1F6PA

Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form iii
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
293
structure length
293
Chain Sequence
MRDLKGIFSALLVSFNEDGTINEKGLRQIIRHNIDKMKVDGLYVGGSTGENFMLSTEEKKEIFRIAKDEAKDQIALIAQVGSVNLKEAVELGKYATELGYDCLSAVTPFYYKFSFPEIKHYYDTIIAETGSNMIVYSIPFLTGVNMGIEQFGELYKNPKVLGVKFTAGDFYLLERLKKAYPNHLIWAGFDEMMLPAASLGVDGAIGSTFNVNGVRARQIFELTKAGKLKEALEIQHVTNDLIEGILANGLYLTIKELLKLEGVDAGYCREPMTSKATAEQVAKAKDLKAKFLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords N-ACETYL NEURAMINATE LYASE
publication title Active site modulation in the N-acetylneuraminate lyase sub-family as revealed by the structure of the inhibitor-complexed Haemophilus influenzae enzyme.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 124
structure length 293
sequence length 293
chains with identical sequence B, C, D
ec nomenclature ec 4.1.3.3: N-acetylneuraminate lyase.
pdb deposition date 2000-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1f6pA00
3W83A 4LVDA 2NUXA 1L2UA 3W1QA 3QPZA 2ZA1A 6ALDA 1JVNA 1VR6A 4K38A 5FEZA 1KM1A 1QO5A 4PTNA 1K02A 1O94A 4RK8A 1O95A 3CWOX 4WQ6A 5G2HA 3TDFA 3OG3A 4ZVJA 1S3HA 3LCIA 1F5ZA 3W1LA 2FPYA 2ZZ6A 5K3VA 3TXVA 4N6FA 3LCHA 2FB3A 1IXOA 3UQNA 1GQNA 4A22A 1BEUA 2C16A 4OGZA 1KBIA 5DELA 5HJLA 5LHEA 1HTIA 3NM3A 2C1HA 2A85A 2WQPA 4BFAA 1TIMA 3S1VA 2G95A 2ATMA 4FO4A 3TSDA 4CCCA 2NXIA 5I3KA 1OFAA 1JCNA 3SGZA 4UFJA 3TUUA 4O15A 4GUIA 4UXDA 3L0GA 3TX9A 3W76A 1OK4A 1TB3A 3W7OA 3W2JA 5F2GA 2QCCA 3W7GA 3B0VC 2ZA2A 1ZJIA 1GG0A 3O6CA 1H7OA 1DKWA 2DZVA 3Q37A 3MHFA 4WZHA 4YL2A 4BI7A 1OFEA 1TPEA 3E02A 1I2RA 2YGYA 3NPWA 3B8DA 1YTEA 4O28A 1PCWA 1BKSA 1MEWA 3MHGA 6TIMA 1YTDA 3C8FA 3P5YA 4NQ1A 4WOZA 2VFHA 3EX3A 1TMHA 3IIOA 5I3JA 1H61A 3WK3A 3PB0A 1G6CA 4IX2A 3BK0A 3W74A 3S9YA 3EKZA 4BF9A 4HIBA 1A5CA 3DFSA 4BI5A 4TX9A 4NJHA 1IGSA 1WDWA 2TYSA 4DQWA 3LHVA 4CCDA 3PG8A 3S1WA 4W9TA 3M16A 4QM1A 5F2IA 4IGHA 2E1DA 3C52A 3NL6A 1K8ZA 4P61A 1A50A 1P0KA 2AQWA 1H7WA 3OBKA 5E93A 1GVRA 1RV8A 1LROA 4U28A 5CZJA 5F4WA 2VXNA 3MW7A 4WUIA 2CFFA 1XDMA 2G5WA 4H3DA 4TIMA 3W7RA 2J88A 3DXIA 5HWJA 1TPWA 3HJZA 1OK6A 4YLWA 2E68A 4UUIA 2FIQA 5LNRA 1LOSA 2V2CA 3FJ6A 2I14A 3IIVA 5EKYA 4JXCA 4B5NA 3W22A 4QNWA 3R8RA 1W8SA 1VCFA 1T8XA 5J5DA 3E49A 1GYNA 1W5PA 4O1CA 4O1DA 3TQKA 1TPB1 3O6DA 3GDTA 4FEZA 3O8AA 3WK2A 5G2IA 5A5WA 4UTUA 2A7PA 4Z1DA 3LLFA 5AFDA 4U4MA 1EUAA 1TV5A 4LS0A 1X8FA 4FIRA 4WY0F 3QFEA 3P84A 4N9BA 4O11A 3FOKA 1XBYA 2VELA 3W1RA 4HNVA 4DBEA 1KFJA 3M7WA 4IXHA 3W9ZA 1D9EA 1YDOA 4MFEA 3ELFA 1Z41A 1X7FA 4AF0B 3BLEA 1DQXA 1XM3A 3CLMA 4LTSA 2Y61A 4GNJA 1NFBA 2FQIA 4IMCA 1W5NA 3SSJA 3G1HA 1H62A 3OVRA 2CLLA 5BOOA 4LUIA 4UTTA 3NQDA 1KV8A 5AC6A 5LKYA 3UYCA 3UY8A 1TO3A 3PBVA 5AHMA 3U6WA 4R7JA 4LS1A 1QOPA 5U4NA 3ABSA 5CG7A 3MBDA 5I3HA 1TV8A 2YW3A 1W3NA 2CZDA 4AHOA 1VS1A 5G5IA 3L67A 3UZ5A 3WK1A 1WOBA 1TPDA 2Q3OA 1HFBA 3W87A 3S42A 1HG3A 3EWBX 3QSRA 2A1YA 5AHNA 3QW3A 3VNDA 3S5OA 3W70A 1VCGA 1Q6LA 1EP3A 3I68A 3LM7A 4IWWA 3S0CA 4I7VA 1C9DA 3FEMA 3KFTA 2J9ZA 4JS3A 4Y6GA 5K9CA 4ORMA 4JTTA 3ATZA 5KSWA 2BWGA 4LY8A 1K8YA 2Y85A 1OABA 1GEQA 1ZAJA 3BGGA 2Y89A 2E6AA 1TYGA 1LRQA 1ICPA 1NF0A 3NAVA 1TCDA 4O50A 4R53A 3A9IA 4RR4A 3MJYA 2GVGA 2QCDA 2FB2A 3N73A 2QCLA 4FNPA 1TSIA 3TJXA 1GVFA 2YDAA 3L5LA 3GIYA 3E96A 3NQ2A 1H50A 2YFOA 1M7PA 1XUZA 3QEZA 5DBTA 4UTIA 4WX2A 3W7EA 4YXGA 3W85A 2QCFA 3EB2A 1NEYA 2ZTKA 4O0KA 3TR2A 2C6QA 2JGQA 2VEMA 1OX4A 4WXZA 2VEPA 3M44A 3PUEA 5CZTA 5D04C 4FNQA 3S5YA 2P0OA 3LCWA 1G7VA 1A5SA 2X2GA 2WV8A 3C2OA 4UR7A 4P2VA 4AH7A 2Q8LA 4Z0SA 3NQCA 1HO4A 4GXMA 3MBFA 2CZEA 2J9XA 3VI2A 3W6YA 8TIMA 5FI8A 3LRLA 5LSMA 1O60A 2AAMA 3G8RA 3RF9A 2VFFA 5F1UA 1VRDA 1MO0A 3G1YA 1GVOA 4O19A 5HUPA 2ZRUA 1MXSA 4JTFA 5CZSA 5LGZA 1G4PA 1OF6A 3QPYA 4MIMA 1MZHA 5FEWA 3CEPA 1YLVA 3NL5A 2ZZ7A 5KITA 1PV8A 1DBTA 3CHVA 4FIQA 1PS9A 1PE1A 1UUMA 4RZ4A 4AB4A 4NX0A 1T96A 3W75A 3EWXA 5EYWA 5C6MA 1J4EA 4UFKA 4FX6M 2CLHA 3S1UA 3STGA 4MOZA 4PFMA 4AEOA 1ADOA 4QNEA 1YADA 1K03A 2F7FA 3ZFHA 4NNBA 1LP6A 2V2HA 5FF7A 1UASA 4JY8A 5KMYA 1GG1A 2ZZ2A 3FKRA 4LV9A 2VENA 3OVPA 3O15A 3NQVA 4A2RA 1GTEA 3DI1A 2C15A 5D05A 4GUHA 4RJEA 1PVNA 3QF0A 3LV6A 2TMDA 1XKYA 3N2XA 2R91A 3G1XA 3H53A 2PRLA 2XN0A 3R89A 3P74A 1W1ZA 1DHPA 3B05A 5CPMA 1JQXA 3R13A 4G1KA 5HINA 2X1TA 4JTGA 4JTUA 4S1FA 1LOQA 5K4XA 1YPIA 1HUVA 2WNQA 1M6JA 3G24A 5FF4A 5AYXA 4YCPA 5D33A 2G96A 4POCA 5D2VA 4K7VA 3I7QA 3UWQA 2ALDA 1O5KA 3WJYA 3W7IA 3TSMA 2WSRA 2BSLA 3EWZA 3PB2A 3MO7A 1Z42A 4DPPA 1W0MA 3UD6A 1GOXA 5D09A 2JK2A 5LNWA 1B57A 1P4CA 1YXYA 2CLMA 3SR7A 4AXKA 3W7QA 2V82A 1FY6A 3ABQA 3HG2A 1W37A 3L68A 3KRSA 1F74A 5AHLA 1EB3A 2E6FA 1B3OA 2R94A 3LCGA 1RD5A 1SW3A 4QAIA 2HS8A 4AWUA 4O13A 2A5HA 2R14A 4GFSA 3H55A 3A21A 1KFKA 3GDRA 4WY0B 3T7VA 4MVAA 1O4UA 2A7RA 3W7JA 4NJJA 3LCXA 1K8XA 1FDYA 1SU5A 2C13A 3BARA 1P5BA 1QR7A 3B03A 3GKAA 3M41A 7TIMA 1ZFJA 2E6DA 5DLCA 4K7YA 5ABTA 4QITA 2QF7A 2NWSA 4Q32A 2Y7DA 4Z08A 5LNVA 2E09A 3TV8A 5DXYA 1KM6A 3C2FA 4RZ6A 1BWKA 2GVLA 4JTHA 3LGEA 1KM2A 3TCEA 3P81A 4FNTA 3KVKA 4QIUA 2QAPA 3M9YA 3GNDA 1SO6A 4JTSA 3PR2A 1JJKA 3PF3A 5D38A 2NX3A 1SO4A 1F6PA 