1YX1A

Crystal structure of protein of unknown function pa2260 from pseudomonas aeruginosa, possible sugar phosphate isomerase
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
250
structure length
250
Chain Sequence
LHPVSISLSSYGADLVRSRGQASFLPLLAMAGAQRVELREELFAGPPDTEALTAAIQLQGLECVFSSPLELWREDGQLNPELEPTLRRAEACGAGWLKVSLGLLPEQPDLAALGRRLARHGLQLLVENDQTPQGGRIEVLERFFRLAERQQLDLAMTFDIGNWRWQEQAADEAALRLGRYVGYVHCKAVIRNRDGKLVAVPPSAADLQYWQRLLQHFPEGVARAIEYPLQGDDLLSLSRRHIAALARLGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein PA2260
publication title X-ray crystal structure of hypothetical protein PA2260 from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Structural genomics, unknown function
total genus 90
structure length 250
sequence length 250
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 1yx1A00
1XIFA 5J8LA 5B7YA 5XINA 4XIAA 3KBWA 3FVMA 3QC0A 3KBMA 4XSLA 3KCJA 3ITVA 8XIMA 1XINA 4XSMA 2GUBA 2HCVA 3QXBA 3ITTA 3KBJA 1XLHA 4QEHA 3BDKA 4GJJA 4DUOA 3KCLA 2QULA 3M0YA 1XYMA 4GLEA 1CLKA 5I7GA 1O1HA 2G4JA 2G0WA 2XIMA 4KW2A 3KBVA 3U3HA 3AALA 2X7WA 7XIMA 4LNCA 3TC3A 1XLCA 3ITLA 3IUDA 1XLLA 1DIEA 1OADA 1YX1A 3CQKA 3KBSA 4HGXA 4QEEA 1XIIA 2NQ9A 2HK0A 4K1GA 1XYAA 2QW5A 5EMJA 1K77A 4ZB2A 3XISA 4EAYA 3M0MA 2QUMA 1GW9A 1S5NA 4QE1A 3VNKA 5B7ZA 3DX5A 6XIMA 2HK1A 1XLBA 4YTQA 3BZJA 4HHMA 3M0LA 4W4QA 1DXIA 2GYIA 1XLDA 1XIEA 1XLFA 4G56A 3GNXA 4X60A 1MUWA 1QUMA 1QT1A 1XIGA 4ZB0A 1XLMA 3BANA 3P14A 3CQHA 3IUIA 1TZ9A 2J6VA 3AYVA 4QE5A 5EMLA 2XINA 2NQHA 2ZVRA 3BWWA 3UA4A 1D8WA 3C0SA 3DBNA 3JU2A 4A8LA 4K3ZA 3UXIA 3XIMA 3ITYA 1XICA 1XP3A 1XYBA 1A0CA 3KCOA 3WQOA 4HNOA 4PFHA 4US6A 1S5MA 2I56A 2Q02A 3VYLA 1DE6A 1XLKA 3KTCA 3KWSA 1XIMA 2ZDSA 3ITOA 4GQBA 3UU0A 3P6LA 4A8RA 5H6HA 3L23A 4HHLA 4YTTA 2GLKA 3QZAA 3C0LA 4YTRA 1XYCA 3UA3A 2NQJA 4DVOA 4A8IA 1MNZA 3M0VA 4XIMA 3ITXA 5TNVA 3KBNA 3XINA 3CNYA 3AYTA 1A0EA 4QE4A 1I60A 4OVXA 2GVEA 4YTSA 4GJIA 5EMKA 3N4AA 3M0XA 5H1WA 3C0QA 3VNMA 1XLIA 5XIMA 3VNIA 4PGLA 4YTUA 5XIAA 3CQIA 4EACA 4A8NA 3U0HA 4Q7IA 2X7VA 8XIAA 9XIAA 2XISA 3AAMA 3M0HA 5AVNA 1DIDA 1XISA 3NGFA 3LMZA 3VNLA 1BXBA 1XLGA 3OBEA 3UVAA 4XISA 6XIAA 3BZGA 4XKMA 3CQJA 3QYSA 1XLJA 1I6NA 5EMMA 1XLEA 1BXCA 3IUHA 4J4KA 4ZB5A 5AVHA 1XIJA 1DE5A 5FA5A 1A0DA 4QDPA 4ZBCA 1XLAA 4X63A 3CWHA 4E3VA 4QDWA 5C9ZA 2QUNA 2I57A 1XYLA 5B80A 3TVAA 3VNJA 4X61A 1XIHA 1XIDA 2OU4A 1XIBA 9XIMA 1QTWA
chains in the Genus database with same CATH superfamily
5GNYA 1QR7A 3DBPA 1LG2A 2ZRVA 2ZUUA 1RQBA 1Q13A 2VFEA 2G4JA 2NXIA 4H6RA 4J2MA 3WYZA 2ACSA 1AW1A 3TW7A 1KC7A 2Z1WA 3QKZA 3TZFA 4JN8A 3BAWA 1YNPA 4EF8A 3GD6A 4KS0A 2OEKA 1LQ0A 2YL5A 2DP3A 4QBXA 3S2NA 4DWSD 1PEZA 2HK1A 4A4AA 4PMDA 3PWIA 4E8GA 1E4MM 1IXNA 1W17A 2BXZA 4FNUA 1H49A 3VO0A 1Q85A 1ONRA 4BI5A 4QG9A 1XKJA 4A6GA 2R1LA 4MAVA 1M5WA 5HNNA 4MB3A 3U9IA 3DEQA 5AZ1A 1JFXA 3KOZA 2PDIA 3N3MA 2FDMA 4KCTA 5REQB 2OXNA 2ODOA 2EJAA 1SSDA 2W6RA 4G2DA 5A5WA 2NQZA 3QZAA 2VDHA 2Z7KA 5HULA 3JS3A 3M5ZA 1LL7A 2Z2UA 3HGJA 1LORA 2WANA 2D2HA 5LIWX 5JIWA 4WKAA 5BU6A 4PCFA 4H4IA 5LXXA 5D05A 1XRSA 2Q3OA 2QUTA 1S38A 3NO3A 4DPPA 2CERA 4U28A 4DY1A 3KL5A 4AVNA 4PMUA 4IMGA 1C93A 2ESCA 3LB0A 3W37A 3ITCA 1G7UA 4V1XA 1GHSA 1EJVC 4HOWA 3VE9A 2POZA 2V2HA 3W7HA 3QSRA 3MCOA 2ASHA 3KDNA 3WO8A 1I2OA 3HG5A 3U3HA 2QGYA 1A5CA 2QCEA 3V35A 1O5XA 3EEGA 4EXAA 3W86A 4EAYA 1V77A 3ITGA 3WD2A 2WNWA 3LGGA 2VX5A 1BAGA 3T09A 4F79A 1EHNA 1XSJA 3Q67A 3M0LA 2PF8A 3GUWA 3GY1A 1FWGC 1YBQB 4X60A 2JKEA 4XD6A 4XAFA 1XM3A 1E6RA 5BRBA 4TX8A 2ZA3A 1LYXA 2GPTA 4KGLA 5C2CA 1PYFA 3PZMA 1IZKA 2FGBA 3B4YA 3JUGA 4LUSA 4UTJA 1J4EA 3PG8A 1R5YA 1NWTA 4AF0B 4YU1A 4IQLA 3GAYA 4RZ5A 1GNXA 3HQNA 2WZHA 3UCDA 5A2BA 3WBAA 4YTSA 2ZZ4A 4G1NA 3CHEA 4PUMA 2G95A 3KP0A 4GG9A 4HOXA 3VKBA 3S47A 1E6ZA 1TREA 3L0NA 3O6DA 2PODA 4QXIA 4MWAC 1XG3A 3STCA 4JQ2A 4RL3A 3B8DA 3D3AA 4QLLA 3LBOA 1JYVA 3I3EA 4MY9A 3VUPA 2XWEA 2IPWA 2GVGA 1TX0A 3PNUA 1C92A 3R79A 1ZY9A 1E1CA 3RAOA 2G0WA 3AXHA 1TE6A 1CGVA 1YE4A 5KTLA 4NI8A 3AWNA 1F5ZA 4Q8QA 3GFYA 1XIIA 3AS3A 1WZKA 4FIQA 3OBAA 3DFQA 2AOSA 4IUOA 1HKIA 1PKNA 1C3FA 3PP7A 4O1AA 4NG3A 1DXIA 1XIEA 2IPJA 3IGUA 4HN4A 4JICA 4Z2KA 3PSVA 2Y7GA 3CZJA 4W86A 4H7ZA 4WXYA 4U3CA 2QR6A 3U8GA 3OGRA 2X16A 3CZKA 3S1UA 3IIOA 3PPGA 1SGJA 2V38A 3WQCA 4IQEA 4WSJA 1I0DA 4Q4RA 4NZJA 2X7VA 5DY2A 3T8QA 4NF7A 1P7TB 2AMGA 1YPIA 4B16A 3BXWA 3LMYA 4IGNA 1SW0A 3T0AA 4XBSA 9XIMA 2FB3A 5FSEC 1MXDA 2CLMA 5AC8A 1G67A 4GNJA 1VJIA 3AIEA 3DFSA 3WDJA 4W5ZA 1RJQA 3GXIA 4J9JA 2NV9A 2PDQA 1R87A 4DUOA 2VUNA 4HVXA 4UNIA 4XZWA 2XIMA 2E77A 3N4FA 1UR2A 2QKFA 2XSXA 1HO4A 2Y5EA 1R9ZA 4PRTA 1GOXA 4QEEA 5K9XA 2Y7DA 3RR1A 2NVDA 4PUKA 1EOMA 4DXVA 1W9UA 2ZXAA 5C6MA 5T26A 5EL1A 1C9DA 3L66A 4AEEA 1XLDA 1KGXA 2BODX 4MKNA 3FA3A 3NTYA 3VD3A 2Z1SA 4LBSA 2INFA 1FUYA 3ZWTA 2DUZA 1XC6A 2QUUA 3NZ1A 1UR3M 2WKGA 1L6WA 3MWAA 3NFUA 1TCDA 2QCGA 1J5TA 1W37A 3BVJA 4XG1A 2BOFX 4QS5A 4ZENA 3KBNA 2D0FA 3T2QA 2R6OA 3TC7A 4MTVA 4S3EA 4K1WA 1ITUA 4FLSA 5D2XA 4UR7A 2AKMA 1UD3A 1TJ1A 3ZFHA 4OKDA 4ES4A 4MVAA 3UYCA 3IVTA 1AH0A 1FH9A 1Z89A 3CM4A 3HPZA 5FJIA 2AKZA 1TYGA 3AUOA 2A3CA 2GL5A 3R4IA 3CQ0A 3W2UA 