3JR2A

X-ray crystal structure of the mg-bound 3-keto-l-gulonate-6-phosphate decarboxylase from vibrio cholerae o1 biovar el tor str. n16961
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
213
structure length
213
Chain Sequence
b'TKPMIQIALDQTNLTDAVAVASNVASYVDVIEVGTILAFAEGMKAVSTLRHNHPNHILVCDMKTTDGGAILSRMAFEAGADWITVSAAAHIATIAACKKVADELNGEIQIEIYGNWTMQDAKAWVDLGITQAIYHRSRDAELAGIGWTTDDLDKMRQLSALGIELSITGGIVPEDIYLFEGIKTKTFIAGRALAGAEGQQTAAALREQIDRFW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hexulose-6-phosphate synthase SgbH
publication title Crystal structure of the Mg-bound 3-keto-L-gulonate-6-phosphate decarboxylase from Vibrio cholerae O1 biovar El Tor str. N16961
rcsb
source organism Vibrio cholerae
molecule tags Biosynthetic protein
total genus 76
structure length 213
sequence length 213
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3jr2A00
2QEZA 5K4ZA 3KRZA 3EWBX 3L0NA 3L21A 1TRDA 1RPXA 3NQVA 5FF0A 2JBMA 5G2IA 2FIQA 3G1YA 4MFEA 1B4KA 3F1QA 1H7WA 1HL2A 1NFBA 5D2TA 2I9EA 3W1TA 1I4NA 2EHHA 4FB7A 2FJKA 3K30A 2ABBA 4R34A 1KV8A 2RKXA 4I7WA 2GJLA 5I3GA 3W1QA 2VKZG 3KAOA 3M41A 2G95A 3ZWSA 4K39A 4JR5A 4QJ1A 3TAOA 1Z44A 3EX1A 2P10A 4LUIA 1P5BA 1FUYA 4GC4A 4NJIA 4S2CA 3W83A 4LS1A 6TIMA 3TDFA 1G67A 4IMGA 3IIXA 3LOTA 2ZZ1A 4OU1A 2LLEA 3TFCA 5C2XA 3W7NA 3QZEA 4UR8A 2VFEA 3E49A 4TU1A 6ALDA 1IXQA 1W5QA 1F74A 3TXVA 1XBZA 1FCQA 2ZCGA 3R2GA 5BW6A 3R5EA 3UZJA 3TIMA 3LHVA 1H61A 3EWYA 2C3ZA 4MLRA 3S0CA 5TBOA 1U83A 1O5KA 2GVJA 4JICA 5D03A 3SFKA 1QCWA 3TMLA 3ZS4A 1DKWA 3GK0A 4RK8A 3TK7A 2ZRVA 4AVFA 5AHLA 3HO8A 4IWWA 2X1RA 1UASA 1PVNA 3WJXA 3TJXA 2DZUA 3VNDA 5LNVA 4UTKA 2W0UA 4MY9A 3DFOA 4MVAA 1SZEA 4HNVA 3QPYA 2Z6JA 3W07A 4OV4A 2CW6A 3FJ6A 2J9YA 4RZ6A 2E1DA 3P74A 1QO2A 2CLKA 3P8IA 5FESA 4IPJA 3RLVA 4LS0A 1H60A 1TYGA 4Y90A 1LBLA 1L6WA 1BTMA 2JGYA 4ZQPA 1JUKA 2QDHA 3EKZA 3HG4A 3DFNA 4NQ1A 5DN1A 2TYSA 1A50A 3W7CA 3W2LA 3A24A 3HF3A 2Y89A 3F4WA 3HJZA 1MEWA 1U5JA 3WJWA 1JJKA 4O50A 3I7SA 3M16A 1I8JA 1XDLA 3DKLA 3H53A 3EXSA 2ABAA 5ABTA 3BG3A 3SW6A 3LLFA 4HSOA 1AL8A 3T4CA 3O6DA 3NQ7A 1K02A 1RV8A 2A7PA 3HG5A 1F73A 3QRHA 4HPXA 4N9CA 4O54A 3I6RA 1OYAA 5F2IA 3A9IA 4GUJA 4JTFA 4CCDA 1OFAA 3UD6A 5D2VA 1H50A 3P82A 1OFEA 4IX0A 3RMJA 3PBWA 2CLHA 1GT8A 3P61A 3DKJA 4S2BA 4IQLA 2KZHA 4K36A 5CSRA 3TNOA 1YTKA 3LCLA 1Q6LA 5BOOA 2FFCA 1VCFA 3PBUA 4M19A 4XBKA 1PE1A 4U4MA 5CPMA 5IBXA 4UXDA 3HPXA 3C6CA 5G4WA 1X6UA 1OX4A 3M47A 3M5XA 4Z1DA 3TE9A 4UFLA 3T40A 3N3MA 3TC7A 2YPIA 2AAMA 4MZYA 1EP1A 3W1PA 3G3MA 4HNTA 3LXAA 4M5PA 2GQ8A 4PC8A 4TIMA 4ZQNA 3W1MA 2X1UA 1ZENA 1LTDA 4LT9A 2WNZA 1OFDA 4UC5A 5AYZA 3DI0A 4M6VA 1KTBA 2A2IA 1W5PA 4DF0A 4N4QA 5LNWA 3W7KA 3O07A 3PB0A 4RV8A 2RDUA 1XM3A 4I7UA 1FWSA 1TTJA 5EY5A 3TQVA 4O53A 3G1XA 1QFEA 4O12A 1OK4A 3ZWTA 5EL1A 2PE4A 4WXYA 3W7OA 3BLIA 3W23A 5FEZA 1LDCA 3UXAA 3W74A 1GYLA 1YDOA 3G24A 2ISSA 2GVGA 4GNJA 4R33A 2O7QA 3MMTA 2J9ZA 5L9FA 2EGZA 2XN2A 1Y0EA 1BEUA 4HSNA 3STFA 3PS7A 3WJZA 1JVNA 1RR2A 4JD4A 3IIPA 4I9AA 1TPC1 2Y7FA 3HGOA 1A53A 5I3KA 5K4XA 5CPNA 1DJNA 3STEA 3P5YA 2Y85A 2A5HA 4GWEA 2CZFA 4O8RA 4UFKA 3G1AA 4O28A 4FX6M 5KMYA 4JYDA 4UTMA 3A22A 4N9EA 3NPUA 1KLZA 1ZFJA 5K7JA 4XKYB 2RDTA 3C3NA 3SECA 2YSWA 1GZGA 4OV9A 1ZY9A 4JDBA 3UY8A 3LXCA 3T44A 3EWUA 1FCUA 4LVFA 4Z1AA 5D05A 1JCYA 4BFAA 2C0AA 1YDNA 2YFNA 5D2XA 3NYZA 1R30A 1DQWA 1XBVA 5BMWA 1CX9A 1EEPA 3S42A 3P7YA 2E5DA 2E6YA 2QJGA 1IIHA 1KBIA 1QR7A 2HS6A 3BW3A 2BWGA 4XKYA 3HB9A 1X8FA 3LB0A 3LM7A 5L6UA 2O7SA 1KV5A 3S8HA 2Q3RA 3W7IA 1OYCA 1TQJA 1X1ZA 2BX7A 4LVDA 2V82A 2Q3OA 5A8GA 2ZRXA 1QWGA 3W7LA 4AHQA 1ZAHA 2AGKA 3KX6A 1GWJA 5HNRA 4UTWC 4NX5A 3G18A 4AH7A 1IXPA 4TMBA 3H54A 1Q45A 4EF9A 3CWOX 1M6JA 2XN1A 1VYSX 1QDSA 2HS8A 1OABA 2V5LA 1YADA 5J5DA 3N9SA 2XN0A 4X2RA 1XXXA 2E77A 1WOAA 1K8ZA 3N2MA 3UWYA 3IGSA 4JX5A 4O0KA 3P84A 1T96A 4OGZA 1YLVA 2R14A 4N2YA 1EWDA 4AHPA 4JXCA 1TV5A 5G5IA 4OBTA 3CT7A 4OQVA 2VFDA 1OX5A 4IJBA 4WY0B 4RXGA 3G8RA 3HG2A 2YW4A 2Y7DA 3GB6A 4CNPA 3NEVA 3W7JA 1LYXA 3A5VA 1G4SA 5KTLA 3SZ8A 3MP3A 3NQAA 4A3UA 4JTSA 5LGZA 2G97A 3KFTA 1O4UA 3WFAA 1JCLA 3TKFA 5HWJA 1TPFA 3GDTA 3G3DA 1GTEA 5FF3A 3TSMA 3MHFA 1H7XA 3L0GA 1VGAA 3G1HA 3NO5A 3MJYA 3PSWA 3WK1A 5DY3A 4GFSA 4GXMA 1UBSA 7TIMA 1KM2A 2P1FA 5F2GA 5G1TA 3SI9A 4DXVA 1IF2A 1G6CA 3NPWA 1LOQA 4JGDA 1H62A 2H3DA 1TPB1 1YPIA 5K9DA 4PCFA 1B57A 3IEBA 5HQEA 3TCEA 4EF8A 3LBMA 4M6QA 3NAVA 3RNDA 1Q6OA 2V9DA 3KHJA 5AC8A 3TUUA 3BW2A 3W76A 1YXYA 1L2UA 2ISVA 1LOSA 4BR1A 4IX2A 1G4PA 2FQIA 3G8EA 4MFDA 3RFAA 1F5ZA 2FPYA 4O1BA 1YPFA 2QUUA 4LV9A 1YDVA 4N6EA 1GYNA 4K7YA 2QCDA 2DZVA 2ZZ4A 4CCEA 3V1PA 5FI8A 4CQAA 1A5SA 3THAA 2WSQA 1SZNA 2ZRWA 1ME9A 3CHVA 4DF1A 5KSWA 2NX3A 3C52A 4ZQCA 3L65A 2CU0A 2EF9A 3M7WA 4FX8A 2YW3A 5D09A 3GNNA 1HUVA 1TJRA 5SWUA 1LOLA 3M0ZA 5GVJA 1TREA 5KINA 4CQ9A 3O16A 1GQNA 4FNPA 4AWUA 4JDYA 3W1XA 3W7HA 5CKSA 1DBTA 1GVQA 3UWZA 3GDLA 1QO5A 1PS9A 4PODA 1T0OA 3JS3A 5F4SA 4MZ8A 2Y63A 1X1OA 2BSLA 1DJQA 2WO5A 4JN6A 3TJLA 1WOBA 1ICPA 1N55A 1IXOA 3HG3A 2QDGA 4HKPA 1H51A 1FX6A 3I7RA 3TROA 3W2JA 2X2GA 1LM1A 3OHIA 1FWRA 1F6KA 3GDRA 2FPVA 5HWNA 3C0JA 3VFLA 4GUIA 3SSJA 4FXSA 