4UQ9A

X-ray structure of glucuronoxylan-xylanohydrolase (xyn30a) from clostridium thermocellum at 1.77 a resolution
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
390
structure length
390
Chain Sequence
HMASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTEVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Ruminiclostridium thermocellum
molecule tags Hydrolase
molecule keywords CARBOHYDRATE BINDING FAMILY 6
total genus 138
structure length 390
sequence length 390
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uq9A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uq9A02
2YA2A 1K6AA 3BUBA 1ISVA 3VDCA 3ZJ8A 3EJRA 4D71A 4FLSA 4M82A 1LJYA 2WANA 1G1YA 2GSJA 1RPKA 4MB5A 2V3FA 1DWAM 2G3NA 4QCFA 1GOMA 3WY2A 5I6SA 4P7LA 1VRXA 2PWFA 4V2XA 3I3DA 4AZHA 3GBDA 3MUIA 2JE8A 3HG3A 3OLDA 1LG2A 1OINA 2OSYA 4ATWA 1CXFA 1KWKA 2VX5A 3B9AA 4AD2A 4LX4A 3K1DA 2RGMA 3AYSA 2WXDM 4DM1A 3OLIA 1J9YA 5CGTA 3VIKA 2FHFA 1G0CA 1C92A 3BUQA 1CXIA 4JAWA 4F79A 1MFUA 4W7UA 3GXTA 1C8YA 1BVZA 3SCWA 1E71M 4AD0A 1M04A 2O92A 2CYGA 1FH9A 2WB5A 1HXJA 1JI1A 4AIOA 2ZOXA 3AI0A 3AMDA 1E1EA 1OT1A 3EDDA 2HISA 1RD6A 4JKKA 3WD1A 4MPKA 2VVSA 5BRPA 2X05A 1HP4A 1E4NA 4ATLA 5CSUA 1GONA 2DSWA 1UASA 1CXHA 1BYAA 2DIEA 3T0AA 4JFTA 1QI3A 1Q6FA 2E9MA 1UD8A 2UWFA 4GKLA 1X1NA 5AC4A 1V08A 1MXDA 3FNDA 3FN9A 5M03A 3WH5A 1OIMA 1KGWA 4CU8A 3UR7A 1W91A 1HNYA 3T0BA 2A3CA 3VO0A 3ZT6A 2W92A 1A3HA 1JD9A 2BV9A 2V5CA 4GI9A 1JZ4A 4MNJA 2PWDA 4OBSA 4AZBA 3MUZ1 1R85A 3HU7A 4QLLA 3D4YA 1WZKA 3WF1A 3L4ZA 3A4WA 1GW1A 1B2YA 5HPCA 5LYRA 2J79A 2WYSA 1CBGA 1WDRA 2VZUA 1R7OA 1EDGA 1V6WA 4GQRA 3UEQA 1VBUA 2WVVA 4EANA 3NDZA 2F18A 1KCLA 1V02A 2VCCA 3CH9A 5CZKA 1J01A 3ARRA 1TZ7A 4DUVA 3SUVA 2CHNA 3ZJ6A 2PF0A 1FFRA 2J7EA 1B3YA 2WMHA 2GJXB 4EE9A 5I5RA 2BXZA 1HT6A 3BVUA 5DT5A 3OGVA 1MW0A 1E55A 3A3HA 3DYOA 1KR1A 3SCUA 4WSJA 5CGMA 4GO9A 1PJ9A 5E0FA 1MW3A 3H54A 5KEZA 1Q4NX 5CSYA 4CD8A 5I0DA 2ZICA 3GH4A 3WMCA 1M53A 4D6CA 5CLWA 1ZB5A 4A3YA 3AIBA 1JAEA 1UQZA 5JIWA 4W8AA 3WEMA 2GUYA 1Z32X 1C93A 3OLEA 2GK1A 4D6GA 1UKQA 2BVYA 1JXKA 1KR0A 1JD7A 3KWXA 1XH0A 4CD4A 1BSIA 1KXVA 4PTMA 3BUIA 2V3DA 3UESA 2E40A 2WM0A 2D2OA 4M8UA 3BLKA 2DSVA 3E1F1 1R87A 1DWJM 1V6UA 4AWEA 4P7QA 3GXMA 1LL4A 2GJPA 2X1IA 1B3ZA 3PTMA 2YL6A 4FK9A 2JEQA 1X6LA 1Q6GA 3MKKA 1BVNP 1R46A 4FF5A 5JBEA 1TCMA 5C8BB 2J75A 1ESWA 1TQTA 1NH6A 1JAKA 3NSNA 1KB3A 3SCNA 3DDFA 3ARUA 3AHYA 3G6LA 2CETA 2EXOA 1JFHA 2G8ZA 3A6OA 1HJXA 2VVNA 3VM5A 3VMNA 1V02E 3BVVA 3BSHA 2JALA 3PHAA 3EJPA 4CU6A 1JYNA 4NI3A 1BG9A 4NX0A 3VSTA 4TX8A 3SCRA 3DX4A 5CJ5A 5E0CA 2O9RA 4B9YA 1HVQA 1H41A 5CG0A 3CHFA 3SUSA 4E8CA 2XIBA 3KE0A 1UR4A 4CKQA 1V0LA 1F4AA 2GDVA 2J8FA 4ZE4A 1J0JA 2VZSA 2WZHA 2Y4SA 4P7RA 2BNJA 3EDFA 4JFUA 4FLOA 4X9YA 3K8MA 2YDRA 1AQ0A 2WPGA 3DC0A 3WN6A 5D9MA 4BA0A 5D9NA 3AHVA 1ISXA 1E1FA 2ZUWA 3N9KA 1OWQA 1TE1A 3VIHA 1QNQA 4AD3A 3UG5A 2F7RA 1JZ2A 1TFVA 2WLZA 1ZJBA 4AIEA 2OW7A 1PX3A 4MNMA 4GQQA 1V6YA 2PWGA 1XCXA 2G3MA 3TTOA 4URIA 1QOXA 2DH3A 5ABGA 5CLTA 2D20A 5JBDA 4Z2LA 3D50A 1QW9A 3BXWA 3S5YA 4W7WA 1W9PA 4LPCA 1UR8A 5A6JA 2XN1A 2WMIA 3RDKA 1QNPA 1VEOA 4B3LA 4AC1X 4UFJA 3CTTA 1ODZA 1LLOA 5EFDA 2VUYA 3LXCA 4UTFA 1V0KA 1E70M 2DGAA 3KL3A 3SUUA 5A8OA 2VTFA 1ISWA 1OT2A 1QNSA 1E0VA 1EOKA 3A47A 4M81A 2NT0A 3VD9A 4A4AA 1V6XA 1QHOA 2WMFA 3SCVA 4TTUA 1ZBVA 4DWSC 5DEZA 4GXPA 4HZ8A 3ARVA 3ARTA 4V27A 3D5HA 3BVTA 2GK1B 3LXAA 1QI5A 3VU2A 4D72A 2OSWA 4DO5A 3CHCA 2WMGA 4CD6A 4OJYA 3DX2A 2BVTA 4F66A 2XM2A 3ZR6A 5AY7A 3WF4A 4PMYA 1LG1A 5A6SA 3VDBA 2FE0A 2WZIA 4JKMA 1UKPA 3IJ9A 3L2MA 4PSPA 3F5LA 1BGGA 3GDBA 4HOWA 3WH6A 3F5KA 3HZ3A 1J0KA 3BMWA 3I3EA 2EAEA 4AIUA 1FP8A 4AZIA 4OGZA 2XGIA 4JKLA 4M29A 4U5KA 3VPLA 3WDPP 6TAAA 2JIEA 1IZJA 3WELA 1T0OA 1V3MA 2CESA 5BYWA 1BAGA 5GNZA 2XFFA 2J74A 3IK2A 1H5VA 3WDQA 2VJXA 1FH7A 4PCTA 4LYPA 6CGTA 3ARXA 1TVNA 5JBFA 1X6NA 3DDGA 5I77A 2J7HA 1HJQA 3ZQ9A 3GYCA 1E0WA 4DO4A 1EOMA 3ZM8A 3DX3A 2QLYA 1XD1A 1UWQA 3WDHA 4NXSA 1WZMA 2NSXA 3FXYA 3W25A 1A47A 1JYWA 2VZTA 4YHGA 4JCLA 1ZBCA 2ZXAA 3WNOA 1CGWA 1NP2A 3SCOA 3GXFA 1MQQA 2X2YA 4BQ3A 1E6PA 1R47A 2V3EA 3WNPA 5LA2A 3CLWA 3WQ4A 4ML4A 2ALWA 1MW2A 3L4VA 1GHRA 1PIGA 1KGUA 5A8NA 3WF0A 3VGFA 5A69A 3MMDA 2O9OA 3EMZA 1QNOA 5ABFB 4CCDA 2PWEA 4XV0A 1CXLA 5A6BA 2EABA 4MAZA 1JDDA 4W93A 1XYFA 3WDRA 5D9PA 3WD2A 4HMDA 1PBGA 3VGDA 4HTYA 2UY2A 3K4DA 1KBKA 1R75A 3VD7A 4D6IA 2W5FA 4EKJA 3O2LA 1WCGA 3DX1A 3AHTA 3OGSA 1S46A 3W24A 2JF7A 2Y8KA 4P7NA 1K9DA 3GZAA 2D22A 1D7FA 4Q7NA 2F2HA 2WVUA 2VL4A 4PMDA 3GXDA 1E4LA 2HVMA 1H1NA 5CQ1A 2EADA 3BCDA 5D9OA 1ZS2A 2A3BA 4PBGA 2CEQA 4J3VA 1UWSA 2A3EA 5DMYA 2F61A 2E0PA 4AD4A 4WSKA 3VIPA 1FP9A 2ZIDA 2PWHA 1E43A 3ECQA 4B15A 1JDAA 2VT0A 3B9DA 3CUIA 4KGJA 3EDKA 2OSXA 2Q8XA 1UUQA 4ZXOA 3NYDA 3N17A 2ZX5A 2XSAA 5CPTA 5D8WA 3OGRA 2VCBA 1K9EA 3GH7A 1B31A 2F7QA 3H55A 1UYQA 1MW1A 3HG5A 2E8YA 2D1ZA 3WEZA 3WY4A 8CGTA 2G3JA 4J7RA 5CXPA 1G01A 4HOZA 2BXYA 3QGVA 3KZSA 2ZX6A 5BWFA 5C70A 3VIJA 1R8LA 1WDPA 3M6DA 2Y2WA 3PZGA 1E6XM 1XSJA 2YA1A 5FIPA 4AYSA 1FOBA 5A94A 3CIVA 1ITCA 3TONA 1PEZA 2Y24A 1QHZA 3AXIA 4UZSA 1XYZA 5E9AA 3AIEA 