4NZFA

Crystal structure of abp-d197a (a gh27-b-l-arabinopyranosidase from geobacillus stearothermophilus), in complex with arabinose
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
431
structure length
431
Chain Sequence
ASMHHYQWAKTPPMGWNSWDCYGASVTEDEVKGNAEYMAKYLKPFGWEYVVVDIQWYEPGANSSIYRPFVPLEMDEYSRLMPAVNRFPSAKGGKGFKPLADYIHNLGLKFGIHIMRGIPRQAVHQNTPILGTNVGARDIADTNSICPWNTDMYGVDHRKEGAQAYYDSLFQLYAQWGVDFVKVADIVASKLYGTHTEEIKMIRKAIDRCGRPIVLSLSPGPAPLDHATLFVENANMWRMTDDFWDRWELLYDMFEQCYKWCKLVGLGHWPDADMLPLGHIGIRSVDGGGTDRMTRFTKDEQRTMMTLWIIFRSPLMFGGELRDNDEWTLSLLTNEEVLHVHQNGYGARQVYRENDHVVWTSQDAEGNQFVAMFNISEKRSVVSVSLKDLGCMEPMKARDLWAKEDLGLVKHQLAFELGPHQSILVKLSPAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Abp, a GH27 beta-L-arabinopyranosidase
publication title Structure-specificity relationships in Abp, a GH27 beta-L-arabinopyranosidase from Geobacillus stearothermophilus T6
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 147
structure length 431
sequence length 431
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4nzfA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4nzfA01
1WOAA 3W86A 3BG5A 3NQVA 2Y89A 2B7NA 1P0KA 3EDFA 2V0TA 3R5EA 3TR2A 5HNRA 5DCBA 4RX0A 2WOQA 4RR4A 1HTYA 1NOFA 2C16A 2VR5A 2D3LA 3EJQA 3W1RA 4XTIA 5D32A 3NM1A 6TAAA 5CGTA 4JDYA 3BVJA 3UWUA 3H54A 5HMSA 2HS6A 2ZX5A 4NI3A 3QJAA 5F4XA 2FIQA 1H7OA 3N73A 3BPWA 3CZKA 1H63A 3W84A 3DU0A 5FF7A 1TPVA 4O8RA 4CVWA 2EKCA 2ZFAA 1WAUA 1KM4A 4O1BA 2X30A 1IV8A 1L6SA 2V9DA 5ABTA 1QR7A 4LS2A 3S1UA 1CGTA 2WSQA 3W3OA 3BV4A 1CXFA 4FNQA 5CGMA 2BLEA 4PFMA 4AHQA 4TMCA 4AYSA 4JYFA 2VC6A 3W75A 3K1DA 3N34A 2E6FA 1HWWA 3WEOA 2RFGA 1FCVA 4FLOA 1LOQA 4TR9A 3BUDA 1SFJA 1XSIA 1P4CA 3BW4A 3W7IA 2BHZA 2NT0A 2A5HA 1V7YA 2ZZ3A 3D51A 2ALWA 1ONRA 2C15A 4UTUA 2ZIDA 3IIOA 4JTIA 1W54A 4Z08A 1PZ2A 3WENA 3MBFA 3B0VC 4IMFA 1KTBA 1K7FA 2ZZ4A 3KAOA 5AHFA 1A47A 3PM6A 1Z48A 2RHGA 4O4VA 3P60A 2GJNA 4QQ3A 2FHFA 4ONVA 1WV2A 5AHMA 4UFJA 1DOSA 4M6QA 2LLEA 2VRKA 2ZRVA 3BARA 2C3ZA 1R2TA 3UPWA 4O19A 4J9JA 4HIBA 4J3SA 4Z1BA 1AL7A 5AB3A 4AW7A 4JR5A 2QDGA 1TTIA 3BC9A 2XN2A 4Z1DA 4H6KA 1JJKA 1JULA 4X9YA 2YZRA 1VPXA 1D7FA 1S5TA 4UMBA 1GOXA 4J3XA 3L4WA 4MVAA 4IMDA 4AAJA 1UD2A 3FYOA 2V3FA 3W23A 3LXAA 4Q33A 3IIXA 3GIYA 1E40A 3TOPA 2VKZG 1RPKA 1M7PA 4A2SA 5D05A 1ZY9A 3W7JA 1K8XA 1JI1A 1TQXA 4FIRA 5CZTA 4ZQPA 1G67A 3MJYA 3BVTA 3SIZA 1W5OA 1ZNNA 4Z1CA 2EAEA 4U28A 1V3KA 5D2TA 3TFCA 4GBUA 2F2HA 1NVMA 4N9DA 1B2YA 4AYGA 3FLUA 3FKRA 3FJLA 1WXJA 2GQAA 2CLKA 2EPHA 3CU2A 3W9ZA 4WX2A 2QPSA 2X2JA 1W9XA 2FLIA 4O14A 2ZBTA 4IX2A 4O17A 5AHIA 2PWGA 3L68A 4LV9A 1T8XA 3Q58A 4M6VA 4QISA 4MFDA 1UKQA 3QM3A 3S1VA 3LCGA 1WZMA 4GUFA 3P8JA 3M5YA 2CLIA 3ZT6A 2Q3RA 2FYVA 1G9HA 5AN7A 3ZS4A 1QOPA 3CT7A 4U33A 3VX0A 1BWKA 3D4YA 1JUBA 4UNKA 4O53A 5MHBA 1DKWA 3NPUA 1TQJA 4WSJA 1DJQA 2IQTA 5DLCA 4OV4A 4OKDA 5A2CA 1N7KA 4IOTA 3V1PA 2EQDA 3VO0A 3L4TA 1K02A 2CLOA 2X2IA 3OLGA 3P74A 3ATYA 4NJKA 5T26A 3W7DA 2QF7A 2VFIA 2QCNA 3MO7A 4FX7A 2NXGA 3S42A 2EEXA 3G0XA 2V5BA 1M7XA 1F7BA 4J7RA 3E12A 3LM7A 5CGQA 2Z0IA 5EBUA 4JGDA 4UTTA 1X1OA 3NPVA 1CYGA 4UQ9A 1S46A 4HT3A 5D02A 3NA8A 3GZ3A 5CSSA 2YR1A 2PCQA 2D3NA 1QPNA 3KFTA 3PBVA 3DDFA 2X2GA 5FF0A 7CGTA 3C2OA 3PG8A 4A22A 1WZKA 2WNQA 4LTSA 5HPOA 1Q6RA 3N2XA 1VYSX 2TRSA 4PCFA 3EDKA 3VFLA 2B7PA 3GDRA 1Z32X 2H90A 3PG9A 1JUKA 1YLVA 3UY7A 2BXVA 1M6JA 4JTKA 1EWEA 3Q2DA 1R46A 3BUPA 3N3MA 1C9DA 1S5WA 3KWXA 4UOZA 3NL3A 4LXFA 2AGKA 1FX6A 2BTMA 1BG9A 4E2DA 3E49A 3W71A 1WZLA 3LPOA 3THAA 1VJIA 3MBDA 1PPIA 5AYZA 3W2LA 3MHGA 4DEFA 3F1QA 1OFPA 3AXIA 2ZQ0A 1EX5A 2VEKA 1TIMA 2AMGA 2OX1A 2OYMA 2A21A 1W37A 1LWHA 1QO5A 3GXIA 5HQEA 1SU5A 1CXKA 4JCLA 4M19A 3TQKA 2QUVA 1WBJA 2FPTA 4NJJA 3CZLA 3PUOA 2ZZ7A 1OJXA 4QSHA 1JCYA 4GE8A 3W7HA 1FBAA 3VGHA 3M1ZA 4G1KA 4GXMA 3GXDA 1KM0A 1UD3A 2D0GA 1LBMA 1QW9A 2A7RA 1EA0A 2UV8G 4WF7A 1SMDA 1EP3A 1TV5A 1CPUA 1K7XA 1JR1A 5C6MA 3HPXA 4BFAA 2E68A 3LCXA 2QCFA 4LV4A 3NZRA 4U3CA 1EO7A 2FPVA 2QLYA 4K7YA 1VFOA 4FB7A 5AYYA 2ATSA 3BGJA 1EP1A 1ODUA 5CPMA 4FNTA 1FWSA 1KBIA 5G4EA 2ALDA 2QEZA 4Y9AA 4AIOA 2WKJA 2JKAA 3W1TA 2WVUA 3VGDA 1CIUA 1OYAA 1JXJA 4UTWA 2H8ZA 1YDOA 1QWNA 5D38A 3WJSA 2PWDA 2QJIA 1KBKA 4JTEA 1UH3A 1RQHA 3UWZA 4PL2A 2CLHA 2XFWA 3HMJG 1GVFA 4LVAA 3QRHA 1SPQA 1QAPA 5I3KA 3FA5A 4MY8A 4XB3A 3GXPA 3VMOA 2QCGA 4RKAA 2JGQA 1T0OA 2GQ8A 3HG5A 5F7UA 4AHOA 3KRSA 2E77A 3G22A 3F4NA 4QNWA 1MO0A 3W70A 1Z44A 3KLLA 2W0UA 1XD0A 4DO4A 2OMAA 3L4ZA 2X1SA 2RDTA 4KMQA 1HL8A 4QIUA 3TA6A 4K38A 4JS3A 4MJMA 1RZMA 1DQXA 4JNMA 4DBDA 5I3JA 4LRSA 1VS1A 3LCLA 2ZXDA 1TPB1 2YPIA 2F7OA 2BY3A 2ZZ2A 3QMTA 3O06A 3EJPA 4CCDA 4N4QA 2Q8LA 4GI9A 2YGYA 3B04A 3TX9A 1KV5A 4Y8FA 1LORA 3NPWA 3WJWA 4HN4A 3ATZA 2VFDA 3MHFA 3W88A 1FXQA 2YXGA 2CU0A 3CZEA 3MWAA 4H4IA 1KCKA 3N9SA 3TUUA 4DO5A 4O18A 3W85A 2DZWA 4NVTA 1F2JA 4J3VA 3L2IA 4B5NA 1RP9A 1Y0EA 3W1XA 4DQWA 4JCMA 2WPGA 2ZUVA 1KV8A 2QCDB 1XD1A 3HGJA 3O15A 1GYNA 3NG3A 3SGUA 2OJPA 1AK5A 3NQGA 3FS2A 2VENA 5CZJA 5DBUA 3LERA 3D50A 4CNOA 3EEGA 1SW3A 3LHUA 1OT1A 3CB8A 1BVZA 1RVGA 1Y7VA 3JS3A 1MXDA 1TMHA 3E0IA 1SZFA 2Y24A 4UZUA 2NUXA 3TIMA 2YKKA 2WNNA 4JIQA 1I4NA 1VIWA 1W0MA 2A2IA 