1F6PA

Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form iii
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
293
structure length
293
Chain Sequence
b'MRDLKGIFSALLVSFNEDGTINEKGLRQIIRHNIDKMKVDGLYVGGSTGENFMLSTEEKKEIFRIAKDEAKDQIALIAQVGSVNLKEAVELGKYATELGYDCLSAVTPFYYKFSFPEIKHYYDTIIAETGSNMIVYSIPFLTGVNMGIEQFGELYKNPKVLGVKFTAGDFYLLERLKKAYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTKAGKLKEALEIQHVTNDLIEGILANGLYLTIKELLKLEGVDAGYCREPMTSKATAEQVAKAKDLKAKFLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYL NEURAMINATE LYASE
molecule tags Lyase
source organism Haemophilus influenzae
publication title Active site modulation in the N-acetylneuraminate lyase sub-family as revealed by the structure of the inhibitor-complexed Haemophilus influenzae enzyme.
pubmed doi rcsb
total genus 124
structure length 293
sequence length 293
chains with identical sequence B, C, D
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2000-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1f6pA00
2KZHA 1VHNA 3GKFA 3LXBA 4A21A 4O0KA 3P67A 3L5MA 3NEVA 2NXIA 4Z1CA 4EF8A 3QH2A 4Y90A 1LORA 4FX6M 3SECA 4OGZA 1F7BA 4IMGA 4KWWA 1T96A 2FB3A 4BK9A 1NEYA 3FKKA 4UMCA 4AF0A 2HMCA 2R14A 1OFPA 1W1ZA 3CB8A 4ORMA 2Y85A 2NWSA 2JGYA 1TV5A 2A7PA 2DZXA 4N9BA 1MXSA 5CPMA 3L67A 1W5MA 1LROA 3RFAA 3T40A 1VYPX 4O8RA 3TE9A 4U4MA 1JR1A 4IWWA 2FFCA 1T8XA 5G1TA 3MI6A 5AYZA 4XBSA 1I4NA 2ZZ5A 1RR2A 2ZZ7A 1RQHA 4Q32A 3PM6A 1ZNNA 4NXKA 4YLWA 1CW2A 2FQIA 2Z6IA 4JYEA 4FX8A 1LDCA 3T4CA 5HR7A 4U28A 3STFA 2C3ZA 3F4NA 5L6UA 4JNMA 3TC6A 1SW0A 1A5SA 1TPDA 4WQ6A 3VNDA 2CZDA 1JQVA 3WK0A 2V5LA 4GUHA 4JTGA 4JR5A 5G5IA 3NPVA 3O06A 1B4EA 4CQ8A 4FNSA 3TW7A 4N9CA 4UTWA 4IX0A 4KWVA 1ML1A 1S5WA 3KVKA 3ABSA 7TIMA 1G69A 1YPFA 1HG3A 3B03A 4IMEA 3S5YA 1PVNA 1OJXA 3DGRA 5H2ZA 1QDSA 3KRZA 4PFMA 3DXIA 3UZJA 2TMDA 1BTMA 1FWRA 1RD5A 1SPQA 3NGJA 4P2VA 3LXCA 1EIXA 1UJPA 3TR2A 3EWZA 4ZZ9A 3O05A 2VFEA 2WKJA 3P8JA 3T55A 1WYIA 4EVZA 3CWOX 5IM51 3F03K 2YXGA 3I7RA 3SGUA 1ICPA 3E02A 3DFQA 1LCOA 2Q8LA 1YXDA 2ATSA 5BW6A 4FX7A 3HB9A 2WSQA 1AW1A 4IMFA 1X1OA 1OX4A 2C0AA 4XTDA 4HN4A 1SSDA 3B04A 1RQEA 4RKAA 3W1QA 1QFEA 1R2TA 4NZFA 4S2CA 2QCDA 1RVGA 3WK2A 3JS3A 4JTKA 3IIXA 2CLFA 2CLHA 2DORA 3NQ7A 3H53A 1SZGA 1GTEA 2X1TA 2J9YA 1PV8A 2PRLA 3Q94A 3BK0A 1WV2A 1SFJA 3UZ5A 2H3BA 2XFWA 4X2RA 1EWDA 4JDYA 4DPPA 3C2OA 4ADUA 5CZJA 2Z2UA 1O94A 5FI8A 3UPWA 1B4KA 1Z44A 4GJ1A 2QCDB 1F05A 1QPRA 3TQ0A 1FCUA 2VENA 2YZRA 4NNBA 2ISSA 3GR7A 4ORIA 5KSWA 4MYAA 1FBAA 1TV7A 3QFEA 1TQXA 2BX7A 3G24A 5BNKA 4YWIA 2Y63A 3PBVA 3W87A 3W7PA 1VLIA 3MHUA 4RZ5A 4O1DA 4QNEA 3DH7A 1H5YA 5TQLA 2PCQA 2Y7FA 1ZJIA 4MY8A 4IXHA 3CM4A 3KFTA 2FPYA 4E38A 4JXCA 1ZAJA 2YSWA 4IXXA 1Z42A 4MOZA 3TMQA 1XBYA 3CC1A 3FEMA 1LLZA 4QISA 3RNDA 3QW3A 3STGA 1X6UA 4Y9AA 3ABQA 5D2WA 4UMBA 1FDYA 3HPZA 5K9XA 3IGSA 2I1OA 5I3KA 3RU6A 4X9SA 2A6LA 2WOQA 3QQ0A 1S3HA 2H3DA 1BKSA 2Y7DA 4JTUA 4WY0A 1THFD 3U2OA 3LTYA 4BI6A 4JTEA 1XDMA 1VCGA 3G1FA 3W72A 1QPOA 3QRHA 2CFFA 1GWJA 1EUNA 2CW6A 1VLWA 3CU2A 5C54A 3ZR4A 1OYBA 1WBJA 1WXJA 1H63A 4A3UA 2ZRXA 3LCIA 4KFPA 2FPVA 4Y6GA 2E68A 3DFNA 2QJIA 3W84A 4WUIA 2Z1BA 3MP5A 1OVDA 2QCCA 2YFNA 4XKYB 1OFOA 5CPLA 4HHPA 1PS9A 4N4QA 1O95A 1IXNA 3EXSA 5D2XA 3NM3A 1DORA 3TQKA 1O4UA 3A9IA 5DXYA 1TPEA 4FXSA 5FF3A 2W0UA 4AWTA 3EWXA 3HG3A 5IBXA 1S5TA 4UTUA 4LUJA 1LP6A 4MVAA 1SZEA 2GVLA 2NV1A 3C2EA 3WJZA 3MWAA 1VGAA 4FNPA 4UTIA 5C6MA 4J9JA 2JKAA 3E49A 3W7QA 5J5DA 5I3GA 2DZWA 1H7OA 1CI1A 3IIPA 4NX0A 4DO5A 1GVFA 1QMLA 1NF0A 3KVLA 3BPWA 3AO0A 4BR1A 1LOQA 1DL3A 3GAYA 2NLIA 1T99A 1TB3A 1TRIA 1DJQA 1EX5A 3DFSA 3G3MA 3LI0A 1H7RA 1KM6A 4O57A 2VC6A 1OFQA 2QUVA 3G0XA 3W7NA 5D05A 3EB2A 4FF7A 2HS6A 1NAL1 5LHFA 3GLCA 5EPDA 5DN1A 4NJGA 3IGXA 2Q3OA 2V5BA 5G2WA 1JRBA 1JCNA 1AW5A 1WAUA 1PCKA 2DU2A 2QCHA 4O13A 5LGZA 3R8RA 3W71A 1DVJA 4HNUA 3O6DA 4XBKA 3W88A 3BW3A 4YL2A 2E6YA 5AOUA 1EPXA 2C18A 5FEZA 3W7EA 4QJ1A 1EP2A 3DAQA 3SIZA 3SY5A 4UFJA 5HR6A 4UCGA 4DO6A 1ONRA 3HGSA 2JKPA 3SJ3A 1Q6OA 1GQNA 4N6EA 2BTMA 1TJPA 3I6RA 2J9ZA 1OG0A 3W2KA 5LNUA 3N2MA 3S1UA 1TPWA 3TXZA 3W7KA 1O5XA 3C6CA 3NQMA 2D73A 3FJ6A 3LHUA 2ZRWA 4H3DA 1ICSA 1K7FA 3GVGA 4K38A 3NOEA 3NL5A 3UY7A 3LRLA 1OFAA 2GJLA 5DLCA 4XZ9A 4AWUA 5DXXA 4RJEA 4I7WA 1O5KA 2YR1A 2V2HA 4N4PA 3MMTA 3KRUA 1QCWA 3V1PA 1F6PA 1FY6A 3ZFHA 2QCEA 3LHTA 2DZSA 1H1YA 2V8ZA 3FYPA 4LC6A 4LVDA 2ZZ2A 2OJPA 5D03A 4QAIA 2B7QA 3GDMA 2E6DA 3BLFA 1GZGA 3QJAA 4FXRA 1IGSA 2DZPA 1QR7A 4UIOA 4RV8A 2B7PA 1HO1A 3NQ2A 2YW4A 2NX3A 4GUIA 3G8EA 3PC0A 4LU0A 4XUGA 4CCCA 5KTLA 3L0KA 4AHPA 3VFLA 1DBTA 2ZQ0A 3CEPA 4UTTC 3S5OA 1AMKA 3M5YA 4Z1AA 3NL6A 3BO9A 3W7HA 4GWEA 3TV8A 1ZAHA 2RH9A 5HNRA 1L9WA 3N73A 4JS3A 2OCZA 1VR6A 3KRSA 4FNRA 3UD6A 1W0MA 4K7YA 4QNWA 1K8XA 1JUKA 2A4AA 1YTKA 5K4ZA 4Q4KA 5CSSA 1U83A 3DFTA 3GDTA 4MFDA 4ZQPA 3MI3A 3W7OA 5AB3A 4JTIA 2DZUA 4K36A 3C56A 1BWKA 1K8YA 1EA0A 5FEPA 3N19B 1MEWA 1OABA 4OU1A 3PB2A 3HBLA 5F4WA 1C9DA 4LUIA 3LCFA 1LTDA 1GG0A 4CNNA 3UWZA 5D2VA 4MY9A 3QM3A 1PHWA 1CX9A 5CPNA 3W7MA 4E0CA 5F2IA 5CPOA 3MI2A 4PA8A 2VEIA 3C2VA 4O52A 4C1LA 4JX5A 3UWVA 2W79A 2WSYA 1JCLA 5HULA 3PBUA 3CIWA 3IIZA 5F2GA 