1YX1A

Crystal structure of protein of unknown function pa2260 from pseudomonas aeruginosa, possible sugar phosphate isomerase
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
250
structure length
250
Chain Sequence
LHPVSISLSSYGADLVRSRGQASFLPLLAMAGAQRVELREELFAGPPDTEALTAAIQLQGLECVFSSPLELWREDGQLNPELEPTLRRAEACGAGWLKVSLGLLPEQPDLAALGRRLARHGLQLLVENDQTPQGGRIEVLERFFRLAERQQLDLAMTFDIGNWRWQEQAADEAALRLGRYVGYVHCKAVIRNRDGKLVAVPPSAADLQYWQRLLQHFPEGVARAIEYPLQGDDLLSLSRRHIAALARLGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein PA2260
publication title X-ray crystal structure of hypothetical protein PA2260 from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa pao1
total genus 90
structure length 250
sequence length 250
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 1yx1A00
3QXBA 3WQOA 4PGLA 5EMMA 4XIMA 5H6HA 1TZ9A 1I60A 5AVNA 4G56A 1XISA 3P6LA 4XSLA 3KBMA 4A8NA 3CQHA 9XIMA 3KCLA 4K3ZA 4EAYA 1D8WA 1XLLA 1XYCA 3CNYA 3P14A 3ITYA 1XLEA 4A8IA 4HHMA 3VYLA 5XIAA 3U3HA 1I6NA 1S5MA 3VNIA 3M0YA 2QW5A 8XIAA 6XIMA 1XIMA 2NQJA 4XISA 4YTUA 5B80A 3U0HA 4ZB0A 2OU4A 3FVMA 2HK1A 3VNMA 4GJIA 7XIMA 8XIMA 5C9ZA 1XLAA 5EMKA 2NQ9A 2HK0A 3AALA 5XIMA 3DX5A 4QE5A 3XINA 4YTQA 3XISA 3KWSA 3QYSA 3M0MA 3BANA 1DE5A 3UA4A 4A8LA 3M0HA 4QDWA 4QE4A 3KBSA 4X60A 3IUIA 4ZB2A 5I7GA 1MNZA 2I57A 3QZAA 5J8LA 3OBEA 5B7ZA 1XIBA 1XLFA 2QUNA 3ITXA 2J6VA 1XYBA 4QDPA 4X61A 4DVOA 1DE6A 3JU2A 1XIDA 5EMJA 3BDKA 3CQIA 4DUOA 1MUWA 1XLDA 4W4QA 4QEEA 3N4AA 4HHLA 3KBWA 1DIDA 1XICA 2QULA 4J4KA 4ZB5A 3LMZA 3C0QA 1XYAA 1CLKA 3BZGA 2GUBA 3ITOA 3KBNA 4E3VA 3M0XA 4XKMA 3CWHA 1GW9A 3C0SA 4HNOA 5AVHA 4A8RA 1A0CA 1XIHA 1O1HA 2XINA 3KBJA 1S5NA 1XLHA 3AYVA 3IUDA 4GLEA 1QTWA 3NGFA 1A0DA 2I56A 3ITTA 5TNVA 5FA5A 1A0EA 3XIMA 2XISA 1XLGA 1XIFA 1XLJA 4PFHA 4QEHA 4YTSA 1BXBA 1QUMA 3AAMA 6XIAA 4X63A 3UXIA 2ZVRA 3ITVA 4YTRA 1XLKA 2GVEA 3M0LA 1XINA 1K77A 1XYMA 5B7YA 2GYIA 3TC3A 3QC0A 5H1WA 5EMLA 4QE1A 1XYLA 3KCJA 3C0LA 4LNCA 3BZJA 4EACA 4K1GA 3M0VA 2X7VA 3ITLA 3IUHA 2X7WA 3VNKA 3CQJA 1XLBA 2QUMA 3L23A 2G4JA 3GNXA 4KW2A 1DXIA 1XIJA 4HGXA 3UVAA 4US6A 3VNLA 1QT1A 2XIMA 2Q02A 3UU0A 2GLKA 2NQHA 4XSMA 4ZBCA 4GQBA 2HCVA 2ZDSA 1XLIA 1XLMA 1XP3A 3CQKA 4YTTA 1YX1A 1XLCA 3AYTA 1XIGA 3VNJA 3BWWA 3TVAA 1XIIA 2G0WA 1BXCA 3KTCA 5XINA 3UA3A 1DIEA 3KCOA 1OADA 4Q7IA 9XIAA 4XIAA 3KBVA 3DBNA 4OVXA 1XIEA 4GJJA
chains in the Genus database with same CATH superfamily
2WMGA 3LQLA 2H3BA 2OGYA 5JQ9A 3VMNA 2O0TA 2R6OA 1TTJA 1PB0A 1HJWA 4Q6JA 4NYUA 5C2XA 1RXOB 1PDZA 1S2AA 4DZHA 1PZ2A 4DYJA 4MYAA 2HK1A 4S3BA 1XLAA 2P3ZA 3M5ZA 3T81A 4J27A 4MPKA 1G69A 4GQQA 2NVCA 5B7ZA 1F4HA 4QDPA 3PTQA 4MY1A 4PB3A 3W85A 3NQAA 1RV8A 3KBWA 1H41A 3QV6A 2DSZA 3NXFA 2GUBA 2XPKA 3IS4A 4HU3A 5IBXC 4KWUA 2VEGA 2ZUSA 2PDXA 3NM3A 3KS6A 1OZMA 1V0KA 4JIRA 2EG8A 1TJRA 3CZJA 4PFHA 4C6BA 1JPMA 3T2PA 4YS1A 3WLMA 4FS9A 4LAUA 1GVSA 2R14A 3VCRA 3UZ5A 2OEMA 2ZZ3A 4C1NA 1O7AA 4F0MA 1VBJA 4M6QA 2DT1A 1CNVA 2C13A 5IHSA 4M0XA 4UUIA 4DWDA 3PAJA 2BY3A 3W7EA 1RR2A 3DI0A 3TYZA 5I79A 1GT8A 5AC8A 1DIEA 3TK7A 4O4WA 2FQIA 3CZLA 5HMDA 2JKPA 2WC3A 3QLDA 3STGA 4Q8NA 1TWWA 1UH2A 2EPLX 4GVFA 3PZQA 3LCGA 1Q7MA 1VP5A 3G6LA 1P0KA 3DFTA 2DJLA 1KCKA 1GG1A 1V03A 1VBHA 3ZR6A 1MW1A 3IIXA 1OC6A 1TJ2A 5D2VA 5MKGA 2HPMA 2ISVA 4Q7NA 2AQVA 4OE7A 1UD8A 1EJWC 1PL9A 3DKJA 1XCXA 3PR2A 4KWVA 2Z2UA 2PDUA 1MXGA 1UR4A 4F0RA 3ALFA 4XD6A 3T7VA 3EX3A 3IVTA 3BZGA 4IPIA 1DWJM 4Y9AA 2ON3A 3UYCA 2FTPA 3Q65A 4IX0A 1P43A 3C2YA 3RX3A 1YDNA 5EU9A 4ZSUA 5TNVA 1QO5A 4E2OA 4O17A 1ECEA 3C2OA 2ZQ0A 4Y2WA 1ZSXA 1ZU8A 5IBXA 1D7KA 2D0HA 1A5NC 3NSMA 3PSVA 3WENA 4NZFA 2FTYA 3O07A 3CQJA 3LPPA 3PS7A 3GNXA 2YFOA 3OIXA 1D9EA 2I7GA 1N55A 2QKFA 2AMGA 3SIZA 3VTRA 1EP3A 2VFIA 1W1PA 1KNWA 2OFJA 2EO7A 4BY3A 4JEQA 3NSNA 3WBAA 1DKWA 4AB4A 3UXKA 4BQ2A 4JYEA 4DJFC 3L12A 1I60A 2O7SA 4HNLA 3U9IA 3VFLA 4C6PA 4AH7A 4HIBA 2OX4A 4AVNA 1UQYA 3WG6A 2FPVA 1IEWA 3Q67A 4FO4A 4Q32A 4H2CA 3WEOA 3CMFA 1QBBA 5E6YA 1HKVA 1RY0A 5C55A 1XCFA 2DW6A 2GQ9A 1VZWA 1V7YA 2DORA 1XLFA 2CPUA 2NUWA 1ITQA 4TMCA 1JRCA 1X96A 1X1ZA 3OBKA 3NDYA 3EWDA 3ANVA 5AC4A 1HVXA 3C56A 4GIRA 3UJSA 3D0CA 2BODX 3W22A 1MRAA 3E5PA 3WMSA 1BTCA 2PWEA 2VL4A 2VCAA 1ZUAX 3TFCA 4H7VA 3WNKA 5E5CA 2GQ8A 3DFSA 1KBJA 4JBRA 4TUFA 1A5OC 1HFBA 1XJBA 4F40A 1YNQA 3W0KA 4C1LA 1KGXA 1HP5A 1OINA 5A94A 4I7VA 3M44A 1JZ8A 1QT1A 3CL7A 2NQHA 3GLCA 4JOMA 4Z2JA 3ZSTA 3I3BA 3W70A 4ALDA 5DFAA 2GK1A 4XVDA 2VEIA 2J7EA 5TD4A 3BWWA 4GYKA 1Q85A 3GO2A 4PODA 4E4FA 1KFLA 2GQAA 4IPNB 4YVXA 5EFDA 3CUXA 4YN5A 1W5QA 3HGJA 4NIRA 1AQFA 2P1FA 5LNRA 3VIIA 1FFQA 2C1IA 1LL6A 4Q8VA 1E6PA 3WQPA 3W71A 1GJWA 2E68A 4A8LA 4IISA 1EC9A 2B7NA 3TFXA 1IGWA 1OB0A 3CZGA 3IRDA 2ZRYA 3WUBA 4S3AA 3H2NA 2W92A 1LG2A 3KBNA 4E3VA 1K4HA 1JCTA 3EWUA 1BWVA 4CVUA 1X7IA 4JX6A 2P8CA 4C90A 3W7OA 3UJRA 4D8AA 4HPJA 3VAVA 3EPMA 1IIGA 1AW5A 2BV9A 1KR1A 2OOGA 4IJRA 3VNKA 4NT0A 4C6CA 5F2GA 3UWVA 3VGHA 1X8FA 1A5LC 3MVTA 3CHDA 4ZO6A 1F3EA 1KM4A 3LB0A 4DI9A 2ZXQA 1QNQA 2GUYA 2MUCA 1KCZA 3B8UA 1ADSA 3PM6A 5FF0A 1M53A 3RO8A 1GGOA 3V3WA 1KGWA 2KZHA 3VE7A 3E0VA 3KL3A 1JAEA 2A7PA 3VUSA 3EX1A 4B90A 1O5XA 