4PCSA

Crystal structure of a bacterial fucosidase with iminosugar (2s,3s,4r,5s)-3,4-dihydroxy-2-[2'-phenyl]ethynyl-5-methylpyrrolidine
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
439
structure length
439
Chain Sequence
b'EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-fucosidase
publication title Exploiting the Hydrophobic Terrain in Fucosidases with Aryl-Substituted Pyrrolidine Iminosugars.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 163
structure length 439
sequence length 439
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4pcsA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pcsA01
1KXVA 5D9OA 3LRMA 4JFWA 4OOUA 3WH7A 3CZSA 3EJPA 3MS8A 1T0OA 4C7GA 3WF1A 3QGVA 1HJQA 1CPUA 4AMWA 3LXCA 4HZ6A 2Y2WA 3DX1A 1G94A 2D0GA 4CKQA 4U3AA 2W92A 1ESWA 1SR0A 2E9BA 4HOWA 5DFAA 4UQBA 1QNPA 1QBBA 1ZB5A 1DTUA 3AZSA 3L2MA 1JI1A 2WVVB 3LXBA 3PZQA 2VX4A 3WIJA 1UWTA 1CLXA 5JUVA 1JDDA 5JBEA 2ALWA 3L4ZA 2IGTA 3RJYA 5DT5A 1LLOA 5CGTA 3VIOA 2WHJA 2V3FA 4MNKA 4JKLA 3MU7A 4NF7A 1B3ZA 3AMDA 3CV5A 3IAPA 1LL6A 4D72A 3K1DA 2AOSA 1UKSA 2WZHA 3IK2A 3EBVA 5A6SA 1EXPA 2VURA 4PMQA 2D2OA 2DT3A 3D52A 1JD7A 2TAAA 3AHYA 1Z32X 1HVQA 1WDRA 1OM0A 4KMQA 1V3IA 1CXHA 1F4HA 2PB1A 4CVWA 3AI0A 3SCVA 2B31A 1R7OA 3LPPA 3WENA 2DSVA 2J7DA 3MUAA 4UQ9A 3WNOA 1E6RA 2JEQA 1JXKA 2D23A 2DDXA 4LYPA 3EDDA 1EH9A 3OIHA 2CBUA 2OYKA 1A47A 3VMOA 4J3VA 3PN8A 3PHAA 4ATLA 1ZU8A 4QLLA 2XIIA 3GH5A 3N04A 1CNVA 1KBBA 4X9YA 1J12A 3FAXA 2WLZA 3EMCA 1KCKA 4MNLA 1KXHA 2Y5EA 1HJWA 3HU7A 4A4AA 1O7AA 2WC4A 3D4YA 3ZQ9A 3ALFA 1DWFM 3S6TA 2ZX6A 3OLEA 3RO8A 4KRTA 1BG9A 2DH2A 3ARPA 3WH9A 1BG4A 4AD4A 2WK2A 1XCWA 4QP0A 4OGZA 1UHVA 4UCFA 3CUJA 2VX7A 2VTFA 4F9DA 2JE8A 3POCA 2EBNA 3QHOA 3A5VA 1E6QM 3B8SA 1ZJAA 4RL3A 1I75A 1CGVA 1RPKA 3DECA 1LQ0A 3POHA 2OSYA 1UD4A 2CXGA 5JIWA 3N11A 2CPUA 3WFZA 4FMVA 2CEQA 2JIEA 2ZUMA 3CZGA 1NWRA 1DHKA 1FP8A 1H0IA 1ISZA 4H2CA 5A6BA 2GK1B 4TX6A 4AZ5A 3AXIA 1UD3A 4E2OA 2ZUTA 1CGUA 2ZXDA 4PRWA 3F5KA 1H11A 2J75A 5A8NA 1KB3A 4YN5A 4AD5A 1HIZA 2V5CA 1H2JA 3VKKA 3WMBA 2YLLA 5CLWA 2X2JA 3PTMA 2BVYA 2FHCA 2ZUNA 4NZCA 1V3KA 1G5AA 2VCCA 3IJ9A 3WUEA 4PSPA 1JNEA 2FHFA 3VD4A 1BYBA 1JFXA 5D8ZA 2WPGA 1JYXA 2OWWA 2D3NA 2WYSA 4HMCA 3SCQA 3T2QA 4WKFA 3L4XA 1TQVA 3DC0A 3KEHA 3WUFA 4M82A 4TTGA 2XGBA 4FLSA 4WIWA 2CYGA 4ZEPA 3ARYA 3I3BA 4P7LA 5ABFB 3CO4A 1QI3A 5BXPA 1H49A 4U5KA 3CIVA 4HA4A 1GQKA 1YHTA 3DX3A 1KGUA 1J18A 5DMYA 3DDGA 3ZSSA 3ZO9A 1Q6FA 3CHCA 5BWFA 1R46A 4JFTA 3ALGA 1E4IA 1AQHA 5CZKA 3OA5A 6TAAA 4TUFA 2QMJA 4HZ7A 4EAMA 3WUGA 3ZOAA 3WBEA 1NP2A 4PMOA 4AZCA 1MW2A 3OLGA 2F8QA 4FNUA 2BV9A 3CUGA 2GFTA 4HZ8A 4RE2A 1QHPA 3F5LA 1JYVA 5I3DA 5A2AA 3UESA 2FH6A 4KGLA 2VL4A 1SMDA 3CZNA 2J77A 4BF7A 1KXQA 3WDQA 2A3BA 2YL5A 4CU6A 1C93A 1DEDA 3B9DA 5I6SA 1XHGA 4M24A 4LX4A 1JZ7A 3BLKA 1PJ9A 5E0FA 2BHUA 3SEPA 5A6AA 1XSJA 3EMZA 3PZIA 1IZJA 1E5JA 3CUHA 1JD9A 2DPEA 4AD2A 1E73M 4GI6A 5E1QA 2Z1KA 4RE4A 1BF2A 4ATWA 2Y4SA 8A3HA 3WMCA 4HOZA 2VT0A 1CXLA 2X2HA 1ZBVA 1GNXA 2O9OA 1FH8A 4UFIA 4AYGA 3UR7A 3RDKA 1CXIA 2J7GA 1MQPA 1W2PA 3W0KA 3WNNA 1W3HA 3AZRA 3W29A 2V38A 4PUEA 1GOIA 1TCMA 1R86A 2CHNA 1J0JA 1B3YA 3WELA 1HVXA 1XRVA 2J78A 5D8WA 3K8LA 4CU8A 1R75A 1QI0A 3N18A 1XC6A 1BVNP 1K9DA 3IJ7A 5CQ1A 4NZFA 6CGTA 1U30A 3AISA 3NYDA 1R85A 3TOPA 5HPCA 1VJSA 4WK9A 3L4TA 1E4NA 1BYCA 3ZMRA 2YKKA 1OGGA 3EMQA 4IISA 4D6JA 4BZYA 4ATDA 3VGEA 3AS2A 3WQ5A 3KE0A 1E70M 2VNCA 3VGBA 1VBRA 1W9UA 1ISXA 3BVUA 1VFOA 1E55A 1QW8A 1ITCA 4MJ4A 3DX0A 1EIBA 3FY1A 4CD6A 4MTVA 2DGAA 4F8XA 1UQZA 4BQ2A 1VFFA 2WVVA 1E40A 4D71A 1RH9A 3WDIA 1UD8A 3AROA 4L4PA 2VR4A 4KWUA 4UOZA 4LXFA 3PZUA 1VFMA 3RPMA 4MPKA 5M3WA 3BAWA 5E09A 3AOFA 3RM4A 3WY3A 3WH5A 4E4PA 3D51A 3A22A 3ARZA 3L4YA 4HOXA 2WCGA 4PMNA 2PWFA 1EGZA 1W1TA 3MMUA 2WMHA 3IJ8A 5IFTA 1GQIA 5CGMA 4OOZA 3AJ7A 3GXDA 3KWXA 4OBSA 3UR8A 4P7OA 3WY4A 1CYGA 2CHOA 5AC4A 3AIUA 3W26A 3ZR5A 4MB5A 2GJPA 5D4YA 2DIEA 5D9MA 3VIPA 1PX4A 1J11A 4Q22A 1JFHA 4Z2LA 1GOWA 1ODZA 1Q4NX 3GXNA 4W89A 1OIMA 4AXNA 5BXSA 1UZ4A 1HF6A 3LX9A 3RMEA 2XN2A 1V6WA 1TE1A 5D9PA 3HZ3A 1ZS2A 3RIKA 1CLVA 1SYTA 3UG5A 4PMRA 4M80A 3EJUA 3ZM8A 3BAXA 4GI9A 1BYAA 2CCRA 1WKYA 1UH4A 2WVUA 4FNSA 1BVZA 5I2UA 1CGXA 2DSWA 4YHGA 2W66A 3VO0A 3CHDA 5EBAA 3W24A 3VIIA 3GBDA 1EDGA 3AHXA 3W82A 3EJRA 5IFPA 4WKHA 5HOSA 4JHZA 4AZBA 3ARWA 3K4AA 4JKMA 2AAAA 4UQEA 2EEXA 5FL1A 2DIJA 1BLIA 1UWQA 3AFBA 3H55A 3SCUA 5DF0A 3WBAA 2GVYA 2IXVA 3TTOA 2E8YA 2D20A 2BY3A 4WF7A 2PWHA 1H5VA 2VRQA 4GQQA 3BAYA 3L4WA 1MW0A 1MQQA 3RM8A 3EDKA 2DT1A 1K6AA 3F5JA 5A8PA 3CUFA 1KWKA 2GDVA 2WSKA 3DYOA 4PMDA 1FH7A 1TVPA 4N42A 5I0DA 4LYQA 3W6MA 1ZBKA 1ISVA 3BUIA 1PPIA 1VB9A 1OINA 4U2ZA 5LA2A 3BUQA 1GONA 4TOQA 3CTTA 3N1AA 3NSMA 2CESA 3SUTA 1J0HA 5CXPA 1NP0A 2GJXB 3PZGA 4U31A 1EHAA 3WNKA 1DWAM 4ZXLA 1JZ5A 1CXFA 2VX6A 2J7BA 2F7PA 4DM1A 1V0MA 3AMKA 4P7NA 3MUY1 4J3XA 2ZUUA 1TG7A 4JCMA 5F7UA 4P8VA 4S3KA 3OGRA 3DYMA 4HTYA 1SZNA 3OGVA 1HKIA 1W3KA 2VZSA 1J0YA 4PMVA 3BC9A 1UR1A 4HMDA 3CZLA 1R8LA 5BYWA 3VNZA 2D24A 4U2YA 3WEOA 1D2KA 1R47A 3WF4A 1R34A 3AYSA 3VDCA 3W81A 3PZVA 4AZGA 4MNJA 4AY1A 4U33A 4JIEA 1JZ4A 