4PMUA

Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (xyna) belonging to gh10 family (space group p1211)
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
355
structure length
355
Chain Sequence
TSLKQAYAQGFLLGTAVNADIVSGKDAASAALVACHFNAVTAENVMKAEVVAPRRGVQDFSAADAFVAYAQRDRQFVVGHTLVWHNQTPEWFFTTADGRPNTPAQQLERMRAHIAAVAGRYTGKVQAWDVVNEIIDEDGSYRSTNWVQRVGDGDTVVRNAFAFAQRYAPDAQLYYNDFNAWRPAKREGIVRMVKMLQQAGVRIDGVGMQGHWGLNYPSLRDIEDAIDAYAALGVKVMITELDIDVLPLTKEGQIIGTGMAHKQFQLPEFKRFLDPYRDGLPADVQAQLRDRYAELFALFWRKRDKIARVSVWGVSDDMSWKNDYPVPGRTNYPLLFDRNHQPKPALDAVVAVPSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase A
publication title Molecular mechanisms associated with xylan degradation by xanthomonas plant pathogens.
pubmed doi rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Hydrolase
total genus 133
structure length 355
sequence length 355
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pmuA00
2GVYA 1ZBVA 2FH8A 1R85A 5C8BB 3VILA 3WH8A 2J7FA 3OBAA 5IXEA 5I0DA 4UR9A 3SURA 4M80A 1B3VA 5D9PA 1XH2A 3WH9A 2D0HA 3AYSA 4PMQA 3WD4A 1QNRA 1UA7A 4ZFMA 2O9TA 1DWJM 3ECQA 4W7WA 3W53A 2E3ZA 4AZGA 3VTRA 3M7SA 4YN5A 5A2AA 3SCPA 4EKJA 3VKKA 3BAIA 1UZ4A 3CZGA 5M17A 2J47A 2W62A 3FAWA 1KQYA 4EE9A 1CXFA 2V3DA 1JAKA 5JIWA 5E70A 2XM1A 1VJSA 1UQYA 2J7HA 3UG4A 5ECUA 4E4PA 4KWUA 3THCA 1D3CA 3KEHA 1JXKA 1R87A 2YOCA 1G01A 2F2HA 3MV11 4JCLA 1JD9A 2OYKA 3WEZA 3CHFA 1OIMA 3OZPA 2UWFA 4AIOA 3GYCA 1UWUA 2VRQA 3L4XA 4AZ7A 3ARSA 3LPPA 4UQEA 1BHGA 4UZSA 3CHDA 4X0VA 2X2YA 3OA5A 1A3HA 1V02E 2GJRA 2D3NA 2DGAA 5AY7A 4U3AA 3QR3A 1ESWA 4HMDA 4UOQA 1DP0A 1UD4A 2AOSA 3WF4A 4AEFA 4MDPA 3FHQA 4WF7A 3OGSA 4ZE5A 2WHJA 4OOUA 3F5KA 5GPRA 2WLYA 3NSNA 3WF3A 2EPNA 4OJYA 2Y4SA 1VIWA 2E8YA 1V08A 3UG3A 4JIEA 1E72M 3SUVA 2QLYA 3VD9A 2QPSA 4TTGA 1WZAA 3W6MA 2WHKA 4PCTA 4E8CA 2W4XA 1N82A 4D72A 1H41A 2WBKA 4RE2A 4CCCA 3ZIZA 1CGTA 3U7VA 1OINA 5CXPA 2PWGA 1VFFA 1VJZA 4XX6A 2XWDA 1E6XM 4PTVA 3WIJA 2J7DA 5F7UA 1E4LA 4W88A 4D71A 1E1FA 1SMDA 3SEPA 1CNVA 3B9DA 4PSPA 1UWTA 4M81A 3VIPA 4LX4A 4MNMA 2OWCA 1QHPA 4CD8A 2YDRA 4LXFA 3AHVA 3BH4A 2CXGA 5CLTA 1O6IA 5GNXA 1V6YA 4UCFA 4MPKA 3GNOA 5CQ1A 3RDKA 4ZXLA 2GSJA 1C3FA 4CGTA 1GNXA 3MV01 3W4RA 3BSGA 2A3AA 1PAMA 3PTMA 1EDGA 3W24A 2PWDA 4TOQA 3WBEA 1TVNA 1QNOA 3DYPA 4UFLA 1W3KA 2VCAA 3BAWA 4L4PA 1W3HA 2XPKA 1JNEA 2WMFA 5ABHA 3CUHA 1V3MA 1WP6A 4CVWA 4UOZA 1HKKA 2XSAA 3NCOA 3KWXA 3CUGA 4DUWA 2EEXA 1UKTA 4U5KA 1QVBA 3WF0A 3AS1A 1C7SA 3VDBA 2ZXQA 5LA2A 1UD8A 2EPKX 1X6NA 2BNJA 2RGMA 3MO4A 3OG2A 4FLQA 3U5UA 3THDA 5TD4A 3ZR5A 1K9TA 4JHZA 2XVLA 3ZJ6A 1CXLA 1UR0A 4RL3A 3MMUA 2UY2A 4GI6A 2CBVA 1VFOA 3AHTA 3AZTA 5A6KA 1M01A 1TUXA 1ZL1A 2QMKA 1E9LA 3VMPA 1HJQA 3WUEA 1C8QA 4H41A 1UA3A 3WDQA 4BF7A 2VT0A 1GJWA 1B31A 3WD1A 5A6LA 4Z2GA 4MB4A 1QI3A 4D1JA 1VRXA 3LMYA 3EDJA 2ZX9A 1HXJA 2ZUVA 3MS8A 4RE4A 3KL0A 4GQQA 3GZAA 2TAAA 3QGVA 1C8YA 4AISA 2Y8KA 1L0PA 3I3BA 1HN1A 4PMNA 2J4GA 3K1DA 3A6OA 2X0HA 3ZT7A 1XGZA 1W2VA 1NQ6A 2D23A 4X9YA 2D0GA 5BRQA 1V3LA 2PBGA 1I1WA 3S2CA 4MB1A 4GIAA 1H09A 4GO9A 3ALGA 4IUGA 1GOMA 2XSBA 2IXUA 4WLCA 2G8ZA 5DT5A 4BQ3A 2VZVA 3AISA 1FP9A 2Z1KA 1BYAA 5DEZA 5CGTA 1NARA 1W2PA 3ARWA 4RE3A 5DMYA 1W1TA 5M5DA 3ARQA 4PCSA 3U57A 3B9AA 3W25A 3W0KA 1JIBA 3AQUA 3RIKA 1GCYA 2ZX6A 3TTOA 3AJ7A 4JFUA 1EO5A 3UG5A 2YDSA 4TVDA 2QF8A 2GDUA 5HOSA 4PMVA 3W28A 4JZ5A 3TOPA 3BMVA 2ZWZA 4QFUA 3ZT6A 3A3HA 3TTYA 2WCAA 4AZBA 1FOBA 1J10A 4JCMA 1C8XA 3WL1A 4TVUA 1VEPA 4XZWA 2GUYA 1K9DA 2Y5EA 1K9EA 2W91A 2V3FA 1KR0A 2E40A 2ZXAA 2Q8XA 4GQRA 3AMLA 2XVGA 1DHKA 4H8UA 1ZB5A 3VIHA 4U31A 3GNPA 5IHSA 4W8LA 4ML4A 4D6JA 1H49A 2Y24A 3VU2A 4ZXOA 4W93A 1V3JA 1BGGA 1JD7A 3SCTA 2CPUA 5AC4A 3PZOA 4M24A 3RM4A 4L4OA 1YQ2A 5CPSA 3WN6A 5BWFA 2VZOA 1CYGA 3CZJA 4UQDA 2WC4A 2VQTA 4AW7A 3WQ6A 1J0ZA 5EBAA 1B90A 3CIVA 4AD2A 3OB8A 5IHRA 2VCBA 4IISA 1O7AA 5CJ5A 3O9NA 3PZTA 3VD5A 1KGUA 2IUZA 5A8MA 3VPLA 3QHNA 5EFFA 1AQHA 3KE0A 3WUGA 1RD6A 5HPOA 3WF1A 3UERA 3GH4A 1ZU8A 4HA3A 4JL2A 3AIQA 5A8NA 3N17A 1ISXA 1GZJA 3IK2A 4TTUA 4J3WA 3T2PA 3DC0A 1IZKA 1EQPA 2UY5A 1WE5A 3WL0A 2VX7A 3CLWA 2VX5A 2D24A 3VD7A 5I5RA 4UFMA 1CGWA 3PBGA 3BLPX 3SCVA 1C93A 2WMIA 3WUBA 1TZ7A 2VNCA 4FLSA 3GDBA 3A4WA 4C7DA 2Z1SA 1PEZA 3RILA 4HPGA 1MW0A 4J27A 1NOWA 2VZUA 5BXTA 5GNZA 1HIZA 4KRUA 4OUEA 3K8KA 1BFNA 4AD5A 3E1F1 5DFAA 3ARZA 2YL9A 4IPLA 3WNLA 1VF8A 5HBFA 4ZENA 1UZ1A 3ARTA 3GBDA 3CO4A 4PMOA 1WDRA 4PTMA 3JUGA 4J7RA 5M3WA 3G6LA 4Z2IA 1WCGA 3PTKA 3N13A 4HU8A 1MVYA 2DQXA 3SCNA 4AZHA 3FNDA 5A2BA 5BCAA 4E2OA 1MW1A 1V3IA 1HJXA 3T09A 4AD1A 1UR8A 1RP9A 1Q6DA 1TG7A 4CD4A 2X0YA 5BXSA 1OGSA 3WD3A 2AAAA 1XSJA 3A4AA 2VVNA 3ZMRA 1BLIA 5ABEA 1HJUA 3SIMA 4UTFA 2PWEA 5FCZA 1GVYA 1QHOA 3CMJA 1PIFA 4D1IA 3ARPA 5A8PA 4AZ5A 3HN3A 3L2LA 1WB0A 2GJPA 1Q6EA 1Z32X 2D3LA 1J9YA 3BGAA 3K8LA 5LYRA 1J0HA 1US3A 2DPEA 2E0PA 1KB3A 3WNKA 1BG9A 4QLKA 2CBJA 2JF6A 2WMHA 2CETA 4P8UA 1UR2A 3A4XA 5AYBA 3BXWA 4MNKA 4XUYA 1K6AA 2B31A 3VGHA 5FL1A 1S46A 3GM8A 4KH2A 3OZOA 3ARXA 4CCEA 1G5AA 3BLKA 3PZNA 4ACYA 3DECA 2BY3A 4QLJA 1E4IA 2NW0A 3WUFA 1C90A 4LYRA 3CUJA 1HL9A 1HNYA 3WD0A 1MXGA 2QHAA 4P7OA 5IFTA 5BXPA 1JDDA 2MANA 