4NZFA

Crystal structure of abp-d197a (a gh27-b-l-arabinopyranosidase from geobacillus stearothermophilus), in complex with arabinose
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
431
structure length
431
Chain Sequence
ASMHHYQWAKTPPMGWNSWDCYGASVTEDEVKGNAEYMAKYLKPFGWEYVVVDIQWYEPGANSSIYRPFVPLEMDEYSRLMPAVNRFPSAKGGKGFKPLADYIHNLGLKFGIHIMRGIPRQAVHQNTPILGTNVGARDIADTNSICPWNTDMYGVDHRKEGAQAYYDSLFQLYAQWGVDFVKVADIVASKLYGTHTEEIKMIRKAIDRCGRPIVLSLSPGPAPLDHATLFVENANMWRMTDDFWDRWELLYDMFEQCYKWCKLVGLGHWPDADMLPLGHIGIRSVDGGGTDRMTRFTKDEQRTMMTLWIIFRSPLMFGGELRDNDEWTLSLLTNEEVLHVHQNGYGARQVYRENDHVVWTSQDAEGNQFVAMFNISEKRSVVSVSLKDLGCMEPMKARDLWAKEDLGLVKHQLAFELGPHQSILVKLSPAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Abp, a GH27 beta-L-arabinopyranosidase
publication title Structure-specificity relationships in Abp, a GH27 beta-L-arabinopyranosidase from Geobacillus stearothermophilus T6
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 147
structure length 431
sequence length 431
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4nzfA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4nzfA01
2NUXA 1UKSA 4N6FA 4IMEA 3GLCA 5E6YA 3I7RA 4HIBA 1KFLA 1PZ3A 3MMTA 4E38A 5BMWA 3DENA 4U4MA 1LYXA 4AH7A 1IZKA 1JXKA 4LUIA 4JICA 1K3UA 3T40A 3W7EA 3F4NA 4OV9A 4AEFA 1EHAA 3CU2A 5LNRA 1TV7A 2C6QA 3K30A 1P6WA 2FYVA 3SJ3A 4ADUA 1KW1A 2D3NA 1SZEA 1ZALA 3AMLA 1M7OA 1FCVA 3W7QA 1J2WA 1FXQA 3STCA 4LXFA 3DFPA 3DFSA 3EEGA 3IVUA 1TMQA 2V2HA 3WK2A 1X1ZA 2Q8ZA 1TQTA 1H3GA 4WY0F 3CTLA 2GOUA 3NQ6A 3FFSA 2Q3OA 1WA3A 3DHFA 4IMGA 3TQVA 2ZQ0A 1I2OA 2FTPA 3GAYA 2FGZA 3OVPA 3KXQA 1GQNA 3M07A 2HTMA 3MUXA 3S5NA 4UTMA 1UD5A 4WSKA 2YZRA 1I2RA 2Q8LA 1DTUA 5A2CA 3BGGA 3H54A 1JCNA 3HBLA 2VFGA 5LSMA 4LVAA 4G1KA 3DX0A 3A23A 3SGZA 4FLOA 1JRCA 2BY1A 4MIMA 3FAXA 3DX2A 1EWDA 1LTDA 3TX9A 3CEUA 3P81A 4LNYA 1FCBA 4EVZA 3HB9A 2EACA 4UCFA 3U2OA 2F18A 4O1DA 2D3LA 1C9DA 4K8HA 5HWJA 3GNNA 2BY0A 2EGZA 2FHFA 3TQKA 1KGWA 1QI4A 3KX6A 2XVKA 4CCDA 1JCXA 2PWEA 3QSRA 3B04A 3EB2A 1PS9A 1XGZA 3R12A 3TH6A 3VGGA 1QDSA 1WDWA 5CPOA 1TPVA 3G8EA 3ELFA 1EB3A 1SO3A 2V2DA 2E1DA 4AB4A 4UMCA 1LRTA 2HMCA 5AN7A 1BWKA 1KGUA 1KXVA 5E0KA 3GDTA 3QMTA 2QCLA 5G1YA 5CPNA 5L9FA 2E8YA 2Z6JA 4FX8A 4TU1A 5A2BA 4JTIA 4E2DA 4UTKA 1R2SA 5LNUA 4MZYA 1WOBA 5I3KA 4NXSA 4HOWA 1LZOA 1UCWA 4ZQOA 2XIIA 1J5TA 2J6XA 1MEIA 3WJSA 3ZR5A 2CLIA 2IGTA 1XH0A 3QFEA 5DY3A 4MY9A 4IXXA 4AAJA 5G4WA 4DXVA 5E1QA 4WOQA 3ANYA 4H2CA 1IXOA 2YW4A 3R5EA 3IIZA 3INPA 3NQDA 1UD2A 1CIUA 3DBPA 1TCMA 4O11A 3HF3A 4UTTC 1F6KA 5D2YA 3GAKA 4R33A 2PRMA 4AWSA 1CXLA 2ZXDA 2H6RA 4ZZ9A 4WJEA 4JYFA 3ECQA 3I68A 4K7YA 2WSPA 4OWGA 4ALDA 3DX1A 3N73A 4IX2A 3TK7A 3EWWA 1BSIA 2OSXA 1W3TA 3C56A 1TQVA 2LLEA 3PM6A 4ZMGA 2CLKA 4PEEA 4UMBA 3NQ7A 4MFEA 2BHUA 3DXIA 5K7JA 4RZ4A 1WZMA 3W86A 4NQ1A 1Q6QA 4QAIA 2X1TA 2NV1A 1VJIA 4ADSA 3C0JA 3WDHA 3W38A 1MW0A 4UZUA 2Z0IA 3R2GA 4YXGA 3W7KA 2EPHA 1ZY9A 4LRSA 3TFXA 1WZKA 3LRMA 2OCZA 3T44A 4AF0A 3S0CA 2ZUWA 1KBJA 4AHOA 4Y90A 3KL3A 4UNLA 3L4YA 1I2NA 2ZZ3A 5AHMA 4UXDA 3BW4A 2WPGA 2Y63A 4GI6A 2CLHA 3HG4A 1D3GA 1RPXA 4X9SA 5FEZA 3VSVA 5HR6A 2A1YA 4CQAA 4AEEA 3BSGA 5F1UA 4U2ZA 3OLEA 2ZWZA 4MZ1A 2ZX8A 2G95A 1AQMA 2Y62A 1KM5A 3LHVA 2QCHA 2QMJA 4JTJA 3HGSA 1ICSA 4LRTA 1I2QA 2D0FA 4NX5A 3FIGA 4WSJA 5BOOA 1D3CA 3L5MA 4LV9A 3W1LA 4GUIA 1JULA 3TOPA 4KWUA 1X8FA 1KBKA 3LB0A 1KBBA 3C52A 4K39A 1HO4A 3II1A 3W84A 3BUDA 1KXTA 3R13A 3S1WA 3EWZA 2WC7A 5AHFA 4A2RA 1KFJA 1NVMA 3CZKA 1OX4A 4AXKA 1F05A 3TXVA 1W37A 1VYRA 1XUUA 3LTYA 1TTQA 2E77A 4WQ6A 4UFIA 5F2IA 1XFBA 3VNDA 3ABOA 2ZUUA 1LROA 4I7VA 2G96A 4R7JA 2ZA1A 4H3DA 1WPCA 4O1AA 3B06A 1I8JA 3EX6A 3WNMA 3IJ8A 3BUIA 3LXAA 1H7WA 2DJXA 2QCGA 4UR8A 2JGQA 1IF2A 1JDAA 1XDLA 3V1PA 5FEPA 1AW5A 3E49A 3NL3A 4LS0A 5C54A 4MY8A 5C55A 2XIBA 3H53A 4GINA 3QM3A 2WPBA 3P61A 1B0IA 3LLDA 3G1AA 1OSEA 5DN1A 1MXDA 2B7QA 1JQXA 3LI0A 4LY8A 3MWAA 1EUNA 6CGTA 5BRPA 2BY3A 3WFAA 4EF9A 4KWWA 5D04C 5F1VA 3RIKA 3NL2A 4X9YA 2OYKA 5A6MA 1LOSA 3G1DA 5AFDA 4LV4A 3EWXA 3G0UA 2WCSA 3NPXA 2WV8A 2VENA 3HPSA 1Q6OA 2Y7DA 5D09A 4AIOA 1O94A 1U83A 3TTYA 1SSDA 4YLWA 1HWWA 2AGKA 3KRZA 1ML1A 2A6NA 3MBDA 2YFOA 1SW3A 5DO8A 3W7DA 2YGYA 5CZSA 2Y24A 3W7PA 3L9CA 2P0OA 1KB3A 1W1ZA 4O18A 2QKFA 4JNMA 3M47A 3CZNA 1JCJA 3BAIA 1YXYA 3PUDA 4KFOA 4X3ZA 1GYLA 1LCOA 3FJLA 3C2OA 2VELA 5EBUA 1SMAA 4QIUA 1BVNP 4MPQA 4PA8A 2YA2A 1LP6A 2ZX6A 1YDVA 5D2WA 3VE9A 5J5DA 1E3ZA 2V0TA 4MJZA 1JD7A 3W2LA 3VGFA 3IGSA 4QNEA 1QW9A 4UQBA 1K7FA 2ZTKA 3BCFA 1AW1A 3HG2A 1MVYA 3VU2A 2VRQA 3E0IA 2ZZ7A 3QZEA 4U31A 3TMQA 3ZWTA 5FF3A 4S2CA 3BMWA 4B5NA 2F7QA 2ISVA 2CLMA 4MZ8A 4ONVA 2NUWA 3S6DA 4OGZA 2A7RA 2XFWA 1EO7A 1QPOA 1TPH1 3LRLA 1PV8A 3W1RA 3MJYA 1GVOA 1QHOA 2E9BA 1KCLA 4JTTA 3N19B 5EMUA 4E0CA 4MY1A 2XVGA 1XSJA 4AMXA 2NWRA 3N2XA 4RLIA 3NXFA 2EQDA 1CGWA 4HPJA 2JBMA 2WNQA 3KVKA 1AMKA 4K38A 4ORMA 1VGAA 4FB7A 5DCBA 4JTLA 2ZRYA 3QW3A 3RMJA 3QRHA 1F76A 3A47A 3KAOA 3G24A 1H7OA 3BAWA 2QPUA 1KLYA 3PBVA 4FEZA 3IV3A 2ZICA 3GK0A 3S8HA 1G5AA 3CGTA 1IZJA 3DFTA 3BO9A 1Z44A 1VLWA 2V5BA 3THAA 1MWOA 4UTUA 3NPVA 4PTNA 1H7NA 1QOQA 4RKAA 4LU0A 3SY5A 4AHPA 3TC7A 4WX2A 5HULA 3AXHA 2WSYA 1DVJA 1CXHA 