1YX1A

Crystal structure of protein of unknown function pa2260 from pseudomonas aeruginosa, possible sugar phosphate isomerase
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
250
structure length
250
Chain Sequence
LHPVSISLSSYGADLVRSRGQASFLPLLAMAGAQRVELREELFAGPPDTEALTAAIQLQGLECVFSSPLELWREDGQLNPELEPTLRRAEACGAGWLKVSLGLLPEQPDLAALGRRLARHGLQLLVENDQTPQGGRIEVLERFFRLAERQQLDLAMTFDIGNWRWQEQAADEAALRLGRYVGYVHCKAVIRNRDGKLVAVPPSAADLQYWQRLLQHFPEGVARAIEYPLQGDDLLSLSRRHIAALARLGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PA2260
publication title X-ray crystal structure of hypothetical protein PA2260 from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Structural genomics, unknown function
total genus 90
structure length 250
sequence length 250
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 1yx1A00
2OU4A 3C0LA 2QULA 4ZBCA 3QC0A 5B7ZA 4ZB5A 4QE4A 4X63A 3UA3A 1QUMA 1XLEA 3BZJA 4US6A 3XINA 4E3VA 2XIMA 1XIGA 2NQJA 3XISA 2GVEA 1DXIA 1TZ9A 4HHLA 4HHMA 3VNLA 4EACA 6XIMA 4W4QA 5AVHA 8XIMA 3OBEA 1MUWA 3QZAA 1XIMA 3TVAA 4PGLA 5EMMA 4XSLA 4ZB0A 3U3HA 2XINA 3KBSA 1XLHA 2ZDSA 2G4JA 1DIEA 1OADA 3P6LA 4G56A 3CWHA 5H1WA 1YX1A 2J6VA 4QDPA 3ITOA 5H6HA 4XIMA 3M0MA 4A8LA 4GQBA 3N4AA 3AAMA 2QW5A 3C0SA 1XLGA 1XYMA 3KBNA 3M0YA 4X61A 1QT1A 2QUMA 3KWSA 3UXIA 4K1GA 3CQIA 1XIFA 5C9ZA 1XIJA 1QTWA 5EMKA 1XLAA 1XYAA 1A0EA 2HK0A 4KW2A 8XIAA 2GUBA 1I60A 2Q02A 3DBNA 9XIMA 1GW9A 3KTCA 4HGXA 2ZVRA 1XYCA 1XLKA 5EMJA 2NQHA 3ITTA 3NGFA 5AVNA 1S5NA 4X60A 4HNOA 1S5MA 3L23A 3M0LA 1XIDA 1XISA 1XLLA 3KBWA 4A8RA 3GNXA 9XIAA 1MNZA 1XIIA 4GJJA 4XSMA 3AYVA 3ITLA 3WQOA 1XP3A 3CQKA 3M0HA 5EMLA 3VNIA 4XIAA 5J8LA 2X7VA 1XLJA 4QEEA 4DVOA 1XICA 2I57A 3VNMA 1DIDA 4DUOA 3DX5A 1D8WA 3IUDA 4YTUA 1XIEA 4QEHA 3M0XA 3QYSA 4YTRA 2G0WA 3ITYA 1XIHA 2GLKA 3UU0A 3VNKA 1XLCA 7XIMA 2I56A 3BZGA 3KBVA 3AALA 4XISA 3IUIA 1I6NA 2HCVA 4EAYA 3QXBA 1DE5A 2HK1A 4QE5A 1BXBA 1XLMA 1XLBA 1XYBA 3CQJA 3ITXA 4GJIA 4LNCA 4YTQA 3KCOA 3ITVA 3FVMA 5XIMA 3XIMA 4QDWA 3KBMA 3BWWA 6XIAA 1XIBA 1CLKA 3LMZA 4QE1A 4Q7IA 3CNYA 4K3ZA 4YTSA 5I7GA 4OVXA 3UVAA 2GYIA 1DE6A 1K77A 3BDKA 1XLDA 5B80A 5FA5A 3C0QA 2QUNA 5TNVA 4A8IA 1A0DA 1XLFA 1BXCA 4J4KA 1XLIA 3KBJA 4XKMA 3P14A 1XYLA 1O1HA 2X7WA 2XISA 3IUHA 5XINA 3VYLA 3KCJA 1XINA 2NQ9A 3TC3A 5XIAA 3U0HA 1A0CA 3M0VA 4PFHA 3BANA 4A8NA 4YTTA 3CQHA 3UA4A 5B7YA 3AYTA 3JU2A 4GLEA 3VNJA 4ZB2A 3KCLA
chains in the Genus database with same CATH superfamily
2AL2B 1XDJA 1W1IE 4AHQA 3BLPX 1G0CA 3LHUA 3N9KA 3CASA 3LBOA 4OQVA 3TR9A 4HOWA 1P5BA 2NQJA 4GFIA 1VAHA 1WXYA 2WLYA 3CEPA 1UKOA 2D3LA 3GNPA 2WZIA 2ZRUA 2E6YA 2SFPA 3VKCA 3W1UA 2ZCGA 1U1UA 3EKLA 1DQXA 3G1HA 4GY7A 3UCDA 5TF0A 2Y24A 4BI5A 3AAMA 1DJZA 1LDCA 1W5OA 5DXYA 1F8MA 3UJ2A 2HK0A 4DO6A 3B9NA 1KQYA 3PWGA 2QAFA 2O9TA 3M0JA 4E2BA 4AXKA 4MYXA 5AB3A 3N11A 5A6TC 3RJYA 1VJSA 4Q3MA 3MSDA 4LY8A 1G7UA 4XAFA 4PMDA 3L68A 5I6SA 5T26A 4LGXA 3R0UA 4D8ZA 4DQWA 4RZ4A 2FZ8A 1XGDA 3W22A 8CGTA 1Q6OA 3COTA 3CUFA 1S2WA 3FDGA 1B3VA 1W9PA 3UZWA 5M3WA 1IIHA 3LX9A 6XIAA 1XIBA 4KWUA 3W7NA 1CECA 3ZLHA 4I7WA 5C8BB 2YCIX 2OMAA 3UZYA 3HFYA 1XWYA 1REQA 1ZJAA 1T99A 1AH4A 2P10A 2RUSA 1ONEA 4UQEA 3VGBA 4MLJA 1JL8A 4F0RA 1FWEC 1W9UA 4TVCA 3P8IA 3MBDA 4N0RA 1OX6A 1AODA 2AMGA 4UTLA 2CLKA 3NQ6A 3DU0A 4W7UA 4GNJA 4L1GA 4GQRA 1SVDA 2OSXA 3CAWA 3CV6A 1TUXA 3TN5A 4S3AA 1W2PA 2BOEX 4DWDA 1AJ0A 3A4XA 3CJPA 3AMGA 2DQXA 4CVUA 1GCYA 2UY3A 1M7JA 2PCEA 2X8RA 3ZO9A 1EJXC 2WCGA 3QW4B 5LNWA 1UR4A 2Y7DA 3BAJA 4ERGA 2AQVA 1Q7QA 5KINA 3R12A 3IV3A 4CKQA 2XFYA 1Q6EA 2XSXA 1RY0A 2ALRA 5BRQA 3TTSA 1BEUA 3ONBA 4BA0A 2ZE0A 3F4CA 1EZWA 3WL0A 1ITQA 2VT0A 4CQ8A 3QSTA 3GR8A 3R94A 4S3DA 3W71A 2E8ZA 1L0PA 2GJNA 2QKFA 1PZ3A 2XISA 1LTDA 4MUPA 3VYLA 1SZRA 4JTKA 4OT7A 1E71M 3ZXWA 4O8AA 1JAEA 2NWSA 3PFRA 1S2UA 1A53A 2Y0FA 1JZ4A 2Y7FA 4J3TA 3WNLA 3EZ4A 3BAYA 1GVSA 1U30A 2PWVA 3EWWA 1OYCA 3UY8A 1B4KA 2ESCA 3CV1A 3MKKA 1TPVA 2VEFA 3OBEA 5I79A 3W1QA 3DC8A 3BC9A 4AX7A 1KV8A 5JVLA 2BB0A 4WJEA 1AA1B 3DOPA 3DAQA 2AAMA 4PMVA 1FP9A 4MB3A 4M0XA 3SUTA 4MTVA 1E0UA 1AJZA 4Y8FA 2YXXA 3ALGA 2YCJA 1KFJA 1R30A 3A3XA 2F2KA 4IP7A 1SU5A 3ZT6A 4IJCA 3BK0A 1V79A 4P7NA 2BXZA 3WLJA 1W9XA 4UFIA 1MNZA 3CZKA 4J3ZA 1VIZA 3MCNA 5FL0A 2WZEA 2G0WA 2GDVA 1GK8A 5FF0A 4LEQA 1KFLA 3K4WA 1LBMA 1VBJA 1B57A 5CC3A 1UMLA 3B9EA 4GJIA 3NPUA 2QCLA 3AWNA 5LSMA 1CLKA 1GVRA 2B4GA 4MOZA 1LQAA 1CLXA 1AQFA 2FLIA 1UCWA 1EX5A 3QY6A 4O17A 3B04A 3UYCA 1QRQA 4DAFA 2AQOA 2W66A 4MPQA 5CJMA 4HZMA 3OIHA 3CWOX 4IH3A 3T08A 1MYRA 4ZQOA 4C6MA 2CCRA 7REQA 3OODA 1TPWA 3LY0A 4H9TA 2VEMA 3OQ8A 1QOPA 4MY8A 2Q8LA 4AG0A 2ZZ3A 3N19B 2C1GA 3QGAC 1V51A 1MUWA 3EOSA 3DYOA 3SY5A 4ACYA 1LF1A 1VQTA 3WBYA 3VIOA 2QUUA 4C91A 5CC6A 3IIOA 1EJTC 1KBJA 4LF1A 5E5CA 3PWAA 1W3JA 2A79A 3G18A 3TN4A 4JQ4A 2VX4A 4KF1A 3A9IA 3BXWA 3VGEA 3WLKX 5D09A 9XIAA 1BWKA 2WK2A 3DHPA 5LIKX 3SGZA 4IFKB 1XV8A 3RK8A 4FNRA 4L4OA 3LPPA 3UU0A 2V3FA 3W38A 2TPSA 1GT8A 3C2EA 4GXWA 3S42A 2HK1A 1NAL1 4WZHA 4C6NA 3VD5A 1GOQA 2R9RA 3PJUA 1NF7A 3KTXA 1D7FA 4C7FA 3EX1A 4AMAA 4CD8A 3H2CA 4H8NA 3KWXA 3GFZA 2PDIA 2V82A 2WNQA 1K8CA 2JFEX 1GVYA 3ARPA 3K1GA 4HBKA 