1QX1A 2VZOA 4CUCA 3VGDA 3WNLA 3EDJA 1CXKA 1QBAA 3APGA 3HJEA 1LWJA 1FH9A 5A6MA 3WH8A 4AEFA 1JIBA 1V3HA 2X1IA 3MKKA 4TXEA 2XWEA 3VIJA 1W9BM 3RILA 1KFWA 1GHSA 1BPLB 4OJYA 2FGLA 1V3MA 5GNZA 1X1NA 3N15A 1QVBA 5CSYA 3SUWA 1EQPA 4J27A 4D6EA 4YHEA 4AZ7A 1EDQA 1XSKA 3U7VA 4V28A 2WXDM 1PEZA 1BAGA 3BMVA 5M5DA 1PX8A 1TUXA 5BROA 1H41A 4QLJA 1OT1A 3WMSA 2VQUA 1GORA 1XH0A 1ZJBA 2ZXAA 3WDHA 4FNTA 5TD4A 4AZIA 1OIFA 5CJ5A 1HL8A 3EJSA 2X2YA 4CCCA 3VX1A 4W84A 2J62A 1TQUA 2BHZA 4P7QA 4QAWA 1JZ2A 2G3MA 4R27A 4DO5A 4AW7A 4W5UA 3PTKA 5GQBA 1UR8A 3VX0A 2VMFA 1JNDA 4NXSA 1MW1A 3TA9A 3WFLA 3LPOA 3ARQA 4IM4A 5ABHA 2CETA 1ITXA 4W5ZA 5I5RA 2F61A 2XM2A 1EO7A 3WD1A 4AZ6A 1WP6A 3WD3A 4ACZB 3ARTA 1HKMA 3AHZA 3ZJ7A 2ZIDA 3VDBA 1XD0A 2EABA 4NI3A 3T2OA 2J47A 3SUVA 2BHYA 2UY5A 3OB8A 4CGTA 3AQUA 4EK7A 4N0RA 1JZ8A 2WWDA 2VO5A 4AD0A 3M46A 2J7HA 3KL0A 2CBIA 2WVTA 3T08A 4EANA 1J0IA 4UFHA 3U5UA 3TP4A 3SCNA 1J0KA 4GZJA 3WSUA 2DT2A 2PF0A 4QLKA 1PAMA 2XJ7A 4IPNB 4YPJA 2FH8A 2QLYA 4PTXA 2EPOA 4PTVA 3TTQA 1NWUA 1QWNA 4PEEA 3GXPA 4OKDA 4GZEA 1R87A 3BLBA 1QI4A 1CIUA 1OT2A 3BUDA 1M04A 3CHEA 3K8KA 2XVPA 1JGIA 2V3DA 4UQAA 1B3VA 3AMCA 1WZLA 1VF8A 2BVDA 2FGZA 4JKKA 4H8UA 3T0DA 1CDGA 4FLRA 3VGHA 5C70A 2EPNA 2D1ZA 4OZOA 4WJXA 3G6LA 2PWEA 2MANA 1JZ3A 5D9NA 3BAIA 5FCZA 2EXOA 1V08A 2XUCA 2GSJA 4PTWA 3ZIZA 4W86A 3A3HA 1JAEA 5AYBA 3CHFA 4UFLA 1FFQA 1US3A 3FHQA 1G0CA 1J10A 2GDUA 1XSIA 4S3JA 1M53A 2A3AA 4AIEA 4LPCA 4URIA 2OLHA 1GCYA 1WPCA 3ZT5A 4Z2GA 3GNRA 3AHTA 1JDAA 1HKJA 3OG2A 1UR4A 3VD7A 5HPOA 2QPUA 3MUZ1 3VD5A 1E3ZA 3UEQA 1V6XA 2RGMA 4QFUA 2J7FA 5I77A 1KCLA 3MMDA 4DWSA 1J9YA 1EOKA 3D3AA 4D1IA 1G1YA 4PMZA 3THDA 4TVUA 4GXPA 3OZOA 3DYPA 2WWCA 4HPHA 1CZ1A 1EDTA 4ACYA 2VZVA 1GOQA 1O6IA 4RE3A 3TTYA 4OUEA 5CSUA 4CU7A 3HG4A 2VCBA 1E9LA 4FLQA 1EO5A 5A8OA 3ARRA 2W67A 3IANA 3ZJ8A 3VIHA 2GJRA 1GJUA 3ARVA 1XH1A 1HTYA 1F4AA 4QDMA 3VINA 3SUSA 2UWFA 7TAAA 2WMFA 3B9EA 1HWWA 2PBGA 3O9NA 2NT0A 1DWJM 2VOTA 2WMGA 3BLPX 4AZHA 3VGGA 4IPLA 3GNPA 4CVUA 3GM8A 4AYSA 1GPFA 2E9LA 1E3XA 3VM7A 1GW1A 3NJ3A 2G3IA 4AMCA 4TVCA 3A23A 5FL0A 4W8BA 1V3JA 2EO7A 3AYRA 4B9ZA 1WZMA 5HXMA 1UKOA 1UD2A 2XFRA 2X2IA 2X09A 1NWTA 3WUBA 3SURA 5I24A 2GJXA 3CPUA 1V0KA 3IAQA 3SUUA 4V27A 2WHLA 1C91A 4W7UA 3WL1A 1VIWA 4U5IA 1PX3A 1HXKA 3OLIA 1G9HA 2EADA 1E15A 2ZX8A 1W2VA 2WLYA 5KEZA 3K46A 5BCAA 3HG5A 1KQZA 4D6FA 1CBGA 4NX0A 2OWCA 2EPLX 3AZTA 1VEPA 2WMIB 2XSAA 2EPMX 1HX0A 3W25A 4MB1A 5EFDA 2DSUA 1OGBA 4EKJA 2WHKA 3VUPA 1ISYA 3WDPP 5IHSA 3LXAA 2YFOA 4UFMA 1SMAA 2VCAA 4C7DA 1C7SA 4KGJA 5ABEA 5JBDA 4X0VA 3WF0A 1C8XA 1B3WA 3SCWA 4H04A 4OBRA 1UWRA 1OGSA 2WKLA 4EE9A 1IV8A 1H3GA 1K9EA 5A8MA 1OCQA 1ODUA 3SCSA 1H09A 1VENA 4AMXA 4CD8A 3W53A 3LMYA 3SCRA 4Z2HA 1TVNA 1HN1A 3CZKA 4IUGA 1RD6A 3ZSTA 5A69A 1L8NA 1MVYA 1AQ0A 1U2YA 1UKPA 3HG2A 7A3HA 4LGXA 1UOKA 6A3HA 4D6CA 1QHOA 1DWHM 4M56A 3NIYA 1TFVA 2YA2A 3S2CA 1N82A 4BCEA 2OYLA 3I3DA 5HBFA 5LA0A 1PZ3A 4BQ5A 3CZJA 1UWSA 3RM9A 1WO2A 1IT0A 1E6NA 3PZNA 5HNNA 4JAWA 4TX8A 2WCAA 1W9XA 1LG1A 4DWSC 1CGWA 1MFUA 4GKLA 3PZOA 1NOUA 2UY4A 2ZWYA 1UASA 3ECQA 1TQWA 4WSKA 1UR2A 4H41A 3QHMA 3AMLA 1GZJA 3D5HA 1W9DM 1KBKA 1BGGA 1D7FA 3BVTA 2PI6A 1B9ZA 3SCOA 2VVNA 4NRSA 2W63A 4XZBA 5IDIA 3VPLA 1NOWA 4P8WA 1UA7A 4HP5A 2CKSA 2VQTA 5IXEA 3DX2A 1C8YA 4JFUA 3K4DA 4D6IA 2CNCA 4ACZA 2XIBA 3SCTA 4J3WA 3A24A 3GXIA 3SIMA 1OB0A 4XX6A 4W85A 3MSDA 1HP5A 1CXEA 3NDZA 4W7VA 1LJYA 2WMKA 3AS0A 5ECUA 3S5ZA 4A3HA 1BYDA 4Z2KA 3FW6A 2NW0A 1OD0A 2WKGA 5KZ6A 1R7AA 2C7FA 4HA3A 2WBKA 3ZJKA 2HVMA 2OSWA 3AIRA 2EPKX 1WZKA 4P8XA 5BRQA 5FIPA 5GNYA 4DO6A 1NH6A 3ZJ6A 1VJZA 2G3JA 4HMEA 3O6AA 3F4VA 1VEOA 3KZSA 3DDFA 2ZUSA 2BFGA 4H7VA 5A2BA 2XVKA 1BHGA 4TVDA 1UYQA 2OYMA 4UFJA 4BS0A 3AHVA 3GDBA 3CH9A 4F66A 3LRKA 1UD6A 1UKQA 2WM0A 2E40A 1FP9A 3AS3A 1E0VA 3MI6A 1W3LA 4H8VA 1KGWA 2F18A 4CN6A 1JF5A 2GK1A 3AIVA 1WDSA 1MFVA 3RJXA 2XSBA 3WF3A 5CG0A 3A4AA 7CGTA 1QI5A 2J79A 1Q6EA 2HISA 1QW9A 4D6HA 5DEZA 3H53A 3GH4A 3BH4A 2Y8VA 2ZXBA 1UUQA 5FD0A 1U33A 1TMQA 2PWDA 1UH2A 1WDPA 3UCQA 2O92A 1W91A 4PYSA 4UQCA 2WC7A 3WD4A 5A6BD 2QHAA 4J3UA 3VDHA 2XHYA 2O9TA 3W4RA 2JF7A 1GOMA 3WQ8A 5DO8A 2VX5A 1JYWA 2EAEA 4ZFMA 4PUDA 1QNOA 1WAWA 2VI0A 4CD4A 4GIAA 3GH7A 2F1BA 2YL8A 1JI2A 2VUYA 3A6OA 5GNXA 5ABFA 2WB5A 1JG9A 2X05A 4CCDA 1CGYA 1FFRA 3AMGA 4PMUA 4B16A 1GUVA 3DHUA 1GOOA 1WZAA 4W87A 5HDRA 1XYZA 3VU2A 1QPKA 2D3LA 2C0HA 4AEEA 3VSVA 4MDOA 4L4OA 4J3SA 5DT7A 2E4TA 5FKYA 1PIFA 1M03A 4DWSD 4JCLA 1E5NA 4ZE5A 3IGUA 4W93A 2EACA 3CUIA 3OGSA 3AXHA 2J7EA 2XVGA 4AD3A 4KH2A 1W9PA 1BTCA 1E4MM 3AS1A 1UH3A 1HL9A 5A8QA 4D6DA 5LYRA 4FF5A 5E6YA 3FN9A 3WNMA 1H4PA 2G8ZA 3ZT7A 4HU0A 1W32A 4KRUA 3KLLA 3UERA 1HP4A 3HN3A 3RCNA 2E9MA 1V02E 1S46A 3FNDA 4AISA 4AC1X 2F7OA 2WSPA 4GO8A 3WDRA 1TA3B 1QI2A 5EB8A 5A94A 4CD5A 1DP0A 2BY1A 1WE5A 4UOJA 4HA1A 1EA9C 3CBWA 1B0IA 4NXKA 1R33A 3TTSA 3KL5A 3GXTA 3GNOA 3L4VA 2NT1A 1UZ1A 1UWUA 1WCGA 2VZUA 4WKAA 3UG4A 2YBUA 1E71M 3UETA 4ML4A 2BXYA 3GXFA 2YBTA 3N17A 2YL6A 2YA1A 1NOFA 3WN6A 1NM9A 2FYVA 2O9RA 2WAGA 1V02A 3LPGA 5IHRA 1JAKA 1KTCA 4P8UA 1ISWA 1XD1A 3WL0A 3EJTA 2WMIA 1UR9A 1L0PA 2A3CA 1OBAA 3BCFA 