3JR2A

X-ray crystal structure of the mg-bound 3-keto-l-gulonate-6-phosphate decarboxylase from vibrio cholerae o1 biovar el tor str. n16961
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
213
structure length
213
Chain Sequence
TKPMIQIALDQTNLTDAVAVASNVASYVDVIEVGTILAFAEGMKAVSTLRHNHPNHILVCDMKTTDGGAILSRMAFEAGADWITVSAAAHIATIAACKKVADELNGEIQIEIYGNWTMQDAKAWVDLGITQAIYHRSRDAELAGIGWTTDDLDKMRQLSALGIELSITGGIVPEDIYLFEGIKTKTFIAGRALAGAEGQQTAAALREQIDRFW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Hexulose-6-phosphate synthase SgbH
publication title Crystal structure of the Mg-bound 3-keto-L-gulonate-6-phosphate decarboxylase from Vibrio cholerae O1 biovar El Tor str. N16961
rcsb
source organism Vibrio cholerae
total genus 76
structure length 213
sequence length 213
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3jr2A00
3NPUA 1I2QA 3STEA 5CG7A 1CX9A 3HGSA 1J4EA 4AWUA 2QCFA 3UY7A 2CLKA 4Z0SA 5BNKA 2DZXA 4MYAA 5DY3A 2E1DA 3KXQA 3CHVA 3S0CA 5AB3A 4UR8A 3W7RA 5CPNA 1YPFA 2DZTA 4O1AA 1TRIA 5LGZA 2G96A 2Y6ZA 3F03K 3LERA 3SECA 1JCXA 1R47A 5C2XA 3FYPA 2AAMA 3G1XA 4MVAA 4C1LA 4IGHA 5H2ZA 2G5WA 3A5FA 1UB3A 3HGJA 2VELA 4Z1DA 4ZQRA 1GVQA 3OVRA 3DZ1A 4HNTA 4FB7A 5LGXA 1RPXA 4GUGA 3FLUA 3PG9A 1NSJA 4N2YA 1N7KA 5KZDA 1XDMA 2NZLA 3UWWA 4O53A 4RK8A 4AVFA 4NUWA 1YDOA 3B04A 1FDJA 1Z44A 2J24A 1OYCA 3P84A 1IXPA 3BW3A 3N2XA 3PUOA 1XBXA 3STGA 1Z42A 1YADA 1GJPA 5AHFA 3UPWA 1NVMA 1QDSA 1OFEA 3MO7A 5G2HA 4N4PA 5FEPA 4IXXA 1OFRA 3GB6A 4OBTA 3DFNA 3MI6A 2WO5A 2JKEA 4EVZA 2V5BA 4HT3A 3QW4B 2GJNA 3ZS4A 2CLOA 1RQHA 3G8EA 2ISSA 1KFKA 2PC4A 2C18A 1I2RA 1LORA 2FIQA 3HPXA 1VCFA 5I3HA 2DJXA 3W7MA 2FQIA 3L0KA 3NQ6A 3GK0A 5GVJA 1UCWA 1OX4B 2OT1A 4YL2A 1YXDA 4AHPA 4ADTA 3CEPA 3GXNA 5HUPA 5KTLA 2X1TA 4FNUA 4NJGA 3GYEA 3FS2A 1AW1A 3W22A 1W31A 1ZFJA 5LNRA 2O7QA 4RZ5A 1IIHA 4IMDA 4MLJA 1X7FA 5CKSA 2ZA3A 4K7VA 1LOLA 1XBZA 3PB0A 4N9BA 1I2OA 2ZA2A 1RR2A 1F74A 2E09A 4LS0A 2CZ5A 2VFDA 3NL3A 1LLZA 3GNDA 3NQCA 2VC6A 4ICNA 4ZQOA 5AN7A 2GOUA 3SR7A 1OG0A 3S1XA 4GUJA 5AC8A 3QMRA 1KTNA 3STCA 1SW0A 1SR9A 3FKKA 1K7XA 5KMYA 3R2GA 4FNTA 2RDWA 3P67A 3I7RA 4UFLA 2Q8LA 1GG0A 3CIXA 4H6KA 4GUHA 4NZFA 2FJKA 3C2FA 5TBOA 3E9AA 3V1PA 1G4PA 2FB3A 4B5NA 4LT9A 3G1SA 1Z41A 2CLMA 1XBYA 1H7NA 1B4KA 1W37A 4MOZA 4KFOA 1JCLA 3TU9A 3G0XA 1FDZA 2ZZ2A 3A5VA 3DH7A 1K8XA 3TX9A 3WK0A 3GAKA 4HNVA 1W0MA 5CGQA 3E02A 1I8JA 2CFFA 2B7QA 3GR7A 2TPSA 2DZPA 5KZMA 4AHQA 2ZFAA 4UTHA 1SFLA 4TX9A 5G2WA 1VPXA 3DFOA 4IXHA 2QCHA 2WQPA 2QCEA 3R5EA 3EWWA 4FF7A 3M16A 1LBMA 5K7JA 3NNTA 3ABSA 3W1NA 4XBSA 3O6DA 2Y89A 1SU5A 4LVGA 7TIMA 1LP6A 4KWWA 5DLCA 1OX6A 4WY0B 2C19A 4KFNA 1TV7A 4N02A 1OF8A 3GKAA 3FA5A 5AOUA 1TRDA 4U4MA 1XUZA 4RV8A 4ZVJA 4DO5A 1VCVA 3EB2A 1XCFA 4EWND 2YCEA 1IXNA 5F2MA 5DBTA 1QMLA 2ALDA 4JYFA 4E2BA 4GJ1A 2VEIA 1S5VA 3KVKA 5K4XA 2Y7EA 1EUAA 3TNOA 2Y7GA 3I7SA 4Z1BA 1GPWA 3SJ3A 2PE4A 4A2RA 1WBJA 4UTKA 1JRBA 3ABOA 3GX9A 4M6VA 5I3GA 2ZYFA 2ZQ0A 3PF3A 4GWEA 3NQFA 3W85A 1YPIA 3UPBA 1WV2A 2E6AA 2GQAA 3C0JA 1W1ZA 3LXBA 2P10A 1D3GA 1OFBA 4JTUA 1LCOA 5FF4A 3G1HA 3QRHA 4NXKA 5EPDA 1QNVA 4JY9A 3DFSA 3W88A 1HTIA 4XTDA 1LLWA 3M5ZA 3RFAA 2C1HA 1G7VA 4P61A 3W2LA 1MSSA 1C9DA 1X1ZA 2V2HA 1ZAIA 3TE9A 1XBVA 4CLMA 3P62A 1GT8A 4UTTC 3M0ZA 2P1FA 5FEWA 2GQ8A 1W3TA 2V81A 2X2GA 4ADUA 2QAFA 3GDRA 3GIYA 4IMCA 3MYOA 4WD0A 1EWDA 1GWJA 2TSYA 1O60A 5G5IA 1MZHA 2G97A 3W87A 1XDLA 4E38A 4RJEA 3TA6A 3LHUA 5HUOA 2VEPA 5F4WA 3BO9A 1LRNA 3QZEA 4PODA 5DCBA 3GNNA 3TFXA 3M5YA 3M43A 1PE1A 3EXRA 2ZZ6A 4UTIA 1TV5A 1OFQA 2ABBA 1F7BA 2EPHA 4N9CA 3QW3A 4KFPA 5K9DA 4EOUA 3WJSA 1KTCA 2D73A 3HG3A 1W5NA 3SI9A 3JS3A 1RQBA 3CWNA 3PUEA 4Z1CA 3SIZA 3PS7A 2ATMA 4WOQA 1YTEA 4ZZ9A 4HNNA 4WXYA 3B8DA 1QR7A 5C55A 3WJXA 4JS3A 3HB9A 1FY6A 4AEOA 2E6DA 1OFOA 4M5PA 4K8HA 1XUUA 1KFBA 3HPSA 3THQA 5CSRA 4MZ8A 4K37A 3IEBA 4WJEA 2A6LA 5A5WA 3F4WA 3NM1A 1TJRA 2OJPA 3O07A 1DQWA 2BTMA 1G7UA 1G4TA 1W8SA 3O16A 5CPLA 4NXSA 4BF9A 3NZ1A 1TPFA 2VFGA 4NJIA 4OHQA 2RHGA 3PSVA 4GNJA 3TC6A 3TC7A 2QCDB 3SFKA 4CQAA 1KA9F 2YZRA 3NA8A 3S8HA 2Y62A 3DFTA 3TDFA 4HHPA 1AG1O 4ZQPA 1QPQA 1ICQA 2NX9A 2QUVA 4O0ZA 1H7XA 3W70A 2AGKA 3L65A 3NG3A 3M47A 3NDOA 2FFCA 1WX0A 3HG4A 1YTDA 2ZRXA 3RLUA 3MP3A 5D2VA 5F2GA 2VFHA 1WXJA 2G95A 1LRTA 1OF6A 4QISA 3QSRA 3NQDA 3SY5A 3QQ0A 4JX6A 1B9BA 4AF0B 2O7SA 1DBTA 3ZWTA 2E5CA 1QO5A 3QPYA 1A5AA 4UC5A 3LCFA 1H63A 2F84A 5KITA 3M44A 3NM3A 1O5XA 4JTSA 1S5WA 3C3NA 3JRKA 3TJLA 2VFFA 2R94A 3C8FA 1WOBA 1TREA 1EUNA 4RXGA 4L4MA 2ZRYA 4JR5A 3D0CA 1NF0A 3Q2DA 3LXAA 5DELA 1P5BA 5HULA 5ABTA 3OBKA 4NQ1A 1QPRA 4UXDA 3ZFHA 4IMFA 3CC1A 1L6SA 1HUVA 2VXNA 4RZ6A 1SZNA 4UIOA 1RD5A 3CIWA 3LCIA 4Y90A 2Z1BA 4WQ6A 5IM51 2ZRUA 4UTJA 4BI5A 4UR7A 4CQ9A 1RVGA 1OK4A 2FPVA 2WKJA 1KLZA 3NPVA 4GC4A 3MYPA 1KV8A 4DBEA 3A24A 4JN6A 3QQ1A 3P81A 3ATZA 2ISWA 4HPJA 3PAJA 1W5OA 3B06A 4JTFA 4DF1A 1IXQA 3P60A 3MP5A 4O57A 3W9ZA 1PCWA 1VS1A 1W3IA 4JYDA 1JRCA 3MI2A 5KINA 3HMJG 4O1DA 3LGEA 3P7YA 2E6FA 5DXYA 1G69A 4YWIA 4QQ3A 3HGOA 3PY2A 3B4UA 2WSYA 1JUKA 1R46A 4CNPA 1M7OA 1TSIA 3LM7A 3O06A 5DY2A 4LVAA 1GG1A 1GVSA 4UFHA 1QOQA 2RDUA 4JIPA 4O15A 2WV8A 3NGJA 4XKYB 