4NZFA

Crystal structure of abp-d197a (a gh27-b-l-arabinopyranosidase from geobacillus stearothermophilus), in complex with arabinose
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
431
structure length
431
Chain Sequence
b'ASMHHYQWAKTPPMGWNSWDCYGASVTEDEVKGNAEYMAKYLKPFGWEYVVVDIQWYEPGANSSIYRPFVPLEMDEYSRLMPAVNRFPSAKGGKGFKPLADYIHNLGLKFGIHIMRGIPRQAVHQNTPILGTNVGARDIADTNSICPWNTDMYGVDHRKEGAQAYYDSLFQLYAQWGVDFVKVADIVASKLYGTHTEEIKMIRKAIDRCGRPIVLSLSPGPAPLDHATLFVENANMWRMTDDFWDRWELLYDMFEQCYKWCKLVGLGHWPDADMLPLGHIGIRSVDGGGTDRMTRFTKDEQRTMMTLWIIFRSPLMFGGELRDNDEWTLSLLTNEEVLHVHQNGYGARQVYRENDHVVWTSQDAEGNQFVAMFNISEKRSVVSVSLKDLGCMEPMKARDLWAKEDLGLVKHQLAFELGPHQSILVKLSPAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Abp, a GH27 beta-L-arabinopyranosidase
publication title Structure-specificity relationships in Abp, a GH27 beta-L-arabinopyranosidase from Geobacillus stearothermophilus T6
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 147
structure length 431
sequence length 431
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4nzfA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4nzfA01
4J3VA 3P81A 4NZFA 1LOLA 3SW6A 1OGSA 2YOCA 1FUYA 4JCMA 4GKLA 1BTMA 4MOZA 5D2YA 4H7VA 3LB0A 5HDRA 3O16A 3U8GA 2YW3A 4UQ9A 5HULA 1MVYA 3GKAA 1FDZA 2V5BA 4JY9A 1ZJAA 5A8GA 3UEQA 2E6FA 2NX9A 5AHIA 4FLRA 2PWGA 1YADA 1N8FA 3TTSA 2VEKA 4NNBA 3DFSA 1WE5A 3KRZA 1CPUA 4UTMA 3PUOA 3W1TA 2EPHA 2WV8A 3KAOA 2A6NA 3KL3A 1G6CA 1TMQA 3STEA 2XN0A 4N6EA 3QFEA 1YDNA 5F2MA 1XCWA 1U30A 2XN2A 1O7DC 1HL8A 1EUNA 1MXGA 2WOQA 4AMXA 2V3FA 2QV4A 4KFPA 2WKLA 4O53A 3NPXA 1WZMA 4O0KA 3V75A 3HGOA 3PG8A 1TYGA 4ZQOA 1B57A 3WDHA 1H1YA 4UC5A 1Q6OA 2OSWA 1O5XA 1OFDA 3W37A 2FHCA 3BO9A 1GPWA 4LU0A 5EKYA 4UQDA 2QPSA 4WX2A 2LLEA 2E5DA 5BOOA 2ATSA 5K2ZA 1XSJA 1G4PA 1MWOA 4JTIA 1CIUA 4ML9A 2B7OA 1XH1A 4A3UA 3BCFA 1SPQA 1F5ZA 1JL8A 3WJXA 2ZRXA 1KBBA 1H60A 3FW6A 2G3MA 1LWHA 1DTUA 2CHNA 2PURA 3QMRA 2ZX7A 1TTPA 1VYPX 2GPTA 4YXGA 1F74A 2F2HA 1UA3A 1GYLA 2EADA 5A5WA 3K8KA 1EPXA 1AW5A 4LY8A 4M6VA 3KEHA 2DP3A 2TYSA 2QF7A 3IEBA 4PCFA 4JFUA 3M6YA 4ZL1A 4JXCA 5I24A 3HBLA 3TV8A 4AHPA 5AC7A 3W9ZA 3W7CA 3GKFA 4UQBA 1JCLA 3BMVA 5I3JA 4EIVA 4MYAA 1MW2A 4WF7A 1D3CA 1K7EA 4EVZA 2FQIA 1TPWA 4CNPA 4NJGA 3QC3A 1HVXA 4IPIA 1RV8A 2E0PA 3LLDA 2F18A 4AEFA 1LOQA 4UR7A 3VM5A 4IPJA 3CZEA 2CLLA 3EXTA 3L4TA 5EBUA 3CTTA 4GO8A 1GYNA 4UR8A 2A6LA 4FEZA 1J4EA 1KXQA 3UYCA 4K7YA 1UBSA 4HPJA 2B7PA 2CZFA 3M9YA 3W7GA 4ORIA 3O8AA 2WJZA 3LTYA 5I3GA 3C61A 3LI1A 4M8UA 3L68A 2FFCA 2JKEA 2F7OA 3EDFA 4JFVA 2OSYA 3RK8A 2RKXA 3EJUA 1GEQA 4MFDA 4IMEA 3C56A 4J9JA 1R2RA 3BW4A 7TAAA 5LNUA 3ZQ9A 1F2JA 5AHFA 3UY8A 4JX6A 1OT2A 1LBFA 3B05A 3U6WA 2VELA 3NGJA 3IVUA 1CLVA 3S1UA 1XDLA 2ZX8A 3UERA 4J3SA 4G1KA 3CWNA 5AHMA 4WSJA 4FX6M 3TA6A 5LNSA 3TAKA 4ZZ9A 1O94A 3ATYA 2DIEA 3ABRA 5AN7A 3B8DA 5FF4A 5C5YA 1ZS2A 1W31A 5F4SA 5FEPA 2QMKA 1LCOA 2YIHA 3NEVA 1TSIA 3A4AA 3DX2A 4HOWA 2E6AA 4NUWA 2Y7GA 3W23A 3L0KA 3N9SA 4JFSA 2YA0A 1UASA 5G5IA 3NQEA 2Z1KA 3OVQA 3IJ8A 3D4YA 3TE9A 2GJRA 1TPVA 5DCBA 1N55A 3TK7A 3KLKA 5LGZA 3PC0A 4XZ9A 3KRUA 3A24A 1VC4A 1QR7A 3JRKA 1UD3A 2YPIA 1EEPA 1I2NA 1SW3A 2Y6ZA 4N4QA 3AJXA 1Q6LA 3LI0A 3T7VA 1VGAA 3GDLA 3CM4A 1G94A 1OB0A 4GXMA 1JF5A 3PBUA 1TPDA 4JYFA 3ZO9A 5I3IA 5F1VA 4KKXA 3ANYA 1JCMP 2HS8A 4IGHA 3K8MA 4O17A 3ZWSA 2V5LA 1QI4A 5LNRA 1TRDA 1RP8A 4KMQA 1FCBA 3G18A 1KM3A 4LXFA 4TMBA 4A22A 5E0KA 2V8ZA 2IQTA 2Y4SA 4GQQA 1XH0A 1XKYA 1XM3A 3S2CA 3WY2A 2E09A 3MUXA 6CGTA 4UQEA 2VC6A 2RHGA 3BUDA 4MLJA 3WK1A 1PEZA 2DH3A 3A21A 3BAWA 2A5HA 2HTMA 3ZR4A 5KZMA 4GRSA 1KA9F 1QW8A 1AQMA 4UQCA 4MJMA 3G8RA 2Y63A 1BLIA 3GBEA 2VT0A 4PFMA 3O15A 1SZNA 3CQ0A 5HNRA 3P60A 2C13A 4M19A 1Z48A 1QWUA 2GQ9A 4HOZA 3IJ9A 4WOQA 3OVPA 2BY0A 3L4VA 3S1VA 3I65A 1V3LA 4MB1A 3HG2A 4LVBA 5EPDA 4MY1A 3C8FA 1B4KA 1JR1A 4LC8A 1Q4NX 4X2RA 1UA7A 4ALDA 2F1BA 4GBUA 1VZWA 1KB3A 1JCJA 4DO5A 3I7QA 3DI1A 3ZT7A 4ZQNA 1JQVA 1EHAA 2VR5A 1NF0A 4ZQMA 1TQUA 3MWAA 3LBCA 1CXFA 2ZRUA 1ODUA 3R5EA 5HMSA 2XVGA 2ZICA 1JXJA 3OBKA 3IGUA 2Y70A 4O15A 4JX4A 1JAEA 3RLVA 4UTTA 2ZXDA 3W87A 2PWFA 4BI5A 3VGDA 2FTPA 3WJYA 5LGXA 1BWLA 3DHDA 3N73A 4LTSA 1KWKA 1G9HA 5CPNA 2EABA 1UUMA 4HP5A 5KITA 1JRCA 3LCIA 3BK0A 1C29A 3EWBX 2ZFAA 3W84A 2JGYA 2IGTA 2PRLA 3HPZA 5HJLA 1UH2A 3E02A 3VX0A 1B4EA 3RMJA 3N9RA 3SY5A 2W6RA 1FXPA 1EUAA 1ZENA 1VRDA 1TTJA 1BWKA 1Z44A 3OIXA 1IXPA 1FDYA 2QJIA 3CPRA 4OJYA 4UFIA 4QSHA 2G95A 3BVXA 3G1DA 3P80A 3HZ3A 4IMCA 1PV8A 4GUFA 3T55A 1MFUA 1M53A 2XWDA 4O4WA 1VHNA 1TRIA 2YA1A 4UFMA 3E12A 2ZA1A 1XBZA 1YPFA 4DELA 4UQAA 3P5ZA 1VLWA 1XCXA 3CV5A 2PC4A 1VPXA 1UUOA 3CEUA 1D9EA 2ZUSA 3MHFA 3TTYA 5K9CA 5L6UA 3B04A 1SW7A 4MZ8A 1KFEA 3WFZA 4JDYA 4CNNA 3EEGA 2DZXA 3F4NA 3FFSA 2D73A 5FI8A 2D3LA 3WK0A 1DKWA 2XIIA 1TQSA 1YDVA 1U2YA 1NOFA 1EIXA 1SO3A 3HPXA 3RLUA 1QFEA 1MSSA 1TTQA 3HO8A 2WSRA 4YCOA 3DI0A 5L9FA 4WXYA 1BEUA 2NV2A 4OU1A 4U28A 1M7OA 3PVFA 4JFTA 1W5OA 1WOAA 1EP1A 2TSYA 4ATWA 3EDKA 1TIMA 1HO1A 2A0NA 5I3HA 2FH6A 4WXZA 1QI3A 3N2MA 4IMDA 4BI6A 5CG7A 3NZ1A 3VM7A 4WUIA 3T78A 5CLTA 3VKJA 1AL7A 1JDDA 3TU9A 1JQXA 2C0AA 2EKCA 2H8ZA 1EWEA 4HSNA 1RPXA 3D52A 3G1YA 3A23A 1H63A 2BTMA 