4PMUA

Crystal structure of a novel reducing-end xylose-releasing exo-oligoxylanase (xyna) belonging to gh10 family (space group p1211)
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
355
structure length
355
Chain Sequence
b'TSLKQAYAQGFLLGTAVNADIVSGKDAASAALVACHFNAVTAENVMKAEVVAPRRGVQDFSAADAFVAYAQRDRQFVVGHTLVWHNQTPEWFFTTADGRPNTPAQQLERMRAHIAAVAGRYTGKVQAWDVVNEIIDEDGSYRSTNWVQRVGDGDTVVRNAFAFAQRYAPDAQLYYNDFNAWRPAKREGIVRMVKMLQQAGVRIDGVGMQGHWGLNYPSLRDIEDAIDAYAALGVKVMITELDIDVLPLTKEGQIIGTGMAHKQFQLPEFKRFLDPYRDGLPADVQAQLRDRYAELFALFWRKRDKIARVSVWGVSDDMSWKNDYPVPGRTNYPLLFDRNHQPKPALDAVVAVPSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endo-1,4-beta-xylanase A
publication title Molecular mechanisms associated with xylan degradation by xanthomonas plant pathogens.
pubmed doi rcsb
source organism Xanthomonas axonopodis pv. citri
molecule tags Hydrolase
total genus 133
structure length 355
sequence length 355
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pmuA00
1JZ8A 5D4YA 2WVUA 3CGTA 3VD9A 1UD6A 2WZEA 3WEOA 2EO7A 3WKZA 3MUAA 2BY0A 2XVNA 1UD4A 3QHNA 4PYSA 3UR7A 3ALFA 1XSJA 3NDYA 4U2ZA 5JBFA 1E0VA 4AD3A 5CJ5A 5D9MA 4GO8A 3RCNA 1E5JA 4CN1A 1UWQA 5FD0A 2WMIA 4GZEA 2W67A 4QCFA 3ARYA 3THDA 1V6YA 4PUEA 2F61A 5BWFA 3WNNA 4QLKA 3CMJA 1E40A 5JUVA 1VIWA 1ZS2A 4CKQA 2XWDA 2AMGA 1G9HA 2W62A 7CGTA 3GZAA 1DWAM 2FGZA 1QI3A 5ECUA 2BV9A 1TR1A 2XFRA 4U2YA 4TTUA 4DUXA 3T0DA 1SFSA 2X1IA 4AD2A 2ZE0A 1CDGA 3AMDA 3APGA 3JUGA 1HN1A 3ZMRA 2VTFA 2QV4A 3T2PA 4AD0A 3K4AA 4D6DA 1H3GA 2PWGA 1QOXA 3L4YA 3TONA 1X6LA 5EMYA 2XM2A 5EBAA 1PPIA 1U30A 2FH8A 1JL8A 3A4AA 1B0IA 3VX0A 4UFMA 3WN6A 1NWUA 2XIBA 4UNIA 3CUHA 3WD0A 5D9NA 3OGRA 3WEMA 3L2LA 4TTGA 1VFFA 2BXYA 3CUJA 1JFHA 1JDCA 4LYQA 1V3HA 4UQAA 3VIKA 5A6JA 2G41A 1E1EA 1UR4A 1UQYA 1EDQA 2GK1B 4OOUA 3UCQA 1UH3A 2VZUA 2RGMA 4YHGA 3WDJA 4CCCA 1E55A 1UG6A 2PBGA 1E6XM 2WKLA 4HPHA 3WNOA 1ECEA 2YLLA 3WQ5A 1KR1A 2GJRA 1YQ2A 1E6NA 2V3FA 1DWHM 4PMXA 4B3KA 3VINA 1K9TA 4JFUA 2F8QA 1ITXA 1US2A 2JIWA 1C8XA 4JCLA 4AEEA 1HVXA 1HJXA 4PTWA 5I24A 1HJSA 3VIFA 5M3WA 2ZUMA 4KWUA 4JZ5A 2O9RA 2OSXA 1W2PA 4HZ6A 1CGUA 4WKFA 2CETA 1KXTA 3VM7A 1W1YA 1ISWA 5CLWA 1JZ7A 1ZBKA 4DWSD 4X9YA 3W4RA 1EO7A 1A47A 1PBGA 4UFHA 1VENA 3D5HA 1C8QA 2WYSA 3AZTA 1KGXA 2DSUA 3DYOA 3GH7A 1W3HA 1OCQA 1B3ZA 1TA3A 1MWOA 3CTTA 1BYBA 1XCWA 1H11A 1EDGA 3I3DA 1RPKA 3WNPA 5FL0A 4BQ3A 5C70A 1XH0A 1P6WA 3SCTA 3CHCA 1OD8A 1JZ6A 4L4PA 1VBUA 4AMCA 3RM4A 3I3BA 1UKSA 1UH4A 4S3KA 3QGVA 5D8WA 1CGXA 4D6HA 1F4HA 3J7HA 3AIEA 1LF1A 3KL5A 2XVLA 2J4GA 3GTNA 1H5VA 5D8ZA 2A3EA 3PZQA 3F4VA 4ZFMA 1JDAA 3ZO9A 4LXFA 1B3YA 3CLWA 4F79A 3AROA 3SUTA 4V27A 2VO5A 1KGWA 1LWJA 4H41A 4H8VA 2WXDM 3SCUA 1U2YA 4M81A 3CIVA 3PHAA 4MNJA 2VJXA 2JEPA 5A8QA 4ZXLA 1IV8A 2Q8XA 2ZX9A 4M24A 2D24A 3PZOA 2GFTA 1HKIA 4E4PA 3GDBA 3IJ9A 4PRWA 2J47A 1MFUA 4W8AA 3T09A 1W9DM 4ZENA 3POHA 4MNKA 5A1AA 4MADA 4DM1A 4R5EA 5M5DA 3RPMA 5A6AA 1CLXA 2QMJA 2E9LA 4JFSA 1CXFA 4Z2IA 1G01A 1GOKA 2BNJA 5AYBA 5A2CA 4P7LA 1PZ3A 2JF6A 1R87A 1B30A 1NP2A 1VB9A 3N15A 3VNZA 1XCXA 1W1TA 4CD8A 4PMVA 2VZOA 3AHVA 3MKKA 4MAVA 4XX6A 5F7UA 1B9ZA 2W92A 2Y2WA 1MQQA 4W5ZA 1GUVA 2D1ZA 2IUZA 4W88A 3N13A 1OB0A 1MQRA 4GQQA 2FHCA 5BXRA 2XSBA 3EMCA 3L2MA 3MO4A 2DT0A 5BXPA 1W3JA 1C93A 2Y5EA 1Y7VA 2VT0A 3WF3A 3UEQA 3PZGA 2Y8KA 4B16A 1FFRA 2CKRA 9CGTA 3MSDA 1E6SM 4XB3A 4J3VA 4V28A 1ZB5A 1CYGA 4U3CA 5DT7A 1K6AA 4AZCA 4AZ5A 1OINA 3AIRA 4ZEPA 4IM4A 1BYCA 1V6XA 4CD7A 4ATLA 2CKSA 2YL9A 2PWFA 3CHFA 2PWHA 3ARSA 5D9PA 4CD5A 3LPPA 2C7FA 1W1VA 3KWXA 1H4PA 2W63A 4DM2A 1JGIA 3BXWA 3IK2A 3GYCA 5BROA 3WBEA 2J7DA 3SCNA 1J9YA 1CZ1A 2W91A 1VAHA 2VRQA 4HOXA 1MFVA 2DIEA 3N1AA 1SR0A 1PZ2A 5CSYA 4B9ZA 4OIFA 4Q22A 2HISA 1J0HA 1WDPA 4HP5A 4UQBA 3TTQA 3L4UA 3VD7A 2EPNA 4AD1A 3AYSA 1HP5A 1AMYA 1ISZA 4M82A 3W29A 4S3JA 4EK7A 4Z2GA 2RGLA 3ARVA 4BS0A 5BYWA 2EPOA 1XH1A 1BF2A 1GQKA 4D6CA 1PJ9A 2O92A 5LA2A 1MW2A 2FHFA 3K4DA 3VTRA 5EFFA 2D0GA 4ZXOA 1XH2A 2B31A 1BG9A 1LJYA 1ODZA 4GI8A 1UD8A 4WLCA 2E9MA 3SCRA 2WZIA 2W5FA 2ZUVA 1Q6FA 1Q6CA 2OYLA 1TUXA 1KQYA 2VRKA 3ZSSA 1DWJM 1WZAA 3W28A 1E4LA 3UR8A 1CGYA 2IXUA 1LG1A 2CESA 1ISVA 4PBGA 1CNVA 1XHGA 1HNYA 4XV0A 4YHEA 1JYXA 4TVUA 4CCEA 4U31A 4JL2A 5A6BD 2VZTA 2WMIB 3VGEA 1DHKA 5A6LA 3AIUA 3FHQA 1V0NA 2OYMA 2VX5A 4AD4A 2BVDA 1WB0A 2OWXA 1CGWA 3FW6A 1Z32X 4DWSA 3ALGA 2E0PA 1UWUA 1DWIM 4OOZA 3CZ8A 2ZWZA 4PSPA 2WVVB 1H1NA 2TAAA 3WL0A 2DH2A 4BQ4A 1V02A 3ARTA 1E3ZA 2DT2A 2WHMA 1SMDA 1PAMA 3PZMA 1QNQA 3CMGA 4PCSA 4UFKA 4FLQA 2QF8A 1UHVA 2IXVA 3QOKA 3AXIA 4MNLA 1UR2A 4P8VA 5ABGA 4C7DA 3ZOAA 4HZ7A 2YL8A 2J7HA 3WH7A 1R7AA 1BYDA 4YPJA 4B15A 1CBGA 4EANA 2YOCA 1NWRA 4M29A 1QNOA 3WMCA 2YA2A 3ZJKA 1KB3A 3DHUA 2D2OA 4HU0A 1TMQA 3O2LA 3OA5A 4W93A 3CO4A 1DP0A 4ML4A 3CHEA 1A3HA 4WSKA 4CD6A 4W5UA 4F9DA 1E43A 3GNOA 5CLTA 1XYFA 1VRXA 4IISA 3VPLA 4Z2LA 2J7CA 2J62A 1I75A 5IXEA 4PTXA 2CITA 3OB8A 1NWTA 1KWGA 3BGAA 3WQ6A 2PI6A 1KFWA 1LLOA 3ZT5A 5A2AA 2WMFA 3OLIA 3AS3A 1TCMA 3KEHA 2CIPA 1JI2A 3TOPA 2CYGA 1GJWA 3AIQA 4AIEA 3WSUA 2ZUNA 2D22A 2DT3A 1LL7A 1KXHA 5CQ1A 4F9JA 1V08A 5JIPA 2EEXA 1TZ7A 4W8LA 4WIWA 1UKOA 3BAYA 3O9NA 3NCOA 