4UQ9A

X-ray structure of glucuronoxylan-xylanohydrolase (xyn30a) from clostridium thermocellum at 1.77 a resolution
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
390
structure length
390
Chain Sequence
HMASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTEVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Ruminiclostridium thermocellum
molecule tags Hydrolase
molecule keywords CARBOHYDRATE BINDING FAMILY 6
total genus 138
structure length 390
sequence length 390
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uq9A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uq9A02
2O92A 2GK1A 1EGZA 1E9LA 1ZS2A 3BUPA 2GJPA 2WWCA 1E3XA 1V3HA 4LGXA 2YBTA 1GOIA 4AZCA 5AC4A 3FHAA 1V0MA 3WSUA 4F9JA 2PB1A 4A3HA 1TA3A 4CCEA 4J28A 3AICA 4CKQA 2EO7A 4EK7A 1MW3A 3ZT7A 4A4AA 3DECA 1CXEA 2VR4A 1X1NA 1W9PA 4FNRA 1XD0A 3ZJ8A 1LL6A 3UG4A 2J74A 4OJYA 3VMNA 1L0PA 1FP8A 1A3HA 3WIJA 3BAJA 1UKPA 3NSNA 2ZIDA 2ZXDA 1WDQA 2XTKA 3W29A 2CETA 3T09A 4WKAA 2WPGA 2GDUA 4Z2KA 2UWFA 3T0BA 4AZ6A 1VFUA 2WHLA 3WUBA 1B3XA 4J27A 3RJXA 3VIMA 1HKIA 3WF1A 4H8VA 7TAAA 1CLVA 4LX4A 3VD4A 2Y24A 3CMGA 2QPSA 2MANA 4BZYA 3U57A 2F1BA 1QHPA 1RH9A 3A5VA 3BVUA 2WSPA 1KXVA 4AEEA 1UR1A 2VOTA 3K4DA 3SCVA 3BGAA 3WUGA 4ATWA 4HOZA 1E70M 2XFRA 2CBJA 4XZWA 4MB5A 3WNNA 2VZUA 1JYWA 3KZSA 3WF0A 3DDFA 1QX1A 4M29A 2WWDA 1FH9A 2BY3A 3JUGA 1XD1A 3CTTA 2JIEA 3EMCA 5I3DA 1MW1A 1KXTA 4N0RA 5CSYA 2BY1A 4UNIA 4UOZA 3ARVA 5A6LA 4KRTA 2WB5A 4NZFA 2VZVA 1UUQA 1YQ2A 1HXKA 2XHYA 3ARYA 2WBKA 1HKJA 3EBVA 3ARWA 1WZMA 2XVNA 1D2KA 3RM8A 5HOSA 5A6KA 3ZSTA 3WL0A 1MWOA 4JFUA 2IGTA 3VD5A 1W9DM 2QPUA 1Y7VA 4J7RA 1ZU8A 2CERA 2WMFA 3EJRA 1UD3A 1HP4A 1PPIA 3HJEA 5ECUA 1UWRA 3S2CA 3VMPA 1V3IA 4MDPA 1PS3A 5JBFA 3U7BA 1SYTA 1TUXA 3SCRA 5CSUA 4JKMA 5HPCA 3SCNA 5A6JA 1GQLA 3GTNA 1TCMA 4S3KA 1EO7A 5LA2A 4ACYA 3UR8A 3UERA 1BHGA 1EO5A 2WM0A 4UFJA 2DPEA 1FFQA 1KQZA 2VC9A 1DWFM 4JL2A 3AMCA 2WKLA 2F7PA 4W5UA 4D6DA 3MUZ1 4PTMA 2B31A 1CGTA 3ZOAA 1ZBCA 1WKYA 5DT7A 4MJ2A 4UFLA 5KZ6A 2A3AA 5DEZA 3UR7A 4PYSA 4D6GA 1NOUA 1VFOA 3WY2A 1QOXA 3ZO9A 3MKKA 3WH8A 1UD5A 2JEPA 4MNLA 4OZOA 3FXYA 3DHUA 2DSUA 4MB1A 1EDQA 1OBAA 1JD7A 3AROA 2E9MA 3RPMA 2XFFA 4PTXA 3VUPA 4J3SA 4KMQA 1CGXA 3AHTA 1V08A 3W27A 2JEQA 5CPQA 4MPKA 3VSTA 4M1RA 2W4XA 2YL9A 1W1PA 3NCOA 4UQDA 1Q4NX 4PTVA 2QLYA 4GIAA 5E0CA 3WL1A 4LQ1A 1UASA 4CVWA 2X09A 5E09A 1ZBVA 3VX0A 2J78A 1DWJM 3CZSA 5I24A 4OBSA 3K8KA 5CG0A 1J0KA 4U5KA 3PTQA 1BG9A 3WDHA 4P7OA 3ZJKA 1BSIA 2O9TA 1FOBA 3VGDA 2V5DA 1PAMA 3D52A 1ESWA 4CD7A 1CGVA 4R5EA 1RP8A 2BHUA 2XJ7A 4HU8A 1KWKA 1B3WA 1W2VA 4HMCA 1MFUA 3DHPA 4TVCA 1K9DA 1SFSA 3VGHA 3D50A 4D6HA 3CMJA 1GJUA 2W62A 1UH4A 3IJ9A 3N04A 2PBOA 1ISVA 3THDA 3AS1A 1U33A 1ZB5A 1CGYA 3AIQA 3IAPA 5A3HA 3GNRA 3GNOA 1UHVA 3BSGA 1E0VA 4U31A 1HP5A 4WJXA 2FHCA 3BAKA 1DEDA 1HL8A 3L4XA 4AW7A 3AIBA 3VIKA 4GZEA 2OW7A 1NARA 1MQPA 2F18A 3SCWA 1GW1A 4JZ5A 5CGMA 2A3CA 4Z2GA 4H2CA 2GUYA 1PEZA 3PZTA 5DF0A 4W7UA 3PZQA 4NRRA 1C7SA 4B9ZA 5GPRA 4JL1A 1I1XA 3WEOA 3VX1A 2OSXA 3MSGA 1M7XA 4NF7A 2A3HA 2D23A 2XM1A 4UFMA 1DWHM 5EFDA 2DSVA 1W3LA 3B8SA 4ZE5A 3NSXA 2EXOA 1QI4A 1HTYA 4LXFA 4AZ5A 2WZHA 3W6LA 4TX8A 3CZNA 2ZX9A 3H55A 3OGSA 1JZ8A 2E9LA 3L4VA 1JF5A 4JFWA 3UG5A 1TG7A 4GI8A 3GXPA 4AY1A 1E72M 1W3HA 4NXSA 2ZE0A 2BXYA 5F7UA 4H04A 2BS9A 4IISA 2QF8A 3EJPA 1JD9A 4PUDA 3PZUA 1UD2A 3WNKA 1L8NA 4X0VA 2YDQA 5I79A 4W8LA 1UWQA 1OM0A 3RM4A 4MNKA 5DMYA 3KLLA 4TVUA 1V03A 3II1A 3ARUA 1LG2A 5IXEA 2DH2A 4V28A 4PSRA 1JZ3A 1KXQA 1FH7A 1QWUA 5HDRA 2FHFA 4WLCA 3ARXA 4HOWA 3TTOA 2VTFA 3L4TA 4QP0A 2VCAA 3L4YA 1VFFA 1BLIA 2YDSA 4Z2IA 3DYOA 1GOOA 2WCSA 3OG2A 3SUVA 2W63A 4URIA 4KRUA 2HVMA 1KQYA 2BY2A 4AD1A 3LXCA 5EB8A 4DM2A 4WKHA 4P7RA 3SUUA 4V27A 2WVVA 3IJ8A 2VRQA 1W9BM 3A4WA 5D8ZA 3ZQ9A 4UQAA 3TTYA 1E6RA 4XUYA 1MVYA 3W82A 4L4OA 3DX1A 1E73M 4D71A 4JCLA 3N12A 2CESA 5FCZA 4TTUA 1PX4A 3VKKA 3K4AA 1E4IA 4TOQA 3CHEA 1OCQA 5D9PA 2JE8A 2PWFA 3K8MA 1G0CA 4ZFMA 2G3IA 2F2HA 3AS3A 5JIPA 2XWEA 1GJWA 3U5UA 4A3YA 2JFEX 4AIUA 2WCGA 3QGVA 1ISZA 3VM7A 4BS0A 2IXVA 3MSDA 2EABA 3CUGA 3EYPA 2DH3A 4U2ZA 1HJUA 4FNSA 2X2JA 3BAIA 1R7OA 4W88A 5EMYA 5D9NA 1M03A 1KTCA 2OWWA 3D3AA 3W28A 2EBNA 1JZ5A 1CENA 2E8YA 3L4UA 4NX0A 2BV9A 3GH5A 1E71M 1CTNA 3CIVA 3N18A 4HA3A 3K8LA 4CCCA 4DWSA 3N17A 2YL6A 1QI3A 1CBGA 1WNOA 4DUVA 4GQRA 2WAGA 2OWXA 4QDMA 2G3JA 3W81A 1G9HA 5LYRA 1BGGA 2BHYA 4UQBA 3EJSA 4NZCA 1PZ2A 3DDGA 3LXBA 1JZ4A 5LA0A 3A6OA 3A3HA 1BYAA 1H1NA 1XRVA 3WY3A 3D5HA 3RIKA 3WH5A 2DT0A 4AD4A 4EAMA 3W38A 2X2HA 1J9YA 3AIWA 3AHVA 5CQ1A 3BLBA 2DSZA 4AYGA 2O9OA 1HJSA 1GONA 1AQ0A 1EHNA 4AMWA 5CJ5A 2WMIA 2ZUVA 4YN5A 3WD1A 5GNZA 5FKYA 1JZ6A 3WD0A 4H41A 1V3MA 1OGBA 1UR4A 3BAYA 4BQ3A 3CZEA 2YIHA 2BVDA 1O7DC 2NSXA 1AVAA 1V6XA 3EDDA 4KH2A 2VCCA 1UR8A 2WHJA 1T0OA 4JAWA 3G6MA 3K46A 3W4RA 2J7GA 1V0KA 1LF1A 3CBWA 5FOOA 1CZ1A 3SCPA 3FN9A 1ISXA 3B9AA 4AC1X 3H54A 3S5ZA 3SCQA 1MW2A 2FH6A 4CGTA 3A23A 4PMDA 1TQTA 2Y2WA 4AIEA 1V0LA 1E3ZA 8CGTA 1J01A 1J0HA 2G41A 4J3UA 3CUJA 3OLIA 1QW8A 4AYSA 3WDQA 1NWTA 3PHAA 2UY3A 3WQ6A 1CYGA 2WXDM 2C8NA 3WH6A 5ABEA 3KWXA 5ABHA 4B15A 3OBAA 