4C6KA

Crystal structure of the dihydroorotase domain of human cad bound to substrate at ph 8.0
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
363
structure length
361
Chain Sequence
KLVRLPGLIDVHVHLREPGGTHKEDFASGTAAALAGGITMVCAMPNTRPPIIDAPALALAQKLAEAGARCDFALFLGASSENAGTLGTVAGSAAGLLYLNETFSELRLDSVVQWMEHFETWPSHLPIVAHAEQQTVAAVLMVAQLTQRSVHICHVARKEEILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEALWENMAVIDCFASDHAPHTLEEKCGRPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIFHLPPQEDTYVEVDLEHEWTIPSHMPFSKAHWTPFEGQKVKGTVRRVVLRGEVAYIDGQVLVPPGYGQDVRKWPQGAVPQLPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure, Functional Characterization and Evolution of the Dihydroorotase Domain of Human Cad.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CAD PROTEIN
total genus 119
structure length 361
sequence length 363
ec nomenclature ec 2.1.3.2: Aspartate carbamoyltransferase.
pdb deposition date 2013-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01979 Amidohydro_1 Amidohydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4c6kA00
3A3XA 4ZSTA 1UBPC 2HPIA 3MDWA 4J35A 1I0BA 1R9XA 1POJA 3FDKA 4H9ZA 1PB0A 2DVXA 5LXXA 2O4MA 3HPAA 1KRAC 1GKRA 1E9YB 2GWGA 4RE0A 1J5SA 4DI9A 3UR2A 3K2GA 5HMDA 3ICJA 3QY6A 4QRNA 3CAKA 4GY7A 2Z2AA 1O12A 4H9UA 1O5RA 2BGNE 3S2MA 3QY7A 2HBXA 3O7UA 3FDGA 1DPMA 2FFIA 2PGFA 3TNBA 3IPWA 3S2LA 2HBVA 4ERGA 1XGEA 4LAOA 4E3TA 3F2DA 1UIPA 3OJGA 4NG3A 2WJEA 2Z7GA 4BJHA 1RK6A 1HZYA 5HMEA 3T81A 2PUZA 4EPEC 3IJ6A 4XD5A 4XD4A 4IFKB 1EJRC 4EPKA 1QXLA 1V51A 3MKVA 3URQA 4QROA 3A3WA 2Z24A 4LAKA 2G3FA 4J2MA 2GWNA 3EWCA 3IACA 4LALA 1YMYA 1BF6A 3EWDA 4I6VA 3UF9A 4C6JA 4C6EA 5FSDC 2I9UA 4H9VA 2QT3A 1FWBC 3RCMA 4HK6A 1FKXA 1POKA 4KEZA 1EJWC 1PO9A 4GBDA 4GX8A 3GU2A 4XAZA 1P6CA 3T1GA 1K70A 1EJTC 4NI8A 4L9XA 2AMXA 3S2NA 4V1XA 4V1YA 4CQBA 4KEVA 2FTYA 4C5YA 3KM8A 3K4WA 1FWDC 2R1MA 2QVNA 5AKQA 4AQLA 4H9MA 4LH8A 4C65A 4B92A 4HA0A 2D2HA 1FWHC 1UIOA 3GU9A 3O0FA 1NFGA 4R7WA 4C6IA 1A5MC 5HMFA 4EPBC 1P6BA 4CEXC 3PAOA 4GK8A 3R0DA 3E2VA 2YZ5A 2VM8A 2OODA 3URBA 3GTFA 1PSCA 3UR5A 1VFLA 4RDVA 4ERAA 1RA0A 3F2BA 3DCPA 3S4TA 2UZ9A 3A4JA 3E0FA 2YB4A 3B0XA 2O4QA 3E0LA 2ZC1A 3G77A 3F2CA 3ITCA 2Z2BA 4QTGA 3D6NA 1K1DA 1M65A 2I5GA 1ONWA 2Z29A 4C6MA 4XAYA 3GIPA 3OU8A 2PGRA 3URAA 2AQVA 4LFYA 1A5KC 1FKWA 1RJPA 3NEHA 1A5LC 2Z00A 1RJQA 3LU2A 4KF1A 2F6KA 4BY3A 2HQAA 4DLFA 2CZVA 1A4MA 4EP8C 2Z27A 3GTHA 1A5OC 4QS5A 1ITQA 1ADDA 2KAUC 3FEQA 3LSCA 3TN3A 2WJDA 4KIRA 3TN5A 4GY1A 1YRRA 1WXZA 1NDYA 3B40A 2GSEA 4KETA 2WM1A 4IFKA 3E38A 3GUWA 4NP7A 1NDZA 3MVIA 4CEUC 3RHGA 2DVTA 1A4LA 3SO7A 2Q09A 4LCQA 4DZHA 1FWEC 4JOMA 4L6DA 4GC3A 1PTAA 2Y1HA 3UBPC 2P50A 2HNHA 1ITUA 2VC5A 4HJWA 2FTWA 3ORWA 1RK5A 1YBQA 1KRMA 4C6LA 4ZSUA 4QSFA 2RAGA 4H9XA 4GYFA 3PANA 3QGKC 2FVMA 3IARA 1EJSC 3LGGA 4KESA 3GTIA 4IGNA 4C6QA 4DLMA 1P1MA 3RN6A 2R1KA 2OQLA 3TN4A 3K5XA 3CS2A 3MSRA 1KRBC 1XRTA 2R1PA 4QS6A 2Z4GA 4C6PA 4RDYA 3PNUA 4RDWA 2WJFA 3EGJA 1EYWA 4ICMA 4LCSA 4DO7A 1V7AA 4G7EA 4C6BA 4IF2A 2D2GA 5A6TC 2VR2A 4UBPC 2XIOA 4F0RA 2Z26A 1RA5A 2YB1A 4OFCA 2R1LA 2P53A 3IRSA 4MUPA 2IMRA 2D2JA 4RZBA 2YXOA 2OB3A 4M51A 2OOFA 2QPXA 4YIWA 1KRCC 2VHLA 1S3TC 1R9YA 3E3HA 4H9TA 4D8LA 3C86A 3NURA 1J79A 4GXWA 3V7PA 4GY0A 3MVTA 4I6KA 3E74A 4WHBA 1RAKA 3AU2A 4C6CA 1EJVC 4GOAA 2QS8A 1YIXA 4PE8A 4AC7C 4C60A 2ADAA 3HM7A 4LCRA 3OQEA 1GKQA 4C5ZA 2W9MA 4R88A 1K6WA 2ICSA 4KERA 3S2JA 2Z25A 4TQTA 1EJUC 4IFRA 2DVUA 3DUGA 2Z28A 1V77A 4XAFA 4C6NA 4IG2B 1V79A 4P5UA 4R85A 1YNYA 1UMLA 4IGMA 3OVGA 1NDWA 3GU1A 3MDUA 2VC7A 3PBMA 4HK5A 4WVXA 3JZEA 1ZZMA 3GTXA 4Z42C 1GKPA 4PCNA 4LANA 3OOQA 4G7EB 4C6DA 1YBQB 3WYZA 1EZ2A 1RJRA 2R1NA 4LEFA 1FWCC 1J6OA 1FWFC 3OODA 1I0DA 3B0YA 3QGAC 4CNSA 4IQJA 2Q01A 2EG6A 2EG7A 1EJXC 3URNA 2VUNA 3LA4A 1ONXA 3UPMA 2GOKA 4WGXA 4F0LA 1V4YA 3DC8A 3CJPA 3F4DA 4CQDA 2E1WA 3GIQA 1FWGC 5E5CA 4RDZA 3NQBA 3SFWA 3AUOA 2E25A 4CQCA 1M7JA 3GRIA 4DI8A 4C6OA 3MPGA 3BE7A 3MJMA 4IFOA 3WMLA 1FWJC 2ANUA 4UB9A 3LGDA 4XD6A 3F4CA 4CNTA 4DZIA 1KCXA 4DYKA 1E9ZB 3N2CA 2OGJA 3AU6A 3TN6A 4B90A 3ID7A 4LAMA 2FVKA 4ERIA 4DNMA 4DIAA 3LSBA 1WXYA 2AQOA 4XD3A 1XWYA 4H00A 4CNUA 1R9ZA 4GX9A 4GZ7A 2BB0A 1J6PA 3LNPA 1W1IE 2UBPC 4G2DA 4B3ZA 1NDVA 1A5NC 2HPMA 2GZXA 3RYSA 4XAGA 3GG7A 5FSEC 1QW7A 3HTWA 4H9YA 4IH3A 4C6KA 4H01A 2EG8A 1IE7C 3IV8A 4F0SA 3PNZA 4PBEA 3T8LA 4KEUA 1JGMA 2PAJA 4KQNA 1FWAC 2A3LA 3QY8A 4IG2A 5G4HC 3LS9A 4J5NA 1EF2A 3WZ0E 1FWIC 4PBFA 4BKNA 3LY0A 4HK7A 4PCPA 4B91A 3IGHX 4EPDC 3ISIX 2PLMA 1M68A 1XRFA 4INFA 5CH9A 3MTWA 4C6FA
chains in the Genus database with same CATH superfamily