5AYXA 3MP4A 4DEFA 1IIGA 2E6AA 5HR6A 3G0UA 3W7MA 2NX9A 1L6SA 1EUAA 1LP6A 4FNSA 3FKRA 1JQXA 5C5YA 4O57A 1H7RA 4AHOA 5TIMA 4DQWA 3U8GA 1SO4A 3S1VA 2VFHA 4O19A 4YCOA 2GUUA 1W37A 1KA9F 3NR0A 4LWWA 4A21A 3NQGA 2CLMA 1OFRA 5G2WA 1QAPA 5LNSA 1SW7A 3QYQA 3GDKA 4PEKA 3OA3A 1O60A 1UUOA 1KFKA 5EMUA 5C54A 4JY8A 3F03K 1XBXA 1NF7A 4HNNA 3E0IA 1OF6A 4RCXA 1R2RA 3CIWA 1H7PA 4I7VA 3MWAA 3LHTA 5I3IA 4N6FA 3EXRA 4IMCA 3EKLA 3QQ1A 4RR4A 3C8FA 3DFPA 5K9XA 4UFJA 3RK8A 3EX6A 3Q94A 1OF8A 2H8ZA 1TTQA 4DO6A 1B9BA 4XBSA 4H6KA 3S5NA 3CWNA 3IIZA 1QOPA 4PA8A 3C2FA 1H1ZA 5EKYA 1I2NA 4UTWA 1W3NA 4JTLA 2VC6A 5HWMA 3HGJA 3CPRA 3DENA 4YMZA 5KZEA 3W87A 2VEMA 1VQTA 3E96A 4ML9A 4Z0SA 1W56A 3WJYA 2B0MA 4L4MA 2X16A 1KFLA 4NZJA 4JYEA 5FEPA 2I14A 1MSSA 1SUXA 1TV8A 1JRBA 4AXKA 3IGUA 1O5XA 4LY8A 5FF7A 3B0VC 3LHUA 1GVSA 3EWXA 1BWLA 4BK9A 1XFBA 3VI2A 2E09A 4UMBA 4UTHA 4QITA 1VYRA 3W71A 3O15A 2Y7EA 5DXXA 3USBA 1TTIA 3RU6A 3LERA 1WDWA 1HG3A 2G96A 1SZFA 3LCHA 4JYFA 4POCA 3PWAA 3OVPA 3DZ1A 1T8XA 4CLMA 4PTNA 3LV6A 3PAJA 3C2RA 3BV4A 1LORA 2Y61A 3PG9A 4FNUA 2PURA 3G1DA 3MUXA 3UQNA 3G0XA 4L4LA 2VEPA 3BLEA 3VKJA 1SR9A 4AB4A 1SFJA 2DZWA 4JS3A 3TX9A 3OIXA 5CGQA 4DF2A 1H63A 4UCGA 4FO4A 4BWLC 4ZQRA 1KFJA 1R46A 1UUMA 1E51A 3LCXA 3LI1A 1TPEA 2HMCA 2RH9A 4BI6A 4IGHA 2V5BA 3L66A 4D2JA 3BG5A 3NA8A 5F1UA 3W75A 4OHQA 3B0PA 2RDWA 3GKFA 5CZ0A 2QUTA 2CLEA 3NM1A 3PUDA 3DFQA 2C13A 5KZDA 3PBYA 4JTGA 2RHGA 2C14A 4UFHA 1FQ0A 4K37A 2JGQA 4E38A 2XFWA 5LHEA 4MJZA 3PB2A 1O94A 3DI1A 4AAJA 4Q4KA 4O17A 3NG3A 2BXVA 2J27A 4WX2A 4DPQA 3GR7A 1F76A 1XC4A 1TTPA 4WOQA 1KM5A 2GOUA 1R2TA 2CLOA 3DAQA 1OYBA 3NPVA 4O1AA 4S1FA 2OT1A 5TQLA 3D0CA 1UB3A 4X9SA 1M7OA 3W1AA 5E1QA 3T78A 3CIXA 3ANYA 2E5BA 2DZPA 1H7NA 3ABRA 4AF0B 1LRQA 2FLIA 4JEQA 4W9TA 4MY8A 4TMCA 2V8ZA 1W5OA 3WK0A 2R91A 1TO3A 2ZRYA 4QM1A 1GPWA 1NEYA 4JX6A 3UPWA 5FEXA 3P67A 4WD0A 1RQEA 2JKAA 4O4VA 4C1LA 1PV8A 1ZHAA 2V81A 2QR6A 1TJPA 4UMAA 4O52A 3O6YX 4Q32A 3MBDA 5HUPA 4UTUA 2CLLA 3V75A 3W9ZA 2Z0IA 3ZR4A 1H5YA 3MI3A 2FTPA 3CQ0A 5BMXA 1AW2A 3DGRA 2QCFA 2NXHA 3M1ZA 2VEKA 4DBDA 1ALDA 1EP2A 2GQ9A 4YLWA 2QCMA 4P61A 1OVDA 4O4WA 4CQ8A 4KKXA 1GTHA 2QCCA 2ZQ0A 3LXBA 3NVTA 1Q6RA 3R8RA 2VFFA 1D3HA 3GXPA 1BWKA 5DCEA 5D02A 3UZ5A 1SFLA 3OG3A 1NAL1 5H91A 4O15A 3BK0A 3N73A 2V30A 4AWTA 5DELA 1M7PA 1JCJA 3DFSA 4UR7A 3ELFA 3FYOA 1JR1A 3P80A 1P0KA 1B3OA 1K7EA 1K7FA 3QMRA 1EWEA 3LRMA 3NL6A 3OBKA 2A6LA 1Z41A 4LUJA 4N9BA 3NQFA 3S9YA 4N4PA 5HR7A 1WBHA 3U6WA 3UNDA 4HN4A 1V5XA 4LVBA 2WV8A 2OX1A 4Y9AA 4HIBA 3N2XA 4PH6A 3N34A 3TSDA 2WKJA 4A2SA 5K3VA 2ZA1A 2JKEA 1J5TA 3EX4A 3TU9A 1K03A 2B7NA 4A2RA 1GJPA 1I45A 1PIIA 4E2DA 5EA9A 1FXPA 3EWWA 4NX0A 1DOSA 3NQCA 1SU5A 1GG0A 1FDYA 1WX0A 4YL2A 4Z1CA 1I2RA 3QSRA 4IMFA 4NJJA 1J2WA 1Z42A 3MYPA 5AHEA 3PM6A 5D32A 1OHLA 3NOEA 1W54A 3KVKA 3LGEA 2NUWA 2DJLA 2NLIA 2Z6IA 3I65A 4UIOA 2OJPA 4K8EA 1G4TA 5D30A 3W2KA 4RZ4A 2ZRUA 3JR2A 5F1VA 1UJPA 4MOZA 3PUEA 2C15A 2AQWA 3IIVA 1L9WA 1KFBA 3W6YA 4A29A 1OFQA 1JUEA 1TPUA 2GPTA 1D3GA 2CZDA 2DU2A 2F7FA 2E6DA 3Q37A 3FKKA 1EP3A 4PL1A 1I2QA 4UNKA 3HQ1A 4IPIA 1EA0A 4HNUA 3QFEA 1THFD 4XQ6A 3UWVA 4ADTA 2YCEA 3QMSA 5C55A 2ZBTA 1WAUA 1VR6A 3LV5A 4EIVA 3QQ0A 3LTPA 3TXZA 2OZ0A 5G1YA 4FF7A 1GVFA 4Y96A 8TIMA 2F84A 2NV2A 2QCEA 2V2DA 3S5YA 2ZZ2A 4EOUA 5K9CA 4BWLA 3STGA 1W5NA 5D2WA 2WNQA 2BZNA 3M9YA 4EVZA 5CPOA 1MEIA 1K3UA 1OFOA 1GG1A 3Q2DA 1LBMA 3TC6A 3GAKA 3HOJA 4TR9A 3HIJA 4WOZA 1FWNA 4FHAA 2H8XA 3C2OA 2H90A 1EX5A 5BNKA 1ICQA 4NU7A 2Y7GA 3M5ZA 1KLYA 3BG9A 4WZHA 3G22A 2J88A 2C6QA 4WY0A 2YXGA 3GLCA 4FX7A 4WQ6A 1G4EA 2FB2A 3HGSA 1XUZA 4YXGA 4AEOA 1K8XA 2WSYA 1N7KA 3W7QA 3C2VA 3SGUA 1Q6QA 4ZVJA 2VXNA 5AC7A 1QPNA 1ZCOA 2QAPA 1W8SA 3LHYA 3SY5A 1I2PA 1TPDA 4CCCA 2A0NA 5CSSA 1S5TA 3DXIA 3GIYA 2HTMA 4NXKA 1UCWA 1T99A 4JTHA 3P62A 3CC1A 3U2OA 3W7PA 4O0ZA 2C1HA 5F4WA 3FJLA 3LTYA 4ZMGA 3CEUA 3W2NA 2QCHA 1DQXA 3BW4A 5AB3A 3W7GA 5I3HA 3IIOA 1SSDA 2Z2UA 4ADSA 1MZHA 1SQ7A 3CLMA 4R7JA 3P60A 3B0UX 5CZTA 3FEMA 4KFPA 3PBVA 3NZ1A 1Q3NA 1FBAA 4LW7A 3QM3A 5HULA 2ZZ7A 3YPIA 4BI5A 3ZFHA 3NL2A 3L0KA 4ORMA 1KM6A 2WJZA 4BF9A 5HINA 2VELA 5KITA 4O16A 1L6YA 3O8AA 2D73A 1YTDA 3L68A 4JTUA 1MO0A 1YXCA 4UTLA 3M5YA 2DZXA 4J9JA 3HBLA 3W7DA 4A22A 1JCMP 1XCFA 4HPJA 5D2YA 1SO3A 1WQ5A 2VENA 4QISA 2QCLA 4FXRA 2NWRA 3CEPA 3W7RA 1Z48A 2NZLA 1RQHA 1W3TA 3W70A 3G1FA 4NNBA 5I3FA 5FF2A 3W2MA 3E02A 2QCNA 3FA5A 2FB3A 4OWGA 2Y62A 3A21A 5D38A 3W3OA 4PFMA 4TX9A 4O18A 4ZQOA 1ADOA 2DP3A 1WXJA 3VE9A 1J4EA 3HGRA 5KZMA 4RZ5A 4B5NA 3W1NA 5U4NA 1TPWA 3INPA 1SW0A 2W6RA 3PC0A 3DU0A 1VYPX 2QF7A 4UNLA 3BVJA 3LRLA 2CLIA 2Q8ZA 3DHDA 2ZDRA 4YWIA 2TRSA 1ICSA 3CU2A 1IXNA 4DBEA 1P0NA 2V2HA 4Q33A 1VS1A 1LRTA 4WJEA 2C16A 3A5FA 1VH7A 4X3ZA 3W73A 3S5OA 2CFFA 1CI1A 2X30A 4X22A 1N8FA 3FFSA 4N9DA 1XBYA 2RFGA 5AFDA 3NQEA 4QSHA 1F05A 1ME8A 4NUWA 1M5WA 1PHQA 2PCQA 3W1LA 4AMAA 4RX0A 5LZLA 2ISWA 4JX4A 2QCGA 4TO8A 1KM4A 1X7FA 3W1RA 3NQ8A 1JUBA 4E0CA 4FNTA 1DV7A 3TQKA 3GNDA 3OVQA 4KWVA 1A5AA 1A5BA 1F2JA 3KRUA 5DCDA 2NXGA 5DCBA 4NNAA 2PRLA 1QMLA 4Y8FA 3ATZA 4O1CA 3G1SA 3O6CA 3UWQA 2FPTA 3Q58A 5E93A 3W86A 5FEWA 3MYOA 3LI0A 4ORIA 2ZFAA 5AC6A 4KWWA 2QKFA 3S6DA 