1F6PA

Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form iii
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
293
structure length
293
Chain Sequence
b'MRDLKGIFSALLVSFNEDGTINEKGLRQIIRHNIDKMKVDGLYVGGSTGENFMLSTEEKKEIFRIAKDEAKDQIALIAQVGSVNLKEAVELGKYATELGYDCLSAVTPFYYKFSFPEIKHYYDTIIAETGSNMIVYSIPFLTGVNMGIEQFGELYKNPKVLGVKFTAGDFYLLERLKKAYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTKAGKLKEALEIQHVTNDLIEGILANGLYLTIKELLKLEGVDAGYCREPMTSKATAEQVAKAKDLKAKFLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-ACETYL NEURAMINATE LYASE
publication title Active site modulation in the N-acetylneuraminate lyase sub-family as revealed by the structure of the inhibitor-complexed Haemophilus influenzae enzyme.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Lyase
total genus 124
structure length 293
sequence length 293
chains with identical sequence B, C, D
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2000-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1f6pA00
2R8WA 2YR1A 3L5AA 5K3VA 1JQVA 1O5XA 3L9CA 2W6RA 3M6YA 4DPPA 3WJSA 3N9SA 4JX5A 3G8EA 4LUJA 4DXVA 4O14A 2EKCA 1Q45A 3E12A 1JUKA 3G18A 3W70A 1NVMA 3L5LA 5A8GA 3IV3A 4IPIA 3GDKA 2ZZ6A 3HO8A 2E6FA 2X1UA 5C5YA 2YGYA 3C8FA 3INPA 1KM1A 1FX6A 3W83A 5FESA 4FNSA 3HPZA 4M7TA 5C2XA 4UMAA 3LRKA 1Q6LA 1Q6QA 2Y85A 2C3ZA 4NT0A 2VEMA 2Y61A 1X8FA 3P7YA 3T4CA 1J4EA 1L9WA 3N34A 3MBDA 2VOMA 1G4SA 4UR8A 3FFSA 5FEXA 4TU1A 4MYXA 3KHJA 5F2MA 3FS2A 4JTIA 3RMJA 4O1DA 4BI7A 2PCQA 1TRIA 2WJZA 2WPBA 3BPWA 1JVNA 4TMCA 3P5ZA 3ATZA 2YYUA 3N2MA 5LSMA 5FF3A 3SY5A 3LBMA 3W7MA 1K8ZA 4NUWA 2QCNA 4CCDA 1H7PA 3OVPA 4QJ1A 3EXSA 2VC6A 2CZ5A 3HG2A 5AC6A 2ZRXA 4IPJA 3HIJA 3LCFA 3UNDA 2WV8A 3W84A 2QCLA 1LP6A 1D3GA 5I3JA 1QO2A 1UCWA 4EVZA 2ZRWA 4B5NA 2DZTA 1TV7A 3RNDA 2GJNA 5AFDA 3GYEA 7TIMA 1OHLA 1QR7A 4HIBA 3PG9A 2O7QA 3C6CA 2QUUA 4C1KA 4ADSA 1PIIA 3NQ2A 3O05A 4MY1A 4RXGA 4RXFA 2Y7GA 2X30A 4JTFA 5HWNA 3FIGA 1KFCA 3TMQA 4R33A 1FWWA 2FTPA 1UUOA 4AF0A 5EA9A 5EY5A 2GQ8A 4EF9A 4FNTA 3W86A 3WJXA 2R94A 3TX9A 2C1HA 1F74A 2EGZA 5AOUA 3S5OA 1KM0A 3NQDA 3DFOA 3QW4B 3W72A 3QSTA 5I3FA 5G2WA 4YL2A 1VZWA 3ZWTA 2DZUA 1AL7A 4MUZA 4FXSA 3IVUA 3G1VA 2TMDA 3G0SA 5BRBA 2C19A 2YFNA 5G1TA 2JKAA 2E6YA 2VFFA 3QW3A 1I2NA 3PM6A 2EF9A 2FPYA 5K4ZA 2RHGA 3ZFHA 3I68A 3W7HA 1ALDA 3LTYA 3W7JA 3P5YA 2J27A 3K30A 3DGRA 3YPIA 3RFAA 2OMAA 3VKJA 3VCRA 1PVNA 5G4EA 2J9ZA 2V30A 1M7OA 3PUOA 1LOLA 1WX0A 1OFQA 2QCDA 3W74A 4GUHA 1SO6A 1UBSA 1DVJA 1OYBA 3PB2A 3CWNA 4DO5A 1JQXA 1TPC1 3BGJA 3CM4A 1CX9A 1LRTA 2E68A 2QUVA 1OJXA 3UD6A 4YCPA 1CW2A 2H8ZA 4LOCA 1HO1A 1K03A 2NWSA 1JCMP 5DXXA 1DOSA 4MZ8A 1G4TA 2ZTJA 4DQWA 2FLIA 3KXQA 1GPWA 1KBJA 4O12A 3P8JA 2Z2UA 3PWAA 2QDHA 1QDSA 2OZ0A 4Z1AA 1H7OA 4M6VA 4TIMA 1XKYA 2DZVA 2V5LA 4O4VA 1P5BA 4ALDA 1PCWA 1RQBA 4N02A 4NJKA 2X1SA 3I7SA 3G8RA 1JUBA 4O54A 3PG8A 5IBXA 4Y96A 4RKAA 5E93A 3DFSA 3BO9A 4YXGA 3NYZA 1YXCA 3ABOA 2BSLA 1XUZA 3W7NA 3NQ8A 4CCEA 2TPSA 5FF4A 4EWND 4N9CA 2YDAA 4AWUA 4XBKA 4O15A 3GK0A 2D73A 3DFPA 3FKKA 4GE8A 3P84A 2FPVA 3GNNA 4HPJA 2E6DA 3MYOA 1VHCA 3C3NA 3O6DA 4Y6GA 3OG3A 4K8EA 5AYXA 1XBZA 4O4WA 1OX4B 1PHWA 3EX1A 1X7FA 1TTIA 3S1UA 1I45A 4RK8A 1SZNA 2J9XA 1F05A 3NQCA 5C54A 5F1UA 3N19B 4ZQNA 4POCA 1D3HA 2ZTKA 4DBDA 1G7VA 1W5MA 3CU2A 3UXAA 1ME7A 1VCGA 3TA6A 3W1LA 2A2IA 3L5MA 1PHQA 4BWLC 4JD4A 1LRQA 1ZAHA 4UMBA 1YPFA 3PSWA 1JULA 5DY3A 3LHYA 1WYIA 3LCLA 2ZZ5A 2A0NA 2E5BA 1Z42A 2Q3RA 1SUXA 4IGHA 3WK2A 1GOXA 1YDOA 1O94A 3W1QA 1LCOA 4FNPA 5D32A 1MXSA 1Z48A 5EL1A 1I8JA 2YSWA 5FF0A 4GWEA 3G1HA 4O1CA 3LERA 3NL6A 2WQPA 1FDJA 1T0OA 3KRUA 4UUIA 1UJPA 1HFBA 1TPEA 3F4NA 4TO8A 5L9FA 4RV8A 1OVDA 4Z0SA 1LLWA 2X1TA 2WOQA 3QH2A 4DEFA 4Z08A 1KW1A 1NF0A 3KVLA 1TCDA 4IUOA 1YXYA 2JKEA 3KVJA 3NGJA 5AHLA 4WUIA 4AWSA 4JTHA 4U28A 3MP5A 5AB3A 4S2CA 1FY6A 3H54A 4NJHA 4XQ6A 2G96A 1JRBA 1K8XA 5CPOA 3M44A 2GQ9A 4RZ4A 3NVTA 4H6KA 3W76A 3G1AA 2Y7FA 1EIXA 3W7KA 1PS9A 3BVJA 4NZJA 3MI6A 5HNRA 1GZGA 3H53A 2ISVA 3W2NA 8TIMA 3QMSA 4LC6A 5AYZA 2P10A 3FJLA 3PBVA 5D30A 3NQFA 2V82A 3W7IA 1FCUA 1KTBA 4NJJA 1GTHA 3SR7A 3S1XA 1A53A 3W7EA 5EMUA 5LGZA 3S6DA 1DV7A 3G3MA 3B03A 4PFMA 4GJ1A 2PRHA 3CIWA 4Z1CA 3PBUA 1H7NA 3M47A 1LZOA 3O16A 5D2TA 2WNQA 4Z1DA 3STEA 3HF3A 4HSNA 3MHUA 4EOUA 3S0CA 2ZA3A 4UR7A 1W5QA 1W3IA 3HJZA 4IX0A 4Z0JA 5U4NA 2CZFA 5EPDA 3NZ1A 3OIXA 1QO5A 3S1VA 2GUUA 1XBYA 5KINA 5CSRA 4YMZA 1P0NA 4CQ8A 1YTEA 3TJXA 2PRMA 1Y0EA 3PR2A 1LBFA 1M7PA 2Z0IA 3JRKA 3MBFA 1AW5A 3PS7A 4PEKA 1JRCA 1RV8A 3L2IA 5ABTA 1SO5A 5HUPA 4NZFA 4A29A 3BW2A 1L2UA 4NQ1A 3W1TA 5A5WA 4DF1A 1IIGA 1H7XA 3C2VA 1QPOA 4AH7A 2RDTA 3DI1A 4E2DA 5CGQA 1SSGA 4LS2A 1GVFA 3EWBX 4ZQPA 4QQ3A 3CTLA 3TC6A 2EAWA 4WY0B 4HT3A 4RZ5A 4MLRA 1Z41A 2ABBA 3IIPA 3LV5A 4ML9A 1TPWA 5J5RA 3IGXA 4JDYA 1O4UA 1SZFA 3G1XA 4MFEA 3W07A 5DXYA 3BW3A 4UFHA 4IWWA 1KA9F 3NR0A 4HNTA 2H8XA 3QRHA 4NXSA 1MEWA 2B7OA 4N9BA 3PY2A 1TPB1 1FCBA 1TQJA 1JR1A 3BLEA 1YTDA 4O1AA 1K8YA 1W56A 1DHPA 3SGUA 3O1NA 2QEZA 5LZLA 3TDFA 4UFLA 1WDWA 4HNNA 3LLFA 5C55A 4AWTA 3E02A 1NFBA 3QQ1A 4NXKA 1T96A 3LV6A 1PL9A 2VFEA 3BLFA 2A6LA 2RDWA 4AXKA 3OEXA 1XI3A 3TXZA 3UZ5A 3NNTA 3ZR4A 1YDVA 