RU8X 1NSJA 1XYMA 4YWSA 1P0NA 1AODA 3OP2A 4CD5A 3HGRA 3V1PA 4LC8A 2XGBA 3HQ1A 4JTHA 3OVGA 4OU1A 4YTTA 1XH1A 1JXJA 3ARTA 4O12A 2PDWA 4XD6A 1P48A 4ZQMA 3T81A 1WO2A 3SZ8A 1QBBA 2TRSA 3PFRA 1PEZA 3STGA 1IV8A 3C0LA 1QVBA 4WEVX 3DYPA 4RE4A 3USZA 1M9HA 3HJZA 3URBA 3I6RA 4BWLC 3B0XA 1Q8JA 3EWYA 3NQ6A 3AS2A 3JUGA 4I9JA 1YRRA 2NWSA 4NYYA 1OCNA 1TSIA 4G1KA 1JCXA 2PBGA 5M03A 4L6HA 3SIMA 3DI1A 2REQB 3PTKA 1LROA 4DF0A 2VWSA 2HVNA 1A3HA 3GK0A 3QSRA 3IGXA 1GVRA 2YDQA 3FA3A 2J78A 3HQPA 4QLLA 3W1RA 1KFLA 4KEZA 5C9WA 2PDQA 3L68A 2WLYA 3EXTA 3B4UA 4TU1A 3RGTA 2GVGA 4XZIA 3AIEA 2AGKA 3IS4A 3WH9A 4PB3A 2YYTA 2QCEA 1KFBA 4FF5A 3WJSA 1E6QM 3NSNA 4HPNA 4LALA 2GJNA 1DQXA 3WLIA 4YN5A 4MSSA 1V7YA 1O5XA 3BW3A 3WNOA 5G1TA 4U31A 3RX2A 2G3JA 1RUSA 4RLIA 4PMXA 4U3CA 1B3OA 4XZBA 3I3EA 4US5D 4D8LA 3S9YA 3BJFA 5EFDA 2I5IA 3WH8A 3WUBA 1U1UA 1FX6A 4DI9A 4MJ2A 3U2CA 5FL1A 1PTDA 4L65A 3C56A 3W6LA 3PAJA 3NWRA 5BNKA 3L4ZA 2PTWA 4W7VA 1TIMA 4DJDA 4ZQRA 1F8IA 4XVEA 1B3ZA 1XYAA 4E0CA 3AALA 4PMVA 3CL7A 2VKZG 2HV5A 1XGZA 3DN5A 1H5YA 1XD0A 5I5RA 1TPWA 4UNLA 2BXYA 1J5TA 3OQEA 4IIBA 2IQTA 1XUUA 2DQWA 3CHFA 3NZRA 2XVLA 4ZODA 1EH9A 2ZRXA 1EQCA 3WF2A 2C79A 4RXFA 2IKGA 5CPTA 1TRDA 3S47A 1XI3A 3NOEA 3OEXA 2PMQA 1S5MA 2E1WA 4IUOA 4JIIX 4GVGA 4KCTA 3R8HA 1FH8A 4WOQA 1B3YA 3C2FA 4GI8A 1BGGA 4BI7A 2BODX 2AGTA 2BZNA 2X8RA 2ZUSA 3KVJA 2VGBA 1QI5A 3M6DA 1Q3NA 4WKFA 2Y5JA 2PZ0A 5HK4A 1X38A 7A3HA 1IT7A 4LNYA 2DSUA 1O94A 1UUMA 1TZ7A 3PTQA 3S5YA 3UR8A 3RCNA 5E9XA 2P8BA 4ZQOA 3WDPP 1SW3A 1I60A 4LCRA 4HCHA 2Z7GA 2GDQA 3CZLA 3N3MA 4IXXA 3OBAA 1GEHA 3BUVA 5BWFA 2VC9A 1Q5MA 3SUVA 1JZ2A 4KGJA 1A0DA 4NZ4A 4U28A 1Y0EA 1ZGDA 1LTDA 3TXVA 1N8IA 1RLDA 1W2PA 1E9LA 1UMYA 3TXZA 4HGXA 3H24A 1OQFA 1WPCA 2NLIA 1V6VA 4I8YA 1QHZA 5FIPA 4PH6A 4YTRA 5EU9A 3A9IA 1F3XA 1R9YA 4GRSA 4F0LA 1MQQA 1MUMA 4DBUA 