1CXIA

Wild-type cgtase from bacillus circulans strain 251 at 120 k and ph 7.55
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic studies of the interaction of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 with natural substrates and products.
pubmed doi rcsb
molecule tags Glycosyltransferase
molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
total genus 231
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1995-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxiA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxiA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cxiA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cxiA01
4CCCA 1G7IB 3TBSA 2JCCB 4R4BA 4P8WA 2A1WL 4Z5RB 2MFNA 4TN9A 3C5JB 3SKNA 5T3XL 4IMKA 4HA4A 3GIZL 1YEFH 5GSRA 3G5XA 2NYYD 5F97E 2FCBA 4LIQE 4Z7VE 3HKFA 1OD8A 3N0PB 3VWKC 3C60A 3BPNC 3FT3B 4JRXB 3KL0A 3LXAA 2DDQL 4ZPVB 4KJWC 5ESQA 3RP1A 4YK4B 3ULUC 5HHQA 4HPYL 2V5MA 1HN1A 3D2UA 4JM2A 1PBYA 4NNXB 4YFEA 3W0WD 3LPWA 2BOCB 4GXPA 2C1PA 2GT9B 2OJEA 2GDUA 1LJYA 2J7BA 3IXAB 4HF5H 4B16A 1CWVA 3ZYZA 4G8EB 1AQMA 5JXEA 1DBBL 1PEWA 4OLVL 1F4YL 3T8XA 2Z8RA 4IOIA 3QR2A 3GSVB 5HDLA 1T0PB 3NCYS 2H9GB 2UWFA 4HLZH 1XSIA 2VIRA 4I0KA 3CH8A 3QXDA 1DLHA 5LKNA 1RZGB 4FG6D 3BEVA 1MJ7H 3DHMA 4ZXBB 3WDPP 4PRPD 4N1HB 4J2XA 4NHCH 1T83A 2YL8A 4QRRD 3RGVB 4NYLB 3TEUA 2X41A 4YAQA 4F8TA 1TZIB 3ZDYE 2EPLX 2CO6B 3HZKA 1WFTA 1ZHKA 5MI0B 4Y8DC 4PJFA 5C6PB 4WFFE 3D4ZA 4CVXB 4PTXA 5D7JC 1N3NA 4XXCC 4OUUB 3OPZH 4P2CG 1NWRA 5DQ9B 2EC9U 2XOTA 3RZWA 2E6QA 1TJHH 2J3SA 3EYFB 5JW5A 3GDBA 1JHKL 4IOSD 3CXDL 5ESVA 3TBVB 3GSOB 1RAMA 5FFLA 2X4SA 4G6JH 2WVVB 5E94A 2HAZA 4PUBH 1NFDA 1GIGH 2VLJA 1FFNA 3GSUA 3RWDA 4C59B 1QX1A 3JV4B 3PTQA 2WINB 4L3EA 3G08B 2DQEH 4XPHL 2G4FA 2VLKD 3VFGH 5A95A 1JHTA 2FO4B 4UT7L 5HHOB 1A0QL 3SHSA 3MOBL 1BFVL 4DO5A 3MUGB 3W0WB 1ADQH 3BVNA 5DO2C 1TVPA 4KI5C 2X1XR 1NDGB 4NWUL 3KPTA 4TRPH 1EOKA 4KV5F 4EI6A 4UIMB 5ANME 1S7WB 2DAVA 1ROWA 2J8UB 2ZG3A 4JQIH 3HC0B 1BYAA 3TO4D 2VZOA 5GGSB 3T4YA 1D9KD 2B31A 1HHHB 2RBLA 4MZ2A 3ZKXB 3L7EB 4Q58C 1OAKL 4A6YA 1A7NH 3IF1B 1NBZB 3JUZA 3LAFA 3VNYA 4Z7QF 3I6GB 3BZDA 1WDQA 1PD6A 1J1XL 1MW1A 4ELMB 3BKMH 1M71B 1E4KC 3MA9L 4K9EL 3AIBA 3WIFB 2J4WL 4XNZC 4TUKH 2HRPH 3VWJA 2DLFH 1JL8A 2WWMC 4JKWA 3G6JB 4YWGL 4F3FA 5J4MA 1PVHA 1LEGA 5TDNB 2B0SH 1CFTA 3IU3B 4AMKL 1PZ2A 3AY4A 5IR1B 3GZAA 4OIFA 2UWEB 1FZJB 3ARDD 3KNBA 1J7VR 4X7TA 3VWKA 5J7CC 3TNMB 1RU9L 4MJ4A 2I9LA 1FYTD 1CECA 1UENA 1MIEH 2UZIL 5C0RL 4LSPL 4ERSL 2WMKA 3FOMB 1BLIA 4TUJA 4G7VH 3DROA 2APBA 4PMYA 3VVGA 4PGEA 2MTPA 2EYTA 2K7PA 2HTKD 2V9QA 4PRIA 4S3JA 3BI9X 5KOMC 3RNQA 2W60A 1NCTA 2JLLA 4TVPD 1BD2B 4O2FA 3IDMB 5DT7A 4TSAH 3KLDA 4QRSA 4Z7UA 5GIRA 1GQJA 2UVFA 4YDKL 1J0ZA 1QA9B 1FORL 3OKDA 4XBGB 3L7EA 4IS6B 4M8UA 5DFVD 4P3DA 3FQTA 1KFWA 2BZDA 1QSED 1MRFL 2PYFB 1MQKL 2RR3A 3UCQA 2Y7QA 4JDZA 4P23D 2IH1B 5C0IB 1U8IA 2VAAA 3K3QA 3HRZB 2OLDA 3NTCH 1Q9WB 3BIKA 5DMJB 4IHOB 5F88A 2BFVL 1GVIA 3KXFD 4OCWL 1JRHH 1D9KB 1LO2H 4Z7VB 5IB5B 2OX5A 1IKNC 1JPTH 4MXQC 4F9LA 4Z7NF 5D7JA 3BEWA 5L9DH 2QHAA 1RY7B 1A6ZA 4YQXH 2VI0A 3U36B 1X6LA 5I23A 4V27A 1ZTXL 2R4SH 1A9EA 1MRFH 5A2LH 1YNLH 1PJ9A 4POYA 1NEUA 2JCCE 4OI7A 1H0IA 4YEFA 4RAHA 1U8QA 4LASH 5BRPA 1P7KA 4I1NB 2XM2A 3BN9D 1F3JB 5E8DH 5A6BA 5DUML 1V08A 4PJBB 1RMFH 4MDOA 4JB9L 2EDYA 4IMLA 4FNSA 3KR3H 4K7PY 1KJ2A 1EO7A 2P46B 2R23B 4FXGB 5TDOB 2XIBA 4RAUB 1AFVH 3V9FA 4M7LH 3QUXA 5EBLB 1ORSB 3KPRE 3O6MH 3RIFK 3U1SL 4J28A 5CGYD 1VB9A 1GGBL 2PW1B 2Q3AA 2ESVB 1C16A 1EV2E 3OKDB 3QUYB 4XBGA 2OSWA 1MPAL 4YHNB 2W59A 2QSTA 4MSWB 5E8NB 3QO0A 3L2LA 3GM0A 3LN4B 4PTTA 1UUQA 3SCNA 4GSDL 5DFVC 5D4YA 5D7KD 4OLUH 4NQED 3B5GA 5GZNC 1YHTA 3NZHL 4RMTA 1UM6H 4TXEA 4OI9A 1I1XA 1GPOH 5ISZD 1R8LA 1IGYA 4JG0H 4NQVA 1JWSB 2ZSVA 3WF1A 3TPUB 1DWFM 5DJ6B 4GS7B 1QW9A 3DV4B 3B5TA 5TH2B 5M7QA 5D7JB 3OA5A 4WRLA 4OKVB 3UDWC 3WFEH 1JTOA 5ITFB 1S7SA 3WQ8A 4F37F 4HU8A 3U4BL 1GGCL 4G7VL 4Y7EA 2XWBB 1L6ZA 4M82A 5HHNA 5IQ7H 4PJAE 3WIHH 1XV8A 5IW1A 1JGLH 4N1EA 3AQUA 1UM6L 3PQYB 1T1WA 4NO5B 4ZE5A 5FO9B 3TT3L 3RGHA 1U8HA 2VC2L 4FNLL 3TC9A 4OV6F 4KY1L 1BQUA 3D25B 1EO8L 2AJVL 3PBGA 1BGAA 1TA3B 2E0PA 2Y23A 5J3HD 4D6FA 5L7XL 1RULH 4NNPL 1MLCB 4D2NA 4F15B 2VH5H 1FO0L 4HK0B 3U7WH 2G3IA 5EA0H 1QI3A 4HJGB 4XPBH 3S88H 4EBQH 4D72A 1YYML 4MSWA 3B9KD 3CZ8A 2YWYA 8FABB 2MCPL 2KBGA 4NO3B 1OSPH 2W0PA 4D3CL 4ZOBA 4PRBB 2J8UE 4PV8A 5IBTH 3CZGA 1Y6MR 3EMCA 2YR3A 1XR8A 3ESUF 3FCTA 4CD5A 1J9YA 1G7PB 1VPOH 2DD8L 2ZKHL 3S5ZA 4WIQA 3VILA 3RDTC 1GGYA 1A1OB 4X6DE 4HUNB 1TJIH 3FO2B 4FQQB 2RFXB 2B8OT 1UD3A 1CS6A 3DO3A 3OXSB 2BSRB 5EZIL 4MA7L 4JFED 3DX1A 4L3CA 1VGEH 5DYOA 3RFZC 4PYGA 5DQJB 4H41A 4ETYA 2X4TB 3U9UB 2W0FA 4U6YA 2J2ZA 4U1NA 3BXNB 4NQCD 1SJEA 1BLNA 5ESAB 3T0XA 1MUJB 3B9KB 1HP4A 2NX5A 2QADD 1FCCA 4RQQB 2D0FA 5F7DA 3WY4A 3ET9F 1DDHA 4UQ2B 1NARA 1GZQA 5DUMH 1CZ8L 2PF0A 1G1CA 4R27A 3KZSA 1DLFH 1YEGL 4LCWA 4P4RA 5KN5A 2FO1A 3TVMD 2O9PA 5I71B 3E6HB 1JDDA 2NXYC 1AJ7H 4TVPL 4U0QB 1XCXA 4JFEB 2VZUA 2ENSA 4KQ3L 2VLRB 2BVPB 4R90L 1KJMA 3AREC 2ESVD 4MQ7B 2E8ZA 4D6IA 1X5XA 