4UQ9A

X-ray structure of glucuronoxylan-xylanohydrolase (xyn30a) from clostridium thermocellum at 1.77 a resolution
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
390
structure length
390
Chain Sequence
HMASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTEVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CARBOHYDRATE BINDING FAMILY 6
publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Ruminiclostridium thermocellum
molecule tags Hydrolase
total genus 138
structure length 390
sequence length 390
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uq9A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uq9A02
2CESA 3VGGA 4AYSA 2OW6A 3NSXA 1R86A 1W1YA 1BHGA 1NQ6A 2W67A 1LG2A 3ZR5A 4PN2A 3QOMA 2PB1A 1XGZA 1MFVA 1OGBA 2XG9A 3AROA 4PMZA 2NT1A 1VB9A 1VRXA 4EKJA 2ZX6A 3WH8A 4P8UA 3CIVA 1QX1A 2WHLA 3SUSA 4OJYA 2D20A 4D72A 4CD4A 5IFTA 2CKSA 4NRSA 1G0CA 3DHPA 3KEHA 2WCSA 3PZIA 5M17A 4CN1A 3IAQA 1M03A 3BVWA 1MXDA 3ZJ8A 2YL6A 1SYTA 5I79A 4BQ4A 4AZCA 4NZCA 2WLYA 1QNPA 1WZAA 2NT0A 3AHYA 5FL0A 4P7RA 4FLSA 3MMWA 3EJRA 2BXZA 1VFUA 4GXPA 1BVNP 8CGTA 1OINA 3W25A 5D9PA 3WUBA 2BVDA 3IAPA 1H5VA 4FMVA 1WAWA 3POCA 4WKFA 1W3KA 2O92A 3BMWA 3OLDA 1BYAA 1KGXA 5HNNA 3VMOA 3U7VA 2YJQA 3MU7A 3EJPA 2BNJA 3IJ7A 4HU8A 3VINA 1U2YA 5I5RA 1BF2A 3UESA 3MV11 5CPSA 1V6UA 4W8BA 1HX0A 3E1F1 3U57A 2V38A 4ACZB 3VDCA 1GOMA 5IDIA 3VSUA 3WDRA 3WQ5A 1RPKA 1PX4A 1M01A 1KXQA 3G6MA 2OWWA 5A6KA 3TTYA 2VZTA 1HNYA 4UQ9A 2NW0A 1XYZA 4CU8A 2V5DA 2O9RA 1EA9C 2CCRA 3PZGA 5CQ1A 3QOKA 2YLAA 5BXTA 1V02A 3CUFA 1ZBKA 3WNNA 2VR4A 4U2ZA 1E6NA 4GQQA 5BRPA 3WDQA 3BVVA 5EFDA 4AD2A 1U30A 2WCAA 3VGDA 4AD3A 3CC1A 1DWJM 1VAHA 1QI5A 1PIFA 4UQDA 1JFXA 3AS1A 1XCWA 2VX4A 2PF0A 2UY2A 4W5ZA 3CUJA 1UD2A 1TG7A 4ZXOA 2X05A 3CUGA 4CGTA 3GH7A 3A5VA 2W61A 1O7AA 5E0CA 2WC3A 5M3WA 4YHEA 4DUWA 3LPGA 3OLIA 4TX6A 1KR0A 5BRQA 1V0LA 2DDXA 4L4PA 1JNEA 3KL0A 4FK9A 1HKJA 2ZXBA 1WPCA 2WSPA 1HN1A 1C8QA 4UQAA 3ZJ6A 1B90A 3AS2A 2VQUA 4DWSB 3NIYA 3BC9A 2A3BA 2HISA 1BG4A 2VC9A 3BAKA 3EJTA 4QP0A 2ZWZA 5A69A 3L2LA 1E55A 1K9FA 5E09A 5A2CA 2J7HA 2GVYA 2MANA 4FF5A 2WWCA 3BUIA 3WD3A 4MAZA 4W86A 4Y7EA 1W2PA 1HP5A 4NZJA 5ABFB 3W38A 2PC8A 1ISVA 1J12A 4PMYA 3SURA 1NOUA 2EADA 1QNQA 4W89A 2CHNA 2F7QA 3GDBA 2BHYA 2A3CA 3SCSA 1UKTA 1EQPA 1C8XA 5M5DA 2XIIA 2E0PA 1UD8A 2EJ1A 2WXDM 5DMYA 4M8UA 1JDAA 4DWSC 3GXIA 3RILA 4ATLA 1TMQA 3FN9A 3VKKA 1TQSA 2WKGA 3A6OA 3HG3A 4GPNA 3DX4A 2DSVA 4PUDA 4MNMA 1AQ0A 1GVIA 4HZ7A 3AMGA 3UERA 1XSIA 2VT0A 5HXMA 1MWOA 3II1A 2W63A 4JFUA 1UWTA 1RP8A 4JFWA 3WF1A 1OIMA 1EDTA 1TQUA 1ZBVA 4URIA 3VGHA 3T2PA 4H8HA 4TXEA 4M81A 4W88A 1H09A 3PHAA 1SR0A 3M07A 1ODZA 3VD4A 3FNDA 5AC5A 1JYNA 3N17A 2EQDA 1LG1A 4UNIA 3L4XA 3TV8A 3VNZA 3QGVA 1K9TA 2WB5A 2ZUTA 4A3YA 1OIFA 5CPQA 3ALGA 2VX5A 2XPKA 5FCZA 2G3JA 3FAWA 1JAEA 1UASA 4JZ5A 5C8BB 1IZKA 4V28A 3ECQA 2GDUA 2VCCA 4XB3A 1O6IA 2BY1A 3CUHA 2DSKA 3UR7A 5I3DA 1TQTA 1V6WA 2PWEA 2Y4SA 3AISA 4PSRA 3OGRA 1MXGA 3EMCA 4TVDA 3RM8A 1TZ7A 3AIBA 4M29A 4Q7NA 2J75A 3CHCA 2J78A 4UFLA 1QWUA 1WDSA 3F5LA 3WEZA 1XHGA 2WBGA 1XH0A 2EPMX 3B9AA 3K4DA 3NSMA 1HJSA 4XUYA 3SCVA 5D8ZA 4EAMA 1ISXA 2FDMA 3AXXA 5A2AA 1C92A 4Z2IA 3ARRA 2D3LA 4V27A 5D9NA 1OBAA 4LYRA 3PTQA 2QPUA 5BWFA 3CUIA 3VVGA 3N04A 1U33A 2D2OA 3J7HA 2J25A 5A6JA 3DX0A 3SIMA 1C7TA 1UWIA 1QBBA 1V3MA 3VIJA 2WVTA 4UFMA 2PWHA 4GZIA 2V3EA 4H8UA 1GOWA 3VMNA 5LYRA 1B1YA 1JZ3A 3OGSA 1UZ4A 1L0PA 3TONA 3WNMA 1UR2A 3F5KA 3HZ3A 3D4YA 2PBOA 1G9HA 2FYVA 2VL4A 1BLIA 4Z2KA 2XSAA 1ITCA 1UKPA 3D3AA 3PZQA 4UQEA 2VOTA 1KQZA 1QNOA 3HMCA 2E8YA 1H0IA 1FFQA 3N1AA 1UZ1A 5HPCA 1DWIM 3DX1A 2PI6A 4CUCA 4HA3A 2BY0A 3EYPA 3WY4A 3CZ8A 3UR8A 1CGVA 3MI6A 3WDHA 1QNSA 4PRWA 1ESWA 2Z1KA 4ATWA 2XYLA 4EANA 4F79A 4MB5A 1J0ZA 1JZ7A 2C0HA 1R34A 2DT1A 4KH2A 3WDPP 4AD5A 1UWQA 1EHNA 4P8WA 3K1DA 2W4XA 1B30A 3APGA 4J7RA 4PUEA 2F18A 4WKAA 2OLHA 4CN6A 1XSKA 3T2OA 2ZICA 1ZJAA 3ZT6A 3L4YA 2CERA 2CETA 1VFOA 4PTWA 5HBFA 3K8KA 1CGXA 3M7SA 1H1NA 3VOCA 1I1WA 3O2LA 2WMIA 2YA1A 1J0HA 1QBAA 1JD9A 3FW6A 5CLTA 1E6XM 2WCGA 1B3XA 4D6CA 3AXHA 5DF0A 3IANA 3ZSTA 3NDZA 4PMNA 4OOZA 2W92A 2FH8A 3AQUA 1I1XA 4BS0A 2CBIA 3WF4A 3ZMRA 1HXKA 3PTMA 4WJXA 3WBAA 4J3UA 2D0GA 3BAXA 4X0NA 4GQRA 2XN1A 2YKKA 3RJXA 2YBTA 1FFRA 3SUUA 1UD5A 1GQKA 4U3CA 2JIEA 3U7BA 3LMYA 3WH5A 3RM9A 1HKKA 1V0NA 1OSEA 1D2KA 3SCTA 2E3ZA 2F1BA 2ZUWA 3BAWA 3OLEA 2AAAA 2J79A 5JBDA 1JZ2A 2VNCA 1V08A 5FD0A 1H3GA 2XFFA 3CZNA 3A22A 2OWCA 2VZUA 1MQRA 5I2UA 1PAMA 5JIWA 2DGAA 1M04A 3TTOA 1GOOA 3VM5A 3MUY1 2F7PA 2UY4A 1PPIA 1UOKA 2XM1A 1C91A 4R5EA 5A6SA 3FY1A 3PZOA 2J74A 4IPNB 3QHNA 3ZT7A 2CBJA 4J27A 3H55A 1EXPA 3AS0A 1GZJA 1JFHA 2JIWA 3VNYA 3MUAA 2WHJA 3UCQA 1XD1A 1YQ2A 1QI2A 5ECUA 4PBGA 1K9DA 4LXFA 1R87A 3UG4A 4MJ4A 1W3JA 1OCQA 4AZIA 3EDFA 1E4MM 1KWKA 2J7BA 1NARA 3WUFA 5F7UA 3SCNA 4XV0A 3LXAA 1BG9A 1P6WA 3WENA 3ARWA 1PIGA 3OIHA 3EDDA 2O9TA 1HJVA 4QFUA 2J7DA 2RGLA 1VBUA 3VD7A 1PEZA 1H2JA 1VFFA 1CENA 4LQ1A 4F66A 1E6ZA 3CV5A 1V02E 2DQXA 3GH5A 4WSJA 4A3HA 2VTFA 2BVYA 1E5JA 1PZ3A 4HZ8A 4RE3A 5D4YA 4W85A 4JKMA 4AZCB 2WLZA 3DYMA 4HTYA 3GXFA 3CH9A 5I24A 2VZOA 