4PCSA

Crystal structure of a bacterial fucosidase with iminosugar (2s,3s,4r,5s)-3,4-dihydroxy-2-[2'-phenyl]ethynyl-5-methylpyrrolidine
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
439
structure length
439
Chain Sequence
b'EIPLKYGATNEGKRQDPAMQKFRDNRLGAFIHWGLYAIPGGEWNGKVYGGAAEWLKSWAKVPADEWLKLMDQWNPTKFDAKKWAKMAKEMGTKYVKITTKHHEGFCLWPSKYTKYTVANTPYKRDILGELVKAYNDEGIDVHFYFSVMDWSNPDYRYDIKSKEDSIAFSRFLEFTDNQLKELATRYPTVKDFWFDGTWDASVKKNGWWTAHAEQMLKELVPGVAINSRLRADDKGKRHFDSNGRLMGDYESGYERRLPDPVKDLKVTQWDWEACMTIPENQWGYHKDWSLSYVKTPIEVIDRIVHAVSMGGNMVVNFGPQADGDFRPEEKAMATAIGKWMNRYGKAVYACDYAGFEKQDWGYYTRGKNDEVYMVVFNQPYSERLIVKTPKGITVEKATLLTTGEDITVVETTRNEYNVSVPKKNPGEPYVIQLKVRAAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-L-fucosidase
molecule tags Hydrolase
source organism Bacteroides thetaiotaomicron
publication title Exploiting the Hydrophobic Terrain in Fucosidases with Aryl-Substituted Pyrrolidine Iminosugars.
pubmed doi rcsb
total genus 163
structure length 439
sequence length 439
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4pcsA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4pcsA01
1EA9C 1V3IA 2E40A 3N9KA 1HT6A 4H8UA 1R47A 2FGZA 3PTQA 2V3FA 5I24A 1UUQA 2HISA 1E4MM 2XUCA 3LRMA 4FLOA 1H09A 3QR3A 2DGAA 2EPNA 1MW0A 5HNNA 1KR0A 1QNPA 3WD4A 1JD9A 1OCQA 4PMNA 1BAGA 3WUEA 3DC0A 4UFHA 2XPKA 1HJSA 5BWFA 5CGTA 1G9HA 1BYBA 1YHTA 2E9LA 3DX3A 3EDFA 4UQAA 3WENA 5E6YA 1EO5A 4FNSA 3SCOA 1P6WA 3RDKA 4AMWA 4JFSA 1LF1A 1O7AA 5E0FA 4U5IA 3H53A 2UY5A 2ZXDA 1W3JA 3WDHA 5HDRA 3ZSTA 3L2MA 4LYRA 1R7AA 3MI6A 2F1AA 3NSMA 3NYDA 2ZWYA 2YA2A 4AWEA 5EBAA 3UG3A 4JL2A 3RCNA 3W28A 2C8NA 1UWRA 4TVUA 1HJUA 5HBFA 4MB4A 2EBNA 4QLLA 3WD2A 1CXEA 4CUCA 3AXXA 4KRUA 1FA2A 1FFRA 2XIIA 1C7TA 1NP2A 3CZGA 1U30A 1C90A 2W5FA 3WY3A 4BZYA 3WNKA 4D6CA 3AI0A 1BGAA 3WQVA 1KGUA 1X6NA 1V6WA 4LXFA 4GO8A 4Q22A 3WFLA 1W2VA 3U5UA 1HIZA 3LX9A 3WELA 2WSKA 5A8OA 3QHNA 4B3KA 2ZUSA 1FP8A 4RL3A 3VDAA 3NJ3A 1KCKA 4FK9A 3WBEA 2J8GA 3AS2A 3SCPA 1ODZA 4HMEA 1V0NA 1CWYA 4PTVA 4HU8A 5GPRA 4M81A 5TD4A 5D9MA 2CNCA 4B15A 1R75A 2OYMA 2D23A 2PWEA 5A6BA 1CECA 1ECEA 1JDAA 1QI2A 4IPNB 4UFIA 4DM2A 2WKGA 4W86A 2A3HA 5A6JA 2FDMA 1OB0A 1CBGA 5BRQA 1J12A 5LA1A 2WCSA 3EBVA 3WUBA 1B3WA 1PZ2A 1AQMA 4Z2HA 1AMYA 2WC4A 1JG9A 4LPCA 2W92A 2ZX5A 3HU7A 3UG4A 1BG9A 4KWUA 2WLYA 4AD3A 1CXKA 1R8LA 3VIPA 3KL5A 7CGTA 3VGFA 3AZSA 1R34A 5GNXA 4P8VA 2ZUWA 2OWWA 4HA1A 2XFFA 2VVNA 4V2XA 3DDGA 4UCFA 4TOQA 1KWGA 2J75A 2OW6A 3MUIA 3K1DA 1C8XA 3WY2A 2WC3A 3S5ZA 4J3UA 2CYGA 1QWNA 1VIWA 5GNZA 2E9BA 1CNVA 1B9ZA 2VI0A 1B3VA 4PMOA 3AYRA 3ARTA 4KGLA 1Q6GA 2QF8A 1H2JA 3APGA 4AIOA 1RP9A 3BAKA 3SCSA 1UR0A 5I0DA 3BUQA 1BYDA 1QBBA 3VGBA 4M8UA 3W29A 2VURA 1M53A 2ESCA 1UWSA 4CU8A 1H41A 3ZJ8A 1PPIA 3AJ7A 4FLSA 1R87A 3KLKA 1XD0A 3A4XA 4AZ5A 1ODUA 2GDVA 3WUGA 3EYPA 1M7XA 3PZQA 3WD1A 3ZMRA 1E55A 4PMRA 3VIJA 1UH4A 2ZUTA 4DWSD 4J3XA 2CBUA 3O2LA 2GSJA 4JHOA 1XD1A 1W9BM 5A69A 1W9PA 3AISA 1B1YA 4NZJA 4JKLA 1H4PA 2CKSA 2BFGA 2XM1A 1XCWA 4AZBA 1UQYA 3WDRA 5EFFA 3NSXA 1SFSA 3OB8A 5IHSA 1UKOA 3WL1A 1HXKA 5JBEA 1TQTA 3SCUA 1VBUA 3DX4A 4U3AA 3GZAA 1BHGA 4JL1A 1UWTA 1H11A 2VX7A 5A8NA 4ZXLA 3MS8A 2WPGA 2ZOXA 3S6TA 3MU7A 3VSUA 1OT2A 1G94A 2DT3A 2XGIA 1Q6CA 1FH9A 1VAHA 5JBFA 3L4UA 4AZCA 3WQ8A 4PMQA 5FCZA 1TVNA 2ZUNA 3T08A 3WL0A 3DX1A 1V03A 2JF7A 1UKSA 2JEPA 3TTQA 4J3TA 4J3VA 2EAEA 4AEEA 3AS3A 4QCEA 1WE5A 3GH4A 2DIJA 2V5DA 3FXYA 2Y8VA 5D9NA 1XH0A 1EO7A 2ZICA 4WKHA 1G0CA 1E1EA 1YQ2A 2XVGA 1NP0A 2VZVA 2Y8KA 3CC1A 4OOZA 1QNOA 3FN9A 4W8BA 1GORA 2WHMA 3UESA 5I3DA 1LJYA 4Z2JA 3RM8A 4MB3A 4UOJA 4C7FA 2ZX9A 4JIEA 4HOXA 2O9RA 3W24A 1DWGM 4MPKA 3WKZA 4W5ZA 1SR0A 2WKLA 2QMKA 3HZ3A 3FY1A 2VR5A 5CXPA 4AYGA 3B9DA 2D24A 3SIMA 1O6IA 1BSIA 4DWSB 3VO0A 2Z1SA 3SEPA 4H2CA 3AXIA 2BS9A 3VUPA 1LQ0A 1JIBA 3K8MA 1DWHM 4HZ6A 3KLLA 1B3ZA 3SUVA 2DT1A 1MXGA 5ABEA 2XSAA 3OLGA 5A2AA 3CLWA 4GQRA 1MQQA 4MB1A 2QLYA 4K68A 2CHNA 2E8YA 1UD3A 1TFVA 4TTGA 5CSUA 3BUBA 1AQ0A 3MMUA 3DYMA 1UD4A 5M5DA 3F5JA 1QWUA 2F8QA 4PMZA 4D6GA 1HP5A 1Y7VA 2YKKA 4V28A 3CHFA 2F7RA 2XG9A 4HMCA 2D1ZA 3WF2A 4H8VA 3IK2A 2AOSA 4DUXA 1QI0A 1W9XA 2ZUMA 2G3NA 2DSUA 3AHXA 3NDYA 1NWRA 4CN4A 3RPMA 5CLTA 4HU0A 2J47A 2BHYA 4AZHA 5BYWA 1CTNA 1E5NA 3EMQA 4WKFA 4NZFA 1L0PA 1E3ZA 1V0LA 1HKJA 5A6AA 3F4VA 5CSYA 2VCCA 5AC5A 4ZE4A 1OIFA 3VIIA 3DDFA 4H04A 4JFTA 3OLDA 1XYZA 3WY1A 2DT2A 1GOKA 4DWSA 2YL8A 4M56A 3WF0A 4UZUA 2OYLA 2W91A 5DFAA 3WNMA 2XFYA 2EPOA 2X2JA 3T2QA 2PBGA 1X6LA 1B31A 4P7RA 1X1NA 5AC4A 2YBUA 4HA4A 3H55A 4UQEA 1CGTA 1TUXA 1JI2A 3N1AA 3UR8A 4P7QA 4TX8A 5BXRA 1I1XA 1JF6A 1TQUA 2BXZA 1PBGA 3SCVA 2VZUA 4WLCA 3VSTA 4W89A 3VINA 3WNPA 2VQUA 4J27A 3CO4A 4PTWA 2WCAA 2QPSA 2JEQA 2VRKA 3BVXA 3IGUA 4PCTA 1UR9A 2DIEA 1JD7A 4XB3A 3K46A 4CU6A 3ZJKA 2YDQA 1W9VA 4FF5A 1FP9A 3AFBA 3RM4A 3AMKA 3T0DA 1BFNA 1IT0A 3LRLA 4MAZA 2A3BA 1EDGA 3RILA 3VM7A 2J77A 2YLAA 4PYSA 1GQKA 3UERA 2A3EA 2J79A 3BAYA 3GXIA 4FLRA 3D3AA 2G8ZA 1JFHA 3CIVA 2EQDA 1E0XA 2O9PA 5LYRA 4A3YA 3WF3A 4A4AA 1HL9A 2AAAA 4GXPA 3WH6A 3VU2A 5A2BA 2WW5A 4QDMA 3A22A 5LA2A 1EGZA 1HKMA 2X05A 5AY7A 1JZ2A 3WMBA 2J7DA 4W85A 3IAPA 4UQ9A 1WZLA 3B8SA 4PN2A 4UOQA 2VL4A 