4PCSA

Crystal structure of a bacterial fucosidase with iminosugar (2s,3s,4r,5s)-3,4-dihydroxy-2-[2'-phenyl]ethynyl-5-methylpyrrolidine
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
439
structure length
439
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Exploiting the Hydrophobic Terrain in Fucosidases with Aryl-Substituted Pyrrolidine Iminosugars.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase
total genus 163
structure length 439
sequence length 439
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4pcsA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pcsA01
3EDKA 4K68A 3F4VA 3TTQA 2MANA 3D52A 4D6IA 4GKLA 3AIVA 3NUKA 1JZ5A 3RM9A 1FHDA 3KWXA 3TTOA 4AZ5A 4NRRA 2BY3A 5BXSA 3WF2A 3CTTA 4AZIA 5FCZA 2J62A 1K9FA 4FMVA 2CNCA 2UY2A 4PSPA 2BVDA 2WAGA 1OCQA 5FL1A 2G3MA 4BS0A 1G9HA 4AMCA 5IHRA 1W1PA 3TOPA 3RCNA 4WIWA 3EJRA 1FOBA 3WEOA 1QI2A 4XZBA 1ZBWA 3BAYA 2FGZA 3ARXA 3A23A 4MDPA 2CETA 2F2HA 4CD4A 1ZBKA 4EAMA 2WMKA 4NXSA 3RILA 4ZEPA 3KE0A 3WDJA 1KGXA 1J0ZA 3VMNA 3UG3A 3ZO9A 2XG9A 3RJYA 1CNVA 1H0IA 4AEFA 1XSJA 3POCA 2JF6A 3HU7A 4HOXA 4P7RA 3RPMA 3WQ4A 2XJ7A 2VO5A 2YL8A 1JZ2A 2F8QA 3BLPX 4Q7NA 3BCDA 3WH6A 1TG7A 5E1QA 2F61A 1CXLA 1UQYA 5ABHA 1CZ1A 5EMYA 2ZOXA 4QCFA 3SCNA 2CHOA 1EO7A 2D2OA 2PWDA 5I24A 3EDFA 3ALFA 1W9XA 1NWTA 1GVYA 1GONA 1JI2A 1GQJA 5I23A 2BXZA 2WC4A 3TA9A 1CXKA 1V02E 2AAAA 4HU8A 7A3HA 4AMWA 5D9MA 5I3DA 3KEHA 1NH6A 4A3YA 1UR2A 3CMGA 2CITA 2QPSA 1HJSA 4JZ5A 1OINA 4DWSC 1C7TA 5D9OA 2ZX7A 2CBUA 2J7EA 3T09A 1U2YA 1VRXA 2GDUA 2V3FA 2WBKA 4C7GA 1KCLA 1OSEA 1ITXA 4NZJA 4ZE4A 3F5LA 1K9DA 1Q6DA 2ZE0A 2UY5A 3PZOA 4MAZA 2FGLA 4WF7A 2BNJA 3PTMA 4ZENA 1VEOA 3VINA 1OGSA 4PCTA 3CHDA 2XHYA 4DUVA 2VZSA 5ABFA 1R46A 1J9YA 3MO4A 1W3LA 4Z2JA 7CGTA 1EIBA 1FFRA 4ATLA 1E43A 1V6VA 2D73A 4BCEA 1H1NA 1BYBA 4W5UA 4LYQA 5AY7A 3AS3A 4DM1A 2CCRA 3BH4A 3L4VA 1FH8A 4MB4A 3VIKA 4BZYA 3UG4A 3VX0A 2W62A 2XWDA 3WH8A 2OYKA 2GVYA 2O9RA 1K9TA 4L4PA 4UQ9A 4U3AA 2ZIDA 3GNPA 3LPOA 4X9YA 3CZSA 4PCSA 3AIWA 1U30A 4BQ5A 4AZBA 1EDQA 1CGTA 3PZIA 3K4AA 4NXKA 4CVUA 4ZXOA 2WM0A 2XPKA 1DHKA 4WJXA 3BLKA 2OYLA 1EDGA 5TD4A 3TTSA 2PBOA 4DUXA 2Y8VA 4CD5A 4D6JA 1XD0A 3W82A 2C0HA 4H8VA 4OOZA 2ZX5A 1OD8A 1OM0A 1GOWA 3ZMRA 1XHGA 3RMEA 2F18A 3WY2A 2J75A 1HKMA 1GPFA 2GJRA 3VSUA 4UFLA 4M29A 3WNOA 3NSMA 1V0NA 2J7HA 1E4MM 4WK9A 3ZJ8A 1H41A 3SUUA 2VZTA 3T2PA 1WNOA 4CKQA 4AD4A 3VGBA 2WVSA 3OLGA 1UWSA 4ATDA 1QI0A 1B30A 3MI6A 3THCA 4JAWA 3RO8A 1QWNA 1EOKA 3WQVA 5JUVA 2WW5A 2UY3A 3MV01 4M8UA 3GH7A 4GZEA 4PMYA 1OBAA 3KLLA 4P8UA 3WQWA 1AVAA 3AMCA 3WFZA 4TVUA 5GNYA 2D0FA 2CBJA 3WNMA 3SCUA 1V02A 2GK1A 5I5RA 3CHFA 1J0IA 4H7VA 1TUXA 2CYGA 6A3HA 2YOCA 1G01A 3K8LA 1TVNA 3D51A 3KZSA 1W9PA 1UD8A 3VGDA 2OWCA 3N17A 2ZWZA 1J0HA 3CHEA 4W5ZA 5EBAA 5IDIA 2EJ1A 3AHTA 4DUWA 3MUAA 1J0KA 2EPLX 3IJ7A 4P8VA 1E6QM 1KB3A 3APGA 4M56A 2E8ZA 2FE0A 1X1NA 3HMCA 3CZKA 1HNYA 3AIUA 2VRKA 1US3A 4GXPA 1UH4A 1ZU8A 2ZXQA 1F4AA 1VAHA 3VD3A 5IFPA 2QHAA 4N0RA 5AYIA 1JAKA 3I3EA 3VDAA 3VDCA 3CUFA 3WBEA 2OW6A 3A47A 2G41A 2GJPA 1LJYA 2XVLA 1TA3B 1U33A 4D6HA 1H2JA 2V5CA 2XFFA 2X2YA 2XN2A 4HOZA 1HJXA 1OT2A 5E9AA 4W84A 4IM4A 1G5AA 1F4HA 2D1ZA 3DC0A 3FHQA 1V6YA 4KMQA 1HJUA 2JIWA 3IANA 5A6LA 3G6MA 4ML4A 2X2JA 5A3HA 1W1TA 2ZX9A 4U5KA 1TA3A 3NSXA 2J74A 3EDEA 3EJPA 1OT1A 2GK1B 1H49A 4OIFA 3ALGA 3WL1A 1KGWA 1AQ0A 2BHYA 3GNRA 4W8AA 2WMIA 1HP4A 2V3GA 2YBTA 3ARQA 1HVQA 4JFTA 2J7DA 1JGIA 4CN4A 4UQEA 1ZL1A 4F9JA 1FH9A 2D24A 3WN6A 3NJ3A 1W1VA 3W28A 3O2LA 1KTCA 2BV9A 3ARTA 2VI0A 2GDVA 4UR9A 1C91A 3BGAA 1VFFA 2W61A 4WKFA 1ISYA 2X1IA 1E4IA 4ZXLA 3K1DA 4QLLA 1NM9A 3GNOA 4B3KA 2X0YA 3L4YA 4M24A 4TX8A 4MNKA 1E72M 1WDSA 3CMJA 3VD4A 1SMAA 4V2XA 3BSGA 4ACZB 1VF8A 2WK2A 1W9BM 4UQBA 2VZUA 3BMWA 3VNYA 3AXXA 3AROA 5BXPA 5LA1A 3AQUA 4P7QA 3OLEA 2XUCA 2WVTA 4MJ4A 4J3XA 1DWAM 2X2IA 1JFHA 3VILA 2BHUA 3DX2A 1ZB5A 1E1FA 1B3ZA 1J0YA 1CXFA 4DWSB 2VUYA 3CZJA 1BYAA 3IK2A 1BAGA 3IAQA 4HMCA 1MW1A 4AYSA 5HPCA 3M46A 4UTFA 5LYRA 5AC5A 1G0CA 4D71A 2BVTA 3HG5A 4NX0A 3BVTA 1BQCA 3LPFA 3EMZA 3WD0A 3KLKA 2E9MA 4M1RA 4B16A 4QLJA 1J11A 1JZ8A 4DWSA 1UASA 2OSWA 1E15A 4URIA 4R5EA 1UZ4A 1JFXA 2XGBA 3EYPA 3PZTA 3PTKA 1UA3A 2WMGA 3CZLA 4FLOA 1NP2A 1BG9A 3BLBA 4IISA 4XZWA 3SCQA 2ZXAA 2XM2A 1QHOA 1W2PA 2PBGA 2PWGA 5CLTA 3E1F1 4PUEA 4E4PA 4GO8A 2J7FA 4UFHA 1PS3A 3QHNA 1MXGA 4N42A 1AMYA 2EPOA 1W2VA 5CZKA 2DQXA 3ECQA 1XH1A 4TVCA 3NIYA 3GXDA 2WHJA 2YBUA 4Q22A 4NF7A 4F9DA 2YFOA 2EEXA 3L4UA 2VC9A 4C7DA 5LA2A 1WP6A 1E9LA 5CXPA 2CXGA 5CG0A 3CZNA 2EPMX 3W26A 1E73M 3AYRA 1VEMA 1E5NA 2A3EA 2JIEA 2BY2A 4W87A 1MFVA 2E8YA 3MU7A 4LPCA 3ARSA 2G4FA 4S3JA 3PZVA 4AC1X 3KL3A 3L2MA 3AMLA 1XGZA 4JCMA 5IXEA 3BUQA 3CH9A 4CCEA 1KR1A 3CZGA 2EADA 1E6NA 2IXVA 2EABA 1XCXA 3VVGA 2VX4A 3VO0A 2VTFA 3OIHA 1CEOA 1CIUA 3VPLA 4UOJA 2PF0A 1LL4A 3MUY1 3LXAA 1GQKA 1HKIA 3IGUA 4J3SA 3WDRA 3SUSA 5CPQA 1BLIA 1KQYA 4HU0A 1M7XA 3EJQA 4IPLA 3T2QA 4MB1A 1CWYA 2WXDM 4YHGA 1QX1A 3CHCA 4HA3A 1WE5A 4DO4A 1HL8A 1K9EA 2D3NA 3LX9A 1EOMA 5EFFA 2A3HA 3DX1A 1RD6A 1UG6A 3MMUA 4LXFA 1UKOA 1CGWA 3F5KA 4FNSA 1V08A 4AEEA 1GHSA 1R33A 3WQ5A 