1CXIA

Wild-type cgtase from bacillus circulans strain 251 at 120 k and ph 7.55
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
publication title Crystallographic studies of the interaction of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 with natural substrates and products.
pubmed doi rcsb
molecule tags Glycosyltransferase
total genus 231
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1995-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxiA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxiA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cxiA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cxiA01
1A1MB 3QOMA 4KROC 3M1BB 1CLOH 5F70A 3TLRA 4XNUH 3GH5A 3TNNA 5ITFA 4WWKD 2WHLA 4JO2H 4DOHB 2I26N 5EC2B 5C0GA 4JFDB 5GRYA 4XP1H 2H41A 1ETZB 2ZG1A 5DQJA 5E94B 3T0WA 4EDWH 2HH0L 5CILH 4UZSA 1B9ZA 5JIWA 1A14H 3O2DL 3PHQB 1LP9E 3D0VB 3MBED 4PJ7A 4X4ZA 4M6NL 5TDNA 1QWNA 1WTGT 1MEXH 3LEYH 4M1DH 1RUQL 2VE6A 3QIBB 5J11C 5T1MA 1RHFA 3C8DA 4I48A 4C56B 4UCFA 2VR4A 4KUZH 1FZKB 4YXHH 1C93A 1N6QH 2Q8BL 5TH2B 5FF6B 3MA7A 4ZE5A 2EXWC 2I60H 3BVUA 1KJ2A 3PNWB 1EO8H 2EYRA 3ISWA 3RGVD 3B9KD 4OV5B 2XZAL 4KXZH 1BREA 4CKQA 1PZ5B 1QBLL 1R3IH 3I6KB 3DHPA 2FWOA 1J8HD 4F15B 2FO4A 3VDAA 3T4AA 2DWEB 2D3LA 1KGWA 4R5EA 2R2BB 3CUHA 3P3YA 4NSKB 1M1SA 3WIHH 2ICES 2ZJSH 3QCTH 2DM7A 3FQWA 1KGXA 4NDMB 1Q6GA 3KJ6H 2OR9H 4LLQB 1CICC 2Q6WB 2OL3L 5EH1A 5EZOL 3FOMA 5IW1B 5AWNH 2FX8H 1L0PA 3BN9C 3G6DH 3KPQB 2E7HA 4U49A 5KSBE 1YA5A 2V6HA 4HMEA 2DKSA 4L4TB 1MW2A 1L7IL 1ZT4B 2G9HB 1W3JA 3BJLA 2YBRB 2V5RA 4JPIB 1H8SA 3QBTB 4G8EB 2A9NH 3ZO0A 2O26U 2IFFL 5GGUA 3SGJA 2H32A 3OZ9L 4D6CA 4RE2A 3H55A 2WCGA 2BERA 1WEJL 1J8KA 3NFPA 3O3AA 4YX2H 1EAJA 1HHKB 4JO3L 4ZUWA 3BQUA 4Y2DA 4LQFL 3DV6A 4K2UL 5CKAA 3VH8B 3V0AC 3WEXA 4HZ7A 1OTTC 3G6JB 2QEJA 2DH3A 3BT2H 3O0RH 2FECL 4ETQA 3D3VB 4Q9QH 1MRCL 5CD3B 5C9JA 4AEHL 2VQ1B 4WEBH 2R4RL 5HHQB 1E1EA 2HT3D 4X9BA 5B39B 5CZXD 3MO1A 4IOSD 2JB5L 1S7QA 3SDDD 1XC6A 2NY5L 4R0LA 2Y4SA 4UQDA 2VI0A 3M6DA 2NY3D 3BX7C 4PRWA 4FTVB 4GI6A 4DZBA 3GBEA 2PXYB 3O4OB 4IDLA 2YWZA 2AEPH 2DQGH 5EZIL 2FL5A 3L4UA 1I9RH 4BSVB 1LF1A 3E1F1 1HSBA 4NSBA 2UY3A 4U5IA 3RVXC 5IMOA 2FJGB 5D6DC 4L8DA 3LAFA 4IBLT 1C16A 5CZVH 3U2SA 4HG4K 4H8HA 1DBBL 3ZJ7A 4FLQA 5E8NA 2YFOA 3DV4A 1CGWA 5K33A 4LPVA 3KYNA 3A6OA 4X6DF 3ZKXB 3ULVL 1IE5A 3OBAA 3HUJF 3NIDE 1KTLA 3ROLB 5FECB 4XPGH 4YZFF 4K3DH 2FGWH 1BGGA 1MWAA 1SJHA 4NQEA 2BS9A 2MQ0A 1IM9D 1BZQK 1C3FA 3BP6A 1YJDL 2ZSWB 3QUMH 3UTZB 3ARBD 3BO8A 4AL8H 1QRND 4UNUA 1N0XL 3AU1A 5GJSH 5IJKC 1K4CA 1V6YA 4PUEA 1VA9A 2NY6C 3QNZB 2BFGA 2EIZB 5D93C 4WY7H 1G6RL 5FAAA 1HSAA 1P4IL 1ERNA 4R4BA 3BDXA 1ZHKB 3ZKQD 4ODVL 2W9EH 1F5WA 1S46A 1WZ1H 4X9YA 3VXSE 4MNHB 2V7HB 3ZKSD 4PV9B 1DQLL 1EOKA 2F54E 5C0EA 3LQZA 1B31A 4AIZA 1RUKL 4AMWA 3RTQB 1XGZA 4PJAA 4AENB 3KL5A 3WD0A 4U31A 3MUY1 1FGNH 1UD2A 3VSVA 4PB0H 3ILQD 3W25A 3GKWL 2VAAA 4TVSa 1F11B 1CLOL 3CUFA 2NY1C 1F6AA 1UB5A 3GJEB 4XNUL 4N8VA 2VAJA 3T8XA 1FV1B 1HKLH 2APWA 4DQOH 2DMKA 5BROA 2W60B 4XT1C 4JO2L 3U57A 4PR5B 1K9EA 1MFCL 1BJ1H 4XP1L 3DWTA 4EDWL 3MV7B 5CILL 4DEPC 1ZLVH 1A14L 4V28A 2VQTA 2FE0A 3MNWA 4OCWH 2Y9RT 3EO0A 3UBXA 2A6KB 1DQQB 2R2EB 2GTWA 3F5WB 4CRPA 1BQCA 1BF8A 4OZGA 5E56A 1OL0A 1JAEA 1KF9B 1JV5B 3AAZB 4M1DL 3F7VA 3TTYA 3TVMC 3BRDA 3KPSE 4YXHL 5E8OA 4ISVA 2CBVA 1DR9A 4ZS7L 3X13B 5I0DA 3GK8H 4WIWA 1K3ZA 2E5EA 3C08H 5HGDB 5D6CB 4ZFMA 4IMKC 4H2CA 1IEAA 3FB5B 3QO0A 2IQAA 1U58B 4FNPA 2MCPH 4YAQB 1BWMA 1R3IL 1MVYA 1ZVSA 3X11B 4KRNA 3VDCA 3GI8L 5JXAH 3GXIA 3MRDA 4G9FA 3RM4A 3OAZH 3ZTJG 1GOKA 2PWDA 1I3GH 5MEQB 6TAAA 5DD0H 3ECBA 5AG8A 1R87A 1LDSA 3QCTL 1NGQH 4JRWA 4OLWH 1KLGB 3ECQA 1MI5A 1DWJM 5CD5D 4V2XA 3ARDA 3KPRB 3QDGB 1NCAH 1RHHA 3WNMA 1WWWX 3BAXA 5AWNL 2FX8L 2Q76B 3VIOA 2HKHH 4EN3B 1LL6A 4U3CA 5I1IL 3QEQE 3AXHA 4L9LB 4WJXA 4LSTL 2WB5A 4L8SB 1FFNA 1EEZA 2BP3A 2GK0A 1LO2H 4XXDB 3QQ9C 3LN4B 1B3XA 2H2SD 5BVPH 1QSEE 2A9NL 3EJSA 4ALAL 1E27B 4K55A 5D7LD 4MTVA 4YGVA 4MQXD 2XVPA 5C71A 4M61A 4YX2L 3JVGA 5MEOA 3OB8A 2CBIA 2EYSB 5IVZB 3C6SA 1JHKL 3DURA 5EU3A 3UG5A 5AAWA 5HVGB 3ZKMC 3BT2L 5ID0B 4Q9QL 1Q9WA 4RFEA 1G9HA 2NX5B 4J3WA 1FGVL 3FFCE 3DX1A 4WEBL 4OIAA 1UQSA 4FQXC 1H0GA 3B9DA 2YD1A 4K9EC 1X4ZA 3MV8B 1J01A 2QQNH 2EZ0D 1FORL 5D2NC 3V5KA 4XNQA 4TN9A 4ZFOA 3GUTA 5F3HA 1EPFA 2BFVH 4A3HA 2YPKA 3GMMB 1F2QA 1UCBH 3H53A 1D5XB 1LVEA 4RX4D 5A6LA 2AJSL 2MHAA 4IS6A 2VWEC 2DQGL 3MLWH 2AERT 4AZBA 1I7TA 1I9RL 3QGVA 1W72H 1CL7H 4AT6A 2DD8H 5I30H 1H15A 3C5SB 5DFAA 2ZPKL 2E9IA 3ZHLA 3N1FC 2DQHH 5FYLE 4QY8A 4GRWF 1QI3A 1D9KA 4NRYA 3PZTA 4JG1H 2R0ZL 4IRJD 3U7WH 5EPMB 3WNOA 2VR9A 2FYYA 4XPGL 1VBUA 2PXYC 5INDB 4ACZB 3ETBF 3O4OC 3QHMA 1YN6B 2BVYA 2LE9A 1P7KB 2CKBH 4M00A 5J1SC 1RURL 2AJYH 2IANA 5GGVH 2YA2A 5E8EA 5J1AA 4XP9H 4AL8L 4KI1A 4NO3A 3KYOB 4YDVA 5DA0B 5C8BB 5FA3B 5GJSL 2NLJA 4JL1A 3SJVA 3ZKND 4MAYB 5LVEA 2X1IA 2J7HA 1VHPA 1JYVA 3DDGA 3AXIA 1FVEB 4WY7L 4C83B 1I1FA 2EH7H 4KK5D 2M2DA 1VBRA 3QHFH 3UC0H 1HQRB 5GGTH 3PABA 3VFSA 3HI1B 3WLWC 4AZ5A 4QF1B 3VXOB 4M6MH 1TVPA 3AHZA 2WXDM 2W9EL 4GT7A 2CXKA 4LLDB 1WZ1L 