4UQ9A

X-ray structure of glucuronoxylan-xylanohydrolase (xyn30a) from clostridium thermocellum at 1.77 a resolution
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
390
structure length
390
Chain Sequence
HMASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTEVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords CARBOHYDRATE BINDING FAMILY 6
publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Ruminiclostridium thermocellum
total genus 138
structure length 390
sequence length 390
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uq9A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uq9A02
1KQYA 4F9DA 1WO2A 3ARUA 3I3EA 5FL1A 4HA1A 4CVUA 1CTNA 2NT0A 3SIMA 2X09A 1PBGA 5A8PA 4B3LA 3AMLA 3WNOA 4B9ZA 2D0HA 3CUJA 3GTNA 1J10A 1W3HA 1XV8A 4AZGA 1C90A 3RCNA 3GH7A 4JHZA 4F9JA 1GONA 2ZOXA 4MNJA 1E6NA 2UY2A 3VGFA 4CKQA 1CBGA 2CERA 4OBSA 3PZQA 4HPGA 3EJUA 3ARSA 1W3LA 4AWEA 1ZU8A 4P8WA 1G01A 1C8QA 3DHPA 1V0LA 4N0RA 1CGVA 1EDGA 3NJ3A 2VZUA 4S3JA 1KXVA 3ECQA 5BROA 1BVZA 2ZX5A 4CVWA 3CUIA 4WKHA 3AXHA 3VGBA 4JFWA 3BH4A 5DO8A 4WF7A 3N18A 4BQ3A 4CD8A 1CYGA 3SUWA 4PSRA 5A6MA 3AS3A 4TTGA 1UR4A 1J0JA 1TCMA 4XZBA 2YBUA 1JYXA 3S5ZA 4YPJA 3ARZA 2VCCA 1UKQA 2G41A 1C7TA 3SUTA 5AC4A 5A8MA 1HT6A 2MANA 2XYLA 1NOWA 5E6YA 3W53A 3D5HA 3BSGA 1E0VA 2G8ZA 4RE2A 4D6FA 3A4XA 3B9AA 2A3BA 1V3JA 1KFWA 4B9YA 1GQIA 3WMCA 3IAPA 1XCWA 3L4YA 1KTBA 5JBDA 4QCFA 3WDHA 4HZ8A 3LRKA 4QFUA 1G0CA 4DWSC 4D72A 2XIBA 2CCRA 3BLKA 3EDKA 2EJ1A 4CCCA 1GQLA 3W24A 3SUVA 4F8XA 3DX1A 3TTYA 4LGXA 2QLYA 4FLSA 1US3A 2J77A 1DP0A 4UNIA 1GOOA 1MWOA 1HWWA 1JZ8A 3A24A 5FL0A 3GZAA 2V3EA 1UWRA 3ZM8A 1ECEA 1U30A 3WMBA 3VD4A 2J8FA 3WY4A 5IDIA 2XWEA 3AMCA 5BCAA 3W37A 3VSUA 1E73M 3H54A 3D3AA 4L4OA 2YOCA 3RM4A 3UERA 3AHTA 3VX1A 5DT5A 4ZEPA 1C91A 1Q6EA 2WVVA 1MQQA 1E55A 5LYRA 1IV8A 2C8NA 3AHYA 2ZXBA 3MUZ1 3OGRA 3EJQA 4H2CA 2AOSA 2XVLA 4JKLA 1A47A 5CQ1A 3VSVA 3JUGA 3VD5A 5A8NA 1XHGA 1E1EA 1JXJA 3A3HA 1MW0A 3SEPA 3N15A 5EFDA 1QWNA 4W7VA 3ARXA 1CLXA 1K9TA 1X6LA 3NSNA 3EJTA 3AMDA 4FMVA 3QHNA 3RILA 1AQHA 3PZOA 3WNLA 2RGLA 4CU8A 2V38A 4OKDA 2D20A 4JAWA 2YLAA 3GH5A 4TXEA 4CCDA 4OIFA 3GNPA 5A8QA 4CGTA 2VX5A 4GXPA 4KWUA 4CN1A 2ZICA 1TFVA 1P6WA 2XGBA 3SCWA 2UY5A 5FCZA 2E8YA 1K9DA 2WC7A 3K4DA 1TUXA 4CUCA 3EDJA 4MNLA 4W7WA 5C70A 3WL1A 4M82A 1JFHA 5GNYA 5KZ6A 1UYQA 2WXDM 3EDFA 2PC8A 4UOJA 1GOIA 3UG3A 2XTKA 2PWDA 1JDAA 2WKGA 2VR4A 4JKMA 4PCSA 1FFRA 3CO4A 1HJVA 1G5AA 2O92A 2O9TA 3VTRA 1J11A 3ZSTA 4JCMA 3LMYA 2WK2A 4CU7A 1JI1A 4ATWA 1E0WA 5A6LA 3WIJA 3T0BA 1UWSA 4HOXA 1JYVA 2WVVB 1ODUA 1E4MM 1EXPA 3FNDA 5I78A 1LL6A 1QI2A 4W7UA 3EDEA 1PIGA 3DDFA 4MNMA 2E3ZA 4AY1A 1OT2A 2XIIA 2OSWA 2BHZA 1E9LA 2A3CA 1CDGA 1U33A 2WMIA 5BRQA 3VD9A 5A95A 4XZWA 5I23A 2WBKA 3FW6A 2VX7A 3WEOA 4EE9A 3VO0A 1LQ0A 3K1DA 2W62A 2F18A 1KWGA 4FNPA 2G3JA 2DSWA 2GDVA 2W91A 4H8VA 4M29A 1QOXA 5JUVA 3ZO9A 4E8CA 1V3MA 1UD8A 4AYSA 2WLYA 4JCLA 3W6MA 2J7BA 2ZWYA 3THDA 5E0CA 1QNRA 3GXMA 4BF7A 3WQ8A 2D1ZA 2WZIA 2VQTA 2BVTA 4AZCA 3K4AA 1JG9A 4J3WA 3PTKA 3WF4A 3N17A 1NM9A 1ZBVA 3OGSA 3D4ZA 1LWJA 3WF2A 4MB5A 2EPLX 3WH9A 2WZHA 1CLVA 2Y5EA 1BLIA 2WM0A 3ZQ9A 3O6AA 4IISA 1H2JA 3PZNA 1UA3A 1OB0A 1BYAA 4PMNA 3LPFA 4X0NA 4WKFA 3ARWA 4ZENA 3QOMA 2Y2WA 1V0MA 3AS1A 3KLLA 1V0KA 1B31A 2AMGA 2GSJA 3SCTA 5CJ5A 3DYPA 1M53A 3O2LA 4AEEA 2DT3A 4UFHA 4M81A 4QCEA 2YA1A 2CKRA 4DWSA 3B8SA 1B90A 2ZX6A 5M17A 1CIUA 1GOMA 4QLJA 3IGUA 4JKKA 4AISA 1V02E 1GVYA 2DH3A 4U3CA 3I3BA 3A47A 1AQ0A 2ZUTA 3WQWA 1UWIA 1WP6A 2WMIB 4W5UA 1SYTA 3CZJA 4AZ6A 1EA9C 1DWAM 1O7AA 1NOFA 3QHMA 2WHJA 1E6SM 1TVNA 1CGTA 3SCOA 1JAKA 1WKYA 2J75A 4D6HA 3CGTA 1UHVA 3HZ3A 2JE8A 2QMKA 1W2VA 3IANA 4AMCA 4NRSA 1CGXA 1E70M 4W8BA 4A3YA 2D0FA 1LG2A 1V6XA 1GPFA 4DUVA 4RL3A 5BWFA 5IHSA 1VEOA 2QHAA 4TX6A 3M6DA 2VNCA 1W9DM 2XWDA 2Y4SA 3CV5A 4AZCB 1OM0A 1NWSA 1N82A 3F5KA 1JIBA 3BUPA 5CGMA 1OINA 5D8ZA 5FD0A 3VDHA 2VZSA 2XVGA 1TR1A 4E8DA 5JIWA 3KLKA 3TV8A 4AD5A 1UD2A 1HP5A 2CKSA 5JBFA 1NOUA 1K9FA 4LQ1A 3RM9A 1WZAA 3RMEA 3HMCA 1ZJAA 3GNRA 3D4YA 2YL8A 1JZ5A 2GDUA 2BVYA 1FP8A 1UKPA 3CIVA 3WDIA 3DX3A 1XRVA 5IXEA 4DWSB 1XSKA 1W3KA 5A6KA 4DUXA 2FH6A 1OD8A 3ARQA 1WE5A 3CZ8A 2YDQA 4AMXA 2ZWZA 3MANA 2DSKA 1E1FA 1JF5A 3WD1A 4CU6A 4OGZA 3AICA 3G6MA 4U2ZA 1W32A 5D8WA 3B9DA 1UWTA 1E3XA 2VTFA 2V3DA 2BS9A 1HX0A 3H55A 1Q6FA 3A22A 3LPPA 4H04A 5C71A 1G9HA 1Q4NX 3DHUA 4W84A 4A3HA 3VIPA 5A2CA 1J0YA 4U2YA 2JEPA 3VDAA 4EAMA 2VMFA 3K46A 1TG7A 4HU8A 2PWGA 3GBDA 4M56A 4AC1X 3SCQA 1MW3A 4CN6A 1V08A 3WFLA 3CHCA 1KXHA 2XVKA 4FNUA 4UQ9A 2GUYA 1E40A 2FGZA 3VM7A 3NUKA 3MMDA 5I5RA 4B15A 1XH0A 2PWEA 4GO9A 1E6PA 1TZ7A 1M04A 2EEXA 3AMKA 3KE0A 2YJQA 4PMQA 2EAEA 4W87A 3HG4A 2QF8A 3RJYA 2F8QA 4W86A 4PSPA 1W9BM 1DEDA 3WQ6A 4GKLA 4IPLA 3U5UA 4W93A 1HL9A 1HJXA 3AZRA 4KGJA 4OJYA 1F4AA 2OYLA 2BY2A 2J4GA 4ZE4A 1CGUA 3FHAA 4D6IA 1CZ1A 5BRPA 3HU7A 4N42A 1GCYA 2FH8A 2EPOA 5ABGA 1BF2A 1KXTA 4FK9A 1UH4A 4IUGA 4WKAA 2DT2A 3WD0A 2CNCA 2X2IA 2XN2A 3BAKA 1Q6CA 1L0PA 1TE1A 2DGAA 2D0GA 1BYCA 3CC1A 2VI0A 3ZJKA 4PBGA 2EABA 1MXGA 3M07A 4QDMA 3HG2A 2EQDA 1E3ZA 1C8YA 1VB9A 1TA3A 4Z2IA 2W4XA 