3GR8A 5ABFA 1V3JA 1WZAA 1F76A 4PEEA 4ZENA 2F61A 3U2OA 5FJPA 2XH2A 3FEMA 4HU4A 4LPCA 2OLSA 1MRQA 4NZJA 1R7OA 3AIUA 5G4HC 1E4NA 4X61A 3LXCA 5M03A 3M07A 1G67A 1FDJA 2NVAA 4HPHA 2GVYA 3PUEA 1AG1O 1VCFA 2NXIA 4UR8A 2R82A 2PDYA 1VBRA 4LUYA 1CEOA 3UWYA 2YW4A 1XF0A 3W3OA 4WLCA 3R12A 1O1ZA 1O6IA 4YTRA 4LAZA 2OWCA 3ARVA 4M6UA 1OEPA 4RDZA 3LNPA 5D32A 4PMQA 3ANUA 4MWAE 3W1QA 4EXBA 4IGSA 1VBGA 1P5BA 1KD0A 2WCAA 2FB2A 1E55A 4ZXOA 4AF0A 3L4VA 4W5UA 4GCXA 3VGBA 4JL2A 1G01A 2TODA 3B06A 1JDAA 4UTMA 5IDIA 3P60A 4XIAA 3NDZA 4A3RA 3ITGA 4NASA 1WXZA 4DO5A 3VIMA 5AVNA 1IEXA 1L2UA 3RAOA 4EAYA 4IMDA 2E8YA 3WQWA 5HXMA 2OG9A 3EMQA 4RUBA 4MOZA 3KLKA 3S42A 1TTPA 1XDMA 3SCQA 3TZNA 1WDDA 2QEZA 3KWSA 3ZVIA 1H11A 3PPGA 4ZR8A 5E1QA 4LUJA 4D6EA 3TTYA 5CSRA 1G1YA 5IOBA 1JDDA 4OGZA 1MUWA 3UERA 3KTSA 4Z2IA 5CPQA 2GVJA 3C0QA 1HKWA 2DVUA 1V3LA 2W27A 1EA9C 1VFMA 3HPSA 4BZYA 1DWAM 1KFEA 1T7LA 3B0YA 5D4YA 3LHVA 3EEGA 3MJMA 3W6LA 4PUDA 2A6LA 3W6YA 3NSXA 4GVGA 3KCJA 3MHUA 1C8QA 5H8UA 3ZT5A 1BKSA 1BGGA 1UIOA 3H55A 2WKGA 2UY2A 4PUWA 3W4RA 5A1AA 2XIMA 2PGWA 1TA3B 4OUIA 3AIEA 2DQWA 1DJQA 3PWIA 4M19A 3DAQA 4O13A 4QJ1A 1QHZA 1XBZA 2HISA 4IJBA 3KCOA 3T55A 1QHOA 4E8DA 4GJJA 5M17A 1B2YA 1XSKA 4F79A 4JAWA 5FKYA 5FJJA 3W2NA 2AQWA 3CNYA 3TR9A 3AMGA 1UPPA 4E5TA 1M65A 3OW1A 8XIAA 2DJXA 2FIQA 4WDWA 3WH5A 4Z2KA 3EDEA 3AUJA 1PYFA 2FGZA 1NVMA 2FMNA 4AZ5A 4S23A 4LYRA 5AOUA 2GZXA 3S83A 1ENUA 1YXYA 2FGLA 5AC6A 4XKYB 4BI6A 4X2RA 2ZX7A 1UUMA 5BWAA 4BKNA 4DXVA 1AUSL 3ENLA 1IWBA 1Q6EA 1EEPA 4XKMA 3GDMA 5D03A 3OG2A 2WHKA 3TW6A 3LM7A 1GOKA 1A0DA 4H6EA 1YBQB 5LIWX 2D20A 1BSIA 3OGSA 4V1YA 2Y5EA 3WNNA 1ME9A 4YL2A 3ABXA 1Z41A 3ABQA 1TELA 3URAA 1Y5XA 3M0VA 1KFCA 1I2QA 2YXXA 4PUNA 3KW3A 3A64A 2PWGA 4OTKA 3TJXA 2GDQA 1ME7A 5F1VA 3VNJA 4DBEA 4DB7A 1OFBA 1BG9A 1HO1A 3GVGA 4Q7IA 1EZ2A 3GS6A 2A1YA 3P5YA 2J7FA 3KBMA 3A24A 2E7FA 4B4HA 2AKMA 4CKQA 3WD0A 2F6KA 5C0QA 3ZOAA 3CIVA 4DYKA 3TONA 2YX0A 2NQ9A 1S2UA 1JCYA 2J62A 3DC0A 3WUEA 3O8AA 4DNMA 3FDGA 3OODA 4UOJA 4L6HA 3G1VA 2V5KA 2XG9A 3PPCA 4Q8WA 1UASA 3QHMA 2BY1A 2VT0A 4NXKA 1DJXA 5FCZA 2XWDA 1ZHAA 4LW7A 4AYSA 3GXMA 3UJ2A 1GHSA 2GJNA 5I3IA 5FACA 1OM0A 1FOBA 4CU7A 2A3EA 5DN1A 3AXIA 5I23A 1A5SA 2C71A 3NO3A 5JMUA 3T0AA 3II1A 1QR7A 1W3JA 1QBAA 3QTPA 4L4LA 1XC6A 4UQAA 2KX9A 2UY4A 4IM4A 4ZEPA 3AHZA 1HTIA 3H24A 1NEYA 3LK6A 2XSXA 3M43A 5DXYA 3UU0A 3AS3A 2CLHA 1PBGA 4QM1A 1VAHA 5FAGA 1TMHA 5GJPA 1UR2A 4IH3A 1MXDA 3CIXA 3TE9A 1TKKA 3VOJA 2VZVA 3WDRA 1D3GA 4PMYA 4JNZA 1JZ2A 1FTXA 3LTPA 3T2QA 4LYQA 2ASHA 1W8SA 5BU6A 3R7MA 4GPNA 1CTNA 9XIMA 2A3HA 4RNIA 2FFCA 4B16A 4HHMA 1N7KA 1N8IA 4K39A 3E12A 4NAEA 1V08A 2BMBA 2VTFA 3PC0A 3IEBA 3C2FA 2VYOA 3QPYA 3OA3A 1R3YA 1P4CA 2XUCA 3IUIA 4UTFA 4F48A 3GVRA 1TMLA 4FEZA 4V2XA 3VUPA 5E0FA 1G4EA 3CQIA 4NILA 2JF7A 3LYEA 3CGTA 4FZIA 1UKOA 4CN4A 2BS9A 2D3NA 2FZ9A 4Z1CA 1L6YA 1AW2A 1OCBA 2DSWA 3BAYA 3C86A 2MNRA 2D2OA 1QMLA 4BWLA 3TR2A 4C1NB 4Q4PA 3F1QA 1ZJBA 2ZC8A 1EJ7L 4Q8UA 3L65A 1JIBA 6ENLA 2VEMA 1VGAA 3NM1A 1PZ3A 3D3FA 2CZEA 4W93A 5HUOA 3O6YX 3L2LA 3R2GA 4GOAA 3EPOA 1QW9A 3GC2A 1CLXA 1W0MA 3QR3A 3VKJA 4RK8A 3SCPA 1RY8A 3HB9A 4MDPA 2PPGA 3LD5A 3JW7A 1VS1A 1M7JA 2W66A 3ZR5A 4MJ4A 4KIEA 1XRTA 3SO7A 4LYPA 3R11A 5A8PA 2OZ8A 3GTHA 3GW3A 4UMAA 4E38A 3FN9A 4H6QA 1X6NA 3JRKA 1TWDA 1WDSA 4B3LA 4MJZA 1ZQ5A 3ZFHA 3QR1A 3W2LA 4LALA 3SFWA 1W9PA 4F0SA 2NX3A 4R85A 4UMCA 2RAGA 6ALDA 3LBOA 4MVAA 4D8LA 1WO2A 1R9ZA 2BZNA 4AY8A 4GZJA 1IYXA 1CDGA 4JHOA 2WLZA 3BJFA 3IJLA 4QE5A 1CXIA 2ZWYA 1TQXA 4IIBA 1TV2A 4DPQA 2PU0A 4AX7A 4KMQA 3WJWA 1P0NA 2VX5A 1WOBA 4LNYA 1NFPA 4Y9NA 3QPEA 4OOUA 3QZEA 5I03A 3E2SA 1NDWA 1MFUA 2CW6A 3R0KA 3GE7A 2A85A 3HZ3A 3DEQA 2IPWA 3QGAC 4RNFA 1LOLA 3IAQA 2OVLA 4GI6A 2XVPA 4M82A 6REQA 2WSYA 1VHCA 2GQ3A 4B92A 3GDTA 1H1YA 3GIPA 3CWNA 1G7VA 4BS0A 3VPLA 3AHYA 2ZKMX 3E49A 2YGYA 4KW2A 3VD7A 5CLWA 1RCXB 4WOQA 3BLEA 1Z8AA 1DBTA 2Y7FA 1KW1A 2QPXA 2XIQA 4O8RA 1XFBA 1ZPTA 1UBPC 3APTA 2X8RA 3KP0A 3S46A 3TJLA 5KZDA 3N11A 3CUFA 3GUGA 3W88A 3TMQA 5LXEA 3KOWA 5CZKA 1MZRA 3VZXA 3RO6A 3WLOA 1XYCA 4FOJA 3RCNA 2NUYA 2GWGA 3M7SA 4CD4A 2E77A 2ZE0A 3L0GA 4JIHA 1JDFA 5CQ1A 4YYFA 4IFKB 7TAAA 1ZAJA 3TN4A 2I1OA 1V93A 5K9DA 4P8UA 3GQYA 5D9NA 3TWBA 4N7QA 1Z32X 2QUVA 1E9YB 2XDFA 3E3HA 5A6LA 4W4QA 3N4AA 3DG6A 3C61A 4FSAA 2FHCA 4AY1A 2VGIA 4HNOA 1ISXA 3S3GA 1KA9F 4MTVA 1CB2A 2VVNA 4UXDA 3FAXA 4H1ZA 3ITVA 3G1YA 1V6WA 3GXIA 2GK1B 1GOOA 4AZHA 2CIPA 3GTNA 1WNOA 3TSBA 1F8MA 1OFOA 3L4TA 3NQ2A 1LRTA 1EYEA 1CIUA 3ZR4A 1Q63A 3ES8A 2OZTA 3S9YA 3UXAA 3UZJA 3BQ5A 3E6EA 3WLSA 5CSYA 4WY0F 2DZXA 3OZOA 2VNCA 4DM2A 3G77A 4TMBA 5E0CA 2YL6A 1AA1B 5LIUX 4Y9MA 1LROA 3G1AA 4A4AA 5G2IA 1UP3A 4B91A 1GZJA 1CX9A 1J4EA 5FJIA 2TPSA 5KZEA 3UPWA 4P7RA 4JTAA 5I78A 2YA2A 2R1KA 1QXLA 1LDCA 3RU6A 3G6MA 3D46A 1SGJA 4N6FA 4BF9A 1G7UA 2VELA 3QKEA 3STEA 2CYGA 3VOFA 5DRCA 4AIEA 2Z7KA 3AYRA 4HB7A 1TTIA 1VH7A 4C6LA 1PTGA 1O68A 2VC7A 4UCGA 3QEZA 3G18A 1PHWA 2DSUA 2I5QA 1XLHA 4J2PA 3UGVA 3LLFA 4I8YA 2WSRA 4MY8A 3S5ZA 4FR1A 3BJSA 3W25A 2AL2A 3GUWA 1XLGA 4L1GA 3TSDA 2WM1A 4CCZA 1ZRQA 3W83A 4JHZA 1UD4A 4GK8A 4FLRA 1U1JA 4LJ3A 3C0LA 4HQVA 1NH6A 3T8LA 4UMBA 