2ZRYA 3EEGA 5F2LA 4XKYB 3N19B 3CQ0A 4DF2A 3C2RA 4H4IA 3USBA 1NF7A 2V2DA 2FDSA 3DHDA 1G7UA 1JCLA 4ZQCA 1VLIA 3KOFA 3UXDA 3HBLA 3B06A 3LI0A 2OCZA 2OT0A 3GDLA 4CNPA 3IVTA 3CU2A 5F4XA 1SSGA 5DCDA 4OE7A 1XBXA 1SUXA 3I65A 5C5YA 4Y9AA 5G1TA 1H51A 5SWUA 2BTMA 3C3NA 4HNUA 1FUYA 2Y88A 4K39A 2WNNA 1YTKA 3TA6A 1WYIA 4IOTA 4LV4A 2B7QA 4E2BA 3U8GA 3M47A 1R2SA 1ZAIA 1B4EA 1MEIA 3PULA 3VE7A 4UIOA 2EAWA 5HNRA 3LOTA 1QPRA 1R2TA 3CIWA 5EMUA 1QMLA 1H1YA 2QUTA 4TU1A 3TMQA 3KHJA 2QUUA 2QAFA 1GVQA 3N9SA 3MI2A 2ZBTA 2HS6A 1J5TA 4JTIA 3PSVA 4CQ8A 2RDTA 2V0TA 3L21A 3THQA 3HO8A 1T99A 1H7XA 1AW1A 1KFEA 2YXGA 1SZEA 1GVSA 4O16A 3P8IA 4C1LA 3L65A 2ISSA 3MWAA 4XBSA 5KZEA 1CX9A 1PHWA 2V5LA 3B0PA 3UWYA 3W1MA 1W5MA 3NZ1A 5DY3A 3PSWA 3NR0A 3G1SA 3NQMA 4JY9A 4PL2A 3W88A 3TW6A 1TPVA 2PURA 2NLIA 4MPQA 5KTLA 4ALDA 2BZNA 1JULA 5AB3A 2WSYA 1EA0A 2DZUA 4PH6A 3R5EA 3R12A 2B7PA 4BI6A 4GBUA 4NUWA 3W86A 1XL9A 4Y8FA 5LNUA 4XTIA 1TTQA 1N55A 3TFXA 2GQ8A 4MKNA 1W31A 3HPXA 2YFNA 2VFIA 1A5AA 3HGOA 2NX9A 2I9EA 3N2MA 3STEA 4N6EA 4BWLA 4IX0A 3G0SA 4MY9A 1LLWA 4E2DA 1S5VA 1O5XA 3M5ZA 4GUGA 4UMAA 3MMTA 4LU0A 2GQAA 4FX8A 2FFCA 4FHAA 1TPH1 4TR9A 3TMLA 1V7YA 2V30A 3W73A 4MZYA 3QRHA 2AGKA 3BV4A 1IIGA 3NPUA 1H5YA 3C56A 1KM0A 1VCVA 4KKXA 4ZMGA 4A2SA 5G2WA 4JEQA 2H3DA 2V8ZA 5HR6A 3NDOA 3ANYA 3KVMA 3VKJA 4O10A 1UUOA 4R34A 2FPTA 3W84A 4I9AA 1JRBA 1EUNA 5F1VA 1OFBA 3FKKA 3PY2A 1KV5A 3LTSA 4GUFA 4DPQA 1XDLA 1OG0A 3MYOA 3G18A 5CSSA 3W71A 4PA8A 4JGDA 4ZQPA 5DCEA 4OWGA 3EKLA 5C54A 3CTLA 1SZFA 3QMSA 5FEPA 4JD4A 5DXXA 3GXPA 1WV2A 1UCWA 5BRBA 5EPDA 2Z6IA 3OA3A 5AYZA 3T55A 3TQ0A 4AWSA 3QZEA 3I7RA 1E51A 4QSHA 3THAA 3TE9A 4BWLC 4UTWA 3O1NA 4IXXA 2QCHA 3W23A 3RU6A 3BG5A 4KFPA 1ME8A 3GDKA 4O12A 1DJNA 3BG9A 1F6KA 3GLCA 3LERA 3P82A 1LCOA 4RCXA 3L9CA 4LVFA 3TKFA 2CU0A 4N02A 3V1PA 1RQBA 1RVGA 3W2KA 1EX5A 4N4QA 3QW4B 3T44A 5I3IA 1JRCA 4FX7A 5LNSA 1FDJA 3LX9A 2NV2A 3S6DA 1IXPA 1TREA 4ORIA 1K7FA 3CPRA 2ZRWA 5AC7A 2RH9A 3PS7A 3O63A 3PUDA 4PCFA 1VYRA 4Y90A 3WJZA 5D02A 3PBUA 3UPWA 3IEBA 4AWTA 3GXTA 1QO2A 2OZ0A 1I4NA 4AHPA 4MLRA 1AL8A 2JKEA 4RLIA 5H91A 3C61A 1GJPA 3FLUA 2QCEA 1I8JA 4JYEA 4K36A 1X6UA 3NL2A 4JDYA 1XI3A 1SZNA 3EXTA 3TJLA 5MHBA 4MZ1A 2Y7EA 2Y70A 5G1YA 3IGUA 3L0KA 2QCNA 3HGRA 3IIPA 4JIQA 3S1XA 1AL7A 4MYXA 4RX0A 2PRMA 1U83A 2QDGA 4UTWC 4MUZA 3PAJA 4RXFA 4ADTA 1B4KA 2V5BA 2B7NA 5K4ZA 1VHNA 1RR2A 3W1XA 1H7PA 3A5VA 2DJLA 1M5WA 3DZ1A 1VC4A 1FXPA 4JX4A 4TMBA 1OFDA 4OHQA 2ATSA 1KTCA 4O53A 4ZL1A 3M5YA 3O16A 3HGJA 2G97A 1TPFA 3ZWTA 4UTLA 2VFDA 4JTEA 1G4SA 1QPQA 1QWGA 3HG4A 4UTTC 4CQ9A 4UNKA 2TPSA 2X30A 3TH6A 4UMBA 3MUXA 1LBMA 5K2ZA 1SPQA 3PBWA 1Q3NA 4HPXA 5L6UA 1OX4B 2BLEA 3DFTA 4FXRA 3B04A 5BMWA 4NXKA 3HGSA 1FWTA 1RQEA 2ZYFA 3FFSA 4RZ5A 2X16A 1DVJA 1OFPA 3A24A 3N9RA 3TC6A 3TFCA 4AMAA 3HG5A 1F73A 1P0NA 1OX5A 1R47A 3QSTA 2BX7A 2XFWA 5FF2A 1WOAA 4LOCA 4Z0JA 5C2XA 3NQ8A 1FXQA 3NA8A 2EF9A 4K8EA 4LS2A 4O18A 4R33A 3KXQA 2LLEA 3EWYA 5K7JA 2TRSA 3SIZA 3LDVA 1SW0A 3WJXA 1QPNA 3A5FA 4YWIA 4LVBA 4Y96A 3UY7A 5KZDA 3E9AA 3QC3A 4FNUA 4XTDA 2E5CA 4N2YA 4UR8A 4J9JA 4PODA 1TJRA 1MSSA 3DBPA 1DORA 1ML1A 4K37A 5HULA 1H7RA 1TTPA 3SY5A 1FWSA 2Z2UA 1JCJA 3C0JA 4WJEA 4X2RA 3W7KA 3DKLA 4C1KA 3AO0A 3IV3A 3F4WA 3TAKA 3STFA 1NVMA 1ZAHA 2FLIA 3LB0A 5HWMA 1PL9A 2A4AA 1K7EA 1XUUA 1FWWA 4GJ1A 2BXVA 2ZRXA 4BK9A 1LBLA 4ZQRA 3TNOA 5GVJA 5D03A 2R8WA 4JNMA 3MP4A 2J27A 3FA5A 2CLKA 4MJMA 3NNTA 3EX6A 3N3MA 1N8FA 3HPSA 2QEZA 4UTJA 2ISWA 2PE4A 3DAQA 3Q58A 1RQHA 1XXXA 1EPXA 3UWVA 4JDBA 1VHCA 4MY1A 1SW7A 3P62A 3TW7A 2YSWA 2C18A 2DZWA 2VFGA 4ICNA 5D32A 3NL3A 2QKFA 3G22A 1JUKA 3L66A 2V9DA 2RFGA 3FS2A 2CLFA 3N34A 4E0CA 4TMCA 4JYDA 3LTPA 2YCEA 3GR7A 3A22A 3M6YA 2ZZ1A 5KZMA 3GAKA 5HMSA 1BWLA 4ONVA 3EX1A 1F7BA 1ICSA 5FESA 1JUEA 1TTIA 3BW4A 2DU2A 2FTPA 3SFKA 4HNTA 5C55A 4LWWA 1R2RA 2UV8G 4N9DA 5CGQA 3DFNA 3DU0A 3TXZA 3G0UA 3IVSA 3QJAA 3G1VA 3NYZA 3STCA 5FF0A 1IXNA 3W1PA 3ZWSA 3JR2A 3TSBA 5IBXA 4HSNA 2CLEA 5FEXA 1HL2A 1QCWA 4JIPA 1TQJA 4NNCA 4ZQNA 2XN2A 5F4SA 3CB8A 1TJPA 1FBAA 1K7XA 1IF2A 4K8HA 5AOUA 2VKZG 5FF3A 3G1AA 4DO5A 1K3UA 3KVJA 5HWNA 2VC6A 2GUUA 4DF1A 2ZFAA 1OJXA 1A5BA 3L2IA 2WKJA 3W1AA 3T40A 3KX6A 4JX5A 4OQVA 2ABBA 2NX1A 5KINA 1OF8A 4XQ6A 3SW6A 1UB3A 2Y62A 3R2GA 4X9SA 1W54A 1X1ZA 2IQTA 4S2BA 1FDZA 4LC6A 4OT7A 4AVFA 5HQEA 1Z48A 5DBUA 4PL1A 3NQAA 3HIJA 3RMJA 4UTHA 5E0KA 3C6CA 2HMCA 5DY2A 2ISVA 1KM3A 3QMTA 5LZLA 5CPOA 3EWUA 4HNNA 2DP3A 4Z1CA 1YXDA 3W2NA 1WBHA 3BLIA 3LHZA 1GTHA 3M5XA 3F4NA 3P80A 1SO5A 2QJHA 1LDCA 1HO1A 3P8JA 5CPLA 2A0NA 2QCMA 4OU1A 4DEFA 1RZMA 2E77A 1D3HA 3NM1A 2NXGA 3OEXA 4AAJA 2ZDRA 4M6PA 3IRDA 3B0UX 2WSQA 5I3FA 2QCGA 1PIIA 2GPTA 4O14A 5AN7A 3RNDA 5H2ZA 1ME7A 2WO5A 1QAPA 1G67A 2Z6JA 4ADUA 3PBYA 4EOUA 3W1UA 1Q6QA 2E6YA 1KA9F 1LYXA 4JN6A 1GYLA 4JTJA 5IBXC 5HR7A 4XKYA 3W2LA 4O0ZA 1JCMP 1CW2A 5CPNA 3BLFA 2NV1A 3S5ZA 1SZGA 3G3MA 3QH2A 1W3TA 1Z44A 1FWNA 3M1ZA 4M7SA 3IVUA 4NNAA 3UNDA 3UXAA 4GE8A 2RDUA 1F2JA 4IMGA 2J9YA 3GZ3A 3LHWA 4ADSA 3QM3A 1LRTA 4O1BA 4BR1A 3BG3A 4MYAA 3E0IA 3PC0A 3UPBA 4MY8A 2FJKA 3M0ZA 1DOSA 3A23A 4D2JA 1WA3A 1JR1A 4GC4A 1QDSA 5EL1A 2Z0IA 4LUJA 1XCFA 4UFLA 5D37A 3LBCA 4LRTA 4A3UA 