2JF7A 3FAWA 4B3KA 3N1AA 2F61A 1IZKA 3DECA 4PMYA 2PWHA 3H53A 1H11A 2XVPA 4P8XA 3POCA 1WPCA 4PMZA 1HTYA 4IPNB 3K8MA 2X0YA 3PN8A 1GQJA 3SURA 2VX6A 2YFOA 2FDMA 4DM2A 5CPTA 1MFVA 1HP4A 1DWHM 2WC3A 1VIWA 2IUZA 2CITA 3PZUA 3L4WA 1KGWA 4GI6A 4AIEA 1CGWA 3HG3A 2EPKX 3BUIA 3LRMA 1XSJA 1V6YA 1JI2A 1CPUA 1JDDA 1S46A 4AZIA 1J12A 4OBRA 3T09A 1MVYA 4AEFA 2BNJA 2TAAA 2ZUUA 2NSXA 3NSXA 1H09A 4CN4A 2W66A 2XM1A 1QWUA 2W61A 4MPKA 1H41A 3VDCA 1H3GA 4UTFA 3VIJA 4ZE5A 2YL9A 4UFMA 1JDCA 1R87A 3U5YA 3GXTA 1MXDA 3AIEA 3FXYA 1BVNP 5A1AA 2CIPA 3BLBA 4V2XA 3AXIA 4DM1A 1G94A 2WPGA 4XUYA 4MJ2A 3N13A 5HOSA 3AYRA 1HF6A 4P7NA 3GXDA 3EJRA 4YHGA 3K8LA 2GVYA 1NWTA 4NSBA 1HKMA 1M7XA 5JBEA 2VZTA 3CHDA 1TA3B 1WCGA 4E4PA 5I0DA 1CXLA 2E8ZA 1ZBCA 2J7GA 4P8VA 4JL2A 4TVUA 1VJSA 5FKYA 2BV9A 4PEEA 3CPUA 1JYWA 3VSTA 4L4PA 3UG4A 1H0IA 4MDOA 4NXSA 4PMUA 2D73A 9CGTA 1MW1A 4P8UA 3FY1A 2F7OA 3CZNA 3CMGA 1R86A 6CGTA 2C0HA 2VX4A 2DSVA 2FHBA 4H41A 2XJ7A 4OOUA 2Z1KA 4H8HA 1G1YA 1JNEA 1R34A 3OBAA 1UH2A 2XSBA 5IFPA 4EK7A 1RP8A 3BGAA 4PMVA 2DIEA 2WMKA 4GQQA 4CD4A 4D1IA 4C7DA 4Z2KA 1W9UA 2C7FA 2E9LA 5LA1A 4M8UA 3HJEA 3WUEA 1KXQA 1GORA 3U57A 3D52A 3CH9A 4Y7EA 2E4TA 3F4VA 3WDPP 2VR5A 5BYWA 4TOQA 2J7CA 1W1VA 3VGHA 3BAYA 2WSKA 5BXSA 4W8LA 3VGDA 3SUUA 3OG2A 3N12A 3S5YA 3VD7A 3L2MA 1NQ6A 1V3LA 5CZKA 2WW5A 3WF1A 1UZ1A 2BVDA 2WMHA 3GM8A 3T2OA 4UCFA 1NP0A 5A6BA 3M7SA 4JFTA 2BFGA 6TAAA 4CD6A 5D9PA 5D9MA 4HPHA 4P7RA 5I77A 3W27A 4AD1A 3UEQA 1CECA 3OA5A 1WB0A 3KWXA 3SUSA 3ARYA 1ISYA 2QV4A 1E0XA 2BHUA 1DHKA 1EOMA 3LXBA 1MQRA 3BVXA 3W29A 3BUBA 2FHFA 4J3XA 1KCLA 2QPSA 3NDZA 3WELA 2OYMA 4M24A 3CZKA 4EANA 2WWCA 3RM8A 1DWIM 5BXTA 3KL5A 2EADA 1KR1A 4X9YA 1JAEA 1FOBA 4JZ5A 1UKOA 1UR0A 2WWDA 1TQWA 2J7FA 3WDRA 4KMQA 1HVQA 6A3HA 2OSYA 3BUQA 2JEQA 2ZUWA 3ZIZA 3U7VA 4ACZA 4D6EA 4MJ4A 4UQAA 1V03A 2YFNA 1E6ZA 1D2KA 1FP9A 1E71M 3CLWA 1L8NA 4PCTA 1EHAA 1UWQA 4AD2A 3EYPA 4AIOA 4HA3A 1PAMA 1R33A 3AZTA 1UR8A 1V3HA 3BXWA 4GIAA 2VCBA 3O9NA 4OOZA 1CENA 1MYRA 1WDSA 3CHFA 2VC9A 4B16A 2BXZA 3AISA 4D6GA 1GHRA 3G6LA 4D6JA 2YLLA 2J7DA 4NZCA 1QNOA 3NSMA 4E2OA 3L4ZA 1CEOA 3W0KA 4PTWA 1HVXA 3TTSA 2WCGA 3VIHA 1V0NA 4NI3A 3CZGA 2A3AA 4M80A 3BVVA 4W5ZA 3MUIA 5CSYA 3AIVA 1KR0A 3ZT7A 3WH7A 1WAWA 2X1IA 4UZSA 3OIHA 1SMDA 1ITXA 4JIEA 3N11A 4HMEA 4X0VA 3AHZA 5CXPA 1OT1A 3WH6A 3TOPA 1B3ZA 3WQ4A 2D3NA 1R75A 3BAWA 1KGXA 4HU0A 4HZ7A 1B1YA 3LRLA 3CHEA 1C92A 1UUQA 1O6IA 4CCEA 2EPMX 3CBWA 3WNPA 1LL7A 3VU2A 3F5JA 2DT0A 1PS3A 2YBTA 2GFTA 3N9KA 1CXIA 1MQPA 3ZT6A 2V5CA 1HXKA 3BCFA 3AIRA 1QI5A 3T08A 4FNTA 1DWGM 3TP4A 3B9EA 4W88A 1GOKA 1H49A 2ZIDA 3L4XA 5KEZA 4R5EA 1WDRA 3WBEA 4ACZB 5HXMA 3WNMA 1V3IA 2DSZA 3A4WA 5HPCA 1AMYA 5M3WA 3NDYA 3SCRA 1QI0A 5A2AA 3WH8A 3WKZA 3T2QA 1C8XA 2DT1A 3POHA 3WUGA 3PZVA 3VIMA 3BUDA 3AIUA 1OGBA 3DX2A 2D22A 2VCAA 1HKJA 3WD4A 2ZXQA 4TVCA 1GHSA 3W4RA 1RPKA 1R8LA 3BVUA 3VIKA 5CLWA 2EPNA 2VVNA 2F7RA 2X2HA 3L4TA 3ZR6A 3AS0A 4HZ6A 3SCSA 5D9NA 1QNPA 3BCDA 1GJUA 2F1BA 2JIWA 1E6QM 4D71A 1XSIA 1PPIA 2WVSA 1VFUA 1ISWA 1JNDA 1V02A 5TD4A 4P7LA 4NZFA 2VURA 4LX4A 5FIPA 3NIYA 3WSUA 1GQKA 1J0KA 2VUYA 3OLIA 1F4HA 3SCVA 1B3VA 1XYZA 3UR8A 1PZ3A 3W26A 3VGGA 4MADA 1MW2A 2CXGA 1CXEA 2Y8VA 5HDRA 1EGZA 3OLEA 3J7HA 1OBAA 1HL8A 1QBAA 2WHLA 1UWUA 1O7DC 1QHOA 1HJQA 4ZXOA 4DO6A 1CGYA 2QPUA 1XD1A 2F7QA 1QVBA 1LLOA 1UQZA 3VPLA 1E6XM 2OWWA 4JFUA 3EBVA 3DC0A 2WBGA 2EO7A 4U5IA 2YL6A 1RP9A 1HIZA 4C7FA 3WFZA 2A3HA 2VRJA 1UD3A 2E9MA 1KB3A 3AOFA 3E1F1 1VAHA 3ZMRA 1KBBA 4PMOA 2W5FA 1PEZA 4TUFA 2CESA 1X1NA 2YDRA 1JZ3A 2PB1A 2FGLA 2WZEA 5FOOA 3NYDA 3MV01 3CZEA 2OYKA 1BSIA 1BTCA 1EO5A 2WMJA 4HP5A 1GNXA 3AXXA 2OSXA 1BG4A 2DPEA 4XV0A 5GQBA 1UR9A 1C93A 4TTUA 1SR0A 1QX1A 4AIUA 4FNSA 1JD9A 1BYDA 3VVGA 3AIBA 2J78A 1PX8A 4HTYA 4BQ4A 1WNOA 1E5JA 1B3XA 1H4PA 5I79A 4LPCA 2EACA 1GW1A 1LG1A 4FF5A 4HOWA 5GNXA 1M01A 3WF3A 4NRRA 1UOKA 3RJXA 1VBUA 2PBOA 3WUFA 1W9PA 3CMJA 4Z2GA 3VGEA 4V28A 5E70A 1TQVA 1JZ7A 4PMRA 1W9VA 1J0IA 2VOTA 4BZYA 4LXFA 2G4FA 2PBGA 1E5NA 4AD0A 2GJRA 4JFVA 3RIKA 4XB3A 2DDXA 2JALA 5ECUA 3BC9A 1US2A 3A5VA 4UFKA 3DYOA 4C7GA 3TONA 4J27A 4W85A 3ZJ8A 2VZVA 1UG6A 2XUCA 2VL4A 3EMQA 2CHNA 4LYPA 1ITCA 4DO4A 3VOCA 3PZGA 3BMVA 2BY1A 3M46A 3RO8A 2ZX9A 4FNQA 3PHAA 3PZIA 2WB5A 1E15A 1V6WA 8CGTA 4ATLA 1PX4A 1J0ZA 2W67A 4Z2JA 2ZX8A 4R27A 3A6OA 1LL4A 2HISA 4Q22A 1EO7A 2XFYA 3VD3A 3AQUA 2XN1A 1BQCA 2WHKA 1VF8A 3W25A 2X05A 1E43A 3W81A 3MKKA 2ZE0A 3AIWA 1H0GA 1PZ2A 2OW6A 5CSUA 2G3MA 2WLZA 2XM2A 2WYSA 4GQRA 3OLDA 4UR9A 2WCAA 5EB8A 1HJUA 3MMWA 4MAVA 3IJ7A 3FHQA 3ARRA 4WJXA 3KEHA 3D51A 1UASA 1NP2A 1OCQA 5AC5A 4ZXLA 2F2HA 2ZXAA 3WL0A 2E9BA 1CXFA 1QW9A 3WUBA 4F79A 1EH9A 5EMYA 2WMGA 5DEZA 4QLKA 3ARPA 5E6ZA 3QOKA 3GXPA 3MV11 2V3GA 4D6DA 1XYFA 1UH3A 4FLQA 1BPLB 1PIFA 1J9YA 2YL5A 1Z32X 5JIPA 1QI4A 5A6BD 2WC4A 1BGAA 3GXNA 2Q8XA 2UY3A 5I24A 3VMOA 1BHGA 2BHYA 3AHVA 2J47A 3LXCA 2YA2A 2XFRA 2V3FA 1DWJM 4UFJA 3FAXA 1R7AA 3WQVA 1W2PA 1GJWA 1FH8A 1HKIA 1HJWA 1DTUA 4MAZA 1QNQA 2J25A 3PZ9A 3FN9A 3EMZA 4AMWA 2CBVA 1KWKA 3U7BA 2VJXA 4PN2A 3SCPA 1NWRA 2OWXA 2VO5A 4PUDA 3KL0A 1W1TA 2JF6A 3WQ5A 4FNRA 3UCQA 1GOQA 1XCXA 2J74A 