1YX1A

Crystal structure of protein of unknown function pa2260 from pseudomonas aeruginosa, possible sugar phosphate isomerase
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
250
structure length
250
Chain Sequence
LHPVSISLSSYGADLVRSRGQASFLPLLAMAGAQRVELREELFAGPPDTEALTAAIQLQGLECVFSSPLELWREDGQLNPELEPTLRRAEACGAGWLKVSLGLLPEQPDLAALGRRLARHGLQLLVENDQTPQGGRIEVLERFFRLAERQQLDLAMTFDIGNWRWQEQAADEAALRLGRYVGYVHCKAVIRNRDGKLVAVPPSAADLQYWQRLLQHFPEGVARAIEYPLQGDDLLSLSRRHIAALARLGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of hypothetical protein PA2260 from Pseudomonas aeruginosa
rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein PA2260
total genus 90
structure length 250
sequence length 250
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2005-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 1yx1A00
4PFHA 3BWWA 3CQHA 1A0CA 4X61A 6XIMA 3UA4A 1A0EA 2HCVA 1XLJA 1CLKA 3CNYA 1OADA 3QXBA 2NQJA 4QE4A 4YTQA 1XLEA 1XLCA 3CQIA 3KTCA 3M0YA 1MUWA 1XYCA 4ZBCA 1I6NA 2HK0A 2QUMA 4YTSA 8XIAA 2QW5A 8XIMA 4GJIA 4XSLA 4GLEA 3C0SA 1S5NA 4ZB0A 4LNCA 5B7ZA 3KBWA 4Q7IA 5B7YA 3VNJA 4HHMA 4ZB2A 4A8IA 4X60A 3NGFA 4QE5A 3L23A 1XP3A 3WQOA 1XYBA 4QDWA 3VNLA 4X63A 1XYMA 3ITXA 1XIFA 3KBJA 3XIMA 7XIMA 2XIMA 3QYSA 3BDKA 1XIJA 2XINA 3AAMA 1XLKA 3C0QA 3BZGA 4K3ZA 5B80A 3TC3A 4GQBA 3ITOA 2GYIA 3BZJA 3P6LA 4A8LA 1A0DA 1K77A 1XIIA 1XLMA 3IUIA 5TNVA 5XIAA 2ZDSA 1S5MA 4YTTA 1XLBA 2HK1A 3KCJA 1XLFA 2I57A 1BXCA 3AALA 3LMZA 1DE6A 3KBNA 1XLDA 3M0MA 2X7WA 4XISA 2XISA 4HHLA 4A8NA 4HGXA 3QZAA 5XIMA 2QUNA 3AYVA 1DXIA 3ITYA 4DVOA 3VNMA 5C9ZA 3M0HA 2X7VA 4OVXA 5XINA 2G4JA 2NQ9A 1BXBA 4YTUA 5FA5A 1QTWA 3KBSA 2Q02A 9XIAA 4QDPA 4XIAA 1XYLA 3CQJA 4PGLA 4XKMA 3BANA 3ITVA 3KWSA 4YTRA 3M0LA 3AYTA 4K1GA 1XIGA 1XLIA 1DIEA 3M0XA 3OBEA 4HNOA 1XINA 1I60A 3VYLA 1DE5A 2OU4A 3KCLA 3KBMA 1XIEA 2GVEA 5EMMA 2QULA 3JU2A 3ITLA 1XLGA 3KCOA 4A8RA 5EMKA 1TZ9A 4QE1A 4G56A 3VNIA 2G0WA 5EMLA 2GUBA 4QEHA 3FVMA 2I56A 4E3VA 3VNKA 3N4AA 5J8LA 1YX1A 1MNZA 4XIMA 4EAYA 2J6VA 3QC0A 3P14A 3KBVA 1XICA 3C0LA 4US6A 3IUDA 4KW2A 3UVAA 3U3HA 3CWHA 3ITTA 1QT1A 1DIDA 2GLKA 4GJJA 1XLAA 4DUOA 3TVAA 3U0HA 3UU0A 4EACA 5AVHA 3GNXA 3UXIA 6XIAA 2ZVRA 4J4KA 4XSMA 3UA3A 1XIHA 1XISA 2NQHA 3DX5A 1XLHA 4QEEA 3DBNA 1XLLA 3XISA 4ZB5A 1XYAA 5EMJA 3XINA 1XIMA 1QUMA 5H1WA 3M0VA 4W4QA 1GW9A 5AVNA 5H6HA 1D8WA 1O1HA 1XIBA 1XIDA 5I7GA 9XIMA 3IUHA 3CQKA
chains in the Genus database with same CATH superfamily
4DZHA 1LOQA 4CEXC 2NQZA 3BV4A 3OGRA 5JH2A 3VKAA 1XLCA 2VZSA 4GINA 2A7PA 4N9BA 3CB8A 1XGZA 1T7LA 2XH7A 4HK6A 8A3HA 4BF9A 1O68A 1KC7A 2WMIB 3QQ0A 3SCNA 3VM7A 3K1DA 1TMLA 3VIKA 4RV8A 3BZGA 4Z2JA 3R8GA 4GQBA 1E6PA 1IEXA 1J5SA 4HNVA 3LQLA 4X2PA 1W5QA 4F0SA 3JZEA 3TNOA 4ZOBA 5C0QA 3UW6A 2BP1A 1TE6A 4HN4A 3P8JA 2CZ5A 3B4YA 3SUVA 1O94A 1V0NA 3TK7A 4J2MA 4F66A 1XUUA 3DU0A 4JTTA 1OCJA 3RCNA 1FVPA 4B3ZA 5DXXA 4ZODA 3SAZA 3PJTA 3DAQA 3WMBA 3PBVA 2CLFA 4C60A 2B7QA 2B7PA 5IBXA 1E5JA 2Y8UA 1KRBC 3P74A 1V3JA 2XM1A 4LALA 2CKSA 1X1OA 3TR9A 4BHYA 4TMCA 4QS5A 3R11A 3L2MA 3DENA 1Q6DA 1XLLA 1XV8A 4D6GA 1E6ZA 1V6VA 3ALFA 1NOUA 4B3LA 2X2GA 1FCQA 4HSNA 3TSDA 2PDJA 2NXHA 1K4HA 4WXZA 4ERIA 3PPHA 4HCHA 4P8WA 4L80A 1OCBA 4UFHA 1I45A 4NX0A 4HMNA 4C6FA 1OX4A 1B0IA 1QI2A 3KRSA 3MS8A 3UWVA 1SR9A 2EG6A 5BU6A 1V7AA 3LHZA 3SDOA 4BI5A 3G3DA 1I2PA 1U1HA 2CBUA 1AJ0A 2PU0A 1GOIA 3KL0A 3GUGA 1JZ7A 7REQA 3MT1A 4H6QA 1I8JA 5AHIA 3O07A 2P5NA 2E6YA 4XG1A 1OF6A 1SMDA 4NYYA 1CLVA 5M17A 5LXEA 1VJZA 4AH7A 5DMLA 3NQFA 3CUFA 1F8IA 2I14A 1MO0A 1KM6A 3RO8A 5HULA 5IXEA 5MF5A 2ZVIA 2F2HA 4I9MA 1Q6OA 2HPIA 4IZGA 3ZSTA 3VO0A 1PKNA 2RDTA 3WFLA 2IPJA 5D05A 3GH7A 1EWEA 1TWSA 1UKOA 1QW8A 5C9WA 1REQB 1TPFA 1UZ1A 3C2RA 3PB2A 4NVTA 2Y5JA 4FF7A 1E5NA 4KCWA 3SR7A 3EMZA 5FF2A 2W66A 4NSBA 4ADUA 2ESCA 4UTUA 3ANVA 1E1CA 1E9LA 1EEXA 4YTQA 1E0UA 3N6HA 4FO4A 3IARA 4IJBA 1FXPA 4IISA 2C79A 3VZZA 3DESA 1O7AA 1REQA 1VR6A 4DJFD 1JF6A 1GJWA 5F4SA 1G5AA 3F5KA 2DVXA 5AKQA 4QE5A 3CHVA 2WSPA 3M5ZA 4GH3A 2PD9A 2Y85A 3PBMA 1JD7A 5CLWA 1JFHA 4O0KA 4Q32A 3AS1A 4CD8A 4RW3A 3TTOA 2BOFX 4QLLA 1SZGA 4V33A 1FKXA 4ZEPA 1W8SA 4IHCA 1JG9A 2P50A 3FGCA 4DBDA 2XISA 3RM8A 4ERGA 4F79A 2WLYA 3G1DA 3F4WA 2OJPA 1S39A 2X1TA 4IXXA 4J7RA 3TSMA 4IQEA 2ACRA 2JFEX 3M0LA 2HNHA 3RRAA 4JIIX 3LX9A 5EMMA 3ITLA 1ISYA 1Y7VA 2A4AA 4M7SA 4C5YA 1TTQA 2VX5A 3ARPA 3V1PA 2PZNA 3WD2A 3KS5A 1JAKA 4DBWA 2VUYA 1QHZA 3U2EA 4XIMA 3SY5A 3B40A 3AMDA 5EU9A 1SPQA 4GIEA 2B31A 3SCRA 3CWHA 4GWEA 2XDFA 5EY5A 2Z00A 2ZXDA 3G1YA 1KKOA 4DZAA 1K7XA 4JQ4A 4KT2A 4IPNB 1P43A 4P2VA 3GNOA 5C55A 5HNNA 1TG7A 4GI4A 2PBGA 4IMGA 5GJPA 1B4EA 3JZUA 4PMOA 3PR2A 2WVUA 3RX4A 3LPPA 4PFHA 3TWAA 3GXIA 1LBLA 5A6TC 1IXOA 3ICJA 4M0XA 1Y0EA 2Q01A 1HIZA 2XJ7A 5CPSA 1FHVA 4HU3A 1CI1A 3SUWA 7CGTA 1JQXA 2CEQA 4D6CA 5B7ZA 5CSSA 3VABA 4UFKA 3SO7A 3S5OA 2FMNA 2HQAA 4RE4A 4D1IA 2QVHA 4AZBA 4NZ1A 5J04A 4JGDA 1BEUA 2QAPA 3RRXA 2P53A 3F5JA 2V69A 4MJZA 1XLDA 3P5YA 3VUSA 1IEIA 1YHTA 5JQ9A 5AC7A 2J47A 2O9OA 4I6VA 2DZSA 2WMIA 3GNRA 3NL5A 4PTWA 3T2QA 3IJ9A 3W1UA 5HQMA 4MAZA 4MZYA 3CQJA 2A3CA 4DPQA 1UH4A 2PP1A 4M6UA 4AZCB 1U30A 2C1GA 3WNKA 