1CXIA

Wild-type cgtase from bacillus circulans strain 251 at 120 k and ph 7.55
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
686
structure length
686
Chain Sequence
b'APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
publication title Crystallographic studies of the interaction of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 with natural substrates and products.
pubmed doi rcsb
molecule tags Glycosyltransferase
total genus 231
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1995-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxiA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxiA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cxiA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cxiA01
3SDXF 1GPOL 1MRCH 4KVNL 4NDMA 5IVXB 4BS0A 5BJTB 5EH1A 4HOWA 1DWJM 4QXWA 1BJ1J 1J86A 2ADIB 3I3BA 2EYTB 1SBSH 4Y4FB 4AJ0A 3DBXA 1JF6A 2X2YA 4U0RB 5HI4D 1I7ZB 4FQHA 1NL0H 5E5UB 3P4MA 1KNOA 3VMOA 3MNWB 4N0YL 1W32A 4Z76A 3TNMA 3POCA 4NDMB 1BM3H 1OSZA 3E3QC 4LIQE 3WKZA 2ZXBA 1QVOB 4UV7L 3AHVA 1KPRB 3DBXB 4KQ3H 1IBGL 2EXOA 4UUJB 1R5VB 2FH6A 3BIAX 3P4MB 4U2YA 1V6YA 1KXVC 1MCRA 3HNVH 2V3FA 2EO9A 1MNUH 4PJGE 3OL2A 3TBVA 4HIXL 2D7NA 1GJUA 1OSZB 3GZKA 2EKSB 3CXDH 3K74B 1HK6A 4ELMA 4O9HH 3FN3A 5DHYA 1NP0A 4LSDA 3MOQA 3LN4A 3HG5A 2VXQH 1WKYA 4NQDA 3OV6A 2WMKA 3J8F7 4N9OB 2P42B 4ZODA 3PDDA 5I1LA 2FB4L 5IBLC 1MI5E 3TBVB 5KN5B 3SGEI 4JFUA 4YAQB 2BHZA 4J6RL 5ACMA 1FC2D 1KJ3H 2H26B 4UFJA 4UTAL 3FB8B 2DT2A 5DHYB 3D39A 5LGJA 4LYRA 1DFBH 5DD5H 1ZTXH 3QSKB 1RU9H 3JWOH 1A3LH 3PWLA 1B6DA 4OD2A 1C1EH 3GBML 5C0EA 2FO4A 1B0RA 2BDNL 4M8VA 4C83A 4YDKH 4NUGL 4MNLA 4X98A 2E7LC 4X83A 3VSUA 3AROA 4C57C 4HZ8A 4JZNA 3ZKQD 4O00A 1M7DA 2EJ1A 3H7LA 3FT4A 4QXGH 1JTOA 1MJUL 2N4IA 4TSBL 1N6UA 2E7MA 3D39B 5LGJB 2EACA 4P49A 5E1AB 4C56E 4PJ5B 2WWMC 3HG1D 2YPVH 4LCIL 3IDYC 3DX8A 1YC8A 2J8UA 1MCSA 4OD2B 5C0EB 2R4RL 2FO4B 1B0RB 1G94A 2WMFA 1MWAL 3MFGB 2JF7A 2OS7A 3GKWH 3NN8A 4X98B 1I9IL 5IFHL 4UIKH 4XP4L 3S36X 1AH1A 4JZNB 1M7DB 2YR3A 3I3EA 1T83A 3WJJC 3CXHK 3WLWC 3KAAA 3PP4H 3DX8B 3N9GL 5IVXF 4TOYL 2VRQA 3W6MA 3IAQA 1KCUL 1Z6JT 5IB3B 3U9UA 3O2DH 2RGLA 5HYIA 3JV5A 3AJ7A 1VENA 1G7LB 5M3WA 3VG9B 3W39A 2B2XH 4QXUL 3B8YA 3RIKA 4OSUH 2HRLA 4Z7OF 5C9KA 4F15C 2OWWA 1UWGL 5IW6A 1AQDB 1U8PA 4JM2C 5IR1A 1Q38A 4L3CA 5TDNA 2GJ6B 4FFZH 4G9FA 4QRPB 2IQ9L 4NZCA 4Q9QH 3U9UB 4K8RC 5MI0C 2D7OA 4AXNA 1RZJH 3MMEA 2GITA 3GNOA 2VDRH 5E6ZA 2Z4QA 5CJOL 4BZYA 4XXDA 3W39B 2I25N 3ZDYF 4TUJA 5GNXA 3UCRA 1KR0A 4JANA 3GSUA 5IW6B 1FNGA 1I3GH 1QFUH 2P5WD 3LQZA 3LDBB 4O4YH 1LL7A 2CDFA 4L3CB 5I1KL 3CX5J 4G9FB 3ZKXB 1ORSA 2FJHA 2GITB 3VXSA 1JRHL 2Z4QB 3A6CH 1NWUA 4XXDB 3O9NA 3AB0C 5EIIA 2PWFA 1NCTA 4M1CD 4PRPB 4TUJB 3LSOA 4RFNB 3GSUB 4OI9A 1FNGB 3PNWB 3LQZB 2CDFB 2ZG3A 4U3CA 5BWFA 3M45A 5A2LH 4G6FD 5J1AA 4ELMF 1NC2A 1J1OH 4FFVD 1UZ8A 1CTOA 3QA3A 5J6GA 4J28A 3O4OB 1ZGLM 2FX7L 3BZFA 5T5FH 5EIIB 1KENL 4KH2A 4Q6YA 2DB8A 4RGOL 5D7IF 1Q9WB 1GGIH 3BVXA 1Z32X 2D03H 5I77A 4KK9D 2V7HA 3BSHA 2YL5A 1I7RB 2B0SL 3UJJL 2WANA 4HIEA 1UWXH 5DRWA 3N1FC 5J1AB 2YK1H 5E7FA 1JWSA 3QI9D 5J6GB 1UZ8B 2J78A 5JLZB 2D73A 3WUEA 2DM4A 4HUXA 3VPLA 1N3NA 4OD3H 3X14A 4FFYL 2C1OB 4LEOB 1MFDL 2W61A 3KXFB 1HSAB 2VSDA 1R0AL 5HYQA 2HVMA 2V7HB 3IKCA 1RJYB 3L2MA 4UOQA 5A6LA 4XVJL 3ARDA 1AO7A 4JPWH 5DRWB 2WMPA 4M81A 1TITA 4I8DA 4YFDB 1FH8A 1FVDA 3WXVH 5CKAA 1P7HL 4F9LC 4JO3L 1TR1A 5F1SA 4HUXB 4P5MA 2J8UF 1N3NB 3X14B 3IFPA 4HTYA 3A47A 1XC6A 2ICCA 3NIDE 5HYQB 3IKCB 4ZFOL 1U3YA 4LSVL 1TJIH 3ARDB 1AO7B 3ARWA 5DFTA 5IJKC 1VEPA 2ZUNA 4V27A 1CZ8H 1EFXB 5E2TL 3N13A 5D9NA 1FVDB 4OCNC 4UQ3A 4ENEC 4OFPA 3BXWA 3QHFL 4WDIA 3TYFA 2YPKB 1GW1A 3QHMA 3IFPB 1VGKA 4QO1A 5ITBL 1K6AA 3QIBC 3OGCA 4ZXLA 4KQ4L 5T5NF 5DDHB 4NBZB 4GJTB 5SWSA 1NARA 4CN1A 1F4YH 4K68A 3FQRA 4GW5B 1FBIL 1CU4H 1U8IA 3ARFD 1B2WH 1V02E 4UQ3B 4GW1A 4WDIB 1BZQK 2YA2A 2ENSA 5DFVD 1VGKB 4G6AC 3MRJA 4JHZA 1UT9A 3KPNA 1MVYA 4HBCL 2Q7YA 2WV3A 1UD8A 4M6NH 5ACLA 5GZND 1OB1B 5SWSB 4WI6A 1EHLH 2R1XB 1DUYB 4P8VA 2R39A 3JVGC 2I26N 2OM5A 1WUNT 1U8IB 5ABEA 3LRGA 2AVGA 3JV4B 4PRNA 3BUTA 3O6FA 5GGTL 3MRJB 3ZLQC 1A9EA 1J0ZA 1GOHA 1ADQL 3MGAA 4M4PA 3JTSB 4AZ6A 2Q7YB 1ES0A 2GSGA 4OLZL 5EORL 3S4SA 2J7DA 4ACZB 2YD9A 4NWTL 5EB9A 1H41A 5H35A 1OAUH 1JHLH 4PRNB 2CIPA 1MW2A 5I1CH 2M8XA 3U7VA 5GZOC 2C7UA 1PY9A 3AHXA 1A9EB 5TQ0H 3WBAA 1MCIA 1T21A 3V6FA 1MAML 2E6QA 4YR6A 2I9LA 4OZIA 2GSGB 3O6MH 3S4SB 2XJ7A 3FTGA 4ZQKB 1E27A 4OLEA 1G6RL 4ZO6A 2GVYA 3H53A 3U36A 1TVBA 1IGCH 2DLTA 2YOCA 5DUMH 5C3LD 2C7UB 4LEXH 3KPQA 1T21B 2V9QA 1JUFA 1K5NB 2P1YA 3V6FB 4PGEA 3LRLA 4OZIB 4YR6B 2I9LB 1BQHG 1G1YA 4JFZH 3WY2A 1WFUA 4DO5A 3FTGB 1Y0LA 1E27B 1CQYA 4YZFF 3S3SA 4CJ0A 4UQ9A 5FGSA 3U36B 1TVBB 3TTSA 1TTGA 4U6HA 2D7QA 4GRWB 4Y2DC 2PXYD 1MHCA 1GHFH 1C5BH 3KPQB 3G04B 4Z2GA 1DVFC 4PGEB 1JUFB 4Y4KA 1KTBA 1V6UA 1J1PL 1JRHI 2IGTA 4ZUTB 3OKMA 3DO3A 5E5RB 3P77A 1T1WB 2AJ3B 2GK1A 2HISA 1Y0LB 2VCAA 1MCWM 4GRLA 1OQOA 1U2YA 1V6WA 3EOTL 2D0HA 2HT4C 4U6HB 1NLBH 3EJSA 4P7RA 3F5WA 1P84J 2DJSA 1PX3A 5JORB 2CETA 2BNRB 3QCVL 5I19H 2V9RA 3CIVA 5DEGA 3PGCA 