4LSBA

Crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
277
structure length
277
Chain Sequence
DLQARHAEAFRALHTRPGAFIIPNPWDAGTARLLAMAGFEALATTSAGYAFSKGQPDNAIDRDAMLDHIADLVAAGGLPVSADLENGFGDAPGTVAETIRLAAEAGAVGGSIEDATGRADTPIYARDASVERIAAAVDAARALPFPFTLTARCENYLHGRRDLDDTIARLVAYRDAGADVLYAPGITDADEIAAVTRAVGAPVNVVMGLQGGLLSLDELAALGVKRVSVGGALARAALGAFLRAATEMRRDGTFTFTQAAVPGRDINRWFAAPDNSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lyase/mutase
publication title Crystal structure of a putative lyase/mutase from Burkholderia cenocepacia J2315
rcsb
source organism Burkholderia cenocepacia
molecule tags Lyase
total genus 107
structure length 277
sequence length 277
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 4lsbA01
3QQWA 3VAVA 4B2DD 1S2VA 2HROA 1DIKA 2R82A 2HJPA 2VWTA 4WJ8A 3FA4A 1E0TA 3EOOA 2XDFA 1O66A 2HRWA 3N25A 2KX9A 2VGIA 2BG5A 1PYMA 1F8IA 1XG4A 1PKMA 4IQEA 3SRHA 1OQFA 1DXFA 2XZ9A 4KCWA 1F8MA 3SRDA 4HYWA 4MG4A 3B8IA 1A3XA 3QZ6A 3T05A 1S2TA 1M1BA 1F3XA 4L9YA 3HQOA 3T0TA 2DIKA 4B5TA 1U5HA 1VBGA 3GQYA 4TV6A 4FXFA 3BJFA 4LSBA 1ZJHA 2VGGA 3EOEA 3OQ8A 3PP7A 4L7ZA 1O68A 3QLLA 4B2DA 1M3UA 1PKNA 3MA8A 4QGCA 4JPGA 1O5QA 1DXEA 4L9ZA 3I4EA 3R4IA 3LYEA 4YJ5A 2V5JA 3HQPA 4B5WA 1DQUA 3QV9A 3IS4A 4QG6A 3G2GA 3QTGA 1KBLA 3OYXA 2HWGA 2ZE3A 3EOLA 2L5HA 1PKYA 2OLSA 4HYVA 1PKLA 1A49A 2VWSA 3H6OA 1SGJA 1XG3A 1UJQA 4B5VA 1F61A 1U5VA 3P0XA 4B5UA 4L80A 4TV5A 1S2WA 2G50A 2X0SA 3E5BA 3M0JA 3U2ZA 3KTXA 3ME3A 3HQNA 1S2UA 1Z6KA 5TAOA 2DUAA 3BJTA 4DRSA 2VGBA 4B5SA 3GG8A 3OYZA 3QV7A 4KCTA 3GR4A 1T5AA 4YNGA 3KHDA 4FXJA 3T07A 2E28A 3SRFA 1F3WA 4IMAA 4ROQA 4KRZA 3FA3A 3E0VA 1A3WA 1IZCA 5JVLA 1IGWA 4KCUA 4KCVA 4G1NA 3QV6A 1VBHA 3EZ4A 2VGFA 3QV8A 3PUGA 4RPPA 4B5XA 4QG9A 1A5UA 1E0UA 4IP7A 1OY0A 3E0WA 1JDEA 1AQFA 4MF4A 4KS0A 1KC7A 2XZ7A 1GGOA 2WQDA 4QG8A 2V5KA 3SRKA 2QIWA 3M0KA 1MUMA 4IQDA 1ZLPA 3LG3A