4LYRA 4PUMA 4EF9A 2X16A 1P7TB 4YL2A 1XF0A 2DT1A 1KFWA 1MEWA 3N4AA 3G1AA 3HA1A 1L8NA 1RJPA 2ASHA 2HS8A 1A4MA 2AKMA 5LA2A 4V1YA 1U5VA 2UY4A 2WV8A 1A5AA 4GACA 4AZCA 1W5PA 4QEEA 2R1MA 3KRBA 1JDDA 3A3WA 1ONRA 1XIDA 2DV0A 1Q6RA 3GB6A 1CB7B 6A3HA 1E51A 4GNJA 3G18A 3BLFA 4D6IA 2NQ5A 4QSHA 1J10A 3HF3A 3LRMA 3HMJG 2HK0A 4TTGA 3WQCA 3B0XA 1S5NA 3TONA 4AEEA 5AC8A 1HG3A 3KVMA 3TUUA 3MV01 3QV7A 1V0MA 4XTIA 3VOFA 3UFYA 3BMXA 4H6KA 3BAWA 7XIMA 4Y7EA 1NQKA 3PZQA 3KVLA 3NZRA 1VBHA 3WF1A 3G6LA 1GG0A 4IP4A 2HVNA 4MPQA 2OO0A 3VXGA 3VDGA 2E4TA 4WD0A 3KHJA 4UTTA 4P7QA 3U48A 4C6DA 1MZRA 4GZIA 3C8FA 1V08A 4XBJA 4A4AA 3GFXA 2R1KA 1XHGA 4O50A 1HUVA 4GUHA 2NZLA 2YCEA 1DIEA 3NQ8A 2F6UA 1SSDA 3GFZA 2O55A 1OT2A 4ZO9A 1OYAA 3A9BA 1SJCA 3FVMA 3OGSA 4JQ2A 2QJNA 4Z2HA 2YCJA 3ABRA 3AIUA 2MANA 1OZQA 2DUXA 1SZNA 2IXVA 3AYRA 4N42A 3AU2A 1OFBA 3MJMA 1C8VA 3UU0A 1AQHA 2HBVA 4U4MA 1KV8A 1XWYA 3GE7A 2B7NA 1U33A 2WMKA 2BZNA 1K8XA 3EX1A 2OZ8A 2VEPA 3ALGA 5HMEA 2DP3A 5I03A 3B3DA 2Z29A 1E0WA 2V68A 4KESA 2DSKA 1JXKA 1UWTA 2DJLA 4N02A 9RUBA 3PAJA 1HGYA 1XRTA 1KRMA 2X1RA 3UPMA 1SW0A 3B8WA 4KFPA 1ZB5A 2PFHA 2PU1A 1A80A 2QCMA 3KUMA 4IFOA 5CBBA 3CAQA 1LRQA 4JNYA 3SFKA 1KFKA 4W85A 1OCQA 3LLXA 3O6YX 1JVNA 1JZ5A 1XLMA 3W2LA 2V9DA 4U28A 1BQCA 3V5FA 1VEMA 3V3WA 1L6FA 3UXKA 1O5XA 2FGBA 3EWXA 2X7WA 1HXJA 4JZ5A 5EFFA 3G1XA 4JHOA 3WLQA 3FAXA 1VD6A 1UKPA 1MQQA 2ZZ4A 3CZ8A 4GPNA 3RJYA 1O4UA 4UTKA 3LHWA 2PCEA 4FK9A 3JUGA 3N2BA 4WSJA 1JCYA 2FHBA 1FWHC 2GQAA 3IVSA 3N2MA 1DXFA 1VS1A 1G94A 1TV5A 4DQWA 1J6PA 1H41A 3PY2A 1JCNA 5BXRA 2PPGA 4AHPA 4LVGA 4WY0F 3HZ3A 2DVTA 1XC6A 3FXYA 3W81A 1Q6FA 3M0JA 1KBIA 1F6KA 2VVSA 1D9EA 4G6CA 3R1ZA 1WOBA 3THCA 3M0KA 1PWLA 3EB4A 2WCGA 2J7FA 2JF7A 2Q6ZA 1HP5A 6XIMA 3WN6A 1EX1A 4LBRA 4I6KA 5DMNA 5ENLA 1PYFA 2IKHA 1LT8A 5ABHA 3MTWA 4MKVA 1MXDA 4MPKA 3NQMA 2NUXA 4CKQA 3PAOA 3O8AA 4NJJA 4A8IA 2PGFA 3LM7A 4O54A 3ELFA 1B30A 1CLXA 1H61A 1TVNA 4KCTA 4EF8A 1PCKA 1RPKA 2ZX9A 3R0KA 2Q3OA 4BA0A 3MSDA 3TYUA 1VBJA 1XLFA 3NR0A 4I7UA 3NL3A 1K8YA 1JXJA 1BYCA 2E0PA 3NGJA 5CEWA 1CXLA 4GUJA 4LYPA 3T0TA 2VZUA 4NZ5A 1GT8A 4H7ZA 4I5XA 4HOZA 1UC4A 4W93A 2PC4A 2PDFA 3HO8A 5FAGA 2V2CA 5CG0A 1AFSA 2YDSA 1EB3A 2I56A 1J0HA 1K1DA 3GK0A 3HGOA 4A2RA 5EYWA 2SFPA 2QF7A 3KP0A 3TXZA 4P7NA 4AZ5A 2PF8A 2YIHA 1E3XA 2XZ7A 5E9XA 1H0GA 4HOWA 3CEPA 2XIIA 3O6CA 1TJRA 3GTNA 1MYRA 2BHUA 4ML4A 1B9ZA 3G1VA 1G7UA 4L1WA 3T6CA 3LLDA 3E2QA 1G67A 1V3KA 4MNLA 4B2DA 1FDZA 4L65A 3NURA 3ZT5A 3L4UA 1I9CB 4IMAA 1JJKA 5HUOA 3AXKA 4JDBA 5AHNA 2CLKA 4FNSA 1H7NA 3W3OA 3ZM8A 3WIJA 1CTNA 5BZAA 1NDVA 3CUZA 1WUFA 1AW2A 1V3LA 1M53A 4S2CA 4R9OA 5A6BD 2YLAA 1E40A 4DIAA 1DE6A 1W5NA 4FHAA 4RL3A 3GKFA 3LU2A 3BJSA 4B5NA 3K1GA 1GVRA 1EA0A 2PB1A 2ZUWA 4WDUA 3VKDA 4MM1A 5JIWA 4RZ5A 4WKAA 4PC8A 2XFWA 5KZDA 1RHCA 3ARSA 1M41A 2ZCGA 4JD4A 4UTHA 2DEPA 7PTDA 1ELSA 4WGXA 4AWSA 2YCLA 4AISA 4DN1A 3T78A 1NFGA 4HHHA 3UWWA 1RBAA 4DM2A 1SGJA 1TPEA 1S1RA 3NOYA 1NVMA 5IDZA 3R10A 2QUTA 5ABGA 5BCAA 3TEVA 2YL5A 3PUDA 1VYRA 4LAMA 3W84A 2IQTA 1TFVA 4J4KA 4DUXA 2OZ0A 4NRSA 1VFSA 2VFGA 4A21A 1K9FA 3PBGA 1SFLA 2J7GA 3P67A 2OG9A 4FMVA 4AX6A 2ZADA 1SZRA 4GFIA 3URBA 3N11A 4H2HA 4S3BA 1FHDA 1EWDA 3FN9A 1PUDA 3W70A 4M6QA 2QUMA 1HJSA 1I2OA 3U7BA 1UR4A 3OODA 3TZFA 1NY1A 4PTNA 1S2TA 1OC5A 4ML9A 5FF4A 1VFUA 1A5OC 2PDIA 3W76A 2ZTJA 2Z1WA 1HFBA 4AUBA 5A6AA 3MI2A 1OFPA 3SECA 3TAKA 1OSEA 3KTXA 4LPCA 1CIUA 3MC5A 4JPGA 3SRFA 2E1DA 1TPVA 1YPIA 2RJHA 3BXWA 4ZE4A 4QBXA 3VAVA 3VVGA 3WEOA 3PUEA 2REQA 1RCOB 1VGAA 4A6GA 3U4FA 4I3GA 4JEJA 1WDRA 1RD6A 3OB8A 4HSOA 3B4UA 5FEXA 2UY3A 4XAPA 1DHPA 4EIVA 4PBEA 4R33A 1LT7A 1CGVA 3VYLA 4N9EA 4C6LA 1XIEA 1P6WA 1R86A 1ZJAA 4NJGA 3PUGA 2CC0A 1OZMA 5HJXA 3CO4A 3WEZA 2NT1A 3LV6A 3MQTA 3UR5A 1RY0A 1CECA 3I4KA 2NQLA 2P8CA 4H9ZA 2G3NA 4XZLX 1U2YA 1XRFA 4UOJA 4WY0A 1PSCA 4ZB5A 1S2WA 2XVGA 4DB7A 2CBVA 2V38A 1O66A 3NL2A 2OSWA 4D8ZA 1GQLA 3AHXA 4AZIA 1UBPC 4Q7NA 5F2LA 3EOUA 4MLJA 4D6HA 4F8XA 1VIZA 2A7NA 2FTYA 4XUYA 1EPVA 4GZEA 2DZTA 2ZA3A 5K2ZA 1FWEC 4H8HA 4JN6A 3DFPA 3GR8A 5CZ0A 2HV5A 3CJPA 3WH6A 2WQPA 1E0VA 3MHUA 2Z6IA 1A49A 4OU1A 4HD5A 5LXXA 3RLGA 4L9ZA 5DBUA 1DYSA 1EGVA 4AX7A 1E9YB 4FX8A 1VEOA 1EH9A 1KV5A 4PMVA 3KW3A 1US0A 1QNVA 3TC6A 3EOLA 3NO1A 1TRIA 3UR7A 4QQ3A 1BQGA 2A21A 1BWVA 1WO2A 2JQXA 4CCZA 2G0WA 3TCSA 3M44A 4BCEA 2ATSA 1OT1A 3GO2A 2CLLA 3AROA 3QKEA 4QLJA 4AD4A 2E77A 5K9XA 4UQDA 1PL9A 3MJYA 1BSLA 3DFTA 4U2ZA 4EACA 3VD7A 3A5VA 1LL4A 2NQHA 1NOFA 1WXZA 1SJBA 1JUEA 2KZHA 2YXGA 3SRKA 3ZWTA 1BHGA 3PHAA 3PULA 3TIMA 4DY1A 3OEXA 3RHGA 2G4FA 4MKSA 3BLDA 2J8TA 3UA4A 4IOTA 1S5VA 2ZZ3A 3B9AA 1IV8A 4MIMA 5LHFA 4LS1A 2WAGA 3VE7A 1SYTA 2JKPA 4JX4A 3BAIA 4Y9PA 3PN8A 4XSLA 2Y8KA 3QLLA 4JBRA 5FCZA 3WBWA 1M7JA 1EGMA 3QVQA 4EK7A 3B8DA 3OG3A 4JNZA 1L6YA 2VGBA 1ZJBA 5CPNA 4HZ8A 4UMAA 3A6OA 2PGRA 3OA5A 1OFOA 2E68A 1SZEA 2W6RA 4IGHA 1OVDA 2BX7A 4ACZA 1UPPA 5C9XA 2VX4A 5C9ZA 3VGFA 2F61A 3H21A 4C1LA 4PMYA 4Z1BA 3W01A 3WFZA 1E71M 4R27A 2DW6A 1TWWA 1V3MA 2WNNA 1W3JA 4DZ5A 1Z41A 4J3VA 3HGJA 1L6WA 4YLWA 5J8LA 4IH3A 1BVWA 4JTFA 1JPIA 2VEFA 6REQB 2DT0A 3S9IA 3WEMA 1VBUA 2V5JA 1PZ1A 3G0XA 5FSEC 3GRIA 4UB9A 4IICA 4Y8FA 