2ZZ2A 3SAZA 3U4AA 4MJZA 3H12A 3PUDA 1BWLA 4YVVA 5ECUA 1TPUA 4HU8A 3PM6A 3SR7A 3EZ4A 2ISFA 5M5DA 4H1ZA 4F0MA 5BZAA 4NL1A 1W1A1 3CGTA 3R2GA 3WLJA 3L68A 3HGSA 3RLVA 5KZ6A 3ARXA 3P8IA 2QPSA 3ZT7A 4FNQA 1UC4A 4JXCA 4LV9A 2ZE3A 4V27A 3FN9A 3AOFA 3QR1A 1P4CA 2FMNA 3ZWSA 1ZS2A 5JVLA 2PB1A 4Y8EA 3V16A 3C3NA 4F3HA 2NSOA 1YDVA 2O9TA 3RIKA 3W7CA 2J8TA 1IT0A 3H4WA 3C86A 4M3PA 5C70A 1EJTC 3OA5A 3LN3A 4K3ZA 3G1AA 3F2CA 4N9EA 1N2VA 3CHVA 4GK8A 3WBXA 1SO3A 2JKPA 3CL6A 1FTXA 2WHLA 3OO2A 3RM8A 1KLYA 3LM3A 4EP8C 4X2RA 4IFKB 3WUGA 3EDFA 1KBLA 2LLEA 5A2CA 1JDEA 1E6NA 1J8VA 3KS6A 2OX1A 1QAPA 4DJDD 3CB3A 2A3EA 4L6HA 1IIGA 1B2YA 5I00A 4B5XA 1NP0A 1HF6A 2AGKA 1QK2A 4UWMA 3OTRA 5ABHA 2RJGA 5I3DA 2QVHA 3HURA 4QDPA 3N12A 4KFPA 2PU0A 3PVFA 5AB3A 4JN6A 3UETA 1VEPA 2W66A 4XIAA 4FX8A 3GVVA 4L7ZA 3KBMA 2YA0A 3N25A 3TJLA 2B7PA 8XIMA 1HKWA 4MOZA 3QSTA 1VKFA 1YYAA 4V28A 2J25A 3GDBA 4O11A 4DBWA 2AL2A 1ALDA 4O57A 1PKYA 3WQ6A 3KDOA 3D3FA 2DORA 4JPGA 5ECVA 1BQCA 1HTIA 1FWEC 4ZFCA 1R3WA 7CGTA 3EDDA 1DV7A 4FR6A 1D7FA 1G6CA 2ZBTA 1J9YA 4HHMA 2XH0A 4IGMA 5SWUA 3UXLA 1R46A 1JUBA 1GYNA 2GSEA 4NJJA 3HJZA 1DL3A 4W8AA 1JZ5A 2Y8VA 1JZ4A 2FZDA 3W7PA 2OQHA 3NM3A 3TJIA 1LOSA 1FWHC 1O1ZA 1BF6A 3QW3A 4QFUA 4M0XA 1XQKA 4GQQA 5D32A 1MDLA 1EDQA 3SRKA 1U83A 4MWAB 4UOJA 3N11A 1BHGA 4WLCA 5F4SA 4CD8A 3B03A 3MO4A 2WMIB 4CCDA 1E4NA 3V5CA 4H6QA 3CZLA 5AYXA 1XLGA 2J7EA 3AXMA 5HPCA 3DKLA 4K7YA 1HL8A 2RGMA 1VH7A 1G4TA 4Z2HA 4JYEA 1F3XA 1E55A 4GNVA 4QX4A 5DELA 1YIXA 4GIAA 2XH4A 4OGZA 4E3TA 5C9XA 2TAAA 3LRKA 1FHVA 3TSMA 2EKCA 3MDWA 3C2RA 3ZR5A 1RQEA 3CZGA 2O9OA 2R14A 1UZDA 1JD9A 4ZO7A 4W85A 3CPGA 3UPBA 1GQNA 5FJRA 4RZ6A 5CPMA 1G9HA 3TR9A 1DYSA 1XLLA 4I9JA 1YX1A 3SY8A 2J7CA 3MV11 4LCQA 4WHBA 2E6DA 1W2PA 3C8FA 2YCEA 1MW2A 1ZAJA 1JZ6A 4AYSA 4UFKA 3RMJA 3CUZA 5AYBA 4NXKA 3AWOA 2X1SA 1EX1A 1CXIA 3H2CA 4ENLA 3B0PA 3URAA 1QASA 3Q45A 2VGFA 3EPNA 3EX2A 4HZMA 4ICCX 1C7SA 3W76A 4DNMA 5BXRA 3ES8A 1L8NA 3SM0A 5BYWA 4MHBA 1VBGA 1B0IA 1LQAA 1M41A 1A3WA 2VX6A 3W82A 2I56A 3EKLA 1DE6A 4PB5A 2ZDSA 3C52A 4ZE4A 1EJSC 4CU6A 3PJXA 3DAQA 4S3AA 1PZ3A 4IOTA 3GDLA 1GYLA 3F4VA 3GRIA 2RFGA 1H5YA 2CNCA 3W2NA 5A6KA 3MVIA 1OSEA 1B3WA 1CB2A 4Y9AA 1KCLA 3HMCA 2VCBA 3LMZA 1PZ2A 3NUKA 3MW7A 2V5JA 1E6QM 1IWBA 2WWDA 3SGGA 1XUZA 3U5YA 4HP5A 4HPXA 4HCHA 1F8MA 3TTSA 2XN1A 3GDKA 3QPZA 1TG7A 1KCZA 2ZADA 3ZJ6A 4JAWA 4WY0F 1J0YA 3WEZA 1FWFC 1HIZA 2OZ3A 1CWYA 3F5LA 2ZWZA 1QW9A 1RAKA 2HS8A 4GCAA 4INFA 1OCBA 4KFNA 4HT3A 1F8IA 5B7ZA 6ENLA 4JOMA 3IVUA 5L9FA 1LBMA 4J3ZA 5I02A 4M81A 2GJRA 1PWLA 2O56A 3LCHA 3WMLA 1PJ9A 5D9MA 3UGRA 3MZ2A 1KM6A 1JZ7A 3BAJA 1WKEA 4B9YA 4HCLA 6PTDA 2XIJA 2P8BA 4OZOA 3UZ5A 5TBOA 4BQ2A 3DFOA 2HJPA 2VX7A 3KRBA 3GNNA 4YVXA 4YTTA 3DI1A 3GUGA 1EA9C 2Z26A 4AWSA 1MW0A 4UTKA 3VKCA 5CXPA 5HDRA 1ME7A 3A47A 3VKAA 3NL2A 3VDCA 4BQ4A 3NQ6A 3EOLA 1WOAA 2G3NA 3SCWA 4AH7A 4GUGA 4O15A 1W31A 3MPGA 3SCNA 1IR2A 4ERIA 3IRDA 1H11A 4GX9A 3LHWA 4MGGA 1RY0A 4XZ9A 1K9DA 3KRUA 2QPUA 3REQB 2WLYA 4DUVA 1DE5A 4IM4A 4NZFA 3QY8A 5D30A 1QOXA 1QTWA 1UOKA 5I3GA 1Q7QA 8A3HA 4CNUA 2PDPA 3RF9A 1UYQA 3PSWA 2V5LA 4EVZA 1TWSA 2VEIA 2C0AA 4QIUA 2CHRA 3EWBX 3CMGA 1K9TA 5CZ0A 3GK0A 2Z1VA 3NPWA 2WSKA 4AEOA 3TW9A 2ADAA 1G1YA 1VB9A 1HO1A 2G8ZA 1HKKA 3UQNA 1C9WA 1NF7A 3OOQA 1ZGDA 4O10A 4K7VA 1B3VA 4HPHA 1S2UA 2A6NA 3H2EA 1ITQA 2J47A 2BX7A 3KL0A 3DI0A 4UTWA 3PUGA 1MNSA 4GABA 1QNVA 2A0NA 4GI8A 3GBEA 3MJYA 3PZUA 1V6YA 4IIFA 5JBFA 3KCOA 3NSXA 1E0UA 3W88A 1OYAA 1PHQA 3POHA 1FOBA 4LYPA 4OFCA 1CI1A 3LSBA 4GE8A 3QJAA 3EOSA 1JYNA 4AC7C 3BLDA 1G7VA 3NOYA 2BSLA 3SZ8A 3BUVA 3B06A 1S3TC 4YLWA 5FEXA 2YXXA 2QJNA 5AY7A 3UJEA 1U1HA 1TPVA 4G1KA 3QTGA 1TR9A 1DJQA 2QLYA 4GA8A 4BK9A 4KEMA 3OYXA 1UKPA 1EH9A 1R3SA 5CPSA 4Q7NA 3RUBL 4PZVA 3UNDA 2VL4A 4KESA 1KCXA 1YADA 1UKTA 1WXYA 3N15A 2E7FA 3PUEA 1A50A 4GXMA 3PBMA 5DCBA 4CN6A 5ABFB 1E6PA 4ILSA 3N2XA 1NTHA 3NM1A 3LPGA 1UP2A 1KQZA 3PHAA 4K8EA 1J10A 1IZCA 4GGHA 1B9BA 2PDWA 4GI6A 4QHRA 5KZMA 4HTYA 4UB9A 2PGWA 3GB6A 3Q58A 2WVUA 3G1HA 4IWWA 4UMCA 4YYFA 2QJMA 4RKAA 1J01A 4R27A 3EX6A 3INPA 2DZTA 4JCMA 3STFA 1AJ0A 3M41A 5DT7A 1VBUA 2E6FA 4MG4A 2VZOA 1M7JA 1KGWA 2QUVA 4DN1A 3I10A 3MYOA 4GI9A 4HU0A 2GQ9A 3F4NA 4LT9A 4W88A 1B3ZA 2W27A 4C91A 3LTSA 3EMZA 3L0KA 4L1GA 3VM7A 4I7UA 3HIJA 1QHOA 4K8GA 2PWDA 1J18A 4LX4A 4UIOA 4C7GA 2PLCA 3PB2A 4YCPA 4BQ3A 4ZOEA 3VZXA 2NSXA 4Q7IA 4NZ3A 3WLOA 5CBIA 4LVDA 3HM7A 3M44A 4IFOA 3LS9A 2V69A 4XTDA 5EKYA 3MUAA 4RDVA 3L4UA 3LCXA 2HQAA 2EHHA 1XIHA 1OT2A 4AX7A 1WV2A 4RLIA 3STEA 4IX2A 1HVQA 3NG3A 1JCTA 2OKTA 4S3BA 4MMWA 4OUIA 3LUTA 4POCA 4E4PA 4GYPC 2YDAA 2FMOA 1LRTA 3ERPA 3GXMA 4JNMA 1K77A 2PPGA 4N6FA 1LRNA 3VIJA 4D1JA 3GO2A 5CC6A 3LD5A 4XO7A 1G69A 1W8GA 2X8RA 1D8CA 5M2FX 1J96A 3CUJA 1XLMA 4CGTA 3W4RA 4R33A 3GS6A 4Q4KA 1H7PA 4HHHA 4PUWA 1PHWA 2QQ6A 5A8GA 3DG7A 2PDJA 3IACA 3DENA 4ZOAA 4JX6A 3LPOA 4OBTA 2IKJA 1DPMA 2V2CA 4HPJA 2TSYA 3E2QA 5D2TA 2CLPA 3USZA 3VDBA 1JCLA 3OIHA 1HJWA 4Q8NA 1OFEA 3WDIA 4AY1A 5FF2A 1G4PA 2V30A 5I3KA 4GY0A 1Q7MA 2WM0A 3MMWA 1EFZA 1O94A 4QCEA 3GVQA 4U3AA 4QJ4B 5G4WA 1BVZA 3QVQA 2FTWA 4TX9A 4E2OA 1LT7A 1DWHM 4X3ZA 2C6QA 3AFBA 3KRSA 1AL8A 