3JR2A

X-ray crystal structure of the mg-bound 3-keto-l-gulonate-6-phosphate decarboxylase from vibrio cholerae o1 biovar el tor str. n16961
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
213
structure length
213
Chain Sequence
TKPMIQIALDQTNLTDAVAVASNVASYVDVIEVGTILAFAEGMKAVSTLRHNHPNHILVCDMKTTDGGAILSRMAFEAGADWITVSAAAHIATIAACKKVADELNGEIQIEIYGNWTMQDAKAWVDLGITQAIYHRSRDAELAGIGWTTDDLDKMRQLSALGIELSITGGIVPEDIYLFEGIKTKTFIAGRALAGAEGQQTAAALREQIDRFW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Mg-bound 3-keto-L-gulonate-6-phosphate decarboxylase from Vibrio cholerae O1 biovar El Tor str. N16961
rcsb
source organism Vibrio cholerae
molecule tags Biosynthetic protein
molecule keywords Hexulose-6-phosphate synthase SgbH
total genus 76
structure length 213
sequence length 213
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3jr2A00
4XQ6A 4YCOA 3C61A 5G2HA 3P74A 3TMQA 4MY1A 4AB4A 4UUIA 2YW3A 4IMDA 3UWYA 1IIGA 3THQA 1SO3A 4MLJA 3RNDA 1QAPA 1B9BA 1GT8A 5BRBA 3LHYA 2TSYA 3P8JA 3PUOA 1VCGA 2E6DA 1KLZA 3IGSA 4M5PA 1QOQA 2YR1A 4WQ6A 1WOAA 4UMCA 4YL2A 3LHWA 2QCMA 1GTHA 2VXNA 1G4TA 1MO0A 3MP4A 3CM4A 2VFIA 3W7JA 3TAKA 3PUDA 2ZA2A 4RJEA 3NQ6A 4O12A 4O50A 1PVNA 5CSSA 4A22A 4NU7A 5CPMA 4QSHA 3QFEA 5G5IA 5AYZA 3HF3A 3TMLA 1PS9A 3B04A 1XKYA 2GVLA 2P0OA 3DFNA 3G1XA 2G97A 4OQVA 3W83A 4NJIA 4G1KA 3DFPA 5I3FA 3IRDA 1RZMA 4K39A 4UTWA 1TTQA 4CLMA 1G4PA 2B7QA 1L6SA 5DN1A 3NAVA 1LBFA 1XBZA 1OFRA 5EY5A 3A5FA 3TAOA 3LXCA 2EPHA 1MXSA 1A50A 3W7CA 4S2CA 2NX1A 3ZWTA 1UCWA 3I7QA 4LC6A 4BI5A 3HBLA 3TSMA 1OABA 3GXPA 2C6QA 5HR7A 4O8RA 3MBDA 3W2JA 1EIXA 2O7SA 2R8WA 3TNOA 2YFOA 1ML1A 5K9CA 3LERA 5D32A 4OBTA 3W22A 1ZFJA 4JYDA 3W70A 3L0KA 1TPVA 3ATYA 4FNRA 1CX9A 1WYIA 2Y63A 3WJWA 1QCWA 3GXNA 5HULA 5I3JA 1CI1A 1LDCA 4GUGA 2TMDA 5HWJA 2DZXA 1TPWA 1MSSA 2VFEA 3FYOA 3LTYA 2ZDRA 2LLEA 4UTKA 1QOPA 4QISA 3GDTA 3M41A 4MFDA 1OFEA 2JKAA 4FX8A 4WJEA 3QSRA 1TIMA 3FLUA 3TR2A 2GVJA 4MVAA 1BTMA 4AVFA 2A7NA 2V2HA 3GDMA 4O28A 5LKYA 3W2KA 3QYQA 2QUVA 2W79A 3QMSA 3G1YA 1FCUA 3QSTA 4DO4A 3NQGA 1F7BA 1L6YA 1QPRA 5FF3A 3P80A 4WX2A 4DEFA 5C54A 5K2ZA 1EB3A 3NZ1A 3TJXA 1KBJA 3VE7A 4JX5A 1LCOA 5D2TA 5E93A 2GJLA 4JYFA 4PA8A 3B03A 1QPNA 5AB3A 1SW0A 3C6CA 4FNTA 1GZGA 2QUUA 3EWBX 4AXKA 2C13A 4CCEA 3W1LA 1TPFA 1OF6A 3KOFA 3ZS4A 5AC7A 1GEQA 3IGXA 1YDNA 1Q3NA 4BI7A 2VFDA 1G6CA 1GYLA 1YPFA 4QNEA 5DXXA 1LROA 1JVNA 2Y7FA 1PHQA 3DKJA 3QEZA 1L6WA 4MKNA 3W7RA 2CLMA 3G3DA 3JS3A 5CPLA 3EXRA 1HL2A 5L6UA 4Y9AA 1LRNA 1TPUA 3DFOA 3NL3A 5CKSA 3NXFA 2P1FA 4M6VA 1PHWA 4POCA 4ZQNA 3S5YA 4IMEA 4PH6A 2BXVA 4UFKA 3YPIA 2Q3RA 2J27A 3TA6A 3H53A 3O6DA 4UTHA 4IMFA 3DU0A 4O10A 3W23A 2PRHA 4KFPA 2V8ZA 1J4EA 1FY6A 5FF4A 2DZUA 1YTEA 4FF7A 2QJHA 3BK0A 3DGRA 1H61A 1XUUA 2J9YA 3EX3A 4UFMA 4LT9A 3MI6A 3G8EA 1TQXA 1XI3A 5BMXA 4MZYA 3NM3A 1YXDA 1R2TA 3BARA 2A5HA 2VKZG 3GAKA 4MOZA 2DJXA 5EL1A 3KFTA 3T44A 1DORA 3C2FA 1GPWA 4D2JA 1QR7A 4LRTA 4GUIA 4K7VA 3W7LA 3TUUA 4B5NA 3LGEA 4KKXA 1YADA 3OEXA 2ZZ1A 3L9CA 3M16A 3EWYA 3CEPA 3HG5A 1KM0A 5DY3A 3T78A 4DPQA 1JCYA 2Y6ZA 2RDWA 3QF0A 2Z0IA 1LP6A 3HGSA 3R12A 1TPH1 3NQVA 3TXVA 3NL5A 1K02A 5FEPA 3I6RA 4ADUA 1FDYA 1G7UA 1NEYA 2ABBA 5LNRA 3G0XA 3W07A 2OT1A 3GVGA 3SZ8A 1YTKA 2V9DA 1YXYA 4AWUA 1OYBA 3E0IA 4YCPA 4UMBA 3GXTA 3MHUA 4DQWA 2TRSA 4XBSA 3O6CA 5KINA 5TIMA 3Q37A 4MUZA 4DXVA 3QZEA 1C29A 2Y89A 4KWVA 1UUMA 3EWXA 2DZPA 1X1OA 2ATMA 4IGHA 5AOUA 3S5NA 3ABSA 3NPWA 3MP3A 1H7RA 1FXPA 1AW2A 2X16A 3QMRA 4ZQRA 3UXAA 3R8RA 4UTMA 4Z1BA 1SSDA 2ZRXA 4ADTA 4WY0F 5D38A 1OVDA 3C2EA 4AHPA 4R34A 4HPXA 3BVJA 1XBXA 3CTLA 2FB3A 1ZAJA 4QITA 3SW6A 1GG0A 3EWWA 3NPXA 3AO0A 2X2GA 1Z44A 4PEKA 2CZEA 1I4NA 5F4SA 3STCA 1OYCA 2JBMA 3ZWSA 3BW2A 1GVRA 3FKRA 3O1NA 1JUEA 1OFQA 4JTSA 1GVOA 3QRHA 1G69A 3W74A 1TRIA 2PCQA 2GQAA 2YW4A 3LRLA 2JKEA 3A24A 3SI9A 5KZMA 3Q58A 1EWDA 2X1RA 1TSIA 1FWRA 1H1YA 2I14A 3GKFA 5F2MA 2EF9A 3KVMA 4IMGA 4IUOA 2CZDA 1OFBA 1TQJA 1X7FA 4QNWA 1UJPA 1EX5A 4K8HA 1AL7A 1ME9A 4FNUA 4UTLA 5EKYA 3FJLA 4LS2A 3S9YA 1A5AA 1F73A 1JUBA 1VYRA 2YYUA 5AYYA 3UY8A 3O06A 2E77A 1DHPA 1VYSX 1A53A 2QCLA 5HJLA 4DELA 1FQ0A 3G18A 3LTPA 3BLFA 2VEKA 3IVUA 5AHIA 2PURA 5KTLA 3G0UA 3N2XA 2I1OA 1GTEA 4CCDA 1KTBA 3D0CA 4NQ1A 4Z1AA 1NVMA 2DU2A 1ZY9A 4LOCA 5LHFA 3EKZA 3C56A 3LTSA 1I8JA 4AWTA 2VFGA 1I45A 4JN6A 3PSWA 1QMLA 1W31A 3W72A 3G1AA 4XUGA 1OX5A 3W2MA 3NVTA 1YPIA 1W54A 3MMTA 3NZRA 2QKFA 2NX9A 2ZTKA 4KWWA 1W5QA 2QCDA 2WNZA 2E6YA 1HO4A 4N2YA 3VI2A 4DO6A 3L2IA 4LS0A 4O0KA 4UMAA 4RXGA 2GJNA 3P61A 1GVFA 1SW7A 3OA3A 1IXOA 2Y62A 5K9DA 3IVSA 3C3NA 4GE8A 5EBUA 3KAOA 2V81A 4HKPA 4JICA 1B57A 5F2GA 4NUWA 2G95A 3NQDA 3UWQA 1K3UA 3WK1A 4O1DA 3W7OA 4JTGA 4N9BA 4OT7A 1EP3A 1PIIA 4K38A 3FJ6A 4IX0A 4UTUA 3SY5A 3TQ0A 2A7PA 4O14A 3R89A 3W9ZA 5HR6A 1VJIA 5F2LA 1SW3A 4ML9A 1JULA 3W1MA 4O11A 3PS7A 3QQ1A 4HPJA 1Q45A 1S5VA 4AHQA 3ABQA 3R13A 1ZENA 3HPSA 2AAMA 3W73A 2EHHA 3O15A 4ZQMA 4DBDA 2YXGA 4X9SA 2QUTA 5CG7A 2IQTA 1W1ZA 1FXQA 3IV3A 3OHIA 2V2CA 1PCKA 3N34A 1W5PA 1EWEA 3DBPA 5LSMA 3GR7A 2Q8LA 1AK5A 2H3DA 1OFOA 4NX5A 4XTDA 5C2XA 1W5NA 4K7YA 1FWWA 2RHGA 4WOZA 2H8XA 4CQAA 2ZA3A 3W6YA 2VELA 3W2UA 