4B9ZA 1KGWA 1JDDA 1OT1A 5A6BD 4JAWA 3WQ4A 3K46A 3ARZA 1PX3A 1TE1A 3VM7A 4IISA 2BFGA 4HU0A 2XSBA 1CECA 3HG4A 1DWGM 5A6BA 1VJZA 3AICA 2DSZA 1ISYA 4CN4A 1YHTA 2E9MA 4D1JA 5GPRA 3GBDA 2J8FA 3WFZA 1NM9A 1W2VA 2PWFA 3WQ6A 2IUZA 5CZKA 4BZYA 3T2QA 5AYBA 4UQCA 3MANA 1JZ4A 3BLBA 4AIOA 5I6SA 2WVSA 1V3HA 3K8MA 3A24A 3PBGA 3GBEA 1OT2A 4W84A 3VDAA 2XVGA 4HZ6A 2FH6A 1VF8A 2X1IA 4NZFA 5TD4A 3N12A 1QOXA 1JD7A 1JGIA 4TUFA 4HMEA 3CMGA 3MV01 3F4VA 3VUPA 2QMKA 4AIUA 4WF7A 3AIEA 5JIPA 4DUXA 3CZGA 2X2JA 1E73M 1UD6A 3VU2A 2BVTA 2WANA 4U2YA 2Z1SA 1JYWA 1SZNA 1W1VA 4DO4A 1MVYA 1HF6A 1WKYA 1LWHA 4UTFA 3BUBA 2X0YA 4OUEA 1E4NA 3MMUA 3WH9A 2DIJA 3FHQA 3VSVA 3DECA 3FXYA 2XVLA 1R85A 1LL6A 3BAJA 4MB4A 2YFNA 3B9DA 4MB1A 1EQCA 2O9OA 3WF2A 2Y2WA 3D52A 4D1IA 4ZENA 2WMHA 2XTKA 1DWHM 1UKSA 4RE2A 1B3ZA 2XVKA 2GJXA 2W5FA 3ZM8A 1MFUA 2BY3A 3BGAA 4Z2JA 3A47A 3VX1A 3N15A 2CKRA 4GI8A 1H4PA 1ZS2A 1EOKA 3F5JA 2CNCA 2GJRA 4PTMA 1SMDA 4GO9A 1CTNA 1BAGA 4E2OA 2VRQA 2EPOA 2ZX7A 5GNYA 3D4ZA 1W9PA 2CBUA 3WD0A 1CXEA 3N11A 3PTKA 3WSUA 4OZOA 3EJSA 1QI4A 1XH2A 3AZSA 4PMXA 1TFVA 2GJPA 1R33A 4HPGA 4HOWA 2XVPA 4CVWA 1HJUA 1GONA 3CZKA 1E0VA 3PZVA 5JBEA 4AW7A 1SMAA 5CSYA 1OD0A 2XHYA 5AC4A 4W7VA 1WCGA 2VRKA 2C8NA 1R7OA 3ARUA 4DO6A 3MSDA 4AZ6A 4AD4A 1KXHA 3N9KA 3GXMA 4AEEA 3GXPA 4PMOA 4M1RA 1CGUA 3DDGA 4U5IA 2OSXA 2JF7A 3NSNA 1UA3A 4ACZA 2WW5A 1NWSA 5BYWA 2XN0A 3PN8A 2V3FA 3JUGA 1OGSA 3TTSA 1HKIA 1QHZA 2D22A 1UR0A 2WVVA 1E3ZA 5DT5A 3W4RA 2WKLA 1JZ5A 1A3HA 1CNVA 2CHOA 4C7DA 4J28A 3L4TA 2VVNA 4GI9A 4FNSA 2Q8XA 2UWFA 2Y24A 4S3JA 2WK2A 2WWDA 3AI0A 4CD6A 3W37A 3T0BA 1CXLA 1JF5A 4OBRA 4C7FA 3I3BA 4XX6A 4DM2A 3L2MA 1W9BM 4FNRA 2J4GA 1Q6GA 3VDBA 1KBKA 3CZJA 2V3DA 1QHPA 4F9JA 3WL0A 2EO7A 3RIKA 4QAWA 2CPUA 1VEPA 4E4PA 1TQVA 1NWRA 2E4TA 4QLJA 4MAVA 4CD8A 1M7XA 4PCSA 2F1AA 4J3WA 1J18A 2FGZA 3L4ZA 1TVNA 1OWQA 5E6ZA 1W32A 1KB3A 3CZSA 3WKZA 4AY1A 1PS3A 1K9EA 2ZOXA 3TTQA 2EXOA 4V2XA 1MW3A 1BGAA 3AIQA 3GH4A 5I0DA 3AYSA 3H53A 4ZE4A 1W1TA 3ARQA 3KWXA 3CZLA 3A21A 2FHBA 1E70M 1C8YA 3W6MA 3OG2A 4W8LA 2IXVA 4M80A 1D3CA 3SCWA 1MW2A 1MYRA 1CLXA 3OZOA 4P7LA 3SUVA 4N0RA 2DT0A 2W66A 3W27A 1UWRA 1W3LA 4D6FA 3ARYA 1FH7A 3BMVA 1BQCA 2OYLA 2JF6A 3EMQA 3VIKA 1B3YA 3BVTA 2F8QA 1GCYA 3LPPA 5ABGA 4Z2GA 1AQMA 5A8NA 1FHLA 3AXIA 2CITA 2YA0A 1CXKA 3WNLA 5IHSA 2VJXA 4HOXA 4JL2A 4XZBA 3W82A 2UY3A 3DYPA 1BTCA 1HTYA 5A6AA 1D7FA 1KBBA 3EMZA 1R47A 3EDKA 4E8CA 3O6AA 1JI1A 1GQIA 5C71A 4LYPA 7TAAA 2WSKA 1G5AA 2ZIDA 1HP4A 1GORA 2Y8VA 2OSYA 4J3TA 4UZSA 3LPFA 2VCAA 1HIZA 3VIPA 3WMSA 1E72M 3SUWA 3VIOA 2DH3A 4D6EA 2XVNA 5LA2A 4TVUA 1B3WA 2OYKA 4M56A 4ZEPA 3BUPA 4AWEA 2BHZA 1UA7A 1QW8A 2W62A 4B16A 2TAAA 4MPKA 3VIHA 1V3IA 3WELA 4H2CA 4CCDA 3GZAA 5JUVA 3VGFA 4RL3A 1DWFM 1KTBA 4AXNA 1ZBCA 2D0HA 4J3VA 2XJ7A 1LWJA 3T09A 3ARVA 3D5HA 1B0IA 1C3FA 4JCMA 4LX4A 2IXUA 4OKDA 2WAGA 3MKKA 4BQ3A 1UR8A 2ZE0A 1TCMA 1XCXA 2BY2A 1MQPA 2XGBA 1QW9A 4D6DA 1H0GA 2XGIA 4R27A 1R7AA 5EB8A 3ZO9A 4P8VA 1UHVA 3BAIA 1GHSA 1WDPA 1CWYA 3CHDA 3CO4A 2EEXA 1EDGA 3HG2A 4PMDA 2WMIB 1OM0A 1ECEA 1JI2A 3UG3A 2ZUNA 3WMBA 4BQ5A 1HT6A 1EGZA 3NDYA 1GVYA 3SCPA 4D6GA 2WMJA 4CU7A 5HDRA 1HL9A 2DIEA 1DTUA 1MW1A 2D3NA 3ZJ7A 4BCEA 1EH9A 2Y8KA 2JFEX 2BXYA 2YIHA 4CD7A 1BPLB 4JFTA 1J11A 3AIVA 4HMCA 2JEPA 2D73A 5D8WA 3WQWA 3VGEA 1KQYA 3DYOA 3EJUA 1CPUA 5GQBA 3NYDA 4AC1X 2EPKX 1B2YA 4NF7A 2F2HA 5CJ5A 2E40A 3N13A 4JIEA 4M82A 2QV4A 2FHFA 5A6LA 1LJYA 4YHGA 4YPJA 4TVCA 5KZ6A 2VX7A 5A8PA 2EACA 1GJWA 4F9DA 2D23A 4H7VA 3EBVA 1UQZA 4FLQA 5D9MA 1V3JA 1J0IA 4ZXLA 3HN3A 2G8ZA 3MO4A 3AMLA 4DUVA 2OSWA 9CGTA 3M6DA 2X2IA 2D1ZA 2ZXAA 4P7OA 5BXSA 1W9XA 4ZFMA 1RH9A 5FIPA 2VZVA 2WZEA 4W8AA 4AEFA 4U5KA 3FHAA 5A3HA 3CMJA 3B8SA 4MJ2A 5HPOA 2CXGA 1UG6A 4AZHA 3WIJA 3G6LA 3HJEA 2DT2A 5CXPA 2G41A 1J0YA 1E43A 2PBGA 3HG5A 5FL1A 3KL3A 3DX2A 4KRTA 3OA5A 1W3HA 3NCOA 1CGYA 1E4IA 1H41A 1TUXA 4HMDA 3ZT5A 1OGGA 1JYVA 2ZX9A 1EIBA 1G1YA 2ZUSA 1X6LA 5DEZA 1J0JA 1XD0A 3THCA 1LF1A 3BSGA 1OD8A 3AJ7A 1RP9A 3VD9A 1WNOA 1DWAM 3CBWA 2X2HA 1GUVA 1UKOA 1NP0A 3KZSA 3BXWA 4U3AA 4Z2HA 5GNXA 3VIIA 3VD5A 3AHVA 5A1AA 4JKLA 1O7DC 2ZX8A 1JAKA 4FNQA 1ZBWA 2VZSA 1QHOA 2VRJA 3S6TA 4BF7A 2ALWA 4KWUA 2C7FA 3I3EA 4Q22A 1W9VA 3T08A 3LRLA 2JE8A 4WLCA 1PBGA 3VILA 1CXHA 1VBRA 5BXRA 3H54A 4D6JA 2XUCA 3GNOA 4ACYA 5FKYA 3VGBA 1CXFA 3SCUA 4P8XA 3WUEA 3U5YA 1XC6A 4E8DA 1PZ2A 3DDFA 2J7GA 2WHMA 1N82A 3DX3A 4J3XA 4L4OA 3RPMA 1UH3A 4PCTA 3AMKA 3K4AA 2AMGA 5E70A 3GM8A 2J7EA 2DSUA 1NP2A 4C7GA 1JZ8A 1E15A 1C7SA 1XSJA 2F7RA 4JCLA 1K6AA 1AVAA 3SCRA 3WNPA 1V6XA 4UOZA 5EBAA 5A6MA 2GDVA 1NH6A 4OBSA 1V0KA 1J10A 1TA3A 1Y7VA 5ABHA 3UG5A 1VFMA 5CLWA 4QLLA 2GK1A 3TP4A 3CTTA 2A3AA 3AIRA 2PWDA 1ZJBA 3GNRA 3BVUA 1TR1A 3WNOA 6A3HA 1GOIA 2Y5EA 1W1PA 1X6NA 3BCDA 5BROA 1NOWA 2NSXA 4UZUA 2XIBA 4CCEA 3PZ9A 2F61A 1Q6FA 3WD2A 1E56A 3MS8A 4X9YA 4K68A 3PZUA 4FLOA 5D9OA 4W93A 1E6SM 1KCKA 3RM4A 2GJXB 1W9DM 3POHA 2YFOA 2OYMA 3AIWA 1UKQA 1CZ1A 2VX6A 1UD4A 3L4UA 4QLKA 3TOPA 1HJXA 1CEOA 4NRRA 4UOJA 1E6PA 3VTRA 1EOMA 2FGLA 4WKHA 1QWNA 3WNKA 4CKQA 1L8NA 2OWXA 1JXJA 1DP0A 1W9UA 4GINA 1C90A 1VIWA 1BSIA 3M46A 4WIWA 4HA1A 1WZLA 3VSTA 