5LA1A 4FLOA 1GOQA 1QI2A 2D0HA 1J18A 5CZKA 2E0PA 4UTFA 4PMQA 2PWEA 4E2OA 2ZUMA 1U2YA 3MS8A 1XH0A 1GOMA 1GCYA 3NIYA 3SUTA 2J4GA 4QAWA 1UYQA 3CZLA 3IGUA 3ARPA 4XX6A 2YJQA 1C91A 3I3EA 3F4VA 5A2AA 3WUFA 1GPFA 3LPGA 2E40A 2XM2A 3ZMRA 1UWTA 1BYBA 3ARZA 4PN2A 1E15A 1BGAA 3WNPA 4RE3A 1W9UA 1IV8A 1TE1A 3BVXA 2GJXA 3VTRA 1UWIA 1E1FA 4RE2A 2GFTA 3QHOA 3LRMA 1TVPA 1CECA 2BY0A 2V3DA 2VZSA 4BCEA 3CUHA 1CLXA 1J10A 2VZTA 3AXIA 3W24A 3PZIA 2XN0A 4GPNA 4CU6A 1HT6A 3AIVA 1QPKA 2VVSA 4GZIA 6A3HA 1VRXA 2Z1SA 4TX6A 2X2IA 3ZSSA 2X1IA 3ZT5A 2G4FA 1V6WA 4J3VA 3GDBA 1UKOA 3AZTA 2J47A 3SUWA 2WSKA 2ZUTA 3GH7A 2E3ZA 2J79A 2E9BA 1UG6A 3AS0A 3W0KA 5A8OA 5A95A 1WDPA 2XFYA 1PX8A 1UOKA 2O9PA 2IXUA 1E4LA 1V6YA 3VD3A 1W3KA 1JZ2A 2QMKA 4QCFA 4GXPA 3M46A 1OWQA 4C7DA 4MNMA 5A2CA 1QBBA 2W5FA 1R46A 2V3GA 4U3AA 1WZLA 4PMUA 1J0YA 1XYZA 1BVNP 1QHOA 1H0IA 3FW6A 2VX5A 3T2OA 4B3KA 1BFNA 3OGVA 2Q8XA 2DQXA 4FNUA 3QOMA 4W85A 3T08A 1WDRA 5ABGA 3AYRA 2GK1B 5JIWA 3O2LA 2Y8KA 5CLTA 3RJYA 2J75A 4MNJA 2X0HA 2WANA 3GXFA 5ABFB 2F61A 1MQQA 3EJUA 3NJ3A 1HF6A 3WEZA 5M3WA 3CZGA 2YFNA 4ZE4A 4AD2A 1CXFA 1QI0A 3IAQA 3SCSA 1LL4A 4MADA 3QOKA 1JFXA 3HG5A 2J7DA 1W2PA 6CGTA 2DSWA 1E0WA 3N15A 2ZX6A 3A47A 3VIPA 1XV8A 5E6YA 1HL9A 1TMQA 3ZJ7A 3MMWA 2YA0A 2WBGA 2YOCA 5BRPA 2VRJA 1Q6FA 1KFWA 4P8UA 2J7BA 1H49A 2D0GA 4WSJA 5TD4A 2ZXQA 2F1AA 5JBEA 1B30A 1BVZA 3VGBA 3ZT6A 3KEHA 5C8BB 2VNCA 3RCNA 5AC5A 5DO8A 3WELA 1UD6A 1PIGA 4QCEA 3BLPX 3TONA 3OIHA 1JXKA 1CXHA 1KGXA 3BCFA 3VOCA 2C7FA 7CGTA 3RM9A 2G8ZA 1CXLA 2WCAA 9CGTA 3AMKA 3PZMA 1QWNA 3F5JA 2DDXA 3EDFA 3LPFA 4DUWA 1V6UA 2TAAA 3BUIA 3QR3A 1GOWA 4WIWA 3T0DA 1NWSA 2E8ZA 2WC7A 3ARSA 5ABFA 2DIEA 1BQCA 2XVPA 4MDOA 4DUXA 4FK9A 4NRSA 3A24A 3VGEA 5AYBA 4AD0A 4PBGA 2QMJA 4IPLA 1J0ZA 3POCA 1E55A 4HPHA 4FLRA 2F7RA 4OIFA 3AIUA 2EADA 2IUZA 2VO5A 3GXDA 2CEQA 4E8DA 3N11A 3HZ3A 4PMYA 5C71A 2C0HA 2WK2A 1UA3A 1TQUA 3WY4A 1K6AA 3MI6A 5KEZA 1R7AA 2D3LA 3RO8A 4WK9A 3LX9A 1QBAA 3EDEA 1C93A 4JFTA 4M56A 3UESA 5A6SA 4Z2JA 2CXGA 2PWGA 5E6ZA 2BHZA 5A8MA 5E1QA 4GO8A 1SR0A 1OSEA 1V3KA 1GOKA 1OIMA 2PWDA 1EQCA 1JZ7A 1AQHA 4M8UA 2WHKA 3DX3A 2WVTA 1G94A 2VR5A 3PZ9A 2WVSA 2ZXBA 2NT0A 4CD4A 3IANA 3ZIZA 3AMGA 3BUDA 4M80A 1ITCA 3VGGA 3WBEA 4B3LA 2JIWA 3A4AA 3TA9A 2RGLA 4CD6A 1UR0A 2YLLA 3BAWA 1I1WA 1JG9A 2VJXA 5I78A 3HG4A 1NWRA 2G3NA 4XV0A 4W86A 2CNCA 1VENA 4GI9A 1VB9A 3DX0A 1U30A 4LYRA 2CITA 3ARRA 3N13A 1OT1A 1XCWA 4EANA 3WDPP 2DIJA 4JFSA 2ZX8A 1CNVA 3WENA 3APGA 2W66A 3DC0A 2VX6A 1MXGA 1KR1A 3GBDA 3BMVA 2GVYA 4HMEA 3KLKA 3FNDA 2CBIA 2CHNA 1MFVA 3DX4A 1ODUA 1HJQA 3D51A 4IUGA 4UCFA 3WN6A 3NUKA 1UR2A 4H7VA 4PCSA 3BXWA 1JXJA 2XN1A 4MAZA 4MAVA 3SURA 1H5VA 2D3NA 2UY4A 3VILA 3QHMA 1VJSA 3SCTA 1ECEA 3EMQA 1R85A 1CGWA 3RILA 3ZJ6A 3AZSA 1HXJA 1R47A 3CZ8A 3GZAA 5C70A 3MUIA 2VI0A 5I6SA 1XSJA 3CC1A 1C8QA 3WNMA 2ALWA 4RE4A 2WMJA 3M07A 4DO6A 2EPMX 3VD9A 3FAXA 3VGFA 4UFKA 1UD4A 3VINA 1LJYA 1LG1A 4DWSB 3A21A 4LPCA 1E6SM 1Q6GA 1HKMA 2EQDA 2OYLA 3A22A 4J3XA 1UZ4A 1J11A 3BAXA 1W9VA 3F5KA 1D7FA 3TTSA 5EBAA 4FF5A 3OGRA 3M6DA 4GO9A 2YLAA 2Z1KA 1E6QM 3WMBA 4CD5A 1JYNA 2XPKA 5A8PA 3VVGA 1W1TA 3W26A 2XGIA 4D6CA 3AQUA 4P7NA 3MANA 1QVBA 3ECQA 5JUVA 1BG4A 2J62A 4C7GA 5IDIA 4XZBA 1QW9A 1YHTA 2CIPA 1QNQA 1GVYA 3VD7A 3VIOA 1RPKA 3CLWA 3BVVA 3GYCA 3OB8A 4HZ8A 5IFTA 1XHGA 1GQIA 2XIBA 1UKTA 3GM8A 4ACZB 1I75A 1W91A 4PEEA 3EJTA 4B16A 1UQYA 3CO4A 1W3JA 1EHAA 2ZUWA 1NWUA 4AZHA 4FNTA 3VNZA 1R87A 1TQVA 2QHAA 2VQTA 3CUFA 4AD5A 4YHEA 3WBAA 3MV01 3WDRA 3SIMA 1FP9A 1US2A 3WNLA 4AISA 2GSJA 1XGZA 2F7OA 1WE5A 3WMCA 3AHYA 2VUYA 1EDTA 5AY7A 3BVWA 3OZPA 4D6EA 2Y8VA 4OKDA 1JDDA 5A2BA 2WMHA 4BA0A 1JNDA 2AMGA 1KB3A 3CGTA 4H8HA 3UCQA 3RDKA 2Y4SA 1JNEA 1WAWA 5M5DA 1CGUA 2DT3A 4X0NA 4UOQA 1CIUA 4W84A 2A3BA 4UOJA 2AAAA 2CKRA 3B9EA 3NDYA 2ZX5A 5A69A 1C3FA 3SUSA 1JL8A 3LRKA 1W1VA 3B9DA 5D4YA 5CLWA 2YL5A 4BQ5A 3FHQA 1WZKA 4JIEA 4QLLA 1EH9A 4M82A 1VJZA 1NH6A 1QNOA 2RGMA 3DYMA 1H11A 2OWCA 2JALA 2GJXB 4XB3A 3AI0A 2VCBA 2WMGA 3DX2A 5I77A 3NDZA 1B90A 5JBDA 1P6WA 1VIWA 4HZ7A 3FAWA 3T0AA 4U33A 1JDAA 1B1YA 4NI3A 5DFAA 7A3HA 3AJ7A 1R33A 1TQWA 3CPUA 2XSAA 4MB4A 4HTYA 3OA5A 2WMKA 2JF6A 1PZ3A 3EJQA 1ZL1A 3ARTA 4U5IA 4F66A 1GNXA 1HX0A 1EOMA 1GHRA 1KCLA 2XVKA 2WNWA 1OIFA 3LRLA 2CKSA 2D73A 1ZJBA 2NW0A 5GNXA 1IZJA 4D6IA 1NM9A 4CN6A 4BF7A 1JAEA 2FGZA 2DT1A 2JF7A 3WF2A 1V02E 5A94A 2OW6A 1E4NA 3W37A 2BFGA 4HOXA 5CXPA 1BPLB 1X6NA 3VIHA 4K68A 4UQ9A 4D1IA 2WC3A 1UWUA 3W53A 4UR9A 2PC8A 2ZWYA 2OYKA 1JI2A 1TFVA 1CXKA 2XG9A 4CD8A 1GQKA 4P7QA 4KWUA 2OSYA 1JF6A 2DT2A 2XGBA 2EEXA 1O7AA 4AIOA 1ITXA 4LYQA 1KBKA 1B3ZA 3HMCA 3N9KA 4W93A 1XCXA 1VEOA 1DTUA 1EOKA 5M17A 1V3JA 3BC9A 2YA1A 3BH4A 4R27A 1HJXA 2ZUUA 1EQPA 3SCOA 1TQSA 4UFIA 4WF7A 5A6AA 1J0IA 2QV4A 1JYVA 2X2YA 3GXTA 1H2JA 1HWWA 1BAGA 6TAAA 1KWGA 2J25A 1B3YA 4HA4A 2CPUA 2BNJA 3ALGA 1E6NA 5A6BA 2HISA 3WQ5A 2X8RA 5I0DA 1N82A 2X0YA 3WFLA 3WQ8A 1WDSA 4FLQA 2FE0A 1B0IA 1GORA 3H53A 2DEPA 1UH3A 3LPOA 3WF3A 3IJ7A 3L2MA 2BVTA 1Q6CA 3PBGA 4W7VA 1W32A 3WH7A 3AZRA 1UH2A 1G5AA 2YKKA 3BUQA 3TV8A 1F4HA 3OZOA 1RP9A 2XWDA 2EAEA 1E5JA 2V5CA 1BTCA 4JHZA 1FA2A 