2DZWA 2NV2A 2WOQA 2NXHA 3BLIA 2V82A 4TU1A 2WKJA 4LV4A 2B7OA 5HUPA 1FCBA 3N14A 5FF0A 1XBYA 4O1AA 4ADSA 1YTDA 3VFLA 3W84A 4Y90A 3KVLA 1VYPX 2QJGA 3U2OA 3EKLA 3B8DA 3LM7A 1O60A 2JKPA 3M5YA 1VLWA 2Y61A 4HN4A 1LBMA 3W1RA 1K8YA 1ZAIA 1OK6A 2EKCA 3W1UA 3E9AA 5LHEA 5EMUA 3GDKA 4CQ8A 3VNDA 2AQWA 1XL9A 3ANYA 1L9WA 3IVTA 4JTKA 3CLMA 1SUXA 1H7WA 3W7EA 5LNWA 2CLOA 4LRSA 1UB3A 1YDVA 3EX4A 1NFBA 4Z1DA 1ZALA 4ZL1A 1IIHA 3C2RA 2QAFA 1MEWA 1TPDA 3M7WA 2ZCGA 4A3UA 3BG3A 4IQLA 4UIOA 5D04C 3M5VA 4DPPA 1D3HA 1FWTA 3N73A 4FO4A 2ZRYA 4PODA 5H91A 1WOBA 1LBLA 2J24A 2C0AA 2CFFA 3MBFA 2YX0A 4E0CA 4XKYA 2ZZ2A 2RKXA 2F7FA 4NJJA 3DI0A 1JUKA 1AW5A 3G1VA 1GVQA 1TYGA 3UWVA 4JEQA 3Q2DA 4LV9A 3G1SA 1W8SA 2C19A 1VS1A 3W1PA 3TC6A 1BWKA 1FWSA 5FESA 2YFNA 1OX6A 3OG3A 4LWWA 3T40A 1O95A 1WAUA 1JCXA 1TPEA 1ZJIA 5K9XA 3EX2A 4WY0A 4K36A 3S1UA 5AHLA 2CLEA 2XN1A 1KLYA 3LOTA 3BPWA 3HJZA 2WQPA 1LLWA 3KRUA 1YDOA 3MYOA 3ZFHA 4H4IA 4GJ1A 3M6YA 4GRSA 4K8EA 2E5CA 4CNNA 1TJPA 3E49A 3O63A 1P4CA 1OYAA 2E6FA 3QJAA 3W7HA 1KV8A 4ZQCA 4ZMGA 5DLCA 3NR0A 2A21A 2NZLA 3TSDA 3W1AA 3GDLA 3BGGA 2R91A 2I9EA 2X1SA 4NNCA 1M5WA 4TMBA 3GZ3A 4YXGA 5L9FA 4EF9A 1W5OA 2CLIA 2DORA 4WY0B 2OT0A 3S6DA 3QPZA 3NQMA 5AHMA 4L4MA 3BLEA 3STFA 4A2SA 1FCQA 3CWOX 3BG5A 3TW6A 4MJZA 1PV8A 1VR6A 3BW4A 3LCLA 2H8ZA 2OX1A 2E6AA 5DXYA 1H5YA 3CQ0A 1LOSA 3EX1A 4UR7A 3HG3A 1SFJA 3ZR4A 3QQ0A 1S5WA 2YSWA 1D3GA 2ZRWA 4ONVA 2A0NA 2ZZ5A 3GNNA 4WXZA 4QAIA 4O15A 3TV8A 2PRMA 3RK8A 3M47A 3OVQA 4RV8A 3FFSA 2QR6A 1KFEA 3MHGA 1JCMP 2QAPA 1NAL1 5HINA 3JRKA 2YYTA 1SPQA 1TRDA 3CWNA 4BWLC 2FB2A 1W3TA 3P8IA 4Y96A 1KV5A 1EP1A 3UWZA 1MEIA 1A5BA 3NOEA 1RV8A 1JQXA 1RPXA 1WV2A 3NO5A 4ICNA 3S1XA 3MJYA 4JS3A 3QW3A 2CLHA 5F1UA 1GVSA 5FEZA 2NXGA 3HOJA 3HPXA 4QIUA 4R33A 3LRMA 2Y85A 1HUVA 2VEPA 3C4UA 2GVGA 3LCIA 1F6KA 3GYEA 1K7EA 5IM51 3UNDA 5C6MA 4IXHA 2FLIA 1S5TA 1H7XA 3AJXA 3A23A 3PUEA 4AAJA 3W7DA 1W37A 4OE7A 3TQVA 4R53A 4UFIA 4JTUA 1VCFA 3LCFA 1QPQA 4GXMA 1YYAA 1J5TA 3LB0A 2NWRA 2E68A 2CZ5A 3SGZA 3V75A 3QC3A 4PC8A 5CSRA 1TCDA 2HTMA 4FHAA 2A1YA 3A21A 4NXSA 4PL1A 5I3IA 2Y7GA 4MJMA 4FNSA 5DY2A 4O57A 4LVDA 2NV1A 3CPRA 3O6YX 4RX0A 1R2SA 3WK2A 4FB7A 2FFCA 4LNYA 4RZ6A 4I7UA 1WA3A 2V30A 3GIYA 3DH7A 4UXDA 3M44A 3DI1A 4UTTA 4HIBA 4GFSA 3NG3A 1LM1A 1OF8A 2FIQA 4NX0A 3O16A 2R14A 3C8FA 1Q6OA 5AC6A 4I7WA 5G1YA 4GUFA 5CZ0A 2Z2UA 4Q32A 2QF7A 3GAYA 4R7JA 1SU5A 4XZ9A 5U7SA 2D73A 4H6KA 1F76A 3VKJA 3PG9A 3LXAA 4O0ZA 3K30A 3L5AA 2ZZ6A 4Y8FA 1FBAA 3QPYA 1NSJA 3TDFA 3L5MA 2CLLA 4LUJA 4KFOA 5EPDA 3CEUA 4C1LA 4P61A 2XN0A 3TU9A 3OVPA 1I2NA 2WSQA 2PE4A 5BW6A 3ABRA 4NJKA 3G3MA 1YXCA 4N9CA 2C16A 5D33A 1JR1A 1LZOA 3NQAA 3UPWA 6TIMA 1KM3A 3I7RA 2P10A 6ALDA 3WJXA 4N9DA 3LXBA 3USBA 5BNKA 3B05A 1KFCA 2RH9A 2FJKA 1W0MA 1K7XA 3C2VA 3UYCA 4E38A 4LW7A 2C1HA 4AF0B 3U8GA 3TCEA 5CZSA 3HG4A 1WQ5A 4RZ4A 2O7QA 3P62A 4RKAA 4HNNA 1DKWA 1VCVA 3LHVA 1DQXA 3KRZA 3PULA 4QJ1A 4JTJA 1KM1A 4RXFA 1ME8A 1W56A 2NX3A 5TBOA 3THAA 1S3HA 4YWIA 1V5XA 2JGYA 4LS1A 3W1NA 2FPTA 1GYNA 3PB2A 5I3HA 3STGA 2Z1BA 1YLVA 2OCZA 1ICSA 4S2BA 1OFAA 1G4EA 1TPB1 3W1XA 4U4MA 4NXKA 1Q6LA 1I2OA 3G1FA 3H55A 3IIOA 4S1FA 3DKLA 4M6QA 1SFLA 1KBIA 4JX6A 4TIMA 1C9DA 1NF0A 5KMYA 4I9AA 2QCNA 3NQ7A 4O4WA 2C18A 1UBSA 1VLIA 1Y0EA 4A2RA 4FXSA 1EPXA 1NF7A 3PF3A 1FWNA 1LORA 2ABAA 5LGXA 5KSWA 1VPXA 4FX7A 3IGUA 4M6PA 2E5BA 4X2RA 4O19A 3F4WA 1KFJA 2ZZ4A 1VGAA 4JDBA 1OFDA 5IBXA 4FX6M 5T26A 5KZEA 3T55A 5K7JA 1EUNA 2CZFA 5HMSA 5I3GA 4DF0A 3V1PA 3LHTA 4CQ9A 1U83A 5A8GA 4MPQA 2WPBA 2DJLA 1LOQA 4O1CA 4JTTA 3PWAA 4GUJA 4LY8A 1B4EA 3HGOA 4LC8A 3O8AA 1VQTA 2ISSA 1GOXA 2BZNA 4OGZA 4XBKA 4XKYB 5AN7A 1LRQA 1WXJA 4FXRA 1CW2A 1D9EA 2QCGA 3CT7A 1N55A 2WNQA 2YZRA 4RR4A 1VRDA 4H3DA 4P2VA 2J9XA 3SR7A 3DHDA 3QM3A 4UTTC 5DBUA 3W7MA 2VEIA 3DFTA 3QMTA 3PC0A 1QPOA 4MY8A 3B0VC 5D2VA 1FCVA 1AMKA 2VOMA 3E02A 4NNAA 3HIJA 3LBMA 3SIZA 1JCJA 3B06A 1UUOA 1SO4A 2DP3A 4WD0A 2WSYA 3LCXA 3LHZA 3S0CA 3NL6A 5BOOA 4IWWA 4ALDA 2ZA1A 2X1UA 2C15A 3IIXA 3WJSA 1KFLA 2DZVA 4PTNA 1I2RA 5BMWA 5GVJA 2NXIA 5G4WA 3PBUA 4JY9A 4ZZ9A 1N7KA 1K8ZA 1ALDA 3W88A 3NGJA 2BWGA 3FOKA 1XDLA 1H7NA 5MHBA 3GNDA 5IBXC 1H7PA 3SECA 2CW6A 5LNSA 3M1ZA 5D30A 1OX4B 4UR8A 4NZJA 3B0UX 1XCFA 5KZDA 3I68A 5D2YA 3QH2A 3NQFA 3UZJA 3CIWA 1KM4A 2GPTA 1EUAA 3SSJA 3W1TA 5CGQA 5AHNA 5SWUA 1TTPA 4JTHA 4HT3A 1SR9A 3DFSA 4LVFA 1X6UA 3NQ8A 4O53A 1B4KA 2HSAA 3W7IA 3M9YA 1XBVA 3S8HA 1PE1A 2EGZA 2HS8A 1SSGA 1QWGA 2A6LA 4LVBA 1OJXA 3LDVA 2J9ZA 2Z6IA 2B7NA 3CB8A 3P84A 3MYPA 2QJIA 1FX6A 3EX6A 1R47A 5U4NA 4OWGA 1ME7A 2BLEA 4UFHA 5DCDA 2CU0A 3TIMA 1GG1A 3STEA 1XUZA 4UFLA 4JR5A 4UTJA 3P81A 1AL8A 4DO5A 2XFWA 3PBVA 3GX9A 3FKKA 3HGJA 4RZ5A 3NPVA 3OVRA 5DCEA 1AW1A 5J5DA 2J88A 3F1QA 2NUYA 1B3OA 2F84A 2GOUA 1HFBA 5D2WA 5CZTA 3UXDA 4IXXA 1O94A 4CNPA 2E1DA 4JTIA 1QFEA 1ONRA 3BW3A 1PL9A 3L0NA 2A6NA 5FF2A 4DF2A 5G2IA 5LZLA 3W1QA 3LV5A 8TIMA 3L67A 3IIVA 3G1DA 3L65A 4EWND 4AWSA 4BF9A 2ATSA 3M0ZA 2X1TA 4PFMA 2C3ZA 1GWJA 1Q6RA 2FPVA 4MIMA 3W7KA 2QEZA 2Q3OA 3PBWA 4O54A 1SO6A 3PR2A 1G67A 3LCGA 4Z1CA 4NNBA 3MWAA 4HNTA 2GQ8A 3S5ZA 3IIZA 3N9RA 1IXNA 3RMJA 1W3NA 1LLZA 1ZHAA 1FDJA 3GKAA 3TH6A 4JDYA 