4NZFA

Crystal structure of abp-d197a (a gh27-b-l-arabinopyranosidase from geobacillus stearothermophilus), in complex with arabinose
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
431
structure length
431
Chain Sequence
ASMHHYQWAKTPPMGWNSWDCYGASVTEDEVKGNAEYMAKYLKPFGWEYVVVDIQWYEPGANSSIYRPFVPLEMDEYSRLMPAVNRFPSAKGGKGFKPLADYIHNLGLKFGIHIMRGIPRQAVHQNTPILGTNVGARDIADTNSICPWNTDMYGVDHRKEGAQAYYDSLFQLYAQWGVDFVKVADIVASKLYGTHTEEIKMIRKAIDRCGRPIVLSLSPGPAPLDHATLFVENANMWRMTDDFWDRWELLYDMFEQCYKWCKLVGLGHWPDADMLPLGHIGIRSVDGGGTDRMTRFTKDEQRTMMTLWIIFRSPLMFGGELRDNDEWTLSLLTNEEVLHVHQNGYGARQVYRENDHVVWTSQDAEGNQFVAMFNISEKRSVVSVSLKDLGCMEPMKARDLWAKEDLGLVKHQLAFELGPHQSILVKLSPAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-specificity relationships in Abp, a GH27 beta-L-arabinopyranosidase from Geobacillus stearothermophilus T6
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords Abp, a GH27 beta-L-arabinopyranosidase
total genus 147
structure length 431
sequence length 431
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4nzfA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4nzfA01
4NZFA 3A22A 2BHUA 3KRSA 5EYWA 3BVUA 1CPUA 2WKGA 1EUNA 3B4UA 4JTSA 4XTIA 1PJ9A 5LHEA 2VFIA 2X16A 3S8HA 1RZMA 2WKJA 2ZA1A 4BI6A 3WNKA 3LV6A 1JF6A 1U2YA 2EAWA 5CLWA 1X6UA 1D9EA 4CCDA 2XVKA 3CTLA 3AXHA 4JX5A 3BMWA 1H63A 4O10A 1SW0A 3KL3A 2YGYA 4BWLC 3B8DA 1VB9A 3BVVA 3LXBA 3MYOA 3L2LA 1PZ2A 4FO4A 4M6QA 4R53A 5FEWA 3PUDA 3TA6A 2WPBA 3GXTA 3C3NA 2RFGA 4UQDA 2DORA 3P62A 4ZQCA 2E9BA 1CI1A 1ICPA 3NQ7A 3SR7A 5L9FA 1JIBA 1CIUA 3ZR5A 1HNYA 4DXVA 3STFA 3CWOX 1TQTA 4UR8A 2A7PA 1YXCA 1T99A 1TCDA 1CGYA 1D3GA 4FIQA 3TSDA 5D05A 2GUUA 3C2VA 5I3HA 1Z48A 1KTNA 3ATYA 3DFQA 4JYDA 1ZNNA 2JK2A 1Y7VA 2HSAA 2TPSA 3DFTA 4ZVJA 1YXYA 1F7BA 4Z0SA 2VEIA 4IUOA 2FH8A 2NWSA 5FF4A 1QHPA 1NF0A 4J3WA 3EXTA 2TMDA 3KXQA 3G1AA 2PURA 4UNIA 4JX6A 5ABTA 3WK1A 3BPWA 3LXAA 4IMGA 4PEKA 3GDMA 1QWNA 1CXKA 2XWEA 2QCLA 2EHHA 1JDCA 3O6DA 1E3XA 1AMKA 2QUUA 2JKPA 2BTMA 2BY3A 4R34A 4MKNA 2DIJA 3CV5A 3U6WA 4FIRA 5K2ZA 1GTEA 2WSRA 4LW7A 1AW5A 4UFIA 1WYIA 3M0ZA 1SMDA 3QFEA 5CZTA 1B57A 2B7QA 1XCXA 2A2IA 2Z0IA 3EDEA 5C54A 2VEPA 3QSRA 5F1VA 1W3IA 1MO0A 1HL8A 1PS3A 3VGBA 3MW7A 3CB8A 4B9ZA 4GNJA 1UOKA 5DXYA 1PHQA 2TRSA 4MZ8A 1I2OA 2A7RA 5A2BA 4LVGA 4J28A 5D09A 4KFPA 1M53A 1TQWA 4FEZA 1KFCA 1AW1A 2A6LA 1J2WA 1VCFA 1ICSA 1KM0A 1WOBA 1UUMA 2EO7A 1AL7A 2V3DA 2AMGA 2NLIA 3TKFA 2X1RA 3FKKA 2J9YA 2WCSA 4N6EA 1XD0A 3W73A 4JDBA 4QJ1A 1PVNA 1JCYA 3W1PA 3HIJA 2PC4A 3FYPA 1BPLB 3NPVA 3BUDA 3HG2A 3TXZA 4O50A 3FS2A 1TQVA 4IPIA 3VMNA 4ADSA 4GUGA 1GT8A 3A5VA 3D4ZA 3WEOA 5CGTA 1MW1A 2VFGA 1QPNA 1PZ3A 1QW8A 1WA3A 5TQLA 1TV8A 3VNDA 2Y63A 2EGZA 3EXRA 4YMZA 3L4YA 2FYVA 1EB3A 3TFCA 2O7QA 2LLEA 2CPUA 2D0GA 2D3LA 4O0KA 5H2ZA 3MMTA 4NNBA 3D52A 4PEEA 1HUVA 3ABSA 3N73A 2NXHA 4HHPA 4Z1BA 1Q3NA 1FBAA 2QCMA 3UXAA 3ZR4A 1VAHA 2BZNA 3BLPX 3W87A 1OHLA 3QSTA 5I3JA 1ML1A 2CLFA 5CSSA 5I3FA 1O60A 3FYOA 4Q32A 3VNYA 3UWQA 3TSBA 5C55A 3TQ0A 2V2DA 2WKLA 3IV3A 5G2IA 3DAQA 4LS1A 1KCKA 4J7RA 2IGTA 3M47A 3INPA 4M7SA 3HBLA 1TYGA 1K03A 3G1VA 2FLIA 2WVUA 3CZSA 1KFJA 1KM1A 4AF0B 2DIEA 3L66A 3NQMA 4LRTA 3EKZA 5CZJA 4OJYA 5LNUA 1LORA 4J3VA 1QPRA 4JIQA 1OX4B 2GQ9A 3EDFA 3SW6A 2Q3OA 1QPQA 3NL6A 3ABOA 4UFJA 3Q94A 2EJ1A 1EIXA 4EF8A 1QNVA 3NQ8A 3W2LA 1MXDA 1U33A 3W2NA 5HXMA 2ZYFA 3RK8A 3S0CA 1PHWA 3L5MA 1ADOA 3OVRA 1DJNA 2Z2UA 3KVMA 3FAWA 3EB2A 3VMOA 5AYYA 3W7EA 5SWUA 1FCVA 4PA8A 1YDOA 4H3DA 3UG4A 5K9XA 1DJQA 3STCA 3TE9A 1VIWA 5LZLA 4ONVA 3SGZA 3O1NA 2GVYA 2ZIDA 4OBTA 4OIFA 3S6DA 1H3GA 4QNWA 3RLUA 3G1FA 4OQVA 1WPCA 1BF2A 1W5PA 3T55A 2ZZ4A 4ADUA 4IMDA 3SJ3A 5IM51 3CHVA 4DO4A 3UXDA 4YCOA 3HG4A 4LU0A 3R12A 4IX2A 4IGHA 1H7NA 1YTKA 4UMBA 4UNLA 3ZS4A 5C2XA 3EX3A 1L6SA 1VYSX 1QW9A 1PV8A 2Y88A 3NZRA 5AHNA 4AMAA 5AOUA 1S5VA 5DCDA 4GKLA 2QUVA 2X2JA 2F1AA 4LXFA 4J3SA 1G69A 1A5AA 3G8RA 1O4UA 1TMHA 2A7NA 1JCMP 4CQ8A 2DZWA 3VSUA 1GVSA 1QHOA 3TTSA 1JUKA 2WPGA 2YIHA 3TSMA 1PCKA 2QJIA 3DBPA 2CLMA 4E2BA 4KWUA 5LSMA 1XL9A 4WQ6A 5HUOA 1I2RA 4NNAA 3CGTA 4LQ1A 3ECQA 3S2CA 1C8VA 3S5ZA 3WN6A 2ZBTA 4NZJA 2C15A 4IMEA 4U33A 3G24A 1OYAA 1VFUA 4ZMGA 5AYXA 3YPIA 3MP4A 4HKPA 3LHUA 1B0IA 4I7VA 1JUEA 3LCWA 1OF6A 4W9TA 3W2KA 5K3VA 4H6KA 3N9SA 3TJXA 4JFUA 3NEVA 3CEPA 1WZMA 3W7IA 4MY8A 5D33A 1IGSA 5F4XA 5CXPA 4HNNA 1RR2A 4Q4KA 2BY2A 1HL9A 1ME9A 1MXSA 3WK3A 2QCDA 4DO5A 3TR2A 2NUXA 5FI8A 3TQVA 3M5YA 3UWYA 3B0PA 3A9IA 1PIFA 3LHZA 3S1UA 1W0MA 3G3DA 3HJEA 4MB1A 3VCRA 3S1WA 5U4NA 4LVBA 3WY4A 1G94A 2YJQA 1N55A 2HTMA 2QCDB 1NOFA 1FY6A 2ZUVA 1BKSA 2QJHA 4ORIA 3W74A 1WBHA 3IIOA 2Q3RA 1W5MA 1CYGA 2YSWA 3CIXA 1H7PA 5BMXA 5HINA 3P81A 3D0CA 3W7KA 2GQ8A 3L65A 3VI2A 5H91A 1VJIA 4WUIA 5I23A 3BLFA 3LCFA 5E6ZA 2ZXQA 2ZUTA 4IOTA 3E0IA 3KX6A 3QPZA 4FX7A 1P0KA 3TX9A 4UOZA 2NV2A 3HF3A 3ZSTA 2WSYA 1TPDA 3NQEA 3VGHA 1HTIA 1L2UA 3VGDA 4MIMA 1I45A 1JGIA 1JQXA 2XIBA 1XCFA 2NZLA 3W84A 1O94A 2YW4A 3C0JA 2QF7A 4HOWA 3WJWA 2TSYA 1BWKA 1CGVA 3KL0A 3NG3A 2E6FA 2V9DA 2H3DA 3NAVA 3E96A 4E38A 5F7UA 3CZKA 8CGTA 5DBUA 4KFOA 2Y4SA 3CT7A 4AF0A 3QRHA 3W37A 4RJEA 1KW1A 3BW4A 4BFAA 1XM3A 4J27A 3QW3A 5F1UA 1IZJA 1VH7A 3MBDA 4PSPA 