1W8SA

The mechanism of the schiff base forming fructose-1,6-bisphosphate aldolase: structural analysis of reaction intermediates
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
250
structure length
250
Chain Sequence
NLTEKFLRIFARRGKSIILAYDHGIEHGPADFMDNPDSADPEYILRLARDAGFDGVVFQRGIAEKYYDGSVPLILKLNGKTTLYNGEPVSVANCSVEEAVSLGASAVGYTIYPGSGFEWKMFEELARIKRDAVKFDLPLVVESFPRGGKVVNETAPEIVAYAARIALELGADAMKIKYTGDPKTFSWAVKVAGKVPVLMSGGPKTKTEEDFLKQVEGVLEAGALGIAVGRNVWQRRDALKFARALAELVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FRUCTOSE-BISPHOSPHATE ALDOLASE CLASS I
publication title Mechanism of the Schiff base forming fructose-1,6-bisphosphate aldolase: structural analysis of reaction intermediates.
pubmed doi rcsb
source organism Thermoproteus tenax
molecule tags Lyase
total genus 94
structure length 250
sequence length 250
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 4.1.2.13: Fructose-bisphosphate aldolase.
pdb deposition date 2004-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1w8sA00
1SZFA 1GVSA 2EHHA 2RKXA 2FJKA 3FYPA 2E68A 1QDSA 4GWEA 4LTSA 4E0CA 4MZYA 3W7PA 2YCEA 4IMGA 3A5VA 4MY9A 4O57A 2OT0A 4ZQPA 3W7EA 3TA6A 2C18A 4O52A 3VNDA 1LDCA 1FBAA 2ZRYA 2O7QA 2JKPA 3C52A 1W5NA 2QEZA 5K3VA 3MP5A 4K37A 5IBXC 4O53A 3CIWA 5ABTA 1EWEA 1ZNNA 1H63A 3G8RA 2ZA2A 5IBXA 4GFSA 1G7UA 3BLEA 1AMKA 1I2QA 4JY9A 1ZJIA 2RH9A 3GX9A 5D37A 4NJIA 3MJYA 5DBUA 4UFHA 4C1KA 4A2SA 1AW5A 3MI6A 3M6YA 2E6YA 1QFEA 3C0JA 1F5ZA 4IJBA 3G1AA 1TV8A 3P8IA 3NQVA 4K7YA 2A6NA 5KINA 4UFKA 3VCRA 2E1DA 4FX6M 3W7NA 3NQMA 4MY1A 4CNOA 1SR9A 3WJWA 1W5QA 4P61A 4LY8A 5C54A 1W37A 1SZGA 4RXFA 3W1PA 3HGSA 2FLIA 4TMCA 1TYGA 1HL2A 1LROA 3UWWA 1SU5A 1QMLA 3TROA 3C2FA 1FQ0A 3WK0A 2XN2A 2R14A 3ANYA 2GVLA 4JTJA 2QCLA 4DPQA 3IVTA 3C6CA 4S1FA 4CNNA 3N2XA 3LM7A 4N02A 4RXGA 2A4AA 4N9CA 3C3NA 1W5OA 1Y0EA 5I3JA 3B0UX 3NYZA 4EOUA 3GAYA 3KX6A 1I2PA 3W2UA 3G1HA 1A53A 1ADOA 3G0SA 5D2YA 1SO6A 1RQBA 1FXQA 1CI1A 1BTMA 4XKYB 3TQKA 4IMEA 4MPQA 3O8AA 1YPIA 3KVMA 3HGJA 3SSJA 1JCMP 2J88A 1A5SA 3W2NA 1HUVA 3VE9A 4RKAA 3LHVA 3LV6A 1WBHA 3VE7A 1O5KA 2Y62A 1XUZA 4O12A 1ME7A 2YX0A 4MFEA 4O19A 5CPOA 1SW3A 3W7MA 3MUXA 1GOXA 4M5PA 4LS1A 3DHDA 3KRZA 3I6RA 4NU7A 3CLMA 3S8HA 4O1DA 4Y6GA 3BLFA 2DJXA 4I7VA 4ML9A 2XN1A 1TQJA 1FDZA 4DO4A 3CM4A 1GYLA 1YXDA 2DZXA 4IXHA 4O54A 2CZ5A 3GXTA 1WA3A 1AL8A 4OT7A 4UMCA 3RLVA 2E77A 2CLOA 3C8FA 1TPUA 4N6EA 1MEIA 2Y6ZA 4JTIA 3GB6A 1DL3A 2GJNA 1S5WA 1TPFA 5EL1A 4HPXA 3LTPA 2A6LA 3DFOA 4XKYA 1HTIA 1LCOA 1SO5A 1VCVA 3HPZA 5LNWA 1PV8A 5D2XA 2QR6A 2WO5A 1FWTA 2C14A 1M5WA 1I4NA 1JCJA 1OFBA 1QWGA 4Q32A 3UWQA 4E38A 1JULA 2H3BA 4IMFA 3S5OA 4N9BA 1H60A 1TSIA 3PSVA 1G6CA 3LOTA 3FIGA 3TFXA 3G1DA 3FJ6A 3A24A 4I9AA 4N6FA 3G3MA 3PY2A 2DZPA 5AHEA 4WXYA 4HNNA 3L0KA 2QUUA 3L0GA 3U2OA 5LGXA 4DF1A 4ADUA 3BK0A 3N73A 3LCWA 4FNRA 1SSGA 4N9EA 1I2NA 3M5XA 3B06A 4NUWA 4UFIA 1TB3A 5FI8A 8TIMA 1YTEA 3I7QA 3P7YA 1XC4A 4ZL1A 3STGA 1QO2A 4FEZA 5LGZA 1ICQA 1RQEA 1GYNA 1ZAIA 4GJ1A 4POCA 3W83A 2CLHA 4ZVJA 2P10A 1VGAA 1R30A 3E9AA 5J5RA 3O1NA 2VELA 4ORIA 1JCLA 1T0OA 1KV8A 4QITA 3N34A 4IOTA 4HT3A 2UV8G 2GOUA 3RK8A 4IMDA 1KBJA 3W07A 4O16A 5AC8A 3UQNA 1QPOA 1M7PA 3W88A 4Q33A 1H1YA 1EP2A 5FF2A 3SZ8A 3L66A 4U4MA 1ALDA 1VJIA 2ALDA 5IM51 3R5EA 4NX0A 1X1ZA 1D3GA 1R46A 2DZUA 2QUTA 3IRDA 4N2YA 3C61A 1G4SA 1ZAHA 1YDNA 3OVRA 3SFKA 1UBSA 1IXQA 1W8SA 1N8FA 4MOZA 3PG9A 3L65A 2CFFA 3NVTA 4WY0B 2ZZ6A 3NQCA 1OYAA 1C9DA 3S6DA 1TV7A 3O07A 3NQ8A 3E02A 1O60A 1YDOA 1TRDA 3U6WA 1SUXA 5EYWA 3UD6A 2GQ8A 4ZMGA 4GUIA 3DZ1A 3W1RA 3IGXA 1KW1A 3SIZA 3CEPA 1D3HA 2YDAA 1MSSA 3PR2A 3GNNA 4AHPA 3CTLA 1BWLA 3UZJA 4FO4A 2YSWA 4FNTA 1KM1A 3F4WA 3P62A 2C6QA 1FCBA 3M16A 4IMCA 2ZZ4A 4M6PA 4TO8A 1ZFJA 2J9XA 1U83A 3VI2A 1DHPA 1RQHA 2V82A 3NQEA 3UZ5A 3CC1A 4NJJA 3LCHA 1OFOA 2E6DA 3GXPA 2NV2A 4XZ9A 2V9DA 4UTWA 1L9WA 3C2EA 1XBYA 4GC4A 1LRNA 4WY0A 5HULA 4Z1AA 3HQ1A 3MBDA 3G18A 1OFDA 2X1TA 4HN4A 3YPIA 4UR8A 5HWJA 3LB0A 1K8YA 1TREA 1NEYA 3NPWA 3RFAA 1F6PA 3L2IA 3W7RA 4L4LA 4PCFA 1VR6A 3DKLA 1OG0A 3NQAA 5KZDA 1OFRA 2E09A 1WV2A 1HO4A 5AYYA 1LRQA 1QPRA 5F2GA 3TK7A 3IGSA 1VCFA 3CWNA 1IXOA 2J9ZA 4O4WA 4ICNA 4JYFA 5EMUA 2B7PA 3LRKA 1KM3A 3W86A 1WOAA 3W70A 2WNNA 4FXSA 5D2WA 1K02A 3H54A 2H8XA 3G1VA 4QISA 4S2CA 4HKPA 1LLWA 3NQGA 5K9DA 1K8XA 4NZJA 4AAJA 3L5AA 3PUEA 1YPFA 2QJHA 1JUBA 3ELFA 3P5YA 1JRCA 3WJSA 1UUOA 4N4PA 5LZLA 1LYXA 3DFQA 3L5MA 2JGQA 5J5DA 1TCDA 3TSMA 1Z44A 1KFKA 2FPTA 1XUUA 2NX1A 2QCGA 5CZJA 3SGZA 1JCXA 3F4NA 1XL9A 1VLIA 3QC3A 3V75A 4QSHA 3DFSA 2QF7A 2FIQA 1PHQA 1H7NA 4MUZA 3ZFHA 3HJZA 2LLEA 2CLMA 3MO7A 1DOSA 3M1ZA 4E2DA 4AWSA 1OF6A 2V81A 3BG9A 4UFLA 1VYRA 2Y7FA 2BSLA 1VCGA 2FTPA 3TMLA 1GVFA 4TX9A 3W72A 2YXGA 2Q8LA 2TPSA 1O95A 3N9SA 3R13A 2YGYA 3W73A 3STCA 1GEQA 1O5XA 3EWXA 5CZ0A 1VLWA 3HG4A 2ABBA 5E0KA 1W0MA 3TSDA 4DELA 3FLUA 1GTHA 3LI1A 3RU6A 3DXIA 3GYEA 3A5FA 3K30A 3KOFA 1YADA 3LX9A 1QPQA 1H1ZA 2FQIA 5I3IA 1TQXA 4XBKA 2VEMA 3W9ZA 1I45A 2JKAA 3ZS4A 5BOOA 3A22A 1JQXA 1P1XA 1WOBA 3IV3A 4JICA 3T7VA 1F6KA 5FF3A 4WQ6A 3NG3A 3O16A 4X3ZA 2B7NA 4KKXA 2XN0A 3GKFA 3BG3A 3PULA 3RLUA 2A2IA 3NEVA 2ZDRA 1GVOA 1SO4A 3QW4B 