1W8SA

The mechanism of the schiff base forming fructose-1,6-bisphosphate aldolase: structural analysis of reaction intermediates
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
250
structure length
250
Chain Sequence
b'NLTEKFLRIFARRGKSIILAYDHGIEHGPADFMDNPDSADPEYILRLARDAGFDGVVFQRGIAEKYYDGSVPLILKLNGKTTLYNGEPVSVANCSVEEAVSLGASAVGYTIYPGSGFEWKMFEELARIKRDAVKFDLPLVVESFPRGGKVVNETAPEIVAYAARIALELGADAMKIKYTGDPKTFSWAVKVAGKVPVLMSGGPKTKTEEDFLKQVEGVLEAGALGIAVGRNVWQRRDALKFARALAELVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FRUCTOSE-BISPHOSPHATE ALDOLASE CLASS I
publication title Mechanism of the Schiff base forming fructose-1,6-bisphosphate aldolase: structural analysis of reaction intermediates.
pubmed doi rcsb
source organism Thermoproteus tenax
molecule tags Lyase
total genus 94
structure length 250
sequence length 250
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2004-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1w8sA00
3STEA 2Y6ZA 2Y62A 4O1BA 2FTPA 5D02A 2NX9A 4CCCA 2LLEA 4AEOA 1BKSA 2FLIA 3G0XA 5J5DA 1VRDA 1YYAA 3HG3A 3QJAA 4O53A 3CEUA 3W2KA 4PH6A 4EF8A 3SY5A 3P5ZA 1DJQA 2WNNA 2ZDRA 5AN7A 3TQVA 3F4NA 2YFOA 4JTTA 3W7CA 1SW3A 3M16A 1GVOA 1AL8A 4ZQCA 1UASA 1EB3A 1I45A 5D2WA 1VS1A 3W1AA 3TQKA 3HPXA 2JKPA 4I9AA 2G96A 1FDYA 3M6YA 4FNUA 1QNVA 1V5XA 1GZGA 3NQ6A 2E09A 1F05A 3S6DA 1AK5A 4Q33A 3KX6A 4QNWA 5G2HA 4JICA 3L9CA 1P1XA 5AHNA 3LCGA 3LHYA 3S1UA 3STCA 4MIMA 3LI1A 3RFAA 4MYAA 1V7YA 2JGQA 2J6XA 4Q32A 1LCOA 1RPXA 1SZNA 2E6FA 1GVFA 4YL2A 3M5XA 2EKCA 5DN1A 4OQVA 5KITA 4QNEA 4JYEA 5HMSA 2WSYA 4IJBA 5DELA 1ICPA 4OHQA 3LTYA 2J88A 3DHDA 3C52A 4GE8A 3C2OA 4CNOA 5LNVA 2AQWA 1YLVA 3R12A 2HS8A 2Y7EA 2IQTA 3NQVA 2A1YA 1QFEA 4JEQA 2VEIA 4S1FA 5F4WA 3R2GA 3MBFA 2ZA2A 1P4CA 1W3IA 1LOLA 2ZFAA 3NPUA 3IGUA 3G8RA 5K7JA 3W86A 3CHVA 2A7NA 3L5LA 1TV7A 3INPA 4TR9A 3HPSA 4UFMA 4WJEA 3PS7A 3QPYA 4Y8FA 3WK3A 4CLMA 5HR7A 1YXYA 4WOQA 4X3ZA 4O54A 3HJZA 3W7EA 2VELA 5TBOA 2VFIA 4GJ1A 1AW1A 3P84A 4FIQA 2GPTA 1DORA 4ICNA 1I2NA 4LVFA 3KXQA 3DFSA 4H4IA 2FFCA 4JS3A 3IIXA 2ISSA 3E02A 3L0NA 2ALDA 4O1CA 3T44A 3KOFA 4L4LA 1LLWA 1QO5A 3RMJA 2XN1A 4M6QA 3OVRA 2R94A 1FCBA 1P0KA 5D03A 2YDAA 1KBJA 3HGSA 3KAOA 1ZFJA 2RHGA 4Z1BA 3EXRA 4ORMA 4A21A 1OFBA 2I9EA 1VR6A 1ZCOA 3TIMA 3TV8A 3CPRA 4BI7A 3GXNA 2QUTA 3LHVA 1JULA 1JUEA 3T55A 1DOSA 4LWWA 3W07A 1VHNA 2H8ZA 1GOXA 3M5VA 2ZRWA 4Y96A 4BI6A 3QMSA 1Z44A 3KVKA 3GK0A 4N4PA 3C61A 3M5ZA 3NPWA 1TQXA 3PVFA 1GTHA 5AYZA 2QCHA 3W7DA 3M9YA 1WDWA 1KV5A 5AOUA 2B7NA 4K7VA 1GG1A 2CLFA 2J9YA 3W88A 3NQ2A 4IPJA 4R34A 3L0GA 2QJHA 3TJLA 3S1VA 2Y88A 4GUIA 2VC6A 2BLEA 2YFNA 2YXGA 5KZEA 2NXIA 2H90A 1FBAA 3GVGA 5K4XA 4MY9A 3OIXA 1GWJA 4JNMA 4Z1CA 3P67A 4O50A 1IXNA 4LS0A 4H6KA 2RH9A 4MVAA 3UWZA 1SPQA 3V1PA 3PUOA 4DELA 4LUJA 1W5PA 3QZEA 2FDSA 2C18A 1K8ZA 3IIPA 4AWTA 1I2OA 1UB3A 3KRSA 4IMCA 3TX9A 2HSAA 4WY0F 3ATYA 2FPVA 3NQDA 1TPUA 1C29A 4Y90A 3R13A 3W7RA 1B3OA 3B04A 1FY6A 3PB2A 4LVBA 2QDGA 4E38A 4FNQA 3W1LA 2A7RA 4WXZA 1VCGA 4UUIA 1S3HA 2WO5A 4CNNA 1DJNA 2XN0A 8TIMA 3NL6A 5KMYA 3CT7A 4CCDA 5F4XA 3WK1A 4PCFA 3RLVA 3RF9A 3A21A 3JRKA 3Q37A 4R53A 1PHQA 4JTGA 4HNUA 3DFQA 2VFDA 3GKAA 4NT0A 3EX6A 1YDNA 2E77A 2Z1BA 2P10A 1TPB1 3O16A 4LRTA 3UY8A 3RLUA 2V0TA 3ZWSA 3PBUA 4RX0A 4DO6A 5BOOA 2NUWA 2V2CA 1KTBA 3KVMA 1OFRA 3WK0A 2FQIA 3P7YA 2WNQA 1W54A 4QJ1A 1F76A 4NNCA 1KTCA 4O1DA 4NXSA 3BVJA 3EX4A 4GXMA 2B7QA 3LV5A 4PFMA 3OG3A 4ZQNA 3G1XA 3QW3A 2AAMA 3N19B 3W76A 4MZYA 4RR4A 2ZBTA 3G0UA 3I7RA 3TFXA 2J9XA 3G22A 2TSYA 1HL2A 4MUZA 5LNSA 1KM5A 1CW2A 2WSQA 4JTEA 3NL5A 5LNWA 4L4MA 3W7PA 3TFCA 1WYIA 1EP3A 5E1QA 3MI2A 4IMGA 2A2IA 3HGOA 4Z1DA 5D37A 3MO7A 3NOEA 3DKJA 1SO3A 1E51A 1K03A 1OFDA 5G2WA 3BPWA 3BG5A 3LM7A 1W8SA 2JKAA 3TSBA 1OG0A 3BW4A 4K8HA 1KLYA 3W1XA 1RR2A 2DZUA 2X1TA 3MMTA 1VLWA 5FF2A 4JX4A 1VCFA 3NM1A 1OX4A 1OYAA 4KFOA 3W1UA 2CLHA 2D73A 1GJPA 3BW2A 3G18A 1XUZA 1Z48A 3ZR4A 3UWUA 4NXKA 4HPJA 4WY0A 1YPIA 3B8DA 1VHCA 3QH2A 5LSMA 2BSLA 1FCVA 4NNAA 4UTIA 3IIOA 5F2IA 1ICQA 1JQXA 3HG2A 4JTSA 1RV8A 4N2YA 3HOJA 1WBHA 4K8EA 3IVUA 4JY8A 2ZZ4A 4I7UA 4E0CA 4Y6GA 3LHTA 1A5BA 3H55A 4DQWA 3ATZA 1VQTA 4ZQMA 3GNDA 3NVTA 1LDCA 1IIHA 2CLLA 3UZ5A 3W72A 3LERA 4O4WA 2C19A 2V81A 2XFWA 1PL9A 3FIGA 5HWNA 4ZL1A 4XBKA 4FNPA 1FDJA 1H5YA 3HF3A 3QSRA 5K2ZA 5HWMA 1OFAA 2W6RA 4FXRA 1LRQA 1FWNA 3N73A 2Z6JA 3THQA 1N55A 1PHWA 1KM2A 5HQEA 2TPSA 3M47A 3O07A 4DEFA 2YYTA 2ISWA 1H60A 3KRZA 3MI6A 4IUOA 1KFEA 3TW6A 3G24A 1T99A 3GKFA 3W23A 4HNVA 4UTWC 1O60A 5CZJA 1FXPA 4WZHA 5G4WA 2YSWA 4TU1A 2ABBA 4XWUA 1GVQA 1OX6A 4KWVA 3P61A 3P74A 3E0IA 3DFNA 1XBZA 3VE7A 1KM4A 1FDZA 3QQ1A 4JD4A 2GOUA 2TYSA 1SZGA 2V30A 4IPIA 4XKYB 1L2UA 3ELFA 4RXFA 3E96A 3MWAA 4UC5A 1NF0A 5FEPA 1MEWA 3W1PA 4XUGA 1KLZA 4UTLA 5G1TA 1A5CA 4OGZA 4O14A 2CZ5A 1WAUA 3HO8A 4JX5A 3CC1A 2CW6A 1TPVA 3S5OA 1PIIA 1I4NA 4LVDA 3E49A 3W1MA 2ZZ6A 1EIXA 2C16A 3FOKA 2X30A 3JS3A 2VEKA 3BW3A 3ABSA 3U2OA 5LHEA 1DVJA 4LVGA 4O15A 1SO5A 5AHLA 1QDSA 1XXXA 4JDYA 5AHFA 3DGRA 3QM3A 3UQNA 2R91A 2JK2A 2EAWA 3VKJA 1KFJA 4X9SA 5ABTA 2O7QA 3E12A 3N2MA 3W2NA 1MSSA 1KFCA 2RDUA 3MP4A 3Q58A 4JTIA 1OABA 3UXDA 