1S5VA 1CGTA 5F4WA 3WNLA 3W7LA 1LM1A 3DU0A 3H55A 1HFBA 4PSRA 4HHPA 3BUQA 4OKDA 1TV5A 1KGWA 3MJYA 3BLIA 3CLMA 2NXHA 3TW7A 2GJNA 2I9EA 2WCGA 1S46A 1YDOA 4IQLA 3L2IA 2F7PA 3WJWA 4O1CA 3RFAA 1KCKA 5G1YA 5E6YA 3M41A 3W1QA 5DELA 1W5MA 3TXZA 3N2XA 4JTGA 3BVJA 2ZZ6A 3VE7A 4FNPA 4CGTA 3W7KA 3P67A 4WY0A 2OSXA 1A47A 1KM6A 1RD5A 1BKSA 4JS3A 3BG9A 1KM1A 2BXZA 4FHAA 1LLWA 1K03A 2HSAA 1QDSA 4LV9A 4UTHA 1ZY9A 3BUBA 2QDGA 1V3KA 2OJPA 5FEZA 2WVTA 1KTBA 1O5KA 1RR2A 2F7FA 4IJBA 3RU6A 3WFAA 1WAUA 4O50A 3B06A 3PB0A 3G3MA 2FGZA 2Y7FA 4O4VA 1JIBA 1W3TA 1WA3A 4NXKA 5FF7A 2Z6IA 3OG3A 3HG5A 2G5WA 3OA3A 2V81A 4L4LA 4CQ9A 2A1YA 5AHEA 4QAWA 4NJIA 3IIPA 4WZHA 2E8YA 3KE0A 1QPQA 3PBYA 4R53A 4O11A 3LRKA 5A6LA 1K8ZA 6ALDA 4BZYA 1PIGA 3BAJA 4FO4A 4M5PA 5EA9A 2OX1A 3QSRA 2BHYA 2TRSA 4WY0B 2A21A 1KV8A 2ZA2A 1AVAA 4O16A 4O14A 5TQLA 1SMDA 1D3GA 3M5YA 4I7UA 1WO2A 2D0HA 1GVFA 5I23A 4UZSA 6TAAA 4D2JA 3UWWA 2AAAA 5HWMA 4UMCA 3DGRA 3CIXA 3DENA 5F2IA 1P0KA 5U4NA 3VNZA 1TV7A 3W7PA 3NR0A 4JR5A 2Q3OA 5FEXA 1ML1A 1DBTA 3MO7A 1LROA 1PHQA 1UD8A 1OFOA 3DX4A 3A5FA 4HIBA 1FBAA 2NLIA 3EX3A 3W7QA 4DF0A 4CCCA 1C8QA 2D0FA 3WY4A 4LC6A 1B3OA 1K02A 3LERA 3TSBA 4AF0B 2CW6A 2ZRZA 3NQCA 1JCNA 1UH3A 2I14A 1WYIA 3VI2A 3TC7A 1KGUA 1HTIA 3ELFA 4KWVA 2PWHA 4KWWA 1DL3A 4J3TA 1V7YA 1HX0A 3SI9A 2CZEA 5D04C 1UD5A 2Y62A 1I75A 1UH4A 3W6YA 1KFJA 3WNPA 1UKQA 3FKRA 1CGVA 1ZJBA 3WY3A 3PY2A 2GUYA 4LRTA 1A50A 1SFLA 5FEWA 1EP3A 3P5YA 4OE7A 2GVJA 1J0JA 2CLIA 1HNYA 1FX6A 1KM4A 4W9TA 4RCXA 1R75A 3UZ5A 5KZEA 2C15A 4UTLA 1XI3A 3LM7A 1Y7VA 3DX1A 2G96A 3ZOAA 1KWGA 1CXKA 2V0TA 3GXNA 4XTIA 4XUGA 3L2MA 2Z6JA 5DXYA 3LPOA 3L9CA 2NXIA 4GI9A 3GXFA 3BVTA 2ZUTA 3L2LA 1EA9C 1CW2A 3LHTA 4MUZA 3HF3A 1LZOA 3CZNA 3C2FA 3O6CA 5IBXC 5HXMA 2E8ZA 3GNNA 1GWJA 3NQVA 4WY0F 1RP9A 3MP5A 1MXDA 2ZBTA 4XKYA 4UFHA 1YTDA 3MYOA 1FCQA 3OLIA 2VNCA 3NQDA 2BWGA 1OSEA 4QISA 1JRBA 1UD4A 5CZTA 1PCWA 4ZQCA 5SWUA 3L4WA 7CGTA 1FWWA 3FOKA 1H7WA 3K1DA 1HWWA 1L0PA 4U3CA 2YGYA 2D0GA 1I4NA 5IBXA 2FYVA 1OYAA 4AW7A 1JXKA 2BZNA 3TSMA 5A2AA 3I7SA 2EJ1A 4QM1A 1O60A 4TU1A 1I2PA 4K37A 3NM1A 5TBOA 4PL2A 2YA2A 1QPNA 2DU2A 2VFFA 2EAEA 3TOPA 3FS2A 4K7VA 1BPLB 4CNOA 1L6SA 5AOUA 5EY5A 4K39A 3AXIA 1BF2A 5K4XA 3GTNA 1QWGA 1LRTA 1UOKA 2E5CA 4X9SA 1QO5A 2OW7A 4QQ3A 4E2BA 1TMHA 4K8EA 3MW7A 2GJPA 4E2DA 3IVTA 2NT1A 2J9XA 4CKQA 3Q58A 1MEWA 4HOXA 1VFMA 3OEXA 1XBXA 3W75A 3BAYA 4XKYB 2QCGA 4GNJA 4B9ZA 3BLBA 4U2ZA 4H6KA 3WEOA 1M7XA 3P7YA 4PEEA 3GLCA 5DLCA 4EOUA 1HXKA 3W2NA 2WVUA 1W5QA 3KOFA 3USBA 4H4IA 4FXRA 3M07A 4QNEA 5LHFA 3M7WA 4UOQA 4MJZA 5E9AA 4O54A 1R34A 1SQ7A 3CC1A 1QWNA 4TMCA 4M6PA 1SZFA 1KGXA 3SGUA 3LHUA 1XDMA 2FLIA 3G1AA 2NUWA 5TD4A 3GDTA 1VJIA 1FXQA 1TQTA 4ONVA 3TNOA 1JDCA 1GQNA 1CGWA 4R7JA 2X1TA 3L66A 1JVNA 1LTDA 1VLIA 4LV4A 4FX8A 4GQRA 3QEZA 4UFKA 4GUIA 3LXAA 2W0UA 3NZRA 3GX9A 1WZLA 2V30A 1XD1A 1VFUA 1BG9A 1UD6A 1SFJA 3EKLA 3TSDA 1W5NA 3EJPA 1IV8A 4N9CA 1GZGA 4IMGA 4X9YA 3LXCA 3WELA 2VKZG 1JD7A 3HIJA 3PS7A 1F6PA 2GUUA 2ZX6A 3KXQA 3UG4A 1X1ZA 2XVKA 3BVUA 1GVOA 2GOUA 3G3DA 4NJJA 5IM51 3EX2A 1AW1A 5LHEA 1VAHA 4O18A 3W1AA 1U83A 5H91A 3VU2A 2B7QA 2X16A 4HNTA 1WQ5A 3HOJA 3NA8A 4NXSA 1EB3A 3LTSA 2WQPA 1S5TA 2C19A 2PWEA 4UTJA 2H3BA 3LRMA 1ME7A 3O6DA 4N4PA 4X0NA 4R33A 1EX5A 1J0IA 4BI7A 2AAMA 2F7QA 1W3NA 1JUEA 3E0IA 4UNLA 3M44A 3QJAA 4J3UA 1FDJA 3KVJA 3O06A 2EF9A 3W73A 4HKPA 3FA5A 3LV5A 3QMTA 1V3MA 1THFD 1EH9A 3G8EA 1NEYA 1HTYA 4TIMA 1TQVA 1TJRA 2XFWA 3BLPX 4A21A 1D3HA 3W88A 2AQWA 3CIWA 3FYPA 4AHQA 3ZSTA 5D03A 3CB8A 4XQ6A 4Y9AA 3W7JA 4E38A 2ZUVA 5DO8A 4J3XA 2CLFA 1S5WA 2WVSA 2ZZ2A 3BLKA 1BVNP 2OCZA 2YDAA 3LBMA 4KFOA 1TPH1 1JJKA 1KW1A 2I1OA 3EB2A 1T99A 1KTNA 1JF6A 2V2CA 1PS3A 3DKJA 1ALDA 2B4GA 3DFPA 4GI6A 3OLGA 2QCEA 1I2QA 3L4ZA 1FWRA 3TJXA 1UKSA 4JCLA 3QH2A 3TUUA 3O6YX 1LLZA 4Y6GA 4M56A 2O7QA 1GJWA 2TMDA 4YCPA 1MEIA 1K3UA 3S5OA 5CPOA 2XVLA 3UG3A 3M1ZA 1OX4A 1JG9A 4UFLA 1PJ9A 3CU2A 5KTLA 1XGZA 1VHCA 4NNCA 2RDTA 4BWLC 1RQEA 2C14A 1Q3NA 4ADTA 4J3WA 3DC0A 3A6OA 1XBYA 4O13A 1FCVA 3G24A 3JR2A 1P1XA 4WJEA 4IUOA 1ADOA 1H50A 2DZTA 2WVVA 4ZVJA 4NX5A 2ZDRA 4TO8A 1YTKA 3LPPA 1NM9A 1K8XA 4BWLA 5A2BA 3QZEA 1VH7A 4O1DA 5D2XA 5H2ZA 3DX3A 4RZ4A 5BRQA 3B0PA 3IVSA 2ISSA 5I3FA 3R13A 2ABAA 2C6QA 3HGRA 4MZYA 2WCSA 3BUIA 2GJLA 4RKAA 4JYDA 5F7UA 2V9DA 1JFHA 5U7SA 3STGA 3V1PA 4PL1A 3IIXA 3O63A 5MHBA 1ME9A 1BVZA 1DHKA 4HNVA 2YJQA 3VGGA 3BV4A 3EDDA 5FF2A 1CDGA 1OX4B 2V2HA 1KBJA 4NNAA 5F2LA 3L67A 4M7SA 2EAWA 1ONRA 3W2LA 1KM0A 3W70A 5J5RA 1VS1A 4FXSA 3MBDA 4R34A 3GBDA 3SFKA 3T4CA 1CGXA 2Y61A 3QM3A 4FIRA 1OYBA 2ALWA 4N02A 2VXNA 2CFFA 4ICNA 1DQXA 3G1HA 2CXGA 2JK2A 4U33A 3LCHA 2CLMA 3GXMA 1KBIA 2B0MA 2WNWA 4O57A 3W7RA 3NPUA 4JTLA 4C1KA 2CZ5A 1QPKA 3C2VA 1W37A 5C2XA 3S1WA 2Y7DA 3Q2DA 3PUDA 4O28A 2P1FA 3CZKA 1G5AA 3AMLA 2EEXA 3BC9A 3NL2A 1L2UA 3SZ8A 3W1NA 3F4WA 3BG3A 2TPSA 3NNTA 3EJTA 3VNDA 4GINA 2YZRA 2VFEA 3MYPA 4FNSA 4POCA 3W7EA 4E2OA 1HT6A 2QCFA 2QUVA 2OZ0A 3FEMA 4HT3A 5CPLA 1QW9A 3R8RA 4GE8A 3MI6A 3W1XA 3W72A 5KEZA 3C2RA 4UTWC 3VO0A 3OLDA 3M5XA 3R89A 1J0HA 1UCWA 2CU0A 2OW6A 4MKNA 3S9YA 3S5YA 2OT0A 1WOBA 3HB9A 4UXDA 5CZSA 3QSTA 3LCLA 4YWIA 3CEPA 4X3ZA 4FNUA 1MXSA 5DBUA 3S42A 1IXNA 4AIOA 