1H51A 2R94A 3O6YX 4PA8A 4CQAA 1ZHAA 2B7OA 4LUIA 1B57A 1XBVA 2VEKA 3HPXA 3DENA 1GJPA 3HMJG 2ZZ1A 5DY2A 3W23A 3TDFA 4GUFA 4L4MA 3TC6A 4M6QA 1OFPA 2BTMA 3LHTA 1EP1A 5F2MA 5CSRA 4NJKA 3GDLA 3QSRA 1KBIA 1FDJA 3NDOA 4XTIA 3SR7A 4BI7A 2OMAA 5D30A 4JDBA 4Y8FA 3Q58A 2CLEA 1FUYA 1LLZA 3BW4A 4R33A 3TSBA 1N55A 5DLCA 2QDHA 5CZTA 3KAOA 5D2VA 2JKEA 5BMWA 3W2KA 2EF9A 1T96A 4LC8A 3NQFA 2DJLA 5AHIA 1B4KA 2QUVA 4AHQA 3B03A 2A21A 6TIMA 1XCFA 1H7WA 2ZA3A 5G1TA 4YCOA 4XTDA 1FCQA 1V5XA 2ZZ3A 3EWWA 3T78A 3FEMA 3UWVA 3P60A 1GTEA 2RHGA 3TIMA 1EUNA 3OVPA 4TR9A 2Y61A 3A21A 5HINA 4UNLA 4JY8A 3P74A 5LHEA 4JS3A 1IXNA 4FX7A 1TIMA 4UTKA 2ATSA 1WX0A 2O7SA 3KHJA 2E5DA 2ZRUA 2ZZ5A 3FKRA 1A5AA 3JRKA 3TE9A 4O1BA 4FB7A 1SW7A 3AJXA 4OE7A 3P82A 5DCBA 2GQ9A 2PRMA 4O8RA 4GUHA 3EWZA 1EIXA 2I1OA 3W1UA 3UXAA 3O15A 5K4XA 1JJKA 2EKCA 2B7QA 3IGUA 2ZRWA 1FCVA 3N9RA 4O13A 4CNPA 3PWAA 3EEGA 1VYSX 3FYOA 1H50A 2DZVA 2QJGA 3N19B 1K7XA 3UYCA 2FB3A 2X1SA 2W79A 1KTNA 1WXJA 2OJPA 2QCFA 1OFAA 2VFHA 3EWBX 4JTGA 4WD0A 3B8DA 1H61A 2W6RA 3AO0A 3OHIA 1TTQA 3KXQA 2Q3OA 5DY3A 5G2WA 4WXZA 4FNQA 3LCFA 1LRTA 4PODA 2EPHA 3BGJA 3S1XA 1ZAJA 1LTDA 2G5WA 3HGRA 2ZQ0A 2PC4A 1H5YA 3A9IA 3EX1A 2YPIA 4UFJA 3KFTA 1MO0A 1R47A 3ABQA 2A0NA 2X16A 4IXXA 1JRBA 3A23A 4LWWA 5I3KA 1GQNA 1NAL1 2NWRA 3E96A 5D33A 1AL7A 3P8JA 1SZNA 5LNRA 1JVNA 3QPZA 4Y90A 3QF0A 2V30A 3LXAA 1X6UA 3TW6A 4PL1A 2OX1A 2NXGA 2CZFA 1ICSA 1HG3A 5F2IA 4JEQA 4YLWA 1K8ZA 2OT1A 1H7PA 5D09A 3WJYA 4RZ6A 2TRSA 1JUKA 1DJQA 3TR2A 2Y89A 1O4UA 1J5TA 5MHBA 3NPVA 2WOQA 4UMBA 5DELA 5CPNA 3DFNA 4WZHA 1AK5A 2ZRZA 3NQDA 4MKNA 1TPWA 4HIBA 1OF8A 3BGGA 4MYXA 1OFEA 4OV9A 1KFCA 2Y7DA 4NVTA 2ISVA 3PVFA 3PG8A 1TPDA 2E5BA 1LM1A 1GPWA 4NXKA 3DAQA 3BVJA 3EWUA 2CZDA 4AEOA 1G4TA 3TCEA 4OU1A 4K38A 4PL2A 4JYDA 3EX6A 4RZ4A 1LBFA 4IPIA 3TV8A 5FF7A 1CX9A 1F7BA 1K7FA 4A3UA 1W54A 2ZTKA 1KLZA 5LNVA 3E12A 2ZFAA 3W7QA 4CCCA 3OA3A 4KFPA 1L6SA 4XBSA 3LBMA 4KWWA 1N7KA 3V1PA 4GRSA 7TIMA 1DQXA 4GUJA 1VHCA 2QJIA 4UTLA 2V0TA 4Y96A 3EXSA 1EP3A 3WFAA 2V5BA 1K7EA 5D05A 3GDMA 4WY0F 3G0XA 2Y7EA 1TRIA 3LCXA 2HS6A 4QIUA 3BPWA 4DPPA 4JX5A 2B4GA 2Y63A 1KFEA 4DEFA 3W3OA 4Z08A 4JD4A 2VFIA 3LXCA 5AHLA 4JTLA 4NQ1A 2A1YA 5F4WA 3LBCA 3NQ7A 4UMAA 4PTNA 1K03A 1L6YA 1G4EA 1C29A 1KM6A 2F7FA 3OBKA 1O94A 1VRDA 3G0UA 1I8JA 4A29A 1G67A 3TJLA 2Y88A 1W3TA 2V5LA 4YMZA 4X22A 3TC7A 3P5ZA 5TIMA 1TPC1 4LVBA 1F73A 1YTKA 1F74A 1OABA 1GVRA 3B4UA 4R34A 1JCNA 5LSMA 3QMTA 4PC8A 3CU2A 1SZEA 3S5YA 2P0OA 1LP6A 2TYSA 2JGYA 5AYXA 3MYOA 3CHVA 3W1TA 5DXYA 2J6XA 4HNVA 5KTLA 5GVJA 1OK6A 1SFJA 2DZTA 3HIJA 4FIQA 2PRHA 1PCWA 3LCLA 4CCEA 4O14A 2HTMA 4K8HA 5LKYA 1YDVA 1OX6A 1PHWA 5HR6A 3KVKA 1UASA 2PCQA 3EXTA 3LRLA 3CEUA 4UR7A 1ONRA 1SO3A 5KZMA 3NM3A 2FPVA 3G1YA 3ABSA 3EB2A 3P61A 4K6AA 2BZNA 5AC7A 4LW7A 1OX5A 4DXVA 3L5LA 3DFTA 3W6YA 4RK8A 1FDYA 3GDKA 1IIGA 3TX9A 4AVFA 4NT0A 1SFLA 1KFLA 2OCZA 5EKYA 1X7FA 2VFFA 1W5MA 1TTJA 3I68A 3FJLA 1Q45A 1Z48A 3W1QA 3W87A 2PE4A 1J2WA 2V2DA 4HSOA 1YXYA 3DGRA 4Z0JA 2R91A 1PL9A 1NF0A 1VYPX 2Z1BA 3QMSA 4QM1A 4DBDA 2CLKA 3EX4A 3NL5A 1NVMA 4D2JA 2VOMA 3TXVA 1PE1A 1GZGA 3C2RA 4AXKA 4UUIA 3O06A 4JTFA 3QJAA 5FEZA 3SY5A 3GZ3A 1VHNA 3BW2A 4UTWC 4UTMA 4WX2A 3FA5A 4KWVA 4WJEA 5HMSA 1SSDA 4FF7A 2NXIA 3GNDA 5G4EA 4MY8A 2Q3RA 4QJ1A 3CPRA 3MHUA 2QCCA 2C19A 4NNAA 2J24A 4PFMA 5FF4A 1LZOA 3DU0A 3PBVA 3EWYA 3IIPA 4MJMA 3TW7A 4Z0SA 1T99A 4GUGA 4JTTA 3MW7A 2YW4A 4FNPA 5D32A 4TU1A 1W5PA 1GT8A 1Q6OA 2HS8A 4BI5A 3T44A 2ISWA 1TJPA 3C2VA 1KV5A 1UCWA 2QAPA 3W2LA 4LV4A 1WDWA 5HUPA 4RJEA 5AHNA 1TPH1 3ATZA 3HBLA 5I3FA 3WJXA 1DKWA 1DORA 4MFDA 1WQ5A 5FEPA 2VENA 3THAA 1LOQA 1W3NA 1OYBA 2X30A 2YYTA 1E51A 1JUEA 4QAIA 4UTIA 1B4EA 1OJXA 4JX4A 5HJLA 2GUUA 5U4NA 4JTHA 4O1AA 1KM4A 2GPTA 2WNQA 2IQTA 4RLIA 3IIXA 3STEA 1F76A 4JDYA 2C3ZA 2ZRXA 1QR7A 3QEZA 1SW0A 3MP4A 2NUYA 1QO5A 3TQVA 1ZCOA 1EB3A 3U8GA 3M7WA 4MLJA 5G1YA 4ZQNA 5LHFA 4XUGA 1J4EA 3W1LA 3PS7A 1I2OA 1H7RA 1JR1A 3MI2A 1P0NA 3NXFA 1TPEA 4NNCA 5BMXA 3HG5A 1RVGA 5LNUA 2GVGA 3ZWTA 4IWWA 3G1SA 2J27A 3VFLA 4O0ZA 3MBFA 5DN1A 3W7LA 1YLVA 4UTTA 3CIXA 1UB3A 1H7XA 5FEXA 2DZSA 2TMDA 3UNDA 2A7NA 1ZY9A 3W2MA 5CZSA 3Q94A 5SWUA 3PB0A 4UTJA 4ZQMA 3IEBA 3GIYA 1OX4B 2ZBTA 2BX7A 2BXVA 4MZ1A 1KFJA 4H4IA 3IIOA 4FX8A 5G2IA 1IIHA 3W7GA 4LVGA 4LC6A 4HNUA 2YYUA 3Q37A 4AWUA 2YR1A 2ZYFA 2CZEA 1ME8A 1HO1A 3B04A 3SI9A 3W84A 3PB2A 4H3DA 1P0KA 4UCGA 5G4WA 5FF0A 2C16A 2VFDA 4C1LA 4IQLA 2WSQA 5KSWA 4LVFA 1OK4A 3LXBA 1L2UA 1VS1A 3M0ZA 3LHYA 3HO8A 3R12A 1NFBA 4ZQOA 3W7IA 4Q4KA 2Y85A 3KVJA 4XQ6A 1XFBA 2WQPA 1XXXA 5G5IA 3PBYA 1T8XA 2DP3A 2V2HA 3EKZA 3UXDA 1RD5A 4TIMA 2ZZ2A 3RNDA 4O11A 3WK2A 3CWOX 3W7CA 2A7PA 1WBJA 3QMRA 1ME9A 4K8EA 1MEHA 4YCPA 4UTUA 1OX4A 3HB9A 1DBTA 1ML1A 2NUXA 1KLYA 4FXRA 3O63A 4JNMA 5D2TA 3RMJA 2GVJA 1Q6LA 4A2RA 2ZTJA 3N2MA 2NUWA 4IPJA 4NX5A 5DCDA 2WSRA 4ZQRA 5H2ZA 2GJLA 4YXGA 4O17A 1FXPA 6ALDA 4UTHA 3B0PA 4W9TA 5E93A 4BFAA 1VC4A 3INPA 3W76A 3IIVA 1Q6QA 3W7DA 1PS9A 1YTDA 3D0CA 3M9YA 4KFNA 3LCGA 4MIMA 2FPYA 3PUDA 3VKJA 3I65A 5HWMA 5CG7A 1FX6A 5CPLA 1YYAA 4S2BA 4AH7A 2JK2A 3BLIA 5D03A 4NNBA 3LGEA 2Z6JA 3NPUA 2YZRA 1XBZA 2NX9A 5DXXA 3L21A 2QAFA 4NJHA 3MWAA 3MI3A 