1SYTA 4MJ2A 5A6MA 3AIVA 4PMOA 2PB1A 1NOUA 1CTNA 1VJZA 4LPCA 5A3HA 5HDRA 1WP6A 2DPEA 1GQIA 1E4NA 3G6LA 4EAMA 4B3LA 5BXTA 4TVCA 3N12A 2VRJA 2WNWA 3TP4A 1ITCA 1L8NA 5ABFA 1AQ0A 3WQ8A 5DFAA 2BXZA 5FL1A 3FY1A 1OD0A 3WD4A 4CCDA 4LX4A 4PMUA 4P8XA 3HMCA 1MYRA 1QW9A 4D6IA 3MANA 5A6KA 4RL3A 1E4MM 3ZIZA 3SIMA 1J0JA 2PF0A 4P7QA 5E0CA 3PN8A 1WKYA 1OIMA 2J74A 3TTSA 1TA3B 3WF1A 3WUBA 1NWSA 3VOCA 1FP8A 1FP9A 4C7FA 2VUYA 2PWDA 1G1YA 4B9YA 2D3NA 2DH3A 1E15A 1J0ZA 5AY7A 3HN3A 1OGGA 4CU7A 3OGSA 4HPGA 4XZBA 3A6OA 4A3YA 3GBEA 5EFDA 3NJ3A 3IAQA 1IZKA 1LG2A 2NT0A 4BZYA 4MDPA 1CEOA 2YIHA 5BXSA 1JI1A 1HL8A 3WQVA 1UOKA 1C8YA 2YA1A 1BHGA 2VCAA 4NF7A 3ARZA 1X6NA 1QHPA 2VC9A 1I1XA 1GOOA 3AHTA 5M17A 2G4FA 3VMPA 3T2OA 3AS2A 3GH5A 1GZJA 2G3MA 1PX3A 2FH6A 2WM0A 1TG7A 4OBSA 2E4TA 1AQHA 3VGFA 2VZSA 3B9EA 5FKYA 3LMYA 1JZ2A 4BA0A 1G0CA 3U7VA 2XG9A 2WCSA 2UY4A 3AS1A 1E1FA 3CZEA 1ODUA 3ARUA 2DEPA 3VUPA 4AZ7A 4D6EA 2NW0A 1US3A 3ARRA 2YJQA 1GQJA 5CPQA 2MANA 4MB4A 2OSYA 1MVYA 1ZU8A 2J78A 2QPUA 3GM8A 4GKLA 4M1RA 1GNXA 3OBAA 4GQRA 3WFZA 2XPKA 1AQMA 1UR1A 4PTVA 4PMNA 3SEPA 5I2UA 4TX8A 1ZBWA 4E2OA 1HJUA 5AC5A 5EB8A 3E1F1 1E4IA 2ZOXA 2W66A 4CGTA 3VIPA 2Z1KA 3VD3A 4E8CA 1J10A 2D23A 3W38A 3VNYA 3M6DA 5HBFA 1HF6A 2ZX6A 3MMWA 4KRUA 4MTVA 3DECA 5CGMA 2GJXA 4GI9A 2VL4A 1CPUA 2HVMA 3AZRA 5IFTA 2NSXA 1B3XA 1J18A 2ZICA 3BLPX 4NZCA 4HOWA 4XZWA 4HU8A 2VX4A 1BVNP 3UERA 1BG4A 1E70M 4J3TA 5D9OA 2XJ7A 4PN2A 3OLGA 5E70A 4J7RA 2WBKA 3VDCA 1W9PA 1UWRA 3WH9A 3GH4A 4OJYA 4D6JA 5BCAA 4N42A 2BY1A 1E56A 2CPUA 2CBIA 2EPMX 4KRTA 4QLJA 1GOIA 1PX4A 5I6SA 3RM9A 1UD3A 4CVUA 3MV01 3U57A 1CIUA 3VU2A 5M03A 2O9PA 4RE4A 1W2VA 2OLHA 3W53A 5DEZA 2DSKA 4DWSC 4DUWA 1UZ4A 1VJSA 3WD3A 2PC8A 2DDXA 3CPUA 4HMCA 3BMVA 2VQUA 2GJPA 3LPOA 1GORA 4JL1A 4UR9A 3FNDA 3T08A 4QCEA 2E8YA 4UOZA 3WDHA 2WMKA 2EPLX 1R7OA 4UOQA 2X0YA 3MMUA 1V3MA 2GK1A 2JIEA 5DT5A 4A3HA 4UQEA 3NIYA 3RM8A 1TVPA 2CBVA 4MDOA 4PMZA 3KL3A 1CXEA 2BY3A 1FHDA 2GUYA 4UTFA 3VIGA 4E8DA 3UG3A 1BYAA 4GZIA 2O9OA 4UFJA 2J7GA 3MUY1 1BLIA 3OIHA 3VIMA 2V38A 2XVGA 1FH8A 3WELA 2D20A 3SCWA 2ZXQA 4W86A 1J0KA 4H2CA 4MPKA 1WZLA 4JKLA 4UFIA 2E3ZA 4H04A 2FHBA 3HJEA 4A4AA 1HKMA 2DSWA 4D6GA 3OLEA 1BTCA 1EXPA 4AYSA 4JHZA 8A3HA 1UD2A 4QAWA 3WMSA 1ISXA 2A3AA 2X0HA 3VKKA 1BQCA 1XGZA 3F5KA 1K9DA 2XSAA 2G3IA 5ABHA 5HNNA 3UG4A 1UKQA 3GNRA 3BLKA 3N9KA 5BRQA 4AZGA 1QBAA 1LL4A 2WW5A 1LQ0A 3WH6A 4ACZA 1UA3A 3N11A 1JNEA 1GOQA 3VD4A 5A8PA 5DMYA 4QLLA 2G8ZA 3VIIA 3CZGA 3GXFA 3IJ8A 1OSEA 3OLDA 1GW1A 3K1DA 3WUGA 1PIFA 3RJXA 2WAGA 3VILA 2CBJA 1J0IA 1OIFA 1E72M 4PSRA 4AZIA 1XD1A 2WB5A 3QHOA 1CLVA 3VM5A 1W9XA 2Z1SA 3L4TA 3AJ7A 4F8XA 1Q6GA 3VVGA 3NSMA 2YL6A 5CGTA 1M04A 4AZHA 4JFTA 1JD9A 1V6VA 4UZUA 3BAXA 4UCFA 2QHAA 5A8NA 2A3BA 3MV11 4PTMA 4UFLA 5LA0A 2DT1A 2AOSA 3BAIA 3IJ7A 1VEOA 4BQ2A 3K8KA 1UR8A 5IHSA 3WDPP 4QP0A 3SCQA 1GOWA 2VCBA 5DO8A 5IFPA 3RIKA 4TXEA 4D71A 4AY1A 4K68A 3AICA 1OT1A 1LWHA 2CNCA 2PBOA 3M46A 2YL5A 2J8FA 4HZ8A 3W82A 1V3LA 1H0IA 2VVSA 1HJQA 3CHDA 4LGXA 1CGVA 2WZHA 1E0XA 3T2QA 1B2YA 1JZ4A 4AW7A 2EBNA 2OWWA 2X05A 3WQ4A 2VCCA 5CG0A 4Z2HA 2WC7A 2YA0A 4LYPA 4TOQA 1QVBA 5HPOA 1L0PA 3AIBA 2ZUUA 5JBEA 3K8LA 4P8UA 1KXVA 6A3HA 1E9LA 1O6IA 3SUWA 4J27A 4JFWA 3ZJ6A 1EQPA 3EDJA 3G6MA 5FIPA 3KL0A 2DIJA 5DF0A 1JYVA 3DYMA 1WZMA 2YDSA 4Z2JA 4CN6A 4GO9A 1NP0A 3WF0A 5KZ6A 1W1PA 1V6UA 4ACYA 1J0YA 3BSHA 1E71M 1IT0A 5C8BB 2WKGA 1HXJA 2W4XA 4ZE5A 2XM1A 2FGLA 2O9TA 4AIOA 1EHNA 2VR5A 1QBBA 5GNZA 2WK2A 1SMAA 5AC4A 4JFVA 2G3JA 4RE3A 2CEQA 1HKKA 3VMOA 2E40A 4UZSA 4IPLA 3POCA 5IHRA 2V5CA 3ZJ7A 4NSBA 1V3KA 3W25A 1EO5A 5CPSA 2JEQA 4IUGA 4P7RA 2Y8VA 4W7VA 2WC3A 3W0KA 1KXQA 2BHYA 3WF4A 1I1WA 2VR4A 1W9VA 3HU7A 3I3EA 4CD4A 4PMYA 4EE9A 1WDQA 1KCKA 3WFLA 5HOSA 2X09A 2J7FA 1S46A 2Y24A 4D72A 5JBDA 1B31A 4GXPA 4H7VA 4URIA 3ARPA 5GPRA 3TA9A 4QDMA 2YKKA 1NQ6A 2WLYA 4MB5A 1C3FA 4CU8A 4CN4A 3KE0A 2JFEX 1R85A 4LYRA 2BS9A 4UQCA 4AIUA 1QI4A 1ZL1A 4GI6A 4U3AA 2ZX5A 3ZT6A 2UY3A 3DYPA 4W89A 2D3LA 1KBKA 5I77A 2ESCA 2ZIDA 4BF7A 4GINA 3ECQA 1E0WA 4M8UA 5KEZA 1V0LA 1UA7A 1XD0A 2XWEA 2JE8A 4PUDA 1G94A 2A3HA 3OZPA 1UUQA 4RE2A 3ZQ9A 1HJVA 1RP8A 1JD7A 1BVZA 2J79A 1CXHA 2E8ZA 4JAWA 2VQTA 3S6TA 3U5UA 3AYRA 3VGHA 4W85A 2UY2A 2D0HA 1EA9C 1B1YA 4ATWA 1GONA 1XC6A 1F4AA 5FCZA 3NUKA 1VEPA 2XFFA 1WZKA 4AISA 2BVTA 1V3JA 3WEZA 4JCMA 2XTKA 4FLOA 1NARA 2EQDA 1U33A 1H49A 3GXMA 4W7WA 3FHAA 3N18A 1C91A 2WCGA 4MNMA 3MUZ1 3NDZA 1UD5A 4KGJA 1VEMA 2YLAA 2GDVA 2X8RA 3A4XA 3DHPA 3B8SA 2J8GA 2EPKX 3SUVA 2VX7A 1QNPA 1JF6A 2JALA 3ZT7A 2XVPA 4UOJA 2WWDA 2ZXAA 5BRPA 3T0BA 2WVVA 1R8LA 1OT2A 3WUEA 5A8OA 2QPSA 3VIHA 2GJXB 3VGGA 1EDTA 2CHNA 3CZLA 1CGTA 3AISA 2GVYA 5GNXA 7TAAA 3D3AA 3AXHA 1GVIA 2J7BA 5E09A 3SUUA 3F5LA 4X0VA 1QHZA 3W6MA 4CU6A 1QI0A 1AVAA 3N17A 1TE1A 2FDMA 3AMLA 1UWTA 1NOFA 1M7XA 2JF7A 3UG5A 1LL6A 1RD6A 1ZBCA 4HA4A 3CZKA 4JIEA 1V3IA 1EH9A 3AHZA 1ESWA 2AAAA 3BH4A 3SURA 3WF2A 3AXXA 5HPCA 2CBUA 5CXPA 1E5NA 5E0FA 4KMQA 3L4VA 2C8NA 3WNLA 3W26A 1KBBA 1E6ZA 1H2JA 1QW8A 3SCVA 3EDDA 3GNPA 1WDSA 1BGAA 1M03A 2WHLA 4OUEA 2VI0A 3IAPA 4J28A 2F2HA 4MJ4A 1BFNA 1W9BM 2WMHA 3WDIA 2OYKA 1RP9A 3GBDA 3B9AA 4M56A 1MW0A 4Y7EA 1E73M 