4R33A 1H62A 3NNTA 1I2NA 1K7EA 3W7LA 1K02A 3LOTA 3OVPA 2FLIA 3PSVA 1SR9A 4JTJA 1TYGA 3OVRA 4DELA 3E96A 3EKZA 1OX5A 2CLEA 3M1ZA 1FWWA 2A6NA 1P0KA 4FNTA 1ZAIA 5C5YA 4NVTA 2G95A 2VOMA 4NNCA 3THAA 2NX9A 2PURA 2TPSA 3GAKA 4M7SA 2CLMA 3HQ1A 1WX0A 3ATZA 3HPXA 5DBTA 2P0OA 3G0UA 3T7VA 2QDHA 4O18A 4LWWA 4PTNA 3BARA 3DKLA 1G7VA 4LVGA 4TO8A 2YYTA 3LHZA 2G96A 3MUXA 1Q3NA 4HIBA 3DHFA 4IGHA 3L0GA 2ABBA 3A5FA 1GYLA 2A7NA 2G5WA 3HOJA 4WOQA 3NO5A 3PB0A 3W23A 1TPH1 4UC5A 1OYCA 5EYWA 4WZHA 3A23A 2QCLA 1L6SA 1QPQA 3GIYA 3UNDA 1JRCA 2ZDRA 3E12A 4MZ8A 2CLOA 1C29A 3UWYA 4PODA 4HPXA 3P81A 3B06A 4UTTA 1SO4A 1XKYA 1YLVA 5K4XA 4DF1A 5D04C 2A5HA 3O15A 1LLWA 4Y8FA 5HUOA 3KXQA 4D2JA 3RMJA 3G8RA 3ATYA 3FIGA 1FCVA 3NPXA 4UTHA 1JUEA 2E6AA 2QCFA 3A5VA 1XI3A 3NQEA 4K6AA 5KITA 3QYQA 3W7GA 1KLYA 1R47A 3OG3A 3N9RA 4KFNA 2ZTJA 4BWLC 1KTCA 1P4CA 1TV8A 1AG1O 1MSSA 2Y7EA 5KZEA 4JGDA 4CQ9A 4AF0B 1GTHA 2E5DA 1L6YA 3HG2A 3VKJA 1LRTA 3O63A 4MKNA 1LOLA 3W1TA 1VZWA 2JKEA 4W9TA 2GJNA 3GNNA 1ME7A 5EBUA 3W2JA 1XC4A 2YCEA 3W7DA 4LS1A 4UR8A 4JD4A 2EGZA 4E2BA 3WFAA 3W3OA 4ZL1A 2A2IA 1W56A 3IIOA 1TPC1 3WJYA 3FA5A 3P62A 2YDAA 3MYOA 3KOFA 4CQAA 4ONVA 3M9YA 4OQVA 4LS0A 4DXVA 5F1UA 2EPHA 3Q58A 1VHCA 1EP1A 3L66A 3EKLA 4M7TA 2AGKA 4JX4A 4ADSA 1B9BA 3QPYA 2A1YA 2VELA 1KFKA 3DHDA 3W7JA 2OT0A 3PR2A 3EX1A 3DI0A 2J6XA 1G67A 1GEQA 4UR7A 1M7OA 5TIMA 3W73A 3UWWA 3UY8A 2QKFA 2WNQA 1HUVA 3C2FA 2ZA1A 4MFEA 1Z41A 1G4SA 3G1XA 1AK5A 4GUGA 1OFDA 1D3HA 1FX6A 3KVMA 2VFIA 4MZ1A 4ZQMA 1U5JA 2WJZA 2BWGA 3N14A 2X16A 3CLMA 3G1AA 4O4VA 1YYAA 1W3NA 3S5ZA 4DBDA 1Z48A 4M5PA 5AN7A 1WQ5A 2J24A 2QUTA 2GPTA 3USBA 3BVJA 4MZYA 2QCNA 2ALDA 5FF7A 5G1YA 3GDKA 4QSHA 2YYUA 2OX1A 2A85A 5D37A 3K30A 3W75A 4TMBA 3TJXA 4OE7A 2C13A 4HSOA 1SW7A 5F2LA 1W5OA 3HGOA 4DQWA 2CLIA 1M5WA 1F6KA 4DO4A 3UWUA 3GB6A 4A2RA 3NQAA 2ZA3A 4O15A 4QIUA 3S5NA 4O10A 5D32A 3QEZA 5I3JA 4O12A 4UFLA 3RLVA 3W85A 4B5NA 1N7KA 1MO0A 3JR2A 4WD0A 3OIXA 4M6PA 1LZOA 5HQEA 2XN2A 1JUBA 3FKRA 3EX2A 3QZEA 1SZFA 3JRKA 4ZVJA 3ANYA 4UNLA 3LHYA 1TQJA 3W86A 1SSGA 4Z08A 5D2YA 1GVQA 3TSDA 5AHLA 1T0OA 5LKYA 3W1MA 1KM0A 3LM7A 4JTFA 3V75A 5D2TA 3NPWA 3INPA 3LXAA 4POCA 4Z0SA 3W22A 4HNTA 3PUEA 4N6FA 3F4WA 2CZ5A 1KM2A 3QMSA 3IV3A 1X8FA 3P82A 1F73A 3G1VA 4JDBA 3O8AA 3DU0A 4CLMA 4ZQRA 2NUXA 3GR8A 2OMAA 2JBMA 3MBDA 1JVNA 5LHEA 3LCLA 4LVAA 5D02A 4NJJA 2HTMA 5ABTA 2DZTA 3W74A 2QAFA 5G2IA 3UXAA 1KBIA 3O6CA 3SW6A 3LCWA 2TSYA 3BG3A 1GOXA 1OF6A 4IX2A 1LBLA 3GXTA 3TQVA 1TCDA 4N02A 1X1ZA 2XN0A 3L65A 4K7VA 3O6YX 3R2GA 1SUXA 1M7PA 3LHWA 1TPUA 1DV7A 1R2SA 4FNUA 4O19A 3LDVA 3HGJA 3UXDA 2C6QA 3G1DA 4K37A 1KBJA 1BEUA 4GUJA 1LRQA 1YXCA 1FWTA 4GC4A 5BMWA 4JIPA 2Z0IA 3SZ8A 1QWGA 3UPBA 4FHAA 4MIMA 2YW3A 5HWNA 1D3GA 5AYXA 3RLUA 3QMTA 5CKSA 1AW2A 4RXFA 4AHOA 2ZZ1A 3C2RA 1AL8A 1LBMA 4MYXA 3CWNA 2FB2A 3TU9A 3TSBA 3W2MA 1FDJA 3PG8A 1QO5A 1TMHA 4O0ZA 2QJGA 3M41A 4O14A 2YX0A 4GUFA 4WJEA 5BMXA 1YXYA 1SO5A 5F2MA 4M19A 4TIMA 5HWJA 4R34A 1PE1A 3CIXA 3LI1A 3TMLA 5FF4A 2Y70A 3M5ZA 2PC4A 2ATMA 3EEGA 2C14A 1WBHA 3NQFA 3W1LA 4LRSA 1OFBA 4AXKA 3LBMA 4N9EA 3G18A 4EOUA 1KA9F 3PY2A 3W6YA 4JN6A 3DFOA 4X22A 3WJXA 1TO3A 2B4GA 3LLFA 4NXSA 1NF7A 5CZSA 3L68A 3NL3A 3S42A 3B0PA 2ZTKA 2ZFAA 1G7UA 2ZZ6A 2VEMA 4MJMA 4JYDA 1KFLA 5E1QA 1YDNA 2GVJA 1JCYA 1F76A 2H6RA 2ZCGA 1A53A 4PL1A 4JTTA 4TX9A 5F1VA 4GBUA 5F4SA 4I7UA 1F2JA 4LRTA 1P0NA 1M6JA 1VCFA 3BW4A 1H50A 3MO7A 1GVSA 3P61A 1KFJA 4NJKA 1KM4A 3I7QA 1LRNA 2E5BA 4FIRA 5LSMA 2Y88A 3STEA 2I9EA 4OT7A 5EA9A 1ICQA 4FNQA 4BFAA 1Q6LA 2OZ0A 2X1UA 4L4MA 4CNOA 2NXHA 3W1UA 4IUOA 4OWGA 1VPXA 4HNVA 3P8IA 3TAKA 2V9DA 1OHLA 1TREA 1WOBA 5FF2A 1N8FA 2Y89A 4UFHA 3O07A 4L4LA 1HFBA 3W70A 2ZZ3A 5EMUA 4RZ6A 3C3NA 3NZ1A 4AH7A 2DJLA 3TCEA 4BI5A 3LCXA 3LTPA 4ZMGA 1R46A 1QPNA 1TTIA 3BGJA 4GFSA 2QR6A 1SW3A 5K2ZA 2JK2A 1FXQA 2ZA2A 3PULA 2ZBTA 1FCQA 4A29A 5D38A 1R30A 2QF7A 4NX5A 3L5AA 3KAOA 1OYAA 1IXQA 1P5BA 1B3OA 5K7JA 2B7NA 4IMCA 1MZHA 3QC3A 1FCBA 4R7JA 1G4TA 2YFOA 3T78A 2VEPA 1JJKA 4YCPA 3G3DA 2EAWA 1DQXA 2IQTA 1QOQA 4LNYA 1O60A 5H91A 4AHQA 1H7NA 1JQXA 1L6WA 4JY8A 1I2RA 3NG3A 2O7SA 3EXTA 4LY8A 3UQNA 2R8WA 3CHVA 4IOTA 3D0CA 1UCWA 3U6WA 2V0TA 3GDLA 4YXGA 3PVFA 3EWWA 3HG5A 3GXNA 1DQWA 3BG9A 3NXFA 3KHJA 4UMAA 4Y96A 4JY9A 3PG9A 1RPXA 3P5ZA 3KX6A 5AYYA 4AB4A 3LBCA 6TIMA 5FESA 3LRMA 1RZMA 4WXYA 4OHQA 2WSRA 8TIMA 4TMCA 3P84A 5GVJA 4O11A 3LHVA 4UFKA 3MJYA 2CZFA 3W07A 2Y61A 1ADOA 3LCHA 3M5XA 3HIJA 2RHGA 4ICNA 1UASA 1VS1A 2C16A 2FJKA 3B4UA 2QJHA 5CG7A 3MYPA 1VCVA 4KFOA 5D30A 2NWRA 3C4UA 3ZWTA 2CLKA 4BI7A 3H55A 3H54A 3W7IA 1KFBA 4CCEA 1QOPA 1WA3A 3TJLA 3LTSA 5AC8A 5C55A 3PBYA 1I2OA 5DCBA 5K9CA 2WNZA 3QMRA 1HL2A 4LOCA 2FDSA 4FB7A 1C8VA 3A21A 2TRSA 3S6DA 3PWAA 4G1KA 2ISVA 1KW1A 4HKPA 1KLZA 3EX6A 3GK0A 3QSRA 4AEOA 1NSJA 3NL2A 1VYRA 4LV4A 5DY2A 3W1AA 4CCDA 2GVGA 4XKYA 1IIHA 1UUOA 2V2DA 4HT3A 3VI2A 4Z1BA 4WXZA 3FYOA 1YDVA 2JGQA 5FEWA 4WOZA 4A22A 1XM3A 3HO8A 4NNAA 4UNKA 4JYFA 5K9DA 4NT0A 2WV8A 5AHIA 3M16A 1IIGA 1OX6A 5KZMA 1W8SA 1QNVA 3W7RA 3TC7A 4M6VA 3NQ8A 4WY0F 3W83A 1W5NA 2EHHA 3B8DA 2Y6ZA 5DY3A 3QQ1A 1OF8A 4PC8A 1VYSX 1FWSA 1WOAA 2PRHA 1ZENA 4DF2A 3TNOA 3DBPA 1XDLA 4AMAA 3W2UA 