3ITOA 5EMMA 5A3HA 3B40A 3BICA 1FH7A 2JK2A 3W7CA 3UERA 2IKJA 4Q4OA 1UWTA 1GT8A 1JUEA 1DHPA 3DG3A 4H7ZA 3BC9A 2X40A 3BLDA 2R9RA 1V3MA 1XLLA 3DYOA 1DOSA 3ABRA 1F6KA 3APTA 2QCDB 3LRMA 5E09A 3PM6A 3HOJA 4YCOA 4N2YA 5FJIA 5CG0A 3UNTA 3W2UA 2QCDA 4PCTA 2X0SA 3R0DA 2YJQA 1IR1A 3EA2A 1T40A 3B8UA 4FX8A 4AD0A 4JTJA 3POCA 1OC6A 1E3ZA 1WAWA 1EOMA 3LQLA 1FA2A 3E2VA 2EG6A 3W1QA 1PX4A 6TAAA 5C2XA 1KBKA 1P5BA 4E6MA 1KBBA 4JTDA 5LIWX 2PCEA 3GVGA 2W4XA 1HO4A 3UPMA 4DBWA 4HKPA 3EB4A 2PF0A 3P60A 3P2VA 3WEMA 1HNYA 1PS9A 2VEKA 4LAZA 4GE8A 3JZEA 3OYXA 1LF1A 4H00A 3MP4A 2QCCA 1TWZA 1LL4A 1V08A 3LTPA 2ZC8A 4M19A 4NVTA 2CLKA 4U5KA 1E0WA 4OJYA 4QCFA 5BXSA 3AYSA 2JEPA 5F1UA 3HB9A 1FWDC 1ZS2A 4GYPA 4ZTXA 1VFSA 1BHGA 2O9OA 1NARA 3L9CA 4PMYA 3UJRA 3GU2A 2DZSA 1TVNA 4Z08A 4AZCB 4A3YA 3QHOA 4WD0A 5B80A 1AJZA 3HTWA 1ONRA 4Q8QA 1BYBA 1EBGA 3CMGA 2XIQA 3LHWA 2F7FA 1EJXC 4AZCA 4JNZA 4DF2A 1QR7A 1T99A 1LLZA 3BZGA 4IPPA 2P3ZA 4GACA 3B9EA 3QW3A 3B8IA 4JFTA 1LG2A 3EGJA 2X1RA 3K4AA 1EP2A 1RLCL 3QR3A 2XIBA 3LOTA 5F4SA 4BF7A 1TELA 1N8FA 4P8XA 4EACA 3O63A 1T6MA 1DP0A 1VB9A 1AW1A 4EKJA 3OBKA 3W2JA 3DENA 5T26A 4AD5A 4GI6A 1X6NA 1KFCA 7XIMA 5KETA 3BO9A 2WQDA 4P61A 4NAEB 1A5NC 1UD5A 2GQ8A 1NFPA 1XCFA 3O8AA 3UG3A 1VD6A 4NAEA 4LX4A 2H8ZA 1WBJA 4UFJA 2WNQA 1XFBA 1XKYA 3QPZA 1PX3A 4XAFA 1HF6A 2BOEX 1O95A 2DSWA 3ABSA 3QGKC 3OZMA 4IPIA 3S2LA 4F9JA 4J3WA 1K9FA 2R91A 3INPA 4B2DD 2WSRA 1TQJA 2F61A 2W27A 1ZJHA 3TH6A 1Q6EA 1WCGA 4DZIA 2JQXA 2RJGA 4Z2JA 3WQPA 1NIUA 3OHMB 5CG7A 1LLWA 8RUCA 4UR7A 1L6YA 4HCLA 2ISVA 2P76A 1F73A 2XIMA 1K70A 1YDYA 4O0ZA 3HMJG 2HXTA 2VZUA 4MUZA 1WA3A 4KKXA 5C7VA 3EBVA 5PTDA 1GUVA 4MGGA 2BVYA 4O0QA 1E3XA 3GU1A 1OIFA 1JDAA 1V3KA 4CVUA 1Q7MA 4CCEA 3PBMA 1IXOA 4F0MA 2ACRA 2VL4A 4Q8NA 4UIOA 4S3DA 4DBDA 2CZDA 1GQIA 5GNXA 3WJWA 4Q8OA 1VBJA 4NG3A 2PDXA 