4AHPA 1UBPC 3M44A 5G2WA 3U0HA 3DFTA 2WZHA 5G2HA 1NOWA 3HV8A 1P6WA 4JCLA 3WN6A 3MKKA 4LYQA 1GOMA 1O7AA 1ICQA 1E9YB 2PRMA 3PZUA 4OJYA 3W1PA 4JYDA 2YL5A 1OF6A 5U7SA 3P81A 5M17A 3WQ8A 3G0UA 3T44A 2ZX9A 4K7VA 5IFPA 1TMHA 4MG4A 2NQLA 3WQ4A 1AQFA 2QV4A 1CLKA 1LT7A 2FFIA 4XBSA 1JVNA 1JDCA 4EACA 1ZUAX 3UYIA 1RP9A 3AIRA 4DJDD 1S2UA 2C0AA 2INEA 4QX4A 4W8LA 3FHQA 3EBVA 4ATDA 4UFKA 4RZ6A 3G6LA 3TMQA 4N02A 1W1TA 4QJ3B 5FJIA 3IJ6A 3TLLA 4UFLA 4ECLA 1IT7A 1GPWA 1YDVA 3MY9A 3RDKA 4P8UA 3P6LA 4S1FA 1RV8A 1JDEA 1XLAA 3FYOA 3URQA 4EANA 3EMCA 3FN9A 3HGJA 3IACA 2NQHA 2W63A 1XBYA 1XUZA 3BTNA 2E3ZA 4H9VA 1E56A 3BG9A 3NWRA 4CN4A 3W1RA 3P93A 2YA2A 3I3BA 3SGGA 3H2MA 1S1RA 1A49A 4AY1A 3NSNA 1NAL1 3EXTA 3LOTA 2OQHA 2VGBA 2YPIA 2VZOA 3N2OA 2YDSA 1FCUA 3KZPA 4EOUA 4V1YA 2VDGA 5HWNA 5FCZA 4AVOA 3STFA 1W1A1 3NQ8A 6PTDA 2J78A 5C6MA 5CZKA 4ZTYA 1ECEA 4PFHA 3TCEA 1LYXA 4WY0A 2QJJA 4EAMA 4X2PA 4GNVA 1QOXA 1X1OA 3PAOA 3BAIA 1QDSA 3MBFA 4ENLA 2OODA 1TPEA 3UJEA 1T99A 3KE0A 3OYZA 3S5NA 1ITCA 3QZ6A 4CCDA 3TJ4A 1ITXA 4GO9A 4CQ9A 1S2WA 1UR2A 1M1BA 3L4VA 4AY7A 2IPJA 4XZNX 4ZQRA 4LUYA 2VCBA 3KVMA 4QISA 1UB3A 2D0HA 2VEIA 2VENA 4XAYA 3M0XA 4JGDA 4JKLA 3URAA 1PS9A 1R6WA 1XIJA 2ZICA 3ABOA 2GDVA 1I8JA 4FX8A 4NF7A 4KF1A 4QBXA 2F6KA 1CXFA 1BLIA 3A3HA 4JTUA 4DQWA 3OA5A 3VA8A 3AO0A 4CCEA 3NUKA 4XKYB 3FEQA 3V75A 3K1GA 5ABHA 4FK9A 3VNDA 2WM1A 4G6CA 3S5SA 2QZRA 3IUHA 2A4AA 1L2UA 2QCDA 3OVPA 2Z1KA 3N3MA 4NVTA 2X0HA 2PURA 3W7EA 1Q6GA 3CBWA 3CGTA 2L5HA 1H50A 4AZ6A 2PDFA 3BLEA 3IARA 4K39A 3Q65A 2VGIA 4H04A 1DE5A 1U5VA 3KCLA 1X7IA 4WEVX 4DYEA 3AXHA 4A3YA 4J27A 2QCFA 4L4OA 3G18A 2XN0A 3ITLA 3BOXA 2XFYA 5EU9A 4Z08A 4MHBA 1K7FA 2D2GA 2XIOA 4GQRA 4K6AA 3LLFA 3LMYA 3IRSA 3W2MA 2O9TA 5HQMA 3GS6A 4YTSA 3MS8A 3H54A 2QPXA 4QNEA 1G1YA 4EF9A 5TIMA 5DMNA 4H8UA 2OEJA 5B7YA 1V3HA 1XPYA 3MVTA 3PTKA 1RAKA 3LCXA 1JDAA 3W7JA 2QS8A 4LSBA 3TSBA 2O56A 1J9YA 4AZCB 2PDMA 2PU0A 3QMRA 5IRPA 4C5ZA 3SDOA 4JYEA 3PS7A 2Z1SA 2W9MA 3VD4A 4PB4A 1QWGA 3DYPA 4AWUA 1CGTA 4PYSA 1M03A 1I2NA 3NSXA 4LF1A 5F4WA 4C6NA 4K8EA 1V79A 3NZPA 1G4SA 3UEQA 4MMWA 3VZZA 5FD0A 5LKYA 1UZDA 3P62A 1NDWA 3MDUA 4I3GA 1ZZMA 3GTXA 4P7QA 3WLOA 4QG6A 2VZUA 3BLIA 2JBMA 4R5EA 3RJYA 1EZ2A 1RJRA 2VX7A 3HQPA 4LEFA 7CGTA 2GQ8A 3B0YA 1W3LA 3BQ6A 4WDTA 3JRKA 4M6UA 5HPOA 2FMOA 2QLYA 5D2VA 1AH3A 2EAWA 3R5EA 2VDHA 1WE5A 1TPH1 2FPVA 4F2TA 4L1WA 4HGXA 4IIGA 1K77A 3VK5A 3VDAA 2OZ0A 4WXYA 2PLKA 3LGDA 3EYPA 1UCWA 1LL6A 4DYKA 3WX7A 2EPMX 3BW4A 1X1ZA 3L65A 4LAMA 1F76A 2D24A 3UGRA 5JH1A 5EMJA 4WSHA 4JD4A 4MVAA 1BD0A 2C1IA 1C8YA 3ZVHA 3GAYA 3CMJA 1US2A 3C5QA 3GG7A 3UZZA 3CWHA 4IPPA 1PZ0A 1DJWA 5EL1A 4PBEA 1WP6A 3PZNA 4PFMA 3R11A 5E9XA 2BGQA 3T0CA 3YPIA 1I45A 1XYAA 3PG8A 4CNOA 1HGYA 3M6DA 5LNSA 4IIEA 3KRUA 4RCXA 2J75A 2EO7A 1TWZA 1WXJA 1FXPA 2FGLA 3WNLA 2VC9A 4Q7NA 1DYSA 4LC6A 3WK2A 4EIVA 1PL9A 4U5KA 1VFSA 3KDOA 1HL2A 4S2CA 3MU7A 5FJRA 4QLJA 4IISA 3C3NA 4FLQA 1XL9A 1J5SA 6CGTA 1VB9A 4PCTA 1LF1A 1ZHAA 2Y4SA 3MCNA 1ZTVA 3SRDA 4S2BA 1BXBA 1H11A 2J47A 2WKGA 3OLEA 1O12A 3LBMA 3N73A 2CHOA 1V6WA 2CFFA 4TV5A 4J3WA 3P3BA 2YXXA 2PGFA 3EPNA 1X7FA 5D8WA 3NNTA 3S9IA 1DQWA 1UIPA 4GYJA 2XWEA 2Z7GA 3GVQA 1R3WA 4PMDA 1B9BA 1UWUA 5AVNA 3GQYA 2CITA 4LYRA 3BK0A 2EQDA 3F5LA 1G4PA 4ZQCA 8TIMA 1OSEA 3NL2A 1KBBA 7A3HA 1JYVA 1OBAA 4UNLA 1MW2A 2G3FA 1GNXA 1GCYA 2YBTA 3EWXA 5XIAA 4LALA 3LXAA 3S1WA 1XIGA 2BNJA 1CW2A 4N42A 2QT3A 3RCMA 1OX5A 4OGZA 4OUIA 4EXAA 2HS6A 3KCJA 3CAWA 1W54A 4V1XA 2J62A 5I3DA 4KWOA 4PUDA 1SQ7A 1TPC1 1WKFA 4GUFA 5FL1A 1NP0A 1UWRA 3GYEA 3PFRA 4R7WA 4C6IA 5LIUX 4S3DA 1XYLA 3BCJA 3OZOA 4GK8A 1AW2A 4Z1CA 3AWOA 1WZLA 3TFXA 2GDUA 1VJZA 3NXLA 5FJJA 2XN1A 1J0YA 1W1VA 1WPCA 1P0EA 2NWSA 2B4GA 2PDGA 1P7TA 3LM7A 3AS3A 2Y8VA 1GG1A 3W4RA 3H24A 2NV9A 1EIXA 2E0PA 4O1EA 2NSOA 3D5HA 2PGRA 5CBIA 3LGEA 3WH8A 3H12A 3KUMA 3K8MA 3VIMA 4HHPA 1DWJM 5G5IA 3L4UA 5DANA 2Z00A 4BY3A 2QDDA 1A4MA 3AXKA 2Z27A 3S5YA 3OG3A 2WPBA 3GNXA 4GY1A 5HOSA 4L64A 1S5NA 3UGVA 2H9AB 2Q09A 3ARYA 3S1VA 1FWEC 1B30A 3W87A 4UTHA 3G1VA 1XIDA 3B9AA 2HEJA 4KPLA 1E55A 4GVHA 5G2IA 1ZALA 1TV8A 1R30A 3O15A 4J2PA 3EWYA 1G0CA 1P0DA 2EJ1A 1UKQA 3LCGA 2VUYA 2VQTA 4GUIA 4XO6A 1LT8A 2CYGA 2OX1A 1XUUA 2H3DA 2EBNA 1S39A 1PDYA 2XSXA 1EJSC 5DCDA 4DO5A 1P1MA 1H51A 4PB3A 3POCA 3FFSA 3ZVIA 5K9DA 5AVHA 3OIXA 5C8BB 3GZ3A 2NUWA 4S3JA 4C6PA 3PNUA 5I09A 4HYRA 4HZ6A 4RDWA 3M07A 4HN4A 3EDDA 3TSDA 3OIHA 3B0UX 2GSJA 1PBGA 2UY4A 3W71A 4JTHA 1RCOB 2DSWA 5T8GA 4HP5A 2HSAA 1DQUA 2VHLA 3CV6A 1CNVA 4UFHA 3TU9A 1J0HA 2X41A 1B3WA 3T7VA 2PC4A 1FWRA 3WDJA 4A8LA 1AJ2A 4RNHA 4MB4A 4FP1A 5D9MA 2R6OA 2WANA 2Z25A 1UR3M 5G4WA 1LL7A 1N82A 2ASHA 4P61A 2RH9A 3ITVA 1HVXA 3EPOA 1XIFA 3LRMA 1QW8A 3UVIA 1OIMA 4URIA 3RK8A 1NH6A 3M4HA 4G7EB 4K3ZA 4H8NA 4C6DA 4DBEA 3RG6A 1UKSA 2J6VA 3GNOA 1TWSA 1E6NA 4Q8MA 3G5EA 3DHDA 1L2QA 4HPHA 4IQJA 5GJPA 2WVVA 2PCQA 2E4TA 4HPJA 4BWLA 2DSZA 4AWTA 1TB3A 1KM4A 2D0GA 3G6MA 3T40A 3V0TA 2OLAA 1V4YA 2OQYA 3F4DA 1IEXA 4HMDA 1W5QA 3UXAA 3RX2A 1LQ0A 1R3SA 4G56A 3VOGA 4D1JA 4DZAA 1DL3A 3PB2A 1HQTA 3U2EA 4TX8A 1IXNA 1QPKA 2CXGA 4A8RA 1D8WA 4HA4A 2P8CA 2ANUA 1TQJA 3RR1A 2ISSA 2AOSA 2REQB 5FF3A 3N2CA 3RLHA 2CXEA 3H23A 1DHPA 1DIOA 1PKNA 3VGDA 2BVTA 1DV7A 2AQOA 2GJPA 4CNUA 3H4GA 5CLTA 2GVJA 1J6PA 3USZA 3LNPA 1KFCA 4IPLA 4S3CA 3BV4A 5DBTA 5H6HA 5CPQA 4PBGA 3GD6A 2CZDA 1E0UA 4LUSA 3LN3A 3W53A 2C1GA 1JYWA 3CPUA 2BVYA 3BLDA 3VKKA 2VEFA 3MP3A 4X9SA 3FYPA 1ENUA 2ATSA 3ISIX 3DG3A 2XH0A 1IGSA 3NM3A 4EKJA 2PP3A 2WMIA 1KTCA 3A3XA 3GXNA 3G1SA 2OR2A 5EMLA 3AIUA 2PTWA 1H4PA 3LCWA 4REQA 3M0ZA 2QJMA 3CIXA 2OTDA 3I65A 4IMEA 1KFLA 3VGHA 2WMGA 3IV3A 1HGWA 3VD9A 1DWAM 2X30A 3PPHA 2CZEA 2NT0A 1XH1A 3EWUA 4UNIA 5BNKA 3STCA 2Y7FA 4N6EA 2BHUA 4RZ5A 4U31A 3TW7A 4I9AA 4CD5A 