3KEHA 3U4FA 3C2OA 4KEMA 2V6AA 1I2OA 3T9PA 2OXNA 3FXYA 4DZHA 1FWSA 2H3BA 3U4AA 1QDSA 3GNDA 1UPPA 4UR8A 3V0TA 1C8XA 4O52A 3F03K 2DVTA 2O56A 1KXHA 4TTUA 4D9PA 4LXFA 1EHAA 4DRSA 4ZB0A 3EWZA 4L80A 3FYOA 1OADA 4X2RA 3NQAA 5H6HA 4PYSA 3GU2A 2VR4A 1W5PA 3O0KA 4D6FA 3UXIA 3GDBA 4UFJA 5DQPA 2Y62A 4BHYA 3TWAA 1EOKA 2R1NA 1HN1A 1PTGA 2Y2WA 4O1DA 4ILSA 1NFBA 3ARYA 3OA5A 3O16A 3FDKA 4JTCA 1WZMA 3P82A 3M0HA 1EFZA 1VBGA 3VDAA 1YW1A 4RW3A 1LOQA 1H7OA 1DIDA 2J88A 1OINA 3NG3A 4AZCB 1WNOA 4LS0A 3U2OA 1JRCA 3UETA 1UASA 3V1HA 3IUIA 3CUIA 4AH7A 1W9VA 3IGHX 4KFNA 4S23A 3RF9A 3A22A 1AD4A 1QVBA 1L9WA 2H90A 3O06A 1JYXA 3KTSA 1QNVA 4ZSUA 1TMQA 1S5TA 4AMCA 5A8MA 2TAAA 4NRRA 3HURA 3UESA 4YJ5A 2Z00A 1S5WA 4BWLC 4AZ5A 3WJZA 3DBPA 3KRUA 1PAMA 4OBRA 1RP9A 3F4DA 3IJ9A 3GC5A 3W28A 3RUBL 1MQRA 4ZOBA 3E0LA 3GH7A 4GIAA 2XH2A 1PDYA 3G1FA 3TR2A 4HHLA 1QR7A 1EX1A 1MXDA 2DZXA 4QM1A 1OSEA 1I4NA 4BS0A 3OZYA 3WD0A 4CD5A 4H9VA 3PPHA 3WIJA 5J04A 1B3WA 4K8HA 1ZJBA 2F7FA 3RPTA 4IPPA 4A3UA 3KHJA 4JYDA 2VQTA 1XJBA 4TX8A 3LCFA 5AY7A 4NRSA 2FVLA 1JDDA 1UOZA 3MJYA 1DV7A 4PUJA 3MUAA 4MJ4A 3H4XA 5E0FA 4GBUA 2GZXA 4GIEA 2I57A 4GYKA 3AIWA 1XC4A 1L6WA 4Z1CA 1RJPA 2WLZA 1AD1A 4DN1A 1B9ZA 2VGGA 1AQMA 1DQUA 2A4AA 1ZLPA 4GYPC 1VZWA 4Q8QA 3S6OA 3ARWA 2GOUA 3R11A 3PULA 4K1WA 4ZFMA 3ARRA 4NAFB 1XQLA 2PZNA 3FGCA 4DLMA 1PB0A 4QG8A 3WH9A 2ZZ5A 3H12A 1KFWA 2YIHA 3W1XA 4DWSC 2Z29A 2QF8A 5HAOA 4Y9MA 4AU0A 2QEZA 3EBVA 1JCTA 4EX4A 3RILA 2ZZ7A 1QNOA 3JZEA 1EIXA 4CU6A 3N4EA 3CIWA 4QXIA 3NM1A 2R94A 4YN5A 1BSIA 5GNYA 4MNMA 1H7RA 4RNIA 4CQ9A 1ZBCA 3H22A 3F7JA 3IVUA 4HTBA 4POCA 5GJNA 3OZMA 2DDXA 4TR9A 4QISA 5BU6A 5ABFA 1RD5A 4HZ7A 3S9ZA 4Z17A 2PE4A 1X97A 3L5AA 4AXNA 1EP1A 2J7CA 3KOWA 1MUCA 3NL3A 1Q2RA 4GCXA 1Q6LA 2CHRA 3CPGA 1W3NA 2RGLA 3IIVA 3PTKA 3CQKA 3V5FA 1MSSA 3WH7A 1VCGA 2J7GA 1MW1A 2W9MA 2CLOA 4KEVA 1RY8A 5IHRA 2PDFA 1TPFA 2DVUA 4PTMA 2KX9A 3RAOA 4LNCA 3CHEA 2XWEA 4DLFA 3QMTA 2DZUA 4JIEA 1G4EA 1JCXA 2CZVA 1F6KA 3MUIA 1CLVA 2VR2A 2DV0A 4AY7A 1KXQA 1W54A 5G2IA 4UUIA 2Z0IA 3EDDA 1GOWA 2E1WA 3VABA 1N8WA 4HCHA 3SRDA 1QI4A 1W3KA 3T44A 4GOAA 3RDKA 3WBWA 3RJXA 3HMCA 4WSJA 4H7VA 4UTKA 5EPDA 3USBA 2PF0A 1KNWA 2QUTA 5I3IA 4WHBA 2DUXA 1YDNA 1X98A 3PZMA 4E8CA 5HJLA 3I10A 4AZ6A 2GVGA 2VUNA 3I6RA 2YZ5A 4K38A 3FHQA 4N4QA 2NXGA 1G94A 1ZGDA 1J0ZA 4RXFA 2ZVIA 3C2RA 3FNDA 5LGZA 3NSXA 1JVNA 4ENLA 4XKYB 3CC1A 3KTCA 3MPGA 5FOOA 3L4YA 3H6OA 4PCSA 1FH8A 1VBHA 2VFFA 3WLTA 2E9LA 4G2DA 2YGYA 2BP1A 5HPCA 4HNUA 5C55A 1WV2A 7ODCA 1I2RA 2QDDA 1UG6A 2FMNA 2QIIA 3GDTA 2XTKA 3IJIA 1HKKA 1NOUA 2AGKA 2ANUA 1T40A 4KCUA 2HE5A 3HBLA 3MQTA 1EO5A 3J7HA 1Q7MA 3AHXA 5BOOA 1MQPA 4AEEA 2F9RA 1WKEA 1EUAA 4KRUA 4JTUA 4A3RA 4DYEA 1R3YA 1F3WA 3DG7A 3BG3A 3SY1A 4XQ6A 3FJ4A 5LIXX 1XHGA 4FLOA 2Q8XA 1QO2A 4XK2A 1UP2A 2X2YA 3GR7A 4PE8A 3DYMA 3S0CA 3FA4A 3ENLA 4PUNA 5KZMA 4C1NA 5I5RA 3IAQA 4GABA 3E9AA 4R7JA 4M80A 3EA2A 1H60A 3TA6A 5C9WA 4C7DA 3NSMA 3ARQA 4S3KA 2FZMA 2QJIA 4W5UA 2ZFAA 1V4YA 1XYAA 2OZ8A 1JPDX 3NTYA 3ALFA 3C86A 1WUFA 1RPXA 3SCTA 1FKXA 4KRZA 5I3FA 1IIGA 1TTQA 4CNTA 4O16A 2GK1A 5JBEA 4CD4A 2X05A 3SM0A 2YXGA 3DG3A 2PP3A 2QAPA 3UEQA 4AD0A 2G3JA 4Z42C 3UFYA 4AY8A 3YPIA 2YB1A 1HJXA 4XZHA 3TX9A 2HBVA 3CS2A 1P0BA 1ZJHA 4ICMA 4V1XA 5A6LA 2DZVA 3SDOA 1O94A 2WMHA 3EOUA 3GDKA 1F4HA 1I0BA 1LYXA 4A21A 1R2TA 1F05A 4QG6A 3W29A 3SSJA 3VGDA 3WDIA 3ZYZA 2ONEA 2FZBA 4DJDA 3AS2A 2CZFA 4C1LA 4RNJA 1UOKA 3KCJA 2PLCA 3RCNA 1EEPA 3I3BA 4HA1A 4IIGA 1OEPA 4I7UA 3WDQA 3T4WA 1OT1A 4F2BA 3LRMA 2RGMA 3LQGA 3DFQA 1LCOA 4ZQRA 4ZCWA 2GQ9A 4BY3A 3DFPA 3W75A 3GLCA 3LS9A 3PNUA 4OIFA 3ZFHA 2NSOA 2PDMA 4QG9A 4HP5A 4DYJA 4FLRA 2UY2A 5FJRA 3SBFA 1C8YA 2A3AA 5U4NA 3RXZA 1XRVA 3FY1A 3PHAA 1I60A 3TJXA 2FHFA 1DIKA 2INZA 2WSKA 1B1YA 3ZJ7A 2ODOA 4FXRA 4TTGA 3KFTA 2IPWA 1CNVA 4AIUA 1H41A 2A3LA 5JBDA 3KBVA 1I2QA 2C18A 4DZAA 1O60A 1WP6A 2Q8ZA 3A64A 4W93A 3TTEA 4WJ8A 4WY0A 4EF9A 1L2UA 3LLDA 1XFCA 1M7XA 2ZXDA 3L21A 3DUGA 1BTCA 5D4YA 1YYAA 2GJRA 4IIDA 4O14A 1TPB1 2PGWA 4J35A 2DORA 4WX2A 3WLRA 3T2QA 2X1SA 2ZX6A 3M5XA 2XH0A 2YCLB 3L5MA 3EWUA 3AXHA 1VGAA 2GL5A 3GY1A 3PZIA 1XYFA 4B5VA 2OSYA 1KBKA 1B2YA 5HJXA 4LBSA 3S1XA 4E3VA 3UWYA 4PTDA 1BWVA 3MDWA 3ZZ1A 3T1GA 4PB4A 1PKLA 2Z26A 4LPCA 1OCBA 1OVDA 5LZLA 1NWUA 4DM1A 5AC8A 4WDUA 3B97A 2ZXAA 3LV5A 4XIMA 9RUBA 3BQ5A 3EKGA 3ORWA 3HG2A 1QK2A 3RR1A 3PSVA 3O05A 1UR2A 3TW9A 3LG3A 4AC7C 1WOBA 1A49A 1V7YA 4Q6JA 3MP5A 1DWAM 3MUZ1 1CGUA 4AVNA 1L2QA 1H1YA 4XSMA 4H2CA 1CPUA 5D9OA 1GOXA 4QJ1A 2NV2A 1NH6A 3TSBA 3DX5A 4LYKA 4RW5A 1DJGA 1KR1A 4P7QA 2ZRVA 1MI3A 2VURA 1R7OA 3N3TA 2YL9A 2J78A 3GUWA 1FCVA 3OVPA 4LU0A 5H8PA 1WKDA 2WO5A 3U2CA 2C91A 4ROQA 3V0UA 4D6GA 5IXEA 3ISIX 2C15A 1MZRA 2A7RA 3CHDA 1R3WA 4IGMA 4C6CA 1F8IA 3WCZA 3SFWA 3WK1A 4JX6A 3A5VA 5AYXA 5LXXA 4KEUA 1EGMA 3BPWA 2J7HA 3V3WA 5E6YA 3BV4A 3ARSA 1KXTA 5DN1A 2VVNA 1J0KA 1AW1A 2FDSA 4GUJA 2WSPA 1QCWA 2OO0A 2J7BA 3R1ZA 3POCA 2OOFA 2E5CA 1GG1A 4UZUA 3GBEA 3E2SA 1SJCA 3IJQA 1Q6CA 4OHQA 1YTKA 4Z1DA 2Y8VA 1BGAA 3IIZA 1C92A 1VH7A 1V3JA 1QT1A 2VMFA 3AIBA 4Q6XA 1PEZA 3DI0A 2VGBA 2ACUA 4TMBA 2NQHA 5D9NA 4MPKA 5BRPA 3S5SA 2QCNA 4MZ1A 1KM0A 4DB7A 3LHWA 2A2IA 