1SMAA 3NUKA 4GZEA 2BVYA 5F7UA 3TTYA 3F5LA 2WSPA 3MUY1 4KMQA 3AZRA 3WSUA 3G6LA 1ISWA 6A3HA 2O92A 1LL7A 1EHAA 3CGTA 3B9AA 1TE1A 2E0PA 1TA3B 3QHOA 1CGYA 1VEPA 1ZS2A 3OLEA 1KXQA 2ZXBA 1KBBA 3KEHA 2YL5A 2CIPA 4MDOA 1OD8A 1Q4NX 3GM8A 3CZEA 3TTOA 5JBDA 1SZNA 3BVVA 3WF1A 3AIBA 1H0GA 4WSKA 2G3JA 2WB5A 4LGXA 3VVGA 3OZPA 4PMXA 1ESWA 1UR2A 1OD0A 2F7PA 4ZENA 4ACZB 3TV8A 2WHKA 2IUZA 2EEXA 2WWCA 2V3GA 1TR1A 2VX6A 1V3HA 1UD2A 1DTUA 4X9YA 1VEOA 1MW1A 3T2PA 2JIEA 4DUWA 4FNRA 4Z2LA 2A3CA 1BVNP 2CETA 4GZJA 5I23A 3KL3A 5DF0A 1BGGA 3EJTA 5JIWA 1KQZA 2VTFA 4JFWA 4AMCA 2ZUVA 1J0ZA 4GKLA 1CXFA 1V0KA 1FFQA 4UOZA 1OBAA 3DYOA 5A8MA 2YIHA 3LPOA 2CBJA 1JFXA 4BQ4A 1H0IA 1HKKA 1NQ6A 4CD8A 1JXKA 1CEOA 2FE0A 4GZIA 4P7LA 3QGVA 4PUEA 1LWJA 1JZ3A 2IXUA 2ZXQA 3CHEA 2VQTA 1E6RA 1ZBWA 1EQPA 2D20A 3CHDA 3ZQ9A 3MANA 3ARWA 5A6LA 2ZUUA 5BXTA 3W38A 1HXJA 4BQ5A 3VMNA 4QAWA 1W2PA 4MNKA 3VDBA 3AQUA 2Y5EA 4L4OA 4PRWA 5A8PA 1JZ8A 3AMDA 4EE9A 5EMYA 1V3KA 3GXTA 1DWJM 1KTBA 1K9DA 3PN8A 1JGIA 1XH2A 2G3IA 4CD6A 1JDCA 2VRQA 3VD3A 2DT0A 3RJXA 1DEDA 3ECQA 4OIFA 1IZKA 1NH6A 3VNZA 2GJRA 2BNJA 3VD9A 3ARQA 4OKDA 3M7SA 1TZ7A 5DEZA 3BGAA 2DPEA 1KXVA 2CXGA 1C93A 4W8AA 2W67A 3HG2A 1XCXA 3OG2A 1CXLA 4TVDA 4GI8A 1Q6FA 2BY0A 1GHRA 4JZ5A 4ATLA 1OINA 3ZR5A 3A6OA 1AQHA 4QLJA 3PZUA 3VM5A 1C8YA 1L8NA 1WZMA 1KGWA 3L4XA 1DWAM 4AD0A 4DO4A 2EABA 3ZO9A 5FKYA 2XGBA 1W9UA 3SUSA 4CU7A 4AIEA 2WVUA 1QNSA 3EDDA 5KZ6A 3W81A 5IFPA 1MW2A 4Y7EA 3B9EA 4ZEPA 2FHFA 1W1VA 1XRVA 2X8RA 3HG3A 1GQLA 1VJZA 3GXPA 1OGBA 3CBWA 5DO8A 1GQJA 3EDKA 4B3LA 1GUVA 1U33A 1ISXA 5ABFB 2F1BA 3M46A 4AMXA 3EJQA 5D8ZA 2FHCA 1MW3A 1QW8A 3GYCA 4GI9A 4FNQA 4UQDA 3K4AA 3DHPA 1JAKA 4JFVA 1RPKA 2OSXA 3OBAA 4HPGA 2WK2A 4MTVA 3VIGA 3W26A 4QCFA 3VX1A 3N18A 3UEQA 5CQ1A 4AZ6A 1XSJA 1VFMA 4S3JA 3I3BA 2WBGA 1OSEA 2HVMA 1JL8A 3K8LA 1J9YA 1UWIA 3BVTA 1UOKA 2EACA 1GVYA 5BXSA 1QHPA 1OGSA 1H5VA 4NXKA 3G6MA 3VKKA 2D0FA 4W87A 4DUVA 1ZJAA 1V6YA 2PWHA 4BS0A 2WXDM 2E9MA 5FIPA 1V6VA 5I2UA 4X0NA 1F4AA 1W1PA 4D6FA 2ZX6A 1HTYA 3WDIA 4J3SA 5EFDA 1LL6A 1A47A 7A3HA 3AMLA 5AYBA 4FNTA 5I77A 1WZAA 3IJ8A 4F79A 4NSBA 4M1RA 2DSVA 4JKKA 2EPMX 3SCWA 1HN1A 4J7RA 1WDPA 2WNWA 1E4LA 3WUFA 3W6LA 1UD8A 4CGTA 5BXPA 1EIBA 2F2HA 4NF7A 1UKPA 3ZJ6A 2YFNA 2OSWA 3WQWA 2FH8A 3DX0A 2YFOA 4ZXOA 3THCA 2X2YA 4UTFA 4OGZA 3PTMA 2WM0A 2OWCA 3N12A 1MYRA 1T0OA 1UD5A 3GXDA 1ZBVA 4EANA 1QW9A 1NOUA 3VTRA 4D6EA 1E9LA 3BLBA 3M6DA 1E3XA 2D22A 2FYVA 2J7BA 2VT0A 3A23A 3EMCA 1V0MA 2JF6A 1CIUA 3I3DA 2ZXAA 4DO5A 3LPGA 3S2CA 3LXAA 9CGTA 1E0WA 1JYNA 4W8LA 1NWSA 2W61A 3EDEA 2W63A 4AZ7A 1H49A 3W6MA 3EJPA 5I6SA 1E6ZA 2VRJA 4Z2KA 1EOMA 5D8WA 2XVPA 5A6SA 5E1QA 1GOOA 2E8ZA 4WSJA 3W37A 2BHUA 4W7UA 4IPLA 3DECA 3WNNA 1GCYA 2TAAA 4PBGA 1WAWA 1LWHA 5A1AA 2GJPA 2DH3A 1W32A 4WKAA 4PSRA 1J18A 4XUYA 3GNOA 1W3HA 3VPLA 5E9AA 2IXVA 2PBOA 4RE2A 5CZKA 1HX0A 1CDGA 5CGMA 3VIOA 1HJWA 1B2YA 1CGVA 3BCDA 3NDZA 2WMGA 2VO5A 4NXSA 1GOIA 3AROA 1GPFA 2WZEA 2J62A 3AIVA 4CVWA 3BVWA 3NCOA 3VIMA 4GQQA 1CXIA 1TMQA 2XIBA 3BC9A 4F9DA 5IFTA 2OWXA 1JZ6A 3TTSA 1FH8A 4JHZA 1UHVA 1VFFA 4MDPA 4TTUA 3O9NA 3VDCA 4E8DA 1TQWA 3MMWA 4FNUA 1K9TA 1XSIA 3LPPA 4TX6A 1CPUA 2VCAA 3W53A 2Y4SA 5DT5A 4UZSA 3FW6A 2DSWA 3SUWA 3VD4A 2WCGA 3VGGA 2GK1A 4MNLA 2X0YA 4C7DA 3F5KA 3WD0A 1UR4A 1S46A 4GIAA 3ARRA 4OJYA 3WMCA 4V27A 2UWFA 2FHBA 2RGMA 1JDDA 5LA0A 3A4WA 5D9OA 3FAWA 3U5YA 4MJ2A 1GOQA 1V02E 2YJQA 2WHLA 3WH7A 3M07A 1WKYA 4W5UA 4ATDA 1Q6DA 1CZ1A 3MSGA 4UFKA 1RH9A 3VMOA 1UA3A 1JI1A 3N13A 2DSZA 1FH7A 4CCEA 1R86A 4AW7A 3NIYA 1OGGA 1ISVA 1EH9A 3PZOA 2EADA 1B0IA 5FOOA 3D52A 2WVTA 5A6BD 4PSPA 4JCLA 3VIHA 3GH5A 1BYAA 4HPHA 3BAWA 1J0IA 1FHLA 4D72A 2D3NA 3BAIA 3BH4A 3DX2A 1R33A 1PS3A 4HOZA 3UCQA 1N82A 3PTKA 2XTKA 1QX1A 2VZSA 5ECUA 2GK1B 1UYQA 3GBDA 3N11A 1XV8A 3EJUA 1ITXA 3IJ7A 3QHMA 1W1YA 5E0CA 1JNEA 1KXHA 1QI4A 5A95A 1PX3A 1GNXA 3U7VA 2GJXA 1GVIA 4QFUA 1UA7A 2QPUA 4N0RA 3IAQA 1PEZA 1HVXA 2DEPA 2O9TA 1KQYA 2PB1A 1UG6A 5HPOA 1V6UA 1DHKA 4QP0A 4NRSA 3ZOAA 4CD7A 2YDRA 2X2IA 2ALWA 1XC6A 1I1WA 5JIPA 1PX4A 3FAXA 1WNOA 3L4TA 1V3JA 2Q8XA 2CPUA 1BG4A 2YA1A 4W84A 1UH3A 2YLLA 4YHEA 4A3HA 4MNMA 1JF5A 2XWDA 4EK7A 1GONA 2CESA 3D5HA 4AY1A 4HZ8A 3W82A 2NT1A 4OBRA 1CLVA 1LLOA 1EXPA 4YHGA 5I78A 4NZCA 1BF2A 1WDRA 4AZCB 3CUHA 1W3KA 5I79A 1US3A 3AIWA 3FHAA 4F9JA 3CZNA 4DO6A 3WH5A 2XVLA 1CGUA 1E6QM 2Y2WA 3W25A 4AC1X 2J78A 2G41A 3OGSA 3ARZA 2XVNA 3AIUA 3AZTA 2G3MA 4AD1A 4OZOA 2A3AA 3RJYA 1KTCA 1GJUA 1DP0A 3ARYA 2WLZA 3CTTA 4CN1A 1WB0A 2D3LA 5A94A 2XVKA 3ALGA 4P8WA 2J7CA 3AOFA 1D7FA 4CVUA 3WQ5A 5C70A 3T0BA 2XSBA 1QHZA 4LYPA 3OGVA 2IGTA 1TQSA 1VB9A 1QI5A 1TVPA 4U3CA 1XH1A 1LL4A 3D50A 2W66A 5EB8A 1HL8A 4TUFA 4U5KA 1NWUA 1KGXA 5HPCA 3CHCA 1W3LA 5A8QA 3L4WA 2PWGA 1HKIA 3QOKA 4ZE5A 2F7OA 1C91A 2W4XA 1C92A 2ZIDA 1PIGA 4PTMA 1GQIA 2GDUA 2VOTA 3ZT7A 4CD4A 2XFRA 1BYCA 3PHAA 1IV8A 4PEEA 2XN1A 1W91A 3I3EA 3HN3A 2WBKA 1C7SA 1JAEA 4D1JA 4WJXA 3CV5A 2PI6A 1E40A 3VD5A 3MSDA 3WNLA 2CHOA 3D51A 2CKRA 4BCEA 3CZ8A 2GVYA 2VZTA 1HJQA 1I75A 4IISA 4XV0A 1MQRA 2DH2A 4CKQA 3EJRA 1HF6A 1NARA 4F8XA 1U2YA 3DYPA 2PC8A 1NWTA 3VD7A 2Y24A 4XZWA 2BXYA 1UR1A 4CD5A 2F7QA 1WZKA 3KWXA 4D6HA 2CCRA 3POHA 4ACYA 3UR7A 2J7GA 