3S6TA 1HWWA 1V0LA 1JI1A 3H55A 3PZUA 3PBGA 4TTGA 4AYGA 4ZE5A 1TMQA 2WCGA 4BQ3A 1B1YA 2YDSA 1B31A 3N13A 3WUGA 1LLOA 1W9DM 3FY1A 3WUEA 3RM8A 3ZM8A 1NWUA 3VIOA 3U5UA 5C70A 4QAWA 2W5FA 1OGBA 4AZHA 2IGTA 1UKSA 1HTYA 1JAEA 4Z2HA 2E3ZA 3UR7A 4CCDA 1BG4A 1K6AA 4AD5A 1NOFA 1X6LA 1EXPA 5EFDA 3AHYA 1E6SM 5IHSA 4GI6A 1KR0A 4QLKA 3IAPA 2WLZA 2XYLA 3HG3A 3MS8A 1CTNA 2ESCA 1ESWA 4PTMA 3WENA 4B9ZA 3PZMA 5HDRA 4GQRA 4MJ2A 4JFWA 1JDAA 1MW2A 2FYVA 5A6MA 5DF0A 4P7NA 5HBFA 2Q8XA 2OWWA 5CLWA 5ECUA 1UKTA 3BCFA 5DT7A 5CSYA 1ZJBA 3OLIA 2E0PA 3I3DA 4D1IA 3EBVA 2WMJA 3ZT5A 3SCVA 3LPGA 4EANA 1L0PA 2YFNA 4U2ZA 3D50A 3HG2A 2UWFA 4J3VA 4UZUA 4FK9A 5JBEA 2DEPA 4Z2LA 3QOKA 3SCTA 2VVSA 1MYRA 2D3LA 1QNSA 4J28A 4MB5A 1DWHM 1CXHA 2D23A 1H0GA 2O92A 1V3IA 2VCBA 3II1A 5CJ5A 2E9BA 4WKHA 1T0OA 4AIOA 1GNXA 4CD8A 4YN5A 2YDRA 3LXBA 2OLHA 2BFGA 4IPNB 2ALWA 1WPCA 1C92A 1C7SA 2D0GA 2J7CA 1BPLB 1DTUA 1JD9A 2ZUTA 4JCLA 5A94A 4Z2IA 3OZPA 5D8WA 4W89A 4PEEA 4HA1A 4BQ4A 2XIBA 1KQZA 4J3WA 4D6EA 1QNQA 4PMXA 2QMKA 2EO7A 3A4AA 3CZEA 2TAAA 1R8LA 1E6XM 4JKMA 3D4YA 4FNQA 1R47A 3L4ZA 4UCFA 1KBBA 3ARVA 1KCKA 4UZSA 1LWJA 1C8XA 1UR1A 2J7GA 1ZJAA 2OSXA 1CENA 2WSKA 1BYDA 5C8BB 1QVBA 4Z2GA 3A3HA 3BAIA 1I75A 1MXDA 4AISA 2WCSA 4QDMA 3WMSA 1EGZA 5CPTA 3DYMA 2J79A 1ECEA 1QW9A 2C8NA 3VGHA 5A1AA 3DDFA 3KL0A 1XH2A 2V38A 1PAMA 5BWFA 1ZS2A 1UD3A 2PWHA 3ARYA 3PZGA 1E56A 2VX6A 5ABFB 3M07A 1VFMA 1XSIA 3W4RA 1GUVA 2WBGA 3CUIA 4OZOA 2VVNA 1GVIA 3OGRA 2WPGA 2EAEA 1E55A 1V0KA 3AZSA 5A6BA 3A4XA 1OB0A 4YHEA 1XYZA 1V03A 1E1EA 4QP0A 5E70A 1EO5A 3AJ7A 3OBAA 3GBDA 1DEDA 1E3ZA 2VJXA 1XSKA 1HJWA 3NYDA 1WCGA 1QWUA 1GHRA 2XN0A 1NOUA 1XC6A 3AISA 1HKKA 1V6XA 3VM5A 1BFNA 2QF8A 1VJSA 3W38A 4BF7A 1WZAA 1VBRA 3NSNA 2CPUA 2XVPA 1G1YA 2YL5A 2GSJA 1LL7A 4PMVA 2DIEA 4PRWA 2DDXA 5E0CA 5FD0A 4XUYA 1B3YA 1GW1A 3D4ZA 2FHCA 3U7VA 1EA9C 4A3HA 2XVGA 1DWIM 1IV8A 4Y7EA 2F7PA 3AZTA 4OKDA 1FP9A 3VUPA 4UFIA 2CKRA 1QOXA 1PIFA 4MNMA 2XFYA 3A22A 3EJSA 3S5YA 2JALA 4D1JA 4H41A 1R75A 2VR5A 1QNOA 2X0HA 2DSVA 2J4GA 1J0JA 3A24A 1HXJA 2PWEA 2DT3A 4TUFA 2EBNA 1KWKA 4MTVA 2B31A 4LX4A 5CQ1A 2AMGA 3VKKA 1AQHA 5I0DA 1HJVA 5I78A 1QBAA 3WDHA 1JDCA 1GQIA 2G8ZA 3UCQA 2OW7A 1V3JA 2WVVB 1XV8A 5IFTA 4WKAA 1DWJM 1VEPA 1E3XA 1Q6CA 1GZJA 1V6UA 2VQTA 1FHLA 3PZ9A 1VIWA 4C7FA 5I2UA 5A6JA 1TCMA 1PZ2A 3DHPA 1LG2A 2NT0A 3SIMA 1GJWA 2F7QA 3VIFA 1MW0A 3AHZA 3FN9A 1UKPA 1JIBA 4AIUA 4FNTA 3W6MA 1HX0A 2Y8KA 1W3HA 1C8QA 5BRQA 1O6IA 2WMIB 3U5YA 1RPKA 3WF1A 4X0VA 2GUYA 5E6ZA 2YA0A 4IUGA 1UKQA 3IJ9A 1W91A 4FF5A 3CV5A 5BYWA 2WWCA 2WMHA 4KGJA 1KFWA 4ACYA 1UZ1A 2UY4A 3M6DA 3HG4A 4FLRA 3WBAA 4PTXA 1UR0A 1BTCA 4D72A 5E09A 3A6OA 3WF4A 1OIMA 4UNIA 5M3WA 2FH8A 2O9PA 1Y7VA 4B3LA 1HT6A 3WUFA 3AHVA 4CU7A 5AYBA 4BA0A 3BAKA 2JEQA 1PX4A 1I1XA 1LF1A 2OYMA 4M82A 4TX6A 2WC3A 2YJQA 2PI6A 4NZCA 3AI0A 3I3BA 2W63A 1D3CA 5CPSA 4MDOA 3ZJ6A 1IZJA 3RIKA 2ZX6A 3VIGA 5EB8A 1W3KA 1GOIA 5JIPA 2WVVA 5F7UA 1KBKA 3VOCA 1EQPA 3FHAA 2NW0A 1V3KA 3A4WA 3BVXA 2VZVA 1BSIA 2NT1A 2DT2A 2YLLA 5JBFA 4NZFA 4TTUA 1TE1A 4U33A 4EE9A 3HJEA 4HP5A 3FAWA 3W29A 1RH9A 4DO5A 4OOUA 3UR8A 3FNDA 2DSWA 2EQDA 4D6CA 3ZR6A 3NDYA 1VJZA 3CUJA 4D6GA 3WDIA 3WH7A 3SUTA 3WUBA 2EACA 2VOTA 4NRSA 5A8PA 4HPGA 2YDQA 2DH3A 4RE4A 3WQ8A 2BXYA 1WAWA 3AFBA 2FHFA 3BAJA 2WVUA 3WMCA 1JZ4A 5KZ6A 1CLVA 2DSUA 1UR4A 2VRJA 3UESA 1ODZA 3KL5A 5A8MA 2PWFA 1R34A 3VIIA 1HN1A 4KWUA 1S46A 3LRKA 4CCCA 2VNCA 1BGAA 2YL9A 4RE2A 4U31A 1UR8A 4H8UA 4OJYA 4WSKA 2DSKA 3GXTA 3GZAA 4DM2A 4GIAA 1D7FA 3W27A 3SCRA 2QMJA 4RE3A 1L8NA 5I77A 3OGVA 2XM1A 4J3TA 1OD0A 3N12A 1ISVA 3WH5A 1R86A 4F66A 3PZQA 3W53A 1VBUA 4KRUA 1KGUA 4L4OA 2F1BA 1CXIA 4GO9A 1HJQA 1UD6A 2VX7A 1UHVA 2W4XA 2DGAA 2NSXA 3SEPA 1KXQA 1UA7A 4LQ1A 3ARWA 4FNRA 1SZNA 5A6SA 3VDBA 2VT0A 2VCCA 3MSDA 3SURA 1ZBVA 1HXKA 4EK7A 3BUBA 5A8NA 2ZUSA 3CZ8A 2RGMA 3VIPA 1PX3A 2HISA 5DT5A 1HIZA 2D0HA 1GQLA 2JF7A 1V3HA 4MNJA 3WD2A 1R7OA 3GYCA 1NWSA 5HOSA 1UWTA 2XSAA 1RP8A 2BY1A 1C93A 3ZJKA 3CIVA 3RDKA 1TQWA 3FW6A 1UD5A 3MV11 3VGFA 2VL4A 3WDQA 3SCOA 3WF3A 2CEQA 1GJUA 2J7BA 3H54A 2EPKX 3N18A 1HP5A 2D22A 3T0BA 1CPUA 3PHAA 1C90A 3LPPA 4EKJA 4XV0A 1CXEA 1CGVA 7TAAA 4J3UA 4CU8A 1M53A 3VNZA 1VENA 3THDA 2XVKA 1SFSA 2Y5EA 3VD9A 2GJXA 2V3EA 5A2BA 3VMPA 2DT1A 5D8ZA 1WZMA 5KEZA 2W92A 1UYQA 1QHPA 4W8BA 2QPUA 2Z1SA 3AIEA 4HOWA 3W6LA 3MUIA 1O7AA 5ABEA 2WZEA 5BXRA 2Y4SA 4HPHA 1UR9A 3AXHA 1IZKA 3OLDA 4F8XA 4HZ8A 1KXHA 3AICA 1EHAA 1CGUA 1JYXA 3ZQ9A 1QW8A 3DX0A 2E4TA 3B9DA 1PEZA 3AMDA 3OB8A 3BVUA 2J8FA 1N82A 4S3KA 3WEMA 3WNKA 1BGGA 3GH5A 3CBWA 3VIJA 5FOOA 3N11A 3GH4A 3VMOA 3BSHA 3W0KA 4AZCA 2WKGA 3A21A 3FAXA 4UFMA 1E70M 4PMOA 1J10A 4UQCA 1UOKA 1NOWA 1SMDA 1UQZA 2DSZA 1E4LA 3ZT6A 4OGZA 4TOQA 4CU6A 1G94A 3L4TA 1UUQA 3AXIA 2G3IA 4AZ6A 5FL0A 4JL2A 5E0FA 2Y2WA 5A2AA 4V27A 1UD2A 2BVYA 1JXJA 4AZ7A 2DH2A 1JD7A 4MNLA 1W1YA 4GQQA 3CO4A 3CPUA 4JIEA 3VM7A 3N15A 1JF6A 1SR0A 4AZGA 4TVDA 4OBRA 2J78A 3K4DA 2Y24A 1TZ7A 2WZHA 4PUDA 4NI3A 1ISXA 4LYPA 3D3AA 3AS2A 4PMNA 5ABGA 4ATWA 3L2LA 1B3WA 4GZJA 3SCPA 5AC4A 5BROA 4MPKA 4M80A 4F79A 2W91A 3VSVA 4BQ2A 2VRQA 4GPNA 5D9NA 4P8XA 3LRLA 1CBGA 2EXOA 4CN6A 