4UQ9A

X-ray structure of glucuronoxylan-xylanohydrolase (xyn30a) from clostridium thermocellum at 1.77 a resolution
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
390
structure length
390
Chain Sequence
b'HMASATINLSAEKQVIRGFGGMNHPVWISDLTPQQRDTAFGNGEGQLGFTILRIHVDENRNNWSKEVATARRAIELGAIVSASPWNPPSNMVETFTRNGVPNQKRLRYDKYGDYVQHLNDFVAYMKSNGVDLYAISVQNEPDYAHEWTWWTPQEMLRFMRDYAGQINCRVMAPESFQYLKNMSDPILNDPQALANLDILGAHFYGTTVNNMPYPLFEQKGAGKELWMTEVYVPNSDSNSADRWPEALEVAHNMHNALVEGNFQAYVWWYIRRSYGPMKEDGTISKRGYMMAHYSKFVRPGYVRVDATKNPTYNVYLSACKNKKDNSVVAVVINKSTEAKTINISVPGTSIRKWERYVTTGSKNLRKESDINASGTTFQVTLEPQSVTTFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CARBOHYDRATE BINDING FAMILY 6
publication title Conservation in the Mechanism of Glucuronoxylan Hydrolysis Revealed by the Structure of Glucuronoxylan Xylano-Hydrolase (Ctxyn30A) from Clostridium Thermocellum
pubmed doi rcsb
source organism Ruminiclostridium thermocellum
molecule tags Hydrolase
total genus 138
structure length 390
sequence length 390
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2014-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uq9A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uq9A02
1MFVA 2J7DA 3GBEA 4GIAA 3FNDA 5DF0A 3EDFA 3BLKA 2DH3A 1B3YA 3SCTA 3DYMA 2VRKA 4J3SA 1HKMA 5CXPA 1E5JA 1M53A 1VFUA 1W9VA 1J10A 2YDRA 3CUHA 1VFOA 3A22A 1EHAA 2BNJA 3DDGA 5BXPA 2CBUA 5KZ6A 1CWYA 4EAMA 1UD3A 1V0NA 3GXMA 3AIWA 3VVGA 1GJWA 2J47A 3SURA 1EOKA 1V3IA 4M1RA 2Y2WA 2ALWA 9CGTA 4JFVA 2QF8A 1R34A 3UERA 1XRVA 3WFZA 5LA1A 1ITXA 4P7LA 3RO8A 1R75A 1E6RA 4FNPA 1G01A 5A8PA 1TA3A 4S3KA 1QI5A 3CZNA 3N04A 3RM4A 2CESA 5I5RA 1BHGA 3RPMA 2JF6A 1JXKA 3WQVA 2C7FA 1UD6A 1GHSA 4DWSA 2D0FA 4DO5A 4ATWA 3WH5A 1KXHA 4H04A 3VUPA 2YL5A 4C7DA 5JIPA 3FXYA 3VMOA 2J4GA 3MUY1 4M8UA 1NH6A 1CXKA 2OSWA 3H53A 5EFFA 2QLYA 4B9YA 1H0IA 1WDRA 2HVMA 5BYWA 5M3WA 5IHSA 1DTUA 4W84A 2NW0A 3ZT5A 1ZJAA 4UQ9A 1QHPA 1UA7A 2VQTA 2YKKA 3DX3A 3TTOA 1V3MA 3BVTA 4AYGA 3ARTA 2W91A 2VZVA 3PN8A 1KR1A 3FW6A 1XYZA 2VVSA 1MXGA 3FHQA 1CGUA 1UQZA 4DO4A 3K8LA 4V27A 2GJXB 3WNPA 1TVNA 3VSTA 2BXYA 4Z2GA 1SFSA 2WC7A 3MUAA 3LPOA 5CGTA 1G9HA 3CMJA 1UD5A 1B90A 3CO4A 3DX0A 1KQZA 3I3BA 3VIMA 1JZ7A 1DWGM 3WD3A 3AOFA 1MWOA 2DT0A 2GK1B 2E4TA 1BLIA 4UFKA 4XV0A 2FHFA 4H8HA 2ZICA 2DSKA 4JKKA 3WL1A 4A4AA 2OW6A 3UEQA 4JIEA 1UKOA 3VX1A 4A3YA 3VGHA 3T09A 1NOWA 2PBOA 3ZIZA 2J79A 5LA0A 1Q6FA 3DHPA 2WCAA 3G6LA 4GINA 5AY7A 1FP8A 2OYLA 1KFWA 4AMXA 1HTYA 1E72M 2V5DA 2QMKA 1D2KA 3GXDA 5ABEA 2WYSA 2Z1KA 1MXDA 3K8MA 3MUZ1 5M17A 4M81A 1MW3A 2WMIB 4WJXA 1NOUA 5M03A 4AIOA 1UR1A 1E6ZA 1S46A 2ESCA 3KL3A 3AYSA 3W26A 2ZUWA 3CV5A 2FGZA 2VURA 5CPQA 1WPCA 2Y8VA 4CD6A 3AS2A 1E71M 1JNEA 2F7RA 3BC9A 3S2CA 5E6YA 2Q8XA 1UH3A 2E9MA 3BLBA 3WY2A 1B31A 1WKYA 2ZE0A 5DFAA 1CLVA 4AW7A 4OJYA 4BQ5A 1G0CA 1W9BM 1CZ1A 3AQUA 3O2LA 3SCVA 2AMGA 3MKKA 3M7SA 3BH4A 3HU7A 3ARXA 3T2OA 2XFFA 2EACA 3W4RA 1UWQA 2EAEA 3ZJKA 1VEPA 2Y5EA 3VIIA 2G4FA 5E70A 2QHAA 1HJUA 3GXPA 2J77A 3N13A 2EO7A 3AIRA 4E2OA 3AROA 3WDJA 4P8UA 2J7CA 1RD6A 2WVTA 1XH0A 1BFNA 1CNVA 2J7GA 4CVUA 5I0DA 1ISWA 4TTUA 2WSPA 1BG9A 2JF7A 1GOOA 3ZJ7A 5CSUA 1GCYA 3B9DA 1JYXA 4KGLA 2ZX6A 1B3VA 3APGA 1H11A 4GI6A 1W9PA 3BAXA 3CZSA 1E6QM 2VX7A 3HJEA 4J3WA 1D3CA 2CERA 2W92A 4H41A 4ACZB 1HP4A 3JUGA 2VC9A 4MB1A 4GO8A 3PZMA 4U3CA 2XIBA 2VCBA 3W29A 2WB5A 1H2JA 5A6AA 4HU8A 2IXUA 5GQBA 4QP0A 2ZXQA 1UD8A 2W62A 4UQCA 1XYFA 3BVVA 1O7AA 1VF8A 3ARRA 1MVYA 3MUIA 3AIBA 2W63A 2X2YA 1JG9A 1QW8A 3BVUA 4HMDA 5A6SA 1JL8A 3VIPA 2O9PA 1XGZA 3PZIA 3T2QA 3VD5A 1NOFA 1H41A 1BF2A 1US2A 4FLOA 1I1XA 2OLHA 1JI2A 1MW0A 2A3HA 2V3FA 2WVUA 2WANA 1GOIA 1IZKA 4L4OA 2O9RA 2WMJA 1XSKA 4PSPA 3LRLA 1QX1A 4Z2LA 1GONA 2YDSA 1J0HA 3GZAA 4H8VA 5I3DA 2FDMA 1KBKA 1BVNP 1EHNA 4GZEA 1EIBA 1O7DC 3F5JA 3A47A 2Z1SA 4CU8A 1VBUA 2BHZA 2WMFA 2J78A 1BAGA 3WSUA 1DHKA 1JD7A 4FLRA 4GZJA 1CGYA 4ML4A 1CYGA 8CGTA 5HPOA 5HPCA 1QNQA 7CGTA 5A8MA 3CMGA 3ARZA 2J7BA 3AHVA 3VU2A 1KWGA 3OLIA 3BVXA 1OWQA 4UFHA 1QI0A 3WNKA 1VJZA 4J3UA 1JDDA 4ATLA 1UWRA 4KH2A 4CD7A 3WNNA 1HJQA 4NI3A 2EXOA 1GOQA 4JCMA 2OYKA 4PMZA 2UY4A 1D7FA 2WK2A 1UWSA 4PMQA 4AZBA 1CGVA 3NIYA 2CCRA 2V38A 1SYTA 4NZJA 3EJTA 5BXRA 3RDKA 3BAWA 1B9ZA 4D1IA 1ZL1A 1PS3A 4LPCA 1OGSA 3A6OA 1EXPA 2XN2A 2DQXA 3LPPA 3IANA 3WUFA 3AFBA 4LGXA 4NSBA 1Q6EA 5D9OA 1UKTA 1BYDA 4F9JA 1DWHM 3S5YA 4U5IA 5M5DA 3OIHA 4UFIA 4CGTA 3NDZA 4UOJA 2ZUUA 3VDCA 2E8ZA 3DX4A 3VILA 4PYSA 3W82A 2XIIA 2Y24A 3BVWA 1UR8A 3ZOAA 4GPNA 3UR8A 2PWHA 2B31A 2G41A 3SEPA 1WDQA 5A1AA 3LMYA 1PEZA 2YOCA 2TAAA 3WNLA 5DMYA 3W27A 5ABFB 1T0OA 2GJRA 3UCQA 1QBAA 1BGAA 1HT6A 4PMRA 3AMKA 1R87A 3VIHA 4XB3A 4MB4A 1JFXA 2BV9A 3WNMA 2IXVA 1VFFA 2WHJA 2W5FA 3ZT6A 1R7AA 3NSNA 4AISA 3LXBA 4OZOA 1E1EA 1KCKA 3VKKA 2O9TA 3L4YA 1EO7A 3WEOA 3A4XA 4AD0A 3KZSA 3NUKA 1EH9A 1HXJA 1DWJM 2EPKX 3OGSA 4N42A 4D6CA 2CKRA 2YA1A 1W91A 3CH9A 4TX8A 3VGGA 3SUUA 1KR0A 3T0BA 3GNRA 1QNPA 1KGUA 1EDQA 2JEPA 1UWUA 2WZEA 2G3MA 1PIGA 2ZX8A 5E0FA 4M80A 4C7FA 3AIEA 3SCWA 4P8VA 1RP8A 1GQJA 4AD1A 3VMNA 1J0JA 2CITA 3OGVA 2UWFA 3KLLA 3WD4A 1H3GA 2PI6A 3W37A 4LYQA 1QPKA 3CGTA 2WVSA 4HOZA 4IISA 1W1VA 2ZXDA 3O6AA 3WEZA 