2DT0A 1ML1A 3A4AA 2PRLA 1VLIA 2QNEA 1J5SA 3VDHA 4LVDA 3K8LA 2WMJA 3QTGA 4URIA 1UD6A 2D3NA 1I6NA 1ENUA 1SSDA 4HMCA 1M9HA 1EYWA 4N02A 4O53A 3DGRA 4QNWA 1KLYA 3VNZA 4AFYA 5JU6A 1QI5A 2BS9A 1EB3A 3PBGA 4EOUA 3UG8A 1Y0EA 5D8ZA 1Q3NA 5FEWA 5D03A 3W6MA 3FOKA 4WXZA 1HZYA 4GWEA 2J25A 3VO0A 2PSNA 3WNKA 3PUOA 6TIMA 2OELA 5GVJA 4PMNA 4JFVA 1IEXA 3WQDA 5C7VA 3NQDA 4E0CA 2VKZG 3PB0A 2PBOA 1CTNA 2AOSA 4GH3A 4W85A 4GISA 1FHLA 1R3RA 4E3TA 1JZ5A 3QPZA 2V2DA 3THQA 2BGQA 4I6KA 5D9PA 1Y65A 4N6FA 3OTRA 1YBQB 4U2ZA 3URAA 3U48A 1K7XA 1WA3A 4ML4A 4FOKA 4UR9A 1JD9A 4B90A 4QROA 1SZFA 2DSZA 3UJFA 2V3DA 2POTA 3HQNA 1JUKA 4GINA 4R9XA 2DY3A 2PTXA 1AK5A 4AW7A 1XLLA 1MNSA 1EF3A 2YA1A 4CN6A 4Z2IA 3G1VA 1W1B1 2EO7A 3HPXA 5D2VA 4I9MA 1JYWA 4P7RA 2QCFA 5AN7A 2HEJA 2R82A 5FJTA 4IIBA 3BCFA 2PWGA 3STEA 2AMXA 4PUUA 1HKIA 4S3JA 4QCEA 1J2WA 4NI3A 5AYIA 1F3XA 3WDRA 3P61A 3S6TA 3OLIA 4F2TA 1VP5A 2PDNA 4I8DA 2PDQA 1GVEA 1JUEA 1OCQA 1XLIA 4H19A 3R6IA 2PGEA 4W87A 3GXTA 3LSCA 5EY5A 2C7FA 1I0DA 1V6UA 5EFDA 1XFBA 2HXUA 4HT3A 5HUPA 1GOKA 3ZJ6A 5TD4A 3CH0A 1OGSA 4ZB5A 2IXVA 1NARA 1POJA 1E43A 2W62A 3A4WA 3CT7A 3N9SA 4H6EA 3E0VA 3MKVA 3W83A 1UWSA 3IGSA 3UPMA 5CJNA 1Y5VA 4DM2A 2L5HA 3HZ3A 1VHCA 5HNRA 3GSMA 1ICSA 2WVVB 3PPCA 1GKQA 2QCCA 4HJWA 4ACZA 1BXNA 3DC0A 2QV4A 5DT5A 4AF0B 2J47A 3GRIA 3E12A 4G7EA 3WQWA 5FKYA 1H7NA 3GIYA 5JBFA 3U5UA 3TAOA 2RDTA 5C9UA 4FLQA 3LD5A 1AH0A 4L6OA 1E4MM 3SUSA 1UBPC 2PLMA 4WUIA 1FKWA 3QJAA 2OWCA 2G5WA 1D7KA 1W3TA 4GNKB 1JI2A 2JQXA 4R27A 1NY1A 1OWQA 4ZQCA 1QNPA 3E96A 1H7PA 5K4XA 4KCWA 1I1XA 2XVKA 1GUVA 5XIMA 3S2NA 1HGWA 1T7LA 3O6YX 4DX3A 4JNYA 4IG2A 3FX4A 4PSPA 4AZGA 2NV1A 1KD0A 1O66A 3BOFA 3CUZA 3A6OA 3ZVHB 2IQ0A 1D3GA 2FFCA 4O15A 2V5LA 3R58A 4UOJA 4KFPA 3WQ6A 5A6BA 2HDJA 1YDYA 1X39A 3OO2A 4FOUA 3HQPA 3KE0A 1ZALA 3EXTA 2CLIA 1E3ZA 3KUMA 3VNDA 2HWGA 1VKFA 5IFTA 3CM4A 2EG7A 1P0NA 1ELSA 1JDAA 5JQ9A 4LRSA 4PBFA 3I3EA 1PE1A 1GYNA 1EPXA 3O63A 1TR9A 2FPVA 1CGYA 4OGZA 4EF8A 3QMSA 1XYMA 1WDSA 5HANA 5FEPA 1E4LA 1Z89A 3WF4A 3DZ1A 3GDRA 3AWOA 2VFHA 5T91A 3M16A 3NOYA 4YHEA 2KAUC 3OYXA 3BCJA 3KLLA 3H2EA 2JIWA 5HATA 1BSLA 4UTUA 3UNTA 1TE1A 4DF1A 2J7FA 3UT0A 1LQ0A 3UWUA 4XD4A 3W7HA 3KOXA 7CGTA 2HROA 2J4GA 1T8QA 3QYSA 1EHNA 2VXNA 2I56A 4HYRA 1EA0A 4O50A 1FHDA 4EWND 1ADDA 4W9TA 1KCKA 2YA0A 4OECA 1BYAA 4E2OA 3KCOA 1QPKA 3GX9A 4C6QA 4PB5A 2D2OA 1RPKA 3ICJA 3NPWA 3LZ3A 3EOOA 2D0GA 4JTIA 2QT3A 1RCOB 4MKNA 5BRBA 3CT2A 5C5YA 4KMQA 3JZUA 3B03A 3NZ1A 1L8NA 3SCPA 5GNZA 1FY6A 3FV9A 3T7VA 1W56A 2CHNA 3LCIA 4B15A 2WZTA 2BY2A 1HQTA 2VELA 3HTWA 7ENLA 2B81A 2P1FA 1ESWA 2A0NA 4WF7A 5HMSA 3VKKA 3AXKA 1DWHM 5EB8A 3WNMA 2BVTA 3URNA 4NXSA 4KCTA 3FK4A 3F2CA 1K8ZA 4MNLA 1P7TA 2QDGA 4JL1A 1UD5A 3O6AA 1UR9A 2PPGA 3OQEA 3SIZA 3LDVA 3H2AA 1J18A 2OTDA 1PO9A 3O0FA 4KCVA 1X96A 2ZX9A 3K8MA 1L6GA 1BLIA 3GFYA 4AD1A 2E5DA 3KZSA 4ZE5A 1U2YA 1FH7A 1AMYA 1XIHA 1T5AA 1WBJA 3W76A 4HVXA 4J3WA 3BZGA 4UXDA 2GQAA 4B92A 4CEUC 1M41A 2FGLA 1GKPA 3SURA 1OABA 6A3HA 3OG3A 5CGQA 1G4PA 1A5KC 1EXPA 5KSWA 4I5XA 3VUPA 1ZENA 3PG9A 2BVYA 3WLPA 4HJFA 3SO7A 1GQKA 4M6PA 2G3MA 3HFTA 4XX6A 1UWAA 2E3ZA 3VIHA 5ENLA 4MM1A 1NVMA 1EJUC 1A80A 4JY9A 4X63A 1XLEA 3W82A 4JQ3A 4Q22A 1H7WA 5C9RA 3TYBA 3SI9A 4AEOA 3PTDA 3H23A 3RM9A 1DVJA 1OX4B 1JZ2A 4B4FA 1UWQA 6REQB 3RM8A 3EX6A 2G4FA 5LYRA 4MKVA 1EYEA 3GTXA 3E3HA 4QR6A 4GK8A 3PZNA 1DWFM 1YEYA 5D2WA 4EWJA 5CGMA 2DZWA 1IEVA 1X6NA 3WNOA 4XUYA 3OU8A 3MZNA 1JI1A 1V02E 1ITUA 1QPOA 3WUEA 1EXBA 4QGCA 3QR3A 1KM5A 1HL2A 1OCJA 1PHQA 1GVQA 4FF5A 1XIEA 1V03A 3O1NA 3EWXA 4US5D 3CMFA 4NZ5A 1DTUA 1GHRA 4LSBA 5BXRA 2ZRZA 1E0VA 3JS3A 3PZQA 4DELA 1GZJA 3K30A 4ZGYA 1BPLB 1ZP3A 2HRWA 5E70A 3SCOA 3PAJA 5HBFA 3UR2A 1UKPA 1QI0A 3BLLA 3KBJA 3REQB 1EDGA 3WUFA 2NQLA 1CGVA 4NJHA 4WSKA 1HL9A 4B5TA 1FHVA 2E28A 4CU7A 4NY2A 5AKQA 3THAA 5C70A 2XSBA 1JXKA 2NZLA 1YDOA 2WAGA 1P4CA 1O68A 4IMEA 4XO7A 4LUJA 1W9DM 1IEWA 3A13A 3P80A 3T78A 4MAVA 2QJMA 2VZUA 4S2BA 1XIMA 3TE9A 3W9ZA 4O1AA 2G41A 3GZAA 2DH3A 1WOAA 1VFHA 2G4JA 2FVKA 2DZBA 1H5VA 1CIUA 5A5WA 2AL2A 2Z1KA 5M17A 1KFEA 3OEXA 5KZ6A 4OV4A 2OWXA 1SGJA 3ATZA 2VYOA 1OFBA 4G5DA 4NNBA 4D6DA 3CWNA 5A2AA 2CIPA 2CEQA 4ZTXA 6TAAA 5G4WA 2CESA 1TV4A 3QR0A 3WH8A 3QQWA 3W86A 3UJSA 4MY1A 1F6YA 1RLDA 3HF3A 3CUGA 4LV9A 4JTAA 3QVQA 2WZHA 4IICA 1CW2A 2XPKA 3AS3A 3L4VA 1FDYA 1V0LA 3VMPA 1R3SA 2PDHA 2TYSA 3N1AA 4F2UA 3V7PA 1XYBA 1XCFA 2PFHA 1A5SA 5A6BD 5HPOA 3W7OA 1JNDA 3DKJA 2MANA 4FXFA 3W53A 4GACA 3UGVA 5AYYA 1J0IA 1C3FA 4L4LA 1EBHA 2V5JA 3OZOA 3CV7A 2A7NA 3B9AA 4LFYA 1Q7ZA 3EPMA 3MJMA 1MMFA 3OG2A 1UB3A 2YBUA 2FZNA 3BJFA 2PTYA 1IGWA 1KRMA 3STGA 4LOCA 1ONWA 1A5NC 4L56A 4TIMA 2INEA 3AICA 4M5PA 2OJPA 2IXUA 1BQGA 2C0AA 3LCLA 1BHGA 4GJ1A 1E9IA 4PCPA 4RX0A 3DDMA 1FRBA 2HSAA 3WQPA 1DOSA 1G4TA 3B0UX 2FHCA 1V02A 2RKXA 3N2CA 4JTJA 4IISA 5F2MA 4JAWA 5IBXC 2VO5A 1F76A 5BMWA 3TCSA 1XG3A 3ANVA 3UVIA 3GC4A 1R2RA 3BLKA 3AUJA 5K2ZA 3TCEA 3N73A 4C6JA 3UP8A 1E55A 5HMEA 2E6FA 5LA2A 3FJLA 5K7JA 3UG4A 3ELFA 4ZXLA 4F40A 1EA9C 1FWAC 3R7MA 1ICQA 1WX0A 3ID7A 3W0KA 4PA8A 3A9BA 4MWAC 3WG6A 3G5EA 3LHYA 4H6RA 1U1JA 4U10A 4A8IA 5AYZA 4E5TA 2VDHA 1PBGA 1TRIA 2P0OA 