4PCSA

Crystal structure of a bacterial fucosidase with iminosugar (2s,3s,4r,5s)-3,4-dihydroxy-2-[2'-phenyl]ethynyl-5-methylpyrrolidine
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
439
structure length
439
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-fucosidase
publication title Exploiting the Hydrophobic Terrain in Fucosidases with Aryl-Substituted Pyrrolidine Iminosugars.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 163
structure length 439
sequence length 439
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4pcsA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pcsA01
3EDJA 5CLTA 1MFVA 3CUIA 1CEOA 1QNQA 3VIJA 3N1AA 5ABGA 4FLOA 2WK2A 1UWRA 3ZJ8A 2XIIA 4TVDA 4WLCA 5HXMA 3ZMRA 1R34A 2ALWA 3T0BA 3L4TA 2DGAA 4UFLA 4LYQA 1B90A 1MVYA 1ZBCA 2EAEA 3WQ8A 3D3AA 3BSHA 3FXYA 4HMCA 1RP9A 1UWSA 4PTXA 2OYKA 5FL1A 2J62A 2XVGA 2ZX8A 1TQTA 1ISYA 1Q6GA 2XVPA 2WVSA 2NT1A 2DQXA 4L4OA 1DTUA 1KCLA 1S46A 1LL7A 1E15A 2CETA 3PZNA 1EOKA 4HU8A 3I3DA 3CZ8A 3G6MA 4P7QA 4PSRA 5FOOA 3W38A 2PWEA 3VNZA 2J7BA 2E0PA 2RGMA 1HJVA 1NP2A 4NZFA 4MNLA 3AROA 4J28A 1C7SA 2QPUA 3WQ6A 3PZMA 1V3JA 3BCFA 2ZUSA 1BVZA 5DT7A 4ZXOA 3W27A 2YOCA 3II1A 3BAIA 2PC8A 4HU0A 3LXAA 1CXHA 2YA0A 3CHEA 2WVUA 5M17A 4FLSA 1UKPA 1B0IA 1UG6A 3CZEA 3A3HA 4DO5A 5I77A 1VEMA 3TP4A 4DUVA 3N12A 4PMXA 3KWXA 1QI5A 3RILA 4QCEA 4RE2A 1VF8A 2WWDA 3NIYA 4OZOA 2X05A 2ZUNA 3DX0A 3QHMA 4FNUA 1IZJA 2F7RA 1R85A 3MMWA 2WHJA 3HG5A 3IJ7A 1DWHM 3WKZA 1ISXA 3HG4A 4AD2A 2A3BA 1CBGA 1HX0A 1JNEA 5IXEA 1U30A 3FN9A 1UD6A 3ZOAA 1UD3A 5A6BD 1V0LA 4B15A 4W7VA 4AD1A 5CGMA 4UTFA 4RE3A 1BF2A 1GHSA 1W32A 1ECEA 5CJ5A 1JG9A 7TAAA 2ZX9A 2CEQA 1C8YA 1UR4A 4OBSA 3SCVA 2WLZA 1YHTA 3PTKA 1XV8A 2DEPA 1XC6A 3AS2A 4NI3A 1ODZA 7A3HA 1FP9A 1W3KA 1H11A 1QHOA 1UZ4A 1V0KA 4AYGA 5BRPA 1BVNP 1C3FA 2WHLA 2ZXDA 1HKMA 4DUWA 2F2HA 4P8UA 1GUVA 4P7RA 4DO4A 1ITXA 4WSKA 1R75A 3WNOA 3TA9A 1DWIM 5I23A 1OGBA 3WQ5A 5I3DA 1O7AA 4JKKA 3GM8A 4P8WA 1JNDA 3WD0A 3VGBA 1E40A 3MU7A 4MADA 2A3CA 5E1QA 2YFNA 3RJXA 4UQ9A 4W5UA 2D23A 2VR4A 4UFMA 2XFRA 3K4AA 2CNCA 3NYDA 4UQEA 1C8XA 1TQVA 3CO4A 1VEOA 3OLEA 1KWKA 4LPCA 2XYLA 4FNRA 3MMDA 2OW7A 3DECA 4JIEA 1CXFA 1JIBA 2IUZA 1QI2A 4JFUA 4A3YA 3WN6A 1E4NA 3DX3A 3BUIA 1EHNA 3IGUA 5BXRA 3AIEA 1E4LA 2J7HA 4LGXA 3BGAA 2D24A 4JFSA 1X6NA 1E72M 2VQUA 4W8LA 1SMDA 1RPKA 4ZFMA 3KLLA 4W89A 4B16A 1GOIA 1XH1A 2D1ZA 4DO6A 3BUBA 2BVDA 3WUGA 1OD8A 4P7LA 1O7DC 4IPNB 3L4ZA 1V3LA 1B3VA 5A8PA 1NP0A 5A1AA 3CIVA 1D3CA 4HP5A 1DWJM 2XTKA 1H4PA 3PZOA 2Y8KA 3GYCA 5BCAA 1JI2A 4UNIA 4EK7A 3A47A 2X0YA 1OT1A 5CGTA 1KXQA 1D2KA 2EPNA 3K8LA 5A8MA 1G01A 1LG2A 4CKQA 4U5IA 4UZSA 1J0IA 1GQKA 3WH5A 1AQMA 5BROA 1R33A 1E4MM 4NSBA 3W25A 4R5EA 2YDQA 4M1RA 4H7VA 3F5LA 3JUGA 2G4FA 2WAGA 3TTSA 1QW8A 1H2JA 4IISA 3AICA 5I79A 3T0AA 1GOMA 1N82A 1C8QA 2FH6A 1E6RA 2O92A 1B3WA 3VDAA 5AC5A 1HL9A 1UASA 4UFIA 2WBKA 3OGVA 3BUPA 1J11A 3K46A 2QHAA 3FHAA 4M80A 4M56A 1OWQA 5ABFB 1R86A 3DX4A 3GXNA 4Z2JA 4AD0A 3AZSA 2D20A 2VRJA 2PBOA 2CBVA 3VGFA 4F9DA 2BY2A 2WVTA 4OUEA 4NXSA 1ZB5A 1HF6A 5DMYA 3CUJA 1UR0A 3BAKA 2EPMX 4E2OA 4ACZA 2VX4A 2D73A 3AIRA 3CZLA 2IXVA 1TR1A 1EDTA 2XSBA 1TVPA 3WSUA 3CC1A 1JZ2A 4D6JA 3WEMA 4JL1A 3BLKA 1LQ0A 3AI0A 3MI6A 1NOWA 1DHKA 2GK1B 3FNDA 3SCTA 3ZT6A 1ESWA 2CIPA 1UR2A 4TTGA 4MB5A 3UEQA 1HJQA 3NSXA 3ARSA 3OZOA 1YQ2A 2XGIA 3E1F1 3A5VA 1HKJA 1UR1A 1QI3A 1CGUA 1K9FA 1JGIA 2WPGA 1U33A 4TVUA 2YLAA 5LA2A 4TX8A 4PTVA 3BVUA 3L4WA 1XH2A 3B9AA 4U3CA 4H04A 2X0HA 4OKDA 4P7NA 4ACYA 3GH4A 3VUPA 1JYVA 3AS3A 3KL5A 3QR3A 5A2AA 4GINA 3TTQA 3CHFA 1QBBA 3IAPA 1EQCA 1IZKA 4UOQA 1NWRA 1GVYA 1BQCA 2XUCA 3CUHA 4E8CA 4UQBA 4J3SA 2VVNA 1ZJAA 2XN2A 3VNYA 3THCA 5DO8A 1GOWA 2BV9A 4DM1A 1ISWA 5ECUA 3BH4A 3J7HA 4P8VA 4GZEA 5I78A 1H5VA 1BYDA 1PIGA 4JAWA 2XVKA 3UG4A 2XVLA 2Y5EA 1U2YA 1HTYA 4PMOA 2BXZA 4IUGA 4CVUA 4OOUA 1V0NA 2XPKA 2WWCA 3B8SA 3EDDA 1BGAA 4J3WA 2FHCA 2FGLA 3BC9A 3PZTA 1T0OA 1JZ4A 1HJUA 3U7VA 4PUDA 2Y24A 2NW0A 4EE9A 2BFGA 4CU7A 3W4RA 5A6AA 4EKJA 4EANA 1V03A 4J3TA 3SCWA 3U7BA 2WVVB 1OB0A 3DHUA 2WC7A 1V3IA 1HXJA 3PZUA 3DYMA 2PWFA 2F7QA 1J0ZA 1JAKA 1LG1A 4PCTA 1OD0A 1E3ZA 3IK2A 5JBEA 4XB3A 1FOBA 5A6JA 1E6QM 1RH9A 4W93A 5A95A 1GJUA 3AMDA 1VBRA 2V3EA 4FF5A 3BVXA 1VRXA 1EHAA 2EXOA 2DH2A 4UFJA 4AZCB 2CBJA 3T08A 1OM0A 2DT3A 3WBAA 3BVWA 1BYAA 3AHXA 2WB5A 4UFHA 2WBGA 4DWSD 1GQJA 3BUDA 4AWEA 3F5JA 2EPKX 1OIFA 1R46A 3DDGA 3GH7A 2A3AA 3CV5A 4GZIA 2D0HA 2E9MA 1SMAA 1XYFA 4DUXA 3MS8A 5I6SA 2WMJA 5CSYA 5LA0A 3D52A 3SCSA 1V6VA 4URIA 2X2IA 1CNVA 1OCQA 1KGUA 4S3KA 1KGWA 5CQ1A 2Y4SA 3WQVA 1G0CA 1VFUA 2D2OA 1KBBA 1W3LA 1WDSA 2W5FA 4K68A 3HJEA 5EFDA 4AZ6A 4C7GA 4AZGA 3MV01 3PHAA 5AC4A 4GPNA 3WNLA 4W86A 3WFZA 1V02A 1J0JA 4CD8A 3LPGA 2WSPA 3RM4A 1J0KA 4DM2A 3PBGA 4GQQA 1WDQA 2WXDM 5EMYA 2F7OA 3WDJA 1NOUA 4U3AA 3AOFA 1BSIA 3WDIA 1CLXA 5EBAA 3AIBA 1TE1A 3WMBA 3THDA 5LA1A 5I0DA 3AHVA 1D7FA 2A3HA 4MJ4A 4W84A 4UOZA 5A8QA 1W2PA 3BUQA 3ECQA 3GXPA 3OLGA 4WK9A 1UH2A 2EJ1A 4ML4A 2X09A 2J79A 1EDQA 4CD7A 1K9TA 5FIPA 4FNTA 1PIFA 2F18A 3MANA 1CGYA 4UQAA 1FFRA 3LRMA 4OIFA 3WL1A 3GXTA 5I24A 2DH3A 1LJYA 