1F4HA 1B3WA 1GZJA 1JI1A 2Y8KA 1UWTA 3GDBA 3VGBA 1HXKA 3LXCA 1JIBA 4J3TA 3EMCA 5A8QA 1KCLA 4WLCA 3BLPX 5D9NA 1UG6A 3MMWA 1UZ1A 4EANA 5JIWA 4KWUA 4U2ZA 3K46A 3VD4A 2ZUSA 4HU0A 3RJXA 5DO8A 3VTRA 3LPFA 4J7RA 1BYBA 1E73M 1JZ5A 4RE3A 3A3HA 1KXQA 1V3KA 3AMLA 2J25A 4EE9A 3T0DA 3U57A 4PTXA 4BQ3A 2WZHA 4R5EA 3NDYA 3AS3A 1UD2A 1E4NA 2VJXA 3EDKA 5FKYA 1W9DM 3ALGA 1FHLA 1AQMA 1R85A 5CLWA 1XSJA 1K9EA 2XGIA 3CHDA 1UKSA 3SUWA 2W67A 3WBAA 3U5UA 1OD0A 2XVPA 3WF3A 3DYPA 1WB0A 5A6JA 3PZVA 3BSGA 2DT2A 2GFTA 1RPKA 3OZOA 3OZPA 3MU7A 4UQBA 4BCEA 4HP5A 4ZENA 2AAAA 4B15A 4OKDA 3WQ5A 3O9NA 3CZJA 4AIUA 3KE0A 3H54A 4W8AA 4FNTA 2G8ZA 2ZX9A 2GSJA 1UD4A 1G94A 4MNMA 1K9FA 3CC1A 1LL4A 3GXNA 1H5VA 1Z32X 2CEQA 1XC6A 3BAIA 3WQWA 4BQ4A 3F4VA 3TONA 3GXIA 1UYQA 3E1F1 2C0HA 4OGZA 2XM2A 3THDA 1AMYA 2ZX5A 1J0YA 5FD0A 5A6LA 3BUDA 1VB9A 2CHNA 1E3XA 3W6MA 1C7SA 2DGAA 2CXGA 4AWEA 4JKLA 4L4PA 1YQ2A 3GXFA 3WD2A 3F5LA 3PBGA 2YFOA 1JNDA 3PZUA 3AISA 2ZUVA 2QV4A 3N11A 4HTYA 3A21A 2X09A 2F1AA 3NJ3A 3W81A 3VIKA 1SMAA 2JIWA 1GQKA 3VIJA 3OLEA 1OINA 4CCCA 4E8CA 3VMPA 3PZ9A 2YLAA 3B8SA 1NARA 3AIVA 2XYLA 4HOXA 1HVXA 3VDBA 1W2VA 1GQLA 2EBNA 3MS8A 5I78A 4AZCA 1VIWA 3ZT7A 1H09A 1CIUA 1R33A 3M07A 3WUGA 3HG5A 3MANA 1H1NA 3BSHA 4AZGA 4MPKA 4W87A 4DO6A 1BYAA 5ABGA 1BVZA 4OOZA 1L0PA 2WMGA 4U31A 1JGIA 1W32A 1OGGA 3AZRA 2QPUA 2CKSA 1AQHA 2YBTA 3II1A 2VVNA 2IGTA 2YL9A 4CD4A 5A6BD 3ARQA 2XG9A 3A4WA 1XHGA 1TMQA 3WENA 2BHYA 1EQCA 1HN1A 1UH4A 3EJPA 4TOQA 3AYRA 1RP9A 1JYVA 2XFRA 4EKJA 5CZKA 4HA1A 4HZ7A 3WDQA 5A94A 1C92A 3N12A 3GXTA 1E6SM 3MSGA 4KRUA 4UQDA 4TUFA 1TQSA 3VO0A 2BVTA 3BMVA 4DUWA 3L2LA 5GNZA 4PEEA 4RL3A 3WF2A 4QLKA 4UOQA 1OBAA 1W1PA 5I79A 3SCNA 3N18A 1V02A 2DEPA 5BXTA 4N0RA 1MW2A 3WQ8A 5IHRA 1W3JA 1QWUA 2XWEA 4UOZA 4DM2A 2F1BA 1JXJA 1M7XA 1CXFA 1SR0A 4W8BA 6CGTA 1ODUA 3WMSA 1GUVA 2OWWA 2V5CA 1GW1A 4NRSA 2WLYA 5FL0A 1XH1A 3QHNA 1LL7A 2E9LA 1NWUA 3QGVA 3VD7A 4UFMA 1WDSA 3PZOA 1DWAM 3AXXA 4X0VA 3HN3A 1M01A 5E9AA 4HMEA 3WF1A 4FNUA 4AMCA 1B30A 2DH2A 4M29A 1V6WA 2VRQA 1K9DA 2WCGA 4B16A 4AZHA 4UNIA 4URIA 3GBDA 3AHTA 3OBAA 1QI3A 1CGXA 1CLXA 4UFLA 2YL6A 3ZMRA 4KRTA 1W2PA 4ZEPA 1UHVA 1WDPA 1CXLA 3B9AA 4S3JA 2VUYA 1C93A 2VQUA 1O6IA 3FAWA 3VGFA 1V02E 5FCZA 1B0IA 3D3AA 1OM0A 3SCQA 4CU7A 3S6TA 2WVVA 1FA2A 2V3DA 1HJSA 1FFRA 1ZBKA 4OBRA 5EMYA 3L4VA 3UETA 2WWCA 3MSDA 4PMNA 5CPTA 1H4PA 2A3CA 3OB8A 3AJ7A 2WMHA 5E0CA 4JAWA 4ZXLA 1M03A 1PX4A 2XTKA 4JKMA 3A23A 2F18A 4W93A 3IJ8A 5E09A 2D1ZA 2CBJA 2J7FA 2WLZA 5HDRA 1X1NA 2EADA 3LXAA 4Z2JA 1FOBA 3WY1A 1J0IA 2WM0A 2DT1A 1TA3B 2ZWZA 5IXEA 1FH7A 4Q22A 4XZBA 3ARVA 1LQ0A 4ZE4A 5AC5A 3WY3A 3BCDA 4TTGA 2ZUTA 8A3HA 3SCSA 3WH8A 3NYDA 4Z2HA 3PTQA 2RGLA 3QR3A 4NZCA 2EEXA 1CENA 1US3A 4DWSB 3QOMA 2UY2A 3AS1A 1QW9A 1ODZA 4AEFA 1QOXA 1CPUA 5FOOA 1FFQA 3VDAA 3SUTA 4AD2A 1WZMA 3A4AA 2FHCA 1J01A 3T0AA 4F8XA 3N9KA 4NXKA 5BRPA 2J7EA 3S5ZA 2E9BA 1NM9A 1DWFM 4QLLA 5I23A 3TTYA 1PBGA 1VEOA 4PMUA 4B9ZA 2A3EA 1FP9A 4X0NA 3B9EA 5CG0A 3BGAA 2FH8A 1WZLA 2X0HA 3L4UA 1J9YA 1OD8A 1E6NA 3VD3A 4TX6A 2BFGA 2XN0A 3N1AA 3WH6A 2WXDM 2DDXA 1E0XA 2WSKA 4LYPA 3EYPA 4UCFA 3EJUA 1QNSA 2ZX7A 1E3ZA 3TV8A 2NT0A 3MMDA 1OIFA 1UASA 1UR4A 4DM1A 3LPGA 2E3ZA 7TAAA 4MDOA 1J11A 2CNCA 3PZNA 3D51A 2XM1A 2X2HA 2WBGA 2AOSA 1U2YA 1V6YA 5JBFA 3K8KA 1JAKA 3ZR6A 3W0KA 4PBGA 1C90A 2JIEA 4C7GA 2BY2A 2VZTA 2A3AA 1X6NA 3U7VA 4GXPA 4NX0A 4PN2A 4HPGA 4PMOA 3GNPA 5A8NA 3ZQ9A 3CZEA 1CGWA 5I24A 1WZAA 2DSUA 2VL4A 3FHAA 3TTQA 4OOUA 3WY4A 1E6PA 3GNOA 1V0MA 1E56A 1OSEA 2UY3A 1QHOA 1R8LA 4LYRA 3KL5A 4R27A 5A8OA 4AD4A 1NQ6A 4ZE5A 2XSAA 1TZ7A 2PWEA 4D1JA 1WP6A 2D20A 4D6EA 3EJRA 3OLGA 4PMDA 3VIOA 3EJSA 1JDAA 1XCWA 1ZBWA 4DWSC 3WEMA 1FH9A 4TXEA 3QHOA 4LXFA 3EMQA 3AMGA 1U30A 5JUVA 4CU6A 3CTTA 2RGMA 3WQ4A 4W5UA 4WKHA 1B1YA 2VR5A 2X05A 1GNXA 4Z2IA 1I1WA 1M04A 1N82A 2EJ1A 2WKLA 3VIFA 2PBGA 2JEQA 2XHYA 4MTVA 2OW7A 1NWRA 1X6LA 2F7PA 1TR1A 3CHEA 4FNRA 3T2PA 1V0LA 4A3HA 5FL1A 4IPNB 3RJYA 4U5KA 3AHZA 2BVYA 1LG1A 5A2BA 4F9DA 1C3FA 3WELA 3WDRA 3SCUA 3CUIA 5LA2A 3L2MA 4KMQA 3PZTA 1E70M 4PMVA 3OGRA 2WW5A 2V3EA 3WBEA 1ZBCA 1LL6A 2CBIA 3WKZA 2XVGA 1PZ3A 1TG7A 1Q6DA 4P7QA 1F4AA 4F79A 5I77A 1ZS2A 3L4ZA 1VBRA 3WFLA 1NP2A 3D4ZA 1UUQA 1W3LA 1JZ8A 4QDMA 2C8NA 1B3XA 2D22A 3WUBA 3WIJA 5CQ1A 4AZIA 4B3LA 4DUVA 2VX4A 5FIPA 4JZ5A 1V3HA 2XSBA 4BS0A 1J18A 3DX2A 2FHBA 3MV11 3SUVA 1JFHA 1ISVA 1ISXA 1E40A 3TOPA 2W61A 1DP0A 1CXEA 4WSKA 1QNRA 1IT0A 3VD9A 4NXSA 2JALA 3AS0A 2YA0A 4NRRA 3AICA 1SZNA 4QCFA 3VSVA 2GJXA 4AD3A 4CKQA 1SMDA 3VX0A 4JFWA 3FY1A 2XN1A 1JDCA 4PTVA 1KBBA 3IJ7A 1QWNA 4HZ8A 2VO5A 2XFYA 3I3DA 1WNOA 4BA0A 4GKLA 4QLJA 3GM8A 2GK1A 1V6XA 3WH9A 4HOWA 2E40A 1E0VA 1GORA 4WIWA 1W1YA 3AXIA 3D4YA 3D52A 4AC1X 3ZM8A 3UG3A 4DWSD 3WDIA 1BYCA 4WKAA 1TCMA 2EPOA 1K9TA 1KXVA 5F7UA 4MDPA 3BMWA 3ARWA 1Y7VA 3VM5A 1UKPA 1HX0A 3A5VA 7A3HA 3CIVA 3VINA 3QOKA 4CD5A 2GDVA 2CBVA 3MV01 2VT0A 1QI4A 2ZOXA 3N15A 2FYVA 2NT1A 3AZSA 1OT2A 1XCXA 1WCGA 2FGLA 1E4LA 1TQUA 2J8GA 1TE1A 3VSUA 2F7OA 1LWHA 2BXZA 3EDJA 2WMIA 3CHFA 3EDDA 3MO4A 4OUEA 2D0HA 2BVDA 4D6FA 1CECA 2J75A 5GNYA 2JE8A 4W89A 4AMWA 3OA5A 1ESWA 2IUZA 4AY1A 3VGDA 1E43A 3D5HA 5CSYA 4GQRA 3BUIA 4J3VA 3W38A 5LYRA 2VR4A 4W8LA 5EFDA 