3LERA 3W4RA 3OOQA 1E4NA 3TC3A 4FK9A 5D05A 1R47A 2Z4GA 2C8NA 4M19A 1HX0A 1TJ2A 1OD8A 1H49A 3L2MA 4WIWA 3UY7A 2C71A 3QTPA 3GG7A 2LLEA 5FF3A 4W4QA 1A5OC 2REQB 4WOQA 3W87A 4C6BA 4MMWA 1VBUA 2NVAA 3ABSA 3MP3A 2YR1A 1XLHA 1PZ1A 4DJFC 4V15A 3DG6A 4NX5A 3MHUA 1XW8A 3I7QA 3EMQA 4XVDA 4UQAA 1T8XA 3EMZA 2GVLA 3W7EA 4B9ZA 2GDUA 4ADSA 4MB4A 4LYQA 1JGIA 2QCDB 1BF2A 1YADA 3W24A 3LRLA 1TX2A 3GW0A 1ZSXA 2ZDRA 1X6UA 4KERA 2YLLA 1EQPA 1EGVA 1XIIA 4AZBA 3TC7A 5LIWX 3S46A 3CPUA 3M43A 3APTA 1RQBA 1Z6KA 3P2VA 3W81A 1FWFC 2DJXA 4UB9A 3RO8A 1PKYA 3S4TA 3MCMA 1SO4A 1QPRA 5D2TA 2D2GA 4PH6A 6PTDA 1VS1A 1X6LA 3AIQA 1AUSL 3BG9A 3CQJA 4O11A 1GJWA 3NQ7A 3MV11 2BY0A 3USZA 4RNFA 1EWDA 4YTSA 5DFAA 2PI6A 4ECLA 1GYLA 2EPLX 1O1HA 2X7WA 5BCAA 3NO1A 4P5UA 4MNJA 4WK9A 3N4FA 5ABTA 2WSYA 4LT9A 3GIPA 2QPSA 1DORA 3LI0A 3NAVA 1MRAA 1EJSC 3MI3A 2X42A 5DLCA 3WLSA 1VHNA 3QOMA 5D9MA 3SUWA 1H1ZA 3KS5A 4ATLA 3G1DA 3H70A 4O1EA 3H2NA 1PIGA 3R0KA 2HVNA 5JMUA 2DT3A 3UQNA 5ABHA 1NDYA 2HNEA 3LU2A 3T55A 5I77A 1KTBA 4Q8OA 1QU4A 4L1WA 3PM6A 4AWEA 5RUBA 2BTMA 3EMCA 1WE5A 4NILA 3H7RA 3MBFA 4F48A 4OKDA 2OYLA 5PTDA 2JEPA 2WKLA 5D37A 4XWUA 1AW2A 1UYQA 4XZBA 5AC6A 3C2FA 2OG9A 2VWTA 4DZ5A 3AROA 4LBRA 2Q71A 4DO7A 4CNPA 1XYZA 1PIIA 2BG5A 3TYUA 3P81A 4B5WA 1YLVA 3MU7A 2QGHA 5REQB 4IFKA 2PRMA 4IPIA 2GYIA 2EPKX 1OJXA 2VD9A 2PURA 1M53A 3CV2A 4Q7NA 4HOXA 4LX4A 1V8EA 3LBMA 3T0TA 3U0HA 1TVLA 3PBWA 1FBAA 4PMUA 1O5RA 4WRHA 4QE4A 1J0HA 4XD5A 1H4PA 1ZCCA 5AYBA 6XIMA 2POZA 5E1QA 1H5YA 4PFMA 5C2GA 2J7EA 4MKSA 1DYSA 2W91A 4RV8A 3OB8A 2VOMA 5F4SA 2VZOA 2P88A 4KS0A 3TQPA 3E2VA 1F74A 2YSWA 4JHOA 3VDBA 1XGEA 2XN2A 1QXLA 5A95A 2OB3A 4MF4A 4IX2A 4FI4A 3GUGA 3KBWA 5FJPA 4ZTYA 5G1YA 4Z2HA 4AAJA 2F6KA 3FJ6A 4XTIA 5C2CA 1A47A 3UZJA 2X7VA 4S1FA 3S5YA 7A3HA 1WO2A 1UZ4A 4Q7BA 4IX0A 3P3BA 4D6EA 2ISVA 5DCBA 4XISA 1WBHA 2QDHA 4AD5A 1W6TA 1OF6A 3MCOA 5C9XA 4NYUA 4J2MA 3H26A 1ZFJA 3PB2A 3WEZA 3LXCA 2NXIA 4CN1A 2X41A 1IYXA 1XDMA 5BWAA 4NXKA 4H00A 3QM3A 1C8VA 3TK7A 2Z24A 4AZCA 2PTDA 4PCNA 4XZWA 1B5TA 4GFSA 3S8HA 3R79A 4WGHA 3B06A 4UQCA 1NQKA 3C8FA 1SFLA 4Q4KA 5AHMA 4E38A 1POKA 2XWDA 1ZAJA 4U2YA 4GVHA 1OYBA 3R13A 4TVDA 3K4AA 2ZX7A 3B0VC 1HFBA 3BO9A 4ZEPA 2PDUA 4MWAD 4BR1A 3H54A 3RITA 1CZ1A 3WMBA 3PBVA 3SSZA 2V5KA 3LQLA 2FVMA 4FX7A 4H1ZA 1J11A 1MRQA 2ZADA 2YDSA 2OX4A 5HQLA 1OD0A 1Y5XA 2CLPA 1VENA 3W7PA 4R88A 2Y85A 1KCXA 1W1PA 3DFHA 3LN3A 1S1RA 2PU0A 1K4HA 2CPUA 4W86A 2PDBA 1XLKA 1JF6A 3OVGA 4ZOAA 4NJKA 2XHYA 2O9PA 3GC2A 2X0YA 3GNXA 3TIMA 1GYMA 1IQ8A 4IMGA 4QS5A 3VKBA 1OYAA 3CL8A 3LTYA 2W3ZA 1O12A 3QRHA 3NGJA 4Q33A 2VRQA 3LSBA 4EXBA 3MZ2A 1WZKA 1PV8A 5FL1A 2O9RA 1HVXA 2WSQA 1XD0A 2CC0A 1LG1A 1GTHA 2Y70A 4PL2A 2VEKA 1K02A 4AX6A 2BBFA 2G3IA 1FCQA 3B8SA 4ZO7A 4L9YA 2BVDA 4NP7A 1V5XA 4PMZA 4YNGA 3W1MA 4K7YA 1LT8A 1N8IA 3NSNA 4GMEA 1EKOA 4NAFA 3WK0A 5G1MA 5B7ZA 2DGAA 3CUJA 5CSYA 2VCCA 1YXYA 4TXEA 3Q58A 1V77A 3IJ7A 4AB4A 3O9NA 4F4RA 1UWUA 1BD0A 3HGJA 4JKKA 4ZMGA 5E9XA 1JYNA 3NDZA 4JN8A 3V36A 2DW7A 4C6KA 2PB1A 3BURA 4KWSA 4GKLA 3WLIA 1XLGA 3KM8A 3HQOA 1DKWA 4RE4A 5HNUA 4BQ3A 3QHOA 2W61A 5HWNA 4Z2KA 4QCFA 2NSXA 5ABGA 3VIMA 3VMNA 5BNKA 4G8TA 4I3GA 3NGFA 1VJZA 1W8SA 5FAJA 4A2RA 1BRLB 1M6JA 1VBRA 3O6DA 4MJZA 2WM0A 4R34A 2GSHA 4UNLA 2CHOA 1D8WA 1P1XA 2BODX 3QHNA 3GDMA 1XLCA 5HDRA 2B7NA 3SCWA 1JQXA 4B5NA 4JDBA 3SN1A 4QE5A 4PRTA 3AQUA 3KL3A 3HIJA 4RDYA 2V8ZA 2E40A 3P0XA 2YYUA 3DCPA 2NWRA 1NF0A 2I5GA 3MUY1 1E40A 3VIPA 3HN3A 3P74A 2NQ9A 3P0WA 4I5RA 1ZJIA 1RP8A 1X38A 4OZOA 2VUYA 4JN6A 3ZWSA 2OX1A 1VJIA 3W02A 3OVQA 5MHBA 4LQ1A 3M64A 1FWIC 3BJTA 3ME3A 1C9DA 4MB1A 3VNLA 4HHMA 1JCNA 1XL9A 4D6JA 4DPQA 3VCRA 4CNUA 2GSJA 4A35A 3HG3A 4X3ZA 3PZVA 3AS1A 4GHRA 4C1KA 2EJAA 4J3SA 3WJWA 1RALA 1YIXA 3AZTA 2OPJA 4XZMX 3BAWA 1DJQA 4BEQA 3TN6A 3RLVA 2GQ3A 4HNNA 4QLKA 3UWQA 3ZMRA 3WDHA 3N25A 3PBUA 3EX3A 4MZ8A 4JY8A 2OEJA 4IF2A 4D71A 2DZSA 3TYCA 3C6CA 3TFXA 1Q6GA 4V1YA 4P8WA 2ACRA 4PR4A 4PTWA 1H63A 4YTRA 2ZRXA 2ATSA 3L4WA 2B7OA 3PZGA 4PTNA 4XKYA 1ZBKA 3L4UA 1OX5A 3IARA 3QW3A 1LQ2A 3CB8A 3EA1A 3SQLA 4L64A 5KETA 2PDYA 2XFWA 3S5NA 1UQYA 3RPDA 3CO8A 1BGGA 4RPQA 3KOFA 3NUKA 4DF2A 5D33A 1XBZA 3VZXA 1AZ1A 1KB3A 4Z1AA 4TMCA 5DELA 4DNMA 5A8GA 2DIEA 3S1VA 3WF1A 4HNCA 1WXZA 4K39A 1VR6A 4J3XA 1WB0A 3S1UA 3S3GA 4H83A 1E6ZA 3JRKA 4V2XA 3W1RA 3QV6A 4GZJA 1HIZA 3I4EA 2INFA 3T0DA 2DEPA 1HF6A 3VD7A 4DWSB 1RCXB 5HXMA 4D1IA 1PSCA 3I65A 4Z1YA 3W2LA 4LC8A 2GUBA 3M0ZA 1KXVA 1S5VA 2J9XA 3DENA 2WWDA 1RJQA 3EGJA 1WQ5A 5CC7A 1UIPA 2H9AB 3ZQ9A 4X2PA 2VM8A 4WDWA 5K4ZA 2A85A 5CZKA 3S9IA 1UROA 1FWRA 2X40A 2W5FA 3WFAA 3IJLA 3RYSA 3AU2A 3W7MA 1R9XA 4DNHA 4EAMA 3MVIA 2YW4A 1OQFA 3FVMA 3UPBA 2H6RA 1QW9A 1HJWA 1SO5A 5I7GA 1NP0A 1BVNP 3E74A 2P0IA 4GXMA 3OIXA 2WQPA 1ZBWA 4UTHA 3N34A 2CLHA 2FJKA 1Q13A 2PDCA 3TW6A 3VKAA 1JNEA 4Q8TA 3RCYA 2DIKA 1TCDA 2QPUA 3VE9A 2C16A 3TDFA 3L4TA 5I24A 4G1KA 2C0HA 4O10A 4NZ3A 5F7UA 1UD2A 3HM7A 4JKLA 3G1RA 3MUXA 4C6IA 3NWRA 3V0SA 3MMWA 3TQKA 1E9LA 2JGQA 3N6HA 3CZGA 4QS6A 3GS6A 3W7GA 3KBNA 5CPQA 4YU1A 1Q6QA 4MY9A 4YCPA 4NKCA 3NDYA 2DSWA 2D2HA 1UKQA 5JXQA 5D30A 1DHPA 5JH2A 4JTHA 1ZPTA 1S2AA 2Y8UA 1XUZA 3ITLA 4LF2A 5FI8A 