1NWSA 5HNNA 4ZEPA 4GZJA 3AIQA 3W6LA 3LPPA 1QBAA 3W26A 2GJXB 4MDOA 4IM4A 1MW0A 3K1DA 3W24A 4BQ2A 3GBDA 3AXHA 2VZVA 1WE5A 2J47A 3RM9A 4ZE4A 2E8YA 1ZBVA 3WMSA 4JKMA 3WDQA 5FD0A 4CGTA 3FW6A 3WELA 2UY5A 3GNOA 3L2LA 5E70A 2E9LA 4PBGA 1W3HA 3VDHA 4ATLA 2EPLX 1C91A 3K8KA 2UWFA 5C8BB 2VZSA 2XJ7A 5A94A 4OGZA 1VJZA 1BYCA 4AIOA 3CZNA 1TQUA 1HKIA 3GXIA 4MNJA 3VMNA 4BA0A 2PWGA 1OIMA 1SYTA 3I3EA 5A6SA 3RIKA 4AD5A 2WSKA 3WF4A 2ZX6A 1WAWA 5E6YA 3KLKA 1EH9A 4JHOA 3HU7A 2ZX5A 2EBNA 8A3HA 5E0CA 5F7UA 1UH4A 4YHEA 5M5DA 1H0IA 2AAAA 5GQBA 2ZIDA 4ZENA 3WNMA 2WW5A 4YPJA 1P6WA 3W29A 3MMUA 4W85A 1HIZA 1BFNA 3GBEA 4B9ZA 3VINA 4W87A 1WZMA 4W8AA 3VSTA 5I2UA 5IFPA 2UY4A 4HMDA 3GXMA 1WZLA 3MUIA 1M04A 1PPIA 3UCQA 2WCSA 4AISA 1CZ1A 1A3HA 2YL8A 1ZBKA 1V02E 3LPOA 1NQ6A 3QHOA 3NSNA 2X2JA 3S5YA 2CITA 2J4GA 1LF1A 4CU6A 1UZ1A 3ARTA 4MAVA 1GJWA 3IAQA 1QVBA 4MB3A 2VZOA 1WO2A 2GFTA 1JD7A 4TXEA 2W91A 3TV8A 1PS3A 4AC1X 3PZIA 3CMJA 3U57A 1HVQA 3D50A 3VM7A 1KXVA 3WH6A 1E0XA 3K8MA 2ZUWA 4CD6A 1TUXA 2XGBA 3CUGA 2Z1SA 3VIHA 2PWHA 3KEHA 1PBGA 4NXKA 1XD1A 3AQUA 3VGDA 3VILA 2E40A 2J7GA 4C7DA 1B9ZA 1UKOA 1XSKA 3L4UA 3VU2A 3ZJ7A 1JF6A 1HP4A 2CBIA 4J27A 2YA2A 3L4YA 3VSVA 3CUFA 1US2A 3EYPA 1E70M 2PWDA 3BAXA 3AHZA 1EXPA 1PX4A 4HTYA 2J78A 4Q7NA 4HPGA 4OBRA 3W6MA 2JALA 3CZJA 4C7FA 5D9OA 1J9YA 3T2PA 4D72A 1JZ7A 1VFMA 5CPQA 2X1IA 3SCUA 1FH8A 3LMYA 5A8NA 2QLYA 2JFEX 2ZXAA 3OGRA 3WD4A 2G3NA 4J3UA 2EQDA 3D4ZA 5ABFA 3I3BA 4ZXLA 2AMGA 1TA3B 4UZUA 3VMPA 1JFXA 2E9BA 1UKQA 3MV11 3UG5A 3WEZA 4PMYA 5IDIA 4F79A 1BLIA 3HG3A 3FAWA 1QI0A 1J01A 4CVWA 1Q4NX 4WIWA 2E3ZA 4W8BA 4MNMA 1E3XA 3BCDA 2EACA 1H41A 3S2CA 1JF5A 2G3JA 4WF7A 2XN1A 4AY1A 1PX3A 5GNXA 3A21A 1GHRA 3SUTA 5EFFA 3KE0A 2CXGA 4M82A 1OGSA 5KZ6A 4PN2A 2WANA 2GK1A 5AY7A 2VO5A 2WZEA 1W2VA 4LX4A 4AMWA 1HT6A 1GNXA 2BY3A 3VIMA 3BVTA 1XSIA 3AISA 2VT0A 1UWQA 2EABA 4P8XA 1B3YA 2FHBA 3WQWA 1KGXA 2ZICA 5A3HA 5BXPA 5GNYA 5CLWA 1CGWA 4NRSA 2W92A 2XWDA 1BTCA 1OGGA 1VIWA 3WY2A 5GPRA 3AYSA 2VX5A 1CTNA 3BLBA 5I5RA 1Q6CA 1UD2A 2Y2WA 4PMZA 1WCGA 4HZ8A 3W81A 1JD9A 2G3IA 2WMKA 4CN4A 7CGTA 1B3XA 4M29A 5E6ZA 4MB4A 4W88A 3GNRA 2WMIB 4GI8A 1KCKA 1MXGA 4OOZA 3W28A 2W61A 4D6IA 5JIPA 3BLPX 3LX9A 2JEQA 4JCLA 2VX7A 3PN8A 2ZUTA 2Y8VA 1ZJBA 2XFYA 4B9YA 2J75A 3DDFA 3SUVA 5EB8A 5A69A 4PMQA 3AS0A 1O6IA 4MDPA 2WMGA 3RMEA 3VKKA 3WF0A 1B1YA 5D8WA 1J0HA 5D8ZA 3CZKA 1UA7A 3EJTA 4UR9A 1KQYA 1X1NA 3VIGA 4W7UA 1KQZA 2ZE0A 3CBWA 2CHOA 3BXWA 3SUWA 1V6WA 1ZS2A 1X6LA 1JYNA 1JYWA 3WENA 1ZU8A 2DSWA 3AYRA 2BHYA 2OYLA 3H54A 1J18A 2F61A 1R47A 2OWCA 1QHPA 3MUAA 2RGLA 1GQIA 2PF0A 4DWSC 4NZCA 4FNQA 3ZT7A 1QWUA 2G3MA 4AZCA 3WFLA 2VZTA 3AMLA 1DWFM 3AS1A 4GO9A 1UD5A 2YL6A 1FHDA 1V3HA 5IHSA 2QV4A 1GCYA 1PEZA 4HMEA 3VO0A 3W53A 2DPEA 1UUQA 2F7PA 4QFUA 3F5KA 4BQ3A 3N04A 5IFTA 3SIMA 1TMQA 3WF1A 2UY2A 3HZ3A 3AMGA 3WDRA 2F1AA 3OG2A 2JE8A 2DT1A 3RM8A 2ZXBA 2BNJA 1W1PA 1XSJA 4D6EA 2FDMA 1CPUA 5BXTA 2IXUA 4QP0A 4YN5A 1QOXA 2D0GA 3WH8A 1E56A 1OINA 3L4XA 4GIAA 4D71A 5JBFA 4UQCA 1XD0A 3ARRA 4W5ZA 5JUVA 4BQ4A 1R87A 3D51A 3W0KA 1MQQA 5E0FA 2X8RA 2VQTA 5CPSA 3WY4A 3OA5A 4J3VA 3SURA 4AMXA 4JCMA 1GONA 4LQ1A 1H3GA 4HPHA 3ZO9A 2BVTA 4TTUA 1KR0A 4PMNA 1V6UA 5ABEA 2A3EA 1C7TA 1CGVA 5CZKA 3PTMA 3VD5A 5BXSA 2DSUA 1UKTA 1BYBA 1QNOA 4D1JA 1UYQA 3DHPA 4UOJA 5FCZA 3H55A 4UCFA 3LRKA 3ARVA 3VD7A 5A6MA 4XV0A 3PZ9A 3LPFA 5KEZA 1NWUA 1XCWA 3RO8A 2BY1A 3PTQA 3UR8A 3WF2A 1TVNA 3EDKA 3ZIZA 3TOPA 3BMWA 2J8GA 5DFAA 5JBDA 3EJQA 1E1FA 4H8VA 2CHNA 1TQWA 1JZ5A 3EBVA 3N18A 3MUZ1 5E09A 4AZIA 1V0MA 3ZM8A 2YA1A 3ARXA 3BVVA 2Q8XA 4LYRA 3AIUA 1L0PA 2GJXA 5D9PA 4PCSA 4AYSA 1K6AA 1ZBWA 3N13A 1GW1A 1EGZA 1F4HA 4XZWA 4XZBA 3T09A 1JAEA 4JL2A 3DX1A 3WH7A 1MQRA 1W9UA 3T0DA 2GDUA 1E6XM 1MW2A 5C70A 4TX6A 1NWTA 3WNPA 3NJ3A 4F8XA 2WMFA 2WKGA 4FNPA 1R8LA 4PTWA 1FFQA 3LXBA 3FAXA 4GXPA 3OZPA 2D3LA 1QW9A 1KTCA 4AIUA 4JFWA 2WYSA 1EOMA 3CMGA 4PRWA 4L4PA 4EAMA 5M3WA 4MNKA 2V3GA 4ATDA 3RCNA 4PSPA 3LRLA 1E0VA 2XVNA 2XHYA 2G8ZA 3ZJKA 4HA1A 2DIJA 1XGZA 3ZR6A 3N17A 2W62A 4XX6A 4AIEA 2FE0A 3POCA 5D9MA 3WF3A 2VCAA 3SCRA 2VL4A 3EMZA 1VBUA 3S6TA 5CG0A 1VFFA 3WY3A 1QNSA 2C7FA 4TOQA 4BZYA 2DSVA 1ISZA 4KGLA 2VCCA 1HL8A 1GOKA 3CPUA 1KWGA 3NSMA 3CGTA 3CH9A 1CDGA 4Z2HA 2VC9A 3KZSA 2QMJA 1TQSA 1XRVA 3AZTA 2X2YA 2CBUA 2V38A 2F1BA 1EQPA 1UOKA 3CHDA 3MO4A 3VX0A 3BMVA 1E1EA 5D9NA 1DWGM 4BS0A 2X2HA 1EO7A 3EJRA 4U33A 1CECA 3SUUA 1UA3A 1V3MA 5M03A 3OIHA 3HG2A 3AIWA 2QPSA 3AMCA 3N9KA 3DC0A 3A24A 1RP8A 3ARWA 4LXFA 1GOQA 1MWOA 3T2QA 5CPTA 3VD9A 1I1WA 4PMDA 1GQLA 8CGTA 4IPLA 1UD4A 4J7RA 2XWEA 2C8NA 4HA3A 1UWUA 5AYBA 2BS9A 4F9JA 3N11A 2WMHA 1HP5A 3QOMA 4JFVA 4TUFA 3DYPA 3VDCA 3CTTA 1VEPA 2YDSA 3G6LA 1GPFA 4PUEA 2CYGA 2FH8A 3VIOA 3IJ8A 1MYRA 3WMCA 4Z2GA 4F66A 5LYRA 3UR7A 3WD2A 2ZX7A 2D22A 1E9LA 4KGJA 1HJSA 3VGHA 2D0FA 2O9TA 2WZHA 1K9DA 2XG9A 1CXIA 1TFVA 5HPOA 2VRQA 4D6DA 1R7OA 1FH9A 1CXEA 3SCOA 4CCEA 1UKSA 4M81A 4W7WA 1MXDA 3WDPP 5ABHA 4WJXA 2WM0A 3S5ZA 2E8ZA 4BQ5A 2V5DA 1JDCA 1H09A 4PEEA 1CLVA 4DWSB 3VM5A 1HXKA 1MW1A 1E4IA 2BVYA 1W1YA 1SFSA 1KBKA 1KB3A 4AZ7A 3CZGA 2YBTA 3ARQA 2CERA 4QLLA 1BG4A 1TA3A 1IV8A 3VTRA 