5F2MA 5F2LA 2WJZA 4JTHA 4NX0A 5EL1A 4MY8A 2CWNA 5BNKA 2OX1A 3EX1A 5HUPA 3B4UA 4A3UA 1QPQA 1JCYA 4UMBA 2GVLA 5KZMA 3EKLA 1XBYA 2ZYFA 4UFJA 2DJLA 5C6MA 4JN6A 4N9BA 1W5OA 1M5WA 3TH6A 2E5DA 3B0PA 1H1YA 4O12A 2OT1A 3A5FA 3NDOA 3TUUA 3TXZA 2OMAA 1W5NA 5G5IA 2A6NA 3QEZA 3BLEA 3WJYA 3RU6A 2CFFA 4UTMA 2G95A 4ORIA 3KVLA 1OFPA 3LCHA 1HUVA 3DZ1A 3NYZA 3M43A 3CIXA 3BLFA 4LV9A 2RDTA 3TMLA 5LGZA 1MXSA 3PR2A 2WV8A 2H8XA 1QMLA 4ADSA 2EGZA 4HN4A 1L6YA 4A29A 3HGRA 4LV4A 4OE7A 4PL1A 1K7XA 3HBLA 4ZMGA 1SW7A 3DFPA 2ZA1A 1ALDA 1H51A 1KFKA 3DXIA 3QRHA 1SUXA 4WD0A 1SZEA 1EUNA 4UTUA 3VE9A 4HKPA 1N7KA 3NNTA 3P81A 1TPWA 1G7UA 2FB2A 3MYPA 3U6WA 4DPPA 3S5NA 4BWLA 1EX5A 2PRHA 1A53A 3BK0A 4KWWA 5CSRA 3GNNA 3TSMA 4AVFA 3CIWA 3OHIA 1Q6OA 1R30A 2A7PA 3KFTA 3C2EA 1ME7A 1D9EA 4LRSA 1G6CA 1TJPA 1TMHA 3ABQA 3EWBX 1I2QA 5DY2A 4QAIA 5D04C 1EP1A 4I7VA 2CLOA 3L2IA 3FYOA 3IGSA 3S9YA 2V5BA 4LTSA 1IXOA 3BV4A 2NWSA 2ZRUA 1AW5A 3DH7A 3FS2A 4K38A 3RK8A 3UPBA 1GYLA 1GVSA 5AFDA 1JCLA 1Q6LA 2C15A 5CPLA 4LNYA 3A9IA 4IWWA 3BGGA 2YPIA 2PE4A 3TQ0A 1H63A 1DHPA 3L0KA 4S2CA 4NQ1A 3MYOA 3W7NA 3UZJA 4QISA 1QOPA 4FX7A 4UTTA 1UBSA 4XKYA 3GR8A 3W1RA 2GQAA 3MI3A 2QJIA 3LDVA 3PSWA 3W83A 4EOUA 1OFEA 1FWWA 4XZ9A 1OK6A 5C5YA 2I1OA 3UWVA 5I3JA 1H61A 5G4EA 1QPNA 1W31A 4RZ4A 1P0NA 4U28A 3P8JA 1EWEA 3EWXA 5AC7A 4FF7A 3MHGA 4AHPA 1OJXA 1A5SA 3NAVA 4ALDA 2HTMA 1G4SA 3W84A 3F03K 1VZWA 4B5NA 1G69A 3GDLA 1JQVA 3LCFA 3W2MA 3OVPA 5G2IA 3L65A 3SIZA 1K7EA 2QCDA 3W70A 2PCQA 4IMFA 4RKAA 3T40A 3TXVA 5DY3A 4RZ5A 3SW6A 3PULA 3S8HA 4WXYA 3L5AA 2V9DA 3PG8A 4C1LA 3W7MA 3O6DA 5DXXA 4AXKA 2ZZ5A 4O1AA 1PVNA 5EBUA 4K6AA 2NXGA 3QSTA 3STGA 3W2JA 4IXHA 1LLZA 3LXAA 1XM3A 3L66A 3LBCA 2GVJA 2QR6A 2DZPA 1B4EA 1TIMA 3WJSA 1J4EA 3NGJA 3VFLA 3PBVA 1TRIA 3C2FA 5F2GA 4DBEA 2NUYA 2QCEA 5U7SA 4O0KA 2QCCA 4KKXA 2E68A 2VENA 3EWZA 1W37A 1WV2A 4TIMA 2F84A 3GB6A 3IRDA 2QCGA 4K39A 3M41A 2DZSA 3I65A 1YXCA 4PL2A 2JGYA 2DJXA 3LGEA 3EX2A 3OVQA 4HSOA 2ZTKA 3ANYA 3G1HA 3TE9A 1QO2A 1G4TA 1NSJA 1MEIA 2Y61A 2ZZ3A 5AB3A 4MJMA 5MHBA 3DU0A 1S5VA 2B7OA 2YYUA 4HT3A 4ONVA 4JGDA 2BTMA 5AC8A 4NU7A 3EXSA 3DBPA 3C8FA 1BEUA 1EWDA 1X8FA 1ZAHA 5A8GA 3IIVA 1SU5A 4HSNA 4O4VA 4WUIA 3NG3A 1G4EA 5HUOA 1KTNA 1S5WA 1M6JA 5AHIA 5FF3A 3C3NA 4EVZA 1AMKA 1CI1A 3DAQA 4JTUA 3NPVA 1FCQA 1KM3A 4MKNA 3N9RA 4PA8A 2YR1A 2TMDA 2QDHA 4IMEA 5D30A 4P2VA 2WSRA 2VOMA 3BG3A 3K30A 3D0CA 2QKFA 1NEYA 4JIQA 3DKLA 1XBXA 2ZRZA 1JR1A 1HG3A 2QCMA 3IVTA 3LHZA 1O94A 3FKRA 4LS1A 3P8IA 3CM4A 1YTKA 5AHEA 3HG4A 1LM1A 1B9BA 1LYXA 3LXCA 1H7NA 1XBVA 3W73A 1PCWA 4NJJA 3NM3A 2ZZ2A 3LRLA 4KFNA 5I3HA 6ALDA 3LTSA 4HNTA 3GDMA 1TCDA 4FIRA 4UTHA 1CX9A 3BGJA 3QPZA 2NX3A 3BO9A 3EB2A 3W7HA 4NX5A 3NXFA 1FUYA 1H50A 1W0MA 1ICSA 3PC0A 1FX6A 3KVJA 4Z0JA 1PCKA 5F1VA 2Y7GA 4O19A 4GUJA 3GX9A 3NQ7A 5TIMA 5LHFA 1WXJA 3EWYA 4LS2A 3LXBA 3FJ6A 2E6DA 3STFA 3W1TA 1XC4A 1IXPA 5EMUA 2P0OA 3GZ3A 4XQ6A 4O18A 4WX2A 1OF8A 4ZVJA 1PE1A 1MO0A 3MW7A 3HB9A 1OHLA 1M7OA 5FEWA 4NVTA 1AG1O 4JTJA 3FKKA 4BR1A 3TDFA 6TIMA 3S5YA 4ZQRA 1UUMA 4K7YA 1HO1A 3TK7A 4IGHA 3GLCA 5HINA 4Z1AA 1TTIA 1X1ZA 4Z08A 3EX3A 1R2SA 3UNDA 3QFEA 4NUWA 4QSHA 4YCOA 1T8XA 1DQXA 1VLIA 2DZVA 4JX6A 1EP2A 3CTLA 3WJWA 4MYXA 4FX8A 4YLWA 2NZLA 3NA8A 3N34A 3W71A 2QCNA 3PF3A 1OYBA 2WOQA 1R46A 3NZ1A 4AF0B 2YCEA 3N14A 3SFKA 4TMCA 2Y70A 1JVNA 1YXDA 2I14A 1VC4A 3M1ZA 1SQ7A 2JKEA 3DI1A 4J9JA 4JYDA 5FF7A 4ADUA 4PODA 1QCWA 3TC6A 3BLIA 3G1AA 3QQ0A 1XFBA 3NQ8A 5FEZA 3GIYA 4O11A 4TMBA 5K9XA 3Q94A 1W1ZA 5DBTA 4UCGA 4MPQA 4W9TA 3NQCA 3O06A 3W7QA 4JDBA 4ZQOA 1UCWA 3TSDA 2PURA 2WNZA 4UTWA 1H7OA 1TPDA 4O10A 1QAPA 3HGJA 3SGZA 5DCBA 4JIPA 1ONRA 3O63A 2VFEA 4NJGA 1AL7A 3G1DA 3GYEA 4NZFA 3P5YA 1X6UA 5DBUA 1O5KA 5D2VA 2QCFA 3MUXA 1O95A 5KSWA 1Q3NA 1HFBA 2EHHA 4MLJA 4WQ6A 2CZFA 3UXAA 4JYFA 4WOZA 1D3GA 4OT7A 5AC6A 2VEPA 1T96A 2CLMA 4N4QA 2CLKA 5D32A 2C6QA 3LX9A 2NX1A 3SJ3A 3PY2A 4JTLA 4NJHA 3P82A 1LP6A 2YW3A 1VYPX 4CNPA 1L6SA 4O8RA 3LBMA 3UD6A 3V75A 3N2XA 3QF0A 2NXHA 4N02A 2VXNA 5LZLA 3DENA 3LB0A 2V5LA 1RQBA 1LRTA 4UMCA 4N6EA 3FLUA 3TA6A 2ZRXA 1H62A 3CWNA 2BWGA 4HHPA 4POCA 1NF7A 2EPHA 2ATMA 2Y85A 3A5VA 3W9ZA 5KINA 3LHWA 1F2JA 3HMJG 3TR2A 2ZA3A 1GVRA 4I7WA 4CCEA 1TSIA 2FPTA 5F4SA 2QJGA 3DFTA 4M6VA 1LBMA 3GDTA 4UFIA 4AHOA 4IX0A 5HR6A 4QITA 3IGXA 4NJKA 3W3OA 2F7FA 4NZJA 5DLCA 1BWKA 3B06A 3MBDA 5IBXC 3ZWTA 3T78A 1ME8A 3M5YA 4DBDA 2VKZG 3W7IA 1W3TA 5EY5A 1GG0A 3FYPA 2BX7A 3B03A 1FWSA 1LBFA 4GNJA 3NQAA 3ABOA 4A22A 2X1RA 1KW1A 3NL2A 2EF9A 3O15A 1C9DA 1KM6A 2ABAA 1H7WA 2OCZA 1KFLA 3VCRA 3GR7A 4RCXA 4EWND 4EIVA 3W87A 1W56A 2ZTJA 2H3BA 4KFPA 3TC7A 3CLMA 2V82A 2GJLA 3CEPA 1GPWA 4JXCA 1VPXA 1YADA 5I3KA 4O28A 3GXTA 3IV3A 3C4UA 2VFFA 5C2XA 4UMAA 4UFHA 2VFGA 3UYCA 1WX0A 2X2GA 4IQLA 3G3DA 4AF0A 2C13A 5U4NA 1M7PA 2NV2A 3TMQA 4GBUA 2OT0A 4E2DA 2GQ9A 1THFD 5FI8A 4AWSA 5GVJA 5DCDA 1MZHA 1KA9F 2PRLA 3G0SA 1IXQA 5FESA 1W5QA 1RD5A 3PSVA 2RDWA 3USBA 2Y63A 5LNRA 2Y7FA 5DXYA 1XDLA 3I6RA 1N8FA 3NPXA 2HS6A 2ZZ7A 3S0CA 3W7LA 5AHMA 1LRNA 4XTDA 2A6LA 1KFBA 3OA3A 3W22A 3WFAA 1QPOA 1SSGA 5FF4A 2A0NA 2Y89A 1QR7A 1SO4A 4H3DA 3FA5A 4N9DA 3CWOX 5D2YA 1G67A 4HNNA 2Y7DA 3G3MA 3WJZA 4U4MA 1ZHAA 