1MFVA 2J4GA 1J0KA 4AD4A 4LYQA 4MNJA 2XYLA 4WF7A 3AIQA 3POCA 1R85A 3EJSA 1SMDA 3IJ9A 4IUGA 4JCMA 1WPCA 4AISA 4MB5A 5D9PA 1A3HA 3MUZ1 4H41A 5C8BB 1NM9A 4P8XA 1R46A 2V5CA 3OIHA 7TAAA 4GINA 2JFEX 3FHQA 3HG5A 1VBRA 4CN6A 2QV4A 4D6DA 3AIRA 3EMZA 3GNPA 1F4HA 3O6AA 1O7DC 5GQBA 2BY3A 1PJ9A 3D4YA 1GZJA 1OIMA 4CCCA 3WEMA 2EJ1A 4HP5A 2YDSA 3BUDA 2DSKA 3WFZA 5FL1A 3AMGA 3ZSSA 4DM1A 5IHRA 1BQCA 1JZ5A 1TQVA 1KCLA 1UZ4A 4M82A 3CZKA 2V38A 1JZ7A 5CJ5A 1J0JA 3WN6A 2V3EA 1VF8A 1HJVA 2CERA 4AIUA 1J0YA 3ZIZA 1QHOA 1E15A 3UG5A 4B9ZA 1WDSA 3GNRA 3LPFA 4PTXA 1ZBCA 5BRPA 2OLHA 2D0GA 3MUAA 4M29A 2NW0A 3VILA 4W93A 3SCRA 2MANA 4KRTA 3BSHA 1D3CA 2OW7A 3VDHA 1MVYA 3ARPA 2WZHA 3J7HA 2WVSA 4BF7A 4ATWA 3CUJA 3A21A 4GPNA 4UFMA 5IDIA 2FGLA 4B16A 2D73A 1SYTA 1ZBKA 5E09A 1WDQA 4U2ZA 1QPKA 2VUYA 4URIA 4UNIA 1GW1A 2PF0A 2QMJA 1WP6A 2J8FA 1JZ4A 2OYKA 1R7OA 3PZGA 1E5JA 4KGJA 1MQPA 3VGDA 3ARVA 3AIEA 1M01A 4QLKA 2VR4A 3BVUA 1K9FA 1UR8A 4BQ3A 2VC9A 3MV01 1C3FA 3CUFA 3ALFA 4UQCA 1B3YA 4AZGA 3RO8A 3AMCA 1E72M 1QVBA 2YOCA 1K6AA 2CITA 1Z32X 5CG0A 2J7FA 2VX4A 2X1IA 3GXNA 1W9DM 2WYSA 2XJ7A 2UY3A 2WMIA 2JALA 3LRKA 1VRXA 1UWQA 3OZOA 1BVZA 2XWEA 4FLQA 3BLPX 3ZJ7A 2VZOA 5BROA 2WVVA 3CZJA 2EO7A 3FNDA 1WO2A 2WMKA 3VGEA 1RD6A 2VCBA 4OOUA 4PMYA 1RP8A 1VFUA 3WEZA 2FH6A 3ZT6A 2ZX7A 4AYSA 1ITCA 3WNOA 3WDJA 2CBIA 5C71A 3WY4A 1VEMA 3RIKA 3GH7A 4F66A 1B30A 3SCTA 2F18A 3H54A 2UY4A 5FD0A 3K8KA 4ML4A 2D0HA 4WIWA 3L4ZA 4LQ1A 6TAAA 1QI3A 1ZB5A 3A3HA 1ZJBA 4U33A 2VJXA 1E6XM 2O9OA 4S3KA 3NSNA 1M04A 3MKKA 1XGZA 4E2OA 5M3WA 3CPUA 1UWUA 3DHUA 4GI6A 1E56A 5M17A 3MV11 5A3HA 4W7WA 3GTNA 3RMEA 2WVVB 1UKTA 3L2LA 3OA5A 2E3ZA 2XM2A 3PZTA 3BMVA 4TVCA 3VX0A 2DDXA 4HTYA 1ISZA 4LX4A 4HA3A 1E4IA 3TP4A 1CENA 1H3GA 1WCGA 3AICA 4XX6A 1NOFA 2XHYA 1QNRA 3AS0A 1Q6EA 4M24A 4N42A 1GHSA 3HJEA 1QOXA 1KFWA 5HOSA 4UFJA 1KBKA 1BPLB 2WANA 3BAJA 3VSVA 1QBAA 3SURA 3E1F1 3KZSA 2ZE0A 4M80A 2J7EA 1VENA 4NRRA 3UETA 3BAXA 4GO9A 1BTCA 4RE3A 2XN0A 2J74A 5DMYA 4MADA 3A47A 1UH2A 4W7VA 4D1IA 2GUYA 1UZ1A 5ABGA 4H7VA 5ABFA 1XSKA 5I5RA 1OT1A 3OGRA 5CPSA 1IZJA 8A3HA 1D2KA 3SUTA 1E1FA 1EOKA 1KXTA 3LMYA 1GOWA 2BV9A 5D4YA 3HG4A 3A4AA 5A6KA 2RGLA 4FNPA 4UQBA 1UQZA 3L4YA 4D6JA 1AVAA 5E6ZA 3WDQA 4PUDA 1MFUA 4AZIA 1ZL1A 3SUUA 2J25A 3EDJA 1PIFA 2EXOA 1EDTA 4Z2IA 2XN2A 4AXNA 4H8HA 1JXJA 4D71A 3PZMA 2EPLX 2B31A 1TG7A 4Q7NA 1VJSA 1PZ3A 4L4PA 1HVQA 3T0AA 2VVSA 3T09A 3BXWA 1ISYA 3TONA 1H1NA 4P8UA 2YA0A 4EAMA 3CMJA 3BUIA 1J01A 2F61A 2WMFA 2VMFA 3GXFA 2G4FA 1OM0A 1G1YA 3PZVA 2X09A 2X0HA 1E73M 4HOWA 3GDBA 1E4NA 4PMUA 3BUPA 2WC7A 1EDQA 1J11A 3N04A 4W88A 4BA0A 3BLKA 4XZBA 3CUIA 4U31A 1JYWA 2D2OA 2Z1KA 3KL0A 2W62A 3BMWA 4P7OA 4PMVA 4KH2A 2J7HA 1UKQA 3WD3A 2BVDA 3U57A 2ZWZA 2BY1A 2GFTA 3ZM8A 1G01A 4AD2A 2JIWA 1J10A 4PMDA 3AHZA 4EKJA 4Z2GA 1E6SM 3N15A 1VFOA 3II1A 3WBAA 5A2CA 4ACZA 5A6MA 3KE0A 8CGTA 1HWWA 1J0HA 2X2HA 2WAGA 1EHNA 3S5YA 3CZSA 5JUVA 2YBTA 2ZX8A 3BCFA 2CEQA 4BQ2A 1V3MA 3TA9A 3VIKA 5KEZA 3QOMA 4HMDA 4IM4A 3N17A 3OLIA 2BHZA 3ZR6A 2NSXA 5HXMA 3WDPP 3WH9A 1DWIM 1E6PA 2WHJA 4U2YA 1FOBA 1B90A 4TXEA 1E70M 4J3WA 3MO4A 3BSGA 4AD5A 1TA3A 4R27A 3PZ9A 1US2A 1E71M 1V02A 3VIFA 4OUEA 3WIJA 5M03A 4P7NA 3AS1A 3ARSA 1UASA 3D4ZA 3W0KA 4D6IA 2JE8A 1XHGA 3WF4A 3LXBA 2NT0A 1JYVA 1NOWA 4YN5A 3SCQA 3ARUA 1KB3A 3WH8A 1FHDA 4JKMA 3T2OA 5BCAA 5AYIA 3VMPA 2GJXB 3RM9A 4R5EA 3VNYA 1K9EA 3IANA 4ZFMA 1ZU8A 2E4TA 1EQCA 4UR9A 3PZNA 4J28A 3L4VA 1PX8A 1JYXA 5ABHA 2QHAA 5GNYA 2WZIA 1BLIA 1B3XA 3VOCA 1MXDA 4YPJA 2WMJA 2CBVA 3WQ6A 1HNYA 3CH9A 1V3LA 1XYFA 2PWDA 3TOPA 6CGTA 5DT7A 1OWQA 3PZIA 5CPTA 4DWSC 3AHYA 3GBEA 2DQXA 3WQ4A 1KWKA 1LG1A 3HMCA 1HJXA 4E4PA 1E6NA 3CUGA 4B9YA 4RE4A 1C8QA 1CLXA 5E70A 2OSYA 1CGWA 1E0VA 4NX0A 1W1TA 1LG2A 3GXMA 4JFUA 3A5VA 2BVTA 1TCMA 3CZLA 4AEFA 1CYGA 3MMDA 3WMSA 1GOMA 2VX5A 2EPKX 1V08A 3AHTA 2PWFA 4JAWA 4FMVA 3ARXA 4WK9A 4MJ4A 1GJWA 1UD6A 3AHVA 5FL0A 1QNQA 1CGXA 2WWDA 4NI3A 1KR1A 1PAMA 2AMGA 3VGHA 3WEOA 3THDA 4C7GA 2VNCA 3W4RA 3LXCA 4OBSA 5CLWA 4CCDA 4HZ7A 3ZT5A 1JNDA 1MWOA 3SCNA 2C7FA 1V6XA 3AYSA 3AXHA 2YL6A 3W27A 3K4DA 3CMGA 4PCSA 1HP4A 2V3DA 4MAVA 3PBGA 1E43A 2C0HA 4E8CA 2WMIB 1DWFM 4X0VA 3U7BA 1M03A 3JUGA 2YL9A 1CXHA 3A24A 2UY2A 4UFLA 5CPQA 1G5AA 5IXEA 2WMHA 2BY2A
chains in the Genus database with same CATH superfamily
1C8PA 1YNLL 4PTTB 4M6QA 2E40A 3N9KA 2J8OA 4FFTA 3PDGA 4YDKH 3MV8B 4IFOA 2BCKA 3Q6FB 1FC1A 4PJDF 1B9BA 2QFPA 3ZKQD 4DB7A 1E4XH 2P5EA 5HDQH 2CJSA 2QSTA 2WGXA 3PQYE 3LRMA 2RBLA 5AYXA 5J5EA 4NLAA 3TMQA 4CSTA 3C52A 2LFEA 1RZKC 4N9GB 5EPDA 2EPNA 3VZXA 1RXLA 3ATBA 2CKBH 5FECB 3SRDA 4PJGB 2UVFA 3PUUA 2V9TA 1IT9H 1BMZA 2DQHH 4K3DH 2C3VB 4FTVD 3TT1H 3QSKB 3OXSA 3VWKC 1JRCA 5DSCB 3IMWA 1OX4B 3K5XA 4HNTA 4JPVH 5EU6A 3IMBA 3CLMA 3WD4A 4R9HA 3LEXB 3TZVD 2V6AA 2XI9A 4OLXL 5EA9A 2I14A 1JDFA 1AHKA 2DICA 2HT2D 3GO1H 3QRLA 4QRAA 2NLIA 1S5IL 1HJSA 1F86A 1VACB 3G6JF 5CGTA 2XPKA 1B3JA 5KS9A 2KI6A 4RNFA 2EIMB 2PTVA 1I0DA 2IOMA 2AJSL 1YHTA 2E9LA 4ZNCD 4QWWC 2QGEA 4PB5A 4UQAA 1AI1H 3DBNA 1XL4A 3LN4B 5D7JB 5B38A 5JPMB 5D02A 1T5WB 3ZMNA 3QRHA 5KOVC 2G3XA 3FO2A 4EXKA 4UTBH 4HWEL 4ADIA 1HQRB 1X9RA 5HYQB 3BH8A 1S5NA 1W1A1 4KROD 3NQDA 5I6NA 3RDKA 1OANA 3SQLA 