2JEPA 4HMDA 2GJXB 4ZFMA 4KGLA 3WF0A 3W81A 2F7OA 4OBSA 3ZSSA 1H11A 2ZUNA 4OUEA 2BS9A 3VD7A 5DMYA 5M03A 2WHMA 3AYSA 2OSYA 1JYWA 4MB3A 1TVPA 1AQMA 3WEZA 4W8LA 1B0IA 5BXTA 3QR3A 4AW7A 1QBBA 4PTVA 4HZ6A 3GDBA 3AOFA 1WB0A 3LMYA 3ARZA 2YA1A 1NWRA 2CERA 4V28A 1NP0A 3WKZA 1BVNP 1MQQA 3B9EA 5D4YA 3S2CA 3VGGA 3DDGA 4JL1A 3GTNA 3K8MA 1YHTA 4HTYA 4JKLA 3WMBA 4W88A 3U57A 1ODUA 4PBGA 4E8DA 1M01A 1Q6FA 3O6AA 1JXKA 1W9VA 3HZ3A 4CUCA 4AZCB 4U2YA 5D9PA 2XWEA 4PTWA 3AMGA 3GBEA 5HXMA 3DYPA 3NCOA 3AIQA 3VX1A 4AWEA 2YL6A 2E40A 2CBVA 4B9YA 4KH2A 1M04A 1LL6A 1E5JA 3BAXA 1FFQA 2IXUA 4JFSA 4XB3A 1J18A 3AS1A 3O9NA 1FA2A 1WDPA 2YKKA 1KXVA 2ZUUA 3CGTA 3MMDA 3UERA 1XH0A 3A5VA 2BHZA 1GOQA 4UFJA 4AD2A 4AD0A 3WY4A 3VIMA 3W24A 1TFVA 3CUHA 1RP9A 1CLXA 2A3BA 1IT0A 1H09A 1E6ZA 2WZIA 1NQ6A 1JF5A 4P7LA 2FH6A 1GORA 5BRPA 1ITCA 3ZOAA 4AY1A 3BUIA 4PMQA 1QI4A 3PZNA 1PPIA 4J7RA 4E2OA 1E4NA 2A3CA 2YIHA 4GINA 1WZLA 5CSUA 4PN2A 4WSJA 3F5JA 4W86A 3B8SA 2Z1KA 4QFUA 3UETA 3JUGA 2F1AA 4HA4A 1MVYA 2DPEA 1JNDA 1QI3A 3K46A 3RM4A 1NARA 3WD1A 1WO2A 3DX3A 3RJXA 2J8GA 2ZUVA 2ZWYA 3GXNA 4MADA 4JFVA 2WLYA 3WIJA 5GPRA 3EDDA 3WY3A 4UQAA 1EH9A 2ZUWA 4HMEA 5FKYA 5A6BD 1E71M 4P7OA 6TAAA 4R27A 1X6NA 1V6WA 2YA2A 1MWOA 2J47A 3VIHA 3QOMA 1J01A 3WH9A 2CBIA 4JKKA 3BAWA 5E6YA 2ZXBA 2HVMA 3W37A 3ZSTA 5M5DA 1R7AA 2W67A 1W9UA 3SCSA 1E0XA 1YQ2A 2WB5A 3WD4A 4CN1A 1VFUA 4JHOA 3FXYA 1R85A 2A3AA 4P8WA 4LGXA 1JL8A 2D20A 4DWSD 4FNPA 1PX8A 5CGMA 1HL9A 2O9TA 1W3JA 2QV4A 3DYOA 4PMZA 4LYRA 3SUWA 3ZIZA 3SCWA 1WKYA 8CGTA 3WNLA 2VURA 1GOKA 3LXCA 2JFEX 3ARRA 5HNNA 1O7DC 3OGSA 1DP0A 2E9LA 1XCWA 3UG5A 1CDGA 2W66A 1I1WA 3WDPP 1H4PA 2VQUA 5GNZA 1UD4A 3OA5A 1JZ6A 1QPKA 4AXNA 3EJTA 5HPOA 4XX6A 2IUZA 2X8RA 1E0WA 8A3HA 1BVZA 1TR1A 4DO6A 2CIPA 5A8QA 3QHOA 1E40A 1ISWA 3OZOA 4QCEA 1KWGA 3T0AA 2WHLA 2VR4A 1WDQA 2X05A 5GQBA 4UQDA 1J12A 4W85A 4AD1A 3OG2A 1C8YA 4A4AA 1MQRA 1LWHA 2DT0A 2O9OA 1KTBA 3N1AA 4U5IA 3TP4A 2VX5A 3VGEA 1B90A 1BF2A 1Q6EA 4W7WA 5A6AA 1C3FA 4PSRA 3QGVA 2G3JA 2XVNA 1CYGA 5A95A 3BMVA 4CGTA 1JYVA 3VU2A 3ZT7A 3AIBA 4KRTA 3GXMA 1Z32X 1FP8A 4FLQA 5C71A 1TQVA 4AMXA 3TV8A 2VZOA 4UFKA 1PBGA 3L4WA 3AS0A 5DEZA 4WLCA 1M03A 3N04A 3GXPA 3WQ6A 4TXEA 4PYSA 1A47A 4B15A 2XIIA 3AHXA 1B3VA 1H3GA 3LRMA 4AD3A 5LA0A 5GNXA 1QI5A 3AMKA 3W25A 2C7FA 4NSBA 1SYTA 2DIJA 3BUPA 1ZBCA 1US2A 2WWDA 2X09A 2XN1A 1JYNA 3WNNA 4W7VA 1B2YA 4RL3A 9CGTA 1CGXA 1PZ3A 3B9AA 4PMUA 3BVVA 2GFTA 1QHZA 1GOMA 2YLAA 1UWRA 2VCAA 3GXIA 3VDHA 1R87A 1QNPA 2CKSA 3WD3A 3GXFA 2XSBA 1W32A 4GI8A 3BC9A 3GM8A 1EDTA 2QLYA 1Q6GA 4UOQA 1VB9A 2WSPA 5DO8A 4H2CA 5A69A 3K8KA 3ARPA 3TONA 5M17A 1UWUA 1PIGA 1JDDA 1TQUA 4D6FA 1GCYA 3NDZA 3MUZ1 2V3DA 1UWIA 3AZRA 3EDJA 3EJUA 3T0DA 1V3LA 4M81A 3UEQA 1EHNA 2CHNA 3WY1A 1JNEA 4ACZA 2BY0A 3CC1A 1JZ7A 4AIEA 1E0VA 1UH2A 1WZKA 2J25A 1KXTA 1B3XA 3U7BA 1CECA 1HVXA 2WYSA 5I79A 2CESA 3POHA 1JG9A 5A8OA 1ISZA 1V0MA 3PTQA 1B9ZA 3CLWA 1HF6A 2F7RA 1QNRA 1TQTA 2XFRA 3BXWA 3SUVA 2PB1A 1PJ9A 1DWGM 4JHZA 1MFUA 1XYFA 3M7SA 3DHUA 2WCAA 1OWQA 3MMWA 3WELA 2AOSA 5FIPA 1FH7A 4U3CA 1BHGA 5BCAA 2XGIA 6CGTA 2WMFA 1TQSA 3HN3A 3AIRA 3L4XA 3VD5A 4GI9A 1MQPA 1MW3A 2ZUMA 5I6SA 3VTRA 4PMDA 3H53A 4CD6A 1JZ3A 4E8CA 1EQCA 1OIFA 1V3MA 1UH3A 3ZR5A 3WNPA 1A3HA 2EPNA 4MAVA 4Z2KA 4UOZA 4D6DA 1XD1A 1XRVA 4JFUA 4FNUA 4J27A 1OGGA 3N9KA 3MKKA 2FHBA 1UWQA 2JE8A 1P6WA 2WNWA 2WKLA 1LG1A 4GZIA 1GOOA 1H5VA 3T2OA 3WFLA 2V5DA 3G6LA 5A6KA 3VSTA 3S5ZA 4YPJA 5JBDA 2J77A 3CUGA 3DECA 3IJ8A 3PN8A 1LQ0A 2XTKA 4HZ7A 4W93A 1Q4NX 3EMCA 3D5HA 3T08A 3EMQA 2ZXDA 4CVWA 2FDMA 3ZJ7A 2ZX8A 1D2KA 3MSGA 1DWFM 2ZICA 2RGLA 4CD7A 1WDRA 1E6RA 4W7UA 1E6PA 3BVWA 4H8HA 5CGTA 3WSUA 2OWXA 5JIWA 3DX4A 1VFOA 5DFAA 1CGYA 5A2CA 3QHMA 3BUDA 3WL0A 2VMFA 4H04A 1HKJA 4PMRA 2PC8A 3TTYA 2WC7A 3MANA 4X0NA 1BYCA 3J7HA 2G3NA 2WANA 3ARUA 2WHKA 2X2HA 4FLSA
chains in the Genus database with same CATH superfamily
3UL4A 2IXQA 2VXVL 3EX1A 1G7VA 5HAOA 4K68A 4CQ9A 5BNXD 1E5BA 2XWCA 1AG6A 3VFGH 3F4VA 3FSVA 2VLRA 5F9OL 1GOXA 2YR3A 4L4TB 4M43L 5AAPA 3AIVA 3ZMNA 4KHXH 1D9EA 4G5ZL 3RM9A 4MAUH 3IETA 3I84A 4TUJB 4QR6A 3ET9F 1K3UA 3RGVD 4KZEH 3WF2A 4J4PC 4K6AA 4IL0A 1VACA 4WDUA 1NAML 6REQB 4ZBJA 4FFYL 4WNQB 3EH2A 3QN3A 5DUBA 4J1OA 4L1GA 2UY2A 4HK3J 3CH1B 3LGGA 1SJCA 2HPOA 1BFOB 4NC2B 3PP4H 4JFED 3QDGE 5ACMA 3W0WA 4H9VA 3CHRA 2VR3A 2G3MA 4G7EB 1A7PL 1G9HA 4R90L 3AXLA 2K8QA 4JDVB 3OPSA 5CPNA 4Z7WA 4FZEL 2WWMD 1HILA 1MFDH 1ASOA 2WGNB 4HLZH 4X7FC 4QAIA 3F84A 1YDPB 3CHXA 1CDYA 1FQ0A 3RCNA 1IXPA 5F9JB 4ASTA 4M1CD 2BSSA 2ZDRA 3NL3A 5FA4B 5IF0B 5EMLA 3ZLHA 4F2TA 1SFJA 4HSOA 2H0JA 2NZIA 1IGMH 3GSUB 1ZBWA 1OK4A 3FK4A 3A23A 1R24B 4BWWA 4D7BA 1XGTB 2GFBA 2AW2A 3U0WH 5GZOC 1KO0A 1R3TA 2XTJC 3CFKA 4AQEA 1FHUA 1LDSA 2VEFA 1U5HA 1KFKA 1BXXA 2WXPA 4IIHA 3HC3H 4JB9H 1GKEA 4M48L 3UYPA 3CPGA 1HO1A 2CDFA 1ZHLA 3MODH 1PSKH 4EBQH 1XSJA 5DVNA 1X8FA 4MD4A 5FA3B 1IC0A 2JF6A 3O6LL 4HOXA 4AYFB 3NOEA 4P7RA 1BQSA 1WDAA 4AJYV 5DD0L 2BODX 1HHIB 1T6BX 3R0MA 2XJ7A 3P67A 4FD0A 4KPLA 4I77H 1JZ2A 5TQ2L 3ULUH 3BLPX 2NXZD 5DZAA 3S37X 1D3HA 5BVJA 3P11H 3VW3H 3VUSA 4I1NB 1WQVT 3WH6A 1TG7A 1ODAA 3GK8H 