1UBSA 4O1DA 2PRMA 1TPFA 2F61A 3SFKA 4GINA 1XC4A 3WJXA 3PR2A 2ZTJA 1TPC1 2OSWA 4TVUA 1TPEA 3GAYA 3W7RA 3NA8A 1GZGA 4H8HA 1UCWA 2DH2A 3IVUA 4PTNA 3MYPA 3ANYA 3NQ2A 4EF9A 3BLEA 1KTBA 2QCGA 4QSHA 3P61A 4DF1A 3WEMA 3WELA 1FDZA 2QCCA 2J27A 5E0FA 3LHTA 3BSGA 1MXGA 5HQEA 5D2YA 3W85A 5AFDA 1M7XA 3B04A 4O16A 3C8FA 1JFHA 3I65A 1JCXA 1F05A 3P82A 1PS9A 3OVPA 4LV4A 3K1DA 5FF7A 1SZGA 2FQIA 2FPTA 1C9DA 4GI8A 3MWAA 2YA1A 3GDTA 1IF2A 5F2LA 3CPUA 1LBMA 2CZEA 4EOUA 3WNNA 1OX4A 1MW0A 5D2XA 1HVXA 3TC6A 1UD2A 2OCZA 4UIOA 3GBDA 4ALDA 1ZJBA 3BAYA 3GNNA 4FB7A 1EHAA 1HO4A 1EPXA 1X1ZA 1J0IA 2X2GA 4O57A 3HMJG 4FLRA 3BGJA 5AC7A 3FW6A 1L9WA 2BLEA 2P0OA 2RH9A 2VT0A 1J0KA 1B2YA 2XN0A 4WJEA 2R94A 3SGUA 1EA0A 2QPUA 4MJMA 1Z42A 5L6UA 3LOTA 2VRKA 2PWDA 1GCYA 1WO2A 1J0HA 2VFHA 3VGEA 4IMFA 3MP3A 2BHZA 4XQ6A 1TJPA 2R91A 1TREA 3UQNA 3OHIA 1V3MA 3Q2DA 4UFHA 3BAXA 2WNZA 2BWGA 1TO3A 2F7FA 3UYCA 2GJPA 1J5TA 5DN1A 1CGUA 4A2RA 2R8WA 1KV8A 3BUPA 1RQHA 2JGYA 5FESA 3PUEA 4UFLA 2X1UA 1AQHA 3GAKA 4O13A 3M07A 4Y6GA 2F2HA 1JL8A 4UQCA 2FFCA 2ZXDA 1GTHA 1PEZA 4FMVA 5D38A 3C2FA 1QOQA 1UB3A 1X7FA 3A21A 1DV7A 1K3UA 2YDAA 1A47A 3HPXA 3D51A 3GB6A 3HZ3A 2VENA 3K8LA 3OLIA 1RVGA 4QITA 4CN4A 1YTDA 4S2CA 3TQKA 2AAAA 3UD6A 3VMPA 4IXXA 2EF9A 1LOLA 1OYCA 5KMYA 3L4VA 4U28A 4UTHA 2CU0A 2FPYA 4OHQA 3G0XA 4H7VA 4KMQA 2WVVB 3GZ3A 1SUXA 2QAPA 3ZFHA 1MWOA 2PWFA 4FXSA 1P5BA 3EX6A 4O53A 4HOXA 3VM7A 2J25A 5HULA 3W1XA 3OLEA 2CWNA 1TMQA 3Q37A 5BNKA 1VCVA 2CFFA 4LNYA 3UY7A 2OYLA 1V3KA 3GR7A 3KHJA 3DGRA 1C8QA 1Z44A 4CNOA 1MEIA 2F18A 3HJZA 2P1FA 1XBYA 2C19A 4K8EA 2NT0A 3FA5A 1GOXA 4MYXA 4LVDA 1VZWA 4JDYA 5BRPA 3IVTA 3UEQA 3DFNA 3BUIA 1H61A 4AHOA 5A2AA 1FXPA 3I7SA 4LT9A 3DX0A 1WAUA 4MY1A 2I14A 3L4TA 2XFWA 4N02A 3TONA 5TIMA 3B0VC 3TV8A 4Y96A 1CGWA 2Y85A 3C2OA 4ZQRA 1D3CA 1UA7A 1EP1A 2GVLA 3NPXA 1AL8A 4PODA 3W1NA 3UWZA 4JICA 1I75A 3BH4A 2ALDA 3CQ0A 1TQJA 1W3TA 5E1QA 1VS1A 4GQQA 4HP5A 1Z41A 1S5WA 3BW3A 3W7JA 1K8ZA 1TSIA 1PL9A 4TMBA 4JCLA 2WNQA 1NFBA 4LPCA 3RNDA 3EKLA 1YTEA 1KBBA 1OFPA 1BG9A 2QJGA 5AHFA 1B3OA 2YYUA 1LBLA 5D2WA 1WP6A 4U2YA 4HOZA 5CSRA 3QEZA 3QJAA 3VE9A 1RQEA 1JD7A 2Z1BA 2ISWA 2QDHA 1F74A 1QDSA 2DP3A 3PY2A 1KM4A 4FNQA 4RXGA 2BX7A 5D30A 4BZYA 1KXTA 2Z6IA 4AEEA 3ZT5A 2Z1KA 1TPWA 3S5OA 5LKYA 2D0HA 7CGTA 1JXKA 2O7SA 3TROA 4GFSA 3LPOA 1K7XA 4JNMA 2HS6A 2X1SA 1OFDA 4U2ZA 2Z6JA 2JKAA 3DZ1A 3WDIA 1A5SA 3GXPA 3P8IA 3C56A 5D2TA 3W9ZA 1HXKA 1TPH1 5K4ZA 2G3NA 3L5LA 4J3UA 4N4PA 3OLGA 5KSWA 3VSVA 4O14A 1UKSA 2F1BA 1QI3A 3BAWA 3CZLA 3EXSA 2BSLA 2E68A 3LDVA 4AMXA 1OFRA 4IJBA 3L5AA 3W1AA 2OYKA 2A6NA 2JGQA 3CIWA 3SSJA 3W88A 4JXCA 1KTCA 4N9DA 5T26A 4A29A 3DKJA 4RZ6A 1XXXA 1IIGA 4AH7A 3EJSA 2CZDA 1HT6A 1TQSA 4JIPA 4FLQA 3QQ1A 4XKYB 1YPFA 3IJ9A 3KVKA 1UASA 5EY5A 3IGXA 4UTKA 3UG5A 1NEYA 1Z32X 1U5JA 4NJKA 3F03K 4PH6A 1QO2A 2FHBA 2V2HA 2VEMA 3DXIA 1QWGA 2B7NA 3NZ1A 4JFVA 5CPLA 2CLLA 1BSIA 1EO5A 5DXXA 2KZHA 1LZOA 1LROA 1WBJA 2YPIA 1WZKA 3DU0A 4GXMA 4O12A 3G1HA 3EX1A 5CG7A 4HT3A 4J3XA 2ZZ3A 4TMCA 1EH9A 2NV1A 5K7JA 4WY0F 3GXIA 4WOZA 1MVYA 4JL2A 3W1MA 3I7RA 2FE0A 5KZDA 4UZUA 1DQWA 2YZRA 1P6WA 3G1SA 4IXHA 1IZKA 4AHQA 5HJLA 1O5KA 1S5TA 4GC4A 2E5BA 2X2IA 2XIIA 4O52A 3RFAA 3CLWA 2A21A 2PRHA 3ZO9A 3II1A 1DBTA 3FJ6A 4H4IA 2Y7EA 2BHYA 4N2YA 4I9AA 1RP9A 4LC8A 4B5NA 1AVAA 1CXIA 3WFAA 3FKRA 2V5BA 4JTTA 4UOQA 1Q6QA 2ZRUA 2B7PA 2E0PA 3PULA 1TPUA 3MJYA 2GJNA 4HNVA 5I24A 2C13A 2QPSA 2ISSA 4JFWA 5DCBA 1MEHA 4HPXA 3P67A 1VFOA 5A2CA 5CPOA 1JCNA 3KLLA 3W76A 1F73A 1SU5A 3VSTA 3BGGA 2CW6A 2ZXAA 1SFJA 1DTUA 4MLJA 4AYSA 1GEQA 4WZHA 4ADTA 3EWZA 2FDSA 4YL2A 1ODUA 4XBSA 1VPXA 5E6YA 2HMCA 1V3JA 4Z08A 1Q6OA 2YFNA 1FWWA 4Y90A 3W7LA 3IIZA 4A22A 5K9DA 4K6AA 2E8ZA 1B4EA 1CW2A 1UJPA 2CLHA 2A1YA 2J24A 3R89A 3ZSSA 3PG8A 4JGDA 3OIXA 3FAXA 3ZQ9A 8TIMA 1DKWA 1K8XA 4DEFA 3LHYA 3UERA 1R33A 3G8EA 3WY3A 3H53A 1A5BA 1AK5A 4QM1A 4YCPA 3HGOA 3LI0A 4HPJA 1SPQA 1FCQA 3KAOA 1KBJA 1K02A 1LRNA 2QDGA 5G4EA 4AIEA 3MHUA 3CZNA 3CU2A 4OGZA 3LTYA 1VQTA 2D0FA 1ME7A 5G1YA 3PS7A 4KFNA 1G5AA 4UMAA 1XDLA 2TYSA 3WJYA 3VU2A 5AHLA 1ZALA 3EWWA 1B9BA 5G2HA 1J4EA 3BUQA 4DO6A 4CNPA 1TPB1 2Q8LA 3CPRA 4XTDA 1T96A 3UWUA 1LCOA 4OKDA 2Y61A 4X9SA 1Q4NX 2J88A 3LI1A 3PBVA 3LRLA 3IJ8A 3LLDA 5HWJA 2C1HA 3LV5A 5AHMA 2WVVA 3V1PA 3GVGA 4ZQOA 3O63A 1TPVA 2DU2A 4GWEA 3AJXA 1Y0EA 6ALDA 1G7VA 2Y7DA 4WSJA 5DY2A 1TRIA 4O8RA 3EJTA 3BVWA 1A50A 1BVNP 2DH3A 3FFSA 1BVZA 1YXDA 3WENA 3LCGA 4ZQMA 3MHFA 2A5HA 1KGXA 1XFBA 4NT0A 1UA3A 1DHPA 1H60A 2DZXA 4GUHA 3E02A 4ZL1A 1XKYA 1RPXA 3BLBA 4TO8A 3GXFA 1KM5A 2RKXA 4LS2A 1HWWA 3ZR6A 1QOPA 3TU9A 1JI2A 1ZAJA 3HGRA 2BXVA 4O17A 2D3NA 2ZA2A 5U7SA 3UG3A 5G4WA 1KM3A 2G5WA 1ME8A 1B4KA 3KRZA 1SZEA 3DDGA 1G4TA 1TV7A 1NM9A 3M43A 3IGUA 4MLRA 4UTWA 1HL2A 4K8HA 3O05A 1KA9F 4JTFA 2WC7A 1V7YA 3A5FA 4ATWA 1P0NA 4W93A 4LVAA 3UPBA 3W38A 3G1DA 3TW7A 2H8ZA 3WK2A 1G4PA 4DBEA 3G18A 1GJWA 1Q6LA 2E77A 3DFOA 3NQDA 1VJSA 2CLOA 4U4MA 5IBXA 3GNDA 4BWLA 5CPNA 1UUOA 2E4TA 4NX0A 3WNMA 3HQ1A 3L9CA 2YA2A 3G1XA 3QPYA 3GKFA 2GVGA 5DLCA 4JYEA 4AEFA 3LCHA 2OW6A 3GR8A 1MZHA 4MUZA 4ML9A 1VR6A 1GWJA 1FDJA 2ZZ7A 3DKLA 5DY3A 1I4NA 3BVTA 3TMQA 4LOCA 2YR1A 1UD4A 5E0KA 3BK0A 1VHCA 4O15A 2VFFA 1I2NA 