3OVRA 5D04C 3IVTA 3NZRA 3FOKA 1LCOA 2Y6ZA 2Y88A 3L5AA 3QW4B 1KW1A 4G1KA 1W1ZA 1FXQA 3EEGA 2B7OA 2ZZ6A 3EX3A 4U28A 4GRSA 3PR2A 1W0MA 1DHPA 4QNWA 5HUOA 4LVGA 1SW3A 1SO5A 3QH2A 2OCZA 1ME7A 3GXTA 3WK3A 1AG1O 5F4XA 3MP5A 2HSAA 3NL5A 3CM4A 1LBFA 2W79A 1V7YA 1IGSA 4NNCA 3WJSA 4ZZ9A 3M6YA 1TQXA 1LLZA 3DFTA 3JRKA 4LOCA 3B06A 3A23A 3LTSA 1FY6A 3NQ2A 5LNRA 2V2CA 1QPOA 1W3IA 3ABSA 2P0OA 2B7QA 3UYCA 4IXXA 4IMEA 3MHGA 1ZAIA 3QEZA 5EBUA 2WQPA 5U7SA 3W88A 4M7SA 2ZYFA 3DHFA 3NQ6A 2E5CA 4HHPA 3DBPA 1FWTA 3N9RA 3T55A 2OT0A 4NZFA 3CTLA 3W2UA 5F2MA 5T26A 1G7VA 2J6XA 3G0SA 2R94A 3QSTA 4QIUA 4O14A 4K6AA 3G1VA 3B8DA 1GOXA 2VFIA 3C2EA 1LZOA 3EXTA 4GUFA 2B7PA 1AK5A 1SSGA 5EPDA 4RJEA 1TRIA 3N14A 3GAYA 4R53A 4P2VA 5AHFA 1OX4B 5AHNA 2J24A 2VEIA 2BTMA 3WK2A 4MUZA 3MO7A 1D9EA 5HJLA 5DY2A 5IM51 3VCRA 1AW5A 4NXSA 1VLWA 3NGJA 4Z08A 2ZRZA 3GXNA 3TSBA 3STCA 4O10A 1TMHA 2DZSA 2YZRA 1XDMA 3TR2A 3GX9A 3PVFA 4JNMA 4MIMA 4LU0A 3TQ0A 3LCWA 1S5VA 3M44A 3LCGA 3GKAA 3O63A 2ATMA 3O06A 3M5VA 2YYTA 2A85A 4FNQA 1GVOA 1OFPA 1KFEA 1VHNA 2ALDA 2UV8G 1KM0A 3NNTA 2TSYA 1S5WA 1HFBA 2C18A 3RLUA 1ZNNA 3W84A 3KVJA 3GR8A 3MHUA 1A5CA 1VPXA 3H55A 2ZA2A 1C9DA 3MI2A 1I2OA 1QOQA 3MBFA 4UTTC 4AF0A 2QAFA 2NUYA 2Q8LA 4IMDA 1DL3A 4H4IA 1FDZA 1TV7A 4MKNA 5A5WA 4LTSA 1LRNA 4FNRA 2ZA3A 3SGZA 2QJIA 2X1TA 3TW7A 3T7VA 3S5ZA 2ZZ3A 5CG7A 1BKSA 1OX6A 1HTIA 3QJAA 3S1WA 3KVLA 1OG0A 1G7UA 5CZJA 4IOTA 3UXDA 4JTTA 3QC3A 3LHZA 3B04A 4LC8A 3R13A 5AHMA 1P4CA 4QAIA 3NM3A 1ZAJA 1TB3A 4RLIA 3QPZA 1F6PA 4Y6GA 5F2LA 4Z0JA 3LHWA 2A6NA 2NXIA 3B03A 3PF3A 5AHIA 5EYWA 3NPXA 4RXFA 1F7BA 2EPHA 4C1KA 3EX2A 2C19A 2GQAA 4MJMA 5BRBA 5I3JA 1DVJA 2VFGA 1EIXA 1MEHA 1PCKA 2GVLA 3LX9A 1YTEA 2YR1A 4JTJA 2WSRA 4DPPA 5J5RA 2NWSA 2H6RA 3R12A 4ONVA 3L5MA 1W31A 5CZSA 3R89A 1JCXA 3KRSA 3MW7A 1HO4A 3BO9A 4H3DA 3TAKA 5G4EA 4K7VA 4N02A 3LCIA 4LVAA 4XWUA 2Z1BA 3LLDA 3SJ3A 3IVSA 2Y70A 4LC6A 3QMTA 3ABQA 3AJXA 4DELA 3EWZA 4IUOA 4MLJA 2CZEA 1S3HA 1TSIA 5DLCA 1FDJA 3F4NA 3IVUA 4FIQA 3C61A 4ZL1A 2G5WA 2A1YA 2WNNA 3W85A 1DORA 3THQA 2YFOA 3LCFA 1GEQA 1O95A 5DBTA 4NJKA 1FWWA 1SPQA 3GYEA 3NL3A 4WY0F 4FIRA 4QNEA 1CW2A 3NDOA 3TMQA 1R47A 5LHFA 5E0KA 4Z1BA 1XKYA 2E6FA 3PY2A 2TPSA 4ALDA 1JULA 2CZ5A 3TA6A 4GJ1A 4WXZA 1VCVA 1C8VA 2E68A 1KTNA 4GE8A 1WYIA 3SR7A 2ZZ5A 2EKCA 5K2ZA 4GUGA 1OJXA 3FYPA 3P81A 5DXYA 2PRMA 5LGXA 1KM1A 4XZ9A 1LLWA 4JTEA 3FS2A 3PG8A 1GVRA 3QW3A 3QF0A 3S1UA 2VOMA 4LNYA 2A4AA 3NQDA 2NV1A 1XL9A 1G69A 4M7TA 1LROA 1KTCA 1NVMA 1TCDA 3S1XA 1VRDA 3UY7A 1VZWA 5H2ZA 3W72A 1VJIA 4MY1A 1MXSA 4E2BA 1RVGA 1RZMA 4WUIA 4BI7A 3BGGA 4XUGA 1VC4A 1NF0A 3MI6A 1VLIA 5D33A 2YGYA 1ML1A 4XTIA 2DJXA 4LV4A 4KFOA 3W1UA 1C29A 3GDMA 3LDVA 3ABOA 4NT0A 2EAWA 4LRSA 1K8YA 1TPH1 1W5MA 3GVGA 1EPXA 4CNNA 4DO4A 3TV8A 1AL7A 3UPBA 2V0TA 3UWUA 2WOQA 3CB8A 4MYXA 5HMSA 2QUVA 3TH6A 3L5LA 3KOFA 1FCVA 3P5ZA 2GJNA 4LRTA 4MYAA 4OE7A 1TPVA 3OEXA 3KXQA 5FF4A 3GZ3A 5AYYA 1SO6A 2B4GA 3IGXA 1OFBA 3C4UA 3FLUA 1XI3A 1KFCA 1YXDA 3P8JA 5LNUA 3HPSA 3O1NA 1TIMA 4JY9A 3PSVA 2QCDB 2I1OA 5LSMA 2H3BA 2YX0A 1OK6A 5DBUA 1SZGA 2QJHA 3NXFA 3HMJG 1PL9A 3RF9A 1AMKA 3B05A 1H7OA 1AW1A 1RD5A 4FEZA 4LS2A 2JK2A 4NVTA 3L67A 1R2SA 4UFMA 3LRKA 2ZTJA 1HO1A 2ATSA 3SIZA 2DZTA 2NUXA 3HPZA 1WV2A 4ZQMA 4AWSA 1YYAA 3TFXA 3O05A 2A7NA 4GBUA 2NX1A 3C56A 4CNOA 2JKPA 4K8HA 4PL2A 5LKYA 4XTDA 4DO5A 1NSJA 4JIPA 4IXHA 3LBCA 4UTTA 2BLEA 2ZTKA 5IBXC 4MZ1A 3BGJA 1QPRA 3E12A 4GUHA 3AO0A 2A7RA 4ADUA 4OT7A 1PCWA 1VCGA 2YDAA 3M43A 4UMCA 2A21A 4NJHA 1EB3A 1JQVA 1B4EA 1VHCA 2TMDA 3N19B 4UUIA 3TW6A 5AN7A 3W22A 2PC4A 3B4UA 1ZJIA 2X1SA 3L2IA 3L9CA 5G2HA 3FIGA 1RQBA 4YCPA 3NQMA 3VE7A 3IRDA 3BARA 1ONRA 5D37A 4JIQA 5MHBA 3W7EA 1WBJA 1QPQA 1KM3A 4K38A 2R8WA 3UWWA 5C6MA 1KBJA 4RKAA 4O13A 1WA3A 3I68A 4QQ3A 2OMAA 2WPBA 3I7QA 1FCBA 4M6PA 3DH7A 4UTJA 4MPQA 4JTKA 2DORA 2YYUA 5AOUA 3BPWA 4NJGA 3PULA 1ZALA 3IV3A 3E9AA 3PUOA 3EB2A 2CWNA 4EWND 4O1DA 5CPLA 1JCNA 2IQTA 4O11A 1JRCA 2PRHA 3ATYA 4UTIA 4KFNA 1K7XA 2J9XA 1H1YA 1EUNA 1P1XA 1XUUA 1PHWA 2FDSA 4UFIA 3BLFA 4ICNA 4JTIA 1QNVA 3KVMA 4HT3A 2CLFA
chains in the Genus database with same CATH superfamily
3W82A 4A4AA 3EWBX 3G1YA 1XCWA 1H7WA 3T2QA 1NFBA 5D2TA 2PSNA 2FJKA 1JZ2A 2J4GA 1B3XA 1VFFA 3VNMA 1R6WA 3PBGA 5I07A 1YE6A 3HV8A 3RCNA 5GQBA 1TWWA 4PUWA 3T1GA 4B90A 6TIMA 3TDFA 4GLEA 4IMGA 1UWRA 5J8LA 4J3UA 3KBNA 4OU1A 3HQOA 4AEFA 2VZOA 3QZEA 3E49A 6ALDA 3L12A 1P0EA 3HM7A 1FCQA 3R2GA 4GOAA 2PWEA 3EB4A 3LHVA 3FJ4A 3EWYA 2C3ZA 4MLRA 3CUJA 5AZ1A 1U83A 3RXZA 5C9ZA 5D03A 1QCWA 4I90A 4S3BA 3RCMA 3ZS4A 1EO7A 4MAVA 1DKWA 1XLLA 3CZ8A 3TK7A 4DJDA 4ZR8A 3HO8A 4IIEA 5HMDA 3DEQA 1Q6CA 3B4YA 4ZODA 2GSJA 3QPYA 4OV4A 2SFPA 1VKFA 1W2PA 4RZ6A 3UR7A 1VBJA 1QO2A 2CLKA 3L4WA 5DFAA 4QG8A 3G2GA 4IPJA 1LBLA 3GNXA 1M04A 2B31A 4JIIX 1AJ0A 3GRIA 2AQOA 1JUKA 3EKZA 1P7TA 3AWNA 3A24A 2GFTA 4GX8A 3HJZA 1P0DA 3WJWA 4CD5A 1JJKA 2GLKA 2OO6A 1UZ4A 4C6QA 3FNDA 1RJPA 1HQTA 5C7VA 3SW6A 1JAEA 3FY1A 4HGXA 3O6DA 3H2NA 5BOFA 3TTQA 3L4VA 5CBIA 2D69A 1RV8A 4XVDA 1OYAA 3EGJA 3E2RA 1VB9A 4JTFA 4CCDA 1OFAA 3UD6A 3TZNA 5A8OA 2CLHA 4GYFA 1Z9AA 2ZUUA 3IUDA 1GT8A 1V3KA 3TNOA 2JIWA 3U2CA 2XSBA 3AXXA 4YN5A 