1CXIA

Wild-type cgtase from bacillus circulans strain 251 at 120 k and ph 7.55
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Glycosyltransferase
molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
publication title Crystallographic studies of the interaction of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 with natural substrates and products.
pubmed doi rcsb
total genus 231
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1995-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxiA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxiA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cxiA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cxiA01
3PHQB 1BFOA 1T5WB 3EJPA 5FOOA 1Z0MA 1S7WA 4PJEE 4GG8A 2WIIA 2FD6H 1ESWA 2V2WB 3QXAB 5CFHA 3GMQA 3MV9B 2IXVA 1UACL 1C3FA 1M7XA 4YHPB 4KUZH 2VZ1A 1QO3A 1QHPA 4IDLA 5KSAA 4Y16C 4QFUA 2VH5L 2OXGA 2BSSA 1Z3GL 4Z7WB 4JAMB 1HP4A 5A2FA 5HI4D 3ZE0E 1FFQA 4MJ4A 3WFEH 3NPSC 4DFIA 5HVFB 2AI0H 2WCGA 3H7LA 3D51A 1KPVA 4L4TA 5IJVA 1ERNA 1EO8L 1OWRM 2JK5B 4HCRL 2EDWA 4F7MB 1FORL 3ROOB 3I02B 2XTKA 1AKJA 2H2PC 4QHNB 5DUML 1NLBL 4EUPH 3OXSB 4BQ6A 1MHEB 1MVYA 1GHFH 1XMWA 1Y0LB 3VSTA 2NW2B 4WKHA 4AD4A 4YHKL 1BD2A 2AJZA 5IQ9B 5DDHB 4AJ0A 2ZOLB 2J25A 4UDTA 3C08H 5IW1A 1OGAD 2G3NA 4FNUA 3ZKMC 2NY4B 3UG3A 2WC4A 3CZ8A 4PRIE 3BO8A 5CWSB 2C4XA 3WNPA 1UVQA 2H8PA 1KPUA 4J7RA 3HI1B 5IBLC 2XIBA 3QNYA 4WCYH 1YQ2A 4XPFL 2YS4A 1OM0A 1HI6A 1MHCB 4F7CB 2XQBL 5J1SC 2PWGA 3GBDA 2AVGA 3WFBL 1NQ6A 3LZFH 2I25N 3QO1B 2DF3A 3PQYD 4FOMA 4P2RA 2VISB 1XH3B 1QNPA 3CHCA 1E1FA 3IJ7A 2A83A 1T7WA 4MS8C 4QO1A 5GS0D 3QPXH 4FP8H 3QIUD 2MNUA 4HMDA 3G04B 2PXYD 4X99A 4DN4L 5GJTH 1N0LA 4E0RA 3WLBB 3S3JA 1UA6H 2KL6A 3CFIC 3WDPP 3T4YA 3B2VL 1ZV5A 5A6MA 1N2RA 4JFZH 1T4KA 1FP9A 4LSTL 2R69L 2OP4H 3S5LA 8A3HA 5BS0A 3DRTB 5MP6L 3HB3C 3G08A 3C6LC 1N64H 4C4KT 1XCTA 3HMXH 1UUQA 1PEWA 6FABH 4DWSC 4N9GB 3S4SG 5TDOA 2VQ1B 3GSUA 4HQQH 3LD8B 3FHAA 3OSKA 4IS6B 4I8DA 4LARH 4PREB 4D9QE 5I1CH 3U4EA 3U2SA 3QCVL 3SIMA 1EZVY 2EZ0C 4Y19A 1RZGB 1D7FA 2DRUA 3RWGA 2Q8BH 4ELMB 5EIIA 4QHMA 1D5BA 3ARGC 1J86A 5DGQA 5C0CA 4Z8FL 3CFBB 1EERB 4M6OL 4RIRB 1AH1A 3FB8B 5FYKD 3RQ3A 4W89A 4QRUA 3H3KA 4C83B 2QKIA 2XV6B 3V5HB 3DX8B 5I1EH 2VITA 3HFML 2IMMA 2QV4A 3BEWA 1A7PH 4M7JH 3T77A 1JYXA 1I85C 1JK8A 3REWB 3G5XB 4JHAL 2LU7A 4WTWA 1ZBWA 3SDAC 1UADC 2GSJA 1SJHA 1MFBH 1G9NH 5D4YA 2BERA 3MV7D 3LEVL 3WUWB 4JPKL 5AZEL 2YLAA 3S4SA 2ZCHL 2DL2A 3ZR6A 1J0YA 4C59B 1FNSL 1YMHB 4RL3A 3DURB 2VE6B 4JVPA 1OAYL 3WD5H 4LDOB 3U7VA 4CVWA 1WLHA 3QPQC 5JPNB 4XP6L 5DJYB 2Z91A 1KENH 1M05A 3GXNA 5JHDA 5M3WA 2Q76A 1XGQA 5JHLL 2VURA 3CUHA 5DEGA 2XA3A 5IJKC 4JFED 2XWBA 3KPRB 1P9MC 4M1RA 3WIHA 4M6NH 4U5KA 4X6EB 1CEOA 1J1PL 3QHFL 2EDHA 2VCCA 2CLRB 1W32A 2OI9B 3SGEI 3MBXL 1W9DM 4GG6F 1MW0A 2W63A 5D8ZA 1W72H 2PYEA 3QWOB 3VXRA 4CU6A 4EIGB 4X7EC 4LPUA 5ECJE 2J6EH 3UJTL 4G7VH 3T0EB 1KCRL 2YKLH 1MAKA 3CZLA 2P8MA 4M62L 4ETYA 5T3XE 3RGHA 4HWBH 1RUPL 3MV8A 1BVLA 4HIXH 3JV0A 1WV7T 4MNQD 1HWGB 1OVZA 1J11A 1JHLL 2EO9A 1A7QL 4Y5YA 5L9DH 4PJFE 4HS6B 1XGPA 5HDLA 4BM7A 1IGJA 1PQZB 3U83A 1OGTB 3LQAC 1QHOA 5JW4Q 2VDPH 4OCNC 1X1NA 5AYIA 4ZAKB 1EUTA 4XBEH 1NBYA 1HHIB 3SGKC 4OIIH 5BYWA 2EDLA 2JCCF 4MLIA 4I5BB 1BAFH 3PXJA 4HEPG 4ZUSB 2GJPA 5IBTH 4JFXA 3VWKC 1TITA 1MEXL 1SYSA 4MJ5B 3RVUD 4G9DA 1CQYA 4GSDL 5C6TL 1BSIA 5A2CA 2Z92A 3CFKB 4X4YB 4QOKB 4WO4A 1NC2D 2IADA 4P5MB 4WEUD 3KPPA 3ISWA 5EZJA 1HHGB 3DVIA 3V5DB 4G8IA 4N0YH 4JQVA 2X70B 2H32B 3DXAD 3G5YA 5SV4A 1EUUA 4AD0A 1JNLL 1R5VB 2BDNL 1C7TA 4NHUA 2W59A 3TBTB 1WDPA 2LFGA 3O9NA 5EUOE 1KLUB 3FZUC 1IM3B 4RX4A 2DGAA 3GNRA 4UUJA 4HV8B 1NFDA 2O92A 2VLLB 1FL6B 1OL0A 2GJ6A 3D39A 5B21A 1GZQB 3PHSA 3PE9A 2Q1EA 3F5WB 2HVKA 1FVEB 3S96A 4G7YL 2IH1A 4TN9A 3O8XB 3MJ6A 2VOTA 3WSQL 5E2TH 5EU6E 4G9FE 4BQ2A 3QUZC 5JXAH 1MAJA 3HC0B 4UTAH 3PZNA 5DFWH 2DB8A 1IT0A 5IESH 1TNMA 4XRCA 3T2OA 4UT7L 3ULVC 2G41A 1S9KC 5CD3A 2WAGA 4N8CL 4DVRH 2FCBA 4PJBF 1VFBB 1H0DA 5DRZA 3WO3B 3O41A 3TTSA 5D1ZD 1X5XA 5TF1H 3CFCL 3SCTA 1ND0B 3KYAA 4KJWC 4XB8A 1KTDB 3GO1H 1SJEB 4NN6B 1SJXA 1U36A 4GO9A 3ILPA 2VLRD 4LGXA 3UTTA 1HCFX 4P8UA 3IVKB 2GUOA 1KBGL 4P4RA 1U8KB 5FUOL 4N1HB 2I5YH 3VGDA 3DLQR 1Q9OA 1BOGA 2XACC 3MXWL 3IJSA 4ZXBA 4LNVA 3QEQE 1E6JH 2DWDB 1GAFL 2X4QB 3MA7A 2LQRA 2FGWH 3KPMB 4PJCF 3QNXA 3MRPB 4JCLA 3UC0H 1DLHA 3RIKA 2XG5A 1A02N 2WQ8A 2BOBB 2LTQB 3GJEB 5C09A 5HGBA 3SCVA 2X6MA 2FX8L 4YC2C 2IPUG 1J0HA 2WW5A 2DQIH 4QEGA 1QLRB 3GIZH 3WL0A 1NP2A 3IDIB 1MVUA 4F15B 4UQ2A 4M00A 4UT9L 3B9KA 1SBBA 3FOLB 5ICXA 3FFDA 5EPMB 2B1HH 4APQC 2EPLX 3LH2H 1KT2A 5FKAA 1GOMA 3DMMA 1UQZA 4XXDA 1TG7A 3ARBD 1FGNL 2HT4D 4H5SB 1PBYA 1TNNA 1QZ1A 4PJAA 3PTMA 4MAUL 5IV2B 4Y5VB 4MD4A 5DQDH 3AXHA 3GMPB 1F6FB 3HE7B 3STLB 5DLMH 3KDMB 4BH7A 3CVIL 5CSYA 3GSXA 4NC2B 1YMMA 4EBQL 3BVWA 4NT6B 4B3LA 5CSGA 2EBNA 2BNQA 1I7ZA 1ZL1A 4LVNB 1UZ8A 1A3LL 4KKLD 1J8KA 4DZBB 2VZ3A 4DK6A 4HT1L 3RDTA 1CLCA 3N9GL 2FX7H 1MJJB 3RUGA 4QWWD 1DBBL 4UQ3B 5EZOH 1JGEB 1UZ6F 5C71A 4C4KO 2ICCA 4CDGC 2VUOA 4PRAA 3PIQB 1SY6A 2JELL 1D6VL 4BSWB 5FCSH 3BQUD 3CXHK 