2NX1A 3HMJG 2GQ8A 4UTWC 5I3IA 1XBVA 3S1WA 1IXPA 4K8HA 1G4PA 4H6KA 4DF0A 1FWNA 5D09A 3EWUA 3M44A 2ISWA 2RDWA 4IPJA 1KTBA 2X2GA 2Y62A 4JX6A 2BXVA 1ZALA 4QQ3A 3L9CA 3P80A 2LLEA 4E2DA 3ZS4A 1P1XA 1ME8A 3BV4A 3G1SA 2E6FA 4GE8A 3QF0A 5A5WA 1TRDA 2Q3RA 1H7XA 4LVFA 3STCA 5HUPA 3M7WA 1R2RA 3NDOA 1OFEA 1J4EA 3HPSA 3HF3A 3MP3A 5A8GA 5J5RA 3LX9A 4ML9A 3TX9A 1S5VA 3T44A 4MLJA 3S8HA 3BG5A 5DCEA 3GYEA 1IF2A 2V82A 4O1BA 1SO3A 4LW7A 4PCFA 5LNVA 1G4EA 3DFPA 4BWLA 3F1QA 2DP3A 4ZQNA 2V81A 4FO4A 4N2YA 2FTPA 3DENA 2ZRUA 3RF9A 4JTHA 3MHFA 5KZDA 1EB3A 1KV8A 4S1FA 3IGUA 4RR4A 5DCDA 4NJHA 4LTSA 3P7YA 3IVSA 4WY0B 3NM1A 3DZ1A 4MJZA 4HNNA 1PL9A 4RXGA 1VJIA 2YPIA 3FFSA 3TKFA 1ZFJA 3NA8A 5D33A 1KM1A 2P10A 2ZRZA 3TA6A 2CU0A 1LBFA 1OK4A 3WJWA 3M6YA 4RZ4A 4O4WA 3THQA 4R53A 2E1DA 3WJSA 5HWMA 1SZNA 2J88A 1D9EA 1FUYA 2O7QA 2EF9A 1ALDA 3PF3A 2CWNA 3P5YA 3DI1A 3M43A 3A22A 2VKZG 4RK8A 3NPUA 2B7OA 4PH6A 3CPRA 3RK8A 4RCXA 2RDUA 2WNNA 2X1SA 5C2XA 1OFRA 4A2SA 1K03A 3W1PA 4LC8A 3AJXA 1RQBA 5AHFA 1XXXA 4XWUA 2X30A 4O16A 2QUUA 2ABAA 3C52A 3IRDA 4OV9A 2F7FA 3S0CA 3OA3A 4O28A 4IPIA 4GRSA 5HMSA 2VFDA 3IVTA 4GXMA 2NZLA 3M5VA 1H61A 5K3VA 1HTIA 3ZWSA 1W5PA 1TPVA 3A24A 1VQTA 1VRDA 2QDGA 3L0NA 4Z1DA 4Q33A 4TR9A 4AWSA 2I14A 3CT7A 1F5ZA 5FEXA 3SFKA 5LNSA 3GKAA 2V30A 5E93A 1FDZA 1IXOA 3S9YA 5KMYA 3ABRA 2R91A 4PEKA 2GQAA 4EF9A 5FF0A 4OV4A 3BLEA 3KVJA 4GNJA 3PUOA 1DOSA 3S1XA 1K8ZA 4OBTA 2E09A 3GXPA 2E5CA 2VFFA 1H7PA 1JCJA 2UV8G 3OBKA 5AHNA 4EWND 1A50A 2HS8A 4XTIA 1TTQA 3PAJA 1XBXA 1TPB1 3N3MA 5G4EA 3IVUA 1EP3A 1MEHA 4O54A 4YMZA 3OEXA 5F4XA 5AFDA 2PE4A 5LZLA 1YTEA 4UUIA 4HPJA 3TXVA 3WK1A 4K8EA 3VCRA 1W3TA 1L2UA 1NVMA 4UTLA 3QSTA 3M0ZA 1RV8A 1XFBA 4BF9A 1I8JA 1ME9A 1ZHAA 3C0JA 3UYCA 3PBWA 5I3FA 3C61A 4NU7A 5BOOA 2ZZ4A 3SGZA 3CEUA 2A0NA 1JULA 4S2BA 2VFHA 1N55A 4UFMA 5AHMA 2WQPA 1EEPA 1J5TA 3W9ZA 1EUAA 1TSIA 1H7WA 3P74A 2DZVA 2WO5A 2BZNA 4QITA 1F74A 2RDTA 4DEFA 4UTKA 2C19A 2XN1A 3NAVA 3OVQA 2VXNA 3W1XA 2C1HA 2CZEA 4UXDA 1FXPA 3G1HA 4MPQA 4H4IA 2J9XA 2Y7GA 4NZJA 3TK7A 1WDWA 1W3IA 3R12A 2J27A 2R94A 1LYXA 4I7VA 5HINA 5CZTA 3P60A 1YTDA 1PCWA 5CGQA 3U8GA 1FQ0A 1KV5A 1K3UA 1XUUA 2ZYFA 3VE9A 3EX3A 4M6QA 3MHGA 2QCMA 1V7YA 4LS2A 3SR7A 2W6RA 1X7FA 4YCOA 5AC6A 4FEZA 4JICA 2WPBA 1UB3A 3HJZA 1H1ZA 2H8XA 1GG1A 3N9SA 1Q6RA 3HG4A 3O16A 1OX4B 3NQVA 4NQ1A 3O1NA 4TU1A 3I65A 3G0SA 2PRMA 3G22A 3W2NA 5SWUA 3PSWA 1Q6QA 4MY1A 1QO2A 2BLEA 1I2QA 3LV5A 1LM1A 3R5EA 4NJIA 1DJNA 2BSLA 3NZRA 1UUMA 3R89A 4MUZA 2G97A 3LGEA 1KM3A 3B0UX 3TAOA 4IJBA 2FPTA 2NV2A 3B0VC 1HO4A 3UWQA 3W1NA 2X1RA 3LERA 1XCFA 4O53A 3BGGA 4O17A 4CNPA 2FIQA 3TSMA 3WK3A 1VC4A 1B57A 3FJLA 2GOUA 5AC7A 5LNWA 1NFBA 3W1RA 2E77A 4JIQA 3Q37A 4HSNA 2B0MA 3TFXA 4QM1A 3TW6A 3GZ3A 3N34A 3BLIA 2OT1A 2P1FA 1A5CA 2C15A 1ZY9A 2F84A 1GPWA 1KM5A 1A5BA 5EKYA 2ZRVA 3NR0A 3TFCA 4XQ6A 1DHPA 2EKCA 1W54A 3NQCA 3ABOA 1V5XA 5DBUA 1TTPA 2GQ9A 1XL9A 1BWLA 3ELFA 4O50A 3IIVA 4DBEA 2RKXA 3PS7A 4EIVA 2NUYA 3FOKA 4O1CA 2CLLA 3CQ0A 2VEKA 4PL2A 1Q45A 2HSAA 3LV6A 4RX0A 3SI9A 4IQLA 1GT8A 3E9AA 1I45A 2YGYA 3NQ6A 6ALDA 5CSRA 4LT9A 4K39A 3B05A 1EWEA 3G1YA 1AL7A 5E0KA 1GYNA 2V2CA 3DKJA 3W2LA 1UBSA 2TYSA 3LB0A 1GVRA 3TUUA 3NQGA 4X3ZA 3PUDA 1H60A 2Z6JA 4WX2A 3QPZA 2QEZA 3L21A 3NVTA 3M47A 4P61A 1LOSA 3TH6A 5DELA 1KTNA 3TDFA 5LGXA 1J2WA 4UTJA 1SFLA 3EX4A 4AAJA 5HJLA 5T26A 5KINA 1W37A 2AQWA 1G6CA 3I7SA 3GNDA 3L5LA 4DPQA 1YPIA 3LLDA 4LV9A 3LRKA 4NUWA 1XUZA 1PHQA 1KFCA 1YDOA 5EL1A 3CTLA 3VE7A 5I3HA 4JEQA 5CZ0A 3L2IA 5BRBA 1KFEA 1YADA 3W76A 2VFGA 3TROA 1QAPA 4I9AA 4JTLA 1E51A 2H8ZA 4ZQOA 1W31A 2H90A 4AVFA 1W5QA 1GJPA 5TBOA 3FLUA 3EWYA 1PIIA 3EXRA 3NQDA 2A21A 3YPIA 5G4WA 4C1KA 1JCXA 1TTJA 2NXGA 3Q2DA 5AHEA 1MEIA 1XBZA 2DJXA 3BW2A 2QAPA 3LCGA 3MW7A 1H51A 1I2PA 4UTMA 1TJRA 2AAMA 4ALDA 4JTSA 3GDRA 2A7RA 3QW4B 2QCGA 3NYZA 1ZCOA 5U4NA 1JCMP 4RLIA 1K7XA 3FS2A 4IMDA 3GX9A 3TIMA 4ADTA 4KKXA 4FIQA 4UFIA 5U7SA 3IEBA 1SO6A 3R13A 4MLRA 4Z0JA 3I68A 5IBXC 1VH7A 1A5AA 3MP4A 3W7CA 2ZRYA 1TPFA 4LVBA 3MBFA 4N9DA 1DKWA 5G2HA 5LNRA 1SQ7A 2NUWA 1SU5A 1GVOA 2GUUA 3EWBX 5L9FA 3E0IA 1OK6A 3S1VA 3N2XA 3HGRA 1Y0EA 3SSJA 3C8FA 4O1AA 5EY5A 5MHBA 2RFGA 2Q8ZA 4ZQCA 1TIMA 3OHIA
chains in the Genus database with same CATH superfamily
2OODA 2CBJA 3UR2A 5CBBA 4A21A 3NEVA 4Z1CA 2ZWYA 1UR1A 3M7SA 1LORA 4MNLA 3V5CA 4IMGA 3R4IA 1F4HA 4AF0A 2WVSA 1W1ZA 2Y85A 2NWSA 3EOEA 4AZ7A 3AYSA 5D8WA 1H0IA 1TV5A 3QY8A 4LBRA 4N9BA 4XD4A 1KBBA 5IRPA 1MVYA 3LD5A 4F0RA 4Z2LA 4L5ZA 1EHNA 1RQHA 4Q32A 3RO8A 2FDMA 3IJIA 1TIWA 1E4MM 4JYEA 4LGXA 4FX8A 1SMAA 1LDCA 5HR7A 4FLQA 1EC7A 1SW0A 1QJWA 1TPDA 4V15A 1JQVA 3MT1A 2V5LA 3H2NA 4U5KA 1XV8A 1B4EA 4CQ8A 1LL4A 3WLNA 3BLLA 3ZLGA 3DGRA 1OJXA 3IARA 5H2ZA 3E2VA 1QDSA 2VC5A 3OODA 1SPQA 3LXCA 1VB9A 5B80A 4JHZA 3MWCA 3W6MA 2VOTA 5IFTA 2HVMA 3T55A 6REQB 2PWHA 4F0LA 3IK4A 3CWOX 1XLKA 4M1BA 5IM51 3TN3A 3I7RA 5ABGA 3P0WA 1LCOA 1YXDA 2ATSA 2E8YA 2ZXBA 4FX7A 1AW1A 1OX4A 3IAQA 2ONEA 3DFHA 4RKAA 4G9PA 2AAAA 3FSUA 1SVDA 1NU5A 1RVGA 1O68A 1LQ2A 4JTKA 1LJYA 2CLHA 2ZUVA 3H53A 2ZUUA 5CLTA 1JYXA 6XIMA 1EGVA 1SZGA 2GK1A 3R79A 4E8DA 2J9YA 1PV8A 3GTNA 3Q94A 3BQ5A 3WH7A 1SFJA 2H3BA 1HF6A 2XFWA 