5I78A 1AQMA 1V0LA 2YDQA 4MB3A 2WNWA 4H8HA 1NQ6A 3M6DA 4B3KA 5FOOA 4E8CA 1MYRA 2DH3A 3THCA 1FHLA 3ARXA 1Q6DA 3L2LA 1VRXA 4PCSA 1E6PA 3CZ8A 1QNQA 1FA2A 2WBGA 3GZAA 1KWGA 5C8BB 1KQYA 4UFKA 5ABGA 2CIPA 4M8UA 1ECEA 1EOMA 1GOKA 4XV0A 5A2CA 2BVTA 5A6JA 9CGTA 5AY7A 3A47A 3ZR6A 4C7FA 1UD5A 3WNPA 1BQCA 4PBGA 1OSEA 2WANA 1DWGM 3VIFA 3S5YA 3N13A 2ZX9A 2CITA 4GO9A 3GTNA 3HG3A 1W3JA 3OZPA 1E43A 1GQJA 4V2XA 1RP8A 1K9TA 4PSRA 3NUKA 2J74A 5E0CA 3VM5A 5EFFA 2ZX7A 2A3EA 5EMYA 1M7XA 3U57A 4M29A 4MADA 2BXZA 3BSHA 3VDAA 4FNRA 4W8LA 5A95A 2YFNA 1VBUA 3BUBA 4GZIA 1MWOA 3WH6A 2OSXA 2Y24A 2XPKA 1E56A 2Y8KA 1SFSA 2ZUWA 4X0NA 2DQXA 4UNIA 1QWUA 1CENA 2F7QA 2PBOA 4QCFA 1MW3A 1C92A 2E3ZA 2ESCA 2PC8A 3J7HA 2X8RA 3EDEA 1IZKA 3PZ9A 4A3YA 3BAJA 1EQCA 2XM1A 2W61A 3AIQA 3PZTA 3T0AA 1XYFA 4B9YA 3KL3A 4MDPA 1I1XA 3BCDA 4WLCA 4UOQA 4FLOA 3K8MA 1OWQA 2WZEA 2JALA 2IXUA 2FE0A 2OW7A 5I79A 4CN4A 1UWIA 4J28A 5E6ZA 3LPFA 1W1PA 3GBEA 3O2LA 1HJVA 2VRJA 4CD7A 4BA0A 1B31A 1WNOA 1H0GA 1JYNA 2EQDA 3BVXA 1CEOA 1PZ2A 1A3HA 1B90A 4Q7NA 1KR0A 2XG9A 1NWSA 2NSXA 2YJQA 3VSTA 1W1YA 1AMYA 2E0PA 1ZL1A 3MMWA 8CGTA 3MV01 4UR9A 1MXGA 1UA3A 1X6NA 3B9AA 3QR3A 3AIBA 2XGIA 1HJUA 4GQRA 3MV11 2FDMA 4CCEA 5AYIA 1H1NA 2O9PA 4TTUA 3NSXA 5E9AA 2RGLA 5E70A 1V0NA 1GJWA 1MXDA 1C3FA 2XTKA 4D6GA 4BQ3A 1HJXA 3FHAA 3GXMA 2JEPA 2YA0A 5AC5A 3NDYA 3H54A 2WMJA 5LA1A 2V3GA 2E8ZA 2YDSA 1E0XA 2F2HA 4GI8A 3CLWA 2ZE0A 1LG2A 3MSGA 3CMGA 1KGXA 3WQ4A 2QPSA 1GQLA 2J7CA 2VVSA 1CGTA 3W6LA 2G3NA 2XFYA 1E0WA 3WKZA 5CPTA 3VMNA 1XCXA 4LQ1A 1OD8A 3PBGA 1QHZA 4QCEA 4DM2A 3ZT6A 1JL8A 2YDRA 4JL2A 3MUIA 2WHMA 3HMCA 4FK9A 2YIHA 3WEMA 3SCPA 2BNJA 3EJQA 3QOKA 4NZJA 1W9VA 1XGZA 1VEMA 5BXTA 2W62A 3AIWA 1JXJA 2BS9A 1W1VA 2OWXA 3N12A 4DUWA 1BSIA 1KR1A 1VFUA 1HT6A 3VOCA 3FAWA 4HU8A 2OW6A 2ZUVA 2F1AA 1JDCA 1E72M 1G01A 4PCTA 3VTRA 5CLTA 2W4XA 4ZENA 1X6LA 4CN1A 4XZWA 2ZICA 1UR0A 1E1FA 3VMPA 4ZE4A 3WDJA 4JHOA 3KLKA 1LL7A 2XVNA 1V6VA 4PMXA 1E6XM 1V3LA 4AD1A 2V5DA 3WY1A 1VAHA 4WSJA 2BY0A 1HJSA 3A4WA 1QOXA 3N9KA 1KXTA 4GPNA 5CPQA 3D4ZA 5M03A 3BMWA 4MJ2A 2DT0A 2A3HA 1LL4A 1V03A 5A6LA 4M1RA 1CECA 2D73A 3U5YA 1FOBA 1M01A 1LF1A 4UQDA 3T2PA 2VJXA 3WY2A 4NSBA 4W88A 3WD0A 1AVAA 2ZOXA 1GVYA 3II1A 5BXRA 3FXYA 3VD3A 5CPSA 2J25A 1TR1A 3CMJA 2XWDA 5C71A 3CC1A 4JZ5A 1B30A 2UY2A 3QHNA 3UG3A 4B3LA 4B15A 1XV8A 4AIUA 2UY3A 4J3TA 2Z1SA 3VILA 3VVGA 2XVLA 2WW5A 2BY2A 4M81A 1UQYA 1TQTA 4GINA 1V6YA 5A3HA 2WVSA 1US2A 3JUGA 1TA3A 1PBGA 1C7TA 1LWHA 2Q8XA 2ZX5A 1E6SM 4Y7EA 1J01A 4JFSA 2WZIA 1O7DC 1KTBA 4F9JA 4XUYA 2CERA 2X0YA 2XN1A 1JZ6A 2AMGA 1CWYA 3VIGA 3PZMA 2WC3A 3W27A 3T0BA 3LRLA 3ARUA 3DX4A 1K9FA 1TZ7A 4UZSA 1BFNA 3WD2A 1HXJA 2WCSA 3VIKA 3MO4A 3BVVA 1B2YA 1MQRA 3VIMA 3G6MA 5BRPA 1CTNA 3GYCA 2X0HA 3OLDA 1UKTA 1TQSA 3VSUA 1GHRA 4MAZA 2DSKA 2JIWA 1DWIM 2VZTA 1JF6A 4R5EA 1Y7VA 1QNSA 3NSNA 3WF2A 1ZBWA 2CBVA 3AICA 2J8GA 3BVWA 1BGAA 3T09A 4DWSB 3VGFA 5I23A 3W38A 4JFVA 1J0ZA 2D0FA 3D50A 4W8AA 2V3EA 1E1EA 3U7BA 4PMYA 3BAKA 1UG6A 2JF6A 1C90A 3W28A 1B1YA 2J8FA 2VR5A 2YLAA 2QMKA 3TONA 2XFFA 1NARA 1Q6GA 3ARSA 1E4LA 2G41A 3A21A 4NRRA 1HKKA 4MNMA 2YL9A 3BGAA 4PN2A 2YOCA 1YQ2A 3WQWA 2EJ1A 5JBFA 2XYLA 4UZUA 1FHDA 3E1F1 3AIEA 3EYPA 3QOMA 4F79A 2C8NA 3DHPA 4ZXOA 3NCOA 4U3CA 1V6UA 4AZCB 4XB3A 5A1AA 4Z2JA 1PS3A 2ZWZA 1B3XA 4DUVA 1HNYA 4AWEA 4E8DA 3WQVA 3EDFA 4MAVA 2JFEX 3BUPA 2D22A 4LYRA 4BQ4A 4JL1A 5A6KA 2GUYA 2FHBA 2W5FA 3VD9A 4MB4A 2F7RA 1RP9A 1WDQA 2QV4A 4FNPA 4OIFA 1ZBCA 3CZEA 2G4FA 3OBAA 1E6ZA 4UTFA 3A4XA 2XN0A 1QNRA 2DEPA 4D1JA 2PWGA 1EHNA 3L4UA 1XH2A 2VC9A 2ZXQA 3VNYA 2VRKA 2CBJA 1Q6CA 1GVIA 4AIOA 1I1WA 3BSGA 3WEZA 3PTQA 2D0HA 2DSZA 4Z2IA 3AXXA 3M7SA 4DUXA 4J7RA 5GPRA 2J4GA 4FNQA 3I3EA 3MANA 4W7WA 1D3CA 3CGTA 3WQ6A 4K68A 3BXWA 2IUZA 1PIGA 4P7RA 1WB0A 2QF8A 1P6WA 1C8QA 3W37A 5M17A 2W91A 4HPGA 5JIPA 3TV8A 4DO4A 4PTMA 2CKRA 3M07A
chains in the Genus database with same CATH superfamily
1RJLB 2UY7B 4IJTA 4FCHA 1GL4B 2CHXA 3QGVA 1CPUA 4KEVA 2Y2WA 3ZDWA 4JK0D 5J56B 4INFA 4WNQA 1AODA 4ZUTB 1MFEL 4UQBA 4YJZL 3NEOA 3U0HA 3OL2A 4TNFA 2NQ5A 2JCWA 4GIRA 5JUVA 4KKQA 3DDMA 1NCDH 3N19B 1JPGA 3NVDA 3MU7A 2D8KA 3I65A 3K1DA 3BLDA 3BVDB 2Q8AL 3HLAB 3T6CA 4OH2A 5GGUA 4E2VA 1Z32X 1FNEA 1ONXA 1NELA 3BRFA 3AI0A 5F7KC 3M0YA 3VH8B 3O3RA 1PZUB 3BUYB 5BVJA 2BJML 4AVNA 3F7JA 2ZF9A 1K8IB 2VE6B 1ZPUA 2C18A 1UENA 4ZSOE 5C2GA 2OV0A 4QBXA 1KA9F 1J12A 1ZNNA 4KWVA 1YNTF 2A6JB 2DZWA 5CUSL 1G4RA 3OLEA 2ID5A 4JRXE 4DEFA 4KRTA 1WDAA 4G7VH 3WH9A 2Y62A 3BKJL 4AD4A 4JX6A 3O6FD 1SJHA 3NMEA 5GZOD 3QG7L 1C12B 3QYSA 3N1QC 1NEYA 1BDYA 2Y22A 2CPUA 1XLDA 3WFZA 3EWDA 4C1NB 2R1XA 3BKYL 4NO5B 4KPLA 3NTCL 1CICB 1SRDA 3ATBA 3KXFD 2C3WA 3TH4T 2LU7A 2CRZA 2DJMA 2WYHA 5DD1L 3V0DA 3GTVA 3VD4A 4Y5VC 4WI5A 3FQNA 1UYWH 2O7QA 3MJ9H 4H4NA 4EZKA 5C08E 5FYLD 1E4XH 3I6KA 4KJQC 4ZTOH 3QEQB 3ARYA 4BZ2A 2BNRA 4ZPTB 4P7LA 1SEQH 3F83A 2J56A 2RAGA 3QDME 4RZ4A 2QCCA 3UADA 1ADDA 5BWFA 3SB3A 3VK5A 3CH8A 4DP9X 3L13A 5L4MA 3WO4C 3MRQA 2PF6A 2X1XR 5AYTA 2ADJB 5AWNH 5KVDL 4JJHA 2VEIA 1WF5A 4U1MA 4GW4A 5EZLB 2J77A 2WXOA 1K7FA 3LEVH 2A3BA 4Z7OF 1OYAA 1C93A 2IQTA 4LUSB 3MOBL 2Q5BA 