1BVZA 1UD3A 4WX2A 1KKRA 4WIWA 4WGHA 3BW2A 1NDZA 3IJ6A 1EO5A 2QF7A 2X2GA 1OF8A 4XBJA 3WEZA 5A8PA 1I1WA 4M8UA 3RLUA 3G6LA 1PDZA 1ZFJA 3ORWA 3GDKA 3TAKA 1IXQA 5E0CA 2J24A 4UQAA 5CKSA 5LA2A 4LANA 2H9AB 4AZ5A 4XQ6A 3L7RA 1NWRA 4WSKA 1PE1A 2ALRA 1RD6A 5HMSA 4NT0A 4G8TA 4J3UA 1UH4A 5LIXX 2X16A 1M53A 3K30A 2R1MA 3CL8A 1CENA 2GUBA 5I06A 1RQEA 4F0RA 4DJDC 1JRBA 4IIFA 1H1ZA 3D3AA 1KRBC 2HS8A 3RXZA 3WENA 6XIAA 3AWNA 3CXOA 3CZKA 1QI2A 2ZZ4A 2OTDA 4ZZ9A 4Q32A 3UJFA 1LUCB 3FX4A 2MNRA 4QAIA 3VNMA 5HQLA 1DIOA 4JIQA 3VVGA 4AHPA 1F4HA 1LUCA 4S2BA 3AXMA 1VP5A 3GVRA 1DXFA 1G5AA 4N6FA 1ZAIA 2X0YA 1V4YA 3BMVA 4KMQA 1OCBA 5EMJA 1I8JA 4GY7A 4NNAA 1YQ2A 3RX4A 1I9CB 1TVPA 2OU4A 4PA8A 4GGHA 2FJKA 4MADA 3ZT6A 3NTYA 4LF1A 1F3TA 1XRTA 2WWCA 4FAMA 3CAVA 4FOJA 3NL6A 4ZBCA 3UEQA 1E6XM 3W9ZA 1KFKA 4DN1A 2LLEA 3MCOA 1SZRA 3V0UA 1MW3A 3PPFA 5DXXA 4ML4A 4AVFA 4UTHA 3CASA 4RDVA 2ZTJA 1PIGA 1O7AA 4RUBA 3PJWA 4PMDA 2IKIA 3THQA 3EOUA 3VNLA 3NO3A 3QGAC 3KP1A 3R25A 2X7WA 2OX1A 3W75A 4Z2GA 1NFBA 3E0WA 3CLMA 5HNNA 3W7LA 4ZSUA 2UBPC 3SIZA 4CNPA 1SO3A 4HOWA 2C15A 1ZU8A 2QDHA 1TWDA 1RD5A 1JUKA 1R87A 1C8YA 3ZZ1A 3FN9A 1OX5A 3UJSA 1NWUA 4XTDA 2YA0A 1TTIA 5I09A 4NQ1A 3TC7A 3MTWA 2E4TA 1Z32X 2JGQA 3QOMA 5DCBA 1VRDA 2R1KA 3ZSTA 1LL7A 3BG3A 2ZUVA 1FFRA 1JULA 1KV5A 2D73A 2VTFA 4IPJA 1GVSA 3UVIA 4L6DA 2QVHA 1B4KA 4BZYA 3O6YX 1K7XA 3LLDA 3TTYA 4EF8A 4OKDA 2O55A 3V36A 2BY2A 4FO4A 3UG8A 2IMRA 2BBFA 4LFYA 3T8QA 3MHUA 1DYSA 4CEXC 4D6CA 3WH5A 2PRMA 2QGYA 1JCJA 4C6MA 3NOYA 5HANA 4D8ZA 3W1XA 5H8PA 1VFOA 4DJFD 3O07A 1V51A 2ZADA 3B4YA 1MRQA 3GKFA 3E74A 1DV7A 1HKIA 2IQDA 1F3EA 3GVWA 3BQ5A 4ZVJA 3BAIA 2R24A 4L7ZA 3M07A 4BI5A 4HMNA 1EA0A 4YHEA 1P1MA 3GAKA 2PP0A 3L4YA 3CK5A 4AEEA 6REQB 2HK0A 1ECEA 1LOSA 4HA0A 4A2RA 3I4EA 3WELA 4R88A 1TJ0A 1O60A 1P0EA 6REQA 1V3HA 3VDHA 1P6BA 2Z28A 