3JS3A 5D02A 5D38A 4UFMA 3OG3A 1GG1A 3KVLA 5AC6A 4LS2A 3P67A 3GKAA 1TV5A 3NR0A 3LI0A 1DQWA 3HF3A 3THQA 2G97A 5FESA 2AAMA 5F1UA 2WSYA 5A5WA 4AMAA 4Z1CA 5H91A 4NJGA 1KM0A 1W56A 2HSAA 1VH7A 3PBUA 3T4CA 3W1XA 1D9EA 1EUAA 4JTUA 3IVUA 3UY7A 3LHUA 3LDVA 2Y7GA 2QCMA 2JBMA 4UXDA 3KRSA 3ATYA 3C4UA 5L9FA 2YFNA 2E5CA 4JIQA 3LTSA 2QCDB 1H7OA 1KM2A 1XM3A 5HNRA 1VPXA 2RDWA 3FS2A 4GNJA 4O28A 1AW2A 3G3DA 5CPMA 4LOCA 3CQ0A 5BRBA 3B05A 1CW2A 2G95A 4TMBA 1THFD 1R2RA 4BK9A 4AF0B 5K2ZA 4LVDA 1EEPA 3OEXA 1Z41A 1IGSA 4RV8A 1L6WA 1K3UA 3TMQA 4NXSA 1EX5A 3H55A 2VFEA 4LUJA 3KRUA 4MVAA 1NF7A 5A8GA 1PCKA 5HQEA 4BR1A 3BV4A 3F1QA 4KFOA 1G7VA 5I3GA 2VEIA 4EVZA 3F03K 2FB2A 3L67A 3W71A 4JTEA 1Q3NA 1Q6RA 3E0IA 2QCDA 1KFBA 3MP3A 3MMTA 2C13A 1PVNA 3IIZA 2DORA 2H90A 4IUOA 5F4XA 3W22A 2YW3A 4G1KA 1M7OA 3TXZA 2WJZA 4X2RA 4ZQCA 2H8ZA 3OIXA 2AGKA 5EBUA 3UWYA 3GDRA 3PSWA 3B0VC 4ADSA 1Z42A 4P2VA 5EA9A 1JCYA 1LBMA 2TSYA 5AN7A 5HWNA 4MLRA 1TPVA 4LRTA 3G24A 4AF0A 1P4CA 2RDTA 3TJXA 5U7SA 2Y70A 4WUIA 2D73A 2EGZA 3HOJA 1TO3A 3L0NA 4H6KA 4WOQA 2QDGA 3E49A 4MJZA 5AHMA 1MEWA 4AB4A 3O05A 4O15A 3DHFA 1R2SA 3S42A 1LOLA 4N9DA 3GK0A 3G1XA 4OHQA 4OBTA 1OFQA 4K36A 2Z2UA 2HMCA 1ZALA 5K7JA 1S5VA 3DI1A 1VQTA 4O50A 2CLFA 5TBOA 4JTKA 3S5NA 3TAOA 3ABRA 5BW6A 1RR2A 1EWDA 1UJPA 2PURA 2J9YA 5C5YA 5BNKA 2VC6A 3GXNA 5KZEA 3NZRA 3WK1A 3L68A 2NLIA 5EY5A 5DBTA 2XFWA 3G22A 1H62A 4AHOA 4OWGA 2FDSA 4O18A 4BWLC 4LV9A 4M19A 4YWIA 3O6CA 4BWLA 4IX0A 1R2TA 4FHAA 3PBWA 2WV8A 5F1VA 4LNYA 1A5BA 4BF9A 3NL2A 3G8EA 1AG1O 1W1ZA 5C55A 4M7SA 1TJRA 1OVDA 1P5BA 3HG2A 1FWNA 3LLDA 4ZZ9A 4JX6A 4I7WA 2AQWA 3QQ1A 4A22A 5K9XA 2A5HA 3TAKA 1W3IA 3PM6A 3S1WA 3BO9A 2WKJA 2NZLA 1FWWA 3R2GA 4AWTA 1QOPA 5KITA 4RX0A 1BEUA 5G2HA 5HUOA 3GR7A 3NQ2A 5AYZA 1XDLA 5L6UA 3W7JA 3OVQA 3PUOA 1XDMA 3N14A 5E1QA 5K4ZA 1KTCA 4UC5A 2QKFA 1WAUA 3ZWSA 4CLMA 1FY6A 3MYPA 2CW6A 3TFCA 2C15A 3W2JA 1S5TA 2QCNA 5C6MA 1EA0A 1G4PA 2H3DA 2E6FA 4R7JA 2V2CA 4Z1DA 4U28A 4EWND 1JQVA 3HG3A 2VEPA 3C2OA 4O4VA 2DZWA 3GVGA 1QAPA 2CLLA 3EXRA 3NL6A 3UY8A 4DQWA 4K39A 3T40A 1TMHA 1FCUA 3QW3A 2VKZG 3W1NA 5FEWA 1X8FA 3NL3A 2X1UA 2CU0A 5D04C 3M41A 1ICPA 1I2RA 4K7VA 1BKSA 3W7HA 3LTYA 3FFSA 1ZENA 1KA9F 3N3MA 1W31A 3TU9A 5HR7A 3SW6A 3DI0A 3NQ6A 3TH6A 3QZEA 3QSTA 3ZR4A 3M47A 4LT9A 2NV1A 4FNUA 3USBA 4GE8A 4Z1BA 3M43A 4JN6A 4CQ9A 4UNKA 4FIRA 2ABAA 1UUMA 2I14A 3P80A 4ADTA 5K9CA 2ISSA 3NNTA 1DVJA 3I7RA 1GVQA 4R53A 2RFGA 2DU2A 1WYIA 3BARA 2ATMA 3TNOA 2GQAA 3UWUA 2EAWA 3TUUA 2VXNA 3GLCA 4I7UA 4O10A 1XI3A 3JR2A 4LS0A 3GAKA 3HPSA 4JYEA 1C8VA 4QNWA 1RZMA 4HNTA 3EX3A 1FWRA 1VZWA 5TQLA 2WNZA 3FKKA 3M5YA 4OV4A 1LORA 1LOSA 4O1CA 3DFPA 5AHFA 4CQ8A 1F2JA 4XWUA 3R8RA 3WK3A 2A7RA 2Z6IA 3DH7A 4JXCA 3TKFA 5AB3A 2B0MA 1DJNA 1MXSA 3W1MA 1OYCA 1B9BA 3I7SA 3GDTA 1XKYA 3SECA 4DO6A 4LVAA 2WPBA 3QRHA 3QM3A 5EPDA 1TPB1 4QQ3A 1LBLA 2NWSA 3W7KA 3RF9A 3M5ZA 5AFDA 4UIOA 1QOQA 4WOZA 4DF2A 1QPNA 5CKSA 3NO5A 4OQVA 3DBPA 1DV7A 3M44A 1TTPA 1V7YA 2C1HA 2QCEA 2CWNA 3NZ1A 3NGJA 2BWGA 3M5VA 5I3HA 2ZCGA 1IF2A 1RV8A 4M6VA 3P84A 3EX2A 3QFEA 4JIPA 3T55A 3LV5A 1S3HA 3H53A 4ORMA 4Y9AA 4RZ5A 1OHLA 4ALDA 3NM1A 2BLEA 2C0AA 2NX3A 2FFCA 4N4QA 4UTTC 2NXHA 1GG0A 3S0CA 3L9CA 2OZ0A 4LU0A 2X1RA 1SQ7A 3O6DA 3BG5A 1FWSA 2V8ZA 3SJ3A 1EPXA 4DF0A 3LLFA 5AOUA 3FOKA 3EKLA 2P1FA 1HFBA 3ABOA 2Z0IA 2R8WA 4EIVA 5CGQA 1KM5A 4RR4A 1GWJA 2PRLA 3QH2A 5F4SA 5C2XA 4ONVA 3G1FA 2KZHA 3W74A 1YXCA 4HHPA 3PF3A 3W1AA 3SGUA 4YL2A 4DBEA 3MHGA 1QCWA 4GBUA 4BI6A 1TTIA 4IX2A 4HPJA 4JGDA 2CLIA 3QYQA 5CSSA 3S9YA 4PH6A 4GXMA 1PIIA 1G69A 3LCIA 2F84A 3UWZA 2ZA1A 3LRMA 3GR8A 4B5NA 4QNEA 4HSNA 5KMYA 1IXPA 3DKJA 4FNSA 3S1UA 4J9JA 2RDUA 1BWKA 3WJZA 1QNVA 3NOEA 3UPWA 4RCXA 4IGHA 3W75A 3NPXA 2G96A 1A50A 5F2LA 2ZRVA 1NSJA 3P81A 1M6JA 1KTBA 3CB8A 4MYAA 4JR5A 2E6AA 3TQ0A 3W7OA 3S1VA 3LHZA 1B3OA 4DO5A 2W0UA 2I9EA 3HGOA 2H6RA 1RPXA 2Q8ZA 3C56A 2YFOA 1XBXA 1MZHA 3S5ZA 3STFA 3W85A 4O0KA 3NAVA 4OGZA 3QPYA 1X1OA 1AW1A 2X2GA 4LRSA 3PC0A 3PAJA 2QCHA 2ZZ7A 3LHWA 4PEKA 3R89A 4JTSA 4E2BA 3LERA 5DCEA 2VFGA 3BW3A 4A21A 3MHFA 4M7TA 3Q2DA 1F05A 3CT7A 3NA8A 4MZ8A 1SPQA 3UPBA 4CCDA 4EF8A 4X9SA 5LNSA 3IVSA 4NZFA 1U5JA 2A85A 4EF9A 1A5CA 5T26A 3QQ0A
chains in the Genus database with same CATH superfamily
2RKXA 5D8ZA 1QDSA 4LAMA 5HMDA 2QUMA 4E0CA 3AXIA 4MY9A 2I7GA 3GVQA 4IP4A 4REQA 4O52A 3V1HA 3VNDA 2PLCA 2ZRYA 4PMYA 1C90A 1MI3A 4RE0A 4K37A 5IBXC 5C71A 2PD5A 3G8RA 2QPUA 3EDKA 5IBXA 1VFHA 1J6PA 1ZJIA 1U5HA 2RH9A 2XVGA 5D37A 1TG7A 2J7EA 5MKGB 3WSUA 3UU0A 1A5UA 2VZTA 2WVSA 4ZB5A 1F5ZA 1E4NA 1V02A 2PBGA 3T09A 1BF6A 1GW9A 1EQPA 3VCRA 1QI3A 2E1DA 4FX6M 3W7NA 3NQMA 4I5RA 4CNOA 1F8IA 4XX6A 3ZVHA 1EYEA 3WJWA 3T1GA 1BD0A 2EPOA 4UOQA 3S2LA 2FLIA 4I5XA 4TMCA 1FWGC 1HL2A 2PDMA 3WD2A 3COTA 3VGEA 4QG8A 1PPIA 2XN2A 2FYMA 3ANYA 4Z2IA 3R11A 1KCLA 4N02A 4RXGA 4Q7NA 3U3HA 4M51A 2DPEA 5MKGA 1DXIA 4H8UA 4QEHA 1WB0A 1S2AA 3FSUA 4B3KA 1A53A 1POKA 2PPGA 5D2YA 1RQBA 1FXQA 1CI1A 4MWAD 3UW6A 3O8AA 3KVMA 4HYRA 4UBPC 3SSJA 3C86A 3I4EA 3PPHA 4RKAA 3UVAA 3LHVA 3TOYA 4IJRA 1WBHA 2Y62A 2YB4A 1V0LA 3MUXA 4XAGA 3DHDA 3KRZA 4NU7A 4L64A 4O1DA 1QNRA 4Y6GA 3A4JA 1TQJA 2Q02A 4Q4QA 1EBHA 3EPMA 