1PZ3A 4ERAA 4GZEA 4Y8EA 3PBUA 4XBKA 4G56A 4YVVA 4UXDA 3CYVA 1PX8A 7A3HA 3VC5A 4INFA 3WELA 1KKOA 5HMFA 1QBBA 3VUPA 1MQRA 5IRPA 4GVGA 3KM8A 1XIHA 5M1TA 4LUTB 2AAMA 1EP1A 3W1PA 3VDCA 3MUCA 2VWTA 1BSIA 3TA9A 4HNTA 1QNQA 2GQ8A 3EPMA 5LIUX 5AYZA 3VABA 2A2IA 3DYPA 3A3WA 4DZHA 4DF0A 1RY8A 2BY3A 3PB0A 1TWSA 4C60A 1XM3A 4KGJA 5EY5A 1QT1A 1S3TC 3KCOA 2REQB 3TZFA 4TUFA 1PWLA 3VD9A 3W23A 3T0TA 1YDOA 4FALA 2PPGA 2GVGA 4BCEA 4GNJA 2TAAA 4BF5A 2JE8A 1IT8A 3SSZA 1GZ1A 4B2DD 5L9FA 2NQ9A 7XIMA 3KP0A 4NYUA 1YHTA 4WCJA 2BVDA 3R25A 3WJZA 1RR2A 1C9WA 1V4YA 1WDDA 1TPC1 1A53A 5I3KA 1S2AA 5CPNA 2XGIA 4C6DA 3P5YA 2IPGA 2A5HA 4GWEA 2CZFA 4J5NA 4O8RA 4K2SA 5KMYA 1AD1A 4UQAA 4QJ3B 1HKIA 3A22A 2PDLA 3NXLA 4ZOAA 4D6FA 5K7JA 1BSLA 3VNLA 3SECA 4HA4A 3IS4A 1D3CA 1UMLA 1GZGA 5AKQA 4OV9A 3H21A 4JDBA 4EPBC 1VEOA 2WSKA 3LXCA 2Z1VA 5D05A 1JPIA 4HK5A 1Q63A 2DSVA 4QCEA 2YFNA 3TN6A 3NYZA 1DQWA 1E4LA 1EJ7L 1EEPA 4GFIA 1DJYA 2QJGA 4NZ5A 1IIHA 3LD5A 6ENLA 1H0IA 3FGCA 2BWGA 3U3HA 4PCTA 4QBXA 3URNA 1ZZMA 2FTYA 5L6UA 4WDXA 2O7SA 4A6GA 3OYXA 4HU4A 1TQJA 4LVDA 1N8WA 2YBTA 1D8CA 2ZRXA 5HJYA 1WKDA 1XYLA 1C93A 5BWAA 1EA9C 4FLOA 4NX5A 3RYSA 3A13A 3S2LA 3H54A 2X1IA 1EGMA 2XN1A 2HS8A 2XH2A 1O1ZA 2V5LA 1JPDX 3N9SA 2XN0A 4U5KA 5CSYA 1QNPA 3UWYA 3GIQA 4H9MA 2E8YA 1B3VA 2VX5A 3QZ6A 3I6EA 1E6SM 1FWDC 3VYLA 2P53A 4AHPA 3UG5A 3TWBA 2Q8XA 4DUOA 3KW3A 1S46A 3VZZA 2AAAA 4IJBA 3O0FA 1BXBA 1VFLA 1OT1A 2WMHA 2XVPA 4CNPA 3A5VA 1V93A 5KTLA 4Q8UA 3MP3A 4JTSA 3K8MA 3BL3A 3KFTA 1O4UA 4M56A 3L4XA 5HWJA 3AXMA 2O9RA 5FF3A 3TN3A 2XIIA 4HTYA 3MJYA 3WK1A 3IJ7A 4GFSA 2WHKA 1UWAA 1YNQA 2MNRA 2CZVA 5D9NA 2P1FA 4XZIA 1UUQA 2WWCA 1LOQA 4AX6A 1BVWA 1KBKA 4CN4A 4PCFA 1WDQA 1B57A 4M24A 3N11A 2FZNA 3BWWA 4MWAC 3KHJA 1YXYA 3AISA 1EGVA 3MMWA 3SCTA 4IX2A 3S2MA 3HQPA 4DM2A 5A6BA 4K1WA 3JUGA 5ENLA 2FH6A 4K7YA 3AIBA 4JL2A 3THAA 2WSQA 4Z2IA 1SZNA 2WBKA 1QXLA 2BGSA 3JVAA 1EDQA 2EF9A 3MWCA 1TV3A 1W9BM 3VDAA 1LOLA 1ENUA 3M0ZA 1TREA 1NY1A 3SQSA 4JDYA 1J9YA 5CKSA 1BGGA 1QO5A 4PUNA 4PODA 3Q45A 3B8UA 2A3HA 4XAPA 3P14A 1DJWA 2WO5A 2O9TA 3TJLA 1WOBA 3FXYA 3UZZA 1VAHA 1N55A 3OLIA 4HKPA 3FHAA 3VNJA 4X9YA 3VIHA 3RLHA 3GDRA 3BICA 5HWNA 2AL2A 3C0JA 3CXOA 3VFLA 4GUIA 2BXYA 4E4UA 2NV9A 2GGGA 4HVXA 5HR6A 3CUGA 3GS6A 5LIKX 1RA5A 5M2FX 4FNSA 5C5YA 1JQXA 3GVRA 1G01A 4M1BA 4O57A 1BYDA 5TIMA 4J27A 3AWOA 3RCYA 5I79A 3S1VA 2GUUA 5DMMA 4C6MA 1NDWA 1OFRA 1R7OA 4H9UA 1O60A 5EMUA 4PBEA 5C54A 3WX7A 4XIAA 2GWNA 3LNMA 2VT0A 1Q2SA 4IICA 3AXIA 1HKVA 3MWAA 4LCQA 4CD4A 4S3CA 4UFJA 3VIGA 3POHA 3OBAA 1XFCA 2H8ZA 3OIHA 2D0HA 3WH6A 4ASTA 1PWMA 3S5NA 4C6OA 1ZU8A 5CC3A 1QOPA 3IAPA 4JCMA 5JUVA 1I2NA 4K1GA 2CBUA 5HBFA 2P50A 2J75A 3E0VA 3ITLA 2G3MA 1VQTA 2P8BA 3W53A 4Z0SA 4L4MA 1F4AA 2VYOA 3VCNA 4JYEA 2GK1B 1MSSA 1TV8A 1A5LC 3B0VC 1W9UA 2B81A 3E74A 4BK9A 2AQVA 3BZGA 3VI2A 4NZ3A 4UMBA 4QITA 4OVXA 4PSPA 4AD4A 3RU6A 4PUKA 1HG3A 2E9LA 3WF1A 4POCA 4JYFA 1JDDA 3SADA 1E6QM 1UJQA 4TX8A 3BV4A 3KZPA 4YTQA 1VP5A 1GPFA 4JFSA 2VEPA 1SR9A 4AB4A 1SFJA 1JNDA 3CWHA 4JS3A 3TX9A 4XSMA 2VVNA 1TX2A 4BEQA 4RDZA 4LFYA 1OGGA 3PNZA 3MV11 3PZUA 4DF2A 3G6MA 4UCGA 4JHMA 2FVKA 3A64A 4C6BA 5JH1A 4BEUA 5ECVA 1AUSL 4NF7A 2IXUA 3KP1A 4H04A 2V5BA 1HP4A 4D2JA 5FSDC 3B0PA 2RDWA 4GI6A 1J6PA 4NYYA 1V6XA 2CLEA 3G6LA 3NM1A 3W25A 4D9PA 9RUBA 3DFQA 1CTNA 4YTSA 1CPUA 3F4VA 3UCCA 1KKRA 1FHVA 4C6EA 4RDYA 1GONA 3WLJA 1UQZA 2CYGA 2QNEA 5BZAA 4O17A 3NG3A 3SCSA 1HKWA 4C6LA 3RILA 3U0HA 1XC4A 1TTPA 4XZNX 1R2TA 1HW6A 4O1AA 5TQLA 2OT1A 4M81A 1M7OA 1XLJA 3LPFA 3CT2A 5E1QA 1QHPA 3ANYA 2OR2A 1F8MA 1ZJBA 3OODA 1CB2A 1LWJA 3UR5A 3ABRA 3W37A 4AF0B 1XPGA 4TMCA 2G4JA 1U5HA 3WBXA 5CPTA 2ZRYA 4DUVA 5IOBA 4FOUA 3UPWA 3P67A 1YQ2A 2XIBA 1YW1A 2BGNE 2Z24A 1TG7A 1QWKA 2OGJA 3R0KA 5JBFA 5C9XA 4GNKB 3N2BA 4QX4A 3GR4A 3V75A 2HXUA 3ZOAA 3W9ZA 4UBPC 3B9DA 4PMDA 5LIYX 2DSWA 3KE0A 3J7HA 3OYZA 3EDDA 1XRFA 4WJXA 3CL8A 3GC2A 2VEKA 2IKIA 4PCNA 1ALDA 2GQ9A 2D23A 3GFXA 2QCMA 1RBOB 4P61A 4CQ8A 4KKXA 4MKVA 3WENA 1LWHA 2G37A 2VFFA 1HL8A 3T9PA 1OY0A 4HCLA 3UZ5A 1SFLA 5EMLA 1WXZA 2YKKA 4O15A 2XYLA 3G77A 1X98A 4GJJA 4AWTA 1GQLA 1NWRA 1M7PA 1IZJA 1JCJA 2V3GA 3DFSA 4CEXC 1KWGA 4UR7A 1XV8A 3ELFA 1L0PA 1JR1A 1J93A 1P0KA 2HE8A 2OELA 1B3OA 1K7EA 3T0BA 4H83A 3QMRA 3LRMA 2P76A 5FJRA 2R1LA 4AUBA 4LAUA 4ENLA 2VRKA 4P7NA 2GUYA 1RP8A 4Y9AA 3RPDA 4A2SA 3AZSA 2ZA1A 4DWSA 4J3WA 4C6JA 1ZJAA 3P2VA 1GJPA 1PIIA 4E2DA 1FXPA 3CPGA 2XINA 3RRXA 1DOSA 5ABGA 4Z1CA 2PDGA 2WB5A 3MCNA 4QTGA 3SCVA 1TKKA 4D6HA 1Z42A 3MYPA 1R3WA 4LYQA 5A6KA 1TE1A 3IJ6A 1X8CA 1S2VA 1GVEA 3LGEA 2NUWA 4WKFA 2DJLA 3CUIA 5I02A 4WHBA 4UIOA 3UG4A 1G4TA 3SUSA 2X40A 4MOZA 3IANA 3PUEA 2AQWA 3IIVA 1JPMA 4S3AA 1E0UA 4A29A 2PBOA 5IDZA 7REQA 4PL1A 1Q2RA 1VEPA 3C0LA 5AC4A 2P3EA 4ZB5A 3VIMA 4ZFMA 1UZDA 4ADTA 5C55A 3BQ6A 4HK7A 1AH4A 4R5EA 2PFHA 4YWSA 1KCXA 4RW5A 1ECEA 5FJJA 1NP2A 4XX6A 3B9OA 8TIMA 2NV2A 1JZ3A 1BF2A 1KGUA 5D2WA 3N3TA 4PUMA 3LUTA 4NRSA 5FKYA 1ECQA 4EVZA 1MEIA 1OFOA 1W1IE 1ZSXA 1EF3A 2F2KA 5CEWA 1TV2A 1FWNA 4FHAA 2XU2A 5EU9A 3WMCA 1RXOB 1DWAM 5DEZA 3M5ZA 1KLYA 2PGFA 4TVDA 4WY0A 1FH8A 4WQ6A 3PPFA 2PDBA 1UPMB 2P88A 4GYJA 2HJPA 4YXGA 1VRXA 2WSYA 