2DZAA 4KWOA 2J75A 3BJFA 4JICA 3OLGA 1CXHA 4RPQA 1QUMA 1DVJA 3LNPA 3E12A 1U1JA 4QGCA 3MCOA 2DIJA 4RZBA 1TCMA 3EMQA 3R12A 3CQHA 3B0YA 1QI4A 5CSUA 3GHRA 2PSNA 3CMJA 1GKRA 2VGGA 4I7VA 2XUCA 4EPBC 5E0FA 2ZDRA 3CLMA 3GU1A 4JHZA 3BE7A 3M41A 4A05A 4BF5A 2D3LA 5T8GA 4W9TA 5CCZA 1P7TA 3THQA 5FF3A 1IXNA 1EJRC 2EPHA 3EX3A 1KGXA 5D8ZA 1EC7A 4HPNA 3HMCA 4QDWA 4W86A 4MZ8A 4I7WA 1AZ2A 1W2PA 2CXGA 2XVNA 1W1VA 1JGMA 3PZOA 4US5A 4EXAA 1CPUA 2QPSA 5D03A 3ZOAA 5EMYA 2QDGA 3GYCA 4L4LA 1UUQA 1ZRQA 3SUUA 4WQ6A 4N2YA 4N6FA 1F3TA 2VDIA 3GDKA 3MU7A 1VF8A 3LI1A 4PMDA 4PUKA 1OB0A 3MWAA 5I3IA 1RJQA 1M3UA 4I9AA 4L4PA 4J28A 3FVDA 4ECLA 1Y65A 1ITQA 5FESA 3NPXA 3G22A 1HKJA 3S4TA 4AEOA 4AW7A 5C2XA 2WANA 1ZHAA 4UQBA 4LV9A 5HJLA 6PTDA 3EX4A 4IIGA 4INFA 1UIOA 3UNTA 4XAYA 1CXFA 1HTIA 1ISXA 4PEEA 1OGBA 2BGQA 4CQAA 2OELA 2YYTA 4YIWA 1QRQA 3WQ6A 1E3ZA 3O3RA 1RBOB 4LUTB 1NWSA 3HTWA 3VOJA 1Q4WA 2IQDA 3AS0A 3UBPC 4CLMA 4IGSA 3E74A 5REQB 4B4HA 2YOCA 4U5IA 2NWSA 4H9XA 3VNJA 4P8VA 2CLPA 3G8EA 4JQ3A 4TXEA 3LCWA 4REQB 3IRDA 1BTCA 4NNBA 4JTCA 1ZBKA 5IM51 1VKFA 2X41A 4NQ1A 4WDXA 4Z1YA 1XC4A 2J7HA 2PWGA 3KL3A 3DC8A 1DV7A 3FS2A 1QJWA 3S0CA 4OWGA 4V27A 3HPFA 3EWWA 3Q67A 4CD6A 3OQEA 2YPIA 3AC0A 3WMLA 1EJVC 2VXNA 1J5TA 4W7WA 5ABTA 3M7WA 5M03A 1H50A 3GHTA 3H54A 3KBMA 1RPXA 3G1SA 3S8HA 4YJ5A 5AHLA 5FL1A 4TO8A 4HVXA 1BLIA 1QFEA 1KQZA 1KBLA 4M51A 1JIBA 5GPRA 4AD3A 3AZSA 3UWZA 1BF6A 1Z42A 2QJJA 1KXQA 2WYSA 1NQ6A 1HJQA 3SCPA 3HJZA 4IPJA 1XYAA 4IL0A 5HANA 4W5UA 3UJSA 3HURA 3EGJA 1O1HA 3ABSA 1E56A 4D72A 4OBSA 4UOQA 4G7EB 2PDLA 4N0RA 4NZJA 3PZ9A 2GK1A 4PCPA 3REQA 2E6AA 3B9DA 3IJ7A 4GLEA 4DI9A 3B0UX 3MY9A 3NO3A 1WDSA 2W0UA 1YQ2A 2WZEA 3RITA 2OWXA 3KZPA 3OVRA 1XP3A 3WH9A 3LDVA 3ZZ1A 4RKAA 2XN1A 3N12A 3UWQA 3CUIA 2FZDA 2QV4A 1YMYA 1GVOA 2VEGA 2QGHA 1PO9A 1G1YA 1ISWA 2C8NA 3VOHA 3MYPA 4JYFA 3W7CA 4YCPA 3OG2A 2G41A 3UCQA 4WK9A 2J7DA 3T05A 5I3JA 1M6JA 2QLYA 1TCDA 1XBZA 3DFNA 1P0NA 1N8FA 4D71A 4Z1CA 3WMSA 1FWNA 2PTYA 3SCVA 3GIYA 1KXVA 3VIIA 3OO2A 1H7RA 3VKKA 4NL1A 2E40A 2ZFAA 2YW3A 2XN2A 3JR2A 4JL2A 3RK8A 4OOUA 3CT2A 1UZ4A 2H9AB 4K8HA 2OX1A 3U3HA 2D3NA 1ZNNA 4H8UA 3BLEA 4QQUA 4YVXA 4IGNA 3T2PA 4FNUA 3MMUA 3WNLA 5D02A 2XFFA 4GYPC 1HKVA 2NWRA 4GY0A 5TIMA 3UQNA 4XAZA 4B16A 1G0CA 2A5HA 4GI6A 3QGVA 3BCFA 4GBDA 4TVCA 1MDLA 3BSHA 3KBJA 3NPWA 5FEWA 1UYQA 4E38A 2WZHA 9CGTA 3GXDA 5JVLA 1VLWA 4Q4RA 3IJLA 1E4MM 2GJPA 3Q2DA 2OWWA 3NWRA 4P7RA 2ZA1A 3VC6A 3TE9A 2WM0A 3SIZA 1L6SA 1W37A 4Q8PA 3NQ2A 1U5JA 1QBAA 2PRHA 3GZAA 2GQ9A 4E5TA 4B2DD 4NF7A 4K68A 4HNOA 4GJ1A 3WKZA 2EJ1A 1R87A 1UWRA 3V75A 4GD0A 1FWWA 1BWKA 2GL5A 3T0AA 2ONEA 1A5NC 1RCQA 3WELA 3C0JA 4FLQA 4GX9A 3E0WA 2F7FA 5LA0A 5HXMA 2HXUA 4R53A 5G1TA 3WSUA 1XLHA 3LBMA 3EKZA 5I3KA 3R89A 1V6YA 2XH2A 1TV7A 1PZ0A 4C90A 3SW6A 1PB0A 2WOQA 3CHDA 3PNZA 3WD4A 1O6IA 2EG8A 3L5MA 1JD9A 3O1NA 4ROQA 4JTHA 5LSMA 1XRVA 1JUBA 3IPWA 4B9YA 1NTHA 1MEIA 1OIMA 5I78A 4HHMA 3HQPA 4P8UA 3AXIA 3HPSA 3WD0A 4CNOA 3VI2A 1XYMA 3QMTA 2Y63A 2ZUNA 5HWNA 1MWOA 3RU6A 4W87A 1ZQ5A 1R9XA 1XYZA 3Q4DA 3P6LA 4RXGA 3IJ8A 4IX0A 2QXWA 2XIBA 4LF1A 3QY7A 3BG5A 3W6MA 3VNYA 5GNYA 1TUFA 4JIPA 5GJNA 3WCZA 4UFMA 3NXFA 2D2OA 2X1SA 1IE7C 1H09A 3W07A 1RP9A 1YW1A 4LOCA 3IK4A 1HL2A 3O16A 3UYCA 3H8AA 1OG0A 1XLIA 3RN6A 3WENA 5HATA 4UOZA 3K13A 2VYOA 3N25A 3MCNA 4O16A 3UCDA 1EJWC 4NI8A 1C29A 4IQDA 3POHA 4X9YA 5AYZA 1J12A 4EAYA 1ENUA 2JIWA 3FSTA 3ARYA 3O7UA 5CPMA 2PD5A 1WBHA 1XQLA 1XRSA 3RU8X 4Y9OA 3W86A 1SJAA 2FZMA 2ZA2A 4K8GA 3A4XA 1I1XA 4R3UA 3M6DA 1PDYA 4I5RA 3S5ZA 2GSHA 1GVSA 4AZHA 4DXVA 2GSJA 5LNRA 4S3CA 3P3BA 1QNOA 3MMTA 2CCRA 2XYLA 5AC5A 3RJXA 4Q7BA 1ZTVA 1GNXA 2J62A 2W91A 5CGTA 5CZJA 1QI0A 3PTKA 5AYIA 4Y2WA 3HV9A 3L21A 4G7EA 5DRCA 1A0DA 4LTSA 4C6PA 1ISZA 4MGGA 5T26A 4LS2A 2J78A 4LSBA 2KX9A 3CAKA 2OZTA 3M0IA 5XIMA 1US2A 3P81A 2O4MA 1R2TA 3PS7A 4YTUA 5FA5A 2I9UA 3VUPA 3T4CA 4MF4A 1RH9A 2ACUA 2QDHA 1GQIA 2GOUA 4JFTA 1LWJA 1TPC1 4LX4A 4UTFA 1TQJA 1SU5A 1ZLPA 4Q8QA 5HINA 2EBNA 1A5BA 4FF5A 1UQZA 1ITXA 4O15A 4G9PA 4GMEA 3S2LA 1OABA 3KBVA 3PJWA 4O19A 4HPJA 1YXCA 4RNJA 5E5CA 3UP8A 2Y0FA 1AH0A 3NDOA 1UQYA 4PYSA 3CZKA 2Z25A 3LB0A 2D73A 3VD5A 2QJMA 1XIMA 1GTEA 5GVJA 3WQVA 1OD8A 3EA2A 3DDMA 1QPQA 5D09A 4QFUA 4RLIA 1I0DA 3CNYA 4I5UA 3WH8A 2D20A 3MSYA 4BFAA 3CZLA 3W7HA 3IJDA 4JIEA 1H1YA 3QYQA 3UVIA 1Y5VA 3CUJA 1VJIA 4LCRA 5U7SA 1X6NA 1UWIA 4L5ZA 3QV8A 4M24A 3W1RA 3LCIA 3NFUA 2PDCA 2ZWZA 2Y88A 1J8VA 3BO9A 1C8YA 2J4GA 3T81A 3CV2A 1EYWA 4G1KA 1GQNA 3VOIA 1V4YA 2ZICA 2HK1A 4QROA 3VC5A 1VQTA 3NPVA 3QMRA 4L1XA 3WDJA 5I07A 4TMBA 1J4EA 2W92A 4E6MA 4QCEA 3P0XA 4FOJA 4HT3A 2WJZA 2PTDA 3O6AA 1IEVA 3N18A 3GKAA 3YPIA 1WCGA 2E09A 2OX4A 2F9RA 3VINA 2ZUTA 1T99A 3N14A 3HM7A 2EPNA 1E15A 1HF6A 2E5DA 1LP6A 3IRSA 3VDHA 1R9YA 2POTA 1BYDA 3G2GA 3ABZA 3WBYA 2GLKA 1TKKA 1YADA 4UWMA 2YZRA 1YPXA 3B8UA 2WXDM 3VKBA 3W29A 3RO6A 4KRTA 2YL9A 4HMCA 4FNRA 1YBQB 3O63A 1QNSA 5EFDA 4EPEC 1F3XA 1HJWA 4GQ0A 2D24A 3TN5A 1X1ZA 4B91A 3L4WA 5BRBA 1YTDA 3F5LA 5H8UA 3MO7A 3BAKA 2NXGA 2JEQA 5FF0A 4DM1A 4GNVA 1JZ8A 2YJQA 4LGXA 4TV5A 1PYMA 1YRRA 4JX5A 3WNPA 4WR3A 3RIKA 4O0QA 3A9IA 3SI9A 1GG1A 1EO7A 2TODA 2W9MA 