2WHKA 5I3HA 5H2ZA 4KESA 4O12A 2EKCA 2F6UA 3PANA 4FXJA 1ME9A 4FB7A 2W6RA 1JQVA 4ALDA 1LLOA 1VLWA 4YTQA 5K9XA 3XIMA 4QDWA 4UOQA 3N2XA 3DN5A 3STFA 2P3ZA 1RD6A 3R8HA 4E4PA 4HPNA 2Y63A 4LUTB 3OZPA 5CKSA 3L2LA 1TV8A 4IMFA 2CZDA 5CH9A 4DBEA 4JTTA 4F8XA 3LRKA 3MA8A 4TX6A 4BF7A 3QV9A 1HUVA 1RUSA 4PFHA 4PMYA 5BROA 4UTWC 4YYFA 4HA3A 1SFJA 3VZZA 2DPEA 2JEQA 3GG1A 5A69A 4I9TA 2EXOA 3WMSA 1XR2A 1CCWB 4PBEA 3BMVA 4LY4A 3DI1A 3LA4A 3M4HA 3HO8A 4GH1A 2YCLA 3AISA 2CXGA 3T05A 1UZ1A 1XF0A 5FF4A 2EGZA 4G9PA 5AC5A 2WZMA 5LNSA 5MKGB 5C9ZA 2Y5JA 1ZRQA 4Q8VA 3LCHA 1XLAA 4LVAA 3WMCA 1EPVA 1N82A 4U3AA 4J7RA 4HNOA 2AQWA 5EMYA 1MO0A 3KL5A 1U5VA 3WELA 4Y9PA 3R0DA 3M0IA 3GTHA 3E02A 1DWGM 1LLWA 4U5KA 2OR2A 4GYFA 1XCWA 2VQUA 2FPTA 2GUYA 3GHSA 4GUIA 1ISYA 3IJ8A 4UQ9A 4YL2A 3W7CA 3LK6A 4GPNA 2OKTA 4QLJA 1VFTA 1PJ9A 1C93A 4B16A 3C2YA 3PWIA 1J6PA 3AJXA 1YE4A 3WY1A 3F4NA 4LCRA 2RDWA 2ZE3A 2HE8A 3PG8A 3ABRA 3N6JA 1JUBA 1XKYA 1Q65A 2ZKMX 1J6OA 4O4VA 4WDTA 2B7QA 4LNYA 2XFRA 1H3GA 3AYTA 3I6TA 1V0NA 1MW3A 3WNNA 3AC0A 4FEZA 4CCDA 1PZ0A 2G3FA 1Z48A 2XU2A 3HPSA 4DF0A 5M2FX 2VP8A 5ECUA 3W27A 3N2TA 1W32A 3WF2A 1X7IA 2B0MA 2GQ8A 4IXHA 2CITA 4R9OA 1VFUA 2A5HA 2OQHA 4KEZA 3BGAA 2V0TA 3TV8A 2BOFX 5F2IA 2BV9A 3RG6A 4BI6A 1TV5A 3L2IA 1S3TC 5IBXA 2YFNA 4PEKA 3DH7A 3EX4A 5JIPA 1U22A 5LIUX 1IZKA 1UJPA 1TV2A 2QHAA 1WPCA 3F5JA 3VGFA 1K9EA 2Z1VA 1QO5A 5HR6A 5CEWA 1TJ1A 4J3VA 3PZ9A 2NT0A 3BSHA 3LCXA 1UH4A 4DJEA 1QHPA 3DFTA 3UR5A 4R3UA 4Z0SA 4DI9A 1MEWA 1UR3M 1EQCA 1DE6A 5CQ1A 1YE6A 1R3QA 3WX7A 1SMAA 2QUNA 3WO8A 2GGIA 3JR2A 5HOSA 4FIRA 4DAIA 3R89A 1QATA 5M03A 3KP0A 2W63A 4UFLA 5FJIA 2ZUMA 3CTTA 3SN4A 4Y96A 2GFTA 1SPQA 5DY2A 4K6AA 1KTNA 3HU7A 4KWVA 4WLCA 1ECEA 3F4VA 2X1IA 4BI7A 1PYFA 4YWIA 4CQCA 2OLHA 1OC7A 2ABAA 4JYFA 2YDRA 1GG0A 4Q8UA 3D5HA 3QEZA 4DJFA 2HJPA 2NUWA 3UCQA 2NLYA 2QW5A 3UWWA 3BGJA 4HK6A 1F3TA 1LOSA 2QUMA 3PTMA 4XV0A 1RJRA 4PC8A 2WNZA 5BWFA 1FXPA 5DT7A 1QJWA 4KW2A 3RHGA 5EGRA 4PUKA 3K13A 3H53A 2QZRA 4HPXA 1TKKA 3NFUA 1A5MC 2RJHA 4S38A 1YBQA 4M1BA 2I5QA 1A5AA 1MVYA 4UZSA 1FWWA 2X0SA 5HWMA 4P61A 1Q6RA 3E0IA 1HKJA 3WL1A 3QKZA 1E0TA 3N6QA 3VOFA 1VPQA 3RRXA 3L0KA 2QYGA 3N29A 4IQJA 3AXXA 4HK7A 4XAYA 3KBMA 4JKMA 5AOUA 2VZTA 1TMHA 2QIWA 4HYVA 1WDQA 3M7WA 4BF5A 3LM7A 4C6EA 5JH1A 1Z42A 3OLEA 1DJXA 2J77A 5K3VA 3O07A 4HNVA 1R9ZA 1XC6A 1WZLA 2A6NA 4FF7A 5B7YA 5DXXA 3PN8A 1S38A 3T2OA 4EK7A 2O0TA 3PUEA 5A8QA 2WMIB 3GYEA 3UYIA 4HA0A 5EL1A 3CB3A 5LXEA 5AECA 2ISFA 1CXIA 1TR1A 5A3HA 4WKFA 4UIOA 3WF3A 1UKSA 3AYRA 1TG7A 2G37A 4D8AA 2YB4A 3BVJA 3LM3A 1YX1A 3CMGA 1A4MA 2X16A 3WK3A 3IS4A 4XO6A 3GXIA 4BZYA 2OQLA 3BE7A 1AQ0A 4A3YA 1I8JA 1GKRA 3QKEA 3RX4A 2Z27A 4KPLA 4NI8A 1PYMA 4JFUA 2F84A 2BY3A 2WVVA 1V3LA 3VNMA 5I07A 4AF0A 3TYAA 4HU8A 4HPJA 3NM3A 2FYMA 3VNKA 1XH2A 1RBLA 1XM3A 3C8NA 3VILA 2WHLA 2Z28A 3GHUA 1JJKA 4JXCA 3IEBA 1QBBA 3POHA 5H8UA 3ITVA 5A2BA 4GYJA 4PMJA 1R87A 3ZLFA 2VX7A 3V75A 1US2A 3SGGA 1IWAA 3KRBA 1KWGA 4KH2A 4RR4A 5G2HA 2CLEA 3C3UA 1XBXA 3APGA 3ZSTA 3KW3A 4ZO8A 4UQDA 4B4HA 1XD1A 3SB0A 1ITCA 5BXPA 3VNJA 2W67A 3E6EA 1TPDA 1UJQA 1HJSA 4IHCA 3TZFA 3ERPA 5HR7A 1P6CA 4PMQA 2WANA 2JKEA 5DCEA 1XKJA 5FACA 3JVAA 3ZVHA 2GDQA 3LTPA 1UZHA 3LEPA 4L7ZA 2EQDA 2C14A 5CSSA 4JFTA 4QAIA 1D3HA 1VB9A 4LUSB 3O2LA 4LC6A 4RNHA 3TTYA 4Q8PA 4Z0JA 1DWIM 4C90A 3QHMA 1ZHAA 4Q4SA 1ONXA 3TONA 4BK9A 2DH2A 4PRWA 1YPIA 3W85A 1S5MA 3EB4A 3DHFA 1UW9A 4B5UA 2E09A 3EOEA 5DRCA 1EJWC 5DMNA 4W8LA 5CPMA 1KTCA 4CLMA 1BTMA 7TIMA 2ZUNA 3TSDA 3PP7A 1FQ0A 1KM1A 2PD5A 1YPXA 1HJVA 2BGNE 1DQWA 4MHBA 4KETA 3LLFA 4GKTA 3BW2A 1L6FA 1H09A 1KFCA 4IUOA 3P5ZA 1K03A 2CLMA 3M5VA 1XH0A 1BG9A 2ZZ4A 2J24A 2VEIA 1GVIA 2OODA 1UUMA 2V69A 1PIFA 3K46A 3UXAA 3QV7A 3IWPA 1E6QM 5SWUA 4GCAA 1UHVA 3IAPA 1BKSA 1TV7A 2TRSA 4HA4A 2WSRA 1WDDA 3KBSA 3V5OA 3CTLA 4HZ6A 4PCTA 1M65A 2J66A 4NASA 3GVVA 4FSAA 4Q8MA 3SN0A 4YS1A 3WSUA 4PSRA 2JIEA 1TA3B 2ZBTA 2QR6A 4M51A 1UH3A 3N13A 1NFPA 3TYDA 1GZGA 3SEPA 3FKRA 1Q4WA 4BFAA 2Z25A 2DT2A 1H2JA 2EAWA 1SZEA 1JPMA 2VFIA 3GXPA 3IRSA 3WJYA 3M0XA 1LBFA 3B40A 5LHFA 2HISA 2XDFA 1LOLA 3W72A 2X1RA 1VFOA 1WKYA 3TUUA 4RDWA 4ZOCA 5EBAA 4H2HA 3A3WA 3UW6A 2ZXQA 5CPOA 4N42A 3E2QA 3DKLA 3AHYA 4OUIA 1J10A 1SJAA 4FNPA 3U7VA 5I0DA 2WXDM 1KC7A 1EGZA 3CXOA 3NNTA 3AMDA 4DUVA 3L65A 4NIRA 1TPUA 1JG9A 4GO9A 1DXFA 4C6DA 4CQBA 3DIPA 4GQ0A 3G1YA 1RHCA 4LUYA 2VGIA 5TQLA 1PVNA 3SR7A 5CBBA 2E67A 2ISDA 3W1AA 1IGSA 1SFTA 1KO0A 2VDIA 5LGXA 3KVMA 4B3KA 1EWEA 3RM4A 1JCYA 4I9AA 4C6PA 4LANA 8XIAA 3EWBX 2Q02A 3CQ0A 4RZBA 3ZR4A 1TPEA 3L9CA 1OX4A 1SO6A 3L23A 1O5QA 3KZPA 6REQA 4UNIA 3Q45A 4CNSA 4L65A 1R38A 3GYCA 1NEYA 2Z1BA 1PUDA 5BOFA 3G22A 2GVYA 3H55A 2FH8A 1W5MA 4O1BA 3PFMA 3PK7A 2ZA1A 1TCMA 5K9CA 2DU2A 2H8ZA 3N17A 4B5XA 2R91A 2DSUA 4UFKA 3UD6A 3GE7A 3D6NA 1TTJA 4QP0A 4FZIA 4P7LA 2VD8A 5AHNA 3VAVA 1U5JA 4LALA 3B8VA 4ML9A 4ZB2A 1C90A 4KWOA 3D47A 1QW7A 2Y61A 3TJ4A 3FIGA 1DXIA 1UH2A 3BLEA 3REQA 3W07A 3MI2A 1VYPX 5FSDC 4K36A 1PL9A 2V67A 3EAUA 1UR1A 2FZ9A 1SQ7A 3KVLA 2DZAA 3ZT5A 1SW3A 1VIWA 3GW3A 2UY4A 3BAXA 2HVOA 2GJLA 3F1QA 4U33A 3N15A 1FWHC 4CQDA 1A0EA 1G7VA 3GU9A 2EG8A 1HVQA 2EF9A 2CKSA 2QV5A 4YYCA 