2C1HA 3B05A 3DH7A 3IVSA 4JIPA 1PCWA 4ORMA 3RLVA 5I23A 4CQ9A 2EACA 1M5WA 2OSYA 1FWWA 1ZENA 5K4XA 3EWBX 3NQ7A 3UY8A 3RF9A 4POCA 4RK8A 1M7OA 3M43A 3PAJA 2VEIA 3E9AA 4GUHA 4R34A 4XTDA 3NZ1A 1KB3A 1VHNA 3ZR6A 3M7WA 3P5YA 4GUJA 4JTUA 1S5VA 1UD6A 2YW4A 3PF3A 3UPBA 2PE4A 2Y6ZA 2GUUA 1XBVA 3C0JA 3FIGA 1KM1A 4GIAA 1SO6A 4X2RA 1OFAA 1OT2A 3LTSA 3NXFA 2QJGA 1W5QA 2W79A 6TIMA 3VGFA 4JYDA 1DTUA 3LB0A 4PSRA 1JCNA 4BI5A 3L4VA 4X3ZA 5I0DA 2JK2A 1GZGA 1OX4B 3KRUA 3P84A 1OK6A 1G4EA 2R94A 3TQ0A 3M5XA 2YFOA 5DN1A 1MEWA 1LZOA 2Y61A 1TV7A 3KLKA 2VFFA 3W1PA 4JEQA 5D30A 4UTHA 4RLIA 5G1YA 2WVVB 3BMVA 3L0KA 2YA1A 4OV9A 4FLRA 1MFUA 4UTMA 1AQMA 3W76A 5KZMA 1L6WA 2ZUWA 1KM5A 1HNYA 3BCFA 5E93A 3G1DA 1WX0A 3L4YA 3U6WA 3BLKA 4PEEA 2VRQA 3SR7A 4N6EA 2AAAA 1KXHA 4O28A 1XI3A 2QDHA 1HO4A 2C14A 2A7PA 2DIJA 2GUYA 5GVJA 5HXMA 3R8RA 7TIMA 1YADA 1ZFJA 2B4GA 3W1QA 1GCYA 4QITA 1B57A 3NEVA 3O05A 5A6LA 3SSJA 3IRDA 3A5VA 2C13A 1I2NA 1M53A 3MHUA 1JRBA 4UFKA 1A53A 4KWVA 2PWEA 2Y70A 2YOCA 2BX7A 4HA1A 3C8FA 3S5ZA 3G3MA 5D2YA 4E38A 4Y6GA 2PWHA 2FTPA 5K4ZA 2ZTKA 1DJNA 3DFOA 3D4ZA 1OSEA 3CIXA 3EJSA 3S1XA 3UD6A 4H8UA 3SW6A 4K7VA 3TC7A 3SECA 2WPBA 2OYLA 1HL9A 4MUZA 3MMTA 4Z0JA 1X7FA 2XN1A 5AFDA 1TCDA 3ZR5A 2ZX7A 4OQVA 4WOZA 1YTDA 4K6AA 3GNNA 4J28A 1LLZA 3P61A 3HJZA 3VNYA 1LOSA 3L5LA 4K8HA 3P7YA 4HP5A 2BHUA 2QCDA 1VCGA 4MJZA 3GXFA 1DBTA 3SZ8A 1XBYA 4DF1A 4GO8A 1CXEA 1HX0A 3IGXA 2FE0A 4JYEA 2V81A 1CDGA 3QQ0A 3HOJA 4QM1A 4M56A 5E0FA 1SO4A 1L2UA 2NZLA 3CM4A 3UCQA 3BLPX 4JTLA 2EO7A 3CGTA 3OVPA 4NT0A 3TW7A 3GXMA 2CFFA 4JFWA 2BY0A 3NQ8A 5D2WA 3LXCA 4PCTA 3I65A 4EF9A 4MY9A 3O8AA 4YMZA 4N02A 3G3DA 3AMLA 5KZDA 2Y7GA 2F7QA 2YA0A 1GG0A 3CHVA 3VNDA 3W22A 1OHLA 1GT8A 8TIMA 3EWUA 1TPEA 3S5YA 2QKFA 3N14A 2V3DA 3W7GA 4WY0F 3IIZA 4MLJA 3T55A 3BMWA 3NL6A 5AC8A 1SQ7A 3OBKA 2NXIA 2YA2A 2VNCA 3L67A 2A0NA 1H3GA 3U2OA 3QPYA 4PH6A 2QCLA 4H3DA 4IXXA 1OX4A 3LLDA 2YX0A 3DBPA 4LNYA 1VGAA 3UQNA 2QAPA 3VKJA 2G3MA 1MSSA 1JCXA 2DZTA 1G94A 4CGTA 1F05A 2CWNA 3T78A 4FF7A 3RK8A 2ZA1A 3ZWSA 1KLZA 2O7SA 1VCVA 2FHBA 2WVVA 2A85A 3FYPA 3TMLA 4JFTA 4MY1A 4IPJA 3DAQA 1SZEA 2NX3A 3W2KA 1SO3A 1VFUA 1TTPA 3KEHA 3KL3A 3KVMA 3TXZA 5EMUA 1EEPA 5I3HA 1W56A 1Q6OA 4OU1A 1UD5A 3K8MA 3FEMA 5EA9A 1PAMA 3DHPA 4UOQA 3W07A 4AWSA 2BXYA 3PB0A 4R33A 3LXBA 2J9ZA 1GPWA 1KBBA 1LRTA 3MI6A 3L0GA 4GINA 1LLWA 3LDVA 2NX9A 4I9AA 4UTKA 1TQTA 3IJ9A 1IZJA 4CCCA 1UBSA 3OVRA 1BVNP 1R30A 3CLMA 1OFBA 5FI8A 2ZX8A 2E4TA 3OHIA 3BVXA 3EXRA 5K3VA 1ZCOA 3II1A 2WVTA 2CHNA 1CGYA 2WV8A 2J88A 2ZUUA 2QMKA 1OFRA 4I7UA 4S2CA 1AMYA 1VYRA 3VMPA 2VFGA 1B4EA 3SFKA 3DX0A 1V3LA 2YFNA 1HO1A 1OYBA 3EJRA 4LT9A 1R34A 1FCUA 3C2RA 3GNDA 3ZO9A 1I45A 3BGGA 1UOKA 1YYAA 4P2VA 3STGA 2J25A 3KXQA 1JDDA 5FF2A 2FHCA 3GTNA 2F7RA 5BRBA 3PBUA 1N55A 3OLEA 1HT6A 1FDZA 5IBXC 3EJTA 3O07A 4CKQA 4JTTA 1KTCA 3VGEA 3LHYA 1UA3A 5HWMA 1G5AA 3UXDA 4UQCA 4GQRA 3IEBA 4DXVA 4K8EA 1O94A 4DPPA 3IJ7A 4YWIA 5FEZA 4ADTA 1SFLA 4LVDA 3GDTA 1ZJIA 4S1FA 5C54A 1ZS2A 2WKGA 2QCHA 1BSIA 2QV4A 1MVYA 3R12A 1CXLA 3RMJA 2Z6IA 1CGXA 4WJEA 1DEDA 2H3BA 1XSJA 1UH2A 4K36A 3EX6A 3N9RA 3UYCA 1G69A 2WCGA 5FESA 1XCWA 3NQCA 4K37A 4TU1A 4OWGA 2G3NA 3WY1A 3P80A 5D03A 3PB2A 1IF2A 1PL9A 1OYCA 3GKAA 2GJRA 3F03K 3B0PA 3LTPA 3S5OA 4WY0B 3QC3A 2X1UA 4HSOA 3EWZA 3WEMA 4JTJA 1PZ3A 1Q4NX 3HPSA 1ZAIA 4M7SA 4N9BA 1VR6A 3W38A 1C8VA 1TJPA 5AYXA 1V3JA 5F1UA 3G1YA 4BZYA 4WXZA 4BK9A 3UG4A 3ZT7A 1KFJA 3HPZA 4GI6A 4YL2A 3BAJA 4FLSA 4JL2A 4O1DA 3IIPA 1GVSA 3NDOA 1H7XA 4HSNA 3SI9A 5FF4A 1XXXA 1K8ZA 1OFQA 3RU6A 3ABSA 3I7QA 3T44A 3W7CA 3KL0A 4NJIA 4FNRA 2E8YA 4NNAA 1WYIA 3Q94A 4JX4A 3DX2A 3A23A 1UD8A 1B4KA 3DC0A 3LRMA 5D2VA 1PS9A 4ZQOA 1G4PA 3WFAA 3N19B 2GVYA 3TKFA 2AAMA 2DZUA 3S2CA 1CW2A 4O1AA 1TREA 3Q37A 4JN6A 4PTNA 4GC4A 4AF0B 1EH9A 1W5NA 4H8HA 3S5NA 3LCIA 2OYKA 4LVBA 2Y4SA 4BI6A 2DH3A 3QW3A 1FWTA 1GTHA 2HMCA 2J6XA 3BLFA 4UUIA 2F1AA 2CLFA 2GVGA 1KGWA 5BRQA 2DZPA 4IMCA 4GQQA 4DF0A 4O52A 4MB1A 3NM3A 1H1YA 3O6CA 2ZZ1A 3GBDA 1H7NA 2ZRXA 2ZWZA 4KFOA 3KVJA 3ANYA 3EDDA 4XKYB 3SJ3A 1QW8A 3TROA 1AW5A 3DHFA 3W72A 5CLWA 4MYXA 2Y7EA 2OCZA 3TJLA 4LS0A 1THFD 2ZA3A 5DXYA 3MYOA 4ALDA 3ZQ9A 3O16A 3QW4B 3C52A 4WUIA 3WY2A 1NF0A 7TAAA 5CPLA 1XUUA 5HJLA 4MZ8A 4JTHA 1LWJA 2ZWYA 3IJ8A 3T40A 3MUXA 2E09A 5DY2A 5U7SA 3WJXA 1ME9A 1VZWA 5KTLA 1P0NA 4MFEA 4J3UA 1QHOA 1DL3A 1ZAHA 3BW3A 3LBCA 4X0NA 2CZ5A 4AEFA 3GXTA 2QR6A 3HJEA 1EPXA 1AMKA 2YW3A 4ZQNA 1YDVA 1JQVA 3TAKA 3W74A 3WDHA 1JAEA 2ISVA 1RR2A 1OGSA 1JQXA 1J2WA 1TB3A 4GUGA 3GLCA 4BR1A 4BWLC 2X2HA 4J3TA 2VEPA 3W2NA 4MOZA 5EPDA 3WNNA 1TPWA 1ME8A 3RLUA 4TO8A 3HG3A 3EXTA 6CGTA 2RH9A 3TAOA 3W83A 3TE9A 3UZ5A 3VGGA 3TSMA 2J24A 1V3MA 2Y88A 3LI1A 3OIXA 3EX4A 3K8LA 3G1AA 3OVQA 1AQHA 3BAXA 4UXDA 4H2CA 1O5KA 3BUQA 5E70A 3L9CA 4ZVJA 3OG3A 1JGIA 4ZQCA 5KINA 4TIMA 1SW0A 3PUDA 4PEKA 1MZHA 3WELA 1OX6A 3HB9A 1GVIA 3GDMA 1UCWA 4MZ1A 4O13A 1YDNA 3WDJA 1Q45A 1O5XA 4GJ1A 2E6AA 3L0NA 1JIBA 2XIBA 2BXZA 4NNBA 3IV3A 2R14A 2CLMA 1GWJA 1W5PA 5K2ZA 3W73A 4LOCA 5HDRA 4CLMA 1XH0A 3A6OA 2F18A 1EP2A 1FCQA 2P10A 1KM2A 1CX9A 2VEMA 1YTEA 3CTTA 3L2MA 3F4WA 3GDKA 1N8FA 4O57A 3BSGA 1K03A 1DQWA 1LM1A 5DFAA 3DGRA 4PA8A 1BKSA 1YTKA 1H61A 2NUYA 1XCXA 3VCRA 