1CXIA

Wild-type cgtase from bacillus circulans strain 251 at 120 k and ph 7.55
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
686
structure length
686
Chain Sequence
APDTSVSNKQNFSTDVIYQIFTDRFSDGNPANNPTGAAFDGTCTNLRLYCGGDWQGIINKINDGYLTGMGVTAIWISQPVENIYSIINYSGVNNTAYHGYWARDFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASSDQPSFAENGRLYDNGTLLGGYTNDTQNLFHHNGGTDFSTTENGIYKNLYDLADLNHNNSTVDVYLKDAIKMWLDLGIDGIRMDAVKHMPFGWQKSFMAAVNNYKPVFTFGEWFLGVNEVSPENHKFANESGMSLLDFRFAQKVRQVFRDNTDNMYGLKAMLEGSAADYAQVDDQVTFIDNHDMERFHASNANRRKLEQALAFTLTSRGVPAIYYGTEQYMSGGTDPDNRARIPSFSTSTTAYQVIQKLAPLRKCNPAIAYGSTQERWINNDVLIYERKFGSNVAVVAVNRNLNAPASISGLVTSLPQGSYNDVLGGLLNGNTLSVGSGGAASNFTLAAGGTAVWQYTAATATPTIGHVGPMMAKPGVTITIDGRGFGSSKGTVYFGTTAVSGADITSWEDTQIKVKIPAVAGGNYNIKVANAAGTASNVYDNFEVLSGDQVSVRFVVNNATTALGQNVYLTGSVSELGNWDPAKAIGPMYNQVVYQYPNWYYDVSVPAGKTIEFKFLKKQGSTVTWEGGSNHTFTAPSSGTATINVNWQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic studies of the interaction of cyclodextrin glycosyltransferase from Bacillus circulans strain 251 with natural substrates and products.
pubmed doi rcsb
molecule tags Glycosyltransferase
molecule keywords CYCLODEXTRIN GLYCOSYLTRANSFERASE
total genus 231
structure length 686
sequence length 686
ec nomenclature ec 2.4.1.19: Cyclomaltodextrin glucanotransferase.
pdb deposition date 1995-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF00686 CBM_20 Starch binding domain
A PF01833 TIG IPT/TIG domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxiA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cxiA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1cxiA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1cxiA01
2EEBA 3O6MH 3IANA 4FG6C 4MZ2A 5H37H 4JIEA 1YYML 3OZPA 3QWOB 2AKRB 3FT4B 4GRWB 4PJ9D 1LGVA 3Q1SH 4XCFL 2NY6C 3GBMH 3MJ8B 1QR4A 1LEGA 1KXHA 4K71C 3WLWC 4OZHA 4YK4B 3SO3C 4Z76B 1HHJB 4JDVA 3NCMA 4HXAH 1WTLA 3WL9B 1YECL 2C3VB 3KNBA 2V5YA 3CVHL 1D5XA 3QZWB 4W5UA 4PD4J 2F1BA 4JFEB 5AYUH 1GC1L 2A3CA 4X7SL 3WIJA 1FIEA 4PB0L 1KYOJ 4EI5D 3UETA 4UILH 3RRQA 3G6AA 1HK6A 3BCDA 1CYGA 2AXGB 2V7HA 4BQ5A 2H1PL 5HHME 1T2JA 2EYRB 2R9HD 2E7BA 4M5YL 1BJ1J 2HN7B 5D1XC 2X44D 4A4AA 4BSWA 2Y1VA 1PQZA 2CLZB 3MRDA 1WZ1L 3DX3A 1S8DA 4EANA 2A0LC 1NC2B 4PREA 4K7FA 4Y8AA 1CICD 1L6XA 1JN6A 1I3RB 1A3RH 2R23A 3DYOA 3QXVA 4G6FD 1HILB 3IU4H 2DM3A 2HLFC 4NRSA 4UOJA 2QL1A 2JJSA 2XFXB 1S9YB 3QA3B 4JN2B 5IJKA 5IHUL 5JTWA 1SY6A 5EB8A 5K9QI 4QXGL 4UFKA 2E27H 2IEPA 2Y8KA 1BVKB 4APQA 1JRHL 1JPSH 4LLDB 4R0LB 5BVPH 1VBUA 2V9TA 4UIMA 2DI8A 2GKIA 2V5SA 4TX8A 3WF2A 3QT2A 4PY8I 2VT0A 1GC1C 4WV1B 1GIGL 3STLB 4Z78A 3CV5A 4EI5B 1UB6B 4OD1L 2GY5A 5IMLB 3KPSB 3HZ3A 4Q7NA 2R1YA 5BXPA 1JHKL 2MKLC 5GNZA 2ITDB 5D2LB 3VGDA 1FC2D 4ORGB 2Q7YA 2ESVD 1KBGL 4HZLA 1U8KA 4LF3A 1S7RA 5F9JB 4XRCA 1UA6L 5E8PB 4LCCB 3VWKC 4YHYB 4QRQB 4P4KB 5EA0H 4BH8B 3NCFB 3R06B 1NC2D 4YUEL 2DLFL 2HYMA 4M62L 3S37X 3N9GL 1HNFA 2B1HH 2Z93A 32C2A 4I9WE 4G9FD 1FVDA 5TPWL 1EJ6A 4AEHH 3WMBA 3U7AA 1N4XL 4HC1A 2VITB 3QO1A 4C4KT 1L9NA 5B4MC 1NMCB 5EZJB 1HXKA 1W9VA 3MV7D 3P0VL 1JNEA 3QOKA 1ZTXH 2ZX8A 5D71H 4PTVA 1CTNA 1WZAA 3FB8A 3AXLA 3TCXA 5JIIA 1ZLUK 2EH8L 2GTZB 3K80A 5KG9A 4M00A 4NO3A 1MFBH 3U6RB 3BAIA 2PB1A 1W2VA 1G9ML 3BWAB 3RHWF 4HJ0C 4B7IA 3QDJE 2JEQA 1UOKA 3TESA 3TJEH 1XGZA 3JTSA 1OLZA 1GGIH 3B9AA 4J3UA 4M1RA 4PJGE 4C55A 1E4MM 3MBED 2Z35A 4LPUA 4L29A 5CBAA 2WMPA 1WFNA 3IKKA 4KK6D 2LAAA 3KXFE 4NQEE 4BFBD 4ZENA 3HC4L 3GJFA 1FFNA 2YL6A 1DBKH 2D4FA 3BKCL 3GIVB 2JB5H 4MNMA 3UTZB 4OLEA 3CUHA 4FOMA 1MIEH 3UCQA 1ADQL 3UTOA 5J13B 1NP0A 3TNMB 2J7BA 3RWDA 3VXRB 1ONQB 5C6WH 2O5XL 5I1EL 4V2BA 1IJ9A 3O8XA 3VKKA 2G75B 3KPQA 3OKLA 3ZSSA 4HIHB 5BS0A 4D0BA 1QRNE 3D0LA 1MI5A 2XG5A 3G6AB 3T0AA 1OIMA 2EAEA 1ZGLB 5HYIA 4RBPK 3AIWA 2ARJQ 2UY6A 1J12A 4HOWA 3MC0A 1A1OB 4JR9L 2BNRA 4PRDA 5AAWA 1NGXB 2ZJSL 3FZUD 4D9RD 3C2AH 4MAYD 4UMGA 1KXVA 1JAKA 5CZKA 4QTIH 1AFVL 1YJDC 4XCFH 1ZA3B 3QEUB 3LPWA 3LN4A 3FO2A 4Z95H 3UTSB 5FO9B 5E8EB 5IFHH 1R7OA 5KVEH 2UYLB 3RZCB 1Q9LB 4QXTB 4MA8L 3OPZH 1S8DB 4F15C 4XB8A 2EEXA 3WUEA 4LCIL 1T2QH 2Z31B 1INEH 3V0WL 3QQ4A 1L7TL 2CJUL 3MODL 4GFTB 1LO5A 3U9UB 3RY4A 4LK4A 4UDTA 2ZCHH 3OX8A 2WZPD 2VXSH 4OSUL 3VJ6A 1JYVA 5JIWA 3L7FB 3AMLA 2LABA 3V7AE 4PRIB 2DDQH 4HK3J 1B0RA 3C8DA 3TYFA 4P2YA 1IAOA 4I8DA 2D1ZA 4DKAA 3RVXC 5K9JL 4OM0L 1A7PH 1UB6A 2DLHA 4ZE4A 1BVLB 1ZS8B 4X9YA 1U3JA 3K74B 3WS6A 1J5OH 3S34L 4GZIA 2YFOA 4QF1B 5I79A 1RUKL 2P5WB 1AY1H 2VXVH 4RGND 1QHOA 1MFVA 4RMSA 1AQKH 1VKXA 4YJZL 2DQGH 4Q9BA 1QLEL 1ZHBA 4M7JH 2J4WH 3BYTA 3I50L 1MJ7L 3H9ZA 1NFDE 4OLYL 2DL2A 3OKDB 2HTKC 2NW2A 1UQYA 1ED3A 5E9DA 1UKTA 3AC0A 1XIWA 2OMBA 3VFVB 1EO7A 5A6LA 3OKOB 3JSSA 3VSTA 1JMXA 3P0VH 5DVOA 1U92B 3FCTB 1EVUA 5EZJA 4AZ8A 4M8QB 4MLIA 5L8JB 3SUWA 2OL3H 2HAZA 3AREB 1PG7X 1MFEL 1XGTB 1IGMH 5JDSA 3B2VH 4XAKE 2JJTA 3ECBA 4YPJA 4NT6B 4GS7B 3MBEB 5I66B 1T0NB 1WDSA 4P7OA 1RJYA 1MWAH 1I1FA 2G2RB 3DV6A 5HYJE 4KRTA 1OP3H 3OB0K 2AV1A 3G5XA 4FQJL 2VR9A 2A6DA 5BV7B 1D5ZA 3CIQA 4PJDA 4XVTL 5M3WA 3RNQA 5CJQH 3B9VA 1QSFE 1QNPA 5IOPB 4NHUB 2BC4A 3CVHA 4MNGE 2WHMA 1P7HL 1UWTA 5IQ9B 4XXDA 3KPRA 1R5WA 3RQ3A 2EXOA 3PHQA 4LP5A 4I48B 4NKOA 1VSCA 3ES6B 2C1PA 