2BHZA 2VL4A 2EPLX 1E5JA 1Q6CA 1MQRA 4OOZA 3WF2A 1VAHA 1HJSA 1XSIA 3UR8A 1H2JA 3FW6A 2VZSA 3EDDA 1EHNA 3NSXA 5I77A 2ZUWA 4B9ZA 3GXIA 4DWSB 1H0GA 5CPTA 1E6QM 4M8UA 2VRJA 3SUUA 2CERA 1JAEA 1W1VA 4V27A 1Q4NX 1CLXA 1PPIA 3WQVA 3I3EA 1QNSA 3AIWA 3WNPA 1NWRA 1AVAA 2XTKA 4Q22A 2PF0A 2OWWA 3AXHA 3QOMA 1W9PA 2BV9A 5I6SA 3AMCA 3AZSA 2PBOA 4PSRA 1QPKA 3VO0A 1W9BM 4CD7A 1CZ1A 4FK9A 2OYLA 4H7VA 3WMSA 5BRPA 3FAXA 3VDCA 1NOFA 1R86A 1F4HA 2DSZA 2XVNA 1JYVA 1OIFA 1GQIA 1J0IA 2NT1A 4AC1X 3IJ9A 3LPOA 2WMKA 4PN2A 3T08A 2JEQA 1JZ8A 3VGFA 1V3KA 2O92A 3VMNA 4FMVA 1UKOA 2OSXA 2WNWA 3EDKA 3EYPA 1JDAA 1I1XA 3ARUA 3ZOAA 1UWQA 1SR0A 3MU7A 1MWOA 3TP4A 3NJ3A 2CIPA 5ABFB 1KFWA 3OLIA 1EGZA 1E15A 4NZCA 3RJXA 1HVXA 2QV4A 1ZJAA 5A6BD 4M1RA 1GQJA 5E0CA 1KGXA 2ZIDA 4CD6A 1BTCA 3WH5A 2WC3A 1M03A 2G3JA 1Q6GA 1HKMA 4JKMA 1E55A 1FH8A 1X1NA 1DWIM 4MAZA 1LF1A 1HT6A 3POHA 3MUZ1 4HZ8A 1GHRA 1PX4A 4XB3A 1FHDA 3W29A 1E40A 1BAGA 3BAXA 2WXDM 3CHCA 3RMEA 1C7TA 3BAYA 1WDSA 1PZ3A 3LPFA 4OKDA 5I2UA 1E6SM 2VZTA 5A1AA 3WFLA 4D6CA 5C70A 4MADA 3VIOA 1E0VA 1CGVA 2BY1A 2GDVA 4CN1A 2F61A 5A95A 1V6WA 4OBRA 1J01A 4UFJA 2VRKA 3KL3A 2WSPA 3II1A 2FGLA 4W5ZA 4HA1A 1VBRA 4IPNB 3U5YA 5CZKA 1C92A 1QBAA 1UHVA 2VI0A 3IANA 1R7OA 4P7QA 2ZUUA 3O6AA 2OSYA 4S3KA 3TTSA 5A8OA 2FH6A 3O2LA 5GNYA 1QI0A 1KCLA 3PZUA 1MQPA 3VMOA 3W81A 2J75A 1XHGA 3WDPP 1NP0A 2W5FA 2D0FA 3AHZA 4OIFA 2XUCA 3VD4A 1E6PA 1LWHA 2WC7A 2XVPA 3T2QA 2J25A 1MQQA 4MNLA 1UR9A 3UETA 3ALFA 1CEOA 2DSUA 4YHEA 2V3EA 2WZIA 4W8BA 1DEDA 1OD8A 3M6DA 3TTQA 1B3WA 5A6MA 4W5UA 1KXHA 2ZICA 2A3BA 2FHFA 3MMWA 3UESA 3RJYA 5IDIA 4B9YA 2DT3A 1TFVA 1BG4A 5JUVA 4B15A 2GK1A 2WK2A 3WFZA 2CNCA 2X05A 2G4FA 3POCA 3RO8A 6CGTA 3MANA 4WJXA 1XH1A 4S3JA 5I3DA 1CDGA 1LL4A 4CCDA 4P8XA 4AD3A 2WZHA 3WDJA 2NSXA 3GXDA 4TXEA 4W84A 4UQ9A 3FY1A 4F8XA 1NWUA 3WQ8A 1LG1A 4P7RA 1VB9A 3IAPA 2ZX5A 2ZX8A 2ZUTA 4M56A 3S6TA 2WPGA 3K4DA 5E6ZA 3OLGA 1U2YA 1IT0A 1ZBCA 1WDPA 3VDAA 5EB8A 1UH2A 2EQDA 1OWQA 1GHSA 1CXKA 4K68A 1WDQA 4N42A 4WKFA 1J11A 1CPUA 1EOMA 1ITXA 3FXYA 3OLDA 3AICA 2W66A 4JFWA 1LLOA 4CKQA 2ZWYA 1QI2A 4P7LA 4GI9A 3OIHA 1GOIA 1KGWA 1V0KA 3VOCA 1AQMA 3CHEA 1KBBA 1ZBKA 3ARVA 3DHUA 1KCKA 2UY4A 2YJQA 2EJ1A 1G9HA 1CENA 1WO2A 3MKKA 4C7FA 4UNIA 1JFHA 2HISA 3RCNA 4CN6A 1EH9A 2XG9A 4QP0A 1UR1A 2ZXDA 4J28A 3K46A 2V38A 1W9XA 2WYSA 5D9OA 4FF5A 2CKSA 3CPUA 2WVUA 3VIFA 4DUXA 4D6EA 4WKAA 3N12A 1FFQA 2WM0A 2XVKA 2DSVA 3W6LA 1WZLA 4TUFA 9CGTA 2EPMX 3OLEA 4AMCA 3N11A 2QPUA 1EA9C 8CGTA 1J18A 1QBBA 2HVMA 3ARRA 2GJXA 4CU8A 1HX0A 2VUYA 2V5DA 2G41A 1F4AA 1CTNA 4B16A 3VNZA 2VR4A 1NP2A 3PTQA 1EHAA 1WNOA 4WKHA 3M07A 3VIMA 3T0AA 4MJ2A 1E3ZA 3FN9A 3ZO9A 2JIWA 2GK1B 2E4TA 4J3VA 5A2CA 3PN8A 3VX0A 4V2XA 4HTYA 1E1EA 1SFSA 5LA0A 3NUKA 1GOKA 4W7VA 2V3GA 7A3HA 3RPMA 1J0JA 3BCDA 3ZT5A 4W7UA 1HL8A 1JL8A 4FLOA 4PRWA 3WSUA 1B0IA 1M53A 3DYMA 3TONA 2VVSA 4HU0A 3ZSTA 4JAWA 2VC9A 3PZQA 3CZLA 1H5VA 2YBUA 3AXIA 3BAKA 1UD2A 5JBDA 1E71M 4PMXA 3D5HA 3WEOA 1B3YA 3AIRA 1JZ2A 1M04A 3EMZA 1E3XA 1EQCA 4DWSC 1P6WA 4AEEA 4V28A 3WDIA 3SUTA 1UOKA 2ZUSA 1UH4A 1BVNP 4GZJA 4W8AA 2YA0A 1TE1A 4DM2A 3T0DA 3EDFA 2A3HA 1UWSA 1NOUA 1GPFA 1H1NA 4HOWA 3AHXA 1TR1A 1XV8A 3NDZA 1GJUA 2ZUNA 2W61A 1ISZA 4WSJA 3ZJ8A 1KBKA 1GW1A 2GFTA 5BROA 4H2CA 2VOTA 2J74A 3CMGA 2CESA 1TA3A 3L4ZA 3M46A 4PTWA 4URIA 4ATWA 1CXIA 3VD3A 4UOJA 2Y8VA 1JZ6A 4CU6A 2ZOXA 1LG2A 4JHOA 2VTFA 2ZUMA 3L4WA 4UFHA 5CSUA 1HJWA 1FH9A 4YPJA 4NF7A 5JBEA 1JFXA 2YL8A 1KR1A 1QI4A 3L2MA 1VFUA 1NWTA 3WQ5A 4Q7NA 3WMCA 4U33A 2JALA 3W26A 1OD0A 2W67A 4Z2JA 2JF7A 5KZ6A 1JGIA 5A6SA 2WANA 2G3MA 3MMDA 4JKKA 4WK9A 2DSKA 1VEOA 3PZMA 4PMYA 1XD1A 3HJEA 1D7FA 4A3YA 3BSHA 1OCQA 5HXMA 4F9DA 2YA1A 3AHYA 4BA0A 2GJXB 4H8VA 2VCCA 2J78A 4BQ4A 3WQ4A 1B30A 1I75A 5C71A 4HZ6A 2CBUA 4NI3A 4PUDA 3WBAA 5AYIA 2D2OA 1FH7A 1CGYA 1JG9A 3AMDA 3GBEA 2XJ7A 2WSKA 4ATLA 1OT2A 2WVTA 4AWEA 3AROA 1QW8A 1XCWA 4CUCA 2PWFA 1V3HA 4JFTA 3WENA 1XCXA 3AZRA 2OSWA 5A6BA 2OWXA 4KMQA 1EDQA 2ZX7A 4HPHA 1LQ0A 1H11A 1M7XA 2UY3A 4W87A 3CH9A 1UQZA 1H4PA 2XFRA 1EDTA 2JEPA 1LL7A 3VINA 4PTXA 2YL6A 3WMBA 4X0NA 1H3GA 1E43A 2E9MA 2WKGA 1WKYA 5A8QA 5I23A 4Z2KA 1R8LA 1XYFA 2DT1A 1HP5A 2BXZA 2E8ZA 3VGEA 3ZJKA 4HA4A 1VBUA 3EBVA 2AMGA 2DT0A 4HZ7A 2XYLA 4GO8A 1WZMA 4JL1A 1TCMA 4QAWA 2WMIB 1SYTA 2YLLA 3VDHA 4DWSD 4TVCA 1JYNA 4BQ5A 3QOKA 4C7GA 1H0IA 4B3KA 3AIEA 2O9RA 4AZIA 1JYXA 1TA3B 1G94A 5A6AA 4UQCA 1ZJBA 5HNNA 1KXTA 3NSMA 5CG0A 1UKSA 3B9EA 4TX8A 4PMUA 1CGXA 1WAWA 1E73M 4DM1A 1R7AA 4XV0A 1XD0A 1XSKA 2DH2A 1E0WA 4J3TA 3WQWA 2RGLA 1V03A 1W91A 1QNQA 5DO8A 3GXFA 5I24A 1X6LA 4Z2LA 5CGMA 4N0RA 2ESCA 4P7NA 4MDOA 5E9AA 4R27A 1EOKA 3LPGA 5BXRA 1B1YA 1E56A 1QI5A 3CZEA 4D6IA 3A47A 8A3HA 1BYCA 1XRVA 1Y7VA 2J7BA 2NT0A 4MTVA 3QHMA 1ISWA 4HOXA 2X09A 1HKJA 1K9FA 1BPLB 1ODUA 2DSWA 2W92A 3TA9A 4U2ZA 1EO7A 2BFGA 2X1IA 5D8WA 1CXEA 5M03A 4M82A 4JKLA 2EXOA 3EMCA 1NWSA 2BXYA 4PYSA 1JNDA 3L4TA 4ZE4A 2WMGA 4R5EA 3W27A 5A6JA 3VIGA 3W37A 5GQBA 4MB5A 1JZ4A 4M29A 3VM5A 4F79A 1DTUA 5EMYA 2J7GA 1W9UA 4H04A 1UH3A 5FIPA 1SMAA 3PHAA 1DWGM 1QHZA 3VIKA 4PMZA 2BHUA 1OBAA 2J62A 1E0XA 1BVZA 5FKYA 2VQUA 1FP8A 1AQ0A 2F8QA 5A69A 3T0BA 2FHBA 2OYMA 