4M1CC 2OYLA 4ZUSB 2FEDD 5DEFB 1JRHI 1AY1L 3PUCA 4XVTH 4UFLA 1E1EA 3PP4L 1A14L 1TIUA 2IBBA 4PJGF 1H15A 4M4RA 2QPSA 2FBJL 2ADGB 3WUWA 4A3YA 1NGZB 4WJ5A 1OW0C 5L6YH 5E1QA 4PJEA 2VL5B 4ZO8A 5HVHB 4ZSOE 4U6TA 1RURL 2FLBT 3HB3C 3MRQB 5DC0A 4X83A 3WKNA 2VC9A 2VAJA 4PJ8C 5L88L 2QLYA 1FAKT 4KK6D 4JIEA 1NLDL 4R0LB 2VXTL 1FFPA 2QHRH 5TFSL 1KJVB 3DMMB 2A0LC 2BNJA 5FD0A 1E27A 3BUDA 2VRKA 1EMTH 2JELH 1TQWA 2YD8A 1A1MA 4QCIB 4W6YB 3AI0A 4RE2A 5ESQB 3WEXA 5L6YL 1AQKH 3PQYD 4QOKA 2BNRB 1NMAH 3D3VB 3PDOA 1XGUB 3MJ8A 2XFYA 5D6DA 4ZTOH 4DN3L 2Y72A 3CH1B 4NYLA 5C9JB 3OR6B 4P2OB 3C8KA 4C58B 1FH7A 3ARFB 3F5WA 4JFHE 2ZCKH 4NZTL 2H32A 1A6VL 4PJFB 2VSCA 3HMCA 1MHHB 3UTQB 2F53A 5DVOA 5HXMA 3X12A 2A83B 3PF2A 5IFJB 1L8NA 5DEZA 5ABGA 2G9HA 3EO9H 3FB6A 1S7RA 3L6FB 4JG1L 4YN5A 4TNWF 4RCAA 1LG2A 3QRGH 1SMOA 5DT1L 3OL2A 4UAOC 1E1FA 1VPOL 4PRDA 1K6AA 4JPKL 3DYOA 3OLGA 3MRDA 4YHYB 1XCQB 1UM5H 2XPGA 1X1NA 3K7UA 4XPTL 4RX4A 4WVRA 5KW9H 4D6EA 4UQ9A 2KQMA 4JHZA 4N8VG 2DL9A 3SUUA 4C4KO 2CJUH 3VXUA 5FYJE 4W68A 4YAQB 3UC0H 4FABL 5EOCH 4C56D 4PJIF 3QUZA 5JHDE 4M5YL 4GKSB 5I8KL 3MCLH 4GS7C 1GOWA 4DUVA 3MBEB 4WI8A 5BVJB 2WQ8A 1CGWA 1BWWA 4NQCB 3R06A 1RFDH 4MS8D 5CSYA 3VD3A 1QQDB 3MV8D 5GZND 4OGAD 1ZOXA 3SE9L 5ADPL 2ICWA 3ZLQC 3OZPA 4UIMA 5JZ7D 1LO5A 4D71A 3KYOA 4G5ZL 1MIML 3WFCH 4WSKA 3FB8A 5DEGA 1C08A 1UCBL 3I3BA 3JWDC 4KUCF 4NGHH 3QQ4B 3P0YH 5J11B 2W9LA 4NC1E 1JIBA 1DVFC 1EOMA 4Y4FA 2WBJD 3GFUA 3CK0L 3QRFM 3T2NL 4JDVA 1LK2A 4QLLA 1S7RB 2AJZB 4J4PA 5E99L 2OMNA 1KN4L 4W8AA 3QQ9D 4Z95L 1T0OA 4K3DH 4LLDA 4XRCB 4M62H 4L8BB 2VR9A 4P2RA 5KSAB 1NDMA 1UCBH 3W82A 3VFWA 4EZMA 1BVKA 1JV5A 4JN1H 1KR0A 1OBAA 4NQSA 5F6HJ 1TVNA 1NSNL 2IGFL 3MZTA 3QEGL 4RGMB 3MROB 1KOAA 1MHEA 4PGEB 4MJ6A 2O93L 4PREA 5HVGB 2NT0A 1FZKB 1MHPL 2D7QA 1KQYA 2GK1A 2X4RA 1EEUA 4PD4J 4H8WL 4PJ8A 5HBBA 4UINL 4QRRB 5HPMA 1KENH 4Q9RH 1H3PL 2FGZA 3BZ4A 5F9OH 1FO0H 1T66D 4GFTB 5DURB 3GNMH 5IB2A 4YHKL 1BQLH 3REVB 1Y6NR 1I1FB 2CDFA 4RAVA 4TTDD 3MRMA 1S7QB 4YJZL 4XAKE 4P3DB 3QIBC 4E42B 3I9GL 2YC1A 3QXTA 3QDGE 3S37X 1WE5A 1V3KA 3PZQA 2IPKB 4P8VA 4P5TA 5DJ2A 1XGYL 5GGVH 4LF3B 1W32A 1BGXH 4HIHB 5I0ZA 4HOZA 3QEUA 1FHGA 1BD2A 4XXDA 1VERA 5GGSY 4CD4A 2NY4B 1FYTE 1NBYA 3DVGB 4PJBF 5GGQL 1FL6A 4P8XA 3RCNA 4LLVB 4MD5B 2DQGH 1DE4A 5ID1A 3VFWB 4DZBA 4IRJD 4NKOA 4WCYH 3L4WA 1UWEL 3K1KC 3D18A 2DLHA 3K2MC 3T04D 3U0WH 3S5YA 3CLFL 1H5BC 2BNQB 1X7QA 1ISVA 5EOCL 5T5NG 5I1IL 3CSGA 1AVAA 2PCPA 2E7BA 2LAGB 4KMTH 5DJXA 1KCRH 4RIRB 1BFOA 1KNOB 4MJIE 3ROLB 4M3JA 3MNVB 3UPAA 1PZ3A 2CPUA 2ITCA 4DKEL 3OGSA 3STLB 5KVEL 4QRRA 5HPMB 1QD0A 3K2UL 2AOSA 4YBHA 3GRWA 1U3HC 3FMGL 3MACH 4PJIE 3JWOL 3GK8H 2KH2B 1DSFL 1A6ZB 3QI9D 2R1YA 3BP4B 1C5DA 1E28A 2Z8VC 2W4XA 4EAMA 2Q3ZA 1PKOA 5TPWL 3BRGC 2IPKA 1IE5A 4OAWB 4Z77A 1KXQA 4LSSL 3JXAA 1J01A 4JFXB 1JAKA 3A0OA 4G6KH 4N0UB 3OZ9L 4TOYL 3PL6B 1ZGLP 4RFEA 3MRFA 3L7FA 4CMMB 1NCUA 4BFGA 1OWQA 5A40E 4NCC2 1FHLA 5HYQB 4J4PC 1L7IH 1DE4B 3VRLF 1NANI 1HL9A 2QKIB 2DSWA 3BDYH 4WTWA 2ESVA 1X5YA 4YHYC 3F5JA 5TPWH 3SCMD 1MCQA 2NXYD 3CFDA 1FE8L 4LSQL 2C3GA 4CNIA 4WO4B 4EI5D 4UQCA 4FZ8L 3OBAA 4XH2A 2XIDA 2XTJB 4K7FA 2HT2D 5AWNL 3UZEA 4JKPH 1NGPH 3WO4C 3L3HB 1EHNA 2IBZX 5JQ6H 1BVLA 4PJDA 3MOQA 2ZSVB 3FW6A 3DUSA 3B2UC 4YH6A 5E0QA 4OB5L 4MDIA 2EPNA 4HIIA 1JK8A 2Z31B 3G6JE 1SJXA 5EN2B 1S7SB 1VFAB 5GRUH 5GNYA 4TNVK 1C5DB 1E28B 1RHHA 1U42A 2R2HB 3GJEB 3MLZL 4URTB 5EO9A 4M61A 1PDKA 3IJSB 4NC1C 3UR8A 3IXTB 1MFBH 4FZ8H 1XCWA 1AO7D 2FIKA 1NEZB 2YEZB 1WBXB 1I4FB 1UXSA 3LRHA 4MJIB 4GRLD 4ZAKC 4O02L 3UBXG 1MCWM 2X1WL 2FR4B 1MLCA 4G3YH 5IWLA 1IBGH 2UY7A 4UOQA 5F7UA 5I75C 4JFQB 3D69B 1BLNB 5ESAA 5B3NA 3O11B 3O8XD 1MQQA 2DQIL 4FFYH 1UB5B 1XF2A 5FL1A 1EK3A 3VFRB 1KEML 5CJ5A 5IFTA 1LEIA 4JFOB 1B4RA 3MV9E 1JG9A 4PFEA 3MRIA 4F58H 2QR0A 3GXIA 3FQNB 1R3KA 2FLRT 4KVCL 4BSWA 1P4IH 3MUJA 5TE7H 2XN9E 2ZWZA 5IKCA 1RSFA 3LQAH 1TZ7A 1QVOA 4X7SL 4UOW0 4FN0A 4NWUH 4GRLB 4DZ8A 5HDQH 3RGVD 3CHDA 3DUSB 4OZGE 2IMNA 2GTWB 2IH3B 2E5EA 2VDMH 2J7GA 1QKZL 2Y2WA 1FBIH 3LEXA 4NC0B 4N9GA 2NNAB 3IFNH 1TETH 5FM4A 3MRRB 1ISYA 1T2XA 2FJFB 4F33B 3FQXA 5CEZE 4OLYH 4K71B 4F7PB 3VXSB 3TBWB 5D7JD 5CBAB 4R7NA 3AIQA 4AM0A 4JRYE 4BQBA 2NY0B 4QTIH 5ISZA 3ARBD 1TITA 3W9DB 5F89B 1KT2A 2ARJB 3EDEA 1J11A 1CL7L 4ZOAA 4MXWH 1HH9A 1YZZA 3O6ML 4UZGA 2ZX5A 2J6EH 3SDYL 3T0EA 1UC6A 4QRTB 1E6JH 4NN5C 4Y4HA 1F90L 3U79A 1QSFE 1UB5A 4LVOB 5JXEC 2NZ9D 4NBXB 1R5WB 5FK9A 4HUMB 4NRXB 3KYMB 1OP5K 3G6DL 2CLRA 1XGQA 1HXJA 2HFEA 4R4NC 4XPAH 5CSZB 5AWNH 5FKYA 4GLRI 1T7ZA 1I9EA 1M7IB 1MIEL 3KLLA 3FO9B 4KUCD 2F5BL 4MNQA 3O4LA 1R24B 3CNKA 3QXUA 3STZB 2X4OA 3ZE0E 2IH3A 4LLQA 5HHOE 4OBSA 2A83A 3RBGA 2YLLA 1JCKA 1G7QA 5EOQL 3B9DA 3VDBA 5HI3D 5FA4A 1W0WB 3H7BB 4NOBA 2YL9A 3FQXB 4WHCA 1XH1A 2J4GA 2JIXD 3DSFL 3RVUD 2NR6C 1OSEA 4CMHB 2EH8L 2GY7B 5CAYB 4HWZA 4G42A 3DX6B 5I19L 1RJZA 3G6JF 4NJAL 1IL1A 1KJ2H 2VH5L 2EXYC 3P30H 4ZNEA 3MXVL 5HDRA 3QEQA 5BRZA 4KDWA 3SGJA 3N9KA 1Y0LB 3WH8A 1M4KA 4JRYB 5E6ID 3VDAA 35C8L 1BFVH 2DN7A 2AXFA 2VDKH 1VIWA 5K59F 4F79A 4DJMA 1OHQA 3WD5H 2ZUXA 5FK9B 2D9QB 1W2PA 3ARBB 4RGND 1LO2L 5JPNB 3N50A 4MA3B 