1B31A 5E9AA 1G01A 2YOCA 5A2BA 1UQYA 1F4HA 1CGTA 3B9EA 4UFKA 3WN6A 1EO7A 3CLWA 3HU7A 2WBKA 4CD5A 3AOFA 2O9PA 4RE4A 3WFLA 4JL1A 2BV9A 3WH6A 5E0FA 1E6RA 4EE9A 4W5UA 3IK2A 4CVUA 1EO5A 2YL8A 3ZIZA 1JG9A 5KEZA 1R8LA 2CBVA 4PMVA 4MDOA 2J47A 7A3HA 5A95A 4JHOA 2XFYA 1JDCA 3WY3A 3CGTA 1LQ0A 4H41A 3WBEA 2GUYA 2WVVB 2XWEA 3DC0A 2GFTA 1KCLA 4WSKA 3LRMA 4QCFA 1W91A 4OIFA 4GIAA 1V6YA 1GHRA 4MTVA 1AMYA 1JIBA 4PMUA 2VCBA 4MDPA 1UH4A 2YLLA 1BYBA 4NX0A 3WF3A 3WEOA 4ZE5A 4W7WA 4AD1A 3VIFA 3S5YA 1JL8A 1BVZA 2EAEA 4AYGA 1ODUA 3OB8A 1CXIA 3VO0A 2RGMA 3W29A 2XFRA 4UCFA 4HOZA 1E5NA 1GNXA 1NWTA 3MUZ1 5I77A 4NXKA 2A3EA 4HP5A 2DH2A 3D51A 1WP6A 3LX9A 5AY7A 3SEPA 3VDHA 1BGGA 4PTVA 2WPGA 4B3LA 1Q6DA 3A23A 4GZEA 2QLYA 4W87A 4PTXA 3U5UA 1WZMA 2WC7A 3WDIA 3WF0A 1R46A 1VENA 2OW7A 2ESCA 2YL9A 3AMDA 3AHTA 3BUDA 3WEMA 1ISZA 4PEEA 2AOSA 4NSBA 5E6YA 1WDRA 3VD3A 1UUQA 1KGUA 2GSJA 2YA2A 1A47A 1HVXA 1CLVA 4A4AA 3FAXA 3QHOA 1QNRA 1G94A 3CHEA 2E9LA 3NUKA 4FNPA 4D6HA 1E3XA 1LL7A 2D24A 3NJ3A 2E8ZA 4DWSD 1V3KA 2JEQA 7CGTA 3BLPX 4IPLA 1ITXA 5A8MA 4GZJA 2EABA 4BA0A 1RD6A 4BQ2A 4XZWA 2J8GA 4U31A 3CHFA 1BYCA 1HVQA 3ZSSA 2ZX5A 1DEDA 1KWGA 2W91A 1UR1A 3VPLA 4DWSA 2ZWYA 3ZQ9A 1VEMA 4YN5A 5JBFA 3W81A 1UYQA 1VEOA 1WZKA 4JKKA 2ZXQA 1Q6CA 3BAYA 4H04A 3AZTA 2ZUMA 3AHXA 4JFSA 1X1NA 1E4LA 1J9YA 1TQWA 1Q6EA 5GNZA 4S3KA 1XYFA 4AMXA 1KTCA 2VMFA 3W6LA 3OLGA 1UWSA 3N18A 3SCOA 2VI0A 5ABFA 5FOOA 1KXVA 4B15A 2WC4A 2WMGA 2WZHA 1HWWA 5CGMA 1F4AA 1E40A 1PJ9A 4PYSA 2VR5A 4EK7A 1E1FA 1VJSA 1WO2A 4PMQA 1XH1A 4N42A 2DPEA 2E9BA 1US3A 1FOBA 1H49A 4M24A 1AQHA 3O9NA 3T0AA 1I75A 5DFAA 4IUGA 1LL4A 4NI3A 3PZNA 2XWDA 1EDQA 1EHAA 4WK9A 1XRVA 3KLKA 5C70A 1CIUA 5IXEA 1CYGA 1HKMA 3VIGA 1V6VA 4LYQA 2XM2A 3T0DA 3KE0A 4AZ7A 1JZ6A 3GNPA 3IJ8A 3VIMA 2V3GA 2X0HA 3RO8A 3A4AA 4KGJA 4CCCA 1J01A 3UETA 5A8QA 4OOUA 2DEPA 4HA4A 1GQLA 1HJWA 1GW1A 1GPFA 3QHMA 4DO5A 3W28A 4AZ5A 3A4WA 2EBNA 4F8XA 2G3IA 5I78A 3W0KA 1WDQA 4KGLA 2QPSA 5CSUA 3WMCA 4DM1A 1PX8A 4UR9A 5BCAA 2QHAA 5ABEA 2J77A 2J62A 2WMKA 3KL5A 3PZMA 3THDA 3DHUA 1M53A 3VX0A 5I23A 3AFBA 3W26A 3L4VA 1MQQA 1V0MA 1HJQA 4J3SA 1SFSA 1IT0A 3IGUA 3ZOAA 2WZIA 2IGTA 4HPHA 3AMCA 3RMEA 3MSGA 3SUTA 4W7UA 1DHKA 1QI0A 4TTUA 2A3HA 3LRKA 3AS3A 1H11A 3EDJA 4MADA 3SCQA 4KMQA 3ARXA 1IV8A 1ZU8A 4D6IA 5LA0A 4UOQA 2CIPA 4PSPA 1BFNA 2V5CA 2G4FA 4OGZA 3EDEA 3CPUA 3BVXA 4AZGA 2VUYA 5CGTA 2G3MA 3EJQA 4LPCA 1E0XA 2J7FA 4UFIA 2YL5A 1XV8A 2ZUUA 5A8OA 2FE0A 3AIUA 1B9ZA 1CDGA 4FNTA 3ARPA 3QR3A 4GO8A 3MUIA 1KFWA 1ZB5A 2G3NA 3BCFA 1JXKA 1FHDA 4Z2LA 1GOKA 3ALFA 4P7NA 2CEQA 1E71M 2QMJA 4QDMA 3BH4A 1UWUA 3CZEA 1FP8A 1UD3A 1GOQA 3A3HA 2PWGA 4MNLA 5IFPA 5A94A 1S46A 4MNJA 2WNWA 4H8VA 2CYGA 4ATDA 1JNDA 2BS9A 4AIEA 2WHKA 1WB0A 1CBGA 4UQBA 3TA9A 1GJUA 1FP9A 1FH8A 6CGTA 1JYXA 3K8LA 4U33A 3ZJKA 5EFFA 1NOFA 2WM0A 4PMRA 1QI3A 1ISWA 4B3KA 2YBUA 3WDJA 3OZPA 1ZL1A 4MB3A 5M03A 1E1EA 2EPNA 3LXBA 2VURA 3RDKA 3RJYA 4UFJA 3D50A 4UFHA 2VVSA 1Q4NX 3UEQA 1R75A 1QVBA 3PZTA 2WMFA 2YDRA 1BYDA 3AHZA 3WD1A 1WE5A 2X09A 6TAAA 4NXSA 5EMYA 2ZUVA 1TVPA 4P7QA 1KR1A 1V3LA 4AD0A 1FH9A 3S2CA 3GXTA 1E9LA 4ML4A 1J0KA 1MW0A 2WVUA 4JHZA 3BUQA 3WY2A 4TOQA 1E6QM 4B9YA 3S5ZA 1TA3B 3GYCA 2BHUA 2YDQA 2X2YA 2HVMA 4AZBA 4AMCA 2DSWA 3LXCA 2GK1B 2EPLX 5DO8A 5AYIA 4AISA 1US2A 3WL1A 5DT7A 2XN2A 3GXNA 4TX8A 1NWUA 2FHCA 1LLOA 5BXPA 1T0OA 2VO5A 4AMWA 5HOSA 1HL8A 3BLKA 2J7CA 3AYRA 4FNUA 3RCNA 2D0FA 5CG0A 3WH7A 1KXTA 2QF8A 3LPOA 1FA2A 4MNKA 3I3DA 1OB0A 1CGWA 1UH2A 1Z32X 4IM4A 3MMDA 2X8RA 1C93A 3OBAA 2ZXDA 1UR9A 2VQTA 1UR4A 2YDSA 4GKLA 4KRUA 3AZRA 3WQ8A 3GXDA 2B31A 5CPTA 3ARSA 4D71A 4LGXA 2WYSA 1E0WA 3ARTA 3WQVA 4FLRA 8A3HA 4GI6A 1GQJA 3GTNA 3W53A 1IZJA 1B3VA 5LA1A 4JFVA 5IHRA 3IJ9A 2DT3A 3KLLA 1HXJA 2UY5A 3ZR6A 3W24A 4TTGA 4X0VA 3L4WA 2F7OA 3WUGA 2JALA 3BSHA 3A4XA 3VMPA 3OGVA 1JF6A 4CU6A 3WY1A 1QPKA 1V03A 5E1QA 3WD4A 4QCEA
chains in the Genus database with same CATH superfamily
3VGGA 2KZHA 4R7NB 1K4CB 1SF5A 1E42A 3QOMA 2PB1A 4XODA 2YUWA 3V0WH 32C2A 2ZX6A 1ZAGA 4XP5L 5I1JH 3MLUH 3N14A 4GQ0A 1JTPA 2RCSL 3O11B 4AIZA 4HYVA 4LVOC 4PI0A 3HBQA 1NFKA 3B40A 3LKQB 2ROXA 5ABAA 1MXDA 4WEUD 1N10A 4JPSA 3GDKA 3R8RA 2AV7B 3K0YA 1VBHA 4XO8A 1ND0A 3IDJB 4GXPA 1OINA 5T5FL 4WKFA 4LP8A 4ZO9A 4FKEA 3VMOA 4PPTA 1U93B 4F15C 4S1RH 3GRWH 1V6TA 4FYQA 4TX9A 3T1WA 3UESA 3RYMA 4WEBL 3IS1X 1SSDA 1XHHA 3A64A 1Q3NA 4Q9RL 5IDIA 5J1AB 4KIRA 1RPKA 1R2SA 3QDMA 1KXQA 5HR7A 4UTTA 4IWWA 4XMTA 2V5DA 4OGAC 3VK5A 3NIDF 1G7QB 3UMNA 1MRFL 1E6NA 1JEZA 2ZUQB 2X4UB 4YDKL 4JZNA 4KCTA 1U8MB 1RVFL 2HQAA 4OCMC 1GYLA 2C16A 2VDNL 1UD2A 3PDOA 4CGTA 3GH7A 3MRNA 1WBXA 4FXFA 4KKRA 3NYZA 2CKBH 1V0LA 4DAFA 5K59F 5E2VL 3Q9QA 4QEGA 4AVFA 3JUZA 4U1LB 5ID1B 1Q1PA 4A38A 4L5FH 3SJVE 2DZAA 5DQJA 4Y7OC 1N4XL 2CHZA 5JIKA 2ZAIA 4PJ5D 5GZOA 1JUFA 4HHWA 4JQVA 1EJWC 1RZPA 2PC8A 4XE0A 4CBPA 2R7EB 1T20B 1AI1L 1VKFA 3CHXA 3D08A 3LNHA 4MD4A 2HS6A 2QDHA 1UD8A 1RZKC 1T7LA 1TVBA 3GG7A 5I1HH 5L7XH 5EEWA 4K7FA 2HBVA 4YBLB 3TCEA 4KK6D 4CEXC 1ED3B 1GIGL 1B3OA 5HUOA 4OAWB 5A7EA 1XEUA 3WS3B 4HIXH 4WIQA 3KMDA 3ULUE 5IM51 1O6SB 1O66A 2APTA 4D0BA 4UNIA 5ABZA 1R24B 