5HXMA 3K1DA 5DT5A 2ZUSA 4EKJA 1VEPA 2CYGA 1B31A 5E70A 3TOPA 4RL3A 2PBGA 1KCKA 1W1YA 4HU0A 1DHKA 2YBUA 3D4YA 4PCTA 2VZOA 3GXNA 4HZ6A 1GZJA 1OD8A 1B3VA 2UY2A 5E0FA 1O6IA 4Q7NA 2VT0A 4UFHA 3WDJA 1XSIA 1WZAA 4HP5A 1WB0A 1XH1A 1HVQA 4PSPA 3EDKA 1TVNA 3KL5A 4PMRA 3CHDA 5GQBA 4MJ4A 3WD2A 4FNQA 4JFVA 3TTQA 3BLKA 1X6LA 3MO4A 1OT2A 1E1EA 3MU7A 2J7HA 5CPTA 1WO2A 2XIIA 3BVTA 1US3A 1E4MM 3S5YA 1MYRA 4J3WA 4TXEA 4H8UA 3L4WA 3PZGA 1ZBWA 1D3CA 5BXPA 4D1JA 1NOFA 3WH9A 2VURA 4EE9A 1OD0A 1E56A 1GHSA 1TA3B 1PX3A 4BQ4A 1V6VA 2YA2A 1LQ0A 4AWEA 1XYFA 3AYSA 3J7HA 2OSWA 1JDCA 1IT0A 1E6ZA 1RD6A 2GJRA 2J7CA 1R86A 4F9DA 4DM1A 1HJVA 2EJ1A 5I5RA 1KTBA 2F7QA 4W8AA 2V3EA 5A6MA 3WD3A 1PIFA 3NYDA 3CZJA 4D6JA 2CBVA 1ODZA 4ZENA 4ATLA 4AZBA 4D72A 2ZWZA 3UG3A 4DWSC 3GNPA 3VPLA 4NZJA 4IPNB 1DWAM 4PMVA 3WNOA 1HJWA 1ISWA 3ALFA 4CN1A 4MTVA 1JIBA 2EACA 1JYXA 1E0XA 1FHDA 4HPGA 1JI1A 4P8WA 4FNPA 4OOUA 1IZKA 4UQEA 3VDCA 2WVUA 4UQCA 1CWYA 2E4TA 1UWSA 1JAKA 4M81A 3AHZA 2J8GA 1PBGA 2J8FA 1V3LA 4UZSA 3GH4A 4GZJA 4V2XA 4NSBA 4YHGA 3SEPA 4PMNA 1QNPA 3CUIA 3AS2A 3AISA 3AFBA 1UKQA 1HKKA 2XSBA 2W67A 1QI5A 1NQ6A 4PMOA 1AMYA 1LWHA 2PWHA 5BCAA 1GQJA 5IHSA 1J0JA 1C8XA 2XYLA 4AMCA 4YPJA 1H0GA 3VM5A 4LYPA 2D22A 3PN8A 1R34A 4M24A 4ACZA 1BYCA 5AYIA 2F8QA 1VEMA 1WP6A 3AXHA 3AMDA 5FL1A 5E9AA 2XVLA 4N42A 4JHOA 4CN4A 3HU7A 1JFHA 3ZR5A 3BSHA 1K9EA 5IHRA 1SMDA 5BXRA 1EA9C 4F79A 3W25A 4W87A 4DO4A 1GUVA 2FH8A 2CCRA 2UY5A 3U5YA 4AZ7A 3VDBA 1M53A 2BVYA 2ESCA 3L4ZA 4IM4A 4CVUA 5CGTA 5EFFA 3WQ4A 1A47A 1W9XA 1FFRA 4C7FA 4PMZA 1WCGA 3LPPA 1HIZA 4E4PA 1Q6DA 1XC6A 1DP0A 2W91A 4Y7EA 3AXXA 1UA7A 4P7LA 1V02A 4DWSD 5FL0A 3IK2A 5I23A 2ZXAA 3OLGA 1UR9A 4HA1A 4P8VA 5BWFA 1NP0A 1R8LA 3AIEA 4AZGA 2VMFA 4CCDA 3HN3A 3VDHA 1JGIA 4Q22A 1TR1A 3O6AA 1MXDA 4QLKA 3T2QA 3WD4A 4KGLA 3KL0A 2ZICA 1HVXA 5HPOA 2OYMA 4OUEA 3KE0A 5I2UA 3CHFA 4BQ2A 1H41A 2DGAA 1CDGA 4ZEPA 2ZX7A 4AXNA 1OGGA 4AEFA 2WMIB 3AHXA 3AMLA 2FGLA 1GVIA 1J12A 1Z32X 1KBBA 1MQRA 1EXPA 2CBUA 2D20A 2XVGA 4L4PA 3HG2A 1E40A 2Y5EA 1KXHA 2PF0A 3N1AA 1K9FA 1LWJA 5A8NA 2WLYA 1VBRA 4W5ZA 1KGUA 4TVDA 3VSVA 1DWIM 1KR0A 2ZUNA 2WYSA 4U3CA 4ZXLA 3CV5A 1E6PA 1SMAA 4UZUA 3LMYA 4AZIA 4QLJA 3VIGA 2V38A 3GXIA 1C90A 3UEQA 1CPUA 3WMSA 1ISYA 1XH2A 1ZBKA 3VDAA 4ML4A 3MUY1 1XSKA 2YFOA 3GXMA 2EPNA 3E1F1 2WHMA 4P8XA 1HN1A 2EPLX 3ZR6A 3KL3A 4AZCB 3DYPA 3U7VA 4U2YA 5A8QA 4HMDA 2J7EA 3OLEA 3VIIA 3HG3A 4JKLA 1FH8A 3QHNA 1K9TA 2EPKX 3LXAA 5D9OA 2WC4A 1LL7A 3FY1A 3CZKA 3ARQA 4DO5A 4S3JA 3PTMA 4B9YA 3VIJA 3VU2A 2OLHA 3A4XA 1OINA 1E5NA 1H09A 3S6TA 1C7TA 1VBUA 2DSKA 5BYWA 5M03A 3CHCA 1BF2A 2D24A 4MB3A 3I3BA 1E6XM 2WW5A 3I3DA 1CEOA 1VAHA 1NP2A 2WZIA 1ZJAA 1B9ZA 1H3GA 4GQQA 4PUEA 2J77A 2NT1A 3F5LA 5BXSA 2VX7A 3MUAA 2XN2A 2GDVA 2V3FA 1G01A 2W61A 4E8CA 1B2YA 4F8XA 3EDJA 3MMDA 2WVVB 2D2OA 3PZOA 2AOSA 4J3TA 2XUCA 2FYVA 3POHA 1AQMA 1PJ9A 1UD8A 2CHOA 2D0FA 2WLZA 1F4AA 3NSMA 2D1ZA 3WUEA 3WQWA 4GINA 3L2LA 4CU8A 4CUCA 3WY1A 5CPSA 2ZOXA 2O9RA 3VMOA 1FHLA 3AIRA 3T2PA 1M01A 4W89A 1S46A 3GBEA 5FD0A 4KGJA 2W92A 5HNNA 3TP4A 4OBRA 5FIPA 4ZXOA 1CXIA 4JKKA 2G3MA 2VRKA 5IFPA 1WPCA 1TZ7A 2VL4A 1G1YA 3BMWA 3RMEA 1DWGM 4GKLA 2J7FA 1QNRA 1VF8A 2BXZA 4PTWA 2WZEA 4OOZA 3MMUA 3VIFA 3WF4A 1HNYA 5D9MA 1UQZA 3G6LA 1QNSA 3WDIA 2VVNA 1EIBA 3VSUA 4AMXA 3EMZA 1R75A 3BCDA 1UZ1A 2EPOA 5A6BD 4X9YA 4AD3A 3WFZA 3THCA 2A3EA 5GNYA 3M7SA 4QFUA 1OB0A 1OGSA 4PMXA 3WKZA 1H4PA 4W8BA 1C8YA 3PZVA 1BYDA 3ZM8A 1V0NA 3SCUA 3OLDA 4NXKA 1M04A 4WSKA 3VO0A 1UKSA 4Z2LA 3CH9A 4TTGA 5D8WA 2FHBA 3W6MA 4GI6A 3VNYA 4PRWA 3AOFA 4FMVA 2YDRA 3O9NA 1E43A 5BXTA 4WKFA 2WKGA 4OGZA 3WEMA 1LLOA 1Q6EA 2VQUA 3MV11 3WQVA 2VX4A 3D4ZA 3PTKA 1QHZA 5BRQA 4W7WA 4D6FA 5A1AA 1MW0A 2FDMA 2PI6A 4JCMA 5HBFA 1VFMA 5BROA 3BUBA 4Z2HA 8A3HA 1EDGA 1NOWA 3PZNA 1C92A 2X05A 4CU7A 2YL8A 3UETA 1KGWA 4ATDA 4FLSA 1SZNA 4TUFA
chains in the Genus database with same CATH superfamily
2BWQA 4Q4MA 4NZ8A 2O92A 1RLWA 1X4YA 3L9CA 1IKFH 1EGZA 1E9LA 3TYGH 4XP4L 1ZLWH 1YEHH 3HC0A 1X9RA 1BGXH 4P2QE 3NQVA 4LASL 4GRMB 4NOBA 4XPHL 2WO4A 3O3BB 4M1DL 4GD0A 5J8OA 4JHUA 4UM8A 1MDRA 3CASA 3P8IA 5CZ0A 3D85A 1EHXA 2YBTA 2BIPA 1JPFB 1N7ML 1TV8A 4LGXA 3DKHA 1V0MA 2VLLA 3ABOA 5EU5A 4LEOB 1OC7A 1OLZA 1HJCA 4HG4K 1E0OB 4PI2A 4AG0A 2F5AH 1ZT4A 3KBPA 3O2DH 4U05A 3QJTB 1IE5A 1TA3A 5J5EA 1TPFA 4Y7OC 5IBUG 4K5MA 5EZLA 3NQKA 2NXYB 1BSLA 3L9EA 4CKQA 1BQGA 2EO7A 4JKPH 4LIQH 5ICYB 1SEBB 4B91A 3UTSB 3DIDA 4PJ5E 1P4LB 2XH7A 3DO4A 1AW5A 3G3MA 3TPUA 1E28A 1YX1A 2CLZA 1UUSA 3LVEA 4BZ2H 3SQBB 1KELH 1X1NA 3U2EA 1SPDA 3FT3B 5DHEA 4FNRA 5HHMB 5FUCE 3R7RA 4L0YA 3LN9A 3RNQA 3N41F 3VFVB 4NT0A 4OJYA 2ZKHL 4PYHA 4O9HL 4HC1H 1FLTX 2YAOA 3LZFL 4I7ZC 4IK6A 3GDTA 2IEPA 3H9HB 4JTUA 5C8JB 2NWRA 4ELKA 5IEKA 1A3HA 3C6LC 3DSNA 5L2KB 3QW4B 2YD8A 4JPKH 5AB2A 5EZLB 2KDGA 3TEVA 1TZ8A 2ZIDA 2ZXDA 2XTKA 3W29A 2OR7A 3BPCB 1ZA6A 2NQHA 1ADOA 5HYSB 4JZNB 3RVXC 4MFEA 4WKAA 2WPGA 4FHBD 2C4FU 4YQXH 5DYFA 2GDUA 5D7EA 3T0BA 3NH7L 3TASA 1S6NA 2ESVE 5DJZA 4F58L 5HATA 4B9CA 4MJ5B 1XEDA 3QCTL 3PAZA 2WHLA 1Y18B 4WO4C 4R90L 1AH0A 4HJEA 1B3XA 1F7BA 3IDGA 3B3IA 4PJEE 5GJSL 3CVHB 5DHVH 