3AXIA 4JFTA 4MZ1A 4UUIA 4FNUA 1ALDA 3P5YA 3L21A 4AB4A 2TAAA 2ZX8A 3MI2A 4GQRA 3W86A 5AB3A 1H1ZA 2OT0A 3WY2A 4Z1DA 5J5RA 4KWWA 3NVTA 3IEBA 1LRQA 3TAKA 4R33A 1YDVA 4RLIA 4Z1CA 1KXQA 2F7OA 2V3EA 1NSJA 4AMWA 3GKAA 3S1XA 1AQMA 1YPIA 2W0UA 3LHVA 3T44A 2E6AA 1LDCA 4MY9A 3GXNA 2YOCA 1XH1A 4AXKA 5EBUA 4DPQA 2BXZA 3BAKA 2WNWA 5CZSA 4HSNA 3TCEA 1QMLA 2OSYA 3LCLA 3MBFA 3NYZA 3BLKA 5LHFA 3G1YA 3L2IA 2RDUA 1XH2A 2WANA 1F76A 1OFEA 5KITA 5HR7A 2VEKA 1N8FA 4PC8A 2ZWZA 1Q45A 1H5YA 1E43A 3ZOAA 3BV4A 1HTYA 3I6RA 3PG9A 2EAEA 1KBIA 3NQVA 4ZQPA 1ZJAA 3RILA 1RP8A 4O54A 5LNVA 5DFAA 4JL1A 3LTPA 5D37A 3WNOA 2ZTKA 1ZHAA 4N4QA 2CXGA 3SIZA 3NPWA 3P5ZA 2CZ5A 3NQCA 3W1UA 2QCFA 1ZAIA 1R2RA 4GUJA 4GIAA 1XV8A 2DJLA 1ZJIA 3THAA 1F2JA 3PB0A 4XBKA 6CGTA 4XZ9A 3TAOA 3E12A 2IQTA 1JUBA 2EEXA 1HO1A 3TJLA 2NXIA 2CHNA 1KFEA 1W56A 3EEGA 3L68A 2DZPA 2G95A 4O19A 2B4GA 1EEPA 2YFOA 2VFEA 2QKFA 4OU1A 4RK8A 3NQGA 1EX5A 2ZRYA 3R5EA 3W7HA 3B0UX 1D3HA 1GG0A 5GVJA 4J3TA 1BEUA 1XBZA 4HNUA 3EX2A 1T8XA 3BUBA 4IX0A 1OB0A 3TMLA 1LRTA 2QV4A 4CN1A 1BAGA 5D04C 1G6CA 2WSKA 4H8UA 1U83A 4Z0JA 4CCEA 5BW6A 2BY0A 3OBKA 1XCWA 3MI3A 1FWTA 2VUYA 1EUAA 5FEXA 1P1XA 3C52A 3T78A 2ZFAA 1NAL1 5DBTA 5F2GA 5HR6A 3I68A 4WOQA 4FNRA 3GBEA 5CPMA 4OV4A 2QCNA 3B06A 1LP6A 4PFMA 1FCBA 4GUIA 4O4WA 3VM5A 1OFOA 2E6DA 3RU6A 1M6JA 4O4VA 1H50A 4QIUA 3LPPA 4NI3A 2Y2WA 5HPOA 2AQWA 2H6RA 2BY1A 2ZX5A 5D03A 5C6MA 4MPQA 2P10A 4U3CA 5A6MA 4ZQNA 3GXMA 1DORA 4TX9A 3QMRA 1E3ZA 1I2PA 1FWRA 2NX1A 4S1FA 3ZT7A 5EMYA 4JTJA 2VKZG 1F6PA 5E70A 1JVNA 3WNPA 4XUGA 5FEZA 4HSOA 3M5ZA 1L0PA 1LWJA 4OT7A 5EL1A 1VLWA 4NVTA 5G2WA 3B03A 3LB0A 5D2VA 1TTIA 3N9RA 1GQNA 2PWEA 1KM2A 1ONRA 3DHFA 3W3OA 1JG9A 3N14A 3KWXA 4JTHA 3M5VA 4UQAA 4NJJA 3R2GA 3AJ7A 1GVFA 1A53A 4UFKA 3PVFA 1QO5A 2WVSA 4JR5A 3O07A 4UMCA 3W72A 1FQ0A 1QR7A 1TB3A 3IJ7A 2X1TA 2C3ZA 3BAIA 2XVLA 3RMJA 3W1RA 3IRDA 4XKYA 3EDJA 1HG3A 3NQ6A 4CCCA 2WVTA 2NUYA 3GIYA 1V3LA 3NNTA 2WJZA 3BCFA 4O1AA 3PF3A 4P2VA 3QM3A 1V5XA 3JR2A 3O15A 5CGQA 4YXGA 3STEA 1O7DC 3RF9A 5A6LA 2CLKA 1JCJA 1WXJA 4H2CA 2EACA 1ZFJA 1YYAA 3BVJA 2J6XA 2DZTA 4A3UA 2ZUSA 1KBKA 2WCGA 2NSXA 5CLTA 4CLMA 4PSRA 3WMSA 4EVZA 5LGXA 3VE7A 2QCEA 3BCDA 3WJZA 3HO8A 4CQ9A 1WZLA 3R13A 3EJQA 3GDKA 1H51A 3W2MA 1ZAHA 2NT1A 4M19A 2VR5A 1X1OA 3LLFA 3VGFA 2A0NA 4PCSA 4RKAA 2I1OA 4JS3A 1QAPA 2H3BA 1GJUA 1UKTA 5KINA 3BG3A 3ABRA 3HG5A 1EP2A 3BVXA 4S2BA 1DOSA 3BG5A 4M6VA 2PCQA 3A47A 1PIGA 2V3FA 1TCMA 3ZWTA 5G5IA 3M5XA 4JN6A 3ABQA 3KE0A 5A8GA 1AG1O 1SZFA 4AEOA 1TRDA 1W54A 2WQPA 4CGTA 5DCEA 1KLYA 5KEZA 2JBMA 3TUUA 1SSDA 3NQAA 3QF0A 4NUWA 3GX9A 2FPVA 4LTSA 2YCEA 5KTLA 2CLIA 3O6YX 3DX3A 1CGTA 4MAZA 3HPZA 1UH3A 1S3HA 1M7OA 3W23A 1SW7A 4N9BA 1SZNA 3NL3A 3DENA 1K8YA 1I8JA 3G3MA 1W5OA 4JY9A 4A2SA 1OFBA 1W5QA 4LRSA 1W8SA 5AC8A 3QGVA 4NX5A 1JI1A 4O18A 2H8XA 4N6FA 3N2MA 5A5WA 4UCGA 4D2JA 2VFDA 1WOAA 1OK6A 1U30A 1KFKA 4UZSA 5MHBA 1XSJA 3LXCA 3QMTA 3S1VA 1L6YA 2ZICA 4JFSA 2WNNA 3FEMA 4X3ZA 1JRBA 3AMLA 4IPJA 2PWHA 3G22A 3NOEA 1MFVA 2Q8ZA 3VX1A 2V0TA 2ZQ0A 4FNPA 1R2SA 1H7WA 4UTMA 1OVDA 3GTNA 3ZWSA 1JR1A 3GLCA 2ABBA 1YADA 2WOQA 2ZA3A 4ORMA 3PAJA 2XN1A 2F7RA 3EDKA 4DBDA 4IQLA 1H7OA 4A21A 4I7UA 1OF8A 1I2QA 2GUYA 3DHPA 1SQ7A 1P4CA 3PBUA 2RDWA 3GK0A 3W7PA 3UCQA 3PB2A 1KGWA 2VELA 2W6RA 2XVGA 5F2IA 1DQXA 2B0MA 3PSWA 1KM6A 3S9YA 2ZX7A 1DL3A 3L4WA 1G1YA 3W7NA 2E5CA 5EA9A 3W71A 1IXPA 1PAMA 2F7PA 4EIVA 2V81A 2XWDA 3RLVA 5F4SA 2ZZ2A 4HPHA 2WV8A 3N34A 1OT1A 1XI3A 2QLYA 3ZT6A 3QMSA 4L4LA 4J9JA 3W1QA 1W5NA 4UTWC 9CGTA 4QAIA 4ICNA 1LWHA 4FNSA 4CVWA 3JRKA 1DVJA 2CLEA 3W1LA 1LOSA 3S42A 2V8ZA 4MOZA 1HX0A 3SECA 2ZUWA 4JTLA 4FX6M 4DPPA 2GOUA 3A6OA 1THFD 4KWVA 1TTPA 1CXFA 3L2MA 1LM1A 4FF7A 4M6PA 3OG3A 3D4YA 2RHGA 1Q6RA 3L0KA 1VCGA 3EJRA 1GYLA 1R75A 4QISA 2OX1A 1XDMA 4K7YA 2EPHA 3TNOA 3T4CA 4MZYA 3DC0A 1VHNA 5HDRA 2GVJA 5K9CA 4Z1AA 2ZZ1A 3LM7A 4QQ3A 1PCWA 1QX1A 4DF2A 2C14A 3PSVA 1SO3A 2NWRA 1BTMA 3HGSA 4LY8A 4OV9A 2GQAA 5DELA 1OSEA 2VOMA 4X22A 4YWIA 1SSGA 3I7QA 3P7YA 2FB2A 3C4UA 1IXQA 2EKCA 3TIMA 3ATZA 3EWXA 3F1QA 4MFEA 1EP3A 4AWUA 1F5ZA 1OX6A 2G97A 5IBXC 1VFMA 4HIBA 3CC1A 3O8AA 4UTJA 4MVAA 3T40A 4UQEA 2C8NA 4TIMA 2C7FA 1R47A 1GVOA 3EWBX 1M5WA 2ZX9A 3R8RA 4LWWA 1XGZA 3QYQA 4AAJA 2VRQA 2VXNA 4U31A 3V75A 3WNLA 3DX2A 1EA9C 5I3KA 1XD1A 1BWLA 2BXYA 3LRMA 1T0OA 4MJZA 1H7XA 5AHIA 2E5DA 1GVRA 1UH4A 1JDDA 2OZ0A 2C18A 1RQBA 7TIMA 3UNDA 1C29A 3QH2A 4K37A 3PC0A 1ZY9A 2ZXBA 1GPWA 3MP5A 1KFBA 3BAJA 2J9XA 1KGUA 2V2CA 1CXEA 2E1DA 1SR9A 1CLVA 1XBXA 5FF0A 4X9YA 3CTTA 1A5CA 3W07A 4JTUA 3A4AA 3EX4A 4ZZ9A 3VNZA 3O6CA 1PPIA 1O5XA 3KOFA 3ELFA 4GRSA 2AGKA 1W31A 1SW3A 1L6WA 3THQA 2DJXA 1AMYA 2FHFA 4RZ5A 1OX5A 4UTLA 3LGEA 1JXJA 3P60A 3S5YA 2C16A 1UD5A 1XSKA 1JQVA 2OMAA 3C2EA 1UD8A 3CZEA 4MYAA 4GI9A 5AC6A 3QQ0A 4Q33A 3CWNA 3S5NA 1KB3A 5I5RA 5C5YA 3W83A 2C6QA 3TFXA 5HWMA 3TXVA 4GE8A 3U2OA 5EMUA 2OSXA 1TTQA 3NXFA 4O11A 3LCIA 1X8FA 4TU1A 5D32A 4K7VA 1FXQA 1SFLA 2G96A 2VNCA 4L4MA 3OVQA 3LRKA 1G4SA 1AW2A 1IIHA 2E6YA 5CZ0A 1OFQA 4WXYA 4WY0B 1TQUA 3W2JA 5LGZA 4M56A 5G1TA 3HB9A 3FOKA 5KZEA 1DHKA 4NXSA 1JCLA 2NX3A 4M5PA 1WV2A 4GO9A 1FCUA 3DX1A 3W7DA 3BARA 4UQ9A 2QMJA 1KWKA 2NX9A 3C6CA 3E49A 2PRLA 1H7RA 