4J3WA 1E6QM 3LPGA 3ARWA 5E6YA 1UH2A 4P7OA 3A4WA 3AFBA 4AD5A 2J7EA 6TAAA 4HMEA 3VDBA 2J25A 3ZR6A 1E6RA 1B3VA 2WWCA 3RJYA 3BAJA 2CHOA 1GCYA 4PCTA 5I5RA 2C0HA 4L4OA 3EMZA 3CUGA 1PIGA 3AMGA 4AEFA 4LQ1A 2VX6A 3VDHA 1WDRA 4U33A 3F5JA 3WQWA 5C71A 4Q7NA 1J11A 1N82A 4D6FA 1GQLA 3FXYA 1QNSA 4W87A 2D0FA 4BCEA 1Q4NX 1V0MA 4JHOA 1OBAA 1CENA 2GSJA 5A6BA 2NT1A 3WENA 1VFUA 5E6ZA 5GNYA 3FAWA 3NYDA 3DC0A 1QNRA 2UWFA 2WMGA 3AMKA 1VFOA 3NSNA 2VURA 3QHMA 1MQPA 2CERA 4AZCB 4AZ6A 3NSXA 3TTOA 1FHLA 5CPTA 2XGBA 3CH9A 4ACZB 1XYZA 4OKDA 1CECA 5JIWA 1HX0A 1C7SA 1FA2A 3W24A 1BAGA 4U5KA 3SUSA 3WH8A 3RMEA 5I0DA 1UYQA 3RO8A 4PEEA 3W27A 1ZJBA 3L4WA 2PWEA 2WHKA 1DWGM 3MUIA 5I3DA 4NI3A 4FK9A 3T0AA 3VMNA 1MW3A 4W8BA 3WMBA 2WHJA 1CXIA 2G3NA 3ARXA 4HMDA 1GVYA 2WSPA 3II1A 3MSGA 4FLSA 3AIWA 3WH5A 2ZX7A 3AHYA 4MB1A 2J77A 3AQUA 4FF5A 3VGDA 1V0KA 4J3XA 1WCGA 1QHOA 1D7FA 2V3GA 1C92A 4OBRA 1FOBA 2XUCA 6CGTA 4Z2KA 2CXGA 1W9UA 3MU7A 1PX8A 4ZE4A 1FH7A 3WIJA 4HOZA 4GPNA 1VBRA 3UETA 1HIZA 7A3HA 1GOMA 1YHTA 4PMQA 4WKAA 2YBUA 3WD1A 1H09A 3WNMA 1KGUA 3ARQA 4BQ5A 5FOOA 3PZNA 1EGZA 1OWQA 2WMJA 3EDKA 4H8UA 3TTYA 1EIBA 2V3DA 1EOKA 1JZ5A 2WBGA 4CUCA 1JZ3A 1JYNA 5HXMA 8CGTA 3FN9A 1H41A 2X2YA 2ZUWA 1J12A 1DWFM 4TUFA 4D1JA 2UY5A 1NOWA 3CBWA 3RDKA 1KWKA 1JYWA 3OZOA 1GHRA 2VMFA 1XV8A 1W3KA 5TD4A 1JDDA 1OM0A 3AHXA 3AOFA 1B90A 3BAWA 2DGAA 3WNKA 1WNOA 5A8MA 1UWIA 3L4XA 1D2KA 2BHZA 3M7SA 3MS8A 4NRSA 4J3UA 2VZVA 1GPFA 4R27A 5A2BA 4UQDA 1ISYA 1JG9A 3SCOA 1R86A 3VGBA 4JKKA 1V6WA 2XIIA 2CCRA 2WC4A 3ZM8A 2XFYA 3SCSA 3QOMA 4HTYA 2W61A 3BAKA 4M80A 1W32A 2BY2A 4N0RA 3CUFA 4P8WA 4DWSB 3ZJ8A 3VIOA 1K9FA 1UKTA 5CSUA 4ATDA 1E3XA 2V3EA 3AMCA 4X0NA 1JNDA 2YDRA 4W84A 1TFVA 3PZIA 2BFGA 1JFXA 3K46A 4C7GA 1KQZA 1VF8A 3N04A 1WPCA 4HA1A 3U5YA 4WSJA 3W81A 3K8MA 2WANA 1UZ1A 4P7NA 3RILA 1B3WA 5I78A 1HT6A 1EQCA 3BMWA 4AXNA 1W3LA 1K9EA 5A6SA 4PMDA 1MW1A 1JAEA 5CZKA 4QFUA 3M07A 4WKHA 1BPLB 1V02E 3VIJA 3OGVA 4FLRA 3VX1A 4AWEA 1HVQA 3ZR5A 1Q6EA 2VVNA 1BSIA 3AZSA 3FAXA 4TX6A 1PEZA 1G5AA 1WO2A 3PTMA 4HA3A 3CZJA 1QPKA 1DTUA 1JIBA 1HJWA 1M01A 1C90A 4YN5A 3A47A 2XYLA 2ZXDA 3VDAA 1CXKA 3LPFA 2E9BA 1XSIA 1EOMA 1UKPA 1E6PA 1CXLA 1D3CA 3A3HA 3IANA 1JAKA 5E9AA 1GJUA 4U5IA 3AS0A 5AYIA 2A3CA 1IZJA 1VFMA 1CWYA 2ZXBA 4W7UA 3GXDA 5A95A 1V03A 3WY1A 4TVDA 3WD2A 3B9DA 1WAWA 1QI2A 3BCFA 3S2CA 4V2XA 1XRVA 4NRRA 1HKJA 1NM9A 2YBTA 4OZOA 3L4ZA 3EYPA 4AZBA 3PZTA 1BGGA 2GDUA 5I23A 4GZJA 4WF7A 1ZJAA 2ZX8A 3WBAA 1FH9A 3MMDA 3PZ9A 1QI5A 4GIAA 5ABFB 3AI0A 1M53A 1J01A 1MXGA 1UQZA 2ZWYA 3PZVA 4PMRA 5IDIA 3UESA 1O7AA 2VNCA 3THCA 2WCAA 1RH9A 3EDFA 4MAZA 2WSKA 2J75A 2WVSA 2EXOA 2QLYA 2WVTA 2XVKA 2ZUTA 4JKMA 3EMQA 3U7BA 2XHYA 3PTQA 3CUIA 3GXIA 1UWSA 2OSWA 1OGSA 3OG2A 1HL9A 3WL1A 4EKJA 2WPGA 2WLZA 2EJ1A 1ZBVA 5GQBA 2YDQA 1FFQA 4DUVA 4KGLA 3ZSTA 4FMVA 3PZUA 1W91A 3WDRA 1UR0A 1KR0A 5LA1A 3O6AA 3VD5A 3EDEA 3WDQA 5A69A 4D1IA 1H0GA 1GHSA 5LYRA 4XUYA 2QMKA 3PBGA 5I79A 1EHAA 4IPNB 5ABEA 3SCPA 4WJXA 2VOTA 4MB3A 2ZUSA 2V5DA 1JXKA 1JF5A 3VO0A 3PTKA 4WK9A 4H8HA 1XSKA 1Q6DA 2XGIA 3W6LA 1X1NA 1NH6A 1MXDA 2BVYA 1TVNA 2OWCA 3WUFA 1OGBA 3BSGA 4UQ9A 1UR9A 2DQXA 3BC9A 1KCLA 1WE5A 3BCDA 1DEDA 2BHUA 2DSVA 1JXJA 3EBVA 1C7TA 4KH2A 4J3SA 4F66A 5A94A 1HP4A 4CVWA 2Y4SA 4AC1X 2DSZA 3W37A 3KZSA 3QR3A
chains in the Genus database with same CATH superfamily
3L65A 3KBNA 5D4YA 5PTDA 2PA6A 2ONEA 3CWOX 3IJ6A 3PWGA 4LAKA 2PP0A 2Y6ZA 1XIIA 2O55A 1IR1A 3M0LA 4AMAA 3EPMA 3I7SA 5HNUA 3W07A 1QOQA 3KX6A 3ALFA 5L9FA 3DGRA 5EMLA 4NZ1A 4C5YA 4AD3A 5D9MA 3WQCA 1E5JA 5FD0A 3ABQA 3M5XA 2WMIA 3RX4A 3CASA 3THDA 1V6YA 5BWFA 3REQB 1S2AA 3C2OA 4A3QA 3UCCA 2HZGA 4DXVA 5JUVA 1H63A 3QXBA 3APYA 4F0LA 2RUSA 5HULA 5MKGB 4NHVA 3S9YA 1MO0A 1TR1A 2XFRA 1JPHA 4U2YA 4PUWA 3AAMA 5HQEA 4FNPA 1SFSA 1FWFC 4AD2A 3WK0A 1CDGA 3THUA 3O15A 3QC0A 3AMDA 3CB8A 4DJEC 1Q63A 2QV4A 1F61A 4KQNA 1H3GA 3L4YA 1A0EA 3TONA 4QSHA 2XM2A 3LHVA 4LUYA 1PPIA 1DE6A 4Y9OA 1JL8A 3A4AA 4N6EA 5E9XA 4UFMA 4Q4RA 4UNIA 3VOFA 3ABXA 3OGRA 2FKPA 3L2LA 1VFFA 3CUJA 4JTHA 1JDCA 2ANUA 1V3HA 3FA3A 3S2LA 5A6JA 3I68A 1OC6A 2G41A 1JCNA 1UQYA 1EDQA 5EMKA 5LIWX 5LKYA 2Z00A 4UTHA 4Q8NA 3O6YX 4YHGA 3F2CA 2ACRA 3WDJA 2P50A 3N2MA 3MCOA 2W3ZA 2WKLA 1E6XM 1SW7A 3BQ6A 3MW7A 2J6VA 3WQ5A 4DPQA 1KR1A 2UBPC 1DWHM 3EPNA 2JGYA 3H2EA 2EAWA 4PMXA 2QDEA 1NQKA 2OT0A 5M1TA 1Z44A 4JFUA 1US2A 2JIWA 3NPUA 3BARA 4JCLA 4D8LA 2P8CA 1A5OC 1HJXA 1KRCC 2X1RA 5M3WA 4XSMA 2PMQA 3PANA 3AALA 5DMMA 3C52A 3W1RA 1A50A 3WQFA 3WJSA 4HZ6A 2DW6A 4DZAA 4LAUA 1JZ7A 1ZBKA 4DWSD 2OPJA 1AW5A 1A47A 1PVNA 5AZ1A 4RNFA 3PPCA 2WYSA 4NX5A 1KGXA 2DSUA 3DYOA 1W3HA 1B3ZA 4M6VA 4RE0A 1BYBA 1H11A 2HVOA 3WLNA 3EXTA 5FL0A 4H1ZA 5HR6A 4AMCA 1CX9A 3I3BA 1UKSA 4S3KA 1VGAA 5D8WA 4BJHA 3W87A 1CGXA 4D6HA 1LF1A 1TTPA 1H5VA 2A3EA 3UZ5A 1A0CA 1JDAA 3TAOA 4I6VA 3SUTA 1W3TA 4MJMA 2BG5A 1Q66A 3QMRA 4O1EA 4C6IA 4XUGA 1U2YA 3SCUA 3LQLA 3CPRA 4Q8MA 3CT7A 4M24A 2I56A 2QJIA 2GFTA 1O94A 3LM3A 2J47A 1Q6OA 3POHA 5A1AA 2TODA 1PKYA 4DM1A 1SO4A 1PYFA 1I60A 4C1NA 5CC7A 4S3CA 3GE7A 2GVGA 1G01A 1GOKA 3NQMA 1OQFA 1HGWA 2JF6A 1B30A 2F6UA 1NP2A 3T44A 5FEPA 4ORMA 4PMVA 2WSYA 3VCNA 5HMDA 5F7UA 4IG2A 1BWKA 