4UUIA 3OW1A 5HNNA 2J79A 3W1MA 4BJHA 1HZYA 3H70A 5RUBA 3U4AA 1LUCB 5EMYA 1LP6A 1EC8A 2X40A 4QLKA 3WH5A 4HZ7A 2BOFX 4K8HA 2P10A 4IJRA 2E40A 4BA0A 2V3FA 5HPCA 3N6QA 4J2MA 5DEZA 1QI0A 3WLTA 3SRFA 3W0KA 4LUTA 1PX4A 3G0XA 1E3ZA 1KTNA 4LBRA 1RXOB 4GBDA 1FTXA 5TQLA 3IJLA 1XYFA 3L4YA 1EH9A 1J18A 2CW6A 1A3WA 4Z2LA 2AMXA 3R8HA 1GVFA 1TZ7A 2Y7EA 2SFPA 1C9DA 2PWHA 4LC8A 4XUYA 3R79A 4V15A 2CETA 1CYGA 1FP8A 3WEZA 1UBSA 1EL3A 5HINA 1UZ4A 4TVUA 1I2QA 4IUOA 3H2FA 1W3HA 1J0JA 4N9DA 5HMFA 4I7UA 1AA1B 4KWWA 1ZS2A 1AFSA 5LNRA 5E09A 1ML1A 1M53A 5CZTA 1K4HA 4IL2A 1V6XA 3F2BA 2XVNA 3DCPA 5I3JA 2FHFA 2Q8LA 5DMYA 4GGHA 4WUIA 3G77A 5DT5A 3OGVA 2WMJA 3W81A 3OU8A 1JPMA 1OADA 3BG5A 2YW4A 3W83A 4AEFA 1GZJA 2XTKA 3C3UA 3EEGA 2LLEA 2AQWA 2E8ZA 1AZ2A 2CLLA 1ADDA 4RXFA 4HD5A 4ZB2A 1WZKA 3PWIA 4GI4A 1K8CA 5CXPA 4AIUA 2Y5EA 3WDHA 4D1IA 5BRQA 1TVNA 1F61A 2DT3A 1S2VA 4L1XA 1LOQA 2DT1A 3NQ2A 3N4EA 2WMFA 5GPRA 2ESCA 3BMVA 2EKCA 4E8DA 2HNHA 1UD2A 2PD5A 1DWHM 1RBOB 5CKSA 1AQMA 1N8IA 1XC6A 2BODX 4NJGA 1THFD 1XV8A 4UCFA 4R53A 1B3OA 3VM7A 3U5YA 3IK2A 4Q22A 3SQMA 1H63A 4JXCA 4KESA 5BRBA 2YJQA 1W3IA 4XTDA 4KRZA 5JVLA 4AVFA 1MMFA 3T09A 1W3TA 1P4CA 2P8BA 5H91A 3U2OA 2XIBA 3QR1A 3LXBA 1OCJA 4DXXA 4HHHA 4YYCA 2BY0A 1PHQA 2G3JA 4EE9A 3CZ8A 4GWEA 6ALDA 3GHRA 1VFTA 4B2DA 3NQGA 3VIFA 1RA5A 1GWJA 3C0QA 5C5YA 3RF9A 2R24A 1QHZA 3V0UA 1W9UA 5A6LA 3K1DA 1EQPA 1JNEA 1K9DA 4YPJA 2VWTA 3V7PA 3WQWA 2E9LA 2R8WA 5G4EA 1E0WA 2VO5A 3M5XA 2FVLA 1EJVC 4GOAA 1OD8A 3KRZA 4DO4A 4XB3A 1Z48A 3RRXA 3MO4A 5CG7A 4WDWA 1RCXB 2F61A 3TAKA 5HNUA 2VXNA 4WIWA 2Y5JA 1W32A 2DSKA 2XU2A 2XVLA 1FFQA 1W37A 4MWAC 4D6GA 2ISFA 1UPMB 2QDGA 3K4DA 1NFBA 2Q8XA 3G8EA 2R9RA 3LBOA 1XLBA 1H1YA 4MOZA 2PDKA 4GBUA 1HXJA 1WDSA 1T96A 4DJDC 1R5YA 3CHDA 4HYWA 1PCWA 1QTWA 3HG4A 2IQ0A 1K6AA 3EKGA 1Z69A 3LM3A 1E4IA 2VT0A 2ZRZA 4CNSA 3VXGA 4OE7A 1FRBA 2PCEA 3V36A 1PX3A 1TPFA 5BOOA 4IM4A 5HR7A 4KCTA 1FHDA 4F0LA 3VIKA 4MGGA 1UROA 4KKXA 3WLLA 3JU2A 2J9ZA 2VX4A 3LXCA 2PDUA 1V3IA 2WMIB 3FOKA 4KW2A 2DZPA 2V5LA 5FESA 3EMZA 2GUUA 3UG3A 2J9XA 4PEKA 3CPGA 5AYXA 1XM3A 2G0WA 3SUWA 4B90A 5C9WA 3NQCA 1QNRA 5J5DA 4ZCWA 3CZKA 1EWDA 3VIPA 4G5DA 3NOYA 4B15A 3TEVA 3EAUA 1N55A 3PZIA 4G2DA 2HPMA 4ML9A 1K02A 1GONA 3NQVA 2I5IA 5BZAA 5DCEA 1US0A 3DG7A 4PMOA 2FDMA 1LWHA 1Q6LA 2ZUVA 3NAVA 3WZ0E 3LTSA 1QWKA 3THUA 4CU8A 3W72A 4GUHA 2RGMA 2ZWZA 3LCLA 5FEPA 1VFUA 2R82A 2Y62A 2P0IA 3TYDA 4Z0SA 3W9ZA 3IJDA 1JCXA 1VH7A 1MSSA 4NZCA 4WD0A 2Y89A 4O57A 2I1OA 4PMQA 1POJA 2NVAA 2PLJA 3C2EA 2ZCGA 1B4EA 3L4ZA 3NQDA 1JG9A 1UD6A 2VVNA 1WKYA 3Q45A 4B3KA 1IR2A 3H4WA 4KFPA 3C2YA 3LX9A 1E6ZA 2EXOA 2BV9A 2HBXA 3R2GA 2VI0A 4AFYA 3CHEA 3S2LA 3KTXA 2CLFA 4E3TA 2G41A 4PUNA 2VD9A 2BZNA 1ISZA 3KHJA 1J10A 3NL6A 5HMEA 1ODZA 1REQA 3TOYA 3DFYA 2E6AA 3AICA 5MHBA 4IFKB 5JXQA 3T0BA 3I6RA 2Q3RA 3QTGA 2WBGA 1VLWA 1TUFA 5I2UA 2YR1A 4AIBA 1TQXA 4JTIA 3QV8A 1RLDA 3ZQ9A 3ZLHA 1LLOA 3HPZA 3KW3A 3ES7A 1FWNA 4JFVA 4MNKA 2YLLA 4LBSA 2I9UA 1V3KA 1VQTA 1FCQA 4D2JA 4FR6A 4BEQA 1GVIA 1C3FA 3L9CA 1EJWC 2B81A 2MUCA 3CMFA 4JDYA 1AK5A 3AYSA 4O17A 4PSRA 4DM2A 2XVGA 4LS1A 2J7DA 1EX5A 4H19A 3SJ3A 4FXRA 1MW3A 2WSYA 1TV7A 3EB4A 2V3GA 4G7FA 5CPNA 3QFWA 1IXOA 3LQGA 4D72A 1R86A 3WLMA 3GXDA 4CCZA 2YL8A 4UFMA 1UA7A 1UZHA 1TVPA 2J7EA 4MYAA 3U48A 3FY1A 3B8SA 4DF0A 1CXLA 4MPQA 3R0DA 2V0TA 4DM1A 2HMCA 3K8LA 4GYPA 1LG2A 2J74A 3S47A 4NZJA 2DIKA 4QJ1A 3VDHA 2Y7DA 3WFZA 1W2PA 2WWCA 1EXBA 5AHNA 3OGRA 5A95A 2ZC1A 3ITCA 2CU0A 3NDOA 1K9EA 4UTKA 1OGGA 1HP4A 3W76A 3UW6A 4NASA 2PRLA 3BAYA 5BRPA 2WHMA 3R0KA 5AHEA 1H7PA 5E6YA 1NWTA 3LTYA 3NXFA 4S3BA 3TE9A 2GL5A 3RM4A 3UXDA 4GIAA 2ISVA 4Q4QA 1O60A 5CBJA 5DMMA 2FIQA 3N2BA 1NEYA 4GJIA 5IHRA 5HJLA 1CPUA 3TN5A 1E3XA 4WDXA 3E38A 5JBFA 2IQDA 1W1PA 5AFDA 4CEUC 1EQCA 4LCQA 3F7JA 1YLVA 1TJPA 4GXMA 4JOMA 4ZB0A 1TR9A 4MADA 4IJBA 2QJHA 4OV9A 3VC5A 1XCWA 2FTWA 4PN2A 3QZAA 8XIMA 1NARA 1S2CA 2FB3A 3TXZA 3VIIA 1F7BA 4GYFA 2QUMA 3A12A 4C7GA 3LGGA 3V3WA 4HU8A 4N0RA 1S5TA 3DI0A 4UTFA 3BG3A 3TTYA 2CHRA 1QK2A 2OQLA 2KZHA 2O9OA 4LJ3A 3MSRA 3QMSA 1DWFM 4GCXA 2WHLA 4UWMA 2GGEA 5LGZA 1EOMA 1E0VA 2VX5A 3MJYA 2WJFA 3BXWA 1SFLA 3T78A 3VKAA 5I3HA 3WF4A 4DO7A 4U2ZA 4FOJA 3VU2A 2WZMA 2DPEA 2OWWA 4AMCA 1RHCA 4K1WA 2ZXBA 4WSJA 3SCRA 1XF0A 4UC5A 2QQ6A 3GY1A 3BLLA 4MKSA 3E3HA 4HA1A 3C86A 4A05A 3LYEA 2DSUA 4E2DA 3P5YA 3IJIA 1TCDA 1XG4A 1CXEA 3G8RA 2HWGA 4XKYA 1J5TA 1QPRA 1K6WA 4TXEA 4IMDA 4KERA 5XIMA 1EJUC 4CQAA 4CLMA 3LPFA 1DIKA 3THCA 3PPCA 1KBKA 1KGWA 1O1HA 1UMLA 2J7CA 5PTDA 3ATZA 4XZMX 4UOZA 3P8IA 3RLGA 3T2QA 3FXYA 4CVUA 4MZYA 2WB5A 4WKHA 3B03A 2QCCA 5LYRA 1Y5VA 3HIJA 2JKEA 1V5XA 4KRTA 1C9WA 1I0DA 5FACA 3MV11 4O8AA 4MWAD 5LZLA 2Q01A 3N9SA 3OBAA 4JNMA 3O06A 2QDHA 3OLGA 1KV8A 3D3FA 4UQBA 4O1BA 1G4TA 3VNIA 4F4RA 1ME8A 1C92A 1TR1A 1XH0A 1MQRA 3VE7A 2XH2A 5HMSA 1F3TA 2F2HA 4L7ZA 3GRIA 1A5AA 5ECVA 4IFOA 3MPGA 1J12A 3EPMA 2CBJA 4RJEA 3TQVA 3RPTA 3M7WA 5XINA 3MUIA 3FYYA 5CCZA 1W6TA 3NR0A 2FZNA 1JGIA 1K3UA 1JIBA 2JIEA 1AMKA 2V81A 3GDTA 1M7XA 4ZVJA 2PWUA 1SVDA 3GR8A 5F2GA 3PTMA 2OELA 3VCNA 4GD0A 4ADUA 5D05A 1C7SA 9XIAA 4TTGA 1QCWA 1MRQA 3VPLA 2B7QA 2BVDA 3WH6A 2YA1A 5CJMA 1YPIA 5HUPA 3MO7A 2OSYA 5REQB 4Y90A 