4NZFA

Crystal structure of abp-d197a (a gh27-b-l-arabinopyranosidase from geobacillus stearothermophilus), in complex with arabinose
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
431
structure length
431
Chain Sequence
ASMHHYQWAKTPPMGWNSWDCYGASVTEDEVKGNAEYMAKYLKPFGWEYVVVDIQWYEPGANSSIYRPFVPLEMDEYSRLMPAVNRFPSAKGGKGFKPLADYIHNLGLKFGIHIMRGIPRQAVHQNTPILGTNVGARDIADTNSICPWNTDMYGVDHRKEGAQAYYDSLFQLYAQWGVDFVKVADIVASKLYGTHTEEIKMIRKAIDRCGRPIVLSLSPGPAPLDHATLFVENANMWRMTDDFWDRWELLYDMFEQCYKWCKLVGLGHWPDADMLPLGHIGIRSVDGGGTDRMTRFTKDEQRTMMTLWIIFRSPLMFGGELRDNDEWTLSLLTNEEVLHVHQNGYGARQVYRENDHVVWTSQDAEGNQFVAMFNISEKRSVVSVSLKDLGCMEPMKARDLWAKEDLGLVKHQLAFELGPHQSILVKLSPAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-specificity relationships in Abp, a GH27 beta-L-arabinopyranosidase from Geobacillus stearothermophilus T6
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords Abp, a GH27 beta-L-arabinopyranosidase
total genus 147
structure length 431
sequence length 431
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4nzfA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4nzfA01
4AYSA 1YTKA 1JUBA 1LLZA 5KZEA 3NQ6A 3NAVA 4R33A 4LOCA 2QKFA 4Y9AA 1H7OA 4WXYA 1J0KA 4FNTA 1YTDA 3C56A 1B9BA 1G4EA 1QX1A 5KTLA 2WNNA 2ZRWA 4TMCA 4WJEA 4UXDA 4H8HA 1KFCA 2ZX5A 2FFCA 3MMTA 3Q94A 4J28A 1BSIA 2J9ZA 3GDTA 3TSBA 3Q58A 4JYFA 2RDTA 1OABA 2P10A 3MBFA 2Y5EA 3IIVA 4JDYA 2YGYA 3S1WA 1JDAA 3TH6A 5HQEA 1H50A 1FCBA 1Z44A 2I1OA 3W7QA 4AEEA 3BGJA 2F1BA 1Z32X 5A6MA 4A2SA 1PIIA 3VE7A 5CLWA 1L6SA 2FTPA 4PODA 2UV8G 3PUDA 3CZLA 1ZAIA 4EF8A 2V0TA 4J7RA 2QCEA 1W1ZA 2C0AA 1ZALA 1I75A 3D51A 1IIHA 1PCKA 1Y0EA 2V2HA 4UTWC 3MUXA 4UTKA 1X7FA 4M7SA 1VLIA 2G96A 4FF7A 1CGXA 2FDSA 1HL9A 2AAMA 2ISSA 5EPDA 2F7OA 1HUVA 2VEPA 4JS3A 5CPMA 3ZFHA 1I2RA 3BVXA 5E0FA 3A5FA 2PWGA 1F6PA 3TSDA 4FNPA 1XD1A 5FF3A 1FWTA 4N9CA 5G2WA 1KBIA 1GG1A 3STGA 4H8UA 1OK4A 4N9BA 5C55A 2E6AA 1TJPA 1O94A 4XZ9A 1FXPA 2J24A 1C8VA 1QO2A 3W76A 2E1DA 3NVTA 4QM1A 2E6DA 1XKYA 1JIBA 5C2XA 1KBJA 3M5YA 1TPH1 3BSHA 2FPVA 1KWGA 4R34A 1JQXA 3B03A 3M5XA 2BWGA 3QJAA 2NXGA 1W5OA 3TQ0A 1CLVA 2R8WA 1TSIA 5LKYA 3WN6A 4HNVA 2VFDA 1NEYA 4MVAA 1LOQA 4N2YA 1FCVA 4JCMA 3VX1A 2DJXA 3LHYA 3QMTA 4X9SA 3S5NA 3ABOA 4HNNA 1H63A 2ZICA 4AMXA 2ZRZA 1W3TA 4I9AA 2G5WA 3DHUA 2PRMA 3BLEA 2FHCA 3CC1A 4WY0F 3TE9A 5C6MA 4K8EA 2BXVA 1OFAA 3W2MA 3MI3A 3C2EA 3ZR4A 1X1OA 4JYEA 2Z0IA 1IZJA 4LWWA 4UOQA 5G1TA 4JDBA 2V3EA 3YPIA 3HGSA 1IXQA 3CPRA 3HG5A 4RK8A 4JTSA 3QM3A 4FNSA 3TDFA 1JD9A 5F1UA 3W9ZA 4M56A 1U83A 1ZHAA 3RIKA 5CPLA 3UY7A 1W5MA 2ZE0A 5F2IA 3G24A 3E0IA 2J6XA 3NQ8A 3G22A 4JX5A 1RQBA 3VU2A 1ML1A 4NNBA 3CLWA 1ADOA 3HG4A 2WQPA 3W2NA 4JEQA 5C5YA 5I3FA 4JL1A 3BG9A 1O60A 3OLDA 2XVKA 1TRIA 3O63A 4GKLA 4A29A 3NQ7A 2O7SA 5EA9A 3QRHA 2ZXQA 1FWSA 2BHYA 1VAHA 1F7BA 1Q4NX 1SFJA 2FPYA 2PRHA 3LCFA 3M16A 3CEPA 4KFOA 3MBDA 2TYSA 1ME7A 1YLVA 5SWUA 1LYXA 3B0PA 4NX5A 1V3JA 5BMWA 1AW1A 4FLSA 4HPXA 3BAKA 3PB0A 4ZQMA 3FLUA 4EVZA 2Q8LA 1DJQA 5FF4A 4KWUA 1TPUA 3EWXA 5LNWA 1QHPA 1UD6A 1EHAA 4U2ZA 4JY9A 2FLIA 3DZ1A 2VR5A 1WV2A 2VEIA 1KM6A 1W3IA 2X30A 5G4EA 1SO6A 5IM51 3AXIA 3UYCA 2PURA 3TFCA 3FYPA 3G0SA 1LTDA 3W71A 1E3XA 3HPZA 3Q37A 3TMQA 1U30A 4XB3A 4A21A 5FF0A 1UH2A 4FIRA 2Q8ZA 1VS1A 3W23A 3IEBA 3P60A 1FX6A 4KFNA 1DORA 4MLRA 1W56A 4LVDA 1HFBA 1AQMA 1XFBA 3G1HA 3M44A 3W75A 2GUYA 4FX8A 1PL9A 3KL5A 1VPXA 1JF5A 1KCLA 5D03A 1NSJA 1KFBA 3UWVA 5KMYA 3ABSA 5CZTA 2Y7FA 5F2GA 2VXNA 2X1RA 4JTEA 3B4UA 4PH6A 2BY3A 4LNYA 1I4NA 1VH7A 4UFLA 4UTUA 4GRSA 3VFLA 3B06A 5IBXA 1QPRA 4O52A 5F4XA 3TK7A 5IBXC 2DP3A 5AYXA 2I9EA 3EDDA 5CPOA 1FWRA 2NX1A 4K7YA 3TC6A 3HB9A 3DHFA 3IIZA 1WE5A 4LC6A 4A2RA 1XBVA 3B05A 2FH6A 3N2XA 3GR7A 4O18A 3STCA 3TU9A 3LPOA 4PC8A 3R89A 1ZAJA 3VGGA 1KM3A 3O8AA 2A6NA 2B0MA 1TMHA 4RXGA 2CLOA 1G9HA 5CPNA 4Z1CA 3TW7A 5AOUA 5K7JA 4WUIA 3GXMA 1LLWA 4QNWA 1JI1A 1DL3A 1HX0A 4JTLA 4NJGA 1FCQA 2FJKA 3N3MA 1A5CA 4CGTA 1W5NA 1JDCA 2D3NA 5TBOA 3NQVA 3DFQA 3NYZA 4MKNA 3L67A 1Q45A 2ABAA 3PBYA 1F5ZA 1UASA 1A5AA 4GI6A 2QCCA 4QAWA 3LXBA 3II1A 4HIBA 1UD2A 3G3DA 3FAWA 3SI9A 4TIMA 4ICNA 5DXXA 1LZOA 1A50A 5HR6A 2E4TA 3KX6A 4NXSA 4O16A 5K9CA 3P80A 3E96A 4NT0A 1UCWA 4MFDA 1R75A 3C2FA 3DX0A 1GYLA 1LRNA 3O16A 3TOPA 3KAOA 1AVAA 2F7PA 4AH7A 4M6VA 1B2YA 3H55A 4CCEA 4JFUA 1VLWA 4MY9A 5AHLA 1YDNA 4TVUA 3SGUA 4AXKA 3HQ1A 4LRSA 4J3WA 1XXXA 4M19A 2D73A 1A5SA 4M6PA 3WK1A 3DFPA 5AC8A 4UC5A 4P2VA 4JD4A 3ANYA 3MP5A 1R2RA 3P61A 5E0KA 4L4LA 1DHKA 2J9YA 4HNTA 4TU1A 4B9YA 3G8RA 3D50A 3NQGA 3UXDA 3QSTA 4IQLA 3IVTA 2FIQA 4K37A 2JKAA 2ZTJA 2GQ8A 3ABQA 2YOCA 3T40A 2PE4A 4YXGA 1RV8A 3M9YA 3BLFA 1KWKA 1P0NA 3L5LA 5FESA 1G1YA 1GVRA 3ZT5A 1QFEA 1MXDA 5F2MA 5G1YA 3GBDA 2ZRYA 3IIXA 3T44A 3EDFA 3CB8A 2ZWZA 1RP8A 3RF9A 4HPJA 3W38A 1AK5A 2Z6JA 3UY8A 1F05A 3GK0A 1AL8A 5BRBA 1S46A 1K8YA 3OLIA 2H6RA 2VOMA 2W6RA 1OX5A 2F1AA 1YPFA 1P4CA 5FF2A 2YXGA 3BUDA 4J9JA 3EWZA 3ZSSA 2Y2WA 3DDFA 2CLLA 5F1VA 1XCFA 1EWDA 5KEZA 5I3HA 1WX0A 2Y7GA 2Q3OA 2Z2UA 3L2IA 1LBFA 3K8MA 3S1XA 1OFBA 3FA5A 3HGRA 1CGWA 1I2QA 1HO4A 5CGMA 3BVVA 2Y7DA 4YLWA 1QHOA 3UPWA 3FJ6A 1H7XA 4ADUA 4WY0B 3VKJA 1LRQA 4HSOA 1EA0A 3NNTA 1WO2A 5HPOA 