3ZL4H 3SEPA 1F4XH 3GHTA 3CMFA 3NNTA 3TCSA 5E1QA 3BPLC 4ZO7A 1ACYL 5B8CB 4ATWA 1PTGA 2DZXA 3JZEA 1IKOP 3TQKA 5JMUA 4XAPA 3R25A 2YGNA 2CG9X 5DK0A 3HPZA 4KCUA 2E7DA 1R24A 1W3HA 1FHVA 4HF5L 2V38A 3TV3H 3SQBA 1MFNA 3CK0L 4GRLA 1LRQA 4AX3A 2BVOA 3KD4A 2CHNA 2OK0H 4QG8A 5DRIA 4PCNA 2G2RB 5FCUH 1NC2A 3KJ6L 4JG1L 1XC6A 1ADSA 1XLBA 1U30A 3C9NA 3H1ZA 5CJOL 3PXHA 2KL6A 3VGEA 3AS2A 3QCVL 4O2CA 2UZIH 3B3BA 1ITCA 4ZD3H 3MA9H 5CZVH 1UUNA 1VFFA 3BGMA 1L9MA 3VE0A 3WDIA 1UD8A 4DEUA 1F4WH 1LEGB 2Z1BA 4J2QA 4N6RB 4UR8A 4DAGH 1B6UA 3N41F 1JGVH 1FAIH 1RURL 2G5BA 5FA3A 4AWJC 4X2PA 1DJSA 1EGZA 3LNIA 3W6YA 1O94A 4GSXA 3P8IA 1SU5A 2YCLB 4E4FA 2YPIA 2C26A 4BFKA 4G1EA 3H0TA 3WY4A 1KPVB 1L6PA 4FXTA 5AC4A 4FNLL 2X3AA 3QDJB 3JZYA 4YDVB 4MHHI 4QRTA 1A6AA 3B2VH 3M7WA 3L08A 1FWAC 1OT4A 3INUL 4JN2B 1NTDA 5TDPA 2HRPH 1DFBH 3RMEA 2V2XB 4E3TA 2C16A 5DN1A 4LUTA 2ZSWB 1I1AA 5D9PA 3HZ3A 3RIKA 4KQ0A 4POYA 2R14A 4OY9A 5FKAB 5EPMB 2WVUA 3OZKA 3CFIC 4XPTL 4RRPM 1J8HA 4FHAA 1P69B 1LO2L 3S37L 3ZDYE 3BJTA 3CG8A 3GMQB 4F0HA 3GMLA 1BVKB 1JPIA 2YGPA 2IALB 1RMFH 1PDKA 1MW0A 2DY2A 4ZQTA 3S3BB 1CG9B 4XPBL 1KBWA 3O11A 3DUSA 4MA1C 4MLSA 3A3XA 2BOFX 5CPOA 3KPOB 3NSMA 2OMYA 2CESA 1VKXB 1J0HA 4U31A 1FG9C 4L18A 4PJXE 3MRKA 2J7BA 1QLEH 2F7PA 3VYLA 3P4MB 4ZFQA 3V0JA 3HRPA 2VR3A 4M9OA 3KYAA 4JO2H 5GS0C 1WC7A 9PCYA 4KWWA 4L9LA 3R2GA 3E49A 1M1BA 3WNLA 3EDJA 4GG6F 4AEFA 1RALA 1V3HA 4ZB5A 3MKKA 2HEJA 1UJ3B 1W9BM 3U2ZA 1BPLB 5GNZA 3MDJA 5GRVK 3P54A 3SUWA 3IRDA 1KD0A 3O6LH 4S38A 4PWIA 1T1YA 3CDFA 3TMLA 3G3DA 4QLJA 2FIRT 3V7MA 5F9OH 1X44A 1YDVA 4BK9A 3DIFB 2D69A 3PABA 2Q20A 2F9BT 3TQVA 5B7FA 3PTKA 4H3DA 4KFOA 4A2GA 1UFGA 4HCRA 5T1KD 1NWPA 5GQBA 3VX0A 4C6PA 3K30A 1CE1L 2QJJA 3BLLA 3V6ZA 1ZALA 4G70B 4HK5A 1AHWA 4QLWA 1E8ZA 2NR6A 5E5RB 1FDZA 2HPMA 4QTIH 1LE5B 1AQKH 3LM3A 3K2UL 3VC6A 3L21A 5F97E 2X6UA 1GIGH 4KI1A 3RG6A 5EWIL 4G7QB 2VAAA 4LOVA 1JHLL 5PAZA 5GZNC 4NKOB 1S5MA 2K6ZA 2XBZA 3HG1B 1T7XA 5ISZD 1RFDH 3KHJA 5IIEA 3QZWA 3QMRA 2NY5H 3V4PA 4UNLA 4P9HC 4ZXBC 3KDPB 2OFQA 2X6VA 1F3DH 5DXWA 2P48B 4QEHA 2VCOA 5D9NA 1KLZA 1TPWA 2WTPA 3HNTH 4BCYA 5LHFA 2DI7A 4ELMB 4DJDA 3BD4A 1X5XA 3Q13A 5DHMC 3U7WH 4ZUSB 5FDWA 5DRZB 5JXQA 1T83A 5KETA 5HPOA 1QR1B 5I77A 4M51A 2X4TB 3QUML 2Q9OA 2QSQA 4E38A 2VZVA 2HMCA 2NXYC 1HJBC 4PUBH 4B3VA 5BV7L 4FZEH 2EPHA 3NA9L 3QULA 2ZKYA 3QRGH 3K3QA 3QH3A 1C5BL 2ZYRA 4FLQA 4MQXD 3IANA 2JB5L 4AQ1C 4A2DA 2CIIA 4Z7NE 3QMTA 4GY1A 4AWUA 1EPXA 3GM8A 3U82B 4ZSUA 5REQA 3L68A 1BYOA 3JVFC 4OFCA 3TF4A 3MHGA 5EFIA 4GW5B 5HXMA 5SWQA 3NQ7A 1RR2A 4XUGA 4YFDB 1NWTA 1JP5A 2GJXA 3CPUA 1NCWL 3QJSB 4G8GD 3AG4B 4G83A 4WO0A 2NY4C 3DO4A 2DQMA 5E99L 2OT0A 1R6VA 5IQ7H 4RDQF 3CQ0A 2ZX8A 4S1FA 1ZIBA 1G7HA 4WO4B 5F1IB 5AHFA 4J3ZA 1E6OL 2GVGA 3F2CA 4HGWA 3VXPB 3OWRA 2DZAA 2WHKA 2AVGA 3ENLA 2XZ7A 2R2EA 3MFFA 4HBCL 1JZIA 2ED7A 5IHUH 4MNGB 4P46D 4XVOA 3RRXA 3LMYA 4Z2HA 4JNXA 5AB0A 5I6MA 4Z0JA 3BPLB 1J6PA 3C5SB 3GUTA 2GY5A 3UTSE 1CL7H 2IMNA 4XP1L 2UVFA 2X4RB 3HV9A 3DX5A 5JDJA 2GHZA 3S34L 4RFOH 4DOHB 4K8GA 3EYUH 4N0FA 3HPFA 3QUZB 4O54A 4K8HA 3W1QA 4R8WH 4E2DA 3C5ZA 4G6MH 4N20A 1P5UB 3PZNA 1EL3A 1OZQA 3VABA 1W0MA 2ICES 2UY4A 1ICQA 3VXTB 4ZX3A 5D5MA 5D30A 1BAFL 4XO3A 2AXHA 4LCRA 2DVTA 3WLWD 5EUKB 4JO1H 3WU1A 1AJ7L 3T1GA 1UA7A 2VQTA 1L6SA 4XXCC 4D6IA 3O3DB 4Q2ZB 1JNNL 1ZD6A 1KJMB 3MSDA 1R5WA 4LCUA 3WLHA 3S5LG 4A7QA 3C12A 2PYEB 3O07A 4Q4IA 4FA6A 1MI5D 4XX1G 1OM3H 4XMKL 5JQ6H 1FWRA 3RIAF 3MBEA 4R7WA 2FEEL 5KYNA 3PUEA 4YDIL 1HSAB 2VIRA 4HU4A 2C1PA 1G1OA 1J5OH 2IQDA 1E9ZB 2VR9A 1X1ZA 2PCQA 2B16A 2QNEA 3CFMA 3NK4A 1JUFA 4FG6C 2GK1A 1ZXKA 2QCFA 5TDNB 1ID2A 1QI5A 4AM0B 4M03A 5C0CA 2ZXBA 5EORH 4DB7A 4X8GA 1SOSA 4FIQA 1Q85A 1UROA 4JFDE 1YMHA 4HLJA 5I5IA 1O5DT 5EUOB 1GOMA 2DYRB 5XIMA 1W72B 4WFFD 1XIBA 4EDWH 3BP6A 3OAUL 4EWJA 3LGGA 1HILA 4CW1A 1GUVA 4AEHH 2K9FB 2D3LA 1TPXB 4LCIH 4AGNA 4L4OA 3T9PA 1MCNA 2E4TA 3DGGA 2RACA 4G9FA 3GIVB 3G0UA 4K4KA 3VW3L 1ZEAH 3F8UB 2BNRD 2AK1L 1D5MB 4LNYA 3AXHA 4HVBA 3D4GA 3W7RA 3HMJG 1XPYA 3HPJA 2EAWA 1E4MM 3B7SA 1JWUB 4A7TA 3DVFA 3EZ8A 4HU0A 4Y1AA 4JQ1A 4Q9QL 3MA7A 1EEYA 4X50A 3FNDA 2WSPA 1WXJA 1TVBB 2ZSVA 1CW2A 1QNVA 2RJMA 4XVEA 3QFEA 3V10A 2Z2AA 3Q48A 4DTGH 5D7IB 3BSMA 4QT5B 4HUUA 3NM3A 5ACLA 1GKQA 3TYUA 1P9MC 2G0WA 4PL2A 1OTSC 5BQ7A 3WI9A 3FB8A 1I1YB 4IIDA 2K0RA 1G4MA 4WY0B 1QMLA 4JRWA 4HNTA 1AQDB 4IMKA 1JZGA 5LCVA 3U83A 3O8XD 3O4LD 1NIUA 3CZ8A 2NY1B 4MKMA 1KQYA 5B38A 4GYPA 1URLA 4FFWD 4C6BA 1ADQL 3FCUB 4XNYH 4LLQB 5D4JA 4NI8A 2OTUA 1E4XI 1FHGA 4PRDA 5GGRY 1NC2D 1TJHL 2WUCH 4QIUA 5H8MA 4L1LA 3CASA 3OZPA 1GHFL 1TTQA 1E43A 4EI5B 1GQJA 4V2XA 2PDGA 5D7JC 2VQ1B 3UTQB 3TEYA 3R0MA 3VM5A 5JW4Q 5EFFA 2ZPKL 3UZ5A 4IGNA 3U57A 1M7JA 3O8AA 4IZGA 1IGWA 2YFNA 4GZIA 4IMLB 3DU0A 2Y24A 5DSCB 2Y63A 3OF6A 2DQXA 3TWAA 4K7PL 2PBOA 5HHVL 3FTWA 3J7HA 3PZ9A 5DMKA 3BO8B 1EQCA 1VPQA 1KV5A 4Y8AA 4PGEB 1CQYA 4WTXA 3WL9B 5DQDL 2JALA 3STZA 4CN4A 4JHMA 5JDSA 2WIMA 4XVJL 4LE8A 3QDAA 4DYEA 3BL3A 2BNUB 2AJ3B 5E6IA 1NWSA 2Z27A 2AKRB 5E4AA 1ZHBB 3MV11 1TZHB 3WKQA 1CCZA 1WDDA 4TTUA 4OZGB 2RGLA 2AEQL 3WFCH 1LO4L 2DQIL 3SDXF 1I1AD 4PGDA 3RU8L 1F8TH 4POUB 