1HL9A 4LGXA 1VBRA 1B0IA 2D23A 5HDRA 1CPUA 2XVNA 3CZSA 2YDSA 1KQZA 3CHEA 1GOKA 4E2OA 4PTVA 4AD5A 2IGTA 7TAAA 2CBIA 2IXUA 3BGAA 1TMQA 3LRLA 1CTNA 1W9DM 4D1JA 1CGUA 4UFKA 5HBFA 1F4HA 1FA2A 2X2JA 4CCEA 1NWTA 4HMEA 3O9NA 1SFSA 3IANA 3RM8A 3VINA 2IUZA 1NARA 3WY1A 1QBAA 1WKYA 3W6MA 4JFSA 1JNEA 3WQ5A 5IFTA 5CPSA 2CKRA 2XM1A 3GXPA 3BUDA 1E9LA 4HPGA 3GXIA 3AIRA 2BHYA 3AZSA 3EJQA 1U30A 3D4ZA 1C8QA 3M7SA 1OGSA 1UR1A 3QHMA 3W28A 1KXHA 1E6QM 4RE2A 1XSKA 4HA3A 3SUTA 2J7FA 1H4PA 3WNKA 1YHTA 1Q6EA 1VJZA 3MV11 4U2YA 1TA3B 4KMQA 1UD5A 3UG4A 1TQUA 4PCSA 3WQVA 4AZCA 2E9BA 4H2CA 5BRQA 4Z2KA 1GOOA 4IISA 1FHLA 3VDAA 4C7FA 1GHSA 4NSBA 3BAXA 4NZCA 3RJXA 3VIGA 4MDOA 4N42A 3AIWA 3VSVA 1LL6A 1WNOA 1OIFA 3AMCA 3PZVA 3ARWA 4J3UA 4MJ4A 1C7TA 2X2HA 4OUEA 2WBKA 4XZWA 5C71A 5EB8A 4OOZA 3D3AA 3ZMRA 1NOUA 3SUWA 5A8QA 5I3DA 1US2A 3WKZA 3A22A 1CIUA 3M07A 2Y8VA 1UH4A 1IT0A 3WIJA 4DWSB 3MV01 3QOMA 4JIEA 5LA0A 3TP4A 5A6AA 2E9LA 2VNCA 2EACA 3EJUA 3BLPX 2ZUNA 5DT7A 3CPUA 1PPIA 2WHMA 1R34A 3SEPA 4QLKA 1NWUA 1TQSA 1AVAA 4AMXA 1C3FA 3ARQA 3SCSA 4TOQA 1B3XA 2UY4A 3CZJA 2C7FA 2BHUA 3VM7A 1CGXA 4LXFA 4S3JA 3ZR5A 2QV4A 1UA3A 1TUXA 2WNWA 4GI6A 2DEPA 3CZ8A 4XUYA 3AS3A 2ZUSA 5I78A 4V28A 1J0IA 4MB4A 3RILA 3B8SA 1IV8A 3DX0A 1G5AA 3N12A 4AZ6A 2ZUVA 5FOOA 3LPFA 1XH1A 3CZEA 1E56A 1W9UA 2J7GA 4PMUA 4H8UA 3T09A 3FY1A 4TTGA 3POCA 4MADA 4BQ4A 3VX0A 4YHEA 1E40A 1HX0A 3VGGA 2OYKA 2VO5A 2O9PA 5E09A 5A3HA 1EHAA 1VEPA 2WW5A 1W1VA 2J25A 3VIIA 3OBAA 1UWTA 2UY3A 2JIWA 3SCQA 2QPSA 2WZEA 3WUBA 3BLBA 3VSUA 3DYPA 1UWUA 3CGTA 3PZOA 2CCRA 2GVYA 1ZBWA 1W9VA 3GNPA 4CCCA 2J4GA 3KL0A 4UCFA 1H11A 3LMYA 4PMRA 5EMYA 4P8VA 3VMOA 4TX6A 1MYRA 4AMWA 2XGBA 3DHPA 1V03A 1OCQA 4H7VA 3VIFA 3WUFA 2E8ZA 4WK9A 4MJ2A 3U7VA 3UETA 2VX4A 1VJSA 3VD5A 3BC9A 2VZOA 3CV5A 4J3WA 2FDMA 3CO4A 5FL0A 2WC3A 3WQ6A 4Z2GA 2WVVB 2WHLA 1I1WA 1RH9A 3WY3A 5DF0A 5FL1A 3QHNA 1NWSA 4J3TA 4WF7A 3MU7A 3SCTA 1E6SM 1UKSA 4GI8A 1TQVA 1U33A 4DO6A 8A3HA 4HU0A 3WF2A 1V3JA 5A6LA 2V5DA 2VX6A 1ZJAA 3IAPA 1J12A 2J78A 2DT2A 5EBAA 3NIYA 1W1PA 3AS1A 1DTUA 5BXPA 5FCZA 1SMDA 3FHAA 1EQCA 3A23A 1JZ8A 1AQHA 4CD5A 1LF1A 1CXKA 3WD0A 1D2KA 5M5DA 1ECEA 1UQYA 2W91A 2XHYA 4RE3A 3S6TA 3VD4A 3CZGA 1EDQA 1GJWA 1TQWA 2WKLA 3HG4A 2WHJA 2D24A 1WAWA 3CBWA 3PZNA 4CN1A 3AFBA 1VENA 1E0XA 5TD4A 1VAHA 2CBUA 1Q6CA 3N13A 2XPKA 3LPGA 4BQ2A 1E6NA 1UH2A 1PX4A 4PTWA 4E4PA 2ZXBA 5A8MA 3WEOA 1JZ3A 1HVXA 3T2PA 2BS9A 1PX8A 2F8QA 5BXTA 1EXPA 2BVDA 1HKIA 3WSUA 4H8HA 3VILA 3CUGA 1LWJA 1GQLA 3PZTA 2CHOA 5I79A 5A1AA 1AMYA 2CKSA 2XG9A 1CDGA 2XYLA 3NJ3A 3WMBA 4C7DA 4CVUA 1VEMA 2YKKA 1FHDA 3L4YA 4OBRA 4AXNA 1EIBA 5A2AA 3EMCA 4MTVA 2ZUUA 1C7SA 2WSKA 1W3KA 4UQDA 3BVXA 4AY1A 2XVGA 1HWWA 2BY1A 1BHGA 2B31A 5GNXA 1WZLA 2EPOA 1R86A 4PUDA 3OZPA 4UQBA 3HJEA 3PZQA 1HJWA 3QHOA 1BLIA 2EEXA 1KBBA 4ACZB 3LPPA 4S3KA 3WNNA 4GINA 5I24A 1B30A 1GOWA 4CVWA 2AMGA 3BCFA 1EQPA 4UFLA 1CNVA 4GZIA 5LA1A 1MWOA 4HPHA 3KLLA 1O7DC 4BCEA 4IPLA 1XCWA 3TOPA 5A2BA 5D8ZA 2W62A 2E3ZA 3OLGA 4PMVA 1QW8A 2YBUA 5HXMA 3MUY1 2JF6A 3T2OA 2PB1A 3WNLA 4LQ1A 3TV8A 3UR8A 2QF8A 1DP0A 3AHZA 1WB0A 4PSRA 1CLVA 2WMKA 1BFNA 5BCAA 3VOCA 3BAIA 1W1YA 4WKAA 4W7VA 2YLAA 1QI0A 2D3NA 1LWHA 3ALFA 3AIQA 5CPQA 7CGTA 3SURA 1PAMA 3L4UA 4JFWA 4J28A 3RIKA 2MANA 1GNXA 2WMJA 5HNNA 4A3HA 5IHRA 1Q6DA 2G4FA 3F4VA 4U33A 7A3HA 4UFMA 1KTCA 1QWNA 3VGBA 5IHSA 3CZLA 1OBAA 5BROA 3OZOA 3THCA 3EDEA 3W38A 2WHKA 3WMSA 1J11A 4NZJA 4FLQA 4UZUA 3AS0A 4AISA 1E4IA 4PMXA 3RM9A 4ZE5A 2UY5A 3FAXA 2OWWA 4LYRA 4DWSD 3ARYA 1JG9A 3BUPA 1UD3A 3ARSA 4L4OA 1ODUA 4AYGA 3L4XA 4R5EA 2D0GA 2ZXDA 5D4YA 3IJ8A 1HKKA 3N04A 4ZEPA 4UFIA 2VQUA 3LPOA 1W3LA 4JHOA 4GPNA 4N0RA 4R27A 3PN8A 4J27A 4JL1A 3GH5A 4UOJA 2E4TA 2Z1KA 4JCMA 2PBGA 4W85A 3W4RA 3AXHA 3A21A 2X8RA 1QX1A 3VNZA 2ZWZA 3EDJA 2PI6A 1DWFM 3G6MA 4OZOA 4FNPA 3WFLA 4NRSA 3OG2A 4CD7A 2VOTA 3LXBA 1ZL1A 4W8LA 3MUAA 3U5UA 1CEOA 3HG2A 2GJRA 1Y7VA 3PZ9A 3AMLA 3MSDA 5A95A 4W86A 3WD4A 1RP9A 4UR9A 3T2QA 2FGLA 3VGEA 3W53A 4M80A 3DHUA 1QWUA 3U57A 4Z2HA 2XVLA 1U2YA 2WVSA 4MB3A 1K9FA 1BG4A 3ZSSA 3AHXA 2VR5A 5HOSA 4EAMA 5IDIA 1QI4A 1O7AA 2WWCA 4KGLA 5GPRA 1P6WA 1LL7A 1TG7A 3L2LA 4ATDA 6A3HA 1NWRA 5I23A 2IXVA 3ZIZA 2J7CA 2YDQA 4QDMA 3BSGA 5IXEA 1EO7A 1OSEA 1FFQA 4RE4A 2J7DA 1SYTA 1H09A 3AQUA 3D51A 2CERA 1E3ZA 1JZ6A 4AZGA 3GBEA 4RL3A 4L4PA 4NXKA 2XN0A 3PZIA 3VVGA 3M46A 1VIWA 1KWGA 1ZBKA 3CMGA 1KCKA 3WQ8A 1GVYA 1UH3A 3AJ7A 4AEEA 3ZOAA 4MDPA 2F1AA 2PC8A 2FHCA 1E6RA 5M17A 1OGGA 5DO8A 4DUXA 5E70A 5IFPA 4PEEA 1HP5A 5HPOA 3PZUA 1L8NA 1SMAA 4WKFA 3BH4A 1PS3A 2W67A 4ACYA 3TTYA 2VMFA 2NT1A 2XUCA 1V3LA 2EPLX 2YJQA 3D52A 4NZFA 1JF6A 4FLRA 1JYVA 1R33A 1J0HA 4DUWA 1XD0A 5A6MA 2YFOA 2X2IA 2Y5EA 1M01A 1JDCA 3WL0A 4W88A 3AYRA 3EBVA 2X09A 1CGVA 5E6YA 2CBVA 3AZTA 1CGTA 3OIHA 3VIOA 2A3HA 3CZKA 3WFZA 2AOSA 4W5UA 1NM9A 4TXEA 3U7BA 1HJSA 3EMQA 1XHGA 1UG6A 1C91A 5GQBA 3HMCA 3VD3A 3NSXA 1GQIA 1CWYA 2WAGA 1J0YA 4M1RA 3AIUA 3ARPA 2WK2A 3RJYA 3J7HA 2OYMA 3N11A 2F7OA 3NUKA 1VB9A 1V3IA 2XVKA 3W81A 1EA9C 2QMJA 5ECUA 1FH8A 2TAAA 3TA9A 3N18A 1H2JA 5GNYA 4AEFA 3BAWA 3T0DA 2FH8A 4WKHA 5A6KA 2ZX7A 4ZFMA 1RP8A 5E6ZA 