3IVUA 3OHIA 1M7XA 4O53A 1QPKA 1U5JA 3S2CA 3WY3A 3QFEA 3QMRA 1KM2A 3WENA 1VJSA 4A3UA 4CCDA 1UH3A 5DY2A 1GYNA 4ONVA 5EY5A 3GAYA 1TQXA 4NNCA 3LHTA 5D04C 1MZHA 3A47A 2CZFA 4JN6A 1ZCOA 3TW6A 4O11A 3S1VA 2NXHA 1WA3A 3EX1A 4UNIA 2I14A 3NR0A 1GEQA 3F4NA 1WOAA 1ME8A 5D2VA 1PE1A 1EB3A 1PVNA 2FE0A 1D9EA 7CGTA 2ZUTA 4JYDA 1DOSA 3VO0A 3UD6A 3R12A 1W54A 2ZZ1A 2QJIA 5A2AA 3OLGA 3LTSA 1KGWA 1VFOA 3LRMA 1GJPA 3GDKA 4UTTC 3CPUA 4AB4A 2ZA2A 3W1AA 3HGOA 3A4AA 2J9XA 1NOFA 3L4YA 2EHHA 4HOWA 4LVFA 1E51A 4AHQA 5BNKA 4TO8A 1ME9A 4XTDA 1F6KA 3EJUA 2GVLA 5K4ZA 4OU1A 1V5XA 4LXFA 7TIMA 1G6CA 2E8YA 2JGYA 4BI5A 3RU6A 3AMKA 5HXMA 3IIPA 1JULA 1N55A 5DY3A 1BVZA 2G95A 1R47A 1GVQA 3PULA 3EXSA 1BWLA 1RR2A 3G18A 3IV3A 5F4SA 3PVFA 2RHGA 5D33A 5G2IA 4JTTA 3I7RA 2ZUWA 2NUYA 1KFLA 3LDVA 3A6OA 4HKPA 4JX4A 1T99A 4IMCA 3C3NA 2QCLA 3LB0A 4Y90A 4Z1DA 2Z1KA 1H60A 5K3VA 1KBKA 1K8XA 3C2OA 1G67A 4JNMA 3R8RA 4LU0A 1W5QA 1JR1A 3PF3A 4QQ3A 4O1BA 4YCPA 1KV8A 4BA0A 4AHPA 4IWWA 4ZZ9A 1SO5A 3DX4A 1RZMA 2V8ZA 4O12A 3P8JA 8CGTA 5DCBA 3E9AA 4WSKA 4OT7A 3W2LA 2A6LA 1SZFA 4LUJA 1XCWA 1EEPA 4OQVA 2BTMA 5CKSA 3NG3A 3WEMA 3KRSA 2ABBA 3S0CA 3AJ7A 1V7YA 1DV7A 1IZKA 1ICPA 3N73A 5TQLA 1HXKA 3QC3A 4UTTA 4GUGA 3ABRA 4H8VA 5D37A 1DHPA 2YYUA 4Y8FA 2ZA1A 1FBAA 4WD0A 4W93A 3VE9A 5CGTA 3TA6A 1GCYA 4XBKA 3G1DA 4JICA 3OG3A 1TPFA 1HVXA 2NUWA 2X1UA 2PWFA 1KGXA 4O13A 3M5VA 4AMAA 4JCLA 3FFSA 5F2LA 1JDDA 2RDUA 2B7PA 4UIOA 2R94A 4FNQA 2VELA 3WJZA 1WYIA 3A23A 2E6FA 2QMKA 1S3HA 3LLFA 2EJ1A 3IJ8A 3VSVA 2WVTA 4RJEA 3HG3A 1PZ2A 1VC4A 4FO4A 3W7NA 2YR1A 3ATZA 1ZY9A 3M7WA 1JCYA 5AN7A 2F61A 1W37A 1EP3A 2J88A 4OBTA 3VM5A 4O4WA 3N34A 3K1DA 1EWEA 1KFKA 1VCGA 3CHVA 3SIZA 3BMWA 4JFTA 4K36A 3TXVA 2V82A 2ZQ0A 1FXQA 4ML9A 3TFXA 2D3LA 5I3KA 3MI6A 3WEOA 2NZLA 1QI5A 1TV8A 4I7VA 2E9BA 4J3VA 2FH8A 3GNDA 4WSJA 4AYGA 1OX4B 3W7LA 4UTWA 2XN0A 2V9DA 1JRBA 1XDLA 3FAXA 2YPIA 2RDWA 3BCDA 3USBA 1ALDA 2H90A 1CXLA 4O4VA 4O14A 4CNPA 5I3GA 3M47A 3EX4A 3SGZA 3GXPA 4JL2A 4GWEA 1QOQA 1UD8A 3FW6A 1RD5A 3LCXA 1G4TA 4JTUA 4OJYA 1CDGA 1TO3A 4RR4A 5AHEA 1SO4A 1CIUA 3KL3A 2E77A 2WNQA 2ZZ4A 1JCXA 3BCFA 4PEEA 2XWEA 3WNLA 1BWKA 3TXZA 2IGTA 1GQNA 5LNVA 5BMXA 2ZTKA 2W0UA 1ZNNA 1H62A 3EWBX 1BPLB 4HOXA 1V3LA 2ZZ3A 2WPGA 1VIWA 5CLTA 3ATYA 3A5VA 3W22A 3C2VA 3VNDA 3RFAA 3MW7A 1UA3A 3M5ZA 1AQHA 5D02A 5EMUA 4X0NA 6ALDA 3SECA 1JJKA 1K02A 1ZJBA 3NOEA 2EO7A 4FXSA 4DO5A 4IMEA 2E5BA 3B04A 2YFNA 3PM6A 2QLYA 2GQAA 1K7XA 1TTQA 3EX3A 1PIFA 4LW7A 3WMSA 3WDJA 5AFDA 1BAGA 3JS3A 4GQQA 3W2UA 1TPDA 3MHFA 1HL8A 1HTIA 1SZGA 2ZYFA 5DN1A 1UBSA 3DHPA 4J3SA 4UTIA 1BG9A 3W07A 1CXFA 2A21A 1OFDA 2FYVA 1OX4A 2GJPA 3FEMA 3TONA 3NPUA 3NPXA 4JX6A 4IMGA 5AHMA 2WV8A 3W7GA 3L4ZA 2PWDA 1OYBA 1S5TA 4HT3A 4GI9A 2OYKA 1YXYA 1PS3A 3GB6A 4DPQA 1GVOA 2WVUA 2ZXDA 1ZS2A 2BY0A 3HJZA 4UMAA 4NJHA 3GNNA 2ZBTA 2WKGA 4PL2A 2ZX9A 3ZOAA 3VI2A 4AF0B 1OB0A 4PA8A 1TQJA 3MYPA 3VSTA 1ZJAA 1PV8A 3VGEA 3NM3A 1FUYA 3LI0A 1TTPA 3PBVA 2B7QA 3UNDA 2ZUSA 1QAPA 3GKAA 2E68A 1GJUA 3NL5A 4X9YA 5E70A 1CW2A 1BKSA 4UOZA 1RQEA 3HG2A 2XWDA 3FIGA 4JIPA 4Q33A 4LTSA 2WVVA 1MW1A 1QI4A 3BUBA 2B4GA 4NI3A 3KEHA 2QR6A 4IXHA 3W7KA 1BEUA 3WNMA 2OMAA 5D32A 1A47A 1VQTA 3ZR5A 1QPQA 4YWIA 1LBMA 3DXIA 4MPQA 4KKXA 2WPBA 2WSKA 4OKDA 5A2BA 3KL0A 4M6QA 3WDIA 1XSKA 2OSXA 3DC0A 4MJZA 5HWMA 4IX0A 5LGXA 1H7NA 3P67A 4GNJA 2WNZA 1VCFA 3UXAA 5HDRA 5HJLA 3L21A 5LZLA 1TYGA 2VT0A 1GVIA 3W86A 6CGTA 1X1ZA 1G7UA 2QF7A 4HN4A 2ZWYA 3V1PA 1JCNA 2V3DA 5CG7A 1XL9A 1SSGA 1H5YA 1I2NA 5G5IA 3PAJA 1O95A 5L6UA 3WNKA 1OSEA 1FDZA 1UUOA 5H91A 2O7QA 1CI1A 3MO7A 2EGZA 1MO0A 2CU0A 3CIWA 2C13A 3LRLA 1M6JA 2H8ZA 2BY2A 4U31A 4KWVA 2AAAA 3R2GA 4GUIA 1AL7A 2A85A 2C18A 4QITA 3L65A 3W37A 2R91A 1PEZA 3TIMA 4O57A 4KMQA 2VFEA 1W31A 4O28A 2OZ0A 3WJWA 3FOKA 4BI7A 3OVQA 6TIMA 1PJ9A 1LOLA 4Z1AA 1QNVA 4FLOA 3LX9A 3S5OA 1MVYA 3W88A 3UZJA 3LM7A 2A1YA 1KXHA 3KXQA 4G1KA 2VC6A 5KZMA 4XKYA 4UTHA 2NLIA 4RX0A 2CFFA 1XBYA 5DLCA 2V30A 1EUAA 4FMVA 1G5AA 4ATWA 3NQDA 3WK2A 3MWAA 4DQWA 5FEZA 1VGAA 1L6WA 3IVSA 5I24A 2VFFA 3VGBA 2A7PA 1DTUA 3TTYA 1XC4A 4YL2A 2OT1A 3EKLA 4E2OA 3NQFA 4UTJA 3VNYA 1KTNA 1R2TA 1AG1O 3W7PA 2FB2A 1ZFJA 3HIJA 2C1HA 3LV5A 1OFRA 3NQAA 3GR8A 4Y6GA 2KZHA 4GO9A 5CZJA 2AMGA 2E0PA 2WANA 5I3JA 3EB2A 2GOUA 3ZR6A 3BGGA 3K8KA 3NM1A 4DBEA 4FX6M 1VFUA 3C6CA 3MHUA 1G4PA 1WPCA 2QAPA 3HGJA 4UMBA 3W7MA 3LBMA 3GVGA 1XI3A 3BVTA 1KXQA 2EAEA 4WLCA 3R5EA 1TQUA 4XKYB 4XUGA 4U3CA 4HSNA 1SU5A 3PY2A 1I2PA 1KM0A 1TPWA 2EKCA 5D2TA 1P6WA 2WC7A 4P61A 4ZQPA 1XCXA 3LV6A 1W5PA 1MWOA 1XH1A 3GYEA 5AHFA 4K39A 2DIJA 3WK3A 1C29A 2QUVA 2CLFA 3W74A 2DZUA 1S5VA 2ATMA 3LCLA 4C1LA 2ISWA 4U33A 3B0VC 9CGTA 2EPHA 4K7VA 1MFUA 4PCTA 1M53A 2BZNA 1BVNP 4JR5A 2FQIA 2VUYA 3FS2A 4WZHA 2F7RA 2CWNA 5AC7A 2NX3A 2RFGA 3L0NA 3KVKA 3NL6A 2ZUVA 2AGKA 5D2YA 1UKSA 4XTIA 4MLJA 5KZDA 4J3UA 2QCMA 3M41A 1EX5A 3WJXA 3BVUA 2DU2A 3OLEA 5TD4A 3VGDA 3BMVA 7TAAA 5I23A 3LTYA 2A0NA 1WZAA 1J0JA 4MZ1A 2E5CA 4AWUA 4UR8A 5LNUA 3W7IA 3W87A 3CZNA 3WFAA 2DH2A 3G1YA 2OT0A 2ALWA 3D4YA 4WY0A 2QCDA 3QYQA 4KWWA 1FWNA 5D05A 2BXYA 3QZEA 4W9TA 3W7RA 1IXOA 3IJ9A 4PCSA 3OVPA 5TIMA 3WJSA 1IV8A 1L6YA 3WY2A 1K7FA 1WBJA 4TX9A 3DX3A 3DI1A 1LP6A 4NX0A 3G0UA 