1N7KA 4ZVJA 2VXNA 1QPNA 2QAPA 3T08A 4HCHA 3SY5A 1OCBA 4HBKA 4CCCA 2A0NA 3DXIA 3WDHA 4B5WA 2QV5A 3CC1A 4Q8WA 1T6MA 3W7PA 1WDPA 4I9TA 3BSMA 4AZBA 1OQFA 2BVWA 2F2HA 5AYIA 1E5NA 2QCHA 2XFFA 4CU7A 1E6ZA 1DQXA 4J3TA 3W00A 4PYSA 5AB3A 3RHGA 5I3HA 4JQ2A 1WAWA 4ADSA 3P60A 2QVHA 4KWSA 4I9MA 3NZ1A 1FBAA 4LW7A 3QM3A 5HULA 2PMQA 1R86A 1GOQA 3T42A 1UHVA 1I1WA 3TNBA 3ZFHA 5A95A 2ON3A 3L0KA 4I5UA 4BF9A 3ZR6A 4UQ9A 3B8VA 1YTDA 1MO0A 2IMRA 2PWFA 3HBLA 1JCMP 1XW8A 4CVUA 4FXRA 3DG3A 1KRBC 4HA3A 1ZBCA 3D5HA 6REQB 2NZLA 1RQHA 3GHRA 3G1FA 4NNBA 4RUBA 2QCNA 3CAQA 2INZA 3SUUA 4TX9A 4O18A 4PSRA 4V1YA 3IUHA 4ZQOA 1ADOA 2DP3A 3VE9A 2QT3A 5KZMA 5CC7A 4RZ5A 1O7AA 5EMMA 1GOWA 5U4NA 1XLFA 2E40A 4ZCWA 1DWJM 3AZRA 4XD3A 3PC0A 4L1XA 1I9CB 3RPTA 1VYPX 2QF7A 4UNLA 2QDDA 3LRLA 2XPKA 1O5QA 2VNCA 2YL5A 4DZIA 3CASA 1P0NA 2V2HA 4UB9A 4QE5A 1RSCA 5E09A 4L1GA 3W73A 4ZSTA 2CFFA 1CI1A 4Z1YA 3H12A 3K13A 1N8FA 2GJXA 3ITVA 4F0SA 3WMBA 3BJFA 1IHIA 3AYTA 4RX0A 1QI4A 5DMLA 2W63A 5LZLA 2ISWA 3W1RA 4DZ5A 2ZWYA 1DV7A 3GNDA 4KWVA 2FYMA 4Q4MA 2R1KA 2NXGA 4PCPA 1MDLA 4AYSA 5IHRA 5DCBA 3VM5A 3H2CA 3UPMA 5FL1A 3BQ5A 6XIMA 3UWQA 3Q58A 3VIJA 3KL3A 4HOZA 5FEWA 1T5AA 3MYOA 3LI0A 5CXPA 1DP0A 3IUIA 2QKFA 4KWOA 4DO7A 3NZRA 1LCOA 3CL7A 4MTVA 4JOMA 3QV8A 4XV0A 3SCQA 1LQ0A 4JQAA 1FWHC 1HJSA 4G1KA 3C3UA 4HU3A 3PK7A 4U28A 3E38A 4BHYA 5D9MA 1IWAA 3GG8A 3PZTA 1SW3A 3N9KA 3UZXA 2HVNA 2OCZA 3CMJA 1JYWA 3GXTA 1KXVA 2VO5A 3VTRA 3MP5A 4NG3A 4WDWA 3CM4A 4L56A 3WQGA 1XICA 4NNCA 1IGSA 3WJSA 2PDMA 2WQDA 4K3ZA 1TQXA 2PTDA 3B06A 1E72M 1FY6A 4E8DA 3NQ2A 2V2CA 1QPOA 2ONEA 5FACA 2Y5JA 3N2OA 4GABA 3CHEA 2HNEA 3QEZA 3W88A 4M7SA 2DQWA 2ZYFA 3DHFA 4CNTA 4NP7A 4HU8A 2CC0A 4NZFA 4H7CA 1DJIA 3UJEA 1XH2A 2WJFA 2EPMX 2BY0A 1LZOA 4D6IA 1XIFA 4LX4A 1OEPA 1SSGA 5EPDA 3H7VA 3IPWA 4P2VA 2OSXA 1CGXA 4X63A 2BTMA 3VCRA 1AW5A 3N18A 4Z08A 2BY1A 2PLMA 1TMHA 2QJNA 4D6DA 4GQRA 4IFKA 2W91A 4LU0A 3LCGA 2V3EA 3O06A 2YDQA 4FNQA 2KAUC 3KOXA 1OFPA 1KFEA 1VHNA 2DT3A 3ARXA 4HMCA 3N15A 2UWFA 1UD8A 1DHKA 3NNTA 1HFBA 3KVJA 2XIMA 3MHUA 1A5CA 1VPXA 1C9DA 3MI2A 4UTTC 5FSEC 3VOFA 2EJ1A 7CGTA 1FDZA 1SZRA 4JTAA 4LJ3A 2ZA3A 1DIDA 3AS0A 2XSAA 2J74A 2X1TA 1OC5A 3HMCA 5AC5A 5ABFB 2ZOXA 2PWDA 4DLMA 3S5ZA 2ZZ3A 3UZYA 3DN5A 1JCTA 3VUSA 4CU8A 2QQ6A 2VX4A 4IOTA 3UXDA 3QYSA 3WUEA 3QC3A 5AHMA 1P4CA 4IHCA 5E6YA 2VQTA 3ABXA 3ZSSA 5HPOA 4Y6GA 4IH3A 4HSHA 3PF3A 1XG3A 5EYWA 3QLLA 4RXFA 1IR1A 4DI8A 3SRFA 3PZVA 1Q13A 2J25A 3SUVA 2C19A 5BRBA 3URQA 3UBPC 4UQEA 3ONCA 3CQHA 1RALA 3R7MA 2YR1A 3IJDA 4JTJA 3NZQA 5J5RA 4A05A 5A8PA 3R12A 4PMVA 2WVSA 3E0LA 3R89A 4JL1A 3TAKA 2NW0A 3E1F1 3WN6A 3LCIA 1UA7A 1GW9A 4GMEA 1FKXA 3RU8X 3L4UA 4TTUA 2Y70A 4RPPA 2ESCA 3MV01 3EWZA 4IUOA 4MLJA 3UXKA 5DLCA 3BCDA 4FIQA 4AG0A 2Q02A 3LY0A 4C7FA 3W85A 3ZVHB 2HDJA 4DJFD 1Q66A 1O95A 1JYVA 1FWWA 1SPQA 4D6EA 4C65A 2ZUMA 2WLYA 4QDPA 2BP1A 5LHFA 1CCWB 4Q4OA 1NDYA 1UIPA 3TA6A 3TTEA 4G1NA 3WCZA 3SR7A 5K2ZA 3I3BA 1TX0A 1LUCB 1IEQA 3LPPA 3DGBA 5DXYA 1T7LA 5IFPA 3K1GA 3VKDA 4JTEA 2OLSA 3BOLA 3NSXA 3EWDA 4LNYA 5B7YA 4HCDA 1R87A 2OOFA 1KTCA 5CSUA 4DYKA 1J5SA 3ALFA 5H2ZA 4C7DA 1QVBA 1JDCA 4E2BA 4M3PA 4DJDC 1CXLA 4WUIA 5A3HA 3BGGA 3MI6A 3WZ0E 4ERIA 3T09A 4XTIA 2DJXA 5BXRA 3K1DA 1ODZA 3IJLA 4LV4A 3W01A 3W1UA 3GDMA 3ISIX 3GD6A 3NTYA 3PJXA 3L4YA 2C1GA 4MNLA 1K8YA 1TPH1 2QPSA 1WE5A 1V6WA 1VPQA 2YA0A 4V28A 3UWUA 3CB8A 1C8XA 1AH3A 2PU0A 3M0MA 3KOFA 2ISFA 4MYAA 4OE7A 4DAFA 2C8NA 2OSWA 2XVLA 4TV5A 1U2YA 3RGTA 1KXTA 1SO6A 1J0HA 4ZGYA 1Z7AA 4JHZA 2YCLB 3WF2A 1YXDA 2ANUA 4FOJA 5LNUA 1AQMA 3HPSA 4HOWA 3O1NA 1TIMA 3I3EA 5I23A 2BY2A 4QG6A 1LL7A 1EYWA 4Y7EA 3VXGA 2V3FA 3KHDA 1RD5A 1SVDA 3BLKA 3LBOA 1X6LA 2V63A 4LY4A 4ES4A 3MS8A 4Y9OA 3LRKA 1C90A 1P6CA 2XGBA 2DZTA 2PD9A 1QNSA 1NU5A 3KEHA 2ISDA 4PMXA 3T05A 2NX1A 4K8HA 4P7LA 3RM9A 1NSJA 4DJED 3POCA 3M07A 4DYEA 2BLEA 1QPRA 3BMXA 4OT7A 2QIWA 1VCGA 2YDAA 4CQBA 1EB3A 4W8AA 1W3HA 3N19B 3TW6A 3W22A 1TJ1A 2QUNA 3FIGA 1RQBA 3OOQA 4LBUA 3GY1A 3T0AA 3PJWA 3VE7A 3IRDA 1QPQA 5C6MA 5FJOA 1KBJA 2NSXA 1TA3A 2VVSA 4J2PA 2BDQA 1XRTA 4GQQA 3HV9A 5AOUA 3PULA 3ICJA 1HL9A 1CENA 3PUOA 1JF5A 3CV1A 4CQCA 4EWND 4Z2GA 3KWSA 1ZBVA 2OODA 4AIBA 2CXEA 4KFNA 3CL6A 2J9XA 4I5XA 1PHWA 2FDSA 4UFIA 4MSSA 3BLFA 3H7UA 1JPKA 4HT3A 2CLFA 2PD5A 2QEZA 3MDUA 3U48A 1C92A 3L0NA 1PKNA 2Z4GA 3WDIA 5G2IA 3L2LA 3F1QA 4DIAA 1HL2A 3W1TA 4FB7A 3K30A 4LH8A 5D9OA 1RK6A 3BSHA 3SCWA 5I3GA 4E2VA 4WK9A 3MC5A 2G95A 3ZWSA 1CXIA 1V0KA 4W84A 1ZB5A 3EX1A 2PDNA 1B31A 4GC4A 4NJIA 1DTNA 2OZ3A 2WCSA 1G67A 2BOEX 4EPDC 1D7FA 3IIXA 3LOTA 2ZZ1A 2LLEA 3BOXA 1W91A 3SUWA 2CCRA 5C2XA 3CNYA 3RO6A 3I3DA 4PMYA 2QS8A 5I0DA 2WZMA 3GXDA 1XLCA 3MCOA 5BW6A 3AXHA 3MPGA 5T9BG 2YOCA 4HZ6A 5TBOA 3DDMA 5T8GA 1YNYA 1QATA 1XIBA 2AL1A 2GVJA 4RE0A 2O0TA 2IPJA 3PZ9A 3GK0A 2GDVA 3K2GA 4Q4QA 1UASA 3N2CA 3BTNA 3WJXA 2Z1KA 2CEQA 2DZUA 1CIUA 3KS6A 2W0UA 4AZ7A 4MVAA 4HNVA 3LQGA 2CW6A 2J9YA 3H6OA 2HZGA 1XYZA 2E1DA 2VD9A 5FESA 4HYRA 3S47A 3MO4A 3KTXA 1BTMA 2JGYA 4ZQPA 5I2UA 4YTRA 3A4XA 1IZKA 4AZHA 4NQ1A 5CGTA 1A50A 3W7CA 3H2OA 3O6AA 1JI1A 2Y89A 1QTWA 4ROPA 3SY8A 3F4WA 1MEWA 2C91A 3I7SA 3M16A 1I8JA 3H53A 3EXSA 4MB4A 5ABTA 