3AZTA 3OKNA 4YHLH 4OIBA 1FIGL 5CSZA 5CLTA 1AHWB 4KQ4L 5LXGH 4X4YB 3VFVA 1OW0A 4H7VA 1DBMH 2A6IA 1IV8A 5DTFB 1T04A 1IC7H 2J12B 4PJ7F 2UY2A 1KTDA 4OFDA 1UWTA 4JR9L 2XZAH 4Y4FB 3UEZA 1IGMH 25C8L 3BUBA 1LWJA 1FVEA 3HAEH 5I73C 5A2KH 1RIUH 3H9YA 1KXHA 1P6WA 1OT2A 3LRSA 4XT1C 3A6BL 3AMDA 4GRWH 3VI4F 4XRCA 2NLJB 4JY6A 4OZGF 5TDPB 2A6KA 4LGRB 2DPEA 4S0SD 1ZLVH 3DX6A 1W72L 3VG0L 3DUUB 4LKCB 5C0FB 4A3HA 2DQDH 3MO1A 4PGDA 1CFSA 1C7TA 1J86A 2GYSA 3SUWA 1NP0A 1JXKA 1Q1JH 1HHGB 1JWMA 2DRUA 1TZIA 3OAYH 2AXJA 2GSIB 1ZHKB 2DQJL 4P9HH 5BXFB 3C87A 3EOTL 3WNOA 1PG7L 1H3TA 3TBTA 3EOAB 1YY8B 3QUKA 4FQHA 3MUY1 1XYFA 3MRKA 4NPYB 2ZCHH 1KC5L 5FAAA 5J1AA 3MC0A 2WVUA 2C4FU 4ZEPA 5FOOA 2IPTH 2OI9C 3ZE2F 2DQDL 3E0GA 3U9PL 4XNMA 3SKOB 5E2JA 1U3ZA 1MWAL 4U2YA 1FNFA 1JNHB 2G41A 3T8XB 3WSQH 2D7TH 2VQUA 4WFEE 4OF3A 5SX5K 3D39B 1KBGL 2J88L 1EJ6A 3EKCA 3OAYK 1GHFH 4Z7OF 5BROA 4YDJB 1RP9A 3VRJB 2I26N 3QEHB 5A94A 5MENB 3QG7L 4K8RC 1IT9L 4QRRE 1RVFH 3VCLB 1VF8A 3BH9B 1DWGM 2HMIC 3GH5A 1YDPB 4QP0A 1IGIH 4TUFA 1HL8A 5A43C 4XXDB 3VDCA 3WCYA 4AG4H 3DVGA 1HSAA 2NW2B 4JFWA 4GXVL 4O5LH 3GMOB 3DETC 1WAWA 4EI6B 2DQEL 4PY8J 4XPHH 1A3QA 3ZL4H 2WUBL 5CZXC 3WD3A 3HI5L 4KROB 1IT0A 3TN0A 2EDEA 5EZLA 4QXUH 3IVKB 2YDSA 4CU6A 1UQSB 1UA6L 1QBMH 2VDKL 3GJFK 3O2DA 4OSUL 3VD5A 3K80A 4W81A 1OAQH 1TZGH 2NY7L 3NDYA 3CHEA 4YHML 3AIUA 4LXFA 4M43H 5DT1H 3VXRB 1UR4A 5CEZD 3FFDB 4L8CB 4K7PH 5ESVB 3TBVA 1QWNA 2J74A 3C6LA 1A4JB 2CLZB 2IANB 1SEQL 3BAEL 2F8XC 2WVVA 5I1CH 1NFDE 4V2CB 4DAGH 1T2QL 3MXWL 1VEPA 2OR9L 2XA3A 3O9WA 4ZUUB 4K7PX 2IADB 3EFDH 1UWGL 4U1JB 2G60L 4JFZH 1NCDL 2CIIB 2O92A 2R56L 3X3FL 5EH1A 4HUVB 3TZVC 5HYJA 2WZEA 1RZKL 4L1DA 3UXFA 3B8YA 1G84A 4A4AA 1SEQH 1QFOA 5BZDA 2CLVB 4YC2C 5A6KA 4RFEB 1FPTL 5I1EH 3ARUA 3WMBA 4Y5VC 2F74A 2VERN 3JVGC 1ZGLB 1HSAB 1IZKA 3LN5A 3PZ9A 1C8PA 4ODSH 1D6VH 1BGGA 1LGVA 4H0GA 2D31A 1H3UA 4J3XA 3FHQA 3RHWF 1E43A 3IVKA 2EECA 3QT2A 2EDTA 2QTEA 4WFHD 2XQYK 3LKQB 3H54A 4XCCL 1F5WA 1WFNA 1U0QA 5A8OA 3KNBB 4KRPD 4PY7B 5HY9A 3I02B 2VSDA 1AI1H 3F7VA 2CDGB 4ZFOL 1OP5H 1NLBL 5CMAA 1NGYA 5BZWB 3AOFA 3MRGB 1MQKH 4FK9A 4X9GA 3AIWA 1MOEA 5EU3A 12E8L 2I60L 3MRFB 3S37H 3WQ6A 5C07E 3VFOB 3GI8L 2BDNH 3N12A 1BZ7B 3SDAC 4AH2B 3V7AE 4YHGA 4KZEH 4MD0A 3DECA 4TTUA 1L0QA 2VLRD 3TO2B 4PJ9D 2FBOJ 2GFBB 3X11A 3JUGA 2F8VA 2EO7A 3TVMB 1GQKA 3PTKA 4AIUA 1A7QL 4RDQF 4O9HL 2GEEA 1T3FA 2EH8H 3JTSB 3T0VA 3WDJA 1U2YA 5IROA 5DHYA 4IOFC 3HC3H 1YN6B 2VDOL 3QIUB 4S2SB 5BCAA 3H7LA 3HLAA 2JALA 3ZTJH 3VXNA 3HZYA 4LLUA 3VIHA 3BKCL 4OM1H 4WTZA 2FGWH 3SQBA 1AD9B 1ORSA 4JFQA 3WN5C 4I4WA 3LPPA 4RWYL 1Z9LA 3EO9L 3LEYL 3M8OL 4PP1D 1NWTA 5DK3A 3BUPA 3WF2A 5E8NA 2GJ6A 3QCVH 3GSRB 5C07D 3BIKB 2WKGA 4YNYA 4TVCA 2YPVL 1HXYB 3MJ9L 1TFHA 4BSWB 3B9KC 3HNTH 3DURA 3TN0C 1PX4A 3GXTA 4PJCE 1ZL1A 3ORJA 4OZFG 4YPGA 3U36A 3OLEA 2GSGA 2YA0A 4FQ1H 4L4JA 3BLKA 4AIOA 4LPWA 2Q6WB 3WS3B 1CXEA 3GMMB 3O2VH 4WWKD 3PHSA 1BYDA 3FNDA 4I5BB 2B1AH 1GONA 4UT6L 2BNRD 5DJAB 1ETZA 2DMBA 5C2UB 4X0NA 3MV8A 4BCEA 1FFOA 2YD9A 2FJFA 1JDCA 2WC3A 1F8TH 2NTFA 2HJFA 3P0VL 1F02I 1RUAL 1KBBA 2DWEB 2NW3A 1WCBA 3FL7A 2GI7A 2QR0B 4M03A 5KZCD 2UUDH 4HCRH 1FNHA 4GRWB 2YPLB 5IB3A 2HKHH 3OHXB 3OJDB 1E4XL 4GW5A 4NXKA 1C16B 1L0YA 1U91B 4AENB 3GXFA 1REIA 4LQFL 3KLKA 4HDIB 3T77A 3O6KH 2APFA 2FATL 4O2EB 2CUMA 3VI4E 4I4WB 2HH0L 5DD6B 4AK1A 3S3SA 1RPKA 1P6FA 5EB8A 5F6HI 3P0VH 4JPWH 5E99H 3SKNB 1QFWI 2NNAA 4FMVA 3BJ91 3QIUD 4HHAA 3RWEA 5FECA 5ICYB 5SWZB 3U7WL 1ONQB 1ZVHA 1XR8B 1KEGH 4F7EA 5TH2A 2PWGA 1H3GA 5HBFA 4JO2L 3BPOB 5FKPA 4MNQD 4G8GB 1EEYA 2XA8L 2AJ3A 5FOJA 1E6XM 5D6DC 1UEYA 3DETD 3MSPA 4Z18A 2J7HA 1JNJA 1AC0A 4RFNB 5KSVB 4FQCL 4X7FC 1H2JA 3LKSA 1QFUL 3BVVA 5D70H 4R8WL 1G0YR 1YPZE 4OM0H 1D3CA 2RGSA 4JHAL 1RZFH 3W0WE 3X17A 2DDXA 1TENA 1T03L 1CLXA 1XCTA 3ALFA 4GQQA 3WUBA 2EBNA 3V0VA 1IL1B 2UV3A 1U91A 1M7IA 1W8NA 4LCWB 4P4RB 1RZ7H 3CVHB 5KN5B 3PZOA 4JJ5A 2DQFB 3B6SA 5K9KA 3NAAL 4RFOH 1QBML 4GBXB 3NA9H 3MJ7A 1RUQH 2VL4A 2CR3A 4FLQA 4UQ3A 3IDJA 4HJ0C 5D70L 5E1HB 3R1GH 2ADJA 2A2QT 2VWEC 2FX8L 5T1MB 4X6CB 1KXTA 4BQCA 2DYPA 5CSUA 1BM3H 4E5XA 4F9DA 3BO8B 2DQGL 2OR9H 2VQ1A 3S9DB 2DWDA 5DZNA 3QGVA 2Y8VA 1QLRA 1HZHH 5B3JF 2AJYH 2CK2A 3JWOH 2WMGA 3BZFA 3C2AL 4UQAA 4QOKD 5T1KA 5DD0H 1QG3A 2XTJE 5IJKA 2I27N 2IALB 3OKOA 3GMRB 3GXPA 2VISA 3QPXL 5EU6A 2ZICA 4QHUA 1IAKB 1UFUA 1ZXQA 4P4KB 5E94B 3DX2A 4LAQL 3MOBH 5EBMB 4R7DA 4XNZB 4N0CD 2DQUH 4OLXH 3VFUA 3CVIL 5JHLL 1JPSH 4JQVA 4G9DA 1JGEB 2WINA 1CLOH 1U8JB 4M62L 3E6HA 5LGJB 5GZOD 3S8WA 1N82A 3LB6C 3RX8A 1QHZA 4WIWA 3WD2A 4P46C 4GAJL 3MJ8B 4L9LC 4JFEA 3QXAB 5AC4A 1AHWC 4QDMA 1IFHH 2HT3D 3IJYA 3ARFA 2EXOA 4NP4L 2GSIA 5HTSA 4XB7A 5J89A 1AO7B 3VDHA 4GMSL 2BNQD 1K5NB 5DTFA 5HVHC 2FNBA 2V7NB 4YC2B 4K23H 1LDPL 1ZK9A 4JZJC 4LPUA 3TBTB 3T4YB 2PO6D 2W67A 4H88H 3QFJA 1UR9A 3UR7A 3KPQB 4XWGH 1B2WL 3MRBA 1WT5C 5AYUH 5AAMA 4PJ5A 1U41A 4XNMB 3CUJA 3QZWB 4AIXA 2Z4QA 4WI3A 3DUUA 1H3WM 2CKNA 2UWEF 1TJGL 4CAGA 5MEPA 1CFSB 4JFFD 3G9VA 1X4ZA 5IFAL 2YJQA 3JWDH 5IOPA 1CDIA 4PB9L 1HEZB 3LKOB 1J0KA 1AR2A 5D1XB 1FL5B 1DL7L 3VCLA 4Y2DC 3BZEB 4D0CB 2WIIA 1WJ3A 