1MAMH 1EMTH 4TNWK 2YA0A 2V5RA 3DBXA 4V2CB 3CLWA 1LEIB 3U0TA 4JKPL 5FEPA 1ZP3A 2V63A 3NO3A 3G5ZA 4P59H 2ADGB 1B4LA 2VWEE 3D1MC 1TJIL 4FK9A 1EEQA 5D8JH 3W0WA 4R83A 4KEZA 1QT1A 1JXJA 3B9KA 3PQYA 1JZHA 2Y3AA 4KWSA 3SDAC 1NMAH 1R3TA 1M42A 4GG8A 4GXMA 4JGNA 1YUHB 2EXYC 1QFUH 2UUDH 3ABSA 2ZOUA 5L4FA 3U4AA 1UR0A 1NIBA 2VYOA 3TYFA 5FAAA 2B2XL 4CSSA 1MRDH 4IMGA 5AW4B 1NC4B 5HHQB 3IXTA 1QSEB 5CPQA 1J6OA 3BFQG 1L6GA 6PCYA 5EZOL 1Q9WB 1LL4A 2C1HA 4IOSA 1S5VA 2VMEA 5HHNA 4KY1H 1DCEA 1PVHA 1DE6A 2R29A 3ZFHA 4RISL 1FFNA 2NY4B 4ORMA 3ZGIA 2J9XA 3QT2A 5CWSB 3REQB 1VKFA 2YLHA 3HVDA 3BZJA 2NZLA 1TQTA 3P4LA 3KVMA 4B91A 2GTQA 4WHTB 2X9XA 3T0VA 4PC8A 1C7TA 1GKOA 2WQXA 3MV8E 1EJRC 1O7DC 4XUYA 1UM5H 4XC3L 2DQTH 3KPRA 4YAQB 3W1NA 2CR0A 2GIMA 3BIKA 4QRNA 1AD9B 4UANA 3MO4A 5CAKA 5D1ZA 1OY0A 2NV9A 4EOWL 3B2UC 1ZLDA 4Y16A 3NT0A 5CSRA 1ZJIA 1GHRA 3W9EB 3MI2A 1DWIM 4IGBD 5LNRA 1E8XA 4KNUA 4G1KA 3PGFH 3MLVL 4KKLC 3MRGB 1IBHA 1MJ8H 3S88H 2BRRH 2JCCF 2PO6B 1UEYA 4P4KB 5A2LH 4YHIB 5F71A 4Z77B 1E4JA 2YLAA 3KYKH 2PDMA 5B1KA 3L67A 1OFOA 2WIIB 2ARJB 2NTSP 3FYYA 3K72B 5LBVA 4RETB 5ETUA 5MENE 3HJZA 3NEEA 7ENLA 1XAKA 1FORH 2ROYA 4F79A 1AOHA 4U3CA 3T4AA 2NSMA 4G7EA 1AZVA 3STFA 4PGCB 2XIQA 3AQZA 2EZ0D 1DVUA 5I1LB 1BQHG 2PCFB 4MDIB 4FYQA 2A9ML 2FHBA 2BOCB 2A9CA 4OCSL 2XTJC 4PJHB 4DZHA 4G43B 3OBAA 2ENQA 3I6GB 3FUNA 2GIXA 4O57A 3BQVA 1OAYH 2VSDA 1A5NC 3L4UA 1J5TA 5C0AD 2D0HA 4D0BA 4ENLA 4Z2IA 4HJ1A 4YHOL 3CAVA 3N40P 4I3RL 2KQMA 1BV8A 1J8SA 4OR1A 1R9ZA 1NEZB 2VLJA 2VDPB 2SEBB 5F7EH 1SW7A 1N26A 4NZDA 4KDTA 3FPXA 3GSQB 4WHCA 4Y2DD 3QXDA 4NLHA 1YIXA 2BSDA 1SLXA 4FQJL 5I17A 1HJQA 1AL8A 1UB6B 3SDCA 4C6MA 3LN4A 2W92A 3EZJB 3C08H 4PJ9C 2WAHA 4ADJA 4DN4L 1WKFA 4GRWF 1UWTA 2IGTA 5IW6B 3DTXA 4HU3A 3S6CA 3W7OA 1DBBH 3IK2A 3UPRB 2ENSA 4CSTA 3WQPA 1ES0A 3EF7A 3BEVB 4KMQA 5IB5A 4LVGA 2I17A 4LSRH 3ZDZE 3S3JA 2BASA 2D23A 2F2KA 3GR7A 4HQVA 5AALA 1OAQL 4OM0H 3IDXH 5FF6B 3PHAA 1R3LB 3NCWA 2L7UA 3RX7A 3DSFH 3UH8A 4E9WA 1G4PA 3EMCA 2D7OA 4NYLB 2BTMA 1MPAH 1HYSD 3U46A 1A7QH 1OHLA 5I1HH 3PIQB 2Z4TA 3U36B 4OGZA 1CLOH 1CLZH 4F9DA 3IWPA 5C07B 3MGAA 3MRJB 3A5VA 3POHA 1M57B 1RCYA 3APNA 3N11A 4OZHF 4KJWD 1CIDA 1XH3B 1DXIA 3L3JA 6REQB 3VAVA 2PW2A 1H0IA 5A6BA 5D05A 3RBSA 3LQLA 4HPOL 2CE6A 1IFHL 2NYKA 3C5ZD 3TZVC 1KB3A 1VFAA 4AD5A 3GG1A 2X10A 3TMQA 1M3JA 2J1ZA 3RF9A 3KLHD 1JNEA 3VFMB 4YQXH 5AEAA 3WJSA 4WKFA 1TQVA 4M82A 3Q3GB 4IIGA 3P60A 2YAMA 2ZXCA 3QIUA 4P2OC 3D33A 3S9DB 5TJWK 1H0DB 3PNZA 4GGBA 4HA4A 1MCQA 1T7VA 2QXWA 3WE6A 4KZDL 2HUHA 3PDDA 1KENL 2VYRE 4XPGL 4OUUA 3FIGA 2QMJA 1H3VA 1ZT4A 5CJBA 3QWRA 4X4ME 5DEJA 3S98A 3CUGA 3Q8CA 5K9QI 3MNVA 3QORB 4KGLA 2VL4A 1LT8A 2PAJA 2B7NA 4N68A 4LX4A 1JZ7A 1W8OA 2K4AA 4HXBL 1XSJA 3QQWA 5JNYB 3NQBA 3ETBF 5BXFA 4AD2A 4R9OA 5C0CD 2P52A 3KZ8A 2ESVA 4ODSH 1A49A 4KAQL 5K69A 3V0TA 2X4NA 1FH8A 1FVEA 2VDKL 1E1CA 2EG7A 3W0KA 4LASH 4XNXH 3TFCA 1WAAE 5DJAB 2IVFC 1MFBH 3NAVA 2J1KA 1B57A 3SDAB 1FGVL 2BP5M 2DD8H 3BT2L 3WV0A 5LGXA 3VFNA 3ZMRA 1F3WA 1U3NA 1LDSA 1O5XA 4F8TA 3WQ5A 3KE0A 1K3IA 3OVGA 3II2A 1DBMH 4MJ4A 2CIKB 2QR6A 3QIWA 3KM1A 1H3PH 2MKWA 3FU7B 3RPMA 3A9BA 3EUDA 2AQ1A 3HS0A 1OP9A 4UMAA 4WJ8A 4U4MA 5LAXB 4C56B 3GHBH 4L5ZA 5DDHA 4YBQC 3L8QA 2J88H 5GRUL 2IBBA 4ENEC 3BOLA 4LV9A 2EE9A 5AKTA 4J5NA 3DEQA 3QYMA 2CC0A 5FV1L 1EP1A 1X5FA 4GP4B 2GAZB 3QIBA 2YD5A 4OU1A 4ORGA 1W1ZA 1WFTA 4F8OA 3ZUNC 4DFIA 3GC2A 4NM8H 4XN2A 4FD0A 3ISRA 1DVSA 3F00A 2NXZD 4FI7A 4HIXH 3UT0A 1HCVA 3QJVB 3ASWA 3XIMA 4GKTA 1BYAA 1ZSDA 3QHZL 2BVPB 2WJ5A 4YHGA 4FQHA 5BUPA 1OC7A 3O3EB 1A5CA 2Y72A 2IKHA 5T1LD 1KCZA 2XZQL 3ETTA 4O53A 1YY8B 4EAEA 5EOTA 4FABH 3T8XA 3BP5B 3NJNA 3Q44A 2IPTH 1VLXA 4YTTA 3IIXA 3WS6C 2DYSB 4HMNA 2P8BA 1EV2E 4ZFCA 5AW9B 2X89A 3NGJA 1FH7A 4N3TA 4FSAA 4IGHA 2JK5A 4PUUA 3MZNA 2CUAA 2OEJA 4H9MA 3SUTA 1PAZA 3WNKA 1IC4L 2DFAA 2V7HA 4DGYL 3HV8A 4Z7OB 4WEBH 3QEUB 4LW7A 1BWVA 1DIEA 1FLTX 2CZNA 3WHXB 4L3FA 3DYMA 3PUCA 4PJ8A 2JKEA 3ZTNL 3VNZA 2D24A 4N0UA 4AT6B 4BJLA 1H3XA 1NDGA 1O7SA 3BPNB 1F61A 1NBZA 4ODHH 1YPXA 2DMKA 1FNFA 2VFEA 5F0LB 5CINL 3MKGA 2F58L 3P3SA 2XWEA 4BWUA 3VIJA 2HLAA 5B1JC 1Z7JA 4X9HA 4CEXC 5C0DB 3FBQA 3VWJB 3IWUA 4WUUA 1YRRA 1ZE3C 3MRHB 1MH5B 1W80A 3WNJA 4DF0A 3R1ZA 4F3HA 1H41A 1A4JA 5ESVB 3CPLA 4NRYB 3VUSA 2PD5A 1NGWB 4HWBA 4M7LL 2CAKA 4N85A 1Z48A 3NCJL 3W0WD 4Y9EA 3AAZA 5EBLA 4NXSA 3TA9A 3ARGA 1H62A 3AY4A 3ARQA 4LSDA 3BJSA 1R2TA 4MJIB 3I9GL 3W7EA 3HPLA 4J3OC 5I28A 4PRBA 3OB8A 1J9RA 1C16A 3H26A 3WYZA 5E9DB 1ZT1B 3PG2A 3C0SA 4NX5A 4U6HB 4JPKL 5ANMB 4B90A 6TIMA 1JCYA 1ONWA 5DX7A 3N14A 5DD5L 1OCWH 1SHMA 4XXDA 3QZWG 1CICC 3SKJL 4PTVA 4IOSD 3SSGA 1M6OA 4RAUB 3EYOA 1HWGB 3BZFA 5FYLH 3WK1A 4X0KA 4N1CA 1NFKA 3PPSA 2XVPA 4ADTA 3X1FA 1JGIA 2ZRVA 1B3VA 1F74A 3TBCA 1VF8A 3CYVA 3F5WB 2QHRL 3WKML 2UYLA 2BFVL 4H8UA 3X14B 2ICWA 3DPDA 2J24A 2ERJB 3BPCB 1PCXA 1RJRA 5I30L 4IM8A 3ITGA 1Z44A 2YMXH 4XCCH 6XIAA 1GY2A 3NIFB 1XR9A 4AHPA 4HV8A 1P6FA 4YCPA 2BSCA 2HXUA 1HI6A 5E2JA 2VLKA 2VLLB 4OBTA 1JDAA 3ZYJA 1W8SA 3QB7C 1YAZA 1GGIL 5C0NC 1K8DA 3L5XH 4MX7A 1U93A 4IXXA 4D9RE 4KI5F 4YBLB 4DZBB 1EX0A 1CZ1A 1XGTA 4PG2C 1Q9LB 2R69A 1HQRA 