1S7SB 2J8UF 4GO6B 4PD4J 3VFCA 4LLDB 4HKJA 5E0FA 2GGEA 2GI0A 1U93B 3KJ4B 3LQMA 3EYQD 4MCZA 5FFOA 3SOTA 3S6OA 1A0QL 2P0OA 2BNQB 1T7ZA 4IHOB 1OTSC 2ROYA 1UXWA 3ZDZB 4ANKA 1MFMA 2H8ZA 1KCZA 4LYRA 1HHHB 4L8SA 3NSMA 5CN1A 3NYDA 4HSQA 2ZWYA 2OO0A 4R26L 1YPIA 4PP2A 2XZQL 5CEXA 3HPJB 2AEPL 1CJYA 2JQMA 4OZFH 3T77A 4Y2NA 5BXFA 3NH7L 4FP8L 1SM3L 5IMLA 3VXUD 2AJZB 4MHHI 1UWRA 3RCNA 3WQDA 5HBFA 4MB4A 1H7NA 5DJCB 3DJSA 4H00A 4ADUA 4Q89A 4PC8A 1F90H 4PJFA 1XINA 2CMRH 2J13A 1P1ZA 1T7VA 1W6LA 1EVUA 2XIIA 2QHLA 5INCA 4AOFA 2QCEA 3HPSA 3AW5A 4HDIB 3ZHLA 4Y1AD 4XTRD 4YE4H 1C90A 3N91A 3QQNA 4XWUA 5IV2B 3WY3A 4WI0B 3U4AA 5FCUL 4CILA 4TO8A 4XAPA 4KI5D 2IF7A 2Z0UA 4JM4H 3VWJC 3Q1SL 1ZHKA 3PWJB 1QWKA 2QHRL 3B8DA 4QXIA 3S5OA 2FB3A 3CBRA 3KS6A 5FEBA 3S35H 3MODL 2E6JA 1KGUA 4MG4A 1XLJA 4E41E 1UADC 2LLLA 5BZZA 2PWUA 4CNTA 3NIDF 1IVTA 1XLIA 3LBMA 4XVTH 2R9HD 1T0NB 1H1ZA 1U1JA 1W2VA 2WNQA 1F3WA 1RY8A 3WFLA 4BQ3A 2ZUQB 4M1CC 3WEXB 2OLSA 4DP2X 3VAEA 1EGMA 4DUOA 5CINL 5F96L 2FJUB 4O1BA 5A8OA 4HS3A 4XGZB 3NK3A 2ZXWB 4E9YA 1F73A 1UEMA 1IXQA 3ARFB 1KCKA 4JPKH 4BH8A 2OMXA 1LDPL 1Q9OA 5IUCA 3AAZA 4HEMA 3VRIA 5BPPA 3HI1B 1UB6B 4PV8A 2A6IB 2J8GA 4G9PA 4Q8MA 3WQOA 1W8EA 2VERN 3ZE0E 3BPNC 1T0NA 3PWVB 5GGRA 1V0NA 1Q94A 1H5BB 1MI3A 4PTVA 1ZAGA 4HU8A 1L0QA 1YEEH 5D7IE 3VXUE 2FECI 5GPRA 1GPOH 4UM8A 5CPMA 4ELKA 5L4MA 4FQ1L 4EXAA 4J6IA 3CPRA 1G7JB 3FTYA 3HE7B 1R75A 5ESAB 3IPEA 5CN3A 4NT0A 4WJ5A 4ZS7L 3IRDA 5C55A 1CFBA 3MQTA 3GZKA 4P04A 3TBYA 1SXCA 1JDAA 1QI2A 4IPNB 1KCWA 1Z7AA 4UFIA 4OCLC 4WEVX 4DM2A 4W86A 1LD9A 4PJBB 5F7KC 1VPYA 1TSIA 2A3HA 5A6JA 2DB8A 4B3VA 5J12B 1BD2A 4NKDA 1GVEA 2V2TB 1KACB 1MIEL 1RV6X 3B4NA 5IMLB 1Y5WA 4WQOA 2W0UA 4IMGA 4KDTA 1GJIA 1NCBH 5LA1A 3TEVA 3OG4B 3EBVA 3WUBA 1UZ8A 1WBYB 3BQUB 4N1HB 3X3FL 2AZUA 1TZ9A 2EEBA 1RK6A 1KBGL 3V6BR 1X5AA 2R1WA 1T2XA 2OJZH 1A9BB 3WNJA 3H7VA 2G4JA 5FLUA 4YBQC 4PB3A 1AMYA 1SJHA 4Q7DA 2IKHA 3L23A 4HU3A 3TL5A 4UTTC 3H7BB 2HMID 2W92A 3ISIX 1ORQB 4X5WA 4U28A 3GSMA 4JXCA 3QNFA 4J3OC 4FEZA 1HKWA 1Q63A 4FYTA 1AR2A 4V2CB 1JCXA 3TK7A 3VXSB 4Q8VA 3LH9A 3D48R 1X8FA 2OMWA 4HB7A 1ZLSH 3ZRFC 4RW5A 4NUGH 1ZLDA 3NZGA 2WNZA 3KL5A 1R9YA 3DV6B 5LGJA 3U2SB 4G6KL 4KZ0A 5DGRA 1R34A 3S5LA 4FFZH 4UTAA 4XB7A 4Z7QE 5ITBL 5LKYA 3UXFA 4PG2A 4PRPA 3KH3A 4IUOA 4P8VA 5CC5A 2XFFA 1T7YA 2VVNA 1KTDB 4V2XA 3ARFA 3NJKA 4BH8B 3QEUB 1KWGA 4J12A 2YZRA 3MI2A 3DHDA 1YY8B 4TOQA 2KZWA 4JFOB 2AF2A 2JJWA 4OLVH 1C8XA 3LCXA 3B9KA 4ICWA 2WXGA 4CKVX 3ECBA 5HVGB 1BKSA 3QFEA 1ZS8B 4OV4A 4TMBA 1BZQK 2N0KA 2E9BA 4LY8A 4N3UA 3C6LB 3KCWA 1CNVA 1DEEA 1H7RA 4GKTA 4G2AA 4YL2A 4Z42C 4Y4KC 4GT0A 2VKZG 1NANH 4LEXH 1XIMA 4PMOA 3NJIA 2X9XA 4KJPC 3S2NA 1XRSA 3AYRA 5KVEE 4N2KA 1XFBA 4GQGA 1BMGA 2K3HA 4DKDC 5FHAH 4PH6A 2CLZB 4BYHA 2DQUL 1IC0A 5KZCB 3FMGL 1KGCE 1WXZA 5DMNA 4J1OA 4Y5XB 1I9JH 2ADGA 3LEVH 4UZGA 4XMLH 3B9KB 5LBSH 4H0IA 5TGBB 3WD5L 4WEEA 1OSPH 3BUQA 5I0DA 1BYDA 1QBBA 3KLHC 4E42B 1XHHA 3QUYA 3EGXB 2YMOA 5TFSH 5I28A 1CB2A 2W3ZA 4JD4A 4UTJA 3W0WB 3W29A 4P46C 1U3HC 2VLJE 2WLIB 3NR0A 1DO6A 2R1PA 1PPIA 1QMUA 1ZAHA 3AJ7A 4TQPA 3TO4B 1R87A 3U2SA 4OQ1A 5JDSB 1R9FA 3N2MA 2WXPA 3RNDA 2UZIH 4AXKA 3KVKA 3UBXB 4U3SB 4R4ND 3CSFA 4OUUB 4S1RH 2BRQA 1UC5A 2GDVA 1SMOA 5D7JC 4PS8A 5F2FA 1TPVA 5DN1A 1RZ8B 1DHPA 2LABA 3WD1A 1LO3L 5CJXC 5D96B 3MFFA 2NLYA 4LVHC 4OE7A 4PIRF 4OF7A 3UYOD 4KXDA 5IJBC 4WW2C 3HVDA 1UJQA 2CHRA 1D5BB 1QPOA 2XG4B 4DKEH 4EDWL 2CBUA 2OB3A 5D7IB 3RUBL 3SGDI 5F2GA 3QJZA 1NCJA 1XD1A 2YXFA 3T8XB 2YMXL 4APQD 4F0LA 1IGFL 3B8IA 5A69A 2G0LA 5CC3A 5IVXA 1P7HL 4JBSA 3CMOH 1YNTA 2FJFA 3QCTH 1V10A 2BS71 2VDKH 4PJCF 4XMXA 4EEEA 4XO9A 1B3OA 1XLGA 3G1SA 2CKSA 3LQGA 1XGQB 1S7RA 4HK7A 2ITCA 1UM5H 2BFGA 3UTTD 2NY6D 1I53A 1M57B 1XCWA 2JJUA 5GRVK 3VWKA 4ERAA 2UY7B 1E6JH 2XV3A 4PJ9D 5D7KD 5EZLA 3IWVA 4AZBA 3LB6D 1KJ3H 1VZGA 2FIKA 2WN3A 3A3YB 4XMPL 5HI3C 4ZSTA 2I27N 4ZSOB 2GQ8A 3M44A 3SODB 1ZGLB 2H6PA 3NCYP 1MDRA 3MKCA 3WL1A 5JBEA 15C8L 1TQTA 5JQHC 1EJXC 5JMUA 4GXVL 5ID0A 1KV7A 3F6IA 4HX1B 4G1EB 1KJMA 1MIML 3RTQC 3SCUA 2O30A 2VLJD 3TYDA 5C7XL 5F4XA 3GK8H 4JL1A 1UWTA 1SHXA 2A3TA 1C5BH 2CLRA 2PO6D 3BUYA 4FA8A 5GJNA 2CWNA 3BJLA 4AQ1C 1CUOA 3FJ6A 2GTWB 4PS3A 3KPSA 4WI8A 3IBOA 1T0MA 4PRPE 3SRFA 4HHGA 4L18A 1RZ8A 2HRHA 3SYAA 4Y9OA 4OCYL 2HJPA 2DQDL 1G94A 3T8LA 4JFFB 4KRNA 1IC5L 3REQA 3FA4A 2X0WA 3GNMH 1E7VA 1AMXA 3PIQB 3ZE1F 5AOKA 1Q6CA 2ESVE 1VAHA 5CLYA 1ROWA 3GSNA 4C6KA 1ZWIA 3WCYA 5JBFA 3Q8FA 3MLYH 4YHYC 4HSHA 1D7CA 2Q7NA 4GS7B 5DLLA 2HRWA 1M9HA 1KCSL 4K8RL 4EX4A 3SRHA 2ZUNA 3T08A 4NQED 4CMHC 4WQ6A 3WL0A 2Z1PA 3ARGC 1INEL 3B40A 4ML9A 5AHEA 3CWNA 2JEPA 2KZ1B 32C2A 3TVAA 5I0VA 1SEQH 2EAEA 3MREB 3UTTE 1FWDC 1HDMB 3R4DA 3ATZA 1XGPA 2B20A 1IQDB 1HSBA 2OMTA 3J27A 3IAGC 1WV7T 4LY4A 5DZJA 1OOAA 4QCEA 5CJMA 5BMWA 2UZXB 3BKCH 1Z0NA 1E50A 4I9MA 4APQB 3FRPB 3UC0L 4H6RA 4KQ4H 4UANA 2NY5H 1IJNA 1XH0A 5K9QI 3UPAA 1EO7A 2I9LA 2ZICA 2GK0A 1XGRB 2BDNL 1YQ2A 3OQ3B 4IMLA 4DOHE 5BRZB 4YL4A 4Z18A 1NP0A 3M88A 1EVTC 1NC4B 4OZ4A 3C2YA 4TPRL 4HEPA 3Q8AA 4AVNA 2V17L 2IC2A 4WJG3 3OC5A 3HHRB 3AYVA 2CLVB 1SJBA 3L3OC 3NABL 5LNVA 5FWRA 4HJJL 3C5JB 2WUBH 1DIEA 1I8JA 1I1AA 5HK4A 3STPA 3IACA 1IGYB 3H42H 3WKMH 5F7NC 