1TQXA 1SO6A 3NPUA 3MO7A 1ZENA 4LUIA 3W1TA 1LOQA 1H62A 4FX8A 5TD4A 2ZZ5A 5F2MA 1QI4A 2QEZA 5LNWA 3M9YA 1F6KA 4E0CA 4H8VA 2ALWA 2Y89A 2Y24A 4JY8A 3NR0A 4WD0A 6TAAA 1OFAA 2I9EA 4NJIA 2FHCA 1GYNA 3GDLA 4BK9A 3CEUA 5HWNA 1SO4A 1MFUA 4M7TA 3M6YA 3TH6A 1JD9A 1LBFA 1EWDA 3NL2A 3D50A 4AVFA 3UY8A 2FB3A 1KCLA 1XUZA 1JF5A 1R30A 1VYRA 2FJKA 4WX2A 1DEDA 3NM1A 3L4UA 2QMKA 4HNTA 3UZJA 1G4EA 1KXHA 4QAWA 3KVLA 1CXHA 1OT2A 3L4XA 4JTEA 1UKQA 3K8MA 2ATSA 3STGA 5E9AA 3LX9A 2C0AA 2EABA 4JCMA 2FTPA 1QPKA 3PM6A 3H55A 2R14A 1OG0A 3HPSA 3TC7A 4LC6A 4MFDA 1XSIA 2ABAA 3VX0A 3VGGA 4WLCA 4NU7A 3FIGA 3K30A 4G1KA 4FHAA 3HGJA 1UH2A 3P80A 4CNNA 2CZFA 4E2OA 1GVIA 4BR1A 4WY0A 2WSPA 2RDTA 5D02A 3WJSA 1TV5A 4JEQA 1CGXA 2WSQA 2ZRXA 3L0NA 1JULA 3SY5A 2F84A 3A24A 1IXNA 4CN6A 3M41A 1WQ5A 4LUJA 2ATMA 4CQAA 1MW3A 2Y6ZA 2QCHA 4O0ZA 3QZEA 3FJLA 3M1ZA 1VLIA 4UTTC 2Y62A 5TBOA 3BW2A 3FLUA 2ZDRA 1W37A 2AAMA 1EWEA 2A4AA 1RV8A 2Y7FA 4JTKA 1XBVA 1E51A 4LVFA 4DELA 1CDGA 1NVMA 4NQ1A 3W70A 3G0UA 1E40A 1ZCOA 2D73A 1ZS2A 2D2OA 1JJKA 5DO8A 3JS3A 3HOJA 4UQBA 1R2TA 5AHEA 4IWWA 5I3GA 3CLMA 1LLWA 4JD4A 2Y7GA 1MW2A 5K4XA 4AIOA 2YYTA 3DI0A 5KZMA 4O1BA 4OWGA 3KEHA 1OK4A 3TDFA 3EWYA 2J9ZA 4AWTA 2F7QA 1D7FA 4JX4A 1R34A 3TW6A 2YKKA 3TOPA 4EWND 3LBCA 4I7WA 1H1YA 3F4WA 1KLZA 3KRUA 3DI1A 2XN2A 1TIMA 1VRDA 4BI5A 2G3MA 5J5DA 4PCTA 4XB3A 4CKQA 1KWGA 1G7UA 4BA0A 5FEPA 3UWVA 3KL5A 4UTUA 2JKEA 1K7FA 3NGJA 4UR7A 3LERA 2YX0A 3G0SA 3T7VA 1KXVA 2ZRZA 2V5LA 3F4NA 2FIQA 2Y70A 3LCXA 4GUFA 4N9EA 5LNSA 4E2DA 1S46A 3NDOA 3USBA 3W7OA 4UCFA 1OYBA 1QI5A 2ZUUA 3MI6A 4K36A 1OGSA 1QPOA 1O95A 3IGSA 1KFLA 1FWNA 1ICQA 4Y8FA 4GO8A 3C61A 3B05A 3LHWA 3UWWA 1TJRA 3E9AA 1GVQA 2GJRA 1EO7A 2FGZA 4WF7A 1KV5A 4K38A 4BF9A 1XUUA 3DDFA 4GJ1A 4RXFA 3DX4A 3TK7A 3L0GA 3PUOA 1OJXA 4NJHA 3BC9A 5E93A 3IIVA 3WK0A 3C2RA 2EQDA 1FWSA 5EPDA 5I3IA 1J0JA 3DHDA 4XWUA 4NJGA 4HN4A 2X30A 1G67A 4WXZA 5BMWA 3W6YA 3L4ZA 1BLIA 1PIIA 4LV9A 4PCFA 4O28A 2VC6A 1PE1A 1M7PA 2GPTA 2HS8A 2OW7A 4RR4A 3BSHA 3N3MA 3PBWA 2ZRWA 2DZUA 3O16A 4RZ4A 3AO0A 2WO5A 3OA3A 3L67A 1LYXA 5HNRA 2V82A 4X0NA 3P74A 3W75A 5BOOA 5F4WA 4B9YA 3EJUA 1TTJA 1LLZA 2NXGA 3P8JA 1WDWA 1VYPX 3IIPA 3MUXA 1IXOA 3O06A 5AN7A 3GDRA 4JTIA 3PBYA 5LNRA 3CZGA 4GI6A 1UD6A 4UC5A 1VC4A 3VKJA 3QW4B 1QCWA 3CM4A 1IV8A 1CX9A 3BLIA 3W7GA 3WY1A 1K7EA 2QR6A 3RIKA 4LS0A 4RX0A 4JYFA 1FDYA 1GJPA 3KLKA 3GYEA 4KKXA 6TIMA 2OYMA 3KVJA 2OT1A 3M44A 4AWSA 4JTGA 4X2RA 3DFSA 3NQFA 4AHPA 4C1KA 1RPKA 2ZRVA 2ZE0A 1SMAA 4AW7A 3BG9A 4FXRA 3TTYA 4K39A 2UV8G 1JRCA 4P61A 1YDNA 1YLVA 4NNCA 3LBMA 4YLWA 4AYGA 2OJPA 3QC3A 1QWUA 5HMSA 1MSSA 4FLSA 2EADA 5BRQA 1WE5A 1SO5A 1JDAA 4TR9A 1OABA 2DZSA 4IMCA 4QNEA 4NXKA 1NF7A 3BMVA 3UPWA 1VGAA 5CKSA 3EJPA 1MEWA 3VO0A 4PL2A 3EDDA 3M7WA 5HUPA 3K8KA 5FF3A 4UNKA 3Q58A 4R7JA 4UFMA 3AMKA 4HA1A 2GJLA 2V30A 2Y5EA 3DHUA 1W9XA 4PL1A 2DZVA 3WDJA 3W2UA 1FX6A 3DFPA 1LTDA 4OE7A 2X2HA 3U8GA 1XH0A 3PWAA 1HFBA 3IK2A 3W22A 1WZAA 4UXDA 2YXGA 3IIXA 4UTIA 3A23A 3W7MA 3W7QA 3MHGA 4BI7A 3GXDA 2PE4A 4GBUA 3SI9A 3WFZA 3HG3A 3NM3A 1R46A 3OEXA 4UTTA 3OLDA 3VFLA 2E09A 4DQWA 4FNTA 5I0DA 7TAAA 1RD5A 3EWUA 4Y9AA 2ISVA 3N19B 2ZWYA 1FUYA 2W79A 3W7CA 4RCXA 2QAFA 2PWGA 3N2XA 1WX0A 1GG1A 2FH6A 1W3NA 2A85A 2ZZ6A 4WSKA 1W1ZA 2H90A 4C1LA 2NUWA 3KFTA 2QUTA 2ZCGA 3M16A 3P84A 1CXLA 1QFEA 3BO9A 2B7OA 4RV8A 5FF2A 1UD3A 1G9HA 4M8UA 3SZ8A 3UZ5A 5BRBA 2ZX6A 4O1CA 4FLOA 5EKYA 1JAEA 3NL5A 4N9CA 5AYZA 3WDHA 3H54A 2YW3A 2E8YA 5CGMA 3NO5A 4DF0A 3DH7A 1N7KA 2YA0A 3IVSA 4POCA 3LTSA
chains in the Genus database with same CATH superfamily
3GIVB 3L1OL 3MROB 1CI5A 2DWSA 3C6SB 4NQCD 4QXUH 3D85D 3VXOB 4Q4MA 5I1JL 3NJGA 2Z1SA 1CPUA 2WKGA 4XVUC 1JFXA 3VXQA 1C1EL 2CPCA 4XTIA 4X5WB 1PJ9A 3MGTB 4NNYA 1V0LA 1H41A 2B8OT 3L4CA 4XBPA 1BDYA 2X16A 4AZGA 4POUB 1OGAE 3ZQXA 5KVDE 1HK6A 2YBGA 4BI6A 1F4HA 2QV5A 1YMHB 4DKEL 2NLJA 3CUPB 3WNKA 1Q8JA 1XLDA 4L8DA 3ZE0B 4PBXA 2DLHA 1JF6A 5CMAB 3TLLA 5HOSA 3B3DA 3TA3B 1FBIL 2ISFA 1HEJC 4PTUA 2XVKA 3EFOB 1Q2RA 1N0LA 2ESVE 3C5JA 3TWCH 3VXMD 3EYFA 3AXHA 4U49A 3ITCA 2CIIB 1UQYA 5IEKB 1H63A 2XZCL 1SW0A 4AIUA 2WLHA 2AK4E 2YGYA 2R0LL 2DQIH 2ED7A 4KKCC 2GTWA 1A0QH 3B8DA 3WSQH 2ZD0A 1II4E 4RV3A 1HHGA 1KGCD 3LXBA 1XLLA 3MYOA 1E9IA 4Z77B 3QXUA 1QLEL 4F58H 3L2LA 3ZRCC 5C7XH 1NBVL 5HHMD 1JPMA 4NI8A 4WTZG 4WDTA 3H8AA 3MUGA 1M71B 3R0KA 4KK9C 3W7QA 2W66A 2WPBA 1D6VH 5CCJA 2MQCA 2Z91A 4K4KA 3WDQA 3HZKA 4FQXD 4XXWC 4TSAH 2RFGA 1D6EB 2XHYA 4UQDA 4BE6A 1MRCH 1A1MA 2P5PA 2E9BA 3P4LA 4JB9H 5E9DB 3VU1A 3P62A 3SCMC 3NRQA 4J4PD 4Y4FB 3SR7A 1A7QL 3CVHB 5IXEA 1JIBA 3HNTH 2J8OA 3EZ8A 4KCVA 4FI8A 5J4MA 2JSFA 1CIUA 4HUUA 1XGDA 5B4MD 3MUAA 2BVOA 3CHQA 2L04A 2Q3XA 3MC0A 1NIAA 5G4MA 4UR8A 4GSUA 2A7PA 1ES0A 2J56A 4ZUSB 1BQCA 1T99A 2XG5B 3NYDA 3V5HB 4RRPA 3SAZA 2P8MA 4FIQA 3INUL 5JPNC 3U57A 5D05A 3KBPA 1RFDL 5I3HA 2X89D 4M8RA 5HHNA 3RVTC 3PL6B 3BZEB 1KTNA 2O6EA 5JIMA 5JQHC 1S2WA 1P0BA 5AYIA 3UG8A 3OM3B 1KLGB 2APXA 3MMUA 2DQMA 4HGKC 4S1RL 1L9OA 3P30L 5BZDB 3TURA 1MLBB 3I02B 1WWWX 2RGLA 1Y7VA 2HSAA 4ZB5A 3DFTA 1PZ0A 4C6KA 2V5RA 3JXAA 4ZAKD 5I2IA 1YXYA 4IUOA 1MFCL 3ITXA 2EYSA 5ESAB 5AAWC 3M46A 4OCWH 5DMIH 1GK8A 4ZRGA 3EXTA 3QEQA 2VXUH 4X63A 4F92B 