4Z0BH 5L6UA 1O6IA 4AKOA 3TZVB 5HDBE 3ECUA 3WIFA 1QZ1A 4P2QE 2GJRA 4KNQA 3VINA 3ORWA 3LYEA 4ZBCA 5B8CC 3S1GA 2OGJA 5L2JA 5F21B 3D2UA 5L9DL 3QJUB 2BWIA 1HWWA 1WD9A 5GGVL 3ABXA 3G6JE 5FK9A 2DM4A 1A3LL 3ZHKA 4NUMA 3VI4F 3OHIA 5EO1B 3GNPA 3M5XA 4RMUA 1U8LB 4HUVB 2EO7A 3LCXA 1FP5A 1UKOA 3CV7A 4H40A 3CVHA 2P1YA 3WTYA 3CHVA 2B7OA 4V27A 2WHLA 4JN1H 1TLMA 5CS7A 1TIUA 4L3EB 1EQWA 4PBDA 1A6WL 1A4KA 2V5LA 2H8PB 15C8H 1Z42A 1G9HA 4HIBA 4GFIA 5D93B 2VKWA 1U8KB 5IHZA 2Q01A 4IMDA 5BCAA 1NCTA 4J4PA 3KYNA 3QR0A 4TNVK 5E8EB 1QLFB 2X9WA 3TFXA 1ISYA 2YFOA 1KO0A 1F6FB 3URBA 3C4UA 1WBYA 1SZGA 1E7UA 2IANA 1TWDA 2JKTM 4AMXA 3WTSA 3IRZA 3EH4B 2I25N 1VCFA 3VFVB 3N4FA 3HS8A 4HEMA 1UKPA 3RWDA 4PB3A 2JK2A 4WKZA 2VLJD 3ES6A 4JFEB 4QHMA 3UBPC 3IJSB 4UILH 3HOJA 5TH2B 1YPZA 3O81A 2XWJB 4I88A 1W5QA 1LG1A 4BFBD 4NKMB 4GKLA 4RX4D 3SRHA 4P2RE 3ECQA 5JO5A 1NUFA 2XISA 4NGHL 5LUMA 5F3FA 1TJPA 4QGYA 1X5YA 2Q6WB 1VPOH 5LGYA 1KIRB 5CPMA 2Y0SA 1CFNB 5AW0B 3W7GA 3MGOB 2XI9A 1Z66A 1AKJB 1LMKA 4P57B 5IEKA 4PZVA 4OTKA 1P1ZA 4CVXB 2DQ6A 3TWBA 3R94A 5EIVA 5A16A 2XX0A 3FB6A 3AS0A 5K9JL 1MJUH 3ARFA 3DRTB 3TN0A 1VGKB 4CDHA 1OARH 2J8HA 1GC1L 3PHOB 3E9AA 4UMGA 1ZGLP 4LESA 2B14A 2F8IA 4P8XA 3WLNA 3WBYA 5BRQA 5FIPA 4P48A 4WDIA 2WJFA 3FK4A 3ZKXB 5DZOA 5CIPB 3GSUA 2ZRWA 4X7SH 2OYMA 4O1EA 2CQVA 4LBEB 4IFKA 5EOCJ 4W9GC 2WBXA 3OJDA 4O02H 1T2QH 3B4NA 2MQ3A 2DV0A 3RL2B 3FA4A 4WCJA 2VABA 3LKSA 4HH9B 5KVGE 1QW9A 3FQUA 3LCIA 3O3AA 2ICWJ 1NFDA 3VFRA 3QUMB 3UCQA 1Z9MA 5I66B 3LKOB 5A6BD 3DOSA 2QR0A 5BV7B 3C2FA 1ZTXE 1HKWA 2EAEA 5E00A 3CLEH 2F1BA 3QNXA 4PH8A 5JHDE 5GNXA 1R3QA 2C0AA 1DQMH 1I1RA 2YCIX 3HNVH 1XLLA 2ZKXA 2DQWA 3K6SA 4TMBA 1EDHA 2R4RL 1RY7B 3TIEB 4AVJA 4NHUA 3OX8B 1H9VA 5KVFE 5FKYA 3N2XA 5HGHB 3QIUD 2CWNA 1ED3A 3VD2A 2EACA 2J9ZA 4QPEA 5LQBL 1SFDA 4YX2H 2YCKX 3A3WA 4DNMA 4FX6M 2Z4QB 4HSOA 1H4PA 3FONB 3CLFL 1HP4A 4MNHA 4OD3L 5C8JB 2VEPA 3MX0A 3QWRD 2R1LA 3FFCA 4PJAA 1EA9C 5DZAA 2Q10A 4GAJH 2RB8A 4OZ4B 3SBRA 3KL5A 2AMXA 5TQLA 4NJAH 1AIFA 5AZ2L 2YBTA 3WFAA 4H13C 4JB9L 1QWHA 5ICZA 4I7ZC 4JKWA 1CDCA 5DU7A 1G4TA 3K6DA 5B38G 1OBAA 3BD5A 3BCFA 5K59F 3IETB 2CLHA 5HJGA 2F53D 5FI8A 4JD4A 1N8FA 1QNQA 4XMLL 3KPNA 4M00A 1PF3A 1VYPX 5TE4L 3F7YA 4H0HB 4M8UA 3WXVH 2BVTA 1OQFA 1WLHA 3ABRA 1C9WA 1NJJA 5DJ6A 2GPTA 3GW0A 2P5EA 4PWFA 4E41E 4ROPA 2YZ8A 3V5CA 3DVGB 5C6WH 1T1XB 4A29A 4R90L 1IKFH 3B0VC 4F9PA 4HALA 4MJJA 4MS6A 3OKMB 2NX5A 4AG4H 4NCDA 1E56A 2Y8KA 5L0QC 1BX2A 4LBRA 4AZ8A 1JPFB 3ANVA 4E9YA 1ZA6B 1G7IA 2ESCA 5EU7E 1TZZA 2CO7B 4LLAA 4EZLA 3TEZA 4A3YA 1PWLA 4TUJB 3KL3A 1KACB 2YEQA 3OHXB 1AHKA 3MV9D 3RYMA 3VXME 4IDLA 4BFOA 4XO8A 3BAEL 1YYCA 4ODTH 3LPFA 1TKWA 3O2WH 1HDMB 2DZTA 3GBEA 1KN4H 2FO4B 3RWCB 3SQMA 3QIBD 4I0PB 4HKJB 5MERB 4D0DA 2O1AA 3SDDB 2NLJB 1KYFA 3B9AA 1KC5L 4JMNA 8FABA 3NIGF 1SM3H 1EAJA 3MCOA 4PHXA 1OAZH 2X0VA 3GKAA 4OIIL 3U1SL 2DEWX 3E74A 3QS2A 4GP5B 4LQ1A 2J2ZA 3T40A 4WO4C 3YPIA 3QQDA 1F6AA 2YIHA 2BNJA 3WK2A 5IP4A 4DHLA 1NCBL 1JNJA 4KDWA 4OV5A 5FO7A 3MZ2A 1AE6L 4NKDB 2WNZA 3QV6A 4JIIX 2EINB 2RDXA 3Q6GL 5J89A 1G1KA 3AYTA 2RQEA 4X6CE 2X89D 4CQAA 4NHCL 2X1SA 3G5YB 3GSVB 4C6DA 4XZWA 2ZTJA 4Y7MA 3KLKA 4JPWL 4P8QA 5AC7A 4A63A 3HHSA 5FJIA 4H6KA 1H9DA 3N42F 1RK1B 1Z9AA 3QUZC 2NNAB 4QNPE 1IWAA 2I7GA 1MEIA 2NTFA 4OZIA 3U5YA 5MEPB 1LZOA 1P5UC 2BK8A 4AGPA 5C7VA 5F7AA 2VN4A 4B5SA 4GY0A 2E75C 3IF1A 1TG8A 2XWDA 5C2BL 4JZ5A 4L1HA 1OC6A 3SYAA 2HWZH 1HESA 2UY3A 4I1PA 3EO1A 1V6YA 1EZWA 1BQUA 1K4CA 4RE0A 2QV2A 5HR7A 4LCWD 1AO7A 2DF3A 1HOCB 4A37A 4NM4H 4WUUD 4F9JA 5ICYA 3P9WB 2CERA 1RERA 1QTWA 3S48A 5INDB 3U2EA 3FRUA 3GPEA 3UZEA 3R0KA 1JV5B 3CH0A 4I90A 2G5WA 4F7MA 1Y6KR 4OLVH 4KRLB 2A73B 2IPKA 4XD5A 5TF1H 3VIKA 4FR1A 1IGCL 5GGTA 3OLDA 4JX5A 3UAJD 4H88H 1BJ1J 2R1PA 2JIWA 4S3CA 3B1TA 3QNZB 1QNSA 3SN0A 4JEJA 3UZZA 1UXLA 2ACRA 3WJXA 3VGFA 5I23A 1A1MA 3TEXA 3RVWD 4QGCA 1UG6A 1J1OH 2JF6A 4GA8A 4FQCH 4Q4EA 5L2KA 4WVXA 4GACA 3FXIC 2R23B 4ZOAA 4OW6A 3EZ4A 4L4JA 3REVB 1TLKA 3BGAA 5LBSL 4AXWA 2ED9A 1KJVB 4GC3A 1FHDA 4JTEA 4CRPA 3W56A 1YN7B 5FYJE 1GW6A 3ULUF 4G8EA 1U1HA 2FR4B 4ADUA 5I6PA 1BXNA 1B3XA 3NJXA 3VFOA 3FU6A 1CVSC 4RMBA 3NEVA 1RHCA 4QDPA 4XNMB 1TPXC 1DORA 4AE0A 4JL1A 1G87A 3NCFB 1OV8A 3EUUA 3VJ6A 2VXQH 1WWAX 4JBSA 4PJDE 1R5VB 1IM9B 5T1JA 4DJED 1Y0LB 2JF1A 3WEXB 4B9JA 2XN0A 2ZTBA 4U1KA 3D3VA 4S1DD 1UACL 1S5NA 4JHAH 4PRRA 1LVEA 2DSZA 2GLKA 2ZZ7A 4HIPA 4NQDE 1A53A 4AF0B 1NTHA 5HHXL 4P7RA 1A1NB 1S39A 5F93C 1S6NA 3JWDH 2ZKWA 1TWSA 4WRHA 4KKNA 2O5ZL 2FUQA 2QUVA 3HB9A 3MR9B 5D9OA 5TIMA 5DRXB 3OZ9L 4RV8A 5F2LA 1A3RH 2PLMA 3DNKA 3N4AA 3ZU8A 1G94A 1Q6OA 5EZJB 4ERIA 3JZUA 5E1AB 1JI1A 3T0ED 5C2CA 3O0RL 2EYSB 4JZNA 1L2UA 2FWOA 3RGTA 2IQAA 1GYWA 1XTLA 4X3ZA 4D72A 2E1DA 1RZPA 2AOSA 1UKSA 2NY1C 3IPFA 4CA4A 3PLYA 2APBA 3D52A 4NNYA 3BW2A 4E42B 1OAXL 5I8EB 1XCQA 3VFWB 2VDMH 3SCVA 2B31A 3E9UA 4Y4HA 1K6QH 1N59B 5LIWX 4NNBA 4DLMA 4EMZA 5BRZA 4JHWL 4EI5C 1H8LA 4KRMB 4FTVA 2P50A 3PWUA 4F3FB 1CNVA 2N59A 2WWMD 4J4PD 3DXAD 4S3DA 3PAOA 4MNLA 4FQ1H 3MN8A 2FQDA 1DWFM 2EEDA 3TFKC 1AL7A 4LSUL 5H4YA 3RL1A 2X6AA 4GH3A 1HHKB 1XHHA 1ZJAA 4GRMA 3TT3L 3MI3A 4L8BA 5KAQG 