3CTTA 2IXVA 3PTQA 3UETA 1V6VA 4BA0A 1TQUA 4FLRA 2F7PA 3DX0A 1GVIA 5HBFA 1JYNA 4JHOA 3BAXA 1SZNA 2XFFA 3VIGA 4GI8A 1UQYA 3DYMA 4PYSA 4WSKA 3BSHA 3A23A 3VIIA 2Z1SA 4W8AA 1EQPA 4LYRA 4BQ5A 4AW7A 1OGGA 4J3SA 3CZSA 3TTQA 1KTCA 2WVUA 1YQ2A 3HG5A 5GNZA 2RGMA 1OSEA 1JZ2A 3AFBA 1UKSA 2NW0A 1BGGA 8A3HA 3AJ7A 2E0PA 1ZJBA 3WENA 3MUAA 1D3CA 4ZFMA 2EBNA 1EDTA 4HMCA 4FLOA 3GH4A 1FA2A 2ZUNA 1UZ4A 2WSPA 1WZKA 2VZOA 4TVDA 1JL8A 5A6SA 5CLTA 1OD0A 3WEMA 4WSJA 4Q7NA 1WZMA 3IJ9A 1B0IA 1SMAA 4BCEA 5E1QA 2W63A 1GOWA 3A21A 3S2CA 2ZX7A 3ALFA 1WDPA 4MNKA 2FE0A 5F7UA 1KBKA 5M03A 3SCNA 4J7RA 3VX0A 4UOZA 2O9RA 4UQEA 5CGTA 2OLHA 1FH7A 4NZJA 2D2OA 3OZOA 4DWSD 2BY3A 3LXAA 3WY3A 4MB3A 4H8UA 4NX0A 2O9OA 4KRTA 1VFFA 4GO8A 2VRKA 3GNOA 5EBAA 4ML4A 1TMQA 5ABHA 2D23A 1QI3A 3PZMA 5LA2A 1AVAA 3IK2A 2EXOA 3VNZA 1FHLA 3MI6A 1VBRA 1U2YA 2XVNA 5M5DA 4UQBA 5AYBA 5HPOA 3NCOA 4YHEA 3QHOA 2VT0A 4MB4A 1SFSA 2E40A 1VEMA 4PMXA 2PWFA 4P7OA 3W6LA 1FFQA 3BVWA 3AYSA 3CUHA 5DFAA 3D50A 1VENA 2GJXA 3MO4A 1W3JA 1KGUA 1VFOA 2D24A 3AS2A 3WD3A 1C3FA 1ODZA 4BS0A 2J7HA 1ISVA 5HNNA 5DF0A 1C7SA 2W92A 3LX9A 1MFUA 3WH5A 3TTOA 2YIHA 2X2YA 3QGVA 1JZ6A 4PMDA 1W9XA 4PTVA 2UWFA 5I2UA 1T0OA 2ZUMA 1BFNA 3ZSSA 4QLLA 4UFIA 2DSUA 2ZXDA 1BG9A 1NARA 1FHDA 1YHTA 3UESA 1TVPA 4J3UA 3GDBA 3WEZA 2J62A 1H5VA 1JXKA 3KZSA 1ZS2A 2WMFA 3PZTA 4WIWA 4PUEA 1NH6A 1J18A 3THCA 1R46A 1I75A 3WDQA 1PJ9A 1M03A 4V27A 2DIJA 2CBUA 1EQCA 1LWHA 1CNVA 4AZBA 2WKLA 1XD0A 4AXNA 1OWQA 4K68A 5ABFA 3IAQA 1EOKA 3T0AA 2DH2A 3VINA 3RDKA 1E4LA 3BAJA 1B3WA 1I1WA 2X2JA 3WMSA 1J01A 3AHXA 2VRQA 4GZJA 5A6JA 5A6AA 5E9AA 1IT0A 2VQUA 5I3DA 1CWYA 3MS8A 3EMCA 1DWFM 1W1PA 1H1NA 1R85A 1JD7A 1K6AA 1UD5A 7TAAA 4AZHA 1XH1A 1KQZA 1LJYA 4GI9A 1KCKA 1BYBA 2Y24A 5E0FA 2QMJA 4KH2A 1QPKA 3ZR5A 3SCUA 4XX6A 4AD3A 4HOZA 2ZUVA 1BAGA 1LF1A 1EIBA 2DEPA 2YDSA 2CHOA 4MB1A 5A8OA 1UR1A 5CPQA 3VIOA 1B9ZA 2GJXB 2O9PA 5D9OA 1HJSA 3RPMA 2B31A 4H7VA 1NWUA 3WY1A 4W89A 3W38A 1XC6A 1VEPA 4PTXA 1ISXA 3L2LA 4JL1A 4LYQA 2DQXA 2XSAA 3WBAA 2NT1A 4HMDA 3VILA 4PTMA 2IXUA 4KRUA 3I3DA 1PX3A 1WDQA 3VIFA 1V6UA 5EFFA 4KGLA 2XPKA 3L4UA 3VUPA 2FHCA 5IHRA 1E4NA 3WNNA 1VJZA 1HN1A 2WHMA 2OWCA 3MSGA 4UFLA 5D4YA 1CXHA 3WY2A 2AAAA 4NXKA 3IJ8A 1I1XA 1VRXA 3AI0A 3WNKA 4IM4A 2PI6A 5ABFB 4D6CA 3AZSA 4OZOA 1Q6DA 1A3HA 4J3VA 3VMNA 3N04A 1J0HA 5BXRA 1RH9A 3BLPX 2CYGA 2XHYA 2JFEX 3UR7A 4NF7A 4M1RA 1E56A 3EDDA 1E4IA 3W82A 2JIEA 4MDPA 5A3HA 2CBIA 3DX4A 1Q6GA 4J3TA 3CUGA 3GXFA 4P7QA 3WF0A 2BY0A 2X0HA 2YA0A 3DDGA 5A69A 3VDBA 2XGIA 1JZ4A 4WK9A 1EDQA 2V5DA 3ARTA 2IGTA 1JFXA 1GUVA 2GK1A 2OW7A 5LA0A 1ZL1A 5DMYA 2ALWA 2X8RA 7CGTA 3BMWA 1AQMA 4RE3A 3VKKA 4GINA 2WAGA 1UD6A 3OLGA 3EJPA 3T0DA 3ZJ6A 4ATDA 2WCSA 3MUY1 2BXYA 3APGA 4YN5A 4UZUA 3AIQA 4JFSA 1V3KA 5AYIA 2ESCA 3ZOAA 3F5LA 1B3YA 3CUFA 3II1A 3A4AA 3GYCA 4A4AA 7A3HA 2WVTA 2F1AA 4UQCA 2Y8KA 3MU7A 1HXJA 3PTMA 3ARVA 1QNSA 4UQDA 3AROA 1QBBA 3MSDA 1W1YA 4Z2HA 4PRWA 3BAIA 4CD7A 5CG0A 3VM5A 1ESWA 5AY7A 3UG5A 2G3NA 2WANA 1UD4A 1XGZA 2D3LA 2ZUSA 2WNWA 3QR3A 2PF0A 3KL3A 1HKKA 1UA7A 4CD5A 3K8KA 1B2YA 4Z2LA 4MTVA 1EHNA 4HA4A 1RD6A 4U3AA 4GZIA 2YKKA 4OUEA 1X6NA 3WDJA 2VVSA 1VFMA 4WLCA 1R7OA 1JF6A 1E72M 3OGVA 4AZ5A 1CXKA 1FH9A 2XG9A 5A2BA 5CPSA 1ZBWA 3OZPA 3W28A 1E6RA 4URIA 4DO5A 3ALGA 2J79A 4F66A 3GBEA 2GK1B 3EJSA 3LPGA 1W91A 2CBJA 4ACYA 1OIFA 3ZT5A 4QP0A 2G3IA 1TQSA 2GJPA 2UY4A 1B30A 1Y7VA 1UKTA 4GPNA 1JGIA 1XH2A 4U31A 1IZJA 5DT7A 4J28A 3TA9A 2J8GA 3AMGA 3CZLA 2CPUA 1ZB5A 4U5KA 1K9EA 4S3KA 4EKJA 1TQTA 4U33A 2CETA 1QHPA 4UOQA 3GXIA 3VMPA 3WN6A 3T2PA 5C8BB 5A94A 1GZJA 1WZLA 2FYVA 1OGSA 3LPOA 1ISZA 5BXPA 4AD4A 3VNYA 3MMUA 2A3EA 1OIMA 5E09A 5I6SA 4RE4A 2J7EA 1D7FA 2HVMA 4GZEA 4AYGA 4AZ7A 3HN3A 3ZJ7A 1UR2A 5GPRA 1QHZA 4BQ2A 1R47A 4D1JA 3L4VA 3PBGA 3WD2A 5ABEA 1ZBKA 1HNYA 2XN0A 2CEQA 4DUWA 4QAWA 3S6TA 3BVTA 4TX8A 1QW8A 3OB8A 5IFTA
chains in the Genus database with same CATH superfamily
2H8PA 1I2NA 1FL3B 4KK6C 3NZ8B 4A05A 1MMFA 4O02L 2WLLA 4B9ZA 2D0HA 4AZGA 3UJ2A 3TO4B 4INFA 4KFOA 1BRLB 5A7EA 4Q6IA 2D3JA 2D7OA 4B41A 2ZOXA 5I71B 3GC4A 4IIQB 1CBGA 4Q0XH 1P53A 4G9FD 2BOCB 3QI9D 1I4FA 4N0RA 4Y2DA 3G8RA 4ALAC 4YXGA 3IN2A 3UTTE 4WKHA 4QG9A 2EIBA 2ARWA 2OMBA 3X14B 5IK3A 1OF8A 1CYGA 2RACA 3GIQA 3FCBA 5DK3A 3DO7B 1IR1A 1TPFA 3QYCA 4UTIA 2IALA 1EEZB 1C7TA 1U1HA 3QJFB 4BI5A 5AC4A 1NOWA 3TU6A 2D7TH 1N4XH 2X0VA 4E2VA 3BLDA 2GB2A 2CHRA 3ARFC 4PJGF 1XEUA 4BI6A 4HAFA 3DX1A 4N87A 1PZUB 1PZ5B 1UT9A 5I5IA 2JSFA 1M9SA 2AJSL 4LEOB 2XN9E 4CKVX 4BF5A 2YOCA 3UERA 3SFWA 3EFDL 5TF0A 3N6JA 4P04A 2E9WA 1AY1L 1BQLH 1LK2A 1X7QA 4NOFA 3G0SA 1ODAA 5F2MA 1JNNL 3BG3A 1A49A 1MW0A 2J8UB 3NIGB 1GVSA 5KJ7E 4MJ5A 3PE9A 3KWVA 3P0VH 4FXRA 2Z4QB 2UUDH 5T5FA 2XZQL 2G75A 1MCOH 2FPYA 4I13B 4WK4B 4RGOH 4CLMA 4GXPA 3NH7H 4M8VA 2BSDA 3O63A 1T89C 4J5VA 2PDWA 3WE6A 4NQCB 1ECYA 1QPNA 1AFVL 4A37A 3CQ0A 2PDHA 5IOKA 4UOJA 2XIMA 2DQGL 2YAOA 1R9XA 5F7DB 1OANA 3O4OB 2ZZ7A 3H3KA 5H94B 4US5A 4N2GA 4OGYL 1P4UA 1RZ8A 1W8EA 2ADJA 4CADB 5JMOC 3B2XA 4G2AA 3KZPA 4EF3A 2E6JA 1U33A 3ZIMA 2MQGA 5IG7A 4QHNA 4QG6A 2CBMA 4N2BA 1YPFA 3FHEA 4LHUA 4G70B 1DVSA 3HNVH 1WWAX 