2VRQA 1MW0A 2QCDB 5CSRA 2EF9A 4JTHA 4JXCA 1GPWA 3QQ1A 3UWQA 4AEFA 3KVLA 1XBZA 1TRDA 1ZAHA 2XVGA 3F4WA 4H6KA 2EADA 2ATSA 3LCGA 1RPXA 4NVTA 3TCEA 3GXFA 2CHNA 1QW8A 5AYZA 2Y63A 4MYXA 3P8IA 3RLUA 4AVFA 1P5BA 3PG8A 2GQ9A 1O4UA 4LV4A 2BHUA 2ZFAA 1RVGA 1EIXA 2DZSA 5J5DA 1C8QA 1TCMA 3W72A 3EJTA 3ZQ9A 1OK6A 1TIMA 1OHLA 2WSRA 3C8FA 3VM7A 1DEDA 3EJQA 3O6CA 3PSVA 4MUZA 2WSYA 4S2CA 1VHNA 3INPA 3BVJA 3KLKA 1B4KA 4N02A 4MJMA 3I68A 1GTHA 1U33A 5H2ZA 4RCXA 3PBWA 1K3UA 3W73A 4CCCA 2Y24A 1F76A 3KRZA 1KTBA 2H3BA 1WOBA 4GJ1A 1OYCA 1OFOA 1UKQA 3B8DA 4AMWA 2BLEA 4FHAA 3R13A 3DBPA 2CZDA 5AHIA 3C0JA 1HNYA 1YTEA 1YDOA 1JCJA 3L0GA 4CNOA 1UOKA 4K6AA 4UFMA 4WOQA 3TC7A 3W1NA 1TPC1 4X22A 2A5HA 4POCA 1OFPA 1GVFA 3CU2A 2VRKA 1V3MA 1TPVA 4OV4A 1R46A 2QCNA 3ELFA 3S8HA 4ZMGA 1IXPA 2W79A 3E12A 3DENA 5LNSA 4GC4A 2ZDRA 1H7RA 3DDGA 5E93A 3QW3A 3DX2A 1JUEA 1TQTA 1NVMA 1L9WA 4LVGA 1SMDA 2E09A 1OX6A 3TV8A 1I8JA 1XSIA 1E43A 5BRQA 1E40A 3GZ3A 5GVJA 4X2RA 1J5TA 3DGRA 1EO5A 2ZX8A 1SZNA 1GVSA 3W1PA 3CM4A 3EEGA 1WP6A 3CV5A 1KW1A 1OJXA 2TMDA 3M6YA 2E8ZA 1DBTA 3VMOA 1GTEA 2VFHA 4ZQOA 2FHBA 4O10A 1L2UA 2PC4A 1PPIA 1T0OA 1U2YA 5U7SA 1ZENA 4UFKA 1KLZA 3W7CA 4NZFA 3W7HA 1F74A 3TUUA 1JI2A 3FYOA 3N9SA 2YA2A 1XDMA 1QWUA 3P74A 5BW6A 3EX2A 2YW3A 2XN1A 2YDAA 5F4WA 5T26A 5D38A 2OW6A 1RQHA 2ZA3A 1KM4A 4KFPA 3CZGA 3WDHA 2WO5A 1LORA 3OIXA 4UMCA 3GDRA 3LBCA 1OVDA 3O15A 4O0ZA 2H3DA 5G4WA 1QWGA 1KV5A 3O05A 3L2LA 4BWLC 3C52A 2CLEA 3BH4A 3LHWA 4UQAA 1JL8A 3L4TA 3G1VA 3HOJA 2QUUA 3BSGA 1J2WA 3BLPX 3IRDA 4M8UA 1DQXA 1P0KA 1UJPA 4OE7A 2NWRA 4GBUA 4NUWA 1WZMA 4O1CA 3S9YA 1UKTA 1C9DA 2CLMA 3QEZA 3BUQA 4QISA 3P84A 3FJLA 5DELA 5A2CA 2ZX7A 5DFAA 2CPUA 4E2BA 4QAIA 2BXZA 4B9ZA 3Q2DA 1CYGA 1NAL1 1P1XA 4XQ6A 5AHNA 1QDSA 1UD3A 4QSHA 1AMKA 2CLHA 2YFOA 1FDJA 2CZEA 2Y6ZA 1Q6QA 4Z1BA 3JR2A 1Q6RA 4LS0A 4OV9A 2Y85A 1QI3A 3W84A 1SR9A 4UCFA 4UQDA 1SW0A 3PWAA 3HJEA 3EJRA 2FPTA 2WNWA 3PSWA 3E49A 3U6WA 3N2MA 3O6DA 3LOTA 2PCQA 5CSSA 1LWHA 1NFBA 2ZZ7A 3W1QA 1TJRA 3TJXA 3A9IA 3NQCA 2Y4SA 4IJBA 1Z42A 1PAMA 4GO8A 2HSAA 3NQEA 2B7NA 4JGDA 4OIFA 3MYOA 2P0OA 4MZ8A 3EDEA 3CT7A 1UB3A 1SO3A 1O5XA 5HUOA 2QPSA 4O15A 3LPPA 2ZCGA 3EXTA 1JF6A 1Q6OA 2ZXBA 4AWSA 1KTCA 1K7EA 2GVGA 2GJRA 3BO9A 2X2HA 4B5NA 4E38A 5DO8A 2Y61A 5HNRA 1JGIA 3HPXA 1TPEA 2X16A 1X8FA 3TJLA 2Y88A 3DH7A 4DELA 3U2OA 4J27A 3GIYA 1GT8A 3MI2A 3BV4A 3GX9A 1XV8A 1G94A 3PC0A 1OGSA 3W6YA 1JXKA 3WK0A 3OVRA 2DIEA 4WXZA 2YJQA 2FB3A 4MY8A 4TMBA 5HINA 1QR7A 2Q3RA 2C7FA 1QOPA 3W7JA 4AEOA 3F03K 3UWWA 4PFMA 4UFHA 2WJZA 2WKJA 3DHDA 2WSPA 4LPCA 1OYAA 2Z1BA 3JRKA 3LTPA 3TKFA 3TQKA 1TPB1 2GPTA 3CQ0A 4HA1A 3BAIA 4EWND 2Y89A 2VEMA 5DCDA 3W85A 4Z08A 1GJWA 4HNUA 4JTGA 1OFEA 3N9RA 3BPWA 3I6RA 1FY6A 2B7OA 3BAWA 1DJNA 1ICQA 3CWNA 1WQ5A 4RZ6A 1H51A 3F1QA 4RLIA 1LRTA 5HWJA 3IK2A 3MP3A 4CQAA 2OJPA 3THAA 1MEHA 1K8ZA 1HTYA 3W7OA 3CTTA 4UTMA 4AWTA 1Q6LA 2E5DA 1PS9A 1WBHA 4JTFA 2JKEA 4H2CA 1H61A 1LM1A 1KM5A 3EWWA 3TMLA 2V5BA 1D3HA 2QJGA 2C6QA 4R7JA 2YA1A 1VYSX 2QDHA 4RZ4A 2V81A 4BI6A 3W83A 1RP9A 2PWHA 5I3IA 1Z48A 1BLIA 4HOZA 2ZZ2A 3FKKA 1EP2A 2HS6A 1OFQA 2CZ5A 4L4MA 1D3CA 3KWXA 1N7KA 3C61A 3OEXA 3VGFA 3CWOX 2XIBA 4BR1A 1AW2A 2NT0A 4PCFA 3O06A 5LGZA 4LC8A 4H7VA 1MEWA 3NQMA 2ZZ6A 3U8GA 3BVWA 4YMZA 3TTSA 3PR2A 4CQ8A 2EQDA 2DJLA 1PCWA 5HULA 1KFEA 1TV7A 4NJKA 3L4UA 2VENA 1JRCA 2X2GA 1F73A 5DBTA 3T4CA 4FLQA 2G97A 3ZSTA 1VRDA 1BF2A 4U2YA 2GVJA 3L4WA 3LXCA 2VEKA 1B0IA 2ZUUA 2ZIDA 1TQVA 4MZYA 1SW3A 2BX7A 1B57A 5A6LA 2F18A 4FEZA 2RKXA 4Y96A 3GXIA 3PS7A 3W1RA 3H53A 1IXNA 4ALDA 5FEWA 1NF7A 4O54A 1KM1A 1F2JA 4D2JA 4BFAA 4ADSA 2G3NA 1EPXA 2HS8A 4YCOA 1S5WA 2PRLA 3SW6A 2VNCA 1T96A 4BF9A 1TQSA 1Q3NA 4O19A 2FGZA 4M7TA 3UCQA 3THQA 4UFJA 3SSJA 3TAKA 3DFSA 2WCSA 1GZGA 1FWWA 1T8XA 5HWNA 3LCHA 1EA9C 2TRSA 1M5WA 3LI1A 3IGXA 3L66A 2JKPA 1CXEA 4PSRA 1WAUA 5KINA 3NO5A 2BSLA 1KXVA 1IF2A 4O50A 2NV1A 3W7DA 1X6UA 1OT1A 4ZVJA 3QPYA 3G1AA 2YCEA 2YZRA 4BZYA 2HMCA 3M1ZA 3FKRA 1W3NA 1SSDA 1TTIA 2GJNA 3NZ1A 4JFVA 4PTNA 1NM9A 1KA9F 2WVSA 1H1YA 3SFKA 1DVJA 1R2SA 3EKZA 3N14A 4LRTA 3S1UA 3O1NA 2D0GA 3W1TA 3EJPA 3NL2A 5E6ZA 1WDWA 3M07A 2VKZG 3CEUA 2QV4A 4PL1A 3VGHA 2BY1A 3W1MA 3HF3A 3NPWA 5FEPA 3P7YA 4WX2A 1VR6A 1YXCA 3BUIA 1UD4A 2YYTA 1MSSA 1KFJA 4UCGA 3QMSA 3BAJA 3KFTA 4BK9A 1XGZA 1QPNA 1JD7A 2QAFA 4H4IA 4O0KA 3W70A 3STFA 4DF2A 4RKAA 4UFIA 3W7EA 5LHFA 1EH9A 3UWUA 3AJXA 3BUPA 1VHCA 4MY1A 3CGTA 4X3ZA 2QCFA 3KVMA 3BK0A 3ZS4A 4CLMA 2Y7EA 2NT1A 4MFEA 3PG9A 3WNOA 3MJYA 3NDOA 3O6YX 3QH2A 1QWNA 5FF7A 5K9XA 4QNEA 4U28A 3WFZA 3VMNA 4XBSA 3IIOA 2CW6A 1JFHA 2YIHA 5LHEA 2ZRXA 4FIQA 5EYWA 2ZX6A 4E2DA 3GKFA 5U4NA 2YSWA 4FNRA 1LCOA 1XH0A 4E0CA 3GTNA 4UQEA 2OYLA 2C15A 4NNAA 2NXIA 1N8FA 3NXFA 4ZQRA 4UZUA 3RILA 1ODUA 5I0DA 4HHPA 3VNZA 1LOSA 4UNLA 4CN4A 3UERA 1VYRA 4CN1A 2Y62A 1YADA 2FHFA 1O7DC 1V3KA 3L4VA 5ABTA 3P82A 2DZXA 1R30A 2NX9A 1YXDA 4DO6A 4LY8A 3BC9A 5A5WA 2C16A 3NPVA 3D4ZA 1LDCA 2WSQA 1ONRA 4ADTA 1JCLA 3G3MA 4N9EA 2QPUA 3VX0A 4N4PA 2D2OA 1CXIA 3BAYA 1FQ0A 1A53A 1WXJA 2P1FA 1JQVA 1OG0A 4MIMA 3EJSA 3KRUA 3UWZA 4EOUA 1L0PA 1VCVA 1CPUA 2TAAA 3CZKA 4AF0A 4CNNA 4A22A 3EDJA 2D0FA 3D0CA 3G1FA 3P5YA 3GDMA 2CLIA 1LBLA 3NL3A 4WOZA 4O8RA 