1LQ0A 2A38A 3G3MA 1OQXA 3U4KA 2OMUB 2WBJA 3EWWA 4U1LB 3FJ6A 3LS4L 3B37A 2KDYA 1AW1A 3L7EA 2D9QB 3OPUA 2NXIA 2ICEB 4LAJH 3RBGA 2UV8G 1MSSA 4MUZA 4BGLA 2OTPA 4NUJA 2X2JA 2ZC1A 2YO3A 2BVYA 3L3DA 3U0PA 2XPZA 3B56A 4HDIB 3DHJA 4LDEB 3IVKB 1WT5C 4U7KA 3FOLA 4GKNB 2DLHA 1ERNA 1ZANL 4W9JC 5G2HA 3SCQA 2WJ7A 4QS5A 2ISFA 3BIAX 4F2FA 1SHXA 3HUJB 1CFSB 4WIWA 4R4BA 4AGOA 4ZTEA 4JRYB 5ABFB 3ITLA 5L0QB 3V0HA 4I9WD 3F2BA 1AGFA 1P4BL 5EMMA 5GS3A 4UWMA 3LH8A 1OTUD 4XPFH 5SX4H 4LCCA 4LAZA 2Y6SC 2HUEA 4XMTA 1JFQL 2GOKA 1KG0B 1NP2A 2MUCA 4RE2A 4BKNA 4PWJA 4M6OH 3FQTA 3KPQA 4X99A 3UWEA 4WD0A 3KCJA 2ZYHA 1ML1A 1WYIA 3N6JA 2LAGB 3MBWB 5AAMA 3UPBA 5JZ7C 1EJFA 2QQKL 5I1IL 2WLIA 1XGPA 1J1XL 3EMZA 2UWEF 5EBWB 1DZBA 5I3GA 2PCPA 1KLFB 2DJXA 3F12B 3RVTD 4KCWA 1NMCC 4CBZA 2Z1KA 4E5XB 1BF2A 8A3HA 4GRWB 2ZWSA 5F8RC 3RUBL 4RAHA 4FKHA 3IS1X 3MLWH 4WWKD 2VKZG 1X3DA 4LARL 1G7JB 4XQ6A 4DKEL 5C09A 2D2JA 3W29A 3NQIA 4BE6A 4PUEA 2MPAL 3MRMA 4O8AA 1S9XB 1NPUA 4X5PA 2HTLC 2DP3A 3ZKMD 2YC1A 2WNKA 4PP1D 2NQ9A 1G7PB 4MRCA 1S7TB 1S8DB 5IHWA 1S2WA 4O52A 1PSKL 3NO5A 1JNLL 4OLZH 3WSQL 3FGCA 3VVWA 3DX0A 4KH9A 3NPUA 1INEH 4P3DA 1E40A 1F00I 5DA4A 4GKZA 1YECH 2ZCKL 2OMNA 3U9WA 1XIHA 3O4OB 5TPWL 3BAWA 2KDGA 4XOEA 4Y0GA 1JCXA 4UUIA 4N4YB 2BW5A 4FFYH 1WOAA 2W0FA 2CMRH 1BQLL 3KBVA 2PO6C 4P4KC 5AL8A 2V2WB 2QW5A 2W81C 3GXDA 2A6IA 3MYOA 3HR6A 3RMJA 4DZ8B 1MFAH 2YZ1A 3AIUA 5AUMB 4H5SA 4U4BA 1NOAA 3V4PH 4DBDA 4N90E 2FJSA 2EDLA 4TPRH 1MDLA 2QKSA 1RPXA 2IG2L 3PWNA 2AXJA 4QY8A 1TETL 1JTPA 4QOKB 1A7OH 4P23C 1KM1A 4Z17A 1OM9A 4XWOC 4NQXB 1PS9A 5IFPA 1TU2A 2MNWA 4JHZA 2NDGA 3ZDYF 4DETA 5LDSA 5GRYA 4DLFA 5XINA 4HJTA 2IXVA 1E28A 3MQTA 1ELSA 3BJLA 2P47B 1PFOA 1JNHB 3BI9X 1K4DB 4X8JB 1TQXA 4DP5X 3VXRE 2R1WB 3LV3A 2WV8A 4R26H 3MRDA 5D2LB 3GEWB 2F54E 4HH8A 1WFMA 2Z7YA 1ISVA 3WHE1 2NX5D 5LN4A 4ZO6A 4G8FA 1JWSA 2PDQA 5HJ3A 3FQRB 5GJPA 4NFDA 5L6YL 2AL2B 1HGWA 4A67A 1SO4A 3LDVA 4XVTH 1DQDL 4U2YA 4WU5A 4GPVA 1R3VA 3B9NA 5E8NB 3Q8EA 3OKEA 3JV6A 4A05A 2VZOA 4EBQH 5D32A 2BP1A 4U3SB 4W4OA 4LT9A 4P5UA 1PEWA 2HXAA 4XN7A 2DQDH 1ZA3A 2Z93A 1EJSC 2EYRA 2P1FA 4S0TD 4A2FA 3BH9A 4DGUA 3W2DH 4C55A 4ORZC 3WFHA 4F58L 2KYIA 3PV6A 1ZVNA 4XP4L 3ZHDA 5C97A 2VDKB 4AZIA 1TO4A 5CPNA 3C0QA 2PC4A 2Y3NA 4RNIA 1A4MA 4X9IA 3P7YA 3MOAL 2V17H 1S9YB 1YEDA 4DERA 2QKIB 4LLDB 4NUGH 2A1WL 4W5ZA 4IRZL 2D4FA 2Y2TA 1LNUA 3HBLA 4KXCA 4ZMLA 2ORBH 2YSWA 4OCRL 3QN3A 4L2LA 4MHBA 3T2OA 1DN0B 1PZDA 4N0RA 3Q65A 2VO5A 4KU1A 3M0XA 3EFDL 3G24A 5ACMA 3SAZA 3SRFA 3HMXH 4PTXA 3RWFA 5GJSH 4GRLD 4ZZFA 4CL7A 4ECLA 3AQXA 4ALAL 4GZEA 4M4RB 4DN3H 5JOFB 1GC1C 1EWEA 2X4OB 4NRZB 3F4DA 3DSNA 3VNDA 3ZRFC 2EO1A 1WZLA 1ZLUK 4PLKC 2A1YA 5TBOA 4OQTH 4QGTA 1K4GA 1QSFB 1NGYB 1XDJA 2ZAIA 2IGFL 5IJKC 3OVUB 3L7FB 1KLGA 2YOAA 2GDUA 4OM1H 3WHE0 5LVEA 1ZVHA 2WZMA 2NVAA 1HKJA 2N1KA 4WHYG 3W87A 1NKRA 4JPVL 3OG2A 4WFHD 3WK0A 3T9WA 5DHVA 3BQ5A 1RZJH 3MMDA 3O6KH 4IBZA 1X5AA 2UVEA 4M6NH 4GO6B 4GXPA 1TMLA 3QORC 2K45A 2QZRA 5CJXC 3NZQA 2PKDA 3GC4A 1Z3NA 1IGML 1XIWA 2LQRA 4LFYA 1DLFH 4UB0L 1SY6A 3VIHA 3WQEA 1U8QA 1FG2B 4PY7A 3GC3A 3G9AB 1YBQA 3EGDA 5L2KD 3IFNH 4L5FH 2X4QB 3V5DA 4Z7NF 4NQCA 2NT0A 1J8HD 4JQAA 3UNTA 1KGCE 3U79A 2VM4A 4WDUA 1SYVA 3M7FB 1E3XA 2DWXA 2GIYA 5J6HA 3GAKA 5B3SB 3KDMB 1V3JA 1PD6A 5B1AB 2DWDB 4M5YH 4M6PA 3CDGB 2F1EA 5BMFL 3GMNB 4QEGA 3SURA 2VUOA 2HKFH 3VB9A 3CXDL 4WHDA 5AL0A 3SUUA 4BEQA 1XF5B 3V3WA 2DJSA 5AG8A 3D39E 1E15A 4IH3A 4F80A 1KPRB 4BV1A 3K46A 3B03A 2PP0A 4QHKJ 1OZMA 2AQPA 2E68A 4BXVA 1S5HB 1LTXA 1TSIA 1TPVA 4EXPX 4R7DB 1C8XA 3KPSA 1B3WA 4GMEA 4DXVA 3DROA 4DYJA 4L4TE 2VM9A 3UTTE 1MVUB 1OEZW 1TFPA 2CJUH 1XCFA 1L8NA 1NMCB 5C0BB 1U2YA 2PCXA 4M5TA 2APFA 2B1AL 4LGXA 1C5CH 4K38A 1QHOA 5D2NC 1A6UL 4YGVA 4LUIA 5IQMA 4GX9A 3HFTA 5LCVH 4H8QA 4M43H 5IROC 1A3QA 3QS3A 5J11B 5LA0A 1K3UA 4UDUA 2AV1A 5HNNA 1BVLB 5ID1A 3NZ1A 1FYTA 1I8AA 2E47A 4M6ML 3GS4A 4WSKA 2AJXH 1NAKH 3HC3L 4GAAA 3E38A 1GZJA 3V79C 4M48H 1H1YA 1B9ZA 1CYWA 4DJFC 3AALA 3K4DA 5HMDA 4TNGA 5LNEA 2EO9A 1NBVH 2HJPA 3E2RA 4WSHA 2W9EH 4U7SA 4H1LA 2WMKA 5KTEL 3ET9F 3ZK0A 3W3BA 4E9XA 5LB1A 2R2CA 1DBKL 2NR6D 1QU4A 1VR6A 4FTVD 4IIQA 5CMAB 2B3RA 4LCQA 1XTMA 2CK0L 4HMEA 2QUTA 2DLGA 4OGXH 3KZSA 1HH6A 3E0LA 1A7PL 5HGDB 5TQ0H 1CZ8H 2Z9TA 3IGXA 1E0VA 3MI6A 5I1EL 1A5OC 2VEGA 2YHGA 4HT3A 4GKOA 3E9TA 3LHAA 4GQ9H 4Z7UE 4HZLB 4MNQE 4M7SA 3FTGB 2IKGA 1I8MA 3F2DA 3WLLA 4YDJA 5IFAH 4MXQD 2WBJD 3RWJB 5JW4M 2F68X 4UQCA 5L8LB 4P23B 1NWOA 3BPNC 4BKLB 2M83A 4KFZC 4XX5A 1OX6A 4US5A 3BLIA 5XIAA 2QPFA 4XGZA 2VX5A 3NPXA 4UR7A 5EEXA 4ZA0A 2VRAA 2A6DB 5DMJB 3G2GA 4DJDD 3FULA 5FFOA 3VWJC 2AP2A 3ZRSA 3DX8A 1T99A 4DBSA 2Y7DA 2P80A 2R2HA 4JDTH 4GG9A 2C0HA 3AWNA 1CR9H 3BJFA 4OV4A 1A22B 2ZVIA 5DUBA 4Q6JA 4W9IC 1CURA 3CAFA 1QLRA 4RZKA 4LYKA 1E50A 3OGSA 2J7EA 2XVGA 2CO6B 1A7RH 5ANHA 4Y89A 3TUUA 2ZT9C 1DQJB 5DUPH 3W7DA 5CAHA 3GLCA 4X9GA 2I5YL 4K3DL 3HLKA 1BD2A 1OPOA 1RUMH 5JW5A 1I7ZB 1I3GL 3RCNA 2E9MA 5F7DB 4PODA 3JVGC 1R5IA 3GKZA 4GO8A 3R4DA 1ZTMA 1S2CA 2WGXA 5E5UB 3UJJL 3C09B 1GSMA 4ETQA 4AQ1A 2MH4A 3X13A 2B77A 4ML4A 4I48B 2VB5A 3WN6A 4HBQA 2QJHA 1JVKA 3EJYD 3TJEH 3K1KC 