3F1QA 4FF7A 3LI1A 2DZPA 4NZJA 4NX5A 3UZJA 1ME9A 2H3BA 1QOQA 1YPFA 1V5XA 3SECA 5E1QA 1NSJA 3FYOA 1ZNNA 4M6QA 2E5BA 1S5WA 2JKPA 5CZ0A 3HB9A 1C29A 4IPIA 1JQVA 3NPXA 3PUOA 3DFQA 2O7SA 1ZY9A 1XBVA 4XUGA 4H6KA 3AJXA 2OT1A 3O06A 3UWWA 3JRKA 1YYAA 2XN1A 2JGYA 5LGXA 3CM4A 1OFOA 3GVGA 3LXAA 2ZQ0A 2ZRVA 3CIXA 3MP3A 3O6YX 4IQLA 1FCUA 5CSRA 1CI1A 3PM6A 3NQ7A 2QJGA 3G0XA 1ALDA 2CLOA 5LHFA 1W5QA 1JCXA 4HKPA 3HQ1A 1G69A 3P67A 2EKCA 3DFOA 1L6SA 1T0OA 1EWDA 1I45A 1AK5A 1AW5A 4LNYA 1XBZA 4DF0A 3HMJG 3DENA 1SFJA 3UWUA 2NUWA 1WX0A 1TTJA 1WXJA 4HN4A 2J6XA 3UWZA 1I2PA 4NVTA 2ABAA 1OYAA 2B4GA 2W0UA 5G4WA 2GQ9A 1Y0EA 3NO5A 3FJLA 4O54A 3W7PA 2OMAA 1B9BA 2HTMA 1R46A 3I6RA 4X3ZA 5U7SA 4IMEA 4XWUA 3W7LA 4UCGA 2H6RA 2ZA3A 4JX6A 1F05A 2ZZ3A 3HF3A 2CZFA 4NU7A 4KFNA 2QUVA 2I1OA 3BVJA 4QJ1A 1F76A 1VH7A 5DCBA 4HSOA 2ZRZA 3MI3A 4AHQA 1D3GA 1H60A 1XFBA 3W72A 2C14A 1N7KA 4TO8A 3HOJA 4M7TA 1TRDA 3ZS4A 3P61A 3GXNA 4L4MA 1YDNA 2VFEA 5TIMA 3IIZA 4OBTA 2C19A 1G4TA 2RKXA 1IXQA 4ZZ9A 2WPBA 3MP5A 4NXSA 3TIMA 3W7CA 3W1TA 4CLMA 2RDWA 4LRSA 4JR5A 3D0CA 2A6LA 1MEHA 3PWAA 4I7UA 4WOQA 4LT9A 3ABRA 1VLWA 2DJXA 4LVAA 3LRKA 4Q33A 3TK7A 4NT0A 2QJIA 2D73A 3Q2DA 1S5TA 4JTKA 2WOQA 2Y7GA 3IIXA 1KFCA 1QPOA 2E5DA 5EA9A 1FX6A 1WAUA 4MLJA 2YR1A 5CKSA 3RK8A 1ZALA 1XC4A 4CNOA 1ZENA 3GK0A 1I2OA 3HG3A 1EP1A 1TQXA 2ZTJA 2EHHA 2RHGA 4UC5A 1H1ZA 4A29A 3QQ0A 3TU9A 4I7WA 4IJBA 2PC4A 3DI0A 1DQWA 4O1AA 5AYYA 2H8XA 4N4PA 3MI6A 5D2XA 2EGZA 4K6AA 3ZR4A 3GNNA 2Y7FA 1VYPX 2PCQA 3PVFA 1VZWA 4YMZA 1SQ7A 4AF0A 4IMFA 3NEVA 4FNRA 2OX1A 4MFDA 4Q4KA 1VYSX 3B4UA 1VJIA 1KLYA 4MZ8A 1ZHAA 4O4WA 1C8VA 2CLIA 4N9CA 1U5JA 1NAL1 4EF8A 5BMXA 4KWVA 1KBJA 4O8RA 3O07A 1Q45A 3BO9A 4N9EA 4ZQOA 4RV8A 1Q6OA 2J24A 3IGSA 4HHPA 1TPUA 3C2EA 4CQAA 3G1FA 1ICQA 2JKAA 3OVQA 4OV9A 4IMDA 3INPA 3MYPA 1UJPA 3W1NA 1W5OA 1KTBA 3P60A 3S8HA 1OYCA 3LHYA 4GWEA 1EP2A 3GB6A 5AC8A 5T26A 5I3GA 4JTLA 1I2QA 1KM4A 4FNSA 2VEKA 5J5RA 1W3IA 2QCDB 4UNLA 1FCBA 2DZTA 1OFRA 4O4VA 3BW2A 3C4UA 3GDMA 1FCQA 1JUBA 2WNZA 5BNKA 1WBJA 2GVJA 3C2VA 1LOLA 3M5VA 3N14A 1L6WA 5DN1A 2NWRA 3GX9A 5AHIA 2Y6ZA 3G8EA 3S5NA 1OFQA 1YDVA 2B0MA 1W56A 3DKJA 2Y63A 3LRMA 1KW1A 3QMRA 4UFIA 2O7QA 3L0NA 4KWWA 2YZRA 2NUYA 3FIGA 1BTMA 3W07A 2A21A 3NQFA 4OV4A 4NZFA 1RPXA 3LXBA 4S2CA 1PCKA 3OHIA 2P1FA 3BW3A 4M5PA 4WD0A 3EX2A 2PRHA 3GAYA 4MJZA 5A8GA 4UTMA 1SSDA 1VQTA 3LTYA 1LTDA 4UFMA 3LCFA 3CT7A 4PEKA 1WQ5A 4Z1BA 4HPJA 2FPVA 3LLDA 5F2MA 3EXRA 3EX4A 5HUOA 3TAOA 2A6NA 1QFEA 4DO4A 2OJPA 3NQEA 3VE9A 1A53A 2CZ5A 3E12A 1GT8A 3IGXA 5K9XA 3GR8A 1LBFA 3TC7A 1KTNA 5K9DA 4RKAA 3KVLA 3CEUA 4NJGA 3G3DA 4FB7A 4DXVA 3ABOA 3BPWA 4EF9A 1LM1A 4EIVA 4EWND 3F03K 3SJ3A 3O05A 3VFLA 1QNVA 3CC1A 1H7NA 4KFOA 4LW7A 1KLZA 2YYTA 2H8ZA 3PG9A 2EPHA 3RLUA 3WJSA 1SO3A 5BW6A 2W6RA 4DO6A 2TSYA 2KZHA 3KRZA 4EVZA 1UBSA 1DJQA 1AG1O 2W79A 3FYPA 3VCRA 4Z1AA 3G1DA 1FCVA 4CNNA 1KFBA 3DH7A 3P7YA 1H63A 3BGJA 3W7NA 4DELA 3NG3A 2X1UA 5AHFA 2GJLA 2JBMA 2YPIA 2YX0A 1IIHA 3MHUA 5D2TA 2B7OA 2H90A 3JS3A 4WXYA 5G4EA 3RLVA 4A21A 3NGJA 4DBDA 2DZXA 2ZZ4A 2QR6A 1ONRA 1M7OA 1LLZA 2Z1BA 3NVTA 3QQ1A 1GPWA 3NXFA 3ATYA 2DZSA 3NZRA 4M19A 4QISA 1FQ0A 3I7SA 3LXCA 4L4LA 4JICA 4IUOA 3M43A 4GRSA 3RFAA 3W2MA 3Q94A 3L5MA 3W2UA 2WJZA 1AW2A 1I2NA 4UTKA 3GYEA 1R30A 1G4EA 4HT3A 1TPC1 5TQLA 1ZCOA 1OX6A 1OVDA 3OIXA 1AMKA 2C3ZA 2X1RA 3EWWA 4NJKA 4FXSA 3K30A 3QYQA 2DORA 4M6VA 4XZ9A 3H54A 4O17A 3T4CA 1EEPA 2GOUA 4ML9A 2CWNA 4JYFA 1LORA 3NQGA 5D2YA 3LCLA 4O52A 4IPJA 3W7MA 3GKFA 2A7NA 4PC8A 1PHQA 1DL3A 2GJNA 3CWNA 3SI9A 1TRIA 1SR9A 2ZCGA 1J2WA 4XBKA 2V81A 2A2IA 2VEIA 3WK0A 1FWRA 5TBOA 2ZZ5A 3T78A 2CW6A 1LRNA 2YW4A 1YXCA 3EXSA 3LHTA 1OYBA 1P1XA 1VPXA 5IM51 3SZ8A 2X1SA 4X22A 4WY0A 4E38A 3L5AA 3TQVA 3U2OA 1VGAA 4GUJA 4LVGA 3LHUA 1SFLA 3DGRA 4ZQMA 3NPVA 5EBUA 3HPZA 2YYUA 4YCOA 5EY5A 2QDHA 3LBMA 3W7HA 4NJIA 1EIXA 3V75A 1Q6RA 3WFAA 3NQ6A 1JCYA 1LZOA 2C0AA 5AHEA 1KM5A 4O57A 5L9FA 1KFLA 2HSAA 3KAOA 3KRUA 3YPIA 2F84A 1TV7A 3SGUA 4UMCA 2VOMA 3P5ZA 1THFD 2Q8ZA 1L6YA 4CCEA 1X1OA 1OHLA 3W7DA 3DHFA 3TROA 1GWJA 3W3OA 2NZLA 2Q3RA 1DV7A 4QQ3A 1EWEA 2P10A 1L9WA 1GZGA 2NXHA 5D2WA 3WJWA 5D30A 3LV5A 4LC8A 3NOEA 3DFPA 4UFHA 4RXGA
chains in the Genus database with same CATH superfamily
3ITYA 1XLFA 7REQB 3W1QA 1XICA 2C79A 2HE8A 3VA8A 1JVNA 3R94A 1KM1A 4PTNA 1O95A 4WQ6A 2GSJA 3TR9A 3LCIA 1XGEA 3BMVA 4DXXA 2YB1A 4LQ1A 3DBNA 2IXUA 3CYJA 3TXVA 1F8MA 4I5XA 1IXOA 4ACZA 3UQNA 2OKOA 4EXBA 5BU9A 1MXDA 5LHEA 5DMMA 2Q02A 2PA6A 2VVNA 3TNBA 1W91A 2VMFA 3MSRA 4FO4A 2ATMA 3GH5A 2WVUA 4MG4A 1OFAA 1JCNA 2REQB 2QHAA 1TB3A 1LG1A 3W7GA 4AZIA 3B0VC 1W2VA 4PSRA 1LQAA 2OODA 1DWJM 3O6CA 2BVDA 4E2VA 4LNCA 5AVHA 3B0YA 4AYSA 3Q37A 3MHFA 1WZLA 4CVWA 4O28A 2PDNA 5J04A 1PCWA 1SMDA 2IXVA 3AZSA 1YTDA 3GBDA 1MRAA 4JIRA 4XAZA 1F8IA 2OQLA 3ES7A 4WOZA 1TKKA 3EX3A 1DE5A 1H61A 2J47A 4ICCX 2YBTA 1KB3A 4DJFD 4HHLA 3PB0A 1G6CA 4LUSB 2OYMA 2I16A 3BK0A 3DN5A 1J96A 1HKIA 2C1IA 1R3QA 1A5CA 2FMOA 1IR2A 3OW1A 2WHKA 4FLSA 1PIFA 3VNMA 5EFDA 1CXHA 3SUTA 1AUSL 3S1WA 2ODOA 5BCAA 4DRSA 4QCEA 4QM1A 3OG2A 4X63A 3HQNA 5PTDA 3OLDA 4FLQA 3W0KA 3NL6A 3CL6A 4F0LA 5E93A 1W1TA 3JW7A 5F4WA 3N15A 3VNLA 4TIMA 