1W2VA 2QPUA 5JIPA 4FNRA 3S2CA 4P7OA 4F9JA 2ZUTA 1OGBA 2DT3A 1MVYA 3VIMA 4JZ5A 4U2ZA 1GOIA 3BAYA 1OD8A 3AISA 5A6BD 4J3XA 1W2PA 3AIVA 1HF6A 3WDIA 2WCAA 2ZX8A 4JL2A 5JUVA 2CIPA 1E6ZA 4F9DA 2F7PA 3H53A 3WDJA 3NDYA 4LYQA 4YN5A 4Z2IA 2DT1A 4W5ZA 4MB1A 2WKGA 3RPMA 1V3HA 4GIAA 1UKOA 3GNOA 1TVPA 1DWGM 4YPJA 3MS8A 2JFEX 4HZ6A 2RGLA 4WJXA 3B9EA 4CU7A 3RCNA 3EJSA 5AC5A 1PZ3A 2OW6A 1KTBA 4TVUA 4UFHA 5ABEA 4HU8A 4AMCA 3K8KA 1JYXA 3BVWA 1QHPA 3EJTA 2BFGA 1UZ4A 1W3HA 3TTQA 2CXGA 2DSKA 4M24A 3ARZA 3NCOA 2XFYA 2V38A 3GXNA 3WL1A 2DIJA 3CUJA 1HN1A 1XSIA 1W9XA 1BTCA 3SCPA 3AZRA 1MQRA 2DSZA 2DH2A 4D6HA 3CUFA 5ABFA 4JHZA 3IGUA 2XWEA 1DHKA 2EPKX 1CXEA 1EGZA 1PIFA 3MMWA 1E15A 1E4MM 3RMEA 3VDHA 3A24A 2VRJA 3BMVA 3ZJKA 4NF7A 1UWRA 1C8XA 1EDTA 3DYMA 3WBEA 1E72M 1OM0A 2ESCA 2D73A 5BXSA 2XN2A 4B3KA 1B1YA 3OA5A 3ZJ7A 4UQEA 1NOWA 2WCSA 4IM4A 1XRVA 3ALGA 1BGAA 3PTKA 4H04A 1DWIM 1UD4A 4MAVA 2VRKA 1GQJA 3WUGA 2X0YA 3WH9A 4U3AA 3KEHA 2XJ7A 4IUGA 2QMKA 5ABHA 4FMVA 3VX1A 3I3BA 3WBAA 4Y7EA 3CMJA 4DWSA 4AW7A 4KRTA 1KQYA 3BAKA 1AQMA 4QP0A 3LRKA 5BXRA 5M3WA 4QCEA 4M56A 4UOZA 3WUEA 4P8UA 2WBGA 4WIWA 2OYLA 2WSPA 1IZKA 1H0GA 3A4XA 2VR4A 1V0NA 2FYVA 2ZWYA 3AXXA 3W0KA 4CN6A 2CITA 4KRUA 3K4AA 1XC6A 1UHVA 2OWCA 5DFAA 1UR9A 2C8NA 4PMZA 1CLXA 3N1AA 4F8XA 1TR1A 4JFVA 1QNRA 2DQXA 3L4WA 5KZ6A 1B9ZA 2GFTA 2WMIB 4XB3A 2G3IA 4AZ5A 4PMOA 4UQCA 2WC4A 2WLYA 4PUEA 4AD1A 4OOUA 3VGHA 4B9ZA 1UR0A 2GDUA 4C7GA 2CBJA 1HIZA 2EPMX 4D1IA 1HXKA 2V3GA 3SIMA 1VFOA 4PTXA 3W6LA 1JZ5A 3GTNA 3AROA 5AYIA 1H49A 1D3CA 1M03A 1BYDA 1NP0A 2J62A 1XV8A 3WENA 3AS2A 5FD0A 4E8DA 1GVIA 4H8VA 4QAWA 2VZVA 4PYSA 2EQDA 1DEDA 3O6AA 2XVPA 1J10A 4BZYA 1GJUA 1CZ1A 2ZE0A 1E5JA 1WP6A 4PN2A 2XSBA 1HJVA 1PZ2A 4HA4A 4FNQA 4K68A 4HOXA 4CN4A 4UOQA 2YOCA 1GORA 4BF7A 3ZSTA 2JEPA 3A5VA 2J8GA 3WF3A 4H41A 4Q22A 2YL8A 2DSUA 1UKTA 3N15A 1BYBA 1GOQA 2OLHA 4W8BA 4WLCA 2DT0A 3KL5A 3S5ZA 3ZO9A 1W1TA 4U31A 4UNIA 1TA3A 3APGA 4HA1A 4AZCB 3W26A 1HTYA 2W4XA 1QBBA 4ACZA 2DDXA 4HMCA 1BF2A 2EJ1A 4D6JA 3CHDA 1E73M 1OB0A 1I75A 1M7XA 2AAAA 1H0IA 1G94A 3W37A 2GJXA 2XWDA 1QI2A 3VTRA 4X0NA 4D6EA 1CECA 1C90A 1MQPA 4FNTA 2X0HA 3AICA 2D0FA 1WO2A 4TVCA 4D6FA 1ZU8A 3FW6A 5F7UA 2J77A 4X0VA 2VQTA 3RM4A 4CGTA 3U5YA 4GO8A 3JUGA 1JZ7A 2PBOA 2WCGA 2YA0A 1J0ZA 3IAQA 3IJ7A 1JI2A 3ZT7A 3WH7A 1K9TA 4BQ5A 3II1A 3VNYA 4QLJA 1CGYA 5AYBA 3PBGA 3CUHA 4UQ9A 3WQWA 3POHA 2YLLA 1HKJA 4TUFA 3OB8A 4XX6A 5I2UA 3PZMA 3VUPA 1BQCA 1JGIA 2W63A 4TVDA 1DWHM 5E1QA 1VFUA 1UZ1A 2WC7A 2W61A 1WDQA 1US3A 4GZEA 3LX9A 2ZXQA 3CC1A 3FHQA 4GZJA 2YL5A 3W82A 3AMKA 1JIBA 5EFFA 1O6IA 1VFFA 4B16A 1V0MA 1B90A 1VF8A 1JL8A 2BY0A 1W9BM 1JXJA 2QHAA 2OWXA 1UD2A 2O9TA 3F5JA 3THDA 1W3JA 3BAJA 1L0PA 1GZJA 1ISZA 1WDSA 1UOKA 4P8WA 1EH9A 1HL8A 4DM2A 1CYGA 2BY3A 2W66A 3K46A 2WVTA 1E5NA 2ZUMA 2J7BA 3KLKA 2F1BA 4P8XA 3WD3A 1R7AA 2VX7A 3FAWA 3HN3A 1SR0A 9CGTA 4ZENA 3ZT5A 2EPNA 2YBTA 1NOFA 1WPCA 4QFUA 3RO8A 1EO5A 3UERA 4D6DA 2FH6A 4ZXLA 3PTQA 2C0HA 1UA7A 4PRWA 1HJUA 1G9HA 4OIFA 4FNUA 4FNSA 2EBNA 1GPFA 3MO4A 4KWUA 2XTKA 2XFRA 4J3SA 3WNMA 1QVBA 2EO7A 1JFXA 2YFNA 1OD0A 4W84A 1KXQA 1UD6A 4UQAA 1NQ6A 1WE5A 4U3CA 2J47A 1XH2A 2BY2A 4U5IA 3GNRA 3MANA 3MMUA 2YIHA 3T08A 1VFMA 5A8PA 2G41A 1WZAA 4OKDA 2Z1SA 1E3XA 2CNCA 3AMGA 4HZ7A 2BHZA 2WWDA 4IPNB 1SZNA 2VRQA 3GM8A 3K8LA 3MSGA 3UCQA 3DECA 5A2CA 3WH8A 4PMNA 2D3LA 1CENA 1ISYA 4KH2A 1B3VA 1LQ0A 2YL9A 5FKYA 3A4AA 4MNLA 3NSMA 4AZ7A 2A3AA 1QPKA 1GUVA 1I1XA 4EK7A 2VI0A 3QR3A 3AOFA 3VMPA 1N82A 3W27A 4W89A 1UWIA 2DPEA 1GCYA 2CPUA 3UG3A 1UR2A 1KGXA 3CZNA 1V6VA 2FHBA 1GQKA 1KXTA 2NW0A 4MNKA 1KFWA 1HKMA 1EHNA 3TTSA 2XIIA 1H3GA 4HP5A 4Z2JA 1J18A 4XZBA 3L4TA 1BPLB 4PMQA 2VC9A 2D0HA 4BS0A 1MXGA 1XGZA 1W32A 3EYPA 3LRMA 4NRRA 4W87A 1V3KA 1JF5A 2VCAA 2FGZA 3W29A 1ITXA 1B3WA 3VKKA 1JNDA 3MI6A 4CUCA 2ZX9A 3QOKA 1YQ2A 2VURA 1MFVA 1BYCA
chains in the Genus database with same CATH superfamily
2HTKD 2YA2A 1K6AA 3OWRA 5D93C 2WKOA 3FEQA 4U1NA 4JZOB 5E5MA 4PJ5D 1G6RL 1W5OA 3N3EA 3EH2A 1WCBB 4FLSA 3TWCH 3S4SG 2CPCA 5DS8B 2ZVRA 4YE4H 3PSVA 3R94A 2XIDA 2XG5B 2YRBA 1RPKA 4HNLA 2YAEA 1JV2B 2JKIS 4O1EA 2VAAA 3RPTA 4ZFFB 2DD8L 5CD3A 1DWAM 1H7XA 5FW6A 4KEVA 2BOCA 4PUKA 4P7LA 4LY4A 2VZ1A 4K94H 3PL6C 3ZE1F 2WO2B 1TPFA 1V7YA 1VF5C 2TSBA 4LUJA 3WFEL 4H9VA 2FDSA 3CX5J 1M05B 3MTXA 4UZGA 5I17A 2WLLB 4BXSV 3E2VA 1LWRA 4P46C 5HPMB 4ZB5A 2XU9A 3OD3A 3NZGA 2N7SA 3OLDA 3PNRB 2ETWA 1BIHA 1CBVH 2APSA 3FTXA 4QTIH 5T1LA 1CXFA 4K71B 5T1KD 4KRMB 3GIPA 3EH4B 1FUYA 4DVBB 3NQEA 4AD2A 4X8JB 5D4HA 5DQJA 4YWGH 4HGKC 4AQ8A 2WXDM 5J6GB 2BNRA 4DM1A 3OLIA 4FMFA 3CUPB 1MUMA 1LNUA 1WDAA 3HJZA 2R4SL 3CJJA 2YPLB 3LB6C 3QFEA 1RIHH 4RZ6A 3NRFA 1G0CA 3QJFA 4HTBA 3GO1H 5H4YA 3LLDA 4I85A 1F8TH 1VGKA 4BFRA 2R59A 1ETB1 4MD4B 4LCCB 1JPST 1OLLA 2X38A 4QBXA 1P1VA 4F79A 4FZ8H 4RLDA 2OJZL 2IKHA 5BV7B 3OX8B 2X9YA 2X42A 4IOTA 3PIQB 3FA3A 1M04A 1CZ8H 2GDQA 4URKA 3EKGA 2WJDA 4R5XA 2CRIA 3C2AH 2G9HA 1P69B 4AIOA 3W11C 2ZDSA 3UWVA 5CZXD 5E2UL 4WD0A 1ADQL 1E1EA 1FI8C 2VR7A 3F5WB 4YK4B 4OFDA 4QHUB 1U21A 1BJMA 2A7PA 3PP3H 4MQXC 4YE0A 5EU3B 2JJSA 2NZ1A 3HRZC 2HG0A 4DF9A 4ETQB 4ZFOL 