4PCSA

Crystal structure of a bacterial fucosidase with iminosugar (2s,3s,4r,5s)-3,4-dihydroxy-2-[2'-phenyl]ethynyl-5-methylpyrrolidine
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
439
structure length
439
Chain Sequence
EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Exploiting the Hydrophobic Terrain in Fucosidases with Aryl-Substituted Pyrrolidine Iminosugars.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords Alpha-L-fucosidase
total genus 163
structure length 439
sequence length 439
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4pcsA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pcsA01
1AQMA 2ZUNA 3EDKA 1SMAA 2DQXA 2WC7A 4AW7A 3RIKA 4B9YA 1JFXA 5JIWA 1H0IA 1HJVA 1UKTA 4AZ5A 2XWDA 1AQ0A 3F5JA 1KGWA 3W24A 5I0DA 1E70M 1EDQA 2J78A 3B9AA 3H54A 4Q22A 5BXSA 5A6BA 3ZOAA 5CPSA 1H11A 2OWXA 4W8AA 3CHEA 2OYMA 4W87A 4LYQA 4XZWA 1G94A 2CBIA 2WCSA 1E6ZA 4BS0A 1DHKA 3MANA 3UERA 2CITA 1UWSA 4DWSD 5FL1A 1UA7A 3CZGA 3CGTA 1W9BM 4RE2A 3NIYA 1DWHM 2F8QA 4ATWA 1SZNA 1JL8A 1WDPA 2WBKA 4BQ5A 4YHEA 2YL6A 2YFNA 5DFAA 1AVAA 3RCNA 1GJUA 3DC0A 1W9DM 2VCBA 1JXJA 3CTTA 7TAAA 4D71A 2F1AA 5A8NA 1M53A 3D52A 5BRQA 3FXYA 2W4XA 3AS0A 2UWFA 4NSBA 5A8PA 1LWHA 1WB0A 3TP4A 5CLWA 3GNOA 2PWFA 2IGTA 3GYCA 1JDDA 2XTKA 1IV8A 2DSKA 1XD1A 4D1JA 5EBAA 1H09A 4J3UA 1E1FA 1WCGA 4U5IA 2WXDM 1XCXA 5D9MA 4M80A 4UQ9A 4RE4A 4JAWA 5A6LA 2E40A 2O92A 1SMDA 2G3MA 2VNCA 3VDCA 2ZX7A 1VEPA 3MUY1 4BQ2A 1E9LA 4FLSA 3UEQA 5FD0A 2VX5A 2CEQA 1E6QM 3KL3A 5CGTA 3PZUA 2E8ZA 4KGLA 4FNQA 2D22A 1K6AA 3BVXA 4UTFA 5IFTA 2WM0A 3W28A 2QF8A 1V6XA 4CN4A 4OGZA 2F7RA 3L4VA 4R27A 3VM7A 2A3CA 3WH7A 3ZT5A 3DECA 2JE8A 1E6SM 5HPCA 1TQUA 1J9YA 1ZU8A 2ZOXA 3GM8A 3UG5A 1HTYA 2X0HA 1GQJA 1UD3A 3GZAA 4AD2A 3CZSA 3A21A 3MMWA 3UG4A 1X6LA 3OGVA 3HG4A 4OJYA 2ZXAA 3L2LA 3CHDA 2YDSA 4HOZA 4JKLA 1UKOA 5C71A 3L4YA 2BHYA 3WNLA 1J0HA 1E1EA 1FH9A 3OG2A 2GSJA 1H41A 3WDRA 2JFEX 1BF2A 4FLOA 4PMXA 2GUYA 5EFFA 3ZR6A 1EDTA 1GUVA 3BGAA 3GDBA 3SCUA 5BXPA 5CG0A 2XGBA 3CO4A 3SCPA 2VC9A 3ZSTA 3AIEA 4C7GA 4DUWA 2ZIDA 3H53A 3UR7A 3VIIA 4H2CA 1Z32X 4LQ1A 3WH6A 4KWUA 4ACYA 1CXEA 5HOSA 5JBDA 3AFBA 1CGYA 5BRPA 3DDFA 5I3DA 1E40A 1E4IA 2WCGA 3EMQA 3CUFA 1OD0A 3BVUA 3AICA 3WY4A 3SCTA 1CENA 4F66A 4PRWA 4ATLA 2BVDA 2J8GA 2EACA 3M6DA 2CBUA 3AROA 3WNKA 3EJPA 3T09A 2YA0A 5A3HA 1MQRA 1C3FA 2GDVA 1WNOA 2EXOA 2WLYA 3WF0A 1D2KA 3QOMA 8CGTA 1JZ8A 3M07A 5A6BD 5I24A 1DWFM 3AIQA 3T2QA 4OIFA 3TA9A 2VJXA 3W27A 2F1BA 2JALA 3ARVA 2DT1A 1ODUA 4U2ZA 2D3NA 1HWWA 4WJXA 3PZGA 3W25A 1W91A 3A4WA 2J74A 1OT2A 2XVGA 3ARWA 2Y8VA 3MSGA 5M5DA 2DT2A 2W62A 1BYCA 3A4XA 1GOOA 4J28A 4WK9A 2VQTA 4QP0A 1IZJA 4IPNB 3WF2A 4FF5A 1FH7A 2E8YA 1PZ2A 5D8WA 3O9NA 3AIVA 1LL6A 5IHRA 3S6TA 1JYNA 4U3AA 1W9XA 4NZCA 5D8ZA 2XIIA 1FOBA 3WBEA 1E5NA 1UD8A 2VUYA 3BVTA 3N11A 5CPQA 1BFNA 1JAKA 1J0ZA 3NSXA 1KBBA 3FY1A 4CU8A 2WWDA 4UZUA 1DEDA 4EE9A 2CYGA 1H2JA 3OZPA 4TTGA 2X1IA 1W3HA 2DDXA 4CCEA 4GKLA 1CBGA 4CD5A 1GQIA 1WDSA 4D1IA 1UWQA 1G1YA 4D6CA 4EAMA 4PMRA 3IANA 3EMZA 3VSTA 4W8BA 3LRLA 3BSHA 3GXMA 5GNYA 4IM4A 3TTOA 5E6YA 1T0OA 2NT1A 1GPFA 1KGXA 4AYSA 3WL1A 4BCEA 3L4XA 1JG9A 1C90A 5EFDA 4H8VA 2D23A 3RDKA 3VNZA 2Z1SA 5AC4A 4A3YA 5HPOA 2CKSA 3CZNA 1MFVA 3WD0A 1EIBA 1PX8A 1CXHA 5LYRA 2VI0A 4AZHA 3VDBA 5CJ5A 2BY2A 5CXPA 3WD1A 1CLVA 3VO0A 1V08A 3EJQA 3WH9A 4CN1A 2PWGA 4ZEPA 5GPRA 2O9OA 2O9RA 2J7HA 3AHYA 3SUUA 1G01A 2WVSA 3A23A 1R7OA 2XFYA 3W82A 4MDOA 1WPCA 2XVLA 3LXCA 2FE0A 3VMOA 2XJ7A 4UFKA 3EBVA 2XFFA 1QI2A 2WC4A 3FAXA 2QMKA 4M29A 2NT0A 1E0WA 1BPLB 3PTQA 1RPKA 3D51A 2YDRA 2X0YA 1QVBA 5JIPA 3O2LA 4AZ7A 3AQUA 2XG9A 3F4VA 1US2A 4Z2GA 1M04A 1JZ6A 1WDQA 1H1NA 4JFVA 5I6SA 3PHAA 1NWSA 2YFOA 1XYZA 3GXNA 2BXZA 1FP9A 3CLWA 3EJSA 4PTMA 5I79A 3II1A 1WAWA 1V0LA 3W0KA 2WMHA 1R75A 3AMKA 5FOOA 3ALGA 3VTRA 1G9HA 1H5VA 1VFMA 2VRQA 3EDDA 2J7CA 3GTNA 3PZQA 2OW7A 4D6HA 4B3LA 5ABFB 3HG3A 3RM9A 2XGIA 3MUIA 3VUPA 5A8QA 2C7FA 1JNDA 4JFSA 2CXGA 1KWKA 3KL0A 5A1AA 4B9ZA 4HU8A 3WD2A 4AD3A 1UUQA 1EO7A 1TMQA 3UG3A 2YIHA 3T08A 3MV11 3VOCA 5A2BA 4FMVA 1LL4A 3ARZA 3THDA 3U5UA 2WB5A 4P8XA 1KBKA 2VMFA 2OYKA 1GHSA 4HP5A 1LQ0A 1IZKA 4Y7EA 5A69A 1EA9C 3WQ5A 1BLIA 1R33A 2WVUA 5CGMA 2ESCA 2UY5A 1CGUA 1GVIA 2UY2A 3NYDA 4N42A 2JF7A 3RJXA 1UKSA 3NDYA 3FNDA 4AIEA 2UY4A 1D3CA 1BSIA 1B3WA 1NOWA 3BAIA 2WZIA 4D6DA 4HMCA 2DIJA 3DHPA 5E1QA 1V02E 4AZCB 2VT0A 1KB3A 1UR9A 3PZMA 2IXUA 2QHAA 4CCCA 3VGFA 1E56A 2ZUSA 1R85A 1UR8A 4ZXOA 1B3ZA 4GI9A 4JFUA 1B3YA 3KEHA 3D4YA 3W29A 1HXKA 4E8CA 1QOXA 1UG6A 1MW3A 1XH0A 1JNEA 2BVYA 1RP9A 2BXYA 1NWRA 2BNJA 1UKQA 3A47A 4CN6A 2VX4A 1KTCA 1XH2A 4JCMA 3FW6A 4DO6A 4B15A 3L4TA 4XX6A 1J10A 1ZJAA 1CGVA 1KFWA 3A22A 4H8UA 1V3IA 4V27A 1QHZA 2J7FA 3OLDA 4AIOA 1XV8A 2HISA 3SUVA 4GI8A 2F7QA 2CESA 1BAGA 1JZ3A 2OW6A 3SCRA 1WZAA 3VIGA 4MAVA 4PMYA 1NWUA 4AY1A 5IFPA 2E9BA 1J11A 4CU7A 2X8RA 3T2OA 1Q6CA 1J18A 3VD5A 1HJSA 1QNOA 1K9TA 3KE0A 2CETA 4KH2A 3WDJA 1KCKA 1J01A 1HKJA 1V03A 4PMDA 2VZUA 3T0AA 1E72M 2OSWA 1JYWA 3K1DA 2VZTA 1QHOA 1W1PA 3AS2A 3BCDA 1ECEA 5I77A 3OBAA 2GJRA 5CSYA 2ZWYA 3TTSA 4X0VA 8A3HA 3CPUA 2CCRA 1JI2A 1B3XA 