3P7YA 3EB2A 1RQHA 4HNUA 2H6RA 5CZJA 4AHOA 1EEPA 3C52A 1LYXA 2UV8G 3UY7A 2Y7DA 5LGZA 3CHVA 1OFPA 2E5DA 3A9IA 3H54A 4FNPA 3C2OA 3W76A 1THFD 2QCFA 3WFAA 4TO8A 5D02A 1P1XA 3TW7A 2B0MA 2CWNA 1KFKA 3LI0A 3DXIA 1WX0A 1IGSA 1H51A 2ZQ0A 4WUIA 3EWUA 4AF0A 1TPC1 3NPUA 4YLWA 3CIXA 1ZCOA 4LUIA 3PAJA 2DZSA 3NDOA 2WNNA 3W7GA 4E2BA 7TIMA 3LLFA 4UCGA 2ZTJA 4XTIA 5HNRA 4N9EA 1R46A 5HUOA 3OIXA 5F4XA 1TV8A 1DL3A 1A5CA 4RK8A 3PBYA 2NUWA 1DOSA 3BV4A 4O4VA 3TJLA 3HB9A 1KM6A 3WK0A 3G22A 5K4ZA 5HWMA 4ORIA 4NJGA 3IIPA 3G8RA 4JIPA 2OZ0A 1HO1A 2WV8A 5C5YA 4N4PA 4WZHA 3GR8A 4O18A 2NLIA 5FI8A 4Z08A 3HG2A 4UFJA 3N2MA 1P0KA 1ICPA 3WK3A 2BSLA 5LNUA 1MZHA 3TSBA 1KW1A 3PB0A 1H50A 1VHNA 3S42A 1BKSA 1F6PA 3PSVA 1P5BA 3HQ1A 1VHCA 4NVTA 1DQWA 3L21A 3L5LA 2TPSA 3BG9A 5CPNA 1OX4A 4JXCA 4QM1A 4IPJA 2ZRUA 4A29A 4I7VA 1W5MA 2HMCA 2ZBTA 3O07A 3S1VA 3HO8A 4JYEA 5C55A 1XDMA 2G5WA 1TV7A 3TQKA 4GUHA 1BEUA 3R5EA 2Y88A 2A4AA 1JCNA 3FEMA 3FIGA 3MI2A 2V5BA 3IEBA 1I2PA 3P82A 3B0PA 3W7PA 5D2XA 1Z41A 1WDWA 1JRBA 3PG8A 3HGRA 3NM1A 3M5XA 5DCBA 1T99A 3GLCA 1K7FA 3PM6A 4ZQOA 5D05A 1QDSA 2QCDB 5EA9A 5ABTA 5K3VA 2C14A 3KRSA 3MP5A 3SFKA 5H2ZA 3KXQA 1RR2A 4CCCA 5E0KA 1KFBA 4JTLA 3W3OA 4OV4A 4XWUA 2BX7A 4YMZA 1QO5A 2R94A 1SZGA 3DHFA 3NQCA 2GQ9A 3LBCA 5TQLA 3RF9A 3RLUA 3S5OA 3N19B 2FPYA 4E2DA 3BO9A 2E09A 5DELA 2VENA 2FQIA 1ADOA 1DBTA 1DV7A 4KFNA 3WJZA 4AEOA 1J2WA 4UTIA 1XFBA 4MY9A 2ZZ7A 1SQ7A 2Z6JA 2CLKA 1SZEA 2ALDA 4U28A 5AYXA 2VFHA 4K6AA 3LCHA 1DVJA 4GBUA 5HQEA 2FTPA 4NT0A 1X1ZA 3JR2A 4BI6A 3PVFA 3GDRA 3G0SA 3G1HA 5EYWA 5F4WA 2W6RA 1F2JA 1HTIA 1LTDA 4WXYA 3TFXA 1H63A 4O52A 1LOLA 3SGUA 3R2GA 2RFGA 3DENA 3W87A 3L68A 1F05A 2PRLA 5D03A 3ELFA 2H90A 2QCCA 1KA9F 1XC4A 3E96A 4MLRA 4JGDA 4AH7A 4DBEA 3UPBA 2QCEA 1RQEA 4A21A 2WJZA 3C0JA 1GJPA 4JTFA 4ZVJA 3N9SA 3DFQA 3VCRA 2EAWA 4DF1A 3L0GA 4Z0JA 3FA5A 1KM5A 3ATZA 3N3MA 5LNVA 3EWZA 3NNTA 2ZRVA 4LTSA 2TYSA 2ISWA 1FUYA 5KITA 4GNJA 4EOUA 2JGQA 3MO7A 1U5JA 1T0OA 4IPIA 3INPA 3LLDA 4HHPA 4LVGA 5G1TA 4OV9A 1DJNA 3G24A 4UNKA 1O5KA 1MEHA 4O1BA 3EXTA 4MFEA 3DZ1A 3MHFA 5FEXA 1IXQA 4MYAA 3NA8A 1OG0A 2RDUA 4M19A 3RLVA 2PC4A 3W7NA 4BK9A 1V7YA 4MYXA 3W2NA 1SZFA 3T4CA 2HS6A 2Y70A 2VFFA 1Z42A 3I65A 1OK4A 3GB6A 2VEMA 2YPIA 3CU2A 1Z48A 3P5ZA 2B7PA 3NQ2A 3TFCA 5A5WA 2Y7EA 2W0UA 3O05A 1ZAHA 2DZTA 2AGKA 1FDZA 1H60A 4CNOA 4FNQA 4JNMA 3LX9A 4L4LA 4EIVA 2Q8ZA 5AHFA 3TC7A 5E1QA 4WOQA 2V2DA 3KHJA 3UZ5A 3KVKA 3RFAA 3P60A 1K03A 2NWSA 4O13A 1VC4A 3W86A 4Q33A 3W71A 1T96A 1R30A 3P67A 3LI1A 1EA0A 1UASA 4J9JA 4UTWC 3TK7A 3T7VA 2V0TA 3LHUA 1QO2A 4Z0SA 4O17A 4IOTA 5FF7A 1K8XA 3M43A 5D37A 4OHQA 1O4UA 1IXPA 2WSRA 4RLIA 1P0NA 2A85A 4JX4A 1W3IA 4M7SA 4FEZA 1JJKA 1O5XA 1JQVA 3LCWA 1H62A 1DJQA 1EP2A 3LRKA 2KZHA 2J6XA 3W85A 3NYZA 2WO5A 2JK2A 4JY8A 4TX9A 2FDSA 5D09A 3HPZA 1M6JA 1XM3A 3RU6A 1RQBA 1JRCA 4W9TA 1ZNNA 3A22A 2V5LA 3A5VA 1E51A 3W2LA 3KVJA 3F03K 2H3BA 2YDAA 3ABOA 4LU0A 3F4NA 2A2IA 3S1WA 1WBJA 1KTNA 3TXZA 1F74A 2X30A 2ZYFA 5F1VA 4HSOA 3FYPA 2RDTA 3MUXA 1RD5A 4ORMA 2QDHA 1T8XA 5J5RA 1LRTA 1JCLA 4QQ3A 2G96A 1M7PA 1C8VA 3UWWA 2YGYA 3U6WA 3BGJA 4NZFA 1N8FA 3OBKA 3TKFA 4C1KA 4K37A 3I7SA 4JD4A 5F2IA 5G2WA 3MI3A 4X3ZA 1TV5A 2ZZ3A 4N4QA 5I3KA 4M7TA 5FEWA 3EXSA 1F5ZA 1TREA 3FS2A 4GWEA 4N6FA 3DAQA 4BR1A 4TMCA 1L2UA 3HMJG 1SZNA 2B4GA 2BTMA 4MZ1A 4FIRA 2YCEA 4O16A 4PCFA 1A5SA 1QNVA 3UWUA 5HWNA 3E12A 3W75A 3NL2A 4N6EA 1TO3A 3GK0A 1TTJA 2CLFA 4N02A 1TB3A 1TJRA 3VE9A 4IJBA 1BWLA 4GC4A 4TR9A 2QCHA 1KTCA 4IX2A 1SO5A 5K4XA 2GUUA 2ISVA 4IMCA 3TX9A 3TROA 1Q6QA 1G4SA 5AFDA 2ZFAA 1TMHA 1GQNA 2VC6A 1G7VA 1I2QA 4Q4KA 2OMAA 4MZ8A 1OHLA 3M5ZA 3PY2A 4RCXA 4ZQPA 3NEVA 4JIQA 2OJPA 4NJHA 5G4EA 4BWLA 4BFAA 4OU1A 2NUXA 3UQNA 1TTIA 2QDGA 4HSNA 4UC5A 3TE9A 2XN2A 3W7QA 1PCWA 4EF8A 3MW7A 3CC1A 3SJ3A 1IF2A 3Q94A 4PL2A 1WBHA 4UNLA 1HG3A 2A7RA 4EVZA 1KM2A 3KX6A 1H1ZA 1X8FA 1R2RA 5AC8A 3L66A 3LV6A 4HNVA 4AMAA 1VH7A 3QW4B 3P5YA 3B4UA 3UD6A 5CPOA 3NQEA 2ZRZA 4LVAA 3EEGA 4Y6GA 4FIQA 1M7OA 5AHEA 1ICQA 1VZWA 1RVGA 4X22A 3WJYA 1XXXA 1H7OA 4JTEA 5DBTA 1AG1O
chains in the Genus database with same CATH superfamily
3U7VA 3KWSA 3ABZA 3QXBA 2YW3A 3T81A 3KZPA 1R7OA 1CLXA 1XIMA 4HNOA 1QAPA 5BRBA 3QZ6A 1K4HA 2JEQA 1K1DA 4H19A 2TSYA 3AIBA 3P8JA 3RUBL 1FWFC 1VCGA 1E6RA 3GHSA 3MUZ1 5H6HA 4M5PA 2MUCA 3OZOA 4YL2A 4D6IA 5A6BD 3E74A 2W63A 4PMDA 1GTHA 3T42A 5BYWA 1HJVA 1TELA 3PBMA 3VIFA 4ZXLA 3MP4A 3B8VA 4L56A 1GW1A 3W7JA 2ZA2A 1CXEA 3NQ6A 3PZGA 4O12A 4MJ2A 5CSSA 4A22A 3BMXA 5C7VA 1X8CA 4Z2GA 2BVDA 1TX2A 1BYAA 1ONEA 4PTMA 1EL3A 2P0OA 1VFFA 3CHEA 1TWDA 4K39A 2CESA 1OFRA 2VYOA 1FP8A 3C5QA 3EPNA 1QHPA 4KW2A 4PMRA 4S2CA 3I7QA 4LC6A 3GXPA 3MBDA 2R8WA 3UR7A 1XG4A 4ZGYA 1ML1A 1XLGA 5K9CA 3KTXA 2XVNA 3LERA 1DE6A 2HK1A 2ZWZA 4OBTA 4JYDA 4KEUA 4QFUA 3L0KA 3U2CA 3GNRA 1WYIA 4D8ZA 5A8OA 1QCWA 3GXNA 1J0IA 4GUGA 2OVLA 4QEHA 1Z69A 4AZIA 4I9JA 1E1EA 2TAAA 4GBDA 3GDTA 4PRWA 3VGBA 5I3DA 1OFEA 3O7UA 3WNLA 1RJRA 2P88A 3QSRA 1TIMA 3TR2A 2GVJA 1BTMA 4AVFA 3QOKA 4AD3A 4O28A 3QVQA 4PMJA 4DXKA 2QUVA 3NTYA 4N7QA 4XZBA 4BY3A 3QMSA 3G1YA 4ACZB 3GXDA 1FCUA 4S3GA 5IRPA 3XIMA 4DO4A 4ZO7A 1L6YA 2PTYA 3UXKA 3MSYA 4WX2A 