1CXLA 5IMLA 3SCNA 4XXDA 3DTXA 2OKOA 2CHOA 1VH7A 1EAJA 4YDIH 2AKRB 5MEPB 3L3DB 1E6JH 1XLLA 3WBXA 4HUKB 4ZX5A 1KJ3H 4Q52A 5C9JA 3GYEA 3N06B 3QNFA 4GB9A 4ODTL 3VVVA 4S3BA 4Y5XB 5FEZA 1G6VK 2EDLA 1BSLA 5ISZD 4NQVA 3MBWA 1O5KA 3B0YA 5D6DA 1I2PA 3ATYA 3MNVA 4FI6A 2JGQA 2C9UA 4N2CA 4NQ1A 1V02E 4UANA 2FEDC 1CR9H 4LARH 3O15A 3LK6A 2ZKHL 4I7ZC 4H20H 4J3ZA 1F18A 3IMRA 3LJ3A 5DXWA 5CEZL 1FCBA 4NUPA 3MCKA 2IEPA 3KPPB 2ZP0T 4NZ8A 5EO1A 3MRIA 2CITA 2W65A 4QXGH 1GGBL 5EU6D 5KSBE 1E2ZA 2O6FA 4BV1A 1OINA 2R1XB 2I85A 2H3BA 2EXTA 4HJ1A 4NJIA 4KI1A 3UXDA 4P4KC 4DWSC 4UTTA 3KWWA 5FYKH 4YXHH 4PTDA 5K3VA 2CBUA 3Q13A 4FRWA 2JQAA 3U2SA 1AQDA 4JDTL 4QRTB 3S3DB 3F7QA 3AB0B 1OANA 5AVYB 4OZGA 1I7RA 2Q71A 4IPIA 5CKSA 3ARDD 1N0XL 1QPPA 1NCNA 1U2YA 4W9DC 2GDUA 5HGAA 3W85A 4G6KH 3QIBC 2WBKA 1U41A 1HH9B 1KTDA 2PYFB 4KFZC 2KLSA 4OKVB 4Z7NB 5IFHH 2L5HA 5I73C 2VXTL 2XWTB 4YTSA 1EGJH 4P5KA 4F7PA 2DW7A 3FTXA 1F8MA 4WD0A 3APCA 2IMMA 3S96A 2EKGA 3AYTA 3SDOA 4Q2ZB 1DSFL 5BS0D 1OM9A 2P46B 5DJ2A 4GAYB 4FOUA 1DDHA 1NPUA 3GSRA 2JCCF 4KY1L 1WC7B 4N2MA 4YWGH 4CBZA 2FMNA 3LBOA 2FGLA 4WF7A 4IIFA 3VI3F 5BJTB 1TJRA 4GXUM 3K2GA 1DR9A 4S1DC 4L29A 4X9GA 1M2VB 5LDUA 5JW4M 1VEOA 2GYIA 2DEWX 1OGSA 3IRPX 1J8RA 4PW9A 4A7UA 3UJJL 1U4FA 2MOQA 3VU1A 3B2UD 3CHDA 3GX9A 5CSZB 4U7MA 3L3HB 4H0HB 3GZOA 1IGFH 3L3KB 4ZT1A 4E3TA 4XO9A 4IFKB 4P5KB 4F7PB 1OD9A 1J9YA 4HGWB 1FBIL 3T7VA 4Z2JA 3HG0A 2H1LM 4OZHF 1XF2B 2UXGA 1V6VA 4FS0A 2ZRUA 4RDQG 5IVZB 2OTDA 4AVFA 4MJIA 5F2FA 4GYBA 5F88A 4BCEA 1G1KA 5HDQH 4M5YH 3VXNB 4KJPD 4QGCA 4I0CC 5AZ2H 4QRUB 5HI3C 1AD9A 2APTA 2XG5A 4LSUH 3CPLA 4U6VL 3NFPB 5AY7A 2AABL 3GFYA 2UZXA 4YK4C 2IV8A 3U2JA 3DENA 1ZGLM 5L6YH 5HGDA 2TSYA 2VDOL 2GCYA 1CLOH 3EAKA 4XZUA 5DQ9B 2V5TA 4C56D 1EIXA 4TL4A 4LPVA 5FECB 35C8H 3VIKA 2GI0A 2J56A 2XI9A 1M9WA 5CZXD 5G5DA 3VXUD 5I5MA 1DJYA 2VIRB 3O9WA 5CNHA 4QTHA 1RZKL 3T8LA 1COBA 2XWDA 1YYLL 5SWZE 4YNYA 5EIIG 5C0CA 1JCTA 3RIAF 1FNSL 4YHLL 1XDJA 4C83A 4DESA 2X7WA 2ZYFA 2IPTL 3TYFA 1J2BA 4UQ9A 2CIKA 1LP6A 3LU2A 2Z24A 3LPOA 4X9YA 3CL6A 4PJHF 5B1KA 4CQCA 1DANU 3GDLA 1A65A 1R0AL 4BF5A 2EDHA 1TKWA 3C9NB 1AOZA 4AZBA 7FABH 4JN7A 4KKCD 5H2BA 1AMKA 3PZIA 3LHWA 4R2GD 1LLWA 4PD4J 4FEIA 3MRCB 4HIXH 1A3ZA 3OU8A 4ZXOA 4IRJC 3QB7C 1EWEA 1XLAA 2BH0A 3GHEL 3P9LA 1UA6H 1RUML 1L9MA 3HS0A 4WI9A 5C2UB 3FJNA 4WJXA 4TS6A 5CBBA 1EDGA 1YNTA 3ZDXE 5GZNC 4H83A 1I0DA 2V9TA 1M7JA 1PJWA 3LV3B 2J8UA 1XQKA 1P1VA 4Y16C 4JDVA 3SQRA 4F15B 4MNQD 4CD5A 3NJNA 4HHAA 1XF5A 3BLIA 3MRGA 1XD0A 3FA4A 1VHCA 4LY8A 4JUTA 4POUB 3LS5H 4D9PA 3D7PA 2CWRA 1J79A 5DY3A 4H8VA 2FQIA 4HYVA 2B3IA 5F8QC 1EAOA 1OVDA 3OBKA 5HHME 2XYCA 3HZMB 1KXVC 2WD0A 1GOWA 4U1HB 3RMEA 2W0KA 2Y06L 3QULB 2J75A 3ERXA 5AQ0A 1F00I 4NCDA 5LG1A 4A2SA 4M1DL 5A3ID 4ERIA 2EH8H 2R0ZL 3VH8G 4W9ZA 4JQ2A 5AL0A 2IPUG 2BVOB 3JWNE 4KCWA 4RW3A 1RJZB 1BOYA 3TT3L 4JFXB 1SPQA 2IDTA 1FNGB 1DQUA 4DGYL 2DQEH 3QUGA 1ONQB 1Z6JT 2HE5A 5C0BB 1XI3A 5HI5C 1VPYA 1OAUL 3U1QA 5C9ZA 1E4MM 2ZYSA 3IXAB 1UXMA 3U0HA 1AHMA 1H41A 3D39B 2VJ0A 3QFDB 3MV8B 2VHLA 2Y1AA 4QHUA 4X7CC 5C6WH 1NDWA 3ROLA 1SJDA 3H2QA 2CZ5A 5HVHC 4IJ3B 1OP5H 2PC4A 4ZMVA 3ELFA 3DJTA 1ONRA 1E4JA 5FO2A 3NQBA 1XDLA 3NZQA 5LNSA 4WNQA 3E6FB 3O4LE 5E9DD 3OLGA 4ZPVA 2J6EH 3TBCA 3O9WD 1B30A 3MI6A 2Q5BA 3QJQB 4TKWA 5L9DL 1FA4A 4JAWA 5EIVA 5FSDC 8TIMA 1QWNA 2J9ZA 1W17A 3M8OH 4JN2A 2D31A 2WW5A 2ILLA 3W57A 4LT7A 2DQDL 3D09A 2UY3A 4H1LB 4W6WB 5REQB 1C8PA 4M8UA 3CC5B 4ISVA 1NSJA 4PJ8D 4GZEA 4XCNA 5IMOB 5DK0B 1ZLPA 4P8UA 4P59H 4ZFZB 3PK7A 2DB8A 3JWNG 1FSKB 3AMCA 2PA6A 5C0BD 3ABSA 1A6ZA 5DJYA 1OF8A 2D0FA 4NN5B 4K2SA 3QIBB 4LOEA 3WJLA 2CKBL 4HIEB 4PRRA 3SCUA 4OLXL 4P57B 2G0LA 2P43B 3DVNB 3CLFH 4KXBA 1GXEA 2N01B 1J0IA 5ID1B 4BQ2A 4ZFGL 1TUXA 5LVEA 2XCMC 3O06A 2OP4H 3T65A 2OL3B 4CNUA 1TVNA 1VKXB 1AGCA 5B21A 1W9PA 1KFLA 3MBXH 1E30A 3QRHA 4HUUA 4QYOA 2OWCA 2HRGA 3EH4B 4DWHA 4HV8B 1TTPA 3LDBB 3B4YA 5DRZB 4DP5X 3UGRA 5LXGL 4K7FA 1X5FA 3CDGB 5J06A 3DXAD 3K6SA 1D5XB 3W9EB 3H3KA 3L08A 2HXTA 1NBYA 1A7PH 3IJ7A 3EX3A 2DQHH 4P8VA 1GC1C 3OPUA 3IRCA 4JO3L 4A68A 2F19L 2NLJA 3SQOH 3R7QA 1M7IB 3FNKA 3IJYA 4PJGB 1D5IH 3DGRA 4C4KO 2VLJB 2J21A 4Z7WF 1LJMA 2E8ZA 1X1NA 1FFOB 1QZNA 3TYAA 1X4XA 3DV6B 4E9TA 1NANI 3QJFA 5FCUL 3LQLA 2B9BA 4JRWA 5DD3H 1QLEH 3AIUA 4UUIA 3T78A 3WYZA 4IKKA 2QSCL 4QXWA 4C6KA 3BG5A 1UH4A 2Q20A 3KYAA 2VXSH 3WJJC 1KLZA 3GD6A 1TZIB 4HJTA 3SE4C 3BGGA 3ETSA 2NY5L 1TXKA 5MKGB 4DNHA 1HZYA 1KTJA 3V0VA 4TIMA 3SR7A 1IVTA 2NY5C 4C65A 3VDCA 2D03H 2J44A 1U36A 3MRHA 1A49A 5FC9A 4OJFH 1OYCA 2G41A 2GJPA 1AHWA 3KDMB 5EDXA 3M88A 2XVLA 3N14A 4I9WD 5I18L 1SR9A 4OFCA 5A2JH 4UWQB 4KJQC 3PIQA 5F3BB 5I17A 1WZ1H 3T4YA 1I3GH 3UTSB 4ZXBB 2P80D 2X2YA 3GVRA 5I74B 4MGGA 4RNHA 3TBSA 5CGQA 3P0YL 4W84A 5AHFA 2PYFA 2R0WH 1JNNL 2ZOKA 1HFUA 4FHKA 1DFBH 4IM4A 1F4HA 3TA6A 1MY7A 3FHQA 1ADOA 3EOAB 1SY6H 4U05A 1V6YA 3ULUD 3BZFB 3JV6A 4BFAA 4KMQA 2OJEB 4GKNA 1V55B 4PRID 2CGZA 1KEGL 4F7MB 5A3HA 4WK2B 3WFCL 4NZRH 1TJ1A 1ND0B 2EPHA 2DD8L 3FFCE 4X6CB 4KJYB 2ARWA 2DUXA 3EDEA 3LPWA 1TV2A 3EJPA 1S8DB 3ARBD 4AVOA 2W5PA 3O41B 4K3HA 4MA3B 1W0MA 3MZTA 4O2EA 4EMZA 4H8WH 1VCAA 