2ZZ4A 3EKLA 3LHZA 4H4IA 2CLEA 1OFDA 5IBXC 4G1KA 5LNVA 1F73A 1JJKA 3S5OA 4BI7A 1SZGA 2DZVA 1VLIA 4A29A 2XFWA 4M7SA 5FF3A 4PH6A 5LSMA 4XZ9A 3B05A 2P0OA 2XN0A 2J9ZA 3TJXA 1TTJA 4O19A 1K02A 1RQEA 3TSBA 4A2SA 2W6RA 3L5AA 1DQXA 3GAYA 1LOQA 3C2EA 1FXQA 2WNQA 3Q94A 4ONVA 2HSAA 3EXSA 5D38A 1RZMA 1SFJA 1VC4A 1R2SA 4M6PA 5C6MA 3LCLA 1TIMA 4O8RA 2NUWA 5FI8A 2OT0A 4J9JA 1I4NA 4GRSA 1GYLA 3IIZA 4FNSA 4X9SA 1KBJA 4GBUA 2FTPA 3G22A 3R12A 1JCNA 1I45A 6ALDA 1U5JA 2E5DA 2WOQA 3ELFA 4N9DA 3VKJA 4JIQA 2JBMA 4AB4A 3B03A 2BXVA 1H61A 4UUIA 3WJWA 2YYUA 1W5QA 3UWQA 4LUIA 3PBVA 4NX0A 1DVJA 1VCGA 3IGSA 3L68A 2A0NA 3TKFA 3W07A 1AL7A 4GXMA 3RNDA 3HBLA 3BK0A 3HOJA 2YR1A 3NO5A 3L2IA 2VEMA 3NXFA 2QCCA 3PWAA 1XKYA 5FEZA 4UFKA 4N9EA 3OVQA 1KM2A 2I1OA 2EAWA 4QNWA 1X6UA 1GTHA 1VRDA 4IX0A 3W1QA 2WSQA 3OVPA 5G4EA 4LC6A 1B4EA 1M5WA 2E77A 3LBMA 5CZSA 3U8GA 4JDYA 1DKWA 3FFSA 2QKFA 1H51A 2ISVA 4P2VA 2OZ0A 5EMUA 3W7GA 4YMZA 4K38A 2C14A 1J2WA 5D04C 4QM1A 4ZMGA 5L9FA 3C52A 4UNLA 1AL8A 6TIMA 4O28A 4MUZA 2VOMA 2ZA1A 3HJZA 1H1YA 5I3FA 1AW2A 4WUIA 1KW1A 2YX0A 1ZAHA 4DF0A 2W79A 1XM3A 1NEYA 2FLIA 2HMCA 1WA3A 2HS8A 3S5YA 2Q8ZA 3W6YA 4K8EA 5I3KA 2A5HA 4ZQCA 2VKZG 3C61A 4X2RA 2QUUA 2A1YA 2ATSA 3HG2A 3LX9A 4NT0A 2C0AA 5KZEA 3NPXA 2QEZA 1XXXA 2RDTA 1SSGA 3LRLA 1JCMP 2X1RA 2QJHA 5FF2A 3TSMA 1SSDA 2RFGA 3BGJA 1IF2A 4O10A 5J5RA 1RV8A 1JUBA 3KRZA 1TPWA 3W7HA 1H62A 2X30A 4WZHA 3GDMA 3TAKA 1CW2A 2B4GA 1PHWA 2ZDRA 5F4SA 2H8ZA 1A50A 3PBYA 1S5TA 4H3DA 3ZWSA 2NUXA 3HQ1A 2GVJA 4YLWA 1EX5A 4UFJA 3S6DA 3INPA 3TMLA 3W73A 2NV1A 3O05A 3P8JA 2C13A 3LV5A 4NNBA 3NPWA 3FEMA 2DORA 4UTTA 1KTBA 5L6UA 2NWSA 2FDSA 3EX1A 1FWWA 5LZLA 1TPVA 2QF7A 3W74A 3LLDA 4LUJA 3UQNA 3Q37A 1E51A 4FNRA 3GXTA 3LV6A 3G1VA 1QWGA 4PL1A 3DHDA 1HG3A 3BVJA 1TPUA 1QO2A 3DXIA 1NFBA 4HIBA 4L4LA 1FQ0A 3E12A 4MYXA 1WOAA 3LCWA 1LZOA 1R30A 4LVFA 1F05A 1TV8A 1D3HA 3MUXA 4MZYA 1H7RA 2Y7FA 4NZJA 1ONRA 3TH6A 2ZRZA 3BLFA 4IOTA 4JDBA 3CWOX 2Y70A 5D32A 1THFD 3QEZA 1EA0A 5FESA 2DZSA 4A21A 3C2OA 3HPZA 3MBDA 3FJ6A 4LRTA 3U6WA 2PURA 4DO4A 1DHPA 3NL2A 3E0IA 1IXOA 1TTQA 4FHAA 1H60A 1W5PA 1Q6QA 3STFA 3QMSA 3LXCA 3LOTA 4ORIA 4WY0F 1HO4A 1G6CA 2JGYA 5FEXA 4YCOA 4DEFA 3EX6A 5HWMA 4O50A 1FWRA 4POCA 4UMCA 3V75A 2A4AA 3BLIA 4S2CA 3PM6A 4E0CA 3F1QA 1SO5A 5D33A 4ML9A 4UTWC 2LLEA 3TW7A 1PS9A 1KBIA 3DGRA 1TQXA 2YYTA 5D30A 3TXVA 1ICPA 3LHYA 1O95A 3VNDA 3W7IA 1VLWA 3UY8A 4OT7A 3TW6A 3ABQA 2QR6A 3G0UA 1FCVA 4FIQA 1EP1A 3LHVA 3EX3A 2A7PA 3OHIA 2QCMA 1QCWA 3EWYA 3ZR4A 1ZJIA 3PVFA 3JR2A 4IMEA 2JKAA 1B57A 3EEGA 3M41A 4A3UA 3PBUA 3MMTA 1XC4A 4DPPA 1LRQA 3BW4A 3QMTA 1LROA 1VZWA 1YDVA 3EWBX 3S5ZA 1EIXA 4D2JA 4NNAA 2NX3A 4WXZA 1W56A 3IV3A 1VYRA 1LYXA 4PA8A 1LDCA 3S1VA 5D2XA 4RLIA 4BI6A 3FKRA 3UD6A 1X1OA 2Q3OA 1DL3A 2YFNA 4XBKA 4QAIA 3P61A 4WOZA 1Q45A 2H3DA 3GLCA 5AC6A 3I65A 5HR6A 1TPDA 2Z0IA 3SZ8A 4MJMA 5DCEA 3W7OA 3W2NA 3W7CA 5CSSA 1Z48A 4TU1A 3W7LA 1PHQA 3TV8A 1H1ZA 2Z2UA 4NJJA 2V0TA 3S9YA 5HNRA 1M6JA 1ME7A 3FYOA 3W86A 3CU2A 1LBLA 4DQWA 4Q32A 4TIMA 1R2RA 5EBUA 4R53A 1ME9A 3L9CA 1B3OA 3SGUA 3N3MA 3W7QA 3W72A 5EYWA 2J9XA 4HNUA 3FOKA 2GJLA 3KFTA 2VENA 3W1MA 3NR0A 4JTLA 3UWUA 1O94A 4O11A 3MHFA 4TMBA 1F6KA 3MI3A 5AHEA 1IGSA 2DJLA 1PV8A 3VE9A 5FF7A 1L2UA 5K9CA 3EXTA 3S5NA 4JTKA 3O6YX 3IIVA 5J5DA 2VEKA 2BWGA 4NJKA 3DI1A 3LCXA 4KWVA 2EKCA 4JD4A 4JTIA 1ML1A 3BARA 3MW7A 4LW7A 4MY9A 2YSWA 3N73A 1G4EA 2DP3A 3W76A 3S42A 1XL9A 3LHTA 1K8YA 1TQJA 3RK8A 3TXZA 5T26A 2RKXA 3GKFA 1OX4A 5BRBA 2E5BA 3QSTA 1ME8A 1JQVA 1QPOA 3CQ0A 3NQGA 3W1UA 1BTMA 3L0GA 1F6PA 3H55A 5IBXA 3NQ2A 4N6EA 5BW6A 5FF0A 1PIIA 2QAPA 1JQXA 3N2MA 3UZ5A 3H53A 4DBDA 3O63A 4XQ6A 3LBCA 5AHNA 3CM4A 4FXSA 2OX1A 3DHFA 5BOOA 4AHOA 3NYZA 1TB3A 3RLVA 3UNDA 4ZQMA 2HTMA 3NQVA 4LV9A 4IUOA 3W7KA 1AMKA 2UV8G 2BZNA 2VFEA 3CT7A 1OVDA 1ADOA 4MIMA 2X16A 2H8XA 3ABRA 5U7SA 4IX2A 3TMQA 2GUUA 1F2JA 2CW6A 3O6CA 4O52A 3GR8A 3LCGA 1W3NA 1GTEA 1GEQA 1U83A 1VYSX 2QCGA 3TQKA 3P8IA 2Y85A 3VFLA 2CZEA 3BGGA 1P0KA 5EA9A 5I3IA 4MZ1A 3R8RA 4O0KA 4JTJA 1FWTA 1OABA 1YYAA 4IJBA 2B0MA 3MHGA 2ZZ7A 5G4WA 2H6RA 2AQWA 4HN4A 3W7EA 4I9AA 4ORMA 4PC8A 5SWUA 3E96A 3B0PA 1VHNA 1SZFA 1PCKA 3UWVA 1ZAJA 1GQNA 1TJPA 5F1VA 1QFEA 1V7YA 3VI2A 4O54A 4O1BA 2YGYA 3P5YA 3P80A 2A2IA 1Q3NA 2QDHA 3PR2A 3IVSA 1GVFA 3L5MA 3NL6A 4QITA 4RR4A 4W9TA 3IGXA 4WY0A 3NVTA 3T55A 3W2MA 2DZWA 4Y9AA 3W7JA 3IGUA 3G0SA 2A21A 5LNUA 3IVTA 3NL5A 4XTIA 3KVLA 4ALDA 2YW4A 1KFJA 3AO0A 3MJYA 1UJPA 3AJXA 3W1PA 3O15A 4MPQA 5AYZA 4QIUA 4LC8A 4FX8A 4K39A 4HPXA 3LI1A 1KFCA 2I9EA 4S2BA 2JGQA 1TMHA 2YXGA 4OGZA 1FXPA 1N8FA 2GVLA 3NAVA 4GUIA 4RCXA 1VR6A 3W1XA 4EF9A 4GUFA 4IMGA 5LHEA 2OCZA 2QJIA 2YPIA 3Q58A 4OE7A 3LI0A 2E6YA 3TAOA 2B7OA 3G1AA 2ZZ3A 2A85A 1KM0A 2CWNA 1GYNA 2V2DA 1T0OA 2YDAA 3FIGA 3WK3A 4GE8A 3WK2A 1A5SA 1SW3A 3BPWA 3GXPA 1TTPA 2NXGA 5DBUA 4KKXA 3M5VA 2NV2A 3A9IA 4OU1A 4EF8A 5AFDA 1KLYA 2A7NA 3QH2A 1T96A 1TYGA 1I2NA 1A5BA 1AW5A 2A7RA 5G1YA 2J9YA 3BW2A 4UTMA 1VH7A 2C15A 1LBFA 3ANYA 2FB2A 4O18A 3P82A 5TIMA 5E0KA 2Q3RA 2EF9A 5C5YA 1V5XA 4PL2A 2EHHA 1TPH1 3VE7A 4IWWA 3OA3A 4JGDA 3W1RA 1OK6A 1ZY9A 1H7PA 4N4QA 3UWZA 4LS2A 4UTUA 2R14A 4R34A 4RZ4A 