4MY9A 3TAOA 2KZHA 1FDZA 3VE9A 3A5VA 3EXTA 1NEYA 3LX9A 4XUGA 4GBUA 1A5BA 2ZRVA 3EWZA 4MY8A 3BG9A 5D37A 2E5DA 3MO7A 3N9RA 5LNUA 1LYXA 3MJYA 3HQ1A 1V7YA 2GQAA 2A5HA 2RKXA 5D02A 1O60A 1H51A 1KFJA 5LKYA 5KZEA 1TPH1 2QCGA 1QFEA 4LUIA 2DZSA 4N2YA 5I3KA 3W7CA 2B7NA 2V0TA 2V2DA 2CLMA 1N8FA 4BF9A 3F4WA 1QWGA 2XN0A 5LNSA 4RZ6A 5DBUA 3S8HA 4UTHA 3HOJA 1TRDA 3GKAA 3QEZA 4CNPA 2E1DA 1SU5A 2O7SA 3GB6A 1CI1A 5AC8A 1GJPA 2JKPA 4YLWA 2CWNA 1OF6A 4O28A 1ZHAA 5HWMA 4DELA 2ATSA 1QAPA 1R2TA 4HKPA 1G4EA 4AEOA 1KFBA 4O52A 2H90A 4I7VA 1YTKA 4WOZA 4LWWA 5LHEA 3M5VA 1AK5A 4OQVA 2DZXA 3QQ0A 4RJEA 1LBMA 2V5BA 1ZNNA 1QCWA 3KVMA 1YPIA 3G24A 1SZEA 4AB4A 1DQWA 3DI0A 3ATYA 3CEUA 5K2ZA 2QCCA 4UC5A 3CLMA 3BG5A 3SJ3A 4O16A 3NM3A 1G4PA 3PBWA 5D2VA 3AJXA 3PVFA 1OF8A 2P1FA 3A21A 5LHFA 1VS1A 3TU9A 2CFFA 4Q33A 1KTCA 4NNAA 3N73A 3O8AA 4K6AA 4MVAA 1FXPA 1W54A 2FB3A 1OX6A 3IIXA 4K7YA 5LNWA 3B4UA 3M1ZA 5KZDA 2NXGA 2FJKA 1KV8A 1XFBA 3QPZA 2NUXA 1M6JA 1H5YA 4KFPA 3W1NA 4XKYA 1N55A 4R34A 1G6CA 2I9EA 3UYCA 1THFD 1K7XA 3IIVA 3EKZA 3M5XA 5FI8A 5HJLA 2C14A 3DFNA 3PC0A 1TQXA 3A9IA 2DZPA 3HG5A 2DU2A 3NQEA 2B7PA 3B8DA 3NQVA 2NXHA 4IMDA 2OT1A 2QR6A 5FF2A 3QM3A 2QJIA 2Q8ZA 5K9XA 3T78A 5CSSA 1H1YA 2QUTA 4AF0B 1HO4A 2FB2A 2J24A 3N3MA 3I6RA 3SW6A 3QZEA 3BARA 4UTLA 1ICQA 1EP1A 1IXQA 1R46A 1WBJA 4PTNA 4UXDA 5D2YA 4JY8A 4YWIA 4JTTA 3GR8A 5TQLA 5KITA 4E38A 4ADUA 3MP4A 5DLCA 1RD5A 3C52A 3LOTA 2Z6IA 1SSDA 4PC8A 3UWUA 3B0VC 1LRNA 4JIPA 3U6WA 4AMAA 4AAJA 5CPLA 1JCXA 3G0UA 3STFA 4GC4A 4CQ9A 4O1BA 2Y89A 1OYCA 2DORA 5LNVA 2ZZ3A 1GQNA 4X22A 2HSAA 2JGYA 4FIQA 4LVGA 3CHVA 5F4XA 4UTIA 2PE4A 4JTGA 3W1MA 3P82A 1KM4A 5D38A 3C2OA 3B04A 2BLEA 2QJHA 4FEZA 3T44A 1H60A 5KZMA 1S5TA 4FO4A 4I7UA 1OG0A 4OT7A 3GXPA 5TBOA 4CNNA 1F6KA 1YDNA 2QCDB 1TTPA 1XXXA 2R14A 5DCDA 3W1UA 1NSJA 4G1KA 1J2WA 2DJXA 4MZ1A 4BR1A 2AAMA 1LDCA 1DQXA 3I65A 1NAL1 1B3OA 1Q6RA 2AQWA 1IIHA 1VC4A 5IM51 4LY8A 2I1OA 4KKXA 3TC7A 3UWZA 4RLIA 2RFGA 2TRSA 2H6RA 2TSYA 3STGA 3EWWA 3EX4A 2F84A 1HG3A 1B4EA 5HULA 3PB0A 4JYDA 3M0ZA 3USBA 4DO4A 3LM7A 3KAOA 4BWLA 3NPUA 1ZAIA 1OX5A 2A4AA 2WO5A 4WZHA 3SI9A 1RQHA 3LB0A 3E0IA 4XBSA 3NL5A 2CLOA 4M5PA 3W3OA 4UFIA 4HNVA 3LBCA 1X1ZA 4M7SA 2Y88A 2V8ZA 3QMTA 3VFLA 3C61A 5F2GA 3LCXA 3LXAA 3EX6A 4MJZA 3QMRA 1WOBA 3UZJA 3CT7A 2NX3A 1FDYA 4X3ZA 3IGUA 1VYRA 3GVGA 2Y70A 3TQKA 4Y9AA 4NJIA 5H91A 1VHNA 3EWXA 3RU6A 3NQGA 2VKZG 5CZSA 6ALDA 1QPRA 5AHFA 2X2GA 4O0KA 1OFDA 1WBHA 1LTDA 3P8IA 1IF2A 2ZBTA 4JYFA 4JX4A 1VLWA 3R12A 1SFLA 1C8VA 1SQ7A 4BFAA 3O63A 4ZQCA 3BG3A 3NO5A 4FNUA 3HGJA 1VQTA 3TV8A 3LLDA 1JCYA 4WX2A 4O11A 3M9YA 4S1FA 4FXRA 5D33A 1BEUA 1EEPA 1EWEA 2GOUA 5AHNA 5DCEA 3NA8A 2NZLA 4DBEA 2HS6A 2R91A 1ADOA 3UPWA 1D9EA 2CLIA 1A50A 3D0CA 3W85A 2JGQA 2BWGA 5HR7A 2FFCA 1WOAA 2BX7A 2H3BA 3KVKA 4N4QA 3LCIA 1H50A 3B05A 4D2JA 3N2XA 3NG3A 4AHQA 3GLCA 3IVSA 4MKNA 1F5ZA 1C9DA 2Q8LA 3MW7A 5SWUA 3C2RA 1W3NA 1S5VA 3PULA 1DJQA 3S1WA 4P2VA 1K3UA 2ZZ1A 1VYPX 3G1SA 1I2OA 4O10A 3W75A 4ZL1A 2YYTA 5FEZA 5D2WA 1F7BA 3M43A 3DXIA 5G2HA 3NQ6A 3T40A 5DELA 4N4PA 1AL8A 3S5YA 1E51A 3P61A 4A22A 4A21A 3RK8A 5G2IA 3TMLA 3S5ZA 1PE1A 2A7PA 1NF7A 1R47A 3W22A 1O5KA 4O17A 4AHPA 2ISSA 2DJLA 2GJLA 2QAFA 1BWKA 3VE7A 3LGEA 1EP3A 1YXDA 3DHFA 4JICA 4GRSA 1B4KA 4QAIA 1KM2A 1TTJA 4ZZ9A 2YW3A 1VGAA 4O8RA 4UMCA 1ZAJA 4M6QA 3NQAA 5CPNA 3UWWA 3WJYA 4UTJA 3M7WA 3FKRA 1H62A 2Q3OA 3W2KA 1QPQA 2V2CA 4K37A 1SPQA 3B06A 2XN1A 3KRSA 4JYEA 3LHUA 4AVFA 4AHOA 4QIUA 3EX2A 3GAKA 2NV2A 5CZJA 4UTTC 4RCXA 2NLIA 3FA5A 2C13A 4DO6A 2ABAA 1K7EA 3G3DA 3KFTA 4N6FA 4ORIA 3LXBA 5BNKA 4UTWC 2PURA 4Q32A 4GFSA 4KFNA 1HL2A 1KFKA 3LI0A 1IGSA 3UQNA 1Q3NA 3GNDA 3FLUA 2ZRYA 4ZQOA 1W5OA 3IRDA 3R2GA 3JS3A 5BMXA 2A21A 1EUNA 3M16A 3TK7A 2ATMA 1TV5A 1GT8A 1VLIA 2C6QA 4UNKA 3W1XA 2A7NA 2NX9A 1GYLA 3EXRA 2Y63A 5E1QA 1GEQA 4NJGA 3PUEA 4LRTA 3H55A 4JTJA 5G1YA 3RLVA 1SO3A 2YPIA 4CLMA 1P1XA 4I7WA 4LVAA 3R8RA 3G1FA 4K38A 4MJMA 4BK9A 5C6MA 1SO4A 3DAQA 2GVGA 1GVSA 3PUDA 5D05A 5D09A 1W5NA 1S5WA 4O50A 1AMKA 3GIYA 1DJNA 3STCA 1GTEA 4ORMA 2A1YA 3SSJA 3SZ8A 1IXNA 4PCFA 3B0PA 4NU7A 4H4IA 4Y8FA 3FYOA 3OA3A 4OWGA 5D2XA 2OJPA 4ZQMA 1YYAA 3LTPA 5FEPA 3V1PA 2OT0A 4OU1A 4HSOA 2J9YA 1EB3A 1EPXA 4LC8A 4P61A 3NDOA 3CIXA 2FPTA 5HWJA 4ZQRA 2XFWA 4ZMGA 1TPVA 3V75A 1ZFJA 1ME9A 2RDUA 4JNMA 3GR7A 4HNUA 1FWRA 1A5CA 3HGSA 2JK2A 1B57A 2QAPA 3W88A 1EP2A 3NL3A 1IXPA 5D03A 2G95A 3PF3A 2CW6A 1X1OA 2Z6JA 3IGSA 3Q58A 2GVLA 5F4SA 2HTMA 3TSBA 3UY7A 4LW7A 4U4MA 1OK4A 3M5ZA 1F2JA 4UTUA 1OFAA 5G5IA 3DKLA 3ABSA 1A5AA 4JR5A 3UY8A 4K8HA 3DHDA 1TMHA 3NXFA 3BW4A 3O6YX 1K7FA 2Y7EA 4TMBA 3A22A 3W2LA 1G7UA 1YADA 3P62A 5DN1A 3JR2A 5EYWA 3TFCA 4FX6M 1GYNA 1P0KA 5AN7A 3LHZA 1EWDA 2WSYA 3DZ1A 2VEPA 2ZA1A 4LRSA 4FF7A 4C1LA 3CQ0A 3HG4A 3OVRA 3GZ3A 4QSHA 1ZENA 4GUJA 4FIRA 2CLFA 1JUEA 5DBTA 4OV9A 3LCHA 1KFLA 3Q37A 1ICPA 1XDLA 1ME8A 3FOKA 5TIMA 3TH6A 2AGKA 5BOOA 5K9CA 5AYYA 4O53A 1R2SA 4KWVA 5E0KA 3TQ0A 4O0ZA 2G5WA 3I7QA 1I2QA 1TSIA 3DKJA 1H61A 3U2OA 4A2RA 2ZZ7A 1VH7A 1DKWA 5HR6A 3ABRA 4R53A 4IMFA 5F1VA 3U8GA 4O18A 2CLEA 1FBAA 4X2RA 3W7PA 3DFQA 1TV8A 5GVJA 4ZVJA 1DORA 5HQEA 4WD0A 5K9DA 1PV8A 1XBVA 3L67A 1LROA 2QJGA 2Y62A 