2PBGA 1I2PA 1V3MA 4S3FA 2I9UA 3WFAA 4AISA 3O6DA 2DZAA 1QPQA 1U1HA 1PDYA 1F7BA 3CUIA 1DQUA 4MKSA 3ELFA 1B3WA 3OZMA 2WJDA 2Z2BA 3ZT6A 2J66A 1CGVA 4GO8A 5ABFB 2X1UA 5XINA 5I3JA 3NOYA 5CSUA 1NWRA 5JBDA 3VM7A 3R13A 4K8GA 2W63A 1PKMA 4S39A 1N8FA 1FHDA 3R79A 4XK2A 4CN6A 4X9SA 3PJTA 1W9UA 2Z0IA 3F5LA 1MNSA 2ZADA 3NNTA 3W9ZA 5DCEA 2CZFA 3GU2A 2HRWA 4IFRA 4LCQA 4S2BA 3A4WA 1UQZA 1YDYA 2Y7EA 1RJPA 4H8UA 1X7FA 4HPNA 2WOQA 2YL5A 3FXYA 1EH9A 2OEJA 3MB9A 3KL5A 4CQDA 1V7AA 2JKAA 3GAYA 4WJ8A 4B9ZA 3OBAA 2V68A 3RPDA 3QJAA 2FVLA 3M0ZA 1EBHA 1C91A 2FPYA 3WNLA 3KBJA 1OGBA 4KGLA 1VYSX 2QZRA 1A5AA 1KO0A 4PCNA 2HROA 3AWOA 1PCWA 3CH9A 2F84A 2BSLA 3H2FA 1JDCA 1BPLB 1MEIA 1W8GA 2IKHA 1HVQA 2IPGA 1T8QA 1HKJA 7A3HA 5I77A 4W5ZA 5K4ZA 3CLWA 4KS0A 1SZRA 3UVAA 3VNLA 1GZGA 3GAKA 1B3XA 3QTGA 3UG5A 1EYWA 3UBPC 3EX2A 4HSHA 5A6BA 3UNDA 1YX1A 2QT3A 3I7RA 1PE1A 5AZ0A 5F4SA 4C6IA 4E8GA 4Y90A 2CBUA 3FKKA 3M6DA 4CUCA 1UWUA 3SFKA 3LXAA 2HS8A 4PN2A 3AU6A 1J0HA 3WMCA 5CGTA 1AJZA 2X41A 2ZXDA 1IZKA 1J6PA 5DBUA 1XIMA 4LS2A 2YB4A 3E38A 1EC7A 3TJIA 1S5VA 1U22A 3RM9A 1IXQA 3MKCA 1QRQA 1O4UA 3GXFA 4PL1A 3RGTA 1W3NA 1OZQA 2OO0A 5DX7A 3IIOA 1L6SA 1QK2A 4OBTA 3EMZA 4HNVA 3M64A 3MVIA 5DCDA 1Q6DA 3TCSA 3TQKA 1L9WA 3DYPA 3L0NA 2YPIA 4GRSA 3BCJA 4HK6A 4QJ3B 1UPMB 4RR4A 3ECQA 4EF9A 4ZE4A 1O5RA 3SRKA 1K9TA 1NSJA 1XYLA 4AC1X 1SW3A 1RA5A 3W2KA 3G5EA 5D33A 3WO8A 4U2ZA 5D30A 1US0A 1EJXC 1OY0A 1LL4A 2ZRWA 3GSMA 2RUSA 4GGHA 4M7SA 2O9RA 1S5WA 3NVTA 5ABGA 1POJA 2C1GA 3E9AA 4WX2A 2V5BA 1I2OA 1DIOA 3LGEA 2BG5A 1AD1A 3UY8A 3B9NA 4B5UA 2W62A 2AMXA 4ZZ9A 1KV5A 3O16A 1V79A 4H9VA 1RBAA 1XR2A 2OQHA 3KL0A 5HUPA 1I6NA 1XXXA 4J2MA 5B80A 1A49A 3HV9A 1SFLA 1ZENA 4YXGA 5FL1A 1W17A 3C2RA 2OSWA 3SY1A 1OYCA 1KC7A 3GIYA 2PSNA 3ITXA 4TOQA 1KFKA 1XKYA 3TLLA 4QS6A 2PU1A 1B90A 1PKYA 5HWNA 3N19B 3O3RA 5AC5A 1B5TA 4F9DA 1W9VA 1C7SA 2WLYA 4IFOA 4DYEA 4RNJA 5FF7A 2GSJA 2CLKA 4J3WA 3W7NA 2PTZA 4AFYA 4L4OA 2FZBA 1WOAA 2D69A 2GVEA 2X1IA 3TN5A 1W1IE 3MTWA 1TREA 2C8NA 3PWAA 1E0WA 1OWQA 4MJMA 1DQWA 2QNEA 3KM8A 1MW3A 3MV01 1NF7A 2X30A 5T91A 5K2ZA 3ZZ1A 3W2UA 1J93A 2Y8UA 2A3LA 4UBPC 2WKJA 2PMQA 2BXYA 2CITA 1U5JA 4M24A 3WK3A 2WVTA 7ENLA 2CWXA 5EB8A 2D3LA 5CC6A 4UNKA 1ITUA 1QNOA 1UHVA 3I4EA 1K1DA 4MNJA 3ZWTA 4YJ5A 3M0YA 2R24A 1VCVA 3VKKA 3MDWA 4JKMA 2NXGA 5JBFA 1OHLA 1KBIA 1XL9A 3PNUA 2XM2A 4FF7A 3PWGA 4GFIA 4QDWA 2E6AA 1W5MA 1ODUA 2XYLA 3N25A 2C91A 3P81A 4DJEC 3I7QA 5E09A 4HOWA 1WKDA 3CWHA 3F4WA 3FW6A 3V18A 2BHUA 2XVKA 2DY3A 1IXOA 2C3ZA 1RD6A 4CEUC 4GIYA 5KTLA 3W29A 2D0GA 3VKDA 5HA7A 4YLWA 3JZEA 3KUMA 2ISSA 1P0DA 1OFDA 2F9RA 1F6YA 4MNLA 3WQ6A 2OWXA 4DXKA 4N42A 3PN8A 1E1FA 1S1PA 3E74A 4WKAA 5FEWA 2AAMA 1OK6A 3GG0A 3M46A 5M5DA 3SQSA 2VR4A 3EAUA 3UA3A 4RL3A 4NAEB 2B81A 1VPXA 1PX3A 3VKBA 4IMGA 4B3KA 3AXKA 1UZDA 1JGMA 2ALRA 3GDRA 3N6QA 5BYWA 4F3HA 2JBMA 1Y0EA 1C3FA 3BPWA 1L2QA 3V7PA 4A8IA 1Z7AA 3LBCA 1XV8A 4HYRA 1HZYA 3T42A 1HGYA 5MF5A 5F1UA 3CPGA 4H8NA 2OX1A 3VDCA 2PE4A 1FRBA 3H6OA 3UESA 1JYVA 4NQ1A 4NXSA 1PKNA 2H90A 1FY6A 3SJ3A 4Z2GA 5GJMA 3N4EA 4DUOA 4C5YA 3SRHA 4S1FA 4AHPA 1FWDC 4HYWA 1GORA 1DJGA 2Y5JA 2DT2A 3A4JA 1GTHA 1P6BA 4H04A 1LQAA 4BEQA 1PX8A 2VI0A 1UWAA 1EL3A 8RUCA 4LC6A 4BFAA 2X1RA 3ATYA 4DJEA 5CZTA 1JZ5A 1KM3A 2Z1XA 4Q4SA 2AOSA 2VXNA 1RHCA 5BU9A 2PLMA 3KTXA 4GC4A 1B31A 1ZZMA 4LY4A 1CXHA 2FB3A 2ZRZA 4XAGA 2OCZA 3RK8A 4I3GA 4GQBA 1RQHA 2D2JA 3M9YA 1E70M 1QDSA 2CHNA 4O50A 4O0ZA 2REQA 1W32A 3BW3A 3CL8A 1NDYA 4IQLA 3QY7A 3Q4DA 4PL2A 1SZEA 2YIHA 5C9UA 3S5NA 3RCMA 5A6TC 4CD8A 5LNSA 1TIMA 3SCNA 2PA6A 1FKWA 2PGRA 2ZC1A 3GVWA 3ZMRA 3GFYA 5D9OA 5AHNA 3HQNA 3N1AA 2QQ6A 3R8RA 2NSOA 4HU8A 4RZ5A 2I16A 3C0JA 4HYVA 1NFBA 3UPBA 2UY5A 3TJ4A 3WLLA 1TV8A 3GW0A 2Q8LA 3SM0A 1WKYA 2CHOA 2PD9A 1R30A 2NT0A 3VKCA 2WMFA 3P8JA 4MGGA 4MHBA 2OEKA 3NIYA 1XSIA 2OR2A 4RZ6A 3PBMA 1FWTA 3WDHA 4K37A 2V9DA 4WY0B 3PUDA 3CT2A 3TZFA 3SUWA 3PB0A 4GY1A 4L4PA 3NR0A 3HU7A 4L65A 1RCOB 1F6KA 4V33A 4GC3A 1E51A 2X7WA 3PBUA 1YPIA 1HXJA 4Q4QA 2E25A 3WJZA 4AWSA 1XYZA 1VQTA 3AJXA 3B3DA 3URNA 3NA8A 3QW3A 1RCQA 2G0WA 1IZJA 2G37A 4RW5A 1V02A 2FGBA 4GY7A 4C6DA 1SPQA 2YXOA 2PTXA 2VEPA 5BOEA 4A22A 4Q22A 2GJXA 4JTEA 3R89A 3VDBA 2IPJA 2QW5A 4HSOA 1CXKA 3W02A 3U0HA 1H60A 4H41A 2QGYA 4FF5A 1UYQA 3FVMA 1FHVA 4LXFA 2J79A 4GQRA 3PAOA 5I3DA 1KR0A 1H7RA 1W1B1 1K8YA 3WQFA 3FEQA 4JTLA 4AY7A 1XHGA 1LCOA 1XIDA 1NF0A 4I9JA 1X6LA 3DFHA 4M81A 2FZNA 4HA3A 1W54A 2HDJA 1K9FA 5J5DA 4QJ5B 4Q7BA 1W1VA 3KHDA 3QFWA 1Q7QA 3ZXWA 2FDSA 4E4UA 4JNMA 2Z6IA 1SR0A 5A6AA 1P0BA 2IUZA 2AQOA 4D6HA 4JFTA 2PF8A 4NJIA 4L9XA 2Y88A 1JCNA 4KFNA 1SFTA 2Y70A 4FIRA 1DJIA 2VQTA 3K8LA 5G1MA 5SWUA 3KVMA 3NQDA 3LA4A 3V75A 4M6VA 4RLIA 1FDYA 4K38A 1J0IA 2NZLA 4JFWA 4DWSD 3VNYA 5CPTA 1F61A 2YCEA 3GU1A 1Q13A 1WDQA 3W72A 3N2MA 3FLUA 4DRSA 2W9MA 4IMAA 4M5PA 3KTCA 1N82A 3IACA 4OV4A 1PKLA 4QP0A 1R85A 1V51A 2DZTA 4TV5A 3RCYA 4XIMA 2A79A 2WVSA 4WGHA 2FFIA 1D2KA 4GABA 1YQ2A 1K03A 1R38A 1W5PA 1JPKA 1QPRA 2D1ZA 1S2WA 4RE3A 2CBJA 2QCMA 2AL2B 3JU2A 4LB3A 1FWSA 1XG3A 4HHPA 3BCFA 1OSEA 4DJFD 3VIFA 3DFOA 2RDTA 4UQBA 5A2CA 1MQRA 4KGJA 3DFYA 2E5DA 4O52A 4PTMA 4YTSA 4P61A 2X16A 4BCEA 