3OAYH 1MQPA 3KYKH 1CGSH 1IC7L 3PABA 5L2JB 1ZEAL 3HBQA 2X7VA 3MWCA 3WHE0 4NZ1A 1N64H 3QQ9C 3LS4H 4AEIH 1DBML 4TULH 4M7LT 3WK1A 1R5VA 5ABTA 3BPWA 4F8OA 4HS6A 3AQXA 3QZAA 4N0CD 4F5CE 5FYKU 1TDQA 4S3FA 5I1GL 2QCLA 4LLQA 5ID0B 4PRBA 4XP6H 4BFGA 3MRBA 1JDCA 2XG4A 3MCLH 4LHUG 1I9JL 3MOAH 5AVXB 2QUUA 1GOWA 2BB0A 5FKYA 1E0TA 3N29A 3JZUA 4QLRA 3RG6A 4ZMAT 2JKPA 3F12B 1E28A 4PVNA 4OR1A 5EO1B 2VDHA 5F8RC 4Z3JA 3W5NA 3SPIA 3T0DA 1F3XA 2IAND 5BXFA 4XGZB 1UT1A 4XNUL 4HFWB 4CILA 4IIEA 4TO8A 4KEMA 4CBPA 3U6WA 5I74C 5IOKA 4FIRA 4KERA 1AO7E 2WSRA 2OWCA 1TA3B 4XC3L 4XMZA 2PYEB 1HHIA 1SN2A 2AFNA 2IWEA 5ANME 3M0ZA 7A3HA 4TUFA 4LIQL 2YCLB 1B4TA 2DSUA 2B7QA 2VSDA 5H35B 4D0CB 1G7MA 1QRNB 1ZKAA 3MDJA 4GG6B 2A2IA 4HU4A 3UJIL 3TF7C 5AB1A 1A5MC 4KUZL 1S8DB 3P2DA 4N0UB 5CP7B 2XX0A 3GJEA 4F2BA 1IAMA 4HIQA 2CGYA 2VM3A 3WKMH 4Z7QE 1MDTA 2D7OA 3KYOB 2JIXB 1U8LA 1FCCA 5FK9B 1O7DE 3D2UA 1NUFA 5FYKD 3S36X 2RCSL 3U48A 5BRZB 1R4XA 4N2FA 1XF2A 4MZ8A 3OBEA 5D09A 3LOWA 2CBQA 3MSYA 1FVEA 4F7CA 3QPQC 1RV6X 4ZS6C 3BT2L 1YEHH 3GJFB 1L5GB 1R7OA 4FEZA 4M5ZH 1DSFL 5AD0B 4C5ZA 4OFPA 1AIFB 4RH4A 2IXVA 3TPKA 1EJUC 2C26A 1ICSA 3SKNB 3WIHH 4JHBA 1MREH 1KM0A 1DSWA 3H23A 1GNXA 3TWAA 1AL7A 4Y1AE 4ZMQA 2V3DA 1S2TA 4TRPL 4JQ1A 5DEGA 1E0OB 3D1MC 4HIXL 5AL8A 5DQJA 1JNLH 2X1RA 3FKKA 4YQXL 2WB7A 3UGRA 2WCSA 1CD0A 1KELL 2IGFL 3BD3A 4GX9A 3HAEG 32C2A 2O61A 3W73A 4JDBA 1IGTB 3ALPA 5EFDA 2I60H 1OCBA 5ABZA 2P48B 3W6MA 2ZKMX 1U8QB 2PGEA 4LARH 2BNQD 4N22A 5B7EA 3NPVA 3HG2A 4AGNA 2UY6A 1P7BA 1BRLB 4IPIA 3RO8A 1MNUH 3W39A 3MB9A 4F8TA 4HH8A 4JZNA 4GUGA 3T1GA 2YAQA 4HUKB 4ADSA 1QASA 3ABZA 3S3PA 3D4ZA 3NDZE 1QNOA 2F5AL 2E3VA 2DAVA 3BOVA 4A04A 2P8CA 4KJYB 1PZ3A 3RY4A 1S7RB 1TV8A 1RIHL 1SJVA 1MYRA 2JB6B 1PLBA 2Y63A 2BSEA 3L4YA 3PDGA 4WFHD 3SDDD 4ZZFA 5A3ID 3GH4A 4YMZA 3TFCA 4M7JH 3UJTH 1MCEA 2O7QA 3T0BA 4DAGH 4M4RB 3BP4B 2CO6B 2BSRB 4PEEA 4WUUE 1HUVA 3ABSA 2NXHA 3PFUA 3DNKA 1L9QA 1P5VA 3D9AL 1VAHA 5SX4H 1HCZA 4O9HH 2PR9A 3SEPA 3W87A 1HQRB 2GBAA 2P5WA 4F27A 2HZGA 5D7HA 4IDLA 2CLFA 5CSSA 3SY1A 3KVQA 3QUZA 1RK7A 4KMLB 2J7BA 4ZSOB 5KZCB 3DAQA 3MVTA 3L3GB 1KBGH 2B08A 1KCKA 2OPJA 1A5LC 3BXNB 3QY6A 1DXFA 1V79A 3FUEA 4ES4A 2I9LB 1BYCA 4U1IB 5LGYA 1KFJA 3IXAB 3MMEA 3HW7A 2DIEA 4WU7B 2CLRA 3D18A 2Z6FA 3EOAA 3QEGL 4AC4A 5B39A 4J3VA 4JRXA 4C90A 4YTSA 2WBWB 4Z77A 5LNUA 4Y4KB 1MH5A 1TYRA 1FIEA 1C91A 5IF0A 1ZRUA 1WQVT 1PYWB 4HCRH 3EDFA 4YL9A 1W0VB 5FO7A 1F9CA 3OXSA 2Q3OA 4UFJA 3UJSA 1LO0L 4JDEB 4YGAB 3Q94A 1JS4A 3IMTA 3WU1A 2YPLA 1NOAA 3LNMA 1CICD 4EPBC 4RFOH 4NL1A 3MRBB 2OL3H 4Z8FL 3GZOA 1RZIB 2A3AA 1QVBA 5KSUA 2CO7B 1G7LA 3S0CA 3MJ7A 1B9ZA 4P23A 4N26A 5I71C 1PHWA 1KBVA 1VKXA 3LNPA 1U8HB 4DZHA 4P8QA 5I09A 1IBFA 4FG2A 4OFIA 4K7PL 1MHEA 2GY7B 3X3GH 5DD3H 2A79A 1QACA 5AYYA 1NBQA 3W7EA 4XP1L 5SWUA 1FV1B 4PA8A 3UG4A 2ICEC 2A0LC 3VFWA 3WUZA 2EYTA 4ONVA 4PJIF 2EKSA 4KQ3H 1FZKA 4KRPB 7REQA 4P3CH 2AV1B 5F70A 2VDOL 3QULB 5I30H 4I6VA 4YHGA 3VOCA 4HSQA 2OMUA 1N4XL 1GYVA 3DYOA 4F7TB 4OQVA 5FOOA 1WPCA 4HCGA 4WWKB 4OJEH 1ISZA 1Z9AA 3O3RA 3GHUA 4LSQL 4UT7L 3NZ8A 4PJIB 1IEQA 2ZZ4A 4IMDA 1ASOA 2Q9OA 3QYNA 4DJEA 5IM51 2VXVL 3MROA 3L7FA 3FQXA 1L7TH 3LK6A 4IGSA 4HT1H 3IK4A 2VLRA 3PGCA 3TO2A 4IGHA 3NZGA 4X4YA 4FMKA 3FONB 1H7NA 1YTKA 4UMBA 4UNLA 4NP7A 5C0EA 3O3BA 1NBZB 4GG6E 3BQUB 1VYSX 1QW9A 1GPOL 5K69A 2VUNA 4H40A 1TIWA 2Y88A 5F7FA 5DX7A 5AOUA 4J1UB 4M8VA 4GKLA 3NACL 3OQRA 1VPOH 2OCFD 3B9AA 2X2JA 4A3YA 5FJTA 2AKRB 3LV3A 3HZKB 4LXFA 4E5XG 4EJ1C 5J12B 2PDWA 1O4UA 3TYAA 4GPVA 1AZVA 2H3XC 4I8DA 1JCMP 1R24B 2EXSA 1RLBA 1X4ZA 1IARB 1GVSA 1S9WB 2NY6B 3HJ0A 4JY6B 5F6IC 4XP6L 2WPGA 5I1GH 1PCKA 4P5TB 4E2BA 3ZLFA 1OGAD 5IFJB 4LPTA 2VDKH 1XL9A 1TJ2A 4QROA 2A83A 3SURA 3AB0B 1QRNE 1I2RA 4WO4C 3ALXA 3CJJA 2IOMA 1QBLL 3WGUB 2G2PA 2KMWA 2GTWB 1SOKA 1CGSL 1BWWA 4XP5L 3QI9B 4KAQH 1BVWA 3QI9A 5EFIB 3V0DA 4WJG3 3P73A 3AYSA 3WN6A 3U9UB 4U33A 3G24A 4HJSA 4Z2GA 4ZMGA 1EF3A 4JANA 5EU5B 4HKPA 1J96A 1K72A 1SLXA 2POTA 1T2QH 3Q05A 3LHUA 2E9MA 4I7VA 2GAZB 4J3OF 3UJ2A 1AP2B 4A7SA 5K3VA 4H6KA 3JWNC 3AY4A 3EGDA 5JU6A 4MD5B 3L3HA 1HP5A 3WAKA 1ZMYA 4JFUA 3CEPA 2WINB 1N68A 4A6YA 1INEH 1C12B 5HHME 2EIEA 1FDLL 5D1XA 1EEQA 4WU5B 3GZPA 2J73A 1EJWC 4GYFA 1JYVA 2HCVA 4XNQA 5F4XA 4MG4A 3FO9B 4UT6L 3TIEB 4H6EA 2YBVA 4PJXB 4HCRA 4YE4H 1EC7A 5KYNA 5LNGA 1MXSA 2QCDA 4Q4KA 1PZ5A 2CUMA 3CH1B 3O6FB 5T91A 3UZYA 3TBTA 3LQZA 1A7QH 4AQ8A 3MX0A 3ZX1A 5D8ZA 3M5YA 4P5KA 1PIFA 3LHZA 1W0MA 3G3DA 3HJEA 3MV7E 2PABA 2AJVL 2N3JA 1CLYL 3OKKB 2WZPD 4KO6A 3SJVA 1DVSA 4YBQC 3FRPG 3P40A 3ZE1E 2HTMA 3S37H 4NQEA 4EDWL 5I06A 2ZUVA 1Q63A 1EK3A 1PJWA 1K9TA 4F91B 4K2UL 2HH0L 1RZ7H 4L6OA 3WLNA 5HDBB 3VA8A 3W74A 5HHOA 3D5OF 1VADA 4PCPA 1OM0A 3EO9L 1W5MA 3B7YA 4KKLC 1CYGA 1JNNH 2WGXA 2D31A 5A95A 3WG7B 4G9FB 5BMXA 3VFUB 1Q6GA 3WTWA 2PTZA 4PTTB 4WSGA 3HN8A 1GZQB 1MF2L 1YO4A 3DK0A 4HWUA 4N8VG 1VJIA 4Y7MA 2BJMH 1G1KA 2CO7A 2WWOA 3CN3A 3BLFA 4F2MB 2ZUTA 3SHSA 3KX6A 1Q9WA 3QPZA 4KUCF 4FX7A 4P7LA 3MUUA 1Y6NR 3HMXL 3BRDA 2UXVA 1TPDA 2VR4A 2AANA 1PZAA 3EHBB 3MLVH 3NQEA 4MIMA 5E00B 3UTQB 3V3WA 1XCFA 5FGCB 3D6NA 1WDRA 2W3ZA 4EPEC 5CPTA 3MYZA 3T1FA 2GTQA 3GLAA 4WWOA 3KL0A 3RX5A 4HIIB 3OHXB 2YPVA 3OJMB 