1S3HA 3BG9A 5H91A 4FNQA 2B7NA 5MHBA 1H5YA 4I7UA 3DAQA 3HGRA 3UXDA 3K30A 3BG3A 3IVUA 5HQEA 1DOSA 1WQ5A 3DKLA 5D05A 3PBWA 4HKPA 1P0NA 4BWLC 5HJLA 4AAJA 2Y63A 4LVDA 5D09A 4UMBA 4O12A 5HINA 4O1CA 1N55A 3T40A 3W2UA 4TR9A 4ZL1A 3G1DA 2GQ9A 2OMAA 3IIPA 3A21A 3RU6A 1KFLA 3B0UX 5AYYA 2ABAA 1DJNA 3WFAA 5D37A 3VCRA 2WJZA 3CEUA 3M5XA 3NQEA 5K9XA 3N9RA 1MEIA 4OV9A 4O16A 3OIXA 3L5LA 4RX0A 4K6AA 3EX4A 4YCPA 4DELA 1GVOA 1SQ7A 1EWEA 1EPXA 5F1UA 2QCDA 4JTTA 1FCQA 2ZBTA 3I7QA 1K7FA 4FNPA 3W2KA 2V5LA 3IRDA 2YW3A 3EX2A 3KVJA 4LOCA 4UTWA 2I14A 1M7PA 3T7VA 3T44A 4N6FA 3P74A 3N19B 3MHUA 3BV4A 4K36A 1OFPA 3W83A 3W7NA 4WX2A 4Z0JA 5LNSA 2Y88A 1MEWA 1SUXA 1FDYA 5D03A 4UTLA 1VQTA 4NVTA 5AHMA 3C6CA 4AF0A 1PL9A 2NXIA 3NZRA 5K4ZA 1PVNA 3P5ZA 3YPIA 1VYPX 4OWGA 3NEVA 3W3OA 2WNNA 3NQAA 1JUEA 3DFPA 5U4NA 1EB3A 1W5MA 3NOEA 3W1LA 4I7VA 2C3ZA 1HL2A 3MWAA 1FWNA 1FCUA 3C2RA 2QCNA 5D2YA 4LNYA 5A8GA 1Q6LA 1IIGA 1KV5A 4NX5A 2BX7A 4BK9A 1P4CA 4PEKA 1T8XA 1YTKA 1UASA 4LRSA 1HFBA 5BMXA 1F5ZA 1FWSA 2Z6JA 3G1YA 1WYIA 4FX7A 3HO8A 1BEUA 4IQLA 1WBHA 4LY8A 3FJLA 5HWJA 3N9SA 5D2WA 3CB8A 1K3UA 4ZQNA 3C4UA 1C8VA 1ALDA 1ZNNA 2ZTKA 4ADSA 4X22A 5EL1A 3W71A 3PUDA 3DI0A 1DORA 3BG5A 4C1KA 5AC7A 3TFCA 3L0NA 3SW6A 4MFDA 5I3JA 2F7FA 5LNWA 4IPJA 4FX6M 3TQ0A 3TIMA 3WK1A 4LV4A 2KZHA 1MO0A 4OV4A 3IIOA 3GDKA 4FXRA 5K2ZA 3E49A 4JTEA 4O4WA 4MFEA 3TR2A 4UCGA 3WJYA 1VHCA 1TO3A 4AXKA 4UFIA 1GOXA 2WPBA 2V8ZA 4XWUA 2TRSA 5EY5A 4IPIA 3MP4A 3UWYA 1UUMA 1O4UA 4K7YA 5AYXA 2B7PA 1SO4A 1CI1A 1KM1A 4XKYA 3HF3A 3R13A 4TO8A 3G18A 3H54A 1OX5A 2V2CA 3LRMA 3QF0A 4QSHA 3TQVA 1SO3A 3G3MA 4MLRA 4BFAA 3N14A 2J6XA 5E1QA 2CLIA 1TPEA 3GDTA 3BLEA 1OJXA 4XUGA 3TUUA 4GFSA 4JXCA 5KSWA 2J27A 4QNEA 4JTGA 3GVGA 2NLIA 1KM4A 1O5KA 5AHLA 3O8AA 1J5TA 1G4SA 4CCDA 4JX4A 1LTDA 3DENA 4NU7A 1OHLA 4A22A 2RH9A 3LB0A 4NNCA 1FUYA 3QJAA 3L21A 4AWSA 4DPQA 3HIJA 4JY8A 4E2DA 3W7DA 3DU0A 3EWZA 2CZDA 2TYSA 4NJHA 4UNKA 3GZ3A 1W54A 4FO4A 4MKNA 3G8RA 5CPOA 5CZJA 3TCEA 4HSNA 3C2VA 1NAL1 4UFMA 1T99A 3C56A 4CNNA 4O4VA 1BWKA 1YLVA 4M7TA 4X3ZA 3HG5A 4CQ8A 1H50A 2YFOA 3CTLA 1QPNA 3QM3A 2BSLA 1BKSA 1YXCA 4Y96A 2PCQA 1SW7A 3N34A 1BWLA 5CZTA 3A23A 4AMAA 3W84A 1SO6A 5DXXA 2H3BA 2R8WA 1MEHA 3L66A 3I6RA 3CLMA 5G1TA 3O1NA 1OYAA 1KFEA 3I68A 3W2JA 4LVBA 2XN2A 2BLEA 2JK2A 3KOFA 1EP3A 3EKZA 3LRKA 5D2TA 3QC3A 4FIRA 1HO1A 1XI3A 5CZ0A 1OYBA 2Z6IA 2V30A 1QOPA 4JEQA 2DU2A 2W0UA 3F4NA 2Y7DA 1VGAA 4JTHA 2ZCGA 3W1TA 2WNZA 1C29A 1FBAA 3M9YA 4R33A 1JR1A 3OG3A 3B0VC 3SGZA 3U2OA 1KM6A 2CU0A 3TROA 1TPC1 2QCLA 3KVMA 2NXHA 4MJZA 3KAOA 2FPTA 1OFAA 3WJZA 4PFMA 4RXFA 1YXYA 5EKYA 2NWRA 3NQ7A 3RF9A 1KM3A 1NF7A 3M1ZA 3NQMA 4JNMA 1TPB1 2C6QA 4AH7A 2GVGA 4DXVA 2Y61A 4Y6GA 5DN1A 4I7WA 2CLFA 5TQLA 5CPMA 3PG8A 4EIVA 3NQ8A 4HSOA 5AHIA 1UBSA 5K3VA 2QJGA 5HR7A 1DV7A 1VJIA 1H7WA 1GZGA 1MXSA 3LDVA 3KX6A 5HMSA 1EP2A 4Y8FA 3ATYA 1P1XA 1I2PA 4AWTA 4M19A 5LHFA 1F76A 3KRUA 1A53A 3PC0A 3S1WA 1QAPA 3G24A 4CCEA 3M6YA 2CLHA 2FPYA 5DCDA 3W75A 2H90A 1SZEA 1LOSA 4Z08A 1R2TA 1JCJA 2X1UA 1WDWA 3CPRA 2QDGA 1ICSA 3GDLA 5BMWA 1Q6RA 3SSJA 4QJ1A 2ZRWA 2HS6A 4LU0A 4DO6A 4LWWA 3T4CA 1ZALA 4CNOA 3THAA 2CZFA 2ZZ5A 1X8FA 5F4XA 3KRSA 3S1UA 3DBPA 4JX5A 4Q33A 2V9DA 3IIXA 2GPTA 3LCHA 3LTPA 2DZUA 2E68A 2C16A 1L6YA 1Y0EA 2PRMA 3L67A 3PULA 3T78A 4TMCA 2XN1A 2ZRVA 1SPQA 4PTNA 3PB2A 2X1SA 3RMJA 2V82A 1JCYA 2NUYA 1L6WA 3A22A 5F2LA 1K8ZA 2TMDA 3M7WA 1KM5A 1UUOA 3QFEA 3TK7A 3UXAA 3UZJA 1K03A 4BWLA 4MY8A 4M6QA 2EGZA 3PSWA 3LTSA 8TIMA 1Q6OA 3KHJA 3EWUA 5LKYA 4YXGA 1TCDA 1LM1A 3OEXA 4LS1A 2ZZ1A 1FCBA 1L9WA 1K7EA 4RKAA 2NX1A 3W1AA 1D9EA 4UMAA 4FEZA 4DF2A 2R91A 4MY1A 3LTYA 4PCFA 1ZENA 3W23A 4Z1AA 3USBA 1WAUA 4BR1A 2QUTA 1DJQA 1EEPA 5HWNA 3G3DA 1JVNA 1A5CA 4Q4KA 3R89A 5F2IA 4CCCA 4LTSA 1ZHAA 2A6NA 4O13A 4O17A 4OQVA 1G67A 1JULA 2ZTJA 1GVRA 2PRHA 3DFQA 5D02A 4JYEA 1FX6A 4S1FA 2IQTA 3LHWA 3LLFA 4O14A 5C54A 2WSRA 1XFBA 3DKJA 2J88A 5G2IA 3G1FA 1ZCOA 1H7OA 2CLLA 4R7JA 4U28A 3TSDA 3QYQA 2VFIA 4JICA 5E93A 1AK5A 2PRLA 3EWXA 3UYCA 1TTIA 1YDNA 3W7PA 2JKPA 3MBFA 3QPZA
chains in the Genus database with same CATH superfamily
3NPUA 1I2QA 4D9PA 5CG7A 5AVHA 3KBNA 1TIWA 1ZPTA 3SCUA 3VKCA 3UY7A 4JIEA 3V35A 3RUBL 1BYAA 5I24A 2BHZA 1W6TA 2E1DA 3S0CA 1E40A 4AY8A 3DGBA 1A5NC 6XIAA 4J7RA 1XLCA 1WZMA 1RK5A 1TRIA 2HJPA 1ZP4A 2G96A 3F03K 1JCXA 3VUSA 3FYPA 1XRTA 3FGCB 1WXYA 3AU6A 2EEXA 4E2VA 4EANA 2G5WA 3EYPA 3VD5A 5KZ6A 2WQDA 4H7CA 4IP7A 4QG9A 2DT2A 3ARRA 4UOQA 1M65A 1RBAA 1PZ1A 1NSJA 3EEZA 3H21A 2XWEA 2NZLA 2P53A 4IJCA 4RK8A 4AY7A 1YDOA 1HVXA 1OYCA 2E9BA 1IXPA 3N2XA 3UG8A 3PUOA 1XBXA 1YADA 4AG0A 1NVMA 3PANA 5G2HA 2GWGA 4AC1X 3GB6A 3MDUA 3DFNA 3MI6A 3O9NA 3IANA 4HPHA 1P0BA 3ZS4A 3ZVHA 1RQHA 2G3MA 2CEQA 3M64A 1I2RA 2CWXA 2FIQA 5C8BB 3CUZA 1VPQA 1FWHC 2XIOA 4AX7A 1UCWA 1GVYA 3NSMA 4ADTA 5HUPA 3DX5A 2X1TA 4QLJA 4FNUA 4NJGA 4Q8WA 3FS2A 4YNGA 2NVDA 3T8LA 1ZFJA 2Z1VA 1BD0A 1IIHA 4IMDA 2GK1B 7A3HA 1X7FA 4K7VA 3VCNA 3PB0A 1JDCA 4J35A 1WUFA 3C0LA 3E2VA 5DRCA 2VGFA 1LLZA 3RN6A 2J47A 4MAVA 1R6WA 3GSMA 2GOUA 4JFUA 1OG0A 4JFTA 5HOSA 2HVNA 1SW0A 3WBYA 1SR9A 4QX4A 5KMYA 5M17A 4AIOA 1F61A 2TODA 3AUJA 3WKZA 4GUHA 4NZFA 