3L2MA 4IMCA 3PG9A 3U2EA 1A3WA 1EOMA 4JKLA 3K46A 1HUVA 5LHEA 2PAJA 3ARZA 1E73M 4GHRA 3BV4A 8CGTA 3WQCA 3WH7A 3WBWA 1BTMA 4A21A 2YDRA 1QI5A 3DG3A 4DBWA 1DXFA 3UW6A 1XC4A 1JUBA 1KFBA 1B4EA 1DHKA 1RSCA 4TQTA 4NNBA 4Q8TA 3K30A 2OZ0A 3EOUA 4E8CA 3EA3A 2C7FA 2Q3RA 4HMEA 3SY5A 1V77A 5HQLA 4AHQA 2DH2A 3CBWA 2BBFA 3BJTA 3D5HA 3HMCA 4QROA 3TU9A 4OECA 2OLAA 4C5ZA 2NQJA 3MHGA 4JIQA 1PWLA 4PUEA 3BGAA 2BOGX 4KEMA 1Y5WA 4Z2HA 4K2SA 1AZ2A 1E15A 3LSCA 3P82A 2EG6A 3PZGA 2ZIDA 3QQWA 2GDVA 4DAIA 3FVDA 3WX7A 3W7GA 4DZ5A 3AIRA 1PVNA 3N4FA 2QYGA 3GVQA 4TV6A 1THFD 2Z25A 1ITXA 4BK9A 5ENLA 1TV5A 4XO6A 3V1PA 3S2CA 4FNUA 3W81A 2YFNA 2BB0A 3IANA 3W1RA 4HA1A 3HPXA 3H26A 3ABSA 3N2XA 4KCWA 5CSSA 1PTDA 4EK7A 2PRLA 1LF1A 4ZODA 1GYMA 1VR6A 3TROA 1DV7A 3R94A 1JNEA 5G2WA 4G9PA 2INFA 3P84A 2OKTA 4NRSA 1SMAA 1HT6A 1W9BM 4LAMA 4K7YA 1RP9A 1Q4NX 1SJBA 3NO1A 4I5RA 4PULA 3RM8A 1LG1A 4NI3A 1GG0A 5JH1A 1GNXA 4HHHA 5CCZA 2ZX6A 3H53A 5D2WA 3HTWA 1VKFA 1NARA 2IKGA 1TYGA 3ZJ7A 2EQDA 4ZFMA 2DT3A 4E0CA 4QG9A 1Q66A 6A3HA 3NQ8A 5HMSA 5D8ZA 1XLEA 3URQA 4CCDA 3ABRA 2VZSA 3TYBA 2DH3A 3U7VA 3GNNA 2PEVA 3QYSA 1VIZA 3BANA 1KXHA 2OPJA 1PIIA 4X0NA 3ISIX 4R88A 4LSBA 4C60A 1M7OA 4O53A 3FA3A 1Q6RA 2V3FA 2WZMA 1MXSA 3WLHA 5TIMA 4HBKA 1Q6QA 3L4XA 4M1BA 3WD4A 1D3CA 3AU2A 1QK0A 2VR2A 4YWSA 3THUA 4MLRA 1H0IA 4XUGA 1ZP4A 5IDZA 3QLLA 1LWIA 1I1XA 4HZ7A 4PH6A 1JCLA 3TC3A 1S38A 4WSKA 2XVGA 2PF0A 3CO4A 3UXDA 5C5YA 3AOFA 5HPCA 4V15A 1V3IA 3RUBL 3MYPA 3S47A 4IIFA 3W07A 4W86A 1EP2A 3QHOA 1B9BA 2A7NA 1PYMA 3UP8A 2QVHA 3MU7A 4NAFA 4PTNA 2VX4A 2PRMA 2XHYA 3FA5A 5CKSA 1TPUA 2J78A 3WF0A 2XIIA 1DL3A 3HGRA 1W31A 3IGUA 3FJNA 1J18A 1E5NA 2PLCA 2WCGA 2QS8A 2QAFA 2V67A 1G5AA 4LVBA 3NFUA 4J3XA 3L5MA 3MO7A 5D8WA 3ONBA 1UR3M 3M0MA 3H21A 4HT3A 4ZO8A 3A5FA 3U4AA 1B57A 1WDPA 1XLDA 1LRQA 2F6XA 1VYPX 2FMOA 3LMZA 1CLKA 3UWWA 3CZKA 1JPDX 2OGJA 1C8YA 3NGJA 4GKTA 3PB2A 4L6OA 2Z1WA 4W87A 2PTWA 2WHLA 5FAJA 3ZLHA 5TQLA 3MUY1 3GNDA 3NVDA 4LWWA 1QUMA 1NELA 1M01A 1ZBVA 3CTLA 2ZVRA 2QIWA 4DUVA 5HQMA 3SZ8A 3KRUA 3FAWA 3WZ0E 1W3TA 3VU2A 3K5XA 2E67A 4W7WA 3WFZA 2PS2A 1R46A 3S2MA 1V4YA 2F2HA 4GYJA 2XIBA 3F7JA 4JICA 1FUYA 4DZIA 3SJNA 5BOOA 1TVNA 4JPGA 4KEZA 3SSZA 2PODA 2OTDA 4CD7A 5A8QA 1BYAA 2RJHA 1OGGA 4QR6A 2CETA 3MMDA 1VLIA 1I45A 1K02A 2ISFA 1O95A 2G96A 1N2VA 1JF5A 2JF6A 2IXVA 4UTWC 4NP7A 1JGIA 3SECA 1EJSC 3GG1A 5LA2A 1R7AA 5XIAA 3S6OA 1GPFA 2PUZA 1XSJA 2JGQA 3W1NA 1L0PA 3VNMA 2ZUWA 3CUJA 2CLEA 1EIBA 5FJRA 1RBOB 1XDLA 2YDAA 1QI4A 1L6FA 3MUCA 4UR7A 2UY3A 5CG0A 2WKLA 3GTXA 3P74A 4WGXA 2ZE3A 4AIUA 3MSRA 4JR5A 4IGNA 3GTIA 4A3HA 1I2RA 2CEQA 1KXVA 2WANA 2I5IA 2C15A 4ZMGA 4FX6M 4GO9A 3F2DA 3M0XA 1LP6A 4CQAA 2XINA 3EKLA 1YNPA 2DPEA 4LUIA 3OHMB 4ZOCA 5ABEA 1NP2A 3ITTA 1QOXA 1MEWA 1QWGA 1TRIA 4MB1A 3LGGA 3UXIA 3BLDA 5DRIA 3W87A 4ACYA 2I17A 3TTSA 1ZLPA 2WZEA 3PTDA 4I9TA 3MT1A 2NVDA 1EDGA 2PTDA 4GISA 1GK8A 1GVFA 5BRQA 4MY9A 4KPLA 3VMPA 4FLSA 4LRTA 1XKJA 3THDA 5BRPA 5AHMA 3W7LA 2G4FA 4HSNA 5DBTA 3SURA 4XSMA 3VIKA 2FJKA 2PB1A 3BURA 4LCSA 5LZLA 3LNMA 4QSHA 4UQEA 3MKKA 1OD8A 4KF1A 1ZJHA 2CHRA 3A6OA 1F6PA 1BXCA 3WEMA 2CBVA 6TIMA 3WN6A 1JEZA 3CZ8A 2D2HA 1GEQA 4M1RA 1NWSA 1TWIA 1QW7A 1KRAC 3GXNA 4ZGYA 1US2A 2RGLA 1GQJA 2V82A 4YTUA 2C18A 1RUSA 1DJHA 1WXYA 1I0DA 5G4WA 4UTWA 1EF2A 3OOQA 4W8BA 3B9OA 1KQYA 1OCNA 2QDDA 1XYBA 3LV5A 5REQA 2VC9A 2FH6A 3G0XA 1ME8A 3TKFA 2CLOA 2PZ0A 3BLFA 1A5BA 2Z26A 3U5YA 2DGAA 3PK7A 1FH9A 3N2BA 1TRDA 3U8GA 2Z1VA 1GTEA 4BHYA 4HTYA 4IXXA 3NYZA 2JE8A 4QE1A 1W1ZA 1UW9A 3FIGA 3VD5A 2CNCA 2REQB 3QRHA 2XM1A 1HP4A 4EAMA 4N9DA 1Q6GA 2X0HA 4Q6XA 1TA3A 3QH2A 2ZUUA 3GB6A 4F2TA 4I5XA 1EQPA 3NPWA 2IS7A 4MB4A 3BLOA 2V3DA 3UJEA 1QI2A 1UCWA 3QV8A 3BW4A 1S46A 1VBUA 4XTIA 3R8HA 1R3VA 4ZSTA 4C6MA 1JUKA 5H6HA 2XZ7A 2PP1A 3BTNA 3Q45A 3IAPA 5CPMA 3CEUA 5HAOA 3I6TA 2A3BA 4HKPA 4Z0JA 2ODOA 3M5XA 1E6ZA 4IIGA 1O12A 1M1BA 4JTUA 4PUKA 3SN0A 1FWEC 5TAOA 3DBPA 1EX1A 3LEPA 3U4FA 4XTDA 4U10A 5HPOA 3EMCA 4FXFA 1POKA 3AXMA 3CUZA 3OVPA 4PMVA 2B7OA 5F2IA 5AHEA 3IJ9A 2QULA 3G2GA 3NQVA 3GKFA 1J12A 1UUQA 4H9ZA 4FLOA 4ACZB 4KRTA 3SQLA 1GVIA 3LRLA 4JTJA 4N02A 3CU2A 1IGSA 1YBQA 3W23A 2OB3A 3VMOA 4R9XA 3CMJA 3M4HA 2BXVA 4NG3A 3LERA 5F4XA 2E3ZA 4ZTYA 3SSJA 5CBIA 3UEQA 2YYTA 3RX4A 5DMNA 2QF8A 2Y63A 2BVTA 4UZSA 3L0KA 2C6QA 3QBUA 3M1ZA 4MFDA 1XLBA 1A5UA 1DXIA 1QOPA 3BAJA 3O6AA 4JEJA 3NQGA 4XZBA 4UTJA 2E5BA 2GJXB 4C6KA 1AMYA 1Z69A 3FOKA 4OT7A 2XVLA 3WMBA 3B4YA 4EP8C 1E9LA 4ECLA 3QN3A 1V0MA 4AEFA 2Y89A 4WJEA 1W6TA 4EE9A 1FWNA 3KVKA 2E09A 1EKOA 3DC8A 4KIRA 4UTLA 4GYPC 3WFLA 2HSAA 2BXZA 3KOZA 4RW3A 1W1TA 3QMRA 4YYCA 3VX0A 1BVNP 2YDSA 2GL5A 1U5VA 2HK0A 4CVWA 2P5NA 2W5FA 5LXXA 3BSMA 2ZZ1A 1E1CA 3WL0A 1VEOA 3HG4A 1UH3A 4HU0A 1S1RA 2DZWA 1D8CA 4PB4A 4S38A 1CXFA 4KRZA 3N12A 3HV8A 3OLEA 4I8DA 4J7RA 4AC7C 5JH2A 1FCVA 4PBGA 1F73A 3IJDA 3TSMA 1K9EA 3RX2A 2CLIA 1BEUA 2PC4A 1JULA 3B0XA 2V2HA 4WHBA 2CKRA 1FH8A 1TPH1 1VHNA 1XINA 3RFAA 3SN1A 3O0FA 3QC0A 3WH9A 1UKSA 4R5EA 2J8FA 1UBSA 3ONCA 4LVDA 3NPVA 4H19A 1JFHA 4ORIA 3MBFA 1TVLA 5FOOA 4Y6GA 2W0UA 3WK1A 3ZM8A 3ARYA 2Q02A 3Q2DA 1SMDA 3A21A 3NURA 2C16A 1KWKA 1Y5VA 3MZNA 3GYCA 2H9AA 