1XBXA 4N9EA 4I9AA 3GX9A 3BK0A 3OBKA 2ZZ4A 4BI5A 4MZYA 4GUIA 4XTDA 3W2UA 4HHPA 1KM3A 1LBLA 3MHGA 2P0OA 2VFDA 1FCVA 4IXXA 4LVBA 5EBUA 3W87A 1L6WA 3C2EA 5KTLA 4GUFA 2YCEA 4UCGA 5K7JA 4MOZA 1KV5A 1FUYA 2H3DA 2XN2A 1H7WA 3W7RA 2A7RA 3DENA 2TYSA 3W7GA 1VCVA 4DF2A 1DL3A 4FNQA 1FWNA 3DU0A 4K7VA 3QC3A 1KLYA 3L21A 4YCOA 2DZWA 3GXTA 3HMJG 4HPXA 3SGZA 3C2FA 3QYQA 3DFTA 1H63A 1XUUA 3O07A 3TQVA 1TTQA 4JTLA 3W9ZA 1GVRA 3GDRA 3HGRA 1L6SA 3L0KA 1AG1O 2C18A 2E09A 5KSWA 1F76A 3C0JA 1GG1A 1OFRA 2E77A 3SFKA 2LLEA 3W2JA 3TXVA 1TB3A 3MHFA 4XZ9A 4XKYB 5CKSA 1SR9A 1RVGA 3R89A 2X1RA 3GDMA 2W0UA 2HMCA 5AHMA 1UASA 4NX0A 3GKFA 3VI2A 3MP3A 3NOEA 1TPUA 1OFEA 1KBIA 2ZZ2A 4MFDA 3TAKA 2Y7DA 2C15A 3KX6A 1L6YA 1R30A 3DH7A 3FYPA 4MLJA 1W31A 2YW4A 3O15A 4IMGA 1SW7A 3EWUA 4BI6A 3LTSA 4N6EA 2VELA 2JBMA 4CCCA 2WNZA 2GVJA 3G1DA 3Q2DA 4NX5A 1G67A 3C56A 3P80A 2QDGA 1RPXA 1Q6OA 2ZRZA 3TSMA 2QCEA 3LRLA 1MEHA 1KM6A 1WAUA 2YZRA 3M5YA 3FJ6A 4H3DA 3TJLA 4FB7A 3IVTA 3LHVA 5J5DA 1EUAA 3HB9A 1OFBA 3RLUA 1JJKA 4K39A 1ONRA 5CZ0A 1KLZA 5I3HA 5LNRA 5I3GA 3UWVA 3SIZA 3MYPA 1J5TA 2G97A 1OABA 1LLZA 3GAYA 3TUUA 3T55A 2QF7A 1TO3A 3TR2A 1QNVA 4JIQA 3GDLA 2B7QA 3GXNA 2I14A 4JTUA 2VXNA 1HUVA 3IIOA 1P4CA 5FEWA 3A24A 4CQAA 2QKFA 5K4XA 4EF8A 1WV2A 4MYAA 5F2LA 1UUMA 3WK0A 2RH9A 4OGZA 4LT9A 4IX2A 5G4WA 3UPBA 5CPMA 4PODA 2Y6ZA 2YFOA 3QJAA 3EEGA 4LVDA 2OCZA 3LRMA 2E6AA 1K02A 2NWRA 4W9TA 4FHAA 4FNRA 3WJZA 1BKSA 2ZQ0A 2A85A 5HUOA 4E2BA 1XCFA 2UV8G 4M6PA 3P67A 3E9AA 2Z1BA 3IEBA 4LU0A 1PCKA 3NPVA 5L6UA 5AHEA 4CNOA 1XC4A 2QCMA 1VR6A 1GVQA 4WJEA 2YX0A 2VEKA 3WK3A 4PL2A 1ZALA 4PL1A 3R13A 2FDSA 3QPYA 2B4GA 1AW1A 1QPNA 3QFEA 2ZDRA 4WOQA 3S5NA 4IMEA 1EA0A 1OFOA 4IQLA 3QF0A 1W37A 1I2PA 5KMYA 3LCGA 3HG3A 1QOPA 3CC1A 3RF9A 4LVFA 2CLKA 1X6UA 3NM1A 3ZWSA 3ELFA 4L4LA 4QM1A 4FX7A 4LV9A 2A6NA 3BV4A 4TX9A 1FCQA 3A23A 3P74A 4QNEA 2EPHA 2CU0A 2B0MA 1W5PA 4N9DA 3W23A 3BGGA 2FIQA 1LM1A 3OHIA 3MI2A 1R2RA 5F2IA 3TCEA 3UWQA 1LOSA 3LDVA 4X9SA 5U7SA 4JGDA 3TW7A 1U83A 3UWYA 1T8XA 4JXCA 1OX4A 4JS3A 5AHIA 2C0AA 1FWTA 1TJPA 4QNWA 4J9JA 4IOTA 1OYAA 5HINA 4A2SA 2C16A 1H7RA 1LOQA 4NVTA 3ABQA 3TE9A 3KRZA 3NPXA 4L4MA 1TYGA 3E49A 3MUXA 1WXJA 2CLLA 4A3UA 4OBTA 4JTKA 3AO0A 3UXDA 2ZFAA 4QISA 4JEQA 3CEPA 1N7KA 3DBPA 4UTTA 1SW3A 1BWLA 1SZGA 3L65A 1YLVA 3W7DA 3E96A 3P60A 1FXQA 5DCBA 4EIVA 4UTWA 1MEIA 4TR9A 5IBXC 4UFKA 2ZRUA 3M41A 3W1PA 1A5SA 1TJRA 3W7QA 2W79A 3L66A 3VNDA 3G0XA 4O57A 4WXYA 4O19A 4Q4KA 3NAVA 3MWAA 4JX6A 3SECA 4LS1A 1UB3A 3THQA 1MO0A 1XL9A 1QMLA 4UFJA 3TSDA 2V2HA 3QSRA 4M19A 3WK1A 4O13A 5CG7A 3CWOX 4WXZA 4PA8A 1ML1A 3PAJA 1M5WA 4OV4A 5AC7A 2VENA 5DY2A 2V81A 4UFMA 3L68A 5EKYA 1SW0A 1V5XA 5HMSA 1FQ0A 1F6PA 1RZMA 3O06A 3W6YA 1WA3A 4QITA 1JCLA 3L0GA 4IXHA 1VCFA 3TNOA 1MZHA 2VFHA 3HGOA 1B9BA 4HN4A 4JY9A 1TPFA 3IIZA 1GWJA 2CLHA 2E5CA 2BTMA 1ZY9A 1W1ZA 1S3HA 2WSQA 1XDMA 2VEIA 1F73A 3S9YA 2VFIA 1DBTA 4KFOA 1EX5A 2J88A 1RR2A 1FWSA 2NUWA 4JTSA 4KWWA 3PSVA 3B0UX 2NV1A 1VYSX 2ISWA 4Z1BA 4FX8A 1ZJIA 1VJIA 3W71A 4UTKA 3NPWA 3TIMA 1W0MA 4DPQA 1G69A 3EWYA 1GVOA 4GUGA 3S42A 4UIOA 4ICNA 1I2RA 2WNNA 3R5EA 2PC4A 4MIMA 3MMTA 4XWUA 4IMCA 3GDTA 3ANYA 3ZS4A 2NXIA 3OVQA 1IXOA 2X16A 1Z44A 1TREA 4UTMA 5H2ZA 3NZRA 1MSSA 3A5FA 3TROA 3N14A 3LCWA 4E0CA 1VPXA 3CPRA 2HS8A 1KFEA 3HPSA 1O95A 3F1QA 2ALDA 3LI1A 1RQEA 4LNYA 5FF7A 3W7OA 3T7VA 2ZYFA 4OHQA 3PBYA 5F4WA 4LS0A 3F03K 4K36A 2WKJA 2FQIA 1JCJA 4GNJA 3W73A 4S2BA 1AW2A 2NUYA 2IQTA 3TKFA 4WY0A 1LORA 3THAA 4DF0A 5T26A 4JDBA 2VFGA 3WFAA 1U5JA 1H1ZA 2CZDA 3KOFA 5LGXA 3TFXA 3NQ7A 2OX1A 3EKLA 2GPTA 1I4NA 4JTEA 1WQ5A 3LXCA 3W7LA 4MPQA 2BZNA 2QCFA 3LHWA 4NNCA 2DP3A 2EHHA 1GG0A 4WQ6A 3EB2A 1TIMA 5BW6A 1JCNA 6TIMA 5MHBA 5D04C 3P81A 1VRDA 2PRLA 1QOQA 2WSRA 3G22A 1ZCOA 4WY0F 2QCHA 4LTSA 3BLIA 3O6CA 4NNBA 5CZTA 3HPXA 1HTIA 2YXGA 4UNLA 1BTMA 5I3IA 1W8SA 4Y90A 3HBLA 1KTNA 2BXVA 3CB8A 3MI3A 4LV4A 1T99A 3W1AA 4XTIA 4RR4A 1ICSA 4IJBA 4GXMA 4R7JA 1XM3A 3NEVA 1C29A 1SFJA 2J6XA 4JN6A 2NX1A 3WJWA 3NL2A 3I7RA 1TPDA 3NQMA 2ZA2A 3EX3A 3Q94A 3LHTA 3C4UA 4RX0A 4ONVA 1OFPA 1KM5A 3L0NA 4PH6A 3FEMA 2ZCGA 1OK6A 2F7FA 4OE7A 2V9DA 5BMWA 3TW6A 3W1RA 3W2MA 4ADTA 3G1YA 2CZEA 1W3TA
chains in the Genus database with same CATH superfamily
3LGGA 2YR1A 4FLOA 5K3VA 1V0NA 1XLLA 3G8EA 1DJWA 2FZ9A 1Q45A 3FSUA 3W70A 1TMLA 1OM0A 1NVMA 3IV3A 3SQLA 4IPIA 1HKVA 1KR1A 4QEEA 2YGYA 1AQ0A 1FX6A 1SR0A 5C2XA 1DYSA 1XR2A 2CBJA 3FCPA 3LRKA 1SFSA 5IHRA 1Q6QA 2VR4A 2Y85A 4HHLA 1X8FA 3P7YA 6XIAA 3T4CA 3CUXA 1J4EA 3RU8X 3QFWA 4IJCA 2VOMA 2PDPA 4R88A 3ALGA 3ZLGA 1CB7B 5FEXA 1QI3A 1DJIA 1LQAA 5F2MA 4JTIA 3RMJA 5TAOA 3W6LA 3IK2A 1W1VA 1PSCA 1JVNA 3ATZA 1B5TA 5LSMA 3SY1A 3SY5A 3LBMA 3W7MA 2QCNA 3T0CA 4CCDA 4GO9A 3PN8A 3PZUA 2WCSA 4M81A 2VC6A 2QJJA 2CZ5A 4XSMA 2BG5A 2PAJA 3M0MA 3UNDA 1HN1A 3GXDA 2QCLA 1BF6A 4Q3MA 5I3JA 2ZWZA 1XPYA 4NILA 2ZRWA 2GJNA 3BSGA 5AFDA 4RDWA 3RLGA 1KNWA 3VK5A 1OHLA 4H9TA 3STPA 4PYSA 1BWVA 3LU2A 2QUUA 3VGFA 4ADSA 1AVAA 3NQ2A 3O05A 2VZOA 2X30A 5HWNA 2QGYA 1JDAA 3MKCA 5TF0A 4R33A 2FTPA 3ABZA 1PPIA 5EY5A 1ZUAX 2YIHA 2WSKA 3NZGA 3Q65A 4DBSA 3C0LA 5PTDA 3NQDA 3DFOA 3W72A 3DG6A 1KRAC 3S47A 5G2WA 4J3TA 1H41A 