3W7MA 3W37A 1HFBA 1IZKA 2FFCA 4XWUA 2H3DA 3BH4A 1JXKA 3HGSA 4NUWA 1QO2A 4ZL1A 1I75A 1FDYA 2J9XA 2FQIA 4JDBA 1P5BA 4O15A 1E51A 2G5WA 1KFEA 3S0CA 1NF7A 1XL9A 4NX5A 3LCWA 1GQNA 4O4WA 2Y7FA 3NYZA 1YXCA 4ZZ9A 3C2VA 3NQ6A 1ICSA 1MW1A 1VLWA 1RQBA 1ZAJA 4ZQRA 3LHZA 3PBYA 3CZGA 4N6FA 1U33A 4CCEA 4KKXA 1WA3A 2C0AA 3BO9A 2CXGA 4LUJA 2DP3A 2WVSA 3W2MA 3LV5A 4XKYA 3WY3A 5EKYA 1KA9F 1Z41A 2PURA 1DHPA 1R75A 1KXVA 3OLDA 1GTEA 1MXSA 4JXCA 1DVJA 3MW7A 1KFLA 1NAL1 1QPQA 5EL1A 5CSRA 4AEEA 3PBWA 3TTSA 4OT7A 5KEZA 5LNRA 3EX3A 1WOBA 4W93A 1OF6A 3DDGA 2R91A 2NV1A 2V82A 4UFLA 1JF6A 2V30A 3M0ZA 1SZNA 3NVTA 1KBJA 1YXDA 3BG3A 2FH6A 1H51A 2Y85A 1JVNA 1VYPX 4GWEA 3VU2A 2ZXAA 3GKFA 4ADUA 1I2RA 3TDFA 5A5WA 4HPXA 4LVFA 3UZJA 4NXKA 1GVOA 3DENA 2Z6JA 2F7PA 3EDEA 3DX4A 3M16A 3C4UA 5G2WA 5F4SA 1KXQA 2X1RA 2FB2A 2ZRWA 1PS3A 3M9YA 2X16A 4HNVA 3BAIA 3PULA 2GVLA 2ZXQA 3GAKA 5TD4A 3UWQA 4LVGA 3TU9A 3L5AA 4NQ1A 5LHFA 2D2OA 1OG0A 1PJ9A 1S3HA 2OZ0A 3W2UA 4W9TA 5F2GA 1U83A 4GFSA 5IBXA 3C6CA 3RIKA 2QAFA 4OJYA 3RILA 4WD0A 4CQ8A 3W6YA 4M8UA 1F6KA 3M07A 2NT1A 2BWGA 1FWNA 2X1TA 3C2FA 1MEIA 3BAYA 2E5BA 3DFPA 5BW6A 3ABRA 2BSLA 1C8QA 2WSKA 3M47A 4GI8A 4I7WA 1QPRA 5AHNA 2ZTJA 5I3GA 3FW6A 4BA0A 5LNVA 3W1UA 3QGVA 3JR2A 3DXIA 3FOKA 3WNMA 3LHTA 3N2MA 4HKPA 4DPQA 2ZYFA 4HPHA 5TIMA 1IXPA 4ORIA 2NUWA 2YIHA 1W5MA 2GQ9A 3M6YA 5J5DA 3LRLA 2F61A 1IXNA 1HUVA 5KSWA 5LGZA 5HWNA 1K3UA 2J27A 1G4TA 5DCDA 3W1NA 2Z2UA 1AG1O 1KWGA 1K7EA 2OT1A 3VSUA 2ZRZA 1KCLA 2XVLA 3VGBA 1NFBA 5E6YA 2EADA 1XUZA 3AMKA 4IPIA 2J9YA 5F4WA 5I5RA 3QSRA 2DJXA 4EIVA 2OW7A 4YLWA 3KE0A 1QX1A 3UEQA 3CIWA 4XBKA 3G1FA 4IGHA 1R2SA 4H7VA 3VX1A 1D3CA 2QCCA 3CWOX 4RCXA 1WDWA 5LKYA 2DH2A 5A2BA 2V2CA 1VJSA 2ZUSA 2CZDA 4JTFA 2HSAA 3BG9A 1JD9A 3DFTA 4MZYA 3GR8A 4AWTA 3WK0A 2KZHA 4LU0A 1PIIA 1TQWA 3DI0A 1J4EA 2ZRYA 2E5DA 4JTGA 5LNUA 3W7NA 2Y62A 1X6UA 3GBEA 3M41A 1EA9C 4O54A 3ZFHA 1LRNA 1GVQA 3GVGA 2D0FA 2XVKA 2A6NA 1QPKA 4WLCA 2ABBA 5C5YA 3UWVA 3QEZA 3ZOAA 3NL2A 4IMGA 4Q32A 4FEZA 4M7TA 4I7VA 2I14A 1T96A 4R53A 3IVTA 3LGEA 3W1MA 3VM7A 4HNTA 2DZVA 4M6PA 3CQ0A 1FXPA 2G97A 3P67A 4OIFA 1XBZA 3TCEA 5KMYA 5L9FA 3GDLA 4IWWA 3OEXA 1KLYA 3LCFA 1KGXA 4AWUA 3G8RA 5BMXA 1SUXA 2OSXA 4OHQA 2F84A 3ABOA 5I3IA 4HHPA 1XKYA 3G0SA 5J5RA 4UMAA 3BLEA 1P6WA 1UB3A 4U2ZA 1WE5A 5DY3A 1VH7A 2WQPA 9CGTA 2WSYA 3FFSA 4Z1AA 4BWLA 3AJXA 4LS1A 3D52A 3R89A 1ICPA 3IGSA 3DX3A 1XDLA 3WNOA 1T99A 4AB4A 5EMYA 2QPUA 1VLIA 2C18A 3DFSA 4JICA 5G2IA 4FO4A 2WC7A 4WSKA 4UR7A 1VC4A 4GKLA 5D09A 2QMJA 3C61A 3PUEA 3TJXA 1MW3A 1A5SA 5EY5A 2A1YA 1GG1A 3PWAA 3P5ZA 2CLLA 4E2OA 4UMCA 1J0IA 3AXHA 2HS8A 3K8KA 2QJHA 3DHDA 4EVZA 3BK0A 1CGVA 3HGOA 1KWKA 2EAWA 1H62A 2V2HA 3E96A 1I8JA 1QNVA 4IMEA 1J5TA 4LUIA 4R7JA 2Y63A 5CZ0A 2NV2A 5HULA 1AW1A 4CNNA 3SGZA 1BPLB 1LBFA 2RDUA 3W7LA 1KM6A 1G4SA 4DELA 1FY6A 1RQEA 4C1LA 2QCMA 3EWWA 3KVLA 3QYQA 3NAVA 2A7NA 3I6RA 2OW6A 5HR6A 3A47A 3WJYA 2VUYA 2E0PA 5DO8A 2B0MA 4Y90A 4AMXA 5CZSA 1JCMP 4LC8A 5L6UA 1JF5A 4UTJA 1G6CA 2GOUA 1GJPA 5H91A 3PC0A 4YCOA 2RDWA 3P81A 3GAYA 3CZSA 4ML9A 5AC7A 5G2HA 2YYUA 5A2AA 4UZSA 2A4AA 1BAGA 3CWNA 3VSTA 1D3HA 3KRZA 5F1VA 5LZLA 1MXGA 2E8ZA 2YYTA 3MP4A 1JDAA 3R2GA 3W87A 1XH1A 3QPZA 1OB0A 2A6LA 3P8IA 1VAHA 2XVGA 3ZR4A 2EABA 4U4MA 2V2DA 4UNLA 3FKKA 5C2XA 3T7VA 3C56A 5DCEA 2ZXBA 2PRMA 3A9IA 2V5LA 1PVNA 2ATMA 4L4LA 3L2LA 4LW7A 3L66A 1L0PA 2TMDA 3U8GA 4EF8A 4RJEA 3GB6A 1GEQA 2VXNA 2C6QA 4PODA 2JGYA 3UWYA 1TMQA 2XWDA 1LDCA 3TQVA 2BY1A 4HOXA 1FQ0A 2ZRUA 1LTDA 2ISWA 1KFKA 3IK2A 1TRDA 4HPJA 3HBLA 4HNNA 2V8ZA 1KTNA 2GJLA 5KITA 3BAKA 2H8XA 2CZFA 1W3TA 3CZNA 4X22A 4A2RA 4JD4A 1KFBA 2WANA 1QI5A 2EJ1A 5LGXA 3MP5A 1TQSA 3FAWA 4NX0A 1ME7A 3L21A 5F2LA 4YCPA 1R47A 2BY2A 2NX1A 2FH8A 2DZXA 4TX9A 4E0CA 1XBXA 3MI3A 3WNPA 1WP6A 4UTIA 1JUEA 1BLIA 4TVUA 1EB3A 1RP8A 2NLIA 2Q3OA 4IUOA 5FEWA 4OBTA 2DORA 1XGZA 1TPC1 5I24A 5BNKA 2VFHA 2YSWA 3EWYA 3QFEA 1LBLA 5AC6A 1CI1A 4AIEA 1U30A 3HF3A 5TQLA 1XCFA 1QDSA 1IIHA 3TTYA 5FEXA 2Y7DA 1XV8A 1WBHA 2E6YA 2IGTA 4O12A 2ISSA 1YXYA 3RFAA 1VB9A 1Q6LA 3WK2A 4AEOA 1VQTA 4O16A 4O11A 1CXIA 3VMNA 1FWRA 5BOOA 4O1CA 5HINA 3W7KA 4AH7A 1ZHAA 2V3EA 3L5MA 1OFEA 1I2OA 1EUAA 4N2YA 5G5IA 3LTYA 4QJ1A 3QZEA 4Q4KA 3BVVA 4N9CA 3S9YA 1TYGA 1O4UA 3M5ZA 3L65A 4UCFA 4ZQMA 3H55A 1FDJA 4MLRA 3GK0A 4FHAA 1MFVA 4O0KA 1QFEA 1H7PA 1XC4A 2ZCGA 2WKLA 5CPOA 3I7RA 4GNJA 2DIEA 2W6RA 1WZAA 3DI1A 1QPOA 4QNEA 5D37A 3P82A 3VE9A 3C3NA 2G96A 4BI7A 1JD7A 5K9CA 1EWDA 1X1ZA 3LI0A 3QMRA 1SMAA 3NGJA 4UQDA 1W31A 3BAWA 4UNIA 1FUYA 4FMVA 1MWOA 4S2BA 2Z1KA 3JRKA 1YPIA 4IX0A 1IGSA 4IQLA 4LPCA 2C19A 4A3UA 3PSWA 4KWWA 4DF2A 1UUOA 2VOMA 5K7JA 1JCJA 3TNOA 5DXXA 4N4PA 2AQWA 4DO6A 1F73A 2E5CA 4MPQA 3W7OA 1LOLA 3CV5A 1JFHA 1QWUA 3TW6A 2B7QA 1Q6QA 4IJBA 1GJUA 3BW2A 3INPA 3W7EA 3KOFA 2NXHA 1TO3A 2DJLA 4ADSA 5CLTA 3NR0A 1A5AA 4M5PA 3KHJA 3DHUA 1TPH1 4FX8A 3WMSA 3KVKA 4BF9A 4RZ5A 3TH6A 6ALDA 1JDCA 3LOTA 1J0KA 4XBSA 4AVFA 1VRDA 1XSKA 1U5JA 3QQ1A 1E3ZA 1OFDA 4A29A 3BLIA 3DFQA 1WPCA 3YPIA 1NM9A 4PSPA 3KX6A 2EF9A 1OABA 1AW2A 3NPXA 1QWGA 3A21A 4UR8A 2Y5EA 3MP3A 1SSDA 4PCSA 1PIGA 4UFIA 2ZDRA 1MEHA 3HO8A 3BLBA 5AOUA 1H5YA 1JI2A 4FX6M 3E02A 4WY0A 5F2MA 2DZSA 3B4UA 2GJPA 2WJZA 