3DTXB 5AYUL 3VUPA 5KVDH 1DN0A 3P11L 2WCAA 4JKPL 3PWPD 5EIIA 3VFUB 2BX5A 3DROB 3KHOA 1SFSA 3MMUA 3MBXH 3MREB 2A6JB 5IQ9B 2PC8A 1WICA 4NBYB 1LLOA 4PRNB 2G75A 3BAWA 4KRPC 1DEDA 3LPFA 3SKOA 5BXRA 3BN3B 4P46D 3ARFD 2QQNL 4PN2A 3RM8A 1WBZB 32C2B 3DDGA 3EYPA 3FB6B 3A21A 3F8UB 4L4OA 3DRTA 5BV7L 4K68A 4A6YL 1SEBB 1AQDB 5MENA 3VXRA 1RV6X 1MF2L 1CGYA 3VXME 4QF1B 5CGYC 2D24A 4F58L 4CN6A 5DUBB 1QBLL 1FNGB 2R0LL 3WH9A 2EPKX 3MS8A 1IQDB 4J7RA 5H2BB 3OQ3B 4DVRH 1NDMB 4IMKC 1WVZA 3Q2CA 3VFGL 3MZGB 1IGCL 3RWHB 2GW5A 3DPBA 3TNNA 4RGNE 3RTQA 2CIIA 1INQB 1HEZA 3CDGA 4CKQA 3CSYB 1NMBL 2D9CA 1YC8A 1T89C 4Z7VF 1ES0A 3RU8L 5C8JB 5J11C 4IUGA 2P24A 1CF8L 2CLVA 4U49A 5BWFA 1AKJD 5IB1B 4NF7A 3BH8A 1V6WA 3PGDA 3ZDZE 5KVFL 3VSVA 4K94L 3NABH 2VDQH 2YLAA 4HJJH 1DBBH 4OLVH 4XZWA 4ZOCA 1IGCH 3T0EE 1L7IL 3PL6C 1D6EA 1E5NA 2VZTA 4LGPB 1BIIA 4LPYA 1DUZA 3FB5A 1NUDA 1W0VB 4YXKL 5M94B 1KJ2B 4M3KB 4OZ4A 2P43B 4ALAL 3WEZA 3C5SB 5SWQA 4NQEA 1CFVH 2HYMA 4XP4L 3HFMH 1UOKA 4LP5A 2XVKA 5C0RH 3QFDB 4GI9A 5D7LD 1GVYA 5E0CA 3BHBA 2WBGA 4W89A 2P8LA 4QEGA 1T83C 3GUTA 2NZ9C 1BZ7A 2GUYA 3MROA 3IJ9A 3F5LA 2O5XL 3SBWA 1EDTA 3ZT5A 4N0YL 3MLYH 3B9EA 4GH7B 3OKYA 5ACLA 2CXKA 4WUUE 2XN9A 3H42H 2OZ4A 4MMXC 1T6VN 2D4FA 3CSYA 4DTGL 5J9PA 1IAIH 1RIVH 3BVUA 4NWTH 3TT1H 1JRHL 1S7XA 1GC1L 3QIUA 3VXSD 2R8SH 4HBCH 5IMMB 4WY7H 4J23A 5KVMC 1AQ0A 2PB1A 3CC1A 4HIJA 2AJXH 2MPAL 1KV3A 1AGDB 4BFIB 2NY3C 1HQRB 5SX4I 1MJUH 3RNKA 5HDOA 5C0BE 4QRUB 4HS3B 4HH9B 2EPMX 1LE5B 3RUGA 3GBNL 2E3VA 3BP7B 5IESH 2O26U 3HMXH 4OQTL 2HMID 1QLEH 2VLLA 3TO4C 3TCLA 3U30C 2DQXA 2BVQA 4GBXC 3CXHJ 3BUQA 4PV8B 1C3FA 2H41A 3T3ME 4QXGH 1XGPB 3N85H 3IAGC 3GMMA 3D9AL 4P7RA 2L0DA 2CQVA 3IF1A 1KFAL 5IMOB 1UWXK 5EZOL 3QIWD 5LA1A 1E6OH 3ZDZF 1JNLH 5DR5H 5DJZB 3HS0A 5F1OB 4LCUB 4A2MA 4QRPB 1NMBH 4PR5B 4PLJD 2WYSA 1MEXH 1TPXC 3ZKMC 1MRCH 5C6WH 1GPOL 3FO0H 5BMFH 4UV4H 5HDBF 1P84J 2X09A 2YPLA 3D39D 3P4OA 4BSVB 3ARYA 1UACH 1NP2A 3MLTA 3SUVA 4GSDH 1CL7H 4FTVD 4R90H 5JORA 3BISA 2YD4A 2XVNA 5I1DA 2VN7A 3NGBC 4UQBA 3D52A 4GMSH 5ADOH 5I1KH 5AD0B 4HIIB 4DGVL 4K07A 3B43A 2LU3A 3AS3A 2PTVA 4KRLB 4KJPC 3T0EC 1Q0YL 2B4CC 3DUHA 2MKWA 2VOTA 4OLWH 3NUKA 3DARA 4LNRB 4U6VL 4PLOB 1FRGH 5ENWB 3NIFF 4ZPTA 2VLLB 4RRPG 3LQZB 2PWHA 3AIVA 1MY7A 5A2AA 5BXPA 1HWWA 1NC2A 1ZT4A 3GZKA 5GRZA 4ZS7H 3Q5TA 5CEYA 3BKYH 4HIEA 2QHRL 2BVUA 5IFPA 5JW3H 4FQ2H 1U6AH 1KC5H 3PV6B 4XP1L 4KK5D 5FHBH 4PCSA 1IAOB 3KLHD 2VYRE 3SDDB 5CUSL 1KB9K 4PR5A 3SCUA 3CHFA 4AW7A 4NWTL 2DD8H 2ZKHH 4L3ED 2NW0A 4RMRA 4XCNA 4LDEB 4KJYB 1H1NA 4N5EC 5HYFA 4ZS7L 5JXED 4DN3H 1A6PA 3KPSD 4WI7A 2LTQB 2MCPH 3V0WL 4HFWB 2I07B 3MXVH 1N8ZB 5DA4A 1QVOB 1MRDL 2BRRL 2J88H 2Z31A 3REWB 3TH4T 3WS6A 5I16A 3D3VA 5F1NA 3CX2A 1T66C 3BWAA 5DD1L 4Z5RA 3CH1A 1MNUL 4HBQA 5EMYA 2XG4A 3DNKA 4JPKH 1QVBA 5DO8A 4PRIE 1MF2H 1S7TB 3BUTA 1JYVA 4NNYA 2LU4A 2Q7YB 4U5IA 1J5OL 3V95A 2ITDA 4LVNC 5CSBA 4F7MB 4OOZA 1F3JA 1MHHA 1M7DB 5FYKL 4RISL 1N6QL 3KLAA 1JD7A 1T6WA 1EHXA 5ABFB 2R23A 4R7NB 3EAKA 2HLAB 3D50A 4U3AA 1T1YA 3HI5H 5JQHC 3BZFB 3LX9A 1MFDL 3EJSA 4Y5YC 5EFDA 2DI8A 2WHKA 5E8PB 1CDHA 4NNXA 2ILLA 4YE4H 5I1LB 4GBXA 3GMRA 3CFCL 3VX1A 3AHVA 4FF5A 1EUTA 2DGAA 1Z9OA 4RISH 4KFZC 4NUGH 3EFFB 2WC7A 1AJ7L 5ACZA 4NO0B 2OQJA 3SE9H 3O6LL 1UKSA 1V6VA 1OGAB 1RZ8B 1FPTH 2RAMA 4R3SA 4N5ED 3JV6A 3T2QA 1JGVH 2ZOLA 3NPSB 4O00A 2DLFL 1A3HA 1E4NA 3TN0D 1UWUA 2IPUK 4HWEH 2GJ6D 3L4XA 2RGLA 4M8QA 4JDTL 1F6LL 4KPHH 3KYOB 5I30L 3UTSA 3FQWB 3F65A 2A3AA 1Q0YH 3MNWB 2R0ZH 3VH8G 4ZTPL 3HZMA 3PZVA 4Z0XA 1EX0A 4JPIA 3D3VE 4QFUA 5ISZB 3POHA 1JFHA 4LSPH 4EUPG 3OSKA 4ORZC 4PJ5B 2C7UA 4P5KB 2WANA 4FS0A 1N3NB 3UTZA 3MLPA 2B20A 4N42A 5IEHB 5FHAH 4OIIL 4F15C 1CD9B 4NCC1 3V6BR 3D39E 2DT2A 5GGTH 4GO6B 1KBGH 1V3MA 2VURA 1HHJB 5D9PA 4U6XA 4HG4J 1R5WA 5GGVY 4N0RA 2V7NA 3PZUA 1J87A 1GCFA 5E08L 2WLYA 4U1KB 2GJJA 4CADB 3WFLA 3HNSL 1NAMB 1U8MB 4F37K 2F2HA 3PABA 5EIIB 4NQXB 4GG6A 1H3PH 2YRZA 2QADC 4Z76B 4WFGE 1I1AA 3Q6FB 4EVNA 1OP3K 4PJDE 2X4OB 4X6DF 4BQ4A 1D5ZB 1MCWW 2GK1B 4WTXA 3QHZL 3TP4A 2DJSA 4HT1H 2A3EA 3P9LB 1BAGA 4LSTH 2WZPD 4X6BA 1S5IL 1E4WH 3ZKQD 4DKFL 2W0FB 3I50L 3WY3A 1DWIM 3GBNH 4KDTA 4HTYA 1RJLA 3ULUE 4GRMA 3IFLH 4EJ1C 1IM9B 4YHMH 2OSYA 4KU1A 1NBZA 1JZ8A 5A1AA 4TULL 1ZTXH 2R4SL 4Y16A 1D5XA 3TTQA 5F93C 4D1IA 4KTEH 2V2XB 4N8VB 4P0DA 1FJ1A 4CU8A 1N6UA 3WYRA 2NXZD 5DI8A 5IEHA 3HG3A 4JKKA 1NH6A 2X4PB 3A5VA 3WUWG 5CILH 3FB7B 3IDGA 3MREA 4XP6L 1FGNL 4WCYL 1JHTB 3AHXA 2VLRA 3MCKA 3QCVL 4IJ3B 4R4FH 2YD7A 4KRPB 4M7LT 2DJ4A 1EDQA 2QSVA 5FIPA 3Q6GL 2PXYB 3UAJC 5JPNA 4BK5A 1MWAA 2E9WA 4Z78A 2JJTA 5A2BA 2PN5A 2YD5A 1JNEA 1K9EA 1X7QB 5E95B 4BK4A 4Y1AB 2WPGA 4S11A 3OAZK 3PGCB 4KK9D 4NQXA 4GG6B 1E4MM 1TNMA 3DI3B 4P9HC 4EIGB 1OTTD 3NFNB 4NZRL 3MA7A 4G7YL 1T04B 5E5UB 2WCSA 1JGVL 2AJYL 3IS1X 1KPRB 5HDBE 1Q0XL 2NY5H 4U1SB 5AZEL 3LMJH 5FB8A 1B3XA 4QLKA 1U3HA 4IRSA 2HT2C 1L9NA 4R26H 4XCCH 1ZT7A 3CD4A 3RVXD 1Q9LB 1QRND 1PKQB 2CXGA 3WEXB 3G5ZA 1TQBC 4XMKL 3IDXL 2V2XA 3BHBB 4M9PA 5CBEA 1EAPA 3HPLA 4KUZH 4L4VD 4XX1E 4BA0A 3WLBB 5DRXB 1YEJH 1X5AA 3UESA 1T21B 3GBML 2APWA 3ARZA 5CD5D 5IMLA 4NN6C 4QYOB 