3CM4A 4NY2A 4UQBA 2DW6A 2YIHA 3RM4A 4IXHA 3AZRA 3E2RA 4UMCA 1PXGA 2E77A 1EBGA 1LWHA 1W91A 3VKBA 4CD4A 2BP1A 1DJGA 5F7UA 1VKFA 1S5WA 4V2XA 4B5TA 2PDWA 4HPXA 1VFMA 3LTPA 5HNUA 3UG4A 2G0WA 2OTDA 2EPLX 1LCOA 1SO5A 2Q01A 4W5ZA 5LNWA 5D2XA 2C14A 4D6EA 4Q32A 3UWQA 1YQ2A 4PUDA 4H04A 6REQB 4IMFA 4N9BA 3OIHA 4TXEA 1TSIA 3TFXA 4I9JA 4N6FA 4KERA 4XVDA 4AD3A 2DZPA 1T7LA 3L0KA 3NSXA 1IEVA 2QUUA 3L0GA 3MDWA 1PKNA 3BK0A 3VILA 1I2NA 2QMJA 3M5XA 4RV3A 5HJYA 1QNOA 3KOWA 5E70A 1JI2A 1RALA 3GSMA 1QBBA 3FAWA 1Q63A 1UKPA 2C0HA 1GYNA 1UP3A 3W83A 4DLFA 2CLHA 1QWKA 3E9AA 3WLSA 3O1NA 2VELA 2WKLA 1YW1A 1T0OA 2FMOA 5DMNA 4HT3A 4PMUA 2X40A 4P8WA 1OINA 2J7DA 1KBJA 3W07A 6REQA 5A6AA 1QPOA 1R38A 4Q33A 1H1YA 1EP2A 2V6AA 4X60A 1YMYA 3WBYA 3L66A 3I10A 2YOCA 1GORA 1R46A 3K46A 2BVTA 2O9PA 3C61A 4H9VA 1ZAHA 4W89A 3DBNA 1YDNA 3OVRA 4XZMX 1JDEA 4ZXLA 1BG4A 1IXQA 1W8SA 3HM7A 1N8FA 4ZO8A 2PD9A 3AIRA 3L65A 4MNMA 3NVTA 1I0DA 2ZZ6A 2VD8A 1BRLA 1TV7A 4HZ6A 3H4WA 1TKKA 1KBLA 1YDOA 4GUIA 3S5SA 5CH9A 3W1RA 2V3GA 1XJBA 3AMCA 5DMLA 3PZOA 3VGFA 1ONEA 3BSHA 1UD8A 2ASHA 4GC3A 4AHPA 3CTLA 2YSWA 2PDJA 1V3MA 1KM1A 3P6LA 1G5AA 3FXYA 3M16A 4TO8A 2J9XA 1FTXA 1W3LA 5HATA 4B5XA 4HTYA 4TTGA 3UZ5A 1TCMA 1XIEA 3CC1A 1DQUA 4FOKA 4AISA 3GXPA 2NV2A 3WH9A 4XBJA 2VT0A 2V9DA 3C2EA 1UA3A 1LRNA 1MDLA 1VFUA 2VCAA 3DX5A 4V33A 1CTNA 3RFAA 3ZR5A 4YTUA 3W7RA 4GG9A 4AY7A 4L4LA 1AZ2A 3NQAA 4E2OA 1WV2A 8XIMA 3E5PA 2CYGA 4ICNA 3V7PA 1XINA 1K9FA 3W37A 2OLAA 5D2WA 4D6IA 4RE3A 2WZHA 2H8XA 3G1VA 4M0XA 5CAHA 5BXPA 5K9DA 4AAJA 3PUEA 2CETA 4KGJA 2QJHA 1JUBA 3WH8A 1UUOA 3WD1A 3AWNA 4K8GA 3VD7A 3KS6A 1LYXA 3LUTA 2JGQA 1S1RA 4GYFA 3L2MA 4AD4A 2AKZA 1TCDA 2XSBA 4DYEA 1XUUA 4GJJA 1QVBA 3F4NA 3GRIA 3QC3A 3D46A 3V75A 4O0QA 1MMFA 1ISWA 2QF7A 2CLMA 3GHRA 4JKMA 4AWSA 1OF6A 2V81A 1GKQA 2BNJA 1UMLA 1W9VA 3TMLA 4PUNA 3W72A 2YXGA 3W6LA 1EJRC 2VOTA 1JI1A 3W73A 2AL1A 3KTSA 3UCQA 2ABBA 3SCWA 4Z2GA 2HNHA 1KO0A 1A5LC 3LI1A 4H2CA 3RRAA 4TVDA 5A6KA 2NQ9A 3B97A 3MSGA 3GW0A 3A5FA 1FHDA 2FQIA 3HQNA 3VC5A 3W9ZA 4FSAA 2R1NA 4DAIA 1JQXA 1P1XA 3T7VA 2HWGA 4WQ6A 5CC7A 1CEOA 3SB0A 3W29A 4QGCA 2XN0A 3BG3A 4UQDA 4Q22A 2A2IA 3NEVA 1S38A 3D47A 3HPFA 5I7GA 5BWAA 1GVOA 1F4HA 4A3RA 1SO4A 1Q8AA 3ANUA 2R94A 5ABEA 2BOGX 4CQAA 1ZHAA 4F0LA 2VEKA 3QHNA 3DENA 2VGBA 4QP0A 4KPLA 3W23A 3OBAA 3TDFA 2DVXA 4WSHA 3EKGA 3TC6A 4LNCA 3LHTA 1EP1A 3WCZA 2YCJA 4NJKA 2YA1A 1FDJA 3NDOA 3KZPA 5GQBA 5A94A 1BYDA 3TWBA 5D30A 2WCSA 4MNKA 1UD2A 2VO5A 3VOFA 3CZGA 5M03A 2GWNA 1LLZA 4MB3A 4R33A 5DLCA 2O0TA 3S2MA 3KAOA 1TE1A 3GTNA 4LC8A 2DJLA 1D8WA 5HQLA 4ZOCA 2J7HA 3O3RA 4H8HA 1XCFA 4DBSA 1H7WA 4YCOA 3SBFA 3VK5A 3BOLA 1WO2A 3AU2A 2QLYA 2GOKA 3TIMA 4K1WA 3APGA 4AZCB 3USZA 1WZKA 3RLGA 5KEZA 4D9PA 2D2OA 4XIAA 1IZKA 1IXNA 1TIMA 1J0IA 3MUAA 4DIAA 2ZRUA 3WD4A 2VCBA 3ITYA 1A5AA 4LBUA 2VC5A 2ZXDA 3L12A 4FB7A 3MY9A 1XRFA 1PZ1A 2J6VA 2IPGA 4WHBA 5K4XA 2EKCA 5CBBA 3IGUA 2ZRWA 3N9RA 1HKMA 4DZ5A 1EKOA 1RBAA 1PB0A 4IL2A 4HMNA 5C8BB 4RE4A 3BH4A 3T8QA 3UYCA 5FSDC 2Q8XA 3FV9A 2X1SA 1WXJA 1OFAA 4MWAC 3EWBX 4YNGA 2OSXA 3AO0A 1TTQA 2Q3OA 5G2WA 4AZCA 2WZTA 4WXZA 1P6BA 3WQ5A 3LCFA 1LRTA 2CBVA 3FA4A 2I56A 3S1XA 1E70M 3S2NA 2ZQ0A 3QGAC 2Z2AA 6TAAA 1OIMA 3EX1A 2YPIA 5AYBA 2IKJA 4OJYA 4URIA 5DO8A 3ABQA 2WJDA 2NLYA 4IZGA 4IXXA 5I3KA 2NWRA 1OCQA 1AL7A 2VP8A 1I1WA 2XSAA 3WENA 2IS7A 3LXAA 4M3PA 1DWJM 1VIWA 1UKOA 2OX1A 3OO2A 1EHAA 2WC4A 4QJ3B 5A8NA 3ZSTA 1TV4A 5F2IA 5FSEC 4PZVA 2OT1A 3N25A 4RZ6A 2TRSA 5HPCA 4C7GA 1CGWA 3O2LA 1OZMA 4CUCA 1AK5A 3ENLA 3NQDA 4MKNA 1OF8A 1E6QM 2VWTA 3OODA 3GM8A 4GKLA 3GD6A 2VVNA 1FWDC 1VIZA 3OVGA 2UWFA 1ISZA 2G4JA 2GGHA 4NAFB 4H9XA 1JAKA 4AEOA 1XHGA 3C8NA 5I23A 4PL2A 3K2GA 4RZ4A 1LBFA 4IPIA 2R1KA 1XICA 4H41A 2ZXQA 5I77A 3W0KA 4CNTA 3K8LA 1K7FA 2OSWA 2DIKA 1W54A 2ZC1A 3CMGA 4CCCA 1L6SA 4ZE4A 3IARA 1Q65A 3V1PA 4GRSA 3WQVA 4AUBA 3SO7A 1SVDA 4NZ1A 3GG0A 3MPGA 2Y1HA 2CITA 4K68A 3WYZA 4C7FA 1UZDA 3W6MA 3G0XA 3N13A 2Y7EA 1HL8A 1TRIA 2HS6A 5I78A 2B4GA 4TQTA 2Y63A 4NAFA 5LA1A 3W24A 2VRKA 2WANA 3V0SA 2VFIA 3LXCA 2QT3A 1A0EA 5F4WA 3BAWA 1FA2A 4N7QA 1K03A 1W6TA 2F7FA 4GKTA 3M0LA 1W1B1 3OBKA 4ERIA 1I8JA 3Q67A 1W1PA 4WVXA 5GNZA 3TJLA 2Y88A 2PDNA 1W3TA 3QTPA 3TC7A 4AZ6A 4OVXA 4R34A 4PC8A 3N3TA 3S5YA 5BXTA 4MJ2A 2JGYA 4ZEPA 3MYOA 4LCRA 5DXYA 1NM9A 2ALRA 4P7QA 4D6JA 1PZ3A 1QBAA 5E09A 4FIQA 4QCFA 4CCEA 2CBIA 4WCJA 1QK2A 3URBA 1JF6A 1B30A 1R3YA 2Z4GA 3IJQA 5J04A 1UASA 3EXTA 3S2JA 2Y5JA 1ELSA 2XH0A 4UR7A 1UMYA 3ZLGA 4QJ5B 2J74A 4R27A 4B2DA 2ICSA 2FPVA 4K6AA 2VD9A 2BZNA 1R0MA 1E55A 1XWYA 4GLEA 4RK8A 4LCQA 3VA8A 4XK2A 5TD4A 2VZOA 2XM2A 3IUIA 1XC6A 4ML4A 2CESA 1Q45A 1OIFA 3QV9A 1TELA 1K8CA 1QXLA 4BKNA 3A9BA 1RA5A 1QI2A 1YXYA 4Z0JA 3WBAA 3GBEA 1ISXA 1WKFA 1QW7A 2CLKA 2QXWA 2VOMA 3TXVA 1PE1A 1GZGA 4AXKA 1RCQA 4UUIA 3C5QA 3O6AA 4GYPC 3GZ3A 2DT1A 4GNKB 3BW2A 3EEZA 4WJEA 3MZ2A 1XRTA 3GNDA 4MY8A 2Q3RA 4C6MA 1QASA 2C19A 3CASA 3POHA 2WHKA 3U57A 1LZOA 1POJA 2F6KA 1UC5A 2AL2B 2BBFA 3WQFA 1GOMA 1GHRA 2J62A 1WKEA 2HS8A 3RMEA 3T44A 1NU5A 1PIFA 2B31A 4YS1A 4NZ3A 5HUPA 1NDWA 4HK6A 1HJUA 1BVNP 3HBLA 3FNDA 4J40A 4F0MA 5FEPA 1W3NA 1ZUAX 1OYBA 2YYTA 5T9CE 1E51A 1JUEA 1Q2SA 4NI3A 