2O56A 1JYNA 4UTJA 1KR1A 1M1BA 4D1JA 3QPEA 3OLEA 3SUUA 3RX3A 1F7BA 4DYEA 2X30A 3STCA 3DHFA 3EWWA 1F07A 3ARSA 1CLXA 5FF2A 3ARPA 1H5VA 1QOPA 2ESCA 5C70A 1IGWA 3KRUA 1HGYA 1FWHC 3NM1A 4POCA 4JS3A 3TZFA 2XWDA 3EDJA 2V3DA 4XZLX 4GYPC 3T2OA 4JX5A 3EX4A 4QITA 4UFMA 2GJLA 4WKHA 4H9ZA 4PMUA 4O1CA 3EYPA 1V02E 5AHFA 4UFHA 5HJXA 4GJIA 2GUUA 2E25A 4PTWA 2PP1A 4UWMA 3SO7A 1ISYA 2HJPA 5EGRA 3MDWA 5DF0A 1EX5A 3BW4A 4W84A 2Y5SA 1REQB 1ADOA 5A6KA 1SW7A 1H1NA 4JOMA 5A6TC 4HPGA 5JMUA 1EC7A 1A5CA 4B90A 4ZEPA 1CEOA 3B9AA 1KM4A 1G01A 3VI2A 1YX1A 2D23A 3TW9A 3KVMA 4MMWA 4PFHA 4U5IA 4RZ4A 3GG8A 4XSLA 1L2QA 1LZOA 1LORA 1J01A 2X41A 4IFOA 5CLWA 3NGJA 4HMDA 1W8GA 1J0ZA 4MNMA 2D0GA 5A2AA 2HE8A 1JPIA 4G9PA 4Q22A 4MB1A 3GHSA 1WKDA 1FWRA 2OXNA 4HA4A 4XAGA 4XZWA 2XZ9A 5EY5A 4JQ4A 4LCQA 3C6CA 1EKOA 3T07A 3G5EA 4A8LA 1J10A 3DFOA 1H41A 1PV8A 3OOQA 3MUY1 2JIWA 4PC8A 1BWKA 4AIBA 3WDJA 1W5MA 1KW1A 1A3XA 4QNWA 1JDFA 1XJBA 3PHAA 2EPNA 1L8NA 5CPSA 2QZRA 2P8CA 4US5A 4PULA 4NIRA 4KWUA 3WY1A 3EDKA 4Y9MA 3CV7A 2YYUA 4MM1A 5ABEA 3IARA 4HSOA 4FALA 4C6NA 2VR4A 4GI4A 2NW0A 2OGJA 3BGAA 3FS2A 1NTHA 1KC7A 3IEBA 4YNGA 3SQSA 1Q45A 1ECQA 1BVNP 2Y61A 2A3HA 2PU1A 5HATA 3UA3A 4CCCA 4NX0A 1NELA 3BMWA 3GNPA 3B9NA 4GH1A 1AK5A 1L6SA 1TKKA 1Y7VA 2BOFX 3ZJ6A 1MQPA 3PWGA 1PIIA 2W62A 1VBGA 3PG8A 3T0AA 1AJ0A 1S39A 3F5JA 1XYZA 2A3LA 4D1IA 4M80A 4L64A 1AQFA 1EFZA 3V3WA 1WDRA 5IM51 4XZHA 2CW6A 3E1F1 1QASA 2PRLA 4LGXA 1IGSA 1BWVA 4M5PA 4PUKA 1QMLA 3HG2A 3TN6A 4C7DA 5D9PA 4B91A 3W7JA 3O05A 1XLKA 1Z48A 2I17A 4TIMA 1GQLA 3ABXA 2OZ0A 1DQUA 2GJRA 1UC5A 1AMYA 4PN2A 4AZ7A 5I3IA 2PAJA 1FKWA 3DI0A 3S2MA 1U5JA 4PMRA 3RG6A 4H9XA 1BRLB 3U4AA 1UQYA 4RKAA 5EYWA 4O0KA 4S2CA 3K1DA 3G8RA 1AH0A 1BRLA 3WFAA 3RN6A 3ZM8A 1XC6A 1GYMA 3RLHA 5AC7A 4HPHA 2UZ9A 1W1ZA 1NU5A 1NDVA 3EOSA 5F2IA 1HP5A 3UWWA 3EEGA 5C0QA 