4L4TD 1P6WA 3RL1B 3U0TB 1IE5A 3ARTA 1XH1A 1VGEH 3NCEB 3RWHB 4BF7A 5HHMD 4XBPA 1MH5A 1P6AB 1IGIL 1S5IH 2A6IB 2OYLA 1ZAGA 4A6YB 4NQCD 4HK0A 5IG7A 1ROWA 2AXFA 1NM9A 1J87A 3QB7C 3APGA 4P2OC 4K07A 4CJ1A 3T8XA 3RWDB 4KTYA 4GBXB 2CITA 2IJ0C 2WIIA 5FOOA 4FFZH 3ULVH 2ILLA 1SYSA 5ECJE 3DHJA 4QCIA 3CCHA 5DUBB 1AQDB 3WKNA 3ARRA 2DQFA 1SFSA 3D0LB 3SCPA 4JQVC 3IFPA 4MD0A 2VJXA 2Y7QA 4RX4A 5KTEH 5HHNA 3SGEH 3TV8A 5LBSL 3ARFB 4Y4FB 4OM1H 5F7FA 3RWEB 1GOGA 1U8HB 4I0CC 5DGQA 3STBA 4KI5E 2J7GA 4FXGB 1I4FA 3Q3GB 3QRGH 2BNRB 4NQCE 2YD7A 4P9HC 2I60L 2R1XA 2CHNA 4XNUL 1QWNA 1QSEE 1W0WB 5J3HC 4NI3A 3WXWL 1IL1B 1BOYA 4OKDA 2D0HA 1CENA 3VXQA 1RJLB 1CXHA 1WCQA 5HHMB 1CECA 4PMZA 2FLBT 3VILA 3BDXA 1U36A 1PG7H 1QFWI 1Y0LA 1OD9A 3IGUA 3TA9A 3U9UA 1NP2A 4ZOAA 4TOYH 3OX8B 5DS8A 4TUOA 5IF0A 1OGBA 1W1PA 1U8PA 4ZS7L 4LPXA 3TBWA 2X4OA 3U0PA 4G8IA 4NO0D 3GO1L 1V6YA 3CZSA 5BS0D 5TD4A 3EYVB 3P4MA 5H8DA 4JHAH 3IFLL 2LV4A 1BQLH 1JZ3A 1T1XA 1RZ8A 1CPUA 1ZBWA 1E4XL 1KPUA 1V02A 1N59A 3QNYB 4FZEH 4MS8C 1BSIA 3VRLE 5F88B 4LLUA 1ISZA 1U2HA 2DQDH 2WVVA 1VKXB 4MNQE 4M29A 2B5IC 3NAAH 1ZHBB 3QUYB 2JF6A 5DD5L 4GMSH 1I1WA 5D2LE 3V6ZA 3KLHC 3ZSTA 4AZ5A 3RA7L 3ULSA 4HMDA 4IJ3C 4NKDA 3SE8H 3VFVA 4MD5A 4LRNH 2ADFL 1HJSA 3BKMH 3ULVC 3O3DA 4PBGA 5EU6E 4PR5B 4PJCA 4OLUL 1IGYB 4M9OA 5BQ7B 4WO4B 3IDGA 3CXHJ 5ABGA 3UTTE 4HPOL 5E6IB 2EDTA 4KTDH 2E6PA 4NT6A 2KDGA 5C0JA 1HKLH 2G5BB 2G3JA 4L8DA 1YNKL 3ZDXE 1C5BL 1FBIH 4F9DA 3S5LB 1MPAL 4MXWL 2YD5A 4Y1AB 4HA4A 1UJ3B 1EEYA 2VQUA 3FQUB 5T5NF 4NZTL 2A6DB 4GXVH 4RISH 4HAFA 2OCFD 4GW4A 3P30H 1VFAA 2MCG1 3CFDB 4TQEL 1JV5B 1P7KB 1YEFL 2E9WA 4QAWA 2Y25A 2VE6B 4ZO9A 5IEHB 4KU1A 5IBTH 5BW7C 3P4NB 4O4YL 2X2IA 1QWUA 4I48A 3U30B 1ZK9A 4UT7L 5JO5B 3RL1A 3U0TA 2J3SA 4FABL 3E6HA 1R75A 1IC4H 2XGBA 1EXUB 1A7NH 5IB1B 3A6OA 3BVUA 4H1LG 4AQ1B 1QUNA 1MFNA 5IG7B 2AXFB 3UTTD 1KTBA 1JGDA 4AC1X 4FFZL 3ULVL 2EDRA 4M43L 4YDVA 3FRPA 3I6GA 2ZCLH 4HIEB 2NX5E 3NN8A 1KT2B 2EKSB 3BI9X 1HKLL 4GSDH 4QCIB 5EBAA 3VCLA 2ZUUA 5C3TA 4MD0B 1FCCA 2P5ED 4PB9L 3VG9B 5DWUH 4Y4FA 2BOBB 3FKUS 1MI5D 3T77B 2CPUA 4JHOA 5I1IH 1SMAA 3HZVA 4Q0XH 4QDMA 1C5DA 4FXGA 4R97C 1WAWA 3LPGA 1ITXA 4MA3B 4X0NA 3G6JA 4HUKB 5I1JH 3VXSB 3UPRA 1AR1C 4FLRA 1I1AC 3H2WA 3UTPD 4IUGA 2A1WL 3D5HA 1JP5A 4MJ6B 1UFUA 2VQ1B 4HBCH 3U7WL 1AR2A 4UNIA 4DGVL 2FZ3B 4F58H 4I5BA 4ONOA 3ESUF 3GIZH 3SDCA 1A2YB 3CFCH 5A6KA 1DANU 3VGAB 5GGUA 1JFQH 5CPSA 1FA2A 1Y0LB 3H3PL 4OAWB 1BPLB 1EEQA 1L9MA 4OFKA 1U91A 5KVDH 2XIBA 3U4EA 4TUOB 4LFHD 4ZPTB 5IF0B 3F5JA 4LARL 3WBAA 1T89C 1CTOA 4PRPA 4LNRB 3UP1A 4KY1H 4X8JB 5B8CB 1F42A 5EFIB 3BAJA 2ZPKL 4UFJA 4TOQA 3EJJX 4XB3A 3EYVA 5I73C 1LNUA 1E6PA 3X13A 5CBEB 1OF2A 2FR4B 4UTAH 1EJOL 4D94A 5D1QD 4ERSL 4WI5A 1E5JA 1HKJA 4ONGH 1BYCA 2DTSA 4I1NB 5DMIH 2E7HA 4M7LL 2GEEA 3SEPA 3D48R 4K7PX 2WVVB 2EYSA 3BN9D 2EDFA 1IEAA 3HG3A 15C8L 1BQSA 3PV6A 2I9TB 1E4KA 4DKEH 1ZGLP 2QV4A 4JFXB 5C0IA 1OTUC 4PB0H 1PZ2A 4OBRA 1KJ2H 1QEWA 5I1HL 2EC9T 4X5XA 5BRZD 4GAJH 5MP6H 3LVEA 1G9MH 1QNOA 2DJUA 3FAWA 3FQNA 2HJKB 3P40A 1IGYA 5EIIA 1JNHA 4WO4A 2JK5B 1IAIL 5C0CE 4ZNEE 3C2AL 3HAEH 4O5LH 2HVKA 5D71L 1BGXH 2WMIA 5DJZA 3K4ZA 1ZHLB 1GORA 1ZBCA 1R3KA 1YMMD 2IAMA 5HPMB 2BHYA 3CFCL 5FUCE 3N18A 1JGLH 1TQBB 1YZZA 3OBAA 3P9MA 1QZ1A 5CD5C 3WFCL 3I02A 4X0VA 4ODHH 4RQQB 4PCSA 4Y1AA 1UJ3A 4NRYA 3B2VL 2OTWA 4OFIA 5FUCC 4C57C 3ULUE 4CN4A 1VFUA 3MUGB 4GW4B 1FNEA 5TE6L 1XGYL 2Q8AL 1S9VA 1I75A 1NCWL 3C6LB 3O41A 1T22B 5HVWA 3WH8A 5BO1L 2FBJL 5BOZG 3ULVF 3QP3A 1WAAA 2EEDA 5BZDB 3FTGA 1MREH 3L3GA 1BZ9B 3TA3B 2XWJB 2D24A 1IRAY 3QIUB 4LHUB 5HYEA 4ML4A 1AVAA 2FATH 3O2LA 5CGTA 2VX5A 3HUJB 3I6GB 4GSDL 4DOHB 2XXCB 1RZGB 3B5TA 3V9FA 4YFLI 5DQ9B 2YRPA 1U0QA 1JI2A 1ZGLM 1IC5H 3VCLB 4EBQH 4AL8H 1XSIA 1RZJH 1GOKA 4HQQL 1ZWIA 4MQXC 1KWKA 2BOBA 3T77A 5DJ2B 5CD3B 5FEBA 1C5DB 2W07A 4GXUM 3REWA 4MA1B 5EU3A 4P5KA 3BSZL 5TQ2H 3IDUA 5IHSA 1QRNA 3VW3L 4JHAL 5ICZB 4YHZL 1T03L 5CEZE 3T4AA 4LQFH 4NSKB 1KJMA 3Q1SL 4HUUB 4KRPC 4EUPG 3LDBC 5T1LD 3OB8A 4IMLA 4PJ5E 1OB0A 3SDCB 4PD4K 1DBJH 4Q22A 1FNHA 5D7SH 3OJ2C 3MLUH 4GMTL 1UASA 4AEIH 1L4IA 2AQ2A 3MRMA 4HKZB 4M6OH 4PS4L 5A2AA 4PJ8D 1FO0A 5DJ8A 5A2KH 2QADC 3L7EA 5SV4A 1MELA 1QBBA 4P4RB 3VD3A 5D9SA 3U4EB 3DX6B 3UBXI 3IDMA 4URTB 1Q8MA 2GI7A 3V8CA 3B83A 4A3HA 5I23A 5EFIA 1J1OH 3V0VB 4W93A 1KCUH 4OLUH 2V3EA 1HHGA 1BOGB 2WWMC 3HN3A 4NCDA 3WQWA 3KJ4B 2JIXA 1E27A 2EYTB 5KSBA 1KG0A 4YH6A 2KQNA 2VZUA 3S98A 2H8PA 2FGLA 1MFAH 4PEEA 3ZR5A 2BS9A 1UM5H 3HUJF 1NQBA 3JWNC 3OSKA 1U3ZA 4L4VA 1B3WA 3FONA 1GQIA 5TFSL 2A83A 3TZVA 2K1MA 6TAAA 4S3JA 2EO7A 3ALWA 5A6BA 3VH8G 3GI9H 5T3ZD 2AABH 2OP4H 4QY8A 4V2CB 3MUIA 2DIEA 2A3EA 2Z4QA 1L0QA 1C08B 4JL1A 3U5YA 3MUZ1 4R4BB 4WFHD 5CJ8A 3NTCH 4HWBH 1TVDA 3TJHC 3SDCD 4LLWA 2W92A 1HHHB 2W0LA 3LMYA 3PHOB 4KMTH 1VB9A 2E6JA 1N64L 2R4RL 2X41A 4OLZH 3T1FB 2ICWB 3BP7B 4APQC 4PRNA 3O3BA 3MCG1 2EABA 5EIIB 4ELMB 1NFDA 4FABH 1M71B 3CMGA 2I25N 7FABH 3BH9A 4LCWE 1F4XL 5C2BH 4L8SA 1BYAA 5F7HA 3L3HA 5E8DH 3TBVA 2PYEB 5HVFB 1G84A 3VINA 5L7XH 1K2DA 3A67L 1OSZA 4K2UL 2YZ1A 2DDXA 1UACL 4W4OA 5FOBB 4YE4L 1CFVL 2E9LA 2XSAA 3QYCA 1GVIA 2DM2A 2J75A 4NXSA 1FG9C 3QDMB 1I8LA 3QULA 3S5LG 1KIRA 4HOXA 3TTQA 4R8WH 3PWUB 2R69L 1M05A 4H20L 3UJIH 2M26A 3C6LA 5T33H 1J1XL 