1YHTA 5JW3L 4Y1AE 1U58A 1VF8A 4Y4KB 5FHBL 2DLFL 3OKMB 3BJLA 3P77B 2GK1B 4IM8A 5LGHL 5C70A 3D87B 5FYJD 3D69A 4GRLB 3WBDA 1B0IA 2XICA 5EUOA 3TOPA 5EZIL 3SBWA 5AAMA 4JQIL 5ESVA 2EDOA 3F5WB 3MRDA 1HXJA 5GS2D 3MJ7A 1FZKA 1NJ9A 3PGCB 3CSYA 3UG5A 4M5YL 4GAJL 1U58B 2YN5A 2ZOKA 1OM3H 3T3MF 4KZDL 5DUPH 3MLWL 1CPUA 4KKCD 2XTJE 1FGNH 5HYJA 5EUOB 3SJVE 5C0CA 5ESVB 2MSPA 2JELL 4LCCA 4XPTL 1NJ9B 3CSYB 4YWGL 5LQBL 4QT5A 1YQ2A 3CUGA 1C16B 3W6LA 4AEIH 5IKCB 4UT9L 3NSNA 2EE6A 3ARGD 3S35L 2IANE 4LDLB 4CD6A 5GRJL 1LLOA 1Q6GA 3WH5A 3WDHA 2DM2A 3NAAH 4XBGA 1HYSC 2BJML 2AEQL 4LCCB 2BXYA 1JHKL 4QT5B 3LIZH 5DJ8A 4K9EH 4I2XA 3VXME 1T4KA 4UNUA 1RJZA 1JI1A 4R9HA 4NZRL 1UZ1A 1WIOA 2W5FA 2QPUA 1HIMH 5IB4A 3VW3H 2XTKA 1S9YA 4QRRB 4Y4HD 2CMRL 3PTMA 5FUOH 3QULA 4XBGB 2BX5A 1I1FA 5FYKD 2JTDA 5AYQA 1YEKH 4X7CC 4OZIF 2D31A 5BZDA 2HJFA 2G8ZA 4JN2B 2E9LA 4X80H 4FQ2H 5DJ8B 4I2XB 4J8RA 1ZGLP 1G9EA 4W5ZA 1W9VA 4NBXB 2YRZA 1YEJL 4GRWF 1QNRA 1PZ3A 1FHGA 3X3FH 1JVKA 5IB4B 4Q7NA 1S9YB 3BP5B 3EJJX 3MLRH 4UZSA 2OW6A 2Y9RT 2GT9A 1I1FB 1DQJA 2WQRA 5MEOA 2D31B 5LKNA 3MRQA 1G0YR 5GHWL 1WIUA 2HFGL 3E2HC 4XC3H 2OR9L 3POHA 4J8RB 4EXKA 2ICWA 3MBXH 5DRXA 1EDQA 3C09C 1A1OA 1G7HA 4XP1H 5GRZA 1KC5H 1J5OH 1WT5A 1SVCP 2PYEE 5D71H 2CESA 4XWOD 1DQJB 1KXTA 3TTYA 3IXAA 3VFSB 1KJMA 2YC1A 3VNYA 1N6QL 3MRQB 4FXLA 3T8XB 3UZVB 5F6HJ 3WIIL 1FH5H 1B1YA 2ICWB 5DRXB 4XBEH 1UKPA 1JV5B 5I1EL 1HVQA 2J7BA 5DC4B 4CD4A 4OAWA 1UJ3A 4BYHA 3WH6A 1EHXA 5EOCJ 3IXAB 1KJMB 2YC1B 3BIBX 2FJFA 1FORH 3RTQC 3WIFA 5EBWA 4Z0XA 1DQML 4JRXD 1Z2KA 5IBTH 4EOWL 2QSVA 1XIWB 1MFEH 2CR6A 2G9HA 4CVWA 1IGIH 1UJ3B 4KK6D 5E6YA 4CD8A 2NNAA 1GL4B 3BW9A 2HTLD 2XRAH 1FLRL 1CXEA 1MFCH 4GT7A 4LLAA 4OCLC 5KTEH 2NR6D 2FJFB 1CXIA 4U1SA 3F7VB 3WIFB 5EBWB 3DUUA 4Z0XB 2P5WE 2X9XA 3VWKA 3T0AA 4YHPA 1W3KA 3VFVA 4L4OA 4HJ0D 4P2OD 1YNTA 1WZ1L 3VOCA 3RVTD 5I74B 3DHMA 4I3GA 3IDNB 3T1FA 4QXTB 3VTRA 1QZ1A 2NNAB 2UYLA 3MXWL 5BO1L 3BW9B 1QBAA 4FQ1L 3LHPL 1I8MA 2E9IA 1LILA 4DOHB 3NZ8A 4U1SB 2JB6A 2LTQB 3ILPA 3DUUB 3ZT5A 1X4XA 5HGHA 5CXPA 1FHLA 2QF8A 2NY1B 4AZBA 3VFVB 3G5ZA 2Y36H 1MRCL 2VTFA 1YNTB 2WWCA 4JHOA 1UH3A 3X11A 2Q76A 2BRRH 3CZNA 2QQLH 1SBSL 2XM1A 5GGQH 1TENA 3DXAE 4EDWH 3AZRA 3W0WA 1I8MB 1S9VA 1NL0L 3RY4A 4XNXL 5F7YC 3ILPB 1T6WA 1PSKH 2F53B 5HGHB 3H7BA 2BZDA 4JVUA 3FHAA 1MHHB 3G5ZB 5JTWA 1ZGLA 4BQCA 3T0ED 3X11B 3BP7B 1RURH 2Q76B 3UTPD 1HKIA 3MRHA 3ZMRA 3KPRE 3SDDA 2VN7A 4AL8L 4H1LG 1ZHNB 3W0WB 3MMDA 5KVGL 1Y6MR 1V3JA 1J01A 2H3NA 4P0DA 3EO0A 1DQQB 3KLHC 3HZKB 2AAVA 5HD8C 2CO6B 3NCOA 1BQLH 3K1KC 2X1WL 3SDDB 4HT1H 1B3YA 2B8OT 4FQCH 4WCYH 4AZ8A 5C2BH 2VXQL 3MSPA 2QADB 1T03H 2H3NB 3ROLA 2DF3A 4AIEA 1OCQA 1URLA 3F7RA 3EUUA 1BEYH 2FGZA 1QA9A 3RPIA 1DN0A 3VFNA 5F3BA 4DWSA 2Q6WA 1NMAH 1TNMA 1ORQA 3QDMD 1E4MM 1I1AA 4KV5F 1SJHA 1DFBL 1F6LL 4ATLA 1ZTXL 1RU9L 1LDPH 3JWOL 1A3LL 1SM3H 3ROLB 1N64H 3PHOB 5CGYC 4P7LA 4UR9A 5JHDA 1VERA 1HF6A 3V5HA 4YDKL 3RPIB 5FM4A 4U4BA 5KJRL 4RAUB 3OB0K 3VI3F 3U7YH 3ZR5A 4DWSB 1JTTA 2Q6WB 4BQ3A 2YFNA 1ORQB 1I1AB 4MNJA 2HKHH 3PWUA 4U1NB 3UTSB 5ICZA 1KR1A 35C8H 2NXZC 1EDGA 4YLQT 1UB6A 1FVCB 1FSKB 1BZ9A 2G2RB 2OSYA 4WUUA 3VD4A 5JHDB 1A7BA 3V5HB 4PTMA 4WW2B 1OGAE 5FYLH 3GKWL 1IAKA 1S7WB 4X9IA 5JUEH 4X7EC 2XFFA 2HMIC 1BQCA 3ZKSD 2DPEA 1AGEA 2X4QA 1WFOA 3WCYA 3BCDA 2Q1EA 4ODBD 3DDFA 1JL8A 2C1PA 1NGPH 1BZ9B 2XPGA 4MB3A 4ZAKA 2VMFA 5IUSA 1IAOA 2DBLH 2FIKA 3KLLA 3DDGA 4OCMC 3V7AG 4AEHH 1I3VA 4OTXH 3ARBA 4U1JA 5T1LD 5CJXA 2XXCB 1FO0B 2WZEA 3FFCE 3MOBL 3ROOA 5JXEA 2B2XL 2J7CA 4OSUL 4LLUA 4XB7A 3AS2A 4ZS7H 1OL0A 2V3DA 4LLVA 1X6NA 4TVDA 2XPGB 4QNPF 4ZAKB 1IAOB 2FIKB 4FFZL 3CDYA 3ARBB 4U1JB 1RZJL 3ZKMC 2CQVA 2VDRL 3JSSA 2GKIA 1BLNA 2DBJA 3ROOB 1P4BH 2YKKA 3FKUS 5BQ7A 2YL8A 4LLUB 1JPSH 2H32H 1QFUL 2FSEA 2X0YA 1R3LB 4PB0H 2NY6C 4PRIA 3QQ3A 3ZHDA 3WNKA 3EJPA 1BLNB 3A6CL 4LMQI 3IU3A 4MQ7A 4E41D 4FTVD 2BMKB 3IJHB 3OKDA 4R4NC 5BQ7B 3AICA 2UWEE 1NOUA 5DSCB 1FZOA 2NY2B 2NXYB 4U1IB 5JUVA 1YEHH 3UXFA 4C7FA 1QHOA 4CD7A 1J1OL 1T89C 2P4AB 4GAFB 2WWMD 4UOW1 1HKLH 3IU3B 3OR7A 1DWGM 1D6EA 5T5FL 5BXSA 3OKDB 5DF0A 3X12A 2D03L 5F7LB 1FZOB 1MIEH 3GGWA 1SY6H 3QHZH 1TQVA 5HGAA 4ZEPA 2DDQH 3WD3A 4B3LA 2YK1L 1I1RA 1UZ6F 5ITFB 2VZOA 2PWEA 3WLWD 4HWBH 1E43A 3OR7B 4OD3L 4M56A 1D6EB 5D9SA 2PTTA 3ESVF 3QCUH 3X12B 2V5RA 2M2DA 3G08A 3PGDA 4WKFA 5DT5A 3MV7B 4X0KA 1QQDA 2TAAA 4UFLA 4NRZA 3PJSB 3TF7C 1PS3A 4JPWL 3HMXA 4UV4H 4PD4K 3VD7A 4FQPA 1S7XA 2BNUB 3LEVH 4MAUH 3SN6N 3GNML 3WXVL 5AYUH 3N06B 4K71C 4JM2D 5L2JA 2PTTB 2CBUA 2J2ZA 3PGDB 4U6VL 4K8RD 1QQDB 4WJ5A 1TJIL 3HE7A 1AGCA 4OZGE 1MFVA 4IUGA 2CKBA 4OIBA 2ZUMA 4PGBB 1S7XB 4ZO9A 1H5BA 5EZLA 3O81A 1R6VA 1UASA 5L2JB 1RZJC 2CRIA 2D2OA 1TETH 4UBDC 1EEYA 4CW1B 4HK3N 4GO8A 3VVGA 1BFTA 4WJ5B 2ZUTA 2A6DA 1VIWA 2BHYA 3RJDA 3HE7B 1AGCB 3S6CA 1F4YL 5IWLA 2A2QT 3O6FC 1HL9A 1KCVL 2HVKA 2CKBB 3OZ9L 3EYUH 3MV11 4OOUA 4DFHA 4U7MA 4U1LA 3O11A 1PY4A 5FYKE 2AKRB 5JIKA 5JR1L 4AIOA 4UQCA 3EYPA 3MRCA 4AZCA 1EEYB 4PJDA 1GH7A 4G7VH 2A6DB 4Z5RA 1EHLL 3TTOA 4MX7A 4EUPH 4PYSA 1ZLWH 4QTHB 1OW0C 2X4RB 3S3JA 2DLGA 4UQ2A 2Z92A 3MRCB 4NQSA 1JDCA 1EVUA 2H32A 1S5HB 3ZYOA 2DQHH 