1RH9A 2OKOA 3ZWTA 1YDYA 3KBVA 2NQ9A 1AL7A 1HL8A 4DXXA 4GXPA 3REQB 2H9AB 4ZB0A 4A3RA 4C6BA 1X39A 2J62A 3IUDA 3TC3A 5I78A 3L4TA 1K6AA 4LYRA 4NL1A 2D20A 3ANUA 4OOUA 2RHGA 1EJTC 1E0XA 3I68A 1QNPA 2IKJA 3B8TA 2J27A 1J9YA 2F6UA 1B3YA 3UZZA 4AWEA 3L2LA 1T40A 3W74A 1CXEA 2O0TA 1UKTA 1V08A 3CWNA 1JQXA 2QUVA 1SJBA 1OJXA 3OQ8A 4YCPA 3NXLA 4XAFA 1CW2A 3H70A 5CBIA 2H8ZA 4LOCA 1HO1A 2NWSA 4OBRA 3CUIA 1PTDA 1G4TA 4DQWA 2UY2A 3P8JA 2Z2UA 3PWAA 4HU3A 2DZVA 4AD4A 4O4VA 1P5BA 2Q8XA 3KOWA 2DVXA 2X1SA 3AZRA 3G8RA 5EMLA 3LZ3A 4O54A 3MV01 4ZB5A 3VKDA 2GDUA 3ZR6A 3U5UA 2YBUA 3KWSA 3IARA 2P8CA 3W7NA 3PTMA 4QE4A 4PCNA 2YXOA 1UP2A 1HVXA 3N4AA 4HD5A 1NOUA 3IJ7A 3RPDA 5EMMA 4WRHA 3DFPA 1QW7A 1RCOB 3TYDA 4AFYA 1RA0A 2FPVA 3MYOA 1FP9A 1VHCA 4NAFA 4D8AA 2XSBA 3OG3A 5ENLA 2BGSA 1RCXB 2XVGA 3VKBA 1I45A 3EYPA 3MJMA 1ZP4A 2YDSA 2BB0A 1W32A 4RPPA 3NQCA 5F1UA 1OC7A 4LBRA 2CCRA 5BROA 1G7VA 3UXAA 3SUTA 1MI3A 4TOQA 4NRSA 4MKVA 1CPUA 1J8VA 1WUFA 4NZ4A 3WMSA 1JULA 4JFVA 2B81A 4PUUA 5DRCA 1FKWA 1KO0A 1YDOA 3SN4A 1O94A 1MRAA 4LGXA 2OWCA 1I8JA 2YSWA 4XD6A 1YQ2A 1JYXA 4G9PA 3A4AA 4PRRA 3LERA 3HV8A 1NDYA 2BMBA 2WQPA 2YB4A 1FDJA 3KRUA 1Q7MA 3CYVA 4UUIA 4IG2B 3VA8A 1UJPA 2PP0A 1XLKA 5LA1A 3F4NA 1I75A 1TV2A 1JZ2A 5GJMA 3WNMA 2NSOA 4DEFA 4H9ZA 4V2XA 3NWRA 4Q7BA 4JIHA 1YXYA 2EBNA 1PKLA 1WDPA 4JTHA 3MP5A 1ZRQA 1FY6A 3H54A 3M44A 4H6KA 3G1AA 4KCWA 1EIXA 3WKZA 1K77A 4RNIA 5HNRA 4W8AA 2BP1A 1GZGA 3W2NA 3TCSA 2QGHA 1ISXA 3PBVA 5D30A 3NQFA 3K1DA 2V82A 4ZE5A 1S2UA 2VGGA 1YBQA 4P7LA 1XV8A 1IZKA 1UOKA 2Q01A 3W00A 1CLVA 2PRHA 1ESWA 3CIWA 4Z1CA 1V6YA 3VINA 3ZT5A 3O16A 4LAUA 5D2TA 3ZVIA 3LS9A 2C71A 4IIGA 2ZA3A 4UR7A 1W5QA 3HJZA 4IX0A 4Z0JA 4B3ZA 3NZ1A 4GH3A 4WF7A 1UWTA 4QDMA 5KINA 3EDDA 3TJXA 1JCTA 3GFZA 3MBFA 4RNJA 3TN3A 2XGIA 2FJUB 3N2CA 4PEKA 4AYGA 2ZX9A 1V03A 5HUPA 1U5VA 2OQLA 4GQQA 4NQ1A 2YBTA 1SJCA 3CO4A 1H7XA 2YCJA 4HPGA 4R7OA 1SSGA 2IPGA 2VUYA 4LS2A 4PMDA 4ZQPA 3MZNA 5JUVA 2EAWA 4RZ5A 4MLRA 2E7FA 4EX4A 2ABBA 3IIPA 3RXZA 1OSEA 2P53A 3MSDA 1CXFA 2HEJA 3QVQA 1O4UA 1SZFA 2VO5A 3W07A 4UFHA 4IWWA 3NR0A 4UOJA 4B9ZA 4HNTA 2H8XA 3PY2A 4W5ZA 1YTDA 2VVNA 4O1AA 3LQLA 1W56A 5M1TA 3VCCA 2V5KA 2QEZA 3WO8A 5LZLA 3QV9A 4BCEA 1ZGDA 1NFBA 3BOFA 1E0TA 1OZQA 1PL9A 2BXYA 4L1WA 5BRQA 2WBKA 3HPFA 1K9EA 2VI0A 3W37A 1WDRA 2PGWA 2WVSA 3CV1A 3UZ5A 4NZCA 3TAOA 3OQEA 3ZJKA 3KBWA 3LX9A 1N8IA 1QHOA 4GBUA 3GVQA 3EWZA 4MY8A 1GJUA 2Y5JA 1Q6GA 5LNUA 2HK1A 5DX7A 4Q6JA 4W8LA 2VQTA 1EXPA 4AD3A 4KEZA 2RKXA 3W0KA 1O60A 3S2JA 3GHRA 4JTAA 5LKYA 5KZEA 2G41A 3L7RA 1US2A 2Y24A 2B7NA 1YHTA 1LUCA 5DBUA 3S8HA 4UTHA 1UIPA 3AISA 3EA2A 4HA4A 3EDFA 4F48A 1XDJA 5BOEA 2O7SA 4I6VA 1RPKA 4Q8OA 1OF6A 4O28A 3QBUA 4F0RA 1HL9A 3U7VA 4M0XA 2ATSA 3T4WA 4HKPA 3AHZA 5EBAA 5HATA 1XYLA 1L2QA 1A3WA 1OY0A 4WOZA 5LHEA 3M5VA 3UU0A 2GGEA 3GU1A 1GNXA 5CJNA 2V5BA 1HKWA 2YL9A 1OQFA 3RO8A 3M0VA 1UR9A 1UIOA 1R3TA 4AB4A 4RDZA 2O4MA 3DI0A 3ATYA 3GNRA 4CD8A 5BU9A 2WNWA 8CGTA 3SJ3A 4Y9NA 2GUBA 1G4PA 4M51A 3PVFA 1EL3A 1KTCA 1B3WA 3KZPA 3O8AA 4MVAA 2P3EA 1XKJA 4N42A 1DIDA 1UQZA 2V5JA 3SCQA 4Z2HA 1XCWA 1U2YA 1RVKA 2ZUSA 5CCZA 1M6JA 2J8FA 4R9XA 1H5YA 3W1NA 3BCJA 3BOXA 4UQ9A 2I9EA 4NAEA 3EWCA 3WEZA 5JU6A 3WLSA 3S2MA 5HJLA 3DFNA 3PC0A 3RCNA 4I8YA 5MKGB 4KWUA 5E9XA 3NQEA 3U48A 3B8DA 4HMEA 1WE5A 2HNHA 2QR6A 2XISA 3AIQA 2X2YA 3ZVHA 3T78A 2F61A 3UG3A 1KQYA 2D0GA 3D47A 1ZZMA 2J24A 1JF6A 2E0PA 5CPQA 3FGCA 4QBXA 4XD5A 5D2YA 4UXDA 2QDEA 3G77A 4F9JA 2PGEA 4H6QA 3MP4A 4BKNA 2UZ9A 1BXBA 4FLQA 3VIJA 3LOTA 2Z6IA 1J10A 3UWUA 1X1NA 2ZVRA 3HM7A 4GA8A 5HNNA 1LRNA 1BYCA 1VBRA 4ERAA 2PDGA 3U6WA 2OEMA 1I9CB 2HVOA 2Q6ZA 4AAJA 5E6YA 3KE0A 3GTXA 3GY1A 5HA7A 4KESA 2W27A 3N4EA 4WKAA 2GFTA 5F4XA 3QKZA 3BUVA 1T41A 1UWQA 2ZUMA 3TR9A 4JTGA 3W1MA 2Z7KA 1KM4A 2VP8A 2AKZA 1S5TA 4FO4A 4OT7A 1XLEA 6TAAA 4OBSA 1XXXA 2R14A 4G1KA 1EHAA 2AAMA 1MUWA 4L9YA 3I65A 3KRBA 2AQWA 1AH4A 1VC4A 4LCQA 2I1OA 4PMNA 1ADSA 2E9LA 1US0A 3SUUA 2H6RA 2TSYA 3STGA 4X9YA 3K8KA 2F84A 5J04A 2JFEX 1WDDA 4P7RA 2OEKA 3ZJ6A 1QHPA 2PWGA 4LJ3A 3LB0A 4XBSA 1H11A 4PB4A 2CLOA 1KCLA 3VABA 3W3OA 3T81A 3C61A 3LXAA 3LSBA 1XSJA 3KS6A 1FDYA 4X3ZA 3MY9A 2ICSA 1X8CA 4W89A 4JIEA 3MQTA 5A8QA 4US5D 3EOSA 2CLPA 1QPRA 4LUTB 1BKHA 2X2GA 3V5CA 2QPXA 3BC9A 4RPQA 3L2MA 4JTRA 1V93A 3AYSA 4JYFA 2NT1A 4MG4A 5T9BG 1EXBA 4DN1A 1SFLA 1SQ7A 4H7VA 3HQOA 4BFAA 4ZTXA 4XG1A 3CUHA 1MW3A 3O2LA 4FNUA 2O4QA 2FGBA 5IHSA 4LEQA 7CGTA 1PDYA 1JCYA 1MW1A 4WX2A 4FXRA 3IPWA 2Y0FA 5MF5A 1CXIA 2PCEA 4IM4A 3RM4A 4DWSC 4DO7A 2JGQA 1R9YA 1DTUA 1TZ7A 2H3BA 3KVKA 4DZIA 3TTSA 2XM2A 3IVSA 1C9DA 3C2RA 4QG6A 3B9OA 1T5AA 1E6ZA 1IEXA 2ZZ1A 1VYPX 4TTUA 1I2OA 1ENUA 4O10A 3W75A 5E6ZA 2AQVA 4ZL1A 3W82A 1CGXA 5BXRA 4OIFA 2YDRA 3EZ4A 4JQ3A 5G2HA 3N12A 5HAOA 3ITXA 1AL8A 4PSPA 2OELA 2AOSA 3CB3A 3A64A 1G01A 3GXIA 2PTZA 3P61A 1WKDA 3LPPA 5CG0A 4A22A 4UQEA 2AL2A 3S5ZA 4XAZA 1R47A 3W22A 3LZ5A 4MDOA 3OIHA 1TG7A 2QAFA 2OX4A 2OB3A 3VE7A 3LGEA 3T07A 3DHFA 5A94A 4ZZ9A 3H4WA 5CPNA 2CITA 3FKRA 1UD8A 3WQPA 3B06A 2E40A 3KL0A 4PGLA 3LHUA 2J7DA 4REQA 5HXMA 3VX0A 4PRTA 1UWSA 3BZJA 3GAKA 5FJJA 1P6WA 1BG9A 4UTTC 2NLIA 1DWIM 2ABAA 1K7EA 2E9MA 3EEZA 3G3DA 3KFTA 4HHHA 3LXBA 