1JQVA 1MUWA 3W7PA 4A35A 1QMLA 4O8RA 2E6FA 3LRKA 5AC7A 4XISA 1EOKA 1YNPA 1HKKA 4GVGA 3V1PA 2YW3A 1EGVA 4FOKA 4ZGYA 1V8EA 1JZ8A 2QPUA 3AUJA 3IWPA 1GKRA 4DY1A 4AD4A 3UR2A 1MWOA 4AWSA 3SIZA 1KKRA 3AHXA 1LWIA 2DUZA 1V0LA 3PZQA 4H6RA 1FDZA 1VRXA 4DJFD 2OYKA 3COTA 3ZS4A 4QP0A 1CWYA 1EX1A 3BGAA 4LAOA 3DIPA 3F2DA 3GSMA 1QOQA 4N7QA 3OO2A 6TAAA 1J2BA 4GCAA 2NUYA 1TPDA 3E2RA 1AQHA 3TDFA 1F6YA 5EPDA 3PVFA 4Y9AA 4NZ1A 1DXFA 4RV3A 2UWFA 5ABFB 3UPBA 2A21A 2WSQA 1BHGA 3G0SA 4GQ0A 5AZ0A 2GWNA 4XVDA 2CLOA 2E9MA 2VDIA 3SCTA 2P1FA 3TYCA 4I6VA 2QCGA 3CL8A 2DU2A 2YLAA 4GA8A 3RLUA 3STGA 1HP5A 4P8WA 1UP3A 1PO9A 2PGWA 1RVKA 3GU2A 4C1LA 3DKLA 3SCVA 4C1KA 3B9OA 3JUGA 4FALA 3GM8A 2GSHA 1Z9AA 2JKPA 1PKMA 3SR7A 1FVPA 3A21A 4FR1A 4WDUA 4CEXC 3NZQA 1W3JA 3OLIA 3CXOA 3E2VA 2VM8A 2E7FA 1VCGA 3W7DA 1VFLA 3SCWA 4IJCA 3EOOA 3LHVA 3VAVA 3TP4A 4GZIA 1VPYA 3GDLA 5C9XA 1QI3A 3P60A 3B0XA 3NQ7A 3W86A 3QOKA 3D6NA 1M65A 2Z29A 2ZTKA 4JNYA 1PKLA 2RGLA 1BG9A 3WUFA 1F07A 4DWSC 1RJPA 3IIOA 3NEHA 3W2NA 1KR0A 4GXPA 3CYVA 2I9EA 4MTVA 3O0KA 4JKMA 1GGOA 3W1QA 1H7OA 5JMUA 2GQ3A 3RMJA 1WXZA 3GVVA 4KETA 3IUIA 1XSJA 3M5VA 1TE1A 1XLFA 1VC4A 2QJNA 1KXTA 3EWWA 4FOUA 2VC5A 3FJNA 3NPXA 1TJ2A 1YBQA 3OA3A 1VBHA 3WL0A 4DXKA 3UJSA 1BVWA 3RILA 3VNKA 1TTQA 3QGKC 1CB2A 3BURA 2HNEA 3R4IA 1E1CA 2OYMA 3CQKA 1B2YA 1GEHA 5JIPA 4E4PA 3ZM8A 1HJVA 4FXSA 3CK5A 4EWJA 5F1UA 2DGAA 4R9XA 4O11A 3FKRA 1G6CA 3RM9A 4UTMA 4HNTA 4QE4A 4H8VA 5CGTA 2JIWA 3SCNA 2V63A 2PDQA 1PUDA 4ZFMA 3CWOX 4ICMA 1V7AA 4GI6A 3W2JA 3QHMA 3CWNA 4JPGA 4WX2A 4NZ4A 5DMLA 5LNWA 3THAA 3W1UA 2BBFA 1A0DA 3GYCA 3QLLA 4HNNA 2R1LA 3MV01 4J4KA 4DELA 3CHVA 3WD2A 2AMGA 2WJZA 1KFEA 1ZJHA 3VINA 1ZFJA 1Z41A 1VFOA 4H9TA 5M2FX 1J79A 5FEXA 2ZUNA 1JAKA 4JS3A 1E6RA 1DXEA 1X39A 5CQ1A 1K8YA 4AC7C 2FQIA 3N4FA 4C60A 3V16A 4WY0F 3TQPA 5A6BA 4FLRA 3VCRA 4MJ2A 3UWUA 2VZTA 1QNOA 2J7HA 3WIJA 1QI4A 3FA3A 1ZP4A 7XIMA 1JQXA 4TR9A 3ARQA 1JI1A 2HE8A 1TE6A 4L6HA 4OBRA 1VBRA 3CT7A 4AUBA 4W4QA 3GU1A 4LY8A 1W3KA 1T41A 4BWLC 4JN7A 3T0TA 1VIZA 3P2VA 4XVEA 4Z42C 2DIJA 7REQB 4LANA 4B4FA 2XGZA 3RIKA 2R1NA 3ZR5A 1V3LA 1DEDA 5BWAA 3V4BA 2ZZ3A 5T26A 1C90A 4CU6A 2VUNA 5M3WA 1X8CA 5CLWA 2J27A 5REQA 2ZIDA 3KS5A 3L5MA 3MUY1 1FWGC 4POCA 4IMFA 3SUTA 2GDQA 5SWUA 1W9BM 4LWWA 3SFWA 4U5IA 1OFBA 3VFLA 4D6EA 3B06A 5KZEA 1O1ZA 5DY3A 3GK0A 3AYTA 3BE7A 4NI3A 4PRTA 1XLLA 3ABZA 3WENA 3L0NA 1LORA 1UR9A 3UWQA 4LAUA 4FNQA 3AU6A 3TN6A 3KXQA 1W8GA 4F0KA 3WELA 2C15A 1XRSA 2F7FA 4H00A 1LQ2A 3T4CA 3N2XA 3W6MA 5C70A 2JKAA 1A3XA 1SR9A 2XDFA 1PZ2A 2HROA 2YDRA 3EX1A 3DFPA 1WBHA 1CEOA 5D38A 4GIYA 5E9AA 3B8VA 5LIYX 2FKPA 3N04A 1K9FA 1QW7A 5T9BG 3ZJ7A 3L0GA 5CPLA 4DUXA 2QGHA 4HNVA 2PAJA 1FWAC 1UOZA 4L4MA 4WOQA 2ZUSA 4B4HA 2YFNA 4B91A 3W23A 4JQAA 1E1EA 2EEXA 3IGHX 4Y7EA 1T0OA 2A7PA 1YYAA 3IGUA 3WLNA 4BI6A 2WLYA 3MDWA 4GVIA 4GVFA 1W9XA 5I0DA 1IHIA 2WVVB 5D03A 1UJPA 4AIEA 4DI9A 5KEZA 1JI2A 1Z6KA 1EDGA 3GBEA 3CH0A 4LW7A 4DO6A 4H9UA 1BSLA 3AJ7A 3DN5A 4CD6A 3T55A 3OVRA 3H2CA 1YXDA 3HF3A 2DZWA 1WUFA 1IXPA 4TVDA 1EHNA 1SMAA 1XBXA 2VVSA 4X60A 5CG0A 1KBLA 4PUKA 2E68A 5AB3A 3GX9A 2E5CA 1RK6A 3GNDA 1BAGA 2PMQA 5CSSA 4X2RA 1FY6A 4RK8A 3PBVA 1G01A 4XD4A 2QDEA 1PYFA 5I3GA 3IJ8A 1SGJA 4FZIA 4DAFA 3F03K 3B05A 4QG9A 3KTCA 1IZCA 3IANA 3UF9A 4M3PA 5GNYA 4Z2IA 2C1HA 2INFA 4ZL1A 3LRLA 4A29A 4NZ3A 1EYEA 3KS6A 5CPTA 4HSOA 1CXKA 4AB4A 3GR7A 1Q45A 4XAZA 1K70A 4XZWA 3L5AA 3PHAA 4B9ZA 1B4KA 2X1RA 4O10A 4C1NA 1I4NA 4BI5A 2I57A 4H2HA 3WUEA 1Y8BA 3U2ZA 2IKHA 4FO4A 4GE8A 1OFDA 4Z1YA 5HJXA 4IHCA 2YZ5A 3TMLA 4OIFA 1TV4A 4RDVA 4ML4A 1VENA 1TPWA 3VGEA 3QMTA 3NL3A 1EEPA 2YOCA 4UR7A 6REQA 2BX7A 2WQPA 3L66A 1Q5MA 2I5GA 4O4WA 1BYAA 4Q8PA 3SUUA 2G97A 3NO3A 4EK7A 2VEKA 4PTXA 1RQHA 1A0EA 4PL1A 1FKWA 4JTRA 1JXKA 1IWAA 4Y96A 4AEEA 4DN1A 1JUEA 3QF0A 4DLFA 3VILA 1YKWA 4D6FA 1ITQA 4B5XA 2KAUC 3M43A 3E49A 3PULA 4JQ1A 1G9HA 3GH7A 1V08A 1M3UA 1I9CB 3MVIA 1Q6CA 5CAKA 1KBJA 1ONEA 1TSIA 5HNRA 2QJIA 4ZQPA 2DH2A 1R3TA 4QJ5B 3UBPC 2G50A 1BWKA 4LUTB 1LTDA 2WYSA 4J3VA 1KM2A 2ZUUA 2H3BA 1WB0A 1NM9A 3OTRA 3PANA 4Q7IA 4DUOA 3N6JA 4ZEPA 2QMJA 1TA3B 4E38A 3GTIA 3G3DA 3M1ZA 4PUJA 4LVDA 8CGTA 3PG9A 1VD6A 2KX9A 2INZA 3H26A 1JF6A 4RDYA 3GVWA 5HR6A 2YX0A 3GG8A 4HSHA 1H49A 2Y5SA 2H90A 2QMKA 3O1NA 4F0MA 2VURA 2VR2A 2HK1A 3LQLA 2WHJA 4IMCA 4ACZA 4ZENA 1F73A 2YB1A 3KOXA 1H7XA 3J7HA 3QHOA 4WJXA 2OYLA 2ZVIA 3DFHA 1DJHA 2VFHA 1NY1A 4Z2GA 2DFAA 3BJFA 3IEBA 4IUGA 3VOIA 5DELA 1GOIA 5LSMA 3W28A 3S0CA 1L8NA 2QCLA 4DVOA 4KT2A 2V38A 1V3MA 3MMUA 2C91A 3M7SA 2PEVA 2CEQA 3MWCA 4MWAA 5EGRA 1OJXA 3HM7A 2AGKA 3TAOA 1CGUA 1GKQA 1OG0A 3AZTA 3KLKA 2WSKA 4W9TA 5I77A 5E93A 1JXJA 2WNNA 1QUMA 1HL8A 4TQTA 1EC7A 3A5VA 2PF0A 4ATWA 2CLHA 4NX0A 3LLDA 4MJ4A 3UZYA 2IS7A 4LYKA 4A22A 1W8SA 2VC7A 4KIEA 1XGDA 3E5PA 1TUXA 1D9EA 2ZADA 1M9HA 2ZBTA 1VLIA 3QR3A 5B7ZA 3AIWA 4JN6A 4R27A 3RITA 1H61A 1H7RA 5BMXA 1SFTA 1ZAIA 4QJ4B 2P5NA 2OEKA 4PRWA 1UASA 3GNNA 4E5TA 3K8KA 4UIOA 1IQ8A 5AC5A 4AISA 2AL1A 5IBXC 3GC5A 3WKZA 2Z7KA 4RDZA 1J0IA 3A4WA 2CLMA 4QG8A 4S39A 3PZVA 4M81A 3L67A 3G1DA 2XH7A 3W7KA 3MA8A 1DVJA 1EIBA 3T8QA 2X09A 3WMLA 3S5ZA 2HV5A 4JCMA 2P88A 2YDQA 3ZJKA 1HJWA 4AD2A 2FVKA 5KINA 4DNMA 1MNSA 2DW7A 