4JPKH 3HNSH 5C0NC 1I7ZB 3HLAA 3O2WH 2EDJA 3QUZB 2FIKB 1HF6A 1MSPA 4NQXB 4DM1A 5I1JH 1XGQB 32C2B 4ZFGH 2J8UB 3RNKB 3SUWA 1CG9B 2W0KA 2XWEA 1YN7B 1FGNL 1ND0B 4EBQH 1ZA6A 4JFFA 4PB0L 2XZQL 4PJBE 3BUBA 1H09A 3HUJA 4GW5A 4LNVA 2YHGA 5E5MA 1JAKA 4CNIB 4DQOL 3L4XA 2OZ4L 2X2YA 4KPHH 4PJ8B 3LHPH 2FB4L 2OYMA 1HH9A 1PS3A 1ZEAL 3QSKB 2EDLA 1V05A 4FFZH 4ZXBD 5BXFA 3QI9B 2H45A 2GJRA 5AUMB 1KJ3L 3CV5A 3ROOB 3JSSA 4DWSD 4HMDA 3ZJ8A 5K9JH 4UT9H 4U7SA 4N8VG 5DJ0A 4P5KA 3WF4A 2I9TA 1BBJA 5C09B 1VB9A 3GK8L 4AZ7A 3GMQA 5IXEA 4BSWA 1X5HA 3TEUA 2MCPL 4K7PY 5DK0A 1X5AA 4M43L 1KB5A 5JXAL 5DMJB 4QGYA 1U8HA 5DTFB 2BNRD 2JK5A 1HN1A 3JWOC 5F89B 5KSAA 3S5YA 1I3GL 3ARFD 3WN6A 5DD0L 1BVKB 4L29B 3VIPA 2VLRA 4OLWL 4G3YH 1XR8B 3F58L 2A6JA 1HJXA 1CDIA 2LV4A 2ZCLL 4UFIA 4WUUE 3ZDYE 5C0IB 2BX5A 2HKHL 1U8NA 3SDYH 4Y16D 3M8OH 3QCVH 1JPTL 3K74B 5CCKH 1W0YT 5I1AA 5IBLD 1KLUB 2LAGB 5D71H 1AQDA 2L0DA 5IB5B 2A83B 4GG6F 1LO2L 1YYMH 2F18A 4Y5YA 1K5NA 3QH3A 4E41B 3U79A 4GRMB 5BVPL 2B7DT 3L7EA 3HE6C 1BFNA 4PMDA 3C8HA 4BQ9A 3MJ8B 2YFNA 2QSTA 1AQHA 2FHCA 3U7YH 2XNAA 4D0BA 4OCSH 3JTTB 4LLWA 3WY3A 3VWKD 5BXRA 4EN3C 4J6RH 3QUXD 5D9NA 4JZ5A 3CUPA 3MLXH 1HI6A 4JQVA 4R97B 5D1QC 2GQHA 4X99B 2CDGA 4L9LC 4LK4A 1ES0B 1TZGH 5AC5A 1XF5A 5D1XC 2NZ9D 3T0EC 4UQ9A 3JWDC 3MRPB 1RULL 2KBGA 3MRFB 2JIWA 3S3PA 1ED3B 4NO5B 2A74B 2QQNL 4FQ2H 2X4SB 3KL0A 1IL1A 1NWTA 2BFVL 1RZKH 4ZNCD 4B15A 4R96A 2PF6A 1Q9LB 2V2XA 2O92A 5T1DH 1E71M 5DJZA 5GS1B 3CK0L 5DJDA 4XPAH 2ICEB 5HJ3B 5C0FB 3DUSA 5ANMB 3MLWL 1QKZH 5JIKA 3IT8D 4FOMA 4X7TB 3VFUA 1OTUC 3MNZA 1CL7L 5IQ9B 2DD8L 4U1JB 3ALWA 5E7FA 1D5MA 5DGRA 2J88L 4LMQE 5HI5C 4A6YA 2CDFB 4NN5B 1UWEH 2DQHL 3WEMA 4ZO9A 1XF4A 3VA6A 3ULUH 3U7WL 1F6LL 1U9KA 3PWUB 1CTNA 2AJ3B 5IB3A 3ZO9A 4PJIE 1KBGL 3K3QA 5C07D 1JRHH 3O3DB 4QRPA 3VX0A 1QHOA 2D7NA 2CKBL 3U46B 5GGVL 4P2QD 4HEPG 4BQ5A 2NMSA 4LSDA 5CSZA 3HG1A 4POUB 3WQWA 4PJFF 4MMZC 4QKXB 4ELMF 3H9SE 2XWTB 3CDGB 1F58H 2J7CA 1B6DA 2NY7H 2LQRA 3QHFL 1AGFB 5DMIH 5GGTL 5IDIA 3SDCB 4OZHF 5DVNA 5HPMB 4G6JH 2W67A 3MGOB 4MDPA 3BZFB 2D7TH 1V7MH 2V38A 4MJ5A 4MB5A 1D6EB 3AROA 4JPKL 4ZS6C 5KVFH 2EDBA 4L4VD 1T89C 1LD9A 3ARYA 3U0TB 3N1GC 2MFNA 4HT1H 5I1JL 1FYTD 1GZQA 1EDTA 3G9VA 1CBGA 2YA1A 4HZLB 1IC7H 4TVPH 2NQCA 4WWID 3CC5A 3RY6C 5MEND 2WW5A 2Q7YA 2RGSA 3LKRA 2JIXD 4EBQL 3DROB 4N0UA 1UXWB 2EPKX 2JF1A 2ESVE 1WNOA 1EQCA 3RKPA 2ZWZA 4HA3A 1MH5A 1C08A 5DVOA 3SCWA 3F5KA 4KPHL 4Z7VE 3U9UB 4Z78B 4M9OA 3RL2A 2QF8A 5GS0C 1T7VA 2VISB 3EYQC 5I23A 1YQVL 3WXWH 3PDGA 4FFZL 3NOIA 1FL5B 1E0OB 1XR9B 1GOFA 3SGEI 3L6FA 3RDKA 4TUOB 4P2CG 5E99H 3FT4A 2F8OA 4KRPC 5K9JL 3SGDH 2X9YA 3BD3A 1I1YB 4ODXA 4RWHA 4UT9L 1Z2KA 2YUZA 1NCBH 4HJ0C 2XSAA 3VKKA 2AXFA 4JFXA 2H9GB 3PZUA 4OCYH 4PJ8C 3MTRA 2M1KA 4D8PB 1JZ3A 1ZVHA 4JFQB 5E8PA 2ICWJ 3D48R 1NCNA 3S4SG 2GYSA 1VCAA 4B9ZA 3QIUB 5IESH 4D94A 1X6LA 2ZG3A 3P9MA 5DQDL 3U36B 1OW0A 4MQTB 1YEIH 3QI9C 5JPNB 4ZXOA 2F15A 4OV6F 3BZ4B 5ICZA 1OGTA 1YECH 4XCCH 3MV11 2XTJC 5CLWA 1AKJA 4NKQB 4WI9A 3VDBA 5IMMB 3LEXB 1ZJBA 2P8MA 1N7ML 1CICA 4R3SB 3HE7A 3SDYL 3QCVL 1M6OA 4HX1A 5BXTA 3B3IB 1MNUL 4I2XA 5CCKL 3WE6A 1BZ9B 1LE9B 5D71L 2Z9TA 1PIGA 4NC1C 4EAMA 4HPHA 3HAEB 4XC1H 3T3ME 2WBWB 2EDEA 1HKMA 5BRZA 3PL6B 3WKMH 1A6ZB 2XTKA 4OF7A 4MHHI 3NYDA 1EJOL 1ISVA 3RA7H 1LEGB 4M5ZH 3U7YL 2WHJA 4OCSL 4N5EC 3HC0A 4PLJD 5IFAL 1V5JA 5HDBE 2G3JA 4L4JA 4YHIB 3JV0A 3EIFA 4I0PB 2BOCA 4J6RL 5EU5B 3QZWA 1A6AB 3MLXL 2UY6A 4G42A 5C0DB 3CUGA 3AZRA 1TZGL 2EXYD 3BUIA 3ABZA 4MNGA 1X3DA 1R8LA 3ZDXF 4YBLC 3CFBB 1N6VA 5I3DA 4BS0A 3GM0A 2CHNA 5TE4L 5A3HA 3KPPB 1T3FA 5ILTH 2RCSH 5B22A 3OKYA 5A6BA 1U3JA 3L3KA 2O9RA 4GQPH 2XY1A 3MLVL 4JJ5B 1EGJH 5CGYD 4HIJA 3B9KA 5TE7L 4LKXA 1EV2E 2VZ1A 5T1DL 2FECI 1VFBA 4HK0B 3TNMB 3EYOA 4M62H 4XPAL 1J8HA 2IG2H 4LEXH 1MFVA 1QKZL 3RVUC 4KH2A 1S7RA 4R97C 5LG1A 1MLCB 2NY0C 4NNPH 4OD2A 5EDXA 4PJCA 1A7QH 3IKKA 3VD3A 1CFBA 1E0WA 2G4FA 3WSQL 3O2VH 3ULUL 1NGYA 5IHZA 2YDQA 3KLAA 4I1NB 3S2CA 1FFRA 2BVEA 5GS1C 1MHCA 2WMKA 1JRHL 2FEEI 2J3SA 1OARH 1O7DC 4NNXA 1P5VA 1XIWD 5IEHA 2B5IB 2BOBB 4OF3A 3WH7A 4ZO7A 1Q0YH 4NQDB 1FHDA 5IK3B 3ZIZA 4KDWA 3ILPB 4IDJH 1U3HB 5HHOE 4NN5C 2BNQB 5TE6L 3WIFB 4XXCC 5DMIL 1NGXB 3WDQA 4G6JL 3I2CL 1V7ML 3DLQR 3D4ZA 5C0BB 3UPAA 1D3CA 4HHAB 1DL7L 3BD5A 3QDJB 2D1ZA 3BEVA 2G5RA 3C09B 4FNRA 4EI5D 1I8KA 3AMLA 1FZJB 3AICA 5ABFA 4RBPH 4L3EE 4AK1A 4Z2JA 3QEGL 4HT1L 1UM4H 4F7PB 4ONGH 5E2TH 4TVPL 1KB9J 4YR6A 1NAKL 1D2KA 5ISZA 3T1FB 2J5LB 5A2AA 2FJFB 3DMMC 5IMLA 2GY7B 3SDCC 2IAMB 1JMZA 1MVFA 2ATPB 1E70M 5F88A 1E55A 2YXMA 4JLRB 5DZLA 5L2KE 3RWIA 2B1HL 2WIMA 2BNUB 4ZPVA 2OYLA 4X80L 1HL9A 5DRNA 5L8JB 1Z3GH 4PJ5A 2Z8WC 4EKXA 1KCSH 3QULB 2CIIA 4PJFA 1NUDA 4ELMA 1NMBH 1XGRB 2Y6SD 3QXTA 3WD1A 5IROC 5EFFA 3GTNA 4X6EB 2XVGA 1UR9A 3BESR 3KPLB 4L8BB 4S1DD 2IJ0C 2VSCA 4OZHA 3MGTA 5E99L 1UWGH 3QQ3B 1HKJA 4JFEE 1A6PA 3FCTA 3GBLA 2YPLA 2P42B 2RJMA 1NCBL 2VN4A 4BYHA 4JQXC 4JCMA 4GZEA 3FQRA 3TVMA 1QRNA 1WK0A 2HFEA 2X7LB 5FM4A 2MANA 2Y7QA 1IGCH 5CBAB 2D31A 4XVTH 3DVIA 4IMKA 3FJTA 4GMTH 3SCSA 4AYFA 4UAOC 1YEIL 2XZCL 4YDIH 1ULVA 4LHJB 4V1DA 4PRBB 5CIPB 2CLZA 3EJZC 