4JFZH 2ZUXA 3QUMB 3SE9H 4QRPD 2NY1C 4ZOCA 3CHEA 2L7UA 4B3LA 4P2RE 3T3MF 3GSXA 1OAXL 3VGHA 1KELH 3W25A 4ODUB 4NQCB 2GW5A 3CFKB 2H6PB 3FZUC 1BGGA 1B4JH 4LQ1A 2WM0A 4M3JA 1KJ2A 2IBZX 4JCMA 5J56B 3FB5B 3BESR 3VO0A 2XWJA 4LL9A 2WCGA 1I85A 3FFDB 1V0NA 2XTJB 3FT2B 4Q9RL 3RPMA 4NN6B 1T5WA 2MMXA 3V52L 2DT0A 4P3DA 1LO3H 4WUUB 5D7IA 2YPKA 1CDGA 3ZYOA 3WFCH 4TVPL 1NFIB 4MA7H 1MQRA 1DEEA 2H2SD 4FXLA 4LDLB 4GAYA 2NSXA 5M5DA 3BEWB 4FLOA 2J74A 5E95B 4Y16C 4PTWA 4LSRL 4HEPG 1L7IH 1ZWIB 1CFVH 1X5XA 3AGVA 2I5YL 2CLVA 3OR7B 1U30A 4HDIA 4XC3H 1JPSL 3WBDA 4TVCA 1NSNH 3MOAH 1XH3A 4U1GC 3J7HA 3C2SA 3RY5A 3UMTA 1FO0L 1V7MH 2XY1A 4RA0C 3IDNB 1BQCA 4IRSB 2P8PB 3N11A 3AS2A 3WIIH 4YEFA 3TVMC 2AI0L 1B30A 3BKJL 4EK7A 2MNUA 4PGEB 4WFFD 2Z8SA 1B3XA 1NMAH 1E1FA 1ADQH 1XSJA 1AXTH 1YN7B 3WQ4A 4XWOD 5TDOB 3EBVA 1MCPH 3CX5K 2BK8A 1UWIA 5D93C 2VDMH 4M1DL 5CKGA 1CE6B 4HZAA 4FZEL 2G9HB 4CU7A 4XAKD 1IGFH 4PRPE 1SEBB 2ORBH 2HFEB 1W9XA 2DT2A 5E1AA 3GUTB 4KK9C 1NAMH 3QI9A 2ZXAA 1T04B 5GGSA 4O9HH 2NZIA 2CKBA 5ITBL 1UM5L 3CH1A 1ODAA 3OHXA 5DHVB 5CEYB 2CHOA 3UTSE 2VDOH 3S35L 4NXKA 3BAXA 1QP1A 2BSRB 1WT5C 5FYJE 3ZDZE 4LOUC 4OUOA 4RGNE 4EDXB 3EHBD 1CFQA 4OV5A 5JOEA 3TZVB 1LP9E 1PKQA 3WUFA 1LL7A 5T1DL 5BMFH 1G0YR 1P1ZA 1XF3B 1XIWD 4DGYH 1C08A 3X3FH 4R4BA 1P69B 4LLWB 1G9HA 1J05A 1QPKA 3WN5C 2ZSVA 3FB7B 3W0WE 4CL7A 4HV8A 5E2UH 4QHNB 5DVNA 3J8F7 4NPYA 5DO8A 3LH2L 4Q2ZB 3MJ7A 3BUYB 3QHOA 4NUJB 2KZWA 2CDGA 1NAML 2EECA 3JXAA 1WE5A 4WENB 3NACL 4JAMA 3H42H 2VCAA 4NN5C 1UZ6E 3IJ8A 4QOKB 4ZXLA 3LRSA 4RGOH 3VRJA 4MXWH 5MI0C 1J9CT 2DQJL 2E8ZA 3BUQA 3S4SG 3QULB 4GAGL 1UKPA 1DCLA 4Z0XA 3QR2A 3ARED 2A3BA 1D9KA 3VMOA 5E9AA 1GZPA 5C07E 1NC4A 2EACA 1GOHA 2R2HA 5J8OA 5L9DH 4UNTA 1ACYH 2Q3ZA 4ODUA 1N64H 2FHFA 5HGBB 3VG9C 4OCWL 3W4RA 4OF6A 2FB4H 4Y5VA 3S3PA 2O93L 3HC0A 4WEBL 4LHQB 5HI3C 5KW9L 1KJ2B 2HWZH 2YKLH 5A6MA 1CVRA 1HN1A 4POZC 1YEKL 1KB5A 1RSFA 1U3YA 2P44B 4LSPL 5LWYH 4NM4L 5T3XL 3TGXA 3FFCA 1EQCA 3K2UH 5D1ZD 2Z9TA 4WUUA 3BO8B 1NFIA 3MLSH 5HHPB 1MWAL 3PWNB 1S7WA 3BEWA 1G6RB 5K59E 3AB0C 5FYKD 1PEZA 3FFCE 5JNYB 1INDL 1NOWA 3PP4L 4XX1E 3MRCB 2F61A 4DO5A 2X1WL 4OZHF 5I5RA 3B9KB 3VXUD 2FCBA 5JHDA 5DEGB 4FTVD 1H0DA 1IV8A 5D7JA 1IC1A 3L6FB 3QH3A 3SOBH 1QO3B 1YUHA 5E2TH 5GZNC 2YD3A 5EU4A 4U0QB 5D2NB 3BHBB 4YN5A 5KSUB 1KJVB 1PZ5A 5L9DL 1DZBA 4IRSA 2OWXA 5JPMB 1FP9A 4HH8A 3N9KA 1M1SA 5EUOE 3FOMB 3PGCA 4G42B 5LG1A 3QXTA 1MFBL 4LGSB 1FYTD 2ATKA 3DRQA 3IJ7A 1MFDL 4TQEH 1JNLH 2XA8H 4JY4A 3H0TB 2Y4SA 2CETA 5FGSA 4L3CA 4K7PL 3D50A 3MRJB 3SCWA 1A7QH 4OZ4A 3A21A 3ILPA 4TUJA 2DYPA 4QCEA 5IHZA 3TPUA 3N17A 2WMHA 1T04A 1RU9H 3BXNB 1NCDL 4EUPA 4K3EL 4X80H 4KKLD 2R2BA 1W1YA 1LK2B 5EZOH 4GKOA 3HC4H 3SKMB 5BXTA 3QUYC 4HWZB 4NN5B 3ECQA 2B5IB 4D1JA 1FAKT 3ZHLA 2CK0H 2R1WB 4AY1A 1CFQB 2Y07L 4MQ7B 1FYTE 3DYPA 4TUKL 3STZB 1H2JA 3SJVD 3ARYA 4I4WB 4MS8D 4IEFB 1FH8A 4LSTL 2XZCL 2EPNA 1WCBA 4AMKH 3EO9L 4LIQH 4MADA 4NC0B 1PX8A 1CLOH 3EJSA 2ICEB 3C5JB 1SJHB 4FZ8H 4JFDB 1KULA 3JWDL 1BX2B 1X4XA 4ONFH 3CXHK 1A6PA 1IGTA 4L8SC 4LCUA 3OF6A 4QRPA 5E2JA 4CVXB 5ECUA 2RHEA 4LFHG 3MJ7B 2DWDB 5DRNA 4AENA 1CDJA 4PMQA 5LGJA 5B22A 4Z7VB 3P0YH 3BYYA 4N8CH 2OX5A 5I17B 5CAYB 1XYZA 3BUPA 1RZJC 4JY5L 2DIBA 4XXCC 5F6IB 4F8TA 1HOCB 1G7IB 3RP1A 1QACA 2BNUA 4DOHE 1QSED 3LEXA 1HKKA 1U33A 1JNNL 1LEGB 3FO1B 2IFGA 4OIIH 1HYRC 3CU1A 5BJTB 3PN8A 4TSAH 4PS4H 4RE4A 3EYOA 2DH2A 1QA9B 1UEMA 5ESAA 3PTKA 2HFGH 4IDJL 4LAJH 4U2ZA 5DHYA 1BM3L 5SX5K 4JG1H 4QCFA 1A6VH 5CUSH 4NQEB 4QRSB 4RMTA 3SDXE 1DUZA 5ALBL 5JOPD 5L2KA 2FDMA 2ZWYA 4K55A 2CDFA 3LMJH 3GXIA 1J8KA 3BQUA 1OCWH 2WUBH 4MX7A 2DSUA 4JFPA 4LRNL 2F1AA 3S4SB 4OF7A 4Y5VB 4NN6C 4EOWL 4M93C 4XVJH 3MV8D 1NOUA 1ZVYA 3HG2A 2Y6SD 5GGQL 2B1HL 3DROB 4RAUA 4XT1C 3F5LA 1RUPH 1W9PA 2GDUA 1BREA 3QJHA 5I0ZA 5LQBL 4O58H 5C6TL 4U1GB 4P2OB 3U1SH 4QRTA 1DQLH 1CZ8H 4H8WH 3O2WH 5DHVH 3B2UC 3IF1A 5GNYA 1J0HA 4BSWB 1ZJBA 4NO2A 4U0RB 1I9EA 4Q9RH 4UQDA 1R6VA 3O6FD 1T6WA 4A6YL 3QIWA 3MRCA 4I18C 3UCRA 1OIFA 1K85A 3VA6A 4MA8H 5DK2A 2BY1A 2ADJB 2EDHA 5E4EB 1RPKA 1UA3A 2VWEE 1QLFA 4HTYA 5F44A 1E6QM 3MZTA 1YUHB 2B4CL 3FN0H 2E9MA 5F3BB 5EU4B 3NFNA 4Y4FD 1J0KA 3QNXA 4GKZB 3SKNB 4WRLA 4O2EA 3WSQH 4GLRH 2OJEA 4AW7A 5T1KB 1AKJD 4JB9H 4JFVA 5BO1H 4LCWD 4YHIB 4U6HA 2MPAH 4HZ7A 4S3KA 4UILL 5I1IL 4HWEL 4TSCL 3L3KB 5I75B 5IDIA 1TPXC 5CHNB 1DBAH 2M1KA 2PETA 4X4ME 1I9JL 1YNTA 3LHPL 1RVFH 3WELA 5IMLA 1KBGH 2PXYA 2E7LA 3EDKA 3EHBC 1RY7B 4PBWD 4ZFOB 1SY6H 1IT0A 1AO7D 2FGWL 4F9PC 2H9GA 2NT1A 3MRJA 1H3TA 3PL6B 2WBJC 4OFYA 2LVCA 2GJ6D 4AMCA 3TPUB 2VXQL 2YS4A 1DSFH 3KZSA 3O6FB 4BH8A 3LV3B 2W65A 3TN0C 2R2BB 2XFFA 2KZ1B 2V5CA 4XP9L 4MAUL 1NCBH 3GSNH 2IBBA 3PTQA 1ORSA 3GMQA 3AIVA 4X5WA 1CGWA 3TT1H 3U0WH 2XA3A 1OAZL 2JE8A 4MQ7A 4PLKD 2NZ9C 4F57H 2R4SL 2J7LA 4NGHL 2DWEA 1S46A 4PJ8A 3LZFH 1AKJB 1T5XB 2PWDA 2CUHA 4S1RH 1QI5A 3TIDB 5AG9A 3OPZL 2BNQD 4UBDC 3F5WB 3C5JA 5HHOA 2VH5H 4JFDA 4YC2B 1BMGA 4LKCB 2A73A 3HFMH 4M4RA 2VLKB 1BX2A 2QQKH 5JXAL 2FJHB 4CVXA 1A4KA 4AZ7A 4HIIB 2ZXBA 3NCCB 1XF2A 1UG9A 3WHE1 3DMMD 3WS3A 4JHWH 2DWDA 2VLJD 2XRAH 1F90H 4Y5YB 4P8UA 1G7PB 3BIKA 4Z7VA 1DWGM 5HPCA 4KQ3L 2X4SA 5ABHA 4LDEB 3GXMA 1VGKB 4HW6A 4R4FH 5LCVH 4J1UB 4P2QB 5HGDA 4OI8A 3HAEA 1KCVL 4G7YH 5DD6A 4Q7DA 3MLSL 