1P69B 4R96B 2VMFA 3MUZ1 3WO4B 5J12C 2SEBA 3CZLA 3H55A 1JHLH 2W60B 1HF6A 2ZCLL 3X12B 4NQDA 4CMMA 4FA8A 3SDAA 3WFHB 1A7PL 1P4LA 3MV7D 4S1SH 2OR7A 1DTUA 5LA0A 5AC5A 4XMPH 3VGEA 3GNML 1GOQA 4HMDA 1FP8A 1MWAB 2YKKA 4NKDA 3AFBA 3HE6B 4PRDB 1K3IA 4KWUA 3U6RB 4MB5A 1XCQA 4KHXH 1EQPA 1IQWL 5DK2A 2JF7A 1JAEA 5KZCB 1J8HA 5D5ME 2IUZA 2VE6B 2B7DT 3VWKD 5E03A 2E9LA 3CSPA 3SDDC 1DQML 4Z2HA 1XGYH 5GGVL 3OTTA 3WEOA 4PJBA 2J7EA 4LP4A 1KPRA 2BFGA 4XNYL 3Q5OA 4QHLB 2HG5B 2EEAA 3BAYA 1ED3B 3WF3A 2Y36H 1T7XA 3WN5A 3CXHK 4OF8A 4KZDL 1AIFA 4PYSA 1OSZB 2YPVH 1WZ1L 3L5HA 1Q9LA 2H45A 2EC8A 3P11H 4KGJA 3ULVE 2X2IA 1G9NH 3TCLB 3DX9B 3KDMA 4JFDA 5EN2A 4NN7B 3II1A 4N0UE 1A9EB 1UR1A 4WKAA 3FMGH 3MACL 4FFZL 4TQEH 5L2KB 4URIA 3OIHA 4Z2IA 2WUCL 1U8KB 3NVQA 1CR9H 4P59L 1DVFD 3ZR6A 4TX8A 3DX0A 1IBGL 4RMUA 2VWEE 2OLHA 1OAUL 2QSQA 2IJ0C 3IKKA 4X9HA 5CD5C 5KG9B 3DO7B 2Z1SA 3GH7A 4OCNC 4XNUH 1OTSD 2DQIH 4FFYL 2CSPA 2WWKT 2XNAA 3V5DA 1G01A 5IG7B 1JZ3A 5IWLC 5FKAB 3LV3A 4L4VB 3BLPX 4PJGE 5F9JA 1P4IL 4B9ZA 4OT1L 4LLDB 3A47A 3OGRA 4J3SA 1PPIA 2R9HD 3ZQ9A 4JN1L 1MCOH 4X5WA 3EJUA 2HH0H 3VXMA 5BZWA 3W37A 3QJHA 4WO4C 3LRMA 2FHFA 5K9OA 1HNGA 1T22A 3AU1A 2O61A 1OWRM 3R0NA 1A9BB 1PIFA 5EO0B 1E0OB 1BJ1H 2WCGA 3BAJA 2VLRE 3MMWA 1GUVA 1FZKA 2P8MA 2DQUL 4OLXL 5JHLH 1HJWA 4Y5XC 2AEQL 4ACPA 2F61A 4H8HA 1ECEA 3WDRA 2JB5L 3BQUA 3U82B 2Z8WC 3MRCA 4JO2H 4ACZB 4LU5H 1J1PL 3MV9A 5JQ6L 1PZUB 5DC9B 3NACH 3IB4A 5TFSH 2OS7A 5EDXA 3REVA 2Y07H 3SJVE 4YZFE 5HHNB 4GO9A 2EIZA 4RAVB 4F7CA 4Q74A 4ZS6C 1W1PA 3MOAL 4U1HA 1GC1C 3HMXA 3S4SB 3CVHH 1TJGH 1DBJL 4TVSa 5F96H 5GRVK 4HXAL 4HKJB 3C5ZB 3GMLB 4FQQA 1NCWL 1LP9F 3O4LD 3OXRA 5ACMA 3TIEA 2BSRA 1HKJA 2EDRA 4OGAC 2EE6A 2Z35A 2AQ1A 4HAGA 1A8JH 3HG1D 3BGAA 2AEPL 8CGTA 4ONFH 3VFOA 1DQJB 4HV8A 4BQ6A 1NKRA 5AUMB 3TTYA 2DJUA 4LSUL 4H20L 3PWLB 4FZEL 5IM7B 2Q1EA 3SCSA 5E4IA 4Y7MA 3HI1B 4PJGB 1EPFA 5LGHL 4UU9A 3H3KA 1GZJA 5LGKA 2DBJA 4JFFE 3L5WB 4KTDL 2DOCA 5DJAA 2EYSA 2P44B 2NXYB 4YBLB 5B4MC 1X44A 2F7OA 3O4LB 2RFXA 1JN6A 3SGDH 3WNKA 1CGSH 2BVPA 3P2TA 4TUOA 3MSGA 3LRLA 4LSUH 1EVTC 2HWZH 2X4TA 3U9UA 1WIOA 2JIXA 5HGHB 3KPRD 1JE6A 4UMGA 1U92B 2WUCH 2F8OA 3O3BA 2HT4D 4Z0BL 5IB3B 2NX5B 1C8QA 3OF6D 3FRPG 3CUFA 2LABA 4F7CB 2BNQE 4YIQB 3NCFB 4M48H 3QHFH 4JEGB 1DLHB 4NZDA 5F7DB 1TQBB 2BY0A 4O2EA 1UADC 2GK0A 3P73B 1UD5A 3SDAD 3OWEA 1CD1B 2EDHA 1SM3H 4HS8L 2PYEE 3RGVA 4B7LA 5FO8A 1YEKL 3WL1A 2HVKB 1ZEAL 2Z35B 4NN6B 2DIBA 2I24N 4PGCB 4GAYA 4GW4B 1FHDA 3DMMC 1ONQA 4NQTA 3GIZH 4P4KC 1I9RH 4PGBB 4LVOC 5I1HH 4JHWL 4HK3N 4KV5E 1EEYB 5K93A 4OTXL 4UQDA 5C08A 4GUPA 4OQ1A 4UFJA 1W3LA 1AHWA 1VJZA 4KI5D 5CP7A 3I75B 4YO0A 4WHYH 3AXXA 1FVCB 2MQCA 5KSVA 1QI2A 3OR6A 3ARFC 3PN8A 2EZ0C 3SGDI 4N9OB 5E4EC 3TTOA 2A6IB 4KRNA 3GJFB 3CPLA 1JN6B 3UTQA 1BVNP 3GH4A 5F1IB 2C7UB 4J12A 3DBXA 2V5TA 4P2RE 3MLRL 4M80A 3T77B 1ODAA 5IFAH 1U8NA 3N1GC 4YR6B 3O3AB 4RL3A 3LRSB 2OWWA 1EGJL 1KTLA 4I9WE 2GJZB 1DL7H 3MLWH 3N1MC 2D1ZA 4CUCA 5CG0A 1OL0A 1H5VA 5C0FA 4BYHA 5EU7C 3SN6N 4UQ3B 4U1KA 1OAXL 1V0MA 3MNWA 2YBRA 5C70A 2HVKA 4NNPH 2OL3L 3UO1H 3VGHA 4HWBL 1W2KT 1NQ6A 1NAKH 3T65A 1I4FA 1UXSB 3OMZA 4GZJA 5C09A 1M05A 4ZAKA 2YFOA 2DKMA 2F54E 4FZEH 1D5ZA 5L0QC 3LD8C 5IBLC 4OZOA 2QQNH 5J1AB 3GBDA 2XFXB 1ZWIB 3G6JA 5I75B 3BP6A 4N68A 4PRHA 5C0AA 3SCVA 4GUPB 4YDIL 3QUYC 1IAIL 1RIVL 5FYLD 5CP7B 4YO0B 3T0AA 1V0KA 1SY6H 1CLVA 1BD2D 4XVJH 3ULSB 3EIFA 2HKFH 4DWSA 2GT9A 2OJEB 3QWRA 2NY4D 4P2QD 2VDNL 2BHYA 4LYQA 5D6CB 5J8OA 4J4PD 1EXUA 5I1IH 2ZUMA 2CYGA 5FCZA 4M29A 2HJLB 1I1AD 5FUCE 3CVHA 3WSUA 1B6UA 2FE0A 4WSJA 1Q94A 1A3RH 3HUJB 3LRKA 5CCKL 4JM4H 1YDPA 2EAEA 3QHFL 2LAAA 1CDJA 2D7NA 4LCCA 4O2FB 2W66A 3WHXB 2F54D 2X4UA 3AZRA 1H49A 3ZHDA 1QR1B 3HPJA 3VMNA 5IMKB 4WHTB 5DS8A 3RTQC 3PZTA 2R1XB 1BVKB 4RA3A 4B7IA 5T3XH 1QPKA 3BO8A 4K94H 2J5LB 7A3HA 2V6HA 4HJJL 1MEXL 3WO3B 4PLKC 2ARWA 4BM7A 3CMGA 4K71C 3QFJB 1DBML 4N8PA 4XGZA 2CBJA 3HZKB 4Q6IB 5DMGD 4U7KA 1QHOA 4QY8A 4L5FL 2PYFA 5I1CL 4KKAD 3I6KB 2B4CH 1KXQE 3LHPH 3HAEA 2ORBH 2D23A 2X4RB 1M03A 1H11A 2X4PA 4O4YH 1EFXB 1TVBB 1AP2A 2K7QA 4NFCA 1U58B 4LLWB 1TQSA 1GQIA 3ARGC 1IAKA 4P4KA 4P2RD 1H41A 1YECL 4BH8A 1N2RB 3NSXA 2VDRL 5E2WL 4OZFH 3ULVD 1U8JA 5LGJA 2R2EB 4HKBA 1FQ9C 3GSUB 3S34L 3WLBA 1W91A 4UUJB 4UV7L 2OK0L 4OD1L 4XB8A 3VNZA 1DANU 4QYOA 1ZA6A 5EUOE 1ORQA 2AEWA 4PRPE 4PG2C 1MW3A 1I1AC 3HE7A 5DSCB 1EZVX 1GRWA 1YA5A 5HHPB 3A23A 4DM2A 1OB1A 1S9XA 4OZGB 1KIQA 3QG7H 3QIWB 1P4LB 1NFIA 2JEPA 5FA4B 1C8YA 3TFKC 2R0ZL 1JZ2A 2E27H 3AXLB 3RBSA 1Z5LA 3CZNA 3WN6A 3SBWC 1JJUA 3OLDA 4NKOB 4KDTC 1U8OA 2R8SL 4LMQI 1KG0B 5C71A 3B3IA 3WSQL 3U57A 2ZUTA 1KN2L 3HG5A 1JF1B 2PCPB 3IAPA 2F7QA 1J8HB 2W9DL 3LN4A 1BOYA 4PTTB 3QUZD 1YMHB 1JPFB 4JN2A 3RA7L 5IHBA 3DX8B 3F6IA 1Z9SA 1R3JB 1M71A 3QIUC 1QNSA 4ENED 2F53E 5IW3A 2VZVA 1ED3A 3PV7A 4MB3A 4RGOL 5BOPA 3BAIA 5INDA 5EU3B 1GOKA 2DB8A 3EJPA 3RJXA 4IIQB 1OAZH 4XTRC 2GTZA 1K9FA 3CFKA 1RUPH 3RZCA 3ARBC 5C3TA 1ISXA 4WU7A 2FGWL 2QV2A 2X4QB 4K3JH 2YBTA 3X11B 4FTVA 4PTUB 5I74C 4WI9A 1OM3H 5DD1H 5DJCB 5JUEH 3ECQA 5LYRA 2GJXA 5TF1H 5TE6L 4LYRA 3SOBL 5MERB 4AIEA 3Q0HA 2OP4L 4MAYC 3ROLA 