4DPPA 1AJ2A 3AYVA 5HNTA 1VFLA 2OVLA 3LLXA 5D04C 3K1DA 4ATWA 2UWFA 3WYZA 4WSHA 1R8LA 2RFGA 1ISVA 4ATDA 1DJYA 1G01A 3WQVA 3LNMA 3LXAA 5A6AA 3S9YA 1O5KA 1ZL1A 3MWCA 1Q5MA 4IQLA 1E9ZB 2VX6A 4LVGA 1UR8A 4MAZA 3TLLA 4Y2WA 5CC5A 2IUZA 4CNNA 2PLKA 2BXYA 3GM8A 4QJ3B 3T6CA 1ZTVA 1S46A 1WAWA 1A5CA 3BICA 2PF8A 2ZIDA 4GUFA 3B3DA 4FHAA 1V3KA 1H11A 3MMDA 3FAXA 3RMEA 1RLCL 4JDYA 1KRCC 4IMAA 3PJXA 3FVDA 4H4IA 4IIHA 2OU4A 4NQ1A 2E9MA 4O0QA 1TZZA 4GUHA 1B90A 4ZA0A 3U7BA 3FEMA 2YW3A 2D1ZA 3IJ6A 4J9JA 2Y88A 4U31A 3TA9A 3FYYA 3KX6A 1H50A 4XSLA 3A4JA 3VNYA 1O1ZA 4RDZA 2OZ0A 2PAJA 3C3NA 4AHOA 1OG0A 1G69A 3ITOA 1LT7A 3LI1A 2FQIA 3QF0A 2QJJA 2EG6A 3M47A 3FYPA 1OCNA 1V7AA 1XG4A 3W7JA 4IFRA 2Z6JA 4QAWA 1G9HA 1W1YA 2PWEA 4DUXA 3CMJA 4GGBA 4A8RA 3MI6A 1K7FA 3HG4A 4GJJA 3RU6A 3UCCA 4QEEA 5EYWA 4RE3A 1J0JA 2OWWA 3BMXA 4DIAA 1P1MA 1IZCA 2PMQA 4J3UA 4AIEA 3VK5A 5K9DA 3EOLA 2O7SA 3EA3A 3MY9A 1F5ZA 4H04A 2V2CA 1TREA 1BWLA 4OV9A 2CZEA 1KGWA 3FEQA 4OBTA 1CWYA 3QFWA 3TFCA 4J40A 4UTTA 3TXVA 3LPGA 3W73A 3F2DA 3II1A 2Y4SA 3WUBA 1TUFA 1P48A 4HTYA 2ISWA 1A0CA 4U28A 1KCZA 1K3UA 4YHGA 3CEUA 5A8OA 4MDOA 4NZJA 3WQ8A 4F0SA 2BVWA 2EHHA 3EDEA 1Y7VA 4NJGA 1ALDA 2CWNA 5D32A 2PBGA 3ANYA 4ICCX 2PGFA 1E0WA 4JPGA 1E3XA 3P67A 3A24A 4H9XA 3SCVA 2Y89A 3GAYA 2XINA 2E1DA 3NEHA 1ZQ5A 3PTQA 3CL7A 3VINA 1I2PA 3CYVA 3B0YA 4HZ8A 2BX7A 2XIQA 4NL1A 3NQ8A 1QNSA 4TU1A 5AZ0A 3U57A 4C5YA 1NWRA 2DVXA 3NIYA 2REQA 1PTAA 3GXMA 3LGEA 5AVNA 1B4EA 1DHKA 3N2OA 2X09A 1QASA 2CFFA 3HPZA 4GIYA 2WC7A 4M3PA 2WYSA 3VUSA 4N7QA 5GQBA 4HIBA 4Y8EA 1LWHA 1W3IA 2QCDA 2ALDA 1E73M 1ZY9A 3EB2A 3QPEA 3NZRA 2ZWYA 4NAEB 2XIOA 2FHBA 3GWQA 4DBWA 3DFOA 4LTSA 2QCMA 3W2JA 4F0LA 2WJEA 2A7PA 3GNOA 4H8VA 3WUGA 2E6AA 4OFCA 1FCUA 1XRSA 1IR1A 4JCLA 4RE0A 2PDXA 1A5LC 4JFSA 4Z2GA 1RZMA 2YCEA 4L4MA 3GH4A 3Q37A 2W0UA 1R0MA 3QGVA 4C6LA 2WV8A 4GX8A 2FKPA 4KGLA 4HSHA 3ZS4A 2WBKA 4J27A 4J2PA 3BUVA 1GZ1A 3SQSA 4E8GA 3SRFA 3WJSA 4WKAA 1TZ9A 1Y8BA 3WD4A 1BAGA 2GWNA 3AYSA 1OF8A 1PWLA 4IJRA 5E0KA 1W1A1 4FAMA 4FIQA 4QDPA 2GVJA 3WLNA 4DXKA 3CHVA 5G4EA 3G0XA 2IPGA 1MFVA 1GEHA 3LENA 2D2JA 3RPMA 3CQIA 5EU9A 3R4IA 1WXJA 5HJYA 1FFQA 2J13A 2XVPA 3H2FA 1SO3A 3GNRA 4BQ2A 1QWGA 2VGFA 4R53A 4ZVJA 1CYGA 1UBSA 1XIDA 3BOXA 2XIJA 4HHHA 2OZ3A 2BHUA 1K8YA 1FP8A 3W2NA 2V9DA 2TODA 4HSOA 2P53A 4AWTA 3NQFA 2Z1XA 1J79A 3PBYA 4EAYA 4Y7EA 3V4BA 4H01A 4NZ1A 3OPSA 4NG3A 1IXNA 1LUCB 3HPFA 1NTHA 3AZRA 4QFUA 4IQDA 3MMUA 2WW5A 3WDPP 5HUOA 1IT7A 1UWIA 3NJ3A 4IP5A 4FNUA 1YHTA 2OGYA 2C19A 2HBXA 4JHMA 3UPWA 2VNCA 3N12A 4ZL1A 1SMDA 3PUGA 4UC5A 2EBNA 6ENLA 5EMUA 2ZX5A 1V6VA 5REQA 4DY1A 2V5DA 2XJ7A 1DL3A 1BFNA 3M5YA 1TJPA 5KITA 4XD3A 3TJIA 3PJWA 3D46A 4ZXOA 4PGLA 4AVFA 2DSVA 1ZNNA 1OK4A 4F3HA 3K5XA 3DERA 3VTRA 2VRKA 2J6VA 4MWAB 2WKGA 1HXJA 5HNNA 4DEFA 3O7UA 1XIJA 1E4IA 3DFYA 3NQ2A 3TLQA 3PSWA 4GBDA 4FOJA 1K9DA 1S3HA 3S5ZA 3ITTA 5AHLA 2E0PA 2GJXB 2YL6A 1DJNA 1EEXA 3KOYA 4OWGA 1XLJA 1RVGA 3UWZA 4M56A 1OT2A 2GLKA 2W92A 3LXBA 2IKHA 3WQCA 1WYIA 1HKMA 2J75A 4YVPA 1I1WA 1FWDC 1GOIA 3C0JA 2ZYFA 4Z1BA 3RGTA 3UR8A 2XH7A 3BTNA 3FSUA 2ZC8A 3AHZA 3U5YA 4LYPA 1H0IA 1F9CA 5CBIA 4R7OA 3SGUA 1XXXA 2J8FA 2RDUA 3A47A 2PWUA 2CXEA 5EBUA 1FH9A 1ISXA 2YOCA 3VA8A 1K70A 4EIVA 4N9CA 1YPFA 5HWJA 1OB0A 2EPMX 2OCZA 1GQIA 4V33A 8A3HA 4HPHA 4ADUA 3T4CA 3KLKA 1XGZA 3R10A 3HGRA 3BZJA 4FP1A 3XINA 3ZR5A 1M5WA 2ACSA 3TNOA 2YKKA 2FGBA 5L9FA 1W0MA 3EX2A 1EC9A 1JXJA 4LAKA 5HQMA 1F73A 4DBDA 3PBMA 2WC3A 5FIPA 1FUYA 4K2SA 2GOKA 4N9BA 1VF8A 2CETA 4S39A 1JZ3A 4DJDD 1OIFA 4JS3A 1LL6A 3MVTA 2PCQA 4UR7A 4HGXA 3WQEA 3WENA 1P0KA 1NDVA 4X9SA 5BOEA 1Z3NA 1H51A 3KOZA 3GTNA 2E9BA 3CGTA 1KKRA 3HQ1A 4L6HA 4QHRA 2PWHA 3QFEA 4C65A 3I3DA 2XM2A 4YWSA 3WQ4A 4TO8A 2NVCA 2OO6A 3N9RA 1ADSA 4MB5A 3ITXA 2Y7GA 1NM9A 2I9UA 5CZJA 2V5BA 1BYDA 4IPNB 3RFAA 2JF7A 4OVXA 3CAQA 1C29A 2PTWA 5IDZA 5IFPA 3QMRA 4J28A 1GORA 1XLFA 1G4SA 3AZSA 4FPSA 1UIOA 4ERAA 1RSCA 1IWBA 2QCGA 4R85A 3ZM8A 4FS9A 3UXDA 7PTDA 1ICPA 1A3WA 1JR1A 4WJXA 1BVZA 4PMOA 5LHEA 3SAZA 2I17A 3PUDA 3B8TA 3MUCA 2BWGA 4WVXA 1GNXA 1LBLA 1AW5A 2I14A 2HS6A 5G5IA 5I02A 5JIWA 3NL2A 1SYTA 1WKFA 4O0ZA 4ZQPA 2VL4A 4ASTA 3P6LA 3W7QA 2WNNA 3TN3A 4HKPA 2AKMA 1OC6A 1THFD 1GPWA 2XSAA 2WBGA 4NVTA 4GVIA 2CERA 3PJTA 3TU9A 4A4AA 3VGHA 3CLMA 3UG3A 4HD5A 5FF2A 1E56A 1OFDA 1KCLA 4IXXA 2Z2BA 4PZVA 5CSUA 4OOZA 1KKOA 4YLWA 4FX6M 2ZWZA 5CPNA 3TROA 3NYZA 1YDVA 4ICNA 4AD4A 2D24A 1VEOA 2OYMA 2QJGA 4AQLA 4R5EA 4JIRA 2V3GA 4GO8A 4AYSA 2YDQA 3HOJA 4MG4A 4Y9OA 4JD4A 1VPYA 4GZEA 1U1HA 1BRLA 2D0HA 1FVPA 1D2KA 4RK8A 1J4EA 3ARTA 1SW0A 2J9YA 3MANA 2EKGA 3SRKA 4IT1A 3DEQA 2NLIA 1BYCA 4X0NA 4O13A 4XBSA 1E6XM 3TJLA 4D2JA 2CZ5A 1KW1A 3C0LA 1UWRA 1EO7A 1P43A 1VD6A 1B3XA 3OBKA 1NELA 1QAPA 1AVAA 4REQB 2VFDA 1KM2A 2ZTJA 3QLLA 1MEHA 1JULA 3E0FA 2X30A 4ONVA 5H1WA 3PY2A 2Z1SA 2BSLA 3A23A 1X8CA 1B9BA 4KBXA 1A50A 1OY0A 3GDLA 4O57A 4GZIA 3WD2A 1CB2A 1KA9F 1U33A 2GGHA 3MC5A 2ZZ1A 3AU6A 2ZVRA 2VR5A 4JGDA 3M0KA 1JZ8A 1XBVA 1K6AA 1M7OA 3BAIA 1NDWA 3AHTA 3RNDA 1KBIA 1M01A 1GQJA 1XQKA 5EMLA 3WFLA 5J8LA 5F2LA 1DTNA 1I9CB 1ONRA 2IW0A 2ZQ0A 1B30A 1DXEA 1FHUA 1FWTA 3PZOA 3E5PA 4BWLA 1XCXA 3GXFA 5HMDA 