1PAMA 4M6OL 5C0RH 1Z9LA 2RR3A 4Q6IC 1R24A 4YFDB 3O2DH 3UTZA 2EIZA 4J28A 3EYOB 5ESAB 2YA2A 1IM9D 1EO8L 5DHYB 3BZFA 1A7OL 4AIZB 4Z8FL 2R39A 3WY4A 1TPXB 3MSGA 1PBGA 4R7DB 3W81A 4NRRA 4OCSH 3RFZC 5EUOB 1K8IB 3ILQD 3TN0A 2VLLA 3RKPA 2G75A 5IQ7L 3VIJA 1UXWB 4WVRA 5D72H 3RU8H 4JFPB 1W9BM 5D7JD 1RK1A 3QEQE 2V6HA 4MAUH 3SCVA 5I1JL 3L2MA 5J1AB 3QXDB 1KGUA 4X7EC 2EEAA 5A1AA 3OKMA 5I8OL 2WP3O 1HZHH 3DO3A 2ZJSH 1N26A 4JZJA 4OKVA 5DSCA 1ZGLA 1TJHL 5HHQB 1CZ8L 4H8WL 5TE4L 3DO7B 5E4EC 5DMKA 2R56L 4PRDB 2PKDA 4P2OA 4JQIL 1T66C 3V4PL 4CCDA 4MXVE 5MEQA 3INUL 5LCVL 4PUEA 1W3LA 1ZA3A 3QEUA 4KJPD 2C4XA 3MFGB 3A67H 3IK2A 3SUTA 1KCVH 2UYLA 4P2QD 1Q9LA 4QXTA 4R26H 3RWFB 5DDHA 4PJ5B 3TCLB 1YN6A 3M7SA 1LD9A 3HR6A 3V0AC 2YFNA 3QNZB 1W72L 1CCZA 5HJ3B 3EJRA 3OGOE 1M7IA 1VADB 5DLMH 1CL7L 3RDTA 2AJXH 4MD4A 4Z2GA 3E2HB 3GBEA 4UDTB 2GJPA 4O2EB 4ZAKD 2PW1B 1LEKB 3W9EA 1KV3A 1CG9A 4KRNA 5E8NB 1N6QH 3AROA 4GLRI 3TYFB 1UD6A 1AHWC 2EADA 4JM4L 1ZLSL 3PF2A 5E03A 5D7KE 1BVLA 1ZS8A 3CHCA 43CAB 3WNMA 4YHZH 5A8OA 3EOTL 2EH7H 2A77L 3QQ9C 4ZFOA 1H4PA 4J4PD 1INQA 1E56A 4I2XE 5AYBA 2DQGL 5FDYA 4UQ3B 3LKSA 3LN5A 4JFED 4OJYA 2DMBA 4C56B 3QG7L 2JIEA 2PCPA 1WBYA 5K9QG 3GMPA 4XP9H 2ESVE 4NQVB 1K9FA 3HMXL 1IGJA 3VFTA 4ZXBA 3O3UN 1NL0H 4DZBA 2V5RA 4KDTA 1G6RH 2E27L 2BNQB 1ED3B 3TIEA 4Z18A 4P4KC 35C8L 3AHZA 1BD2D 5I0DA 4LCCC 3VWKB 3OKOA 1F13A 5ACLA 3GMNA 3MLYH 4K94L 1WV7T 5A8MA 1F58H 1VCAA 2AEWA 1MRFL 4M8QA 1A6ZB 1BFTA 5IKCB 3CUGA 4RAVB 4EN3D 2N7AA 4Z2JA 4OF8A 4TSAL 3QOMA 3MNWA 3SKOA 5A3HA 4L9LA 5EO1B 5I66A 2J7DA 4CBPA 2HT2D 3KHOA 4QNPE 4GRWE 3OKNB 1ZANH 1NCWH 3DV6B 4PJIE 2W61A 5GJSH 2AV1B 1MCLA 2VLKA 3G5XB 3OAYK 3VIGA 5FM4A 5JORB 1SQ2N 4S1QL 4XMPL 3EDFA 3GSVB 1UM4L 3CVIL 5I8EB 2D7PA 4Y4KB 1FL5B 3L3OA 4NHUA 1UR0A 3V2AR 2ZE0A 4R7NB 2F54D 3FO0H 1NGPL 2CPCA 4NZUH 1ACYL 1V5JA 4LPTA 5LXGH 5HGDB 4M8VA 5SX4I 1DQQB 1SHMA 1A3LH 4Y1AE 5D1ZC 4G80B 3QRFM 5A3IC 4KHXL 5E0FA 5K93A 2BXZA 1PVHA 4N0RA 2X4RB 2C3HA 4IDLA 5HYQA 1UA7A 2VDRH 2XT1B 4Y2DA 2FDBP 2O5YL 3BZFB 4AIZA 4RMQA 4K94C 3M8OL 4Z7WF 1B4RA 3FJTA 4DEPC 4Y89A 2JLLA 1TZGL 2J88L 1UXWA 5AAMA 3BVNB 2QHLA 1MHEB 1AQDA 5HYFA 3MRIA 3PDDA 4JRYA 3LKPA 3HNSL 4U1NB 3WHXB 1XGRB 4XZBA 1F4YL 1NWTA 3ELAT 4G5ZH 4HK3N 4OLWL 3RWEA 3SCRA 3OZ9H 5DWUL 1E1EA 4RFNB 3G5VB 3LKRA 4AMXA 5HHQA 1ACZA 1Z32X 1I4FB 3Q3GA 3DMMA 1E0WA 1KCSL 2XWTA 2OK0L 1BYDA 3QCVH 3BUTA 3B9KD 2R1XB 2XTLA 1WBZB 5K33A 1W0WA 1ZVSB 2OSYA 2WUCH 1WITA 3RWFA 3RX7A 2NY6B 3ZTNL 1XGQB 4Q6IA 3OAZH 1CLVA 4OFPA 2YEZB 1HVXA 2IQ9H 5HJ3A 3HE7A 5CJOH 1AMYA 1BIIA 3IDYB 1FJ1B 4HGWA 3RDTB 3GYCA 2D7NA 3M1BB 2AK4B 3F6LA 1A3HA 4PJBA 2PW1A 5EU7C 2QR0B 3O11B 3KDMB 1LEKA 1C8QA 5DVMA 5A94A 1NGPH 3U0PB 4G8IB 1PKOA 1IKNA 4RFNC 3RTQB 2XZAL 5L8KB 3AU1A 4GRLB 1WJ3A 2EIDA 5D1ZA 1DJSA 4POYA 3S5ZA 2H32H 2AQ1A 2BSSA 3BRGC 3MPCA 3DSFH 4CN1A 3FW6A 2I27N 43CAA 4BK4A 3O4LD 2C4FT 1T1XB 1I8LC 2D31A 4Z95L 3BP6A 4F7MA 1N59B 2PYFB 3QNYA 1UWEH 4OIIL 1I8MB 2VAJA 3N12A 1INQB 5MI0B 4CMMB 4E5XA 1E0XA 1UH2A 4ERSH 2W62A 2VLRD 4C56A 4TPRL 3UDWC 4AD0A 3QEHB 4UQ2A 2VZVA 4LMQI 5I19L 4I2XB 3V6ZB 4ZSOA 1KTRL 1KENH 3NABL 2VDKH 4M7ZB 2FJGA 5IBLC 5BZWB 3RIAF 2NNAA 4K94H 4PJEA 2GJRA 2FYVA 1QVOB 4MDIA 3G6JF 4CN6A 1VFMA 3C5SB 3QR3A 1G94A 2NQCA 5EC2B 3SURA 4WO4C 2JELL 3PGFH 4GOSA 3SQOH 4B3KA 3IDGB 4LGXA 1NBQA 1MIEL 3C5ZB 3WDJA 2NXZD 3CUPB 3U1SL 3TVMD 4LSTH 1VJZA 2RFXA 3PTMA 3R1GH 4O5LL 4IRZH 2G5BA 1HVQA 2G41A 3TZVC 3OKNA 3S5LA 3UG3A 3DX2A 1BFVH 1EEYB 3P11H 3Q6FA 3G9AB 5D72L 1VFAB 3RVWC 3BX7C 1IAIM 1VPOL 4TRPL 4R3SB 1UZ8B 1TQSA 1MWAA 4W6WB 4Y16D 1XYFA 5GGVL 4QRRB 1JDCA 3W2DL 3MI6A 5F7DB 1MCNA 1HT6A 1ZT7B 2AJ3A 3A22A 2W9DH 1MSPA 1LP9B 2VDPL 1YPZB 3PZIA 5IVNA 5F96L 3TT3H 3KVQA 1QFPA 1HH9A 5FGCE 3FN9A 1WTGT 3E6HB 2NY2B 4UZUA 3S2CA 4WI9A 2MJWA 4RL3A 1JWMA 4KK5C 4G6FB 2VABA 4N90D 4MAYC 3EO1B 3WD1A 2X4RA 5C08B 3V0WH 1MAML 3GRWL 3SHSA 4KV5E 4ODWA 2FGWH 4HIEA 5ALBH 1KT2A 2EKSA 4C7DA 3TVMB 4LEOA 3QHFL 3D18B 5ACZA 5DI8A 1HXMB 2GSGA 2XQBH 3MGOA 4KQ4L 4Y19B 4PJXA 4PGDB 5FKAB 4E41D 3CH8A 3JV4B 3LKPB 4U1NA 4H2CA 4LASL 3ARSA 1XV8A 3I9GH 3BXWA 5L2KE 5D1XA 4D9LH 2NY6D 5I8CB 4NZJA 4DVBB 3LKRB 1NJ9A 4D3CH 2YBTA 4MA3A 1CFTA 4M1GH 4D8PA 3P0YL 3WV0A 1CD1B 3X12A 1BQLL 4Y16B 1CGYA 2R4SH 4MJ6A 1Z3GL 4JVUA 2QLVB 3A23A 1UADC 3BW9B 5ID1A 4UFHA 3MGTB 2HRPH 3NSMA 3VM5A 3KPLA 4PJ7E 1G7MA 3HI6H 3O3EB 2A74A 2WHLA 3Q2CA 1AJ7L 1BIIB 3RX5A 3E6FB 3HC3L 2YD8A 4OLYH 1U91B 4L8CB 3M1BA 1JD9A 1Q94A 1OW0A 4JHBA 4U1KB 1G7QB 3V6FB 2QR0A 3O11A 4LCYA 1HH6B 1FZMB 4PP1C 4PRPB 3RGVA 1VACB 2ZUNA 3LEYH 3T2PA 3WFHB 2Z1SA 1LJYA 3EYUH 1OTTD 3OGCA 5CIPA 5EFDA 3D85A 1JVKA 2UUDH 2P8MB 3X13B 4NN7C 3QUMH 4XPAL 2D31B 5FO7A 3BP6B 3KLDA 4DN4L 1WSST 1CDYA 4WTZG 5KVGL 1FG2A 1K4DB 1X6LA 2DKUA 1HWWA 1LWJA 1JFXA 5HI4D 4E5XB 1JUFA 1XD0A 4MNLA 1OAYH 5BXFA 4KUZH 2MQCA 1KBKA 3VMNA 5HYJB 2IQ9L 5BV7C 4YGVB 4DO6A 4A6YH 3S96A 2FECL 4DM1A 4ZSOB 1IGFL 4UV4H 4X98A 3POHA 1FFOB 4YLQT 1T1YB 2XGIA 4KJPC 1LG1A 5DMGC 3DTXB 4BELD 4N5EC 2HJKA 3WFBL 1J8HA 3B6SA 4GW1A 5IR1A 2JK5A 2W4XA 2NTFA 1EO5A 5I1CH 1TVHA 4FNPA 1EDTA 2EO9A 4QTIL 3P4OB 4ZG1A 3C8KB 5CSGA 3F65A 2VXUH 3QHTC 5FYJL 1R3KB 3CGTA 5FM8A 4YAQA 4JDTH 3VGFA 1H09A 4I0PB 4QLLA 1R87A 4NRYB 3Q6FB 2J78A 4P5MA 3CPLB 4I3GA 