2X0YA 4HSOA 3TLQA 1DJZA 1YPXA 2CNCA 1NDZA 4NSBA 1UKQA 1R3YA 1R9ZA 1UPPA 3HG5A 3QRHA 3RR4A 4HPXA 3VCCA 5F2IA 3A9IA 1A4MA 3HFYA 2GGJA 2OZTA 3QTGA 2DW6A 4DUXA 1W6TA 1PZ0A 5D2VA 1H50A 3P82A 1OFEA 4IX0A 1IR2A 1E6XM 4D1JA 3TOPA 4AZ5A 3DKJA 1NDVA 1BAGA 4IQLA 4K36A 4S2BA 5CSRA 3H26A 3LCLA 3FN9A 3SCPA 4NI8A 3IJ9A 4YTTA 2Q09A 3APGA 3T8LA 4MHBA 5IBXA 3OW1A 4K8GA 2DIKA 3C6CA 1X6UA 1OX4A 4BKNA 2PDHA 4YVXA 1NARA 1ONEA 3REQB 4UFLA 3N12A 3GH7A 4LF1A 1W1B1 4FPSA 3TC7A 1POKA 1ITUA 3FSTA 4CD8A 5TAOA 3LXAA 4M5PA 4PC8A 5BXPA 4ZQNA 4IPLA 1LTDA 4MB1A 4LT9A 2WNZA 3ECQA 4XO6A 1FA2A 4M6VA 1KTBA 2NT1A 1W5PA 4KERA 4MNKA 1V3LA 3W7KA 2VCCA 4O1EA 2FZMA 3BSGA 3O07A 1BRLA 1FWSA 4O12A 1E0VA 3ZWTA 1HJVA 5HDRA 3W7OA 1DIKA 3NJ3A 3CO8A 2RJHA 2XG9A 1T40A 1LDCA 3EMCA 2A3BA 5T9CE 1TR9A 4L7ZA 2O7QA 2IPFA 3DESA 1E1CA 2XN2A 4YVPA 3STFA 3PS7A 4JD4A 1WB0A 1Q6DA 3GC4A 3VD4A 2Y7FA 4E4PA 1EHNA 3CUZA 1EPVA 3C2YA 4Q8QA 2CPUA 2OQYA 4UFKA 1U1HA 3G1AA 4O28A 4FX6M 2G3NA 4HN8A 5A6TC 3U5YA 5I09A 4XZHA 3R43A 3TYZA 3MY9A 4MPKA 2RDTA 3C3NA 2VHLA 2YSWA 3SFWA 4JN7A 4UTFA 1JCYA 1YDNA 3G5EA 4D71A 1O68A 1OT2A 5D2XA 5MF5A 3VOHA 5HJXA 2O4QA 1XBVA 3S42A 1ESWA 4MADA 1JF6A 4JTRA 3AS2A 1RHCA 2PWUA 3BW3A 2GJPA 4NL1A 2PBGA 2XIOA 2Y8UA 2OLHA 2NQJA 4B3ZA 3CV6A 4GGBA 3S8HA 1OYCA 1X1ZA 2BX7A 2JF7A 4JQ1A 2Q3OA 3WNNA 2QGYA 3SBFA 1QWGA 4EX4A 1ZAHA 2AGKA 1GWJA 1Q5MA 5HNRA 1XRVA 3G18A 1P0BA 4YU1A 4AH7A 2I5IA 2ACUA 1IXPA 4TMBA 3VGEA 1RCQA 4EF9A 3WQWA 4PRRA 1YEYA 1DTUA 1VBHA 4W85A 1YADA 5DO8A 3LGGA 1J0JA 5J5DA 3IK2A 4X2RA 1XXXA 2E77A 4W89A 1P48A 1K8ZA 3IGSA 1DQUA 3WFLA 1Q7QA 4Q8PA 1N2VA 1PJ9A 1EWDA 1R3QA 4JXCA 4ZTYA 1TV5A 4OZOA 3PZMA 4OQVA 1RY0A 5FA5A 4RXGA 4KIRA 3SO7A 2EPLX 1G4SA 2EPKX 5JQ9A 3DYMA 4OBRA 4A3UA 4MM1A 3WFAA 3USZA 3TKFA 3P93A 1VD6A 2YXOA 3MHFA 4LGXA 2Z29A 5DY3A 2BGQA 1WDRA 1QRQA 7TIMA 1B0IA 5AVNA 3OPSA 4B3LA 2Z28A 4YNGA 3VDGA 5G1TA 4DXVA 4PB5A 1IF2A 2FH8A 3NPWA 1X39A 3R79A 1TR1A 1EC9A 4US5A 5HQEA 4H00A 3ZR5A 1Z32X 4EF8A 5C7HA 4M6QA 1Q6OA 1MXGA 4QROA 3N04A 3W76A 1W17A 2BASA 2ISVA 2I17A 1G4PA 3NO3A 1E3ZA 3RFAA 3WDPP 1F5ZA 2TODA 4GI4A 4O1BA 3E0WA 1YPFA 5IFTA 2OPJA 3VAVA 5FI8A 4ZTXA 1HGWA 1SMAA 1XD0A 1ME9A 2JIEA 2ZRWA 3WLOA 5KSWA 3A3HA 4WIWA 1N8IA 3M7WA 3GNNA 1TJRA 3WH8A 5C71A 1UWIA 3QGVA 5KINA 4CQ9A 3UXIA 1BF6A 3UFYA 4HHHA 1VF8A 4QAWA 5CAKA 3GDLA 3I4EA 1PS9A 5F4SA 1CGYA 3M64A 4ZEPA 4MZ8A 2Y63A 1X1OA 4G8TA 3BAXA 3L4TA 5LA0A 2VD8A 3UR2A 1ICPA 1H51A 1FX6A 3VM7A 3TROA 3W2JA 2WWDA 1LM1A 1FWRA 1F6KA 1BYBA 4H41A 1G5AA 4QJ5B 5AYXA 1M01A 2VMFA 1Q8AA 4U31A 2Y5SA 3W7MA 1AQ0A 1EUAA 1A3WA 2W62A 5A69A 1H7RA 3GVWA 4MJ4A 2CKRA 3M7SA 3U8GA 4AZGA 1AD4A 4O19A 3NR0A 1TE6A 3GH4A 2CLMA 3NQGA 3CH9A 5LNSA 3GDKA 3OA3A 1UUOA 2VDGA 1XBXA 3F03K 4LEFA 1NH6A 4HNNA 2PDIA 4RCXA 3VA8A 1ELSA 8RUCA 4I7VA 1FWCC 4I9JA 4S38A 5CJMA 3LHTA 2ZXBA 2VR4A 2I57A 1LL6A 3DFPA 5K9XA 4QDWA 3EX6A 3Q94A 3UZWA 1OF8A 4DXXA 1V77A 1B9BA 3TW9A 4B92A 2G8ZA 4H6KA 2JALA 3IIZA 1H1ZA 5EKYA 1F3EA 3U7VA 2ACSA 1IZCA 3C0SA 1J01A 1W3NA 4JTLA 3CPRA 4AY1A 1XF0A 1TZ7A 3DENA 3M0HA 1WKYA 3W87A 2VEMA 2VRJA 2GL5A 3E96A 4ML9A 1W56A 4KRTA 3R6IA 1VFTA 1X1NA 4F9JA 4H9ZA 1KFLA 4NZJA 1V51A 2I14A 1AA1B 3NO1A 4Q4RA 3EDJA 4AXKA 2XJ7A 1QW9A 4IL2A 3RM4A 4UCFA 2GJRA 1I60A 1FRBA 2E09A 4YS1A 1QJWA 2ZUNA 3O15A 2JF6A 2OXNA 1MW3A 1TIWA 3LERA 1WDWA 1H4PA 4ZBCA 3DYOA 3OVPA 3SM0A 1T8XA 3DIPA 1SJCA 3IAQA 1UKSA 4L4OA 1LORA 2Y61A 1MI3A 3K4AA 4FNUA 2PURA 3MUXA 2FFIA 1PTDA 5E0FA 3G0XA 3FXGA 3MB9A 1B90A 2YBVA 1H09A 3OIXA 5CGQA 3DUGA 3MUIA 2VM8A 3BUVA 1SR0A 4NRRA 3H8AA 4FO4A 3LK6A 1R46A 2DGAA 5XIMA 4OUEA 3LCXA 3WQVA 1S2WA 1XQLA 3LI1A 3WL1A 2XIQA 3S1GA 1QW8A 1VJZA 1CZ1A 1DYSA 3VZYA 3BG5A 3NA8A 5F1UA 2C7FA 2FGLA 1UWSA 2BHZA 4I6KA 3HFTA 1F6YA 3VIKA 4C5YA 5KZDA 3PBYA 4JTGA 2RHGA 1WKFA 2C14A 1XLKA 1FQ0A 1FWIC 4E38A 2YDRA 5FOOA 2XFWA 4YTUA 4MJZA 3GBDA 4QXIA 3PB2A 1YMYA 1O94A 3STPA 3WQ4A 1ONWA 1MUWA 4GGHA 2BXVA 4J3SA 2J27A 4WX2A 1SJBA 9XIMA 2GOUA 2IS7A 4L5ZA 2CLOA 3NPVA 3N29A 2X7VA 1OGBA 1UB3A 2FGZA 2WBGA 3BDKA 2E5BA 3EOSA 4PUEA 4GH3A 3WLIA 1H7NA 2GUBA 1SMDA 4DNHA 4W9TA 8A3HA 1XINA 1W5OA 3WLNA 4ZOEA 3WIJA 4KMQA 4W5ZA 2EKGA 4JX6A 2ASHA 2XSXA 3VDBA 2ZXDA 1GK8A 3OQEA 2PTZA 4WD0A 1RQEA 2WKGA 3V5CA 3GHUA 1PV8A 3TJ4A 1ZHAA 3W02A 1GOKA 2V81A 1U30A 4G6CA 4O52A 2BHUA 3IACA 3KBSA 2VR5A 4Q32A 2PUZA 3MBDA 5HUPA 4UTUA 1XISA 3PJUA 2CLLA 2CKSA 1E4NA 2PODA 3DBNA 1N82A 2Z0IA 1FH7A 3UESA 2WZIA 3H7RA 1H5YA 3MI3A 5EFDA 4C6NA 4NAFB 4LUTA 2FZ8A 2V3DA 3M1ZA 1H41A 4DBDA 4LPCA 1EP2A 4YLWA 1OVDA 1PBGA 1VFOA 1AH0A 2QCCA 4RDVA 1Y5XA 3VX1A 3LXBA 4QRNA 4E3TA 1ZPTA 2L5HA 3C5QA 5I00A 4Z17A 3GWQA 3MMDA 3BK0A 3N73A 4AD2A 4Z42C 5DELA 2PB1A 3C86A 2REQA 3FDKA 4KEZA 3NL6A 4G7FA 4N9BA 4AU0A 3MSDA 1QW7A 3O2LA 5HR7A 2XM2A 4HN4A 2VDIA 4GZIA 2UY5A 5KZ6A 4LVBA 1ZBKA 2OX1A 4HIBA 4PH6A 3AU2A 2WKJA 5K3VA 4A8IA 3TU9A 4A2RA 1D2KA 1RAKA 3PZIA 4IISA 3EWWA 3R4IA 2YJQA 4ZE4A 1RJRA 3K4DA 3NQCA 4BQ5A 3NURA 1FDYA 4YL2A 1JG9A 3QSRA 1R3TA 4Q6JA 5AHEA 2Z7GA 4J3XA 2WZHA 3OO2A 5D32A 4UQBA 1W54A 4QGCA 5C9WA 1GOOA 1KD0A 5GPRA 2XZ9A 2XH0A 4AVNA 5M5DA 3UXLA 3BLLA 5D30A 5HNUA 4PMQA 5F1VA 2AMGA 2R1MA 1L9WA 3W6YA 