4GAGL 3O4LA 2ESVD 3OB0H 4JRYB 1QYGL 2XTJE 3QH3A 5EC1A 1JGUL 1LDSA 2XZCH 4JKMA 2Z4QA 5KSBF 4MAYB 3BAIA 4X8JB 2VWEC 4WEMB 5DQJB 1ZGLM 3EJZD 5ACZB 2WMKA 4WW2A 3MACL 1KB5A 4L8DA 3K2UL 5CCKL 1CGXA 3NMEA 4PRPB 2FO4A 4WWKC 3FCTA 4W4OC 4NN5B 3ZE1F 4JO2L 1JV5B 4QTHA 1RFDH 1X5HA 1YEKH 1SMOA 1F4YL 1DP0A 5GGTH 3FT2A 3WHXA 4U1NA 3DVNA 1X5LA 2Z9TA 4L1HA 4PG2C 1GC1L 4KPHL 4K3JH 3GNMH 4XZWA 2WZHA 1P2CA 5TQ0H 4HUXB 2VXUL 5DRWA 3P9WB 3TN0B 5DD0L 4HGWA 2NMSA 1H0IA 3QOMA 4ODHL 1NDMA 1D3CA 4GXUN 1GOOA 3MNVB 1TJHH 4EAMA 1MCKA 3WL9B 5FYJH 5I17B 3DUUB 3CVHL 1CICB 5IR1A 5FHAL 1GOWA 2EXYC 4JG0L 4BELD 4W84A 1FL5B 3EYFB 1JNHB 4W68A 3BT2L 3UYRL 2ZJSL 3FJTA 3CFDB 2LU3A 3LB6C 3P4OB 4MXVE 1J05B 3PWNB 2RB8A 3IDNA 3BEVA 5E1QA 1Q9WA 3AB0C 4POYA 1A2YA 3OZOA 1XGTA 1QRNA 3QRGL 4N0FB 2FRGP 4MA7L 5HHMB 4QT5A 3MUY1 2QR0A 3RWIA 3KJ4B 4EN3D 3V0WL 3QIBC 1R24A 1WAWA 2HISA 2EC8A 3LPGA 1F58H 4Z5RA 3HRZA 1W1YA 1WITA 4P2QA 1E6NA 4YFLI 4JR9H 3LDBC 1F3JA 4F2MB 3OKYA 4YXHH 4Y2DB 4I3SL 2NPLX 3X13A 1ACYH 1Q0XH 3A4XA 5ACMA 1T5XA 2XKNB 2FIKB 2VL5A 1HH9A 1UCBH 3L2MA 3CFJB 4QHKI 4R2GC 4ELKA 1FNLA 3C6SA 1C7SA 2ITCA 3WQ8A 4DEPC 3AFLA 1IGCH 2ICWB 3HZKA 1HHKA 1FOBA 4B9ZA 1F2XK 3MRIB 1JDDA 1RZIB 1EOKA 2CNCA 4AG4H 2OTUB 5CLTA 3DTXB 2WLYA 5DZLA 4TVPL 4XXCA 1KC5L 4R3SB 2ZPKH 4M7KL 3JV6B 2FEEL 4AZ6A 1HKIA 3SJVA 4FQXA 3GH4A 5MERB 5CQ1A 4NZDA 4NF7A 4YNYB 4XMKL 1CLZH 3O3DB 5I76A 1KCSL 4WW1B 1TJGL 1LO4H 2R4SH 3B3IA 3PWPD 4M9PA 4FABH 3QQ9D 1XGUA 2DIAA 2QADB 2OLDA 3VRJA 4PJ5E 2W92A 4P3CH 1EFXD 3A22A 5B8CA 4JREB 1QNOA 5I1DA 2DT2A 3OGCA 3GKZA 1RI8A 1GSMA 2R2HB 3BPCA 3DYPA 1WNOA 4AIUA 1U33A 3MUGA 3JV5A 4HUUB 4YHOH 4E4PA 2CDEA 3NIDF 3OJMB 4KK5C 4MCYA 3N1AA 3QHMA 4LU5L 2BVPA 5IHSA 1W0VA 3LN4A 4G3YH 1HINH 4OAWB 5HHOE 3TZVB 2V5CA 1A7RL 2BY3A 1MY7A 2P43B 3JV4A 3H9ZA 3X11B 1CVRA 3QO0A 3B6SB 1FAIH 1RK0B 2E40A 4YH6A 1V3HA 1DUZA 1JPSH 2WK2A 4V27A 3D85B 4YDKL 5HVGB 3BE1L 2VLKB 4MSWA 3SUVA 3BXNA 2APVA 4OM1H 1V6XA 4ZFZB 4ZTOH 2VDQL 2DOCA 5SWQA 1V6YA 1MWOA 1BBDH 4EZMA 2YA2A 5DYOB 1KCVL 1C5DB 2OL3B 4KXZI 4LCWA 4AMKL 4NRZA 3I2CL 1ZB5A 3CZGA 4QLJA 2P44B 1YEGL 1FH5L 2ZXDA 2HKHH 1T7ZA 1UXSA 5KTEH 2NT1A 1CDJA 4HJ0C 1Q9KA 5I66B 1K5NB 1BFSA 1EJOL 2P46B 2J2ZA 3MFFB 4YDVA 1LO5B 5TJWK 3S35H 1B0GA 3QG7L 5IFJA 1WK0A 4NO2A 1A6AB 2WUBH 5DF0A 3QQ4A 2EYRA 1G7HA 3ZTNH 4BSJA 2Z8WC 4HUVB 4O2FB 5B3JF 4WFHD 4ZMAT 4CD8A 3WNOA 5DJ8A 5C8BB 2QF8A 4LAQL 1UWQA 5CEZD 3PGFL 1X44A 3WBDA 1PZ5B 3QEGL 2NYYD 3KYOA 3M45A 4NZCA 4M1CD 3CHFA 4MA1B 3LKOB 4M1GL 2IANB 4OF3A 3TH2T 4CJ0A 3P4NA 3SOBH 2WANA 1F3RB 3VWJC 4PJ8C 2XWJB 1HE7A 1VPOH 1U8JB 2X2IA 4BK4A 3UTZB 4GO8A 4KDVA 3P11L 4RISL 4KUCF 1IAIL 4WHCA 3BIBX 2NT0A 1MCEA 3H9SD 4WEBH 3TH4T 1HSBA 4OI8A 3MREA 1ISWA 4OLVL 4UTBH 1UA3A 2WP3T 3H9HA 3MTRA 1UWIA 1MUJB 3MJGX 1EV2E 3HKFA 3ULVH 4JZNB 4XC3L 2XPGA 3RJXA 5TGBB 1KFAL 3L3GA 3ZIZA 5F7UA 3V6FA 1NMAH 4WHYH 4ZS7H 3RVTD 1M04A 1QFUH 4KK9C 1KEMH 3NABL 5E99L 2FR4B 3WH8A 2WV3A 5DUBB 2DTML 5KSAC 1DFBL 1S7XB 2AEWA 3MRLA 3RAJH 1E4XH 1YEDB 4NCC2 4G6ML 2PW1A 3QIUB 2PO6C 2ED8A 1L9MA 3PL6D 5CAYB 3BH4A 4JFSA 1BBJB 2PXYB 4S1DD 3FXYA 1R5IB 4PJDF 1GGIH 5DT1L 4XNXH 3L6FA 1BMGA 3O3EA 3FQNB 1TVNA 3P9LA 3L3JB 4U0QB 3EDDA 3HZYA 3L4UA 2DBJA 5FUCC 4OTXH 1BX2B 5GISH 4IJ3B 3L5XL 3EMQA 2PB1A 1IC7L 2XY1A 2AXFB 1YEJL 2CRYA 4GG6E 5F7LB 2R29H 2CGRH 1T0MA 2A6KA 2JJVA 4LSSH 1XSKA 3A4AA 3SURA 4PJFA 3TBYB 4NBZB 3HNVH 5CSZA 1U95A 5J11B 3AIVA 5T3ZH 5CXPA 3F6IA 2CLZA 1JJUA 3EOAB 5C0GB 4OKVA 1DE4B 1BF2A 1CE6B 5BW7C 2R0ZL 4WHYG 4QXGL 1RZ8B 3NZHH 1I9JH 1E4WL 1PLGL 4YE4L 5HBFA 4MXWL 3RZCD 4NIKB 3VRIA 5CMAA 1K9TA 3GKWL 5E09A 4PLKC 4DW2H 1RU9H 3DVGA 3HPLB 4X7TB 3MOQA 1CK0L 5JDSA 3TF7C 2NLJA 2JCCE 4E5XA 5LGJB 1SYVA 3KAAA 3U46A 1QSFB 2Y6SD 3D3VB 4UFHA 4PRNB 4K55A 1JIBA 2CKBH 3CZFB 3ALGA 4J3SA 3OPZH 2VUYA 1N5AB 5HHQA 3DNKA 4HPGA 1DANU 3QISA 3NCCB 1MFCH 1JPTH 1INEH 4LBEB 4XV0A 3BRGC 3ZO0A 5BCAA 2V7NB 4FQLL 1DWGM 3L3OB 5C2BL 3BKMH 1U42A 5CP7B 5EUKB 4HK0A 1CLYL 1HHHA 3IFLL 2YDRA 2MSPA 1AXSA 1MQPA 5GZOD 2EABA 1UD6A 3BP7B 5GGRY 1HTYA 5C2UB 4Y4KC 3L4XA 1JWMA 4JO3L 5I8CB 3UZEA 2HFTA 5FV1L 4U1KA 4M7LL 1PYWB 4NM4H 1XF4A 1WFNA 4B41A 1KEGL 3EW3B 5CKAA 3IRPX 1HWHB 4JFEB 5JDJA 4RGNE 3VG0H 1TTUA 2SEBA 2GTZA 2X2HA 3CZKA 1CT8B 3TJHC 4PJBE 1UYWH 2AQ1A 2NW0A 3BSZL 4PJXF 4Z7NF 4RGMB 5GGQH 5GGUA 5FA4A 2Z35A 3WY3A 2J7LA 1GOFA 4EKXA 5HYJE 3MR9B 5A69A 1YPZB 1PG7H 1NC4D 5HHVL 5HPCA 2BOCA 2X1XR 2VLME 5E00B 1OF2B 1R8LA 1HN1A 1AY1H 3BGFC 3ZLQC 1EEZB 1ZBCA 1FYTE 4P59H 1ZU8A 4R90H 5IK3A 3BVTA 2P7TB 2ADJA 4XC1H 3EOYG 1UWSA 3M8OH 1YN7B 4KZEL 4PJCE 2DWEA 3MGTA 5C0BE 5HYIA 3QUKB 4FQ1L 4Z7WF 3FMGH 1MLCA 3EO0A 5EU3A 4NSKB 4EOWH 3WF0A 2G2RA 3ARVA 4ZUVB 2ZOXA 3I75B 1O7DC 3VTRA 4OZGF 3HTLX 4JDTH 3GYCA 3DIFB 1Z3GH 1B2WL 3MRRB 2PWFA 1CS6A 2DICA 3MJ8B 2XVLA 3VFWA 4RFEB 4MJ6A 1HKMA 2XZQL 3VFRA 2P5WD 1JWUB 3DXAB 4I9WE 4DFHA 1QPXA 2BK8A 4D6JA 3O9WD 4L3CB 4QRSB 5F8RC 3MLYL 2BRQA 5C0AE 1LO3L 1G6RB 2V17L 4XBGA 1YY8B 3OL2A 2J3SA 4KK8D 4MB5A 5FYLL 1FORH 3QAZB 2WHKA 3ILQD 1F00I 3IFPB 5JBFA 1OD0A 2AW2A 3OKOB 3AXXA 3E6HB 5IHZA 3UJJL 5IVNA 1DBKH 5FXCH 2DSWA 4KVNH 2WBJC 