4B3KA 4XZWA 1C7TA 1GVIA 4TVUA 1E55A 1VFMA 2VZOA 2DSWA 2PC8A 1JZ4A 1ZB5A 1KGWA 5BRQA 4XUYA 3WQ6A 5C8BB 2X1IA 3ZJ8A 1OCQA 1HKIA 5DT7A 2GDUA 3VIGA 1EO5A 1L8NA 4FK9A 1KGXA 2OWCA 2EQDA 3DHUA 4U3AA 4D6HA 2WNWA 5JBDA 1WO2A 4D6DA 4Q7NA 3IJ9A 4FNSA 1MQQA 1LJYA 4QFUA 4QAWA 3ZO9A 3DX1A 5A2CA 5AC4A 2ZWYA 3CLWA 1HF6A 2EPMX 2WPGA 1C8QA 2QMJA 5E6ZA 4U33A 1LG2A 4W88A 1UZ4A 3W53A 1FH8A 2X2IA 1KXTA 2XVLA 1E1FA 4M24A 4FNQA 4Z2KA 2ZUMA 4ZFMA 2OWXA 2VX6A 1Q6CA 3RMEA 2D0GA 4ACZA 5IFPA 4W86A 4D6GA 1NP0A 3POHA 4P8WA 3RM8A 1V6UA 2XPKA 2F7QA 4J27A 3KLKA 1BQCA 3PZQA 3VGEA 1HIZA 1VJSA 4W7UA 5C71A 3LRKA 3AMDA 1TQWA 4MAVA 1CXIA 2D23A 3AHYA 3CUJA 1XH2A 5GPRA 2WC4A 1OB0A 1RH9A 1H0GA 4BF7A 3HZ3A 2XJ7A 1R86A 1Q6GA 1NWSA 1LF1A 3SCOA 3I3EA 2Y4SA 2F8QA 2OSYA 3VNZA 4H8UA 4PRWA 4Y7EA 3TA9A 3HG2A 2NSXA 4PCTA 2YJQA 4JFTA 1B3ZA 2X8RA 3F5KA 2WC3A 4PTMA 4HA4A 4W5ZA 3TP4A 4D71A 4OIFA 2YL8A 1IV8A 1EDGA 2WZIA 4AZ6A 5BXSA 2WMKA 1E4IA 4CVWA 4MJ4A 3BAYA 1QHZA 4PUDA 1E15A 4BZYA 3W24A 1I75A 4PUEA 1MW1A 2DIEA 3WDHA 3EJQA 3TTSA 1FHDA 3W6LA 4PCSA 3A24A 2BY1A 3ARSA 1TQVA 1E6XM 1QI2A 3WNOA 4UR9A 3U5YA 5EBAA 3WH7A 1XSIA 5DEZA 5AYIA 3T08A 4FF5A 3K4DA 5EB8A 2O9OA 3GYCA 4IUGA 2W66A 4WKFA 4AXNA 3WL0A 1ZJBA 2VCCA 4MADA 2A3BA 2EABA 2VZSA 1HL9A 1DWIM 2J62A 3DYOA 4MJ2A 4YPJA 5BROA 2QPSA 1UR2A 1BSIA 4MNLA 3ALFA 2BS9A 5E1QA 5CGMA 4JL2A 1BTCA 2J74A 3RM9A 2GJPA 2VZUA 1GJUA 3BUQA 4TVCA 3BXWA 3KL0A 1GOMA 1G5AA 3ARPA 4D6IA 3AZTA 4V28A 5D9MA 3MI6A 2YBUA 4AZ7A 2CIPA 2ZIDA 2W4XA 1UQYA 3EDEA 2XUCA 6A3HA 2D3NA 1EQPA 1W9XA 5A95A 4UFJA 3BUBA 2WHLA 1V03A 4D6JA 1J0ZA 2YFNA 2F2HA 5ABFA 2G3NA 4FMVA 3G6MA 3WN6A 2DPEA 3HG4A 3ARYA 3IGUA 3DC0A 5IFTA 2ZXAA 4JHOA 2CYGA 1GOWA 4PMXA 1W3KA 4M56A 2DT3A 4UZUA 3SIMA 4GI8A 2OYMA 3CUGA 3PTMA 1G1YA 2F61A 1B2YA 2VTFA 5A6BA 3SCPA 2VMFA 5I2UA 2VOTA 1JF6A 1MQPA 1V3JA 3W25A 3K4AA 5AYBA 2EPLX 5ECUA 1CTNA 1VENA 5CPSA 2YLLA 2G3JA 1JYWA 1A47A 1UH2A 1HJVA 5CJ5A 1C8XA 1JZ6A 3RILA 2VRJA 4JFSA 3AXHA 2EPNA 4MAZA 4J28A 4E8DA 4KGJA 5HXMA 1EDTA 2YA2A 2G3IA 2J7HA 1HJWA 2PB1A 3GH4A 3N17A 3DDFA 1ITCA 5JBEA 1QBBA 4FLQA 3GH7A 2PWGA 3WDPP 1P6WA 2VCAA 1KQYA 5D8ZA 2VX5A 4PMYA 1QNOA 4K68A 5GNXA 4CN6A 1W3HA 3SUSA 2WKGA 2CETA 4YHGA 2MANA 1UKQA 4AZCB 1HWWA 3CPUA 5TD4A 1PX8A 5D8WA 1KTBA 1ISYA 1TUXA 1VEMA 5A69A 2E8YA 3J7HA 5I6SA 1C91A 2XVKA 3VNYA 4MNJA 1LLOA 1JZ3A 1KWKA 5BWFA 3EMZA 4OBSA 1BG4A 1WAWA 4H7VA 4WK9A 3CBWA 1J12A 4WF7A 2OSXA 1HVQA 4X9YA 1HL8A 1ISZA 3U7BA 4LQ1A 1PX3A 1CXHA 3DECA 3ZSSA 2CHOA 1PIFA 4HZ6A 1GOKA 3L4XA 2DSZA 4QCEA 4ZXOA 2WWDA 3UG5A 2PWFA 2D3LA 4JCLA 1V0KA 3BCFA 2WBKA 3WF4A 3IAQA 3ZR5A 1QVBA 3KWXA 3RCNA 4U2YA 2WHMA 3FAXA 2YIHA 3VM7A 2DSVA 3M6DA 1V6VA 1PZ2A 3CHCA 4JHZA 1UR0A 3UG4A 5A3HA 1MYRA 3MMUA 1OGBA 2UY5A 1KB3A 1EGZA 3M46A 4CCDA 3WUEA 1HJXA 2DIJA 3BUPA 4W85A 3ZJ6A 3OG2A 4HPHA 3AMCA 4P7NA 3RIKA 3IAPA 2WAGA 3WMCA 4YN5A 3POCA 1WZKA 4IPLA 1CGTA 1DEDA 1JF5A 1OIMA 4MB3A 4MB5A 1HNYA 1XD0A 3LRMA 3WF0A 1EA9C 3HG3A 4W7WA 1XV8A 3NSXA 4ATDA 3QHMA 1E0WA 3PTKA 4AYSA 3NSMA 3L4TA 1CDGA 1PAMA 1Q4NX 3K1DA 4AZ5A 3WD1A 4PTWA 3AI0A 4UZSA 3THCA 1TQTA 2PF0A 1UR9A 1TFVA 2D24A 1GQIA 2D2OA 3WD0A 1ZBVA 2GVYA 1BPLB 2WVVB 4NZFA 3BAJA 3FN9A 3OLDA 3AIUA 4XX6A 1R46A 4AEEA 1KTCA 1UOKA 5DT5A 3PHAA 5D4YA 4CD8A 1MQRA 5KEZA 4DUXA 5ABHA 3L4WA 5CLTA 5HOSA 1LWJA 5HNNA 1E4MM 4GZIA 4M82A 5A6KA 4V2XA 5IDIA 1ECEA 3PZGA 4P7OA 4AD5A 2VI0A 1PJ9A 5D9PA 2X2JA 3D50A 2XGBA 4AIEA 1ZU8A 4CUCA 1JYNA 2XVNA 3IK2A 4FLSA 4BQ2A 1JZ2A 2JFEX 3ZSTA 1CEOA 3GTNA 1TVPA 2V3GA 1PPIA 3CZGA 2XWDA 5A6MA 2FE0A 3W28A 5A2AA 4JL1A 4PSRA 4HMCA 3ECQA 1UWIA 1GVYA 4CCEA 2GUYA 1V3LA 1A3HA 2VNCA 3SCRA 1C8YA 3HMCA 3LX9A 3AHXA 2WHKA 4CN4A 1E9LA 3CUFA 1AQ0A 2CPUA 3CZ8A 1XD1A 2ZUNA 1HP5A 1J0KA 4UQAA 1NWTA 3EBVA 2YDQA 1IZJA 1WE5A 1R47A 1W9UA 2E0PA 2WCSA 3CZKA 4LX4A 3UESA 3VPLA 3WMBA 2ZXBA 1AVAA 4GO9A 2BY3A 1W1TA 4RE2A 5HBFA 4TVDA 3UR7A 1UA3A 4W7VA 1R7OA 5BCAA 6TAAA 1H49A 3GH5A 4GI9A 4RE4A 1CBGA 5C70A 4YHEA 1HKKA 1EOMA 1OT1A 2HISA 3NCOA 4JFUA 3H55A 4UQEA 3BAKA 1JAEA 2D73A 1GPFA 3VOCA 2BY0A 4E4PA 4NF7A 4HA3A 1HKJA 1MFUA 4WSJA 1BGGA 1U33A 1E5NA 2O92A 4ACYA 4GQQA 1VAHA 4MNKA 2BHUA 1V08A 4P7RA 1YHTA 1JD9A 3KEHA 2PWDA 4CN1A 2X0YA 3ARUA 4J3XA 1GHRA 3CZLA 1VRXA 2J8FA 1K6AA 2FH6A 4F66A 4IM4A 4D72A 4P8XA 4H2CA 3AIQA 3VDHA 4UTFA 4EK7A
chains in the Genus database with same CATH superfamily
3ARBB 1OGTA 4MRCA 1FGVL 2JTDA 1EVUA 1ESOA 1I1AC 4B9FA 4CJ1A 1P5UB 1KBGH 1P0DA 4I9WE 1PYWA 2RAGA 4D9RE 3ARGC 2H41A 4GEJA 2OMVA 4ZSOE 2MKLC 3DUUA 4X9SA 1TJ1A 3DDGA 4WUUD 1T0PB 3H9ZA 4JRXE 4D9PA 3H42H 2QF8A 4DB7A 4UIMA 1R34A 3LTYA 1MFDL 5DO2C 2IAND 1R75A 4UTUA 3GI9L 3TYAA 1C9SA 3G77A 3P81A 3WIHH 3FYYA 1TUFA 1Q0YH 5I5RA 3TVMB 1W5NA 2C7FA 2GZXA 1K4CB 1I4NA 2KBGA 5FWRA 4PGEA 4GH3A 2J4GA 2R39A 4N8VG 3H53A 4L1SA 2NY5C 1D8CA 2EIMB 4JY5L 4W84A 2NW0A 1YG9A 4N24A 5CUSH 3RYMA 3CE1A 1SQ2N 1R3KB 1MXGA 5IVXB 1UUNA 4U1JA 1JPKA 1G1KA 1MFEH 1L6GA 3SDXA 4I0CC 1E5AA 4K36A 4Z2GA 2WC7A 4O8AA 2FUQA 2X6VA 3CMJA 3U7YL 1ZLUH 2WNNA 4JKPL 3NQFA 3EYOB 4DBEA 2EH7L 4XAWL 2GK1B 4XBGB 4PJFE 1PKMA 4P3DA 3V52L 2JKLA 4JKKA 1NBQA 4EZKA 1IGFH 2F6XA 3ZIZA 3QDJD 1IGTB 2WCAA 1S7VA 1IE7C 2OYLA 4AMXA 1AD4A 4IU3B 1GSKA 