1QPKA 1QNRA 2DDXA 1PJ9A 3A4WA 3AZRA 1B3ZA 4Q22A 1QI4A 1UR8A 1W9XA 2JF7A 3ALFA 1UWIA 2JIEA 3KL3A 1M01A 4AZBA 2BHUA 2GSJA 5HBFA 1JZ6A 4H41A 4RL3A 4D1IA 4NZJA 2DSKA 1M53A 4GO8A 3VIPA 2GUYA 1UD8A 1DEDA 3MSDA 5HOSA 2FGZA 2HVMA 4QLKA 2VZUA 2MANA 1EIBA 1M03A 4GI6A 3VIKA 5BYWA 1SR0A 2DT0A 3BSGA 1AVAA 4QCFA 3WD3A 2UY3A 3AXXA 3ZJ6A 1H0GA 1CGXA 4D6HA 5IHRA 4TVCA 1PZ3A 2JEPA 4NRRA 1E73M 2VR5A 1LL6A 1QNPA 2GJPA 1WB0A 1G5AA 1E5NA 1LL4A 4CCCA 2O9OA 3CZSA 2ZXQA 3GNPA 4WSJA 2XSAA 2XM2A 3VOCA 3GZAA 2O9RA 3AIVA 5A8OA 1W1TA 3W37A 1Q6FA 4FMVA 4CN1A 1B31A 2EEXA 2W4XA 4YHGA 2ZUVA 3QOKA 4KRUA 1LLOA 1VB9A 1DWAM 3VPLA 3QHNA 1Y7VA 1WNOA 4U31A 4PMVA 2HISA 2WMIA 2OWWA 1NM9A 2ZUMA 4BF7A 2PI6A 4ATWA 2OLHA 1QWNA 2TAAA 1CXLA 4FK9A 4V27A 3FHQA 3FY1A 1IT0A 1E6PA 1UQZA 2FYVA 3UESA 1BGGA 4M8UA 5A6BA 4D6FA 2V3DA 1JDDA 1ISVA 4WKAA 3HMCA 3IANA 3A4AA 3D5HA 1HN1A 3IJ9A 2YL9A 1WKYA 3CLWA 1MFUA 3M6DA 2XIBA 1ODUA 1C92A 2VX6A 1B2YA 2VJXA 1E0WA 4LYPA 2YKKA 2G41A 4BCEA 1CYGA 2DT2A 3D4YA 1MQPA 2E4TA 4HZ7A 4X0VA 4Z2IA 1TZ7A 1E43A 3WEOA 3TTYA 3ARYA 1QX1A 2WNWA 3H53A 4AXNA 2CKRA 2J7CA 2DIEA 4WKFA 1PX8A 1RD6A 4V2XA 1HVXA 2VOTA 3RJYA 2WCAA 3EDEA 3VIFA 3UG3A 3ARUA 1FP8A 3WUBA 2JF6A 2YBUA 3PZGA 1FHLA 4RE4A 5FL0A 3WIJA 1EA9C 4PYSA 4M24A 3MSGA 4CU8A 2J77A 4Y7EA 5JIWA 4H8HA 3WUEA 2CESA 3BAJA 5C71A 3MUY1 2B31A 3BAYA 4Z2KA 1WDRA 4Z2LA 5CXPA 3K4DA 3M46A 1H49A 3MKKA 2BHZA 4E4PA 4N0RA 2OSWA 3VDBA 3VGEA 1GVIA 1CWYA 2WHKA 4P7OA 2XN0A 4JHZA 4OJYA 4HOWA 1HJXA 3GTNA 2GJRA 4KWUA 2XM1A 3BAWA 4AW7A 3EMQA 5A6KA 1KXTA 3ZQ9A 5DT5A 1G1YA 3EMCA 3ZSTA 1VJSA 5DEZA 4X0NA 1KFWA 1AMYA 2J7EA 3A23A 2W63A 1UQYA 4KH2A 1E55A 3OLDA 4QAWA 1JZ3A 4CD4A 3SCQA 2WVVA 1XHGA 1NH6A 4QDMA 3L2MA 3LXCA 1BHGA 1K9EA 4E8DA 1G9HA 4GI9A 2YDRA 2W66A 3SUSA 1CXKA 1TG7A 2OSXA 2CKSA 3ARZA 1FA2A 2ZOXA 4MTVA 2IGTA 1ITCA 1E6SM 1JXJA 2VTFA 4CCDA 1UH3A 1W9PA 4J3XA 2WCGA 3APGA 3GH5A 3WY1A 1W3JA 3DX2A 4HZ6A 3RDKA 3VD4A 4CD5A 2VURA 3A6OA 5FKYA 2QF8A 3NUKA 3WL0A 4KRTA 1JL8A 1F4AA 2YIHA 4A4AA 3GDBA 3ZT5A 1HWWA 2D3NA 5CSUA 4MAZA 3U5UA 3GXFA 2J74A 4AEEA 6TAAA 1CIUA 5TD4A 4S3JA 1G94A 3O6AA 3OLIA 2ZWYA 4V28A 5HPCA 1UR9A 3VMOA 1CENA 2VNCA 3WD1A 3M07A 3AHTA 3WNKA 2Z1KA 4B3KA 5A2CA 3B9DA 1JDAA 3A22A 2JIWA 5GNZA 1AQ0A 2WKLA 3QGVA 1PZ2A 4B3LA 4MPKA 3VX1A 3UETA 4D6GA 4QLJA 1VFOA 4JKLA 1A47A 3AJ7A 2VRKA 1XCXA 1JFHA 2QMKA 1B30A 3AFBA 1OT2A 1PAMA 4AD4A 4HOXA 4AD3A 1OBAA 3EJSA 1V3KA 1UWTA 6CGTA 3N15A 1WZAA 1J0YA 2YJQA 4HOZA 3KL0A 1BAGA 3VGGA 2AOSA 1JYXA 2F8QA 5HDRA 2OYMA 1GOOA 2WC4A 1UHVA 4JFTA 3O2LA 3WNNA 4GQRA 2VUYA 3WDHA 3EDFA 4FLQA 2OW6A 3UERA 4A3HA 1WP6A 2VVSA 1V6XA 4XUYA 4PMUA 4WKHA 1V6YA 4AZ5A 2J25A 4GKLA 3EJPA 1XYZA 1H1NA 5BRQA 1XH0A 3NCOA 4ACZB 3ARPA 3OBAA 1FH7A 4UQDA 3U5YA 3WUFA 1Z32X 2V5CA 2EADA 1BPLB 1GORA 3WQ4A 4X9YA 2YLLA 4ZE5A 4HA4A 3DYOA 2FHFA 1US3A 3AXIA 1SZNA 4KMQA 1E6ZA 1CGTA 3F4VA 2DSZA 2BY0A 1KTBA 5AYIA 4JZ5A 1J12A 3NDYA 2WZIA 1KR1A 2YL5A 3EJUA 3WH9A 3PZQA 2W67A 5DF0A 4AMCA 1QHZA 1JI1A 1WDPA 1ZL1A 1W9DM 1Q6DA 4AEFA 3VVGA 1LWHA 3OB8A 1EO5A 3L4VA 1V08A 3ALGA 1WZKA 4UFKA 1BG9A 3WBEA 4D6CA 1HJWA 1AQHA 1LWJA 3NDZA 2OWXA 4U5KA 1VAHA 3PZVA 3POHA 3T2OA 5BWFA 1DP0A 2ESCA 3TTOA 4FNSA 5A6LA 5A2BA 1M7XA 2J7FA 3HN3A 2WC3A 9CGTA 3M7SA 4H8UA 2O9PA 4N42A 2C0HA 2NT0A 1GZJA 1JZ8A 4PTMA 3A4XA 3O9NA 1TCMA 1E6NA 3W82A 1I75A 1WPCA 2OSYA 1KXHA 2WHMA 1W91A 5D4YA 1R7AA 2BXYA 5E9AA 4U2ZA 2GVYA 4NX0A 1NOFA 3ZR5A 2EPOA 2GDVA 2ZWZA 2EO7A 3ZSSA 4NF7A 6A3HA 1J10A 1NARA 2CCRA 2VMFA 3AMKA 1W9BM 4FLRA 2VI0A 3SEPA 3B9EA 3RPMA 2NSXA 2J8FA 1HNYA 3GXDA 4MJ2A 3OGSA 3SCPA 2WLYA 3AHYA 2YFOA 3VD3A 2CPUA 4CUCA 2PB1A 1OSEA 4H2CA 1C90A 1L8NA 4DWSA 4PMRA 1W1VA 4AZHA 1VENA 4MB1A 4R27A 1W9VA 1E5JA 3TONA 3CHCA 2VCBA 2V3FA 3VIIA 1E71M 3SCNA 2PBGA 1I1XA 4CN6A 2J7DA 3VSUA 1JXKA 1EDGA 1MW3A 2XFFA 1HKKA 1Q6EA 4U2YA 1C93A 2ZUUA
chains in the Genus database with same CATH superfamily
5FA5A 4POZC 1BQLL 1SY6H 2DN7A 2HRLA 1TZHB 1IT8A 3N6HA 4HPNA 5EO1A 4POUB 4LYQA 2A9NH 4HU3A 3N14A 4ZSOB 3BSHA 5JHAA 4MF4A 2OZNA 3IIPA 4JZNB 1SLVA 2NT1A 5ERWB 2WNNA 1S7UB 4AVOA 3G77A 4HIHB 2BOEX 3R7RA 4HU8A 3CZ8A 1FNHA 5GIRB 2RDTA 4N2EA 4NRXB 3H9SB 1OAZH 1O6TA 3DWTA 4NPJA 2LAGB 1ED3A 4KXDA 5G4EA 1ZD6A 2QPUA 2XQ0A 4F58H 1CE1L 4AL8H 2IPKB 1BVZA 5C9JA 1RPUA 3UTTE 4GS7B 4KXBA 2CO6B 2J8UF 1GGIL 3H3KA 3RILA 1T1YA 3LCLA 4F4RA 1MFBL 1JDFA 4PU2A 4FNUA 4Y9NA 3VCCA 4I5XA 3MMWA 1R5IB 1U22A 1ISXA 4PULA 5JHDD 3HG4A 1OP9A 5D9SA 2OZ4H 3VRLF 3D39B 1AKJD 2TRHA 1I3UA 1XSOA 1HCVA 1Z9OA 1CDCA 2BIMA 2PC4A 3PQYB 4A38A 4QNWA 3RUGB 3PTKA 2DEPA 1O9WA 2EJAA 4TYUA 1BREA 4F0RA 2NOYA 3MRHA 1PLBA 4JFXB 2NNCA 2IGFL 3ABXA 5FHAH 1ITXA 5FF0A 4W9CC 5BUAA 4NQDA 5I3DA 2EYTB 2A38A 5F7AA 1SOKA 1IVLA 3IMVA 3FQNB 2NW2A 3KZPA 3PREA 1AXSA 3V6OE 2VMJA 5J04A 1PDKB 3FB8B 4EBQL 5MKGB 1VEOA 2XKUA 3QV8A 2F6XA 3GNDA 4Y4HC 4JFUA 3WN6A 1HW6A 1U3NA 2DQHL 1OSPL 5GGSA 5F9OH 1TLKA 3M44A 4BFFA 4KETA 1SMDA 3MNZA 4QGYA 1M6OB 3UJSA 4JQ2A 2ARJA 2OT0A 2O7SA 3MLZL 2X4NB 1KYOJ 1S5IL 2O6PA 4JFFB 2CPCA 4FERA 3C5SA 3QFGA 4PRDB 4WU5A 4G7FA 4U5IA 1MY7A 4NKDB 4UZSA 4QHNA 3UCDA 5DEFA 3OR7B 1R33A 3D25B 4IGSA 