chains in the Genus database with same CATH superfamily
2DSZA 2ZUUA 2ZE0A 4NYUA 4CQ8A 2NVDA 3ZFHA 2PTDA 1H1ZA 1KGWA 3SCNA 3C52A 4TVDA 1MI3A 3W1AA 2PDXA 3CZ8A 2VM8A 4MB4A 4HYWA 2PC4A 3UWVA 3HQOA 3MTWA 4JD4A 3NPXA 1E6PA 4IPPA 2BV9A 1S5NA 4YVPA 3QLDA 1H51A 5JU6A 4CGTA 4L6DA 2GDQA 4U5IA 1OHLA 3DBNA 4H9XA 3A3XA 2EPOA 4WKFA 1Z41A 3BWWA 2PZNA 4D6IA 1W91A 3FEQA 3VZXA 2Y88A 4MDPA 4NKCA 2C79A 5BXRA 2PBOA 3PZOA 5HR7A 4HSNA 1T96A 5E0KA 2PP1A 2PMQA 1P0DA 2IW0A 2JFEX 5I2UA 2MUCA 4JBRA 4XVEA 1TX0A 4GI8A 3G1HA 3CQIA 2CKRA 5EYWA 1EDGA 5IFPA 3N1AA 1KQYA 3BV7A 3W2KA 4E0CA 1M03A 4QLJA 3HFYA 1ICQA 1S39A 5KZEA 4PB4A 3THAA 4JIPA 2VEPA 1UA3A 4LEQA 2X1UA 3TX9A 1IT8A 4KGJA 5HJXA 4RZ5A 3RRAA 2VQUA 1AZ1A 3TC6A 1V8EA 3MYPA 4ZA0A 3CZLA 3U9IA 2PWDA 1L6WA 4XZ9A 1BWLA 4GIEA 1WBJA 4MWAD 1I2NA 1KCKA 4L9YA 1X97A 3C3NA 4NJKA 1P48A 5CBJA 3P67A 2UBPC 3MUCA 4YHEA 1SJDA 3B40A 1ML1A 1UIOA 4IMFA 3ITXA 4UCFA 2XU2A 1AD1A 4V27A 2YDRA 2NQ5A 3AAMA 3NL5A 2V5BA 4YHGA 3OB8A 4PL1A 1LWJA 2V0TA 3TYUA 3ORWA 2PCEA 2W3ZA 2PDQA 4M3PA 1S2UA 3REQB 1TV3A 3WQPA 2WZEA 1EJ7L 4UB9A 2PWUA 3EBVA 2WHLA 4FR6A 5M17A 4PCFA 4FR1A 4ZB2A 2OO0A 4B92A 3PPFA 2FH8A 1HJVA 3GX9A 4AVOA 1UWQA 3EWBX 1LQ2A 1W2PA 2R1LA 3Q37A 3GNOA 4J7RA 1E3ZA 2XYLA 2VZSA 4RXGA 2I5IA 2CETA 1LUCA 4QEHA 2B4GA 1OFOA 3UETA 4ZQCA 4GH3A 2NXGA 1VC4A 5HUOA 4US5A 3KXQA 2CLEA 2QDDA 2YBVA 1ZAHA 4YTQA 4N02A 1TWZA 3NQ6A 2G0WA 2WJZA 1QO5A 3FNDA 1L6FA 3EOEA 3LCLA 1RQBA 5CLWA 3N2OA 4DZAA 2PFHA 4CLMA 4P8XA 4XAPA 2J75A 3RFAA 4H3DA 1I60A 3ZR4A 4W5ZA 4F9JA 5HR6A 1VQTA 3GXTA 5A6TC 1M04A 4HN8A 4DLFA 3VO0A 2V67A 5LIXX 3DOPA 2TSYA 3G0SA 1PTGA 1QXLA 1S1PA 