4C7FA 1WZKA 1Q3NA 3K4WA 4QG8A 3RR1A 3HBLA 2V5LA 5I3GA 4DNHA 5FI8A 3NPUA 2C19A 3P80A 2A85A 3AIEA 2ZTKA 3KXQA 1X38A 2D2HA 1ZY9A 3QSTA 2C18A 2JK2A 4K37A 1Z8AA 5HMSA 3DGBA 1JDAA 4F40A 3LHTA 2AL1A 2R82A 5FOOA 2H8ZA 3Q94A 4EP8C 4NZCA 3B9OA 2UBPC 2Z28A 3S9ZA 4GGBA 1W9PA 1X96A 1SMAA 3EEGA 3U7VA 4R7OA 3SQMA 1IT0A 4QAIA 4GY1A 3ES8A 2C16A 1NWUA 3ABOA 4PCTA 3P14A 3D3AA 5HQEA 4EWND 5BRQA 3CUGA 1FH8A 4UXDA 1XCWA 2GVYA 4HNUA 5BW6A 3V0UA 3QZ6A 3DUGA 4Q8VA 4HA0A 2A6NA 4NY2A 2JBMA 2WSKA 3SN1A 3W73A 2QCHA 5H1WA 1UCWA 2BY2A 2XSAA 3NEHA 4Q8WA 3ZR6A 1EJXC 4TU1A 4DJDA 4OTKA 3LUTA 3LSCA 1QCWA 4U10A 3IAPA 1I75A 4Q4OA 1XG4A 8XIAA 2QW5A 2ZE0A 3RR4A 4S3JA 3MYOA 3GXTA 5EA9A 2V3FA 2CYGA 3PBYA 4FLRA 3R6IA 2VEIA 1TVLA 4Y8EA 1BKHA 5CPOA 3RNDA 1FHLA 1AMYA 3RLVA 4BQ3A 1GPWA 1BG4A 1O5KA 2G5WA 2PLMA 3VFLA 3AZRA 2CZFA 1WBJA 1P6BA 4RNFA 4XZ9A 2HZGA 4Q4KA 2IPGA 4W8BA 3QFWA 2BMBA 3F4DA 2AKZA 1EKOA 1RK5A 1VFHA 2EAWA 4NZ4A 5LIUX 3W1QA 1I0BA 2FHFA 4CGTA 1XUZA 3M47A 4JQ1A 3MI6A 1UHVA 3I3EA 4GQRA 4MFEA 4XKYA 4IUGA 3ITVA 4NX5A 1F61A 1PX8A 4DAIA 3SCWA 2Q3RA 3R4IA 4ATDA 3QSRA 3V1HA 4HZ7A 4J2PA 3U2OA 1BVZA 3HGRA 1EJSC 2DZUA 4KMQA 1CXIA 4DO4A 4NXSA 3IANA 3UCCA 2A1YA 5CXPA 3MDUA 2CBIA 3GXPA 3W38A 3ME3A 4F9DA 2OEKA 1F8MA 3UR2A 4DBUA 1ISVA 4GQGA 4H01A 2PDMA 2Z24A 1NDZA 3L4XA 1JYVA 1WYIA 3KOYA 1UP3A 4PL1A 2OYLA 3WLJA 1HW6A 5TBOA 3KRUA 1CYGA 2OT0A 3B8SA 3B8IA 1MW1A 1UKSA 5CGQA 2XM2A 3C0SA 2J8GA 2QIWA 2X42A 5GJMA 4UNLA 2DSVA 3TAOA 3MPGA 3PZIA 3VD9A 4F2UA 5I06A 3TSBA 2PDQA 4K3ZA 3SUSA 1OQFA 2GYIA 2AMXA 3BG9A 4B15A 1JGIA 1PEZA 3FA4A 1L2UA 4Z2KA 5CC3A 4TQTA 3MMWA 4E2BA 5F1UA 4YYFA 5BXPA 4PTMA 3ZIZA 2ZE3A 2OB3A 3OTRA 1QPNA 4O4WA 2XIJA 4J27A 3N13A 4C7DA 2BGNE 3WF2A 2GVLA 1DEDA 4ZXLA 3W7GA 4ILSA 1DORA 2VCBA 4O28A 3OQ8A 4PMRA 1A5CA 5C7HA 2WC7A 1W5OA 3K5XA 4IJRA 3M5YA 3LG3A 4D6DA 3HN3A 1UR3M 3HG5A 4KRUA 1H7PA 1X1NA 3IGSA 3BCDA 1CB2A 1EP1A 5BRPA 2J27A 3KDOA 2Z2UA 3TX9A 3GH5A 5C9RA 2GJXA 5CJMA 1XI3A 1M5WA 4XZBA 3UJEA 3ISIX 4F0RA 3JW7A 2Q8ZA 3APYA 2MNRA 4BEUA 1O95A 3H6OA 5CJNA 1P6CA 1NU5A 4UQAA 1HVXA 4IQLA 2C1IA 1C92A 3W7LA 2ZRZA 3M5VA 3KS6A 1T41A 5CG7A 1F2JA 3PSVA 3ZT6A 2OYKA 4O10A 4AMCA 2EGZA 4QJ1A 4DWSD 3A24A 3QR3A 1F5ZA 5DELA 3EKGA 4X2RA 4O8RA 4OVXA 5HPOA 4QX4A 1ONWA 5G2IA 2WPGA 3KBSA 2PODA 1QK2A 3WG6A 4RV3A 1UR8A 4PCSA 1E73M 2WB5A 1MUMA 1D7KA 5EMKA 3DHFA 4ORIA 4M1RA 1CENA 3G1HA 3B97A 1X6UA 4RE0A 1TIWA 4UR9A 1Q45A 1H1NA 1RA0A 2VT0A 4LS0A 3C0LA 4XUGA 4DLMA 1DQWA 2BWGA 4M7TA 4L7ZA 1QW7A 4PUNA 4XO6A 1YNPA 4C6JA 1UP0A 2AQOA 1VENA 4DWSB 3FV9A 4CCEA 1WDQA 1MW3A 3S83A 2X30A 3WLNA 1DJZA 3W4RA 1KFCA 2BBFA 4HIBA 2ABAA 3DFOA 1LTDA 4YHGA 1HKWA 3WX7A 1BYBA 4XKYB 3TTYA 1KBBA 4QE4A 3GVGA 3BAJA 2ZOXA 4LEQA 4S39A 2OKTA 2D0HA 2P3ZA 3L5LA 3COTA 2VO5A 4A3UA 1WPCA 3NDYA 4OT7A 3GNPA 3PZUA 4DJDC 4KKXA 4H04A 4CNTA 4PTXA 2P88A 1DWJM 3K2GA 1XIIA 4W8AA 2GQ3A 1ZCOA 4UIOA 3TN3A 5CAHA 3K8MA 3GR4A 4ZO8A 1TRDA 4PMUA 3P0WA 3BTNA 3W71A 1VPYA 1LORA 5AN7A 4QISA 5DQPA 3V18A 4KEZA 4XIAA 5DT7A 2PDBA 1O12A 4CD7A 1A4LA 2ZUVA 4FR6A 4NASA 2BHZA 2GOKA 3GU9A 8CGTA 2FGLA 1V7YA 3IJ6A 4FSAA 1NH6A 2WLZA 1V02A 3CT7A 5DRIA 4C1KA 2ANUA 3QFEA 1UZHA 4LUIA 2FB2A 4TX6A 4LW7A 4IFKB 4DUWA 5HNRA 2O9RA 5FJJA 2QCDA 2ZVRA 3Q58A 1XH2A 4I90A 4TX8A 3TYAA 1DJQA 1SO4A 1KM5A 3IVUA 3AISA 1Q13A 2A79A 3LK6A 4W4QA 2HS6A 4U2YA 4DO7A 4QM1A 3C61A 4AXKA 3I3DA 2YL6A 5JBFA 4PN2A 1IIGA 3CHCA 4UTMA 3A12A 3WLHA 1LLOA 2INFA 2OWCA 1MW2A 4ZMGA 2IQ0A 3QPYA 5G5IA 5FD0A 2J8FA 1B3ZA 3CH9A 3BQ6A 3NM3A 4FAMA 3MMDA 1RA5A 3B03A 1E70M 4S38A 4AWEA 5EBUA 1EP2A 2WVVB 4LAKA 4U3CA 3RX2A 2P76A 4CU7A 3N3MA 2I17A 4D8AA 3ZWSA 4A8NA 1S5WA 2INEA 3GBDA 3QZAA 1T8QA 2C0HA 1TX2A 2BXYA 2NQ9A 2BNJA 3GXNA 2Z1VA 3WO8A 2I9EA 3V5CA 4HPXA 3VIPA 1ECEA 3SB0A 4X22A 3GVRA 3OLIA 3WLPA 3PZTA 3CGTA 3T0BA 2FDSA 1CZ1A 3B8VA 3WDHA 2YXOA 4CQBA 4RNIA 2XIOA 3JS3A 2NLIA 3GYEA 4ZQPA 4UBPC 1K6WA 1XYFA 2D22A 3WL0A 1P5BA 4WKHA 1QT1A 1DHKA 1TPH1 3W7QA 1GKQA 1KQYA 2DSZA 2VC9A 3IIZA 3CZGA 5EMJA 1DJNA 4US5D 1TVPA 1XKYA 1JI1A 2NVDA 3TOYA 5H6HA 2RDUA 3BWWA 4OJYA 5HJYA 3S1GA 3B04A 3H2MA 2YDAA 4RDWA 2PP0A 1PBGA 1FDJA 3TMLA 1MXSA 4WJ8A 2CZEA 3N1AA 3VZYA 1ODZA 5K9DA 1NEYA 1X7FA 1N8WA 2ISFA 3DHUA 5JXQA 4WDTA 1R5YA 4EX4A 1V0KA 4C6NA 1SR0A 4A8LA 4NAFB 3C3UA 3DG3A 2I16A 3NZPA 3WY1A 3RDKA 1IT8A 1SSGA 2QJIA 2XN0A 3F2DA 2J79A 1YXDA 2RJGA 3WK2A 3AU6A 3BANA 1JCJA 1I60A 1T5AA 2VRQA 3EDEA 1B3WA 2V6AA 4MKNA 3LERA 1CT5A 3MBDA 1VPXA 4F0HA 5E0KA 2BODX 4RK8A 5T9CE 3R0UA 5DBTA 3MHGA 4OGZA 1UR1A 3OHIA 1TJ0A 2XPKA 4DJFA 1BXNA 1ZUAX 3W00A 1MFVA 4AG0A 1OYCA 3WF4A 1ZZMA 1HO1A 3LXBA 3VFCA 3IUHA 3VOCA 4NXKA 4S23A 1SO5A 1UA3A 4KEUA 2FPTA 3HB9A 1PX3A 3BLLA 3N04A 3LQGA 4A35A 2VC7A 3POCA 3IIOA 5TD4A 2IKJA 4R7JA 1WZMA 1Q6GA 1YPFA 4POCA 3HU7A 4MNMA 3DN5A 4M56A 1J11A 2DJXA 3HQ1A 2UY2A 2QZRA 2R1NA 4LBSA 1FXQA 4RDVA 2B4GA 2WBKA 2CW6A 4AEFA 2OMAA 1ZS2A 1FWTA 2AL2B 1ZAJA 1IIHA 4RPPA 4JFSA 3RCMA 1TWZA 5A2BA 4KWUA 1ZAHA 4IMFA 1TWIA 4LY4A 4ZTXA 3KCLA 2Y5SA 3II1A 3O06A 3LTYA 1ZAIA 3PFMA 3PK7A 3DG6A 3AICA 2D69A 4FNPA 1W9XA 1I2NA 4D6FA 2RUSA 3ARXA 1DWAM 3WUFA 2OQHA 1EJ7L 4OOZA 1UUMA 1ZBVA 3CV6A 3H7VA 4HTBA 3UVAA 