4C7GA 2QQKL 2X70A 1FIGH 2YK1H 3H9HA 3TFKD 2XM2A 3CZ8A 2O26U 3PZUA 1TNNA 2V2XB 2J7CA 4FQ2H 2CBVA 4KC3B 2DDQL 5FK9A 4QRRA 4JFTA 3WJJA 5F7DA 1RFDL 3SGJC 3MNVB 3MV9E 1UG6A 4I3RL 2UY4A 3EYQD 2FHBA 3O45A 3QHZL 4JM4H 1CIDA 3ZE2F 2XVGA 5JW5A 4E41B 3FTGB 3LD8B 3QWQB 3NCBB 5EH1A 3BVTA 3L3GB 3WUBA 4MPKA 3RVWD 1RULL 3GI9L 4ODWB 2OTUB 4KRMB 1JK8B 1S7XA 3IJHA 3LDBB 1P5VA 1WDPA 3TM6A 3EOBA 1JGVH 4PJXB 5FKAA 1YMMA 2XKUA 3U36A 4BKLB 3HMXA 3JV4A 3CX2A 1YYLH 4RWYH 5B39A 5IHUH 3CZGA 4JPWH 3BSGA 2X2JA 1EHLL 5DJ2A 1BZ7B 5CD3A 4Z7OE 3MSPA 3CDYA 5I75C 1E4KC 3CDFA 4KK6C 4Z7QE 2BCKA 3PDOA 4AWEA 3BN3B 5DJCB 3LKOB 1BYBA 2ESVA 1EEZB 2D3LA 4Y16A 1NKOA 1HXYA 2DLGA 4NSKA 5T1DH 5BMFL 1KB9J 4V1DB 1DL7L 2IANA 1I7RB 4PRBB 4IMLB 4NN7B 2ARJA 3ORJA 4TPRH 5FM5O 4PTUB 2VUOA 3TA3C 4NJAL 2CIKA 1REIA 2NXYC 1UC6A 5DJ8B 2A9NH 1MQKH 3L9RA 4NCC1 1BLIA 3MRPB 5D9SB 4MB3A 1KLFA 1G7QA 4JM2A 3RHWK 3RGVB 2EIEA 1KELL 4RFEA 3T2QA 2MQ3A 1RURH 3WFHA 1FFQA 3ETBF 1CICA 3IAQA 25C8H 3OGCB 4OTXL 4LX4A 2JIXB 1VFFA 4LLQA 3UTSD 2H8PB 3UTTB 8CGTA 5FO7B 3O4LA 1VESA 1FG2B 1K4DA 4O2CB 1NCCH 1KN2H 4JFOA 4UV7L 1PIFA 2Z31D 3NGBB 1KC5L 2JJVA 3BAEL 4HLZG 4LPVA 1KF9B 3VX1A 2X4QB 4FFVC 2PC8A 1OQXA 4L5FH 3ARZA 4QKXB 2DSKA 4QY8B 1FYTB 4KXZH 2W9EL 4YPGB 3SDXA 3CMOH 5F7MC 1S78D 4WTWA 5IQ7H 2DT1A 3MA7B 4ZAKA 3S37L 4OT1H 4NCC2 2EC9U 4GG6E 5IESL 4OIAA 1NARA 2XTKA 4XC3L 3C09C 2P5EE 1OGAB 1MEXL 4MJID 4X6CA 2VXSL 4OSUH 3PXJA 3VXSD 2J8GA 5F96H 3TT3L 3T0VA 3O3BB 3ARVA 1WCGA 2IXUA 1QHZA 5IR1B 4TSCH 4HWEH 3DNKA 1FLTX 3AFLA 4MAZA 3VDBA 5JHLH 4QHMB 1UZ1A 4D1IA 4BQ3A 1ZT4B 4L8SB 4M61B 2HFFA 1KFAL 3PQYB 2JIXD 4ODVL 3VFOA 2XNAB 4YXKL 1H0GA 3T1WA 3G5ZB 2CMRH 1WICA 3QFDB 4U1SA 5L6YL 1KN2L 1T3FA 1MQKL 2YBUA 2IFFL 3VH8B 2PYEE 3O6KH 4JFDD 2YLLA 2VDRL 4L4JA 3PJSA 4WY7L 3O4OB 3IFOB 4N0FA 3NIDE 1X5ZA 4PGCA 2LTQB 3EBAA 1JHLL 1GYAA 5MEOB 3MNVA 3P0GB 4NQCA 4DGIH 1MW1A 5IBTL 4EI5C 1ZVHA 4N9GB 3R8BB 2H6PA 3O45B 4M5ZH 2C3WA 4TNWF 3QO0A 3L5XL 3HI5L 3H9SB 4YXHL 5GGRY 3PZ9A 1QNRA 4FMFA 4U6XB 5E6YA 3QWRA 4U1MA 1UM6L 3FT2A 5DMGD 5I71C 1T5WB 2B4CC 4P3DB 4AYFA 1A9EB 1FZKB 3BKCH 3CXDL 5K9KA 1MCHA 3MV7A 3VFUA 4CVZA 3M17A 3BZ4B 3PZOA 5D8WA 2XZZA 4RNRA 4M7ZC 3N1FC 3RBSA 5GNXA 5KS9F 5DYOB 5IMKB 4EN3C 2EDNA 2VN7A 5D6DA 4J27A 4R97B 3AIUA 5CJQL 1AC6A 2ADFH 5CEZD 5F7YC 2BY2A 5DJCA 1EEZA 1D6VL 2H2PC 5DK0B 5AEAA 1TA3A 4JQVA 3FB6B 1HXYB 2CXKA 3OR6A 2DBJA 1NEZG 1A7RL 3IXAA 1J86A 1OAUH 2MSPA 4ZO7A 4V1DA 3EMQA 4FFVD 5SWQB 1U3HA 2IANB 1I7RA 4N68A 4PRBA 2WZEA 1CIUA 5JHDD 4HUXB 3S88L 2QBWA 1GNXA 3OZOA 1RULH 1YN7A 5JPNB 3GIZL 1CGSH 4WTXA 2CIKB 4IMKC 1CLZH 4FZ8L 3FMGH 4OCSL 3U4AA 4TVPH 2VURA 6FABL 1UQSA 2IADB 2FX9H 4ZPVB 1JPST 2ESCA 4I13B 5BROA 3N13A 1PPIA 2V3FA 4D0CA 1LQSR 4GKSA 3U30C 1T21A 4YK4C 3ZL4L 3CK0H 5E6ID 2ADGA 5ISZE 1DWFM 4G6KL 2BVQA 1BQHB 1X5YA 3CX5J 4MAVA 3EIFA 4K3EH 2H2PD 4Y4HD 3TWCH 5FCZA 4HMEA 3UTTA 3NIFF 3CZLA 1AGFB 4AYGA 1ZSDA 4NFCA 3W38A 4CD8A 2GYSA 1F97A 1CU4L 4QTHB 3NSXA 2BSRA 2ITCA 1R47A 4FQHB 1JHTA 2ZCLL 1AQHA 3DX7B 4HFWA 4M4PA 1J5OL 1VENA 4AD4A 2OW6A 4MVBC 3VXRE 1IEBB 4KZEH 3AAZA 4K3HA 2GJ6B 1E0VA 1N0XL 4LLYA 5I1AA 4HLZH 4N0UE 1W1VA 2EDJA 3ARGA 4HV8B 4QHNA 2YWYA 3L2LA 5MEPB 1QLEH 4M7JL 4HMCA 1US2A 5LYRA 1GXEA 2Z8WC 2BOCB 3OGVA 5EZLA 4Q9QL 3RKDC 4GRMA 4JFUA 4NNPH 1DR9A 4PJXE 1QG3A 3BUYA 3L3JA 3ZL4H 4KK5D 4V27A 2DI9A 2AJVH 1ECEA 2GT9A 3O6ML 3PQYA 4N8CL 1O7AA 3WJJC 5C0BD 4CW1B 1TUXA 4LGRB 5F9WB 3WE6B 1U95B 3G04A 2DQUL 3OF6D 5EO9A 2EBNA 3NIGF 4KH2A 2AJZA 3PWLA 4U1SB 5JBEA 2Q86B 3CNKA 3VH8A 5ETUB 5EBMA 5J06A 2IG2H 1SYVB 4PJFF 4QO1A 4JFFE 1G1CA 3VM7A 4ZUUA 1TVBA 5ADOL 1H5VA 2QEJA 5FHBL 5TF0A 1U8LB 2XACC 4K7PH 2VLKD 1NWUA 1NC4B 1KXTB 1MCWW 2HLAB 4M5ZL 3HLAB 1UA6H 4LYRA 2EE9A 4XVTH 4TUFA 4WJ5A 5HGBA 1YMHA 5BYWA 1V6WA 3TH2T 3DX9A 3CTTA 3P77B 3BH8A 2RCSL 3ARBD 3N85L 3VGGA 3HNTL 4WHYH 3QI9D 1F3JA 3T0BA 3N1AA 3JWOC 2EIBA 4UQAA 3HMWL 1A14H 4HKBA 4ZQKA 1IM3A 3WF3A 2Q3AA 4J3XA 1A9EA 2VDLH 1A22B 4XWGL 5DD0H 4X7CC 2AK1H 2QQNL 5HHPA 1IM9B 1G7JB 4PY7A 2A6JA 2XQBL 2YSSA 4U3XA 3D3VB 3VDCA 1H3UA 2PW2A 2E7CA 5JNYA 3MJ9A 4NBYB 5IB4A 4M02A 4X6DF 5FUZL 3MBXL 2GTWA 5DYOA 4AZIA 1O7SA 4GAJL 1Z9OA 3DUUB 3OL2A 5C0AE 3NGBC 3V4VH 5A40E 5I1HH 1JL8A 5D7JB 2XWDA 3D87B 4FQLH 4A3YA 4BSVA 1L7TH 2CJUH 4HPHA 5EU5B 2D7QA 5CSBA 4BA8A 1B4JL 5D2NA 4DGIL 3BHBA 3AY4A 4OD3H 1IBGL 4E0RB 1E28A 5FOJA 5TQ2L 3FL7A 4HCRL 4PV8B 5DRWB 1IGCH 1MVFA 2I07B 1I8KA 5HDBF 1E4WL 3SDYL 3DC0A 3T3PF 1HIML 1V7ML 1DBKL 4G42A 1KGCE 3C08L 1AP2B 5F1OB 4UTAL 4PRPD 1OM0A 4KUCD 4B53A 2NXYB 4E42A 4OIFA 4AZHA 4U05A 1C3FA 4R26L 4EIZC 2NW3B 1T83A 1OWWA 3IT8D 3H0TA 3UG5A 2IADA 4ZPVA 4JG1L 2X0YA 4PG9A 5A16A 4ODTH 3JTTA 2CESA 3L3DB 4X7SH 3AISA 1U93A 2MOVA 1CBGA 5JXEC 4ZODA 4KROD 1NUFA 2WP3T 2BJMH 3TNNB 3ZDYF 3K3QA 4HXBH 4N0YH 1M4KA 1BLNA 1QBLH 4FTVA 1ZSDB 3EDDA 4CNIB 3UBXA 4XPTL 2R0LH 3GHBL 4OCYH 1B0WA 3G6DH 3SPVA 2R1WA 4JN1L 4FQHA 1FRGL 2OTPA 3AQUA 3T2OA 1UWGH 3Q5TA 3WF0A 1JTOA 1W8OA 1CI5A 4KKCD 3W5NA 3UAJC 3VI3F 1UWSA 4X6DB 5EPMA 5FL1A 5ESQA 3QHMA 5CGYD 4CMHB 1I3GL 3SDDD 2VISB 5I1AB 2OL3B 3VIKA 3IJYB 2DLIA 4Y5YC 3KPMB 3KNBB 5J11C 5D8JH 3F12A 5IVXE 2VLRB 1U58A 3GBNL 1GQJA 5F21B 4ACPA 2AEPL 5LGJB 2BHZA 4UR9A 2AEIT 3ABZA 2XIDA 2PF0A 1MW2A 4XMLH 5I17A 3V4PH 