4PCNA 1K5NA 4L9LB 5CPQA 5FCZA 3ZYZA 3FX4A 1G7VA 1IEAA 1W8NA 5F2MA 3D18B 4RGOH 3VXNA 1FNHA 2EC9U 4DYJA 3MGTB 2PC4A 4OLXH 2J78A 5F2GA 3FJNA 2GJ6B 2Y72A 1F2XK 5FJJA 2FDMA 1SJXA 4L4VE 5MERA 1AG6A 1G4MA 3TURA 5BWFA 3CUIA 3MP5A 3KDOA 1FKWA 4ZUSB 1SXNA 4B7IA 2OO0A 1OB1A 5G55A 1WAUA 3NAVA 5D32A 3LY0A 3R6IA 3JWNC 3GTTA 5TDOB 3G1DA 1QNOA 1DN0A 1NMBL 2RFXA 2TSAA 4JM2B 1FWDC 3OJVC 5CBAB 5T1MA 4J3OG 2N4IA 2QQNH 2BY0A 1LO5A 3OC5A 2VQ1A 1FO0A 4Z7OF 1EC7A 3N6QA 3PWJA 3O3AB 1CI3M 4L1WA 1CU4H 3MI6A 1TVDA 5KSBA 3UGRA 5DHVB 1DBJH 4PRWA 2XNAB 3UPCA 3NJMA 2N0MA 3C2RA 4ZUVA 4G8TA 5DX7A 5HYJA 2K78A 1PFOA 4FQIH 3C60D 1I8LC 5D6DC 3SBRA 2DI9A 1RBAA 4ERIA 1BWMA 4KJPC 5I8KL 2W0UA 4ILDA 1WIPA 4IXHA 4HAKA 2AQWA 5E8PB 4S3CA 4JFHD 3KM1A 2VMDA 4I8DA 5IMOB 3MRHB 1R9YA 5DZOA 1JWUB 1KB5H 3F2BA 4IRJA 3DROA 2PCPB 3RJXA 1DJHA 1ZHNB 3PL6D 2CK2A 1G4PA 1A4KB 2CBQA 5FUCE 1OSPL 1KPRA 5I30L 2B4CC 4E41A 3KOYA 5GVJA 2OL3A 2YAFA 5I1DB 4NOFA 4NBYB 2X4PA 5JNYB 5C97A 4FG0A 2MUCA 1OAUH 5DK3A 1NGYA 1FGNH 4P2QA 1TEGA 1DVZA 6PAZA 4QNEA 4YGVA 4ABVA 5D04C 3C12A 4PC8A 5F7HA 1PL9A 3WLLA 3PZOA 2C34A 1EXPA 4GJJA 1A0CA 3IUDA 3IETB 4F9PC 3I6RA 4DAGL 2YPVH 3PUOA 1Z41A 1TCRA 3K4WA 1IGCH 2RFGA 3GNXA 3WQEA 1T83A 3ZE0E 4LC6A 4Z78B 2PZNA 1PEZA 3ZTNH 1DEEA 5DCBA 2V2CA 1XGEA 4ACTA 1ZVNA 1WBJA 2WYHA 4YSUA 4HZ8A 3NJXA 4P2CG 4CQAA 5C0BA 3GXFA 3RI5K 2J1YA 2C0AA 1WTLA 3BP6A 2BOBB 1TE1A 1A5MC 1TJIH 5TH2A 3DPBA 4N02A 4H88H 3HG4A 1KPVB 5T3ZE 2Q8LA 1ISYA 3Q06A 4P3CL 3TQ0A 4AEOA 1NM9A 2PP3A 3FT9A 2EDTA 1QYGL 2OMYA 3QEGH 2IUZA 1NFIB 1JZ4A 3MANA 1M6UA 4PS7A 1T0MA 1V79A 4PRRA 3HS0A 2YD5A 4PJ8A 4W84A 3CIWA 2NY2D 2FH6A 1VF8A 4IJCA 2HKAA 4AGOA 3CMGA 3WLHA 1Z5LB 4WF7A 3HI1B 3LYRA 1UD6A 4TLUA 2H32B 2XYCA 4J8RB 4IS6A 1JYWA 1W1VA 4DO4A 1ROCA 3WTWA 2AEWA 1XZ0B 1T8QA 2XVLA 2GITA 3EIFA 1AGBB 2AERT 1G7PA 4L3EB 2XTKA 2D8KA 4PA8A 1K7FA 3ML8A 3C2OA 3CYJA 5U4NA 1XLEA 3N15A 3LI0A 4NJ9H 4F0RA 1XMWA 5AYQA 3LI1A 1KEMH 2EPOA 3TPUA 3WJLC 4A7SA 4DF2A 3O6FD 5J57B 4H6QA 2J20A 3BLOA 1SY6L 4R7LA 1IUZA 2I5GA 4ODWB 4N1HB 2ENQA 1U8JA 1HJUA 2DUAA 4ZI8A 4UQ3A 2DZBA 5ICZA 3MJWA 4PJ7E 4Q33A 2KS0A 4A7GF 2JJVA 5EOCL 2EE2A 4AD4A 1KXHA 3WBWA 1D6VL 4LC8A 4H3DA 4AWUA 4GA8A 3QUKA 5E5MA 3QPQD 5L4JA 3U4AA 1EDYA 3TEZA 4JM0A 2Z2UA 3GR4A 4FIRA 2FQIA 4FS0A 2D22A 4N1CA 4H0GA 3BLIA 4I7UA 1S9VB 5F4WA 1G7MA 4A35A 4MX7B 3ZYIA 3QSTA 1MCCA 3P61A 1IF2A 2Z4GA 2J56A 4NKOB 1S38A 4PRDA 3R8HA 3G6DH 1GS7A 3CIXA 1DSFL 1Y6KR 3SGDI 2I27N 3WL0A 2EUZA 4OFDA 3BKYL 3WUZA 4JY9A 4CVXB 4ZSOA 2V30A 2V2XA 4HC1L 2EDLA 1MIEL 3HV9A 3KYNA 4TR9A 1SDDA 3TTQA 3CFCL 3QI9A 1KRMA 2IANB 2QIWA 4AGNA 3H53A 1MJJA 3B1UA 4AJ0A 1QLRA 3JWDC 3V0SA 5C8JA 5FHAL 3WJZA 4C4UA 4OI7A 1W0VA 3UAJD 1UC4A 4B9PA 4ODHL 2IIJA 1P5VA 3HKFA 4MKNA 2YDAA 3GJEA 1RVKA 4XPFH 4MNGE 2QAFA 5DK2A 1XIWD 3LPPA 1AQMA 1V7NH 4V11A 2V67A 1E1CB 4NT0A 4Y1SA 1BTCA 1KJMA 4ZMVA 3JQOB 3GU2A 1UM5L 5C71A 4KRPC 3PWLB 4WWNA 4K7VA 1N59B 2FWOB 3L1EA 4NP9A 3BUPA 1BBJB 4AWEA 2NV9A 2VIRB 2GW5A 3B34A 4MPKA 5FDYA 4H2CA 1MFDH 5DURB 2D0HA 2I7SA 2CK0H 5GGVY 1S7WB 3KDMA 3MN8A 1NFDB 4JN1L 3D8MA 1TCMA 3WFAA 3D33A 2FDSA 1ETB1 4D6DA 3SOBL 1K7XA 2GABA 1UHVA 1SN5A 1EFZA 3GU1A 1GHSA 5BQ7A 5K1JA 1XW8A 2PR4L 1DVFD 1YBQA 2H0PA 4IOSA 3EYVB 3NDYA 4CU7A 4NYLB 4AX6A 2Y36L 1ZWIA 4EOWH 4YSCA 3F03K 3V18A 1YTDA 4R33A 2BC4A 1N12A 4DJED 5BMWA 2OG9A 5F3HB 5ESQB 2PRLA 1NCGA 2J8UA 3H7RA 1PZCA 3V5OA 3K4ZA 5CBIA 3BVJA 2YWYA 3C2YA 3LZ3A 2OU4A 3W2LA 4H7VA 5EA0H 3WTUA 2CU0A 3QWNA 4PJGA 2AMXA 5CIPA 3M6DA 3L3KA 1AZCA 1DCEA 2AZAA 1RZJL 1W9XA 1JVKA 4OD3L 2LGNA 3S36L 4HZ1A 3CMJA 3B8SA 3GBMH 4HF5L 1AGFB 1CDCA 3LSOB 3SE8L 4TL5A 2R69H 4IICA 2BCKA 3FU6A 2IPUG 3DMMC 3QUZA 3EO9L 1A5OC 5H8MA 3BWUC 2EH8H 3LNDA 1EWHA 1PLCA 1CLKA 4RAUA 3MRCB 4GUJA 4RNIA 5AFDA 1IIKA 1P0SE 3TWCL 4E42A 4U05A 4KMTL 3UBPC 1HEHC 4FNQA 2EE3A 4XN4A 3W70A 1XG4A 1AD9A 4HUUB 4HX1A 5C08D 3W7LA 5HVGB 4JRYD 3FTUA 3RVWD 1SF3A 4U1KB 5HI4D 4O1EA 5CJMA 2GL5A 3TJ4A 3ZKNC 1J7VR 3IVKB 1JZFA 3WUEA 2CLZB 4RIRA 1E9ZB 1PZ5A 5HHOA 5IFHH 3SBWC 1RJRA 3S9IA 1AHMA 1Q9WA 4AOFA 4JCLA 3P3YA 1XRSA 1RQBA 3G08B 1CF1A 2FZDA 3ABKB 5F9OH 1XF1A 4L4TD 3QWRA 1KV7A 4ZMXA 2A6NA 4YUEL 2GCYB 3GYRA 2DD8H 4N90E 1QEWB 3HTWA 1QNVA 4MIMA 1FYTB 4QOKD 2EH7L 6A3HA 4YX2L 2Z34A 4Y16A 1SFHA 4UZUA 3T9WA 2AW2A 1MZZA 3DO7A 2CSPA 2ORBH 4D0CA 3K6NA 4OLYH 3STLA 3WLSA 1CZ1A 3V52H 3TOPA 3Q13A 3L1OH 4EVNA 2UZYA 2Y0FA 1P7KA 3IPEA 4UOJA 3VTRA 3SGJA 2W88A 4FI7A 1U1HA 1QWNA 4Y2OA 4U1NA 3P3SA 4YHPA 1JDEA 3E3QE 1Y6MR 3GMLB 3J2PA 1QLEH 4LMQI 3QJRB 2FEDC 5LAXB 4BEUA 4LAQL 4FQXC 5A2BA 5HDQH 2DQWA 4Q6XA 1CYWA 2QQKL 1NC4A 2X4SA 3ATBA 1I1CA 2VCOA 2WPBA 4HAFA 3SDYH 1EJTC 2NUPB 3B2DC 2EG6A 2EYSA 3N9RA 1W0WB 4FTVB 2E1WA 1DSWA 1KCSH 4I0CC 2I5QA 1F05A 1B4EA 4MAUH 1LQ0A 5JXED 5CLYA 3PANA 5J3HC 4BEIA 2ANUA 4JN7A 3QFJB 2BRRL 15C8L 1G7HA 1OZMA 1BYBA 3O6LH 1CF8H 3SGDH 1I3RA 4WI8A 4OFKA 3W5MA 1CXIA 4IBVA 3MXWL 5HQEA 3FU8A 1HHJB 4X8GA 2IMRA 1GNXA 4IUOA 3NBNA 4FNLL 3ZDXF 1EPFA 5IVXF 4HUWB 3OG6B 1A5UA 5AY7A 4F9LC 2JKSA 3K80A 1N0XH 2V5KA 3A23A 4KQ3L 1D9KA 3R12A 1X7IA 3T7VA 2QBWA 2YL9A 1BXXA 3BX7C 1P4IL 3I6EA 5TGBA 3V0VA 