3LYEA 4JTRA 2UZ9A 1KWKA 4FMVA 1UD4A 1C7TA 2CBVA 2ZA3A 4XKMA 2W4XA 3L12A 4I5UA 2WM1A 1BYBA 2NX9A 3WLHA 3OBAA 1RQEA 1Q4NX 1FWGC 2G8ZA 4JL2A 3QBUA 5H8MA 5GPRA 5LA0A 3CU2A 4MZYA 3ARUA 3W26A 1FX6A 3INPA 1C7SA 2QVHA 4HYWA 1YTDA 2BY1A 3L67A 3C61A 2E4TA 1DIEA 1IT8A 2D73A 4WKHA 3UR7A 2OLSA 2FB2A 4AHPA 1UP0A 2XUCA 5F1UA 2WPBA 3BW4A 3CK5A 5DEZA 3VKDA 3BJSA 1A5UA 3VI2A 3NQMA 2DT1A 4F9DA 3R2GA 4GYPA 1KFKA 3CHCA 3AIEA 4RV3A 4EE9A 4X60A 1HJUA 4OBSA 3KDNA 1JZ7A 3OHMB 3B8DA 5HQEA 2XN0A 4HU0A 3SUVA 3B0PA 4O54A 4DWSA 4O4WA 7XIMA 1N8FA 3MT1A 3AALA 3RR4A 1KGUA 5TAOA 1NOFA 2HV5A 1TWWA 3LGDA 4UNKA 2JBMA 3GVWA 1YNYA 4JHZA 3SIMA 1HL8A 2H9AA 3TOPA 3MHGA 5A8PA 2A3BA 1LROA 3SECA 1R6WA 4A3HA 3GK0A 4RKAA 1I2NA 3GXDA 4B3ZA 1TWIA 3M6DA 1GEQA 1RA0A 2AL1A 5CLTA 5IDIA 2D20A 2HQAA 2PC8A 1UQZA 4IGNA 3B4YA 3Q94A 1TIWA 4QDMA 2BHYA 1CXKA 3ITGA 1GJPA 4ZSTA 2AGTA 2YDAA 4W8BA 2CU0A 5T8GA 1ME7A 3RO6A 2VEGA 2XM1A 1Y5WA 4ZENA 2CKRA 1AG1O 1KM4A 1LWJA 2YBVA 4M82A 3WMLA 3O3RA 2VWSA 4LWWA 3RRAA 1E1CB 3KXQA 3I4KA 3DFNA 4HHPA 3MHFA 4DHGA 1F61A 2V38A 4IMCA 3G1AA 3GHTA 3AS0A 2Y7EA 1E6PA 1W3LA 4JFWA 4DBSA 3BCDA 3LCGA 4W88A 4M81A 1XICA 3QOKA 2G97A 3IUDA 1I45A 3ARXA 1VFSA 3K8KA 4YXGA 4BJHA 1A3XA 1Z8AA 3NQEA 4D6IA 1PPIA 4M7TA 3Q67A 4IP4A 4E2DA 4JTSA 4UTIA 1E1EA 4YPJA 1JPIA 1XRFA 4MSSA 2V5CA 5LA1A 3AOFA 5I78A 3TMQA 1Q85A 2R14A 5D38A 4IGSA 2EPHA 1CGXA 3EWCA 1C9WA 2Y8KA 3OA3A 1PWMA 1TWSA 1NQ6A 4JTFA 4KIRA 5CAHA 3SRHA 5FJJA 2XH4A 4D72A 2OKOA 4G1NA 5TBOA 4LUTA 1E9YB 3WQFA 1Z7AA 4GC4A 3G0SA 4EANA 4H7CA 4AIBA 1JCMP 1FWJC 1TQXA 3GG0A 2XZ9A 4LAMA 2WPGA 2QQ6A 4GUGA 3W84A 2XG9A 3K2GA 3QH2A 3W7DA 3TKFA 2PUZA 4GE8A 4B9YA 3P84A 3CZEA 3JUGA 1JF5A 4QLLA 3MO4A 4NYYA 2DSKA 1SSGA 2PC4A 3VDCA 3QLDA 4GZ7A 4PN2A 3P8JA 5EMJA 1ODZA 4CEXC 3LB0A 5KMYA 5CXPA 2JF6A 1F07A 3WQOA 4GG9A 4GY1A 4MLRA 2VC5A 4QJ4B 2ZRWA 4Q4PA 5H91A 3EB3A 3ZVIA 5MKGA 3BOLA 3LOTA 4R33A 3IRDA 3R25A 3TNBA 5D2YA 3MYPA 1E15A 1CT5A 1XLBA 2FMOA 3KVKA 5F1VA 3C4UA 2A3CA 2I9EA 3ES8A 3LMZA 4Q7IA 9CGTA 1TRDA 3UF9A 1D8CA 1IZJA 1ODUA 2WQDA 4C6OA 1Q6FA 1KBBA 1QWKA 2WJFA 3VX0A 1TJRA 4MUZA 3L4ZA 3BMWA 3SCRA 4UOZA 3NYDA 1JDCA 1ZUAX 4GQQA 1P0EA 3U8GA 1WAUA 3JU2A 4PBGA 5DMLA 1HJQA 4LBUA 5IHSA 4TV5A 3CAVA 4M6UA 3B05A 1NIUA 2OT0A 4HNLA 5CLWA 5I09A 1Q8AA 1R5YA 2YBTA 3P7YA 3VM5A 2XIMA 1LL7A 1C8QA 1YQ2A 3AFBA 1K4GA 8XIMA 1LJYA 4YVXA 3AXIA 3HGSA 5EMMA 4JR5A 4JX4A 4IOTA 3R8GA 5CBJA 4Q4OA 3G8RA 4A8LA 4JNMA 2Y5SA 4HCDA 3RN6A 5GNXA 4IGHA 3M44A 5FAGA 1NJJA 4AC1X 5F4XA 3Q65A 2X1TA 4QRNA 4NNAA 4ORMA 4W84A 3ATYA 5DY3A 3ARZA 1ZU8A 1SM9A 1KM6A 1XI3A 2FTYA 4DXXA 2C6QA 3UGRA 3S2LA 4W5ZA 1P6WA 3MSYA 3QSRA 3S83A 3VPLA 4OUEA 1CBGA 4DO4A 2B31A 3TQ0A 4CGTA 2C1IA 4CCEA 5C0QA 3W25A 2ZRYA 3EDKA 3E1F1 3D3AA 3R5EA 4L9XA 1PX4A 3CYJA 1GQNA 2PLJA 1NP2A 1J0YA 1PTDA 3VIFA 4H3DA 2R6OA 1Z9AA 3GD6A 3VIGA 3EPOA 3NEVA 1TB3A 2GSEA 5ECVA 3WBXA 1KBLA 2OFJA 1EOMA 4JIHA 3F2BA 3KS6A 2G3NA 3M07A 5FF7A 1XINA 2QVNA 3M0VA 2I1OA 4PUWA 3HG5A 5GJPA 1TZ7A 4KKXA 5EKYA 4NNCA 5CG0A 4ZOEA 3SCQA 3M6YA 1ZCOA 1VFFA 3SCUA 1UPMB 3TAKA 4FNQA 5KTLA 4WXYA 3EEZA 4JTDA 4AZ7A 2TMDA 1Z32X 4YIWA 3VOHA 5FEXA 2DJLA 2R1KA 3DECA 3M0MA 4HK5A 5I23A 3C56A 2BXVA 1JIBA 4S3FA 2J79A 3TEVA 5BMXA 3DGBA 5EMKA 5A8NA 3G24A 3I7RA 3ZWTA 1IF2A 3W2MA 4DWSD 2GGGA 5DCDA 4QTGA 3FSTA 4WY0F 1AFSA 5BW6A 3BH4A 1Q6DA 1SFSA 5C7HA 2VDGA 4HU3A 4LAUA 4UBPC 1SZGA 1DJWA 3ZSSA 4WGXA 1L8PA 1UP3A 4XZ9A 2NX1A 4L61A 4HMNA 1OZMA 4N4PA 3FJNA 1B54A 3LUTA 3CL6A 1QI3A 3S2JA 3GH5A 1ECQA 1G67A 1FCBA 3L66A 3NPVA 3VFCA 2VOTA 2ZICA 1DP0A 2VC7A 4GQGA 1ISZA 5C54A 1U5HA 3OHIA 3PVFA 1Q8JA 3IANA 3S1WA 3BARA 2FZDA 3VU2A 4JQ2A 3C2VA 3HJEA 1TJ0A 4ZBCA 2ADAA 4BF9A 2ZUVA 1QOXA 4HCLA 4UMBA 2YA2A 3EEGA 2ZX8A 1YNPA 2F61A 3TVAA 2VCAA 1J5TA 2ISSA 3NURA 3VX1A 1IEQA 3THDA 3SJNA 4CNOA 3LZ5A 3VOJA 1LLZA 3VCNA 2IKGA 2NQ5A 4MFEA 2WMIA 4TV6A 5AFDA 1SR0A 4IPLA 4XBJA 6ALDA 3CH9A 1MWOA 2YXOA 1JPHA 1TYGA 2PP0A 1JGMA 4IQEA 3HA1A 2XFFA 1KQZA 1UD8A 3H2MA 3W70A 5CPLA 5IRPA 1XH1A 1M7PA 3TW7A 1XSKA 1VRDA 3KAOA 5G1TA 3WEMA 1ZZMA 1REQB 4NF7A 4B3LA 4E8DA 3FN9A 3NQVA 1OBAA 4FNTA 4M7SA 1IEIA 4MJ2A 3GZ3A 2NT1A 1OZQA 1RBAA 1V6WA 1M3UA 4UWMA 4N9EA 1I75A 5AC7A 2VC6A 1AMKA 4JX5A 4C60A 3FLUA 1ME8A 3PPGA 5JUVA 3WFZA 4Z08A 4S3GA 2VZVA 1M68A 3OYZA 3LBCA 2YPIA 3KDOA 4GX9A 3TOYA 1GJUA 5D8WA 1N55A 2Z7KA 2E68A 4QQUA 1XSJA 4BQ5A 3KP1A 4LVFA 1RXOB 4H8HA 3G6LA 2OQYA 3CWHA 1LP6A 3T07A 5MF5A 1XSIA 4M29A 2F38A 2QMKA 3IV8A 2ZZ6A 4K1GA 4QNEA 2Z2UA 3NPXA 2PDKA 1PCKA 2I16A 4E4UA 3G1XA 3MTWA 2OYKA 3W88A 1J8VA 1FOBA 2ON3A 4IFOA 2CYGA 1ZBVA 5DRIA 1QNRA 4QSHA 3PS7A 4LUSA 4JTEA 4FLSA 3AHVA 1UC4A 1BF6A 1UKTA 4PULA 1Q63A 3G6MA 5E6ZA 3A3HA 1YXDA 1MDRA 5LNVA 4RE2A 2BNJA 1SW7A 4PTVA 1UUQA 1VEPA 3QC3A 1D3CA 1HTIA 1XYLA 1LM1A 1UR0A 4K68A 1MFUA 1O95A 2GGJA 4GI6A 3VIIA 5DX7A 1UMYA 4UMCA 3UA4A 2WKJA 5I3GA 3HV9A 4ZZ9A 3QC0A 4AD3A 1Z41A 1KGXA 1OGBA 3T8QA 1W31A 3NO3A 4M24A 3C5QA 3EXRA 3HMJG 3B9OA 2Y6ZA 2Q09A 4GI4A 3V18A 2F2HA 3M41A 3CZJA 3TXZA 5FJUA 1F3EA 1TVNA 2PDGA 5EFFA 2QCHA 2IKJA 3BAKA 3C0SA 3D3FA 3TYEA 3SQMA 4W7WA 2BOGX 4X22A 5C6MA 3Q2DA 3NZGA 2FFIA 1JAKA 2FIQA 2CLFA 3CZ8A 1FTXA 