4DJDA 5HWJA 1CLVA 3BV7A 1JG9A 2VRJA 3L2LA 2V2CA 3FJ6A 2I14A 3IIVA 1QK0A 4PMVA 3W22A 4KCUA 3KBMA 4V1YA 3R8RA 3MDWA 1YBQA 1T8XA 2EPNA 1K1DA 5J5DA 2HBXA 1JDDA 1HJVA 3TQKA 2WKLA 1MNSA 3HPAA 4QTGA 3UYIA 3WK2A 3W28A 4I9TA 3N3TA 1EUAA 4FMVA 3UZYA 4LS0A 1P43A 1X8FA 2EXOA 3LU2A 2XIIA 3M0XA 3QFEA 5ABFA 3P84A 2O56A 4PRWA 4IQDA 4XD4A 3RPMA 1XBYA 2VELA 4DBEA 1KFJA 4MFEA 1CGUA 1R9ZA 1M53A 1X7FA 4LTSA 3AWNA 1ADDA 1NFBA 4DWSB 4IMCA 1BAGA 2PDPA 4DJDC 1H62A 3OVRA 5BOOA 3I3DA 4LUIA 1H3GA 4M80A 4V1XA 3R8HA 5LKYA 1F3TA 1TO3A 1FH8A 1JGIA 3EOLA 1E6RA 3ABSA 1GNXA 3NDZA 4AZ6A 4W88A 3BJFA 2WKGA 1XD0A 1W3NA 4Z2IA 3KM8A 4J40A 3BWWA 2FHCA 4JN7A 4YYFA 4AG0A 4S39A 4WSKA 3EWBX 2XDFA 3ZJ6A 4J28A 3WF1A 1EP3A 3G2GA 4DZ5A 4DM2A 3MA8A 2J9ZA 1F6YA 1M3UA 3U3HA 4IP7A 5A8QA 3BAJA 3WQFA 4H7ZA 3KE0A 3C0LA 3PP7A 1TCDA 3PZNA 1CLKA 4O50A 5A2BA 4RR4A 4Q4MA 4B5SA 3VM7A 2QCDA 4UNIA 2DH2A 2QCLA 2E7FA 2WPGA 1GVFA 2YDAA 1RP8A 4FXJA 3GIYA 1QU4A 3GHUA 1VBUA 5DBTA 4YXGA 3RO8A 4GKTA 3W85A 2QCFA 2ZXBA 3TTOA 2G0WA 4O0KA 4AZCA 2FVKA 2ZX7A 1E6NA 1PYFA 2EPLX 4F66A 4WXZA 3H2EA 3M44A 1AZ2A 1PDZA 3S5YA 5CSUA 5MKGA 2E4TA 3VGHA 4PUNA 1EJVC 1G7VA 3C2OA 4UR7A 3DC0A 4IP4A 4GXMA 1V4YA 3MBFA 5C70A 4U5KA 3W6YA 3WD4A 3ZLFA 3KZPA 2Z28A 3LRLA 2DSZA 2Y2WA 1VFFA 2XFFA 1WZMA 3RF9A 3TEVA 3B9DA 1MO0A 5C8BB 1KGXA 3MO4A 1MXSA 3IJDA 5RUBA 1NTHA 3QPYA 4RZBA 2E40A 5FEWA 3NL5A 2ZZ7A 5KITA 3VDBA 3CHVA 2Q09A 4HK6A 1NDZA 4RZ4A 4AB4A 1IEXA 2OO6A 3BLOA 4NX0A 3WBXA 1M04A 1HJXA 5C6MA 4QE4A 2DVUA 4P7LA 3STGA 3VGDA 1EGMA 2IKJA 1P1MA 1GHRA 3I4EA 3CQKA 2D2HA 2OWWA 8CGTA 1LUCA 5CLWA 2W4XA 2F7FA 4H9UA 2WB5A 3WQDA 4MUPA 2V2HA 5FF7A 4JY8A 3LENA 4GLEA 3FKRA 4LV9A 2VENA 3O15A 1REQA 2DT2A 1GTEA 2VZUA 1RJQA 4RJEA 1IT7A 2SFPA 5T91A 5AECA 2HROA 1A4MA 1XKYA 1S39A 4NZ1A 2XN0A 3SUUA 3L4XA 1UR1A 4UB9A 5CPMA 4DVOA 3ITLA 3R13A 1DWHM 4PUWA 2YLAA 4DI8A 3WQWA 2UY3A 3PWGA 4F0RA 1N8WA 3E0LA 1HUVA 5AYXA 5I06A 1SYTA 2G96A 5D2VA 2GGIA 3UWQA 2ALDA 2BSLA 3EWZA 3LSCA 4DPPA 2I57A 1W0MA 3UD6A 1GOXA 5D09A 5AY7A 2I9UA 2EO7A 3D3AA 3SR7A 3WBAA 1FY6A 5HQLA 4S3FA 3HG2A 3L68A 1F74A 2E6FA 4NP7A 1B3OA 3LCGA 3TTEA 1ITQA 1OT2A 2Z2BA 2NT1A 3BOLA 2VZSA 3A21A 1KFKA 1LF1A 5HXMA 4NZ4A 2GGEA 4JBRA 2PDYA 1HT6A 5ECUA 3BOFA 2A7RA 4NJJA 1K8XA 1VB9A 1NJJA 6REQB 4S3BA 2D0FA 1JZ5A 4GKLA 4C6NA 3N4EA 1DYSA 1ZUAX 4K7YA 5ABTA 3AHTA 5ECVA 2Y7DA 4Z08A 4Q7NA 1CNVA 3TV8A 2FZ9A 5DXYA 2Y5SA 2GVLA 1KM2A 1A5LC 3D47A 3P81A 3KVKA 4QXIA 3M9YA 3VKCA 3GNDA 1DTNA 1SO6A 4JTSA 2HDJA 3SUVA 3TYBA 1TWZA 2RGLA 2ZRYA 3EEGA 3LUTA 3N19B 2WMIA 2XVLA 3CQ0A 3H22A 4DF2A 1NF7A 1RAKA 3QFWA 3DDMA 2FDSA 3APGA 3KOFA 3HBLA 5D9MA 2OLSA 3ZJKA 2ZX5A 4CNPA 3IVTA 3BAKA 4ZODA 4AY1A 1UMYA 2VCBA 2IQ0A 3THCA 3WELA 5G1TA 1H51A 5LXEA 1FUYA 1OM0A 1UWQA 4K39A 2WNNA 3TA6A 3P14A 2I5GA 4J3WA 2X05A 4G6CA 4XZLX 4ML4A 1ZAIA 1MEIA 4IG2B 3AMGA 4KEUA 2O9PA 2D0GA 2WZEA 1QMLA 4JFSA 1GVQA 3N9SA 3MI2A 4YTTA 2ZBTA 2HS6A 4JTIA 3WUEA 3L21A 3PK7A 3HO8A 3S2LA 2QIIA 1GVSA 5AZ0A 5J8LA 2GUBA 3GFYA 3PZOA 2ISSA 3MWAA 4XBSA 3AUOA 1KRCC 1CX9A 2V5LA 3AALA 3UWYA 3ITGA 4NRRA 3W1MA 1IWPA 5FAGA 1V7AA 3WQ5A 3AQUA 3S2CA 3UR7A 4BCEA 3NQMA 4JY9A 3W88A 2PURA 5KTLA 2GZXA 1KXQA 4DJFA 4N7QA 1EA0A 1TG7A 3R5EA 5XIMA 1CB2A 4GBUA 1A3HA 5LNUA 1TVLA 1TTQA 3TFXA 2GQ8A 5EBAA 1XDJA 1C3FA 3HPXA 2YFNA 4V15A 2GK1B 1V6XA 4HNOA 2IPJA 3E5PA 4PEEA 1SM9A 4PMOA 4YYCA 3G0SA 3IJ8A 2PWEA 1LLWA 3GFZA 3UR5A 3CH9A 3MMTA 4PGLA 3VILA 3KBWA 5FSEC 2VGGA 3AYVA 1V7YA 3RXZA 5BWFA 3GQYA 4GCXA 3NPUA 1XLJA 3QBUA 1V3HA 1XIBA 2VWSA 1VCVA 4KKXA 3R0DA 1YQ2A 2H3DA 3MANA 2YIHA 4TXEA 5A8PA 1NM9A 3RMEA 4TTUA 1UUOA 2VHLA 1JRBA 4GVGA 1EUNA 4J27A 3UF9A 1OFBA 1UKQA 4JHOA 1KV5A 5DANA 1ZJHA 1NY1A 1XX1A 1U2YA 5FA5A 1DXFA 1EYEA 4XK2A 1IEVA 4DJFC 3NWRA 4PA8A 4ZQPA 1FOBA 2PU1A 3EKLA 3U4FA 1SZFA 3QMSA 3GU2A 4GI4A 3W6MA 1S1PA 1P0BA 4C91A 2WJEA 3V0TA 3REQA 3T55A 3TQ0A 4AWSA 3VKBA 1HZYA 1RA5A 3Q4DA 2BVWA 3IACA 1XH0A 3GRIA 1V02A 1QW7A 4IXXA 1KC7A 3MC5A 5GJPA 3WLKX 3DCPA 3L9CA 3ME3A 1RCQA 2P8CA 2I5QA 4RDYA 3DFHA 3LYEA 3F4VA 3NXLA 2PTZA 5LNSA 4GZ7A 4IIEA 4TX8A 3A4AA 4J3TA 1AJZA 3LQLA 1FDJA 4ORIA 1K7FA 3CPRA 1J0IA 3U2CA 1RBLA 3PUDA 2YB4A 3H2MA 3GTNA 3AS3A 2FH8A 4Y90A 1CGTA 5D02A 1J9YA 2BNJA 3O0FA 4AWTA 3GXTA 1IHIA 1QO2A 2OZ0A 1E3ZA 4AHPA 4MLRA 4M81A 1QK2A 2JKEA 4RLIA 2XSBA 2ZUNA 5HNUA 4JDYA 1XI3A 1SZNA 2D1ZA 1CCWB 3SB0A 2AQOA 2Y8VA 5G1YA 3L0KA 1E9ZB 1FWCC 3N18A 4NASA 4JIQA 2OKTA 5C9ZA 3PFMA 4RX0A 4R88A 4L1GA 1U83A 5HATA 1QI0A 4RXFA 1HGYA 1PDYA 4QDMA 2V5BA 2B7NA 4CD6A 1JZ6A 3W1XA 2VDIA 1H7PA 3RITA 3OQEA 3WMBA 4JQAA 1M5WA 1J0ZA 3EMCA 3BCFA 2PSNA 3LM3A 3RCMA 3VXGA 1V51A 1M7XA 2CETA 4JN8A 2EG6A 3ZWTA 4UTLA 4KCWA 3CZGA 2W62A 1QNOA 1VAHA 5KZ6A 3MVIA 4IIFA 4GVHA 2OGYA 3PBWA 5JQ9A 1Q3NA 3Q67A 2V6AA 2PF0A 1ZBWA 3ARWA 2FDMA 4QBXA 1RQEA 2ZYFA 2PWHA 3FFSA 8XIMA 1TE6A 4MMWA 2X16A 1DVJA 1OFPA 3TFCA 3TTSA 2BX7A 5FF2A 2YDSA 1WOAA 1G5AA 3SRDA 4LOCA 1GW1A 3NQ8A 1TWWA 3NA8A 2EG7A 3KXQA 2VX4A 4ZA0A 1B9ZA 4GK8A 1JPMA 3LDVA 2F61A 1SW0A 5EMJA 1QPNA 5T9CE 3RRAA 4LVBA 2G41A 4AX7A 2E5CA 1HXJA 4HCLA 1ENUA 1PWLA 1EBGA 2PLKA 4PODA 1D8CA 4Y8EA 4B4FA 1DORA 1UPMB 1GVEA 1KRBC 1TTPA 3E2SA 3UCQA 4KRZA 3IANA 