3ALFA 3LXBA 1CEOA 3NUKA 2OSYA 1V6YA 2A3AA 2D1ZA 3BAYA 3KZSA 2GK1A 1NOFA 1TQSA 3K8MA 3CZJA 5I2UA 1LJYA 1WZKA 2G3JA 3WY1A 2G3IA 1HJWA 4GIAA 3A5VA 1TZ7A 4X0NA 3PZNA 4AISA 4J3SA 4AXNA 3CIVA 1FH8A 2BY1A 1H3GA 4H04A 1V3KA 3WDQA 2C0HA 4PBGA 1K9EA 3K46A 4CD7A 3PTKA 1QWUA 1HVXA 5CZKA 2VRKA 1VF8A 4DUXA 1DTUA 1WZMA 4Z2IA 2XUCA 5EMYA 4K68A 1H4PA 3BVVA 5GQBA 1OT1A 4MTVA 3VGHA 4KGJA 3ZQ9A 3VMNA 4WF7A 4HTYA 1GOIA 1MW1A 3ECQA 4PCTA 1EXPA 3CZ8A 3WNMA 1GVYA 4Z2JA 4U3CA 1C8QA 3D5HA 1MYRA 2VOTA 4U5KA 2QMJA 4UOJA 1E0VA 2XIBA 2AMGA 1E71M 3VIMA 2YLLA 3N04A 4Z2HA 2F18A 1RH9A 3AHXA 2WHKA 1V0KA 3AHTA 4JKKA 1JZ7A 1JYVA 4V28A 4UFJA 2XFRA 2WVTA 1JGIA 2XN1A 1JD7A 3T2PA 4DO5A 4UQCA 4FNRA 3RO8A 1FA2A 4MB5A 3VX1A 3EDFA 2J75A 4D6GA 4AZIA 4WKFA 1FFQA 3ARRA 3EJRA 3D50A 3SUWA 1QI4A 1OIFA 3OGSA 1JD9A 2J77A 3G6LA 4NXKA 5HNNA 5IXEA 4MPKA 3VIPA 3AZSA 4AC1X 4E4PA 2Y5EA 1TR1A 1H49A 1V3MA 1MW2A 4TVUA 5E6ZA 4HPGA 4CKQA 1TVNA 2YL9A 1E4LA 1HJQA 1HJUA 1U33A 2WVVB 4UZSA 4PSRA 3GNPA 3GXTA 1Y7VA 1F4AA 1CTNA 4AMCA 4PSPA 3DYOA 1GJWA 3FHAA 1QNPA 3I3DA 4AZBA 3CMJA 2VO5A 3VIFA 4GZIA 4NZFA 5KEZA 1LF1A 5A8MA 4JHOA 4HMEA 1E6XM 1GOWA 3U7VA 4MNKA 4UFIA 2ZXBA 3W38A 1BTCA 3SEPA 4NXSA 1TE1A 3DX1A 2ZUWA 3ARXA 3BAJA 2WW5A 2ZUUA 4FK9A 2VZVA 3IJ7A 2GJXB 4MDPA 2JEPA 4DWSC 3LMYA 3VVGA 1OWQA 2V5DA 4P8UA 1BG4A 1BG9A 4P7RA 3W4RA 4AEEA 1JZ2A 1V3JA 3SCNA 4PMQA 3S2CA 4QDMA 3BSGA 3VGEA 3W81A 1N82A 4MB4A 5D9PA 2DH3A 4F9JA 2XWEA 1XD0A 1G0CA 5ABGA 3SCVA 5BYWA 3WF1A 2X2IA 3BCFA 1BYAA 1XC6A 3PZTA 1UD6A 3N17A 5M3WA 1W9VA 1QI3A 5JUVA 3UETA 3QGVA 1XCWA 3DDGA 1ITXA 4TUFA 1TA3B 1ISZA 5I5RA 3KLKA 3N13A 1V6UA 1GW1A 1UYQA 4W5UA 3BXWA 1HKKA 4W5ZA 3AIBA 1ITCA 4M8UA 4P7NA 3BLPX 3TV8A 1C8YA 4HOXA 1HT6A 1B31A 2F7PA 1W32A 4YPJA 4CD8A 4HA1A 2FGZA 2EAEA 3K4AA 2ZE0A 3W6MA 1XSJA 2ZICA 1ISVA 3B9DA 4LX4A 1BGGA 5FCZA 2VZSA 4OBRA 3GXIA 4Z2KA 5DMYA 1W2VA 3QHOA 2J7DA 1JAEA 1ZBWA 1KR0A 4PMOA 1DWAM 4ZE5A 4W8LA 1ZL1A 4UOZA 5IDIA 3WD4A 4W86A 5CQ1A 1EGZA 2FH8A 1DWIM 2WYSA 1DWJM 4WSKA 3UR8A 4E8DA 1KGUA 4TTUA 3VIOA 2ZXQA 3VIHA 2A3BA 4H7VA 1O6IA 2WANA 2CNCA 1UQZA 1GCYA 3QR3A 2NW0A 4GXPA 3VM5A 3CMGA 3GXDA 2QPUA 2XSBA 2YBUA 3AXXA 4WKAA 1P6WA 1O7DC 3THCA 2VR4A 1GOKA 3GXFA 2YKKA 3SUTA 4AZ6A 3ZSSA 1XSIA 7CGTA 4TVCA 3OZOA 4AMWA 4W85A 3LRKA 4UQEA 4W89A 1OGBA 5CPTA 2WC3A 3AZRA 1US3A 2PBGA 4XUYA 2W67A 2V3FA 1QI0A 5A6JA 2V3GA 3AISA 1HX0A 5E0CA 1FHDA 1R87A 4MJ4A 3PZ9A 1JXKA 1TQWA 3LPOA 2EJ1A 3AIUA 1GORA 4HZ7A 1M03A 4J27A 5CLTA 1EH9A 4W88A 2G3NA 5E0FA 3ARPA 1CIUA 3WBAA 1TCMA 3AHZA 3OLIA 3ZIZA 1UHVA 4H41A 4F9DA 4ZE4A 3VGDA 4P7QA 2D20A 1JF6A 3M46A 4RL3A 1V02A 3ARUA 4PCSA 1PX3A 4GZJA 3CUIA 1UZ1A 1LL7A 4M81A 2QV4A 2O9TA 4J3VA 2XVPA 1JYXA 3L2MA 1FP8A 4V2XA 3QHNA 1V3LA 4XV0A 3PN8A 3MU7A 5E9AA 5BWFA 1EOMA 1MVYA 2YL5A 1B2YA 4PTWA 1W3JA 2E4TA 1OCQA 1QBBA 4BF7A 2XVNA 5ABEA 4DWSA 2VCCA 1E3XA 3ZT7A 1ISWA 2Y4SA 1E55A 1LWJA 1TVPA 2WZHA 2CBJA 3NDZA 2OYLA 1EO5A 4D72A 4JL1A 1E15A 3FHQA 4W7UA 1KQYA 2OWCA 3EDJA 3U57A 1EOKA 1PPIA 3HG2A 1GOQA 1QX1A 1OGGA 4FNTA 4DO4A 2DSVA 1OBAA 4FNUA 4S3JA 4HA4A 3AMDA 1QHPA 2BVTA 1GQLA 4PMUA 2YA2A 3AJ7A 3VDHA 1ODZA 1QNRA 4CVWA 3CUJA 2BS9A 4FLRA 1UR0A 3E1F1 1SR0A 3AI0A 3WQWA 1EHNA 2J62A 1HNYA 1MFUA 4Q7NA 4BZYA 1GNXA 3DX3A 1B9ZA 3WEOA 3HU7A 1CXKA 1EHAA 2VL4A 1JDCA 4JL2A 2XPKA 5I23A 3MUZ1 3WQ6A 1PIGA 1TUXA 3BH4A 3WELA 2JEQA 3DHUA 2FHBA 4QLKA 3VINA 2VTFA 2ZUMA 2E9MA 3TTYA 5E09A 2DH2A 4PMVA 1JF5A 1RP8A 1UD2A 2X2YA 1GQKA 2F7OA 2DIEA 3N9KA 4Z2LA 1E6PA 4CGTA 1XYFA 3CBWA 4H8HA 4HA3A 3W37A 4D6IA 5EB8A 2X09A 3ARYA 1ZS2A 3DX2A 4MB1A 3GBDA 3EDEA 3BC9A 2PWEA 4P7OA 4QLJA 1WE5A 3ARTA 4KMQA 1GOMA 4EANA 3BAWA 4PEEA 1Q4NX 2F2HA 1MW0A 2VCAA 3POCA 1QI5A 3S5YA 3U7BA 2G4FA 2CHOA 4D6EA 1Q6DA 2D73A 3FAWA 3PZOA 4OKDA 2WKGA 5A95A 5KZ6A 2PC8A 3WF4A 3WNNA 3WFZA 2D2OA 4PMNA 1UA3A 3L4ZA 3WY2A 1ZBCA 4GPNA 2OSXA 2C8NA 2ZX6A 4PTXA 3WUGA 3ZMRA 1ZBVA 4W7VA 4NF7A 1NH6A 4P8WA 4W84A 1AMYA 2BY0A 2V38A 3IJ8A 3VD3A 1W3LA 2ZUTA 1Q6GA 4QAWA 4MADA 4HOWA 2FH6A 4HZ6A 3W6LA 1XGZA 4ZXLA 4GZEA 3WUBA 4B3KA 3L4WA 1HF6A 4PTVA 1UOKA 3VMPA 7A3HA 3AS3A 4CCDA 3RJYA 1OD8A 2EO7A 1B1YA 3TOPA 3PTMA 3IK2A 1C8XA 4ZENA 1ZB5A 3BMWA 2TAAA 2CPUA 4M56A 2WMFA 5TD4A 2VURA 1HL8A 1VENA 2DGAA 2EPKX 3L4UA 2J79A 1E6RA 4CD4A 2WSKA 4TOQA 1V0NA 3H55A 3AXIA 1CECA 1CZ1A 1L8NA 2GK1B 3I3EA 3RILA 1UR4A 1W1YA 3CZEA 1W1TA 2VRJA 2WMJA 2D24A 1FHLA 2O9PA 4DWSB 3WUEA 5CSUA 3A4AA 2PWDA 1PIFA 1WP6A 4BA0A 5DT5A 4UCFA 3KL5A 4HU0A 4OOZA 3VD9A 4XZBA 3GBEA 1WZLA 3BUBA 5JBFA 3WDHA 2ALWA 1X6NA 3T0DA 4NZJA 1NP0A 1R46A 2A3EA 2YA1A 2J8FA 5DEZA 1E3ZA 3IAPA 3NJ3A 1B0IA 3PZVA 2WVVA 1VEOA 4IUGA 1XHGA 5M03A 9CGTA 4UQAA 4RE3A 2A3HA 3F5LA 1MQPA 5A2AA 3WEMA 1LG1A 3UESA 4J3TA 1K9FA 4MJ2A 1R86A 4GQRA 1E6NA 1YQ2A 1E4NA 1EDGA 2JIEA 4QCFA 3ZO9A 1W1VA 4FLQA 4D6JA 1WKYA 3NSMA 4GO8A 1J0YA 1VEMA 1VAHA 3WIJA 3BMVA 3QOKA 2WMIB 2EPLX 3NCOA 5HXMA 2RGLA 3MS8A 3WFLA 2ZUVA 1CLXA 3VILA 2GJPA 4AEFA 1U2YA 1QW9A 1EQPA 1Q6FA 3WF3A 1A3HA 3F5KA 2FGLA 2QPSA 2DT3A 4MB3A 3ZJKA 3RPMA 5BXTA 1O7AA 3O6AA 4S3KA 1VJSA 3LX9A 4OUEA 1VIWA 2V5CA 3LPPA 3M7SA 1GONA 1V6WA 2YBTA 4JHZA 1J0KA 2X2HA 1L0PA 1WDRA 