1JXJA 5BYWA 4ATDA 3QHOA 2E9LA 2W63A 2CKRA 4XZBA 1GORA 4AIUA 2CEQA 3L4YA 4HMCA 1DWFM 3AXXA 5I78A 1UWIA 2C0HA 1E4NA 2JFEX 1W3JA 3AMGA 5A94A 1V0MA 4PMRA 4NSBA 1C91A 1WPCA 3OGVA 1IV8A 3B8SA 3CUFA 1W1YA 3L4UA 1UKQA 1ISYA 3L4VA 1U33A 3WEMA 1GQLA 1OM0A 4AZCA 3AS2A 1J0KA 3KZSA 5EFDA 4KGJA 3AIUA 3T2OA 1ZS2A 5ABGA 4DUVA 3WH7A 1E5NA 2DIJA 2DT2A 1XYZA 4FLRA 4JFVA 1E6NA 2C7FA 4H8HA 1E4MM 2G3IA 1JYWA 5DF0A 2WBGA 3MSGA 2CCRA 2YIHA 4E8DA 2XIBA 2WHLA 4AIEA 2WVVA 2WAGA 3GNRA 1G1YA 2J8GA 2J77A 3IJ8A 3ZSSA 2PC8A 3PZIA 1JI1A 2WCSA 3F5JA 2CBIA 3RM9A 3I3DA 3UCQA 1KQZA 2VX4A 2IXVA 3PZGA 1JF5A 3UEQA 2V5CA 1HF6A 1U30A 3BMWA 2D20A 3N1AA 1B3XA 1UUQA 3VIJA 1MW3A 2J7CA 2WCGA 3WD2A 5IFPA 3PZVA 1MW2A 3SUWA 1G0CA 1QW9A 1DWAM 4AXNA 4CN4A 4OZOA 3PZ9A 4CU7A 1DWHM 4BZYA 1CGUA 4CD5A 1PX8A 2ZE0A 3HU7A 3VVGA 1US2A 2WB5A 1UD6A 4MJ4A 4U2YA 1E6RA 4JFSA 1MXDA 2YLAA 2XHYA 4AYSA 2YL5A 3FHAA 3EMQA 2E9BA 4UQBA 1WZKA 4KRTA 4W86A 4GINA 2WLZA 4EAMA 5E09A 4A3HA 4WIWA 1GVIA 5E6YA 1XC6A 3AYRA 2WZEA 4AD0A 4P8VA 3WKZA 4EK7A 2X8RA 3G6MA 3SCUA 4J3XA 4QDMA 1YHTA 4CVUA 1V6XA 3SCQA 3VUPA 2J7EA 3CUIA 4D6DA 4UZUA 5CLWA 3MUIA 4MB3A 1ODZA 3APGA 3U7BA 2XFYA 1GOOA 3F4VA 1PX3A 1V6VA 4LQ1A 1XH0A 4Y7EA 3GXMA 3W82A 4MNJA 5E0FA 4PMDA 3WDHA 3AIBA 2G3NA 1RH9A 4A4AA 3MSDA 3SCSA 1UYQA 4AZCB 3ZQ9A 3WNNA 3NYDA 4GI8A 4F9JA 1TVPA 2EPOA 4BCEA 1CLVA 2OLHA 3ZJ7A 4BS0A 7TAAA 1LJYA 1GONA 1CXHA 1LWJA 4IM4A 4QCFA 3CGTA 5FD0A 1UKPA 2O9OA 1QOXA 3D3AA 1NM9A 6TAAA 3CZKA 5D9MA 1KWGA 2FGZA 4KGLA 2DDXA 5CPQA 1RP8A 2BHYA 3WH6A 3IAQA 2WVVB 1D2KA 3ZM8A 3CZ8A 4LGXA 4J3SA 4OBSA 1JZ3A 1IZJA 1BYBA 2Y2WA 4D6GA 1UG6A 1BSIA 2VJXA 2YA2A 4GKLA 4GZIA 2JE8A 3K8MA 1W9VA 2PI6A 1PJ9A 1GQKA 2CYGA 2EBNA 1FFRA 1QNPA 4ACZA 1GOQA 3SCOA 3GH7A 2BVYA 5CSYA 1VENA 3HMCA 1KXQA 1HP4A 3OGRA 2J79A 2VURA 1ISVA 2VO5A 2XIIA 3AOFA 3BCFA 3DYOA 2XFFA 1E6ZA 1PZ2A 3J7HA 4P8WA 4GZEA 4HMEA 5FL0A 1OGGA 1EIBA 4U5IA 5D9NA 3ZR6A 3VGGA 2WWDA 3VNYA 1JI2A 5LA1A 3NDYA 1CECA 4LYQA 5D4YA 1Q6FA 2WW5A 2WKLA 1HKIA 1W3LA 4LYPA 2QMJA 1GOWA 1V02A 4PBGA 4AY1A 1AMYA 1KWKA 1ITCA 3WNOA 3AS0A 2BS9A 2J8FA 2XWEA 4J3UA 2WWCA 2D22A 2C8NA 3WY1A 4AD4A 2VMFA 1HJVA 4U3CA 1KXVA 1ZBWA 4WSKA 3AIVA 1EXPA 4B3LA 3F5LA 3SCWA 3N15A 3WNMA 1W32A 2FDMA 2VR5A 2BVDA 2WMJA 1MFVA 3GTNA 1B9ZA 2BY0A 1B2YA 2FHCA 3K4AA 4PEEA 1W9DM 5JIPA 1FA2A 5I79A 4DWSA 4EANA 1CIUA 1V6UA 2O9PA 1BGAA 1BYDA 4UFKA 1HVQA 2CHNA 4BQ2A 3UR7A 3ARYA 5FOOA 1A47A 3MUAA 4NRRA 3N9KA 3W38A 2A3CA 3VX1A 6A3HA 2WHMA 4PUEA 3VM7A 4UFIA 2ZXBA 3NIYA 3SCRA 1OGBA 1TMQA 3EDEA 1UWRA 5HDRA 1UD3A 2DIEA 4D6HA 1J0YA 1V0NA 3BAJA 4YHGA 1PBGA 5HPCA 3BC9A 4HOZA 4GXPA 1RPKA 1BF2A 1CWYA 3DHPA 5KEZA 2EO7A 1L8NA 1FHLA 2XGIA 3VGBA 3SUSA 1V0LA 2PB1A 2VX6A 1MYRA 4GPNA 1GUVA 2DH3A 2WVSA 3AMKA 4QLLA 2BVTA 1J12A 2D1ZA 3N18A 4NRSA 4W89A 5AC5A 2A3EA 3KL5A 3MUY1 2BY2A 2JIEA 3VIIA 1LL6A 2YDQA 2CHOA 3WDRA 4Z2HA 1JZ5A 3IJ7A 4ACZB 1OT1A 1OSEA 4ZEPA 5JBFA 5D8ZA 2XGBA 3GH5A 3AI0A 5DT7A 1ECEA 1BQCA 3AS3A 5ABFA 4MAVA 1CBGA 2DEPA 7CGTA 1VEMA 1VFMA 4D6FA 4UQAA 3CTTA 1W1PA 1UR4A 4F66A 1JDCA 1UD5A 2CITA 1NH6A 4W85A 1PIGA 4LPCA 1JZ7A 3VGDA 3WELA 4QCEA 4TX6A 2YKKA 3AFBA 2YBTA 1JF6A 5A3HA 1B3ZA 1OB0A 2XM2A 4AZ6A 3N04A 1E70M 4HP5A 3RM8A 2PWHA 3CBWA 1MFUA
chains in the Genus database with same CATH superfamily
3LU2A 2E1WA 2WNNA 4O1AA 4L9YA 3VILA 3R5EA 2J66A 4K39A 1JCLA 3E5BA 2D73A 4L7ZA 2JGQA 4QS6A 1RBOB 3WH9A 4G8TA 3WD4A 3ISIX 5I03A 1UA7A 4ZFMA 4BR1A 3W1NA 3ECQA 5EGRA 3M7SA 4EKJA 1WOBA 3ITTA 2W62A 4O11A 5LXXA 1EC8A 2WOQA 3GQYA 4C65A 3N29A 4KWUA 3THCA 1D3CA 1G4PA 2PS2A 4Q32A 1R87A 3M64A 1K03A 2YOCA 3W70A 4CQ9A 3MV11 4H3DA 3B8TA 3L66A 3PY2A 1EJRC 4DI8A 4MF4A 4HNUA 4JCLA 4KETA 2OYKA 3UXKA 3PBYA 3OZPA 3QW4B 3APYA 1XRTA 1OK6A 2VRQA 4PFHA 2WSQA 4GGHA 4OUIA 2X1UA 3WYZA 1MRAA 3K1GA 4UZSA 4XSMA 3LSBA 1A3HA 1RCQA 4JR5A 2DGAA 4C6IA 5LNSA 3BOLA 1ESWA 3V75A 5FACA 2Z1XA 1UD4A 3B4UA 4CNTA 3FHQA 2W0UA 1F3XA 5KZEA 1UUOA 2BODX 4ZE5A 2IKGA 4DJFD 1FDYA 2R94A 5AC8A 4GYPA 4JQ2A 3T4WA 3NO3A 2QAPA 2EPNA 1DJGA 4JIEA 2JGYA 1E72M 1YE6A 2QLYA 3VD9A 2QPSA 3M43A 1WZAA 2WHKA 4PCTA 1RVKA 4F0LA 1YADA 4RE2A 3ZIZA 3LY0A 2XWDA 3STPA 1E6XM 5KMYA 3WIJA 3DHFA 1UIOA 4W88A 3W87A 2PU0A 1LYXA 5MF5A 2FVLA 1P43A 4LX4A 4PTNA 1MNZA 5CPLA 3EKGA 4LUTA 4PULA 1B9BA 2YDRA 3EEGA 3FEQA 3C8NA 5CLTA 1V6YA 4Q8MA 4LT9A 4MPKA 2PDMA 3NXFA 2LLEA 1C3FA 5CPMA 5CBJA 4YTUA 6ENLA 3WJZA 1KFJA 3BV4A 4XZHA 1GNXA 1RA0A 4JTFA 1UJQA 1HUVA 3W4RA 3UWEA 1Q6RA 4TOQA 1ZLPA 3T8LA 1QNOA 1DPMA 2HROA 2IMRA 3M1ZA 4ZBCA 1IXOA 4MZ1A 2XPKA 2WMFA 5ABHA 4CVWA 1V3MA 3BK0A 4D8ZA 2AGKA 4YYFA 4HNOA 5AHNA 4AH7A 3E9AA 1DQXA 2HWGA 3OP2A 5ECVA 1UKTA 1AJ2A 1AJ0A 3VDBA 1JULA 2QUTA 1K7FA 1UD8A 3MO4A 3EKZA 4DXKA 4MY8A 4Z1YA 4GIEA 4FLQA 3THDA 2X16A 3ZR5A 1BRLA 2XVLA 3G1HA 5D2WA 4MLRA 5TNVA 1V93A 5I3KA 2VEFA 1V51A 2CBVA 3WQCA 4YTQA 1M01A 1VYPX 2EPHA 2ISVA 2Z2AA 3L0NA 5T26A 2HS8A 4HPNA 3NDOA 2H8ZA 1X6UA 4ADSA 5I3HA 2V67A 1C8QA 3AUJA 3GB6A 2FVKA 2NQLA 2VT0A 4S3BA 1GJWA 3TYZA 1J6PA 4G2DA 3BOFA 2V5KA 1OC7A 2P8BA 4MB4A 4LC6A 1XBZA 2OZ8A 4L56A 4XTDA 4ENLA 3MBDA 1ZCOA 2TAAA 4RPQA 5G4HC 2P1FA 1C8YA 1KTBA 3N4FA 1A80A 3LBCA 3WLLA 2Y8KA 