1B4EA 5DQPA 3FX4A 3QPEA 3GC2A 5HJLA 2XGZA 4L80A 3AS0A 4EANA 4RLIA 4FLQA 4Q3MA 3SUTA 2AL2A 4JDYA 3NTYA 2C3ZA 3GU1A 5FACA 1QO5A 3FA3A 4BF7A 1EB3A 5CG0A 3U8GA 1TWWA 4DWDA 5G1YA 4ZQNA 4K3ZA 1J4EA 1R87A 1H7RA 3MCNA 1DE5A 4XO6A 4M29A 1TPEA 4NNCA 5BMXA 5BRPA 5LNUA 4AD2A 2J27A 1XD0A 3W7LA 2Z26A 3LBOA 3PJTA 4JTRA 3Q94A 3UNTA 4UTJA 3CTTA 4HVXA 2OVLA 2IPWA 3LLXA 1E43A 2BX7A 4IUGA 1UZ4A 4J28A 1I9CB 2REQB 4AWUA 2ZYFA 2CZEA 3W84A 1MDRA 4J3WA 1BLIA 3FXGA 3NDZA 4C1LA 1UG6A 1OK4A 3LXBA 1J0YA 3H23A 1VS1A 5T8GA 4PTWA 1EZ2A 4P7RA 2ZE0A 2NQ5A 2WCAA 1OZQA 2Y85A 3DOPA 1XFBA 4W86A 1XXXA 1EOKA 3QKZA 2DP3A 4AX6A 2ZUMA 4PEEA 2XZ7A 2PU1A 2ZX5A 1E0VA 2A7PA 4YCPA 1KLYA 4ZO9A 2RJHA 4JNMA 2V69A 2GSHA 2WCGA 4A2RA 3WZ0E 4AIEA 4G2DA 2REQA 3TN5A 2WZMA 2ODOA 1FXPA 2A3AA 3B0PA 2DZAA 4HCHA 4BFAA 3VIPA 3AS3A 2BHYA 3BZJA 5E0FA 3W7DA 5GJPA 1JD7A 3ES8A 4YHEA 1A49A 3MJMA 4MG4A 1MW2A 5FJIA 1J0JA 1PKMA 3SAZA 5HWMA 1UR4A 3S2CA 1EGVA 3NYDA 5HA7A 1YYAA 4WGXA 4AZIA 4DNHA 1O5QA 4AZBA 3F5JA 3LG3A 4NNBA 1UH3A 5A8MA 3VCNA 3WN6A 5DXXA 4DBUA 3R43A 1YE4A 4CD8A 5D02A 4ROQA 3GH7A 3OZOA 4UFMA 3OG3A 5CZKA 3POCA 1PX8A 3KVLA 3GKAA 3NR0A 3CLWA 3LI0A 3HF3A 2G97A 4HBKA 5FESA 2WSKA 4LYQA 1EDQA 1W8GA 1W56A 2BOFX 3ZM8A 3LQLA 1GNXA 5DMMA 3F4VA 1D9EA 1XLEA 3WLIA 3IVUA 3LHUA 3IAPA 3VFCA 3MO4A 1ZGDA 4E8CA 1NWSA 3LMZA 2OU4A 4U31A 1DJHA 3WH7A 3AHXA 3ATYA 3L23A 1IV8A 5C70A 3U2ZA 3E0WA 3HV8A 1BSLA 1VPXA 1J01A 1E6PA 1EC8A 3CQIA 1W17A 3H8AA 4XAFA 5CPMA 3TZFA 5HXMA 3VMPA 3GG1A 4WKAA 2DT2A 3B05A 2G95A 4NZ5A 1HQTA 4HPHA 1R2RA 4BK9A 1TX0A 1M01A 2ACUA 4LVDA 1W3JA 1L6WA 1PZ0A 2HCVA 7CGTA 3TMQA 4NXSA 1EX5A 3H55A 1UJQA 4LY4A 4F8XA 3RAOA 3KOYA 4C90A 5HQEA 1D2KA 4J1OA 4F0RA 5DMYA 3F1QA 4KFOA 4J3ZA 2YA0A 4PCNA 2ZX6A 3E0IA 4AD1A 4ACZA 1KFBA 3MP3A 2C13A 4J2MA 2H90A 2DORA 4IUOA 3W22A 4IFOA 1FWJC 1WZAA 4OBRA 4KCTA 2WJZA 2Z7GA 3QC0A 4D8LA 2QJMA 1RJQA 4KEUA 2AGKA 3UWYA 3B0XA 3GDRA 5BOFA 4MLRA 3ZR6A 4ICCX 3CAVA 3W4RA 3KL5A 2VWSA 2OG9A 3PTQA 3HURA 1G0CA 4IM4A 2X1IA 1MQQA 1NWUA 2QDGA 1UD4A 1EXPA 4FALA 4MJZA 5AHMA 3NWRA 3O05A 4O15A 4N0RA 2PWGA 1XSIA 1LOLA 4KRUA 4GYKA 4LALA 2Z2UA 4XKMA 1CXLA 1GZ1A 1T41A 5TBOA 3P0XA 2NLIA 2XPKA 2XJ7A 5DBTA 1H62A 3WQ8A 3RX4A 1PEZA 1CCWB 4M19A 3BXWA 1S46A 3L2LA 3PBWA 5F1VA 3FSTA 4LBRA 3DFHA 4DWSD 4DI9A 5A8QA 1W1ZA 4H6RA 1V3HA 1J79A 5TAOA 2X7WA 5GJNA 3EA1A 3CV1A 1Q5MA 2A5HA 1PSCA 2VR4A 1D3CA 3S1WA 3ID7A 2WKJA 1FWWA 2G37A 1BEUA 2WMHA 3WG6A 4C6BA 2G3NA 3NQ2A 5L6UA 1UW9A 1M7XA 4HN8A 4UC5A 5KETA 2QKFA 1R3RA 5C9UA 1BQCA 2D1ZA 3GNXA 4DM2A 4CLMA 2CW6A 3TFCA 2VVSA 5C6MA 3O7UA 4IPPA 4U28A 4GINA 2OWWA 2DZWA 1QAPA 3WLNA 4DQWA 4ZO6A 1YPXA 2CU0A 1E4MM 5D04C 1UR8A 2OOGA 2ESCA 4DM1A 1GOQA 1ICPA 1I2RA 4S3CA 1I0BA 4K7VA 4YVPA 3W7HA 1RBOB 5JUVA 3I3EA 5FJPA 1W31A 2D2HA 2A3LA 3SW6A 5AVNA 4I8YA 4H9YA 3TH6A 1EH9A 3M47A 4FNUA 1RXOB 4GE8A 4Z1BA 1R8LA 3M43A 1XIHA 4JN6A 4YJ5A 2OLSA 1UUMA 4FXFA 4AZHA 3F2DA 3NNTA 5HANA 1WKDA 2DU2A 3WNKA 1WYIA 1KXTA 2NQJA 3UWUA 1RK5A 3GXDA 4L1XA 1V0MA 5FL1A 3GAKA 4JYEA 3UCCA 2CBUA 1VZWA 1JFXA 5TQLA 3SUUA 3FKKA 1P0BA 1EIBA 2WNWA 2BY1A 3WK3A 2VTFA 1DHKA 4IHCA 2AQOA 2Z6IA 3V0TA 4JXCA 3TKFA 5AB3A 5FJUA 2B0MA 4X2PA 4CNUA 4J2PA 1OYCA 1B9BA 3I7SA 4EPKA 3GDTA 1CLVA 5IFPA 5I03A 3N4EA 5A2BA 4DO6A 4LVAA 5EPDA 4M6UA 3BLKA 3I4KA 4QQ3A 2VDIA 4X9YA 2EKGA 1IR1A 2NWSA 1E9YB 5AFDA 4L9ZA 3DBPA 1DV7A 1E0WA 3WNNA 2WWDA 2QCEA 3N4AA 3NZ1A 2WMIB 3M5VA 4PMOA 3GWQA 2P53A 3PJWA 3TLQA 5I3HA 2X05A 2ZCGA 4A8RA 4BEQA 1RV8A 3OLIA 3QFEA 1VFLA 3H53A 3OZPA 1JNDA 3GDBA 4ALDA 4QROA 2QHAA 4OBSA 4HU4A 3IRSA 4UTTC 1E0XA 1HL9A 2QQ6A 3L9CA 3ZT5A 3RXZA 1SQ7A 3WH6A 3CPUA 3BG5A 1EPXA 5AOUA 4PUKA 3CXOA 2FHFA 4WDWA 2XFRA 1O66A 4KWUA 5IDIA 2XSXA 2PRLA 5C2XA 4ONVA 3WLOA 3LNMA 1UP2A 2KZHA 3MC5A 3W74A 5D9MA 1MYRA 2WMIA 2GVEA 3VZXA 7ENLA 2Q09A 5HNTA 2EG8A 2VEGA 2CBJA 3T05A 2CHNA 4G9PA 1BQGA 4GBUA 1QW8A 3EZ4A 3S6TA 1TTIA 4HPJA 2CLIA 5CSSA 5FOOA 1G69A 2F84A 1W9PA 3GU2A 1B9ZA 1G1YA 1KGXA 4QNEA 2GUBA 4YN5A 1WPCA 3N4FA 3EOLA 2X42A 4QBXA 3WDRA 3WF1A 1QI5A 4MDOA 4FNSA 2RDUA 3IK2A 2E0PA 1T8QA 2VC9A 3NOEA 1HF6A 3ZJ6A 4ZODA 1A50A 3L4WA 3ZMRA 1UWIA 2JFEX 1J0HA 2VGIA 3EDJA 1RCXB 2E6AA 3KL3A 1O6IA 3LHZA 1DJYA 3T0DA 1EF3A 3H4GA 2YZ5A 3TOPA 1TX2A 2TAAA 4OGZA 1X1OA 1VFTA 1Z7AA 1HX0A 3LHWA 3R10A 2P88A 4PEKA 4JTSA 3K4WA 3BW3A 4GQBA 3MHFA 2R1MA 3WQDA 5LNSA 4GY0A 1SPQA 4EF8A 5AECA 5I2UA 1DIDA 3ZIZA 1GVSA 3CB3A 2FJKA 2ZWZA 2PDGA 3CV2A 2E68A 4GWEA 1UWUA 3NQBA 1V4YA 4O1EA 2UZ9A 5BXRA 1XP3A 2C18A 1LDCA 8CGTA 3WUEA 3C52A 1EC9A 1M68A 3LZ5A 5E0CA 5A6BD 1U1UA 4O53A 4GGHA 1EWEA 1ZNNA 2ZA2A 1G7UA 4AG0A 1AMKA 1XQLA 2WBGA 3NZGA 4GISA 4JY9A 2PB1A 1GGOA 1Y65A 3QR3A 3FCPA 2O4MA 5LA0A 2DDXA 4CU7A 1JZ2A 4UFHA 1ZJHA 2PDUA 4C1KA 1ZLPA 2F6XA 2PZ0A 3VIIA 5DF0A 3MKKA 4JQ2A 4A2SA 4AEFA 1RJRA 3VD9A 3NQVA 4K7YA 2A6NA 5KINA 4J7RA 4UFKA 4MY1A 1E6NA 3BV7A 3EGJA 5C54A 1W37A 2W5FA 4XZWA 3W1PA 3ONBA 1TJ1A 4HCLA 4JQAA 1TYGA 3APTA 4DI8A 3P3BA 1HNYA 1HJXA 3G6MA 4MM1A 1QMLA 1ZBWA 3FJNA 3ITTA 4PMDA 2F6UA 5I09A 2R14A 4XZIA 5EB8A 2QCLA 3W26A 3C6CA 4CNNA 1ZP3A 2BV9A 3N2XA 1AA1B 1QHOA 4HZ8A 4N9CA 3C3NA 2NQHA 3BC9A 3RPTA 5I3JA 3B0UX 3NYZA 4OFCA 3KX6A 1SJDA 2VZSA 