3GR4A 4X60A 1W2PA 2Y5JA 1NY1A 3S6TA 4DPPA 3AICA 1IZKA 2YLLA 1AD4A 5FI8A 2E3ZA 2P5NA 1Z44A 4B3ZA 4BHYA 2MNRA 5HA7A 4HK5A 3TQ0A 2YZRA 1XSKA 3LSCA 1EXPA 4UQBA 3GR7A 4ORIA 3DCPA 4AIEA 4AY8A 3CNYA 1E15A 3QFEA 4KCVA 3WQ8A 1ZPTA 3L4WA 2NVAA 2OU4A 4YWIA 4WJ8A 4HYRA 4RZ5A 2PLMA 2PCQA 4BA0A 2Y7FA 3DC0A 4IXHA 3WSUA 3WD4A 3VDHA 3AIVA 3KFTA 1C8QA 3WBWA 1JPIA 2O55A 4JXCA 4HP5A 5JU6A 2XIBA 1UQYA 1A4LA 4NF7A 1ODZA 1X6UA 3ABQA 4P8WA 3TN6A 5D2WA 1TKKA 1WKFA 4RNIA 3MVTA 3MCMA 5I02A 1A5KC 1THFD 2DIEA 4JTEA 1VCGA 1BVNP 3FJNA 3QGKC 2CW6A 1VLWA 1XYFA 1WBJA 3N11A 3LCIA 3DFNA 1VENA 4P7NA 4R9OA 4WUIA 3PBGA 1DTUA 2QCCA 3QV6A 1O66A 1IXNA 1N8IA 3QHMA 3OLGA 1PWMA 3HG3A 5IXEA 4LUJA 1YNQA 2J74A 1K9TA 2NV1A 3WJZA 3FX4A 4UTIA 1C91A 3POCA 3E49A 3W7QA 4UWMA 5J5DA 1RJRA 2Z00A 3WEZA 4FPSA 1QNQA 1IEWA 3PK7A 1Z89A 4BR1A 1X1NA 1DL3A 1EEXA 3AU6A 3H4GA 5H8UA 3ZLFA 1XLHA 3N6JA 3DFSA 3G3MA 1H7RA 2VZUA 1EZ2A 3EB2A 4FF7A 3GLCA 1RD6A 1Q6GA 5DN1A 4NJGA 4EWJA 4Q8OA 1JRBA 5I07A 2YCLB 1ZBVA 3ITCA 1JCNA 1D8CA 1PDZA 1AJ0A 1WAUA 2XIMA 4QJ5B 3HQPA 1HKWA 3ARWA 4LQ1A 4O13A 1Z3NA 2FTWA 3W71A 1DVJA 3O6DA 1B5TA 3FXYA 2F6XA 4XBKA 2B81A 1ZJBA 4FOKA 3TR9A 3RXZA 4Q8PA 5AOUA 4PTWA 2VO5A 2C18A 3FGCB 3SIZA 3SB0A 4UFJA 2GSEA 5B7YA 3AS0A 3BL3A 3SJ3A 4IG2B 1Q6OA 1UHVA 3RCYA 1H41A 2BTMA 3I6RA 1OG0A 1M04A 3P93A 3N2MA 3TXZA 3LZ3A 4WF7A 4MWAC 1P6BA 3BMVA 1ICSA 2X0HA 2ISFA 3NL5A 2D2JA 4JQ3A 4RDVA 3UY7A 3LRLA 3RR4A 1CXHA 4WKHA 4RJEA 5DXXA 4I7WA 3DYMA 1C7SA 3U57A 3LHTA 4PMDA 4LC6A 4LVDA 2ZZ2A 2OJPA 5D03A 1H1NA 4RV8A 2J79A 3RRAA 4GZ7A 4CUCA 3WO8A 2BY2A 3NDZA 3THUA 1HJXA 2C79A 3WIJA 1O1ZA 2AL2B 3V0SA 2F38A 5KTLA 1EYWA 1XIHA 4AHPA 2W66A 2ZQ0A 3CEPA 1M7XA 4LUSB 3QGAC 3VMOA 3NL6A 3QTPA 2Z2BA 3W7HA 3SCRA 3N73A 4JS3A 2YCKX 2OCZA 1VR6A 4KWOA 3HZ3A 4H7VA 3UD6A 4AZCB 4K7YA 4QNWA 2VUYA 1JUKA 4DAIA 4EXQA 5CSSA 1VBRA 3DFTA 4YYFA 3W7OA 4LYRA 1TFVA 1BWKA 1EA0A 2WJDA 1JI1A 1MEWA 1OABA 3AWNA 3HBLA 1C9DA 3GNOA 2J75A 3M0IA 1LTDA 1GG0A 4CNNA 2QPSA 4WLCA 3UWZA 5D2VA 4MY9A 3SN4A 3MUAA 3QM3A 2YB4A 3DESA 4C1NB 5F2IA 5CPOA 2PU0A 1LT8A 3ZVIA 4XSLA 3ABXA 4TQTA 3UWVA 2WSYA 3CIWA 3AIQA 3NNTA 3DECA 1M3UA 3W7LA 1GORA 1K9DA 1K02A 4AD5A 4GI8A 3BLDA 3OVPA 4JTJA 1TYGA 2FZ8A 1UH4A 2ON3A 4NYYA 3OVRA 3HPAA 3C0SA 3WNOA 3RCNA 2VP8A 3T42A 1OX5A 4PUNA 3B0XA 2Z2AA 2A6NA 5B7ZA 2PB1A 8XIAA 3AYRA 4NVTA 2BGQA 2G95A 2VOMA 3SCPA 1XIBA 3THAA 4YVPA 1HGYA 4X0VA 3CHCA 1F3EA 3GVQA 4DZIA 3EA1A 3G0UA 5D9PA 5CC6A 4BKNA 1MW2A 4PTNA 5CJNA 4KW2A 2F8QA 3S83A 4TO8A 2G96A 3BOLA 4HIBA 3L0GA 2BMBA 4TV5A 4GC3A 1GYLA 3DIPA 3N3TA 2G5WA 4ZB5A 3NO5A 3DUGA 4OBSA 1G9HA 2PTYA 5H1WA 4UC5A 2X09A 3B9EA 3TLQA 2E25A 3E0FA 4MZ8A 2CLOA 1C29A 1XCXA 3ERPA 1TMLA 1V0KA 3B06A 2YBUA 3B9AA 1CNVA 3NVDA 1OGGA 2A5HA 5A8MA 4Y8FA 1E0UA 5HUOA 3KXQA 3H24A 4ATLA 3VMPA 3RMJA 3G8RA 3WEMA 1RVKA 3NPXA 4EACA 1SJDA 4E4FA 1UR3M 1KGUA 2OX4A 5KITA 4ZA0A 1XJBA 3QYQA 1XYLA 5EFDA 3W7GA 4NYUA 2GGIA 4KERA 3OG3A 4YTUA 1V03A 4HQVA 4LNCA 4KFNA 4BWLC 2ZUTA 1KTCA 4GQGA 1J18A 1AG1O 1X7IA 3GNPA 1L2QA 2EG7A 3ALFA 3HG2A 3QKEA 3VKJA 1LOLA 4PE8A 5CGMA 3E0VA 5EB8A 4LEQA 3GNNA 3W2JA 3W7DA 2POTA 3MUIA 3R7MA 3NGFA 4G7EB 2NQ5A 3AS1A 2NQLA 3W3OA 3WFAA 5HNTA 4PCSA 4MWAE 4ZL1A 2YIHA 2A2IA 1W56A 5BOFA 2ASHA 2YDAA 3KOFA 1YE4A 1JG9A 1YBQA 4OQVA 3UFYA 1XIJA 4DXVA 1MXDA 3LEPA 1VHCA 1EP1A 1XLEA 3ITOA 3L66A 3CASA 2AGKA 1Q7QA 1B9BA 3QPYA 2A1YA 2FZMA 2VELA 1VBUA 2VRJA 4H7ZA 3EX1A 3HM7A 2I16A 2WPGA 2E4TA 2I17A 4IISA 1TE6A 3B9OA 3UY8A 4XISA 3UNTA 3C2FA 1G4SA 3G1XA 1AK5A 3HV9A 3RJXA 1XD1A 2WJZA 3VIOA 2BWGA 3N14A 1VFOA 1AH4A 1K6WA 3VNIA 4DBDA 5AN7A 2J24A 3WQWA 4AY7A 2GPTA 3USBA 4GYJA 2QCNA 3EGJA 3V7PA 4U31A 3B3DA 3PTMA 3E6EA 4CD7A 3WUGA 2IUZA 1SW7A 2G3NA 3IRSA 4I8YA 1UR2A 3GIPA 2DW6A 4PR4A 5BU6A 3GB6A 4A2RA 2OZ3A 3S5NA 1A3WA 4YVXA 4O10A 3NZQA 3RM8A 5I3JA 3CZEA 1TJ0A 5BWAA 1UD3A 3A9BA 5DX7A 2EPMX 3ICJA 3BURA 3VNJA 1WXZA 4JQ1A 3VDCA 4M29A 4RDZA 4IJRA 4NAFA 3GH5A 6A3HA 1DJXA 4Z08A 3PFMA 4X0NA 3J7HA 3FYYA 4HCDA 3V75A 1R6WA 5D2TA 3T4WA 4POCA 3LXAA 5HPCA 4Z0SA 3NSMA 2R1MA 2Z29A 4QCEA 2BHZA 1KM2A 3P2VA 3QMSA 5KETA 3P82A 1F73A 2HPIA 2Z7KA 5BOEA 4RW3A 3TYUA 1ISYA 4CLMA 3R1ZA 1Q65A 4OUIA 3GR8A 2ALRA 4CD6A 5CC5A 2VGBA 3KL0A 1VJSA 3BLOA 4LVAA 3CAKA 1GOQA 3P0XA 2QHAA 2X1IA 1Z69A 3APYA 5ABTA 1HJQA 4QFUA 3UXAA 3WF1A 1KBIA 3NDYA 3LCWA 4PGLA 3VINA 2TSYA 1E6ZA 4IX2A 4YTTA 1LBLA 1XIGA 2W3ZA 1X1ZA 2FJUB 1XICA 4U3AA 3AS3A 3R2GA 3EPNA 4CN4A 2O0TA 3NZPA 1M7PA 3WZ0E 3REQB 1CECA 4HA3A 1DV7A 1PAMA 4O19A 3UXDA 2W4XA 2C6QA 3G1DA 4IL2A 1BXNA 4P7OA 2JIWA 1LRQA 4F0HA 1EDQA 1YXCA 4MWAB 3NZGA 3LPPA 1ZL1A 2Z0IA 4OOZA 3SZ8A 2BB0A 3R0KA 4MIMA 2YW3A 2DSWA 3QMTA 5CKSA 1AW2A 4AHOA 1NDZA 3GHSA 3UJFA 4C6IA 1RPKA 5C9ZA 2ZUNA 4D6IA 4PCTA 1Y65A 4MYXA 1Y7VA 5DT5A 5GNXA 2WSPA 2QJGA 2BGNE 5BMXA 1FWFC 4S3FA 1YXYA 5F2MA 3URNA 1R0MA 4NASA 4R34A 1PE1A 3CIXA 4GYPC 1RJQA 5I7GA 5FF4A 2Y70A 3M5ZA 2PC4A 3EEGA 4P8VA 3WQFA 1E1CB 4GMEA 3APGA 2C91A 1NH6A 3LBMA 1UWRA 4DM1A 4M3PA 1S1PA 4LB3A 4X22A 1YW1A 3DFOA 4AZBA 4NXSA 4HYVA 2PDHA 3S42A 3B0PA 1IEVA 3HPFA 3VILA 1CGYA 4MJMA 1OINA 4PL1A 2PA6A 4GIAA 1FKWA 4JEJA 5IOBA 2ICSA 4D8ZA 2GOKA 5F4SA 4I7UA 4DJED 5LA1A 