4LASL 3AYRA 2W0FB 4HKJA 4Z2JA 3FB7B 3PDOA 1AI1L 3QWRD 3NZ8B 2E7CA 4QDMA 2GFBB 3CHDA 5DZNA 3RU8L 4TTGA 4BH8A 3BW9A 4PUDA 4HWEL 3VGHA 4QTIH 2QHRH 1F8TH 1UKSA 4RWHA 4WJXA 4NQEA 5FECB 5D1ZB 1IE5A 4WU7B 3RIAK 3SY0B 3L9RB 4P46B 4EDXB 5CD5C 3O2VH 3UO1L 1LE9A 3WFBH 1H8NA 3BGMA 1MLBA 2QQLL 4X6BA 1RIUL 1I4FB 1U92A 4JPIA 4K3DH 3W39B 4ZFGL 2BSTA 1UM6L 1MCPH 2MWCA 4C58B 2WB5A 1D5ZB 3P40A 3RGVD 1XR8B 3QR2A 1S9WA 2XYCA 3RNQB 3VIHA 5E5MA 4DN4H 4JQVC 3T3PF 3GUTA 2HRPL 1TVDA 2HA1A 2APBA 3ZE1E 2GW5A 5DK2B 4RMRA 5E8DL 4MNGA 2A77L 4MA8H 1EEUA 2CXGA 3MLZL 1R75A 4XMLH 4LSTH 2R69H 4XPAH 3JWOL 4YBQC 1I7RA 3BZDA 2X7LA 1NJ9A 2ALWA 3WBAA 1WE5A 4WNQB 1E28A 1UQYA 5BROA 2H9GB 4I4WA 3RX7A 2F53D 5DO8A 1QTYT 5TD4A 5LA2A 3VW3L 4KKAD 5EH1A 1BZ9B 4L4JA 1CXHA 3ARBB 4L3EE 5AUMA 4ELMF 1B2YA 1TQSA 1KUMA 2HFEB 2RQ8A 3HR6A 4XVUC 3QCVH 2ATKB 5A6BA 1CIUA 1LD9B 5D8JL 4O9HH 5DMJB 1LNUA 3RRQA 3BUPA 1IT9H 4TQEH 5JPMA 3EFDL 5J4MA 1AQKH 5DMGD 4F9PC 2VN4A 4O2CB 3QI9A 4MHHI 4ZUWB 4Y5XA 4XCEB 4HH9A 4JLRB 5F9JA 5J12B 3ULSB 4ML4A 3NA9L 3WYRA 4OLUL 5TQ2H 1IKNC 3IDGB 2X4UB 4PLJC 3F12A 1KV3A 3LS4L 2Y07L 3DV4A 5J1TC 3ARFC 1FPTL 3BQUB 4ACZB 3B2UD 3TT1H 2ESVB 4K23H 1UR8A 3DARA 5DFTA 1RIHH 4JPKH 5AZEH 1GCYA 5D9SB 3PHOA 4ZDHA 3QULA 4G43B 4GIAA 3DMMC 4XZUB 3C2SA 3KXFE 1NCNA 5GS1C 1T7XA 3DSFH 1P5UA 5JBEA 2E27L 1KGCE 3LPWA 1B0IA 5HGDB 5JHLH 8FABA 3CPLB 2CERA 4FG6C 1Y6KR 4ZOBA 2VX5A 1IL1B 1CFTA 4ZXOA 2WAHA 4Z2KA 1NLDL 4YBLB 2CIPA 5FO9B 4KMTL 3SDDB 5BVJA 4OBSA 3RL1B 43C9A 4PJ7F 3MBXH 1NDGA 2A0LD 4Z0XA 4N5EC 2EADA 2ZCLL 3SE9L 3UJTH 5A95A 3EBAA 4JHZA 5IBLD 3AVEA 4M62H 2HLFC 5HHOA 3VXSB 5K9KA 3VFOA 1RUPH 5BRPA 4JN2B 2H3NA 2FEEI 2IQ9L 2V2TB 3P2TA 4NBYB 2BVOA 4CBPA 2BVTA 3UX9B 1SFSA 2F54E 1JHLH 3AXIA 3NIDE 4P4KD 1P84K 2WSKA 3CCHA 4UAOB 1UR2A 4LHUA 4LYRA 1K85A 4RE3A 1X5JA 5H94B 5D1XD 3MRMA 3TONA 4JN1H 3KGRA 1ETZB 4NHCH 4R6UA 1T83A 1DEEA 1DR9A 3NCYP 5E94A 4OB5L 2E8ZA 4RWYL 4EN3B 1MEXH 3NIFF 2H6PB 5C6TH 5BZDB 3BAXA 4NP4L 2KZ1B 1F4XL 1TZGL 2GTWA 5C9JA 3U0WL 4FNQA 5D93C 1EVUA 3RY5A 3UTSD 3L3DB 3U1SH 1Z9MA 2PCPB 2PYFB 3QXVA 3AM8A 4P23D 4H0IA 4DZ8B 1DUYA 4NM8L 1WCGA 1MRFL 2A6IA 4Q97A 3LN5A 4KJQC 3BH9B 4XVSH 3WLWC 4URTB 5E8NA 4D3CH 1A7OL 4GS7C 1I8MA 4TTUA 2CK0L 5BMFL 4KRMB 1U0QA 4KKBD 1ISVA 1T2JA 3WSQH 5KS9B 4HWUA 5FO8B 1X7QB 1OP5H 3QDME 2ORBL 2FL5A 3AHXA 3EKCA 3S35X 3CXHJ 1HQRA 3POHA 5HGHA 4D6FA 4UT7H 4HFUL 5B3JE 1CCZA 3HPJA 5CJXA 4N8CH 2OZ4L 3FL7A 3CFCH 4HDIB 4L29B 2VR9A 1QI4A 3KS0J 3TTYA 3VXTB 4WU5B 2DSVA 1P7QB 4PV9B 3JWDC 3E6FB 5FB8A 1U3HB 1TQCC 3CZEA 3BLBA 5DJ6B 4AQOA 1JRHL 4BZ1L 1EFXB 3WNLA 4IMKA 4KJYA 2DQHL 4PRHD 5FUOH 2BV9A 3FOMB 4BKLA 5LYRA 3FQXB 4LKXA 4CCCA 2ZXAA 4I13B 2YXMA 3OX8B 3WN5B 4V2BA 1ACZA 1GAFH 2F18A 3VXOB 1T0OA 3APGA 4Z7VB 4JZJB 5T1KD 1BQHG 3VE0B 2VAAA 2H2SD 4XH2A 1A6PA 4YIQB 4H8WL 3S34L 3WEOA 1QNSA 2FX8H 1CU4H 3BYTA 1U58B 5HNNA 5MEOA 2R2CA 1NGXA 1S3KL 1T1YB 4PB0H 1XIWA 3KEHA 4UT9H 4WHTB 1LE5A 1AE6H 1KF9B 1V3LA 1MPAL 3CUIA 1IAII 2Y8KA 1T1WA 1IBGL 1IAOB 4JRXD 3A67L 3UTOA 3EJYC 2OR9L 3SKMB 4LLQA 4LLUA 2YUWA 4FQXC 2J7GA 3MGOB 5EBLA 4ZTPL 3SO5A 3H6JA 5KJRL 4X7FC 4N0CC 2D7MA 4MAUH 4YO0A 4GG6A 2YWZA 2XVKA 3WKNA 4PJDE 1H5BC 2GDUA 5CUSL 5HHNA 4OCMC 4YDJB 4FXKB 2WHMA 3EYPA 4D9LH 1ED3B 5T5FL 4P2OC 2IC2A 3HG2A 2EPKX 3OZ9L 2X2YA 4LPXA 4ENEC 1MHPH 5BRZE 2A3CA 1T2QL 3G6AB 4DGYH 1H3PL 5FDWB 4WV1A 3RNKA 2DQDH 1CL7H 3FTGA 1BQHA 4ZS6C 4UNIA 1S9YB 4GZEA 3W2DL 1HXYB 1WCQA 3EDFA 5FK9A 4PCTA 4BZ2L 4L8SB 3W6LA 1N0XL 4IOSD 3KLKA 3GIVA 5I2UA 4MQTB 3PNWB 1D6VH 4FQQA 1Z5LB 1ZT1A 2JCCA 3FB5B 2ZKHH 1KTBA 1N5YL 5HVHC 1JYWA 2AEPH 5I75C 1W9VA 3WD4A 5D70L 1AO7E 3C09B 3LEYH 3GI9L 4OFDA 3VXUD 3LX9A 2EH7L 4LLWA 2NNAA 4QRPB 3MACH 4O2EA 3K2UH 5A3ID 2YRLA 3H9SB 4ODSL 2VDRH 3PWVB 3W5MA 2ZCKH 3BUTA 1HNFA 4F9LC 1TQUA 4NWUL 1KULA 4EUPB 1CZ8H 2CBUA 3BN9C 4JO2H 4X6FB 1FG2A 1C08B 1U6AL 3POCA 5KVDL 2BVDA 1BGXH 3I6KB 1MW1A 2CEQA 1FSKC 4MADA 5SWSD 3C5ZC 1W8OA 5HY9B 1VFAA 3OXRA 1NMCB 3SCMD 3INUH 1QNQA 1QSED 1I3GH 2H26A 1RQ5A 1JFQH 2UY3A 3E0GA 1EEQA 2HJFB 1OGGA 3FN0H 3LEXB 5FO7A 3ORJA 1NGWB 3HG4A 4ODHH 1LWJA 1LL6A 4JZ5A 4JQXC 4KJWD 3KPSB 4WLCA 3NSMA 1QW9A 5FGBC 4HFWB 4IOFD 3PL6B 1KIRA 4PJBA 1BVNP 1V03A 4C7GA 5E8PA 2E5EA 2VCAA 3GSRA 3RI5F 4OLWL 5HYJA 5BXFB 1CDUA 5KANI 1ES0B 4M6AA 1IGTB 1G1YA 3BZEA 2OTWA 3CH8A 3BLKA 1J9YA 2FIRT 4MA7H 4PJXE 4F3FB 4Z7NE 2PN5A 4FFWC 4JB9L 4PGCA 3SE4A 5J13C 2JLLA 4YHIA 4PJCA 4QGTA 5AWNH 3CX5K 1KLGA 5E0QA 2AKRB 5C0BA 3VGAB 2AQ3A 3P0YH 2VRAA 1OGAA 1Q9LA 3ES6A 1PG7X 4APQD 2MPAH 4QHUB 1LK3H 4RAUB 3UTQB 5FD0A 1WBZB 5HPOA 5HOSA 3QDGD 1C8PA 4RZCA 4I1NB 1UD8A 3EUUA 5CS7A 3GGWA 3RZCB 1MFAL 4ZE5A 3LN9A 1RP8A 3VXQA 1WC7A 2Z93B 5TE7L 4MHHG 1EOMA 3PQYA 5HDBF 3BAWA 2P45B 2XWTA 3L2LA 4Z7WE 2FYVA 1IJ9A 4TVPH 3MODL 1KC5H 3HG1D 4WF7A 5C0AA 1BJ8A 1HCVA 5I15H 3TPUB 1I7TB 5JW5A 1GGCL 4AYGA 4OZGE 1B90A 1HQ4B 1A1NB 3H0TB 1QA9B 5J8OA 2BNJA 5ABFA 4PRDB 2CIIA 2VR5A 1ONQA 2YPVL 4J1UB 4K8RC 5GSVA 1MQKH 1X6NA 3MNWA 1EXUA 3GSNB 2ERJB 3VU2A 2NQCA 3AHTA 1EQCA 1B6UA 4XP5L 1PZ2A 1IGMH 3ULUD 2QJDA 2B20A 3QWQB 5DD6A 2B5IB 5I0DA 4LRIA 1ZEAL 3REVB 4L4OA 2EDRA 