1CGSH 1FA4A 4AF0A 4XCYA 4KKPA 1ZOXA 2AJ3B 5IG7A 1MRCH 3TASA 1DVFB 1BQGA 1S46A 3KL3A 3C60A 4MMZC 2W3ZA 3QQ9C 4MDJB 4N8VA 2VURA 3ITTA 4JZOB 5D4HA 4ERSL 4ZDHB 2V9DA 3QRLA 4R2GD 3HZVB 3P4LA 1UH3A 5AALA 3RF9A 5MHBA 2DW7A 4XR8C 4FQ1H 3GRBA 1ZGLB 1ACYL 3D2UD 3DG7A 2W9LA 4RMBA 2DDQL 1HHIA 2W0KA 3ITOA 3NFPB 3RWFA 4FS9A 3IU4L 2OAAA 3Q65A 3QW9A 5FJPA 4HGXA 4HDIA 3SPHA 3GHBH 1REIA 5FGCE 2PXYC 3EGSA 4GS7C 2QAFA 1GS7A 2QKIB 2BNRA 3J2PA 2IWEA 5AZ1A 4ZUUB 1K8DA 3DK2A 4TTUA 3ZJ7A 3F7LA 4MDIB 3FK3A 5BQ7A 3RJDA 3BGJA 3D69A 1T41A 2CERA 3TN0B 2JSFA 4JRWA 4AQ1C 4JZNA 4HU8A 4ZUSA 3OJMB 4BELD 5ACZB 2XQBL 4YZFF 1QYGH 2EIEA 4GA8A 4K9EL 4ZFFB 3G1XA 5CS7A 4P4KC 3AUVA 2BNRE 4OD2A 1RV6X 4EOWL 3RDJA 4GP5B 5CJOL 1Z0NA 1GYUA 5E0KA 4AH2A 4E68A 5DRCA 3O3AA 1GYVA 5T1LD 1GOIA 2V9UA 4G7VL 4Y9MA 4Z2LA 2F5AH 4FO4A 2VLRD 4LVEA 1KBKA 1XISA 1A9BB 1HUVA 5DJDA 4DVBA 1VBUA 4Z1BA 3M7OA 4WWOA 4LAOA 1E3FA 3SQLA 1XG3A 3STEA 3F8UB 1VJZA 3MRGB 4P5TB 2IANB 2IQTA 4CD7A 3WNNA 3RBSA 1HJQA 4NI3A 4UQ2A 5DMGC 5EUKA 2JIXD 1RJYB 3X1EA 4KTYA 2Z00A 1B6UA 2WSYA 4HQQL 5BXRA 3VI4F 3O81A 4GG9A 2DQXA 5F2FA 3NCWA 3RB5A 3F4NA 4M6UA 3P0XA 3V9FA 1AKJB 5M5DA 1O66A 4DBDA 3DESA 3I75B 4RAVA 2OMTA 2D7TH 4S1RL 3K6SB 4US5D 5ABFB 1SDDA 1PVHA 4C58B 4X2RA 2BJMH 2AV1B 3VIHA 4XB3A 1AYOA 3EAKA 2F19L 5LGKA 3V4VB 3QUYC 2OMYA 4FI8A 3WS3B 5J7CC 2OCFD 4GMSL 1DWJM 3GSWA 3ECUA 4PG2C 2D8KA 3CH9A 3QDJB 1KGUA 4KKAC 4O8RA 1KLYA 1AY1L 4MJ5A 1KTKE 2W07A 1FWBC 1WOBA 4QCIB 2EUVA 3CL8A 2X4UA 3G04A 1Z9SB 1HHHB 4QNEA 5A6TC 4HCLA 4EZJA 3LMJH 3ALWA 3WQOA 1YPZA 5GGVH 3PGCB 4NNXA 2QF7A 3X14B 4NQTA 5BMWA 4FGMA 4Y2WA 2MNWA 2AQ2A 3P2BA 1UG6A 4L4TA 4GAGL 4C6IA 2AEPL 1FY6A 3V35A 1JZ5A 3D2UB 1USZA 3OPUA 4KOBA 3DX8B 4H8WC 2X9XA 5AYUH 1FLRL 2B16A 1UACH 4A67A 3U57A 1JHTB 2ODOA 3DOSB 1TPB1 3L0KA 1A6TB 5DQ9A 1TETL 5EBGA 3DJ9A 3IWVA 3ECVA 4AC2A 1FHUA 1K9EA 2XGIA 3KRZA 4YTRA 4K3HA 2LTQB 3NJMA 4K2SA 4L0ZA 2AKRA 2YXGA 3W2DH 1ZVHA 3DYPA 1JWMA 4RDBA 2YD0A 2F8IA 1VKFA 3M0YA 3B2UC 4L4TE 4R7VA 3MBXH 1RQ5A 2WWMD 3TZVA 1OTTD 1CL7H 4L05A 3VXSD 3QTPA 3WQWA 3TONA 3VU1A 2C0HA 3T3PB 3UX9B 4NAQA 5GHWL 3QUXB 1DLFH 3B34A 5IMOB 3DVIA 1RI8A 2CKBB 3WN5B 2YAHA 1I1FA 5F9DC 4AGOA 3MLYL 4Z7QF 3AB0C 4GH7B 1JK9A 1FN4A 2YSWA 1E51A 1A5AA 3W81A 2VB5A 3KPSA 2H3DA 3PPGA 5T1LB 3SY6A 2YARA 5ICZB 4K94C 4LL1A 1ZSHA 2ZAIA 3MS8A 4NFCA 5DFWH 2H1PH 4PGZA 1VIWA 3LSBA 2NLJB 2ISSA 4QKTA 4HLJA 1J9QA 1ZRUA 1LZOA 4XNZC 1L0PA 4W9IC 3DTXB 4WNQB 2WMGA 4BUGA 4Y5XA 4IBVA 4QIRA 3RWGA 3Q44A 2RHGA 3AADB 1GVFA 4Y4KC 3E6HA 3KPSE 4H01A 1JOIA 1QR4A 3MJ7A 4DBUA 4DFHA 4U1HA 5IUSA 2O55A 1R5YA 3WJJC 3SYCA 1KRAC 4HZ7A 2PC4A 3DRTA 2I60L 1JQVA 1C92A 3QPQD 4C6QA 1FNAA 1ZVNA 5D7JA 2WO5A 1EDHA 2Q7NA 4GB9A 5F7AA 4IZGA 2IOOA 2PCEA 1S9VA 1DLHB 3UYRL 6CGTA 3F7KA 4XBMA 3N1PC 2OZ4L 3S83A 4NRSA 4YVUA 1NWUA 3DHFA 4LAZA 3K6IA 1LE5B 2DH2A 4M29A 4Y2OB 3TXZA 4B16A 2DQHH 3R25A 4GZ7A 2CZFA 2Z4GA 3EOUA 2I27N 1S7SB 3G6DL 2Z31D 3RTQC 1A7OH 4KRMB 1Y5XA 4OECA 2I24N 2DWEA 1R3LB 4ELKB 4K15A 4B95C 1F6YA 4QR7A 3LHZA 1X7IA 1NSNH 4NFBA 2AI0L 2QHRL 4MS6A 2XIOA 1E4XH 5PAZA 3CAWA 4UILL 2PDNA 3GZQA 2Q01A 1FOBA 1CVRA 2QCEA 3HGJA 1U8MA 3DBXA 1SOQA 1Q45A 4ORIA 4BSVA 3W84A 3MLVH 2NLYA 3NG5A 1JGEB 5ECGA 2ETWA 2V5RA 2B77A 2WXNA 3NYDA 3PTQA 3QR3A 1EWDA 3RCYA 2VDQB 3FOMA 4G11A 2IDUA 2XPZA 3FU3A 5K69A 4AD2A 4HUUA 4JO2H 5KSAD 3O45B 3IAGC 1ETZA 2ED8A 2FEDC 3B2VH 4AGMA 2W65B 5IGXL 3V6OA 2Y06H 3WTWA 1KDIA 3GNML 4PMUA 5E00B 3JS3A 2P0IA 3VD3A 5DEGA 3S3GA 2QSVA 3LNPA 3AITA 1CD8A 4YL9A 3EXTA 2GI7A 2QVTA 5ICUA 3SDXF 4H25B 1DVSA 1YMYA 1D6EA 3MMDA 4DM1A 2VYOA 2PCYA 4MDOA 4W9CC 4OCMC 5F93C 4MY1A 1WV7T 1J88A 3OWEA 3PBUA 1F4WL 5B21A 1C90A 4C7GA 1NSJA 3SY0A 3ILQC 4FI4A 4WW2B 3QA3A 5B7FA 2WP3T 3I02A 4P59H 1Q3NA 3VWKA 1RJPA 1O95A 3G1YA 2DF3A 4F8TA 1YXDA 3KWTA 4DP7X 3GWQA 4AUBA 4TULH 4I9AA 1I8LC 5FYJE 2BP8A 4NOBA 3Q01A 3EBGA 3CSYA 3BE1L 1AYRA 2PGEA 4MJIA 2YAMA 1IE4A 2P8CA 4HXAL 3U79A 4HFUL 3BVNB 3FKKA 3FB8A 3TBYA 1DBJH 3GSVA 4I1NB 1A02N 2OZ8A 4UB0H 4IRJD 1XLGA 2JKJA 4A3HA 1JGMA 3HHSA 1PFCA 3RJYA 4E9YA 4UT7H 4NZUL 3PWIA 4MJ6B 4AUYA 2WW5A 4GBXC 5HGBB 4Y90A 1PZ3A 5H8UA 3W2KA 4L5FH 3RL2A 1NP2A 3G08B 4MJIE 5KYUA 4O0QA 4JZ5A 5CJXA 5CZSA 3DOIA 2PP0A 3BEWB 5HULA 1J2WA 3RX8A 4E5XG 3UACA 1KRMA 3S47A 4OCRH 1QSED 3X3FH 3VX0A 4JFWA 4JIHA 3ZYZA 2VLJD 2ZKHH 2UVFA 5AENA 2NY0D 2AZAA 2NLIA 1AZ1A 3RL1A 4R3SA 3VFUA 1I8KA 4A39A 4X2PA 4UU9B 3VVWA 3TIMA 5AHEA 5K4XA 4K38A 3T4AB 4X5XA 4ICMA 2EC8A 1MSSA 4ONFL 3H7BB 1IGCL 4RMQA 3CIVA 4CD5A 1YY9D 2Z31B 3TA4D 5E6IA 4GMEA 4GRLD 2P24B 1TCRA 3U0WL 1XCXA 4C57C 1H1YA 4OT1H 3CFCH 1TQUA 3EOAB 3MLRH 1T1YA 1Q1JH 4BE5A 4D6FA 5HGAB 1JCVA 1IXPA 3QEQE 1I9EA 4MLIA 5DUML 4PG9A 3LZLA 2JQMA 1ESWA 2QCHA 3MAWA 2EPHA 3VGDA 3FFDA 3IJ6A 4FQHB 4W8LA 5EFDA 4HBKA 2V7HB 3LEXB 4E5XA 4EN3B 5GGRY 1RIUL 1TVDA 5TGBA 3NJLA 5MENB 3VW3L 3VA6A 3OX8A 2OTUB 1OCQA 5AW2B 1TJHH 4OR1A 2BSTB 1KGXA 1UP0A 4UF7C 5F0PB 3V36A 2ADGA 2ZRUA 4L3CB 2EG8A 1P43A 1OKEA 3IRSA 2ZF8A 4KNTA 1BIIA 2UZXA 4Z95L 4QAIA 4HFWA 3LTPA 4P9ML 4UBPC 4XMUA 4DGVH 4F9PC 1YXCA 1DQUA 3UTQB 5B39A 4W86A 1TV7A 4JK0D 4KIEA 3FVDA 4XNYH 4DY1A 2G5BA 3ZE0E 3THML 2O5XL 3C6LA 4QRPD 4LSBA 2YKLH 5H37A 2Q8BL 4X5QA 