1KA9F 4E2DA 3BOXA 4LEFA 1WB0A 4HBKA 1H3GA 2JKEA 3UA3A 5DMYA 3IEBA 1HZYA 3R2GA 5JU6A 2QMJA 1XSIA 2PLCA 4NZFA 5CBJA 4BI7A 5LIYX 2HCVA 5D2YA 3USZA 2ZX6A 4ES4A 1LL7A 1ZALA 4YHEA 3V4BA 1VFLA 5DXYA 4O14A 4C1NB 3HG3A 2YA2A 4LAOA 2WVSA 4Q8UA 2R6OA 3M16A 4PULA 5KZ6A 1W56A 3MVIA 1ZPTA 3TW6A 1XS2A 1K03A 3LHVA 3A5FA 3W1TA 5XIAA 1W8GA 3MB9A 4CVUA 5M2FX 5A95A 4CU8A 4HA3A 4V1XA 3GBEA 4PMNA 1W6TA 3ARUA 4MY9A 3W7NA 3A4JA 2FFIA 4DHGA 3GFYA 3UG5A 4FX6M 3GM8A 5MKGA 4FXRA 4DLFA 1K70A 2Z6JA 4NHVA 3W85A 1HGWA 3HFYA 3GXMA 2RGMA 4QE1A 3MO4A 4KFNA 1EBGA 4HA4A 3BSMA 1XFBA 3BPWA 1MRAA 4JIRA 5SWUA 5A3HA 1P4CA 3OP2A 1SFJA 3XISA 3UWUA 3W7MA 4ADSA 1W91A 4R7WA 3U2CA 3BLKA 3WQPA 3G0UA 3OZOA 2I1OA 3GG0A 4KGLA 4FB7A 3PPCA 4MNKA 1GKPA 4O53A 3EB3A 1Q6QA 3LPFA 3I6TA 1RVKA 3EXRA 1I6NA 4LNCA 3AMKA 5BXTA 1Q5MA 3CC1A 3PJXA 4MNJA 4G5DA 3VE9A 5E09A 1KBKA 4FP1A 1UD5A 3RPTA 1F73A 3BH4A 4QIUA 3CL6A 4BWLA 4N4QA 1QVBA 3O2LA 1KRCC 1W9UA 4JTRA 1MFUA 1F3WA 1X8FA 2Q02A 2IKIA 1AG1O 5BROA 3OZPA 3STPA 4GCAA 3GC2A 5FIPA 4E2VA 4IFKA 1W5MA 3PG9A 1UPMB 1J93A 1FWAC 5K7JA 2DQWA 4Q4QA 3GU2A 3OBKA 3KP1A 5TAOA 1CW2A 1FBAA 1QXLA 3S2NA 4QCFA 1YX1A 3EMCA 3OLDA 2Q8XA 2QJHA 2I5IA 1P48A 4JXCA 5D2XA 4XQ6A 4GO8A 3VGBA 3BVJA 4IPIA 4FLOA 4DWSC 2DSUA 3UYIA 3T0DA 4GXMA 5HR7A 1JYXA 3EDJA 3WQGA 4FA3A 1KKRA 4NJKA 4S3DA 1U22A 4L56A 4MWAA 1A0EA 5GQBA 3LTSA 1LOSA 3D47A 4M19A 1EO5A 2IPFA 4H4IA 3OIXA 5AYYA 5CZSA 4W84A 1QMLA 1F6PA 4ZQRA 1GGOA 3KBWA 4CNPA 2NX1A 4WJEA 1FWDC 1BGGA 4RDZA 3QW4B 1VYSX 2WQDA 3VZXA 3WQ4A 4QG9A 1VRDA 3A3XA 4ASTA 2CLEA 5FSDC 3SGGA 2QMKA 2PF0A 4K39A 3GQYA 1AMKA 2FKPA 2G8ZA 4O1DA 3BK0A 2J25A 4PGLA 1YE4A 1EIBA 3TTQA 1UJQA 1KCKA 1RZMA 4F2BA 4YYCA 4AD0A 2GQ8A 1UZDA 2CETA 3MW7A 3UZXA 2HISA 3PZGA 1NAL1 4IG2B 2ZZ6A 1C7TA 2X40A 3THDA 2ABBA 4LU0A 2QCEA 4LVBA 5DT5A 2XVLA 1KTBA 3QH2A 1PDZA 4XAFA 1UWUA 3TJ4A 5C7VA 3DIPA 2G3IA 4HN8A 2PDUA 5CBIA 4HA1A 3V16A 4HPHA 1D3HA 5A6SA 2VGFA 3A22A 1GVIA 1IWBA 5MKGB 3AIQA 2A0NA 4ICCX 4CD5A 3LM3A 1D7FA 3NJ3A 3B06A 4GJIA 2JGQA 1TIMA 3NQEA 1QOPA 2POZA 3HQOA 1QHPA 3WQDA 3N9RA 2NVAA 4IL2A 1DPMA 1MRQA 2O92A 4O1AA 4ADTA 3ZS4A 1GTHA 1WA3A 2W61A 5I3FA 5G4WA 2J7CA 3A3HA 2BB0A 4H8NA 1EOMA 3KOXA 5DCEA 3CYVA 7TAAA 3AS2A 2ZXQA 3HFTA 5LGXA 1M1BA 4NT0A 1ECQA 3KOFA 1R3YA 4PB4A 4Q6JA 2ZRUA 4DUVA 5J5DA 1U1UA 1FDYA 1OIFA 2CITA 3GUWA 2VURA 2ZZ1A 3OHMB 3M6YA 3PBWA 5D38A 1Q8AA 5A8NA 3QRHA 4HNTA 1EZ2A 3RGTA 5BOEA 3FEQA 1T96A 3NDZA 3BSGA 3KVKA 2Y7GA 4XD4A 1YDYA 5K4ZA 4Y96A 1GZ1A 1NWRA 2CNCA 1RBLA 3W2NA 1EHAA 1XLAA 4JTEA 3SEPA 4FLSA 3VTRA 3DBNA 4E8GA 4AD5A 4WOQA 1AH4A 1B57A 1L9WA 4UCGA 5F7UA 1LM1A 3TA6A 4JTGA 3SJ3A 3S3GA 2JIEA 1CDGA 5I09A 1CBGA 4PA8A 3N15A 2HE5A 1RLCL 4LC8A 3W75A 1VCFA 3BW4A 5BOOA 3HPZA 3M64A 4QR6A 3I6EA 3KX6A 3VCCA 4B5VA 4M81A 2W27A 5FEPA 1BFNA 1J9YA 1QOQA 4ZO7A 3PM6A 1K9EA 4B5XA 4WZHA 2VELA 1H1ZA 3E0IA 4URIA 2G3JA 5AB3A 2Z0IA 5EPDA 1H5VA 4A3RA 5CQ1A 4O8AA 3UZ5A 4HCDA 1PV8A 2VZOA 1FWRA 1ME9A 1BVNP 4LCQA 3S1VA 2G96A 4CEUC 1G4PA 3OBEA 1LOLA 3IGHX 3ERPA 3W27A 5I23A 4O1CA 4KEVA 4K8EA 2GFTA 3ARWA 1HT6A 5A8QA 1DOSA 2EPMX 3N2TA 3AMGA 3T44A 1G7VA 1Z48A 2EEXA 4IWWA 4PRTA 3RLHA 4YNGA 1NDWA 1JULA 1P0BA 1IZKA 1FWIC 2QKFA 3T08A 4R9XA 3UXLA 4MHBA 3TU9A 2WCSA 4ZCWA 3FDKA 1XSKA 1UR9A 2FYMA 1VRXA 3CASA 4S3AA 2DUAA 2HE8A 3ID7A 3L5AA 2RH9A 6REQA 3TWBA 1I2RA 1ZU8A 3JVAA 3GNNA 4H9YA 1UMLA 3GWQA 3H26A 3I10A 4PTDA 1POJA 1VHCA 3CU2A 3NGFA 4UFIA 3MVTA 4UUIA 4NJHA 2X09A 4DF2A 3GG7A 4LUSA 4FS9A 4J9JA 2XIMA 1IWPA 3RG6A 1XLKA 4GX8A 3VX0A 3FCPA 4GK8A 5DEZA 4RW5A 4GYKA 4YVVA 4UCFA 1FUYA 1BXCA 5LNWA 4KFOA 3LN3A 3T55A 2YB4A 1YNYA 3GW0A 1LF1A 1A5SA 5AOUA 2IMRA 3GC5A 1LRNA 2VRKA 5FAJA 3EWBX 3F2CA 2VD8A 3AJ7A 3EWDA 4TTUA 1XBXA 2WK2A 3BGGA 1K7EA 1Q65A 2CXEA 4HSHA 3LI0A 5F2MA 5D9NA 4KCVA 1EC9A 2BSLA 4YWSA 2JEPA 1HP4A 1OM0A 1JR1A 4DO5A 1K8CA 3WDPP 3STFA 1AJZA 2I5QA 2DVUA 2OCZA 3GDLA 1JQVA 3WUEA 5AZ1A 3XINA 2XG9A 2C3ZA 2YCLB 4AY1A 5EMUA 5CSYA 4PEKA 3VIJA 3EBVA 1KWKA 1ME8A 3ENLA 3CB3A 1ZGDA 2O0TA 1HQTA 3S6TA 3CM4A 1JF5A 4UTWC 3GG1A 1IWAA 3FAWA 1R47A 3VNZA 4L4MA 4J35A 1MNSA 4YPJA 4DBEA 3NSMA 3UXAA 1VHNA 2XINA 1OGGA 1QWGA 3TC3A 3ORWA 3AHVA 4KIRA 1S5MA 3RF9A 1QNQA 4GBUA 2G50A 5H8PA 1RCXB 1DQXA 3GIQA 3NA8A 1A5KC 1IEWA 1F07A 2PUZA 2X1UA 4U5KA 1TMQA 4FALA 1W3LA 5U4NA 2BY0A 3HPAA 5I24A 3MHFA 3A4AA 3TJXA 2PDWA 2OGYA 1LYXA 4O11A 3ZJ7A 4KWVA 1S46A 2OQLA 3EX2A 3W7JA 2Y24A 4IP5A 4GNKB 4MYAA 2J88A 1EJTC 4PUWA 5EMLA 4AY8A 1UD3A 3N3TA 4IPLA 3TFXA 2PWHA 4PBFA 2VEMA 3GD6A 4LY8A 4Y6GA 1P1MA 1EUNA 2BXZA 1UB3A 5FJPA 4QP0A 2OOFA 4LYQA 2VCAA 2DFAA 3TLQA 4XV0A 1F76A 1TA3B 2OODA 3QR1A 4GVIA 1H49A 3ARQA 2V81A 3D46A 1PZ2A 5LIXX 3URQA 1GW9A 4FIQA 3W26A 4BZYA 1FQ0A 2CLOA 5E70A 2PI6A 3J7HA 4JY9A 4XZHA 3VDBA 4JTDA 2WKLA 3AJXA 1W31A 3A4WA 4JYDA 3WLOA 4V28A 1NJJA 1EPXA 3LD5A 2AAAA 1IZCA 3UXDA 3C86A 4GIYA 1OFAA 4B5SA 3EXSA 5E93A 3UR8A 5AYBA 3XIMA 5D32A 3AIRA 4M82A 4UNIA 4Z2LA 4PUEA 5A8GA 4PMZA 3HPXA 1B3VA 1L0PA 2PGEA 4H1ZA 2GWNA 2VD9A 1HL8A 4EANA 3O05A 4LT9A 4WX2A 1IZJA 2XFRA 5C9UA 4JN8A 4B4FA 4ERAA 5IRPA 1SUXA 2BOGX 1DIKA 3LPOA 2ZX7A 4JDYA 2WHLA 3UG3A 1TE1A 4HB7A 2WBGA 4JL1A 3PWGA 2Q71A 