4W85A 1OBAA 1YECL 3MA9H 4RWYH 4XCCL 4D72A 3UBXI 2VLJE 1S8DA 3WFDL 2VITB 3BGMA 4EQ2A 1FH5H 3RWDA 4PBGA 4K94L 1PX4A 4P2OD 1CFQA 1GGIH 4RAVA 3TA3C 2V3EA 3PN8A 4CVXB 3TO2A 5I75C 3WUWA 4MA1B 1RP9A 1A9BA 4IIQC 5GQBA 1WIUA 4ZUUA 4HWZA 3MMWA 5E1AA 1ZK9A 3G5VB 4MS8C 3G04A 1ZGLP 2C4FU 1P5UA 4HWBA 4XC1L 3QCUL 3H42H 5E09A 3CFDB 3WKML 1RJLA 4G80B 1A7PH 4LLMB 3CPLA 3QAZC 3WS3B 4P2RD 3RA7L 3FFDB 4KJQC 4M5ZL 4NJ9H 3AI0A 3V0VB 2AABH 3MRCB 4LEOA 3WH6A 4NT6A 5GGRB 1CDGA 4HKXA 3CH1B 1BQHB 4HS3B 1GH7A 4NZDA 2C3XA 3BPCB 4HK3N 4M5YH 1UJ3A 2QLVB 4HH9B 4HUMB 1G0DA 3D87B 5EU4B 2VL5A 7CGTA 5KS9B 1BBDL 4S2SB 1NKOA 2X4OA 4LBEA 4FQXA 5DDHB 4EZMA 1P1ZB 2RCSL 2D7PA 2ADIA 3DX9B 4GI8A 3HG3A 3HU7A 5F7EH 2PR4H 4CN4A 5D2NA 4JRXE 1R3KA 3VU2A 2B4CC 4HA1A 2A6IB 4C59B 1AGBA 3N1QC 2IG2L 4NKOB 1MCWM 3QZWG 4X5XB 4NBYB 4JDVA 1WZMA 1IVLA 5J89A 2DQFB 2HLAB 1PKQE 4NNPL 4NNYB 4U33A 4JHOA 2XFFA 2G2RB 3VD5A 4KTEH 1A7QL 4GINA 1HJUA 3O2VL 1IEHA 1U2CA 5FM5O 4Z7WE 2AI0H 3PUCA 1R75A 5HHPA 1IGJB 4J4PD 3AS2A 2GJXA 4YHKH 4GAGL 3QXWA 4UV7H 1CU4H 3D39A 1F4HA 1OARL 4KJWC 3CH9A 5GZNC 2PTUA 3OHXB 2R1XB 1NSNH 3TM6A 1YEKL 4G8GB 5I76A 1UZ6E 1PGRB 4LCWD 3HFMH 5IW6B 4NP4H 4PTXA 4IDJL 1S9VB 3BOVA 5D7LA 1VGKB 3C2AH 4ZNEE 4W7VA 2IALB 1KXQE 4CCDA 3FB7B 4DTGL 2V5SA 4DN3H 4MCZA 5EC1A 3I3DA 4JRYB 3FQXB 3QDMA 4TNVF 4CVZB 3OG4B 1WIOA 1BFVH 2DJSA 5JUEH 1KPUB 1EDGA 4FABH 3DOSA 3ZE2E 4QLRA 2JJTC 3OR7A 1DDHA 5ETUA 3VPLA 4AZGA 2WAGA 3GEWB 1MCPH 2EDXA 3BPNC 2VDRH 1OGAD 5EB9A 4J3UA 1NQBA 2E3VA 3LPGA 2QQLL 4MJIB 4ZDHA 3IDIA 4X9FA 3A3HA 4GS7C 4NUJB 3UTTE 1WITA 4WHTA 1LO4H 4KRLB 1G7PA 2JJSC 4W93A 2JB6A 4U7KA 1B88A 4NO0D 4PJ9B 5BO1H 1O5DT 3I02B 3GXPA 4ODUB 4WU7B 3HZKA 1I4FA 5SWQA 1ZT1A 3FQNA 1KCSL 3FO1B 4P9HC 4XCNA 3H0TB 5EZJB 2JEQA 1NMBL 3WUBA 4LF3A 4GAYA 1QSFA 4GLRI 2BHZA 4OZ4A 3ULSA 1AO7E 2IAMC 4PGBA 1ZLUH 3FFCB 5KANI 4HJGA 3IAPA 5C6WH 1W8NA 4TTUA 3ZTNH 4LFHD 3OA5A 3C60C 5CJXC 2YKKA 3D2UB 3AIWA 4RGMB 2JTDA 5C0CE 3CHEA 3MUGA 1IT9L 3A47A 4JPVH 3PG2A 2JE8A 3D52A 2PUQT 4UMGA 1IGCL 2BXYA 3OIHA 3CZEA 3NGBB 4XVTL 3QNXA 5DMKB 4GMTL 1VKXB 4D2NA 1KBBA 1NP2A 1FPTL 3NTCH 1GIGH 1ZOXA 4NYLB 4ATLA 4YDIL 3VVGA 4P59H 5C8JB 2GCYA 4RWYL 5I8KH 1NM9A 4O2EB 3F5JA 2YOCA 3OKLB 4HGKC 3A22A 3WXVH 3WD3A 2AXGB 3SKJL 5KVMC 2A3BA 1UEMA 5IIEA 3JBG7 3JWOL 3V5DB 2GJ6B 3CMOH 4N0FB 1AD9A 1JK8A 1NUGA 3EDDA 2EIEA 2OK0H 4MVBD 4UTFA 3H42L 5LGJA 1MCFA 4Y5VC 5H2BB 2FGZA 1A7PL 3HE6A 2ZUMA 1DUYA 1MCDA 4NJ9L 3O2DA 2ZCKH 3V5HA 3W2DH 5IHSA 1G94A 1DBMH 4ZXBA 1TVDA 2YN3A 2MOVA 5MERB 1LQSR 4UBDC 1V0NA 2PYEE 3DUUB 4RMUA 5D1QA 3DBXB 3KPSD 2J7LA 5D1XA 3T0EA 2CMRH 4OLUH 3W82A 4K8RH 5E08L 3SE8H 4RMWA 3UTSD 3DYPA 2FR4A 4ATWA 1J1XL 5HY9B 1BOGB 2PR4L 1MOEA 4XBGA 1URLA 1V6WA 1RZ8A 5AG9A 1VADB 2B2XL 1S7VB 4BK5A 1P4BH 4HKJA 4PG9A 4Z7OF 3BP5A 5CUSH 2O5ZH 1LDPL 3RJXA 2BDNL 3RZCD 4FNUA 1IGFL 3JWDL 4XGZB 1QEWB 2W65A 4Z5RA 3FQTA 1UA6H 2I25N 3G5ZA 1B2YA 1A6WL 4QTIH 1CDHA 1S7TB 1CS6A 2UVEA 2VCBA 5A43C 4KTEL 1UXSB 1JNLH 1SM3L 4LLVA 4Z7UB 1KC5H 2JCCB 3OLIA 3GBMH 1KNOA 3ULUD 4KDTC 2JELH 2AI0L 2XI9A 4PJEB 2HKFH 3V52H 3NA9L 4XWOD 4Q9CA 2F8XC 4Y16A 2C1PA 1EFXA 5JUVA 4HZ6A 2GJZA 4XCYB 3SQBA 4P4KA 15C8H 1CU4L 2GSIB 3GMNB 1T5XB 3W5NA 1SBBA 1QSED 1NSNL 1EXPA 3OKDB 1XGUA 5JPMB 2IF7A 2HRLA 1MXDA 3HFML 4NP4L 4JG0H 4KAQH 3C2AL 1BLIA 1R86A 3VFGH 4I3GA 1HQ4A 1U8OA 4HUNB 3IFPA 3MUHL 4DN3L 4YPGA 3MJ6A 4CU6A 2HJFB 3ORJA 3WBAA 1LE5A 2P5EE 3QUXA 4PJHB 3CZNA 1BFVL 1DVFC 2VXSH 4PRPA 5JUEL 4GXUN 3GJFB 4JVWA 4WF7A 3AXLA 4JAMA 3NZ8A 3PZNA 1W3KA 2KL6A 3PWPB 4AIEA 1T89A 1NJ9B 3WBEA 2AJZA 1MCPL 2SEBB 2ORBH 1U8LA 3VXRB 4EE9A 4TVPD 2K1MA 5DD6A 4LRIA 4XPTH 4YQXH 3TZVB 3VNZA 2X4RB 2VOTA 3RY6A 3IETB 1LO4L 2YLAA 1YEDA 5EBLB 1WISA 4UNVA 3RMEA 1LK3H 4M8UA 3CAFA 3FQUA 5I6XC 3VWJB 1K6QH 1FVCB 1JPSL 2XA3A 1F4YL 3PP3K 3QIWB 4XX6A 2NXZB 3W0WD 4WKHA 3GNPA 5GS2H 4NCC1 3M17B 4B7IA 1CFTA 3VXUE 3IK2A 4HUWB 4JREC 2W38A 1WZKA 3L5WA 1HCVA 3VSUA 3KPNA 4GRLC 5EA0H 3UERA 4LLUB 1KIPB 2C7UB 2J7FA 2RGMA 1ZBKA 3P77A 4MMXC 4BF7A 3DRTB 1FZOA 2X6MA 1CLCA 4K71B 5MHSD 4P2QA 3FONA 1AR2A 3DXAD 4X0VA 1XH0A 4KUCD 1BPVA 1GC1H 3MNVA 4F33B 3PWLA 3PGFL 4HUVB 4FQQA 1FVDA 2VH5L 5ESAA 2MWCA 2CLRA 3E6HA 1XGPA 1UADC 4ZUVB 1EHAA 2HFTA 4D0CB 1WF5A 1GCYA 1GIGL 3SCMA 3GHBL 4P59L 5A2IH 1N8ZB 5B3JE 4X83A 4M3JA 3RPKA 4MD4A 4CUCA 5D2LF 3FT2B 5I8KL 4G5ZH 2XIDA 4JFDD 1Q6DA 1YPZE 1P6FA 5B8CA 3TJHC 5ACZA 3KR3H 2DQEH 3UJTH 1J7VR 4PCTA 2UWEF 4P23D 4XRCA 2OR8A 3MGAA 4ACYA 2PTTB 3UPCA 3QA3A 5IBUG 1ZB5A 1TJHH 3MUAA 2JIXA 3QFJA 1EAPA 5M7QA 2UYLA 3KNBA 2F5AH 5H8DA 3WUFA 5SX4I 3QIBD 3V0WH 5KVEL 5LCVL 4OZIB 4I9WE 5E1HB 4C56D 2OK0L 4P4RB 3BVVA 5GSVA 4RIRB 4WO4B 2IPTL 1WBYA 4XNMB 4NRRA 4ZOCA 5FKPB 2F74B 3KGRA 5GISH 5IB2A 2XRAH 2AKRB 2ADGB 1DBML 2AQ2A 5DS8B 4K7FB 1NH6A 3S35X 2VZOA 8FABB 4BA0A 1GONA 1B3YA 1XCWA 3LQAH 1XH3A 3AB0B 2QADB 1TJIL 4X0KB 5L88H 4OLUL 4K8RL 3DO7A 3SE8L 4MD5B 1LEKA 4PJXF 5M5DA 2DMCA 2GW5A 3SDXA 4XB3A 1MJUL 3BLBA 4UTBH 4Z77B 1WFNA 3MJ7A 1WFOA 5IB1A 1C90A 1IKFH 2X2IA 5DURB 3NN8A 4I3RH 5FYKU 4WUKL 4FLOA 2J62A 3N18A 1JPFA 3IS1X 4YC2B 1AIFB 2OCFD 4WW1A 4Y19B 