4NZFA

Crystal structure of abp-d197a (a gh27-b-l-arabinopyranosidase from geobacillus stearothermophilus), in complex with arabinose
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
431
structure length
431
Chain Sequence
ASMHHYQWAKTPPMGWNSWDCYGASVTEDEVKGNAEYMAKYLKPFGWEYVVVDIQWYEPGANSSIYRPFVPLEMDEYSRLMPAVNRFPSAKGGKGFKPLADYIHNLGLKFGIHIMRGIPRQAVHQNTPILGTNVGARDIADTNSICPWNTDMYGVDHRKEGAQAYYDSLFQLYAQWGVDFVKVADIVASKLYGTHTEEIKMIRKAIDRCGRPIVLSLSPGPAPLDHATLFVENANMWRMTDDFWDRWELLYDMFEQCYKWCKLVGLGHWPDADMLPLGHIGIRSVDGGGTDRMTRFTKDEQRTMMTLWIIFRSPLMFGGELRDNDEWTLSLLTNEEVLHVHQNGYGARQVYRENDHVVWTSQDAEGNQFVAMFNISEKRSVVSVSLKDLGCMEPMKARDLWAKEDLGLVKHQLAFELGPHQSILVKLSPAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Abp, a GH27 beta-L-arabinopyranosidase
publication title Structure-specificity relationships in Abp, a GH27 beta-L-arabinopyranosidase from Geobacillus stearothermophilus T6
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 147
structure length 431
sequence length 431
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4nzfA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4nzfA01
2ZXQA 3DI0A 3LLFA 3ZT7A 1TQSA 2ZZ2A 1UBSA 2RHGA 1CXKA 1JDAA 1WZMA 3KVLA 1KXQA 1IXNA 1VYSX 2V0TA 4O11A 3AMKA 1ZS2A 3WK0A 5AFDA 4LC6A 1PHQA 1G67A 2HS6A 3KRUA 5I24A 2WC7A 2YYUA 4DPPA 2IGTA 4WY0F 5HUPA 3LCHA 1UD3A 3K8LA 1MW1A 2P1FA 3E96A 2QUVA 4MZ8A 3EDDA 3LHYA 1CXHA 3UZ5A 1D9EA 1YYAA 4LC8A 1TQUA 4MJZA 4JDBA 5TQLA 3N3MA 3O07A 1FWSA 1VHNA 3HJZA 4OV9A 2KZHA 1LCOA 5D32A 1KM4A 3PR2A 1JAEA 5AOUA 3PB2A 3GDKA 1N8FA 1SUXA 1RR2A 1GZGA 5DCDA 3OLDA 2X1SA 3G1DA 1XSKA 1JCJA 4CN4A 4IMEA 4BWLC 5AB3A 3HG4A 2R14A 4QNWA 3S42A 4ZVJA 1WAUA 5AC6A 5HNRA 1FWWA 3L0NA 3GDLA 3WDJA 4N4QA 1XD1A 3L4TA 3R5EA 4JTGA 1LZOA 3S5YA 3IV3A 3LGEA 1ME7A 1BEUA 3EX1A 4IXHA 1MW0A 2ZUSA 3EJTA 1KLZA 1PVNA 4WUIA 2YFOA 2VT0A 2X1TA 5E70A 4GINA 2ZUWA 2EADA 2Z2UA 4HIBA 2RFGA 4NNAA 3DI1A 2Z1BA 3IVTA 1MVYA 2FHCA 1M5WA 4JS3A 1I8JA 1EX5A 1UKSA 3CZKA 4QM1A 3QF0A 5HWMA 4N4PA 4O13A 2ZZ3A 3KE0A 2E9BA 1I4NA 2V82A 5E9AA 1BSIA 3VGFA 1LRQA 2H90A 3DDGA 2W6RA 2ATSA 1GVFA 2BY2A 5BRPA 1F6PA 5I3KA 4FX8A 4A2RA 5HPOA 3IIVA 4FEZA 3W74A 1RQEA 1UKQA 2VFEA 4GBUA 2OW7A 5DBUA 2ZA1A 1V3LA 5IBXA 5FF4A 1CXFA 1KGWA 2OT1A 4AF0B 1J0JA 2QMKA 4O0KA 3IEBA 2ZRXA 2JBMA 3VMOA 3LHUA 3VMPA 4Q33A 1CX9A 1GT8A 3C56A 1YPIA 5L9FA 2EJ1A 4MOZA 2NV1A 3EWWA 4XBSA 2ZX5A 4WOQA 4UXDA 5L6UA 3T40A 3G1XA 5K3VA 1LBLA 1ONRA 2QKFA 1FXPA 1SQ7A 1OFDA 2Z6JA 3NGJA 4TX9A 3M6YA 1ZENA 3IIXA 3IIOA 1CGTA 1XBVA 2DORA 3W86A 2DP3A 4HPJA 2GJNA 1VH7A 2Y62A 3W7MA 3HGJA 3TR2A 3QMTA 1WQ5A 3MHGA 3D50A 3KLKA 3NQ2A 4DELA 3TXZA 4L4LA 4AIOA 1KM3A 1UUOA 1SR9A 2NUYA 1V5XA 1S46A 1OFPA 3M07A 3NQVA 4LWWA 2W0UA 1MO0A 1D3GA 1H7WA 1SW3A 4CQ9A 1U33A 1LBMA 4X2RA 4LXFA 3LBMA 5AHIA 2ZDRA 5HULA 3DHPA 2G95A 1HTYA 1W8SA 1TPUA 4FNTA 4N9EA 1J4EA 1I2NA 3GXNA 1LRTA 1SO4A 1QWGA 4RJEA 3RILA 1CPUA 3L0GA 3PG8A 5H2ZA 2WNNA 3O1NA 3O63A 4JICA 3M5YA 3GAYA 1C9DA 1OYAA 3VMNA 3U2OA 1EIXA 4JTJA 5HWNA 3GDTA 4ICNA 4JTFA 3NQFA 3BUBA 1TPDA 2OYKA 1VYRA 3R89A 1OK4A 4UNLA 3VU2A 4UUIA 5F2IA 3VE9A 3E49A 4IPIA 1KV5A 3OVQA 2WVSA 2EF9A 3G1VA 3N73A 4FB7A 2CLEA 3W70A 3BSHA 2QCFA 2AAMA 4ZQRA 1CXIA 2EGZA 1EB3A 5EPDA 3P5ZA 3LV5A 4BI7A 3WN6A 3W23A 1Q6RA 3PBYA 3QRHA 5LGXA 3NQAA 2Q8ZA 2OMAA 2EACA 3A21A 2FHBA 1V3MA 2BY1A 1WXJA 2ZZ4A 5C2XA 3A5FA 3VX0A 2A1YA 4HSOA 1OFBA 3W72A 3TFCA 3P8JA 2XFWA 3DBPA 1FWTA 4HPXA 4RZ6A 2XN2A 3WNOA 1XL9A 5HJLA 3ZSTA 4ORIA 2BZNA 5DCEA 1FWRA 3LCWA 4KKXA 4XUGA 3F4WA 1UH2A 1O5XA 2ZRVA 1CGUA 5G2WA 1TPVA 1OYCA 2C7FA 3NAVA 3L2IA 3CZGA 4PCTA 3TC7A 1QWUA 4FNSA 1JCXA 4U2YA 3A23A 4GI9A 3LOTA 1M7PA 5I5RA 3QW4B 3TIMA 4AB4A 3QYQA 2F7FA 1R2RA 1DHKA 3MYPA 1KFJA 3V1PA 3TONA 5BRBA 3WENA 3RK8A 3LM7A 2E1DA 1KWKA 4MPQA 3II1A 1G1YA 1F6KA 3OBKA 1JI1A 1YLVA 1ZFJA 4AW7A 1VZWA 4JTSA 3V75A 1QPKA 5F4SA 3C2FA 3NQEA 1BG9A 1GVQA 3B06A 2XN0A 2FPTA 3ZWSA 1HL9A 5KEZA 3EKLA 3C2VA 1ZY9A 3EXTA 3NM3A 4XKYB 3S5NA 4UQCA 2BWGA 2OSXA 3PUDA 1OX4A 3PY2A 4J3SA 5J5RA 3MWAA 4JGDA 2I1OA 3IJ9A 1VCVA 1W1ZA 5BOOA 3S6DA 1W0MA 5DLCA 2EHHA 2ZFAA 3B0VC 4M6VA 1VAHA 1KFKA 3TSBA 4ONVA 4UNKA 4J28A 3G1HA 5IBXC 2PCQA 3TXVA 4PL1A 4AYSA 4MVAA 1KGXA 3WK1A 2VFHA 2V2DA 1SW7A 4UTIA 3YPIA 2X2JA 1P0KA 3O8AA 3THAA 2NXGA 2QJIA 1R46A 3C6CA 5BMWA 1HO4A 3HPSA 1ICPA 4A3UA 3WJSA 1A5AA 4OWGA 3M16A 1KFBA 3C2OA 4Z1BA 4UZSA 1LRNA 2TSYA 3RF9A 3IK2A 1FCUA 3VCRA 2BXYA 2D3LA 3QQ0A 2PWHA 3FS2A 4A29A 3DX2A 4JFVA 1J0IA 3FW6A 1JR1A 4LV9A 5D37A 1UD8A 2YGYA 3W75A 3LTPA 4LOCA 1HVXA 2ZWZA 1KWGA 3THQA 1TRDA 1H61A 1UD2A 3CPUA 3I65A 3OLIA 3MW7A 2E8ZA 2F7RA 3TW6A 1TV5A 1CGYA 2WANA 4H6KA 2QMJA 4BI5A 5EY5A 3QSRA 1TQWA 3INPA 5U7SA 4ALDA 2D0HA 3VGGA 1BWKA 2QDHA 5HUOA 3DHUA 2QCHA 2YCEA 3W2JA 3TV8A 3N2XA 1QOPA 3P62A 5EYWA 5LNWA 2G97A 2QCLA 3UWUA 3B05A 3L4UA 1G4EA 4OQVA 5CZSA 5D33A 5HR6A 1JD7A 2RH9A 3BUIA 6ALDA 1CGXA 1RP9A 3BLIA 4JTHA 1THFD 1GOXA 3BW4A 3G22A 3MHUA 2E5DA 1DHPA 2GJRA 4UOQA 1UOKA 3GAKA 3P8IA 2CLMA 3PSWA 5K9CA 3W7QA 3WJYA 3TJXA 5K4XA 1H62A 3L2LA 4UMBA 2CZDA 3NM1A 4MYAA 2ALWA 4LS1A 1NVMA 1LYXA 1OJXA 4AEFA 3EDFA 3CZEA 1IXPA 3SI9A 4JNMA 2V2CA 3U8GA 2R94A 4DO5A 4YCPA 