5BNKA 2CERA 1FFRA 2PURA 3M0XA 3NO1A 3BAYA 1HL2A 1Z7AA 3GXMA 2C91A 2ZRYA 1HT6A 1C92A 3WQVA 1RY0A 1UR1A 5DT5A 3VOJA 4GMEA 3JS3A 1REQA 1VLIA 1O1HA 2C6QA 3VXGA 4J28A 4Z17A 3EXRA 4D6GA 2XINA 1GEQA 3BICA 4HU0A 4A8NA 3RLVA 2YPIA 2O9OA 4L65A 2JIWA 2R9RA 5AYBA 1R85A 1Q6FA 1AFSA 1FWDC 3LMZA 3GG8A 4MJMA 4PMYA 1Q85A 4W7UA 2GVGA 4ZXLA 3R94A 1UKPA 3GVWA 2P76A 4JCLA 1PYFA 3WH5A 3CAKA 1DJNA 4C7GA 1LJYA 4ZO6A 3GRIA 5D9MA 1XIEA 1XF0A 1VEPA 1KBKA 2A1YA 5KETA 4TTGA 1V79A 1IXNA 4PCFA 3AOFA 1ITUA 3IACA 1IHIA 5D4YA 4B4FA 3P2VA 4DAFA 1DWAM 4LC8A 4P61A 1CDGA 1TIWA 5A8NA 4DNHA 4GIYA 1B2YA 1PTGA 1BRLB 2OZ3A 3ARXA 4J2PA 1GHRA 3FAXA 4G7EB 3V75A 1H3GA 2RDUA 1VD6A 2W9MA 4R5EA 4XZWA 5B80A 4MAVA 2JK2A 3GIQA 2ZIDA 1KGWA 5D03A 3GNPA 1OCBA 2CW6A 2QT3A 1UOZA 2Z6JA 1H2JA 5BU6A 1UR4A 1A5LC 3TSBA 3UY7A 4V28A 3R7MA 3VKKA 3M5ZA 1F2JA 3DKLA 3ZSSA 3UZXA 3UY8A 1X7IA 2WVUA 4XIMA 1FRBA 2OZTA 4X61A 3NXFA 3BW4A 4WJ8A 5C2GA 1UPMB 1KCZA 3P62A 3UW6A 5DN1A 2R24A 3WQWA 1JAKA 5C7VA 3H2EA 1P0KA 5AN7A 3ZJ8A 3LHZA 4CNUA 1GOOA 3PAOA 3II1A 2ZA1A 3XINA 4FF7A 1PUDA 4J3XA 3RJYA 3BZGA 3GZ3A 3ITGA 4IPPA 3NFUA 4FIRA 5DBTA 2PLKA 1G9HA 1ICPA 1TX0A 1ME8A 2VJXA 5TIMA 3TZNA 5JQ9A 3BV7A 4E3TA 5K9CA 5AYYA 4O53A 1HJSA 1R2SA 4YTUA 4JOMA 3I7QA 1I2QA 1TSIA 3U2OA 3R11A 1VH7A 4R53A 1A4MA 3P93A 4O18A 5HMFA 4M8UA 3TA9A 1QBAA 1Z9AA 2Y8UA 4WGHA 1U1HA 1DORA 1R9XA 1V02E 5HQEA 3GTNA 1C8XA 1XBXA 4N9EA 4I9AA 2G4JA 3GX9A 4ZENA 3BK0A 2QUNA 3ZO9A 4ZO7A 1UD2A 4XVDA 4XTDA 2FVMA 4YNGA 4AD1A 1KM3A 1LBLA 3MHGA 1FCVA 3C0QA 4OJYA 3I6TA 4LVBA 3WLIA 3W87A 4PMQA 2ODOA 4GUFA 5FJOA 3WLPA 1KV5A 2XZ9A 3DENA 2TYSA 1DL3A 1ODUA 2DIKA 1FWNA 4NI3A 4K7VA 1KLYA 4YCOA 3PZVA 2HJPA 1ODZA 2O55A 3F5LA 1ZJHA 1Q4WA 1DIKA 3WF4A 1GOQA 1UG6A 2EQDA 1FWCC 4JTLA 3CZLA 1BYAA 3GDRA 5KSWA 1F76A 1GG1A 4L56A 4GO8A 1IT0A 4XZ9A 2G8ZA 2XM1A 3R89A 1JPKA 3GDMA 2W0UA 1TVLA 3GKFA 3QZAA 3RAOA 1J93A 1OFEA 1UWRA 2ZZ2A 3TAKA 3KX6A 1L6YA 2POZA 1W31A 4BI6A 5CBJA 3ALFA 3LTSA 1XIGA 4N6EA 4DJDA 4Q4MA 2W66A 3LBOA 2WNZA 2GVJA 1H4PA 3C56A 3RITA 4D71A 1BPLB 1RPXA 1OGGA 4XZBA 2R82A 3M5YA 1CWYA 3H4GA 1K1DA 3IVTA 2HVMA 3LHVA 2CYGA 2H9AA 2YKKA 4C6DA 2X0SA 2V63A 5T91A 4HYRA 3WD4A 3ZJ7A 3EOLA 5LNRA 5I3GA 4PUKA 3UWVA 2HWGA 3SIZA 1E15A 3MKVA 1P0BA 2G97A 1FHLA 4GKTA 2I5IA 4E2OA 1X97A 3TNBA 1QXLA 4MWAB 2I14A 4QEHA 3GG0A 2YCKX 3OOQA 1XINA 4HMDA 1KBBA 3A24A 2QKFA 4MYAA 2RH9A 4OGZA 3QKEA 5G4WA 2QNEA 2Y6ZA 2OCZA 2XIJA 3LRMA 5BXTA 1LG1A 1ECEA 4W9TA 4GCXA 3WJZA 1TWDA 3GVVA 8A3HA 3E0WA 4M6PA 3P67A 2EJAA 1PCKA 1XC4A 1DJXA 1E73M 5A6SA 5E09A 4DWSB 3E0FA 1W2VA 1OCJA 4RL3A 2Z1XA 3MVIA 1EA0A 3WD2A 2XZ7A 4H6EA 1I2PA 4BEQA 1C9WA 2VC7A 3KTSA 3CC1A 1ZBCA 1E40A 1R9ZA 1X6UA 2CLKA 2XIIA 2DUAA 3NM1A 5ABGA 3ELFA 5H8UA 4NI8A 3ZWSA 4QM1A 4TX9A 5I07A 4L6DA 2PDJA 3IJLA 4WSKA 2B0MA 1W5PA 1UWUA 1JPMA 2PZ0A 1WXZA 3BGGA 2FIQA 3R0DA 3MI2A 2ZX5A 3E2QA 2VX7A 2GZXA 3LDVA 3DFHA 2Z24A 4JGDA 4PB5A 2OODA 3UR5A 1WDSA 3HV9A 1IZCA 4RE3A 1JFXA 4NZ1A 4DRSA 3HU7A 2YZ5A 4IOTA 2DH3A 1QBBA 4D9PA 3IS4A 3TWBA 1UP3A 4QG9A 1ZQ5A 4CN6A 3MANA 1TUFA 2CLLA 2VC5A 1U5HA 1GKRA 4OBTA 2VDIA 2XIQA 3AO0A 1POJA 1V3HA 2KX9A 3KBSA 3T08A 4JEQA 4GFIA 5A2CA 1SW3A 2VCCA 3B9AA 5LIYX 1M04A 3W7DA 2PGRA 3ARTA 2YA0A 5DCBA 3IWPA 3KOYA 4XZIA 1W17A 3Q45A 3W1PA 2VOTA 1AZ2A 1TJRA 2XSAA 3W7QA 1M53A 3KDNA 2PDNA 1Z8AA 1UB3A 5EFDA 1IR1A 2F2HA 1E72M 1HJWA 4IG2A 3QSRA 2OWWA 3W27A 3QLLA 5DMYA 1ONXA 4DLMA 4F4RA 3CWOX 3AYVA 1TR9A 1E1EA 3VDGA 1R3YA 3F4CA 4PMVA 1SW0A 4AZBA 1RZMA 1KQZA 3W6YA 1W3JA 2XVNA 2JE8A 3HURA 1MXDA 2R1MA 3ABXA 3TNOA 1MZHA 2VFHA 1B9BA 2VUNA 1NWUA 2V38A 3QN3A 3IIZA 5AY7A 3V36A 4PTMA 3T0BA 2IKHA 1S3HA 1VIWA 1QATA 1ITQA 1E6QM 4GVHA 3TJIA 4CN4A 4GG9A 1F73A 3S9YA 3R8GA 1B54A 1DBTA 3VZYA 1ZL1A 1ZLPA 5AC4A 1UC5A 2DVUA 4Z1BA 5LIUX 4FX8A 1ZJIA 4ATWA 1VJIA 3EA3A 3W71A 3TIMA 4DXKA 4DPQA 1NWRA 5CC3A 1JAEA 3CIVA 1QI2A 3I4EA 1EFZA 4IL0A 4UIOA 3GIPA 2J79A 4ICNA 5C0QA 1EC8A 3ITYA 5H8MA 1XLAA 3F2DA 4Q4RA 2QW5A 3R5EA 1ZBWA 2PC4A 4GINA 4D6EA 2E4TA 3ANYA 4ROPA 3OVQA 3SCOA 1Z44A 1TREA 4MF4A 3KL3A 3NZRA 3A5FA 5REQB 3L23A 2UY4A 1JZ5A 1AH3A 3CPRA 1KFEA 3HPSA 1XG4A 2ALDA 3K1GA 5I77A 3W7OA 1LQ0A 5F4WA 3CWHA 4K36A 2FQIA 4GNJA 4ZSUA 2IQTA 3LA4A 2PSNA 4DF0A 4JDBA 1NH6A 4H9XA 4XZMX 3WFAA 1U5JA 1UR0A 4GQBA 5LGXA 1I4NA 1NWSA 1U1UA 1WQ5A 3LXCA 1TWZA 1OGSA 2QCFA 4NNCA 2DP3A 2EHHA 2YL5A 1E4IA 4PN2A 3QTGA 6TIMA 3WDQA 4OTKA 4AQLA 2WWCA 5MHBA 3PP7A 1DQUA 4QJ4B 1VRDA 4C6LA 5C9ZA 5BWFA 2HISA 2XPKA 3HN3A 4AEFA 5FD0A 3QV6A 3SRKA 2PBGA 3WG6A 5CZTA 3RHGA 1XX1A 1JPIA 1S46A 3PBGA 1F8IA 1BXNA 3MI3A 3CH9A 4S3GA 2I57A 3GNOA 1ICSA 1IYXA 2DGAA 3T0TA 2ZE0A 3LEPA 3NEVA 4KH2A 4TQTA 1M03A 5E0FA 3ZLFA 1NOFA 4D72A 1C8QA 3UNTA 4YHEA 3L4WA 3N2BA 1XYBA 1TPDA 1EOMA 4F2TA 2REQB 3NQMA 4IH3A 4US5A 3RPMA 1I1XA 2AMGA 3WD3A 4YJ5A 4S38A 4GBDA 1OFPA 3E3HA 1QNQA 1JDEA 4F9DA 1CBGA 5BMWA 3W2MA 1RLCL 2WMIA 4ADTA 3M0LA 1W3TA 4N7QA 1JQVA 3BAXA 4DPPA 2FHFA 3WJSA 2ZOXA 3N9SA 1DWGM 2VZUA 2EKCA 1A49A 1Q2RA 1IWAA 5C9WA 3N29A 3RUBL 4CU6A 2I5QA 3HMCA 4IUGA 2ZZ6A 2P3ZA 2X1UA 4F79A 3JVAA 3GHUA 3EB3A 3W83A 4O8AA 3FV9A 2WC7A 4HGXA 2XJ7A 1G5AA 3R1ZA 3OLGA 1EJ7L 2Y1HA 4M24A 2V6AA 4ZOBA 1G4SA 