3C61A 3GBDA 1S5TA 3BPWA 1MO0A 3DC0A 3B8VA 5H1WA 3WL1A 5CSUA 1TPEA 3NAVA 4MM1A 3NQCA 2R9RA 3HG5A 4AHOA 3NNTA 3PBWA 4GJIA 1RBAA 1IXOA 4I7WA 3W1UA 4XZMX 1RBLA 1PV8A 4G6CA 3R43A 1SUXA 3OJGA 4CNNA 3B4YA 3UXAA 1V5XA 3R1ZA 3VKBA 3M0KA 3H53A 3N11A 3BICA 1JPDX 3QH2A 4CUCA 1ZJAA 4QQUA 1X98A 3UEQA 4LCRA 1PO9A 3GIPA 1JXJA 1KM6A 1CECA 4TX8A 5HPOA 2GK1A 1RD6A 2ZZ7A 3B0YA 3SUWA 1Z8AA 2WM1A 5D9MA 3KBWA 2WZTA 3CQJA 2QT3A 1DXEA 2VFHA 2WC4A 3BGJA 3JR2A 4HNCA 1KFLA 4MZ1A 4AD1A 4WVXA 1A53A 2XVGA 3DGRA 3KM8A 5EMLA 1F74A 4K68A 2O55A 3O9NA 1H7XA 3LDVA 3QM3A 4R33A 3DXIA 4ACYA 3OTRA 1PX3A 2VURA 1ICSA 2B7QA 1ZTVA 3DECA 3OHMB 4IGSA 5E9AA 4F0KA 3GD6A 1TTPA 1D7KA 4KIRA 4Z2HA 2Y2WA 3BLDA 3MYOA 5H8PA 3LNMA 2FHFA 3ITYA 4YWSA 2C19A 4DJED 4IUGA 4HVXA 3DENA 4V15A 4BQ4A 4UTHA 2ZX9A 5PTDA 3UWEA 3T2QA 3CUZA 4ASTA 4Q8NA 3NQ7A 2VCBA 1W9VA 1XYFA 2ADAA 3RN6A 3G24A 4HA4A 2WJDA 1BYCA 2PLCA 3MSYA 4M19A 1OD8A 4NAEB 3THUA 4HSOA 1PIGA 3TN5A 3H70A 3WNPA 1BWKA 3I68A 3BAKA 3S5OA 2R1PA 1H5YA 3NQ8A 3OU8A 3W7QA 1XF0A 4JOMA 4EWJA 3C2EA 1RQHA 2G37A 3AJXA 3DERA 1YLVA 2X2GA 2Z26A 1WUEA 3UBPC 5DRCA 1J5TA 1DJZA 4U2YA 3QOKA 4DPPA 4FF7A 1BPLB 3GLCA 2HPMA 4Z0JA 1CGWA 3P93A 5FL1A 3MI6A 3NTYA 4HMEA 4MJMA 1WYIA 2G3IA 1J6PA 2BGNE 4B5UA 3LCHA 3KZPA 2IQ0A 3P84A 3VMNA 4WIWA 2ISSA 3W72A 3IIVA 5HNTA 1V0LA 2PEVA 4DZIA 1XSJA 1I6NA 2ZRZA 4XIAA 3ZLHA 3ZR5A 3HPZA 4M6QA 3MI3A 2NWRA 3AMGA 1X8CA 3R0UA 5XIAA 2EPMX 4IQLA 4P7OA 4EF8A 2PPGA 3TOYA 1FWGC 1E4MM 2E5BA 2BHYA 4MJ4A 1AODA 4UCGA 3CK5A 5ABTA 5A2BA 5BOOA 3RU6A 3U2OA 1XJBA 2D3NA 2B7OA 1V0NA 4W5UA 3IVUA 4CVUA 3NZPA 2Y63A 3AUJA 3W6YA 2G3FA 3TJXA 3UNDA 1WXJA 4Y7EA 1VZWA 3BL3A 1LG2A 3I7QA 1O5QA 1C7TA 2NX1A 1LG1A 3V16A 1GEQA 1W3KA 3BQ6A 4QG6A 4Z1DA 1UWTA 3NPWA 2WJEA 4M6PA 1WP6A 