1GW0A 2DI9A 1CO1A 4XZ9A 1R3KA 1PJWA 1V3MA 3U6XA 2HTLC 1U0QA 5JXEC 1DE5A 3VFNB 4AZCA 2FT7A 1S2AA 4IDLA 3MNZA 3SYAA 1NM9A 3ZYJA 2BCKB 2WZHA 2BCMA 3EGSA 4P5KB 3WIFA 1PZCA 1Z5LA 1N6QL 2B59B 3VOIA 5BS0E 5EYWA 1KIRB 1BF6A 3C9NA 3S36H 1KB9J 5AALA 5BOFA 2AW2A 3ARFA 1CFSB 4UTTC 2GTWB 1XUZA 3PP7A 4MDRA 4JDZA 1FWXA 5J89A 4J3OD 4JBRA 3ZHLA 5IMOB 4IP4A 5GGSB 3STFA 1JZFA 3GMOA 3CXFA 3EYVB 3LQAC 1TVNA 4JN2B 3GYEA 5AW4B 3CGTA 3DRQB 3DGBA 2PF6A 1RUKH 1BBDL 3GC3A 3WTVA 1BJ8A 5ISZE 4KO6A 2CLZA 1XPYA 1P0SE 3ZN6A 4LASL 5HDQL 4BV1A 4RL3A 2VITA 4ODSL 1OINA 5JIWA 3TV8A 3PG2A 1QRNA 1MJJB 5IHUH 2DQIL 1SZRA 3E3QE 5AVHA 3FNKA 3F5WB 2OPCA 5LCVL 2WQWA 5DXYA 5ICXA 5E5UB 3ECWA 2IH9A 1TQCC 5HUOA 3WDIA 3VNDA 4JY8A 1T89A 2OZ4H 4QRPE 5EPMA 4AMXA 1RAMA 4BZ2A 5I6LA 2BNRB 1YECL 2AJ3B 4G8FA 5D8WA 3VNKA 4Q3MA 3MO1B 5ICZA 3KBVA 1HX0A 3UG8A 4UR8A 4A3HA 3ZHKA 4F7TA 3OF6A 3QWRA 2PLTA 3NQVA 4KJQC 3HE7B 3Q06A 4HU8A 1NC2A 3L23A 1WG3A 3BGFC 3RX7A 2EO1A 4ZTYA 1K8IB 5JW5A 3T0CA 1NMAH 2ZKWA 4OLWL 2EXTA 4ZFCA 2H8ZA 1V6TA 4XTDA 3MMDA 4DGWC 4LB8A 4PYHA 1KFEA 1XIEA 3MB9A 3UMTA 1Q9KB 1X9QA 43C9B 2EAEA 3TJXA 1F6FB 5JXEA 1IUZA 1DEDA 2YQBA 4IPLA 4M9PA 2PDNA 3ROLB 3IM1A 3PXLA 4AMKL 3TYAA 4OZFB 3PSVA 3D07A 3ECBA 3BEVB 1J5OL 2CWXA 5TBOA 4KRMB 1XZWA 1P0BA 4E3TA 5TFSL 3ML9A 2ASHA 1XIWC 4I7ZC 3D05A 1QFUL 4KAQH 3UTSA 5ELIA 4WEMB 2Y36H 2PUQT 3N43B 3H0TA 3O45A 1L0PA 1U22A 1H5BB 2X87A 4K38A 5IV2A 4UTTA 3WTUA 2D31A 2X4RB 2H47C 3O7UA 1E27B 2A4EA 1RK1A 2QV5A 3NAVA 4P8XA 3VI4E 3QV8A 2X0YA 1YUHB 4HHLA 4ODWA 4DM2A 5CPTA 3PV6A 1XWVA 2DYSB 1KJVA 1KENH 1F13A 1EO8L 1FBIL 3N2MA 3MJ6A 4Z0XA 2G3FA 4ZQRA 1HCZA 2BNJA 4LF3A 5HGHB 5H4ZA 2WXGA 2ZUUA 1CCZA 1HILB 3M16A 4MWFA 4KNQA 3ZWTA 4LPVA 1LM1A 5IMMB 2GTQA 4XXDB 3MACH 3AXIA 1F9CA 4UU9A 5HOSA 2EH8L 2EG6A 4MY8A 4NSKB 4HFWA 1UBSA 3B4YA 3BVJA 2BGNE 1TA3B 1W80A 5I0DA 1F11A 3PUCA 12E8H 3I7RA 5FKYA 2BFVL 4PEEA 3V0AC 1JYWA 4KUCD 1CR9L 5FFOA 3KS0J 3QUZD 3MJWA 1J9TA 6ENLA 2C0HA 2FHBA 4FG0A 3CH1A 3PCYA 3RWJA 1BOGB 2XSBA 1RP8A 1E9ZB 3ZDXE 4GQQA 2FL5A 4H5SB 4ZMAT 1KXQA 3WEXA 4AIZA 2E4TA 2AV1B 4ZAKB 1YMHA 4MXQC 1A6ZB 2N0KA 2VSMB 3CHVA 3L2MA 3MGOB 4N8CL 1G7JB 1P4IL 4ZO7A 2WW5A 5MENA 5EBLA 5FKPA 2WMHA 1FJ1B 4UCFA 5A6BA 1IE5A 2VDIA 2ZUYA 4HPHA 5B3NA 4L4MA 4APQB 1EEPA 3OPZH 2X1SA 3SGDH 2V2CA 4JFXB 1ISYA 4AVKA 3IFLH 2A9AA 4JTHA 1PG7L 4I48A 1DHKA 2NXHA 2WTOA 3W29A 1XDLA 1N19A 2FHFA 4E4FA 2DMHA 3GHPA 5D1QB 3NDZA 4PCYA 4PUWA 5HD8C 1XIWA 4H83A 5LIYX 2VDOL 5BXTA 1JAEA 1VRDA 1BEUA 1UR0A 2ZSVA 2GQ8A 2R14A 4F80A 1RPXA 3N1MC 5L9FA 2Y69B 3EEZA 1CW2A 3ANYA 4YXLH 4I77H 5FYLH 2Q8AH 3ITLA 3UF9A 1IBHA 3VJ6B 2J7DA 1QNOA 5HWMA 2LABA 1HVXA 4R7NA 1XMEB 5EU6D 4U1GC 4WFGD 5EG6C 2ACUA 5CSYA 4FFYH 1JHLH 4NHVA 4DJDD 3TBSB 4OCMC 2WXIA 4Z7NE 4YDJA 5T8IA 4IG2B 3CHEA 1O68A 1U3NA 1JHTB 3TBYB 4RVBA 1MDRA 2Y07L 1GSMA 4N26A 3KRUA 5LN4A 4ORZC 4G8IB 4P2RB 4UYPA 4BD4A 5LGYA 4DKEH 3WO3B 1QSZA 1YADA 2XXGA 4JQ2A 2X1QA 1NDZA 3KW7A 3T2QA 4LMQE 2R15A 4AIXA 3L4TA 1U8NA 3TSDA 1YY9D 2A9BA 1I8KA 4GJTB 1CE1H 3BCDA 3ZDZB 2OI9C 3VW3H 3EPNA 4LIQH 4IJCA 1YNQA 1JPHA 1YPZE 4F5CE 3R1ZA 3NGBB 1PYFA 2VC2L 3JSSA 3Q65A 3K5XA 3T4AA 5BMFL 1R9ZA 3FTZA 1QBAA 5PAZA 3FQYA 2QPUA 3M0JA 2ZWKA 3A12A 2ZWNA 3OZMA 2X7LB 1SVDA 3D0LB 4NB7A 4OI9A 2OA9A 5C08A 4R97B 2OMXA 4Z0JA 3MV7D 4WI9A 4LUSB 3B2VH 3TCLA 4C55A 1BSIA 1L5GA 1SW7A 4K8RD 4BKTC 3ZYOA 1YNTA 1H3PH 4F37F 1UWXK 5HJBA 1PDKB 4X6FB 1XGPB 3FL7A 3T1FA 1KPUB 5ESAA 3WMPA 5ALCL 4NN7B 2QUMA 3RNKB 2DQDH 4FPSA 3BGMB 1KM4A 5IQ9B 5AWNH 2R0KL 4M9OA 4N1HB 4JFVA 3OMZA 1S2UA 1CLZH 5J6GB 1WKEA 3HBGA 2BS8A 2HMCA 3TF4A 3IXAA 1S39A 4IMFA 3UQNA 4CNIA 3DVIA 1FN4B 3M46A 3CUPA 3PZIA 3N0AA 1PX4A 4GG6F 1LDSA 1GIGL 4JM2C 4NHCH 1DBTA 4GVHA 2G97A 3CVIH 4N9BA 3QWQB 4PJ7F 3V9EA 2NZ1A 2Z1PA 2K4AA 3TN3A 4GW1A 2P52A 2DBLL 3LYRA 2VLJD 1QRKA 4JQIA 3ARRA 1K3ZA 4Y1AE 5C9UA 5F3HA 2ZXAA 3WL0A 3M1BB 1KTLB 1EJ7L 3WUBA 4MMYA 1EH9A 5B1BB 4MMXC 2VDQH 3P69A 3M7FB 3MV11 3ME0A 5IBUB 1TJPA 2ONEA 3WKYA 1IBGH 3CNKA 2CBTA 2Q8XA 2X1XR 3VMOA 4QQUA 2PCQA 2WP3T 4KVCH 4A21A 2BERA 3L8QA 3U4AA 1GJWA 3RUGB 2C79A 3LEXB 4MD4A 4OZ4B 1U91A 4G8GD 1IYXA 4Q9BA 1DJWA 1NWRA 4K2SA 4UNVA 3GSMA 2J74A 2X6BA 3GBNL 2QGCA 2B15A 5E5CA 4O12A 2I5QA 5EIVA 3TXZA 2IAMD 3DJRA 4BCZA 4BQ5A 3FFCE 1Q65A 5ID1A 3HG5A 2NOYA 1NFBA 4HG4K 3NIFB 4UIMB 1FUYA 3P4LA 4LEBA 1R5WB 4YIQA 2PKDA 3TBCA 4NIYE 3OAUH 2AANA 2NW3A 3CFQA 1WXYA 3OX8B 4W4OC 1UUSA 3RU8L 4C6MA 4UM9A 5F6IC 1B0RB 3BP5B 4FFWD 1FX6A 2VDLL 1CLCA 2XKSA 1HOCA 4Q7DA 1H61A 4E0RB 3PG9A 5FO7A 3IN0A 4MB3A 4YWGL 4AENB 3HBLA 1TMQA 4R6UA 3VRJB 1DJIA 5FHBL 2V9UA 1S5IH 1JN6B 4FP1A 5DXWA 3PREA 2E40A 3MX0B 1PLAA 5ANMA 2P80D 3GW0A 1D9KB 3ORJA 2GJXA 5G2HA 2HYMA 5F44A 1KGUA 5ALBL 1TPXB 5I1IL 4Z7VF 2Z4GA 2GVJA 2NY5C 4IGMA 2CGRL 2X2YA 1QO2A 3QQDB 5J5EA 4QLLA 4JM2A 2F2KA 2ZXDA 1IAII 5T1LA 5D4IA 1P4BL 1PKQE 2GSIA 3EFFB 3MDJA 1RCOB 3MUGA 5EO0B 2WKLA 5DELA 3BE1L 3G5XB 2QELA 3TEXA 3TO4C 4K68A 2KLRA 4HU4A 5I71C 4IIQC 4MMXA 2LTQB 4U6YB 5BRZA 1FYTD 5HUPA 4A2DA 2DVXA 3MS8A 1JGLH 1AHMA 1YPXA 3MLXL 3B2MA 3E5BA 5IIEA 4AZHA 2GIMA 5DRXA 5F4XA 3P93A 1IXPA 5HP5A 5CEZD 3MBDA 2KBGA 