3S2LA 3G0XA 3WENA 1IF2A 1ZBWA 4QQ3A 1YPFA 6ALDA 1J6OA 3CO4A 1HUVA 4RJEA 1UD5A 4UOZA 2NXGA 1G94A 1KM3A 2WZTA 2CZEA 4W8LA 3LXBA 4TMCA 3M0KA 1VJZA 4L4PA 1ME8A 3WD0A 1PTAA 3G2GA 4Q4QA 1PDYA 5DMLA 5C54A 1KD0A 4FEZA 3TR2A 2REQA 2J77A 2FHFA 6TIMA 2PCEA 3HBLA 5F2IA 4PTWA 4JTRA 1DTNA 1RHCA 1EEPA 1A5SA 2XFRA 1TR1A 1KXHA 1HT6A 3KWSA 1QNSA 4U2YA 5DT5A 2F6UA 3M0VA 4MM1A 2AL1A 3O0KA 4DJFD 1AW2A 3CO8A 3H22A 3SURA 4GD0A 3IJDA 2ZA1A 5D8ZA 4MLJA 1OJXA 1W3TA 1KBJA 4UNLA 1X7IA 3K8LA 3V3WA 1ZP4A 3N2MA 3W22A 5T91A 3ZT6A 1Z8AA 3EWDA 1FWDC 3FSUA 4L6DA 3N04A 4UFLA 1SM9A 1BLIA 5U7SA 2GDVA 4DAFA 2X09A 5CZJA 1PS9A 1NWRA 3P61A 3G18A 2L5HA 4C1LA 4Y96A 2WCGA 2WSYA 4Y7EA 5FF7A 4MADA 3WL1A 1IWAA 4QNWA 2W67A 4QE1A 1DBTA 1RPXA 1T40A 5FF0A 2H3DA 3THQA 3TK7A 4I8YA 4F66A 3IUIA 2GGIA 2EPOA 2OLSA 1ZALA 2DW6A 3VIPA 3HV9A 3KOXA 5FOOA 2POTA 4I5UA 4N6EA 1QCWA 2D24A 4JCLA 4C6BA 1H50A 3A23A 2QJIA 1LG1A 1IYXA 3FKKA 1M1BA 3W24A 3CK5A 3JZEA 4H9XA 4H9TA 5EMKA 5A6BA 4C65A 4WXZA 2TODA 1SMAA 3EWYA 2YIHA 3C5QA 4LWWA 2DEPA 4ZQPA 3E12A 5HPOA 1O7AA 3UYIA 5K7JA 3L4YA 1DQWA 2VI0A 3MHGA 4MSSA 2Q8XA 3C2YA 3A4XA 4LUTA 1QK0A 3TAOA 4TVDA 3WMBA 1XIFA 3DUGA 5HATA 1POJA 3G1SA 1VRXA 3EX3A 5BOOA 3TEVA 3SW6A 3SQLA 2B7NA 3GC2A 2WWCA 4LB3A 4W87A 3ARYA 3BDKA 3W7KA 1CIUA 1KNWA 2VCAA 1JYWA 2G37A 3TWBA 5T8GA 2DIEA 2ANUA 1J0JA 2OCZA 2XN0A 3GNDA 1Q6OA 4WJXA 4JTTA 1QHZA 3K4WA 3RYSA 3UXKA 2ZZ1A 3DHFA 4DWSC 3PNZA 5CBBA 3QY6A 2GVYA 3AMGA 1FCBA 2X41A 3QR3A 2XINA 1IEWA 4LS0A 2PDXA 2HPMA 1XICA 2C13A 2IQDA 3HV8A 4FHAA 5EFFA 3RCYA 1R2TA 2OVLA 3EWUA 3OBKA 1ICQA 4C7FA 1HG3A 1JCJA 2JGQA 1I1XA 2Z6JA 4FLOA 3UXDA 3VX1A 4AG0A 3H55A 4R34A 4WIWA 4H8VA 3GC5A 3PTDA 4URIA 1WDRA 3VIOA 2WVTA 1UIPA 2J9XA 5FI8A 2VWTA 3WLTA 4H2HA 3THAA 5AVHA 5DXYA 4O50A 1GEQA 2E8YA 4ZCWA 3ATZA 4KBXA 1O12A 2XSAA 5EB8A 2VGBA 2WHMA 1GVYA 4Q4OA 4AIUA 4GIYA 3KBWA 5CJNA 2QDHA 4RNHA 4G7EB 4NJKA 1RPKA 1MQQA 1ITXA 1MI3A 3HG4A 3MJMA 1JPHA 4AW7A 5I7GA 4F40A 1A5OC 1ICPA 1ZB5A 4NZ4A 1A47A 1M9HA 3V5OA 4RPQA 4CNNA 2P0OA 1VFUA 1Y5WA 2G96A 4ADUA 1UR4A 4LUJA 1QO5A 1I2QA 4WEVX 5IHSA 4JIRA 2CESA 3ABQA 4IFKA 3EGJA 4BHYA 1A5LC 3W2LA 5KEZA 3N9KA 2AQOA 3WG6A 3AJ7A 1ZNNA 2R1KA 4IIDA 4WRHA 5C9RA 1DWJM 2RHGA 3PPHA 1GVQA 2VYOA 2A1YA 3N1AA 1CGXA 1B3YA 1V03A 4LBUA 1ZJHA 1M53A 4L1WA 4EWJA 4O52A 1XFCA 2PE4A 4GX8A 3S42A 3ZMRA 3KXQA 2OPJA 4A35A 1XG4A 3NZPA 3AIVA 1RY8A 3E0VA 4HMCA 5AVNA 3DG3A 4M82A 4WKFA 3VE7A 3FEQA 2YCKX 5FAJA 5C0QA 1X1ZA 2Q8ZA 2G3FA 1QDSA 1QOQA 3GX9A 2Z0IA 3ANUA 2Y24A 4PFMA 2Y0FA 4AMCA 4KFOA 2RH9A 4O17A 5F2MA 3E0LA 7TIMA 4XAGA 4JTDA 3B8UA 2AGTA 1FWIC 1VBJA 2CZDA 3PZIA 1OIFA 1GWJA 3AHTA 4IIEA 4C6NA 4HCDA 2ZA2A 4LNCA 3SCUA 3VOCA 4B5UA 4ADTA 1F4HA 5D38A 6REQB 3KM8A 3JRKA 5CPNA 4PYSA 1WE5A 3T55A 4QM1A 1TTPA 4C6QA 4NIRA 3IWPA 3WH6A 4O53A 4PODA 2GYIA 1R3VA 4MWAA 2YR1A 5I09A 1B9ZA 2P3EA 2ZXQA 2F2HA 3I3DA 1F9CA 4C1NB 2PF0A 2WMIA 5LNUA 2INEA 3W29A 1KXVA 3GW0A 3BAKA 2GQ3A 1SW7A 3W2MA 4IP4A 1LT8A 1X98A 1L6SA 4A8IA 3XINA 4UTTC 4MUZA 1V3KA 4YTUA 4MIMA 1D3HA 3G1FA 5E9XA 2YFNA 3S5OA 3H26A 5K3VA 3OLDA 6XIAA 4AZGA 1HNYA 4AD5A 1W2VA 2QHAA 4AZ7A 4LU0A 1EZ2A 2INZA 1W9DM 3TYBA 3IAQA 4UTIA 3GR4A 4PC8A 1JZ3A 3N17A 5B7YA 1Q6CA 2E1DA 4HNUA 3URQA 2PWFA 4H8HA 4C6IA 4JZ5A 4M6QA 2HCVA 1BYCA 1OCJA 4AD1A 3W84A 3BLOA 1E1FA 3NQ7A 5AHIA 2G5WA 3CH0A 4G8TA 4Q22A 2MNRA 4MNLA 1P1XA 1Y8BA 3NR0A 1KO0A 2A79A 4LVFA 1VZWA 5DBTA 2MUCA 4L6OA 3B8SA 3PPCA 3W7JA 3UD6A 1U1UA 4IH3A 5BXPA 2FHCA 3SN1A 2OZ8A 3LTPA 3SRDA 4JR5A 3LCFA 3TFCA 3WH9A 2FVMA 3MANA 4XBJA 3TCSA 4LNYA 1NEYA 4NU7A 4Z1DA 3KHJA 3DHUA 1I1WA 3UPWA 4LS1A 1O4UA 2P10A 2X1RA 3SSZA 3HFTA 1QVBA 2FDSA 2H9AB 5FL0A 4DIAA 3BQ6A 4BJHA 1F7BA 3CUXA 3EWZA 3WUEA 3T2PA 4LUIA 1KQYA 5GVJA 3PBYA 1MYRA 3WK1A 3GHUA 4A8NA 3U0HA 3O6YX 5LYRA 1UWIA 2Y88A 1A49A 3H2AA 5I5RA 5AHNA 5LGXA 1R9YA 3DHDA 3K4AA 2GVJA 1KBBA 2V5BA 4HNVA 4FI4A 2J24A 2OEJA 1BYBA 3MU7A 1BPLB 3VDHA 2DSZA 1ME9A 3L7RA 3RJXA 3CAQA 4Q8TA 1JXKA 3M0IA 5BXTA 3G3DA 2G3IA 4FNPA 1X39A 4YNGA 1GPWA 2A85A 2G41A 3ARUA 1NH6A 3S9YA 4JQ3A 4DWSB 4V15A 2VFHA 2ATSA 2EO7A 1TX2A 2OG9A 2ZC1A 4C6DA 3M16A 4NRSA 3M07A 2P8CA 3VIIA 4DJEA 3TN6A 4JIPA 3VKDA 4IF2A 5E0FA 4HU3A 1C29A 4B5VA 2O92A 2DZVA 2E67A 1XLFA 2GUUA 4QJ5B 1J0IA 1XIGA 1ZQ5A 3CQHA 2OEMA 1Q2RA 4QAIA 3VGHA 2FIQA 1XYZA 4GOAA 5F4WA 1O5QA 2JIWA 1FBAA 5K9CA 1BG9A 1JI1A 4GUIA 3UNTA 4MDOA 4GVHA 3TAKA 3WQOA 2WB5A 1GVSA 4K37A 1FKXA 5IHRA 2NX9A 1LCOA 4C1KA 3PULA 1ADDA 3GKFA 1TMHA 4K2SA 1W9XA 2VENA 5D2WA 1AH3A 4GJIA 3H23A 4H19A 1EXBA 5G1TA 2YPIA 5TQLA 1XGEA 4DJDC 1RXOB 3AQUA 1SUXA 4XZHA 4M7TA 1OZQA 1E1EA 3W7DA 2D0GA 1TJRA 1GG1A 2JF6A 4QJ1A 3DECA 2EJ1A 3R0UA 4Y9OA 2JKAA 3QQ1A 2QAPA 3LCGA 4W93A 1XYLA 1H0IA 2QDEA 1R3YA 4KWSA 5DMMA 2ZUNA 3L21A 3I68A 1AK5A 4R7JA 5BCAA 4PA8A 4JX5A 2J88A 3JW7A 3KL3A 2ALDA 1B5TA 3VINA 4EAMA 2O4MA 1NDVA 4DF0A 5DO8A 1M68A 2ISVA 3HB9A 3OP2A 2ZICA 1PX8A 3CAWA 2DDXA 4F9DA 4IHCA 3ECQA 3M0MA 4GZIA 3ONCA 2BGNE 2NXHA 1VFMA 4UC5A 4M1RA 3WD4A 1IZJA 4R9XA 5CCZA 4QE5A 2ZOXA 3NDOA 2HE8A 3W7LA 2RDWA 3ZJ7A 1MXSA 1AVAA 2CKSA 1HFBA 3FJNA 5DN1A 3GNOA 2BFGA 3BMWA 2CW6A 4XV0A 4ZQOA 2W3ZA 2XIIA 4XAYA 4C7DA 2YL6A 3EA1A 