5CZ0A 4GBUA 4C1KA 3O63A 3LPOA 3BLKA 4WSHA 3VOHA 2PLKA 4DF0A 1TPVA 1YE6A 4GMEA 1LOQA 2BLEA 1JRBA 4WQ6A 3BSGA 3FX4A 4A3QA 2QCHA 4CQCA 1WBJA 5FESA 1EGZA 4KWSA 3N6JA 5IRPA 3ABZA 4GXWA 1F74A 7CGTA 1XCWA 1HJUA 3N73A 3NPUA 2XGZA 2ACRA 5F4WA 3I10A 4CGTA 2ZUVA 4AW7A 4Q4MA 3R0UA 4M6PA 5T8GA 1FWIC 1ECQA 3MUIA 4U2YA 3VD3A 5HWMA 4YHGA 1YRRA 2V0TA 4LV9A 3CPUA 3WF4A 3V4BA 1QTWA 3ZSSA 4TTGA 3R43A 4GQGA 1XIFA 3LHYA 2NSXA 4ROPA 5GPRA 1NIUA 4H8HA 3V1HA 4LY8A 3DOPA 4Z1YA 1H51A 9CGTA 3EOSA 4NZ3A 4XBJA 3NZ1A 4YCPA 2PWVA 3PZTA 3QF0A 3PBVA 4R7WA 2OSXA 1RALA 2VQUA 3GG7A 5HJLA 2QUUA 2DUXA 1UR1A 4REQA 3VIHA 1R6WA 3BAWA 9XIAA 4NJHA 5FI8A 1WX0A 3E2VA 4ZQOA 3QXBA 3WLNA 3IJ8A 2EGZA 4GXMA 4DWSC 4ML9A 4LF2A 1Z89A 3F5JA 3KCLA 1XBYA 1OIFA 1RQBA 3ITYA 3AMCA 1DWIM 3NZQA 4JQ4A 4PFMA 4I6VA 4L4MA 3M7WA 2NWSA 4G2DA 3MI2A 1MWOA 3Q94A 4JY9A 1UROA 2XU2A 2QUTA 1GPWA 4DIAA 1ZAHA 2IQDA 3AXHA 2BWGA 4AZGA 1NJJA 1LOSA 1F07A 2GSHA 3DXIA 1REQA 1ZJIA 2YOCA 1KKRA 3L66A 2QCCA 4HK5A 3AZRA 2ABAA 3IVUA 1OFAA 3TOPA 4D71A 3CHFA 1RQEA 1RD5A 3G1FA 1NQKA 4B5SA 3IUHA 4HZMA 3W7QA 1HKMA 4ICMA 4L7ZA 2ZCGA 4ZQRA 1E0UA 2XWEA 3AISA 2VCCA 4LV4A 1OCQA 4P5UA 1MDRA 4W8AA 4F9JA 3T05A 2PDLA 1FKXA 1XGEA 3W7MA 2F2KA 3EB2A 1SU5A 2A6NA 1JZ7A 2Y4SA 3I3DA 4JYFA 2WHMA 2PD5A 1LQ0A 5K9CA 2W3ZA 4JN7A 4OZOA 3LZ3A 3UT0A 2QAPA 1IZCA 2YYUA 5BWFA 3RXZA 4PZVA 5FF4A 5A6BD 1B9ZA 4XZIA 2DZPA 2Z24A 4IFKA 4DWSA 4UOQA 2EF9A 1GQIA 4WSJA 4QLLA 4V1XA 1YW1A 2QUNA 3T9PA 5CH9A 1BSLA 4WEVX 1GWJA 1EFZA 4EF8A 4QCFA 1UWSA 1H2JA 4QQ3A 3LHWA 2XGIA 3WLIA 1O94A 3N17A 2DZBA 4WD0A 4YNGA 2G3IA 5EKYA 2C79A 3GHSA 5CLTA 3T07A 2I56A 3GC4A 2VO5A 3CYVA 3A23A 2VGGA 4DEFA 4IP7A 3CO8A 2TYSA 3LI0A 4A2SA 4QLJA 4R34A 4NAFB 1XWYA 1K7FA 2YA1A 3H22A 3TQVA 2H8XA 3QMTA 4PUUA 3HURA 4RDYA 1KCLA 2GVLA 3GU9A 3PFRA 1RBLA 4H4IA 3FKRA 2HCVA 1AFSA 1FX6A 4IJCA 2VFEA 2UBPC 4DJFA 3NQMA 3KZPA 4GUJA 2YBTA 3KE0A 4U5IA 1ZB5A 5IM51 4ZO9A 1IT0A 1RJRA 3BW2A 2O7QA 3MDUA 4I7WA 1LYXA 2XIOA 3KOYA 4QG6A 4LVGA 1IT8A 3WJXA 1UMYA 3M5VA 1H5VA 4RZBA 1ALDA 1FWJC 4EVZA 3M0JA 5GVJA 4JL1A 3E1F1 4JZ5A 4AQLA 5FEXA 1UC4A 4TVDA 1QCWA 3O15A 1JDEA 3IVSA 1XUUA 3S1VA 3GHUA 3E02A 1W5OA 3WKZA 3HPZA 3AXXA 1XRSA 3TYEA 4TIMA 3WQGA 3ZIZA 5ECUA 3NL3A 4A8RA 2J9XA 3AYVA 3U48A 5JUVA 3UQNA 2QXWA 3QSTA 4O10A 1FWBC 3S4TA 5DQPA 5A95A 4J3SA 2CESA 5I6SA 4D1JA 3VGFA 2D0FA 5KITA 3LQGA 1JF6A 3MYOA 3JS3A 4EACA 4UFJA 2PDBA 1XDJA 5FJOA 5C7HA 4WJXA 4IL2A 3LX9A 1OGSA 1OCJA 4Z17A 1Q5MA 4PSPA 3EX6A 5CPSA 2GJLA 5LKYA 4HCLA 4RPQA 4E4PA 2VFHA 3L7RA 4HNUA 3MMWA 1E71M 1HNYA 3HFYA 1FA2A 1AL8A 3APGA 1KFWA 1RVKA 4NL1A 3BUVA 1WKEA 1U5HA 3OQEA 4ZL1A 3MC5A 3LSBA 5EGRA 3F4NA 4C6JA 4RX0A 4C6NA 4XAPA 5DCBA 4NJKA 2JEPA 1U30A 2CLFA 2V38A 2A2IA 4GUGA 1I8JA 1F05A 1W2VA 2ZDRA 2CCRA 1GW9A 3DZ1A 4KCTA 5DT5A 1S3HA 5DMLA 4O1DA 1H0GA 2Q8ZA 1GW1A 3OVGA 4NZ1A 2H8ZA 1WXJA 1RJQA 3W1XA 5M1TA 4DO4A 5H8MA 2BX7A 4US5A 2GUUA 2WNQA 1NWTA 1P6WA 3K1GA 3F4CA 3SB0A 3AMDA 3G8EA 3LENA 1JYXA 1F3TA 3D47A 1IXNA 3ZLFA 2J9ZA 3G1XA 2VRKA 3WLTA 4HMCA 2HVNA 1TJPA 3R4IA 3H70A 2J47A 1H7PA 4JX5A 3V5FA 3VKAA 5CAHA 4JNYA 4AAJA 5AB3A 5L9FA 1U2YA 7ODCA 4XUYA 5REQB 2ZYFA 3VIGA 1MZHA 2ALDA 4CNOA 3VK5A 1KTCA 3BGGA 1EJTC 2VFFA 3TIMA 3WBEA 1QNVA 5HQEA 1MYRA 3KEHA 4W9TA 4N4QA 2FPTA 2BOFX 1EDTA 1GJPA 4DXXA 1ISYA 2CZ5A 4JTQA 3JR2A 4GX9A 1UKTA 1OYAA 3MKVA 1IIHA 2BVYA 4PR4A 5BXSA 1W56A 3AIQA 2QF7A 3U7BA 4ZFCA 4ZB5A 1WAWA 1XYAA 1YEYA 1L8NA 4IQDA 4Y9PA 1TZZA 1F4AA 6PTDA 2WSQA 1UR0A 2WBGA 4R27A 3VFCA 2CKSA 3XIMA 5KEZA 1QI3A 2ZTKA 3NPXA 3V0UA 3KRBA 2R1NA 4EWND 3W7RA 1TG7A 3W38A 1UOKA 1W3IA 3H2EA 3UXLA 1E72M 3DYMA 4R53A 2GDUA 2POZA 2CZDA 3CV2A 4Q4RA 3TP4A 1XD0A 1YTDA 4Q4KA 4HGXA 1Q6FA 3SGZA 5HOSA 2CFFA 1E40A 3V35A 2ZZ5A 4X3ZA 4DJED 3CQKA 1OF8A 3O06A 3PZOA 4D6JA 1C90A 3KVJA 4MZ1A 4NZ4A 4MB5A 1UH4A 4ERGA 3EWBX 1FHUA 1BQCA 4QNWA 3W7JA 4RKAA 4O4VA 3PPFA 4MMWA 1D8WA 3FSTA 3JVAA 3L5AA 5M3WA 1SJCA 2PRHA 2Y8KA 3G0UA 4LEFA 3I3EA 4AD1A 4NI8A 4ZB0A 1K8CA 4GGBA 4W84A 3LTYA 2E1WA 4I9AA 4JFUA 3RILA 3THAA 3W28A 1F3XA 1QO2A 5LSMA 3M0HA 1GEHA 2SFPA 4IG2A 2DSKA 3PZ9A 4H9TA 2B4GA 3IPWA 3K8MA 3TX9A 3OGVA 4M80A 4NRRA 4H9XA 4IP4A 5FJUA 1G0CA 3ITOA 3C0SA 2QHAA 1VFHA 2YDQA 1UD5A 3HO8A 2VC5A 5RUBA 2XFYA 1XM3A 2VGFA 3EXRA 1OC5A 2IQTA 3DIPA 4DBUA 4ZTXA 1KLZA 4C65A 3CAKA 5T9CE 1KM6A 4PMUA 2NWRA 3ZT7A 2DV0A 3NQ7A 5AHIA 3I65A 1X8CA 4NUWA 4O11A 1XH0A 3PG8A 3L9CA 3U57A 2J7DA 4FHAA 5C8BB 1UZ4A 3PPHA 2VOTA 3SGGA 4MB3A 4N9CA 1GOXA 1I9CB 4LAOA 1WYIA 5D38A 3RHGA 4LBRA 2NV9A 2WBKA 2YCLA 3V0TA 5JVLA 1F9CA 5BMXA 5A5WA 3F2BA 1FP9A 1YKWA 1JZ6A 3BSHA 4IOTA 1EF3A 3E2QA 1TZ9A 2AGKA 1E1CB 1E1EA 4LEQA 3TXZA 4M7TA 4H9MA 5LIKX 3ID7A 2WNWA 3FJ4A 4ERAA 1E4LA 3IIVA 3EXTA 3S5SA 2GGEA 3G24A 5BROA 1B3ZA 4XZNX 3R25A 4Z2LA 4BJHA 3AS0A 5C9ZA 3B0VC 1LBFA 1XX1A 1TCMA 2FTWA 2ICSA 3H54A 3PZIA 2J6VA 3PP7A 3A9IA 2R8WA 1V0LA 3TAOA 1DE6A 4POCA 4O0QA 5H91A 4QEEA 3B03A 1EJVC 3U2ZA 3OJGA 1TPC1 1OX4A 4Y8FA 3RRAA 1EWDA 5IHRA 1G6CA 2WZHA 4QG8A 3AC0A 2FJUB 1R2RA 3GYEA 2HE5A 3N3TA 3KP1A 3ORWA 4UFLA 2OMAA 2NW0A 2OZ3A 2DEPA 4JFVA 3L67A 1KB3A 4ZXLA 3M5YA 1XH2A 3AAMA 3ERPA 2RH9A 4RJEA 1ZL1A 1PEZA 2H9AB 