1LWJA 2A4AA 4UZSA 3IJ7A 4GQRA 3WY4A 2H8XA 2AQWA 2HTMA 4OWGA 3LXAA 3PBUA 2QUTA 1Y7VA 3KLLA 4NXKA 3ECQA 1O5KA 3ZWSA 2X1SA 4LV9A 2VFGA 1I45A 4JTJA 2XFWA 3KOFA 1JG9A 3L5MA 2BHZA 3PUOA 4Z0JA 2WKLA 4RV8A 1CXKA 4ZL1A 5C54A 1MFVA 3W1UA 1Z41A 2V2CA 3EXRA 1SQ7A 3QF0A 5DCEA 2VFIA 4GUJA 4OGZA 1QCWA 2ZRUA 3DKLA 3EX6A 4CN6A 3W2JA 3P81A 2Z6IA 4UUIA 2EABA 4FXRA 6TAAA 4AIOA 3C2RA 3BG5A 1KXTA 1XH2A 2G3MA 2WVVB 1IIGA 1SFLA 4N9DA 3W3OA 2Y70A 3KVJA 1OT2A 4JFSA 5F7UA 1MEIA 1VJIA 2C3ZA 5E6YA 3LCWA 3V75A 2A7NA 2JBMA 1MXSA 3CZEA 1K03A 4AHOA 3LERA 4RZ5A 5A8GA 3UWYA 3RMJA 3NGJA 3SR7A 1H3GA 2QCGA 3NZRA 4LVAA 4MB1A 1PHWA 1QPOA 1JVNA 5EL1A 2ALDA 2JK2A 4GUFA 3S42A 4RXFA 1HL2A 1M7PA 2OSWA 5AC6A 3DKJA 2PWEA 2ZXAA 4BWLA 3GXTA 3DU0A 2XN2A 3VMPA 4DPPA 5I5RA 3S5ZA 1B4EA 3E02A 4Q32A 1DKWA 3OBKA 1UD5A 3QQ0A 3DFNA 2V2DA 3K30A 4WQ6A 5CXPA 1B3OA 1MW3A 4WF7A 2WOQA 1KLYA 3HZ3A 3IGSA 1VFMA 3VSUA 2XVLA 5DXYA 3M43A 4MYAA 3TNOA 5DBUA 3TAOA 4S2BA 3EWYA 3UG3A 1FDYA 3GLCA 3LHZA 2OYMA 1CGYA 4NU7A 2A7RA 3G1XA 4N6FA 1TMQA 3LRKA 4IMFA 4IOTA 4QJ1A 1XUUA 1J4EA 1EP1A 1KBBA 3TSMA 2V5LA 2QDGA 4QIUA 1LROA 4XWUA 2GJLA 4DBDA 4FNUA 4UQCA 1CGTA 1FCUA 1H7PA 3KE0A 3GXDA 4DO4A 5HUPA 3I7QA 3UPBA 3DX1A 1W0MA 3BW4A 3RK8A 4Q4KA 3RLVA 1ZJIA 3AO0A 4JY8A 3CZSA 5L9FA 5BRPA 1HO1A 3DFTA 4GUHA 4DXVA 5EBUA 4ZQCA 4PSPA 2C19A 4PEKA 4I7WA 5K2ZA 3I7SA 3N19B 4GE8A 3BLBA 4O1DA 1WZKA 4UQ9A 3L9CA 1JCMP 3LCIA 4LS2A 3C4UA 4FB7A 4CVWA 4IPIA 5LNRA 4R53A 2GVYA 5G2HA 3KHJA 5EKYA 1KB3A 4LUIA 1TREA 2YA0A 3LHUA 3G0XA 1D3GA 2RH9A 2X2IA 4OHQA 3WJYA 5KSWA 3O07A 4JTKA 4HPHA 3L5AA 3H54A 3BW3A 1KGUA 5LSMA 3G8EA 4UQBA 4I7UA 1KCKA 1JUKA 4IMDA 1CGVA 1QO5A 3L0KA 3UEQA 4ORMA 3S5YA 4CKQA 4DF0A 3MP4A 4NJIA 5D2WA 2QMJA 1PZ3A 3UG5A 3BAXA 2NSXA 3GDLA 4J3TA 2ZZ5A 1MW2A 3WNPA 2DZPA 2YX0A 1G4SA 4O17A 3DAQA 4GIAA 1VYPX 2XIIA 4GI8A 2CXGA 3CIXA 3LLDA 1DQWA 1GWJA 4JTIA 4AAJA 5KITA 4HP5A 4GFSA 4NZJA 5CZSA 2NUXA 1W8SA 1AMYA 4U4MA 1XM3A 2DZWA 1W9XA 3TQVA 2OW7A 1H1ZA 2JGQA 3HPSA 3QW4B 1H7WA 2X2JA 4N4QA 3P5ZA 3D52A 3SY5A 1HG3A 4JFWA 2TSYA 2OX1A 2QJHA 3MHGA 1A5BA 2OCZA 2C14A 3UZ5A 2DH3A 1QW9A 4EIVA 3TROA 3GBEA 5E9AA 4JIQA 3A22A 1THFD 1J0IA 4LT9A 1E3ZA 4K8HA 3WNNA 3EWUA 3QPZA 5D2XA 5HR7A 3PB2A 2YW4A 1J0HA 4NJJA 2LLEA 3HO8A 4UR7A 3EDKA 3TR2A 3G1SA 3T55A 3T7VA 3CTLA 5AB3A 4N6EA 2NV2A 3W1XA 2ZRVA 1TB3A 3P62A 3BLKA 3WY1A 1TV5A 2E6YA 2F7FA 3L68A 5HMSA 2F84A 3QGVA 3CLMA 4J3XA 2GUUA 1SPQA 2DZVA 1JXJA 5E1QA 5K4XA 1G69A 4C1KA 4CQ9A 2EEXA 5J5RA 1YYAA 3AMLA 1D7FA 1JAEA 1R33A 1PHQA 3BW2A 3GAKA 4H3DA 1AW5A 3M0ZA 3STEA 4UNKA 3L2MA 3T78A 2EACA 2A2IA 4LVBA 3NA8A 1CGUA 1UH4A 4ZQNA 2CLKA 3ZWTA 3K8LA 2V3FA 1XBXA 4Z0SA 4FX7A 5CZ0A 1CXHA 3DI0A 3DFOA 3QSRA 3S6DA 1SW7A 2TPSA 2EAWA 3SJ3A 1QMLA 3LGEA 2C8NA 4S1FA 4O1AA 2IQTA 5EMYA 1XUZA 1MXGA 5K9DA 4DF1A 3A21A 1VZWA 1TQWA 1GOXA 2F2HA 3A24A 3W2KA 4MOZA 4M5PA 3UQNA 1HWWA 4LQ1A 3BARA 1ICSA 3SZ8A 3PUEA 4IUOA 3ZT6A 3HMJG 2R14A 2J25A 1SUXA 5D09A 4MAZA 1NF0A 4GXMA 3UG4A 4AW7A 2QCHA 2X1TA 4IXXA 4EF9A 2YKKA 1CX9A 1TCDA 4K38A 3HBLA 5CGQA 1OF6A 1IGSA 5FI8A 2DZTA 5AYYA 1G7VA 1XSJA 4AIEA 1BTMA 3OA3A 3BLIA 1GG0A 2WCGA 3BG3A 4FLRA 1OF8A 3VCRA 1I2OA 4IPJA 3W1LA 3B0UX 1WZLA 3GXNA 1UUMA 4NQ1A 1SMAA 4IX2A 5BOOA 3TX9A 1PIGA 4LS1A 1XD0A 2NWSA 1SZEA 1EO7A 2QEZA 3L4XA 1M7OA 4GINA 1VB9A 1YPIA 3ZO9A 4DEFA 3LHVA 2ISVA 3NQ2A 8TIMA 1UA7A 1HT6A 1EUNA 1TTJA 4UTLA 5FEXA 1R34A 4ORIA 2F7QA 3AXHA 5MHBA 2DORA 3WELA 3NEVA 4IGHA 3IGUA 3I65A 2J27A 2D0HA 1RPKA 3ZT7A 1YDVA 4TR9A 3RNDA 2OSYA 5D30A
chains in the Genus database with same CATH superfamily
2R1YB 5IBLC 1T7LA 1LLZA 1DVZA 4NP4H 4HSHA 4LSTL 3TL5A 1ENUA 2QKFA 4DB7A 1I53A 1J0KA 1M9SA 3WGVB 4B7LA 1ZANH 3I6GA 4E5XG 4F7PB 5C0AD 4RPPA 1V54B 2WJ7A 3CFIC 1MIEL 5FJJA 3R43A 3OAZK 2I7GA 3QHMA 2PUQT 4OCXL 1IYXA 3GRIA 2HP4A 4LH8A 4LLUA 1YKWA 4KEUA 3MN8A 2PBGA 2PAJA 1FAIL 2NX5D 3QZ6A 2ICEC 3PZOA 3ZUNC 1BSIA 3B9NA 1K8CA 3APNA 4Y5VB 4FTVD 5IB1B 4LUSA 4V27A 4A39A 1V10A 3P0YH 5IVNA 1S9XB 3CB3A 2IDUA 2XTJB 1EC7A 1YNQA 3IIVA 4PCNA 3LD8B 4HKZB 3TH2T 2DQXA 1JDAA 3U1SL 5MENE 1UWIA 4H19A 5A8NA 1M71B 4C55A 4JN1L 4IIGA 1L9QA 5CSGA 1MYRA 1IRAY 1MF2L 1I7ZA 3BD4A 1M6OA 2F1BA 5KYUA 3I9AA 5A6MA 4FD0A 4M8QB 4EZMA 2BZCA 2G5BA 3U1SH 3NOIA 2FTPA 3CZLA 4QXGL 4WO4A 5C07E 4ANVA 3VD9A 2QVKA 4J7RA 1C93A 3F05A 1V8HA 4QIRA 1EVUA 1Y0EA 2JMRA 2DRUA 4UTKA 1X7FA 5EO9A 4RPQA 3SKMA 3SCMB 1NCBH 1S7TB 4XGZA 1VLIA 5C9ZA 2FDSA 4LGSB 2WNKA 4EBQL 3MRGA 4QLRA 2R1YA 2W9EH 4GRMA 5FM5M 1JZ4A 4KY1L 1KJ2H 4WEBH 3THMH 4NKMA 3K6FA 4E4FA 1XL6A 1TMLA 3MBXL 3BVXA 2HLFD 5GRZA 3BZEA 1AIFA 3A5FA 5FF3A 1FWTA 3LS9A 2O5XL 3Q8FA 1QUNA 4IGBC 3T4AA 4BJLA 4C47A 3STGA 3C5JB 3HC3L 2FEEL 1GTNA 1OK4A 1EFQA 5KVEL 4HNOA 5C55A 1V6XA 1TJPA 2E6AA 2IBBA 1FXPA 3N1QC 3LYRA 2H26A 1UWRA 1QNSA 2NYYD 2PC8A 2OLHA 5JQ6L 1D9KA 1LUCB 3P0XA 1XMWA 1KBJA 2KH2B 5GGUA 3VI3A 4GH3A 1A1OB 1DL7H 3FDWA 1HDMB 4J2MA 4DYKA 1COBA 3UGXA 3ULUE 1AUSL 1FHUA 3MCKA 3M5XA 3LKNB 2WHJA 5MEOA 1JAKA 2NUTB 1W5OA 3VGAB 3VXNB 1JPDX 3SIZA 3HMWL 5F8QC 1UYWH 3WN6A 1P7HL 2XGZA 3ITXA 3OQ8A 2OXGA 3W5MA 3WEXA 1NCAL 3SCQA 4Z7UB 4YXHH 2DJUA 3TPUB 4QBXA 5D8WA 3IDYC 5F44A 1R87A 3TNNB 4RL3A 3UJIH 1TOXA 4JW3A 1MRFL 3ZJKA 