3VGGA 1S2CA 1ADOA 1OWQA 5JBEA 3G0SA 3LPPA 1SO6A 3T0AA 4L1GA 2MANA 1BTMA 5EU9A 4HTBA 1IYXA 3E0VA 4IMEA 5I5RA 3MQTA 3PANA 1NQKA 4GQ0A 1A5SA 3Q45A 4EAMA 1HUVA 3CHEA 1XUZA 4O12A 4DWSC 4EACA 4PUWA 2YX0A 3GVRA 4KCVA 5CPOA 3AYSA 3U9IA 1SW3A 3W7MA 1YHTA 2ISDA 4LS1A 1F61A 4EAYA 3S8HA 3WQOA 2ZE3A 1F8MA 4QCEA 2VEFA 4I7VA 1DIOA 1MNZA 1FDZA 1XQKA 2PDCA 4LUSB 2OQHA 1YXDA 2HQAA 4IP7A 1WA3A 1AL8A 4F4RA 3C8FA 3AI0A 4JTIA 1DL3A 1ONWA 1TPFA 2OYMA 2XIOA 3VKDA 1BXCA 1VCVA 1HKVA 4NKCA 4GABA 1KCZA 2H3BA 2AOSA 4E5TA 3WLMA 3PSVA 1G6CA 4INFA 3LGGA 4I9AA 3ARPA 3VOJA 3PY2A 4HNNA 1E5NA 4YTTA 3UJEA 1PYFA 1MRQA 4ADUA 3N73A 1SSGA 5I3DA 4NUWA 4YTSA 3BANA 4LUSA 2E9BA 3I7QA 3GC5A 1A3HA 2CNCA 5LGZA 4HHMA 4POCA 1IE7C 2HISA 5C9RA 4JL2A 2P10A 3GR4A 3RIKA 2FVMA 1FH9A 1R30A 3G1RA 1TJ2A 4ORIA 1JCLA 4GD0A 4Y9MA 3N34A 2D2GA 2DSZA 4GY1A 3SRFA 2UV8G 2C79A 4V1YA 4O16A 5AC8A 4W84A 4KEVA 4C1NB 3GUGA 4XD3A 3RN6A 1DP0A 4L4OA 4DJEC 4DLMA 4GVGA 1ALDA 1L6GA 1VJIA 4DJEA 2W4XA 3TC3A 5LIYX 5IM51 2QUTA 5H1WA 2WYSA 3IRDA 3M0VA 2QJJA 3VKKA 1CT5A 1JZ8A 3TN3A 3SFKA 2O55A 3T9PA 1GW1A 4MOZA 3VD4A 4QX4A 2FHCA 1ZSXA 1C9DA 3S6DA 4E3VA 4WDTA 3OQ8A 3VUPA 1O60A 3BJTA 4NG3A 5IFTA 1SUXA 2GGEA 4ZA0A 3VOIA 5XIMA 4G8TA 3WF2A 1KW1A 3DCPA 3S46A 4C6DA 1D3HA 3VVGA 3TWAA 2J13A 3A13A 3BAXA 1JXJA 4C1NA 5BXSA 5JH1A 4FO4A 3WEZA 4AIUA 2OX4A 3P62A 2ZZ4A 4YYFA 1DHPA 2O56A 3CMJA 2OEKA 3LCHA 1FRBA 1FFQA 1JPDX 3WDHA 4XZ9A 4Q4PA 4UTWA 1M41A 1L9WA 4GCXA 3VNIA 4KWOA 4H83A 3VNKA 3C0SA 4MSSA 3GIPA 2X1TA 4UR8A 2PWUA 1NEYA 3OZMA 4JBRA 1XR2A 1OG0A 1OFRA 1QI4A 1LRQA 5F2GA 4JFUA 4KQNA 1J6OA 3CWNA 3NDYA 4JYFA 4KBXA 2B7PA 3LRKA 1E4LA 1KXHA 2ZXAA 4IGNA 3TN4A 5FJTA 1K02A 1PWMA 4S2CA 4QRNA 3PZGA 1NP0A 1K8XA 1V6VA 1WXYA 1YPFA 1AD4A 4YVXA 1GQJA 3WJSA 5JBDA 2XVNA 5EMMA 1XV8A 3AIBA 2JQXA 3DFQA 3EB3A 1RVKA 1HKJA 3TSMA 1Z44A 4HPNA 2AQVA 1JCXA 1UHVA 1VLIA 4QG9A 3MT1A 4X0NA 4CVUA 4NP7A 1AQHA 1WDQA 4FOJA 3DFSA 2FIQA 3IJDA 2G3JA 2LLEA 2X0SA 2PF0A 3MO7A 1E56A 2PWHA 3M1ZA 4OUIA 5D8WA 1C8XA 4UFLA 4H00A 1VBJA 1Z69A 2FTPA 5EMJA 2WB5A 3V36A 4FA3A 3T4WA 1HW6A 1XSJA 3N9SA 2YGYA 5IHRA 1O5XA 4O8AA 3HG4A 3FN9A 3TSDA 3RILA 2ZVRA 4YHGA 4H9TA 1GONA 3T0TA 1F3TA 1M53A 2WM0A 3K30A 4YPJA 4ZB0A 3MTWA 4IJCA 2WJEA 1OM0A 4CQDA 1I45A 5I00A 4JICA 1F6KA 2Z25A 4HJFA 3O16A 2BGQA 3GKFA 5CBJA 2WMKA 4DXKA 4OZOA 4C6IA 4HNOA 5AC4A 3QW4B 2OO6A 3O6YX 4PA8A 2W9MA 3RDKA 4LUIA 2B7OA 3ECQA 3GE7A 4B9ZA 1F3WA 2ZZ1A 4LAOA 2BGNE 4JQ3A 5CQ1A 4GUFA 4M6QA 2CKRA 3AS2A 1KBIA 4DJFD 4NZCA 4Y8FA 2DY3A 3GTHA 3MDUA 2P5NA 3PFRA 1FUYA 4QJ4B 3V16A 1AJ0A 3KCJA 2GYIA 3VIGA 4GZJA 3TYEA 3F5KA 5BMWA 1T96A 5AHIA 1B4KA 1AQMA 2A21A 2YCLB 1OBAA 5JIPA 4HU0A 4XTDA 1ECEA 3EWWA 5CPTA 2GGGA 1X6NA 3PFMA 3SCQA 2Q71A 2DW7A 1NIUA 2ISFA 1E15A 1TVPA 2ZX9A 1OCBA 1XX1A 4TR9A 3A21A 5HINA 4HHLA 3UG8A 1U30A 4LUTB 4X61A 4UTKA 3KHJA 5FL0A 2DUZA 4UOJA 4O1BA 3L4UA 4DJDA 2PRMA 3KLKA 2HZGA 4GUHA 4KW2A 3AXHA 1TUFA 4GIRA 5DANA 5HBFA 4NIRA 5REQB 4KS0A 3SCRA 2V67A 1G94A 4O13A 2OR2A 3PWAA 4S3FA 2YCLA 3EEGA 3A6OA 3VPLA 2XTKA 3ARZA 3FYOA 1UWAA 2ZVIA 3BSGA 3AXKA 2WK2A 3G2GA 1K7XA 4IIEA 5JIWA 2FB3A 1B31A 3UR5A 1ODZA 2BASA 2V3DA 2VFHA 4JTGA 4WD0A 3PZNA 3KXQA 4LUTA 4FNQA 3UR8A 5A6TC 2EPHA 1ZAJA 1CGVA 3HGRA 1OG6A 1Y5VA 2DFAA 1JYVA 3O0FA 1PZ2A 3THUA 1R47A 4A8IA 2A0NA 3VKCA 3BOFA 2J7CA 2GK1B 3A23A 3UESA 5FKYA 4U5IA 1B3ZA 1FOBA 5D33A 3P8JA 5REQA 5LNRA 1JVNA 1XCWA 3QPZA 3QF0A 1X6UA 5AY7A 4TVCA 4F9DA 2RAGA 4PL1A 3UXIA 4WEVX 3LEPA 1S2UA 3TEVA 3VIJA 4B91A 4D71A 1ICSA 5HOSA 2JEQA 4JHZA 1HG3A 1K77A 4JEQA 3FY1A 3V0UA 4LFYA 2GWGA 3WJYA 4Z2LA 1JUKA 3IJIA 4LXFA 2VR2A 4MWAE 5MHBA 5DELA 2WOQA 4Q4MA 4FS9A 3BJFA 1VJZA 1HJVA 4HZMA 4PN2A 3EOOA 4GYJA 4MYXA 1OFEA 3U7BA 2ACQA 3OYZA 4KWSA 3THCA 2GK1A 4OV9A 3KP0A 4JHMA 2J7GA 1LM1A 4B3ZA 4NXKA 4IPNB 4TVUA 4S3BA 3BVJA 1XIFA 4MMWA 2OGJA 1A0DA 1B1YA 1G4TA 5LIKX 2QPXA 2QULA 3VIOA 4MAVA 3TV8A 5ABFB 4BCEA 1CX9A 4GVIA 4CQBA 1FFRA 1HVQA 3PJXA 4F2BA 4XZNX 3WBWA 3PBMA 4D6DA 1L8PA 2XGBA 2ZFAA 3UEQA 3LBMA 1NQ6A 5RUBA 7TIMA 1VHCA 3VYLA 4Y96A 3KWSA 3ES7A 1YDYA 4M24A 3WFAA 1OGSA 2V5BA 3T2PA 1Q85A 3GDMA 2P3ZA 1QI0A 4QIUA 2XIQA 4DPPA 2NT1A 1KFEA 2ZUSA 2PBOA 3T8LA 4NQ1A 3LBCA 3IJ9A 3NQ7A 4JIEA 4UMAA 4DBWA 4ERGA 1L6YA 3URAA 1KM6A 5ABFA 1UR2A 1O94A 1ITCA 3G0UA 1KWGA 3AIWA 3ZXWA 4JFVA 4Q7IA 1SM9A 5TIMA 2BXYA 4BEUA 1YTKA 1Q7MA 1OABA 4WR3A 3BICA 3WEOA 1UR1A 1A5KC 4QAWA 3CHVA 3W1TA 2J6XA 3MUZ1 5GVJA 2ZADA 3HQOA 1OK6A 2J47A 9CGTA 1HKWA 3HIJA 1EJVC 2JF6A 1V51A 3CAWA 3QGVA 4UQCA 2DV0A 4O14A 3KBWA 4K8HA 3HFYA 2A79A 3B9AA 1IT0A 2V3EA 1JF5A 2INEA 2PCQA 3UGVA 1P7TB 2FJUB 3NM3A 3CHCA 3LY0A 2WQDA 3G1YA 3ABSA 3FHQA 3MCOA 4KT2A 3A64A 5AC7A 3VIMA 4LW7A 4DXVA 3E2VA 3L5LA 3DFTA 3RGTA 2X41A 3GDKA 1IIGA 4NT0A 2DT3A 4IPLA 1RA0A 2OCZA 1AJZA 2VFFA 3UZXA 1W5MA 4NI8A 2FZMA 2JALA 3WO8A 4MF4A 4NYUA 4IFRA 3W1QA 5M17A 1S39A 2PE4A 2R91A 2XG9A 3TZNA 1HIZA 4QM1A 4DBDA 1Q13A 3NL5A 1NVMA 4S3AA 4WKFA 3H2OA 4JTFA 3QJAA 3M0JA 2PA6A 3IUHA 5FEZA 4AVNA 2CHOA 1SSDA 4FF7A 3QQWA 4QJ1A 1MFVA 2J24A 5HK4A 3RCYA 3GU9A 3PBVA 4MJMA 3TW7A 4YTQA 4GUGA 4JTTA 3MW7A 2YW4A 3GIQA 4ZFCA 1BFNA 3B9EA 1ZJAA 3DHUA 2CERA 4TU1A 4HK5A 4QHRA 1Q6OA 