4LY8A 1C8QA 2WPBA 3NPWA 4LUIA 1ME8A 3RFAA 1C29A 1B9BA 3EDEA 2VRQA 3FAWA 3ZR5A 5F4WA 4CQAA 1MEWA 3NA8A 3W3OA 3D51A 1HUVA 1AK5A 5D2XA 3DC0A 2HMCA 4Z1CA 1OF8A 4FLRA 5G2IA 4YXGA 4Z1DA 4BA0A 1A5CA 1EP1A 4PH6A 1MXGA 4J3UA 1TQTA 4HP5A 2ISVA 3L4YA 3QGVA 1P1XA 3OLEA 3BAWA 3HBLA 3P67A 4OT7A 1FQ0A 3B4UA 2V2HA 1UD4A 1WZLA 5FF0A 4NNBA 1W31A 4CNPA 1H50A 1WOAA 2WVVB 2H6RA 1CIUA 3WNMA 3LTSA 1OGSA 5G2HA 1Z44A 2ZA3A 3B04A 3BMWA 3T78A 4MKNA 1GVOA 1LORA 4X3ZA 3TTYA 2FTPA 1ZCOA 4PL2A 3IVUA 7CGTA 3GNDA 2QUUA 3EJRA 2BSLA 1LOQA 1K7FA 1KBIA 2WO5A 3UWWA 3W7IA 4C1LA 4GKLA 3W7OA 1D3HA 1W56A 2ZXBA 2GVGA 1U30A 1SMAA 3ZSSA 3ABSA 4IMGA 1G6CA 3W7GA 3DH7A 3DX0A 3ZT6A 3ECQA 2AQWA 2FIQA 1BAGA 1TSIA 1B4KA 3VNYA 1OT1A 3FKKA 4IX2A 2TAAA 5DFAA 4AF0A 3W1AA 3HGOA 2YPIA 4KWWA 5KTLA 2WNZA 2OYMA 3DX4A 4GUHA 4O1DA 4EWND 1KM1A 1H7RA 4NX5A 1L6WA 2DIJA 4UNIA 3ABRA 3N34A 2Z0IA 5I0DA 2VEPA 5DY2A 1TYGA 2ZRWA 3UG5A 2TPSA 2VOMA 4W93A 4O50A 4H8HA 4N02A 3G18A 1O5KA 4O57A 3W1TA 3DU0A 4K36A 2E5BA 1VFOA 5LNUA 4RCXA 2J27A 1OHLA 3LV6A 1MFVA 3TU9A 1VIWA 1JCLA 3OEXA 1SW0A 4RLIA 4LRTA 4A22A 2C19A 4A2SA 3LTYA 1KM5A 3GXMA 1GG1A 4JCMA 1QMLA 9CGTA 2CLHA 4LV4A 2ZBTA 3I7RA 1S3HA 5A6LA 4OBTA 1XCXA 2Y6ZA 3ZQ9A 3TMQA 3LHWA 1JCMP 4UTTA 3NZRA 3L21A 3C52A 4UFIA 1H60A 1G5AA 1H5YA 5CKSA 1XGZA 1EO7A 1R34A 4J3VA 3UWYA 1BVNP 1WX0A 1HTIA 1JUBA 1QAPA 3CWOX 1TTIA 2YX0A 1OFEA 2A5HA 2ZUVA 2FJKA 4RK8A 5TD4A 2ATMA 2DH3A 4XBKA 5D2VA 1GTHA 3W7CA 1WYIA 5LSMA 1UA3A 2NX9A 4OE7A 1OVDA 2PURA 4R33A 3L66A 3O15A 4N6EA 2CPUA 1OABA 3CPRA 3GR8A 2D0GA 3GLCA 3EJSA 2FH6A 2WSRA 4AMWA 3MP4A 5K4ZA 1O94A 4LTSA 3EWBX 4Q4KA 1H3GA 1L0PA 2YSWA 1LWHA 2Y2WA 1W5NA 4J7RA 1U5JA 4LPCA 4S2CA 1HWWA 1A5SA 3NOEA 4WJEA 2WQPA 2CLLA 3ZOAA 1Q45A 5KZMA 3HGSA 1XCWA 4NJIA 1E3XA 3K8KA 1O60A 2QUTA 3FIGA 5AHMA 3PBVA 2Y70A 5CSSA 5LZLA 4IPJA 1QW8A 1DBTA 4OKDA 3I68A 3EDKA 3G1FA 3MMTA 1QDSA 3CC1A 1PIIA 5KZEA 2NZLA 1GJPA 3A22A 1LLZA 2OCZA 2ZZ1A 4MYXA 4RZ5A 2Y7GA 4GE8A 4O8RA 1I2QA 1K8XA 1KFCA 2C0AA 4HT3A 2ZZ7A 3WELA 3M0ZA 3UWZA 4PODA 1E51A 3CB8A 3DHDA 4YL2A 5DN1A 2X16A 1FWNA 1GG0A 1KM2A 1SFLA 4AWUA 2YR1A 2EPHA 3FA5A 2XVGA 3IJ7A 1GTEA 4DF0A 4IMFA 2QAFA 2YIHA 5E6ZA 3GIYA 3N9RA 1GVIA 1CXEA 3EWUA 5D03A 3TSMA 1VS1A 4BK9A 3WFAA 2PWEA 4KWVA 2ZX9A 3E12A 3MBFA 3STEA 5I23A 2E6AA 4NVTA 4MFEA 1VFMA 4W9TA 5HR7A 1SZGA 4ZQPA 2FLIA 3A5VA 1ICQA 4JYEA 3R12A 4O54A 4XKYA 2XWDA 4JR5A 2ZICA 4N9CA 1E43A 3WEOA 4WQ6A 2WPGA 3FEMA 4QQ3A 1DL3A 1DORA 1VPXA 1LP6A 3UERA 3K30A 4M6PA 5J5DA 3LPOA 1DJQA 1JUEA 1EPXA 3VNZA 1XFBA 2E8YA 2WJZA 1H1ZA 4LVDA 1SSDA 2C15A 2A4AA 1F5ZA 4IOTA 3NG3A 1V3JA 3O05A 3NL3A 1YPFA 1C8VA 1K7EA 2JKEA 1OK6A 6TIMA 4BFAA 1B57A 1VLIA 3W85A 1T96A 2ZRZA 4JTIA 5BNKA 1LLWA 4G1KA 1PE1A 2WVTA 1BKSA 4XZ9A 4NJGA 3LHVA 4MUZA 3R13A 3W83A 5F1UA 1QPRA 4UOZA 3Q94A 2QCEA 4MIMA 2NWRA 3BG9A 1P0NA 1WE5A 1TV7A 4QITA 1IV8A 4UC5A 4CGTA 1RVGA 1XM3A 3TJLA 1JXJA 3HF3A 3BUDA 3A9IA 1IZJA 5D2WA 5FF3A 1VFUA 3W1QA 2ALDA 3UZJA 2O7QA 2Y89A 1TRIA 3W7JA 2VNCA 1XUUA 4NT0A 3AJ7A 3QPYA 3WDHA 1W54A 4NQ1A 1RP8A 4IMCA 1G4TA 1XXXA 4NNCA 1AW1A 4TMCA 1EEPA 4HNNA 1PZ2A 4K8HA 3LCLA 3LXAA 1KFLA 4GXMA 1SZEA 2ZRYA 3DAQA 1OFQA 4WY0B 4IGHA 2ZZ6A 3S1WA 1TPC1 3KX6A 2Q3OA 1EUNA 4UTTC 3N9SA 5G1YA 2ZRUA 3UNDA 3C61A 3BLKA 2CU0A 1PZ3A 3CHVA 1GYNA 1OX5A 4FXSA 3SW6A 5CPMA 3UY7A 2PWDA 5DXYA 3W2NA 1YDNA 3W22A 2PRMA 3G1SA 1G9HA 2QCDB 2FE0A 5AC8A 3QH2A 4E2BA 1JI2A 1HO1A 1W5QA 3HQ1A 4XQ6A 3SZ8A 3BLPX 1AG1O 3T44A 1QWNA 1WA3A 4WXYA 4UFLA 3S5OA 4IQLA 3T55A 4UIOA 4JXCA 4O16A 5MHBA 3M47A 8TIMA 4CCCA 2J9YA 3TNOA 3TQKA 1H7NA 4AXKA 3CTLA 3NQDA 2E4TA 3WJZA 2ZTKA 2D0FA 4PCFA 1TPB1 1BF2A 4O4WA 3DZ1A 4TU1A 1VCGA 4O52A 4DPQA 4H3DA 4CN1A 4UQBA 3RMJA 2NV2A 4CN6A 4PSPA 3VSUA 1WOBA 2BY3A 2B4GA 1RQHA 3HGRA 2WVVA 1PIGA 1QHOA 2PC4A 2R8WA 4FX7A 4JY8A 4FNUA 4AWTA 1KFEA 4GI8A 3TK7A 4UZUA 1UCWA 4U3CA 3S2CA 2DZPA 2A0NA 1HX0A 5HXMA 3C2RA 4I7VA 2Q3RA 1HG3A 3BARA 4WOZA 1JULA 3PSVA 1TIMA 5D02A 2WKLA 4WSJA 2H8XA 3M5XA 3CEUA 4ADSA 3PWAA 3GXIA 1OX6A 3UPBA 1GWJA 1OFRA 4C1KA 2ZWYA 4LVGA 1K7XA 1SSGA 3LRKA 1V7YA 2UV8G 4NJKA 5DELA 1RZMA 4JTLA 1UH3A 2B0MA 1TB3A 3B0PA 3EX2A 3FFSA 5K2ZA 4KFNA 1J0HA 3OIXA 3W76A 4MB1A 3P5YA 3T4CA 1K3UA 1MZHA 3ABQA 1I75A 4ZQOA 3TUUA 2ZX8A 1YADA 3W07A 4FX6M 5T26A 2CLIA 3KVMA 3H53A 2VENA 2OT0A 3D4ZA 3L2MA 3LBCA 2QCMA 1LDCA 3GXDA 2VFIA 3TW7A 3AXIA 2EKCA 2JGQA 1OSEA 3CM4A 3A24A 1JD9A 1QPNA 1VHCA 3UG4A 3BPWA 4EVZA 1L6YA 2WSYA 4N6FA 1FX6A 4RX0A 1MXSA 4UTUA 3DFQA 1AMKA 3MO7A 3MUXA 5CLTA 3LI0A 1P4CA 3USBA 4DEFA 4J9JA 4U4MA 2ZUUA 4J3WA 4QSHA 4KFOA 3DX3A 1KLYA 3W88A 1QX1A 1UD6A 3EWXA 4QNEA 4TO8A 4AHQA 5CGQA 4DQWA 1FXQA 1QI5A 2Y7EA 4M19A 4JIQA 3NXFA 2BXZA 4E0CA 4PA8A 1Z32X 3L4ZA 5ABTA 1HT6A 1F2JA 1BLIA 1BPLB 2ZQ0A 1RQBA 4Z0JA 4FMVA 4OIFA 3WY1A 3ANYA 2E77A 4ML9A 4UTKA 1CXLA 1TPWA 4FXRA 7TIMA 2XN1A 1JGIA 3CZNA 4M6QA 4UCGA 5KITA 4AEEA 3EJPA 3S9YA 2WNQA 2C6QA 4FLSA 4X9SA 1JRBA 1R47A 1G94A 3EJUA 4YLWA 3BAXA 5D04C 4GQRA 4LVBA 4DXVA 2ZTJA 5CG7A 2Q8LA 2HSAA 5E93A 5FEWA 3OA3A 3LXBA 3O16A 4CCDA 1IZKA 3TQVA 3CTTA 1M7XA 2QCNA 3KFTA 2VFGA 1KBBA 4POCA 5U4NA 2YYTA 2EEXA 1J5TA 5A2BA 2A7RA 3NL2A 3G3DA 3W2KA 4KFPA 1XUZA 1NM9A 3RU6A 3MYOA 4Q32A 1BWLA 3BCDA 