1FWSA 2FJKA 4Y5XA 1LO0H 3ABOA 3NBNA 3PU7A 3L3KB 4W9EC 1N82A 7ODCA 1AODA 3HE7A 1Z9SB 5T3XH 1HL9A 2FJHB 3QC6X 3NPWA 1B0GA 4K8GA 4M80A 1CF8H 4HYRA 3PGFH 3NJGA 3QR1A 2PCEA 1S9YB 1UZ6E 2D20A 3RO6A 1HC1A 2J4WL 9RUBA 1ZLSH 3R10A 5D1QB 4K73A 2CZNA 2ORBL 4ZMWA 4LU0A 2IXVA 1TVPA 2CLIA 2H6UA 4MQSB 5BOFA 4EDWH 3FNDA 1NCBH 1J05A 4D2JA 5E8OB 4LVBA 3ETSA 1N59B 4NIKB 4MJIB 3KPSA 3OJDB 1CD9B 4JHMA 5IHZB 4HX1B 1DL7L 5IT2H 3C8KA 2Z92B 3HBGA 4P7NA 2YPVH 3GH4A 4WWOA 4X5XB 2BVWA 5D1ZI 1NC2D 3H2MA 1EQCA 2QFRA 4GH3A 2NUPA 2C7UA 4J3SA 1PSKH 2E6YA 1RIVL 2BV9A 1TPDA 1F6FB 4OZHE 1MFEH 4F2BA 3BRDA 1J9CT 1BYDA 4NOFA 3UG4A 3V6OC 4ZFQA 1I4FA 3MCYA 5HYIA 1BOGA 2YDAA 4PJAE 4C56D 3B8YA 3W1UA 2LVEA 1XDTT 2X4QA 2GHZA 2HH0H 3VI4E 2GJ6D 1J0ZA 2BP8B 1MCLA 4D8LA 1SSDA 5EF3A 4XB3A 1Z89A 5JPMB 4RV8A 4Z3HA 4FRWA 4GRSA 2UY7B 2CKBA 5I1CL 1U8LA 3RPTA 1PNDA 3D3VE 1BV8A 1FH5H 5I8KL 4Y9OA 3KX6A 4DB7A 2YARA 3BDXA 3DHDA 1L0YA 2EXYC 4RESB 4OF8A 5C9KA 4M7SA 4U3XA 3UP1A 4DUXA 4XN9A 3G6DH 1G4EA 3FKKA 3GMOA 2R1PA 3C8NA 1V7NH 1KGUA 3TF4A 2X30A 4NOBA 4LUTB 4JRYB 1I2QA 2FB3A 4MY1A 1WDSA 2EE2A 3HJEA 4H40A 1TJ2A 3WLKX 1F07A 2Z34A 2OX5A 2OFJA 4YK4C 3RDTA 5DURB 5CSGA 4HS3A 4BHYA 5AYXA 3N6QA 5FAJA 1I2PA 3GG7A 1FA4A 4UNVA 2N7AA 2I5IA 4NQCB 3DEQA 2QUTA 3P73B 3NACH 4OZ4A 4E9YA 2A3HA 3CFCL 2I9TB 4PTUB 2XUWA 4CD7A 4JY9A 4D9PA 1VHNA 2YKLL 1M2VB 5KVGH 1UMYA 2GSIA 1PCKA 3GXTA 5KJRH 4A3UA 5KG9A 3W6LA 3MZNA 4PWFA 3WZ0E 4X4XA 4OTKA 2AK4B 3GDKA 1YNTA 3EJYD 4GVFA 1WE5A 2VABA 3FSVA 3G5ZA 4X7EC 3ABQA 3NDYE 3QDMD 3QJFA 5A94A 4U1LA 4TO8A 1E9YB 5JR1H 1TQUA 2H1XA 4XGZB 1O9VA 4B91A 3SCMD 1R2SA 4ZMNA 3VFSB 3TSBA 3GJFB 1EH9A 3HU7A 4H26A 2EBNA 5KYYB 4GP5B 2WXJA 1P7QD 2HROA 1OOWA 2GABA 4O5LH 3T8LA 3GBEA 3TNNB 2WXGA 4ZGYA 5TF1H 2CH8A 4WHYH 2BDNL 5B39A 3NSNA 1LORA 2CCLA 3D4CA 3QNZB 2QADB 1JJUA 3P81A 3O3AA 3TYUA 3KVPA 4A7UA 4RJEA 3HC2A 2A3LA 5EPMB 1BF6A 4ZL1A 3GSNH 1XGRA 1PTDA 3U57A 2NCEA 2OXNA 3DJRA 1C08B 5AB9A 1E0XA 3DBNA 2RAGA 4LSRL 4G1EB 1RR2A 3QISA 3AADB 2JK5A 2PWHA 4HAKA 1E50A 2NVDA 1B9ZA 1V7AA 1R3YA 1SXSA 3NPZB 4PJIF 3VU2A 2JKIS 4HS8L 3EYPA 3BAXA 1WV2A 4U1SB 3ARBB 1G1OA 1W0WA 3DHMA 2GFBA 3ISRA 3W1TA 5MERA 2X7LA 1FL6A 4WR3A 1XBRA 3BEWB 3SE6A 3FCPA 1SXNA 1F76A 1KCSH 3BKJL 3W01A 3O45A 1PKQA 2WJ7A 1JVNA 3QDGB 3O0RH 5EBLA 2GWNA 4I1NB 1TJRA 4R9OA 4YYFA 2AITA 1EJUC 3ZO0A 3PGDA 4WNSA 3NG5A 1HWGB 5C9RA 3MPCA 3E80A 3STLA 1BVWA 4G6AD 4BM7A 3EGXB 2FJGB 5CCKH 3IJIA 2EIEA 2VWEC 4YLWA 1BAFH 3IVSA 3M1BA 5IBUB 2YD1A 3I68A 3BJFA 5C7VA 3ERPA 1A2YA 3JWDC 4DGYL 1OABA 2OMBA 2PO6B 2FHBA 1AD4A 1VRDA 3WQWA 4ADIA 4WI8A 4CSTA 4TUKL 1CGWA 2JIXD 2VOMA 1AD0A 3L7FA 2PTTA 2ZC1A 3DX6B 1OGGA 5LBGA 5BV7H 1VIWA 4RCXA 3B37A 3SB0A 2PYED 3DTUB 3S8GB 5IVNA 4DUOA 4E41B 3M5VA 2WMIB 3KGTA 5AC6A 2VFDA 1V79A 5AKSA 4QPEA 5FA4B 3LX9A 1XRSA 4LAZA 4YHOH 1J88A 3V5CA 3STZA 1QTYT 5FYJL 3FK3A 4Z1CA 5T9CE 2KZBA 1CG9B 3W70A 2EZ0C 5IK3A 4MXVF 1HSBB 5HYSB 2I24N 3J8F7 3RVXD 2M83A 4JYEA 3CBWA 1R6WA 1X6LA 2DSWA 1J18A 3SPHA 1FFTB 4LBAA 4YDZA 4ONFL 4WV1C 5D5MA 1FZMB 1T20B 1JV2B 4M9PA 1IYXA 4GO9A 1S1RA 4LAMA 1PG7X 4ZO8A 1ETJA 1S7VA 2Z1BA 3WF1A 4NO3B 5D7SL 4E42A 4IMDA 5MENE 4EZMA 4MM1A 1QOXA 4HHGA 5J4MA 3CVIL 4M1BA 1E56A 3ARRA 1T03L 3F4CA 4LLQB 5DRCA 1RSFA 4BH8B 5HVGB 3ZXAC 5IESH 3MBEA 3W3OA 1DBAL 5FCSH 5A3ID 3SDXB 3ZL4L 3BSMA 1UCTA 2HRPL 2P48B 3BSZL 3VD5A 2VDNH 3RB7A 5KZDA 4GFTB 2HZGA 2I7SA 1EUUA 4D1JA 1L6WA 3KPQA 3P77A 1S7XA 3A13A 4S11A 5HHQA 1BD0A 1KB9K 3C0SA 4B60A 4OGQC 3APMA 1NWUA 3PTQA 3BWZA 3GR4A 3A6BL 4KZDL 4ATTA 1TVNA 3EA3A 1U8JB 4OCRH 2XJKA 3MJ7A 4ZQNA 4XOBA 3EBVA 4M6NL 4QRPB 5C0JB 1XKYA 1KPVB 1LZOA 4YQXH 5D7LA 3QYCA 2V5SA 1MG2C 2PPFA 1EGZA 3D33A 4Z7OF 1MJ7H 3LZLA 3E2VA 1YYAA 4X9GA 2MQCA 5I1HL 3TW9A 2HEJA 2OZTA 5HYJB 4EN3B 2HE5A 4IKNA 3OZPA 1K8YA 1QA9B 3MNVA 1OK0A 3KLSA 2X88A 5LWYL 4MNKA 3URQA 1M7DA 1F11A 4LE8A 3NM1A 5JOPD 4HA1A 3U9UB 2PTYA 3DBXB 5D9MA 3ECVA 2MQ0A 1DE5A 2PDNA 2OL3B 4Z5RA 1AFVL 2ALDA 3LQGA 5LCVA 3WO8A 3WTSA 4TOQA 4BZYA 2VCCA 1XQLA 1YDPA 1NBYA 4M62H 3QC0A 5IV2B 4NN7C 3PL6C 3PS7A 4EJ1C 1MHCA 3X3FL 2QCMA 4U05A 1A4MA 3ORJA 1WFUA 5CJMA 1QR7A 5T1KB 4PV1C 4WWKC 3BH8A 3UDWA 3AIWA 5G1MA 3DC0A 1CYXA 1TR7A 2D7PA 3WBYA 4WKZB 4IPLA 2YXGA 5K9CA 3OMAB 3GSXB 4PE8A 3WN5C 1G9EA 4KTGA 4GYBA 2EHHA 2IOMA 4NKOA 3CTTA 5FGBC 3G6LA 5FO8A 2R29L 4C1NB 2I9UA 1BD2D 3GSUB 1XF2A 3NJLA 4U4BA 2A83B 1YMMD 2CIIB 4W7WA 5FIEA 3MRPB 5AKVA 1H09A 2NY0D 4QKXB 5FV1L 4A2LA 2QHLA 3CAWA 4MNQA 3A5FA 5IJVB 1E4IA 1W1YA 3TN4A 3TBVB 2XPZA 4PV9A 3PG9A 2VGLM 4L0PB 1QNRA 2PDGA 2FPTA 3Q6GH 4NP4L 2OCFD 4J1UA 4BSVB 5GJTH 5DMJB 4KQ3L 2GUYA 1CB7B 4PH6A 4L1GA 1OAQL 5CEYB 3B9KD 2Q8AH 1BGXH 5HI4C 4OZIE 4PGLA 3BSGA 2Q1EA 3GNML 4P0DA 2CBTA 2PRLA 1VFTA 1A3RL 1PLCA 2F74A 4FFVD 1DVYA 4JZJA 4F24A 4QTIL 4X60A 1FGNH 5HHPA 1JK8A 1WQVT 1AZUA 1X4YA 3V5KA 1YXDA 1JCXA 1PEWA 3V6BR 4NP7A 2CC0A 1WZ1L 1T21A 4N25A 2Y5TA 4ZUVB 1NGPL 3IDUA 3WD5H 2E86A 1YYMH 4JDYA 1Q9KA 4LLMA 4WQOA 3URBA 3E9AA 4NX5A 2XG4A 3RPIB 4HWBH 3ZUNC 2O30A 5A6BA 1I82A 3QXWA 5D02A 4GO6B 4RNRA 5CLXA 2OEKA 5DVOA 1HN1A 2OXHA 2EG8A 4H7CA 5HNUA 2XIBA 3MDWA 2DP3A 4FX7A 3P9LA 1ADOA 