2TMDA 1C92A 1V8EA 1ZJAA 4MZ8A 4B2DD 3OZPA 2J74A 2VEKA 1GUVA 5A69A 3SEPA 3OYZA 1KGUA 3ITLA 2Z1KA 4AG0A 5E9AA 1HQTA 4H00A 4F8XA 4C6EA 1AK5A 2X40A 1K8ZA 2EJ1A 4UOZA 1FBAA 2G41A 3WQ4A 4HJWA 2VWSA 1WUFA 3ZWSA 3GIQA 3EBVA 2GFTA 3VC6A 1M5WA 1W1A1 4AXKA 3L4YA 3TDFA 3DHFA 2YL8A 2OQYA 5G1YA 5CZJA 2W61A 5LIXX 4H83A 4LRSA 3FS2A 2H3DA 3N9KA 3EWWA 1NOFA 3FGCB 4V28A 5K7JA 4MFEA 4MAVA 1OK4A 3AMLA 4MDOA 1TPB1 1M68A 4DZAA 2YXGA 3LGDA 3SCVA 4H7ZA 1HO4A 3QY8A 4DJDD 5AN7A 4AYGA 4HHLA 1DIDA 4R7OA 4C7GA 4UTIA 1QASA 4UB9A 3DERA 4MKNA 1I0BA 3HOJA 2W67A 4IQEA 3TYAA 1SJDA 2E4TA 2FVMA 3M0LA 4UFHA 4PC8A 4G7EA 2G97A 2XSAA 1OVDA 3U5UA 4OIFA 3OG3A 4JCLA 2NQLA 4IIHA 3F4DA 2J8TA 3T78A 4REQB 2ZFAA 1D3HA 2RKXA 1MI3A 2G4JA 1VFFA 3W1PA 2DQXA 3RRXA 1ITCA 3EXSA 3MW7A 3BGJA 4PTDA 3TYDA 4C6FA 1E6XM 4YTTA 2HZGA 4MKVA 4EKJA 1IR1A 3TVAA 3WL1A 1E0XA 3W76A 3NEVA 4RCXA 1KTNA 3R10A 3MWAA 4QAWA 5H2ZA 1W91A 3VD4A 2V5CA 2QCDA 4XZWA 5LGXA 3S0CA 6XIMA 1E9ZB 4G8TA 1RP8A 3O6CA 8XIMA 2A0NA 1C93A 4LS1A 4EOUA 3UZWA 2YL9A 1FWRA 2JALA 1OFQA 4C6OA 2IPFA 2VX7A 2IW0A 3VDHA 3SR7A 2XJ7A 1REQB 4GBDA 4KWWA 1W5NA 2AGTA 4IPPA 3AYSA 2VEFA 2ZA2A 5AYIA 1RPKA 2QCLA 3FXGA 3MCOA 1TQJA 1BRLA 2QDEA 3DN5A 4C6QA 2BP1A 3C2EA 4ATWA 4M51A 3WJSA 2ZA1A 4XZ9A 1S5NA 1E4MM 3W75A 4WY0A 3ITCA 4UIOA 2J25A 3WBYA 2Z4GA 2VUNA 3GR7A 2B7QA 5EBUA 4DN1A 5HDRA 1KXTA 2G3JA 3IV8A 4CQ9A 2JFEX 2IQ0A 3LM3A 5A6MA 4EPEC 2EHHA 2OT1A 4N4PA 2HE8A 3SGUA 2IKJA 3AS2A 2GLKA 4O1CA 2NLIA 3B8TA 1H61A 2FKPA 2RDXA 4IPJA 4AD3A 2VD9A 3WH6A 1ZBCA 1GQKA 1KRCC 4DWSB 4NX0A 4IXHA 3FNDA 4GQ0A 3WUFA 4XZLX 4XD5A 2PGEA 4AWEA 3UR8A 5CEWA 3OEXA 5LIYX 3C8NA 4GH1A 2O4QA 3U3HA 3GY1A 3MP4A 2BVWA 3HIJA 4GA8A 3USBA 1HJVA 3GDLA 2E28A 4L1WA 3WH8A 1TV7A 3IGHX 5I02A 4L9ZA 2YJQA 3DG7A 1GKRA 3LPGA 4QE4A 1BVWA 3HN3A 1MNZA 3BAXA 3WELA 4CCCA 4ZVJA 1KV8A 4DVOA 3MI6A 4GNKB 2WZTA 1VFSA 4PUJA 3G1RA 1KBBA 1J01A 3LDVA 1H63A 4H8VA 4HNNA 2XH7A 3TN3A 1UP2A 3P0XA 1OFRA 3C4UA 3SCTA 1G4TA 1ZY9A 1R9XA 4MUPA 4MZYA 3UCDA 1PPIA 5JXQA 3N13A 2ZBTA 5AYXA 4JD4A 1YTKA 1PS9A 1WPCA 4EXAA 1PZ1A 5G1TA 3UCCA 2I9EA 4INFA 2DIEA 5EBAA 2DP3A 3T4CA 3NAVA 4DX3A 1TV4A 3W7DA 1ELSA 2UWFA 4J35A 7REQA 3H4GA 4JDYA 2QVNA 3ZJ6A 1HL9A 3POHA 3VIPA 4I90A 3FYPA 4UTUA 5AFDA 1PAMA 3QKZA 5DT7A 4Q8QA 4B5VA 4U31A 2CZVA 4FNQA 4IGHA 5EYWA 2IMRA 2Z27A 2NLYA 1ONXA 1WDWA 2I5GA 4U3CA 1ZALA 5CGMA 2J77A 3G1SA 2G50A 2NQZA 3CV6A 3VOGA 5HR7A 4B4FA 1SFSA 2P0OA 4TVCA 4LUSA 2WNZA 1RPXA 4WOZA 4AZCB 1AQHA 1KRBC 1VJIA 2TSYA 2OJPA 2PCEA 5BXRA 1HW6A 3UFYA 1JYWA 1J2WA 1VLWA 2VMFA 1DOSA 1B3VA 3VO0A 3NJ3A 3R5EA 3PBGA 1VJZA 1UD2A 4IP5A 4QLKA 3B9EA 3B8WA 3E96A 1XLJA 3WLJA 2QJIA 2YCKX 4X63A 1NU5A 4QBXA 1JCMP 4W7VA 4LNCA 3W73A 4HA4A 1V3HA 2ZVIA 3MMTA 1AD4A 3T09A 4QSFA 4TO8A 2Q01A 4GVHA 1AL7A 4OU1A 3TTEA 1VPYA 2V8ZA 3LZ5A 2R94A 3P67A 4HZ6A 1AJ0A 3TAKA 2FH8A 1EPXA 1GVEA 3GXTA 3WMLA 1Z3NA 2IXUA 2Y62A 4MJ2A 1AODA 1M7PA 4JTDA 2VOMA 1HKKA 2J7CA 3LV6A 3AHVA 4OFCA 3CUGA 3DYOA 3WY1A 4X22A 3DFNA 2HPIA 1X98A 3C3UA 4MYXA 2JEQA 3KHJA 3VZZA 5JBEA 4GIEA 1Q6CA 5CXPA 4AD2A 3KZSA 1SW0A 4UFKA 2QJNA 3K4WA 1J5SA 3LMYA 3DESA 3RITA 4IGMA 3GBDA 2DUZA 4QJ4B 1ML1A 3LN3A 4UQ9A 2Z2AA 4C7DA 3SQMA 1Q4WA 3KLLA 2R1PA 4ROQA 2VWTA 3UG3A 3WNMA 1TPFA 4D6DA 1IE7C 1EP1A 4JXCA 4QEHA 3SCWA 5FEZA 4F0LA 3B8DA 3UWQA 2C0AA 3MSYA 4KFPA 3VX1A 1VB9A 1VFUA 1FWHC 1CGYA 1E9IA 3LU2A 5C7VA 4AVOA 4FA3A 1KTBA 1X97A 3UG4A 2Y61A 4ZOAA 3LCIA 3LLDA 4IZGA 2OSYA 3DECA 3GH5A 2F38A 3PNZA 3IIZA 1E0VA 1H1ZA 1RVGA 1VJSA 5L6UA 1JI1A 1OFPA 2XN1A 3LLXA 4XSLA 2OQLA 2OYKA 2ACQA 1EXBA 1ZBKA 2ZZ6A 3D3AA 4D6CA 3M47A 5I3FA 1LLOA 1NFGA 3VCNA 4JN8A 3AIWA 3SIMA 3AUOA 2XFWA 5EMKA 1LT8A 1K70A 2Y7GA 4F2UA 1PV8A 4P2VA 2MANA 5KZ6A 4FPSA 1GONA 3RR1A 1PZ0A 3O1NA 1TX0A 3N9RA 4XAZA 4Z42C 1EX5A 4YVPA 3EB3A 1AMKA 3DFQA 2YLLA 3ZO9A 2DU2A 3RM4A 4BI7A 3VVGA 3W24A 3UNTA 3QV7A 4V27A 3V5CA 3W27A 1RAKA 2J7HA 4ZO7A 3W7HA 4JCMA 1UD6A 1UZ1A 1Q2RA 2PDMA 1UWTA 4IF2A 5ABTA 2WV8A 4QNEA 4R9OA 3WQEA 1BG4A 3CV7A 1IQ8A 2Z1SA 1YLVA 3VNDA 5DY2A 2E1DA 1TSIA 2ZTJA 4PCPA 2VFGA 4WF7A 1CGXA 5C54A 3ATZA 3EOLA 3UD6A 4W89A 4PMOA 4IIDA 1XP3A 4ZQNA 3OGRA 1XIGA 2PP0A 1H49A 2HWGA 3KBVA 2ACSA 3EKGA 2Q09A 3DU0A 4PTXA 5AYBA 4F4RA 2PURA 4EPDC 3BAIA 2PDIA 1UC5A 4IG2B 3NQCA 3LHZA 3P3BA 5AKQA 4LQ1A 4CU6A 5LA0A 4JQ3A 3GFZA 3AMKA 1XBVA 4XAYA 1UB3A 3G3DA 2ZXBA 4FNSA 5GNXA 5LYRA 3IARA 3BMXA 3GD6A 3P93A 3WDQA 4JQ2A 4O57A 3QHNA 1E6SM 1OF6A 1S39A 3NQEA 3UF9A 3VE9A 2PDKA 3M6YA 1QWKA 5EA9A 4LC8A 3W74A 3OO2A 1CB7B 1SYTA 2V3GA 3ZLGA 2CLMA 2F7FA 2GGGA 2A7RA 1B3OA 4GLEA 1LT7A 4B5WA 2QPUA 4AVFA 2J24A 4JTHA 1UA3A 2WZIA 1GOQA 2A3CA 3SCOA 4GX8A 4QHRA 1MSSA 4GY0A 2QJJA 3CLMA 4A2RA 2YCLB 4E6MA 3WEZA 4O0KA 4Q4OA 5HMEA 3HM7A 4B15A 2OODA 3L5LA 3NEHA 1W2PA 2D23A 2F8QA 2W79A 3MANA 3BV7A 5G2HA 3M41A 4IHCA 7PTDA 4FX8A 3J7HA 1R9YA 3M0KA 4PRTA 3F4VA 4LUTA 3ARTA 1BFNA 2ONEA 3URBA 1LL7A 1TX2A 4PGLA 3UZXA 2B0MA 2YZRA 4XD4A 5TF0A 3STCA 3W2JA 5PTDA 2WB5A 3U6WA 3VGGA 4MWAC 1O60A 1KRMA 4I5UA 1DP0A 2FHFA 3DKLA 2P3EA 1ADDA 2BY2A 2VURA 3KFTA 3TNOA 4WUIA 1A4LA 4URIA 1OX4B 2ZZ2A 4TXEA 7XIMA 1VC4A 3S1XA 8A3HA 4KESA 1HGWA 4HNTA 2WCSA 3OBEA 3TEVA 