1F2JA 4B5WA 3MO7A 1GVSA 4P7QA 4NJKA 1L6GA 1O6IA 3WMCA 4Q8UA 3WLPA 3QY6A 2QZRA 5AC5A 1ICQA 4INFA 2D69A 3T9PA 4BFAA 3VD7A 2X1UA 3UZXA 2A79A 2VWSA 3VIPA 2OYLA 1QK2A 1XG3A 4GKTA 5BXSA 4Q6JA 3NURA 1WOBA 1N8FA 1A49A 3DFYA 4QP0A 3WNKA 5FL1A 1RP9A 4L4LA 3W70A 3TN4A 4MKSA 2H9AA 3NZ1A 4AH7A 3L4ZA 1TR1A 4WR3A 3TCEA 1S2AA 1R46A 4B4FA 4GACA 4IIGA 5K2ZA 1AJZA 1M65A 2BP1A 1FXQA 3AXXA 3GD6A 5C2CA 1FCQA 1R30A 1S2WA 5M1TA 3TVAA 3PZIA 3O9NA 2QDEA 1IXQA 3GHRA 1P5BA 4IUGA 3DERA 1IZJA 1MZHA 3QC3A 4ICMA 1E56A 2YFOA 1R7AA 2VEPA 3G3DA 2EAWA 3QY7A 4Q4OA 2IQTA 4W87A 5H91A 4AHQA 4HOXA 4AUBA 3UQNA 4LUTA 4C6MA 3D0CA 5EFFA 2HEJA 1KRMA 4GZEA 3PVFA 4FS9A 4ROPA 3HG5A 1TA3B 2XU2A 4HPGA 3LBCA 1RZMA 4LCQA 4OHQA 4I9JA 4TMCA 5GVJA 2Y61A 1ADOA 4PMRA 3LCHA 4YHGA 3HIJA 4IFKA 4MB5A 1UASA 4G6CA 1A3XA 4S38A 2RGLA 1XW8A 3WL1A 5CG7A 3ZWTA 5D30A 3CHFA 4QJ3B 5MKGB 4RE3A 2NQJA 3W7IA 5HANA 1WA3A 5E9XA 1J6OA 1CXIA 3M46A 5AC8A 5C55A 2X0SA 1XGEA 1P0BA 4OKDA 1C8VA 3A21A 1XLIA 3UU0A 3B8UA 3T2QA 1KLZA 3EX6A 1X98A 4H6QA 1YE6A 1I1XA 1GQLA 2OEJA 5DY2A 3W1AA 4CCDA 2GVGA 1G94A 1IIHA 4C7DA 2WW5A 4FAMA 2V2DA 4HT3A 4D9PA 4WXZA 3WCZA 1K4GA 1EH9A 3RO6A 4JOMA 4A22A 3SGGA 3RPMA 3HO8A 4NNAA 4O8AA 5K9DA 1IIGA 2PDYA 4DBSA 2XYLA 3RLGA 2ZX8A 2WVVA 1V08A 3W7RA 1VAHA 3MZ2A 3TC7A 3K1DA 4Y9OA 3W83A 1W5NA 4HHMA 2EHHA 3B8DA 4D1JA 3QQ1A 3GTFA 5KEZA 3ONBA 4PC8A 4J35A 1WOAA 4DF2A 2QGHA 2QNEA 4L7ZA 3VVGA 2HK0A 1PKNA 4RE2A 1EOKA 3MV01 5I3IA 1CXEA 2PGWA 1G4PA 3PUGA 4DF0A 1FWNA 1W1B1 5BXRA 2VCBA 4FR1A 3W01A 5LA0A 4KCTA 2ZVRA 2SFPA 1P0EA 4GYPA 4QQ3A 5DRCA 2O9TA 3W4RA 2LLEA 3G1SA 4GE8A 3G6LA 1TRDA 1AQFA 3RILA 1CBGA 3CQJA 1YX1A 3PJUA 3TCSA 1J4EA 3IWPA 3UCDA 3N6HA 2I56A 4D6EA 4HJFA 3GYEA 1IF2A 5E0FA 4PCFA 5LNVA 2XM2A 4HZ7A 4GY7A 3AMDA 3CO4A 3F1QA 3Q4DA 2VMFA 1RAKA 4H01A 3SQSA 3CYJA 5A1AA 1UD5A 4JTHA 1L8NA 2GSJA 3B9NA 5A69A 3IGUA 3CMFA 1E1EA 4C7GA 4H6RA 4WY0B 4R85A 3VZXA 2VC9A 1PL9A 4RXGA 2YPIA 2VZTA 1SZRA 4PMQA 2FYMA 3HJEA 4G2DA 1XR2A 4W7WA 5D33A 2J7FA 4A8IA 5I09A 5D9OA 2BOGX 5KZ6A 3AFBA 2CKRA 3WJWA 4UOZA 2PBOA 3BH4A 4A3QA 4RZ4A 1JDDA 4FXFA 2D2HA 4GVIA 3GHUA 4FP1A 1QK0A 1F9CA 4E3TA 1ALDA 3KP1A 3GUGA 3PF3A 1WZKA 3M43A 3UEQA 3CPRA 4WSJA 3U4AA 2X1SA 5TAOA 5I24A 1RQBA 4AZ6A 4BF7A 3IRDA 4HBKA 1FHLA 1QPKA 3OA3A 5M2FX 1TWWA 6ENLA 1DTNA 3IVTA 4GXMA 1EF3A 4WDUA 3M5VA 1E4NA 2D24A 3ZWSA 1W5PA 2FHBA 4J2MA 4PUEA 3L0NA 4LAKA 3VD5A 1C93A 5CJ5A 1WDQA 4DZAA 3NJ3A 3S9YA 5KMYA 1ZB5A 4U33A 2GQAA 3CBWA 4EF9A 3VKKA 4GNJA 1RCQA 2E09A 2DUZA 2VFFA 1H7PA 2UV8G 3BAWA 1A50A 1OQFA 4XAZA 5A6TC 4RUBA 2X41A 2XGIA 1MEHA 3NTYA 2HK1A 1J0KA 4WJXA 4DYKA 4XG1A 4QX4A 5C7VA 1BRLA 1E0WA 4HPJA 5I0DA 2WMIA 4F0SA 4GLEA 3SRHA 3PJTA 1HJWA 3ZJ8A 2XTKA 4GHRA 4LB4A 3CMJA 3C0JA 2XVPA 3T0DA 5BOOA 4NU7A 3MB9A 3CEUA 1F3TA 4UFMA 2WQPA 4M6UA 1H7WA 3P74A 5FJPA 3TZNA 3OW1A 2JQXA 2DZVA 3ITGA 3ARZA 2PDIA 4UTKA 2C19A 2XN1A 3F2DA 3W1XA 2PFHA 4MSSA 1LL7A 3G1HA 2Y7GA 2XFFA 1MFUA 1XISA 1WDWA 2R94A 1R7OA 4I7VA 1TVPA 2AL2A 2R1LA 3SFWA 3GHTA 5HINA 2WBKA 5CZTA 3OBAA 1OCNA 3MUCA 4YU1A 2FGLA 1PCWA 3U8GA 4YIWA 1EGMA 1V3KA 4HHHA 4I6VA 1Q4NX 4LS2A 1I0BA 3CGTA 1DIOA 4LBUA 1UROA 4XBJA 2P76A 4JICA 4PUDA 2H8XA 1P7TB 3HG4A 2PP3A 1UP2A 1I6NA 2C7FA 3O16A 2WZEA 4W88A 3NQVA 3O1NA 2INZA 1RXOB 3I65A 1DP0A 1QO2A 2BLEA 1I2QA 4H9UA 5A6MA 3FK4A 5LXXA 3F4VA 4ZE4A 1DWFM 4MB3A 3NZRA 4G7EA 2DV0A 2WLYA 1DIDA 1R3YA 2FPTA 2NV2A 2X1RA 2F6UA 3LERA 1XCFA 1G01A 2FIQA 3WK3A 5BZAA 4DJFA 1HZYA 2YA2A 3T09A 5LNWA 4IZGA 1V3HA 4HSNA 3GXMA 3TFXA 2EBNA 1KGWA 4AC1X 1BF6A 3BLIA 2P1FA 1A5CA 1KM5A 5EKYA 4XQ6A 1DHPA 2EKCA 2IMRA 3VKAA 4ICCX 5DBUA 3UWEA 2GQ9A 2UY5A 3GC2A 4O50A 1M68A 4GQRA 4BEUA 5DMLA 3A12A 3PS7A 2GVEA 1B3YA 1ZCCA 2Z25A 4O1CA 2RGMA 2CLLA 4J3ZA 3KTXA 4RX0A 2VX5A 3E9AA 1I45A 3S5SA 2YGYA 4BCEA 1WUEA 3I3DA 4GABA 6ALDA 5I06A 2OLSA 4REQB 2OSWA 4NP7A 1EWEA 3DHUA 5E0KA 4J4KA 2TYSA 3CV7A 3IJ7A 4J3TA 2PI6A 2QMJA 3N6QA 1BSLA 3GYCA 4WX2A 3UA3A 2QEZA 3NVTA 4DJDD 2A3CA 4PMXA 3L2MA 4P61A 4PN2A 4J27A 1LOSA 2IPFA 3PWGA 3TH6A 2BOFX 4HMCA 2F2KA 1RK6A 1HKKA 4UTJA 1W37A 4B16A 2GDUA 4AIOA 3ABZA 3RUBL 4C6FA 3PZVA 4LV9A 3LRKA 3LGDA 4NUWA 3QYSA 4PTVA 4DWDA 5BRBA 1E9IA 2GJXA 3WH9A 3W76A 3TROA 4JL1A 2H8ZA 4YJ5A 3LMZA 4ZQOA 3BOFA 3IJ6A 1W5QA 3EXRA 2ZVIA 3AHVA 1E9LA 1W8GA 2NXGA 5AHEA 3W25A 4B5TA 3URBA 1TJRA 4ALDA 3GDRA 3WQCA 3CV2A 2QCGA 5U4NA 1UYQA 3OP2A 5G1MA 1KCZA 1H0GA 4KIRA 3FS2A 4IIFA 4KKXA 1CGUA 2FMNA 1DIEA 3AQUA 1QI5A 2XH0A 4MLRA 2VC7A 4Z0JA 1HVQA 1A5AA 4F0KA 4H04A 2I5GA 2V3GA 3H2FA 1SQ7A 4KBXA 5HPOA 4WHBA 3EWBX 1IEQA 4I5XA 3R0DA 1OK6A 2ZADA 3C8FA 5MHBA 3LA4A 2RFGA 3VUPA 3WN6A 4XAGA 3IUDA 1JPMA 1QTWA 4QR6A 3GSMA 3KWXA 1TIMA 1FVPA 4O0QA 4I5RA 3RAOA 3LZ5A 3VOFA 2WK2A 4US5D 3UPMA 1CIUA 2NXIA 3OQEA 4FA3A 3GIQA 1GKQA 2OLAA 3GC5A 1UMYA 4KWWA 1T96A 2FB3A 4BK9A 3SN0A 2HMCA 1Q6DA 3CB8A 4HU0A 1U5VA 3KOZA 1UH2A 2A7PA 4QXIA 3OOQA 3PJWA 2DZXA 1MXSA 3VA8A 3L67A 3S6OA 3ZSTA 1EJVC 3TE9A 8A3HA 4OZOA 2YCJA 5A2CA 1J96A 1ZNNA 4YLWA 5A6LA 2YZ5A 2PD5A 3IUIA 3OLEA 3STFA 1TZ9A 1V8EA 5L6UA 4NL1A 1G1YA 4WQ6A 3VIKA 1XLJA 4ENLA 3T8LA 4GUHA 2PDFA 3AISA 4JTGA 2XSBA 2RAGA 2DY3A 3NPVA 3O06A 3THCA 5BRPA 5T91A 3ZT7A 4FNSA 