5I75C 3P0YL 1OXYA 3M5ZA 2LU5A 2YKKA 4B6ZA 2CLOA 5HMSA 2OJEB 3JTTA 1VFBB 5AHNA 1TB3A 1P7KA 4KKBD 3BJSA 2KDGA 2HPTA 3SY0B 1D8WA 1HH9A 2OOFA 3FT3B 3MV9D 2HFFB 1OAUL 5C0RL 1X4XA 3MSGA 4Y7EA 4J40A 4IS6A 2X4PB 1QAWA 4O58L 5C71A 4JY4B 2YWYA 3BAYA 2WTPA 3KXFE 5B38G 2X1TA 3EYFA 5FKPB 4MFEA 4EXPX 2JGQA 5AENA 1CDYA 3VGEA 2XN0A 5J57B 3TYGH 4HOWA 2HCZX 4MDIA 1NDVA 5JZ7C 5A6KA 5H8UA 1KXTA 1WISA 4L8DB 4NCDA 2NDFA 1FVEB 1A7QL 1IKNC 4X0NA 1GH7A 4I2XE 3CL7A 4GOSA 1CR9H 2R1LA 3CSGA 1FZOB 1BHGA 5KUMA 3WEBA 4ODVL 4MS8D 2CJTA 3UTZB 2OSXA 3FUMA 1F3RB 2FQIA 2VTFA 2HFEA 3SBRA 1DEEA 2WCGA 2LQRA 4I7WA 2WKOF 2FJSA 2EDOA 4JVPA 3SE8H 1UB3A 3OVQA 3FT2A 3UPRB 2FLBT 4YR6B 4JX4A 4URTB 3O4LE 5IQMA 2NYKA 2FTWA 3I50H 1TJ1A 2VXVL 3OV6A 3JWDL 4U1NB 1D2OA 3BGJA 4HFWB 4LCWA 4HOXA 3PJUA 3V5HA 4IPJA 4LDEB 5FJJA 2H0EA 3M7WA 4MZ2A 2OW6A 2V2CA 1V6YA 2DZEA 2F8IA 3UNTA 1LEIB 2UWEA 4XN5A 1JEZA 2HXTA 2B1AH 4HGMA 4DJEC 4IIQB 4E9SA 2DEXX 1Y5VA 4Z7VE 3EJYC 3AXIA 2DWDB 5FJIA 2VERA 3SPVB 5EOCJ 3K6OA 1LUCA 2YB1A 4PJBB 3PC0A 1IAIM 4CDGC 4HFUH 1MUMA 4ZUUB 2GW5A 3W0WB 1YN7A 4K7PL 1EO5A 2EC8A 1KCVL 4UI2A 5HHNA 3GYRA 4D6CA 3LN4B 4MCZA 3RLSA 2H45A 3PZVA 1SR9A 4BFRA 4RQQB 3TBCA 3AWEA 1RFDH 3ROLA 2OMXA 3HN3A 9CGTA 3ABGA 3KTXA 2C3GA 5I76B 2OSYA 1YQVH 5TE7L 3JWNE 1OFOA 2R6OA 4FA8A 2X1XR 4LVOB 2J1XA 3CB3A 3TIEA 3GBNH 3ZZSA 2QQLH 4HIEA 1P4BL 3D0LA 2RCSL 3FOMA 1MJJA 1SUXA 3GLAA 4M61B 4ZXBD 1C90A 1L8NA 1S3HA 4XAZA 1E5JA 3P1VA 1DVFC 3TFBA 3IFLL 3HGSA 5D7EA 1F90L 1VZGA 5LBSH 1KTRL 3MFFB 1HKLL 1XWVA 4CL7A 4R90H 4Y2OA 1RSYA 5I8EB 3NK3A 3UABA 4WFED 1VSCA 3VXUD 4WLCA 5IW6A 3T0BA 1RHCA 2YCLA 1FE8H 5IFAL 1ZBCA 5LNGA 3KYNB 3SN1A 1AIFA 5EUOB 5KVEH 3FXYA 5CWSB 3WIIH 3ABSA 2G4JA 1N9PA 1TQTA 3MXWH 4G9FD 1V05A 2DZPA 8PAZA 3PV6A 5IJKC 3JWOC 3L5XL 3IMSA 2IANE 2OZ3A 4NZFA 1RJZA 4JAMA 2QUMA 4HKPA 3PZMA 3VE9A 1PV8A 5L8JB 2BDQA 3WK2A 1I9IL 2H3XC 3BAIA 3EO9H 5CSSA 3I4KA 1UG6A 2Y69B 3A3HA 1FCGA 4DUVA 3N12A 4WGXA 3LZ3A 1DYSA 4NNAA 1WOBA 5F7NC 3IJSB 4OZOA 1IFRA 1TX0A 4XIAA 4L37A 2AMXA 3ZVHB 4W4OA 4NUPA 1FWIC 4XNMB 2G9HB 3H0TB 4EF3A 1G7VA 1KTJA 2BSTA 25C8H 1HXYA 2F58L 2FT8A 1ONQB 4AH2A 1X5IA 2DQWA 4EI5A 3U4AA 4QXUL 4OZGE 4YDVB 3WLPA 3II3A 3MO7A 3BN3B 4P57A 1ECEA 2F5BH 2NQCA 1SOXA 4JIHA 3RFZC 3AS2A 3IXAA 7A3HA 5MEQA 1W3KA 2J6XA 3GDLA 4NCC1 1XPGA 2R69A 1LNUA 1IE4A 3VXMB 3VKAA 5T3ZE 1BG1A 2YYTA 3SECA 3JWNC 4MMYB 1XLIA 4MOZA 1QSZA 3OWRA 1JNDA 2YAEA 3VGBA 4M4PA 3MU7A 3IJLA 4B97A 4IQLA 3RJXA 3BLOA 1NFIB 1W1IE 3IWPA 5GRJL 4UM9D 4D8PA 1FCCA 5GZOD 1C8XA 1MF2H 3OF6D 1ZHLA 4A3YA 2MCMA 1BQSA 3ISWA 3AIEA 4JFDB 2Z31C 5TE6L 3OO2A 1IXNA 3H8AA 4ZUTB 1WBXB 2FL5B 4HUKB 3SYPA 4F5CE 2DWSA 3C5JA 2B4GA 3ZE2F 3BZDA 2Z2BA 4OM0H 3DMMA 4BZ2A 5AFAA 5AVWB 4A7QA 3E5BA 3WH5A 4FNLH 3WTVA 1FO0H 4A6GA 1OSZA 3LN5A 1JERA 3NR0A 3T0AA 4CJ1A 5ESAA 4S2SA 4WJEA 3RCMA 4HYWA 3ITTA 3E0VA 5J1SC 3OGVA 5HULA 4MA8L 4IYKA 1NGZA 1OKEA 4H8WH 1H51A 4L1DA 5ABFB 2DWTA 3V75A 4AJWA 4AVKA 1LMIA 1FWCC 5HAOA 4O1AA 4GXUN 5AG8A 1SJMA 4GKZA 1IXOA 3TC6A 2GK1B 3UZEA 1EK3A 1ESWA 2CIPA 3K2GA 4TTGA 5C0QA 3Q1SL 1EGMA 2Q71A 2XGIA 5BRZE 4PRAA 4KQ0A 4HUWB 2VFGA 3SOBL 1XEUA 4WDXA 7TIMA 1SPDA 2OXGA 3LCYA 2AEPL 3MBDA 1C29A 1Q4WA 4FI7A 4FQ1L 5C8JA 3Q06A 5I1LB 2LVCA 3CUHA 2XUCA 4IFKB 2R0ZH 1KLUA 2ZPKL 4ZMXA 4DM1A 2VDLB 1NPJA 1PQZB 3QUZA 3V7PA 3MOAL 4JO3H 5U7SA 4YCOA 1GYVA 2G75B 3R2GA 3PY9A 2IQTA 3VE0B 3KPMB 2NW0A 4FQCL 4FTVA 3PWPD 4EANA 1MWAL 3YPIA 2VLJD 1Q85A 1RUKL 4JE0A 5F89B 1FDLL 2ERJC 4FXTA 2C19A 5C92A 4XVUC 2QQNL 5I74C 4GXMA 3QUMH 2WJDA 4V1DE 1ZSXA 4HBCH 4RWHA 3BZJA 2J8UE 1FWXA 3V4VB 5ALBL 4KV5E 3DPBB 3LNDA 4DWSD 1XLLA 3MLUL 4GZIA 5D05A 5ABTA 5CU9A 3GHEL 4FADA 1DSFH 1PLGL 3VRLE 3MV7D 4LCSA 4KRMB 3NPVA 4URIA 3IKCA 4Z0BH 2V2TB 5FF6B 1IEIA 4DGVH 5I6LA 4X8JB 1R3KB 4G8IA 1MCWW 1FWFC 4TQPA 1ILUA 2F1EA 35C8L 5DDHA 4ZI8A 1L7IH 1RZ8A 2FEJA 3VXRB 5TFSH 4NQSA 5DS8A 1YBQA 2P0IA 2Y6SD 2WSPA 4GQQA 3ONCA 5KANI 2BASA 3TA6A 1SFDA 2LHAA 2OR2A 1DLHA 4O1FA 3M1OA 3WV0A 3LB6C 1QASA 3GXPA 3F7YA 1E27A 3KPPA 1K9TA 4KK8D 4E5TA 1DJXA 2Y9RT 2R4SH 3IDXH 3QEUA 4FFVC 2DQJL 1LJYA 1AJ2A 3GX9A 2JSFA 1QBAA 5DANA 4GK8A 5DT1L 4M3HA 2TMDA 2UY6A 3OKNB 3B9OA 3IRPX 2QKIC 3RM9A 2E8YA 4L8CA 3VKJA 5C0CD 2WJZA 3QIUA 4LCCB 5FK9B 4OJCA 2VLKB 1VH7A 4QIUA 3EXSA 3BRGC 4YX2L 2HSAA 2P4AB 3NQIA 1OIMA 4XTRC 5D1XD 3R6IA 1OAXH 3JR2A 3QLDA 1PF3A 3C4UA 1FV1B 4HJTA 4C4UA 3CDGB 2QR0B 1RLCL 2NLJA 4YHEA 5ETUA 4LUYA 5I6PA 3PXLA 4NAFA 1DVSA 4PS3A 3MMUA 4A2DA 4F92B 1HOEA 3QMTA 5L9DL 3A64A 3VFGH 2NY5C 4NQDD 1K4DA 1PSCA 4JM2A 3MY9A 4R9HA 4K37A 3N5AA 1G84A 2VEIA 3OC5A 4FHJA 2ZVIA 4KKBC 2H6RA 4LL9A 4AQ1A 4ZA0A 3WE6B 4Q32A 3VM7A 4QXGH 4PJ5A 4MZIA 1NVMA 3DO7B 3A12A 1BWWA 3TBSA 5E1AB 3VIHA 1RBLA 4A67A 5TK2A 4B5ZA 1SMOA 5B4MD 1S7TA 4J4KA 2FVMA 1J8HB 5AW8B 4AEHH 1EVTC 5C07D 3CFTA 1OOAA 5EA0H 5CCHE 3U46B 3ZRCC 1GGIH 1MFBH 5HJGA 2VC7A 1WA1X 4OLXL 2XBDA 2IQ9H 3FDWA 1OTUD 1T1ZB 3MC5A 3NJIA 4HWNA 3MTWA 2H32B 4O17A 2AKMA 2JFEX 3WIFB 3WD4A 4CILA 2G3NA 5D70H 5IGXL 2JNZA 4DXKA 3H4HA 3JWOL 3SYQA 2AMGA 1KA9F 4A68A 3CQPA 3SPIA 1SGKA 1U8HB 3L48A 4PMYA 1F18A 4A39A 4W6WB 1NF7A 1J01A 3NPUA 3HF3A 