1I0DA 3I3BA 1HN1A 3HPZA 4PMNA 3PK7A 2GJNA 2X0HA 3FGCA 3GWQA 3Q4DA 4GBDA 3LV5A 2KX9A 3VNMA 3GHUA 3UBPC 1XP3A 4GQ0A 1MXSA 3ALGA 2QVHA 2YZRA 4JTTA 2IXUA 3W83A 4WLCA 1JPMA 4FNUA 3FYOA 5DT5A 4FXSA 4BQ3A 1K77A 2YCEA 3E2RA 2Z1KA 3WK3A 3VZYA 3IUHA 1W2PA 4RE3A 5DMYA 1A49A 4M7SA 3ARQA 5AZ0A 2OU4A 3W25A 4DBSA 3RIKA 3GC2A 3TTOA 2OQLA 3EWBX 2GDUA 3LGEA 3W28A 3TOPA 1KTCA 3ITCA 2ZWZA 3LOTA 3R8GA 2WJDA 4QFUA 1MSSA 4RLIA 2VOMA 3EGJA 3N73A 2R91A 1C8XA 1YKWA 4KEVA 4TVUA 2O7QA 4UCGA 3REQA 4QG6A 3V1HA 2E40A 3AMLA 4MY1A 2A1YA 3NGFA 4GBUA 5IBXC 4CNPA 1H60A 5IHSA 4W8LA 3ZFHA 4D6JA 4AYGA 1C8VA 1V3JA 2DQWA 2CPUA 3P82A 1T41A 4ZR8A 1Q85A 1SZFA 2ZZ4A 3GVWA 1CYGA 1P6CA 4UQDA 1TPVA 1O12A 4I9JA 3P0WA 5DXXA 5KTLA 2NVAA 2HE5A 3OB8A 5IHRA 4OHQA 3FCPA 4ERIA 1O7AA 4DJDD 5CJ5A 3O9NA 2Z1WA 3NQFA 3VPLA 3KE0A 3UERA 2BG5A 4HA3A 3WBXA 3PBWA 4W9TA 3DC0A 3KW3A 1OFDA 2F7FA 2UY5A 2VX7A 1UROA 3CLWA 3H12A 3PG9A 1CGWA 3NQDA 3RX4A 3LCXA 2WMIA 2QW5A 3RFAA 2IQ0A 3P8JA 5CCZA 5XINA 1UBSA 5JXQA 3A4WA 5K2ZA 2HK1A 3RILA 1EJVC 4LY4A 1KM4A 2VZUA 5JVLA 3K8KA 5B7YA 2YL9A 4IPLA 1VF8A 3NEVA 3ARTA 1S1RA 3GBDA 1Q65A 3CO4A 4PMOA 3SFWA 4HK7A 2OJPA 1PS9A 1WDRA 5M3WA 4PUUA 2Y0FA 3NPWA 4MLJA 5CPNA 5XIMA 1POKA 3NR0A 4RE0A 4AZHA 5A2BA 2OZ0A 3T44A 4WGHA 1S38A 5E93A 3DI1A 3L9CA 4AD1A 1UR8A 1Q6DA 1TG7A 1CLKA 3EX4A 2OODA 2Q8ZA 1TVLA 4QDWA 3M9YA 2EG8A 1XSJA 1W8SA 3CV7A 2PC4A 1JRCA 3ZVHA 1E9YB 5FCZA 1DJXA 4IPJA 1GVYA 4LRTA 4D1IA 2XIOA 3H2EA 3HN3A 3T0CA 1WB0A 4LFYA 1W37A 1Z32X 2NQZA 2OCZA 4E6MA 1FBAA 1US3A 4ZO9A 6REQB 3WNKA 2CBJA 5AYYA 3KVKA 4JOMA 1D3HA 2EAWA 4EIVA 5AYBA 2O0TA 3QR0A 4MNKA 4Z1DA 4XUYA 1E0UA 3VGHA 4PUNA 1S46A 1O66A 3GM8A 3GX9A 3OZOA 3IIVA 1G5AA 3PZNA 1R3VA 3DECA 3QLDA 3WUFA 3UCDA 3DFHA 1V7YA 4LYRA 1HL9A 1HNYA 4B5XA 1TTIA 1UOZA 3W2UA 4P7OA 4IFOA 1XYMA 1RJRA 1JDDA 2C16A 2MANA 2NXHA 3PF3A 1SO5A 1E5JA 2H6RA 1GZGA 1XSIA 4E38A 4HZMA 4ZCWA 1YTKA 2VZSA 2XZ9A 1EHNA 3NSXA 4XBKA 2PP1A 4WDWA 4LF2A 1AODA 1QTWA 4B9ZA 3GXIA 4DO5A 1AFSA 3SRKA 3SUUA 3BUVA 2VFFA 3GVGA 4PODA 1XLKA 2QDGA 3LTYA 1EGVA 3MCMA 4S23A 4DBUA 4IOTA 4QE1A 2PDCA 4YCPA 5FEZA 4GCXA 2BTMA 2PF0A 2YR1A 3KWSA 3AXHA 4J5NA 2BV9A 2PRLA 3AMCA 2PBOA 3AC0A 1QPKA 1YEYA 1W9BM 4CD7A 7ENLA 2ABBA 4GYKA 1XG3A 1GTEA 4Z17A 5BRPA 3VDCA 3CNYA 3TN3A 3F03K 2DSZA 3GNXA 3C8FA 2XVNA 1EUNA 4OU1A 3LPOA 3QW3A 3BLOA 1X39A 1DBTA 4XG1A 3BE7A 4PN2A 2OKTA 2V5JA 3SW6A 1KC7A 2HRWA 4E5TA 3S1WA 1UKOA 1TTJA 1VHCA 3QV6A 1YNYA 2PGFA 4IIFA 2WNWA 3EDKA 3EYPA 1JDAA 3HOJA 5MHBA 4WSHA 4XD5A 1JCJA 1SR0A 3NJ3A 2BOGX 3OO2A 3R11A 4O57A 1NFPA 3L0KA 3EWWA 2A85A 1BXNA 1BTCA 4ZTXA 3TJIA 4NNBA 4JKMA 1FWCC 5K7JA 1LF1A 3BZGA 4HZ8A 1E40A 1BAGA 4QE4A 3DXIA 3G1RA 3HGSA 3SY5A 1PZ3A 4OTKA 3O3RA 4HCDA 2VZTA 5I2UA 3M16A 1EP1A 1KBLA 2QUNA 1RBAA 1CGVA 3G0SA 5BOOA 2F61A 5A95A 2GPTA 3KBJA 3NM3A 5H1WA 1V6WA 3A5VA 4OBRA 1J01A 5EY5A 3IPWA 1AZ1A 3KL3A 2WSPA 3A3XA 4W5ZA 1EIXA 3QV8A 4XAZA 1C92A 3A24A 4HCHA 5LNRA 3M5XA 1P0EA 1IEIA 2YPIA 3TMLA 3HGRA 4CCZA 1LROA 1KCLA 3GXNA 3PZUA 3FYYA 2J75A 3WDPP 3I10A 3PS7A 3ITOA 2XUCA 1LZOA 3VD4A 2CLLA 3TWBA 2DSUA 4XKYA 1A5KC 2PE4A 2V5BA 4WJEA 2V3EA 4LANA 4LYKA 4DO4A 4C6QA 5G2IA 5I3FA 2ZICA 4LC8A 2FHFA 4C6MA 2RJHA 4QJ4B 3CYVA 4NNAA 3R13A 1MEIA 2DT3A 4BI7A 3WLNA 4AF0B 3M0KA 2OTDA 3W7OA 5C0QA 3MKCA 4B15A 2YSWA 4WQ6A 1E1CA 1YXYA 3G0XA 1X98A 3L7RA 4B92A 4HPXA 2G4FA 2W6RA 4WJXA 1IXNA 1DXFA 5I3DA 2PCQA 1VCVA 3VFLA 1TV8A 3C2FA 2ZZ1A 3QZ6A 4LBRA 3GTIA 4E3TA 2OELA 4W84A 1LM1A 3FY1A 1RJPA 4LF1A 1VIZA 4UTUA 3W2JA 3TA6A 3W7CA 4QITA 3U2CA 2ZX8A 2FZMA 5TIMA 2WPGA 3K4DA 1AA1B 1XIIA 4A3RA 3I6EA 5EB8A 1UH2A 3GFYA 1KCXA 4GXWA 2QZRA 5BRBA 4K68A 4PH6A 1WDQA 1XKJA 1G7UA 4WKFA 4FNTA 3PBUA 1U1UA 3FXYA 2W66A 4N9DA 2XU2A 1IIHA 4UMAA 2GOUA 3LERA 4P7LA 4GI9A 3OIHA 1KGWA 4UTKA 4HBKA 3VOCA 5FF4A 2CW6A 1ZBKA 1XYAA 3USZA 1KCKA 3ATYA 5A5WA 1VCFA 2BGNE 3LK6A 2OEMA 5HWMA 3URAA 5DX7A 4UNIA 1ML1A 2ZC8A 1MMFA 4CN6A 3IS4A 2XG9A 4QRNA 3W1PA 3TH6A 3SJ3A 1FXQA 4J28A 2DUAA 1US0A 3K46A 1VFSA 3E0FA 5D9OA 3IIOA 4LS2A 1NDWA 1JPIA 2XVKA 2WM0A 2DSVA 1WZLA 4TUFA 4RV3A 3HO8A 2EPMX 1KLZA 1KNWA 4IGHA 5KITA 3N11A 4FXFA 2ZC1A 2QPUA 1J18A 2HVMA 4EWND 1XGDA 2X1RA 4Q4OA 1F4AA 2VR4A 1AL8A 1NP2A 3PTQA 4WKHA 4O8RA 1UMYA 4NZ1A 2GK1B 4J3VA 4MM1A 3PN8A 5HQMA 4DPQA 3DDMA 3TNOA 3V5CA 2UV8G 4V2XA 3SN4A 1TKKA 1ZTVA 5LA0A 1SZRA 1J0JA 4W7UA 5D2YA 1XYLA 5HJXA 4L80A 5IBXA 2INFA 4HU0A 4IIBA 3AWNA 3FS2A 1EPXA 3QGAC 2YBUA 1UD2A 4JEJA 5HUOA 3WLOA 3WEOA 3GYEA 1JZ2A 2GUUA 3IJIA 3CM4A 1P6WA 5K3VA 4E2BA 1UH4A 1BVNP 3OTRA 4X60A 3CL8A 2YCKX 5DN1A 2BP1A 3T0DA 3DKJA 1EC9A 1FWNA 1XRSA 4AVOA 1GPFA 1H1NA 1K7EA 2A5HA 3E12A 3AHXA 4CEXC 1TR1A 4K36A 1YLVA 2HSAA 3MY9A 4OE7A 1IE7C 2W61A 1ISZA 3STCA 5BROA 3PSVA 5AB3A 3OBEA 2QCLA 3K30A 1VYRA 2CLPA 5LNWA 3CT7A 4IGNA 2Y8VA 3SDOA 4CU6A 1F6PA 1LG2A 1BD0A 2E28A 2ZUMA 4Q4MA 1JPDX 4JBRA 1HJWA 5JBEA 4GX9A 1KR1A 1QI4A 5LZLA 4F4RA 3TZNA 4Q7NA 5D05A 4WOZA 1IXPA 2H3DA 4ES4A 1OD0A 2W67A 1ZAJA 1THFD 1JGIA 3MI6A 4CLMA 4O0ZA 4WK9A 4PMYA 2Z2BA 3APTA 1D7FA 3IRSA 4GG9A 3WLQA 4JY9A 4KW2A 1XPGA 2GGGA 1O1ZA 4OV4A 3KOYA 1S2AA 1WBJA 3MCNA 2GJXB 1QUMA 5AC6A 4WUIA 4F0KA 1B30A 2A4AA 4NI3A 