2YMXL 4DKFH 1OD9A 1D5IL 2YPKA 3G6LA 2D9QB 3CDGA 5BV7B 4CJ1A 5I6SA 1MAMH 5EFIA 5DMKB 4HF5L 1I8KB 2NXZD 1OLLA 3JWOC 4GKZB 1NCBL 5IFPA 4K9EL 3EYOA 5EU7C 2VABB 5IB3A 1A6VL 1PFCA 3AHYA 4G80A 1QWNA 4GBXD 3GMOB 1CFNA 2EE2A 3ARUA 5CGMA 4YXKL 1W72B 3QZWG 3HMWH 4CN1A 1LWHA 3ZL4L 5HYFA 1H2JA 2NY2C 4AMKH 4XVTH 5C08E 2AK4E 2XVPA 5F44A 4MPKA 4X6CB 4HX1B 1YN6A 1FH5H 1JGLL 4WI3A 2DQTH 3NH7L 1U93B 1CENA 1ZVHA 5F9DC 3T3PE 4XUYA 3MOAH 1C12A 3GMMB 3HI5L 3OTTA 5CHNA 5EC2A 3WD0A 1HH6B 2X10A 3TA9A 4B50A 3MV7A 3GMNA 5HHPB 1EJOH 1JGDA 2R1XB 3KNBA 4Q6YA 4P57A 4YGAB 3FQRA 5EN2A 2AXHA 4U6HB 1N8ZB 4ODVH 4YPGB 5IROA 3BVUA 4TTDD 3WN6A 1OIMA 3BKJL 1W2VA 3FO9B 2ARJQ 5DRNA 1HF6A 1TVHA 1FNHA 2VKXA 4ZO9A 3GXIA 5HI3C 2FJGA 4IDJH 4LAQH 2IEPA 2DQFA 3MJ7B 3PGFH 4GZIA 4ELME 4KY1H 3QIBD 1G7IB 1XEDA 4JG1L 3WUBA 2EDFA 2ZSWA 4XP4L 4CMMB 4KKCC 3CUPB 3CXDL 1FJ1A 4JPVL 1ROWA 4P3DA 1VRXA 1TZIA 3QZWA 4QF1B 3RHWK 3V7MA 3RZWA 4KQ4H 3DUSA 1R3HA 2DIEA 2X44D 1M7DA 2C8NA 1GQIA 4Z0BH 1CDCA 4D8PB 5FOBB 2P5EB 1IC5L 3P11H 5EBWA 2UWEF 4FNLL 1Q6DA 3N06B 1NEZB 3GHEH 4U1HB 3UZQA 1MFDL 5MI0B 3STBA 1GORA 5D7LD 2DM7A 4MNQA 2ZG3A 3QDJB 4XC3H 1U2HA 3WIFA 4WUUE 3Q5OA 4JIEA 1B31A 2NY6D 4M24A 5E99H 5EZIL 4X7DC 5EBAA 3U0TB 1KXQA 1H3VA 2C3HA 4PLOB 1HDMA 3JWDH 2DH3A 2K1MA 3HE6A 3MBEB 3VDBA 4Q2ZB 4TUOA 5AC5A 4BQ5A 5KN5B 5J57B 5SX4H 1ZHLA 3KPRE 3BP6A 4ATDA 4QCFA 3RGVB 5JIPA 1NC2A 1UD5A 1HL9A 5JOFA 1D5MB 3GMRA 4AZCA 2WBWB 3PV6A 5L2KD 4PSPA 3W11C 3MRDB 2OI9C 1M7IB 1OM3L 3MQIA 4YHNA 1AFVL 2OLHA 4XI5D 4P3WA 3T0EE 4FQ2L 1PKQE 1ZA6B 4U1IB 4PMRA 2V3FA 3QXDB 4PJ7E 4W81A 5BXPA 3B83A 3SDYH 5A2LH 2WMHA 3UPRA 3WIIL 5GS0L 4F33B 1EJ6A 3QFJD 2F53B 1LEGA 4TRPH 5BO1H 3LMJL 5I30L 1AQMA 1I1CA 1FNFA 4RMVA 1RVFL 1KIQA 5LAXA 4FTVD 1FZJA 4QXGH 5E9DD 4RNRB 5EU5B 1FO0A 1NCAL 3LRHA 4KK6C 5F3HB 1AGFA 2AJSH 1E4WH 4FFZL 1UKPA 5I2IB 4MXWH 1VEPA 1WFOA 3VXPA 3CC1A 1JPFA 3PZOA 5EG6C 1T0NA 4IRSA 2HMIC 5ERWB 3WFCL 3QJFB 1CK0H 2VLRA 2D22A 4GLRH 4HJ0D 5SWZB 2HJLA 4X4MA 2G5RA 2UZIL 2I07B 4M4RA 3NIFE 5DJAA 2VDKL 1S7RB 3C60D 1U8IA 3FW6A 1QG3A 2YSSA 4X6DB 3T04D 4G42B 4PGJA 3LAFA 4Q7NA 2VLJB 3L3KB 1UWEL 3P4MA 2F8VA 3CFEB 3KS0H 3FQWA 3ZDZF 4K3HA 3QDMA 4KJPC 3WKML 2YD1A 4CVUA 3KZSA 3TCLA 5FA3B 5FYKL 4JAWA 1MCHA 1OQOA 4JO3H 4WGWB 3MZTA 2F7PA 4OOZA 1BG9A 4OCLC 2UV3A 4LL9A 3VWJD 3RX8A 4M7LH 4MX7B 1ZHNA 5CPTA 2ADIB 2IALA 5A2IH 3SCPA 4OD3H 3BVNB 4P48A 2UY4A 4HU0A 1HEZB 5M95B 3DROA 2VZUA 1W1PA 1MCSA 1FN4A 5DS8B 5TDNA 2C1OA 3KLSA 3ZKNC 1D6EB 4GKNB 4NN6C 3CZSA 4A4AA 4P7QA 3BSZH 4M3JA 3MXVL 3QIWD 4JJ5A 3QI9C 4X5XB 3P0VL 5E6IA 4OQTL 3R8BB 1J5OL 4Y5XC 3RWCB 2CHOA 2D4FA 3VIPA 5E1AA 1UD3A 3KL3A 1AVAA 1FZOA 4NBXB 3H2WA 1CBVL 4RE4A 4OCWL 1TJIH 2EYTA 3S98A 4OZHB 3AY4A 4WI5A 1OLZA 4AM0A 1NAMA 2C3VB 2F7QA 3WBEA 3H3PL 1I8IA 1KXVC 5KSAD 2LTQC 1YDPA 5EO1B 3W9DB 5I0ZA 2RBLA 5KANG 3GMLB 4OCSL 2JFEX 4MDIA 5IMMB 1P7KA 1GOKA 4KU1A 3C5JA 2JJTA 3VMOA 2HFGH 4F15C 2AJXL 5D1XB 4X9YA 3HRPA 1KELL 1KTLA 4V1DE 1JRHI 4PTUB 5BQ7B 4BUGA 4NKQB 5IB4B 3S2CA 4GUPB 4Y4HD 1WGOA 1AKJD 1AGCA 1KWGA 5EULV 3Q6FA 2OMBA 2YN5A 1OARL 4RE2A 5GRVK 2AJ3A 5A8OA 1B2WH 3O3BB 4HKZA 3UTSB 3DI2B 4D6CA 5FEBA 4OCYH 4P23B 5DVOA 3FQTA 1GGUA 5CGYC 2CKRA 3PZQA 3RVWD 3H55A 3MLYH 1E6PA 1LO3H 2A74B 3RWEB 2XM1A 3BAEL 2RGLA 1FAKT 2G75B 5FYLH 4NZUH 4XX1E 3WF1A 3P9MA 4LVNC 4X9IA 3Q1SL 1FYHB 4PP1C 4WI6A 4JO4L 2CSPA 1TUXA 4XZBA 3TIEB 5IMLB 3VD5A 3RJYA 1E4JA 3O81A 4LCUB 4O58L 3D69A 5J9PB 5AD0B 1SVCP 1H8OA 3UESA 3CC5A 4P2RD 1ZSDA 4PLKD 3X3FL 1AI1H 1BVKA 3ZDYF 3LQZB 2N7BA 4ZD3H 2DLTA 2OJEA 4OLEA 5E56A 5ID1B 4JRYE 1S7SB 1IV8A 4PBXA 2R23B 4MA3A 4PS4H 3LKNB 1X5YA 1FGVL 1MI5D 1G6RL 1VGKA 4AT6A 5L88H 3EYSH 1ADQA 4K8RH 4FN0A 5T3XH 1CIDA 1E3ZA 4AC1X 3PGDB 1T83C 1JHTA 3ZT6A 1E56A 3UO1H 5JNYB 1MIML 4HIEA 4NRXB 5E08L 1C8XA 4PRPE 4ZFGH 2FWOB 4RRPA 4LPVA 3FT3B 4NGHL 1UB5A 3MJ9A 4XCYB 4XNYH 2YOCA 2C7UB 4XCFL 4P99A 4GAJH 1YEEL 3AM8C 5C0DB 4E9LA 1GPOL 4AIZA 2HRPH 3MCKA 4UQAA 4D72A 4N8VG 1NGQH 2JJSC 1DN2A 3R1GH 4FQIH 3RL2A 4ZUTA 1A9BA 5BXRA 1R3JA 4OT1L 5T1KB 4P5KB 4UINL 2G9HA 4J28A 1ZHKA 3PZVA 5INCA 4YQXL 5C0FA 4Q9QL 2HT3C 3JUZA 4NUJB 2RCSL 3CMOL 4E42A 3NUKA 3MI6A 4LSRL 1V7NL 3NAAH 3ZHKA 1ZXQA 3MRGA 3VIFA 2OTPA 2BVQB 4ZQKA 4NNXB 3PN8A 1IGIH 1U9KA 1QR1A 5IVZB 2YUVA 4W7UA 5C0CD 4JRXB 1CICC 1P84J 3UETA 3VW3H 1TQVA 1W0WA 3BP4A 1MQQA 2I26N 4PG9B 3FO1B 5CJXC 4JFFE 1VBRA 4GMSL 3UBXG 5DO2C 1S5HA 5C0IB 3O3UN 1WBXA 1ZT7B 5C9KA 5D8JH 4PJXA 2E8YA 5DTFA 1FE8L 4YHGA 2ZSVB 2BNRE 3PWPA 2ENYA 5HHME 5D9PA 1T21B 4Z2LA 2PWEA 1A6ZA 5T1MA 4OCRL 2YZ1A 1KPRB 1C5CL 3ARRA 4IMKC 1T80A 4N8VA 4HZ7A 1B3XA 5GRUL 5LWYL 3SQBA 2VIRB 3BUYA 3F7VA 2YBRA 2UVFA 4NQDD 5TH2A 1T0PB 5K9QI 3NA9H 3OAUL 2ATPB 1U91A 5JHDD 3VWKB 5F9OL 3LS4H 1MCCA 5DD1H 4PJHB 4WUKH 1DQJA 4EVNB 3ROLA 4JDVA 4NQTA 3TJEH 1XIWC 4OLXL 1JF5A 3PF2A 5DD3H 4F37K 2OWWA 4OZGA 4OI9A 3UBXA 4I77L 1IAKA 5BRQA 1W8NA 1GGYA 4PB9L 2PYED 2GJXB 4EDWL 3CK0L 3UTPE 4M03A 3VXRD 5IB1B 2PNDA 4NRSA 4ODTL 5HDBE 1HSAA 2E27H 1JAKA 1OPGL 1TVBA 1ZA3A 4NQVA 3GSVB 1KNOB 1Y18B 3FB6A 32C2A 2XN9D 3D87B 2Z8VC 1RY7B 3S97C 4AIEA 3PZUA 2XQYG 3MV8D 4G8FA 