1FCBA 4GD0A 2IH1B 2NX5E 3VXUE 1USQA 2I9TB 1U9KA 3D12B 3C8HA 3QP3A 4YR6B 1E3XA 1LL7A 4XMLL 7CGTA 3GWQA 1GAFL 4I6KA 3RY5A 4XBPB 2Y5QA 3GT6A 4I2XB 4DP1X 5HJBA 3EYFA 1VH7A 3N9GL 2B59A 3AZTA 4JFYA 2Y1AA 4HD9A 3REVA 4AG0A 2H6RA 3C09B 4OLZL 4JTIA 4AVJA 3CHPA 2R1KA 1B0RA 3N18A 5JXAL 3R1GH 3HA1A 3V4BA 3AQDA 4AZ8A 5H8UA 4WU5B 1VJSA 4BUGA 3F64A 4B5UA 4NGHL 2W27A 3RPKA 2CZ5A 2BP0A 2V7HA 1HINH 3OF6D 3HMXH 2CMRL 2BIMA 2GC4C 5L9DH 5CU9A 2JI1A 4NS0A 3UROR 4ZTPL 2X0HA 4OOUA 4RCAA 1GRWA 1AFVH 1DZ0A 1YMHA 2B0MA 3FQNB 1FGVH 3GJFA 2TODA 3W56A 4M4PA 3PWUA 4WK2B 2W81C 5CSUA 1JXFA 2C3ZA 4LCQA 1OAYH 4O00A 2FX7L 2PDCA 3MTXA 3W26A 4NO5A 3OWEA 1A0QL 3TBWA 5IV2B 2X7LB 1YYLH 1NWOA 4JFQB 1V93A 3RY6C 3CHVA 3V4PH 5A43C 3ARDC 5C0CA 4KNSA 4D6IA 1T3FB 5AW3B 5GJSH 3WIHA 1ZXQA 4GBXB 4AY8A 3S3SA 2KYIA 3MC5A 4QRTB 4DPAX 2CGRL 3QORC 1DUZB 3SE6A 5G4NA 3RTLA 2YL5A 1MLCB 4Z76B 4OB5L 1WAAF 4FNTA 3M64A 4QYOA 2GGHA 1NEZB 1KFWA 3QV7A 1JMZA 3MFFB 3E6HB 3QYQA 2VR7A 5DT1L 4H1LB 4X9SA 3ALFA 4B5VA 4P7NA 1E71M 4LQFH 3EJJX 1CFTA 4LFHG 3MLVL 3A3HA 4Z7WA 5FA4A 1EHLL 4LVGA 4PEKA 5DEFB 4ATDA 4QG8A 1JTOA 4PHZA 4OF8A 1F7BA 2Z00A 3WGVB 4UQBA 3ZGHA 3MRBA 3BWUF 5C2BL 3IKCB 2ZYIA 3QQ9C 3VWKC 3BWSA 5FM8A 3S5LG 1XISA 3MV9A 5C0ND 4W81A 4IRSA 4NUGL 1UWFA 4N2GA 3LXBA 1ZCCA 1RQHA 3GUFA 3Q1EA 2VGLM 2QTEA 2GJLA 2P48B 4ZQPA 2YBVA 3UJJH 4F20A 5F1NB 4C54A 5GGVH 2R8WA 3KWVA 3N41F 4LW7A 3KR3H 4LBSA 4TVPE 2YCKX 1AH3A 1E90A 4DQAA 4WFEE 3LQAH 2WUBL 5F1IB 1VFTA 1NUFA 4ACPA 4C58B 1DVYA 5DO8A 2EPLX 1XF0A 2X1RA 2XOTA 4KAQH 4WUUA 3T1GA 4PRHD 1OC7A 3CUPA 1BMWA 3C5ZB 3FT0A 5C09B 5FYLE 2QJHA 4YXLH 2AJUL 3FQXA 4H1LH 4LLWA 2ODIA 4UM9B 3PAVA 1WEJH 3V9CA 5I06A 2B1AL 2NNFA 4YDIL 3G6AB 1R2RA 3QIBA 5CJQH 4FLRA 3W53A 3VNLA 3XIMA 3QZOA 3X3GH 1KIQA 2QULA 3P0VH 1EGJL 5GHWL 4AV0A 3GRGA 5DYFA 3GSQB 1WCBB 1F2JA 1JNLL 4AV5A 3DJTA 3WY1A 1XB6A 1SSGA 2OCZA 2TRHA 3EB4A 1MCHA 4PN2A 4NKQB 3GLCA 3S2NA 4CBZA 3M1CA 4ZFFA 1S2CA 4GKZB 4JHWL 5A40E 5FKAB 3GZOA 4OJYA 4NN5B 2CKSA 3QNXA 3TL5A 4HHLA 1Z7JA 1RSCA 2AK1H 1MUMA 1D6EA 1CQKA 2ALDA 2YL6A 3KPMA 4PL1A 3H7VA 2V69A 2X6CA 4UDTA 4IOIA 2J5LC 3LZ5A 2HLAA 1BVNP 8CGTA 4HEPG 1QZNA 2VE6B 3TC3A 1MCJA 4FDWA 1O5RA 1RXLA 2QCLA 3OLDA 4CVZB 1F8TL 4HGKC 4K5LA 5B38A 2F38A 1S5IH 5B7ZA 2K7QA 1V6UA 3GHUA 2NY1B 3BLLA 1IAKA 1A1MB 1C08B 5KYWA 1Z3GL 3QHFH 1U3JA 4JAMA 3TC7A 4ZXBD 2XYBA 5GS1C 2ICES 4X6EB 3G6MA 2JIXA 1XYZA 1J2WA 3WV0A 5KTEL 1A5FH 4PRNA 3ERPA 3FB6B 12E8L 1D7CA 4AD2A 2DM2A 3KLAA 4RX0A 3VABA 3FUEA 3ULAB 4IRZL 2X05A 3NCJL 3CUJA 1CD0A 2MKLC 4HPYL 3A3WA 5EL1A 2HYMA 3JTTA 3VI3E 2FSEA 1BECA 4H8QA 2EXYD 1G6RA 2A6JA 2EDBA 5DHDA 3AS2A 2ZKHH 4HG4J 4FFVC 3BC9A 3HE7C 2EKCA 1Q0EA 1BG4A 2VC9A 4OFCA 4L6HA 1YY9D 2DKMA 5ISZD 5EEVA 1N6QH 1QSFD 3UPRA 2VN4A 5DZNA 5LUMA 3Q05A 3TEVA 3OGCA 2PWVA 5HNRA 5KG9A 3R7RA 4Q8PA 3V5KB 4Z6AT 3ULVE 4AH2B 3BPOC 4NNYA 3VKKA 5EHFA 4KW2A 2K9UA 5AL0A 1UT1A 5TE7L 1UM4L 2YSSB 3NL6A 1RP8A 1Q72L 3PYCA 1XLFA 1AO7A 1AIFB 4ABQA 2PXYB 1KXVC 3FXGA 3RQ3A 3EO0B 4B97A 2NR6C 3N17A 2W60B 2FJFA 4KY1L 2D2JA 3IDIB 2PR9A 4H4IA 5C1MB 2ISSA 1P7QA 4G7SB 2HXTA 4KZ0A 3FAWA 2QHRH 4IG2A 1P1VA 1TJ2A 2Y5JA 2D7OA 5C8BB 1UOVA 1AD0A 5LN4A 5H6HA 3OHMB 4JO3H 2QQLL 4G5ZL 1TQXA 1EAPA 1FFPA 3IN2A 4YSTA 1NCCL 3FFCD 3EMCA 3QO1B 1H5BC 3BDXA 3W1UA 2DQDH 4Q7NA 3MYJA 3CH0A 1MY5A 4LPWA 3LGEA 2EKGA 4QXIA 2DW7A 3NGJA 3PFMA 5ACMA 4W68A 4M6VA 3BQVA 2TYSA 4OCRH 3DSNB 1YAIA 1GOWA 1EVUA 3NCYP 2R1YB 3UC2A 2Z35B 2VUKA 1UZ4A 2DICA 4H83A 3F5KA 1OCWH 1RSFA 4K23L 1RURL 1ZTMA 3QB7C 1WS8A 3KS0J 5GS0L 4LCUA 4UU9A 4GLEA 3LN4B 3E9TA 5BZWA 3CT2A 3RL2B 3ELQA 4GRLC 1XGPB 3AQZA 2Z1KA 4F79A 3W75A 1J0ZA 1CFSA 3WSQL 4YL4A 1U8IA 4P48A 5AB2A 1AOZA 4G8GB 4IIDA 4WKAA 4GY4A 4CN6A 1I1YA 2EIJB 2CERA 4NQEB 5I07A 4XKYB 4QHLB 1YG9A 3O2LA 1MRCH 1P1XA 4WHYG 5EIIG 4MJIB 3NPVA 4MS8D 4RW3A 1MHPL 4BS0A 2OR2A 2BSED 3DU0A 5KSVA 2BASA 3VH8A 1FFRA 5DJ2B 3E3HA 3LMYA 8XIAA 2Q3XA 3I6GA 4P3DB 3L16A 4FAAB 3URNA 1M6JA 3A22A 1R3HB 2OZ8A 3RGVA 4AL8C 2PWUA 4CQ8A 3LS4L 4V1DA 3GO1L 2P50A 4MZYA 3AXKA 1GOGA 2QPXA 1TPFA 1JN6A 2BVOB 4UT9H 5C9JB 2CBJA 5CZRA 5AKTA 1OVZA 5CAHA 4AEHH 2XHNA 4IMKA 1QOPA 3NPXA 3MR9A 1HHKB 2N59A 3VI4F 2CUIA 1BJ1H 2VD9A 5GSVB 4G83A 4HGMA 1E4MM 5E6IA 3DJZA 3I50L 4IJTA 4MWFA 4Q7BA 3WUFA 4G6AC 4EI5C 1P7HL 4EKXA 1LO4L 2FB3A 3DVNA 4UOW0 2XQBL 1VFAA 4F66A 3ZL2A 2YPKB 2RMNA 4QQUA 2J5WA 1PZ3A 2NZ9D 1AW1A 1LP9E 4Y19A 4ES8A 3B3IB 4LBEB 4US5A 1LD9B 4P2YA 4PY8I 2Q10A 4Y5XC 4FOUA 3NFNA 2P5EE 5C09D 3H2QA 1H9VA 5D02A 4W9IC 4NT6A 1W8GA 4PH8A 2J8FA 5GGRA 2PWFA 5IB4B 1I2OA 4F4RA 4F1SA 4UM9D 3BLBA 3CDZA 2NY3C 2MEJB 1BQSA 4ZX6A 1NUGA 1XR9A 3GBEA 3OZ9H 3RO6A 2VDRH 2ITDA 1IT7A 4FFZA 4HMEA 3L5AA 3SGGA 3T77B 4QTGA 4XC1L 2F6AA 5L6YH 2FFIA 2O1AA 1YEFL 4H6RA 2DZXA 2UBPC 5BS0D 1LWHA 1TR7A 4HKXB 3DX8B 3N25A 3MMUA 1FCQA 3EGDA 1F76A 2QCCA 1F73A 4MNHA 2DKUA 1MCWM 2V5YA 1E8YA 1CCWB 3ARFC 2H2PC 3PABA 3VOHA 4FQCL 3A47A 1LK3H 1NDMB 2ICWB 3TN0D 4JCWA 2F58H 4HW6A 2PMZA 4BFOA 1S9WA 3D4ZA 2PYED 3GKAA 3I7SA 3IDNA 5HI5C 1HESA 5GZNA 2VKWA 5BW7A 1VF5C 1Q85A 3QUYD 3V8OA 3MI2A 4PJ5B 1A8JH 5EMMA 4RLIA 2P9RA 4AW7A 2G2NA 4N4YB 5AC4A 4IQEA 