5KZMA 3NWRA 1RLCL 2DZSA 3KXQA 1TFVA 3KOXA 3H4XA 2DIKA 4JTKA 2EPKX 1EBGA 4Y96A 3A9BA 5DLCA 4L61A 5U4NA 1TWZA 2R1MA 4GUFA 3PZVA 3MHFA 1XW8A 5CPNA 4O15A 5HBFA 3JUGA 1M6JA 4QX4A 3TCEA 4O16A 3LI1A 3RF9A 3BO9A 3AWNA 4DPPA 3C3NA 1X39A 4LH8A 3MPGA 5HR6A 2Y85A 2WC4A 2PDNA 3PANA 1J5TA 1PJ9A 1E0TA 3DHUA 2VRJA 1S3TC 3N2OA 1Q2SA 4QTGA 4IIEA 1XLMA 3UWUA 1XLCA 1TVPA 2GJRA 1CZ1A 4HP5A 5HNTA 1L6GA 3QGVA 3GKAA 2WO5A 1EJUC 2QJMA 1UD3A 3CXOA 5E93A 3WQOA 2WPBA 5A6JA 5DMYA 5A8MA 2VGBA 2QPSA 3I6EA 4GFSA 2NUXA 1LZOA 3EYPA 4I7UA 1XLLA 1F2JA 3B8VA 1KBLA 3PY2A 1KBKA 3QVQA 2BVDA 3A12A 1P0EA 1R86A 1SZFA 1EO5A 4DBDA 4PMRA 5A3HA 3K13A 4S3DA 1H7WA 2EAWA 4P8WA 2Y24A 4MWAA 5C70A 1OT1A 2P0IA 3CB8A 4LBSA 3RLGA 4L56A 4S3KA 5CJNA 3UWZA 1QU4A 1LWJA 2WVUA 1YPXA 3WLRA 4EX4A 3CUHA 3VDAA 3DCPA 3RIKA 4XWUA 4G7EB 5BCAA 4D6FA 1Y7VA 3FDKA 1UP0A 1T41A 3R0DA 1V02E 3BOLA 5CBBA 3MP5A 1KM2A 1MDLA 1RLDA 4IQJA 3N34A 2BGNE 2WSPA 2WMKA 3NL5A 3CB3A 1JNDA 3V36A 3CASA 3EEZA 3VINA 3PTMA 3HGSA 1MQPA 4DO7A 2JIEA 3WSUA 1XD1A 4N9EA 4KT2A 2RHGA 4M29A 1H7OA 5HULA 3BOXA 4NX5A 1GVYA 1AW1A 1IR2A 4AZBA 4XVEA 5K9XA 3ZJKA 1R8LA 2ZRUA 1J0YA 2QCDB 2PGFA 1O5KA 4RNHA 2X42A 5FEPA 4UTTC 2WW5A 5U7SA 4AMCA 3N15A 5G5IA 2VVSA 3AZTA 4DUXA 3O2LA 4J3ZA 3ALGA 1PCKA 1GKQA 3W37A 1YDOA 1J2BA 1QPOA 3TA9A 5FIPA 3VI2A 5FL0A 3GNRA 1W9DM 1SO6A 3RMEA 2VM8A 3VGEA 3H2CA 3C52A 1PXGA 3HG5A 2D24A 4PB5A 1BRLB 4K8EA 1EIXA 1N8WA 1R2TA 4JS3A 4ZCWA 4EXQA 3W26A 1SR9A 4PEKA 1M3UA 5KMYA 3SCSA 5HNRA 3OVRA 5I7GA 4DI8A 3MSDA 2JQXA 1SO5A 1Q6LA 2VC6A 3EDFA 2EXOA 1P1MA 2GPTA 3BOFA 4ACZA 1W1YA 5AVHA 3VA8A 1AQMA 3PUOA 4QISA 3FYOA 3MO4A 3HPAA 4L9YA 2PWFA 1A0EA 4BWLC 5LHFA 2E0PA 3PJWA 1HN1A 4DJDC 1A50A 2AAAA 3ZJ8A 1MMFA 3NZGA 1MUMA 1SJAA 4JIIX 2PI6A 3SY8A 3QGKC 1FHLA 2WMIA 3N18A 1P48A 4TR9A 1LJYA 4MAZA 2J7GA 4RDVA 4NYYA 4PYSA 3GR4A 4A29A 4ILSA 4GZIA 1RZMA 5D9PA 2WJZA 1CI1A 2PDFA 3NDOA 1Q45A 3K4AA 3P0WA 3KAOA 1WV2A 1CLVA 1YXCA 3E0IA 4WCJA 2LLEA 1IHIA 3DBNA 3HG3A 3FV9A 1TMQA 4C7FA 1VENA 5LNUA 4DF1A 4L6DA 3MBDA 4FOUA 3LHTA 1E6QM 5HJXA 4UTTA 1FWGC 4B2DA 3PTKA 4QIUA 3T08A 1ONRA 3FSUA 1AH0A 4PCSA 4G1KA 3CAQA 4ICCX 3AHTA 1EGMA 5HANA 2C19A 3CMGA 1MW0A 2QCGA 3T0TA 5I3GA 1PWMA 4XBSA 1L8PA 2GOKA 3V16A 4XZMX 4WDUA 1TJ0A 2VP8A 3USZA 4NZ5A 2R91A 4DO6A 4D9PA 1NOWA 5EMJA 5DANA 1F3WA 3BK0A 3A3HA 1A5KC 2QCEA 3RNDA 3AROA 1Y65A 4DLMA 2ZXAA 5DMMA 4GZEA 4FNRA 3FY1A 3G22A 1WA3A 1KLYA 5IXEA 1VFOA 2XH0A 3TYCA 4PCTA 7REQB 3H7VA 1IF2A 3HQ1A 2QV5A 2DZUA 3ZVHA 4RXFA 4GI8A 3S6DA 2NV2A 4HA0A 4DJDA 4AX6A 3C2VA 4GH3A 1W9XA 4GNVA 5LNWA 2DFAA 4D1IA 3W7IA 1XLIA 2BY0A 2HEJA 1XUZA 3WQ5A 1XIIA 1B4KA 1PX4A 1CXEA 2QV4A 5EMMA 4LUSB 2ZUTA 2GSEA 3PHAA 4XAFA 5JIWA 4ES4A 3N29A 1ZNNA 4N2YA 3CT7A 4N0RA 1H7XA 3FHAA 3CH0A 1DIKA 3EA1A 2RGMA 2X1SA 4O19A 4AZ6A 3AALA 3THCA 1XYFA 4GCAA 2QLYA 3QQ0A 5F2LA 4X60A 5MKGB 4GVIA 5BNKA 3VM5A 1A53A 4PSRA 1JD9A 3R58A 4NVTA 4NY2A 3B8IA 2RFGA 2QIIA 3PVFA 3FJLA 4CQ8A 4O1AA 1BVZA 4P7QA 1C8XA 4O1EA 3ME3A 2J75A 3EKZA 2OKOA 3TLQA 2O55A 4JYDA 3CZEA 2VZTA 1XH1A 1KKOA 1EXPA 3BXWA 3KWXA 1JR1A 1VPQA 2G95A 1E4IA 5H1WA 4K6AA 2D2GA 2Y2WA 1YNYA 4JTSA 4DELA 1EGVA 1GZ1A 3ICJA 1CXLA 3OA5A 1TR1A 2V63A 1M04A 4OBRA 4ZE5A 1LLWA 1T6MA 3EDDA 1JQVA 1VFLA 5AYYA 3N3MA 1RK5A 4B5NA 1PO9A 4ICNA 1OG6A 3LCHA 3AICA 2J27A 4TTUA 3UETA 3TTOA 1EC8A 1CT5A 4KCUA 4O12A 1EEXA 1LLZA 4TX9A 4CD6A 3H4WA 4O54A 4JY8A 3BICA 3H2MA 5AHFA 2EPOA 4ZB2A 4CEXC 4HK7A 3S6TA 3PFMA 3WD3A 4I9MA 1X38A 3RJXA 3LCLA 3SUSA 5D2TA 3VXGA 3EWYA 1LTDA 2O92A 3QYQA 3TW9A 3KOFA 1WE5A 2WJFA 2NT1A 2PC8A 1NDVA 1AQ0A 3ES7A 1GYNA 2BDQA 3ARSA 4LVFA 3GRIA 1VYRA 1SVDA 3VZYA 4S3CA 5I3KA 5HJYA 4QDMA 1IXPA 5GQBA 3UVIA 3WNOA 1B54A 3QMSA 1XI3A 3H7RA 4UC5A 3FFSA 2PDHA 1TB3A 4Q8OA 3LG3A 3E2RA 2VD8A 1EOKA 4WDTA 1HL2A 3SUTA 1OABA 2JGYA 3TA6A 3BAKA 4D8ZA 3E0FA 5GJNA 2C1HA 1Q3NA 1IEQA 4US5D 3W2MA 1PHQA 1BHGA 3WK0A 1FWAC 3B40A 2CWNA 5A6KA 3IJ6A 4H6KA 3P62A 4R33A 3VYLA 3EZ4A 3QOMA 1HKIA 1GOIA 5EMUA 4WVXA 3CEPA 2PWUA 4RV3A 4PA8A 3P80A 3XISA 1M41A 3OLGA 1A3HA 2C0HA 2YA0A 4AEOA 2ISWA 3SUVA 4J9JA 4NJGA 3MQTA 1HJQA 4QXIA 2OOFA 1DJYA 3M0IA 1KXQA 3CHVA 5BOFA 3WQDA 3OLDA 1WZKA 2X2GA 3EB4A 3W1UA 4Q3MA 3IUDA 3WD1A 4PRWA 1CGUA 3HF3A 3EX4A 5I00A 1HF6A 3EA2A 1E3XA 4MNKA 1TCDA 1UWQA 1CBGA 3APYA 1T96A 3W1MA 4AWUA 5FJTA 3R8GA 1L6WA 1UA7A 2HBXA 4HPXA 4K1GA 3L68A 1VF8A 5M2FX 2GJPA 2VR5A 3GNOA 4B5TA 3PF3A 1FXQA 3IGXA 1ISVA 2INEA 3KDOA 1J11A 5D09A 4FI4A 4DM1A 2NX9A 1SSGA 1DTUA 1R3QA 1S2CA 2PDGA 4PMXA 3MS8A 1DJNA 3VIOA 2VRQA 1OIMA 3QV9A 2BHYA 3R6IA 2ATMA 3GX9A 4AHOA 2HJPA 1BGAA 2PDQA 1TR9A 4A8NA 1E6RA 1TPWA 2EPNA 4RZ4A 2DVTA 1GHRA 3GG8A 3MUXA 4ENLA 1G9HA 2HVOA 4JKKA 5E9XA 3AQUA 1U1UA 2FVKA 3THQA 2HMCA 3S8HA 4EIVA 4DNHA 4AUBA 4XV0A 1DEDA 3EWZA 3MA8A 2Z6JA 2GGJA 1J9YA 3K1DA 3BDKA 5AC7A 3ARWA 2WWCA 4IL0A 4HMNA 3EGJA 3LXBA 4GD0A 1JI2A 3POCA 4Z1BA 1ICQA 1CW2A 4J3TA 2ZRVA 3PJUA 3SAZA 1VRDA 1EDQA 4P7OA 4QAIA 1IWAA 1MFVA 2Z7GA 3INPA 2OO6A 1LRNA 1SO3A 2WMHA 4IWWA 5D04C 4HTBA 2PLJA 3CPRA 1V6UA 2CLLA 4M8UA 2FZDA 4K1WA 2P76A 5E0KA 2X7VA 4LUTB 1AH4A 3E5BA 2ZX9A 2DW7A 5CAKA 1FFRA 2VFDA 1J0ZA 1T99A 3RG6A 3TQ0A 1JPIA 4XO7A 