1JAEA 1U5HA 2RFGA 1QI3A 4NAFA 3CXOA 3TCEA 4GVFA 3FA3A 1X7IA 3R7MA 4HMEA 4WF7A 3G1FA 2TAAA 4BQ5A 1ADDA 1WAUA 3W25A 4RCXA 3T4WA 2HVMA 2E8YA 3NOEA 4RNHA 1FH9A 3CMFA 5KETA 4MSSA 1G4TA 3WF0A 1AW5A 3WYZA 3AXMA 4Z1DA 4WSKA 2XU2A 1M9HA 2YA1A 6TIMA 4OHQA 2ZWYA 1CXKA 1JDFA 4KPLA 1MSSA 3R43A 4HMDA 1Q7QA 1KNWA 1EHNA 3WJSA 1KM0A 5B80A 4RZ4A 1OFQA 3UJ2A 1YLVA 2Y70A 4E4UA 2ZDSA 4H41A 1FP9A 5HUPA 2GDQA 2P0OA 5LA1A 2CU0A 3E0FA 4HHLA 3B0PA 4HCLA 1R0MA 1UKTA 5CPQA 1A5UA 2CFFA 4UMCA 4LH8A 5IOBA 3WQFA 1HJVA 3H12A 3TW9A 2VFHA 1EGZA 4IUOA 1NF0A 1KCLA 4ZSUA 4JKMA 5A8MA 2WVTA 3FOKA 1E6SM 2HMCA 2GVGA 1FH7A 3T07A 5K4XA 1EDTA 2CHNA 1EQPA 4FXJA 3PNUA 3N6QA 4ORMA 1XICA 3W7IA 3IUDA 4AWTA 3OVPA 2YR1A 4GFSA 1UBSA 3HJEA 3DC0A 2H6RA 3ZLFA 3WJYA 1WAWA 3H4WA 2WHJA 1DJXA 4C91A 2AGKA 1A3XA 4AY7A 4M80A 3EOOA 4MJMA 2DORA 3KOWA 4IMEA 4NI3A 1EF2A 2GJRA 1XIBA 4AIBA 5ECUA 3UESA 2X2YA 2E6FA 2ZYFA 3QM3A 1LWIA 3TKFA 4R34A 4UR7A 1GJPA 2DH2A 3IGUA 1JNEA 1FP8A 1XLEA 1LL6A 3RMEA 3MUXA 3WDQA 3PP7A 4ZQMA 4JNMA 3QHNA 1W54A 1BF2A 4F2TA 1XCXA 2FZNA 4IM4A 4OUEA 1D3CA 2E9LA 1KLYA 5LKYA 3L0KA 2IXUA 3OPSA 2QCDB 3DCPA 3WNOA 3W28A 3B0VC 2BHYA 3RM4A 2J13A 4P5UA 2ZX8A 2ZZ2A 3NQBA 1Y5XA 3M0MA 1VAHA 2X0YA 1YDNA 3L0GA 4O52A 2QUNA 4DVOA 2EPLX 3LPGA 3N2OA 2J66A 5I02A 3W2JA 3CV1A 1Z69A 4R5EA 2PWUA 4PB5A 2H8XA 4LUYA 4UZUA 3FNDA 5A2AA 3SSJA 3VGEA 3NQDA 3AZTA 3VNIA 3H2AA 2W62A 3LXCA 3TFCA 1TZZA 3EB2A 2J6VA 4OV4A 5BWFA 1V03A 3V5OA 3VNDA 2BASA 3K30A 4G1NA 2R9RA 5KZEA 2RAGA 3IV8A 4H83A 3LEPA 3HQNA 3D0CA 4FIRA 1FY6A 1JPMA 5I7GA 2VOTA 5HR6A 3QY6A 1R46A 4BKNA 5LGZA 4FEZA 4HU4A 3G6MA 3QXBA 1ME7A 1UOZA 2W4XA 3D5HA 4KIEA 4AVNA 4JYEA 1UUOA 5EB8A 3A13A 4XZNX 4P8XA 1NWTA 4JS3A 1X39A 3LZ5A 3H70A 2CHRA 3AOFA 1EX5A 2D1ZA 2Z27A 3FA5A 4X9SA 4K7YA 1P0DA 4DXKA 4XZIA 5KEZA 2C14A 1DP0A 2VFFA 2AOSA 1QR7A 3EOEA 1ESWA 4QLKA 4QG6A 2RGLA 2OVLA 1E6XM 4JOMA 2ZZ5A 3CAVA 6ENLA 4LCSA 1E4LA 2ATMA 3ZVHA 1HNYA 3BARA 4HTYA 1GYNA 4KBXA 3WFAA 2A7RA 4YU1A 3CTLA 4XD5A 3ZXWA 4OFCA 3MSRA 3KWXA 4CQ9A 3CK5A 5FKYA 2PZ0A 5HOSA 2Z4GA 4YMZA 4LVAA 1TZ9A 3IIPA 3W88A 4L64A 3WLKX 1EA9C 3LY0A 1P1XA 3L4TA 1Q7MA 3LRKA 1UC5A 3KEHA 1E1EA 3AFBA 2C15A 4C6EA 3G5EA 3ZFHA 3E2RA 4QJ5B 2WZIA 3FHQA 1BTMA 2DIEA 1H11A 4DNMA 3K4DA 2VDGA 1SFSA 2R14A 2EKGA 3U9IA 3L68A 5HMDA 4Q8MA 1PX4A 3EEZA 1C9WA 1I1WA 1RV8A 1EEPA 3WK0A 3CBWA 3SUTA 3TR2A 4FOKA 4X0VA 5F4XA 2F8QA 3EOSA 4Q7IA 1B3YA 2NSOA 4O13A 3VK5A 5LIKX 2OFJA 4GISA 5DCDA 3BQ5A 1RD5A 3DHPA 3SGZA 4C65A 2ON3A 1H63A 1KGUA 1A53A 2XZ9A 2I57A 3T0CA 1KFBA 3U57A 1Z89A 2YSWA 4NZ3A 1BKSA 5F2GA 2VVNA 4ZXOA 3UG8A 3UZJA 5I0DA 5CH9A 3M0HA 2G4JA 1R2SA 2NV2A 1G9HA 1K6AA 4GUFA 2GVJA 1H4PA 3V0SA 4DI8A 1PIFA 2WC4A 2V5BA 4WCJA 1TJ2A 1BRLA 2BVYA 3Q45A 3EDDA 2V0TA 3E1F1 4WKFA 1J79A 3A21A 1V6TA 1F9CA 2QT3A 4N4PA 4IT1A 4QTGA 1VB9A 3QPEA 4AHQA 1JFXA 2WO5A 2ISWA 1BAGA 2VP8A 5AVHA 4K38A 2NLYA 3I7SA 6XIAA 4HK7A 3KHDA 3SQSA 1R3RA 3DERA 5D2TA 4JTSA 3UT0A 5IHSA 4PFMA 5BWAA 3EXTA 1JCLA 6TAAA 1RLDA 2I7GA 3W87A 1H0IA 4MADA 4GXPA 3E9AA 4OUIA 3AUOA 4X0NA 4O0ZA 2FDMA 4XX6A 2DIKA 2QUUA 2PDGA 4BJHA 1KWGA 1XDLA 3DFQA 4ALDA 4Y9MA 4Y90A 3MP4A 3DG7A 2GJNA 5AFDA 1ZCCA 2ZC8A 3P62A 3VDAA 1RSCA 2XWEA 1Q66A 3C6CA 3QLDA 4NRRA 4KH2A 3CPUA 3DI0A 4KEMA 4AYGA 4AD2A 3LOTA 1M01A 3PWIA 1LUCA 5C6MA 3OZYA 3SZ8A 3M7SA 2H3BA 2NSXA 4O12A 4HGXA 5GNXA 3BLOA 3VNMA 4HJWA 1GOWA 4Q8TA 2BVWA 1SFTA 3OYXA 3CYJA 1JRBA 4DBSA 1FCBA 5HAOA 2Z26A 3FW6A 1YTKA 4OECA 1T0OA 3GC4A 1C93A 1F4HA 3IJIA 4O18A 1G6CA 1L2QA 1V5XA 3IVTA 4JKLA 4CNNA 4NKCA 2J9YA 1KR1A 3WUBA 2JGYA 5GNZA 1MVYA 2ZXAA 2WZMA 1XG3A 3EA1A 1MQRA 2CHOA 5RUBA 3LCXA 2XTKA 2A6LA 4PUDA 1PIIA 1ZP4A 2HVOA 1R3TA 4E4FA 3P60A 1OADA 2Z1KA 4G7FA 1C90A 4ACYA 3N2CA 4AZGA 3S2CA 1F7BA 4HOXA 4NNCA 3C5QA 1VIWA 4ACZB 4XWUA 4BK9A 3GDBA 5AC6A 1F74A 4Q8OA 1S2VA 3P7YA 3TC7A 2PDXA 2HDJA 4X63A 4M8UA 4LBUA 2GGHA 1KW1A 1E55A 1GZGA 1U83A 4LANA 2C91A 4J3TA 1EIXA 3MKVA 1AJ2A 1PXGA 2J7BA 1IEQA 3GG8A 1PVNA 4HK5A 1VPQA 5IFTA 4W5ZA 3RM9A 5XINA 4BR1A 1KGWA 3W1NA 4R88A 4GHRA 1N2VA 1ITCA 2E67A 3I7QA 4GRSA 2G37A 1LQ2A 3F7JA 2F6KA 3W83A 1GOXA 1X8CA 4MLRA 1Y8BA 1DL3A 3W1LA 2IUZA 1RQEA 1A50A 1MEHA 1B3OA 3LCHA 1MNZA 4QDMA 3FEMA 5JUVA 1V51A 1PWMA 3H23A 3NNTA 5E9AA 4ZGYA 2G95A 4YCOA 1JDCA 1M68A 1KR0A 1W9VA 1YYAA 2Y1HA 5DFAA 2P1FA 5H2ZA 3EWUA 2QCNA 4OV9A 5AVNA 1JNDA 2DDXA 3L4YA 2VOMA 1A0CA 2WKJA 1H60A 4WDWA 4PBGA 1JRCA 1XSJA 3MWCA 5T9BG 4AB4A 1Q7ZA 3LRLA 1BGAA 2QVNA 3MP5A 2ZZ7A 4ZO6A 3NO5A 2QCCA 4YTSA 4LVFA 4LV4A 3P84A 3KL5A 3VOGA 5FL0A 2IS7A 3FJLA 4DAFA 2GSEA 3NAVA 3NSXA 4J5NA 3SJNA 3S1XA 3OGVA 4MB3A 1GQJA 3OIHA 3WD3A 4Q8NA 3MDWA 3FXGA 1OFRA 3EDKA 3FY1A 4F4RA 1XLBA 5LZLA 3NQVA 3M1ZA 3O0FA 3FX4A 3QR0A 4LUJA 1ZJIA 5D37A 1GJUA 1GCYA 3DZ1A 1LLZA 3UNDA 3GXFA 2GGIA 3BW2A 1GORA 4QDPA 4XKMA 1GOMA 4PCNA 1XIGA 3UY7A 2AGTA 1W1IE 4O57A 2A3LA 3TW7A 5DY2A 5JBDA 1EUAA 1XBYA 4ZA0A 3VGHA 2DT2A 1VLIA 2E3ZA 1R3QA 5HA7A 3K46A 2ZBTA 2B0MA 2ISDA 3VD3A 2Y7DA 1CGWA 4LRSA 4MFDA 1FX6A 5D2VA 1LBMA 4C7GA 3W82A 2EPKX 4GVGA 3L2LA 5C54A 3ZVHB 1OD0A 3T7VA 2QYGA 1OHLA 4BWLC 3QOKA 4J3UA 1H7XA 2F84A 4AIEA 2DW7A 1AVAA 1XLJA 1DWGM 4J3XA 2XSBA 3ZJKA 