2ZWZA 4ONOA 1ZHBB 1BG4A 4NWTH 3QUZB 5SWSB 5TPWL 4PYGA 1EFQA 4K9EC 5FCUL 3I85A 1CFSB 1CXLA 3SCMB 1OT2A 1MJ8L 1Q8MA 2EXWD 1FIGL 3ZM8A 1QSEB 2MCG1 1RP9A 1G7PA 4MD0B 3IS1X 4JREC 3MRHA 1TETL 2ZCLH 4WV1C 5FUZL 3B9EA 2ILLA 2P8PB 3GH5A 5ID0A 2GEEA 3BJ91 1WEJL 4HC1L 3S9DB 5E2UH 1QFWL 1AD9B 4WDIA 2MJWA 4JQIH 2IQ9H 3ZDXF 3WS3A 3BWUC 4MQ7A 1XH3A 2YDSA 3IXTB 4HIJB 5GGSY 3TZVC 1UM4L 5EB8A 1IZJA 2I60L 4M82A 1TTFA 4WO4D 1IGFL 3AIUA 3V6ZB 5FGCB 1A4JB 3L3IB 4U1MB 3BKYL 1SHMA 4DQOL 1MF2H 1ISXA 2ICWI 5DK0A 3LPPA 4TUKH 2GHWB 2VLKE 3VVGA 1DBJL 5ITFB 4I2XE 2EEBA 5C08A 2PC8A 2AK4A 5ALCL 3CLFL 4HXAH 4RX4D 4E41D 3HMCA 2A3EA 2JE8A 1HVXA 1B3WA 1CF8H 2FH6A 1C16B 2GJ6D 3GRWL 3D39D 4Q58C 4PYHA 1FFPA 5EO9B 1TZGH 3IGUA 3IF1A 3V4VH 4TULL 4KI5C 4H26A 4APQB 3FT4B 3WUWG 5IM7B 1FDLL 5ICZB 2DQGL 2JB5H 2ZG2A 4NM8H 2WVVB 1KN2L 1MRFH 1INQA 3PV7A 1LVEA 3SKJH 3QDGB 3KPQB 4FQHB 2HAZA 2FHFA 2XXMB 1A6WL 3IGAB 4HP5A 1CGSH 2IGFL 1N6QL 2X4OB 2UY5A 3OKDA 1MQRA 1L7TL 1LEKB 2DMBA 1F45A 1CR9H 1R3KB 2BC4B 3DX9B 4M43L 4UT6H 3OGRA 4M8QB 3UTTD 3HG1B 3MFGB 1T04B 1E43A 2COQA 4J8RB 4D0CA 2GI7A 5HI4C 5FF6B 4HFUH 2EKSB 2H32H 4D2NA 5AY7A 4GJTB 1KIUA 2IANE 2J8UA 3D18B 1LP9F 4DO5A 2OZ4H 4ZXBD 4LCYB 4AZGA 3QG6B 1T1ZB 4JFVA 5I1LB 3W37A 4TNWF 4RMQA 3PBGA 3QUXD 1ZS8A 5AC4A 5B39G 1YYML 3VFUA 1B0WA 7FABL 2UZYB 3OB8A 3SE4C 2EEDA 4BZ1H 3U6RB 3GSOA 4Z78A 5M03A 4Z7VF 2OSWA 2IPKA 3F58L 4PSRA 3B9KD 4WUUA 3M46A 4QCIB 2UWEE 5IMOA 3QFDB 2VRQA 2GSIB 4ZYKA 5IHUL 4PUBL 3HI6L 3V8CA 4EI6A 1UZ4A 1GGBH 4U1GB 3I50L 5F7EH 3SQOL 3T8XA 4CCEA 2UYLB 2E7HA 3WD2A 2HLAB 3S34H 2NXZB 2ITDB 2CRZA 4R4BA 4TOYL 3U48A 2YD6A 3KHOA 4OGXL 4U6XB 5C0ND 4RGOH 5GS0C 1HJWA 3PDDA 5ANME 3UJIL 3QIUC 1IBGH 5F1IA 3A67H 5BJTA 3BKCL 2BNQD 2OR9H 2PXYC 2E6JA 1U2YA 1UYQA 2NZIA 3O6LL 3D25B 4ZTPH 2VDNH 2X9YA 3D2UD 1PKQA 3WHE1 3WDIA 5CEXB 5I1KL 3RDTD 5B39A 5KJRH 4P9MH 4PJ7A 2VX4A 2Y5EA 4IJ3C 5DMIL 3PWLB 5CUSH 1OAQH 1ZMYA 4ODXB 4S2SB 1U8HA 2GK0B 3DX6B 4M8VA 5I79A 4NQUA 1VHPA 1ECEA 3BPOB 3AOFA 5D71L 2R0KL 3ZJ7A 3O4LD 3MLPA 5GRVL 3CX5J 4LRIC 5J11C 4M7ZC 3GNPA 1H3PH 1E6RA 4B7LA 4AH2B 2WINA 3AB0B 5DK3A 5IXEA 2E6QA 3A6CL 3L1OH 1MW2A 4B9YA 1NPUA 1RZKC 4OLYH 3W2DH 2YK1H 1JZ4A 2BJML 4PCSA 4DN3H 3UP1A 1FHLA 4QHLA 1X4ZA 4HLZH 1CTOA 5EBMA 1UD4A 5GRXG 1T1XB 3QIBB 5ENWB 5J89A 4MLSA 2F8OA 3KR3L 2CO7B 4NXKA 1VACB 1OAZL 1YUHB 1FNEA 5FIEA 43CAA 1N5YH 3P77B 5D96C 5FYKE 3EJRA 1XYFA 4YHML 3SBWA 4P2YA 5FGRA 3OJ2C 1QSFE 1L8NA 2O61B 3D3VE 2EH7H 1QVOA 1NC4A 1SQ2N 4ONGH 4R2GB 4BUHA 1G9HA 4U6VL 4I3RH 1IILE 2VZSA 3WLWD 4DEPB 3WFHB 4U1JB 5HD8D 5DWUH 5AAMA 2W65A 2X4RB 4NWUH 4OZFG 1H3UA 4GINA 4KUZL 1SMDA 3LKPB 4AIXA 4CU8A 5C07B 1UR0A 5HTSA 5KVDH 4WFGE 4AZHA 1DQQA 4H25A 3HC3H 1JTTA 2X05A 3SCQA 4NO5B 4H1LA 3O45A 4UBDD 1JFXA 3ABZA 3P4LA 3PWUA 4XGZA 3WFEL 2D2OA 3OHXA 4ZFOA 2AI0L 3HUJA 5CIPA 4PTMA 3ZDZE 1IZKA 3GFUA 3I6LE 5I19L 2IQAB 1S7VA 1Q0YL 3MMWA 1QRND 2XRAL 4LF3A 5EOTA 4D6DA 1KOAA 2DT0A 4HLZG 5DI8B 1GHFL 3VCLB 1RK1A 4ISVB 4JFDB 3GB7B 1MCJA 4K7FA 4Z7QF 1HNGA 5L2KB 1WTGT 3HLAA 1FNGA 2P5WA 4NQSA 1A1MB 3F7YB 2XFFA 3FRPG 4GRLA 3C08L 4OF6A 4LSVL 3O9WA 2NTFA 2F8XC 4RGMC 2QMKA 3W9EA 3MRFB 3BAJA 2ZUUA 3C5SA 4XPBL 4XX1G 3TP4A 3Q0HA 4OZFA 5I8OL 4WCYL 3NIGE 3QUYA 4KRPD 4OV5A 1K2DB 2YDQA 3QFJB 4XNQB 3LZFL 2I9LB 1VJZA 1XF5B 3MRCB 4KTYA 3WMCA 2GITA 4HKXA 1JBJA 2WIMA 3RIFK 1GOGA 3I6GB 4FTVB 4V1DA 3L5JA 1T20B 4NO3A 2VXTL 5GJTL 3UAJC 1F5WA 1KTCA 1AP2A 4FQXD 5C0RH 1E27A 2EC9U 3CUGA 1MFAH 2DLHA 1OSPH 4JZOB 1EAJA 3T1FB 4JFZL 1JDCA 5EA0L 2APWA 3RVUC 4UFIA 4TSAL 4UIMB 2OP4L 2A6DB 3V6OC 2B0SH 1JG9A 3O6FD 5K9QG 4QYOB 1QNZL 5F89A 5HYEA 4NKMB 3HMXL 1GGCH 2RFXB 3R06A 2FJFA 4JY5L 3C60B 6FABL 3KPTA 3NDYA 3OKKB 4PY8I 1GW1A 2ZX9A 3MLVH 5C7XL 1WJ3A 5JUVA 2FHCA 5H35A 1KSRA 2YPVH 4HQQL 1DBAL 4J27A 1A4KA 1QSVA 5I1CL 3NFNA 3D4YA 4E8DA 4AW7A 3FFCE 4UOJA 2FLRT 4DKAA 1ZGLA 3LVEA 1RHFA 3DYOA 2Q8BL 12E8H 4PEEA 5GGVH 4R97B 2XKUA 1EHNA 2YMXH 1F13A 3VWJB 4PJ8B 2OCFD 3Q3GB 3M17A 4NQCB 4NYLA 4XB7A 1CDBA 4MCZB 3D4ZA 4ZE4A 2MCPH 1NP0A 3ZDYE 5DJDA 1YEIH 5D1ZC 3X3GH 5ISZA 2PUQT 1I7UB 1QFOA 4J6RL 4AEFA 1A7PL 2DLGA 4M7JL 3K1DA 4FQJL 4K9EH 4CL7A 3GSNL 3KPOA 3AI0A 3Q2CA 1BFTA 2YRPA 5CJ8A 1E15A 4HA4A 5GNYA 3NCJH 1RJYA 3QIWB 4X6CF 1XD0A 4LIQL 1BFOB 3MRQA 1S7WB 4GG8B 2WIIB 2AV7A 4YXKH 5JIIA 3ZL4H 2AXJA 3GMQB 3WY2A 4D9QD 4FFVD 3WD5L 3QNZA 3CIQA 3LKQA 4AL8L 5BV7L 1QO3B 1JGLH 5KSAB 1LG2A 4KHXL 3NH7H 1K4CA 3E3QC 3UPCA 2BSSB 1VFUA 3HI5H 5D5MF 4AMCA 4WTZG 3EJJX 4L4VE 4DM1A 5H37H 2VZTA 3OKEA 2NR6D 5DJ2A 2X4SA 5E7FA 4F57H 4HZ8A 4JFFA 1KPVB 4L4TB 2N7AA 5IJVB 3VSUA 2BSRA 1W72L 3BKJH 3ARBC 3QQ3A 2HT4C 1AKJB 2OL3H 3SE8L 3U9UA 2J6EL 2BNRA 2DSKA 2BZDA 2FNBA 2YKLL 4TSCH 2YZ8A 1BD2B 2AJZB 1IC4L 4HWBL 3VFTA 1G9MC 3SCOA 1A6UH 4HIXL 2X9XA 4UDTB 3CXDH 5IW1B 4Z2HA 4JPVH 4LMQI 3W0WE 1R7OA 1FVDA 2D7QA 5CJBA 5L9DL 3BO8B 2YA1A 1UVQB 2H8PB 2RR3A 1OQXA 1KPUB 3BUBA 1ITCA 2AXGA 1E72M 3JVGA 4MAVA 4KKLC 3QNYB 1LK2A 3WF4A 1HI6B 1IC5H 1U2CA 5TFSH 1GH7A 1BWWA 4XBEL 5IB5A 3AY4C 5I71C 2D7TH 1V05A 4OIIL 4WWID 3IETA 4QWWC 2Y06H 4P2RB 1PIGA 3BSHA 4UQEA 5IBTL 2A83B 5JTWA 2QQNL 5KG9A 2ESVE 