3FFSA 4RK8A 4ML9A 5CGQA 3SSJA 1DV7A 1ZY9A 5KZDA 5E0KA 3O6CA 2W79A 3I7QA 3O6YX 3TNOA 1OYCA 5HWJA 3MJYA 4AMAA 1XI3A 4M6PA 4Q4KA 3C2VA 3F4WA 2Q8ZA 1SSDA 2B0MA 4DO5A 3LTPA 3W1QA 2DORA 5D09A 1F6PA 1F73A 2GQ8A 1TJRA 2VEMA 1TTPA 2E6YA 4FEZA 3O1NA 3TW7A 2V2DA 3Q2DA 4FNSA 3W85A 2B7PA 5I3IA 4IMDA 4LW7A 2ATSA 2H6RA 1JRCA 4MY1A 3P62A 3HPZA 3TKFA 3LCLA 3T7VA 1RVGA 3CQ0A 4OV9A 4RJEA 3W7JA 3R5EA 4UNLA 1ADOA 1ZALA 1SO6A 4BWLC 1RQHA 1TREA 3ABRA 1JCMP 4DPQA 1ZENA 5G1YA 3TROA 2RFGA 2Z6IA 3EWUA 5BMXA 3LHUA 4GUFA 3N3MA 2ZRVA 1BWLA 1EPXA 1GTEA 3VNDA 5I3GA 3GDRA 5K3VA 4UTKA 4GRSA 2DU2A 1Q45A 1TTQA 4AHQA 1VYRA 3B0VC 4AWUA 3CB8A 4OWGA 4UFKA 4QQ3A 1F5ZA 2DP3A 3LLDA 1TPEA 2NUXA 2ZCGA 3PBWA 1NVMA 1GQNA 1F6KA 3W2UA 4A2SA 5LKYA 4M7SA 3W7OA 4GC4A 1J2WA 4RZ6A 2P1FA 1L6WA 2BZNA 4OU1A 2DZTA 5K9DA 3BG9A 3HIJA 1O4UA 4E2BA 1Q6QA 3IEBA 1H7RA 2A5HA 3LRKA 1F7BA 1WBJA 2R14A 2E5CA 4BFAA 1IF2A 1K8XA 4UTTC 4FB7A 2AGKA 1TB3A 4MFEA 4GFSA 5SWUA 1YTDA 5T26A 2Z0IA 3W7KA 1FWTA 3NQFA 3P80A 4MJZA 3A24A 3M0ZA 1YDOA 1T0OA 2KZHA 3S42A 4LOCA 4PC8A 3EKZA 1KM0A 3LOTA 4FHAA 4X2RA 3LCWA 3A22A 2Q3OA 3S1XA 2NWRA 3H54A 3LV6A 3ZS4A 5EKYA 5BRBA 3QYQA 1OX4B 1QPRA 5IM51 3PWAA 4LY8A 1WOBA 1ZJIA 2QAFA 4WY0B 5CSSA 2QF7A 3G1FA 1Q6RA 1X7FA 3MHFA 1QWGA 2UV8G 1EUAA 3AJXA 1HO4A 2YGYA 2YZRA 2CU0A 4DF2A 4PEKA 2YX0A 3W74A 4FNRA 3W7GA 1OVDA 1ME9A 3W1NA 1A5AA 1JJKA 1SR9A 1LBLA 3C0JA 3NQMA 2C0AA 2J9ZA 4EF9A 3T4CA 4M5PA 4AH7A 5CKSA 1LOQA 1F74A 2ZZ1A 4P61A 3LLFA 4N6FA 2C14A 2DZXA 5HULA 3PG9A 1K8YA 4ADTA 1L9WA 3UY7A 1OX5A 4LC6A 3THAA 5EYWA 4RLIA 1FXQA 1R2TA 2NLIA 1I2RA 1FCUA 1O5XA 5CZ0A 3RNDA 3QMRA 5LNUA 1WOAA 2ZQ0A 2VFHA 3KHJA 3UPWA 1JCJA 7TIMA 5C55A 2C1HA 1Z41A 1XKYA 3DHFA 1G4PA 5TQLA 1ZAJA 1VH7A 2E1DA 3CU2A 3YPIA 1UUOA 2X1UA 1FWRA 5HJLA 3R8RA 1DBTA 2FPYA 4YXGA 5CG7A 1TYGA 4S2BA 1VYSX 3IVSA 1GYNA 4R7JA 3IIZA 2E6AA 3E9AA 3L68A 4YWIA 1EA0A 3B0UX 4UIOA 4IXXA 1QOQA 3SZ8A 1YPFA 1EEPA 3PUEA 1JCNA 3NO5A 1SFLA 2DZWA 4IX2A 3TCEA 3G1VA 4D2JA 1LOSA 1NFBA 2Q8LA 3WK2A 3NEVA 3R89A 3NZRA 3I68A 1KV8A 2R8WA 3PUDA 1UJPA 1ML1A 3EXTA 4JR5A 3I7SA 5AYYA 3UWWA 4YCPA 2HMCA 1OF6A 3OEXA 5CZSA 4FO4A 2RKXA 3O8AA 3LRMA 4O57A 5D05A 4O0ZA 4LVAA 4X22A 1AW2A 4UNKA 3GAKA 2A85A 2CLIA 2YW4A 4MZ8A 4M7TA 1TQJA 3M7WA 1YDVA 5HNRA 1P5BA 4O16A 3LI0A 3NR0A 4Y9AA 3UWQA 3AO0A 5D38A 4O52A 2ZRYA 1TTJA 5KTLA 4AB4A 4MFDA 5E93A 3MHUA 4MLRA 5LGXA 4UR8A 1TRDA 1H1ZA 4A2RA 3QC3A 2QCLA 1KBIA 1OFOA 4PTNA 4UTJA 5FEXA 3PM6A 4YMZA 3EWWA 1OFQA 1D3HA 1ZNNA 3TAOA 4CQ8A 1TV5A 3A23A 4UR7A 4DO4A 4O17A 3TJXA 1K7FA 1XUUA 1K3UA 4IOTA 1FQ0A 3PAJA 2WQPA 4OBTA 5K4ZA 1MEHA 4TO8A 3GXPA 1R47A 1X1OA 3C6CA 4LU0A 1PV8A 4XTIA 3HQ1A 1TPFA 3OBKA 2B4GA 4RV8A 3N9SA 1VCVA 3KRUA 4JTFA 3NQEA 1TPC1 1JUBA 4K36A 5CPOA 3W75A 3S5ZA 1XDMA 1VGAA 1Y0EA 2QAPA 2WPBA 4N9EA 4DXVA 2C3ZA 4FX6M 1B4KA 3SI9A 4HPXA 4K37A 3PBYA 2QUVA 3DI0A 1S5TA 5L9FA 3C2RA 1LTDA 4LUIA 4LC8A 3GAYA 1XCFA 1LZOA 4OV4A 4GUGA 5FF0A 3PB0A 3WJXA 2PC4A 1G7VA 1LORA 2A21A 4MOZA 1C8VA 1DQWA 3F1QA 3TAKA 1RQEA 3W2LA 4JY9A 1TPH1 5K9CA 1J5TA 3U8GA 1W3NA 2CZEA 5A5WA 2JBMA 3UWYA 4NNBA 2NV1A 3BARA 1I2PA 1SFJA 3M44A 2W0UA 3NL3A 4FNTA 5CZTA 1B57A 1A50A 2H3DA 1R2RA 4GWEA 3G1YA 1DKWA 5F1UA 2PRMA 1KM1A 1H7XA 3HG5A 3C56A 2O7SA 2J27A 1JRBA 2QEZA 4UFLA 1TV8A 1K02A 1LROA 3TU9A 1VJIA 2Q3RA 1GT8A 4QIUA 2J24A 4GUHA 4MZ1A 4UXDA 1JCXA 4RXGA 2G5WA 1YTEA 3NQGA 4DF1A 4LT9A 4CQ9A 1W5MA 4R33A 1GEQA 1Z42A 1IGSA 3QW4B 5J5RA 5IBXA 5D33A 3GDKA 1JUKA 4NJIA 1WQ5A 4CQAA 5EPDA 2FB3A 3FJLA 5I3FA 3QMTA 2V2HA 3MP3A 1NAL1 1BTMA 2CLEA 2GVGA 2GJNA 2V8ZA 5CPMA 2Z2UA 3LCXA 5C54A 2OJPA 5D2XA 2GUUA 3FEMA 3EEGA 2FJKA 4O13A 3L21A 3MP5A 3DFOA 2ISVA 3L67A 5CPNA 4AAJA 3L5MA 3W6YA 1U5JA 5EA9A 2A4AA 2QUUA 3P60A 1WA3A 1TO3A 3H53A 5AYXA 2WKJA 3G1SA 1OK4A 2E5BA 1DL3A 5H91A 4JTKA 3VI2A 5BW6A 2BXVA 1SZFA 4BF9A 4M19A 5H2ZA 1ZAIA 3G8EA 3LCIA 4DF0A 4G1KA 3O05A 3SECA 2CZDA 5L6UA 4HIBA 5DCEA 2FIQA 4BI5A 1XL9A 1HTIA 4TX9A 1H7PA 4ZZ9A 2QCDB 4N9CA 2TRSA 3JR2A 5BMWA 5D2TA 4ZQPA 4XBSA 2X1SA 4Z0SA 4BK9A 2OZ0A 1IIGA 4C1KA 2X16A 4QM1A 3B05A 3S1WA 2XN2A 3ZFHA 1SW0A 1I8JA 4FXSA 1PS9A 1RZMA 1U83A 3SR7A 3SGUA 2G97A
chains in the Genus database with same CATH superfamily
3STEA 2V3DA 3AS1A 3ARTA 3ALFA 3V1HA 3QFWA 4P7RA 3T2OA 3BL3A 1VRDA 3N4EA 3N3TA 5A1AA 1YPXA 4O53A 2GGHA 4PH6A 3P5ZA 5HMEA 3OLEA 1DJQA 2WNNA 3VFCA 5AN7A 3TQVA 1CXHA 3I6EA 4JTTA 3W7CA 4AYSA 3R25A 2WXDM 1J9YA 1UJQA 1UASA 3AYTA 1GOIA 3W1AA 1L8NA 3KEHA 3EDKA 2JKPA 5HNNA 2G96A 1FDYA 3M6YA 1V5XA 3CH0A 3FV9A 1GW1A 4QDPA 1F05A 1KKOA 3SQMA 2EKGA 1JG9A 3CUFA 3TP4A 3BSGA 3MSYA 5FJJA 3KX6A 4QNWA 3T42A 3LCGA 3JUGA 3U4AA 3STCA 3RGTA 3LI1A 2QMKA 4QTGA 3RFAA 1V7YA 1AZ2A 1LCOA 4B5TA 2E6FA 5DN1A 4OQVA 1OCNA 5DELA 3LTYA 3EA1A 2PMQA 2DGAA 1QU4A 2Z28A 4LXFA 5BXTA 5LNVA 4AVNA 1S46A 2DUXA 3OQEA 1E4LA 1LL6A 3WNLA 1BKHA 4XB3A 3M0XA 5FJTA 1FH8A 3NQVA 2A1YA 4F79A 4FLRA 5J04A 2ZA2A 1TFVA 3NPUA 5K7JA 3IGUA 3G8RA 3ZJ6A 1VFFA 3CHVA 3UWEA 3RITA 3INPA 4ZE5A 1ITUA 3WQPA 3IV8A 3OP2A 2HBXA 3PS7A 4E2OA 3QPYA 2QULA 3CO8A 4IUGA 2G3JA 1W3LA 1WP6A 2VZTA 2Q8XA 1KQYA 4JL2A 3REQA 5TBOA 2ZADA 2VFIA 3P84A 4FIQA 2GPTA 1DORA 3FYYA 4ICNA 