5DEJA 4PGZA 3SOBH 3O2VH 4DGUA 2KZHA 4GE8A 5IM51 2PTTB 3DURB 3GMRB 4YDVB 3ZGIA 1GGOA 4FR6A 3DTXB 5CSGA 4GJJA 3N6QA 1PUDA 4MB3A 2HKHH 5FFGA 4BXVA 5HYQA 3LZQA 4UOJA 1BG1A 1RPUA 3WIFB 5GJPA 3ZLFA 3IV8A 3GBMH 3W24A 4TMCA 4MPKA 1SR0A 2WKLA 2QMKA 1F1DA 3AG1B 3HZ3A 1RJLB 4HKXA 4FG4A 4TVPH 1PSCA 4MJ5B 2FX9L 1E5YA 2MTAA 3AQYA 3VFOA 4KPHH 4AYGA 1VBJA 3RZCC 4KCWA 4ZQMA 3SIMA 3FK4A 4GH3A 1BSIA 2I9EA 1IIGA 3UG8A 1GS7A 1K4CA 1YEEL 3VO0A 3SEPA 4FQIH 2OSLB 1BQHB 4V33A 1OAQL 1VPOH 1W72A 1KPRB 4H2CA 5C0DA 3RX4A 3AXIA 1MCDA 1TJRA 3WGVB 1DWHM 5G1TA 4GAJL 3KLLA 2J8TA 1XR8A 3SUVA 4A35A 4Z7UA 1MXGA 2C5DC 4BFFA 1NAKH 4XO3A 3CLWA 5HYJA 1OX4A 1RZ7L 3RPDA 3LMJL 2QLYA 3NCJH 1FF5A 1LVEA 1P4UA 1TFVA 3IJHA 2KKQA 3MRBB 3BUBA 4BF5A 4NN7C 4NWUH 4FFWC 4HCGA 4AF0B 3KCLA 5ECVA 1HOCB 1UD4A 5M5DA 3MO7A 3F5JA 3HF3A 2OJ1A 2W9LA 2MTPA 5FO2A 1EJRC 2C3HA 1N64L 1NL0H 4HXBH 4IGBB 2F7IA 1HP5A 1KUMA 2NY3C 4L4VB 5DHYB 3S35L 5J8OA 4WCYH 4ERSH 3EWCA 4GJIA 2VENA 3SAZA 2X28A 8FABA 2XRAL 3D3VA 4HMCA 1EUAA 2XG9A 2Y63A 5F7DA 3VRIB 4F9PA 3OPUA 4X83A 2RR3A 5ID1A 2HT4C 1MUJB 5IW3A 2AJVL 4Q0XH 3H56A 1N8ZA 1U8KB 1TITA 4HCRH 2WNGA 4HC1L 4NM8L 1P5VA 4QHNA 1T80A 2DSUA 3NDYA 4OIAA 4XGZA 3KPMA 3TFKC 1RAKA 2KQMA 3WEAA 2KLTA 4JPWL 2ABAA 3VKBA 5HPMB 4Y4HC 4A05A 5CLTA 1JCNA 2BHYA 4WFGE 4X6EA 3FU7B 3WJMB 3P14A 3HPXA 4BZ1L 3FTZA 5AOMA 3V0WH 4PODA 2GAZB 3MRQB 4NZFA 3VWKD 2ZA1A 2PTTA 3DURA 3GMRA 3E96A 3D12B 1USZA 2B59B 4FN0A 1JV2A 1RQ5A 4PJEB 2VSDA 2YAFA 4ZOEA 5LQBL 5DA4A 1O9VA 2BH0A 4UQ3B 5ISZB 3F4VA 2L4OA 5A6AA 4FQQA 4HPOH 2FLRT 1XJBA 5AVYB 3BSZL 3T0EE 1LE5B 3PNWB 1PV8A 3VIIA 2VLRE 5DMIH 5F9OL 1U1UA 4HU4A 4PVBA 3LZNA 3ILPA 3N1FC 1BRLB 1RJRA 4N2HA 1XYZA 2ZSVA 4DWSA 5G2NA 2JGQA 4QXUL 2AVGA 4WFHE 2FVKA 3N9GH 4GY4A 1R24A 3MBEB 2WOYA 3QZWG 3WF0A 4L80A 2VM4A 2OYLA 2J24A 2VDHA 5BXFB 4O2EB 1A4KB 3O8XD 1MCSA 3O9WA 5EBLA 4XSLA 2ZC8A 3O07A 4JY6A 5JHLH 5I8KL 1LMKA 1D2PA 5CZXC 3RVWC 4ONFL 4JFEA 4AWUA 1AG6A 2FVLA 1SOKA 3X3GH 4QTIH 4ZVJA 1XGPB 5AC4A 2UX7A 1ZSDB 4UTWA 5I17B 2I1OA 4XOBA 1QRNE 1NIEA 1JGMA 5B1BB 2O56A 2Z2UA 3HGRA 4FGMA 4HA4A 2R1XB 4GBXC 1CGTA 3JWOC 2FWSA 1EC9A 5DJYB 4JPVL 4WJEA 3H4WA 1A5CA 3H3BC 3FTGA 2Y7NA 3FUDA 3P82A 2PYED 6REQA 5IEKA 4ZFOL 2NYKA 3IV3A 5D5MB 1A2YB 4F8NA 4P7QA 3PBUA 1UP3A 1NAMH 4TX8A 1AQDA 3H3PL 1TQUA 1RSCA 1ZAJA 3P62A 3T6CA 1OW0C 3SCVA 2QJMA 3MT1A 4AXWB 1QEXA 4YMZA 2P50A 3VSTA 3VINA 3ROLA 3FYYA 1F58L 1AKJD 1XTLA 2VQUA 2FEEL 3RGBA 2DJLA 3CO4A 1NFIB 5T3XE 2JEQA 3ZIYA 2VRKA 2R51A 4NI8A 4UCGA 5I6KA 5F1OB 1NVMA 1V05A 1G7LB 5G2WA 4C5ZA 1JD7A 5IK3A 5CBBA 4Y5YC 3NFSH 4HWBA 4XB3A 4CU6A 1EF3A 3QPEA 3WLOA 1GZPA 4A2SA 3QUZA 4Q4KA 2NZ1A 5L0QB 5CNHA 1WCQA 5L6YL 4X9GA 1GOXA 2Y7OA 1EBPA 3G5XA 3K71A 2VDIA 1O5XA 4US6A 4N87A 1LQAA 3DI1A 1AH0A 4MAZA 5HGBB 2A3BA 2YXMA 3B05A 4FZEH 4O4WA 2X4NA 5HYSB 1K7XA 1FYTD 1MAML 4YR6B 1QFWM 1CF8L 2IDCA 3ZTJG 2J77A 1YAZA 2BSBA 3REVA 3U7YH 5IMMB 3JTBA 4G7VH 4GG6A 5IVZB 4LCQA 1D5XA 1UWXH 4P4RA 4RAUA 2A3EA 2J79A 3GXIA 4WU7B 5CR1A 1HJCA 1LOSA 3BFQG 2G8ZA 3TFCA 4HJ0D 4WDIB 2D7MA 3P8IA 3W85A 3CVHH 3S96A 2Y85A 2H3NA 3GUGA 1I1FA 4HIXL 2J6EL 1I3RB 1EGJH 1E0XA 5LYRA 2CUMA 5FGBA 1HQ4B 1QOPA 4A4AA 4FG2A 3KVJA 1SO6A 5F0JB 1HL9A 3QH3A 1QBML 2YN5A 4I18A 2WW5A 3HC4H 5KVFH 4PJFF 1E9YB 1IXPA 1FBIL 4Q8UA 4GB9A 5IR1B 5CWSB 5KZEA 2IPUG 2VLKA 3WQCA 5CWSA 4HNCA 3WMBA 2J7DA 4KX9A 4PV9A 4UAOB 5JO5A 3SE8H 5E08L 4RK8A 5FCSH 2IPTH 4WD0A 1ZPTA 2IKJA 1AS7A 4JY5L 1DBBH 2YSSA 4RSYA 5SWSB 3RU8L 5J6HA 4DHLA 1KRMA 1U6AL 2J88L 3A4FA 4HJFA 3P2TA 5EYWA 2H32H 3GR7A 3UJ2A 1IKNA 3KPRA 2REQA 4LDCA 1IL1A 3F5LA 1S3TC 4KWSA 4Q9QL 3DX8A 4HFWB 1NGPL 1NL0L 2WSPA 4WK0B 3WIIL 4UBDD 4MSSA 4DZ8B 2F5BL 4R8WH 3WSUA 3V5HA 1CD9B 1YUKB 3IIPA 4QRRD 3IJYA 1BD2B 4Y7OC 2NV9A 3L1OH 3X11A 3O05A 4PWEA 4IKNA 2G9HB 1EHAA 3QYCA 4GSQA 1N59B 2LHAA 3S3PA 3CGTA 1AJ0A 4YBQD 5FB8A 1TA3B 3QHOA 3NVQA 1CGYA 3KLQA 2XZAL 3P0GB 4N2YA 1U4EA 4QNEA 3S8GB 3QNXA 3OLEA 4HALA 4Z08A 4DVOA 3LRSB 5D4HA 4F7EA 2ZXBA 4PCFA 2WLHA 2R1KA 2C1PA 3KEHA 2XG5B 2FGBA 5ISZE 5HYJD 1QFUH 4YHYB 1AZZC 4N0YH 2YL5A 2CIPA 2QADB 4R0LA 3CUPA 1AG1O 4MDOA 3E49A 3FT0A 4R84A 1O5KA 2XPGB 4GP5B 1WTGT 1FLRL 5C08D 5AW7B 4E4UA 1DVFB 1L3NA 3QI9A 2QJNA 1S7TB 3P9WB 3RAJH 1JPSH 3SJNA 1KEML 2I60H 4WSKA 1H0GA 2D03L 5DJ2B 1ACZA 3B9NA 4AIBA 3PV6B 3VXTB 3FTUA 5TDOA 3S5LB 1D9EA 2WTRA 2D2GA 2DYRB 2HXTA 4BM7A 3OZPA 5FOJA 3RU8X 4E41D 2OZNA 2HKHL 1P6BA 5DVKA 5HYEA 1FWSA 4A3UA 3VW3L 1H7PA 5KYXB 4PFHA 2DQIL 2JKIS 5KBPA 2WB7A 4N4YB 2XPGA 1KW1A 4OH2A 5E6IB 4AC4A 1USQA 2RACA 3MJGX 1I2OA 1AKJB 1E28B 5J06A 1JXDA 4DGIH 1GYAA 3ASNB 4PGDA 2QPFA 5B4MD 1NBVH 3OA3A 3T81A 5SWSD 1D3HA 4JGDA 2OXHB 2RHEA 2YD1A 1V3HA 2IH1A 3IWPA 1IIKA 3IFOB 4IRSD 4Y4FA 4O58H 1PQZB 2HXUA 3GW0A 4AUBA 1ZQ5A 4KAQH 4OZHE 2XXFA 3V4UH 4ZPVA 3FO9B 3QIBC 5IBLD 3WU1A 3RL2A 2Q2EB 2A3CA 2C1GA 3LMZA 1DBAL 1S5HB 1M7JA 2I25N 2JTYA 3S3CB 4KI1A 4PJXA 3GO2A 3AY4C 5KYUA 3O8AA 4UUJA 5JZ7D 3V79C 3US0A 5LCVL 2GHZA 5DF0A 4NWTL 4JG9A 5AEAA 3UMNA 3EJTA 1YNTB 4B2DA 3DOSB 4R4NC 2BNUB 4X9IA 2PYEA 3RNQB 4CBPA 4AQAB 1PIIA 2P5EE 5D7JD 3MN8A 2MMXA 1HE8A 1WD9A 3NIGE 5MENA 1I45A 4OAWB 5AB3A 2ZUVA 3FKUS 3QUMB 1B6UA 1DJGA 2HLEB 3FGCA 1CXFA 1ED3B 