1X6NA 2OGJA 3WF1A 4JTCA 3ARWA 5FACA 3LU2A 4QGCA 2J7BA 4C6CA 2FB3A 1XRFA 4QG6A 1V0NA 4GZEA 5CGMA 1UWAA 1JCLA 4FA3A 3EDDA 4PMXA 4HNVA 4LYQA 1W0MA 2VJXA 1MYRA 1R3QA 1TCMA 2TPSA 3D47A 2GDQA 4D6GA 2EPNA 2FZMA 2QVHA 3CZLA 1UD2A 2PBGA 5C9WA 4LUSA 5FD0A 2PDQA 1NWSA 3R5EA 1H41A 1TZZA 5E09A 3ARZA 4BS0A 4YTTA 1UP3A 2OU4A 4LVGA 1G9HA 4E3VA 9CGTA 2F8QA 3LQLA 1OF8A 3GKAA 5AOUA 2V68A 4U4MA 4PCTA 3R79A 2D24A 4ZVJA 3MZ2A 4DO5A 3E0LA 1VCVA 4GQRA 3BSMA 3CV2A 1IXNA 3CIVA 2PAJA 1T5AA 3WH9A 4JYFA 1LL7A 4GJ1A 2HE5A 1JFXA 2VEIA 3KVKA 4NY2A 1RY0A 2Y7EA 1GYMA 3ZJKA 1XIDA 1R9XA 2P3ZA 4CN6A 2WW5A 4Z1BA 2CIPA 1GPWA 2J75A 4A2RA 3KZPA 1FWEC 3ABOA 3GX9A 4M6VA 2ZYFA 2ZQ0A 1G01A 3PF3A 4A8LA 3UW6A 3T08A 1I9CB 5BYWA 2E6AA 2GQAA 3C0JA 2DSZA 1D3GA 3MV11 4ZXLA 4JTUA 3G1HA 3QRHA 4NXKA 4ROPA 4W86A 3EA3A 3MZNA 1U30A 5CLWA 2BASA 4GX8A 1H0GA 4AXNA 4IGNA 2Z1SA 1MSSA 3CHEA 2V2HA 1PO9A 3P62A 4J3WA 3OIHA 4ADUA 4J4KA 3N6JA 3GDRA 4B5SA 3F2CA 3MYOA 2CITA 3CXOA 3G1RA 1UD5A 4EPEC 1SGJA 1XDLA 3SQLA 1ZRQA 3UCDA 4PSRA 1RCOB 2IUZA 3B9NA 1GHRA 2XG9A 1EJXC 4AZCB 5DCBA 3TFXA 3M5YA 1PE1A 1R9YA 3EXRA 1WZKA 2E0PA 3GH7A 1WE5A 1OFQA 1J0YA 4ZB2A 2EPHA 3BCDA 4N9CA 3S4TA 3VILA 2DFAA 3WJSA 3TTSA 2D73A 3E3HA 1RQBA 3CWNA 4IFOA 3SIZA 1UKTA 3OPSA 1OC5A 2PWUA 4ZZ9A 4HNNA 4TUFA 1BPLB 5C55A 3FXYA 3UG4A 1FY6A 1FWCC 5I23A 2E6DA 1CB2A 3UFYA 4B4FA 3FAXA 1H3GA 2YA1A 4IH3A 3U7VA 1NDYA 4M5PA 4Z42C 1L6FA 3WF3A 1KKRA 4PBEA 1V8EA 3F4WA 3NM1A 1EFZA 1DQWA 2ON3A 3KOWA 5E70A 4E2OA 5CPLA 1DQUA 5E9AA 1U5HA 3W02A 2QPSA 1EJSC 1QWKA 2RHGA 3V0UA 3WLQA 3EA1A 5BWFA 3AIUA 4CQAA 3SFKA 4UBPC 2YZRA 2J4GA 2P88A 2Y62A 4US5D 5CCZA 1XYZA 3WDPP 1R3VA 1WKFA 4C6QA 3W70A 2VEFA 3AXKA 1GCYA 3HG4A 5F2GA 2Y5JA 4BCEA 2VFHA 4BEQA 1U1JA 3V1HA 4JBRA 3LY0A 4JX6A 2D2JA 4P7OA 4AF0B 2EBNA 2E5CA 3VOIA 3MCNA 4E4FA 1HIZA 3BXWA 3FV9A 1K9TA 4UC5A 3LCFA 4JHZA 2CERA 1H63A 1BVWA 2W61A 3NM3A 1A3HA 1O5XA 1XR2A 1A5OC 3TYEA 1VFOA 1YW1A 4RXGA 3HA1A 2ZRYA 3SCNA 2SFPA 4W7WA 2GSEA 1C7SA 2AKZA 2OKTA 5HULA 4PMJA 5ABTA 1DXFA 2PDNA 2XYLA 4NQ1A 4IMFA 1XGZA 2I7GA 4ZSUA 1L6SA 4RZ6A 3A12A 1Q7MA 2OSYA 2Z1BA 5LA0A 4WQ6A 5IM51 3O2LA 2PP0A 4CQ9A 3AS3A 1OK4A 4HPGA 3THUA 3CASA 1JZ7A 2WKJA 1QBAA 1KLZA 3TZNA 2FTYA 3TWAA 1FP9A 4EXQA 3ATZA 4NHVA 2EG8A 4ZE5A 4EAMA 3PAJA 1W5OA 3A4WA 1FTXA 3MP5A 3W9ZA 3VOJA 3UJRA 4HD5A 3VO0A 1I1XA 4PFHA 3EDKA 4WK9A 2V6AA 1JRCA 1DP0A 3H26A 4O1DA 1UIOA 4CD7A 1HKKA 2I5QA 3SRKA 4C6NA 2Z1XA 5DXYA 4P8XA 4B15A 3PY2A 2WSYA 3EAUA 1R46A 1M7OA 2NT0A 3O06A 5DY2A 1Q13A 1QOQA 1R3YA 1W3HA 3PFRA 2RDUA 3A4XA 4G7EA 2X0YA 4O15A 1LT7A 2WV8A 3NGJA 4XKYB 4NRSA 3BC9A 4G1KA 2PDUA 1QATA 1VLIA 4XISA 2J8TA 2P76A 3S46A 1YQ2A 4PBFA 4KRTA 2J9ZA 2UY4A 2W6RA 2YCLB 2V5KA 3MMDA 3GAYA 1XLMA 4FS9A 4J1OA 2IMRA 3G6MA 4D1JA 3EXSA 5D38A 1EOKA 4KW2A 4LF1A 3D46A 3BJSA 2WVTA 1R2SA 3LCLA 3GVVA 2Z29A 3LGGA 3R43A 2DIEA 2OT0A 4RNHA 4B4HA 1UH4A 1XLKA 1GYLA 1HJXA 1KBKA 5LIYX 2FTPA 3QGVA 1VFFA 1MW2A 2E9MA 3AROA 2VL4A 1JCNA 3KL3A 3VX1A 4TXEA 1BG4A 2E5DA 4N9DA 4JIQA 2X8RA 2JBMA 4AB4A 4GYJA 4UUIA 1Q6CA 3TZFA 3WJWA 2YYUA 3UWQA 1ELSA 3E2SA 4MJ4A 3W07A 1LUCA 3HBLA 3BK0A 2A3EA 3NXFA 3PWAA 1XKYA 1CENA 2NV9A 3F4VA 4UFKA 4N9EA 3OVQA 1KM2A 1JL8A 1KQYA 4TTUA 4HTBA 4PMVA 5BOFA 4U5IA 4DAIA 1X6LA 4LUTB 2OR2A 3GHTA 3OVPA 3H7UA 3G2GA 1M5WA 3U8GA 2YJQA 1MI3A 4P2VA 3T0CA 5EMUA 4PB4A 4LB4A 4YMZA 3KBWA 4E8CA 1J2WA 4EXAA 4QM1A 2OX4A 3UA4A 5DFAA 4UNLA 5HDRA 1AL8A 3U5YA 5H1WA 3GC4A 4C6MA 7ENLA 4MUZA 1A5MC 2ZA1A 3Q65A 4EPBC 1KW1A 3NVDA 3P93A 4B5UA 5MKGA 4K8EA 3SADA 4XAGA 4ZQCA 2DSWA 1GHSA 4NT0A 5KZEA 3OTRA 5BXTA 4LBUA 1K4GA 3ITTA 2D0FA 4KS0A 1E1FA 4F4RA 3IV8A 3N4EA 3N15A 1O6IA 1RY8A 3BGJA 3UESA 2VO5A 1JUBA 3KRZA 4DAFA 2XVGA 4L6OA 3W7HA 4WZHA 3EMZA 3TAKA 1WDDA 1PHWA 3PZMA 1A50A 3S9ZA 1S5TA 3ZWSA 1OD0A 3W6MA 3KL0A 2C13A 3ZSTA 2YIHA 1ZLPA 2DORA 1KTBA 5L6UA 3T0BA 2QDDA 3PPFA 4LANA 2L5HA 3DYOA 1DIEA 3LA4A 3W24A 8CGTA 4H7ZA 2IKIA 3LV6A 1CLXA 4B5VA 3DHDA 1TPUA 2YA0A 4F2UA 3FXGA 4B5TA 1E6PA 2NVAA 3MQTA 4EKJA 1PPIA 3QGKC 4QLLA 4BQ5A 5A2AA 4F79A 1FQ0A 4MYXA 1WOAA 4AZHA 4LVFA 3VIOA 2YLAA 1H7RA 3HQOA 1QXLA 3CWOX 3E0FA 4JTAA 1EA0A 2WZEA 5LA1A 2FHCA 3L4XA 3DHPA 3C2OA 3ZJ8A 2R6OA 3SUSA 1CYGA 3U6WA 1IXOA 3NZGA 2I5IA 3UCQA 4C65A 1TTQA 2ZVIA 3VDBA 1Q6QA 3STFA 4ENLA 2PA6A 3VINA 2YDRA 4ORIA 5H8UA 5FEXA 4JHMA 1FWRA 3EOOA 2NW0A 4POCA 2GGEA 1WDQA 2IXVA 3MSGA 1BRLB 2P8CA 4GI6A 2CKSA 5D33A 1F9CA 1KBIA 2V5CA 3DGRA 1TQXA 4C6PA 2PLKA 3TXVA 4CEUC 1VLWA 3WUFA 3MSRA 3RJXA 3QY7A 1W91A 1EP1A 4UZSA 4JZ5A 2GDUA 4XV0A 4AZ6A 4KWSA 3CYVA 3S3GA 3ZR4A 4IMEA 2GSHA 4DWSD 3SDOA 1J2BA 3WH5A 1B57A 3FHQA 4NZ1A 1QJWA 4DI9A 4DPPA 2DGAA 2YOCA 4REQA 4IFKA 5C7HA 4D2JA 5IOBA 2ZXQA 4DJFC 3H12A 1VYRA 1LYXA 5FL1A 4UB9A 3LUTA 2WANA 5GPRA 5FJUA 4XBKA 1V6TA 1QW7A 5HR6A 3SZ8A 3K1GA 4YIWA 3W7CA 4V15A 1Z48A 7REQB 3W7LA 1PHQA 5HA7A 3N2BA 3WN6A 3TC3A 1HW6A 1M6JA 4CUCA 1ME7A 3FYOA 4MGGA 1HZYA 3SAZA 1N82A 3L9CA 2P0IA 1B3OA 1TWZA 2G3NA 1IR2A 2J9XA 5EYWA 4HNUA 4TX8A 2GJLA 2VENA 3CHDA 2WPGA 3W1MA 3GC5A 3A9BA 3UWUA 4O11A 3SFWA 3RMEA 4W5UA 5FF7A 1L2UA 3WMLA 2Y4SA 3EXTA 3O6YX 4XD4A 1Q2RA 1VFMA 2CBUA 3SRHA 5ABGA 1XYAA 3LMZA 3ZVIA 3DI1A 