2RGMA 2CBVA 1R8LA 3APGA 1TFVA 2CERA 2J47A 1HKIA 3LPFA 3D3AA 2W66A 2VZOA 4UFMA 3B9EA 2W63A 1CGTA 1W3KA 5LA2A 2V3DA 3J7HA 4HMDA 2PBOA 3ARQA 4C7DA 5BCAA 1S46A 3N1AA 3WY3A 2WAGA 1OINA 1HVQA 4DM2A 4TXEA 1KR1A 1KXVA 3K8KA 4N0RA 5AY7A 1C7SA 3CZKA 3WMSA 1E43A 2XM2A 2D3LA 2JF6A 1V0MA 3DX4A 1UH4A 3VGGA 4KRUA 1ZJBA 3WDIA 2QLYA 3WNPA 3WNOA 4BQ3A 3WUFA 2VX7A 4B16A 5FIPA 2GVYA 4AD4A 3RMEA 4PUDA 1V6VA 2PWHA 1VFFA 4PMZA 2YOCA 3AXHA 4QLLA 3BAXA 1JIBA 3VSVA 1U30A 3WDPP 3K8LA 3IAQA 4ZFMA 5FKYA 3EJTA 4M24A 4UFHA 1BHGA 3D4ZA 3EJUA 2E3ZA 1XSKA 2Y24A 3BLBA 1R34A 1JI1A 4JFTA 4ACZA 1CYGA 1OGSA 1NP2A 2WHJA 3B8SA 4W93A 2GFTA 1W2PA 3DYMA 4JKMA 1QNSA 1ZBKA 2WNWA 3WKZA 4E2OA 2DT0A 2X05A 4M82A 3NSNA 1CXIA 1I75A 2Y8KA 1TG7A 2UY3A 1C92A 2DSWA 2WWCA 3OB8A 3W26A 3VIKA 1HKMA 4M1RA 1UASA 5F7UA 5DT7A 3GH7A 4F79A 1UWUA 4GQQA 3N15A 3JUGA 3CH9A 2B31A 2D0FA 3AMCA 1W9UA 4LYPA 4AZGA 4P7LA 3CC1A 3CUHA 5GNZA 1OB0A 1MQQA 3SCWA 5GNXA 4J3XA 1PBGA 1CPUA 1E73M 2D0HA 3RM4A 1DWGM 3WSUA 4JCLA 2XHYA 2VVNA 1CXFA 4NI3A 1UWRA 1IT0A 2AAAA 3BUIA 3TONA 4DM1A 3KWXA 4R5EA 1BVNP 4QFUA 4EK7A 3VSUA 5A6KA 1UH2A 1H0GA 3WL0A 4TX6A 4P8VA 3SURA 3ZM8A 1ISYA 1PEZA 1UD5A 2OWWA 5D4YA 4IPLA 2WMIA 2PB1A 3BLKA 1HN1A 2J4GA 6TAAA 2DEPA 4AIUA 3SUSA 3HJEA 1NOUA 2XN0A 4GO9A 2JIWA 3WMBA 1CNVA 3MSDA 5A6SA 1KXQA 2G41A 3BAKA 3IGUA 4HPHA 1Q6EA 4MNLA 1UZ4A 2BHZA 3G6MA 3K4DA 5FL0A 1NARA 4GINA 3MMDA 1UR2A 5C70A 1XRVA 1V3HA 5A6MA 5M17A 5A8OA 1JZ5A 2WMKA 1C91A 1J0JA 3SIMA 5JBEA 2GJXA 4UQDA 3AS1A 3WQ8A 4A4AA 1NQ6A 2J7BA 2E0PA 4JIEA 4AD1A 3POHA 3PZIA 1HXJA 3BUDA 2EABA 1QWNA 4DUVA 2PF0A 4PYSA 4YHGA 1CGWA 3WH8A 2OLHA 2FHFA 3VKKA 3BUPA 5A6AA 2BV9A 1JZ4A 1C7TA 1E4MM 1EQCA 4JFWA 1MXDA 1OIMA 4AZCA 1PZ3A 3ZJ6A 3PBGA 3UCQA 5I78A 1TA3A 2XVKA 4U31A 1VFUA 1ESWA 4WLCA 3VIJA 1D7FA 1HJXA 4GI6A 3W53A 3ARSA 1CWYA 3AMLA 3MKKA 3MO4A 1CGXA 4FNSA 2WHMA 1UH3A 1LG2A 3LXAA 1J0IA 5C8BB 1VRXA 2X2JA 1K9DA 1I1WA 3GXPA 2Z1KA 3N12A 1W9PA 1HL9A 1BVZA 4QCEA 1CDGA 1JDAA 2WBGA 1I1XA 4OZOA 4TX8A 3RM8A 4TVDA 3DX0A 1GZJA 2WCAA 2VQUA 1FFRA 3IJ9A 5HDRA 1KXHA 3A3HA 6A3HA 2EBNA 3EYPA 4FNPA 2EPMX 2PI6A 2XSAA 3CHFA 4LYRA 4WIWA 2J7EA 1SFSA 2GDUA 1PJ9A 1KCLA 3HZ3A 5DF0A 1DP0A 2IUZA 3ZJ8A 4BQ4A 2ZXDA 1B90A 3OA5A 5A94A 2XM1A 4AD5A 3EMCA 4XB3A 1VBRA 3GH4A 1SYTA 4U33A 3CUGA 3LPGA 1TQTA 2E9LA 2YL8A 1TQVA 1XH1A 1OM0A 1LLOA 3WQ4A 1QBAA 1MWOA 3CZLA 3TTQA 3HMCA 2D0GA 2BY3A 4UQBA 5HBFA 1UQYA 3I3BA 3N18A 5AC5A 1NWTA 2WZEA 3WH5A 1KWGA 4AMXA 1VBUA 2DSUA 2YLAA 4ML4A 3GNRA 1KTBA 2WPGA 2AOSA 3AYSA 3T0BA 4A3HA 2W61A 4C7FA 4LXFA 2DSZA 1VB9A 1BYDA 3OLGA 1HIZA 2Y2WA 2EADA 5A2CA 2ZX5A 4L4OA 3SCOA 4J7RA 1QPKA 4CU6A 2FYVA 5DO8A 1F4HA 3VD7A 5D9NA 2W92A 3AZTA 1YHTA 4CVUA 3VD4A 3OLEA 3ZT6A 2VX6A 2YJQA 3AIWA 5E70A 2ZX9A 1OSEA 1KXTA 2EPOA 3WD3A 2WLZA 1R47A 4URIA 2FDMA 3A6OA 2WK2A 3ZJ7A 1B3VA 3CHCA 6CGTA 2CIPA 4W7WA 3WQVA 2HVMA 4PUEA 4UNIA 2NSXA 1HP5A 1RD6A 3VGBA 3AYRA 4ATDA 2WSPA 1CXLA 3SCSA 3MUAA 5ECUA 3FN9A 3VPLA 1R7AA 3VX0A 4PN2A 1M7XA 4L4PA 5ABHA 3AMGA 2WKLA 5AYIA 2VVSA 4MNJA 3LRMA 2V3EA 4UFLA 4IISA 3HG5A 4UR9A 1PX4A 3AOFA 4U2YA 3MI6A 4LGXA 4F8XA 1J12A 4ACZB 4UOQA 3BVWA 2CKRA 2XYLA 4MNMA 1BQCA 1B30A 1BGAA 5LA0A 1BYBA 3U5YA 3MMUA 4YN5A 3MV01 1VJZA 3OIHA 1PAMA 5D9OA 2BFGA 1KQZA 4NX0A 2YDQA 4AWEA 3WMCA 1PS3A 3OGRA 5IHSA 4AYGA 5LA1A 5ABFA 1C93A 1ISXA 2F61A 2XN2A 3DYPA 4JZ5A 1UD4A 2W91A 1AQHA 3AIRA 2J7GA 2G8ZA 3A24A 3SCQA 3WEZA 3CV5A 4HZ8A 2WMGA 2IXVA 4J3WA 3WENA 4EKJA 1GHRA 3WN6A 1UKPA 4AD0A 3VDAA 4OBSA 1QW8A 5AYBA 1A47A 4OOUA 3KLLA 1E5JA 4KRTA 2ZX8A 1E0XA 4NRSA 1X1NA 1M01A 4WKHA 1QNQA 1WO2A 4CD6A 4MAZA 2EPNA 3HN3A 3QHMA 2DPEA 3BUQA 1MXGA 3VU2A 4D6FA 2EQDA 1G5AA 3AHVA 5BROA 4X9YA 2Q8XA 2BHUA 1JFHA 2VR5A 1VFOA 1UWTA 2MANA 3ZR5A 4WSJA 2WHLA 2FHCA 1UWIA 4CUCA 4LPCA 2W5FA 1HP4A 4NRRA 2CHNA 1NM9A 2EEXA 5BXRA 1UR1A 2ZWZA 3GH5A 2J25A 3S5ZA 3VNYA
chains in the Genus database with same CATH superfamily
4M3HA 4P46B 2DORA 2BM3A 5EA0L 2WC7A 1P7TA 4Y2DA 1EUNA 2DQXA 3AZUA 4PBFA 3WLQA 2BCMA 1PYWB 1FF5A 5DVOA 2NV2A 1OP4A 2R59A 4KKRA 5C9JA 2LR4A 4JMXA 1BGXL 1AD9A 1R19A 2CJTA 3V6BR 4DGYL 1JFXA 1ML1A 1U58A 2FB2A 1AGDA 2Y22A 5IROA 4PCYA 4PY8I 4XX5A 4AUJA 3OVRA 4A6GA 1UKTA 5BPPA 2IG2L 2IH3B 1SM3L 1ZV9A 5T8IA 4QEEA 2BVUA 2P8PB 1F41A 4GRMB 3W24A 4JKNA 5I0DA 1WFJA 2FZ8A 3P14A 1H5BC 3FEMA 5GGVY 2NY6D 1UWAA 4AOFA 3CXHK 5C09B 1EDQA 2QPDB 5ID0B 3MXWL 3FFCB 3L5LA 4U28A 1ZKAA 4WUKH 1FGVL 1G6RH 5CPOA 5CPSA 4N85A 4F2MA 2CH8A 3DHMA 4C56A 2X4UB 4HLZG 2OWXA 1ED3B 2BLFA 3LNEA 1VHPA 3BO8B 4L9XA 4LYQA 3HNTL 1G94A 1URLA 1CX9A 2PDQA 3S9YA 4K3EL 6TIMA 3TEXA 3UBPC 4AX7A 4WK2B 5LAXB 1JF1B 1XAUA 5ETUA 3QO0A 4HIXH 2Y1YA 4EUPB 1ZVHA 5HYEA 3I9GH 1LD9B 5I1AB 1T3FB 1G84A 4M7SA 1FGNL 5FOOA 4ANVA 1A7QH 2E7MA 3F85A 1GOHA 4NNYB 3GYRA 2B2XH 3WSQL 1MVUB 1J6OA 1UWSA 1UA7A 5FL1A 5E8OA 4ZX4A 1HI6A 3CK5A 1PVHA 3W1ZA 3D2TA 3WIFA 1I7UB 4H1LG 1W9BM 2FYMA 3M0HA 4DJDC 4YTRA 2VUOA 1U4EA 1QFEA 1IBHA 4KVNL 5ENWB 3P73A 4QDPA 5DCDA 2F8QA 3ZGHA 1S7WB 5DT1L 1CLCA 4JS7A 4XHQA 1AACA 2ORBL 3HRZC 2YL6A 1BYOA 2YFNA 4ZK8A 2A1WL 1GJUA 3D85D 5I82A 4PLNC 3TN4A 1W9DM 2FTAA 2YMOA 2VCBA 1HE8A 