3OVGA 4I8YA 2L5HA 2DU2A 3KAOA 3MUAA 5CLTA 2V5DA 4JFWA 3WDRA 1OINA 3WQEA 4ZB0A 3W72A 4C6CA 3TN6A 2BTMA 3WL1A 1E0TA 1ML1A 4PUUA 1LLWA 3WLIA 3AAMA 3R8HA 4CCCA 4CN4A 3UWYA 3JRKA 1AZ1A 1P0EA 1S38A 4OE7A 1EC8A 1JZ2A 1JUKA 5DANA 3C52A 4P61A 1SQ7A 3S5SA 4ZVJA 2PLKA 1R7AA 2A3HA 2FTPA 3MCMA 4I9JA 3MUIA 1E1CB 3H2OA 3AI0A 4UTTC 4GKTA 2Y5EA 5C5YA 3TZNA 4AVFA 2V2HA 4YWIA 3H24A 2W5FA 4O1BA 3MSGA 3K4AA 3NEVA 4K2SA 5LYRA 4QJ4B 1WKEA 1DTUA 3N4EA 4KCUA 1DWFM 1UWQA 2OTDA 1UH2A 3EA3A 3N29A 1ZL1A 1XKJA 1XGDA 5DX7A 3WLTA 5ABFA 3E38A 2E28A 5HWJA 4LAUA 5C70A 4J3WA 9XIMA 1UD4A 5KMYA 3TYCA 4A2SA 1PAMA 4D8LA 3HV8A 4FXFA 2XGBA 4J40A 5G2HA 3S9YA 1D8CA 1SJDA 1F05A 4JTQA 3VA8A 1LQ0A 3C2EA 2X05A 2VUNA 3I3BA 5EBAA 1VCGA 3C4UA 1KFJA 2B81A 4PRRA 3T1GA 3LCLA 2QF8A 3C2FA 3OW1A 1ZJHA 4BQ4A 3QZEA 1ODUA 3H7RA 4YS1A 4AF0A 3E3HA 1NIUA 1BRLB 1W3NA 4JR5A 3KBNA 5BYWA 3GTIA 3VKCA 4EOUA 1CCWB 1W1B1 5G4EA 4GZJA 2FH6A 2ZRYA 4D6EA 4QHRA 3DYMA 1HVQA 1W1A1 5D30A 1JDEA 3T8LA 1E4NA 4PTVA 3VIFA 1OFDA 4B92A 1GUVA 1C8QA 1MDRA 3E49A 3BICA 1J0IA 2VDHA 1XDJA 3E6EA 2ZUSA 1TO3A 3C2VA 3PTDA 3APGA 4K7VA 1D2KA 4JEQA 3BOFA 4B3KA 5I79A 2VKZG 4C1NA 4AAJA 1RY8A 2A3BA 1OFEA 2EJAA 4HNNA 3S42A 1TR9A 4MOZA 4KF1A 4JFUA 3TMQA 2WHKA 4ZQNA 1R6WA 3N73A 2VC5A 3L4VA 2FQIA 2WSYA 3AWNA 1JYNA 3WZ0E 4ZL1A 3AO0A 3UWEA 5AECA 3TTEA 2DZBA 2F2KA 3IIXA 1KO0A 3BC9A 2H9AA 3QKZA 1I2QA 2FVKA 1W9BM 4XVEA 2Y89A 5M3WA 1NF7A 3RAOA 1IR1A 4JX6A 4DRSA 3W0KA 3WNNA 3EKLA 4PE8A 2CWNA 2X7VA 3I6RA 2NUYA 4GQQA 4FI4A 1FHUA 2V5CA 1BYAA 3G8RA 4R85A 2DZWA 4K1GA 1OF8A 2NT0A 2WMJA 1DE5A 2YFOA 1F3EA 1C9DA 5JMUA 1RQBA 1A5LC 1POKA 3TP4A 3V35A 3GSMA 4PMJA 3EZ4A 1KBJA 3GIPA 3LGEA 1FA2A 5BOFA 2TSYA 3P2VA 3QBUA 3NIYA 2XFYA 4GJJA 2WNZA 4GZ7A 5TQLA 4DUOA 4G8TA 2W67A 3PFRA 1K9TA 3UXIA 3SURA 2HNEA 3DX5A 1BG9A 4ENLA 4AXNA 3MA8A 1LG1A 4G2DA 1VCVA 3WLRA 2DZXA 1BSIA 5A6MA 1GVFA 1YTEA 4LXFA 2VL4A 4KS0A 3HG4A 4DJED 3WJWA 3QTGA 3NUKA 1IT7A 2ACQA 5F4WA 3NVDA 5I00A 2BS9A 3VNLA 3ITXA 2WMGA 1V6XA 3W7RA 2OO6A 4B90A 1F4AA 1IHIA 4MB1A 4B9ZA 3OBAA 4RE3A 5A6KA 2RHGA 1K77A 3UGRA 4DX3A 3QOMA 3HIJA 4XVDA 1K9DA 1GVEA 2CPUA 1Z9AA 3LBOA 3WK1A 2XVKA 1B1YA 1TPB1 3CLWA 3D3FA 3UD6A 4MVAA 1OGSA 3UJRA 5KITA 1VC4A 3H4XA 4U31A 5BNKA 1PZ3A 1DBTA 2VFIA 3P61A 4UMBA 4Q4MA 3PUOA 3MUY1 1W1PA 3KE0A 3GLCA 4GY7A 5HBFA 3AYTA 5L6UA 4N9DA 2YB1A 1OY0A 1DIOA 4HHPA 3ABXA 5D8WA 3N9SA 2EQDA 3KRZA 3RPDA 1M7OA 2PRMA 4LWWA 2VMFA 3W7EA 4KGJA 2E9BA 1UD2A 4Z0JA 1MQPA 2D0FA 3IWPA 4ZQOA 1GK8A 2WC3A 3ITTA 1MMFA 1XQKA 5JIPA 2VX7A 2WZTA 1XISA 2QCGA 2WWDA 4NUWA 1XH0A 1AW1A 3CQ0A 1DJWA 3BUVA 4TOQA 5JH1A 2OPJA 4CNUA 3QV6A 3FJ4A 3CL7A 2AMGA 4IP7A 4ZFCA 5E6YA 1ZENA 3DOPA 3LHYA 3KDNA 4WGHA 3VGGA 1MUWA 3OOQA 4FX7A 5T91A 3SM0A 1NARA 3VD4A 2VGIA 5LHEA 1Q2RA 1FCVA 1V8EA 3KZSA 2RKXA 4JTUA 3NSNA 2HPMA 1QNRA 3Q65A 3TROA 3NQ7A 4DJEC 2PAJA 1EDGA 4GYFA 1XD0A 4L61A 3OYZA 1IGSA 3MUZ1 4OBRA 1CGUA 3C3NA 4WY0B 1FTXA 1TJPA 2Z7KA 2QPXA 2G3MA 3VGDA 2TPSA 3WLMA 4C6IA 1YE6A 3TN4A 2W79A 4IG2A 4DJEA 3W23A 5E0CA 1QU4A 3U4AA 4XTDA 1A5MC 1W3IA 1OBAA 4AYSA 1IXPA 1TYGA 2QULA 5C2CA 1AQFA 3G0SA 2FZBA 3VU2A 4H9VA 3BLPX 2OXNA 2WHMA 1OX4B 3N4FA 2VQTA 3VM5A 2ISVA 1JPDX 4MB4A 4QSFA 1UP2A 1PJ9A 2OEJA 4TR9A 1CXEA 4ATLA 4GUIA 1R7OA 1Q4NX 1KB3A 2PWVA 2NVCA 3TQVA 4M3PA 2QEZA 1CWYA 3QEZA 4FZIA 4MAVA 2ZX5A 2BVTA 3AXXA 4KQNA 3LA4A 2YZ5A 3S46A 2DPEA 3D6NA 1OC6A 3BGAA 4C6MA 1GYLA 1L6GA 3S6OA 1MI3A 3CO8A 3FGCB 2NW0A 5BU9A 1VFMA 2AQWA 3KVJA 4MUPA 5CC6A 1QPRA 1GOKA 5LNVA 4ZQCA 3CWOX 5CKSA 4ZE5A 3E5BA 2PP3A 2ZRVA 5FJOA 1S5TA 2FGZA 5BXSA 3LMZA 4GABA 2HJPA 3CV7A 4Q22A 3GDRA 3ONBA 5IHRA 2I5GA 1WE5A 4AHOA 4LJ3A 4JKKA 3CEUA 4HU8A 3REQB 5A6JA 3TQPA 3KCOA 3PPGA 3B8TA 5G2WA 4TVDA 2VTFA 4GKLA 2QR6A 4S3EA 1WDDA 3FFSA 4H2CA 1N55A 2GWGA 2O7SA 4XO7A 4DF0A 3TJLA 1MUCA 1YIXA 1QATA 2C1HA 3CWNA 1Q63A 2HBXA 3FYOA 4UQEA 2OZ3A 2ZUMA 4AD1A 2PCQA 3IGXA 1EJUC 1VFFA 3LCFA 1J96A 4Z42C 2FPYA 4YN5A 4GIAA 5DY3A 1GW1A 5DF0A 3PSWA 4NU7A 5I6SA 2V67A 2Y7FA 3GDTA 1KXTA 3BGJA 4A22A 2HEJA 4DJFC 1AK5A 3M9YA 5CJ5A 4BQ2A 3W74A 2CLHA 3ABQA 3QY8A 5A2CA 2INZA 1UROA 2D23A 1B3XA 5D4YA 3R13A 1XR2A 3QQWA 3L4ZA 1QAPA 4PSRA 2W3ZA 1C91A 5FACA 1LJYA 4A3YA 2VWSA 4CN1A 1OEPA 4U33A 4BI6A 2YXXA 3TYZA 5D9OA 7ODCA 4ZENA 1DXEA 3R58A 3W1AA 3MKCA 4H19A 3ANUA 2QUVA 4DYEA 3ARVA 4WHBA 2GGEA 4AU0A 5CZKA 1KFEA 2JE8A 4KERA 4GVHA 2NV1A 4BS0A 1S2AA 4E3VA 4RX0A 4JCLA 2MUCA 2BV9A 3CHEA 3A23A 1ADOA 2GUYA 1J2BA 2XH4A 4UQCA 1KXHA 1E1FA 3ARRA 3GR7A 1TR1A 2A3EA 3RPMA 4L1GA 2R8WA 3BCJA 3EX6A 1IGWA 2NXIA 1UD6A 2FIQA 3W1MA 1LBFA 4GA8A 3SADA 3INPA 1GPFA 5A1AA 1ZSXA 3UETA 3R8RA 4FNQA 2UY5A 3BV7A 2QDDA 3OJGA 3EAUA 5LIWX 4W7VA 4GCXA 4C5ZA 4D1JA 1A3WA 4K36A 1SVDA 1CGYA 4RXFA 2V2DA 3GZ3A 1B54A 4PB3A 4ZOAA 1UG6A 3F03K 1NSJA 1WKDA 2IPWA 4WIWA 1QW9A 5JBEA 3E0LA 1RQHA 4LB3A 1S1PA 3WNMA 1KM2A 3UY8A 2OU4A 4MB5A 3E02A 4LQ1A 1XLGA 2GDVA 2OYMA 1H51A 4DWDA 1ICQA 1EF3A 4LYKA 4CQDA 1UJPA 3CIVA 3DFYA 1DIDA 1Z3NA 1QWKA 4H6EA 1B90A 4H7VA 4WRHA 5C8BB 1C7SA 2GZXA 5HNTA 1KFLA 1B4KA 1DTNA 4HP5A 3O15A 3BMVA 1LUCB 3E2SA 3FYYA 3THUA 5CPTA 5HWMA 3EPOA 1M03A 3NZGA 5K3VA 3GVQA 3DFSA 3GTFA 3SCUA 4EKJA 3FKRA 