2OKTA 1OFQA 5HNTA 4CVWA 3N17A 4QE4A 1D3GA 2F7FA 4L6DA 1EP3A 4YJ5A 1IT7A 3RJXA 5CCZA 3OB8A 5I24A 1EZ2A 3OZMA 2FJUB 2BG5A 3QFEA 1THFD 3EAUA 3WO8A 1E6NA 2X0HA 3V3WA 2IW0A 3QQ0A 3AUJA 2HK0A 3TXZA 2V5KA 2J77A 2OZ0A 3CS2A 1GKQA 4FF7A 2PU1A 4AFYA 4MWAD 3STGA 1KR0A 1LT8A 2WNQA 1T41A 3B8TA 2QXWA 2C79A 1GG1A 2NLYA 4GQ0A 3THUA 3TC6A 2HVMA 3WQCA 3GAKA 3HOJA 4TR9A 2H8XA 2WC7A 1EX5A 5BNKA 3BZJA 1CB7B 3A6OA 4NU7A 4GVHA 4PMZA 3G22A 2J88A 1LG2A 4LF2A 3AHYA 1UH2A 3HGSA 3AICA 4AEOA 1NJJA 4ZO7A 3C2VA 4LCRA 1Q6QA 3CAVA 1BG4A 1PEZA 1CGWA 1PB0A 2EQDA 1W8SA 3UVAA 1I2PA 1WZLA 1AQFA 5CSSA 1DXEA 2ADAA 2FTWA 4NXKA 2VI0A 4JKKA 1T99A 4HZ7A 1TV4A 4JTHA 4M80A 4F79A 3U2OA 5HAOA 2HV5A 2W67A 3BAJA 2NVAA 3FJLA 3R0DA 1UWUA 3UJRA 3CEUA 3ANVA 4GKTA 4HMDA 4HOXA 1OADA 2D3LA 5CJ5A 3EMQA 4IP5A 3FA3A 5CZTA 4KFPA 4KQNA 3KBWA 1PUDA 2XVGA 2EJAA 2DT0A 3NL2A 1KM6A 2WJZA 1EIBA 4ZFCA 1Q65A 4KCWA 2VURA 3B3DA 2VELA 4GO8A 2BOFX 5DT7A 1EQPA 3O8AA 2D73A 3L68A 4JTUA 4UTLA 3EKGA 2DZXA 4D72A 7ENLA 4A22A 5D2YA 4IT1A 1SO3A 1NTHA 1ZP4A 2VENA 4WKAA 1OZMA 1TVNA 4DBWA 4JNZA 2A3CA 3W7RA 1Z48A 1W3TA 5I3FA 1A0EA 1R0MA 3ZQ9A 2FB3A 4OWGA 3A21A 1QNRA 1B54A 3CK5A 1H5VA 1F8IA 3ARSA 1PX3A 3HGRA 4GZJA 4B5NA 3W1NA 1SW0A 2J78A 3BVJA 3GG0A 2CLIA 2Q8ZA 3DHDA 5CQ1A 5H1WA 1JPHA 4AY7A 5A6MA 1ICSA 1EJSC 1EOKA 4Q33A 2PP3A 1LRTA 3ITXA 3A5FA 1XLMA 4F4RA 3KBJA 4IIGA 3R58A 4F0LA 1EXBA 1F3WA 2ZX5A 4X22A 1CBGA 5LA2A 5I78A 3FFSA 2J62A 2PDXA 2RFGA 3NQEA 1VFUA 5CPQA 4QSHA 2QIIA 5GNZA 4NASA 4AVOA 1FFQA 3MT1A 1KM4A 1OIFA 2GDQA 1JUBA 6CGTA 5FJIA 3TQKA 3OVQA 1E9ZB 3NQBA 4D6JA 1A5BA 1F2JA 1US3A 2Q6ZA 2E67A 4NNAA 3EB3A 2PRLA 4QS5A 4LCSA 3G1SA 2CLPA 4KS0A 4IM4A 1A5KC 1M65A 2A3EA 3W86A 2FMNA 4R9OA 4GI8A 3SIMA 1Z3NA 5AC6A 1WNOA 4IPPA 3WF0A 3S6DA 1EFZA 1Q7ZA 4BZYA 4TQTA 1L8NA 1KRCC 3T2PA 5G1MA 3QW4B 1KW1A 4PBFA 3SAZA 3EX3A 4GRSA 2GK1A 3GE7A 1W0MA 1J0KA 3NWRA 4ACZB 1DHPA 5XIAA 4QNWA 4C7GA 3LN3A 1QI5A 1ISZA 3WK3A 1AG1O 1NELA 5F4XA 2GYIA 3BOFA 9CGTA 3NL5A 3ZO9A 1LBFA 3GU2A 3W4RA 1YDYA 3GH5A 2D3NA 4LOCA 3AZTA 2Y24A 4Q4PA 4HJWA 4XISA 4GACA 2P0OA 1REQB 3UYCA 3CUFA 3MHGA 5U7SA 3V16A 3WSUA 1ONXA 3NQ6A 2WCGA 1L6GA 2XWEA 4XIMA 2OT0A 3T55A 4NKCA 4ZO8A 4ILSA 2J6XA 3D6NA 2ZUTA 4LAKA 1F07A 4K6AA 4D8ZA 3CZKA 3C2EA 1QI2A 3B0YA 1AK5A 1FWGC 1TRIA 3VNKA 1FP9A 1J10A 5AHNA 3G1RA 3LMYA 3GTIA 1D9EA 3QFWA 5DY2A 1VLWA 1B3WA 2ZRZA 1KGWA 4XD5A 4H6RA 3UA3A 2YZRA 4S39A 3CV2A 3TR2A 2DVXA 3E5PA 1W2VA 1YBQB 3OBEA 3BJSA 3NSNA 3VMOA 4Y9NA 1HGYA 1MMFA 3S3GA 3M5VA 1EJVC 5AYBA 4CN1A 3PTDA 2UV8G 1KM0A 1K9DA 3GFZA 3V36A 2TSYA 2C18A 1WCGA 3MZ2A 4IIHA 4Q3MA 4AY8A 1I2OA 3K46A 4AF0A 3MBFA 2XH7A 2F61A 1DL3A 4DNMA 3AS1A 4GD0A 5CLWA 3TWAA 1LRNA 4FNRA 3ZLFA 4Y9MA 3TW7A 3KCJA 3T7VA 4W87A 1BKSA 1Q85A 3VZXA 1C3FA 1XSIA 4EACA 2GZXA 1HXJA 3KDNA 3QJAA 4C6CA 3KVLA 3URBA 5E70A 3LHZA 3QHMA 3N6HA 3R13A 2DVUA 2GWGA 4J3ZA 1UOZA 2FHFA 1ZAJA 2MUCA 4RLIA 4JAWA 5F2LA 3B03A 3LHWA 4UOQA 3NPXA 1W1A1 1JYXA 4C1KA 1QK2A 3XIMA 4OKDA 2GQAA 4MJMA 2VFGA 3VIIA 2AOSA 5HA7A 4W86A 4UQDA 1MEHA 3UJFA 3RPMA 5FD0A 3TLLA 2QULA 2WSRA 1M53A 1MRAA 2ACQA 4NY2A 3MW7A 1HO4A 5G4EA 4K7VA 3VGGA 4DXKA 4H8VA 5AY7A 4C6IA 3HURA 3LLDA 1OB0A 3SJ3A 1NOWA 3IVSA 4PGLA 1MQQA 4JPGA 4PMUA 4U2ZA 3QMTA 3ABQA 4DELA 4EXQA 3IVUA 3QV6A 3MKKA 1Q6EA 2PDFA 4ZL1A 4YHEA 2AKZA 3FAXA 2YFOA 3GBEA 2YIHA 3BH4A 3TYEA 4KGLA 2GGEA 4HQVA 2Z1XA 4NJKA 5JIWA 5C70A 4WKHA 4IPNB 2PF8A 4FIRA 3TTOA 1CW2A 4S3GA 5E0KA 4Z1BA 3H23A 1XKYA 2HBVA 2E6FA 3PY2A 4ZE5A 4ALDA 4JEJA 1Q7MA 2CZ5A 4Z2LA 6XIAA 3BE7A 2EKCA 4GUGA 1OJXA 3BURA 1WZMA 3FYPA 4H2HA 1C7SA 4LSBA 4Q22A 7PTDA 1RPKA 1KM1A 1RP9A 2DVTA 3QW3A 3RLGA 1EJUC 4O1FA 2CITA 2A4AA 5LA1A 2QMJA 4RZBA 1EBGA 4PRWA 1G69A 4M7TA 1TCDA 2YCKX 1V03A 3CIVA 1DXFA 2EXOA 1MXSA 2C71A 3OZPA 1RVGA 4MF4A 1IEWA 2I16A 3E2QA 1XGZA 2FMOA 4F3HA 4QJ4B 1VC4A 1XQKA 1ML1A 4QHRA 1IGWA 3WH7A 1BGAA 3UWEA 3RM8A 2Z1SA 3ZLHA 1W5MA 3GVGA 4DO4A 3TV8A 1AL7A 2IPWA 2V0TA 2G3FA 2QUVA 4LUSB 3OGRA 1F9CA 1GVIA 2J7HA 3KXQA 1TFVA 3CGTA 1OFBA 1VIWA 4RL3A 1XI3A 1W1PA 4ML4A 2WVVB 4JY9A 3PSVA 2QCDB 2YX0A 4JCLA 4RE2A 4I3GA 3HMJG 2I56A 3RF9A 1AMKA 5FL0A 1H7OA 4LS2A 4GIRA 4NVTA 1JDAA 2O4MA 3L67A 1NM9A 2OWWA 2R6OA 2J47A 4UFMA 1UD6A 2ZTJA 4RE3A 4WSJA 2BVYA 1AODA 2NUXA 3HPZA 3SRDA 2UY3A 4AWSA 1YYAA 4Q8OA 4GPNA 5BXSA 3KZSA 2A7NA 4GBUA 1PDYA 3AMKA 4AZIA 3K8KA 3D3AA 4CNOA 1IV8A 4OBSA 1ITQA 2FZBA 1FP8A 4KWUA 4U3AA 1UD5A 4XTDA 1WZKA 4IXHA 3E5BA 5IBXC 3VD7A 1TUXA 1DWGM 5BU6A 4NJHA 5DQPA 2QZRA 1B4EA 2TMDA 4A8RA 4UUIA 5AN7A 2PC4A 3AHVA 3NQMA 1VEMA 1ONRA 3WH5A 4F8XA 3W7EA 3UWWA 3IGHX 3RX4A 4O13A 1WA3A 3I68A 3ARRA 1FCBA 2FZ9A 4UTJA 4MPQA 3AQUA 2UZ9A 5AZ0A 3AFBA 3IV3A 3B9AA 3EB2A 7TAAA 3RN6A 2PDUA 4Q8VA 4O1DA 1JCNA 1W3KA 3MUY1 3VOIA 2IQTA 1MDRA 4XSLA 2AKMA 3N4FA 4TVCA 2PRHA 3GC5A 5GJPA 3ME3A 1K7XA 1UZHA 3NEHA 2W9MA 4IQEA 1K70A 1XUUA 2XDFA 1Y5VA 2PCEA 7ODCA 1QNVA 1S39A 6REQA 1NWTA 1V3HA 3DCPA 4AWEA 3HPAA 3L21A 1TRDA 1RPXA 2JBMA 2FIQA 4GJIA 1XIDA 3PWIA 4C6FA 2I9EA 1I4NA 2WMIB 5A6LA 2ABBA 4R34A 1KV8A 2RKXA 2GJLA 5BYWA 3M41A 1E15A 4OFCA 4DHGA 1X97A 4K39A 2EPOA 2OG9A 4B2DA 3TAOA 3CZEA 1Z44A 5A2BA 2DY3A 5CLTA 1WP6A 2HVOA 2P10A 