1EO5A 3DKJA 2TYSA 3STEA 4RZ6A 3G8EA 4PC8A 4AXKA 1A5BA 3UERA 3BVWA 3ZSSA 1BWLA 1EIXA 1K8YA 4N9EA 1CGWA 3O1NA 4Y96A 3HG4A 4FIQA 3GR7A 1TRIA 1PE1A 1SW7A 3CLWA 3IVUA 3TSBA 3LHWA 3GXNA 1HG3A 4X9SA 5CKSA 3DZ1A 1KXTA 1H7WA 5IM51 1JL8A 1OK4A 3MYPA 3V75A 4FXSA 4CQAA 4O0ZA 2Z1BA 3P62A 4NZFA 1ADOA 4RXFA 1BF2A 1LP6A 3BCDA 1I2QA 3B06A 3QMSA 4FLQA 4JL1A 3WDIA 4LQ1A 5H2ZA 5E6ZA 4KFNA 5A8GA 4XUGA 3O6YX 4AF0A 4K39A 3STFA 2WNZA 2XN0A 5I3FA 3EWXA 4OE7A 3ZSTA 2TSYA 3M5VA 1WQ5A 3B03A 1UKSA 3RNDA 2ZZ5A 3MI2A 3R13A 1TPUA 3VM5A 1FCBA 5FEPA 3EKLA 2ZX9A 4HOZA 4RV8A 1TV8A 1TPFA 3GYEA 1UA7A 5E0KA 4EOUA 1GJWA 3SY5A 2ZZ6A 1B0IA 1MW2A 1TQVA 5DBTA 4EWND 2FPYA 4E2BA 3NQ2A 2H6RA 4JX6A 2JKEA 3L4UA 4UTLA 3W7PA 3W7RA 5BMWA 3HIJA 1HTIA 1J0JA 5D33A 1W3NA 4FNUA 1PIFA 5LSMA 3NQDA 1XM3A 2OSWA 4RZ4A 3S6DA 2QUUA 1GVRA 3EX1A 3CPUA 3EDJA 3W7QA 4KWUA 4JFUA 3O63A 3G1SA 5C55A 3L4XA 4JY8A 8CGTA 1O60A 2C8NA 3DX1A 3DFNA 4TMBA 1BTMA 2XWEA 3WFZA 1QCWA 3TC6A 1QHPA 1PCKA 3QH2A 1F74A 4D2JA 3WJZA 1XFBA 4IXHA 2NWRA 4LRTA 1QI3A 3QF0A 2ZE0A 1OVDA 4MAZA 2NWSA 2P1FA 5LNWA 1I2PA 4A21A 1RPXA 1O7DC 1B3OA 4NXSA 4QAWA 3PSVA 1RV8A 1PEZA 4RXGA 3AO0A 3HZ3A 5CXPA 5A6MA 1DV7A 1PHQA 1EUNA 1PV8A 5BRPA 4JFVA 3GX9A 3OA3A 1RD5A 3G1HA 4UQAA 1ALDA 1JRCA 3CC1A 2GVJA 3CTLA 3M44A 1SZGA 3C2EA 4UCGA 3VNZA 3K30A 3UNDA 1IXQA 3NQMA 1D3GA 3QSTA 3WK1A 1R33A 2ABAA 3TV8A 5K9DA 3EJUA 5D2XA 4XQ6A 1ZALA 5EYWA 4JFSA 3IIVA 3LHVA 1P1XA 3WNLA 3LLFA 3S1WA 3ECQA 4UFHA 4J3WA 1W8SA 3IGUA 5KZEA 1DHKA 1OF8A 2VELA 4PL1A 4GRSA 4NU7A 2C7FA 3VSVA 3LBMA 5CPNA 1V5XA 3WN6A 4UQEA 1AL8A 1YPFA 3I7SA 1KFCA 1VCFA 2QCEA 5FF3A 5HUPA 5LHEA 4NJHA 3AJ7A 1ZJBA 3WK3A 1E43A 4MKNA 2YDAA 4U31A 1TSIA 2EGZA 4NJGA 2WSRA 1F5ZA 1TCMA 5HUOA 2BHYA 3A24A 4KFPA 2O7QA 3NL5A 4AMWA 4GO9A 3TMQA 5DELA 2DU2A 3PS7A 4B9ZA 3HG2A 1JG9A 5E9AA 2WO5A 2JBMA 3T4CA 1A5CA 4XZ9A 2OT0A 2CPUA 2F7FA 3NQFA 3NOEA 3BUIA 4JX5A 4CN6A 2ZUTA 3S8HA 4O50A 3TK7A 4UC5A 3KL5A 3G18A 4GUIA 4O10A 3BSHA 4FNPA 3CEUA 5CG7A 2VT0A 3G1VA 1J0HA 3TFXA 4JTSA 1B9BA 4LY8A 4U2YA 1D9EA 1SSGA 2I9EA 3STCA 3TXVA 1H60A 3EB2A 2WCSA 4DBEA 5SWUA 1NEYA 4UQBA 4JY9A 1TPDA 3W1AA 3ABQA 2WSPA 3VI2A 4UTTC 2D0HA 1U2YA 1TTQA 2ZICA 3WNKA 1QMLA 2E1DA 3G24A 1F6PA 2PRLA 5K9XA 1AVAA 3G0UA 1ML1A 4MYAA 1HL2A 2G95A 3W2JA 3PY2A 3CPRA 3UG3A 3VE7A 5HR7A 5LNSA 3LRKA 1HVXA 2ZX6A 3ZT5A 1UUMA 1H50A 3NQAA 1SO5A 4H8VA 3CEPA 3EX2A 3B8DA 3TONA 4NZJA 3LV6A 1CXHA 1CGUA 3THQA 2BZNA 1BEUA 1IIGA 3UWWA 4HOWA 4HNUA 1LROA 3LPPA 4QAIA 1G7VA 3NQEA 3BUBA 5G1TA 3A4AA 4CN1A 1Z42A 3EXSA 4UIOA 1H1ZA 1LCOA 4WQ6A 2I1OA 1VHCA 2HTMA 1L6YA 1UH4A 5AHLA 1H7RA 3I68A 3ELFA 1JCLA 2PC4A 5TBOA 3W1LA 4P61A 3O6DA 2YCEA 3D0CA 1UJPA 5HWJA 1LYXA 1TTJA 3EKZA 1XDMA 2CZEA 4L4MA 3HQ1A 2GPTA 3H53A 3TSDA 2F1BA 1C29A 1GYLA 2FGZA 1X8FA 1XH2A 2ZA2A 2WNWA 4B9YA 4ZMGA 2TPSA 1F76A 1VFMA 4AHPA 1W1ZA 3LCHA 5U4NA 1G7UA 4ATWA 3WY4A 1W3IA 1EHAA 1L9WA 4Z0SA 2FJKA 2Q8ZA 1O95A 4AMAA 2E9BA 2P0OA 2RKXA 3DKLA 1UASA 5E1QA 3G1XA 2CLEA 4J27A 1KW1A 4FXRA 1A50A 1DORA 2YJQA 2R8WA 4YXGA 1TJRA 3FAXA 3USBA 2QUTA 3FJ6A 1QOQA 3LX9A 3A22A 2PWFA 1R2RA 1UD4A 2EHHA 1OFOA 4LWWA 4ICNA 3PVFA 3BVUA 4WXYA 1MW0A 5G4WA 2FB3A 1IXOA 1PHWA 2D73A 4CN4A 2TAAA 3PR2A 3NO5A 4WOQA 1Q3NA 2NSXA 1NSJA 1KGUA 4C1KA 4NNCA 3HGRA 1TQUA 3ZWTA 3NNTA 4MIMA 3B0UX 2PRHA 2JKPA 4UFMA 4CNPA 1OX5A 4UTWC 1UKTA 2XIIA 2VFEA 1HXKA 1ICQA 1WO2A 4LC6A 4FNSA 3A5FA 2FDSA 2CW6A 1SR9A 5D04C 2Y2WA 2E6DA 1CLVA 1ZJAA 1KM3A 2B7OA 5AHEA 1QI4A 3UG5A 1G1YA 4WZHA 3OLIA 1E3XA 1LRQA 3UXAA 4OGZA 5F2IA
chains in the Genus database with same CATH superfamily
3KPPB 4GKNA 4RX0A 1A3XA 4L2YA 3W1RA 4K3HA 5HMSA 3ZL4L 1H8LA 1H7OA 3B2VH 1BOGA 3FO9B 4NPKA 4PW9A 4KWOA 3BQVA 4FQ1L 3WJLC 1WAUA 3CHXA 5C8JB 4DJDC 4D9LL 4DGVL 2JF1A 1N3NA 3DRTA 1QA9A 4TMCA 3CASA 5HDBB 2VJ8A 3WBDA 3HVDA 1FHDA 5AW2B 2BHZA 1SGJA 4UTUA 4QUOA 5F44A 3LKRA 1RMFL 4Z3IA 3DIDA 1ZDSA 2GJNA 3P6LA 1UC6A 1YZZA 3P0XA 1X39A 3FFCA 5EOQL 3PFUA 3PPCA 6PTDA 5AL0A 2BSDA 8FABB 3WTWA 4PG9B 3ARGC 5FM4A 1T20A 1L7TH 5C7VA 1YMYA 2PYEB 3WKNA 3LMZA 3AHVA 1M7PA 3IGFA 5DHXB 1K8XA 4S3EA 4KEMA 5E9XA 1O6IA 3QV6A 4NAJA 1XS2A 2VXUH 5ENWB 1I9JH 5I15L 3FKRA 1GCFA 3M7FB 4Z76B 3IJYA 4WX2A 4P2RE 5FUOL 2WMGA 2IQ0A 3PS6A 3KPPA 1NUGA 4Q97A 4FFZA 2V5SA 3VB8A 2A3BA 1O9WA 3B2VL 4FP8H 1KRCC 3NPUA 1G1OA 3R0UA 2Y1HA 2GC7C 3FO9A 5C8JA 4S1QH 3MO7A 2QT6A 5HY9B 3JUZA 2NSOA 3URQA 3OAUH 1Q7MA 4E42B 3CIVA 2WJFA 5D02A 4H04A 5CSSA 3SRFA 5JQ6L 4LTSA 1U3ZA 5KBDA 3HC3H 3AAMA 5FJTA 4RVBA 1XF4B 1GGCH 3N1AA 4X6CE 3HPJB 1U3HC 2HCZX 2VC9A 1QPXA 1JYNA 3ULVF 1BG9A 1JCVA 5AALA 3NJVA 1J5OH 5JHMA 1Q9LA 4D0DB 8FABA 1L7TL 1G7PA 1FZOB 3KCWA 4PB4A 4QR7A 1EX5A 5F0LB 2Y2YA 1CXKA 2ITCB 4V27A 2GSIB 4F3HA 3DUSA 3I2CH 1FBAA 2D1ZA 4X0KB 1ZSXA 2KT6A 4Z76A 4CSPA 5J56B 3AU0A 4TRPH 4B7IA 1E72M 3BGJA 3E0FA 1IBYA 4H1LH 4B3KA 4IFOA 5DQDH 3RVWC 1NMAH 4LQFH 4FP8L 4NCDA 1MNNA 2KQNA 3W82A 2JKAA 3VGDA 3S8WA 1Y18A 4CVZA 4OCXH 2QADB 1P7QA 2QJIA 1TX2A 4S1QL 1UH3A 1B5TA 1TZIB 4AC7C 2A3LA 4AVOA 4NJAH 3ARFC 5HY9A 5F7UA 3KRSA 3PNWB 4E42A 3KLLA 5C9UA 1T1XB 3SKUD 3EJPA 1GGCL 4PLJC 1NFDE 2NYKA 1P1MA 1XF4A 4OCMC 1KCKA 1OAYL 4DVRL 3HPJA 2B8OT 1NWRA 1KBPA 2JH2A 1J5OL 4HNLA 4PBDA 5T1LA 