4JPWH 1XPGA 3NAVA 3PJTA 3E8UL 3LKOB 3CWHA 5DBUA 4AF0A 3CT7A 2YCLA 3P4NB 4MNGB 2FSEB 3IDXL 3M0LA 4DWDA 4JLRB 4X5QA 4UM9B 5MHSD 4PFHA 4RJEA 4LLAA 4G82A 3WLTA 4YE0A 4J27A 4RQQA 2WYIA 3GMQB 3QW3A 5F1UA 5DFWH 5HPMA 4XC1H 1VH7A 3SCVA 3BWUF 2BBFA 1E5ZA 1MWAH 2QKIC 3OQ3B 4NENB 5T33L 4O1DA 1M6UA 4X6CA 4O5LH 5D7IB 4TQEL 4H9YA 1NBZA 3D25B 3N50A 5JA8B 1ZP3A 4X4KA 3WJXA 1XF1A 2R69A 3B9KB 4NJAL 1BRLA 1PYFA 4E8CA 1MHCB 1XB6A 2XUWA 3CFUA 4TVUA 1S9VB 1TPEA 2PDCA 3AHXA 3I6LD 3GAYA 4X4XA 3N42B 3I50L 1Q1JH 1UA6H 3KCJA 4RNHA 1PY4A 3W7RA 2BIHA 1PW3A 3OG2A 2GWGA 3WIIL 2EXYD 4NWTL 2JK5A 2J5WA 3TNMA 1V6YA 4CQBA 1WGOA 3QIUD 1EJOL 4WJ5A 2K7QA 2CCRA 3EFOA 1IT7A 4G42B 3SE9L 2NQCA 3IFPB 3K80A 4NAFB 5DT7A 3PWLB 4QSHA 1AR1B 3ARDC 4ODHL 1ZZMA 4DF1A 5HGHA 1GQIA 2QCCA 1AH4A 2HUEA 3W4RA 3HUJF 2VZVA 3L54A 1VD6A 5A6BD 2QHRL 2WMIB 2XJKA 3D3FA 1T7YA 5I2IB 3BSGA 1CT8A 4X6FB 5HQEA 1U8KB 4MWFB 3W85A 3SY8A 2CJSA 4TLUA 5LIYX 5AFDA 4XP4L 3S8GB 3B04A 3CUZA 1PFOA 4K55A 5MERB 4O16A 1NY1A 4P5MA 2ICWJ 2NR6D 2OOFA 1CD1B 5D7SH 1OCNA 3TYDA 4NN5B 1A6VH 1Y0LA 2VLLA 4NIYE 4PRNA 4TVPE 1TTAA 3LZNA 4B27A 4E5XB 1UJQA 2GK1B 1JZJA 3RR4A 5FM4A 2EEFA 3I75B 4M29A 1BIHA 4R90H 5F2LA 4K3DH 1IF2A 2PLJA 4RMBA 4EOUA 2GJ6A 5C0ND 1S1PA 1UC6A 3PAOA 2VD9A 1D7DA 1ZK5A 4JDVA 4MQSB 1UD2A 1V08A 4HBCL 3GBDA 3KR3L 3DX6A 1JNLL 2O1AA 4KMTL 4WAFA 4Z3FA 5HD8C 4OV5A 1FP9A 3ES6A 4QP0A 3T0AA 3INOA 4G8IB 1HO4A 4AQAA 5DZJA 3GS4A 3RHWK 5DMMA 4K94H 4XPTH 1SXCA 4HFWA 1XH3B 3BGJA 1VLXA 3FW6A 4LSVL 5AC7A 3O4LE 2ZCKL 4PMFA 5L4JA 2X4RA 4L4TD 2XN0A 2ALAA 4HQQH 4NHUA 4PWFA 2DMGA 2EPHA 3SGUA 3QDJB 4P99A 1EA0A 1IKNA 4F8QA 2FVMA 4YHNB 4Q9RL 1Z42A 4JHMA 4QRFA 1OY3B 5B1CA 5I15L 2WMFA 4X6DE 5ADPH 5GRXG 4DETA 3T2PA 4RNRA 2RD0A 1G0XA 4QR7A 4Z0XB 3EF7A 3WQDA 1SDDB 4WHYH 5BRZD 1KCUL 3HE7A 2NNXA 3K6IA 4HFUL 4XXWA 2IUZA 4XQ6A 4IOIA 3OKNA 1X96A 4OOZA 3OHIA 1JSYA 1EFXB 1BYNA 4WWPA 3HFML 4K7FB 1I1FB 4DESA 1XGEA 3Q2DA 2QTEA 3QNZB 4Y4FC 3S8WA 5IVXB 4MB4A 3CL8A 3HPJB 4XKMA 3P4OA 1OCOB 2QQQA 4ONFH 3UZZA 3RY5A 4NKOA 4TVDA 1B6DA 4F20A 3FOMA 4BFIB 1CGUA 4MJIB 4NQCB 5DS2A 5EOQH 1KV8A 3TN0B 1TV2A 2R1XA 4WDIA 3T6QC 1GS7A 3CVHL 1KLFA 3QNXA 4BEQA 4NNYB 2DQUH 4V1DB 4H0GA 3GAKA 1NFDB 4PBVC 1K3UA 4NYUA 1BOYA 4IP5A 5FA3B 3HFYA 3HE6B 2RBLA 2NDFA 3P11H 1BEYH 4X5XA 2DEXX 3CIVA 1DYZA 2OULB 1K9FA 1QOQA 1X7FA 4HZ8A 4AMCA 1W72H 4HJWA 3MV9D 3SPVB 4TV5A 5DRWA 1XLAA 3HPXA 4TNWK 4HHHA 3L13A 4PMZA 3K8LA 5LN4A 5GS3A 1AS6A 3T0EC 1YTDA 3EPMA 1BX2B 2AAAA 3L3KB 3R43A 4S2CA 1GTNA 3E0WA 1T41A 4JHWL 1JV5A 4IXXA 4KCUA 3TXAA 4RQQB 4AQEA 2XNAB 1LOLA 4AD1A 2G4GA 5DFVD 5C2CA 4UTHA 2CU0A 2ZDSA 4N8VB 3TQPA 4YHZH 5C7VA 4H7VA 3F4VA 2E46A 4KMQA 3IMWA 1TR1A 2BVQB 1I3VA 4PV9B 3GHRA 4O53A 3DTDA 4RAUB 4CMMA 3Q6FA 3PHQA 3VOGA 3ANVA 2JQAA 3NFSL 3VXUE 1Q6FA 3MV9B 1FH7A 3LZ3A 5GRUL 4B90A 5BNKA 4LEXL 1VCVA 4YX2H 5KSBB 3STLA 4RWYL 1Q8AA 2QVNA 2BGQA 1S4IA 5DCCA 4Q4QA 2F8XC 2PGWA 1T0MA 2GCYA 4JEJA 3UY7A 3WFBL 1V3KA 5E4EC 3GR7A 3KP0A 5ABFA 1C8QA 1A1MB 5E9DA 1H49A 1KKRA 5AW3B 3MNMA 4CNOA 3AUVA 3VCLA 2YEQA 5I5MA 5LA2A 3NIGE 3MLWH 5EH1A 2F18A 4QWWC 3QH3A 4NNPL 1N18A 5EZOL 3HJZA 2C19A 2V5MA 4K8EA 3VIFA 4U1NB 5D70L 2NT0A 4TRPH 5I77A 3LVEA 3FA5A 1HKLL 4MYXA 4V11A 2POZA 1YMYA 4QRNA 2BOCB 3ETBJ 5BZAA 1QNSA 1YEKL 1BQHG 2BVPB 2W92A 1LLOA 4JDYA 2COVD 1BIIB 3RVUD 3DFNA 3IVTA 4WU7A 4YAQB 1A3ZA 5TE4L 4Q8NA 1DE6A 2OGYA 3DX0A 5D1QB 4I48B 4YIQA 3CAKA 1ZVNA 4X83A 1NEZG 3UCCA 3VG9B 2WQRA 2I14A 4MD4A 2XFWA 2A3LA 4K3ZA 4HJIA 2YK1L 4E9WA 2W63A 5TIMA 3TV8A 3A6CH 5TH2B 3TC9A 5L2KE 1SJBA 1D3CA 2GJ6B 2GVLA 3ARXA 4B60A 4OF6A 1YNQA 3JV4A 4FPSA 3KEDA 4H8WH 4IIBA 3UWZA 5LXXA 3SZKC 5H1WA 5C9JB 2ROXA 1CB4A 4LIQH 4ANKA 1RBOB 3O2VL 3FO9A 1EZ2A 3BH4A 2EC8A 4CDHA 1VJZA 5M17A 5CSGA 1XYMA 3SCNA 2E27L 2JTYA 1FYTA 4M8QB 1BQUA 5DD0H 1MFBL 3SGJA 1JHTA 3FU5A 5F0MB 1W3TA 4M5YL 4ABWA 3PWPD 4M1CD 3Q1EA 5LBGA 1S5WA 4MDPA 5ECVA 4DI8A 1JRHL 4J6IA 4YEEA 5EOCJ 5AVTB 1K8ZA 3GUGA 4F0LA 1OM9A 3MRDA 2WNQA 2Y6TE 3OVGA 2FIRT 1HEHC 3OF6A 5EMLA 1K5WA 5D1XE 1MJ8L 1KBBA 3NG5A 1XF4A 4G8FA 5AZUA 1OFPA 1YTEA 3O4LB 2BODX 5AHFA 2WQWA 3KTSA 2LFGA 5F0JB 3U0TB 1EC9A 3TZVC 4MZ3A 1WP6A 5CSRA 1FYTD 3QEZA 3QJAA 2XC8A 4BFKA 2PYED 3VE9A 2YGQA 4M00A 1G6RL 1QABA 2ISWA 2P76A 2QDHA 5SWSB 2DP3A 3PNUA 1E27B 2JE8A 2Y23A 1O1ZA 3PY2A 1L3WA 5AKRA 5BVJA 1YSOA 3OXSB 2YDRA 5D30A 1KBLA 3U30C 4NG3A 3APCA 4I5BA 1I8IB 3M17A 3V4UL 2QZRA 2PW2A 5T5FL 3LDBC 1QNIA 3FQRB 4O58H 4P9HH 5D7IA 4TV6A 3CLFH 2HKHH 2V2WB 3CXDL 1FLRH 3NSCA 4PLKC 4CU6A 1XJBA 2OEMA 3B40A 3QIUA 2D0HA 7CGTA 1MHHA 4US5A 1WJ3A 5CBEA 2O7SA 3P02A 2AQRA 1U93B 5ITFB 3U7WL 1K7XA 2HS6A 5CWSB 1MFEL 5CBIA 1TVNA 4K3HA 4HNUA 1MG3C 2NXZC 4PJDB 2A3HA 4JX0A 5E4EB 2JKAA 3OGCB 5FPIA 3NJLA 4XX6A 5TJWK 3RLSA 2YD6A 2PCFA 4U0RC 3OO2A 5JXEA 3AU1B 1A5SA 2XJ7A 1TTBA 3C56A 4IIQB 2EUZA 3W9ZA 4PM1A 3OHXA 4DY1A 4WIQA 5CKAA 3UYRL 3B8TA 5DHVH 1DJXA 2WO4A 3VFCA 1EEYA 2YS4A 3QDJA 2F1BA 3BAWA 1UR9A 3CZLA 4LAZA 4R8WL 4L18A 1CBVH 2PDNA 3LDVA 1OO2A 2OL3A 4MJ5A 4U7SA 5EBLA 4Q9RH 4U1JB 1I6NA 1I3GH 2B59B 2JGQA 4ZK8A 3SSJA 4JFYB 1NGYB 1EJVC 4FI6A 4N9DA 5T26A 1L7TL 4A29A 2VQUA 4S1SH 5KN5A 2IH3A 2R29L 4X98A 1IIGA 4RZ6A 3MSDA 3GZQA 1AGCB 1TQSA 