1WO2A 3P0XA 4KWVA 1FWAC 4U33A 4JTIA 2CBJA 4LW7A 3MW7A 3MB9A 1OD8A 3F5KA 2DP3A 2HCVA 3KBMA 1XL9A 3LHTA 3PTMA 3RK8A 2AKMA 3TXZA 2PDCA 2RKXA 3LNMA 3GKFA 1OX4A 5BRBA 4ICCX 3RPDA 3QSTA 4KGLA 1YNPA 3SGGA 3CQ0A 3NQGA 2I16A 1BTMA 2DT3A 3MU7A 3H55A 3QY6A 2J13A 3NQ2A 4N6EA 2UY3A 1PIIA 1JQXA 3BLKA 3CUHA 3H53A 1PX4A 2X42A 3C0SA 4FXSA 2BMBA 2QMJA 7ODCA 3ENLA 5I79A 5CZKA 1UC4A 3NYZA 2PDBA 1XHGA 4N0RA 4HMNA 3NQVA 4LV9A 4IUOA 3UJEA 1AMKA 3ITLA 5GJMA 1W32A 1OVDA 4NYYA 4GO9A 4YU1A 2H8XA 3VK5A 3ZT6A 4QEHA 1V3HA 3O6CA 2ZVRA 4A05A 3GR8A 2QCGA 5RUBA 4M24A 2Y85A 2JEPA 3DFHA 4MZ1A 3T1GA 5BCAA 4JTDA 4BJHA 3DECA 5B7YA 2V69A 5DQPA 2PDHA 1OABA 4IJBA 3UR5A 4GQQA 3ITXA 1D7FA 4HN4A 3W7EA 2ZC8A 2GJXA 1QASA 4V28A 5SWUA 4JN8A 1GOOA 3B0PA 1F8MA 1VHNA 3GNXA 1J93A 1GQNA 3H23A 1QFEA 1V7YA 3HJEA 2VZTA 1MUCA 3P5YA 3E0WA 1R87A 2QDHA 1FP8A 3L5MA 3NL6A 1PEZA 2YBTA 4P7QA 1CGWA 1EDGA 4OFCA 4C6IA 4DUVA 2DZWA 3L12A 4Y9AA 3W7JA 2A21A 4MWAD 5HQMA 4ALDA 4Y2WA 1V0KA 4FOKA 3BH4A 4V1YA 3W1PA 5AYZA 4LB3A 1HKJA 4HPXA 4S2BA 2FMNA 2F9RA 4E6MA 4EPKA 1TMHA 3NQBA 1FXPA 4CEXC 4XZLX 2OCZA 5BXSA 4DY1A 1Q85A 3MUZ1 4IMAA 4F0KA 2B7OA 1FA2A 3G1AA 1MXGA 2Q6ZA 1KM0A 3QBUA 4NG3A 5HPOA 1ESWA 1T0OA 2YDAA 2Q01A 3FIGA 2GDVA 4GPNA 3DBNA 4J3ZA 2WC3A 4B9YA 4MDPA 1TTPA 1EH9A 3SM0A 4GX9A 3LNPA 3RG6A 1W1IE 2E1WA 2A7NA 2DUAA 1K1DA 1T96A 1CCWB 5G1YA 4UTMA 2FZNA 3PWGA 2VEGA 1V6XA 4XD5A 2GVEA 1LF1A 4A8IA 3K4DA 2PDXA 3OA3A 3LD5A 3T07A 1OK6A 4XAFA 4UTUA 4R34A 3IGHX 1S3HA 3BG9A 4AZ5A 2B7NA 1Y5XA 5IDIA 4JQAA 2E8YA 2OYLA 1BVNP 2QVNA 3BSGA 5I2UA 1DOSA 5D05A 2IW0A 2GGJA 2DPEA 4NI8A 4X2PA 5D09A 3VTRA 3N12A 4PTDA 4O12A 1J9YA 4Q8OA 4J3TA 3T40A 1UZ4A 3EWCA 3AMKA 2OMAA 4LEQA 4S3FA 5CPTA 4NZ3A 1IEWA 4Q4MA 4XZBA 5K9XA 3N9RA 1MEIA 1EHNA 3R11A 1VKFA 3AMCA 3L5LA 3EX4A 4YCPA 1SQ7A 1VBHA 2D2GA 3GW3A 2J66A 4JTTA 3I7QA 2DUXA 3W2KA 2V5LA 1GOQA 2YW3A 3EX2A 1E9IA 4UTWA 4B91A 1M7PA 2XINA 4N6FA 3QXBA 3WNLA 3MHUA 3BV4A 3NTYA 3KTXA 2WM0A 4DJEC 2GGIA 1SUXA 3KLKA 5FSEC 1E6ZA 1R5YA 2BODX 3LPPA 2OOFA 3L23A 1VQTA 2QGYA 3ARVA 3KOZA 3CJPA 1BKHA 2YBUA 1VYPX 3W3OA 4X9YA 2Z7KA 4ILSA 3N6QA 3DFPA 1RUSA 1I6NA 1W5MA 3NOEA 3TQPA 3W1LA 2RGLA 1OCBA 4AEEA 2A3AA 1E9LA 4DBUA 1YNYA 2H9AB 2R1NA 4H7VA 4LNYA 1Q6LA 1H49A 4PRRA 5M1TA 4PTMA 4CU6A 2BX7A 4BK9A 1P4CA 3GNRA 1T8XA 1YTKA 4LRSA 1HFBA 3TOPA 3G1YA 3SRDA 1WYIA 2PZ0A 3TN4A 4X0NA 3WDRA 4YYFA 4LY8A 4JN7A 1ZQ5A 2HRWA 4DUWA 1F4AA 1K3UA 4QRNA 1GUVA 1UR3M 1XYCA 4ZQNA 1KRBC 3WQ5A 1C8VA 1ALDA 1IZKA 4OECA 1QRQA 3W71A 3BG5A 5DF0A 3U57A 3D6NA 3TFCA 3L0NA 3WQFA 4MFDA 5LNWA 1MUWA 3SB0A 1A5UA 4FX6M 2G8ZA 4MMWA 3TIMA 4QDWA 1KBBA 1PYMA 4L80A 4FAMA 3K5XA 3MVIA 3PHAA 3IIOA 3OW1A 3WLTA 4O4WA 2PDYA 3TR2A 3RR4A 3WJYA 4AXKA 2FTWA 1GOKA 2OELA 2TRSA 5EY5A 3UWYA 3MP4A 1QK2A 4PUWA 3CMFA 1K4HA 5GQBA 1KM1A 3E1F1 3E5BA 3R13A 4TO8A 3H54A 1OX5A 3II1A 3MCMA 3ZJ6A 4DLFA 3UT0A 5E1QA 1UR9A 3GDTA 3NO1A 1XP3A 2PTYA 4XUGA 4H6RA 5T9CE 3SURA 2HK0A 2NLIA 3O8AA 4YTRA 3VOCA 4GVFA 3GG0A 1XJBA 1E43A 4QS5A 3OLEA 3TLQA 3LB0A 4TV5A 4XIMA 3TTQA 4MNMA 1KNWA 3L21A 4AWSA 4DYEA 2FYMA 3L4ZA 1SFSA 1ITCA 4URIA 3M4HA 3TJ4A 2DSKA 3L4UA 4UNKA 1VFSA 3GZ3A 1W3JA 1W54A 4FO4A 4QR6A 4HSNA 2WMFA 3C2VA 3WBAA 2OEJA 3C56A 4O4VA 1YLVA 1Z89A 3RCNA 5EMLA 3TCSA 4PCSA 1KXTA 4DZHA 1IE7C 1VRXA 1V3JA 4UNIA 3AZSA 4Y96A 3AALA 3AMLA 4OUEA 1BWLA 5I5RA 4AMAA 3BQ5A 4KEMA 1EJRC 5G1TA 4MWAE 1HP5A 3EKZA 5D2TA 3QC3A 3B8SA 3GIQA 2EKGA 2G3JA 1PAMA 2DU2A 2PI6A 3F4NA 2Y7DA 3OGVA 5AKQA 4JTHA 2VNCA 3W1TA 4E5TA 3M9YA 4HN8A 3VIFA 1QHZA 3SY8A 4MJZA 3KVMA 4FXJA 4QXIA 5FJIA 3RF9A 1KM3A 4PUNA 2C6QA 2Y61A 4I7WA 1P6WA 2O9TA 2A3LA 5AHIA 1UBSA 3C86A 3QTPA 3PZNA 3QVQA 1MXSA 1EP2A 2VM8A 4H9TA 4Y8FA 2ZX8A 3PJUA 4LYPA 3REQA 5LHFA 4OJYA 1A53A 1QAPA 3G24A 4RE3A 1QOXA 1KCZA 3SUWA 2FPYA 4HCHA 2V63A 1SZEA 1LOSA 4W89A 3DYPA 1WDWA 3CPRA 2QDGA 2PTZA 5BMWA 3R6IA 2CLPA 4YVXA 1Q6RA 2JF6A 3SSJA 4LU0A 1DJHA 5FJTA 2RJHA 2CZFA 1X8FA 3VXGA 2OYMA 3KRSA 2O4MA 2PEVA 4I5XA 4FOUA 3WQ8A 3CHCA 3LCHA 4GH1A 1US0A 2DZUA 3OZPA 4Q7NA 3PULA 2ZRVA 4Y9MA 4ZODA 1CDGA 1JCYA 5E0FA 4AD0A 4HYWA 4R3UA 3A22A 5F2LA 4I5UA 1UZHA 2FKPA 3TK7A 4MY8A 1FHDA 3LTSA 8TIMA 1IT0A 5LKYA 2WMIA 4YXGA 3W25A 3MUIA 1L9WA 4JFSA 3FN9A 5A69A 5FA5A 2G50A 3POCA 1HVQA 4I9TA 4DF2A 2Z00A 2Z2AA 4NZ5A 4LAOA 2DUZA 3SO7A 4GYPC 4X61A 3WENA 4PCFA 1ZENA 4H2CA 3NOYA 4UR9A 5CQ1A 4PUJA 4C6EA 1XYLA 3VDCA 3CQJA 5F2IA 4CCCA 1JZ6A 3ONBA 1PJ9A 1EBGA 1CXHA 1G67A 2VUYA 2R1LA 4Q4RA 5D02A 4IPNB 1WKDA 1RA5A 4JYEA 1FX6A 1E6RA 1KRMA 4XAPA 5EBAA 3NGFA 2QLYA 3DKJA 5A8PA 2J88A 2DZBA 1HJUA 5HQLA 1ZCOA 2CLLA 2D22A 1FH9A 4WRHA 4JICA 1FOBA 1V79A 4HCDA 3LG3A 3UYCA 1TTIA 4S3GA 3W7PA 5D9PA 2VWTA 3MBFA 3QPZA 2GJRA 1BHGA 4F9JA 3STEA 1J4EA 4AWUA 4D8AA 2CLKA 2C8NA 2V3GA 5JBFA 4MYAA 3VIKA 1XSIA 1ZBWA 4US5A 1Z8AA 1EDQA 1IT7A 2DZTA 4O1AA 3AIVA 4IL2A 2PDGA 3WX7A 5LGZA 3LERA 3UXLA 3GNPA 1K9EA 3G1XA 1PIFA 2P3EA 6TAAA 4W8BA 1AODA 2ZE3A 3TP4A 1KO0A 1TE6A 2VELA 4Z1DA 1UA7A 4ZQRA 1AQFA 4C5YA 1CNVA 1SR0A 3FLUA 2NT1A 4N2YA 3R25A 3ANVA 4NUWA 5HK4A 3BAYA 3U2ZA 1FDJA 2XZ7A 1BXCA 3WNMA 1ZTVA 5AHFA 3GD6A 1FH7A 1QDSA 1NOFA 5FEPA 2BY0A 3PZOA 3CZEA 1B30A 2BP1A 1OWQA 