5IBUB 4DQWA 3EH5B 3QISA 5C0AD 4D0DA 3L7FB 2NSMA 1FZOA 3GTHA 1LO0H 2P49B 4UB0H 3VUPA 3I2CL 3F7QA 2ITCA 3MQIA 2GSIA 3TA9A 1MG3C 3UY8A 4LNCA 4X0KA 3ZR6A 3M7WA 4GUJA 4J3OD 4W9JC 3FTGB 4AZ6A 1ET7A 1L8NA 1JHLH 1JYVA 4TRPL 4X2RA 4Q8BA 3V95A 3LTSA 4LLVB 3K5SA 1NC2B 2F6UA 4RPQA 4WVXA 3VGFA 4LQFL 5I9QB 4OCXL 5AC4A 1US3A 1YEYA 3BMVA 3APTA 4NQCB 1ZA6B 1RLWA 4ZE4A 4NJAL 2QZQA 5DEZA 3U6WA 5HYSA 2Z34A 2QIWA 2E6JA 4WW1B 5GVJA 7TIMA 4Y9CA 1ZFJA 3GBML 1ODZA 3FVDA 5ACLA 3SSJA 1I7ZB 1GGIH 1JRBA 1HKWA 2AQPA 3FSTA 1NDGA 1PY0A 1RJPA 3LAFA 3O8XB 3UZQA 5K4ZA 2WHJA 4UYPA 2FBOJ 3NA4A 3JBG7 1IEWA 3RWFB 3NCMA 1Z69A 4PR5B 1KCUH 1WKEA 1DBTA 4M1RA 3VI4B 1QNSA 3FTXA 5I8CB 4J2XA 4MS8D 2V81A 2GGIA 4FEIA 4EXBA 1MWAB 3PZ9A 1M03A 4PLKC 3GXMA 2CFFA 2NQZA 4Q4EA 1SBBA 2DYSB 1JHLL 3O8AA 3FTGA 2XZCH 4LLUA 5E5RB 5ABDE 3S5YA 4WY0F 4W9IC 2C34A 3ANUA 1NC2A 2D3VA 2XGIA 1VFAB 4I0PD 1R87A 4LCWB 4HQQH 3VFOA 1AC0A 3UQNA 2G3MA 3IJIA 3RKPA 4C4UA 3T78A 4GUPB 3FBKA 5J6HB 3TMLA 3DX7A 4MY1A 3B3IB 4NQCA 1R85A 2EDHA 1R24A 4Y16C 1GW1A 2CERA 4C58B 2G37A 4WW1A 3ABXA 4L6OA 4M24A 1GGIL 2JCCA 4A7VA 1U1UA 3O3UN 1XZ0B 6PCYA 2N7BA 1K4DA 3MV8D 4GAFB 1QSFB 4TX8A 2FO8A 4Y2DC 4LT9A 2H5UA 4WU7A 1JZ3A 3RL1B 3TNNA 2GJZB 1N55A 5TDNB 3H9SE 3UMNA 5B39G 3JTTA 3LPWA 4KRPD 5J13B 3RWFA 3D34A 4PR5A 1O94A 3GDTA 3VI4A 3X3GL 1M1XB 5KS9E 2O61B 4LEXL 4KCUA 3RMJA 2Z31A 1CGXA 3PAUA 5JNYB 4U6VH 4Q8NA 4PRWA 5B38B 1MAKA 2XZCL 3GKAA 3ZDZB 2OMYB 4K73A 1F2QA 3QUMH 4D8PA 3FHEA 1DQDH 2ACQA 1T04B 5F1UA 5TH2B 3UG4A 1TTRA 2BOBA 4HQQL 4MYPA 1VFAA 3QDGE 4MX7B 1WB0A 4P2RD 1IMHC 4LY4A 4AQ1C 4GUPA 1UD8A 2QPXA 4ZQOA 2H32H 1KXTB 1XFCA 2IPUK 1E28B 2JI2A 1KIUA 3MRNB 3T09A 4GNKB 3AXXA 2XVNA 5CCGE 2IH1A 1E9YB 1M41A 1KD0A 1SJBA 2CGRH 3DHFA 4UZGA 1QSFA 1KCSL 3HE6C 5I2UA 2UZIH 3KWUA 2MQGA 2YUWA 2IXUA 2GJZA 1TJHL 3RURA 3UGXA 2GI7A 1INQB 4QE5A 1N64L 5EPMA 4DJEA 2B59A 3QK0A 4JM2C 2VN4A 3SBFA 2ARJB 1AFVH 2Z6FA 2DBLL 4MNLA 5CD5C 4ZVJA 1DQDL 2JLPA 3K3QA 1T22A 4HUMB 3CCHA 4IKKA 4DJMA 3IRSA 1IILE 4ODXB 4IJCA 4LT7A 1ZBCA 3CZ8A 4NNBA 4WO0A 4L0YA 3EA1A 4KZEH 1K3IA 4P9HH 3F4WA 3L3IB 4O9HH 3BSGA 3O2WH 3PQYE 1XGDA 4PA8A 3UGRA 4LOUC 1YTKA 1H61A 2CU9A 3DI2B 3VCRA 4LCIH 1R5WB 2A74A 4Q6KA 1EJTC 1XL9A 3MRNA 3PJSA 4YVVA 4FTDA 3GMMB 1VLWA 5IMOA 2CGRL 3CWGA 4PRIB 3VDHA 1EJWC 3N04A 3VJ6A 1UR0A 3TH4T 1TE1A 1A6PA 2UZIL 1QPQA 1SQMA 4MA8L 3PBWA 3RE0A 3MSPA 4W93A 3NSDA 4OAWB 1EJUC 4YHML 1ZHNB 4ZX3A 1D2OA 4LVFA 1INQA 3T1WA 2K3HA 2WBJB 2EICA 3FQWB 1AFVL 1KBGH 2ZRWA 5EF3A 1ZSHA 3U5UA 3BDYL 4TSBL 2ARJA 1J1XH 3RBSA 5TD4A 3ULVL 2Q5BA 4FSAA 2IXQB 3RIKA 3FSUA 4OJYA 1RJCA 3QA3B 4IOFD 5D96B 4KZEL 5T8GA 4P9HL 5L6YL 3DXIA 4O9HL 1DDTA 3AABA 5CSBA 2HH0H 3LD5A 3QIWB 4GH3A 3P9LA 3L3IA 3A67L 4LCIL 4HBKA 3NIDB 1UWUA 1ORSA 4MNHA 2Z8VC 5A94A 1R5WA 3QSRA 3QBUA 4R90H 3AFLA 4EIVA 4BJLA 4IGHA 4Q8OA 4H7VA 1VRSA 4PRIA 4HW6A 2NY5C 5SX4H 2J12B 2EDYA 4KKNA 1NCTA 2VM9A 3LIZL 3BPLB 3RVXC 2HE8A 2BDNH 4S38A 2E5DA 5E23A 4RDQG 1TETL 2EE3A 3SN1A 2WBKA 2LV4A 5IV2B 1LRNA 1S2UA 5D93B 1ZHNA 1KBGL 4R7VA 1U4FA 2OEJA 2WBJA 3FQWA 1WBYB 4NZRH 1CD1B 2PDXA 4MPKA 2VERN 3JUGA 1O9VA 4L5FE 2CNZA 5I3IA 4WHTB 3E3QE 4A7QA 1ED3B 4HBCH 4G7EA 4JKKA 3RAOA 3OO2A 1VLIA 2C18A 1KDJA 3HS0A 1HWHB 1DFXA 3QC5X 4A2HA 5AVZB 3C61A 4H83A 3FGCA 4BSWB 2A1YA 3M4HA 4K8RC 3KLHC 3O41A 1BIHA 2HS8A 4H6RA 5EZJB 4GG8B 2QJHA 1CE6B 3PN8A 3LNDA 1F6AA 2CRIA 3M1CA 4A2LA 1I7RB 4L1HA 4R90L 1OAQL 4E3TA 1V55B 1HQRB 4HJEA 4FZEH 2WCPA 4P2CG 5H91A 4E0RB 1JEZA 1FTXA 2NNFA 4JZOB 2BDNL 3VSTA 3KRZA 5LZLA 4W6YB 4BCYA 4KMTH 2KAUC 2C1GA 4GQ9L 3I9GL 3PIQB 3FKKA 3HHMA 4CVUA 4P9MH 1I53A 3SRHA 2TMDA 1GEQA 1Z0MA 2C6QA 4NZRL 3BEWA 4NCC2 4WWKC 2BY1A 2WTRB 3CDYA 1OGTB 1WBYA 2YD8A 1CD1A 1Q6GA 1FWIC 1TITA 1EEZB 1F4XH 4P04A 2UUDH 1W3TA 2X1IA 4HBCL 4WHTA 2BY2A 4KVCH 1FWGC 1ED3A 5A3HA 4E0CA 3MI3A 3OTTA 3NJKA 4IUOA 3D2UD 4Y9PA 2P5WE 3IF1A 2AEOA 4R2GC 4Y89A 3W57A 1Z5YD 1ND0B 2Y7DA 1WBHA 2IGTA 2XQYG 2ISSA 1TZZA 3DBXA 4LEEA 4IMKC 1BQLH 4DZAA 1CXIA 3QDGD 1CC3A 1TNMA 2W91A 1JWUB 3OKMB 3WXWL 4N0CC 4WAFA 1E4IA 3ISYA 2FMOA 4C5ZA 1FC2D 5BMFH 1HQRA 4FZEL 2ZCGA 5LYRA 2XBDA 3QBTB 4BI7A 1JD7A 4BCEA 5JYMA 1EWDA 4LAZA 4E0RA 4FFYH 4UNIA 1MWOA 4S2BA 4IRJA 1YHTA 4IX0A 3B7RL 1CEOA 4FOKA 4P9ML 4MPQA 3PIQA 2R1KA 3CHSA 2YZ5A 4APQC 3MRLA 4ECNA 3QEHB 4FX8A 3WMSA 2NY2C 1F4XL 2WTRA 4AVFA 1OGTA 4QFUA 1XSKA 1WFMA 1W0WA 1YA5A 1QOKA 3ZKND 3AC0A 4KVCL 1PMYA 4JQVA 2EF9A 5C0CB 3BYYA 3MZ2A 4HEPG 1H5YA 1JI2A 4M80A 4YK4C 2YL6A 4I1NB 3NMEA 5IHHA 2TYSA 1FNFA 4CCZA 1WIPA 3MFGB 3QO1B 4WIWA 5K9OA 1YN6A 3C5ZB 3DXAE 2PDCA 5DRNB 3IVUA 4TSCH 3BO8B 2GJ6B 1HG3A 5BMFL 1MQ8A 3PQYD 4DKDC 4CQAA 3SJNA 4HU4A 1SJAA 5A8GA 2XN0A 3U1PA 4ES4A 4FFYL 3B2DC 1FCBA 25C8H 3F04A 4JFFB 3UVIA 3T1FB 4EOUA 5JPNC 4ZMQA 1TQVA 3O0RL 4UTLA 4KKCD 3W7RA 1VPYA 4K3DL 1JGDA 4LLYB 2WXJA 4BUGA 3S6DA 1MCOL 3V9CA 1EGMA 4JY8A 5C9JB 2C8NA 4Q2ZA 3VG9B 1XFBA 3U4BL 4IXHA 4S3BA 4QROA 4ZMNA 2YGPA 5LNWA 3S37H 1JZ2A 1P43A 3MTRA 1PLAA 3QHNA 5D8WA 2O0TA 3QHTC 1PHQA 1MJJB 3D6NA 5MP6H 5AB0A 1TTAA 3WN5C 4K5LA 4WDTA 1MCKA 1DP0A 3T9PA 3NFUA 4JNZA 1IGJB 5KZEA 4L1DA 1KLGB 2EDRA 3LBMA 4Y9NA 3QO1A 1SJXA 1ZJBA 4TSCL 4XOAA 3C5ZA 2ZPKH 4OUUA 4HPNA 5JHDE 5DRNA 