1GCYA 3FFSA 1MRQA 2E3ZA 4LAKA 1A4LA 3QTPA 2BOGX 4UQAA 3B9EA 4BI7A 2PCQA 4WEVX 2WJZA 2WPBA 1A5MC 2NQ5A 2V67A 1WXYA 4PUJA 1EJXC 3PZTA 3CAWA 2PDHA 3VYLA 3L12A 2C79A 2FZNA 2B31A 1E71M 2OYLA 3MUAA 1D7KA 2ZRXA 4IPJA 5LYRA 1W1TA 3BMWA 1QO2A 1UCWA 3KEHA 5XINA 4B5NA 1SYTA 3N15A 3UJSA 1TV7A 3RNDA 1EDQA 7TIMA 1QR7A 5JVLA 4HIBA 4Q8MA 2O7QA 3HFTA 3P6LA 2IPWA 3GD6A 4C1KA 2PDCA 4TVUA 4H6RA 1D2KA 3IRSA 3MC5A 1M68A 2Y7GA 2FZ8A 3N6HA 3FIGA 3TMQA 1W9XA 2G0WA 4JBRA 4HZ6A 4WVXA 4GY1A 4B92A 3F7JA 2BASA 5EA9A 4OUIA 1HJXA 1UWAA 4EF9A 3TQPA 2QDDA 3AUOA 2VQUA 4V27A 4G2DA 3W86A 4JQ2A 2R94A 5M03A 1Y5VA 2FDMA 3GHSA 3S5OA 2XWDA 1KM0A 4FSAA 3QW4B 4DBUA 3PZOA 3QSTA 3ARWA 4UNIA 5E9AA 5EMJA 5FJIA 1AODA 4YL2A 1EZ2A 1VZWA 1ZB5A 3AYRA 3BOLA 1U30A 2AKMA 3WBYA 3DYMA 4IMAA 4XZLX 2ZX6A 4MUZA 3G1VA 1J0YA 4TUFA 3T05A 3KBJA 1XQLA 2C19A 3SCUA 1DHKA 2JKAA 2J7HA 5B7ZA 2E6YA 2VFFA 3QW3A 2FMNA 1FHDA 2BY0A 3CL6A 4PTVA 4GQ0A 4PTXA 3VOGA 3LTYA 3WFLA 3DGRA 4BQ3A 5AZ1A 3VKJA 3VCRA 4F0LA 1H1NA 3PUOA 4Q8TA 4H7ZA 4GLEA 1LOLA 1ZP3A 1VFLA 2AGTA 1DVJA 1IWBA 2F2KA 4DO5A 5D8WA 1CX9A 1LRTA 5FSEC 2E68A 2QPSA 3AS3A 3OHMB 5FCZA 3RCMA 9XIMA 1ZPTA 1PZ0A 1DOSA 3LNPA 4LX4A 2FLIA 4C60A 1GPWA 3MSGA 4O12A 4OVXA 1QDSA 3WD1A 1S3TC 4KETA 2OYKA 4FR1A 1TUXA 2J13A 4NZ3A 1W1PA 1JZ3A 3V0TA 4CUCA 1C7SA 4ALDA 1PCWA 1RQBA 5FOOA 1VPYA 2PDFA 1TE1A 4NJKA 3I7SA 3OLDA 1JUBA 3DC0A 3DOPA 1O6IA 1UA7A 3OZOA 3PG8A 1DWFM 4PBEA 4Y96A 5E93A 5A8OA 4Y9MA 3OLIA 1E6XM 3TTYA 3RR4A 4E8GA 4YXGA 3ABOA 4XV0A 1GZJA 1OD8A 3NQ8A 3EWDA 5LXXA 1KWKA 1TFVA 4LUTA 1TCMA 4AWUA 4XBKA 2D73A 3PZNA 4GE8A 4GYJA 3O6DA 4DYJA 2PDXA 4RDYA 1XBZA 3AROA 3B9DA 5GNZA 3EX1A 2PD9A 2CWXA 1X6NA 2P0IA 5C54A 1S2WA 3FSTA 1AQHA 4DJFD 4POCA 5M2FX 4DBDA 4BF5A 3TA6A 3W1LA 2A2IA 3T1GA 5GJNA 4NYYA 1GPFA 4KRZA 4AZCB 1OINA 1JPHA 2A0NA 1Z42A 2Q3RA 5RUBA 3W28A 1SUXA 3FHAA 4IGHA 3WK2A 4DUWA 2OLHA 4YVVA 3UVIA 1Z48A 5FIPA 1OWQA 5FF0A 4O1CA 4CD4A 4IL2A 1C93A 1HFBA 4TO8A 5L9FA 2NQHA 1P1MA 1K4HA 1LLWA 2X1TA 5B7YA 4KW2A 1PKNA 1DP0A 3TYBA 2VR5A 4HN8A 4IUOA 2D2JA 2JKEA 3WL1A 2UWFA 4U28A 2R1KA 5JIWA 1XGEA 1AH0A 2YL8A 4D6JA 5IOBA 4XZHA 4MAZA 4J3ZA 4RW5A 1J18A 3PJTA 5CPOA 2GQ9A 3NURA 3JW7A 3FVDA 3NVTA 3W76A 1JZ4A 3W7KA 2DZAA 1BGGA 2VRKA 4G6CA 3VUPA 1UQYA 2P10A 2PTXA 3FJLA 2VNCA 3CNYA 1FCUA 1KTBA 4GVFA 2XYLA 4Q4SA 3S1XA 1A53A 3W7EA 3S6DA 1DV7A 3SBFA 3UP8A 4XISA 4GJ1A 1JG9A 1YBQB 4QLJA 3M47A 2WNQA 3EOOA 4Q8QA 3MHUA 3XIMA 3S0CA 1VJZA 1JEZA 5U4NA 5EPDA 2DFAA 1JYNA 2G4FA 1QO5A 3S1VA 1XLGA 4EE9A 1XBYA 3OP2A 3VFCA 4XO7A 1P0NA 3NQBA 1YTEA 1LBFA 3GW0A 1W9DM 3KCJA 1TWIA 1W6TA 4INFA 3UT0A 5T8GA 1JRCA 1EJRC 1SO5A 1TE6A 4KERA 1L2UA 3SY8A 4I5UA 4HCDA 1IIGA 3DI1A 2Y8VA 2HQAA 4R85A 3DERA 1BYBA 4ZA0A 1GVFA 3EWBX 3AIBA 1GVEA 4HT3A 4AXNA 2TODA 1XQKA 1MWOA 1Z41A 3NCOA 5J5RA 2VT0A 4JDYA 1BRLA 3WQ6A 5C9UA 1NFGA 3UPMA 3VD9A 4ROQA 2A3HA 5HQLA 3BW3A 5LA2A 3V4BA 4NXSA 3WNKA 4N9BA 1TPB1 1FCBA 1TQJA 2FFIA 1JR1A 1DHPA 2J77A 1J11A 3O1NA 4A6GA 3BCFA 1WDWA 5C55A 3UGVA 1TVPA 3UA3A 4AWTA 2ZICA 2QMKA 4PCPA 4UZUA 3BURA 2UY5A 2RDWA 3OEXA 1E9ZB 4H9MA 2PP3A 3PWIA 3ZR4A 2HV5A 4MY9A 2GYIA 1P6CA 3BANA 4B3KA 3WNNA 3H23A 4XKMA 1NEYA 2ZRVA 5I3DA 4CKQA 2E5DA 2IQDA 3N9RA 5CC5A 1LYXA 1V7YA 2GSEA 1BVWA 1TJ2A 4LY4A 1H51A 3F4DA 1QFEA 3LK6A 4LUIA 1NIUA 4JFWA 2JIEA 4BF9A 2D1ZA 2XN0A 4QQUA 1E9IA 4HPNA 3PBMA 2J74A 3GKAA 3QEZA 3GB6A 1S1PA 1CI1A 2BOFX 1Q66A 1GJPA 4YLWA 1N8WA 5HWMA 1TV4A 3LYEA 1WKFA 1QAPA 2QLYA 1HVQA 2BVDA 4AEOA 1KFBA 4O52A 2H90A 1YTKA 3HQNA 3PNUA 4HYVA 4FXFA 2V3DA 3KZSA 4Q8VA 1FP8A 3G24A 1SZEA 2WZMA 2NV9A 1RP8A 2EPLX 3ZOAA 3PZMA 5AC5A 3CEUA 5K2ZA 4WK9A 4H9VA 3NM3A 2GGJA 3A3HA 1IE7C 1PEZA 2X0HA 4FA3A 3A21A 5LHFA 3VD5A 3H7UA 3TU9A 2VYOA 4Q33A 3C0SA 4K6AA 2EXOA 1FXPA 1W54A 2FB3A 1OX6A 3ANVA 4S23A 1VIZA 5LNWA 3VDAA 1WB0A 3B4UA 3M1ZA 3THUA 3QPZA 4AX7A 4KFPA 5I23A 1UZHA 1EGZA 4MUPA 4HTYA 5I79A 4AIBA 3AMGA 3B8WA 5D8ZA 5ECUA 1DTNA 5FI8A 4IP5A 2PDBA 4DJEA 2WJDA 3O7UA 3HG5A 1E6NA 1CXKA 2DU2A 1E0VA 5HOSA 2B7PA 4CN1A 2NXHA 4IMDA 4RNFA 1R3VA 1XC6A 2Z27A 5FF2A 5K9XA 2Y4SA 2WMFA 2QUTA 1SGJA 3N3MA 1E4LA 2EEXA 3QZEA 3FA3A 3BARA 1ICQA 1EP1A 1IXQA 3AS0A 4YWIA 3S46A 4JY8A 3DC8A 3MMWA 2I5GA 1RD5A 1X6LA 3PPFA 3WLRA 3FGCB 3OVGA 3BAJA 1KRMA 4JIPA 4IIBA 3T2QA 2PWDA 5AVNA 4AMAA 1FH8A 2DPEA 4ERIA 2AL1A 2PLCA 1GOWA 1E56A 3STFA 4CQ9A 1RBOB 2EJ1A 5EGRA 2HSAA 3AXKA 4MWAA 1QK2A 3HZ3A 4FF5A 4UTIA 4QG8A 1RY8A 2VZTA 2WHJA 3FHQA 4FEZA 3ZYZA 1H60A 4JEJA 4B4HA 2WANA 4I7UA 1OG0A 1YDNA 2QZRA 2CEQA 4W88A 5DCDA 3W1UA 1NSJA 3N6QA 1NDWA 3ZZ1A 4HOZA 1DQXA 1NAL1 2D23A 1B3OA 1JXJA 4DJDC 3VC6A 3AJ7A 4RLIA 2IKIA 1J5SA 2RFGA 2VX4A 3EWWA 3EX4A 3JUGA 3IK4A 1QHZA 1B4EA 5HULA 3NTYA 1TKKA 4UBPC 4Q8UA 3LM7A 4BWLA 2OZ8A 1VAHA 3TN4A 1EGVA 3V3WA 3E0IA 3DG7A 3NL5A 3U2EA 2AMXA 4UFIA 1C3FA 3OYZA 3LBCA 2Y88A 3CH0A 5JXQA 2WB5A 5F2GA 3LCXA 1VEMA 3QMRA 3UZJA 4GI6A 3EMZA 4Z2GA 3AI0A 2IS7A 5E5CA 3OTRA 1L8NA 3GVGA 3NSMA 4FS9A 2QHAA 5H91A 4PMUA 1W3KA 3RILA 5AHFA 1KXQA 1OFDA 3WBWA 2BXZA 2DW6A 2L5HA 4JX4A 1VLWA 2EKGA 3R12A 1VPQA 3VM7A 1XLDA 1C8VA 4X63A 1A47A 3NO5A 3HGJA 1VQTA 3LLDA 3SCSA 3OGSA 4DI9A 2RGLA 4O11A 3H24A 5D33A 1EEPA 5AHNA 3WLNA 3NA8A 