5HNTA 2DYRB 1TR7A 1NPUA 2YPVH 2NR6A 4MVAA 5CSUA 1BXAA 1R17A 3NJFA 1FDYA 3IB4A 2BWGA 4LVBA 4A3UA 3VH8A 1BQSA 4H9XA 1FWRA 2VGBA 4AQAA 2OAAA 2A79A 4XN9A 3A3WA 3RTQB 2IAMC 4QRBA 2WZ0A 4MNQA 1BPVA 5CBJA 5B3JF 1BSLA 3DJ9A 3LBMA 2ZCHL 3OVQA 3GIQA 3FTSA 3HC3H 4H5SA 4P9HH 3NSYA 5I8KH 3QXTA 4UMGA 4HG4K 1SDDA 1WKFA 4XVDA 4JFTA 4G7SB 4MD5B 1QI3A 3K5XA 5MKGB 3KGRA 3I10A 1WBZB 4PP1D 5KVMC 3VC5A 3BYYA 4EDXA 1X5AA 4GKLA 5IK3A 7FABL 1V08A 3FNDA 1FGVH 3TZVD 3WH5A 4PI0A 2CHDA 1W8EA 3DI3B 4A7QA 3LYEA 3R12A 5TDPB 3Q6FB 5EU4B 3PWLA 1XGQA 4Q89A 1PEWA 2XPYA 2CRMA 4WWPA 1NCAL 2NY4B 4Z7UE 5DD6A 1ZT7B 5JPMC 2XQ0A 2ZQ0A 1FPTL 3SIZA 3LH8A 2KZHA 3U1QA 2IDSA 2A3CA 3VO0A 4YTUA 2IG2L 3W1AA 2JQMA 5EORL 4DP8X 1A3HA 3FU7A 2WXJA 2YEVB 4AC7C 1UOVA 4RFNB 3NH7L 3N43F 4X4XB 1E0TA 4GI9A 4QDWA 2YK1H 4FCAA 4P04A 5JDSA 4OBSA 4IIFA 3ZKQD 2QEZA 5G4NA 4M4PA 1QLEB 4JDTL 3HU7A 3D4YA 1EFXD 2MWCA 3NABH 3QNXA 3F7JA 3WF1A 2DL2A 4MCZA 5IROA 3QFDA 5D7HA 3K0WA 3QEHB 2VDLL 5EMJA 3GR8A 2JGYA 3WBYA 4DGIH 1T1YA 1Q8AA 2J79A 4YO0B 4YR6B 2VZUA 1WDRA 3NDOA 3SFWA 1XIFA 4GQRA 3M41A 1KPUA 1P1ZB 4S3AA 1EJOL 1G9ML 2WVVA 2CLVB 3GYRA 2L3BA 3PL6B 3HBZA 1YQVH 4P4KB 2EC9T 4YUEH 1YYAA 1E67A 3IJDA 4PRNA 1V27A 2V81A 1OOWA 3TR9A 1ZIBA 4F93B 1EJVC 1P7KA 1K3IA 2NX5A 3W73A 3GMOB 4U6HB 4Z7NE 2GSIB 3FT0A 2ADIA 2ERJC 3OJ2C 3QPXH 3ARRA 4MHHI 5LNEA 4M7ZB 1TZ7A 1IE7C 2HE5A 4DUVA 4JR9L 3BVNB 1CYXA 2FLRT 2G60H 3E8UH 4L9LB 1AIFB 1RAMA 3SUVA 3S2MA 3IJYB 3U2SB 1AZNA 3GRIA 1XZ0B 5B1JA 1RSYA 3D85D 5EIIB 4P57B 1HT6A 5JUEL 2QQ6A 4LLVB 5IVNA 1LVEA 4P5TB 4RA3A 1EEQA 1E55A 1J9QA 4LVOC 2YQ2A 5FM5M 8XIAA 3SGEH 4XH2B 5HMEA 4XNXL 3PF2A 5FYLL 1BD2A 3D2TA 5KEZA 2DI8A 3LDBB 3UO8B 1Q4NX 5DRZB 2ZZ7A 5F21B 3VWJC 5E5UB 3W9EB 4ZUVA 1J5SA 2B59B 3WMCA 2WLIB 3HMXL 4BH8B 4LPVA 3W7QA 3MBWB 5C0ND 1AXIB 1JAEA 1LK2B 2QVNA 4HJEA 2AQNA 3DGRA 4E9XA 1S2EA 2PP7A 1DFBL 1ZHBB 4KKQA 1S5MA 4ONFH 3LHZA 3OLEA 1JPFA 3EH5B 1UKQA 2BVYA 2Y0FA 4N2FA 3DUUA 1KR0A 4JJOA 4XNQB 4CD4A 5G2HA 4QRPE 4OD1L 1AH0A 3UTZA 4GACA 1PKOA 1AO7A 4D9RE 43CAB 2ATMA 2W9EH 5D5MB 4I0PD 3IPBA 2GSEA 4BEUA 2J8HA 1HZLA 2VSCA 4M8UA 2WZEA 4JFEB 5AKQA 2R56L 4LC6A 1KBPA 4F7TA 3DOIA 3N2MA 3BLKA 1DZ0A 1R87A 3A6CL 1UB6A 3GXMA 4PS4L 2X1IA 3PTMA 3JBG7 4K73A 3T1FA 3U1SH 4Y9CA 1YEHL 3F01A 2YL6A 4BK4A 3UCRA 3V4LA 1BVNP 1KN2L 1C1EL 1LORA 1PQZB 3RDTA 4FF5A 5JBEA 4GIOA 3VABA 3RRQA 1GG1A 4M3JA 1AUSL 1NOAA 3VKAA 3NSNA 2W65A 4MA1C 7PCYA 3SCNA 1IC0A 1J5TA 2PRHA 2AFNA 4PGLA 3AHYA 2CETA 5IBXA 1SDAB 5DDHB 2PEVA 1FGVL 4GY4A 3JZ7A 5CLXA 3R1GL 4KMLB 2W27A 1MCOH 1SYVA 2FNWA 5I75C 5GZOA 4I7VA 3C75A 4P46D 4PJEF 3SJVE 5C0RL 4L8BA 5JW4R 1PD0A 1YYMH 1AGFB 2FLMA 1X5HA 3BSHA 4P59L 3EJPA 3VM5A 3VMNA 1V02E 2V5YA 4NX0A 3BPCA 1SN5A 2GAZB 3VSTA 3MNDA 1U93A 3FUKA 2R4RH 3PWJB 3LKNA 4P9ML 5CJ5A 1HKLH 4PY8I 1N8IA 1WHPA 3FQXB 1ZRUA 4Z0XB 2VRAA 1L9TA 3K81A 3PFUA 4PVNA 4NQDB 5D1ZA 5E1AB 2NY5C 5CG0A 2CDFA 1I2RA 1KLGB 3SUSA 4OIAA 1EZWA 2XIBA 5DVMA 3UYCA 2OMXA 3KE0A 2WZMA 1NBCA 1NEZA 3GBMH 1J5HA 3I6GA 1LLZA 4ELKB 5MHSD 5SWUA 3VFRB 2Y7GA 1YEGL 2ZAIA 1KG0B 3JWNC 5EO0B 4FX8A 3UWEA 1BQLH 2C13A 1HXYA 3K91A 3LH2L 4GNVA 3V6OE 4JICA 3TWBA 1JPTH 4NBZB 1DDTA 3BKYH 3LN4B 3DZ1A 4I6KA 2ZUQB 3KVPA 3RUGE 3U4FA 1FZMA 1UJ3B 1RJZA 4RBPK 4QNWA 4JFUA 5C2GA 2EVFA 3HE7A 1P5VA 3T4YA 5CP7B 2YGOA 2DZTA 4BHUI 1Q0XH 4PR5B 4WV1C 4YDVB 4V11A 5HDWA 2CJUL 4MFEA 2WPGA 4TUKL 5FM5O 5IB1A 3V5KA 3KNBA 1MF2H 5E95B 5E23A 5KYYA 5A6TC 4OCYL 4BA0A 1NQKA 1S1RA 3VNDA 4E0CA 4GW4B 4XO4A 4N2KA 2UXGA 2AC0A 1IM3D 5IQ7L 1KBWA 1QKZL 1S2TA 4M0XA 4LE8A 3OMZA 2SEBA 4FQQA 5C3IA 3ZVIA 3AACA 1RZKH 4LDCA 1IFGA 2VC7A 1I1FB 4MQTB 3AXLB 1K4GA 3OOQA 3V5DB 2W3ZA 2IDFA 2P76A 4HJWA 4PTUA 4LLQA 5LWYL 2OODA 4PLJC 1KB5H 2WLZA 4QNPE 1ZJBA 2FTWA 1E4WL 1UJQA 3GUTA 2OW7A 4HKPA 4L37B 3WN5B 1V6YA 4WW1A 2M26A 4AENB 4AZ8B 4Q8BA 1BEYL 4OLEA 3O3UN 1MCJA 3MCKA 4URIA 2XGZA 3CHQA 4WFED 5FS5A 3OA3A 1YDYA 3QZLA 3SR7A 3LZRA 1ZVNA 2X4NA 1ZA6A 2G2PA 5C0IA 4JANB 3NK4A 3LRSB 1HH6B 3QCTH 3ARGD 4H25A 4KKLD 4ZS7H 3T8VA 5I0ZA 4Z2LA 1ZFJA 3VA2C 3WG7B 3KBVA 5GGTL 2JVUA 3BXWA 3SGEI 4MZYA 4W7WA 1N5AB 4EO5A 3WLBA 3IXTB 3SIKA 5L4MA 1W9PA 2H8ZA 4GISA 5AZ2H 1D9KB 1VRSA 4TUUA 1NCDH 2VFFA 5HWJA 1UR8A 3FSOA 3BL3A 2FL5A 1WWWX 1UM5L 1ZPUA 4CC0A 4B3LA 3PPEA 4KERA 3KBFA 4X6CB 1UWXK 1YUHA 3PDDA 4POCA 3T2NL 1LLOA 2VUYA 4U1LB 5FXCH 1WUNT 1E70M 5I74C 4WO4A 3SUUA 2V5SA 2ZP9A 2LTQB 3PP7A 3N40F 4M6PA 5ECVA 1A6ZB 3CSBA 1IWBA 1OT2A 4JN1H 4Q2ZA 4QRQA 2ZRYA 3UJIL 3BXNA 1QNZL 2YX0A 2YS4A 3FA5A 1VGEL 1OE3A 2MCPL 4WFHD 2EVHA 4XOAA 4UBDC 1WKEA 4GY0A 3OGOE 1V6XA 1QHOA 2WMFA 3C86A 4IP7A 3SCVA 5L4IA 4TTUA 1ZBVA 1IKNA 4LEOB 4IKIA 2DZPA 1ECYA 3MN8A 5TTRA 1JGDA 4MMYB 3ARTA 3TBSA 1V5XA 5D4QA 3H0TA 4CRPA 1EJOH 1G9MH 3L1EA 5JMRA 2GK1B 4WV1A 5BVJB 3BW2A 1EERB 1YHPA 4G7RB 4JTUA 2KPNA 4JR5A 1LQSR 1MCOL 3WOVA 4PUNA 3C5ZA 3NA4A 3LKQA 1PCWA 3CPRA 3V4VB 3FJNA 3WHE1 4H8NA 1QHQA 4PEKA 5J6SA 2O61A 4CGUB 4ODXA 3RNQA 4B6ZA 1YO4A 4L1BA 3O3AB 2ATPB 4ODUA 5BZWA 1OCNA 5IROC 3NJJA 3C0SA 1P7QD 1XGRB 2AANA 1X7TA 4O11A 3UGRA 2XQBH 2HLFD 1JNLL 1LG1A 3GEWB 4IF2A 4E6MA 5JOPD 3C2AL 1HG3A 2FE0A 5FB8B 4UC5A 