4G5DA 3KXQA 3HM7A 4H4IA 3VMPA 4JS3A 1A47A 3U7BA 4U3CA 2ISSA 4QG6A 3AYSA 4C1NA 1QO5A 4YTTA 4IIHA 3OVRA 3W25A 2R94A 1FCBA 1E6SM 4R9OA 3B4YA 4ORMA 4WRHA 1OFBA 1ZCOA 4GYKA 3TIMA 4GKTA 3WUEA 5E9AA 4AIOA 1CGXA 1E15A 5HANA 4BKNA 1JUEA 3EMQA 2YB4A 1DOSA 3CK5A 4QS6A 1VHNA 2H8ZA 2ZRWA 2XIQA 3P0XA 4BI6A 4D6EA 3H22A 4JHOA 3KVKA 5I3DA 3GK0A 4B3ZA 4ZO8A 3HTWA 1K6WA 5D8WA 3M5ZA 1XKJA 1TQXA 4DM2A 2QUMA 1U1JA 1EZ2A 1YDYA 1MNZA 1WDWA 5AOUA 1E4MM 1TZZA 1GG1A 1C90A 2D3NA 3PJTA 3CO4A 1TIWA 2DSVA 3A4XA 4Z2KA 4M8UA 4XZWA 5CBJA 3RYSA 3NQ2A 1FH7A 4NZ3A 4R34A 3UESA 1KR0A 4W4QA 4E8CA 2BLEA 2YFNA 1S39A 3CS2A 2NXIA 3GVVA 4H83A 3ZVHB 2H90A 5M3WA 3VGBA 3COTA 2PWVA 2W91A 1IT7A 3BLOA 1VFSA 2YCLA 4W86A 3P67A 1IXNA 3AI0A 1XLLA 4MVAA 3ARSA 4IGNA 2FGLA 3V1PA 4B92A 4LUJA 3QZEA 4AWTA 3KRSA 4YVPA 1E9IA 3VGHA 3E6EA 3ANVA 3NQDA 2EO7A 1C29A 3M0KA 3PWGA 4Y90A 5C71A 3W7RA 1B30A 1TWDA 2H9AB 1QHOA 4GQ0A 4HYRA 3WF4A 4LVBA 1V6YA 1J6PA 3MSGA 3DGBA 1VCGA 3DC0A 5GPRA 3MB9A 3O7UA 1AH0A 2OELA 3UCCA 4GI6A 3AXKA 3PNUA 3NL6A 3CT7A 4CCDA 1BYDA 3RF9A 4TVDA 1OGSA 1T7LA 3H2FA 1DWFM 4JTGA 3GKAA 4NT0A 2VT0A 3BZJA 3VIHA 4Y9PA 3O16A 3DDMA 4LRTA 1DPMA 1GKQA 2EPKX 2WZHA 2V2CA 2BS9A 2Z1VA 2BODX 2R82A 2WNQA 2YIHA 1WDRA 2VCBA 3LMYA 4QJ1A 1KTCA 4HPNA 2AQVA 4IGSA 3BVJA 1EJTC 2B7QA 3GDBA 3V18A 4GI8A 3QW3A 3W76A 4NAEB 4E2VA 2ACQA 1HN1A 2AKZA 1TUFA 2J9XA 3P6LA 2TSYA 4HZ8A 3NL5A 5A8MA 4CVWA 3LPFA 3U2EA 5AVHA 1EP3A 4AD0A 4B4FA 4M80A 2D2GA 4IMGA 4OBRA 3BMXA 3NOEA 2BMBA 1OFDA 5G2WA 1W8SA 4UTFA 2XZ7A 3MMTA 4E3TA 4AC7C 1XWYA 1UR8A 4ZOBA 3V5CA 4UBPC 1RJPA 3OJGA 4GISA 4LBRA 4DLMA 1A0EA 3TW9A 3BW2A 3G18A 2J78A 1XUZA 4GC3A 2PDWA 4L80A 3UWUA 4NXKA 2I17A 1VHCA 2CHNA 3QH2A 5HQLA 4I6VA 1RCOB 3CT2A 3SDOA 1ICQA 3HG2A 4C6LA 1RV8A 4N2YA 4K8EA 3IVUA 4JY8A 2OWWA 4DZAA 4DQWA 4F0KA 1D3CA 3GNDA 2OOFA 1LDCA 4QLJA 3UZ5A 3W72A 4XBKA 1H5YA 3HF3A 3VIGA 5K2ZA 3V3WA 1OFAA 2ACUA 1LRQA 3THQA 1YBQA 4E8GA 4HBKA 4IIEA 1W9PA 1H60A 3MI6A 1EGMA 3QC0A 1ZZMA 1H1NA 4C91A 2CIPA 2Z24A 3AS0A 3DC8A 4AU0A 1T99A 3CZLA 3BANA 4UTWC 4XSMA 5CZJA 4WZHA 2XH2A 2ABBA 4YTQA 4KWSA 4KWVA 4LANA 3DFNA 1IE7C 1DE5A 3VE7A 1W9BM 1KM4A 1NFPA 1NOUA 1FDZA 1TX0A 4YN5A 3UEQA 4JD4A 2TYSA 4RE4A 3CV2A 3E96A 2VQTA 4UC5A 2DY3A 3DHUA 4ZOAA 1J0HA 3ZYZA 3KRBA 2FHCA 2IPJA 3W1PA 2Q6ZA 1E1EA 1A5CA 3NQBA 3HO8A 3B9EA 4OOUA 3S5OA 2WPGA 2C1GA 2BB0A 4BA0A 1EDGA 4DJFA 3U2OA 4O15A 4NILA 4GBDA 5AHFA 4ZGYA 3VKJA 2FZ9A 1HKIA 3DG7A 3KZSA 3E12A 2OGYA 3UYIA 3WF2A 4HGXA 3THUA 4Q4MA 3KM8A 1OABA 4H2HA 2ZUVA 3GXMA 4NX0A 1BD0A 1QPQA 1JCYA 2GVLA 5KZMA 1AVAA 2ZYFA 2DJLA 4UFJA 1Z89A 4IP5A 4N9BA 4LCSA 3RJXA 3TH6A 2I9UA 3SRFA 2XFRA 4NI8A 3A5FA 1C8XA 5CLTA 3NO1A 1W5NA 4FXFA 1A5NC 3QEZA 3BLEA 2G95A 1EF2A 2C79A 4G7EB 4ORIA 3KVLA 1OFPA 4J1OA 3PN8A 3NO3A 3NYZA 3CIXA 4PUEA 3BLFA 1UD6A 1UA3A 1GQLA 4A29A 3AIUA 1KR1A 4LV4A 4MJ4A 3UGRA 4ZMGA 1A49A 3TZNA 1CNVA 1CLVA 3VGEA 1H51A 4ACZA 3DXIA 1SUXA 3EEZA 1W3HA 4UTUA 3VE9A 4XD4A 2BVDA 3NNTA 4ICMA 4QDWA 3U6WA 3KCOA 4HK7A 3M64A 1PX3A 4KWWA 1FHUA 4AD1A 3GNNA 4RUBA 1XH1A 3OHIA 1Q6OA 2YCKX 3N2CA 4QHRA 1R30A 2RJGA 3WFZA 3MKCA 1ME7A 1D9EA 1YW1A 4LRSA 1TMHA 1W1TA 3N2BA 3LSBA 1I2QA 4QAIA 1R3RA 2DSUA 3IGSA 1BHGA 4GCXA 2I5QA 1IXOA 2NWSA 2ZRUA 4K38A 1AW5A 3FS2A 2AGTA 3UPBA 3LQGA 2GQ3A 5AFDA 3ZVIA 1PXGA 1XW8A 3BGGA 4Q6JA 2E4TA 1DHPA 3K1GA 3MYOA 3W7NA 5CBBA 4EX4A 1UBSA 4Q8VA 3A12A 3W1RA 1IT8A 4Q7IA 4QCFA 1FWWA 2NQZA 3I4KA 4XO7A 2I1OA 3KCJA 4RZ4A 1UWTA 4A8IA 4U28A 3M0IA 5AC7A 1YX1A 4AHPA 3CV6A 2PU0A 3W84A 1SJCA 1XF0A 3OVPA 5G2IA 2YXXA 2P5NA 2QCDA 1UMLA 3W70A 2Y8KA 1UP0A 1YNQA 4RKAA 4GG9A 4RZ5A 2IPFA 3PULA 3L5AA 1P6BA 5HATA 4C1LA 4V1YA 4GHRA 5DXXA 1XYAA 3UBPC 2CBUA 4JCMA 3RRAA 2ICSA 4JQ4A 3W2JA 3E5BA 1LLZA 1JPDX 1VPQA 1XM3A 4HOWA 3LBCA 1X7IA 4KCVA 4J27A 2F61A 4JAWA 1AJ2A 4L6HA 4MTVA 3FW6A 3VNZA 3VFLA 3LU2A 3O3RA 3C2FA 3E38A 2QCEA 5U7SA 5BRQA 1W37A 5EMKA 2BOEX 2DIEA 2OGJA 2QCGA 3IRDA 4GKLA 3T0AA 5A8NA 1V3LA 1R8LA 1JGIA 4HSOA 3TE9A 3G1HA 1UD3A 5CAKA 1MEIA 1P1MA 1AH3A 5MHBA 5FJPA 5I06A 5ABFB 1KO0A 4HT3A 2BTMA 1UKSA 4JTRA 3UERA 5ABGA 1D7KA 1ZAHA 4DLFA 3R4IA 4W88A 1SVDA 1QWKA 4KQNA 5HUOA 3UG4A 1KTNA 4I9MA 1X39A 1XIJA 5AHIA 3C3NA 4HK6A 3C0LA 2DUAA 3NPVA 1KM3A 2J47A 4PA8A 4DBWA 2EBNA 1ITXA 2TMDA 2QDHA 3V0UA 5C2GA 2VR2A 3TYDA 3A4JA 3CMJA 3AFBA 1QNOA 3W6LA 3DKLA 3SUUA 1XBXA 4DYKA 1JR1A 2XVPA 3IJ8A 4LS1A 3BQ6A 1UR4A 3T07A 4ZR8A 4IL0A 1AH4A 2XPKA 1XBVA 4EXAA 1KXHA 3CYJA 5EMLA 2XISA 2P0IA 3LTSA 1PB0A 5JXQA 3GDMA 2YDRA 2NX3A 1ZBCA 3EB2A 3WLJA 3BAJA 1FFRA 1H50A 1BYAA 3N1AA 4W7UA 4UB9A 3PC0A 3NJ3A 4Q8TA 5F1VA 2Y7GA 1ITQA 2D24A 3TJ4A 1W32A 3EWYA 3LXBA 3FJ6A 2WCGA 2E6DA 2P53A 1SR0A 1OT1A 1IXPA 3ARZA 1VENA 4FAMA 3GZ3A 4ZVJA 1OF8A 4RE3A 3VUPA 3HB9A 4BR1A 3S5YA 5PTDA 4ZENA 2J13A 2PLJA 3EA3A 1UD4A 2DW6A 3ID7A 1DP0A 1V51A 4PGLA 3E3HA 2G4JA 3VO0A 3EX3A 1VJZA 3QFEA 4O1FA 4IHCA 3CZJA 1VLIA 2DZVA 1L6FA 1W8GA 2ESCA 3CTLA 1AUSL 3GUWA 3QY7A 4JTCA 1R46A 5RUBA 4AF0B 2YCEA 3PZVA 4TMCA 3B0YA 1RAKA 1QHZA 4ECLA 1E72M 1SQ7A 5LIWX 2JKEA 3DI1A 4I6KA 1FKWA 2W4XA 2R1NA 3NQ8A 5FEZA 4QG9A 3GIYA 5AY7A 2Y1HA 4O11A 3VDCA 5K9XA 3W82A 3R58A 3NQCA 3W7QA 4JDBA 4GMEA 4H8VA 1QBAA 