1LOSA 3QJAA 4JFTA 1XKYA 4JFUA 4NUWA 3NQCA 4O4VA 3GZ3A 2X30A 5I3IA 1DJNA 2WSQA 3VI2A 2XIIA 4JCLA 3QQ1A 5CPOA 1E3ZA 3H54A 3QC3A 2WCGA 3QEZA 2QR6A 4BZYA 3TH6A 1YDVA 3TMLA 3RLVA 2Y61A 3ATYA 3TAKA 2FYVA 4KMQA 4UCFA 1XBYA 2FB3A 3KVJA 4DBDA 2QV4A 1ADOA 1Z48A 3PBWA 4YCOA 3IGUA 1RV8A 2XIBA 5AHFA 5FEZA 3MI2A 4X9YA 3EWZA 2D73A 3A4AA 1H7OA 3ABOA 4JL1A 1SPQA 2YW3A 2EAEA 3DFSA 1XSIA 5I3GA 3P60A 3BV4A 3MJYA 3DX1A 3LX9A 1EP3A 4KWUA 1JUKA 1GJWA 3NQ6A 5D2YA 1XV8A 4CNNA 1UUMA 1NAL1 4FNPA 4QAWA 2CLOA 1PJ9A 2E6DA 1WBJA 2VEIA 3PUOA 3W2MA 2A7NA 4O53A 2ISWA 4TIMA 1TQJA 4XTDA 1EP2A 2ZYFA 2HTMA 3C8FA 3TX9A 1QHPA 3KEHA 2QEZA 1PCKA 2WSKA 4O1BA 4GUJA 1QI3A 3L0KA 1B4EA 3KL0A 3STGA 4ADTA 1FBAA 3M1ZA 4EOUA 4QAIA 1V3KA 1XH0A 1TQXA 6CGTA 4I7UA 4R34A 1TV8A 5KINA 3PS7A 3VNDA 4DO4A 4GNJA 4O14A 3TA6A 3VGHA 5LGZA 3S8HA 1F74A 1DQXA 3TOPA 1KM6A 3A6OA 4TMBA 4K39A 4JX4A 3LLDA 1W5PA 1PL9A 2CFFA 4OGZA 1KXVA 3GDRA 2TYSA 4RKAA 4M8UA 1KBJA 4FHAA 1NOFA 1XH2A 2VEMA 3M9YA 3L5AA 3W1LA 4U31A 3VO0A 2VEKA 4MJMA 1DVJA 3BAIA 1TMHA 4WSKA 5HMSA 3KWXA 1O4UA 1PCWA 4XTIA 4HNTA 4Y96A 1Y7VA 2GVYA 2FFCA 1HFBA 1A5BA 4CNOA 3UCQA 2YA0A 4O19A 2WV8A 1K8YA 3C4UA 1VJSA 3H55A 1MWOA 1W3IA 3LDVA 5A2AA 2F18A 1LTDA 3VFLA 3W7RA 2V3EA 2A85A 3NQ7A 3HIJA 4FNQA 3PG9A 2F7OA 3HJEA 1IIHA 1L6SA 1X6UA 1HL8A 5CZJA 2YA2A 5A5WA 4GUFA 5BRQA 3M41A 2F7QA 1G69A 5I3FA 4NI3A 1GYLA 2AMGA 1JQVA 1KV8A 2X2GA 3E9AA 2ZX7A 2W79A 1AL7A 3IRDA 2QDGA 1PEZA 1RPXA 1JJKA 1XDLA 2ZIDA 4HSNA 5HDRA 1GCYA 3VGBA 2G5WA 4U28A 3SY5A 2V3DA 4WY0A 4L4MA 3IVSA 4JTUA 4FLOA 4HKPA 1K8ZA 4JDYA 4UR7A 5EKYA 3F4NA 3MBDA 4UTHA 2PRLA 3MI3A 4NXSA 4GO8A 5EL1A 3LCFA 2FDSA 4AIEA 3SSJA 4GC4A 1B3OA 3TC6A 4HA1A 1KGUA 1RPKA 3L4VA 4FNRA 3BAKA 1H7PA 3DGRA 2NT1A 1H51A 3JRKA 3T7VA 2E6FA 3SR7A 1WV2A 3VSTA 3O6YX 1K02A 3NPVA 1I2RA 1VC4A 4HHPA 3CIWA 1QW9A 2CW6A 1A47A 3W7EA 2GPTA 3TKFA 3G3MA 3WJXA 1L2UA 1TJPA 3G1AA 1KXTA 3W1MA 3GTNA 3WY3A 5G4EA 4FF7A 5EMYA 2WKJA 4GUIA 2V30A 3VM5A 1W3TA 4RZ4A 3W2LA 1LWJA 1EA9C 1PS9A 2RDUA 3PBUA 5AYZA 3GK0A 2B7NA 5LHEA 5LKYA 1VLWA 3HB9A 4CQ8A 3LB0A 3BVWA 3WDIA 1N7KA 2E0PA 2YDAA 1VB9A 2H3DA 2CHNA 1OX4B 1X1ZA 3IIZA 3WY2A 3P80A 4OU1A 4R7JA 2Y5EA 3KL5A 1FDYA 5AHNA 1X1OA 4UFJA 4EIVA 4WXZA 4UTWA 5BW6A 3M43A 4QJ1A 4R53A 5FF7A 1CGVA 3WMSA 4K7VA 3BW3A 3W7NA 4MY1A 4CKQA 2A2IA 4UMAA 1JDCA 3EX3A 1DKWA 3BC9A 1BVZA 2DIEA 3K8MA 1KW1A 2C1HA 2B7OA 2G96A 1TPEA 3CWNA 1G4SA 3DFNA 5D38A 2YZRA 2I14A 4IUOA 4HPHA 3P82A 5D05A 5HQEA 4XWUA 5CZTA 3I7QA 4AMXA 3JS3A 1H7XA 3VM7A 3CV5A 2F61A 1U83A 4CCEA 5FEPA 3BVJA 4PSRA 1FCQA 4MY9A 1YXCA 3PVFA 3NO5A 4UTLA 2D2OA 2XVLA 5LHFA 5KZDA 1Q6OA 3UQNA 3FYOA 4BR1A 1KXHA 1F76A 2V81A 3LHTA 1ODUA 1FDZA 1F05A 2YFNA 1M6JA 4E38A 1A50A 4O10A 3GR7A 1KB3A 1KA9F 3DENA 4LW7A 5EMUA 1FCVA 1T99A 2C14A 3W38A 1ZALA 5F2MA 4DO6A 1JQXA 2YA1A 4JD4A 1ZAJA 1TTJA 3WNLA 4AH7A 4CVWA 3NL5A 2DH2A 3HG2A 2F1BA 3TQ0A 2YKKA 2WSPA 4NU7A 1NF7A 3QPZA 4I9AA 5FEXA 2BHZA 3BSGA 3W1NA 3KXQA 1UKTA 3GKAA 2V8ZA 3HPXA 3NVTA 5DBTA 2YJQA 2H8ZA 1JCYA 1UA7A 3W2UA 3FKRA 1NFBA 1CI1A 4UMCA 4Z1AA 2J25A 4WF7A 3UY8A 4GJ1A 3QSTA 4Y8FA 3BH4A 1Q6QA 3HMJG 1LROA 3MP5A 3KAOA 5CLWA 3S0CA 2NT0A 4S2BA 3WNPA 3O6CA 3OHIA 1CGWA 1VRDA 3RIKA 1K03A 1QFEA 1SO5A 3L68A 4MFDA 3I7SA 1QOQA 4ADUA 4LVFA 4UFMA 1S5WA 4H8UA 2CZ5A 4J3XA 1MFUA 4DF1A 2A7PA 3CQ0A 5EA9A 2FPVA 4OJYA 5K9DA 4QISA 3SIZA 1KM0A 4JTEA 3F03K 4HN4A 1YXDA 5EBUA 3NL6A 1TMQA 3BUPA 3AMLA 2JK2A 1MW2A 4K38A 1X8FA 3FOKA 3N2MA 4K8EA 3R8RA 1FY6A 2FHFA 3G0SA 2PWFA 5K9XA 5AC7A 1JDDA 1VCFA 3W1XA 4B9YA 1WZKA 1Z41A 1QPQA 1OG0A 4UR8A 1OT2A 1JCNA 3N14A 3GXPA 3L4WA 2C13A 4EF9A 2HS8A 3HOJA 3S1VA 1LM1A 1TPFA 2C3ZA 2F7PA 1RD5A 3RLUA 1WBHA 3ZWTA 4YMZA 1IF2A 2QPUA 3M5ZA 5D09A 3W1PA 2VFDA 5HINA 4FO4A 2OSWA 2BLEA 3NR0A 3BLFA 3EJQA 5GVJA 2QAPA 3LXCA 4ZQCA 2EABA 4O1CA 2BHUA 4K37A 4S1FA 2YXGA 2C18A 3G0UA 4JL2A 3LCGA 1XC4A 3WJWA 1HL2A 4GUGA 3ZO9A 5FESA 3TCEA 4WLCA 4EF8A 1G4PA 1S5TA 2FQIA 3W1UA 4RV8A 1H63A 4JN6A 2DZTA 3OVRA 1XH1A 2XVKA 4NX0A 4UQEA 1ZJIA 3BCFA 2LLEA 1VR6A 4JEQA 4K6AA 2XWEA 3GBDA 2V3FA 2OZ0A 1F7BA 3SGUA 1F73A 1B2YA 2A6NA 3W7LA 2ZA2A 4UTWC 1SO6A 1FUYA 3QMRA 1AL8A 2X2HA 4HOZA 1OYBA 5CGTA 1QO2A 2GQ9A 2GJPA 3W37A 4M7TA 1W37A 4M56A 2GUUA 4FIRA 1SZNA 3L67A 3P84A 3D0CA 2RKXA 1EWEA 3D52A 5I3JA 4PC8A 2VXNA 3CT7A 1P6WA 2V9DA 4UQDA 1QO5A 4ZL1A 5F2GA 4AAJA 1L9WA 2ZCGA 2GOUA 2TMDA 3KHJA 4ORMA 3DXIA 4LS2A 3UYCA 3AJXA 5G1TA 4X0NA 4WD0A 3L4XA 3P61A 1A53A 2CXGA 3CGTA 5C6MA 3B0UX 3CLWA 3KLLA 1DTUA 3QMSA 1NEYA 3LCXA 3PC0A 2VR5A 4AEOA 2OSYA 4Y90A 3GVGA 1JIBA 3BAJA 2GQAA 8CGTA 4OHQA 1PPIA 4TR9A 3GYEA 1OB0A 1I2PA 1OFOA 2NX1A 2NX3A 2X1UA 4MLRA 4MZ1A 1WDWA 1UH4A 3EWYA 2J24A 1XBXA 1YTEA 1AVAA 4ZZ9A 4JFSA 5KSWA 1AMYA 1ZAHA 3EXRA 1GVRA 5DCBA 1HXKA 3CIXA 5A6MA 2X2IA 1ZHAA 1R2TA 4GRSA 4GIAA 1TTQA 5FF2A 5LNVA 3TFXA 2ZX6A 5SWUA 3LI1A 1MEIA 2VC6A 4FLQA 3AXHA 3PB0A 2FPYA 5H91A 2E5CA 3FJ6A 3GBEA 1UD5A 4AYGA 1SFJA 1KCLA 3CEPA 4GI6A 3L5MA 1CYGA 2C16A 4JYFA 3W73A 1XSJA 3C3NA 3PF3A 3L5LA 3G24A 3HG3A 4O28A 3B03A 3IGSA 1AW5A 3MP3A 4U2ZA 1ZJAA 1D3CA 4GFSA 1KBKA 1ML1A 1XBZA 1TQVA 3R2GA 1JRCA 1PHWA 1U2YA 1X7FA 4JY9A 3GXTA 2JKPA 2Z1KA 1EO5A 3L9CA 4JTKA 3WK3A 2RDWA 5AHEA 2WVUA 