3OGSA 2Z2UA 4AEEA 1TCMA 4O1FA 2J8GA 3DKLA 4C1KA 1MFUA 3AO0A 3F4WA 3TAKA 5FSDC 2FLIA 3F7JA 5FOOA 1PL9A 3BUVA 2CXEA 2BGQA 3T0TA 1K7EA 1XUUA 1LUCB 1EIBA 1OD8A 5GNXA 1Q13A 4ZQRA 5D03A 1E55A 4E4FA 1TX0A 1GGOA 1PX3A 4KF1A 4MJMA 1US3A 1CTNA 3B8TA 2ISWA 1PX4A 4U33A 3TYDA 4DM1A 3AMCA 2XSAA 3ZMRA 4LUTB 4AVOA 4JQ4A 1I6NA 2O9TA 3U4AA 1EGZA 2YSWA 2QF8A 2C18A 2DZWA 5D32A 3WQEA 2ZC8A 2V9DA 4HOXA 2QDDA 4B5VA 3ZJ8A 3GAKA 1TVNA 1M1BA 2ZUVA 1ISZA 2CEQA 1VIWA 4ONVA 1EX1A 1JUEA 1CXKA 2Z29A 3RLHA 3BW4A 1XRTA 4GIYA 4ROPA 2DU2A 2VZVA 4HNTA 1K9DA 5CGQA 2POTA 1DIKA 3QJAA 3WNMA 3AXMA 1DJXA 3CGTA 3UZZA 3W1PA 4I8DA 3JR2A 4HSNA 2BMBA 4ZQNA 5I02A 3CB8A 2V5KA 1FBAA 1K7XA 1UA3A 5KETA 5A6MA 2GUUA 3M0YA 1OJXA 5FJOA 2WKJA 3W1AA 4HPGA 4KPLA 3N4FA 1EBHA 3SCNA 5KINA 1UB3A 2CITA 2OTDA 1YNPA 3JU2A 4LC6A 4AVFA 1DTUA 3NDYA 3H2CA 2GJRA 2ZXDA 3RMJA 4V2XA 5E0KA 2HMCA 5DY2A 1FH7A 3FXYA 2VWTA 3DYPA 3EWUA 4LB3A 1R8LA 2PZNA 4Z1CA 2RJHA 3HU7A 3C0SA 3GHSA 4ZXOA 5GNYA 3ZXWA 1A0DA 2A0NA 4GH1A 2QCMA 1RZMA 3N6HA 2NXGA 2ZDRA 4HZMA 1H4PA 4M6PA 3IRDA 4LCSA 2QCGA 2GPTA 2OB3A 3RNDA 3WLPA 5H2ZA 1QAPA 4ADUA 3QOMA 1X6LA 1BVNP 4EOUA 4L7ZA 1O6IA 2WVTA 5EMYA 1NARA 3FDKA 1E4IA 2WLZA 4J3VA 2WBKA 3NZQA 2V68A 2VCAA 3BLFA 1WP6A 1HIZA 1SZGA 4QE5A 1Z44A 4MAVA 4D1JA 3UFYA 1HL9A 4GE8A 4ATWA 4OKDA 3EEZA 5IHRA 3RO6A 2X8RA 2CESA 4O1BA 3JUGA 4B5XA 3UPBA 4MY8A 1L8NA 1UWTA 3ARQA 3A23A 1M03A 4D2JA 3LN3A 1C8XA 4GC4A 1QDSA 5EL1A 4UFLA 1XCFA 4QROA 4LRTA 1D2KA 3HQPA 4UWMA 1LLOA 3MSYA 4AD2A 1X8CA 4E2OA 3V5FA 1YPFA 3TZFA 3SECA 1Q6FA 4AZ7A 4CQCA 4QLLA 5CZ0A 1C29A 1JQVA 2ACSA 3DFQA 3QXBA 3S3GA 3FGCB 4H6KA 3AJXA 1V6UA 3VOCA 3JRKA 3E74A 1YYAA 3CMFA 4JIHA 3VZZA 3CM4A 5REQB 2VUNA 3O7UA 3GVGA 1OBAA 3E2VA 2ZRVA 3CIXA 3CUJA 9XIAA 5CPTA 4CD7A 1XQLA 1A80A 1M68A 5LHFA 1EDTA 4ZB5A 4GGBA 3SCSA 3VO0A 4QR6A 3FVDA 3RJXA 1X1NA 1U22A 1I45A 2VEFA 1WKFA 1AW5A 1XBZA 4YTQA 3HMJG 1SFJA 3UWUA 3PJXA 1WX0A 1I2PA 2VTFA 4NVTA 2B4GA 2W0UA 2QVNA 4YTUA 1B9BA 5D9PA 1R46A 1B5TA 4KETA 1V3LA 3W7LA 1XIHA 5DT5A 1R3YA 3AYSA 2VX6A 2ZZ3A 3HF3A 2CZFA 1NFGA 2I1OA 4DO7A 5M2FX 3PANA 5CGMA 5D4YA 4HSOA 1EF3A 1SJBA 2XM2A 4TO8A 3R0KA 4PN2A 5GJNA 4M7TA 1TRDA 4AW7A 1TJ0A 3GXNA 1Q7MA 3SCPA 2VFEA 3VGBA 4OIFA 3B40A 4QP0A 2HZGA 4LEQA 3IK2A 4CNTA 4ZZ9A 2YBVA 4NXSA 3PNZA 3W7CA 4CLMA 4AISA 1UIOA 2RUSA 1QTWA 3VOIA 1U1UA 4JKKA 4I7UA 2QNEA 2EPOA 3ABRA 3NJ3A 2DJXA 4LVAA 4PUEA 3B97A 4M29A 2OSYA 2QJIA 3Q2DA 3QV6A 2O55A 3N2TA 2WOQA 4AD1A 3GS6A 1QPOA 4M56A 1FX6A 4HPNA 4WGHA 2QJNA 1RVKA 2EKGA 1F61A 3HG3A 1CGYA 1TQXA 2ZTJA 4KESA 2RHGA 1HJWA 1EOMA 4MGGA 4OJYA 4UC5A 1R9YA 1H1ZA 3TU9A 4I7WA 1B31A 1UC4A 1AH0A 1YMYA 4O1AA 1YRRA 4N4PA 2Y1HA 3WD2A 2EGZA 2F6XA 1Q66A 2PTWA 2Y7FA 1K9TA 1VYPX 1VZWA 4DX3A 3I10A 3FHAA 2OX1A 3TOPA 1E0XA 1VYSX 4TQTA 1XIIA 4Z2KA 3B4UA 1R3VA 3BC9A 1KLYA 2OZ3A 4MZ8A 5DX7A 3BL3A 3B8UA 2PGEA 4C6BA 1MUCA 4O4WA 2YA1A 4HK7A 3NSXA 1U5JA 2ZIDA 3E6EA 1XLEA 5BMXA 1SJAA 1OC7A 1Q45A 3BO9A 4N9EA 1W3JA 3O3RA 1JD9A 5IFPA 1TPUA 3C2EA 3W82A 4CQAA 1ICQA 4LX4A 1W2PA 3B0XA 2V5JA 3OTRA 3URAA 1W5OA 4CD8A 3RR1A 5T26A 5I3GA 4IIHA 1V0KA 1TE1A 2BXYA 1KM4A 3K1DA 2OYLA 3U9IA 1W3IA 3WQCA 4UNLA 1OFRA 3BW2A 1JUBA 5BNKA 2DSWA 4MB1A 4L9YA 3M5VA 2QPUA 5DN1A 3F4DA 1PJ9A 3EWDA 1OFQA 1LL6A 3DFYA 1W56A 3QV7A 2Y63A 4GGHA 5IFTA 3L0NA 3OYZA 2NUYA 3IJLA 3FIGA 1P7TB 2WW5A 3LXBA 4S2CA 1PCKA 3UVAA 2P1FA 1D7FA 2AOSA 3BW3A 4AXNA 4DBSA 3GH4A 1V0LA 4UTMA 1SSDA 3IWPA 1SVDA 3CT7A 2D0HA 4GJIA 2FPVA 5HUOA 3OLGA 4ZE5A 4XSMA 2GOKA 4MPKA 2OJPA 2YOCA 1EH9A 2D24A 2NVAA 3NQEA 3B9EA 1GT8A 2VQUA 4X61A 1ADSA 5K9XA 3GR8A 4KBXA 1LBFA 1VFSA 1KTNA 3PZUA 5K9DA 3M0IA 3CEUA 1US2A 3FK4A 2C7FA 3ABOA 3BPWA 4EF9A 1H5VA 4EIVA 3R8GA 2OWXA 2TAAA 2J7HA 1UR8A 3IUIA 3O05A 3VFLA 3CC1A 4KFOA 1KLZA 3PG9A 1NP2A 2HBVA 4WJ8A 2V3DA 1L2QA 4YHGA 3RLUA 4JEJA 4W8AA 5BW6A 1R3WA 3WH5A 3URNA 1DJQA 3MUAA 1AG1O 3FYPA 3VCRA 4L64A 3H23A 2OYKA 3P7YA 2A3CA 4YVXA 1ZQ5A 4DELA 3NG3A 5CJ5A 2Y5JA 3MJMA 4P8UA 3MHUA 1IIHA 2VI0A 1OT1A 5D2TA 2FZBA 4E8DA 4JCLA 4WGXA 3VIHA 5A6JA 1ONRA 3OZMA 3MV01 2X0YA 4FI4A 1LLZA 5I3DA 3NVTA 1WNOA 2BVTA 4GO8A 3QTGA 2FGZA 4AZGA 1XWYA 3M43A 2A3HA 1XGZA 3T4WA 1I2NA 1GOOA 3GYEA 4UTKA 1R30A 1D7KA 2QIWA 4HT3A 2WMJA 1TPC1 5TQLA 2GGJA 4KRUA 1ZCOA 4H9MA 3QHMA 1OVDA 3UXKA 1Y8BA 1AMKA 4NJKA 2X1RA 4FXSA 1R9XA 3H54A 4O17A 3T4CA 4IT1A 4QG8A 1RPKA 4O52A 3W7MA 1NH6A 4L9ZA 1ITCA 1O68A 4DXKA 3O9NA 1SR9A 4HK5A 1CXEA 2X40A 1JIBA 3T6CA 5B7ZA 3E5BA 3URBA 2EJ1A 1HQTA 2FJUB 1UOKA 4GNKB 1YXCA 3U2EA 3LHTA 1OYBA 3CQHA 3S5SA 3L5AA 1EPVA 1VGAA 1Q65A 3WH9A 1Q6DA 3LHUA 3B8VA 1OGGA 2WAGA 1GVIA 5EBUA 5EY5A 1WKDA 3MSGA 3W7HA 4O8AA 1V6TA 1XG3A 1Q6RA 3NQ6A 4J3UA 1H1NA 4W84A 3FSUA 3UCDA 5L9FA 1KFLA 3H6OA 4FR1A 1UG6A 5E9XA 3KAOA 3YPIA 1OGSA 1JI1A 5CEWA 3WH7A 1L6YA 1X7IA 1AQ0A 4EPBC 2V5CA 3TROA 1V3IA 1X39A 4GJJA 2NZLA 3FA3A 2Q3RA 2P10A 4GIRA 1VEOA 3UG8A 5D2WA 1BXBA 4AWEA 3VD7A 3WJWA 5D30A 3LV5A 4C6CA 2HQAA 1ZP4A 1XHGA 8A3HA 4JZ5A 3MU7A 4GVIA 3W37A 3VIFA 3MUCA 4C6FA 3N2BA 2YA2A 2Z7GA 5G2HA 3TDFA 4ZVJA 1S3HA 2HVNA 5EMLA 3HZ3A 4GI6A 3W1LA 2FPYA 2KX9A 4ZE4A 3RHGA 3LCHA 3GZAA 3LZ3A 3SQSA 1EHNA 4LALA 1BRLA 1HTIA 3W26A 1BYDA 4J1OA 1E1FA 