1OJXA 2X1SA 1I8JA 2H8XA 4J27A 3EJQA 4J28A 4UTWA 1F7BA 3THQA 1LOSA 3VCRA 1V5XA 3A22A 1XFBA 2NXGA 4RJEA 4X22A 1NVMA 3ZR6A 3LOTA 2ZIDA 4O12A 5G2WA 2E6DA 3CZGA 1AL8A 3EJRA 2PWDA 1P4CA 2RDUA 3F1QA 3TFXA 1UKTA 1GG1A 3GVGA 3QPZA 2Q3RA 2ALDA 1R2SA 3G0SA 5BNKA 3L4XA 1P6WA 1B9BA 3NOEA 4KWUA 4I7VA 1CGYA 4HA1A 4JL1A 5DBTA 4HPXA 2WNQA 4NVTA 1W9XA 2JGQA 4DPPA 1KM2A 4U2YA 1N7KA 4AEEA 4O19A 1G1YA 3GXIA 4UCFA 4J7RA 5E0FA 2H90A 1KBKA 3Q94A 4GO9A 2E77A 1CYGA 3S1XA 6TIMA 4Q4KA 3DXIA 3TQVA 3E96A 3MHUA 3QW3A 1HG3A 3DH7A 1AK5A 2YX0A 3F03K 3SJ3A 3IGSA 1HL2A 3UWYA 2ZWZA 2X30A 1LRNA 2WKJA 2GVLA 2E68A 3FLUA 1XV8A 4BR1A 2ZRVA 4YMZA 4Q33A 4FLOA 3HGSA 2X2IA 3LCXA 1W8SA 4MY9A 4N9EA 3RNDA 3LHWA 4CLMA 1BSIA 3BPWA 1JCXA 3FYOA 2YFOA 4IX0A 3QF0A 2VRQA 4DXVA 3FKKA 2QCNA 1T96A 2B7NA 1OT1A 2QLYA 4ZQRA 4QITA 2CZDA 2YFNA 3D51A 2EGZA 1PIIA 2C18A 2FPYA 1Q45A 4AHOA 2J9YA 5EYWA 2J6XA 4A2RA 4NX0A 3TONA 3LGEA 4Y90A 2BY3A 2ZWYA 1PVNA 3VMPA 3VMOA 2J27A 3UG5A 4JTTA 2TAAA 3HJEA 3VSTA 2QCHA 2WPGA 1OVDA 3IGXA 4AXKA 3EWWA 3UXAA 2FE0A 3W76A 4WLCA 1KLYA 4LT9A 1ME8A 1SUXA 3N3MA 3KRSA 4PODA 3PBVA 1JUBA 3MP3A 1MFVA 3NVTA 5J5DA 3PUEA 1SW0A 3W38A 2R14A 1VCFA 5G1TA 4DF1A 5KINA 5CXPA 4U4MA 4JEQA 3MP4A 1E3ZA 1JUKA 2A7PA 5E93A 2OT1A 2QJHA 2WANA 4RZ5A 5C55A 1SZGA 1OG0A 3INPA 1GJPA 3EXSA 2DZSA 1IZKA 1ZAJA 3EX6A 1OF8A 3LTPA 1KLZA 1PE1A 2ZQ0A 2ZRWA 5CZJA 3W22A 4GI8A 3WJZA 2WNNA 3PF3A 3DFOA 3EWUA 1XCFA 1QHPA 1T8XA 3RILA 4DBEA 3H53A 3DBPA 1PZ3A 1WZKA 2C8NA 1J5TA 4TR9A 1H51A 3OVRA 2R94A 3CT7A 9CGTA 1RQHA 1VCVA 4BK9A 4WQ6A 3GDMA 3UPWA 2BSLA 1SR9A 2WSYA 2ZYFA 3IIOA 4O1BA 4DEFA 5FESA 3GIYA 1P0NA 1EP2A 3BSHA 1PAMA 4AAJA 1LORA 4UCGA 1QMLA 3C2EA 2GVGA 1B2YA 3O05A 3EJSA 3CGTA 1SO4A 5AHLA 2ATMA 3BW3A 3LCFA 4JL2A 1KXTA 3IRDA 4PC8A 3PM6A 1LP6A 2X1RA 1TPC1 1XUZA 2HMCA 2VFGA 4UMBA 1TCMA 4LPCA 3NQFA 2CLEA 4FLSA 3VMNA 4RLIA 3EWYA 3R12A 1H7XA 3NAVA 3CWOX 4BA0A 4LWWA 3PB2A 2YXGA 1H1ZA 1OF6A 1DHPA 3G1VA 3LXBA 1ZAHA 4HN4A 3VGHA 5CGTA 5K9XA 3ZFHA 4RK8A 2NX3A 5GVJA 4AWSA 3LHYA 1E3XA 1F05A 2JBMA 1I45A 5CGQA 1RZMA 3LHVA 3NG3A 3FJLA 5D09A 5D2TA 1DQWA 4W93A 3KVLA 3TW6A 1FY6A 1GVSA 3IV3A 2J9ZA 2FDSA 4TVUA 8CGTA 1LDCA 5BW6A 1KXHA 4PCTA 1QPOA 3PBWA 3GXDA 1W0MA 2E4TA 3DAQA 5D30A 2ZXAA 2VEPA 3L65A 3I6RA 4DBDA 2WSKA 1MEHA 1SO5A 4B5NA 1VIWA 3BSGA 3WNMA 3W1MA 1JDAA 1UD2A 3GR8A 2G97A 4LQ1A 4UZUA 2X2GA 3TQ0A 5LZLA 1SO6A 3KL0A 4Y8FA 4UTUA 4NJKA 3GR7A 4CN4A 3VSUA 3M43A 2QPUA 1KFLA 2O7SA 4NU7A 5I3KA 2HS6A 5G4EA 1AMKA 5AYYA 4DQWA 5CGMA 4EF9A 2V3DA 5DXXA 4RXFA 4OGZA 3VE9A 3NQ6A 1VR6A 4WOZA 3TIMA 4S2BA 3AXHA 4Z1AA 4MIMA 1AQHA 3IIZA 1YYAA 5C6MA 2EACA 3KLLA 4FF7A 4Z08A 3LX9A 1ZAIA 1DORA 3DZ1A 4OBTA 5C54A 2Y5EA 3VFLA 3NDOA 3TROA 2ZE0A 5D2VA 1OK4A 3BLFA 2DZVA 3KVKA 1DV7A 2UV8G 3P74A 3W7HA 3UWZA 3S5ZA 2FB3A 2WKGA 3QQ1A 4MVAA 5LNVA 1PPIA 4RR4A 2DJLA 3W1LA 1FQ0A 3W83A 1AMYA 2EQDA 2F7RA 3NQAA 5F2GA 5D33A 2VENA 4FIQA 3B0VC 1JCYA 1K7FA 1TPUA 2QUTA 4A29A 5D05A 3TAOA 1R46A 2PRHA 3EKZA 1PS9A 3BAIA 3MMTA 3SSJA 3O07A 4AYGA 1WBHA 1W3IA 3NPWA 2DH2A 2FHFA 1Z41A 5EMYA 1ZFJA 3L4YA 4JTFA 5I0DA 3QPYA 3G0UA 3NPVA 3YPIA 5ABTA 2JKPA 3CZSA 1Q6QA 2NWSA 2Y85A 3ZWTA 2VOMA 3T44A 5AYXA 7TIMA 2BHUA 2QCMA 3WY1A 1LBLA 5DCDA 3ZT6A 2WNZA 2F84A 3UPBA 1PIFA 1TPFA 3ABOA 5HUPA 3KWXA 4O1AA 3HMJG 3GYEA 3M5ZA 3M0ZA 2OYMA 2QMJA 3GAKA 1A5SA 2Y7EA 4UNIA 3W7MA 2QR6A 3GB6A 4UIOA 2YYUA 2ZA3A 3R2GA 3VSVA 5CSRA 2QDHA 3GDKA 3NYZA 1H7OA 3L0NA 4MZ1A 3A9IA 3HPSA 4FX7A 1ICSA 2QKFA 4ZQPA 3E49A 2Q8ZA 3BGGA 1SZEA 3FJ6A 4LUIA 2XWEA 1XSKA 2EHHA 1PL9A 3QRHA 4AYSA 1Q6RA 2WSQA 5DFAA 1YLVA 2ZXQA 3NL6A 4IX2A 5D37A 2CLOA 3SR7A 4JIPA 4MY8A 4QAIA 2VUYA 3EWZA 5BMXA 3C0JA 4AEOA 4H3DA 4YL2A 3W1UA 1G7UA 2Y88A 4M7TA 2E6YA 3ZT5A 2ISWA 3TFCA 2R8WA 3RIKA 3MI3A 1JGIA 5HR6A 3EDJA 3IJ7A 3LDVA 1F6KA 1A5AA 1DOSA 4JICA 4HNUA 3M16A 1KTCA 4MPQA 5LKYA 3W07A 1WPCA 4MAZA 3L0GA 1CGUA 1H61A 3W2MA 1XD0A 1H7NA 1EO5A 1GG0A 1G4TA 1TQWA 2FJKA 3VGBA 3DFNA 5CKSA 4KFNA 3LV6A 2FB2A 4AMWA 4GUGA 2OMAA 3KL5A 1OFEA 4AB4A 3QMSA 1FWNA 1WV2A 1WZAA 3DX0A 4BF9A 5LNWA 3EX4A 3HG3A 3H54A 1DJNA 1QO2A 1JI2A 2CWNA 4NQ1A 5AFDA 3EXRA 5HPOA 3DHPA 3CPUA 5DN1A 1QOQA 3WJSA 1W56A 1CXEA 3ABSA 1LYXA 4AVFA 2PRMA 3DKLA 3W85A 1GCYA 2Q8LA 4QNWA 3DDFA 2FPVA 5K7JA 4O8RA 5K4ZA 1JI1A 3TXVA 4FLQA 3NQ8A 3UY7A 3UXDA 3W7NA 3GAYA 4ADUA 3KHJA 2Y24A 4MYXA 4B9YA 1SSDA 3PSVA 5CPMA 1CXIA 4JTJA 4K36A 3P62A 3W86A 1HL9A 1R33A 4GJ1A 3CLWA 4QJ1A 2YYTA 2GQ8A 8TIMA 2ZX5A 2OYLA 2D2OA 3DDGA 3CTLA 4PH6A 1C9DA 3CHVA 4GUJA 4XB3A 2ZZ1A 1QNVA 3WENA 2GVYA 3JS3A 2ABBA 1KV5A 2G3NA 5E70A 3TMLA 5K9DA 3UQNA 3NQ2A 2NT0A 3S5NA 1IXOA 4NI3A 4I9AA 3NQMA 1MW3A 1G7VA 4XBSA 3BVWA 1GT8A 3STCA 3W2UA 3NM3A 4H8VA 3SECA 4XWUA 2CLKA 4AIEA 3EX1A 2ZZ3A 1OX5A 3W1PA 5HUOA 1RVGA 2QCDA 1S3HA 1OFBA 1BAGA 1SSGA 3OLEA 4EWND 4YLWA 1XXXA 3KVMA 5FF0A 3L4UA 1JD9A 1GVRA 4N6FA 1NFBA 4H8UA 1G67A 2BHZA 4JTSA 3W74A 3B0UX 3P84A 5TIMA 1MW0A 4JTEA 4C1LA 1F73A 3LCWA 4Q32A 4L4MA 2A4AA 4CCDA 1OFPA 1G69A 5BMWA 2DIJA 2C7FA 4NZJA 3WDJA 1C8VA 3W7DA 2ZRYA 1AW2A 2NSXA 4N9BA 1GVIA 1Z42A 2WPBA 3GZ3A 4JN6A 2F1AA 3S8HA 1FCUA 5DY2A 4Z0JA 4BFAA 1DJQA 1M7PA 2X2JA 3C52A 3HQ1A 1UJPA 2WSPA 1ZNNA 2KZHA 3D0CA 3P82A 1R47A 4OV9A 3I68A 