5HJLA 4ECLA 5H1WA 3SN0A 2IXUA 2W79A 1ZBKA 3W7OA 2NWRA 3VGFA 1XDLA 3RRAA 1JUKA 2NQLA 1JI2A 2A5HA 2Y6ZA 4W7VA 5LXEA 1HP4A 3U2OA 3BG3A 3C8NA 2ZZ3A 7ENLA 1E72M 1XCWA 2PDBA 1XIDA 4I8DA 4P8XA 2HWGA 3BSMA 3BL3A 1E9YB 4HJFA 2WMFA 4C6MA 3N2BA 1V08A 4WY0B 2YA2A 3FCPA 3F5KA 4GLEA 3WBWA 3ONBA 3GVGA 3WJSA 3I4EA 1UQZA 5F4XA 1UZ4A 2E6AA 3G1RA 1E70M 4D8AA 3GDRA 4GVGA 3GWQA 1QFEA 3T78A 4O18A 1R38A 1CBGA 3OA3A 4MF4A 3CASA 2GOUA 5CLWA 1UKOA 4EK7A 4FK9A 2D1ZA 2VR5A 1D8WA 1EJXC 1Z3NA 2ZE0A 4N0RA 3ZJKA 4FLQA 1NQ6A 3ME3A 4ZOBA 3CV2A 5MKGB 3FDGA 5T9BG 2WZEA 4JDYA 2O7SA 1PIGA 4D72A 3H4XA 4GKLA 4R9OA 1HP5A 3WKZA 3AIRA 1CGUA 3WMSA 2OKOA 4GCXA 1B3XA 1FFQA 2V3EA 2XPKA 2WOQA 2OFJA 5EGRA 4PTDA 3E2VA 1BD0A 2A6LA 3RU8X 5K9DA 1Q8AA 1QI4A 5BROA 1PCKA 3RXZA 3L2MA 3W9ZA 5JBEA 2OODA 3QV7A 1FWCC 2ZKMX 3UXAA 3SCTA 3R5EA 1K3UA 3D5HA 4QEHA 4UQEA 2Z28A 1XH0A 1NFBA 1O1HA 1M7XA 5D9NA 3QZ6A 3FXGA 4F4RA 1PBGA 1XV8A 1KA9F 1VF8A 3THDA 2CBJA 2QDGA 2QUMA 2WBGA 4F0SA 1GVOA 1PKMA 1FWJC 3MP3A 1O6IA 2P53A 1N8WA 4ZB0A 2PTYA 2Z29A 3HF3A 4KCVA 3WNKA 1HJQA 5AYZA 1J0HA 2JIEA 2VWSA 3G5EA 3GIQA 4GQGA 1UC5A 1NF0A 2OO0A 4PR4A 1QNQA 3KHDA 3O05A 1TWDA 3SECA 4WJEA 3I6EA 4AZHA 1FXPA 2PC4A 5TD4A 3M7SA 5EY5A 1T8XA 4IJRA 3RNDA 1V0NA 2VRQA 3WFLA 1SFJA 1A5KC 1OINA 2V2DA 3NQGA 3ENLA 3CJPA 2DT2A 3SUTA 3FGCB 4JFWA 3PK7A 1OB0A 2V3GA 1RSCA 2ZRZA 1ZL1A 5A6MA 3J7HA 4UTMA 3MKCA 2JE8A 4PUJA 1M01A 1OHLA 3D6NA 1CTNA 3IARA 1JPIA 1UWUA 2C0HA 3B04A 3G8RA 3QMSA 3R43A 1WBHA 5HMEA 4NZ1A 1U2YA 3MO7A 3ITVA 1GUVA 3S2JA 4XSMA 3DOPA 4AWTA 5G1YA 3TFXA 3OVGA 1FWTA 1GJWA 1IIHA 1XQLA 1ADSA 2WK2A 4H9ZA 1NAL1 4MB1A 1SPQA 4IL0A 3TC3A 2G4FA 2WJZA 4CD7A 3WLIA 4GWEA 1QBBA 3WK0A 5CSSA 4BEUA 2GJXA 3SCRA 1QRQA 3MS8A 3TTOA 3LRMA 1UR8A 2HRWA 3GNRA 2O0TA 1VYPX 2J6XA 3M6YA 4DYKA 1V0KA 4O14A 2D3NA 3GIYA 3P62A 4NAEA 1XJBA 4DO5A 4ICNA 5BWFA 2CZVA 1U5VA 3WJZA 3WLLA 2ZUTA 3EYPA 3WQ8A 4US6A 1SR0A 2CKRA 3L5AA 4M6UA 1RVKA 1QI5A 1B1YA 2Y89A 3AYTA 3MTWA 1REQA 5HA7A 3F4WA 4JFTA 4NILA 2PGRA 3LHYA 1ODUA 3PUOA 1E6SM 1P0KA 2PWEA 4ZGYA 3SJ3A 4J3TA 1RD5A 4P7LA 4Y8FA 1V3IA 1BXCA 1Q6RA 3DYOA 3NO5A 3UZJA 4PCNA 4UQ9A 5B80A 3TVAA 1GT8A 1WCGA 3CC1A 4OV9A 2XVGA 2CCRA 4O4VA 2C8NA 3G1VA 1B57A 3AO0A 2NVAA 1V6TA 2E5DA 3CUIA 3CL8A 1GTHA 2QZRA 1VYSX 4KH2A 4IT1A 4J3UA 4V33A 2DT3A 3LHVA 4HGXA 4S23A 1KFCA 1QW8A 5BMXA 2QJGA 3WBYA 1XUUA 3IJIA 3SIMA 4XZMX 1E5JA 2WQPA 3DH7A 3T08A 3TUUA 2NQ5A 1VJSA 1OX5A 1HL9A 3B9EA 3M64A 3WDQA 1RZMA 5FAGA 2ZRWA 3II1A 5GQBA 4O1BA 3LM7A 4AQLA 1O95A 5E9AA 2PMQA 1W1IE 4A8LA 1JF6A 5HBFA 3OGSA 4P7RA 2YFOA 2VEMA 3W72A 4OBSA 4P2VA 4GUHA 3KOYA 3VIHA 2Y85A 2ZZ5A 1E43A 2MANA 1FH7A 1J2WA 3RX4A 3LHTA 3N4AA 3DHPA 1US2A 3E0IA 1K9EA 1EYEA 1OFDA 8TIMA 4RNFA 8XIAA 2AMXA 4E5TA 4DXXA 3V1PA 4OV4A 1RCXB 4XB3A 2WPBA 3O2LA 1UCWA 1XS2A 2GUYA 2VURA 2FVKA 2OWXA 2YLLA 1WKYA 2R24A 1XBZA 1H41A 3PTQA 3SQSA 3UVIA 2QS8A 1TZ7A 3MUZ1 1XR2A 4HNTA 2DSUA 2EG8A 5I06A 5A8QA 3KCLA 3GR7A 2OELA 3FLUA 1OX4B 3VFLA 3V1HA 3FW6A 4GUJA 1TPDA 2ICSA 3TDFA 3U4FA 4S39A 5A95A 2PBOA 4LANA 2X2YA 1TPWA 4FP1A 2OLAA 3GBDA 1G01A 4JFVA 2DQWA 4KRUA 2DVUA 3AROA 3XISA 1NFPA 3TJ4A 4A21A 1QPOA 1E3XA 4XAPA 4K36A 1F3TA 1DHPA 2X40A 1W32A 1XPGA 2NUYA 1KTNA 2J7BA 5FF4A 4IP5A 3U2ZA 1TPC1 1LWHA 4AY7A 3DC0A 5A6BD 4IMCA 1VR6A 3COTA 2OOFA 3GXDA 4RV8A 4FMVA 3WLSA 4C6LA 3RO6A 2DPEA 4GIRA 2GFTA 3OQEA 1XI3A 3ZO9A 3EKGA 2E3ZA 1V02A 4DM1A 4M6PA 2VTFA 4ERGA 4GYPA 4MAZA 1K7FA 1RD6A 1O5KA 5FCZA 1K8CA 4AD0A 9XIAA 5HWJA 4WGHA 5KITA 2BG5A 4A3HA 2ZX8A 1WZLA 4B92A 3EBVA 1E9ZB 2V68A 3P60A 1XDMA 4LBRA 1Y0EA 4HMEA 1JCNA 2H8ZA 2FLIA 1DJYA 1W3LA 2FH8A 4GY1A 1M3UA 1GTEA 4JFUA 3WLQA 3LBMA 1V6VA 2Y2WA 3DFTA 1WNOA 2DH2A 4RE3A 3NO1A 5GJMA 4LF2A 4B15A 4IMDA 5I03A 2I5QA 4P8UA 1EC7A 1QI3A 3STGA 5D04C 3QBUA 1LTDA 5D09A 1TQXA 4Z42C 2D20A 4CVUA 2RUSA 3EA3A 1WUFA 5GPRA 2YGYA 2IQ0A 1GJPA 3MV01 1ISXA 1F74A 2WCAA 3CIXA 3UZZA 3VOIA 4L80A 3NDZA 4FOUA 5LHEA 1XGDA 3AXXA 3VOHA 4DYEA 4BA0A 1IXQA 2W63A 2Z4GA 3TQ0A 4LVGA 3PC0A 3ANYA 3F4CA 3Q94A 3URNA 1JDDA 3ITXA 1IWPA 1ONWA 5HR6A 4DJFC 4XD5A 4ORMA 5FEPA 3BH4A 1CXFA 3VUSA 3MZNA 4R85A 3BGJA 2WSRA 1H1YA 4K68A 2QCNA 1IXOA 1JULA 5D02A 5I24A 2I17A 1O5RA 5RUBA 1Q6DA 2WHKA 3GR8A 3ABXA 3E3HA 4UFMA 2HBXA 3JZUA 1POKA 1I60A 4DLFA 1VFSA 4HMDA 2CBUA 5CH9A 3ZVHA 1TFVA 3BW3A 1DP0A 4IMEA 2FB2A 2PDFA 4P61A 3TX9A 9CGTA 3P67A 4W7WA 4ZR8A 3WNMA 6A3HA 2VXNA 4S2CA 3O9NA 3S1GA 2HNHA 4QISA 2EG6A 4FXJA 3DC8A 1QPQA 3G24A 3C61A 2DZXA 4YJ5A 4JBRA 3ZZ1A 3BOFA 3L2IA 1T41A 4ZTXA 2CHOA 1H1NA 4I6KA 3MBDA 2FZNA 3VI2A 4TTGA 2BOEX 2DGAA 4AXKA 4JY9A 4B4FA 4PUEA 3H53A 1IEXA 2VCCA 5CQ1A 2PAJA 3W07A 3WIJA 3G8EA 2CLHA 1VPQA 3OB8A 3B8IA 3AU2A 4EX4A 3PS7A 3KTSA 5HK4A 1GQKA 5HNRA 3BV4A 1UH2A 1SO6A 1MUMA 2HISA 3SGZA 1E9LA 2OB3A 4LQ1A 3W1NA 1OEPA 1BTCA 1SO4A 3TYDA 3C2OA 1VFHA 5H8UA 1J5SA 1A5BA 3PB0A 1XISA 1A3HA 3OJGA 2Q01A 1O68A 4AB4A 3TNBA 5F2LA 3NVDA 2CIPA 4LB4A 4AHQA 1LUCA 1QATA 2A21A 1J0ZA 1ZLPA 4HSOA 1W91A 3TXVA 5LGZA 2FQIA 4LYKA 4AIBA 4UQDA 3AIWA 3AHVA 1AFSA 3NQ8A 1GKQA 5MF5A 5C55A 4QCFA 2IS7A 3HPSA 1VLIA 5CG0A 2OQLA 4UQBA 5FIPA 3AI0A 3SO7A 2E09A 2V3DA 5D9PA 3KBSA 4U2ZA 3CEUA 1UH3A 