3S34H 5FO9A 3BD5A 3OJDA 5EMJA 3KW3A 5ECVA 5A8NA 4N7QA 3D52A 3Q2WA 4WU7B 5I0XA 4I90A 4NI8A 3CN4A 3T6QC 1WUZA 4L9ZA 3ASWA 4MMYB 2W4XA 4BQCA 5ADOL 1P6CA 3AS0A 3B37A 2PDYA 3VXUB 4LAKA 5B8CA 2F53B 2ZJSH 2W0FB 3RGVA 3TP4A 1WD9A 5AHEA 5FCUL 4QT5B 3CX2A 2DL9A 5LKYA 1TITA 1KLFB 3ROLB 4Y4KC 5JMOC 2EEFA 3ISYA 2R2BB 5CJOH 3B9VA 5FYKE 3MVSA 1TZ9A 2HMIC 3G5XA 3VRJB 4GYKA 4O5LH 3SQSA 1XRTA 3OB0H 1FAKT 4AYDC 4JFZH 2WO2B 3W0WB 2VN7A 4UTUA 1FAIL 3QCTL 4ZO7A 3HVNA 5I1JH 1YEFL 2DSKA 3LV3A 2GQ3A 3EO9H 2DQHH 1XD1A 4KKLC 4D1JA 6REQB 5EBAA 3RWGA 4F7TA 1TCDA 4BH8B 4F2BA 4P2QB 4QROA 3HNTH 3VXMD 3W9EB 3R12A 1FFOB 1P5UA 2FUTA 4FA8A 5D9MA 3D12B 3L4CA 4W4OA 2A9DA 4JNMA 4Y9FA 5GRZA 2ZRZA 5A6LA 1ZPTA 3T0VA 4D94A 5K9QG 5I18L 5HDWA 2G3MA 5F9WB 1TEFA 1NC2A 1BZ7B 1HXMA 4E42A 2Z28A 3JVGC 4FL4B 4XVSL 1MIEH 5I1KL 1LE9A 3OOQA 5DQJA 1HIML 1FCUA 3PJWA 3EJJX 4IDLA 1MRDH 3QDJE 3SDYL 1E9LA 3H4XA 4Z7QE 4LCQA 5TNVA 2LU4A 2ATKB 3F5WB 4KAQL 1SOXA 3BRFA 3GQYA 3GKWH 4UIOA 1FL3A 1E6QM 1LQ0A 4OZFG 2QPEB 2LLNA 3LGEA 1ZTXL 1Q6QA 4GUIA 3MA7A 4X6DB 1IARB 4M1GH 2UXVA 1AFSA 1SM9A 3PZUA 4KGLA 4MQSB 4FNQA 2PGRA 2UZYB 1J48A 4K5PA 3CS2A 4IOIB 1GIGH 5IFTA 4KOCA 4GRWF 4PJBB 4XE5B 5H37A 3RVUC 2D3VA 2ZKHL 3B2UD 2YBRA 4KDTC 4GSQA 2F7RA 3L4VA 4OGZA 4YDJA 5B22A 4EIUA 1E0TA 2R82A 5LKNA 4R27A 4MIMA 2R0KH 4K3DL 1N8ZA 1E2VA 4LMQE 2PF6A 3OKNB 4OQTA 3VFRB 2O5ZL 4M43L 5C6PB 1HILA 3DECA 3ET9F 4K2UL 2H8PA 4OKVB 1CT5A 1YEEL 1E6SM 1A6TB 1NCWL 1TQUA 2IDSA 5KOMC 1QAPA 5HPCA 2HPOA 1KYOK 2CDEA 1J9YA 5IJKC 1WOAA 1SJMA 1Q94A 1FXPA 2ADYA 5CCHE 4JMNA 5A8GA 1T5XB 2Z0BA 2Z31B 5EGRA 1X96A 4AD2A 1NJ9A 2XFXA 3DJRA 3FOMA 3HR6A 3S1UA 2RH0A 4XPBL 4F9LA 4DN1A 1R3IL 3GSXB 3MMWA 1XF1A 2I9LB 3G5ZB 1SZGA 2R91A 4QUOA 4IRJC 1M7IA 4KTEH 1JPFB 1QBLH 2AERT 4L29A 3DO7A 3L2LA 4QRBA 5GGSB 1FVEA 3CCHA 4GMSH 1UKOA 1V77A 2JGYA 1BV8A 1UCBL 2DVXA 3EPMA 4GXMA 2BHYA 3B2VH 3GC4A 1GW0A 1FH9A 3OG2A 3BL3A 4GKTA 2HCVA 3M7FB 4FHJA 4MNGB 2FGBA 3R89A 3MBED 2JFEX 5EU3B 1BF2A 3FQNB 4NNAA 4LOCA 1FYTE 3ARGC 4FLOA 4CC4A 4LSTH 4KK8C 3RKDC 1S2AA 32C2B 3RO6A 4LLUA 3H42L 2DWTA 1C5CH 3QPQD 3VXRB 3RX2A 3GDBA 3ZR6A 1EDTA 3AJXA 1XT5A 2VXVL 4JRXE 4DESA 2W0PA 1EJUC 2Y36H 5XIMA 4N20A 2A6DB 1TNNA 1XLLA 3AIEA 3LZLA 4FXGA 2D03L 1MRAA 1RUQH 2E6AA 3ARFB 4PB9L 3VFUA 3ANVA 1XCTB 4MLIA 3T4YA 1ZVSB 5TH2B 1YKWA 4OLYL 4KWUA 4L9YA 1CXEA 4J2XA 2A9CA 2MQCA 2XJKA 1CGYA 4ANXA 3LKOA 3REVB 1A0DA 3DJ9A 3CYVA 4MBOA 3M0YA 1TTFA 4PGBB 4QHPA 4F9PA 2WSQA 2W81C 3EYFB 5CLXA 5TQLA 3WKQA 4JPGA 2OQHA 1OX6A 1OANA 1U91B 3ZLFA 4AVHA 4XKYA 1WIOA 5AEAA 1IBFA 2AJZB 5J3HC 3BVUA 4LS2A 2ZWKA 4S3DA 2ZCKH 2MCAA 5KMYA 1FNGA 5E6IC 1J8HD 2EYSB 4LGSB 3MLTB 5DBTA 1PQZA 3G5VB 2P5WE 1EC9A 2QPXA 1RK1A 2ITDB 3QY7A 2NY2B 2BVDA 3CMOH 2Z4TA 1BD2A 1U92A 2HRGA 4LLYA 3SSJA 2CBUA 2H6PA 3JWNE 3MJ9H 3T2LA 3N2TA 4KRPB 3IYLW 4N8CH 2QZ5A 1OW0C 4N0UB 2R1LA 2ZC1A 3CDZB 1JZJA 3MUGB 3O6KH 1YEJH 3VKDA 2H90A 2YA0A 2OA9A 7ENLA 5G5IA 1R3IH 1WEJH 3TZVB 5K9QI 4A8NA 1RZJH 2PTVA 4F8LA 4TNEA 2EXOA 3E0LA 1IM9A 4AG4H 2XTLA 4DSYA 4RE0A 4RWYL 3WF0A 3MLUL 2EVHA 2ZT9C 2PYED 4Z5RB 2E68A 3NA9H 8CGTA 1EEPA 5DWUL 3MGTB 1JZ8A 1AD9B 1EZSA 5IM7A 3WQEA 4HNVA 5C0FA 4FQJL 1U58B 3F2DA 3IDXL 4AT6B 1OSZA 4PHXA 1YEGH 4TPRL 4ZTPL 3RWCA 3TA3D 3U2JA 2VJXA 1N6QH 3TA9A 3W27A 2BNUB 4IPIA 2I5GA 1IC4L 4LF2A 4XZMX 5TDNA 5E5LA 2DT1A 1C5BH 3DOIA 2QKIC 4KI5C 4PTTA 3NZ8B 5EHFA 3PNWA 4G59C 2FO1A 4KKQA 4JFED 3IIOA 2CBOA 4WJXA 4P2OD 5F1KC 3R8QA 4B7LA 3TEZA 1Q6OA 1X98A 4AHOA 4LCUA 2WJFA 4WDIB 3A4WA 2CLOA 3VG9B 2XVGA 2J74A 4ZQOA 3FOLB 1I9EA 2YB4A 1QO3B 2C4FT 4ZOAA 4DP5X 1X3DA 2Y1AA 1ET7A 4Y19E 2DT2A 5I07A 4MMXA 3S3CB 1V27A 2FL5A 3D25B 3DVFA 2VMCA 3Q8AA 3OGCA 4NQDB 5SWQA 3VXSA 2OVLA 2ZZ7A 2NUPA 3E9AA 2X4QA 5IVXB 1S7SA 4C58B 3FONA 3FX4A 1IEAB 5DY2A 2ZZ6A 4JTCA 1GXEA 2WN3A 1FH7A 2H9AB 4ICMA 4MF4A 1MREL 4OT1L 1FC1A 4PL1A 5D8WA 3TQ0A 1PG7H 2G60L 1AKJB 2KYIA 4RX4D 4QRFA 5A2KH 4H6QA 5IHRA 3B05A 3EOTH 1F61A 5CINL 1HHIA 1JYNA 3S6TA 3GY1A 4CKVX 4FZEH 4XHJC 4EDWH 5AENA 2QS8A 3GSNL 2UUDH 3IFNH 5EOQL 4ELME 5I1EL 5JIIA 1P0NA 3F8UB 1OIOA 2XIIA 4WI9A 5D8ZA 3AY4C 5CG7A 3QXAB 1UYWH 2OL3A 2VUYA 5BQ7B 1JDFA 1UOZA 1FDLL 3KDNA 1P69B 1T8QA 3VKJA 4N9EA 3N11A 3QC6X 1J05B 5CPQA 4IRSC 3LI0A 4W4OC 3ULVL 1JAKA 3NSXA 2ZOLA 3KBVA 4JIIX 5CHNB 3UMTA 4KJYB 3HVDA 3HTLX 1LYXA 4LU5H 4OWGA 3RNDA 4XNXH 3UAJC 3VXQB 4L8DB 4PJCE 4FRWA 5KAQG 3HCVB 4OV4A 4LB8A 4LVHB 5MHSE 2HFFB 2IMMA 4UZUA 1LK3L 1V79A 3KLHD 2X1IA 1YEGL 2PW2B 6PCYA 3EA3A 2WJEA 2IOOA 1AO7B 3ZL2A 2EXYC 5CH9A 5DQ9B 1RZQA 2OZ4L 1G0YR 3TPUB 3KS0J 4F2FA 5ICZA 1GQIA 1UWQA 3R10A 4D6CA 4MRBA 4B50A 5LNEA 3GTVA 1NDTA 3IANA 5F1NA 3UGUA 4W8BA 2YXMA 5A7BA 2ZSWA 4Y1AD 2JKAA 2IADA 5HBBA 4IM4A 3Q65A 4RXFA 2BP8B 3BVNB 1W0VB 1GPFA 5CAYB 2ISFA 1AMXA 2IGLA 3NRPA 1N8FA 3QWQB 2EEAA 1L4IA 3QAQA 4M61B 1A4BA 3N44B 1QPRA 2IANA 1JG9A 4KC3B 1C90A 1GZGA 2NY5H 4H8VA 4L5FH 2WXFA 1M3UA 3H2OA 4CNIB 3N73A 5FACA 4HAFA 3RDKA 2I60H 1WBXB 1NPUA 3VNZA 2GOUA 4LUSB 4I2XB 5AC4A 1CFQA 2BC4A 2XN9D 3H24A 1O5PA 4FQ2H 3EWWA 1SJAA 4NPYA 3EOTL 1MFVA 2R2EA 5IMOA 4JIHA 5DMIL 1OAUL 3BWAA 1EIBA 3BW3A 5MEQB 1DQDH 3NZQA 4N0CD 