1HILA 1AC0A 2VLJA 2X40A 4Z5RB 2IAMB 1JPGB 4BZ2H 4MX7B 4UQEA 4MDJA 5K9JH 1UM5H 1OAUL 1JHLL 5DMYA 4TVPH 3UESA 1I7UA 5I1CL 4PCTA 1CT8A 2CNCA 1PJ9A 2JCCA 1G7MA 1WISA 3WEOA 2BNQA 5TQ0L 1LP9A 4OFVA 1HOCA 5L8JB 1FVEA 3I75A 3O6ML 4PJ8C 1QFHA 1FYTA 3CBWA 2MCPH 3PHAA 3V6ZB 1IQWL 2MHAA 5KVEH 2MFNA 3PXHA 1IGCL 1OD7A 5SX5H 1I7UB 1GOMA 3AIRA 1CT8B 4UZUA 2JCCB 1G7MB 4S3JA 15C8L 4YFEA 1LP9B 4P2RB 5IM7A 1AGBA 1MVFA 4QOKA 5HVGB 1SY6A 3QDJA 4JRXE 4MQXC 3I75B 4V2CB 4JFZL 3V4UH 4WVRA 4ENED 1FYTB 4M7LT 3IDGA 3QIBD 4W8LA 5JBDA 2VT0A 2EIDA 3OAYH 1OPGH 3TPKA 4LVHB 1GHFL 1V03A 3DVFA 1C5BL 5IM7B 1AGBB 4EAMA 1T2QH 4HGWB 4U2ZA 3C6SA 1BMGA 3DETC 5C0BE 1OAQH 1DL7H 3L6FB 2N56A 2XZZA 4G6AD 4L3ED 1L0QA 5C0GA 3PTKA 3IDGB 3P9LB 1GC1H 1J12A 4N5UA 3SEPA 1H0GA 3BPCA 2VLRA 1ZWIA 1V0LA 1HQRA 3MFFA 5I19L 4CRPA 1A9BA 2WVSA 1QHPA 4HEME 3LMJH 2D23A 1A4KB 5T1MA 1JFQH 1RZGA 2C3WA 2VURA 2F61A 5C0GB 3SKNA 1UG9A 1MY7A 1QSZA 1MFAL 2OW7A 1R5IB 1HCVA 2VLRB 1YEEL 3O8XA 3EDJA 4XGZA 3MFFB 1A9BB 4J3WA 3BPLC 5A1AA 1W1PA 1MEXH 5DUPL 3JWDH 1OLLA 2E0PA 4X6EA 4RWYH 3B3IA 4MB4A 2RAMA 2VRKA 3T0EE 1I7TA 1RZGB 5GZOD 3LPOA 2FX8H 3UTPE 1FGNL 3SKNB 4PJDF 3F65A 3VXUD 1D5XA 1MJJA 3KL0A 3O8XB 2F5AH 4XGZB 3PIQB 2F54E 3GM8A 4AEIL 5CJQH 4TNVK 4X6EB 4OJFH 1CD1A 2J47A 5I8EA 3BDXA 2CR3A 2R2BB 3NAAL 3TZVA 5DFWH 3OLEA 1UENA 3NDYA 2QHAA 4MS8C 3U7BA 1D5XB 3QO1B 1RMFH 5I2IA 5FIPA 3DURA 1A4JA 1LO0H 2F7OA 3BT2H 2PBGA 3SQOH 3H0TA 4TVSa 4K9EL 2Y25A 1IKNC 1R3HA 2J7FA 1E6OH 1UWSA 4NZJA 3FT3A 1E4JA 1HIML 3C60A 2JCCF 3ARQA 4TNWF 4Y2DD 2MQ3A 3MXVL 3UX9B 2UVEA 5FUOL 2Q8BL 3TZVB 1LP9F 1DVFD 2HFFA 1YEKL 2ATPA 4FF5A 1A4JB 3A0OA 1C08A 5DWUL 4JPVH 4X80L 1IQDB 3H0TB 4FQ2L 4WNQA 3L3HB 3IJSB 1R3HB 3SCPA 5KS9B 2HT4D 4Y89A 3C60B 3X3FL 2J74A 1NMBH 2AXHA 3MLRL 3EO9H 1NC4D 3BRDA 1HHHA 3WQ8A 5I79A 5MHSE 4PJIA 1Y7VA 3NCFB 2ATPB 2VX7A 1TVDA 1C08B 1MHEB 4RMUA 4OM1H 3CFCL 4Q74A 3SCMA 3MBXL 2XWBB 1YECL 5CGMA 1KTLB 3OJDA 4P5TB 4XP1L 1KC5L 4NT6B 2QQKH 4HEPG 4U5IA 4AENA 1J5OL 4YPGA 5D71L 2RQ8A 1X6LA 1HHHB 3QIWC 4PJIB 1CL7H 4MJ4A 1RUAL 3PZOA 3UG4A 4FLQA 2HAZA 1FP5A 3MJ8A 4ISVB 1MCOL 1YUHA 2LE9A 3ZDZE 4KUZH 1FJ1B 3I50H 1W3JA 1KGCD 1CD8A 5A6JA 4S1QH 1R47A 4YPGB 3VWKC 3D4YA 1RZKC 5TF0A 5IQ9B 1BD2A 4CAGA 4JPKH 2FJGA 3BEWA 4PJBA 4JEGB 1FORL 4RMWA 4YDLC 4L5FH 1IM9A 4GFTB 4NCDA 3DMMA 3RZWA 5IBTL 1DBBH 1YUHB 3HC4H 3FO0L 4LIQH 1ACZA 1TVHA 4D9QD 1WZAA 1MFEL 4MHHI 2KKQA 1HYSD 3HLAA 2QPSA 1SYVA 1IGIL 1FN4A 1IE5A 4PYHA 1CXLA 2K7QA 1P7QD 3DROA 2XRAL 3Q6FA 1MFCL 4ONGH 3DI2B 1BD2B 1XYZA 3GI8H 3KG5A 2FJGB 1G7PB 4PJBB 3SE3C 4ERSL 1UKQA 2ICWI 4I18A 4K07A 1IM9B 4L8SA 1DDHB 3DMMB 3VXTB 4H8WH 4NGHH 5D6DC 3O4LA 5CS7A 2OL3A 1DZBA 1TVHB 2X09A 1W2KT 5J6HA 2RFXB 5TQ2H 1GOWA 2YIHA 2IH1A 2J75A 1XF1A 2J7LA 4Q22A 3MOAH 4FTVE 3OKLA 1TVNA 4ZUUA 4JZJA 1RUQL 3K4ZA 4L8SB 4BH8A 3MCLH 4WI2A 1NCWH 3O4LB 3QG7H 2OL3B 1T3FA 2Y36L 2YKLH 3TFKC 5J6HB 1J8HB 1T5WA 3FFDA 2BRRL 4PJFB 4YBQC 3N15A 5C07A 2QQLL 3X13A 1NBZB 3MCKA 2Y07H 1JYXA 5FYJU 1WWWX 4EDWL 5F96H 1CGUA 3IKKA 3OKLB 5HHXH 2J7HA 1MVUA 2CKNA 4A4AA 1QRND 3EBAA 1AR1C 4M9OA 4JZJB 4MXWH 4R4BA 1CYGA 3O9WA 4Q58C 4OFYA 3EGSA 3BMVA 1ZJBA 1G7JA 1T3FB 1T0MB 3MC0A 4QCFA 2EQDA 1T5WB 1P6FA 3FFDB 1NCNA 1RURL 1KIUA 2V5SA 1FZJA 3X13B 3IFNL 3MCKB 3EMZA 2Y7QB 3KYMA 4HUWB 3ULUH 1NWRA 1FZMA 1KCLA 4UFKA 1MVUB 2AI0H 1NKOA 4C58B 2FYVA 4R4BB 3O9WB 4LRIC 3EGSB 3TV3H 5GJTL 3MJ9H 3NIGF 4ZD3H 4OV5A 2ADJA 4XVUC 3SOBL 1KFWA 3EOBA 1VDGA 1BQLL 3MUY1 1FZJB 2A73A 3RTQD 1HNGA 4HT1L 1GQJA 4FQCL 2VR9A 4WCYL 5C2BL 5DVMA 1LGVA 1ZVHA 5L2KD 3LV3A 1ZEAL 4I3RH 4PJCB 1KIPB 3EOYG 4U3HA 4RMSA 3NA4A 1FE8H 2WZHA 4BM7A 5DURD 4ZFZB 4JGJA 5J13C 2ADJB 4D72A 3NH7L 4ZNCD 5FO8A 1BX2A 4ZNEA 3KPSB 1NMAL 4P2CG 1JCKA 2A73B 4PJEE 2X4NB 5J11B 3S37H 1EEQA 1OARH 3WV0A 3SPVB 5B3JF 1E6XM 1PQZB 2K3TA 4LU5L 3LKPB 1LDPL 2DQTH 5D96C 3LV3B 1ZLVK 4ZUVB 1N64L 4H2CA 4HFUL 2FNBA 2R2EA 3AZTA 1LMKA 4CMHC 5JZ7C 3HMXL 5I17B 5FO8B 1BX2B 3U7YL 5ICYA 1W2VA 1CS6A 4PJBF 1Q9LB 5DLMH 4Z77A 2HKHL 2YPLD 4L8BB 1Z3GL 3WFBH 35C8L 4Y5VC 4YK4C 3HMWL 3PL6C 5BVJA 2EDYA 5F7UA 3QO0A 1TMQA 4GG6E 5CJXC 5F93C 1HJSA 5JXEC 5T3ZH 3DUHA 2VABA 4LSQH 3CZEA 1AKJA 4MDIA 1H8SA 4TUOB 2YLAA 2CKBL 4CGTA 5F9AC 5JUEL 3SGJA 5ICYB 3A4WA 4BQ8A 1IARB 1J8KA 3S5LB 4WO4A 3DJ9A 1U41A 3RIFK 5BVJB 3QO0B 1MCPL 3IF1A 1HVXA 1NGPL 4H04A 4YHYC 4N8CL 1TZGH 2VABB 4FQJH 4NQDD 3D18A 1X3DA 2X1PA 1W9PA 4MDIB 4ODUA 3F58L 1BGAA 2H41A 3H9SB 5DK2A 3HZMB 3WDJA 5F9OH 2VC2L 4WO4B 1E71M 4U1MB 1L7TH 3VFRA 3ARRA 2BFGA 4QHUA 4ZPTA 3HNSH 5HYFA 3KLHD 3PQYA 1CGVA 3IF1B 5HD8D 4MWFB 4GXUN 3VIMA 5HDBE 4BELD 1EXUA 1F2QA 4NYLA 4GKSB 3VU2A 1Y6NR 3CUPA 3D18B 3MLPA 1AI1H 2XOTA 5DR5H 4DFIA 3OWEA 5I1GH 1IAMA 2IG2H 1RAMA 1ZHLA 5IW3A 3HE6C 3B2UC 1D5BA 43C9A 3ZJ6A 1QNPA 3QEGH 4PTUA 3T2NH 1NAMB 4QHUB 4NNYA 1JPSL 3ZE0E 1A2YA 3PQYB 3WUBA 4YQXH 2N1KA 2DKUA 1EXUB 4PB0L 4XXCA 4NYLB 4L1DA 5CAYB 4XP6H 4P3DA 3I2CH 4XAKE 1H9VA 4XC1L 1ZHLB 4EBQH 4LKXB 2YD3A 1BVLA 3QUYA 1DHKA 1D5BB 43C9B 3M46A 5CGYD 4JG0L 1C5CH 1BQSA 1EMTH 2I60L 4ZSOA 5MEND 4J7RA 4NNYB 2DQJH 1QBML 4IIQA 4LSTH 4NO5A 4K3DH 4P46A 3MJ9A 4OLUH 4P3DB 4YDJB 