1IAIL 3BZFB 4FLQA 3QQ1A 5D55A 4PP2B 2DSZA 4K94L 1UASA 4G9FA 4EPSA 3IGXA 4XG1A 3GIVA 1VBGA 2FO4B 4UTKA 1BQ5A 3V5OA 4OKVB 1NEYA 1C3FA 1CLXA 4NNPH 5EMKA 2J2ZA 3AZSA 1Z9PA 5GGVH 4C1NB 3D0VB 1RZIA 3QA3A 2V2HA 3WUWB 3P0VL 1WTGT 3BUYB 2QNEA 3NIFE 3IACA 3BUYA 4QLLA 1YRKA 3V79C 4XCFH 3DG7A 1EJXC 1G0CA 1KB5H 2R29A 1SNRA 4EX4A 4R90L 3RB7A 5F7AA 3ZU8A 5FDWA 3NZ1A 4KKCD 1U4EA 3SJVB 4JFVA 4BCXA 5CPLA 2CLLA 2XWJA 4AVJA 1ZHLB 2CYGA 3S6CA 2UVEA 1QR1B 4PR5B 1BQSA 5A2FA 3VFNA 3W5MA 4GXVL 1LROA 1LZOA 3IPWA 2YSTA 5JH1A 1KDIA 4JFXA 3UO1H 3MMEB 4WK0B 2YPIA 4DO7A 3GQYA 3UGXA 2FTYA 4UQ3A 5EF1A 1R0MA 5EEXA 2ESCA 5CG7A 2WXPA 1EH9A 4IKNA 1TG7A 3C87A 1WV7T 4C58B 1B4LA 4IBVA 1MVYA 2VDMB 2PAJA 1NTDA 3ESMA 1BFOA 4H20L 5DHXB 1REQB 3MO1B 3MLPA 3MKVA 1XVSA 5KSAB 4G8GE 3PHOB 4NJ9L 5JW4N 2VDPH 1P6WA 2PXYD 2B9BA 4ICWA 1FH5H 3E0LA 4WKFA 1U8LB 3DA0A 2A77H 1HE7A 4LGPB 2F8IA 5DT5A 4F9PC 3R4DA 1BBJB 4S2SA 3B5HA 4S2SB 1EHXA 1BMWA 3S3DB 4WIWA 5J8LA 4G6JH 5B38G 3P6LA 4UBPC 2E5BA 2AKMA 1BYAA 3T2LA 5L0QB 2A21A 1VFAA 5H37A 3BTNA 3O0LA 4LSDA 1DBTA 1S5IH 3WE6A 4B53A 3FJ6A 3UGUA 4H4IA 2GABA 4I9AA 4WKAA 3M0KA 4YTUA 3W11D 1Z5HA 3CVIH 4HEME 3IGAA 4LFHG 4Q4IA 2Q87A 4P5SA 4W9EC 2EDWA 4KXCA 4AVKA 4XD4A 4GBXB 4QRPE 1MHHB 2K6ZA 3U6XS 2XH0A 1TETH 4HETA 1PKQE 1I7UB 4WUUA 1AD4A 2I9TA 3ETTA 1BA9A 2Y6SD 3MR9A 4I1NB 2PA6A 5B7FA 4FAMA 2AQ2A 4YHPB 3LEXB 3PU7A 2GJNA 5J9PB 1FORH 4YSRA 3TF4A 4HNVA 1TVHB 1T40A 2C13A 4OQTA 3ZDXE 4JFWA 4P8VA 4FR6A 4W9CC 1BFTA 4BH8B 1MEHA 4HPXA 3WF4A 1NCWH 4KOBA 2WWNA 1MCIA 2EO1A 4XAKE 2BS8A 1P84K 5EV7A 3RTQA 3MVSA 5A2CA 1JV5B 1GORA 3HC0A 1F73A 1UXSA 4E9XA 4J1UA 4NBYB 2AGTA 1RH8A 3BGGA 4MA1C 3ME0B 9XIAA 2HAZA 1SFJA 2I5QA 3UR2A 2X4PA 5DK0A 4D0BB 3EGSA 1DTUA 3F7YB 4XXCA 3CPGA 4AYSA 3I9GL 5CR8A 1X9LA 1GEQA 1E4KC 1CI3M 4HEPA 5JMRA 1J1OL 2ACRA 3MRJB 4ADTA 4PWEA 2DZEA 2H1LM 2INFA 2BJML 1X9QA 3QNFA 4OZ4B 5F9JB 2O6FA 5GNXA 1ODUA 3KGSA 2QFRA 3RBGA 2DJMA 5E6YA 3ZDZB 3ZXAC 3IUIA 5HBFA 3F2BA 4L5FL 2VUOA 5DUML 2P88A 5CN2A 4ZCWA 3M4HA 2A3CA 1I1AD 4A22A 3BPCA 1HJCA 2WM1A 1OANA 4F8XA 3LN4B 4NO0B 4WI3A 3QC5X 1XIHA 2A1YA 3WLPA 3WLMA 4L4VE 3SY0B 3PG8A 1TVDA 2Z8VC 3OIXA 1Z0MA 1Q85A 4DGVL 1E90A 2FYYA 3N40F 3VGAC 1CTMA 1K8XA 5CEWA 2WLMA 1DVTA 3IAGC 3FZUD 4E41B 9PCYA 4DJED 1R33A 5DRXB 2MTAA 3IRZA 1RJCA 3G8EA 2E59A 4JM2F 4S3GA 3WQEA 2PYEA 2AQSA 1ADSA 3NAAL 2FVKA 3MLUL 2XYBA 3FCSA 5GJTL 4G7EB 3KCWA 1POJA 3G6JE 1RKRA 4NN6B 3UTSA 2QQLH 1P7QB 5GS1C 4HPJA 4Q6JA 2CQVA 2BG5A 5F6HI 2P44B 1TYEB 1W0VA 4OF0A 4UINL 1A5UA 1AHKA 4HWBH 4OKVA 2Q8AL 5G4EA 3MHUA 4OGZA 4UV4L 5AYQA 3IXTB 1NDTA 5IROA 3A64A 3NSYA 5FR3A 4XAWL 3VXUD 4EACA 1OCWH 3WKNA 3N2BA 3PWPB 3TN6A 3WJYA 3XIMA 2ICCA 5AHLA 3ES6B 3V4UH 3K4WA 5CCGE 3SUTA 4P5RA 1TJIH 2WK2A 5G2HA 3EYUH 3BUQA 4WNQB 4DK3A 3UXDA 3I50H 3WE6B 4RE2A 5EZPA 4BFJA 1ECQA 3IPEA 1G7IA 3O2DL 2ALRA 3HPAA 1P5UA 3E2QA 3B8YA 3WJLA 3ZQWA 4LDEB 1AI1H 4RWHA 2GSJA 5EIQA 1E2ZA 3FBQA 4U1SA 3BP6A 1UGKA 2OTWB 2DF3A 1S7QB 3IJ8A 3LRLA 4NZDA 4P46C 5CP3H 5HWJA 3BZDA 3P3UA 4HKJB 5IFAH 1B3IA 1S7VA 4Q6XA 5KBKA 2ZOOA 5KTEH 5C0IB 5AHMA 3TZVA 5EU3B 1RHHA 4WKZB 2N1KA 1UJTA 1NCBL 2BIQA 2VN7A 3MQTA 4GWEA 1ESOA 2F8VA 6ALDA 3DVFA 4GHRA 5E99L 4AI7A 2UUDK 1HZLA 1EOMA 1XHHA 1G7VA 3QQ4B 1O1HA 1YE4A 2P5NA 4JDVB 2C4FU 2K7PA 3UPRB 4KRTA 5HI5D 4O8RA 2GW5A 5C07E 3WENA 4JZNB 1K4HA 1W8EA 4L8BA 2Y3AA 1PX4A 4WFFE 2A5HA 4YN5A 4XWOD 3CZFB 1TX2A 1USQA 3QYSA 4PJ5A 3ZVVA 1DHPA 1FPTL 2YD2A 1QWHA 5DK0B 3WI9A 1J05A 4ZG1A 5ICYB 1XKYA 4RGNB 1ZBCA 2JK5B 3BLBA 1H5BB 3GXFA 4B7LA 4OLUH 1TNNA 3TT3H 2GTZB 2E9LA 5CAHA 1JI2A 1ZAJA 4IBWA 1W9DM 2DT3A 1UWEH 3PP4L 43CAB 1JGDA 2FQGA 2HJFB 3E6FA 4IL0A 2ZA2A 4Y9PA 1FGVL 3O9WB 4H1ZA 1QSEA 3UG3A 3UDWC 1BZ8A 2N59A 3CLFL 2VH5H 4Y9CA 4M0XA 4MWAE 4C6IA 4X5LA 1ZGLM 1XLHA 2JJTC 4X42A 1NM9A 3M43A 5JXAL 3IGUA 1Z9MA 4JFQA 4NQXA 5F89B 1A0EA 1ISYA 1R3HA 3ICJA 4JKKA 4S0HA 4P2RA 1UJ3A 4G8GB 1B3YA 3OKNB 2BZCA 5JW4M 4Z1YA 1Z3GL 4W84A 1I8LA 1UXWB 4KX7A 1KA9F 3BKYL 4EUPA 4JTFA 5BZDA 2K8QA 3T1WA 2EBNA 2OR8A 3TW7A 5L2KB 3R8QA 4W9IC 1A3LL 3DIVA 2H8ZA 4OGYL 1G4PA 3N4AA 5TGBB 1FWJC 2AJVH 4DBEA 1Q9LB 2H32A 4JN7A 1M6OA 1Q6LA 2O4MA 2E77A 2ZP8A 2KS0A 3FTYA 5TTRA 2XTLA 2CLOA 2GITA 2XZCH 4Z78B 3MV9A 2ZWLT 1H09A 5CPNA 1BBJA 3CDCA 3JWDH 1LQSR 1XR9B 1FNLA 3UTPE 5C3LD 4FXGB 4YE4L 1R9XA 4DAFA 3JYCA 5BXRA 1RK1B 5FHBH 1IFRA 3KWVA 3NPZB 4PY8J 4BZ1A 5LWYL 5C0FA 2GVGA 5I66B 3LBOA 4JTDA 1YY8B 2P5EA 1L8PA 4NRXA 3GR8A 2VXTH 4NRXB 3FMGL 2NV9A 1GS8A 1A5KC 3TBWA 4ML9A 1VA9A 1GWJA 3N44B 3BWAA 1ET5A 3BVTA 4NKDA 2OJZL 3MV8D 3QUZD 5IVZA 5SWSD 1PDKB 1WWAX 4MTVA 4I3SL 1WS8A 3WFHB 4BXVA 1I2NA 2VFFA 1KBGL 1MHPH 1FL3B 2L3BA 4P7NA 5BUAA 3UYIA 1H6FA 1JN6B 4LMQI 2I24N 3U46B 4UUIA 5T1LB 2ZPKH 5HANA 3MTXA 1I0BA 3GSWA 3P5YA 4ODVH 3ZIMA 5DJXA 3BWWA 1VBRA 2P0IA 4AB4A 3BLOA 2ZX8A 5C0BD 4XNMA 3D08A 1T8QA 5FYJL 1UQZA 3J2PA 4PJCE 2Z93B 2WQUA 3SSGA 5FJRA 4K3EH 3NPSB 2JEQA 3UPRA 2C9XA 3L9RB 4PWIA 2HWGA 4LYKA 3ZRFC 1OC7A 3MLSH 3Q4DA 1KXQA 1WLHA 2E56A 2F7OA 3ILEA 3HVNA 3NCEB 4DGUA 4PJDE 1NSJA 5ANMB 2DVUA 3GJFA 3LHVA 4GD0A 1JV2B 5DA0B 3T44A 2AJSH 4XAPA 2EZ0C 4M8QA 4BA8A 4MY9A 2DUXA 4NASA 4NRZA 2XPZA 2OTPA 2WMPA 1XH1A 1NCDH 4L29B 1R3KA 3DVNA 