5C54A 3WNPA 1OWQA 2QV5A 3BE7A 3VE7A 3PZTA 2PWGA 2XISA 3SUSA 3CJPA 5LYRA 3B03A 1QPNA 2ACUA 1GZGA 2QUUA 2C13A 4CCEA 3W1LA 1BFNA 4RE4A 3WL1A 3KOFA 3EGJA 5AC7A 2DV0A 5C70A 3ITGA 2VFDA 4S3JA 3WX7A 1LROA 4XVEA 1HL8A 3QEZA 3G3DA 4NL1A 1B30A 3QPEA 7PTDA 5L6UA 1LRNA 5G1MA 3S5YA 3ANVA 4PH6A 4HK5A 1XYZA 4R7WA 3NWRA 3O6DA 4UTHA 1HZYA 1A47A 3W23A 2V8ZA 4C6MA 4FF7A 3AHTA 4R85A 1R9XA 2BY0A 1XUUA 4ACZA 1H2JA 3VOHA 4PTVA 1ZU8A 3G8EA 3MI6A 1XI3A 1E71M 4UNIA 4MZYA 4JZ5A 3NM3A 4FLQA 1QOXA 3BARA 4E3TA 4C6LA 2A5HA 2VKZG 4F48A 3VFCA 1YPXA 4MOZA 1DYSA 3AMCA 3PP7A 4L64A 4AEFA 4KF1A 1AUSL 5ABFA 4GUIA 2FVLA 4B5NA 3LGEA 3UVIA 1EHAA 2P3ZA 3RCNA 4KKXA 2HISA 1YADA 4KCTA 2ZZ1A 2GDQA 3CAKA 3EWYA 1VBRA 2QPSA 2ZX5A 1UKOA 3FGCB 4UQEA 1LQ2A 5JH2A 4DPQA 2RDWA 3HGSA 4ZXOA 3COTA 2WMGA 3R12A 1PJ9A 5D4YA 1TPH1 5B80A 1D2KA 3TXVA 3F2BA 1G7UA 1M01A 3PN8A 1YXYA 4AWUA 2J6VA 4F4RA 3GXTA 3MHUA 1TUXA 3TCSA 4KRZA 1HN1A 5TIMA 4MUZA 1M1BA 3QZEA 2J25A 4AD1A 5B7ZA 2XPKA 3EWXA 1ONWA 1A80A 2BP1A 1J8VA 4IGHA 3C8NA 3WBYA 7CGTA 5FOOA 4KIEA 3MP3A 4R3UA 1AW2A 3FXYA 2WMHA 3AZRA 4Z1BA 1H11A 2DSUA 3WEZA 3VDHA 4ADTA 1FFRA 3C2EA 3GM8A 4AHPA 1OGBA 1BPLB 4HPXA 1FKXA 2FB3A 1ZAJA 2BVWA 4AWEA 3AS3A 1Z44A 1B90A 1I4NA 3OLGA 1JZ7A 3N2OA 2ZWYA 4OTKA 1AMYA 3FKRA 1OFQA 3AUOA 3QRHA 1G69A 4LUSB 4UQDA 2PCQA 4IIFA 2YW4A 1ECQA 4GLEA 3SI9A 3EWDA 3KE0A 4H6RA 3V35A 4TXEA 1EWDA 2X7VA 1TSIA 3HQNA 2I14A 3GKFA 4URIA 2WPGA 4IMGA 4GQQA 2QJMA 1FWIC 3LM3A 4K8HA 1R3YA 1ME9A 2XHYA 1Q6CA 5FD0A 3BJTA 3NQBA 4TV5A 4FR1A 2E77A 3V5CA 3M0XA 5C9ZA 4M82A 2VEKA 3CAWA 4MPKA 4S3BA 1KBBA 3G0UA 2VX7A 4GKLA 3URBA 2PP1A 3K2GA 3UESA 1YQ2A 2DU2A 4B4FA 1ZY9A 1H49A 5LHFA 1VB9A 3LTSA 3VIKA 2VFGA 5CXPA 1QMLA 1W31A 3W72A 1KB3A 1BVNP 1YDYA 1POKA 3NVTA 4HZMA 3MMTA 2CKRA 3NZRA 4EPEC 4XBJA 2REQB 4HB7A 2PSNA 2QCDA 2WNZA 2EQDA 4JQ3A 1IEVA 4LUTB 1J96A 3TOYA 3TTYA 1H3GA 3L2IA 4UMAA 3IAQA 2VGBA 4KEMA 4RW5A 1D8CA 2GJNA 3NYDA 1TJ2A 1PKNA 3OLDA 4WF7A 3AAMA 1IXOA 4XSMA 6ENLA 1R8LA 5CBIA 5EBUA 3KAOA 4OUEA 1TWZA 3CMJA 1SJAA 1YEYA 4HHMA 4NUWA 4I5UA 4P8VA 4AIBA 3UWQA 1NARA 1M41A 4O1DA 5H8PA 4JTGA 1EP3A 1PIIA 5D9MA 1JNDA 3FJ6A 1C91A 4IX0A 3FX4A 1C8XA 3TQ0A 4ZENA 3K13A 5HR6A 3UJRA 4PUJA 4LJ3A 1SR0A 2WVTA 4AFYA 2PLJA 3FSTA 3MANA 4CD7A 4O11A 2VX6A 1F4HA 3PS7A 1Q45A 3VDBA 4TTGA 4B2DD 3R13A 3KEHA 2AAMA 3W73A 4B9YA 2EHHA 3FEQA 2AAAA 4DBDA 4X9SA 3LNMA 2V6AA 1IGWA 5CG7A 2IQTA 2A3EA 1G0CA 2V2CA 2ZUSA 1Q7MA 1W3HA 1C8QA 1V93A 4JEJA 1V3MA 3UFYA 4FA3A 1W5NA 4PMOA 4K7YA 2YOCA 4DJFA 1ADSA 3WMLA 4R5EA 3MMWA 1F8IA 3N29A 2WOQA 2NXHA 1V0KA 2EXOA 1Q4WA 2WSPA 3FSUA 1UR0A 4FOUA 1R85A 2AL2B 1Z7AA 2B7OA 3BMWA 3H2OA 4MNJA 1R7AA 1WCGA 4KT2A 3W84A 2NQJA 3IJLA 4ROQA 3KVLA 3VM5A 1DJHA 2QJGA 1G9HA 2PDYA 3LM7A 2JKPA 1HQTA 3M5YA 2Y61A 4HN4A 2Z1KA 1XYAA 3DGBA 5EBAA 2YLAA 5HBFA 2XM2A 3SUTA 3CLMA 3HN3A 5A6BA 4US5A 2CLOA 1SJCA 4H7CA 1C93A 3R79A 3SM0A 3C2RA 3KBNA 4KESA 4UIOA 1F3TA 1G5AA 1FWTA 4DPPA 3N73A 2ZRYA 1WOBA 3H7VA 2PA6A 1CGXA 4IFOA 4NJJA 1JUKA 4YTQA 1TJ0A 3G1VA 4CD4A 4S3FA 3W1PA 4HZ8A 3FW6A 4LB3A 3WDPP 2PCEA 4LWWA 5AC4A 3T40A 1O95A 2J47A 1ELSA 5K9XA 4GOAA 3QLDA 4KCWA 3IUDA 3GFZA 1T40A 1E0XA 2HJPA 2D20A 1KLYA 2YCKX 3BPWA 3J7HA 4GZJA 3AMDA 1K4GA 3GZAA 1V3KA 1O5RA 3LK6A 4GJ1A 1XH2A 1AFSA 4CNNA 5XIAA 2PGWA 4MSSA 1K6WA 4ZQCA 1NWRA 2EPNA 3GW3A 1UR2A 3F5JA 4IGSA 2BFGA 2QJNA 3TSDA 3W1AA 2BOFX 1F6YA 4ICCX 4V2XA 2X1SA 4NNCA 1M5WA 2L5HA 1AQMA 1W5OA 1V03A 4H8NA 4HMDA 5IXEA 6XIMA 4GJJA 2PDUA 5AHMA 1KR0A 1E1FA 2BY2A 4HZ6A 5AY7A 2CLPA 2OGJA 3T2PA 3IV8A 3BLEA 4U33A 1BWVA 3BG5A 4MJZA 3VNKA 3R1ZA 2CBIA 4HBKA 1W91A 2H8ZA 4A8LA 2E6AA 5DXYA 1LOSA 4UR7A 3H8AA 1S5WA 1D3GA 4ONVA 3VMOA 2NW0A 2ZZ5A 4WXZA 4QAIA 1PZ2A 3TV8A 2PRMA 3RK8A 1LWJA 4DNHA 4RV8A 4Y9PA 3VGHA 1EC9A 3WD4A 1JCMP 2QAPA 2YYTA 4P8WA 4Y9NA 1TRDA 1W3TA 4Y96A 2VDGA 4QCEA 1MEIA 1EEXA 1ONXA 2XH4A 1RY0A 3NO5A 3S1XA 1E6ZA 2G3NA 4B5SA 4F2TA 2QGYA 4F2BA 1HUVA 2VEPA 3GYEA 3FXGA 1K7EA 1EIBA 5C6MA 4IXHA 5J8LA 4PUMA 4DJEA 3AJXA 4AAJA 3TN6A 4R53A 1K9TA 1VCFA 3G6LA 1YYAA 4GYPC 5CGTA 2CZ5A 3VD5A 4PC8A 2YDSA 4U3CA 1AJZA 4Q4SA 5I3IA 4MJMA 3ZVIA 5DY2A 2EJAA 3O6YX 3KCOA 4RZ6A 1WA3A 1OCBA 4HIBA 1W9VA 1OC5A 2FIQA 4YU1A 4PTDA 5CZ0A 4E4FA 2CHRA 3PK7A 3AHYA 4R7JA 2QF7A 3GAYA 1SU5A 2W66A 4AG0A 2ZX6A 3PTMA 1KBKA 3IJ9A 2DUZA 3RHGA 1OZQA 3VKJA 2BBFA 3D6NA 3K30A 2ZZ6A 4Y8FA 1JI2A 1RSCA 4XV0A 2VRQA 1MXGA 3NGFA 4B3ZA 3L5MA 4EE9A 3WQ6A 3PZIA 1LT8A 3VGGA 2FZNA 3CEUA 3R11A 4D1JA 2XN0A 3WQ4A 4FR6A 3TU9A 5BW6A 1XDJA 3VD4A 3G3MA 1YXCA 5H8MA 3UPWA 1KM3A 4N9DA 1XLCA 3N2TA 1C90A 2C1HA 1P43A 3TCEA 1DIDA 1YNQA 1Y5VA 1CXHA 3L4WA 3REQA 1EBGA 3P62A 4H2HA 1IR2A 1DKWA 4FI4A 1VCVA 2DPEA 4XK2A 3WBAA 3WNMA 3PULA 4QJ1A 2G3MA 3MZNA 1KM1A 5I09A 2V38A 2Y24A 3CMFA 1O6IA 2GL5A 9XIAA 4PBFA 3USZA 1CXKA 4LS1A 1FWEC 1E0WA 1YLVA 4BQ2A 5CPSA 1OFAA 2X1IA 4J3WA 1M04A 2QULA 2PDLA 4NXKA 1ZJHA 4S1FA 1FP9A 4JX6A 5KMYA 1NF0A 3NFUA 3OVGA 1MUWA 1ZB5A 2C18A 2XG9A 2ZADA 4A2RA 4FXSA 1EPXA 3PF3A 3GSMA 2AGTA 4MF4A 3IGUA 4X2RA 3VU2A 4D1IA 3RLHA 2XGZA 3EAUA 1S2UA 4O8AA 5T26A 5KZEA 5HMSA 4PB4A 4CQ9A 3LHTA 5RUBA 2PUZA 5A8GA 1V08A 4F9DA 4JTTA 4LY8A 1DEDA 1L6FA 5EFDA 2OO6A 