3WBAA 4Q8PA 1FH7A 1JCNA 2VFIA 3O07A 1T7LA 4MVAA 4NZJA 4ATLA 3W7JA 4LUJA 4HJFA 4XO7A 4AWEA 5CAHA 3RCYA 1LT8A 4GNVA 3S2JA 2CLEA 4QX4A 4JFTA 3WENA 3R12A 3LGDA 4KMQA 3TROA 3B9OA 4HPHA 1VYSX 1H11A 3BV7A 3O7UA 1UWAA 4EPEC 4ZQRA 1FWWA 4PTXA 3H2CA 1E43A 1I6NA 4GLEA 5DANA 4NQ1A 3M47A 1RY8A 5EA9A 5I23A 4Z2KA 3XISA 3NQCA 4HHPA 1YNQA 2DT1A 3LMZA 4RZBA 1P0BA 1ME8A 1QK0A 1VBUA 1AG1O 1WZMA 4JL1A 1TCMA 1GVFA 3VDHA 3TN6A 7REQB 4IXHA 4DWSD 4ZOEA 2YW3A 3I7QA 4KFNA 4C7GA 4ZZ9A 4H6QA 1H0IA 2O9RA 3N6JA 4QE5A 3MBFA 3O16A 4BFAA 2DFAA 1J2WA 4TU1A 5CG0A 1UCWA 2H3BA 4DM1A 1WQ5A 4JTRA 2AQOA 1A5AA 2NX1A 3H2OA 3Q65A 4J3TA 4I9AA 3OOQA 3WQWA 3LTPA 4J35A 1W91A 4UTHA 1QNQA 2WO5A 3CAWA 5LIWX 3GU9A 5DO8A 3GUWA 3GTXA 1PKMA 3F2BA 1RK6A 3HM7A 3BG3A 3VABA 4XVEA 1H5YA 4R27A 4QHRA 3CZEA 1XLIA 2NT0A 4C6JA 2Z1BA 3QHMA 1ISWA 4HA0A 4Q4QA 1GYLA 2W92A 1YBQA 5C7HA 1CXEA 3DKLA 2PD5A 3Q94A 4JKLA 3PFMA 1NWSA 4PYSA 1QPQA 5C5YA 2WMGA 1M3UA 3CWOX 3LHTA 4R5EA 1KFBA 5TF0A 5A6JA 4DIAA 4B4FA 2X1TA 1YYAA 1DTUA 5EMYA 2J7GA 3T1GA 5FIPA 3M4HA 3PHAA 4ZA0A 1S3HA 1HG3A 2BHUA 3L5AA 4GH1A 2J62A 4DAIA 2V5LA 2Q09A 2F8QA 3T0BA 2GJLA 6XIAA 2PTWA 1ZAHA 4QQ3A 3DFYA 5I78A 3PPFA 3PPHA 2JFEX 4Z0SA 4Q4SA 4PMRA 1IV8A 3KUMA 3KLKA 1ISYA 2ATMA 4Q33A 4Z08A 4AHOA 2ZVRA 3SQMA 3U2ZA 4AZCA 3AIUA 3T2OA 3W7KA 5ABGA 1Q4WA 3ZR4A 1T6MA 3VKBA 4H8HA 3EX1A 1MO0A 1ZNNA 1J5SA 2DV0A 2CCRA 2YIHA 1O60A 4E8DA 4HK5A 4KFOA 1V5XA 2J27A 3GNRA 3MQTA 3PBMA 2O56A 3EXTA 2R8WA 2YDAA 1JI1A 4Q8QA 3I3DA 3OYXA 1R2RA 3PZGA 1GVQA 3UEQA 4J2PA 3L65A 5HK4A 3NQVA 1UUQA 1TV7A 1MW3A 5I07A 2WCGA 5IFPA 4IX2A 1U5VA 8TIMA 3WQFA 2E5DA 5GJPA 3S5YA 2PLJA 4CN4A 3GXTA 4CU7A 1NAL1 3V35A 1B57A 4POCA 4BZYA 4UUIA 3HV9A 1RVGA 3FEMA 1VH7A 1PX8A 3VKCA 3OVGA 1F74A 2QV5A 1W3NA 4YTSA 2PGEA 4U2YA 1YXDA 2CC0A 4LAZA 3DN5A 4Y9PA 5FF2A 2WZTA 2E9BA 3H54A 1AK5A 1F9CA 1I4NA 4FF7A 2PFHA 4WIWA 2PDHA 4AD0A 4P8VA 3WKZA 4EK7A 2X8RA 4QDMA 1QNVA 1RQBA 3KBVA 3OA3A 4J4KA 3QRHA 3RU8X 1XLFA 4DF0A 4KF1A 2FDSA 3RU6A 4O10A 1VHNA 2XFYA 3DC8A 1V6VA 4E4UA 2XIMA 4TQTA 4LQ1A 3AYTA 2P76A 2PGWA 4LJ3A 4GXMA 4HNCA 3GXMA 5EL1A 4UTJA 4NZ4A 1F8IA 4OGZA 3WDHA 3AIBA 1A5NC 5DMMA 2F6KA 1BWLA 1FDZA 1PKLA 4NAEB 1T99A 3WNNA 3NYDA 1TVPA 2EPOA 3OIXA 4BCEA 4BS0A 4DO6A 1RV8A 1GONA 1LWJA 4IM4A 4C1KA 5D2XA 4Q7IA 2QJIA 2O9OA 1QOXA 3L67A 3D3AA 5I3GA 3W1QA 3CZKA 5D9MA 2R1PA 1RP8A 3UZXA 2WVVB 4O15A 4E2DA 2DVXA 4OBSA 1JZ3A 3PUOA 1DXIA 4FNSA 2Y2WA 2REQA 1Q6OA 2VJXA 4IPPA 2JE8A 4C6EA 1GQKA 3EX2A 4DBWA 4ACZA 3GH7A 4ERGA 3WLTA 2PRMA 1NF0A 3UQNA 1AZ2A 3OGRA 2J79A 1ISVA 3BCFA 4AWUA 1PZ2A 3J7HA 1XUZA 2WWDA 4RNJA 3M0JA 1CECA 1XQLA 3QEZA 1W3LA 4JHMA 4I9TA 4K7VA 3GDLA 1PXGA 1LRNA 4AY1A 1KWKA 1ITCA 4IG2A 3PWGA 3MZNA 1EEXA 2WWCA 2D22A 1KXVA 1FKWA 1GW9A 1ZBWA 3UCCA 1S5TA 5KZDA 3F5LA 3KRBA 4FS9A 3GKFA 3WNMA 1R3RA 1W32A 1TQXA 3GTNA 1B2YA 3DAQA 2PPGA 5K9CA 2FHCA 3MHFA 1YDNA 3QYQA 4GK8A 3U3HA 3WG6A 1V6UA 3T40A 2IQDA 5IDZA 1BGAA 1WOAA 4HU3A 3ARYA 3HZ3A 4U28A 9RUBA 3NZ1A 3FSUA 3LCFA 1ZQ5A 2HVOA 3MA8A 2W3ZA 1DYSA 2WHMA 5HWNA 1K8YA 4MUZA 1P4CA 3NIYA 1RCXB 3W7HA 3BSMA 5HDRA 3URQA 3KRSA 1K4HA 2DIEA 4MWAD 3BAJA 4UR8A 4C91A 2HMCA 4JEQA 2BSLA 3U0HA 5KEZA 3ITGA 1FHLA 4S3DA 3H7UA 3SSJA 4Q8OA 2SFPA 4K38A 4AC7C 2VX6A 2PDPA 4DBEA 1F76A 2WVSA 3GW3A 3VXGA 4GABA 2D1ZA 3EKLA 3N18A 4DJFC 3KZPA 4NRSA 2VWTA 5AC5A 2BY2A 2Y89A 1RSCA 2CHOA 3WDRA 4Z2HA 1O5RA 1F73A 3IJ7A 2OX1A 2HS6A 3ID7A 1OSEA 3NQ8A 4C6BA 1QJWA 4ZEPA 5JBFA 1K8ZA 2XGBA 1TELA 3GH5A 4PA8A 5E5CA 3AI0A 4G1KA 1BQCA 3BGGA 1LRTA 1CBGA 3E74A 1S39A 4JQAA 1VFMA 4D6FA 3CTTA 5H2ZA 3GXPA 2AL2B 2Y63A 1OFRA 5DCDA 4H9VA 3FSTA 1ME7A 4W85A 1GWJA 3UXIA 3LENA 2GVEA 4LPCA 1T5AA 4M51A 1OX4A 2HPIA 4Q4PA 4N4PA 2XM2A 1GK8A 4NJIA 1KKOA 2DZAA 4JDBA 4ASTA 1FUYA 4KCVA 2YFOA 3G3MA 3GR4A 2OG9A 5C8BB 4Z1BA 1VGAA 1KFKA 3OBAA 4ZQMA 4CNSA 5IXEA 5I0DA 1FDJA 1FQ0A 4F3HA 4M80A 1B3VA 3MMTA 5D9PA 5J5RA 1XH2A 2FZBA 4MWAE 2E1DA 1XLLA 7TIMA 3BWWA 2O9TA 2E3ZA 3VTRA 3CL7A 1H7WA 3GG1A 3VKKA 4Q8TA 3BAIA 1EYWA 2Q3RA 1KQYA 1N8WA 4R88A 1UQYA 1GJPA 3UWZA 3RXZA 3G0UA 1JXKA 1I2OA 4J1OA 3B8WA 2FTPA 8RUCA 4UR7A 4S1FA 3CHFA 1OIMA 3P84A 3GYCA 3L4XA 2PTZA 4AF0A 3ARSA 3LPPA 3IGUA 1G69A 2NV9A 4RDYA 2X2YA 3OA5A 1H51A 3CUZA 2D3NA 1P48A 4U3AA 2QDHA 4KERA 4HMDA 5G2WA 4UOQA 1VFHA 4AEFA 4WF7A 4IJBA 4NY2A 4QM1A 3W84A 3F5KA 2MNRA 2PTDA 3MT1A 2WLYA 1D7KA 4OJYA 2QJJA 3OVRA 2DIKA 1V08A 1X8FA 2PLMA 5FJJA 3LGGA 1A5UA 4PUKA 4EPDC 5E9XA 4TTGA 1O68A 1WDDA 5PTDA 3XINA 4JYFA 3SFKA 1N82A 4Y6GA 1H41A 2WBKA 2WV8A 4CCCA 4IIDA 4D72A 5CEWA 1QU4A 4RV8A 4GJIA 3U7VA 2VELA 1RQHA 3E2QA 5EKYA 1VFFA 1VJZA 2CZEA 4PTVA 3NYZA 5L9FA 1BSLA 1E4LA 4D71A 1E1FA 4A8RA 4PB5A 3TYDA 1KTNA 4DYEA 4MNMA 2OWCA 3CWHA 4BKNA 4WOQA 2ZZ2A 2OLAA 1R38A 3RLGA 3LB0A 3BH4A 1NSJA 1ZY9A 1O6IA 1RQEA 1AD1A 3GNOA 4CQDA 4YTTA 2QF7A 2GSJA 4I5XA 1MZRA 3NZPA 4GIYA 3N2TA 3BSGA 3UXDA 3N2BA 3A4JA 3GU2A 5DRIA 5EMMA 3W02A 3WBEA 3DYPA 4L4PA 1ALDA 1JUBA 5HMDA 4IMFA 2XSAA 3W7MA 4AWSA 3KWXA 2PUZA 4DQWA 2QT3A 3KX6A 1P7TA 2EEXA 2GSHA 4U5KA 3WF0A 4Z42C 4R9OA 5LA2A 5AHIA 4DY1A 3THAA 1TWIA 1FWHC 1DQWA 2BNJA 2RGMA 3NL6A 1K9TA 4JHZA 1CXLA 1WXZA 3QM3A 4LVFA 2Z0IA 1SFJA 2TODA 3VNDA 