1W3TA 2YPVA 4ZQTA 1NUGA 1BPVA 4LOUC 2WMIB 1A02N 4I5XA 3CUPB 1S9KC 2JF7A 1FC2D 5IMKA 4V1DB 1NCCH 2VGBA 4P5RA 4NBYB 1BFVL 4K8EA 2BXVA 4A7QA 4PJCE 2KKQA 1B0RA 1B30A 5I6KA 5HDOA 3Q2LA 4I3RL 1IZJA 3W4RA 1JFQL 1IBZA 5GISL 5ADOL 2DWTA 5HI3D 4DCQB 3VXQB 4UOQA 5G1TA 3AQDA 4ORIA 1F0LA 3MMUA 2F54D 2F74A 3IXAA 1INEH 3WFEH 4JDBA 5D9NA 3P11L 5LYRA 5I6SA 2FSEA 4MD4B 2IWEA 1CD0A 2CIIA 3WBDA 3CPRA 5IESL 4PTTA 5CC6A 3NJNA 4OV6F 3V5HB 1J5HA 5ESVB 5A16A 5TE7L 5DS2A 2EYTA 3QM3A 1RZGA 3TDFA 5EUOF 2DJSA 5F1UA 1KZQA 3O2VH 1SJEA 1J2BA 4OCYH 5EO0B 1IJ9A 3SY6A 3CU7A 5F1IA 1L8PA 5AENA 3E3HA 3VI4F 1YRKA 4JZOA 5B7YA 1JGEB 3B43A 3QO0A 3CV6A 4K3DL 4ZB5A 3RUGA 2CMRH 4KRUA 4P4KB 2VHLA 4MMWA 3MGTA 3NMEA 3CLWA 5CCGE 3GS0A 5EBMB 5AQ0A 5C5YA 5I3FA 3WZ0E 5EU5A 4JL1A 2YDQA 2AQTA 1O60A 2DLIA 3TM6A 2HX8A 3BG9A 1TRIA 3O63A 4GKLA 3SQSA 1H6FA 2AJZB 4UNUA 2O7SA 1W6LA 1ONEA 1HL5A 1FH8A 4MADA 1C5CL 2WZAA 2ZXQA 3CC5B 1F7BA 2PRHA 2VITB 1MVUB 1Q4NX 2X9XA 3M16A 2OTPA 1HJUA 2Q71A 4KFOA 2QVTA 4IMLA 1MRCH 3UBXG 5D7EA 2BNUB 2TSAA 5L4MA 2ZP9A 1GOIA 5A69A 3KPPA 5LKYA 8FABA 4GFIA 4ZQMA 1ITUA 3FLUA 4ERIA 3P93A 3LS5L 4LDLB 2HG0A 2YBGA 3UPRA 2YD5A 4XVOA 3QIBA 1VBJA 5FF4A 1N3NB 4RMBA 2XFXB 1TPUA 2BX5A 5JW5A 1AOZA 1QHPA 3TJHC 1EHAA 3V7AG 1A0EA 1QPPA 5IROC 3N6JA 3RGVA 3DZ1A 2P26A 3CIAA 2VR5A 3B9DA 3NESA 4HSQA 4EKJA 5I1CL 4X4YA 4KNQA 5LA0A 4BSJA 1KM6A 1NINA 2W5PA 3M0IA 1W3IA 1ML0A 1BTCA 4DJDC 3AXIA 3KVDD 3CIQA 3P54A 3VXOA 4IP5A 2AJUH 2YZ1A 3NZHL 1DJYA 3NTCH 3O2DL 5D72L 4KEVA 3QUKA 3TIEB 4JM4L 3TP4A 2VABA 3FQNB 3GMLA 3HTLX 1U30A 5CO1A 3HPZA 5LIKX 4XV0A 3NN8A 4FIRA 2WZPD 2DQEH 1G7HA 4BQ5A 4C6BA 3BN9C 3DX7A 3P60A 2WQ8A 4OF7A 2OZ4L 2AQOA 1J8HA 4OGAC 3SD5A 4KFNA 3S36X 1XFBA 2YQGA 3W75A 1N5AA 3KBEA 2AQNA 3ROOB 4AXWB 1PL9A 3B9EA 2BP1A 2JTYA 2N1KA 3GMPB 4ZUUB 4UQIM 5AW4B 1JF5A 2JI3A 3UGVA 3RWCB 4MUPA 1MCPL 1XT5A 3EBIA 5F96L 4P2QD 5JPNC 3S88L 4DJED 5DI8B 4JN8A 2OJEB 3NN8B 4JTEA 3V5HA 3PUGA 3B4UA 4PH6A 4TX8A 5FYLH 4BWUA 4OCSL 3V4LA 4LNYA 1I8IA 4KC3B 1I4NA 1DQQB 5EWIL 3SR7A 1NCTA 1GZHC 4R7DB 4I9WD 2ENQA 5B7EA 4JIRA 3LH9A 4UFLA 3VFLA 2VR8A 3CK5A 3KAAA 5IBXA 3KPPB 1V8EA 1QPRA 3AGWA 4PD4K 3GMNA 1LK3L 3MRJA 4HU3A 2HT2D 2C9SA 3RN6A 1E7UA 1LP9A 5D7IE 1J96A 4PP2B 2OR9H 5AYXA 1P5VB 3ELAT 2PCXA 4R97C 4Q6XA 5CPOA 4B9PA 4FTVE 1X5IA 4ZXBB 4K7YA 1FFQA 4UAOB 5C2UB 5EB9A 3DHFA 3EOUA 1F11B 3IIZA 5CPSA 1W8EA 5BZDB 4A2RA 2GGEA 4ILSA 2J57A 3MX0A 4NKQB 3GFXA 1EHLH 1HIML 4OGQC 4E3TA 2X4OB 4FXKA 3GR7A 1ICTA 4YHIA 4XAFA 3STCA 3DIFB 1YNKH 3FT1A 1ZAJA 1LK2B 2Z91B 1I4FA 1JGLL 3HZVB 2ODOA 7PAZA 3EKCA 3H24A 4PRIE 1ID2A 1G9HA 2HVKB 1U1HA 2FZ3B 2VE6B 5CPNA 2VQ1A 2YJLA 4P5TD 1TKWB 3GSMA 3VKAA 5DS1A 2VERN 3CHXA 4ZX5A 3MKCA 4PJIA 4QDPA 1G0CA 4AX6A 1GS7A 4X98B 4XPAL 5EWIH 3RTQC 4D9QD 4WUIA 1WZ1L 4YTSA 5CAKA 4DNHA 3L4CA 3WX7A 3L1OL 5FFGA 3DJRA 4K94L 1MAJA 1F6AB 5CHNB 1HX0A 4JTLA 3B5HA 1NIDA 1Z5HA 2FMOA 3EGDA 1BV8A 4CGTA 1QLEL 4PVNA 3BH9B 5AD0A 5I71C 4P46D 3DPDA 3FEQA 5IROA 4JHUA 2EDMA 4D0DB 1SHMA 1E6RA 5K39B 3QO1A 5ETUA 2ABAA 1CWYA 2WCAA 4ATDA 2UZXB 1UASA 4TM9A 3CWGA 3HC0A 4Q9BA 5FCUH 2AJSH 1Q66A 4F2BA 1NFDA 1FFOA 1UD2A 4AZCB 3AZRA 3MT1A 3SO7A 2NY1D 3OXSB 3IAPA 3CAQA 4GBXC 1ASQA 5GJSL 1XRSA 4RETB 5GIRA 3B97A 4XOAA 3VFCA 1G7IA 5K9CA 4PIRF 3EB3A 3MRRB 4XH2B 3SJNA 1RJYA 4ZS6D 5DHYB 1GKOA 1INQB 2N0MA 4ALAH 4UV4L 4UT6L 4TUKH 3WJMB 1CENA 3L9YA 2XVNA 4LCWE 3O16A 3D4GA 4PB9H 2YAEA 1PKLA 2ED6A 3H7LA 4DETA 3QWQB 4MDPA 2P5PA 1FWCC 4KQ3H 1KV3A 3GHSA 4WHBA 1W1IE 4O2CB 2W38A 4YK4C 4ZX6A 2GJ6A 3FQ2A 5I1AB 3TJEH 1EX1A 4AIUA 4HHWA 4NKDA 2CERA 4FN0A 4QRFA 4IRSA 3BXNA 4ODHL 3V7MA 3K6SB 4F2MB 4XISA 1OAUL 2Q6ZA 1YMHB 4QT5B 3HQ1A 2I9LB 5HK4A 2SFPA 3W11C 4WI8A 3WK1A 1A5SA 1RY7B 3FN0L 4FQJL 3QZMA 4HUUA 4S3EA 5D6DC 2GTZB 4P2VA 2M8XA 3H6AA 1HJXA 3MP5A 3P61A 3CDFA 5T3ZD 2ACRA 2J62A 4MWAE 4QG6A 1ZS8B 4TKWA 2VCCA 2G2RB 3FYIB 3LPGA 3GI9H 4TU1A 1MZZA 3OGOE 1SXAA 3L48A 5HDLA 3MDJA 5ITFB 5DYOB 1SGKA 1PL3A 4XXDB 3IVTA 4Y19D 3VKDA 2XOTA 3E6HB 1LJMA 2ID5A 3LPFA 4LL4A 1LHZA 2GQ8A 2JKIS 2YS4A 1MFMA 2IPKA 3ABQA 4HJUA 1OG6A 2UZXA 2PS2A 5LGKA 3T40A 2VC2L 4NIKB 6XIMA 1DQKA 2DZBA 2DW7A 3M9YA 4RBPH 3GNOA 3UPCA 3T04D 3ARZA 1P0NA 5KN5A 3L5LA 3BIBX 3BZDA 3KXFD 4OJAA 5JOFA 5FESA 1AIFB 3HG0A 1CT8B 1M2VB 1RK0A 5F3FA 3BIKA 4DUWA 2YDSA 1GVRA 4N4YB 4ABQA 1QFEA 3OYXA 5LQBH 1EZSA 1J05A 4DPBX 3NZSA 4E9LA 4HW6A 1DEEA 2ZKXA 3Q3GA 2RA1A 4HPJA 2FX8H 4FJ6A 4YGVA 2DQCL 2ZCKL 3FBKA 3MJ7A 4G5ZH 4ZW7A 1NICA 2DY3A 4MKSA 4Q33A 2QLVB 2QQQA 4J6RH 1F05A 3UY8A 5T1MA 4L61A 3SDCA 2R69L 4BXSV 1AL8A 2IPUK 3N4FA 2P9RA 3PWJA 4QI3A 1J88A 2NY2D 1A4JB 2H6RA 2W6RA 4TVPD 3PFRA 4I3SL 1KYUA 5E4AA 1OK8A 1OX5A 2H45A 4PM1A 5FF2A 1Q7ZA 1MCRA 2YXGA 2EIBA 3EWZA 2D31B 2D2CC 4PUBL 3ZSSA 4D9LH 5F1VA 3GF8A 2CLLA 3O11A 3OG6B 3WL9B 2YXXA 1F2XK 2YXMA 3MRKB 1KN2L 1D5IL 1FZKB 1GW0A 3AM8C 3F85A 2Y2YA 2W9MA 1R5WA 3H70A 4UWQB 1S2WA 3L2IA 2Y7GA 5FSDC 3GBML 1XCQB 3RVWC 3K8MA 4IISA 3S1XA 3NZPA 4P5UA 1A4JA 1I2QA 1HQRB 4LSSL 4ZW5A 4HJEA 2V3GA 3BWWA 2YMTA 4IOSA 2OMBA 3OZYA 4YLWA 3GUFA 4Z23A 4W9CC 1ZA3A 5C8BB 5C0FA 4O5LH 5TQ0L 3D4CA 3VKJA 2NVDA 2ICEA 3WIHH 2JKWA 3DJ9A 3POCA 1PZUB 2YGPA 1R3JA 3OTTA 1Z8AA 1CWVA 2BNQE 2JKXA 