2PDWA 4JKMA 3G0SA 4MIMA 3F2CA 5I3GA 2Q7NA 4X3ZA 1BGGA 4H8WL 3T71A 4IGMA 2V17L 5IB4B 1D9KD 5SX5K 1CI1A 2D31A 3MA7B 4LOEA 3LS5H 3HR5A 1A22B 4Z7OE 2L7JA 4W6WB 3QQDA 4A2MA 1XYCA 4OZFA 5EUKB 3BRGC 1G87A 2H26A 1BWLA 3QFGA 2R83A 4WQOA 4U5KA 1F3DJ 3BWUC 2GSHA 3P0WA 3WDPP 6TAAA 2VDOL 4N3UA 3CFEA 2XKNB 3H9SA 1EGJL 3WLKX 2EDMA 3GBML 2MCG1 3ZDYE 5BYWA 1QO3A 4HHAB 2BM3A 3D69B 1KB5A 4DFHA 4NBYB 3FGCB 2EICA 3GBLA 4M93C 1OP3H 2AJXL 4X98A 1XR9B 4EI5A 1A6UH 2J12B 1L5GB 1G7IB 5JW4M 2O0TA 4GVGA 1EQWA 2VJXA 1IO4C 3NJGA 5HHQB 1W8GA 4NQEA 2JKXA 1DQIA 4PCTA 5IWLA 5FEPA 1SPDA 3NJMA 1TYEB 4P05A 3TA3D 4LMQI 2GUBA 1OARL 1ML0A 2JLPA 1TVNA 1Q9WB 3Q48A 4W1TA 5JBFA 1NGXB 2X0VA 1XF3A 3E2HC 1VACA 5TH2B 5ISZD 1FLRH 4N1CA 1XPGA 2P5WD 3U7YH 1UEYA 5I77A 1UB3A 3GYEA 2NY6D 4N25A 3PWPA 3RUBL 4JDYA 4HIQA 1FO0H 5EU7E 1YNTA 2PTDA 3E5PA 1WV7T 4HQQL 5T1KA 1VFLA 3NCYP 4GYPA 4J2XA 1DJZA 3FB7B 2OGYA 1VPQA 2IALA 1J5IA 5KYXB 4P61A 3I6TA 2K4AA 1JYWA 3C56A 4HUWA 1OAXL 3C5SB 4LGPB 5KSUB 1CE1L 1IGFH 5HGDA 1NM4A 5I5MA 1HCVA 3U1SL 4KNSA 1E0UA 1OG0A 3DHFA 2V30A 1CGWA 4JAMA 3FDKA 3E7JA 4ICMA 1MQQA 5TDOB 1MN4A 1P5UC 4AGMA 1E6PA 1U58B 2Q8ZA 3KPOB 2HJKB 1BLNA 5MEQB 2OL3A 3F7PC 4OV4A 5TK4A 3PJWA 3GMNB 4NZUH 4OF7A 1EF3A 1F3RB 2Y88A 1B2WH 2VJ8A 4MOZA 4ML4A 4KOBA 3L4VA 4CNPA 2XWJB 4PUMA 3QC5X 3DFYA 1KIRB 3V2AR 5EGRA 2R2EB 2NQ3A 2BOBB 3APNA 3QJRB 5HGBB 5IOKA 4U3SA 4WDXA 2EUVA 5TK2A 2A9DA 2PLKA 1G7MA 3ABQA 3ITXA 5BUAA 1L6GA 2J6EL 2CZDA 4K71C 5A69A 5TGBB 1G6RB 3W0WB 2AK4D 3ATAA 3ZVHA 3GMPA 4W9IC 4B3EA 2E67A 5CJ8A 2PDQA 3GSNH 4XV0A 5IY5B 1CXLA 2OSLB 4MJIA 3HI6H 3T3PB 5A6BA 4P46A 2PDHA 3W22A 3ECBA 3AQXA 4BRJA 1ZCCA 3VK5A 4G9DA 3B2VL 4JKWA 4PGBB 2A7BA 4XBPB 1U1UA 1CLKA 1TF4A 1FWGC 2VFEA 3CQFA 2NOYA 5D9PA 3F83A 5ADPL 4JM2F 4R7OA 4C6PA 3JV6A 1K5NA 4PJGF 1VIZA 5HHMD 3CQKA 3AWEA 3VACA 4EKJA 5G4OA 4NB7A 3DX1A 4KTGA 4QHLA 4JPVH 4DPRA 3MPCA 4GSUA 4FHBD 4U1IA 4QHPA 5GRWA 1ICSA 3U0TB 1QK0A 3UGEA 2ZCKH 1D7FA 3ULVE 5G55A 3GZAA 3GU9A 4LVEA 2F2HA 3UA4A 5IQMA 1MJ7L 3WU1A 3R13A 2VL4A 1S7SA 1N5YL 1JHTB 2KHAA 4P5SA 4PMDA 5BRZA 3CFDB 5HDBF 1WQ5A 1WAUA 1P6FA 3D2UB 4I77H 2VLMD 4MNHA 5JORA 1E4LA 2HVMA 5CQ1A 1AKPA 1UEMA 2EADA 2GY5A 2YBGA 3KDPB 4PGEB 5CEZE 4L18A 4I0PB 2ZOUA 3W23A 1RZ7L 1Z48A 2DMKA 2LFEA 4NQCB 4OCSH 4UT9A 4ZUSB 3PULA 4B0MM 4KMTH 1IUZA 2A3EA 4LVAA 2XH7A 2E0PA 2WPBA 3DO4A 1IGMH 4U1HA 5E0KA 3HE6A 3LRGA 3EHBD 4MSSA 3HIJA 3PWPE 1IBGH 4OZGA 3RTQC 3KR3H 4X4YB 4BWWA 2H3NA 2I60H 1JDAA 3ULUE 4W9GC 2OSXA 2Q8XA 3QR0A 4LKXA 4ZXOA 4LNVA 4YFLI 4LUTB 4XWGL 3SBFA 3HZVB 1AS7A 3QPQD 9PCYA 4JHWH 1M3JA 3O07A 4L29A 3ONCA 4W7VA 1SF5A 3SGKC 2YUWA 1HOEA 2BS8A 4HALA 5TFSL 5EF0A 4OI7A 2DWYA 5J11B 3OGRA 1CK0L 1ZLPA 2VCBA 4LASL 3QCUH 5SWSA 3GH7A 4U3HA 4LHJB 2D7MA 5DS2A 3BW9A 3UOAB 4IOIB 3PHQB 3WN5C 4QSFA 3DX6B 4J39A 3H55A 5K9QG 2TRYA 5GISL 1CF8H 2I5GA 2D1ZA 3O6LL 3U6RA 2IOMA 3SODB 2IDTA 2G3JA 3OKEB 5GS3A 3ENLA 1NC2A 5DJDA 5T9BG 4A2RA 1UADC 2ODOA 3QGVA 1F74A 1QFEA 1YW1A 1NCNA 3DLQR 3MOBL 4EJ1C 4TUJA 4DNMA 4S3FA 5EBWB 1NDMA 5I6OA 3BT0A 4EWJA 1S5HA 1D5MA 3QQ9C 5EIQA 3CH1B 4IKJA 3SOTA 5C70A 2ZSVA 3O4LA 1UP0A 4H00A 4OVVA 3I6RA 4Z7IA 3IDJA 5KVGE 2IC2A 5E5LA 2Y2WA 3IMWA 4J3OH 2A7RA 4DEWA 1XXFC 4WCYH 3LOTA 4OV5B 1JMZA 3TIEA 4BJLA 4F37K 4C1NB 2YA1A 1NAML 2NW3B 5FIPA 4BFAA 3EIFA 4BY3A 4QAIA 5B39B 2BSRB 2FTAA 5KZCB 4AL8L 3UTSA 1ITCA 3DFNA 4EIBA 5C0GB 4QT5B 4EXAA 2G3ZA 4K4KA 4XPFL 2ESVD 1MIEH 4DTGH 2X9ZA 2E5DA 2R1NA 5E9AA 4PUBH 3AIEA 1R9ZA 2PR4L 4Q8WA 3BYTA 5L6UA 3LD8C 4ODTH 3MRJB 4U7SA 3RJOA 5HDRA 4N0FA 1LUCB 5E2WH 3USBA 4XP9H 2XVNA 1CD9B 2K1MA 1MRQA 3VXSB 2QCEA 2GPTA 4U49A 1RUKL 2H32B 7TIMA 3DHDA 2WOBA 1GZGA 1HWHB 3MLZH 4PJAF 7TAAA 4D0BB 3K5RA 2WBJC 1HEZA 1TMQA 4QEGA 3TZFA 1CTNA 3VFSA 5H4ZA 1W9DM 2JTDA 3E2SA 3JWNG 3RU8H 4UTMA 4MLRA 4AU0A 1OAQL 5F7EL 5HBFA 3P3RA 5TQLA 3SKMB 1I3GL 5HY9A 2RACA 1NCJA 2VLJA 4ZO9A 3S3PA 3MWAA 1ADWA 3M88A 4KITB 3R8HA 4PCKA 3LRHA 2IBGA 4O16A 3PAYA 5I9QC 4AJYV 3IANA 4O13A 3ZKXC 5FUOL 4QWWD 5AW2B 3TVMA 3H2EA 5J13B 2J43A 3JYCA 4HH9A 5T1LD 3PGFL 1T21A 4JUTA 1NARA 5I1KL 4IP5A 1QBAA 1O66A 4LB4A 3AU1A 1F58H 1Q94B 1WBYB 4PJ8B 5DO2D 8FABB 5ADOH 5J89A 3EYUL 1TIWA 3CU2A 2J1ZA 1I7RB 4JHMA 1A4JB 3ZTJG 4NAFA 4P99A 5CZ0A 3HC4L 4S3GA 1ACYL 4M5SA 2GJ6B 2ZZUT 3MRCA 1E9LA 5HP5A 1ONQA 2UXTA 3QIWC 3M8OL 5J1AA 2VDOH 3AIRA 1RD5A 5FI8A 3AZSA 3EJQA 3ABKB 3RBGA 3IUIA 2W95A 1C8QA 2AXFB 5KJ4A 4EKXA 2IBBA 3KLAB 4PJHF 4PHZA 5D6CA 1PZ5B 1VPYA 3K13A 3M7SA 3GZPA 1B4TA 1UOWA 4K3EL 2CO3A 4NT0A 1GC1H 1UR1A 2WXLA 3QHMA 3W28A 1E2ZA 4PWHA 3MBFA 3QDMB 4KQ3L 3QCVH 1IC4L 3ZLFA 2YZRA 4WEEA 5HQMA 4U1GB 1XSKA 2RIKA 4G7YH 4XPBL 4Y9FA 4XPAL 2JKSA 3B37A 3GMRA 2VXTL 3B2UD 4ZZKA 4M5TA 2I7OA 2MJWA 1JNJA 1Q6EA 3ZMEA 1VJZA 3O05A 1SVCP 3NBNA 1OSZA 4NJGA 5DUPH 1F3WA 3UG4A 1IAIH 2G0WA 3G6JF 1IAKA 4GJIA 3WQVA 4AZCA 4HGWA 1FFNB 5D7JD 3QEZA 4QXIA 3LBCA 3X14B 1EAPB 1J8HB 1BV8A 4I2XE 1BYOA 4FN0A 4ONHB 5BRQA 1WKDA 1IT7A 4WW2A 4IUOA 1XICA 4ODSH 3N44F 3OTTA 4LESA 2VLRE 1FHLA 5I8CB 1ZTVA 4Y8AA 2Z7GA 4YBLB 4F15C 5F6IB 2ATSA 4IW4C 4GNJA 1NGZB 4NSBA 3TNBA 3NCYS 4Z7WA 3BAXA 4MCYB 2APFA 3CV6A 2VXNA 