1QSED 2BSTB 4PGBB 5LWYH 2VLRA 1MFEL 4L5FH 2CHOA 2KZWA 3QSKB 5C9JB 1VESA 4R8WL 3APCA 1TTPA 1DE4A 1A5SA 4YHNB 2Y3NA 3OAYH 3QDGA 1UOZA 1ZSHA 4HMDA 2YQ2A 1Z9SB 4X4KA 1Y8BA 3JWNH 3KYAA 5G4EA 5HY9B 4NAMA 4IFKB 5AHNA 1B4LA 5BQ7B 1QU4A 1JF1B 1J0HA 4J2PA 2XHYA 4CQDA 4OCXL 4QOKE 5HGDB 3F7YB 4LEXH 1A1OA 2IQ9H 1EUTA 1UYWH 3ZZQA 4MDIA 4HNVA 3QTGA 4P7QA 3KAAA 3T55A 1WA3A 4W4OA 3CFJA 4M19A 4TNGA 4F2EA 3E2VA 1UWAA 2V5DA 2VH5H 3LN5B 4R2GD 4GQGA 1T2QH 3OLGA 4PGDB 2DY2A 2XG5A 2WCSA 3MUY1 3V0SA 3HPJA 5DHXB 1QSFD 4GW4B 2RQEA 2IPUK 4K1WA 4NP7A 4A4AA 4JTLA 2QBWA 4P5MA 3PTMA 4UQDA 3GWQA 1RZMA 3MSDA 4LP5A 3BAIA 2WQUA 1RIUL 2DQFA 2I25N 4MBOA 5TJWK 3VG9B 1M2VB 2D3LA 2XQBH 4Y9OA 5CC7A 1MG2C 2HA1A 2V17H 3FO9B 3L7FA 5D7LA 4KHTL 1T83A 5CU5A 3EKCA 5A6TC 3O4OC 3KXFB 5L4MA 2AVFA 4K7YA 1FBAA 3URAA 1S7RB 2HV5A 3QC6X 4RAHA 4G6FD 4FZEL 3V0GA 1FL3A 3NZ8A 4PV8B 3CHOA 4Z8FH 2VCOA 4DO5A 1FDLH 3TO4A 4ACYA 2QDEA 2OKMA 5HGAB 1BRLA 4XD4A 3UO1H 1OIFA 3PL6D 1IQDB 2Y0SA 4L8CB 4LCYB 4MBRA 2Y7FA 3TC7A 4FR6A 5DD1H 2GCYB 4IIQA 1OCOB 3RVTC 4XODA 4PB4A 2BOCA 2J8GA 5FSEC 5K9QG 2NDGA 1RQEA 5CINL 3FU6A 1MFDH 4PB0H 4Y96A 2Z8SA 2EEDA 3Q6FB 2A21A 2Z0IA 4J12A 3X14A 4ODBD 3N73A 1KTKE 4YDMA 1WRFA 3U0TB 3F6IA 3DO7A 4X9BA 4PP1D 3S37H 4C6PA 5MHBA 4Y2LA 5FKAB 4PRHE 1EEZA 2WAQA 3PBGA 2R56H 3QJFA 4FJYA 2APXA 4DLMA 4M62L 1QR4A 1PFCA 4UAOB 4RRPA 3VKCA 1NQKA 2VMCA 4KK8C 1ZWIB 3OIXA 1PBGA 3N5AA 4E41E 5KVGE 1PZ5A 2WMPB 4Y4FD 5LGZA 2D8KA 2CBPA 1IM9B 1QLEL 2V33A 4KEVA 4LEOA 1ZLSH 5HVGB 1XQ4A 1TZIB 3CDGB 4M5SA 1DKWA 4B2DA 4MHHI 4HT1H 4JZNB 3H9SB 1EX5A 2IPFA 2J8UA 1ZLUK 2EVGA 3NEEA 4ADSA 1J0JA 4V1DD 2Z4QA 3SPVB 3S5ZA 5LHEA 1UP2A 1E28B 4UC5A 5A8MA 5KVEH 2XYLA 3W2UA 3W53A 4J39A 4FA3A 3MBED 5E7FA 4Q4OA 3W1XA 2C4FU 3WDHA 2XIBA 5IQ7L 3BLKA 4NQCA 3R4IA 7FABL 5LXVA 3C8DA 3WGVB 3W57A 2A4ZA 5F7DA 3GBLA 2MQCA 5AOJA 2A1WL 4E8GA 3CHRA 2AZUA 2B77A 5IDIA 3P9MB 4PJAE 4H9MA 5H94A 4L65A 2L7EA 4UNLA 4PWIA 1XLGA 3HE7C 3LUTA 5TF1L 4CADA 1UR3M 4TQPA 5I1CL 3IGFA 3VSVA 2WYIA 1Y6KR 2FEEL 5E0QA 3MLRH 2ODOA 3N15A 4EJ1C 3T42A 4AQ8C 1E4WH 5KYYB 3DA0A 3KEDA 2WZMA 4JO3H 2I24N 2B7NA 4OKDA 3JV6B 3VKJA 3KJ6H 3QZWB 4CCDA 4LBAA 1J2WA 2R1LA 5BS0D 2YXVA 1SRDA 2Q3OA 2QNEA 3VFNA 2DJ4A 4HPJA 3V7AE 4IRZL 1X9LA 1GWJA 2BCKA 4P5KA 3SQOH 2B59A 3FT4B 3DBSA 1ZD6A 3GVQA 1ID5I 4NENB 4NFCA 4GH1A 3LMYA 3PANA 4GRWF 1D2PA 1GG0A 3ZBMA 1H5BC 5D4JA 4JHMA 1CFSA 1JNHB 4PWGA 3EDEA 1T66C 5ISZD 5F4SA 1YEHL 1LO2L 2GTWA 3KCJA 5REQB 1E9LA 2A3CA 4XTIA 5IMOA 2VEFA 5I23A 5GGSA 3WEOA 5EWIH 3EYVA 4JN2A 3OMIB 5AYQA 3VO0A 1SUJA 3DRQA 5GGQH 4WEEA 5B3JE 2W91A 2GDVA 2J4WL 1EZVY 1DVYA 3RI5F 4LSPH 1FQ9C 1NFGA 3HG1B 1EZ2A 2HT2D 2ZA2A 4AE0A 2EILB 1DCLA 4OF0A 1MJJA 4QRPD 1BLIA 3QNXB 2AJZB 3F5WA 1TPDA 4L4TE 3CWOX 4MWAB 3PS6A 4TPRH 2WHVA 4FA8A 4KRLB 1AA1B 3MSRA 4G9PA 4AEEA 1SY6H 2DJUA 4E2DA 1FXQA 4QCEA 2JKAA 3NVTA 3VXNB 3LM3A 4R84A 2XETA 2CJUH 4IRJB 3EZJB 3KWUA 2WXHA 2E77A 1DJXA 3QY7A 2VXSH 1AQ0A 1FGVH 2BNRA 2WMIB 2AJ3A 3IMWA 3T6QC 3MO1A 4O16A 1DWAM 5KS9F 1NOFA 1B9BA 1E6SM 3SCOA 3ZMEA 2KZKA 4W9FC 4DK3A 1UHVA 2UWEB 3ZIYA 4ONGH 4PH6A 3HE7A 5I19H 3IGXA 4GIPD 5EU7E 4AQ8A 1K8IA 4ZAKC 2CKSA 4JY6B 4YMPA 3E2RA 3MAWA 3GNNA 3UWEA 2F5AL 2NNFA 3ZRSA 3NABH 1DE6A 1SM3L 3WS6A 1Q9KA 43C9A 1KLYA 2FZ3B 4APQC 3TA3D 5EU6E 5F97E 4GNJA 3ROLA 1LK3H 3OWEA 4D3CH 3TVMC 3GTFA 4Z1AA 1CVSC 3BEVA 5BOZG 1LWRA 5D1QC 2QTEA 5FOBB 4O52A 1UWTA 2VTFA 4PRAB 3EJZC 4S10A 5EDXA 1G7IB 4NO5B 1S2CA 3PP3K 2H2SC 1PHQA 4WNQB 1H5BA 4PVNA 4F0RA 4GH7B 2X4RA 2NCEA 2QVNA 4B5SA 1OD7A 3QLLA 1UBPC 1D5ZB 1E27A 4AVJA 3DRTB 3E02A 3F7VB 4DYEA 1X5FA 3NA4A 5KETA 3KRSA 4OIAA 1YUHA 3ERXA 5EUKB 2F6KA 3IJEB 3K0WA 3IAGC 1VPQA 4JYEA 2QPDB 4HJUA 4Z5RB 3KLQA 5I1GH 3OODA 4FYRA 1Q85A 4LSVL 4EUPH 1MFMA 1ZHLB 5HGHA 4HF5L 1JVNA 4GMSH 1HILA 4W93A 4K39A 3LHVA 4X63A 1XFBA 5IP4A 1ZVHA 1WHPA 5FGRA 4CC0A 5IMMA 3NQEA 4ZE4A 2YAMA 2GTZB 3CDZA 4XXDA 4E6MA 1SVCP 3ATDA 2OJPA 3WD0A 3NCCB 4KERA 2X2IA 2NV9A 4EN3B 3OB0H 3UJFA 4IH3A 4NSKA 5EBWB 3ZL2A 1GZQB 2EABA 3H4XA 4JR5A 4FFVC 1TA3A 2IOOA 2VEIA 3SGDI 3EWYA 3MV7E 3GSNB 2PWHA 4NYLB 2WQAA 3FKUS 2XVPA 5CCZA 3CU1A 5L88L 1DN0B 1HP4A 5JZ7D 1TYGA 1WDWA 1KEMH 5EIIB 1F4WH 3QULB 2ZZUT 1YYCA 3LRMA 4PJGE 3NGBC 1DANU 3UIZA 1XF3B 4H5SA 2XIDA 4OBRA 3MZ2A 4JPQA 4C6LA 5I6NA 5F0JB 5KVDH 2NY7L 2AV1A 4D9PA 3FTGB 4ZAKA 3EWDA 1A6ZA 3PJTA 4TQEH 4YDIH 4HUMB 4JEJA 3MGOA 1VADA 1GMIA 4XCCL 1NEZB 1R3TA 2CIPA 1FJ1A 2EG8A 5DD0L 3CG8A 3CZFB 5E7BA 4QF1B 2WPGA 3AY2A 5FEWA 1DL3A 4APQA 4R97C 1AI1H 4Y19D 2AQ3A 4JFXA 5LAXB 1R3RA 4KQ3H 4B3EA 1WDDA 4E4PA 3MYZA 4HALA 3UG4A 5D1QA 1QNZL 3ZKND 5I1HL 4M4RB 1G7LB 2GGJA 4HJ0C 4NN7C 3EUUA 3XISA 2F7OA 1R86A 2VX4A 4MA3B 1A9EB 3CK0L 4PMVA 4LH8A 1IFHL 3NFSH 2ZVRA 4BKLB 1CC3A 1C9WA 4ZS6D 2VR5A 5AHLA 1NQBA 4TOQA 2AFNA 2J7CA 1LYQA 3VJ6A 3QUKB 3VGDA 3G3DA 3VXPB 2AMUA 3QGKC 5EOCH 1B4EA 1X97A 1EK3A 4JHWH 1AHWB 4NRXB 5BMXA 2FSEB 2AQQA 5D9PA 3TIMA 3OZ9L 2DDQL 3TBSA 5C0GB 5DJ6B 2ZQKA 3SUSA 1ZLDA 1E0XA 5GJTH 2NUYA 4IG2A 3LXBA 1JHTA 1XO8A 3TBYA 4UOW0 4JOMA 3BVXA 3PAZA 4W81A 4G8IA 4P2RA 4EANA 5ADOH 1Z44A 1OVDA 3KL5A 1M65A 1KACB 3LKOB 1DXEA 1PO9A 3BPLB 