1XF0A 5HPOA 1G7LB 3NNTA 3TW9A 3S7GA 4Y2WA 1VGEL 1M7XA 2R69H 1B90A 1QPKA 2OX5A 1JGEA 2X4SB 3Q5YA 4N6QA 5GGQL 4HMEA 3S2CA 1W0YT 4PRDB 1KM2A 1RUQL 2GK0B 3Q2CA 4YR6A 5FO7A 3EIFA 1DWGM 1ZPTA 1JGMA 2QR0A 4JZNA 1NGWA 1S9WA 1VJSA 2H0PA 2VXQA 3O6AA 2R83A 4G8IA 4A3UA 3JZYA 1QNIA 5F0JB 2IV8A 4ZUWA 1GYNA 2XFRA 1QASA 3FQXA 2CXKA 3GAYA 5FUOH 3UVIA 4P3CL 4EI5A 2OZ4A 3T1WA 3A47A 1W6TA 2E6JA 3VI3E 4JN6A 2H6UA 5I16A 3MDWA 4O11A 3REVB 3IMBA 3GG8A 5KBMA 3EX1A 4MB3A 4KX9A 4F8LA 3QJZA 1ZLWH 4LEEA 4NCDA 2FQFA 6FABH 1Q9LB 1BAFH 5AVZB 1MH5A 2XQ0A 3GSOA 2OS7A 1AGBA 4L4TE 3F58H 3UO8B 4J2XA 4JTRA 1EB3A 1S2EA 2B1OA 3OZLA 2F8OA 2R1MA 7CGTA 3N0AA 1QBLL 5D1QC 4J1OA 5DQDH 4Z95L 2FATH 2EE2A 3R12A 3SBFA 2XM1A 3BT2H 4HDIB 1A0DA 1A7RL 5A2AA 3KM2A 4OAWA 1BBJB 3LRMA 4DJFA 4TULL 5CJXC 4PJ8C 4URKA 3D05A 3ITVA 2NXYD 3RZCA 4MNQB 3B56A 3HGOA 3UTQB 5GJMA 1Y65A 1YZZA 1HWHB 1IQWL 1JHKL 4TO8A 3WLJA 1YDPB 4PWIA 1F6KA 4IDJL 2GVLA 4AY1A 5T1DH 3VQMA 1B0GB 1UWXK 5HVGB 3HKFA 3QNYA 1G6CA 3RRAA 5G5DA 2DIKA 1JJUA 4RW5A 1XTLA 3DTDA 3OKMB 5HXMA 2IGFL 3IIPA 1JULA 3GMQA 3BOXA 2F58L 1BVZA 4KDTC 1IKFH 1S7XB 1A4CA 4G11A 1BWLA 1F6YA 5I30H 3JV6A 3SUVA 3IV3A 5MERA 1HXMB 3MNVA 2X9YA 4AJYV 4DW2L 1LUCA 1Y5XA 4LAUA 5IXEA 3AU6A 2MANA 4JTTA 5F1IB 1XB8A 1DXFA 1KFLA 1WAPA 1X5LA 4BFRA 2GQHA 2X3BA 4HKPA 4JX4A 2CBUA 4JZNB 4IMCA 2R51A 1NWSA 3C3NA 2HEJA 3SIMA 2R29L 2AERT 1F6AA 3OKEA 4HXAH 2CA3A 1E9PB 1ET7A 1H5BC 3E3QC 3QJXA 4K8RD 1KBKA 5D7IB 3V6OC 1R3KA 3B2DC 1H60A 1KKOA 5D4IA 4L3EE 2C79A 3WNIA 4OGAD 1I85A 2CXEA 3UCCA 3QFJB 2RJMA 5JHLH 1PX8A 5CPQA 4M7KH 4ZUTB 4US5D 5B38B 3W01A 4YAQA 3EADA 5DDHA 5JPMA 4ICWA 1JR1A 4GRMB 2F5AH 1RZPA 3AC0A 3CSBA 4IWWA 4N86A 4NUMA 5DVKA 1RBOB 4MLSA 1ZT4B 1ZLVK 2H5UA 2OV0A 5JA8B 4PJXF 4TS6A 5HYSB 4ZB0A 3WMPA 5C0CE 5CKAA 1Z9NA 1KC7A 5DCBA 3ARGB 3LIUA 3O41B 3S35L 5EIVA 3H7RA 4G6AC 4I88A 2GYIA 4AVNA 1SZFA 1ONQB 2XFXA 1XCWA 3DYMA 4PWFA 3VYNA 4OQVA 3U46B 3QJRB 1ZSHA 4NQEB 3UO1L 1S5NA 4W9IC 2ABBA 5INCB 3HZKA 3AJ7A 1QFUH 2REQA 1DV7A 5I1EL 1IZKA 1CICC 2Z6FA 4XVUC 3N73A 4L80A 2H0JA 3TYZA 4X5XB 3QC3A 2FQEA 3IKCA 5JYLA 3WF0A 4G9FE 2D03H 1UR3M 5CCHE 2PR9A 3BYYA 1A4LA 3F7KA 1JK9B 4ANUA 2XRAH 4JZ5A 4NT6A 5MEPA 5HI5D 3S3PA 5DHMC 1DQMH 3KLDA 4YDIL 4I9MA 3U57A 1ACYL 1Z2KA 1TPFA 1JZGA 3U5YA 4GQ9H 3V0JA 1TJMA 1CGSH 1FRGH 2B4CC 5EZJA 3H6OA 4PJ9C 4WDUA 4S3GA 3VINA 4ODVH 2XIDA 3KRUA 3N1AA 5AVQB 4XMUA 2BOCB 4MXWL 5H6HA 2UWEB 4P2QB 3TASA 1AZ2A 4RW3A 1DWIM 3WKMH 2R94A 4EEEA 1RU9L 4LHUG 4FFVD 3B9KD 4HN8A 4Z0BH 3KMDA 3WDQA 3QHFH 4OB5L 2MMXA 1I8MA 5IM7B 3A23A 1EEYB 1RURL 4TUUA 4APXB 4ZFZB 1B1YA 4HS6B 3RPDA 3MRDA 4QHUA 3QZLA 3QIUA 1M7DA 4PFHA 4HKXB 3VDCA 1FQ9C 1NAKL 1YC7A 3B6SB 1RZJC 2HVMA 4FO4A 3TN3A 3W7NA 4H8PA 4IRZH 3ULVF 4AV4A 1FSKC 2W61A 5FYLL 3L23A 1L0YA 1JCYA 5E09A 2R4RL 4JVUA 2VN3A 2ATPA 3UTSD 1T3FB 3OGCA 5JORA 3R79A 4V1YA 4MD0B 2DM3A 5F1OB 4W7UA 4AD1A 3B2MA 4D2JA 2VLJE 3VWJD 2Y8VA 1FFRA 4AD5A 3LRSA 2XX0A 1PSKL 4HBCL 2BSEA 1A3QA 1FNEB 3URQA 3QG6B 4HIJB 4ERGA 3LQZA 5FM4A 4JFTA 5DT1H 3EG9A 1BGGA 1WDPA 1UZ6F 2QQ6A 4GZIA 3M0HA 1GGBH 1IAOB 1LO2L 1OAKH 5AAWC 4QHLA 1VBUA 5GQBA 4WW1B 4R85A 1TV8A 3CLEL 1KLGB 2E9BA 2ESVB 2L3BA 4M7JL 2O5XH 5D4JA 3D2UD 3GNDA 4WSJA 4AYGA 1Q1PA 1GHFH 2V9DA 3FO2B 3QUML 3FAXA 3K74B 5T1LB 1AQDA 1HKWA 2WXNA 5C0EB 3DUSB 4O4VA 4OUOA 3II3A 1P6FA 1AODA 4XMZA 1JZFA 1JGLH 3V4UH 1X5XA 3DA0A 3OO2A 4JL2A 4XN4A 1QOQA 2W8CA 1UD8A 4BQ4A 3FW6A 3VFGH 1RD5A 1KRMA 5D7LD 4JTUA 1TTUA 4B9KC 4U6XA 4OJYA 1CDGA 1IBYA 1N2RA 5BZWB 3W9DB 5DEZA 3RDTA 1EZVY 1F56A 4RR4A 2OMVA 1U8QA 4IHOA 1TWIA 3MSGA 1T7XA 4PY7B 5FCZA 2E56A 2LW3A 5IG7A 2R15A 3BW9B 4CVZA 4ENLA 4LCUB 1XQKA 3WUWG 2WNQA 1PSKH 4FE9A 2X6CA 2J74A 1JZIA 2DEPA 3BCFA 5M1TA 3Q8AA 2DV0A 2MOGA 5JBEA 2AGTA 2XWEA 4UT9H 4XAWH 5J13B 4B4FA 1NC4D 3O3UN 1QRKA 4N0UA 2QDDA 3TXZA 1OGPA 4B97A 1GQNA 1D9KD 1HYSC 2GFBB 4D7BA 4BWTA 4PN6A 2ZTKA 3F2DA 3MJGX 5DJ2A 4JZJA 3FUEA 5FEBA 1GZQA 3RCMA 5C0IA 4FHKA 1ZHKA 3UVAA 1PLCA 4AM0Q 1V3LA 1AO7B 4DGVH 4LVNB 1YX1A 1XWVA 2CLRA 2AK4A 1LE5A 2D7OA 1VIWA 5T3ZE 5ADOH 4I0PA 3A5VA 3RIAK 4N0YH 1FP5A 1K4CA 4UV7H 3ZZ1A 2WZ5A 2EBNA 4Q7BA 3W22A 4ZAKC 3M5ZA 5FA3A 1C9SA 4X0NA 2J4GA 1EPFA 1P84J 4K2UL 3MFFB 4Y5YB 3SECA 3EOLA 5L2KD 1TTBA 4P2YA 5IBTH 3K6NA 3US1A 5I3DA 1ZJBA 4I89A 1UVQA 3G6JA 4KQ3L 3NOEA 4NWUH 3KW3A 1A1NA 1ACYH 2O6CA 1UG9A 5DEJA 5ECJE 3SSGA 3VYOA 4D8ZA 5ID1B 4IMEA 2E5BA 4ODXA 3B04A 4PGLA 1H3UA 1CF8H 4NWTH 1I8KB 4KZ0A 4HMNA 3PM6A 1UEYA 4XAGA 2V17L 3QWNA 2QLYA 2BIMA 3ABKB 2GQAA 4WENB 1FV1A 3EX3A 4PWEA 4LW7A 2VDNB 4PJ7E 4RIRA 4RWYH 4DQOH 2CIPA 5AFDA 2JEQA 4JRFA 2FJGA 1BZ8A 2Y6TE 4EKXA 4HU4A 4GQQA 3W2UA 5D6CA 4A04A 4C60A 1C16A 1SRDA 3JTSA 5L7XH 4RRPA 5DZJA 4ROPA 1WICA 4FFVC 3N0PB 4AG0A 5DN1A 1EAPA 1BG9A 2QF8A 5LIUX 2H3KA 1TZIB 2A21A 3NPUA 4AU0A 1TDQA 5AHMA 3NPXA 3HN8A 4GEJA 4IBYA 5GGUB 3VI3B 4JX6A 4DJFD 4LASL 1QHZA 4P4RB 1XIHA 2PWDA 4B4HA 2ZOLB 4J1UA 2IKJA 4AC7C 5E00B 3WLIA 2NZ9C 1S5TA 4C6PA 5A6BD 2AQQA 1X5KA 5HAOA 1X7IA 1JRHH 3FSVA 4DN3H 2HN7B 2WVUA 4PMFA 3VYLA 4ONHA 4JFDE 1F4XL 2W0KA 3RG6A 1QRNA 1FO0H 1ZIAA 4NQXA 1FGNH 5LCVH 3HJZA 2X6VA 3NCWA 1M1XA 3GNNA 4GGBA 2WKGA 3KBVA 3MV8B 3UBFA 1HZYA 3MRFB 3DURA 3ZOAA 3VA6A 