4JFXB 1SJMA 3DYOA 3BQUD 5EORL 4DAGL 5DZOA 4C60A 1KGIA 5AC8A 1R38A 2VN3A 4JANB 4MQ7B 5K9JL 1UOLA 4YJ5A 4X7FC 1RUML 5ICUA 2BIOA 5CEYA 4PJ7A 4P5TD 4JFED 4WWKD 1HKKA 2YXXA 3T2NL 1NQ6A 1CEOA 1A1OB 2OZ4A 4FX7A 4PUEA 3QGVA 2HP4A 1WV2A 4EWND 1G7PB 3HAEA 1MH5A 1LWJA 1OG6A 2OMUB 1JZ3A 3RITA 3GNML 3H3KA 5I9QB 5D1XA 4ZDHB 3GG0A 4GVFA 1QSZA 5SWZA 4L4TD 1ZBWA 1VZIA 1WOAA 4IU2A 5HHXH 5KSBF 1IEIA 4JY5H 1I9JL 5A6LA 1BEXA 3UWWA 1L9TA 2A9AA 3W38A 1WAUA 3HR5A 3WTXA 2CWXA 3LDVA 3LCLA 2EECA 4AGMA 1E4JA 3FDKA 1CLYL 2CWRA 2WBJD 4ZD3L 3NM3A 4APXB 3KLAA 2AK4B 3NQFA 2Y5EA 4WHTA 3RVVC 3L3JA 4GFTB 4PRWA 1ZJHA 3RIFF 3N34A 1EGJA 4N2OA 32C2B 2A79A 4OJFH 2QDDA 4X0KB 1W31A 4NM4H 5LO7A 4EE9A 5EMYA 1VYSX 3L9BA 3DSNB 3GXTA 1SBSL 1NKOA 3HG1D 5I0ZA 4IPIA 4N0FA 1WKFA 1ZDQA 1H8OA 1HXMB 1S2EA 1TENA 1R30A 4CD6A 5DJ6B 1E1CB 2VSMB 3EH3B 1WGOA 1CTOA 3RGVC 2PGEA 2Z31D 4GMTL 3U30C 3SJVB 4CQDA 5D2LB 1CT5A 4L4LA 1I8IA 4PR5A 1UJTA 2VDKB 4KITB 3SUTA 1OD7A 3ECQA 3OJMB 4NN7B 2YDAA 4NQDA 2E6QA 5DUPL 3MJ8B 4RBPH 5FO7B 3RWCB 1PYMA 4MGGA 4BSVB 4UR8A 1SRDA 2XN9D 2ETWA 2BNJA 5M7QA 5I3IA 3HMXA 4Y16D 5F7EH 4IG2A 6XIAA 4H1ZA 4IOSD 1DVSA 3WUZA 1TIMA 2D3VA 5I1EL 1SOXA 1MNZA 1TZ7A 2HWGA 2PDNA 5I2IA 2Y7SA 5EEXA 3IDUA 1AQFA 4MKNA 5DEZA 1KULA 3BGAA 2WQUA 3HG1B 5AZ2H 3P77A 4S3BA 1RK5A 4H88L 5C0BA 3KW7A 4ZL1A 4ZFFB 4FFVC 3QIUB 3COTA 4GVHA 2WWKT 4KWVA 3VE0B 1NAMA 2Y1HA 2RCSH 4MS8D 5DD3L 3O9WC 4IM8A 4MFEA 4C83B 2BY0A 2PURA 2VC5A 2Z4GA 3NEOA 4X4ME 4LBUA 1HXYA 4LCWB 1OINA 3BD4A 1XQKA 3R89A 2X16A 1S7VA 1XDTT 5JQIB 1CI1A 2CZDA 2DQUH 3ZR5A 3GDMA 2W38A 3WL9B 4Z0SA 1KNOA 2YSWA 5C0CE 2PDBA 2UXTA 2W65A 4UNLA 3VNLA 3ATYA 3UAJC 2WBJB 4I9XA 4AQ8C 1PO9A 4ESKA 2ZCKL 5LKNA 5HHQA 1IGML 3P4MA 1OCBA 2GT9B 3LNDA 3V0EA 1EWHA 1IE5A 4HNUA 4TQEL 5F7WC 4IP7A 2AQSA 2OXGB 5IJKA 5FKYA 4NZRL 1UIOA 4NAFB 3TJHD 2P5WB 1P4CA 3DCPA 4Q8WA 4FX8A 1OZTG 1HYSD 5CLXA 3EDDA 2BB0A 5KZDA 1NJ9A 1YEHH 3NIFE 3LKPB 3W81A 2EE6A 1SEBA 3WIAA 5A6IA 5TBOA 2DJUA 4Y7EA 4ZEPA 4L6OA 3RWJA 2H5UA 1NZRA 4C4UA 1TT6A 4G71B 3KBHE 9RUBA 3GI9H 3L1OL 1GQLA 2X4OB 3BT2H 1IEWA 3TNMA 2QBWA 4ZUWB 2WLLA 3QWRA 3OMZA 4XVTL 1ZLVK 4MJ6B 3CBWA 2XOTA 3QI9D 2P5WA 1R0AL 3ULUE 1CI3M 3BW9A 3T44A 1MVUB 1XGYH 1EC7A 2Z1VA 1FCQA 3X1GA 4L4TB 3ZLHA 2WXJA 1ISXA 3KPSB 4PWIA 1M65A 4ISVA 5MEPB 4BBWA 2RGSA 3GRGA 3DC8A 2O6EA 2EG7A 1F3RB 2FHCA 1BAFL 3TFXA 3VOFA 5KVDH 2ABBA 4FNQA 3K5SA 4UQDA 2FZ8A 3GUTB 3GAKA 4M6NH 4MTVA 3W76A 1XUZA 1PZAA 2HT2C 2DF3A 1KDJA 4KMLB 1J8HB 1GPWA 4NQSA 3N18A 4LV9A 4K3ZA 4ZSOE 4M80A 4IYKA 2A7PA 1S9XB 2FZ3A 2XZQH 1F4WH 3UEQA 3UJTH 4B0MB 1G7QA 4FIRA 1EO8H 3ZL2A 3RJOA 2Z91A 3GR8A 3ULUF 2GUBA 4JJ5A 4TM9A 1MELA 3LKPA 4JHUA 3K8LA 3ALPA 5D7IF 3MY9A 5F72S 5SX4I 4P4KB 2EACA 2K3TA 2FD6L 2CA4A 3TUUA 3KOZA 4LSUH 2Y7QB 4QEEA 1OGSA 3OAUL 1UC4A 2CJUH 1QW7A 3ES7A 4LV4A 3VG0H 3QK0A 4FYQA 3ULUD 1ZJAA 3FB8A 4X4KA 3VZYA 3VDGA 4RUBA 5ABAA 4L64A 5INDA 5HR6A 1D9KD 5C0FA 3S3JA 4UTBA 3NQVA 2DQCH 2X4PA 4X4ZA 4YSUA 2E9MA 3P60A 3GVGA 3FT4B 4JG5A 5I2UA 3QZWB 1F61A 1F4AA 4B5WA 3O3DB 2YD0A 4IBZA 1W1PA 4A3RA 2ZX6A 3NTYA 2R59A 3BFOA 4LAQH 4OFYD 3WDIA 4JYEA 3SGEI 4F8LA 3BWWA 5FV2A 2GTQA 3I68A 4XO8A 1PS9A 5EU3B 4NKMB 4NQ1A 2JLLA 2H26B 3ET9F 1XPYA 2OJEB 3AMLA 1E6OL 4LCCB 1J9SA 1GYLA 1C16A 1WZAA 3FO0H 4UT6H 3DESA 3L3OB 3PRZA 3BX7C 3IJ8A 3TBTA 2CXKA 3FA3A 3GLZA 1U8NA 4KDTC 4ODSL 5T5NG 1X4YA 1YPZE 4LSRL 5FW8A 2AMUA 1KFAH 4NP4L 1ECQA 2EPMX 3H24A 1HN1A 5J9PA 3IJSA 4J7RA 4N6QA 3AXMA 1WDPA 5FGCB 4HZAA 4LDLB 4IGMA 3O6DA 2O4QA 2BIIA 4XPGL 1I3GL 5E8PA 4P23A 3LNMA 4DK6A 4RZ5A 2CQVA 2ICEC 2J1XA 5HY9B 3LCGA 2OMZA 2YFNA 5B1JC 4RNRB 2RJHA 2R1NA 5EEZA 4LF2A 1B6DA 2XJLA 1JQVA 3ZQXA 2YPLE 1A7NL 1JK9B 3DV6A 5LGJB 1EXGA 2ODIA 1XICA 2O5ZL 4UWQB 4OGZA 3PTMA 2V9RA 2EDDA 2JLPA 1XG3A 3THUA 1CYWA 4LJ3A 2BBFA 4K3GA 3PWJA 2ZAGA 4AUUA 1J86A 1Q1JH 2C79A 2GZXA 2V5BA 3DUHA 1SOQA 4OLWL 2NY6B 4QY8A 1FZOB 4EANA 4GKNA 5JIDA 3NG5A 4OJAA 4RFOL 1I1RA 1E9LA 4RIRA 2X10A 4JM0A 1K7FA 1QRKA 4ONHA 2P26A 3D2UB 4A7GA 3CL7A 3M6DA 4NHVA 1MN4A 4HUWB 3L5IA 3MBWB 4TNVF 3I02A 5IT2L 1O94A 1X6UA 3ZR4A 2VT0A 4GMSH 4XN9A 2OYPA 5T5FL 4YQXL 1V5XA 1HINL 3QIUC 2XFXA 4ZD3H 2QGBA 3LKSB 4LLVB 5DS8A 2JQAA 2ZXAA 4H26A 3OKLB 1M7IB 2GSMB 4J2PA 3DH7A 3LPGA 1GEQA 4MQSB 4KZEL 4US5A 3LS4L 4AZ8A 4L8SB 2OCZA 6ALDA 3T6WA 9CGTA 1LD9B 4PJBA 4ABVA 3QDJA 1Q0YL 2VWTA 2VDOB 3L9RB 1EK3A 2L7UA 2CRMA 2KZBA 3O2VL 5HDLA 1GYMA 2R0WH 1MSPA 1TTAA 2MPAH 3BWAB 3H85A 3QJRB 3QXVA 3KP1A 1DSWA 1AH4A 3CFKB 4AZ7A 3V36A 4MADA 4AC7C 2IG2L 4MHBA 3LNEA 1YEIH 4RVBA 4AV0A 4OF5A 2FJGA 2JI3A 2PPGA 2ZZ1A 4UM8B 2MJWA 5KSVB 3NO3A 4PREA 3QQ1A 4L5FE 2Z64C 3O2DA 4QHKJ 1AD9A 4ZPTB 1EOMA 2Q8BL 3BV4A 1EXHA 3VXTA 1TZ8A 1A1MB 1JXGA 4FQJL 4NO3A 4XX5A 5DVMA 5B3JE 2YGNA 4WSJA 5L2KD 2EF9A 3W37A 2BHUA 5DJAA 3GSWA 2FT6A 4IIQB 3DECA 3GHRA 1EAQA 3UPBA 1GHFL 2X4RA 4FQHA 4UDTB 5JHDE 4PBGA 1QK2A 1LXMA 3II2A 2OXHA 5TGBA 3T05A 1HKLL 3L9EA 3V6OC 4JZOB 1RBOB 5J56B 1QFWH 4XUYA 4LLMB 3KM2A 2JVUA 1KZYA 2HX7A 1W3HA 3RX5A 2Z9TA 3W73A 3IKCA 4IRZA 5E9AA 4NCDA 5FS5A 4YLQT 3STLA 2CR6A 2E6PA 3QQXA 4D9QD 2IXVA 3RGVB 1XYMA 1K8DB 2BOCB 4XR8C 3ORWA 3QJHB 1CDGA 3FQRB 3VIOA 2NY1C 3QEGH 4WY0F 3C6LA 1I8KB 1CGVA 1LO4H 2WXIA 3R8QA 