2QXWA 2VZSA 5BYWA 3O8AA 1PX8A 2Y5EA 4EPEC 2PD9A 1K9TA 2J62A 3BG5A 5DMMA 2HZGA 1TO3A 3NA8A 1S2VA 2Y1HA 2HXTA 2HVMA 1TA3A 3ZJKA 5KZDA 4XZNX 2OEMA 2BZNA 4OU1A 4TVUA 1AH3A 3VFLA 4WCJA 3NZPA 7REQB 1V6YA 4W8AA 3UXKA 4S3BA 3SADA 1HKVA 3KVJA 3UVAA 4PL1A 1TWZA 4MIMA 3WLOA 1UUOA 2Z7GA 1TWDA 3FCPA 1HP5A 1IR2A 4UMAA 2EPOA 2I7GA 1TSIA 3HV8A 4LEFA 3AIUA 3UA3A 1PXGA 3L0NA 5E09A 2YYTA 4ZR8A 2VRJA 4US5A 2NW0A 1EUNA 1R9YA 1ZS2A 3ONCA 3CBWA 1VCVA 3BV7A 3VVGA 4TQTA 3S6DA 3PC0A 5DBUA 3W1TA 1HO4A 3LHZA 1GGOA 1VC4A 2HPMA 1J12A 1YNQA 3THCA 4EVZA 3VIKA 5FESA 5EA9A 3SZ8A 3UG5A 1RA5A 3U2ZA 3W7KA 1MUMA 3MSRA 1HGYA 4JNZA 1NU5A 1Q66A 4NZFA 4GRSA 3L0GA 4H9ZA 3TTQA 1US3A 1SZNA 3N04A 4F79A 3KHDA 2YCKX 4OTKA 5AZ1A 1OHLA 1RV8A 1OM0A 2CNCA 1VRXA 1QPQA 3CZLA 4LH8A 1J9YA 4UFMA 1OG6A 3BWWA 3IGXA 4L9ZA 4DZIA 3N2MA 2C3ZA 3FXGA 3VMOA 1V0MA 3GR4A 2G95A 3RIKA 5D2XA 4K37A 1ITXA 3NQBA 2FH6A 2V30A 1W9BM 5DO8A 2X2GA 3RLHA 1CX9A 5HA7A 4XAZA 4GXPA 3BANA 3LPOA 2J8GA 2Q6ZA 4PMXA 1PKMA 2ZUUA 3E2RA 2NVDA 3VC5A 4QJ5B 4AWUA 2H8XA 4ES4A 4OE7A 2Q3RA 4LJ3A 3QPYA 5AHEA 1JFXA 2Z6IA 5FSEC 2D22A 1E51A 2ATMA 3M0YA 2KZHA 3O6CA 2CBIA 2VCBA 4IL2A 1XIFA 1IXPA 3H7VA 1EH9A 3H21A 2MUCA 2XVLA 4HSNA 2Z1WA 2R24A 4MGGA 3EYPA 3M0LA 1XBYA 4A22A 1BQCA 4Q4QA 2QPXA 2PP1A 3G77A 1EP3A 1A3HA 4G6CA 2E6DA 2D0FA 2WNWA 3RMJA 3MDUA 3EKZA 5I3KA 4AD2A 1J2BA 3T0CA 4GNVA 1SJBA 2DQWA 1EL3A 4RL3A 1OFEA 4ZQMA 2AKZA 3APYA 4EP8C 4U5IA 4PCFA 3W7IA 2WMKA 3IK4A 4H8UA 2WC4A 1EJVC 4LB4A 3BL3A 1W3HA 3FFSA 1F4AA 3HB9A 1RAKA 2P50A 3THUA 3PF3A 1D9EA 2PTZA 1K6WA 5CSRA 1RR2A 1G1YA 4NJIA 1TV3A 2PDLA 2EJ1A 5G2WA 2C79A 1W5QA 1CXFA 1GWJA 3WJXA 1HO1A 4AVOA 1YXCA 2HS8A 1AZ2A 3S2MA 4AWSA 4IJBA 3OGVA 3QY8A 1G5AA 2E7FA 5LNUA 2ZDSA 3T40A 1WDPA 4C6FA 4KFOA 3HGOA 2QUVA 3V5CA 1B3ZA 4EPDC 1GOOA 4KGJA 1QTWA 4DYKA 3SJ3A 1WDWA 2CLLA 2DP3A 3TH6A 4H41A 1OGGA 3IVSA 3PR2A 4HOZA 3GHRA 3GTIA 3WNPA 2PODA 5BZAA 4H7ZA 4UCFA 3ZOAA 1ISWA 3FGCB 1GTEA 1YRRA 3MB9A 1E0XA 1H7XA 4AUBA 4YTUA 4MFDA 4J1OA 1NSJA 4LCQA 4LV4A 4X9YA 1S2CA 4JBRA 4I6VA 1Z44A 4J5NA 1FWBC 4I9JA 3NL5A 1CDGA 1NOWA 4EPKA 1CB7B 3M1ZA 2DUAA 3FS2A 3K4DA 2VENA 1O5XA 4GGHA 4QE1A 3DXIA 1HKWA 1FDJA 1O4UA 3WF0A 4LW7A 3BDKA 5FA5A 1KLZA 3NZQA 1V3IA 4PTXA 1RQHA 4XTDA 3QQ0A 5E0CA 1E70M 1FFRA 2ACQA 4UCGA 5ABFB 1TTPA 4JIIX 2XGZA 3CQHA 4GLEA 2YJQA 1SUXA 4DBUA 4ERIA 1ZP4A 4K8EA 3URBA 3HJZA 1EBGA 3B8UA 4QQ3A 1XIGA 3LMYA 1RVKA 4KQNA 5AVHA 3WD3A 1A5BA 1W1ZA 4N9DA 3T8LA 1DBTA 1EIBA 2E25A 2H3DA 4NX0A 4EKJA 4RCXA 1OIMA 3W00A 4P8VA 1W8GA 4HU4A 4GY0A 4F0KA 4LS1A 1H61A 1MDLA 3TC6A 4JOMA 5HULA 4XUGA 3VD3A 3T2PA 1WZAA 5D02A 3W6YA 3AUOA 1TPC1 4O0KA 2ZOXA 1XRTA 1BKHA 1R46A 3V16A 4DUOA 4PRRA 1XUUA 2O4QA 3LPFA 2XGBA 4NSBA 5CAKA 3CUHA 4MWAE 1LRNA 5KEZA 3R8RA 4LCSA 4RJEA 3IGUA 2BFGA 3MS8A 3C52A 1XS2A 2D23A 1N2VA 4UFHA 4BCEA 3GKFA 3I68A 3UJEA 1XLDA 3TTOA 2UY5A 4V28A 3Q4DA 3W1LA 1OFQA 1F6PA 4IUGA 1PCWA 4PUDA 2YL8A 5E93A 2CWXA 4F0MA 2OOGA 5HINA 1JD7A 1QI2A 4A8NA 2NUXA 1V93A 4NAEA 3GQYA 2WJZA 3IPWA 4Z2JA 1GVOA 1MW0A 4LS2A 4HN8A 1QHZA 3H4GA 1M1BA 1LG2A 3E0WA 3EDJA 3GXNA 3VD9A 3T09A 3EDFA 4LUIA 2OT1A 4H9YA 3P93A 3VZYA 4D6HA 3BLIA 1MXSA 2V63A 3WLMA 3V35A 2FTWA 1K8XA 4AYGA 1TE6A 1J93A 3H24A 1EF2A 3IK2A 3CIVA 6CGTA 5I3JA 4O19A 1FDZA 3QQ1A 1E6RA 7TAAA 1XYCA 4ZQNA 2QJHA 3W2UA 5I3DA 3H2OA 3RCMA 2O9OA 2RHGA 1KM3A 3OP2A 2NXHA 3AO0A 2TSYA 3BGGA 4Y9AA 3M9YA 2DZTA 4ZFCA 4LVBA 3T0AA 3VOCA 3OGRA 1NWTA 1AQHA 1CI1A 3ES7A 5CZ0A 1V08A 3H4WA 5M5DA 3E38A 2QGYA 3QR1A 3TWBA 1MEIA 4ADTA 4M6QA 5T9BG 4XAGA 4C1NB 4ZODA 3MO7A 3P60A 4KRTA 3GBDA 1LUCA 3GO2A 2OZTA 4A6GA 2QULA 4M8UA 3GVGA 3VDGA 1GW1A 1E5JA 3XISA 3S5OA 2IKIA 2WOQA 2GPTA 5F2GA 5A1AA 3W2KA 3QZAA 2RH9A 3GNNA 1HW6A 4L1XA 3VCCA 3U3HA 3OGSA 1X1ZA 2GK1B 3WLQA 1W1TA 5FJOA 5AC4A 3VXGA 3M7SA 4GQBA 3W6LA 3GVQA 4MADA 3FAWA 1QHOA 4X61A 2P8CA 2HMCA 3NL6A 3AJ7A 1R3VA 1Z69A 2E5BA 2W27A 1K1DA 3A12A 2D69A 4IMDA 1S39A 3A5FA 3PNZA 1NFGA 4A2SA 2VEPA 3VC6A 3M5ZA 3NR0A 4IZGA 2V68A 4CVWA 3VIJA 4L4PA 4MWAA 3TZNA 1ADOA 1UA3A 4IPJA 4UTMA 1T0OA 4B91A 1PHWA 3NXFA 2EPNA 4QX4A 3WKZA 2ABBA 3L7RA 1NWSA 1J01A 3UWEA 2WHJA 3GB6A 1PKNA 3F5KA 3SUUA 4NUWA 3A21A 1ZAIA 2PRHA 5DF0A 2P76A 2GJXA 2QDEA 4I90A 4YMZA 3CNYA 3MKCA 1X1NA 2QS8A 2CBJA 4B5SA 1LRQA 2CW6A 4CUCA 1QW8A 4AY1A 4LYRA 3O15A 4RZ5A 5L6UA 3F4WA 4E4FA 1EJRC 3BSMA 3RX2A 5LKYA 5IM51 4JYEA 4DJEC 1WCGA 3F5LA 3AMKA 2IMRA 4NZCA 3QZEA 1W5NA 1WDRA 2WMGA 1HT6A 1AL8A 4D1JA 1W1VA 4RUBA 4JQAA 3IACA 3B8WA 2DIJA 5GJMA 1PDZA 2IQDA 1TTIA 3I7SA 4G56A 3LHVA 1WUEA 3QV8A 4HMDA 2Q3OA 4WR3A 4FA3A 4JTGA 1US0A 2XN1A 2P5NA 3ANUA 3DHUA 4WEVX 2NQZA 4CD6A 9XIMA 4RPPA 5ABEA 3R43A 1JRBA 2NV9A 4WY0B 4GVGA 3PZTA 4A29A 3FW6A 3B9DA 3WBEA 4MNKA 5I00A 2JGYA 3DYPA 1EDTA 3DFSA 5AHIA 4JQ1A 1PZ2A 3WEOA 3ZLGA 2GJPA 3NQGA 3CAKA 1NDZA 2GGEA 1X8FA 5I03A 1B3YA 3NXLA 2FTPA 4TX9A 1IT0A 3UERA 1UD3A 2A3EA 4HPGA 4HQVA 3P14A 1MZHA 4PODA 1R85A 3L5LA 1JYVA 4Q4RA 2JK2A 3ABOA 3CIXA 3V1PA 3G3DA 4WD0A 2OSWA 3KCLA 1DPMA 4PEEA 4AIOA 4IWWA 3B4UA 2MNRA 4K7VA 4L5ZA 5M1TA 2YX0A 4EXQA 1IV8A 5C2XA 3W1PA 4GI9A 4JEQA 4H9MA 4FR6A 3QYQA 3W1NA 4I8YA 5CJ5A 3S1GA 1IE7C 5U7SA 1W17A 3KWSA 1AL7A