2NZLA 4Y2WA 3K4AA 4LUSB 2VX5A 1D9EA 2BNJA 3W85A 1ISZA 2BWGA 2J25A 3C2YA 1WOAA 4N4QA 4D2JA 3N2XA 4AHQA 4MKNA 1F5ZA 5SWUA 1W3NA 3N04A 1DJQA 1K3UA 2CHNA 2EPNA 4G1NA 2EPOA 3WQGA 3H2MA 1G0CA 3ARZA 5FEZA 4EAYA 1XSKA 2ZDSA 3ITVA 2X7WA 3EMCA 3T40A 1GQLA 2BDQA 3WENA 4ZOCA 2GLKA 4A21A 1VP5A 3VGHA 2ZXBA 1EKOA 1PE1A 4IZGA 1NF7A 2EG8A 1LG2A 1HP4A 3HA1A 2QS8A 1XGZA 2ISSA 1ADDA 3GQYA 4JICA 5H6HA 2XWEA 1KM2A 3W4RA 1VGAA 1ZAJA 4A8IA 1R3QA 1J0IA 4W7VA 3M7WA 4MNJA 4ZE4A 2CC0A 3W2KA 1SPQA 2XN1A 5CGMA 1KCKA 4JYEA 4AHOA 6XIMA 1SMAA 3VDBA 3ARQA 4QIUA 4DHGA 1M7JA 1AQMA 3M46A 3VOCA 5CZJA 3PJXA 1TELA 3FA5A 4AISA 4N6FA 3BTNA 3EKGA 4ZFCA 1DXEA 5DT7A 4Q32A 2ACUA 3SDOA 4C6CA 4WDXA 3SUVA 1EQCA 3DFYA 3IV8A 1KFKA 5CJ5A 5C7HA 1Q3NA 3FLUA 3PFRA 1Q63A 3R2GA 5BMXA 2A21A 3M16A 2ATMA 3WX7A 1TV5A 1GT8A 1UKQA 3WLLA 5HPCA 2NX9A 3T0AA 2D3LA 4LB3A 4JFTA 1OCNA 2Y63A 4NJGA 3PUEA 1REQB 5G1YA 2HVNA 1NQ6A 4L80A 4GZJA 3MV11 1XLCA 4LVAA 3G1FA 4K38A 5CC7A 5REQA 5C6MA 4L1GA 1SO4A 1J96A 4KEVA 3PUDA 4HSHA 3FDKA 4O50A 2JF7A 3NOYA 1MDLA 4ORMA 3POHA 5M3WA 4NU7A 5BXPA 3V18A 5EB8A 5FKYA 2OTDA 1GK8A 1MYRA 4Y8FA 4Q8NA 3ARPA 3O6AA 4LYKA 3IJIA 1YYAA 3LTPA 1SFTA 3WUEA 3V1PA 4CQCA 1OT2A 4HSOA 2J9YA 1EB3A 5HWJA 2ZUWA 1EDGA 2W3ZA 3IJ6A 1XGDA 3FX4A 3G6LA 4JNMA 4HNUA 1FWRA 1A5CA 5I5RA 1A5UA 3QV8A 4GZ7A 3M6DA 1IXPA 3NL3A 2OEJA 2G95A 3PF3A 4H19A 3Q58A 1A0DA 2GSJA 2XU2A 1W1B1 3WBXA 4D6HA 1S38A 4MMWA 4LW7A 1OK4A 3UG5A 1V6UA 1YRRA 1DIEA 3N13A 1GVIA 3ABSA 4JR5A 3SCRA 3DHDA 1TMHA 1WKYA 4YTTA 2ZUNA 3O6YX 2Y7EA 3CQKA 1PZ1A 3S2NA 5BCAA 4BZYA 2REQA 3W2LA 3MCMA 1BG4A 9XIAA 4M29A 3JR2A 1Q8JA 1GYNA 2Q02A 3NEHA 2WLYA 2DT3A 1UC4A 5JBFA 4QSHA 5I0DA 1ZENA 4GUJA 4AZHA 3VGBA 3LCHA 4O1EA 3Q37A 3FOKA 4AEEA 3TH6A 2AGKA 3LY0A 1R7AA 3GNXA 3EOEA 2ZXDA 4DJFA 1CNVA 2HBXA 3KS5A 4O0ZA 4HNCA 1TVNA 4F2UA 3AZTA 1H61A 1F4AA 5A6BD 3PZ9A 5HR6A 3WH7A 3BJFA 3U8GA 4UQCA 2WC4A 1FBAA 4JNZA 3SQSA 3MUCA 3W02A 5GVJA 4OZOA 3WQ5A 3UXKA 3GFXA 4WD0A 4JFSA 3EOUA 1XBVA 3L67A 1RK6A 2Y62A 4XAYA 2WJEA 4GYKA 4H04A 3CK5A 3L4XA 2EG6A 1PX8A 3W2UA 4GX8A 1W8GA 2GDVA 1TA3B 2P0OA 3F5KA 1OB0A 3AYTA 5T9CE 5KTLA 2YCEA 4UCGA 2XN2A 4W7WA 1H7WA 2Y8KA 2A7RA 1VCVA 4DF2A 3ITLA 3IUIA 4FLRA 3U4FA 4Q7IA 1ISYA 3L21A 2DZWA 4DUOA 3HMJG 4HPXA 3C2FA 4GY7A 3ERPA 3DFTA 2INZA 4Z2LA 1AD1A 8RUCA 3CL7A 2XH0A 3L0KA 1ZJAA 4EANA 2C18A 2E77A 4DI8A 4GVGA 3TXVA 4FZIA 5CKSA 1P7TB 1RVGA 1FWJC 1QNSA 3H8AA 3E2VA 3MA8A 1UASA 4NX0A 2QVHA 3TOYA 3VI2A 3MP3A 1GUVA 3NOEA 3ISIX 2PTDA 1BTCA 4C90A 3LNMA 1UD3A 2C15A 2I7GA 3MPGA 3FYPA 4MLJA 4PBGA 2GWNA 3O15A 4IMGA 1SW7A 3DIPA 3K4WA 4DUVA 4B5XA 1VFSA 4GYFA 1MNZA 3TLLA 3ZT7A 4G56A 4L9XA 4PEEA 2QDGA 1PWMA 1GKPA 1VFFA 2NVDA 1Q6OA 2DVTA 2ZRZA 3VDCA 3L4UA 1CGVA 1IEWA 3FJ6A 4FB7A 2VCAA 5J5DA 3A13A 5E0CA 2OLAA 3RLUA 1ONRA 1VENA 1KLZA 4ZSTA 3CTTA 3R0KA 4IIFA 1CYGA 4J3SA 4E8CA 3MYPA 5CAHA 2A3CA 1OC6A 3CV6A 5A1AA 5LIKX 3T55A 4GABA 1Y7VA 1TO3A 2QF7A 3TR2A 3FYYA 3GXNA 4O0QA 5DMLA 1UMLA 4G5DA 3I10A 3TYZA 1HIZA 4JTUA 2VXNA 1HUVA 6REQA 1GW1A 3IIOA 2DIEA 3RPTA 1F61A 4WDWA 4A8RA 4EF8A 1CGWA 1ZTVA 3WK0A 5DFAA 4LT9A 4IX2A 1JD7A 4PODA 3QJAA 1V3JA 1V6XA 1K02A 4FHAA 4FNRA 2DSUA 4A05A 1HGWA 2ISDA 2A85A 4E2BA 4C6QA 3E9AA 2Z1BA 2VGFA 4GCAA 5L6UA 5AHEA 2QCMA 1B3XA 3U5YA 2C7FA 4AZIA 1XJBA 2X0YA 3M64A 1FTXA 3QGAC 1XRTA 2ON3A 3IUHA 8XIMA 1AW1A 3QFEA 1XLJA 3S5NA 1OFOA 2FMOA 1W37A 3OYXA 3LCGA 1PYMA 3HG3A 3RF9A 1YNQA 2J66A 3OBEA 2Y5EA 3KTCA 1GORA 4FX7A 4UB9A 1FCQA 4GACA 1W1IE 1WP6A 4QCEA 2CU0A 1POKA 3GM8A 1LM1A 3WBAA 1R2RA 3D3FA 5U7SA 2GJXB 3TW7A 1U83A 2QIIA 2KAUC 4JS3A 5JBEA 2X41A 4GQGA 3WDHA 2C0AA 1FWTA 4B91A 4J9JA 3UESA 1HJUA 4A2SA 2NQZA 3ABQA 2VDGA 3PK7A 5TNVA 1FWIC 3E49A 3GE7A 3MUXA 3M0KA 2EG7A 2XH7A 4A3UA 5LIXX 2I56A 4EACA 2ZFAA 4RW3A 1Q6DA 1AQFA 3ARUA 5JH2A 3AS1A 4AZCA 4ZFMA 3RRXA 1P48A 3P60A 1WKEA 2OGJA 4JTCA 1LL7A 1RALA 4J2MA 2Z1WA 4UTWA 1OEPA 4UFKA 2QJNA 3M41A 4E8DA 2PDKA 3ZXWA 3TYUA 2UBPC 2Z26A 2POTA 4JCMA 3SECA 1JDFA 2IXUA 5TD4A 3LENA 1QMLA 4V33A 4H1ZA 4M19A 4JIRA 2HE5A 2VX6A 3ZQ9A 1UUQA 3V35A 3T42A 3EGJA 3PAJA 4IFKA 1ELSA 2OSXA 4E4UA 3DG3A 3GSMA 1V0LA 2VENA 4BQ2A 2V81A 4UFMA 4QS6A 2XUCA 1SZRA 5DQPA 1E70M 1WA3A 1XWYA 1RAKA 2V3EA 1KCXA 3LMYA 1TPFA 4QCFA 1FWHC 4JNYA 4ENLA 2BTMA 4XD4A 1ZY9A 1UROA 4AVOA 2VFIA 4KFOA 1RR2A 5HDRA 3ARRA 4KWWA 2WCGA 2INEA 2NV1A 3MTWA 4C7FA 3UG8A 3GDBA 1E6SM 5HANA 1EO7A 2F38A 1S2TA 3EWYA 1GVOA 1YE4A 4GUGA 4WGXA 3S42A 1RHCA 1OBAA 2FH8A 3VD7A 1I2RA 4YIWA 2FTWA 2GSHA 2WMHA 4WLCA 4MIMA 4MHBA 5C71A 4GOAA 3ZS4A 1ISWA 2X16A 5H2ZA 3N14A 3K2GA 1PB0A 2D3NA 3BMVA 3LI1A 5FJRA 4BQ5A 3PJUA 3TP4A 1ISVA 3ZR5A 4D6IA 2Z2AA 2C1GA 1AW2A 3ES7A 3TKFA 3VC5A 5JBDA 2VGBA 4ATLA 5T26A 4FK9A 4D6FA 6ENLA 2VFGA 3SO7A 3E38A 3KOFA 4MTVA 3TFXA 3S5SA 3K4DA 4WQ6A 1TIMA 5BW6A 3PANA 4GK8A 5BOFA 3OZMA 3G22A 2QCHA 4LTSA 3D3AA 4EPKA 3O6CA 4DAIA 3AQUA 3N6JA 5C8BB 1K4GA 5BZAA 4RE2A 3VDHA 1W8SA 1B1YA 1OIFA 2BXVA 4LV4A 3ENLA 3WYZA 2ADAA 4RR4A 4H2CA 4IJBA 4N0RA 1ZBKA 1GQKA 4GXMA 4R7JA 1YE6A 4Y7EA 2BVYA 2NX1A 3WJWA 1V02A 1WAWA 3I7RA 4I90A 3RMEA 3QGVA 3QHMA 3FAWA 3EX3A 3N2OA 3Q94A 2DZBA 1VFMA 4XX6A 1WUEA 4ONVA 4GISA 3L0NA 3W25A 4PH6A 3CZKA 4FP1A 