3HGOA 1L8PA 1EGMA 2ISSA 1S5MA 4GYJA 1LRQA 2C1GA 2PAJA 1D9EA 1N55A 3A4WA 4RR4A 4H3DA 4NILA 1OD8A 2OQLA 3QMTA 4KBXA 1FCVA 1EJXC 3GYCA 4W89A 1HW6A 4D6CA 1AMKA 3BMVA 3QY8A 4NNAA 3E02A 3PAOA 4J1OA 4D6HA 3APGA 3SIZA 1JCJA 3B06A 1SO4A 5CGMA 4Q6XA 1SGJA 3K1DA 3V0TA 3LCXA 2DGAA 2GGIA 3NL6A 3WF1A 1XPYA 1OIFA 1GOWA 2EG7A 4NI8A 1UYQA 2ZA1A 1YW1A 4QGCA 2NT0A 2C15A 3IIXA 4FAMA 2DZVA 3VOFA 4UQBA 4J3UA 3GNOA 2OU4A 2WJEA 3OG2A 1XDLA 1KBLA 5MHBA 1W1VA 2GSEA 4MB5A 3CZ8A 5LNSA 3TYCA 4NZJA 2EBNA 2X7WA 3WLLA 2WZIA 3B0UX 5A2AA 5BU9A 2WVVA 4QR6A 4ZB2A 1FTXA 3OBAA 4J3SA 4DAIA 1PWMA 3W1TA 1KD0A 1EC8A 1RA0A 1TTPA 4JTHA 9XIMA 3DFSA 2EGZA 2PDXA 4XZMX 2HS8A 1SSGA 1QWGA 1S2AA 2GDUA 1Q7ZA 3TEVA 1O5QA 1OJXA 4IISA 2GJXA 3CB8A 2Y8UA 3MYPA 4XKMA 3UZZA 1FX6A 1PTGA 1R47A 4OWGA 4PCNA 4UFHA 2V3GA 1OGGA 1QWKA 2ZC1A 1TZ9A 1VD6A 1XUZA 4JR5A 4XZWA 1JYNA 3P81A 3CHFA 1QK2A 4DO5A 4I9TA 4OVXA 4QLLA 1GOMA 3FKKA 3L7RA 1UBPC 1GQIA 2F2HA 4AD5A 3F1QA 2NUYA 2QYGA 3NOYA 5D2WA 5CZTA 2UY5A 2QJJA 1ZTVA 5E70A 4OFCA 5GNYA 2BASA 1GVEA 4R27A 1FWAC 3W1QA 6REQB 3HTWA 8TIMA 3IIVA 1G1YA 3G1DA 2WQDA 1Q6GA 4XD6A 3M0ZA 2BOGX 4LBRA 4DNMA 2C3ZA 2FPVA 4NIRA 4Z1CA 3CL8A 4HNTA 1EFZA 5AKQA 2DZAA 3IIZA 1Q4NX 1IXNA 1W3NA 5CG0A 1LLZA 4H9XA 1ZHAA 4LX4A 3BSGA 4HA1A 1GW9A 4W85A 4WR3A 1E40A 3WUBA 1UPPA 4RNIA 1NP0A 2H6RA 5CZJA 1LYXA 1M53A 4L1GA 3THCA 4C6EA 1S1RA 3B8IA 1SFSA 3W76A 4GGHA 3W82A 2VEGA 3E0WA 1KFKA 3DXIA 1IGSA 2ZQ0A 5I77A 4L61A 3PTQA 1EGVA 1PEZA 4YLWA 3CIXA 3HPFA 3W7GA 1V0NA 3LLFA 1YNPA 4ZODA 2BHUA 2WM0A 4N9EA 1R46A 5HUOA 3OIXA 4GX8A 1XD1A 5HNUA 1A5CA 4RK8A 4H04A 3H2MA 4QSFA 3MU7A 1JD7A 1M7JA 2CPUA 4GMEA 2NUWA 1MDRA 4HU8A 5I00A 5LIUX 3HB9A 1KM6A 5IFPA 4LAMA 4ORIA 4NJGA 4CVWA 4N4PA 4O18A 4Z08A 3HG2A 4V33A 1JDEA 4EACA 3N2MA 3WK3A 2BSLA 3URQA 4B5XA 1MZHA 4JL2A 3PZ9A 1KW1A 1PIFA 2PDBA 2G8ZA 5D9NA 4AUBA 3ICJA 3AYTA 4GIRA 1UWSA 1U2YA 2TPSA 2OYKA 3BG9A 3RM8A 3DDMA 5A3HA 3BURA 1W5MA 2HMCA 3O07A 3S1VA 3VAVA 2R9RA 3H23A 1XDMA 3RPMA 1TV7A 4QEEA 1BEUA 3R5EA 3CH0A 3ZQ9A 3IEBA 1WZLA 2IPFA 2V69A 1IEWA 4BKNA 3PG8A 3ZYZA 3HGRA 3NM1A 4LEFA 3V7PA 5I06A 4NSBA 2I57A 4RV3A 2CETA 2EG8A 3EDKA 3W53A 3OLIA 4GH1A 4H7VA 4GY0A 2C14A 3IJ8A 1CGWA 3MP5A 4LUYA 3SFKA 3EOLA 5H2ZA 3KXQA 5E0KA 2J79A 2PTDA 4JTLA 3CUXA 3W3OA 1PX4A 4OV4A 4XWUA 2XVPA 2R94A 1WZAA 2W62A 1SZGA 3DHFA 3LBCA 1J6OA 4GYPA 1TZZA 2WC3A 1PBGA 3QZAA 4E2DA 4KEZA 3QGKC 3K4WA 3OP2A 4QBXA 1GNXA 1UA3A 4PRRA 3KOWA 1WKEA 3CMGA 3I10A 5PTDA 1IWPA 3POCA 4U28A 7REQA 2VFHA 1CEOA 4EPDC 5I07A 1DVJA 1CPUA 2FTPA 1HNYA 4NT0A 1W1TA 4JTCA 1O1ZA 3A47A 3GDRA 3HFTA 5F4WA 2W6RA 3CS2A 1F2JA 1HTIA 4WXYA 3UPMA 3TFXA 1LG2A 4KMQA 3SGUA 3R2GA 4RDVA 1BF2A 1HKVA 3L68A 1F05A 1JAEA 1W1A1 2GJRA 2OZ3A 4HYRA 3S2NA 4I5XA 1KGWA 4DZ5A 4KWSA 3RN6A 4JGDA 2Y2WA 4XZHA 4U10A 4A21A 2SFPA 4AC7C 4NZ3A 4FPSA 3VO0A 4NHVA 3DFQA 4DF1A 3I6EA 3CBWA 4G56A 1E56A 4DZAA 3FA5A 4GO8A 3AS1A 2NQ5A 3NNTA 3WFLA 4YTTA 4HZ7A 2O55A 3AMGA 2Z2BA 1QVBA 4GNJA 2QUMA 3D5HA 3INPA 1LLOA 5D8ZA 2DW6A 2XVGA 4ATDA 1DJNA 4XX6A 2PDWA 4LYPA 4DUWA 1Q6FA 3MHFA 5FEXA 1UR9A 1HKKA 3NA8A 1V79A 1RLDA 4RNHA 4M19A 2PC4A 1XWYA 2VL4A 4P8XA 3AALA 4I5RA 4QDMA 1SZFA 3LA4A 4KERA 2CERA 1Q6EA 2WJDA 1YX1A 2VEMA 3CU2A 3RLGA 2XGBA 2NVCA 3LLXA 2J7CA 4DBWA 5CAKA 2Y7EA 3GH4A 2G3IA 1Q85A 4Y9OA 4AD2A 1FDZA 3ES8A 3GVWA 4DN1A 3DOPA 3OTRA 4YVVA 2OYMA 3VIOA 5TF0A 4WOQA 3UZ5A 4DJDA 4J7RA 4KS0A 3UT0A 4O13A 5DMNA 3MVIA 3AIVA 2FZMA 3B97A 2WVUA 4UTWC 4E2VA 1CWYA 4PUWA 1QO2A 4Z0SA 1UP2A 4IOTA 5D37A 4OHQA 2XWDA 5IHSA 2WSRA 1P0NA 3GD6A 4Y7EA 4M7SA 4RNJA 3LS9A 4V1XA 1K77A 1C7SA 1RCOB 1K9DA 1XJBA 3LCWA 1PDYA 3S9ZA 1EP2A 3GTNA 5A8MA 4AVOA 1HF6A 5CCZA 1PKYA 2V68A 3BXWA 2O9RA 4ZE5A 2WO5A 3KWXA 2NVDA 3KDNA 4WSKA 2WZMA 3ZVHA 1XM3A 3W01A 4TUFA 1JRCA 2WNWA 4ROPA 1E51A 5C9WA 2FZ9A 1Y7VA 2NT1A 1WUFA 1F74A 5IDIA 3BLOA 2ZUMA 4DUOA 1RD5A 2HXTA 3CZEA 4L6DA 1WPCA 4ENLA 3CB3A 4QQ3A 5HQMA 1PXGA 4XZLX 1GOIA 4DUXA 4K37A 3VINA 1U1UA 3I7SA 3CV7A 5G2WA 4X3ZA 2ZZ3A 5HPOA 2GK1B 1DIKA 1B2YA 4M7TA 5BROA 3EXSA 1F5ZA 3CWHA 2BTMA 2BB0A 4PMZA 3W75A 1UC5A 4JIIX 3WDQA 4GI9A 2GSHA 1TO3A 3GK0A 2RGMA 3VE9A 1TJRA 3BLKA 3MCNA 4IJBA 2VZSA 3B9EA 4Q7IA 1IEIA 4IX2A 5K4XA 2GUUA 3RX4A 3TROA 2XJ7A 3BAWA 1C92A 1E4MM 1PYFA 1GQNA 3VOGA 2WMIB 1G7VA 1LQ0A 4GCAA 2OMAA 5FL1A 2FMOA 1OEPA 4RCXA 5G4EA 1BLIA 2NUXA 5TD4A 3UQNA 2QDGA 4HSNA 3FN9A 3RPDA 1PCWA 3RM9A 2NLYA 4H6EA 3GBEA 3CV2A 4LNCA 3CC1A 3SJ3A 3OU8A 1IF2A 4PL2A 1E73M 3KS6A 3A13A 4EVZA 3NO1A 3KX6A 3L4ZA 1VFTA 5AC8A 2E7FA 3LV6A 4HNVA 5D9OA 3CAVA 2C7FA 5GJNA 3WLIA 3L4XA 3P5YA 4HMCA 3HPAA 4Q8QA 4RPPA 5CPOA 1RLCL 4FIQA 2WWDA 4W87A 1M7OA 5E0FA 5AHEA 1ICQA 5JU6A 1VZWA 5E6ZA 3S4TA 5HJYA 1VEPA 1QDSA 3CQHA 2GGGA 1LWIA 3WLTA 4QG8A 3P74A 3AZSA 4MKVA 4MY1A 3TMQA 1VEOA 3N13A 1WDDA 3UWYA 3VCNA 3EBVA 3U0HA 1B9BA 1GT8A 1R38A 3LHYA 1L8NA 3VNJA 4AZHA 2VX5A 1YNYA 1DJWA 2E6DA 3IGSA 1R3TA 3BQ6A 1T8QA 2J62A 3VD3A 4MB4A 4PUKA 2PF0A 3HMCA 1BVZA 3WBWA 1G4TA 5I78A 3H12A 3N4AA 1MO0A 3KBMA 2MNRA 3CM4A 1DWHM 3UXIA 3F7JA 4I3GA 3E2QA 3K8MA 4S3EA 1A0EA 5CPMA 3HF3A 1QU4A 4D71A 3SEPA 3B04A 1XKYA 3W02A 5FJJA 4ML4A 3G1XA 2G97A 2OKOA 3TYAA 2FFIA 3T9PA 