3BCDA 3B2MA 3VTTA 2HEJA 4LF3B 3QMSA 3FOMB 4I88A 4P46D 4ADJA 2VYOA 3TE9A 1U3HD 2E5DA 5F4SA 4LCYA 1MEIA 4QM1A 3QORA 3FO1A 3D39B 4ORZC 1MI5E 4QDGA 4OV9A 3W86A 5D2VA 2J62A 3AIVA 4PJ5D 4N6RA 5DCCA 3NCOA 4PJEF 1XIBA 1QNZH 1VIZA 3LKRB 3MUHL 2XZCH 4MXVF 3RB5A 3VFMB 2BOEX 4NILA 4GQQA 1GK8A 3T7VA 3VIMA 4G8FA 1QT1A 1TMQA 2GSIA 2BMKB 2OI9B 4E0RA 3BC9A 3JT0A 3M43A 2G9KA 1HESA 2R56H 4G8IA 4P46A 2E68A 5IFTA 3EPMA 3NL6A 1RZIA 3LHPL 3P77B 3V4VB 5EEWA 1FH8A 1IAMA 5KVGE 1OCWL 2IQ9H 1MHCB 1UXSB 3SKOB 4JHZA 1UHVA 1ZT4A 4AG4H 5F3BB 4XOEA 5DU7A 1IC4H 3VDCA 3CBKB 5JLZB 1YDNA 3O9NA 4X4YA 1J9QA 3QS3A 3HC3H 2OODA 3TN6A 4QNPE 4TX6A 3WX7A 1AH3A 4APQC 2HVJA 4JREB 2JFCA 3RPTA 1EUTA 3MTRA 5I1GH 9PCYA 1MAJA 1F3TA 5DT5A 5CP3H 4LSSH 3QQWA 1AO7E 2IV9A 1J1OH 5C3TA 3SPIA 1AFVH 2YEZA 1X1ZA 3E9TA 5JZ7C 4KKAD 3RWIB 4A38A 2X0YA 1UR4A 1BQLH 1S46A 4B27A 4AITA 1QPRA 4RNHA 5AZEL 2FL5A 4QAMB 5T3ZH 2ISVA 2NW2A 3WMCA 5H94A 5AVSB 3HN5A 3P7YA 1ASOA 3ISWA 2RGMA 3TVMD 2O61A 2R56L 2E9WA 4UILL 1OLZA 3TROA 5TFSL 2FPYA 2H3DA 3UP1A 3CXDL 5IFAL 3TW9A 4I3GA 1HIMH 3IJHB 4XKYA 2ZG3A 2V7HB 4KC3B 2PO6C 2YPLA 4LSVL 3H0TB 1V7NH 1YYLL 1GOQA 2GC7C 4IXXA 3NA4A 3D9AL 2E6YA 1HHIA 4MNQB 3SE3A 3CFBA 5ESQB 3U46B 3FRUB 3WQGA 1A7OL 3DLQR 3VMOA 1A21A 4AKPA 1QG3A 1JDEA 4G11A 4O0ZA 1JGEA 2Q71A 3HIZA 5PTDA 1FH2A 1KPRA 4L1SA 5C0DB 2HMCA 1FN4B 3MUGB 4FAMA 5E8DL 3V5KB 4GX8A 2NQDA 3LPWA 5K39A 3NIYA 5AVHA 1RFDL 3C60D 2V5LA 1VD6A 2VN4A 1Y1UA 1EH9A 1NFGA 4LCIH 2GWNA 1RIHL 1OFOA 4ABUA 4H9VA 2HWZL 3ARGD 3RX8A 2H1PH 2JH2A 2WVTA 1P2CB 1KEMH 1WHOA 5D2NC 3IVTA 2XWZA 4PSPA 3BW2A 2HKFH 1SQ7A 3PXHA 5DEGB 3ZDYF 4PRBA 3CMOL 1ADQL 3VIHA 4F7PB 2ZP9A 5FO9A 3GH5A 3ZDYE 1JPFA 4QQUA 4LLYB 4PGEA 4E41B 2KHAA 2F53A 4BQ6A 4QG6A 3RHGA 4K7FB 4K8HA 3ISYA 3D25A 4X6DF 4LARL 4WKZB 3UTSB 1H6UA 3ARGA 4MD5B 4TVPE 4K5OA 1WHPA 2O61B 3EO9H 3GSOB 4PJHE 3FGCB 4Z23A 1PS3A 2H4EA 4JPKL 1NCGA 2DWEA 1M9SA 3SPVB 4HOZA 5I9QC 4DPPA 3PTKA 2CLVA 3ENLA 5ITBH 5IKCB 2XTKA 2R91A 4PUMA 1FYTB 1R6VA 3A6BH 1A9EB 1P5UA 2VZSA 3FUHA 3PQYB 4KJYA 4WI3A 5FGRA 4TU1A 4PJFB 1SSDA 4QTFA 5ACZB 3GBDA 1VGKA 5AVQB 3N11A 3UPCA 5DRNA 3G5VB 4HF5L 3JV5A 1ITXA 1J2WA 1FWIC 3P2VA 1ELSA 3CJPA 3FQUA 4W9JC 2J6WA 1U8QB 4BFKA 3EXSA 1TKKA 3GSOA 4LUTA 1KXHA 5C09E 3QIBA 1RLWA 3GEWB 1HHJA 3SN6N 2GJXA 4HH8A 4OT7A 3KCJA 3VKCA 2PTYA 1U21A 1UA7A 2QPUA 1Y65A 1HDMA 4N0RA 3AREC 3NGBB 4XZUB 4G8GB 3NPUA 2ZKHH 3ABZA 5IVXF 3VXMA 1Q7MA 5JU6A 4DEPC 3QARA 1PKNA 3KPMB 3QY7A 5HPOA 4LWWA 1EZVY 1V6UA 1DHKA 5HJYA 3MVIA 4BFBD 4HUVB 4QP0A 1H6EA 4Y19D 3O0RL 2D2CC 4NRSA 4JRXD 2VDQL 3NP3A 3EADA 1K3UA 2YDRA 3QORB 4FTVE 5MKGA 4QBXA 8FABB 3K72A 4HZMA 4S3GA 3MLZH 1Q1JL 2YMTA 3V8OA 5KS9E 1TQBC 3B5TA 5DD0L 5HHME 5AC6A 1HOCA 3CQPA 1UH3A 2YUXA 4G6FD 4YIQA 4I89A 1G7MA 1OAZL 4JHWH 3MZGB 4U1NB 1RZJH 3GIYA 4MNMA 4XBKA 1XR2A 3D69B 3O4LB 3MSRA 1WS7A 3FONA 3HI6L 3OSKA 4KTGA 2GAZA 4M5SA 4L4TE 1QSED 2LLGA 3JWOH 5EA0L 3T0VA 2FSEA 3OJDA 3N06B 3AFLA 3VB9A 4C58B 4AY1A 1DE5A 3DKLA 4UQIM 2C9AA 4HZ8A 2C14A 1CL7H 4NG3A 4QRRA 2NT1A 2HTLD 1U8IB 5KBKA 2HX8A 4NO5B 3CVIL 5AOIA 1P43A 3W7NA 1CDUA 5HHOA 5C0BE 1EHLL 4J1UA 1J5SA 2P5EB 4NZCA 4F37K 4G43A 5AB9A 5J4MA 2BCKB 1BF2A 3Q6FA 5AUMB 5LN8A 4OZIA 1S2VA 4A29A 4HV8B 4UTIA 3HE7D 3O6KH 3LHWA 4AZCB 3C4UA 1D6EB 2VDOL 1W3KA 2DJXA 3TC6A 1XF5A 2ZC1A 3FHAA 3P0YL 4N2GA 1EB3A 3Q1SH 3CZNA 3V3WA 3C60B 1QTYT 3Q44A 4HK3N 5IHHA 2EG6A 3B04A 4JFYA 5L2JB 2DWDA 5G55A 2VP8A 3U0WH 1TZGL 1QPQA 4IJ3C 4PB0L 1E6QM 2Y2WA 1CICD 3W25A 3GB6A 3G1HA 4F2UA 2XVNA 1MCOH 2R6OA 3PREA 4P2YA 4AD1A 4OZOA 2APWA 5GGUB 5LGHL 4Y1AE 3FSVA 3ZK0A 1U36A 5GS0D 2R2BB 5GSVA 1BBDH 3ARYA 3BI9X 5GS1B 2E5CA 4MNGA 1KCUH 4CN1A 1WB0A 2XTJB 1AGEA 2ZOTA 3LSOA 2D3LA 4JREC 4GQ9L 4K7VA 3TESA 3LZ3A 3QUGA 3UPMA 2WMPB 1MRFL 3EX6A 3K6NA 1N7KA 4Y2OA 4JN1L 4P8WA 2Q6WA 3GSQA 1W72L 3SPJA 1CCWB 1H60A 4WI6A 2QUMA 1NGQL 1D7FA 3ZHNA 3GMNB 2RDXA 2GITA 3FHEA 3FS9A 4MMXC 4DJMA 1LE5A 2WO2B 1P0NA 1R0MA 1T7LA 2J88A 4HKXB 5CZXD 4FQQB 3WQ5A 2XU9A 4TQEH 4DXXA 3UWYA 1VGEL 4N28A 1QHZA 2DN7A 2VL5B 5JUEL 2CIIA 4GD0A 4MZ1A 5C2GA 4YX2H 5JXEA 4KW2A 3M8OL 2A77H 3MP4A 4L48A 5IEHB 5D38A 3GQFA 3FU7A 4LEBA 5J04A 2QSQA 4H9XA 4NRYB 5EB8A 4W6YB 3O16A 2BSEA 3FB7A 3MMTA 4Q4RA 1NMBL 3NO5A 2VM9A 5JIIA 3T4AC 4HKBB 4TUFA 4YSDA 2E6AA 4F3HA 1DVZA 1NWUA 3H1ZA 5BJTA 5L8KB 4I8YA 1QAWA 2KT6A 3BLFA 4E8GA 4Z7VA 4M62L 1DCLA 5HHOB 1UBSA 2B81A 3L4WA 5JPNB 2PWGA 2ZKHL 5BOPA 4ALDA 5B39A 1TZZA 4K3EL 3LI0A 3NABH 2R27A 3M5VA 4AGLA 2DLTA 3DFNA 1D6VL 4ZE5A 1TPXC 4ILDA 2W4XA 3THAA 5IEKB 3EOOA 4FI4A 1PIGA 3R7RA 4PTMA 3FTGB 2GDUA 1EC8A 4A21A 4HWUA 3S0CA 1E65A 4OZFA 1R3SA 3LQLA 1TPB1 4MBRA 2XFRA 3LCFA 1BYCA 3PHAA 1KELH 4WV1B 1W91A 4LP4A 5D70L 5TE6H 3DFQA 3OKDB 2WBKA 1MAMH 4W9IC 3I7QA 1J5OL 3B3IA 5D2LF 1GTFA 1A9BA 3AZUA 1EJUC 3EH2A 1MFAL 5F3HB 3GSVB 4JN1H 3HNSL 4OZHA 3VD5A 1C9SA 1TQCC 5I6MA 1FWFC 2PI6A 3K30A 1MI5B 4JFDD 4JVWA 3Q1EA 1RL1A 2WTOA 4A7QA 2EXWC 2CHOA 2CKRA 1PG7H 1XWYA 1NCIA 3P11H 2GVYA 2HTKD 2BASA 4CQBA 2Q6WB 1XF2B 1G4MA 1AGCB 5HVWA 4S1FA 4N90E 1ZJIA 4XOAA 2PDQA 2OLAA 3AWOA 4O02A 4Z1YA 4R53A 1FNHA 1NARA 1F58H 4WNJA 1F5WA 2W0KA 4YFLI 2QSCH 3B8YA 5IJCC 3IGAB 4YBLC 1NWTA 3V4LA 3VD7A 3ES8A 1MCJA 