3V4PL 3B04A 3S9YA 1U8QA 1XIWD 5MP6H 2YUVA 4QCIB 2XIDA 1OGSA 4Y5VC 2VXUL 3TXZA 2PD5A 5I2IB 2BY3A 2P5EA 2JCCA 1XSIA 5BOOA 2PGRA 4WI6A 2B81A 2XNAA 5CAKA 1TWDA 3BW4A 4F2TA 4OGYH 4XXWC 1KCZA 3CWHA 4JQ1A 2WXKA 4HZ8A 2AS5M 4AQEB 3C6LB 1CT8A 3ATFA 3KPSD 4M29A 2NDGA 2BRRL 2DQHH 1XMEB 2AEIT 4GI8A 3F1QA 3LB0A 3P3TA 4MTMA 4AXWB 5I73B 1VRSA 3IJQA 3S35X 2ETWA 3M0IA 3QPXH 3SE9L 2Y8VA 3CNKA 3IDGB 3NJVA 5I66A 4I88A 4XCNA 2HUHA 1O6IA 3MR9B 4PWHA 3D09A 3QULB 2AQVA 4HNUA 2VZ3A 3D0AA 3WE1A 1DQTA 2XV3A 2NY6B 4YPGB 4F7CA 3EYOA 1TYJA 4B9FA 2F0CA 3BEVB 1R47A 3CVHH 5AOLA 3M88A 3QW4B 3V52H 2A6KB 3MODH 4JM4H 3I6KB 4FLHA 4GRWF 3ECBA 3RURA 2BP0B 4PJXF 5DA0B 3GC5A 3VXQB 5IFHH 1VS1A 2X6CA 3FB5A 4FQHB 1F56A 1E4WL 1LDPL 4JGNA 3W1ZA 1H5YA 1SO4A 1XLEA 2Q7YA 3DAQA 1J5TA 2DI8A 4JXCA 2I60L 3IETB 4AIXA 2NQ9A 4Y9CA 3WY4A 4JNMA 3SBWC 2UZPA 4WW2A 1RK0A 4LLUB 4PMNA 2HTMA 4BK4A 2VLRD 1V4YA 4LSSL 3NFUA 4EVZA 1HZLA 4L8SB 4ABQA 4WTWA 1VPQA 1L2UA 1UYQA 1E8ZA 4AU0A 3IFPA 1OC7A 3EXRA 1A64A 3K2KA 4C65A 3AGVA 3HBZA 3B8WA 7PCYA 1KB5A 3HMXA 1GOGA 3CLFL 4DN4H 3SQOH 1IT9H 5EH1A 1E5UI 2PPGA 3VWKB 1XFBA 4GMTH 1RIVH 2YA1A 1A9BA 3ARXA 1EJ8A 1L0PA 2GJXA 4GAYB 1GS6X 3ZRSA 1QOKA 3MN8A 1OPOA 5H2BA 3T09A 2VDKB 3DVGB 2YSSA 4Y4KC 3WNPA 5DHMC 2WKGA 1OY3B 1I7RB 1DJHA 1SGJA 1P6AB 4GXPA 1QW9A 3UEZA 3W85A 2WYSA 2V2WA 2WUBL 4BWLA 5D7JA 1E9OA 3RCNA 4NPYB 3DUGA 4S3BA 3WJXA 1N7KA 3TV3H 5IEHB 1ONXA 3G08B 1XF5B 2YD4A 5T3ZL 3MRBB 3POCA 1XYCA 3L0GA 1TRIA 5J3HD 3WJYA 3F12A 3IGAB 4PWEA 4C55A 1A5AA 3QEQD 1KCUH 1GOKA 4ZOEA 4PGCB 2VC9A 5TBOA 3R1GL 2DQUL 1QSFA 1IAKA 3BDYL 4OF7A 3CHDA 3CDZB 1JGDA 1DWGM 3G5XA 5EBMA 3HG1E 1V3MA 4WEBL 2QPSA 5SWZB 1WBZA 3EGDB 4O0QA 1MWOA 3QZPA 1I1WA 4P2RE 1E8WA 3BIKB 1VERA 2GITA 2JELL 3UYPA 3TU9A 1IVTA 1ESOA 3KPOB 1R5WA 2WBJA 1XLKA 5D4QA 1NAMA 2NXYD 5IQLA 3AT0A 4F66A 3W1QA 4A6YB 1QSEE 2E7LA 5IMMA 2WZHA 1JNHB 1VR6A 4UTJA 1KM4A 1FH9A 4JB9L 5CSZB 5ABHA 1ZA6A 1X7QA 2E6DA 3EH2A 4DF1A 4AZ7A 3GPSA 2V2XB 3O05A 2KYIA 3VWJB 1TIMA 3PAOA 5HJ3A 1PVHA 5T1DH 2V8MA 3ALFA 1UB6B 3S8FB 4TQTA 1M01A 5AC7A 5FSDC 3QI9A 2KQMA 3QPZA 2PXYC 4MXVE 2M26A 5A6TC 4YTSA 1YHPA 2HT3C 1WBJA 3MSDA 5LG6A 1GGCL 5EV7A 4PB9L 2NY1D 2L7EA 5DQDH 4YVPA 2UY3A 2PYFA 5I5MA 2W9DL 3UGEA 3EWYA 3P9MB 1I1YA 1MLBA 5M1TA 2LLGA 3LHPH 1L5GB 3VOCA 4D8ZA 4MAYA 3QDJE 3FJ4A 4PCPA 5CPNA 1JCYA 4YHGA 4ZOCA 3TH4T 1P1XA 1VB9A 4GUCA 3AXKA 4ANVA 1P5VA 4DQAA 3OAYK 3KBMA 4HCLA 5F44A 2W60B 3FTGA 3PHOA 4AC4A 1OFAA 5B1KA 1A9EA 5BNXD 1LL1A 4NS0A 3ZMEA 4H00A 4PZVA 3PPGA 3ICJA 4I90A 1C92A 4HS8H 3F4NA 3GC2A 3IJHA 4HKBB 1ZHBB 2NY5L 3TJHC 1CUOA 2B08A 4MJ6A 4N2FA 1BBJB 1ZRQA 3GTTA 3RVTD 3PUUA 3FUIA 5JHBA 3ZDZF 3UG3A 4FQXB 3ARUA 5AW7B 4OM1H 1J9SA 4MVBD 3RL2A 3DC8A 1NL0L 3O2WL 5C0BE 4RSYA 5LNWA 3W7KA 3I6EA 3FOLB 2OCCB 5LG1A 5BO1H 5GJPA 4AYBA 2WHKA 3IS0X 4WFHE 1MAML 5EOCL 5D03A 1ICPA 4W9ZA 1ASOA 4N2IA 5HYSG 2INZA 2J88A 3QUXB 5IVZA 3GMQA 2G50A 1DXFA 4ADUA 3MBED 4E8DA 2D3JA 1XLDA 2FIQA 3C2VA 2CKSA 1FA2A 3G1RA 1FVPA 1UH3A 4J3XA 3OAUL 3F04A 4HZ6A 4XBPB 4IG2A 4RXGA 3WL0A 1F3WA 3AREA 5IRPA 1JZDC 2DWXA 5MHSE 5HGHA 5HBBA 4S3JA 5AVZB 5AAPA 1G9MC 5GRZA 2OR9H 2ZWYA 1IQWL 3ZDXE 4XVEA 4F7PA 4KCTA 2VDOB 4I18A 1AGBB 5E5LA 1CLZH 4O2CA 4MPKA 3CNYA 3LEXB 2FO1A 5LQBL 4H20H 1UJPA 4Z3JA 1A47A 3GMRB 3PDOB 4MHHI 1E51A 1LP6A 4KNTA 3DFQA 4ES9A 4LSUH 5GZNA 5K33A 5BZXA 4HOZA 3UWUA 3NQGA 1GOOA 3US1A 2CO3A 1MUCA 3WNNA 4BDVA 1RUAH 4OU1A 1LMKA 4HIBA 4XUYA 2XN9B 2FQGA 1GPWA 4JJ5B 3DX8B 2RFXB 4LPVA 4M6OL 1W5NA 1XH0A 3OBAA 4B7IA 1KZYA 4FQQB 1D5IL 1S7QA 3W2DL 1OD7A 4Y4FC 4BXSV 1WG3A 4HNOA 2E9IA 1DBKH 2CDEA 1HZKA 4Z76B 2V4LA 1T03H 1YECL 3L4VA 1CX9A 2EYRB 4AV5A 4GUGA 2WPBA 4HG4J 1S3KL 4UFKA 3UBGA 3G9VA 3NIDB 4G1MB 4OFVA 5D1XC 3LKRA 1MEWA 4R85A 3IB4A 2APSA 4O19A 4XP4L 4WUUA 1M7XA 2QCDB 4KJQC 1I8UA 1ERNA 2YPKB 4YUEL 5ISZA 4YZWA 3AYTA 5L6UA 1KXHA 4ODHH 1PJWA 3EH4B 5D4YA 3TPUA 4JG1L 3QWRA 1TJGH 2VQ1A 1ZSDB 5LDUA 5LN8A 3E12A 4JRXE 5ENWB 3DU0A 5FEXA 1MCBA 2DJ4A 4FLRA 2VI0A 1YPFA 3QQ1A 3DROB 4LCIL 1UP3A 3VOFA 1HNYA 1SUHA 3AHYA 3KG5A 1SHXA 5DJXB 1Y65A 4L4LA 1YIXA 3G1HA 4RDVA 2YEZB 3VIIA 5J6GA 4DQOL 3OXRB 1I1XA 5KTEH 3NQDA 1HKKA 4NNYA 5FF7A 2UXTA 1C93A 1CLYH 4MNQD 3VFTB 3N1AA 3CXHK 2QFPA 2VWEE 3ZMRA 5HXMA 4JUSA 1R34A 3X1FA 1Q94A 1G7MB 3T05A 3EOLA 4PJCB 4QYAA 3PP3K 5FL1A 5FUZH 4KERA 1U3HC 2ZXWB 1OTUC 3AC0A 1FWRA 4OIBA 1NGQL 3JZYA 2DQIH 3DFSA 3RWJA 1NP2A 4JGUA 2I5QA 5DD5L 5E4EB 4DTGL 4HC1A 3V0EA 1V3JA 5C6MA 3QHFH 3TPKA 3ETBJ 4N28A 3GW0A 2CD0A 2GVGA 5I77A 3P0XA 2XISA 3R94A 2RA1A 4QRSB 3NJFA 3PNWA 4X7SH 2X05A 4BH7B 1HCZA 1UWXH 4P5TA 1F58H 1IZJA 2OTUB 2ARWA 2QCHA 2ACUA 4ZBCA 5D1ZC 3PBMA 3PUDA 1UD3A 5A6BD 3CYJA 1U8IB 2MH4A 4ERSH 1F4XH 1FG9C 2BP5M 1LEKA 3HPXA 4GACA 5A2LH 3LHZA 1VHCA 3HPJB 5D7IF 1H11A 5LNSA 1FL3A 2V0TA 4GQ0A 3TAOA 3UPWA 5DXYA 4LF1A 4Y90A 3WD0A 3RY4A 3R7QA 4MADA 2AQPA 1F3DJ 4UQ9A 4AQ8A 3MLYH 1U8PA 1OPGL 5IR1A 4PP1D 3D08A 3RWIA 4AC2A 1TQVA 3CO4A 1SBSH 3T07A 2NXZC 4Z3TA 1J2WA 4XNQA 4NN6B 4JFSA 3IDNA 3STCA 5K1VA 2O7QA 1KBJA 4AX3A 3QW3A 3BE1L 2W81C 1MFAH 4IPNB 3ARFC 4DI9A 4HETA 2OK0H 1NGPH 1K2DB 3FLUA 4A3RA 4GVHA 2MSPA 1RU9L 