3GNRA 4XISA 4L4VA 3VACA 2WMIA 3MLUH 3ENEA 4JJHA 3U0WL 1DIDA 1CN4A 4WI3A 3ARQA 1UC5A 4HHAB 5C2BL 2YPVH 4PV9A 4X4ZA 2DN7A 3LBCA 4R2GC 4P5MB 4WUIA 4JFTA 3GFXA 3RVXC 4UM8B 1PBYA 3DX6A 1U8QB 4D0DB 4WV1A 4HVBA 5C6TH 1FZMB 4JX4A 2VM9A 5FW7A 3V4VL 1X7FA 1ZL1A 2QCLA 2QVHA 3NURA 4YSPA 3WBWA 2EILB 2J1KA 3ZRCC 3V4PA 4HK0A 2D24A 1BQLH 1G7LB 2WYIA 3D3VB 4LSQH 3O41A 4AXWB 3O2LA 4MM1A 3O3DB 4A6YA 5ES4B 3G1HA 1AC0A 1XBXA 4OZGF 4YFLF 1N8ZB 1Z6KA 2WJ7A 3MJ9H 2BV9A 1RLWA 3RUGB 3CX5J 3I6LE 1C91A 2I27N 2VKWA 2A7BA 1UROA 4LASL 1NLBH 4DP8X 4LL9A 2O4QA 4JPVH 5AALA 4ZXLA 3KRZA 1BD2E 5KSUB 3ETBJ 1QKZL 2UV8G 2KS0A 1Q6RA 1R3HB 2QS8A 4NWUL 2XWBB 1Z44A 4FS9A 2JELL 1M9SA 1G9MC 2YWZA 3PS6A 1KJ3L 3WG6A 4BUQA 1G6RB 3RI5K 3DURA 2J8TA 3P4NA 1WDSA 3VD4A 4IMGA 1KTRL 3HNSH 1KRAC 3L67A 1O5PA 1JCKA 1SMAA 5BO1H 3VI3A 5IEKB 3W39A 1Y5VA 5IQLA 2JGYA 2Y1HA 1X5KA 5DLCA 1RA5A 3HN8A 5HHVL 2QZQA 1MHHB 4MZYA 1XXDC 5FPIA 4N2DA 4NO0D 3VNIA 3PUEA 3LKOA 4ZSOA 3VNYA 3AXXA 3AROA 1RU9H 4OZIE 4GS7B 4I0PC 1E4KA 1NCBL 1MCJA 1ZAIA 4GFIA 5AC6A 3C2FA 5C92A 4GNVA 5CPOA 1RZJL 3RZCD 4YTQA 4B95C 2BP1A 2PGWA 4C6JA 2JH2A 4EBQL 1FV1B 1JNNH 4FAMA 3KBJA 5IEHA 4L9DA 3TSMA 1DWAM 2X2IA 4L1XA 3HLAB 4FQ1L 3SADA 3R43A 3VILA 5KG9A 4MQXC 5K59F 3BEVB 3EYQC 3T2NL 5EY5A 4FNLL 4JNXA 1IGTA 3ZHKA 1J0YA 2H2SC 4Q9QH 1B3ZA 3L8QA 2BVEA 4L29B 2F9RA 3UQNA 2E5EA 3U79A 1K5WA 4S3AA 3CZUB 3IK2A 3EKLA 1BAGA 2JIXB 3IAQA 1UATA 3AUWB 3BKJL 4AUJA 1LD9B 2XPYA 3NJHA 3M46A 1HU8A 2R69A 4CL7A 1OG6A 4E0RB 5AC5A 4H8QA 3BQUC 3N1MC 3RTQA 1NEPA 4D71A 2P48B 5HHPB 1R19A 3BVTA 4W4NA 3IFLL 4PJDB 1BQCA 4R7LA 4ODUA 5E2TL 3W11C 2OR9L 2DEYX 5L4IA 2JIEA 4HYRA 3FDWA 5B1JC 3P0VH 1BIHA 2Y23A 3BDBA 3AUOA 5CAHA 1U8IA 4FI8A 1BD2A 3VQ1C 4FQQB 4LEQA 1BP3B 3CK0L 2Q09A 4XMZA 3NZ8A 4GVIA 3O6FD 2F1EA 4FTVD 2OSWA 1E15A 1EXUA 2NX5D 2V5LA 5F0MB 3LA4A 4R5EA 3QIWA 4L1SA 5AW5B 4ERSL 1P1MA 1W8OA 2VDPL 3N3EA 2LQRA 4P4RB 2K9UA 1FWIC 2ZYIA 2E9GA 1UA3A 5IUSA 1RAKA 1WKFA 4HXBH 4M7TA 4WRHA 3D4GA 4S1SL 2RIKA 5DFTA 3UO1H 1AXTH 3B2VH 4FLOA 4K1WA 4HS3A 5T3XE 3V5DA 1R5YA 2YB4A 1ZK5A 1XW8A 4G5DA 3ZHDA 1FWDC 4YNGA 3B34A 2ZXAA 4O1EA 1WD8A 4YDNA 1KKRA 4HKPA 1QHOA 4OFYA 4OQTA 4WGWB 3F4WA 3V7MA 4PJCE 4P5MA 2PBGA 4PUEA 4MJ6B 1LO2H 2H0FA 2JKEA 1DSYA 2J7FA 2WTRA 4UFHA 5IVXE 4OZFH 3GSNB 4X4YA 2A7PA 2EPOA 1D7KA 2V0AA 5IJVB 1M1BA 3BKYH 2PP3A 1F42A 2PRLA 3ECQA 3ATFA 4YIQA 5AYXA 4KRPC 1R0AH 1SHXA 3L5WA 4KS0A 2QW5A 4FTVA 4Q22A 1QPQA 4F9DA 1KRCC 2YFOA 2ETWA 5ABZA 2WP3O 4K23L 4KROB 2Q87A 2MPAL 4ROQA 2IQAB 3L4UA 1OX4A 2FZ9A 1LO4L 1O7VA 3QFJA 1E9IA 5HDBF 5LA2A 3OQEA 1PY4A 3LSCA 4FX7A 4NX5A 3SQSA 2F08A 4W9KC 5CXPA 5F88B 1KELH 3UAEA 3MCKB 1TTQA 2FD6H 1QSFA 5HHOB 1AQ8A 2XKUA 3CFTA 4NFCA 4Z76A 4K5NA 4GUJA 3MSRA 1K8CA 5C0IA 2IQ9L 3AYRA 1U8JB 3GZQA 4DZ8A 4LUSA 3PDOB 2AABH 4MFEA 2I1OA 3CIXA 4QIUA 3UZJA 2BY2A 4NKIH 1MJUL 3ZGIA 2FR4B 2PTZA 3E02A 4KW2A 3QFWA 2QTVA 1LUCB 2FNWA 3QS3A 5K39B 1X97A 3L5XH 3QNZB 4FXKC 2VELA 5DRXA 1A1MB 1JCXA 4G7VH 5HJDA 2G4FA 4MCMA 1XZWA 4LBRA 4XBJA 3WD5H 4LT9A 5C2CA 2CDEA 3ZUNC 3IFLH 4S3JA 3EHBC 4ZTYA 4AC1X 4XE0A 5CP7B 3A9BA 1CS6A 3IBOA 4OUUA 1VADB 3NAAH 5I0ZA 3VG0H 1YDPA 3LZNA 3L3JA 2CR3A 4GG9A 1OF0A 1J7VR 2CCVA 4K37A 3CH9A 4M5ZH 1ZVHA 3K5SA 1TZ9A 1ERNA 2OJZH 2PPAA 4J6RL 3P2DA 1KR1A 2EADA 5AB9A 3BW3A 4O4WA 4PA8A 2XN9D 3TTEA 2QTEA 1LK3L 1RJPA 1XCXA 1QEXA 3FT1A 1HAWA 4U1JA 3LNHA 4YL4A 3N34A 4A39A 3VVGA 4KTDH 3WFEL 2VB5A 1J1XL 3AWEA 4Q4EA 4C6DA 1CEOA 4Z18A 5EC1B 3VPLA 2OCFD 3F6JA 3UJRA 4IF2A 1E5ZA 4XNZB 3GUTB 1PF3A 2NQDA 3CIAA 3RJDA 3LRHA 3MJ7A 2YXXA 3QEZA 1ETB1 1NIEA 2ATPA 1KIUB 2H6UA 5BUGA 2WAQA 5AYUL 1A5OC 4WI0B 1B6UA 2OTUB 5T3XH 4LUTB 3SUSA 4DAIA 4K3ZA 3O8XD 1A0CA 4N8VB 1M7XA 1KYOJ 1Q72L 1ZVSA 2Y07L 4ODSL 1N6QH 4FX6M 2ZCLH 3ZE1B 4A3RA 2XG4B 3BIKA 3ELQA 1IRAY 1CZ8L 4MB1A 2YOAA 5I1HL 2NR6A 2CGRL 1GS6X 2JVUA 4DJEC 2P3ZA 4N4PA 3DUHA 3T81A 1JNLL 1A7QL 1GIGH 1CT8B 4YLCA 3UJEA 4XZUB 1K8YA 1WE5A 5AOLA 4PJEF 4DO4A 2LTQC 5CCJA 3KLSA 3D3FA 1QOPA 4N26A 1SFLA 1ETZB 3AAZA 3IGFA 4NI8A 1BRLB 2PURA 2F54B 4IDLA 5D2WA 1IKOP 2HS8A 5FAAA 1I6NA 1BREA 3PNRB 3WLJA 2Y8UA 3HZYA 3BP6A 4EACA 4JG1H 3DX1A 3GDTA 1RD6A 2ITCB 3HC0A 3ES6A 1OPOA 2IQ9H 4UTBH 3RPKA 3MMUA 1KIRB 2NUPA 4X99B 3D05A 1TKKA 3E6HB 2IAMA 1UKOA 3F7RA 2CHXA 2Z0IA 4X6DF 5T3XD 3NPWA 3ABXA 4G9FB 1HKFA 5HHMD 3IAGC 1DUYB 2NNRA 4EDXA 1K85A 1BFTA 2OQJA 1AODA 4IWWA 4PFEA 3QPXL 4QXTA 4BGDA 2XQYA 1S4IA 2H26A 1AD0B 2FAUA 5H37G 2P53A 1ME9A 2X44D 3NGBC 4MYWB 4NNPL 2W9LA 4GH7B 4DJDD 1GMEA 1H0DB 4HG4K 1M56B 3ZO0A 1V0LA 1JPFB 5HMEA 4Y5YA 3OL2A 3TWBA 1CD8A 1SY6L 2COVD 4QT5A 4UV4L 3FCUB 2ZXWB 4FXLA 4GMTH 4GRMB 4TTGA 5IK3A 5BW6A 4WCJA 4MA7L 3CN2A 3NJXA 2WCGA 1P1ZB 1P84K 4NJ9L 5IHUH 4BQ3A 2FQEA 5HDBE 1XIMA 1HXMA 2VERN 1UXSB 3NEOA 4FGMA 4PJ5B 2H9GA 1B31A 2YDSA 3B97A 3DI0A 3N13A 4DGUA 4RE0A 1OFPA 1JPIA 1HG3A 1MWAB 1R3KB 5EOCH 4NCC1 3X1NA 1F3XA 3N2OA 3KGRA 2RH9A 4BEUA 3SY0B 4U6YB 3ZM8A 1AG0A 2YRBA 4P46C 5D2NE 4HCRH 1X9QA 1FLRH 1MSSA 2J9YA 2W5FA 1QYGH 1S3KH 4NPYA 4NI6A 5FGSA 2DJ4A 4ZW8A 1EB3A 2V2XA 1OGBA 3EHBD 1PHWA 1YN6A 3UD6A 1QTWA 2DZVA 1DHPA 2A5UA 5KOMC 3QTGA 4UWMA 1SUJA 1CCWB 