4NN7C 3FO9B 2EXYC 2JGYA 3L45A 2P43B 2R94A 1KN2H 4LS2A 2AEQL 1IV8A 2YPVH 2QCMA 3NT0A 1PKLA 3DVNA 3TYFB 1SOKA 1N4XL 3CTLA 1QHZA 2BG5A 1E15A 2PYEA 1AZCA 2DIEA 4HD5A 4R96B 3W6LA 4BZ1H 3KBEA 1KYFA 5DUPL 1QASA 1YPZF 2WXJA 3BLOA 2YZRA 2YRPA 5B7ZA 4HT1H 3Q45A 3KCLA 3WH7A 3RIAK 6ALDA 4IRJB 2DQFB 5HPMB 1QZ1A 3ULSA 3B4UA 3SOTA 5B1CA 1ZJBA 4HUMB 2VCCA 2R1XB 3WFDL 5HI4D 4U28A 3GB7B 1AH0A 1YNQA 5C0EA 3N1MC 5CCGE 4XPAL 2X1TA 1E9PA 4BXVA 2XH7A 3W9DB 4G83A 2C26A 3IIVA 3P02A 4X5WA 4MNGA 2FNBA 1XWVA 2PYEE 5E7FA 1SUHA 4BM7A 1KCSL 4Q8VA 6REQA 2EDJA 1BZDA 4Z7NB 5A3IC 2OKMA 4NQED 2G3NA 3G6MA 3GDCA 1W5OA 4PMXA 5C6WH 1QSEB 3WXWL 5B7MA 1A7QH 3FGCB 1MHHB 3G1SA 4N0YH 4X7FC 1XF5B 4DAGH 2VLJB 3QQ0A 4N1CA 3HPJA 2YD4A 2B1OA 1BP3B 4XZ4A 4MNGE 4R3UA 1ZVYA 2ZG3A 3CV1A 1TJIL 1M6JA 1AMXA 4NQXB 4TV6A 1JPDX 3KDOA 4W4OC 4QT5A 1K4GA 3F7YA 2PDJA 4LLUA 4AT6B 3CWHA 3S0PA 4E8DA 2PTVA 3K0WA 4GRLB 2VCAA 4O5LL 1JWUA 4PB4A 5K9JL 1H0DB 3SUSA 1W0YT 3SDOA 5DFVD 1EAOA 1F1AA 4C59B 2OLDA 3SDCD 5A69A 4PULA 3VNYA 1ONEA 3RX5A 1E5BA 4Y5VA 5DN1A 1WAWA 4JN1L 1NDMB 5C0BA 3CBWA 3NNTA 2VIRA 1MWAH 3CB8A 4X9YA 1X5YA 2W1NA 4D2JA 1YMHB 1KTNA 2OCZA 5CLXA 4F8LA 2FLBT 2YXWA 1PY9A 1IWPA 3MTRA 4MCMA 2C14A 2MWCA 4ZTOH 3OHIA 4NC0B 2DSVA 3UTOA 1J8KA 1UR0A 3EFFB 3QULA 3KPNA 3JU2A 4B7LA 3ZJ6A 4HGKC 2H5UA 5BZWB 4P9HL 1AHWB 1WZKA 3P73B 3QEHB 4IPLA 3HNTH 4I90A 1SPQA 4YCOA 1C8PA 1HNYA 1GTEA 4KXZH 5C07D 2PDLA 3NSXA 3LHTA 4AYSA 1ZLPA 1UWGL 2VM3A 5FX3A 2VC5A 5HHVH 3IU3A 2R2HB 1OJXA 5IQMA 2CJSA 1RIHL 1OADA 1UR9A 2COQA 4EXAA 3QPEA 3GX9A 4RLIA 4RWYH 2PD5A 1NDYA 5F2IA 3BAJA 5I1AA 5FUCE 2XI9A 4L3AA 5F7EH 2DPKA 3RGBA 2CO7A 2CM5A 3HPLA 3L4WA 5CP7A 2N59A 2Z4TA 3U8GA 1TYJA 3PZGA 4O4YH 1LROA 3MRLA 5ID1A 1TVPA 1AZZC 1LO2H 3VKDA 3W28A 3OHXA 1MREL 3ARGB 1YMME 4FMFA 1HAUA 5A16A 1D5XB 1XGQB 3F7QA 3WHE1 1S7TB 4LNRB 4LSDA 4QHPA 4UTCA 3O6KH 1S5HA 4HUVA 2ODHA 4HN4A 3ZDXB 4M1DL 1E9QB 4IMGA 3UWEA 2E0PA 3CZKA 3N40F 5IK3A 1XLFA 1K2DB 4GGHA 4AGLA 4BSWB 5JHLA 1L6XA 4RE4A 4YHEA 3KWWB 4OFPA 4P2RA 1OT1A 1V7YA 5KYWA 1PSCA 3BAKA 4KZDL 4NF7A 2YS4A 1MFUA 3L65A 1VAHA 3WE1A 3VFOB 2A74A 3Q8BA 4F7EA 4TLSA 4UTFA 4DJED 4C60A 1MFVA 5CU9A 2AP2A 3W9EA 3ZLGA 3V10A 3VNKA 1AQ8A 4G1EA 4ODTH 1KYAA 1TMHA 3A6CH 1B3YA 5M2FX 5CXPA 3B8DA 2B2XL 1SLWA 4P2RE 2WQDA 1XB3A 2P8BA 3M0LA 2FIRT 2OFQA 4MNQD 1I7ZA 1LRQA 1UD3A 4O10A 3C5SB 1GJWA 4GRWE 2X89A 1FFNA 2XA8H 1ML0A 3EOTL 2W9DH 3UERA 4OLWH 4IGMA 3RO8A 3AT8A 4AYFA 3FSWA 4HZLB 1PLGL 2C9XA 5CO1A 3FQUB 1XH3A 1E4KC 1Y07A 3OPSA 4TL4A 4MIMA 2BRRH 4R2GC 2Y8UA 5I03A 2FSEA 2DV0A 1TTIA 1RURH 4TQTA 3MRNA 1PG7W 4MMZB 3OJGA 4YS1A 4F3HA 4J3OG 4XPBL 2XWCA 3HVNA 2OSWA 2J27A 1GA2A 1FBAA 5I28A 5JYMA 4QWWD 3LZQA 2YR3A 1VESA 2G4JA 3II3A 1SJCA 3K2UH 4ZAKD 1MCHA 2WXLA 5I6LA 1LO4H 2YAOA 1KR1A 5AYYA 4Y96A 1KJ2H 2E7BA 4ZZ9A 5F44A 1SFSA 1A6PA 3CPLA 3S3SA 5GGTL 4BEUA 1RU9L 2VDRB 3RI5F 4S1SL 2PXYB 1IC4H 2Y1VA 3G5ZA 5IHUL 4U3SB 2E09A 3PWJA 4YDKH 4JM2A 1PKNA 5L2JB 2FYYA 2DD8H 3D0VB 3D0LB 4JFDA 4YTUA 2A4EA 3PLYA 1OM3L 4PVMA 4IPIA 3V4PA 2HT4D 4AQ1B 2R2CA 1OEPA 2E6QA 4I3GA 5F3BB 1KT2B 4YHPB 5M03A 4K7FB 4BFEA 1J1XL 4AQEA 2UXVA 3I7QA 4PY7A 2D9CA 5GGUA 4FB7A 5IV2B 5KANG 4Q9RH 1N59A 4P4KB 1H62A 1W5PA 1JP5A 1T1WA 1CFMA 5FESA 2GC7C 5DFAA 4QG9A 3MFFA 3QCVL 4BQ5A 4ZX4A 4LOCA 5BOEA 4JFDE 2WN2A 4R7XA 3T2OA 2EUWA 3P0WA 1U8NA 4HSNA 1U4EA 1PCKA 5E70A 1INQB 3ZE0F 2WOYA 3AIRA 2QVNA 3RUGB 3A6BH 3N2XA 1XH0A 1BFNA 3APDA 4Z6AT 3B9DA 2GSMB 3ZTEA 3NIDB 2IBZX 1IGJB 5D70H 2PFHA 4B9CA 4YDJA 2EVHA 4ZZFA 5DHVB 2QJHA 1HP4A 4XZMX 3ES6B 3REWA 1OQXA 4GKSB 2P47B 3PABA 5HHNA 1XFBA 3NJVA 2N1KA 5BRZB 5DA0B 3EKLA 3SYPA 2W63A 3KBPA 4LF3B 1XDJA 3E80A 4UM8B 4DEFA 5F7NC 1AFVH 4E2VA 1NC2A 4DN4L 5AB2A 3PF2A 1U5JA 1M1BA 1JI2A 1MW0A 1E6JL 4FFZA 3UF9A 3UA3A 2O5ZL 1J0HA 1LO3H 3KPLA 4H8VA 5KW9H 1I8MA 4GAYA 4AQAB 2ZYIA 1QXLA 3CXFA 4FG0A 4XGZB 2WMFA 3SQBB 1CLZL 3H6OA 4MNQB 4X4KA 3IN0A 3FB5A 1YKWA 1LUCB 4UFHA 2A1WL 4CEXC 4HC1H 3KMDA 2ADYA 3LY0A 3C0SA 4GQGA 4PMQA 5ESQA 4JD4A 2VN6A 1SYTA 3W23A 1HCZA 1RHHA 3M45A 2XJLA 2YPIA 3U36B 2KHAA 4MG4A 1GGYA 1S9WB 3MBEA 1Q6EA 1IM9A 1RMFL 4CGTA 2C9UA 2PWHA 3FH5A 3FA3A 1XBXA 2YOCA 4NKDA 3DZ1A 3H9SB 3BLDA 4UWMA 12E8L 4F7TA 4PJDA 3C0LA 4KK5D 3QTGA 4PCYA 2IXVA 1VFFA 3RRXA 1OHZA 3FL7A 43CAB 1F2QA 2G37A 2WWMC 5GS2D 1OTTC 2YD7A 4KKZA 4A2RA 3NJKA 2EPKX 5D7SH 4WW2C 3M16A 1M1XA 2PO6A 3T0BA 1OG6A 1QNPA 2WKOA 2C3XA 3KM1A 2F1EA 1XUZA 1RP8A 1HXYB 1J0JA 4PJDE 4GIPD 5K1JA 1K7FA 3DUGA 2O61B 3W37A 2AKZA 3OAZK 4Z1DA 1XAKA 4JY4B 2W0FB 3GUTB 5T3ZE 4BKNA 3S48A 1JGLL 2DQEL 2NY7L 5D9NA 3JWNH 5HI3D 3AY4C 3AB0B 2WLIB 3MJ8A 2Y63A 2C3ZA 5FHAH 2D3JA 5DD5L 1GPOH 2BDQA 1HK6A 1BGXH 4RE3A 1IIGA 1V3KA 1CFTB 2P42B 5F21B 1AI1H 3AY2A 1M6UA 3OEXA 1XBZA 3R1GH 1LK3L 2BLEA 1O6SA 1HHKA 2OJEB 3SUWA 4HEPA 5HR7A 4GBXD 3ZBMA 4PLNC 2DJMA 2D69A 3QZBA 1RULH 3BSGA 2GFTA 5SWZA 2FZ8A 4NZ4A 3BWAB 4B5UA 4GP4B 1A8JH 2B15A 4JVWA 4K3JL 3QPQC 2CMRH 4Y4KB 1CDUA 4R7NB 2VDOH 3UBPC 3OSVA 1D5RA 1SJHA 5IQ7L 1ECYA 4ZW6A 4ALDA 3QUMH 1AMYA 4JTIA 4BI7A 1S7RA 2XSKA 3JZYA 4LWWA 3WD2A 3OB0K 1E2ZA 3T4AC 5SWZE 4XNXH 4B3VA 1DXEA 3IKKA 4I9MA 4BD4A 4RGNE 4AWSA 5DJZA 3FFCA 5DANA 3AGWA 1WUZA 4P5UA 4DKTA 3OLEA 3W7JA 5I1EH 2J13A 