2C1HA 1S2CA 4GYPC 2AKZA 4IMAA 3TSDA 1G0CA 1ZRQA 4HOZA 3SCOA 5I3KA 4XD6A 3SY1A 3OP2A 3SGZA 1Y5VA 2JF7A 3R11A 2ANUA 2BHUA 3MZ2A 3TX9A 3W76A 4I9JA 3W7OA 4A4AA 3P2VA 1V02E 4G5DA 4XZHA 4W8BA 1WB0A 1DKWA 1HW6A 4WZHA 3K2GA 1OFEA 3HMCA 1J01A 3E02A 2ZC1A 3B8DA 1YTEA 3MHGA 3P5YA 1Q85A 3CS2A 2PTYA 4D6GA 1PO9A 1TMHA 1OC5A 3WK3A 3JZEA 2BBFA 4QX4A 1S2AA 1S46A 4ZFMA 3W74A 3EKZA 3WQ8A 3IPWA 1HF6A 3CT2A 1E6XM 1UR3M 3LLXA 4TX9A 1BKHA 4WKAA 1IGSA 4UQCA 2OQYA 2ACRA 2ZUUA 1C7TA 5BOFA 3WQGA 1NWRA 3LHVA 4CCDA 4W9TA 3T1GA 5CPSA 2BG5A 1PZ1A 5A6SA 2E1DA 4Q7BA 3C52A 1K8ZA 3EWCA 1A50A 1P0KA 2GLKA 3OBKA 3GY1A 1GVRA 3ZZ1A 3CUXA 1LROA 3HV9A 3SUWA 2VXNA 4WUIA 1K6AA 3W7RA 3DXIA 5C0QA 2CYGA 3MCNA 3HJZA 3PZQA 3ZM8A 5LNRA 2FIQA 4RNJA 1H11A 2I5IA 4NAEB 3U5YA 5EKYA 4MJ4A 1J0HA 1VP5A 3FVMA 4B5NA 1FWEC 4QNWA 4CGTA 4URIA 1VCFA 2UY5A 4MB4A 1GYNA 1W5PA 4O1CA 2PI6A 4NZ5A 3SCQA 3GTIA 3LZ5A 3GDTA 4FEZA 4QAWA 1HP4A 3SCWA 3WL0A 5FJJA 1W1YA 1I0DA 1Q5MA 3OYXA 5BXTA 1B2YA 4Z1DA 3LLFA 4U4MA 7ENLA 3A6OA 4YJ5A 3ARZA 4C6OA 4WY0F 2IUZA 1J6OA 2QXWA 4KERA 3ZLHA 2BV9A 4DAFA 2FZ8A 3LBOA 1LG2A 4O11A 1UR0A 1WXYA 1D9EA 2NQJA 1FP8A 1K70A 3ELFA 2AQVA 1DQXA 1IT0A 1S2VA 2ZUSA 4FLRA 3SSJA 4HU4A 2Y0FA 2CLLA 2VRQA 4UTTA 1PEZA 3NQDA 3ZT6A 5AC6A 3SY8A 2UBPC 1ZCCA 3PTKA 3GR4A 2GGGA 3EAUA 3UYCA 3UY8A 3PBVA 5BOEA 5HDRA 3T0AA 4R7JA 1QOPA 5U4NA 3V7PA 4C6DA 3EOSA 5JUVA 1VS1A 1B0IA 5G5IA 1TPDA 2Q3OA 4P8VA 3WN6A 1HG3A 4NRSA 5AHNA 3EA2A 3VNDA 3W70A 1VCGA 3LM7A 1TUFA 4IWWA 4I7VA 1C9DA 1KQZA 3LS9A 5K9CA 4PMRA 4GABA 4B9YA 4DUXA 3LK6A 2R1LA 4HHMA 1K8YA 2QUMA 2V3GA 3WQ4A 4P7NA 1OABA 1GEQA 1ZAJA 2R1KA 1XPGA 2E6AA 3RILA 4MSSA 1ICPA 1NF0A 4JNZA 3KBNA 1UJQA 4PR4A 4ZOBA 2FYMA 3ANUA 2J78A 2AKMA 2FB2A 2Z26A 5E6YA 7XIMA 4UQ9A 1V0MA 1KWKA 2DIEA 3TJXA 3VDGA 3NQ2A 3OHMB 1QBBA 1H50A 1M7PA 5C2GA 1XUZA 2DQXA 1NQ6A 4UTIA 4PYSA 2ZTKA 3TR2A 5A6BD 3GHTA 4XVEA 4DY1A 3N04A 3K46A 2OXNA 3PUEA 4QEEA 3CV6A 5CZTA 4FNQA 1A5SA 2X2GA 4P2VA 5I07A 3ID7A 1WAWA 2Q8LA 1W9VA 3GVVA 3VGFA 1PKYA 2QS8A 4R85A 4B5TA 2CZEA 3VI2A 3FJ4A 1YX1A 3GFXA 2BOFX 1NWUA 5LSMA 3FW6A 1O60A 2AAMA 5ENLA 3G8RA 2VFFA 5LYRA 1E1CA 8RUCA 3G1YA 1EQCA 1GVOA 2PDLA 4O19A 4JTFA 2OO0A 1G4PA 1OF6A 2E8ZA 1B3WA 4PTVA 3AHXA 5G1MA 3L2MA 4FIQA 1PS9A 4OOZA 1PE1A 1UUMA 4WHBA 4G2DA 3SM0A 3W75A 4LF1A 1DJYA 1J4EA 3DGBA 4UFKA 3A3XA 3S1UA 1ADOA 4C6IA 5A1AA 5DFAA 1V08A 1YADA 5ABEA 2F8QA 3ZFHA 3VC5A 4NNBA 4Y9NA 4D1IA 2ZZ2A 3EMZA 3NQVA 4JFWA 1EXPA 4S3KA 3NYDA 1UWAA 3WLOA 3QF0A 2BY1A 1S2WA 3CPGA 2JIEA 1CGWA 4WVXA 1YE6A 4TVDA 2TMDA 4RE2A 1RK5A 3P74A 1W1ZA 2BXZA 5IRPA 2VP8A 2PZ0A 3B05A 4CU6A 1DJWA 5HINA 5HJXA 1W3KA 4JTGA 2V5DA 4HGXA 1YPIA 2WNQA 5AC4A 4GFIA 4POCA 3EZ4A 4K7VA 1E9LA 1YW1A 2IKGA 3WJYA 4WCJA 3TTQA 3PB2A 4PUDA 3MO7A 5C7HA 1MXGA 5JU6A 3FJNA 1E0VA 2JK2A 2W92A 2CLMA 2VR5A 2FMNA 4O0QA 3W53A 1OQFA 3NO3A 4KGLA 3W7QA 3TYEA 4H8HA 3ABQA 3A4JA 1B3ZA 3BJSA 3KRSA 3VOHA 4YU1A 4QAIA 2A5HA 2R14A 4J4KA 5GJMA 1XLMA 4RE3A 4KGJA 4MVAA 2PDBA 1O4UA 2XZ9A 3LCXA 1QNPA 1SU5A 2C13A 3H21A 1IEIA 3BARA 4DN1A 3GKAA 1TV3A 4AYGA 3QC0A 4LAOA 4HU8A 3GNXA 5I77A 2YXOA 4OBRA 3KCJA 2NWSA 5AKQA 4QHRA 1FWFC 4D8ZA 5LNVA 2E09A 2CHOA 4JTHA 3LGEA 1EXBA 4PCNA 1E5JA 1JF6A 4F0HA 1C92A 3PR2A 1GORA 2QQ6A 4H00A 4BF7A 3C2RA 2HNEA 1UP3A 2ZX8A 3USBA 6XIAA 1DXEA 3W25A 3K13A 3VDCA 5JMUA 4LUYA 2WC4A 4JFVA 2ESCA 1W8GA 1G7UA 1M7JA 3UXDA 3ZIZA 1ONEA 3ITTA 5CJMA 3CU2A 5F4XA 3VIOA 1SSGA 5DCDA 2BASA 3UR2A 1XBXA 2QJJA 2QV4A 3LA4A 2YCLA 4CCZA 3EA3A 4Y9AA 4HNUA 2Y88A 1EC7A 1XYMA 5CJNA 1E4LA 2B7QA 3AYRA 4AD3A 3KW3A 2QT3A 1MZRA 1I1XA 2J77A 3AXXA 5HNRA 2EAWA 4HYVA 3S46A 4J3XA 3L4VA 7REQA 4TU1A 3KHJA 5DRCA 1J5TA 3IAQA 3PSVA 4CNSA 2V0TA 1YE4A 4XAFA 3UJSA 3AXHA 1KFEA 1SZEA 3A9BA 4GQBA 3P8IA 4F2UA 4C1NB 2YL6A 5KZEA 1AQMA 5A8NA 1ONXA 3PSWA 2DH3A 3NR0A 2NLIA 2PS2A 4ALDA 4RNFA 1JULA 2YLLA 2REQA 5AB3A 1WDSA 1G94A 3R12A 3WBYA 3AS1A 5DO8A 4IM4A 1N55A 2E9BA 1JDFA 4N42A 1W31A 1J0KA 2NX9A 1Q6CA 4M3PA 5A6TC 3STEA 4G7EA 1DHKA 5LA2A 2E1WA 4B91A 4MY9A 2R1NA 3WYZA 3RJYA 4NKCA 1SGJA 3PZVA 5IXEA 4KCVA 4R5EA 2FFCA 4FHAA 3QLDA 1FP9A 3W73A 2DY3A 4MZYA 1PKNA 2H9AA 3HQOA 1KXVA 1CDGA 4KWOA 2CBIA 5MF5A 4L9XA 4A3RA 4O10A 1XLCA 1GJWA 3CPUA 5F1VA 3ORWA 3WF2A 4ZR8A 1PBGA 3ONCA 4GUFA 1I1WA 2WHLA 1OG0A 1UMLA 1FFQA 4HA1A 3W71A 4JGDA 3T07A 1HKVA 2Z1VA 1E4MM 4Z2HA 4AIUA 5C54A 3WO8A 4FOUA 5FEPA 4DJDD 4TV6A 4JD4A 5DXXA 5BWAA 3EOEA 5BRBA 1A47A 1H0GA 3OA3A 1UZHA 2J66A 3CHFA 3CO8A 5TF0A 1E51A 4QSHA 4HP5A 1C9WA 2P8BA 4D9PA 4JL2A 3BG5A 3GDKA 4O12A 1DJNA 3LQGA 1R5YA 3LERA 1W9DM 1NFPA 2PLJA 3BH4A 2ZKMX 4LVFA 3QLLA 2CU0A 3W2KA 5JIWA 3BLPX 4PTMA 2NLYA 3LX9A 2DVTA 1IXPA 2Z2AA 3AIVA 6TAAA 4XAPA 2O0TA 3O63A 5M03A 3WJZA 3IEBA 4YVVA 4XSLA 3QKZA 1I4NA 1XFCA 1EEXA 4DWSA 1UR2A 5H91A 3WLHA 1GJPA 4EXAA 3VAVA 4JYEA 1NELA 6PTDA 4GOAA 3EXTA 3TJLA 2XM1A 2Y7EA 8XIAA 2Y70A 1UP0A 3FHQA 4ZOAA 3EOOA 2IQDA 3B9OA 3S1XA 4WSJA 4MYXA 4LAUA 2PRMA 4NG3A 1U33A 3EDKA 2BHYA 3PAJA 4AEFA 4ADTA 5K4ZA 1CECA 1RR2A 3MS8A 2DJLA 4REQA 1DP0A 1TVPA 4RDWA 4JX4A 3VIIA 4GG9A 1E0WA 4ES4A 2HV5A 1US0A 3O16A 4H41A 3TC3A 4LCQA 4B3KA 4JQ1A 4DI9A 3NUKA 4U5IA 3UWEA 2VFDA 1G4SA 4GQ0A 1XLLA 1CT5A 4CQ9A 