2JKEA 2PDLA 3AS0A 3CWHA 4PE8A 1XYFA 2OLSA 3G8EA 2ISSA 1BF2A 4W93A 3WD3A 3U9IA 1W3LA 5A6AA 4J2MA 4PSPA 5I3HA 3W38A 2DJXA 1E1EA 5BXPA 3GK0A 3MV01 3CEPA 3AYVA 1RJPA 1IZJA 1TJ2A 4A3RA 4K3ZA 5BZAA 5C2CA 1W31A 1V3IA 3UF9A 2O7QA 2VD9A 1N2VA 3FYYA 6PTDA 2Q02A 5CKSA 3WBEA 1MZRA 1LOLA 1I2OA 1AJ0A 1RR2A 2W4XA 2E09A 4J3XA 4LS0A 1D8CA 2VFDA 4AIUA 3NL3A 2VD8A 4ZTXA 1GQKA 4ICNA 5AN7A 3S1XA 3QQWA 1OB0A 2ODOA 4Q8MA 2WHMA 3R2GA 1Y7VA 3I7RA 2Q8LA 4UZUA 3CIXA 2FJKA 2OOGA 3CH9A 4P8UA 3WH8A 4L9YA 4ATWA 4EP8C 4U3CA 3V1PA 3FEQA 1XLBA 3QN3A 3S2CA 4B5NA 1KWGA 3G1SA 1Z41A 8A3HA 2CLMA 1JZ3A 1KGWA 5CH9A 4MOZA 1W37A 1EYWA 3BQ6A 2PTDA 1IR1A 2ZZ2A 3DH7A 1K8XA 3TX9A 3WK0A 4G7FA 2FVLA 3LM3A 5CGQA 3E02A 2PFHA 4PZVA 2DZPA 5CSYA 5KZMA 3HM7A 4AHQA 5LXXA 1SFLA 4FR6A 7TAAA 1NM9A 2X41A 5G2WA 3KWXA 2HV5A 3DFOA 4IXHA 2WQPA 1U22A 3EWWA 2WMGA 3N4AA 1K8CA 1DWIM 1P0DA 4GCAA 3OGSA 4JQ1A 4CNUA 2BY3A 7TIMA 1LP6A 1B3YA 2C19A 5A6BA 1F6YA 4EK7A 4N02A 1TWSA 3GY1A 3FA5A 1UWTA 1E9YB 3UGVA 3F7JA 5DANA 4EWND 3EB2A 1T41A 2YCEA 4H9ZA 4E2BA 4P8WA 5MF5A 4GC3A 3B3DA 4L64A 5AYBA 3BOLA 3SCOA 1EUAA 2GLKA 4W8AA 2Y7GA 3PZQA 3BDKA 3SJ3A 2PE4A 1VIWA 3VGEA 4UTKA 3R0UA 3UBPC 4EE9A 3SQSA 4WSJA 3NQFA 3PJWA 1V93A 1NJJA 1W1ZA 3LXBA 3SY1A 4INFA 1OFBA 4GI4A 1DE6A 1XD0A 5FF4A 1PSCA 2VWSA 3WQVA 5EPDA 3DFSA 4XTDA 3VIIA 3P6LA 1G7VA 9XIAA 1VFHA 2HXUA 1X1ZA 1XBVA 1OZQA 3ABXA 4RW5A 4S3JA 1J0ZA 3M0ZA 2P1FA 3URNA 2GQ8A 1JD9A 1W3TA 3HV9A 5I09A 3T0TA 1V51A 2Q8XA 2GSJA 2G97A 3TA6A 3BCFA 3AMGA 1YE6A 4PODA 1DWFM 3GNNA 3M43A 1JZ2A 2ZZ6A 4B3KA 3SCRA 1TV5A 1H4PA 2ABBA 4PBGA 1F7BA 3T05A 1MQQA 5K9DA 1SFTA 3WL0A 3K8MA 3DOPA 1KC7A 3RO6A 3V0TA 1E55A 3IUHA 1REQB 3SI9A 5IXEA 3JS3A 4Z1CA 3PUEA 2ATMA 4WOQA 1V03A 2E8ZA 4Q7IA 4B9ZA 4WXYA 4R88A 3UYIA 4JS3A 1NARA 4AEOA 3GM8A 3H2AA 1DTNA 3WQWA 2WZHA 2PMQA 2WHKA 3TYDA 1YBQA 2CHOA 4K8HA 3N9KA 1XUUA 3HPSA 2XSBA 1ZBKA 3THQA 1ECQA 4WJEA 2PP1A 3U0HA 3SCQA 4OBSA 2G3IA 1OBAA 3W81A 1W8SA 4L4PA 2W91A 3UVIA 3RJYA 4BF9A 4IIBA 3GHSA 4H9MA 3TC6A 1XLIA 4NI3A 2CNCA 4WKHA 3S8HA 3DFTA 1OGBA 2WCGA 5A8OA 4HHPA 1AG1O 4HYRA 1ICQA 3OLIA 2NX9A 3TTYA 1ZCCA 1TWIA 1D3CA 4GK8A 3NG3A 3NDOA 2WHLA 5D2VA 4MHBA 1WXJA 2ADAA 1LRTA 1OF6A 2E67A 1BXBA 3BAIA 1M53A 2O7SA 2RDXA 2OZ8A 3CPGA 2Z25A 3MSYA 1ADDA 2R24A 2BB0A 2BHYA 4P8VA 4PMUA 4R9XA 4JTSA 1S5WA 1KWKA 3C3NA 3KRBA 1J79A 3I6EA 2VFFA 1HL9A 1TREA 3M0YA 4GXWA 1EYEA 2OO0A 4L4MA 5JVLA 2PU1A 4KEVA 4HP5A 3DERA 3Q2DA 4NAEA 3LXAA 1MVYA 3GTIA 4GY0A 1JCTA 5DELA 3VIMA 2E9LA 3TN3A 2REQA 3MMWA 1QPRA 4UXDA 1TA3A 4K8GA 3O0FA 3GDBA 1E1CA 1PTAA 1E72M 3CIWA 3E2RA 1EZWA 4WDTA 4Z17A 2ZRUA 4W8LA 4OKDA 4DWSA 8RUCA 4UTJA 3QKEA 1RVGA 3O3RA 4QP0A 3U5UA 2ZUWA 3CL6A 3NPVA 3MYPA 4TVUA 1KV8A 1DEDA 1FWBC 3VCCA 3ZLGA 4GNVA 1LWHA 4HPNA 4HGXA 3BMVA 1Q65A 1QNRA 3GH5A 4KMQA 3RCYA 4E3TA 4DF1A 1IXQA 4RE0A 1G1YA 3JW7A 3WMCA 4NRRA 3MI2A 1QHOA 3EMQA 1YDYA 1XQKA 4CD8A 3AIRA 1T6MA 2E6FA 1T7LA 1CXLA 4YWIA 4QQ3A 4CNPA 5DMLA 2OQYA 1GVSA 2ZDSA 2BY2A 1Q7ZA 4DJFD 1OCNA 4JIPA 2AL2B 3LHZA 4DN1A 5LNVA 3GVQA 4C1NB 3BSHA 3ABZA 4DM1A 3AUOA 2DW7A 3S5OA 4YN5A 4XG1A 4M7SA 3BLPX 4W4QA 5FF3A 4PH6A 1V6WA 3WF2A 4EACA 5CBJA 4A2SA 3TSBA 1B3ZA 1FXQA 3C3UA 2WNQA 4ONVA 2KAUC 3ZOAA 2QJJA 1Q6FA 5E5CA 4QTGA 3H4XA 3ITVA 2YA2A 3VIPA 2XH7A 3VABA 1I75A 1TIMA 5FI8A 3WUBA 1IYXA 4QG8A 1V4YA 4F40A 3RITA 4M56A 3T4WA 4D6CA 3UZWA 1ZP3A 4FNSA 1W1VA 4H6QA 2XM2A 4PTVA 1I45A 2O56A 2ZUNA 2WOQA 3ELFA 3VKJA 5M2FX 4KWUA 1S39A 2BXVA 1J0IA 3OYXA 2J79A 5A2BA 3PBVA 2PDIA 4XAYA 4XZWA 3TKFA 1XINA 1QW8A 4DNMA 3VC6A 1UP2A 1NFGA 4RW3A 3HOJA 3L2IA 2VEMA 2POZA 2QCCA 4IQDA 2Z1WA 1K9FA 4GVGA 3EDEA 4GYFA 4Q4QA 1X6UA 3IJQA 1VRDA 4RPPA 4JDYA 2I56A 3B8VA 4JL1A 1UHVA 4KBXA 2GL5A 3H2OA 2C14A 5ABFB 4B92A 3CL8A 4H9UA 4ZOCA 4Q6JA 1XKJA 4XZIA 1XV8A 1SMAA 2VOMA 3PJTA 2YL8A 3EPNA 1H1YA 4G8TA 1WXZA 2W79A 1WA3A 2HS8A 1BF6A 3S5YA 5LIXX 4ZO9A 3M0LA 3QV6A 4IG2A 3M07A 1JAEA 4OZOA 2HPIA 3QY8A 3UJFA 2A1YA 3HG2A 1FH8A 4MDOA 5AZ1A 2BOEX 1US2A 4W85A 4F48A 2RDTA 3IUIA 4MAZA 1XRVA 1UWQA 1LWIA 2X1RA 2QJHA 1Q5MA 4X0VA 4Z2KA 2RFGA 3GNOA 4O10A 1M1BA 1TPWA 1H62A 3KBSA 4WHBA 4F0HA 5AC4A 2ACQA 3H7VA 2B4GA 5F4SA 1E73M 5JH2A 3PBYA 3A4AA 5HXMA 2OSXA 2NUXA 4YLWA 1EX5A 3TMLA 4L5ZA 4AISA 4NNBA 2WVVB 2B31A 1HGYA 4UTTA 2NWSA 3EPMA 3EX1A 5DMNA 5LZLA 1TPVA 3NSXA 3LLDA 2J7CA 3R58A 3Q37A 1E51A 1H09A 3GXTA 4N42A 3DHUA 3QOKA 3LGDA 1HG3A 3VOHA 3VKDA 3WNNA 4M8UA 4US6A 3W6LA 1ZJAA 1EXPA 7CGTA 1BQGA 1LG2A 1LZOA 1TV8A 1D3HA 2WLZA 4AX6A 3T2PA 1JAKA 2Y7FA 4NZJA 3WH6A 5M5DA 4LSBA 4WEVX 6A3HA 1J10A 5FESA 1MDLA 3MBDA 4LEFA 2AQVA 2PURA 4DO4A 1CPUA 3E0IA 5REQA 2D0HA 3RXZA 2NQHA 2AOSA 3IJLA 2XIMA 4CD4A 2JGYA 4DEFA 4BKNA 2I5GA 3IK4A 4UMCA 4Z2GA 1CGXA 1W17A 4ZXOA 3EGJA 1ZBVA 2BVWA 4E0CA 3ARYA 4MB3A 4UTWC 3CAKA 2C1GA 1RD6A 5D30A 4FI4A 1O95A 3W7IA 4WGHA 3R4IA 2QR6A 3WZ0E 4ZR8A 3OHIA 4YTSA 2QCMA 3EWYA 5DRIA 4L9XA 1W1B1 2PD9A 1BSIA 3JUGA 2HDJA 4LALA 3EEGA 3PBUA 3MMTA 1C91A 1JPHA 1XC4A 1P6CA 4S23A 4Z1YA 3BW4A 3QMTA 1LROA 2R9RA 1E56A 3ZLFA 1YDVA 3EWBX 4UQEA 1QNSA 2BGQA 1WNOA 2NX3A 1W56A 2J7FA 3CZKA 1JZ8A 1CB7B 4RLIA 4BI6A 2AMGA 4QE5A 3WLIA 1TKKA 1X1OA 5M3WA 4GKTA 1J96A 