1LT7A 2PDBA 4PMDA 3EB3A 5DBUA 3EDFA 3WDQA 3LERA 2J6XA 2D2OA 3C2RA 3G1YA 4NAFB 3XIMA 3O16A 1T5AA 2P8CA 4JHZA 2POTA 4Y8FA 2MNRA 4MDOA 1XIMA 3R8GA 4JFSA 1G4PA 1F7BA 2E6AA 3KTSA 4N9BA 3ZVHA 4F2UA 4DQWA 4ML4A 3UWYA 3LHTA 3R2GA 5LIUX 1K9EA 3DKJA 2UY5A 4GYPC 2NT0A 4EIVA 1XRFA 1ZLPA 3ITTA 1E9LA 3M5VA 3QY7A 3W53A 3PJXA 4A6GA 3O6YX 1JPHA 3LBMA 1T0OA 2SFPA 1J4EA 1JUBA 4UQCA 3S42A 4IQEA 3MV01 3TROA 1GYMA 3L9CA 1G6CA 1CB7B 3FYYA 4KH2A 4IICA 2GLKA 1GUVA 3E0IA 2OSWA 1HKMA 5CC5A 4S3CA 1LL6A 1OX4B 4C6OA 2I14A 2YFOA 3LPFA 1KRBC 1PDZA 1F6KA 3P3BA 3VTRA 3GVVA 1TTQA 1E51A 2BODX 1C8YA 1V02E 4XUYA 3ITCA 2OEMA 1D8CA 3WZ0E 5A1AA 3S0CA 3I10A 3QMRA 1GW9A 1JCXA 1EPXA 4ZBCA 2ZZ2A 1YBQB 1ADDA 5I3HA 2D20A 3QPYA 4C1LA 1Z6KA 3ZS4A 1JDAA 3UY7A 1AW1A 4GKTA 1VFMA 3PWAA 3LLXA 1V6UA 1UD8A 3ALGA 4QLLA 1QOQA 1XLEA 3PBMA 3FGCA 3AS2A 1CLKA 3W70A 2Z7GA 3CMFA 1F4HA 1AH3A 4AMCA 1R38A 4UIOA 4QG9A 1K8XA 1KXVA 4Q4RA 3W01A 4IG2B 4RKAA 2PTYA 1ZJIA 5LHEA 1VFUA 2R91A 3DBPA 4XBKA 3S6TA 3A5FA 4ZSUA 5IBXC 4GGHA 2V5DA 3AIUA 2ZX6A 4GIRA 3GFYA 3CL8A 1J2WA 4JN8A 3ZM8A 4AVNA 4OBTA 3PS7A 4WSHA 2PDYA 1RVKA 4MAVA 4E4UA 1XQLA 1R47A 3OZPA 3JS3A 4WF7A 3E1F1 1Q6EA 4FXFA 2IPFA 3OQ8A 1A47A 5MKGB 2YXXA 1F3EA 1H7RA 1EOKA 1NP2A 1ZCOA 3G18A 4E6MA 5K9CA 3MT1A 3B9DA 5AVHA 1QBAA 4U28A 3N4AA 4L1XA 3WQDA 1VLIA 1UR3M 2PTWA 4RNHA 5BCAA 4MYXA 1QPQA 2WMIB 1EC8A 4F0HA 2ZZ3A 4RW3A 1PL9A 1OT2A 2HTMA 1OADA 1SMAA 3TXVA 1MUWA 2VJXA 1J0KA 3GBEA 4UNIA 4O17A 5G4HC 5H6HA 3NDOA 4ZZ9A 1ISXA 3HPAA 3OA3A 1RSCA 4MB3A 1WDDA 2QEZA 4PYSA 5J5DA 1HVXA 3U5YA 1XX1A 3WDRA 3FA4A 6TIMA 1W5PA 4PUWA 1GZGA 1TPVA 3WNNA 1A0DA 5K3VA 1BEUA 3QGKC 1B3OA 4CKQA 1HTIA 3WMBA 3POCA 3HTWA 2HVOA 4MVAA 3NQBA 4CNSA 3ID7A 1E1CB 1HUVA 1S2TA 4WGXA 1OT1A 5GQBA 2P3EA 4ZOAA 3A9BA 