1KTCA 4K7YA 2WKGA 1WZAA 5K7JA 3MI6A 3S1XA 3ZS4A 1UJPA 3TROA 4UTJA 2F2HA 1YTKA 5KMYA 1P5BA 4UFKA 3M7WA 1PAMA 1W3NA 3Q37A 2PE4A 2P10A 3GX9A 4PEEA 5AN7A 1SO3A 3TSDA 3ZR4A 4DF2A 2GVLA 3EEGA 2VUYA 1IGSA 4JIPA 1IIGA 1HNYA 1MW3A 1KTNA 4IMDA 3ZT5A 4LS0A 4MZYA 2NWSA 1QCWA 2Z6IA 5G4WA 3PUEA 3BMVA 4H7VA 1CDGA 3NPXA 3NQMA 4IWWA 4DBEA 2QPSA 4NJJA 1JFHA 1SMDA 4GO9A 1MXDA 3WY4A 4AVFA 1Z42A 3UPWA 3W9ZA 3BG3A 3UXAA 4P61A 3OVPA 2BHYA 3NZ1A 1ALDA 3W7DA 3G1YA 2Y63A 3W7HA 3DDFA 1MEHA 1NSJA 3EXSA 1EWDA 4PEKA 4E2DA 1G7VA 4O18A 4BF9A 3TAOA 2J88A 2WOQA 4AHPA 4N9BA 1GPWA 2NLIA 1M53A 2X1RA 3O6DA 4CLMA 5F2LA 3CU2A 3F1QA 5C55A 1JF5A 1TO3A 2F84A 4HNVA 2OW6A 2DZUA 4LQ1A 4M7SA 3LRLA 3EDJA 4OV4A 4NZJA 2R91A 4N9DA 3EB2A 1QR7A 2ZXAA 2J9ZA 3NYZA 2ISSA 2QLYA 5AYXA 1IXOA 4GQQA 2QJGA 5F4XA 1J2WA 2DZVA 1TCMA 1R2SA 2CWNA 1E40A 4O1AA 1FCBA 1VYPX 1NF0A 2JGYA 5CGMA 3VGDA 3C0JA 3PULA 3D4YA 3NNTA 4LT9A 4Y9AA 1FDJA 3GB6A 5F1VA 2VKZG 1JG9A 1Q6LA 4O15A 4RR4A 3IJ8A 4JTTA 7TAAA 5AYYA 2ZZ5A 1JXKA 3QM3A 1QI4A 5E1QA 1M7OA 1YDOA 2NXHA 2Y7FA 3IGXA 4LNYA 1QNVA 4MLJA 4Z0SA 3TE9A 3Q58A 3HZ3A 4P2VA 2DZWA 1GJUA 1XD0A 2I9EA 2V5BA 1I2OA 3BLEA 3G0XA 3STFA 4B9ZA 1W9XA 3I6RA 4IJBA 1CLVA 1W5OA 3BAYA 4YWIA 1WO2A 3EX4A 2E68A 4LVAA 4BI6A 4JX6A 3DFPA 4O12A 4AHOA 1XCFA 3CLMA 1KCKA 5DXXA 3ATZA 4U33A 2VRKA 2NSXA 4ZQMA 1ZNNA 2OJPA 3BG5A 2PWGA 5CXPA 2EQDA 4XB3A 3BGGA 1TJRA 5HWJA 1SU5A 5C5YA 4ATWA 1DV7A 4HOXA 3KRSA 3SGZA 3W7PA 3UEQA 2EAWA 3GDMA 3BUQA 3G8EA 5BMXA 4NZFA 4AWSA 4IX0A 3OLGA 1YXYA 3FJLA 3W71A 5F7UA 2YW4A 3VGEA 4E2OA 2BX7A 3W7KA 4LRSA 3SECA 1ZJBA 2Y7DA 1ICSA 3NQ8A 1W5MA 3K1DA 4Y6GA 2B7QA 3DHFA 3LERA 4HNUA 2Y24A 4I7WA 1VGAA 3M5VA 3BVXA 3ZFHA 1XI3A 2DZXA 3FLUA 3QFEA 2FB2A 1LOLA 2P0OA 4LUJA 3MHFA 5CPLA 4X22A 5I3HA 1R75A 3LRMA 3B8DA 3KRZA 2H3BA 4M5PA 3W84A 3OG3A 5E0KA 4O17A 3HO8A 5C54A 2BTMA 2ZXDA 1TTPA 2J6XA 1SZFA 1PS3A 2BY0A 3GXFA 3WNNA 2GJLA 3TDFA 4H8VA 3DFOA 1EH9A 2QJHA 3QZEA 4WX2A 2A6LA 3PM6A 3FYPA 4ZQNA 3BLBA 3VX1A 2GQ8A 3ELFA 1G7UA 3BGJA 2OYLA 2NXIA 3NQGA 1VQTA 3UWQA 1AQHA 2D3NA 3BO9A 2NUWA 1H1YA 2NUXA 1XDMA 1CW2A 3QW3A 1S5VA 2DU2A 4UTMA 3BW2A 4BWLA 2Y85A 3VSVA 1YTDA 1VJIA 2EO7A 5A2CA 5DY3A 4NJHA 5CPNA 5E0FA 1J0KA 2CZFA 1UB3A 2C8NA 2QCGA 3RNDA 5FI8A 3L65A 3S5ZA 5CZ0A 1O7DC 2AGKA 2TRSA 3FAXA 1GEQA 2IQTA 3LHZA 4LU0A 1R33A 3P7YA 4IXXA 4MAZA 1TPH1 1B0IA 1ME9A 2ZE0A 2CLFA 2VELA 3AO0A 5G5IA 1OF6A 3BVTA 3W6YA 2O7SA 3NPUA 4QIUA 4D2JA 3UG3A 2G3MA 4JFWA 3P74A 1BTMA 3JR2A 3UD6A 1TCDA 2GVJA 2VFFA 2QCDA 1D7FA 3CZLA 2GUYA 4ZMGA 2V5LA 1Q4NX 1O95A 5A8GA 1PV8A 2WNWA 4MY8A 1Y0EA 5D2TA 4A21A 3KOFA 1QPOA 5DO8A 2AAAA 3Q2DA 3W1RA 2YOCA 1Q3NA 1UASA 3KL3A 4PFMA 1DQWA 2QF7A 4NXKA 3GNNA 1GQNA 3S1UA 1MSSA 2A21A 5CSRA 3KVKA 1AQMA 2ABAA 1EA0A 1AW2A 4B5NA 4TVUA 3BVUA 2RDTA 3EKZA 3N19B 4H4IA 1T0OA 3U6WA 5IM51 4HOWA 5AHLA 1WPCA 5LNRA 5LNSA 4J3TA 4N2YA 3CZSA 2QCCA 3P81A 1IXQA 3EX6A 4UQAA 3PAJA 1EUAA 1JVNA 4WZHA 3LCIA 1DOSA 3NDOA 2F1AA 1PIFA 2CZEA 3E0IA 1OFAA 1ZAIA 3DFTA 2BXVA 3G8RA 1DEDA 3C2EA 3ZR6A 3TTSA 2Y88A 2G3NA 3BVVA 3WFZA 4JYDA 3VKJA 2CLKA 2FH8A 4PTNA 3W87A 3UXDA 2FGZA 1LBFA 1I45A 4O0ZA 4UFHA 2PRHA 3UWVA 4PCSA 4UQ9A 3GKFA 3O06A 4GWEA 2DJXA 1GVSA 3SJ3A 2DJLA 4H2CA 3WK2A 3WNKA 3BK0A 3IIPA 6TAAA 1R30A 2OX1A 1JF6A 4JX5A 5D30A 3LPPA 3HPZA 4RXFA 1TREA 2E6YA 5TIMA 4Z08A 2E09A 1JL8A 1KTBA 4J27A 3M44A 2B7PA 3SFKA 4RXGA 1EHAA 2ZUTA 2ABBA 3NEVA 3DKLA 1T8XA 3STCA 2DZSA 3WEMA 2J9XA 4AMAA 2WCSA 1WP6A 3A47A 2JKAA 5TBOA 3VE7A 5E6YA 1N55A 3E02A 4FIQA 3HG5A 3DKJA 2Y4SA
chains in the Genus database with same CATH superfamily
3RFRA 3PHOA 1E28B 1OG6A 2ADJA 1QNIA 4OQ1A 5C2BH 3PWPD 2EYRA 2CK2A 2DZAA 4YSRA 1WKDA 4FR6A 2VR9A 3BPLC 5I24A 2IGTA 2XDHA 4OZIA 5HUPA 4GW4B 3LHYA 3CMOL 3KNBA 3CH8A 4TULH 4LIQE 1VHNA 4OV9A 1ZVSB 5I07A 2H3NA 4IUGA 3GDKA 1P6CA 5FUCC 3OLDA 4HS3A 3JZYA 2GDUA 1XD1A 1S2VA 5ICXB 3U83A 4MX7B 5E70A 3FB7A 2AC0A 2RFGA 1TZIB 1K8IA 3CFDB 5HWMA 3IN2A 2V82A 1LRQA 1W1A1 3VFRA 1F6PA 5I3KA 3NO3A 1A1NA 3R8HA 3PYCA 3T2NH 3VJ6A 4NUQA 4GXWA 1ND0A 5E9XA 5I26A 2XZCL 4YWGH 4XHJD 3NRPA 5HNNA 1V5JA 3QWRD 2ZRXA 3JTSA 1DSYA 2IC2A 4JB9L 3JZEA 2VR2A 4LVNC 2BNRD 3VD1A 4JHAH 1DJXA 1NCAH 3OR7A 1OFDA 2OP4L 5JHLA 1XGPB 9PCYA 4MWFA 4W9LC 1PLGL 3QDMD 4DELA 1DWFM 2FO4A 3EB3A 3DMMB 3KPRE 5ESVB 3ZY7A 1FFPA 5DJCB 1TJIL 3QVQA 3MQIA 3LBMA 4WKZA 4FNTA 4AENA 2AJYH 1J4EA 3GXNA 5ITBH 4EIZC 4YHEA 3O1NA 3Q67A 2J8UF 2BERA 1R24B 5I00A 5HHOD 4E4FA 2GQ3A 1QFUL 3R7QA 2GSIB 2IKHA 3LS5H 1KV5A 1MCIA 4NHCH 3N73A 2Z28A 2R2EA 3FA4A 4FP8H 5EBLB 4LYRA 3ZTNL 5HGHB 4XVSL 3E7JA 1UKPA 3QRHA 5LGXA 4W9DC 4UBDC 1IILE 1AFVL 3TH2T 4LVOB 4Y16C 1WFMA 1HINH 5CBIA 5HJLA 5HD8C 3DBNA 3WF3A 1O5XA 2ZRVA 2UWFA 4XO8A 1RJYB 3MHZA 4C6BA 4ZUVA 4QRSA 5CP7B 4M81A 3DXAD 3QYQA 4AZCA 3VRLE 3OPZL 3MNZB 3NJGA 5IESH 2VKXA 1E4WL 3SE4A 4DM1A 3NJ3A 5D2LF 5C09B 2NY5H 4KTDH 1D5BB 1MCSA 2WZPA 1EEZA 2OSXA 1S9XB 2ZC8A 3EPNA 1DN0B 4JGDA 3PREA 2PCFA 4KAQL 5AQ0A 1WA0X 3IDXL 2A73B 4UNKA 2GVEA 4ORZC 4KKCC 3VXQA 3A3XA 3DVGA 1ML0A 3VFWB 4XMXA 3TEZA 3F6IA 4B9FA 2G3FA 3OZPA 2ATKB 3MRDA 1IAMA 2NZ9D 3VCRA 4UDTB 2D3LA 5DYFA 3WDPP 3VZZA 3QZLA 1J0IA 3FW6A 5RUBA 2PTYA 2HH0L 3KOYA 1FNFA 5ALCL 4GAAA 4PWJA 3W75A 