3MMUA 3AUOA 3VDGA 3PAJA 3C2EA 2QGYA 4JTAA 4V1XA 5A6KA 3MHUA 1TUXA 1ZL1A 1KV5A 4RXGA 1O1HA 4IZGA 1E9LA 1XUUA 1S2VA 3FV9A 1ICQA 4L1GA 2OO0A 1TRDA 3WD1A 2BXVA 4NHVA 2PLKA 4O12A 1VRXA 3EDJA 4YXGA 1LBLA 1HXJA 1WKEA 2WQPA 3OHIA 4AU0A 5CAKA 4LV4A 1EF3A 1PZ1A 3C2VA 4NZ3A 1KRMA 2VFGA 3VAVA 2Y88A 3S1GA 1SJCA 1MI3A 2OR2A 3ZT7A 4UTTC 4IMAA 1P0NA 2D23A 4AB4A 3CYJA 3WJSA 2GQ3A 4GY7A 3BTNA 4MB1A 4LUTB 3SAZA 2V8ZA 4GO9A 2XSBA 2V68A 4Z1AA 1GKQA 5AZ1A 1OFQA 3VOGA 4XQ6A 3EOSA 1SSDA 1XYCA 4NUWA 3AISA 3THQA 5CGTA 1NARA 4LEFA 3ARWA 3M5VA 5EBUA 4ZL1A 5C55A 3HPSA 4PCSA 3U57A 1NU5A 3B9AA 1W5QA 3W0KA 1GCYA 5LKYA 1AL7A 4RW5A 1PYFA 3QY8A 3UG5A 2YDSA 4C5YA 3WLHA 2P5NA 2NQHA 5BU9A 1XYBA 5C54A 3ZT6A 1JGMA 3TTYA 1M7JA 2WCAA 4AZBA 1FOBA 1J10A 4JCMA 3R58A 2YXXA 1H7OA 1PL9A 3QTGA 1K9EA 5HR6A 3R79A 3CC1A 2ZXAA 1A5MC 2XVGA 3AXMA 3WLMA 3VIHA 4U31A 3B0XA 4NJGA 3MDUA 4ML4A 2Y24A 3ITXA 3VU2A 4E8GA 2F9RA 1JCTA 4W93A 4LNCA 1BGGA 4KESA 4HCLA 3LA4A 3PZOA 4M24A 3U8GA 3RM4A 3OHMB 4F48A 3CTLA 4L4OA 3LBMA 3WN6A 4H1ZA 5BWFA 2VZOA 1ZALA 2DU2A 3N34A 1HW6A 1WXYA 5CJMA 1WDWA 3TW6A 2PODA 1JVNA 4ROQA 2VCBA 3JVAA 1VS1A 2ON3A 4ZSUA 3VD5A 4XZLX 3W1AA 2INEA 2IUZA 3PP7A 5A8MA 4H9YA 1AQHA 1XL9A 2XFWA 3WF1A 1ZU8A 2VEPA 4JL2A 1O4UA 1ISXA 1GZJA 1EQPA 4P61A 4B5TA 2ZA1A 2B7QA 3SCVA 4XIMA 3MWAA 3M0LA 2HNHA 1Q13A 3WUBA 7REQA 5KETA 1QRQA 3B8DA 3UZZA 3FGCB 3V36A 1PEZA 1VBGA 4MIMA 3NFUA 3KTXA 4J27A 1NOWA 4HQVA 5GNZA 3CB8A 3H4WA 5AC7A 1OJXA 1S2UA 3E1F1 1ZENA 1XISA 4A05A 3GR8A 5HBFA 4K7YA 1OFOA 1UZ1A 3MUXA 3NVDA 2VGIA 5D30A 3QV7A 3BOXA 2C3ZA 1OG6A 3LD5A 3JUGA 3M6YA 4J7RA 3G6LA 1OABA 4Z2IA 3FA4A 1WCGA 4NG3A 1OQFA 3N13A 1MVYA 3QXBA 3SCNA 5DMLA 2V63A 1XBVA 1Z89A 5BCAA 1MW1A 4QG8A 1RP9A 3S8HA 1HO1A 4DAFA 1A53A 4GUHA 2Y7GA 2OPJA 1OGSA 2GSEA 1J93A 2AAAA 3EX3A 4IFRA 3A4AA 2VVNA 1Q6LA 2X41A 1HJUA 1Z48A 3IVUA 3SIMA 4UTFA 3CV2A 2NUYA 1M65A 2ALDA 4M6PA 2IKHA 1PIFA 3REQB 4BF9A 3L2LA 2GJPA 4JIPA 4B4HA 1J9YA 4PRTA 3ZWTA 2YZ5A 5FEXA 4DJFA 2WMHA 2JF6A 3S9ZA 2E6FA 3A4XA 2WJZA 4ICMA 1TE6A 2PF8A 2B31A 1TMHA 5TQLA 3TC3A 4CCEA 3PBVA 5CZJA 3SGUA 2NW0A 3TYEA 1C90A 3DFOA 4NYYA 3WD0A 4I5RA 3V7PA 4ECLA 1MXGA 2QHAA 3I4KA 4NP7A 2ACUA 2I5IA 2BHZA 2VL4A 2EPLX 3M0XA 3TN4A 1MQRA 3ZZ1A 3VUSA 3W1TA 3TK7A 3HJZA 3UR8A 2GQ9A 3V0SA 4O19A 5FJIA 2FB3A 5HMEA 2ZUWA 4IGSA 4NX0A 3H6OA 4XWUA 4DWSB 3THUA 4GQGA 1TPFA 4EPKA 3H55A 3ABSA 3P2VA 3MJYA 2I9UA 1XBYA 1T8QA 1LLWA 1CLXA 2NQJA 3KOZA 1IZCA 4JQ1A 3WNPA 4L1XA 2HXUA 1NWRA 1AVAA 2XTKA 4C6OA 4Q22A 2OWWA 3QOMA 3UYCA 1W9PA 3AZSA 3GVVA 4D8AA 3GHRA 4GYJA 3VO0A 4FP1A 3K5XA 3U4AA 4FK9A 1UMLA 3BLIA 1GT8A 3WMSA 3G3DA 3N6HA 2TRSA 3FAXA 2NSOA 1F4HA 3SRFA 4O8AA 1JYVA 2NT1A 3DCPA 3IJ9A 1XLJA 4G1NA 2VDHA 3ANVA 2C18A 3MTWA 1PCKA 2JEQA 3NQ6A 1JZ8A 3VGFA 1M6JA 1V3KA 4N2YA 3DFPA 2VEGA 4FMVA 5EPDA 2HE8A 1SSGA 4QJ3B 4LCQA 1I1XA 3EB2A 3ARUA 3OG3A 1UWQA 3CASA 3GNNA 3CQHA 3TP4A 2CIPA 1I2PA 1KFWA 2AKMA 3OLIA 1E15A 3RJXA 6TIMA 2OB3A 1UBPC 3SN0A 2RDWA 2H8XA 4M1RA 3P7YA 2FIQA 4G5DA 3QJAA 1QWGA 3S1XA 3TDFA 3N2XA 3WH5A 5FI8A 3W2KA 1M03A 1XJBA 3HQPA 3B40A 1Q6GA 4JTLA 1E55A 5I00A 1CI1A 1DWIM 1LOLA 4DYKA 4JYDA 3G1SA 3T42A 1KFCA 4TX9A 3CHCA 2Z2UA 4M19A 2QCMA 4IFKA 4B5VA 2CLOA 1E6SM 5A1AA 3VIOA 2GDVA 4CN1A 1X1ZA 5HQEA 3PUGA 3H53A 2VRKA 3II1A 1VBRA 4JTDA 3CL6A 4IPNB 4OECA 4P7QA 5SWUA 1YPIA 3O6AA 2OSYA 4S3KA 2ZA2A 2BOEX 2V6AA 3O2LA 5GNYA 2OEKA 1QI0A 3W1UA 1MQPA 3S4TA 1MUCA 1XHGA 1NP0A 2D0FA 3AHZA 4OIFA 4KCUA 1LWHA 2WC7A 2XVPA 4MNLA 2ASHA 4BI5A 3ENLA 4YHEA 5HANA 3UP8A 4LEQA 3B8UA 3CPRA 1B3WA 5A6MA 2OOGA 4W5UA 2A3BA 2R1LA 3UESA 1CX9A 4B9YA 1XIFA 4D8LA 2ABAA 2VYOA 2X2GA 4X9SA 5BOFA 2YX0A 1W6TA 4WXYA 1EJWC 4C6LA 2CNCA 2X05A 3POCA 6CGTA 2QCGA 5CKSA 3RCMA 4S3JA 4EAYA 3GVRA 5H8MA 4P8XA 2PAJA 3VC5A 3VKJA 3WK2A 4JTKA 4DNMA 3GXDA 4UQ9A 3QC0A 4F8XA 3UFYA 2PDNA 3WQ8A 3BZJA 4YIWA 2DORA 3RF9A 1XFCA 1VB9A 3EWYA 2ZX5A 4X2RA 7XIMA 3O0KA 3M0ZA 3LNPA 1WDPA 4QAIA 4DJDA 2EQDA 1C29A 3N6QA 5I09A 1NJJA 2VWSA 3EX6A 1E9ZB 4JICA 4A6GA 3WBWA 1J11A 4JFWA 1QI2A 5AHMA 4HNLA 5K9XA 4IF2A 3L23A 3ARVA 3OQEA 2UY4A 4BF5A 2YJQA 2EJ1A 1G9HA 1Q3NA 4MKSA 3UD6A 4YJ5A 4DRSA 3MP3A 2P8CA 3U2EA 4C7FA 1JFHA 2HISA 2X0SA 4OWGA 3RCNA 1EH9A 1UR3M 2ZXDA 3CU2A 4BHYA 1W9XA 1NDVA 1UC4A 3KOWA 2HEJA 4Q8WA 4UTTA 2G5WA 2VGFA 2CKSA 2WVUA 4DUXA 4D6EA 3LCWA 1FFQA 3W6LA 1S1PA 1F6KA 1VP5A 3OLEA 4XAPA 1CCWB 4GI4A 2MUCA 4XKYB 4ORIA 3BPWA 1EA9C 4CQAA 2PWUA 3UZWA 2R1NA 4ZQOA 3ARRA 3IARA 1HO4A 1HX0A 3TQKA 2IPFA 3HMJG 1SQ7A 5EMUA 1O95A 3CIWA 4NYUA 3UF9A 3AYVA 2CLKA 2GLKA 3FN9A 4C5ZA 2E4TA 4LS0A 5A2CA 4IJCA 1G67A 3GR7A 4R9XA 1XDJA 1Y8BA 4L1WA 4A22A 3BVJA 1DTNA 2DZBA 3HV8A 3GLCA 4J9JA 3TAKA 1GVRA 1WV2A 3W23A 3NUKA 4QSFA 1W5MA 4W7VA 4S2CA 3EAUA 7A3HA 2GGJA 3VCCA 3WSUA 4S3GA 3DYMA 2VVSA 2PDFA 2VC9A 3FIGA 3O0FA 3PZQA 4DZ5A 3R94A 4GOAA 4FX7A 3S5ZA 5CH9A 1QOPA 4PMXA 4OT7A 4HHMA 4F2BA 1Q2RA 4DWSC 1ONEA 4AEEA 1R30A 2FPYA 3WDIA 3PJUA 1UOKA 3WO8A 4Q8UA 4W8AA 2YA0A 4O17A 1RLCL 4R7JA 3EDFA 2UBPC 2Z4GA 2FYMA 3USBA 1NOUA 3TTEA 3ABQA 1R3TA 4N9BA 1FY6A 4KIRA 4I9MA 1RA5A 1L6YA 3ZJ8A 3PAOA 1Y5WA 4HKPA 1GW1A 3P8IA 2VOTA 2J74A 2CESA 3M46A 3TSBA 3I65A 4PTWA 3DEQA 1JR1A 