2YEZA 4WI6A 1MCEA 3LDBC 2AJSL 4MMYB 2FPVA 2AGTA 3TT3L 3EB2A 4YHML 3PN8A 4MFEA 1Q45A 3DVGA 3TTSA 2PRHA 4ETYA 4KWSA 4S39A 4UBPC 3GFUA 5J6GB 5AALA 5IVZA 3VW3L 3GC5A 4PJAE 5HMEA 5F8QC 1X5KA 2J7LA 1L5GA 4U3HA 4JFFE 2EDFA 2ZXWB 1RZFH 2LU3A 3JBG7 1RJYA 3U2SB 3WKZA 3B1TA 4AY1A 1H3PL 1MW3A 2AQNA 4ZO6A 4I3RL 3AYSA 1VADB 3K2IA 3CZLA 3A21A 3SY0B 2QSCL 2P5PA 4JS7A 1CBVH 2R91A 2X3BA 2ZOKA 4MHHG 4M80A 1QNZH 2LHAA 1PAZA 1MYRA 5D2NB 5T8IA 4JLRB 4AH7A 3HBPA 3Q4DA 4D6FA 3CVBA 1BQCA 3EG9A 4IT1A 4OZHA 5EN2A 3FDGA 3AXIA 4LSTH 3AFLA 3MJGX 4Z3IA 2EDHA 4DXKA 2QNEA 4WR3A 2F6XA 3P9LB 1TZIA 4XP6L 1CT5A 2WSKA 2TSYA 3EADA 4J3TA 1CL7L 5JQ9A 2LU7A 3SDDC 4MWAE 3D39A 2XCMC 5EBMB 5FEBA 3MCMA 3NPSB 4R0LB 5D7KE 4N7QA 1OSZA 4MAYC 2A7PA 4LX4A 2JELH 3MKKA 5KYUB 3IF1B 3EX1A 3HCVA 5D7LD 2WQUA 3C60B 3VXRE 1DJSA 1ZGDA 3MREB 2CWXA 2OEKA 1NTDA 2BWDA 2JKRM 5IWLA 4ZMWA 4KUZH 2R2BB 1YPZA 3AY2A 1FLTX 3H26A 4DQOL 1MN4A 1KQYA 1HJCA 2IGLA 2EC8A 3NYDA 3OKYA 4AC1X 1Y0LB 4HPOH 5KSAC 4PV1C 2Y62A 4MNQD 4NUQA 4M82A 2NLIA 4BDVA 3PL6B 1K03A 2VX7A 2BGQA 5CC7A 4MNGA 3BRDA 1K3IA 3SZ6A 3O2WL 3ZQWA 3T8QA 4HU2A 4FQ1H 4FXGB 4F92B 2FUQA 2OSWA 5E7FA 2AABL 4UWQB 1ADQH 3PJSA 2E59A 4FZ8L 3KNBB 3FHAA 1DVTA 2JJTA 5FO2A 2VW6A 3FCGA 4NQXA 1A3RL 5EBWB 3GFXA 3W2KA 4PJIF 1MFCH 5FL1A 3DX7A 2GSEA 3QE5A 4H44C 1DJIA 4HMDA 4OCSL 5D9SA 1FIGH 1AODA 5FJIA 4GUIA 3MRDB 4RFNC 3GEFA 4OI8A 1OAXH 1QKZL 2X1QA 4JVPA 3PK7A 3UWWA 1UXSA 1NP0A 5DA4A 5KYXA 1DQML 2DM4A 3RB5A 1O7DC 5KBNC 1L7IH 3FUMA 3GSRB 3K2KA 2J4WH 4BF7A 1CE6B 5JW5B 2C7UA 4N1EA 3F04A 3ORJA 4D0DB 3FEMA 2GI7A 2ZNWA 1G7JA 4LVHB 3ALXA 4L4OA 2DQGL 4UOW1 2Q87A 4DZBB 2P88A 5FV2A 1NP2A 1DFBL 4IBYA 4OLUH 3VQMA 3VD0A 3SQOH 3HBLA 5DD5H 1YAZA 5H35B 4HDIB 2NY2B 5AB9A 4FQPA 4KDTC 4I3GA 2ACQA 3ZRFC 1VFMA 4ONGL 3ILQD 2OJEA 3IFOB 2EYTB 1QW7A 1I7TA 3P1VA 1QFUH 2CPCA 4S3BA 3GMMA 4BBWA 1XICA 1L7TL 2Y5EA 2VYOA 3WD2A 3QZLA 4WY0F 5J4MA 3L3HA 4LGSB 3II2A 1F11A 2YPLA 4DXVA 1YYAA 2QJJA 4LIQL 4IGBC 2CKBB 5SWUA 3T8XB 1W6LA 3R7MA 1DYSA 1RLCL 5PTDA 2VR6A 3W7RA 1EOMA 4LCCC 2HXAA 2HFEB 1O9VA 3GAKA 3IMVA 2PZ0A 4HXAH 5CAYB 2XQYA 5E9AA 3GZ3A 5I66B 1ICPA 5EDXA 3O6FB 4Z7UB 2YOCA 2VDMB 1SM3H 3VFPA 1AQDA 4O58H 2NDFA 2DZEA 4JL1A 2WZ0A 1WH0A 3G9VA 1S2WA 3LA4A 4DGVH 1IBDA 2J47A 1PDKB 1OXYA 4PRPD 3WTYA 4AENB 2FRGP 1YJDH 3MUHL 3VAEA 3BH9A 1KMGA 3RLVA 4N3UA 4YXHL 4A2LA 1UH4A 1DJNA 3P60A 3UPBA 4ZB5A 4L3CB 1DBKH 1U92B 3VQ2C 5GGUB 5D1XC 2XWBB 1NF0A 3ABRA 5C6TL 3C3NA 4F7CA 3IIZA 3QUGA 2FT6A 3W29A 1OCOB 4E9YA 3MOBH 4Q6JA 1ZTXH 3UP1A 1VRDA 5E9XA 4NNCA 4LNYA 3LIZA 5FYKH 1GC1H 4BUHA 1WT5A 5CNHA 3TNMB 4MVAA 3RNDA 1BA9A 1JPMA 1HS6A 2GIYA 3MP4A 4FYSA 1V5JA 3MJ7B 5G1MA 1S3HA 3V0WL 5A2LH 5I1JL 3MLUL 2F9RA 1D8CA 1WQ5A 2FT7A 2MHAB 1UFGA 2VDMH 5AHFA 3QYMA 3R10A 3FAXA 1RZIB 2YD4A 1NDWA 1H62A 4GKTA 2XDFA 3GG1A 1XIWB 3DETD 3T0EC 2XWZA 1HHIB 3V36A 4CLMA 2JEQA 4IPLA 1JVLA 5B8CB 1BM3H 3ZTCC 2P5WA 3N2CA 2J8GA 4LOEA 3M7FB 3V75A 3O63A 3VXOA 5CJBA 3GX9A 2JLPA 3ZYJA 5DRZB 3M7OA 5D7IF 3E38A 1N8ZA 4S1RL 1TPVA 3GRWL 1OGAD 3ZTEA 4L8SC 2H8PA 3OJDA 1VZHA 3EHBC 3FN3A 5E2WH 3MC0A 3RWIA 4G8IB 5SWSD 4MKTA 1MCFA 4DBUA 1KLFA 4Z77B 3T0AA 4G7VH 4NI3A 3QF0A 1EDQA 1S7UB 2BPBA 1EFXA 2YKLH 5D1ZC 2H3BA 1JZ6A 3QJTB 2GWNA 1AKJA 4WNQB 4QQ3A 3SJ3A 4KKXA 4Y2DD 3B5HA 1DVFB 3A4AA 5CD3B 2VEIA 3HHSA 2QFPA 3IDGB 4L80A 1KB5B 5FO7A 3BZ4B 4R4FH 4AVIA 3A4WA 4OCXH 2WM1A 4ODTH 4NENB 4DM1A 2CKBL 2KMWA 1PX8A 1TZ8A 2VWEE 3IMBA 3QIWA 4BHUI 4L5FL 3V6BR 1HJQA 5EO1A 4H6KA 1CR9H 4EN3B 5C0JB 1FFTB 1VFBA 4PGZA 2E6FA 4D8OA 3U2ZA 3V35A 3N40P 2AXGB 1LZOA 2VW7A 3ZDZB 4PRID 4ADUA 4HJIA 1LK2B 8PAZA 1NMAH 2GY7B 4PGJA 3UIZA 3UL4A 1S7SA 5E1GA 2UXGA 4WU7A 4EI6B 1G7UA 1JXKA 5I1HL 5L7XL 4TN9A 4Z2LA 2ZTJA 2PTXA 4QDMA 1UWUA 4ZMPA 5IFPA 1IQDA 4P46A 3QHTC 4GQ9H 2CLIA 4JJ5B 4HIXL 5CZVH 1NDGB 1GJUA 1HW6A 4I9XA 4OT1H 2DL9A 4FYRA 4YO0B 4HBKA 3RCMA 3ZJKA 2YMXH 2IJ0C 5E56A 3MRJA 4CCZA 1T5XB 3EFOB 4ALDA 1R1CA 2K4WA 1IQWH 2Z25A 2P5NA 2HTKD 2J1XA 3OWRA 4PQXA 5C08B 4RGOL 3AWNA 4JRYB 3IGKA 5AOKA 4IMAA 4MQ7B 1GZGA 2H90A 5GRUH 4OLXL 3DHDA 2ZZ6A 3W01A 1FWEC 1L3NA 1L6WA 2V9DA 2LOEA 1I1AD 1N5AB 5FM4A 1FH9A 5HTSA 1OZUA 1P4LA 4KBXA 5ANMB 5T9BG 3GYCA 2OQHA 2HVMA 1ID2A 3TMQA 4B9FA 3O15A 3U0HA 3QDHA 4L4TB 4HK0B 3PUCA 4L7ZA 3O06A 2NXZC 4QOKB 1FA2A 3EO1A 3I3DA 5HY9B 1AZZC 3U2OA 3TVAA 3CDCA 3ABXA 5DUBB 3LCGA 3FULA 3TIDB 5F1KC 3ZKXB 3ANYA 3AZRA 2X70B 3TIMA 3ARSA 3A3YB 3QG7H 2QQNL 5B22A 4O1CA 1B3VA 2J6EH 1ONWA 4IBSA 4NO2A 1CU4L 3IV3A 1DBJL 4FERA 3RVVC 4PJCB 5IJCC 3PQYD 4NLAA 3A4XA 4HHGA 2EZ0C 2EKSB 1A5NC 1Q2RA 4JYDA 5AAPA 4Q8WA 5DHMC 2OW6A 1JWSB 4BD4A 1NQ6A 4FQIL 4CNOA 3FOMA 4JQIA 2Q01A 3FU7B 3F6LA 5KAQF 2IO5A 2ACUA 1Z6KA 1QX1A 3FQTB 4BXVA 1UJ3B 4PTUA 1C12A 1FFNB 4DP9X 2G3XA 1KB5L 4YHOH 3WN5B 2X30A 4MJZA 4AZCA 1OWWA 3U0WH 4JDZB 4FLSA 3MMWA 5MEND 5AHMA 4B90A 1VFUA 3AT9A 3QO0A 1UWYA 4ELKB 4PD4J 4ERAA 5LGKA 5CFHA 3TYBA 3NIGF 1KGXA 4HIQA 3EJPA 4NP4H 1RLBA 4GRWF 5ICUA 1K6WA 1ACYH 1OAUL 4A2DA 1FGNL 1LUCB 5FYKD 4J23A 4OV4A 2CR6A 1IL1B 3X11A 3SY5A 5SV3A 6TIMA 5SWZD 4O0QA 4Q4QA 3MJ9H 3NFSH 3MCOA 3MMTA 4F7EB 4PWIA 2WXGA 2VZTA 2YPVL 4LP5A 1F6PA 