4IMFA 3NQ6A 2XVNA 3RPMA 1QOQA 3NO5A 1TE6A 2WC7A 4FB7A 4MIMA 4GI9A 3Q58A 3MZ2A 1V6YA 2HNHA 3SCUA 4NHVA 5I0DA 3WDPP 3L4ZA 4AF0B 3I7SA 4FR6A 3GVVA 2P10A 5I3HA 1OX6A 1E3ZA 2X09A 2Y0FA 5BW6A 2E9BA 1O5QA 2QR6A 3FHQA 3UR2A 1UIPA 4WZHA 4UTKA 4BR1A 4TX6A 4ASTA 3FK4A 3W86A 5EY5A 4ERIA 3BL3A 4U3AA 1K9DA 2POTA 1CYGA 1MEHA 4RE0A 4UQCA 5DELA 1JYNA 2E6YA 1C9WA 4KQNA 5FSDC 1XG4A 5C71A 2PCQA 1OBAA 5J8LA 3B0PA 2XN2A 3TV8A 3T4WA 3JZUA 1V0NA 2KAUC 5A2AA 4CQBA 4MSSA 3SUUA 3B9DA 1UOZA 1Z9AA 2Z00A 1DQXA 1B0IA 4ML4A 2XSBA 1UG6A 2D22A 1K6WA 4UNIA 3GDBA 3TOYA 3GBEA 2VDHA 4QQUA 5A6SA 6XIAA 2Q3OA 2WPGA 3WYZA 1LWHA 4BF5A 4KH2A 1E43A 4OKDA 2GYIA 3ARRA 1YMYA 4LF1A 1EB3A 4MPQA 4ADTA 1E5JA 3W84A 3TUUA 3PZUA 2WNNA 2HXTA 4LGXA 5A8NA 2V3EA 1F5ZA 3H8AA 4GUIA 3T6CA 1XBXA 2G5WA 4FXSA 2GOUA 4GZ7A 5E70A 4KFOA 1BLIA 4WXZA 1I75A 2V2DA 1OJXA 4MWAB 1UMLA 4WIWA 1JUEA 2A4AA 4GYFA 2ZX8A 4AD5A 5F7UA 3MJYA 1JL8A 4Q8MA 3A22A 1NM9A 3E0WA 5EPDA 4H6RA 3ARQA 3KRSA 1LQ2A 4Y9OA 4DHGA 4GKLA 1DXEA 2XFRA 2FZ8A 3KBSA 3MCMA 3CJPA 4Y7EA 2I57A 2O56A 3EPNA 3UR7A 3LS9A 1HJXA 4JTFA 1V5XA 2V81A 1QPKA 3GXPA 3T8QA 1BYCA 3W7KA 3CAVA 2PDWA 1FDZA 3PZNA 4L5ZA 3VOCA 4B5XA 2OXNA 2P8BA 4ATDA 4WDXA 3NG3A 1KM5A 2QDGA 3BLLA 4E3TA 2D73A 1HL8A 1A80A 4WXYA 3TC6A 4D6IA 1UR8A 1BD0A 3C6CA 2XGBA 1FWCC 5CGQA 2EBNA 1ZTVA 2Q8XA 1MVYA 3OZYA 1Z48A 1OYBA 4D2JA 3AO0A 3S1UA 4GINA 1BF6A 2QUMA 3SBFA 1GQNA 4CNNA 2O9TA 1A5CA 3GWQA 2EKGA 4AU0A 3BG9A 1LUCA 3I68A 2ZDSA 3QSRA 3REQA 2IKIA 4FXRA 1RH9A 2BHZA 4E2DA 4QITA 3EOOA 5GNYA 2W4XA 1K6AA 3AJ7A 1X1OA 4J3UA 4G56A 1YXDA 2GWNA 4K3ZA 3WCZA 2JKEA 4NU7A 4KKXA 3WLQA 2Q71A 4JX4A 4W8LA 3BH4A 4GNJA 3VIJA 1US3A 2J7BA 3NTYA 4D72A 1VD6A 1FCQA 2WM0A 1MW2A 3LCWA 4KEUA 3GZAA 3NQFA 1AH3A 2NX1A 4IPLA 4P7LA 3C5QA 4HVXA 1M7XA 3Q37A 1I4NA 5IFTA 4XB3A 3TMLA 2BFGA 2OELA 3A3WA 2QCFA 2WMIB 1CGTA 5F2MA 1QW8A 3DHPA 5D37A 3LRKA 1WZLA 1QAPA 4FOKA 5A2BA 1XLKA 1V6VA 8TIMA 1WB0A 3UPMA 2AKZA 3OQ8A 3WIJA 5C2CA 3AS1A 1XQKA 2YBUA 3S1GA 1WKFA 5EMYA 1KM0A 1VRXA 5HK4A 4AD0A 1HG3A 5C9RA 3WLKX 3AYTA 1DJZA 2A21A 2YSWA 3FCPA 1AZ1A 3RLUA 3IV3A 1JG9A 2Q6ZA 2E40A 3RDKA 3B8SA 1TUXA 3NOEA 3PULA 4TX8A 4F0KA 1WQ5A 4W7UA 2NXHA 4Z1AA 4O28A 1R3SA 1R5YA 3O05A 4Q33A 1X1NA 2RJGA 4DF2A 4GG9A 5BXPA 3CYJA 4U4MA 3B04A 3N9SA 1EWEA 1FWFC 4QS5A 4Q8PA 1XIBA 4NNCA 1GOMA 3A4XA 4WKFA 3OVQA 4LU0A 1ADOA 5IFPA 1DYSA 2HBVA 3WNPA 6TAAA 1GYLA 4J4KA 4H7CA 1XIHA 4NF7A 5AY7A 1Q8AA 2YR1A 3ZVHB 5G4EA 5JU6A 2BASA 1SZNA 2E6DA 4BQ5A 3OB8A 1P7TA 5BXTA 1SZGA 4JQAA 4KERA 4LTSA 2BGSA 1BWKA 4MG4A 4HJFA 2AL1A 2WXDM 3CHEA 4AXNA 4YVVA 1OC7A 1TV3A 5FD0A 4H2HA 1CENA 1UJQA 1SUXA 1TPDA 4NNAA 3CC1A 3PJXA 1JVNA 3QM3A 4AWTA 3UR5A 2JIWA 2OLHA 5CG7A 1TTQA 3HMJG 3VNZA 1VIWA 2HXUA 3K8KA 1KWGA 1J10A 4UFMA 1XIEA 1YDVA 1ZCOA 2PP3A 3UZZA 4WRHA 3RR4A 4JQ1A 4GYPA 1FCBA 6CGTA 1DPMA 4HPGA 3CQHA 3SRFA 3W7PA 4CNUA 1KM1A 3FGCA 3QFEA 1Q6OA 3VNIA 3VC5A 1R0MA 3MI3A 4O14A 3CQ0A 2VENA 2HS6A 3V5OA 2QJHA 3UA4A 3S2LA 3LUTA 1M03A 5E6ZA 1XPGA 3E0LA 1RA0A 3NQBA 5KINA 3VGDA 3BG5A 4LOCA 1WAUA 1IV8A 4JIEA 1FP8A 5HATA 5FSEC 4BQ3A 1K7XA 4RXGA 4JGDA 4ZQPA 1K4GA 2XZ9A 5FA5A 4A05A 2E8ZA 2PBOA 3PBYA 5JIPA 3B97A 3OYXA 4LANA 3AFBA 3GHRA 2ZUNA 4EPBC 6REQB 4FXJA 3BZJA 5DY3A 5KSWA 1WCGA 3O0KA 3UZYA 3F2CA 1U83A 3T0CA 3EDKA 2G3MA 4XQ6A 4F0HA 3QZ6A 2QDHA 4YU1A 1UZHA 2HQAA 3G3MA 4I6KA 3U2CA 2B31A 2DUAA 1JAKA 3RYSA 3PSWA 5D2XA 1CGWA 5J5RA 1H50A 2WVVA 1IT7A 3MCNA 1QPNA 3AI0A 5D02A 2Y7DA 1FVPA 3B9AA 2YZ5A 3GXDA 3P5ZA 2CERA 2OYMA 4ZQMA 5I07A 4DAFA 5BMWA 3HG2A 1T40A 1LBMA 3GC5A 4DQWA 3WQ8A 1A47A 5CC7A 4G1NA 1GCYA 5XIMA 1ZCCA 2WAGA 3XINA 4H9UA 3VILA 4M3PA 4ZOEA 3RLHA 5CJ5A 3P2VA 3CWOX 4O8AA 3PBWA 4L80A 1BYBA 2O9OA 5AECA 4U5KA 4XG1A 1ISZA 1XICA 3AIVA 5A8OA 1S2VA 1O1HA 4FK9A 1LORA 4PUMA 3LCFA 2DIJA 5EFFA 3HJEA 3S2JA 2YB1A 5KETA 1JXJA 3UCQA 1ZAIA 1FCUA 2GGIA 3G8RA 3UGRA 4LBUA 5LGZA 3QC3A 1DWGM 4PMZA 3IJQA 5J04A 4PCFA 3TWAA 4X9YA 5CPLA 2BNJA 1W3LA 2Y6ZA 4CCEA 4ZBCA 1B30A 1TUFA 1H7NA 2Y8VA 4J1OA 3W1LA 4PE8A 3S1WA 3FYYA 2YKKA 1E6NA 2EJAA 3H23A 1OADA 5I24A 3SI9A 4ATLA 3G1DA 3NL6A 4YWIA 1M9HA 1J96A 1GVQA 4GE8A 1YE4A 3HFTA 4UR9A 1W3KA 4PBFA 4RPPA 4J3VA 3IJ7A 5CJMA 5AZ1A 1EPVA 3OIHA 1AVAA 4ZA0A 1MQQA 1K7EA 3BMVA 2ABBA 1I2NA 3H2AA 1UKPA 2ZZ7A 3QR0A 3GHTA 4U28A 4O1BA 5K3VA 4HD5A 5I09A 5AYZA 1A5MC 4JHMA 4R7JA 3G1HA 4N6EA 3CK5A 5CC3A 1V6TA 1BF2A 2WQDA 2A5HA 3SRDA 3A47A 2RDUA 3WDIA 2WWDA 4IX2A 3MUAA 2XH4A 2O4MA 2YLAA 3OHIA 4J40A 2F6UA 3EWCA 4FX7A 1XFCA 3B05A 5ABHA 2WMJA 1XYMA 2XTKA 1DWFM 2CBIA 4PBEA 4JFSA 2ZA3A 4OBSA 4O1FA 2DVXA 1XPYA 1C7TA 2J13A 2VDIA 2FYMA 4PRRA 3DGRA 3MY9A 1UWRA 4IUGA 2RDWA 2V30A 4DLFA 1ISWA 1K8XA 4J5NA 2YW3A 1JCXA 5DO8A 4H01A 4JTTA 2Z29A 4UFIA 5LA1A 4XBKA 4O18A 4PTWA 4AEEA 3GZ3A 1DTNA 3RPTA 5BZAA 3P6LA 4ZOBA 3RN6A 4LAKA 4RE4A 5D2YA 3N2TA 1YIXA 1DORA 3ARPA 3EDJA 2W91A 1OT2A 2C14A 1JPHA 4AZCA 4GIAA 3G0SA 1DE5A 1P6CA 1DHPA 3H12A 1TZ7A 3STPA 3VABA 3WF2A 5C6MA 1R47A 3CM4A 1ZGDA 3STFA 1SW7A 4HN4A 2VDGA 4YHEA 3BQ6A 1T5AA 4FLQA 2XIJA 2V5LA 2PDJA 5CPOA 5K4XA 1GOWA 3SADA 3A5VA 2WYSA 3B0UX 2ISDA 2VZUA 1W3HA 3TQPA 1SM9A 1YPFA 1Q8JA 3SW6A 2X0YA 1K77A 3DUGA 4PMDA