2WSQA 1LM1A 3TJXA 3M44A 1GPWA 3WK1A 1JUEA 2R14A 2A4AA 2BWGA 1JI1A 3MP5A 5D02A 1EP2A 3I7SA 1CYGA 2C7FA 2IQTA 4LTSA 2Z2UA 3NZ1A 3CIXA 5HWNA 3ZT7A 3IIVA 5AYXA 1MEHA 1ADOA 2BTMA 1C8QA 1GVIA 1Y7VA 1KM6A 1FCQA 1XV8A 3VMOA 2A85A 1AK5A 2VT0A 1F6PA 1HL2A 1SW7A 2ZA3A 1XDMA 3A5VA 3BAKA 5CZJA 2ZXQA 2Y85A 5CGMA 3HQ1A 4JD4A 4IMDA 3WDJA 2EAWA 3BH4A 2QJHA 4Z1AA 5I3JA 4XB3A 5KINA 1G67A 4JFUA 3M5ZA 6TAAA 1FX6A 4RXGA 4AVFA 3UG5A 1KV8A 4OQVA 3AXIA 3EX4A 5LNVA 3M43A 4LUJA 2D2OA 8TIMA 2GJLA 4GFSA 3TU9A 3TC6A 3AJ7A 3UPBA 2RDUA 3MHUA 3CLMA 3WELA 1KTBA 2ZYFA 3WK3A 3WJXA 1VFOA 5FI8A 1GJWA 2A5HA 1VJSA 1TV8A 3DH7A 3S9YA 4FMVA 3OIXA 4NUWA 4EF8A 5EKYA 4B9YA 1DV7A 3KE0A 3W22A 3IGXA 2C13A 3BAYA 1UA3A 1JR1A 1WE5A 3VGBA 2VEMA 4B9ZA 4O57A 3C61A 3W2UA 5EYWA 4BI5A 1JDCA 3LV5A 3CT7A 2E6FA 4PEKA 2WNNA 4U2YA 1ZENA 3BV4A 2EJ1A 4ZQRA 4OE7A 3UWWA 4FIQA 2WNZA 1IXNA 2VXNA 2YIHA 3WEOA 1WOAA 1P1XA 1L6SA 3VGDA 2ZZ5A 1ZAJA 3P8JA 3R8RA 3M7WA 1P4CA 1ZJIA 2OW6A 3PG9A 5D30A 5G2IA 2D0GA 4J3XA 2JK2A 3BG3A 4BR1A 1VIWA 2E5BA 4NT0A 3W6YA 4CCEA 4H8HA 2Y7FA 2PRHA 3WJYA 1H63A 4OKDA 1W5PA 3CPRA 2A21A 1TYGA 4MYAA 3G8RA 2F1BA 1OX4B 1PL9A 2QCEA 1YPIA 4WZHA 4ADTA 5A5WA 1KBIA 3O63A 2E09A 1A5CA 5ABTA 4BI7A 4HNVA 3FKKA 1DKWA 3EJSA 3DI1A 4Z1BA 3T55A 3TCEA 1CDGA 1H1YA 3W87A 1EWEA 4UFMA 5TD4A 4UOZA 1TPEA 3VGEA 1IGSA 2C15A 2DZWA 2V9DA 3LCHA 2EABA 2Y2WA 3TAKA 1UJPA 1TPC1 3W37A 2PRLA 3TSDA 3W23A 3LLFA 3W76A 2ZFAA 3KVMA 1LBMA 4BK9A 3W71A 3PR2A 4CN1A 2BSLA 3A6OA 4O17A 3PF3A 5HWMA 3O07A 2BXYA 2VFIA 4EWND 4NZFA 1TPDA 5I5RA 3C2VA 1R47A 3S1XA 3BARA 3IVSA 4MAZA 2W79A 1F73A 1GTEA 4UTWA 1FUYA 3EWYA 3GX9A 1QPNA 1VFMA 5F4WA 5HINA 1VH7A 3S5ZA 3D51A 4HOXA 3N14A 1L6YA 2NXHA 3O16A 3ZWSA 5LGZA 5H2ZA 3KHJA 4A21A 3NEVA 3L4UA 1EPXA 1Y0EA 1H5YA 5HPOA 1T99A 4L4MA 5CG7A 4E2BA 2ZX7A 1MEWA 1LRNA 1VLIA 1XL9A 4A22A 1I45A 1H1ZA 2TPSA 4CCCA 1TIMA 3B0VC 4E2OA 2RKXA 2C16A 3N3MA 3GXIA 1EA0A 3NQGA 1TTIA 4C1KA 3BCDA 4JGDA 3GR7A 4UQ9A 4NJGA 1VPXA 3F4WA 4BF9A 5I3GA 2FE0A 3W2KA 3W7NA 2D0HA 1RR2A 1WX0A 2YYUA 3FS2A 1XM3A 3SFKA 3WNPA 2QF7A 3TDFA 1DQXA 1BKSA 3RILA 4NJJA 3FAWA 4GUHA 3A4AA 4M5PA 4JFWA 3BLIA 1OK4A 4IXHA 3W1TA 3W7MA 2A7NA 3NGJA 3M16A 1CGXA 1PPIA 3IEBA 1AMYA 4S2BA 3TUUA 2AAAA 2QR6A 1J0IA 2OJPA 4GXMA 3N2MA 4UQAA 3GYEA 4OT7A 1F2JA 2TRSA 3K8KA 4LVGA 5IM51 1W5OA 5DY2A 2X1RA 4FNPA 4FNTA 1C8VA 5LZLA 1YPFA 3WNOA 1OJXA 5CLWA 4DEFA 2CW6A 4JY9A 4H8VA 2ISSA 2ZIDA 1WO2A 1G4TA 3LBCA 2YJQA 1O5KA 4HNUA 2OYLA 5G5IA 1AG1O 4M7TA 1SR9A 3WNLA 4R34A 1HVXA 1XI3A 1SU5A 1B2YA 4M19A 3AJXA 3PBWA 4TO8A 1TREA 2HS6A 1SFLA 5D2VA 1OB0A 3UD6A 3E12A 3L5AA 1L0PA 4LOCA 4PCTA 2F2HA 3M0ZA 2QDHA 5FESA 1ME9A 4O14A 4U33A 3E02A 3QQ0A 1W9XA 2ZXBA 4H4IA 3D50A 3L2MA 3OBKA 2OT1A 1TQSA 1KM1A 4FXSA 5FF0A 2CWNA 1FCUA 1KFCA 3JS3A 1MW1A 3WMSA 1ZJBA 3OLGA 2QCNA 2OZ0A 3OA3A 5AHNA 3ABQA 3LOTA 1ME8A 4W9TA 4QITA 3STEA 4ZQPA 1PHWA 2E6DA 3UNDA 4YCOA 2BY2A 3W7RA 3OG3A 2NSXA 1X7FA 4XZ9A 4PSRA 2YYTA 1YTDA 3QMSA 3VNYA 2H90A 3NM1A 4JN6A 3G1HA 1D7FA 1RQHA 4PSPA 4GE8A 2E8ZA 2G3MA 4HHPA 4PL1A 3TROA 1EP3A 4UNIA 2DIEA 1W5MA 1JUBA 3P62A 4LVDA 4NXKA 4CNPA 1EEPA 1W8SA 4JYEA 3G1SA 3ATZA 5F4SA 1ZS2A 3L2LA 4LQ1A 1R2RA 1BPLB 3A24A 3DHPA 1A53A 5HJLA 4IOTA 4P2VA 3IGUA 1E40A 1G6CA 3LCLA 4KWVA 4GBUA 4U3CA 4N02A 4QAWA 4XTIA 5DBUA 3HPZA 1S3HA 2FIQA 4N2YA 1QWGA 1J0KA 2NX1A 3CWOX 3GBDA 2ZRXA 1H60A 3HO8A 1UH2A 3MI6A 1H7PA 4N6EA 1EP1A 1XC4A 4FLRA 1XCXA 5E9AA 3GVGA 2WSRA 4O13A 3T4CA 5K4ZA 3EJRA 1NM9A 1BVZA 1F5ZA 2NXIA 1ZJAA 3GIYA 3BVWA 3W07A 2DZTA 4ZQCA 4RV8A 4X0NA 2GJNA 1WAUA 5AYZA 2WKJA 5AC8A 4CVWA 1KFBA 3M1ZA 4UFHA 5HMSA 1GJPA 1Q45A 4MB1A 1FDYA 2QJIA 4AHQA 4JTEA 3RF9A 1WP6A 1Z42A 5D38A 3RFAA 3S42A 2R91A 1RV8A 4DPPA 3VMNA 3UPWA 2BLEA 3TQ0A 3GDLA 1JDDA 3BPWA 1TJPA 2DIJA 1DORA 3K1DA 1KXQA 3P82A 1XH2A 1U2YA 4AMAA 1RZMA 2X1SA 3F03K 5U4NA 3W75A 1VHNA 1B3OA 4JTSA 1Q6LA 2QV4A 3B0PA 3T78A 3NQCA 5I0DA 4CN6A 2Y70A 1KV5A 1FBAA 3P5ZA 4O8RA 1FWWA 4DO6A 2CZEA 1K8XA 5J5RA 1H51A 1K8ZA 1I2PA 5T26A 2JKAA 3GBEA 1B9BA 1M53A 1VR6A 4AYGA 4JTFA 3W1AA 2I9EA 3TW7A 2ALWA 4DF0A 2C18A 3HIJA 2OT0A 3B0UX 4J3TA 3DHDA 2WVVB 1YXDA 2E5CA 2Y7EA 3LDVA 3C6CA 2EHHA 2H3DA 3KL0A 1G1YA 1D3HA 3W2JA 1PS3A 4UQCA 3KRSA 4I7UA 2Y4SA 2GJRA 3DDFA 1QHPA 1VAHA 3IJ7A 1JCMP 3O6YX 4WY0B 5CPMA 3BVJA 7TIMA 4O0ZA 3BC9A 3W1QA 1TJRA 2A7PA 1LLWA 4BWLA 1GVFA 2Y7GA 1L2UA 4O50A 3TA6A 5EPDA 4MOZA 1OFQA 2WOQA 4O54A 3A9IA 4JL2A 3VX0A 5G1TA 3NDOA 1LDCA 4NI3A 3FOKA 3TSBA 4WF7A 5G2WA 1JXJA 3TMLA 3WJZA 2VUYA 3BVUA 4HPXA 3NQEA 4O10A 3UY7A 3VE7A 2OSYA 1ICPA 3PY2A 4H8UA 1NSJA 3E9AA 1GG0A 5C6MA 2YA1A 3K8LA 3G22A 3MYOA 1KM4A 1PIGA 1G4SA 1KM3A 1K7XA 1HTYA 2B0MA 5F7UA 1RD5A 2ZZ4A 5DXXA 3BUQA 1Q3NA 3GTNA 3W7HA 5K9CA 4QQ3A 3THQA 1KXHA 3O15A 1PJ9A 3F1QA 4MLJA 4Y96A 3I65A 2NT1A 5F2LA 4X2RA 4UTWC 1DEDA 1EH9A 5I3IA 5KTLA 2CLOA 3M41A 4FXRA 4IPIA 4BI6A 1MFVA 1YADA 5D2XA 1CGTA 1VS1A 3PS7A 1G4PA 1TQXA 4JY8A 1OYCA 5CZ0A 4O1BA 2JKPA 3RU6A 1VRDA 3UWYA 1PIFA 3LPOA 3DAQA 3PSVA 4N9EA 3BLEA 4DO4A 1EX5A 1RVGA 1CXIA 1LOLA 4J3VA 3CPUA 1GT8A 2QAPA 1SZFA 3PULA 3L0NA 3EDFA 3W73A 1QW8A 2J27A 5TQLA 1UD3A 3V75A 3L4WA 3QSTA 5GVJA 3BLKA 2NX3A 3SR7A 5I24A 1H7XA 3ZR6A 1SQ7A 3H55A 4XTDA 1PE1A 2YXGA 