4DPQA 2H5UA 3CCHB 5E6RB 2FDBP 2QPFA 3EUDA 4JO3H 4CVZA 1MCJA 2VQ4A 4Z7QB 3CU1A 3E5PA 1EEYB 1QMLA 3N2JA 2CD0A 2YD0A 5IVXF 4FXKA 5FO8B 4YZFF 1ZLVK 4I6KA 3NYZA 4A7GA 4O0QA 5GRVL 5LHFA 1QLFB 3ARDA 4QXTA 5DMGC 1EQCA 1XRSA 1XH2A 4IBTA 2RDUA 3L2IA 3RGHA 4Z2HA 5E94B 3HMXA 4KO5A 4PC8A 3SQMA 4MNKA 3G5VA 5J0BA 4D8AA 1H5YA 2MQGA 1T66C 2WIIB 1ONWA 2P24A 4JQXA 3WIHL 4PMOA 4G5ZL 1ETJA 4LLMA 4NZUL 3I6RA 1OHQA 5REQA 4Q9QH 1AP2A 1UZGA 1IAIM 2EAEA 1HJSA 4AVIA 1P1ZA 5CJNA 2MCPH 3T6CA 1AD0A 4I0CC 2NOYA 5IB2B 3PANA 4OIIH 2OKOA 4XE0A 1BEYL 3TW9A 3AHZA 2OA9A 3VCLB 1YC7A 2FB4H 3GBLA 1QA9B 1DVFA 2XWRA 3H3KA 3OMNB 4J8RA 4JL1A 4K3DL 3TVMD 2ZSWA 1LYQA 1ZHAA 4Z7WF 3NPWA 5DUPH 3NQCA 3O4LA 3VH8G 3W1UA 4U6HA 1A9BB 4L3EB 4MHHI 3U0TA 4UTBA 1R2RA 2WMIA 4DWSB 1XV8A 5BV7H 1ZJIA 2X7WA 2E47A 4KBPA 5F6IB 3THAA 1EDGA 4LEEA 1S9XB 1E7UA 4XZ9A 1PKQA 3W9EB 5CC3A 1QPPA 4JQIA 2VHLA 3E12A 3Q6FB 2IQTA 2EEXA 4IU3B 5DZAA 1W3JA 1KFEA 3AB0C 4HS8L 5HYJB 2ZOKB 3I02A 4Q89A 4BFOA 3L68A 2G95A 4XB7A 5K1VA 3QBUA 1J5HA 5HDLA 2YFOA 1OAQH 4Y16D 2IFGA 1EEPA 2EH7H 1HILA 5C92A 3ATEA 3REWA 1MRQA 1IM3A 4XCYA 3H4HA 4LPUA 3EJJX 4LRNH 5DWUL 1C8YA 5C0QA 3B0UX 1GG0A 4NY2A 4MADA 4RPQA 3PQYA 2VN4A 3ARFB 3JV4B 4IIQC 3EMCA 1W1A1 1KC7A 4Z76B 3JQOB 5FKAB 3V6FA 1G7PB 1ZUAX 5MKGB 5E4OA 1LRTA 3B8WA 1ODAA 1BAGA 2ZYRA 3EH3B 3A67L 4PJ6A 5D04C 2E6JA 5DR5H 1OQOA 4G7VH 5FA4B 2R0WH 3VFRB 4OUOA 3MTWA 5F2MA 1BVOA 4CCEA 5BW6A 1NCGA 1IGJB 1VGKB 2ATKB 2EYRA 1X7SA 1BQKA 4NJAH 5HI3D 3WUWA 2W9LA 3CFDB 3A4JA 2O72A 5T9CE 3PHSA 4Q58C 2VUYA 4IHBA 5D1ZD 1EUAA 3MJ9A 2AXFA 3AWNA 4PRPE 3JVGA 2XOTA 1XGRB 2X89A 3HNVH 1TJMA 5A2KH 5F2GA 5SX5H 4YHPA 5HR6A 3QQWA 3VNLA 1P1XA 3T07A 4FS0A 3ZYIA 1AGBB 4G2AA 2IH3B 5JNYA 4PMUA 1AOZA 4HKBB 1PKMA 2P4AB 1LP6A 1E5AA 2NTSP 5AYUL 4DN3H 1UPPA 3GVRA 3W26A 2X5PA 3RU6A 5HJYA 2QQKL 5GGRY 5ICXB 1XLKA 4O4VA 1ZU8A 2EIDA 3LPPA 3SUUA 3ZXWA 3F2CA 5KYYA 3LRSB 3JWNE 3X1EA 2AQWA 3IKCB 3APNA 2ZX5A 3QHTC 4C60A 4YHKH 2XGBA 1SYSA 2P10A 4U3CA 4XODA 1BXAA 1CG9A 4IG2A 1A8JH 1GKQA 3IKKA 3GXMA 1O5QA 2J6WA 3BV7A 5JQ9A 3NCYS 3E6HB 1IT9H 1MQ8A 2AVGA 1URLA 2DL2A 2ZG2A 3NSJA 1C5BH 2WKOA 1S2CA 3F2DA 1MQRA 5DURB 2PDGA 5FL0A 3WH7A 1ETZB 4LAQH 1AOHA 4L37A 4MJHA 4YSAA 1EHLL 3WNPA 1TUPA 2QSCH 3Q5TA 1D5ZA 3QUZC 4WW2B 5HVFB 5BOFA 2NY7L 5JORA 2F6AA 2Z65C 1J1PH 3M5ZA 1LWJA 4OT7A 5EL1A 5IWLC 2XKSA 5LXGH 1PSKH 4E42A 2BV9A 4DWSC 5G2WA 2NY3C 3NQBA 2KPWA 4XD6A 1W3KA 3BW9B 3F7VB 3E9AA 1UCBL 2HFGH 3KXFA 3NZHL 4BELD 3W3OA 1UOWA 1JG9A 3M5VA 4DTGH 5DJ8A 1R9ZA 4QOKE 1CFSA 5DMKB 1FBIH 2CALA 2V7HA 1GVFA 5JDJA 2A3EA 4JQVA 4GXUN 2VR6A 1T80A 4NWUL 5HHOE 4PJEE 4XNUH 4CEUC 1RA0A 2BNQB 1K6WA 3ATDA 3ILDA 2J7DA 2A99A 2FO4A 2FBJH 4JO5A 2C3ZA 3H12A 2NY5C 3BAIA 2GSGB 3ITGA 2GSGA 2Z7UA 2HJKA 4HBQA 1E2VA 3B9OA 1KYUA 2WVTA 2V2TA 4LLVA 2XM2A 2NX5A 3MOAL 5J89A 4U6XB 1U6AH 1DFXA 5I9QC 4WNJA 1HI6B 2ZSWB 5DS8A 2V2XA 1GGUA 2AXGB 4G43A 5LCVL 2XSXA 5GPRA 4RGMC 1U3ZA 1UM5L 1QO3B 2X38A 3R19A 2X4UA 5MENB 1OWQA 1VF5C 3K74B 2PPGA 3STEA 1FFNB 1HDMA 8FABA 2GK2A 4IM8A 3CVCA 1Z3GH 1SM3H 2DKUA 2VXSL 2XFGB 5IQ7H 3FTXA 1JCJA 4H2CA 1TELA 3SN4A 4A37A 3Q8BA 1TWDA 1YYAA 2J6XA 1QBLH 3TYCA 4KEUA 2NSXA 1KDJA 1NCAH 3OBAA 2IPTL 3QR0A 4FJZA 4PV8B 4IIZA 3WMSA 2ARJQ 2EC9U 2AKZA 2IKIA 2QCEA 2I9LA 4S1RH 1QT1A 3A3XA 5DHMC 2V9RA 4JDTH 1JWMA 4AQ1B 3HU7A 2UWFA 3R13A 3MA8A 4XMLL 5ITBH 3W2MA 5E94A 1GL4B 3WEBA 1NCCH 5KUKA 3GLEA 5E09A 3LLFA 5CJOH 3WMQA 2IDSA 1QUNA 4M6NH 4Q52A 3RDTC 4PCSA 4HCLA 5AKQA 4JS3A 1E28B 1QZNA 3LIZL 5EZJA 2Q6WB 3VJ6B 1UKTA 2EDKA 4U1MA 3BG3A 3HG5A 1VEMA 3BVXA 1P5VB 3T8VA 4C6LA 4AIZA 3IKCA 3BG5A 3SUWA 2PCQA 2OLHA 2CKBB 3PZQA 2XG4B 1TCMA 4D8PB 2RALA 4PVBA 3RDTA 4JN6A 2APBA 3R18A 4NUJB 5EO0A 4UT6H 3TESA 3MPGA 4KV5E 5HMEA 3MSGA 3QQXA 2DYPD 2IQAA 4HPOL 4YBHA 3L95A 2FZ8A 4AEOA 2OMYA 1NANI 2BS71 4HT1L 1W54A 2CWXA 5DCEA 2BVEA 2FGWL 5G5DB 1GOMA 2QT3A 3SYQA 3TUUA 3GRWL 3VFGL 4YHML 1JUFA 3QRGL 4J23A 1WWBX 4DB7A 5HVHC 3AZTA 2NYKA 4DJDC 4NKCA 2G0KA 1E6JL 4CVUA 4BE5A 1ADDA 4Y9MA 2G4FA 4NUWA 1A25A 4YDMA 3UJEA 3MRKA 2FPVA 4LTSA 1N4XH 2YCEA 1U21A 4K8RC 4L3CB 4K5LA 4ZFGL 4XCCH 2CLIA 2I9UA 4G7FA 1M2OA 5F9WB 3AQDA 4GAYB 3AMGA 2Y5TB 2R7EA 5AVQB 3W25A 5D2NE 1IC4L 3W23A 4N9BA 4QHMB 1H4PA 2NSMA 4Y2NA 4G6FD 3HPLA 1B2WL 4H9UA 4OLWH 2PW1A 2Q01A 3GRWA 3V5HA 5MI0C 4XPHH 4HZLA 4ZJ9A 3QTGA 4O02A 4LRSA 5A6TC 5AC8A 5CZ0A 1IWAA 3MXWL 4RLDA 4UIKL 1GS6X 4N6FA 5DEGB 3P2VA 2NW3B 4OCYH 4UZSA 4PGDA 5D1ZI 4JFSA 4ZFOL 3L3DA 2A6JA 4IQEA 4BF7A 5FUOH 2FJGA 3FEMA 1HL4A 1K4CA 4X3ZA 3V1HA 1SDAB 2YGOA 3QPXH 2NY5L 3G22A 3NEOA 1MFVA 4FQXA 2Q8ZA 3VIHA 4P8UA 2BSED 4FNPA 3SDDA 4UTMA 3I2CL 4XRCB 1IQDA 1TZGL 1U2CA 3ROLA 1HXJA 3WV0A 1ZTXL 2OMWA 3B1UA 4JQIH 4QXUL 4FOJA 1JR1A 3SDOA 5EBWB 2EDHA 2FX8H 5FWRA 2V0AA 4XNBA 1XYBA 3CSGA 4ZTYA 3WQ4A 4OVVA 3B6SB 4GRMA 2WQXA 5KYUA 1YADA 3GE7A 5HYJD 4Z7OF 4Y8AA 2XN1A 4OCSL 2UWEA 1YEGL 1Q9LA 4XI5C 4IK6A 4LLWB 4W9LC 3US9A 2OMVA 1PTAA 2PP9A 1J8SA 1UWXK 4G7QB 2GK0A 3RRXA 1OF8A 5IEHA 1Q94A 1P2CA 2YQ3A 3DROA 1P4CA 4JRXE 5E2VH 1EKOA 4KFZC 1W32A 4EZKA 5IMKB 5E6ID 3MBXH 3UTZB 3K6SA 2FR4B 2Q6ZA 2VELA 4P3CL 5IB2A 1WKFA 1OCZB 3K5RA 4WFGE 2W4XA 2ZX7A 3R7QA 1E4LA 3GBML 3RUGE 3DRQB 3DOIA 3PUCA