1HYSC 1P4BL 3QEHB 1P7QB 2WWCA 2XUCA 3T77B 3RUGB 4OLXH 1U36A 2X4QB 1US3A 1OAZH 4G6MH 4L4TD 4FQJH 1DP0A 4WKAA 4NZTH 1UA6L 5F9OH 3WIHA 4DGYH 3U6RB 3IVKB 3BXNA 3HAEH 4M02A 4QTIL 2NY2D 5IMKB 2EO1A 4NZJA 4M48H 2VDKH 3QEUB 1JNLL 1CGVA 1KC5L 2WLYA 1GRWA 3GBML 3ZR6A 2JELL 4HC1H 3O3EA 2HKFL 1I8IA 4G9DA 3P30H 4X5LA 3LRMA 2VDQH 3VGGA 4KKCD 3JV6B 3Q0HA 4CN1A 4UINH 5DC4B 2DPEA 15C8L 4OD3H 3D3VD 3DSFL 4L8CA 2RBLA 5DD5H 1T20B 4L3CB 2W4XA 3C8KA 1NPUA 3SCTA 2MKWA 3ZE1E 2VVNA 5I8EA 4FQIH 3VXMA 3BCFA 3NPSB 1FHGA 4JG0L 5HVHC 4KAQL 1B3JA 1OWRM 4RISH 3HZMA 3HRZA 2Q20A 1TA3B 1H5BC 1YNKH 5KSBF 3D25B 4ZMAT 1PVHA 1CZ8H 1PDKA 4X6CF 3DO3A 4O5LH 4XXCA 3TH2T 2VIRA 4FTVD 4Z76A 1GYAA 1QACA 2J4WH 2PXYD 4I3SH 4TOQA 4C4KT 3KLLA 5FKAA 4O51B 5TDOB 2OTUA 3N12A 2PW1A 3P4MA 2HFFB 1X1NA 4OAWA 5HYJA 1QQDA 4WNQA 3RWEA 1CEOA 3D50A 3GZKA 2Z92A 4OQTH 2HVJA 3MRLA 4IMLA 5FM5M 2ORBL 3D5OF 2D22A 2Y8VA 1F3JA 4J3SA 4H25A 1E5JA 4XPTL 4YQXL 4DCQA 1NFDF 1PIFA 1YY9C 4G8FA 3DMMA 4FQLH 5EUOF 1U95B 3WLBA 3RNQA 1LK3L 5BS0B 2XG9A 2WBKA 2HTKD 5H94B 1NGPH 4G6KH 2EACA 4HH8A 1K6QL 4P46B 4MXWL 4M7LH 1JUFB 1XF2B 5FV2A 2XT1B 1AJ7L 2R1WB 3M45A 3MV9A 2FSEA 4MJ4A 1FL6B 4Q74A 3V4UH 5CEZL 3PP4L 4ZQKB 4LOUD 4LCCB 4NQCE 5IROA 3TZVC 5EA0L 5DFVC 3IRPX 3LV3A 3OX8A 4KVNL 2EEAA 5SWSE 5I79A 3QUMA 1RZFL 4F79A 1XIWA 1OQOA 5T1LB 2F8QA 3QIWC 2BSRB 4JQXA 1GSMA 1RV6X 4OFVA 4OZFB 1HH6A 3RTQD 1V6UA 1BLNB 2CDEA 2D73A 3NIDF 4WFED 1E72M 1T1ZB 4YFDB 1CDJA 1RZ7H 4UQ2A 3SKNB 4MD0A 4GH7B 2LTQB 2L7UA 4YXLH 3P73B 4NFCA 4HGWA 4H1LB 3EGSB 3H9YA 4G5ZL 4OZGE 4K71C 4GKNA 3MV7D 3KR3L 3NCOA 3UJTL 4NFDA 4FQHA 2HMID 5HHVH 4WDIA 3S37X 2R0WH 2V2TA 3D69B 3GSWA 3TA3A 1JDCA 2OSWA 5GRJL 1TJHL 1TG7A 1MVUA 1QA9B 3C5ZB 3VIIA 5IG7A 1V0LA 4IIQA 1IAKA 4HS6A 5SWZA 2PCPA 5D7KE 4D9QE 4RGOH 5FGBC 5C0AB 3CPUA 1EO7A 5KW9H 3TO4B 4DK6A 4LCUA 3CFJB 5CWSB 2XRAL 1CGUA 1ZA3B 1IAOB 1J05A 1S78C 4RBPK 3UDWA 5K59E 4RZCB 3HMXH 3QRGH 1CZ1A 4X4YA 2HVMA 3C9NB 2WSKA 1MCLA 5JHDE 2VDOH 1RFDL 2VABA 3LQAL 2O93L 5JBDA 5CIPH 4KKNA 1QBBA 3LRHA 1FO0B 5JMOC 2IXVA 4JFOA 5L88L 2OLDA 2ZOKA 5GJTL 3BP7B 2WLZA 2E4TA 3KPRD 2DM2A 3QDGD 4JFPA 5D7IB 2OBGA 1MCIA 1IKFL 3K0WA 1AC0A 1TXKA 3MLTB 4N90E 4I3RL 4BKLB 1U8IB 4KKAC 3MBXL 2UWEA 4IHOB 5J8OA 2BC4A 2AK4B 4GIAA 5A8QA 1JI2A 1S7XA 4H0IA 4OLXL 5M03A 4PRHB 1G9MH 1OAZL 2VDML 4G6ML 1P84K 4FQJL 1TQBC 4AH2B 3I6GA 3BMVA 4XHJD 3T2PA 1KYOK 4NZTL 1NC2A 4RQQA 4DGYL 1XCQA 4JN2A 4PJDF 4LLYB 2QADC 1PG7H 1E4WH 2VDKL 4M48L 4KC3B 3GXNA 1FAKT 4WJ5A 4HC1L 4QNPE 1WT5C 5I1HH 4FFWD 2NNAA 3AQUA 5H35A 3IDGB 3P30L 5IB4A 2YRPA 3AMCA 3MJ9L 4JPWL 3OMZA 4OF8A 3WO4B 3S88L 2V2WA 4G6AD 1E1FA 4JGUA 4UINL 3ZQ9A 2PYFA 2NW0A 5K9KA 1T66C 3GSQA 4OD3L 5KZCB 3U0PA 4RAHA 4E4PA 4PP2A 3R06A 5F96L 2NX5D 5DD5L 4TSBH 4UZGA 1FG9C 4QEGA 8A3HA 4NQSA 1K4DB 4FQIL 4PB9H 3EZ8A 1UM5H 3BMWA 3ULUF 4PD4K 3PDOA 4RISL 2O9PA 3NCEB 4BQBA 1LP9A 3C5JA 1B0GB 4OUEA 1CZ8L 5HI4D 1NMCC 4O5LL 3VXTB 2J4WL 1UKPA 3O6AA 2OYPA 1QSZA 2V5MA 5J06A 5DJYA 4U6XB 1KTCA 4JM4L 3GMRB 2VLKB 3TWCH 3QPQD 2HTLD 2VO5A 1DWAM 4JY6B 1KIUA 2V9QA 4YEEA 1AQKH 3VGBA 1S9YA 5T1KA 4W7WA 4BQ8A 2OJZH 4WW2B 3BC9A 1BYAA 4HAFA 4R4NC 1MAJA 4YPJA 2GDVA 4ORGA 4PJGF 4LP4A 5GIRB 1ADQH 4XCEA 5E2WH 2BSTA 5T33H 1MY7A 4U1SB 3SJVE 1J0HA 2RFXA 2MQ3A 3VFWB 3KXFE 2WUBH 3L95B 3IDMA 1FZMA 5EOCL 5A2KH 3Q3GA 1NGPL 4G6KL 1W72A 1ZS8A 5INCA 3L3IB 1CQYA 4M7LL 1SEBB 3WSUA 5IEKA 3IDUA 4MAYD 5CEXA 2IPKA 1CK0L 2ZE0A 4HU8A 5EBMA 3HPJA 1BJ8A 2DQCH 3STBA 3V4UL 1BHGA 2CIPA 1Q72H 1WTLA 2XKNA 3KPMB 4ZO8A 4DW2H 2QHRH 3SURA 5KSBA 5MI0B 1T83C 1IC5H 1MQRA 2X4NA 4FXGA 2P7TA 1AD0B 3UPRB 1N5AB 2CKBA 2AV7A 1KIQB 3QUYA 3QUZD 4Z2IA 3EOAB 4X6DE 4ZUSB 5CJXA 2E8YA 3CZKA 4JHWH 3S9DB 4X5WA 2FX7L 4YZFE 5EBWA 5HHOD 1VDGA 1MCHA 2BSSB 3OXRB 3AS3A 3O6MH 1RK0A 5CPTA 3MRIB 5BVJB 1PX3A 2NTSP 4YFLF 1C8QA 4E5XA 3L4TA 3MROB 3BJ91 1WBZA 3LS4L 4LCCC 1NP0A 2ZUQC 5FO9B 1RZ7L 1JWUA 1CD1B 2D0FA 4QAWA 3RVTD 4U3HA 4RGNB 1MUJB 1UOKA 4YXLL 5KTEH 1GXEA 3IGAA 4PJ8D 5BJTB 1A6TA 2R9HC 4P8VA 3BKMH 1MCSA 5JNYB 2XWJB 5HHVL 4QHNA 1LO3L 2FATH 1B0RB 1LO0L 4MA3A 1K8IA 3DVNA 1UWQA 2O61B 1CT8B 4LIQE 4BSJA 3S5LB 4FG6D 3U9PH 3AY4A 3PWVA 1PG7W 4LSRH 4YNYB 3GH4A 5D5MB 3A6CH 1UVQA 1V08A 4RGOL 5C09D 3SBWA 5KW9L 4QXWA 1X5GA 1KR0A 2CYGA 2WW8A 3HPLA 4Y5VA 4MWFB 3LKNB 4MNJA 3LKQB 4PJBF 4M7ZC 3HMXL 5BV7B 2CBJA 1WCQA 5MP6L 3RVWD 2VDOL 1FSKB 4JFED 2BY0A 1P2CB 3QQ4A 2VR5A 3QJHA 4MJ6B 3GSOB 3C5ZC 1WPCA 2RHEA 3CLEH 4K8RD 4ODWA 3LDBC 5EFIB 5D72H 3MACH 5J6GB 3BIKB 3L3DA 4OM0H 4X7SH 1HNYA 1I9JL 2CRIA 3D18A 2C7FA 1FP9A 1V02E 5C92A 2D03L 5IBTH 3WN5B 3EMCA 1ODZA 4NPYA 5FYKH 3EOTL 4NHCL 3SPVB 4HIHB 4OIIL 2F7OA 1G9ML 3WNPA 2GK1A 1AGDB 3VXSA 5C0JB 3EYUL 4NC0B 4E41D 1YMHA 3EO1A 1G7HA 1PG7L 2NSXA 1ZLUK 3A6BH 3OKKA 1ZT7B 3MODL 4ACPA 4CMMA 5KAQF 5ESQA 3QUKB 2X4TA 3VD7A 5T5FH 2WZIA 1GOGA 2A38A 1M53A 4KDTA 3V4VH 4Y1AE 2Z31B 4CD8A 4FXKB 1K2DA 3D6GA 4Z2HA 1JNHB 1Z0NA 2EDFA 3ARPA 3CO4A 3K46A 3W5MA 1JD9A 4MLSA 2ITDA 1MJJA 4TSBL 3TN0C 4AG4H 2WIIB 1N3NA 4ZSOA 4PB9L 3RWJB 3OWEA 1OQXA 1UM5L 4XPFH 4N1HB 4C7FA 2CRYA 4PYGA 4R2GB 1U8KA 1R5VB 4JZOA 2HFGH 2YEZB 1A3HA 