4TMCA 3EKZA 1FWTA 5D05A 1WZAA 1JFHA 3UWZA 5LKYA 4RR4A 1CLVA 3MP4A 4MLRA 2TMDA 3WY4A 3VFLA 4JX4A 3NPWA 3UWQA 3RNDA 3B8DA 1ONRA 1VCVA 4JIQA 1JGIA 3JRKA 4O12A 2XWDA 1ICQA 4OIFA 2J9YA 4GKLA 1HFBA 1LBFA 4J28A 1IIHA 4ZQMA 1JI2A 4RCXA 4CGTA 1O4UA 3CHVA 1TPFA 2FH8A 3BUBA 3LERA 2YW3A 4PODA 3NO5A 5AOUA 3OHIA 3PC0A 3DI0A 3BAXA 1FDJA 4IJBA 5G2HA 3UZJA 4DBEA 4FHAA 2YA0A 2ALDA 4N9CA 5D33A 1PZ2A 5AHLA 2QCCA 3LHZA 1DL3A 1JIBA 4NX0A 2GVJA 3OVQA 4LVBA 4QJ1A 5AC6A 4EIVA 1QPQA 3EDJA 2VFFA 2AAMA 1XD0A 3U6WA 4PCFA 3EJQA 1JAEA 3LTSA 2QMKA 4LPCA 5HR7A 4W93A 3NAVA 3W70A 3BVTA 1H50A 1VCFA 2VFDA 5AHEA 4Z0JA 5K9DA 2ZWYA 1KTNA 1O7DC 2BXVA 2FDSA 4UTLA 4O52A 2F1AA 3FYOA 1I4NA 4YL2A 3VSUA 3PB2A 5KZDA 4UMAA 1BEUA 3N9SA 2FB2A 4Z08A 3NQAA 5EMYA 3L0KA 4XQ6A 4NNBA 2OYMA 4ZL1A 2BHYA 4FIRA 4BA0A 2H3BA 3GR8A 1GYNA 2OMAA 3EX1A 3DFQA 3EJUA 2AQWA 5KZEA 1BG9A 2BZNA 4QM1A 3W2NA 3W85A 1QWUA 3LCWA 2ZX5A 2GQ8A 1R2TA 4Y6GA 2ZX9A 2ZZ1A 1DBTA 5CZTA 3DHUA 2ABBA 3DFNA 4LWWA 3JR2A 2B7NA 2G3NA 2X2IA 2QCMA 5TBOA 5I3FA 4LS1A 3P7YA 1FQ0A 3P84A 2ZRUA 3SECA 2ZE0A 4JL1A 1J4EA 3DX4A 3LHYA 4DO5A 4J7RA 3UZ5A 1TQWA 3GB6A 3DKLA 5HXMA 1S5WA 4WD0A 3L2IA 1O60A 4PFMA 1W54A 4WOZA 3MBFA 3BG5A 3DX3A 2GJPA 1JCLA 1HL8A 1MW2A 2X2HA 4IQLA 3TE9A 4OBTA 2BXZA 3W7JA 2DZPA 3LHTA 3LI1A 3SZ8A 3WEMA 1W56A 4J3SA 2WQPA 4JXCA 4L4LA 3L5LA 1CGVA 1N55A 2NUYA 1IXQA 1HX0A 3S1UA 1QX1A 3LCGA 2XWEA 1RP8A 1VB9A 3M5YA 4XBSA 1KGXA 1ZNNA 4HSOA 1NEYA 4D2JA 3BG9A 1UKTA 3BLPX 1MZHA 2E4TA 3LXBA 3W7CA 1IV8A 1N7KA 1QR7A 2QUUA 2PURA 3SIZA 3EJTA 4XKYB 5DLCA 2RFGA 1QO5A 2JGYA 4Q32A 4A29A 1Z41A 5A2AA 1GJUA 1XSIA 5C2XA 5DELA 1UD6A 3ZSSA 1GG1A 2DORA 4QSHA 1OABA 3SI9A 1LLZA 1OFAA 1FWNA 1EO5A 4GQRA 4AWTA 4ZVJA 4BFAA 6ALDA 1VCGA 5G4EA 5CGTA 3CB8A 2NXGA 3W7OA 3LM7A 1JVNA 2TYSA 4TMBA 3E96A 1S46A 1YDNA 1CGUA 5DCDA 3NM3A 5BMXA 1ZCOA 3PWAA 4O16A 2CFFA 2DZUA 3PVFA 2F7RA 3A22A 4XWUA 4OV4A 3TJLA 3MYPA 2B4GA 4JDBA 3CM4A 3GKAA 2A2IA 1PCKA 4K7VA 3NVTA 3MO7A 3D4YA 2VR5A 1YLVA 2D73A 2F7OA 2ABAA 3W2MA 3LHUA 3C8FA 3FW6A 1QOPA 2WVVA 5KEZA 1QPRA 1YDOA 5CXPA 2C19A 2NT0A 4TX9A 2HS8A 4DBDA 4UZSA 1HNYA 4Z0SA 3ZR4A 3CIWA 1UB3A 3G1VA 2V81A 3QMRA 3PAJA 4LW7A 3QYQA 3ZFHA 4XBKA 3BUPA 1VYSX 1TCDA 2PWHA 3LGEA 2ZXAA 4WY0A 1MXSA 2CLEA 4M6QA 3WNNA 2HSAA 1W3NA 4J3WA 1QI5A 3FYPA 3S1VA 3UXDA 2R8WA 4HKPA 1AVAA 1K8YA 5E0FA 3LCIA 4UR7A 4ML9A 2QLYA 4FLQA 5E93A 2J24A 4RZ6A 1WBHA 3C3NA 4Z1DA 5HNRA 1L6WA 4HA1A 3BW3A 5H91A 5F2MA 3G1FA 3LPPA 3BGJA 4MYXA 3NNTA 4FLSA 4BWLC 3P80A 3D4ZA 4WXZA 5K3VA 2QPSA 1K03A 1XBZA 3D52A 1MSSA 1TPWA 2C3ZA 6TIMA 3RLVA 3C4UA 3RK8A 3MI3A 5TIMA 1OGSA 4K6AA 2QJGA 1XUZA 4JFTA 1QPKA 1B4EA 1T96A 2ATSA 2DP3A 4ORIA 1PEZA 1M7PA 3SSJA 1U33A 3EXRA 5HDRA 1O5XA 1ZHAA 3TONA 2Y61A 3PBUA 2ZCGA 2CZ5A 4M7SA 3QF0A 1TRDA 4FNSA 3G18A 3TKFA 1QFEA 1UOKA 1CXEA 3USBA 4JTHA 1OF8A 1TPUA 3ABSA 4O4WA 3W83A 3P74A 2CZDA 1HUVA 1P0NA 4BZYA 2V5LA 1P0KA 3CWNA 3ZSTA 1GVRA 4UC5A 3TXZA 4KFPA 1PVNA 3BSHA 2X30A 4TR9A 3T7VA 2EEXA 5A8GA 1CXKA 2FPYA 3LX9A 1XXXA 3Q94A 5EY5A 3NL6A 1OT2A 2FHBA 1WZLA 4UCGA 4GI8A 5CPLA 4WXYA 1LRQA 3SGUA 4GIAA 1BAGA 2CLFA 4FNQA 3TAOA 3VX1A 4A3UA 3UY8A 4IWWA 1BF2A 1OYAA 1PIIA 2E6AA 1VQTA 1UH3A 2YDAA 1CPUA 3L66A 1RP9A 2E68A 5K4XA 4LVFA 4LT9A 1Q6RA 5HUOA 4POCA 3HG3A 2FB3A 3GDRA 3UYCA 1OVDA 2YKKA 4JCMA 1K02A 4IMCA 1SO6A 5U7SA 1JD9A 4GUFA 3MP3A 4GQQA 5I23A 1AL7A 3QC3A 1TPB1 5FF7A 4NJIA 1IXPA 3NG3A 4FO4A 4TIMA 4M6VA 3UCQA 4JEQA 3G0SA 3O06A 4UOQA 1F7BA 1LORA 4M56A 1V3JA 4CKQA 2YSWA 2FJKA 2ATMA 3NYZA 4MKNA 2W6RA 1KA9F 4JTGA 5A6LA 3NQ2A 3QH2A 3BVVA 1GOXA 4AWUA 1OK6A 3VM5A 3VO0A 4C1LA 1LWJA 1JL8A 2UV8G 5HQEA 4O4VA 4FX7A 4R53A 1WYIA 1OYBA 2RDTA 2I14A 1OG0A 3HPXA 3HZ3A 2YCEA 1UBSA 2WJZA 4AMWA 3O6CA 3QPZA 1PHQA 2B7OA 4RJEA 2XVLA 1V3KA 1TTJA 3VKJA 5AC7A 4MUZA 5CKSA 4EOUA 2RDWA 1OFBA 1MW3A 2C1HA 2GUUA 2OW7A 2J9ZA 2YFNA 5CLTA 3LCXA 1JCYA 1NOFA 2Y88A 1GVQA 1A50A 4LC6A 3KEHA 1V3MA 1OHLA 4YMZA 3CZGA 3S2CA 2XN0A 4PL2A 2C8NA 3BLBA 1KM2A 2QDGA 3KVJA 3IVTA 1R33A 1J0HA 3Q37A 1Q4NX 4LC8A 2WO5A 3LV6A 1LBLA 1G7UA 1N8FA 3GKFA 3W1XA 1TRIA 3PBYA 4GUGA 3C2EA 1B4KA 2WVTA 2DZVA 3HGOA 4GI9A 4DQWA 3CQ0A 1SZGA 3L67A 2W0UA 3UERA 1GCYA 2EF9A 3EWBX 3STFA 3EX3A 2DH3A 2DZSA 4FNUA 1NAL1 2DZXA 1OFOA 2GQAA 5FEWA 2ZZ6A 4FF7A 3NOEA 3WY2A 3NQ8A 1GZGA 2PCQA 3GXMA 3Q58A 2V8ZA 1R34A 4K36A 4H7VA 2NZLA 1LOQA 4JFVA 2JKEA 3ABRA 1WV2A 2WCGA 4IUOA 1E3XA 4Y8FA 2QUVA 1AQHA 3L65A 2F84A 1CXFA 1MFUA 2FFCA 2CLLA 2XN2A 2V3DA 4JTKA 1UD8A 2V2CA 3AMKA 2X16A 3CLWA 4CNNA 2PWDA 2Z1BA 1TQJA 3FEMA 3LHWA 4KFNA 1R46A 2QCDA 1UUOA 5IBXA 4HNTA 3W88A 4OJYA 3NR0A 5CSSA 3ZT6A 3UXAA 4CQ8A 1O95A 4JDYA 1UA7A 2VFEA 2FLIA 1OX6A 4XKYA 3S5OA 3STGA 3PSWA 3HJZA 3NQMA 2C14A 1ME7A 1TO3A 3IJ9A 1SPQA 1XCFA 3L4XA 3WFZA 2R94A 3O6DA 1WXJA 1HG3A 1HXKA 3L4TA 1KTCA 1OX5A 1A5BA 2NLIA 3NZRA 3DU0A 4GC4A 4M8UA 4GNJA 3GZ3A 3Q2DA 1R30A 4ZQNA 4UFKA 4GWEA 5KITA 1YXCA 4JS3A 1ODUA 4MVAA 3LBMA 3EDDA 1OFRA 1YTKA 2B7PA 2VRKA 4I7WA 4NJKA 3LRKA 1VYPX 3G1YA 3L4VA 3P5YA 2EADA 1SO5A 3IK2A 1XD1A 3BAJA 4PCSA 1DJNA 3A21A 3VMPA 1W31A 2ZUVA 1TSIA 3NL5A 4WUIA 2PE4A 3U8GA 3GXDA 3B05A 3W7GA 1NF7A 4RX0A 3L68A 5LNWA 2WVUA 2E0PA 1ZFJA 3TFCA 4JTUA 3LTPA 2GVYA 1B57A 1KWKA 