3QLLA 3OHMB 4G1KA 3A9BA 4CLMA 4C91A 1L6SA 4EXBA 4RL3A 1JGIA 2QNEA 2Z25A 5EY5A 3A5FA 1AD4A 3A6OA 2D2JA 2PPGA 4YYCA 2BY1A 1VFUA 1MXSA 4GQRA 1A50A 3W7CA 4C6NA 3WF0A 3ZWTA 1HJSA 1ITXA 3TSMA 4CNTA 3O2LA 5HR7A 1EIXA 2O7SA 5C8BB 2YFOA 2YCIX 3FDGA 3WUGA 1IT7A 3W70A 4XG1A 1TPVA 1P7TB 1A5KC 3UR2A 4F0SA 1S2WA 5HULA 1LDCA 1FRBA 2TMDA 3HU7A 5HWJA 1MSSA 5FL0A 4JL1A 3PFMA 2ZDRA 3TWAA 3SQSA 1QOPA 1GOOA 1XH1A 3H2NA 5JVLA 4QISA 4MFDA 3WQOA 1H0IA 4FX8A 4ES4A 4CU7A 3EMCA 3M46A 1JF5A 2V2HA 3TONA 3K1GA 1MQRA 5LKYA 3QYQA 3TNBA 1BRLA 4Q8UA 5GQBA 1RK5A 3GTXA 4DAFA 1R9ZA 4DZIA 1ZZMA 3WD2A 4HNLA 3DECA 3R94A 3NZ1A 1DWJM 1WZMA 1JXJA 3CXOA 1LCOA 5D2TA 1V51A 5E93A 1XLAA 3APTA 4JYFA 5AB3A 4AX7A 3ARSA 3KDOA 1SW0A 3C6CA 5I03A 1B54A 2IQDA 1S3TC 3B40A 1ZBVA 1JYVA 2E1WA 3M0YA 3GXFA 4A6GA 1OT2A 1A49A 3IGXA 1YDNA 5JH1A 1Q3NA 3NIYA 3IK2A 4BI7A 4AXNA 1YPFA 4E5TA 5DXXA 2OOGA 1L6WA 1I60A 3K5XA 3W7RA 2VZTA 2PWDA 2YL5A 2CHOA 3WLJA 1HL2A 1IYXA 2ISDA 1X6NA 4OBRA 4MNMA 4M6VA 4POCA 1EZ2A 1FWHC 1V3LA 2OB3A 2JQXA 3SUVA 2DH2A 1BXCA 2BXVA 2ZDSA 3H53A 2F2KA 4QX4A 2E0PA 4IMFA 4O10A 4WDXA 1OC6A 2PRHA 4KFPA 5LIWX 1B3XA 5FF4A 1GYMA 2P53A 3BK0A 1H61A 2J9YA 3LN3A 2GOKA 4IGMA 2G4JA 3DEQA 1TQXA 3GR4A 3AQUA 4Z42C 2UZ9A 1HKWA 4C6QA 3GAKA 1E43A 1GPWA 1MDLA 4K7VA 4AZBA 1EOKA 2V5JA 2XVKA 3OEXA 4C6OA 3B8WA 3L9CA 3M16A 3ARPA 2XTKA 4D6JA 3QKZA 3HG5A 4J4KA 2Q02A 4PGLA 1XINA 3T78A 3E2VA 5C9RA 1E9IA 1N2VA 3NL5A 1K02A 3WYZA 1FDYA 4Q22A 1PX3A 3FYYA 5LNRA 3G0XA 3PZUA 3NDYA 3CZJA 3DX5A 2V9DA 1OYBA 4YCPA 5KINA 3Q37A 4DXVA 4GIYA 3DG6A 4KWVA 1V6XA 1KKRA 4QRNA 2IUZA 1X1OA 2ATMA 3HQOA 3QKEA 2WHJA 1FXPA 3QMRA 1XLHA 2DUAA 3R8RA 2GJPA 2ZRXA 4WY0F 1OVDA 3BVJA 4L9XA 3CTLA 3EWWA 2V3EA 2CZEA 4AYSA 3PTKA 4RE0A 5AC5A 4LYRA 2JBMA 2CEQA 3BW2A 3MTWA 1AZ2A 4IMAA 1JUEA 2Z4GA 3H7RA 4L65A 1TRIA 3OYXA 5JBEA 4AW7A 3CL7A 3HQPA 2X1RA 3HJEA 2CHNA 1FWRA 2PDMA 4HA4A 3JVAA 1GJWA 5C0QA 1OFBA 1TQJA 4QNWA 3VDCA 3VUSA 1UJPA 4GQBA 4LCQA 4QCFA 4FNUA 2IXUA 4LS2A 1JUBA 3AROA 2YLLA 2BOEX 1DHPA 4DY1A 1VYSX 1A53A 2QCLA 1LL4A 1FQ0A 3E6EA 3GG7A 4MWAE 5HQLA 3LTPA 3BLFA 3IVUA 4GD0A 2POTA 4LBSA 3RX3A 2PURA 4CQCA 5M5DA 5KEZA 2QZRA 2XU2A 2OZ8A 4WSJA 2VTFA 1W9PA 2AL1A 2Q8XA 2I1OA 1A5NC 2TODA 3PWGA 1QW8A 3QTGA 1WXZA 4NAEB 4NQ1A 4Z1AA 4WIWA 4BQ4A 1UR4A 3C56A 3CQIA 1DIEA 4JN6A 4GXWA 4PMUA 3PSWA 3G5EA 1E4NA 4KRTA 1OX5A 5GJMA 3ITXA 3U48A 3NDZA 1PUDA 5CBJA 3EMQA 1TJ1A 2QKFA 2OXNA 3PHAA 2E6YA 3GRIA 3NSMA 3M64A 4N2YA 4CEXC 4GGBA 3T09A 3H2AA 2RUSA 2J7GA 1P0BA 4RXGA 3P61A 1BVWA 1SW7A 5A6KA 3OA3A 4C6DA 3C3NA 3GTFA 3KRBA 3SN4A 4HA3A 4L9YA 4C6PA 5F2GA 2G95A 1XCWA 1AH3A 4OT7A 1EX1A 2FMNA 3SY5A 1AQFA 4O14A 2CBUA 4KETA 1KO0A 3R89A 1UR1A 1VJIA 2WM1A 1JXKA 1TMLA 4GVIA 4C7FA 4M56A 5A6AA 1CNVA 2BS9A 4HPJA 3ZSSA 2HVOA 2W5FA 3HPSA 2HRWA 4E8GA 1DJZA 2YXGA 2PWUA 1VPYA 4J40A 5H8UA 1W1ZA 1FXQA 3OHIA 4ERGA 1JPDX 3GO2A 3N34A 1W5PA 3DBPA 5LSMA 3N9KA 4NZCA 4EXQA 2Q8LA 1AK5A 5DANA 3K8KA 1IEQA 1Q65A 1OFOA 2I5IA 3W37A 4XZIA 1FWWA 1E6QM 1WNOA 2NSXA 3W6LA 2VELA 3WDHA 2XZ7A 3TJIA 3UWEA 3OJGA 5CC6A 2ALRA 1SJDA 5HUPA 2WCAA 1XBYA 4O1AA 2KX9A 1XIGA 3WLKX 1YTDA 4DXXA 2W27A 3VFLA 1TKKA 4Y90A 1VYPX 2PU0A 3U2OA 2PWHA 2UY3A 1GQJA 4LSBA 2Z24A 2G4FA 3AYSA 1LBMA 3WELA 3U9IA 2EKCA 3W1UA 2FH8A 2AQWA 1SUXA 4YHGA 1CXFA 4F40A 3W7EA 5LNWA 2EEXA 3A64A 4LRSA 1W17A 1YDVA 3EX4A 3VOJA 4QLKA 1MEWA 4WKAA 4IQLA 3M5VA 3UF9A 2QVHA 1D3HA 4ATLA 1B31A 2EPMX 4WDUA 1C3FA 2DT1A 2PTZA 2J66A 4PB3A 3SCRA 1OQFA 4GACA 2CFFA 3MBFA 1W6TA 2WHLA 3BAKA 2ZZ2A 4PSRA 3MSRA 4NAEA 3GXIA 1WXYA 2PGEA 1GVQA 3UWVA 4GKTA 3Q2DA 4LV9A 2FHBA 1W8SA 1OINA 1VS1A 2C19A 1WDRA 1FWSA 1UKPA 3PTDA 1JCXA 2WVSA 4XAZA 2WK2A 1ZJIA 2E8ZA 5CC3A 1ECEA 3BCFA 4K36A 5IDZA 5AHLA 1OC7A 5A69A 2VUYA 3W4RA 3HFYA 1YDOA 3MYOA 3ZFHA 3AS0A 4H4IA 3C0QA 4KWOA 4B15A 4K8EA 1DTUA 2E5CA 1XIFA 1IT8A 1P4CA 1ZBWA 4P8UA 3EA2A 1E0TA 3QJAA 3W7HA 4RPQA 5M3WA 4ZMGA 5BXPA 1IZJA 3WLSA 3NR0A 4W8AA 3GDLA 2DW7A 2R91A 3WD0A 2OELA 4B4HA 3SDOA 4TMBA 4YXGA 5L9FA 4WY0B 1YRRA 3S6DA 4PBGA 3VDAA 4CN4A 3NQMA 2WCGA 1IHIA 2W61A 3MQTA 3LCLA 1H5YA 1EJUC 1UA7A 5M17A 4GNKB 3HG3A 3OB8A 3ZR4A 4MM1A 2YSWA 2ZRWA 4REQA 2G37A 1JDDA 1K8CA 4O15A 2AQOA 3CAQA 1LQAA 3M47A 3OVQA 1FHDA 4UCFA 4NRSA 3MHGA 4H01A 5DRIA 4F0KA 3TLLA 1NAL1 4Q4PA 3SCWA 1UJQA 4H9TA 2FB2A 1KV5A 1UG6A 3NCOA 1UWQA 2P8CA 1RPXA 4ICNA 3ZJ7A 2HEJA 2F9RA 3HOJA 3HPXA 4QIUA 3H26A 4MG4A 4Y2WA 2PWFA 3C4UA 2GVGA 4DWSB 1F6KA 5IM51 3UNDA 1GJUA 2IXVA 1S5TA 3B8TA 1X1NA 4D8LA 3MPGA 3W7DA 1W37A 2VD8A 4OE7A 3TQVA 4PR4A 3KL3A 4YTUA 4B3LA 4JTUA 3TTSA 4HCHA 3CZKA 4FXJA 5BU6A 5CSRA 2HTMA 1W9XA 4MADA 1PSCA 1Q6DA 4FNSA 3DN5A 3CYJA 2VCBA 4RX0A 2DIKA 1R2SA 3QV9A 2VC5A 4FB7A 4LNYA 1V6WA 4I7UA 1V7AA 5FCZA 1XIJA 3DH7A 4AMCA 4REQB 1GPFA 1JFHA 4UTTA 3SB0A 1MW3A 1OF8A 4NX0A 4AVNA 1ZLPA 4PUUA 4LF2A 5AC6A 1ODUA 1SFTA 2D23A 4GUFA 3PWIA 4J2PA 1E5JA 3AJ7A 4XZ9A 3Q65A 2D73A 4IQJA 1I0BA 3VGEA 3AXXA 3PG9A 3LXAA 2I7GA 2RGLA 3IAPA 4O0ZA 3L5AA 1J18A 5HANA 5FKYA 1FHUA 3GW0A 2OZTA 3EKGA 1CXIA 4PMQA 1NSJA 4IP5A 4Y8EA 2PDFA 2WB5A 5EPDA 4C1LA 3OVPA 1I2NA 5EMYA 1IWAA 3Q67A 2R1KA 3T0AA 3UEQA 5D33A 1JR1A 3NQAA 6TIMA 4Q4OA 3LXBA 3USBA 