4PMUA 1ZGLA 3HS0A 1CGYA 4X7SL 2HT4D 3INPA 5F9WC 2GITB 3NN8A 3R8GA 3W2JA 4QOKD 1WEJL 4G5AA 4QXUL 4TYUA 3K5RA 5HHME 2YL6A 1BVLA 4ANVA 4M02A 2NQ5A 1GL4B 2JKWA 5H37A 4F7CA 4IQJA 4LS1A 3QEQB 2I9LB 1N26A 4RZCB 2AJSL 1C8QA 4Z7WB 1XL4A 3TP4A 2HLFC 5FYLL 5C0JA 2I07A 2NYYD 2F8VA 3NA8A 5KETA 3RHWF 4FLRA 1QOXA 2WXNA 4Y88A 1XFPA 4OT7A 4KH2A 1MWAA 4I3SL 3WNMA 2WXMA 3WSQH 4NG3A 5DRXB 4R26L 1L8PA 3EMQA 1K7FA 3W7IA 1D3HA 3B2UD 1AD0A 1SMAA 3CHSA 1EC8A 1OB1B 3FKKA 4PI2A 4RAVB 5TK4A 4MNHA 1VFSA 1IAKA 1WT5C 3MRJA 4PRIA 5E99L 4C83B 4W93A 3QUMA 5I8EA 4LSTH 4WWKB 3G18A 1Y65A 2F6UA 3AUVA 4DWSA 1KUMA 2J27A 4U1NB 3U0PB 3TU9A 5C71A 3RI5F 2CMRH 3L2NA 1E7VA 3IMUA 3V6OA 3V5HB 4IRJC 3GRIA 2O30A 3VXMA 2YAFA 5I17A 1V6YA 1IAOA 4W9CC 3L21A 4YHKL 3WQPA 2F74A 4S3KA 4L3FA 5BV7H 1EO7A 3EO9L 3ZQXA 3SN1A 1FG9C 1Y18B 1ENUA 1ACZA 4JRYB 4WFGE 4YO0B 4I6KA 2CPUA 4UT9A 2FH6A 4AMWA 1BD2E 2YXMA 1CVSC 1C91A 5C2GA 1FFQA 2L7JA 2OJEB 3CCHA 2R8SH 5IR1A 4R9HA 2Y70A 5BS0D 1NFPA 5KZEA 4X6DE 1P7KA 1IBHA 4YHYC 1T1YB 2YCJA 1MCPL 1KM2A 2J55A 4HZAA 2EPHA 3VRJB 4K3JH 4IMFA 1FHVA 5GRVK 4K2UH 5EEYA 4F79A 3MBFA 2WWMC 4PUNA 1UW9A 3S34L 5IEHA 2FLRT 3VI4B 3DDMA 3VFNB 2WPGA 1LEIA 3LPOA 5MKGA 1F5ZA 4A7GA 1KCUL 3FQWA 5HJYA 4TLKA 3RTQA 4JTIA 1E72M 5H2BA 2B7DT 1PE1A 4OSUL 2WVTA 3T2LA 1OQXA 4H8WL 3ISWA 3FL7A 1EZVY 5PAZA 4GP8B 5HA7A 3FSZA 1UR9A 4KO7A 1TLKA 2FZ3A 4X5XA 2KUTA 4LEFA 5D7LE 4IU3A 1Q9LB 5EULV 2Y8UA 1K4DB 4QUOA 4C90A 1AHWC 4HNNA 3IMSA 4WGKA 1XR9B 4WY0B 4FAMA 5I8KL 2PPDA 2PBOA 2VC2L 5ABDE 1TUFA 3WQFA 5CPMA 3UY7A 5JH1A 2J8HA 1IGFH 3F83A 1IYXA 2P8LA 4NRYB 2AMUA 4ZFOB 3HQ1A 1AG1O 4PTTA 2NSOA 3VXNA 5DUML 5I6KA 5TH2B 3M47A 2ZUNA 4CCCA 1XQLA 5AL0A 4MWAA 4O52A 2FX7L 2DYRB 2KPNA 2XVPA 3FJNA 2X4UB 5CHNB 3D4GA 3N11A 2YRLA 3MSYA 3LUTA 3C2RA 5FCUL 2WKLA 2H8XA 3U6RA 5BCAA 4LCYA 3W39A 3FRPB 3GXIA 1OFRA 1K7XA 3LRKA 1Q63A 4XD6A 2G60L 4JTLA 2QFRA 1FL6B 1XX9C 3KOWA 2WXLA 2XGZA 2LOEA 3C09C 5JXEA 2D3JA 3EJZC 1ZV5A 2JKJA 2WB7A 1IBFA 3EWCA 2FJGB 3SJVB 3N0AA 4XPGL 2PDHA 5GGSA 4N6FA 3PABA 4QHUB 5FK9B 4XKMA 3TYEA 3G08B 4OZFA 2Q86A 3KW7A 4IL2A 4JKWA 3WXWL 2BVEA 1MEXL 2FYMA 3ISRA 3VG0H 4NZRL 1F5WA 1J6PA 3VUAA 2FVNA 5EWIL 2H8PA 3EFDL 1DBMH 1XZWA 3KPPA 5ALBH 1I9IL 4NQVA 2Y69B 4IRZA 5ERWB 3P4OB 4FXRA 3QQ4B 4NENB 2UX6A 4X9SA 2QQLH 2F5BH 2XZAH 4YLWA 3TBTB 3RGHA 4UAOB 8A3HA 2NW3B 3OA3A 2XPZA 4B6ZA 1M2VB 2C1OA 4CCDA 2QCNA 4AW4A 3NJFA 3RWIA 2XU2A 1KZYA 4E41E 1VF8A 3WFBH 1PSKL 2ITEA 4YX2H 1KF9B 1Z5YD 3GI9H 4JFTA 1XGTA 2QF8A 1RAMA 5LG1A 3TIDB 4UBDD 1E3ZA 2BK8A 4X63A 2NZ1A 1BEYL 4Y16D 5K33A 2PO6B 4ZMWA 3F12A 2IOOA 5E8OB 5FJOA 3WFHA 5CZVH 2EDOA 4U1IA 1NAL1 4ODSH 3C3UA 2JKXA 3HRPA 3O4OB 3FONA 2JLLA 4DN3H 4B9CA 3D2UA 3HW7A 2ZYFA 1UCBL 3TU6A 1QI3A 4ADTA 3GSWB 2X4OA 4QAIA 5C07D 3S83A 2C9AA 3QISA 2YAHA 1CF1A 1MRAA 4WDIB 3VTAA 3TOPA 3U7YL 4HJEA 2HT3D 2AABH 4HJFA 5AG8A 4YVXA 1Q2SA 4LSVH 4JZJB 2FEEL 1U1UA 4ETQB 3MRNA 4KCVA 1HU8A 3QDAA 4KKCD 1LJYA 4TSCL 1ZP3A 3ZBMA 3LEXA 4NQSA 4GKSA 1LTDA 5CLXA 2H3KA 3HIJA 4DIAA 3REQB 5CZJA 1S2EA 1JS4A 2JI2A 3RDTB 3I75A 4HAKA 3MUGA 1X5GA 3KXFB 3REWB 3AC0A 1QSVA 4MB3A 1XDLA 4G7VL 3H21A 1D2PA 1GKQA 3RZCA 5B3JE 4PMVA 4JO1L 5EUKB 4MNQE 1WLHA 3IUIA 1CE6A 1F42A 3JWDC 1HQ4B 4BQ9A 1B3WA 1AANA 3V0WL 3GMLA 4LUSB 2HLFD 1M65A 1BQLH 5KJRH 1WNOA 4R7JA 1INEL 2Y5EA 5EZLB 1X1OA 5ADPL 4PR4A 5FF7A 2F54A 4MY1A 3P3UA 1SY6H 1DKWA 2DIEA 1KIQB 1OD0A 4PGBA 1Z6JT 2Q7NA 3NFNA 3HR6A 2NQDA 5BQDA 4AD3A 3U9UB 2E25A 1FLTX 1IC5H 4KNSA 1YXCA 2ITCA 1NCWL 2MOGA 3GS0A 4PCNA 1FDZA 4CILA 3HPLA 3T8XA 5IVXF 1D6VL 4W85A 3L3HB 5F2MA 2G5RA 4OLWH 5XINA 2YA1A 1PZ5B 4XO9A 5DMLA 3MN8A 3KBEA 2AGJH 2ENYA 1OGGA 4G59C 1KB9K 2XIOA 3GUTA 4ZQKB 4HK7A 3H0TA 1UKTA 2IFGA 1EEQA 4YTQA 5GZOA 2H8ZA 4GY0A 1ES0A 5EPMB 1NFBA 3UY8A 4GJ1A 3ARFB 4HZ1A 4IRJD 2OEMA 5D72H 4IIQA 4QEGA 5CLWA 1GW1A 1UQSB 3FY1A 1MJ7H 4YDIL 1A4KA 4WTQA 4FXKC 2A7PA 1QEXA 4HIQA 2QGCA 4P04A 5GGSY 3J07A 1AGFA 1HI6B 4HCLA 2FFIA 1MFEL 1V7ML 1ZA3A 1JDDA 2A3HA 1ULVA 4WTXA 3EXLA 5JA9A 1NC4D 4UR8A 5ACZB 2Z4GA 1DQVA 2NY0C 4NO2B 5BZAA 3FBQA 2OSWA 4Y5YA 2JQAA 4PYSA 4LSSH 3KGSA 2CGRH 1OAJA 4YTSA 2QT6A 2C9VA 1IAIH 3LCGA 1G4PA 4LLWB 4OUEA 3P11H 2YXFA 2XVKA 4ZXBD 3J8F7 3BCFA 3L5XH 4IDJH 1F73A 3QKZA 3DGDA 1H0DA 3SQOL 4HOZA 4WNQA 3ILDA 4D1IA 5D71L 4JQXA 1NUGA 2GJPA 4PGEA 2WWMD 4FKKA 1DQTA 4CSPA 2E7HA 1Z9NA 2DQGH 4QHNB 1MQKL 1WCQA 1HS6A 4X0NA 5EBMB 3TXAA 1X5FA 4EI5C 4U0RB 2WZHA 3LCXA 3VYPA 4JFQA 4A3YA 4WFHD 3GVGA 3GO2A 4AD0A 1KACB 4AG4H 4J23A 2EO9A 1DQLL 3JYBA 4DERA 2Y5TA 4PHZA 1R3JB 3QWNA 1XAUA 3FF7A 5FUZH 3UXLA 4B5ZA 1WXYA 4MAYB 3SHSA 3RL2A 4ICMA 5HYSG 4ODWB 4B41A 1SFJA 1UOVA 3CEPA 3EH3B 1FYTB 1XSJA 3Q44A 4D9QE 1AW5A 3UJJL 5CILH 5DRCA 1W80A 1JRCA 4PTUB 4R83A 1YPXA 5I76A 1J1XH 3KVDD 3LH2H 1JCTA 2W0PA 4HF5H 3L9CA 4U6VL 2WVUA 4K7YA 5F3BA 3T0EA 2EEFA 1RA5A 4X9IA 3KCWA 4PJDA 1P9MC 1SDYA 4AZ7A 4FEIA 3FUFA 3D85D 5IHRA 1IIGA 2VQ1B 3V0HA 2B14A 3BMVA 1E9YB 2DQJL 5FHBH 2IOIA 4EXQA 4KZDL 3QAZB 3FUHA 2N7BA 4N9BA 4CLMA 1GZHA 3IF1A 2XQBH 4P5TD 1JZ3A 1GZQA 1OD7A 2J9ZA 2OQHA 1HHIB 1J2WA 4H5SA 4O1AA 4HKXB 4JPVL 2ARWA 4IT1A 4I85A 4UU9B 2XN9A 1HWGB 1S9YB 4G3YL 4WW2A 4CNIA 5L2JB 3LH9A 1RZKL 2GSGA 1XEUA 1KCKA 1PG7L 