4HUXB 1K9TA 4FQIL 5JO5A 3BKJL 4ATDA 1WWCA 3VPLA 3LEYH 3QNYB 1W1TA 4XVUD 2CK0H 5DMKB 1F6AB 4B53A 1AGEA 1W0VA 4E41A 3ETBF 1J5OH 1GJWA 5GNZA 5IXEA 4X4ZA 3C5SA 1B0GA 5SWQB 4V28A 5HVFB 4JQIL 5MEOA 5F9JB 1LQ0A 1GOFA 1VGEL 4UIKL 3RKDC 5EOTB 4UNVA 2H3NA 2A6DA 5JOEA 4Y2DD 4JHWH 5L2KA 4XP9H 1WISA 4K3EL 1US2A 3OLIA 1YMHA 4L4PA 4BA8A 3QDME 4ZOEA 5GPRA 2Y7QB 3PGFH 4JDZB 5CLWA 3GB7B 4HLZG 4K2UL 3RVTC 4XH2B 3GI9H 4QXTB 2CESA 5EO0A 5MI0C 3S98A 1INDH 5GS3A 4ZYKB 5B8CA 3GMPB 1J8KA 4F66A 2VITA 3WH7A 5DZLA 3PHOB 1WF5A 4UIKH 1CQYA 1V0LA 1AGFB 1EERB 5DYOB 2IWGA 2EYTB 2XWJB 1S3KH 5I8CB 4LNVA 1SJEB 2XICA 3L5XL 5FUOH 2OK0H 5DJCA 3TVMC 4HWEL 2V3GA 3G04A 4X0VA 4YUEH 2JJSC 3QB7C 1NEZA 4ELKB 3QJHB 2D73A 1A1NB 1QTYT 4FOMA 4HKJA 3V6ZA 2CIKA 3EGSB 3PWUB 4LBEA 3AHZA 4MNGB 3TJEH 1AGEB 4E41B 3LH2H 4XVSH 2DI9A 2W9EH 4M5ZH 2FR4A 2EACA 4AD2A 1ZS8A 2V2WA 4HS3A 3BC9A 3SDCB 1LE5A 4FQXC 1VRXA 1HHIB 2JJVA 3MBEC 4L8SC 3KWWA 5HD8D 5EU5A 2QPUA 4MAUH 4MQ7A 5JIKA 3T0BA 3GBMH 4FNQA 3O6FC 5CHNA 5DC4B 5DEFA 3SPVB 4Q6YA 2CBVA 3AVEA 5I79A 3DXAD 1EQCA 3TN0B 4QLRA 2NY7H 5E8OB 2J1KA 4R8WH 1T5WA 3VXUD 4DKFH 3T1WA 2NY1D 5DJZA 1ITCA 5B8CB 3C5ZA 3QWRD 3PWJA 4FQJH 2VX7A 4KKLD 4M7JH 3VI3F 2D3NA 1H3XA 1FNLA 3UPRB 2X9YA 3PWPE 3CX5J 3KPOA 1FAIH 3O3BB 3GEWB 5CGTA 3MLUL 5C86A 2XVGA 3IJHA 4JFOA 4FFVC 4ZUUA 4ODTL 5CJOL 4RAUA 3FQNA 2V17H 3ELAT 1UD6A 1TCRA 2FX8H 1MAKA 3BPCA 2WNGA 1H5BA 2C4XA 3RPKA 2CDEA 3O2DH 4MNGA 4P9ML 3R1GL 1QSZA 5LCVL 1XSKA 2YOCA 5KSUB 5J6GB 3F5WB 3VMOA 2JK5A 5FCSH 1HHIA 2C0HA 4TNWK 2BCKB 3GK8L 4D9RD 1CFBA 4FFZH 4ZD3L 1ESWA 2F1AA 1NUFA 3JVGA 2OBGA 4N9GB 5ICZA 1EUUA 1RIUL 1CICD 3RVUC 3HMWL 1S9WA 2IFFL 4MA1C 4X7EC 4QWWC 5GS2H 3SY0B 1IEAA 5CD3B 2A74A 4W6XB 1HKMA 1IRAY 4UILL 2NY5L 2CRZA 2Z8SA 1I7RA 3CZKA 3QDGD 5FGBC 5IVXE 2GK0B 3P73A 5ALBL 1XH0A 5C0NC 1U95B 3LS5L 1AXTL 3F7YA 3A4AA 2FYYA 5C0GB 4YHOL 1LE9B 2C3HA 4JGJA 4LARL 3T0EB 4E41E 2A3BA 1CIDA 1TVHB 5C0DA 3RRQA 3MMEB 3H7BA 1HYSC 2C3VA 1E55A 4U1NB 3BE1H 1PY4A 4WUUA 1EO8H 2AJVH 2YRPA 4WEBL 1YEEH 1SYSB 3UETA 3VH8B 2HFGL 1FE8H 4MD0B 1L6XA 4ORGB 4EDXA 2XTJD 4NRXA 1V6XA 4G6FD 2CHNA 4QOKE 4WDIA 1KUMA 2CDEB 2F58L 2FHCA 3TVMA 5CJXA 4XC3H 1A7OL 1FVCA 1OCWL 1I8IB 1Y0LA 3IGUA 3GBEA 5E9DD 1T0NB 4OCYL 3WUFA 3MBED 3L9RB 4K3HA 4KUZL 1NC2B 3BE1L 4N0FB 3STZA 3VJ6B 2OL3B 1KLFA 5DUPH 1EXPA 4FQCH 5IHZB 4JDVB 2EADA 4LCYB 1G7PA 4PJ5D 1LP9E 1G7MB 1HK6A 3TIDA 3VI3E 1X5GA 1FZMA 2P42B 3IDIA 3VIKA 1S9WB 5MEND 2EEDA 1KTLB 4HPHA 5EZIH 3F6LA 3MV9D 4L8BA 2ADGA 3WUWB 1CIUA 5D1ZC 3I84A 2VLMD 1JF5A 5E6ZA 3BUYA 4Y1AE 4I8DA 3TWCL 4MQXD 3RL1B 1R34A 2RCSL 5D6CA 3LKOA 3QIBD 3ZO0A 2HISA 2WBJB 3O2VL 4LSDA 4XNYH 3RAJH 3S35L 3SEPA 1U3JA 4ELME 1DDHB 1DQMH 3ZDXE 4OSUH 3BZEA 1M1SA 5DJ0B 2OW6A 5IP4A 4GQRA 2FJHA 4GG8B 3UZVB 4NQUA 4JY6B 3VRIA 2VZSA 2AJSH 4WFGD 2BNRA 4TQEL 4X80L 5DS8B 2ZPKL 4WDIB 2J7CA 3BXWA 4BF7A 1UKPA 2AQ2A 3CIVA 1F45A 5IF0A 1V5JA 4G6JL 4E42A 4AWEA 1NC4A 4P3CL 3E3QE 5JLZB 1NFDB 3VJ6A 2YKLH 2LQRA 4LRNH 1QEWA 3SIMA 3HAEB 3EOAA 3EYUL 1W3KA 2EABA 1AGCB 3UG3A 5I76B 3EJYC 1GOGA 3H0TB 3D4YA 2D22A 1C5CH 4WNQB 2OI9B 1AP2B 4D1JA 4NN5B 4GJTB 5DD6A 1FNGA 3K81A 4L8SB 1J0YA 2ZX8A 1XGTA 1E4KA 1N0LA 2WWMD 5EULV 3BVNB 3VIMA 4F2MB 1FSKB 1EGJA 3QG6A 1S3KL 4NRYA 2MJWA 3ZE1F 4PUEA 5FGRA 3O2LA 3ZYJA 5J13B 4Z76A 4D0BA 3PQYE 1A22B 4QOKB 5KVGL 2HFGH 3CX5K 3WBEA 3R06B 1S9XB 2XN2A 4ONOA 1QFUH 5CJBA 4DGIH 1A2YA 4RFNC 1XF4B 3O45B 2VX6A 4Z0XB 1S7UB 4U3CA 2UZYB 1CCZA 5IDIA 1MFCH 1BBDL 1CFTB 3IU3A 4PJ5E 2H2SD 2E9IA 3PZNA 1NCBL 1FZJA 1ZLWK 3DHPA 1IAII 3MKKA 3OKKB 1C08B 3S5LB 4E4PA 4OZ4B 4DWSC 1PYWB 5DRWB 2N7AA 5BO1L 1B2YA 3QQNA 4KK6C 5JLZA 2H8PB 3ZYIA 3IFPB 5DFTA 4N8VA 4ONFL 1NFKA 4KKCC 4GAGH 3AB0C 2AAAA 1G94A 1HXKA 1KENL 2V7HA 4P2QE 1QLFB 1H3VA 4A6YH 1A4JA 2CLZA 2IANA 3CFEA 3RHWK 3RVWD 4F9PA 1G5AA 5D2LE 3EW3B 3OKMA 4R4BB 4FQJL 2ESVE 2R2BA 4PIRF 3FHAA 3EZ8A 3HNVL 3QXWA 3RZCD 2AMGA 1ZBKA 1IGFL 3QH3B 2WWDA 1Z5LB 1YNKL 1N7ML 1CR9L 3ARVA 4P59H 4P7QA 3PHQB 4F9LC 3ULVC 5EZLB 3C60D 1B88A 5GRUL 1TZHA 2V5DA 5HYJB 2BY2A 2EJ1A 3D0VA 4W85A 1OGSA 3ABZA 3HI6H 3BSZL 5T1KB 3HUJF 4PJCA 3W6LA 3EJQA 4ZXLA 1JZ5A 3OGOE 4KKNA 2ID5A 5IJKC 4LPTA 2V2TB 3FONA 4JPVH 2G5BB 1WCGA 3EOBB 4IRSB 1JXJA 1D9KA 3IXAA 1RQ5A 5GS2D 4ZXBD 3ZDXF 1HQRA 1T7WA 1ZBCA 3SKJH 4HPOH 4XCFH 1KCRL 4WU5A 5DK0A 1KFAH 3HB3D 3ZT6A 4KKLC 4L9LA 1A3RL 3BVTA 5I74B 2VIRB 1TE1A 4JVWA 3TBYA 4XPGH 1KB9J 1US3A 1KELH 4R96A 3ZE1E 2X42A 2CDGA 4XMKH 2YN3A 4Z78B 3PWVB 2AEQH 6FABH 4EKXA 1WAAE 3HZVB 1JBJA 4JZJA 1BP3B 3ILQC 3HFML 4BZ2L 5I9QC 1S8DB 2IGTA 3PGCA 4HX1A 3SCWA 1YNTA 1IARB 4C83B 1VBRA 1VEMA 3QUXB 5EBLA 5T5FH 3TO2A 5FOBB 3GYCA 3MA7B 1FBIL 1TTFA 4LCUA 3AJ7A 3W27A 5I66B 1YEHH 3N1AA 2QLVB 1UA3A 4HQQL 4QGYA 1KLGB 3L5JA 1LEIB 2P49B 4WI5A 5C1MB 3SGKC 4PLNC 3WNNA 3D0VB 1RJYB 2G8ZA 1YN6A 3PWUA 2CIKB 3EGSA 2AXHA 2CDFB 5MHSE 3UTSE 2AK1H 5E6YA 2UZIH 1ZS8B 2V2WB 3BUIA 3LCYA 3G5ZB 1AD9A 1RU9H 2NY6C 2J77A 4YHPB 4K94C 3OAZH 1XFPA 2EH7L 3MRHA 3O3DB 5AYBA 2AEPH 2J8HA 3BD5A 5GSVB 1E0XA 3CO4A 5D2NC 3DHUA 4Z2GA 4P5TB 5DJ2B 4AZHA 3GKZA 5DK0B 4LF3A 1NGQL 4PRAA 2NZIA 3T08A 4FQLL 2MQ0A 