2UY2A 3HGJA 3OO2A 3SGZA 3P93A 5DCBA 4Z2LA 1R5YA 1CXKA 2WANA 5HJXA 3G1DA 2VVSA 3U2ZA 1X6UA 5DBUA 1XLGA 4RNJA 3DX5A 3GM8A 3QGKC 3K8KA 4D6DA 2XGIA 4KETA 2VEPA 1T96A 2CLMA 1V0NA 5I2UA 3ARXA 4TX8A 3LX9A 5LXXA 1BSIA 3AOFA 2NX1A 3VD9A 2V5CA 2X42A 2EG6A 4NJHA 1XYCA 5CGTA 3P82A 4CNPA 2XH0A 4H8HA 5FSEC 1Y5WA 4LUYA 3NGFA 3N2XA 1XGZA 3F4DA 1FVPA 3UFYA 1NQ6A 1VD6A 4DXXA 2VXNA 5LZLA 5HBFA 3LS9A 4H8UA 3T2PA 3ITXA 3L2MA 4DYEA 1Y8BA 2J4GA 1MW1A 4JQ3A 3W27A 4WK9A 4XUYA 5KINA 4DUWA 2ATMA 3W9ZA 3URQA 3KE0A 4MDOA 3DFTA 4M6VA 1UC4A 1XR2A 1LBMA 3GH5A 3GDTA 4AHOA 3CMGA 4IX0A 3N6JA 4W84A 4NZJA 2WYSA 1LG1A 1XIMA 2GUYA 3MBDA 3SQLA 1C3FA 3T78A 1ME8A 1GQKA 2VKZG 1W3TA 5EY5A 1GG0A 1FWSA 1LBFA 1R87A 4PRRA 7REQA 3ABOA 3T0CA 2YLLA 2OEJA 5KEZA 3VILA 2EF9A 2YBTA 5FJRA 3XINA 1LUCA 5REQB 2OCZA 1VFMA 3VIJA 3GR7A 3WZ0E 3KP0A 2AKMA 4TV5A 1FWGC 3T08A 3BH4A 3NZQA 3ISIX 1ZCCA 3TZFA 4DVOA 1U2YA 5IFTA 1JZ2A 2QZRA 1PKMA 4J2MA 4GNKB 5U4NA 4DJFC 4AG0A 2G50A 1MUCA 5I00A 4GIRA 2OWXA 3N12A 1I6NA 3AMGA 3WEZA 1T41A 1IXQA 1F9CA 4HJWA 4S3DA 1RD5A 4GQRA 1BQGA 3USBA 4WKAA 1XDLA 1WDSA 3WN6A 2WZIA 4K2SA 3S9ZA 1LRNA 4XTDA 5CG0A 9XIMA 1QJWA 3N04A 1XV8A 3OA3A 1W17A 5M1TA 1ISVA 2PDMA 2UY5A 1EQCA 4XKMA 4DJFD 4H3DA 4N9DA 5KETA 4C6OA 1PDYA 5D2YA 2PDXA 4U4MA 1BSLA 3RM4A 2WB5A 4ML9A 4J3XA 3M0VA 1A4MA 4Q3MA 3KL3A 1EGVA 3O6CA 2UY4A 2CETA 5A2CA 1LLOA 4G2DA 1XINA 1XSIA 3VAVA 5BRPA 3F4WA 3UP8A 1Y5XA 3WLRA 4DUOA 4LBUA 2GQ8A 2VEMA 1W9VA 2VDIA 3BSHA 1O68A 1PYMA 3TW7A 4PMZA 3W85A 4KEUA 5I3IA 3UG5A 2QVHA 3T05A 2FDMA 1UR2A 1XYZA 4LW7A 2VYOA 2VDGA 1VPYA 3SO7A 1TE1A 3LCLA 2I5IA 3CQ0A 3VINA 1NY1A 1Q4NX 4OTKA 3R5EA 4CD8A 3ZOAA 1ZENA 3TROA 2RFGA 3LHUA 4QEHA 1UQZA 2ZRVA 5B7ZA 4UOQA 4PCSA 1EO7A 3GDRA 5K3VA 2MANA 4UOJA 3C86A 1TZ9A 1TTQA 1VYRA 4WSKA 3H8AA 2X1IA 1E0XA 3O9NA 1J6OA 2DP3A 2NUXA 5LKYA 3SCTA 4J3UA 4ZTXA 4M7SA 4RZ6A 2BZNA 5K9DA 3BG9A 1O4UA 2GFTA 1Q6QA 1VBHA 3IEBA 1H7RA 4LUTA 3UXKA 3VUSA 4XV0A 5I07A 1WBJA 3S46A 2XTKA 3VOGA 1IF2A 1GOQA 4YU1A 3UJEA 4R85A 1FWDC 4C6IA 4FB7A 3GIPA 3ITCA 2AGKA 1GK8A 1TB3A 2PEVA 4GFSA 3R8GA 5C9UA 4H04A 1BF2A 1XYFA 5T91A 1KBBA 4MJZA 5DQPA 2PLCA 1YDOA 2KZHA 3S42A 1PZ1A 4FHAA 4D6CA 4PBEA 3LCWA 2Q3OA 1Q85A 4WHBA 3H54A 3GG1A 5EKYA 2BHZA 7ODCA 2WAGA 4GXWA 1QPRA 3P0WA 3PWAA 2FGZA 4J4KA 3AIEA 5AC5A 1ZJIA 4QCEA 3VNKA 2QHAA 1XH0A 4WY0B 1DQUA 1HP5A 2JALA 2UV8G 3AJXA 4H7CA 2CU0A 1BYCA 3B8VA 2O9RA 3RXZA 4DF2A 1J93A 2YX0A 3W74A 1OVDA 1EX1A 1JJKA 1NQKA 2QNEA 2YDSA 4Y9OA 1HT6A 1MWOA 2BFGA 3E0FA 2J9ZA 3PZQA 4RV3A 1IEXA 4X63A 2ZZ1A 3A3HA 3WFLA 4P61A 3KOWA 4GY1A 4N6FA 3LM3A 4GX9A 1UKOA 2DZXA 5HULA 2OSXA 2Z7GA 3UY7A 3WH7A 1OX5A 4RLIA 1IEQA 2NLIA 2Z1WA 1GPFA 2QGHA 4PB5A 5CZ0A 3RNDA 3PZOA 5LNUA 2OZTA 2VFHA 2WHJA 3UPWA 2BNJA 3QTGA 3CU2A 3UNTA 3WLNA 3MCMA 1GYNA 1QI5A 3W6MA 1EA0A 1AD4A 2HNHA 1RJQA 3HN3A 3WDHA 3I10A 4GABA 2DZWA 1RBOB 4DRSA 4RDYA 3VOJA 4D2JA 1LOSA 2Q8LA 2ISDA 4QXIA 3RDKA 1R6WA 1PWLA 1KV8A 1RBLA 3L4TA 4H41A 1Q13A 1C91A 4JR5A 5AYYA 1TJ2A 5CZSA 1TX2A 3O8AA 3LRMA 5D05A 4O0ZA 3OIHA 3E0LA 2A85A 3M0LA 4M7TA 3M7WA 2HPMA 4HCLA 1HJUA 1E43A 3LI0A 4LUSB 5HK4A 3QOKA 5FKYA 4TX6A 3NYDA 3VKAA 4MFDA 2B31A 5LGXA 1CGWA 5A6SA 2W66A 3QC3A 1UC5A 3VC6A 3QV8A 4UTJA 1VFUA 2Q71A 2WBGA 4UCFA 1ZNNA 2OOGA 1SMAA 1TV5A 1O1HA 3HV9A 2J8GA 4DO4A 4O17A 3T1GA 1P48A 2PBGA 3I6TA 1XUUA 3S2MA 1OC6A 1W1VA 2SFPA 3QYSA 4IOTA 3GTFA 5K4ZA 1MEHA 4TO8A 1QI4A 1PKYA 1PV8A 1TPFA 4X60A 3BOFA 3N9SA 3WUFA 3KRUA 2J79A 1TPC1 3WNOA 2IW0A 4L4PA 1J2BA 2XGBA 1HKKA 1X8CA 3R8HA 1FKXA 1AQ0A 3VKBA 3PJXA 1IEIA 1C7SA 3GBEA 1E73M 4XZBA 1RA5A 2QUVA 4IFRA 3P2VA 2WSPA 4LUIA 2BY1A 4LC8A 1XCFA 1TCMA 3GY1A 2BY3A 2NT0A 4GUGA 2VO5A 1JZ7A 1J79A 2PC4A 3JU2A 4PUDA 1BFNA 4MOZA 2A21A 1KC7A 3TAKA 4Q8MA 4CQBA 1GVEA 3PZNA 3BWWA 3SUVA 2JBMA 1ONWA 1QPKA 1I2PA 1SFJA 4DB7A 4ATWA 4AEEA 2W0UA 2WWDA 3NL3A 5JIPA 1VBUA 2GJXA 3GZAA 1R2RA 2WHKA 3KBWA 4S3AA 3G1YA 1DKWA 5F1UA 1I0BA 1B2YA 2WJDA 4UFLA 1TV8A 1AQHA 3G6MA 4CEXC 3RPMA 2Q3RA 4OVXA 2PODA 4UXDA 3H26A 2P3ZA 4R33A 5EMJA 1IGSA 1JDAA 1S5MA 3FJLA 4CGTA 4IIBA 3MP3A 1NAL1 5C9ZA 2GVGA 3CUHA 1EJXC 2PFHA 3GG0A 2WK2A 2OJPA 3BSMA 4JZ5A 5D2XA 4GFIA 4O13A 2XVKA 4XIAA 3DFOA 3HZ3A 2V3FA 2ISVA 4Z2JA 5CPSA 1M1BA 4KEVA 4IGMA 3BJSA 1TO3A 2RUSA 1GQIA 4QP0A 1OK4A 2V5KA 5I77A 1ZPTA 4JTKA 4BF9A 3LCIA 4KWUA 3UA3A 5LA2A 2CZDA 1Q7ZA 4ZSUA 5L6UA 4HIBA 1UZ1A 4BI5A 3BCFA 4H9MA 4F40A 1UQYA 1H7PA 1K70A 4ZZ9A 3WQDA 2QT3A 4ROQA 1IWAA 3GHRA 2E8ZA 7ENLA 2BVYA 5A8QA 4F8XA 2XN2A 2QDDA 2YL9A 2Z1SA 1KKRA 4IFKB 5FL0A 5E5CA 2YBVA 1X1NA 2Y62A 1XIFA 5CBIA 2FTPA 5D02A 2NX9A 3Q4DA 4CCCA 1QNPA 2ZVRA 3CL6A 4W8AA 1YYAA 3HG3A 4EF8A 3W2KA 1QBBA 3PZGA 2XU2A 4AEFA 3M16A 3KOYA 4HA1A 4ZQCA 1EB3A 1I45A 4L64A 4US5A 1EGZA 3WMCA 4IMAA 1QNVA 3CPUA 3VD3A 3NQ6A 2E09A 3T81A 2AMXA 1F8MA 3V36A 1AK5A 4PRTA 4ZOEA 4MYAA 2JGQA 3RM8A 4RDZA 4GVFA 2G0WA 4Q32A 3WDQA 4YL2A 1NM9A 4JYEA 5HMSA 1ICPA 4OHQA 5ABHA 4PTVA 4MM1A 1TWSA 1XRVA 3C2OA 3DFYA 1E70M 4CNOA 1YLVA 3NOYA 3L4ZA 4LCRA 4BEUA 1KWKA 3P14A 2PB1A 3UZYA 3SIMA 3BMWA 2ZUWA 1Q2SA 1W3IA 2ZFAA 3CAWA 5I79A 3I3EA 2WVUA 4HJFA 4LYQA 2RDXA 4M0XA 5BWAA 3EMZA 2OLAA 3MMUA 4LYKA 2WCAA 1XIHA 1CEOA 2TAAA 4U2ZA 