5JHLL 2YD8A 5IHRA 3EW3B 4QTFA 3WFDH 1OAUH 2P43B 3L3HA 2ATPB 1WWBX 5DI8A 1USQA 5EEYA 2WNWA 5F72S 3L9RB 4JR5A 1FHLA 4PB0L 3OVPA 4U1NB 1U2CA 3NCYP 3JV4B 5KSBE 3SZ8A 4AIXA 2VFIA 4ZMQA 3HKZA 3CQQA 2ERJC 5C09D 1DO5A 1SYSA 2BO0A 3KR3H 1B0WA 3PL6B 2OQJB 1CF8L 5EN3A 3UBGA 3VIFA 2PGEA 2BSTA 3WUWB 4IP7A 4DP0X 2HH0L 1U6AL 3EIFA 3C6LA 1PCWA 5SX4I 3RDTC 1P5VB 3BWAB 2P8PA 1FKXA 3VXSA 3Q7JA 3OZMA 3KOZA 4XD6A 4YBLC 1N9PA 3C6SB 3LZ5A 3QDGB 3ZDXB 1I7RA 3AYVA 3GIZH 4YC2C 4K5OA 4KRPB 2EEFA 4F7CB 1EO8H 3QQXA 2HPOA 5KYYB 1FVDB 4EUPB 4TO8A 1QACA 3L5MA 4OCXL 2BWGA 1X38A 5KZMA 5HHPB 3N4EA 5HINA 2XV6B 1D9KC 5FHAL 2EUWA 3LTYA 3Q43A 4Q7NA 1KR0A 4LSBA 4IMFA 1CS6A 3F3HA 5H2BB 1RZFL 5JW3H 1FBAA 2PSNA 3QR3A 2XGIA 3EWYA 5AYIA 2E5CA 2PGRA 1XIGA 3QQ3A 1M7OA 4YN3A 4KESA 4LS2A 2BNQE 3GJFK 3GMMA 1KB5L 3KP1A 2ISWA 4X63A 2FD6L 2GBVA 2H3KA 5AD0B 1IQ8A 3MBED 2HLFD 1PD0A 1CBVH 1GQLA 5FJPA 3W6LA 5D93C 3VRIB 1QHZA 4NZUH 2WHMA 5AB2A 1FFOA 3TXVA 2KC0A 1H15A 4Y5XA 3LZQA 4ETYA 4QTGA 1NLBL 2QVKA 4MD5A 1CL7I 3WFBL 2ZQ0A 5HHMD 2DW5A 5BUAA 5INCB 1Q94B 1G01A 3CVCA 2YARA 1T22B 4K7FB 2BIOA 5EZIH 3E6HB 1MRAA 4ZX4A 4MXVE 4PS3A 4ZE4A 4NP4L 4CGUB 3TU9A 2WD0A 2AKZA 2DU2A 1QRNA 1X7FA 1YEIL 4FB7A 3MV7A 5CEWA 3VXUB 3GMOA 5BZWA 1CLKA 3T78A 3QLDA 5BXRA 4HHAB 4Z1DA 3UXLA 2A2QT 1ZGDA 5H94B 2CKBL 1SGKA 2FX9L 4JYDA 3SE9L 2NW3A 5DJXA 4DNHA 1S3KH 4D7BA 3DMMA 4G9FD 3GSNA 4N8PA 5I6OA 3CFBB 1TA3A 1YNTB 2LLNA 5A7EA 1J01A 2WZIA 1VACA 35C8L 3U9UB 4Z7WE 4HPYL 3K6FA 3V6FA 4Y1AD 3NXLA 2LFGA 1TV2A 1MJ7L 3C60A 2DZPA 3DX4A 2PPCA 1NSJA 3HTLX 3HQOA 5HHOB 3NP3A 2CDFA 3S36L 1AH1A 2FX8L 1S7VA 4MQ7B 3U48A 3ZKXC 4G59C 4FP1A 4JTKA 1JDFA 2X0HA 4C6FA 5D2NB 3O6YX 2XXCB 4RIRB 1EBPA 5F89A 2VMDA 3M8OH 4PJ5A 4PV8A 5ACZB 4A1RA 5D1XC 3APYA 1Q9KA 3BVWA 1DVXA 1DLHB 4FG0A 1F41A 5MHSD 3J8F7 4KVCL 2QMKA 2XFFA 1HZKA 1LWRA 3DIDA 2EKSB 2XH2A 2VO8A 1XAUA 1OXYA 1J1PL 3V6OE 4X6DA 4YHPB 4WI4A 5CC3A 4TVPE 1FWHC 1AS6A 5BV7C 2GQHA 3FV9A 2XZCL 1A80A 4WUKH 1DL7H 4Y19B 2R4SH 4RESB 3FQ4A 3WUZA 4MAVA 4Z3GA 2PWUA 2FJFB 2GUYA 2P42B 1PG7W 4BSVA 3U4EA 1DQUA 3PNWB 1OYBA 3QRFM 4EPDC 3GY1A 3OF6D 5KANI 1E6ZA 2J71A 3B04A 4D1JA 5IJVB 4WRLA 1NFIA 2VRKA 1DBJH 5ENWB 4JFFE 4FCAA 1VCBC 2WLKA 2J4GA 5E08H 2IUZA 4PG9B 2X7WA 4MSSA 2RR3A 4HPGA 4DO4A 2X4SA 5E6ID 3LRMA 5I1DB 1HS6A 4N6QA 1T0OA 4QRPE 4EIBA 4JTQA 4F2MA 4R0LB 3O3BA 4XVUD 3PJWA 2QTVA 3FUEA 5F6HJ 4IDJH 4J1OA 1J05A 3E8UL 4ERSH 5GHWH 3EOYG 2HFEB 2ED8A 1IEAB 3TC7A 1OGAE 1ZCCA 3FS2A 4WJG3 4LVEA 1R9FA 2CZFA 2GUBA 1FH5H 3B43A 4NNPL 2HFGL 2FZNA 2WINB 1TZAA 2O6FA 1UWEL 1F4HA 2C3HA 5T3ZD 4MZ1A 4WWID 2RA1A 3B9KD 3PQYD 2IDFA 3N41B 3PWPA 1XL6A 4TN9A 3HKFA 2Q3ZA 2OYKA 3IDGA 4J3VA 4K3HA 2QS8A 3LNFA 3C75A 1OTTD 2J8UE 2ZG3A 1AR1D 5D7KD 4YIWA 5JW4R 3NJGA 3IS0X 1D7KA 2WC4A 3ZQ9A 5D2VA 3QFJB 1NCOA 4LDCA 4CMHC 4JN7A 4XZUB 4Y2OB 4GUHA 4I6KA 5CJQH 4H9YA 1UQSB 4OUIA 4IX0A 1IQDB 1HSBB 3OHXC 1T1WA 3LKPA 1TYEB 5I16B 3A64A 3EAKA 4DNLA 5DHDA 2QDEA 4PJCE 3DRQB 4HIHA 4I0PC 5CC5A 1LO0L 3SY0B 1W5MA 3F5KA 4X80L 3I68A 3SDDC 1EC9A 5A8NA 3OR7B 3WBWA 3VKKA 4H25A 4AH2A 1NGXB 4NZCA 3KPRD 4Z7QE 2YCJA 1G1CA 5F4XA 3BP7A 4PSPA 3BSZL 4PLOB 2OWWA 1LO3L 4PS4L 1SFTA 4LS1A 2B8OT 3ZO0A 3RDTB 2V8MA 3EB3A 1AS7A 4DWHA 5F2FA 2J3SA 2M26A 2ZOKB 5D1ZD 4MA7L 3MRCB 3CO4A 3N50A 4Y16D 5AYUH 2WNQA 4YC2B 4UINH 4WOQA 3ELQA 1Z6KA 5LKNA 1PKQE 3ALGA 3E0WA 4BI7A 5DD3L 1XGYL 1Q0YL 1FZJA 5EG6C 1F6LL 6TAAA 1IGIH 4UTBA 2E28A 3HZMB 5DVLA 1F18A 3LN5A 3Q0HA 4M8VA 4L4VA 2Z6JA 1D9KB 1D3GA 1R38A 5LGZA 1ZS8B 3DTDA 2KLRA 4CU6A 4ES4A 1IEXA 4GG6B 3IAGC 3HE7B 3IM1A 2QADD 1UJQA 3T1FB 2O5YL 1MSPA 3GJFA 1JUBA 4M61B 4HUCA 4LSQH 1ID5I 4YHYB 3CN2A 1TWIA 4GQBA 4Z78B 2FEDC 3H3PH 1OCCB 2QDGA 5HMSA 1GGOA 1JPMA 1EGMA 1U8OA 2PTWA 2XG5B 4US5D 4R5VA 4HKZB 2EDKA 4QKXB 1UOVA 4FE9A 1WAAF 1TCMA 1XFPA 1EJ8A 4J1UA 3KWVA 4HWBH 4CU8A 2APTA 2P80D 1EHKB 4AQ8C 1E4NA 4F2UA 1E70M 2XZZA 3BUTA 1DDTA 3OKNB 4B3EA 3G04B 3V75A 4PRIE 3UJTL 3GU2A 1OSZB 4LLMA 4M1CD 4MOZA 1T7LA 3KYOB 1P0KA 5AVWB 3QJRB 1BD2D 5AOUA 4PJGF 1YNYA 3SDCD 3MOQA 3WY3A 1ONEA 3QISA 1GAFH 3QY8A 5EOCH 3LSOB 1Q45A 3BX7C 5EC1A 3NDZE 1TRDA 3CFKB 4C57C 3S4SB 4OOZA 1TTGA 4UQ3A 4CAGA 4L1BA 3UR8A 2CFFA 3DI3B 4MQSB 3USBA 2W07B 3BG9A 5D9MA 1W6LA 1G6VK 3BTNA 3IPWA 1J11A 5IVXE 5SWSB 4W89A 3B5GA 4OLUH 5FW8A 1HF6A 2DN7A 1DJWA 4LRNH 1BWKA 4PJFA 2XN9A 1KN2L 4Q56A 1MDTA 2GQ9A 1RK5A 4G2DA 2HSIA 2UY6A 3JWNG 3VXNB 3ECBA 2GJ6E 2VGLM 32C2B 3VO0A 5J9PA 5EBAA 2NDFA 1P7TB 3W24A 1EDGA 1IC7H 3BARA 3K6NA 4WKHA 5HOSA 4G82A 3TPKA 1BEUA 3H55A 5JOPD 3CSFA 4NAFA 5E23A 3OYXA 4IS6B 1AG0A 2BY3A 2PWHA 1WBZA 5D1XB 2GK0B 4A7UA 3APFA 1GYUA 1WISA 3L7RA 2HVKB 3UTZB 1RIUL 3FO1A 3C6LD 1D6EA 3DYOA 2A5HA 4TKWA 3GC5A 3V2AR 5LA2A 1QPXA 2V69A 3NPWA 4LU0A 4EF8A 2OG9A 4UIOA 3SDYL 3MUJA 1QHQA 1A3WA 2JV6A 1YNLH 3B8DA 3T3ME 1NUGA 1GVRA 1G7LB 1G9EA 2V2HA 3GO2A 1FO0H 1AG1O 2UWEB 2W0KA 4YTRA 2PDLA 4PHZA 3CZLA 4N8UA 4R97B 5LNSA 1DANU 1H7XA 1FH9A 2DL9A 4YSRA 1JIBA 2YPLA 3KLAB 4XNDA 4HS6B 4OB5H 4P2OA 1DOSA 2KZHA 3N15A 1EQPA 1K1DA 1J4EA 4Y8EA 1YJDH 2OR7A 1BAGA 1Z1WA 1AY1H 2I9TB 2VQUA 1RCXB 4FNTA 4GKSA 3UO1L 4ZK8A 3CSYB 4N87A 4QDWA 2J4WL