2D1ZA 4UMAA 1TJ2A 1AQFA 2Y5SA 3N13A 3EXSA 5BXRA 2E6FA 2XSBA 2Z27A 1W3JA 2GWGA 3GKAA 1C93A 3ATYA 3G2GA 2VT0A 3HPFA 1OX6A 2CKRA 1VHNA 3CLMA 3TUUA 5CKSA 1KRBC 2X7WA 4J3VA 2OXNA 4ADSA 3KHJA 1OINA 4ZEPA 2V6AA 1K8CA 2CKSA 2XFWA 4PBEA 3W1PA 5LIXX 3BOLA 1W6TA 3ARSA 2E28A 4DF2A 3CUZA 3CS2A 1W1VA 2EF9A 3EA2A 1JGIA 2PSNA 2CZFA 4NIRA 3GYCA 2ACSA 6REQA 3R8GA 1GVOA 1W5OA 3AXKA 2BGSA 1LYXA 4GQBA 1KM0A 5C54A 2Q3RA 2J7DA 1GYMA 4C6MA 2PD9A 1FHUA 1SR0A 1RCOB 4XZIA 3GIQA 1SUXA 1P7TB 1A4LA 1AMYA 1ISZA 3RR4A 4S3JA 4Z2GA 2QUUA 4BS0A 1XH1A 1BF2A 1L2QA 4FOUA 3CTLA 3BV4A 4QJ1A 2FIQA 2O92A 4NJIA 2B7NA 1N8WA 4ZXOA 1RJRA 4B5TA 4GI8A 1UD8A 3ZFHA 1K4GA 3UXDA 4XO6A 1DPMA 4FS9A 1Q6FA 1Q6CA 4MZYA 2HPIA 1TUXA 3HOJA 3O06A 3ZSSA 1G4SA 2Z2BA 4EF8A 3KOZA 1KKRA 1VLIA 1R3RA 3NZPA 3VKCA 2CESA 4DLMA 3PJWA 1XHGA 2BMBA 3DXIA 1D9EA 2VZTA 2NQHA 4INFA 3VGEA 5C55A 4NKCA 2VX5A 1E1CB 1XG4A 3L7RA 2BVDA 4JTGA 1WB0A 3P74A 9RUBA 5H1WA 1CGWA 4XKMA 5D09A 2VC5A 4DWSA 4JOMA 3MB9A 3PF3A 2ZWZA 4PSPA 3ME3A 1H1NA 3LGGA 4BQ4A 1V02A 2R1KA 4CQ9A 2DT2A 2WHMA 4JTFA 3PZMA 4FXRA 3KOXA 3CMGA 2XH7A 4PCSA 3WLIA 4MKVA 4GLEA 1MDRA 1UHVA 2IXVA 4MNLA 3AXIA 2FPVA 3AWOA 2ZRYA 1J2WA 5ABGA 2YL8A 4Z0JA 4WGXA 4HGXA 1R7AA 3GFYA 1TV3A 1BYDA 1CBGA 4EANA 2NV2A 4M29A 1EP1A 3WMCA 3JRKA 1VBJA 4L6OA 4WR3A 2D2OA 3MJYA 4W9TA 4AF0A 3OA5A 3CO4A 2VEPA 1GQNA 4X2PA 5CLTA 1WBHA 1VRXA 1XW8A 4Z2LA 2J7CA 2J62A 4P2VA 1K7XA 4AU0A 3OB8A 3DU0A 4Q7IA 3QQ1A 2C6QA 5TIMA 3LN3A 1E9IA 1VYPX 1LLOA 2PDHA 3E74A 4ZA0A 4QEEA 2GGHA 3B0VC 3H2NA 4LAMA 3PPHA 5AZ0A 3VDGA 1TCMA 3M5YA 2CIPA 1JI2A 1AL7A 3GYEA 4GVIA 1GJWA 3AIQA 3OA3A 3FLUA 1FWDC 4O1AA 4OVXA 2D22A 2PCEA 1V08A 5JIPA 1Z41A 3DHFA 4IJRA 4JIRA 1EJTC 2QGYA 3HJZA 4LNCA 3NCOA 7TIMA 4PBFA 3P67A 2HVNA 1VJZA 3AJXA 3DDMA 3UZYA 5HDRA 4FXJA 2VGFA 4B3LA 5HNRA 1QPQA 3BE7A 3N12A 4C6PA 4C60A 2PLCA 2WNWA 1ZCCA 3B0YA 5FL1A 4FSAA 3FY1A 1OD0A 4H9MA 3WD4A 3BURA 2R6OA 1K02A 3VUSA 1MYRA 1QW9A 5A6KA 1VP5A 4JD4A 4DBDA 3TN5A 1J0JA 3WZ0E 4P7QA 1TWWA 3OODA 1OIMA 3VABA 3V7PA 3TTSA 5F1UA 4DO5A 2G0WA 3WF1A 3TYAA 5C2GA 3SY5A 4X22A 1GVEA 3KXQA 1JPDX 3GC5A 5AY7A 1Q2RA 2J9YA 1H61A 3HN3A 3KP0A 4GKTA 1R0MA 2HXTA 4CU7A 3OGSA 4A3YA 3A6OA 1T5AA 1IT7A 4H6QA 4CQBA 1LG2A 4PH6A 2ICSA 1SW3A 2NT0A 1XJBA 4F48A 2XN0A 2YIHA 5BXSA 2ZE3A 1JI1A 1HL8A 3ITCA 4ADUA 1ZP3A 2YA1A 1BHGA 1YDNA 4NAEB 3DFOA 5CEWA 2PP1A 1QHPA 3TNBA 1I1XA 5M17A 1RY0A 4E3VA 1XISA 3GH5A 1KRMA 3TWAA 2WM0A 4OBSA 1TG7A 3UJSA 3VGFA 4GXWA 4O13A 1S39A 2Z1BA 5LNWA 5KMYA 2PU0A 5FKYA 2P8BA 2A7NA 4BA0A 3N29A 3S46A 3EX3A 1QK0A 2QDDA 3AS1A 4KS0A 3CZEA 2DZUA 2QNEA 2WQPA 3GU9A 4D6EA 1US3A 1XLLA 4RUBA 1I45A 4MB4A 8XIMA 1TPUA 3IUIA 1P48A 3W7DA 3TU9A 3B8VA 3MZNA 3QV7A 4RDVA 3RU6A 3MTWA 1RV8A 1UUMA 3OBAA 5AKQA 3QV6A 1N7KA 1YRRA 1FRBA 4M51A 3KLKA 4PTVA 3TJIA 4JIIX 1YYAA 1HJUA 5ECVA 5EB8A 1HKVA 3REQA 3FYPA 4E8CA 1J10A 2OZTA 1ZRQA 4A6GA 3VNYA 3MMWA 1RA5A 2PDXA 4R85A 3V1HA 3WG6A 4P5UA 2GJXA 3KWSA 1V51A 3E02A 2HVMA 1O4UA 2NSXA 1B3XA 2ZICA 4HOWA 2WM1A 4L65A 4XZWA 2GL5A 1EUNA 3W72A 1VYRA 4J7RA 4PB4A 3DG3A 1UWRA 4JGDA 3WH9A 1V7AA 4HNNA 3OZMA 4N42A 3LXBA 2ALRA 5LIYX 3N2CA 2V68A 4QG9A 2CPUA 2CBIA 4KRTA 1GOIA 1PX4A 4N9BA 4NASA 5C5YA 4CVUA 1ZPTA 4E8GA 3KTXA 2BVWA 4RE4A 3W53A 4C65A 4LB4A 4ZB5A 1AZ2A 2IPJA 5JMUA 1XLGA 4DIAA 3WD3A 3LCHA 4PGLA 1J93A 2XINA 1TO3A 1XDJA 3CL6A 3EWBX 4HMCA 2GJPA 3LPOA 1GORA 5AHNA 5LZLA 2DY3A 1XRFA 1TUFA 4JL1A 3UZJA 1SR9A 3OIXA 1WQ5A 1FWWA 5I3JA 3A9IA 4UOQA 3EX6A 4K39A 3GHRA 4UTKA 4JR5A 5BMXA 4W4QA 2JIEA 3OYZA 4FAMA 3RM8A 4NI8A 3ERPA 3KL3A 2QKFA 3BPWA 1BYAA 2Z29A 2O9OA 2POZA 3CT2A 3EB3A 1QW7A 4ZB2A 3S6OA 1EBGA 5F4XA 2CLKA 3V5OA 3EWYA 2DP3A 3SCWA 4W86A 1NF7A 2FFCA 4H2CA 4AG0A 4X60A 2E3ZA 4H04A 1AFSA 1HKMA 1W3IA 1XPYA 3HTWA 5H6HA 3HG5A 1EXPA 3CWHA 4PTNA 5HJYA 3N2BA 5FF4A 4DZIA 4ERIA 4ZQMA 4LCRA 4XZLX 3B0PA 3CYVA 4DN1A 3ANUA 1RD5A 4HHMA 1K9DA 3CAKA 5ABHA 4Y9NA 1UKQA 4AZGA 3WH6A 2NX9A 5K9DA 4DBWA 2ADAA 2E5BA 2X7VA 4NUWA 4QLLA 4AVNA 1GVFA 3CZGA 3GXFA 4Q6XA 4CQCA 1OSEA 1GW1A 4HJWA 2BWGA 3MP3A 3RJXA 3VILA 1NIUA 3EXRA 4IT1A 1OIFA 4PSRA 4AZIA 3O3RA 3GUWA 3VM5A 4UTUA 2Z1SA 4NJJA 1V79A 2YL6A 1A5AA 1BKHA 1KLZA 3NPXA 1UROA 4KFNA 3V0SA 4N2YA 3CQIA 1JD9A 1V6VA 3FGCA 4UZUA 3BAXA 3QRHA 4UCFA 2QHAA 5A8NA 1I4NA 2A3BA 2G97A 2VGGA 3MV11 4LT9A 4QIUA 4UFLA 3WQGA 1DHPA 5LA0A 1L6GA 3E5BA 5F2MA 2AOSA 4NZ3A 2HPMA 4S2BA 2VFDA 3BAIA 3GNDA 4A3RA 3K8KA 3APTA 1UR8A 5IHSA 4MY8A 1TV7A 4MJZA 5HJXA 4QP0A 2E1DA 1JGMA 1GOWA 3I7QA 2FQIA 2HBXA 1MZRA 4DF0A 5FAGA 5FEXA 3NL5A 4D71A 3E2SA 4B91A 2FB2A 1OT1A 4UTJA 4YWIA 2J8FA 4K7VA 3W82A 1V3LA 5ENLA 4LGXA 3T1GA 2DUAA 3L23A 3T2QA 1B2YA 4AW7A 2EBNA 3W7EA 2QCDB 2OWWA 2X05A 3WQ4A 5G1MA 3GY1A 3PBUA 2QIIA 3SADA 3UZXA 3GX9A 1EF3A 1RQHA 4GACA 1XGEA 4GUGA 5JBEA 3RLHA 3DENA 4DYKA 4P8UA 1KXVA 2VEGA 1E9LA 1O6IA 4JFWA 3ZJ6A 3VI2A 4HPJA 3N34A 1TQJA 2IPFA 1WZMA 5LNVA 3UG8A 1I0BA 1T6MA 2AQWA 2CC0A 2VWTA 1TPH1 4H9UA 1IT0A 1XYBA 2B0MA 1Z48A 4I9AA 2CXEA 2FGLA 2YB4A 2VWSA 3SRHA 4GGHA 4AIOA 2W0UA 1SMAA 1RZMA 3UXIA 4DY1A 4NVTA 1YIXA 4L1WA 1PTAA 3W88A 2E40A 4UZSA 3POCA 3ZJ7A 4GZ7A 1LRTA 1EO5A 3P6LA 1M65A 3CQHA 3H7RA 2ASHA 1KXQA 2BHYA 1SVDA 