4A2MA 2ADFH 1YEHL 3FAWA 2E8YA 3CUFA 5AYIA 2YUVA 1DSFH 2BVYA 3WIJA 2UY5A 3NACH 4L3EE 1D9KC 1NCDH 2NXZD 1BVLB 3QUYB 5A8QA 2JEQA 5I1DB 1ZJAA 1LQSR 2YWYA 1PKQB 4Y5XB 4MD4A 4BJLA 2DN7A 3QJHA 4IIQB 2BHUA 2F1AA 4P46B 5DJXB 3ORJA 4WGWB 1SY6L 3QHZL 3JTTB 5I71B 2DDQL 1GOGA 2HMID 2VKXA 4LNRA 3PZQA 3ZT7A 4B53A 3MRFA 3QCUL 3FN0L 5C09A 4OIAA 1RD6A 2E6JA 4HSQA 1WE5A 4MD4B 2B4CL 3QJHB 1Z9MA 1H5BC 4KVCH 5H2BA 5DRNA 1C3FA 4UV4L 5DJ6A 2XVLA 4LNRB 5JIHA 3LEVL 4MAUL 3RIAF 5JDSA 5GS1C 3VDAA 2V5TA 5AYUL 3VXSD 5DRZB 3CSPA 5E9AA 3MRFB 2BVQB 1VFOA 5C09B 3U0TA 1U0QA 4FZ8H 1ODUA 2KQMA 5GXBB 2W9DH 4HFWB 4YFLI 3ZKMD 3E0GA 2PWDA 2PR4L 3L7FA 5DRNB 5H2BB 3OZPA 5DJ6B 4BZ1H 3BQUA 1S7SA 2AGJH 5D1QC 4P5KA 1NC2D 3EOAB 3CU1A 1CLOH 5FD0A 4RX4A 5DEFA 1UOKA 1TETL 3IVKA 2NY6D 3N50A 1J7VR 3AMDA 4UTBH 1F2XK 5DJCA 3L7FB 1CFQB 3OLDA 4GO6B 4P5KB 4R4ND 3NIFF 1W91A 1CN4A 1Z0MA 1AQHA 5I9QC 3W4RA 1I9EA 4G7VL 1S3KL 3AU1A 1YPZE 4PN2A 1MCDA 5DJCB 4Y19A 5DQDH 5LVEA 1SJEA 1JP5A 2PW1A 4PD4J 1HIZA 1S5IH 5D7JC 1VEMA 5BRZA 4QHMB 3CVIH 5FFLA 4MJ6B 4RDQF 4GI9A 5K9QG 2DQHL 3I6LE 1VPOH 2H9GA 3AU1B 4MSWB 3WE6A 5BXPA 4BZ2L 3GMRA 4Y19B 1CQKA 3ULUF 1BVKA 2Y6SC 3GM0A 4ORGA 3UJTH 2Z8VC 3RM8A 5FCZA 3GSVA 4YO0B 2WBWB 4MTVA 3SDXE 5HHVH 5KSAC 5EC1A 5BRZB 2J7EA 4E42B 5BS0B 5F9WB 5CPQA 2H9GB 4UT7L 3QWRD 3WE6B 1V0KA 2E40A 2XY1A 3GMRB 3AREC 4ODXB 1KGCE 4ORGB 3GSVB 3ES6A 4XMLH 3UYOD 4M48H 5E9DA 1K8IA 2MWCA 4NXKA 3SKOA 2VI0A 3L4VA 4P2QD 4RL3A 2CCRA 4W5UA 4HS3A 1NGZA 3ZHKA 3G9AB 3UTTA 1NBQA 4NFCA 1BYCA 4D9QE 3ALGA 1WZKA 1GCFA 1U8KA 4GH7B 4NZTL 4YHIA 4MJ5A 3VFTB 2DM7A 3ABZA 1CK0H 1RJLA 4J3XA 4RGNC 4UBDD 1OPGL 4U7SA 1FFQA 1K8IB 5E9DB 1QI3A 3O6FD 5D2NB 1VJZA 4KDTC 4X99A 5ERWA 2B5IB 2EIBA 4HS3B 1NGZB 3IXTB 4HCRH 4JFOA 2WSPA 4MNQE 4H8UA 5GGRY 3GIZL 3OKNA 4Z8FH 3RZCB 4WFFD 1OAQL 1DL7L 2VLKA 4YHIB 5SWZB 1GC1L 1LL4A 4GUPA 4DK3A 3QNXA 1MCCA 3DX6A 4WHYH 3VI4E 3VGAB 1A7NL 3NA9H 5C0JA 1E4KA 5HYEA 1WAWA 2JIEA 4X99B 5ERWB 5FM5M 1B90A 3WUWA 4JFOB 3LMJL 3VFGL 4KJYA 4H5SA 4XPBL 5IVZA 2QMKA 2VDKH 1F3RB 1U6AL 1WFNA 1JD9A 1I3RB 3QNXB 2XM2A 4X9GA 1BLIA 1IZJA 3LY6A 1QRNE 1JHTA 4UAOC 1HEZA 3IFOB 1MEXL 4NUJA 2AQ3A 3WUWB 3JWDL 4ZFGH 2BVOA 2O5ZH 2OL3L 4KJYB 5BZWA 4H5SB 5IVZB 2A38A 4QCIA 2FX8L 2J79A 3B9DA 4GPNA 2YD8A 4FMKA 4J4PA 1MFBH 2EXYC 1GOQA 3SIMA 1MF2L 1XD1A 5C2UB 4PJ8D 1V5JA 2DRUA 1JHTB 2YBRA 3TH4T 1R5WA 4H8VA 4QGTA 4QRSA 4J3OC 4NUJB 3U30B 4QWWC 1QLFA 2BVOB 4Y2OA 4MGXA 1FFOA 1P7KA 4OJFL 3LN5B 2XKUA 1PIFA 3PWVA 4QCIB 2W4XA 3QFJA 5IVXE 1NWTA 4M6AA 2ZKHH 2Y2WA 3BPOC 3ZOAA 4M3JA 4YHKH 2X0HA 1A7RH 1RMFL 5FA3A 4MQXD 4LRNH 2B7DT 3RKDC 1LO0L 4NOBA 3SQOL 1KLFA 3X3GH 5ILTH 2YBRB 4QRSB 3RY6A 2FLRT 3VIFA 1QLFB 4Z7OE 1P7KB 3ULVH 3PWVB 2HKFL 3L9RB 4JFDA 2ZXAA 3QFJB 2H1PL 1XCQA 2H6PB 1RZIA 3H3BC 3SCMC 4P23A 5F72S 5ACZB 3CIQA 1MCJA 3V0WL 4OF3A 3RVUC 1YYML 2DT1A 4JPVL 2VXTL 1GQKA 4R2GC 1A64A 3DETD 4H25A 4PY8I 2ZX9A 3WKMH 4K3EH 3ZDYE 3BDBA 1BGGA 1O7SA 1E1EA 2AK4A 5C71A 5D9MA 5EA0L 4JFDB 2WMHA 1NMBL 1EO7A 3EO9L 1XCQB 4HK3J 4WI5A 4OCRH 4P23B 1EJOL 5HYJD 2XY2A 3B9KA 4L4JA 3VA6A 1X9QA 4ALAH 5C0CD 4Y16C 4N90E 4OM1L 4RA0C 5FHAH 5FXCH 4AH2B 1EAPA 2NY3B 1IILE 2D0GA 4HULB 1B3ZA 2X70B 3AGVA 2QQKL 3ZTJH 3A4XA 3QDGA 3DIFA 2OTWA 4U1KA 4D2NA 5T3XD 4JFFA 4JFPA 1I1XA 1CL7L 3B9KB 5EPMA 1TCMA 4ELME 3ZYJA 2C3HA 3L3OA 1XHGA 3CZ8A 3ECBA 3FQWA 2XFXA 1DLFH 2DWEA 1GONA 4JFWA 2IF7A 4KUZL 4NQDE 4FRWA 3I50L 5D7IE 4BK4A 5AC5A 4I18C 3D3VD 4NHCL 3WHE0 3QDGB 3DIFB 3RWEA 2OTWB 4U1KB 3SCRA 4MNGA 1CIDA 1CGYA 3U5UA 4JFPB 4JFFB 1XGYH 2HTKC 5GS0H 1MLCB 4JPKL 1XD0A 4R8WL 3W9EB 4FZEL 2WVVB 3L3OB 4O5LL 3D39E 3ECBB 1MFNA 3BGFB 3BH9A 4L5FL 3NFSH 3FQWB 4GAYB 3MUAA 5TPWH 1NCUA 1T0NB 4LAQH 4MS8D 4WWKC 1W9DM 3QG6A 1IC5H 3ZE2F 1Q8MA 5MP6H 4MNGB 4JREC 5CHNA 2DTSA 2X41A 2QJDA 1GRWA 1IC4H 5HPOA 4R0LA 3GI8L 3CFKB 1W1VA 3NPZB 3RUGA 3LPGA 3VXRB 5AG9A 4LCYA 4H8WL 2WHMA 2OMBA 2J8UE 4GG8A 4FXKA 1LD9A 4P4KA 2CKSA 3WF3A 4APQB 2AOSA 1HE7A 1JGUH 5DUBB 1E56A 2VLMD 2CK0H 1A8JH 1BBJA 1F45A 2QR0A 4Y0GA 5CHNB 3C5ZB 3U4BL 2VLLA 3MOAL 3S96A 1KELL 2L0DA 4LMQE 4LCYB 5EU6D 5H94A 3MCLL 2HYMA 1OTUC 1NCWL 3QG7L 1LD9B 4FXKB 4GG8B 4P4KB 2ZX7A 4LARH 1JGIA 12E8H 2WYSA 4WGVB 3BPNB 3N18A 1WVZA 1TVPA 3NUKA 3RAJH 1GAFH 4HK0A 4Y7EA 5F96L 2VLLB 2XSBA 4C7GA 3Q1SH 2ENYA 3S96B 3PZUA 4NSBA 4EDXA 1BYDA 3QR2A 3THMH 4K7FA 4GQQA 4MXWL 3KHQA 1XGUA 5H94B 3WY1A 4UQDA 1JNLH 5TF1L 2E27H 3QIWD 5SV3A 3UPRB 4R97C 3GJFA 4G9FE 4XNZC 5A8NA 1JNHA 2F8OA 3MV8A 4NO3A 1KUMA 4IDJH 3CVHH 3ULUL 1KYOK 4RIRA 4JDTH 2XZAH 3V0AC 2AI0L 4EDXB 3B43A 4K7FB 5I6SA 1XGUB 1QG3A 3WN5A 1UYQA 1HZHL 3TV3L 1R7OA 3VWKD 3MJGX 4HUVA 3MJ9L 3TT1H 4ZD3L 3HR5B 3GJFB 5CEYA 5EBLA 3MV8B 4NO3B 3VXSE 4AT6A 4RIRB 2EC9T 5C6TH 1ZHBA 5CBAA 5GNZA 4MJID 5JMRA 3BGMB 3TIDB 4OLVL 4N9GA 2VCCA 2Z8SA 1W72H 1FE8L 1FL5A 3D85A 4LAJH 4HUVB 4V1DD 5E2JA 1RK0A 3E6FB 5DD6A 2DJ4A 5ISZD 5CEYB 5GPRA 3S37L 1OARL 2A6JA 3OJVC 4AT6B 5I16B 3MLUL 1R8LA 4DCQA 5BOZG 1ZHBB 1YMMD 3L7EA 3SGJC 5CBAB 3AIEA 4HIHB 1UKSA 4N9GB 3FCTB 2FDMA 1FL5B 3D85B 4F66A 2EIEA 4U05A 4L4TA 2ITCA 2J7GA 4H8WC 2WMIB 5DLML 3HFML 3ZTNH 1GXEA 3WFBL 1S9KC 1ULVA 