1NQ6A 1POJA 3GC5A 2J9XA 3Q65A 3VD9A 1B0IA 2UV8G 3NQBA 1EQPA 3K13A 3Q37A 5I0DA 1XPGA 1ZP3A 5K7JA 1J96A 1UH2A 3KUMA 8CGTA 9XIMA 4EPBC 2OELA 2QUVA 1LL6A 4XUGA 4QQUA 2ZICA 1F76A 1W1VA 1QPRA 4IQLA 4UMAA 1P7TB 1W56A 3VGGA 4HOZA 5AB3A 3UJEA 3R8GA 4GQRA 4FNQA 1E4IA 4NJKA 5HPOA 2AQWA 1P7TA 1ITUA 2A21A 2WMFA 4DO5A 1GKQA 4O50A 4URIA 3EMQA 1XLMA 1TV8A 2GGGA 4O54A 2CFFA 2Y7FA 4TV5A 3WD0A 1ADDA 4BEQA 4C6EA 4F2UA 4D6EA 3CTLA 4GWEA 4DWSB 2BOGX 4H8NA 1GHSA 3HGOA 3P3BA 1A5OC 4XD4A 5DEZA 2EQDA 3WLNA 2BHUA 1QFEA 3LM3A 4C6LA 3B8SA 1ZBVA 3KBVA 5FJUA 1HJSA 3TMQA 1RXOB 4A3HA 3TZNA 1VFMA 2FB3A 1SZEA 4JY9A 4LUSA 3ZLHA 2VENA 1W2VA 4YL2A 4QTGA 3KOWA 2GVLA 1P0DA 2QUNA 1HL8A 2XVGA 4XD3A 3AIUA 2PA6A 4PTNA 5GJMA 1XBZA 2HVMA 3XIMA 4GIRA 1K77A 1QU4A 2GQ9A 4JTEA 2GJPA 2A79A 3QZ6A 3ZXWA 4DVOA 4IQJA 1HKVA 4J35A 5LA0A 1WDPA 1OX6A 5E1QA 1QPOA 3TA9A 1J0JA 4CEUC 3M43A 4C6FA 2QPUA 3LCLA 1UD6A 1A50A 7CGTA 1QJWA 1VFFA 1TYGA 3WFLA 5I2UA 3SFWA 1BSIA 2P50A 1JCYA 1YIXA 5LHFA 4JN6A 1VBHA 2E6YA 3GD6A 9XIAA 1DTNA 2W92A 3R94A 2VX4A 3U2OA 4AZGA 1AD1A 5E70A 1M01A 3AISA 2XIOA 4XB3A 2YXXA 4MJ4A 3VX1A 4S3GA 1RPXA 2INEA 1E6ZA 3W29A 1ZLPA 7TIMA 3DX5A 1C9WA 1G7VA 2BTMA 2ZRVA 5DMNA 3PBUA 3HA1A 3W2NA 1OFDA 5CSSA 1OHLA 3B9DA 3THDA 4JFUA 3NG3A 1R2SA 3P8JA 2CXGA 1VIZA 4ACZB 1P6WA 3UZJA 2BVTA 3AXKA 1W1IE 5I77A 2Z00A 3W83A 2FVMA 4DJED 2OT0A 5F7UA 2DQXA 1UWSA 3VDCA 1YKWA 5DMYA 3OIHA 1PVNA 4JTQA 4FOUA 3UGVA 3W7EA 4C6IA 2GL5A 3QVQA 3URAA 1D7FA 4HA1A 3STFA 1O68A 1Q6FA 4F0HA 4CQCA 5BMXA 4NZ1A 2V67A 2NXIA 2FB2A 3GZAA 3RCMA 1EXBA 4M6QA 1UUQA 1Q2SA 3U8GA 3WIJA 4NI3A 4QSHA 1TMQA 4B2DA 3ES7A 4GFIA 3MJMA 1TREA 1WB0A 4L6OA 4KWWA 4ZB5A 5D04C 3HG4A 2DDXA 1O5QA 3TR9A 3P14A 4QFUA 2AQVA 4HJWA 1HVQA 4H8HA 4UNKA 1FWAC 3C61A 5FJPA 1Z7AA 3PWIA 1GOIA 2YZRA 3T08A 3ARXA 4Q7NA 5EMUA 3SAZA 2GGJA 4QLKA 