2WSPA 3BT2H 2XZQL 4NQDB 1DQQB 3V4VL 3SO3C 3H53A 1YMME 4LLVA 2QMJA 4ZUVB 4XBEH 5ID1B 4X7CC 1KCUL 2XSAA 5L8LB 1CPUA 5IEKA 5K33A 2OJZH 4I48B 4A2LA 5MEQA 2XVPA 2C4FT 2CPCA 2EDFA 2V5RA 3CXDH 5DRZB 1JYWA 4LLUB 1ITXA 2F5AL 1ZHNB 2B2XH 1T2JA 4HK0A 4P5MA 5E56A 2K9UA 4UTAH 4ELMA 4V1DD 4QT5B 1K2DA 1Q38A 4ODBD 5CWSB 3RA7H 1B1YA 3KHQA 3VIIA 2D3VA 1UA6H 1M53A 4QNPF 2PBOA 1LDSA 5ANMA 2E7CA 4JVUA 1HXYA 1Z0MA 2XWDA 3FRUA 5F7WC 3I85A 3GNPA 2XWTB 3BPCB 1H8SA 3KE0A 4XCYA 5FYKU 2NY0D 5JDJA 5T3ZL 3FCTB 3JV0A 4C57C 3R8BB 5T1DH 1KLUA 5KSUA 1JI2A 3IDNB 3G6MA 2AV7A 3L3HA 4M9OA 1RUPL 1HZHL 3N85L 4ZXBC 4MQXC 5B8CC 3AMGA 4X4ME 1I1WA 1O7VA 5D71H 5A2IH 4TUJB 2J7DA 1HI6B 4HKZA 4JL1A 3MU7A 1UZ8B 3U46A 4JFXA 4YFDB 1ETZB 4AL8H 3MV7A 1JUFB 2RJMA 4P57A 4I18B 3IJSA 1B3YA 3PL6A 4JB9H 3MA9H 2A9MH 1M7DA 5CPTA 2NTFB 5C3LD 4FQIH 1VACA 2QL1A 1I1YA 1IEAB 1JGUH 2GJ6E 3AREA 3CIQA 4V1DE 1HOCA 4HZLB 1EZVY 1D2KA 1FIGH 1DCLA 3KJ6L 4WKHA 4L4VA 3WF4A 1KB5L 4I3SL 3NFSL 5MENE 1JPST 4XHJC 2CGRH 1QI0A 4IS6A 3PP3K 4MA8L 5SWSD 1QOKA 4MXWL 5GGRA 4O4YL 1BQHA 4BUGA 2X1IA 3ZTNH 3VXMB 2C3VB 4FQXA 3WBAA 5F1SA 3VGDA 4JANB 5FA3A 3CHCA 5D9SB 43CAB 5JW3L 3IK2A 4P99A 4ONGH 5HGBB 1VKXB 3U0PA 3KJ6H 3NCBB 5F1KC 1XHGA 4HA3A 4UU9B 5F9DC 4AZBA 5JIIA 4OUOA 3JV6B 4U4BA 1KIUA 4WV1A 3GO1L 2EYSB 2Q8BL 3PL6D 3A67L 3B6SB 3D85D 5AEAA 2VDLL 5BO1H 1VFAA 3RDTD 1SMDA 2AJ3B 2EH7H 3C5ZC 4GOSA 5A6MA 1R46A 2C1OA 5DF0A 1B4JL 3VD4A 3JWDL 3MRQA 1XYZA 1TR1A 4NKQB 5A6SA 1Z6JT 1FNSH 5CP3H 2E9BA 3VXSE 3U46B 2W92A 3EZJB 3S96A 3DVNB 2VXTH 4R0LA 3LIZH 1A64A 3IDIB 1AGDA 4BFIA 3TT3H 1K85A 4KY1H 2NLJA 2XXMB 1G7HA 4FP8H 4UI2A 3IETB 5K9JH 4LEOB 1PG7X 3W9DA 2XV6B 4ONHB 3KPSE 2GDVA 4G3YL 3C08L 4YHNA 2DLEA 4P7OA 1I8IA 5EB9A 1KB5B 2V3FA 3O3UN 4L8DA 4RMQA 3C8KB 3UPCA 5IBTL 3RVVC 4GAYB 4GW4A 4LSTL 4Y4HB 2NTSP 3HI1A 4G9FD 4PJGA 1HKIA 1E6OL 2Z31D 5DD5H 5J0BA 2G3MA 2IAND 2HFFB 1U36A 5K9JL 3Q48A 4AG4L 3P30L 2Q7NA 1QSFA 4LCCC 1WTGT 2XXCB 1CTOA 3IJYB 3SOBH 3GGWB 3JUYA 1Z32X 4PG9B 3U1SH 4N90E 4DK6A 4ETQA 3DX7B 2OWXA 5CJQH 5EIVA 5B39B 2R29H 5IW1B 4Z7QE 3KR3L 4GRMB 5ID0A 2GUOB 4LOUC 2ESCA 3QUZB 3HR5A 1GOHA 1MVFA 4XPFL 4ODTH 5CJOH 4U31A 4X6DB 5D1QA 5FIEA 5A16B 1QRNE 3HRPA 4R4FL 5HNNA 4DQOL 1ND0A 1E40A 4PBWD 1BBJA 1FRGL 4G9DB 4UDUA 1J8HE 3QZWG 4PGCA 5KS9E 4I3RL 4LVHB 4PGBA 2W07A 4DN4H 2BMKA 4ODXA 2GITA 1RHFA 4RRPA 3BN9C 2LVCA 3SCRA 3H9HA 1BFNA 2J78A 4YXKH 3MV01 4ZFZB 4PRBA 4AZCB 3KYMA 4NZRH 4HOWA 2JJTC 3E2HC 2O5ZH 4D0CA 4GQ9L 3JSSA 5DGQA 3VXMD 4IDLA 4FQPA 5SWZD 1W1VA 1IKFH 5FYLE 2E27L 2MQ3A 2H26B 2P7TB 4S3KA 3ZZ1A 2GK2A 1HQ4A 1M6OA 2C1PB 3HE7C 4MNQB 2Y9RT 4NQEE 4W70A 3C8HA 1XIWA 1XGTB 4APQA 1HH6A 2ED7A 3CPUA 4P2RB 2Z4QB 32C2A 4HIXH 5DHVA 2VXVH 1HVXA 3JWOC 5D1ZA 4AD5A 1D5BB 2E40A 4Y4KB 3M07A 3IDUA 5DO2D 2XN9D 3WIJA 1E15A 1SEBA 4BELD 4MJ5B 3THMH 2LTQC 4G6ML 3GIVA 2DQTH 3TJEL 3IDYB 4ZE4A 1MCFA 1SZNA 3BEVB 5H8DA 4AZ7A 1RJZB 2WIIB 3AIRA 3CLWA 3U9PH 5E0FA 1MJJB 4KI1A 3IFLL 3C6SB 1VCAA 4MS8C 5IMLB 1A7OH 4LKCA 3THCA 5FYKE 3DGGB 5J06A 4Q2ZA 4I77L 1M04A 4ODVH 3EOYG 3M1BA 4IIQC 5F44A 4PBXA 3ALGA 4OZHE 5E5MA 1WDPA 3ARBA 3DRTB 1T1YB 3WMSA 4X8XA 2IQ9L 1RK0A 3L3GB 3CLEL 2Y36L 5IESL 4OQTH 1J88A 4PJCB 4XB3A 5DK2B 3BOVA 4M43L 4ACYA 2UYLA 2V2TA 1JWUA 3GSXB 2NR6D 3F7VB 2X4SB 1N5YH 2Q76B 4BFEA 3H9SD 1NJ9B 1F4WH 3OKMB 2APXA 4WI2A 4D8PA 4EI5C 1DUZB 1LHZA 1T2QH 4XP5L 1TQCC 3L3KB 3SE8H 1CWYA 3V5HB 2HG5A 3BDBA 3CFBA 2WSKA 1F11A 3V4PL 1E70M 1N5AB 1IGML 3U0WL 4R3SB 3O2DL 1NOUA 5ETUA 3VXTB 1HILB 2DQHL 5GISH 4AMWA 1MRCL 1Q9OB 2FL5A 1A3LH 2MSPA 1QR1A 4S0TD 1GZPA 1R3LB 4JKMA 3PWVA 4J3OC 1GHRA 4J3TA 3GUTB 3L4YA 3FQWA 5C6TH 1KIQB 4NGHL 1BHGA 2WBWB 2ZG1A 4G5ZH 3FONB 4W7UA 2V5YA 1P9MA 3IDXH 5EOCJ 4EN3C 4HS6A 1YEIL 1YPZB 1BQCA 2GQHA 3GRWH 2DBLH 1KTBA 4X98B 1JF1A 2CUHA 4D9RE 3GSRA 1EFXA 3WJJC 3BW9A 4S1DC 4P46A 2J7LA 2ZOKA 5KS9F 5L7XH 3WQ5A 2ZCHL 1WEJL 2MHAB 3LZFH 5JOPD 1W3HA 1U9KA 4L8CA 4I2XA 4D9QE 3DXAA 2JB6A 4MGXA 2JJSA 3TNMA 2FX7L 5LAXB 3T4AB 1WZMA 2R2EA 1NJ9A 3D39A 3WFZA 2APVA 1TQTA 1AI1L 3AMLA 4M1CD 3WS3A 3ZSSA 1PZ5A 4W6WB 3CFKB 4UUJA 1VFBB 3KPMB 4DGYH 4LPVA 4XMLH 4M7KL 3WKML 4LKXA 3S36L 4JAMB 1JGIA 2IXVA 1MAML 5DSCA 3W2DH 3I50H 2IBZY 3MBEA 1XIWC 2X9WA 3QRGL 1IM9D 2XN9B 2X1QA 4HXAH 2D7OA 5DMGC 2XYCA 3TV8A 1KLGA 1A21A 2UY3A 3L3IA 1WCBB 4LIQL 3DV6B 3GMOA 4YHKH 3VXQA 4B9YA 3O6FA 3QJFA 1MSPA 1RJLB 1SYTA 5CGMA 2VLKE 1QNZH 4K7FB 3CZEA 3MSDA 5EFFA 4BQ8A 1D5IL 3MX0A 3DXAE 4WWKB 4AENA 3CUIA 3VIGA 4U05A 5H94B 4Y16C 5DUPL 5I6SA 5H35B 4CRPA 1A47A 3LKPB 3GMLA 4MDIB 3IKCA 4QRPA 2H3NB 5A3IC 1QI5A 2AJZA 4JHBA 5CFHA 4WI6A 3S35H 5L8JB 4O9HH 1K4CB 2BSTA 2NY2B 3C6LB 1U93A 1CXIA 4G43A 4HH9A 3VW3H 4M61B 2ZUNA 1JHKH 4OZIF 4XCYB 2GSJA 1LO3H 1DQJA 4HV8B 4IIQA 1S9YB 3FTGB 1CU4L 2AJUL 4ZS6D 4QHMB 3UCRA 4M5YH 5J56B 1DFBL 3MLSL 4D0DB 3H9SB 4S1RL 1MJ8L 1DHKA 5KZ6A 2PUQT 2ATKA 1MELA 3AHTA 1VBUA 1UB6A 1YEDB 1J12A 3MJ9H 2P45B 1KCVH 1CN4A 4OGYH 3WQ4A 1OPGH 1UCTA 1ZJBA 1I3RA 4EI5A 3T2OA 2Q86A 3QQ3B 1EDGA 4HZ6A 3N18A 3AREB 1XT5A 4U1SA 2AJUH 3EMQA 5E2TL 1XRVA 5A2JH 2H1PL 1J0IA 1MY5A 5FUOL 4W86A 1NWUA 2WV3A 4XWOD 1DQLH 5F3HB 