1NCDL 4JUTA 2WBJB 4DIXA 1K77A 2GIYA 4MUZA 5E2WH 4BQBA 1LD9A 5AKRA 4R53A 1ZT1B 2CO4A 4EOWL 5T3ZE 5DY3A 4G43B 4ONFL 5C0CD 4GG6E 3WD1A 1AZZC 4DYJA 3AB0B 4RBPH 3TYZA 3I4KA 1N5AA 3LS5H 5ITFB 4JGJA 4S1SL 4X5PA 4U1SA 3DFHA 3DETD 4FQ1H 5HHMD 4YTQA 3BQUB 3GB7B 5MERB 1X7TA 3GWJA 4K7PX 5D72H 3DHDA 1O6TA 5PAZA 4KCTA 4JX4A 4C1KA 1N3NB 1NVMA 1WBJA 4JY5L 3S36X 4GWEA 4PJAB 2ZA2A 3PQYB 2LV4A 3A23A 4JFYB 1G01A 1RCOB 2XFYA 1XLDA 3L3OB 4JG0L 3KVKA 4ACZA 4JJ5A 1IXPA 3LXCA 2FE0A 3LB6C 3TBVA 3DV6B 2YCIX 2UXTA 4Z1CA 1TZHA 1KM6A 3N6HA 3IPFA 5DJ0B 3SB0A 1T66D 2QMKA 4TLSA 3WG6A 3CV1A 2OQJA 3TBYA 4O52A 4I0PD 4OJEH 5LGXA 4PJCA 4FULA 3D51A 1NUDA 5DXWA 5JORB 2XG5B 4MNHA 2FO4A 3G5ZA 1QVBA 2OEKA 3E49A 5JIPA 2RBLA 2XG9A 4Y1AB 1US2A 3BISA 5LGHL 1WA3A 4YXGA 1A4LA 3V10A 3STPA 4IFRA 1E9OB 5BZWB 4PUWA 4AX6A 4UT6A 4K55A 4PJDA 1A3RL 3WJMB 1IQ8A 1RK5A 2JIXD 2F2KA 3ABSA 5BWAA 2H2PC 4WO4B 2BXZA 1D9KC 3W56A 3WEXB 1TVBB 3O6FB 4ELMA 1ETA1 4P06A 3GDMA 4K68A 4ZAKC 3RX7A 1I7RB 3UOAB 3LIZA 1Q9KB 1DQXA 2J1XA 3EJSA 2D3JA 4H5SB 4MG4A 3DUUB 1RERA 3II1A 3K2KA 4GC3A 3SJ3A 1UUSA 4ZFFA 1I3GH 4MD5A 2OR2A 2PN5A 2EE3A 5GRJH 3V4VB 2Y1ZA 1G9HA 2J6EL 1H5VA 5G4HC 2A7NA 2J7CA 3NAVA 2KX9A 2DQTH 2JQMA 2OW7A 4HALA 1R0MA 1BF8A 3SRHA 3HG3A 5CUSL 3SYAA 3RM9A 4O51B 2EICA 4ZYKB 3ZWSA 2XGIA 1J1OL 5BZZA 2FMNA 4R7NB 4ONGL 1W0YT 2P43B 3C12A 3MUIA 4IFKA 3VUPA 1QSFE 2VP8A 1MCPL 2X4SA 5IZ7A 5K59E 8FABB 4N3TA 3WFCL 1AANA 2IKGA 3QJVB 2NXIA 5AYYA 1MJUL 2KDYA 2CXGA 4ISVA 3R19A 4GUPB 3GBNL 5CIPB 4WY7H 2X4NB 3BYYA 5BVPH 4HUVB 4OJFL 3LN3A 3GSNA 3UGRA 4FFYA 1DORA 4DLMA 4AD3A 1KACB 5D1QD 3KX6A 2FZMA 3V9EA 3UWWA 1TMQA 5F1VA 2CR3A 3K5SA 1SVDA 3MV11 4YWIA 2YUVA 4OFYD 2Y5JA 2V7HA 5L6YH 2LLGA 3H4HA 2EIKB 3AWEA 2N0MA 5GRUH 2OGYA 3S5NA 2NX5B 3QORB 5ADPH 4P8XA 4LLYB 4DGYH 1EK3A 5EBGA 1KJ2B 1A6VL 1GHSA 3TWYA 4LAMA 1I1AB 4O58H 2MJWA 1XICA 1AJ2A 1I60A 4MFEA 5F7FA 2VEFA 1UP3A 5A69A 4LHUA 1K72A 3TZVA 2IDCA 3WQ5A 4RGNC 4XPTL 2DZUA 5CBAA 4KTGA 3M7WA 1BLIA 3UJRA 4X6CE 4Z0BH 5DT1H 5HMDA 1BBDH 3FCUB 4NO3B 5FYKD 2WVUA 5DJXA 1JCXA 2PODA 3QDAA 3HBPA 3SGJA 3GDRA 1F2QA 3E0GA 3CBKB 1Q4WA 1CGUA 5C0FB 4O9HL 4X9SA 1OAXH 2ZWSA 3QRGH 4ADGA 2OMZB 2NVAA 3U2ZA 4DZ8A 1NEUA 4HG4K 3HS9A 1J5OH 4BWWA 1RXOB 5GSRA 1UKSA 2MQGA 3DXAA 5CPMA 1XF4A 4K9EL 1BXAA 4YWSA 3ULVC 3NDYA 4ZA0A 2YSTA 1EPVA 2VYRE 3V0SA 4X80H 1JZEA 2VDKH 4AIEA 3H4FA 4JZOB 3QT2A 4JBRA 1TMHA 1EPXA 1XMWA 4O2CB 1D3CA 4AGPA 4UTWC 4LRIA 4TNWF 1QSEB 3FO0L 2Z00A 4PJXF 4D6DA 2G5UA 2X9YA 4TUOA 4DJEA 2QHRH 4DH2A 1GG0A 3S46A 1XB3A 3E2HB 4JREB 3OVPA 1QO3A 1K4HA 3KM2A 1F2XK 1N8IA 3DHPA 1OZQA 4BFOA 4P2QE 1QSZA 1V02E 4AZCB 5PTDA 3QQNA 3VXNB 3GLDA 3L5WB 3IU3B 3VXRA 1ZLSL 1Y5WA 5HNRA 4DTGH 5ITBH 3RITA 2IXUA 3S98A 3VGFA 5GJMA 4NKMA 2CGYA 3N0AA 1TV7A 1KT2A 3C09B 1PUDA 3F62A 2A74A 1UR8A 4JX6A 5EPMB 5JA8B 1Q9WA 1FNSL 2PCFA 3WEBA 2FWUA 4JFUA 1B3YA 4G8FB 1DZ0A 1FVCB 2W88A 1NFDB 2M8XA 3FEQA 1HXKA 3UTPE 3S34L 5C09A 3MDJA 4E8CA 1T1ZB 1TG8A 2HB0A 2QVMA 2OV0A 3BEWB 1RP9A 2JCCF 1R0AL 1OX4B 1MIEL 1FORH 4DVBB 3HGOA 3O4LD 3F04A 1E4KA 4JCMA 4KERA 4LCCA 1MI3A 4B15A 1XKYA 5DJ8B 3DZ1A 1XG4A 3BO8A 3WMPA 3AU1B 4Z95H 1ZIAA 1QTSA 3SBQA 3K0WA 4I0CC 4OI7A 2HFEB 4OFDA 15C8H 4Z7NB 1DJYA 4MOZA 4F7MB 1R3JB 3SKNB 4S38A 3DVNB 4A3UA 2WIMA 3MCNA 1XV8A 2VW7A 4NP4H 5K9OB 4S1QL 3MQTA 5FDWA 4UTKA 1UZ8B 4NIRA 2HISA 3LLDA 3JTSA 2VFGA 3QSRA 4L7ZA 1PKYA 4QXWA 3SUVA 7REQB 3S1WA 2NPLX 3RFRA 2OW6A 3H85A 4Y2DD 2ZVIA 3SJNA 3UCCA 4K3DH 4U6TA 1WAAA 2XWBB 1H62A 5ALCH 2R8SL 2QZRA 4LBAA 1P9MC 4ODUA 4CSZA 3L23A 3FO9B 3JTTA 3VFTB 2WUBH 3L7FA 4URKA 1TJHL 5JPMA 3H0TB 2YUXA 1KB5H 1ZA3A 3H9SA 2X8RA 3CPRA 1MJJA 4HCRH 4ZS6D 5BRZD 1F6YA 3GSUB 2P4AB 2FVLA 4WJG3 3QEUA 3L66A 4XNMB 2XIDA 3MRJB 5D7HA 3U9PH 2BG5A 5DLMH 1H5YA 4AY8A 3EZJB 3ABLB 5J6GA 2YGOA 3LERA 2PXYB 2LVEA 3K81A 4P46D 2AVFA 3IB4A 2H6RA 4KQ4H 1V03A 3OO2A 2VZUA 4PMDA 1ETB1 2EC9U 4LPUA 2ITFA 4FXGC 4UDUB 4ODXB 3EXJA 4RQQB 3C2YA 1OFOA 1UW9A 5E5MA 1FWBC 2P9RA 5JXED 1E72M 2F8IA 1BF5A 3EA2A 3BP7B 1AAJA 3U2SA 1PMYA 3K1DA 2VZTA 1H60A 1AS8A 3ZE1B 1NICA 4F7EB 4FNLL 1L6FA 4B2DD 5EG6C 1SDDB 3I6TA 1G9NH 5T9BG 1W1PA 1PY4A 3EYUL 3P0GB 4XXCA 3RLVA 2IEPA 3OBAA 2GJRA 5CSYA 3O6LL 3C2FA 2Q86A 3V0TA 3W0WA 2CWNA 3TTSA 3NQBA 2PDPA 3OAUL 2H9AA 1D5RA 4Y2WA 1ET8A 2R1WA 1RFDH 2NNFA 1PDZA 3ALFA 1OG0A 2QL1A 3NUKA 2PAJA 2OSYA 1N5AB 3L5JA 1H3TA 4JFEE 5GS1C 3SCMD 2NXYC 1A0EA 3O1NA 2H0EA 1EX0A 4EI5A 4TM9A 1G43A 3A0OA 2HLAB 3BAYA 5E99L 2F6UA 3PG9A 4JLRB 2PP8A 3RNQA 3TC6A 4D0BA 2VW6A 4NO0D 1GW9A 4Y9CA 3K8MA 1GYAA 3OKEA 5I71C 3A4DA 4AXKA 4EZJA 4LVFA 1TCRB 4JEGB 3QR2A 3MUXA 4GX9A 3LKPA 4V1XA 1EC7A 3CFKB 4WHDA 2EUXA 2G3JA 2G3IA 4F1ZA 1SBSL 4Q14A 2OR7A 2CA4A 3BQ5A 1AY1H 4GQBA 4R5XA 1VIZA 4AISA 4J3SA 4AXNA 3U7WH 4OFVA 1R9XA 2BY1A 3N85H 2H47C 3KYKH 4H04A 3L1EA 2HPMA 2FLMA 4GP5B 5FGRA 3ZDZE 3ITLA 3EFFA 2OELA 3MJ9L 3R79A 2REQA 2WQRA 3CIXA 4PG2C 2X7LA 4Z6AT 1QHQA 4HSOA 1L6SA 3I6KA 4CD7A 3BGFC 1N8ZB 1TTAA 1KIQB 4R97B 5ENWA 3SGDI 2FZBA 1EO8L 1UXSA 1IL1A 4DPAX 4AG4L 1QR1B 3SCMB 2H0JA 1NJJA 4HHWA 4LUTA 1RBLA 1SOQA 1E6JL 3C5SB 43CAA 5EUOE 1VHCA 2DM2A 2PZNA 4P5SA 3LKRB 4OLYH 2XUCA 