7TAAA 5C0AD 4EOWH 2Z2UA 2ZRZA 1IE7C 4P2OB 2MANA 2YX0A 5CO1A 1CO1A 4HYTB 4OZ4A 4TVPD 4AVNA 3U57A 1JR1A 1TQBC 2F1BA 4H8WC 2VMDA 3DG7A 4YVVA 2BNQA 3HE7B 3PXLA 2HPOA 2WSPA 1R24A 4G8IA 4LF1A 5DUPL 1UR1A 3CV7A 4KBXA 3SCVA 5AOZA 2C5DC 4MWAB 1QO3B 2V5BA 3VOIA 3FT4B 1XTMA 2H1PH 3FPXA 4DZ5A 3NA9L 1IVTA 1A65A 1GOFA 1G1KA 2WIIA 4NRZA 5A40E 2BGNE 3DBNA 5H8PA 1U9KA 4BA8A 2XFRA 2R7EB 2NX5E 3I6KA 2EJAA 1A3LH 3KZSA 1QASA 1ROWA 4ZO7A 4KTGA 1MEXL 4M29A 1EWHA 4NO0B 3FO0H 2V7HA 3AXLA 4AEHH 1KV8A 4AF0A 2NTFA 2BWIA 4HBKA 1UIPA 2ITCA 3BL3A 4HU3A 2J27A 2QW5A 3C12A 3EMCA 5I3DA 5E4OA 2EZ0C 1KXTA 1X98A 4ENEC 4DBEA 3AREB 4QJ3B 5FSEC 4LHUA 3S0CA 1T7YA 3GJFK 2IANB 4OZGA 4TV3A 2F0CA 1ZA6B 4NENB 4LNVA 3RDJA 4XPHH 4A6YA 3Q0HA 3O6CA 3NFPB 4WW2F 1EBAA 5MHBA 2C1OB 2ONEA 5A6LA 3BARA 2BVPB 2ISWA 4H25B 1KYUA 1AANA 1UCTA 1UG9A 2WB5A 3WLKX 1EZUA 4NZFA 4I3GA 1RPUA 1UUQA 4BD4A 1QFUH 1KKRA 2Z91B 4ZTOH 5GGQH 2LFEA 2EYTA 1IBGH 4BK5C 3EBVA 4LLVB 3T6CA 2F5AL 1SOQA 4I0PA 1KENL 3WL0A 4N2IA 4LO9A 2P5EA 3DX8B 4Z7OB 2VXQH 4G7QB 2R69H 1TX2A 3PUUA 2EG8A 4B9KC 2HKAA 3R06A 3TH6A 4MCYB 2MWCA 5D5MF 1EFZA 1FVCA 1PS9A 3W1QA 1W72A 2QPUA 3HZKA 3V0EA 4KZDH 1ETZB 4P06A 3RWEB 1X1OA 4FULA 2L7QA 2GC7C 2WMFA 1KELL 1E6OL 3C60C 3HJEA 4IMKA 4XVSL 1JRCA 1H6UA 3ABGA 4X4XA 5AW7B 3L3OA 3W7OA 3NFNA 3MAWA 3IJLA 3ZE0F 4I5BB 1SYTA 3ULSB 5E9XA 4M7JL 3TVAA 4OV4A 3SCRA 5CSUA 2MKWA 1HH9A 1HNGA 2BX5A 2EXYD 2H2PD 1ET7A 3DTXA 4KDVA 1P0KA 4GXVH 3FB8A 3ULVF 3SCNA 2BP8B 4UT6H 5CJOL 3L3GA 4U6HA 3GTNA 4MXQD 4UOW1 3WN5C 1EO7A 4AGNA 3EG9B 1JJKA 5LA2A 4ACYA 1DQQB 4WHBA 5D1ZB 2WM0A 3KDMB 3HC3H 3W56A 1KPUA 1IFGA 3UW6A 4JFEB 1FFOA 3UXDA 2VC9A 2XIJA 1XGYL 4KJPD 5B21A 3OV6A 4D6DA 3GO1H 1Q45A 5DRNA 3MUZ1 1TMCB 4ODTL 4XC3L 1UZ8B 5BMFL 4J2QA 2WSDA 4X9BA 3B56A 3FOLA 2CJSA 2WTPA 1WUFA 3TFXA 2XBTA 2YQGA 1TZ9A 1YN6B 4IYKA 1XLIA 4B5SA 3NK3A 3RTLA 3KG5A 3TJLA 4J1UB 3P77B 1JCYA 4MJ2A 4UFLA 5KZ6A 2VDNB 5DEZA 4FMFA 2QKSA 2OXHA 1QATA 5IMLA 4P4KC 3O8XB 2A3AA 1A6ZA 1FCUA 4M6PA 4ONGL 3TH3T 1ZT7B 1NOUA 3QFJB 3W7QA 3GUGA 3CLEH 3QQ3B 4HFWB 4JDTL 3RXZA 3NQ8A 4XMLH 3MKKA 3WH8A 2GOUA 5KSWA 4DP6X 3SFKA 5IB1B 4MNLA 1XIJA 3W7KA 3V10A 1S9VA 3KTCA 3RYSA 4X99B 3B4UA 1AZ1A 3FUNA 3QAZC 1C08A 2DQCL 3BKJL 3NA9H 4XCFH 2E9MA 4OJDH 3N44B 2XFFA 3QV8A 2VDML 4X50A 4WOZA 1V08A 1JTTA 3ROLA 4ZB0A 3K6DA 3NACL 5I1EH 5CPQA 4MPKA 3MLXH 1UXSA 3GSVA 3IVKB 5B38B 3PWUB 2AFNA 2NW3A 4KKRA 5CZSA 3NCOA 3Q2VA 1F1AA 3KH4A 4PRIA 1NBZB 1TPWA 4IGNA 4J40A 4UQDA 5IQ9A 1K77A 3KPPA 5A5WA 3MLSL 4PTVA 4FF9A 3PP3H 4UAHA 4NNBA 2PCEA 2R1PA 4WEBH 4GIAA 3KLHC 3ZE2F 1OVZA 3W9DA 4BWUA 2J8UF 4UMCA 5DQ9A 2R1WB 4LQ1A 3SE3C 3EWUA 4ZMYA 4Y4KC 3RGVC 4AY7A 4UDTA 4KROD 4BE5A 1BYPA 2X09A 5I30L 3C8FA 5E09A 5GGQL 4ZTOL 1ZBVA 3KPSE 2ID5A 3PHOA 5I24A 3QG7H 2DRUA 4U5KA 2AEIT 4L8DB 2AL2B 4POCA 3KPSA 1IAMA 4LCUB 2O9TA 2HYMA 3F58H 1CVSC 1D2OA 4IQJA 1AGCB 5LIWX 1RK1A 3LN4B 3D52A 3LV3B 1E1CB 3ARGD 4ODSL 1G7JB 4U1NB 3SE8H 4YYFA 1TV2A 3G1YA 3VTMA 4F3HA 4BHUA 3HNTH 4C83B 3DDMA 2JMRA 3QORC 3EEGA 3HLAA 4R4ND 1OFAA 3FYYA 4AMKH 4ZUSB 3CN2A 1W0WB 5JW4N 1FNGA 3FCPA 4MA7H 2JNZA 2VLRA 2ZG3A 4LCCB 4AQ8A 2AEPH 4NN6B 1VCGA 1MHEA 2DZWA 4TVCA 4MPQA 3STZB 1RJYB 3PHQB 4E9RA 1K9DA 1QBLH 4N0UB 5IQOA 3R1ZA 3VGHA 1KZYA 1B4RA 3CMJA 2D7QA 2NUTA 1X5GA 1GJUA 3N04A 5C2XA 3TV3L 5CEXA 2C79A 1ISVA 4LLYB 3MCMA 1OM9A 1SJEA 2PGEA 1P4UA 3THDA 3EXLA 2GTQA 1ZB5A 3KS0H 3IU4L 4UCGA 3TXAA 2YD5A 3W3BA 3ZDWA 3U83A 4JDVA 3GSRA 3BVDB 3IAPA 3AIQA 3U0PB 3MLVH 1THFD 1VCBC 1QQDB 4MWFB 4C6LA 4HPYH 5EY5A 3OR6B 3GNRA 1J8VA 3HUJF 4RNFA 4OQTH 1QMLA 2EVIA 1OCCB 4H3DA 2DS4A 2FWLB 2XI9A 4O0KA 3P81A 5HTSA 4TUJA 1FDLH 4DGVL 1GHFL 1NKGA 3QHFH 1U93A 3LLDA 4WJXA 3BAKA 1KFGA 4F8NA 2CLVB 5FV2A 3S37L 3ZIMA 1EP1A 2UV8G 1Q5MA 5D4IA 2RBLA 3RDTC 3L4XA 2GCYB 4F15C 3K71A 1E9PB 1Q9WB 1T6MA 3PJSB 3UOAB 3K7UA 4GP4B 5IK3B 5EC1B 5AD0A 5FF4A 2Z8RA 3VIKA 4PV8A 4TUKH 5KINA 2V5YA 3EBGA 3ZZSA 1FNEB 2VABB 3EYQC 4QHNB 1XBYA 1HI6A 2EYSB 2YD1A 3BP5A 1BZ7A 2XRAL 4MSSA 1AS7A 4G6MH 1MWAB 4GS7C 3MXWL 3DIVA 4G6AD 2A4CA 3HS9A 2NY7L 2EF9A 2GUYA 2P0IA 1EAPA 1T5WA 4JZJB 1BXCA 3PZTA 2XZZA 3V18A 2CZVA 3YPIA 3BP6B 2XH0A 3VW3H 1CX9A 4NRRA 1C7SA 3FJTA 4IGBB 4LBEA 2ADFH 4B9ZA 4LSUH 2DD8H 2ANUA 1BVLA 2A9AA 1QDSA 4KWSA 4OJFL 1HINL 4E2DA 1NBVL 4QSHA 3O41A 3ULUE 4CQBA 4YDZA 1WOAA 3TZNA 3LSOA 1BP3B 3OGCB 3MSGA 3FRPB 4JVUA 1M7XA 2OFQA 3P3UA 3GD1C 1PSKH 3EGSA 3WHXB 2D23A 4UFMA 5D7KE 5EFDA 4C47A 2ISDA 4N68A 3QMTA 1ME8A 2VXUL 4K3DH 3MJ8B 1N2VA 3L23A 4R6UA 2Q6WA 2DV6A 3O11B 2HJPA 4XXDB 3IK4A 2VDKH 1CD1A 4I0PD 5C9JA 1QI4A 4FHKA 1HTYA 4LXFA 4O2FA 3KYKH 2VW7A 2CU0A 1F3DJ 2IH9A 3HPZA 3TYEA 5JW4M 3W6LA 4TX8A 3B2UD 5DMIL 1FC1A 4AV5A 4L1WA 4UWMA 4YS1A 2ZX9A 3H55A 4FFZL 1MHEB 4D2NA 2R0ZL 3N1MC 4K3ZA 4HS6B 4DGIH 1TMHA 2E9LA 4PCNA 4W9DC 4JFWA 3UG5A 1KTNA 1OC5A 1G0XA 3GIQA 5I66B 4JE4B 4F7EA 1TG7A 4ZSOE 2OTWB 3WG6A 1RZKL 1DV7A 3QFWA 1A6UL 2ASHA 2QL1A 3H7BA 3GXPA 1LVEA 2OX5B 4P2QA 5D7LE 5D1QB 2KI6A 4L4TB 3GMPA 3P0XA 5BMWA 4EN3A 5C6TL 3BXNA 1FVDB 5I3FA 1F1GA 3ZL1A 2VIRB 3N85H 4YHIB 1P4BL 3VXRB 3M44A 3L3DB 1S2UA 3AU2A 4IISA 1S5HA 1PD0A 2B1AH 3KPSB 4NO0D 