4NJIA 1DEDA 3E9AA 3BARA 3R0DA 2YCJA 1V8EA 2A7RA 4WK9A 3NQ2A 1O60A 4ZSUA 1TB3A 2XSBA 3N29A 4E6MA 1T96A 2XIOA 5CLTA 3GE7A 3PBVA 2Z2BA 2NWSA 3VGBA 2DZWA 1ISWA 2V5KA 1I2NA 2PDHA 3IANA 4BI7A 4PEEA 3VD7A 1UASA 1P0DA 1VHNA 4M19A 4BY3A 1F3WA 1EGMA 5AC6A 4NYYA 3UESA 2NX1A 3HPFA 3S9IA 3W87A 2XHYA 1KM0A 5D2YA 3GKAA 4TIMA 5C7VA 3WD1A 1DIDA 3M43A 3NGFA 2EXOA 4DWSA 2Q6ZA 1XIJA 3QOMA 2E25A 1F6KA 1Q4WA 4MDPA 3Q65A 2BV9A 1GOQA 3C56A 3I7SA 4MY8A 3T6CA 3V5FA 2QCMA 3U57A 2YL8A 3OGVA 1UOZA 3OODA 2XWDA 2EPHA 3EWCA 5I79A 1TKKA 7TAAA 1RJPA 3SQMA 3WBEA 3LK6A 4IJBA 3B4UA 1N7KA 4RCXA 4JY8A 3AHZA 4AZIA 5BWAA 3RK8A 3NQBA 4J27A 2PEVA 3GFZA 1VBHA 3RCMA 1DVJA 3H2FA 3AHXA 4S3FA 4RK8A 2UY3A 3HA1A 2JEQA 1ZCCA 2J7DA 1SZNA 3KE0A 3FSTA 4ZZ9A 3FJLA 3WLNA 2GDQA 5FSDC 1K8XA 4LVBA 4C5ZA 1XKYA 1XD1A 1NELA 9RUBA 5E6YA 2PBGA 1X38A 3QFWA 4FXSA 1WO2A 5BNKA 3WFAA 4EOUA 5C71A 2WO5A 4OOUA 4E4UA 3RJYA 1GPFA 1XYBA 4MLRA 4UNKA 1UKSA 3IIZA 3VYLA 3TYUA 3QMRA 3HQPA 1WKFA 3E02A 4D6IA 1MEIA 4CNPA 2JGYA 4XQ6A 3VVGA 3FNDA 3NYDA 3SB0A 2E9LA 3IS4A 4L5ZA 4WSHA 1L2UA 4LV4A 4EWND 2XH2A 1YQ2A 3A13A 1SU5A 3PJUA 4C6OA 1OT1A 1WXJA 2O4QA 3WD3A 5FEZA 4ZFMA 2X1IA 5IFPA 5A8MA 1T5AA 1TWWA 4H01A 5CPQA 3CZEA 1UWAA 5EFDA 3R7MA 2IQTA 4DJED 4WR3A 5J8LA 3SRFA 4FOJA 4R3UA 4B5SA 2E0PA 3TJXA 1CYGA 4UTFA 3UZYA 3I6RA 2NV2A 2QJHA 1HZYA 1NM9A 1G4EA 2HNEA 4JNYA 3KOFA 4FB7A 4CCZA 2HEJA 3ZXWA 4NT0A 5CKSA 3W01A 3ZIZA 1B4KA 2ACQA 1S5NA 2QAFA 4DUWA 2VMFA 4W4QA 4AMAA 3MI3A 1QUMA 2Z00A 5AC4A 2PDLA 5EMLA 1OFPA 4MNJA 3ZOAA 1C7TA 3W71A 1K8YA 4Y9NA 1WOBA 3KRZA 2A3AA 4DBDA 2D23A 1D9EA 4FS9A 4PULA 4YWSA 1ONXA 4B5WA 1UWQA 2BVDA 2HVMA 3MUY1 1J6PA 4PUUA 4LAMA 4XZNX 2FTPA 3GU2A 2BGSA 4XBKA 5E6ZA 4IXHA 3W23A 3AAMA 4KIEA 2VR4A 3QTPA 3GLCA 2IMRA 3UVAA 4A3YA 5TF0A 1XLJA 4GXWA 1QNRA 1EP1A 4R53A 1I9CB 4XUYA 4PH6A 4ZBCA 1RLDA 4LOCA 5A8OA 4HTBA 3S2CA 1BRLA 4HK5A 1PX4A 4IMAA 5M03A 4HHPA 4RXGA 3FVMA 2Y5SA 1OQFA 5A1AA 1SO5A 1KFKA 1TA3B 4KEVA 3R10A 1EO7A 4LUSB 4Z2LA 4XK2A 3WQVA 1NWUA 4JDBA 2WW5A 3C2VA 5G4HC 4WJ8A 4BR1A 2P76A 4UTTA 2YBUA 1X6LA 3IGXA 3IAPA 4R88A 2QW5A 3O15A 1SFTA 1EQCA 5GJPA 4J35A 1B30A 2X2GA 1EX5A 5D2VA 4F2BA 4O13A 4CCEA 4GC4A 1CGWA 2XDFA 3RLUA 4JIEA 2BVYA 2CZ5A 1OCQA 2XG9A 1MQRA 1V0LA 3NYZA 4TO8A 1OFBA 4IL2A 4J3WA 4DM2A 4JKLA 3P81A 5G2IA 2PUZA 3S83A 3QOKA 3H2MA 3S5ZA 1SMDA 2VFIA 4B3ZA 1ELSA 3LBCA 5KSWA 1EA0A 4UTUA 4AZBA 3ITOA 1EOKA 3P0XA 4B2DA 7PTDA 5DANA 4NXSA 4ZO6A 1E1CB 2V82A 3VMPA 4JL2A 4CN1A 5XIMA 5XIAA 4KEUA 2J4GA 2DSVA 2CXGA 2V5CA 4U10A 3LPPA 3JR2A 3IJ6A 3WLHA 2QT3A 3PF3A 2DSWA 4AD2A 2ZIDA 3R13A 4LS2A 3MHFA 4P5UA 1QJWA 2QVNA 1ODZA 3WEOA 4Z08A 4Z1BA 2PRMA 2CHNA 1Q63A 1Y5VA 3N73A 4RZBA 3GG7A 1EUNA 2VC6A 4ZTYA 3AXIA 3WJYA 4EPBC 4CU7A 2VQTA 5AC5A 4J3VA 1V93A 1JEZA 1KV8A 3M5XA 2DZSA 4JTCA 1MQPA 1PZ0A 2Z27A 3BLKA 5FJOA 1Z48A 2XZ7A 5GJNA 1VQTA 3W0KA 4JYFA 3VNKA 2UWFA 2VKZG 2F2KA 2JQXA 3IJ7A 5I3IA 4P8VA 3GYCA 4JTEA 3A4AA 1H61A 3DBNA 4O1EA 1U1JA 4S38A 1NOWA 2H3BA 2NUWA 4CUCA 2E68A 4GH3A 1AD1A 3NZRA 3WLPA 3UU0A 3TE9A 3OZYA 2HPIA 2Y70A 3RU6A 1ZTVA 3CIVA 1JRCA 3TN3A 1OG0A 2ALRA 2XVNA 3O63A 4AVFA 5HOSA 5JH1A 2BS9A 5HQEA 3MWCA 3O16A 3L4WA 4XVEA 1U5JA 5DCDA 3MSDA 4P7NA 3A21A 2D2OA 4FAMA 1PKLA 1QBAA 4NI3A 1LBFA 2D3LA 4UTLA 3H2OA 2WC7A 3PANA 3W3OA 3TW6A 3S6OA 2RDXA 2WNZA 4XKYA 2VDIA 1N8IA 5ABGA 2X1TA 1UMLA 5M3WA 1EO5A 5IDZA 3FXYA 3LLDA 3V0SA 5HNTA 1H63A 1A80A 1SJDA 4ZL1A 1V6XA 4GH1A 4XWUA 1KM4A 3B0VC 1RBLA 3H4GA 2WVVA 1F61A 2D2GA 4ZB2A 2VR2A 3BC9A 3BOLA 4HSNA 1J2BA 2XVKA 3CPUA 4O12A 4NNAA 3LDVA 4ZQMA 3EKZA 6CGTA 1VS1A 3R25A 1XBYA 1TUFA 3G22A 1OC6A 3N2OA 1AMYA 1L8PA 2PWUA 3NJ3A 5EYWA 5LNWA 3IIPA 4Q3MA 3WNNA 2OZ0A 3GAKA 2XIBA 5EBUA 1TCMA 3BICA 4J28A 3M0XA 2OYMA 3L5LA 4IX0A 1HX0A 4AZCA 1UR0A 3RGTA 3ARTA 1MFVA 2QCDB 1FXQA 3SFWA 1R30A 4ALDA 3ZM8A 3O7UA 2PP0A 1QNPA 1EXPA 4S3DA 3B8VA 1Q7ZA 4DPQA 4FNSA 5HNUA 1QW7A 4BF5A 3O07A 4U31A 4M5PA 3ITTA 1RCOB 3CYVA 4M7SA 4D6GA 3SY1A 1CXHA 3VCNA 1MEWA 3GG8A 1K6WA 2EPNA 3TKFA 1GQJA 2A7PA 1MXGA 2BOGX 4JKKA 3HMJG 3H21A 3S46A 1JCXA 3PWAA 5M1TA 3LZ3A 2R91A 3TQPA 3UGVA 2FJKA 3C0JA 4O0QA 1OFQA 5HQLA 5D4YA 4KWUA 2BXYA 1JZ8A 1WPCA 4MZ8A 1UMYA 1XBXA 1E0TA 3W1MA 2VDGA 2BASA 4CD4A 2WPGA 3FX4A 4FOKA 1GCYA 1W3HA 1LRQA 4HYRA 2V9DA 1FA2A 4G6CA 3DGBA 4IIHA 1R3RA 4BS0A 1LQ2A 3EX4A 3BJTA 4P8WA 2W4XA 1JXJA 4WGXA 4H9UA 3CHDA 3KVJA 3NPXA 1FWAC 1UBSA 4H04A 2EBNA 4LAZA 2YYTA 4XZBA 1M03A 3IK4A 3W2JA 1YEYA 1DIKA 1TV8A 4LC8A 3QYSA 1CXEA 2OQYA 1EP3A 1OX4A 1XLEA 4H6KA 1OGBA 1HJXA 4D6HA 3VFCA 2GOKA 4GO9A 4ASTA 4Y9PA 1UWRA 3DDMA 3GFXA 4N4QA 1KFJA 1EYWA 3W7GA 3UW6A 4DBEA 3LGDA 3A9IA 3VXGA 2Q8LA 4GBUA 2C14A 1PPIA 1WP6A 4HQVA 1Q6QA 2PDCA 3TYCA 4ZMGA 4J5NA 5HQMA 1DTUA 2VJXA 3TWAA 4RE2A 1CXLA 3DXIA 2DIJA 2W92A 3HPAA 3E5BA 4FX6M 2DW7A 3H24A 1P0NA 1ISZA 3NSNA 2VEGA 1P43A 3IJ9A 4RXFA 3QFEA 5CSRA 3BG5A 1NJJA 3UY8A 5K2ZA 2YLAA 2W0UA 3S6DA 3U7VA 1OC7A 1VBRA 4JNZA 3Q4DA 4HHLA 1V6WA 1FCVA 3M9YA 1DJNA 1TPH1 1BGGA 4ZXLA 2ZRXA 4CQDA 4GZ7A 3VX0A 3RMEA 1IT7A 1ZSXA 2Y8UA 3H8AA 4GYKA 4I9MA 2BVWA 3W83A 1W9VA 1X7FA 5A8NA 1NDZA 2VZUA 4LC6A 1BSIA 3H7UA 3QKEA 5LA2A 4F8XA 4NNBA 3POCA 1TE1A 2YCLA 4F0RA 