4ODXB 4YHYC 2BSEA 2CM6A 1C16B 3FB7B 4TVPE 4C6PA 1LEIB 1K6AA 1NOFA 3Q01A 2ZZ7A 1N8IA 3KPPA 4MJJA 4WHCA 3HZMA 1GYAA 1QNVA 4L56A 3BVJA 4X2PA 5EFDA 2Z3FA 2FWOA 5BZWB 3LRSB 1Q2RA 5I18H 1ILSA 4ZB0A 3NZSA 4PJ5E 2FKPA 3IXTA 3W1LA 1AQFA 2QVFB 5KG9B 3KOFA 2WLKA 4JM4L 3BSZH 3CVIH 4LRNH 4Z7QB 3M17A 3URQA 4DEPC 3UWEA 1F6PA 2XYLA 1RL1A 3TVMB 3HG3A 1IT8A 3KCOA 2VR6A 3MS8A 5E0QA 2YD6A 5C09B 3F6IA 1H1ZA 2ESCA 2Y63A 1TJXA 1J8KA 4UUJA 3QAZB 5C0AB 1ESWA 3EYVB 4R83A 1SBSL 3WFDH 1FNEA 4PTMA 4YSDA 1MCOH 3HJ0A 3THAA 2DRUA 1GPOL 4GQRA 1YA5A 3RY4A 2K8MA 3ITXA 3MT1A 3PZMA 4CCDA 3B4UA 3Q2WA 2V30A 1GG1A 2XQYG 5H6HA 5HBFA 4LLVA 1PNCA 1WV2A 2QGDA 3GMQB 4AC2A 2Q7YA 3MJ8B 3RX9A 4IRSA 2HROA 4Y6GA 1H3VA 3LTVA 1ZMYA 4NT6A 2E7CA 3FT9A 4R9XA 3WQOA 5BQDA 3D39E 1UKTA 4Z76B 3REQA 4GKZB 5DT7A 1AH4A 1QK2A 4C90A 3REVB 3MBEC 3MRLA 1IM9A 1HQRA 4P5UA 4WO4B 2FB3A 1XGQA 1A2YB 3QJVB 1SF5A 4MLRA 3SCVA 1K5NA 2EECA 4EANA 1TIWA 2YFNA 3UPRB 1PTDA 2OQHA 1HJBC 1G84A 2BRQA 4NVTA 1U92A 3A5FA 4ERAA 3S8GB 1BXAA 2DEPA 2QJHA 5EZIH 3G6DL 5C0DA 3SCTA 4PB9H 2VVSA 4CSTA 5IJKA 5D1ZI 1P7QA 1FFNB 4V1DB 4NERA 2AXFB 4YHIB 3V6ZA 4URKA 3AM8A 4J28A 1H19A 4KT2A 5GXBB 3FUMA 1DWHM 2ZWSA 1D5XA 3W9EA 5EU3B 5H8UA 5IT2L 3ARFC 3BWUC 5EUKB 4LVDA 2G9HB 3A4DA 5CJ5A 5PAZA 2KZKA 3BJFA 1AJZA 4JPVL 3ZKND 3CLMA 1FIEA 3MBWB 3N0PB 4JDYA 3MOQA 4U6YA 3US9A 1JUBA 2AJZB 4G1EB 4MD0A 4X9SA 4NUMA 3GLZA 1AJ2A 2VXTH 2DICA 3QUKB 1ZRQA 4RA0C 3V18A 5JYLA 3N2JA 1XB6A 1DL7H 2R59A 3FTZA 2DMBA 2OLHA 2BFGA 2FZ3A 1NBVL 1W8NA 2IGFH 3QRGL 1ET5A 2ALWA 1P1ZA 3UGUA 1QABA 1ITQA 1C92A 3SFWA 1C7SA 3QFJE 4EVNB 5A2LH 3T8MA 4HUXB 4AQ8A 4MD5A 4PFHA 3TAOA 1BPLB 2LTQB 1JD9A 2R23B 2ZUTA 3IDNA 5TDNA 2ZRXA 4Q8MA 2C34A 4JCLA 4G3YL 1S7VB 3GR4A 5BZAA 2WUCL 3TJHC 1XIEA 1I9RH 1E90A 4FFZL 3UBFA 1LTXA 2R9HD 4LF2A 2YGNA 2A6KB 2CRIA 4Z7UF 3RIFF 5IGXL 2VC2H 5MHSE 3QRFM 3WQEA 4FG6C 4TTDD 4F57L 1KQZA 4D6EA 1Q1JH 4QRPD 1M65A 4HQQL 3P60A 2QMKA 3D2UB 5DVKA 4F0SA 1YEHL 2ZUQB 4XKMA 5DHDA 5FGCE 4M6OL 2QPXA 2V17H 1THAA 5B39A 1SSDA 4HNUA 2ZQ0A 4F33A 1X5YA 3NCEB 3QJOA 1E6XM 2PPCA 2YAEA 1Y65A 2BGQA 1FNEB 4MQSB 4FYQA 1TQBB 3L4ZA 4WDIA 4BGLA 1S39A 4KTDL 5IBUG 1KCKA 1SLWA 1T4KB 1W6LA 4KNTA 3SSGA 3UJTH 4D9RE 1LWJA 3FCSB 1EYEA 4AQ1B 4JHOA 1A9VA 3CWHA 5DJ2B 1C9SA 1C8XA 1UR1A 2J7GA 4O57A 4QHKI 1OQOA 3PFMA 1F97A 4PH6A 2GYSA 3U6RB 4RW5A 2VFGA 5CM1A 3IJ6A 1G7JB 4OGQC 4GW1B 1MDLA 1UP0A 4XP6L 4HAGA 4QG8A 2CA3A 1FGNH 1A8ZA 3BURA 2WCSA 4IIQA 5FO8B 4G9FD 4QDMA 1MI5E 3QE5A 1T7LA 2IKGA 1F3WA 4AQOA 1FFTB 4WDIB 4P23D 2JLLA 3I68A 3MCOA 3MWAA 4ZFCA 4E42A 2RKXA 4ZTOH 5CPTA 4ZQPA 1AO7B 4KVCL 3IRZA 3UPRA 2QT3A 5F2IA 2D69A 1B2WL 4CEXC 1AZ2A 4NKIL 4TULL 4ZI8A 4M93C 2QCFA 4ENEC 3Q2LA 4PMFA 2OMWB 2W65B 4YJ5A 2CLFA 3P9WB 3VD0A 1TV5A 2J7LA 4JQIA 4Q74A 5K9XA 4P5RA 1ZHNB 2CH8A 2EXSA 4XRCB 5HPMA 1L8PA 2V38A 1F5ZA 1IGML 1ZS2A 1M5WA 2C9SA 5EBLB 4UT6H 4RGNC 2JKTM 3BTNA 5FKYA 3GGWB 3EXSA 5ABFB 3FSWA 5EZPA 5KVFH 4LK4A 1VFMA 3WIHL 1WWBX 1XSIA 1OAKH 4IS6A 4BA8A 5BMFL 4LQFL 1ICPA 1AJ7L 3PHQA 4X9BA 4RRPM 1G7LA 2P88A 4MZRA 3DBXA 4W4QA 3HZVA 2OMBA 3CXOA 2EAEA 3ILDA 4TSAH 3AZSA 3TMLA 5A6BA 3K5RA 3MUJA 1JV5B 1WUNT 3IPWA 5DA0B 3W01A 4P07A 5KN5A 4QP0A 3PJWA 3QQXA 4EDXB 4L64A 2IANA 5E70A 3UXFA 3GS4A 4XIMA 1BWWA 3ME0A 1VS1A 5BZDA 3OHIA 3PU7A 2H2SD 1HJWA 3OP2A 1IFGA 3N41F 1A7BA 1NCCH 3GT6A 3QUZA 5AYUH 4HJEA 1GHRA 1GVSA 3HR5B 3ZXWA 2K6YA 4PIRF 4LDEB 3NJMA 4XNAA 1VCFA 4PBXA 2X53A 4RZCB 3M0KA 4LGPB 4KDVA 3RU8L 4Z5RA 2AANA 5GGRA 4O00A 2QF8A 2VDMB 5JA8B 5JU6A 2BZCA 4GQ9L 1FH2A 1QEWA 1GSKA 2B5IB 4TUJA 3MLSH 2WLIB 4XVSL 2AQ2A 2PR9A 1VBRA 2NX1A 3TF4A 2OELA 4YL2A 4PLKC 1LEGB 2VUOA 3DIVA 1UCBH 2E77A 2YL5A 1T21B 2DJUA 2JKWA 1XIWD 2OJEA 3G5ZA 5FKPB 5ITFA 5K5YA 3JZUA 3GBLA 3F58L 2WXJA 4XAWL 1O94A 4P2RA 2AEPL 4PRWA 4PJEA 4G7YL 1R3SA 3HR5A 5MENE 2CLOA 3QPQD 1M7DA 1MAML 1MEXL 2F54E 4OCXH 1K72A 4HEPA 3CU2A 5FJTA 4WO0A 4Z7OF 1OC5A 3MC5A 1UIOA 1C5DB 1MELA 2FHCA 1QBMH 3G6AA 3P69A 5AG9A 1RAMA 5EOQH 3F7JA 2AK4D 2F74A 1AXIB 5AUMA 1DWIM 3HS8A 5CBAA 5HHOD 1P6BA 2HFEA 4JKPH 2XU9A 1TV3A 1KPUA 1XZ0B 2ENJA 5F7LB 2AJSH 2Z7UA 3CX2A 4QWWC 1T4KA 3NDYE 5IBTL 3KLHC 4G6FB 1FXPA 1H51A 1QOXA 1XDMA 2JKAA 3ZYJA 1A1NA 3BG9A 3CL7A 2XFYA 3EX6A 2MIZA 3II2A 4LF3A 3R13A 1DDHB 2CO4A 5KVEL 4NUGH 5CZXC 3F04A 3O0KA 3MNMA 1V77A 1IBFA 3MLUL 5F96H 5HJ3B 3NCJL 1REQA 2BMKB 4N6RA 5EFIB 1LWIA 4JFOA 3PE9A 4OD1L 3HNVL 5HJBA 4AX3A 4YC2C 3H4WA 4OLVH 3B0VC 1K2DB 2IIJA 5E2WL 5KVGH 1HXJA 4E2BA 2DT3A 2CRMA 4TUFA 3BDXA 2KZ1B 4L18A 1NGZA 2TRHA 3GPEA 4Z0BH 3VQ2C 1VBHA 1A4KB 4XO5A 4NKMB 1KEMH 1DUZB 1XYBA 3WTSA 2AMGA 4M51A 5CQ1A 1AQHA 1AQKL 3OB0H 2IH1A 2J1YA 4LLVB 3QHFL 4WKZA 4HUXA 5LXGH 5GS3A 1HJVA 2XY1A 4OU3A 1HGWA 1QBAA 5K7JA 2XQ0A 4YK4B 1TPVA 1JDCA 4ZMOA 2WOYA 4LPXA 4PWEA 5GJSL 2CC0A 4ZB5A 3EWDA 1ADQA 2VDKL 2B1AL 5GRJH 4R9OA 3UTTE 2APXA 2GAZA 4K2UH 2C19A 1YUHA 4HIIB 1FH5H 4ZUUA 4ZGYA 3GBNH 2X2GA 1DWJM 1TMHA 2P24A 5I8OL 4DKTA 1B4TA 3I7RA 3PPGA 4PV9B 1W1B1 4YHMH 3CHSA 5CU5A 2NNXA 3MRPB 4WK4B 1EGJL 3CO8A 5F7DB 3B43A 1XKJA 5D96C 5JR1L 2YPLB 1DIEA 4M1GH 2XZQL 2FZMA 2NT0A 1EK3A 3DGGA 1L9TA 4PJAE 3RWFB 3A4JA 