5TQ0H 3VCLA 2UWEB 4J6IA 1KA9F 1YDNA 4DK6A 2OL3H 2NV9A 1JD9A 1S9YA 3PZUA 5AG9A 2AJ3B 4OB5L 4YTQA 3BICA 3HLKA 4U1JA 3DO7B 4RFNC 4KKBD 5HVWA 1R3JA 1DYZA 1KRBC 2H3NA 1ZS8A 3TM6A 2FR4A 3D69A 5IM7B 5I74C 2Q3XA 2HK1A 2V9QA 1P0NA 5T5NG 3DVNB 1VCAA 5DRZB 4HUUB 1SSGA 5DMKB 2PDLA 1MSPA 4WU7B 3MT1A 3FCBA 4TVUA 3NZHH 4NILA 4CNSA 3IDYC 4ESKA 3L45A 2HJLB 4MAYB 4QBXA 5CN3A 3GSNL 2DLIA 4WWKD 4B2DD 1GYWA 5LGJA 3QS3A 3T2LA 3GB6A 4Z3HA 1R9FA 2GT9A 4Z8FH 2GJZA 3MOAH 4DSYA 3S1WA 3MV7E 2QHLA 1QWUA 5HDRA 3C5SB 2BFVH 3H42H 5D2LE 5L7XL 1UMLA 1IAOA 5HQEA 4HX1B 3VXOB 3ROLB 1PZUB 2UXGA 4RISL 3U4EA 3MRCA 4KK5C 2A5UA 4M8QB 4JIQA 4HOWA 1FHVA 1FP5A 3O9WC 5BW7C 1U8JB 1AH4A 4S1SL 2PR9A 1LTDA 1T96A 2QUUA 2K8MA 2X70A 3MRDB 4HLZH 4EUPH 4Y16C 3DYOA 2N7BA 5I75C 3WIHH 3NXFA 1UZHA 1G87A 5AVWB 5IVZB 2EDKA 3MXWH 1GOOA 3RWGA 7FABL 1RK6A 3NAVA 2V2HA 3ZWSA 4J12A 1A3ZA 4ELMB 2CBMA 3URBA 4LE8A 4KS0A 3W7HA 3NZ8A 4FXKA 4YXLH 2ZOLA 2HVMA 4KRUA 3FC8A 1KV5A 1CD9B 4H9TA 4BZ1H 3NQ6A 5I8CA 4OJFH 4P7RA 1NBYA 4RKAA 4QXTA 4HKJB 3RX5A 2VERA 1A4MA 4WWOA 1TXKA 3IDIB 1W9BM 4G6FB 3K4WA 3HZMB 1TJHL 2WXOA 3RY6C 3GNXA 3FQ1A 3N42F 4FCAA 2ON3A 4KIEA 1R3IL 4NJJA 4XD6A 3LB6C 3W82A 3AGWA 3AT0A 1BDYA 3DX1A 4Z76B 4D71A 3RVUD 2XTJC 2RKXA 3AB0B 4KVCH 3HUJA 1TJGH 3LSOB 1ORSA 5FCZA 4TTUA 2VC2B 3KYKL 1V77A 4YHNB 4P2OC 1BLNA 3D39D 4WHYG 3O2DL 3K4AA 5A2IH 1UWXH 1FKXA 4PRDA 5CMAB 3L21A 5B39B 3L5LA 1U8JA 4TOQA 3T65A 4B7LA 3JVAA 2CGRH 4F2EA 1V27A 4HYWA 1G0CA 2FB2A 2NW2A 1HH9B 1SHXA 2G3IA 3JV4A 1HYSD 1RZKH 5JIPA 2J8TA 4PV1C 3QEHB 2EILB 5I5MA 3SSGA 4J3BA 4QRSB 5LWYL 4Q33A 5CPLA 1SLXA 1A5FH 5MHSE 1GG1A 3UNDA 4GUCA 2E6PA 4HUVB 3HPLA 1ZDQA 4PVLA 2YD7A 1FN4B 2HRLA 3ZKMD 3IS4A 2XFWA 5T1DH 3SAZA 1T6WA 2W27A 4Q8PA 3K6FA 2DH3A 3GFXA 1JEZA 3AZUA 1W72L 4FNSA 1QFWI 3GSXB 3WKQA 5ECUA 5ADOL 2ZSVA 3FT2B 1K7XA 4F8QA 3QQ9D 4GBDA 3FQXB 5L4JA 1ZCOA 3QJZA 5EMYA 4FA8A 3ITYA 1EWDA 4IIDA 4LAZA 2OEJA 3KHJA 1CVRA 5ICXA 3VWJC 1KTCA 2GQHA 4FTVB 5HVGB 3N1PC 1S8DB 4JFEE 4S3GA 4QXGL 1S5HB 1JZ5A 4WFHD 4FNLL 4EIUA 1CENA 2DWEA 4X4KA 5GJMA 5DJ6A 1EEZB 2IANA 1E71M 2W6RA 2ZVRA 2PPEA 4B95C 5GZOD 3G1DA 4HA3A 3O63A 4A7TA 1MNUL 3K8LA 3MJWA 4XMKH 2VXVH 1ZIBA 5FGBA 1X7IA 2JFCA 2UXFA 3A4FA 4DP5X 2VWSA 2YL6A 3AJXA 4PY8J 4XO8A 1A21A 3O4LB 2XSKA 4FZEL 4JTCA 5L7XH 1CWVA 4Y4KA 3VFNA 1EUAA 3CN1A 5DMLA 2AJVH 2BNQD 1N8WA 1OT4A 2GTZA 3FFCE 4JFPB 2E25A 2WAGA 4FXGB 4RZCA 1XRFA 3LEXA 2KUTA 5C7ZA 1NFGA 4DPCX 2Q1EA 3DSFH 4RQQA 4YDNA 4ZGYA 4U1NA 4W9IC 4PGZA 3FSVA 2GPTA 2QQLH 4NZCA 3GNML 5GGTH 4ZTYA 4HNVA 3LXBA 1NLDH 2X89A 1ZV9A 3G5ZA 5F3BB 5EEZA 4N6FA 3HE7A 5IW6B 4P49A 3PBMA 3QZWB 3WY3A 2I60L 4IRZA 4AD4A 2Y89A 1J9YA 1YEEH 2L4OA 2PGRA 4CNUA 5KS9F 5GS1B 4MXVE 4Z7UF 1QLRA 5EBWA 3O6FC 5H4ZA 3AHVA 3GSNA 3W7EA 3ZS4A 5MEOB 4H2AA 4BSVA 4TX9A 1Y18A 3ET9F 1AQ0A 3HNSL 5H8MA 1NF7A 4WI9A 4CA4A 2YXGA 3DO3A 5HDQH 4XP5L 4XRCA 1XF2A 3ZE1E 4J8RA 5EWIH 2W95A 3CXDL 1NBZA 4LDEB 2WMIA 1IBGL 2ZUVA 1MZZA 3OHMB 3VOFA 2VDQB 1EDHA 1DBKL 2CLFA 3S0PA 4MX7B 5C0AE 5KVEH 1GGIH 2DQGH 4NQQA 4WHYH 4K7PY 2EH8L 5IVXA 3MTXA 4XD5A 3C6EA 3ULVE 3OKLB 3LIZA 2YUVA 1OGBA 1T2QL 4KJYB 2NNAA 1A5CA 2VDLB 4PRDB 4H1LG 1YY9D 4LVHC 1O7DC 4KXCA 1N5AA 5TDOB 2ZXGA 1TQXA 3SQBA 1V6XA 4WV1C 2JKWA 2RFXB 3TZVB 5BVPH 1H9VA 5JMRA 1RV8A 2IKIA 5FYLE 2XU2A 3G0XA 4EI0A 3G6MA 4NUGL 1OTTD 4YDLC 1GQNA 3L48A 4HCFA 1GYVA 4KXAA 1PG7X 1AD1A 4WCYL 1AD4A 1V0KA 1XP3A 2QADC 2J7GA 3CBWA 2EE0A 3RWFA 2Q3OA 5FOOA 2YPVA 1CZ1A 1ZJHA 4LNRB 2YB1A 4RW3A 1YN6A 2C1PB 1WS7A 1QBML 3GDKA 1MJUH 4X6DB 2NZIA 1XF5A 3H54A 2C71A 4G3YL 5I1IH 1H5BA 4PW9A 5FA4A 2VLKD 1OK4A 2AANA 5DC9B 3QI9C 3NQEA 5REQB 3ETSA 4DVBB 1HK6A 1V55B 3MX0B 3KDMA 4N9DA 2OMWA 2C9PA 2PN5A 3CUJA 1RZ8A 3I02B 1G7JA 2AQTA 4WFFD 2X1SA 1BVKA 5E8NA 3WDQA 1VGEL 1YBQA 3BLDA 5CBEA 4GRSA 1WAAE 3H6OA 4TVPE 3NOYA 2UY3A 4FJ6A 1CYGA 4M6MH 1M3UA 3LMZA 4ZW7A 5ABEA 1FI8C 5LGJB 4KERA 3TWBA 4JO3H 5AW6B 1O68A 4RZ5A 4GXFA 5IEHB 3HR5B 4U1LA 2CZEA 4BFNA 2W38A 3NACH 3L5AA 4BFIA 2E7FA 2IDTA 3LQZA 2P5WD 1JDEA 1QJWA 5H2ZA 3SJVD 2PTWA 3L6FA 3QPKA 2E0PA 1O5PA 2FWSA 5G5IA 5I09A 2H8PA 1EAOA 2DVXA 4B41A 2JB5L 3CQQA 1Q13A 1WOBA 2VWTA 4M6QA 4LB8A 2IXQB 5I03A 4PGBA 1OOWA 4DJFC 4JCWA 2JB6B 3UTZB 4C8XA 1XH0A 4DYJA 2GQ8A 2ZNXA 4J3OC 3I6SA 4JTAA 4EIVA 3GMMA 1ASQA 1RLDA 3NIYA 3I9GH 4KZEL 4MD5A 2J4GA 3SUTA 4MZ1A 1RIUL 5B8CB 3EO9H 1OE3A 1UYQA 5ENWB 4PJBA 4B5XA 5FUZL 4KKBC 5FSDC 2XXCB 3MFFA 1MI5B 2OP4L 1A6TB 3EBIA 3ARPA 4XODA 2JI3A 1B2WH 2KERA 4WTXA 3QARA 3S4SB 3R0KA 4XX6A 5CC7A 3I3EA 5KTEL 2ZZ7A 5U7SA 1AR2A 1ZJIA 3M5XA 2GZXA 3SDDB 3WUFA 3LPGA 2NY0B 3E3HA 1AG6A 5FF6B 3QTPA 2R29H 3ARZA 3CMOH 3QUKA 4LRTA 1E15A 1EA0A 2DV0A 1T21B 5IMKA 1ZTMA 2YXVA 2A74A 4QHPA 1W9UA 4JPWL 1IV8A 1JPSH 3BVXA 4WEEA 3CDYA 3JVGC 4W9JC 1UWIA 2GJXA 1AODA 2GL5A 4RE2A 3B9OA 4C56D 1MRCH 4YIWA 5KOVC 3LRMA 3IMTA 1EZLA 3KVPA 5HHPB 3NQMA 4QHMB 4N9BA 5E2VH 4WU5A 4TVPH 5CNHA 2QCEA 2LU5A 4MVBD 2BVEA 2HFEB 3CWGA 5IR1B 3CUHA 2WO2B 5CINH 3MHGA 1FPTH 4OQVA 2ALDA 5DFWH 4OZIF 5CH9A 1Q85A 3SGZA 4YNYB 1LQBC 2R2BB 2Y5TA 4TNWK 4GPNA 3OGCA 1HT6A 3CYVA 1GGOA 1JN6A 3MNWA 2VVSA 3UAJA 1K3UA 2QF7A 3GBML 