4WJEA 4Y8FA 3TLQA 2PP1A 3ICJA 4S3EA 4YYCA 3GS6A 4X3ZA 4RDVA 3W7EA 5A8PA 3TOPA 3M07A 1I2NA 4LVFA 3DFSA 2FFCA 3E02A 9CGTA 4FA3A 4LAMA 4O1CA 2OQHA 1D8CA 1LLWA 4L4LA 3RMJA 4M6QA 2FVKA 1G9HA 4FR1A 4M82A 2YDAA 4E3VA 3TN3A 2RHGA 4Z1BA 1GONA 1VR6A 3TV8A 3CPRA 3LHVA 2PZ0A 2PTWA 4WVXA 2R1MA 1YHTA 3FSUA 3M5VA 4GOAA 4Y96A 2DW7A 3QMSA 5HJYA 4CU6A 1Z44A 4UQCA 4AD3A 3C61A 1BG4A 3NPWA 1YRRA 2PS2A 1MQRA 4Q8UA 2ZXQA 1GTHA 2ANUA 1HJXA 4ZB0A 4J5NA 1NP0A 4K7VA 8RUCA 2CLFA 3QV7A 5GQBA 3N4AA 3L0GA 2QJHA 1KB3A 2ZWYA 3S1VA 2Y88A 1J0ZA 1UZDA 2BOFX 1I75A 3BQ5A 4NL1A 5FSDC 5H8PA 2PDPA 4IIGA 4Q4SA 1FBAA 3VTRA 3CBWA 3FNDA 4OOZA 4XVDA 1JZ6A 4MY9A 4Q4OA 3A6OA 2FTYA 4C5ZA 4HD5A 3D3FA 1QI2A 3VKKA 4P8WA 1W5PA 4EAYA 2JEPA 4JKKA 1UUQA 3TX9A 2HSAA 3DECA 4WY0F 2FPVA 3GFZA 3CAQA 2QV4A 2C1IA 2OVLA 5DMLA 3VDBA 3B04A 5MKGA 3W1LA 2FKPA 2J7EA 2AL1A 4CNNA 4MB4A 8TIMA 2ZUSA 4K68A 4XAYA 4AC1X 3UZZA 3FY1A 3JRKA 3N13A 4R53A 2D23A 1H4PA 5CPQA 3EX6A 3AU2A 2Z1BA 2VCAA 2DIKA 1DTUA 1E6XM 3R0KA 3AIQA 4KRTA 3UJSA 2V0TA 2YKKA 3S5SA 5BOOA 3FGCA 1PDZA 1P7TA 4A8RA 3AZTA 3WK0A 2FQIA 1XIIA 1F76A 4NNCA 2IPGA 4O1DA 2W27A 3LV5A 4FI4A 4ZQNA 3OG3A 4D8LA 3SFWA 3F2DA 2AAMA 3N19B 1BG9A 3M4HA 3G0UA 3SY1A 3I7RA 1M9HA 3UETA 3G22A 4MUZA 1TV2A 5LNSA 2EXOA 1KM5A 5LNWA 3CHEA 3IUDA 4L4MA 4HNCA 1K6AA 3TFCA 1WYIA 3UXLA 1J12A 4GGHA 2A2IA 2XWDA 3HGOA 1IWPA 5D37A 3VK5A 1EKOA 4LAUA 1OM0A 4REQB 1E51A 1K03A 4M6UA 4HNLA 1EDQA 1XIEA 3LM7A 3H4GA 3AMCA 2UZ9A 2JKAA 4EPEC 1RR2A 2WVTA 1S2VA 2DZUA 2X1TA 4DWSB 1VLWA 5FF2A 4PBFA 2NSOA 3NM1A 4LF2A 4MWAB 1TG7A 2D73A 1GJPA 1XCWA 1U1UA 3PPCA 4HMNA 1QW8A 3ZR4A 5H1WA 2VZVA 2W92A 3WY1A 2AL2A 4HPJA 2OZ3A 1GJWA 1B1YA 4QDMA 5GJMA 4JTSA 1FWEC 4WJ8A 2WLYA 1B90A 2ZZ4A 2DT2A 3AHYA 1A5BA 1VQTA 2XVNA 2Q09A 4Q8PA 3K5XA 5GJNA 2WKGA 4O4WA 1PIGA 2C19A 2V81A 2NVAA 1PL9A 3FIGA 3AWNA 3M0JA 3WH8A 2HCVA 2DT3A 5I24A 4NZCA 1MFUA 5HWMA 5TF0A 5A6LA 3KBJA 3BCDA 2Z26A 3ZQ9A 4JIHA 2AAAA 3RCNA 3N73A 4KESA 5ECVA 3OGVA 3ARRA 4EACA 1PHWA 1KM2A 1OCBA 2YYTA 3E0VA 4J40A 4PCNA 3KRZA 3KP1A 4IUOA 2GL5A 4L65A 2A79A 3G24A 2O4MA 3W23A 1GYMA 1NDZA 4DAFA 4AX6A 1W9UA 1Z3NA 3EDFA 1GVQA 3PK7A 1QASA 2JIEA 1TWZA 4PUUA 5AKQA 2GOUA 1SZGA 2V30A 3ELFA 4RXFA 1E6NA 1MEWA 3PP7A 5I6SA 4U3AA 2KAUC 4UTLA 5G1TA 1GHSA 4GPNA 2QMJA 4P7LA 2CZ5A 1WAUA 4HTYA 3G1RA 3BURA 1PIIA 4LVDA 4EWJA 1ZJBA 3E49A 2ZZ6A 1EIXA 2QVNA 2FHFA 3JS3A 3ABSA 5TAOA 5HNTA 4FALA 3DGRA 3UQNA 3ZJKA 1UH2A 2Y2WA 3TYEA 1K9EA 4IG2A 4X9SA 4OKDA 5ABTA 5IRPA 5A6AA 3USZA 2O7QA 1CIUA 2POZA 3N2MA 4IM4A 3M6DA 2YL8A 1DWHM 3RHGA 2RDUA 3QV6A 4NZ1A 3SRHA 1NARA 3UXDA 1CGUA 5F2MA 1B31A 2WJZA 4QE1A 4TTUA 3QHNA 4XZIA 5BNKA 2CWNA 4DUVA 3KWXA 3EX1A 1K1DA 3EKLA 3WDRA 3MMDA 1XBYA 4Y9MA 4NAFB 2V68A 4ZXOA 5C6MA 4LX4A 1W5OA 2E5DA 4O12A 1JDEA 3TUUA 2OMAA 4HMDA 2D0GA 4NYYA 3QBUA 3AXMA 3WJYA 2CFFA 3PZ9A 3LCHA 4QJ5B 3LGDA 3DZ1A 3M43A 3GNXA 2RDTA 2HE8A 1MXSA 1QMLA 3M46A 4ADSA 3WG6A 2O9PA 1K7XA 4HSHA 3AICA 4D6GA 4E4UA 1XLBA 1SW7A 5FJUA 2PLMA 4RDWA 1PO9A 1B5TA 3P81A 1G7UA 3FN9A 4NG3A 3RO6A 5BU6A 1GOMA 3R1ZA 2CKSA 4YWSA 3HFTA 2Y0FA 2E40A 2E25A 4C6EA 3VIFA 3TSMA 4TXEA 3CIWA 1BXCA 4IJCA 1EYEA 3LZ5A 3WLOA 2G3NA 1TJPA 3ABQA 4HQVA 4M56A 1UOKA 2DH3A 4O8AA 5D04C 1EP1A 3QHOA 4I7VA 3L2IA 2RGLA 3FYOA 3S9YA 1E71M 2V5BA 3TYCA 5T9BG 1XHGA 3EPNA 4GZEA 4J3SA 2ZX9A 3DH7A 3RK8A 1VRXA 3MDUA 1E55A 1Q6LA 2C15A 3E74A 4LNYA 5IHRA 2J7BA 2WVVA 2PE4A 1H63A 3FCPA 4HA0A 5B80A 4XD5A 1Y5VA 1RJRA 2VGFA 1QOPA 4FX7A 4UTTA 4XKYA 4H2CA 1RY0A 3C3UA 1UPPA 4FZIA 1UG6A 3MUAA 3AQUA 4AZ7A 4KW2A 5C5YA 4J35A 4US5D 3UWVA 1CGYA 1W31A 3OLDA 3RG6A 1NFGA 3SCVA 2REQB 3EWXA 5BU9A 2VEGA 3K4DA 4JQ1A 1OJXA 1UMYA 5IDZA 1FHLA 3B9AA 3F03K 4AZCA 4B5NA 4CD4A 1OD8A 1JQVA 4UQAA 1QNSA 4LH8A 2IMRA 2W3ZA 2POTA 1JAEA 1WB0A 4IMFA 2QPXA 3U2CA 5DY3A 1RLCL 4UQBA 3S8HA 4XAZA 3C2YA 2V9DA 3SM0A 4J7RA 1V6VA 2J7DA 2BDQA 3CTTA 3O6DA 4AXKA 2HEJA 2PDFA 3WL1A 3OTRA 4DJDA 2NXGA 3APYA 4X0NA 3WL0A 1A0DA 2P3EA 3R0DA 2INZA 3W38A 3L66A 2QR6A 1Q66A 1TVLA 2DZAA 1TIMA 3PBMA 4Q6XA 4J28A 2GSEA 1BXNA 3VM5A 3SJNA 3S1GA 3TTSA 4S38A 4DBEA 1CXIA 3OZMA 2PTZA 4O0KA 4DAIA 2QCCA 3EWZA 1DE6A 3H7RA 3IGHX 3BDKA 4D71A 1VFLA 3M41A 4PMQA 3EGJA 2JGYA 2Z2BA 3W26A 4HU8A 1P43A 1QO2A 4IFOA 1A5OC 1M53A 1YIXA 1S5VA 5HQMA 1B54A 2ZVIA 2YYUA 4ONVA 4YIWA 4JGDA 2BGNE 3EXSA 4YNGA 3ITOA 2P50A 1R3TA 5A8GA 4TVUA 2DZBA 3IIVA 1SU5A 4HSNA 4O4VA 1E6PA 1NWSA 1G4EA 4GYJA 3KL5A 4AW7A 1M6JA 1MDLA 3WQGA 1Z9AA 4EVZA 3DAQA 3TN5A 1FCQA 4MKNA 3N9RA 1V7AA 1IHIA 4F2UA 3GIQA 1R86A 5D30A 2GJPA 2VOMA 3T8LA 2HQAA 3TONA 3BG3A 1JNEA 1X98A 1OD0A 2Z2AA 4ZE4A 3D0CA 3GR4A 4PUNA 1NEYA 3AAMA 1V77A 4JIQA 2ZRZA 1HG3A 2QCMA 3TR9A 3IVTA 1EPVA 1O94A 3P8IA 3JZUA 2VGGA 3AIBA 3OZPA 4L1WA 5AHEA 3TEVA 2PF8A 3BAKA 2VWSA 1B9BA 1ECEA 4FR6A 3ARQA 5DF0A 1D7FA 1U1HA 4K1WA 3KUMA 4KFNA 1E56A 5I3HA 2XYLA 4UQ9A 1XG3A 3VZZA 1EFZA 4R3UA 1N8WA 3QPZA 2XHYA 1S2AA 4LBSA 3NXFA 1FUYA 4ZO6A 1XICA 3Q67A 3SCQA 1FX6A 2DPEA 4YJ5A 3KVJA 1TWWA 3ITLA 1PCKA 3GWQA 1B3XA 3K46A 3KDNA 3GX9A 2CZVA 1XD1A 4WGHA 5TIMA 4L56A 4QX4A 3CAVA 4W87A 1X6NA 1VAHA 4HCDA 5EMUA 4IPPA 1M41A 2P0OA 5JBFA 3HMCA 4WX2A 1FRBA 1OHLA 1U33A 5JQ9A 4NVTA 4JTJA 