3DETC 2JCCE 4M8UA 5LAXA 1W3HA 2AXGA 2V7HB 5IVXA 4JDZB 4GI9A 3NOIA 3RUGE 3C08H 3LEXB 3C9NB 3VG0H 4R4ND 4ATDA 2EYRA 1ZA6B 1S7TA 4KMQA 1CXLA 2YPVH 4P7QA 5BJTA 2HJLA 5ETUA 3W26A 5FXCH 4MNQD 3U9PL 1J88A 4OI7A 1UD4A 4D2NA 4YX2H 1QA9A 2NY5L 3MA9H 3RKDD 1W32A 4PJEF 2ZCHL 1IFHH 4K7FB 1P7QA 1JN6B 1I3RA 4HCRA 1UXSB 4U1HB 1MQ8A 3HLAA 3MLRL 2XPGA 5IK3B 5T1LB 5KSBF 1B3ZA 5ILTH 1M01A 3SBWC 3WNPA 2QJDA 3WDQA 2CERA 3S4SA 4YC2C 3DX9B 1BWWA 4LVHB 4ZUWA 4FS0A 3QCVL 4N9OB 2QKIA 3H7BB 5C0CD 1F3JB 4M7LT 2A38A 5C09E 4UIMB 1AGEB 2BSED 3MV9A 4FQQA 1URLA 1XAUA 3HJEA 3STLA 3K8LA 4Z78B 3L3IA 3V5HB 4F15B 3MV7E 4GQPH 3ZE0E 1E5NA 2X89A 5DO2D 2QLYA 3KHQA 3IF1B 3H9SE 2YSSB 1S9WB 2E7MA 5GS0D 4HF5L 3H3PH 3BAKA 4NOBA 5CILL 5DFTA 4ZFMA 4ORGA 3GM8A 5IB3B 3D4YA 4KVCL 1TQCC 1TTFA 2CLRA 4LF3B 3HPLA 2ADJA 3GI8L 1A7BA 2NW0A 1KCRL 1DQJB 3MS8A 4MNQB 5CUSL 5EUKB 1FH7A 2APBA 2ZUQC 3C6SB 4MCZA 4XP4H 4ATWA 3U57A 4JPIA 4H26B 5KSAA 4XPGH 5IVZB 4GH7B 2DI7A 1NPUA 1YEKH 4U6HB 3LQAL 3PDGA 3ZKND 4Q0XL 2RQ8A 4UIKH 4PP1D 3QAZB 4Y19E 4E8CA 5HYSG 5IB5A 4WU5B 4JQXC 3GMMB 3FB8B 5DUMH 4EJ1C 3L4VA 3PZGA 4W86A 2GTZA 3SCSA 4P23C 4ZTOL 2CBIA 5F1NB 5A16B 4WLCA 2WMKA 5GGTH 5GISH 1R3JB 4Y5VC 3U6RA 5GJTL 2QQQA 1U93B 3BWAA 1JYNA 3FQRA 3BD3A 2WNGA 3K2MC 2MKWA 3FRUB 3O6FA 3VNYA 1GONA 3LV3A 3UTQA 3VFNA 2FX7L 1AD9A 2BNRD 4QXGH 4I18B 4ZO8A 1OT1A 2D0FA 3KYKH 1UWQA 5KAQG 5CBAB 3TP4A 2BVUA 5I24A 3UBXB 3GMQB 4NHCL 3PABA 2WBKA 2OYPA 4LPCA 5IFAL 4KRUA 5F1IB 4PJ8B 4IIQB 3GIVA 1I3GH 4PMRA 4IISA 1N6VA 3I2CL 4PRHD 3REVA 3HI6L 4X6DA 5EPMB 2IG2L 5ESQB 1ISYA 4AEIL 4PV9B 3B2UD 2AQ3A 4KJYB 2QPUA 4R27A 1S3KH 1RIUL 2VISA 3D9AH 4M7LH 3TNMA 3T0EE 5GZOD 3KPMA 4ODXB 4YHOL 4HT1H 3LB6D 2HLFD 2Z8VC 3H9YA 3EYSH 3OKLB 1HWGB 1RIVH 3ZM8A 5F7EH 4NQXA 4OCRH 4OCXH 5BS0B 4CD6A 1HKMA 4XP1H 4DUVA 1MFUA 1L0PA 2IPUK 1NAMA 2VMFA 2X4SB 3F7PC 3HE6D 3DBXB 3B5HA 4JFSA 3LPPA 1C8PA 2BMKB 2ZUWA 3HAEB 1F3RB 3KPPA 4PJIB 5E1QA 3BAYA 4PJ7A 4KK8C 2F7PA 1G01A 1R85A 4KUZL 1MJUH 2CIPA 1YYMH 1VJSA 3FO2B 5FO9A 5EOQH 1RHHA 1RZJL 1E9LA 2P24A 4MJIA 4IRJA 5TQ0H 4RAHA 2IGTA 3A24A 1XGUB 3BZEA 3BE1L 2CBUA 3T0ED 1T0PB 4NJ9L 4F7PA 1RIUH 3D9AL 2ZUSA 4D3CL 1C16B 4YEEA 4ACZA 4QRRD 1CBVL 1TQTA 5JW4Q 4PRIA 3LKNA 5I73B 5BRPA 4LSSH 3OKMB 1CR9L 5DSCB 4DWHA 4NKMA 4FQQB 3BKML 1IAOB 4KZDL 5DT5A 4MVBD 2GSIB 2EDBA 2W9EH 3FQTB 2JB5L 4EAMA 1P5UA 1S9WA 4PJGF 4QF1A 2C0HA 5EFFA 2J8UE 4K9EL 1RJCA 4PJ5A 4HFUL 4ETYA 2XQYG 2IAMD 4FQJH 1U8QB 1YY8B 3QNZA 5D2NC 5J6GB 4HPYH 5HOSA 1C5CH 2ZKHL 3VXUB 1VADA 5JXEA 1UVQA 3D3VE 3EYFA 4MD4B 3W27A 4K3JL 4HUNB 4EVNB 3OKDA 1EA9C 5IVZA 1X9QA 1LO0H 4H7VA 5E9DB 5A2LH 2IAMC 1XIWB 3KLAB 5C0AB 5AZ2L 1SVZA 3L5WB 2B4CH 2CIIB 1A0QH 5HDOA 1K4CA 2ICWI 1IAIH 3NVQA 3FT3A 4O9HL 1J10A 2UWEA 3DX8B 4RGOL 2ZNWA 3V7MA 5KEZA 4WGVB 4GQQA 4JM2D 2DRUA 3PWJB 2A77H 3CFIC 3NCOA 4OZFA 2VIRB 3AREA 4XAWH 1MCQA 1XR8B 3RGHA 1Q9OB 2FIRT 3ECBB 1RUML 3MBEA 1NKRA 2WCSA 3GMRB 2GSJA 5D5MB 4DKFH 2VH5L 1R3JA 4NFDA 1QBMH 5IT2H 4NWUH 1OD8A 1DLFL 1RP9A 4MYWB 2PCPB 1X44A 4HD9A 4NQVA 2GFBB 4QOKD 1NCAL 5HYSB 3UTQB 3AIQA 3RNQB 5GGVH 2G3IA 3HU7A 2P47B 3IDJB 1GGYA 2XRAL 4D6GA 3W37A 5C71A 1KPVA 3RL2B 1AD0B 3WEOA 1HQ4B 4P5TB 3FY1A 3LXBA 1ISXA 4GO6B 4IPNB 4UFLA 4LPWA 4OCMC 4XNUH 1QQDA 1HIZA 4PJFB 4XNZC 4QHLA 2V2TB 1A0QL 4RAVA 2VC2H 5HDQL 1MLBB 1T66D 2A6IA 5CGMA 4DAGH 4C4KO 4KJYA 1ZTXL 4L9LB 5EO1A 5HYJD 3HE6C 5HHVL 4ZFGL 6CGTA 4G6AD 2DM4A 1KQZA 5C0DA 4GBXA 2XN9B 4JREB 1XF4B 1OM3L 2ORBL 2OI9C 4NQXB 5C2UB 5ELIA 3JV6A 4EQ3A 1J1PH 1FVCA 2H32A 3DURA 4LCWB 3RJYA 4Y4KA 3TFKC 5I71B 3WN5B 4DWSA 2BX5A 2NCMA 5CZVH 3DBXA 3EGSB 4EN3A 1NBZB 4J7RA 1FP5A 5F9DC 5JQHC 3MOBL 4X9IA 4DZ8A 1NAKH 4H5SA 3RY6A 2HVJB 2FBJH 4LEXL 2GCYB 4BH7B 2EPMX 3U2SB 2BY3A 1QI3A 3ZYJA 4K68A 2GAZB 3W29A 1BD2A 1NFDF 3A6CL 1H1NA 1RHHB 2ERJB 3HG1D 4UTFA 4MDOA 2H1PH 3WIHL 4BZ1H 2WANA 4GG8B 2P24B 3NCYS 3VXQB 2AJSH 4M56A 4L4OA 3RVVD 2HA1A 5MENE 5DHXB 3ZJ8A 1NCAH 2WLZA 5DEZA 1NGZA 4NRZB 3MRIB 4K8RH 3A5VA 2JEPA 1BZQK 3WHXA 4FQ1L 4XBGB 4LASH 5DEFA 4P59H 2X4OB 3DXAB 3FO9B 4NKMB 4OZGA 3WH9A 2GSIA 1BFNA 2PWGA 5KBNC 2P7TB 1H8OA 3LKQB 4OD3L 4KZEL 5LA1A 1G0DA 4JFHE 1A1NA 2J2ZA 2A9NL 1ZS2A 2F74A 5DQDH 2P42B 3VXNB 4JEGB 4H8UA 3BLKA 2PTVA 2YEZA 1YY8A 2PNDA 5J6GA 4U5IA 2YRZA 2BSTB 3WKMH 4Z7NE 1CGXA 3HE7B 3MACL 2F5AL 5D96C 3F5KA 1DVFC 1FJ1A 2Q20A 4HGWB 3UR8A 1UVQB 3EYFB 3RO8A 1JZ4A 3IVKA 1NBYA 4UFMA 4QLJA 3T0DA 4QYOB 3RM4A 4JLRB 3DV4B 1GC1H 1S7VB 1FORL 4N5UA 2CIIA 2Y06L 5D7KD 1UT9A 4PYSA 3ET9F 3O3DB 1NSNL 4JRXA 3O6AA 2AXHA 3SUVA 4HGKC 4Y4FC 1Y7VA 2HWZL 5BQ7A 4LYQA 2BSSB 3PWJA 1I7ZA 4F7TA 3MRHA 4H1LB 4JFQA 4WW1A 4OZFB 2YC1A 1YY9C 3CMOL 1I9JH 3BP5A 4L4TB 4F7MB 2PYFA 5HDLA 3RPIA 3F6IA 3JVGC 5A8PA 3UEQA 3GMRA 1K6AA 5INDB 4L8DB 1KEML 1C12A 3UX9B 4MWFB 2WVSA 5EZIL 3FQUA 5IIEA 1E4XI 5F7EL 4HPYL 5J6HA 2GFBA 4FQXC 3QEHA 4UQ2B 3MKKA 1WB0A 5CMAA 5FB8A 1GZJA 1KB5L 3IU3B 1JV5A 1P7KA 2A9ML 4NKIH 4PGJA 4KKBC 1EHXA 4H0IA 2VE6A 4UV4L 5KN5A 5IEHA 4X4XA 1AD0A 5GRJH 4JKWA 4ZD3L 1NL0L 3CSBA 4PRWA 1TVNA 2X4PB 2MHAB 1MHHA 2VDLL 5BV7H 2BXYA 1MI5E 3BAWA 3ROLB 2RFXB 4XP5L 5GRVK 1YEEL 2YD9A 3QUZA 1KGWA 1H0IA 5F7NC 2YBRB 4GT7A 1TMQA 5C0DB 3I84A 3T08A 3A4WA 3SGJA 2UV3A 2FJFB 3S36L 5EWIH 5LA0A 2Q6WB 3WMSA 2ICES 1CDHA 1U8NB 