3CZEA 2YOCA 2NX9A 2WKLA 4HNNA 1G7VA 1NF0A 2CU0A 3KVLA 4Q4KA 1UH4A 3HOJA 1G4EA 1THFD 3P67A 1OT1A 2GVLA 1EIXA 3BW2A 4AW7A 4A2SA 3BMVA 1FDZA 3IIXA 4DPQA 3BK0A 5D2TA 1G9HA 3EJPA 5LHFA 4I9AA 4GJ1A 1KM0A 4PC8A 2TSYA 3TW6A 3C2RA 3G3DA 5AB3A 1HL9A 5C5YA 5LNSA 3S5YA 3CEPA 1KLZA 3WJWA 2RH9A 4Y9AA 3B03A 4UNKA 4N4QA 1E43A 3DC0A 2O7QA 1QCWA 2TAAA 1VZWA 2QEZA 1E51A 4JFSA 1SW0A 4U28A 1SSGA 5BW6A 2GUYA 3BVXA 7TAAA 4HSNA 2VOMA 4O19A 2GPTA 3N9RA 2OX1A 4NJHA 1NFBA 2OSWA 4J27A 3ZOAA 1OFDA 3EX2A 1U5JA 5D03A 5EA9A 3VGHA 5I3HA 3OVRA 1AL8A 5DFAA 3PB0A 1MXGA 1M6JA 5KSWA 3ATYA 3MHGA 1HO1A 1X6UA 1QWNA 4UTJA 3UEQA 3DGRA 1D9EA 1A5SA 3GXPA 4UQDA 5L6UA 2Z6IA 4RXFA 1RQEA 3GNDA 4IMFA 1UD4A 1M7XA 1C29A 1G69A 1M5WA 1XBYA 3MHFA 1IIGA 3G0XA 1TTPA 3UG4A 1W0MA 2CZFA 3KL5A 2GQ9A 1XSKA 1GEQA 3QGVA 2F7PA 2X2JA 4GO9A 2PWGA 3CZSA 4RK8A 1DQWA 3DFOA 3A5FA 4HP5A 4LS2A 1SZNA 4WLCA 4J9JA 4P61A 1SMDA 1BWLA 5KZMA 4Q33A 5DBTA 3P60A 2QAFA 3BLFA 2YX0A 5F2GA 3TSMA 3K8MA 2ZZ2A 2CPUA 2F61A 3OLIA 1RQBA 2H8XA 1F74A 3L0GA 1Z32X 4FX6M 3W9ZA 3I6RA 2EO7A 3QEZA 2PWFA 4RZ5A 2V30A 5BNKA 2G5WA 3QJAA 3M5XA 3FLUA 3CTTA 4UQEA 3HGRA 2J25A 2DH2A 2CXGA 5EL1A 1K7EA 5MHBA 3D0CA 5E70A 1AW2A 1DHPA 4HT3A 5DXYA 3ZT5A 4DF1A 4O53A 3QQ1A 4YCPA 2P10A 5AHIA 3WY3A 4S1FA 1X1OA 1JQVA 1S5VA 2VNCA 3AO0A 3CV5A 4KKXA 2BX7A 3WDIA 1XCWA 4X22A 3WY1A 3B4UA 4JX6A 2ZUSA 1J0JA 3GDKA 3ZQ9A 7CGTA 1JF5A 3PUEA 1BLIA 4UFLA 2DU2A 4UTIA 2V3FA 1ALDA 3NPUA 5FEXA 5BRQA 2WNWA 4ATWA 1H61A 3M6YA 5LHEA 2NV2A 4UFJA 3C2FA 3R89A 4KMQA 3IIPA 9CGTA 3GXTA 3NA8A 4OHQA 4QISA 1CW2A 2F7FA 3TNOA 5SWUA 2YR1A 3DZ1A 3LXCA 3W1UA 3EXSA 4JX5A 1MO0A 1I75A 3N34A 3MW7A 3L21A 4YWIA 2ZRWA 3OEXA 1QNVA 4UTTA 3GXFA 1XH1A 3MI2A 1CGYA 3W1MA 1TB3A 1QMLA 1R75A 3IRDA 5CSRA 5BRBA 2FHCA 3HGJA 2KZHA 2A0NA 2X1UA 4GUJA 1W5QA 2QCFA 3CC1A 3VCRA 3VM7A 1QO2A 1A5AA 1UUMA 4JIPA 3EWUA 4XUGA 1ZAIA 3O05A 2CHNA 1VC4A 2NWSA 5FF2A 1V3LA 2AMGA 4HN4A 4HPHA 4IGHA 2VEKA 4PH6A 4MJMA 4JR5A 4NNAA 1GTHA 1KFKA 2I1OA 2DJLA 3KFTA 4JCLA 1KFEA 1QI3A 1V5XA 4N4PA 3KOFA 1YTEA 2WVSA 2ZDRA 3G3MA 2G97A 1FWSA 1XBVA 4IX0A 2GVGA 4FNRA 4DELA 1G94A 2WKGA 1UKQA 1P5BA 1CX9A 2QCDB 2V3EA 4DF2A 3UQNA 4UUIA 5CGQA 2X2GA 1LWHA 1QAPA 2J9XA 3O8AA 4NNCA 5AYYA 4JYDA 4M6PA 3PG8A 3NQFA 2J88A 3KLKA 4AF0B 3UG3A 1HTIA 3W7IA 2QUTA 2P1FA 2ZRZA 2VEIA 3QPYA 1DJQA 2Y5EA 3VSTA 3FA5A 2XN1A 4UTHA 3NQVA 4NZJA 1OFEA 4OU1A 3W74A 2VKZG 2E6YA 2VFHA 8CGTA 3W1NA 4NU7A 3ZO9A 2ZBTA 4IPJA 4CQ9A 1XKYA 1PAMA 3WENA 3EXTA 1A47A 3TV8A 1EUAA 1ZAHA 3EDKA 2BHZA 4NVTA 3M9YA 4UIOA 3YPIA 1JG9A 1VHCA 4MFDA 4K37A 3HMJG 2ZTJA 5F4XA 1GWJA 1RPKA 2WSKA 2FPTA 4O0KA 1XBXA 2EAEA 1KCKA 3IIOA 3HG5A 1SO4A 2ZA2A 4GO8A 1WBJA 2WANA 3W1PA 5IBXC 1H62A 1U30A 5LGXA 1TMHA 2C0AA 3EKLA 1EA9C 3DDGA 3DKJA 3KLLA 3W7LA 2ZUTA 4AEOA 1JF6A 4Z1CA 2V82A 1OFPA 3TTSA 4AYSA 2PC4A 1DOSA 1TQUA 4K8EA 5DCEA 3W3OA 2Y6ZA 3ZS4A 1JUKA 5HUPA 5K2ZA 5FF4A 1L9WA 4CLMA 4N9BA 1DHKA 3O1NA 2Y89A 1YYAA 3GXNA 2FH6A 1W5NA 3TR2A 2VEPA 1H7RA 1VFUA 1T8XA 2O7SA 3VI2A 1GVSA 2Q3RA 3KWXA 2H8ZA 3L4ZA 2RHGA 3FKRA 3GDMA 4O28A 3WK0A 3TIMA 3W72A 1W3IA 1FXPA 5E6ZA 5KMYA 3UWUA 1FY6A 1SUXA 3VNZA 1JRBA 1PCWA 3LCFA 1OF6A 3HJEA 1FWRA 5D37A 3WNKA 2EKCA 3M5VA 4ICNA 3RLUA 3QW4B 2ISWA 4O15A 1T0OA 4GRSA 4CN4A 4HOZA 5K9XA 5D32A 3SW6A 1V7YA 2A6LA 3OLDA 4J3UA 1S5TA 1JJKA 1UASA 1TV5A 3PUOA 4TVUA 1WQ5A 3UWVA 4O1CA 3I7QA 2VC6A 2FQIA 3P8IA 3KRUA 4AIEA 3WN6A 1SFJA 4H6KA 3G1XA 4CNOA 2FPVA 3EDEA 2YPIA 1Z48A 4QNWA 2ZRVA 3FJ6A 1HT6A 2E5DA 3CZLA 1BTMA 2Z1KA 4N9DA 1KWGA 1CI1A
chains in the Genus database with same CATH superfamily
2BBFA 4F66A 1ROWA 4YIQB 4C6LA 1WVZA 4HU0A 1C7TA 3W7EA 1EAQA 3CVIL 1TO4A 2EJAA 4CSZA 1QNOA 1I53A 2E9WA 3P2DA 4L5FE 1MCRA 2IH9A 3L95A 5FD0A 5K9OA 1XIGA 2RFXA 4KTEL 5DMMA 2NQLA 3VOFA 5SX4I 4MWFA 3PAYA 4I18C 3A23A 1MRDH 3DX2A 3TX9A 1P6FA 5IJKC 5EULV 3HB9A 3G5WA 3OMZA 1FA4A 1T4WA 3WEXA 2XV3A 5DA4A 3AACA 1KGWA 4PUUA 4H8QA 4G7SB 5FCSH 3FSTA 2H7WA 5IOPB 4PRPD 4AB4A 3NGBC 3IPWA 1BWKA 3HI6L 1Q90A 4RZKA 1U8NA 5FLUA 2E8YA 5LIXX 5I3KA 3S97C 5DLMH 2X2UA 3CSFA 2CLIA 1E9IA 2GGJA 4D6HA 4NQVA 2ZOOA 3CD4A 4CADB 1DVZA 3HF3A 3GZKA 3CZUB 3INUL 1NBYB 2PDUA 3ECQA 1EUTA 4P06A 1BZOA 2GSMB 4BHYA 3W86A 5I7GA 2NV1A 3T8LA 1KTDA 3RCNA 2WIIA 1FVPA 1Y1DA 3WIFA 2VI0A 3HAEB 1KBJA 4RV3A 5CZVL 5ICXB 3MT1A 1VADA 4WNQA 1FC1A 3PYCA 2GYSA 3UJEA 4AD4A 4DVRH 1RPXA 4NQCB 1I8UA 2JF6A 2A1YA 1NGPL 2O5ZL 4ONFH 3QIWC 3GG1A 1UR3M 1UZDA 2G95A 9XIAA 5DD5H 3N25A 5E4EB 1TZHA 1BG4A 3S37L 2H4EA 2DD8L 2YPVL 3K4DA 5MEOA 2O5NA 1WS7A 3VFMB 2VL5B 4PRBA 4AXKA 3QLLA 3GMRB 1WDPA 1IM9D 1EHKB 5HAOA 2NUTA 4HKBB 5JMRA 5T5NG 3PL6D 1JZ5A 1S2VA 4W88A 5I1HL 1TT6A 4JE0A 2WLKA 1EDQA 1CFNB 4N9GB 2ENYA 3MRMB 2XWRA 5C55A 3MNVA 1F1GA 2KAUC 4TUJB 4Y2WA 1K3IA 5BRPA 4FEMA 3S35L 4HJ0C 3EFFB 1I8LA 4LV4A 2R15A 4WEMB 2XJKA 1QPXA 1Q6OA 3CIVA 4FQQB 5D09A 5H94B 4FI8A 1O94A 1OK8A 5C8BB 4KX7A 2WZ5A 2YPLB 1SYVB 3OZ9L 3MBDA 1AHWA 1CFTA 4QY8A 3QV9A 3W7DA 4A8LA 1W1ZA 1JNHA 4O18A 3TVMC 1XAKA 5E8OB 1NCHA 1UKOA 1GYLA 4OCWH 3C2OA 2P5WD 4O51B 2ZX6A 2SEBA 4BHUI 4FXGC 2HFGL 1E9LA 1XL4A 4NIKB 3H2CA 1VLXA 2BFVL 5J8OA 5DZ9A 5LBSH 5JPMA 5HGGS 4LKCB 3NPSB 5TDOB 2ZG2A 3AHZA 1UM4L 1ZT4A 1GYUA 3L3KA 