1GCFA 3MRLB 2R0KL 1IARB 3NCYS 4KJWC 4DJDA 4ETYA 1ZJAA 3QQXA 4JFFD 5AUMA 3VGEA 1FUYA 1PV8A 3LI0A 4J4PD 1TTPA 3PBVA 4XNMB 1K4DA 1R3QA 4E6MA 1CE1H 4A2FA 3FQTA 4LEQA 4EVNB 4UB9A 3NQIA 4X9YA 4CSPA 3QAZC 1BKSA 5KJ4A 3X1NA 1CW2A 1M9WA 4QXGH 4UOZA 1OM3L 1RQEA 4PB0L 1VRXA 3VCCA 1WH0A 2WVVA 5BV7H 2DWXA 4W1TA 4GUPA 3MRQB 4B9IA 4U3SB 2UWFA 1NZRA 4WEUD 1HE7A 4G3YH 4H26A 3TYUA 3O9WB 2PWUA 5E08L 3P4NB 3XINA 3P82A 1XZ0A 3W2DH 3S98A 3CAWA 3BHBB 4PGEB 1KPRA 3UYPA 1BWMA 3ULUL 1IT7A 3SBQA 5D32A 3BPCA 1VQTA 1XF5B 4WHDA 4K8RC 4YK4B 5HHOE 3T6VA 1F3RB 4YWIA 4MPQA 3GMMB 2Q6WA 2VRJA 1E6OL 4OKDA 1NCAH 2BIHA 4F8OA 5A2BA 1TWZA 1T2XA 2EUXA 1JDEA 1ACZA 1NQKA 3V9FA 2EE3A 3JTTA 5EZPA 2O6PA 4MG4A 3A6BH 4PGJA 4AVJA 2WZPA 4D94A 1Y8BA 1MCBA 4QY8A 4NZTL 2BDNL 3MTRA 2ZNWA 1V5JA 1BFTA 3DMMC 5JHDB 1GGTA 4AWJC 2Z1XA 1G5GA 5LGXA 3P67A 3GH4A 3MO1A 4H04A 2WNZA 3CL8A 3QS3A 4LFHG 3ARYA 1ZSXA 2MNUA 2EIZA 4XNMA 3BPOC 3U6RB 2X0UA 4XPBL 1GVIA 4WI0A 3DC8A 4PUJA 3VXSE 1W1YA 3H4XA 3JWNC 4JPVH 4ZMOA 1U92A 2CJ3A 3N44F 2O9RA 2O30A 2G4JA 2F54E 1JCNA 1R6VA 5CG7A 4LCQA 5FECB 1A5UA 4G5AA 3BCJA 5D1ZD 2KLTA 3NH7L 1HINH 3N3EA 3WJLC 5ABDE 3D3AA 4HUVA 4HYWA 4QRTB 3BQVA 1G7MA 1T6VN 3RX9A 4IGBD 5HQLA 3KLSA 4YS1A 1O5PA 2CBOA 3UZZA 5H91A 1KB9K 1UUOA 4L29B 2OKMA 1QABA 1FHLA 2VDOL 1OIOA 2DIAA 4A7UA 2QUNA 3V2AR 1X5MA 2EGZA 1NBCA 1FVDB 2NVCA 3LUTA 2FIKB 2YAQA 5IV2A 3WS3B 2H8ZA 4KWVA 2HCZX 4U31A 4X7FC 4DI8A 1NGPL 2AAAA 5F93C 3RVXD 2P52A 2A85A 2P28B 1WTLA 1A7RH 5BV7C 1HCYA 4R4BB 1U95B 5EOCL 5I1KH 2PTXA 1E4XI 3EBHA 3MJ9A 2GG1A 4ZTOH 2QQLL 6REQB 4F1ZA 3EHBD 4XNBA 4O28A 3JU2A 3AREA 3WJWA 3FOKA 4E5TA 1EQWA 5D8JL 4GIOA 1SEQL 4V28A 1SQ2N 3B8SA 3O7UA 5IFTA 2CD0A 2XG5A 3CXHJ 4FLOA 4OKVA 4Z1AA 3RPTA 4UNTA 4HLEA 4M3HA 2H2PC 1BX2A 5C9JA 1R7OA 1ZCRA 1JHTB 3KXQA 3LM7A 5A8MA 3C08L 4H26B 2GBVA 2VC6A 3V0AC 4RESB 3DIPA 4UTHA 3R0UA 2NLIA 4Q4MA 4RX0A 1U41A 1XBYA 1WTGT 3NJXA 4OZIB 4GOSA 1SUHA 4K3EH 4LU5H 3JW7A 1NCGA 1XGPA 3HG1D 2A77H 5TDPA 1UR8A 3CUXA 1TXKA 1D9KB 4RUBA 3IDUA 4AKQA 4LANA 1N6QH 4JPIB 2YRZA 1H3TA 1YJDL 4MCMA 4PJ9A 1VGAA 1L6WA 3QXDB 3BO8B 4P7LA 3IVSA 3VGBA 1UKOA 2BSTA 1FNLA 2YGOA 3BIAX 3MYJB 3FT3B 3LEVL 3RAOA 2NW3A 3NQFA 4WY7L 1Z66A 3VNYA 4REQB 2KPNA 5K1NA 3W7PA 1YN7B 1CJYA 1WFIA 1KCZA 1UXMA 3V6OA 5IIEA 3QY6A 4H1ZA 4NP7A 3NQAA 3GR8A 5DJ2B 4X9FA 2PGFA 4GO9A 2DN7A 3BWSA 2PDJA 3FO1A 1SVDA 3QYCA 4JG9A 4DJDD 4JO4L 1AR1C 4NHUB 4AC1X 2GOUA 3ZR6A 4N0UB 3BGGA 5E8EA 3K8KA 3NM1A 4ZFGL 5AB0A 1RAMA 5A3ID 1B0RB 4G9FD 2MEJB 3G5XA 3QQ9C 3ZTCC 3CUZA 3DVNA 3W7MA 1WPCA 3TYFB 2H9GB 2YEVB 4QRRA 1PKMA 2WLHA 4N2GA 1HK6A 1SN2A 4E8GA 2XZQH 2XIMA 4Q74A 3ZHKA 1S7VA 4ZUVA 3R5EA 1D5RA 3T2NH 2X4NB 5I8CA 2XIOA 4GYJA 3QFWA 2A9CA 1H9VA 2GGGA 1Q63A 3PY2A 4F66A 5AAWA 1QBBA 5KVGH 1OF2A 1P6WA 2Y6SC 1YEWA 1MWOA 3DOIA 1W5PA 3LV6A 3RGBA 2ZUYA 5IVXB 3WTTA 2PTWA 2RJGA 1NGQL 2M1KA 5H2BB 3SDAC 4FJYA 1SM3H 4IW4C 4QFUA 1Z5LA 1AQDB 1G6RB 4KKCC 2CLFA 3FX4A 4QLJA 4URIA 5KJRH 1DUYB 4XAKD 5D70H 1CDUA 3UZVA 1S5VA 2ATMA 3AWNA 1CGSL 1FRGL 3LCLA 4GMTH 1Q13A 2J6VA 5D5ME 3TF7C 3O3BA 9CGTA 2A79A 2PLTA 5ICXA 5A94A 4N2MA 5ALCL 2R23A 3T3ME 1EXUA 1BVNP 4HNCA 2AV1A 5SWZA 4PJ7F 1HI6A 1KF9B 2EDTA 3V52H 2OELA 2F7RA 5E9DB 5DZAA 1QUMA 1S9VA 2RFGA 2NSOA 2QADD 1OHZA 2INZA 4LEXH 2MKWA 1AXSB 2AGKA 5D2YA 2ATPB 1ZLWK 4U0RB 1YE4A 4K1GA 1XGQB 4ZODA 4YTQA 4W8LA 2XBDA 4MNHB 2V63A 3GWQA 5KVGL 3WJXA 3BVUA 1M3JA 2DU2A 2W4XA 3ETBJ 5E9DD 1XF4A 4NJ9H 3OLEA 4H88H 5TD4A 3GKZA 1DJHA 4MQ7B 3KPRB 3GNXA 1WZAA 2EC9U 3ESVF 4IPPA 2VIRB 3SN1A 4H5SA 4AWUA 1VBRA 2A5UA 1XZWA 5IDIA 2DEYX 2Z4GA 1QFOA 3BUYB 5LNUA 1L6XA 1J6OA 3SDOA 1F86A 3L9RB 1P1VA 2OL3L 4HVBA 1IAKA 2OT0A 2PPCA 2CDFA 4AIXA 2Q8XA 3GY1A 4OZFH 4QGCA 3ZDYE 4R0LA 5J8OA 4KWWA 1ZE3C 4U6HB 4BV1A 4DBWA 3QZEA 4R7WA 1ILUA 3ARGC 5D7LB 3WKPA 1Z5LB 4XB8A 2GSHA 2CO1A 5CEZE 5TIMA 3WJSA 2DZEA 1L6YA 3WY2A 4Q3MA 1K7FA 4QDGA 4Y1AB 1WBJA 2J8GA 2MTPA 3DX3A 3DI1A 4LESA 4UQ2B 1YNTB 4S10A 3AXLB 3WXVL 1KPRB 4GEIA 5SV3A 4P5MB 1LP6A 2XG9A 3TN5A 2A9ML 5B21A 5CSRA 2X4NA 4F7TA 5I8CB 5HDBE 3WSUA 1AD1A 3K2MC 4GW1B 5JU6A 3BEVA 1BAFL 1E70M 2PKDA 1DR9A 4N0RA 4OJFH 4MJ6A 4AEFA 4AW4A 5EBWA 1UT1A 3TZVC 1ONQA 5J1AB 2XV6B 1DJGA 5LKNA 4PJFA 2EADA 2ATSA 3LNGA 4LSBA 1KIPA 3H7BB 3X14B 3QSKB 5DMKB 3LCGA 4JANA 5FD0A 1MG3C 3FZUD 3GTHA 3V0TA 4AWEA 1BIIB 3H26A 3IN0A 3MTXA 5AYZA 2Y63A 2H8PB 1YHPA 2P5WB 1MCCA 4RGND 2AANA 5F9AC 3GW3A 4WSGA 2RQEA 3VXPB 5BVJA 2OU4A 1WAWA 3VABA 2CBMA 5DDHB 2XBTA 4F7MB 3KPLB 5JPMB 4KK8C 2DZSA 2VUNA 1RSFA 4OBRA 1XGQA 1TCMA 5CINH 4BA8A 5IR1A 3RHWK 1Q6FA 3L7FA 3W72A 2Z1PA 1H8OA 1REQA 4J40A 1UZ6E 4WJ5B 1PKYA 1SHSA 1PNCA 4KAQH 2YLLA 2WSRA 5CBAA 2GK1A 3AM8A 3VM7A 1KELH 4Y4KA 2GIMA 3MU3A 2WMHA 4D6HA 2V7HB 1KKRA 3KLKA 3SCRA 1B4KA 3D34A 2R9HC 4N02A 3IDIB 1IEAA 1IKNC 4DJEA 4YIQA 3LN5B 4K55A 5JR1L 5CR8A 4AZ8B 2OKOA 1RHFA 3NIDE 4UWMA 3QXAA 4BZ1A 2NR6C 5K9QG 1INEL 2IC2A 1UM6H 1KTBA 4L5FL 3DTXA 3PPEA 5D70L 5LBSH 3W3BA 1KR1A 3FN0H 1OYCA 1WOBA 2PF0A 4JIEA 3B8DA 3WD5L 3P4MA 4WKHA 2OEMA 3JWOC 1FGVH 2PN5A 5DA4A 3K5SA 4GO6B 4JDVA 5DURD 6FABL 2A6IB 4FHAA 4PLOB 3PL6D 5ALCH 3ZDZB 3FU6A 2X89A 1E27A 3FF8A 2A3AA 4KVCL 2MPAL 3TJHD 5EF0A 3SYPA 2I27N 4JR9L 3PLYA 4KKNA 