3TW7A 4N9CA 3WNMA 1OADA 4L56A 2WJFA 3ABSA 2PF0A 1HG3A 2HBVA 3OZYA 4IG2A 4IMEA 1R5YA 5XINA 1PVNA 3KRZA 1ZU8A 4PFMA 1V6YA 1EC8A 1EO7A 3UZJA 2TMDA 2P50A 1BTMA 3AOFA 3NGJA 4P2VA 2VR2A 1EIXA 3FHAA 3TR2A 3EWZA 4ZZ9A 3O05A 2VFEA 2WKJA 1DHKA 4ZCWA 1ZJHA 4S3GA 1ICPA 2X42A 1CXFA 3OBEA 2Q8LA 4GVHA 1X1OA 2C0AA 4XTDA 5EMLA 4PMZA 3W1QA 6REQA 4NZFA 1CPUA 1GGOA 3PZMA 5FAGA 1ZSXA 3AIBA 3IIXA 3VD4A 1P7TA 3ARVA 4IP7A 7TAAA 3MV11 4D6HA 3OLIA 3KDOA 4AQLA 1NWTA 1TJ2A 3GNRA 4TTGA 3UPWA 1JF6A 3ITVA 2Y0FA 1FCUA 2VENA 4NNBA 4RNFA 3UXIA 2ISSA 3ZVHA 5KSWA 4MYAA 3VCCA 4W89A 1UWUA 4BQ2A 2HRWA 4HCLA 2Y63A 5GJNA 1NOUA 3W7PA 4CNUA 5HMFA 3N2CA 5GJMA 4QLKA 1TVNA 1ZJIA 4IGNA 3MCNA 3CM4A 4XZHA 2FPYA 2L5HA 4ERIA 2YSWA 4V1YA 3KBSA 1H11A 3V1HA 1A47A 1XBYA 1C8XA 1RLDA 1TX0A 5JH2A 1LLZA 5I6SA 4H83A 3FVDA 5DT7A 2V67A 4QISA 3CZLA 3KL5A 3STGA 4R27A 2JF7A 4Y9AA 1QW7A 1E6XM 1JAEA 4UMBA 3HPZA 2JE8A 1WAWA 3PZUA 4YYCA 4UB9A 4DHGA 2I1OA 1K6AA 3E2SA 5I3KA 2WOQA 4WY0A 4ZBCA 4BI6A 4CQCA 4LEFA 3CU2A 1OY0A 3H4WA 3V5FA 1WXJA 4KEMA 4KFPA 3ZJ7A 4Y6GA 2VX6A 1E9ZB 3DEQA 4JCMA 1NDWA 3QHOA 2Z1BA 3MP5A 2YFNA 3WDHA 1OFOA 1XIEA 4J3XA 1PS9A 1O95A 3NM3A 1Y5WA 2J7DA 1US0A 5DXYA 1TPEA 4FXSA 3RM4A 3CZ8A 3EWDA 3RR1A 2W0UA 4AWTA 1JZ8A 3EWXA 1S5TA 1HKMA 5GNYA 1R9ZA 3N17A 5TNVA 1SZEA 2GVLA 1GNXA 1VGAA 4PULA 4WSKA 3QBUA 3T0BA 2JKAA 4QDMA 3ISIX 1H7OA 1CI1A 3IIPA 4NX0A 1KRCC 1JL8A 1VFHA 3BPWA 3AO0A 3MMDA 3ZXWA 4AISA 2NLIA 3STPA 4I3GA 5E70A 1JXJA 4PFHA 3UG3A 2V63A 1X97A 2VC6A 4ZO8A 3WNLA 3TTYA 3TYBA 3AXIA 2WMKA 3FNDA 4YVVA 2PWFA 5A8NA 5G2WA 2CERA 5E6YA 1WB0A 2VZOA 5AC4A 4GD0A 1AW5A 3UGRA 3IAPA 2JIEA 1BWVA 4CU6A 5LGZA 3R8RA 3CT2A 3KS6A 1GZJA 5JBEA 3TN5A 3GQYA 3W88A 4AMCA 5I5RA 1PTDA 4B5VA 1EPXA 2Z26A 4IPNB 3WNPA 2ZC8A 3DG3A 2HISA 4QJ1A 2CEQA 1M1BA 2FH8A 4QG6A 3OJGA 1MUMA 1ONRA 1ITCA 1UC5A 2REQA 2XIIA 3ES7A 2YCIX 3BUVA 4UQ9A 3IJ8A 1GQNA 4N6EA 1TJPA 1V02E 4Q7IA 1OIFA 2J9ZA 4AZ5A 2H9AB 4JNYA 2WVTA 3PBMA 1JNEA 1S2UA 2PZ0A 4PMYA 3W7KA 3C6CA 1U1JA 3NQMA 5T9BG 3RJYA 3TYEA 3GVGA 3N25A 3L12A 5JUVA 2XISA 1CT5A 2Q09A 2JFEX 3EKGA 5A3HA 5AY7A 4C7FA 4CU7A 2YR1A 2QVHA 3MMTA 2P0IA 1LF1A 3ZFHA 2QCEA 3VABA 3H2OA 4QE4A 3A13A 4QAIA 3VYLA 5ENLA 2Y5SA 3BLFA 1GZGA 3QJAA 4IT1A 2XWEA 1QR7A 1BD0A 7REQA 4WKAA 4YPJA 2VZVA 2YW4A 4EX4A 2CLPA 3G8EA 4LU0A 4XUGA 5AVHA 1C8YA 3U0HA 1ITUA 3VFLA 4F9JA 3S5OA 4L9YA 4Z42C 3BO9A 5MF5A 2WVVB 3TV8A 1ZAHA 4PBFA 5HNRA 4FNRA 4MUPA 3M0XA 3BICA 3ARRA 1K8XA 5LIYX 5A8PA 4IM4A 5E09A 3HMCA 2PWDA 4JTIA 4XX6A 1QNSA 3C56A 3UESA 1K8YA 4RZBA 1XYMA 3N19B 1XCWA 2P8CA 4WRHA 1JYNA 5CQ1A 4TVDA 2WCGA 1GOMA 4EAYA 2YBVA 2G41A 2AGTA 5HBFA 1CX9A 5CPNA 3W7MA 3MI2A 1V6TA 2WKGA 4O52A 1DJWA 1OC5A 2KAUC 3OPSA 4C1LA 2Y1HA 3QV7A 1X6NA 2HPMA 1JCLA 4PMNA 5HULA 4R33A 1PBGA 1K7EA 5JBDA 4L80A 9XIAA 3L2LA 4K1GA 1M01A 2E1WA 3PSVA 3QPEA 4KCWA 3EKZA 1N2VA 3M1ZA 4MNMA 3ZR5A 1FWWA 2WC4A 1UD8A 4DAFA 3OZMA 2BY0A 4Q4MA 1PKLA 4JTDA 4L4OA 1KNWA 1BXBA 2NX9A 2TPSA 3GAKA 4M7SA 2CLMA 2X7VA 3ATZA 3HPXA 5DBTA 3CLWA 5T8GA 4LWWA 1K8CA 4JFSA 3LGGA 3II1A 4LVGA 3K2GA 3KW3A 3VIJA 3V16A 4QTGA 1VBGA 4IGHA 3B4YA 2ABBA 3MZNA 4FSAA 2A7NA 3CK5A 1UR4A 4GFIA 3PB0A 5J04A 1TPH1 1X96A 1L6SA 3GIYA 2EPNA 1JRCA 2ZDRA 3E12A 1QBAA 4B5UA 4HPXA 2WZTA 1HL8A 1HIZA 5A2BA 5K4XA 1JZ2A 1LLWA 3T0TA 4N0RA 1TWIA 1E43A 2CNCA 5EMMA 2JEQA 3K8LA 3ATYA 5E5CA 3FIGA 3EMCA 2E6AA 1P43A 2VX4A 4K6AA 5FSDC 1PXGA 1Y5VA 3SY8A 3VNKA 3EB3A 4AX7A 1TV8A 1J0JA 1MSSA 4CQ9A 1EKOA 1E5JA 2YXOA 4H1ZA 2WWDA 2ZUMA 2D1ZA 3O63A 4MKNA 3W1TA 4J3VA 3IV8A 1JGIA 1DJGA 4Z2JA 3LPGA 3G2GA 1ME7A 4C91A 1UWSA 4CEUC 4YTSA 4PMVA 1UKOA 3W29A 4EXAA 2YCEA 4UR8A 2BASA 2EKGA 1EJUC 1TUXA 4E2BA 5DMNA 2MANA 6XIAA 4EPBC 3OGVA 1POKA 4B5SA 2DZBA 3GBEA 1VFLA 2WC3A 1TPC1 3P62A 4KETA 5TD4A 4CQAA 1ODUA 2OQYA 2EPHA 1EL3A 3Q58A 4P8XA 2NLYA 4M7TA 3DC8A 1QI4A 3W81A 3TYDA 3DHDA 2OT0A 3MSRA 4R3UA 3DI0A 2J6XA 3GTHA 3W73A 5FIPA 3UWWA 2PBGA 4KESA 3BZJA 4GG9A 2BODX 1Z41A 2HE8A 1D3HA 1FX6A 5ECUA 1SJBA 4MZ1A 2X16A 3XIMA 1YYAA 1W3NA 3NWRA 1V93A 1Z48A 4TVUA 1WQ5A 3D3FA 3NFUA 2QUTA 4KT2A 1B31A 3UR8A 1HXJA 5CBIA 5JH1A 3GDKA 3ARPA 1BF2A 3UVAA 4QSHA 2YYUA 2A85A 2W61A 4RPPA 4ZTYA 1OD0A 3TJXA 2AMXA 3OYZA 3SUWA 3HGOA 2WMGA 3QKZA 4DO4A 3UWUA 2O9OA 4QIUA 1VFFA 2ZIDA 1D7KA 3QEZA 4O12A 4UFLA 1N7KA 1JF5A 1U1UA 1SYTA 1Q6EA 3JR2A 3OVGA 3ARSA 5I79A 3O6AA 3SQLA 4UQEA 2XN2A 3GU9A 1JUBA 2IKIA 3FKRA 4C6DA 1W9XA 3MKVA 1FFQA 1TQJA 1O12A 3BAYA 1SSGA 3EDEA 5D2YA 3PN8A 3CUXA 4QLLA 2Q8XA 3CL7A 5AHLA 5BCAA 1XIDA 5LKYA 1GVIA 3UYIA 3AS2A 4H2CA 5HJYA 5D9MA 3TQPA 4JTFA 6CGTA 2CBIA 3INPA 3R43A 4WDWA 3PUEA 3EBVA 3C8NA 3F4WA 1VPQA 3ZT5A 1X8FA 2J7CA 4BQ3A 1PZ3A 1TE1A 4Y2WA 4E5TA 4ZQRA 5EU9A 2NUXA 3H7VA 5LHEA 4ECLA 3L4XA 1SFTA 2BS9A 2PMQA 3KBMA 2HTMA 5G2IA 5D8ZA 3O0FA 4QBXA 3VM7A 2OELA 1GOXA 3E1F1 1F8MA 3GXTA 4K7VA 4DIAA 3LHWA 3FCPA 2B31A 4XIAA 3VD9A 1TPUA 2XVNA 2R1NA 3WQ6A 4FOUA 1E6NA 2X05A 4NHVA 3HGJA 1KBJA 1BEUA 4KRZA 1FWBC 1FWTA 4GC4A 5IDIA 1I75A 1NDVA 1NFPA 4HSHA 4JIIX 2GDQA 5A95A 4FHAA 3U7VA 5HWNA 3H8AA 3RLUA 3AZTA 2YDQA 1DJIA 3LENA 2OXNA 3CWNA 1FDJA 5EMYA 1XC6A 3DYOA 4O0ZA 5XIMA 1JFHA 4O14A 2YX0A 4GUFA 1T6MA 4URIA 2P3ZA 1ZUAX 2FGZA 