3N19B 1XRSA 2PZNA 3UXIA 3WKML 3QG6A 1ORQB 3A47A 5KAQF 5JW3H 4AOFA 3MRIB 4Z5RA 2BS8A 2CMRH 2EP6A 3PZOA 2E6JA 5F7BA 3ZYIA 1MWOA 1DSFH 4RUBA 3QIBD 5TE7L 4RKAA 1OG6A 3L17A 3AXHA 5HA7A 3ILPB 5AKRA 4X6FA 1CYGA 1MEXL 2WLYA 1PEWA 3KPRA 5KVFH 5ANMA 5AD0A 2DV0A 1GVIA 1FCQA 1D5XB 2BOBA 4F7MA 1SW7A 2NXYD 4S38A 4JD4A 2FQDA 4NQXB 4XB3A 5C71A 3AWNA 2VQTA 5EC1B 3H56A 1KV8A 3NZHH 5CCJA 2POTA 5EV7A 4I3SH 2JFCA 3I9GL 1UP2A 4KKBC 3G5EA 3GI8H 4RWYH 2ZYFA 4FQXD 2A5HA 3KR3H 1O7DE 3FDKA 2XFFA 3ILEA 3OKLA 2GSJA 1JR1A 4O57A 5D1XA 1CF8H 4HC1A 4BI5A 1JPKA 4K8GA 3CH8A 3RVWC 1PKYA 2XISA 3OTRA 2OW6A 1L2QA 5KZ6A 3V5HB 2EE9A 3T0CA 4QXVA 1DDHA 5CJQH 2VKWA 3DYOA 4RVBA 3QQDB 3N1PC 3HR5B 4QYAA 3TCEA 1SM3H 2V9DA 2J8UB 3GGWA 5CR8A 5F3BA 1VPOH 4UDUB 3UJSA 5DR5H 1KELH 2FDMA 3IJEB 2QKIB 2BSLA 3N2TA 1E4JA 4XAFA 3DPBB 5C0EA 2QEJA 4XBEH 1TZ7A 1JK9B 2W79A 1ZTXE 3UZVB 3BX7C 3CZFB 5HINA 3S5ZA 2HE5A 3QXTA 4PB3A 3T6VA 2ADJA 3I3EA 4WAFA 1G9NH 5DJAB 4XBPB 4U4BA 3N2BA 4A21A 4Q8MA 4NZUH 3FCSA 3U7VA 4HLZG 1HFUA 2E7MA 1WWBX 1H1ZA 3EF7A 4K94C 3B0VC 4WJXA 3H9SE 2C1IA 3L3JB 3LN4B 3CFDA 1Y5WA 4RFNC 3DO7A 2QF7A 4KHXH 5GRUL 4QS5A 1E6JL 4WEUD 2EXYC 3VJ6A 4Z95H 2DFAA 1TX0A 3RO8A 3BPCB 4ACYA 3OMAB 3X12A 3DUGA 4FNPA 4G8EB 3KYKL 1HKKA 4DEFA 4QJ3B 1OZMA 2XKNB 4REQA 3H7UA 4HNUA 1KJMA 4LBAA 3MRRB 1OCBA 1U1JA 1B2YA 1GGTA 4YEEA 2WBGA 1W6LA 2IXVA 1UOVA 5EA0L 4AVHA 2V2TA 2F2HA 2BP3A 1GGIH 1RZ7L 5F0PB 2IWKA 2CBUA 1Q38A 3W5MA 1TA3B 1RULH 3QG7H 3IJYB 1XX9C 4S3EA 3DFHA 2EDWA 1QZ1A 5DFVC 4FFVC 4RZCB 3WO3B 3FQTB 2H90A 1A5OC 2VDKH 4B6ZA 1CURA 1RQHA 2OL3L 2PP8A 4PFEA 1W5MA 3DOPA 4F40A 4L3CB 3JV4B 4ZOBA 4ZW6A 4EUPB 4JPWL 1YMMA 1DJHA 2NNCA 2H8PB 4H25A 2JELH 4U3CA 4NRXA 1HIMH 2WXKA 1D9KA 1GZPB 2PO6D 3HO8A 3ATBA 4ZCWA 3OR7A 3VH8G 1EP1A 4S1DD 4G42B 5CUSH 2GIMA 3GIYA 3D39E 3NP3A 4JN2B 3VW3L 3QI9A 3M1ZA 1NAMB 4HEPA 2C7UA 1YPZB 5M94B 4TUOA 2DQMA 4P04A 4LGXA 1ADWA 1IBBA 3VMNA 1JNDA 1A6TA 2L04A 5GHWL 4F7CA 3BPWA 2DIJA 5DEZA 2W9DL 1KXQA 4WO4C 3EH3B 4NM4L 3B5HA 3GRWL 3A4FA 5K39A 2WLJA 3QZPA 1L9PA 2ZSVB 4K7PL 2VSKB 5JHDA 3RL2B 1BYBA 2ARJQ 1VR6A 4JG9A 3SBPA 3HIJA 4G8IB 4N0RA 3QQ3B 3EBGA 5IQ9A 3KRSA 5J89A 1F07A 2QQLH 5CS7A 5HDLA 3D7PA 4LSPL 2W62A 1RHFA 3V4PH 3MLYH 3W9EA 1SFHA 4O54A 2WOQA 3GNRA 4N20A 3V0UA 8FABA 2WLNA 4WQOA 3QDME 4PREA 1ZA6B 2OU4A 3QUXB 3FBKA 4I77H 3T6WA 4EI5A 3L1FA 5T1MB 1EEUA 2V2WA 5KW9L 1CBGA 3B40A 2B5IC 4MA3B 4YHLL 1CTNA 4HCIA 2DW6A 3B8IA 3MLXL 3QO1B 4XC3L 2KH2B 2WAGA 5JXEC 4M4RA 4DNMA 5I17A 4NKDA 4M1GH 1MFVA 3NIGF 4AZ6A 3ONCA 2NW0A 1UB5A 1EJ6A 2NY6D 4N2FA 5L88L 2UY6A 2JEPA 1PE1A 1V6YA 3EKZA 1FWTA 3QUZA 4MPKA 3D05A 4RR4A 4F7TB 3UTQA 2CKBH 3WY4A 4GRLA 3AFLA 3EYSH 3FA4A 4H26A 3SO7A 1UVQA 1CL7I 5INDA 3APGA 1S9YB 4OIFA 5C08D 5FECA 5DX7A 4PPTA 2IXUA 5I1IL 1S5HB 2NPLX 3OHIA 2TSAA 3MHZA 1W9BM 1F4XL 2ALDA 5CZXD 1A02N 2FVKA 2WXLA 4C59B 3UF9A 2QGHA 2I5YL 1UMLA 2XVPA 4AQOA 4C6EA 4JO1H 2E7CA 3EJQA 5HR7A 3U4AA 1TVNA 1JCVA 4Q6JA 3GVVA 1F3XA 1KTNA 4UTLA 4XPFH 3FYOA 1I4NA 4JFZL 1AE6H 5ISZA 4JPVH 2F38A 1BG9A 5EBAA 2JLPA 3SE3A 2F53A 3OGVA 3PP7A 4W4NA 3DHUA 4YGVB 1RUAH 4LWWA 4AVKA 2D7MA 4DYEA 4U6VL 1SFTA 4JL1A 1QOKA 4G72B 1U8JA 3KYAA 5DHVH 1T89C 5GRJH 1MW2A 1NARA 2J3SA 3W02A 3DX9A 1Z6JT 1FV1B 2V5CA 4XE5B 1QX1A 3LYEA 5C6TH 5HI3C 4HSOA 5FAJA 4YDLB 4GHRA 1XF0A 1KGYE 3T8XB 4JHBA 3ZSSA 4ZFOL 2HX7A 4JCWA 4P49A 4BD4A 1U93A 4ZSOE 1DQIA 3SDCA 3ZVVA 1VEMA 4PWKA 3MLPA 4Y1SA 1KJ3L 3UPAA 3RFZB 4K3JH 1F6FB 5F7NC 1EXUA 3SYAA 3NM3A 4GY0A 2VEGA 4LCCC 3DUSA 3F62A 3GNOA 1F00I 1S5IH 1OAYL 3GKAA 4L5ZA 5EFIA 5FFGA 3P93A 2HG5A 4OLZH 1QOPA 4KHTL 1U8QA 4OGXH 1RERA 3NIDE 2CIIA 2FZ3A 1GIGL 4XPBL 4JFPB 2G3IA 3MRHB 2HSAA 4S1RL 5I0WA 3EA2A 3S1VA 1QFUL 2DSUA 5E93A 2YZ8A 5HVHC 4LEQA 2X4NB 4APXB 3L3GA 4WUKL 4R4NC 3UJTL 1K03A 4LLUB 2X1PA 3TJIA 2JALA 5GSRA 3FTSA 4EI0A 3SPHA 4EWJA 1J1XL 5FJRA 5ITBL 2ROXA 3GDBA 1OAZH 1JGDB 5DVOA 1DIEA 2FJHA 2H26B 5CINL 4XBMA 3MRJB 4PMRA 3RX8A 3NIGE 3WF1A 4P8UA 5CPLA 4IEFA 3ULUH 3TAOA 3ARBD 1FHVA 3GVRA 1E65A 5M2FX 4C56D 5AYTA 3W39B 2DGAA 3C60D 2ZC8A 2NR6D 2VGIA 5CSBA 4LHUA 4PQXA 1LL4A 3QC3A 5EBGA 4JTDA 2Z4QA 1KQZA 4AT6A 1EX1A 3WTSA 2GJ6A 4JTGA 3BVVA 5DANA 4GY1A 3ZMRA 4PY8J 3TBSA 5FK9A 4Y4KC 4J8RA 4JKNA 3F12A 2B4CL 4G9DA 1FNEA 2R9HC 2TSBA 2DWYA 4OUOA 4MRCA 4I0PD 1Q0XL 2AK4B 1JZ7A 1QK0A 2PF8A 4QCFA 3CZGA 3V9FA 4B5ZA 2HFFB 2Z31D 3ZY7A 3G6JF 1J0HA 5JQ6H 5L0QB 3TT1H 4R2GC 3VXRD 4GUGA 5IKCA 2PCXA 2WVTA 4GI9A 2Q8BH 4GLEA 3TYUA 1GCYA 2PF6A 1ETZA 5GS0C 1DVFC 3ZKXB 5E5RB 2YGNA 3N04A 1BFVL 4NOBA 4QOKD 1YEJL 3AIQA 3QIWB 1GPOH 4Y8FA 4Q9RL 5LN4A 1MCCA 1XCTA 2GFBB 3ECBB 3WXWL 1L9MA 3MCOA 5CSSA 1ZVHA 3C8KB 4RL3A 3AROA 4KJQC 4DX3A 4MADA 4Q6IA 1XCFA 3BUYB 1A5NC 3FQRB 3Q2WA 3IYLW 1GKOA 3O6LH 4AIXA 2NX5A 4LOEA 4JHOA 5EOCJ 2GYIA 1NKRA 1M01A 1OFRA 3LRKA 3P5YA 5DUPH 5GJMA 4X4ME 5A2FA 4OLWL 1JGUL 3F7JA 2E9JA 4PCSA 4R4FL 1DJNA 1A7NH 1NF7A 3GKZA 2BERA 5C7HA 2I9TA 3Q1SL 4XXCA 1UQYA 1ZP3A 4Z23A 5F9WB 1P0BA 1BZEA 3EJPA 4JK0D 1KM0A 1C5DB 2F54D 1HL9A 1RUKH 2EDKA 3HRZA 1AKJB 5E5MA 2VRAA 1E5JA 5GGTH 1E43A 4YXLH 4D72A 2QEZA 4M3PA 1QEWA 4DFIA 1IAOB 1UJTA 5CJOH 4YLCA 4L4TB 3OVRA 4PG9B 4HZAA 4XPGL 3QDJA 1W8EA 4FXGB 4XZUB 3VVGA 1JGLL 5AG9A 