2E9MA 2GDUA 3ZO9A 1TQXA 1VFTA 1RXOB 1NP0A 1FKWA 1YEYA 1OX6A 4HNCA 4NG3A 4EVZA 4ICNA 4ZTYA 2CIPA 4Q4PA 5EGRA 1Q6CA 3WQWA 1QO5A 4HZ6A 1WUEA 3SN4A 1TV3A 1W32A 4ZR8A 3ZVIA 4HNLA 4JIHA 1NFBA 3PTMA 2F6XA 3VIHA 2J9XA 4ICMA 5BMWA 4W89A 3LTPA 1YDOA 4PMXA 2BOEX 4D2JA 3ITYA 3H4GA 3NZQA 3ZLHA 1R3SA 1THFD 4IMCA 3F2BA 3F4CA 4M29A 3K8KA 3QHOA 4L6DA 2Y61A 1OJXA 3WJZA 3GW3A 4GI8A 1WKYA 1EZWA 4S3GA 2GUBA 6CGTA 4JAWA 3GDMA 1UD8A 4FR1A 3UPWA 2GK1B 1S3HA 3NVTA 1Q6EA 2PDKA 4V2XA 1US3A 3HGSA 1N82A 4H3DA 3CZJA 4JIQA 1V02E 2OLSA 4LAZA 2FB3A 2O4QA 1UWSA 1XM3A 3TOPA 4XK2A 1WDWA 4QITA 3M0YA 4PH6A 5CPLA 4IX2A 3DKJA 3TYDA 2PWFA 1OX5A 1R9ZA 3V36A 2PE4A 2R24A 5H91A 3WQOA 2DGAA 2YCIX 2OKOA 1HN1A 1EQCA 7ENLA 4TVUA 5E6ZA 1B31A 3GVWA 4MDOA 3T09A 3L66A 3W2UA 3VMPA 1IXQA 3FIGA 4NJIA 2Z1XA 1HKMA 1V3IA 2OSYA 1AA1B 3H53A 3TQ0A 4E2OA 3MKKA 1ONEA 4DJDD 4S2BA 5ABFB 5C2GA 4F0KA 5I3DA 3R0DA 4JTLA 1BD0A 3ZMRA 4DF1A 3N9KA 5TF0A 3LS9A 1G4SA 1NP2A 1WOAA 5A8PA 5A6LA 4KWWA 3W1PA 3THAA 2YCKX 3TQKA 2CZDA 3L67A 2WW5A 2H90A 1XX1A 2EHHA 2TMDA 1WP6A 1R8LA 3LGDA 2TRSA 4UQ9A 1NFPA 2Z1BA 2VM8A 4B5WA 1FWSA 2R1LA 2WSRA 3FDGA 3QF0A 2XWDA 2ZQ0A 4ZB2A 4EWJA 1ONXA 3T8QA 1W1YA 2R91A 2CZVA 3O0KA 3BG3A 3E0VA 3SCQA 2BY3A 1EBHA 4UFLA 3PANA 2CKRA 3CMGA 1C3FA 3GTXA 4GH1A 1PIGA 2J6XA 4L6HA 4YTTA 2X1IA 1I4NA 5F1VA 1FFRA 1XL9A 3PBUA 4AMAA 4QRNA 3VIOA 4XISA 2NUWA 3E5PA 1TB3A 4PMQA 3RUBL 3N34A 2BDQA 2VC6A 3QJAA 1QTWA 1Q8JA 3NQAA 3W7KA 3GHUA 2FZ9A 4GUGA 4HYVA 1RUSA 3LENA 2J7EA 3PB0A 2E8ZA 4TV6A 1DJYA 3AIVA 1QI5A 1M7PA 2QAFA 1UW9A 1S2UA 2WMFA 4UTIA 3QW3A 1S2CA 3R5EA 4HQVA 4W8LA 2FLIA 3U0HA 1PPIA 3AHYA 1KCXA 4XSMA 1FWCC 2QQ6A 1F6YA 3S2JA 5A5WA 5PTDA 3V7PA 4LVDA 2VQUA 3I68A 1D8WA 3CQKA 3SY1A 1ZFJA 1G69A 3NQGA 3G24A 3R25A 4F3HA 2GPTA 3CQIA 4RJEA 2J9ZA 2WMHA 4WUIA 3H22A 4HYWA 2WVVA 1LDCA 3OA3A 1Q85A 1CGTA 4BY3A 2E1WA 5B7YA 3U8GA 3W37A 1EYEA 2ZRWA 3SRHA 1XXXA 3NYDA 2CWXA 1ICPA 3DBPA 3C0QA 3A64A 3C56A 4DO6A 4A3QA 3LZ3A 3V0TA 2DZPA 1CNVA 3AALA 1QPKA 4CCDA 2IKGA 1GZJA 5HQLA 2IW0A 3IV3A 3UZYA 4EXQA 1JCMP 9XIAA 5HMFA 3GX9A 1E6NA 2OGJA 1WQ5A 4HJFA 1QBBA 1OC7A 4I9TA 2EG7A 3SGUA 1WDPA 3QC3A 1HJXA 2PURA 3T40A 2PMQA 2GGJA 1W1TA 3QMSA 1GHSA 1DWIM 5C71A 2WJDA 4K6AA 1MXGA 3ES7A 3DECA 5AC4A 1PHQA 4KRZA 4AF0B 3RMJA 2YBUA 3GNXA 4ZOEA 1J6OA 4H9UA 3WQ8A 3TNBA 2BXVA 1GHRA 3VMNA 2YDQA 3TXVA 3SBFA 2PTZA 1UKQA 2X8RA 2VFEA 4LRTA 2PA6A 1TA3A 1TX0A 1W0MA 4RUBA 2PBOA 1RJRA 4Q3MA 1XYBA 4XD3A 4JFVA 4XD6A 1XIJA 2QDEA 3IAQA 4DYKA 1V79A 3IUIA 3MANA 3ANYA 5MHBA 1G01A 4LNYA 4JN7A 5E1QA 3M4HA 4IMDA 1PHWA 3IK2A 2OSXA 3UZWA 4IPPA 1KD0A 1DXIA 4UFJA 3UEQA 2XSXA 3SFWA 4LUTA 4WJXA 3A47A 2Z1SA 4UC5A 1OK4A 1XYLA 2V3EA 3GS6A 4Z17A 3BAYA 4DEFA 1J01A 3SSZA 3FKKA 4IIFA 3DGRA 2Q09A 3LV5A 3KOZA 2A3AA 4Q33A 5DLCA 3SRDA 4DWSA 2UWFA 2YDRA 2V82A 1TTPA 1J0JA 4OZOA 1K4GA 1N7KA 4H7CA 3M0ZA 1KTCA 3QC0A 4OQVA 3K8LA 1VEPA 3GY1A 1FWFC 4NNAA 3PVFA 1RK6A 4XZMX 1QOXA 5H8MA 2OQYA 3N6JA 4RR4A 3U6WA 5A6BA 2OLAA 4D9PA 3HOJA 2V30A 1KM3A 1JCXA 1E9ZB 3CL8A 3DI1A 1RP8A 2HROA 4GC3A 2PTWA 1CLKA 2NQJA 1FOBA 2RDWA 2KAUC 3KTCA 1XYCA 4RE2A 3ATYA 3FYPA 4HPGA 1H7OA 4V15A 5KZMA 3DFHA 3H2CA 1NDYA 2YL8A 4MY8A 3E96A 1DJHA 1GYMA 4EAMA 4MY1A 1UR2A 1XFCA 3B9EA 3L9CA 3TV8A 5FJRA 1EP3A 2QJGA 4H8VA 1IR2A 1CX9A 2EXOA 1WZAA 2GJXB 3QQ1A 4M6PA 4CN6A 1VBGA 1PTDA 3DHDA 3EWYA 1WX0A 2FHCA 1T6MA 3CHFA 2J77A 1BXBA 3SN0A 1PCWA 2C13A 2YFNA 4JTJA 1J0ZA 1JPKA 3MBFA 3VIGA 3TA9A 1T8XA 1WXJA 1DJIA 2Y8VA 2BGSA 1DWHM 1PTAA 1YBQA 5HDRA 8RUCA 2X0HA 4ZFMA 5CGMA 4FPSA 2V63A 1DJGA 3DYPA 1VYPX 4F0MA 1R85A 4UR8A 1TSIA 4UTWA 2VR2A 3PWAA 4IFRA 4MWAE 4TUFA 3WD1A 2G3FA 1W2VA 2E7FA 4X61A 2CESA 3KTSA 1TPDA 1R2RA 1QASA 3G3MA 2GJLA 1JZ4A 5A69A 4GE8A 1AODA 2V3GA 4C6QA 1X6LA 4H9TA 3ARTA 1SW7A 3B05A 3WLSA 1RALA 4AFYA 2ZXBA 3O9NA 2YKKA 1CEOA 4LF2A 2GGGA 1E9IA 3DYOA 4PODA 1ZBCA 3STGA 3WQ5A 2ACSA 3HG2A 2UZ9A 1VH7A 4CQ8A 3ITOA 4XAGA 1SM9A 2B7OA 4IIDA 5FEZA 3LLFA 2ADAA 3PC0A 3AXHA 1GVYA 4GYPA 1ZBWA 4GIRA 4N7QA 4PSPA 2A2IA 3CH0A 3TJIA 1B9BA 1O5QA 3KWSA 2TYSA 4OBTA 1YNQA 1XJBA 2GVEA 2WNWA 1AL8A 3WDIA 3KLLA 3S1UA 1O1ZA 3W7DA 2Y2WA 2P3EA 4Q6XA 1VFOA 3AYSA 3CUHA 5FJTA 2P0IA 3GHSA 3T42A 1GONA 4H6RA 2Y62A 1NELA 2FJKA 2QV5A 2R1PA 1UH3A 2X0SA 2PS2A 4I8DA 1XDMA 3B9NA 3TTSA 4S3FA 3BJTA 3M0VA 4NP7A 1A47A 4W88A 1A3HA 3PG8A 2Y4SA 2E5BA 4S1FA 4JCMA 3EDFA 4E0CA 3VMOA 3FSUA 3W6LA 2XGZA 1TREA 5ECVA 4CU6A 2ALRA 1PTGA 1AQMA 2ZIDA 1R3WA 4ZOCA 1YDVA 1IYXA 1E6RA 3NQ6A 3IS4A 4DZIA 1YXYA 3QGAC 4H00A 3KFTA 3NL6A 2JALA 4DYJA 5CC5A 4CVWA 5HNUA 4XBSA 4AC1X 3STEA 3LYEA 1DKWA 3UF9A 4FOUA 3GVVA 5I5RA 3WJXA 3UERA 3WLLA 1HKKA 2FVLA 2Z2BA 1Q2SA 4J3ZA 1OG6A 3FJNA 3QGKC 1TELA 4GYJA 2O56A 5REQA 1VBRA 4JHMA 3AQUA 1LQAA 3WF3A 4MG4A 3LCGA 1D3GA 5BMXA 1PKLA 4XBKA 1K8ZA 1IF2A 4IGMA 2D2JA 2Z7GA 4PCFA 4CQCA 1GEQA 3CS2A 4K1WA 4KETA 3MV11 4QXIA 1EXBA 3W2MA 4L4OA 2H3DA 4C6KA 1TUXA 1H7WA 3LSBA 1T40A 3UPBA 1QHOA 4MMWA 3AIWA 2QHAA 7A3HA 3L65A 1GWJA 2WJFA 4MWAD 3ARZA 1M65A 4DELA 4IIBA 4P7OA 2E25A 2VFDA 2D2GA 3WH5A 3TYEA 1H2JA 1X98A 4ZBCA 2HSAA 1PE1A 3QPZA 3VIMA 1H62A 2VJXA 3S1WA 5A8OA 2AL2A 1Y5WA 3EWCA 4WXYA 1R30A 1XIFA 4OKDA 3BDKA