3AIUA 4LUIA 1P5BA 1Z69A 3HTWA 1POJA 3PJTA 1EJWC 2VR2A 2X09A 3EOUA 4OIFA 3TFCA 4F66A 2Z2AA 1DJGA 3W7NA 2VFEA 3D46A 4TU1A 1IXQA 1F74A 3EDEA 3GUWA 3TXVA 1XBZA 4UWMA 2E9MA 4FR1A 3BCFA 4JKLA 4HNLA 3H22A 2EG6A 1H61A 3N13A 1QK0A 2D20A 2PZ0A 4JFWA 4RNFA 4JICA 1M7JA 3SFKA 3TMLA 1E9YB 1ZJHA 2ZRVA 4AVFA 5AHLA 3WDQA 3WD2A 4IWWA 1MNSA 3OZYA 1PVNA 3B9EA 1NWUA 3R8HA 4UZSA 1UKOA 4LAMA 3ZM8A 1UR9A 4H9TA 4CD6A 1R8LA 3FJ6A 1ZQ5A 3UU0A 3PFMA 2POZA 1UH4A 3P8IA 2ACRA 1EOMA 2XISA 2RDXA 4MWAB 3RLVA 4LS0A 1TYGA 1ODUA 3B40A 4Y90A 1V3MA 3SUTA 1L6WA 1FFRA 1E4IA 3UJSA 2QDHA 1GORA 4DX3A 5DN1A 5A2CA 3W2LA 1UP3A 1V0NA 1HIZA 4O50A 3WNOA 2HE5A 5CAHA 1XDLA 4J4KA 3DKLA 2HRWA 2WPGA 3AIVA 3BG3A 3A12A 3R10A 1XIIA 3LLFA 3R8GA 5JBDA 3EA3A 3NQ7A 4GO9A 2A7PA 1F73A 4U3CA 4N9CA 1MQPA 3I6RA 4HMEA 4O54A 3CAWA 1PX4A 4U2YA 3ZJKA 2GGIA 4XVEA 4S3EA 3RMJA 3PBWA 2NVCA 4XG1A 2OU4A 3DERA 4MMWA 3EPOA 3S83A 4DM1A 4V1XA 4US6A 3I6TA 1Q6LA 3M6DA 6TAAA 5IXEA 1SFSA 3GM8A 2Z1WA 1PE1A 2ZUSA 4U4MA 1BWVA 3SN4A 4YYCA 1F3XA 3TE9A 2C1IA 3R0UA 2V67A 3KUMA 2YL8A 4WGHA 3T40A 3N3MA 4MZYA 4IIDA 1UMYA 3FJNA 1RLDA 3G3MA 4Q7NA 2VP8A 3T81A 4TIMA 3GTXA 5FJPA 2X1UA 1SJDA 2X7WA 1ZL1A 1WDSA 2JFEX 1FOBA 1XIJA 2ZX6A 3W6MA 4RV8A 2RDUA 1KBBA 1BG9A 4NAEB 3G1XA 3QR3A 2Y1HA 3T0DA 3L4ZA 1E40A 3EBVA 2PE4A 2OKOA 4Z2JA 3QR0A 4WXYA 2I5GA 3BLIA 1V3JA 5FEZA 2WZTA 4HZ8A 4J7RA 3W74A 1GYLA 1PKMA 2J7FA 3L23A 4R33A 1C8YA 3MMTA 4Z2HA 1J18A 5ABFA 1HKMA 4H6EA 2EGZA 2CHRA 1Y0EA 3RRAA 3GXMA 1JVNA 4P7OA 3BLOA 3WLTA 3HGOA 3AMDA 2OVLA 4MJ2A 3STEA 2Y85A 5E0CA 2Z25A 2GVEA 1O6IA 4JYDA 2VEFA 4BA0A 4UTMA 3K4WA 3NPUA 5BRQA 2Y2WA 3PPHA 1ZFJA 4HYWA 4ZB2A 3LPOA 2OQHA 2OYKA 3UY8A 4S23A 3EWUA 4LVFA 4EANA 4BFAA 4CN6A 4EPEC 1XYMA 1G0CA 3PHAA 1RH9A 1CXFA 1S1RA 5BMWA 1CX9A 3SCOA 3P7YA 2E5DA 2E6YA 2P8CA 4CQDA 1KBIA 1QR7A 4GVFA 3WD1A 4DJDD 4XKYA 3HB9A 1X8FA 3LB0A 3GHTA 1KV5A 2Q3RA 3W7IA 4AD5A 2V82A 4W4QA 2OB3A 1EH9A 3QGKC 3W7LA 3CV7A 3KX6A 3WLKX 2OEKA 1EXPA 4BQ3A 4MUPA 4Q8TA 5EFFA 1Q45A 1UD2A 1OABA 4RE4A 1E0WA 3WH9A 2VOTA 4IIBA 2VZVA 5C2GA 3AUOA 2X2YA 1WOAA 2QPUA 2OYLA 3N2MA 4O0KA 3P84A 1T96A 3M46A 4OGZA 4AQLA 1KC7A 2DUAA 3FA4A 3CQJA 4N2YA 4URIA 2JEQA 4WJ8A 1E43A 1LUCA 2W66A 3TYUA 1QU4A 4OBTA 3CT7A 2VFDA 1OX5A 4PTWA 4AD1A 2R24A 4UQCA 1G1YA 3BCJA 1OM0A 4LYKA 1ADDA 3HG2A 4LBSA 3GB6A 3W7JA 3KL0A 1OINA 2ZVIA 4G9PA 4LAOA 3SZ8A 4PUJA 1JGIA 2BMBA 3NQAA 3L7RA 5LGZA 2WM0A 2G97A 5C0QA 4AZCB 1TPFA 1LL4A 3GDTA 3TSMA 1ZGDA 1VGAA 3M0VA 3G1HA 3NO5A 3PSWA 4GXMA 4L9XA 1UBSA 3QZAA 1DIEA 4QLJA 1KM2A 2RGLA 3HA1A 1X38A 2NQZA 2J7CA 2EG7A 5F2GA 1G6CA 2J8TA 1QUMA 4JGDA 1H62A 3F2BA 3VD3A 2P3ZA 4C91A 4R3UA 1ISYA 3RNDA 3WBEA 4G7EB 3U2EA 3SJNA 3BW2A 5D9PA 4BR1A 1Q4NX 3QV7A 2FQIA 1JZ7A 4GYPC 1XLBA 3H70A 3AHTA 3G8EA 4MFDA 1UWQA 1E1EA 3WLSA 8XIAA 2YCLA 3PZOA 2QUUA 4LV9A 3S46A 1YDVA 4N6EA 1GYNA 1JDEA 4XUYA 4CQAA 1A5SA 3R94A 2BXZA 1MFUA 3A47A 4KESA 2I9UA 2NX3A 5TF0A 4I5RA 2CU0A 3L65A 1IEIA 3DG7A 2YW3A 5D09A 1KGXA 1HJXA 3A4WA 3VGHA 5SWUA 5GVJA 3O16A 1GQNA 5CBBA 3W7HA 4G5DA 1GVQA 4IIFA 1EDGA 1T0OA 1E5JA 3JS3A 8CGTA 2PEVA 4XZBA 3OQ8A 3NYDA 3VMPA 5DANA 4PFHA 4JTCA 1GJWA 2MANA 3HG3A 2QDGA 3WQDA 3I7RA 2Z7KA 2X2GA 1CGTA 2FPVA 2WHLA 3ITOA 1IWBA 3SSJA 4PBGA 1W3JA 1KFWA 5E9AA 4AX7A 1IIGA 2E6AA 2PAJA 3FKRA 4R9XA 2W92A 4A8NA 4AHOA 4FS9A 2VFHA 5HNNA 1W37A 4LWWA 3W29A 2NVDA 1KR1A 4ACYA 1HJWA 1XIMA 1QAPA 4FLQA 3QYQA 4HD5A 1PYMA 4PEKA 1KFKA 1FWEC 4DY1A 4JY8A 1QOXA 2QDEA 1NF7A 3GTNA 4ZSUA 1J0YA 1R2RA 1NOFA 2BVTA 4AIUA 2FVLA 3EA2A 2A79A 5I3IA 4N6FA 4IMCA 3EKLA 3S6TA 3TONA 4RR4A 1FVPA 2ZUWA 3RK8A 1TTQA 4DO6A 2YLAA 4C1NB 4KCTA 4L6HA 4XBSA 4UOZA 4EE9A 4PA8A 3C2FA 1KB3A 3WNMA 2VDHA 2YL6A 4HPNA 4UTWA 3PAOA 3PZQA 4L6OA 4YMZA 5T91A 3ZT7A 3FX4A 4L64A 3PTQA 1XYCA 1B3ZA 3WJYA 2B0MA 2X16A 1ZBWA 2DPEA 4UZUA 3DC0A 3V4BA 1SGJA 1RBLA 3GNOA 3F7JA 1JRBA 3T0CA 4LY8A 5FF7A 1T8QA 3LHUA 3ARQA 3EWXA 1BWLA 3EZ4A 3MUZ1 1XFBA 3MKVA 4F40A 3DHUA 3H4GA 3GFYA 3W71A 3NUKA 3S2JA 3AC0A 3USBA 2BHYA 4O8AA 2G96A 3UG8A 1SZFA 1RK5A 2OLAA 4F48A 3LCHA 3PWAA 4IG2B 2Z26A 5CG0A 3U2ZA 3LV6A 1HZYA 3G1DA 2P5NA 4L4LA 5G4HC 2O9OA 1YIXA 2DZWA 2HISA 5CC6A 4ZQRA 1KFJA 1QBAA 1UUMA 2G50A 1EYEA 1TPEA 2RH9A 3WQ6A 3A3XA 4M82A 5A6BD 2QW5A 4N42A 1UG6A 2Z27A 3GYCA 4PB3A 1J0ZA 1R38A 4MB3A 3PUDA 1LF1A 1GEHA 2HEJA 1JD9A 3KTSA 4K37A 2JGQA 3S2CA 4IFRA 3D3FA 4M1RA 1H49A 2VGBA 4AAJA 3VO0A 3ZLGA 3IK4A 4XAYA 4DRSA 4P7QA 3CBWA 1O1HA 4DPQA 1F76A 1KM5A 4PCSA 4ATWA 4PB4A 4EAYA 4U5IA 3DAQA 1OYBA 4GYKA 3D0CA 4X9SA 2HQAA 3W1AA 2IUZA 4ZXLA 1EZWA 1W9VA 4DBUA 2E9BA 2HROA 1UR4A 5MKGB 2DZPA 1O12A 3WG6A 1LRQA 2FLIA 3APTA 4MY8A 1TO3A 4KRZA 3MSRA 4REQB 4JZ5A 4ZO6A 4TTGA 5FEXA 4XO7A 1S2TA 2JKAA 4O4VA 4C1LA 1V0LA 1JNEA 4UMAA 1C8QA 1CECA 1IEVA 3REQA 4OOUA 1Z89A 3Q67A 2FTPA 3CQ0A 1OCJA 3DGRA 2QCFA 3WD0A 1LQ2A 3V0TA 2NXHA 9XIAA 4LYRA 3WDJA 2PP0A 3PPGA 4PUDA 4B9YA 4ZA0A 2XUCA 1Q6RA 1D3HA 2OO0A 5CH9A 5D02A 2F6KA 1VFHA 4WSKA 4C6KA 4JHOA 1NAL1 5H91A 4AISA 1XHGA 1GOIA 2VCAA 3GNRA 4EXAA 1M41A 3D47A 3V7PA 4L1WA 5C9RA 3P80A 3FK4A 1EHAA 2OEMA 5GNYA 3ABZA 2XIJA 1YNPA 3S9YA 1R9YA 3CAKA 1W1TA 4N4PA 2PTWA 1ITCA 3U6WA 3UNDA 1V5XA 2WV8A 3DFYA <