4AY0A 3F3HA 5EF0A 4FC3E 1S7SB 2VR2A 1XBYA 2CBOA 1TJXA 3UG8A 1HDMA 5DTFB 1QK2A 4FN0A 2CZFA 4PJDB 3JVAA 4YHMH 2HXTA 3TYBA 4PJXF 1I6NA 4WLCA 4J9JA 4GSDH 5DURD 2OMZB 4M62L 4X6DF 3UW6A 5T1KB 3L0GA 3RPTA 2D03H 4W81A 4OZHB 3W9ZA 3KHDA 2VIRB 4HWEL 2HUHA 3QJAA 1RJYA 3NZSA 5D1ZB 5MHBA 3TBCA 1VENA 1LNUA 4QJ4B 1S7UA 3MBWB 3BN9D 3ES6B 3QRLA 4HHAB 4GKOA 2VR6A 3BP7A 3CV5A 4JM2D 1ZA3A 5ADOH 5F7LB 4GAYA 1Q66A 1Q6GA 4UTIA 3W26A 1H61A 3NCJH 3M6YA 3LQMA 3WZ0E 4NKIL 3C2FA 2FJUB 5ECJE 2FEEI 3CZ8A 2H9AB 4NKOB 4ROPA 1FLTX 4RW3A 3B1UA 1KZYA 4UTTA 4E9SA 4PRID 4XAKE 3NEEA 1OE3A 1QMLA 1R75A 2FHCA 1VF8A 1SJEB 2KZHA 4GOSA 3EBVA 4GUJA 1BZ9B 3CC1A 4WI5A 1CLXA 4E9RA 2ADAA 1HILA 4RESB 5D4YA 3AISA 5LBSA 1IKFL 4JR5A 1LP9A 5IB3A 1NC4B 1L7IL 3MV11 4FOMA 3V7AE 1EC9A 3G6JE 3PPSA 2I24N 2F9BT 5ABAA 4BKTC 5CGQA 4HJEA 7PAZA 1J01A 3BGMA 3NH7L 4KAQL 2XUWA 4HULB 2ZOWA 3S36X 1VFFA 4OU1A 1J93A 2V5KA 1F18A 5CCGE 5KYUA 3ALGA 1ISVA 5CLZA 3BIKB 3GS6A 2DI9A 4L6OA 5DF0A 3CV1A 1CWYA 2BHZA 2ADGB 3M9YA 3AQYA 4MJIA 1B3VA 5JYLA 2B16A 1NEUA 1JGMA 2PW2A 5GQBA 4PP2A 3W0WD 1EA9C 1HKVA 3QQ9C 4JQXA 3ZIYA 5DCEA 5EZOL 1F6AA 3OXRA 4XPTL 2JIXD 4RFNB 4Z0XA 4N9BA 1N9PA 3KYNA 2BNQA 3EXLA 3L6FB 1NGXA 1MDLA 7REQB 1GS6X 4NZTH 3QORD 3QUYB 5EUKA 3U6RA 1SEBA 3QJSB 3I6GA 5BO0D 1N3NB 1YYLH 4N2AA 4WHYH 1ZLSL 1YO4A 2R4RL 3KRUA 4Z2HA 4N85A 4YVNA 2H2SC 4GAJL 3I2CH 3ZPDA 1L0YA 3R94A 1UKSA 3GUGA 1NIAA 1PZ3A 5E0QA 1T7ZA 3C5ZC 4AH7A 3OO2A 2FBJH 3RNQA 3VUSA 1Q9OA 1TZ8A 2DI8A 3WF4A 1QO3A 2AGJL 4NUGH 4JHUA 4L3ED 5ADPL 3MMEA 4P2YA 4PJXE 4H2HA 2UZIL 3B5TA 4M7JH 4X6DE 3GAYA 4TQTA 1FG9C 2UXTA 4BFBD 2OXGA 1NAKL 1J05A 3MJMA 4F7PA 2RQEA 1JRCA 2PCYA 3VDCA 2K8MA 3TV3H 2W65B 1HKMA 3GG7A 5F71A 1FAIL 1IGTB 4UCFA 3KLAA 1KFGA 2OQYA 4QHUA 3DBSA 1UG9A 1EO8H 4X61A 2IQ9L 1TPVA 1HKWA 3BOVA 3ZE1B 1XLMA 2F58H 2CUHA 1CBVH 5JR1L 5E56A 4WO4B 4GI4A 3OAYK 4AAJA 1N8IA 1OIMA 2UXVA 3M1BA 3GI9L 5L6YL 2NXZD 4R33A 3BZ5A 1IWPA 4AYEC 4JYFA 4WJEA 2C9AA 5J3HD 4M3HA 5KJ7E 4XVOA 3AS3A 4K5LA 3PIQB 3S3PA 1F3TA 1EAOA 1Q6QA 1NOLA 3O11A 2FJGA 4D6CA 2OCZA 4MQXC 1USQA 3BT2L 4Y90A 4X5RA 3PHSA 3O2WH 3CFKA 5BXRA 2VDPB 2HN7B 3OPSA 1EFQA 4CQAA 4HNOA 3F2DA 3AIWA 3OLEA 3PAOA 4C6DA 4N8VB 3UWEA 5FO7B 3BWAB 1VESA 3MU7A 2D0FA 2B5IB 3ARFD 4KXCA 1EHXA 1T5WB 3UTPE 5K9QI 1A2YB 3VRLE 2WMIB 4HX1A 5B39A 4WKFA 4WQ6A 4UFIA 1NDTA 4CC4C 1QHZA 2VCCA 3GPSA 1SM9A 2FR4B 3NL3A 2BVOB 3EYUH 2XG4B 5D9NA 5C54A 1B0IA 2Q9OA 4D9QE 3AFBA 3EOAA 3DTUB 5IROA 4PJBB 2AJZB 4XP6L 2NSQA 4EF9A 5I0YA 2VWTA 5D04C 1RK5A 3D4CA 5A6MA 5AFDA 3EWXA 4AIOA 4YLWA 3E7JA 1MCOH 2YFOA 3AQXA 5KN5A 5G5DA 4OZFG 3V4PA 3S83A 4LLDA 4U1HA 4XOBA 1AGFA 1IAMA 1FFQA 3QPEA 2DT0A 1R38A 5SWSE 1DBBL 4L9LA 2VELA 1SMAA 4QIUA 2X2YA 4FFZL 5K9OB 4AD3A 4L4VB 3VD9A 1E8XA 5D71H 3IGSA 4QNEA 4GMEA 1EQWA 2PXYC 1MVYA 4LCIL 4M1CC 4MWFB 3S5SA 3EA1A 2ZZ7A 4MZ8A 2IPUG 3BD5A 4OCNC 4XZNX 4D6JA 5DRIA 3T0WA 1JPMA 3SD5A 1XSJA 1J8KA 4RLIA 3WEXB 4B2DA 1KC7A 1RURH 4EANA 3WD5L 3QW3A 2L7QA 4S0SD 1SVDA 1T8QA 2VDML 5IJBC 5IBLD 3SCMD 1U8NB 2FT7A 2X7VA 2WSYA 3SDAA 4H04A 1A7QL 4X7SH 1LM1A 4FMFA 1JUEA 2CKBA 4NQVB 2BSTB 1ZBCA 1CJYA 2YRPA 3PZVA 2DQEH 2YQBA 1CDIA 4CCZA 1RJPA 4KIRA 3JZYA 4B5TA 4ZXBA 1WUZA 4LL4A 4EVNA 1N64L 6XIMA 4DK3A 3WLIA 3QR2A 3AXIA 4U49A 2DDXA 4PJGB 4LCCB 4LUJA 2ROYA 1WBZA 3PK7A 1ZIBA 3AJ7A 1XO8A 5DMNA 3QB7C 1QAWA 1JZ6A 3WJXA 2YB1A 4FOKA 4WNQB 5G2NA 3UETA 2C4FT 1EPFA 3SGDI 2VLMD 3DMMA 4G6AD 3GHUA 4U2YA 2B20A 2P50A 3WEOA 1WOAA 1P1XA 4YEFA 3V0VB 1DN0B 2NY3C 3WLBA 5LCVL 1HH6B 1TZHB 3CAFA 2I5IA 2QJNA 3ULAB 4V1DD 4YZWA 3OKDA 5MEOB 4ECNA 1TYGA 1GAFL 5DHVA 4PRBB 2I7SA 1NKGA 5FM5O 1ACXA 3EJSA 3DI1A 4Z1BA 1EWEA 4F8XA 1SF5A 2ZXCA 1TVBB 3F4CA 1FH9A 4I0CC 5CD5D 3GIQA 5HWMA 4XD5A 1FH7A 4A63A 5AVVB 1MDAA 4PVBA 1OQFA 4HMCA 2XCMC 3MNVB 2CETA 1QPNA 5FX3A 2QVHA 1UWTA 1ZWIA 3GSUA 4PBEA 4NAFB 4IKJA 4RH4A 3ZBMA 5IK3B 4LEBA 4QKXB 3M7FB 1I45A 2DL2A 5TF0A 1CFTB 4QY8B 2C16A 1V3HA 4P2AA 1VPXA 4LSRH 4GMTL 2QKIC 2HVKA 1A3QA 1N4XL 4Z7VA 5HNTA 2UVFA 4P8XA 1MCNA 1WA1X 1CGXA 3CXFA 4AIZA 4BS0A 2OGJA 1O66A 2JJVA 1F2JA 2ICEA 3K8KA 5JPMB 3HVNA 4LLYB 4JFED 1ZT4B 1OHQA 4DNLA 4HB7A 1GMEA 4RMSA 2VSCA 3L3KB 1O5KA 5BRZE 3TBTA 5DVMA 3FFCD 4R97C 4W6YB 3PTQA 2MQ3A 4CSTA 3QG6B 2HS6A 3QHFH 4KESA 4UTFA 5AZ2L 3M0ZA 3OQEA 4GYPA 5B7ZA 4H4IA 2YC1A 3TIEA 4XNUH 2JTYA 1KFCA 1SYTA 2NY0B 4ERGA 1R9ZA 3V10A 3PHAA 3OB0H 1TWSA 1DVFB 4W9TA 1PHWA 4X6FB 4LCWD 2PGEA 4XZ9A 3MRGA 5ANMB 3QMSA 3NDZE 1D7FA 3TROA 4FQ2L 4PL1A 2PB1A 4BRVA 1PDYA 1TKKA 1R2RA 4QTHB 2WXFA 2C3VB 4FFTA 2NX1A 3PNRB 4OZIB 4MZ2A 1AZZC 5FGBA 2EO1A 2O6CA 1XCXA 5K4ZA 3QJTB 3FK4A 2C9RA 4OVXA 1KEML 3BVWA 5I74C 4RV8A 1NIDA 3L9RA 2XQBL 5AC8A 4M43H 4DFHA 4XCNA 2IG2L 1TZAA 2VXTH 4AHQA 4XGZB 3CUXA 5D38A 5ESAA 1YPXA 5L8JB 4CSSA 1TJPA 1Z3NA 2XZCL 5D7JD 4BV1A 1R3TA 4GUCA 1VHNA 4X6BB 2DY2A 3MREA 3B0PA 1DDHB 3URNA 5J5RA 2LW3A 1RZKH 2X87A 1M53A 2DVXA 2VDOL 5A3ID 2QQNL 5F6IB 1CD1A 3GGWB 3DHDA 1I3RA 3A4WA 3F5LA 5F3BB 1YAIA 4IGSA 3H7LA 1PS3A 3CDGA 3IMTA 4J6IA 4UQCA 8XIMA 1XIHA 2EG6A 1O6TA 3OKOA 4R7LA 4WY0B 3WTTA 4BWLA 4P05A 2Y7GA 3ANVA 3A3YB 3VD5A 4ZRGA 3LPFA 2FVMA 3BVUA 5IMKA 1KY7A 3UY7A 1ICPA 3R1GH 3SOTA 3UIZA 3UDWC 3O4LE 2QBWA 3N3TA 1K7XA 