4PP1D 4C1LA 2AXFB 3QWOA 3GYRA 1GW6A 3MANA 5LWYH 2YD5A 3MCMA 3V55A 3LNIA 4LPTA 3A67H 3IVKB 4L18A 4LDLB 1OGGA 4O02B 3KOXA 3HM7A 2YBTA 1L6ZA 2E9IA 3QDGB 4D8OA 1BFOA 1GW9A 1RUML 4IKNA 2XXGA 3FFCE 2I07A 1EQCA 4TOQA 1QAPA 1RP9A 1XPYA 4HJWA 1XGYH 2QQLH 2B1HH 3PWPA 2CC0A 1DV7A 5DMKB 2VXUH 5I15H 1ETA1 3FQWA 1JTPA 5KSAC 5I79A 2AV7A 1A9VA 1FPTH 4LNCA 5DRWB 1M7XA 5LCVA 1SR0A 2Y7QA 3QLLA 2WIIB 1EAQA 5FL0A 1LL7A 3QI9A 3QGVA 1MNSA 2ERJC 2FB3A 1DVQA 1L6SA 4Z1AA 5FC9A 1H51A 2Y69B 2GABA 3GG8A 1CGXA 2H8PB 4PS3A 1NGZB 4G9DB 5AG9A 1FH5L 4G7SB 1KFAL 2VUYA 5H1WA 1O6IA 3QWNA 1K5WA 1PYMA 4M8QA 3K91A 1QNZH 2FQFA 2WVVA 4LCRA 5ID0A 3F62A 2AF2A 3PAJA 2R29L 1V5JA 4DZBA 3N6YA 4PMNA 5LHEA 4KVNH 3KFTA 2XTKA 4JKMA 4PJ9A 4DETA 1INDH 3L81A 3DVGB 2CBJA 2AHIA 3LXAA 1LDPH 4GIOA 3WY1A 5E9DD 2XZ7A 3N2MA 4BFIB 4Q22A 1R24B 2ZDRA 2DORA 3O9WA 3SCSA 1TJGH 4PJ8A 4IRJC 3I2CL 3OZLA 2ZOLA 3QOMA 1JJUA 4ZMYA 1QW9A 4ANXA 5CILH 1CPUA 1WFJA 2C3WA 5FOOA 4W4NA 3AU2A 2DMGA 1NEUA 3MO7A 3T0AA 4DYKA 4IQHA 2X9YA 3ZHKA 3FB6B 2E9BA 3ITGA 1XIEA 4QLLA 4OF5A 1MNNA 5I23A 1FIEA 1S7XB 1PDKA 1E9YB 1INEH 1S8DB 1CVSC 1F18A 1DIKA 4QE4A 1RY7B 1YEIH 4GBXB 2XBZA 2PRLA 3QWRD 3V5KA 4WWKA 4HHPA 4X7SL 3LPGA 3DGBA 1U8JA 4JICA 7XIMA 5MKGB 3FUEA 4WNJA 4FAAB 1F3JA 3ZXWA 4B2DA 4XP9H 4HPGA 5A8NA 1RL1A 2NY0C 4JM2F 1BLNA 4YO0B 2EYRB 4O2FA 5JORB 4L4JA 2V0AA 4MMXA 1BA9A 1NJ9B 2EUZA 4HNVA 4RFEA 1FH9A 3S5NA 3QARA 5T1MA 3M64A 4W5UA 4EUPB 2VR5A 5HVFB 5FEWA 1I1WA 1N82A 3VIFA 2JEQA 3CHEA 1BW8A 5FL1A 5REQA 3BZJA 1BJ8A 3QR0A 1LM1A 1C3FA 1M6OA 1E70M 1G7JA 3OGRA 2V3EA 3NH7L 2UV3A 3V16A 4LANA 3V75A 1X8FA 4ONOA 2UZIL 4NRXB 4OFYA 5DZ9A 5BJTB 5D4JA 1SF3A 2BVPA 2Q7YB 5G5IA 3QEUB 4OFVA 1FCQA 4F7MB 1ISXA 3T3MB 5GJSL 4BFOA 3W5MA 3FXGA 4M4RB 2OLSA 1FNFA 4HCRL 4WEEA 4DZ8A 5HYJD 4AD3A 2ATPB 4JS7A 4JTAA 4HJTA 3IJ7A 2O5NA 1QWNA 4FXFA 2XCMC 1WAAA 3VC6A 3MUUA 3DX7A 3R8GA 4OVVA 3RG1C 4AEHL 1XW8A 4KQ4H 4Y0GA 3AXIA 4TVSa 5KSUB 3U2CA 1HH6A 4JANA 5SX4H 1K9TA 1YYAA 4WRHA 5TH2B 5FF2A 5I66A 2QSTA 3N15A 1WCGA 4FE9A 4P2OA 4MHHG 3MO4A 2AXJA 4YPGA 4ZSOA 3S1UA 2BVDA 1A2YB 4ZQKA 5IJBC 4NT6A 2R0WH 1CECA 2HV5A 4H0LC 2IUZA 2XTLA 2ZJSL 1P6AB 2LU7A 1X5IA 2J88H 5CWSB 4CSZA 1EZLA 1G1CA 3AVEA 2A2IA 2A9DA 2GUUA 3V1PA 1IAOB 5E9DB 3R8QA 3O3BB 4C56D 1WK0A 3R06B 3WLLA 2JJSA 2ESVD 4FAMA 3OL2A 1MZRA 4HA0A 2BWDA 4H9MA 2DWXA 3OQ3B 3S5LG 5E5MB 1MH5B 1I2PA 2IS7A 4WWID 5HI4C 2XWXA 4JE0A 3K5RA 3CS2A 1G6RB 2OX5A 3AQZA 1FH8A 2OYPA 1DUYB 3DMMA 1E1FA 1FWHC 4FNQA 3MRRA 4DJDD 3I6GB 1BRLB 2VX6A 4EPDC 3O11B 3WBYA 3T0XA 4UM9B 3NA9L 1W0VB 4PJDF 1G9ML 3O3DA 1NCWH 3DWTA 2GQ3A 2IQDA 4DN3H 5E4AA 4PJFA 4HVXA 3AHYA 5JXAL 4AM0B 2A0LD 4DLFA 4FMKA 2QR6A 1DQTA 4QTFA 2QGEA 1JPTL 3VNZA 2NSMA 1A66A 2Y07H 3LKPA 3IGHX 2GWNA 2WKOF 2YJQA 4YQXH 2YL8A 2VL5A 2HXAA 1JN6B 2Z4QA 2ACRA 2NV2A 4JTHA 4Z18A 2PCPA 3NGBC 2E1WA 3MV7D 2ANUA 3BAYA 4GSDL 4PHZA 1H7XA 4HJEA 3S5LA 4PJAA 4LSTH 4BFGA 3IWPA 1IUZA 1F3WA 4PCSA 4MYAA 2JJVA 3MUHL 1LYQA 4GQZA 4UMAA 4O13A 5DVNA 1HWGB 4FF5A 5DBUA 5GGRB 3PK7A 1LK2A 4M7KL 2CK2A 5DFVC 1NAMB 3OJVC 4LUJA 3PS7A 3SDCC 1TVBB 3VH8G 3OKOB 4OB5L 4I77H 2E6DA 5TQ0L 1IEAB 5EOCH 3TA3C 4MNLA 3MOAH 3DXIA 5EF3A 2HN7A 1I2OA 4Q6IA 4DNMA 4PJAE 4X4XB 1ZE3C 3UP8A 3CQ0A 2FRGP 2VJ8A 2IEPA 2F58H 3FT3A 3AWNA 4Q4MA 3GC2A 3MZ2A 4U1KA 2YAEA 3IMBA 5AVTB 3HS0B 4BZ2L 2HP4A 1NMBL 5ABTA 5A2IH 1IR1A 3UGVA 4N0FB 5F6IB 2F08A 1FE8H 4FZEL 1VGKB 3PTMA 5T3XE 3IIZA 4D8ZA 5AKQA 4C90A 1MCJA 2VAJA 1OCJA 5IOPA 4H0IA 3CDGA 3GSRA 3C4UA 4EPEC 4EF9A 3VH8A 5KVFE 1FV1B 4B5ZA 2J6EH 5D9SA 3QW4B 1EDTA 4N87A 3HC0A 3JVAA 1T5WB 2Q6ZA 2BSLA 3CHOA 3PAUA 1UUMA 1I85C 4N2AA 3CMOL 3NCJL 5JPMA 1ZUAX 2DL9A 3W7HA 2IDQA 5I1CL 2DSZA 4DPBX 2DJXA 3UG5A 4C4UA 3IAQA 2B81A 2OQLA 1NKGA 3AAMA 2DQUL 4TLTA 3GO1L 2J20A 3LV3B 3GBNL 3KYAA 4WUUB 3A5FA 5FA4B 4ZQPA 4H20H 1KLGA 2EXSA 4IHCA 1EJXC 3LS4L 1JCXA 1FNLA 1P4LB 2CKNA 3U3HA 1RJZA 2WLJA 1MCOH 2VLLA 3L3GB 3EH2A 4TTDD 3RVVC 5D4QA 3UJJH 5DMIH 2ITDA 4PY8J 1EA9C 4GYKA 3LCXA 4Z8FH 1CS6A 3TNMB 1F73A 2J66A 3RJOA 3KYNB 3VB9A 4U6XB 1WX0A 1O9VA 1BAWA 5I1LA 3THCA 1TG8A 5T5FL 3VZXA 1VCGA 4TQEH 4PFEA 3S35X 1A1OB 5C2CA 4DJEC 4TVPL 2AQSA 3BP5A 4LKCA 5CEZD 1EJSC 1XVSA 1XCTB 3W3OA 1KBWA 2ICCA 4OLVH 1BD2E 3X12B 4FHJA 1O1ZA 1SYSA 4TV5A 8PAZA 2DRUA 1W72L 2CHZA 1IBZA 4GUFA 3NJFA 2QT6A 1S2UA 1ZTVA 4C6JA 3U9WA 1BZQK 3ABOA 4KFOA 5F7DB 5CPOA 2D31A 3V5DA 4DP6X 5IBLD 4JFFA 2ZUNA 3L54A 3MP5A 2ICWA 1NWTA 1J5CA 3N43B 1B4EA 2X53A 1QOKA 3WS6A 2DQMA 2JB6A 1KB5H 3FQ1A 4RE2A 3SGDH 5EDXA 4KK6D 3PPEA 1N68A 1U58B 3OKNA 1JNNH 2BDNL 4DSYA 5KOMC 4R2GB 4QWWC 3L3IB 3MUGA 1M2VB 4JX5A 3TEVA 4FKEA 3OG3A 1RLCL 2VZ3A 4L6OA 4ZAKC 5JPNA 4H7ZA 3BQ6A 1P53A 1E5NA 4M0XA 4JFFE 3DRQA 4CNTA 2J8FA 1E50A 4AYID 4D72A 3KBFA 5EZIL 5HYIA 4G3YL 5C86A 4DKEL 2Y88A 3B3DA 2ADJA 1U1UA 4GT0A 3BLKA 4YJZL 2DH3A 2FATL 1E5JA 2AVFA 1N2RB 1J5HA 5GGQH 3AXMA 1QPPA 3HPZA 3OD3A 3M9YA 4DPCX 5BOPA 2HT4C 2K3HA 5FK9B 2X1PA 2Y2WA 2NUYA 2FJGB 3LQZA 4I5XA 1KV7A 3DFQA 4QHKJ 2F74B 2V5JA 1IGFL 4Z08A 1HINH 4BRJA 3CZNA 5HQMA 5HUOA 3OXSA 5L4MA 2JKTM 4JJ5A 3Q94A 3T6VA 3PXHA 1J6PA 2Z1PA 5C0JB 4ZW5A 4EE2A 4XCCH 4TQIA 4LKXA 3DOHA 3WLJA 5JIPA 3TX4A 4M8UA 5SWSA 1CLKA 3MLTA 1WDRA 1U8LA 3LZ3A 