1TMQA 1F5ZA 3VNYA 1E3XA 5JBFA 1I2QA 3EDDA 3UXKA 3U6WA 4LS2A 1SPQA 5HUPA 4W85A 1AK5A 2OKTA 2WC3A 2GQ8A 1F73A 5CPNA 4PUNA 1HJQA 3A3WA 3M9YA 4LS1A 3R8HA 4ECLA 3PK7A 3LLDA 1BRLB 1YKWA 4ADUA 3UZJA 4GNKB 3WUEA 4REQB 2OPJA 2ZIDA 2HVMA 3MMUA 1GKRA 1UB3A 4J3WA 2WBKA 2XFFA 3N17A 2J9YA 3VGGA 5CXPA 1W9PA 2TAAA 3VE7A 4V33A 4U31A 3GO2A 3WO8A 3ANYA 5BNKA 3G1VA 1MYRA 1XKJA 4JX5A 1SR9A 4ZO9A 3GDTA 4HU3A 3NYDA 3N6HA 3VGFA 5LGZA 1KWGA 1IR1A 1EJVC 2J74A 4RCXA 3IAQA 3AHXA 1FCVA 1ZALA 1W1TA 2PGFA 1SW7A 2HJPA 2J66A 4NNAA 4NNBA 4QRNA 1HJUA 3F5KA 2XUCA 4Z2GA 4N42A 1Q63A 4Q4SA 4Q33A 3FFSA 2XZ9A 1K3UA 3BDKA 4M6UA 2CFFA 3CWOX 5TD4A 2FPTA 1VIZA 3BQ5A 2VVNA 1M65A 3WK1A 2J4GA 4ES4A 3IGHX 1KM4A 3DHUA 1K6AA 3FAXA 4K8GA 4KWWA 4PULA 3WF1A 2WSPA 1W5OA 1G7VA 2HISA 3ZXWA 4S3JA 4TVUA 3SI9A 5BMWA 4XX6A 1KBJA 3ZJ7A 4F2BA 4OU1A 2VEGA 1LT8A 1WDRA 3NZ1A 3W0KA 3GHSA 4IZGA 3TYAA 1JQXA 3W7EA 4GUFA 1ZQ5A 1DWJM 4L5ZA 1X1ZA 1W9UA 4MPQA 3RO8A 1VBJA 4RXFA 1FFQA 1XGDA 4PBFA 4I9JA 4DM1A 3IJ8A 1HJSA 4TUFA 1HGWA 2GPTA 3VPLA 3CHVA 5T26A 4Z42C 3T81A 2W0UA 3HV8A 3M0ZA 5F1VA 2R1NA 1KBBA 9CGTA 2ACQA 1V6TA 2VZUA 1V0MA 3GTNA 4J3UA 3WF0A 1RCXB 3BLOA 5KMYA 1XLBA 3V36A 1ME9A 4JX4A 5U4NA 1T40A 2QUMA 1DBTA 3WLRA 1L2UA 4WZHA 3QYQA 5FL0A 4KPLA 2ZICA 4HMDA 1UIPA 4RE0A 1UD4A 3TWAA 3MV11 2HBXA 4EAMA 2PRMA 4BA0A 2DQWA 5CC7A 2Z2UA 3MHFA 1QW9A 4YXGA 5CG7A 4Q3MA 1JQVA 2NSOA 3UGRA 3BUVA 1ZY9A 4AEEA 3FIGA 2Q8ZA 2RDTA 4XWUA 3SQMA 1FBAA 4GPNA 4ROPA 3H7VA 3ONBA 3LXAA 3CH0A 3W87A 1LQAA 1B30A 1SO3A 3V1PA 1OC7A 3TA6A 4BI7A 5E0FA 1FWFC 2YB4A 3RXZA 2WMKA 4DBWA 1R87A 2C0AA 3LXCA 3QYSA 3UR7A 1OFAA 1V93A 1ZAJA 5G2IA 3R13A 2VX7A 5AN7A 5DRIA 3A5VA 1YDOA 3QY8A 4JY9A 5TBOA 3ZT5A 4ZO8A 5DX7A 3H4WA 2DZWA 1US0A 4HA1A 3VIGA 3G1XA 1W9DM 3W7GA 3AHVA 