4J1UA 4EIVA 5FF3A 3UGXA 4HUVA 4MDOA 2OJEA 1I9JL 3AIWA 4NRZB 4UTBA 4ZQRA 3VSVA 3EFFA 2CLHA 5AKSA 3UL4A 1UXMA 2C1PB 2YPKB 4MCMA 4EIUA 5LQBL 1TV2A 1OQXA 3OPSA 4GIEA 4YTSA 2XCMC 4X83A 1M6UA 3E96A 1QEWB 3PZVA 2RDWA 3UJ2A 4MJ4A 1NPJA 4OUEA 3DMMA 4AK1A 3MACH 3EO9L 4Z9KB 4CW1A 1AO7D 3W2JA 3FSUA 2A3TA 5C71A 3DUSA 3GMLA 4HIIA 3CQJA 4LUYA 1EBPA 4ODVL 3HAEB 3D3AA 1GAFH 1D5XB 2WAHA 3EYQD 4HC1H 3MVIA 4NC1C 3VWKC 1VFSA 2GVLA 4C6LA 2FEJA 3ECVA 3IDYB 5ERWA 1U3NA 1MJJA 3HKFA 5CZVH 1OANA 3ARGC 1EBHA 1GVQA 3C5QA 3UPMA 2B7DT 3EBAA 3SUWA 5A8QA 1DSYA 1US2A 3MUCA 3WKZA 4X63A 4F8OA 2Y63A 1CIUA 2EE2A 2HJFA 4QDGA 4F1SA 1SFTA 4CBZA 1IT0A 3ZS4A 3ABGA 5DS1A 4KKPA 1MI5A 3L08A 3QOMA 5HYJE 2QJMA 3MJ7B 5L8KB 5ETUA 2E9LA 2RQEA 2VNCA 4FJZA 5A6AA 5AAWA 1Z3GL 3QJSB 2V69A 4DKEH 3DDMA 1ZLSH 4AYFA 3SRFA 4JGJA 2OMYB 4JO2L 4Q33A 3LV3A 5ID1A 3FB8A 2ZOLA 1R34A 3I65A 3R5EA 1G4EA 1YLBB 3FCSA 4CNIA 1BOGA 1E4XL 5E24E 4QLKA 3AWGA 1TPVA 1IFHL 1Z9SB 4U7KA 3FYOA 1SMOA 4IFKA 4TOQA 2QKIB 3Q1SL 2QFRA 3MRBA 1B3XA 1FORH 4JFPA 3BIAX 1A4BA 2OZ3A 3BIKA 5EUOF 1QMUA 5SX4H 2BHUA 1MNUH 3QUYC 5D6DC 4XBSA 5M1TA 3M5VA 4Y19A 4LEXL 3VM7A 4ZAKB 3IN2A 5CKGA 4I9JA 4NI8A 1L7IL 5D1ZD 4M5ZH 4GW1B 3T81A 1J2BA 1T1WA 3VG9C 1TUXA 1U8LA 4NNYB 1HHJA 5TE7H 3GSVA 2DEPA 1MRCH 3EJYD 4XUYA 2QW5A 1OAXH 4XR8C 3GSNB 1KGYE 1X9UA 5CIPB 5I78A 1I1AB 4CC4A 3B8SA 3RILA 5KSAC 1IV8A 3QGKC 1P5UA 2COQA 3P3UA 1G5AA 1JSYA 1HHKA 2XDFA 3DG3A 4W9TA 4AZ6A 1TZ8A 3L81A 4L23A 1FO0L 4FQJL 2ALRA 3U1PA 3LVTA 5CD5D 4GRLC 1W1ZA 1ZD6A 5F7YC 2Z31C 1XC4A 2FX8H 1E56A 4K8HA 4P9HC 3M17A 3CB8A 1M6OB 1R5VB 3KJ4B 1W3TA 4PMUA 2ZKHL 5FGRA 1CT8B 4NUWA 3D25B 3Q6GL 3MUUA 4FFYH 4PFEA 4G42B 1GYUA 1QLRB 4L5FL 4QRPD 5CU5A 2PA6A 3VX0A 4NERA 2X1WL 4TQPA 4YHEA 1E40A 1F56A 3KLDA 1X97A 3VGGA 5LDSA 4YBQC 1L9WA 4CA4A 2PF6A 1TZHA 2P0OA 3MGTA 3WGUB 3JS3A 3SDAD 4Q4PA 3QIWA 5CGYC 4QRSB 2WTRA 3RKPA 3UTTA 5FEBA 2EG7A 2WW5A 4IMAA 1GZHA 4JTQA 1GOGA 3R7QA 3O41B 3WXWL 2JKEA 4Q6IA 3GSWA 3BEVA 1UT9A 4V2BA 3GQFA 4B4HA 4ONVA 2CGYA 1JOIA 2FIRT 3EB2A 1TLKA 1BGXL 3TJLA 3R0UA 3F1QA 4DP2X 1Y6MR 3KM8A 2B39A 1DVQA 2FWUA 5AOKA 3INUH 4S1RH 1KFEA 3ML8A 1MCFA 5DMLA 3BH8A 2UZYB 2ZC8A 3DYPA 4F0LA 3E9TA 1CD1B 2PUQT 4IU2A 4PGJA 4Y0GA 3QJAA 3B0VC 3B3IB 4X99B 4X7EC 4UNKA 5BRBA 3C6SA 4J2QA 4H9TA 4PR4A 2E46A 3GNPA 3P5YA 4WHTA 2PW1A 4CCCA 2V9UA 2PCPB 1BREA 2FX8L 2EC8A 2QVIA 4XVTH 2OU4A 4UCFA 2Y7DA 4L2LA 3LMYA 3UXLA 2EYRA 1ENUA 1WZ1L 2XZ7A 2QZQA 4MQXD 2VQ1B 5F88A 1AL7A 2P0IA 1T0NA 2FUQA 5B3JE 2XGBA 2FJHB 4QX4A 4MJ5B 3BPOC 5JXEC 2ZTJA 4RDYA 3APDA 3HI1A 2OJPA 5C6TH 4EI5D 2NRDA 4RAUA 1I8MB 1M7JA 1TJRA 1PFOA 4H7VA 3DGGA 3MOAL 3RVTC 4AG4H 2QCDB 5EZJB 1HAWA 3P2TA 3QUYA 5D6DA 4MYPA 4K37A 5KN5B 4FOJA 1I1CA 3GHRA 4G6KL 1ZLDA 3TSDA 3QIUB 3SYOA 3DTXA 3U4BH 3NZ8B 5IT2L 2VX4A 2D7TH 4WDUA 3BC9A 1U5VA 3TQKA 4OCXH 3SE4A 4D7BA 4CJ1A 4P2OD 3GHBH 3QJTB 3QZOA 2ROXA 4WO4D 5BVPL 4U4MA 4WDWA 4PP1C 4J40A 5FL0A 1IT8A 3IVUA 3NZSA 2V9RA 2GTZA 2DZUA 2YARA 1IIIA 3V4BA 1JVLA 2H6PB 1CFQB 2AERT 4MKVA 1SZRA 3HC0A 5CMAB 4EOWH 4K3JL 1NDGB 1DYZA 1KEMH 2ITFA 2JK5A 3LUTA 4WEVX 3ZFHA 1MAKA 4YDIL 1CFTB 1P7HL 4ZMGA 2YAFA 4J3TA 2H1XA 3MO1B 1HKWA 2IIJA 1F4YL 2X4RB 3AZUA 4X0KB 2F6UA 4OZHF 1YY8B 1D7CA 3IIXA 3GSUA 5D72L 3IS0X 1BBDH 1F41A 3ASOB 4FZEL 4IKNA 2HMIC 2O5NA 1UKSA 3RWCA 2GUUA 2GVEA 3L23A 3SCTA 2VIRA 2OOGA 2GSGA 4KHXL 3V95A 3BZEB 3WF2A 4LKCA 2V5DA 1YEGH 4FXGB 3SHSA 3S2NA 4ZXBD 4DK6A 3VFCA 5EZOH 5G4EA 2N7BA 5SWSD 3W7CA 2GYSA 1VA9A 2YCKX 4QYAA 5K3VA 3HVNA 1XLMA 3GC4A 3O7UA 2AK4B 1SMDA 3PPSA 5C09A 1A4LA 3SSZA 2G2RA 3ZE0B 3HZYB 1KKOA 4HEPA 5F9WC 2Q3ZA 1DVXA 2XH2A 1GVEA 4CD5A 1LF1A 3W7RA 3MODL 1WDWA 1MNUL 3G24A 2VO8A 4WNSA 1KB9J 1A4MA 3II2A 1ECEA 2XG5A 3NQVA 1B3OA 1SFLA 2G96A 3KYNA 2P24A 3HB9A 4RE3A 1B6DA 2WXNA 1JERA 3IDYC 1C12A 1TQWA 2V7HA 4GUCA 1SDYA 3APYA 4DF1A 5E9NA 4QNEA 1ETJA 3Q3GA 4ODWA 2WHJA 1U3YA 5DZOA 4OCLC 3SBQA 5IKCB 1RHFA 3ZRSA 4HHGA 5TD4A 5DI8A 2HLAA 1VAHA 3V8CA 4L8CB 2HSIA 5CHNA 1Q6CA 3FJ4A 3FH5A 2GT9B 1PL9A 5LJYH 1AGBB 2IAMA 2E7FA 2HWGA 1HXMA 2XPKA 3W84A 3NABL 1HSBA 1AKJD 4NSKB 1E6NA 1UH2A 2VDOB 4IBVA 1UWFA 3RAOA 2JSFA 1WISA 3S35H 3WFBH 1HVXA 4PG9B 5DC9B 4H20H 5G5DA 3OKKB 1PX8A 3KCOA 2F8QA 3CUPA 4I5RA 1NWPA 1EXPA 3WSUA 3NFNA 2Y7OA 4WTZA 1JMXA 3KS5A 1XLCA 4AJWA 1H6EA 2CHOA 3B9NA 4OZIF 1OJXA 1CDGA 3L3OA 1XINA 3M64A 3QYSA 4PYHA 2A1WL 43C9A 3CDGA 2QKFA 4HC1L 2FUTA 3CIQA 2ARJA 2EDKA 2ITCB 4O0QA 5G5IA 5KSVB 3KDNA 3TBCA 3TSBA 4QRFA 4AXNA 3QDGD 2ARJQ 2MHAA 4JFOA 4L4VD 3MKVA 4H2HA 2YSSB 4MXQD 1ACYH 5C9RA 2HQAA 3NJHA 3CEUA 2WSKA 4Y2LA 5GGSB 3R18A 1W3KA 1G1KA 4UQDA 5IIEA 4PD4J 3BVXA 4ZOEA 1JZHA 5AOIA 4NYLB 1OGAE 1AD0B 1NINA 2BY1A 4DP6X 3CH8A 3DNKA 3LN5A 5KINA 3MRPB 4QYOA 5ESQB 4UQBA 2Z4QB 2Q9OA 1KYFA 5E4AA 5D2NE 5I8KL 1P1MA 1A7NH 3GG7A 2A77H 4OFYD 4Z7UF 2ZOKB 3IJEA 3LTVA 1XGYL 4V1DE 1TLMA 3CK5A 3LQAC 4Q7DA 4QHNA 1ONXA 4JTKA 2OK0H 1BLIA 2J8OA 2Y6SD 1KBBA 5B7FA 3LPPA 4IIDA 4S3KA 1QWKA 5JR1H 2B3RA 4AFYA 4HIHB 2HWZL 3P4OA 1AQKH 2I07A 3ZXAC 3FOLA 3NQBA 4AGNA 1F5ZA 1GOWA 4AEIH 1WX0A 4CVWA 2YUZA 4B0MB 3AYVA 4DGYH 4KWOA 1MRCL 1J9RA 1RHHA 2QADC 1CNVA 4ZQNA 