3PWPA 3U5YA 4Q97A 2PTUA 3AY4C 4YZFE 4DCQB 3L7EB 3TFKD 2VR5A 3SDCC 5T3ZL 3TN0C 5JA8B 3WSQH 4LSQL 4YBQD 2FR4B 1KIQB 4YNYB 4IMKC 4FNQA 2FEEL 2E7HA 4JFQA 5CD5C 2XT1B 2Y5TB 3BO8A 3RUGF 1LO4H 3VH8G 1AR1D 2HFEA 5IEKA 3U6RA 1UR0A 2YBTA 2WC7A 1H0IA 4I13B 5J9PA 3DV6B 2W65B 5GRYA 3VX0A 4FNTA 2GI7A 4XCNA 4TYUA 4FQJL 4B15A 1MELA 4DM1A 1BBDH 1CL7I 2QQQA 1JPTH 1RUMH 4M1GH 1A47A 1CEOA 4BH7A 3T0BA 3BO8B 1A6VL 5F9OL 3VRJB 4PV8B 3FW6A 2ZOXA 2GFBB 2HFEB 5IEKB 1L7TL 1EBPA 1O7VA 2W9EL 4XCEA 3UBXA 4KROC 3HNSL 3U82B 3AIQA 3GXIA 5J9PB 5I78A 2DKSA 4XVUD 2WAGA 2P47B 3HMCA 1AGFB 3GIVA 5J1SC 3F12A 3AYSA 5SWSE 1AI1L 5DR5L 5I1GL 2IXVA 1T1ZA 4NRSA 4NQEA 4JVPA 2IG2L 2X4TA 4BH7B 4PRWA 3HI1B 3T3ME 2BK8A 5D7KD 1NBVL 3BOVA 1AD0A 3QEGL 5CIPH 3W37A 4GMSH 3T2NL 2EYSA 3MBEA 4XCEB 3UBXB 3ULVF 3GXPA 3BISA 4FMVA 2R4SH 2XG9A 4XP6L 3GIVB 3O45A 5F7EL 5C08A 4WUUD 3F12B 3I2CL 1Q9KB 2WBJA 3ARTA 3NCJH 3QXAA 4L4VA 1T1ZB 1OAXH 4NQEB 4EBQL 1PD6A 2E7BA 2NY5H 2UV3A 4NP4L 4FQLL 3CVHA 1AD0B 4M5ZL 5FO7A 1S7RA 5E8OA 1C5CL 5EO1A 2DQJL 1D6VH 1YJDH 5JZ7D 5C7XH 1GCYA 3QUKB 4K3DL 5I1HL 1S7UB 4OLUL 3S5LG 3O45B 5EOQH 2ADFL 2WLZA 1LWHA 3QXAB 3FB5A 3IB4A 2G75B 3PL6D 1NCDL 2WBGA 4U1GB 2QKIA 2J8HA 5FO7B 4PLOB 5E8OB 3UR7A 5FB8A 5JXED 5EO1B 1CICB 2ZUWA 4JFSA 1W72A 3TA9A 2NX5A 5A2KH 1S7VA 5DQ9A 4OZIE 3AOFA 2AS5M 3ZO0A 1KT2B 4GZEA 5EO0A 2QKIB 1F11A 1UYWL 5DJDA 1BIHA 1O0VA 4LKCA 5FB8B 2APFA 3DRTA 3BAIA 3I6GA 3BQUC 4AMXA 2F19H 2FX9H 1SVZA 2DM3A 4GRWE 3WS6A 2A3BA 3KZSA 5AG8A 5T1KD 2DYPA 3P9MA 3N11A 4KVCL 3GEWB 4HBQA 2NX5B 2ATKA 1P2CA 1S7VB 4ZOCA 4HZLB 4C55A 5A6BA 5EU3A 3KL5A 2WCSA 1LG2A 5EO0B 4NN7B 1F42A 2CRZA 4PRID 1RFDL 5DT7A 3JBG7 1A7PH 1FC1A 5DJDB 4GRMB 3DX7B 4LKCB 4I48A 3DRTB 4PTXA 1HNFA 4FZ8L 3C6LC 2X4OA 2UUDH 7CGTA 1U8OB 2V2XB 5IMLA 3NIYA 2DYPB 2W9DL 3P9MB 1SYTA 4IHOB 3OKOA 3HE6D 4X9YA 2ATKB 3B2UD 2EEXA 1P2CB 2AV1A 4BZ1L 1MUJA 4XHQA 5HHMB 1U95B 5BVPH 1WIPA 4YBLC 4Y5YA 1YNLH 4J3UA 3TH3T 1CLOL 3WENA 1M01A 3BUDA 4GZIA 3SKUD 5EOCH 4IRJC 4I48B 2X4OB 1E15A 4OGZA 4XCYA 1TE1A 4XPFH 3OKOB 2AV1B 5KSUB 1B4JL 4D9RD 4Y5YB 3GSXA 5ID0B 4V2XA 3QJFA 1M04A 1P4IH 1RSFA 5A40E 1HXYA 2ZXDA 3TVMC 3CLFH 4GSDH 4W6WB 3DTXA 4KZEH 3LKSB 1D9KD 4WV1C 4GLRH 1KGXA 3PZMA 5KZCD 3V6BR 4B9YA 4YHEA 5FV2A 2GJZB 2ICEB 3KLAB 4U6YA 2PI6A 1N82A 3QJFB 1S5IL 2DMCA 3HA0A 5I9QB 1FFNB 4KI5F 5HYJE 1PX4A 2AERT 2CDGA 1XF4A 2NT1A 1E4WH 1LL6A 3VRLF 1HXYB 2BFVH 3CVIL 5C0CE 3CD4A 5FUCC 2FEEI 1UB5A 1JBJA 3F4VA 3CJJA 5IB1A 2HVJA 2DJUA 5IK3B 1LHZA 1MJ8H 1N0LA 5FYLD 3UJTL 3AMGA 2HLFC 4DKDC 3CFBA 3ZJ8A 1WDRA 4U6YB 4M6OH 4HGMA 2ESVA 4RGMC 3CGTA 1MRFH 5HHVL 5HHQA 2CDGB 5J1TC 5ANMB 4KJWC 4C59B 3S88H 5KVFH 4NRYA 1UB5B 2XN9D 3WO4B 4KTEL 4JHWH 3KJ4C 5IB1B 4X7SH 2DICA 4I2XE 1N59B 1CDUA 2HVJB 1A7OH 1LWRA 3CFBB 2QSTA 1BAFH 3OLIA 3A3HA 2FD6H 2ESVB 4XMLL 5HHQB 4M48L 1NEZG 2AJUH 3F7YA 1D5IH 5C0AA 4AYFA 2P5EA 2QSQA 3PTQA 4EANA 5D1QD 3F7QA 3N85H 1X5ZA 1E4KC 4PRHA 3UO1L 3H9YA 2Y06H 1HWWA 1ITCA 1V05A 1DWAM 3OHXA 2RB8A 3NPSB 4PPTA 4R90H 3F7YB 5C0AB 5CINH 4K94H 1TG7A 2P5EB 5C1MB 3UTZA 1EOMA 3RGVA 2K7PA 2VZVA 3OLGA 5ETUB 2VLJD 2AK1H 4Z8FL 1JGLH 1VESA 1VA9A 2Q3AA 2VLME 3EJYC 5DS8B 3BE1H 5A8PA 5A8MA 3RQ3A 3KPMA 3NA9L 2EO1A 3FQXA 2BNQD 5H37H 3QH3B 4KV5E 3NGBB 1N8ZA 1XGPB 2HLAA 1ISXA 5D7JD 4KI1A 3ZL4H 3FB6A 2CH8A 3RPKA 1E1FA 4Z7VB 5DJYA 5HHOA 2CIKB 2PKDA 2MKLC 3KPMB 4AEEA 3H8NA 3L5HA 4R7NA 3T77A 5CJBA 5E08L 5KBNC 3HJEA 1E4NA 3VI3E 2VKWA 3DGCR 3IGUA 2Y6SD 4OIIH 3PWJA 2CBIA 4M61A 4QOKD 4ZFGL 3VDCA 2O5ZL 3QDJD 5JDJA 5A95A 1E70M 5D70H 3Q5TA 1CGTA 5KSAD 5B38A 2WKLA 3NABH 3NBNA 5EC2A 4M7JL 3RY6C 4R7NB 4OGXL 2ORBH 1LE5A 4MA3A 5EN2B 1WGOA 3ARED 4DOHE 1LG1A 2A74A 3BKCH 4JVWA 3PWJB 4XVSH 3TH2T 4M61B 5F6IB 2FECI 3U4AA 2G60H 1RHFA 3FQUA 5B38B 4XPAH 4ZTPH 5J12B 1JE6A 2ZKHL 3WELA 3CSGA 4IJ3C 5EC2B 2NMSA 4KTDH 4YHKL 4X8JA 4JFYA 1I8LA 5J0BA 1A7RL 4P9ML 4LRNL 4LSSL 1LE5B 4MA3B 5I66A 3X3GL 5ILTL 3VGHA 1U8MA 2F8XC 2IALB 3EZ8A 5FGBA 4L9LC 5ABGA 4RGND 1LVEA 1IC1A 3DNKA 4MJ2A 1CLZH 4CKQA 2DQCH 2X1OA 4UB0H 1JXJA 2M26A 5IHZB 2XTJC 4GINA 4EZMA 3UAJC 4X8JB 4JFYB 3MLTA 5TE6H 2WCGA 1NPUA 4PSPA 5D9PA 3LRMA 5I66B 1BWWA 2QV2A 4UOJA 3TP4A 3W0WE 1U8MB 3WKML 1NCBH 3FNDA 4OCWH 4K3EL 1KB9K 5IIEA 2KUTA 3CK0H 1CFSB 4R26L 3FO9B 4OCRL 2RHEA 2DQUH 3KNBA 3T09A 3MLTB 1E5NA 3HN3A 4ACPA 3NMEA 1QPKA 2DT3A 1H15A 3P40A 2FATH 4QYOA 2R9HC 3DUSA 3OGOE 1QPPA 3IDIB 4UNIA 5IIEB 1VFBA 2OTPA 4ZXOA 4D1JA 3GB7B 4BF7A 2D7TH 1MSPA 1T0PB 3HG4A 1E28A 1WBXA 2ZUQC 4UINH 1T04A 3BHBB 1H15B 2X1XR 2Q8XA 5INCB 4BFBD 2F8VA 3O0RH 5E6IC 1ZLSL 2EEBA 1XT5A 4R0LC 5GRXG 2YHGA 2EXYD 3SDAA 2NY4B 5B22A 4F57L 5ALCH 5HY9B 4TVPD 4U31A 1XAUA 3TJHC 6TAAA 4S2SA 5GS0L 2XTLA 1WBXB 1L7IH 3MACH 1EGZA 5CZVH 4QWWD 1T04B 1UZ6E 4DW2L 1GPOH 5DHVH 5F7DB 1UD6A 4AZHA 3CX2A 3KL3A 4HC1H 3RWIB 4DVBA 4PJHA 5JHDE 4LAQL 3SDAB 1IC5L 4MHHG 2D0FA 3RKDD 5DVLA 3AFLA 3AXHA 3MUJA 3BKJH 5D7KE 1IC4L 4S2SB 1S7QB 3UMTA 4JG1H 4F3FA 3D52A 2E5EA 3P4NA 2MCG1 1GYAA 1OGGA 5C8BB 3QUZB 2EE3A 5DJ0A 4WUUE 4DVBB 4PJHB 3SCMD 2WVTA 1JGUL 2BOBA 1W3HA 2CK0L 2EDWA 1CZ1A 3QRGH 3RVUD 1W2PA 2QSCL 4NX0A 4R2GD 3ULVC 5IT2H 