2EPNA 1TFPA 3BKYH 1LG2A 4RMRA 1E4KA 1HHKB 4N2BA 5FUCE 5DHXB 4R5EA 1G6RL 4PJEE 4AUJA 3JUGA 4R3UA 5DCDA 4P5KA 3QN3A 2BNQA 4QY8B 4TMPA 5DZVA 1PDYA 4PGDB 1E8YA 3HFTA 3DX4A 1INEL 3BP6A 4LCWD 1HCYA 5JHDE 1BZ9A 4EUPG 5AB1A 4P2OB 3DH7A 2KT6A 3EKCA 1UFUA 1TTPA 4ELMB 3D47A 3RFRA 1DJIA 4N1EA 4Q97A 3O6DA 3OG6B 5F7MC 3F7LA 4OD2A 4GYPC 1ZAGA 1GCFA 4HYVA 4HGWB 2QXWA 1NMCC 4BFBD 1RBAA 4F91B 2PD9A 4R96A 1BJ8A 1JYVA 5BXFA 3TFKC 1F2XK 3B2VL 4NENA 4QS5A 2F8OA 4UQIM 5AVXB 4UOQA 3I84A 5FF2A 4Y19D 2IALB 3HJ0A 2A74A 1BQCA 2P3EA 4P8QA 2KLTA 3BPOB 2X9WA 1TXKA 5J3HC 1YEGH 1GGUA 2EE9A 4PMOA 2WQUA 1DDTA 3EOBA 1THCA 3TROA 1CFSB 4GISA 4EACA 5CSBA 1E3FA 4AK2A 1KV5A 2VM8A 3U7VA 3G6JE 3W4RA 2FEDD 1IGIL 1Z6JT 4P2QD 5EIVA 2XV0A 2K9UA 5FO7B 3DK0A 2OTPA 1LG1A 3VQLA 3T42A 1BJ1J 3X13B 4GY1A 3UCRA 1D5ZB 4DP5X 3DJ9A 5TDPA 4MA7H 3KRSA 4FL4B 1WBYB 3BVWA 4UFHA 5TGBA 2WBGA 3T3MB 5KETA 2EPKX 3GH7A 3S3PA 3GAKA 4P2VA 4HWEL 4M6ML 1SMAA 5BOZG 4KIRA 4ZTEA 2XYBA 1UW9A 3BUYB 4BY3A 4WXYA 4XBEL 1EX5A 5FUCC 3M6YA 1HHJB 1CNVA 3F5WA 3FFDB 3REVB 4FYTA 3CN0A 4QRRD 2ZSWB 3QQNA 1D5BB 3QUYA 1G9ML 4GPNA 1R5YA 4CD8A 5HHVH 1XFPA 3IFNL 1IL1A 3CWNA 4UUJB 5DI8A 2X1SA 3TLLA 5E00A 4BI7A 4ZQTA 5FW6A 4K7PH 1C9SA 2IBZY 3E6HB 4PPTA 1D7FA 4W84A 3LIZA 3NVQA 4ML4A 5EU5B 1QBMH 3L3IB 4X4MA 5LAXB 4NI8A 1IGFL 4NJAL 3MANA 5FESA 1ZT1A 4JFOA 1DIOA 1E6JH 4M8VA 4XCFH 3B0XA 1A6UL 1BZOA 1H6FA 4N4QA 4GW4B 3K1DA 4GFXA 5HDOA 5CJXC 4GG6A 5C2BL 1I1FA 4IMKA 2J47A 2Z7YA 1NUDA 1KRBC 1RJCA 2H8PB 3GSOB 1I85A 2RCSH 3CSPA 4KEUA 3KCJA 4PD4K 1TZIB 1MJUL 2CM6A 1IBGL 1ZY9A 4MNJA 1SYTA 2ROXA 4P07A 4LV4A 4OVUA 5I0XA 4RA0C 2CHWA 4YNYA 1YNKL 1FKWA 3FU3A 4W6YB 3W7RA 5ESVA 4C56E 1HKLH 5KYNA 3ENLA 3DHJA 4AUUA 3QJZA 4GX8A 4HUXA 2R56H 3VINA 1F8TL 1VFSA 2VDIA 2GJ6E 2R4RL 2PF8A 1OVDA 5DJZB 4IRSD 3R12A 3DJSA 4OFCA 3G5YB 3PYCA 4ZUWB 2GK2A 4MMXA 1FP5A 4WHDA 3GHBH 1WO2A 4ZTPH 4LKXB 1XL9A 3RR1A 3ATDA 3QH3B 5EBGA 1KXVA 3B0PA 1SLUA 1XGUB 2UZXA 4ROPA 5EC1A 4R7DB 1O6VA 3MYZA 4I3SL 4U1KB 1P0NA 43C9B 1PDZA 5EEUA 1LEGB 1KT2B 2GKIA 7PAZA 1OQFA 5KN5A 2LV4A 2FQDA 1UB5A 3O6KH 5L6YH 4M7KH 3EYVB 4ODTL 3LN9A 2H8ZA 4PB3A 4F0MA 5DXXA 4Y1TA 5BQ7A 4GMSL 5BW6A 3CCHA 4YAQA 3WEXA 1XGDA 1Z69A 3DMMD 2Z4QA 3KYMB 1JZ7A 1AZRA 4KZEH 1MRCH 3C08H 3MA7A 3KTSA 3CL8A 4XMWA 1SBBA 1D9KA 3GSNB 1GZPB 3I3BA 1CCWB 3Q2LA 3UJRA 3VMPA 5I19L 1G4MA 3PF2A 2YD2A 1N2RB 3GEFA 1N0XH 1H7XA 3V7AG 2GY7B 2J5LC 2PPAA 1E3XA 4ZMYA 4GIEA 1Y07A 2Z91A 2NV9A 1FVCB 3FT0A 2R1WB 2G3JA 1RUQL 2NX5A 1IEHA 1SJEA 3SGGA 1N18A 4PN2A 2BVPB 4F8PA 3MLRL 4OLZL 1W2VA 3UBXI 1AG0A 1EV2E 4AMWA 3DXAA 1S9XA 4ZNEE 5HWMA 2VXNA 3QDME 1FXPA 4IM8A 3NJHA 3ENEA 3DIFB 2PSNA 1HIML 3SDCB 2ITFA 3EOYG 2XWDA 1FNEB 1OQXA 4TULH 3UC2A 3BLBA 1Q6CA 1HDMB 4NSKA 4UANA 2GBVA 3K71A 4X63A 2HPMA 2FSEB 2H9GA 4F9LA 1E5AA 1W6LA 2Q6ZA 2WWMD 3MLSL 1P5UA 3FQTA 2Y7MA 4X5RA 3HC3L 3L65A 1FRGL 1ZLUH 4TUUA 2WQRA 4P61A 2XWJB 2HV5A 1YPXA 3N42B 2J5WA 4UXDA 1UA7A 3GHRA 1KQYA 1X1NA 3FA3A 5EL1A 3V0UA 4YSCA 1ZVSB 2P8LA 3M7FB 4A35A 3QUZD 4HKXA 5L8KB 3H54A 3GFUA 3S1UA 4XVSH 4A1RA 3U1QA 5FB8B 2A79A 4PR5B 4FTVD 1CK0H 2X1OA 4NZ1A 4N8VA 4LS1A 4FI8A 4DBSA 3AS1A 1JQXA 1NCHA 2WXFA 3MCLH 1YNTF 2NY7L 3I6SA 3VO0A 2WW8A 1FHUA 5GJMA 2BO0A 2UY2A 3MNWA 2Z6IA 4WK2B 5CZTA 4GH1A 2ZXBA 3KPRD 3W39A 4OCYL 1MNSA 3BD5A 4QXIA 5DA4A 2J8HA 3IDJA 4Y2DD 4GIAA 2XA3A 3NVTA 1AK5A 3CX2A 2F08A 1GONA 1DVXA 3L9BA 2GAZA 3MV8B 1Z3GL 1EEZB 4HIJB 3ZO9A 1EP3A 5CEZH 4TTUA 2JVUA 4M7JL 4O02L 1CGVA 2KQNA 3HCVA 4J9JA 1IT7A 1BYBA 3UMTA 2F7IA 3NA8A 3LRKA 2AKRB 4W9DC 2ONEA 3GWJA 2IAMB 9PCYA 3TWAA 5ID0B 1PTGA 1I1AB 1MCSA 4XKMA 3MC0A 5C54A 2Z93B 1WFTA 3EJQA 1E1FA 4OLYL 4M8RA 1NQBA 1EB3A 5INDB 2DUZA 2P24A 4P3WA 2ZPKH 3BVVA 1QRNA 4PCSA 3E0LA 4FFZL 4NZUL 3RZCD 1WLHA 3AUVA 2H6PA 3TEWA 4B9PA 3T0DA 2PYEE 3SCMC 3D6NA 3Q13A 1T0PB 1GOFA 1RJLB 4JO1L 1NMBH 2ESVD 1IM3B 4HZAA 1RUKH 3AAMA 2DV6A 4MSWA 5DUML 3DSNA 2DQ6A 4JFEB 2ZA1A 3L0NA 2DJUA 1LRNA 5FWRA 1VYRA 3RX2A 1SXCA 2P76A 2XVNA 2XHYA 3T2NL 3BP7A 1OP4A 4XKYA 1YNPA 4YFEA 3L81A 4XX6A 4L3EB 4S1DD 2HK1A 3S6TA 4LB4A 4U3SA 1VFFA 4ORZC 1KEGH 4H1LH 2SEBB 4WEEA 2P5WA 1U9KA 3X1GA 1UZ8B 1GJIA 3TN0A 4AM0B 1ZS8A 2AMUA 1WT5C 2JLPA 3FO0L 2OKTA 1DIEA 2CBUA 1I45A 2WIIB 1FPTH 1XB3A 2JQAA 1THFD 5DUPH 1NCNA 1B2WL 4F8QA 1IBZA 1GTNA 4ECLA 5BZDA 1YEJL 3VD9A 3ZKXC 5AYBA 2HMID 3REQA 4F9JA 4DJFD 5HYEA 1EP2A 1MCEA 5A43C 2JJSA 4IGBD 5AOJA 1NDWA 3APYA 1IX2A 4NHVA 3RAOA 1SW7A 4YTRA 3H6AA 5HPOA 4PC8A 4P2QE 1UKSA 1URIA 2QPFA 4M8QB 3DFNA 4IP5A 3MRCA 1B88A 5FCUH 3VFMB 2FWOB 4G6AC 2CERA 2DS4A 1QPKA 1QLRA 1CICD 2HT2D 1D5RA 3NTCH 3LS4H 5D72L 4H41A 4D1IA 3BK0A 2DSKA 2AQTA 2ADIB 5TDOA 5T5FH 3NZUA 3VIKA 1NGWA 1M03A 1OEZW 1AH0A 1WAAA 2ZCHL 1G9NH 3ZJ6A 2YXWA 3MJ8A 2FIKA 4IHBA 1DE6A 3FCGA 5I1JL 2VHLA 2A6IB 4PJXE 3PFUA 4DWHA 4ZMGA 2APTA 5HGDB 5BMFL 2ED8A 4IHOB 4LF3B 4EAEA 5EZJA 1P7HL 1BXVA 3UJJH 5JOPE 2H1PH 3PULA 4W81A 3RNKA 4LIQE 4PMVA 4BF7A 1NSNL 2YCJA 1ZCOA 2TPSA 3B3BA 3LENA 3FHQA 3RVXC 3IFOA 5CN3A 4JREB 1N70A 2WBXA 3SPJA 1XC4A 5MEOA 3ZE0E 1J4EA 3HMCA 1JGEB 2WTRB 5DMGD 4EVNB 2EDKA 5ITFB 3A4AA 4IHCA 1ZK5A 2DBLL 3TCLA 1RY8A 3M6DA 3SQRA 