3ETBJ 2IV9A 1AIFB 3W87A 3RLUA 1V03A 3V0WH 2OX5B 3LTPA 2WIIB 4K73A 2VC9A 1SLXA 3AISA 4D6JA 3KPQB 5GS2H 4XX5A 2QVIA 4YSOA 5DJ8B 2NYKA 1NZRA 4NNPL 2RCSL 5JHBA 3RN6A 5KWYC 1Y1UA 5DQ9B 3BQUB 3EIFA 2DZTA 4NX5A 4W5ZA 3MUIA 3QCVH 1I7UB 1WAWA 3L3GB 4UZSA 3U8GA 4PFMA 4AHQA 4L4LA 2H41A 1OT1A 1J05B 3N3MA 2QVKA 3SE3C 1UUQA 2A7NA 2EPMX 3WNPA 1R17A 3MLSH 2B4CL 3GKAA 2X7LA 4JY5H 2DQEL 3BCFA 4W9ZA 1TTUA 5EO1B 5CWSB 3D0LA 4POZD 4W88A 2YD5A 3SJNA 4B0MM 5CZ0A 1TKKA 3SSZA 1XYLA 4MDJA 4LUSA 4BRJA 1HAUA 3SBRA 4DGYH 4WQOA 2PPAA 1XISA 3W23A 4Y2DC 2OOFA 1PDKA 1XGPA 2CIIB 1KPUA 1KUMA 3RNDA 2WXKA 3VIKA 5CLWA 3RNKA 3O2DH 3BKML 5D9NA 1KBLA 3BGMA 2F1BA 4LNVA 1NFIB 5IQ9A 4IUOA 3L5XL 1V5XA 1XB6A 1DIDA 4G3YH 4LX4A 1IAIH 1XYZA 5J6GA 1EXUB 4L18A 1CXEA 1QSEE 1NIDA 4M6ML 4NAJA 2QADD 1TPXC 3T07A 4J9JA 5I6PA 1AJ2A 1BF8A 4RGNC 2F8VA 1FN4A 2Y1ZA 2AQVA 4OV6F 3CN3A 4Y1AD 3SBPA 1YNLL 4K8HA 1NC4B 4C7FA 4EOWH 2RH0A 1KBBA 4DI8A 1D7BA 4DOHE 2GABA 4IKLA 3DC8A 4YFLF 3R43A 2EAWA 3NYDA 3QP3A 3C5XA 2VDNH 5DJ2B 1GNXA 4TUJB 3M1BA 1KTLA 1SJEB 1SNRA 2PZNA 1H6UA 2LTQC 4P07A 2EDKA 4U4BA 1H4PA 2X41A 3ZDYF 4PMRA 2GJRA 2UVEA 2JALA 3RUGA 3DPBB 3LEXA 3DK0A 5KTLA 3NP3A 4OZ4A 3S83A 2XUCA 5BVJB 3USZA 2DEWX 3FFCD 4MS8C 4GBUA 4XBKA 4ATLA 4R27A 3BH9B 3F6LA 2JGYA 3DIFB 3TBBA 3EYOB 2ADIB 1ZIBA 2WUCL 2R39A 4RAVB 1KY6A 1LXMA 2ZRXA 4IMDA 4OZHF 1NEUA 1FHUA 3SE3A 1IWAA 1OCQA 5AC5A 2F2HA 2OS7A 2E9BA 4UIMA 1TSRA 3FS2A 1FP5A 1BQGA 3MI3A 4PYGA 2GOKA 1R5WA 5CJQL 4D6DA 3V8OA 1JNJA 3TO2B 1O0VA 3OX8A 3N2OA 5I24A 1I0DA 2IFFL 2C1HA 3PTDA 1B0RA 3BP5A 2C9RA 5AKVA 4L9LB 1PLGH 1S38A 4E0RA 5A5WA 4KESA 3FN9A 4M1DL 3ARDB 2X5PA 2YGOA 2K4WA 1XLLA 3U7BA 2DI8A 3DIPA 3W71A 1A4BA 4AENA 2APTA 3UETA 3H7BB 1JCMP 4K3JH 4BA0A 3VRJA 4FLRA 1W1A1 1AK5A 1NCOA 4FZ8H 2VGLM 2WSDA 3T6XA 1K2DB 1JN6A 5A16B 3UBGA 1TQBB 3MX0A 4AW7A 4BWTA 3VG9C 3CZSA 3NIDF 1D9KA 3NRFA 2A77H 5FI8A 2P5EB 2NXIA 3WYZA 3S1UA 3MRJB 4ZFMA 2H2PC 3DG7A 3QQDA 2OK0H 1L3NA 4JM4H 1UFGA 1Z41A 2FMOA 3Q2CA 4DVRL 2YR3A 2LLNA 2KHAA 3EFFA 5DMMA 4EIBA 5EO0A 3EF4A 3V6ZB 2UUDK 3G5XA 2ZCKL 3QY8A 1TIMA 5M03A 1NICA 2W9DH 4U6YA 2VLME 2D2OA 3SGZA 4OLVH 2NZLA 1LM8V 5D2LF 1WD9A 1ES0A 2VDKH 3JW7A 1KCRH 4LEFA 3FYYA 3EOTH 25C8L 4ZPVB 4WAFA 1OCZB 3R7RA 3MRFB 1BXNA 3OG3A 2BSTA 4OCSH 4PGBA 5DD5L 5EC2B 3EYUL 2NY4B 3NJNA 5K1JA 3HR5B 3ZGHA 1HCYA 1FFQA 4L1SA 5C9JA 5DFAA 2BOLA 1W3JA 2D24A 2XQ0A 4YL9A 4YHNA 4V1DE 1F45A 1XKJA 3BAEH 4KKXA 4UAOC 1GTHA 4XP6L 1Z9SA 3TEVA 4UFIA 2EEBA 2XH4A 5I09A 1TVPA 3WXVH 1AR1C 4QOKD 5HY9A 4IFKA 3KPSB 5IDZA 3F2DA 3A4EA 5BQ7A 1BQKA 1OWQA 1RH8A 1LHZA 4L5ZA 1JF1A 1B3WA 3GKWL 4QYOB 5JXQA 5HGDA 2VRQA 3F7YA 5E9AA 3QQ9D 4O0ZA 1XIHA 1EVUA 4ZUTB 1CDJA 2XTJE 2ZP0T 3MUCA 1U83A 4LEEA 4KH2A 3QQ3B 1MCIA 3SRFA 5C0AD 2Z64C 3LN5A 4NUGH 1YA5A 1YEEL 2DEPA 4PGDA 1OC7A 4FR1A 3RPIB 2QAPA 4JRXB 5FYKL 1YXDA 3LH9A 3RPMA 3W38A 4GW4A 3D0AA 1CU4H 1NAMH 3DO3A 4F20A 4P8QA 2EDOA 3DKLA 2YPVH 4PWEA 2EIKB 2MIZA 2XPKA 1VJZA 4WUIA 2WHMA 4J4KA 3UJTL 1T6MA 3U2OA 4KJWD 3WY2A 2AAAA 2Z8WC 2L7JA 1M2VA 1PTAA 4HXBH 1JZDC 4A55A 1RSCA 3FO9A 4H9VA 3DH7A 2H1PH 3WNKA 2YUZA 3MYPA 2XH0A 3AZSA 5BXRA 3VMNA 1N7KA 3KXFA 4IJRA 2WJ5A 5LXGH 2R69L 5E08H 4Q7IA 5IKCB 1G7MB 1S7RA 3FO2B 2CBIA 4JJHA 4LWWA 2OEMA 1WTGT 3IGLA 2GAZB 4PV8A 3GRWA 3VDBA 3N14A 2Y1HA 4WK9A 2H8XA 1GKRA 3ARTA 2ZCGA 2IGTA 2CRMA 1XB8A 3GX9A 5HGAA 4EDXB 1IQDA 1UW9A 4L8CA 1HQTA 2ATMA 4LCYA 5FUZH 4ZNEA 3KM1A 2GCYA 4ATDA 4ZGYA 2HZHA 4DKTA 3DMMB 1LNUB 1NOLA 4PRHD 4UQCA 3NPUA 1NCCH 3Q6FA 3W1AA 2OYPA 4K3ZA 2G0KA 3FO0L 1FAKT 3AROA 3PJUA 1EXHA 3VM5A 4J3OH 5FUOH 2PRLA 3U0TA 2J66A 3PBYA 1NCBL 2KPWA 5FKAA 2YWYA 4E41D 1ZTXH 3X1EA 2IS7A 3PWNB 1FWWA 1RD6A 1VLIA 1MIMH 4LS1A 1RCYA 2ZAIA 4UMGA 4GKOA 5IBTL 2J6EL 4JDEB 3PHOB 4YU1A 4YBQD 5CPSA 1ZWIA 2LU3A 1T5WB 5AZEH 1TTCA 3AY4C 2VDRB 3QYQA 4URIA 2WMPA 5TPWL 2MRYA 4LGSB 4AZ8B 1IM9A 2UY4A 1Y7VA 4JTUA 3O0KA 3C2VA 2LU4A 3DKHA 3VKAA 5DT7A 1TZIA 3CDGA 4J28A 4GG6E 1KRMA 2DQUL 1F2XK 1K9EA 1V7YA 4PJ7E 5DWUH 4JZOB 4JZNA 3UX9B 4AYID 3H9SA 4U33A 1SOSA 4RNJA 1T7XA 3KVDD 3FB7B 3C5JB 4MAYD 4AD4A 3VNYA 2VN4A 4DF1A 3SPVA 4BQBA 4YCOA 4POCA 5DK0B 3ZJ7A 4MWAC 1E28A 3RAJH 4XP5L 2WZ5A 1ZLEA 5ABEA 5JYLA 1ZBKA 4Y90A 2WOQA 3IS1X 4E38A 2WWMC 1IEXA 1KQYA 2ZAHA 4IRJC 4XH2B 1RLDA 2GOUA 1YEIL 4BE6A 3WEBA 3E2HB 1Z9MA 3N55A 2R1KA 3W6YA 3P9MA 3EOYG 1FLRL 3WTTA 4RQQB 4CKQA 1MEHA 1QO3B 4FG6C 5I1AB 2HVOA 4AY7A 2PR4H 1EDGA 3BOLA 5C0CE 4H20L 4H8PA 3EXRA 3ESMA 4JFPB 5KYYA 3GHSA 2KYIA 2O5ZH 4YBHA 3JV6A 5GJPA 4GY4A 2FYMA 5I00A 3QZWA 2MANA 2X38A 1LEKB 4QNPF 1GQIA 2Y7LA 3DVGB 3WMCA 4W9EC 2W60B 4A8LA 1O4UA 5D70H 1OK4A 4IQEA 1EUUA 3VXUE 4X98B 1MWOA 4LRNL 2QJHA 3FT4A 1MEXH 2V3EA 2K70A 4A7QA 3L9EA 1K8ZA 3H42H 4HFUH 4NENA 4NCC2 1X9UA 5HULA 2GBTA 1H6FA 1MQQA 4F4RA 1JNHA 2YBRB 1C16B 2QR0B 2XVLA 4PWFA 3AY4A 2NX1A 3MI2A 1GHFL 2FB3A 5REQA 1C5BH 4JNYA 3WLNA 3BYYA 4Z7VE 4S1DC 5K9XA 4GMEA 3P30L 3US0A 4UILL 2O30A 1OZQA 3T4AC 5E9XA 3X11B 2QCNA 4L4TD 3VOFA 4MKTA 2P0OA 3ATEA 1FZKB 4D8LA 3OKDB 3SJVD 5FCZA 5MF5A 1ID2A 4JPIB 3HG1A 2NZ9D 1JPST 5IJCC 4GSXA 5HHMB 2PGWA 3QNXA 2AJZA 1JPTL 3V35A 1JVLA 4MWAA 1BMWA 