4IS6A 1RHFA 5IFJA 3MLXL 1C7SA 4QEGA 1G6RL 2EPKX 1HZHL 1DFBL 1R33A 3VRLF 1E4IA 1RU9L 4F7CB 4QHUB 4XHJD 4JB9L 3WS6C 3QDJA 1E4WH 1NBZA 5GS1C 1UCBH 2DL9A 5ADPL 2R8SH 5T5FH 4FNRA 1QFOA 3PIQA 1BJ1H 4PJGA 1JWUA 4GZJA 1CT8A 2DD8L 5D2LF 2NXZC 3EO1A 2GIYA 2VDNL 3F7YB 3G6DL 4AD2A 4OQ1A 2AEQH 3HCVB 4S1SH 1U8OB 3QDJD 3DXAD 3QISA 5J4MA 2K7QA 3I6LD 5IBUG 1CLYL 1B0IA 3TVMA 4GJTB 1ZMYA 1BVNP 1ZJAA 1HXMA 3PWPA 4Y19A 5C0ND 4HQQH 2H41A 4I0PC 1X7QA 2NY3D 1EFXA 1CXIA 4PLKC 4UTBH 1RK0A 3QUYD 4LNRA 3DXAA 1MCWM 2WW8A 2P43B 3FO9A 4U7SA 3ZDXF 2UY3A 3MO4A 3HRZB 2F5BH 2VCCA 1NJ9B 2FEEI 4C83B 1NC4D 4YDKH 5IMMB 5FDWB 2K3TA 1FHGA 2P7TA 3O9WC 2FB4L 1OF2B 4XNMA 1C91A 3MCKB 1KPRA 5GRYA 4LYPA 3SDCC 1VERA 5IROA 7FABL 5EMYA 2V7NB 2BDNL 3OKKA 5ID0B 1WIOA 2F74B 4L5FL 1ZBKA 3MROB 3AICA 3WNLA 3O2VL 5ID1B 1QOKA 1F3DH 4JDTL 3G6MA 1MF2H 2WBJB 3QQ9D 4NWTH 1G7MB 3ZT7A 5I30L 2PXYC 1E40A 2E40A 1YEJL 3I3EA 3PV6B 2I9TA 3WL0A 3IVKB 2VI0A 1KIUA 1IQDB 1NCDH 1MVYA 1ETZA 2RB8A 1F4YH 1BHGA 4LCYB 4X5XB 2YD1A 1KXVC 1EMTL 2EDKA 5C9JB 1VACA 4KQ3H 2B8OT 4RRPA 4JO1L 5E2VH 3SCMD 2VRQA 4KDVA 1RJZA 3SGKA 3TO2B 4DVRH 3EFFA 5A6SA 1AGCA 4HU0A 4HAGA 4UOW1 4N8VA 1CE1H 3GO1H 3MRHB 2P8MA 3LSOA 1B0GB 4ETQA 1A7RH 4DM2A 3LQMA 4L4TE 4LLVB 1AIFA 4KHTL 1KIQA 4NC2B 3ROOA 5BVPL 3KLKA 5I6SA 5HSFA 4G8EB 1QFHA 5BXFB 3ARBC 3I02B 5DJDA 2QF8A 2EE2A 5GRXG 3UZQA 5IFPA 4O51A 4Y5XB 4MXQC 1A6TB 3ZHKA 2O9OA 5ILTL 1QSVA 1KXQE 5CMAB 3VGBA 5FB8B 4X5LA 1FE8H 3FHAA 1XF5B 3WUZA 2EO1A 2IMNA 1DTUA 1OP9A 5KN5B 1AI1H 1XGPA 1LE9A 4LAQL 4XCYA 3OXRB 4CRPA 3ZJ6A 4PRHB 4ONHB 5L0QC 1F3DJ 3GSNA 1NDMB 2Q76A 4YGAB 5E2UL 4DFIA 1HJXA 5D7JC 3VMPA 2X4PA 5I8KL 1J8HB 3B6SB 4GW1B 2EXWD 2DQUH 4YHLL 1TVHB 1AH1A 1TQBC 5L2KD 1ZL1A 1I3UA 1UWEL 5A3ID 1BZ9A 3IJSB 4CDGC 5F9AC 4OOUA 4CD7A 2YUWA 1OLLA 3VTRA 1PDKA 4PLJD 3H54A 5I9QB 1WNOA 5DQJB 5F71A 4X6BA 2CKBH 4MMZC 4L3AA 4F7EA 3QPQD 4X4YB 3CUFA 2XOTA 1E72M 2NY1D 3AIBA 2DKMA 4PJAF 2AP2A 2VDML 1E4LA 4MNKA 5HHVH 4ZFGH 3MCLH 1ZHNA 1IC5L 3CLWA 1OM3H 1C1EL 2J8UA 2B20A 4U6YB 5FK9B 4WY7H 4ACYA 3QDJB 1TJGL 3G08A 5A69A 3PIQB 2HT2C 2EDDA 4JPVH 4WI6A 2VZOA 2YDSA 3TZVD 4X7DC 1CT8B 4PIRF 3V4UH 3RJXA 1IC7H 4FA8A 4BK5A 3GXDA 4JZJC 1Z3GH 1UD2A 1KJMB 1GJWA 1L0XA 3T2NL 3KL0A 4JFFA 2ZG2A 1AC0A 5EOTB 5TDNA 3BT2H 4GQ9H 1QNSA 2YL8A 5INCB 1U8OA 2Y5EA 4YFEA 5JUEL 1J8HD 2ZOKB 5E2WH 2JJWA 3PGDB 1MCSA 5J7CC 1QBML 3CSPA 1FO0B 4X4ZA 5FKPB 2FO4A 1ZOXA 4JZOB 2NZ9D 3CXDH 5M03A 2Q8AH 3TJHD 3VA2C 4NQUA 4WHDA 5AYIA 5B39B 5DRXA 1QI2A 4M6NL 4RFOH 3W2DH 4OGXH 4OZGE 2WHJA 2AJXL 5GS3A 1F90L 3F7QA 4WFHE 1U8JA 1F8TL 2M2DA 1EAPB 3Q6GL 3LKOA 1Q72H 3VDAA 1FV1A 5B4MD 1HYSC 5EC1A 1JF1A 4PGBA 4RGMB 1TJGH 3M07A 2V7NA 3OKKB 5I18L 5ID0A 1K9EA 4YXLH 1H5BC 4OFDA 4X9HA 1K8DA 5C0RL 2WVUA 4UOW0 3RX8A 1BECA 2XZCH 1JGUL 1QSEA 2CUMA 2P8LB 2Z4QB 2IFFH 3C60D 1NFKA 2OMNA 1LO2L 3GMOA 3SCQA 5DUPL 1IQDA 2WINA 1A21A 1BBJB 3HPJA 1J0YA 4KK9D 2UZIL 2IQAA 2AAVA 2A6KA 1DLFH 1BFOA 3OKEB 4DUWA 3POCA 4KKBD 4LHUG 4P46A 4IOIA 5E8OB 4XCCL 4ELMA 5JW4R 5AYQA 1AE6L 3OB0H 4M3KB 5BV7L 3LSOB 1YEGH 4LLVA 5JMOC 3BH9B 4LEXH 5DA0B 4K3GA 4XAWL 4EXKA 1E4JA 1KIQB 3O4LB 4U6VL 3GXNA 4J8RA 4PJ5D 4JFOB 1OB1A 3BVVA 1D5BA 4LSPH 4UI2A 5T3XD 3ZTJG 5JA8B 3B9KC 1IEHA 3NA9L 3DVFA 3O2VH 2X4QA 4GPNA 3M8OH 3QUZD 3GSWA 3WUWA 5E00A 5L7XL 4DGYL 4YPGA 3SDXB 4FHBD 3SO3B 2QHRH 3F58L 4ZAKB 4FQIL 3QIBC 3CJJA 5C8JA 3PWUA 2IXVA 2JALA 3DI3B 1EPFA 1A9BA 1M05B 4MB4A 5DJAA 1T7WA 3PP3H 2IPTL 3SDAB 2VQTA 3ALFA 3FN3A 2CRMA 2Y6SC 3QUMA 3ILQC 1T80A 2XY2A 3OXRA 5E08H 4BFIB 1GPOL 1DSFL 1A6WH 1CLXA 3DHMA 1QYGH 2Q76B 5AUMA 3A6BL 2R9HC 4F37F 3E0GA 1GPFA 4IHOB 4NDMB 4W7WA 2YOCA 5KANI 3FB5A 1HHIB 5DK3A 5DJ6A 2CKBL 3HB3C 1W0VB 4K8RC 3FFDA 4TSBH 4U7MA 3RI5K 2RGSA 5T3ZE 5DQJA 3GTNA 3BFOA 3QIBA 3VXPA 5JOPE 3QFDA 4BUGA 4JKLA 3MMDA 1A3RL 4S0SD 1DEDA 3I9GL 2Z92A 2RBLA 5C86A 2IPUG 4OZFH 4HUWB 4W4OC 1DWIM 1VEOA 3HUJE 4LPYA 1AQMA 4DK6A 4U6YA 1MUJA 2JCCA 4TXEA 2YIHA 1AI1L 5CD5D 5MEOA 1F5WA 1T89A 3R0NA 4NO0A 4MB1A 2XZQL 4N9GA 5ICYA 5KSVA 1CD8A 4ZUTA 2NY2D 1KOAA 2R29H 4WDIB 4YBLB 1FC1A 5DFVC 4JFFB 5EOTA 2VLJA 5BXRA 3RDTD 4F3FA 1CU4H 5INCA 1H5BB 3MLVH 4E4PA 5C08D 2OK0H 4UUJB 4W7VA 3LHPH 2NY4B 4MSWA 2ERJC 1OTSC 3HG5A 3GB7A 3NZHL 3PWPE 3SKJH 5FKPA 2F58H 3MV7B 4J4PC 3GNOA 3W39A 1T7VA 3SE4C 4HIJB 3LCYA 4CVZB 2NY0D 2O9TA 3WDPP 4AMWA 1SEBA 2ED9A 1F02I 5DJYB 5MENA 4Z5RA 2BNRE 2ENSA 1ND0A 3SOBL 1U8JB 1A1MA 3MREB 3AZSA 1CQYA 4Z2LA 4UIKL 5IUSA 2ZWLT 5ALCL 3OHXB 5MERA 5EC1B 3FB6A 3OR6B 4D9QD 2WWKO 2A3HA 1U8MA 5IP4A 2CR6A 3HG1A 3S88H 1UR2A 3OJVC 2HVMA 3CFBA 1RZKL 4FQCH 4AMKL 3T3ME 2B0SL 1JTPA 1YPZF 2ZSWA 1XF1A 3BP4B 1DN0B 5GHWL 5JPNA 2O5YH 5E2WL 5SX5H 3RCNA 4ELKA 2PYED 2AVGA 4EI6A 3GMOB 3WCYA 3HPJB 4N0CC 1UQSB 4NJ9H 1QSFA 4KTEL 1EXPA 1OPGL 1KCRH 2NY7L 4PMXA 2I5YH 4D0CB 1T21B 35C8H 1YEGL 4NPYB 3O0RH 4X80L 1T20A 1BQHA 3MUJA 4XI5D 3RGVC 5MHSD 5KVMC 4JO1H 2Y9RT 4HZ6A 1V08A 4J8RB 2YHGA 4QOKA 2BRRH 3DGCR 3HZYB 4P2QE 2FRGP 1DQLL 1V3IA 1R5IB 3BC9A 3UESA 2H2SC 4QOKE 4EUPH 5FYKE 3T65A 3AAZB 5HVHC 4Z0XB 1K9TA 4JDVB 5DJAB 1A9BB 2NYYD 1Q6FA 2EH8H 1U2YA 3X3GL 1WVZA 3QCUH 5MHSE 1GZPB 3HG4A 1D5XB 1PSKH 1EHNA 2UWEF 4ONFL 3RIAK 2UZXB 5AUMB 1NGQH 4JFEA 5EZLB 1MCEA 4YHKH 3W0WD 3MV8A 2CKSA 1R3IH 3L3JB 4NDMA 