2OMBA 5D8ZA 3N13A 3ZJKA 2DIBA 4G6FB 2ZXDA 2XQBL 1SYVA 3G6JF 4CAGA 3PJSA 4UNTA 5KSVB 1HXYA 3SDAA 1UWXH 3WO4C 2YKLL 1NGWB 4TSAH 3AXXA 1YY8A 1AP2A 1DVFA 1GL4B 1HYRC 2NYYC 3BFOA 4TYUA 1U2HA 2K3TA 3KWWB 3KPSA 1AQKL 3ZL4H 1V0MA 3F8UB 4ESKA 4X98A 5JW5B 5E2WL 3QHNA 5T33L 1T1XA 4JRXD 3DX8B 4JM2B 4MZ3A 3HCVB 1EIBA 1OGBA 1VJSA 5C6TH 4B9YA 3MRNB 2WUBL 4XMPL 2EDOA 1OY3B 1T4KB 4HCRH 2J75A 4QYOA 3RZCA 5DQ9B 1MLBB 2YS4A 3SKMA 1IILE 4ML4A 3V6ZA 4QOKE 3ZR5A 1GJUA 3DIFA 2JIEA 5HYSB 1U42A 1KXHA 2PBOA 4LVHC 4PGEA 1RK1B 1VFMA 1PKOA 3MCKA 5GS2D 4NIKB 4Z8FH 3KLSA 2D0HA 3FTGB 2VJXA 2DQCL 2X70A 3O9WC 1QPPA 5CEZD 4RCAA 4AWEA 1Q72L 2QHRL 5B4MD 1K9TA 3BZDA 1GVYA 1UR2A 2F53E 1S5HA 4GRLA 1IC5L 1UWTA 4GRWE 1ZHLA 4F7EB 3QP3A 1SJEB 5CGTA 1QSEA 5D8WA 2WMJA 4JHWL 1TVHB 4PRAB 3MRMB 2GT9B 5CJ8A 1NDGB 2V7NB 5A2FA 2X9XA 1DJSA 3GIVA 2Z8RA 3QNYA 1DBJH 3VFOB 1IRAY 1KEGH 3W6LA 2X09A 4TOYH 3VFMB 3BUYB 5KVGH 3H8NA 2VDLH 1YMME 1JN6A 3DX6B 2R0LL 5MI0C 3PQYB 2XSBA 3RPIA 4DO5A 1P4LB 4NOFA 3PXHA 5J12C 1I8MA 3THDA 1E28A 5CJQL 2DQIH 5DK2A 4UQ3B 4XH2A 5HYFA 5F9JA 1RZIA 5TQ2L 5T3XH 1JGEA 3RM8A 4M93C 5GSRB 2ENYA 4UDTB 4MAZA 2H6PA 3V79C 4PMZA 4ONHB 3BW9A 1K8DB 3MX0A 4DZ8B 5CAYB 3IXTA 2I07A 2OQJB 3MC0A 2CGRH 4RGNC 3A6CL 4ZENA 2BVQB 1YEGH 2D9QB 5ELIA 1U8JA 2W0PA 2QR0B 2GAZB 4YDLC 5HHME 1OB0A 1I9EA 2Z8VC 3QIUD 3P9LA 3REVB 2DYPA 1AO7D 4UB0H 1IAMA 5EOQH 1BIIB 1R6VA 1KTDB 3H7BA 4MS8D 3ZYJA 4YDJB 2HYMA 5K9QI 5L2JB 1FL3B 4J28A 3IFLH 1DEEA 3CLEL 4F2MA 1Z32X 2EE2A 2BVPB 3MACL 1V7NL 4OM0L 3EUUA 2BVDA 1GZPA 2X44D 3O8XB 4KKBC 4U6VH 3BD4A 4I5BA 4MQ7B 4QRUA 2XN1A 3TH3T 4XAKD 2FH6A 3MFFA 1WCGA 3BPLB 5IBTL 3L5HA 3F12A 3F7PC 2NW2B 5FYKL 3TBVB 1H5VA 1MYRA 2ATKB 5I66A 1TVNA 3WHXA 1AHWC 1JTTA 1MQ8A 1PY9A 4MNQB 1XGYH 1XSKA 4D6FA 5F6HI 3VG0H 3A6BL 2ZSVB 2FDBP 3PL6D 4N8CH 4LGRB 1FG2B 5BXSA 4P23A 3WF2A 4QLJA 4NN7C 1RAMA 2A77L 3V4VL 2AS5M 1XF3A 4I0PD 4ERSH 3WN5C 4PJBA 2APFA 4LIQH 4RFNB 1C5DA 3S7GA 2D9CA 2C9AA 3QG7L 1KGUA 1J8HE 4NZRL 3TNNB 4AG4L 5ITFB 1EGZA 3AMGA 1FRGL 4Y8AA 4OLVH 5C0GB 5TDPA 1NC4A 5DQJB 3SIMA 5ALBL 1GHRA 2ARJA 2Y07L 4OGYH 3LRSA 5KJRH 1KTKE 2ARJQ 1TVBA 3QG6A 4GG6E 3QB7C 4G7YL 1GUVA 1H5BA 4DWHA 3PHOA 4A2LA 1C8PA 4PJ7B 3I6KA 5TDNB 3W9EA 1GZJA 4KJWD 3T65A 4B3KA 2DJUA 2P8PA 1MELA 4TSAL 4HUUA 5F1KC 2VE6B 1H41A 4A3YA 5A6SA 5AYBA 1OCQA 5T1MB 4I48B 3CSYA 1MCJA 3ZL4L 3NPZB 4EEEA 3NIGF 1L9NA 4OBRA 1RZJH 3IDYB 1NOUA 6A3HA 1FDLL 2WMGA 3MA7B 2LAAA 3F6IA 1KJ2B 1G7IA 1FFPA 4OUUA 2EYRB 5IW1A 1AY1L 2Y72A 3ZT5A 1EGJA 3WNKA 4TSCL 5HGBA 3BVNA 1FCGA 2FWOB 2FO4B 2UZIH 3T4AB 2Q7NA 2AAVA 3O41A 4LPUA 1P84J 2HLFC 1CLYH 4I4WA 1BYCA 3AMDA 3KEHA 2EDYA 2XVNA 3WUEA 1KYOJ 4OLYH 4NQDD 4XNXH 4M80A 1BZ7A 3C6LC 3FQWB 4ZPTA 5IWLC 1U3HD 4Z8FL 2Y1VA 5D70H 2BNQD 4WUUA 1FNEA 5BMFH 4LCIH 3FOMB 5D7JC 4JM2C 5C0BD 4C7DA 5E24E 3QDJD 1VFAA 1R5WA 1JGUH 1X5YA 4JR9H 5ADPH 4WV1A 2OJEA 4FA8A 1BM3H 5CSBA 3V95A 5FOJA 5B39A 5GGUB 2H32B 2XQYK 5LA2A 4PD4J 1TNMA 1KCUH 3O3AB 1FN4A 2J6EH 3NFPB 3MRRA 4W5ZA 2IAMD 4ZUWB 1KEGL 3BQUB 4FTVA 4Y2DB 3DV6B 4ELME 2WNWA 4JO4H 2VDLL 5GNZA 3WEXB 4NJAH 3DETD 4DGIH 3BUDA 5C9JB 2XFXA 4XVJH 4OCRH 1CF8L 5AAMA 2J8UF 2XPGA 4GZJA 2DQIL 4LGSB 2H8PA 4F7TA 1E6PA 5A8NA 3MO1B 1LL4A 1S7QB 1QRNE 4R0LB 5T3XL 2EDKA 2WUCL 3SE9H 4DZBB 2ERJB 5E5UB 4YHMH 3VIKA 2FZ3A 2CGRL 1KJMA 4EUPH 1MIMH 1HSBB 4NWUL 1YEGL 4L8DB 5JIPA 4P5TC 1C16B 3U2SB 4OZFH 1J88A 4X7EC 5FGBA 2Z1KA 4LVOC 5ENWA 4GAFB 4ODTH 5E8NB 5A8OA 3TC9A 3DV4B 2Q87A 3KYNB 4XI5C 1DQDH 5DZNA 4JDZA 4PJIA 4UB0L 1A4JA 3NCYP 5EOQL 1KTLB 3W39A 2BHYA 4TUKL 2NXYB 5E4EB 1O6IA 4BFEA 1SJHB 4NQEB 3IFLL 1PSKH 3BP6B 4MNHA 2V7HA 4QRRE 3RWGA 4PRIE 3BO8B 1E6OL 1AC6A 3AU1B 1K4CB 3INUH 2EO9A 4EIZC 4ZG1A 4WTZA 4FN0A 1KR1A 4U6VL 5EB8A 2HG5A 1QPKA 1HSAB 1UENA 4R4BB 2D7OA 1FQ9C 4N0CD 2DKUA 1U8PA 3RDTC 4UIMA 4OI7A 4AZ8A 4JFHD 3U4EA 2BY2A 2FDMA 5DRZA 3IAQA 4N8CL 4Y4HC 35C8H 5C0EB 4FHBD 3LQZB 4JCLA 3O8XC 4AIZB 4PJAB 3EDEA 5LXGH 1A21A 4ERSL 2EDNA 3ZYIA 3T09A 4PRDB 4HIEA 1I1RA 4WLCA 2WBJB 2BK8A 3PV6A 2ESVA 2VAAB 4W4OC 5TQ0H 1F6AB 1FO0H 1UB5B 3T8XB 4N8VB 4Z7VA 5HVWA 3PHSA 1X5FA 3TBYA 2Z93A 5FIEA 4P8XA 4OLVL 5AC4A 3IRZA 4JFZL 1VFUA 4MA8H 3CMGA 4OGYL 5KJRL 1AFVL 3FN0H 4Y7EA 1HWGB 1GVIA 4OFYD 1E4NA 3MNWB 3U1SL 5JDJA 3EO0B 3FHQA 3UBXB 3BDBA 1C12A 3IDNA 2XKSA 2GTWB 5DJ6A 4R27A 3VDHA 2V9RA 1QP1A 2EIBA 3DYMA 3M46A 3F7VB 1R47A 1MCOL 2WC4A 3MUIA 1OB1A 1GCFA 4PY7A 3AIEA 2R4SL 4FZEL 5J13B 5E8OB 2YPVH 3K4DA 4ISVB 4YFEA 1CGSL 1RZJL 4MB1A 1QNSA 3WIIH 3MLPA 4TVCA 5AY7A 2WWDA 3QDGA 1T2QH 3ZDXE 2DIAA 4XMLH 1IEAB 3QO0B 2IQAB 4YWGH 5DWUL 1ZVSB 2A2QT 2UZIL 3MRDB 4CL7A 4G9FB 2Q3ZA 4M4RA 1KN2H 3CZJA 3QPXL 4G8GD 2FHBA 2DDQH 3ECBB 4OLYL 4C55A 1WAAF 4Q6IA 4J8RA 3OKEA 5T5NF 1MI5B 5DVKA 1MRDL 3BGFB 2WSPA 4S1QL 1GHFL 3ARDB 3B8YA 2FO1A 4UTAH 1H0IA 3CFKA 1TTFA 1RHHB 4GBXC 2FRGP 2PO6D 4LCIL 5KAQG 5F7UA 5DK3A 4JRYD 1SBSH 3BAWA 3WH8A 5FCSH 1EEYA 4PS4H 2EDRA 1T83A 3ZYOA 3VGEA 3SCPA 2YUVA 1FFNB 2UY4A 1EEZB 2GK0B 4JR9L 4WI7A 2OYKA 4Z7WF 4MB3A 5C08B 1F4AA 5FK9A 4YGVB 4JEGB 4WK9A 1DANU 4M61B 2OXGA 2EJ1A 5FEBA 4C4KO 1PZ2A 2PKDA 5MEOB 2D3VA 2YDSA 2BRQA 1RI8A 