3AU6A 3TW6A 1HZYA 3B0YA 1CLXA 2XSXA 4AY7A 5AVHA 1T7LA 4AZ7A 3WDJA 2WHKA 1NJJA 1E0WA 2DSVA 1SM9A 3L9CA 2W6RA 4JTDA 2WMIB 1BFNA 1Q2SA 4JX5A 2FVKA 1JF5A 1UZ1A 4Z2JA 4O14A 3E12A 1JUKA 3K8LA 1T6MA 3G18A 5C9XA 3B8SA 1UKOA 5A8GA 2NVCA 3GDKA 2HRWA 1JFHA 2IW0A 3HO8A 4FR6A 5C5YA 4GI9A 3A3WA 2YA2A 3C8FA 3INPA 7REQB 3AIUA 1KM1A 4Q8PA 5FESA 4LXFA 4ICMA 4QR6A 3HPZA 4M7TA 3EDEA 1Q6LA 1S5NA 2BY2A 2VEMA 2Y61A 4NG3A 4UCFA 3WDIA 1L9WA 3V0SA 3S2CA 4QDPA 2DT0A 3QV7A 3T8QA 4TU1A 4MYXA 4MJ4A 3KHJA 3TEVA 4LB4A 1A5NC 3PUGA 2R6OA 3U2CA 1TRIA 4YTQA 3SSZA 4TMCA 3P5ZA 3MS8A 3THDA 1M41A 5FF3A 4WSHA 3APTA 3M0JA 1VKFA 4UOZA 4H8HA 3IANA 4QJ1A 1S5MA 3EXSA 3TLQA 3VZZA 1JZ6A 3SRDA 3CUJA 5D9NA 3LCFA 2WV8A 3W84A 2PEVA 3VUSA 4ZBCA 1WNOA 1GHSA 2DZTA 1A5OC 2OOFA 4DZHA 3PG9A 4I6KA 4LAZA 5BXSA 1GQIA 1M01A 4RXGA 3EBVA 3CS2A 3B97A 3RCYA 4R3UA 3LGDA 2WHLA 1FWWA 4K68A 4C6NA 1UUOA 1DJHA 2BOEX 1VBGA 3UZYA 2GQ8A 4A3QA 1B9ZA 2WPGA 2C1HA 1F74A 5AOUA 3ARVA 4FOUA 4KCTA 3RRAA 1FVPA 3PJWA 4JQ4A 2XGBA 4QSFA 4P8XA 3Q4DA 4NP7A 3G0SA 1E0UA 5BRBA 4H9YA 1FWFC 2YFNA 5DMNA 1GYMA 4C5YA 1I2NA 4AZ6A 5K4ZA 3ZFHA 3W7HA 2OR2A 2CHOA 5FACA 1RXOB 3P5YA 2VD8A 1JGMA 3YPIA 3RFAA 3PTDA 3MU7A 1TV3A 3A9BA 3CZ8A 3QOKA 1PVNA 5G4EA 4DJEC 1VFTA 2PMQA 1WX0A 1OFQA 4GUHA 1UBSA 3GH4A 7ODCA 1OYBA 1TPC1 3BGJA 2IQ0A 4UOQA 3VOIA 3A4WA 3QPEA 4LYQA 4ZO9A 2ZTJA 1U33A 2G3MA 4Z2IA 4Z1AA 1MVYA 4QTGA 4M3PA 4M6VA 4TIMA 4UQDA 1E4NA 3T0DA 2XIOA 4B5UA 1IT8A 3GU9A 4J5NA 4EPBC 4W5UA 5HMDA 6A3HA 4BHYA 2G3IA 1WO2A 3UBPC 1CT5A 4UR9A 2PC8A 4RKAA 4ZO8A 4JKKA 3BO9A 1NOWA 3VU2A 3E1F1 3NYZA 4GJJA 3VNIA 1XUZA 2WKLA 2J8TA 2JQXA 2X1IA 4MWAC 4PE8A 2DDXA 1UBPC 2YDAA 4JHZA 3AXIA 4O15A 3GK0A 4HB7A 3WDPP 3RX2A 3FKKA 4B5WA 4H7CA 3P84A 2YBVA 2E6DA 3WL0A 3E5BA 1OADA 5AYXA 1K9FA 1EF2A 1X7FA 5CZKA 3VIIA 3S1UA 3K13A 4LUSA 4RK8A 1SZNA 3NSXA 1H5VA 1F05A 3N19B 4ZQNA 5A6BA 1D3HA 1BVZA 1W5MA 1MMFA 2QVNA 1V0KA 2OQHA 5I2UA 1EGMA 4Q22A 4ZOAA 3L5MA 4BWLC 4JD4A 1LRQA 1RD6A 3PSWA 5DY3A 1UR8A 1O68A 1L6GA 3E0VA 2ZZ5A 2E5BA 4IGNA 2XDFA 3W1QA 1LCOA 2DH2A 5EL1A 3CT2A 2W62A 1YMYA 3FXGA 4GWEA 3G1HA 2HE8A 4J1OA 3NL6A 1T0OA 3WH6A 1R0MA 1KGUA 4FPSA 3CAQA 5A6TC 5FJPA 5I00A 4X60A 2C1IA 3UETA 1UH4A 5IDIA 3TYCA 4RV8A 1JDCA 3J7HA 4IP4A 4MPKA 3QH2A 2YCLA 1ZCCA 4Z08A 1KW1A 1NF0A 1BYDA 3KVLA 1E55A 1XYAA 3KVJA 3NGJA 1MXGA 4L4PA 1E9YB 3PZGA 5AB3A 4S2CA 4NJHA 1XSIA 2G96A 4E5TA 1JRBA 1K8XA 3GTFA 4D8LA 2Y7FA 4PMJA 3AMLA 1MW2A 1RBAA 4LF2A 1PS9A 1U22A 3BSMA 5HBFA 3MI6A 1QI5A 2PDMA 8TIMA 4HBKA 4PCSA 4LC6A 3RDKA 2ZC8A 3RYSA 1IV8A 3OO2A 1GTHA 3SR7A 5LGZA 5EMUA 3I3EA 1UH3A 3G3MA 4J27A 3SGGA 3U4AA 1F3EA 1IGWA 3PBUA 1H7NA 2ESCA 1AJ0A 3BE7A 1PO9A 2QJMA 3CHCA 4EOUA 3M07A 5CLWA 3GR4A 2ZX7A 3E6EA 4HK6A 2W63A 5CSRA 4CQ8A 2PRMA 5DANA 1Y0EA 1VJSA 1M7PA 4G7FA 1CZ1A 2TAAA 3DYOA 1AW5A 1J6PA 1IWPA 3PS7A 4L9ZA 5I06A 4ZTYA 5ABTA 4R7WA 2YB1A 4NZFA 4XIAA 3BW2A 3W1TA 4A29A 3ZM8A 1PWLA 1K9DA 5A5WA 4DF1A 3C2VA 3SN0A 3WQFA 4AH7A 2RDTA 4E2DA 1KXTA 1BGAA 3CTLA 4WY0B 3AIVA 3EPNA 4I9JA 3LV5A 3IGXA 1JI2A 4W4QA 4LUYA 4Y8EA 3G1XA 4MFEA 1M9HA 3QRHA 1MEWA 3F5JA 4FXJA 4P8VA 4KGLA 2GUYA 3BLEA 1VFUA 3A3XA 4HMNA 2QPUA 4HNNA 4B3LA 4CEUC 3E02A 4Q4PA 1FWBC 3QQ1A 1KKOA 1T96A 1S2CA 1SMDA 3A12A 2A6LA 3VD4A 3WF3A 3NNTA 2OFJA 1FDZA 2PU0A 4S3EA 3A5VA 3AMKA 1R3SA 1CCWB 4QGCA 3E5PA 1A5BA 3BG9A 4YS1A 5D37A 1NTHA 1Z6KA 3CV2A 3MJYA 3HQ1A 1OCQA 2GQAA 2A5HA 3CAVA 3GUWA 4L1XA 5DO8A 1FHUA 2BBFA 1KFJA 2Z25A 2PBOA 3WNPA 7XIMA 1XYCA 1O5QA 5I3KA 3W7CA 1QW9A 1N8FA 5G4HC 3S1GA 3SN1A 8XIAA 1UWIA 3VILA 4GJIA 3HOJA 3THCA 1TRDA 1BSIA 4B9YA 2E1DA 1SU5A 4CNPA 4MB5A 4J7RA 7TAAA 2P5NA 2JKPA 1DWHM 5C2CA 1F9CA 1ZHAA 4DELA 4GNKB 1PKYA 1CXHA 3OJGA 1R2TA 1G4EA 1VBHA 4I7VA 2V3FA 5FSDC 2E1WA 3CQIA 4LWWA 4OQVA 2GK1A 2FGZA 3F2BA 5I24A 4C6FA 1LBMA 1XIDA 1JYVA 3VGEA 1TA3A 3E0LA 1QCWA 4HA1A 3KVMA 2MANA 1QI4A 2HPMA 1DQWA 1S2AA 3DECA 3BG5A 4O16A 4QHRA 2GGHA 3AJXA 1B0IA 1OF8A 4PUMA 3ICJA 3CBWA 5FL1A 1UJQA 3CASA 1VS1A 4AIUA 3A47A 3KDOA 2PDWA 4NNAA 4TV6A 3B9NA 3L4VA 2BGNE 5CPSA 4DJFC 1VBUA 1QTWA 3GZAA 5KZDA 2GQ3A 2NXGA 3VMNA 2FJKA 3WUBA 1NDZA 1JDDA 3IJ9A 4A4AA 4HOWA 1N55A 4R34A 1P7TA 3WLOA 1THFD 1ZBVA 4RUBA 1K7XA 3UF9A 3EKZA 3M5XA 4C1NB 3A9IA 4JKMA 4PUEA 2PZNA 2E9BA 4C7DA 1GKQA 1BQGA 2QJIA 2VWSA 2Q8ZA 1H1YA 4AW7A 4AF0B 1Y5WA 1HO4A 4GIEA 3SCTA 3KLLA 4I5XA 4L6OA 3WUFA 4GIRA 1KBLA 1WBJA 4P7OA 4QLKA 4JTTA 5KITA 1A80A 2NQLA 4ADUA 5DLCA 3QXBA 3MCNA 3UCQA 4PC8A 4DLFA 4MADA 1KD0A 1KWGA 1EZWA 4GQRA 4HK5A 1V77A 1F07A 4JFUA 3QR0A 2P88A 3B3DA 1PIGA 3NZQA 4GC4A 1OYCA 2CXEA 4X22A 2JGYA 1RUSA 3CHVA 3DBNA 2PE4A 4D1IA 3N4FA 4KIEA 5D38A 3C2OA 4GX9A 3T44A 1A0CA 2W91A 2VZSA 3WEOA 4LQ1A 4CNNA 1F6KA 1V3MA 5FJTA 2QCDB 5GPRA 1C90A 4HU4A 2DJXA 1XPGA 4BR1A 3NIYA 4LBUA 3TYEA 4F3HA 3HQPA 4MNKA 1Q6RA 4S3KA 3H22A 1V4YA 5LXEA 4WKFA 4KKXA 3AWOA 2XFYA 2UY3A 1B31A 1HG3A 4JYDA 1ZS2A 3WELA 4LCSA 3KAOA 3NPUA 4MWAE 2A4AA 2WO5A 4WZHA 3P14A 1RQHA 3SAZA 1XCXA 2WSPA 2HNEA 4HNVA 4LFYA 2V8ZA 3QMTA 3VFLA 1V7AA 1V3KA 3EX6A 4MJZA 1WOBA 3CT7A 3R25A 3IGUA 1VYRA 4GI8A 4JKLA 4EXBA 3NDYA 4Y9AA 4NJIA 1XH2A 3BAWA 5CZSA 6ALDA 2GJXA 3ES8A 4O0KA 1KGXA 2DY3A 2ZBTA 1EBGA 3VD3A 2OO0A