5T8GA 1CT5A 3LB0A 4RJEA 1S5TA 2DP3A 1SJCA 1YXDA 2XDFA 4H2HA 4HNCA 3LPFA 4GGBA 4Z1AA 1HVXA 2DVUA 3GHRA 5CAHA 4J9JA 3UT0A 5AYXA 4RZBA 2PWDA 3GWQA 2PTXA 3CU2A 5DXYA 3VIPA 3L2LA 3T4WA 3F2BA 4YPJA 4TR9A 1DE5A 2J9ZA 1W37A 3NO1A 3T42A 2E6DA 3VOFA 3GYEA 1GPFA 3VGHA 4IMEA 4MAVA 4GYKA 1XV8A 3VK5A 3IK2A 3ZT7A 2QV4A 4IP4A 4XK2A 5KSWA 4ECLA 5AY7A 4X0NA 1KRCC 4KBXA 1QI4A 5EMLA 4AC1X 5D2XA 2BS9A 2PLJA 3AO0A 4GQQA 2VOMA 2VX6A 4L4MA 5DN1A 1YNYA 4D6GA 3TIMA 4AWEA 4R34A 1OFRA 1KM5A 3CO8A 3S1UA 3PPGA 1NY1A 5A94A 1EJ7L 2BB0A 4AH7A 2YBTA 4AF0B 5EBUA 1OC5A 3F03K 2HK1A 3KTCA 2J74A 3COTA 2CBJA 2WSQA 3Q67A 3SUWA 4AF0A 2MUCA 1RP9A 1WDDA 3W0KA 1UA3A 4JTKA 4IIGA 1KCXA 2UY3A 4M3PA 5LA1A 4O11A 4UQDA 4QP0A 4FX7A 3LX9A 1Q6RA 3SB0A 2P1FA 2BXZA 4Y90A 2VT0A 3SGZA 3NFUA 3W81A 2B0MA 2OX4A 4YTUA 3W7NA 4HNOA 1C9DA 1B54A 1H7WA 2OB3A 4LYPA 3LK6A 1XDLA 1ZBCA 3TYUA 1I1XA 1YNQA 2EXOA 3T78A 1W31A 1TR1A 4RDYA 5AHIA 3OB8A 4FLSA 3NXFA 4A3RA 1QDSA 3SGGA 3FJNA 3BJSA 4ZXOA 4ZO7A 4OV9A 2E77A 2X05A 1RHCA 4MZ1A 1I6NA 4PCFA 4MOZA 5CGQA 2PWHA 2XGIA 2PWGA 2VCCA 3TTQA 3BGGA 2PI6A 1HIZA 3WG6A 3SCRA 4AXKA 3UYCA 2VEMA 1HTIA 4I90A 3EX6A 2Y89A 1Q4WA 3MB9A 1QI0A 3FSUA 3A24A 3QV8A 3OW1A 3I7QA 4A29A 1R9XA 2E68A 2D2JA 5AC8A 4O1BA 4GFSA 1JZ5A 2W9MA 4H9MA 2EPLX 4G5DA 2E9MA 2GGIA 5FAGA 3SCSA 1HX0A 3DU0A 3QJAA 4JHZA 1CGVA 3KBNA 1NH6A 4JTIA 1E0UA 1JAEA 2W61A 3FIGA 3RR1A 4GHRA 3USBA 3PZMA 4H6RA 4BQ2A 2WWDA 3Q45A 1EIBA 5BRPA 3A5FA 2V81A 3IRSA 4PCNA 2C6QA 4ZR8A 5LYRA 3HBLA 5H91A 4F2BA 1JIBA 3FVDA 4XKYB 4AWTA 4ZGYA 1BLIA 1QUMA 1I2QA 3WQWA 4TTUA 1QT1A 3SURA 4AU0A 3WNMA 2AAMA 3GW3A 4HK7A 1UR4A 4Q33A 2AL1A 2WBGA 4UTFA 4XZMX 2ZX7A 3CUXA 4W4QA 1CZ1A 3KBSA 3SM0A 3I6EA 2OLHA 5CPNA 4BKNA 3SY1A 3AIQA 1QK2A 5HMEA 1EEPA 3KWSA 1W3LA 5BRBA 2D1ZA 2FGLA 2RH9A 1SFLA 3N04A 3IACA 3TJ4A 2BGNE 3L5LA 2RGMA 4HU3A