2O7QA 3PS7A 2FFIA 4XZ9A 4CVXB 1H8NA 3QEGH 4HYTB 4GSXA 3RN6A 25C8L 1S9XB 3TXVA 5IROC 4L8DB 1OSPH 4QDGA 3ABQA 5K9JH 3AZUA 3T1FA 2CNCA 1XGRB 4EIZC 1OHQA 3G0UA 1EEXA 1Z6JT 4BQ2A 4EACA 4XNQB 4LLYA 1IKNC 3CB3A 4U1SA 4M5ZL 5DJAA 1IAIH 3ITCA 5C9JA 1Z42A 1DVFC 3SKNA 3S37L 3L1GA 8PAZA 3WYZA 2W1NA 3MCLH 2A6KB 5LA0A 5ISZD 4LKXB 5DS8A 5U4NA 3GY1A 3B8UA 4GAJH 4H44C 5MP6L 1VD6A 2QDVA 1QNQA 1MJJA 2Q3XA 2E9BA 2H26B 2E75C 1YPZF 4ODVH 1A50A 4HCRA 5DMYA 3FUIA 1JNJA 2X7VA 4FQXC 1IGJA 1AGFB 1KLGA 2CR6A 2ADAA 4YX2H 3U0PB 4ERSL 4H8PA 3AW5A 1Q2RA 2FWSA 3QEGL 1A5FL 5KJRH 4CNPA 5HI3C 2UWEE 4PR4A 5KVDH 2VFEA 2R56H 1SR9A 2VC2B 5DS1A 5I77A 5CP7B 3T4YB 1G1YA 1FFTB 4OGZA 2TRYA 1OSPL 2Y89A 4EUPG 5K9JL 4HZ8A 3V4UH 3CN4A 4S1RL 1OW0A 2BSED 4JO8A 2ZX5A 3QJAA 1F18A 3R06B 3BPWA 4D0CB 3GSUA 4U1MB 4XNQA 4O8RA 2Z8RA 5DFVD 1JTPA 1J87A 5IJVA 4QRUB 3W3OA 1G7MB 3IRPX 5LN8A 4AVJA 4NFBA 2VC6A 3K1DA 4YFLF 4GABA 4P0DA 1LL7A 4KK9C 1V7YA 4WW2C 3R1ZA 1SZRA 3VTTA 1T6VN 1V0LA 4GAJL 4UM8A 5H8MA 1AI1H 2YN3A 1OIMA 4F2UA 4O4YL 4LKXA 2XTKA 1NGXA 1KGCD 1N5YH 3ZE1F 2YZ8A 1QWHA 4JR5A 4BQCA 5I1IL 2QSCH 4G71B 1TTIA 2QLVB 3H26A 1XLEA 1PDKB 5F6HI 4YX2L 2PP9A 2ADGB 5CBIA 4Q9RH 3MRMB 1DJWA 3APMA 4UOW0 3U0PA 3W7JA 1LE5B 3RFZA 4OCNC 1A5LC 5KJRL 1KV7A 4DGIL 4WV1A 5KVDL 1O9ZA 3W9ZA 1GYUA 3H7LA 3G2GA 1PZAA 4D6JA 2A9MH 1WAAE 5CP7A 3S3DB 3T4YA 2VDRH 3ULSA 3L3JB 3V4UL 5I6MA 5J89A 4K9JA 5DJDB 5AN7A 3P4OB 5BV7H 3BIAX 3U4KA 5LQBH 4G42B 1EFQA 5I1LB 1YEEL 3FT3B 4UTAL 3MQTA 1VHPA 1HK6A 2C9XA 4QE1A 1NARA 5T26A 4QRUA 2INFA 4EI5C 3AM8C 3TTQA 1G7MA 5IQNA 4RCAA 4LRIC 4X83A 1CU4H 2YR1A 2D3NA 3O6MH 1QPNA 1AI1L 4NKQB 4Y9FA 4ERAA 1WZKA 3ZE2B 3QGAC 1TWSA 2D2JA 3EDKA 4XNZB 3RGVD 4ICWA 2XV2A 5DUML 1ZT7B 2QSCL 2KI6A 3SM0A 2NY0D 4UOZA 3OMIB 3OTRA 2BTMA 3ITYA 4XO3A 4JZJC 4JKWA 3TCTA 2EPOA 4X4MA 2VEKA 2N1TE 2W38A 3L3DB 4XVTH 4LE8A 2ADGA 2X4RA 3GK8H 2G8ZA 3MRMA 1EJXC 5J12C 4NJJA 1TWWA 1LE5A 4R88A 3M1ZA 4G1KA 3AICA 1XG3A 5EFDA 1V7MH 3E5BA 4G6CA 1BGAA 1EA0A 1D9KB 4O0QA 2A9ML 3BLDA 3O9WC 1K7XA 4ELMF 3DXAD 2L0DA 3IETB 2QVHA 1K8CA 5GS2D 1LEKB 4WK9A 3GZAA 5I06A 5LQBL 4FNTA 3WGUB 1FWSA 5A8NA 3P4OA 4PUUA 4G42A 2P80D 4UTWA 5TJWK 5D38A 3FT3A 3U2EA 1RQHA 4PREA 4CD8A 3KM2A 5E6RB 3MLTB 3U46B 2ITDA 4F2MB 2WBGA 1BXCA 2V5KA 1CU4L 3G6DH 5F21B 2NR6C 3EYVA 1UXMA 3L4ZA 4JS3A 4EDXB 3U4FA 3GBLA 1VS1A 3IJLA 4H7CA 1X1NA 4MB4A 1E4XH 5CF3A 3RU8H 3CFJB 3ILDA 3L6FB 2K0RA 1EO8H 3A6BH 2YXGA 3IGLA 1C12B 1S78D 5T3ZL 4PRHD 3VILA 1GIGH 5LWYH 4JCMA 1KV8A 4JFHE 4E4UA 1N8ZB 3SGUA 5ID0A 4AMKH 2VENA 4XVTL 3M46A 4U6XA 1RVGA 1KBLA 4UZUA 2NUXA 5IHZA 3A4XA 2VN7A 2A2IA 3S1GA 1RSYA 4XVEA 5AZEH 4DYEA 2LAGB 4BFFA 4XTDA 1D9KA 2X44D 1PU0A 3VW3H 3QIUB 1UMLA 2Z8SA 2W79A 4IP7A 3IDYB 4L29B 2E7DA 5ADOL 4XZIA 3G6JA 3RR4A 4P7RA 1CLYH 1G1KA 2QHAA 4RLIA 2JKTM 2GSJA 4OV9A 5EU9A 2BIMA 4YS1A 2FTWA 3VXRA 4XG1A 2OTPA 1MCDA 3MLTA 2GJJA 3EYSL 4F2MA 3C8HA 5IW6A 2G4EA 1P4BH 1NWPA 3W1QA 1PKOA 3W3BA 4P46D 3VIIA 4EDXA 5DQ9B 1E42A 1E4XL 3OBAA 5AEAA 1DQVA 3WUZA 3S5ZA 5ITBH 1WAWA 3A6BL 3ZHDA 1A5OC 3OP2A 1N26A 2BPBA 3L6FA 1UZHA 5D2NB 2WPBA 1GIGL 5LWYL 1NOAA 4B41A 5EIVA 5CKAA 4L9LC 4PRPB 4TTDD 3VNYA 5I6LA 4G59C 1X96A 2BHUA 1N8ZA 2VX4A 2MTAA 4GAAA 3VKAA 5C3LD 5AZEL 4EN3D 2EPMX 4JREC 4JO3L 3K91A 1YYMH 2YPLE 4WDXA 4HUWB 5IOKA 2C26A 4NZ5A 3O3RA 4AD3A 3MNVB 4M7LL 2EDNA 3FHAA 3U7YH 8TIMA 4KRUA 1FCCA 1OD9A 1EMTL 3O3AB 1A7OH 3WLBB 3JWNH 3AZSA 4NSKB 3H42H 1CLYL 2YARA 4EZMA 5D1XE 4UQ3A 3V5CA 1UHVA 2H2SC 3H3PH 4FF7A 1BBJA 3IJSA 1FZMB 1HI6B 2X6CA 4JFTA 4KXZH 3U9PL 1I1XA 2ZC8A 1VFUA 1KEMH 3MOBH 3P30H 3FK3A 3W07A 1KELL 1P4BL 3Q65A 1T21A 2A5UA 3U36A 3L3OB 3OVRA 1WCBB 4RGNC 3KPMA 4QXWA 3OKDA 5ITBL 5DQ9A 2ZUUA 4RZBA 3O6KH 4I7UA 5D7LB 4AX6A 2WXPA 1S9WA 1C8YA 1IM9B 4ACZB 1R34A 3V8CA 1FCUA 4MSWA 3SGDH 1JPGA 2BNRA 2PMQA 5D7IE 3OLEA 4PTMA 4ASTA 2GUOB 2V5TA 2HKHH 2P26A 1YNLL 1BJ8A 1S3TC 4NO0B 3V3WA 2Y07H 1ZHKB 3RNKA 4YWIA 1T03L 4X4ZA 4AM0A 5IQ7L 1PYMA 5C9WA 3EX6A 1AGEA 1R38A 2YAMA 1B9KA 1PL9A 4X6DE 4OD1H 3U7YL 3MNVA 1YEIH 4HSOA 2O5ZL 1PZ3A 1ZAIA 2E9LA 4XXCC 5AYXA 5HP5A 1A7OL 5KVGE 1V3JA 5JMOC 4GI6A 3H42L 3O3AA 4IMLA 3HBZA 4I9MA 3WLBA 3KWVA 3BZGA 2OZTA 2BIHA 4W9EC 3W7CA 1EAJA 4Z1YA 3Q94A 2Z0BA 1X4YA 1FZMA 3DC0A 1WA1X 5I78A 1HI6A 2DWEA 3QVQA 1KEML 3MOBL 3NP4A 4XO4A 2K6WA 4H8QA 4UMGA 1HKVA 1EH9A 2O4EA 5LBSA 3GSVB 2WAHA 3P4LA 4ZB2A 2TSBA 3OL2A 3ZY7A 1V05A 3NVQA 2GQ3A 1M42A 3O6KL 1HQ4B 1WCBA 1KDIA 3SJ3A 3RZCD 1PTZA 2Z35B 4ATDA 3RCNA 4ALDA 5IB3A 5D7LA 5B22A 1AZUA 4ACZA 2XACC 4UMSA 1PEWA 1Q85A 1QHOA 4P4KB 4X0NA 3KJ4B 2BSBA 2HKHL 1SM3L 1R9XA 5TE4H 1EK3A 2GUOA 3CDZB 1GORA 1IBZA 1EGZA 4MKMA 1WRFA 3NTCH 3CFCH 3V4PL 2FO4B 1UYWH 3RLUA 1VLXA 6ENLA 3N15A 2BK8A 1ACXA 1AJ2A 3OIXA 4OD1L 3QB7C 4KRZA 4QHPA 1HZKA 3EYQD 3MMUA 2J8TA 4K55A 2DN7A 5D1QC 2HCVA 2DUXA 3VD7A 1OX6A 2BSSA 1YDNA 4D8LA 3QSKB 4H0HB 5JPMC 1IKFH 5DJXA 4X6BB 1HYRC 3HRZB 1ACCA 4LLMB 1FCQA 1GQIA 3RGTA 4PP1D 2OMWA 1HFBA 5LAPA 5LBVA 3ZX1A 5FLVA 4Y9EA 4Y5XC 1Q6CA 1W6TA 3WMQA 4DZ8B 1DBAH 5EEXA 4O4WA 7PTDA 1ICSA 3N41B 2W0PA 4LSUL 3BQUB 1B90A 4R0LC 1M7IB 2DP3A 2Z35A 2OZ3A 2YJLA 1MXSA 1XCQA 1KFLA 2W95A 3DTDA 4PS7A 2UY7B 4O02B 3VYPA 2FATL 5TE4L 4P4KA 1K9DA 3NVTA 