2FKPA 3GIQA 4ATWA 5FJRA 1ZFJA 2ZOXA 3TU9A 1H7RA 4WDXA 3S3GA 1JFXA 1TB3A 1F5ZA 3BLLA 5FESA 1VFUA 4EXAA 3CAKA 2YCLB 4HVXA 4PBEA 3GW0A 4TMBA 2JALA 2IW0A 4J40A 2PGRA 4KBXA 4Z2JA 2JF7A 3H2MA 1XQKA 3B4YA 3LHYA 3RPTA 2Z28A 3PZMA 4X2PA 3HJEA 3CQJA 4DF1A 3EOLA 1OCQA 3UG8A 1WYIA 1WUEA 1U22A 2J78A 3HFYA 4H8NA 3ANYA 1OZMA 3WQ4A 1FWAC 5C71A 4GFSA 2OLSA 4KKXA 4PUDA 1OYAA 2A7RA 1N8FA 1CGYA 2JKAA 3RNDA 2HK0A 3UWQA 3V3WA 3QZAA 2E6AA 4O1FA 1EBHA 2WVTA 3AROA 3EB3A 4CUCA 3LX9A 2Y5SA 5LHEA 3N2OA 4IP5A 2A7PA 4O1DA 3AZRA 2DZSA 5CC5A 3TLLA 4O28A 4L4MA 4ROPA 3SZ8A 2PZNA 4DZIA 1YIXA 1IWAA 2XFRA 1XIMA 5DXYA 3ERPA 1H3GA 3KP1A 3UWVA 2E9MA 1Y65A 3G2GA 5J5DA 1DQUA 4A29A 3EWZA 3W86A 2AAMA 1DXEA 2ALRA 1F3EA 2BXZA 2E8ZA 3VGEA 2DJLA 4X3ZA 3F1QA 4V33A 4QAWA 2GOKA 4I90A 4WY0A 3PJXA 3N9RA 3DESA 4YU1A 4TVCA 5XIAA 1BXBA 4IQLA 1JYNA 5D04C 4JTJA 1VZWA 4AZIA 1JYXA 4DJED 3PB2A 1G94A 5A6AA 3LRMA 4UQCA 1KXTA 3PJWA 4H01A 1FWSA 4CNUA 4TX8A 4PMUA 1CGXA 3UJ2A 2BVWA 1E73M 1R7AA 2OMAA 1LORA 4XV0A 2DH2A 4RNIA 2GYIA 3PC0A 4O53A 3SSZA 3HQNA 3TC7A 1UJPA 2RGLA 3DFNA 5MKGB 3CQIA 4PFMA 3TW7A 5AVNA 1BEUA 1ZJHA 4UBPC 4C6PA 1R0MA 4LBUA 2ESCA 4P7NA 3SQLA 3LPGA 1ZGDA 1B1YA 1E56A 1QI5A 4D6IA 2Z00A 3HB9A 8A3HA 3EZ4A 4HU4A 4HOXA 1VBJA 2ACRA 3UWYA 2QDDA 2X1IA 1RZMA 1EFZA 5M03A 4M82A 3D0CA 2EXOA 3QN3A 5LSMA 5BZAA 4B3ZA 1R3WA 1JNDA 1P0DA 3L4TA 3UPBA 3RPDA 3W27A 5GQBA 3EXRA 4M29A 3VM5A 1GYNA 2I9EA 4H04A 1SMAA 1DWGM 4HK6A 1QHZA 4PMZA 1SO4A 5HJYA 2CHRA 2VQUA 1AQ0A 5HUPA 5A69A 5BYWA 4RK8A 2G0WA 2E9LA 4MUPA 4HMCA 1DWFM 1GG1A 3ELFA 1KV8A 3O6DA 3A64A 4MG4A 1V0MA 3L21A 3JZUA 3M0YA 3W7GA 2YB4A 3B8SA 5FAJA 3L4UA 1GQLA 3U48A 3AS2A 3KZSA 4KGJA 5G2HA 1SVDA 5AECA 2VD8A 4DUVA 3OW1A 3FJLA 3D3FA 1IIGA 4O16A 1W5OA 1XYZA 1Z44A 3MC5A 3DFQA 3CV1A 2WBGA 1GEQA 3C0SA 2DVUA 2WHLA 1DORA 3WQPA 1PTDA 2VDGA 4R85A 3U2OA 3FOKA 1TZ9A 4LTSA 3ZSSA 2E5CA 2PC8A 2TPSA 2PMQA 3F5JA 2CBIA 3RM9A 1KQZA 1VQTA 1GOXA 4GYFA 1Q63A 5DQPA 2D20A 1AQFA 3NTYA 1Y5XA 5T91A 3TCSA 1MEHA 3VIJA 2IQTA 3ZYZA 3SUWA 3SO7A 4K37A 3R89A 1GKPA 2ZA3A 4LUYA 2CZDA 4LVAA 4I7UA 1DWHM 1YBQB 2ZBTA 2PEVA 3E2SA 3TXZA 4CD5A 4PB4A 4MZ8A 2ZE0A 2VUNA 1ZZMA 5G1MA 1OFEA 2JK2A 2WB5A 1U1JA 4MJ4A 4IUOA 1E6RA 1V7AA 3FHAA 2F84A 1PIIA 4W86A 5E09A 3W1XA 1KRAC 1LOSA 2A3LA 4XD3A 1JUKA 3D47A 3HBLA 4M6UA 1Q66A 5FJTA 3SR7A 2E09A 5CLWA 4IIEA 3GFXA 3ITYA 1DVJA 3U7BA 1GOOA 1PX3A 4FOUA 4GH3A 3KBWA 3I6TA 1REQA 1XH0A 5BU6A 4Y7EA 3W82A 1ZP3A 2DZUA 1LTDA 3UVIA 2G3NA 3UJRA 4A4AA 3FDGA 2V30A 3SCSA 4ZFCA 4AZCB 3ZQ9A 3UA3A 3F4DA 3DZ1A 4G7FA 2J6XA 4QCFA 3CGTA 1UKPA 5ENLA 3FVMA 3RRXA 3G22A 6TAAA 4JTUA 4GY1A 5D2VA 1KWGA 2FGZA 3ES8A 4KGLA 4GE8A 3IAQA 3KOFA 5DLCA 3CZ8A 4LGXA 4J3SA 4IMEA 1S2TA 2DP3A 1BSIA 3CEUA 4RXFA 1A0DA 1ZPTA 1K1DA 5T9CE 2YGYA 3EA2A 5G1TA 4L4LA 2CYGA 1FFRA 1QNPA 2OGYA 3SCOA 1G7VA 3P5YA 5CSYA 1F2JA 2PDKA 4I7VA 4XD4A 1HP4A 3S6DA 2VURA 4HHHA 3AOFA 4U4MA 3M0HA 2ICSA 1LUCA 4OQVA 4Q4KA 2HTMA 3G1FA 4U5IA 1H50A 3ZR6A 1N55A 4PUJA 3S2LA 1TV3A 2ZRUA 1X96A 3MCOA 5D4YA 2WW5A 4NT0A 1HKIA 1O94A 1W1IE 2QMJA 2Y6ZA 4DB7A 2DJXA 4H6RA 3KAOA 1Q5MA 4FX6M 5E1QA 3AU6A 1V02A 1AMYA 4AG0A 4LAUA 3WNOA 4QJ5B 4G6CA 3GG0A 2CWXA 4E3VA 2J8FA 5CBIA 4J3UA 2OGJA 3WY1A 2VMFA 4U3CA 2XIQA 4FNPA 3G8RA 2IKJA 1A50A 2H9AA 4B3LA 1J96A 2IPJA 3N15A 3LNMA 2QS8A 2BY0A 4IQDA 2P3ZA 3K4AA 4PEEA 1FA2A 4FIRA 3W1LA 4DWSA 3G18A 1QPNA 3JW7A 1AH0A 2PU1A 2Y70A 3N4AA 4KWOA 5H8PA 4UFKA 1YDVA 1HVQA 4BQ2A 4S3CA 3UR7A 1A47A 3MUAA 4DI9A 1M41A 4O14A 3C2RA 5D37A 5JH1A 3TYBA 4PUEA 4A2RA 3VM7A 1TMQA 1GEHA 5GVJA 4D6HA 3GRIA 4DELA 5HPCA 4HOZA 1BF2A 4ZSTA 2EO7A 2FZ9A 2E6DA 4LRSA 2XGIA 5BMWA 1PDZA 3HTWA 1MYRA 3NQGA 3GDTA 3ZWSA 2NX9A 2REQB 3DG6A 4RNHA 4WZHA 2ZYFA 2A3EA 3W01A 1O5KA 2JIEA 4PC8A 3W2NA 1LL6A 3GO2A 1L8PA 3RR1A 4PUMA 1JZ5A 3F4WA 2AGTA 4ZOCA 4ACZB 5D8ZA 1KM0A 4KQNA 1KFLA 4DPPA 3BCJA 3NPVA 5M2FX 1XLDA 1ECEA 1W3TA 4L5ZA 4MAVA 1Z6KA 1X8CA 2DEPA 2E7FA 1S5WA 3CK5A 4UQAA 2Q6ZA 4F66A 3QQ1A 3SGGA 3EXSA 5CG7A 2CITA 3QPZA 1ADDA 3VGDA 3HIJA 3EWDA 2X7WA 4QCEA 2Y7EA 2GGHA 4TX6A 3AFBA 2YBTA 1OF8A 4NAFB 3CHVA 5D2TA 3CH0A 1Z8AA 3AO0A 2C1HA 3O8AA 3B9NA 3B3DA 4IG2B 4RNFA 1M68A 1E70M 4HP5A 1MFUA 3TTSA 1ZAIA 1WBHA 4M0XA 4JPGA 1KM6A 3FA3A 3GC4A 4O0KA 2QJHA 1XIEA 3LHZA 3B06A 3NOYA 1I2RA 1BVWA 1SW0A 4UR9A 3BLDA 4XTIA 4JTCA 2ISDA 1GG0A 3AYSA 4PMQA 2C91A 2Z24A 2W9MA 1WKDA 5C7VA 3GHSA 3V4BA 4W7WA 4RZ6A 4AZGA 4Z0JA 4YN5A 5A2AA 3SCPA 4WX2A 3VNKA 1S5NA 1LBMA 2DUXA 1BTMA 3NQBA 5M17A 2J47A 4EE9A 1A5SA 1CXFA 1PYMA 1JAKA 5E70A 2J7HA 4H2HA 1PV8A 1AW2A 3BLEA 4KEUA 2F2HA 2ODOA 3UGRA 4O0QA 1JD9A 2B7OA 3F7JA 2Z7GA 3TYUA 1L9WA 4YWSA 1UWUA 5LHFA 1EPVA 2WPBA 1HQTA 1R3YA 2Y62A 4AZ7A 4AQLA 1IR1A 2WKJA 3TUUA 1SGJA 4H9ZA 4UQEA 4Z1CA 3CHDA 4X0VA 3M5YA 2W79A 2GJRA 3WJWA 4JTHA 3QR3A 3GDKA 4K6AA 1DP0A 3PSWA 1QFEA 2WM1A 3KP0A 3WF4A 4MDPA 4WY0F 3W72A 4N9EA 3W00A 3OGSA 2WHJA 4R3UA 3A5FA 2R24A 5GPRA 3NSNA 2QCCA 2Y4SA 3UG3A 3SRHA 2HBXA 1TX2A 3SUVA 4NXKA 3C2OA 3JZEA 1E51A 1DJQA 1RR2A 3FLUA 3G1DA 4E8CA 5ABTA 1V8EA 4MYAA 4RKAA 1OX4B 3STFA 4JX6A 1CGTA 3H22A 1OINA 4Y9AA 3G5EA 4XX6A 2PRHA 5C9RA 4P5UA 3HQOA 4C1NB 2FB2A 1TJPA 1UWTA 2WQDA 3B0YA 1QHPA 