2FHBA 3WMSA 3FIGA 2DZUA 3T40A 1LWJA 4CQAA 5AC8A 5AB3A 5FF3A 3KX6A 4O52A 1TPB1 5F4XA 3TQKA 3UWVA 2QCDB 4QIUA 1A5CA 4GFSA 1NF7A 2WVVB 1OFAA 3I7RA 3SIZA 5CZ0A 1QCWA 2DJXA 1E40A 3ZR5A 1Y0EA 3DFTA 3KFTA 2QCLA 2Y89A 3BW2A 1A53A 3O1NA 2BLEA 4RZ6A 1IZJA 4UTTC 4RX0A 3A47A 1T0OA 1M5WA 1O4UA 2ISVA 3DHUA 4DPQA 4LS1A 3L5AA 1TV8A 1IGSA 5HWNA 2NUXA 4JDBA 1XH2A 3VNYA 1I2OA 2DORA 4UMAA 5CSSA 3BG5A 3P8IA 1LRQA 2VFDA 4JD4A 1MO0A 3MHGA 2OYKA 1FWTA 3NL3A 3II1A 3P8JA 1O95A 4ORMA 2RFGA 1KXVA 2C16A 3K8LA 3HGJA 3W2KA 5HR7A 1VJSA 3GXPA 4N2YA 1L6YA 4AH7A 4IXXA 3PR2A 4Z1BA 5HQEA 4N9DA 4P61A 2CPUA 4HSOA 1UB3A 4O10A 5KMYA 3UD6A 2X2HA 5BRPA 4UUIA 4A2SA 3L5LA 4EF8A 1V3JA 3S0CA 3ZS4A 3PSWA 3BARA 2ZX9A 1E51A 3STFA 3G0XA 4Z1DA 3UCQA 3L5MA 1CX9A 4JTKA 4UTIA 4FB7A 2DZPA 4ADSA 4JY8A 1SU5A 4OQVA 5T26A 2C3ZA 3THAA 1OK6A 4MFEA 1WP6A 1QAPA 1YXYA 2AMGA 1PHWA 4IOTA 4CQ8A 5KSWA 3QGVA 2VFIA 5E6ZA 1KCLA 4DF2A 3D50A 5K3VA 4M6QA 2PE4A 1GTEA 3IK2A 1OX6A 4RV8A 2ZCGA 1X6UA 4IWWA 3W7OA 3OHIA 1OYCA 4OHQA 1GOXA 1VCGA 4UFJA 1TPEA 2E5BA 1QOPA 1L9WA 2V2DA 2C1HA 4LS2A 3GK0A 3GNDA 1NSJA 1OFQA 5KZDA 1XUUA 1OHLA 1XC4A 3LCGA 1CI1A 3G1FA 3Q37A 1IIHA 1EWDA 5AHNA 1VYRA 1A5BA 3TDFA 3E9AA 3N19B 5HWJA 2VEMA 1IF2A 3BAXA 1MZHA 1ZCOA 1KFKA 4GUHA 3B03A 3LLFA 5D38A 2CLHA 3TCEA 5BRBA 3WDIA 3C2OA 1GVQA 3G1SA 1FWSA 4NJHA 3BH4A 1J0KA 1B0IA 5G4WA 2YW4A 4ZMGA 4PCSA 5G2IA 2PCQA 3TMQA 3UWUA 1QHOA 1QPRA 4K8HA 3EWXA 3C3NA 3U2OA 1F76A 4XTDA 4GIAA 2XIBA 1RPKA 2EO7A 1QX1A 2Y2WA 1WXJA 4CVWA 1IIGA 4WSKA 3GXTA 5LSMA 3B4UA 3DFQA 3CZLA 3LRLA 2FIQA 3NQGA 1XBVA 2A2IA 4K6AA 3W1RA 2DZWA 1HUVA 1K8YA 1EO7A 2A7RA 3C6CA 3TX9A 3UZJA 2QEZA 5I5RA 5A2CA 1J2WA 1TJPA 3LHZA 2FPTA 4PSPA 3WNNA 4JTHA 4JFWA 5E1QA 1H3GA 4FNRA 3PAJA 3VX1A 1Z32X 4P2VA 5EMUA 4HPHA 1JULA 2FH8A 1HO4A 4DO6A 2A85A 2BX7A 1U33A 2NZLA 1XSIA 1IXQA 3S6DA 4WD0A 4LVAA 1R2TA 4RXGA 1X8FA 4H2CA 4CCEA 5DY3A 3ATZA 3WK2A 1GJUA 3PWAA 4IMFA 5D32A 4HNNA 3L21A 2BY2A 1DVJA 3P61A 3IIVA 1YXDA 3BLEA 2J25A 4OIFA 3ZSSA 3W71A 4IXHA 3W2JA 3BGJA 2E9BA 3VGEA 1TO3A 1QI5A 1VYSX 1H62A 1TB3A 3HG4A 3M47A 3A5VA 2NUYA 1AG1O 2R91A 3SGZA 2J24A 2P0OA 4OWGA 3RF9A 4AF0A 2WO5A 1WDWA 3PULA 3AO0A 1GTHA 4O0ZA 1SMAA 1KM5A 2QUUA 1H7RA 3MI2A 3AMKA 1PZ2A 3K30A 1ICQA 1PCKA 3DHFA 3TKFA 4TX9A 2VRKA 2QAPA 2Z0IA 1DEDA 1VB9A 3WEMA 3MBFA 4FMVA 3FAWA 1TREA 5A6MA 2BY1A 2ZUUA 1TQXA 3QW4B 1X1OA 3C4UA 1EA0A 3WNKA 4FNTA 2W79A 1P5BA 1LBMA 4XBKA 2YSWA 4OT7A 2D3NA 4I7WA 5F1UA 1H7PA 3BUPA 2ZTJA 3NXFA 3FAXA 4JIQA 3ABQA 1I2RA 2AGKA 4LW7A 1OABA 3G22A 4MLRA 4Y96A 2XN1A 2X1UA 1TQJA 1CXHA 3AJ7A 5CLWA 1KFCA 3BAKA 4AWUA 3TC6A 1CXLA 2QJGA 3NO5A 1W54A 2NV1A 2QAFA 4GC4A 4UOZA 2GQAA 4S1FA 5HINA 3NL5A 4LVGA 4CN6A 4JTUA 4JNMA 4JYEA 1XL9A 2P10A 1YPIA 1ZHAA 4DO4A 3G1XA 2VFHA 1L6WA 2ZZ5A 2E1DA 5D02A 4U31A 1ZALA 2WC7A 3QYQA 3ECQA 2YKKA 1ZJIA 2J88A 2NWRA 3M5VA 5G2HA 3BMWA 3WNOA 4CN1A 3TJLA 4S2CA 5AC6A 2ZZ7A 2RDWA 1K7XA 2QCCA 2VEIA 4OV4A 1D7FA 4PEKA 1RQBA 3D4ZA 4LOCA 4UNKA 1KFBA 3VGFA 2BXVA 2H3DA 4GWEA 1VFOA 1G4EA 4JGDA 5AYZA 3GDRA 2A7NA 3TR2A 2BXYA 1YTEA 3N34A 3TH6A 4Z1CA 1VQTA 1U5JA 5EL1A 1G4SA 4Z0SA 3W3OA 2ZUWA 4LUJA 4PA8A 3W7IA 2JKAA 2NX1A 3PG9A 4LNYA 1NAL1 3NQ7A 2YR1A 4E0CA 2F61A 4AWTA 3N14A 4JX5A 4LS0A 4AMAA 2RH9A 3WK3A 4H8HA 1ICPA 4FNQA 2ZZ4A 1OFRA 3QQ0A 4PTNA 4LVDA 2V3EA 1E43A 1TTIA 2Z2UA 5DCEA 3WN6A 1X7FA 1R30A 3UNDA 2ZXBA 4LRSA 3HJZA 1W1ZA 1H5YA 1YXCA 5D2WA 1TCDA 2YCEA 1WX0A 2Z1BA 3UWQA 4UTKA 3EDEA 3BVVA 1WBJA 1M6JA 3BCDA 1MW1A 4LVFA 2V82A 4NT0A 1W5PA 4K38A 2ZTKA 2H6RA
chains in the Genus database with same CATH superfamily
2RA1A 2ZKYA 3FN0H 4ZW6A 2P5NA 5JIWA 5D2YA 3FHAA 4GRWH 3PQYD 4QOKE 1CB2A 2F5AH 5KBMA 4L3ED 1YN6A 3BT0A 3RWIB 4Q7NA 4NNBA 3L23A 4UTMA 3QZOA 4R96B 3PPCA 3KHOA 2WOQA 4TXVB 4O53A 3UP1A 1NLDH 3QZLA 4ZQOA 4GQGA 1E9OA 2ZCHL 4WJG3 4RSVA 2FZDA 3UAFA 3IACA 4WX2A 3EFOA 5BOOA 4L4OA 5K2ZA 5FA3B 3O7UA 4KJWC 2X09A 2HPOA 3FW6A 2ARJB 1F74A 1E2ZA 4F48A 3LMJL 5FFLA 4JXCA 1IBHA 4EVZA 1ED3B 3ZE0E 3D06A 2OR9H 4OUIA 3HAEB 2E0PA 3PGDA 3UJIH 3VM5A 1FH7A 3SRKA 1BYCA 3RB5A 4MA8L 3CC5A 4HS3B 1MRDL 4EI5C 2CO7A 4GABA 3V0WH 1TFVA 4WCYL 3C61A 5FXCH 4LBEB 2PBGA 4BQ3A 1V79A 1K5NA 2CCRA 3G5ZA 3D2UA 3GHEH 2OTPA 1GAFH 3O4LE 3UY8A 2QTEA 4ERGA 1XDLA 3IJSB 3TAKA 4LOUD 1IGTB 3MSDA 5FF4A 1HSAB 3F7YB 2GSIB 4EDWL 1W31A 3EFFA 2VXVH 4C5ZA 4JFHD 4ALAC 4M1GL 3W23A 1RUMH 1QPPA 4US6A 1O6IA 2OMZB 4IU3B 2OI9B 4LYKA 1TU2B 4M93C 4ENZA 3KP0A 5E24E 5GHWL 4GQ0A 1VGAA 4PRDA 3TZFA 5D7IE 4YH6A 5DHVA 4F2ME 4WRHA 1RZJL 2X6MA 4UAHA 1IAIM 4GKNB 4E9QA 4HJIA 5LAXA 3QNFA 4XO3A 3N06B 2HJPA 2KBGA 1HXYB 4RGMC 1EGJH 2VGLM 3O3AB 4QTHB 3BUDA 3LNHA 5EU5A 4KZCA 2MNRA 3UU0A 3OKYA 3VDCA 1J9TA 2MKWA 4PMEA 3O15A 4D8PA 5KSBF 5EB9A 5C92A 2PSNA 3P60A 3RGVC 3NJVA 4HK7A 4XPFL 4NS0A 3KPMA 3NIYA 3H2WA 4UU9A 1G9EA 2BSSB 1JR1A 4LC8A 2Q8BH 3WKQA 1V77A 3ZDXB 1NQKA 1PXGA 3BZGA 3TNNB 2TRHA 3G6DL 2P26A 2EABA 1UUMA 5KITA 1C29A 2DEPA 2B3RA 4HPYL 3UAJA 3MMDA 4OCYH 3C60C 4N86A 3TEYA 4U1NA 1IXPA 1UCBL 4L8CA 2JKSA 4F7PB 4Q4MA 4F92B 2EUWA 1A3HA 4O4WA 2ZA1A 4UQAA 2HSIA 2VZ1A 4UQ3A 3CV5A 1IGYA 3G5VB 2F8IA 3MHFA 4OM1L 5FECA 5C08A 4UNUA 2QHLA 2D3LA 3U79A 3ZYOA 3HV9A 3NJXA 5FYKU 1C1EL 3WF4A 4LEXL 