2OX5B 2PLTA 2Y85A 3P77A 3ZVVA 4DN4H 3NTCL 3CFCL 3CDZA 5IVXB 4TTUA 1ZV9A 4OFDA 4PJGB 1E5BA 2X1RA 2VMDA 3JWOL 3SE8L 2NZIA 4JFHD 3O6FC 1OG0A 4W9TA 3AHZA 3NFSL 4YXKL 1G43A 1OAKL 3W5NA 1F6KA 4F57H 2X1TA 3JZUA 1IKFL 2QJJA 1UFGA 3VFCA 3CO8A 2G9HB 1A9BA 4X6BA 5CZVH 1NTDA 3LHTA 2R29A 4IBUA 1ROCA 2GQ9A 2F61A 2VMCA 3HBPA 2KDGA 2J27A 3DTUB 2A7BA 3IUIA 1JHTB 3X13B 1DBAL 2CLVB 4IPIA 4AKQA 3VFNB 3DK2A 1WFTA 2W9LA 4NAFA 4AJ0A 3ULUC 2NY4D 3EJZD 4LEOB 1M7IA 2ZUSA 1ZLPA 3RUGF 4B9GA 1BOGB 2FWUA 3L5WB 1J12A 2QTVA 3NGBC 1X5YA 4DN4L 2UY7A 4O02A 1SGKA 1QA9B 1UUQA 4F8XA 1FORL 3SCSA 2ON3A 4HWBL 1MCPL 4Q32A 4I7VA 4PJGA 4E6MA 4R53A 4UT7L 5BZWA 1NIFA 1PAZA 1S2VA 3CVHH 4ZZFA 1VEMA 3MKGA 2PB1A 3OEXA 1XSOA 4OVXA 3A12A 3HN8A 3OJGA 3PZVA 5MKGB 4KGLA 4UNTA 5J5RA 1EAPB 4DKFL 1UB3A 4X7FC 1WE5A 2H0EA 3X17A 1FOBA 1WNOA 2YPLD 3OOQA 1T0NA 1XR9A 3VA2C 5CZVL 5IREA 1T20B 4YC2B 2J6EH 4PUJA 2AKMA 3CWHA 4JGNA 2K78A 3MRKA 1MJ7L 1A5SA 4A7GF 1WYJA 1CL7I 3C09C 4DPAX 2G30A 3HGOA 4IFKB 5D1XD 3OXRB 1BG4A 3QT2A 1JHTA 3RM9A 1AW1A 5CZXD 3LIZA 1G4SA 3VFNA 4KI5F 5J06A 2Y6TE 4RGOH 4LEOA 3VQ2C 4LVHC 4MKTA 4UZSA 2A4AA 1PZBA 3L5WA 2E8ZA 2A6IB 2AQNA 3IDJA 3QPZA 2B5IB 3CUJA 1E5JA 1XIGA 4UNLA 3BUVA 1CICD 3IDGB 5I1JH 4L4LA 3SFWA 3CVHL 3IMUA 1TO5A 4MJJA 1V4YA 4URKA 3BKML 3CVIH 2V8ZA 5D2LE 3UGUA 5MKGA 4UDUA 3DTXA 4OLZH 4WNSA 1EAPA 5I30L 1DEEA 1PCSA 3WV0A 2Z00A 3V7AG 1JUEA 1XQ4A 3MO1B 2Q3OA 2Z91B 3FTZA 1Q9LB 1G7PB 2VFHA 2J6EL 3UA4A 3AYRA 3QPXL 1GY2A 1QFWI 3AU2A 2J5WA 5CZKA 3DUSB 1VB9A 5KZCD 4HC1H 3NPSC 3QEQB 2I7OA 3SQLA 4O1CA 5EIIB 4X0VA 3QUXC 4IFKA 1E0TA 3L5MA 3OXRA 3DX9B 4PGZA 3LTYA 4HEMA 3QHMA 4FHAA 1XC4A 4RGOL 2W6RA 1GZQB 1DUZA 3CHRA 5C07E 1AJZA 3QMRA 1Y18B 4CVZB 2Q7AA 4N5EC 1S7VA 1P7QB 4PI2A 1DQKA 1KTJA 3II3A 4KWWA 3TNOA 4W85A 2A6IA 4DO6A 2DKMA 5KSAD 3FH8A 4W9CC 3SUUA 3ARBD 3D07A 2VR6A 2E40A 3IDGA 3GNXA 3TJHD 3RB5A 1OSZB 3CVIL 3SADA 1VRDA 5I2IB 3AXLB 5EB8A 1U93A 4XAGA 4OLZL 1UQYA 2WHKA 5T1LB 4TPRH 4MWAA 2OFQA 4Z7OB 3MO1A 4KU1A 2Z91A 4FX6M 4WY0A 4M82A 4U1LA 1QACA 3TN0D 3MS8A 1W9DM 4A39A 1EIXA 2Z24A 4TV5A 2VXUL 1I9JL 2G0KA 1UUNA 3QEQA 1SW7A 2L7UA 4OSUH 5EIIA 3SDAC 3CNYA 3CH8A 3DX9A 1MIMH 4HJTA 2VRJA 3P62A 1GZQA 3EKGA 5E4AA 4AL8C 2XWBB 1J5IA 2VW7A 3N43B 2HJFA 1B0IA 1IEVA 2ICWB 5HYSB 2QS8A 1R5VB 3OAUL 3UAEA 3BJLA 2R69H 4R9OA 4U3SA 1CQYA 4HALA 4L6DA 4BY3A 4HIXH 3HC3L 2CKRA 4D2JA 3ZHKA 1NDGB 3TZVC 1FKWA 1OSZA 3QDAA 2P1FA 1FH7A 1R7OA 3UZQB 4GQPH 4R84A 5C1MB 1RPXA 1O7DC 5I2IA 3B9NA 3JZ7A 3VWJD 3AXLA 5FO9B 4RXGA 4ONOA 5CXPA 5A6MA 2VO8A 4TPRL 3QTPA 3CUHA 1C5CH 2AL2B 2ZKXA 1MUMA 4UBPC 1ZE3C 1FUNA 2PSNA 2PLCA 4KRNA 3WNLA 5I03A 1BFNA 1QK2A 3WN6A 3WUGA 1KFCA 3BEVB 3KBWA 2KMWA 4KO6A 4LLUB 1T7YA 3FQYA 3LVTA 2MCPH 1V02A 3Q6GH 4HS6A 5DQDL 1NMAL 1XO8A 3KH4A 3VFOB 2NQCA 4ADIA 3SBQA 4I3SH 2XWBA 2FT8A 3KEDA 4DBUA 3W1AA 2B1HH 3DX7B 3EMCA 4QI3A 5E2VH 4BF7A 2ICWA 4XVJH 1R24B 1X9QA 1R5VA 1CFTB 2VITA 2R69L 3P2TA 1FI8C 4NQQA 3GFYA 3THQA 4QAIA 5F7KC 5ABFA 2JCCB 4UTBH 4P2OC 1IBBA 4MCNA 2X0YA 4I3RH 1K4DB 4OFYA 2QSTA 1XDMA 2PTZA 2F1BA 1EXPA 2L4OA 1F5WA 4WU7B 2ZYRA 1FFQA 2MCG1 1W1ZA 2BP3A 3TNNB 2JF6A 1C5CL 5FO9A 2XPYA 3FSWA 1L9WA 2Q8ZA 3JTTB 2RJGA 4YSCA 2AL2A 4I0PC 5BOZG 4C59B 3W0WA 1LO0L 4UB0L 4HH8A 3S5LA 4HJIA 3S36X 2Z31B 1BF5A 1UD4A 3RG6A 1NCBH 3N5AA 1ZP3A 3BEVA 3PR2A 2HZGA 3P2DA 3A3HA 4BFEA 1ILSA 4ONFH 4YWGH 2CKBB 4D8PB 2MCPL 4PM1A 3Q6GL 2H3NA 2ZUYA 2PYFB 4UT9A 1ICQA 1AD1A 2BOBB 1K5NA 3PUUA 4I3SL 4XN2A 2QVMA 5LIXX 1HSAA 3NQVA 3OPUA 5E2VL 4GBDA 4IKJA 4KIRA 1Z1WA 2NTFA 4XVJL 3RJOA 1NEZA 2ADFH 4I9WE 2J44A 4FKHA 3D12B 1YG9A 1KIUB 2VCCA 3UZVA 1GPFA 1CFTA 2ZFAA 1T7VA 1HW6A 1UP2A 2VQ4A 4G5AA 2IH1B 3RTQC 2HV5A 2IKJA 2E6FA 1SLVA 1FCVA 1VFHA 3T07A 1P4CA 2XIJA 1AD0A 3DG7A 4LFHD 3IIOA 1G1CA 3HMXH 1VEOA 1CLXA 1FWAC 4DN1A 2E5EA 2C5DC 2DQIH 2RJHA 4PVMA 2X7LB 3WIJA 4L1LA 4OLWH 5EUOF 1KCUL 4PMZA 5EPMB 3MNWA 2B59B 1C08A 1E7UA 4K3GA 4GYPC 1QFWM 5E8EA 3IWPA 3FYOA 2V3FA 3IUDA 3IIXA 2J8OA 2WQ8A 4YDNA 3JYCA 3BURA 4YWGL 4D9QE 1T22B 4Z1CA 3CCHB 4U28A 4KJWC 4B4FA 2CKBA 4E2VA 1KLFA 4LOFA 2PYFA 1WXJA 2EPHA 5RUBA 5BU9A 5F7MC 3LNFA 5I73B 2XWRA 5B3JE 3QDJA 2R2EA 4XMTA 2CSPA 3OG4B 3VCCA 4N20A 5C07D 3ZMRA 4KTDH 1SF3A 2A74B 5DLCA 1ZTVA 3V1PA 2FWOA 3PJSB 2OR8A 5HOSA 5IMOB 4HZLA 5JQIB 4UTTA 4Q4QA 4E9LA 3VJ6B 3HMXL 3GZ3A 1KYOJ 1CDUA 2VXTH 3DDFA 1G7LB 3MVTA 3E0VA 2EUXA 4YHYC 4WJKB 5EF1A 4D9RE 3NWRA 3BPOC 2X7LA 2V2XB 3UBXG 3TWBA 2H3XC 2PTVA 1IAOA 3N3MA 2UZYB 4EKXA 3SDDA 3QRBA 4LXFA 1FPTH 3WLTA 4XAFA 5AQ0A 2VL4A 4U6VL 3W2LA 3FT4A 4DEFA 1UWSA 3OWEA 2OYMA 4BZ2H 2VCBA 3QUML 2WXIA 1JCYA 2A7RA 1XLKA 2WXGA 1CPUA 4JIRA 3RPDA 1RZFH 1B3IA 2WXKA 4UTAA 3TN3A 2EDMA 5DT5A 3WO4C 2YBTA 2NY6D 5FKAA 3F5KA 1ODUA 4KRLB 3N0AA 3P9LB 2WMFA 5L7XH 3ZVIA 3FSVA 1ORSB 3CQKA 4JKLA 4MNHB 3KPQA 4R97B 3PAOA 2GZXA 1QFOA 3UP1A 2PWDA 2NQJA 4B5TA 4QTGA 2WIIA 5E2JA 4PL2A 2Y3NA 4MG4A 5KAQG 2E7HA 1I9IH 4WRHA 1E27B 2EXTA 3GTFA 4Q4IA 4DZHA 3U7WH 3IARA 4KNUA 12E8H 2W0UA 5B8CC 3B1TA 1DQXA 5I3JA 2ZXDA 1G7LA 4ZMOA 4WO4C 4H20H 3H12A 4DZ5A 3SIKA 4KV5F 4X7EC 3HPLA 2V2XA 3ZL2A 1V93A 1H6TA 3PJLA 2QTEA 4PB0H 2UZYA 4JDEA 1F2JA 2IAMC 4ONHA 4J3VA 3L2IA 3QJHA 5HNTA 2ZUVA 3FS2A 4JS7A 5DBUA 4K07A 