2V5TA 1ORQA 4JO4L 1OGGA 3Q2CA 4UI2A 1DLFH 3C6SB 3DURB 4NJAL 5EU3B 3VFPA 4GUPA 3CD4A 1UZ6F 4HZAA 3CHDA 5DJCA 1Q9WB 4RFEB 2ZX8A 4XVJL 4OCRL 4PJ9D 1UQSB 2GK2A 4E42A 5A1AA 1JYNA 5HDQH 1B3WA 4IRSB 5B39G 3AMKA 4ZFOB 4XNQB 3SGJC 1W9BM 4OKDA 3ESUF 1N26A 1FIGH 5F3HB 1N5YL 3KDMA 4U6YA 2YPKB 3E3QE 2D0GA 2YDRA 4M24A 2XGBA 3HNTH 1EUUA 3WUZA 3SE9L 1JZ8A 2OSXA 3WIJA 3EW3B 3BQUC 2MHAB 4IS6B 4Y2DC 4YO0A 3VMNA 2F2HA 5ABEA 2IADA 4YHML 1I7TB 3WEOA 4AT6B 3AYSA 1L7TH 1MIML 1H15B 1I7RA 2DSUA 2DT0A 3O4LB 3BLKA 1W8OA 4MAYA 3S36H 3ZMRA 1NUNB 4KK9D 2EH8H 4ODTL 3CZ8A 1AI1H 1FVEA 3N17A 1D9KB 4NRYB 3SN6N 4Z9KB 2WKLA 2GITA 4R0LC 2FEDC 2EBNA 3HI1A 2OTWA 1MJ8L 5DEZA 2A3HA 1G0YR 2IBGA 5SWSD 2FYYB 1CE6A 5ABHA 3TCLA 5FDYA 2ERJC 1PSKL 5ADOH 2IANB 4QHKI 5J1AB 5E8EB 1ZBCA 4NO3B 1L0YA 4YDVB 4YHYB 4PTMA 2NLJB 4R7DA 1Q9KA 3UX9B 5HHOA 1I1FB 1UA3A 2VX4A 1ZANL 3N11A 3PABB 1MWOA 3VFSB 5FYKD 4RFOL 5I1DB 4J23A 5IVOA 4UU9A 4YBQC 1HJWA 5F7DA 2GJ6D 4NBXB 1N59A 5CBEA 5E4EC 3GSNH 4QXTA 2X42A 4Z0XA 4L3EA 1RU9H 4WFHD 3Q5YA 3NZHH 1OGSA 1B90A 1UM6H 4CU8A 1ZJAA 4YHZL 3O2LA 4JQIH 4CW1A 1V3MA 3ARSA 3LRKA 1U92B 5BV7H 4PSRA 3OJVC 5L8LB 1AQ0A 1ZA6B 3X3FL 4JFFB 1UG9A 5DD3H 1CQKA 3HUJB 5TQ0L 4GW5B 5L2KA 1FO0L 1ONQA 4LVEA 5E5MB 3K80A 5D7KD 4NKIH 3TN0A 1F4XL 3VRJA 2BNRE 4U1IA 4NXKA 1HH9B 4MA8L 3FN0L 3JXAA 4TX8A 2ZOXA 1JMXA 3VGAB 1L4IA 4JO1H 3WV0A 4APQC 3O45A 3OPZL 5BXFB 2X9WA 3FB8A 2CEQA 4MNMA 4JFEA 2DQJL 2HJLA 1KFAL 1UR1A 1H8OA 1CBVH 5DJ0B 4BZ2H 4P5KB 2YPVL 4U1NA 2I9TB 1INQA 2WWMC 1UZ1A 3WIIL 5TD4A 3GMQB 1T2QL 3BSZH 4XMLL 2VZVA 4BSWB 5DK0B 5DLML 1GW1A 1KB5B 1U8HB 5A3ID 1DSFH 2P44B 2JK5B 5KSAB 5GHWH 1KN2L 1QD0A 2VLJA 3V6FA 2DDQL 4LKCA 4MX7A 2C3WA 2VLRB 4V27A 3VMPA 4P99A 3CMJA 5J13C 4WENB 5J1TC 1P6AB 5ECUA 2A6JB 1NFKA 3NUKA 2CK0H 1PBGA 3O9WA 3JTTA 3LS5H 3FOLA 3DYOA 1U8NB 4F8XA 2AEWA 4F9PA 4PSPA 2XFRA 4OUOA 4PS4L 5IHBA 5I1AB 5BRQA 4H8VA 2GI7A 1AQDB 4IRZH 4XBPA 3PWPD 4LSUH 1K5NB 3QH3B 4QXGH 4Y5YB 4C7GA 3RJDA 3L7EB 3W9DA 4NO5A 2A74A 3VXRD 3F4VA 4M56A 1XD0A 1H2JA 3CVHH 3MXWL 2E7BA 3TZVD 3AZSA 2AEQL 2XNAB 3ARDC 3QHZL 4D0BB 4LPTA 4LLWB 4M1GH 3BKJH 5C0FA 1DLFL 3CUPB 2QSCL 4CDHA 1HI6B 3VWJD 5JTWA 1CCZA 2CDGB 3ULVE 1XF5B 3QIWD 4LVNB 1OAXH 2A0LD 1UUQA 2NXZD 5C07E 3LN5A 4D6DA 2DM4A 3PZVA 3MRJA 5HDQL 4NC2B 2CRMA 4YDKH 3DTXA 1BEYL 1PLGL 3WBDA 1IL1B 1L0XA 5I71C 1FIGL 1EHXA 4UR9A 4JRXA 4YJZL 5T3XD 2YD8A 2HRPH 3KYMA 5JORA 2V2XB 3HNTL 3FAXA 3NFSH 4KJYA 5DJZB 5IHUH 3NBNA 5DJDB 5CP3A 3ZOAA 3DUSB 1NL0L 1PKQA 5FB8A 5D1ZA 3VFUB 3MNZB 3JTSB 1UWXK 3A67L 1D5MB 1QRKA 4H8WH 3S36L 4A6YB 43CAA 1MHHA 2EH8L 3WQ5A 2I5YL 4LHUD 3KYKH 3NMEA 4Z7WA 1XF4B 4L4VE 4NZCA 5C2BL 3P0VH 1X44A 4M1RA 1Q0XL 1EVUA 1FYTE 3BUTA 5IB3B 5LKNA 4M6OL 2G5BA 2X1XR 1PEWA 4F7MA 4LSSL 1AR1D 1OSZA 1W9UA 4QRPB 1HKKA 5MENE 4DN4L 5GRUH 5CSZB 1UGNA 3HG1B 5AYQA 1ZLWK 3SY0A 5D7SL 1EHLH 1LEIA 4ZNEA 2HT4D 1JPGA 1X5JA 2WANA 3MYJA 1U8MA 4AZCA 1MHEA 1NBYA 3BLPX 3VW3H 5DJ2A 3EO9H 1NLBH 4MJ5B 5KN5A 5DJXA 5LGHH 3VXPA 2XFYA 1AHWA 3JV5A 2R56H 4WO4D 5F21B 1RU9L 3WYRA 1C1EL 3NZHL 2NR6D 3GJFK 1UM6L 5DA4A 1GZQB 4JQIL 2EPLX 4TRPH 4MDJA 5AZEH 1PEZA 5A6AA 1C5BL 2NY4B 1MCQA 3UTTA 3CC5B 4HBCH 5B3JF 5BV7L 2Q7YB 1I75A 3RVVD 3LKRB 3ALFA 4TUOA 4N0UB 4NM8H 1NBZA 4KY1H 2CR6A 5DD3L 2FLRT 4WVRA 1Q4NX 4KROB 2DTSA 5GRWA 4NKIL 3L3GA 1MH5B 1C08B 4ZXLA 2HA1A 3RL2B 1EH9A 2V9TA 3ARED 5HI3C 3V4PH 4JZJC 5EN2A 2X89D 5DURD 2HT2C 3IS0X 2W62A 3LRGA 3O3UN 4NWTH 1NANI 1P7QD 1IGTA 3L6FB 4OOUA 1FNSH 1AO7A 1DFBH 2F58H 2VDNH 1OAUH 1PYWA 4JB9H 3FT4B 3BZ4A 5KS9F 4M7JL 5C0CA 1JWMA 5J11B 3SGEH 4BZ2L 2AXFB 1KG0A 2Y2WA 2JEPA 5EOCJ 1R3HA 2X41A 4JFXB 2EDHA 3TIDA 4R8WH 5K9OA 5E8PB 1RIUH 4YBHA 4NQVA 3X14A 1UACL 2E9BA 3VGAC 1SY6H 4OI9A 2GFBA 2X05A 3P9MB 2C4XA 4X4XA 2IMMA 2FBJH 4S1RL 2Q86A 4M6NH 5ICZB 5GHWL 2DSZA 1OGTB 4Z7OE 3NSNA 1AKJB 1RUQH 1M7DA 1OHQA 3VNYA 1QFWM 2DB8A 3RWCA 5IWLA 4NRSA 5AD0A 2P8MB 1YUHA 3A0OA 2Y5TA 1CICB 2I9LA 3LS5L 3QYCA 3NSMA 3DGCR 3HE7B 5D7JA 4YHIA 1M6OB 3AVEA 4QRQA 3ZTJH 4HX1B 3O11B 5F93C 5I1LA 5JXEC 4I2XB 3UZEA 3WE6B 3OTTA 1QSVA 4LSUL 4QXGL 3MSDA 1ROWA 5BRZB 4WSJA 4W8LA 1OCWL 1F42A 1KJ2H 3F7YA 4GG8B 5JOPD 1OT2A 3HC0B 4M1GL 4JFVA 4FFVC 3RKDC 4H88H 3BKJL 2OL3H 5EZOH 2BOCB 3QZWB 5BS0D 2PYEA 1WP6A 4G42B 4OF5A 3ZE1F 2VX5A 4P46D 4MNGB 4WEUD 2VL4A 1OAXL 4OQTA 4Y5YC 4CMHB 3JUYA 1T3FB 3A4XA 4YDKL 4JFSA 1T21A 2IMNA 1OF2A 2HVKA 2ED7A 3OZ9H 2HRPL 3S5ZA 4Y4KA 3CJJA 4HIJB 4HPYL 2P48B 1WEJH 4LKXB 3NFSL 1VFBB 3EYOB 5ACLA 3ZM8A 4JO3H 4PY8I 5HBBA 1J0JA 4Y7MA 4K2UH 1S7RB 3BAKA 3HB3D 5GGRY 1A7RH 5T1LD 4ZODA 1MRCH 4PJCB 3X17A 3L7FA 5FDWA 1OPGL 2H32H 2VXUH 4P5TA 4AEHH 1TQCB 1JD7A 3KYKL 1PFCA 4PP1C 3UROR 1UYQA 1NGYB 5D96C 5IHZB 3P0VL 3KLAB 1NGXA 5B38A 5J4MA 2F53D 5T5NG 4GKZA 5FCUH 3W11C 4JHAL 4MXQC 2BJMH 1GPFA 1MHCB 2JF6A 1Q9OA 2BVTA 4AD2A 1O7AA 1A2YA 4NNXB 5IEHB 3VRIB 2EDTA 4X6BB 1XHGA 3T2NH 5DJAA 4JY5L 5FGCE 3WD4A 1IQWH 2NY6B 1G7LA 1Z5LA 3MREA 5D93B 1KQZA 3BP4A 1Q38A 4LMQI 1JZ6A 1YMMD 2P5EA 5D9OA 2UVFA 3I84A 2VB5A 3VW3L 1V8HA 1HCFX 1NLBL 2A1WH 1BVNP 3ULVH 3RDTA 1TZIA 3TFKD 3BEVB 2E6PA 3WNLA 2R56L 5EU7E 1I8KB 5ABFB 5C0AD 