5FAGA 1WYJA 4GZIA 3V6ZB 4IMFA 3DOSA 3E0FA 3L3OC 3QWOB 1WA0X 4RMWA 4GYPC 3MV9B 1XIWC 1ILUA 1VC4A 5JZ7D 3NPWA 4IX0A 1WGOA 1MELA 3KPNB 4Q4QA 5D8ZA 4GLEA 2EE9A 4LSBA 5GZNA 1FBAA 1WFTA 1MDLA 2KH2B 2E3ZA 3FSWA 5KVDL 4QRRA 3LMZA 4R9OA 2W79A 3OLGA 5EBMA 4F2BA 2CO1A 5REQB 2PP1A 1MQKH 3VXQB 5K9KA 4B5TA 2APXA 3P73A 4AQ1A 3SDAC 2YUXA 5IQOA 1J05A 4GIPD 4O19A 3JTBA 5GJPA 1K8YA 3L17A 2OQYA 3TV8A 2VDLH 1HHIA 2EDJA 3DIVA 3FO9A 3QDJB 4P5KB 4XSMA 3D3VB 1J8SA 3D39B 3FU7B 3KPSD 1SJEA 4JREC 1CLVA 5HHOA 5BCAA 3IFPB 3VOCA 4PRPA 4DQAA 3BAIA 1UGNA 3FN0L 5FO8B 3RVVC 4D0DB 4EIGB 2YRPA 4X7TA 3V5HB 3WKPA 2Y6ZA 4I9WD 4NQED 2AQWA 1LK3H 2X89A 3QNXB 4FQPA 4NN5C 1JK9B 3G6DH 4ZMQA 4OGYL 1IAMA 1P4IH 3TJHC 4EXQA 4EMZA 1E4XI 2X0UA 3ALFA 5F7AA 4LVHC 1E7UA 2Y5QA 2Z4TA 1TJIH 1NFDF 3FL7A 1AE6H 4IM8A 2E74C 4Y19D 4LOFA 4QRUA 4ZDHB 2NXYB 1PLGL 1KPUB 4QI3A 3ZL1A 4J28A 3DFTA 5DHYA 3TNMB 1LMKA 4Y5XA 1IEAB 2V5JA 4DWSC 2QVMA 4TMPA 5HNNA 3BV4A 1UQSA 2NY2B 2BNQA 3UC2A 3IKCA 1XFBA 2F84A 2R6OA 5CPQA 1EEZB 1BZOA 2ZP8A 4U33A 1VSCA 1HW6A 4QNPF 2FQGA 5E4OA 1K4DA 1FCQA 1A6VL 1DQQA 2GSIA 3B7UX 1KTCA 4DX3A 1LO5A 2PYED 3VGBA 4TOYH 3RTLA 5F8QC 3MLXL 1CU4L 3OAZH 4JHWL 1FG2A 2EPHA 5IHSA 4HUXA 3S34L 1OW0C 2DV6A 2VDQL 4L9LA 3L7RA 3IJYA 3LHAA 3AW5A 3B4NA 4FLHA 5IFHL 2NX5E 3U46B 3W38A 3WMSA 1F6PA 3BG3A 3BPNB 1XTMA 3VXUD 3S88L 3BURA 4RFNC 4H1LG 4R5TA 3GHEH 3IBOA 3RM9A 1D5IL 2FSEB 4M61B 1UROA 3UMNA 3I6LE 3IAGC 3I74A 5IHBA 1YY9D 3E0WA 2FEEL 3OKLB 4P3DB 4RETB 5EU6D 1CGSH 3EGDB 3OQRA 2UZXB 4FFZH 4IDJH 4NQQA 5GGQL 5CBAB 4DWSD 3ARYA 2B59A 4FP8L 3UR2A 3QYNA 4IJRA 2VR3A 1M41A 4WHYG 2O5YL 3FRPB 1R3KB 3TEVA 4PBXA 3N14A 1DBAH 1H5BA 4AAJA 2IQ9H 4TS6A 4KC3B 1ZLWH 1O6SA 1Q9KB 1N26A 2VXTH 3D87B 1QO2A 3ILPB 5EMMA 5JOFB 3RPBA 3RX5A 4F9LA 5DJ2B 2I17A 1Z6JT 3QBTB 3B2VH 1M7IB 1OX5A 3MZ2A 4ZEPA 5IQ9B 1KJ2L 4NAQA 4XZ4A 3SGDI 2H9GB 2AQ2A 3LIZA 3SKJH 5MF5A 4NZ8A 3BH9A 2VQUA 1QQDB 4JFFA 1T22B 3D5OF 2QSVA 3IBEA 3LPOA 3HGSA 3UMTA 4AUUA 4FFWD 1WFUA 1GYMA 3CUXA 4GIRA 4PJDE 4N0RA 5C0JA 5HI4C 5GRVL 1KM3A 2PLCA 3M0XA 3PN8A 5AVUB 1A53A 5J0BA 4IPJA 5BW7A 1YMME 1OC5A 2YD6A 3GH5A 4UOJA 4BUGA 3LGDA 3QW3A 2NR6D 2PBGA 3KOWA 2UWEF 3QH3A 4RX4A 1QX1A 5D7IB 3RY4A 3JVFC 1TCRA 5J12C 2ZWZA 3KPRB 2NNCA 3FSAA 5L2JA 1KMGA 4TX9A 1DWFM 4FNPA 5IFAL 1HDMA 3GVVA 3SFKA 5SV3A 4XBEH 4CD7A 3W1XA 5C9XA 2ZCLL 1ZL1A 1K3ZA 3BP7A 5BXFA 2EKGA 2WUCL 2E7CA 4HS6B 5FGBC 1PQZA 3RDTB 4RGNC 4NVTA 3U5UA 3BKCH 3AMLA 1LE9A 1IEWA 1FWHC 1TTQA 2DLTA 3IGAA 4EUPB 2ZDRA 4JDVA 5D2LB 1WJ3A 3OF6A 2EINB 4IL2A 3TX4A 4GX9A 1KFGA 5DCEA 3W53A 3DHUA 3QHZH 4ML9A 3SJNA 1QWUA 5HMDA 4LCIH 3M0HA 2AMXA 3U36A 1GA2A 1WWBX 3PG2A 3NRPA 4LCYB 4MSWB 4AM0B 5FOOA 4FXFA 4N85A 1MEIA 3BOXA 3B4UA 1BG4A 4XWGH 2W0PA 4PRHE 4APXA 1R38A 2JH2A 3TNNB 3WFDL 4BIKA 2OMUA 1KJ2B 1DQWA 2C71A 2VR5A 1P0BA 2E6QA 3L12A 4A8NA 5F9OL 4GVIA 4EAMA 5CSRA 5EFIA 1ULVA 3PHSA 3AWOA 1HZHH 3EX4A 4JE0A 1K77A 3FS2A 1Z6KA 4AY8A 1GYWA 3E80A 3B9VA 4YHNA 5K5YA 5H94A 2QCGA 3TN0B 1DO5A 1U1HA 2VE6B 2PNDA 5J7CC 3NGFA 1YEFH 4ZTOL 1INEL 1H7PA 1S5NA 5FGSA 3LSCA 4OZIA 1NKRA 1S1PA 3ZWSA 4ATDA 4B5WA 5IB5A 1HH9B 4MXVF 4L1TA 4NX5A 5SWZD 4REQB 2ROYA 3PQYA 2PTWA 4MQSB 1PGRB 4XVUD 2FJGA 1EO7A 5MHBA 1IU1A 5FUCC 4HDIB 3GB7A 2EDQA 2CLRB 1N64L 3O81A 1EANA 4LK4A 4OM0L 5IVXB 1SJCA 2YCLB 1XXDC 4O18A 1CFSA 5GGVH 4O52A 5D1QC 4OKVA 2OVLA 4JYDA 2ENYA 3HE7B 2QL1A 4TNVK 2IPUK 2Q5BA 1JV5A 2F5BH 1EJFA 1R3HB 2BTMA 3V5KB 4X7CC 4FQ1H 3VXNA 3GBEA 4C8XA 2BOEX 4HKBB 1H15B 1P4UA 1SHXA 1D8CA 5HDOA 3T77A 2CIKB 3VUAA 1G7HA 1KCKA 2SEBB 5IMMB 1GVYA 1ES0A 1UH3A 5D93B 3DBXB 4AEEA 2WBXA 5AD0B 1KTKE 2DDQL 2GBUA 3CFJB 3QKZA 4MDPA 2YDAA 4WDIA 1HAUA 4C5ZA 3L3HA 5IEKA 3EYSL 3QTGA 1E6RA 3P14A 4NQCD 1PSCA 4HX1A 4NO2B 4OZHE 4D94A 4DUXA 5E70A 1S7UA 1M7DB 4XNAA 2E77A 5LIYX 1HP5A 4WI7A 3AITA 3GUTB 2F74B 4G8AC 1QO5A 4KRZA 4L37A 4MA8H 4XCCL 5HYQB 2FZ3A 3PP4H 4JD4A 3WQOA 3S5LG 2BBFA 3STFA 3J8F7 5B38B 5FEWA 3BWSA 1AQKL 1JZJA 3QMTA 5HPOA 1GZQB 1A7NL 2YC1A 3IVTA 4OHQA 1A5MC 3JTSA 4FXKC 8PAZA 1DBAL 2DWEA 1RK5A 4JKNA 1ZIAA 1J9CT 1EZ2A 3IACA 3K30A 1RJYA 4UQ2A 5BS0E 3BH4A 3N42B 1UUSA 1WLHA 4A38A 3D0AA 3DOPA 5JR1L 1IGML 3OR7B 3PS7A 4HBKA 1F6AA 1MJ8L 4Z3GA 1OARH 4KZCA 4R3SA 2VMFA 1N5AA 3AQDA 5HK4A 5A5WA 2W60B 1PW3A 5EOTB 4QHKJ 1VLIA 1BM7A 4HV8A 1M7PA 2HCVA 3KCLA 5D32A 3RWIB 2WQXA 1OQFA 4JG0L 3IMTA 4J4PD 1KCVH 4ZSOA 5KAQG 3MJ8A 1CD8A 1JYVA 2A5UA 2FMNA 4NOFA 2C1IA 3JT2A 4PJEE 1TZIB 4Z7QE 3PF3A 4Q6YA 4D3CH 1FQ9C 2ZF9A 1ORSA 3RLSA 2YFOA 1IT9L 1UWGH 2Y5TB 3S5NA 4JIPA 1MHCB 2CZNA 5BZDA 3MXWH 3WL0A 3JVGC 3T44A 3DUGA 3VYLA 1N8OE 2YLAA 1W1B1 4W68A 3UXIA 3QHTC 2B0MA 3HS0A 1ZWIA 3QUZA 2R94A 4BFIB 3BHBB 4N9DA 3WX7A 2IH1B 1CGTA 3HIZA 3O6LH 3VXRB 2AQPA 3RF9A 2BZDA 3FTWA 4DQWA 3O8XC 1XIMA 3D39E 3JV0A 2P88A 3VNLA 2A3HA 3GSRB 1BQHG 2EUZA 3CZKA 5A3ID 4EWND 1FO0B 3B9KB 3WFZA 3QUZC 2ZOOA 5CCKH 3KVDD 2DLHA 4KVNL 2FPVA 4TXEA 3U7BA 5AVNA 5E8DH 3TYEA 3HI6L 3H0TB 2VL5B 4F33B 1UG6A 5B21A 4X80L 5LNVA 3WMPA 1UC4A 5C07E 4YSDA 3QRBA 3PABA 4M1RA 2FWOB 3MNWA 3E6EA 5HJBA 1V79A 3BOVA 2H3KA 1H0DA 3TH6A 2IO5A 3VYNA 2BSBA 4ZXBC 3RJYA 1XX1A 3F2DA 2OA9A 4FG0A 