2TPSA 3DG7A 3AIBA 4PCPA 1SPQA 1G9HA 3BOXA 4C6JA 3VTRA 1NDVA 4L5ZA 1CYGA 2BGNE 4HPXA 4C5YA 2BLEA 3DFTA 4NXKA 3GVQA 2CBVA 3W01A 1V3MA 3VCCA 4DWSC 3LGGA 2NVCA 3QR1A 3TC6A 2VD8A 4MB3A 1VJZA 1OX5A 1R47A 3WQVA 4ICMA 4DNMA 4Z0JA 5C2XA 1VRXA 2WZTA 2PLMA 4K8EA 4LS2A 4O18A 3KP1A 2VC9A 3EWYA 2TRSA 1UD5A 3SIZA 4DJEA 4KQNA 3DX5A 3OJGA 1VFHA 2ASHA 3TA9A 2D3LA 1LT7A 3A5FA 4MNLA 3LEPA 5CAHA 3UY7A 5KZDA 1WDQA 4N2YA 4J9JA 4KRTA 1TJRA 1MUWA 4Q8MA 2EBNA 1ML1A 4K37A 2F38A 3FEQA 2G3IA 3E3HA 3SCTA 4XD5A 3QV8A 1PWMA 3C0JA 4WJEA 3T42A 5H8MA 1V6VA 3IV3A 1RP9A 1NVMA 1ZAHA 5HWMA 3RM9A 1QOXA 1OWQA 4W8LA 4GJ1A 2BXVA 1GZJA 4BK9A 1H41A 2G37A 2R8WA 3AHZA 5LIKX 3ERPA 1GONA 3NNTA 2FZNA 3EX6A 4KEZA 1QW8A 4G1NA 3ARTA 2F6UA 1N8FA 1RALA 3HPSA 4WDTA 1JPIA 2QEZA 4HYRA 3W6LA 1XV8A 5FL0A 3MTWA 4HHHA 3P62A 2J62A 3G22A 2F9RA 1JUKA 3AU6A 2IKIA 4JYDA 3LTPA 4NZCA 4QJ3B 1O5RA 4YNGA 4DJEC 3B8SA 5HMSA 5FESA 1QRQA 1XYLA 4BJHA 3UETA 2FTPA 3SFKA 5C55A 2WVSA 2QMKA 4Q8WA 3CZJA 4IPNB 3DFNA 2J25A 3TXZA 1V79A 3G0UA 1VFTA 3G1VA 1IXNA 3H2OA 4AQLA 3ZWSA 5IBXA 5A6AA 1GOWA 1HL2A 1QCWA 2FH6A 4AMCA 2PDCA 3KDOA 1IF2A 1UQYA 2FKPA 4K8HA 5AOUA 1VFMA 1CWYA 5HWNA 2DT3A 2ZUMA 4DF1A 2J13A 4Q4QA 1S5NA 6XIMA 3II1A 4OQVA 2ABBA 4XIAA 5A8MA 1OF8A 1E5NA 1JF5A 2Y62A 2C8NA 3SW6A 5HOSA 3B9AA 1X1ZA 4BQ2A 4BS0A 4XB3A 1FDZA 5HQEA 1Z48A 4H19A 3RR4A 3NQAA 3HIJA 5HPCA 1VEMA 1BPLB 3EOUA 3OGVA 1D3CA 3PAOA 2ISVA 3K4DA 3QMTA 5CPOA 4HNNA 2DP3A 6REQA 1A4LA 4H8VA 3AC0A 3BLIA 4A35A 4QG6A 2CNCA 1W3HA 1AA1B 1WPCA 2QJHA 3FA4A 1MNZA 1LDCA 3P8JA 2E77A 1EDGA 3EPMA 1YPXA 4O14A 5AN7A 3SN1A 1ME7A 3GWQA 1RXOB 1KBKA 3W27A 2WZMA 2YCLB 1VBHA 5H6HA 1KA9F 4WDWA 1LYXA 2QW5A 5IBXC 1GYLA 4O0ZA 1CW2A 3Q45A 3QH2A 4TVUA 3AZRA 1W3TA 1FWNA 3M1ZA 2EPKX 4M7SA 3UNDA 3BTNA 1QASA 2Q8XA 2F6KA 2JQXA 2J9YA 3GC4A 3GIQA 3GZ3A 4ADSA 1LRTA 3BG3A 3ITVA 2P3EA 4UZUA 4H6RA 1E43A 1C7SA 3IUHA 3WSUA 2PD5A 2Z0IA 3WL1A 4LUJA 1UWSA 1GOQA 3LBCA 2OR2A 3F1QA 3IJIA 2DIJA 1FFRA 4IG2A 4LH8A 3DYOA 3H12A 4ASTA 1QOQA 5EMKA 1ZNNA 1RY8A 2E5BA 1S5WA 2JKPA 2PWFA 4FK9A 4IPIA 4LANA 3NPXA 3PUOA 5JH1A 4GY1A 2O7SA 1ZY9A 4XUGA 2WK2A 3UWWA 3BQ6A 2QUNA 2XN1A 1TWDA 5LGXA 4PBGA 1OFOA 4IFKB 4IPLA 4I6VA 1E70M 5EB8A 3M6DA 3KUMA 3MP3A 1AQFA 4G7EB 4HQVA 3S4TA 3TN6A 2QJGA 2CLOA 4D72A 5JBEA 3M7SA 4A05A 4OTKA 4DYEA 1JCXA 4IICA 2EKCA 1T0OA 3SEPA 1KQYA 1AK5A 1EQPA 3DENA 2H9AB 4EE9A 2G50A 1OYAA 3N2OA 2GK1A 5G4WA 2W66A 1S5MA 2OMAA 4W89A 3D46A 3R58A 5A6KA 3OLIA 3T8LA 3I6RA 5U7SA 3UG5A 2X0SA 3ZOAA 3TWBA 3VVGA 1SMAA 4U2ZA 4XWUA 3TQPA 3EYPA 4KFNA 2XVGA 4QJ1A 1F76A 2HNHA 3THUA 2ZRZA 1I60A 3MI3A 4AHQA 1XFBA 3W72A 3I6EA 2C14A 5E0FA 1Z3NA 3BZGA 3O2LA 2WVVB 2C19A 3TIMA 3D0CA 2A6LA 2CPUA 4WOQA 4AFYA 1L6GA 4LT9A 4HVXA 4WIWA 1VLWA 2QMJA 2Y4SA 3U57A 1MQPA 4NT0A 2D73A 1L8PA 1S5TA 4JTKA 2Y7GA 1KRAC 1KFCA 3AS2A 4GX8A 1WAUA 4MLJA 3A64A 5CKSA 2B81A 1FWGC 2OLAA 4H9VA 4NY2A 3GK0A 3N12A 3PJWA 1UR4A 4U31A 4C90A 3XISA 3ZT5A 1QWKA 4P7RA 4S3DA 3UZXA 3A13A 2H8XA 3BSGA 4DAIA 3MI6A 4K6AA 4RE4A 1XQKA 3KCOA 5GQBA 2PCQA 3PVFA 3LNPA 4YMZA 2QJMA 4MNKA 4L6HA 4AF0A 4IMFA 5TD4A 4FNRA 3QGAC 4MFDA 1E73M 2GWGA 4QDWA 3WY1A 3OA5A 4HD5A 1ZHAA 1AJ2A 4N9CA 1WZAA 1NAL1 4EF8A 1XLBA 1V3KA 1UIPA 3UVIA 3O07A 2DGAA 4D8AA 4KW2A 4Q4SA 1Q6OA 1EJTC 4HHPA 1VBRA 3G1FA 2JKAA 3OVQA 3CL7A 3L4YA 4REQB 5EGRA 2NQ5A 3H4GA 4YWSA 1W9PA 4A8NA 1QBAA 3P60A 3S8HA 4PMYA 3ARXA 3SURA 4HZ8A 1ODZA 4JTLA 5C9RA 4K3ZA 5J5RA 2BY3A 2VEKA 2DZTA 9CGTA 3RIKA 1MW2A 3GDMA 5IDZA 1AMYA 1WKYA 2CWXA 4Y2WA 3GX9A 4AX6A 2Y6ZA 3G8EA 3I6TA 1YDVA 2B0MA 1C8YA 3LY0A 1JZ7A 1EGVA 3DKJA 3V0UA 4PTDA 3KBSA 3QY8A 4KIEA 4KWWA 4GYFA 2PMQA 2YZRA 1G1YA 3URQA 1UC5A 1RCOB 3U0HA 3OHIA 4J2PA 1UKSA 5HMEA 4W7VA 3MB9A 3EX2A 4E6MA 3WQ6A 3GAYA 3WF0A 1G01A 1VQTA 4UFMA 3W38A 3M46A 2Y8UA 2PP1A 3QPEA 3EXRA 2GSEA 3V16A 3ZYZA 5LIXX 3UXLA 2A6NA 7CGTA 4DO4A 4UQDA 4MB5A 1ITUA 3CO4A 2CZ5A 1JNDA 3IGXA 2DUXA 1PTDA 3TC7A 3F2DA 1RUSA 3L12A 4K2SA 4NJGA 3NZPA 4JNYA 3G3DA 4DXVA 1CB7B 1TZ9A 2J6VA 1XRFA 4JCMA 3VD4A 4JIIX 4IZGA 1GZ1A 4EANA 5DQPA 3BANA 1QHZA 3GW3A 3WUBA 3RDKA 1SO3A 1HKJA 2W6RA 3AYTA 4EVZA 4DLMA 1UYQA 2ON3A 2C91A 1Q6GA 1FCVA 1VD6A 3DH7A 1H63A 1UWUA 3BGJA 2AL2B 2ZE3A 2X1UA 5AHFA 5T9BG 2VC5A 2PAJA 2JBMA 2YPIA 2YX0A 2VURA 4H8NA 4XUYA 2H90A 3DESA 2PGRA 3JS3A 4A21A 3NGJA 2YXXA 1DEDA 1N82A 4C7GA 2ZZ4A 4U3CA 1GPWA 4M19A 2W27A 1BD0A 4LUTA 1Z8AA 3I7SA 3CZKA 4L4LA 1MI3A 4FALA 3RFAA 3U7BA 2TODA 3RM4A 2VDHA 2E67A 1KXTA 3ARRA 1IEWA 2BVYA 3MV11 4H8UA 2WJZA 1AW2A 2PD9A 3CMGA 1Q2SA 1G4EA 5D9OA 2FVLA 1S1RA 1JZ2A 3GXDA 2J79A 2X7WA 2NQZA 2C3ZA 4UOJA 3K30A 1PZ2A 4M6VA 4XZ9A 3M0JA 2GOUA 4JYFA 3NQGA 2CHRA 5D2YA 3RAOA 4PC8A 1PHQA 1DL3A 4QFUA 2GJNA 3FNDA 3SI9A 4ENLA 2OSXA 1E0TA 3WK0A 1POJA 1LRNA 1VPXA 1R0MA 2ZXQA 3TQVA 2WC3A 1GYMA 1WDPA 1R7OA 4LVGA 5BYWA 1JD7A 1SFLA 3OLEA 3DGRA 4HMEA 4ZQMA 1R87A 2DZAA 3HPZA 2YYUA 4YCOA 1BG9A 4IH3A 3LBMA 1LQ2A 2X2YA 4I8YA 2PBOA 3WFAA 3AOFA 3TWAA 1JCYA 2X7VA 1KM5A 1Q4WA 2DZBA 4JTQA 3JZUA 4F79A 4S38A 1IWAA 4EAYA 5JBDA 5LA1A 3P5ZA 4CCEA 1KGUA 1X1OA 3DHFA 1R3TA 4JFTA 3DECA 4IIGA 3W3OA 1W9UA 1O12A 1IGWA 1JYVA 1EWEA 1L9WA 2NXHA 4QG9A 3NVDA 3BJTA 4XO6A 3S2MA 4KCTA 4UFHA 