3FKKA 4ZQRA 1UUMA 3SEPA 1IQ8A 3OLGA 3BAIA 4K7YA 2EPLX 1HO1A 3TK7A 3VDHA 4IGHA 3GLCA 3UR7A 1FHVA 1HW6A 1TMQA 4Z08A 1HKVA 1R2SA 1XP3A 1IV8A 3WJWA 1KXTA 2G37A 4YLWA 1J0KA 2WMGA 2HVNA 3W71A 3KS6A 5CC6A 6XIAA 2MUCA 4JTAA 1UWUA 4B91A 3N14A 4GIAA 1T40A 1YXDA 4H6EA 1VC4A 4K3ZA 4JYDA 1NWUA 4L6OA 1JXKA 2R1PA 1QCWA 3ZVHA 1JI1A 3BLIA 3TC6A 3K13A 3B8IA 3U3HA 6XIMA 1DXIA 3T8QA 1EH9A 1S3TC 3Q94A 4MPQA 2GDVA 3FHQA 3UJRA 1DWJM 1UCWA 3TSDA 5HPOA 2WNZA 4K8GA 4UTWA 4MB1A 3OZOA 3H2NA 4D72A 3CUGA 4PRWA 1UR0A 3EWDA 4X9YA 3K2GA 2EG8A 3GYEA 4NZFA 3ZO9A 1HGWA 1Q65A 1O5KA 5I09A 5D2VA 2H9AA 4YTUA 3EB4A 1Q3NA 2EHHA 1R3YA 3UXAA 4WOZA 1D3GA 3TA9A 4XISA 4PE8A 5A6BA 2CLKA 1TELA 3SJ3A 4JTLA 1LP6A 2WHLA 1YE4A 2Z4GA 3W53A 1MQQA 5AC4A 3MUIA 3PFRA 4FK9A 3KZPA 4HOXA 1ZLPA 4ZODA 1BXBA 3MDWA 4L5ZA 3QF0A 2J7FA 4N02A 3P3BA 1E9ZB 3GSMA 3DENA 3UW6A 2V5LA 3VC5A 1W2VA 4AISA 1RQBA 1ADSA 1GCYA 3LPPA 3VIMA 3R10A 3TA6A 1H62A 1HX0A 3CWNA 4C6DA 4POCA 1UH4A 3VOFA 1ZSXA 2EPHA 1WZMA 3HMJG 3LHWA 1F2JA 3UXIA 2ZA3A 5M2FX 1TSIA 1SFSA 5F4SA 2QJGA 4PCPA 2X2YA 4UFIA 1ISYA 5HR6A 2HVMA 5H8UA 3IGXA 4NJKA 4NAEA 1TR1A 3QXBA 1BWKA 2HXTA 3B06A 5I7GA 1Q8JA 1DJGA 3M0YA 3M5YA 4R7OA 2KX9A 1RK6A 4NSBA 2BX7A 3B03A 1XLHA 1SM9A 3NQAA 3ES8A 1V3MA 1KW1A 4CVUA 1ZBVA 3MA8A 2A3CA 3VIPA 3EBVA 1KNWA 1LT8A 1H7WA 4ERGA 3UGVA 1KFLA 4C6BA 3WBXA 1ZL1A 4EIVA 3N2OA 1ZJHA 1W56A 2OSYA 2F2HA 3W37A 4KFPA 2BGSA 4JKMA 2GLKA 2ISFA 3CEPA 4G7FA 1GPWA 1VPXA 1M03A 1YADA 5I3KA 4O28A 3GXTA 3IV3A 4AZGA 3C4UA 2XGZA 4WDWA 1PTAA 3VD5A 1WX0A 2X2GA 1AJ0A 4HN8A 1M7PA 1S1RA 3U5YA 1F3TA 4F3HA 5FI8A 5DCDA 1EHAA 3QR3A 2VP8A 2RDWA 2V38A 2Y63A 4HK5A 3QY8A 3GHTA 4GA8A 2J6VA 3I6RA 1N8FA 3CJPA 1QK0A 1LWJA 2XVLA 5AHMA 3Q65A 3WNPA 2A6LA 4B3LA 3VMNA 3CL8A 4GO8A 3WFAA 1V3JA 3WQVA 1SO4A 1NP2A 3FA5A 3CQJA 3WX7A 4TOQA 1G67A 4HNNA 1LJYA 2Y7DA 3G3MA 5LYRA 1NDWA 3WUGA 3C0SA 4RK8A 3EDJA 5CGQA 1Z69A 1J10A 1V0KA 5E0KA 1MYRA 4PMNA 3I7QA 2QJNA 5CGMA 3TWBA 2E28A 3GC5A 3MJYA 4QEEA 4Q4KA 3IJDA 3C2VA 1WZAA 4XZMX 2ZE3A 2Q8ZA 1SSDA 4C7GA 2XUCA 2DORA 2PGEA 1TTPA 3V5FA 3SURA 3N6QA 4Q8NA 4E4PA 4DM1A 3O1NA 1RPKA 4LQ1A 2V2DA 3AHZA 2B7PA 2WM1A 2E7FA 2C0HA 3BXWA 1EXBA 4MY1A 4ZCWA 3B9OA 4GYFA 3TKFA 3AIRA 1DXFA 3T7VA 1RVGA 4OV9A 4AQLA 4F4RA 4UNLA 1ADOA 3W01A 3FJNA 3ABRA 1GW9A 1JXJA 1VIZA 2CLPA 3AMKA 1BWLA 1GTEA 3VNDA 3CHCA 2PDJA 3RR1A 4B5VA 5BROA 2HK1A 1TJ1A 4P8UA 5C9XA 4OWGA 4F9JA 3VIOA 1QTWA 1F5ZA 1TPEA 1NVMA 4C7FA 1F6KA 1Q7MA 3MCNA 4C6KA 2P1FA 1L6WA 2RAGA 3II1A 2DZTA 4IISA 2A5HA 1F7BA 4DHGA 1WNOA 1EZWA 4I8DA 2R14A 2E5CA 4UTTC 5A95A 2NLYA 4JIRA 3A3WA 3EZ4A 3OODA 5SWUA 1YTDA 1OG6A 3W7KA 1FWTA 3NQFA 3QTPA 4RNFA 1RUSA 3A24A 1CXLA 1T0OA 1QT1A 4ZA0A 2ZXBA 4QAWA 4WKFA 2DVXA 3LOTA 1B9ZA 4BQ2A 1ISWA 1KRMA 3OZYA 3AJ7A 4G7EA 1FA2A 1OX4B 5C7VA 3TYAA 4DYJA 1J0JA 3QKZA 3GU2A 3OBAA 3IANA 1DTNA 1E1FA 2QAFA 3B8UA 3SUWA 4LALA 1EJRC 3G1FA 4B2DD 3MHFA 3S6OA 1H11A 1QXLA 4GQGA 1HO4A 2YGYA 3OQ8A 4IF2A 4PEKA 4MB3A 3W7GA 5XINA 1A5AA 1ZBWA 1SR9A 4DJDC 5ECUA 4EF9A 3GTNA 1MUWA 5GNXA 3LLFA 2XIOA 3U0HA 3V0SA 2GUBA 1L9WA 3THAA 1AJZA 1FXQA 1R2TA 4H9TA 8CGTA 1OT2A 2WZEA 2ONEA 4KH2A 3QMRA 4Z2GA 3KHJA 7TIMA 5C55A 1JDCA 1A4LA 1Z41A 1WCGA 1VH7A 4IL2A 2IUZA 3E2SA 3YPIA 1FWRA 5HJLA 4DJDD 3R8RA 1DBTA 2FPYA 4S2BA 1VYSX 3IIZA 4UIOA 3WD3A 3SZ8A 3CHDA 1ZBKA 3URNA 1EEPA 1MXGA 3MT1A 3RCMA 1SFLA 1EO5A 4E5TA 3G1VA 3OB8A 2RJHA 3WK2A 4EE9A 3NEVA 1OINA 2DEPA 5C2CA 1WE5A 1JDDA 1E6ZA 1MMFA 1ML1A 1UBPC 3I7SA 3VX0A 3OEXA 2RKXA 3BUVA 3GUGA 4C6QA 2YW4A 1POJA 1RCXB 3B9DA 3SGGA 1P5BA 4O16A 3NR0A 5JU6A 3WLPA 5D38A 4O52A 4AB4A 1HKWA 3DG6A 1KFWA 1E6QM 4IT1A 4R27A 2A3EA 1F07A 4JN7A 3VDAA 1KBIA 1MFVA 1DHKA 1VEMA 3MUCA 1W1B1 4MJ2A 1IWBA 1OFQA 4QLLA 1V6UA 3A23A 4DWDA 2F2KA 2V6AA 3PFMA 4U10A 1K3UA 2X0SA 1FQ0A 1JZ4A 3PAJA 2WQPA 1R47A 2CXGA 4XZLX 1X1OA 3C6CA 1KRCC 3OBKA 2B4GA 1BRLB 3WLLA 3NQEA 5IFPA 3R94A 2FYMA 4K36A 4PB4A 1QK2A 1A3WA 1Q6FA 1QRQA 5CXPA 3S5ZA 1XDMA 1FP8A 2YBUA 1Y0EA 1UKQA 2QAPA 4DXVA 2C3ZA 4M51A 4PMOA 3SI9A 1A5KC 3O0FA 3VX1A 3CLWA 4K37A 3BJTA 3DI0A 3C2RA 3UA4A 1LTDA 1LZOA 4OV4A 3WO8A 2FZNA 4L1GA 1G7VA 5ABFA 1XIDA 1C8VA 5LIXX 1RQEA 3N9KA 1UZ4A 1TPH1 2ASHA 3U8GA 1W3NA 1PAMA 2CZEA 1JPKA 1MRAA 2P8CA 3BARA 4NNBA 1R3WA 3WBAA 4GVGA 3M44A 4MKVA 1K4HA 1E4NA 2GGIA 4FNTA 1B57A 5H6HA 1A50A 1EIBA 2WC4A 1OZQA 4GWEA 4HYWA 3C56A 2VRKA 1JRBA 2QEZA 2HPIA 3WBEA 4R9XA 4AIUA 4MZ1A 4RXGA 4DF1A 4LT9A 3MZNA 1Z42A 3QW4B 5D33A 2EJAA 1JUKA 4PUMA 1WQ5A 2FB3A 5A69A 2CNCA 2V2HA 5JBEA 2GJNA 2V8ZA 5CPMA 3ONCA 1Q5MA 1DEDA 3UU0A 4GINA 4L4OA 3DEQA 4J3VA 3LZ3A 2FJKA 2PWDA 3FHAA 3L67A 4C6PA 1Q6GA 4FLQA 3L5MA 1U5JA 3VNJA 1U30A 2XM2A 2QUUA 1PX4A 1XLMA 5H91A 4QE5A 3ZT5A 2BXVA 3ZM8A 2D2HA 1PSCA 4DF0A 2ZICA 4IQJA 3O05A 3VNMA 2VURA 1XL9A 4NP7A 1NWTA 3UF9A 1Z8AA 1Q6EA 1DJXA 3OLIA 4S3CA 2HROA 5EGRA 5A6BD 4WSHA 3JR2A 4DNHA 5BMWA 5D2TA 2X1SA 4Z0SA 3S4TA 3GVWA 2BASA 3AXHA 4FXSA 1NU5A 2CESA 1RZMA 5C7HA 2R1LA 1U83A 4B16A 1LG2A 2G97A 1JEZA 3RPDA 2Y6ZA 1ADDA 4O1BA 1XLDA 2LLEA 1AODA 1BKSA 2FLIA 4CKQA 1R3VA 3QJAA 1A5UA 4HYVA 1YE6A 1UWQA 3CEUA 3SY5A 5HNUA 3CXOA 2ZDRA 5BWFA 2F9RA 3M0HA 4EPDC 3F4NA 4GQQA 3TTOA 1SW3A 3IK4A 4KEZA 