2M1KA 1FFRA 3GPEA 5I3KA 1E4XH 1XF0A 4Y9EA 5T3ZL 4EN3C 5FEXA 2V6AA 1UJQA 1RMFH 4LDOB 2DUXA 5CAYB 3VXNA 1R3IH 5B7EA 2YXWA 4IRJA 2AGKA 1LL6A 1OHQA 3MOAL 4MNMA 4AY1A 2AP2A 1QW7A 4QSHA 4Y19E 4DEPB 3CQHA 2WMIA 1DVQA 1E90A 5AW6B 4JTTA 2UWEA 2OQJB 4ZMQA 4HNTA 2C91A 3KH4A 3R58A 2UY7B 3HC3L 2JB5H 4XO6A 2J72A 4KRZA 1Y18B 4WFHE 2VQTA 3SBFA 3Q5OA 3PTKA 3QAZB 1VLXA 3B3IA 4ZMXA 3OGSA 5I6MA 4JY6A 3VFPB 4XMTA 3O6AA 1V79A 4GD0A 5DJYB 2W0KA 2Y2WA 3KLLA 5JW4N 1B31A 4NZRL 5CJ5A 5IJDC 3FIGA 3BZ4B 4G6KL 5GS0L 2FZ3A 2B7QA 1ZV2A 3G1HA 4C56B 2CKRA 2HB0A 3PP4H 3NGFA 3PJSB 4XPTL 2RDWA 3LKSB 4AL8L 4QLJA 5DVNA 3IGUA 2PFHA 4ZZ9A 1PG7X 3DFSA 5FOBA 4S1FA 1CS6A 3IDMB 5EMKA 4PRAA 1JFQL 3BUTA 3QHMA 1QWKA 3TR2A 4YLCA 3RYSA 1G7IA 4NO5A 4PUMA 4YSPA 1SEBB 4WNQA 3QPXH 1A0CA 3UEZA 3CO8A 1C8PA 2D0FA 1BAFL 2A2IA 2DLIA 4IBLT 1VEOA 2QHAA 4TX6A 1ZLPA 5B39G 1D5ZA 1N82A 4UT6H 4N2NA 6ALDA 3DRTA 3F7VA 3UJJH 1Y07A 3DOSB 3TN0B 1MRDH 2EYSB 1AR2A 3BPNB 3STLB 4HUNB 1FWRA 5EUKA 4WWNA 3G77A 3IJEA 4WO0A 1AHWC 1FWJC 5JHDD 5AOIA 2BVYA 3LHZA 3FRUB 4UM8B 5EBGA 2G5BB 2YCEA 4Z5RA 5L2KE 5C6WH 2VDPB 4M5YH 1P6FA 4LJ3A 4L1LA 1ZHLA 4DXKA 1N0XL 2YHGA 4JFZL 1OD8A 5DX7A 1I2OA 4PJXB 2GTZA 5DRZB 3MLVH 4F2UA 2OXNA 2AQRA 4NBYB 3P3TA 5F9OH 4F92B 1RUQH 1NOAA 2B1AL 3OJ2C 4OZGB 3N42F 4K15A 4HJ1A 3QIUD 3BPLC 4Q4EA 4EN3A 2DD8L 1TO5A 4YZWA 5EBWA 4MJHA 1GZQA 3TQKA 2G0WA 2IPGA 3L5MA 1YJDH 5T9CE 1GZHC 2PWGA 3GSNA 3COOA 4NYLA 1HG3A 4XPHH 5EEZA 1DN0A 1J1OH 2Z7GA 3VXOB 1QTYT 2F53B 3UD6A 5EIIA 4WK2B 3GTXA 5CR8A 3QULA 3BQUC 2ZDSA 5D2NE 4PREB 1XF3A 1RURL 1PXGA 5I6OA 2DZEA 1JSYA 4TXVB 4D0CB 2FX7H 4M7LH 4YL4A 1X44A 3WQ6A 4YE4H 3NACH 4K8RH 3STCA 3FTGA 4KGJA 1HYSC 1D6VL 2BY2A 4QEHA 2ESVD 2NVDA 2R29L 5AKRA 4AMAA 1BF2A 1NEZA 3SQSA 3CZFA 4WKAA 4QF1A 4B9KC 2IKGA 4QITA 3V1HA 5LAXA 3ZLFA 5DC9B 4NY2A 4P4KD 3DFOA 1DBJL 3E5PA 3OMAB 1HW6A 4FNLH 5HNTA 2MEJB 1SMOA 5LIXX 4PMYA 5F7EL 5FJTA 5BOOA 4L9DA 3Q2NA 4M4RA 5IZ7A 3LDBB 1G7LA 2GI0A 5I15H 4A68A 5E51A 3NA8A 2YFOA 4QHKJ 4MA3A 1A9EA 4WXZA 4NKIL 4B0MB 2BZDA 5C6TH 3PRZA 5MHSE 1S46A 1RV8A 4AZIA 3RRAA 5AC6A 5JTWA 1SO6A 2QSVA 5A7BA 4BKLA 3LV5A 3LLDA 1U8OB 1X38A 4IFRA 4DW2L 4X6DE 4UTUA 3QUKA 3SPGA 3GEWB 2C4XA 4OIBA 3VXPA 4UTFA 5FLUA 4UFMA 1AHWA 5FW6A 2FSEA 1BD2E 4K4KA 1XGRB 1XKYA 2INZA 3M1ZA 4G6ML 3N13A 3LCYA 2EIJB 3ZUCA 2UXVA 1HF6A 1BZEA 4O0KA 4YHGA 4LU5H 5C0GA 5DJ6A 3NQDA 4JQVC 2VD8A 2MWCA 4S2SB 2EDLA 4GP8B 3NZPA 1MFAL 2BWIA 3VSTA 1FWHC 4UCGA 2EKSB 4PMUA 3PY9A 1CYWA 3EWXA 2Y1AA 3LKOA 2XJ7A 4O10A 4OOUA 3G18A 1R34A 1AIFA 1X5MA 3B2PA 4IGNA 4E9TA 1M3IA 5LA1A 3GLZA 4M8UA 1GZHA 2OX5A 4E5XG 3MN8A 2WIIA 3RX3A 1W1VA 2YN3A 2WKJA 3KPQA 4AH2B 3R0MA 2BVWA 4XN7A 1RL1A 5DJ8A 3IF1B 4GRWE 5DQ9A 3BQUA 3QZOA 5JIQA 1I7UA 3L3GA 1T83C 4F57L 4NZ8A 4AD1A 2W81C 5LXEA 1J05A 3CFNA 1FFOB 4JO1H 1FLTX 4KRPD 4H25B 3ENEA 2WZ0A 1MPAH 2BHUA 1KDJA 3QAQA 3IDGB 4LAQL 4MNGB 4K94H 1ILUA 3AWFA 2XIQA 4J1UA 2YPLB 2ZXWB 1KV5A 3PNUA 2JKTM 5EO1A 4OH2A 5CWSA 1FOBA 3I4EA 3QY6A 3TTEA 4WVXA 4D6EA 1R0AH 2CXKA 5HJYA 3W7CA 4QBXA 4UYQA 4L9LC 3RU8X 2MNUA 4HA3A 1R33A 5M94B 4Y9PA 3ARDC 3OAYK 2CIIA 4UB0L 3M86A 1A4MA 2GSGB 3CHFA 4OQTL 3KMDA 4XCFL 4GQ0A 3NSMA 2PSNA 1NFIA 2JIXB 3CUXA 3N2JA 4L29B 3NN8B 4GP5B 3FDWA 3ZT7A 2X1IA 4ZD3L 1Q2SA 2KKQA 1TQBC 1EXUA 2NX5B 2Z92B 4S3FA 1RZ7H 2FECI 3E8VA 4C4KO 5KS9E 4Y9NA 4CCEA 3URQA 3BQ5A 3P02A 1MQPA 1NC4A 2QHLA 3CNYA 1DWGM 1MCQA 1DFBL 4HZAA 5F7BA 5CEZH 5DZ9A 4IKJA 1HNGA 1AMYA 1LP9B 2ZCZA 4JQVA 2JKSA 1MCDA 4HSOA 5DJ2A 3EKGA 4IBZA 4MZIA 4TUJA 3VIMA 3PS7A 3EPMA 1SJEA 2FB2A 3JWOC 2VCAA 4K1GA 2ZXQA 5E9NA 2I7GA 3GHUA 1NGYB 3FQ4A 1FYHB 2WNKA 4IMEA 4I2XB 4TKWA 3TVAA 1XSIA 5H8DA 1XBVA 5B7YA 4WDXA 4N25A 1ISWA 4ZS7L 2VR6A 4FQCL 1E2WA 4X8XA 4B9CA 2IANE 2NY4C 3TT3L 4LBUA 4WEBL 3DPBA 3W2LA 2JJSC 3VTTA 5C0AE 5BVJA 5CSBA 3B8UA 2Y6TE 3UP6A 1G67A 1O7DC 2BZ7A 4TSBL 2OKOA 2R7EB 4E9QA 3EBVA 2HWZH 2WBGA 2QCHA 5SX4I 1H9VA 3BH9A 4X9GA 3DIFA 1HGWA 3TCTA 4X4ZA 3EYOA 2ADIA 4UTLA 1IBDA 1T4KB 3IIPA 4KZDH 1IKNC 1PEZA 4RAVA 4ICXA 2FQEA 4R4FH 5IW6B 3CBKB 2G95A 4M1CC 4S1RL 3LGGA 1JZEA 4TTUA 3U6WA 4AIUA 3AXLB 3WZ0E 5CZRA 2VDML 1P7TB 1E5JA 5H8PA 4XKMA 3QXBA 3TO2A 1UOKA 2CO1A 3KRBA 2VMDA 1LRNA 4F8LA 4L3EE 2A9NH 1TMLA 2WBWB 4AD0A 4JRLA 2Z35B 2V68A 4L9LA 2ADGB 4RNIA 1J9QA 2QSCL 3ARDA 5AVYB 1IGSA 5F72S 2O6EA 3Q0HA 5DRIA 1XTMA 1HQ4B 1I6NA 3S2JA 2IH1B 4EXBA 1A4AA 4YR6B 3H7BA 4Z2JA 5KYWB 1EO7A 1RFDL 1K2DA 4KKAC 5A16A 2XH2A 1SZEA 1MAML 4S2BA 5FF6B 3N44B 1SFJA 2P5EA 1HDMB 4WJXA 4PV1C 3V4PB 3S2AA 2NSQA 3BZGA 3MRJA 2G2PA 3P2BA 5E6ZA 2AF2A 3A9BA 3GSQB 2E5DA 5FJJA 3P3SA 2VLMD 1J9YA 3HZYB 3RTQB 1Z32X 4M6UA 4QXTB 1BGAA 4KX7A 4OGAC 3TV3L 3TR9A 3V6ZA 2YA2A 1F0LA 4X6BB 3EJYD 4J3ZA 4X22A 3QQXA 2CGYA 2NQCA 1K7EA 1N55A 3MBXH 3DHMA 4Y9CA 1AH4A 2OWXA 2QVMA 4IOSA 1GYVA 4PBXA 3ZQXA 1CICD 3GUGA 4ZPVA 4S0TD 3MYJB 3MRFA 1EC9A 3GVGA 2XFFA 3P54A 4PVMA 1UQYA 4JX5A 1OF2B 2WZPD 4RE0A 5EC2A 1CL7H 1K1DA 5K93A 4LF1A 1EQPA 1JPDX 3HR5A 3LOTA 4LOFA 2JJSA 1YQ2A 3WFEL 3WKML 4MASA 3N4AA 4L1WA 1JZ2A 5B7MA 5IF0B 3MWAA 1UM4H 3RFAA 4NZTL 4HWEL 2IGFH 1KKRA 2OVLA 3HFYA 4X6DF 3KPSA 3XIMA 5D7JB 2PAJA 1RIVH 1IKNA 