5HYFA 1YPFA 3TW9A 1KFLA 3U9PL 2VLRB 2VLKA 2WBXA 3C6CA 1G0DA 3ECBB 4OLYH 3ZUNC 2X4TB 2E67A 4LASL 3AACA 4WK0B 4HK7A 1VCAA 3THAA 3PREA 2JKXA 1KW1A 1I8IA 1DWGM 4ZFGL 4M9PA 1P2CA 2E4TA 4UINL 2GJLA 1WAAF 2FHFA 3FF8A 2JIXB 3IPEA 5SWSE 4XVUC 3IK4A 4S39A 4IU2B 3KR3H 3VX1A 1MIEL 3T09A 3WFCH 3GMOA 2FAUA 3JWOH 2VLKE 4PGDB 4MSSA 1NL0L 2EJAA 1HTYA 3QQ4B 1SN0A 5JQ6H 2DEXX 4MOZA 4UTMA 3URBA 4AIOA 3WIAA 4IEFB 5C8JA 4A8NA 1EJWC 4YXGA 4KPHH 5E6YA 4L0YA 1AS6A 2IV9A 4BUHA 1T83A 1OY3B 2XSXA 3CAQA 2YK1L 1KB9K 4M03A 5AOKA 3O2LA 4OTKA 1H5BA 3IE9A 4P5MA 4IRZA 1ZANH 3PWUA 3DFNA 4L37A 4F2BA 4XO8A 2J77A 4XKYB 3L5WA 3ASNB 4JPIB 5CSUA 2B4CC 3LKRB 5J1AB 4ZMAT 4LUSB 4U0QB 5EFIB 4ISVB 4ODSL 4MCYB 3N6JA 3GQYA 4H41A 4HIJA 3MCG1 4U3CA 2C34A 4KZEH 4TUJB 4C6PA 2CUAA 2PLJA 1O12A 1P5VA 3NFSL 4MDRA 4H88L 4PJFF 3L9BA 3U4BH 4NUPA 4TOYL 4KK5C 2PURA 4NSKB 2WZPD 3U1SH 2VDNH 2YX0A 5IBXC 3QQ3A 2WANA 1K1DA 4Z77B 3VFVA 3VXNB 4WKZB 4JHWL 1CURA 4Z7UB 2XZQL 5DJ8B 1HTIA 2G60H 3VI3A 3HLKA 4PGJA 4CU8A 1D5MB 3LGEA 3INOA 3VXSB 4PJAF 3M1ZA 3W83A 4DELA 1XI3A 3K13A 5A8MA 5AVVB 1QI0A 3IJSA 2QFPA 3DIPA 3KGSA 3GFUA 1GOQA 1ZSXA 3L21A 3ULUL 4PJ7A 4QHMB 2CCRA 4NP9A 2XN9E 1XDMA 3DO3A 6ENLA 3CSTA 1XBYA 1ITQA 1EXPA 5HI3C 3IANA 1T2JA 3VI3E 4LGXA 4F9JA 2OJ1A 3OIHA 1PNCA 2BRQA 3UROR 2AL2A 1F02I 1NDGA 3W82A 1KEGL 1UR8A 3UR8A 3EWDA 4MZ2A 4K7VA 1HCVA 1JWSA 2OR2A 2QJDA 4MZYA 3KTXA 1VQTA 3PSWA 1SFHA 2R56L 4PJ7E 3VNMA 5CSBA 3IMWA 1JFXA 3WNMA 1H9DA 3KPRD 3IRCA 5CD5C 1KCKA 2O9TA 1MRDH 5KVDH 1EH9A 3DHMA 3D05A 1OAKL 4F7CA 1A7NL 3HV9A 1R5VA 1QFUH 1UWUA 3MZGB 2FBJL 1POJA 3BEVB 1UZ8B 1FORL 2X3AA 3LEVL 3GT6A 2MNRA 1JNHB 3EX1A 3QEQA 2Z92A 1LNUB 3NIGB 1IBGL 4IMKC 2W94A 4XOAA 3RWDA 1F4HA 4R7LA 2BGNE 1E9ZB 2Y7DA 4PB5A 1QZNA 5FA3A 1NUGA 4PP1C 2PTYA 1UZ1A 1PUDA 4D0DA 1DE4B 3BT0A 3CVHL 3U2EA 1BYBA 1NFIB 1ZHNA 2I7SA 2VLMD 3VXOA 3MYOA 5B39G 4FNLH 5AHIA 2KPNA 3QJZA 1K5NA 3MTXA 1FHLA 4QXWA 5EZLA 2R59A 4DGWC 1LDCA 3ZN6A 4JTFA 4OIAA 3FTYA 4AMKL 5H37G 1WB0A 3UTTD 3HBPA 4WHTA 1A8ZA 3FCUB 2PDWA 5B80A 2VKXA 1XC6A 5HGHA 1CLCA 5D2XA 4LBSA 3TKFA 1UXMA 3T77B 2CQVA 4HIHA 1T7YA 4KO7A 3U4EA 5DXXA 2J8HA 2Z3FA 1C7SA 2G95A 4KCWA 5KSAB 4AWEA 5SX5K 2F6UA 4E0CA 4HLZG 1BWKA 3ZTCC 1S5TA 3UBXA 3IDXL 1CE6A 1YQVL 4RDYA 3AISA 3AXKA 1TJMA 2A7RA 3QHZL 4YSAA 4KCVA 3K2IA 4IQDA 2WQXA 2ERJB 3JTTA 2F7FA 5DEJA 3AWFA 3B8SA 1U91B 4HOXA 2F53D 3QFJA 2AJVH 2NPLX 1GEHA 3T6CA 2YZ1A 4GIYA 3RVWC 5TDOA 5EBWA 1UIOA 3MBDA 4PJIA 5FAJA 2FIKB 2VVNA 4GYJA 1HIMH 4U1MB 1JZFA 2XG9A 1WF5A 4HCGA 3L1OH 4HXBH 1M68A 1L9OA 1D5ZB 5HAOA 1Y0LB 2XFRA 5CZKA 3V0FA 4KFPA 5D6DC 3QFJE 3Q6GH 4UQDA 1IGIH 4F2FA 1XBVA 3ZWSA 5BOJA 4PCKA 3UO8B 2G5RA 5DSCB 2XWEA 4UOZA 4BQCA 5EEYA 1TPFA 1PCXA 4PJIE 3G1AA 4FR6A 3CYVA 1WVZA 5TQ2H 3IXAA 2QVMA 4M3KB 1K8IA 3S9YA 3MRBA 5IM7B 1A6UL 3OXRB 3AHTA 3KPRB 2A6JA 4JQXA 4YHKH 1ZXQA 1WWBX 3WFEL 1ZGLP 3DGRA 3D7PA 3OB0H 1UXSB 5LBSL 3HI6H 1TPUA 5F3FA 4CU7A 4XC1L 3KGTA 1YC7A 1BX2B 1BVNT 3HZYB 5I76B 4FXKA 3EB4A 4M6MH 5CPTA 3A3WA 2YXOA 4N2BA 1WQ5A 3RRAA 1Q6QA 1B4TA 3CQPA 4DH2A 5I1DB 2GEEA 1F42A 2NY0B 1TU2B 1KCWA 4AX3A 2XZCH 4YHIA 5AC5A 3OYXA 4S23A 1WFOA 2RJHA 1H3PH 2RGLA 1QFOA 1US3A 3SYOA 1ODZA 4X0KA 5T91A 4L4VD 4WK4B 2NDGA 3V6FA 2GTWB 4TKWA 4F92B 1L6YA 1UG9A 4LCCC 4L1HA 4XAKE 4DGYL 3N1AA 4AOFA 3TA3D 2ZX7A 3ZDYB 2NT0A 3DIFB 4ZMGA 3UTTB 1RZJH 2A5HA 3HS0C 1DUZB 3FSZA 3KH4A 1F6AA 3NTCL 3QO0A 1AGFB 1NIFA 5F6IC 5JBFA 3K8KA 3DV6B 4HUWB 3TF4A 3KAOA 4KNSA 3RHWF 1KIPA 1HQTA 3FYOA 1DSFH 1UB6A 2VEPA 5H4ZA 5CCHE 3MYZA 1DFBH 43C9A 1OK0A 1OY0A 5I6MA 4BK4A 1OO2A 5EL1A 1R8LA 3W2JA 4D1JA 2UXGA 4L4MA 3O15A 4H5SA 4H1LH 3CHVA 5I0VA 1EFXD 4LXFA 1SY6H 4K7PX 5JUVA 4U7KA 4C54A 4UUJB 2RDWA 1EGJH 3N4EA 2GTZA 4IGBD 1KM1A 5A7EA 2CO2A 2Z7ZA 2F53B 1LG1A 3DFPA 5EWIL 1II4E 2AMUA 2E7LC 4QRPB 3APYA 5KN5A 1YMMA 4AMAA 5TNVA 1ZS2A 4CCZA 1KCUL 5IW6B 4GVHA 1DBAL 4W9ZA 4FOUA 1BVKB 4LVHB 1AGEB 2VX4A 4EI6A 1Z0MA 1J18A 4IQJA 1KN4H 1JFHA 5KZDA 1BVLB 5DLCA 2EVGA 3H7VA 3CHPA 1IEQA 4YSRA 4DUOA 1MEXL 3C87A 3T6WA 3B9VA 4G5DA 2J56A 5DY3A 2DYSB 1GRWA 1YPIA 1X7QB 4BA0A 4FERA 5AHLA 3STZB 2MCAA 2P3ZA 4PVLA 8FABB 4ODUA 5TTRA 4ZMLA 5JOPD 4DJDC 4R0LC 3WLQA 4UT9H 4LB4A 4ANUA 3MX0A 4Q6XA 4XZUB 3TT1L 3T42A 1I31A 3R11A 3OGOE 3T9WA 2FT7A 3E8VA 3SPGA 4Y9AA 1LWRA 1HX0A 4YVXA 7A3HA 1TITA 4X8CA 3ZZQA 2K9FB 2A0LC 3RVVD 2C6QA 3H3KA 3HOJA 5D2NC 1KFKA 2GBAA 4LZKA 4OUEA 3TX9A 35C8H 5GRJH 5GNYA 2JKWA 3VI3F 4NQEB 1CF1A 4Y2LA 3KDNA 1E43A 4NAEB 1ZT4A 5CZVL 1C7TA 2VEKA 3ESMA 3A9BA 2R0LH 4DCQA 5DMNA 1DVXA 4XUYA 1MCBA 2X1IA 2YC1B 3V6ZB 4PJ7F 1AMKA 2C9QA 3AG2B 3NGBB 2CHXA 1THFD 1IQDB 4KH9A 5EIIB 4JTJA 1LXMA 4G42B 2WO2B 5DCDA 5IROA 2WUBL 3WLBA 3MRQB 1X5ZA 1CQKA 2DJ4A 3OKYA 4L4VB 2ZA2A 1FVDA 4J1UB 1OL0A 3GVRA 3WL9A 2WLHA 2ZWSA 3OZ9L 1S1PA 2BM3A 3GIPA 4YSSA 3SDCB 4L9XA 5IFPA 2HSAA 3OKLA 5IW1B 1ZEAL 3TA3B 1M4KA 3EYSL 1NLDL 4XK2A 4QXGL 3J27A 3WCZA 2WC4A 2WXFA 5IHZA 4BF7A 3LM3A 4Z7WB 4HD9A 4JPVL 3F12A 4XBEL 3SE9L 3C0QA 1RAKA 3QXTA 2F8VA 5D7KD 1NDTA 1Q9KA 4NCC2 2NSXA 5I1IL 4PTMA 3D1MC 3SPVA 1IM3A 5ES4B 4Q8PA 5LQBL 4K5MA 2FX9L 3SN0A 3MT1A 1MRFL 3SDYH 4TLUA 1B54A 4TSBL 1EFXB 1MW1A 3EJQA 1WDDA 2XZZA 5AWNH 4B5TA 1X9RA 1WWWX 3JZEA 5LXGL 3M43A 