5DTFA 4NBZB 2EQDA 4Q4MA 3CX5J 2ED6A 4X2UA 1CLOH 2YCLB 3OGCA 5CJOL 3G8EA 1FH8A 3QNYB 2DLFL 1FVCA 5B39G 4G8GB 1G9EA 1ZPLA 3HE7B 5CEZE 4N8PA 1SFSA 1XIBA 1Z5LA 3DUUA 2QV5A 4JTQA 4PB3A 4UT7H 1LO0H 3CDCA 3W84A 1R38A 2V5JA 4P2QE 1RK7A 1DFBH 3P0YL 3P73B 3BLBA 3IUHA 2NXIA 2UY6A 4B90A 2IBZY 3CVHL 5KVGE 5A40E 1CW2A 1PTGA 1S5VA 4AUUA 2A6DB 3H7UA 4JR9H 5CPNA 4TUFA 1ZS8B 2C8NA 2CM5A 3RNDA 3P4NB 4ZNEA 1GYMA 3S5ZA 5E23A 1FPTL 3LQAH 4ONFL 2H0FA 4UTAA 4EI6A 4MAZA 4OGAC 3IXAB 3VFTA 1NGZA 4FHJA 2CJ3A 2C9XA 2QPDB 4MA3A 4TOQA 4G9DB 3MCOA 5CC6A 3DV4B 3QDJB 3GC3A 3LNMA 3VNIA 1WG3A 4R4FH 5JXQA 3H3BC 3IM1A 3GRWL 3KPSA 4L4PA 4ZD3L 4N2YA 3GLZA 2QCCA 1IZCA 2VISA 1WFTA 1MI3A 1I8IA 3H22A 4KXBA 2JFEX 4E9XA 4NP4L 1LE5B 4IBVA 3UXDA 2MCAA 5JBDA 4I0KA 2ZOXA 3UWVA 4AM0A 1DCEA 4S1RL 3EGXA 2K6ZA 3BK0A 5JPMA 1NAMH 2PXYB 4P2YA 1D9KB 3EPOA 4EBQL 4I0PB 3JBG7 3DPDA 4I13B 3NIGE 4YL9A 3WFEH 1HCFX 4QE1A 1P5UC 1XF3A 2KMWA 1OZQA 3DI0A 5I74B 1UT2A 3H42H 3C5ZA 1UOLA 2BOBB 2QPFA 1MI5A 2QUVA 3I4EA 2ID5A 1YYAA 2YBUA 3O4LE 2X44D 4H7CA 1I7RA 3SY0A 1YEJL 1YZZA 4EZLA 2D20A 1SUXA 1RR2A 4N0YH 3G1DA 2X4NA 4RWYL 3QR0A 3O6LH 3WS3A 5D1QA 1WAUA 3L0NA 3OZMA 4WUUE 2DFAA 5CMAA 1M6OB 1TFHA 4K3HA 1PVNA 5EIQA 1TTGA 1UR3M 4B4FA 4GINA 4DGUA 1W0VB 1YJDL 5I1CL 2H0EA 4QRFA 3KE0A 1K4HA 5GISH 3GDCA 5KS9E 4K9JA 4DM2A 2OMZA 3NIFF 1YNYA 3ULUH 3IGFA 3PUUA 3FYEB 2PTXA 3ZVHB 3QUXA 4E36A 5INDA 1P7BA 5IIEA 3N40F 2DUXA 4HZLA 1S8DB 4N90E 4XNQA 2EJ1A 4DBSA 1HEHC 1M05B 4HEPG 1VSCA 1NMBH 4ZTXA 4RFOL 3MHGA 5DVLA 3NQ2A 4LEBA 2K0RA 3E2HC 5EZPA 1P6AB 2EICA 4OLEA 1UUOA 3SQSA 3GBMH 4E0RB 3WQCA 2G95A 3PZUA 5HYQA 4QXGH 2NXZB 4Q7NA 1LRTA 1IGYA 1ESWA 1SJXA 5H2ZA 4N2CA 3GAYA 4NQEA 1YYML 2A9NH 4PUKA 3LY0A 4G72B 3CK0H 4IPIA 5HGDA 3V0FA 3NCJL 1A5OC 3WN6A 4PS3A 4UINL 3PBYA 1UR2A 4C5ZA 3WKQA 1AE6L 2X7VA 2XG5B 2CCRA 2A1WL 5E4AA 3HN3A 5CH9A 2XN2A 3LCWA 4XUGA 4HJUA 1J8VA 3GS6A 1DYZA 2RAGA 1SGJA 2LLGA 2HKHL 2X89D 1NFIB 1F8TH 1E4KC 4KX7A 4XCFH 3BMXA 4QO1B 3LM7A 4HS6A 4AW7A 1PKMA 1CG9A 4QTIL 4DVBA 4F2MB 4EEEA 1ZD6A 5FM4A 1VA9A 3ISIX 3AAZA 5TGBA 3FO9B 4U6YB 3MFFA 3QUKB 2E27H 1LEKA 2VSKB 4J28A 1HIMH 1QSFD 4N8VA 3LN5A 5GIRA 5JLZA 3B8WA 3WK1A 2V2DA 2C1PA 2ZSVA 3IGKA 1DJYA 3AHZA 1ZCRA 2W59A 5IHLB 3PAUA 2QHLA 5IW1A 2PCYA 1PFCA 2YGYA 4FQ2H 1HVXA 3GVVA 2FMOA 5HAOA 3CPUA 4P4KC 4BFOA 3ASOB 3B7RL 2VI0A 1BZ7B 1BQCA 5HR6A 3D87B 4GXUM 1K2DA 3MUIA 5F89A 1THFD 5C3TA 4XN7A 4KTGA 2HVJA 3C6SA 3PSWA 3W2DL 4MJIA 3EOLA 1H62A 5DJ6A 3EDFA 3DTXB 3GUWA 4QDPA 3MCNA 1PKOA 3HBQA 2CCLA 5IWLA 3GW3A 4L23A 3W3OA 5AYIA 3NK3A 4L3EB 1CIDA 3VWKC 4P57B 1ZGDA 4CD8A 3VNKA 2PDKA 3NPSC 1I7UB 1KG0B 4ZO7A 3NA4A 2N59A 2DEPA 2PTZA 1OGSA 2EVJA 4ZFZA 2AJZB 4PRHA 5I28A 2EVIA 3REVB 3CUIA 3SADA 4PL2A 4A68A 1DXFA 1FG2A 4W81A 2F53D 4LYQA 4E9SA 4NQCB 3L23A 3PXLA 1EAJA 3TIEA 3ECQA 3GUFA 4QRTB 5ID1A 4NPJA 5AZ0A 3TJEL 2R2CA 4IX2A 2WNZA 1XMEB 3ILPB 1HHGA 3GO1L 4NKDA 3QFDA 1RUQH 3TR9A 4G9FA 2TPSA 4HFUL 1EQWA 4HLZH 4N02A 1XBDA 5BV7B 2RALA 1RCOB 4F7PB 4APXB 2LW3A 4Q4IA 3CXDL 2CLHA 5J1AB 5B38B 1XCXA 2VL5A 1CL7L 1H15B 3WCYA 4D9LL 4E5XB 4WWNA 2ED9A 1DQDH 4LQFH 4PJEE 5I1EH 3AS1A 3ANVA 5C0EA 4PLJC 2VXUL 1IT0A 4OE7A 1T04B 3JV6B 4JVWA 2CK0H 2JCCF 3CBKB 4W88A 2YSWA 1JGDB 3BPCB 3LU2A 5DUPH 1RBLA 4JY5L 4A38A 3MUCA 1BAFL 5GSRA 2C0AA 4JBSA 1KN4H 3BXWA 4OGAD 1FWNA 3U46B 4OZHA 3TVMC 2QL1A 2E9LA 1A25A 1W72A 4UQIM 1YJDC 3TL5A 1LM8V 4C6LA 2ZICA 3O3EB 5IBLC 3MCMA 3K30A 1BLNB 3FU5A 1SSDA 1J9QA 5GS2D 4KU1A 4XGZA 3SIKA 3TBYB 3MBXL 1SBBA 3X3FL 3BZ4A 4FZIA 4YS4A 5EC2A 4UOZA 2NWRA 1G7MA 4QITA 2EECA 3IS0X 2E7LC 1E9OB 2HZHA 4FXGC 4KIEA 4P46B 2IW0A 3ZZ1A 4DEPC 2Y89A 1A6VH 4CDHA 1A1OA 3WXVL 4DUVA 3ZRFC 4NQ1A 3F7YB 4EJ1C 3LCLA 3LXAA 2WJEA 1A7RH 4YUEH 4PJ7A 3RWGA 1KPUB 5DJZA 5REQB 2BCKA 1VFAA 3UNDA 3C61A 4HGWB 1PZ3A 3R4IA 4LGXA 3UCRA 1PB0A 1RK5A 3VD9A 2HG0A 2VXVH 5HI3C 4JVUA 1E50A 5I9QC 4OCRL 2D8KA 4PJFA 4TNGA 2PGFA 4AXKA 5HDBF 3VOIA 5AUMB 1C5CL 5CLZA 2EKGA 1TPB1 1BF2A 4WJ5B 3NJLA 1RQHA 1LILA 4MF4A 3MRLB 1F4WL 2PC4A 4H26A 4P8UA 4LLDB 1AY1L 4WOZA 3M5XA 4GSDH 1GWJA 4C1KA 1HH9B 3APTA 1KCRL 4LHQB 1DP0A 4NASA 5T5FH 3H7BA 4EXPX 5JUVA 2ICWJ 4BZ2L 2BNQD 1MZHA 4P59L 3JTTB 2CLIA 3AZRA 1H3XA 1K5NB 4DP2X 1P2CA 2VZVA 5HI4C 3MROB 4HVXA 3BPWA 4MCZA 3PS6A 4N2LA 4S39A 1U8KA 4J3WA 1B9ZA 1TJHH 2P5WA 2R0LL 2H5UA 4QNEA 1SLWA 2Y7EA 4W87A 3V0TA 1BQUA 4KTYA 4OIFA 3E5BA 2YQBA 1RUML 2P80D 1KLGB 1BRLB 4L4VB 2Q02A 1G7QA 3KDMB 4P06A 5CEYA 1WBYB 1MHCB 4KHTH 1PTAA 4EI0A 3RIFK 2HSAA 1B4JH 1QMUA 1ZLVH 3O16A 1B90A 5I0ZA 3TQVA 3KYMA 5DEFA 4MRCA 1DWGM 1PKQB 4NUMA 2YPLB 3U57A 4LHUD 3D39B 2DEXX 1QRNA 5KJ7E 4B5WA 3H1ZA 4MAUH 2PW2A 4ZOBA 2YSTA 1CT8A 2WBJC 3FRUA 3K4WA 1AGCB 5IW6B 3MC0A 4LU5L 1NDWA 3IDGB 4E42A 2Q7YB 4KMQA 4DBDA 2IAAC 4WWOA 3JSSA 1XGYL 3ULAB 4F1SA 4K5NA 1LO2H 1CU4H 2XCMC 3BV4A 4QRBA 3KGTA 1EP3A 1UUMA 4F37K 1GYAA 2I69A 3NH7H 3E8UH 3HZYA 5TE4L 4EKXA 1QHPA 1PCKA 1W8OA 3T1FA 3V7AE 2EKJA 5F9JA 1OGBA 5L2KB 1SJDA 2ALAA 1KBLA 3AXKA 4DO4A 1HCVA 3MLYH 1K77A 1HKJA 2VYRE 2X0VA 1RUAL 3VNMA 2KBGA 3MRFB 1NOFA 4WCJA 2ETWA 3LV3B 1TMHA 3QYNA 4DJFA 1ZT4A 3QDGE 2Y36H 3OXSB 3I85A 3VWJB 5DLMH 3EFOA 1OIFA 3HN8A 1K8YA 3OKLB 4OLXL 32C2A 3N17A 6XIAA 2GFBB 