4CW1A 4JFYA 4FXLA 4P4KA 5GHWL 2GJJA 5C8JA 4HUMB 2JJTC 4X99B 2VCBA 1MNUH 3DYMA 5DJ0A 1ORQA 4ONHA 4E0RB 4DM2A 3RCNA 3T4YB 4K7PL 1H41A 1S46A 2KBGA 1N2RB 3EJZC 2Y72A 4BZYA 1T4KB 5T3XD 4PJ9D 5GGRA 3S5LB 3RO8A 5BS0B 1JVKA 3G08B 2V3DA 4JFHE 4N9OB 1SZNA 2CLVA 4IRJD 3SGDH 1XCTB 4G6FD 1KXHA 5E2TL 4HULB 4YBLC 1KR1A 3AIEA 5JXAL 1FG9C 1CD1A 1MCIA 2WBGA 4PMUA 5TDOB 5IESL 4M4PA 2CIKA 1AFVH 4GRWH 4C57C 4Z77A 3U4EB 3U2SB 3EYUH 4CMHC 4Y19B 4DVRL 4GFTB 3F65A 3VXSE 4ATLA 5TF1L 1RZFH 1HK6A 3RWGB 4NC1E 5I1AA 5EIIB 4QHMB 2CKNA 5GS0H 1D5BB 3GO1L 3WD1A 4G5ZH 4RA3A 2WNWA 2W0LA 5C0CB 5I30H 1E0VA 3ZR5A 1XGYH 4QRUB 4I2XA 3TNNA 1LMKA 3MGAA 3UCQA 1MFEH 2QKIB 4OUUA 1XH0A 2I9TA 1GZJA 4HPOH 4WSKA 4PMYA 2VITB 4X7CC 4HS8H 3BEWB 1E6JL 5DVNA 3T77B 3BGFB 3OG2A 5BWFA 4H8UA 2FGWL 1JK8B 2BY0A 1GONA 4MNMA 4OZIA 2GSGA 1W1TA 3WFCH 4YFDB 1SJHB 5B38A 4GT7A 4G9FD 5D2NA 3DO3A 2DQIL 3SGJA 1GNXA 4PRHA 4S0TD 4X6DF 3S4SB 1QFWI 1OW0A 2UZIH 2NW3A 3LRSA 3PP3K 4F8TA 3WS6C 1UKOA 1BLIA 5FYKU 1SM3H 3LV3A 1FRGH 1RZKH 5ABEA 3LH2L 3I84A 1MCLA 4GPNA 2EIZA 5F70A 3WY1A 2Z91B 4JFQA 5ESQA 1M05B 1X5AA 5JHDB 3MUJA 2Q76B 4CUCA 1UT9A 1XGQB 3WIJA 5DEGB 3VMNA 1C1EH 2XWBB 5D7JA 5KVFH 5DQDL 5FM8A 2WCAA 3LSOA 3EGSA 1I1AA 2BMKA 4JFOA 4YHZL 2PYEB 5ITBH 1GCFA 3VXRB 4UZSA 3KYMA 3GSQA 2F74A 2P8MB 5I1HH 4GI8A 4AWEA 2FX7L 3RFZC 3MV8B 1BVLB 4LVEA 1B0RA 2UZXB 3P3YA 3SDCD 5IUSA 1LP9E 4W8BA 1I1YA 3QQ9C 3I3BA 4Y5YB 4UQBA 1I1WA 5F1OB 3L5HA 4OZHF 1XGPB 1V02E 3AQUA 1IGJB 2UWEA 3ZHDA 2G5BA 4OQTH 1J5OH 2W5FA 3MCG1 4TX6A 3ZJ6A 1W2KT 1MCDA 2XZCL 1CBVH 1NBYB 3WN5C 3U7YL 3O3AA 5E7BA 2DI7A 4Z7VE 4DWHA 4JZJC 4JFXB 3H3PH 4NNPH 4OJYA 1SYSB 3L95A 2GJRA 4G9DB 4TVCA 2Z92B 3UROR 4WO4B 2IADB 5ILTL 2NXYD 5ANMA 3KPPB 5EZJB 1RFDL 4G8IB 3G5YB 2DKMA 4UOW1 35C8H 1ZLUK 1YEKL 4X0KA 2F7OA 1LJYA 5GGTL 1WWWX 4NHUB 2V9QA 1T6WA 4WY7H 1WP6A 1B3ZA 3VXUA 3STZA 1VESA 4UUJB 5LVEA 4K3JL 1MCOH 3GNML 4CRPA 1NFDB 1NKRA 4DOHB 1BF8A 3AFBA 5TQ0L 2GJ6B 5DVKA 3TESA 3D39B 1L6XA 5EBGA 2HVKB 3S96B 3BX7C 2IH1B 1R46A 3ZE2F 1KJ3H 2EACA 5HDQL 2QPUA 2IFFH 4U6YA 4JL2A 1TJHL 3SCSA 5FYJL 1HKJA 1JZ8A 4JM4L 4XRCB 1IEAA 1JI1A 4D0BA 1V7MH 1I3RA 3BAEH 5CD3B 4B3KA 2XY2A 4OQ1A 4XX6A 3BRDA 1JE6A 3WFZA 1H0DB 5DRZB 2WSPA 3O41B 2ZUMA 1FZKA 2VSDA 3G6JA 2ZG1A 1P1ZA 3ILPB 4C56E 2HMID 3UTTB 4L8SC 2OSLA 4XP9H 2GUOB 5IB2A 5HI5D 4P4RB 2P42B 2NYYC 1S9VA 1J0IA 2WWKO 2AERT 5IVXA 3CD4A 4M1CC 1Q9OB 1BOGB 3IJSB 4ZXBB 4JR9L 3L5WA 3N18A 3KPLA 3HS0A 3MA7B 1CYGA 1MWAA 5BZWA 3C09C 3QNXB 5KOVC 1ACYL 1DLHB 1Q0XL 3IDJA 4QRPE 4YGVA 2WVSA 1UCBL 1IKFL 5H2BA 5BXSA 2IBZX 5C09B 4LLDA 4X9BA 5HGBB 2OW7A 2V7NA 1KYOK 3WEZA 5BOPA 2J7FA 2ZXBA 1MVUB 4UQ2B 1HOCA 2LV4A 4XVJH 3B9KB 5ICXB 3FFDB 2UY6A 4Y8DC 4AG4L 5FKAB 1GPOH 1HYRC 1KT2B 1H4PA 3DMMB 2NY1C 4XXDB 1QPKA 3VD9A 2ZPKL 1NMCC 1EAPA 3QB7C 5CSUA 3RVTC 3QUMA 4X0VA 3UYPA 5EFDA 5GJSH 3CMJA 4IEFB 4PJAB 3T0VA 5CBEA 2ZX7A 2FDBP 1CLZL 4MD4B 3KPSE 1V7NH 2DAVA 1MRDH 2F61A 1LO4L 2R4SL 4Y7MA 5I3DA 1G94A 4BH7B 2R0LH 3IJYA 4FABL 3GSXB 3AAZA 1Z2KA 1QFHA 1YMMB 1QLEH 5IFTA 4L3AA 3PL6C 4L9LA 2BNQB 3O2DA 2R1YA 5CILL 1I7ZB 4P3CL 1UZ8B 1YJDC 2R8SH 1V6VA 5CINH 5ELIA 2A3HA 4GMSH 2Y1VA 4PTXA 4I0CC 4YHOL 1KJVA 3RUGB 1DQML 4Z76A 4Z7QE 2G3IA 5ICYA 5GZND 3BISA 2X2JA 2A3BA 3TV3H 2OR8A 1AGEA 3CIVA 4PRAB 1HNYA 4ZSOA 1X4YA 3O4LB 5FIPA 4LX4A 3E8UH 5EC1B 2BCKA 2LU4A 3QH3B 5DJCA 1EHLL 5GRUH 1FAIL 5LWYH 1E40A 2XWEA 1BZ7A 2Z4QB 2NX5E 3AREA 3AIRA 1XR9A 4LPWA 2XYLA 2VDLL 2HH0L 4OM1L 3OAUH 4IOIA 4WW2B 4ZTOL 1KB5B 4D6HA 2Y9RT 4WHDA 1ZBVA 3EFFA 2HVJA 3IJHA 3VMPA 1G9MH 2FO4B 3FCTB 1OTSD 4AD1A 4BFIA 3DVFA 4QTHB 5JO5A 2K7PA 3DC0A 4JHOA 2HKHL 4YUEL 4PJ5D 5FKYA 3IB4A 3OR7A 5IGXH 3RTQA 3FT2B 3WHXB 4OF5A 4I77H 4GBXA 4U1NB 3DVNB 3CK0H 4OGZA 2Y6SC 3S35L 5A2BA 4LAJH 4ODTH 1P2CB 2D3NA 5DRWB 3Q5TA 3QXWA 1L0YA 2A38A 2DEPA 2WUBL 4FS0A 4GS7B 3BSGA 4HGWB 3ZTNL 5HHOD 3ULVF 1NDMB 3FFCA 3CDFA 5FHBL 4UFJA 2D4DA 5FCUH 5AAWA 3BZ4A 5GZOC 1FFOA 5HJ3A 5T5NG 5FUZH 1IAIM 1YNKL 3BEVB 3IDNB 1Q9WB 1A2YB 1WCBA 1XGTB 1QRNB 1WEJH 4HC1H 2J62A 3SKNA 5BV7C 1GVIA 3EDKA 4QT5B 1VPOL 3RVVD 2D03H 2QR0B 3RWIB 1X4XA 1M01A 1R24B 3PTKA 1UM4H 2PBGA 4PTTA 1BOYA 4Z5RB 4WEBL 2B4CC 3HRZB 9CGTA 1IGFH 4P2QB 1G7JA 1B3JA 1F97A 1F3JB 5E8EA 4UTBL 2ZUYA 1KTRL 3ULVL 3SBWC 3X13B 5J0BA 1S7UA 1UGNA 1T5XB 1TFHA 3X12A 2VL5B 1HH9B 1NMAL 2CPUA 2EQDA 1RUQL 5ALCH 4ZS7L 3C6SB 4ELKB 2ITCB 1AR1D 1KLFA 2XOTA 1BQLL 1KEML 2HT3D 4X6CE 4KRPB 3F7PC 3TVMD 3HZKB 1HHKB 5D2LF 4L4VA 5JMRA 4H8HA 5D7LA 4TULH 2Q3AA 1E4XL 3RAJL 2DQGH 2XA8H 2PW2A 1ADQH 3IU4L 3MRNA 4Q22A 2J4GA 2JEPA 1I1XA 3SJVB 1WIUA 4FQXB 5DQ9A 4XNXL 5D5ME 1A6WH 3UPAA 5I76B 3DX0A 3B3IB 3WJJA 3OZPA 3WCYA 1UASA 1L7TH 1DJSA 4MYWB 4OFKA 3MJ9H 3WELA 1XGUB 4HGMA 4QXTA 3VRJB 2CGRL 3W0WA 1GPFA 1DQLH 2VDOH 5B8CB 1YECH 5I1DB 4IM8A 3OGCB 3LRGA 3A5VA 2ICEA 3RMEA 4GRLC 3WDHA 1C92A 3BPCB 5T3ZL 3O9WC 5KSVA 3MUGB 1R0AH 1DQDH 4MJIE 2CDEB 4NJ9L 5B4MD 4MCYB 5EZLA 3TTQA 2BVPB 3IAPA 5KZ6A 3V6BR 1D2KA 3QRFM 1W0VB 3ILQC 3LN4B 1UH2A 2P5EE 2M8XA 2IH3A 1NMBH 3L7EA 2V9RA 7FABH 1I9JL 3NCYS 1BYBA 2IFGA 3EJTA 3JV4B 4ERSL 4RAHA 3QO0B 2YL9A 2CD0A 3F58H 5GSRA 4OFIA 