3IETB 1PDZA 5D2NB 3VXUA 1VYSX 32C2B 4UQ2B 1R5WA 1QNZH 1T6BX 1AFVL 1E0TA 1K1DA 2X1IA 3GHRA 3PG8A 4I5RA 4IGBA 3OAUL 4QNEA 5CSSA 5GJTH 3EG9A 1V6WA 4XZLX 3K4ZA 4P3DA 3RHWK 3GDBA 3RE0A 3TBVB 2D2JA 4IMEA 4LEEA 2EE2A 4MA1C 1UM5L 4PS4H 4KKAC 4AGPA 4BV1A 5JXED 4FXSA 1BCIA 1S7XA 3MLVL 5HINA 3SUWA 2LLLA 1HI6B 3AITA 3BP5B 2J1ZA 2ZUTA 4KXZH 1I1FA 5SX5K 4UU9A 3D39B 1A6AA 3ARBC 5JIHA 3EOEA 4PB3A 2E9BA 1O60A 3AS0A 3BYYA 1UG6A 3BGJA 1I1YA 4P4RA 4WY7L 1IGSA 5A8OA 1RURL 2XH4A 2GBTA 3S37H 1OK8A 1WDPA 2I5IA 3HQOA 1IU1A 1UOKA 3VD1A 1EJ7L 1H1ZA 4PBEA 3BISA 3PWJB 4LS0A 4LBRA 4FP1A 3ABRA 4N3TA 5TJWK 1MUMA 3DJ9A 3WXWL 2QMKA 1AHWA 2FB4L 2XETA 3UACA 3LTSA 4G6ML 1O5DT 1U8KB 3KWWB 4L3FA 3O45B 4L6DA 4NYUA 4GXPA 3DPBA 3Q5OA 4OLVH 3LEVH 4RRPM 1W5NA 3NM3A 4JM2C 2Z7WA 3LZ3A 5MF5A 3FO1B 4LPYA 1A6AB 4J8QA 3IUDA 1J2BA 3P69A 4X8CA 3S2JA 1KCBA 4PWGA 3S83A 1R46A 1NBVH 5GGUB 5ID0A 3O81A 1AG1O 3T3PF 3LRSB 3QKEA 3QIWB 1XYZA 1BVNP 3CAWA 3QRGH 2MCPL 2B0SH 2ITCB 4KJWD 2VX5A 3U0HA 2Z3FA 1FCGA 1IBBA 1BYNA 4F8PA 4NZTH 4WY0F 2DQXA 3BV7A 1SVBA 2L3BA 2VDPL 3BEWB 2ADIB 3IRCA 3NPVA 2ZT9C 4JW3A 2MMXA 3I6KB 4KTDH 1AO7D 3AYRA 2VDKL 3N14A 3IDYB 3O2LA 3A3WA 4UTCA 2KMWA 5CLTA 3V7AE 1CFNB 3KEDA 4BFFA 2HBVA 3MYZA 4MNJA 4JR9H 2WANA 5EZOH 4F8LA 2Q76B 3FT4A 2QAPA 4OIIL 5ABFB 3FB7A 5LLIC 3IJ6A 3NJ3A 4Y2DB 1JP5A 3WFHA 4GX8A 5G4EA 5BXFA 2WTRA 4XPFL 2MHAA 1CXFA 1AHWC 2A4AA 2YYUA 3P0GB 5JORA 4HCDA 3SCSA 2XZ7A 5C0JA 1I7UA 4L4JA 5HDBB 4K9EH 2J7DA 4FXGA 1YJDC 4K5LA 3GSMA 4FR6A 3W1RA 3CAFA 1LP9F 1EEUA 3A47A 1CF8L 1AR1D 2VSDA 5E6YA 2CLEA 3H4XA 3KP1A 4C91A 4E9WA 4JHWL 1UURA 2PTTA 5HI4C 3IV3A 3SDDA 2ICEB 4HIBA 3NQIA 1P7KA 1CI1A 1GA2A 3Q6GH 1CL7L 4G42A 1HILA 4GB9A 4V1XA 3VXGA 3N4EA 4H7ZA 3QHZH 2P5NA 2VRJA 2J2ZA 3VI4B 3ZW3A 1M7PA 1KFWA 4JDEB 5ACMA 5GJTL 5IHWA 2YC1A 1PZDA 2LGNA 4I2XB 5TD4A 1H49A 2ZXQA 2Z65C 4XBSA 4K15A 3C2AL 4NQDB 2F1AA 3EOLA 3SSZA 1MG2C 5JBEA 4EZKA 2BRQA 3IDUA 4MNGE 2A4ZA 5CILL 3DGGB 3D8MA 4RETB 1Q2RA 5LHDA 4LU5H 2HT2C 3UZQB 1FJ1A 1QPXA 3ZKXB 5IB3A 1BKHA 2VNCA 2P44B 3PFQA 3SO5A 8FABA 1MFMA 2CZNA 4LLMA 4X6CF 2XG5B 1EJOH 1MLCB 3JYBA 3OXSB 1JPEA 3BLPX 4MY9A 5F8RC 2VN4A 1PD1A 4KKCC 3UTSA 4I5XA 1KGXA 2XPGB 3VOCA 1ME7A 4N9EA 3MHZA 3C2EA 5LDUA 4M8VA 1K5WA 1DLHA 2IANE 4YX2H 2H26B 1XIBA 2VGFA 4UU9B 5K93A 5M7QA 3A3YB 4L1LA 4DGYH 3TVMD 5DZOA 4YTSA 1FYHB 3OG6B 3DBXB 1YBQB 3QC3A 4DN1A 1NCCL 4EO5A 3MQIA 1G6RH 4Y5YB 4OLVL 1BVKB 2RMNA 4RFEB 1LLZA 5AZ0A 2VXTL 4DPRA 2H6OA 5MEQA 3UYPB 3T65B 1UWEH 1ZAHA 2FVKA 3EJZC 4YXLL 1OK0A 4O4WA 1SOKA 3LMJH 4XX1G 4HULB 1O1ZA 4UTBH 3F8UB 3QQ4B 4GUOA 1JN6B 2BWDA 1KMGA 4S1DD 1SFJA 3EOTL 3KXQA 3R13A 4XBPA 3WKZA 3BT2L 3O3DB 4UTLA 3C2FA 1UJ3B 5FA4B 4WGWB 2DQJH 1G9MH 2YD9A 5HYJD 5EEWA 1EGMA 4Y9EA 4M62L 4BR1A 3ZE0B 2QKIB 4PJCB 4MMXB 4I5UA 1KRCC 2QMJA 4KVCL 3SPIA 1Q9OB 5EUKA 5DRWA 4EQ3A 1RZIB 2ZJSL 1H50A 1JPGA 2DLTA 3WLIA 2ZSWB 1I8IA 5CCHE 4JFYB 4PGCB 3BEVB 3SDYL 1NBYB 3ULSA 1E55A 4FFYL 1VPXA 3IVSA 2IGFL 3H6JA 1OGAE 1RIHL 2VDOH 5EZOL 1K8ZA 1KD0A 3ZWTA 4XXCC 2PTUA 4TNGA 4YC2B 4F93B 2VGBA 3C09C 3V5DA 3KWVA 2FT6A 2Q7AA 4E8DA 1TTJA 4ENLA 2EDNA 3HZ3A 1VKXB 4P5TB 3L3IA 3W73A 4Z7QB 2WK2A 2R0LL 3B5GA 2DYSB 2QQKH 3M0ZA 3P3TA 3WY4A 2CFFA 1K6AA 4UNKA 8TIMA 2OJ1A 3F7LA 2E7HA 5GS0L 4RDQG 4NQUA 3KW7A 3PXHA 1CLYH 2ZZ6A 5BRZB 3FCGA 3IBEA 3L3KB 5BUGA 3FFDA 2ZD0A 1K4HA 4WK9A 3MLTB 4GOSA 4IEFB 5T3XE 2F6XA 1XXXA 3MJMA 1IKNC 1MG3C 4KEUA 3S88L 1REQA 3EDEA 2AQWA 2K8QA 2CLOA 2OO0A 3PANA 5IBXC 1LDPL 1Z89A 4WWKB 4JFTA 5TDPA 3RZCB 5GS1C 3X3FL 4GUJA 5KANG 1W5MA 1KXTB 3B2VH 4U7KA 1BXUA 4AYBA 5ABZA 1S3HA 2Q09A 4Z2JA 1I9IH 4EPKA 3F01A 7XIMA 5AC6A 1DUZB 1RUSA 3G5YB 5TIMA 2BHZA 1PDKB 2PABA 3KJ6H 1MHCA 2PW1A 3MRNA 3Q2LA 4YBHA 3SO3B 4TNFA 5E1QA 1ZS8B 3H12A 1CDHA 3VFRA 3GSNB 5J0BA 4NP7A 4HGMA 2YSSB 3FJ4A 4ANWA 3VRLF 2PWDA 1BKSA 4P5MB 2WIIB 4NRZB 3EOOA 1JZ7A 3FU3A 5FGRA 2Y0SA 1H7XA 2AGJH 2WHKA 1AXTH 3NOIA 3DX3A 4WFGD 4XOEA 2O4MA 5D03A 3NTYA 2OXGA 5D4QA 1MZRA 5KN5A 4WI6A 5FK9A 1TPEA 5CC3A 3IANA 4ZQNA 3PJNA 1BMZA 4GCAA 5LHFA 1UC6A 5BO1H 1CDCA 5FYJD 2P80D 3AMGA 4LF2A 4PBVC 3T6QC 4LRNL 4M80A 1ITCA 2FO1A 4JN7A 3HMJG 2NY2B 3H2QA 3RFRA 2DIAA 3FU6A 3A4AA 2RDUA 3TA9A 3B1TA 1EFXA 3CJJA 2PODA 4LAOA 1G6RL 1OFPA 1KTDB 1T0PB 4GY0A 3VKCA 1FGNH 1PYWB 4S11A 4IP4A 3T55A 5E8DH 4LGSB 2XXMB 4HJJH 1PCWA 3IDXL 1A02N 4JY5H 5JA8B 3HG4A 1FL6B 3KYNA 1OWRM 3HA1A 5LCVH 1E9QA 3MN8A 4FQJH 2FZNA 3MPCA 5IT2L 3S5OA 2G3NA 2KC0A 3V0SA 3BIKA 4X0KA 3F85A 3TDFA 4QT5B 4MUZA 4TRPL 5D1ZI 3APMA 1MAJA 3ARRA 1SDDA 1OTUC 5C2UB 4OHQA 1KCSL 1XCWA 5CSZB 5DCEA 4EANA 1JHKH 5AECA 3MJGX 4ATTA 4FE9A 3M0MA 3HJ0A 1FUNA 5T5NF 5C6MA 5F7YC 4ORZC 3L9BA 2P1YA 5IFAL 3WENA 3TZVA 1XLAA 4IIQB 1HCFX 2ZYRA 2FQIA 3JV6A 5KSAA 4HN4A 1MXGA 3U6XS 1BXXA 1SLVA 1CE1L 2R6OA 3BP6A 4LVOC 3ZYOA 3TEZA 2C26A 4ANUA 4IFRA 4YWIA 3VFPB 2EDFA 4HMEA 1AGDB 4KFNA 4Y5XC 3HR6A 5D1XC 4Z3IA 2ZCHL 3CLFH 2COVD 4QRPD 3RAOA 1U8MA 1H6EA 5BZWA 1MFVA 2EXWC 5E94A 1ODUA 2DUZA 3WLPA 1IL1B 4XCYB 1JGLH 3E7JA 4HJGB 4MZIA 1J5OH 1HJQA 2V33A 3UROR 5ILTL 5AD0B 3NG5A 3RUGA 4OCNC 2EXYC 3KBEA 1YAIA 4E36A 3I6TA 3NUKA 1U3HC 1X5IA 3GLAA 4KXBA 