4ETYA 4HFUL 3CLWA 3GSRA 1EDQA 4LSVL 3TO4D 1HWWA 3KJ4C 1CGTA 3N1MC 3QULA 4Y4HA 4ZEPA 5AZEL 1JZ2A 5D2LE 2FHFA 2MTPA 5ISZB 1EX0A 4ZYKA 4HBCL 1OD0A 5C86A 4J3VA 5IMLB 1WC7A 3FB6A 1P53A 4NM8L 2DWDA 3MRBA 4KY1L 4AM0A 2UWEE 3QR3A 3S6TA 3QHTC 1NGZA 1CECA 2XN0A 3GO1H 2NY1B 3FO2B 3RWIB 1A7OL 1V03A 5DRNB 3W81A 4PJ5B 3MRKA 1KQYA 3VXUA 3D85D 1RUML 4PJFB 5F1NB 4ELMB 1QVBA 2AK4D 3LKPA 4U6TA 1UCTA 1FNSL 1DFBL 4WSKA 4PRHD 2VDNL 1UZ8A 3MGTB 4K3EH 4OZHB 5IKCA 1NCDH 4JB9L 1BOYA 3FCTB 5CIPA 2PTVA 2PWHA 2YPLB 1XF1A 3GKWH 4J27A 1HK6A 4AEIH 1CVSC 5E9DD 5FO8A 1KPVA 3FQRB 3TVMB 2H2PD 4OGAC 3TV3H 2HFEB 5K59F 1HL8A 4E8DA 4PUBH 4R8WL 2Y7QB 3BAJA 1MFCH 1RIUL 2ZCHL 2D31B 1SY6L 4CVUA 1RPKA 4PJXE 1FIEA 5FUZH 3MLRL 1AVAA 4P2RE 4N5UA 1ITCA 3H3BC 1J12A 4Y4FD 3IU3A 3P4LA 2FBJL 5KZCD 3GGWA 1HJQA 5CGMA 4ZAKD 3BWAA 4V1DB 3UXFA 2CLZB 4W81A 4Z7UF 1YPZA 2JCCF 1S8DB 4D3CH 3NDYA 3BGMB 3P0YH 3RWDB 3L2LA 3RIAK 1O7SA 4PJEF 3WS3A 1CFQB 1HHIA 2RAMA 1F3DJ 1A0QL 4ZS7H 4RAVB 5EZLA 4CU7A 3GNOA 4GBXA 1W2PA 3DHUA 5IVNA 4UT6H 3TCXA 2D7MA 3TH4T 2R2CA 1FNGA 5DRWB 3TO2B 2XHYA 3WUWB 2VLKD 1OW0C 1A9BB 1D5ZA 5JDSA 3GI8H 4H0GA 4ZUUB 4HWZB 5DEFA 1RVFH 1IQDA 4KJPC 5E1AB 2LFGA 3FRUA 4HH9A 3H6JA 3G04B 2XQYG 2WMPA 3HAEG 4XPHH 2BRRH 4QNPF 2AJUH 2DKMA 3IFNL 5DDHA 3CPLB 4XPBH 1KJ2L 4GKOA 1CVRA 3CFEA 2R2HA 4OFYA 2AQ1A 3AHVA 4LEOB 3VD9A 4NT6B 5I74C 4H88L 4AD3A 4I0CC 1HDMA 3HE7C 4YHLH 1CYGA 4PMVA 4NKOA 4HKXB 2O9OA 4LPWA 4IOFD 5I1IH 1MHPL 4EDXA 4X6CE 4LSTH 1AH1A 4WU5A 1UJ3B 3I50H 1B0WA 1JF1A 3LXBA 2WZPD 2VL5B 3L4YA 2P5WE 2X4OB 4LBEB 2R1YA 4FQXB 4P7RA 1IGIL 4OFDA 2ITCA 1ADQA 2ADIB 5M94B 3BKYH 1Y18B 4ALAH 4UQBA 5D2NB 4LCWE 2CKRA 2E9MA 1R3KB 1A8JH 3RP1A 1AGBB 3J8F7 3MBEC 1A22B 2WCSA 4JDVB 3HR5A 3HZVA 1NFDE 1UKOA 5GGSA 1JHKH 5E7BA 1A7RL 2X10A 1TITA 4XMKL 5EUOE 4J3TA 3ZSSA 2VXUL 1EMTH 1FGVH 3DGGA 4CMHC 3MS8A 1F90L 3ARZA 5FHBL 2PO6A 1FORH 2QMJA 1MCNA 5FCUL 5HHPB 3RWHA 1X7QA 1OGAE 4DO4A 3RGVC 3B9KC 1WDSA 2GJXB 2ZUNA 2AJVL 2BJML 4OGXH 4RGND 1IZJA 3D39B 5IQ7L 2AJSH 4PIRF 1BFOA 5LA1A 3MUZ1 3VI3F 5I76B 1I1AD 3T2NL 5LWYH 4UIKL 1H9VA 2KZWA 1IQWL 5D7LB 2FEEL 3O6FD 3CSBA 2ZPKH 1TQCC 1QG3A 2ED8A 1G7QA 3PIQA 3E2HB 5B38G 5EC1B 4U4BA 4NUGL 2O5YL 2R0ZH 3QDMB 2A1WL 3B5TA 4X6FA 3NCJL 4MDIA 2P46B 1KB3A 5GNYA 4UDUA 3WQ6A 3GI9L 5EIQA 3PE9A 2V5YA 3BISA 1IGYA 1RURH 3OR7B 1DDHB 5ETUB 1A02N 4JIEA 1YNTA 1QPXA 3AYRA 1MJ7H 1NOFA 1X9QA 5A8PA 2LVEA 4ZDHB 1OD9A 3IDIB 1F02I 3TONA 2CSPA 5L9DL 4POYA 5L8KB 4WHTB 3UO1L 4OZIF 3OAUH 1AE6H 3DI3B 1G7PB 3EFDH 2J7DA 3GO1L 2JB6B 2X2JA 2V3DA 4CBPA 4KRUA 1FC2D 5SWQB 1ZT1B 3FQNB 2HT3C 4XCNB 1A3QA 1G9NH 5DUPH 4NQCA 4LF3B 4GAYB 1QSFB 4U1LA 3SDDC 1UKTA 4OZ4B 2QL1A 4APQA 2WVVB 3ULSB 4C58B 4K3EL 3TYFA 5I1EH 1J18A 5SWSA 1NCDL 4PGBB 4P57A 2DAVA 4HJGB 2G75A 2IH3A 4QRRD 2IBZX 2XZQH 4PRID 1ZV5A 4AEIL 4GLRH 2Q8AH 3MUGB 3U4BH 4Z7QF 3DX3A 3TV3L 4V2BA 4PUBL 2OZ4H 3OKLA 4N0YH 4ZSOE 2FB4H 3UG4A 4ZOBA 5IBUB 1ZEAH 1R3JB 3QNXB 3RUGF 2Z31D 3SCOA 1NMAL 1BD2E 5JQHC 5FUZL 1UASA 3H9HA 3GSUA 3Q6GL 5E0CA 4N0FA 1J0YA 1I7UA 3WFEH 1KJ3H 4JVPA 2GCYB 4PLOB 3WFZA 4D3CL 3GMPA 2PW2B 2YC1A 3P0YL 3ARBC 1QI2A 4R2GD 4H5SA 4OI8A 1I8LA 2NCMA 4O02L 1ZGLM 4MXVF 2VERN 3UYPA 2YL8A 4PJDE 4L1DA 4RSVA 3UTSE 1ZS2A 4UT6L 4OTXH 1W1TA 3TTQA 5IIEB 2VCCA 2HLFD 2VYRE 3WFCH 4HD9A 4GO6B 4M43H 5I15L 4HPOH 1AD9B 4W4NA 1JK8B 3EJJX 4XVUD 1RVFL 1B3ZA 1W0WA 5C7XL 1UH3A 4AD5A 4XPHL 2BRRL 1SVZA 2AJUL 5LGJB 1LWHA 3HE6B 4XPBL 5DD1H 1DUYB 2ICCA 4LU5H 3F58H 4ZXBB 2A9MH 5JHDA 4RA0C 1KB5H 2ZCLH 4YHLL 4LARH 3ULUE 1BQHG 3ILQC 4IEFB 5D1QB 3SCQA 1JPTH 5D1XB 3T0EB 3I50L 3DHMA 1WDRA 1QLRA 3D3AA 2QKIA 5F8RC 2FR4B 4U2YA 2GUOA 2ZG2A 1A7NH 3BKYL 4TX6A 3LY6A 5FD0A 2IQ9H 4WIQA 4N68A 4XBGB 5FFLA 3PWNB 1RZ8B 2JF7A 1NAMH 1JCKA 4HKJB 4PG9B 1E4MM 2J4GA 3BP5B 3RJYA 3OJMB 4PJGE 3EDKA 4HCRA 1F4WH 3SGKA 1NCWL 2W65B 4Z5RB 3FQTB 5DI8A 4UV4H 3UTPD 3G5ZB 1OD7A 1DUZA 3VX1A 1UJ3C 1T22A 4U0RC 2XV6B 5AZ2H 1F13A 1EMTL 3EJYD 1RULH 4LLVB 4OCMC 1OM3H 3QJFA 4FNLH 1KNOB 1BQLL 1MFUA 1UR8A 4U05A 1KB9K 1CFNA 4E2OA 3ES6A 4E0RA 4TVPE 4Y16B 1OTSD 2C1PB 3PQYD 1EFXB 4OGXL 4X8JA 4DJMA 2GJZB 4P4KB 3CK0H 4KK6D 3SCVA 2VC9A 5DHVH 4AMKL 1FH9A 3CH8A 2HISA 1DWGM 4Y2OA 1XGUB 4TTDD 5LWYL 3QDAA 3MMDA 1ZGLA 2AGJH 4ZFOL 1CXLA 2YD2A 3VUPA 2J88H 4KV5F 5CD5C 4JE4B 3UYOD 3W0WE 1HQ4B 2NTFA 3IFPB 5HGHA 4YPGB 4F9JA 1E56A 1LE5B 1OSPH 2HN7A 3RIAF 1LK2A 3D5HA 1M7IA 4PRPB 1KOAA 1R33A 5KZ6A 1KBGH 3SQOH 3UTQA 3IJYA 2YUXA 4JAMB 1JDDA 4B50A 3NZ8B 3IKCB 4YXKL 2Z91A 3P40A 4A6YH 2Y24A 3AM8C 2AJZB 1NEUA 2H2SC 4GQRA 1U8LB 2XN9B 1MJ7L 3HC3H 4PGJA 5MHSE 1Q6CA 5DD6B 3K2UH 3DXAE 5EO1A 3OJDA 4MQXC 1CFSA 3KXFA 1IGML 3E2HC 1TR1A 3OAUL 1AE6L 3B6SA 5J3HD 3WFHA 3EFDL 3FQUB 4J3OC 1BVLA 5F7HA 2B20A 2WNGA 3MCLH 4H8WC 3FY1A 3WL9A 3VGFA 1WCBB 3U30C 2YD5A 4LHUA 3NDZA 4DOHE 1G9NL 1CFTB 4JZJA 5DUPL 4JFDE 5I1GH 2EZ0C 3L5WB 4CGTA 3KPNB 4CCCA 3UJJL 2VLMD 1J9YA 3MRQA 5I1EL 1N8ZA 3P77B 4FQCH 1LG2A 4KMLB 4MNQD 1FZOB 4KRPB 3F62A 4X6DA 2IGTA 5CINH 2YD6A 3IJ7A 5I77A 4P2QB 2BCKA 3FONB 2Q8AL 5D7IF 2UY7A 3U4BL 3KLDA 3OGCA 4JKMA 4C56E 1L6XA 4N0YL 4FQQB 1FVDB 1G7JA 1QZ1A 5ESAB 2CLRB 