1VBUA 1TPWA 5REQA 3QHOA 3W02A 5SWUA 5K4XA 4KGLA 1HL9A 4UMAA 3U57A 2FDSA 1FCBA 4I6KA 2AAAA 3B8WA 3LOTA 5K9DA 4MMWA 4EVZA 3W6LA 4B2DD 1AJ2A 2J7DA 3WD1A 2P3ZA 4LUSA 2CLOA 4GRSA 3RLVA 2O9RA 1Y5VA 2UY4A 4BS0A 3ARZA 1TA3B 1LROA 4NF7A 1OFPA 4QAWA 3CHDA 4NJGA 1GPWA 2PDCA 3HIJA 3ZLGA 3FW6A 3Q67A 1W6TA 1KFBA 3P8JA 1IZKA 4LUJA 5ABFA 4N6FA 3ZIZA 3PPHA 4WCJA 4LAOA 3WUBA 5C70A 4ZOEA 4AD4A 2ISFA 3E02A 2ICSA 1EF3A 2G4FA 4WJXA 2OQLA 5FF0A 3AZRA 4ZFMA 2ZUMA 1JNDA 2DPEA 2QDHA 2FZMA 2FHBA 3BZGA 4PBGA 4AUBA 1GOXA 2HMCA 4BWLA 3BLIA 4HJWA 4HYVA 2BY1A 3UXIA 4MFEA 3ICJA 2VRQA 3W25A 1S2CA 4J2PA 2X05A 4ZQOA 4QJ1A 4N9CA 3O8AA 4GC3A 1WKYA 3TN4A 1ECQA 1I75A 1J8VA 2E09A 5DT5A 3D3FA 3CUIA 1YW1A 1OX6A 2J47A 4NZ4A 2RJHA 1C93A 2VD9A 4OWGA 4QIUA 5JVLA 1NJJA 1W1A1 3S3GA 1Q6DA 1O1ZA 1DWAM 2AL2B 5G2WA 3OZYA 3EX2A 2WMHA 1JDEA 2ZRYA 3B06A 1CB2A 1JL8A 1W56A 4LPCA 4M80A 1Y65A 5AOUA 4AF0B 3E3HA 1EIBA 1FCQA 2VX5A 4AX6A 3QQWA 1Z42A 1GJWA 4DVOA 3PZUA 4AC7C 5DFAA 1K8CA 1WNOA 4WKHA 1V3IA 4DYKA 2OWXA 2F7FA 3ONCA 2O92A 1XG4A 2A7PA 1V3KA 3AZTA 4AY7A 4CCZA 1JZ5A 1SFSA 2XVLA 3FDGA 1E1EA 4JS3A 1AFSA 1L6YA 2XN1A 3LU2A 1FWRA 3UF9A 3WLJA 3AS1A 1UUMA 4PTMA 1QU4A 3MCNA 3NURA 1A80A 2ZWZA 3REQA 4EWND 1DJQA 3JRKA 1HNYA 4DO4A 2DZTA 4WX2A 4IIHA 4LCSA 1BWVA 3QMTA 4PC8A 3QW3A 1E6SM 5CAHA 4E4FA 5EY5A 4DHGA 3VCNA 4FNQA 2ZX7A 5D4YA 2J79A 4H9UA 2AL1A 1FHDA 1TTIA 2CZVA 1A5NC 3AISA 1L2QA 3WMLA 5AC4A 1KFWA 1N7KA 5D8WA 4AC1X 2J7BA 3RMJA 2YIHA 2RKXA 3VIFA 3IJ9A 4A29A 5DT7A 5FSDC 2TYSA 5BRQA 3OGSA 1R3QA 2PWEA 4YCPA 2YGYA 3LRLA 4LRSA 3NSMA 4MKVA 3WMSA 1K4HA 3WJZA 3C2VA 3IANA 1XHGA 2J7FA 4DX3A 3IUIA 5T91A 4GQGA 4IPLA 1G4SA 1V02A 2P0IA 3PTMA 1SW0A 2V5KA 2Y8KA 4JTUA 3WLQA 4N2YA 1QMLA 4HK5A 2EBNA 1P1MA 3VAVA 4OOZA 2BS9A 3BW2A 