1Y5XA 4NP4L 3TAKA 5AB3A 3X17A 4H20H 2HFFB 5DEFA 4H7VA 3EWWA 4JYDA 2IV8A 4PCSA 3SY8A 2VD8A 2HT3D 5DU7A 1A7BA 3B3BA 1FXQA 3LNHA 3BW2A 4MAVA 2J1XA 3U7WL 1NGQL 4NJ9L 1BFVL 1S3KL 4JX4A 3TBWA 4LCIH 1QQDA 1YEGH 3GIZH 4MWFA 4PLJD 4JQVC 4IIQA 1FWNA 4K94H 1AW1A 3RWJA 3CFKA 3HG1A 4XZUA 1FZKB 3RZWA 2Z0UA 1K2DB 3A4DA 3T3ME 4N2GA 4RV3A 2PYFA 3U25A 1OD9A 3AC0A 4JQXA 3U30C 4QR7A 5D7IA 1W6TA 4B92A 2DYRB 1GPOH 1YUHB 4XH2B 5F3HB 3S35X 5CBAB 3H3BC 4QTIL 1UOLA 4G7FA 5I6SA 3HI6L 1AXTL 5ABDE 1WTGT 4UTWA 1ZVHA 1ITQA 3UJSA 3VXUE 3TO4A 4OFDA 4ELMA 1LORA 4DO6A 1BJMA 3M17A 1PBYA 1JHTB 2B1HH 2B7DT 4WI7A 4XX5A 4YBQC 4BHUI 1B3OA 3ATBA 1QFHA 2ARJA 2ITDB 4NNXA 1G6RA 2WUCL 4YPGB 5IHZB 4UFKA 2VLRD 3VINA 4DGUA 2W9EL 3O16A 4M6ML 3A21A 3UP6A 3U9IA 1MOEA 4ODUA 3O1NA 3HBQA 2E3VA 1E1CA 2O72A 1ZXQA 2TODA 4HK0A 3IKCB 4J3XA 2V0AA 3MR9A 3V4PL 1BF5A 1J8KA 1NCHA 1IC5L 3ALPA 4ECNA 5INDB 3BGGA 1D7FA 3SYAA 4Q4KA 4IG2A 3ULVL 2XQBL 5IT2H 4EXPX 4J2MA 2Z1KA 1E6QM 1CLOL 1R0AL 2KT6A 3KW3A 1NOAA 4YU1A 1JYNA 3CXFA 5A8PA 1XF3A 1TRIA 1P5VA 5CKAA 1IWPA 1Q38A 1SYVB 4P9ML 5F88A 3US9A 3ZVVA 4K94C 5FYLL 1D7KA 2WWMC 1QLEH 4L5FL 4X5LA 4CQAA 4DIAA 3HPJB 1HWGB 1LP9E 3LIZH 1R5IB 3UBXG 5MI0B 3ZDXE 5IFAH 3MANA 4IIHA 4P7NA 1TZIA 3A67H 4E38A 5FUZH 3UL4A 3M45A 3N3EA 3EB2A 4K39A 4AVHA 2DICA 2EO1A 1BG4A 4PRTA 3EIFA 4DBUA 2Y6SC 4NQTA 5E1HB 1DJNA 4JY9A 1NELA 2YBVA 1QOPA 4BKTC 1TCRB 3RA7L 1YHTA 4WCJA 4OZIE 3ECBA 4N4QA 4YHIA 4X6DE 1WV7T 3CQPA 4HK0B 5EU6E 4A2DA 3JRKA 4FALA 5AC7A 4K1GA 5PAZA 4DXVA 2HVJB 4HZ8A 4LUSA 1XHGA 1R3WA 3KHDA 3K30A 4H40A 3QAZB 4GA8A 3V0AC 1MPAH 2EKSB 3QUZC 2VQ1B 3KJ4B 4FQ2H 4W9ZA 5D93C 1PY9A 4PEEA 5AL8A 2PDPA 4ACZB 5G4MA 3R79A 2AV7B 3UGVA 1UQYA 4MCZA 5I17B 3D47A 5D1XE 1MO0A 2ICWA 1CFVL 5HNTA 1EHAA 3GWJA 3AWFA 1AZRA 4H88L 3PAUA 4N90D 1CCZA 5ID1A 4TLUA 4MFDA 3GEFA 4PJ9B 1FPTL 1BFTA 3EYSH 2YPVH 3C60B 1AJ2A 2QHAA 4DY1A 4JQ2A 5E8PB 4HD9A 4HFUL 1TFHA 1VFLA 2J24A 1JRHI 3F2LA 3IGKA 2NQCA 2QVNA 3GIZL 1YUHA 3Q5TA 1XFPA 4XH2A 2CKBA 3CX5J 4L0PB 3MV01 5EUKB 4P3CL 2WLJA 3NSCA 1IEWA 1UUMA 2DU2A 1A5NC 3NIDE 2EVHA 3WHXA 2GSJA 5DRNB 4FG0A 2W65B 4NNPH 2YWZA 4PS3A 3RNKA 2YCKX 1MQ8A 2Z1BA 4OVXA 5SWSD 4FQHA 4YXHH 1EDTA 4IKJA 3IVTA 1NTHA 4CAGA 5I6OA 5HDWA 4JFFA 1IXQA 4JMXA 2ZRVA 4JS7A 1DBAH 4LBEB 2Y8VA 3FOKA 3L5MA 4MY8A 3U4BL 2VX7A 1F2XK 1UWFA 1QWHA 2ETWA 5D7LD 1MNSA 1SO6A 3IUIA 4K5PA 4YWSA 2ZP0T 1A6WH 1MCPL 3JUZA 1JUFB 3SJ3A 1KB3A 3RDKA 3T0CA 1R2RA 2XIMA 2GJJA 2Y4SA 2WUCH 2N0KA 4G80A 2GB2A 1KB9J 3SE6A 1RR2A 5KYXA 1GKQA 1BBJA 2MJWA 3NRQA 1B4JH 1OYAA 3F2CA 2DT3A 3E2QA 1XGEA 5I19H 4LAJH 3QMSA 4X0NA 2FBRA 1EK3A 4MNGB 4MOZA 1XLDA 1CIUA 2WLHA 3B8DA 5HJDA 2ISVA 5EOTB 3BLLA 1AL8A 1JGVH 2A3BA 2H9GB 3DGBA 3GIVB 4W84A 2PYED 4ZW8A 4UMAA 1EC7A 3V52H 3GK0A 4HK5A 2E59A 1ZFJA 4UT6A 1RU9L 2FR4B 4PWHA 3VI4E 1EGJL 2YQ3A 4ZW6A 1YY8B 3AWEA 3UZEA 1NSNL 5I73B 3W5MA 1LRNA 5F1OB 5CLWA 5D4YA 1NCWL 3FHQA 5JXQA 1IGYB 5T1JA 2WJ7A 5K1JA 1XIGA 3LHUA 4QLLA 3VXPB 1WKDA 3DYMA 3AT8A 4ERGA 5F89B 4L48A 3JWDH 2HN7B 4KRPB 3V0FA 2VCBA 4OT7A 3DX2A 4NZTL 1QFWL 3A5FA 2CRIA 4KHTL 4KK6D 4PB0H 3CEPA 1OQOA 2VIRA 4R9OA 5F6IB 4GW5B 2O5XH 2QGDA 1FRGL 1F4WL 1F4XL 2JSFA 4QT5A 3ZTCC 4DN3L 1XDMA 3CVDA 2HKFL 3I75A 4U33A 4X80H 4U0RB 3LCYA 3HIZA 1AO7A 3GSQA 1IQDA 3RGHA 5JNYB 1NF0A 2ICEA 3B40A 5DFAA 5ICZB 3HAEG 4MA8H 3DMMC 1Q94B 3RA7H 3AJ7A 5LGYA 4QRPA 3G0SA 4IDJL 5I15L 2GBVA 1CT5A 3LDVA 2WMKA 3H7LA 3H2CA 4HTYA 2AK4B 1C9WA 4YSCA 4XBGB 2EUXA 4JLRB 4OCWL 4ETQA 5L2KD 2WSRA 1E42A 3H2AA 1QRND 1LBLA 2KQMA 5IFHL 1HX0A 2NY1C 3L3HA 5HP5A 2R94A 3LRLA 2DJXA 4IQHA 1PO9A 2NW0A 2GBAA 1TENA 4ODXA 1LQAA 2V17H 4XXDA 5L9DL 1DFXA 1YADA 4MJMA 1PKOA 4PWKA 1BWKA 4G8AC 2PLJA 1JAEA 5A94A 3D25A 1E4NA 2CLPA 2BFGA 1SXBA 4HOXA 4HFUH 3W37A 4AITA 1SJVA 2IAMD 5INCB 4QJ5B 5KJ4A 3WNIA 4GGHA 4BY3A 1UQSB 1B9KA 2AJZA 4BK8A 4IRJC 2BCMA 3QDMD 3RVXD 1KFBA 3MWAA 5FB8B 4U4MA 4GGBA 1WDWA 1TITA 3CVIH 1KN4H 3UIYA 3KS6A 3ME0A 3BE7A 1JI2A 5JHMA 3QNYA 3E0IA 1V6TA 5EULV 4NKQB 3I4KA 2ICCA 1FDZA 4AM0A 2XG9A 4Q9CA 3D5OF 3NL3A 3U2OA 4P7QA 1HTIA 2ZC8A 2AJXH 4PJIA 4U6TA 1KCXA 3FH5A 3IU3A 3QEGL 3ZDXB 2OSYA 1KEGH 4X9GA 4ZAKD 5TPWL 2EEXA 1YNKH 4BWLA 3DHJA 3EF4A 5CHNA 1E9PA 3J8F7 4H8WL 2LW3A 3BKCH 4MA3A 3U0TA 3V0VB 3N9KA 4AB4A 5FM5O 4K3JH 3LBCA 1MFNA 4HJWA 3TH2T 1BA9A 5DA0B 1FO0L 1OCNA 1KY6A 4V1DE 5K7JA 1ZVSB 4GKZA 1DQUA 5ESAA 4J5VA 1PUDA 2YQ2A 1MCWM 1S78C 4O58H 4OF7A 3RWCB 3N2CA 5F8QC 4AUJA 1F13A 1EOKA 3BV4A 1GVSA 3IGFA 3D0CA 1YXCA 4C4BA 3BH4A 3UTTE 5GRVK 4IBUA 3SIKA 1WKFA 2CO7B 3G6DH 3WJMB 1SRDA 4OI8A 4ADGA 2V9DA 4HIEA 1YPZB 4YHKL 2L5HA 1OP5K 3QFJA 3SCOA 4RIRA 3A12A 4UFIA 4HAGA 1YYAA 4M8RA 1XGUA 4GEIA 3OKOA 5H91A 2EDRA 1N67A 1NINA 3MUGA 4UTBL 4JZOB 4WHTA 1OM3L 4K2UH 1RZIA 1H2JA 2FIKA 5DD6B 1PAZA 3LD5A 2DOCA 2UY6B 4GS7B 6TAAA 5F7WC 5J13B 5K9KA 4I4WB 2B4CC 4M1CD 4M6OL 4ZFFA 2J25A 1KWGA 1KFAH 5D8JL 1KN2L 1ZEAL 1B3YA 2FLIA 1X5XA 3NIGF 4XPTH 3EX4A 3G6JA 2P7TB 4PGJA 4M03A 1GGCL 3WQ5A 1MFCL 3MXVH 1FAIH 1K4CA 1NPJA 3P4OB 4MAYC 3RJQB 1V5XA 2X8RA 5EGRA 2RACA 2H0JA 1GGTA 2E76C 2MTAA 2WY3B 1KY7A 3IFNH 3DG3A 3KTXA 3C56A 3W86A 4GKSA 4W4OC 4XHJC 3TC3A 