4R8WL 4QCIA 3B4NA 4ZW5A 4N3TA 3SDCC 1F13A 4EXBA 1AL7A 4WY7H 3NPZB 4GC3A 2N0KA 1I3GH 3UJTL 1JJKA 1EMTH 2G5WA 4GIYA 1E1FA 4JTUA 4NO5A 4P4KD 3F4NA 4PMDA 1JV5B 1N5AA 4XD4A 1T4KA 3WBEA 3CFTA 2W27A 3SGEH 2H26B 1O9ZA 1E6JH 1Z3RA 1S7QB 5A2JH 3M0JA 1P1MA 3FO2A 5MEPA 4LY4A 4DPAX 2PTTB 1ZEAH 3T3MB 2RH0A 2AJVH 1HHKA 5IQOA 3F7JA 2F15A 4Y2DC 1Q6EA 1NCIA 3SPHA 4U3AA 25C8H 4PJHA 3AFBA 2QT3A 4XN1A 2FMNA 3KL5A 4BQCA 4UTWA 3VWKD 2VW4A 4US5D 2RD0A 2DQHH 2WLIA 1RSFA 4DP5X 1D2KA 5T9CE 1D7BA 1CFTA 1XR8A 5FCZA 2AXJA 5C0BD 4PG9B 3VM7A 1QBAA 1X38A 2BP3A 5H35A 3CH1A 4PSRA 5J7CC 1HK6A 4YTTA 4DBUA 2ZNXA 1S2CA 1NGQH 3FYOA 2WQ8A 4XMPH 1ODUA 1LVEA 2E9IA 5F9DC 1KA9F 1NDYA 1GQIA 1WAWA 5E7FA 3TWCL 3CS2A 4CU7A 4LMQE 3QS3A 3W1NA 2ZCLH 3WL9B 1CI1A 4UMCA 4ONOA 1S7TA 1JEZA 5DK0A 4XZUA 2NW0A 4JDZA 5D4JA 4DKAA 3NZQA 5F6HJ 3I7SA 2D69A 4ZMXA 1I60A 4LX4A 1CE1L 5HVHB 3RBSA 3GINA 1CQKA 2YZ8A 3ECVA 1FZJA 4MADA 2AK4E 4PLJD 3FQ1A 5CJBA 3G5XB 4X4XB 5C0AE 3RPIA 1UM5H 4DCQB 4P2RB 1Z41A 4LRIC 5CBEA 4BZ1A 2DWEA 3L4WA 3IJHB 3HOJA 4LDLB 2CJUH 1RD5A 4YMZA 1IF2A 3MC5A 5C0CE 5D09A 4M6MH 3BLFA 5LGYA 3MLTA 4YHGA 3NESA 4FQQB 5F1OB 5IQ9B 3AYSA 4F9DA 1AHMA 4R7NB 1ZJIA 2FBJL 2XWEA 1H8NA 4P7LA 5T1DL 2MQ3A 3TVMD 2G9HB 4ZI8A 2HVKA 2FBOJ 3EIFA 4WNSA 2GI0A 5XIAA 4R4BB 3TBBA 1KKRA 3SCNA 1U91A 2PDQA 2ZCGA 5HOSA 4LS2A 5IBLD 1FFNA 1KJ2A 4YDKL 2WQAA 4AZUA 4OCXH 4N1CA 4OJFL 1FORH 4OZ4A 5JPNC 1W0YT 5DVMA 2GIXA 3K2GA 4PRPA 3VH8A 1VFHA 1WD8A 3IFNH 1HESA 2YAEA 3LNDA 3MODH 5CEXA 5GGVL 1OFOA 2HKFL 3U30B 1UH4A 3M0IA 3LDBC 4MYPA 4ZZ9A 5KSWA 1KCVL 1ZAHA 2FB4L 2P8PA 1SHMA 1QKZL 4GIAA 4FS0A 5BO1L 1XYLA 3T0DA 3DYPA 4KO5A 1CBJA 1MUJA 4AYGA 4PB9L 3V0UA 3C3NA 3PF3A 5E6IB 3MP3A 3KPRD 4HT1L 3KWVA 1WFUA 4XCYA 3HMXA 3GJEB 4J4PA 4OZIE 4N9GA 3ZTJG 2WV3A 3LS4H 3KBPA 4TNVK 4UTJA 3FCUB 1T6BX 1W3NA 1IBDA 4PEEA 5HI3D 3CPLB 2VDNL 1MW3A 1KTNA 2CO7A 3FRPG 1BFOA 5IB5A 2AQPA 3LKRB 1G7PA 2Z93B 4TUOB 5IG7A 1B4TA 4NT6B 1ALDA 1W9PA 3PWJA 3DDFA 5KZCB 4O2FB 3V0SA 4BSVB 1M53A 4WU5B 3O6DA 3ALWA 4ZNCD 4QRRE 3OJDA 1TO3A 2F84A 2OODA 3W9EA 5DQPA 3KBWA 3TH4T 4C4KO 2MQ0A 2HVNA 1OADA 4M1BA 5DS8B 1JZ2A 1RULL 1NF0A 4BY3A 3R06A 3D4YA 3EZ4A 3NNTA 1CICA 3OU8A 2UZXA 2VKZG 3TTQA 3AXLB 4LNYA 2GWNA 1GS7A 1DUYA 3MX0A 4INFA 1E42A 3BAYA 4KGLA 3FOMA 3TPUA 1WK0A 3VXUA 4CW1A 5HI4D 1PY4A 5JW3H 5JHDE 2QVFB 1I85A 5KBDA 1MCWW 3C9NB 3G5EA 1G6RA 3LPWA 1KENH 1WFOA 3PP3K 2BWIA 4NM8H 3DJZA 1J8RA 2BIPA 2J1YA 4DAGH 2APXA 1YXYA 1U8LA 4U1SA 3D5OF 3VGEA 2DD8L 4E2OA 5E2VH 4QHMB 3NQ8A 4Y6GA 1FFOA 2AMXA 3SRFA 4I4WB 1US3A 1LOLA 4DUXA 3VIKA 3MMEB 3B8DA 1R9XA 4XMLH 1H3UA 3ILEA 3B2VL 3CUHA 1DSFH 2XFFA 3U2SB 3ARDA 1DBAH 3WNNA 1BXXA 1PUDA 2R56L 2GIMA 2WM1A 1TTUA 2RFXA 4AISA 3WTWA 5KVDH 4GUCA 5KVGL 3APGA 4K5LA 4BWLA 1OIMA 2JVUA 1I4FB 1NGWA 4KKAC 4QD2E 4E8GA 4ELMF 4FFYL 5AKSA 5HHMD 2CZFA 1UB3A 4FFZA 3G5YB 1KYOK 5I30H 1W8GA 2WBJD 3PZQA 2XXCB 4BKSC 3HZMB 4Z2JA 3V0GA 5LAXA 2ZE0A 3RWJB 3GFZA 3W6YA 2VDLH 2QIWA 2DBLH 4QIUA 1H5BB 3NACH 1FI8C 5IUCA 1DLFL 3F58L 1TCDA 2GVJA 2YUXA 3N41B 3VFOB 5KTEH 2EYTB 2X1PA 4LL4A 3Q2DA 4NI6A 4OD1H 2W81C 4J8RA 1U3YA 1SYSB 4ZO9A 1U3HB 1DWJM 2VW7A 7FABL 1TJ0A 3DGGB 4BQBA 3QTGA 1NAMB 4XXDB 2DW5A 5ABGA 2R29A 2QJMA 3P81A 3Q8FA 4IKNA 3CAWA 2GK2A 3NDOA 5IB4B 2AJXH 1RCXB 3S3GA 3MCLL 5T1KD 3A13A 3C6LC 4GXVL 1AD9A 3BJSA 2YLKA 3ERXA 2PRHA 3JWDL 5JUEL 3LG3A 3IIPA 4IJ3C 6TAAA 1JVKA 2B15A 3KS0J 3MNWA 3T6XA 3B9OA 4IL0A 2ZUTA 4NILA 1JZGA 2WCSA 5C9UA 4AYEC 1I1XA 4ASTA 1GSMA 3NOYA 3E02A 4FIQA 3SDCD 2OXHA 5J6GA 2Y4SA 4PVNA 2XYLA 2ZNWA 3LLFA 5HK4A 2RHGA 4FADA 4TMPA 3IWPA 1HL4A 4B95C 1LE9B 4HH9B 3SBFA 1OLLA 2HS6A 4QLRA 3MJ9H 2W65A 1EEXA 4LLUA 5C7HA 2N3JA 3GJFH 2DWDA 2NX5A 5KSUB 2X0SA 2NY1B 1HFUA 4RL3A 4WFGD 3BPNC 1VZIA 3BRFA 4NNYA 2DWSA 4WENB 5FPIA 1ZTVA 4HJGA 2XM1A 4MASA 1BECA 4NZ8A 4Y2DD 1WTLA 1AJ7L 1BD2D 3VDBA 1QLRA 1MW0A 2YFOA 5EUOB 2Y7LA 2EADA 4ZUSB 3SO3C 2PYEB 4S3FA 3KYKH 3VIOA 5F96L 1NMCC 2E9BA 3WLJA 2AV1A 1IX2A 4I2XB 3KDNA 3L6FB 1BZ9B 5D6CA 1FP5A 1JDFA 1E4NA 3TNNA 2VFEA 4ZS7H 3RVXC 1UXSB 1QNZH 4F9LC 3SE3C 2DN7A 4PRIE 5KVFE 4Q33A 3IXTA 1YPIA 2VGLM 1AO7E 2BDNL 2WLYA 3BH8A 2ON3A 3IIXA 4D6IA 2DORA 5AW9B 2JJSA 4L4LA 1KM3A 3HPFA 4XBJA 3VFSA 3VXME 5LGJA 3C0LA 2KPWA 3LNIA 3ARUA 1CFNB 1EANA 5B4MC 3H26A 5FR3A 1FWCC 4QYAA 4FJ6A 4KV5F 1IEBA 4B60A 1C9DA 3BSMA 1IE4A 5D7LD 4FI8A 2DOCA 1OK4A 4UNLA 4UUIA 3V2AR 5DMIL 3E49A 2EF9A 3S2NA 4XNDA 1G7IB 1P7HL 1CZ8L 2XTJE 4KCWA 3ROLA 4NWTH 2VLJA 3W72A 4X6BA 2P4AB 2UVFA 1HC1A 3BLOA 3NZ8A 4QT5A 4BSWA 4OZGB 2AEOA 4FNSA 1NGPL 5DX7A 4XPTL 5EH1A 3FH7A 5BRZB 4NO3A 3RIAK 2PCXA 3NSXA 3EYVA 5I06A 1ZFJA 2G75A 1UWRA 1KSRA 1R19A 1BG9A 1FRGL 1YEIH 1FH2A 2BJML 1E5JA 4UQCA 1OX4A 4J3SA 4JRXB 3Q2CA 4F33A 3WUGA 3UBHA 5CJNA 1N0XL 5B1KA 4X6FB 1EXUB 4LHJB 3THAA 2DLHA 1KLFB 1R46A 1PY0A 5TJWK 1OP5H 5IHUL 4J3OC 4YBLC 5GJTH 2BFVH 3VCCA 1MVUB 2IEPA 3RDKA 4HX1A 3FU9A 2BG5A 3NSDA 1MCBA 4LOCA 4F24A 3DTUB 1EEUA 1JP5A 2OOGA 2XICA 1C7SA 3FFCB 5EYWA 2QCLA 3L4UA 1F11B 3OHMB 5HD8D 4JFPA 1IEVA 1DHPA 1GVEA 5J9PA 5FJRA 5I8OH 2ADAA 2AGTA 3PNRB 1HDMA 4UNTA 5KYUA 1DQIA 1SOKA 4HQQH 3JUZA 4JIHA 1TTBA 2SEBA 2UVEA 3F2DA 3T0XA 2GI7A 1YN6A 3CFMA 5FDWB 1UUQA 2Z0BA 5IT2L 3AM8C 4E41D 