3P80A 3EWBX 2DT2A 2WCSA 3LHTA 1V0KA 1U30A 5AHFA 1W1IE 4UQDA 4GH3A 4B3ZA 2BHZA 4Q4PA 4NJKA 4MB3A 3BW2A 5FSEC 1QNQA 3IAQA 2FHCA 2NQ9A 1UR4A 5FJOA 2G8ZA 4O1CA 1ODUA 3AJXA 1JULA 3N14A 1R3VA 3DHFA 4YCOA 4NHVA 2YXGA 3R89A 2YCJA 3B8IA 4Y2WA 2PWEA 3C52A 3HZ3A 2VFIA 2OLSA 3LI1A 1Y65A 2HPIA 3L68A 3LHYA 2HS8A 3WBAA 4QFUA 4M29A 1MNZA 3FJ6A 4NU7A 1BKHA 2VFFA 1WYIA 2V5DA 1QPOA 1KM3A 4D8ZA 4FIRA 3CLMA 4E4UA 2V3DA 3BMXA 1TJ1A 4TV6A 3QSTA 5I07A 4E2VA 3STEA 1JPIA 1DWIM 4R34A 4MFDA 4GH1A 1OFOA 3AOFA 1S3HA 4PMVA 3PM6A 3WQVA 3LLXA 4W7VA 3W3OA 1IIHA 1HFBA 1H0GA 1V51A 5JU6A 4WR3A 3PK7A 2OWXA 3QTPA 1XR2A 1US3A 4XBJA 2R94A 1EPXA 1LROA 2WLZA 5F2IA 3TA6A 1BRLB 1YADA 2E77A 4HHLA 5KSWA 3HJEA 1BEUA 2ZXQA 4D6IA 4GX8A 4AD0A 1W31A 4UTTA 3KBMA 4AZHA 2WSRA 1P6CA 3L12A 3ARPA 4LVAA 1SJCA 3S2NA 3WSUA 5C2GA 3IS4A 3PTDA 1FWDC 4ZO6A 4M6VA 2Y85A 3CL6A 2J13A 1DIEA 4H9MA 5K2ZA 1TPB1 2D2HA 3W7OA 4QEEA 2YBUA 2J66A 5JIWA 3SN1A 3B0VC 1R8LA 3CUXA 2ABAA 1P6BA 3PZTA 1VYRA 4H1ZA 2PWDA 4OWGA 1KNWA 3BGJA 3FA5A 4PA8A 4ERAA 1A5CA 2C16A 3BJSA 1XHGA 4UTUA 4L9ZA 3BUVA 3N34A 4LT9A 2HRWA 2FGBA 1SW0A 2ZDSA 1R3YA 3B8TA 1HN1A 4M6PA 1V02E 1UKOA 2X1IA 4WK9A 1UD4A 1OX4B 1E71M 4JTFA 3HO8A 5DT7A 5T9CE 2GPTA 5A6JA 4Y9PA 4EF8A 1U33A 3MZ2A 1XXXA 1TTJA 2FZDA 4NXSA 2DP3A 4TMCA 1BFNA 3CMGA 1JYNA 4L80A 2ALRA 1NDZA 1KFWA 3K13A 1JRCA 2BY3A 1EWEA 3IVTA 3UZXA 4C90A 1YEYA 2Y1HA 3TCSA 5KTLA 4FPSA 5CPSA 5EY5A 2VTFA 4PTDA 3ARUA 4PR4A 1RK5A 3ARTA 2TAAA 4GNKB 3WQCA 1TELA 3FAWA 3HA1A 4UZUA 1ME7A 5K4ZA 1XLHA 2C79A 3E12A 2YYUA 5AYBA 3W88A 2VGFA 3FLUA 2CKSA 1RQEA 3RGTA 2CPUA 2GYIA 3R58A 2WCGA 5I7GA 3VNYA 3W7MA 2QCHA 1M41A 9RUBA 3VNZA 2QIIA 1N8WA 4G7EA 4ZO8A 1A53A 2Z1XA 1E9LA 3LNMA 3GBDA 4DPPA 1CGXA 1NFPA 3BAXA 3UNTA 2EHHA 3AIEA 3M9YA 2POTA 1UP2A 1AD4A 3AWNA 4M51A 4B9YA 2BLEA 5C2CA 1YDOA 1HNYA 1MQQA 1W5NA 3P74A 1GOWA 3SB0A 3O05A 1CXIA 4ZMGA 2C6QA 1AG1O 5BU6A 1JZ3A 3IK4A 4C6CA 4MJMA 3EXRA 1H2JA 3SZ8A 3UA3A 4Z0JA 4DJFC 1TYGA 3OQEA 3VKDA 3WH7A 3PUDA 1MW0A 1PTDA 2GJXA 2PDBA 4GUJA 2Y8UA 1Q2SA 5F2LA 2REQA 3TKFA 3DC0A 5I02A 3FAXA 2VFDA 1V77A 1H0IA 3TR9A 5C71A 4IG2B 2P3ZA 1R47A 1A5SA 3MI6A 3OVGA 2PC8A 3FA4A 3W7QA 5EB8A 3FSUA 3GVGA 3WQOA 2BXVA 4A3QA 5FJTA 2AAAA 5EFDA 1SSDA 4O15A 3WMSA 3UCQA 1FWFC 3WQ6A 1W9VA 5DF0A 1PZ3A 3S42A 4NJHA 3NZRA 4NX5A 5BXSA 4YVPA 3M0LA 4ZOCA 1MEHA 4OU1A 2X42A 2YCKX 2BDQA 2CBIA 3GIQA 5E5CA 3BPWA 3AUOA 3TWBA 1XGZA 2BWGA 3UZWA 4FB7A 4MIMA 4Z1BA 3F4CA 5HANA 2ZTJA 1FDYA 3W24A 1UWAA 3O9NA 4CD4A 1PIFA 4PCFA 3TXVA 3SCQA 5C7VA 3ID7A 1TO3A 1JCNA 3ENLA 3U57A 4XD3A 3CIVA 2CBVA 1TRDA 3WQ5A 3T07A 5D9OA 3IIVA 4AD3A 1TREA 4XKMA 1VR6A 1XKJA 1NDVA 2GZXA 3QZEA 2IW0A 1SYTA 4GC4A 4W8AA 4Q4RA 1P48A 4MLRA 4H7ZA 4FNPA 4YTRA 4F0SA 5CGMA 1OZMA 4JFTA 1UUOA 1WNOA 4V33A 2X8RA 1E72M 4HSNA 4QDMA 5CEWA 1GQLA 5KZ6A 3DECA 3OEXA 4HK7A 5D02A 3B9NA 1PVNA 4MB5A 3W7CA 3ZOAA 3W1LA 1N8FA 1OZQA 4U3CA 2QUUA 3T08A 3AXIA 1XSIA 4J35A 1DOSA 1H7WA 4FXFA 2J4GA 1L6WA 5M5DA 2FJKA 2FZ9A 1T5AA 3IAPA 2NLIA 1GOKA 3AROA 3CAKA 4Y6GA 4GY7A 1HL9A 5BXTA 2GK1B 1S46A 1RQBA 3TNBA 2JGQA 1CGYA 4ERGA 1WQ5A 2YBVA 5MKGA 5A2CA 3R25A 3TYZA 2FB2A 2DH3A 2ZX5A 3NQMA 5DO8A 3UU0A 3KBVA 4HT3A 3FXGA 2PBGA 3A47A 1Y5XA 1C93A 4DWDA 5B80A 1NU5A 3SM0A 2A0NA 3QC3A 1UWTA 1OYAA 5GNXA 3KFTA 3VNLA 4AX7A 5I03A 1QHPA 4C6JA 1C7TA 1BXCA 4GQGA 3T9PA 1EDTA 3W7RA 3WD1A 2ZZ1A 2ZRVA 4F2BA 3P14A 4KWVA 4GQBA 4HK6A 4JX5A 2W3ZA 2X0YA 3A13A 4AXNA 4DJDA 3C2OA 3EA1A 1E51A 5A8NA 2C8NA 4L5ZA 3LK6A 2NXHA 2QVNA 4LH8A 3V1HA 4P8XA 4JFWA 1WA3A 1NQKA 1K8XA 1NFGA 2CESA 3BO9A 1TPUA 3AIBA 1Z8AA 3GTFA 1QOPA 2PU1A 3W7NA 4RNIA 1B3ZA 5CSUA 1PV8A 1SZNA 1VJSA 1AUSL 3R43A 3KBWA 3BL3A 4QLLA 2VEGA 3S1GA 1BPLB 3O63A 1DWGM 5GJNA 5F2MA 1H60A 1EUAA 4NILA 5CC7A 1B1YA 2H8ZA 5FF4A 4FLSA 4JTSA 3G2GA 1EP1A 1VCFA 3UXKA 2VMFA 1GEQA 4B16A 3GDKA 1M01A 4FXJA 2ACRA 4KIRA 1LLZA 2J7FA 3SY5A 4DWSA 2HXTA 3BICA 4IX2A 3VFCA 4W87A 2RFGA 4WKAA 3IVSA 4I7WA 4ZO7A 3S3GA 2IKIA 3BSHA 3CUZA 2D2OA 3UXLA 3N1AA 4JEQA 3LUTA 3E1F1 2E8YA 1XIHA 4Q6JA 4BF5A 2BGSA 4WXZA 4IGNA 4DX3A 4JTGA 4JR5A 4JIHA 4MM1A 2JALA 3CS2A 1OIFA 2IKGA 5D33A 3TYUA 3IGXA 3UETA 1B9ZA 4D9PA 3ME3A 2UY2A 1LJYA 3P7YA 4X0VA 2XIQA 3O07A 3PZOA 4US5A 2PP0A 3DENA 4IZGA 2ISDA 3A24A 5FIPA 3ATYA 5D2TA 1GJPA 2IMRA 3UR8A 2OKOA 1X98A 3BAKA 4GIRA 3GXTA 1QNVA 4YIWA 5I06A 1M6JA 1R7OA 2D3LA 3PSWA 2ZC8A 5BOFA 3HFYA 1GG0A 4GRSA 2YYTA 3AISA 3S1UA 3R7MA 2RDXA 3U5UA 4M0XA 2ADAA 3MQTA 4B3LA 5HULA 1JEZA 1JJKA 4LUSB 3PF3A 1E6SM 1Y0EA 1KCLA 3DUGA 3F4VA 2H9AA 4OUEA 1W9DM 4G8TA 1MFUA 3QM3A 3E96A 1GW9A 4MNJA 2PDCA 4RV8A 4ZQOA 3OZMA 2J77A 1Z42A 4NUWA 4HMNA 1V0MA 1E4MM 1NF0A 4GYKA 1IXQA 4D6DA 4S3GA 2PWVA 2XINA 1MI3A 3ARXA 2GVEA 2VX6A 2EG6A 5H8UA 2J9YA 3I10A 1ZCOA 4JFUA 4YXGA 3UVAA 4WGXA 4B5UA 2E1WA 4LB4A 1JCMP 3TX9A 4ZXOA 1VP5A 1PJ9A 4MY1A 1JCLA 5AHIA 1EDQA 1DORA 1GVEA 4P7RA 3PPFA 2Q8ZA 3KRSA 5CBBA 5FF0A 1FWJC 4KGLA 3UYCA 3EDJA 2H6RA 3KVLA 3HURA 4N2YA 4S38A 3QV7A 5DXYA 3QR0A 3TOPA 1MEIA 3GFYA 1M04A 4LU0A 4QM1A 4HPNA 5IXEA 3WQPA 4HYVA 1ISXA 3H7UA 3PR2A 1X6NA 3HPXA 3A9IA 2C13A 2PDNA 2HE5A 3L2LA 1B3YA 1DKWA 3H2AA 3M0JA 4HNCA 1J0KA 4AZGA 4AAJA 4ZO9A 2Y6ZA 2I16A 1BGGA 3T8LA 1ZSXA 3WK1A 3KOWA 