1CLOL 3CFDB 2BZCA 1AGBA 3PS6A 3BSZH 3CFUA 1O12A 3O15A 1TLKA 3NQKA 1XS2A 3QEUA 2E56A 2A3AA 5BW7C 1BJ8A 4WTXA 1PDZA 2CGYA 1GYAA 3ROOA 4XPHL 4XAZA 5F7HA 2Y7SA 1EBPA 4N9EA 4J3VA 4JTRA 1OC7A 3GM8A 3RM4A 3KPSE 3SR7A 3ZR6A 5HP5A 3QUXC 1PXGA 4AQAA 2N1TE 3UC0H 2XWTA 2NW2B 1HSBA 4ODWA 3G3LA 1KT2B 5GGTA 1QNPA 1QFWI 2Z9TA 1BWMA 4N2LA 1A4MA 2PP1A 3PWUA 1KCBA 2R0WL 1K8IB 5DRXA 4DJDA 2GC4C 1UWRA 1OP5K 5BU6A 1M1XA 1DL3A 1ZL1A 4G1MB 2P3EA 2VFFA 3U6WA 2BRRH 1FHDA 3TN6A 3FU3A 4Q7BA 3PGCB 3THCA 4JO5A 2PCPA 5AG8A 3ZL1A 1K6AA 1YMMB 3MJ6A 4DJFC 4ZL1A 5E9NA 4FIRA 1I9IL 4H25B 3W2NA 1JN6A 1QWUA 3W85A 2DTML 5AVYB 4X4KA 5CPQA 5JQ9A 1KYDA 4YL4A 1MSPA 2BS9A 3PWPD 2XSAA 1SBSL 3FJTA 2ZAHA 4NZ5A 1SJBA 4J7RA 3D48R 4WD0A 2C7UB 4WOZA 4UM8A 4TUOB 4YE4L 1AXSB 1I7ZA 5AZEL 1J5HA 2DZPA 2GWNA 1A6TB 1YN7A 4PIBA 5F1OB 3GNXA 1N55A 2C9SA 3SY8A 4M5SA 1LO2H 1CFSA 2OJEA 4H9XA 4KO6A 3H85A 4YHKL 5JHDB 1N0XL 2JGYA 3MCLH 1V6UA 2NY1D 3ABGA 4M7KL 1WEJH 5CGTA 4XN1A 4EIBA 1S46A 2VDNH 1N8ZA 1F56A 4EPSA 1P4LA 4LSBA 4PRRA 4P4KD 1YY9C 4M9PA 3W9EB 2X0WA 1Z9PA 2ABAA 4YDLC 3W2MA 1KN4L 2MCMA 3GUFA 4G9FD 3NJNA 5IW1B 3KWWA 3ZZQA 1MZYA 1J1PH 2PWHA 4ABVA 4PBFA 1OC5A 3P0VL 2V2WB 1HVQA 3O45A 3RFZC 1TE6A 1E27A 4BFIA 4FLQA 4DPCX 5HNRA 2A77H 4W87A 3N4AA 1Z6KA 2FGLA 1QSED 1XBZA 4WTQA 3RLVA 4KV5F 2BVEA 3EOLA 4XT1C 2PF0A 1CZ8H 3TPKA 1PEZA 3AIRA 4N0FB 1UXLA 4C91A 1ZHAA 1NPUA 1NQBA 4FNSA 3QUZB 3G18A 4KPLA 4D6FA 4RNJA 3UTQB 4HXBL 3S88L 5CLYA 4PYHA 5LA1A 1AY1L 4H26B 1UVQB 2F9RA 5BPPA 2EYRB 1FVEA 1HJVA 1MH5B 4FQ1H 5KBLA 4OFDA 4TV6A 3Q94A 4RNFA 1OT2A 3TZVA 3SKUD 3T77B 4A3UA 4OI9A 4L4JA 2VM9A 5DJ0A 5AWNH 3MN8A 2FB3A 5F72S 1SO6A 1ZQ5A 1JD9A 1N68A 4KVCH 5EUOF 4NWTL 2XYCA 4H9VA 1WKDA 3CO4A 4WGXA 3NYZA 2MNJB 1MIEH 4C1LA 4RNRA 2C91A 5KZCB 1EIBA 4J2QA 2YKLH 3HZ3A 1UBSA 4KTDH 1OFBA 3LQAC 2X42A 1GC1H 2MMXA 3VXMD 3KWUA 5DS1A 2MSPA 1IGCL 4DM2A 3MNWA 1BQLH 1KDIA 1TRIA 4Z2GA 1OM9A 3PBYA 1V55B 2PTTB 1JWUB 4DQWA 3R10A 1JZ2A 3SIKA 3AIEA 4M9OA 1VBJA 1SN2A 1GHSA 4KBPA 4B7IA 4GSQA 4K3DH 2E27L 2ENQA 2DQFB 1U93B 1R5IA 5CSZA 1LUCA 2HJFA 1UUOA 3X3GH 4PMDA 1EXUB 5L0QC 1ZHKB 3DUSB 3HJZA 3C9NB 4OKVA 3L4XA 1IKNC 3WFZA 3O6DA 5DD0L 1HG3A 5EFIB 3ZKXC 2HG5B 2AI0H 1RJZB 2X89D 4U1JB 2A9ML 5FV1L 4YYFA 2CIIB 3BZDA 4HLZH 4HS6A 4NJKA 4OCRL 3G1YA 4Y4HA 2BNJA 2ZUVA 2G2RA 4YBLC 5MENE 4HNNA 5GS3A 1UH4A 3BPLC 3CB3A 4AW7A 4DPQA 2XU9A 1VEOA 1YEGL 5LHFA 3CMOL 1XTLA 1V7ML 5E2UH 1IGMH 3S5YA 2OPCA 1EEZA 4JIIX 4JFSA 4UIKL 2HROA 4AX3A 2B2XL 3E0GA 4YGAB 1UOZA 1O68A 3T6ZA 2FJHB 5AVSB 3X2QB 1LEKA 1SJVA 1EF2A 2PXYB 4L8SA 1A5SA 2O26U 4QRPB 3LZ3A 4RXFA 2BDNH 5L2JB 3GNDA 5F9WC 1NCOA 4TPRH 4IEFB 4KV5E 4LSTL 2MPVA 5F7MC 4M48H 3OGRA 2YCJA 5FYKH 5DBTA 4D8AA 5F2GA 2ZCLH 5B7FA 1WTGT 4HDIA 4IKLA 2EVGA 2UWEB 4X7EC 1DVUA 2PWFA 1P1VA 5BNKA 2CXGA 5C09A 3BZGA 2Z4QB 5E70A 1AW2A 4AT6B 1T0PB 2GJ6B 4KEVA 1FNGB 3P77A 3TBSB 5FK9B 4U10A 2X0UA 1ADQA 2JQMA 1EFXB 5FB8B 3F12B 1TJGL 3Q8BA 1FNEB 4QHNA 3VOGA 1KCUL 2EEFA 4ODSL 5JW4M 3VQLA 4AM0Q 5EUOE 4KXZH 5I6LA 1ZV9A 1MYRA 1RIVL 3RJXA 2I32A 3ARWA 3CBKB 5F0MB 5L9DH 3QFJA 3MUCA 3EH2A 4YFEA 4PW4A 3AQUA 5D1ZC 1G0XA 2FWOA 1W16A 3BJSA 3LIZH 3UBPC 3Q0HA 5FGRA 4GQPH 2YPKA 1UUMA 4PUDA 3IRSA 2ISFA 1JNLH 3H9YA 1KEGL 4NNAA 1R0AH 1QBML 1XG4A 1PG7L 2PBGA 1YTEA 2NY3B 5DC0A 4IX0A 4NIRA 1G94A 5ES4B 2VDQH 3KXFD 4ZTPH 1D6VH 3P4MB 1G84A 3CFCH 2X2GA 3WIIL 1SUJA 3OYXA 4UMGA 4Q6IB 3VNIA 5DCCA 4UIMA 3RP1A 3UT0A 1MJJA 2GJJA 3MJ9L 3HHSA 5GJSH 4BDVA 2NX5B 4NU7A 4AZBA 3KRBA 3FRPB 4AL8C 4F15C 3S4SB 2IPFA 4UF7C 3TA3D 1PAMA 1LWRA 1BQHG 2PR9A 1ZAHA 5CHNA 2OK0H 2VR9A 5CEZL 2BVDA 2WANA 1Q72L 4JZJA 3VXSB 5I76A 5HGHB 1G9ML 1U1HA 4AEOA 3L7RA 4Z1CA 5DFTA 1NUGA 2IFGA 1P7QD 4N26A 2WK2A 2MQCA 4ZMVA 4IJTA 4RAVB 5J13C 3HRZB 4XBGA 5I26A 3O2DL 4PLJC 1HJSA 1DHKA 1F4YL 2FH6A 4W4QA 1E4MM 1G87A 1QEWB 2VEPA 2QZRA 1FTXA 3B2PA 5HVGB 3HTWA 3GDMA 3FOLA 5E6ZA 2KT6A 4X50A 4HIIB 1AZCA 3WDPP 2K7QA 3MLRL 5HD8C 4BFNA 2A6LA 1UASA 3STZA 1E0OB 2FQIA 3EWDA 4AIEA 2XM2A 2FPVA 3HBGA 2JKRM 4R97B 2YGPA 3SO3B 4QNWA 3CZLA 4QCEA 2IEPA 4N6FA 4QHRA 3EO9H 1RJYB 4LUIA 4P2QA 4AK2A 4XODA 4ICMA 5HNNA 5FCUL 3K30A 4FHJA 3U4EA 5E2WH 1S7UB 3V0SA 3QUYC 2D3NA 4NKMB 5C0BA 2WD0A 5JIMA 1QSVA 3RWIB 3STCA 3BP7B 3ZO0A 5E0CA 1IJNA 3GHEH 5I8CB 3GSWA 2Q3OA 4S1QH 1ZA3B 3QXDA 1WA3A 2COVD 3DHFA 1X6NA 1GKQA 3TTQA 1X6LA 2AMUA 2IADA 1D7DA 1LK3L 1MJ8H 3FAXA 4J40A 3K2KA 3E6FB 1Q2RA 4EX4A 3C2AL 5I74B 2BY0A 3EYVA 3S46A 2BZ7A 4QHKJ 5E9DA 1L9OA 3LMJH 3W28A 3ESNA 5CPOA 4PYSA 2QHLA 3DETC 3IETA 4TVPH 4UT6H 5H35A 2WHKA 1LP9B 1U92B 2W94A 4DVBA 2CUAA 2P4AB 3N91A 2OMVA 4F91B 5I6SA 4P2RE 2IIJA 1TCMA 4DAGL 4UQ2A 4PGEA 2CESA 4RA3A 1T5AA 3DX1A 1FLRL 3EWWA 2C0HA 1Z5HA 5KYUB 4NQ1A 4F2BA 3SY0B 1TU2B 3LZQA 4NZ8A 4CNIA 4PTXA 3S9IA 2ZUWA 3KL3A 5K33A 3V0HA 4NUJA 3EFOA 5DZPA 1K6QL 1BX2A 1D3GA 1XX1A 3P1VA 3VSVA 5GNYA 4JRYA 2WJEA 3ZZ1A 3MRLA 1CLYH 3NIDF 1ZCRA 4DN4H 1U4EA 2DSZA 5DK2B 3HPJA 4AYMC 2DAVA 2VHLA 4MB3A 4WO0A 3OXRB 3ZHDA 4M3JA 4GUIA 4HUCA 3TOPA 4X9BA 3GSXA 1EXHA 4QRRA 4PG2A 5KSUA 4C7GA 3BUDA 3HNVH 4NQDA 1M7JA 1NGXB 3VNLA 2R8SL 5AY7A 1VYRA 4Q9QL 3GMLA 5EUKB 1N5YH 2ZUUA 1CUOA 5IB2B 3U6RB 1BVKA 5SWZE 1SJXA 1OARL 3EX6A 1LLAA 4XO3A 2DZBA 2I16A 