1OGSA 3EOAB 4JHWL 2Y06H 1NOFA 4RA3A 1GOWA 1NCCL 1W0VA 3D6GA 1IAII 2GT9B 3AREC 2O5ZL 3CLFL 3FQXB 4RBPH 2QHAA 3IS1X 3Q0HA 3WE6A 5C2BL 3M46A 5C9KA 5CWSA 3RWJB 3VIMA 2AJZB 2XWBB 3PWLB 2DJ4A 1DQDL 5EBMB 3OXSB 4XNYL 3GSQB 1PQZB 3NAAL 4XMKL 3MRDB 2CLZA 1TVBB 3LD8C 3RGVD 2GK1B 3SCTA 1NC2A 3MX0A 2LVEA 1U6AH 4M82A 2CBJA 3ZDZF 4WCYH 2R23B 1YY9D 2TAAA 3IYLW 1MYRA 1LP9F 4PJCF 3PWVA 4NFBA 1YMHB 5J9PB 1GJUA 3S5YA 5KSUA 5AC4A 4WFGE 3AVEA 1LO4H 3F8UB 5JOFB 3MBEC 5HBBA 5DVKA 1JG9A 2DJSA 1BVKA 4APQB 1S5HB 1H5BA 4JN1H 5JPMA 4EKXA 1ERNA 4UT6H 3SKJL 1OWQA 4JR9H 1OD7A 4WV1A 1TJHH 3DVNA 3SGDI 1G7HB 1JGUH 4FXKB 2DQJH 3MO1A 5IJVA 2GITA 2W38A 3DRQB 5D2LA 1OGAD 1W9DM 3QHNA 2F53E 1UZ6F 4WFEE 2XFRA 4M43H 5MP6L 5I76B 1U8KB 2ENYA 1H3VA 4TNVK 5D8JL 4KVCH 3WIFA 3BPLB 4TUJB 3MMWA 4Z5RB 2EDXA 3I3BA 4U3CA 3PZQA 1OTUD 1A1MB 3MREA 4LP4A 1VFBA 4XCCH 5IFTA 2DBLL 1S7SA 1U41A 1LK2A 4X4MA 1JJUA 3JV5A 4KDTC 4M6NH 5C0FB 1JCKA 4TVUA 4K9EC 1CD9B 4LRIA 1HQRB 3ARWA 3NZ8A 2FEDD 2BVYA 2DLFH 2I07A 3VXME 5DFAA 3CFBB 2W66A 5DTFA 1C8YA 1F4WL 5FCUH 5DJ0B 3QO1B 1H3GA 1GOIA 4KUCF 4I4WA 4RGNC 3WL1A 3K2UL 2XG9A 4LBEB 4Y19D 5CJXC 3WY3A 3MSDA 4XPHH 3O6FC 4EI6B 3CVHH 4G3YH 4UFIA 1N3NA 2OR8A 1SBSH 1SJHA 3RVXD 1B90A 3CZKA 1OY3B 3S97C 3L3DA 5FUZH 4Z2KA 4NBZB 4KRPB 1QYGL 1AR1D 2D73A 4LCUB 4MDJB 2XN2A 5E9DD 4OOZA 3JTSB 2Z31C 4AENB 5AY7A 3PGFL 3SQOL 2WIMA 1OAUL 4HHAB 2R4RH 4M48L 2HT3C 1BD2E 1DQMH 4XTRC 4U1LA 4BQ6A 1J0ZA 4OZHE 4D9QE 1HOCA 4UNUA 4NQED 5JBDA 4HG4J 3SDYH 1V0MA 5HGHA 4K8RD 1AO7A 2FX8L 1DANT 4YNYB 3ALPA 5KVFL 3WKML 5E8DL 4B15A 5D7SL 2X4UA 1TLKA 3WBEA 5A2BA 1YYLL 2APXA 5I15L 3B43A 3IJYA 3WUGA 1NGYB 3RWGB 1ONQA 5M17A 5L2KB 2YL5A 5D7IE 3I6LE 1GGUA 5JW4M 2CDFB 3D4ZA 2N7BA 3G6LA 4IPLA 1II4E 3F12B 2APTA 3VW3H 4FQXB 1W2PA 4AY0A 4XMLL 4D0BB 4HS8L 4QLKA 4RMRA 4AQOA 1Q0YH 2WC4A 3NH7L 4L4PA 4Y8DC 4PFEA 4U2YA 4X0KA 5I77A 4PLOB 3W9DA 2NR6D 2DTMH 3AY4C 3QJHB 1TZIA 1F6FB 3PQYD 5C6PB 5I30H 1NGXA 3SDDA 4QRTB 5I1DA 1A3LL 1CFSA 1LLOA 3LN4B 3GSQA 2VNCA 3QEQA 3WD5L 5CJOL 2PI6A 4WWID 5DK2B 5IW1B 3RILA 1LVEA 1CF8H 2CEQA 1UXSA 4U1HA 1QLFB 3CMJA 5DT7A 2EDEA 5FKYA 1UKQA 5CP3A 4Y4HB 4OZIF 5DFWH 2GUOB 1GGCL 4UZSA 5TPWH 3GJEB 3GSOA 3BPNC 2ATPA 4XH2B 5FYLH 3HE7C 2OJEB 3G9VA 3AYRA 2QKIB 5ITFB 3U46B 5T1KA 1JF6A 4YZFF 4TN9A 4K3DH 4MJ4A 5HPOA 5CQ1A 1S5HA 3PWPD 1B0RB 5F6IC 3EJPA 3PZVA 2CRIA 4GKNB 5GGRB 1HINL 1G7HA 2CSPA 3L3IB 4J12A 5IB2A 4DCQB 2X7LA 1YNTB 5T3XH 3I2CH 2GITB 3WY2A 4DKFL 1G5AA 4O2FA 1RZ7L 1GOMA 2VDNH 4HP5A 2FATL 4HWNA 3EJUA 5KS9A 5DGRA 2EKJA 4P9ML 3WIFB 4OJFH 1B1YA 4MNQA 5KOMC 4HH9A 2CGRL 3ZIZA 1S7SB 2L4OA 2XFYA 4JPIB 5DMYA 3SGEI 5DJXA 3O4LE 5D8ZA 3CLEL 1JZ5A 3CFEA 2IH3B 4LHJB 5F3HB 3SDXF 1U92A 3FCTA 4GRWH 3P73A 5HHXL 4Z7WA 4CMHC 3BVXA 5D1QB 1X5IA 1U3HC 2KL6A 1WZMA 3VFSA 1BFSA 1JNJA 4RIRB 4H04A 5B3JF 5IB5B 3TIDA 4PTXA 2NLJB 1P84J 1QX1A 2R2EB 3TO4A 2VKXA 5HHOB 3NA9H 4OBSA 3MXVL 2D0GA 4Y88A 1I1FB 1RV6X 4JO3L 4AJ0A 3W53A 3V5KA 2A73B 1QW9A 3PNWA 4YHNB 4ODSH 1EGJA 4JRXE 1D5ZB 3KXFA 2X05A 2FJHA 1O5DT 4DJMA 2IBGA 3D69A 3RTQC 4KTEH 1YQVH 4X6EA 1I1AB 5CZVL 1AD9B 1E4NA 3WNKA 1PG7W 3WEMA 1DWAM 1G7PA 3BIKB 5TDPA 3HI5H 5DRZB 3SE8L 3LY6A 1R5WB 4U1LB 2NY5C 5I6XB 3PABB 4P2QA 3IDYC 4PLJC 2AXJA 1DE4A 1OAQH 4HC1H 3RVUC 4U33A 3RWHA 3TO4C 3UEZA 3THCA 4UT9H 2GY7B 2OLDA 1NWSA 4POZD 3OGRA 2EXWC 4PV9A 5HD8C 1JWSA 2F19H 3CDGB 4U31A 4WW2A 2ZXQA 2YPLE 3L4WA 1PLGH 4NZRH 3NCJL 3WL9A 1HP4A 4R7DA 3JUYA 5D96B 4HS8H 3RMEA 1ZT1A 1SYSB 4JRYD 3RTQD 4Z77B 4FQXA 1J1OL 1QNZL 1RK1B 3P30L 1BG9A 3WDHA 2DQEH 2FNBA 4HXBL 5B38B 2Y7QB 3UJTL 2Q8BL 3OLGA 5A2CA 4M81A 5AZ2H 1XH0A 3AHYA 1U8HA 1H3WM 5LQBH 4K71B 3W9DB 3DO7A 5EO0A 2W9DL 4X6FA 4DW2H 2GJZB 4AEFA 4LGPB 1CFSB 4V28A 2AGJH 3L4YA 3LS4H 2NMSA 1ZLWH 4R5EA 3MMUA 3ULUD 3V4VL 1AGDB 2BV9A 2G4FA 1LD9B 4MJIB 3EOYG 5SWZA 3WXWH 4FG6D 2BNJA 3U7BA 1K5NA 3H3BC 3RY6C 5IESH 3BZEB 3QDME 4WIQA 3PP4H 4M1CD 4OLZL 1C16A 3PL6D 4XH2A 5DS8B 4W8LA 2VZTA 5HGAB 2WMJA 5C07A 3W9EB 3LKNB 1U8PB 3WFDH 1CG9B 5E8NA 2DB8A 4LLDA 5C0BA 5BRZB 3T0XA 1WEJH 2O61B 3WDRA 3RNKB 1H15B 2BRRL 4EI5A 1CDCA 5IB2B 2DTML 3OKYA 3QFJB 3FQTA 4LOUD 3NBNA 1EQPA 5GSVB 3KPSA 1KPUB 2AEQL 4L1DA 2X89D 1UR9A 5C07D 2ITDA 2AK1L 3X14A 2Q7YB 4LVNB 2J7HA 3KYNA 1OAKH 4XPFH 4R2GD 4Z8FH 1U8QA 3TC9A 1DUYB 1S7RB 4XC1H 3DDFA 4KI5D 4ZS6D 3VUPA 3GMPB 1OBAA 4QGYA 4P2RD 2PTUA 4ZXBB 3R06A 4LU5L 2PO6B 3VFTB 1JZ7A 1E73M 3C8HA 4WI7A 4EZMA 3WH7A 5CLWA 4G8GA 5T1MB 3ULSB 3TIEB 2OZ4A 3GK8L 3D1MC 4NKDB 3VWKA 2Z93B 3L5WA 5L88L 2DSZA 1I3VA 2IUZA 4JM2F 1K4CB 2AJVL 2W5FA 4G9FB 3L5HA 4PMOA 4KHXH 5D1QA 5E4IA 4PJAA 1IAKB 3AXXA 2VIRA 4GAGH 2Z91B 4PUBH 3VE0B 3MNWB 2K9UA 5E6IA 1CXEA 1S3KL 4Y1AD 3CD4A 5MEND 4YWGL 2MTPA 3EUUA 1BM3H 3UZVB 3GGWB 2R0ZL 3V5KB 3PNWB 4YHNA 4XHJC 3B3IB 3UXFA 3UZEA 1DP0A 5ENWA 4MXVF 5HYSA 5T3ZH 1I9RH 1I1AA 3CFDA 4WF7A 2EDQA 2VL5B 5KSAC 2J25A 5DUPH 4C58B 4AIEA 5TDPB 3T0EA 4XP1L 4L29B 4HGMA 2YMXL 5DD1L 4R7NA 3EYPA 3LRHA 5M95B 1HQ4A 4P5TA 2BFGA 4GUPB 4U1JA 4UQ9A 1MNUH 4N0YL 1E6SM 3RWIB 4WSJA 3MRLA 4IRSC 1NCBL 1ZLSH 3ZMRA 2WMFA 2J6EL 4X6CF 4QHLB 2DN7A 2QQNH 2X1XR 4JQXA 1MLBA 1E43A 2OWWA 5HYQB 3N50A 5EOCH 1RMFH 1JGDB 4XTRD 3W0WB 4OGZA 4UAOB 2RIKA 5EULV 4OZFG 4KKCC 5HXMA 3GSUA 4DUXA 3KYOB 3DUSB 4HWBA 1LQ0A