3TAKA 3SDCB 2DJLA 1EA9C 2ESVA 5FM5O 2CCRA 3P84A 1X5JA 2Z93B 3GHPA 4PBEA 2YLAA 1IGCL 1IILE 4K5PA 1KM5A 4NQSB 4IJBA 4AD3A 4EI0A 4L8BA 3JS3A 3ZTNL 2FB4H 2XN9D 5EC2A 2BGNE 5I0XA 4L4PA 4N9GA 3QRBA 1TJIL 4H88L 3QYSA 2HISA 4FOKA 3WLWC 3EBGA 3VKAA 4ORMA 3QEHA 3QEGL 4MMWA 4PV8A 4YYCA 4J2MA 4UM8A 1L0YA 4PB0H 1LLZA 2EVHA 4TV5A 5CHNA 1BFOA 1QNIA 2YUVA 2E0PA 5IEKB 2VFGA 4NI8A 5JXQA 1J8KA 2EDMA 5ESAA 3RWFA 3TPKA 3FV9A 3HG3A 3ZZQA 2OAAA 1TJHH 3MOAH 4EIUA 3N42F 3EOAA 3QZWG 1OX4A 4UR8A 2R56H 4URIA 1BQLH 4JY6A 4H8HA 2BZNA 2ERJB 4HKZA 1A4JB 2BHFA 4WI4A 2DIBA 4LL1A 2BP5M 4IYKA 1ENUA 2IPTH 2HT2C 2XUWA 3SKNB 4EPDC 1JUBA 5FKPB 3S9ZA 4QR7A 2ARWA 3IEAA 2EIKB 4NJ9L 3VXQA 2W9DH 4HHAA 7PTDA 4H9YA 2V7NA 1KEML 1ALDA 1OQXA 4N2HA 4JBSA 1E27A 3O6YX 3CIAA 3RM8A 2HFGH 5MKGB 4L2LA 5FA3B 4KUCF 4YSDA 5D8ZA 1ISXA 3NABH 4R5VA 3ARRA 3IMUA 1OBAA 3K6SA 3AG4B 3MBWA 4FA7B 2EYRB 1U33A 2GSMB 4ZZ9A 3PIQA 3DX0A 4IIEA 1XTLA 4JFXA 4X9IA 2X88A 1BVLB 2FVLA 4GZIA 3GIQA 1B1YA 1WFNA 4S0HA 4PJFE 3D4YA 1GZ1A 2PBOA 3P8JA 3UABA 4IJ3C 3WQOA 2CJUH 4PJEF 1VYPX 5I3KA 3C2VA 1BLIA 1KQZA 4UYPA 4HB7A 3WEXB 4G8FB 4GY7A 1X44A 3MO1A 4OCWH 3GSXB 3LKNB 1FVCA 2VM4A 3G6DL 4JG1H 3PNWB 3FEQA 3URQA 1A6ZB 3WY4A 3UR8A 1R5IA 1JGDA 4X6CF 1XQKA 3DGGB 2X4RA 4QYAA 4I48B 4AYID 1JZ7A 5F9JA 2C0HA 4L8CB 1R34A 3KPPB 1FWTA 5E23A 3VOJA 3BEVA 2PU1A 5JPMC 2F18A 5AW9B 1Z5YD 3T2OA 5MHSD 4EN3D 4IQLA 2RJHA 4YMPA 3GGWB 2ATMA 3G1RA 3QEQD 1JD9A 3QAZB 2I14A 1E6XM 1N70A 3HPSA 3TTEA 3CB8A 2CLKA 3UTTA 3VXME 3NDZA 1KCWA 4XPFL 3WF4A 4NO3A 2ZVRA 3SDAA 1V7NL 1P2CA 3UZWA 4QRPA 2DIAA 3BOVA 3PSVA 1ZLWH 4NRYA 1G1OA 5FF3A 4PRHB 3V9EA 1JCYA 1TB3A 3OEXA 2DQJH 3SO5A 2J79A 3NXLA 4XO4A 5F7AA 4HFWB 4YWIA 4NHUB 4J2PA 2PP7A 5DJCA 1QPOA 5J1SC 5CZXC 4WV1C 1M04A 3F84A 3HAEG 4HA0A 3VC6A 4ZMZA 4PUJA 2P42B 1MFDL 4NI6A 2CK0L 5FFGA 4Q97A 5BOOA 1R9FA 5B7MA 5HR6A 4KXAA 1QLEB 6XIMA 3PY2A 1HILA 4P9HH 1YQ2A 2P7TB 4PBVC 1NCJA 1TNMA 1FCVA 2A9BA 3UG4A 4GG6A 1RL1A 2YN3A 3GC2A 1T96A 2Q09A 4QFUA 3D0VB 2IFGA 5I1KH 1VBUA 3USZA 2OMAA 1YDYA 4X9BA 4OSUH 4GRMB 2PW1B 4EOWL 1TITA 3WIFB 1D5IH 2DKSA 1GGUA 3KCPB 2PPGA 4R8WH 3W71A 1E5JA 2PLKA 1FWGC 4PVNA 2PF8A 3DXAA 5EF3A 2JKXA 5G4MA 1A6AB 2VZOA 1M65A 1OYBA 2JTDA 1YXDA 1EZUA 4JAWA 3C6SB 2AJ3B 1XVSA 4IISA 1SHSA 3ESUF 3HPFA 4JPWH 4S0SD 5EA0L 2E9MA 4D1JA 1UOLA 5KSUA 4A22A 5KZDA 3C8KA 1P84K 5CZKA 4K38A 4BZYA 4BZ2A 3QY8A 1PKYA 5AECA 2ENSA 1QFWI 3WO4C 4C1LA 5TFSH 3K8MA 4Y1AA 1KEGH 3L95A 4LNRB 3LLDA 4BWWA 4E8GA 3N12A 3GBML 3FH5A 4DJFD 2YAHA 3CXOA 3PUUA 3GAYA 3C9NB 4LP4A 1FVPA 2R69L 4BKSC 5IQ7H 4ZXBB 3GO2A 3EYOB 5FX3A 2F53A 4J9JA 4JD4A 3W87A 2X0YA 4UV4H 5ETUB 1E4NA 5DJAA 2EH8L 3S96A 3VSVA 1R85A 4MB4A 4JFZH 9XIAA 3CXHK 1KJ2B 1NEYA 3NEEA 3JV4A 4D1IA 4EN2A 1DDTA 1B3ZA 4Y5VB 2WD0A 1WWAX 2HE5A 1SXSA 1PHWA 2UUDH 5BMXA 3VUSA 2OEJA 3OKLA 3VFNA 3BO8B 2VZ1A 4LSSH 2VP8A 4XBJA 2IFFH 2EUVA 3AZSA 1XIMA 2VLKA 1TFVA 3OR7A 3WIAA 3IFNH 4ZW7A 1IAII 5IFHL 4NY2A 1AQKH 4G7QB 1NIEA 5ISZB 1Z9SB 3SQRA 3L5HA 1QSFB 3LHWA 1J5CA 3G6JB 2O7SA 4UTIA 1F4WH 4C57C 3S8GB 4OF7A 4OGQC 5T3XE 5F9OL 3IFPB 2BNQD 5LBVA 1ZLWK 2DD8L 4YTRA 4U1HB 1SXBA 3ARED 1QTSA 1FWXA 4AT6A 1AHWA 3SDCD 3K71A 2WXRA 2W07B 5IMLB 1JZ5A 4Y6GA 1RUPH 1YDPA 2VVNA 3QFWA 4K5NA 2ORBL 4CD6A 1QAWA 4B9KC 4M8QB 4OLYL 2ZT9C 2E9GA 1X5IA 1KBKA 3KHQA 4M4RA 3V52L 5DVLA 1KJ2H 3L1OL 3NN8B 4CMHB 3BG9A 4I0PC 1M7XA 1PL3A 1TVNA 1W32A 4MXVF 2FTYA 3V4PB 1QLEL 1ASQA 1HE8A 4F37F 1YDOA 1P6BA 3FFCB 2EDEA 4JO5A 4HIIB 4PR5A 2VABA 4MLIA 4PGEA 5HDQL 4Y90A 4HCHA 3N1FC 3E96A 5D1QC 5AFAA 2QUMA 4N0RA 2GZXA 3O8XD 1A5SA 5E8NA 5FFLA 5DC0A 3SDYL 3BVTA 2F8QA 1O6TA 1INQA 5I16B 5AC6A 2ALRA 1KCSL 1ZY9A 5KBPA 3AG3B 2Z7GA 3T4AC 2VJXA 4GH1A 2B4GA 4MAUL 1MJ7H 4RZ6A 3EYQC 4YK4C 5ECVA 3NCYS 1VP5A 5I5JA 2ZRUA 3VIPA 1FL3B 5HA7A 3O6LL 2XVNA 2OYKA 1CF8L 4QXTB 2OMUA 1G6CA 4NIYE 1URIA 3R58A 1FVEB 4NNXA 1BZQK 4PGLA 1I7RB 2APVA 1BSLA 4E68A 1LWJA 3QIUD 5JW4R 1B0IA 4LV9A 5AVNA 3L12A 3RWCA 4AJYV 5JHLA 3PBYA 1DVQA 4GFXA 3CSYB 1N0XL 4JFFA 1WDPA 1HT6A 2J9XA 3C61A 5ADOH 5DS1A 2GTQA 3S9DB 4J4PD 5IW3A 3FSOA 4POUB 4H19A 2UUDK 2PDGA 3NK4A 5AOZA 4OE7A 4E0RA 4JNXA 2X4NA 4O2EA 4Z7QF 1UBSA 1NKRA 5AG8A 1D5RA 4QTHB 4NCDA 1G7IB 3TJHC 1IMHC 5IHBA 3K2UH 5GRJH 4I9JA 3WOVA 1DCLA 3ITLA 2CNYA 2NTSP 1REIA 2QADC 5F7NC 4JTKA 3LZPA 2CA4A 5CKAA 2X2IA 3EFFA 2H3DA 4ZFMA 1I2NA 4JTDA 3RWJB 1HH6A 4MJ2A 3TYFB 1XGQB 3WS6C 43C9A 4YLQT 2VLJD 2XXGA 3R1GL 4C6MA 2A6IB 2FJUB 4JQ4A 2OKMA 4XKMA 3PSWA 3KAAA 1HINL 2FWLB 3HEIB 3HMXL 2LFEA 5L9DL 3NZSA 5FUZH 4N87A 2QXWA 2B0SH 4QXWA 4M03A 5XINA 3HLAA 4BRVA 3MNZB 1LRTA 4P07A 1AFVL 1TJXA 1FGVL 3BQUB 1VJIA 1BJ8A 4JKLA 2PDUA 4OF3A 4MD5B 5DMKA 3ZUNC 4AX3A 2OVLA 4Q22A 1OAYL 3HVNA 2YXWA 2VD8A 1CXHA 2A73A 1TU2B 1X9QA 1A1OB 4IEFA 4KI5C 4E3VA 1YYLL 4ZB2A 5E1HB 4KCWA 3ENEA 3V4PL 4I5BB 3VC5A 1QFWH 5GJSL 1P4CA 4QRUB 4U7SA 4PWFA 1QDSA 4F33B 5DD6A 1K4DA 1EJUC 1IM9D 5G4WA 1XSJA 3FO2A 1LRQA 3W74A 3UY7A 3F1QA 5DEGA 4TTDC 5AW2B 2QKIA 1BEUA 3UWZA 1XLGA 3S9YA 4GABA 5DJ0A 5AW0B 1IBBA 4LQFL 2B2XH 4IFKA 2O6CA 1GOIA 1HCYA 5BS0B 1HQRA 1Q6FA 4K68A 4AB4A 3PFRA 4PJXE 3L9CA 1XL6A 3EOYG 3B06A 4QLKA 3WYZA 