2QVMA 4Z1CA 4M0XA 2WMPB 3HKZA 5T1MA 3EG9B 4HCHA 2ORBL 3ARRA 2CPCA 3MV9B 1D5IL 3ATDA 1YE4A 3BMWA 4EDWL 3MCYA 1P7QB 1SM9A 4YXLL 2FTPA 4AZ6A 1WVZA 1A0CA 3DBSA 1QLEL 2PP0A 4FMKA 5F7KC 5HPMB 2WO5A 2XSBA 1A6ZA 5EO9B 4ERGA 4ZOAA 3QZWG 5F97E 1ZLWK 1OT1A 1GTFA 3HGOA 3CSFA 4KWWA 4OZOA 3HB3B 3LKOA 2C4FU 1JGLL 3ZIYA 2DIJA 1MCJA 4PW9A 2MMXA 1TYGA 3OTTA 4KERA 1WAAA 4MMYB 4BHUI 4HMEA 1UXLA 3A0OA 1A3LL 1GR7A 4NJ9H 4JMNA 5AVRB 1JFXA 1NELA 2E5BA 1OHLA 1TELA 3QQNA 3CDZA 1XKJA 4A22A 4OH2A 1KM5A 3ME0B 4IRSB 3E0WA 5F0JB 9CGTA 3DX8B 4PV9B 2ZBTA 4UM9D 5JHAA 4FNLH 2QUMA 1RJCA 1G7LA 1SBSH 4Q4OA 4B5TA 3SCQA 1H60A 1E65A 1R34A 4F0RA 1J8SA 3CWOX 4D8PB 3KAAA 5CSGA 4WIQA 3ABZA 3KTXA 4LMQI 3P0VH 1FCCA 4QROA 3SCMC 1IM3D 3K2IA 2P3ZA 2DEWX 1VKXB 5GS1B 1AIFB 1GGBL 4D6FA 3N42B 3T6WA 4FQLL 5HJ3B 2BOCB 3BP7B 2Y2WA 4Q6YA 2AQ2A 3WUWB 3ID7A 4MNQD 4KKAD 5JIDA 2NUTB 1P0EA 5KYWA 2QUTA 2ADGA 2AXGB 4O00A 2P47B 2F68X 4K94L 4I5XA 2NZLA 2FVKA 3V79C 1PL3A 2JEQA 3B2DC 1KFCA 2OR9H 3UWZA 3ZDYB 3GH4A 3R1GL 3VZXA 1GTEA 2BS71 2ESVB 1QT1A 4MSSA 4HK0B 1ORSB 3EWUA 2GSEA 4LBAA 1EHLL 1VFMA 3SDYH 3M0XA 1YNTB 3EBAA 1E1CA 2FLIA 1ICQA 3R12A 1A7NL 1T22B 1O5PA 4K0OA 4YHIA 2X1IA 1BD0A 1JWUA 1O6SA 2NY2C 3O3UN 1LUCB 1QTSA 5ADOH 4FQXB 4NOBA 4Z3HA 3WEZA 2OULB 4XWGH 4G1KA 3E0VA 3QT2A 3KPOB 2XPKA 3C6LD 3BDKA 5IDZA 4OLZH 4X80L 4AG0A 3BG9A 1A3RH 4IU2B 1FE8L 4OKVB 1E8YA 2HBVA 4ZFGH 2FL5A 5FF3A 4MGXA 1JPSL 1ZV2A 2CZNA 2CIIB 2DSWA 4JJ5B 2ADFL 1AW1A 2X05A 1FHGA 2WZAA 5LIUX 1UC5A 1DIKA 4QPEA 2YMXL 3QI9C 1GYNA 2BMBA 3H2OA 2AQOA 1HHHA 3BOXA 4G80B 2I9TA 3HAEA 3Q0HA 1X5YA 1RZGB 1EHKB 4YHNB 3S4SA 4WXYA 2VURA 3P30L 4O16A 4TUKL 1PNCA 3L9BA 4CC4A 4JFHE 5EHFA 1QYGL 2CKRA 2WINB 5HBBA 4DI8A 3WQEA 1F6AA 4LNRB 4JY8A 4KZEL 2F54E 4RRPA 3NFSL 1TJIH 3BLDA 1K72A 4TQIA 1HHJB 5DJYB 3V0VB 2E7DA 3FUMA 2DWXA 2XT1B 2W63A 1V7NL 2N0MA 4M51A 5EN2B 2ZX8A 1EGJA 3WJJA 1U5VA 1NOUA 3QR3A 2MCMA 4KNTA 3T77B 1DDTA 1JWSA 2GBVA 4REQA 1RERA 1NDMA 2PN5A 1M7JA 4Z8FL 2EPOA 1Q85A 1EJRC 5C0QA 1QR4A 4Z42C 4XPBL 4PJ9B 3ZE2F 1GY1A 3M1BA 3KPMA 3QEHB 3SDOA 4FD0A 1F00I 4FPSA 3IYLW 3MACL 2QUNA 1XLEA 4KK8C 3PP4L 5IQ7L 4KKNA 4IZGA 1H6EA 1X4YA 3LEVL 3CZNA 1E8WA 5B4MD 4Q6IB 4Y2NA 1TPXB 5EBWA 2ZOLA 1MH5A 4KC3B 4FQHB 4JAMB 4Z7NB 1E5UI 3GK8H 5IB3A 4YSUA 1Z6KA 2XQYA 1M7XA 1MRCL 1S1PA 6A3HA 2EEXA 1TYEB 5A2BA 3VXRB 2YRZA 5CBAA 1BVWA 5C6PB 4KFPA 1RSYA 3NEEA 2L7EA 4D9QD 2EDRA 1JMXA 1L3WA 3L1OL 3ZGIA 3GZ3A 4M8VA 1ZLPA 2GJ6B 3G6JB 2EIJB 1JF1B 1OAUH 4L5ZA 3W25A 1INQB 3VIIA 1JV2B 3MLWL 4DYEA 1FBIL 1KIUB 4QRQA 4Z77A 2ZF8A 2JKLA 1QFWH 3IGUA 2JV6A 4DN4L 1NGYB 5AHFA 4LCIH 2XXFA 5AAWC 3HG0A 3SDXE 5D6DA 3EJZD 2I16A 3P60A 4CEUC 3RTLA 4JFFB 2VDHA 1IIIA 3BP4A 1X97A 2ISWA 3KEHA 1ZHLA 4WHYG 1OAKH 1DQXA 4YFDB 5AZEL 5FKPB 3U0WL 1BYNA 3ZL4L 1KXVA 3F7QA 3MSDA 4MMXB 2TYSA 4RKAA 1ODAA 3L5AA 4U31A 4KMTL 4WW1A 2AJSH 4BF5A 3LNGA 3BGMB 3U2ZA 2HJKB 4HMNA 1E2ZA 4GQZA 5FYLH 3ZVIA 3CSYA 1YO4A 1B2WL 3KPQB 2EDEA 5MF5A 2YKLL 4KHXH 5AOJA 3GPEA 4WEBH 3EA1A 3MJ6A 3O6FA 1AKPA 4J3OD 5I02A 1G69A 2YDSA 1KQYA 5FO8B 1BAWA 1YNKL 4C8XA 5DD1H 4MQTB 3IVSA 1KBGH 3IDYB 4EAYA 4O2CA 5ICZA 3IGAB 4XP9L 2O4EA 3BDYL 4OCLC 12E8H 4NSKA 2DT2A 3BKYL 4FZ8H 1H7PA 3MSPA 3DWTA 5CEZD 3SR7A 1WV2A 1Q72L 1PYWA 3NPVA 4HHPA 5CC5A 1NWPA 2D7PA 3WJXA 3G3MA 3HURA 3T0EE 3MLUH 3PJTA 3L3JA 4PJDE 4P2QD 4AT6A 1CLYH 3S35L 5CUSH 2J6VA 2V2WB 2ZYRA 5BW7C 3UTZA 2C91A 3C8DA 4RAUA 1L9OA 2E0PA 2REQB 3SPJA 2DTML 3VCNA 3TOYA 4EIVA 3M43A 3BKCL 3P0XA 1BEXA 2QTEA 1CGVA 5I71C 3ZE1E 4PV8A 4K94C 3UROR 3OKOB 3OB0K 3GSVB 1OL0A 4ZO8A 5F93C 4N25A 4EANA 2WLZA 4WKFA 4X7TB 3CV2A 3E0GA 3QUZC 1H7XA 3X14B 3O2VH 4MY9A 4KIRA 1ZK9A 3NO5A 4DOHB 2XN9E 5IFJA 5C0IB 4LCCC 2A4ZA 3QJOA 4WK0B 5D4IA 1RZFH 3QIWB 5B38G 4FL4C 4E5XG 2R0KL 2X4RB 4MLIA 4NAFB 4Y4KA 4I9AA 4DP7X 3P93A 1UA7A 2VITB 5AALA 4LDEB 1ZLVK 5ISZB 4Z1AA 1BJ8A 3C6EA 3EO1A 4LIQL 2ICEA 3UYIA 2D23A 3L08A 2W94A 5BUPA 2NT0A 4ZX4A 4FG2A 1DVFB 1SO5A 4H01A 3CFQA 4ADUA 3H6OA 1S5WA 2CO3A 2DMKA 2PP8A 4R7XA 2BOFX 3G0SA 3SCMD 3W1XA 4XBPB 3GXPA 1L9NA 1WC7A 1LM1A 1TPFA 4GUQA 2VFDA 1O9WA 4ZNEE 5M7QA 2ROYA 3MNMA 1FWAC 1NCUA 3GM0A 1Z9MA 4A2GA 3O4LD 3KBSA 5J8LA 1V51A 4EF8A 3W0WB 4L29A 3VYNA 3GMPA 4H9TA 1ZP4A 3SGUA 1X9LA 4WUUD 4R7VA 1AYRA 1MFDH 3GTFA 2X6BA 1OD8A 3L67A 2IMNA 5GGTH 2PW1A 4PC8A 1DBKL 1QO5A 1YEYA 2BDQA 3CH9A 3KPSE 3UBXA 4AOFA 5E0CA 4RLDA 2FAUA 3L4XA 4QEEA 3ZZLA 4ERIA 4Y1AA 4GYKA 3RNQB 2NY2D 1E4XI 1NINA 3L3GB 1M03A 4LRNL 5J12B 3HRZA 4HWBL 2X2UA 4IS6B 4OGYL 5FD0A 4QXTB 5GJSL 1OB0A 1EJWC 2XH4A 1I1RA 3UYPA 4NYUA 4N90D 5TDPA 2Q8XA 3HI1B 2X2IA 3L3DA 4GRSA 2Z4QB 2ZX6A 3STLB 1OT4A 2B2XL 5K9OB 3RPBA 2FPYA 2NY0D 3FXIC 5JA8B 3QWOB 4XP6H 4XMVA 2Q6ZA 2P52A 1Q6FA 4G6JL 1G1KA 1W91A 5FSEC 3LY6A 2J12B 3QI9D 3W0KA 5ESQB 2NQ3A 2WKGA 1G0CA 4NQQA 4L37A 3E38A 3SSZA 3D06A 1W15A 2YSSA 3S9IA 2GKIA 5ANMB 1EVTC 5D1QE 4H7VA 3NPXA 3UDWA 4CMMA 2IH3A 4NWUH 2XY1A 4B9IA 3SBQA 3E6FA 3VD0A 4GW5A 1PWMA 3BEWB 5F2LA 4H13C 4EI5D 3H2EA 4GLRI 2XJKA 2P8MB 3LRLA 3TH3T 2Z64C 3HA0A 1L6FA 2ZXAA 3RO8A 4R3SA 1E4JA 4Y9AA 4O15A 3OM3B 1JXKA 2NXHA 3L7FA 1DE4A 4A2EA 1Z89A 3TYBA 2YQ2A 1XGDA 5I6XC 1NAKL 1KQZA 1OBAA 4BI6A 4A8LA 4JX6A 1H19A 2VCBA 3BQVA 3MV01