1BTMA 4D6HA 2CZFA 3E6EA 4O1DA 2X16A 4EXQA 4BQ2A 2A3LA 2DEPA 3MUZ1 2ZWYA 1LRNA 3INPA 3LY0A 4PCPA 3NO1A 1UOKA 4GJ1A 3S6OA 1LOLA 4AZBA 5CH9A 1ZBKA 1WO2A 3P61A 3SQSA 3FCPA 1MVYA 4O53A 5A94A 2EPNA 4XG1A 3RO6A 4ORMA 3G1RA 2QEZA 1RD5A 4S3KA 1KRAC 3NEVA 4RE0A 1ZCCA 2HVMA 3ARRA 4NZ5A 4Q4KA 4HCLA 1QAPA 3PB0A 4E8GA 7ENLA 3WCZA 2B7PA 1MUMA 2GQ9A 4IP7A 4CD7A 3DOPA 3QYQA 5BOEA 2V5JA 5I3IA 1QO5A 4Q8WA 3TVAA 3WD4A 3T81A 1B5TA 5E0FA 1R3RA 5BWFA 1OEPA 4ICCX 4IQDA 5L6UA 3TTOA 3W6LA 2QNEA 2PPGA 4DJFA 2DJXA 3AMKA 4LAKA 3P82A 4GYPC 1IYXA 3UFYA 2HK0A 3OQ8A 3LZ5A 3VZXA 4HOXA 2G96A 1AQ0A 1A47A 1FCBA 1HKVA 4HCHA 4HU3A 5BMWA 4QEHA 2FTPA 4Q7BA 4PTVA 2B31A 1TRIA 4YYFA 3SGZA 4TVCA 1SFJA 3T1GA 3BWWA 4AX6A 1FP9A 1OCQA 1EJTC 1B31A 2XFRA 1KA9F 3WEMA 2NT1A 3CL7A 3EKZA 3IJQA 2XHYA 4EXBA 4C65A 3GTNA 1FWHC 3GU9A 1XQKA 5EMUA 4AF0B 1E6PA 3WJWA 2O7SA 1T6MA 4XO7A 4M1RA 1QT1A 3CPRA 4FS9A 4O19A 3SSJA 1VZWA 1KLYA 4PUWA 3HG2A 3UR5A 3AIQA 4AIOA 3W07A 1GW1A 2O4QA 3ZSTA 3NQFA 1VF8A 1XSKA 4AYSA 5AC4A 3GIPA 4E6MA 3B8WA 3CQHA 3LCHA 2WVTA 3WK3A 1JAEA 4PMXA 3WQGA 1U2YA 2PRHA 1WAWA 1NIUA 3HU7A 3EOLA 3MANA 2VCCA 4MJZA 1LUCA 1L0PA 4X9YA 2FZMA 2GSEA 3SUVA 4X61A 4P7NA 3WLQA 3BW3A 1PZ1A 1ZJIA 4LB3A 4J40A 1JD9A 1X96A 1HKWA 1YXCA 4L6DA 4C7DA 1Q4WA 1QASA 1HG3A 2XFFA 4HJWA 2W27A 3KP0A 3R10A 3CUHA 1G7UA 3K30A 4RPPA 4ZTXA 1UD3A 2QKFA 1X8FA 3S83A 1TCMA 3VYLA 1X97A 5LHFA 2BVWA 5J5RA 3UZ5A 3RMEA 4UTWA 3M5ZA 3OHMB 1ZQ5A 3H53A 2Z4GA 5DBUA 4O54A 3W22A 3C8FA 4LCSA 1LM1A 2GVLA 1RH9A 2A3HA 1K7XA 3CV7A 2WWDA 4IGSA 4IMAA 3CTLA 3AHYA 3SFKA 1EA9C 5FA5A 1KFKA 2ACUA 2B7OA 4K1GA 1E15A 1FOBA 4PCSA 2VR5A 2YXOA 1WDRA 2OB3A 3MUAA 1L6SA 5DN1A 3WFLA 3O6CA 4U2YA 4GISA 5DCBA 1B90A 4GY0A 2WV8A 4IMGA 3B3DA 1NVMA 4J9JA 2VNCA 2QR6A 3WJSA 1T7LA 1XG3A 1IWPA 4XZBA 4JIPA 4LCRA 3U8GA 1H5VA 1Q8JA 2PZNA 1XP3A 5E0CA 1B57A 1GVOA 3E2QA 4R88A 2WZTA 4A8NA 2ZDRA 2HISA 3DFQA 3CT2A 3EOSA 1U1JA 3CU2A 2QXWA 1YXYA 2P76A 3NYZA 4JNZA 3VCCA 4RL3A 4IGMA 4HCDA 4KRUA 1AVAA 4WVXA 4YJ5A 3W7IA 4PCNA 4ZQMA 2P0OA 1IEVA 2QUNA 1EEXA 1IF2A 1GYNA 3TSMA 1CXHA 5KETA 3V0SA 2XIJA 4MYXA 3WLRA 3OODA 3QGAC 1JYXA 1VPQA 1H1NA 3STPA 3OLDA 3RJXA 3LA4A 3V5CA 3KCOA 2JF7A 2FYMA 2CLEA 2CWXA 1BQCA 3ANUA 2WC4A 2GFTA 1OFQA 3M46A 4CNPA 2A3AA 3BH4A 3SCOA 1IZJA 2F38A 4ZA0A 1E4NA 4XWUA 1DQXA 2QHAA 3B8DA 5DY2A 3MUCA 4GUGA 4IQEA 3NZGA 4YHEA 2ZUWA 1XIEA 4UR8A 4AZ5A 1CIUA 2BXYA 5I5RA 1I1WA 4UTLA 3BOFA 5CC5A 4K36A 1UC5A 2GUBA 2PI6A 3L21A 1TIMA 1GQJA 5AYIA 4LVBA 3EMQA 4F9DA 4NL1A 1UHVA 1DJZA 4GFSA 4K2SA 1U22A 1BG4A 3ANVA 1KO0A 1BYCA 4GPNA 4P7LA 3R8RA 3GHSA 3SIMA 1GHRA 1IZKA 3GB6A 4H9YA 4IH3A 2VJXA 4GJJA 3S9YA 1ZJAA 4J3ZA 4KQNA 1LBFA 4MKVA 4GQQA 2V2DA 2XSAA 3SCUA 3BAWA 3S2CA 2ONEA 5DRIA 4IICA 4R33A 2QUTA 3S8HA 4XUGA 5C54A 1IGWA 3DBNA 4U33A 4C6FA 4R7JA 2V9DA 3I6TA 3SBFA 3UA4A 2PDXA 1LBMA 4JX4A 1VEMA 4WGHA 2YGYA 2FPTA 2GWGA 4AZIA 1JCJA 3K2GA 3LBCA 3D47A 1GOQA 4QRNA 3ABRA 1PWMA 2Z2AA 3HPSA 5M1TA 1LOSA 3DGRA 2BFGA 1Z7AA 3XINA 2C19A 5IBXA 3OJGA 1D7KA 1KGXA 3K46A 4AXKA 1CGWA 1UWSA 3POHA 4YMZA 1W0MA 2ODOA 2J7GA 1SMDA 4ZR8A 2FH8A 1F05A 1Q4NX 2DQWA 2CBUA 4Z1AA 4H8HA 2HJPA 4JY9A 3A3WA 2Z24A 1Z32X 1KWGA 3UP8A 3UERA 4YTTA 1YMYA 1PIIA 4O14A 4I8YA 4Q8NA 1TWWA 1EGZA 3M0MA 1RCQA 3WFAA 1PXGA 5BCAA 4DUWA 3BLKA 3O8AA 3ZIZA 3MSGA 2A7RA 1FH8A 3IIZA 3DX5A 5U4NA 4NT0A 5A8GA 2D1ZA 2F8QA 4XSMA 5ABGA 3ARWA 3RPDA 1DXIA 3KLLA 2R1MA 1XIBA 3RRAA 1MRAA 1E1FA 3JR2A 1QBAA 4E3VA 3NYDA 1WKDA 2XFWA 3OG2A 1ECQA 4NKCA 2UY3A 2VYOA 3L7RA 1R2RA 4MFEA 4EPBC 4DBWA 4FX6M 4JEJA 3WD0A 5EA9A 1G69A 2WSPA 4FSAA 4FI4A 1MO0A 2WO5A 4GGBA 1LRQA 2PGEA 2PODA 1R87A 3GNRA 2F6XA 3I7RA 3GNPA 1SFSA 5EMKA 3CASA 2E5BA 3TC6A 3GG0A 2XZ9A 3GWQA 1BKSA 3I3EA 2AQVA 1LZOA 4HBKA 3UY8A 1OYCA 5IDIA 4Y8EA 4LFYA 4RUBA 4MSSA 3WBYA 2Y7GA 5BXRA 3MHFA 2PWGA 4GIEA 2QIWA 3ARVA 2NW0A 4W7WA 4CNNA 2A79A 1TTIA 3CB8A 3KWSA 1UR1A 3GC4A 3C0LA 4BCEA 3MYPA 4EVZA 3OBEA 4HNLA 1ISYA 1WDPA 4F79A 3UD6A 3W6YA 3OPSA 3LV6A 4AVNA 4M7SA 1XICA 3ITTA 3TR2A 1B3VA 3LCIA 4QE1A 4WZHA 2QCEA 3WNKA 3EA3A 4IOTA 4NYUA 3MP5A 4YU1A 3G1XA 2XIIA 1KM1A 3ITYA 1HTIA 1F3WA 3N11A 3R1ZA 4Y9MA 1I2PA 4UMAA 2GJNA 4I5XA 1D2KA 3MI2A 1UQYA 4Z1DA 4DLMA 1Q6FA 4GFIA 1H62A 3C8NA 3WL1A 2R1PA 3VDCA 2Z0IA 4PMNA 5F7UA 1H09A 3W27A 1VBJA 4CVWA 4N9BA 2DUAA 3EB2A 2D3NA 4KH2A 2PFHA 3VD3A 3WQEA 1G5AA 4QHRA 3VIGA 3WUGA 1O95A 1CBGA 4R7OA 5ABTA 3WLKX 3HBLA 2OFJA 1H3GA 2QJGA 1EZWA 4KBXA 5J8LA 5A6MA 2WOQA 4PL2A 4AYGA 4RW3A 2PP1A 1OY0A 1KFBA 3W2LA 2VP8A 1GVQA 3SRKA 4IP4A 3WY1A 4M5PA 1UJQA 5DRCA 4BQ3A 1QPNA 3QW3A 3AXXA 3CO4A 4W5UA 1Q3NA 3VD7A 4PB5A 3S2JA 3WNMA 4IFRA 4M8UA 2QV5A 3DFOA 2ZX7A 4WQ6A 4HU0A 4R85A 2O0TA 2Y8KA 4XQ6A 1QATA 4UQ9A 2Y88A 1O5XA 2FH6A 3ARSA 4V27A 4LUIA 1F8MA 1SZEA 4JTDA 3DDMA 2POZA 2R91A 1HX0A 5A69A 5TD4A 1JUKA 1GUVA 2WC3A 4DHGA 4AD1A 1ONXA 1KLZA 3F4WA 3IJ7A 1ZBCA 1F8IA 2DW6A 3DC8A 4CUCA 4LF2A 3CC1A 1ICPA 4YS1A 4Y8FA 3BCDA 4UNKA 1M7JA 1VHNA 2WZEA 1MZHA 2WVSA 3OGSA 4GNJA 4PTWA 3WNPA 3TROA 3MJMA 3BLPX 3BLFA 8XIAA 4XZHA 1Q85A 3HFTA 1E9ZB 3U9IA 1XD0A 4QDWA 3W1AA 1BTCA 1W3NA 1JZ2A 4IPIA 3U4FA 1SJDA 3ITOA 4HJFA 3U7BA 5D09A 1PAMA 2C14A 4JBRA 3Q67A 3A6OA 4IWWA 2OO6A 4J3TA 1V02A 1Q6DA 1V93A 