1GPWA 4GIEA 4EE9A 4PMYA 3IACA 3WLOA 1WDQA 1KCKA 3WFLA 4JS3A 5EMJA 5HOSA 2J7FA 4OWGA 4X61A 4D72A 1P7TA 4GRSA 3KRBA 4GXPA 4H7VA 3O16A 3ARPA 1NQ6A 3W7KA 3A9BA 3LTSA 3QYQA 5LXXA 4CU8A 2JFEX 4LRSA 4GNKB 4LYRA 5TF0A 4M7TA 1W1IE 1QI4A 1XQKA 4XBKA 4U3AA 2UV8G 1AJ0A 3IGXA 3W2LA 1ENUA 1U1HA 3MQTA 5D04C 3DH7A 3P84A 3LBOA 5M2FX 3Q2DA 2ZIDA 4GINA 4HU4A 4M8UA 3E6EA 3TLQA 1V0LA 1QRQA 3LCXA 5F1VA 4PUDA 3O0FA 1WA3A 1IGSA 2A3HA 5A5WA 3L5LA 2O4QA 3ZQ9A 1HJVA 4LVBA 5SWUA 2E8ZA 4JAWA 4Q8QA 2FMNA 2VQTA 2Z25A 3U5UA 4GJJA 4ZOEA 2I5GA 4Q3MA 2D0HA 2DUZA 3VOHA 1GONA 4DJED 5FCZA 1TV5A 3KOWA 1J6PA 3NOYA 2AKMA 3LCIA 1UZDA 1NARA 4R9OA 4W7WA 4OV4A 2ZBTA 3GQYA 1C91A 2ZQ0A 3MUZ1 3B4UA 3MHGA 4G8TA 2CLOA 1UD5A 1QMLA 1A3XA 2YLAA 2GDVA 2X8RA 3CAQA 3WLKX 2VX7A 1JF6A 2JALA 2VFIA 5IBXA 1R9YA 2ZXAA 4EWND 4KEVA 3TSMA 2QPSA 3VZZA 4YCOA 3VGGA 2CHNA 3CZLA 4ZQNA 1CGTA 1GYLA 3VFCA 1L2UA 3F5LA 2RH9A 4A8NA 3M4HA 1G7UA 4PCNA 5BRBA 3CXOA 3BW4A 3ABSA 1NOFA 1ZBCA 4JIEA 2PTDA 3SRKA 2GVEA 3AHZA 3BH4A 3SURA 3WF2A 5HPCA 3AXXA 2Y70A 3JZEA 1T96A 1JCJA 5DMNA 2WJDA 4UTTA 3S5OA 1E6ZA 1QW8A 2I14A 4JTKA 1M03A 2PGWA 2WHLA 1CB7B 3IAPA 3O6DA 4N6FA 3SJ3A 4ZOAA 4XTIA 1XIDA 1UIOA 1OFBA 3B9AA 1MW0A 2V63A 5IRPA 9XIAA 1EYWA 3PJTA 3HZ3A 4I7WA 4IQDA 1AD4A 3W7PA 1EUAA 5D30A 3RR1A 1WOBA 4AD5A 1O5XA 1B3VA 2WWCA 3G24A 4ERAA 4ICCX 3GDKA 1BWLA 1PXGA 4L5ZA 1V8EA 5I5RA 2C0HA 4L4OA 5U4NA 4X63A 3GU2A 1PTDA 4LQ1A 1SM9A 1KM6A 3VDHA 1KM2A 3T78A 1DXEA 4Q7NA 1J11A 3IV3A 3LSBA 1REQA 5DN1A 3ABOA 4BCEA 1Q4NX 2PDMA 3NO3A 5A6BA 2DU2A 3WENA 3FAWA 3NYDA 3DC0A 2X40A 2UWFA 2WMGA 3KOFA 5G4EA 4IL0A 2XGBA 3S42A 1XYZA 1IWPA 1CECA 1FA2A 3W24A 4BI7A 3MVTA 4ZZ9A 3U2EA 3WH8A 5F2LA 3GLCA 1SW0A 3RO8A 3SSZA 2WNQA 2PWEA 1GZ1A 1DWGM 3MUIA 3TK7A 1HZYA 3T0AA 3VMNA 5FJTA 2OO6A 2QZRA 1FWSA 1GZGA 1IXPA 3LTPA 1MI3A 2O7SA 4EACA 2J77A 4PUKA 3QMSA 4FF5A 4BWLC 2V3GA 1C92A 4OBRA 3QTPA 4Z2KA 1XIBA 3LG3A 1P43A 1KFEA 3TEVA 3TJ4A 3F2BA 6PTDA 4IWWA 1CLKA 5FJPA 1GOMA 1FCVA 4NAEA 4ZQCA 1RBAA 4PMQA 4JY9A 4IGHA 2JKEA 1YBQB 2ABBA 1KTBA 1XYLA 1KGUA 1T40A 5FOOA 4R7JA 5CC3A 1ICSA 3PZNA 3NQGA 1OWQA 3RCYA 4S3BA 1A80A 5EPDA 2V3DA 4CNSA 1EOKA 3O1NA 4D8ZA 1JZ3A 3UWQA 5HXMA 1ICPA 4ZO9A 1DWFM 4TUFA 5CPOA 3PY2A 4XKYA 1NOWA 3F03K 4A2SA 3OZOA 1GHRA 2VMFA 1JDDA 4E2BA 3AHXA 3WNKA 4GY7A 1Y65A 3L4XA 3UP8A 3QW4B 1JCYA 3MS8A 3AXMA 2QS8A 2VZVA 5C9WA 3PBWA 2C3ZA 1GPFA 1ELSA 2OLSA 1XPGA 2NV9A 1TIMA 3VGBA 4DJEA 4BEQA 2CCRA 2ZVRA 1ZAJA 3QGAC 2WC4A 3ZM8A 4HMNA 3GFZA 1Z6KA 4HTYA 1R2RA 1OFOA 3MI3A 2YYTA 4N0RA 2GGEA 2P76A 1K9FA 2WZMA 5DMLA 1B9BA 1A49A 4ATDA 1S3HA 4W84A 2C19A 3PZIA 1B4EA 3MCMA 1UBPC 4EPBC 4H3DA 2R94A 1KFKA 4XSLA 3U5YA 1PDZA 3W81A 4LVDA 3VXGA 4LBSA 2RDUA 4GABA 1EQCA 4DBSA 4LS0A 3HMJG 3H6OA 1MW1A 4QFUA 1BPLB 3VIJA 3VX1A 3T40A 1SJAA 4WQ6A 1BSIA 3KRSA 4TX6A 1PEZA 1G5AA 1WO2A 4HA3A 4Q8TA 4OT7A 1HJWA 3A47A 2XYLA 4H9VA 1QUMA 3LZ3A 1GKRA 2P1FA 5LGXA 3CEUA 1EOMA 1UKPA 1E6PA 4YTQA 1OADA 2C91A 5E9AA 4U5IA 1XLBA 2VDIA 1UCWA 1IZJA 1MNZA 4GH1A 1KM5A 1CWYA 1X7FA 2OX1A 3KCOA 3PBVA 3FIGA 1A5CA 1V03A 3WY1A 2FYMA 3B9DA 3PPFA 3AC0A 1IEWA 1QI2A 3UXKA 2NQ9A 3EX4A 4UBPC 3IRSA 4V2XA 1XRVA 3DBNA 4NAFA 1FKWA 4FOJA 3L4ZA 1AH3A 5I23A 1OCBA 3BWWA 4WF7A 2OEJA 4HNCA 2C1GA 5DCEA 4A35A 2Q8LA 1JRCA 3WBAA 4EF9A 4PL2A 3P82A 2ATMA 1M53A 1S2VA 2ZWYA 2NXHA 3RPDA 4PMRA 2ZTJA 2WCAA 1RH9A 4MAZA 2NUYA 2YW3A 4O14A 2QLYA 4O0QA 1FHVA 3QM3A 4AFYA 1PUDA 3EMQA 3PTQA 3A24A 2BOEX 4M6UA 1AH0A 1A5LC 2OSWA 3E0IA 5JXQA 3L5AA 3VC5A 2EJ1A 2YDQA 3E2RA 4DUVA 3EWWA 4KGLA 3PZUA 1UR0A 3VD5A 3WDQA 4IPJA 3PBGA 1PCWA 4B92A 1R30A 4UTIA 3IWPA 4GQGA 4MB3A 4CQAA 2V5DA 1K1DA 4IQJA 3M0JA 1JXKA 4IMAA 2VOMA 3ONBA 2P5NA 1MDLA 1JUBA 3BO9A 4ZCWA 2OWCA 2DQXA 4H19A 2YBVA 3O6CA 4NX0A 3U2OA 1DEDA 3S1WA 3PSVA 5C7VA 3KCJA 4Q8VA 1HP4A 1VBGA 2Z4GA 3D6NA 2PDYA 1ADSA 1JZ8A 2YZ5A 2ZFAA 3TH6A 1UD6A 2ON3A 3KCLA 4WGHA 3R43A 4NQ1A 3WEOA 2QCDA 2D2JA 2OEKA 4DI8A 1M3UA 4ML9A 3BICA 1ONXA 3T4WA 4YVXA 1EGVA 1UD4A 3V0TA 3M47A 1Q3NA 4RXGA 1XSJA 5JBFA 3MMTA 3NZQA 1E0VA 5CJ5A 5G2IA 4OQVA 1XLKA 4CQ8A 5CSRA 1UWQA 3QKEA 4LF1A 4GZEA 2PDKA 2NXIA 5FJJA 4PODA 4DX3A 3Q37A 3W7QA 1F73A 1A4MA 3H53A 3H4GA 4QLKA 3OO2A 5B7ZA 3B8WA 4BF5A 1DJQA 1C8VA 4H7CA 4KPLA 4JTJA 1ZS2A 1TV2A 2TSYA 8TIMA 7CGTA 4FR1A 4BFAA 2FGZA 2PZNA 1QI3A 3R7MA 5I06A 2BV9A 3QQ0A 4DUXA 3T0DA 5LNSA 5HQLA 3W9ZA 4LEQA 1BSLA 1TPVA 4JTUA 1ZNNA 1DV7A 4V1YA 3ZMRA 1GVRA 3R25A 1A5BA 4AD0A 4PC8A 2EKCA 3NQBA 3S3GA 2ZDRA 1QOXA 5AC6A 3CV7A 1RA0A 3WJXA 3BOFA 1U30A 2FH8A 4LC6A 1ONWA 1IF2A 2INFA 5AC8A 2XIBA 4UIOA 3WD0A 5D9NA 4B2DA 3LRKA 4LYQA 2FPYA 2OQHA 4BK9A 5D38A 1GEHA 1LOLA 3GAKA 3W1MA 5I02A 3OTRA 2RGMA 3DX5A 4GVFA 2V0TA 1OC5A 1M1BA 4ZB0A 3W1LA 2PP3A 2PGRA 4CCCA 4QE1A 1E55A 1W5NA 1UG6A 1WBJA 1W5MA 1IE7C 2PBGA 3LB0A 4F3HA 4HPHA 3CV6A 3WNOA 1ECEA 4MWAA 2YLLA 3Q58A 2GJRA 1YQ2A 1E6NA 4GCXA 4B5NA 1K9TA 1SZNA 4J40A 1UJPA 3I6RA 2OLAA 4UNLA 4XG1A 3I4EA 4AEEA 1EP3A 4LAZA 4CCZA 4DYEA 4ADTA 5I24A 1C9WA 4KWUA 2HJPA 4JZ5A 3H2OA 2OZ0A 2XZ7A 4US5D 1JEZA 1RR2A 2P88A 1W1YA 4Q4PA 3UD6A 3VOGA 1A5NC 2OODA 2QCGA 2NVCA 4UFHA 1QFEA 3BG3A 4HT3A 1EKOA 4LW7A 1AA1B 3GH7A 4LVAA 1X7IA 3PFRA 4QQ3A 1OCQA 5C7HA 