2COVD 5K9KA 3QLDA 1DUYA 2X4TB 2GI0A 2X4PA 4OGAD 3VVWA 5CJXA 1MH5B 3IDNA 3VXME 3HOJA 4HKBA 5C07B 1Q5MA 4YDLC 4I8YA 3VGHA 5BNKA 4KGJA 4I77L 1X5KA 1EFZA 2QR0B 5E08H 1X9LA 2AEOA 5JDSA 1GOIA 4JQIH 2Y1HA 1JDEA 2HS6A 2NZ1A 3ECQA 1H61A 4Z2JA 1TUPA 1C8QA 4LUSA 1KCSH 3WTUA 1FVEB 1IGYA 1A0CA 1MYRA 4R7XA 2ZA3A 4B5XA 3OXRA 4C56E 5IQ9B 1TJ0A 2VGIA 1TQCB 4GBUA 3BKYL 2QMJA 1UGNA 3BP6A 2CBMA 3BWAB 5E24E 1E0VA 4G80B 1W31A 2XQYK 4L48A 2DV0A 3UWEA 4IQJA 3IXTA 2Z6IA 3FQNA 2F9BT 3P62A 1FZOA 2FQGA 5LXEA 3GSQA 2ZQ0A 1WYJA 3D5OF 5FXCH 3NEHA 1NDMA 1RH9A 2WHKA 1N2RA 4QKXB 1TTRA 1V0KA 3BCJA 5AZUA 4HU2A 1PG7X 1KFGA 5EOCL 4W68A 5AAWA 1H3PL 4U1SB 5B39B 1AL8A 3FFSA 4JTQA 1JZ7A 5EMUA 5TFSH 2B9AA 4V28A 4JRLA 3QEHA 3JR2A 2XFRA 4LEFA 1JGUL 4NO5A 2V37A 2O6CA 2EECA 1JD7A 3RWDB 4IXXA 4QITA 4IBTA 5D30A 5I1EH 2JELH 3D07A 3L3OA 4FNRA 4UQCA 2V5KA 3JZUA 4J23A 5IMLA 4HN8A 3RO8A 5AOJA 2A6KA 1NKGA 2B8OT 4JPIB 3G08A 4UT6H 3TT3H 1FA2A 4MB5A 1NMAH 3VX1A 1SJHA 5CZJA 3EDFA 2J75A 1YG9A 5HHQA 4AZIA 3FF8A 5C6WH 1S38A 3BGGA 2UYLA 9XIMA 3J27A 3NQEA 4DZBB 3RXZA 3W1TA 1FNGB 1W80A 1ITBB 1GGBL 1S3KH 4HX1A 1ZGDA 1JD9A 4OAWA 2HJKA 3WE6B 3W88A 4XRCB 1IGFH 2CBTA 4NXKA 2ITDA 5IXEA 3QY8A 4G8IA 3H4GA 2HVOA 4QDGA 2H41A 1TTPA 2C3VB 4PV8B 5HATA 4DELA 1H49A 4F33B 1ZLEA 3RE0A 2FPTA 4O1CA 5E03A 5ABZA 2YL9A 5IP4A 2EPHA 4HUUA 1A6TA 2ZDSA 3PC0A 4DP6X 1I7RA 4B27A 5DTFB 1VP5A 2J66A 1DDHA 3RJOA 1BX2A 1F4XH 3DPDA 2GGIA 3GNPA 3KOFA 1NCAL 1HU8A 1ULVA 3MTXA 3BN3B 4JZNB 3BTNA 4XBKA 2ZFAA 3VWKB 1IXNA 5EU9A 5AB3A 3DYOA 3FHAA 4PSPA 3H4WA 4QRAA 3S47A 1QNPA 3EH4B 1G5GA 1GZPB 1OSZB 1R3RA 1SF5A 4LB3A 4KI5F 3GR7A 1PXGA 3N42F 2PO6D 3OSKA 2R7EA 3CMJA 1IT9L 4XP6H 1Y0EA 1P7KA 4NAMA 5JPMC 1AS6A 1W5PA 3CMFA 3E6HB 5GGSA 3ETSA 4ERIA 2KZKA 4JHOA 4KO7A 1MCNA 4HMEA 4BI6A 3VWKC 4YXKH 2QKIA 4PG2A 3VFMA 4WKXA 3AO0A 4MNKA 1T7VA 4UFIA 4R0LC 1DUZA 2R29L 1KJMA 3MJ7B 3FQYA 3ZZQA 1BTCA 5TFSL 2H3BA 1DFBH 1FTXA 4HU3A 3RCMA 1A0QH 3MLWH 4GIRA 2L7JA 3DX1A 1DLFH 2HLEB 3FT2A 3ARXA 4C57C 1LBFA 3KWUA 2GHWB 2WW5A 2ZUUA 2LT9A 3GRBA 4APXA 3KJ4B 4O4VA 2PPFA 3VTMA 4FDWA 3CU1A 4UDTA 3TT3L 1H8SA 5D8JL 4BFNA 4ESKA 3LMYA 2BO0A 4OTXL 1MFCL 2P1YA 3VVGA 2V5DA 2NW3B 4R97C 2W80C 1QEWA 1DCEA 3W72A 2GITB 3BWUF 1AYOA 3KXFA 1LTDA 1J1XL 4Y16D 1V3JA 5I3FA 2UZIH 3SB3A 4YBLB 5AG9A 2YRBA 2FT6A 4QO1A 3KHJA 1D5XB 3MRKA 2NQJA 2AJVL 3A9BA 3MRLB 4A2DA 3G1YA 1JNNH 3R06B 3IJIA 2OJEB 4AK1A 1HFUA 4L8SA 4UT9H 2NXZD 3EYQC 4MB4A 1N82A 4E5TA 2FECL 4QRPE 4L0ZA 3SECA 5A16B 1G0CA 5T3XH 4B3EA 1MJJB 2AABH 2CBQA 4PCFA 4LU0A 3QVQA 5BYWA 3WJYA 2GI7A 3PZTA 4PRRA 2WBJD 1UD6A 3NFSL 3N17A 5M3WA 3LNIA 2O6FA 2XBTA 3D2UA 3EUDA 4UMGA 3VXSD 4H13C 5D1QB 4P4KD 3DMMA 3QGVA 3H2QA 4IRSA 5LLIC 3IEAA 1VFAA 1ITXA 4XZBA 3IRPX 3CUPA 5FCSH 1TA3B 4QDWA 1T04B 4XN2A 4XD4A 4XCCH 2XWCA 1QBMH 4ZXBC 3O2VL 5TQ2H 4QE5A 1GW1A 1P4IL 5SWUA 2ZVRA 2IAND 1J8VA 4L8SC 4W5UA 2Z7ZA 5BOOA 3BXWA 1OQOA 3NQDA 2O4MA 1YPZE 1A6UL 1ITCA 3AU0A 4P7NA 2NQ5A 2P50A 4GKNB 1A3WA 4MQXC 4NHVA 4X8JB 1RVFH 1B31A 1UROA 2F7PA 5D72L 1W32A 5DEGA 1Q9OA 3B7RL 1KZYA 4HA1A 4B95C 3PHSA 3UPCA 1ZTMA 2EAEA 3K4AA 2X1QA 4OZHA 4WNQB 2ACRA 2NV9A 1AP2B 3VH8B 2Y7QB 3FKUS 4CDGC 3ASNB 3JV5A 1LOQA 2FZDA 3RX5A 3NVDA 5TDNB 5C7HA 1E0UA 5D9SA 1NFDA 4JEJA 2RFXB 2V2XB 2VZSA 4Z2KA 3TC7A 3GUGA 3QHOA 3HHRB 4ZO8A 1R3KB 4KK8D 2NW2B 1K3UA 1N5YH 4AQEA 4EI5B 1ZBWA 1TVNA 4ZE5A 4W8LA 1TQJA 4ZTOL 3C5ZC 4JTDA 1HGYA 5ANME 2O6EA 4ONHA 3AQXA 4RDZA 2H1LM 4MJMA 3S5OA 3JVAA 4XMTA 3P61A 1NU5A 1EGZA 1YNLH 5AQ0A 4M8RA 2CK0L 3MX0A 5EORH 1M6JA 1ONXA 2ALDA 1DQQA 3ABKB 2WYSA 4WSKA 1JVOA 3DUSB 2NNAA 2F9RA 2E5EA 3M7OA 4LL4A 3NQAA 3C8DA 1TJ2A 4TTUA 1BXBA 2MWCA 2WBJA 1CQKA 2ZXQA 1R3HA 1EEZB 2Y69B 3J07A 3O2WL 5FYLH 3STZA 2IPTL 2NY1D 4N9BA 4UMCA 4LUJA 3PJSA 4TULL 2QVTA 1CVRA 3RP1A 5EYWA 2PMQA 3KCLA 2NW0A 2QJDA 4XMUA 1W0WA 3RWEA 3WBXA 1C08B 3P40A 4IW4C 3FK4A 5FJIA 2WJ7A 2H0FA 2DJXA 3VCNA 2XSBA 1OB1A 2YBUA 4NCC2 4HNLA 1F3RB 2Z1VA 4WKAA 4GZ7A 2Y1VA 5TPWL 3KPSA 4E41A 3GR8A 1M05A 4ZUTA 3K3QA 5HHMB 4GBXA 1ZLUH 1GOKA 3GXFA 1BWLA 2YKKA 1R2RA 2VIRA 4AZ6A 4M48L 5LN8A 3VI2A 4HK0A 4HFWB 4KEUA 1XSIA 7CGTA 3ZHKA 3OZOA 4IBVA 3FB6B 3TV3H 3FQUB 3EMQA 4YX2L 3RR1A 2GGHA 3WMQA 4LT9A 2X9ZA 1X5MA 2B7QA 4YU1A 4L8DA 3VE0B 1XTLA 4FQCL 3Q5OA 1US3A 2PBGA 2W67A 2HMCA 4HWNA 3V4PB 4LSRL 4MCZA 4P9ML 1P1MA 2V3GA 1JZDC 4PRPB 3CAFA 5E0CA 1H7RA 2EILB 4Y1AA 3Q05A 5DQ9A 1R87A 4MJ4A 5F97E 1P6FA 4X7CC 4PREB 3DV4A 2VO8A 5IB5A 2V68A 4F7EA 5ESAB 1M9SA 4F15C 3MRFB 5AOUA 2AFNA 5CLTA 4FZ8L 5DHVB 3TO4D 2EF9A 4B97A 5J0BA 4W88A 5HVHC 5E56A 2G3NA 3EIFA 4NRYA 4FA3A 1TTGA 2Q86B 1CK0L 3ARPA 1CIUA 3RVXD 1ZLSH 1Q1PA 1T7LA 1V6TA 1TELA 3T7VA 5EZJA 2CO6A 4R5VA 5L8JB 3ZIZA 3OZ9L 4H41A 3FFOA 5F1IA 2BK8A 3KPRB 4GYJA 3VZXA 1NBVH 5IEKA 4ZE4A 1ZFJA 2YAQA 2FYYB 2F5BL 3EJYD 3VGDA 3W0WE 1ZP3A 3CL8A 3N2BA 1MI5D 4Z7VB 3HI6H 5IEHB 3E6FA 1UUNA 1JF6A 4JLRA 7PAZA 2H6OA 2HSAA 1A3ZA 3HE6A 3V1HA 4XKMA 3CK0H 1EWHA 2HN7A 4K23L 4PBXA 5E8DH 3RWHA 3Q4DA 2NUWA 1RKRA 1NC4D 4I2XA 2PO6B 2ZCLH 4GZJA 4K8EA 4XBJA 1S9KC 4YVXA 2FEEL 4WFEE 8FABA 1LL7A 3PGFL 5I09A 1SRDA 3QJFB 5D2NB 5IHUL 3LBMA 3FTYA 2IG2H 5HHQB 