4XV0A 3GKFA 3PSVA 3E02A 4MY9A 1EP3A 1HIZA 4FHAA 2BOEX 2Y24A 4GLEA 4H7VA 1ZLPA 4M7TA 1CCWB 1JRBA 4MAZA 4Z2KA 2Q3OA 3D0CA 5G4HC 5I6SA 4TMBA 3WLHA 3QJAA 2OXNA 1XS2A 4WY0B 4INFA 1VFFA 1QRQA 1F9CA 4N4QA 4DEFA 4W93A 3BQ5A 3ZR6A 3UCCA 4H6KA 3UG5A 1I0BA 3BANA 3TNOA 4OV4A 2WBKA 1R9XA 2FGZA 3AMGA 3PC0A 3P8JA 1AW5A 4OOUA 2V5KA 2AGTA 3CUFA 4C1NB 3PBGA 1OINA 1SO5A 3VUPA 3W01A 2G95A 3CUGA 4K68A 2AKZA 3C6CA 1O5RA 2BGNE 3CHCA 4LRSA 4XZLX 1EB3A 3FDGA 4UMBA 7ODCA 3FVMA 3O6DA 3WJYA 3GVRA 1UYQA 1F3XA 3H4XA 4XD5A 1GQNA 5C9ZA 1O94A 1J8VA 2Q6ZA 2VEMA 2NQZA 5FAGA 3LZ3A 3VMNA 3EWCA 1XLGA 1ZBVA 1BF6A 1QBBA 5FSDC 5LHEA 4NXKA 3ZR4A 2V82A 2TMDA 4F66A 3WO8A 4QXIA 1DBTA 4REQB 5TBOA 2I56A 1UG6A 4QCEA 1E5JA 3WBXA 4RX0A 3ZFHA 5K9CA 3NPVA 4A3UA 1T40A 4FLOA 3VOJA 5HXMA 1W5PA 2ZVRA 4C5YA 3KM8A 4O4VA 1ZAJA 2QF8A 4B92A 1MXDA 3QHNA 3FV9A 1GORA 4FA3A 1QU4A 3UR7A 4RLIA 5IFTA 1A5MC 3R94A 2PTXA 3EKLA 2E67A 1SZGA 1SZFA 2XM2A 2JEPA 1VFHA 3QN3A 1CX9A 1LL4A 4E8CA 4MZ1A 2RJGA 4J3UA 1V6TA 3KTSA 1O5KA 4CCCA 1J0ZA 3S4TA 4PGLA 3CQ0A 4CN6A 4GKTA 1OT1A 1P1XA 3KVJA 3ABQA 3FEMA 4C6MA 1B3XA 1WV2A 4IIBA 2GK1A 3O16A 3E0WA 3MYOA 2PDYA 1L6YA 5CPOA 4M82A 1W2VA 2QPSA 3AAMA 1QJWA 1IV8A 4XSLA 4EP8C 5TNVA 3GXIA 4QS5A 4QE5A 1IEWA 3LSCA 1BYDA 1HO4A 1V03A 1Q8AA 3KWXA 2YIHA 5FI8A 3ZYZA 2ZFAA 4IFKA 4NNAA 2Q02A 3WLJA 3WF1A 3RHGA 2DZXA 5D2XA 1XQLA 1KC7A 3RUBL 3W38A 2PS2A 1A80A 3DHPA 2DUXA 4WLCA 2CNCA 2CZ5A 1KXVA 3G1AA 5EBAA 4L61A 3WNOA 1I2RA 1JNDA 1VYSX 4ZSUA 4QSFA 4A3HA 1AZ1A 2ZZ5A 3CB3A 3BZGA 4PRRA 4MNMA 3WF3A 1RALA 1YHTA 5AC8A 1XYMA 2PDHA 3MWAA 1XLEA 2J88A 4A8IA 3VABA 4BF7A 3QOMA 3RN6A 2R1KA 1FWWA 2XIMA 4XIAA 1FCVA 3TN4A 3K5XA 4H3DA 4ZOBA 2FHBA 1DP0A 1V3JA 1C8XA 3Q2DA 4JTLA 1XRTA 4QS6A 5HAOA 3VKJA 4FNSA 1C29A 4JHZA 1JZ7A 2VEPA 3M0VA 4MLJA 1I2OA 1A5BA 4ADTA 4C6BA 1PCKA 4BR1A 2YCLA 3ONBA 3VDBA 4GO8A 2WAGA 3U6WA 3ZJ6A 2O55A 1DJYA 5A5WA 5GVJA 2C0HA 2HTMA 3ERPA 1DIDA 3GDBA 3GG1A 3H8AA 2FDSA 2YDAA 2G37A 4I6KA 3ZWTA 1KXHA 2VRJA 2ZRYA 1YIXA 3CZLA 2NQ5A 4BZYA 4CKQA 4IP5A 1OWQA 1MW1A 4LAZA 3WMBA 1OF8A 3CEPA 3R13A 3W1XA 3IGSA 1F2JA 3V5OA 1XYZA 2Z28A 3FHAA 5MF5A 3KVKA 3TK7A 4DWSB 1W17A 4P5UA 2G3IA 4YCPA 2EPHA 1LG1A 3GXPA 1FH9A 1QVBA 4F9JA 2QCDB 3MI3A 4F40A 3AYVA 1T8XA 3VNJA 2I7GA 5LXEA 2J8GA 3SRHA 1GKPA 4LPCA 1OX6A 1ADOA 2EPLX 4GZEA 4AZ7A 4H6QA 1F74A 3SQLA 4AMAA 3VE9A 3KP1A 4E2OA 3SN4A 1O5QA 1MQPA 3EOEA 9XIMA 1LRTA 3B04A 3H2EA 3EX4A 1DHKA 4IIHA 5AHLA 4Q33A 1UH4A 1BVNP 4FIQA 3GHUA 3WF0A 4IGHA 1HKIA 3BCFA 5D4YA 1AL8A 3AMCA 4XD6A 4CNTA 1KGUA 2YL9A 1I60A 2OZ3A 4WRHA 2IKJA 1LCOA 1E0XA 5A8MA 4ERIA 2OWCA 1WXYA 2XG9A 2X2YA 3H2NA 1EJ7L 3Q94A 4BI7A 2PLCA 1TIWA 1L6FA 1NJJA 4BFAA 1Q6QA 1RBLA 1S2AA 3R12A 5MKGB 1E0TA 4AZCA 4H01A 2W61A 3ECQA 1G7VA 2V2HA 3ZO9A 1JPKA 3LHWA 1XH2A 1UR8A 4NAFB 4DF2A 2C18A 3RX4A 3ZZ1A 3FIGA 1IWBA 2OJPA 3KX6A 3PBUA 2WPGA 3BZJA 4ZBCA 3VIHA 3M0KA 1CLVA 2Z1BA 3PFMA 1ZENA 2J24A 3KBJA 2RJHA 4F48A 1XRFA 2RKXA 5TF0A 1HKMA 2YL6A 4TTUA 4AD5A 2OVLA 1NELA 3DAQA 5K3VA 1EHAA 3WLSA 2YFOA 4HMEA 3W82A 4ZFCA 5K4XA 4YL2A 4H9ZA 2RDUA 1W1ZA 5IM51 4H41A 4RE3A 4JIRA 2MNRA 1UMYA 2YZRA 3QY6A 1U5HA 3MMDA 4F0HA 1XKYA 1KQYA 3UJ2A 1T8QA 3QY7A 3HB9A 1JDDA 2V8ZA 3VX1A 1DPMA 4TX6A 1FFRA 4MB1A 4JDBA 2QYGA 3AIVA 2X1SA 2WJEA 4KCUA 3IIPA 3QSRA 2NXIA 1R7AA 4W85A 4HTYA 3E0IA 1BWVA 2QGYA 4O16A 1FX6A 1PYMA 1JCTA 4CGTA 2C71A 3VIOA 1EO7A 2O9RA 3SGUA 4OZOA 3AQUA 2V3EA 4ORIA 1JFHA 3M47A 2XN2A 1KBIA 1YPFA 1XLJA 1E70M 3THDA 2CHNA 4ZXLA 2OU4A 1FKXA 4KEZA 1TKKA 3ONCA 4U4MA 1V0NA 4FEZA 2D69A 3KBNA 3UWYA 5CSYA 4G1KA 2PDJA 4HKPA 4CQBA 2FTYA 3HG5A 4V2XA 1GVRA 3LPPA 3AZSA 5H8MA 4OQVA 4H2CA 1XFBA 4TU1A 4S3EA 3NFUA 3TFCA 2WNZA 2OEMA 1IT0A 4QNWA 1AL7A 4B5NA 4L65A 3KBSA 2OZ8A 2WQDA 3SUSA 4FNRA 3URBA 3C2RA 2W67A 2WM0A 4G9PA 2BXZA 6XIAA 1VFMA 3PTQA 5HATA 1FHLA 2ALDA 2HVNA 1YNQA 3FVDA 2Z2BA 3IVUA 1ONWA 2OSXA 2QULA 1EC9A 1YDNA 1V6VA 4JTCA 3EXSA 1PX8A 3QGVA 1A5KC 2PB1A 1YW1A 4JTQA 1R2SA 3LU2A 3SW6A 3GUGA 1TZ9A 2VQUA 4GZJA 1MXSA 4LVGA 4Q6XA 4HA3A 4Y9OA 1EXPA 1IEIA 4ES4A 1XYBA 2WXDM 3GUWA 4OTKA 3LERA 1Q6EA 4H4IA 5D04C 2JE8A 2DVTA 3SO7A 4DZHA 1JF5A 3PWAA 5KITA 4I9MA 2J7BA 4PMYA 1O4UA 4W7UA 3VOCA 1KRMA 3RO8A 1SR0A 2BS9A 3EX6A 3WEOA 4UR9A 1AODA 4LXFA 4US6A 4E0CA 5HNTA 1XRVA 3TUUA 3PBYA 3QV6A 2FVMA 3GDRA 3TA9A 1TX2A 1XI3A 2BP1A 4PZVA 2I5QA 1J2WA 2W79A 4IXHA 2QUVA 3VOHA 1KRBC 3EOUA 2ZX8A 4WOZA 3WMCA 1BSIA 5CAHA 1EBGA 3DYOA 3BGGA 2RDWA 1LLWA 2JGYA 5KMYA 3A22A 1EA0A 1XD1A 1O66A 4F0RA 5G1TA 1P0BA 2NZLA 2Z26A 3W7GA 1FHVA 4MUPA 3NPUA 2ZE3A 1WCGA 4FNTA 3W70A 4ROPA 1XBZA 2G4JA 2OT0A 4ZB5A 3PJTA 3A4AA 3AU2A 1ME9A 3OB8A 3SECA 1X38A 4PE8A 3SN0A 1HJXA 5HDRA 4ILSA 2F2KA 3DYMA 1XDLA 5FAJA 4JL1A 3WDQA 1J96A 5D32A 3DG6A 2DVUA 4UFIA 1EPVA 5JUVA 2A1YA 1AD1A 5EBUA 4PSPA 4GI9A 2Z1WA 1BF2A 2WC7A 1GYMA 3L4TA 1A5UA 3LPGA 5E0KA 1HT6A 3HMCA 2XM1A 3C56A 1VJIA 4P2VA 2PE4A 5DFAA 2D23A 3G1HA 1P0NA 1CLXA 1XPGA 2EF9A 4HNUA 1ZU8A 3WYZA 4AH7A 3G1YA 1EBHA 3UQNA 1J6OA 3NQAA 3DFNA 1ZP3A 3ELFA 1E1CB 4X22A 2WMHA 2NVDA 3DU0A 2GOKA 4X0NA 4D71A 3NJ3A 3WBEA 1ZB5A 1X1NA 5GJMA 4JTJA 2HXUA 3R0UA 4KCWA 2Y70A 3LB0A 5F1VA 2PA6A 3CQJA 4RE2A 1IR1A 3VMPA 5HJYA 2OX4A 1DJIA 4DI8A 2Y61A 