3GLCA 5AC6A 4KESA 4QS6A 3W7OA 5CBIA 4C6FA 3FGCA 2NVCA 5FJOA 2BOFX 3M0IA 1H1ZA 4DLMA 3RIKA 5HNRA 5IDZA 3RCMA 3CU2A 1LBLA 4Y9NA 4TIMA 5FKYA 3WFZA 2DVXA 3THCA 4R53A 4E8GA 1ME9A 1Z69A 3BAKA 3CYJA 1JPMA 2X0SA 3KFTA 4IGMA 2C1IA 1DIDA 1K6AA 4TMBA 3CQIA 3MI3A 4DJED 1RPKA 1IGSA 2DJLA 1AJZA 4XBJA 3VE9A 1UMYA 1V02A 3CAWA 1UPMB 5K9CA 3VM5A 1VFUA 2XFRA 3ARXA 1GKQA 1JYNA 3IIVA 3WDQA 5J5DA 2RUSA 2ACRA 3BARA 1VEMA 2VGGA 2XVPA 3S42A 3W76A 1TX0A 3BJFA 3DEQA 4Q4OA 1JDDA 3WQ6A 1JQVA 3L0GA 6ENLA 1TWDA 1JXJA 5FF0A 3UZ5A 2GK1A 2VX6A 1E5JA 5JXQA 3MJMA 1HKIA 5AHNA 4S3BA 3DC8A 5BROA 4HK7A 3I3EA 3DHFA 2DH3A 3UG5A 2VVSA 5BOOA 1PUDA 1MMFA 1XISA 2C0HA 2XVKA 4G6CA 3UNDA 3AIQA 3VGHA 4OOZA 3IJ6A 3RPTA 1RJRA 3AOFA 2UV8G 3O7UA 1HJVA 1XQLA 2XFFA 4MWAB 2VFEA 3A13A 1DPMA 1NOWA 2WAGA 2X16A 2GUUA 2O9RA 1F2JA 3UXIA 1OC7A 3EOLA 4AC7C 3TQKA 1O1ZA 3BWWA 2WCSA 4WDUA 3N1AA 3VFLA 2Y0FA 1UBPC 2VR5A 5EA9A 4IP4A 1MQRA 1D8WA 5I3IA 3VU2A 2C71A 4O0KA 1R3RA 1IZCA 1FWTA 3E6EA 3WLKX 1YYAA 2B0MA 1Z7AA 2PGFA 3AYTA 1V0LA 4I9AA 2VTFA 1IQ8A 1YRRA 4PC8A 4JFWA 2XSAA 5F1VA 4PUUA 3VI2A 1VFTA 5CAKA 2UBPC 2WB5A 3EOEA 4XD6A 1KGUA 1MNZA 1MWOA 3PR2A 2OZ3A 2FVKA 4QITA 4ZGYA 3FX4A 4A6GA 4C5ZA 1S5NA 1KXHA 3W2MA 1KKOA 3WQ4A 3MY9A 3R8HA 1HKMA 3W53A 1X97A 1WZAA 3IVTA 1E4NA 2YW4A 3MJYA 1UJPA 3AJXA 3O15A 4MPQA 3QHMA 3AAMA 4K39A 3E74A 1D2KA 4FP1A 3BICA 4S3DA 4OGZA 2GVLA 3NAVA 3W1XA 4EF9A 1UKOA 4IMGA 5CJNA 1VENA 1UKPA 1EJ7L 2YPIA 3LI0A 1ONXA 1F07A 3H22A 3ZLHA 1UG6A 5HMFA 1GYNA 3IAPA 1HN1A 4GE8A 4CU7A 1JF5A 3SCWA 3U4FA 3V18A 4NAFB 4ROQA 2HVMA 5DBUA 4KKXA 3DESA 3FK4A 2RGMA 3GG7A 5E6YA 4YPJA 3HN3A 4EF8A 1KLYA 3GZAA 4CU8A 1A5BA 3N04A 2J9YA 3BW2A 4H8UA 2C15A 3EBVA 3K1DA 3UVAA 4PMNA 3VM7A 2VOTA 2Q3RA 4J3UA 1XLAA 4I6KA 1V5XA 4F0LA 3DUGA 1EQPA 4ZTYA 5AC5A 3VE7A 2BDQA 4AZCA 5EMYA 2Z28A 3AXIA 4N4QA 4LS2A 4JNZA 1CTNA 4BY3A 4RZ4A 5H91A 4FNQA 2O4QA 3NEHA 1E9ZB 4U3AA 3VPLA 5HQEA 1BGAA 1KRAC 3PBWA 1DIKA 5HJLA 2WHJA 2IPWA 2Y63A 2PLMA 1CGUA 2PP3A 4O1CA 2QQ6A 4YHGA 1MXDA 1ZS2A 4TR9A 1Q8JA 2ICSA 2XUCA 3RU6A 2D2OA 3KTSA 1V7AA 3FHAA 5AYYA 1ZL1A 3RLHA 2Q09A 3WFAA 5D37A 2O92A 1E71M 4OV9A 2V38A 4ERAA 3WG6A 3E5PA 1GONA 3QLDA 3AICA 4DELA 4H9XA 5HJYA 1K7FA 3VDGA 3TWBA 3CH0A 1F3EA 2BOGX 3GUGA 4JAWA 3QR0A 3WNOA 2NSOA 1QUMA 3CUXA 4K36A 3W83A 5LNSA 2Y88A 1MEWA 1CEOA 2VVNA 4RL3A 1BVZA 3OODA 3ITYA 3ARSA 1FDYA 5D03A 3NWRA 2QPXA 1S1PA 4Q4SA 5A8QA 1RHCA 4AF0A 1QBBA 5K4ZA 1LL4A 1K70A 4OWGA 2FGZA 1XSJA 1IEVA 1JF6A 3H2FA 1V6VA 1AMYA 3NQAA 1GZJA 2ZX9A 2MUCA 1IWPA 3GWQA 4Y8EA 3NSNA 1FWNA 3C2RA 2QCNA 4MSSA 2DEPA 1IV8A 5D2YA 5KETA 5A8GA 1IIGA 3MS8A 4DZ5A 1XX1A 5I6SA 1NELA 3FSTA 5HNUA 2QJNA 4V27A 2DDXA 1J0KA 5DT5A 1LJYA 2Z6JA 4UQCA 3R0DA 1OGSA 1RSCA 2FZ9A 4NL1A 4IQLA 2X7WA 3N9SA 2DIKA 5D2WA 3SCTA 4JHOA 4OUIA 1ZNNA 2ZTKA 2Q71A 4IF2A 5EL1A 1JYWA 3KS6A 4DX3A 4U31A 5AC7A 5TD4A 4L4OA 3KCOA 3WDIA 1AQMA 3QV8A 5I3JA 1TV3A 4RUBA 1OC6A 3WK1A 4LV4A 4OV4A 1TV4A 5CXPA 4R7WA 4Q7BA 1XPYA 3PWIA 4UOJA 1UWUA 3BAXA 4FXRA 3NUKA 2VRKA 1Q4WA 1UQYA 1Q6GA 2WK2A 4UCGA 1O66A 1VHCA 3URAA 2WPBA 4JIIX 4IPIA 3HV8A 1SM9A 3RDKA 1IEXA 1CI1A 2IKHA 4XKYA 2V3FA 2QNEA 4QSHA 1ENUA 1SO3A 2Z4GA 2J6XA 2CLIA 1TPEA 3HZ3A 4LH8A 4XO7A 3TUUA 4JXCA 2J27A 4EX4A 2UY2A 3USZA 5AHLA 1UQZA 1VIZA 1J5TA 2YCLA 1P7TB 4NU7A 1ISYA 2WWDA 4DI8A 3KBJA 4ACZB 4M80A 4JY8A 4IT1A 3WBXA 3W7DA 1UP0A 1MUMA 1JNEA 2GYIA 1EX1A 4O1EA 3G8RA 3TCEA 1NAL1 4PEEA 1T99A 2EPOA 3WMBA 1BWKA 3AFBA 4M7TA 4X3ZA 3HFTA 4CQ8A 3RX3A 1QPNA 3M0JA 4AWEA 2BSLA 5HAOA 3BGAA 4D6EA 4G2DA 2WLYA 5CZTA 1B3VA 1PDYA 2H3BA 3I6RA 3B9AA 4H1ZA 1OYAA 3UJSA 1KFEA 3I68A 4LUTA 3AHTA 4LVBA 1CIUA 2XN2A 2JK2A 3KOFA 1EP3A 3LRKA 4XZMX 3OLDA 4FIRA 1HO1A 1UD4A 1XI3A 3VD4A 2V30A 3QHNA 4B3ZA 4D6DA 4JKMA 2X05A 3UNTA 1VGAA 1YPXA 2WNZA 5A8MA 1FBAA 4QJ4B 3HPAA 3OG3A 3B0VC 3SGZA 4TTGA 2XJ7A 3TW9A 3MKVA 4HJFA 2CU0A 3TROA 4W88A 4AD1A 5HMDA 5A6KA 3H24A 1UH3A 3GVWA 3TJIA 1AH3A 1NF7A 3NQMA 1Z9AA 4DXVA 1RH9A 5JMUA 5TQLA 3TONA 5CPMA 3PG8A 1XLEA 4Y7EA 2WMHA 2BXZA 2QJGA 4ACYA 1UPPA 3COTA 4CVWA 1PXGA 2NLYA 3LDVA 3STPA 2X0HA 4P7LA 1XYBA 1GNXA 3ATYA 4AWTA 2EG7A 2RJGA 4M19A 4BHYA 1B1YA 3U7BA 3IK2A 3W28A 4XO6A 4WLCA 3M6YA 2CLHA 1EGMA 3WQDA 1UD8A 1C8QA 3WD1A 3W75A 2H90A 3WEMA 1TUXA 3GDLA 5CPQA 2ISFA 3QZAA 2ZRWA 3ITGA 4GIRA 5E6ZA 3S6TA 4HBKA 3SRFA 3QKZA 2R82A 5FCZA 1E70M 1PX3A 1EL3A 1EIBA 1G0CA 2PRMA 3QC0A 1ITQA 1SPQA 3RMJA 4DYKA 2WSKA 4NIRA 1L6WA 1VJSA 4GBDA 1RJQA 1KM5A 1UUOA 1I0DA 2ALRA 1JGMA 3QFEA 5GNXA 3KS5A 1V6YA 4BWLA 2EGZA 4HZ7A 3S47A 2GQ3A 3EWUA 4Z2JA 3IRSA 4LS1A 3WQEA 2OSWA 2AQOA 2NX1A 2ESCA 3W1AA 1D9EA 1EO5A 3UG3A 4TQTA 1U33A 4MY1A 3W23A 4IICA 2ACUA 3USBA 1EEPA 3AXXA 3G3DA 1RLDA 1SJDA 1JVNA 5CG0A 1H2JA 2ZE0A 1OCJA 1PZ2A 3H7RA 1JULA 3WD4A 4GZIA 3NO3A 1GGOA 5CJMA 1BRLA 1IT8A 3DFQA 3TN6A 3AS2A 5A2CA 2IQTA 3UA3A 3LHWA 3LLFA 1DJIA 1KD0A 2WSRA 1XFBA 3MTWA 4DYJA 3G1FA 1H7OA 2VCAA 4R7JA 3GO2A 5E93A 4AFYA 4F3HA 4WGXA 2JKPA 3KP0A 4ZOEA 4KQNA 4ZB5A 3N29A 2VDGA 3IJIA 1BQCA 2A3CA 4O0QA 5FOOA 2QCFA 2IKJA 4G9PA 3KE0A 4Z0SA 5BNKA 2G0WA 3CUJA 4UR8A 3W7RA 5JBEA 4ZB0A 4JL2A 2VX5A 5CPNA 2VHLA 5CBBA 2XIJA 3P2VA 4BQ2A 2WSPA 2Y6ZA 3SECA 3O0KA 