4Q4PA 3WLQA 3GVWA 2YDRA 2CBJA 4RXGA 4LVDA 2NUXA 1L2UA 1ZTVA 4YN5A 3SSZA 2XWDA 3WF4A 6ALDA 4K38A 4ROQA 1QO5A 1H0IA 1K02A 1O94A 4RK8A 2XHYA 3GO2A 1VPQA 3CWOX 5CSYA 3VU2A 5IOBA 2J8FA 2Z25A 4LAZA 4L1XA 3GYCA 1TIWA 4N6FA 2VVSA 2FB3A 1FHLA 1BEUA 4US5D 5E09A 1KBIA 5DELA 5HJLA 3VKDA 2FHBA 3UGRA 3C8NA 2ZUWA 2A85A 4BFAA 1TIMA 3S1VA 2YCKX 4CCCA 1R7AA 4IPPA 5I09A 1QT1A 1EJSC 3TUUA 4EPEC 4O15A 4LYQA 4GUIA 4UXDA 3L0GA 3KLKA 1OK4A 2WJDA 3SIMA 4BEQA 1PPIA 2W67A 3VOJA 5F2GA 5BXPA 2OX4A 2ZA2A 1ZJIA 3O0KA 7ODCA 4CQBA 3VIKA 1H7OA 1GUVA 2DZVA 4YL2A 1D8WA 4PUMA 1XS2A 1I2RA 4MWAA 3NPWA 4B5UA 2JIWA 6TIMA 1OZMA 4NQ1A 3NOYA 4W7WA 1K9FA 3FGCA 2VFHA 1E71M 3IIOA 4D6EA 1DWIM 4IX2A 5REQA 3S9YA 4FXFA 1ESWA 4AU0A 4BI5A 1KRMA 5DF0A 3APYA 4GO9A 3HJEA 2G3FA 3PG8A 1AVAA 1OZQA 3N11A 1W3LA 3CJPA 4PMJA 4P61A 2AQWA 1RV8A 1UD3A 3UEQA 3BAIA 4U28A 3LPFA 4PRRA 2CFFA 1JFHA 1XDMA 3MUZ1 5I5RA 1TPWA 1OK6A 1PIGA 4BA0A 2D3NA 3N17A 2E68A 3KBVA 1LOSA 2WM1A 4RL3A 4OZOA 4JXCA 1W9XA 1H09A 3QHNA 1Q4NX 2OU4A 3GXIA 4MWAC 1W8SA 3E49A 1HVXA 1K8CA 3DOPA 3GG1A 1EL3A 4O1DA 1V3JA 2XIMA 2XIBA 1TPB1 3CUGA 3O6DA 3CNYA 4CQDA 1MUMA 2DDXA 3O8AA 4Z2LA 5G2IA 3F2BA 3NURA 3UCCA 3CUHA 2ONEA 3WLJA 3KTSA 1GHSA 1EYWA 2OFJA 3MT1A 4UTUA 2WSKA 4NHVA 4V27A 1UKOA 1TV5A 2WMFA 3BDKA 1QNRA 2HXTA 4N9BA 4HNVA 4UR9A 1YDOA 1DJZA 1UR9A 1Z41A 3CQIA 4AF0B 1XM3A 3WFLA 2Y61A 4UTFA 3N29A 3TN5A 3CLWA 4D6DA 2A3AA 4E8GA 2OEMA 3T8QA 4HA4A 1WKEA 4H6EA 4I5RA 3E2RA 5AHMA 1OD0A 3U6WA 3TN4A 4EPDC 1TA3B 4OUEA 4GC3A 4A3HA 5HBFA 5CG7A 3MBDA 1ZLPA 5I3HA 4LJ3A 4PMDA 4ZO8A 2YW3A 2CZDA 4AHOA 2JE8A 3MUY1 3AI0A 4W7UA 3UZ5A 3WK1A 1J0YA 3E0VA 2WZHA 3W87A 1R6WA 2CBUA 1IR1A 3QSRA 5BRQA 2A1YA 4XKMA 2INZA 1HKWA 1XD1A 3S5OA 2W63A 3W4RA 1UA7A 1B3YA 4JOMA 5LIYX 3AIRA 1JGMA 4JS3A 3WNLA 4JTTA 3AICA 4H1ZA 2IMRA 4Q6XA 5KSWA 4BQ3A 3H8AA 4LY8A 4GACA 1U1JA 4Q3MA 3MVTA 4F48A 2Y89A 3V5OA 4CKQA 2WXDM 1TYGA 1LRQA 4DZAA 3EBVA 1XC6A 3ES8A 3NAVA 1ZBCA 4R53A 3MJYA 2GVGA 2HWGA 2QPXA 3N73A 4FNPA 4Z17A 1QXLA 3QY7A 1TSIA 4WKFA 2J7FA 2YFOA 3HV8A 5I6SA 1E9YB 4B90A 5CC3A 2PP0A 3EB2A 3RX4A 1GKQA 7A3HA 3FX4A 4QS6A 3WEMA 3MMUA 2C6QA 1KKOA 2JGQA 3GTHA 1ELSA 3QKEA 1OX4A 1S2TA 1UWIA 4IHCA 4DBWA 2DV0A 1P7TA 2E0PA 3RPTA 1QJWA 2P0OA 2YDQA 2WV8A 1P0DA 1UZ1A 4J3SA 4AH7A 3S9ZA 4Z0SA 4S3AA 1KNWA 3NQCA 1HO4A 5DMLA 3S6OA 2J9XA 8TIMA 4AIEA 3UBPC 3PBMA 2ZRUA 1AD4A 5CZSA 5LGZA 5HAOA 2IS7A 2X0HA 3AS0A 3QHOA 2GJPA 1UH3A 4MIMA 1MZHA 3BICA 1YLVA 2BOGX 4M1RA 4LF2A 1PV8A 3PWIA 1T96A 3CZEA 1UQZA 3EWXA 4C6MA 5FCZA 1J2BA 4MOZA 4PFMA 1KCKA 4DZHA 4QNEA 1ISXA 3CHCA 1HKKA 1J93A 3WMLA 1LJYA 3CH0A 1LP6A 1UASA 5KMYA 1GG1A 3OVPA 3I3BA 2C15A 3SN4A 2VM8A 1PVNA 3HURA 2EQDA 1F3WA 3HPFA 4L65A 2R91A 3G1XA 3ZSSA 3H53A 3R89A 3DEQA 4W93A 1DHPA 4G1KA 4ATLA 1PZ3A 1XYFA 3W00A 4JTUA 4S1FA 1LOQA 3KEHA 1JFXA 3EDEA 4ATDA 1JZ4A 2WM0A 3OVGA 1M6JA 3G24A 2E28A 3ITCA 2VQTA 1NU5A 1DJGA 1CGVA 1O66A 2ISDA 3SN0A 4FZIA 2PBGA 1O5KA 3GG7A 3M64A 3W7IA 3TSMA 2WSRA 3RYSA 1Z42A 1DJIA 4WJXA 1J79A 3RG6A 4NYUA 1XSJA 2VC7A 1YXYA 5CBJA 3C0QA 2D69A 2V82A 3WEOA 1KO0A 3H70A 3D3FA 5AHLA 1EB3A 1F4HA 3N6JA 4PB4A 2Q71A 3UG3A 1FVPA 2Y8KA 1FA2A 3D5HA 4O13A 1YKWA 4GFSA 3T7VA 1UUQA 3W02A 2WCGA 3QN3A 3T05A 3W7JA 2UZ9A 3S2JA 1FDYA 3BAXA 1P5BA 1QR7A 3M41A 4C65A 1ZFJA 3IJ7A 3N6QA 4XD3A 2BOEX 4M82A 3TCSA 4A8LA 3H24A 4GIAA 3VIJA 4QITA 2QF7A 4EXQA 4P8XA 5C7VA 1TJ2A 1KM6A 1MW1A 3C2FA 4CN6A 4GCAA 3TCEA 3TYUA 3C5QA 1PKMA 3BAYA 4FNTA 4QIUA 1UP2A 4X0NA 2PF8A 1JL8A 1WUEA 1JJKA 2VT0A 3PF3A 3W81A 2NX3A 2BY0A 1SO4A 5F2LA 4XKYB 3SAZA 5F7UA 4H4IA 1A5NC 2FGLA 3BGAA 3NO1A 1IV8A 3SJNA 2V2DA 3DHDA 3G1RA 3R6IA 4LYKA 1XINA 2IPGA 4PMZA 3B06A 3FYYA 4NZ3A 3UNTA 2OT0A 3GDLA 1LWHA 1I9CB 4MKVA 5SWUA 4C5ZA 5DMNA 3F5KA 5I79A 4NIRA 2BTMA 5TAOA 1YTKA 4LV4A 4F0MA 4E2BA 3U8GA 4KWSA 3M47A 4US5A 4IIDA 1BSLA 4I6KA 3V18A 3VE7A 1ITXA 4HCDA 2YL8A 4UZSA 1MDRA 2GYIA 2V69A 4FLOA 1XSKA 1H1YA 4W5ZA 2QUTA 3QZAA 3TMQA 2E9LA 4B3LA 2QAFA 1AQHA 1V6WA 4CQ8A 1AH3A 3OBAA 1XGDA 1XYBA 4JFUA 2OQHA 2YXGA 1ZZMA 4M0XA 3CV7A 4C1LA 1X96A 3W24A 3WH6A 4U10A 2XFRA 4JTDA 1V93A 5M17A 1OY0A 3B0PA 4LAKA 3WLLA 2P53A 1DQUA 1I75A 1W5MA 2EEXA 4MWAB 3VGEA 3GH7A 5DY3A 3UJFA 4OUIA 2IKHA 4MPQA 2BZNA 3B8IA 2DZUA 1ZPTA 3IARA 2B7PA 2FZDA 4BI6A 3MCMA 3W86A 2PEVA 1XL9A 4CEUC 5IDIA 2XFYA 4XTIA 1KBLA 4MKNA 2NT0A 4HYWA 3WQPA 2NW0A 2VFIA 4W86A 4AD5A 1A5AA 3STPA 1TZZA 3HGOA 1UZDA 3PZ9A 2I9EA 3T2OA 4N6EA 1UWRA 3GC5A 1XKJA 4IX0A 5B80A 4E2DA 2ZXAA 1S5VA 3M5ZA 4GUGA 4UMAA 1AODA 2GQAA 4FX8A 4Q8QA 1TPH1 4TR9A 2V30A 3ARUA 3QRHA 4H6QA 2HVMA 3J7HA 4IFRA 1IIGA 1H5YA 1NP0A 1MRQA 3KP0A 1LQ0A 2BS9A 3IUDA 1R3SA 1V03A 3C56A 4UBPC 1ZP3A 2YL5A 3IV8A 5G2WA 3AJ7A 3GSMA 3BURA 2V8ZA 4ZSUA 5HR6A 3KVMA 1BHGA 4C6QA 3W84A 2J8TA 4D6CA 2NQLA 3FKKA 2GDVA 3PY2A 1LWJA 3LTSA 3L23A 1XDLA 1J0JA 1BQGA 4JAWA 2P50A 4G56A 5DCEA 4B2DD 4OWGA 2UY4A 3WUGA 3CTLA 3I4KA 3LPPA 4XAYA 1WV2A 2QPSA 2PTXA 2PGFA 1CBGA 4J2MA 3P93A 4NAEA 4Q8NA 4RDZA 5A6LA 5AYZA 1KGWA 2CXGA 1T6MA 1J8VA 2FZMA 1KR1A 3TE9A 4UTWA 3WIJA 2QCHA 3W23A 3WF3A 3RU6A 4HB7A 1ME8A 1BVZA 3CUZA 3BG9A 1F6KA 1B30A 1EA9C 3P82A 1LCOA 3OGRA 4H9YA 4RCXA 1T5AA 3TKFA 3CB3A 1EX5A 3DG3A