2F6UA 1MUCA 1OM0A 3NIYA 1KCXA 4MUZA 2ZZ2A 4LX4A 1REQB 5D37A 3WF2A 1XJBA 1I6NA 3UZJA 3P0XA 2DZBA 3CM4A 1JR1A 4IPNB 4X63A 4L1GA 4PTMA 3NA8A 2OOGA 5CC6A 3MCOA 3LSBA 1C91A 1XWYA 4GX9A 1LQAA 5D8ZA 2EPOA 4YTQA 2VOMA 4L6OA 5E6ZA 3LDVA 1V6UA 1BRLA 2DZVA 3CTTA 2GOUA 3CZGA 3BJTA 2W0UA 1TV2A 2UV8G 1KXQA 4I8DA 2HCVA 1D3GA 3PNZA 4GKLA 3T05A 3F5KA 1B0IA 3T6CA 2CCRA 2ZKMX 2X05A 1DE6A 2IPGA 5ABFA 4PBFA 1G4EA 2PDWA 3EB3A 1L8PA 2E1DA 4UXDA 3UPWA 1KCKA 3MTWA 4JTEA 3H6OA 3BSMA 2R14A 3E2SA 3Q4DA 3TJIA 3JS3A 1RLCL 2D0FA 2O92A 2WKJA 3VDGA 1SW3A 4LBUA 2GJRA 2A3EA 3HPAA 4A2RA 2WK2A 3SURA 3QYSA 4AW7A 1VS1A 1ZPTA 5HMDA 3ICJA 3GAKA 4MDPA 4IIFA 1TMLA 3S2MA 1XINA 3N17A 3APGA 1XIMA 1OFRA 2VD8A 3W29A 4AF0A 3NSMA 2E5DA 2C7FA 3P0WA 7TAAA 3I6EA 2NLYA 1XGEA 3T0DA 5CC3A 2OT1A 4MZ8A 1EGMA 2ABBA 4XTIA 4DYJA 2CLKA 1YTKA 4DBDA 2O9PA 1UC4A 1A0CA 4AHQA 1OG6A 3HQ1A 5FKYA 4MPKA 3VVGA 4RNFA 4JHOA 4L4PA 3MBDA 5HWMA 3ZWSA 3Q58A 4GI8A 4UOJA 1MXGA 1QNSA 1OC5A 4C6EA 3ITGA 3E0VA 1J01A 3PJXA 4XZIA 3EX3A 1AH4A 5TAOA 4LRTA 4P7OA 4O28A 5DQPA 1GVYA 3O2LA 4HPXA 1POKA 4QITA 1JFXA 1XLKA 5D9NA 1S2TA 5A3HA 1OABA 4NI8A 4KEVA 3K4WA 4FX7A 1SO6A 2WHKA 3W25A 5BW6A 2AAMA 4KCVA 4HA0A 4TO8A 5LNUA 1RP8A 1R38A 1EFZA 1SJBA 4DRSA 1QHOA 3TYBA 3ALGA 4NSBA 3TJXA 4J7RA 4HZMA 4NNCA 2WVUA 3S1XA 2WKLA 2CLPA 2ZQ0A 1Q2RA 3WQDA 4JHMA 3A64A 2YB4A 2GVGA 2TSYA 2D22A 3HPFA 3PP7A 3Q37A 1U83A 1LBLA 4HVXA 3LG3A 4LVFA 2DJLA 1JZ6A 1S1PA 3N6HA 1N7KA 3O3RA 4DUVA 1A5LC 5F4XA 5F4SA 4O0ZA 5CZSA 3MMTA 1TV3A 2NX3A 1A3HA 3XISA 1SU5A 2DORA 3WBWA 2TYSA 4W89A 5K7JA 1NOUA 2A3BA 3VGBA 4O1AA 1PDZA 1E6QM 2WZIA 3BAJA 1WOBA 1E6XM 2O7QA 4HIBA 1A4LA 4UQAA 4EWND 1E40A 3BC9A 1Y7VA 1CDGA 3H55A 2QW5A 3OYXA 4H83A 1Z89A 1Q65A 2VR4A 3W7LA 3OZYA 2HDJA 1EF3A 4C6LA 2TRSA 3W1TA 5H2ZA 3ZJ8A 3RLVA 3T4WA 4DPQA 3SEPA 4UQCA 2W4XA 5FL0A 2IPFA 3TTQA 2XUCA 3N3TA 4WF7A 3B97A 1OC7A 1YE4A 2CLIA 2W91A 4Z17A 2A2IA 4HN8A 2MANA 1W56A 3TQ0A 1OGSA 3NDZA 4B5SA 2Y63A 3CQIA 1XCFA 4IX0A 5M03A 2YKKA 1CZ1A 2X7VA 1J93A 1WBJA 3C2FA 3E9AA 2ON3A 2PDIA 3GFXA 1UH2A 4OFCA 4M19A 4JQ4A 4C7FA 1S5MA 1WDWA 3L5LA 2D2JA 3TWAA 1E73M 1JD7A 3CUIA 3W84A 1O6IA 1KW1A 3W26A 3XIMA 3KHDA 1NSJA 3MCMA 1QI5A 4HPGA 3HGRA 3NVDA 4QAIA 4GXWA 1GHSA 1RVGA 1U1UA 2ZE0A 2GLKA 2AL2B 3WDIA 4JY8A 1EP2A 1RBAA 3HJZA 3CV1A 2QAPA 1S5WA 5JQ9A 2IUZA 2QVHA 4DB7A 4UFJA 1UUMA 5A6AA 4ZOAA 2FPYA 3CLWA 4AC1X 2ICSA 3JW7A 4JFSA 2OSWA 4QIUA 4PC8A 2BY2A 2ISWA 1UKPA 1JDFA 1KQZA 4NRRA 3OZPA 3DKJA 1GK8A 3H7RA 3T0AA 4MNLA 3ES8A 1ZBWA 1B54A 3L0KA 4LNCA 4HK5A 1Q66A 5EMMA 4U28A 2FZ8A 5HUOA 3MHUA 1X6UA 5E70A 3TJLA 3ITXA 1FWCC 2E09A 1WZAA 2CWNA 2V5BA 1BXNA 1EJXC 3GO2A 2ATMA 1VIWA 3URNA 1TA3A 1W1YA 4MAVA 2FMNA 3C0JA 1FA2A 3KEHA 4IT1A 3UPMA 3MW7A 1CTNA 2ZYFA 4ROQA 3CAQA 1WUEA 3VMOA 1SPQA 4RE4A 1U5JA 3I7QA 2J8TA 4TIMA 3LD5A 3A23A 3PY2A 5I3FA 4RNJA 3ZXWA 4KS0A 4DZIA 4I9JA 4N4PA 5EKYA 2OGJA 2A85A 1M7OA 4I5RA 6A3HA 4ZE5A 1C8QA 2D20A 3UNDA 5G1MA 3FJ4A 3S46A 4HOWA 4GZ7A 2BB0A 3EDEA 4YNGA 1SZRA 2CERA 2ZXDA 1VHCA 3AFBA 4TOQA 3RYSA 4JAWA 3OBKA 3REQB 3KAOA 3VM5A 2GJXB 1IE7C 3BLOA 3IIXA 1R3QA 1GPFA 4IPJA 1FDJA 5LIXX 4KEMA 3HMJG 3QY8A 4IG2A 2Z6IA 5AN7A 3W2KA 3O6YX 3VNMA 1YPXA 1GTHA 3DEQA 4BHYA 1MFVA 1W5OA 4BKNA 2CC0A 1OFPA 3AC0A 1O68A 1GT8A 2PLMA 1UPPA 1DTNA 2WNWA 3NL5A 6ENLA 3LV5A 4LUJA 8A3HA 2ZOXA 3B4UA 5HBFA 1PHWA 1PB0A 5LXXA 4YVXA 3DH7A 4LS2A 1XLMA 4G1NA 1XX1A 1JZ5A 5H8PA 1OCBA 5HQLA 2NQJA 1M5WA 3MSYA 1F6PA 3QPEA 3EZ4A 4UTJA 1NOFA 4J1OA 1AJ0A 3AALA 3IPWA 2HBVA 2E9BA 2NV1A 1IIGA 2G5WA 5ENLA 4LEQA 1TVLA 1HUVA 4YLWA 4EPEC 4J3SA 3PN8A 4RPQA 2VC6A 3LEPA 4UMCA 4O12A 1EJRC 3VGGA 4DXVA 1TG7A 2GGGA 5T91A 3MT1A 1V6YA 3AXMA 1XC4A 1L9WA 3EWDA 3V35A 5BROA 1ZGDA 5CZJA 2IXVA 4PTNA 2JQXA 3APYA 3IJ9A 1FWBC 3MMWA 2ACQA 2IXUA 1XFCA 5ABEA 4JN8A 4E2BA 3W00A 3SY1A 3VTRA 4HOZA 2X0SA 1TMQA 3FW6A 2IQTA 4LTSA 1D3CA 1ISWA 1N2VA 4FF7A 4XK2A 3C4UA 5A2AA 1NWSA 5AKQA 3AS1A 5C7HA 1FH7A 3WLIA 1UIOA 3N13A 3O0FA 2FFCA 4NNBA 2E28A 1X6LA 3I7SA 4OVXA 2VWSA 3PPGA 5EYWA 4A2SA 1S5VA 3W1NA 3ZLFA 1QPQA 1QO2A 2A6LA 2YA0A 1VBUA 2PWFA 2PDPA 4J28A 1PSCA 2EKGA 3L2IA 3DI1A 1CI1A 4CQ8A 4Q4OA 3WK0A 1KFJA 2NWRA 3LI0A 4EAYA 3E0FA 1VCVA 1GJUA 1YQ2A 2G3NA 1GZGA 4CU7A 1WAUA 3QQWA 1K1DA 1GQKA 3QQ1A 4AY8A 4AWEA 3M6YA 2Z6JA 4A4AA 5J04A 4Q4SA 3AS0A 4GG9A 2RHGA 4S3FA 3NDYA 4XX6A 2HQAA 2GJLA 3CHFA 4BF9A 2PTZA 3QV9A 2UY5A 4F3HA 4GABA 3LCFA 1E9IA 5AECA 2WJDA 2F84A 5BYWA 1YRRA 1NDYA 3B40A 2QF7A 1D3HA 3CAVA 1CB7B 2G4FA 1XIIA 3GC2A 4NY2A 2P50A 2AL2A 1ITUA 3DBPA 7REQA 3W02A 3A9BA 3ORWA 1M7PA 2I17A 1PWLA 1XDMA 4I9TA 4FMVA 5DX7A 4GACA 4NJIA 4PEEA 4FF5A 3EDKA 4DBUA 4XAPA 2RAGA 2XISA 3V5FA 3IUDA 3QKZA 3TZFA 1AH0A 2WW5A 4LQ1A 5I78A 1PPIA 3II1A 6REQB 1WDDA 2CKRA 4JYFA 2OGYA 4PMRA 1BVZA 3NPWA 2HZGA 3ALFA 3HN3A 1RR2A 3MB9A 3NGJA 2B7NA 4AG0A 3NVTA 4JTTA 1VRDA 1PIGA 3I68A 2J8FA 3NZ1A 1VYPX 4TUFA 1YTEA 5A6TC 1BGAA 5LGXA 5A6KA 3D3AA 5AYYA 3CYJA 3BOLA 1KM0A 2E6YA 2XVPA 4ADSA 2BY1A 4RZBA 3SCPA 1ZAHA 3H22A 3LENA 3ABSA 4JIQA 4OBSA 1TWIA 4ACYA 3NCOA 4RXGA 3ZT5A 5FOOA 2VELA 5IOBA 3EDFA 3TW9A 4WHBA 1UR0A 3ZVHB 1FHUA 2XPKA 3OP2A 2BHYA 3MUXA 3TC7A 1HO1A 5I24A 2V69A 9CGTA 2GVYA 1I1XA 2W92A 3I4KA 1W91A 5CGQA