4UOJA 2UUDK 4PMVA 4RE3A 1OGAD 2FWOA 5FGBA 2YC1B 5CBEB 3MMDA 3DWTA 5AY7A 2GTWA 4WW2A 2JCCA 5T3XD 4Y2OA 1CL7I 2GJ6B 1UZ8A 4OIAA 5HY9B 4NT6B 5GSRB 5GRYA 4LSSH 3PNWA 1I3UA 1U2HA 3OGCA 4AD3A 4ISVA 4HCRL 4YBQD 1R7OA 3GSQA 3TTSA 2OXGA 3CVIH 4J6RL 3EYQC 1V6YA 1S9YA 1N8ZA 3L3OA 3C60B 3FT3A 3K8KA 3I2CL 5FM5O 1FL3A 4DZBB 3GI8H 3GSNL 4RGNC 3SE4A 1B30A 1KT2B 1HKLH 5EU6D 4GBXD 2C1OB 1C1EH 4G6MH 1NQBA 4DGYL 3TYGL 4PRPB 3PQYA 5FYJU 1BFTA 4FQXB 4QHUB 5D5MF 5DHYB 3SDDA 1PEZA 1FO0B 2ZE0A 4KZDH 3A4XA 4U6HA 4RA0C 3MI6A 1VESA 1BMGA 3BAKA 1TFVA 1QRKA 4CVWA 2RCSH 4UAOB 1HCFX 1ISWA 1P7QA 1D7FA 2OTPA 4P2OD 2EYRB 5JIWA 4U3HA 4DUWA 2IG2H 1B0IA 3MQIA 2EE2A 1F4AA 1S5IH 3FO9A 2DSZA 1MW2A 4D6HA 3D1MC 3MTRA 3NAAH 4BSJA 4B5EA 3CUPA 2NY6D 4OAWA 5C0EB 1F13A 4G80A 4XNXH 1FNAA 1DWHM 3B83A 1ZLUH 2JCCF 2Q7YA 4NNYB 1IGFH 3L2MA 3QDMD 1UWRA 1P7QD 5D2LA 2X6MA 1F4XL 3HNVH 2AJSL 3UYRH 2HKFL 2A1WH 3W26A 1NCCH 1NGXA 4WO4D 4GAFB 1IM3A 5IT2H 4QAWA 3QDHA 3QYCA 3WD4A 5ABFA 3LSOA 4Y4FD 5FKAA 3VFTB 1I7RB 5GHWL 4PTMA 4NO2B 1HNYA 2OW7A 3WNPA 2EEBA 2IAMB 4WHYG 1YQVL 3ROOA 3BXNA 2NXZB 2QEJA 4QRPE 2BY3A 3KPPA 2HJFB 1KB5A 3V8CA 3AYRA 3HZMB 1YJDC 3K0WA 5C0BA 3MMEA 3QIBB 3P9MA 3HI6L 3RUGE 3T2PA 5JTWA 4ZFGH 2XY2A 1RUAH 2F54A 5HHMD 3VH8A 1T80A 4P5KA 3P4MB 3EDDA 3G9AB 2R4RL 2XKUA 4XPGL 1LVEA 2DM7A 2NPLX 3B9VA 3NFPA 1XCTB 4BH7B 1E4XH 3SURA 4O51B 5C9KA 2QMKA 5HHME 2WHJA 4X9BA 4MA1B 1QPPA 5I8OH 1W72B 4C56A 1ZV5A 4Y5XB 4LCCB 5FV2A 3BKML 1WIPA 4HGMA 2DT1A 1FYTA 3NIFE 3UDWA 4DFIA 1FSKC 2OMBA 5KSAC 1T0NA 3LN9A 4JFDE 5SWZA 3MCG1 2PI6A 4OLYL 4AL8L 2OL3A 2Y5EA 1DWJM 1Z0NA 2VLJE 4XAWL 2FIKB 5FKPB 1NCWH 4J1UA 3G6AB 1G7MA 2TAAA 1KIPA 3F7QA 4X6CA 5A3HA 2EDKA 4X6EA 5EORL 5I8OL 4LX4A 1BF8A 3MODH 2HLFC 1KPVB 5KAQF 3MO4A 1P4BH 1AO7E 1NAKL 1TVHA 2X70B 3QAZC 1FFPB 4M7KH 1LEGB 1UKTA 1MAMH 1QR4A 5AZ2L 4WUUB 3W2DL 4KXZH 3PWLA 1N2RA 2GAZB 5IV2B 4ORGA 4ZFZA 4AZCA 3Q3GB 3LOWA 1ES0B 3MRIB 4UB0H 5IW6B 1PG7H 5IBUG 2NT1A 2FH6A 1OGTA 1MJJA 4NQCE 2AK1L 4MPKA 3KGRA 4KHXL 3CUHA 5IKCB 1BEYH 4S1DD 5BW7C 3O2WH 3QO1A 1LL4A 4PRIB 2H32B 5FCUL 1YC7A 3PE9A 1KSRA 4RE4A 1W72A 1K4DA 2VJXA 2WWCA 3M1BB 5GZOC 1JNHA 4X6BB 2PXYA 3NA9L 2EICA 1X3DA 1D5BA 1CI5A 4N0YH 2PWFA 2VABA 3CCHA 5T1MA 2XZQH 4Y4KC 5HHMB 1RK0B 2C3XA 2PTUA 1OARL 4KJWD 5FO7A 4NHCL 1A6UH 2CERA 5JDSB 3L3JA 1V6UA 2MWCA 3KPQA 4WNQA 1C5BL 2N4IA 5D72H 1AKJA 1IGIL 2BC4B 5E6IC 4ZG1A 4JPVL 5D1QC 5E9AA 3RUGF 2W91A 5FO8B 4YDLB 4NXSA 3C6SA 3QFJE 5HI5C 1DQDL 1QFWL 3W25A 3VFPA 1ZMYA 4QHKI 5BXTA 1HJSA 1S9KC 1MCJA 3RVVD 2VDML 5ABHA 4LCWD 2P5EE 3BEWB 3T3PF 3VRIB 4JRXA 4X7SH 1JGEA 4F7TA 5EBAA 2I5YH 4WGWB 3WH6A 2F1BA 4AZ5A 1CT8B 3I6LE 1T1XA 2A9ML 1EAPB 4FTVB 4PTUA 4LAJH 3QXAA 2F7RA 1UD2A 2EKSA 2ICCA 4HGKC 4BZ2H 2XT1B 3AXHA 3BLBA 3CPLB 3KPRA 4CDGC 2XGIA 2JF6A 3GM8A 3ECBA 1UA7A 4UV7H 3WFHA 4X98A 1WFUA 5I76A 5DJDA 3R8QA 3ZTNL 2OZ4L 4XAWH 5FYJH 2DT0A 5MEOB 1BBDH 3MUHL 1W1YA 5TGBA 2YK1H 5C7XH 4ZNEE 1ZT7B 2KZWA 3G6LA 3CZJA 1FNEB 4UV4L 5KSAA 2V7HB 1X5HA 4P4KD 3RL2B 4HF5L 1UWSA 1INDL 1LD9B 4U7MA 1NCAL 4MDJB 4PMOA 5DLMH 4UZSA 1LEKA 2BHUA 1S78C 2VRJA 4KRMB 1ZGLA 4WEMB 3VSUA 4MCYB 4QXTA 5L2JB 3O6FD 5IMOA 4ONGL 1MHEB 4LEXH 1D6VL 3SDCC 3NZ8B 3QBTB 4GRLC 4ZAKD 3TNNB 4L4VE 5C09B 5HSFA 3NIDE 3GMPA 3F5KA 1B4JH 3IFOB 3PHOA 4FNTA 4U2ZA 3TYFB 4OI8A 2WNWA 2EKJA 1TZHB 4D6JA 4H26A 1XF4A 3O45A 3LIZL 3ALWA 1MAJA 5IQ9A 3R0MA 4YZFF 1N7MH 4LL9A 4ZTOL 4X7DC 1E73M 2GHWB 2EKSB 3F12B 1IC5H 2VCBA 1T1WB 2CKBA 5JORB 2VE6A 4KK9C 3VXPB 4J8RA 1BQSA 3ARDA 1SJHB 3AROA 3CDFA 2AJXL 2MPAH 2XNAB 3V5DB 1FVEB 3V4UL 2DSVA 2HN7A 5D4QA 5ITBL 3FN3A 1BJ1J 2R0KH 4AISA 3PTMA 5TE4H 4KK5C 4WFED 4YX2H 1IEHA 3TBYB 3L3IB 4PRHD 2JF1A 5C0AD 5ELIA 1W9UA 3MO1B 2B5IB 4PGJA 3C08H 5INCB 3BCDA 3E1F1 3OKEA 4AZGA 4QXUL 5CKAA 1INQA 1OWWA 3HLAB 5FYKD 2E7LA 1W9XA 2OTUA 3QEQE 5BRZE 5EBWB 1A1OA 5KG9A 3DO7A 3LRGA 1X5LA 3LKPA 1JGUL 4NI3A 2VLKB 4GI6A 1IAMA 4RNRB 1SQ2N 3ZJ7A 1YECH 4AEEA 4R2GB 3F58H 2XG5A 4HKXA 4ZQKB 4XI5C 5GS0C 1XIWD 1YEGH 1UWIA 2XRAH 4PJXE 1ACYH 3ARGA 5A2FA 1D6EB 2CKBH 4QXGL 5KVFH 1WNOA 1N4XH 4BH8B 2DYPD 3QI9C 5GNXA 25C8H 4LPCA 4XP9L 3BSGA 4G6AD 3IGAB 3MUAA 3S4SA 1MCIA 1WV7T 3LKNB 4WU5B 1L0PA 1TCRB 2DQJH 4P9HL 1X5JA 4MZ3A 3ZMRA 1TQVA 3CFJB 5IQ7L 3QCTL 1MCDA 4XNQA 5GSVA 2YMXL 2YXFA 5A8QA 1NCDH 3HA0A 2K3TA 1A14H 5JNYA 3LB6D 3MFFA 5EUOB 3WL0A 5FYJL 4K9EC 1K9DA 2XIIA 1QFWM 3OR7B 4ISVB 5SWZE 5I6XB 4RDQG 2FYVA 5IHSA 5CJ8A 4B3KA 1KJMB 4YHEA 2XY1A 4P23A 3ZHLA 3AUVA 5KSBE 4P48A 6A3HA 2BRQA 3N06B 4KAQH 1NLDH 2ZX6A 5MEQB 2EIZB 5F8RC 3SY0A 4CJ0A 2O5XH 3IRZA 3QUXD 1WC7A 1YUHA 4PRPA 3U83A 2JJUA 4YBLC 2P5ED 2P5WE 4NC2B 3VIJA 1UJ3B 3HG1A 4FLOA 4ZTPH 4ZO7A 4ZENA 3HRZA 4TUOB 4UOZA 2Q8AL 4P5TC 2B2XL 3GSWA 5F88B 3O2WL 4NJ9L 2CBIA 1BX2B 4D9LH 3LMYA 1HTYA 1KEGL 4IJ3C 4N90D 5FHAL 5KJRL 4U0RB 4UR9A 4AT6A 3QCUH 2WXDM 1BVZA 3OF6A 5GGRY 1RVFL 4QRUA 1FL3B 5TF1L 4LHUA 1QNQA 2WBKA 5IHLB 4ZXOA 2WUBH 4H1LH 2JE8A 1CQKA 4CVUA 4XNQB 4GINA 3BGFC 3H6JA 2GJXB 2NQCA 5E08H 4U1MA 1BIHA 4I18A 4V2BA 1MW0A 3FXYA 1CZ8H 1C5BH 5L8KB 4HMCA 3H9ZA 1V03A 1R0AH 3VOCA 3M17B 1L7TH 2XSBA 5CZVL 4W88A 4M00A 1I1YB 1CDCA