4RNIA 2EPMX 4PMJA 3UEQA 3QEZA 1QXLA 3NZGA 5CSYA 4C60A 4JTQA 4HA4A 3DZ1A 1GONA 1JRBA 4W8BA 4HYVA 1GKPA 1RV8A 1WUEA 1OG6A 1S2VA 1DHKA 4IIBA 3WF3A 3W7MA 2CLKA 4FA3A 1F05A 2GK1A 3ZLFA 4E38A 2OJPA 3UG8A 2WMJA 3QV9A 3UZWA 1OIMA 1LWIA 2R82A 1CT5A 2VVSA 4CLMA 3NOEA 1FQ0A 3EEZA 1JPMA 2PWHA 3U6WA 1PIFA 1UA3A 3VILA 4JTUA 1XL9A 3ZQ9A 2H90A 1HL2A 2P3ZA 2WM1A 4LRTA 2QV5A 1OFRA 2J7FA 4G56A 3F5JA 4W5UA 4NZCA 4MKVA 1GVFA 1OBAA 4HNNA 5E70A 1Z6KA 2XM1A 4QRNA 4K39A 3UG4A 3UBPC 4HNOA 1Q2SA 2Z6IA 2V67A 3TYAA 3FA5A 1JDCA 1HKJA 4ONVA 4Z0SA 1UD8A 3L67A 3LEPA 4N4PA 1DJWA 1XXXA 3K4DA 2DVXA 2ACRA 3IRSA 3DFNA 4UMBA 3SGUA 2XISA 3L4TA 5E5CA 3MBFA 4PRRA 3B9OA 3IUHA 4NJHA 1TVNA 5K4XA 3RILA 3T81A 1EC9A 4HPNA 4LYQA 4IICA 4YL2A 2OU4A 3TZNA 3MSGA 2Z1XA 4J1OA 2C19A 2VC5A 1SZRA 4M29A 4ZVJA 4E8DA 5JMUA 3ARZA 3NEVA 1BGAA 2GZXA 1YHTA 3APTA 3HFYA 7REQA 2ZTJA 1QPKA 4IQJA 1DJZA 4AFYA 4NP7A 4GHRA 4OTKA 1RQHA 4GQ0A 3WQEA 2FYMA 2CPUA 3TC6A 4UFHA 3QGAC 4Y2WA 1K7EA 5FJJA 4MJMA 4DO7A 1KBIA 1V3MA 3WH5A 1XRFA 4G9PA 1W1YA 4D6CA 4Q32A 1RLCL 1I2PA 5CEWA 5JH2A 1K03A 4QG8A 3C2FA 1E40A 2EPKX 3VGGA 3CNYA 2ZC8A 4S3JA 3EWWA 3UR8A 2A4AA 2F61A 4H00A 2BVTA 1UR1A 1R2RA 3NVTA 5CC5A 3EOUA 1KWKA 2Y7FA 2WMHA 2CC0A 1KBKA 4ROQA 4ZB5A 3LSCA 4HBKA 4AZ6A 3FDKA 1SZFA 4X63A 2I5IA 1F76A 1Z42A 5BU9A 1LLOA 3ZVIA 4PBEA 1W5MA 3OZPA 3W7RA 1ECQA 2ZCGA 3GXFA 4E2BA 3LV6A 3KBJA 3W26A 5ENLA 1GOKA 3NCOA 1KTBA 2AAAA 3BO9A 3PG9A 2VC9A 3QH2A 3CUGA 3F2DA 2CLFA 2NLIA 1YTDA 1L0PA 1JNEA 1TMQA 1AJ2A 4L9XA 1FDJA 1AMKA 4GZEA 3KVMA 3WLMA 3CXOA 4FZIA 4YHGA 4Z0JA 2ZZ7A 4O54A 3CTLA 2NT1A 3LZ5A 1RK6A 1A5MC 2X1UA 2V3FA 5FJPA 1UD6A 3L0GA 3AZSA 1HGWA 2F9RA 3DG6A 3WMCA 1JGMA 1V7AA 1TIMA 1US3A 3NSMA 5A6SA 3LCIA 1W1B1 1OF6A 4YTRA 5CZSA 1BG4A 3R6IA 1A5AA 1Q65A 3EX1A 5AZ0A 4HOZA 4C5YA 1TELA 2UY4A 1X6UA 2FGZA 1A4MA 1DQUA 1EWDA 3CS2A 2VOMA 4KF1A 4JN7A 4XKMA 3F03K 4HMNA 3BCDA 5FEWA 4CQBA 1ZENA 4W89A 3KS5A 4CQ9A 1XH1A 3MYPA 4AC1X 1JQVA 4S3GA 2IUZA 3FY1A 3A4JA 3P8JA 1RK5A 3S3GA 5A94A 2DZBA 1QI2A 5REQA 3R1ZA 1KFEA 3OG3A 3R12A 5A6AA 4GJJA 2BMBA 4JEQA 4GMEA 1UWSA 3TONA 4A3RA 4DI9A 5IM51 3H7RA 3HQOA 3M47A 2PRLA 1XLCA 1DXEA 1JPDX 2JK2A 4K1GA 3LI0A 3ABOA 1KRBC 3AYSA 4BWLC 3I65A 3LOTA 1W56A 2XZ9A 1ZU8A 2YOCA 4N02A 3R8HA 1AQ0A 1R7OA 1VPYA 2VRKA 2J7HA 1UD4A 3B3DA 3TQKA 1XDJA 2NQHA 1AZ1A 2WYSA 4ATWA 1AW5A 4JL1A 2I5GA 1R9XA 2GJNA 5E93A 5HAOA 3LXCA 3NXFA 4RE0A 3SCPA 3GH7A 4WVXA 1VYRA 4I3GA 4Z1AA 4AXNA 1XIMA 4QP0A 3W38A 3EDJA 1FWRA 3HG3A 2DU2A 4ZO9A 3NQDA 3G0UA 4QR6A 1UIOA 1WAWA 4IPPA 4LY4A 4E2VA 4HYWA 4LTSA 2WCSA 1JCYA 4GACA 4WDXA 2BHZA 2O9RA 3B40A 1YBQA 5A6TC 1BVWA 5FA5A 4HA0A 1N8FA 1KRMA 3BAIA 4I9AA 4JIQA 4EXQA 2VZTA 1GVEA 1CX9A 3VNJA 2C7FA 2DJXA 4EPEC 3UR7A 3B9DA 4O1CA 3V4BA 3DCPA 4ZOCA 2O7QA 1LBLA 1Z69A 2CWXA 3VIKA 2AAMA 3C3UA 2YX0A 1HXJA 2ISWA 3GYEA 4DXKA 5H8PA 2BBFA 2Y5JA 4I6VA 5H8MA 2PFHA 4AF0A 1V7YA 3QC3A 3BSGA 1YKWA 3NQAA 4OIFA 2CITA 5KZEA 1JNDA 2PURA 3ES7A 2X7WA 2QF8A 2OYLA 1PTGA 5A6LA 3SUWA 4DJFA 4UXDA 1I8JA 1V3JA 3KTXA 3CWNA 4R7WA 3CMFA 2CWNA 1N55A 4H6EA 4CEUC 2IPGA 3VGDA 5E09A 3KP1A 3S8HA 3SDOA 4QNEA 3OHMB 3ALGA 3KAOA 1QO2A 1TZ9A 3R0KA 3FOKA 4LCSA 4MB5A 1F6PA 3LENA 4KCUA 2R1NA 3S1XA 4RNJA 2E5CA 3YPIA 3SBFA 3MSRA 1XX1A 4XIMA 1CLXA 4B9ZA 3M1ZA 3RM4A 1CDGA 1KFLA 1Q6GA 1R0MA 4PGLA 3UR2A 2QGHA 3PZQA 3UPMA 1V51A 1TA3A 3UERA 5F1VA 4HJWA 1MSSA 1TO3A 5G2WA 2B31A 1A0DA 1Q3NA 3UJRA 4U5KA 4TR9A 4J7RA 3ATYA 1XLAA 2REQB 4E3VA 1S5TA 1I45A 5HWMA 3PAJA 3KLLA 1C8QA 4GYFA 3W1AA 3TA6A 1M7PA 3A9BA 3QHOA 3D47A 1UH4A 2UBPC 4JTLA 1M6JA 3B9AA 4MY1A 4QJ3B 3BE7A 4JTHA 1ITCA 2WQDA 4DZHA 4XVDA 5DQPA 1HJSA 1VAHA 4AD3A 1Y7VA 4NHVA 3LG3A 5AECA 1P7TA 4W7UA 4AYGA 1FP8A 3RX3A 2A3HA 4PB4A 2VEPA 3GG0A 3TMQA 4DBSA 1RALA 3QLLA 4DWDA 1A5UA 3MUIA 3ZR4A 3OVQA 4MJ4A 2ACUA 3N13A 3TLLA 3BAYA 2D0HA 2VHLA 1XLKA 1FCQA 2QCHA 2W62A 1TV7A 2Y63A 4ROPA 3NQMA 2IKHA 5G1MA 1V3HA 1G0CA 4UR8A 1UBPC 4DZ5A 4H3DA 3WQPA 4IPJA 3IK2A 4Q8UA 4DAIA 4IFRA 1GYMA 1VCFA 3W27A 5I07A 1DJHA 4TMBA 4GFSA 4KRZA 3WQDA 3RPDA 1CB7B 4PUNA 1UP3A 3M46A 4JTJA 1CPUA 3S5YA 4GYJA 1WKDA 4ZE5A 4EE9A 3VNDA 3H70A 4DF2A 1NOFA 2GGGA 1RA0A 1Y65A 3OEXA 1FVPA 2ZX9A 3UF9A 3P2VA 1W5QA 1ZJIA 3IIXA 4O8AA 4DBUA 1AODA 2YB4A 4ADSA 2I9UA 3TOYA 4RDWA 3W1RA 1G5AA 4QDMA 3PJTA 2PTDA 3BTNA 4D9PA 3WSUA 3IJ8A 3N6QA 4B2DD 3AZTA 3WK3A 4HKPA 3GNXA 2RJHA 4H8NA 3B97A 1M7OA 3VCRA 4M80A 2E6YA 4LUTB 1MRAA 3LTYA 3VCCA 2GGEA 1LZOA 1A0CA 1JL8A 2OO6A 1H1ZA 1K6AA 5I3HA 3KTCA 4JHZA 5C8BB 2PP3A 1OK6A 2UZ9A 3P84A 3E6EA 3VOFA 1EKOA 4YMZA 1PZ1A 2B7QA 4PE8A 4C6FA 3DIPA 1E0XA 5D9OA 1P1MA 2PLMA 4AEFA 3MDUA 2QMJA 4QSHA 5CGQA 1GKRA 1UUMA 2YBTA 3E5PA 2OSXA 2ABBA 3CZ8A 1NVMA 1I4NA 2WXDM 3OBEA 4NNCA 1EJWC 3CQJA 1SW3A 1I6NA 5CPTA 2Z25A 3ARSA 2CFFA 3F2BA 1M65A 1OVDA 1TRIA 1F07A 4NVTA 2QV4A 4J40A 2C1IA 4G7FA 3BSHA 2F8QA 4DJEC 3VNZA 4RE4A 2OR2A 1IEVA 5HUOA 1HW6A 4ZQRA 3ORWA 4N9BA 4I90A 3T4CA 4MUPA 2JFEX 4N9DA 1W9PA 2FGLA 5A8PA 4GY7A 3AS1A 5EBAA 2PCQA 4ATDA 4GZJA 5J5DA 3SIZA 3H7VA 3MHUA 1GZ1A 2WKJA 3MB9A 3B05A 2CEQA 3AXKA 5BXSA 3LNPA 1F6YA 2PRHA 4WZHA 2AQWA 5BW6A 4DX3A 3LCLA 2ABAA 3WJWA 1JG9A 1PYMA 1CGTA 2BWGA 3CWOX 3SCSA 