3WFLA 1B4KA 4S2SB 2C34A 2HFEA 4ZOEA 4TKWA 5FF2A 2KPNA 3DTXB 4FLQA 5IBTL 1B0IA 3DXIA 3URQA 1ZTXE 3WTTA 4NI8A 1K8XA 2RGSA 5CEYB 5C0BB 4JGDA 3SO7A 3STPA 4I5BA 1XPYA 3WF3A 1CFSA 5AOJA 4NHCL 2QXWA 3IJYA 4DP9X 1MF2L 2JLPA 2JXMA 4JPIB 4KXZI 3HHSB 1V8EA 3D9AL 5F4SA 2G75B 4PRPE 1F42A 1RUPL 2K1MA 3NZUA 3REWB 1T21A 4Y9CA 1IM3B 1G5AA 4N2LA 2YD3A 4REQB 2XQYK 3DVGA 2BZ7A 4DQAA 6REQA 5BOOA 3GO2A 3TV8A 4ZS7H 1O5XA 1MI5E 5E51A 5AZEL 1PKLA 1RP9A 2KS0A 3LZ5A 4GAGL 4P4KA 4UTUA 2E9IA 2HRWA 2EO9A 2D8KA 2JVUA 4YE4H 5ANHA 1NANH 1RJCA 1WEJL 4NGHH 1BTCA 3CQFA 5IQ9B 1JCTA 1NIBA 3WSQL 5K9QI 1QK0A 3SQMA 3MRMB 4WFHE 5DT5A 3B2VL 1SHWA 4JQ3A 3CVIL 2NXZD 4ZXBB 4K2SA 1GKPA 1UB5A 3SGEH 1ZENA 3GMMB 5EN2B 3CVBA 3DX5A 1U8HB 3H2FA 1X3DA 3K72A 2C1OA 4IJTA 1E4WL 5D7SH 2R51A 5ISZA 3THML 3UTZA 4XR8C 5MHSD 5ITFB 2PBGA 3B7TA 3LQAL 1T1WB 2ZKMX 3L0NA 1KCKA 1W1YA 3FYOA 2EIMB 1NEPA 4G42B 4HCRH 5C09B 5J11B 3CO8A 3STGA 4GIPD 5KG9B 4JO2L 3D4YA 2PS2A 2VZOA 4N0YL 4HZ6A 2VLJB 4I85A 5F2FA 5K9CA 4DZIA 2B1OA 3DROA 1ONXA 4X6EB 5DHYB 3W9EA 5C0IA 2EC8A 5HGBA 5IJCC 1O6IA 4Q7NA 4XWGL 1G7HB 3FN0H 1OCJA 3W7GA 3WDJA 1ZMYA 1XSIA 2FSEA 4LRNH 1M4KA 4FG2A 3PGFH 4R3SA 5I1CL 1WZAA 1XYAA 2N7AA 3EOAA 4P2CG 2DLFH 4XD4A 4XKMA 3EDKA 4PMRA 1F8IA 3RG6A 3QJHA 5DJ0B 4WAFA 5C08E 3GTTA 3ZTDC 2G9KA 1CFNA 4Q4SA 1X4ZA 4FNQA 3BDKA 5BWAA 4JFVA 3TTQA 1Z5LA 3D33A 3QT2A 4L8SC 5GIRA 5PCYA 3SOTA 4DCQB 1NVMA 1FFOB 1CTMA 3BLKA 1NFKA 1KPUB 1X6LA 3ATZA 1I8LC 3U79A 3MO4A 3NDOA 3ZIYA 4J3OF 4LCWD 1AGEA 4NUJA 4Q52A 5CJ8A 3SQRA 4PJ7E 1GR7A 1JWMA 2HSIA 1E1EA 1BFOB 2VXSH 1F8MA 1OFOA 1UPMB 2GJ6D 4XPTL 3MU7A 3XINA 4Q8OA 1ZNNA 3V0JA 3BE1L 3QIWA 3PUEA 1K6QL 2ZUQC 2NY6D 2R2HB 4MLJA 2N56A 2VB5A 2XIIA 4PLOB 3BVTA 1FWDC 1SW3A 1TKKA 4JAMB 2ZXCA 3P0VH 4PTUA 2PCQA 4DKFH 3RBGA 1NEZA 5IB2B 3RWHA 5B80A 2AERT 4XKYB 4J3WA 3FO1A 2H7WA 2PPAA 4TXEA 1Z9PA 3FYPA 4X5XB 1I7RA 3TWCL 4H19A 2ZCGA 2ZCHH 4D1JA 4OW6A 3CC5A 3CZFA 4Q0XH 4Y19A 2XWCA 2X38A 4E41E 3UBHA 3N3MA 2VURA 3P67A 2F38A 4L9LB 3NFSH 5FIEA 6FABH 4N1CA 1MVFA 4F24A 1OD0A 1MCSA 1T66C 3S3PA 3KVLA 3RN6A 4BQ4A 1XR9A 3HMWH 3FSAA 3T2NL 3ZMEA 1OHLA 2R23B 4LLVA 4UUJB 3GWQA 1GOHA 1A0QL 2AAVA 3HRPA 5DSCA 1P4LA 2H41A 2PU0A 2UV3A 3P9LB 4GSXA 1NGYB 3QJRB 3PWGA 1JDCA 3GF8A 4XOAA 3TO2B 1U95A 4XBEH 4M82A 1KACB 1VH7A 3CWNA 3LHYA 5ERWB 4E9XA 1WEJH 4XI5C 2EJ1A 1S9WA 3WSQH 4X2UA 2NSMA 4QXWA 2WTOA 4PRHA 3OSVA 4XN4A 5MP6L 2PDIA 2HLFC 2ICWI 4N26A 3I6EA 4L3EA 5CCKL 3FRUB 2V3EA 4YDKH 3FU7B 4MQTB 5E5MB 3ZKSD 5A6MA 1EHKB 4R0LB 1YVLA 1OB1B 1MFAH 4WNQA 4WXZA 2CGYA 3ZL4H 4KRPD 3TT1L 3WTSA 1PSCA 2CUAA 2PLKA 1YA5A 4ATLA 5IQ7H 4JO8A 3MNWB 5EU6D 2J88L 5KBPA 2FGWL 5EA0L 4PM1A 3GNPA 4RNIA 1GWJA 5JMUA 1TR7A 4IPNB 2JKTM 2MOGA 3B2DC 3IUHA 2OQJB 4AVKA 3SYOA 3VWJB 1AC6A 1IGCH 2DMKA 3WFBL 3ATYA 4WDXA 2W9DL 4BINA 4CN1A 4FX6M 3OJVC 1EEXA 3Q2WA 1E0XA 3C6LA 1FHDA 2IQ9H 5DXWA 4NN5B 1XS2A 3D08A 3G6JE 5HHPA 4OOUA 1J93A 1NPNA 2IPFA 2K3HA 4GSQA 4XO7A 1BZ9B 3DMMD 2J7LA 3KBHE 3TURA 2OZ4A 3GGWB 1AP2A 3BH8B 3MA7B 4LVHB 3RKPA 3KJ4C 4M48L 4C58B 3AHZA 4YR6B 4LANA 3PGFL 2ENJA 5L9FA 3PIQB 2WGXA 5DVNA 2Z0IA 4BRVA 4G43A 3CUXA 3GH4A 1IEAA 4GZJA 4V2XA 3RL1A 5MEPB 2A1YA 1H15A 2QR0A 2DJUA 4W81A 5BOJA 1S1PA 4KKXA 3O3AA 4TV5A 2DY3A 5KVFL 5JOPD 3MRHB 3SEPA 3QC0A 1OABA 3TOYA 1WZ1L 1ZKAA 4JN1H 2C9UA 5DLLA 4J4PD 3TC7A 5EN3A 3MB9A 4JD4A 4Q9QL 3QXDB 1YEFL 3AS2A 2DZBA 2EVFA 2XSBA 1H3VA 2FB3A 3FSUA 5KBDA 1NQ6A 5BZAA 1AMYA 2JQZA 5BCAA 1OFDA 1LJMA 5LKNA 1FNLA 3O2WH 4KDTA 4J3OD 4R7XA 1C8XA 4ZD3L 4HNTA 4WO4B 4ZNEA 4N2HA 1NAL1 4HXBH 2A9CA 2BSCA 3B9KC 4H0GA 5AKTA 1ASOA 3VVWA 4KUZH 2VDNH 3GI8L 3BZFA 5AL0A 3FVMA 2NNCA 1OFBA 2FZ3B 1KG0B 2F8QA 3S5SA 3AG3B 5CJQL 1I9RH 2E5BA 3V5CA 3L54A 5EA9A 2EDQA 1WV2A 3GSXA 1EXUA 1N64L 4J9JA 2J4WH 1P2CB 2WXFA 4N42A 4KEZA 3VI3B 4U1HB 2RJMA 4JY4A 5CJNA 2F8VA 4EI5B 3IE4A 1JFHA 1N9PA 2ZF8A 5BZDB 1OYCA 2VSMB 1B88A 5EDSA 5ISZE 1R3QA 3LCGA 4EWND 1UJQA 3HM7A 1WIUA 3FUMA 4NZ3A 1BBJB 4WV1A 2WZMA 2OMXB 3I4EA 5E6IB 3W25A 3Q65A 4W87A 2F84A 1GUVA 3HGRA 4HN8A 1JZGA 4JTKA 3AY4C 2UY5A 4IBYA 1X5MA 3OGOE 5HJ3A 1P48A 3DEQA 3F62A 1MREL 4P3WA 3UABA 3P73A 5KSVA 2DPKA 3BLIA 2AEWA 3TLQA 3HQ1A 4JHAH 3WU1A 1PWMA 2Y63A 2BOEX 3AXKA 3GSUA 5EFFA 4M02A 4PP1D 4Y4FC 3NO5A 4ONOA 2ZWLT 4PJXE 2OK0H 4C7FA 3DLQR 4LPVA 3EX6A 2I07B 4P46A 4UZGA 4S1QL 5DTFA 5DJ2B 3W1ZA 1HIZA 3T40A 3ETBJ 5DY3A 4AFYA 2Y7DA 3MPGA 3TCEA 4Y1AA 3TC6A 4XBMA 4B90A 3TT1H 3GG8A 5CBJA 2W91A 5D33A 5MERB 4IRSB 5KYUB 4Y7EA 1WAUA 3NABL 3FQWB 4B9PA 1HCZA 4DWSD 1DQTA 4PJEA 2OG9A 3QFGA 1FIEA 2ZXAA 3MFGB 1J1PL 4K7VA 4PN6A 3FOMA 3ULVD 2FWOA 2Q7NA 4IL0A 3KPQB 1NP0A 2W9DH 4JFFD 2UZIL 4Q3MA 2H2PC 3MO1A 3EWBX 1PKMA 2BNRD 1OGAB 3OPZH 3VDHA 1M1XA 3S6OA 3PABB 3XIMA 3QC6X 1NL0L 3TFBA 1EIXA 1TR1A 3QTGA 3AAMA 4FZIA 4Q22A 4EXQA 1T80A 1H9DA 2QSQA 2X70B 3ARGB 3MRDA 5TDOA 5EHFA 2EKSA 3EKCA 4KVNH 4FXJA 1K03A 5SWZE 4GT0A 5FAGA 2NNAB 4KGLA 1URIA 2J71A 2O93L 3KL0A 1D5BB 1N18A 4M48H 1AUSL 1UPPA 2ZOKA 4C6OA 1NCIA 2OYMA 5KSAC 1JWSB 1ADSA 4KK8D 5HYQB 4HX1A 4LV9A 1FYTA 4Y9GA 3NZSA 2PDMA 4ROQA 4R4FL 1HQ4A 1H41A 4AHQA 3V5FA 2Q3AA 5I1KL 2GJZB 4O02L 1NC4A 1OXYA <