1XCWA 3BGGA 3IARA 3I3DA 4AQLA 4QISA 1RPKA 3WNPA 1XH0A 3SCTA 1IEXA 3RLUA 3C86A 1VBUA 2VD8A 3P62A 1J4EA 4GI4A 3KL5A 2OX4A 2PLMA 3WBYA 3GTNA 1XG3A 5D8ZA 5EMMA 3TW9A 3E0FA 4ZFMA 2HBVA 5IM51 1B3YA 1KFBA 3SN0A 3CLWA 1J79A 5FEZA 4AWUA 3EA3A 1XLMA 2VO5A 3DI0A 4GVGA 5F2IA 5HK4A 1KGWA 4H41A 3KTSA 4H8VA 1XBZA 1R3TA 3CIVA 3PHAA 3NXLA 1PKMA 3N2OA 4JX6A 1FWNA 2Q8XA 2ZX9A 2D24A 3UPMA 3BUVA 4E4PA 3LQGA 3IJ9A 4RPPA 1B5TA 3UJFA 1DYSA 4MNKA 4JN7A 4MADA 3VNKA 5M5DA 3AUOA 3W7MA 3LGDA 3RPMA 2J27A 4WXZA 1CLXA 4JN8A 1AMKA 4K36A 2OQYA 2Z7KA 5AYBA 3GVGA 4P7LA 3ZLGA 4JXCA 1UP0A 2JQXA 3WLMA 5KZDA 3K4WA 1B9ZA 2Y2WA 4KIEA 3MDWA 5AC7A 3ITGA 4JQ1A 4L1XA 4FZIA 4GE8A 3G3DA 4DBUA 3N9RA 5BXPA 1ML1A 1XGDA 2CLIA 1KA9F 2Y5EA 3P61A 4JEQA 1EC9A 1XP3A 3UEQA 2Y8KA 3ISIX 1UMLA 3UCDA 4XZMX 2A5HA 2CFFA 4A21A 9CGTA 1BRLB 4ZTXA 4V28A 1YTEA 1CYGA 1K6AA 2R9RA 4AVOA 4CD7A 4ATLA 2YL9A 3DKJA 4MLRA 3CHFA 4QG6A 3MI6A 2C7FA 2IPWA 3WBXA 3WQPA 5DRCA 2W63A 2A0NA 5I09A 4FXFA 3OBKA 1A0DA 3BXWA 4A05A 3LHUA 1MUMA 3TMQA 2WJFA 4HYVA 2REQB 4FNSA 3WBEA 5G1YA 3SCNA 1H7RA 2W91A 1CZ1A 4YIWA 4HOXA 4JBRA 2WZTA 1OFQA 1PZ2A 5CSYA 5JH2A 3QH2A 1Z3NA 3T8QA 1W17A 3DERA 2EPNA 3LA4A 4AD1A 2F84A 3I4KA 3CNYA 3OP2A 3G1RA 1XIEA 3S1UA 5DXXA 1J6OA 4GISA 1MEIA 4D6CA 1XXXA 3CIWA 4B5UA 3NWRA 2J88A 3NA8A 3M5VA 1RY8A 3VTRA 5EFFA 2D0GA 4MM1A 4GY1A 2Z1WA 4HIBA 1TKKA 1KQYA 2ZC1A 2VRKA 3O05A 4ROQA 3UXLA 4IX0A 1E4LA 4C6EA 2QXWA 2YCIX 4OHQA 4DXXA 3OHMB 1GJPA 3NG3A 1CGYA 4PB5A 1WXZA 2DZPA 1ISVA 2CU0A 3SAZA 4ERGA 1CNVA 4AHPA 4YHEA 1JYXA 3TE9A 3NVDA 4KRZA 3M44A 4WY0F 3LBCA 2WMIB 5A6LA 3PC0A 3UWWA 3WQOA 4US5A 5CBJA 3GW3A 4LWWA 2H8XA 4HYWA 4XD3A 2OCZA 3ONCA 3EX1A 4C90A 1UWUA 2VHLA 2WVVB 1ME9A 3UJEA 1WYIA 2DH2A 3RCMA 2OOFA 3NNTA 1PAMA 4NP7A 3BDKA 4HK6A 4UFKA 2GGJA 4O52A 4FLQA 3QOKA 4G6CA 3P0XA 4ZBCA 4C7DA 3ZOAA 3CEPA 3ZYZA 3MKVA 2J7HA 3PVFA 4ZL1A 4YU1A 3M64A 2QCFA 5DY2A 3TROA 5C9XA 2YOCA 1NWRA 4AEOA 1EJUC 4QQUA 2IW0A 3ZJKA 2F7FA 1KB3A 3NZRA 3FCPA 3E2QA 1TMQA 3O2LA 2INZA 3QLLA 3HA1A 3LHWA 4CD6A 4W5UA 4NYUA 3GNOA 4IISA 3VPLA 3USBA 4GC4A 3ELFA 4ZMGA 4N4QA 5IXEA 4PTXA 1F8IA 1HKWA 1SO3A 3BMXA 1W5PA 1KFWA 5A2AA 4NXKA 1XWYA 4JNZA 5C2XA 1DIOA 1YADA 3OLIA 3BJTA 3N4AA 1QASA 4LSBA 3KEHA 3OU8A 3TOPA 2CYGA 5C0QA 4JPGA 2OEMA 4AIEA 3BJFA 2VD9A 3WSUA 2ZUNA 1H1YA 3FYYA 1GK8A 2Y7DA 2B7PA 4Z0SA 4ICNA 4ROPA 4C6BA 4IJBA 4I6KA 2EEXA 5FA5A 4LUTA 3BAYA 4HTBA 1PB0A 3OZYA 4MJ2A 4M3PA 4PMOA 1RJPA 4K3ZA 4K2SA 5A3HA 4O1FA 1T0OA 1R38A 1EBHA 1WP6A 2DPEA 1PE1A 2B81A 1GQIA 1ZHAA 3G6LA 4YTUA 4TVCA 4K1GA 1VPQA 2EPHA 4I7VA 4LX4A 4PMUA 4D6IA 3MANA 3NFUA 3LCWA 3LRLA 3Q65A 4RL3A 3ZIZA 3F4NA 3PN8A 4DQWA 2W79A 3GKFA 2J74A 4ENLA 1NWSA 3TKFA 1L9WA 4C7FA 4LS2A 1PS9A 4O1BA 2VYOA 1EX5A 3VOJA 1VC4A 3BG5A 2J8TA 2JBMA 3ABZA 3QJAA 2CLMA 2DVUA 3A22A 3GBEA 4IGNA 1IEVA 5EFDA 5AECA 1IZKA 4AVFA 4E4FA 3N9SA 4EAYA 1P0NA 3STFA 3ANYA 4LBRA 3WQVA 1UOKA 4F0HA 1I9CB 2VCAA 2PTYA 1W3NA 4BI6A 4NF7A 3ARZA 4QM1A 1RQEA 1SU5A 2Q3OA 3AHTA 3VMPA 2JKAA 1UW9A 4DEFA 3SR7A 3WQDA 3BVJA 3BLDA 5G1TA 1AQHA 1FWRA 3LHZA 2VZSA 5CAHA 3B9EA 1GOXA 3IGSA 1MSSA 5KITA 1LCOA 1G0CA 1KCXA 1DJNA 5H8MA 1MXSA 2XG9A 4L7ZA 3TZNA 4L9XA 1TPEA 3ARUA 2DEPA 2X16A 4JIPA 1TV8A 3UQNA 3INPA 1MVYA 3E0LA 4IG2B 1NF0A 2L5HA 3U9IA 3H8AA 2QJGA 3CM4A 1A3WA 3EX2A 3RX3A 3P14A 1GNXA 3C2YA 3G77A 4RKAA 3WFZA 4JY8A 2XPKA 4PMNA 3WLSA 3U48A 3F7JA 2NV1A 3QQWA 2GLKA 3W22A 4QDWA 2FGBA 3G1XA 4CGTA 3O07A 4MZ8A 4NYYA 1M5WA 2QVHA 3JVAA 1P6BA 1GTHA 3M6DA 3MKCA 2ZX6A 2YXXA 5CGMA 2HRWA 4GI9A 3FDGA 4GYFA 1VCGA 5IFTA 3AZRA 1ITQA 5JH1A 4MY9A 5CPMA 3BSMA 3LHTA 2OMAA 4FIRA 4ZSUA 3U8GA 2VX4A 4WXYA 4J3TA 1SJDA 5CC6A 5AB3A 3L9CA 3UPWA 3GH4A 1MRAA 3R0UA 2EPMX 4MUPA 4KEMA 6REQB 3RM9A 2XU2A 3VU2A 1F5ZA 5M03A 1W2VA 4GOAA 2OLHA 4RNIA 3G5EA 2DSKA 1KO0A 1PZ0A 1UZ4A 4B4HA 2E09A 1P0BA 2AAMA 2NX3A 3VNLA 2DDXA 5EKYA 3BMVA 1SZGA 5JVLA 3T05A 3FNDA 4QG8A 4QS6A 4ZODA 2ACQA 4QCEA 2GZXA 2E8YA 2WMKA 2EPLX 4MVAA 3FA5A 1R7OA 4O0ZA 4A3HA 3NIYA 1U5JA 1ZLPA 1YX1A 1CXEA 2BY3A 1FHDA 3S1VA 4UTFA 3VIGA 1X6UA 1S1PA 3EZ4A 3S5YA 3H4XA 1FWJC 1EFZA 4C5ZA 1BLIA 2V38A 2XVGA 3W83A 3BV7A 1FH8A 3WELA 2DVTA 5CJMA 2D20A 1J0KA 2Z28A 3PUGA 4JKLA 1XDLA 4UFIA 1S2UA 2GJLA 1FWCC 4JTCA 2OOGA 5D33A 1AL8A 4IP4A 4G7EA 3RK8A 3TQVA 2ZA2A 2ISSA 3GVQA 2QVNA 4K8EA 4GWEA 3B40A 4AYSA 4JHZA 8A3HA 3T9PA 2Z24A 4R34A 3IVSA 4HHLA 3VKKA 4OUIA 4K38A 2E1WA 1SPQA 3S9IA 1S3TC 1AD1A 4AB4A 5XIMA 3S2JA 4GXMA 2XSAA 5J8LA 4ICMA 2G3IA 4D8AA 1CCWB 5HNNA 3BLKA 4ACZA 3U6WA 1P0DA 4PUJA 3OVRA 3VD4A 4K8HA 3MJMA 2G8ZA 2PTWA 3HFYA 3IJ8A 3JU2A 3K1DA 2YSWA 1MEHA 1YDYA 2QDHA 4LY4A 3N2TA 4MGGA 4AIBA 1XD1A 2WB5A 2PTXA 3QHOA 3WK3A 3AJ7A 4F8XA 1R6WA 3VVGA 1NU5A 4LTSA 2XISA 1R9ZA 2ABAA 3GTHA 4K1WA 3GTFA 3C0LA 4KT2A 3UJRA 3SQSA 3H2FA 5AVHA 4F2BA 4H9YA 4EXQA 4AF0B 1XLAA 3A3XA 2P3EA 3NQEA 5IFPA 2I5IA 1DQXA 5LNRA 2PE4A 2A7PA 4K68A 4C6FA 3VKDA 3QPZA 3WCZA 3V5CA 1G67A 1G4TA 5BWAA 1OFPA 2VVSA 1HJQA 3CHDA 1DXIA 2WZHA 1DE5A 4O0KA 3M0VA 4EVZA 1M41A 2VCCA 3N3MA 5H91A 1KLYA 2WC7A 2YA0A 1TVLA 5J04A 3G22A 2D2HA 2PDPA 4FX8A 4LYPA 4YVPA 4QEHA 4LS1A 1NTHA 3TFXA 5HPOA 2VGIA 3L66A 2GYIA 3R11A 2ZUUA 3G1YA 3LBMA 4B5WA 1ZFJA 