1OY0A 3GZ3A 2QCDA 2J27A 1BWVA 2RKXA 3HGRA 1TJ2A 4HK7A 4PSRA 4QLJA 1KKRA 1KM1A 1W3KA 1KFBA 3E96A 3T2OA 1FY6A 3MA8A 1OCNA 4QE4A 5DY3A 4PMZA 3CQIA 5HMDA 3AMDA 1TUXA 2X0YA 3GW3A 4QITA 3WDPP 3WELA 1LWJA 4L1XA 3W7EA 1E9IA 2EPLX 1Z32X 3IGSA 1PDZA 1A5NC 2OWCA 3BAXA 5LSMA 4ML9A 1A4LA 2HVOA 2D73A 1UHVA 3P80A 3QV8A 3VDAA 3DYPA 1H60A 3CLWA 1PV8A 1U30A 1E0VA 1VEMA 1B54A 3HN3A 5C9UA 4O19A 2OWWA 3UWVA 5A2AA 1ISYA 1FCUA 1C8XA 4KWWA 3OZOA 4RW5A 1V4YA 3IVSA 1P5BA 1JZ2A 1PE1A 2GGJA 4K6AA 4YTQA 2Z1BA 2YXOA 4DZIA 1W9BM 3VD4A 2ZFAA 3F4DA 3P74A 3WQFA 5JUVA 3TTEA 1QPNA 1TVPA 1S5VA 4H7CA 2FTYA 2I7GA 3NNTA 4DYJA 3UA3A 3NWRA 4PMYA 1UJQA 4QAWA 2WBKA 3AMCA 4S3KA 5CAKA 2CLIA 2DT0A 3KOWA 3BOXA 4LJ3A 3MCNA 3STPA 1P6CA 4K8HA 1EF3A 2PS2A 3VTRA 4O28A 4BF9A 2VC7A 3L4ZA 1LF1A 4D6DA 1J0KA 1T6MA 4L64A 1E51A 2HDJA 4X61A 1LJYA 5FJTA 4RUBA 3W6YA 5J04A 2YJQA 1IE7C 3CIWA 4ZQCA 3QRHA 2WC3A 4UOQA 3ZLGA 5MHBA 1W0MA 2I16A 3WUFA 1BFNA 4KQNA 5I6SA 3TSDA 3AALA 1W6TA 1LDCA 1MUCA 3GTIA 4MYXA 4HZ7A 5GNZA 3W53A 3W1QA 1KGUA 2E5BA 3Q37A 4J3SA 4Q8MA 1IHIA 4ML4A 2WAGA 2HK0A 2ZTKA 2ZUVA 3AYRA 2PTWA 5CZTA 1QOPA 1VC4A 1GOIA 1PX3A 4EIVA 1IEIA 3TIMA 3LI1A 1C8VA 1H7OA 1P48A 4UMAA 4MPQA 4Z1YA 1WYIA 3GU9A 3SCQA 4FALA 1P6WA 2TYSA 4Q8PA 4QS6A 1W8SA 1CCWB 1GZJA 1TPB1 4FF7A 1HJUA 2DV0A 2VZVA 1RUSA 1ZPTA 3EB2A 1X6NA 1QHPA 2FVLA 3L23A 3Q2DA 1IV8A 1H7NA 4C6KA 1BWKA 3ARQA 4I7VA 2VUYA 1UPPA 3CAKA 2BXVA 1DJXA 1FKWA 3K8MA 4MFDA 1UD2A 4U5IA 3ZS4A 2HS6A 1PVNA 4PBGA 3LYEA 3WY1A 1R6WA 4IGSA 4LUYA 3U7BA 4GXPA 1JD7A 4JTAA 2YXGA 2A2IA 1WZMA 1YXCA 1UROA 4IJCA 1PB0A 1X97A 2VD8A 3MP5A 2A3BA 1Q8JA 3APYA 5XINA 2ON3A 2R1PA 4D8LA 2J8FA 3GH4A 2FHBA 3WK2A 3WCZA 3V7PA 1CLKA 1UQYA 3OG2A 1U22A 4WCJA 3SEPA 2VP8A 4LY8A 1OGGA 3TP4A 1FX6A 4J3XA 5BMWA 3OVRA 1D3GA 1UPMB 4AHPA 1NU5A 3REQA 3LPFA 4GQRA 4A3QA 3N34A 1MUWA 5I2UA 3LHZA 4UFIA 2W91A 2YDSA 4FSAA 3RDKA 2EKGA 3HGOA 1WDQA 3ID7A 3PZTA 1XCFA 4ACZB 4UQAA 2PGFA 4LW7A 2GJLA 4XAZA 2RDUA 3AUJA 3QPYA 2PD9A 1H09A 4M24A 4MZYA 2E40A 8CGTA 1RVGA 3DFYA 4YXGA 3EDKA 3VGEA 4F9JA 1EDGA 4NX0A 1LROA 3N6JA 2J13A 1T99A 1N82A 1S46A 3FYPA 4TV5A 1GHRA 3K46A 1KM5A 1EF2A 1BF2A 4RW3A 4C6CA 1YNYA 5AFDA 1TTIA 3N3TA 1FHDA 1K4HA 4M1BA 4NZ5A 2UY5A 1W3IA 4D6JA 3ZLHA 5DRCA 4UUIA 3TOPA 4IZGA 3M6DA 4HZ6A 5HMSA 3WFZA 1XCXA 3VMOA 3AIBA 3BK0A 3ZYZA 4MNKA 5FJUA 3RFAA 3S1VA 1UKQA 2I14A 3B8WA 1WX0A 2B4GA 2QULA 3M0YA 2I9EA 1UUQA 3FS2A 2Z2AA 4QROA 3LHUA 5IBXC 2FFIA 4MWAE 4EF9A 2DZPA 4PN2A 3PZ9A 4BEQA 1PCWA 3BW4A 3V0TA 3SUUA 1WDDA 3TTQA 1EBGA 3DYMA 3PBUA 1RR2A 3UWEA 4KETA 4IG2B 2VVNA 4ICMA 1GEHA 3W1XA 4P7OA 1R2SA 4BCEA 3OQ8A 3RPMA 4O4WA 3KVKA 1XF0A 2BGQA 1ZBVA 3VC6A 1H7RA 1X1OA 3LA4A 3W6MA 2XM2A 3UR5A 1TWZA 4RR4A 4HK6A 1L6GA 1JFHA 3P6LA 2FZBA 4PMNA 1YPXA 5ABFA 1KB3A 1X1NA 4AVOA 4NUWA 4L9ZA 3OU8A 1Z7AA 2XJ7A 4N7QA 2XVPA 2X42A 3ARPA 3WF1A 3UZXA 1EZWA 3W1UA 4HNLA 2DH3A 1GVIA 3QM3A 4GPNA 4X0NA 1R7AA 4AZ5A 2J9ZA 4B4HA 4PMOA 4BKNA 1XWYA 4KEZA 1DWIM 1MFUA 4BZYA 2GWNA 1UZ1A 4AD4A 4AX6A 2J66A 2WVSA 3G1DA 2CU0A 5CJ5A 1TJ0A 3TROA 5HINA 2XFFA 1OABA 1VENA 1K02A 2C71A 1W3NA 4F0HA 1E71M 1SFSA 3CQKA 4O16A 3I4KA 3K1DA 3P5ZA 1Q66A 1TV3A 3CV7A 4NJGA 5DMNA 2F6KA 4A2SA 2QPXA 1OZMA 4REQB 1C91A 1XGZA 1R8LA 3GU1A 2Y61A 3H6OA 3M4HA 4NRRA 4TVUA 3IGHX 3F7JA 3L2LA 4B91A 1K8ZA 3C6CA 1UG6A 3CMJA 1VIZA 3ISIX 3ITYA 2H6RA 2VO5A 3AIUA 4L9YA 1XW8A 4L4MA 4WKHA 1DOSA 2GJPA 3BCFA 3GIPA 3TU9A 2HROA 4N2YA 2XGIA 1ZUAX 1F4AA 2VRJA 1OD8A 4ZXOA 1R86A 4AU0A 1EUAA 2DJLA 3M0JA 5BOFA 2BY3A 3N2CA 3TYEA 1S39A 4J4KA 4FNRA 3O6AA 4UTHA 3BJSA 4GNKB 3TN5A 3WNLA 5DMYA 4GGBA 4Y6GA 1H2JA 5JBDA 4QLKA 3IJQA 1BSLA 2P50A 4HA1A 1MZHA 1PAMA 1T7LA 3LGEA 4I7WA 1F2JA 1O66A 5FKYA 3O0FA 1ZZMA 2OLHA 1MW3A 2PZ0A 3OLGA 3KBVA 1UWTA 5BRQA 2J75A 7XIMA 2OX4A 3RLHA 3WX7A 3GQYA 1UP0A 3FFSA 1VP5A 1RCQA 2DY3A 1EC8A 1XLBA 3LQLA 3S1WA 3N9SA 1TIWA 3UT0A 3GSMA 3WDRA 3TNOA 3SFKA 2H8XA 3VD5A 2QCFA 2DUXA 3B0UX 3TA9A 3UG3A 4JQ1A 3FKRA 4PCSA 4LEFA 5AYYA 5CSUA 1PUDA 4YYCA 1D2KA 3MI6A 1A0EA 3MI2A 1Q5MA 3DFHA 3SI9A 1XHGA 4EPKA 3A3HA 3C0QA 2NLYA 1YDNA 3OPSA 3G0SA 1UB3A 3ZT5A 2FFCA 4CNOA 3RCNA 3NL3A 4RZ4A 1ICSA 4FIRA 4MKSA 4QDWA 2R1MA 1W3JA 1CW2A 2PZNA 4Z2GA 4UQCA 4OBRA 1SVDA 1CEOA 1VEOA 4BQ5A 1TPFA 1S1RA 7ODCA 1FRBA 2PDKA 4O0KA 1XINA 5EPDA 2J7GA 4B5TA 3VKJA 1HN1A 2OGYA 5AHMA 3I6TA 1JPKA 2ZRUA 1CNVA 3FV9A 1J12A 3NA8A 2YKKA 3U2CA 1FDYA 4C6PA 2FZ9A 4HZ8A 4FXFA 4ORIA 4Q4SA 5TAOA 4HU4A 4TV6A 3WF4A 5IXEA 3GTHA 3WH8A 2WLZA 2JF7A 1AQFA 3EAUA 3AISA 1BVNP 3W6LA 2Y1HA 4CCCA 1YDOA 3UJSA 3MT1A 4M51A 5CZKA 2PLJA 1ML1A 2WKLA 3GH5A 1FWWA 1S5MA 5AHEA 3GC4A 1CENA 5AHLA 2IKGA 3MQTA 2PWGA 3DU0A 2PU1A 1ENUA 4DO6A 4IUGA 3VNIA 1QWGA 4Z1CA 3PBWA 2CYGA 2QYGA 3HQ1A 5I3FA 5DCEA 3GHSA 2IKIA 3CYJA 4ZEPA 5A69A 1JIBA 1BXNA 3QY7A 2GJXB 2ZVIA 5CGTA 2ZYFA 2UV8G 3M5VA 3A64A 1W5PA 3PZNA 3WUBA 1XFBA 3I7QA 1GJUA 1TWIA 3AS2A 2X30A 4Q4MA 4PL1A 3W02A 4NAEB 1XYFA 1QNOA 3WNOA 5M17A 3VD9A 2PI6A 1EIXA 5C9WA 4XZIA 2WMKA 2Q71A 5CGMA 1XBVA 3HJEA 1EJ7L 2CXEA 1B90A 1PO9A 2VFGA 2CBIA 2YBVA 2KX9A 3M0ZA 4KRTA 2OGJA 3SJNA 1REQB 4KWVA 2FZ8A 1OGSA 3UJ2A 4B3KA 5EMUA 3FK4A 3LRLA 3A5FA 2YA1A 2F6XA 1XC4A 