5I78A 1UD6A 3ALGA 4QEHA 4GO8A 2ATMA 2J78A 1US2A 1WBHA 3WMBA 1DJZA 4HMNA 4S3AA 2ACSA 2QJNA 1V51A 1LUCB 3G18A 4UR9A 4EOUA 1KA9F 4GX8A 2GWGA 3WDJA 4D72A 3CAVA 3PPHA 3L68A 1MNSA 2VEMA 2VJXA 4JYDA 4UCFA 5E1QA 1JCYA 1TWSA 2HJPA 1A53A 1V4YA 5I77A 4TX9A 2FZBA 3KLKA 4KPLA 4NZ3A 3B97A 4FR6A 3QQWA 5AZ1A 3BW4A 2G3MA 1SJCA 1E0TA 5GNZA 3ANUA 3S1GA 4LAUA 1KFJA 2WWCA 1KM4A 3K8KA 1FWEC 1LT7A 1VFUA 3EPOA 4FIRA 5LSMA 3STEA 2NVDA 1H09A 4OT7A 5EA9A 2YOCA 1VF8A 4D71A 4EAMA 4Z1YA 2NXHA 3W1UA 4OWGA 1IHIA 4HA4A 4LF2A 4OVXA 4KF1A 3W27A 3RN6A 3WY1A 1OHLA 5FF2A 3WX7A 2Y89A 4QG9A 2Z1SA 4UFHA 3WL0A 4HZMA 1OGBA 3PAOA 5EMUA 3UF9A 2D3LA 1K9EA 1EJSC 4C6NA 3BGJA 3F2BA 1A5UA 3ZYZA 2YA1A 2CKSA 4CD4A 3K1GA 1JYWA 4XZMX 2ZBTA 1PTGA 2QF7A 4X63A 2NQ9A 1B3OA 2B7NA 1FCBA 4R7JA 1G4TA 3T78A 2A3EA 1JJKA 4YCPA 1QOQA 4BJHA 3SEPA 2WHKA 3GNXA 1H7NA 3SSZA 1L6WA 3CXOA 4F48A 4JY8A 2O7SA 3EXTA 1A5OC 2J7EA 3VGGA 3VGBA 3V3WA 3GTXA 1UCWA 3U6WA 2CHRA 2QQ6A 2OWXA 2Z24A 3NXFA 1EQCA 3KHJA 5CAKA 4Y96A 1RPXA 3P5ZA 5AYYA 2FVKA 6TIMA 2FZ9A 1JI2A 3TJIA 4GJIA 4W93A 4V2XA 3UR5A 4DBUA 1QHPA 3SADA 8TIMA 5M3WA 2FH6A 1XPGA 3P84A 4PYSA 4O11A 2GJPA 3AJ7A 1JDEA 1DWJM 2OYMA 4ICNA 3M6DA 1UPMB 3SCSA 2R1PA 3B4UA 1PIFA 3MYPA 1LL6A 1VCVA 4KFOA 2NWRA 3C4UA 4BI7A 2Q6ZA 5FJRA 1J2BA 3UG8A 1KFBA 5A6SA 3WLJA 3KCOA 3LTSA 3EDFA 4MG4A 5K9CA 3DDMA 2FDSA 1PX4A 2C0HA 4FK9A 2BNJA 1CYGA 3AIWA 3PWAA 4G1KA 2ISVA 1S5MA 2DVTA 4RNHA 3QSRA 4AEOA 1RBOB 3S9IA 1VYRA 4PB5A 5DEZA 4XKYA 2O4MA 1IEXA 4XZLX 3WLKX 4Z1BA 3FYOA 3RM9A 4E8CA 1UIOA 1U1HA 1VRXA 4G7FA 1OIMA 2YBTA 2ISDA 3EDJA 2D0HA 2WV8A 5AHIA 3MMUA 3GC4A 1OX6A 3LYEA 3OQ8A 2PEVA 1QNVA 4M6VA 3NQ8A 1FHVA 4B3LA 1W1IE 1KWGA 1OF8A 5AZ0A 4FI4A 1UD2A 1DWIM 5AYBA 3UVIA 1NP0A 3DBPA 4AMAA 1XRSA 2GUBA 4UTWC 3S1WA 1IXPA 3XINA 3WBYA 2AKZA 2OQHA 4JHMA 3WUFA 5C8BB 1UW9A 4E4PA 1J0ZA 2ISWA 3EA2A 1QI2A 2FFIA 1TG7A 1KTBA 2QPUA 1CGXA 4M24A 3BSGA 2E40A 2JEPA 1JDCA 4JKKA 1UOZA 1FA2A 4LAZA 4AWEA 3ZS4A 2IQDA 4Z2GA 3VTRA 5A6BA 1UZ4A 3EOOA 4HZ8A 2DQWA 1EA9C 3QF0A 1SJAA 2Q3RA 1OD8A 1H7XA 4DZ5A 1OFEA 2WQDA 3A4AA 1EZWA 3MP3A 5J5RA 3LLXA 4GQ0A 1XRVA 4ML9A 3TX9A 1XIFA 3K4AA 1XYAA 3UJSA 4DJFD 5C9RA 1G4EA 1MW1A 4BWLA 4FO4A 3E2QA 4N2YA 4ZODA 3DENA 4NZ1A 2ZRUA 3KTCA 3QOKA 5CC3A 3MHFA 1EB3A 1KV8A 1B3VA 4S1FA 2F9RA 4RR4A 5DCDA 4LTSA 3DZ1A 1ZBWA 4HNNA 1VJIA 3NEHA 4NY2A 1FTXA 3FSTA 3NA8A 3KRBA 1AQHA 2P10A 5IHSA 2F6KA 3MDUA 2CU0A 2VQUA 1LBFA 5DRIA 4U2YA 1IYXA 4A6GA 3R10A 3WD3A 1R3SA 3CV1A 4J5NA 1IE7C 4O4WA 3THQA 4R53A 4MNJA 3DG7A 3GH4A 1D9EA 4S39A 1E9YB 4WK9A 4L1GA 3U5UA 2D0FA 1WDPA 4RK8A 3W02A 3B8WA 2B7OA 2GUYA 1RY8A 3COTA 4ZGYA 1E73M 4PH6A 2GVYA 3RK8A 4QSFA 1K03A 4DJEC 5C71A 4W5UA 2X30A 4V27A 5H8PA 2ABAA 4PCNA 1QHOA 3MA8A 2VL4A 2WXDM 2GYIA 4IPIA 3NSXA 4GRSA 5IFPA 1W6TA 2DVXA 2NZLA 2V3FA 4ZOAA 5C9XA 3PWIA 3SCOA 1XH0A 1HTIA 2WMFA 3VPLA 7ENLA 1TPVA 3A24A 1VQTA 4GNVA 1XX1A 1XLDA 2I14A 3CH0A 3SFKA 5FEXA 5ABFA 4MDOA 2C8NA 4C5YA 4QE5A 1F61A 3GW0A 1IXOA 3ABRA 4JAWA 4KS0A 4MADA 1B90A 3BLEA 1V6UA 4DX3A 1K8ZA 4OBTA 1J79A 3IUHA 4LUYA 4EWND 2DSUA 2ZX6A 2PTXA 4JTAA 3REQA 4XTIA 2VD9A 3CB3A 1XBXA 1TPB1 3N3MA 3NIYA 1EP3A 5C2GA 2D20A 3HFTA 5LZLA 4LX4A 1QNOA 3APTA 4UUIA 2WNWA 1E55A 3QZ6A 2Y2WA 3PPFA 3AMCA 4AEEA 3UZZA 3BOXA 3VCRA 1W3TA 7ODCA 1L2UA 2YL5A 4KGJA 4CN6A 1BAGA 4UTLA 1XFBA 4BF9A 1XYBA 4KGLA 3UYCA 1EX1A 3PBWA 5I3FA 1ZTVA 3C61A 1EC9A 1CB2A 2ACRA 4DWSC 5AHMA 3V5OA 3W9ZA 2W5FA 1EUAA 3T1GA 3KBWA 4H9XA 4S3CA 2ZXDA 1VJZA 3TNBA 2VEGA 1GYMA 2WHLA 1DXEA 2VI0A 2X7WA 4DNMA 1FH8A 2CZEA 2HV5A 3PFRA 1E0VA 3UW6A 2EPOA 3EDKA 2PTWA 3TK7A 3AI0A 1AUSL 5FCZA 2XIJA 1W3IA 3PNUA 5C9UA 1GQKA 4Y9MA 3P60A 4DN1A 4NI3A 1YTDA 1FQ0A 2QGYA 1WPCA 1IWBA 4PUUA 3L4VA 3EX3A 4HGXA 4PUWA 3MHGA 2QCMA 1V7YA 3SR7A 4RE4A 2W6RA 1X7FA 3CUHA 1VKFA 4FEZA 3MU7A 1UB3A 1TX2A 4NQ1A 1XLLA 1E4IA 3N2OA 3PSWA 3OG2A 1Z7AA 4NJIA 1DJNA 3QR3A 2BSLA 3ARTA 1YBQB 3S2NA 4S3JA 2Z27A 3EDDA 4IJBA 1RCOB 1W2VA 3B0VC 3U2EA 1HO4A 4WIWA 4O53A 1W1A1 3BGGA 3P14A 4CNPA 3TSMA 1VEOA 4JTCA 1B57A 5AC7A 2YDRA 1P1MA 2VX7A 4TX8A 5DMMA 2E77A 4JIQA 4D8AA 2GGEA 2B0MA 4CQBA 4GY0A 3GZ3A 2E7FA 2VZSA 2ZRVA 3NR0A 3TFCA 3BJTA 1W54A 1JAKA 3NQCA 3ABOA 1V5XA 1BWLA 3ELFA 4DBEA 3CUJA 4N42A 4GKLA 2RKXA 5A6KA 4EIVA 3FOKA 3I6TA 2DSKA 3RMEA 2VEKA 4ZFMA 4KRUA 2NV9A 4PL2A 1Q45A 2DH3A 1QVBA 1S46A 4KEZA 4IQLA 1XHGA 3KZPA 3IJDA 1UR9A 3SCVA 5CSRA 3VIGA 4LT9A 3UR7A 2Z1WA 2GFTA 4K39A 3G1YA 4I6KA 3VKCA 4HMDA 1Y5XA 1MUWA 3WELA 3SY1A 2ADAA 1NWRA 1LG1A 3SCTA 3W2LA 1UBSA 3CMGA 2F61A 3AYVA 3PUDA 2UY2A 4KEUA 4QRNA 1RA0A 1OT1A 1H60A 4KQNA 2Z6JA 3ID7A 3L21A 2J7GA 2E9MA 3PZGA 4AZGA 3LPOA 3VOCA 5LGXA 4U10A 1J2WA 4IF2A 2XH7A 1DE5A 3EX4A 3VX1A 5HJLA 5T26A 5KINA 1ZP3A 3O7UA 5DO8A 1I60A 1QATA 2PWUA 1PDYA 2TODA 4DPQA 5M17A 3W37A 1AH0A 1KFCA 5EL1A 3CTLA 1GKRA 5CZ0A 3M0HA 5JBFA 4MB4A 1HL9A 1CGWA 2Z28A 4LYKA 1KFEA 5I00A 6PTDA 1ZGDA 1QAPA 2E9BA 4ASTA 4XZWA 2H90A 2D23A 4AVFA 1UPPA 1GJPA 5TBOA 3FLUA 3F5LA 3UBPC 3U7BA 3YPIA 2OQLA 2DGAA 1W9PA 3WH5A 1JCXA 1S2CA 1V02A 1XG4A 1MEIA 5FJTA 2DT3A 1XBZA 4JQ2A 3D5HA 3QVQA 3SN1A 3LCGA 3MW7A 1FH7A 1H51A 1I2PA 1KBLA 5C7HA 1QBBA 2IKJA 4Q4QA 2A7RA 1A3HA 8CGTA 4TV6A 3NYZA 1J0IA 