5BRBA 1CFVL 3CHSA 2QCCA 2XTJD 3ALFA 4MAUL 3L3JB 5D03A 3VFOB 2HT3D 4QYOA 4RMRA 2OLHA 3DI3B 3BWZA 4Z7WB 1JDFA 4IOTA 1ZVYA 3H26A 4DX3A 2BNQE 4ZUTA 2EIEA 3SDCB 4KRTA 4DQAA 3VC5A 2WV3A 1UFUA 5KOVC 4QXGH 3QQ3A 1W1ZA 3ZKMD 3NCOA 2BVQB 3CLFH 3WS6C 4B6ZA 3OQEA 4CBPA 3FCGA 3RPIA 4E4UA 4JRXA 4F7CB 5HJXA 2J44A 5DVLA 2UWFA 1T0OA 3LCXA 3V4VB 3Q1EA 2DSUA 3BG5A 3F7RA 3FTXA 1BG9A 3MNWB 1QMLA 1BFVH 3CT2A 3WEZA 1P1ZB 1E67A 4GXVL 4HEME 4PCNA 3HB3D 5AVUB 3SCMB 4DQWA 1KIRA 4TNFA 4L1GA 2Q7YB 1I75A 4Z1DA 1CNVA 2VOMA 5CU9A 1CFBA 3VINA 1E4LA 1MAKA 3MXVL 5JHLH 5DO2C 1YEKH 5IKCA 1OK8A 1G7MA 2WXOA 1DBMH 3FO2A 4L8SB 4JBSA 1J5DA 1H1NA 5HHQB 1KJ3L 3R8QA 3M8OH 2GAZA 3TXAA 3GS4A 2NUTB 1UQSB 4GI9A 1CZ8L 5I1KH 4GAJH 1ZENA 1RJLB 4ENZA 4PJHF 4ANXA 4EDXA 3NSYA 1G7PB 4N9CA 4MB1A 1NTDA 5CPQA 4KDTC 5D7IB 5FF3A 4K9JA 1YXYA 3DMMA 4LYQA 1LNUA 4KROD 4RMTA 3ETTA 4B7LA 1BVNT 3APNA 4M48L 3G6JB 4G5ZH 3FKRA 1OM3L 1DZBA 3WNNA 4PW9A 4NAFB 1LTXA 4ESKA 1RLWA 3MSGA 4UFLA 3SJVE 1IKFH 2OJZH 4KKNA 2DQHL 4D6CA 1KB5B 1A3HA 3QXDB 1RH9A 3PWNA 3ILEA 5F6HI 2VR8A 4M1RA 3GLDA 5I02A 4JPWL 5AL0A 3QZBA 4JDEA 4G7FA 3PHOA 4FG4A 2M8XA 4GUCA 3PK7A 4I9WD 4G7RB 4I4WB 1CTOA 1T5WA 3LDVA 3MHZA 4JQXC 3DFQA 1V05A 5FYKE 3LI1A 2I5GA 4AZ8A 4HCRH 3LB6C 2CLLA 3JWDC 3JRKA 4BUGA 2CLVB 4MY9A 3GC2A 4JE4B 4Q8OA 3CJPA 1IIKA 3GU9A 5JDJA 3QFJB 1ZA6B 3A4AA 4JZOA 2WVTA 3IE4A 2DVTA 5CJNA 4C6KA 2UX6A 3ARVA 1MCLA 3FB7A 3C5JA 4Y5YB 1ETB1 4J1OA 3SN6N 4E5XB 3H2PA 1Z6JT 5I2IB 4LC8A 4OE7A 5DK0A 4NQEE 4LOUD 3I85A 2V5LA 3WAKA 5AZ0A 1KIUB 3QJUB 3CPLB 1G43A 3ZDYE 4OZFA 1ZANL 1QNVA 4RMWA 5HWNA 3V4LA 4XH2A 4L6DA 2H5UA 1GYUA 4PB9H 1O5PA 4DEPC 1AGFB 3W28A 5C0CD 4LCIH 3RWDB 2YMXL 3CTLA 3AGVA 1W91A 2IWKA 4R34A 2ATPB 2RJGA 1JGIA 3EOLA 4RQQA 1QO3A 1B6UA 5I1AA 3CLEL 4XWOC 4Y8AA 4ABWA 2CK0H 2ZXCA 1KJ2B 3FF7A 3C6CA 2XI9A 4PTNA 2BLFA 1OARH 1QYGH 3OL2A 2EC9T 1UTDA 3QAZC 4OZHE 3DURB 1OYCA 2J88L 4JFPA 1R9FA 3VTAA 5GZNC 2FVLA 1JWSB 5AD0B 4KKRA 3DOIA 3BFQG 4KDTA 2HZGA 3VXUD 3NOIA 4QLWA 3OB0K 3DETD 5B1CA 1HNYA 1LEIB 1RZJH 2NY1D 1LEKA 4FS9A 3DVGA 5JHDE 1QW8A 2W60A 4JRWA 3I3EA 3W56A 3MY9A 3DUGA 3DARA 4G11A 1BQSA 2QW5A 4XBEL 4X98A 3LB0A 3DFPA 5I75B 2FATH 4WTXA 4KOBA 4IRSB 1UB3A 4HPGA 2I5IA 4U1SB 5I1JL 4FOMA 2RB8A 2R4SL 4N2MA 4BJHA 1E4XI 4F33B 1TJHL 1RZFL 4HBKA 4S3JA 2YBRA 1C16A 4QD2E 2QR0A 2LVEA 3V0DA 3NIDE 3B0UX 4JQXA 4WF7A 2AEWA 1REIA 4YGAB 4KO9A 1OOAA 3TN0C 3MLYL 1BOGA 3IMBA 2IKHA 5E6UB 3C08H 2G41A 5C2GA 4PB3A 1RULL 3X11A 4O50A 3Q8EA 1TV3A 1OP9A 3IAPA 2YRLA 1EL3A 3KHQA 1FZKA 2FWSA 2FCBA 3OKDA 1PS9A 5LBSA 4JPIA 1G7JA 4JN1H 3NJKA 1U8IB 2OEKA 2V0AA 2QLYA 2LT9A 2WJEA 1GOOA 3P7YA 3SDXB 3U79A 1YE4A 1XBDA 5AW8B 3DVNB 5D2LE 2ESVE 2X6CA 4CC4C 4PJIB 3D3AA 4MVBD 5BOPA 1IV8A 4A6YL 1JPKA 1SHWA 4DZ8B 5HI4C 5C0BD 4YHYB 3T1WA 4BXSV 2PDYA 1KCUL 4WFHD 2RUSA 1TWIA 4URTB 5C07B 3QHNA 1AQHA 3WFDL 2OQJA 1TPC1 2F6UA 1EAOA 2UY7A 3WYRA 5A8QA 4KWUA 4B5VA 4IK7A 3I9PA 4CN1A 2HPOA 4NJAH 1Y18A 2FBRA 4I3GA 1K9DA 3M9YA 3NJIA 3VFPA 5GZNA 3ISRA 5GNYA 1IQWH 5DJYA 1GOIA 3MCMA 1FZMB 2WKGA 1A3WA 4AI7A 5JW4R 3K71B 1G5AA 5IREA 1U3ZA 3QC5X 3BZ4A 5F7AA 4C56A 1E0WA 5A6LA 1IJNA 3SDYH 1QZNA 3OHMB 3PJSA 5GGRY 3T3MB 3LKSA 1PIGA 1E9OB 3BW3A 3QV7A 2AQ1A 2CE6A 2OSWA 3LHPH 6PAZA 3WD5L 3LDBC 2KC0A 3IDMA 1Q1JH 5F7MC 1A6UL 5JPMB 1CD1B 4FQLL 4H1LH 1SEBA 4BKSC 5IM51 3HS0B 1GOGA 4M6NH 1PWMA 3RX8A 5DC2A 3ABXA 3WL9B 3S3SA 5JOFB 2G60H 1OV8A 2D1ZA 2GLKA 3M47A 5L2KD 1JG9A 3HI5L 3U4KA 5I30L 3DOSA 5KANI 3TN0A 3F4CA 2EYSA 4F40A 1LWJA 1W37A 1FRBA 3UJIH 3STLA 4YHOL 2OQLA 4IJBA 4KNUA 3LPFA 5AZ2H 3QOMA 3AS1A 1YVLA 3FRUA 4UM8A 3UPBA 2ITDB 2FX9H 2BSSB 2FJGB 2AMGA 2G5BA 3SCTA 3WKNA 1GK8A 4U6VH 3LENA 2APFA 4EPSA 1X4YA 3LH8A 1TV8A 3V5CA 4PJXA 2TYSA 4M6QA 1V7NL 4KMLB 3SYQA 5HYSG 1GVYA 5DRZA 1HZYA 4PC8A 4X8GA 3HPXA 3S0CA 5E8OB 2ED6A 2Q71A 4CC4A 4OZGA 2QLVB 3RVXD 3WJYA 2CO7B 3HZ3A 3HMWH 4ZODA 1W2VA 1O7SA 4FQXB 3AAMA 4X6FA 1OHZA 2ISVA 2F54E 5E8PB 5C0JB 4X6CB 1TRIA 3YPIA 1NSNL 2XWDA 2FRGP 1NWSA 1TR1A 1M2OA 2WKOF 3I10A 1PVNA 4AQOA 2FJFB 2AJVH 4XOBA 1BCIA 5AENA 4O8RA 4WSGA 3VXOA 4JFED 2F53A 1ITUA 3D4YA 3SO7A 3VFSB 4WTQA 2E68A 1LMIA 3D8MA 4L0PB 1D9KC 4X99B 4PREA 1A3RL 1YNKH 1NGPL 5ICUA 3FKKA 2E6DA 1RVGA 3ID7A 4D0CA 4WDWA 4DWSB 1OCRB 1XSKA 1K8YA 4O28A 4OJFH 1V93A 1JCJA 3H9YA 3QR1A 1NM4A 1DIEA 2YMTA 3WFAA 4Q8UA 1ZAGA 4HWBH 3DFYA 3O4LE 3O15A 5DQPA 1AO7B 3LQAL 1FWEC 3UT0A 4CVXB 2XWTB 4J3BA 1ASQA 5MERB 4LSSH 3U2SB 4PI0A 4J4PC 3LNEA 4FDWA 3RVVD 1N70A 3GBDA 2ORBH 5MHSD 3REQB 3W7MA 3WFLA 5TH2B 3CFMA 3CHCA 4UTAA 4NQSB 2DWEB 2PDXA 1I1CA 3KGRA 1U8JB 3VYOA 3CXDH 3NL3A 4M03A 3FQ1A 5CSSA 2OJ1A 1YDYA 3RVUC 4A38A 1INDL 4GFIA 4JGUA 2QF8A 1W8GA 3FVDA 1BD2D 2GGGA 3N29A 2QUNA 1L9TA 4OGXH 1U8OA 3B8IA 2IADB 1S3HA 4NIRA 4FFZL 4W9LC 3TT1H 3Q43A 2GJ6B 2Z31B 1ZIAA 2Q2LA 5LSMA 5BRPA 4Y16B 3NK3A 4O1DA 1TO4A 2CKBH 3DBNA 1WZ1L 1OE2A 2Q2EB 3F7QA 2CNCA 3B9KB 1NEPA 1QQDB 1XGRA 1L4IA 1F2JA 1LOLA 2YD6A 3ZJKA 5DA0B 4WEVX 2EQDA 1E3ZA 4S2SA 2JF7A 4UBDC 4ERSH 1IC4H 3DECA 2HFTA 5H2ZA 4TX9A 3BJFA 2EKSA 2V7HB 4EXPX 2VX6A 4YHKL 1HKLH 4QNPE 3H3PH 3RGHA 3HE6B 3P2DA 4LL1A 4P57B 3BZ5A 4JQ1A 4H8QA