1WAEA 5JPMC 3QHOA 4JIIX 3SIMA 5HNRA 2F7QA 3HIZA 3Q1SH 5AW6B 3CBKB 1MW0A 3E74A 3SSJA 3DFNA 1I9IL 1ETJA 5D1XE 3VQLA 5C54A 2VAAA 2WV3A 4AIUA 4TVSa 1PVNA 5IJCC 4FNTA 5HJGA 1KMGA 2V63A 4G80B 4UIMA 4AIZB 2Y8KA 4FXKA 3IMVA 3LV3A 4WU5B 1Q0EA 3WLTA 1LDPH 3THUA 1OPGL 4KO6A 3ES6B 5DURD 3MV7A 3QIWC 3SGJA 4X0VA 3NIFE 3DGGB 1L7TH 1ZHKA 5KAQF 4HLJA 4A1RA 4GAYA 1UKQA 1W91A 1P4UA 1T40A 4HWUA 2W3ZA 2E74C 4YH6A 5C9UA 4R34A 1KFWA 1D5ZB 1UZ1A 1MJ7H 1EANA 3IF1B 3D12B 3MZGB 3HKFA 1OY0A 1V79A 2UY4A 3SPGA 3HFTA 1HS6A 3PHOB 4QNWA 4ODHH 1NDGA 4PJDF 4R7VA 1H7RA 3DHJA 3SE3A 3U9UB 1OF2B 3LVTA 1F45A 5DYOB 2YD9A 4N3UA 1SZRA 4O52A 4LH8A 2CO7B 4UNIA 4PB9L 5SV3A 5I0YA 3FQRA 4OCYL 1VRDA 1HILB 3KGSA 4N6RB 5EFIA 2XA3A 1VFAA 1AS6A 4LNRA 1HT6A 4WNSA 5D6CB 5ITBH 5J56B 1KIUA 1XF0A 4RFOL 5AW0B 5D1XB 3QEQE 3WUFA 4DEFA 4CU7A 4GABA 1DVFD 5AYBA 1Q94A 2JEQA 4GY0A 3RVUC 4QRUA 4F0LA 1KC5H 1DUZA 5HVHB 1N7KA 2BOBB 2WC3A 4BSVA 3V5FA 1Z69A 2PI6A 4AG4H 2XFXB 5CPSA 5DVOA 1FUYA 2VDIA 2IQDA 3ZJ6A 3H7RA 3D3VD 3ME0B 2XDFA 5MF5A 5F9DC 1VHPA 1VFAB 4LNRB 5AAWA 5GIRB 2XV0A 4ZNEE 1ZVNA 5T3ZH 1GOIA 4QWWD 1QPRA 1E5CA 1W3KA 2E5DA 4EF9A 1TOXA 4ZNCD 3UTTB 5GS0L 3KJ4C 4JOMA 3T1FB 2IDQA 2XJLA 4UNTA 3QGKC 5I00A 3FHAA 4NRXB 5GS0C 1HL2A 3VJ6B 2OMAA 1BSIA 2A73B 2BWDA 4HKXA 4W6XB 3GSRB 3HB3C 3FCBA 5C0RL 2ZUQC 3AU1A 4N2HA 2BDNH 1YPIA 1XR9B 4TTUA 3TN6A 1Z2KA 2FJFA 3TWYA 2LR4A 3GLEA 3NJVA 4KBPA 4EE9A 1QTSA 2WBJC 1V6TA 4GIYA 3FAWA 5IMMB 3N1QC 3MRHB 3PDOA 4IJBA 2J66A 3SE6A 1LO4H 1RH9A 5C0AA 3ZQWA 2MPVA 5D2NC 4OOUA 1UTDA 3UR8A 2OJ1A 5BRZB 3FNDA 3MI3A 2VQ1B 2YQBA 4R5XA 4OLZL 4Y5VC 3QY7A 4TPRH 2EQDA 2P5WB 1XLHA 2IWEA 1ZJIA 3ZR6A 4D6CA 3FHEA 4G80A 2H45A 5DC9B 3NDYA 4XAFA 3FGCA 3HGSA 2ZAGA 1H15A 4GNJA 1ZY9A 1NFGA 5DTFB 1DQVA 2XG5B 3DBXB 4RFNC 5AB1A 3OVGA 1FQ9C 2GBAA 2JNZA 2VXVH 2MCPL 4MSWB 2WAHA 3IGLA 3QZPA 2CFFA 4HEME 4U1IB 3T0CA 1VHNA 3WQ8A 4JY4A 5HTSA 3VXTB 3GJFH 4E5XG 3I75A 5KSVA 2R1LA 5XIAA 2QHRL 1ML1A 3M6YA 3FMGL 4KKBC 1Q4WA 4F2BA 3NPZB 4LLMA 2FHFA 4YXGA 2A79A 3BAJA 4X8CA 3T4AB 2ZSWB 3GSXA 4RFOH 4E9LA 5KZ6A 4GRLA 1L9OA 5ESVB 2UWEA 2OOGA 4D8LA 1F7BA 1R5VA 3N50A 4J12A 1TWWA 1UR4A 1A5FH 4I7UA 3HMJG 3UESA 5F7YC 3ULVE 1OTUD 1ZLSH 4WO4C 3PWAA 4HK7A 5IB1A 3KW3A 3WJXA 1O7DE 3KL5A 1X9LA 4FYRA 2PWFA 2WKOA 4FERA 5IMKA 3SDAB 2OX4A 1HEJC 4GK8A 1HN1A 2FSEA 4H9MA 4WVXA 3PAVA 2V6AA 3LRKA 1FDJA 4JTIA 4CCCA 2V5SA 4YHNA 2HLEB 4X50A 2RB8A 1KFJA 4YSQA 4RE2A 3PWIA 4U31A 4EUPG 3EG9A 5F44A 1TJHH 3USBA 1UR8A 2VEKA 4NQQA 4OT7A 3KPNA 3K4ZA 4OJYA 3B3BA 5ICZB 2F6AA 2Y72A 4E4UA 3T40A 2YCEA 2UZPA 5F1IA 4N25A 4TSCH 1LRQA 1SFTA 2X10A 3BN9C 3QW9A 1YE4A 2PYEE 3O1NA 4IGHA 1F73A 2VEIA 3W27A 1LYQA 4RE3A 2IGFL 3TBSB 1XXFC 4JTCA 1FL3B 4WWOA 3FONB 3K2UL 1NIDA 4M6MH 3SKJL 3TNNA 1X9UA 2HT3C 3O63A 1NF0A 5D7JD 2VN7A 4YSRA 1P5UB 4MDJB 3IDXH 5ICYB 4OZIF 2H1PH 1OFBA 1VBUA 3MTWA 1QUMA 2A1WL 1A6WL 2XXMB 4KXCA 3VG9C 4LSRH 2C6QA 1F5WA 1MZZA 4ZUSB 1FGNL 1X5IA 3RHWK 4FLHA 3ZYOA 4CQ8A 1CXIA 2F53E 4OD3L 3GMLB 3MA7B 4W9JC 1NCAH 5DJ0B 4DPCX 5CF3A 5EIIA 3R4DA 5I30L 3SN4A 4JFDE 4I6KA 1JPTH 4YDKH 3OWRA 1RK7A 4LBEB 1ZDSA 1OP3K 3GR7A 1HCZA 2ONEA 4MYAA 4XCEB 2C9XA 1AHKA 5FWRA 1UWAA 4YDJA 2NSXA 2OMUA 5CR1A 1GKRA 3EO9H 4C83B 3VXUE 2QIIA 4HN4A 4HIHB 3CX5K 1N7ML 1SZNA 1AH1A 4A8IA 2YLHA 5JXED 2C13A 4G7SB 2PO6D 4LCWA 1K4CA 4HT3A 2KPWA 1UFUA 2W95A 1HHGB 4OJCA 3J27A 3VDBA 2VCCA 1NOLA 4HALA 1TUFA 4PJ8C 4JIHA 1HXKA 1R9ZA 4B5SA 1Y0LB 2CUHA 4HUCA 5FESA 4Y9BA 3EWWA 1EP2A 4XWOC 1I31A 3QUZD 1QBLL 3KXQA 5LXVA 4MY1A 4XAGA 3QIUD 2NXHA 1FAIH 1TR7A 3L5WB 3TJHD 3E2RA 5K2ZA 3GSQB 5D7SL 4LQFH 5AVSB 3K13A 4DXVA 3VE9A 1EBAA 1HIZA 2D0HA 3FQ2A 5DQDH 4AVIA 2NY7L 2GKIA 4MNJA 5DT1L 3FQWA 2FT7A 2VEPA 4MAYB 1Q5MA 2DJMA 1R7OA 2BLFA 1VCGA 3GYCA 4NILA 5B22A 1LRNA 4DN1A 4DX3A 5HOSA 4DEWA 1UWXH 2UWEB 3S9ZA 3BGJA 3GW0A 2BY1A 4NWTL 4WY7H 4QXGL 4I8YA 2AK4A 3MUGA 5FHBH 1C93A 4NHCL 3RDKA 4PRHB 4UQ3B 4Y9NA 1HH6B 1CWVA 3DVNA 1QO3A 3QEGH 4Y5XA 2G75A 3VABA 4GYFA 5BW7C 2A9NL 5ID0B 2YSSA 2KLTA 1TVLA 4LU0A 3KRBA 1P5BA 1LGVA 3P7YA 3U0TA 1RV8A 4DZBB 2VL4A 3WDQA 1AGFA 3UAJA 3LN4A 4UAOB 3B9KD 4P9HC 3MCNA 4TR9A 1TQJA 4RWHA 2J7BA 3N18A 3H54A 3QEHB 3MBEA 3T0BA 2D22A 2R1MA 5CJNA 4C1NA 5HQEA 3ARBC 3N85H 4OCXL 2IOOA 2WTOA 1TVBB 5E0KA 3MR9B 3PP3H 4AVKA 4RNFA 2AEPH 3R12A 2HFFA 3EGSB 2ASHA 1JMZA 3QAQA 4C47A 4YWGL 3NA9L 3VNZA 1T83C 1RZ7H 4JFHE 4QRTA 4MVAA 3THDA 3IBEA 1SFSA 4MZ1A 3MV9D 3VD9A 1GGCH 3MLVH 5CJOH 5ALBH 4Q97A 1FJ1B 1NFAA 2OZ4L 4GIEA 2ZPKH 1OSYA 1PKYA 5KEZA 4F0RA 1OD7A 5HDBB 4QGTA 4MWFA 2G4JA 1V93A 3CIQA 3FZUD 4IOSA 3AQXA 2UZYA 4LNYA 3HRPA 4LLDB 4GXVH 4Y2WA 2EIDA 1GW6A 4IZGA 4Z78B 1AP2B 1DL3A 1O7AA 2CBMA 3S1UA 2PZ0A 3S48A 2XETA 1FWNA 5BO1L 5DS2A 1UB3A 1KUMA 4N3TA 3O3UN 1FNFA 1MAKA 2DQCL 2VXSL 4GAGL 3W0WE 2GUUA 2Y4SA 3QPXH 3L9EA 1UR9A 1FNHA 2R29A 1LDPL 5IY5B 5FYJU 1XP3A 2ALAA 2DI9A 3MRBB 1DBML 3KVKA 3PULA 1JGEA 3K4WA 2YBGA 1GVRA 3AICA 1JVLA 4IMDA 2HK1A 4KCUA 4LRTA 3S2AA 2NY7H 5GIRA 1B4EA 2JI3A 1EBGA 3E5PA 1XRSA 4LFYA 4BJHA 4HYWA 1F4WH 4ICXA 3JV6B 2Y5JA 4ZMPA 3BANA 4YLQT 1F07A 3LQAC 4JY8A 3OB8A 1N82A 2J2ZB 5I16A 3DTUB 1WG3A 2D8KA 3GH5A 4JTQA 