1IEBA 4YLBA 4J3VA 1GK8A 4ZNCD 2FUQA 4FFZL 1JWUB 2MQ0A 1A9BA 1B5TA 2C15A 2I56A 1J88A 1FP8A 1LRNA 5CSZA 1LLZA 3N9RA 2FATL 1Z9PA 4OAWB 3MOAH 3V4VL 4NP4L 3GJFA 4C8XA 4EI6A 1XLKA 4LBSA 1AIFB 1V3LA 1OGAB 1OO2A 1WAAF 2E6QA 3V5DA 3G77A 1CBJA 3P74A 5REQA 3UWZA 3P0YH 3UZQB 1EXUA 5E9AA 5I30L 1BAFL 4WWKB 1SO3A 3WFDH 4F33A 3GNNA 3LK6A 3HN8A 3Q2VA 2YL5A 3DLQR 4BF5A 3DNKA 5D55A 4BFIA 1A21A 2J8UE 1CLZH 1QBBA 3Q48A 2C9SA 5E1AB 1E5UI 4MZIA 4DWSA 4NP9A 3LCFA 3ZT7A 3UXAA 2XTJD 1A1OB 1TZHB 2BSDA 5FECA 1DVJA 3ZFHA 3VXRD 2Y4SA 1P4LB 1LWJA 1RZ8B 3LQZA 4XNYL 2BRRH 3TBYB 4MCYA 5DLML 1A6PA 1M6OA 3VWJB 2XWJB 4CBPA 5FSEC 4G6ML 1FVDA 4JTHA 4J1OA 4E2VA 3MBEB 4C6IA 5HDBE 3G8EA 4IGBA 4D72A 2XQ0A 3Q8CA 4A6YL 2I24N 3KW8A 1E15A 3FHQA 2DZXA 2PGFA 1BREA 3QC0A 4YS1A 2VDQB 3M0JA 2F15A 3G6JB 1PPIA 3HG2A 4NAQA 3OZ9H 5CJ8A 4YHML 1EOKA 4U6HB 4PRHA 5F7HA 2FDSA 1RQBA 3RU8X 1MI5E 2ARJA 1QX1A 4P2OB 3QUGA 3RPKA 4O1EA 3BI9X 2POTA 4EPKA 2HRPL 3QSKB 4FNTA 4DO4A 2O93L 2DSVA 1CDHA 3HI6L 1OBAA 1TOXA 5CFHA 1DIDA 2WNQA 4XMXA 2R8WA 4IBZA 3TWBA 1BP3B 4YHLL 3MBWA 2P5ED 4X5RA 1T89A 4HHHA 3U2EA 3EWUA 3WYZA 5I1CH 1PF3A 3LN9A 2YA2A 4IGBC 3H7BB 2FDBP 3VDHA 5I6LA 2C18A 4JFOA 1MZZA 2CKBH 5FF2A 2CIKA 2O1AA 2B16A 1LRQA 3E1F1 1UR0A 3BZEA 3VXRE 1FGVH 1G6RL 4KXAA 1SR0A 3AI0A 1IUZA 3WQWA 2WXPA 3KXFB 3FKKA 1HNYA 1UA6H 1I3UA 3SQOH 1KFJA 1ME8A 2X4SB 1OAZL 1GNXA 3QQDB 2PDGA 2UX6A 4S3FA 3MV8D 3OTRA 3OWRA 1B4JH 1B9ZA 2W07B 3WS3B 4E9YA 1KW1A 3HU7A 1OYAA 4L4TB 2DIBA 1TSHA 4X6EB 5EH1A 1OCRB 3QMTA 5DJ8A 3VSQA 2XPKA 3DTUB 5I23A 2ED9A 4CL7A 5F44A 2V5BA 4O0QA 4KHXH 4DW2L 2DL2A 1PIGA 5ACLA 1ILUA 5D1XB 3BH4A 1TUXA 4FIRA 3UJ2A 4AUBA 1UURA 2JEQA 1LNUA 4D3CH 2G4EA 3NGBB 3TIDA 2AQPA 4PR5A 4XVUC 2ZUMA 4ZR8A 2E9MA 2BNQE 1RALA 5IMKA 3IDUA 2ZTBA 5F4WA 1GS6X 2YD3A 3T0EB 1RAMA 4PH6A 4DNHA 1GQKA 2F7OA 3OAUH 3N9KA 3ZLQC 5E6IB 2H3NA 1K3IA 2JCCE 4MAYA 2XWBA 4OZ4B 4L8BA 4JQAA 3W57A 1MZYA 4PVMA 1ML0A 1EO8H 4A1RA 1F18A 4CGTA 1J7VR 4N0UE 3M1ZA 5G2WA 4MJIB 2YSSA 4Y2OB 3L7FB 1SEQH 3PWPB 2DYPB 3WEXA 1XYFA 1IGSA 2EO9A 1ZA3B 2DWXA 3CBWA 3TJLA 4M3KB 2EG6A 4D6IA 4LLQB 1DIOA 1AUSL 5KW9L 3W0WD 1AP2A 3NCMA 4PUBL 3G6DH 3DX2A 4JM2D 3UX9B 2BP1A 5AB0A 4UTFA 3IS1X 3EDEA 2H4EA 4NO0B 2TRSA 3C52A 1Z0NA 5AB2A 1NBYA 2QDDA 1KFLA 2NZ9D 2PWEA 4RMUA 3SJVE 4ABUA 3Q06A 4P7OA 3Q8BA 1Y07A 3QUZB 3F1QA 2X0VA 2J6EA 4MVAA 4Q8UA 1M2OA 5CU9A 4D7BA 5AN7A 1NBZA 3UXLA 4C6PA 4OLXL 2YPLE 2WKOF 1HH6A 3RZCA 4XI5C 3TNMA 3KYKL 1TR9A 2LAAA 2VCAA 4JFZL 4IQLA 2TSBA 1LO2H 4OD1H 4Y89A 1NCBH 5GGTA 2AC0A 3I6RA 3CC5A 1OAQL 3K74B 5AB1A 5J1TC 4HWBL 1ZT7A 1XFPA 35C8L 4U1JA 2EXSA 3B0PA 3M64A 5EMKA 3SQMA 4FALA 3TNNA 1OAZH 3VNDA 1FA4A 4AQOA 1N55A 1DL7L 2CZNA 1RZGB 4H88H 5ICXB 5DK0B 4DN4L 4GIEA 4FQLH 2V8MA 4S23A 3W87A 2COQA 5I18H 4NNYA 1F6PA 5D7EA 1N64L 4N0FB 2CBPA 3UO1L 3HE7A 4DHLA 3SQBA 2G4GA 1BBJA 3LZRA 2A9AA 2WKGA 1NLBH 1FWGC 2Y8UA 1XQ4A 3RR4A 2Y0SA 3W76A 4HXAH 2J9ZA 4Q8MA 5CZVL 3KPOB 3BV4A 3LDBB 3RRAA 4X8CA 3MA9L 1JZHA 5I66A 1VKFA 3WNNA 3IKCA 1G7PA 4WHYH 4LEXH 5L2KD 1PIIA 1D5IH 2QQLH 4KS0A 3NQCA 4GSDL 1UA3A 5MENB 3ALPA 3CJPA 3CU2A 3DSNA 3BE7A 3QNZB 5EL1A 3RIAK 1TZIA 4GYFA 4PJ7F 3PL6D 3TBSB 1GGBH 1CFMA 3MLZL 4QR6A 1ZBVA 3QIWA 4NF7A 3MWAA 4KPLA 3DENA 3H56A 1SEQL 2GTWA 4JRYA 5FJOA 4BI7A 4P8WA 1AMYA 3RFZA 3M1BA 4HD5A 1ORSA 5JIMA 3VD3A 2EDDA 3UZVB 2VR6A 4ORMA 1GTEA 2ZUTA 2DMHA 2PDIA 1E51A 3S1VA 1UOVA 3G6DL 3SQLA 1OP3H 1Q8JA 3E12A 2APTA 4I18B 1T7WA 4K2SA 1LVEA 2CG9X 1TRIA 3B4UA 2BFVH 1JEZA 4YBLC 2OT1A 4WGVB 3T77A 4S3CA 4G9DA 2YXOA 3GX9A 4N2MA 1Q1JL 1YN6A 3KLHC 2ATAA 3LXUX 2WQ8A 4M7JH 3P02A 1KCVL 3S3SA 2G9KA 3M1CA 1ZHKA 4OLXH 1UWEL 3L4WA 2ILLA 5L9DH 2Z25A 1MHPL 5K9KB 3HZYB 1YTEA 1H19A 1EUTA 1QFWH 4FPSA 1QDSA 1UOKA 1MLBA 5D7IE 1TWIA 7A3HA 2BNQA 2VE6B 3AS3A 2FJUB 4CCDA 4KQNA 3WIIH 2EO7A 3ABGA 1CTOA 4B9GA 1SN2A 2P8BA 4GJ1A 5AECA 4PFHA 3D7PA 3HE7D 1Z5HA 4GVFA 1JK8A 1SVCP 3IACA 4DQOL 4GVHA 4MVBD 3IDIA 3GBLA 2ZUYA 4RWYH 2K4AA 4EI0A 2Z2AA 1DBKH 4Z7OF 4LCWE 5DQJB 4GFSA 1JZFA 3QQ9D 2FJFB 1QA9B 5BS0B 4P9HH 4KRZA 4K5MA 4BM7A 1IAIL 3DUSA 4IGBD 1DANT 5DRXA 1QPQA 3QPYA 1YXCA 4MWAD 4YE4H 2DGAA 2MCPH 2VDRL 5HAOA 2N7SA 4IEFB 4A2FA 1NWOA 2PTUA 3O0RL 5C07D 4Z3IA 5HYIA 1IEQA 1TTJA 4CD4A 4MWAB 4N8VB 4M6VA 3BWZA 4TOQA 1FWDC 4XI5D 4OJDH 3RUGF 4CQCA 1V55B 4PGEA 2WTOA 2HV5A 4NZTL 3L5XH 3NIDE 4TVPL 1CZ1A 5CSSA 4L4VE 1K4CA 3ECBA 4ODHH 1RUPH 1KGJA 4EO5A 2CDGB 2B3IA 3QDJD 3C6LC 1DVFA 1T1WB 2WZPD 3RILA 1FX6A 4D0BB 3I7SA 3UZZA 1Z66A 3HLKA 2VRJA 3DG7A 2EDLA 3OKEB 4DP0X 4HJTA 4QLWA 3ME3A 5I16B 5G55A 4TS6A 4UM9A 5MP6L 3N42B 1NCTA 4HSQA 4MDRA 3WMLA 1ZHNB 3F00A 3C8HA 3GUFA 2R14A 3C3UA 4DWSB 5CSUA 2HA1A 3HBZA 3A4AA 4ZFZA 4LFHD 1RUMH 2XOTA 4JPSA 1PIFA 1XSOA 1WP6A 5HQMA 2OI9C 4H8WC 4MCYB 3VWJA 5B8CC 4UCFA 1NJ9B 1FVDB 2XFXB 4L4LA 1CR9H 3O6YX 1Q1JH 4AC2A 3WLNA 3LKQA 1GYMA 1WZLA 3WL9A 3O3DA 3IMRA 5EIQA 4O8AA 3S42A 1HZYA 1MQKH 3GSNH 1FZKB 1X6NA 1QBML 4BSVB 3QI9D 5I76B 1IBDA 4NZJA 1BIIB 2E6DA 2EIZA 1YYMH 5GS0C 2ADFH 5H2ZA 4P61A 1NOAA 5BJTA 4Q4KA 1OSPH 4FADA 2WO5A 4XOAA 2EDWA 4YDIH 1PYFA 2YKLL 3PZVA 2ADIA 4IDJL 1KB5B 4RGND 9CGTA 3W7PA 4UQAA 1YMME 1J1XH 