1Q6CA 5A2FA 2GTZA 3QB7C 4M43H 4XBPB 3BSGA 1WICA 3STZB 1UR2A 5EU4A 1IGFL 3P4NB 1KB5B 3V5KA 2F1BA 1UADC 4LARL 5DJ0B 12E8L 4E8CA 2OZ4H 5JW5A 3CHCA 3QZWB 2BOBB 5E5MA 5A6KA 4LGRB 3WN5C 4Y16D 1B0GB 3RAJL 1WLHA 4YHOL 1BQUA 4Q6IA 4RCAA 2YD7A 2AXJA 4JGUA 2GTZB 4MZ3A 3F6IA 3THML 3VFMA 3DHUA 5EBGA 5EU4B 3TA3C 1JZ6A 4D6EA 5DTFA 1NMCC 4LHUB 1JNLL 4H8HA 1QSFA 2E27L 4J6RH 5JW5B 3AHYA 5TE7H 3OJ2C 5BMFH 1DWFM 1L0YA 4BQ5A 5F89A 2PF0A 5E5MB 4G8GA 3TNNA 3LKQB 4PJXB 3CVHL 3AHTA 5DT1L 3HR6A 4JDTL 2EBNA 2J3SA 3PZTA 5EG6C 2XZAL 4GBXA 1ZE3C 3K8MA 4NUGH 3BAEL 1UWIA 2Z31B 4DKFH 3VINA 4UDUB 1QSFB 3TT1L 2AV7A 2R1WA 4K7PY 4F8TA 2HTKD 5F89B 2A6IA 4PRIE 3CFDA 5JPNA 1GOOA 2NY0C 2JEPA 3TNNB 1BP3B 1NFDA 3H55A 5C9JA 4E5XB 3IGAA 3MRLA 3SQBA 3FXYA 3AI0A 3EJTA 3U9PH 4J2XA 1M53A 1GVYA 3B9AA 4GBXB 2YD5A 4JRYA 3B9VA 4WWKD 1Q6FA 1W72L 3BI9X 5IFHH 3CCHA 4J3SA 1EH9A 1ZBCA 3OGSA 2FE0A 1V3IA 2A6IB 1X7QB 2CLZA 1OP9A 5JPNB 3AC0A 3IJYA 2NCMA 1ZBKA 1U3HC 5D7LD 4AMWA 1NFDB 4GW4A 5C07D 5C9JB 4TOYH 4ZUSA 3IGAB 2AAAA 3TO4B 4PJ9C 4WFHD 2EPNA 4JRYB 1MLBA 4NBYB 3VDHA 5I73C 4DZBB 3CCHB 3S98A 3O3BB 5I1AA 2HWZH 4AIZA 4JFEA 4UDTA 1IEAA 2CBJA 2W07A 3NSXA 3IJYB 1ZB5A 3W5MA 3QEQD 4ZUSB 1OTUD 4L8CB 1P5VA 5DHVA 4X7DC 4D6CA 4PJHF 8CGTA 5AD0A 1KYOJ 4HC1A 1MLBB 1UVQA 3RNQA 4AZ5A 2BRQA 5GS3A 1JNJA 5CJOH 5DGQA 5I1AB 4LHQB 4JFEB 2EE2A 4IRSC 1VKXB 1CBGA 1E73M 1A7QH 1E9LA 4HWNA 4XNYL 1LO4L 5J3HC 1HXMA 1J0IA 4I0PC 2J25A 4D6JA 4AEFA 5FF6A 2EH8H 3MV9A 2X7LB 5AD0B 2XQBH 1MI5B 1UVQB 1DN2A 4BFGA 4MB1A 3QXVA 1C7TA 1RQ5A 3MBEC 1ZT4A 1JPTL 1RUML 4LCWD 4M1GL 5H8DA 3ALPA 1EAJA 3GSQA 1HYRC 1OP5K 4NWUL 5IVNA 1HXMB 4C56A 4ODHH 3O6AA 1AE6H 2X2JA 5FF6B 5HHPA 4FNPA 3GO1H 4Z7UA 3D2UB 2C4FT 1X5LA 2OZ4A 3BWAA 3U2SB 1ZT4B 3NCYS 2FX7H 4DO6A 1BOYA 4MNKA 1KENH 3GSQB 2EDDA 1RZFH 1V8HA 4HJGA 4C56B 1IV8A 3C5JA 1HH9B 2ZCLH 3MQIA 1RUPL 1JIBA 4HA4A 2Y5EA 1JDAA 3STBA 4Z7UB 4PJDE 3DECA 4CVZA 4A6YA 2VITA 1QR1A 2Y24A 4HV8A 1NDGA 3BWAB 2XYLA 1VACA 3QUXC 1OAXL 3CFIC 1LEGA 3HC0B 2NY5L 1AKJD 3OMZA 4QHKI 4NN5B 4S11A 4HUUA 1MFDH 4RFOL 4ZMAT 4HJGB 3C5JB 2XWTA 3KYOB 4FQXA 1JDDA 3IETA 1LNUA 4XVJH 1FIGH 3MRNA 3VG0H 1D6VL 1YJDL 3QEUB 5C7XL 3UPAA 4CVZB 3DGGA 4A6YB 2DIAA 5EOQL 2VLJE 1QR1B 1NDGB 1NFDF 1V3MA 1VACB 2EDEA 3WS6C 1EUTA 1LEGB 1H3UA 4Z95L 4UZGA 4WEBL 3SGKC 5L9DL 3L3IB 3BCFA 2UY3A 2DQEH 2XWTB 2DAVA 4FQXB 3SDCD 3H3PH 3TN0D 5KAQG 2PN5A 4WHDA 1UC6A 2JCCE 3MRNB 3MLSH 2BNQE 3LRSA 5CD5D 1XH1A 1WWBX 1LP9E 3DGGB 1BQHA 1FDLL 3BN9C 4JPIA 1ZXQA 3BD4A 4WI9A 2ALWA 1FYTE 3EYVA 3CZKA 3TBTA 1IFHL 5ITBH 5DK0B 2QMJA 2CITA 4GQ9H 4OI7A 1XGZA 4MAYC 1E3ZA 1HCFX 1JZ5A 4UFMA 1A6AB 2HT3C 3HUJF 3K2UH 1OGSA 4QOKE 1BQHB 3QDJE 1OAZL 1XFPA 3EYVB 1U93B 3TBTB 4KROD 5AY7A 4K7PX 3GSWA 4HBCH 4EI6A 3ULUD 1K8DB 3DI3B 1IZKA 2MKWA 3FQTA 5E99H 1PG7H 2EC9U 1C12B 2O5XH 4YHZH 4XH2A 1UCTA 2FCBA 3OBAA 3VSVA 1RI8A 4TULH 1VEOA 4Z2KA 1FL6B 5BVPL 4U0QB 3P4LA 3TV8A 1YNLL 4NQCA 5EDXA 3SKJH 4RZCB 4DZ8B 3VILA 2JJUA 5CBEA 3TT3H 4XZWA 4X4YB 3SCQA 2VE6A 3GSWB 5EOCL 3WXWH 1ZK9A 4FQIH 2ZCKL 5ADPH 4Q2ZA 4OLZH 3FQTB 2VLRE 1T7YA 4XH2B 1HNYA 1BFOA 3GJEA 3WF1A 1P5UA 1ZAGA 2PYFA 1NEUA 2KBGA 1UCBL 2WVUA 4DGVL 2WMGA 5D1XA 3RKPA 2GCYB 4RAVB 4N0UA 3HRZA 4EKXA 3QXTA 4Z7UF 2VE6B 1BECA 1P4IL 4OLYH 2NY5C 1HP5A 4Q2ZB 4YE4H 3OAZK 4KZEL 4OV6F 3V5DA 2RJMA 4YC2B 5HNNA 5IV2A 4D3CH 4BUHA 3MANA 1G6RH 3FHQA 2J1KA 4LVNC 4DGYH 2G4FA 1QLEL 1X5GA 1ZLUH 3IDMA 5D1XB 2R29H 3HRZB 1KTKE 3SE9H 2IGFH 4NHUA 2BFVL 1MPAH 5D5MA 3QNZB 1ERNA 3V5DB 1MQPA 1CFTA 5IV2B 1BFVH 2W62A 1E72M 1CFNA 3O2VH 5EUKA 2LAGB 3EHBC 1XGRA 5EBMA 1UA3A 1D5ZA 3IDMB 4M6OL 4ZXBC 3BQUD 4EQ2A 2NW3A 1MRFL 5TE4H 3IJ9A 3DX4A 4NHUB 4RX4D 3MNVA 1QW8A 1BFSA 1FLTX 4O51A 4TXEA 5KVFL 2JIXD 3VWJA 1EO8H 1A6ZA 1FAIH 2Z35A 5A6SA 1CFNB 4KKBC 4AG4L 4W81A 5EUKB 3I3DA 5EBMB 1XGRB 4BA8A 1D5ZB 3LD8C 2V5CA 1B3WA 2ZUYA 2FD6L 3T0DA 4ZS6C 3RGVC 3C6LD 2NW3B 4BKLB 5JW3H 5M5DA 5FHBH 2AJUL 1D5IL 4ONOA 3MNVB 5EU7C 3BLKA 3FN9A 3FL7A 4S1DC 5E94A 1A6ZB 4WJXA 1AHWA 5E2UH 3H54A 5EO9B 1F4XH 2Y23A 4X7FC 2OJEA 2Y06L 4IRJD 1HSBA 2PO6C 3OA5A 6FABL 2EZ0C 1VBUA 2X4PB 2DSUA 1DUZB 3NIGE 4R7DA 4DN3L 2CUIA 4K94L 3EYOA 4F9DA 4R3SA 4NRRA 4OF0A 3WHE1 5E94B 3VJ6B 1T80A 1AHWB 2AK1L 4NCC1 1JGLL 4MA1C 5M17A 1KEMH 2OJEB 4M3KB 1HSBB 2X42A 3BE1L 3INUH 3TVMD 4LGXA 4ELKA 2X89A 3EFFB 3L1OH 4YWGH 5LQBH 4R7DB 1UA6H 3VNZA 1AFVH 4J1UB 4UT9H 1AP2A 3EYOB 3M1BB 4R3SB 2LU7A 4PTTB 1BOGA 5AZEH 4PG2A 5B3JE 3ZL4L 5CP7B 2OMNA 3TYGL 2UZIL 3MRIA 2AEQH 3VIKA 4ELKB 1XCTA 3QOKA 1K9TA 4HIJA 1JHKH 1EQPA 1RZ7L 2NQCA 2V2TB 2K9UA 4KUCF 4WW1A 1AP2B 4PJBE 4JQXC 4OIIL 1ZLWK 4GS7B 2HLFD 2ZSWA 4HAGA 2G5BA 5I6XB 3KPOB 1NKRA 2CMRH 2F74A 4P3WA 8FABA 3UTTD 3RWGA 2WP3T 5D70L 4XMPH 4JIEA 3MRIB 4KJWD 3NABL 2JJWA 1XR8A 1XCTB 4HIJB 2ORBL 3QIUB 5LBSL 2BY2A 2WCAA 2J77A 4KAQH 5DC9B 1YEJH 2D7MA 3SY0A 4CN6A 4AISA 5GISH 3BKCL 4OLWL 4XVSL 4NO0D 5EZJA 4KC3B 1F6AA 3RWFA 3O4LE 4ZTPL 2VZSA 1AXSA 4XCFH 5D5MF 2VLKD 4Y8AA 3KLKA 1T5XA 4KTDL 5FOJA 2ZPKL 4Y1AB 3SY0B 4QHNA 2DGAA 2GJRA 1HHKB 5EZJB 3N1PC 5HVFB 5SX5K 3G5XA 3MODL 4ZE4A 4HD9A 4ODVH 2DQCL 2IPKB 3EDDA 3OSKA 3UYRH 4ESKA 1N6QH 1T5XB 