1JK8A 5LAPA 3H53A 1JQXA 3MWAA 1EUNA 3TVAA 5LYRA 4FLHA 2WMGA 3V5FA 3RLHA 3W24A 1PKQB 3CHRA 3SDXA 5C0AD 1B3YA 3I75A 4LSSL 5CKAA 2XV2A 1Q9OB 3HC3L 4JPSA 3T4AC 6ENLA 4IP4A 4UOW0 1YRRA 2WXGA 2QKFA 1QO3B 1BQUA 3MMEB 4HWUA 1FYHB 4JVWA 4H9ZA 2E67A 2ASHA 2Y5JA 5HHOA 2Z4TA 1SFDA 3VGFA 3AZUA 3BTNA 1T66C 3JQOB 2JB5L 3P4OA 3QHTC 3SOBH 4F7PB 3WUEA 3HBQA 2A7RA 3BSZA 4EKJA 5DEFA 4JTTA 1AXTL 4JR9L 4E0CA 4MY1A 3N2XA 4NCDA 5DK0B 3NXFA 4WI6A 2J78A 3OZPA 4G6KH 3IV3A 2EDQA 2E7DA 1IGWA 5TQ2L 2B0SH 3GH5A 1QLEL 4DKAA 4I88A 2BOFX 1YEHH 1OPGL 4AHPA 3H4FA 4MWAA 1JBJA 2XVBA 3FQNB 2BWGA 1BEYL 2CH8A 1QXLA 4MA8H 1BWWA 4X99A 1Z9SA 3AT8A 3VAEA 5ESQA 1R1CA 3PP4H 1MCEA 2VT0A 2WZPD 2YLHA 4RGOH 3HQ1A 5CFAA 1N7MH 2DPKA 4OM0L 4YSSA 2NUPA 4HJ0D 1GGCH 1WDQA 4DJEA 3UG5A 1Q6FA 4WTZG 3QULA 4JIHA 1MQPA 3O11B 5C0CE 2Q8AH 1RPQA 1UACL 3AOFA 3QTGA 4N8CL 3UTTA 3V7MA 3CFKB 3TVMD 1IBDA 3GYCA 3EH1A 1I1YB 1EJ7L 1WRFA 4R6UA 1SLXA 2O0TA 1MZRA 1CBJA 5D72L 4FIQA 1FGVL 4RSYA 1GYMA 4YLBA 5C2BL 4TL4A 3P8JA 1ZAJA 3SYOA 3FDWA 1VIWA 3CPLA 6A3HA 3NK4A 1W5PA 1DUZB 1FFPA 1UQSA 3MOAH 3OZYA 1BXVA 3B0YA 1J9YA 1QRNA 4AH2A 4U1MA 3PAZA 1KBIA 3IE9A 4HX1B 5B39B 4XB8A 1ZLVH 1OIFA 4X0KA 3RE0A 1DKWA 2ZOKB 4FYSA 4JM4L 3RPBA 2FSEA 4G6FB 3VI4B 2GI7A 3HTLX 1OY3B 4O17A 2LOEA 2E76C 4Y5YA 3VI3A 3EW3B 1NBVL 3LZPA 1AQ0A 3EOAB 4G7VL 2IH1B 3N14A 3O16A 3WH8A 5CG7A 1MEWA 1OAXH 4MVBD 3HN5A 4XVJH 4EOWL 3FN0L 4BKSC 2JKWA 5KBMA 1WUEA 3RN6A 4FKEA 1TTIA 2XZZA 3BCDA 4QKTA 4F9LA 5HHME 3W7NA 5H8UA 3ID7A 1NANI 1XM3A 3SFKA 4M7LL 4IGBA 5HYJB 4L9LB 4NJJA 2LTQC 3ZJKA 3I74A 5CCKH 2DF3A 4AVOA 3ARVA 1AMYA 5CPSA 5MP6L 3TUUA 2AAAA 2RBLA 3B8WA 3GYEA 1I8LC 4LVGA 4BWTA 4ZFGL 4Y1AD 2R69H 2ZIDA 1AHWC 3RVWD 1Z9NA 1FRGL 1GR7A 3QUMB 4XP5H 3VCNA 2VLJE 1YE6A 4W8AA 4NQTA 1CU4L 2VLRA 3JWOC 3VDGA 2H2PC 4N1EA 1W9XA 4S3GA 5FF0A 4QG8A 4XO4A 4BEIA 3WMSA 4JRWA 3U5YA 5EBMA 3SDAB 3ULVH 2HTLD 1NCAH 5FKAB 5JPMC 3W7RA 1ZHNA 1M2VA 5BMFL 2SODB 1W8SA 3ATZA 1P7TA 3B8SA 2GEQA 3BFOA 5BO1L 4KWVA 2YD6A 2MCPH 4EVNB 3PPCA 4E8GA 4XTIA 3RIAK 4LAKA 5C3IA 2ED7A 4RMRA 1REQA 1NJ9B 1YNLL 4WKZA 1WBZB 5C7ZA 4BKNA 2NY0C 4PJIF 1WWAX 2FIRT 1ZJAA 1E4XH 1C08B 3WNIA 3JU2A 5FEBA 5CPTA 5EU5A 2CXEA 4PIRF 2ZADA 1VERA 2EECA 4X5XA 3HG1A 1WP6A 3MXVL 2YHGA 3C6LA 2EXYD 4ODHH 2BSRB 1GUVA 1JDDA 1J5DA 4FS0A 1I1AA 4OT1L 2GGGA 2P80D 2PR4H 4XOAA 1LILA 4WK9A 2CHZA 2X4QB 4YBLB 3F7LA 4ELKA 4NQEB 2J6VA 5C0DB 1FZMA 3FCGA 3BPLB 1MCWM 4FQJH 1FWWA 4YHGA 4TM9A 4IQDA 1UMYA 5I71C 4QLJA 1IWAA 2WVVB 3H2FA 3SGGA 3BRGC 5D1XC 3V5KA 5BQ7A 2VXVL 3UBXI 3N4EA 1NMCC 3GKWH 5CPMA 3SUTA 1J1OH 2ZOXA 4LSQL 3TYGH 1FQ9C 3PNWB 3QOMA 5EPDA 1A14H 3GSUB 3ZE0F 4MTMA 1JHLL 5AW2B 4A8NA 5CLXA 4NI3A 3FO9B 4PJCB 4YR6A 4KZ0A 2VUYA 3PY2A 2AV7B 1NSJA 4KUZL 3RGTA 1PTAA 2PBOA 5F6IC 1LWIA 1UWFA 3Q2LA 3IUIA 2I9UA 1WCQA 3AC0A 2HVKB 4CBZA 1ZE3H 3THQA 5GNXA 2OMBA 3I4KA 1NUFA 2HMIC 4YC2C 3U7WH 5ICUA 4OUEA 2J7BA 4AIZB 1A6AA 1M68A 1DVXA 4TX8A 4ZO7A 2ICEB 5DGRA 2AFNA 1BYDA 4MQTB 1BXUA 1FYTA 1G0DA 1CB2A 4FXKA 3TBTB 3WHE1 1CLVA 3P54A 1FHNA 1KG0A 4NI8A 1JGIA 2FT6A 4IICA 2PAJA 2M2DA 3FULA 4J28A 4DPBX 1YEFH 1NTHA 3MLTA 3CHVA 1TPFA 5PTDA 2GDVA 3TIEB 1F61A 4Y9FA 4F8NA 4R4BB 3WKYA 4HK6A 4F5CE 2JCCE 2GI0A 2PGRA 2BNRA 1DVQA 2WZ0A 5LDUA 1ILSA 1S2TA 2LAAA 3ZLFA 2AJVL 4D7PA 3W70A 1J10A 3WJJA 2G3FA 4DLMA 4P59L 1EZLA 4MRBA 3M86A 3T09A 4PTUB 1NFAA 1H3VA 2H3BA 2NY7L 3EJUA 2BZNA 4A6GA 2CBIA 4WJKB 4BUQA 4JZ5A 3FVMA 1D5IH 3GW0A 2WMPB 3L9RB 3B8YA 3MBFA 1OP9A 1SLUA 4F15B 1UWXH 1S7XA 4R7DA 4ACPA 2F8IA 5I1DB 4B50A 1EWHA 2HJKB 1R85A 2P88A 4KF1A 1G5GA 2CO7A 1I9RH 3MBXH 1XWVA 3CXDH 3DSNA 3OAZK 2L4OA 2Y1HA 3SRHA 1RZ8A 3BZEA 3UXLA 5AYQA 4PJIE 2HJLB 1I8IA 3RIFK 5D5MA 4HWNA 3B83A 3PGFH 4JPGA 3EJYD 1LYQA 3GMPA 5C0RL 3LIZA 2Y7LA 1EO5A 5J13B 3QI9C 1I3RB 1AD0A 3IB4A 2NXGA 2W38A 3CDGB 1LTXA 2FIKA 3OKOB 2O93L 2O56A 4K23H 5ACZA 5IFAH 2CFFA 3BJ91 2F7RA 5D9SB 2F8QA 5FUZH 1GY2A 1XGRB 3VRLF 3NVTA 4DZIA 1BJ1H 3LZRA 4OVUA 4YK4C 4QXUL 3CIWA 3G1VA 4K7FB 3ZFHA 3L45A 1SHSA 2PSNA 4L4VD 4PV8A 4K8RC 3IANA 3SKOA 4L3AA 1I9EA 4OZFH 3DECA 3QC0A 4GBXA 2BB0A 1V0NA 3ZE0E 3BGJA 3E5BA 4MHHG 5BZDA 1MSSA 4MF4A 3KCPB 1W0YT 3S2AA 1A3XA 4ORIA 4XX1G 1U33A 1ZP4A 4EI5C 3BIAX 1CXEA 2CRZA 4ODWB 2JXMA 4C90A 1OF8A 1PWMA 4PWGA 2VAJA 3ZSTA 1QT1A 5KSBA 2ZUXA 1UR0A 2FPYA 1F1AA 4N2GA 4PR5B 3PXLA 1WZLA 1M1XB 4RAHA 1X5IA 3JWDL 1P53A 3RAJL 4U1IA 4GUFA 4I2XE 1KCXA 2R6OA 3QUZC 5DEGA 1A7PL 4L0ZA 4DOHE 3WD0A 4GRLC 4ZZFA 2LU4A 1GOXA 2BNUA 1AFSA 1JN6B 4ZAKA 1H6EA 3P6LA 5EEWA 2IANE 3C8NA 4KROD 3MROA 3AG2B 2BJMH 2YXVA 1MFAL 4ZG1A 4NZ3A 2EEDA 3U0TB 2YFNA 4L4PA 5CLTA 2ZUNA 3I6LE 3U57A 5IB4B 3W9DB 5BS0A 4TQEL 4NDMA 2CHRA 3Q37A 1UM6L 1YN7B 1C16B 3W1XA 4I3RH 4R4ND 5B7EA 4EPBC 1E9PA 3SE3C 3HM7A 3WQ4A 3LB6D 1ISZA 2NZIA 2TODA 1CTOA 2OJEB 3RPKA 1R34A 4DTGH 3VIPA 4XH2A 1QUNB 2R7EA 4TRPL 1E3XA 4Z17A 1IILE 2V3DA 3SJVB 2O9OA 3CLWA 1CE1H 3C8HA 1WCGA 3PHQA 4UINL 3KBHE 3CSGA 1BYAA 4GISA 5LXGL 2ESVA 3DV6A 4UT6A 1AS7A 3RJYA 1IAII 1P4LB 3FSVA 3MA9L 1TO3A 1T80A 1FE8H 4HSAC 3DU0A 4KNTA 3NSDA 4L1BA 2Y06L 3AREA 3PABB 3WFBL 2VRKA 2O5XH 4I7WA 1VYPX 3L4VA 3X13B 1DLHA 3UXFA 4TNVK 3BAJA 2OQHA 3SDCC 5GGUB 4QXGL 3W7GA 3X11B 4Y4KD 3O45B 2WVUA