5C07B 2C5DC 4IGBB 4JN2A 1YEHH 4WY7L 5IB1A 2O9OA 2BVWA 4WKFA 3TA6A 3MREA 5D6CA 4HG4K 1A6AB 1W8NA 5T1DH 2BS9A 1FZOB 3IJYA 3TPUB 2DLTA 4N8PA 1RQEA 4AENB 5E2WH 1OSPH 5I3KA 5DQDH 2LU5A 5HJLA 3RNKB 4V28A 5LNDA 5F3HB 3LH2H 4M5PA 3SKMB 2V5TA 5EMLA 4AZ8A 2XH0A 2L7UA 4JQ3A 4JG0L 2C79A 3IGUA 1BSLA 2GDQA 1NCTA 1RUKH 4IMLB 1IFRA 1Q7ZA 1QWGA 1BOGB 3NL6A 3UIZA 4IHOA 4FHKA 5TK4A 4XVTH 2HKAA 3SD2A 4TTDC 1KCVH 4PYHA 4YU1A 5MEQA 4P05A 5DC2A 1ZCOA 5EU4B 3ESOA 3MUJA 2RR3A 3VWJD 2CLOA 4YEEA 2CHWA 1KC7A 1UJPA 4XVUD 4F20A 3FUHA 4XTIA 5JBEA 4X80H 1CK0H 2QTVA 1WLHA 5TIMA 3HG1D 1XLCA 3PHQA 2CETA 5TD4A 4X5LA 3W57A 4YWGL 3O8XA 4ODWA 2HWZH 1MAJA 1HDMA 4NKOA 1BG4A 4H7VA 4NQSB 2OJZH 1S2CA 4PJIF 2HK0A 4ORZC 1PL9A 1O7VA 3L4XA 2W81C 3V5HB 4M48L 3HBZA 2YMTA 3UWVA 3FO0L 2Z6JA 3P11L 3PHSA 1GGBH 4DT2A 2BIIA 3O6LH 4OQTL 4GBDA 1OC5A 3BG9A 5IBLC 3CZFA 5DK0B 4Z5RA 4WHDA 2UY5A 3RNDA 2G5UA 1HJXA 3TSDA 4QJ5B 3BUPA 1H8SA 4NJHA 4ZRGA 4D8PB 1UM4L 1MEHA 1QO3A 1TNMA 3EWXA 2WAGA 1CMOA 1R3IL 2VDMH 3VYNA 4KK6C 3ZL2A 4HIEA 1PO9A 2OXGA 2YQBA 4L9LA 1E0WA 1FUNA 2AS5M 4GIRA 3TT3L 1GC1L 3WD1A 3PG8A 4HJFA 1FCVA 4LAQL 3LS9A 2FECL 3Q8CA 3VE0B 4D8LA 1JULA 3O6YX 1TQTA 3G1HA 2PF0A 1Q5MA 1V7NH 3ETBF 4JEQA 4BWUA 1KJ3H 1QU4A 3V0WH 4ZAKB 4EWND 1BQ5A 3CFJB 5FCUH 1PZUB 1KTCA 4Y8DC 3JQOB 4GCAA 4MY8A 2W9MA 1VFBB 3MVTA 2YQGA 4V2XA 2CW6A 1L3WA 4ZUWB 2KZHA 2DQTL 4RA0C 4AIEA 3U6RB 2R83A 4OUUB 3UWWA 4CLMA 4HEPG 2XFWA 3S5OA 1TZOA 3QJRB 2PRHA 1UWIA 4WFHD 3R5EA 1CUOA 1V3LA 2X2UA 1BF6A 3IUHA 4M61B 4QMEA 4CN4A 4JFZL 1GW0A 1XD1A 3R0MA 1C1EH 2BP3A 3SYQA 1QOQA 3RAJH 3UESA 2CIIB 3G18A 1Q13A 1BWWA 2QCNA 3T5WA 3TS8A 1CBGA 3T0EE 3NM3A 3WUWG 4ZUVA 4HIIB 1PLCA 1JAEA 1E8ZA 5IR1B 1HKJA 3NPVA 1KY6A 2WQSA 1TO5A 4J3XA 1VH7A 3AIQA 2VO8A 4RFOL 5DUBA 1DYZA 5FYKL 1EXGA 2VQ1A 4KPLA 3EDFA 1WG3A 1L7TH 1YTDA 4IMCA 1K8XA 4XC3L 1LO0L 5KVGL 3NA8A 1Z3NA 5EULV 5CD5D 2H0EA 3IETB 5KVMC 2BOLA 3SJNA 3VWJB 1UA6H 3H2WA 4L5ZA 1W1IE 5CZRA 2APXA 1EEZA 4JFOB 4K9EC 4UTBA 3CEPA 3HG1B 3BP6B 2XKNB 2E6PA 3TPKA 2GC4C 3WUWA 5DLLA 3C8NA 2GBTA 4DP5X 3O2WL 5I26A 1EDYA 1RK5A 3VXTB 2PDPA 1BMGA 1SJDA 4A66A 1KXHA 1O7DE 5DTFB 3VMOA 1NH6A 3MDUA 1AP2B 1IJNA 1H0IA 9RUBA 3W1UA 1XICA 4RJEA 1ADQA 1LDSA 3E3QC 2EE0A 5AOIA 3FUNA 2RCSH 4AYGA 3EH1A 4WV1C 3PFUA 1F8TL 1H6EA 3HKFA 1MCKA 2ILLA 2GJXB 1QLRB 2C9VA 1PF3A 2BXYA 5C2XA 4KRZA 3BXNA 5J12C 3S2AA 3LRGA 3T65B 2Z93B 2VW7A 1JZ7A 3CO4A 5JH1A 4W9KC 1TUPA 1UC4A 1HEZA 3FIGA 1WJ3A 3U6WA 4O11A 4RAUB 1CE1L 1UKOA 5DY2A 1VF5C 1S5IH 1KB9J 3U0TB 1LOSA 1DBBH 4DXVA 2PDBA 5GRUH 1JPFB 4LLMA 5LGHL 4IKKA 1GYAA 5M17A 4OCXH 1ZZMA 2VDPH 2ESCA 1G7HA 3SGJC 4X6EB 4OCYH 4GSUA 4ZXBA 3AS2A 2IGFL 4F1SA 1JNEA 4GRWF 3CCHB 2XISA 3NOEA 3VKAA 4KUCF 3WY2A 2VABA 5C9ZA 1FH2A 3W5NA 4PGLA 3MNZA 1W1ZA 2P53A 3E8UH 1NANH 3JT0A 3U82B 4IK7A 3QYSA 1JPGA 1UCTA 1W5MA 5FO8B 4JJHA 4YSOA 2DKSA 3WDJA 1A4AA 1RD6A 3RVWD 4LCYB 4FKHA 3CU2A 2C1IA 3FSAA 5DDHA 3KPMB 2DZPA 4FXGA 3NFUA 5E8EA 1HEJC 4TYUA 3MA7B 3R8RA 4MB1A 4DW2H 5DRXB 4ZT1A 4YX2L 3CQIA 4WJ5B 2OMUB 1L0XA 2XTJD 3EWBX 1NCIA 4XP4H 3PZIA 3OR7B 1P0BA 4X6BA 5EBMA 2E9GA 4POZD 3FQTB 2O5YH 5DU7A 1IAIL 4PSPA 3LRLA 5ESVA 3LUTA 3PY2A 3L5AA 4DHGA 2N7SA 1HHJA 5DRZA 3L9RA 4GZEA 1NCNA 4KZ0A 3HI5L 5F96L 2YQ3A 3QXUA 5DVOA 4LOFA 5LXEA 3PIQA 1YECL 5IWLA 1UOZA 3VU2A 3PJSB 3FYIB 2IO5A 4ORGB 4KH2A 1HS6A 3E9AA 4PJCA 4E41D 1QFWM 4YS4A 4E4UA 4OU1A 1H19A 1NUFA 3URNA 8RUCA 3EZ4A 4LPCA 3W7LA 4JFHE 4PL1A 4JY6B 3WUFA 3MKGA 2ZOKA 1RZFL 3KPTA 3NSJA 3PGDB 4HWNA 1VADA 3UCDA 2E8ZA 4PRNB 3BVWA 1FO0A 4X9HA 3ULVE 5J1TC 4LBAA 4DJFD 5E8OB 5C0FA 4PJCE 3IVTA 2VE6B 4I8DA 1TREA 4GVGA 3VKBA 4FC3E 4WKXA 3TOYA 3P69A 4B9PA 2WSQA 1B4JH 2ZC1A 1ZWIA 1O6VA 3VKKA 1KELH 2MFNA 1TZHA 1OGPA 1E9OB 5EUOB 3DCPA 4KHXL 5EMJA 5BWAA 4PD4K 4PP2A 5F9JA 4NHCH 4IJBA 4HV8A 3EEZA 2R9HD 3EXRA 4LHUG 3M0IA 4FADA 3CDCA 4GYPC 1QAWA 3OGVA 4J2QA 1HI6A 4GABA 2EKSB 5DD1H 4W9HC 2FGBA 2ZBTA 3LCLA 4UIKH 1BYOA 4MD0B 2V9TA 1XKJA 3P4NB 1KENL 3P6LA 3P40A 4FSAA 4XCNA 2BINA 2IFGA 4KUZL 3LXCA 3WO4B 2UYLA 4FX5A 4ZODA 2VAAB 1OARH 4U3XA 1D9KD 3CLEL 2WBJA 4RNFA 2BZDA 5I18L 4QE1A 4NZRH 1T1XA 3ELQA 2TRSA 1HZHH 3L5HA 4WVRA 2YW3A 4QRSB 1ZHKA 1ORSB 4PU2A 4XPHH 4R5EA 3HR6A 3C6EA 5FKYA 4YR6A 3KS0J 4LVHC 5CZTA 4U1GC 3FT4B 4BFFA 1R9YA 2VDLH 2CRZA 3LIZA 1NCAL 3PZVA 4F3FB 2AAAA 2LVEA 4LESA 4LHUA 2JLLA 1ZGLM 4J6RL 3KTCA 1V8HA 4IMDA 2A1YA 5JIHA 3U6XS 3WNIA 1LL4A 5B7EA 1PZ1A 1Z32X 5E8NB 1XGTB 4MKTA 2NXHA 3GJFA 2XM2A 3KDMA 2PPFA 1E4WL 3ZX1A 1QBMH 2WUCH 1QFEA 1YTEA 1QLEH 5FOJA 4JRFA 1YQ2A 2OB3A 2XTJB 2YFOA 2XZAH 5HYEA 2CR3A 3U2IA 5JW3H 2QV4A 4X98A 2Y6SD 4GQ9H 2HH0H 1WC7A 2BP0A 2HRPL 3RWJB 4DF1A 1OINA 4WTQA 5FI8A 1MF2L 4PFHA 3N9GH 1GZQA 4TQHA 4Y9FA 2X6MA 4LCWA 4HBCL 3D0CA 1ET5A 3MV8A 1S3TC 4WI8A 3IS4A 3Q5TA 1YEJL 4H6EA 1TVHB 2YL9A 4CD4A 2UY6B 3SRFA 3TYZA 3ZIYA 5I8EA 3AXLB 1U8OB 1UH4A 3P3TA 4TPRH 5U7SA 4HA1A 3PNWB 5E6SB 5H35A 3K1GA 5D37A 3CM4A 3SE3C 2X4QA 4BQ6A 3VO0A 3QIUA 5GNZA 4LCWE 1F5WA 4JHMA 3MV8E 1V02A 4N0RA 1MW2A 3GFZA 4KY2A 4CNPA 3ARFD 2G0KA 2EYTB 3UY8A 1X38A 3JV5A 3GJEB 4HUXB 3BPWA 1BFVL 3VD7A 3KVJA 1IL1A 1NY1A 2DZTA 3BKCL 3KXFD 3U2OA 5E9AA 4HMEA 2AJYL 3FKRA 4LLVA 3M5YA 2H45A 5DD3H 4LCCB 3MY9A 3KS0H 5SX5H