4CD8A 2Q01A 3KOXA 4LXFA 4BEQA 3UGVA 3TJXA 3TV8A 3RDKA 1EX1A 4ZXLA 3GS6A 4JTGA 2KZHA 1TYGA 5DCBA 4QBXA 1IEWA 3KVLA 2ISWA 3INPA 3HQ1A 4ZOBA 5AFDA 3C61A 2A3AA 1PAMA 3PTMA 1AJZA 1EDGA 4IMCA 2PWDA 3IWPA 1S2CA 1TVNA 3TLQA 1W3KA 2P3EA 3BAWA 2DUZA 4IWWA 1FWGC 3EPMA 1EYEA 3BW3A 1JNEA 1MRQA 3CUHA 4UOZA 1VR6A 3QH2A 1HKKA 5EMJA 5C6MA 1EF2A 5F1UA 1P1MA 3NCOA 5DBUA 1IWPA 1Z42A 4D9PA 3I68A 3DH7A 3CUGA 4WVXA 3AS1A 1C7SA 2E67A 1GVOA 1H7NA 2XH0A 4MHBA 5IM51 2EPKX 4H9UA 2G4JA 1I60A 3U5UA 4BK9A 1H1YA 3FJ4A 4Q4RA 1SR9A 2PDJA 3TQVA 1JDEA 1XDLA 4FOKA 4GRSA 4IT1A 1S2WA 1J5TA 3P67A 2UY2A 1VFOA 4IXXA 2QMKA 4RDWA 1ONXA 3C0JA 1U1HA 1HJQA 4NXSA 2QIIA 3TN5A 1PE1A 4H41A 2C1GA 4BF7A 1B31A 3IEBA 2A0NA 2ACQA 4HT3A 4D1JA 1LCOA 3LMYA 2PDIA 5HMSA 1AH4A 1XXXA 2ZUVA 4AY7A 3W74A 1CT5A 2R1MA 1FHVA 3KL0A 1XLHA 3I6RA 2C19A 4GQQA 3GZAA 1A4LA 4ZTYA 3COTA 4H7CA 4GY0A 4AISA 4HSOA 2Z7KA 5D38A 1SPQA 1L0PA 1WX0A 2H90A 2J4GA 2X30A 4US6A 3BQ5A 3A6OA 2EF9A 5A8GA 1XGZA 1TPDA 3URBA 1A5OC 3P93A 4PCFA 2YYTA 4YL2A 2VFEA 5BMXA 3S2CA 1T96A 4AMAA 1VJIA 1GOMA 3V0TA 3OJGA 4JDYA 3O15A 3LI1A 2G8ZA 3UJFA 1QXLA 3NO5A 1BYAA 5G5IA 5DEZA 3KDOA 4REQB 1EP2A 3P0XA 1ZJIA 2YCLA 2J24A 4MWAA 1KO0A 1JIBA 3TWAA 2ZX6A 9XIMA 4PBFA 1RUSA 2XH7A 2BGQA 1OFAA 3OVPA 3G24A 5HOSA 5HMFA 4JZ5A 1XS2A 2AKZA 4ZO8A 3XIMA 3NXLA 2PDWA 3CUXA 1IGWA 3QV9A 2E77A 1EWEA 1P7TB 5LNUA 4ZQCA 1OY0A 1VEPA 4XZWA 2GUYA 1K9DA 2V3FA 1UPPA 1KR0A 4M6VA 4GQRA 2Q8XA 4KWWA 1UIPA 2R14A 3TW9A 4H8UA 1ZB5A 3GNPA 1R47A 3UR5A 3Q67A 1H49A 4L6DA 4X63A 4CEUC 1JD7A 3KM8A 3SCTA 5AC4A 3BW2A 4IMGA 4TR9A 3RR4A 5K9DA 2ISFA 5CPSA 3CZJA 4AW7A 3LXAA 2RAGA 3QF0A 5HAOA 4WRHA 4I7WA 1I0BA 3N2CA 1AD4A 1JUEA 3DBNA 3E96A 4ZO6A 5EFFA 3WQOA 5HPOA 3DU0A 5A8NA 3N17A 4DO7A 2Q71A 4TTUA 4US5A 4J3WA 3YPIA 2GVJA 3T2PA 4Q8VA 1IZKA 1WE5A 3CT2A 5CJNA 1OYBA 2VX5A 4R53A 5I5RA 1XIBA 4FO4A 2VDIA 1TZ7A 2IKIA 2VNCA 4FLSA 3W76A 5HWJA 4IX0A 2Z1SA 4GUFA 4CQBA 4HPGA 1PKNA 1W0MA 5M1TA 2HJPA 2RDTA 1K7XA 3PPGA 2C6QA 3VFCA 4AD5A 1BFNA 3LQGA 3WCZA 3WNLA 2X7VA 1NEYA 2YXGA 4DHGA 4ZENA 5U4NA 1EC7A 3TNBA 1W1ZA 1UUMA 4JTIA 1I45A 3C56A 1HKVA 4TIMA 3PTKA 4FXJA 1MNSA 3FNDA 5MKGA 4QG9A 3DHDA 1V3IA 3T09A 1Q2SA 4JX5A 4IMDA 1GGOA 4QNEA 3RLUA 4CD4A 4GACA 1TV2A 5BXSA 4NZFA 3VNIA 3WD3A 4FXRA 3ZLGA 1Y0EA 4LB4A 4XBSA 4HJWA 3NQ7A 3UZ5A 1BLIA 2AQWA 1QCWA 5CZTA 3ARPA 1XR2A 4UC5A 2NXIA 1Q6EA 2D3LA 3F4CA 1JDFA 2PDQA 1J0HA 2AL1A 3BMXA 2POTA 2YYUA 2DPEA 1KB3A 1BG9A 2QCFA 3L5MA 4QLKA 3HG2A 1EZWA 3GG7A 1G4EA 4QROA 3W7IA 2BMBA 5FL1A 1Z3NA 4KH2A 2V69A 3SIZA 1EWDA 3SJNA 3U4FA 1ONWA 3ARXA 1XW8A 3LLFA 4LH8A 4NJJA 4ACYA 2CLIA 2I7GA 1E4IA 4QSHA 3WJXA 3KLLA 4H9XA 3V18A 5BXPA 2ATSA 2O4QA 3K4WA 1XLCA 4OOZA 2J8TA 3WF2A 1VAHA 1HJSA 3E2VA 3L2IA 2PP3A 4W4QA 4DEFA 1H2JA 3FW6A 1XRFA 2TMDA 3KRZA 4GHRA 3E0WA 1R2TA 5I77A 3WQEA 1TTPA 2ZRWA 4NASA 1IT8A 2J9YA 5FA5A 1H62A 2FZNA 3Q58A 1W1A1 1H0GA 1A5CA 3VZZA 3QKEA 3PWAA 3CO8A 2XIJA 3DFTA 3KS5A 3GD6A 1Q4NX 1PPIA 1NQKA 5E0KA 1TREA 3I3EA 3D6NA 4JQ3A 4ZMGA 3NL3A 5HNUA 4B5WA 3I7SA 3R10A 3W7EA 3A3WA 3EOOA 3KBMA 4PSRA 1D9EA 3ES7A 3WK1A 2EHHA 1CZ1A 3BJSA 1BKSA 5DY2A 1DE6A 1QPOA 2HQAA 3DG3A 4GCAA 1TR9A 4PMJA 3DG7A 4HNVA 2HVNA 4YVVA 1OIFA 1GQIA 4AC1X 1XLGA 3IK4A 3AU2A 2VEKA 5KZMA 3T08A 3AJXA 1DJHA 2QCDA 3L5LA 3DERA 4WXZA 3VMNA 4LVDA 5REQA 1XFBA 2OSXA 1FWIC 4DZHA 2FGBA 3ZOAA 2RJGA 2IPGA 4AVFA 3MU7A 1EGMA 1DJYA 1KRBC 4O4WA 1EGZA 4NZCA 1PWLA 4MYXA 4GQBA 1JPHA 2QV4A 1ZJAA 3UPWA 4R33A 5A6BD 1GQJA 1P5BA 2HV5A 3ABZA 4UTLA 1IEXA 1UP2A 4LUSA 2WC3A 4JXCA 4GJJA 1LP6A 4H00A 3QC3A 2CZVA 4MJZA 1FH8A 1X1NA 3LN3A 4F0HA 1EP3A 1EZ2A 3NQAA 2WXDM 3QSTA 3RMEA 3BAYA 3LQLA 1WDSA 1YTEA 1QMLA 3LCHA 4FR6A 4OKDA 3S2MA 3WX7A 2BX7A 3QMRA 3PR2A 3WFLA 5C70A 4MADA 4GVFA 4GVIA 1E0VA 4UIOA 4Q7BA 1MDRA 3WLIA 1OC6A 1J79A 1AUSL 5HNTA 4HYWA 3QFWA 5HULA 2FGLA 4HA1A 5CZKA 2NV1A 5KINA 1UHVA 3IANA 3QKZA 2DY3A 1K4GA 2ISSA 2Z27A 2ZUUA 3OU8A 4YTRA 4Y8EA 2FH6A 4RJEA 3VMOA 4NI8A 2O55A 2O7SA 4MKNA 2INZA 3IIPA 1GPWA 5C9WA 1E6PA 1UR9A 3UETA 3ALFA 1CEOA 1GVSA 3DBPA 2WZIA 1SZGA 4W8BA 1DEDA 1OD8A 3TTQA 3VOIA 3TR2A 1KXHA 2Y85A 4KEZA 4ZQPA 4F0RA 4AHPA 3RJYA 2A6NA 5IDIA 3NA8A 2Y7FA 1TFVA 3Q37A 1BG4A 1V4YA 1OCNA 4K8EA 2WK2A 3WFZA 3PVFA 4L61A 5K4ZA 1XH1A 5IOBA 3S0CA 3ABRA 3TJ4A 1CDGA 1LL4A 3RITA 4B5UA 2ZZ7A 4Y8FA 1F07A 3VE9A 4LNYA 3C3UA 4AUBA 3TKFA 5DRCA 1D3GA 2ZUTA 5C9UA 3O1NA 2ACSA 5E6ZA 3ATZA 1IT0A 1ZBCA 3VDAA 1WKFA 1GHSA 1CXKA 1Z9AA 4V1YA 3H26A 4TV5A 3I7RA 4N42A 1OYCA 2JKEA 1EOMA 3OLDA 3AICA 4S3AA 4CKQA 1UW9A 5IRPA 4S38A 2GWGA 4IFKB 3A9IA 4LCRA 3MJMA 3KRUA 2EKCA 3CHEA 3DHUA 4WGXA 4MPQA 2Z6IA 4X22A 5EU9A 1OF6A 1CENA 5AOUA 1WO2A 3LLDA 3MKKA 5TAOA 1VLWA 4M1BA 2PTXA 3VYLA 3GDMA 3W7RA 1KM5A 2YCJA 1UR1A 2G97A 4N02A 1XIHA 2V38A 1EX5A 3E5PA 3SN1A 4FF5A 3URNA 2BDQA 5G4EA 4WKAA 4GZ7A 1TPWA 3P61A 3K13A 3SM0A 2PDGA 9CGTA 1V77A 1KA9F 2DZPA 5CSRA 4AMCA 3TYAA 1X97A 5AHLA 5C2XA 4EF9A 4WHBA 8CGTA 1K8XA 1QBBA 3NPXA 2Q3OA 1LDCA 3R0DA 2VUYA 1CB2A 3NVTA 4B16A 3W73A 4IJRA 3UVAA 4O13A 1EHAA 1WNOA 1ZRQA 3T0AA 4MJ2A 2GZXA 3FX4A 1R3QA 2X40A 3DIPA 4HTYA 1M7PA 1OHLA 2A79A 1H63A 1E1EA 3C4UA 4NJKA 3LM3A 2V3GA 3BCDA 2EG6A 1DIKA 1HL8A