1HKMA 3V36A 4OT7A 2P0IA 1JQXA 1YXYA 4GC3A 4PCTA 2DT1A 3BG9A 4WF7A 2GSHA 1W5NA 4PTMA 2BDQA 2NZLA 1FP9A 3VM5A 4NY2A 3ABSA 4Y9MA 4PFHA 3ARRA 3UCCA 2VGIA 1ECEA 1JJKA 4MB4A 4GBDA 1BKSA 3THCA 4R5EA 2KAUC 1OD0A 1VCGA 1FWBC 2FPTA 3L4VA 4PTVA 4AWEA 4PMRA 1US0A 4D2JA 1GZGA 2E1WA 4OUEA 3OW1A 1UW9A 4CNSA 2D69A 3RN6A 4Z2JA 2P1FA 2EEXA 3W00A 4PMQA 3CHFA 2G97A 1DWGM 3KEHA 5KINA 5H91A 3FYYA 5CAHA 3WNPA 4CVWA 1EPXA 4FF5A 4X9SA 1CXKA 4L4OA 4Q8OA 5CC3A 3NL5A 1GOWA 4AISA 2GVLA 4TXEA 1TV2A 2OT1A 2GQ8A 4MYAA 3LLFA 1H7XA 3P0WA 1YDYA 1MEHA 4D8ZA 2NVCA 1L6YA 3T1GA 2XU2A 3FAXA 4B3LA 2YSWA 1C90A 3RPTA 2XGBA 1GW9A 5D37A 3CV1A 1A3XA 2C16A 4HB7A 1OK4A 4GUFA 3W25A 3WLRA 3VDGA 1HKVA 1JAEA 1AD4A 1S5WA 1NWSA 3KW3A 3CB8A 4H41A 2ZQ0A 5DLCA 1ZBCA 4F2UA 1EJUC 3KLKA 4G7EA 3FYOA 3GHTA 3GXPA 5G5IA 2HTMA 3FJ4A 5CG7A 3QN3A 3QPEA 4LAKA 3QQWA 4PB3A 3L4XA 2FPVA 3WDHA 4HPGA 5AOUA 4FX7A 4N9CA 4YS1A 5JQ9A 1THFD 3PFMA 3MKVA 5LA1A 4NAFB 4BWLA 1TV5A 3R89A 3A12A 3UWYA 5HXMA 1MDRA 4IPIA 4LAOA 4KERA 3KFTA 1DXFA 4GISA 1RP9A 4AHOA 2VEFA 2I57A 1D7KA 1E0WA 2DZAA 4MFEA 1OC5A 1ZRQA 4CN4A 4GRSA 2E9MA 4RPPA 4S2BA 3MMTA 3RITA 3NQVA 5H2ZA 1WA3A 4CEXC 3LV5A 4JHOA 4LCRA 4H83A 5C2GA 5E1QA 3S0CA 4LEQA 3PZOA 3LNMA 3SUSA 3K30A 1LOQA 5D03A 5LNVA 3EMQA 1DWFM 1YW1A 4UZUA 1LP6A 3NPUA 1GVRA 4JIHA 3LXAA 2ATMA 1X96A 3MC5A 2KZHA 5DXXA 4KWOA 3UFYA 4Q33A 3N18A 4QG6A 1RP8A 3VPLA 4DHGA 3OLIA 3T8LA 1GOOA 2J74A 3CEPA 4IMFA 2BHUA 2ZVRA 3WQWA 2G50A 3PZGA 1S2TA 3VAVA 3DFPA 4CQAA 4LFYA 2TRSA 2WNQA 4O0ZA 1GQIA 4UFJA 1FDZA 3HZ3A 2X05A 3UWQA 3UP8A 5KETA 3BJFA 1LL6A 3C0LA 1FHUA 2XIQA 4OQVA 1CLVA 1SFLA 3K8KA 3W28A 3S9ZA 2Y62A 6REQA 2NT0A 3CL7A 4F48A 4WUIA 1H62A 5AC7A 2CLEA 4WD0A 2WJEA 2ZXBA 3WF2A 3EMCA 4IIGA 5C9ZA 2PA6A 2PSNA 3PR2A 4C1NA 5G2HA 3UCQA 3LERA 5DRIA 1H7WA 4AUBA 4PTXA 4L65A 4LVAA 1W5OA 3SCVA 1JCMP 3PWGA 3EOOA 2Y8KA 3O8AA 4GINA 2J79A 1RBAA 1PXGA 5AHFA 1B4EA 4DF1A 4GI4A 4E4FA 1Q4NX 5I77A 1DIEA 2YZRA 2EG7A 3BLLA 3T7VA 1B31A 4QGCA 1NQKA 5I3JA 3GVRA 3QF0A 1T0OA 5PTDA 3BZJA 5IRPA 2Y7EA 4XO6A 3TTYA 2W9MA 3GTFA 4US5A 3P5YA 4ZSTA 3VZZA 3W2KA 5HJYA 2WSPA 4PSPA 4JEJA 2B7OA 5FESA 3RG6A 3MY9A 3VMNA 1X8FA 3JU2A 1I75A 3ZVHB 3G3MA 3BMXA 4A29A 3M5YA 1KXQA 3UWUA 1W1VA 4CD5A 1KLZA 4LRSA 1FWSA 1TMLA 2UY2A 1MW1A 1P6BA 2A3LA 4QQUA 1T8QA 1Q45A 4EACA 2CZFA 2HV5A 1AH4A 2VM8A 2WV8A 1JUEA 3PJWA 4MWAD 2R94A 4KT2A 4R7OA 5BOEA 4DZAA 1W1ZA 3B9NA 4E2DA 1MZRA 5HJXA 4Q8VA 3E74A 3VU2A 4I5RA 1OFOA 4XSLA 1QI0A 2J62A 2G3MA 3EXRA 4OJYA 1E4IA 2H9AA 1DWAM 4JFSA 2A7NA 1JAKA 3HOJA 3LCWA 2E4TA 3UWWA 2CLOA 3WF0A 1KR0A 2YYUA 4KW2A 4OWGA 3EB4A 4GKTA 4P7QA 1TV4A 3BW2A 3EDEA 1LLWA 1XD0A 1U5HA 4LYRA 2B0MA 4EXBA 1LOLA 3ZJ8A 4L4LA 4H9MA 2C15A 1PL9A 4A05A 2ZX7A 3KZPA 5IDIA 2O55A 4B90A 1DIOA 3GTXA 1NY1A 1E73M 3ICJA 3TQVA 4Z2IA 5DFAA 2BB0A 1E5NA 1BKHA 4IISA 1WAUA 1LUCB 4BFAA 1AJZA 1V02E 3T0TA 3GDTA 3V0UA 4H7VA 1V0MA 1ZP3A 4PTNA 5D8WA 4RDZA 1Q6EA 1EBHA 3H2NA 2E8ZA 2OT0A 2XN2A 1KW1A 4PMVA 3T44A 1IEQA 4GVFA 2HE5A 4TQTA 4IXXA 2BY2A 3CUFA 3QLDA 3WZ0E 5EA9A 1VD6A 1ZCOA 2C18A 3O3RA 2BLEA 1TRDA 3S2MA 2EF9A 3K2GA 2YW3A 4XD4A 1BXBA 3PTKA 1SR9A 2ISDA 1WDWA 5JIPA 4MZ1A 2DIKA 2FZMA 3EA2A 2HXUA 2Z24A 2D2JA 1AQMA 1NFGA 3CH9A 1XRTA 2YCIX 1EWEA 3T0CA 2C3ZA 3MUCA 1FHLA 4WOQA 3W81A 2NX3A 3B8TA 3S4TA 3BLPX 4FXRA 3W7IA 1XYMA 3ELFA 4Q8WA 2PWVA 3H54A 4A2RA 5HWNA 1VFFA 2W5FA 5CPLA 3AMKA 5JXQA 3AMLA 2NQ9A 2DVTA 3TN4A 3A5VA 4H9YA 4ACZA 3T0BA 3DX5A 1WQ5A 2HMCA 3R8GA 4V1YA 1SSGA 2XTKA 1OYBA 4WX2A 2HSAA 1W54A 1EDTA 3PFRA 4JQAA 1AG1O 3U5UA 4YCOA 3D46A 3OIXA 4CQCA 1P0EA 2ZXDA 3QHNA 2E28A 3UXIA 4DO4A 3WQGA 3CT7A 1ZJAA 1G4SA 1KFWA 1DORA 3IIVA 2Q02A 1DJIA 5HANA 2XUCA 1OM0A 2GLKA 5I78A 1LM1A 5TNVA 1KRCC 3UWZA 4KKXA 4IPNB 1YLVA 3GG1A 4OVXA 4K38A 1FWNA 3CV6A 1MWOA 4DNHA 4EPDC 3VIFA 2D22A 4OHQA 1TSIA 3N14A 1NDWA 3T0DA 2BY0A 1R85A 5D33A 1KXTA 3FEMA 3M7WA 1DJGA 3FIGA 3LX9A 4DLMA 4AIOA 4H9VA 3MKKA 2X0HA 1Z44A 4HNCA 3L9CA 3LY0A 3ARVA 4UCFA 3QGKC 5F2GA 4WQ6A 5FF3A 4ATLA 4W9TA 3OLEA 5LIXX 2CLLA 3LLXA 4IG2A 3WQ4A 5U4NA 3S5SA 3N2TA 1OWQA 3E2RA 1E4LA 3CAVA 2DFAA 5DX7A 1NDYA 2ZX6A 4FPSA 2PP1A 3T07A 2OZTA 1H0GA 2V63A 4XD3A 2NUXA 2XVLA 3KZSA 8RUCA 1FFRA 6XIMA 5EU9A 4M6VA 4LPCA 3G77A 1QT1A 4BF7A 3W70A 3TH6A 2P5NA 1QWKA 3QQ0A 1AL7A 1V6UA 3E2SA 4HD5A 1KTCA 3V75A 3VC5A 4WY0A 3GXTA 2J8GA 3RLGA 1RBOB 2PTXA 4KPLA 2PDNA 4H8UA 1OFAA 5H6HA 3MVTA 1H5VA 2YDQA 4LSBA 1R3QA 4AWUA 3T4WA 4Q6XA 4ZA0A 3G1XA 1UJPA 1KR1A 2V0TA 1HVXA 1D3CA 3L5MA 2TPSA 3ABZA 4AAJA 3BMVA 1E6XM 4XZLX 4CKQA 2WJFA 2HZGA 5LHFA 1HQTA 3VNYA 4BI6A 4N42A 3KVLA 3HO8A 4LXFA 4XTIA 3EXSA 3P7YA 3PAOA 5L6UA 3KCJA 3P3BA 1WZAA 2GUBA 1WBJA 4REQA 5MKGA 1KWGA 2ZDRA 1E3ZA 1QMLA 1BYAA 1AQHA 1VCVA 2P88A 3P82A 4XUGA 3KUMA 5JU6A 3FAWA 1S1PA 3SADA 3A3XA 1S2CA 4DI8A 1P0BA 1ZJBA 2J78A 3AIQA 3MMDA 3WN6A 3TCEA 5C7HA 3K5XA 2V8ZA 3APGA 2PGEA 3EB3A 4EANA 3BLFA 5LNRA 3NQEA 2FKPA 5C2XA 4O1FA 1XSKA 5T9CE 3VIMA 2GGHA 2Y4SA 3BWWA 4HIBA 1Q6FA 3C0SA 3IV8A 5AKQA 4Q7BA 4I9TA 1BRLB 2GQAA 1IGWA 6TAAA 3KX6A 5IOBA 3G6MA 5KZDA 5HUPA 3DERA 2ONEA 3L12A 3EPOA 1W1TA 2GVEA 4I5XA 3TMLA 4C6JA 3SSJA 4OECA 4LGXA 1IT8A 1EIBA 3O6CA 4CD6A 4IQDA 2Z7GA