1E0TA 4Q33A 1DQMH 1NCUA 4Y2OA 1DL7L 2Z93A 4ZOAA 3RAJH 3KAOA 2X9XA 2VW4A 2WKGA 3A21A 4O02B 1LO2L 3TVMD 5TFSL 1DXIA 1PZ1A 4M5PA 3OX8A 4UFMA 3HAEB 4KROC 3UFIA 4FXRA 3ITLA 3MPCA 2BFVL 2QJGA 2AITA 1IFHL 2R29L 1MG2C 1EXBA 3MV7B 1UOKA 4XNXH 1U95B 4PTUB 3U7AA 1IGCL 1I4FB 1ZTVA 1FZOA 3MNZA 2WQPA 4OUIA 1UQZA 3ZWTA 2DSZA 4DF2A 4YGVA 2ZRWA 4AKQA 4DBDA 1D3GA 5HUOA 4TOQA 3ZDZF 4AMAA 3WLWD 3H9HA 1T1WA 3EOSA 2EIBA 3HG1D 3SCMD 1GGCL 3FH5A 1WCQA 3G9AB 3MLVL 1ROWA 2F8OA 3IDIB 5FV2A 5AVHA 2H1PL 3FB6A 4CJ1A 5FLVA 1GKOA 1VGKA 3ARDB 4ONGL 1U83A 5HULA 3EHBB 2A4AA 1U8MA 3LIZH 4R84A 2ACRA 4PR4A 4AZ6A 3SO5A 4JL2A 5CD3B 5E0FA 4P2OD 5C0AD 1XFBA 4G7RB 1IE5A 2D3VA 4R4ND 1N2RB 4QOKD 5E1HB 2Y2WA 4LDOB 3NH7H 5DRCA 3H2FA 2Z4TA 5KS9E 4ALAC 1NEZA 1P7BA 2DH2A 1JD7A 4O0ZA 3W3OA 5LIWX 2I16A 4C1NB 5AVVB 3CO4A 3DGDA 4I5XA 3JRKA 1SVDA 1MCBA 1PS9A 2IPFA 4FG0A 2YX0A 4FQHA 3KYOA 3BZEA 4QAMB 4NN6B 5GGUA 5EEZA 1SZFA 3B8UA 32C2B 5E6SB 3HBPA 5DY2A 3N15A 3FPXA 3V0HA 4NENB 5E9DE 1JF6A 1RPXA 2IWKA 1SR0A 1IEXA 2WSRA 1YLVA 2H6RA 1D2PA 3LH8A 4NZDA 4OBRA 3K4DA 5BJTA 2Y24A 2HCVA 4QS6A 2YD2A 1GYCA 3E2HB 4UTCA 1AR1D 2X3AA 5I1JL 1HINL 1OO2A 4NI3A 3R1GH 2OPCA 1L9PA 3RVTC 4FYSA 5K9QI 4M6UA 1UM4L 4Y4FB 2X70B 1HUVA 3B56A 4XNZC 5D7IA 2IDCA 5ABGA 3R8BB 1YEJH 3ESPA 3L2LA 1JPFA 2QQQA 3T4WA 1BZDA 3IXAA 5DT1H 1TCRA 5BROA 1NZRA 4MPKA 5BU9A 1P7QD 2W91A 4BQ9A 4QRRA 5F9JA 3ZVVA 3NXLA 4IRZA 1KTNA 5A2FA 1RCXB 3DX6B 2DZAA 4XCFH 4GPNA 4O17A 4GY4A 3W72A 4M61B 4PLKD 4PRPA 4AWJC 3KTXA 1EUNA 3QZAA 1CBGA 3AWNA 3VWJA 4Q8UA 4LOUD 3T55A 4AI7A 1RIHL 2GJXB 2AQ1A 1H60A 1MDRA 1DQJB 5JZ7D 3N42F 2QUMA 3NRFA 2G60H 2F7OA 5JZ7C 4OBSA 2ZYRA 1NU5A 3P80A 3DSFL 1JF1A 2VABA 1A4KA 4NP4H 5I1EL 1RV6X 1YEKL 4WTZG 2VM4A 3C60A 4AH2A 4YSCA 3ZFHA 4NP7A 4PJ9C 4Q6IB 2FX7H 3K0YA 4Q9RL 2G3FA 3ANVA 3WTYA 4R7WA 3NTCH 2I07A 5I1CH 4O1DA 1O9ZA 4GBXD 2WHMA 1YZZA 4M61A 1NAKL 5BS0E 3UCRA 3EB3A 9XIMA 1HXYB 4MB3A 1KNOA 1CG9A 1LNUA 1KGJA 3PJSA 4RLIA 5IBLC 3TBTA 4HIBA 3QVAA 1BVNT 4JFFE 1B0IA 5BXTA 3DBNA 4XUGA 1FO0B 2R2BB 3QR3A 2P8LB 1QBBA 4XZMX 3OWEA 4GEJA 4JICA 5FDWB 1XYLA 1WB0A 4M62L 1WLHA 3A67H 2WXOA 5DJ6B 5KANI 4XTIA 1NWRA 4V1XA 3GG1A 1BQUA 1E4XI 3JTSB 5IHLB 2CERA 1NP0A 2Q86A 2VAJA 3FSAA 5I75C 1IAIH 1RUSA 2CBQA 2K1MA 1QQDA 5JLZA 4LAUA 3VGGA 2XZZA 2VM8A 1XISA 4WK0B 3DDGA 4JL1A 2I5IA 2OG9A 3WSQL 4ZL1A 1I2OA 3K8MA 1L9RA 2XUWA 3SGKC 3HKZA 3QEQD 4HTYA 3TESA 1SLXA 3OKYA 2JTDA 3GSNA 3M43A 3U57A 1OTUC 3EB4A 1F6YA 3O6AA 1M6OA 4RDWA 1KPVA 1YCSA 4R4NC 4UAOC 3WAJA 3EG9B 3HZ3A 3O6KL 1LTDA 3IJLA 4IT1A 2G97A 4AZCB 2QKIC 3ES8A 5CSGA 5F3HB 3KPMA 1BZ7A 4XNQB 3GO2A 5DC4B 4XP6H 2A38A 4PTWA 1N6VA 1NDVA 4GQBA 3KVPA 3RLUA 3QI9A 1B6DA 1QFHA 4GSQA 4ZFFA 3A13A 2O93L 1KXTB 2E40A 3GUWA 2CBVA 1BXNA 4MNHA 2R0KH 3KWTA 1GTHA 3BEVA 1FUNA 5AB2A 4NZTH 1LL6A 3SJNA 1ZK9A 3SDAD 3GJEB 3TU6A 3N4EA 1SRDA 1FVDA 4DZ8B 1XIDA 5I0WA 1U1HA 1H8SA 4ZW5A 3GTHA 4IHOB 4KROD 4WGVB 3DX8A 1O0VA 2I60L 2ADJA 1WDPA 2R1WA 4R8WL 2EG6A 3TVMC 4BQ6A 3MMDA 4IQEA 5CZTA 1F8TH 4OSUL 2PO6C 4LPTA 1S9KC 1E5AA 3A5VA 5FO7A 4D3CL 1O68A 5KJ4A 3NZRA 2F58L 3Q8FA 2OEKA 3SB0A 3L16A 4AD2A 2X6MA 3DMMD 3W7EA 5DFWH 5K9QG 2AMUA 3TA3A 3ZMEA 3MMEA 3QDGB 5EWIL 3VIMA 4BZ2A 1G4MA 4W4OC 5AW9B 3ROOA 2QF7A 3K5XA 3TN4A 3PWUA 1NGWA 2N59A 1YNLH 4EN3B 1BD2B 3VXRB 4ZX3A 4PJBB 1C1EL 4ILDA 5ADPH 1H09A 5H1WA 2W94A 3QC6X 3RN6A 1S5IL 1Q2SA 8XIAA 1DVSA 1TTFA 4I18C 3WBDA 2FH6A 2Y9RT 1GORA 3MJ9L 5BRPA 5DLMH 1ITCA 4OI8A 3WLHA 5HHXL 4IGBC 3VFRB 3QG7H 3E12A 4AY1A 2CR0A 4PMQA 4ZZKA 1FHNA 4OH2A 5HGBA 1MQKH 5KJRH 4P3CL 2XVBA 3OVRA 4Y1AD 2J1WA 4XNUL 2BNRD 4JO8A 4L5FE 3QR2A 5F8RC 4G8TA 1WZLA 4KIEA 1UB6A 1UB5B 2HZHA 1FO0A 2R2BA 5EPMA 4BCYA 2NQHA 3MKCA 3RGTA 1P9MC 3EGDB 1G0XA 2GJ6D 2CLKA 2B7DT 3F5JA 2BSSB 1Q13A 2C7UB 1DBKL 3I85A 3TBBA 2N56A 3QRBA 3TAKA 3GU2A 3UETA 2VD9A 3TNNB 3ZZ1A 1N6QL 4L48A 4ZD3H 5CSSA 4C60A 3GIPA 3AT9A 4NQXA 4OVUA 3GVWA 3D39A 3K46A 3C5JA 3GTVA 3ARFB 2FWSA 4LBAA 1SVZA 2X5PA 3ZPDA 4I88A 1A80A 1WO2A 1W3TA 3U7WH 5KS9A 1AMXA 3OXRA 3ZL4L 5IW3A 3GXNA 4GUPA 4JY5H 3NIDF 4JFVA 1KIPA 5HGHB 1W72L 3QWRD 5KSUA 2D7OA 1VSCA 3KAAA 3WIJA 5GPRA 3V0AC 5DBUA 4N2NA 3WY3A 1EH9A 1RLCL 4F37K 2UXTA 2ZUWA 3BWAA 5I6PA 3M47A 1M7PA 2B2XH 2PYED 4L4TA 5KANG 3SIZA 1WIUA 1SEQL 1S1PA 4A7SA 1IKNC 1OX5A 1MUMA 1I7UB 4ODHL 6XIAA 1OGPA 3UC2A 2NW0A 1T20B 3BAWA 5E6YA 2HVMA 4GUOA 3W37A 1J4EA 5JNYA 3NIFB 3ZY7A 1SFHA 4KJQD 5BV7L 3PPCA 1W9UA 2DQIH 2ESVA 2ZSWA 3GSXB 4LZKA 3MNVB 3EAUA 4OWGA 3W7DA 2Q1EA 1TZHB 4XBEL 1HWGB 1DTNA 3UT0A 1PG7W 4R7OA 1JULA 2E9IA 2A3AA 3HBQA 3EO0A 3H3PL 4JPWL 3L9YA 1PGRB 3VXRE 2D20A 1XFPA 4F33B 3C8KA 2A6LA 3E2HC 1QSZA 1YJDL 2APSA 1NDYA 1EERB 3OHXA 3TJPA 5EZOL 4HPJA 1HL9A 1RPQA 1SQ2N 1ME8A 3KZPA 1XF1A 4H2AA 1W3JA 2I9LA 2W27A 3NJGA 4MX7A 4BFOA 3UWWA 4QOKA 3EEGA 1CL7L 1KPRA 3MDUA 3MRLB 4LYRA 4PMZA 4X4XA 3SUWA 3ZIZA 4ES4A 4O0QA 1JPGB 1XR2A 3MUCA 3SY8A 3SE8L 4BJLA 1W3NA 5C08E 2GVJA 5HDWA 3WBYA 2J6VA 4QISA 1M7IA 1XB8A 3IJYB 3U30B 4JE0A 5IMMA 5HDOA 4ADIA 3LXCA 1UWEL 2OCZA 3NZUA 3PAJA 4NUJB 1CB7B 1R9XA 1Z0MA 2GFBB 5J1TC 5J8OA 5GZND 2E6JA 2HKAA 3WIFA 2ZT9C 3BIBX 1FCGA 3V1PA 2C26A 4G1MA