2NQHA 1W0MA 4DWSD 2Y8VA 2Q01A 3N6JA 3C86A 2JIEA 1A3XA 2E4TA 3HG4A 4RZ4A 2O7QA 1V77A 3LHVA 3T07A 3U57A 3B8UA 1CLVA 4RDZA 1UH3A 1XQKA 4JTJA 1POJA 1ME8A 4V27A 4O1FA 2DT2A 1W56A 3WFZA 4J3TA 4C1NB 5GPRA 2QIWA 3THAA 2VWTA 4YWIA 3UW6A 1V5XA 3W1NA 3PB2A 4AZ5A 2OCZA 1ICSA 4S2BA 1U5VA 4F0RA 1G4EA 4HOXA 1OCNA 3VABA 3W1XA 4MWAB 1Q6LA 3G1FA 3DKLA 4KGJA 1KBIA 4Q8PA 1W9UA 2QHAA 4E4PA 1MFUA 4IIBA 4I9AA 1GONA 1NOUA 3NQ7A 1VLIA 3PUGA 5T9BG 1SMDA 1NF7A 1FWNA 1VFMA 4CEUC 5LGXA 5KSWA 3SN0A 2G0WA 3UG4A 4O19A 3AISA 3F4WA 3C0SA 4JDBA 3OA5A 1OFDA 3CV6A 3T55A 1NM9A 2VMFA 2KAUC 3CO4A 1U83A 4S3AA 1L6GA 2DJLA 4O1CA 3TTEA 3PWAA 4TX8A 2DVTA 1EO5A 2X2YA 1B4EA 4HN8A 4JAWA 3O8AA 2BZNA 3DFHA 4XKYB 1WXJA 4FXRA 1CW2A 4H7ZA 5ABGA 2YZRA 1JF6A 4P5UA 4IIHA 5DBUA 2VC9A 4IHCA 7A3HA 3PC0A 6TAAA 2Z27A 3B0VC 4NRRA 4AIEA 5HOSA 1HP4A 3R6IA 2VOMA 4H9UA 3IUHA 3KOXA 2Z1SA 3RCMA 4US6A 4R7OA 1LL7A 2DP3A 2NVAA 4WD0A 4C6BA 4C90A 4IFKA 5TAOA 2A3AA 3S0CA 5BOOA 2PWEA 3B8SA 3S3GA 4ALDA 2E25A 3E1F1 2D2HA 4A35A 4ZBCA 3WJSA 1KFLA 1GK8A 4PTNA 3BCJA 1I2RA 1RBAA 2NXIA 5G4WA 1N7KA 1P6WA 4X0NA 3NGJA 5CJNA 2GUYA 4WLCA 1BAGA 1X6LA 2XIIA 3LGDA 4AQLA 4V15A 5IBXC 5FJOA 1F4AA 2CW6A 5D30A 1OX4B 4UR8A 4DLMA 8XIAA 3VIPA 3A4XA 1KGXA 4IH3A 5BXRA 1XCFA 3ZT6A 1VIWA 5EMKA 1H09A 1KM4A 1EUAA 1XP3A 5J04A 3SSJA 5CGQA 5AHNA 4GZ7A 1T7LA 4E3VA 4LVFA 2HSAA 1BXBA 1TVLA 4BA0A 3GTHA 4JFUA 1CGVA 5LA0A 2B7NA 3EX6A 5U4NA 1ME7A 2BHYA 3VZXA 1GQKA 2CU0A 1GG1A 1B3VA 2R6OA 1LUCB 4UFLA 3RM4A 1UOKA 5EFFA 4U2YA 3HGJA 3GIPA 5KETA 2QQ6A 3HV8A 4HQVA 3OVRA 5DCEA 1JIBA 1BYDA 4GISA 5J5DA 2J88A 3K4AA 2GOUA 1E72M 4CQDA 4NG3A 1HFBA 3WN6A 1KRCC 2XFRA 3P3BA 3EA1A 4JTIA 4H9VA 3BW3A 3PJTA 3F2DA 1EJVC 1QUMA 1ZCCA 4DF2A 5G2IA 3BL3A 3BAYA 1K9EA 4EWND 5HNTA 5FAGA 3MMUA 2ATSA 1QBBA 2X1TA 1Q6RA 2J7EA 3A3XA 5LIXX 1H0GA 4YTRA 1SO6A 1E1CA 2EPKX 2H9AA 3GVRA 1EH9A 3N11A 1HT6A 2RJGA 1KGUA 4AZ7A 2GGJA 4G6CA 5CQ1A 5HPCA 1UZDA 3RDKA 3GKAA 4JDYA 3P7YA 3EB2A 3ERPA 4XO6A 4YYFA 2VGIA 1EEPA 3C52A 3CUZA 4ERIA 3CHVA 4NAFA 1OFPA 5HATA 3A9IA 3ARVA 3H54A 2R82A 2BVYA 4FNPA 3ZVHB 2QCFA 2VGFA 5D02A 3LYEA 4H8UA 2GWGA 2B0MA 3UVAA 3LI0A 1GUVA 1GORA 2UY4A 3QR3A 4I8YA 1QASA 1CENA 1XSIA 2J74A 1GEHA 4H83A 1ZCOA 4LUIA 2DZSA 4E2BA 4GPNA 3MUY1 3GH7A 4GO9A 1DL3A 4DJFD 3R7MA 1WKFA 4P7LA 5BRPA 1XLBA 1DOSA 3DHUA 1VKFA 3VNZA 3S9IA 2ZUWA 3G22A 4J3XA 1UD2A 4PMVA 3G8RA 5G4HC 1HO1A 2OLSA 2WV8A 5C5YA 4WZHA 3U5YA 4UOQA 5FI8A 3GS6A 3NO3A 4UFJA 4LB4A 1P0KA 5ECUA 3TSBA 2I56A 3SY8A 1VHNA 1TWWA 1F6PA 3PSVA 3M6DA 4QS5A 4B5TA 3HQ1A 5AZ0A 1UUQA 3G77A 4NVTA 4H2CA 4PMYA 8CGTA 1OX4A 1Q7QA 1TA3B 3ES7A 5FSDC 2ZRUA 3HO8A 4IL2A 5C55A 3MJMA 3O0FA 4GUHA 1PPIA 3TQKA 2Y88A 3DESA 4A3QA 1VFLA 2AKMA 1XGEA 3RYSA 1I2PA 1ZP3A 1DE5A 3E5BA 3LMYA 1WO2A 1JRBA 2DQXA 2FHFA 3W26A 4GY7A 5DCBA 3UBPC 5REQB 5JBFA 3BICA 5CPQA 4ZQOA 3WNOA 5D05A 4ZEPA 3RJYA 2OWWA 1ZUAX 1LJYA 5FACA 4CCCA 3AXKA 3CNYA 2HV5A 3GFXA 4QJ5B 3NQCA 3PPCA 1J0ZA 4A3HA 3KTSA 3STPA 4A3RA 4DVOA 2FPYA 2AOSA 4K8GA 2HBXA 2E09A 1ADOA 1DBTA 4KFNA 3WJZA 4TTUA 1J2WA 2VM8A 1UD5A 3HM7A 1SZEA 3VC5A 5AYXA 3LCHA 1OM0A 2BHZA 3R0UA 4S39A 3EEZA 4HVXA 5HQEA 3WQGA 1ISZA 3JR2A 3GIQA 1ZJAA 3G0SA 1RY8A 3GG1A 4HYVA 2Q09A 1M3UA 1TV4A 4O52A 1MW0A 2O92A 4TVUA 1JZ5A 3DENA 1JDAA 3ELFA 4O1EA 2H90A 4JQ1A 4M1BA 2QCCA 3T0CA 1KA9F 1TUFA 1JPIA 4AH7A 2QCEA 4C6FA 4YS1A 4WCJA 3UZWA 2EAWA 1IV8A 4DBSA 1AH0A 1DWFM 1RHCA 1XIHA 3EWZA 1MNSA 4MTVA 1FUYA 4EX4A 5KITA 2J8FA 5FJTA 3EWCA 3UR5A 1U5JA 5FJRA 3LLDA 1UZHA 4KRUA 5G1TA 3G24A 1RD6A 4UNKA 1O5KA 4HJWA 4O1BA 3EXTA 1PX8A 4MFEA 3WH9A 1IXQA 2HQAA 4MYAA 3M0KA 1PKMA 3RPTA 4FLOA 4JIHA 1XV8A 2HXUA 4BK9A 3AWOA 1B3WA 4L5ZA 3ZZ1A 3V1HA 3T4CA 3BAIA 2VT0A 3ARTA 1VFHA 2HS6A 2VFFA 1XLDA 1HVQA 3DCPA 4OZOA 3GB6A 2QS8A 2YPIA 1Z48A 2B7PA 1JGMA 3ENLA 3AU2A 3N04A 4BF7A 3WY1A 4DI9A 5EU9A 1XRFA 4NP7A 1K6AA 2ACSA 1H60A 4MHBA 3SIMA 1N8IA 2D2GA 1WB0A 2E8YA 2CXEA 3UGVA 4ILSA 1BTCA 3SN1A 3H4XA 1GZJA 1DWIM 4HPNA 3RFAA 1HVXA 2ZX9A 2G3FA 1RH9A 3WNNA 2BV9A 1R30A 3LI1A 2RJHA 3TK7A 3T7VA 1QI5A 3UCCA 1RCXB 2V0TA 4MB3A 2ZVRA 3VX1A 3VIGA 1KWKA 3GU1A 2CCRA 4O17A 5FF7A 3M43A 1QJWA 2VR2A 2C8NA 3ZM8A 5LIYX 3CIVA 3QFWA 5CH9A 3MS8A 4RLIA 2A85A 4JX4A 5M2FX 4XISA 3BWWA 1J10A 3I3EA 4FEZA 5CLTA 2XFFA 3KUMA 1O5XA 4GVHA 1H62A 3LRKA 1PTAA 1JZ3A 3EYPA 5E5CA 3GUGA 4HOZA 4KCVA 2KZHA 2J6XA 3W85A 1TV2A 2UBPC 2WMKA 3NSXA 4E6MA 1BGAA 4TX9A 1D8WA 3GHUA 5D09A 1UWRA 2HE8A 4PSPA 1M6JA 4W9TA 3A5VA 4DWSA 2OOFA 1HJXA 2H3BA 2YDAA 3ABOA 4LU0A 2A2IA 3S1WA 1WBJA 4J5NA 1KTNA 1MMFA 1P0DA 3N3TA 2X30A 4MWAA 3G1RA 4YWSA 4BEQA 1W1YA 5F1VA 3TP4A 3FYPA 1IZCA 2RDTA 3WMSA 1KQZA 1W1PA 3IJ7A 2G96A 1M7PA 4MDPA 3T2QA 3UWWA 3VD9A 3U6WA 3BGJA 1NFPA 3IACA 1ZSXA 1OGSA 3OBKA 4C65A 3AHZA 3AIEA 4JD4A 1R3SA 5JBDA 3NUKA 3DYMA 4C60A 3QHMA 4IP4A 1L2UA 3HMJG 4FP1A 4MZ1A 3VNMA 4W7VA 2YCEA 4O16A 3H6OA 1QNVA 3E12A 3WDJA 3CPGA 3TN4A 3NL2A 1R87A 1XC6A 1A0CA 2DSWA 1XF0A 5E6YA 1UROA 1KTCA 4IMCA 3ALFA 2YL9A 1Q6QA 1G4SA 2ZFAA 1XH0A 1A5OC 1I2QA 4PUDA 2HVMA 3M5ZA 2OJPA 3NVDA 4BFAA 3VXGA 1W3JA 4UC5A 4AC1X 1E55A 2XN2A 2YXXA 3WDIA 1Y8BA 1WBHA 4KIRA 1GHRA 1HG3A 4K68A 2D3LA 3BZGA 1VFSA 3QW4B 