4KCVA 4L56A 5C2XA 1J6PA 2AAMA 4MVAA 4H83A 1GQJA 1E4IA 3S83A 1A0CA 4GY7A 1RP9A 5G1MA 3A5FA 2FH6A 3HGJA 4S38A 4BQ3A 2IS7A 1ODZA 1MFVA 7REQA 3D3AA 4HNTA 4FLSA 4FB7A 4GUGA 3PG9A 1S2CA 5KZDA 4IHCA 3UWWA 3M0VA 4OOUA 2J24A 1GJPA 3LMYA 3UPWA 1OFEA 2YZ5A 3V7PA 4IXXA 3PZUA 1OFRA 3LS9A 4OBTA 4RZBA 2WO5A 2CLOA 1KFKA 1SJBA 1JZ4A 3CZGA 3B0YA 1LORA 3MANA 3HPXA 2ZXDA 3W7MA 2J74A 2FQIA 3L0KA 3NQ6A 2OT1A 1EZ2A 3AIEA 4YL2A 5F7UA 1YXDA 2Y2WA 1TV2A 3KHDA 1AW1A 3RR1A 5LNRA 4RZ5A 2ZADA 4B2DA 1FRBA 3PPCA 1XBZA 4N9BA 2UWFA 2ZA2A 3IARA 5B80A 1UA3A 1LL6A 4HU3A 1RK6A 1F74A 1J5SA 4AZ7A 1TMLA 3MDWA 3CK5A 7XIMA 2PD5A 1QI4A 3GNDA 3NQCA 1BAGA 3VGDA 4ZQOA 4WKFA 3SR7A 2EG6A 2R1PA 4IIDA 1A4LA 3WLOA 3FKKA 3URQA 1EF3A 4XVDA 2F6XA 2ISDA 2RDWA 3P67A 3K46A 4IQJA 1GG0A 1HXJA 1GW1A 3ZT7A 4XX6A 1TWWA 3C2FA 1NU5A 1ZBCA 2OEKA 1A3WA 3H2CA 4UQAA 4F8XA 1U1UA 1GKPA 3GE7A 4DJDC 1SVDA 3OA5A 3KUMA 5C2GA 3KEHA 3ITCA 4YHEA 1XBYA 4C6BA 1XGEA 4J27A 4M6UA 1MDRA 5FL0A 3TU9A 3G0XA 1FDZA 4C6LA 1PKLA 1A80A 3QPEA 1OY0A 2BV9A 1A47A 2B7QA 4AZGA 1S38A 2ZFAA 1UD6A 1VPYA 2VYOA 4PYSA 1KRCC 1X38A 4LGXA 1VPXA 2QCHA 3M16A 2V3DA 2DQXA 5K7JA 3W1NA 2YL6A 3B9DA 4XBSA 3O6DA 4LAUA 1QT1A 5DLCA 4G56A 4WY0B 4L1GA 1TV7A 1ZJBA 1PWMA 1TMQA 1TRDA 3KM8A 3N18A 4RV8A 1E0VA 1XCFA 3C5QA 4C6DA 5CAHA 1XH2A 2DT0A 2GOKA 2VMFA 2X1IA 2ALDA 5FIPA 1S5VA 5K4XA 5CSUA 4HNLA 2J62A 3T81A 2G4FA 3WD2A 2QW5A 3TNOA 3I7SA 3O6AA 1QTWA 1A5LC 3DG6A 1JRBA 5I3GA 1C8YA 3OOQA 4GWEA 3GVRA 2CESA 5I77A 2XGZA 4F2TA 1YPIA 1FKWA 1UR2A 5JIWA 5C0QA 3TYAA 1X7IA 4JY9A 4QROA 3W88A 3M5ZA 2ZXBA 2C1HA 4QAWA 4P61A 2XM1A 3WBWA 5DT7A 4CGTA 1LT8A 1ZAIA 3CV7A 3Q45A 4CLMA 4UTTC 3ISIX 4IP5A 1NOUA 4ZO8A 5I00A 2X2GA 1TJ0A 3GIYA 4IMCA 1KQZA 1EWDA 4D6HA 1O60A 3VVGA 3W87A 4E38A 4RJEA 5HNTA 5HUOA 2VEPA 5F4WA 3BO9A 3GFYA 4YVVA 4GNKB 3WDJA 4I90A 2GFTA 4OTKA 4AEFA 1B9ZA 3ICJA 1V6UA 3VNKA 2GUBA 3BUVA 4FMVA 2D3NA 1L6GA 4LYKA 3QW3A 5FJJA 1IHIA 4ZOBA 5GNYA 1MW0A 3SIMA 4LJ3A 1B3XA 2VGIA 1KTCA 4JIHA 1P6BA 3HG3A 4L61A 1W5NA 1N8WA 1AA1B 4RNJA 4C90A 1PIGA 4NF7A 4U10A 1DJWA 4QDMA 2Z27A 4E8DA 3HB9A 2BBFA 2WBKA 1OFOA 3QZ6A 4KEUA 1KFBA 2VT0A 5CSRA 2OTDA 4MZ8A 3IEBA 2PDWA 3HTWA 5A5WA 1KGXA 1GOWA 4GLEA 1B54A 3O07A 2BTMA 1G7UA 1G4TA 3BZJA 1TELA 3AHVA 1ZB5A 3FAWA 4E4PA 4NXSA 1WKYA 1TPFA 4PTWA 1LQ2A 3PUGA 2VFGA 3GYCA 5CEWA 4KCUA 5J04A 1Q6EA 3TC7A 2QCDB 3L7RA 1KA9F 3NA8A 4WJXA 3TDFA 3A4JA 2BVTA 1MW3A 3M7SA 4C6KA 2NQ5A 4ATLA 3NIYA 3VD7A 1MRAA 5A6LA 4O0ZA 4KIEA 1H7XA 4KH2A 1NTHA 4TOQA 3JVAA 2AGKA 3L65A 5CLTA 1PDZA 2FFCA 1PX8A 2F38A 1YTDA 2ZRXA 4HOZA 3MP3A 3WLRA 1XPGA 2G95A 3V16A 3SY5A 3QQ0A 1I1WA 4GQ0A 2WJDA 1RA0A 3ZWTA 3F4CA 3QPYA 1EO7A 2QHAA 5JIPA 4NYUA 1UD3A 2QULA 3M44A 1B90A 5BU6A 1DHKA 4CN1A 3JRKA 2R94A 1WOBA 3GRIA 1HJSA 4JR5A 2BGSA 1NF0A 1HJWA 2ZWZA 1XFCA 2AAAA 2PF0A 3VNLA 2H9AA 4MKSA 5I78A 4RE2A 3ZFHA 4WCJA 4HK6A 1B31A 1HUVA 2VXNA 2W9MA 1SZNA 1J01A 1Y65A 4GACA 4UIOA 4Q8VA 1P0EA 3WD0A 1V77A 1K6WA 3VDHA 4BI5A 3TYCA 2FPVA 1QNQA 4DBEA 3A24A 4JN6A 1DYSA 1O7AA 2D3LA 3VZZA 4PMRA 1EC9A 2E40A 3B06A 4JTFA 4O57A 3ZM8A 3K4AA 1PCWA 1W3IA 4JYDA 3FSUA 5A3HA 3EMCA 5I06A 5KINA 3HMJG 3LGEA 1R7AA 3P7YA 2W92A 4A3QA 1G69A 2VUNA 2FZ8A 1M68A 2VI0A 4LVAA 4UFHA 4ZE4A 1XCXA 5G4HC 1W1A1 3IPWA 4J5NA 4IIFA 4HOWA 4D72A 2ZZ4A 3EKLA 2CLEA 3DDMA 1OFDA 2FZDA 1F73A 2WVUA 1AUSL 3RLGA 1SZGA 2I9UA 2XFWA 4AD2A 3H4WA 2VC5A 3U3HA 4HCLA 5LSMA 4XZ9A 2XN0A 1W9PA 3KOYA 3ES7A 3THDA 1K02A 3HPFA 3AWOA 1DQXA 1ZZMA 3Q94A 1S3TC 2HSAA 2Z26A 1RZMA 1SFJA 1VC4A 3GU1A 4B3LA 4M6PA 3GW0A 5C6MA 4K1GA 1Z3NA 1XD1A 1HX0A 2XH0A 3PTDA 4O8RA 2NUWA 4RNFA 4J9JA 1FHUA 2IQDA 3W26A 1GJWA 1BG9A 5DMMA 1S5MA 5BRPA 4UQDA 6ALDA 1U5JA 1KBLA 3B03A 1H61A 3WEZA 3MMUA 1X1NA 4NX0A 4UOZA 2ANUA 1DVJA 1OT1A 3L68A 4Q8QA 1AL7A 3KW3A 1AD1A 1ECEA 1VP5A 7PTDA 1ISWA 4W7VA 5FEZA 3IWPA 1TZ9A 5CPSA 5JU6A 4QLKA 1R9ZA 1E4MM 4QNWA 4GINA 1GTHA 1A0EA 1IWBA 2FHFA 1UWSA 2WSQA 4H8NA 1RP8A 3OG2A 2PGRA 3QV9A 4ASTA 4LC6A 1R86A 2E77A 1TVNA 3DFYA 1TVLA 3FFSA 1JDFA 4JPGA 2QKFA 3CUGA 2ISVA 3WFLA 2XTKA 3W7GA 4K38A 4PMDA 3MA8A 1L8NA 1W9UA 4AD4A 3PTQA 4ZMGA 4UCFA 4DM2A 2VRQA 2P5NA 6TIMA 2PTXA 4WSKA 4J3SA 3M0MA 1R3WA 1AH0A 1WDRA 3HJZA 4DBWA 1AW2A 3S6OA 2YX0A 1ZAHA 4DF0A 2YB1A 2HMCA 2VURA 3BV7A 4XSLA 3ZSSA 2Q8ZA 3W6YA 4IGSA 3TYZA 2A5HA 1DXIA 3C61A 4X2RA 2ATSA 1E3XA 1EC7A 3LX9A 1GVEA 3CMJA 1XXXA 2DSVA 1SSGA 3TLLA 3GXFA 5CC7A 3LRLA 1JCMP 3B40A 4HHMA 5FF2A 4I3GA 3TSMA 1NFPA 5J5RA 3WH7A 2E4TA 5I0DA 4K1WA 4Q8TA 4CN4A 2VRJA 2ZDRA 2H8ZA 5JUVA 1B3WA 4D6JA 1AVAA 1YHTA 2GVJA 2HBXA 1UIPA 3O05A 1O5RA 1BYCA 3NPWA 2V67A 1QHPA 3CS2A 1XIMA 3RILA 2QF7A 3CUFA 3VUPA 3UQNA 1J0HA 3G1VA 1QWGA 1A0DA 1QO2A 1XLLA 1RALA 2WNWA 5LIUX 3DXIA 1CT5A 3CNYA 1GW9A 1ODUA 4HIBA 2BS9A 3E12A 4MUPA 3KL5A 4CCZA 4MZYA 1XLDA 1ONRA 2VQUA 1V3MA 2ZRZA 4BF7A 4JDBA 1CGVA 2Y70A 2F6KA 3FJ4A 5D32A 3F4DA 3QEZA 4H04A 2NQZA 2DZSA 3N3TA 5LA2A 2ZUTA 4A21A 3HPZA 1XLHA 1KR1A 4LRTA 1VD6A 4MM1A 1DHPA 3NL2A 2INEA 4GG9A 4LAKA 6REQA 2VGBA 3H4GA 3LXCA 4A3HA 1HL8A 4J2PA 2OG9A 4ZFMA 4WY0F 1HO4A 4GABA 1G6CA 4YCOA 2PBOA 3EX6A 3VOGA 2QGHA 1J18A 1EEXA 4OVXA 4O50A 3AHYA 1OM0A 3ZZ1A 2A4AA 3BLIA 4H01A