3K8LA 4J27A 4GNJA 1EQPA 4GHRA 5FIPA 2NWSA 2XN2A 3SI9A 3QMTA 2NSOA 4GFSA 4O8AA 3PPGA 4DHGA 4GO9A 3Q67A 1TELA 3RITA 3WF0A 1MNSA 4ACYA 2YW4A 1RVGA 3BSHA 1J8VA 1E71M 4BWLA 1BRLA 1KTNA 2OT1A 3EWCA 5C8BB 3HQPA 3WFAA 2W4XA 2HE5A 2G5WA 3BZJA 2XM1A 3M0YA 2RJHA 2O9TA 3O7UA 1R3WA 5CJNA 2WK2A 2V30A 3TAKA 4RE3A 2CEQA 3D47A 4IPLA 1NEYA 5IHRA 4I3GA 1LRQA 4NSBA 1V3KA 4O10A 2REQA 1EYEA 4G56A 3Q94A 4LV9A 4IP7A 5GJMA 4DVOA 4Y6GA 4IICA 1I2NA 2YX0A 3UVAA 3HU7A 4CD4A 1I0DA 1XICA 1LQ2A 5EL1A 3IS4A 5JBDA 3C3UA 1B31A 4EPDC 1UOZA 4H01A 3TA9A 4CEXC 1H51A 1ZSXA 2WLYA 3MP5A 4IP5A 3C56A 2YXOA 1JVNA 1YPXA 1M7JA 4CN4A 3DG6A 1WKDA 1J96A 4QJ5B 2POTA 2PDGA 1ZL1A 3D46A 4GI6A 4DO6A 5I3GA 4UR7A 3I6TA 1EB3A 4W89A 3S0CA 3O0KA 3C8NA 4WCJA 3GG0A 2CWXA 2HE8A 1Z69A 2XWEA 1EJRC 1G94A 5CZTA 1BXCA 5EGRA 1SJBA 3NQDA 1PHQA 4ZQRA 4TIMA 1TV4A 2UY2A 1G6CA 1EA9C 1CI1A 4XAGA 1B1YA 1UPMB 4MOZA 1HO4A 2KZHA 1A5KC 3RAOA 4AISA 3W7IA 1V3JA 4JCMA 3KVJA 3GXMA 1H7WA 2NQLA 3B9OA 2WCGA 3IK4A 1TB3A 2ZA3A 1VEMA 2W27A 4KWVA 3W7RA 1QNPA 4XZNX 1AK5A 1A53A 1BWVA 3MT1A 1RCXB 4MG4A 4UOJA 3URAA 2WWDA 5BRPA 2WVVA 2CLPA 1OT2A 1TPWA 3WUEA 3DIPA 3VIHA 2GJXB 4WSHA 1VLWA 5F2GA 1VFTA 1SO5A 1HG3A 1V93A 7TAAA 1BKSA 4I9MA 1EJ7L 2J7BA 3VCRA 1L6YA 4IIFA 4X0VA 1D8WA 1W31A 4HKPA 1NJJA 4DF1A 3RYSA 1QI0A 3N17A 1AVAA 2PGFA 2JF7A 3M0HA 3UG5A 1LL6A 1RD6A 2XIMA 1V3IA 1ESWA 1DXFA 2X0SA 3L4VA 5LIKX 3W26A 1H2JA 4ZOBA 3W86A 4S39A 1BGAA 1LLWA 3H26A 3QY7A 2X1UA 4J28A 3HGSA 3TX9A 1FUYA 1F2JA 2E77A 2WMHA 3KZPA 3GBDA 4OECA 1DIKA 4M56A 3CL8A 4Y7EA 4ZR8A 3ARWA 3F2DA 3GVVA 4P7OA 4XAZA 6TAAA 1K8YA 4HMEA 3VDBA 3ZR6A 3W1NA 3RJYA 4RW5A 7REQB 1GCYA 2E5DA 3M9YA 4DB7A 3PTDA 2EG6A 2IKJA 5FACA 3UWYA 3PNZA 8RUCA 4AEFA 3DN5A 2VX6A 5FJUA 3OQEA 1O95A 1J5SA 3IIPA 3NO5A 2D0FA 2GQ8A 3NQVA 1V0MA 2PURA 1OHLA 3STPA 2GSJA 2NT1A 1VFUA 4HHHA 3W73A 5GNYA 2QQ6A 1QNRA 4OGZA 5D32A 3AMKA 1VFOA 3NSNA 4UCGA 1MQPA 2CERA 3MSYA 2DZXA 4AZ6A 4ALDA 1LDCA 3MHFA 3TTOA 1M68A 3G0XA 5JIWA 1DJWA 1HX0A 1H1ZA 1PHWA 3L67A 3B3DA 1UYQA 5I0DA 4PEEA 5F4WA 3L4WA 1S5VA 2WHKA 4AX6A 4FK9A 1MW3A 2VFGA 2Y7GA 3ARXA 2FTYA 4TMBA 2OQLA 4HMDA 4YVVA 4JTTA 4FLSA 1S2WA 2ZX7A 4FO4A 3VGDA 2I1OA 5EU9A 1QHOA 4F2UA 5K3VA 3FGCB 1LM1A 1W9UA 1PX8A 3WIJA 4YCPA 3UETA 3UXAA 1YDOA 3C4UA 7A3HA 4XZHA 2PAJA 2YBUA 2XIOA 5EY5A 3WD1A 1RSCA 2PDJA 2PD5A 2GDQA 4JTEA 2FZMA 1ZJHA 1FXPA 3ARQA 3UWUA 1HQTA 3W02A 2TPSA 4JTIA 1QK2A 1EGZA 1JR1A 3EDKA 2OU4A 5I00A 1ZALA 4CUCA 1IEQA 4U4MA 8CGTA 5AHLA 2ZUWA 4JDYA 1OVDA 1J12A 3C0SA 3G8RA 3STCA 3U2CA 1K8ZA 4D1JA 3R79A 2UY5A 3PSWA 1JYWA 3ZXWA 4Q8PA 3EOEA 5KINA 4REQA 1OM0A 2WOQA 1VRDA 3BAWA 2DGAA 1WNOA 5A8MA 1D2KA 3M7SA 3P7YA 1TX2A 7XIMA 3S2MA 4R27A 4NNBA 4YNGA 3ENLA 3ICJA 4ZO6A 5EMUA 3SCOA 3LM7A 1V6WA 2XIIA 4V33A 3KM8A 4QNWA 2NUWA 5CBBA 3QR1A 3GXPA 1ZY9A 1Y0EA 2MNRA 1XIJA 3P3BA 2BY2A 4M80A 3TQKA 4AHOA 1UWAA 1FXQA 1JQXA 1ZENA 3VIOA 2Z1XA 3UVIA 2V3EA 3AMCA 1GEQA 1JNDA 3H55A 2BFGA 1JFXA 1KQZA 1QR7A 4R88A 3N04A 1QAPA 1WPCA 4IIHA 3XINA 2WANA 3RILA 1B3WA 5G2WA 5I78A 3BMWA 3E0VA 1KV5A 1K9EA 2R82A 3V5FA 1XLFA 4NU7A 4PL1A 1JAEA 5CZKA 3M07A 4WKHA 1KFJA 3OGVA 4AWEA 4Z1YA 3T6CA 4L4LA 2BDQA 2FZNA 3L0NA 3FAXA 3DCPA 1XLCA 1MZHA 1QPKA 3CMFA 2Q6ZA 1JIBA 3M16A 3C3NA 4QXIA 4IMGA 2ZXDA 4NJGA 1KV8A 3VDAA 4ES4A 2RDTA 3G8EA 3ZS4A 1XSIA 1CXLA 3IANA 5I3KA 4Q8WA 5AYIA 2A3CA 1B54A 4PB3A 1VFMA 4W7UA 1MEWA 1MRQA 3SB0A 4E38A 1OCJA 3BCFA 4JX5A 4KEUA 3ABRA 2A2IA 1AW1A 1N8FA 3EEZA 1LOQA 1HKJA 1NM9A 1THFD 4Y96A 4EIVA 4MYAA 2Z1VA 3IJIA 2WQDA 3EOLA 4HSOA 1SZEA 4GJIA 2V5BA 1QI5A 3R10A 1X1ZA 5ABFB 3AI0A 4M6PA 1ZJIA 1H62A 4XBJA 3G0UA 3MC5A 4JTSA 5IDIA 3UESA 1SQ7A 1JCTA 3TSDA 4MWAC 3FFSA 3EDFA 5G5IA 2EXOA 4NXSA 2XVKA 4IQEA 3U7BA 1DJYA 4F4RA 1OX5A 5LXEA 4B4FA 3CUIA 2HXUA 1OGSA 3OG2A 2WPGA 1AJ2A 2C13A 3T81A 2V82A 2IQTA 4RK8A 3URNA 2NLIA 2HK1A 5T8GA 3PWIA 1YXCA 1MUCA 4UNKA 1GHSA 4KFPA 4IPNB 5ABEA 1QXLA 5D2WA 3KVKA 1TREA 1BVWA 2PS2A 1JF5A 1K7FA 1POKA 1Q6QA 2V2DA 2ZDSA 2XGIA 3W6LA 1HGYA 1X1NA 4GYPC 3UZZA 1NH6A 1X96A 1MXDA 3HURA 4K6AA 1E0UA 1OGBA 3A64A 1KC7A 3BSGA 3FS2A 4C6NA 3ITOA 1O5RA 4UWMA 1WE5A 5L6UA 3BCDA 2DSVA 3R6IA 2C71A 4KH2A 4J3SA 5A94A 3R12A 3ZWSA 4AC1X 4DBEA 2BTMA 2RFGA 5TAOA 4Q8OA 2Y8UA 4UC5A 2FDSA 3CGTA 5HMEA 3TW6A 3VD9A 2WZEA 1VH7A 3NTYA 4HJFA 4I9JA 3WKZA 1VFHA 3UGVA 3MUAA 1BXNA 4O8RA 2Y63A 4R53A 2XVNA 3FJLA 4K7YA 3V36A 2PF8A 2PUZA 5AVNA 3QLDA 2A1YA 3NDYA 2I7GA 1P1XA 2Y89A 5MHBA 3ORWA 4CN1A 5D37A 5E5CA 2G50A 3EGJA 3GD6A 4JTDA 5CZSA 5CAKA 1SJCA 1JUEA 3MP4A 3GK0A 4QCFA 1WX0A 1REQB 3ARYA 3OOQA 3LYEA 3SW6A 2GVLA 3PFMA 1AW2A 5TBOA 2FZ9A 4QJ4B 1H7NA 3WLHA 3CMJA 1E40A 4B3ZA 3COTA 3NM1A 3WJZA 3NYZA 1EF2A 1TX0A 2AMGA 3MA8A 3GZAA 1K4HA 5HMSA 2I5QA 5ECUA 3TNOA 1JCMP 2C79A 4IIGA 3PUEA 2PODA 3S1XA 2X1IA 3EWXA 3APGA 4AY7A 5BZAA 4IH3A 5DBTA 2VTFA 1XYAA 5EYWA 3T2PA 2XH4A 1S1RA 3VCCA 4GG9A 2WSQA 2PWGA 1X6LA 5EMYA 3AUJA 3W6YA 5EBAA 5FSEC 4O12A 3T0CA 2A21A 1B0IA 3VX0A 3N4EA 3WN6A 3CWNA 1B57A 4QX4A 4TTGA 2BXYA 3QZ6A 3PWAA 4S1FA 4UQAA 3VIKA 4Q32A 3TN6A 1OYCA 1E1EA 1UR4A 2VEMA 4IFOA 1ONRA 4OOUA 3UCQA 1UH3A 1VCFA 2VZUA 5D2XA 4C1LA 4TV5A 3V1PA 4F0RA 3KDNA 2Y85A 2Y0FA 4N7QA 4G5DA 3ITXA 