4QLLA 2IH8A 4M8VA 3TC7A 1XZ0B 4HKBB 2Q1EA 3UETA 4L1WA 3VXSB 5J12B 3OSVA 5IBUB 3CU2A 1CE6B 1JNNH 4JQ2A 1V3MA 4DTGL 1F3JB 3C8HA 1P7KA 3MZGB 3BFOA 4U1KA 5E6SB 1FWGC 2QCNA 3ELFA 4AMCA 3FSTA 3KDNA 4U1GC 3DENA 3WFHA 3E12A 5LNSA 3V0DA 4ONFL 1AZUA 1FVDA 3GKWH 1LEGA 3UMTA 3S35H 3NDZE 2DM2A 3WLQA 4H1LG 2PU0A 1F4XH 4B3EA 3ATDA 4JG1L 4K4KA 3FO1B 4FYRA 4PJAB 4UQ3B 3U2SA 5JR1H 2VO8A 1BOGB 1IUZA 1TVHA 3RL2B 2FAUA 4NRZB 2P50A 3QZPA 3AYTA 3OJDA 4I0PB 3T4AC 4GA8A 3QORA 2OULB 5DT5A 4XPTL 3R0DA 3KHDA 5B3SB 2QHAA 2ORBL 2ZZUT 5H8DA 3N42F 3DGRA 3KTXA 3QNXB 2ZX8A 4H9YA 5JMUA 1OPGH 4IMKC 5JXAH 5JO5B 5ESAA 3ARBB 3HUJA 4AFYA 2D9QB 3MYJA 4I3SH 3CV5A 1C9WA 1IGYA 3EO1B 3TBWB 1OJXA 2TMDA 1PWLA 4LLVB 4KRTA 3DMMA 2E8ZA 3EO0B 4ZUWB 3UBXB 4PJAA 5JMRA 5FOOA 3NCJH 4KHTH 4UOW0 5HDQH 4YHOH 4BUGA 1PDYA 1U2YA 1D5IH 1KN2H 3CQPA 2NNAA 3JVFC 2Z7ZA 3EGSA 4G43A 1HKFA 2O55A 4UFKA 3W7HA 5MKGB 1HESA 2GJJA 4NZFA 1J18A 5TDPB 5L4JA 2EKGA 1VACB 3FYOA 2FCBA 4TSAH 2OB3A 4A63A 3DV4B 1QWUA 3V0VA 3QCVL 3GMOB 1X5HA 1I9IL 2XN1A 4OZHB 4YHPB 3ULVH 3EX2A 5F4WA 5FA4A 1ZBVA 5D38A 5I6OA 1RQHA 3WBYA 4N2OA 3GS6A 1NFDE 3MAWA 2ZA3A 1KM4A 3JUZA 2J1ZA 4KFPA 5AW3B 1G4MA 4PQXA 1LORA 1MRCL 2I16A 1MHHB 3EFOA 3L3OB 3PFUA 3PWLA 2JSFA 4F33B 1VADA 2QNEA 4W9DC 3LBCA 1TEFA 1ZQ5A 3INUH 4ECLA 1U8HB 3GQFA 2GSGA 3DO4A 4OZGA 2YBVA 1WFNA 2CO3A 1UUQA 3KS5A 3G5YA 3QYSA 1AD0B 5CSZA 1M6UA 3B8YA 1AQKL 4HVXA 3LB6D 3E9TA 1Y5VA 3L4TA 4C56A 2ORBH 1A5NC 4H9TA 3G1VA 4YFLI 1TTFA 4GAGH 3FO2A 3AG1B 1J2WA 4KXZI 1TZHA 3EYVA 3BLPX 3T0TA 3BWUC 4Q8PA 1ADDA 3U4AA 1D6VL 1E5YA 4NN6C 3X1EA 2GSJA 1E55A 1FLTX 1UKTA 2CLMA 3BZGA 4NASA 1QK2A 2VX6A 4MMYB 4QISA 1GPOL 4KK5D 3WE6A 2Q8BH 4NAFA 5LN4A 5D72H 3ZPDA 1VSCA 5IHUH 2HE5A 4KTYA 2CPUA 1MAML 4E2BA 3H7VA 3ULVD 1FNEA 5HHMB 4PBGA 4FMFA 2ITDB 4XQ6A 3D3VD 1QDSA 1KY7A 4KRZA 4Q58C 1MHCB 4L2YA 2JV6A 5MI0C 2V2XA 3IJEB 1A6ZB 2NQ5A 3M7OA 1UB6B 3L9RA 3HB3B 5CP7A 1ISVA 2IV9A 4MXVE 4OGYL 1R17A 4LS0A 2E74C 1OAYL 4JREB 2NY6C 2Y85A 3IFPB 1YAIA 3VFGL 1KIRB 3PWVB 5DQJA 2B0SH 1HI6B 1R3WA 4EPEC 1HF6A 1E0UA 3FSAA 3HJEA 3B37A 1B6UA 2UXTA 2WNWA 4CSTA 3IJSB 3TA9A 1VESA 3N2MA 1BZ9B 1LWHA 2LAGB 2QGDA 3IXTB 2CO6B 4KKRA 3GRWH 5J04A 4G42A 3TJXA 2WLYA 5DEGB 3NQCA 4HYVA 3GJEB 5CG0A 1KO0A 3KYKL 1Z42A 2GJ6D 4GO8A 4AKOA 2HSAA 2B7NA 3IGKA 5E9DA 2F38A 2PGRA 4L4VD 1ZA3B 3RTQD 4JGDA 1KIUB 4RDQF 1QFHA 4MZ8A 4LHUB 4OF0A 4U1JB 4J23A 1SO3A 3FU7B 1WAAF 2OCFD 5CC3A 1GXEA 4O15A 4PUEA 2HJLB 4V1DD 4X4KA 3GU9A 3EOTL 2ZXBA 1AS7A 5IHZB 1K7EA 2GVGA 4B5NA 4E38A 3M0JA 1Z3GH 4JHVA 5DO8A 3RBGA 2ZE3A 4PJHA 3MOAH 3MLYL 5ADPL 2GEQA 4L0ZA 4NO2B 1QSFA 1RUAH 4R96A 3ULAB 4MAYA 4WUUB 1RLWA 2R0WL 4L8SB 4NQDE 4Z7VF 5DMYA 5DC4B 2PEVA 3Q6FB 4D8PB 4MTVA 5CJQH 2Y88A 1G9MC 4M7LL 1QFWL 3BJFA 5K1VA 5CUSH 4PV8A 3DX9A 4J27A 3ERXA 3MI2A 2GUOA 4XCCH 1FZMA 1ONXA 4KCWA 3RUBL 3X2QB 3AMDA 5CZVH 5I28A 4M93B 1U3HB 1TQCC 3O6FC 4Z0XB 3MTWA 3AS3A 1FTXA 1SFSA 1RZ8A 4TSAL 4OTXL 1BWWA 3II2A 4GAYA 5EBLA 5IIEB 1JXKA 4OZIF 1D8CA 3MDUA 3TZNA 1IQDA 2I5YH 2DIEA 5EMJA 4Z8FL 1IFHL 4ZMWA 3I6LE 2R82A 3N2CA 4LYQA 2JK5A 2FB3A 5D7IA 3VACA 1FWAC 4PUNA 2ZKMX 4KI1A 5LDSA 4FG2A 3FDKA 5A6AA 5B3JF 4XMPL 2ZCLH 2ZTBA 3O45A 3F03K 4NZCA 5CHNA 1A2YB 2A83B 4I18C 5D5MF 5DJYA 4EI6A 3GPSA 4LPCA 3MLYH 1IT8A 1IWAA 2N0KA 4HZLA 1QAWA 3NIFB 1ZWIB 4FXKC 1XICA 2WHMA 3TKFA 2YSTA 4RISL 3CQ0A 2CGRL 1KNOB 1CLKA 4MZRA 4ZW6A 3BAIA 4EWND 3WEAA 1UPMB 4UM9A 1TKWA 3WH8A 1U8CB 2E76C 3TBYA 5DCDA 3W85A 3WDRA 3QG7L 1GJWA 2JI1A 3RWJB 3KPQB 4JFZL 5TJWK 4HNUA 5BWFA 2Y0FA 3N9RA 1NDYA 4M6OH 1AZRA 4LCYB 3I6RA 2B7OA 4MAYB 3QR3A 1RUKL 3CWNA 1JQVA 3OJGA 3LSOA 1KCVH 1ZE3H 4PBEA 3BE1L 4RLIA 4GMSH 3CX2A 4K71C 3CHSA 2CE6A 3EBAA 3FFCA 4GZ7A 2DW6A 3IK2A 5E8NB 3QHFL 4B53A 4JQ4A 1GHRA 3TNBA 4GRWH 5BUGA 2PDFA 3RJYA 3UZEA 5B3JE 4Z7VA 1TIWA 4RWYL 4GNVA 1H0IA 1MEHA 2X9WA 2AAVA 4YGAB 3HQOA 4HMCA 4D0CB 4ZFQA 5FAJA 4BKTC 3ARDD 2XUWA 2O5ZH 4JTFA 3EGXB 5EORL 4ZFMA 4JHZA 5CR1A 4GPNA 5T91A 4HU2A 1QSEA 4N24A 1LM1A 4G1MA 2V5BA 3DOSB 3P3UA 5B1JA 2W63A 2ADFL 4OZIE 4R7JA 4WKXA 2EDRA 2Y9RT 2H2SD 4AEHH 2QDHA 3W24A 4Q2ZB 1OD9A 5DT1L 3CU1A 1I3UA 1HEZA 1U93A 1HU8A 5I5IA 4ZQKA 5I3IA 4N3TA 1U6AH 3R06B 3TYDA 3SGEH 4IBZA 2CZ5A 4L4MA 5DT7A 2I07A 3RU8L 3HPJB 3MJWA 3MRNA 4LGPB 2GJZB 4OD3H 4C4KO 3OEXA 5CEWA 2APWA 5I15H 2LFEA 3FQRB 2PYFA 4XZWA 1V3HA 1POJA 4A7GF 4OF3A 4LOUD 4B3LA 4GMSL 1N64L 1FO0B 1FORL 1IL1B 1JPEA 2MOQA 5GRWA 1SVCP 1OD8A 3VXGA 4FQCL 4Z1YA 1G4RA 3DK0A 3KYOA 3OC5A 2FYMA 3PJWA 2BP0A 2VR4A 5FJRA 1N2RB 3PV7A 1NUDA 1AI1L 2J2ZA 4QHKJ 5EZJB 3V36A 2P48B 4N28A 4AK2A 3VOJA 2CHZA 1HSAA 1NARA 1RPUA 4NEHB 2A1WH 3T4CA 1OALA 3L2NA 3HRZC 2DQGL 1RJCA 1AI1H 4GRLC 5CMAB 3SE8L 3ZSTA 1VRDA 3S46A 5DD3L 2NXYC 4GQBA 1A5KC 2GVJA 3LXCA 3D0VA 2VEKA 4JLRB 5T1JA 5I19H 3D87B 2X1OA 4XSLA 4JFYA 4N90D 2XISA 4MZYA 4ZS6C 4A6YB 4XVTL 1ZA6B 5A6LA 4FEZA 1WIPA 5GRYA 1DN0A 3T9PA 1WGVA 4R3UA 4FP1A 3OJVC 3TO4B 1CF8L 1EEQA 4NWTL 3H53A 5MEQB 1UZ4A 1IXNA 2B14A 1C8YA 4NY2A 5AB2A 1EBGA 1TYEB 2FT7A 2I85A 3C09B 4XBMA 2E7CA 4Y16A 4U1SA 5E1AB 1MCOH 3PF2A 3WIHL 4ZDHB 1KJVA 4Y4HB 4ADSA 4ALAC 4XN7A 1XLDA 5LNEA 4FFYA 1E6JL 1WFTA 4HEPG 4PY8J 3R94A 3RR4A 5EU5B 1ERNA 1I3GL 1TZ7A 2MOVA 3WN5B