3MCMA 1QI2A 3B4UA 1U5HA 4LY4A 4GZEA 1QK0A 3GC2A 4AY1A 1S2TA 2XIOA 3NURA 1V6YA 4Y6GA 4Q4MA 2INEA 4JOMA 2E67A 1XXXA 2Z00A 4YPJA 1A3WA 4UB9A 4CN6A 3SCQA 1ZENA 1AG1O 3ZJ8A 2Q6ZA 4YCOA 1E15A 3C61A 5G2HA 1UR8A 3CHCA 4AB4A 1EYWA 2D1ZA 1IIGA 4FMVA 1SO3A 4MLJA 3HA1A 3RNDA 1A5LC 3TJ4A 1HJUA 1P6CA 1XG3A 3ONBA 3PUOA 4D6FA 1XSKA 1KLZA 4IG2A 2YR1A 4WQ6A 2PDQA 3ONCA 2VXNA 4Q8WA 2VFIA 1UZ4A 2BNJA 4O50A 3PJUA 1PVNA 1UC4A 4J3VA 3QFEA 5ECVA 5AYZA 3TMLA 1EQPA 1GVIA 4ZO8A 2CIPA 2GVLA 3W83A 3ZR6A 1UQYA 2PLCA 4ZE4A 5I3FA 1E9YB 1G4PA 2B7QA 2ZUNA 5ENLA 3NAVA 1LBFA 1MVYA 1VEMA 4QDWA 3U2EA 3TAOA 3LXCA 2VURA 2PGRA 4HCLA 3HBLA 3WQWA 1ITUA 1OABA 3FA3A 5I24A 4F0HA 3WQVA 5D32A 3W22A 4LAOA 1LG1A 4F3HA 4YVXA 4FNRA 1CX9A 2YBUA 2DUXA 1CI1A 2PZNA 1TPWA 3UA3A 2VFEA 4W7UA 4OIFA 3FYOA 3WUEA 3R25A 1MXDA 4UTKA 2GVYA 3ZT5A 1HKMA 4Z1YA 1NWTA 4EPBC 1KXQA 3UG5A 3UZXA 4GFIA 4MB1A 4MVAA 1MZRA 2A7NA 3CHDA 2D3NA 4IT1A 3T0DA 3EOSA 4YHEA 2WZHA 2W79A 4X63A 5FAJA 1F7BA 1QPRA 3P80A 1PKLA 3Q4DA 1EJTC 3CUFA 4DEFA 4H9YA 4G2DA 1KBJA 3OQ8A 3FK4A 3KOYA 1GVYA 2GJLA 3BC9A 1A4LA 1X7IA 4HP5A 3ARXA 3EWBX 2ZX8A 1TPFA 3MT1A 3C3UA 1H1NA 1E70M 2Q71A 1OF6A 3KBWA 1GEQA 4F66A 3VIIA 4KCUA 1G6CA 3MV11 3EPMA 1V4YA 1JVNA 1FHLA 2Y7FA 2JF7A 1XLFA 5BZAA 1W3LA 3ITLA 1UD8A 1MW1A 2CLMA 4WK9A 1H4PA 3JS3A 3HURA 3EXRA 4H9MA 2X41A 4CVUA 2VVNA 2VC7A 2X05A 4UZSA 3NL3A 5DT7A 2P1FA 3NZQA 1PHWA 3EB3A 4PYSA 4ZQNA 1UHVA 1QI4A 4IMEA 4JQ2A 3N4EA 4UFKA 2OGYA 3YPIA 2Q3RA 2J27A 4GZIA 3TA6A 4TOQA 3MUIA 2PBGA 3RRXA 2EO7A 1XLMA 3DU0A 3VKBA 3APYA 1YBQA 1XIIA 1FY6A 2DZUA 1YTEA 4JIEA 4PN2A 3DUGA 5GNXA 1KRAC 4UFMA 4LT9A 3KBVA 3RMEA 1WAWA 3DBNA 3U7BA 4XVDA 1R2TA 1X98A 5EL1A 1DORA 2IS7A 3C2YA 4D2JA 5BWAA 5I23A 3H4GA 3BLDA 3WL0A 3BJFA 3ZXWA 3T2OA 4NYUA 4W93A 3ITVA 5DRCA 3CEPA 4Q6JA 4B91A 4P7NA 3DG3A 1KM0A 1M65A 4EP8C 3LPFA 2R1PA 5DY3A 3EA3A 2Y6ZA 3P0XA 3QF0A 4PMXA 1NWUA 1LP6A 1B5TA 3LNPA 4HPGA 2BXYA 3DYPA 4GX9A 3NQVA 3W27A 4L1WA 1DJXA 3Q45A 1X96A 5JUVA 3GE7A 5FEPA 1NEYA 3TTOA 5ABEA 3W07A 3GVGA 3SZ8A 5CZKA 1ISWA 1XYLA 2PDCA 3KM8A 4KGLA 4DQWA 4XBSA 3O6CA 5CLWA 2HWGA 2Y89A 2PC8A 4FOJA 1UUMA 2E9BA 3S5NA 4JHZA 3WSUA 2X16A 1E3XA 4ZQRA 3PJWA 3WIJA 5A8NA 4GINA 1SSDA 1YHTA 1YKWA 2BDQA 3P2VA 4R34A 1U1JA 3S2JA 1XBXA 3TYEA 3NPXA 2PODA 2X2GA 4AD0A 4PEKA 1ZS2A 3JZEA 5HMEA 3CT2A 4EKJA 3MVTA 3OYZA 1GVRA 1V02E 3RR1A 1P48A 4JTSA 1GVOA 3UETA 3W74A 2GQAA 1ZL1A 2OLAA 3W38A 3LRLA 2XFYA 2JKEA 3A24A 5KZMA 1AODA 3N2CA 3Q58A 2Y5SA 4B3KA 5IOBA 1F8MA 2I5QA 3LG3A 2I16A 4PUEA 1UR3M 4IUOA 3BOFA 3QC0A 5LXXA 4L80A 1AL7A 2VR5A 4F0LA 4AZGA 1RK6A 4UTLA 3SAZA 2IKGA 3FJLA 1VPQA 3OZYA 1Y5XA 3N1AA 4IP7A 2YYUA 3O06A 1RVKA 1BSLA 3T08A 3IJ6A 5HJLA 3DFYA 4C7GA 3G18A 3VNLA 4JFSA 3GG8A 5KTLA 2JIWA 1KXHA 4QXIA 3N2XA 1ITQA 2V5CA 3VNYA 4C6KA 1KTBA 4CCDA 5LA1A 1I9CB 4PZVA 2PDKA 1NQKA 1ISVA 4LANA 2QMKA 4PE8A 3LZ5A 1I8JA 2CC0A 2X8RA 4AWTA 3LZ3A 1I45A 1PZ3A 1H41A 4NASA 2VZVA 3GUWA 3WMBA 3G1AA 4XUGA 4D9PA 4Q8OA 3W2MA 5A6TC 2ZVIA 3ECQA 3PPFA 2ZTKA 3WQ5A 4KWWA 4QJ3B 1W5QA 1OD0A 1KCKA 1OCQA 2J7HA 2WKGA 3UXLA 1Q8AA 2J7FA 4DO6A 4LS0A 2CNCA 2YXOA 5I79A 3BV7A 3SFWA 1WZKA 1ODZA 2Y62A 5K9DA 3CPUA 2Y5JA 3IVSA 4NAFB 1CLKA 7REQB 5B7YA 1L0PA 2GZXA 4JICA 3ZT7A 4BQ5A 4B5VA 3R8GA 4K38A 4UTUA 2HPMA 4ZFCA 1U22A 3W9ZA 3R10A 3W25A 1QPKA 4J2MA 1VFOA 4G1NA 3V0UA 2J78A 1SW3A 4ML9A 2ZX7A 4DM2A 4JTDA 1JULA 3GC4A 3QQ1A 3AIWA 3ABQA 4PMNA 3O15A 1XLEA 4C5YA 9RUBA 3D47A 4ZQMA 2QUTA 1P0EA 2NQLA 3IV3A 1EWEA 1W9DM 2B31A 4KH2A 2WJFA 3WQPA 4WKFA 4HU3A 2IPGA 1CTNA 3WLNA 2DIJA 5A6JA 2VZOA 1TVNA 4WOZA 2PP3A 3KZSA 2H8XA 2Z7KA 1VBUA 4CQAA 1V3JA 2ZA3A 3W6YA 5MF5A 3W2UA 2WCSA 4YVPA 3WMCA 2EKGA 2V82A 7ENLA 2J8TA 3VGFA 4BHYA 4DRSA 4LV4A 1FCBA 3V3WA 2B81A 3N14A 5FF0A 1F61A 4ADSA 4UWMA 3VDGA 2HZGA 5AYBA 4DO7A 1HIZA 4JFWA 2QF8A 3W1RA 1ZBKA 1K8YA 1ZAIA 3H2FA 2ZICA 1OK6A 4CQ8A 3VNDA 1XL9A 4F9JA 3ANYA 1L9WA 2PU1A 1H7WA 3N25A 4JTAA 3VNIA 1NFBA 4Z1DA 3WQDA 2QAFA 3NJ3A 3M7WA 2ZCGA 3XINA 3O3RA 4RDYA 3LD5A 1VJZA 5HAOA 5D04C 5AYIA 4FO4A 1PWLA 2OODA 3M0MA 5H91A 1OCJA 2VUNA 1LBLA 3AMLA 2OWXA 2XIMA 3ARQA 4XKYA 2RKXA 3UJSA 3HZ3A 5GJPA 1AW5A 1PIGA 2F8QA 1TYGA 4ZSUA 3G1SA 3II1A 3ZJKA 1BWKA 3LQLA 3RG6A 5FESA 5D9PA 2YFNA 1OX6A 3VZZA 1E6XM 3N6QA 2ESCA 1FWCC 1TWIA 4RZBA 4NF7A 4WY0A 3S1UA 2XN1A 1X38A 3LOTA 3HJZA 1LLWA 3M6YA 4GRSA 3VZYA 3E49A 1OYAA 5FJIA 4AZ6A 4GYKA 2VZUA 2PD5A 3ISIX 2GDVA 2NZLA 3BGGA 4F0MA 4DJEC 1T5AA 3V4BA 4EF9A 1XHGA 2FDMA 2CLIA 2DVUA 3RO8A 5T91A 1OSEA 2OT0A 2QVNA 2JALA 2FZ8A 3T6CA 2QDDA 4QQUA 3OIHA 4NZ4A 4IPLA 3STFA 4A2SA 1FCQA 3TW6A 4RUBA 2DIEA 1PV8A 1VR6A 3W00A 1UIOA 2EPOA 4JFVA 3SRHA 3LUTA 1SFJA 2XIJA 4W4QA 2OEKA 4AD4A 3T4WA 3IRSA 1UWAA 4FALA 3SRDA 3AHXA 3MUAA 4ZO9A 5BXTA 1FH9A 1M68A 2QR6A 3TC3A 2XH2A 5DX7A 3O9NA 4FOKA 2XINA 1KC7A 4ICMA 1NH6A 3JRKA 1SPQA 4OJYA 3P8IA 2P0IA 1EP1A 3UWZA 4QP0A 4IUGA 4ASTA 1WV2A 2C0HA 3ARUA 3ME3A 4U2ZA 3MJYA 4JS3A 2IQ0A 3QW3A 5F1UA 3H2EA 4P7OA 4R33A 4I90A 1TG7A 2ACQA 3LRMA 4I6KA 4JN7A 3RIKA 2QMJA 3OGRA 2G50A 3A23A 3WG6A 4V1YA 4UFIA 1E4IA 3LCFA 4GXMA 1J5TA 1NJJA 3LB0A 4QDPA 2NWRA 2AMGA 3QC3A 4W5ZA 1TCDA 2A1YA 2Y7GA 3OOQA 1OG6A 3OO2A 3PZQA 1JD9A