5I75C 3GSRA 3OB0H 1W9XA 5C07E 5TE6L 3VM7A 2VX6A 1KCSH 5JNYA 2WHKA 3WMSA 4WFHE 2IADA 4QHNB 3DX0A 3P73A 1DBJL 1NCBL 4OCWL 4K94C 3G5XB 1ZANH 3CK0L 4WY7H 3EDEA 1CIUA 4OI8A 2XA8H 3E8UH 5ABDE 1ZHKB 3GSRB 4LLYA 5BW7A 4H1LB 4GLRI 4LP4A 1DQMH 5JNYB 1LWJA 2F7PA 3CLWA 2DSKA 4AD1A 2FATL 3VM5A 1QTYT 3LEXB 3CC5A 5FECA 4LPUA 4EUPG 2SEBA 3L2LA 4IEFB 1UWQA 3FZUC 4ZO8A 3G6DL 2F58H 3RDTC 4K3GA 3VIHA 5GGSY 2EABA 3MLVH 2D7TL 3DHJA 3A22A 4LLYB 1Q4NX 3VRIA 4B7LA 3LOWA 1CLCA 4UINL 4HZ7A 3F5JA 3PZNA 3ZJKA 4XWGL 2QLVB 5F7HA 1ZA6A 3CC5B 5FECB 5HVHC 3EYFA 4POUB 4NZFA 5A2CA 2FEDC 2WP3O 5BJTA 3QR3A 1CDGA 5CCKH 4PMNA 1WQVT 2EYTA 4Y4FA 3SUUA 3MREB 1MY5A 3PV6A 5GQBA 4PUDA 5ALCL 2DKMA 3LHPH 4P7QA 1I7ZA 4ZNEE 4XHJC 4RMTA 3HG1A 3OXRA 4JAWA 4HPYL 3VRIB 1BF8A 1L7IL 1SMAA 2OCFD 3MACL 3PHQA 3NFPB 1EDTA 5CZVL 1SEBB 3BZEB 2XVGA 1ZA6B 2UZYB 3EYFB 2LVEA 2R56L 5CFHA 4HC1L 1QVOA 4B7IA 1M7XA 4CUCA 4HLZG 3DX1A 3QYCA 3CU7A 1KPRA 3PV6B 1WZMA 2QBWA 1KB9J 3PWNA 2F9BT 2AK4D 5D4QA 1IGML 3BKJL 4XNXH 3HG1B 1QFOA 3OXRB 4UUJA 1R5VA 3PHQB 4JG1L 3W26A 4IBLT 4LLQA 3QXDB 2F5BL 2ZWLT 2EKSA 4Z2JA 4Q6IC 2XTJD 2BSED 7TAAA 3OAUL 3E1F1 1BYBA 3UAJD 3SJVD 4MCZA 4AL8H 2GUYA 3PWNB 3QRGL 5KVGH 2FGLA 2GJXB 1DWIM 5IT2L 4JKWA 2VH5H 4M43L 2RCSL 4G8IA 4DKAA 4NOFA 2IAND 3OPZH 4LLQB 4PRDA 2FL5A 3NCEB 5KN5A 2EDJA 4YAQA 2OZ4L 1A21A 2H26A 3HU7A 4PREB 3FB8A 3RWCB 4MCZB 2WC3A 5B8CA 1KJVB 4M62H 2CDEA 1NQBA 4LLWB 4E0RB 1E6ZA 1D3CA 4Z18A 2R9HD 3VXMD 4G8IB 5E8NB 5CWSB 2WC4A 4PRDB 1Z5LA 1KXHA 3NIFE 2FL5B 3PQYE 5B4MC 2EAEA 3RI5K 4QEGA 3Q0HA 1HJVA 3BUQA 3MLZH 5TE7L 4M7KH 2YUXA 3LS4H 5BMFL 5B8CB 4FNSA 2ZOLB 2MOVA 3AYRA 2VQ1A 5E1AA 4PJ5A 5IW1A 2CDEB 4W70A 5E6ID 4Q9RH 2P5WB 1X5FA 2BVEA 1W3LA 2Y4SA 1RIHH 1Z5LB 4KK8C 4QTIH 1C90A 5KJRH 5SX4I 4DKFL 3BKYL 2CRYA 3TJHD 4HZ6A 1ZKAA 4OOZA 4OD1L 2VQ1B 3W25A 5IW1B 2D4FA 4HHAA 1FPTH 1CFBA 3ULUE 4JFTA 3MUGB 1HINH 3U9PL 4QFUA 4G6FB 5IB3A 1F3DJ 4HXBH 4ZSOE 1ETZB 5F8QC 4LASH 1TQCC 2J5LB 2PYED 1G7LA 1E40A 5DVOA 1DQLL 3GRWA 3MRRA 3IAPA 2GK0B 2GUOA 4HHAB 1AQDA 5E8PA 3PN8A 1QOXA 2GJ6A 5IOPA 5D93C 4H20H 1QFWI 4QRPA 3QZWG 4DEPB 1AXTH 5E4EC 3KPLA 2WUBH 2A9NH 3JV0A 2XVPA 3QI9B 2HWZL 3MOBH 2VERN 2H45A 3EMQA 3ULVD 1S7TA 5IBUG 1KJ2B 3MRRB 4B16A 2JJTA 2GUOB 2G3JA 5A2BA 5E8PB 4LHUG 5IOPB 1K4CA 3KPLB 1HKMA 4MPKA 4FK9A 1OGTA 2VDLH 4FHBD 5FYJH 1UWUA 1SMDA 1A7QL 3QPQC 4PRPA 1S7TB 2OSLA 4HOXA 4X6BA 2E3VA 3CSBA 1HL8A 1N4XH 3PNWA 3TA3D 4LCUA 3HI6H 4KHTL 5MEQB 1A14H 1VHPA 2EH8L 4CDGC 1JN6A 1K4CB 2AJZB 2XQBL 5JW4N 2GIYA 5T3ZE 3VGGA 3PXJA 1OGTB 4P3CH 2WKGA 4M93C 5J06A 2QHRH 2D24A 3MS8A 5C0FA 1RHHA 4YHNB 2OSLB 1Q9WA 4X6BB 1G9MH 1N2RA 4ODHL 4LVOB 5E1QA 2B31A 1AE6L 5CQ1A 1ZA3A 4LCUB 2VQTA 2JIWA 2AJSH 1A3RL 1I7RA 3VGFA 5EBAA 1JN6B 1UH4A 3GO1L 3L5JA 3VA2C 4NC2B 5JLZA 1WDSA 4NQUA 3ARFB 3KHOA 2HJLA 2NY0D 2YLLA 5C0FB 1CGXA 1X4YA 3DXAD 4L4TD 1RHHB 1ZS2A 2C1OA 2AEIT 1LE9A 4UTFA 4GRWH 4LEOA 1CDYA 1RZFL 3B4NA 3KXFA 1HSAA 1N2RB 1XR9B 5C92A 2ZCLL 1ZA3B 5E03A 3CO4A 1RJYA 1ZSDB 3PWPD 3KLDA 4JKMA 1IT9H 3ZHLA 3IAGC 1V7MH 1XV8A 2ZUXA 3QRFM 1UKTA 1RULL 2XIIA 3KPRD 2HJLB 5F1KC 4GKLA 1U3HD 3SCUA 2EDHA 4Y19E 5F9JA 4D6GA 1X5JA 1LE9B 1R86A 4DK6A 3RJXA 4PJ9D 4DWHA 4QRTA 4PGDB 3G6LA 1FIGL 3VG0L 4NSKB 5J8OA 2OI9C 5BRZE 5CZXC 1EFXA 5I18H 1RUKH 2DLHA 1PAMA 3GNMH 3QT2A 3TBWB 4GO9A 5C86A 2Z0BA 4JRWA 4ZUWB 5J4MA 5GRVK 2YPKA 5L0QC 3QAZB 5F9JB 5L6YH 3C08L 5D1ZC 3CZLA 4JO1H 2DQEL 4KDWA 4U6VH 1X5XA 4QRTB 4RE4A 3H3PL 3MA7A 4OF6A 4OM0H 5DDHA 4LPCA 2EH7H 3C2AH 3MLSL 4GW5A 2WINA 2P43B 5EZOH 4IRSD 3A5VA 4YBHA 1CFVL 5J3HD 4I0PD 1NQ6A 1R3JA 2PXYA 4XZBA 5FUCE 1IEHA 1P4LA 1BGXL 3MA7B 4GQ9L 1OB1A 5F7FA 3SUVA 2R1XA 1TFVA 1DUYA 3MBED 1KCVH 2WINB 3OZ9H 3N1QC 2DI7A 3K2UL 2MTPA 3GBDA 2XNAA 4DTGL 3JV4A 3WNMA 2DOCA 3IK2A 3UTTE 2OJZL 5C08D 1R3JB 5HDLA 4HKBA 4AMCA 4KGJA 5JR1H 2PXYB 4L4VD 3BUIA 5HDOA 3JTSA 5FKAA 1P4LB 2WK2A 2DT0A 4Z7QE 4WLCA 3S34L 5E99L 1PG7L 3WQ5A 3M07A 2IH3B 2O5XL 4YHZL 3S6TA 2QLYA 4ACZA 1OGAD 4OIFA 5BYWA 1J0KA 4HPOH 2XNAB 4TULL 3BDYL 4F7PA 3SCVA 1R87A 1TQBB 3UDWA 3OKEB 1NM9A 3MGTA 4HKBB 2H8PA 3SKJL 2VLKE 1OINA 3HC3H 3V7MA 1QACA 3TT3L 5FKAB 3WXWL 4BSWB 4FQIL 5ADPL 3S5ZA 3SCOA 3VD3A 5FGCB 4HUKB 1OP3H 3QUXD 4ZQKA 3LPFA 1H3XA 3RVXC 5GIRB 1TTFA 2CJUH 4WI8A 3FFCD 4F7PB 3MGTB 4NC0B 1BF2A 2Q20A 2H8PB 1M71B 3CC1A 2XXMB 1K5NA 5D2LA 1FNSH 4OLYL 5L8KB 4YE4L 3ARGA 3ZE2E 3WDIA 1H49A 3CLEH 3BWUC 4D3CL 1IQWH 1BSIA 5DI8B 4QRQA 2UZXB 4DGYL 4HJJH 3VWJC 3L3DB 4DGIH 2R29L 1GOKA 4NO2B 1XYFA 3G04A 1ZMYA 15C8H 4A3HA 3SE9L 2IGFL 5D2LB 2X10A 3B6SA 4P4RB 1MPAL 4ZUTA 3QP3A 1MQRA 2W63A 1UR8A 1A1MA 2ZJSH 3FQNB 1T1WA 2AJ3A 3BN9D 4ATDA 3ARGB 4D8PA 4H7VA 1BFVL 3UC0H 3QWQB 4F7CB 3O2VL 3QCTH 4QRQB 2I27N 4LGSB 5JORA 4EI5C 2BNRA 4MAYD 2JF6A 4KHXH 1UWTA 3QFJE 5TE4L 2HT3D 3BXNB 3B6SB 3O6KL 1A1MB 2EEDA 1EO8L 4D8PB 1FAIL 5HI5C 2C4FU 2VSCA 3IFLH 4Y4HB 3NZHL 1TJGL 4GMTL 3MV01 1HT6A 2BOCA 3V9FA 1GORA 1HN1A 3TBSB 5D4YA 5EWIL 2APXA 3Q5OA 4S1SH 4DN4L 2X4UB 1WAAA 1E6RA 3KS0J 4PBWD 5E2UL 3W24A 1F4XL 2X6MA 1WBZB 3UETA 4XVTL 1MFAH 2ZG2A 2BOCB 2WQ8A 1YEEH 2AK4E 3WQ6A 2R8SL 3NDZA 1C16A 1A3QA 5IKCA 4LLMB 4XPGL 1MCQA 