1TZZA 1PJ9A 2ISWA 3RO6A 3W2LA 4LV4A 1HGYA 4GVHA 3AJ7A 5AHNA 5HJXA 1TPH1 3ATZA 3WJXA 3E1F1 4Z2KA 1WUFA 3ZSSA 1V6WA 4HMCA 4R85A 2GJXB 2VENA 5EMLA 2UY4A 3QZAA 1D7FA 4JFSA 3VIKA 4QAIA 4C6LA 4UTIA 3W53A 2GUUA 1VFSA 4V27A 4JTHA 2QYGA 4JTAA 2NT0A 4DXXA 1KM4A 1BAGA 1DJIA 3AIEA 2C8NA 1ZPTA 2WNQA 3B9NA 4M82A 4US5A 4BJHA 3STEA 4IP5A 3G5EA 1QR7A 6ENLA 3QEZA 3DG7A 1JIBA 2NUYA 3TQVA 6A3HA 3A4AA 1GCYA 1UUQA 3M7WA 4R9OA 4A8NA 2NVAA 1M1BA 4J5NA 4L6HA 1Q6DA 4XUGA 1NELA 4I8DA 3AYTA 1I2OA 1JR1A 3AMKA 4W88A 4F79A 1RVGA 7ODCA 1OGGA 2GVGA 2YB1A 4W87A 4JCLA 4DJFC 4OOZA 4YIWA 2GJXA 4CQCA 1OCNA 3VOCA 4Q4OA 1YLVA 3VMNA 4JKKA 4C6OA 1HJQA 3B9OA 5FEXA 2J75A 5A6MA 2FGBA 3SCTA 5CZSA 4RW5A 2QJNA 4ZQMA 3OPSA 1X98A 2UY5A 2BXVA 3SFWA 1JG9A 2J25A 3IIOA 3SM0A 4FX8A 1KB3A 2DSWA 1IIHA 3W7GA 4LVGA 2QPSA 4PRTA 3OU8A 2PTZA 2VX5A 4LH8A 2FZNA 3IV8A 5E9XA 5G4WA 1HXJA 2AMGA 4JN8A 2WSQA 3MU7A 1L2UA 1NFGA 3M0ZA 2WAGA 3LHYA 3HO8A 3R12A 5C9XA 4B3LA 2Y8KA 1NFBA 4ZQOA 2W62A 3W7IA 4Q4KA 5BROA 1H11A 4WDUA 5HAOA 2WXDM 4E3TA 4IISA 2WQPA 3IWPA 4ATDA 1WDRA 1MVYA 2AKMA 3A4XA 4I6VA 1MUCA 1RD5A 1VBHA 2ZZ2A 4DUXA 1ME9A 3HB9A 1OGBA 4ICMA 2NUXA 4ZB2A 4FXRA 3O63A 5D2TA 2FTYA 3RMJA 3ARSA 3S9ZA 1UKQA 4UQEA 1V3JA 4UCFA 2QUNA 3F7JA 1JXKA 3HU7A 4EP8C 5CLTA 2ZTJA 3N2MA 3EDDA 3VOGA 2O9TA 3MVTA 3DIPA 4M1RA 4IPJA 5DCDA 2WSRA 1DJZA 2YL6A 4YXGA 1SJAA 6ALDA 3VDCA 4UTHA 1R7OA 3DN5A 1DWIM 1VC4A 3WIJA 3MSRA 1WZMA 1XKJA 3W76A 1Q6QA 4M80A 1XYAA 4UOZA 3D0CA 2FVLA 3LCGA 1REQA 2FPYA 3VKJA 2BB0A 4MKVA 5CPLA 4GQGA 2QVNA 4AH7A 2JK2A 2Y24A 3BLIA 1JZ5A 3NZPA 4PMNA 2GQ3A 3QN3A 2PAJA 2VC7A 3CL7A 1XH0A 4IMAA 3ZVHB 3BTNA 5C2CA 2G3IA 4GCAA 4WDXA 3WLRA 1XBZA 4S3JA 7TAAA 3L21A 2QAFA 3MWAA 3MI3A 2PWVA 4GX8A 2PLJA 1GVYA 4F0KA 2AAAA 1LT8A 3AIQA 1XIGA 2PSNA 3IUDA 2IQDA 2WSYA 5A5WA 3K8MA 4Z1CA 2OKTA 5H91A 4JIHA 3T4CA 3W1XA 5I07A 2E4TA 4ZGYA 4KCWA 3UETA 2WZEA 2VUNA 2QCMA 4IIBA 1CPUA 1MRAA 4UXDA 3KRSA 2UY2A 3NIYA 4IFKA 3CQJA 5L9FA 4OECA 1V93A 2YFNA 1C7TA 1PKYA 3FVDA 3T2OA 3LTSA 2QCDB 8RUCA 4YTRA 1KGWA 1NFPA 1KWKA 3BLPX 4O28A 1LLOA 4KIEA 1XRSA 2ZUUA 4H19A 3G3DA 3N2OA 4LOCA 3CQ0A 4U33A 3V4BA 5BRBA 4GIAA 3CZKA 4UWMA 3OLEA 1CW2A 1THFD 3E5BA 3CUXA 1GQLA 3OEXA 2I17A 5AZ0A 2WMJA 3RR1A 1EJTC 3AROA 3MV11 4LUJA 3KRUA 4MVAA 1QT1A 1CXFA 1PCKA 1BXNA 3B8IA 7XIMA 5I3GA 4EVZA 3F03K 4C91A 4XSMA 3K13A 1Q6RA 2QCDA 3SRKA 1JAEA 2YXOA 1MW3A 3B4YA 3WMSA 1VPQA 3OIXA 4GI8A 3B0VC 3PSWA 4FPSA 2NW0A 3CUZA 4P2VA 3D3FA 5EA9A 3VD5A 1LBMA 4ZTXA 4LRTA 2RDTA 3QTGA 2XIMA 4Y9PA 1PTDA 2Y70A 4B5UA 3V35A 2F38A 4F48A 2D73A 4HYWA 3HOJA 1TO3A 4H6KA 3E49A 1R6WA 3BMWA 1R85A 3QHOA 1MEWA 1U5VA 5FAGA 3DHFA 1R2SA 3S42A 1EOMA 2W92A 3GK0A 3WUGA 4OBTA 2OPJA 1EQCA 4K36A 4L9XA 4Q8OA 1S5VA 3OTRA 3AALA 4US6A 4O50A 2VHLA 3P0WA 1MFUA 2PDLA 1DE6A 3ABRA 5BW6A 3ARYA 2J9YA 5BNKA 2VC6A 5KZEA 3NZRA 1ITQA 3WK1A 4MB4A 5EY5A 3TTOA 3AXXA 3THDA 3U5UA 4O18A 1EJSC 5BU6A 4BWLC 1V77A 4E4UA 4ENLA 4LV9A 4YWIA 4BWLA 4XVEA 1LG1A 1UYQA 2Z7KA 2WWCA 4X0VA 3IGHX 1AMYA 1FWNA 4I7WA 3T2QA 3FJ4A 4HNCA 3M07A 4A22A 1W3IA 5FCZA 2OB3A 2NZLA 5CBIA 3R2GA 1BRLB 4RZBA 4GX9A 2Y4SA 1XLMA 2HEJA 1X96A 1XDLA 5D9NA 3OVQA 3PUOA 1PX4A 5DX7A 3CH9A 1WAUA 2G41A 3ZWSA 4AC7C 2IKGA 1FY6A 4H6EA 4GK8A 3T0CA 3GBDA 2C15A 4IG2B 1EO7A 3TYZA 3W2JA 1R3SA 4J3VA 1S5TA 3WEMA 3TR9A 2QCNA 3P14A 2H3DA 1PYMA 2E6FA 4R7JA 4WLCA 5LYRA 4HJWA 4O4VA 3EXRA 4P7NA 3NL6A 4Y9NA 3UJ2A 4KEZA 3ITXA 4FP1A 5FEWA 5BRQA 3GH4A 3M41A 3VM7A 3TTEA 5H8PA 1EJXC 1AVAA 4I6KA 4XB3A 3N1AA 3BL3A 1S5MA 4QS6A 3N3MA 4L56A 5HR7A 3S6OA 2EG6A 3N29A 1EPVA 4U3CA 2JEPA 1UZHA 1Y8BA 1E6RA 3ALFA 3QZEA 4FI4A 4LT9A 2NV1A 4CQ9A 2GFTA 2HRWA 4IG2A 3MKVA 3P80A 5EFFA 2GGIA 4PTMA 5K9CA 3MUIA 3OOQA 4PMRA 3I7RA 1GVQA 1W2PA 4R53A 1C92A 3B3DA 3B8VA 3CYVA 1UWRA 2ATMA 4W4QA 3M0XA 4KF1A 4UNIA 1XH1A 4TX6A 2VXNA 2XU2A 4LF2A 1XI3A 3JR2A 4LS0A 3AQUA 3GG7A 4ECLA 3HPSA 4QNWA 4HNTA 3ITCA 1FWRA 3AICA 2WNZA 3DHPA 3KEHA 4GPNA 3ARRA 1LORA 4ZTYA 5CPQA 1F2JA 4TV5A 4U2ZA 1WXZA 3R8RA 2EXOA 4W7UA 3DERA 2A7RA 3U2EA 2EO7A 4KMQA 3WQEA 1DJNA 3SCSA 3WDPP 3W1MA 5BYWA 4XUYA 5E6YA 4B92A 3S1GA 3QKEA 2WPBA 2HJPA 1TPB1 5C9ZA 3WF3A 3VZYA 3W7KA 2QZRA 4CN1A 4LSBA 1EDTA 1QOQA 4DF2A 3CUFA 4AY8A 1V7YA 2C1HA 1VEMA 2CWNA 3XIMA 1M03A 2CLPA 1E3ZA 3WUFA 1IF2A 4M6VA 2CPUA 4AIBA 3EX2A 4JIPA 4MUPA 4WRHA 4XAPA 4ORMA 1H3GA 3LM3A 2P50A 3WF0A 3UPMA 3AHYA 2NX3A 1A0CA 5B80A 4G7EB 2FZBA 3WNOA 2IXVA 1A4LA 2X1RA 4C5ZA 4I3GA 1ADSA 3WQWA 3CUJA 2JIEA 2V8ZA 4Q8WA 3LLFA 3E2SA 2P1FA 1FKXA 2VUYA 3ABOA 5ABHA 2R8WA 3AIUA 2PWEA 4H8VA 1GWJA 5F4SA 3WDIA 1TFVA 4PUMA 3ZJ8A 4H7VA 3BDKA 4HHPA 1XLGA 4DBEA 5FJRA 4IIHA 1L8NA 1QCWA 4XV0A 3QYQA 1W32A 4EK7A 3LCIA 1UR3M 2ZA1A 2IPJA 3W02A 4G7EA 1ZRQA 5KMYA 1GJUA 5M1TA 4J9JA 1RD6A 1QNVA 2NSXA 2J7FA 3UPWA 3WDQA 2ZX8A 4CCZA 1ZBVA 4L4PA 3CB8A 1LT7A 4A3HA 1B3OA 3TYDA 2GDQA 1AQFA 1ZL1A 2WSPA 2VX6A 3PTKA 1GQIA 3HGOA 3PWGA 1RPXA 4AZGA 1MZHA 3NXLA 3FW6A 3NAVA 4AD5A 1AW1A 1WDSA 3PC0A 3PAJA 2QCHA 3PP7A 2C1GA 3KTXA 3NFUA 4E2BA 2VFGA 3A4WA 4M7TA 1UQYA 4ZFMA 3Q2DA 1F05A 3CT7A 3NA8A 4MZ8A 3WQPA 4X9SA 4GFIA 3IVSA 2DQXA 3CQHA 4MWAB 3SCVA 1U5JA 1RP9A 4MJ4A 4PB4A 1SZFA 2EHHA 3TYAA 3FYPA 4LTSA 3W7PA 