3KWUA 2IGLA 3SN1A 1CTNA 1ZGDA 2F53E 4U28A 4MBOA 3PVFA 1AHKA 5D7LD 4LESA 4ATWA 5BZDB 1HO1A 4DN4H 1JPGB 3C5ZA 4BI6A 2AANA 3NPZB 3WQEA 4MVBD 1M9WA 4WUIA 5HVHC 1HH9B 3L9RA 2IMNA 1BQ5A 3FO9B 1H5BA 2AKMA 5M5DA 4PSRA 2VW7A 4GIPD 4C6LA 3WFDH 4I9WE 1KCRL 4QR7A 1CYXA 3LVTA 4L4VD 4FQXB 1Q94A 2EH7H 4QEGA 4FFZL 2VDQB 1XB8A 4PWGA 3LKQB 3RWHA 4O9HH 2C34A 1O6SB 1UOWA 1WT5C 4Q89A 2WLZA 2PBOA 3K2KA 3CMOH 4MXQD 5CAHA 5T1KB 2V81A 4XE0A 1JK8B 2WWKT 1DCLA 4KGJA 4PJDA 1ZU8A 3BYYA 5A95A 5HNNA 5CN3A 4EJ1C 3OXSB 4QIRA 1RMFL 5I23A 1QLRA 3HMXA 2BINA 1IBGL 1CL7H 3S8FB 1TG7A 1ZRQA 4KFMA 3VXTB 2Z8WC 1PSKH 2GFBB 1KTDB 2AXGB 4ZXBB 4NQDE 1FBAA 3VIKA 2YXVA 4PJ9D 1I9RL 2D0FA 2YUWA 1EEQA 3NJNA 3BURA 4RBPK 3FXIC 1AZVA 3APCA 5EU6B 1FA2A 1G7PA 4HXBL 4OQ1A 4G9DA 4EN3C 1JHKL 7A3HA 3QJRB 2EIEA 5I17A 1JFXA 4OAWA 1YAIA 4R5VA 5DJDB 3M0YA 1XF3A 2EDMA 3FU5A 5I6LA 3UZ5A 1ROWA 1ZP3A 2G96A 3GXNA 4XTIA 1U95A 4WO4B 4GZEA 4FYQA 2D4DA 1UIOA 1QSEE 4ZPTA 3TBYA 1MFCH 4BQ9A 1M04A 3MLVL 3A4JA 3BP7B 5JYLA 2A5UA 1FCQA 3NQDA 1ENUA 1NFGA 1T0MB 4WVRA 1F3WA 1O60A 2DU2A 3OMIB 5AOUA 5AZUA 3U0TA 5TQ0H 2GPZA 5DF0A 2V2TB 1OM9A 4HHMA 4AZBA 5T1JA 3VFTA 1M7XA 3G5WA 1G6RA 1L3WA 2HG0A 3RCNA 4EACA 1F9CA 3D0LA 3W11D 1YN6B 3SQRA 1EC7A 3F6JA 3SGUA 1EIBA 3GM8A 2X1TA 3OOQA 1JVNA 2FNWA 4Z7NB 4QD2E 2JIXA 4Q8PA 1Z9MA 3S3JA 2NXZD 5CR8A 2DSVA 2NY3D 3UGUA 1IV8A 1IAIH 3EFOB 1JD7A 3QIUA 2J55A 2EDKA 3T2OA 1Q6DA 5IM51 3G3DA 4P8QA 2Q5BA 1HVQA 4ZPVA 2BWIA 1I3UA 4MCMA 1VPOL 3HOJA 2FQDA 3PZTA 3QK0A 8PAZA 3AMCA 4HHWA 1FL3A 1MVUA 5PCYA 3WH5A 4X0NA 4ZSOE 1RZKL 4C83A 1UOLA 4KY1H 2Y0FA 1TKWA 3R06A 4MB5A 4PP1D 4X5WA 4N2FA 3VD1A 4Y9AA 2CO7B 3ES6A 1K9EA 4XH2A 3FXGA 2PTVA 3ZGHA 1K5NB 1HYRC 3SY6A 1B54A 4KTGA 3K6SA 4MMWA 3QDME 1Z5YD 3WLKX 1NWOA 4MD0A 3CU2A 5KTLA 3BWZA 5D9MA 4DZIA 3EFFB 2XFXA 1EEXA 4J3WA 5I79A 4TYUA 1SUHA 1R19A 4NHCH 5ESVA 1FGVH 5I1CH 3IJYB 4Y5XC 1RLDA 4LHQB 1A6UL 3H4GA 4MZYA 1GS8A 3LIUA 4PRDB 2PCEA 4A7SA 4JQIA 3RJYA 5DHVB 3NDYA 2XH7A 1S8DB 4HNVA 3ABMB 2EO1A 4KRNA 4M7SA 2X1QA 2B77A 3SDCA 5LAXB 1S5IL 5ACLA 4NT6B 5DK2B 4GNVA 4PJXF 1LO5A 2O1AA 2PMZA 2WZPD 5CR1A 2XDFA 4A2DA 4N7QA 1VACA 2CZ5A 2PU1A 1PX3A 3QQ4B 3WKYA 4Q4OA 5AOKA 3BUTA 4AVJA 3NRPA 2BSCA 3W1XA 4UQ2A 3KPMB 3ZL4L 4MKNA 4QG6A 5CZSA 2X44D 1J1OH 3EB4A 3N40F 2YL5A 2R1MA 4AIOA 4UT9L 1I8JA 4J27A 4XC1L 1LOSA 5HHQA 2VN5A 1V5XA 2NXGA 1RIVL 4X6CE 1Z9PA 4TQHA 2JQMA 3VAVA 5GRWA 4GMEA 3EJRA 2J5LC 1SN2A 5ALBL 4QRRA 3HIZA 2LGNA 5DBTA 2VYOA 3IT8D 1ONEA 4BIKA 4L8CB 1L7IL 2FWUA 5IM7A 3VRIA 3LKPA 3GRBA 3KWSA 1TNNA 2WKJA 4W84A 4DYJA 5C08B 4QXTA 4FLOA 5G2NA 4N2HA 2ZOKB 3ZTJG 4WGVB 2ANUA 4IIEA 4JPQA 4ZQRA 3VNKA 3D51A 2O9RA 3QEQA 3SCNA 4QOKD 2QJJA 3NDZA 1XMWA 1C9SA 2J6XA 4BHYA 4FRWA 5IMLA 2A3BA 4JTTA 1ADSA 4XCNA 3PWVA 1GHFH 4LARL 3SKMB 4Z42C 4PHZA 1TVHA 3MP3A 1H5BB 3NVTA 3TTQA 1CZ1A 3GTXA 1CCWB 3MOBL 1Q7MA 1NP2A 3PV6A 1I0BA 2QYGA 4L2LA 4K9EH 2ZRWA 4LF3A 3WMCA 5HQLA 4ZCWA 4NN7B 1I0DA 1RBOB 1IU1A 3PZIA 4RFNC 9CGTA 3MZGB 1I9CB 3ZTNH 4YHYB 5K69A 1VD6A 4XBPA 4ASTA 4JM2F 1FVPA 2JXMA 4YK4B 1HJBC 4A37A 4YIQA 4JTQA 2Z28A 1MAMH 5C0CD 2V67A 2VXUH 1IBDA 5F96L 4P5UA 3BEVA 4OTKA 2X6BA 1GK8A 1SDYA 3Q65A 4PR4A 4OUEA 1IGCL 2W9LA 2PZ0A 4ZQKA 2JELL 3MNWA 5DS2A 4BSJA 3TX4A 4LCRA 3VWJC 3PTDA 4XAWH 2YZ5A 2XFFA 1ZAHA 4X9GA 1BAWA 1CDJA 4R5EA 3LHVA 3EBGA 1QLRB 1E6OH 1FY6A 4UV7H 2O5XL 3N2JA 4OLVH 3IDXH 3BD4A 4QXUL 4PB0L 1Y07A 3DAQA 2I9TA 2WSKA 1MEHA 4E9RA 4HISA 1M56B 2F15A 4ZODA 1DQLL 4DM2A 3QDJA 4CN4A 2O7SA 1BXVA 2HS6A 2E28A 1PWMA 3G5XB 5E2JA 3QJOA 4MX7A 1J5OH 4QLJA 4G9DB 2ICEA 5CSZA 5I17B 3QFWA 1KB5H 4OAWB 1YJDH 2LR4A 3NDOA 4Y9PA 1PX4A 4NUGL 2DJLA 2X0HA 3IDIA 4Q58C 1ISYA 5BOJA 1U95B 3AHZA 5CEXB 1K7FA 4J1OA 2QUTA 3V4LA 4B9PA 3MMTA 3SSJA 1NCTA 5EV7A 4ZPTB 4B5TA 1BW8A 3TBYB 3RX3A 4JTFA 1J0ZA 4F0RA 1B0WA 1FE8L 3ILPA 2AABH 4KXZH 4AGQA 2QCMA 3DO3A 5G55A 4NQCD 1F6YA 1RKRA 4YWGL 3TTOA 3MZ2A 4XIAA 4L8DA 3Q0HA 2YYUA 3R2GA 1IQWH 1PKMA 3L81A 4P07A 3HE7C 5JIDA 3U0TB 4L9LA 5KS9A 4GISA 3O6LL 3A6BH 1OEZW 2WOBA 4LT7A 2PD9A 1GGTA 5AW1B 4G80A 3PWPA 5MHSD 1Z9SB 4W9FC 2XWZA 4FI8A 3X3FH 3ALWA 3D0LB 1FHNA 2FDMA 2R0LL 1WBYB 3UJTL 2C1IA 3W07A 3ESPA 1E4XH 4U1LA 2FT7A 1M3IA 1P6FA 3H85A 1S78C 1T4WA 3AG1B 1HYSC 5ECGA 3N3EA 4PJ7A 1MUMA 2A9NH 4EXPX 3D18B 3DFYA 1CXEA 3ITOA 2WXQA 4N24A 3MAWA 2GGEA 4ZPVB 3WD5L 1V03A 2FZ9A 1TKKA 4L7ZA 4MYXA 3U7YL 1BXCA 1N3NA 4K36A 3SBFA 1MVUB 3MROB 5EA0H 2XOTA 1KC5H 2F53D 4C83B 4Y1SA 3ZDYF 2BP5M 4DJDC 5M1TA 4J8RA 5B4MD 3KS6A 5K9DA 3R06B 3NQ2A 3FOMA 1ZHBA 5AKSA 4Y2DA 4X5WB 4XBSA 3ES6B 1JDFA 3PFMA 4XH2B 1ORQA 2CLKA 1OFBA 2DJSA 1QLEB 3K6SB 1HKKA 3IAQA 4MQTB 5DSCA 4R97B 3R4RA 4TM9A 3B0UX 3P84A 1Y6KR 2Y5SA 3ITVA 3VDHA 1C5BH 1BEYH 4MD0B 4NZJA 2EILB 2XFXB 3C52A 1XF0A 3P82A 4L1BA 5BRZE 3IDYC 5ESVB 5E2UH 1P7HL 4Q56A 3MUCA 5E2WH 3A4DA 1FYTE 1MCPL 7ODCA 1MFDH 3R43A 4AC4A 3KWVA 3WLBA 4K2SA 3QCTH 4M81A 1O95A 4PB4A 3CN1A 4W85A 4AM0A 2WJDA 3NCCB 4D0BA 4I2XA 4NQDD 5KBDA 3FX4A 1FV1A 2WNKA 3CASA 3U36B 1PZBA 1FNHA 4GAGH 1ISVA 1XHGA 4JZNB 4UUIA 3S0CA 1VACB 5BUPA 4DP2X 4Z7WF 3STFA 5I06A 4NZ8A 1FFTB 1KULA 3BPLC 3KOWA 3WLNA 3NH7H 3MB9A 3SO7A 1MI5D 2VM9A 1G0XA 3L3JA 3M8OH 4RV8A 5D2NA 1OCBA 1S1RA 2YXWA 3ZPDA 