1H49A 5E6ZA 1K7XA 1RBAA 1E40A 4IMDA 3GU1A 3GX9A 4ADTA 2QMKA 1JPHA 5U7SA 4HYWA 4A8NA 3IEBA 1SO6A 2V5DA 3I6EA 1SMDA 1VH7A 3MP4A 5BRQA 3W7CA 2ZRYA 4XAPA 4E6MA 1TPFA 3MBFA 4N9DA 2CYGA 3UERA 2GUUA 5L9FA 1HKIA 1AJ2A 1YPXA 1NQ6A 4Q3MA 4FXJA 2KZHA 4R7WA 3GKFA 1BPLB 1KCKA 3CHEA 5I03A 3QH2A 3FW6A 3KUMA 4FX6M 3C0QA 1RCXB 1F7BA 1HKJA 2AOSA 3BDKA 3WMSA 5DMYA 4HU8A 3T07A 1WP6A 1OFPA 2QW5A 1B0IA 2IW0A 2JGYA 4IQDA 1IT8A 2IPGA 5CPMA 4GCAA 1W5MA 1LROA 4ZSUA 3LU2A 3T40A 4O8RA 3H2MA 4U4MA 1JR1A 4IWWA 3AHXA 4B91A 5G1TA 3MI6A 5AYZA 6TAAA 1I4NA 2ZZ5A 1GONA 1RR2A 2HDJA 1REQA 3PM6A 4NXKA 4IICA 2DT2A 1EYEA 5CC7A 5GQBA 1R8LA 3F4NA 3VM5A 2P8BA 1PYFA 3VNDA 1JDAA 2VDHA 1HP5A 4X2PA 7A3HA 4H00A 4UTWA 4MF4A 1J0YA 4KWVA 3ZLHA 1ML1A 3KVKA 3PPGA 1G69A 3L4TA 1YPFA 4HK6A 3B03A 3CH9A 4IGMA 5CJMA 3DXIA 3JW7A 1R86A 2RDXA 4YNGA 3V0UA 4OBRA 1VP5A 3F03K 4QS6A 2YXGA 3E02A 3DFQA 1XINA 5BW6A 4JKLA 4HTBA 3WBXA 2WVUA 4HN4A 2G3JA 3B04A 3T05A 3BZGA 1QFEA 1R2TA 5A2AA 2GL5A 2QCDA 3WK2A 3ENLA 2OGYA 2WHMA 2CLFA 4ZOEA 3NQ7A 1QW9A 1IWPA 4BQ5A 2HWGA 1GTEA 3WG6A 2O92A 2PRLA 3WQVA 3CAWA 2NT0A 3UZ5A 3E5PA 2WMJA 2XVLA 4NKCA 3IJQA 4JDYA 5CZKA 1TV4A 3KE0A 5CZJA 1B4KA 4AZIA 4GJ1A 1A0CA 2GWNA 2QCDB 1TV3A 4RPQA 1F05A 2DDXA 5C9WA 1FBAA 1TV7A 1NOFA 1D7FA 3G24A 5CXPA 5BNKA 3W87A 1VLIA 3MHUA 4JIRA 3V0TA 4L61A 5LYRA 3AZRA 3DH7A 1H5YA 3KBNA 5TQLA 3K8MA 3PP7A 3BCDA 4W86A 3CS2A 4Q8NA 2VVSA 4M80A 4IXXA 1Z42A 3VZZA 3TMQA 2XPKA 2EG8A 3FEMA 1KD0A 4REQA 4AC7C 3GG8A 3PTDA 2VUNA 3QW3A 1HJVA 4JQ4A 2VNCA 2VGGA 3H2CA 4LFYA 4GCXA 3IGSA 1T41A 1XLFA 2PF8A 1FP9A 4C60A 3RU6A 2IS7A 4X9SA 2A6LA 3QQ0A 9CGTA 1S3HA 2Y7DA 1BKSA 4HJWA 3LTYA 4GGBA 3W72A 4H2HA 3QRHA 3TYZA 1YIXA 5M03A 1GWJA 4PB3A 2YL6A 3ZR4A 4ILSA 1OYBA 1WZAA 4A3UA 3DG6A 1XKJA 2FPVA 2QJIA 3B8IA 4RDWA 2PGRA 1R3VA 1OVDA 4CNSA 2G8ZA 4DUXA 4XKYB 4X9YA 5CPLA 3WYZA 1D8WA 4B90A 4N4QA 4TTUA 1UH3A 2IKGA 1BKHA 5D2XA 3UZWA 3NSNA 1E6SM 1DORA 3TQKA 3A9IA 3WUBA 2BVYA 2UY4A 5IBXA 1LWJA 1T5AA 3R58A 3MWAA 4FNPA 4B4HA 4RE0A 1R9YA 4J9JA 2HXTA 1GEHA 3M0KA 3QC0A 3I4EA 1HT6A 3GXFA 4DO5A 5J8LA 1NF0A 3KVLA 4NIRA 4ACZA 2YA0A 1LOQA 4LYQA 3GAYA 1T99A 4NILA 2PUZA 1TB3A 1V79A 1KM6A 3RYSA 1OFQA 3WQOA 3G0XA 1JPKA 3W7NA 4E3VA 2HS6A 1W32A 5EPDA 1KB3A 5JIPA 1L0PA 4W8LA 2Q3OA 2V5KA 1XYZA 2HZGA 2V5BA 3KZSA 4GY1A 4AZHA 3AROA 1FHDA 3L23A 4C1NA 1PCKA 2DU2A 4GK8A 1DXIA 3WF3A 4GGHA 3S47A 1NARA 4A4AA 3OLDA 4HNUA 9XIMA 1HVXA 1BYCA 3NQBA 3BW3A 3G77A 1HW6A 1DQUA 4B5XA 4TVCA 2OEMA 3W7EA 1EJ7L 1EP2A 3DAQA 3SY5A 3WD2A 1KKOA 1ENUA 1MWOA 3WD0A 4KCUA 4AVOA 5CAHA 3DX5A 1PB0A 1WUFA 3ZJKA 2ZX9A 3W2KA 5LNUA 5I3DA 4GZIA 1TPWA 4RDYA 3GU2A 3FJ6A 4CKQA 3LHUA 2XINA 1CLKA 2ZRWA 4H3DA 4IIBA 1K7FA 4K38A 3NOEA 3WNNA 3BAXA 3WD1A 1OFAA 5DF0A 4CNTA 5DLCA 4XZ9A 1JZ5A 3JZUA 2PDKA 4N4PA 2YL9A 3KRUA 3H4XA 4WVXA 2GZXA 3FYPA 1AFSA 2B7QA 3GDMA 2E6DA 1EJRC 4S3BA 4FXRA 3THDA 3I10A 2DZPA 4UIOA 4S3KA 4AYSA 3NQ2A 1HKVA 4OUEA 2O4QA 4GUIA 3R8GA 3PC0A 2R82A 2Z1KA 5A8QA 3KWSA 1WKDA 4F40A 4BF5A 2VGFA 1DBTA 4UTTC 1AMKA 2W9MA 4Z1AA 4J3WA 2AL1A 3MSYA 4IIDA 3A4XA 2PP0A 1VFTA 1WE5A 1L9WA 1R87A 4PTXA 1X6LA 1PTAA 3KRSA 1W0MA 3N15A 3CYVA 2XVKA 5IHRA 2A4AA 2PSNA 3SO7A 5K4ZA 2EPKX 1CTNA 4MAZA 1U83A 4MFDA 3FXGA 2GGJA 5AB3A 4AD1A 4D6JA 2X0YA 2DZUA 4G1NA 4ROQA 4H6EA 4JQAA 3E2RA 4P5UA 4OU1A 5CH9A 4ZOBA 4XO6A 5F4WA 1B3XA 1MQQA 1F3XA 3BJFA 4F2BA 2CIPA 2BGSA 1OCQA 1B1YA 1PHWA 2CITA 2WMIB 1TA3A 4PA8A 3C2VA 3WFLA 3FAXA 3PBUA 1H62A 3Q67A 3V35A 1E1FA 3WH6A 4W84A 1C92A 4JBRA 4DI9A 4UZSA 5FJIA 1H2JA 4DELA 1VBHA 2CBUA 3E96A 4HU4A 3WLLA 2V3DA 1P0KA 4FNTA 4HK7A 3U9IA 4BQ4A 2HVNA 2RUSA 3I3EA 1ZAIA 5C5YA 3GS6A 3QGVA 4ERGA 4NNCA 2J8GA 2PURA 1MUCA 1GKPA 4US5A 1CCWB 2CXGA 3CL6A 1PZ0A 3MMWA 4K1WA 1B3WA 4LXFA 4Y7EA 5FKYA 2ZC1A 2P0OA 4AY1A 1B54A 3T7VA 1LQAA 1P48A 4C6LA 3PJXA 4EKJA 1VFMA 4K3ZA 4DZHA 2J7HA 3LHZA 2WZMA 3VGHA 3S2CA 1Q5MA 4F8XA 3DHFA 3VX0A 4DJFC 1FWJC 1RBLA 1ZS2A 2PGEA 3VIMA 1WXYA 5CG0A 1MW3A 5EYWA 2OSXA 4WZHA 2NVCA 2XVGA 3UNDA 4IIHA 3UWYA 2WCSA 4PODA 3OO2A 1NIUA 3TW9A 3P81A 3E0LA 1SO4A 2WKLA 3GG7A 4CCZA 4MB1A 4DF1A 3WLQA 4TUFA 3O15A 5D04C 2JALA 3QLDA 1TZZA 4D2JA 2WM0A 1FCVA 4UTHA 3T0AA 1JUEA 2QJJA 1XI3A 2XIQA 5BROA 3HQNA 1XYCA 4DYJA 2DEPA 3ORWA 1NJJA 1R47A 2PDWA 1UD4A 1UWTA 3N9RA 1FHUA 2CHNA 1TV2A 2Y7EA 2OO6A 1E3XA 4JGDA 1C9WA 1JD7A 4H9TA 2EO7A 3IPWA 1L6YA 2CZVA 1LRTA 1RLCL 4EPDC 1V3IA 2OLHA 3R11A 2JKEA 4W9TA 3GZAA 3ZM8A 1XC4A 1R38A 4C90A 2A3LA 4L64A 1RJPA 1NWUA 2VRQA 4LS1A 2EGZA 3LM3A 3LK6A 1Q63A 2OVLA 1GOWA 3DN5A 3B8VA 3WJYA 3MYOA 4ONVA 1KO0A 4QQUA 4JX4A 4ADSA 4HNCA 1P6CA 1KWKA 3W7JA 1FWHC 3BAKA 1CDGA 1G67A 4C65A 4UR7A 1M7OA 5TIMA 2QKFA 2WNQA 1HUVA 1VIZA 2AQOA 1LWIA 2ZA1A 4MFEA 4A05A 1C90A 2VFIA 1B3ZA 3G1AA 1P0DA 4B3KA 1JIBA 5CLWA 5FSEC 2I5IA 4AFYA 4M5PA 1ZQ5A 4DLMA 4Q8WA 2REQB 4B15A 5FF7A 5G1YA 4EPEC 4QEEA 4EE9A 2HE5A 3H12A 3QOMA 3ARUA 4EPKA 4ZSTA 1M7JA 1A0EA 3K30A 2QT3A 2NT1A 2V6AA 3KBJA 4TMBA 4FALA 4HSOA 5F2LA 1BQCA 4H9MA 3CHDA 1M5WA 4EXBA 1F6KA 4F2TA 1J10A 4O15A 2ZE0A 2J66A 4C6CA 4QE1A 3QV9A 3W85A 4B5NA 4JL2A 5CPTA 1LZOA 4FOJA 3V18A 4TOQA 3XISA 3OB8A 4AD3A 4IHCA 1PYMA 1XSJA 2OZTA 4KWSA 4W8AA 3W24A 3AMGA 2PWVA