The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
76
|
sequence length |
213
|
structure length |
213
|
Chain Sequence |
TKPMIQIALDQTNLTDAVAVASNVASYVDVIEVGTILAFAEGMKAVSTLRHNHPNHILVCDMKTTDGGAILSRMAFEAGADWITVSAAAHIATIAACKKVADELNGEIQIEIYGNWTMQDAKAWVDLGITQAIYHRSRDAELAGIGWTTDDLDKMRQLSALGIELSITGGIVPEDIYLFEGIKTKTFIAGRALAGAEGQQTAAALREQIDRFW
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal structure of the Mg-bound 3-keto-L-gulonate-6-phosphate
decarboxylase from Vibrio cholerae O1 biovar El Tor str. N16961
rcsb |
molecule tags |
Biosynthetic protein
|
source organism |
Vibrio cholerae
|
molecule keywords |
Hexulose-6-phosphate synthase SgbH
|
total genus |
76
|
structure length |
213
|
sequence length |
213
|
chains with identical sequence |
B, C, D
|
ec nomenclature | |
pdb deposition date | 2009-09-08 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00215 | OMPdecase | Orotidine 5'-phosphate decarboxylase / HUMPS family |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Barrel | TIM Barrel | Aldolase class I |