2ZYRA 3GK0A 4KRTA 2DL9A 4Z3IA 3WKNA 4KI5E 5MKGA 5AW4B 2R69L 5D8JL 2VEMA 1QSED 3HG1D 4GUHA 5BRBA 4OH2A 1OCQA 2GOKA 3KBPA 1X39A 5DD1H 5REQA 5IGXL 4RWYL 5I66A 3MQIA 8XIMA 4Z7QF 1S7QB 2X4UA 5FJPA 4GMTL 1R0MA 2Y2WA 1WXJA 3DI2B 3QUKA 3DFQA 3PFRA 3VRIB 5AYBA 3L8QA 2A7RA 4C47A 1GVEA 2AJYH 4B2DA 5B8CA 3V0AC 4DN3H 2D22A 3P40A 1NH6A 2B8OT 5FKYA 1E5YA 2CKBH 1DVJA 1KGIA 2XZZA 1TPXB 5AAWA 5CZRA 3KJ4C 3ZTEA 3QEQB 5LIXX 1HIMH 3X11A 1H3PL 1PZ5A 2ZYIA 5IMLB 2NY5H 3E2HC 5T3ZE 1RU9H 3MI2A 4NZ3A 4WFHD 3PZNA 1TVHB 5FYLH 1J1XH 1TWIA 3C4UA 2AV7B 4M7JL 4K15A 4EOWL 3E9TA 3HMXL 4DGIL 3ABQA 4X4YA 1RZIA 3G22A 3EJYC 5CLWA 4LF3B 1J48A 5E4EB 2QJGA 3V79C 5HINA 5A2KH 3LMYA 2X1PA 2XQBH 2JXMB 3FZUD 3FH8A 3RCYA 2YN3A 5LWYH 4JFEE 4LDCA 3SJNA 3RRQA 3CFEB 3BEVB 3B7SA 1OG6A 1KFBA 4ZQKB 2BBFA 4QGCA 1JYWA 3DV6B 3W7IA 1VBJA 4HWEH 2GBVA 4LP4A 5BXFA 4NKMA 3QQ0A 1V7NH 1EZVX 3EGXA 4GFTB 3RHGA 3QWRA 2F8QA 1YXCA 2N1KA 3ZL1A 1TCDA 4RGNB 1WAAE 2PW2B 2OWXA 2V82A 2FBJH 4NT0A 4P7OA 2FQGA 2A6DB 4NLAA 2VDRH 1BTMA 4HKZA 2OR2A 1XDJA 4MA3A 3UJ2A 4X83A 3VIIA 1GJIA 4V28A 1EDTA 5XIMA 3ZQXA 3UEQA 5A8GA 1GH7A 1DN0A 4MX7B 5GZOC 3QV6A 4Q0XH 3DFSA 4HPOL 5CSZB 1V7ML 5IMKA 1SY6H 4FZEL 3M0HA 3QCVL 3BIBX 1KCBA 1GY1A 5I75C 5DUBA 4JZJC 3IDIB 2WO4A 2I16A 3QJSB 3MRMB 4F8XA 1XJBA 3RYSA 3HNVL 3LXUX 1G6RL 3STZB 5FCUH 3RRAA 3CFNA 3AUVA 3D2TA 4LK4A 4HKJA 1KBBA 1Z5LA 2PURA 2G3JA 4P59L 4IIQA 1AW5A 4LY8A 3SB3A 5IFTA 4GP8B 4KIEA 3WG6A 5I3JA 1ZP4A 1MW2A 3N3TA 5D1XA 3WS6C 1RK1A 5IHWA 1YN7A 1RUKH 2ESCA 1RZ7L 1OC7A 3INUH 3RPIA 5HJGA 4L9LB 1XTLA 1MH5B 4GXPA 3FO0L 3CH1A 3CSYB 1MMFA 1QI2A 2V5KA 1KLFB 1AFSA 3EJUA 2PDIA 2M83A 1NELA 2DLFL 1S9XA 1K4HA 3UERA 3QOKA 3CWNA 5HI4C 2J3SA 4JNXA 1YEEH 1LCOA 4KWSA 2YIHA 1J8HA 4IBWA 2Z7YA 3KJ6H 4F8OA 2W62A 4U1LB 3C6SA 3NQEA 1JAKA 5DZOA 3DX7B 4AQ1A 1IEQA 1QK2A 1AANA 4HFWA 2DQHL 1NTHA 3KDPB 2DW5A 4RMBA 2IQ9L 2FGWL 3TIDA 4XAFA 3AJXA 3NYKA 4PHXA 5BQ7B 4OBRA 3XINA 1A4KA 5EIVA 1YHPA 3OMNB 4Z7OB 1AHWA 3ZWSA 3TO4A 3SDYL 1N3NB 1QI4A 5DZLA 2YRBA 1T3FA 3CX5J 1MQKL 5CD3B 2B14A 4PN6A 2QGYA 1OPGH 3FOMB 1GYWA 3FVDA 3ZE1B 1AIFB 2VKWA 2CGZA 1NMCB 2GDQA 3P9LA 4JQIL 5HNRA 4M19A 1BTCA 3ULUE 3D7PA 5HTSA 3VFMA 5C0GB 4KBPA 2DQGH 1DUZA 3GGWB 3C0QA 3GG1A 2J6EA 5DSCB 1YHTA 4ZQNA 3MMWA 1EHNA 1Y6MR 1ODUA 4S1DC 4EO5A 3R5EA 2OR7A 1DO6A 2IFFL 4U10A 3M86A 4LMQI 3VUSA 3UTSA 2P80D 2FTPA 3CQQA 4NPJA 2DQTL 2ATPB 3DJ9A 1YCSA 3APYA 4R27A 4YUEL 2HKHL 4MZRA 3FUDA 3UZEA 4F2EA 2QJIA 1KPUB 1PV8A 5GXBB 2H0PA 1JPMA 3ISWA 2PR9A 4NKCA 4N2DA 1PD0A 3WLBB 4FQXC 4XP4L 1AKJA 1VPXA 1UUOA 4G8GA 4ZA0A 5ITFB 4AM0B 4FQIH 4JDYA 2ZKHH 3AM8C 3OD3A 2RGLA 3LRSA 1N70A 4RSYA 4GSXA 2UWEA 4JG0L 2J7HA 1BEUA 3SURA 4Z7AA 1B3VA 2WMIA 1TIMA 2R4SL 2BX5A 3N2MA 1DJZA 3VKJA 1AL7A 3NACH 3QZWG 5GRVL 1CDUA 5GJTL 3L3JB 1CGTA 3WNLA 2VJ8A 4CD8A 2XWTA 4KJPD 1CT8A 3KBJA 2OSXA 1A47A 1L9OA 1USQA 3TYAA 3KBVA 5REQB 2YPVA 2HVOA 1GQKA 2F7FA 2O9OA 1WBXB 1G7HA 3PB0A 2IV9A 2NXYD 4KQ0A 4IDJL 4KEUA 5C1MB 4XNXH 4LSBA 5A8MA 1G9MH 3E1ZA 5BO1H 5HVFB 4P57B 5A6LA 2WXIA 2HH0H 1RJLB 3O3RA 3WIHH 1NCAL 3QSRA 3P0GB 2E4FA 1MOEA 3D05A 5F7LB 4W8AA 4UZSA 4WO4C 1NAMB 5F2IA 1P0KA 3CFMA 3MFFB 5TE6H 4JM0A 7REQB 3SGJC 1V7AA 4LASL 4ERSL 2NLIA 4Y19E 3W7QA 3X11B 3TA3A 4KHXH 1PZ5B 3KW3A 3RDTA 4TRPL 4ELMF 3N13A 3ARGD 4J3TA 2EDDA 2Y62A 1UKQA 1XFPA 1BZQK 5EUKA 4X4YB 4WFEE 1SYVB 1EAJA 4KKZA 4L3AA 4W9TA 1JWMB 2MCPH 1XI3A 3S2LA 1FVEA 5AKQA 3PIQB 4PJFA 4Y4KC 3RVTD 2EECA 2QJNA 2YRPA 1XF1A 2XGIA 3ZKMC 3LZFL 2E8ZA 4JKNA 5CILL 5EMJA 4EVNA 1NC2D 3V4VA 4YTSA 4PE8A 3PL6B 1H7WA 4GMSL 2WZIA 4KAQL 1I4NA 1F07A 1MCKA 1YEFL 4TSBL 3AZRA 5BXFB 4OCNC 5K4XA 4F80A 4J39A 2D7PA 2ZAGA 4X9SA 4MWFB 4JG9A 1P5VA 4IU2A 1J1PL 4LCCA 3IBOA 4K3EH 3OF6D 3Q5OA 1MEWA 1KFGA 1IAKA 1K6QL 3MV9B 3T3PE 4MHBA 4LSSH 1A9BA 1KYOJ 1J79A 3PJLA 4C1NA 5M3WA 1QVBA 4MA3B 2YMXH 5IJKC 4G2DA 4Y16C 4I3RL 2WWNA 5AVQB 2ADGA 4LV4A 3FDWA 3EO0A 5IMKB 3HR5B 1ZEAH 1WCBB 4XPTL 3GBNH 2V30A 4U6HA 5HYJE 3MBXL 5DUBB 2DLEA 5MENE 4BWTA 3MRKA 2EE6A 5KOMC 1F6PA 4J3OD 3SYQA 1I7ZA 3KXQA 2C9XA 3TBVA 1V6XA 2XU9A 2QDVA 1LP9E 2FMOA 3CCHA 4P2RE 4WI3A 4UDUA 3T0DA 4XZNX 3QRGL 1JBJA 8FABB 4PPTA 3VB8A 3QMTA 3PJNA 3VZYA 2R1YB 3RPIB 2H6PA 4Z7VA 3LB6D 5T3XL 1PVHA 3RTQC 3SKOA 1QP1A 3CH1B 5DFWH 2OCZA 3QHFL 2HP4A 2B0SL 4L9DA 3T4WA 3BKCL 3C6LA 4S3GA 4HLJA 1VEOA 5A6JA 3NGFA 3ZZ1A 4M82A 1RPUA 3ITXA 3EYFA 4G6MH 4GBXC 4GRMB 1MEIA 4IGSA 7PAZA 3PAVA 4JAMA 2EVJA 5I28A 1VHCA 4N8CL 4MADA 1Y0LB 2DQUH 1BVNT 1GYUA 1CBJA 2DZTA 4B16A 2IG2L 2AVFA 4GUCA 4C6FA 5ETUA 4N68A 5A6BA 5HBFA 1E7VA 1CF8L 3VDGA 3ECBA 1UWEL 1CLKA 2XY1A 5F2LA 2V2HA 2LE9A 4DP0X 2OBGA 5J5RA 3MBDA 2VD8A 4N2NA 5D71L 4PWFA 4Y9FA 1T3FB 4XO5A 4P5KA 3B4YA 1ADQA 3KPQA 1IFGA 3B2VH 2Z9TA 1UCTA 4JUSA 2EIBA 4CNTA 1O9ZA 3CXHK 4J5NA 3JQOB 3VQ1C 3P9LB 5KUMA 1AO7E 5FAAA 4B4HA 4E2OA 2YARA 1F3EA 4GT7A 1OGTA 4UTWC 1JGEA 4HPGA 4H8PA 3STLA 1UA6H 3DX9A 1MHCB 3S42A 1FLTX 3S34L 1UP3A 1OJXA 2X1SA 3WL9A 1DYSA 2ENSA 3PAYA 3MWCA 1XFBA 4HUKB 5KVEE 2XX0A 3CUIA 5JIIA 5G2WA 3LEVH 4DGYL 4GVIA 5DMKA 5LDSA 5GSRA 3RWGB 5CBIA 5DJAB 4BHUA 4I7VA 4YDLC 2GGGA 2E27L 2QV2A 4NKOA 1QFUH 3TN6A 4N90E 1ZIAA 4QQUA 5IB1A 4ODSH 3F84A 3BWAA 1T1WA 4KKPA 3QE5A 1TETL 