1I6NA 1GZHA 1E6PA 3TLRA 5EY5A 1E4HA 4X4XB 2F9BT 3DURB 4IHOA 4RGNE 2IBZY 2PN5A 3TN0B 3P14A 4Z7AA 3WMPA 2VEFA 4GJTB 3UJJL 3H7BA 2PYEB 3NJVA 3CN1A 1IAIH 5GGVL 3HGJA 3ERXA 3KR3L 1F4HA 1GKRA 1W72B 2B77A 2W3ZA 2Z1BA 3BT0A 3QUYB 2SFPA 1YE4A 1FY6A 3LQAL 3CZFB 1IGTA 1TVHB 2CBVA 3NPUA 7A3HA 2Z92B 1MAJA 3Q1SH 1XLJA 4KAQL 4HWZB 3WY3A 3L68A 4JN8A 1D5ZA 4NNPH 2XWEA 3OVQA 1RZ8A 4JREC 1PTZA 1U5VA 2YXOA 4YXLL 4AQ8C 1AZNA 5ERWA 3CLEH 4ZE5A 1JK8B 3X13A 4GG9A 2WWNA 1H7PA 1WEJL 3T0CA 4HKBB 3CN0A 3PU7A 2BLEA 3N44F 5CJQL 1YQVH 3VO0A 1F6YA 4UCFA 4CILA 3X3GL 3RAJH 3P0VL 4Z7NF 3TYDA 2YZRA 2ZWSA 4HZLB 3ETBJ 3UTQA 4WW2B 5GZOC 5C6PB 4B3LA 1HI6B 3PJUA 1WZMA 3B9KC 4HJSA 1R46A 2MNUA 1MFNA 1XBZA 3N3MA 5H4ZA 4Y8FA 1UUQA 1OCCB 4AK1A 2PDPA 1W72H 1XLDA 3V5HB 2OZ0A 3QHOA 2O61B 4OCNC 3ELFA 2AK1L 5HATA 1T21A 2VDIA 4Y4KA 2X1OA 3EZ4A 4Y8DC 1VS1A 3PGCA 3QN3A 3BLPX 2EABA 4ES4A 4BQ2A 2ZX5A 5FYJH 3VPLA 1HZLA 1OF8A 1F4YH 1O9ZA 4NJGA 4H04A 2GVEA 4JYFA 1HXMB 4BFIB 3KYOB 2XIQA 5D7EA 1S5IL 3VFUA 2FJSA 5JHDE 3L5IA 4YLWA 5EUOE 5CEYA 1A80A 4KDWA 4PYSA 3AACA 5F0LB 3QHFL 2XU2A 3S8HA 4G6JH 3GUTB 3LKOB 5IW6B 4JFOB 3QWOB 5D96B 3LKRA 5I1LA 1A5FL 1NKGA 4LCWD 3QXWA 1CYGA 1J8VA 3EWXA 4Y9PA 5D7LB 1KC7A 5TDNB 2RDXA 1OJXA 5C6WH 1TPXC 5E08H 5EOTA 5I73C 4DP5X 5IIEB 3SJVA 3RRXA 4WXYA 2BVWA 1D7BA 3D9AH 1YEKH 2WMKA 4KJYB 1T03H 2WO3B 4P2AA 2XXMB 2ZKHL 4OU3A 1V0MA 5LIYX 2VUNA 4MNQB 2KZ1B 1TV4A 3U36A 4J3SA 4XBMA 3MRQA 4W7UA 2C1OB 1H11A 2ODOA 3ARXA 3FSAA 1N6QL 2YW4A 1KIRA 5AENA 4MBOA 5ICXB 1AHKA 2YWZA 3EYUH 3CPUA 1F18A 3CBRA 3NWRA 2GTWA 4ZOAA 5DRXA 3SYPA 5AW5B 1R3QA 4AGPA 4KKAD 2PYFB 2JQXA 1KBVA 2DLHA 3DV4B 4Q56A 3ARGA 1QEXA 2IWEA 3VU1A 3CAVA 5LIKX 3GG0A 1FH5H 4JDVB 4HLZG 4GVIA 3U82B 1XM3A 2YMTA 2X42A 1ZSHA 4ANUA 3TIEA 2QELA 3LN9A 3HR6A 1QUPA 4GUFA 2QHRL 3S83A 5M03A 3GLAA 1FFOB 2NNAB 8FABA 2ICEA 5SWQA 4FXRA 3QJFB 4UFHA 4JO3L 3VNJA 3O2VH 3P30H 4L4VA 2KLSA 3QBTB 3T65B 3TU9A 3TBSA 2DQDL 3PUGA 3DUUA 4KKPA 3QZ6A 1WXJA 1QRNE 2VH5H 2DWSA 5D71H 3UR2A 2VDRB 3HI6H 2HP4A 3SN1A 3S5NA 3KVDD 3JW7A 4AMCA 4JPIB 3VYPA 4AISA 4OCRL 3WL1A 4R5XA 4AVKA 1HHHB 3GXNA 1FZMB 3KAOA 4GWEA 1T83C 4TVSa 4DVRH 5L2KD 3BLKA 3FB7A 1QFPA 1BIIB 1R3SA 2V4LA 1OCWL 3DHMA 5F6HI 1Z32X 1XCTB 2A77H 4LLMB 4GLRH 2Y7NA 2PP0A 2BSSB 1JNHB 4Z0XA 3LRHA 1K2DB 1UVQB 3BQUD 2R23A 1A7NH 1FWAC 5M95B 5D5ME 3MA8A 2Z7WA 5DVPA 2AQVA 4GW1B 1TETH 4BE6A 1R86A 3NQIA 2NXGA 5EBLB 1XGUB 1HFUA 3TBTA 4ZZFA 4YXGA 1MFVA 2X6MA 1VRXA 5CEZE 1MRCL 4IKIA 2J8OA 3R4DA 1U3ZA 4LCVA 4F5CE 1M03A 4QHNA 4QKTA 3T44A 3AQYA 4HYRA 4PGDB 4P7RA 1XLKA 1EX1A 1SQ2N 4PRPB 4X6BA 4M6NH 1BREA 2BVDA 4H9MA 4WI7A 3FRPG 2P1FA 4OZGE 3HOGA 4QXUH 4R84A 3TZFA 1NC2B 1BF2A 4GJIA 3PBUA 5AHIA 5CPSA 2DS4A 4KPHH 1Q38A 3AWGA 3WAJA 4CNNA 4M6MH 1WXZA 4UT9L 4YAQB 3ZDYF 3BG3A 1M01A 3ZHNA 5TQ0H 4AEHL 3IMTA 4JXCA 4CU8A 4LS2A 4A29A 4M02A 3LZFH 4GQZA 4YCOA 3U0TB 3SKOA 1VGKA 3OHXA 4GQQA 4OF6A 2HVBA 1YUKB 3CVDA 1POJA 2NPLX 3HQOA 2V17H 5FAAA 4ZTYA 3FQ2A 2VISA 3ZQXA 3TR2A 3QXTA 1AGEB 4DUWA 4LEEA 1GKQA 2ALAA 5FYJD 4HCRA 1F3DH 3BL3A 1A22B 2YR3A 2FZ8A 4PJBB 1XL9A 1NFGA 4OZIE 2ZWZA 1IIGA 3H2FA 2W9MA 1M9WA 2YPIA 1BZ9A 4LSPH 3DO3A 4E5TA 3CVIH 2OP4H 5ABFB 3PBMA 3IB4A 1OCBA 1KT2A 3M4HA 3W7CA 3GIZH 3OZ9L 1T2QH 2FT8A 1OGAB 4X0KB 3GDBA 5CLXA 2A3CA 2VDRL 1UCBH 1C8XA 2Z31A 2EIZA 4LGRB 3V6OE 3STZA 2ZUXA 1NGXA 3GXIA 3LGGA 1S7VA 2Q0ZX 5SWSB 3AB0B 1AQ0A 5C7VA 4BWLA 5L6YL 1AYOA 4KDVA 3EOEA 4JIHA 3N43B 4JFWA 3WF1A 4GKNB 3VGHA 2A6KB 4QDWA 2WXQA 2ZYHA 3W39A 4BKLA 1ZZMA 2V8ZA 1H1YA 4Y2DB 3HGRA 4KV5E 1FHNA 3ALGA 1D5XB 1LK3L 1S8DB 3LTVA 3MYOA 3BD5A 5CZJA 4G9DB 2F58L 1E9IA 5C0AD 2E09A 1N8WA 5AW4B 4G1EB 4PJ7A 4OIAA 2IPGA 1N0LA 3FVMA 1XF5B 2EPMX 4ISVA 4XCEA 2BOCA 2FEJA 3ZGIA 5A2AA 4WGVB 2JKTM 3RFZC 1NDTA 4AQAA 4PRIB 4DW2H 2CZNA 4B3VA 2QUTA 5LNUA 4DO7A 2OI9B 3HOJA 4UFMA 2PWHA 2X9ZA 4FEIA 3ICJA 4PMJA 4H8UA 3Q8CA 3CU1A 5CBEB 3R4IA 3N2XA 1U8OB 3D05A 1SZGA 2BZDA 2JKLA 4OH2A 1NAL1 4JJOA 4TUJA 2KPWA 3O9WD 3WJJA 2XSAA 1UKPA 1X5YA 2BSTB 5FV1L 4Z7OB 1QA9B 2EDRA 5K9KB 3I68A 5C07E 4Z7VF 2ZUYA 3SSZA 5I6XC 3P4OA 4HA3A 3VCNA 3M8OH 1AFSA 4KQNA 1RZFL 4MZ2A 1QNSA 5I17A 3O6DA 5ENWB 2NSQA 4RMWA 4ATWA 1K4GA 2NLJB 4GX9A 2P44B 3COOA 4G7RB 3WDPP 1PF3A 4Y4HC 4LL9A 5REQB 4NUMA 1B30A 1HWGB 2UZPA 3MSYA 3CVCA 2CETA 4PTWA 1NPNA 5LVEA 1CBVL 2BNRD 1QBAA 3MA7A 2DMHA 1QNZL 3F2LA 4YDVA 5C7XH 4KOCA 3JVGC 1I1AB 4NWUH 1GZPB 1UB6B 1K8DA 5TK4A 4TF4A 2DI8A 3PTMA 1CMOA 5I6LA 3FCPA 5B39G 2XBZA 4PLKD 4LSTL 1RUQH 4U3CA 1JCLA 4TIMA 1KYDA 4M3JA 3UJTH 1ANUA 3KPLA 1DTNA 1VA9A 4HVXA 3D48R 1QPQA 1GGOA 4J39A 5JBDA 1M68A 3SGKC 1T7VA 5EF2A 2WINB 2YCLA 1EEYB 4B9GA 5JIWA 2QGDA 4ZAKA 3OO2A 1KZYA 2UX6A 4ZS6D 3QHNA 3QHZH 4DOHB 2JKPA 2JELL 5KBDA 5D6CA 3PQYB 3U30C 1QI2A 2BSRA 3LDVA 1OHZA 4S1DC 3MV7D 4MJ4A 1W3JA 1KWKA 5F9DC 5H37G 1MHCA 3H9SE 4P5MA 2E67A 4AVHA 2PGEA 3CPLA 4Y2NA 4DGUA 5F6IC 1H2JA 4XVUC 4LQ1A 2EXSA 1XBVA 4XD6A 4KUZL 4A3HA 2QDEA 3APMA 2OTWA 4L64A 2HBXA 2PTTB 3FMGH 3GI8H 3LHVA 3SDXB 2DYPD 4HPOL 3WQ4A 1FCGA 2QV5A 3GSUA 4BK4A 5MENB 5JQ6H 6ALDA 2OODA 2DY2A 3MRMB 5DEJA 3GHTA 1SNRA 2EP6A 4FQ1L 1MUJA 3B03A 5AYBA 2MCG1 2OLSA