5HVHB 1DUZB 3QDJE 3BWAA 2WZIA 4MSWB 5IF0A 3BXNB 1QLFA 1H1NA 4XPGL 4HIIA 5TE6H 5SWQB 4A3HA 3S5ZA 5E9DA 1P53A 3HZVA 2QBWA 4XMPH 4LCWB 4NRZB 2RHEA 3OPZL 2GAZA 4NRYA 1JPTL 1INEL 5INDA 5CPQA 1YEFL 1UXSB 4OGXH 4WFFE 2P48B 3D0VA 1Q9KB 4UOQA 3AYSA 4AXNA 1FSKB 5A8PA 3ULUL 5JXEA 1I9RH 3BKML 2PWDA 1AD0A 4Y8AA 1TQBC 1IEBA 4YDVB 3RGVC 4W87A 4UI2A 2YD2A 1B0GB 3G6DH 3A23A 1E4LA 4Y1AE 1BFVH 3L7FA 4K2UH 5IFJB 4NO2B 1J8HE 4W6WB 3QQ4B 2EYRB 1G7HB 1PIFA 1GVYA 1ZTXH 2QL1A 4GQQA 2CBIA 3VD7A 4P7LA 4NM4L 4YAQA 3O0RH 4HBCH 5DJ8B 3HNSH 1HYSD 3VG0L 2NY7H 3D0LA 2R0KH 3KYOB 2F53E 1X5FA 1LQSR 4G6AD 5IVOA 3SUSA 4GKSA 4H0HB 4WFEE 25C8H 1UYWL 4CCDA 4A6YA 3P4NB 1HHJA 2EDKA 5GGQL 4KKAC 2XUCA 3A6CH 2HWZH 2WVUA 1NWSA 1ZE3C 3RBSA 4WGVB 4OIFA 4GQ9H 5D72H 1HVQA 3VI4F 1RPQA 2BJMH 4KRNA 4AISA 3NSNA 1HSBB 4KQ3H 4FLRA 2OSYA 2LVCA 4IIQA 3MREB 5J13B 1JAEA 1KJ2A 3KR3H 1JWSA 1DVFA 4OFVA 4R90L 1EGJA 1ULVA 3H9HB 4XC1L 5DC4B 5SWZE 5DMGC 3N04A 1WFTA 2XPGB 3L3GB 4Y4FD 4YHMH 3NCEB 4IMLA 3V6FB 4ATWA 3T65A 4Z9KB 3LRLA 1XF1A 3ARYA 3CDCA 4U6VH 3VFMA 3PGCA 3LKSA 3HAEA 1B4JH 1KCLA 3FMGL 5DR5H 3D50A 1DWIM 4X6DE 5D1QD 2IG2H 4EOWL 3MRLB 4RGND 2DLFH 2ZOKA 5CEZH 2VLJE 1URLA 4R0LA 4JDTL 2PW1B 3B2UC 5GNZA 2VXVH 4U2ZA 3BESR 5JZ7D 3VFNA 2MMXA 3UDWA 1OCQA 1MCBA 1AQ0A 4ZO7A 3L6FB 3O3EB 5HYJD 2B39A 4YHLL 3P9LB 5I16A 2J75A 3HZYB 2VLMD 2Q3ZA 5JR1H 1QBMH 5I19H 1Q0YH 2YPLA 1XD1A 4Y4HA 2XRAH 3SE3A 2D3VA 1FYTD 1ZVSA 3OJVC 3DGCR 5I1IH 5K9OA 1KXTA 3BCDA 2GT9A 4W6YB 1LP9A 1T0MB 2A6KB 2GIYA 2A1WH 4PJFB 1R3IH 1BPVA 5CSZB 1CE1H 1U95B 4G6FB 1QUNA 1DBKL 4KVNL 1QI5A 1V02A 2YFNA 4UTFA 2CLZB 5C0BD 3VNZA 4LSVH 4OKVB 2A0LC 2O9RA 4FMKA 1OP3K 5E4EB 4XPBH 4QTIL 2QHRL 1F8TL 4O51A 3VINA 1JF1A 4LCCA 5I8OH 5LGHH 2YXFA 2KQMA 1VA9A 3JSSA 3VRIB 3O2VL 5CMAB 1FLRH 3DVGB 4YDIL 5JDSB 4JFTA 4PMVA 2N1KA 4K3DL 1DDHA 1YJDH 1MCPL 5FYJE 2NLJB 4P4KC 4I9WD 4E5XB 1SYVB 3G5ZA 1OD7A 5C0AD 3U46B 4PRWA 1MREL 3QXTA 2VXTH 1MI5A 4NZTH 2NY2B 5D1XC 5HHQB 4TUJA 3QP3A 1YY9D 3CU1A 3DX1A 4MA8L 2VVNA 1T03H 5EA0H 4XMLL 3AZSA 3MUIA 3L3HA 4TSAH 3KYKH 4XPAL 4EUPG 4HK0B 1L0PA 1UXWA 1HHHB 4OM0H 1TZ7A 4MB4A 1AXSB 5DA4A 4WJ5A 1QNZH 5F7HA 1IVLA 5FM5O 4P23C 4JY5H 2Q8XA 1ZGLP 1JWMB 1JNNL 4F80A 5TE4L 4PP2A 4S0SD 1V0LA 4XCNA 4U1KB 5C7XH 4XNUL 3ZE2E 3QYCA 2IAMD 1DBAH 1XF4B 1CFBA 2C1PA 4CVXA 3AMCA 4M29A 2SEBB 1FP5A 3GBML 4O9HL 4C56A 2GTZB 4NKDA 1KIPA 2VKWA 3G9VA 4KKBC 4HG4K 1UWRA 1ZVYA 2FB4L 1WVZA 3MROA 2YEZA 3AS1A 1IT9L 4TVSa 4YR6A 3VM5A 4TQEL 4M5ZH 1H11A 2A6JB 1K8IA 3EHBD 5FA4B 2Z35B 5GGUB 1AQKL 3KLLA 1Q1JH 1O0VA 1HKLL 1I8LA 2BOCB 4D6EA 2OYKA 1FA2A 4YWGH 1WZAA 3VJ6A 3NCBB 4J6RH 1TLKA 3U36A 1AGDA 5IK3B 2ADJB 5TQ2L 5DJXA 4FQJH 3GSNH 2WVTA 3NFPA 2DMCA 1XF2A 6A3HA 5D2NC 2V7HA 2DWEB 3TT1L 4K23L 4LIQH 3MGTB 1OW0C 1RIHL 3BDXA 5KW9L 1VB9A 4L3ED 5CJOH 3IKCA 4M5YL 1MLCB 3EO0B 5EU3B 3KL0A 3N15A 4AL8H 4NQDA 5BV7H 2G2RB 4OIBA 4BFGA 1FFNA 3AICA 1NGWA 3DSFL 1R87A 4KHXH 2H2SC 5CZVH 4NRRA 3TO4A 2B4CH 5IIEA 4KI1A 2DDQH 3VXME 1CXKA 4P8VA 3VFWB 4X4XA 4U33A 4MJ6B 3EOBA 3VFRB 4UQDA 1NSNL 3W29A 1K9DA 2WWMD 3TA3A 5C0JA 1UKTA 4BSVA 4XBGB 4NOBA 1E5NA 3TM6A 1TDQA 2YD7A 3FN9A 1VKXA 3SE8H 4R4FL 2GK2A 2DH2A 5JIWA 5C3TA 1CI5A 5JLZA 4L9DA 4JGJA 4GXPA 2FBJH 5IHZB 4U6TA 5I77A 1BGAA 2XN9A 2YD8A 2QQQA 1IC4H 4HKJB 3X17A 3HU7A 3PDOB 4UCFA 2YD3A 4H1LH 4E8CA 3DGGA 3HMXA 5F1SA 5AZ2L 4BH8B 2NX5A 3BW9B 3G5VA 5CIPH 2MHAA 3KXFD 4FXGA 4GI9A 4NQEB 3FO2A 1WO2A 3UAJD 5A8QA 4JN1L 3MSDA 1KGCD 4NHCL 1LE9B 2VI0A 4BF7A 3QJHA 3TBVB 3HE6D 3BGMB 1MLBB 3ARTA 4X6BB 2JIXA 1U92B 4GW4A 4JPIB 1G1CA 2BSTB 3A0OA 2QQNH 5DHVA 1ODAA 3NTCH 2R9HD 5D7KE 1AGBA 5ADOL 4NQXA 5J3HD 5GHWH 1S9WB 1T3FA 3WUZA 4H7VA 3IFNH 5E5MB 3U1SL 1MHHA 3GUTB 5SX5H 3O2WH 3D52A 4C7DA 1RULH 2UUDK 4K7PH 3O4OB 4I48A 1DTUA 4MNGB 2QEJA 4LSQL 4E41A 2L7JA 4XVSL 5A3IC 2E7LA 2BVUA 1I7RB 4D3CL 4XTRD 2X7LB 1NJ9B 3TT3L 1MJUH 3BP5A 3QEHA 1E28B 3RY4A 3L4WA 5SWSE 2VB5A 4I4WB 3ARSA 3T0DA 1T22A 3RWDA 3ARXA 3ULVE 3F5JA 5AUMB 3SCMC 2VR4A 3O6KH 4ZEPA 1E6XM 4J3VA 5DT7A 3VM7A 4FNTA 2HTLD 1LNUB 1NWRA 3VKKA 4PJGE 1PX3A 4G6JL 3BAKA 4D9RE 5JPMB 4IRSD 4IOFC 2PR4L 3PJSA 4CNIA 5F7MC 1H3WM 3QI9B 1OGSA 2CQVA 1OP9A 1P6AB 4Y5XB 3RP1A 4HH9B 4QRQA 3U4AA 1GQJA 5EO0A 1Q6CA 2FJHA 5F9JB 5GNXA 1FZMA 1D9KA 2OJZH 1NFKA 2X1IA 5GQBA 3QUXA 2CESA 3F12B 3K7UA 2OS7A 1AQHA 3DV4B 1NEZG 1EZVX 3OGSA 1CU4L 1VFMA 4YEEA 2B31A 3QDMD 1QWUA 3PHOB 4I0PA 4PB0L 3OKNA 4P5TA 4ZPTA 4ZDHB 3QULB 1AE6L 3A6BH 3BLPX 3BH8A 5T3ZE 2CHNA 4XNMA 5D5MA 1WKYA 1WT5A 5D2LE 4RDQF 2J47A 4XPTH 1YC8A 3GSWA 4AEIH 4WSJA 1K3ZA 2O93L 3CH1A 2M1KA 4J3TA 1E6QM 2E7MA 3VPLA 1NFIA 8FABB 1HZHL 4Q9CA 2R1WA 1A3QA 1H3TA 1OCWH 1HIMH 1O6IA 1CXEA 5BVJB 1NGZA 4HAFA 43C9B 1FVCA 4D9LL 4R27A 4KDTC 1NDGB 4YHZH 2X4NA 4L9LC 4Z0XB 3O6AA 4MWFA 4KUCD 4MJIA 1MHPL 5E6ID 1DHKA 3BD5A 4DGYL 4PR5A 3GH7A 3D2UA 1E4XI 2DQDL 1CL7L 5HHOB 5K9KB 3BUIA 4TXEA 3VFOB 1P4IL 1RZJC 3NDZA 2H3NB 4JM2A 4N90E 2BVOB 2DQUL 1KYOJ 3H9YA 4HU8A 2EECA 2CMRH 3WH6A 3CCHB 3BOVA 4C55A 4LHUB 3ULUC 1JF6A 1PSKL 3QXUA 1XSJA 1A64A 2ZKHL 4HZLA 4LLYA 3A3HA 2AEPL 3MRMB 3OQ3B 6TAAA 3WDRA 2VWEE 5F6HJ 3U7YH 3LEYL 1BJMA 