3NCJL 4PG9B 1EPFA 4Z18A 3QF0A 4O02A 4F9LC 5CSBA 1O1ZA 1OT1A 9PCYA 3ECVA 2EGZA 1O12A 4XR8C 3CFKA 4LANA 3Q8EA 2PP0A 4MDJA 3GZKA 3KRSA 3N1FC 3GVRA 2IUZA 1R3SA 1MJUH 4KCVA 1I7RA 4KJQC 1W6LA 1QK0A 3GJFA 2XWTB 3LN3A 2V4LA 5D1ZA 5E1IA 1CT8B 1LQAA 3OVRA 2IEPA 5SX5K 1MCOL 1E9QA 2WSYA 2GK2A 4W9HC 3HURA 3M0IA 4AIXA 1AQKH 2AQ2A 4DNLA 3UPRA 4PJ8A 4OZFB 4TVCA 4NY2A 4ZMXA 5ADPH 3VMNA 2HRGA 1DVSA 1DJHA 3G1VA 1NP0A 2XYBA 1ZGLA 5CGTA 4XN9A 2JBMA 1I45A 3NG3A 1GCFA 1YA5A 1GORA 2JJWA 2X9YA 2R2HA 4BDVB 25C8H 5KBKA 2NCMA 5I16B 3R0UA 3N17A 5CC6A 3IS1X 4AG0A 1SO5A 2TSAA 1VIWA 3WD0A 4UZUA 3RDTB 3KL0A 1KFWA 3IDMB 2H3XC 3TF4A 1WFMA 4M43H 5CGMA 1GW0A 1JVKA 3FFCD 2WNXA 4MIMA 3AQZA 3UBXG 2J8UF 3KLLA 4HHLA 5IQ9A 1LG2A 4A7GF 4DZHA 1ECZA 3P74A 2DM2A 4NI8A 4R3SA 4AV4A 4HUMB 4JR9L 1FVEB 1KJMB 3CX2A 5D05A 4MGGA 2YL9A 3BAIA 3O07A 1W3IA 3OU8A 4GJTB 1K72A 4OW6A 1LG1A 3L4YA 5D7JA 4HC1H 4HCIA 2VABB 2G3IA 3L3OA 3ERPA 1S9KC 1FFOB 2CR0A 1TPFA 4I1NB 2IH1A 4R90L 3GTHA 4ABWA 5AVVB 4AGMA 3MLRL 3GMPA 2O5YL 4FFVC 4X7TA 2VWTA 3ULUD 2HK1A 4R9XA 3B2MA 4BFIB 4YGVB 2Q8ZA 4LCCB 2EHHA 2BVQA 4QCIA 3TVMD 1IAKB 4TNVF 5HHXL 1N8WA 4QXIA 4XI5C 1U1HA 5JLZB 3SCQA 1NCGA 3UF9A 2WHVA 2VO8A 4YL2A 1WWAX 4XZBA 1N2VA 4RA0C 3U5YA 2VDGA 3BX7C 1M01A 5DR5H 5HR6A 2VDPB 3EYQC 2ADGB 1UM5H 1SHSA 5L7XH 4JICA 4NJ9H 3II3A 4ONGH 3EO0B 1Q4WA 2EPMX 1SEQL 2W8CA 5DQDH 3GIVA 4H8WC 1G4TA 2FJKA 5B38G 2IKIA 2QV5A 1NUGA 1WA1X 1FSKC 4YE4H 4DPCX 2BMKA 1I7ZB 5C2GA 1A7OL 3FRUA 3VXSE 1FL5A 5L8KB 4B5VA 4M03A 1T6MA 1WA0X 1Q66A 4J2QA 4ADUA 3CCHB 4FLQA 2O6FA 3W7NA 3UXDA 2IJ0C 2Y24A 3UROR 1QD0A 1ZDSA 2CO6B 4UDUB 4IGBD 4NG3A 2ZX5A 5BV7C 1EZLA 4ODTL 4ZEPA 1P7TB 3V5OA 3I6KA 2FWOA 3QZWA 3NZUA 3PHQA 1EANA 5ESQA 1EL3A 1Q72H 2QGDA 4N0YH 4Q8UA 1IGIH 4Z7VB 2X42A 3STCA 2OJEB 2QQ6A 2YL6A 1SPDA 1NCHA 2R82A 3QORB 1ISWA 4NKIH 4ZI8A 3QUXC 3VYPA 1Z2KA 3RCMA 3AI0A 1XGDA 4JFYB 5HHOD 4WKZA 5CP7B 4ZMZA 4L5FH 1LWIA 5GSVA 4JAMB 4MQ7B 2GJZA 4JN1L 1FCUA 4Z0JA 1F61A 2WSPA 2KZHA 1QFWL 4PTVA 5H94B 3EOAA 1S7SA 4OZIE 1O0VA 5A3HA 1U4EA 5EMMA 2A83B 1XIWD 2L7UA 2J6EL 3P0VL 4LUSA 2ISVA 3T3MF 5ETUB 3EKCA 2VWEC 4GNKB 4YDNA 2YPLD 2P3YA 1W1YA 3FSTA 4F7EA 1EWHA 3VFNB 1XZWA 3ECBB 3WQOA 3AXLA 4JY4B 3W0WB 2XWJA 5IROC 3DX6A 5LCVH 5CPTA 3T0EE 4V11A 3W2KA 1RV6X 5D5MA 3DSFH 3AB0B 4N9DA 4P5KB 2R9HC 1T80A 5EOTA 2CYGA 4KU1A 1FCCA 4YZFF 3UCQA 4K0OA 1UJ3B 3L5MA 5IKCB 4N2CA 4OQVA 1HQRB 1OIFA 3OR6B 4OJCA 5SWZB 1DP0A 4FQHB 1KCLA 1OGTB 4LF1A 1B0RB 2PE4A 1IQDA 5KVGL 5GGQH 1JGEB 4RISL 3LKRA 3RL1A 2OMWA 3FQXB 5LA0A 1H0GA 5JIMA 3TZVB 3DX9B 3V5HB 4GPVA 3ZHNA 3VXUE 3ELAT 1X8CA 3WL9B 5AHNA 2BZCA 5E6IA 4UBDD 1ZLSL 4Q6YA 1MCCA 5GSRB 1MRFH 3TPKA 2HRWA 3MPGA 5I1LA 1FIGL 4OD3L 1JWSB 3KLHC 4IPPA 1NDYA 3AS0A 4G6FB 3COTA 5IUCA 2EO7A 1F86A 1IIGA 4Z7IA 5LSMA 1FFQA 1NCWH 1N67A 3W1RA 4NKOB 4L6DA 1A65A 1AGBA 3TX9A 1TJPA 3IDGB 1CI3M 2P7TB 5E4EC 3RPMA 4AVIA 3D39D 1OAKL 3FQNA 2A85A 1YEKL 3S6DA 1U8JA 2G60H 4XMPH 2NTFA 4IMFA 1KDIA 2YPVL 3IIVA 3ZSSA 4OCXH 3S7GA 4P8VA 5D7SL 1E6ZA 4PJAA 4H19A 3RPTA 3KTCA 1LUCA 1VFLA 4G5ZH 3WEMA 1X5HA 4MDJB 2DF3A 4DF9A 4YSPA 4AZCB 1X1OA 2L3BA 1SJDA 2BRRH 2JCCA 3BQUC 5F1UA 4XZWA 3GSQB 4PJCF 4RBPH 5HYJD 4IH3A 5GRXG 3GJFB 1A7RL 5D1ZB 2FSDA 3NL5A 4O2EA 3RVUD 2DT3A 3AIEA 1E9QB 1L6WA 2BSDA 1JZ7A 5IEKB 4OVVA 2VLJB 3SCSA 1KYDA 3VXMA 1W9DM 2ITCA 4C4BA 5KSAA 2KDGA 3O81A 1U9KA 4M9OA 1G4EA 2YLHA 3N6YA 4AEHH 2QUMA 2IS7A 3ZDZF 2V0AA 1ZGLB 4AWTA 3KCJA 4HH8A 1A9EB 3VI3A 4PTNA 1PG7X 2VC5A 5FO7A 1Y1UA 4BFNA 5CINH 1U2CA 3AZSA 2P5EE 3BCDA 4QHMB 4K38A 2OWCA 5GGVY 3P81A 4G70B 3V4VL 3A3XA 2R1NA 5TE4L 3PUCA 1C90A 3OAZK 2NX5E 1UROA 2VEGA 2OQJB 4HGMA 5FJIA 3AQDA 2XM2A 3W1TA 1J18A 4LQFL 4YBHA 3V7MA 1IEAA 3M7OA 1U30A 5KG9B 3MLPA 5LO7A 3EADA 1B57A 2C79A 1A1MA 4XAPA 3RJDA 2UVFA 2WLIA 4R3SB 2FHCA 1FHVA 5EORH 3V4UH 2HWZL 3SDXE 1V55B 3PP4L 4IJTA 3CZUB 1CEOA 1VYPX 5D7JB 2VDPL 3ZJ8A 1IHIA 5CZVH 3L3OB 2W94A 1ROCA 1OWRM 2EEFA 2IH1B 4R0LC 3TFBA 1HVXA 1WISA 4IPIA 3KTXA 1RV8A 1E9OB 5HATA 3S35X 4AEFA 4JZOA 3GMPB 3CZEA 5DJCA 4X7TB 3BISA 2LABA 2D2JA 3QFJA 4HPJA 4ZOBA 3BHBA 1OTUC 2RIKA 2WTRA 2KLRA 2BVQB 4IQJA 4MAUH 1L0QA 2CJUL 3VKAA 3F58H 1E8WA 4J9JA 3H3PL 3G1RA 2BS9A 2BJMH 3NABH 2LW3A 4PP2A 3TYGL 3PGDB 1HEZA 2DIEA 3ABRA 1M4KA 2FX9H 5C5YA 2VDNL 1X5XA 5HHMB 1ACYL 3CC5B 1TSIA 1AZ1A 2JI1A 1XLKA 3B83A 3GIVB 5E99L 1VERA 4NFBA 3U7AA 4QJ4B 3QY6A 2NPLX 4Q8NA 2Z1KA 3DERA 3HBPA 3IJ8A 3EGDA 4GRWF 3G5ZB 3D2UB 4KROD 1V6TA 2BMKB 1I2NA 2TSBA 5GRJL 1EBAA 2O4EA 2W0PA 3FRUB 1Q6LA 1FL5B 2OMXA 2E6QA 3VUPA 5AVYB 3CM4A 1TCRA 2FX8L 1MLBA 1HE8A 4QHNA 4G42A 2AV1A 1XPGA 1ZTXL 3BJ91 3PBUA 2WQWA 5F1VA 3RVXD 2EXYD 3B9EA 4BCYA 2VSCA 4KGLA 2HXTA 2FO1A 1G01A 3UACA 2BCKA 1EJOL 2Y4SA 2D2HA 4JBRA 3L9EA 5DVLA 3QZWB 1KIPA 5ESQB 1AQMA 3WD3A 3UP6A 1BXBA 4NQEE 4K23L 2XKNA 4HOZA 2H2PD 1BVKA 4UV4L 1CBGA 3S96A 2IC2A 4HDIA 2V8MA 5C6TH 5DUMH 4N0CD 4IHCA 4D9RE 1JCJA 1HINL 4IBSA 3ZT7A 1DFXA 2VR5A 4WKZB 1O6TA 3WQFA 1BIIA 3OTTA 1ADQL 5E7FA 4NAJA 4LPVA 5EU5B 3HNTH 2PWFA 1GYCA 3EOEA 3ZKNC 2DQIL 5EFDA 1JRCA 4D8PB 5JW4R 4XO6A 3BK0A 4G6KL 3EOAB 1S7SB 3WIIH 1LEIA 3N9RA 1QHZA 4UU9B 1VRDA 1Z44A 3OIXA 4LUSB 3LIZH 3DOIA 4HEPG 4OD2A 5B3NA 4F7EB 4QTFA 5EU3A 2M1KA 