5HMFA 2YCEA 4IMGA 3A5VA 3W7EA 4O57A 3XINA 3EMCA 1X8CA 3TA6A 1MUMA 1FBAA 3O9NA 5LIXX 3SUVA 2O7QA 2JKPA 1W5NA 2QEZA 4LF1A 5K3VA 3MP5A 4S3EA 1M7JA 3OGVA 2GZXA 4LUYA 4HQVA 1MW0A 1H63A 3BLEA 1OT1A 1I2QA 2NVDA 4HMDA 5IOBA 3AFBA 1NH6A 1YNPA 4NJIA 2VX7A 1VEOA 7REQB 2PC8A 4ROPA 1AW5A 3RM8A 2E6YA 1QFEA 4IJBA 3G1AA 1TV8A 3SN0A 1IWAA 2BS9A 4MWAA 3A3HA 1BHGA 1P48A 1Z9AA 2GDVA 1EJ7L 2OLHA 4LY8A 4NRRA 4RPPA 1SZGA 4RXFA 4PE8A 4XAZA 5TF0A 3HGSA 4JEJA 3BWWA 3GQYA 3F5LA 3UWWA 1SU5A 1O12A 1CGTA 3RCNA 3C2FA 2BVDA 4GH1A 4I90A 4LAUA 4JTJA 4CD7A 3CZEA 2R1PA 3LM7A 3TCSA 4Q8PA 2A4AA 4S3DA 3LPGA 3W27A 3WKZA 1Y0EA 7REQA 3VX0A 1SYTA 3GAYA 1I2PA 4CGTA 2IW0A 4ZR8A 4FLSA 3TQKA 1JCTA 4IIGA 4MPQA 2I57A 4FZIA 4HA4A 3CJPA 3GY1A 3LQGA 4AU0A 2J88A 4NZ4A 3LV6A 1US3A 4IIDA 5B7ZA 1AQ0A 2OZ8A 4O19A 3W01A 5HPOA 4M5PA 1GOXA 1J10A 1QNQA 3I6RA 1KRAC 1ZP4A 4ML9A 1KQZA 5XINA 2XN1A 3LN3A 3UA3A 4MAZA 1G01A 4DO4A 1SZRA 2HVMA 1AD1A 2DZXA 3H2MA 1N2VA 3OG2A 4IQEA 1GQKA 2HV5A 3RU8X 2Y8VA 2PF8A 1TPUA 1CZ1A 2OEMA 4H8NA 3CHDA 2Y6ZA 3R58A 3T08A 4MADA 1ENUA 3H21A 1A5MC 3D3AA 5A6JA 2A6LA 1HTIA 3K4AA 3HPZA 1FWTA 1M5WA 1JCJA 1OFBA 4E38A 1D7KA 3H4XA 1JPHA 1JULA 3KZSA 3S5OA 1H60A 1OC5A 3FIGA 3G1DA 4W7VA 4NILA 3H70A 5AHEA 4WXYA 4BQ4A 3SUWA 2OQLA 3AIVA 4EX4A 3U2OA 1SR0A 5LGXA 1FH7A 2WVUA 4N9EA 4QQUA 2XYLA 3B06A 2WMGA 3FDKA 3UP8A 3G6LA 4UFIA 1TB3A 5FI8A 8TIMA 4Q6JA 4W93A 3T81A 3STGA 1QO2A 5M3WA 4FEZA 1JDFA 1JYWA 1ICQA 2ADAA 1RQEA 1ZAIA 4FAMA 3GFXA 7PTDA 1VGAA 4Z2JA 4K2SA 5J5RA 1XLIA 4QITA 3UG5A 2GOUA 3RK8A 1NDVA 3W88A 4WF7A 1B54A 2D23A 3SZ8A 2E1WA 2ALDA 2E40A 4Q8UA 3R5EA 2DZUA 3RCMA 4N2YA 3EOSA 3WLTA 3K5XA 2F9RA 2DVTA 1MZRA 4H7CA 3SEPA 2CFFA 4P7OA 3NQCA 4C60A 3O07A 3NQ8A 1TRDA 1UP0A 5EYWA 3UD6A 4ZMGA 2PODA 2C1IA 3IGXA 3SIZA 3CEPA 2XGIA 2FMNA 3PR2A 4W8LA 2XWEA 3UZJA 2PGWA 1CLXA 2PDIA 2YA2A 4ASTA 4MGGA 3F4WA 1C9WA 4IMCA 1ZFJA 1ITXA 1DXFA 3NQEA 3CWHA 3MMUA 3J7HA 3CQKA 1OFOA 3ERPA 2E6DA 4GYPA 3BQ6A 1LQ2A 1AZ1A 5D9PA 3WUBA 1XBYA 4GC4A 4QLKA 4YYCA 5HULA 4Z1AA 2KAUC 3II1A 1OFDA 4AX7A 1UD5A 4HN4A 4MKSA 3LB0A 2PWDA 3EDFA 2ZX7A 1UA7A 4PCFA 1DWGM 3DUGA 1HO4A 5AYYA 5A2CA 1VCFA 1IXOA 2J9ZA 4BQ3A 1EDGA 3AISA 1BWVA 1KM3A 1F3XA 4HA0A 5BOEA 3IS4A 2WNNA 4FXSA 1UWTA 1J93A 3H54A 4ZOBA 2PCEA 2QV5A 2FDMA 3K1GA 2J8GA 1U33A 1US2A 5CJMA 2V68A 4PTDA 5A6LA 1E6XM 2FHBA 1WP6A 1W1IE 3ELFA 4E2VA 5H8UA 1JRCA 4EXAA 1UOKA 1YIXA 2DUAA 2FZ9A 2PTYA 4WSJA 3WX7A 4N4PA 3N18A 1BSIA 5AVHA 4PBEA 5J5DA 3CGTA 1Q6FA 1ZJBA 2PLMA 1KFKA 4W5UA 2QCGA 4QXIA 5CZJA 3SGZA 1OC7A 1XL9A 4LEQA 8XIAA 1UOZA 2D69A 1PHQA 1H7NA 3ZFHA 1MXGA 4PMQA 3HJZA 4U3AA 4E2DA 1F4AA 3QV7A 3UVIA 1FWCC 3ARXA 1VYRA 3HV9A 2BSLA 1VCGA 3NCOA 2DH2A 2TPSA 4P5UA 1H09A 1O95A 3STCA 1GEQA 1VLWA 1V03A 4JOMA 1LWJA 5A6SA 4BQ5A 5ECVA 1W0MA 4DELA 3SRDA 1GTHA 1KCKA 3ANVA 2I5QA 4C65A 3RU6A 3DXIA 4RE2A 3LX9A 3KOFA 1YADA 1NDZA 2W27A 1QPQA 3PWIA 5J8LA 1YNYA 2XVLA 4XBKA 3ZS4A 2MUCA 2YJQA 4EXQA 5BOOA 3A22A 5FF3A 3NG3A 5C7HA 4KKXA 4QDWA 3PULA 4EPDC 5CLWA 4R7OA 3GW3A 1XPGA 1H51A 3KL0A 1B57A 1XBVA 3HPXA 2PUZA 1CB2A 3BGAA 1XIBA 4UQ9A 2V3FA 1OFPA 5F2MA 5CSRA 3GDLA 3QSRA 4BI7A 2OMAA 4C6CA 3HZ3A 3WQGA 1BYBA 1FHVA 2CLEA 2FH6A 3KP1A 3RM9A 1WNOA 2EF9A 1TWSA 3KWXA 1YBQA 5D9OA 3NQFA 1CIUA 2QUVA 6TIMA 2VZVA 1KRCC 2ZUWA 5G1TA 3WFZA 1FCQA 3E0LA 1V5XA 2PGFA 2YL8A 2ZZ3A 3T78A 3FEMA 3W28A 2O4QA 3P60A 1GTEA 3D6NA 4RDZA 1EUNA 3OVPA 3AXMA 4YVVA 4JY8A 3NSMA 1TWIA 4DUWA 3P74A 2DH3A 4FX7A 2ATSA 3RX3A 3CUIA 3WL1A 2HBVA 2ZZ5A 3APYA 3BSMA 2SFPA 1B90A 4ZE5A 4XG1A 4OE7A 3P82A 5DCBA 3A3XA 2C7FA 3EWZA 2J8TA 1C8YA 1VJSA 6XIAA 3UXAA 3O15A 1DWFM 4H1ZA 1GYMA 3KHDA 1UWSA 1LQAA 4C6NA 1V6TA 4H9ZA 4F3HA 4CNPA 4RDWA 3UJFA 2VQTA 1VYSX 1H50A 1JPMA 1RH9A 4ZCWA 5H6HA 1X6LA 4TTUA 2W79A 1KTNA 4DYKA 2QCFA 2FGZA 3B8DA 1H61A 2W6RA 4E6MA 1R3TA 3H2AA 4DNMA 3WLHA 4PODA 1Z3NA 1LTDA 1JEZA 2PC4A 1H5YA 1O1HA 3CHFA 1IWPA 3PZIA 3EPOA 4UFJA 3KFTA 2CWXA 2GDUA 3IJ8A 3SJNA 2NQZA 2IQ0A 1RHCA 1JRBA 4LWWA 4ACZB 1GQNA 2WHLA 3E96A 3B8WA 3B0YA 1AUSL 4XAYA 4Y90A 1UROA 4HGXA 2NXGA 4PYSA 1TMLA 2CZFA 5C9WA 3CH0A 3NSNA 2XDFA 2J4GA 2F2HA 4YLWA 1K8ZA 5FA5A 5D09A 1GKPA 2PEVA 4J35A 1QHPA 3I6EA 2Y89A 1O4UA 3NPVA 4PCTA 3QV6A 3RJYA 2ZRZA 3H12A 1TPWA 4HIBA 4OUEA 3BLLA 1M3UA 1KFCA 2Y7DA 2ISVA 4F2UA 1LF1A 3PG8A 2D24A 3N2TA 1NJJA 4FR6A 2E5BA 3EWUA 3RR4A 1LJYA 2CZDA 2BHZA 1GJWA 2RDXA 1VB9A 4K38A 1X39A 1QK0A 2E28A 3EA3A 4PSPA 1F7BA 4XSLA 2X8RA 4W8AA 3GTXA 5FIPA 1EZWA 3SQLA 3IJ6A 2ZTKA 3N04A 1TMQA 1KLZA 4UTFA 5LNVA 5DRCA 4JL1A 3OA3A 1WZLA 2YDRA 1TV3A 1J0ZA 1N7KA 1Q6EA 3DFYA 3L4TA 1DQXA 2PP0A 2Z28A 3BMXA 3N12A 4AYSA 2QJIA 1EP3A 1SJBA 4X63A 1K7EA 1RPKA 1CENA 2QVHA 4CEXC 5D05A 5DEZA 3LCXA 3LENA 1XYZA 1K9EA 1JDCA 3BPWA 2G4FA 2CXEA 3C0LA 2PDYA 3BAJA 3ZJKA 3W3OA 4XZLX 4JD4A 3W38A 3ZLHA 2A1YA 3MKCA 3SQMA 3VINA 4PTNA 1G4EA 1C29A 4Q4RA 1EYWA 5BCAA 1VRDA 2YL5A 3PK7A 1WAWA 1PTGA 4A29A 2PI6A 3FK4A 4U10A 4HA3A 2PWFA 3R94A 4LVBA 1F74A 1GVRA 3B4UA 3DYPA 4J3UA 3M64A 1W3HA 5LSMA 2DIJA 2BFGA 4D8ZA 4E8DA 4IQJA 2TYSA 5AYXA 3B8SA 4M81A 1B3VA 5KTLA 1H2JA 2D0FA 1SFJA 2DZTA 2PRHA 2E7FA 3SCPA 1E3XA 2HTMA 5LKYA 2VMFA 1XIJA 1PHWA 4IL0A 3MSYA 3V5FA 1ECQA 3E2QA 4FF5A