1EEQA 4V1XA 4YLCA 1J6PA 4A8NA 3ZW3A 2EACA 2Z25A 5D8JH 4G7EB 1X5FA 4ZUSA 1M7OA 4MJ5B 1RZFL 3TXAA 3IAPA 2D7NA 2VMJA 3U0WH 4F5CE 3N2TA 3E2VA 1I60A 3HS0B 1SO6A 3CJPA 3NXFA 1DPMA 3O2WL 4PSRA 3FGCB 5L7XL 5DD0H 1IO4C 3NEOA 3O41B 1TV7A 2Z9TA 2VDIA 1F6AB 3V4VA 4JEQA 3LHAA 2X1QA 3E7JA 3IS1X 3BGAA 3FCBA 4Q6IC 2V37A 1I9IL 3BLKA 3DO7B 5HHXH 4P3DA 1RZKC 2AAAA 5A3ID 3ARQA 1IE4A 2QDHA 1AHMA 1E27A 2GVEA 2ZCHH 3FRUA 3IDUA 2V68A 4IFRA 3NEVA 2BMKA 4YDMA 4UFKA 4H20L 4LCQA 5F71A 4PB0L 5E8NB 2ZWKA 3DGDA 4QLRA 1LO2H 2FZDA 3BEWB 3KLQA 1J1XL 3ULUH 5B21A 1YJDH 1BYNA 4Z3JA 4QM1A 5F7YC 3D5HA 5KSUA 4JTLA 4EPSA 1NIDA 4MJ5A 3IF1B 3U0WL 3UZEA 1UJ3B 1T66D 4M03A 2Y7GA 4J8RB 5E08H 4DP8X 2HH0L 4OGAD 1X5IA 3DBXB 1B54A 3LLDA 4LNYA 2IPUG 1E30A 2FKPA 3VKJA 1G94A 3UTOA 2NYZA 1T5WA 1W17A 2Y5SA 5HHXL 5IJCC 2WZHA 1LHZA 3KDMB 5I3HA 4PJ9D 3DO7A 4FL4C 2J9ZA 3MRJB 5FYLH 3NABH 3H24A 4YDKH 2HAZA 3IJ9A 4MDOA 5DJCB 1NELA 5FI8A 2O92A 2E4TA 4B0MB 4NZ3A 1T0MB 4IRJB 3II1A 4QE4A 2E7LC 3FV9A 4S2CA 3SFKA 4OF5A 4YR6A 3DX0A 5HMFA 4XD5A 3GNDA 5BO1H 5D6DA 2VP8A 2Y0SA 5E8NA 1LO2L 3H7VA 3MRLB 1ZLUK 1RPQA 1AODA 2CRMA 2HVJA 3UXDA 3H9SD 4Q22A 3IANA 1AHKA 4ADTA 5DWUH 1RY8A 1W0WB 4HYRA 5C54A 5E4EC 2WKGA 1MVYA 1LK2A 3S8FB 2PU0A 4XT1C 3IFLH 5KBNC 4LYPA 2JJTC 2H1LM 3QC3A 1UJ3A 3APYA 4J8RA 1OTSD 1C8VA 4EXPX 3G1YA 4ANKA 4PY8I 5GNZA 4MAUH 4FLSA 5D4IA 5K9OB 1YN6B 1NH6A 3Q8EA 1K9TA 2Z1VA 5I1DB 1RSCA 4JX4A 1CFVH 3DX2A 1MRQA 5AVHA 1Q72H 4RFEB 2E6QA 3N19B 2AXGB 3KDMA 1CW2A 1OGBA 2A3CA 7XIMA 3WX7A 1W5NA 3NABL 3AY4A 4BI6A 3MRJA 1L6PA 5JW4N 4OOZA 2CLFA 4O52A 1JS4A 5DJCA 5AVRB 4KFOA 3EDDA 1T0MA 1AW5A 4JRYE 3W72A 5CLWA 2DDQH 3MYOA 4KMTL 5IKCA 1JGDB 5BO1L 2VCOA 3UAJC 7TAAA 2EKSB 5HJLA 2ZWYA 3AS0A 3MUXA 3GIPA 1J8HB 4J3UA 3S2MA 4HCFA 5A2IH 4QLWA 1F8MA 3T65B 4D9RD 5T5FA 4Q2ZB 5DWUL 4IBWA 4BWLC 3WNNA 1TPWA 3WAKA 1U6AH 3PWJA 3KDPB 2Z3FA 1OP5H 1NIEA 2DY3A 4EIBA 3OG3A 3NZPA 1W3LA 1MZHA 3GEWB 5I76A 1UCWA 1BQLL 2JKXA 3GTIA 3VXPB 4RFNB 3UMTA 4O58H 2VOTA 5HDRA 2X0HA 4OUUB 3C6LD 2PD5A 3L2MA 5I1DA 1Q72L 3UESA 1LM1A 3DGRA 3GVVA 2KLRA 4RFEA 4XWUA 1SUJA 1WBZA 4AK1A 2AXGA 2QQNH 1C91A 4P7OA 1E51A 2X1PA 1LT7A 4MUPA 1GQNA 2KZ1B 3K2UH 2YPVA 3LQGA 3NQ6A 2DDQL 2CXGA 4KY2A 2LFGA 3W2MA 3GRBA 1KA9F 4XO8A 1DHPA 1R75A 3DOSB 3T77B 3V4PA 2VN5A 3FQ4A 2EKSA 3HLKA 3CQHA 3UABA 4JQ2A 1J8HA 3OMZA 4U1SB 5DJAB 1KBJA 2KDYA 1QNIA 3T65A 3BANA 3M0KA 1ZAGA 1YEWA 3SKNB 1E5YA 4CJ1A 2F7PA 1TTUA 3DX4A 3C4UA 2V9QA 1BX2A 1U6AL 1LUCA 2IH9A 2WZAA 3MLXH 3BAIA 5DS8B 5CNHA 3ORJA 5F2GA 1K8IA 3RP1A 3R18A 4Y8EA 2BLFA 1QTPA 1XYLA 3D0LB 4FXKC 3BAEH 1FL3A 2NT1A 3E6FA 4KEVA 1TUXA 4PUMA 2DI9A 3VFUA 3VXPA 3T2PA 4HPHA 4I9JA 1G01A 4US6A 3BE1H 2NUWA 1KEGH 2PTWA 1K3UA 4P2QA 1ASOA 4PJHE 2QQNL 2NQHA 2XVLA 2BZCA 4YVNA 1X5HA 4NGHH 3BSMA 3PNRB 2YGOA 5ENLA 2VR8A 5AY7A 3HHSA 4K7PH 2Q2EB 3WUBA 2ETWA 3H4FA 3L13A 3DOSA 3T77A 1SNRA 3GSUB 1R6VA 4F24A 5FM8A 3D87B 1PIIA 5IJVB 4DWSD 5LNUA 5DMIH 4LANA 5GNYA 1WHPA 1NCGA 3JVGC 5FUCC 3M41A 3GVGA 1RD6A 4YHPB 1U2HA 1T96A 4F7PA 4UM8B 5GS3A 3TCEA 3G6AA 2G0LA 2P8CA 1NGXB 3G8RA 3KXFB 5HK4A 3AACA 1ICTA 4YXHH 3BAEL 3S48A 4JFDE 3D0LA 5FCUH 3FFSA 4M3JA 2Y7SA 4WQOA 4L05A 4AXWB 1T1YA 4V2BA 4GS7B 1OO2A 4AB4A 4YPJA 3QUYC 3QI9B 3DFSA 4FO4A 1ZGLB 2ZPKL 3C60C 5D09A 3RFZB 1VBHA 1E8YA 2VABB 3AMDA 1NM4A 4WV1B 2IPFA 3AXHA 1EEUA 4NGHL 1UQSB 1YIXA 4QHLB 4JPVH 3ULSB 1MI3A 3S47A 3QYQA 3I6RA 1SXCA 4PI0A 1E9IA 3QFDB 3BPNC 3TURA 4HWBA 1N70A 1BM3H 4M93C 1D5BA 4XBMA 3V4BA 1BAGA 1E4KA 1XHHA 4I18C 1F4YH 5L4MA 2F1EA 4G80B 4DCQB 4XCCH 1UXWB 4IBYA 3ATAA 1IAIL 3HW7A 2BGQA 1OB0A 3VNIA 1U1JA 1CBJA 3MT1A 4RL3A 3CUXA 3MCLL 4A8IA 1PVNA 2K8MA 4YHPA 2AABH 2YD1A 1GOOA 1EKOA 2JGYA 4YBLC 2E1WA 3V0AC 1LTDA 2YAEA 3KXFA 3N12A 4ODVL 2KQMA 3AYTA 7PCYA 1I1RA 4AITA 3K5RA 4HDIB 4YSRA 3GG1A 3UL4A 4TVUA 5JMUA 4AXWA 4QRPB 4BKSC 3QFEA 1LBLA 2P5WD 3N9KA 3QI9A 2OGYA 4XHQA 2X4RB 1ZGLA 1XLJA 1X38A 4PCPA 2VABA 3LEYH 5GRWA 4E9QA 4Z7UF 4QCFA 4O16A 4EOWH 4W89A 3DDMA 2F54E 1FWRA 2R56L 5CGYD 4QMEA 3SPCA 4JPVL 4FQPA 1UQSA 3PWPE 3S9YA 1O4UA 4CBPA 4QHLA 1FDJA 4HU0A 3TJIA 4H19A 5IK3B 4NQDB 2WKLA 5CPOA 1WZAA 4LK4A 3AU6A 1NOUA 2P47B 3QFDA 4C60A 2RR3A 3QWOA 3NGJA 1MCJA 2A0LC 1F4YL 1F97A 4XCCL 1A6UH 4GLRI 4PREB 5A40E 5HI5C 1IGSA 4G80A 1B2WH 4DCQA 1BQCA 1UUOA 5AW6B 1UXWA 4JRYD 2ITDB 1KYOK 4MXVF 4JJ5B 2WCAA 3EYVB 4W81A 4ADSA 3IDMB 5BVPH 4U3AA 4L8BB 4ZW6A 1UWRA 5B3SB 3KVKA 3BN3B 1FGNH 1R3WA 4FFVD 3QIBA 1N5YL 5DHMC 4JFXA 3DMMC 4LPWA 3MKVA 4ZXBB 1AW2A 3NPXA 1XISA 4J8QA 2NQDA 4HDIA 2DSVA 1W8NA 4RSYA 4BQ9A 4UU9A 5ID0B 1ZRUA 4QRPA 4C83B 4Q9RL 3FL7A 3STEA 4U6XB 2P5EE 3G8EA 5BNXD 4XI5C 2ZD0A 5IHZB 3LEYL 1NFGA 2OVLA 4Y96A 4FIQA 3QZ6A 3F5JA 1JZ7A 4H0LC 1TRIA 3NRQA 3CLWA 5KVEE 2VDRL 2DKUA 4JN7A 3B1UA 3GDCA 4FLQA 5IK3A 4NQDA 5BV7L 3STFA 3ATFA 3GWJA 4GUCA 3G6JB 3EHBB 3R13A 4JVWA 4XZUA 3SY5A 2J1YA 3S35H 1AJ7H 1N9PA 3VXRB 1AAJA 3ESMA 3D2TA 3M0LA 2R2CA 1E6XM 1PBGA 2QUUA 5IW6B 4JJ5A 4XIAA 3O6ML 3IDMA 4Q4MA 3DFNA 4RETB 4L8BA 3WFZA 1QHPA 5L8KB 3CL7A 4PGCB 3STZB 1QI3A 3QF0A 4DHLA 4Q7IA 2MCMA 1F4AA 3RIFK 4ZXBA 1B0WA 4JFVA 3GIVA 4NUQA 1SZGA 5DMLA 1W2VA 3NQMA 3UEZA 4XQ6A 4C83A 1P2CB 2PW2A 4JFSA 3GK8L 4A7SA 3IT8D 1W8SA 1U8JA