2XWJB 5F93C 3DX6B 3FFSA 1H49A 1QBLL 4I0PA 1JNLH 4HCRH 3CAFA 2Q9OA 1ZV2A 1IJNA 4U1NB 4DAGL 3FQ1A 4ZS6D 2XWXA 3GW0A 3UBXA 2WLNA 4EAYA 3VRLF 2ZUQB 2C0AA 3V9EA 3NJ3A 1RPXA 4UQ3B 5JUEL 4M7LT 1IGYB 1OQXA 5K9KA 1OWQA 5FECB 3RL1B 2BM3A 1QOXA 3NQBA 1VGKA 1TV5A 3MJYA 3I9GL 4ZO8A 2V2XA 3TW7A 1KCUL 5GZND 2F7PA 3MLSL 4O02L 3UCDA 4XNAA 1KCKA 2OS7A 1W5MA 3RI5F 3TC9A 4FF5A 3P67A 4WY0A 4JS3A 3C5ZB 5EZOH 4Z1PA 2BXZA 4QF1A 3BUBA 3E0GA 3L9RB 1KV7A 3RVWD 4O4VA 3RAOA 3WN5A 5AHEA 1S9VA 2F08A 2XTLA 4O11A 1F3DH 4XMXA 1HJQA 1Q94B 1BVWA 3R0MA 2O55A 3BQ6A 2Q7YA 2CO3A 3RWHB 4MCNA 2CWXA 4HMDA 2FX7L 3VNZA 5DEZA 1W1B1 4HIBA 1A3LH 2BB0A 3T5WA 4P2OA 3LERA 5HDBE 3VOIA 2ZRZA 3AWGA 1KGUA 4PJDB 1T66D 1LUCB 1DBBH 2YXOA 3PL6C 2KZWA 5IRPA 2Y8UA 4HBQA 5AAMC 1LE5A 4Z1YA 3KPOA 3UTTA 3D47A 2JCCB 5B38A 1KY6A 4GUOA 5C0IA 3O4LD 3E6EA 1SDDA 5EHFA 3CUFA 2PO6A 1F58L 1QQDA 3IU4L 3CNYA 1CW2A 1Z9LA 3HF3A 1FPTH 3K0YA 1G7PB 3F04A 1F3DJ 1A4BA 4YZWA 4NM4H 1S5HA 5KSAB 5SWUA 1X5FA 3K1DA 4IIFA 5IBXA 1P9MC 3QS3A 5T33H 3X17A 1XF3B 5C07E 3ABKB 1IMHC 2HRPH 1YYMH 2BK8A 3CZJA 4YXLH 3LU2A 4CNOA 1E72M 5SX4I 2VCOA 2IPWA 3VI3B 3TWYA 3GTNA 1L9TA 4K8EA 3IVTA 4L9ZA 4RWHA 5GS0H 4LHJB 4EKJA 4IRJC 5JHLH 4KVNL 2HNEA 4GYKA 4P99A 4GQBA 2A9CA 1SZFA 1NY1A 2VXSH 1AXSA 5H4YA 3L66A 1SOQA 5DMLA 4JQVC 5BUAA 5IBUG 4A55A 5FW8A 1BG9A 1SN5A 1S2WA 3HHRB 1W5NA 1E7UA 3VFTB 4DRSA 1F4YL 3BXWA 3IV8A 2G8ZA 1G6RB 2BP8A 3FU0A 1IM9D 1TJHH 5I6NA 4N1EA 2XH0A 1VAHA 1DQTA 3T0ED 1WQ5A 3SBWA 4N4PA 2JIXB 4MLIA 1JUEA 2FWLB 4QDPA 4L6OA 4AD2A 4E9WA 1OCCB 1P7QD 4UMGA 1V3MA 4JZOB 5DJCB 3QN3A 2YD9A 1VPYA 3QIUB 3PCYA 2JJSC 4PCYA 3QFJB 1DBAL 4AG4H 2WQVA 3WXVL 5DO8A 4TV5A 3L2NA 2Z93A 4ANVA 2WTRB 4YHLL 3QCUL 3R11A 1QNSA 1FL3B 2V2CA 1LQSR 1LXMA 4GI6A 3DPDA 4U1MA 3VOCA 4PP2B 5FFOA 4PY8I 2UVEA 4PB9H 2TMDA 2VERA 1H1NA 3UG3A 2JK5A 4JJ5A 4WDUA 1TKWB 3KNBA 4PLNC 1RQEA 5E6UB 2X10A 2VHLA 2E56A 4UB9A 2GGHA 4D6FA 4I9WD 3O2WH 4H6RA 2XN9E 2CNCA 2ZJSH 1SYTA 3ARDD 4KK6D 3NCEB 3GJEA 1MAKA 1JFHA 4RMRA 3HU7A 1TCRB 1MLBB 3O63A 5MHBA 4G42B 2R0KL 2AV1B 1XL4A 3BV4A 3QIBA 5F1SA 2PDYA 1NFAA 3GXUB 4M80A 3N04A 1BF6A 3CHOA 3ZL2A 1S2VA 5A8NA 3QI9C 5IREA 3GSNA 4IOFC 5LA1A 2Y6SD 2WNWA 3ZYZA 2ETWA 1QR4A 1KIPB 4LJ3A 3OXRA 1FAKT 3BKYH 4S1QH 4GS7B 3FN9A 3K0WA 2XKNB 1BVKB 3S96B 3P0WA 4HDIB 4XOBA 4PLOB 4CADA 2IANE 2MNUA 4CNIA 3SDCB 5HI3D 1QFOA 3LCLA 5GS0D 2RQEA 2WM0A 4ZE5A 1LO5B 1IXNA 4NP4H 1EFXD 3THQA 4IRSD 3C5QA 1GZHC 1NVMA 4XVUC 2PDWA 2WJEA 4M6NH 1PZDA 3F1QA 2VZ3A 2G5UA 2L7QA 3L4XA 2WBJA 4YTQA 4UQ2B 3F85A 4FJZA 3N6QA 5DMNA 2E77A 4JFZL 2W60A 1CG9A 2CRIA 1IKFH 3A3YB 4OD2B 4JFPA 1AK5A 5HHQB 1XKJA 1GW9A 4PJBE 2W61A 5LXVA 3S83A 4QRRB 3V8CA 2P5ED 4I0PB 2DYSB 3FYOA 2YFOA 4W8LA 2K78A 2QLYA 1BXNA 2R0ZH 1XGYH 1PDKA 5EYWA 5IM7B 2BY3A 3PWIA 3LKPB 4A7UA 3WLMA 1G0CA 2EYTA 3VFVA 4B5SA 5K9KB 4LSRL 4XAYA 1VGKB 4QXTB 4Y4FA 4N0FA 3JUGA 5EMLA 2V2XB 3F7PC 5F88A 1DL7H 1TLMA 1N0XL 2JTYA 3QUZD 3DFOA 3RR4A 2HT4D 1S2EA 3GIZL 1WZKA 4IHOA 1VSCA 5L88L 3VW3L 3S9DB 4QF1B 2PB1A 3T4AA 4XCNB 4H8NA 3PWVB 4A63A 2NR6A 4G9FE 5AHLA 4NZTH 3WN5B 2EUZA 2J88H 3CVIH 1TCMA 3PV6B 4WU7A 1ZSHA 1LDPL 2WW8A 2LV4A 3AREC 3ZFHA 4J3BA 3I4KA 2DT2A 4XBPB 3RAJL 4M24A 2B1AL 2FDSA 2AERT 4YIQB 8CGTA 4LKCA 3B3BA 4MD5A 3PBWA 3H70A 3K71A 3WMLA 1DBJH 3AG3B 4OLZH 3W1MA 3MNWB 2V9TA 3U6RA 4AQZA 3W26A 5IQOA 2QPUA 4HZ8A 3GFXA 1AMKA 5ALCL 2V5TA 3E74A 4FQLL 2QHAA 3SE3C 3BDYH 3T2QA 3BGMA 2GIXA 3QDMD 5C0IB 1E4KC 4MVAA 2I9TB 3U9IA 3QHZL 3E0VA 1AMYA 3BT2L 3NQAA 5D33A 2EDEA 1QQDB 4PMZA 3QDJB 1R46A 1PS9A 3QGAC 2FHFA 1MRCL 3KXFE 3CVCA 2ZCKH 3TJ4A 3M6DA 2NW2A 1PYWA 2ICEB 1LO0H 1WEJH 4QDMA 7PTDA 3MRJA 2ZOUA 3W7MA 4JUTA 3BW9A 5LYRA 3VSVA 1OAYH 3L0NA 3FN3A 2BP3A 4RIRA 3E49A 3L7RA 2AJVL 5HJYA 1PL9A 3QRHA 1E4LA 3ILPB 4FABH 1GEHA 5IHSA 4YVPA 5J13B 1AHMA 4ZZFA 5F9OL 3SE4C 2Y88A 2JKJA 3NO3A 1RZKC 4L8DB 4PMVA 2OI9C 3GG7A 4DQOL 1X7IA 1E4JA 3O6FD 1KBGL 1CURA 5KS9B 3DI3B 1AXTL 2F5BL 2Q6ZA 1AFVH 2IVFC 4HEPA 1NC4D 4G80B 3DLQR 3PWPB 1N6QL 5KBLA 1WTGT 4J23A 5EMKA 1FNSL 2EJAA 5H4ZA 2DBLH 5CJQL 1CFTA 4P46A 4XPHH 1HE7A 5KJRH 4GW4A 4KO6A 2NY2B 1FNLA 4LUTA 4PY7A 1RULH 2C7UA 1BHGA 4GUJA 1WUEA 1QNVA 3IWUA 3F7VA 4PJ7B 5D9NA 5E70A 3UQNA 4K5NA 5IF0A 3H2FA 4NI3A 5I8KH 5E5UB 4W7UA 4IMKA 2POZA 2Z93B 2GQ3A 1X5JA 1BAGA 1NDZA 5CIPA 4N2LA 4TULL 4NZDA 3L4UA 5AL0A 1RLCL 4U1MB 2VYRE 1PD1A 3MDWA 4C1LA 1F8TH 3AB0C 3WTUA 1PZAA 4J8RB 4JJ5B 2NSXA 3GZ3A 3W24A 1ZHBB 4PRPE 2RCSH 3FCGA 2WXKA 4Y2DB 3STBA 1DJQA 2B9AA 4PCPA 4A6YA 1N8IA 3WLQA 5FCZA 2OKTA 5AB3A 1ORQB 3DG3A 4HYVA 2AXWA 4KY2A 4LRIC 5FYKL 2OFQA 1MG3C 4U0QB 1HDMA 4LLUA 4PJIF 4Z0BH 4E6MA 4ANUA 4BWUA 1TJIL 4BUQA 2CU9A 1JNNL 1NCCH 3TZVC 3U46A 1G9NL 3I6LE 2K8QA 1MO0A 1OOAA 5H2BA 3QIBB 3P8JA 1T89C 3GZOA 2GSJA 4B53A 3K8LA 3HGJA 5EBAA 3GXPA 3BO8A 2OK0H 1PYFA 3TEZA 1KTJA 4Z1BA 3EOTL 2JLPA 3UD6A 3STPA 2X6VA 2FJFA 1K1DA 1CX9A 5JH2A 4UTIA 3GZQA 5JOPE 5HAOA 4G1EA 1UWXK 3GSUA 4KI1A 4CADB 3CZFA 3RQ3A 4W4OA 1NZRA 2E75C 1RY8A 1K6AA 4ZUUA 4D0BB 4I2XB 4CL7A 2E5BA 1FV1B 1OF0A 3DBSA 4LS2A 3IS4A 4IOIA 5KZDA 4AJYV 1IIHA 1A14L 2QR0A 3VXRA 1UXSA 1QSFE 1OHQA 5ID1A 4L6HA 3LDBB 4NAMA 3WQ4A 5D38A 2CLHA 2KKQA 4G7VL 1ZKAA 5HYEA 5AW8B 4RDWA 2H0FA