1I8KA 1A6TA 2N1KA 1B2YA 1OADA 4PY8I 2A99A 3K72B 5EMUA 5F7DB 4M7LT 2YS4A 4KUZH 4X0VA 3VOIA 3RTQD 3NEXA 1U8CB 2WXRA 3GW3A 4O10A 2DIEA 4BJLA 3OKOA 2P49B 5DZOA 3WUBA 4IOSA 3V95A 2AJ3B 2XQBH 3U36B 3BAJA 3VNJA 2OPCA 1L8PA 3WFDL 1BD2E 3VTTA 5A3IC 3MROA 2BHZA 4N87A 1T0MA 1YMME 4MUPA 5JOFB 4EXBA 3ZHLA 4G70B 1HL2A 4K3JL 5IMKA 4JFZL 2H3DA 3N2MA 2X4RB 3FU7B 2ATPA 4DKAA 1KFWA 2VXUH 1LO5A 3L3DA 3A23A 4UMAA 4KH2A 4IBSA 1E55A 4B92A 2WVVA 4ORGA 1YKWA 1Q0XH 4OSUH 1IC4H 4BK5C 2FT7A 2PCPB 3B4YA 5E8PA 4LUSA 5LGJA 4MWFB 4DZ5A 5ADOH 1BXUA 1AO7B 3OHMB 1DQQA 2ZF8A 5LIUX 2BRRH 1FWEC 3E8UL 2ALAA 5KSWA 4QS6A 2QVNA 3ZTCC 2G0WA 3WL9B 1C5CH 2X1QA 5BUGA 4ZW6A 3TO4A 2A4EA 4P4KA 1Y0EA 5HVHB 3N2CA 5SX4H 3ZKQD 2BGSA 5I16A 4IMLA 3HW7A 1TQCB 2K1MA 4JKLA 4G6ML 2QGCA 4PRIA 1G7JB 1J0YA 3N2XA 3O15A 1RHHA 2F8QA 2YAFA 3R7MA 1V8HA 2POTA 3M41A 2ADJB 2VXSH 1WP6A 4ZMQA 4PMUA 3RUBL 1IEAA 5I6NA 1SVZA 32C2B 5I17A 3LKOA 5JHLL 2C79A 4U6HA 1WAPA 1E4WH 2GI7A 1T4KA 5CGBA 5IHUL 1GSKA 2PLMA 1BTMA 3MV9E 2BX7A 3O2DA 3NDZA 1VAHA 2FEEI 4L4VB 2ESCA 4KI5F 3VC5A 2W94A 1F3EA 3U9PL 2A9CA 4V11A 3O9NA 3LKQB 3LU2A 1SEBA 1MELA 5E9AA 4X9FA 3OSKA 4DLMA 2NY0C 4NF7A 1JCKA 3N91A 1CDUA 3F2LA 1CFBA 1R3WA 3U1PA 2UVFA 1FH2A 3OBKA 3EWXA 4DELA 1DBJH 3IE4A 4NJ9L 4JDVB 3HKZA 1R3LA 2G5BB 2YGVA 3PBWA 5EZOL 4MB1A 3PFMA 4GXWA 1T1WB 2PU0A 2V3FA 5D4HA 3CIQA 4H8PA 3B9KC 3SDAB 1GKOA 3D87B 1Z2KA 4X6DA 1TO5A 5CEWA 2CLRB 4KHTH 4MNGA 4GABA 4MVAA 5CZXD 1HZHL 1TJIL 3AWNA 5EZIH 2FO4A 1DLFH 2NWRA 1HS6A 1MVYA 2PDYA 1DZBA 3K5XA 1A80A 3QI9D 3ANYA 5LDSA 4DQWA 4YGVB 4OUOA 4FA3A 2DTSA 1F6AB 4ZO6A 4DGWC 5IJDC 5AYTA 1BW8A 1Z5LA 3FRUA 5D6CA 4IH3A 1TZZA 3ZDZE 5HINA 1SDDB 2EDYA 4RIRB 2CGRH 2ZZ6A 3JXAA 1WBHA 2YMXH 1WEJH 3C6SB 3Q8EA 2VM9A 5DT7A 1NWOA 1UXSB 5BJTA 3F00A 3IVTA 4MAYD 3NP4A 2I25N 2B7OA 4LLYB 4BV1A 1BQLH 1OF6A 2ZUNA 3O41B 4YEEA 2WHJA 2IJ0C 2HN7B 3D0VB 2YRBA 4CNUA 3U82B 4D8OA 1ETB1 2OGYA 5ENLA 1L9WA 2WQPA 4XSMA 2W27A 2GTWB 5CJ5A 4MMZB 3F85A 1GAFL 3RLUA 5E9NA 3LD8C 1XYBA 2G0KA 5HGBB 2HZHA 3U0WL 1CE1H 2IS7A 1ADQA 3OHXB 3OQRA 5C08A 1L6FA 4FXKC 4P8UA 4ODBD 5HHMD 4WSKA 3GM8A 3CG8A 1JPHA 5HI3D 3QYNA 2E74C 5B38A 3HZMA 5DJ2B 1ZPTA 5BUPA 1WKEA 5D2LB 4PJ9B 4I87A 5DRXB 4MS8C 4JS3A 1KWKA 5DK2A 2UWEF 3U48A 4V1YA 2OW7A 1QEWA 1UEYA 3AW5A 3IGUA 3HE7D 4MLJA 2G96A 2CGYA 4LGXA 4M3JA 1DQKA 4CNNA 1X6NA 1HQ4A 4WFEE 4MY8A 1RCXB 3VXUE 3AVEA 4XHQA 2IGFH 1OD8A 4P7LA 1Q38A 1AGDB 3TC9A 1B4JL 5J5DA 4ZB2A 1OT1A 4N8CL 4BSWB 3L6FB 4G9FE 3HRZA 2G2RB 2PU1A 4KH9A 4NSBA 3S88L 2AGTA 4O00A 4EBQH 3BRFA 3DHFA 1JPFA 3TBYA 3TTSA 1QW8A 5I79A 1FCQA 1DBBL 5JW5B 3LRSB 3IJYA 2ZSVB 4NY2A 1IJ9A 1A4LA 2P10A 5KBPA 4UFIA 2Q3RA 1OSPH 1OWQA 3NEHA 5HJDA 3E2HC 3PWNB 1OYBA 3G6AB 5EF0A 4Y9GA 3L3OA 3JV4A 3AZSA 3KPNA 1T5AA 1EJ6A 5JOEA 2VRJA 3MLZH 4MKSA 3WI9A 2QSQA 5CPLA 2FTAA 5CPOA 2EG7A 3OAZK 1HAWA 5KJ7E 2V9TA 1S5IH 4S2CA 3KLAB 4RMSA 3WAKA 4E2OA 1LTXA 5GZND 3R06B 1KFAL 1X98A 2C6QA 2PODA 4UOW0 1F6KA 3ZDYF 3QARA 4D6JA 4L18A 3OZLA 3RZCC 4ZDHB 1JMXA 3T1FA 1FO0B 1R3HA 5B80A 1ELSA 3ARSA 4JTKA 1FIGL 4NDMA 2YBGA 2QIWA 2ZXGA 5LA2A 4Q9BA 1J87A 3BZEA 4DOHE 1GYCA 5DHYB 5KBKA 1KLYA 2A7PA 1H3VA 4OKDA 3MJYA 3COTA 5H35A 5DEJA 4L4TB 3CQQA 2B2XL 2VYOA 4DYJA 3QAZC 1I7TB 1RCOB 1ASPA 3FQRA 3B2XA 2Q09A 1IZKA 3QNXA 1ZAIA 2HNHA 2J4WH 3DI2B 4PJ8A 3SKJL 5DO8A 1UVQB 4I5RA 3TGXA 1KLFA 2Y88A 2R39A 3SSJA 4PLKD 2ORBH 1J93A 5GS1A 4ZXBC 5C0AB 4ES4A 4N6EA 3RIFK 3OGCB 5ISZD 1JHLL 3AXLB 2HVBA 5F2GA 1HXJA 5EO0A 1DL7H 4U1GB 4CVZB 1Y0LA 3SKOA 5A6JA 4FKEA 2OS7A 3VYLA 2VLLA 4O14A 3RDTD 2QJMA 2V3EA 4O1BA 1WUFA 4AZCB 3G0SA 4WW1B 4ENZA 1EFZA 3AHXA 4WHTB 4UTBL 4DT2A 4F0HA 2YX0A 3H4GA 3LH8A 3GPEA 2E68A 2HMIC 3IXTA 4EZKA 4BKSC 2E9MA 3C2OA 1G7QB 4WWNA 4D9LL 1JPDX 4Z1DA 5JUEL 1M3UA 4IGBC 4X6CB 2Q10A 1FX6A 1JHKL 1TG8A 1A4JB 2P52A 4TNVF 2VFHA 3JVGA 1O4UA 3EB4A 3MGOB 5LIWX 4J3OH 3SBQA 1OG0A 3L1OL 1REQB 3UA3A 4UWQB 3KDPB 3VKBA 4Q6IB 4PJIE 3W2DH 2OX4A 3QUMB 3OVRA 3WLMA 2C1OA 1TQJA 3VTAA 2WXDM 5EMYA 1EQWA 4EDXA 3AOFA 2HT2C 2ZDSA 3QQ4B 5I1CH 1ULVA 4LZKA 1CLXA 5D4JA 1ZPUA 1S3KH 3SYOA 3THDA 5KTLA 5I8KH 3DUHA 1I1RA 3WLIA 4LIQL 4ABUA 3SKNA 4UMCA 5EPDA 4R7WA 5FIPA 2BM3A 3WS3A 1CGYA 3NSCA 4H2HA 4XP4H 3U0PA 3QJHA 1QFOA 2J9XA 3ES8A 4G7VL 1GSMA 2VP8A 5IMLB 4YUEH 4L9YA 2Z1WA 1RK7A 1BVOA 4XX1E 2VH5L 1KMGA 3FS2A 2VR2A 1ICSA 3QO1B 1JWUA 1ZBVA 4P5TD 5TIMA 4MLIA 5DRWA 3EHBB 2I9LB 4JMNA 4I9WD 1TZGL 2O6DA 4FEMA 3RE0A 1T2QL 4ZRGA 5E8DL 5D96B 4J35A 3CFCH 5IVXA 1NFDA 3QORA 4JHOA 4P2YA 4AQAA 2JB5L 4JD4A 2Z8RA 1IZCA 2YKLH 4JY5L 5F1NB 4NL1A 5GZOC 2XC8A 3PWPE 5AD0A 2VLJE 1HIZA 1WQ5A 2P1YA 3AAZB 3QIWA 4RMWA 2PDPA 4XC3L 3ESOA 4HMDA 1S9VA 5K2ZA 4HLZG 1EJOL 1AIZA 2VEPA 4UTWC 4Y1AA 1OWWA 2ZCGA 1KBGL 4NYYA 2E5BA 1VKXA 3H2OA 4N2GA 1FFOA 4C6OA 2FZ3B 2YJLA 3MXVL 3PHSA 3TV8A 5FS5A 4WTZG 1XZ0B 1NGQH 1HVQA 3PS6A 4FHKA 2HJLB 1CD8A 4PL2A 1FYTB 3WLNA 1J1XL 3MV7E 2ZT9C 2CZEA 4OFPA 3PWUA 3WFEL 1NGXA 1IWBA 4GJTB 3ZJ7A 4AV0A 4U6XB 1EZVX 3B2MA 4K9JA 2LTQC 3SDOA 2R23B 1PX4A 3Q65A 1U92B 5KAQF 5ES4B 5HDBB 4LANA 2BDNH 1MRDL 4C7FA 4NKCA 3C0QA 1QCWA 4J2PA 3BH9A 1C12A 1XTLA 4PMEA 4ZW5A 1QD0A 3E3HA 3F7QA 3L4CA