4X9BA 2Z93B 4Y2NA 3CFBB 3DJTA 4QJ4B 1DUYB 1IIGA 4DF1A 4ZUSA 4JANA 4YL2A 4OM0H 3OKMA 5AFAA 3IDNB 3N5AA 2XY2A 3MV8A 5D4IA 1K9FA 1VFSA 4QM1A 5L2KB 4G83A 4XZLX 1I2OA 1R86A 4JG1L 4QHKJ 2P76A 2BIQA 1E4NA 5E5CA 5F1UA 4MKTA 4ODWA 2X1OA 1EDGA 1IHIA 2X44D 1X9RA 2ARWA 4HV8A 3P81A 2QGEA 4FLQA 5F2FA 1FRBA 2EYTA 4GO8A 2YBVA 4UTJA 5GHWH 1J0YA 1M1BA 1U83A 2J13A 3FH5A 3LQAC 1I9JL 3IRCA 3WS6C 3N14A 4EF9A 1VAHA 3WIJA 3FT4B 1CE6B 4OH2A 4HJ1A 4F24A 2EPLX 3EYFA 3RTQA 2WZMA 5FYJU 5HDBB 5LBSH 2RGLA 3NL5A 2J21A 2UWEB 2ZUVA 5D4JA 5FK9A 1CB2A 2GJPA 2IGFH 4GW1B 2FJGB 1QW9A 2DLFH 3ARGA 4PYHA 5AKVA 5F96L 4YDKL 4L1LA 3MUUA 3U4BL 3X1FA 2IFGA 3WLPA 4XMPH 4HA0A 2QPSA 3KPPB 2VQ1A 3FTXA 1R9ZA 1LXMA 5AVXB 3JWNG 4M03A 4O00A 1GVEA 1UBSA 3I65A 5EN2B 2V5JA 1S5WA 5K4ZA 3X11B 5J11B 3GF8A 2R83A 3VZYA 3V5OA 3RK8A 3O6CA 1GGCL 3PJTA 3WTSA 1A1NA 2DFAA 4L65A 3RMJA 2Q1EA 2X42A 5D2NC 3W7CA 3WGVB 3TYFA 4N4PA 5EF2A 2P80A 5D2LE 4DAFA 5HDQH 4RLDA 3MN8A 3LPPA 4FL4C 3B9OA 4LP4A 2YSSB 4Y2OA 1ZLWH 3LS4L 3O2DA 2LU7A 5MEPB 2X2HA 2WWKO 3O45A 4OVUA 2OJ1A 4A7QA 2YD6A 3JS3A 4S3BA 4WGXA 2J8OA 4L1WA 3MV9E 1TPUA 1ZCOA 3QEQD 3DVGA 3U82B 3QEQE 1MCHA 2CBVA 2YKLH 3CQPA 3APGA 1YECL 5FB8A 1TFVA 4NY2A 5BNXD 2J71A 1GZ1A 5AHFA 4OCYH 1YNLL 1OHQA 4OIIH 4Y9GA 4U0RC 2CFFA 1BQGA 2J47A 3NSCA 2CLHA 4E0CA 3BQUD 1EMTH 1RU9H 1T04A 3EO0A 2V2TB 3A64A 2Z1XA 3COOA 3V0JA 3O2WH 1N4XH 4LSVH 5IOPA 3NCJL 2ZYRA 4X4KA 1FO0B 5F7AA 3V52H 5D2WA 2W63A 2H26B 1UIPA 3VKAA 3HHSB 4I4WB 4DAGL 4NQEA 5DTFA 2BOGX 1NINA 4LALA 3OX8A 3CL6A 3CQJA 3P9MA 1K8XA 5D1XD 4XBGA 1N0LB 2V7NA 1UM4H 2XIMA 4FEIA 4D0CA 5BCAA 5I8OH 2OB3A 4ETQB 1S46A 3S35X 2WXQA 5CD3A 3QPQC 1Q9LB 2RTTA 3FRPB 1NC4A 4H00A 2R7EB 12E8H 4JPKH 4AIXA 2XCMC 1RZJC 3ARFA 3B97A 3BLIA 4TXEA 4ADUA 3TV3L 3V9FA 1XGRB 1W1IE 4NYUA 3MRMA 5BV7L 3FTZA 5AKTA 2Q7YA 5HYFA 3MLVL 2YPLA 4G8TA 3R11A 3NPVA 3I6LE 1AYRA 2OXNA 4LSPL 4RX0A 1RJQA 1V0MA 2FSEB 1R5VB 3HB3B 5BOPA 2BX7A 1A02N 4EOUA 2HXTA 1ZJBA 3WDIA 3CB3A 3VNMA 1DSFH 4IKLA 2YPIA 1CFTA 1IB5A 2B81A 4HS8H 1DQQB 3A6BH 3LHPH 1D3GA 2PUZA 1M7OA 3GYEA 3HBLA 2ENPA 1W15A 4R83A 3K2GA 2VX7A 2P5EB 2GVYA 4HGMA 1OPGL 1KTJA 1BEUA 3FJ6A 4YPGB 1EHLL 1BXXA 2NW3A 3NJHA 5DQDL 1ZD6A 4OLWL 3RDTA 1PS9A 1OT4A 2Q3XA 4UAHA 3PDDA 3UZVA 3UBXB 1JIBA 3B04A 2ZCHH 3GS4A 5SX4I 2LOEA 3IGAB 5DMLA 4L4VA 1GW6A 4Q4SA 3RPDA 5HQLA 4NX5A 3NP3A 2BWIA 1A1MB 1BMZA 4XNUL 4DP4X 1I1AD 3SPCA 3DMMD 4AWJC 3SPVB 4P4RB 2MNUA 4ADJA 3FJ4A 4KIRA 3TXVA 4PJHF 5DHYB 1O75A 1L3NA 4M8VA 1IX2A 3UXDA 5JYLA 4UTMA 1IZCA 3EJUA 4X0KA 3D2UB 4PY8J 1BA9A 4PIBA 4OGXH 1RIHL 4D8PA 4FZIA 1CYGA 1OGSA 3VXOA 1QRKA 1A6VH 3RYMA 1T22A 3VXPA 1N12A 2G3XA 3QK0A 4UM9D 4IOTA 2NSOA 3FNKA 4F57L 3Q1SL 4NWUH 1MCSA 2R4RH 5C0AE 1W2PA 3DYMA 1AKJD 2XUWA 4JKMA 4QF1A 1AGBB 1B9BA 1NGWB 3D3VD 3APMA 5AOZA 2AK1L 3VFOB 1ZBKA 4XUGA 4ZFCA 3O9WA 2KZHA 3WKZA 4E2OA 2DT0A 5HGGS 4UTTA 2X05A 4C6NA 4M82A 3NSNA 1LK2B 1HYSC 1TLMA 4NPYB 1F3TA 2PPAA 5IBUB 2ICES 5DHVA 1OWWA 3QIUD 4Z7QF 2UY3A 2GC4C 1VFHA 2DSWA 4G6JH 1BF6A 4QTIH 4LIQE 1LLWA 1HKMA 1A8JH 3W26A 2XTSA 5HGHA 3W7RA 4NUJA 4O02H 1Q45A 5DT7A 2VXQH 4G5ZH 4HF5L 5D9SB 3EXRA 4C6FA 4N1HB 1UATA 4C6LA 4FXSA 4JKPL 4JO3H 1B6UA 4QPEA 4M7ZC 2FYYA 2WTPA 1T7ZA 3V7AG 2EDMA 2QELA 3KR3H 2YAFA 4OZIB 3CH9A 1XIWD 2J2ZB 2VB5A 5FI8A 5I1GL 2VDLL 4I48A 1XKJA 4KDWA 2DZEA 4DKEL 4F2MB 4RESB 5HYSB 4UR7A 4LO9A 5LBGA 1QD0A 4XBEL 3TT1H 4QRRA 3OV6A 1Z41A 2OPJA 1G7PB 5GNZA 3MRBA 2WM1A 4IHCA 1O5KA 1ZAJA 2AI0H 3SCWA 1MQQA 2C34A 2C4FU 5GNXA 3HE7C 4K3JL 1X7SA 1XGDA 5D4HA 4N3UA 3P0VL 1GYUA 3AG4B 3ZYOA 4PVLA 1PBGA 3QWOA 1IIHA 3QIWB 3WS6A 2G5WA 4JTAA 2D0HA 5C2GA 3RM4A 4XWGL 4Y2DC 3MACH 1DWGM 3M8OL 4J5NA 1KIRB 4KRNA 4RZCB 4U6VL 3SO3B 3TZVD 1YADA 1HEHC 2CUHA 4AH2B 2PTTB 1V7YA 1NUNB 2NZLA 4KRPD 5IROC 5REQB 3RBGA 3WIFB 1OB1B 5CC6A 1IT7A 3SDAD 3B2VL 4OGXL 4ANKA 5IB4A 2BSSA 4FQPA 1YPXA 2F6XA 3ISIX 2PDMA 3O3RA 4NKIL 3CIAA 3P30L 3PFMA 3EOAB 4LCSA 1KELL 4H1LA 3BUIA 4WO4A 1PCXA 4X99A 2ITCB 2VIRB 4JM2A 4Z95L 1BYNA 4UUIA 5C0DB 4HFWA 3KWXA 5ICUA 4R5EA 4HCGA 4P2OC 1IIKA 2R29A 3VI3F 2B7PA 2PABA 2I9EA 1IBGL 1XLBA 3R8HA 3VSUA 2OQLA 2IH1A 5A6KA 4G9FE 1UH2A 3BOLA 2VEIA 4P8VA 1Y1UA 4JBSA 4R88A 4MMYA 4XCEB 4Y4HD 4JN1L 1ISYA 3WFEH 5LG6A 4HZ1A 4UT9A 4KHXL 2JI1A 4CDHA 2X5PA 2DUZA 3MV9A 2EKCA 4IPLA 4HNTA 1K8IA 2GT9A 3KCPB 4D3CL 4LNCA 1Q7ZA 2KI6A 4P2OA 2PB1A 5AW9B 3SJVD 5BXFB 2IKIA 2NY1B 2UWEA 1HN1A 3U9PL 3WK1A 3WTTA 3FHEA 2AV7B 3CFDB 2I26N 4R2GB 2QTVA 4Q6IA 1TPB1 3T3ME 6TAAA 4AIUA 1IGCL 1QUPA 5HJDA 3TT1L 2NXYD 4S0SD 1SZRA 3HJEA 5D7LE 2XN0A 5CKAA 4WI0B 3TA3A 3H7UA 4DN4H 1DOSA 3E7JA 2Q3OA 1KXQA 2V7HB 5DD5H 3S1GA 3BAKA 5FLUA 1WZ1L 5A3IC 1KLGB 1INDL 3TJEL 3B03A 5HPMA 4JDVB 4K3JH 1YNKL 2NX5A 3QORA 4X5LA 1Q6EA 3E6FB 3QRLA 5KSAA 3B2XA 3EB2A 3V6FB 4DOHB 2C1HA 1FPTL 4HLZH 2PWVA 3QUKA 1IC0A 3HZVB 1RULL 1NARA 3GK0A 3QMRA 1S7TA 1TVPA 2GB2A 4OUOA 4AVOA 4LHUB 4ES4A 1HCYA 5IJBC 3LRHA 1REIA 3MJ8A 1I8MA 3DFSA 3W7LA 1ZHNA 4OFIA 4BSJA 2BERA 4ZBJA 4CADB 5GISH 2I7OA 1KXTB 5SWSE 2XZQH 4E9LA 1GG1A 4GVIA 5A8OA 2MH4A 3OKYA 1MG3C 3BH8B 1C91A 3W9DA 1LEKB 2UY7A 4HUCA 5DUBA 3AS1A 3TIEA 3ZMNA 3NQ8A 1CUOA 3BGMB 1KC5L