2QQKH 3TYFA 5I3FA 2YARA 4KHTL 2P8MA 1M05A 5GRJL 1U4FA 2E1DA 2B7NA 1S9YA 5CJBA 1JBJA 1UR1A 4Q8OA 1VZHA 3LTPA 3KWXA 1PBYA 4XNUL 3W9ZA 3MRQA 4YCOA 3UGVA 1A5KC 1G7HA 1X98A 4OZHF 2ZSWA 5HATA 3RK8A 1C08B 3QUKA 4J2XA 3V0AC 4G9DA 2BNRD 2VKXA 4IJCA 4QYOA 3WJLC 2PPEA 4FQXB 4XSMA 4A2MA 2VE6A 2XYLA 2R23B 1SVCP 3WG6A 1AW1A 4DBWA 4OZIB 4FYRA 2JCCA 4IUGA 4ECLA 4Y16A 1TZIA 1DJWA 1WPCA 4WAFA 1P4LA 3T2NH 3SQSA 4AISA 2PSNA 4TSBH 3PU7A 4JG0H 4U1GB 5I76B 5AENA 4XC3L 1CIDA 1R46A 3PFQA 3S3GA 1TNNA 1AZBA 2HSIA 2JMRA 2LU3A 2BNRA 4XCFL 3FHQA 2I5YL 7TAAA 1BWMA 3MJ9A 2JFEX 3M17B 4KKNA 2I9TA 4CN6A 4PTNA 3X13A 1WUNT 4MXVE 4IEFA 1SVZA 4WTXA 1HTIA 3AU0A 3AIRA 3EMZA 2ZXGA 1BV8A 4NUMA 4GXFA 5KS9F 1O7DC 3N4AA 3VKAA 3WJZA 3MRCA 4HPOL 3OYZA 4GMTH 4CCCA 2QDHA 5KINA 1IAIL 4FFYH 4HP5A 2E5EA 2G5BB 2X9ZA 1QEWA 4NC1E 2Z34A 2E7HA 4RA0C 1F11B 1SXAA 1W8NA 2ZZ4A 4NNXB 3PPGA 3G1VA 3T6VA 1UT9A 2EILB 4FJZA 3RVXD 1JZ5A 2I5YH 1YDVA 1KCLA 3W83A 1IEBB 1NLDL 1OFRA 4M82A 3CZKA 4HHWA 4R0LC 1PZ5B 2HROA 3DSFL 3RDTB 3T2LA 2V38A 3NJMA 4XBSA 1IE4A 2P88A 3C5QA 1DVTA 2YEQA 1MVFA 3N3EA 4M7KH 2G5BA 5E8DH 1KMGA 3BJSA 3BG5A 4O28A 2QQ6A 1TPUA 2XCMC 2V3EA 3CDCA 3WMQA 2MPAL 1VF8A 1KN2L 2Y22A 2IEPA 4JB9H 2QVIA 1MWAL 4WCYL 4ERSL 1DQWA 4LDEB 5IOKA 2C3XA 2BXVA 1AS6A 1KLZA 2BCMA 4EN2A 1TR9A 4KK9D 3UG5A 3PTDA 1A4JB 1UGKA 4CA4A 3L48A 5DTFB 4B9ZA 3D07A 1F6AA 2GVLA 2PS2A 5TQLA 2BNRB 1A7RL 4KFZC 1QLRB 4XCNA 1RLCL 5HSFA 2I17A 4M6UA 5G2HA 3L5XL 1A6TA 1ZTVA 4PL2A 2FGWL 3EA2A 4EDXA 4A22A 4ODWA 2FWUA 4ZUUB 2VH5L 3NQAA 2B0SL 1Q9LB 1IFGA 4C83A 1BXVA 1QFUL 4MUZA 4Y8DC 2J72A 2K9FB 2QSVA 3KWTA 1PKLA 3BURA 1MVYA 3CIWA 5E1IA 1GW0A 3ARPA 1FH5H 3VZZA 1TVDA 2ESVD 1DKWA 4PWFA 2CE6A 4KK5C 1OE2A 3CUJA 1OGAB 4NQDE 4A1RA 1A8JH 3VXSA 2VWSA 3H70A 5HHPA 1VLIA 4GPNA 3TWBA 5AD0B 2V8MA 2UUDH 4TS6A 5E1GA 3A3WA 4UFMA 1JPST 4BFOA 5A2LH 1Y8BA 3LIZA 4NUGL 5EZIH 3V0HA 5GSRB 1LORA 1YE4A 3ABKB 5IQNA 4OUUA 1WRFA 5I6OA 1JMZA 3MXVL 5D70H 5TE6L 4AL8H 2VUYA 3ITXA 1M4KA 1J2BA 2I7OA 4MCMA 4M5PA 1AXSA 5ITFB 3KR3L 1JZ4A 2J8FA 3PSWA 3PZGA 4ZB5A 3FTXA 3F04A 1JCMP 1M6OB 5CJXA 3KPSD 4JQ4A 4KGJA 3HR6A 1G1OA 3TDFA 1XF2A 3FB6B 5CIPA 1Q72L 1M01A 4GQPH 4Y9PA 1OAXL 4TL4A 3O3EB 4UTWC 4U1LB 2CIKB 1FN4A 1NINA 1FJ1B 3PIQA 2FFIA 2VC9A 2VXQH 1JGEB 2NR6D 5I1AB 1C3FA 4AZGA 2OTUA 3I2CH 4Y5VB 1E72M 4MWAD 1NCCH 4M6MH 1RK0A 1A8ZA 4X99A 5K59F 1Z32X 3DIFA 1A6WH 2B2XH 3KCPB 3QZMA 4KJQD 5FDWB 2E1WA 2VR6A 2Z2AA 3QUXC 3RVVD 3TXZA 2PTZA 3NZRA 3V4VL 3HRZA 3GXNA 2FYYA 1W9DM 3UGRA 5B8CB 2UY3A 4FA3A 3GIVB 4GXMA 3Q58A 4OCWH 3LRKA 1U8JB 2EC8A 2OMNA 1QLFA 2GHWB 3O41A 3PXJA 1E5CA 3ABQA 2F6KA 4WI4A 3QAQA 3MJ9L 1U41A 4XPTL 3H6JA 5LIUX 4NQDD 3ZJ7A 3C2AH 3WFDL 4JO5A 4I6VA 3QXWA 3RGVD 3IIVA 1A4BA 1DBML 2AQ3A 4KKRA 4QLRA 3QZBA 3B8TA 3CLEL 2WVVA 2G30A 2ATKA 2ENYA 5DDHA 3EFDH 3JR2A 1E5UI 1PLBA 3FNDA 4OKVA 1NBQA 1LDPH 1GSKA 3VGEA 3QN3A 3DRTA 5EDSA 1X4ZA 4G1MB 3VRJB 1RD6A 1A65A 2WXNA 3JRKA 5M1TA 2CO2A 3HG1A 3D4CA 4AG4L 2Q8BH 5AOUA 4Y2DD 5CP3A 4ENED 3QQ4A 3B2DC 2FH6A 4G70B 3ZT6A 3PL6C 5I66A 1I8UA 4N02A 5F0PB 1TPDA 4J3OF 1EUUA 4AYSA 4DIXA 5FSDC 4QIRA 3IJ6A 3OYXA 2VUOA 2Z8VC 4R7XA 1S1PA 4PRDA 2Y6ZA 2YLKA 4C56A 4P57B 3FU6A 1G9MH 3XINA 1EV2E 5FYLL 1VEMA 4YHIA 1RHCA 4QNWA 2F08A 4NQDB 1Z9NA 1F2JA 3A64A 1B30A 2Z93A 3QWOA 2FVMA 4Z9KB 3MHUA 1YEJL 1J5IA 3MROB 1FORH 1Z9AA 2W9EL 5DUML 1E1CA 2YD9A 4D2NA 4NNAA 2K0RA 4RPQA 5T9BG 5DUJA 1TIWA 1TJMA 3K8KA 1VCAA 4C1LA 4ML4A 1AGEB 1GAFH 3HB3B 4ODHH 3VI3A 5I1DA 3BWUF 4MMWA 3JYCA 3L4ZA 5GS1A 3U0HA 4XAZA 4CW1A 5E0KA 4ODVL 1GGBH 1EZLA 1GOGA 2J4WL 4PJEE 3REWB 3RA7H 3OXSB 35C8L 1QFWL 1QBMH 1ZJBA 4PP1C 3TN0C 1LK3L 2VJXA 2BP5M 4LIQL 1E9QB 1U8LB 4UQ3A 3IF1B 3UAFA 1BM7A 4S3KA 4PLJC 1J93A 2EJAA 4YVPA 4ADTA 1DVFC 3PS6A 5EHFA 1UA6L 3ARDA 1OAKL 4IRZH 4O02H 2IADB 1MSSA 1B57A 4HSOA 4DJEA 3VXME 4NUJB 3SDXA 3RLSA 1ZXQA 3HR5B 3I75A 2HX9A 2YRLA 4YX2L 1S7WA 3WE6A 1UWUA 3DHUA 1E56A 2HYMA 2OMBA 5M17A 4D0BA 1IBYA 3KRZA 4W7WA 3SM0A 3RMEA 5DI8A 1IQWL 1JPTL 1U95B 2GSGA 3R1GL 4K8GA 7TIMA 1UKTA 5D1XB 5DD0H 4KFMA 2E86A 3LIZL 4ZS6C 5E8EA 1GTHA 3VCCA 2E3ZA 5I5JA 1NM4A 2VGGA 3LLXA 3GTVA 4L3AA 1TXKA 4NQTA 3NQMA 1J9RA 3QHZH 4MJID 5C08A 1RJZB 3HLAB 3PZTA 4GCXA 5DQPA 5T3ZD 1LNUB 4PY7B 3UJRA 2HFTA 4HA3A 4HG4J 1UWFA 5CBIA 3P4LA 3BP7B 1H3GA 4JLRA 1RUKH 4UIKL 2WWMD 2Y5JA 1I8MA 1T22A 2XHYA 4RMRA 4U1NA 3QO1A 3REWA 3S4TA 4FL4C 4NO2A 4N42A 1FRGL 3HI5L 1K4GA 1NAML 2FT8A 3PDDA 1U5HA 5KVGH 3FJNA 3DENA 2EE2A 3BAJA 4KO6A 4Z7WB 2BGNE 3C2VA 3N29A 4UFJA 5C5YA 4LB3A 3SURA 3MROA 4XVUC 2VXVL 2OMVB 3VFRB 5AW6B 3HE7C 5DS8B 5EEUA 1BZ7B 1EZSA 1FVDB 4KUCF 5IW1B 4F91B 3HZKB 5GJSH 2XFXB 3E5BA 1VENA 4UF7C 1ZA3B 4NRRA 4QSHA 3UETA 1GS8A 2WQWA 5I8OL 3BRFA 5CU5A 5I02A 3MCKB 2NNFA 5CCKL 4FXKC 3GSRB 3INOA 3AT9A 1OPGL 4NUQA 3STZA 3IIXA 4HIBA 3SGGA 3VCLA 5EN2B 1IM9A 3TBYB 4FC3E 2F9BT 3N1GC 4NL1A 4DVBB 1UH2A 4XPBL 2E27H 3E6FB 1RHHA 2A9NL 3D0LB 2PCQA 4IGBD 3WFCH 3VXPA 4H7VA 4LBEB 4P2RB 2BGSA 5ABGA 1JNHA 1HQRA 3HQNA 4U6YB 1AHWC 3OGRA 3T40A 1T89C 4S10A 2OMAA 4URTB 3OU8A 5E1AB 3SQOH 1D9KC 3PFUA 4B60A 4N5ED 4ZMNA 1F7BA 1I9RL 4MASA 5AKVA 2EVHA 1EOKA 2XIQA 3LMYA 2HFEB 1Z89A 5HHNA 3CSGA 1AQKH 1I3RA 2ZDSA 3PS7A 4F58H 1UB6A 5I1CH