1VS1A 2PTYA 3GG7A 2EPNA 3IUIA 1JCTA 1GZGA 4XSLA 4B5WA 2J7CA 4TTGA 4WR3A 4AY7A 5G2HA 4JICA 3L9CA 1A0CA 1O6IA 3LHYA 3RJYA 3RUBL 1BGGA 1SMDA 3RO8A 2J6XA 4PUWA 2J66A 2FMNA 1RPXA 1SZNA 1LT7A 2G3FA 3EOUA 1JAKA 3S2NA 5A6KA 2XINA 4QNEA 2WSYA 1KRAC 2Y8VA 1O12A 3GBDA 2J88A 2EQDA 3DHDA 5CJNA 3C52A 4XZHA 4H00A 2OEMA 4IPLA 1DWGM 1OY0A 3R12A 2WZMA 4GYPA 1TR9A 3W81A 1JZ5A 3E0WA 2VEIA 4S1FA 3N6HA 3R2GA 2PF0A 3F5LA 1LOLA 4AFYA 4Z42C 3L5LA 1TV7A 1S1PA 4AX7A 3WD0A 4BQ5A 1TVPA 4UFMA 3WK3A 5FAJA 5HR7A 1REQB 2VELA 4EAMA 3I3DA 1AW1A 1I1WA 7XIMA 2XIMA 3IIXA 2DV0A 1HVXA 4PMVA 2ALDA 3OHMB 3T44A 3KOFA 4TV6A 3WELA 1P0KA 3GC2A 3PBGA 5DMYA 1KBJA 3KAOA 1ZFJA 5REQA 3WF0A 4PTDA 4V28A 1XX1A 4L9ZA 3GXNA 2QUTA 1JULA 3FA3A 3DCPA 5FA5A 1EBHA 3W07A 2ACRA 3WH5A 3WD2A 3VPLA 1CLKA 1ZB5A 4OZOA 1R7AA 4CU7A 2WJEA 3V5OA 1J11A 5AYZA 5CEWA 3WD1A 3W7DA 3I4EA 3TJIA 4CUCA 2VRQA 5C9WA 3M9YA 3NSNA 4ASTA 3VOIA 4FOUA 2J9YA 3AUOA 1EA9C 4IPJA 3EWCA 1E1CB 1V3IA 1XSKA 2IQDA 4GUIA 3KLKA 2DVUA 4PB3A 2VX5A 3HV8A 2YXGA 1CB7B 3VOCA 1OIMA 1GKPA 2O55A 2ZUNA 3GVGA 4OBSA 3VKDA 3IPWA 4MKSA 3TYZA 1RHCA 5MF5A 2ZXDA 2X41A 3T0TA 2RH9A 1SPQA 3PUOA 3SCWA 1XIBA 4FS9A 3DUGA 4CN4A 1DJYA 1O7AA 2D22A 3MTWA 3W24A 5I02A 3IIPA 3FSTA 1UB3A 4GZIA 1C8YA 1I0DA 3ATYA 4I3GA 4FF5A 4HP5A 1EC8A 1IEWA 1V02A 1FY6A 3ZLFA 1UIOA 4LAZA 4FNQA 2A7RA 3GD6A 2Z1XA 2WO5A 1DJNA 2XN0A 4PEEA 1PJ9A 5KMYA 3WK1A 4PCFA 3RLVA 3A21A 1CXFA 3AS2A 5AZ0A 4HNUA 2PCEA 2VFDA 2OEKA 3FXGA 2P10A 3D5HA 1TPB1 3VNLA 2ZX6A 3UY8A 2NQJA 4US6A 4DO6A 1XS2A 1WPCA 2DQXA 1KTBA 3KVMA 2PI6A 1OFRA 2QIIA 3P7YA 4XZNX 3AISA 1HJQA 1WZKA 1G1YA 1PTDA 3WMSA 4GXMA 3HQNA 1IR1A 3SY8A 2PTXA 1XLEA 2J7GA 1O66A 4S39A 3WQOA 4MUPA 3VXGA 1H09A 2ZBTA 3DG3A 1BWVA 1ZUAX 2WSQA 3SCSA 3CZKA 1TA3B 2VM8A 3W7PA 3NUKA 5E1QA 3WQFA 2PU1A 2QGYA 2ZDSA 1GQJA 2BV9A 3HJEA 3DKJA 1BYBA 2WBKA 1DIKA 2DDXA 3BG5A 1OG0A 3NWRA 1KLYA 5DEZA 1CTNA 5C0QA 3L12A 4JX4A 3GU1A 4KFOA 1SJDA 4D1IA 4BS0A 4WY0A 2Y5EA 3WDIA 2BSLA 2R1KA 5D9PA 4UTIA 3IIOA 3L2LA 4IP4A 1JQXA 1HIZA 1WBHA 4RZBA 2HK0A 2WQDA 4UOZA 4E0CA 1FWAC 4Y6GA 3LHTA 1F3EA 3H55A 1EHNA 1LWHA 3ARYA 1E9YB 3NVTA 1IIHA 5E6ZA 3IAPA 2YDQA 2CLLA 5CAHA 3LERA 3LGGA 4A05A 3MANA 5CQ1A 5A3HA 4JL1A 1L0PA 1FDJA 3GNPA 3QSRA 1I60A 3CZEA 2PWHA 2W6RA 3PPGA 4CEUC 2Z6JA 3AROA 1R0MA 5D9MA 2WKLA 5HQEA 3QY6A 3M47A 2NVCA 2ISWA 4CD6A 3K8MA 4WKHA 2CBJA 3RCYA 4CQDA 4NKCA 1PUDA 4P7OA 3CV1A 4Q8QA 3TW6A 1IZKA 1W91A 2QV5A 1XG4A 1ZJAA 3N2TA 3MO4A 4HNVA 3LD5A 4HHHA 4JTQA 1FXPA 3FX4A 1C7TA 5G4WA 4JOMA 2YSWA 2P76A 2V3EA 3P74A 4JPGA 1OCQA 3VMOA 1Q8AA 3WQ4A 1XBZA 2NVDA 3BV7A 4PUKA 1E3XA 3QQ1A 1XJBA 2VVNA 3VNYA 3H2EA 3VGFA 4IPIA 4XKYB 1L2UA 4JHMA 3NIYA 1XD0A 6TAAA 1US0A 3DFHA 2BY2A 2WMIB 5M5DA 1XPGA 2CBVA 1GUVA 1UWRA 1IYXA 2A3BA 2WC7A 4OGZA 4JX5A 2EEXA 3CC1A 1Y65A 1JPHA 1TPVA 4LUSA 3TYBA 3W1MA 1E0UA 3BOXA 3FOKA 4JBRA 5I23A 4NI3A 1EBGA 1O1ZA 2VEKA 3BW3A 2VZUA 2GDUA 4AZCB 5LHEA 1DVJA 4HMEA 4LVGA 1WZLA 1SO5A 2OO0A 3A4WA 1X96A 3QM3A 4P8XA 2EAWA 1EQPA 1KFJA 5FJIA 3KLLA 4AZBA 4QJ4B 1HKMA 3CUXA 3MP4A 3Q58A 1NDYA 3SCOA 3KCLA 4MY8A 5HUPA 3B4UA 3SADA 3SN4A 1F6YA 1K4GA 2ZC8A 2DUZA 4PYSA 3LA4A 1AA1B 3E2QA 4EXQA 2NQHA 2OT1A 3LEPA 1EOMA 2HBVA 3TXZA 2AOSA 2CHOA 5JH2A 5G5IA 3ZT7A 2Z25A 1G01A 4L9YA 6REQB 1HUVA 4LV9A 3TMLA 3ABXA 4H7VA 3UR2A 3PR2A 2WV8A 2H8XA 1EF3A 4QLKA 1G0CA 2EGZA 4HN4A 3HGRA 4KEMA 3HBLA 2E3ZA 4X61A 5JMUA 3DFPA 4YVVA 2ZA1A 3QRHA 4WD0A 4YPJA 1EUNA 3LSCA 2QW5A 1V3HA 3RX3A 3AMLA 4DPPA 3S5NA 4BWLA 1R38A 2PRHA 8XIMA 1A53A 3BK0A 4H9ZA 5CSRA 4AVFA 3S47A 2CC0A 2EPMX 3C2EA 3KBMA 1G6CA 1HF6A 4GI9A 2PA6A 2VC5A 3EWBX 5DY2A 1NJJA 4U2YA 1R9YA 4FOJA 4LTSA 3BV4A 4TQTA 4C6JA 4WF7A 4MAVA 1GYLA 2QF8A 1GVSA 3A9IA 5LA0A 4IWWA 3LNPA 2YPIA 2ADAA 3TQ0A 3L0KA 2I56A 4NQ1A 4S2CA 4JFTA 4NYUA 4M24A 2IPWA 3UZJA 4PN2A 3ENLA 1GZJA 3L4UA 2GQAA 1XRFA 3ES7A 3WCZA 5JUVA 3LDVA 5CSYA 1XLFA 3DBNA 4EOUA 1OFEA 3L4XA 3SN1A 3MVIA 4HTBA 5I3JA 3WQWA 2WMFA 3ECQA 1QPNA 2IXUA 2O4QA 3S3GA 4J2PA 2EPOA 2PDYA 1EWEA 1KCZA 1KCXA 3RLGA 3MHGA 1A5SA 1NOWA 1H41A 5JVLA 1RA0A 1VZWA 1CXEA 1G69A 4GYPC 1VJSA 1K7EA 3AHVA 3S6TA 2PDQA 2PCQA 3GH4A 3PUGA 3BOLA 5DFAA 2BY0A 3RM9A 1E0TA 3PJUA 5EBUA 3C8NA 5AZ1A 4IFKA 2ZUTA 3VZYA 1CGVA 2J77A 3STGA 2FGBA 3BZGA 1DIOA 3LXAA 4V33A 3SBFA 1LQ0A 2DZPA 1PEZA 1DJHA 1OCJA 3NGJA 5TNVA 1TRIA 1OSEA 3ITGA 1W1YA 2NQ9A 2D2JA 5DT7A 2NUYA 2I5GA 2VR5A 3CUZA 3GG8A 1EJUC 3GB6A 1PX8A 1SJBA 3VIKA 2CEQA 4PZVA 1YXCA 3OVQA 4CD7A 3ANYA 1R9XA 1IEVA 2C7FA 3URAA 1F8IA 1GOKA 3DU0A 6CGTA 2I57A 3GW0A 2L5HA 2B7OA 4CNTA 3GH7A 4GX8A 5AC8A 1FWBC 4NU7A 1WUEA 1BEUA 1EWDA 3BAXA 2VNCA 1X8FA 4M1RA 2Y5JA 4WUIA 1P0EA 5GNYA 3NG3A 4LEQA 1XPYA 1P6CA 5FF3A 4AY8A 4JTUA 3CQHA 3CUJA 2YR1A 3UG8A 3T2QA 4HU0A 1R7OA 1BVWA 4P2VA 1JI2A 2PUZA 1FTXA 1V3KA 3K30A 1KRBC 1NIUA 4QFUA 4ZTYA 3LHZA 3FKRA 3UVIA 3B3DA 1AMYA 4Q8OA 3CM4A 1UR9A 1YTKA 1ZU8A 3G6LA 2F38A 1H7NA 4FPSA 3W73A 4NJJA 5BOFA 4A3RA 3NM3A 2ZZ2A 6ALDA 3T0DA 3TOYA 4ZEPA 4HNTA 1TCDA 2VJXA 3WMBA 2PDIA 2QJMA 3ARVA 3ZZ1A 4UTHA 3BGJA 1ZQ5A 3RILA 1BQCA 3H24A 3BO9A 1SJAA 4J3TA 4NX5A 3JVAA 2GK1A 4PMJA 1W0MA 1ESWA 2AMGA 4IZGA 4DUXA 4J3WA 3D6NA 1WO2A 4O19A 3NQ7A 3NVDA 5HMDA