1YC7A 3E6HB 1XGPB 4P3DA 4TVDA 3S4SA 3LH2L 1YQVH 3SUSA 4IRJC 2VMFA 3SCMB 4IJ3B 5IR1A 2V3GA 4AQOA 4Z2LA 5DZOA 3CIQA 4MD4B 3WFEL 3GB7A 3OR6A 4LQ1A 1RSFA 2XTJB 4GZIA 5B8CB 4RMTA 5TGBA 2VRAA 5ACZB 5T3ZL 3E3QC 3CXHJ 4DVBA 3ZKNC 4XRCB 1OWQA 4JGMA 3MV01 3LXCA 3QA3B 4KK5C 4OTXL 3BZEA 2JIXB 3QFJB 1EAPB 1JGLH 2ZOLA 3WFCL 2UYLB 3KNBB 5DQDH 1HHJA 4HPOL 4M4PA 5JXEA 3VIGA 3W6MA 1GQLA 3MSPA 4X0KA 5E0FA 4LCYA 1VRXA 5GSVB 2F7PA 5I6SA 1WBYB 4L4TE 5J9PA 4DKFH 5DMGD 3AREA 5SX4H 5IB2B 4LRNH 5DD1L 4LU5L 4GO9A 2B8OT 3UAJD 4S0SD 2A9ML 1NBQA 1SMOA 5E4IA 1N7MH 1KB5L 5CXPA 5CHNA 2EC9U 1DQMH 4LARL 4PMQA 4JFTA 1QNPA 3H3PL 4Q22A 1XH3B 1C92A 1NCTA 2VWEE 4WW2F 1HINH 4M8QA 2DBLH 1MNUH 3OKMA 2W9LA 4QCIA 4YBLB 3G6JE 1TMQA 3MPCA 1LEKB 3SDXB 3D3VE 1I3RA 1HE7A 3K4AA 1A7NL 3MJ7B 1ACZA 5IB1B 2IQ9L 1V02A 3NN8B 2VZSA 1JPFB 3UMTA 1EJOH 1RJZA 1NAML 3EHBD 4WW1B 4PRNA 4ZXBC 3QWRA 3VRLF 1KTBA 5IFAH 1F4WL 5EO9A 3W0KA 1FP5A 3PP3H 4FTVE 4TQEL 1T20A 4UV4L 3CX5K 3BXNB 2NY0B 5LQBH 4OF6A 4URTB 5AZ2L 1QBMH 1OM3L 4FNLL 2YL5A 5TE4H 1TUXA 3GSXA 2VXTH 4NCDA 2KQNA 2R29L 3O3EB 1JP5A 4Y1AA 1I8IB 4G9DB 3OXSA 2CIKA 1BGXH 2DICA 3MLVH 5FV1L 5TE7H 1H0DA 1YEHL 1SZNA 4B5EA 4KZEH 5DFTA 5DVLA 4L8CB 3QXAA 3C8KB 4O9HH 1ISXA 4NRXA 3LB6D 3JWNC 5I8EB 3ARFC 3VXMB 2AGJL 1S7UA 3HMWH 4X9GA 5C6PB 3HZMB 3HRZB 3PZ9A 2J6EA 3SKOA 3WSQH 5M95B 4ONFH 1EQPA 4Z76B 4U3XA 4ENED 2VIRB 1QO3A 5IF0A 3F7QA 1JFHA 4HLZH 2XOTA 1OSPL 2OTUB 1R24A 4U2ZA 3ARGD 2PW1B 3P4MB 4Y16C 3ULVD 3T2OA 4OAWB 5HYJB 1CN4A 1QQDB 1ZKAA 3SQOL 2F7RA 4W6YB 4WNQB 4P4KC 3RWEB 4UFMA 1XF2A 1J0ZA 5E00A 5IBLC 3S34H 4NX0A 2HVJB 3MRLB 4A6YL 2EEBA 4XV0A 4IMLB 1HHHA 5GZOD 1YC8A 1F3JB 2DQDH 3FRPA 3HC3L 3K2UL 4H25B 3BSHA 2WINA 4DCQB 5JW3H 3PZQA 1QFWI 3REWB 4UILH 4G8FB 1MPAH 3I75A 5TE6H 3DMMB 3WLBB 2NXYD 3RNQB 3L3OA 4MSWA 4WFEE 3VWKC 5D5MF 4KHTH 4NQED 1KXTA 3I2CH 3QUXC 4QOKA 4FZ8L 2WV3A 4EUPA 2VLLA 1DL7H 4HV8A 3MCLL 2CXGA 2NZ9C 1KIRA 3MV9B 3K8LA 3EJPA 3EBVA 2FSEB 3QEGH 3MU7A 5HDOA 5I1GL 4ODSH 4Q2ZA 1G84A 4LRIC 4DAGL 3MV7E 5CP7A 2NY5C 2F53A 1NAKH 3NAAL 1CD8A 3LV3B 4AEFA 5EBGA 2H26B 4FQCL 5EG6C 5DC9B 3GMOA 3LKOA 5CINL 3QUMB 4W8BA 3BDYH 4D0DB 2BMKA 3EZJB 2B1HH 2CJUH 2EEDA 1JNDA 4OFIA 4X80H 1HH6B 4S3KA 4IPNB 2CDEB 2J7EA 4LHUG 3VE0A 3W27A 4WHYH 2CPUA 1PY4A 3BEWA 1YMMA 2WBJD 4YHOL 3BN3B 4UQ2B 2P45B 4UAOB 4MD0B 1VAHA 2DRUA 2VCAA 4BZYA 2WQ8A 3HS0A 1ZVYA 4HGWB 1YJDC 2QHLA 4GKNB 3CFJA 2W63A 4FQHB 3L1OL 4WDIB 5JOFA 5JW4Q 3BCDA 2GKIA 2IPUK 4LL9A 3DSNA 2V2TB 3GSWB 3TA3B 5JIHA 3KPRE 3QDGE 4GJTB 3GM8A 5C2UB 1JGLL 1MVUB 3CZSA 3SCMC 4IJ3C 5I75B 3NCCB 1UQYA 1P6WA 1IKNA 5IG7B 2FYVA 2XZCH 4TPRH 4IIQB 2W0FA 1IAKB 4HS6B 5SWZB 4H7VA 2PCPB 4X0NA 1IAIM 2DI7A 2E40A 5BYWA 3RL1A 1JWSA 4JANA 4DKFL 3AHXA 1BFSA 2WP3O 4LCUB 5B8CC 1QW9A 4LRNL 3WFDH 3D85A 4JKKA 1J05B 3QAZB 1OAKH 3QWOA 4K94H 4ZUTA 1U8IA 3WELA 4X4YB 4HK3J 3PGCA 1DQML 5E6ID 4G9FD 4OJYA 5F1OB 2VABB 1VEOA 4GKLA 1AGCA 2CKNA 2EXOA 3MOQA 1HINL 2DBLL 4JFOB 2ZOKB 5E9DA 1MI5D 4XP4L 4JFPB 2NX5E 3QCUH 4WWKA 1DEDA 3IDXL 5JZ7D 3MV8E 4HJJH 2I27N 2UWEB 2BC4B 3NIGE 2YD9A 1S7XB 1UR4A 4PMOA 4GW4B 4ZOEA 4Y4FA 4NGHL 3MBEA 4TNWK 1Z9MA 4ZAKA 3I6GB 4RA3A 3MR9A 4F80A 1A7BA 1NC2B 1XCQB 2LVCA 4JN2B 1K4DA 5LQBL 1Q1JH 4AD0A 3OKOA 5C08D 1QBML 4PV8B 1KGCD 4WJ5B 3DUHA 1BBDH 4Q9BA 3GXFA 4UZUA 2VXTL 5CJOL 2NNAB 1J10A 5H35B 5IB4B 1EXUA 3TBWA 3A21A 4AJ0A 1BGXL 3CDCA 2V2WB 2DL2A 1HILA 3RGVA 5JLZB 2PYFB 5K9KB 2EEXA 3GSQB 4KZEL 3VIHA 4AIOA 4PP2B 3R06B 4J3XA 4O9HL 4CCEA 4NQSB 2HWZL 1OLZA 4UUJB 5I24A 5JBEA 1Q94A 2ICWA 1XZ0A 3LEVH 4IRSD 5J0BA 3OGVA 3HMWL 3PDOB 4EK7A 1ORSA 1A64A 4K7PX 1VFFA 2XKUA 4GG6A 4M03A 1LP9B 3C5JB 4ONFL 2YLLA 3LIZL 1KCLA 5HYEA 4OLZH 4B0MM 1D5BA 5DJYB 2X4PA 4F8TA 4HFWA 2ILLA 5IOPA 4P7NA 2ZUSA 1TTUA 4GAGH 4Y89A 3O4LD 1S9YB 5T1KB 5JW4R 4WFFD 3S34L 3HA0A 5A2JH 4HOZA 4ORGB 1YEKH 4MADA 4RMRA 2IH1A 1DN2A 4XCEB 2DQDL 2BSTB 1D9KD 1TDQA 2HJKA 3BPNB 4JKPH 3QO1A 4UFLA 4KU1A 5JW3L 3FMGH 1R5IA 1XCTA 4UILL 1LNUB 3MRGA 2RFXB 5F7YC 1MPAL 2J8UE 4GS7B 2J8GA 3IDMB 1FZMB 4PLJC 4OFKA 4KHTL 4DTGH 4F9LC 2E27H 3Q3GB 1M71B 1ZE3C 1RP8A 2IAND 3SKUD 1W72B 1ZS8B 2JJVA 5F6IC 5INCB 2QTEA 5IV2A 1QI4A 5FA4A 5IEKB 1A1OB 3DX7A 5CEXB 3MOAH 2IPKB 5EBMB 3HPJB 1CPUA 3FRPG 4ODSL 3S6CA 5F7MC 2DLFL 2QQLH 2QV4A 4XZBA 3SDDA 5KSBB 5CGYC 5I8OL 2X4NB 4HA4A 4FXGB 2P7TB 5JQ6H 2FNBA 3O6KH 2AV7B 4N1EA 3QUYB 2R23A 1OP9A 3C60B 4EUPG 3O3BA 5HI3D 4GXPA 1PW3A 1PBYA 3BDYL 4KVCH 4X5WB 3W29A 4PMRA 2J25A 1I1AA 4U6HA 2CJUL 5EBWB 4W68A 1UYWH 2P1YA 4NRZA 3KPOA 4OZFG 1RK0B 3O6FA 3A23A 3CIVA 3TYGH 1OIFA 5C09E 4W86A 4E5XB 1WBZB 4JFFD 5EORL 1CT8A 1JWUB 3GSNA 5KSUA 1U6AH 3V7AE 5FKYA 4LGPB 3IGAB 4J1UA 5BZWA 4ZTOH 4PTVA 1XIWC 1A6TB 4TUJA 1IM9A 1EOMA 2VNCA 1RH9A 5T3ZD 1A6VH 1T80A 3ARBA 1IT9H 1OIMA 3DRQA 2Z8SA 4QHNB 3PF2A 2WK2A 4N9OB 3VTRA 4MA3B 2X4UA 5FO7A 5I1KH 3DVNB 5DRXA 4W6XB 1W1PA 3WKZA 1FPTH 4X9HA 5IFTA 3PWVB 4TPRL 1T5WA 4KK8D 4FNQA 3R1GL 5EFIA 1UVQB 2DSVA 1IC4H 1OSEA 1E4XL 1CD0A 4WGVB 2K7PA 3HPLB 4E41E 4BFIA 4Y5VB 5B3NA 1HJSA 5LJYH 4XP6L 1T1WA 2J8FA 1OAKL 3RILA 1WWCA 3LOWA 3AIBA 3OG2A 4Q0XH 1JPST 4GW1A 3SKJH 4OKVA 5KSA