4JTLA 5FF2A 1A5SA 3B4YA 2V3FA 1Q8JA 3QGKC 4B3KA 3VINA 2F8QA 3NQFA 4XKYB 1DL3A 2BGNE 2ACUA 2YXGA 1HVXA 4PTWA 2PDUA 1IIGA 3D0CA 1PDYA 2FZBA 2ZUMA 3GSMA 3QFWA 2O9RA 2OSXA 3O8AA 3PB2A 1D3HA 1XBVA 4N02A 4HHPA 3W3OA 2J9XA 1CGUA 2YCEA 4GNVA 1KXTA 3JS3A 3VM7A 3VNDA 3VAVA 4H4IA 3TJLA 1UJQA 2PLKA 3W4RA 1EO7A 5DX7A 1WAUA 3DFSA 1PBGA 1XINA 3U0HA 3GG7A 2VM8A 4GX8A 1TA3A 2ALDA 2C14A 3Q45A 4WX2A 3IGUA 4BQ3A 5A8GA 2TYSA 1K3UA 2VEKA 3CHCA 1OD8A 1JZ6A 4L4PA 3AU6A 3RM4A 2A6NA 1UH4A 4XD4A 1F4HA 3RFAA 3RG6A 3H21A 3J7HA 4CNPA 2XVLA 2J4GA 1EJVC 1AJZA 4QS5A 4O11A 3PZQA 4Q8UA 2F38A 4LXFA 1YE6A 4L56A 3QVQA 2GPTA 4JNMA 2A4AA 4V27A 1EL3A 3V18A 3SRDA 4JTAA 5I3IA 2WXDM 4MNJA 1DJHA 3VE7A 2JEPA 5A8QA 3B8IA 1IV8A 1NELA 2D2GA 3ZR4A 2NX1A 3PZOA 1PZ1A 3W1XA 1HKIA 4DZ5A 5K2ZA 4YLWA 3GDBA 3SQLA 1U83A 4PRWA 3CJPA 1U1JA 4HK7A 4BKNA 2EGZA 4W8AA 1ECQA 2B7OA 3T09A 1W9DM 4ZENA 3STGA 5D02A 3MYPA 5A6AA 2E9LA 3FK4A 3HV8A 3GR8A 5A2CA 2BLEA 4CEUC 1Q7ZA 1R87A 5FJRA 4IMCA 1VB9A 4IFKB 3VNZA 1HO1A 3DFYA 1XCXA 3QC3A 4CD8A 3AHVA 4MAVA 5BW6A 4R7OA 1T8XA 7REQA 5DRIA 3TWBA 1MQQA 4XAFA 1GUVA 4PA8A 4W88A 4Z1DA 2F6KA 4EX4A 4NAFB 1OB0A 3G1AA 4GQQA 2FZDA 2FHCA 3MI2A 4HU3A 3CPGA 3EMCA 3L2MA 4EOUA 3MO4A 3DFHA 3FX4A 1O5KA 3UR5A 4C6KA 2V8ZA 1B4KA 1Y7VA 2VGBA 2J6XA 4KWOA 3SGGA 1F76A 1FFRA 3L2IA 3DFTA 1WDDA 4DJFA 1FCBA 3MSDA 1E6SM 3C61A 4GX9A 4KWSA 4I5XA 1ALDA 1ZB5A 3W2UA 4AZ5A 1OX4A 3KTCA 3AIRA 4IM4A 1LZOA 1BYCA 5I3FA 2DZTA 1DKWA 4HK5A 1VS1A 2PWHA 3V35A 3GW0A 3UYCA 4DO4A 1H4PA 3R89A 4NZ4A 3DFNA 2ZRZA 4E6MA 4C91A 2GUBA 3FKRA 1D7KA 1IXOA 3IK2A 4MYXA 1Q6RA 2C1HA 3OG3A 5BROA 1P0KA 3P8JA 5FESA 4LUIA 1J9YA 1VAHA 1MFVA 2INEA 2VENA 3N1AA 2VEIA 2Q71A 4YXGA 4B9ZA 1R3VA 4OIFA 4Q22A 4S3AA 1J0HA 3CO8A 1WDPA 4UQBA 1EPXA 2V69A 1FWGC 1ZAHA 3AYSA 4M82A 3W29A 4IQLA 4ZO8A 3BG9A 3PK7A 1F8MA 5AHEA 2RGLA 1WXJA 4J2PA 5AYZA 5BYWA 2EPOA 4WEVX 1LBMA 1C29A 3YPIA 4KETA 4IZGA 4HZMA 1PJ9A 1DIDA 1MW2A 3UU0A 3IEBA 1XH2A 4FPSA 1BG9A 1LP6A 3LSCA 1N2VA 3S1GA 3K5XA 4R3UA 3RNDA 4KBXA 5D2TA 3UFYA 2W5FA 4JNYA 1OFDA 2OYLA 2WKJA 3C0JA 1IGWA 4TR9A 5GVJA 5CZ0A 1R2SA 3HBLA 3RUBL 2BP1A 2HCVA 1XX1A 4KESA 3R8RA 1OFRA 4CQDA 3NQ2A 4CCEA 4U31A 4JL2A 2B7QA 3ZWTA 5A6BD 1DHKA 1ADOA 3AIUA 1XUUA 4RCXA 1JCXA 2BB0A 1LOSA 1Q4WA 1QOPA 3IRDA 3LCGA 3SIZA 3BW3A 2OWXA 3SBFA 1F6PA 3NL2A 1X1OA 1Z32X 4YTRA 1DWIM 3QW3A 4N9DA 2TAAA 3WL0A 5FF0A 1JPMA 1QNQA 2ISVA 4WDXA 2QF8A 2ZZ1A 4QE5A 1Y5VA 1LUCA 3EKZA 2OKOA 4KW2A 3WH7A 3NQCA 1H7PA 4F40A 4B15A 2DZWA 1QNOA 5DBUA 4JQAA 4UMBA 3W1QA 3DHUA 1DP0A 4O16A 4NZJA 1A3HA 2YZRA 4WSKA 1TRDA 2E67A 1XYFA 1X38A 1J2BA 4QNEA 2CITA 3ITLA 4C6OA 3QY8A 3KBJA 5AN7A 1TWZA 4LB3A 1NWTA 1KRAC 3BGAA 4FIQA 2ZKMX 4IXXA 3WQ6A 3VYLA 5BU9A 3ZT5A 2Y5JA 1FWIC 3DKLA 2YCKX 3AS3A 3PNUA 3HGRA 4RLIA 2PWVA 3HF3A 5FJOA 2BGQA 2PDWA 4US6A 2QT3A 5DCDA 2DT3A 4MWAB 1LL7A 2GWNA 5CQ1A 1SFJA 4JN6A 3W1UA 4F9JA 1ZCOA 3DGBA 5A6TC 1TZ7A 4WIWA 1UKOA 3VKBA 3O9NA 1SYTA 1Z9AA 4WUIA 5A6MA 3ITYA 1GT8A 1R9XA 4P61A 3TYUA 4L6HA 2PB1A 2C15A 1NOUA 3HQ1A 3EOSA 4QROA 3QPYA 4C1KA 5BXTA 5ABFA 1AQ0A 3WQ8A 3R0DA 4MWAE 5JU6A 2BXZA 3PR2A 3MWAA 4CCDA 1DQUA 2HNHA 3HMCA 3TXVA 1E4MM 3SIMA 1HFBA 1W8SA 2PF0A 5E0CA 1F05A 2OVLA 1WKYA 1YXYA 1X98A 4IL2A 2KAUC 3WUBA 3VOCA 1FP8A 1FP9A 2VUYA 2OGYA 4HSHA 4Z1AA 2PWDA 1G1YA 3P5ZA 1A5MC 2D3NA 2DH3A 3C5QA 1E15A 4ONVA 1J0ZA 4RR4A 1WKFA 1U1UA 2V5LA 1EWEA 2E6DA 1FWEC 3LLDA 5FAJA 5KZMA 3HG3A 4HPGA 4XZBA 3VA8A 3W74A 1OFAA 4XAPA 3NJ3A 1VCVA 3IAQA 4O28A 3TMLA 2C0AA 2R14A 3ZLHA 3R13A 4BZYA 2H9AA 1E9ZB 1CEOA 1NFPA 3GTXA 5CZJA 3SGUA 2OZ3A 1C8YA 4Z17A 4L80A 1X6NA 2FB3A 1SSDA 1NDWA 2CLFA 2HROA 3GIYA 5T91A 2GJNA 3AS2A 3T2OA 1A5UA 3N19B 3ATZA 1GZJA 3GIPA 2G3MA 1PX3A 2FH6A 4FF7A 2AL1A 3KP1A 3WLQA 3W23A 3NO1A 3S5ZA 3MWCA 3W2MA 1OZMA 5AYYA 2WJEA 3IPWA 4QTGA 4MMWA 4M6QA 2WCSA 3WO8A 1O12A 3IUDA 1E1FA 4DJDC 1OY0A 5IOBA 3VUPA 1L8PA 2NW0A 5K7JA 2J24A 2YJQA 1GQJA 2EG7A 2OSYA 3H7VA 1KTCA 3CHVA 2HK0A 1XL9A 2J78A 2RKXA 3GM8A 5DANA 3URBA 2OZ8A 2D73A 3H2CA 4A3UA 4M1RA 4GQRA 2ISFA 3TDFA 1YPFA 1UR1A 5HNTA 2R8WA 5I2UA 1ZBWA 2XN1A 3AYVA 3VNMA 4E2OA 4YWSA 3E1F1 1E4IA 2ZOXA 3VIPA 1LBFA 3DG7A 3VD3A 3STEA 4PCPA 3HPAA 3HQOA 2D23A 3W38A 3N6QA 4S3FA 4ZTYA 1Z7AA 3DECA 3GNXA 4JQ2A 5AHIA 3JZUA 1J18A 3BLPX 3W7LA 3SQMA 1TSIA 1XYMA 1BVNP 4I90A 3UERA 1E70M 3NZ1A 5D9OA 5KETA 3SM0A 3W01A 2XJ7A 5DCBA 1ADDA 4PN2A 3OLGA 5E70A 2WBKA 5HA7A 4XTDA 1W9PA 4MSSA 4Q4OA 2ZCGA 4GFIA 1XR2A 3H54A 5K4ZA 3KRZA 3TJXA 1CIUA 1SO6A 2O9PA 4X9SA 3NQ6A 2JKPA 2P3ZA 2PDQA 3QFEA 4DUWA 1VJSA 1XYCA 2PC8A 4XO7A 3E12A 3U2ZA 3GDMA 3LCLA 2YGYA 4RV8A 3CPUA 3LV6A 2VQUA 5DELA 3ZVHB 4A8RA 2Z7GA 4UR9A 1FWBC 3IVTA 3T08A 4HCHA 3EOOA 3KDOA 3LXCA 3PB0A 4MKNA 2X0YA 3MMUA 2DW7A 3B97A 5DT5A 2DZVA 1TVPA 2CBVA 3UY7A 3RF9A 3NL3A 1XS2A 1RLCL 1OABA 2GUYA 2H3BA 4E8DA 4GZIA 4LVFA 4NT0A 4WDTA 2OB3A 5BOOA 1R2TA 2YCLA 4LBUA 2ZYFA 3OIHA 2Q01A 3VKAA 3EWDA 2TMDA 3QN3A 3UNDA 1Q85A 2ZXQA 4MPQA 2I9EA 2I17A 3NL6A 3GC4A 4MPKA 1WZLA 4GCAA 3HJEA 4R33A 4A4AA 5H8PA 3DAQA 1EP2A 2DSWA 4D6GA 5D2VA 5BNKA 3THQA 1C9DA 3I6EA 2R91A 4Y9AA 3GDLA 1UD2A 3IIVA 3CUXA 4QAWA 3WMSA 1TJ1A 4RV3A 1ISXA 4L6DA 2X0HA 1BQCA 4L1GA 1NDYA 3F5KA