2VDPH 2Q87A 4P5MB 4NJ9L 1XW8A 1A3XA 2HJPA 2DQTH 1V3IA 4MDIB 3LSOB 2LLLA 3E0LA 1WH0A 3IFLL 4FMKA 3E02A 4JXCA 5IFHH 1PUDA 3VRIA 3ZE2F 5IMKA 4AEHL 3APCA 4HK0A 2IADB 3FH8A 1OVZA 2WYHA 3L5WA 3TA9A 1YJDC 4O51A 4NKQB 2I14A 3N18A 5AKRA 1I8IA 2XH4A 4IFRA 3GHPA 2PXYB 3MLXH 1BP3B 1S4IA 4JGMA 5JHDD 4JX6A 4BI7A 1A50A 4PVBA 2Q6ZA 4ODBD 5E6ZA 4JB9H 3WJMB 1W2VA 3KGTA 2EKSB 3DN5A 1DDHB 4RDZA 1JCMP 4PRPD 4RGNE 1ZY9A 1J9TA 1L7TH 4LTSA 3QO0B 5D71H 4TNGA 5KUMA 4WOQA 1OGBA 3M5ZA 3F05A 2DT3A 1MVYA 3FO2B 3HOJA 1QO3B 1F05A 4U2ZA 4U1KB 3MYJB 4LVFA 1YDNA 1NCCH 3KS0H 1W2PA 4XTRD 3MRQA 4FA7B 3COTA 5F96L 2IAAC 4JQVC 1XAUA 4NWTH 5DA4A 3GVRA 2NY3B 1E6ZA 2CIPA 2DP3A 2VELA 3VH8G 4RFOL 5AQ0A 5C0CA 1EUAA 1AGCB 4JIQA 3W2MA 5GJMA 1DVSA 1DBJH 1GYCA 1BF8A 3QUXD 4U1SA 2G5UA 4OLZH 2I5QA 2QJNA 4HC1A 1RULH 4MB1A 1UA6H 5JPMA 1MHHA 5FF6A 4NAEA 2DQGL 4G1MA 3EZ8A 3C8KB 4H26B 1GGOA 2AAMA 4O4YL 1AQFA 2ACUA 2Q8LA 2JFEX 1SBSH 4FERA 2GLKA 3FUFA 1CDUA 3P4MA 2CKBB 3N1MC 1TJ2A 2Z3FA 3KHOA 5LIXX 2DL9A 4HWZB 1XCQA 3H9HB 5DJAA 1WOAA 4MDJB 1IYXA 5I66B 2DJXA 5AC5A 3VXTB 2BVOA 3F2LA 3T6ZA 3WFBL 3NPVA 3HPLB 4NZ1A 4TVUA 4LNCA 3EOTL 2QJHA 1CFVH 4AMCA 1FC2D 4YDMA 1TJHL 1QHPA 2NYZA 3HG1E 3OHXC 4C57C 1UZ4A 2EIBA 1A3RH 1TETL 1S9KC 2C7UB 4ZQTA 1TWWA 2WJ5A 4G7EB 5D30A 4DY1A 4FOMA 2CGZA 4IOFD 4M24A 5AB0A 4QRPB 3BSZA 1VFBA 1TWZA 1NZRA 4KO7A 3SE9L 3HMJG 1KGCE 1PG7L 4MNGE 4XPTL 1MF2L 4OI8A 2NNXA 4KHTL 4LL4A 2VDNB 2IPJA 3MI2A 3TW9A 4NNCA 5AL0A 3BAEL 1XP3A 3RKDC 1V7NL 4GKSA 5FUZL 2PCEA 3QV9A 1SM9A 4IQLA 4G8EB 3EFDH 1JGLL 2DQEL 4JNMA 3WJZA 1I1AD 4D6HA 2KC0A 3A6CH 5IVZB 5I8OH 3CUFA 4Y5VA 2W9MA 1B9BA 1LCOA 4KEUA 2YZ5A 2XWEA 1LHZA 1DHKA 2VDIA 5D96C 4P3WA 4Y4HA 4QWWC 4AJVA 4KPHL 3LQAL 1BZEA 1OC6A 3NO5A 1PIFA 2GUOB 2J8UE 3RUGF 2O72A 4RIRA 2E27H 4MAUL 1JCVA 3RDTD 1AGDB 1IZCA 3BMVA 3IU3A 3VD0A 2C79A 3BZJA 2R1KA 3VFTA 2R23A 3OYXA 2NV9A 1K5NB 2OZ8A 3PWGA 4I90A 2PLMA 2VISA 1EDTA 3DYMA 3EG9A 4P3CL 3KPRD 3TIDA 1OM0A 1QTWA 3WLNA 3GKWH 4XNUH 5D7KD 3FU9A 5F3HA 1DJXA 5LUMA 1IKOP 1DQDL 3OA5A 1N7MH 1ITBB 1VZIA 3L16A 2HRGA 1F00I 1Q2SA 1N0XH 2AL2B 3ZJ7A 3UNDA 1KV7A 4NAJA 3RFAA 2AV7A 1NOWA 1F1GA 3VXRE 1G4RA 5CF3A 5DURB 3KRBA 4KI5F 2UX6A 2E7DA 3WTSA 4QPEA 4D7PA 4J9JA 1X7QB 3QUGA 3FT9A 1PLAA 3HHSA 3R8GA 5INCA 5E08H 1DWIM 1GYLA 1GKRA 4HHPA 1GQJA 2KT6A 3K7UA 2X0YA 2PXYC 4WGXA 3WUGA 4DYKA 1UYWL 1E8ZA 4ECLA 3L6FB 3TZVC 1AODA 3N4EA 4XISA 1EFQA 5KBPA 3HNTL 3EZJB 3TYCA 2OZNA 5C2CA 3NJLA 4FMVA 5E5MB 2V9QA 3WBAA 4PJDF 4LPXA 4MD0B 3R1ZA 3S1VA 1DXIA 2V5BA 4AV4A 4F7PB 2ZBTA 3TR2A 3QPYA 1A0EA 1EGVA 4FIQA 4DWSA 4ERSH 5IMLA 2Z9TA 1HESA 3LRKA 3N50A 5FO7A 3V4PH 1J6PA 1TZGL 4ZD3H 1BQUA 4DB7A 4FQXB 2WBGA 4S1QL 6ENLA 2WYTA 2WSPA 4GI4A 3UCDA 1S38A 1MJ8H 1FORL 2R2HB 5I6XB 1ET7A 1MAJA 3GD1C 4HLZG 4X5WA 2BWQA 4JIIX 4WDTA 1AK5A 1GC1C 3C2EA 1SN2A 3U0WL 1XGUB 3KCPA 4HK3J 3K1GA 3LHTA 3MSRA 3RWDB 2HXAA 3DBPA 4BK5C 3U6RB 4KRUA 2DQFB 1FIGH 1SZEA 2A6JA 4LQFH 4RGMB 5IQ7H 1UCWA 4NNXB 2G3FA 3BP4A 1RZFL 5A2KH 1MIMH 2GIYA 4EUPG 5F2LA 3WUWA 4NG3A 4XRCA 2C8NA 4QHMB 4ELMA 4M1BA 2VWEE 1TJ0A 5A2FA 4JKPL 4QGTA 4LYKA 4XCEB 2ZSVB 2F08A 4DJDA 1JVNA 1QNRA 1XLFA 1TYJA 2DQXA 1NBQA 5E94B 1OX4B 2YD0A 3L4WA 2F8OA 2CLPA 4GUGA 4XD3A 1FTXA 2X4TA 4Q9BA 1R3LA 2DLEA 2G3IA 2OXHA 5F6HI 4PB0H 4ADTA 1GKQA 4S3DA 1R3WA 4OZFH 5F4WA 2VDML 3GK8L 1FZOB 2DQDH 4N6RB 3ZL4L 4PUEA 1F4YH 4ODVH 1KTJA 1T3FA 2NXYC 3MVSA 1JRHI 5E51A 2GDUA 1DO6A 2EH7H 1Q66A 5ICXB 5ABZA 2IQAA 1SYSA 3JUZA 3ZN6A 3VFPA 5J4MA 1EGJA 1IBZA 4L1SA 1BKHA 2EPMX 4QMEA 4D1IA 3I02A 4U4IA 3OZLA 1K8CA 5CKAA 2V3GA 1R0MA 1G7QA 3L3KA 4CMMA 1VFHA 4PTXA 3W6LA 1KLUA 2KMWA 3BP6B 4WNQB 1PTZA 2J9YA 3DKLA 1A6AA 4ETQA 1FL3B 2WZ5A 4QRRD 2PURA 3AROA 2Z26A 2NQDA 1ZVSB 4IGHA 4N20A 3HF3A 4KWVA 5EMKA 4BK9A 4OFVA 1M03A 1BVOA 1BYDA 1H7RA 1NLBL 1NP0A 3N41F 3IGHX 1X5XA 4NNPL 1QRNB 3SQBB 1IC5L 5D2LF 1VRDA 5G2IA 3TXVA 4F2MB 4YDJB 1OP5H 3T6VA 2HROA 4DKAA 4W70A 5T5FH 2LLEA 2PZ0A 3PBWA 1RSFA 2EQDA 5DZVA 1NY1A 5HYJA 1IGYB 1S7RB 2LU7A 2MOVA 5K7JA 4JN2B 4ZT1A 4O9HL 5KVGH 2OQJB 3LKPA 1E9QA 5EHFA 2FBOJ 4XVOA 4X2RA 4BZYA 1GJUA 1NBVL 5D1XA 4PJ8A 4ZX4A 2PCYA 4C56E 1MDTA 4WW2F 4A22A 1VHPA 2HN7A 3OKOB 3QULA 3QQ4B 3RX8A 4YXLL 4QEHA 3BTNA 4R7DA 4F0MA 1PV8A 4NQDD 3SPVB 2GZXA 3LD8B 1RA0A 4OQTA 3SDXA 4HA4A 3C2YA 2NWRA 4XAZA 4ZGYA 1Y5WA 2IFFH 4HOXA 3TAOA 2YOCA 3KLAA 1BX2B 4HSQA 3BN3B 3TBWA 3Q65A 3ME0A 2XWTB 2DBJA 4R9XA 4H01A 5LNRA 4QTIL 3WF3A 3TW6A 2GWNA 1IQDB 4X7SH 3JXAA 3QDGA 1MZZA 4F5CA 3V52H 4Z3FA 2E1WA 2HTLD 2YL8A 2WB7A 2ZG2A 1SFHA 1BYPA 1U8QA 4L5FH 1UKTA 4NUQA 2JTYA 3CHSA 4GMSL 4Y2OB 5F1NA 4OSUH 1BYBA 3RIFK 2P10A 2PAJA 4Z7NB 2LQRA 4W8BA 1PY4A 2W80C 1EXUB 2W5PA 3S5ZA 3FFDA 1I4FB 2ZSWB 1MCLA 2JQZA 3UTSD 5TIMA 3P69A 1T5KA 1WBHA 1VFAB 4B95C 4FQIH 4O50A 1CBVL 2WB1A 2HSAA 2HX8A 4AZCB 2Y06L 1HTYA 2WYZA 3DRQA 4N8VA 1IGWA 4XZHA 4DP9X 2XX0A 3FONB 3INOA 3V0FA 2VH5H 3CHVA 1FYTB 2UUDH 5E2WL 2DDXA 1LXMA 4HMCA 5CSZA 1QCWA 2EJ1A 2PCFA 2QR0A 5CJMA 4D6JA 1A7RH 2FEEI 3EO9H 3CHDA 2OKOA 2X7VA 2BMBA 1F2QA 4J1UB 1I4NA 3IPEA 2WQUA 3CIAA 5LGHH 1M7XA 3MLZL 5ITBL 2NQJA 3B7SA 1ZMYA 3QDAA 2WO3B 1TTUA 4GGBA 4PLJD <