3MYZA 4WFEE 3VXPA 1K4DA 5CUSL 2BERA 1KEML 1EEZB 5FIEA 3BUPA 4U5KA 3INUL 4NN6B 5A3IC 3QDGE 3L1OL 5DD3H 4JFFE 1UA6L 4YH6A 1AFVL 3HPJB 3NJ3A 5KOMC 1REIA 3VXPB 1K4DB 5AZEL 3GUTA 3EYQC 4IPNB 4ZE5A 4QRRA 5EFDA 5DMGC 1INEL 4UFHA 4M1DH 3F5LA 1GQLA 2CSPA 3GK8H 3LB6C 4MNMA 3KYAA 3K3QA 1HHGA 4JN2A 4G6MH 3OG4B 4MNGE 5DQJB 2ESCA 2WW5A 1U8LA 4JRXB 3SO3C 3HI5H 4GXUM 2Z1KA 2P44B 4P2OA 3EHBD 1R3KA 3GUTB 2X5PA 4ZXBD 1Z0NA 3BP5A 3MXVH 1I1YA 4HXAH 4I1NB 3BH8B 4NNXB 5IF0B 3G6JA 3G6AB 2Q8BH 4KRPC 4YEEA 5D2LF 3MZTA 4PRHD 1XH3B 4XMPL 2CERA 3BVVA 5IFPA 5DJAB 1CG9B 1HHGB 5DWUH 4CADA 2VRJA 3H42L 5IGXH 1OD9A 1R33A 1U8LB 5BV7B 3GTNA 4KKBD 3OIHA 4KAQL 1FQ9C 4P2OB 5GISL 3RUGE 1UR9A 3ARYA 1R3KB 2F7RA 1I1YB 2ERJC 4JR9L 4ZS6D 5INDA 3RGVD 3G6JB 4YX2H 4EN3C 3GH4A 3VFSA 2ZX5A 4XCFL 1MCWW 1A1NB 5E2WH 3T8XA 3WY3A 4CADB 2COQA 4F8QA 3CFCH 1F02I 1FNHA 3QUMA 2HN7B 4NNPH 4S1DD 5GSRA 1YECH 4M7ZC 2D3LA 3T1WA 1YQVH 1JV5A 1ZLVH 5INDB 4OBSA 2PO6D 5LXGH 3GXTA 3U0PB 4AD0A 1B30A 2EZ0D 3SE4C 4ODVL 3ZKNC 1RUAH 4PGCB 4TX6A 3ALXA 3UYRL 1HHJA 2FHCA 5FK9A 3V8CA 4NQVA 5HHOD 4PY7B 3QUMB 1KCSL 5GSRB 1MCOH 3T4AA 4JE4B 1XIWA 2HH0L 3QDHA 3T0EB 4M1RA 1ZANL 3TJEL 4WY7L 1AJ7H 3VCLB 4N8VB 4NKOA 3ULVE 2XA8L 3E8UL 32C2A 1R75A 1CE6A 1HHJB 5FK9B 3F7VA 1WAAF 1CXKA 4NQVB 3MV8E 5K9OA 3T0XA 2X8RA 4Y4FC 3OKKB 2ARWA 3T4AB 1WV7T 3FO0H 4W6YB 4U0RC 5EUOF 5JIWA 3LEYL 2AJVH 1VBRA 2VVSA 3IDNA 2ITDB 1H3TA 4QXTA 2F58L 3QDMA 1FO0H 4G9DA 4NKOB 3WY4A 32C2B 2VNCA 1CE6B 3MLVL 4DUXA 2C7FA 4WU5A 4ZFFA 4ERSH 3GRWL 5K9OB 3Q3GA 4OFKA 1H8OA 1RPQA 2GTWB 1I85A 4OGAC 4TNVF 5C0BD 2D9QB 3MZGB 4CCEA 5CCKL 2P8PA 4F7MB 5I24A 3QDMB 1Q0XH 2MPAH 5KOVC 4G9DB 1OVZA 4WU5B 4ZFFB 5LAXA 1FG2A 2FHFA 3Q3GB 5C0IB 3B5GA 3SCSA 1RUQH 2DH2A 2F53A 3S97C 1JTPA 1MHHA 1YNKL 2E8ZA 1FG9C 3WH7A 3UTQA 1M05B 4HW6A 2OXHA 3MSGA 3BP7A 4PMYA 2BSTA 2P8PB 1NP2A 1GUVA 1ZHNA 4L4TE 3CMJA 1DBAH 5LAXB 5F8RC 3ALFA 1FG2B 2ZNWA 1F8TH 2XGBA 4KKAC 3MUIA 4RBPK 4F2MB 4M02A 1DQQA 3PWPE 4M24A 3G6JF 3HZKA 1VADA 3RGHA 2VWEC 3UTQB 3WNPA 5E0CA 1C8XA 2BSTB 1H11A 3VFUB 1JGVH 2WZPD 1XSKA 3BVNA 3IFNH 3RX8A 1DJSA 3PP3K 3QDAA 4TOQA 4D6DA 4OLXL 3LKRB 4V28A 3WUFA 2F54D 1AIFB 2VN4A 3MYJB 2VH5L 1R3IH 3L3JA 3TPUA 1WEJH 5GJTH 5M95B 3OPZL 4I4WA 1VADB 5KSVA 3SOBH 1N26A 2I5YH 5T1LB 4UT6H 2B39A 3BVNB 4W93A 1AGDA 4JFHE 3A23A 2KPNA 1EPFA 4WHYG 4M62L 5SV4A 5DVKA 4IISA 1ZEAH 1N5AA 4NQTA 5F7KC 1DANT 3PHOA 1KLGA 3FZUD 3L3JB 3TPUB 4QKXB 3UROR 1WSST 4I4WB 1KLUA 3RDTD 1U8QA 2ZNXA 4FQQA 4EK7A 5KSVB 4PB9H 3NH7H 4RAUA 1QNOA 1O6IA 2X9YA 1AQKL 3MLZL 4DAGH 4M7KL 1H1NA 3LS4L 4U1NA 1AGDB 3UTSA 2WW8A 3U0WL 1U33A 4E41A 1I9JH 4K23H 1QNZH 4NQEE 5GGUA 1FVCA 4LU5H 2V6HA 2CBVA 1N5AB 2G2RA 3I6KB 4Q9RL 1KLGB 2FEDD 2RR3A 4HFUH 3VG9C 3CPLA 1T83C 3LKOB 1RIHL 1KLUB 4WW2A 1U8QB 4FQQB 4O2CA 3HMXH 4QTIL 1ECEA 1S7WA 4M82A 4WSJA 4KI5E 3OF6A 4XHJD 3VRLE 3HS0A 5C08E 5MHSD 1Z3GH 3FRUA 3DX9A 4E41B 3HMWH 4L4VE 4YDVA 3BLPX 4FTVB 5GGUB 1FPTL 1QBLL 2HRPL 1PLGL 1NBYB 3CPLB 1KCRH 1HINL 1YY9C 4LPYA 1K85A 4IMLA 1MIMH 4HXBL 4O2CB 2JJTC 3H6JA 4M7LH 2CKBH 2BSRB 4LASL 3LDBC 1A22B 3WJJA 4F58H 1FO0A 1RIVH 1MAKA 3RL1A 3HS0B 1DEEA 1EBAA 1XF3A 3FRUB 3DX9B 3IDYB 3ZKXC 4YDVB 5CLWA 1MCPH 2D9CA 4XPHH 1E55A 2VRAA 4N8CH 4H20L 4YHGA 1AXTL 4IMLB 2WUBL 4Z7NF 2A9NL 1C91A 4RFNC 3F58H 2VC2H 2NX5E 3RL1B 1DEEB 1I8IA 1XF3B 2XVNA 4YN5A 4RAHA 1BREA 1KPVB 2VZ3A 1GIGH 4KJQC 3LH2H 3O4OC 4G8GD 3B2VL 3VX1A 1QOKA 1R3LA 3K2MC 3S5YA 4AQOA 3A67H 7A3HA 2VDLL 4F15B 4EIZC 5FYJL 4QLLA 1I8IB 1A6TB 4JM2B 2A1WH 5EIVA 2BMKA 3IJHA 2J4WH 1TPXC 5DSCA 1N4XL 3HI6L 3T04D 4U1IA 5MI0B 1A14L 5B4MD 2R15A 2IPTH 4JJ5A 4PBXA 1XCXA 3O6LH 3ZTJG 4XC1H 1PZ2A 1W8OA 3FONA 4P3CL 4Z6AT 2FH8A 2QHRL 1EK3A 4HS6B 5JW4R 1WZLA 4URTB 4PJEB 4JG0H 4JZ5A 2I60H 1F90H 1G9ML 4LK4A 5IHBA 4HA1A 3BGAA 4R6UA 1QBMH 4WU7A 4KK8D 4GIAA 2AJSL 3TO2A 4JDVB 3JWOC 4JJ5B 4MLSA 4XP9L 5ITFA 1K3ZA 3AB0B 3FONB 2P24B 2ZUSA 3GDBA 3ARDC 1JF5A 1KXQA 3MV7A 4WU7B 2DQIL 3TCXA 3PJSA 1U91B 4F37K 4WEMB 3TO2B 4XI5C 3BKML 4Y88A 3FOMA 3S36H 1IT9L 1Q94A 1V7ML 2BNUA 4GI8A 4DKEH 3MRMA 4AC1X 2EYRA 2A3HA 2NTFB 2NW2B 3GMQB 3FN0H 1QYGH 1RVFL 1DWHM 2B4CH 4WW2F 1GNXA 3HRPA 2G41A 4NJAH 3FOMB 5CSBA 3W2DH 2FWOA 1Q94B 3LRHA 4F9LA 4OF7A 4PGBA 1A5FL 3MV9D 1MWAB 5I18L 1RUKL 3MRMB 1UA7A 2EYRB 3OKYA 1ISYA 3P9WB 5L6YL 3OG6B 3RIFF 5GJSH 3R0MA 4JO1L 4CW1A 4ODTL 4OM0L 3PZ9A 2ESVE 4MQSB 2EH7L 3C2AL 2FWOB 2PR4H 4JJHA 1AY1H 5EZOL 4LXFA 3QPQD 1WBYB 3QIBA 1T20B 4H0GA 4JO2L 2GSIA 4IOIA 2AKRA 1M4KA 1Q6DA 3LS5H 2OR8A 5I15L 1KWKA 4PYGA 5CEZH 2M1KA 1IEBA 2P5EE 1GQIA 1IKFL 4HLJA 4QTHA 3QIBB 2X4RA 4D6HA 2GSIB 4IOIB 5JO5A 1QP1A 4J23A 4PRHE 1AR2A 3BEVB 4HP5A 3WF4A 1S5HA 3DSFL 5J7CC 3I84A 4IDLA 1S3KH 2EEAA 4D1IA 2IAMA 2CPUA 1JPGA 1G9MC 4MXQC 1CNVA 1IEBB 3L3KA 4HPOL 3D0VB 2C26A 4L3EB 1U92B 3RPMA 1B9ZA 4HH8A 4LGPB 2P8MB 5JO5B 5BXFA 5C0NC 1CECA 5EU7E 3HC3L 5KG9A 1LO5A 4LYPA 4MA8H 1LF1A 4R5EA 2GDUA 2J4GA 3CPUA 2W59A 5BV7L 1CXFA 5C0RH 4DO4A 3L3KB 4NC1E 3V6ZA 1CLVA 3BSZL 2CJUL 2OQJB 3PG2A 5BXFB 2YSSA 3VXUA 4TSAH 5HTSA 4P2RA 5KG9B 5CZXD 5HHOE 1LO5B 3BUYB 1FNSL 4UT7H 3GMOA 3T65B 3LPWA 3CLEL 5HHNA 5D1ZD 4Y4KC