4M9OA 5E94B 1PG7W 3SO3B 4R8WL 4U1GC 1B1YA 2H1PL 2WKGA 1IQWH 4B7IA 3FRUA 2NXZC 3MSGA 2VDRL 2X1PA 4JKWA 1F11A 2ZCKL 2GTWB 5FGSA 5C9JB 5ILTH 4UFLA 1CZ8L 3D5HA 1NFDF 3WH9A 1BGXL 3OLGA 1DUYB 5ECUA 4Y1AA 5FYJU 2ADGA 4GBXC 1J8HA 2X09A 5HYQA 3VFGL 4BA0A 2A6IB 3INUL 3LN5B 1I3GL 3ZZ1A 1HILA 1P7HL 1EEYA 5E8NB 1JFQL 2XGBA 3LPOA 3C8DA 1TA3A 3FN0L 1GUVA 4L4PA 1QBBA 5CP3H 2NCMA 1J18A 4XP1H 3T4AA 5F1KC 4K3EL 5HDQH 5JQ6L 4FQPA 2OK0H 3TV8A 1NKOA 2FL5B 2DT1A 1HQRB 4JM4H 1H5VA 1K8DA 5HGHB 3BPOC 3BPNB 4ODWA 3HPJB 1AO7D 3QA3A 1S8DA 4OD2A 2BNUA 4TTDC 2Q86A 4DVBA 3M6DA 4AEHH 1P5VA 3IDMA 1VEMA 5FB8B 1CD8A 3T0BA 1DLFH 4JCMA 5D7IF 2N56A 3B8SA 3WEMA 1TFVA 4UNUA 4KJYB 3FONA 1BGGA 2MQCA 3VI4E 4BKLB 4LKXB 5AWNL 2J4WH 4RFOL 3P0YL 1MCRA 4PJEA 2MPAL 4HOZA 4WIQA 4JDZA 1NANH 1INDH 1LK3L 4BQCA 1E1EA 2Y5TA 1IKFH 4UILH 2VAAB 4XH2B 4Y16A 2VMFA 2RAMA 3CLEL 4W70A 5GPRA 3QDHA 3V0AC 5C0EA 1C93A 5MEOB 1J1XH 1L6ZA 1NGXB 3V4UH 5C07E 5AG8A 4X5LA 2HG5A 1UH3A 2LVEA 3BZFA 3TYFA 1XIWB 1CPUA 1K4DA 2ED7A 1LE5B 4KAQL 2W9LA 3OJDA 2JB6B 1T1WB 1V6UA 3ZSTA 2O5ZH 4ZUUA 5BVPL 1XCXA 4LLQB 1CGTA 5I15L 4LLUB 3OGOE 4NOFA 2D1ZA 3UR7A 1TQWA 2NY6C 5EBLB 3FAXA 5CEYA 1AHWA 1MXGA 3OGVA 2EAEA 3TNMA 1OB1A 2F58L 5CPSA 4YO0B 5GS3A 3WJJC 4GG6B 4MNJA 1H8SA 2HJKA 5F3BA 4HIHA 4RSVA 5HHNB 1MQKL 4PGBA 1IRAY 4UDUA 3RY6C 3ZJ8A 4C54A 5E24E 3LHPL 4JFDE 5AG9A 3RUGF 3V52L 5CILH 4M93B 3O6FA 3C2AH 5E5RB 3QBTB 1PZUB 3O6MH 1IGML 5EORL 4PRIA 3RNKB 4WV1B 5GRWA 1F90H 3FTGB 5GGSA 1BQHB 4DKFL 1DQMH 4XI5C 4CD5A 4ZG1A 4LDEB 2Q6WA 5FK9B 1CDGA 1MAML 3GIVB 1U8OA 2WPGA 1CLXA 3ALWA 4QXWA 2Z0BA 5HDRA 4FQQB 2A73A 2X4PA 4DGIH 1ZT1B 2JCCB 2QHAA 3SDXF 1EHLH 5EOCJ 5F6HI 3WQ6A 4QRRE 3EDEA 4LLWB 2NNAB 2MKLC 2VDLH 2HH0H 1FL3A 5TDPA 4O2EB 1U3YA 3HMWL 5C1MB 4Q9BA 1RJLA 2CPCA 4XVTL 2VC9A 5IW6A 2P24A 3MRKA 3ECBA 3C6LA 3L4VA 1FG2B 1MJ7H 1SY6L 2DQTL 3AIWA 5D9OA 4YUEH 3W25A 3MOAL 5L7XH 4DWSA 1VFAB 3OXRB 5T1DL 3IK2A 2NY4D 3U0PA 5CZXD 2H26B 3VDCA 1E73M 3ZO9A 3KWXA 1WBYA 2JTDA 1I75A 1OGBA 3C60C 4ODVL 3QHZH 5FO7B 3PZMA 1O7AA 1DCLA 1TCRA 2DYPA 1KB5L 4WI8A 4XCCH 4NI3A 4NN7B 1D5XA 5FHBH 3ARGA 1NGYA 1KIRB 4PJBB 4IDJL 5E8PB 1FCGA 2PTTA 2G60H 3GSRB 2G3MA 3IDXL 4KY1L 5HYJB 1M71A 4B16A 4R97C 2X41A 1YNKH 5A16A 4NQCE 4KQ4L 2CXKA 3MMEA 3AGVA 5C08D 2AK4D 2OTWB 3BZEB 5IEHB 4TNVK 1YA5A 3MLUL 4Z0BL 1LEIA 3SDAA 1Z9LA 3NOIA 1AQDA 4PGCB 1BQSA 3GHEL 4YHIB 5IWLA 2WHJA 4PJCB 2OWCA 4Z7UF 1LF1A 4POZD 2VXQL 1KLGB 1TE1A 1OGAB 4LNRA 1S7TB 1Q9LB 3ES6B 1NOUA 1CLOH 3GK8H 3QIWC 2NY1D 2P1YA 3AC0A 3KWWA 1RUQH 3ZE0F 3CH9A 2J1KA 4GW5A 4RZCB 4GRWB 1BQLH 4KRLB 3GGWB 2GVYA 1NAKL 3E2HC 5IJKA 3VXQB 3VXMA 1WC7B 3JWDL 3EAKA 1IAMA 3PQYB 5J6GA 2XWTB 1R34A 1OSZA 3V2AR 1AJ7L 1UEMA 5F88A 5C0AB 1JPGA 4JANA 3UDWC 4JVUA 3IU4H 5HGAA 5JW5B 3QEUA 1MWAH 4L4TE 4FK9A 3MO1A 1S78D 4FFYL 2CYGA 5ABFB 2E9BA 1FH8A 1E6ZA 4QCEA 3C8HA 5FUCE 3SKOA 2CIIB 3LCYA 3IDYB 1ONQB 3PP3H 5GSVB 4UQ9A 3O2LA 3RKDD 4Y4HC 1JUFA 3SE3C 3DBXA 5E9AA 1UQSA 5L8KB 3MNWB 4PJ9A 1EXUB 4GRMA 1KGWA 1BD2E 3JTSA 3SDYL 5MHSE 3W81A 5JW4R 3FN3A 4IRJA 1NARA 5DD6B 4PBWD 4NPYA 4M7ZB 4JPWL 4TRPL 4WUUD 5BO1L 3RVWC 1PBGA 4PMZA 4NJ9H 2YPKB 5L6YL 1QOKA 3SGKA 3CDGB 3FQUA 1MRCL 2YC1A 1UWXK 1EVTC 3E1F1 2AAAA 2AJVH 1C8QA 5EFIB 1UB6A 2AJSL 5A3HA 1K6QH 2W4XA 2EE9A 4ERSH 1U8LA 3EYOB 4JKPH 5IB3B 3O2DH 4G80B 1Q94A 2CBJA 4YHEA 5D96B 2ENSA 1CFNB 1RAMA 1ZT4A 4XPGH 1NBVL 1YYLL 4XAKE 2CJUH 5EUOA 1RZJH 2OMNA 3T0ED 4FLQA 1I3UA 4BJLA 1YN6B 3WNNA 1DN0A 1DBML 3LKRA 1YEFH 4NKIH 2Y36H 2KKQA 4RCAA 5BS0E 2D31A 1C12B 5EC2B 5CHNB 1EHXA 3ULUH 3MV7B 3GMNB 2KDGA 5EU6A 1JGDB 1P6FA 3KNBB 4G9FA 3VDHA 1BYDA 5BOZG 4P57B 4N42A 3FQRB 5EN2B 2VC2L 3ALPA 2R2BA 4L8BA 3ZQ9A 4H04A 4K7PX 4ZAKD 3PZTA 5DRNB 5A40E 1ZLUH 2ZZUT 3IJ9A 4PJGA 4Y19E 1TVHB 2H41A 2P8LA 1IARB 1ODZA 1RMFH 2FJGB 4KRTA 4NKOA 3TBSA 4OD3L 2DQFB 4M56A 1F02I 4Z95H 1CXIA 3O11A 2ZSWB 1A7BA 4OZ4A 3ZT7A 3NFSH 3IU3A 1FJ1B 1GHRA 4P3DB 1TZIB 3QZWB 4KH2A 4EI5A 3WENA 2XFYA 3DUSB 1R3HB 2GKIA 1J9CT 1I8LC 1HP5A 2L0DA 2GY7B 3QEQA 1M7DB 5C92A 2C4FU 4EJ1C 4PJIF 2I27N 5L2JA 2DSZA 5EBWB 5IOPA 4CVZA 1X6LA 5I74C 1TJIL 3LS5H 1IGYA 1FFRA 3O8XD 3SDCA 2VO5A 4MNQB 3L4TA 3NSXA 1GZPA 5I78A 3WIFB 2EDOA 5LBSL 3B5HA 5ESVA 5D2LA 3BCFA 2HFGL 5AEAA 2AV1A 4ZNCD 1HDMB 2CRIA 2CUHA 4B0MM 4W7WA 3HE6B 4TUOB 1QEWA 3WMBA 1IC1A 3TO4C 4Y0GA 2HFFA 4JKLA 1ZHLB 3QDAA 1XCWA 3BP6B 4LCIH 3LXAA 5F97E 3A47A 1NC2B 2XN0A 1G7QA 4R96A 3IFOA 3TWCL 5JOFB 3GMRB 2YFOA 4AZCB 1ZWIA 3ESVF 3PV6B 4OCYL 2EDYA 5IFHL 4YHLH 1ZJAA 3FY1A 4GRLD 4N68A 4BFEA 1A3HA 4YHNB 1X5KA 4Q6IA 1UEYA 5ALBH 2CKBA 4KTDL 1S7QA 1ZJBA 2D23A 1U8PA 2R4RH 1F6AA 4NZUL 1B3YA 2QMJA 3IJ8A 4KHTH 3UPRB 4H2CA 2V5TA 3QUYD 4XPHL 2O9TA 3KL5A 1I9IL 1LEGB 1GJUA 2J7CA 4MD5A 4LLAA 4Y5YC 1VERA 4ZD3L 5F7WC 2EXWC 5F7NC 3TBWA 4CN6A 2XSAA 1FIEA 1KIQB 5LAXB 5MEPA 1FZJB 4V1DD 4PS4L 3SCNA 1FO0B 2IF7A 3S88H 1QI2A 3DOSA 4F9JA 1UZ6E 4BA8A 1AGFB 5C3LD 5L88L 3EYSL 4K8RL 5T3XL 1UHVA 2BVYA 4ZPVA 4WWKA 4W4OA 3VXPB 3WXVH 3ZMRA 1VF8A 1JPFB 2HTKD 1LL4A 1T0NB 4IRSB 5DJZA 4OIAA 4YDIH 3OR6A 2VLRB 1CL7I 2C7FA 1N7ML 2HJLB 4XNYL 5KSBE 4WO4C 4U3HA 5HXMA 3THMH 4GAJL 1MREH