2QCDB 3BLLA 3QJAA 1CBGA 4PMVA 1UWSA 3IIXA 3B05A 4QHRA 4N4PA 4O28A 1U83A 3QN3A 4KEVA 3AXKA 1WAWA 1FWEC 4ZXOA 4P7RA 4WDWA 5JQ9A 1BGAA 3K8KA 2DIEA 1OCBA 3SIMA 2QJNA 3QR1A 3M1ZA 3W2UA 3WX7A 1LBMA 1M7XA 2GQ9A 1I8JA 5LZLA 1OJXA 1UJPA 4O1BA 1ZJHA 1NIUA 4F66A 1NTHA 4AIEA 1QO2A 3H2OA 4UTFA 4JQ3A 3AWNA 1GVSA 3B8UA 5J04A 5KSWA 1KBLA 3BCDA 2DUXA 2PS2A 4XK2A 2XPKA 4D6GA 5HWNA 4C6LA 4B3ZA 2BXVA 3SQSA 5D05A 1JYNA 4UOJA 2GSEA 3BE7A 4Q8TA 5KTLA 4NZ3A 1NAL1 4DZ5A 4Q8OA 1BF2A 3CPUA 3QZAA 3OA5A 1FP9A 3UCDA 4JIHA 3HMJG 1JCJA 1GEHA 7REQA 4TQTA 2DQXA 2NV2A 4P5UA 4M1RA 4PMNA 4KS0A 3R8RA 4NT0A 1B3ZA 4DWDA 5HJYA 3NSXA 4HTBA 3LENA 2ZA3A 4LYKA 4LAMA 1SJCA 4OGZA 3EWDA 3SADA 1GG1A 2VL4A 3ABOA 1IHIA 3VOIA 1GJPA 4HBKA 2VDHA 2C71A 2QDGA 4HCHA 5LXXA 2CLFA 3WQVA 4ZMGA 1O7AA 4QSFA 1EH9A 3V3WA 1WKEA 1ZBWA 2G3JA 3VA8A 2ALDA 5FACA 3F7JA 3SN0A 3RHGA 3C2FA 3S4TA 5FF2A 3KLKA 4C6CA 1K03A 3QC0A 3ARPA 4FX8A 4MJ2A 5CPTA 4O13A 2CHRA 5D38A 4Z1YA 3QV9A 3DFOA 4QAIA 2Q71A 5EMMA 1OC5A 2IKJA 2CW6A 3A4WA 4HQVA 1GQJA 2G3MA 4ZO7A 1P6CA 4XBJA 2I9UA 1M7PA 4PMOA 4UNLA 3OHIA 1QBBA 3KDNA 4TO8A 2WBGA 4LC8A 3RYSA 2EF9A 3FN9A 4ZR8A 1IXPA 3KFTA 4HZ8A 2BWGA 2VX6A 2X16A 5DELA 4ORIA 1KRMA 5C7HA 4LU0A 3GIQA 3NQ2A 3GC2A 2NXIA 7ODCA 1O12A 2FZNA 3AU6A 1TSIA 4TOQA 1FWNA 3LZ3A 1DKWA 3FEMA 3O6CA 5A6JA 2QYGA 1UR2A 1S3HA 1W3LA 2REQB 1SW3A 1GOQA 3VZYA 1W3IA 1JUKA 4CQCA 1O68A 4H7VA 2HNEA 3NA8A 2OLAA 1BG9A 3F1QA 1R3YA 4DXKA 3NXFA 4B5WA 2NLIA 3A64A 1FXQA 3PPCA 1A5SA 3BOFA 4UMBA 1UH3A 3MP5A 4Q8WA 4Q8PA 1ZJBA 2ZRXA 2PAJA 3N04A 3WKZA 2VNCA 1QWGA 5CBBA 2ISVA 3AHZA 6A3HA 1W1PA 2WYSA 1WUFA 4H2HA 3PSWA 2NXHA 5LIWX 3AUOA 3DG3A 1FY6A 1VEOA 4Z0SA 1MRAA 3PHAA 2Q01A 3STCA 1LJYA 4L56A 4GYKA 1K9TA 3CIVA 3W7PA 1CGTA 3P5YA 3SSJA 5I3IA 2IKHA 3P2VA 1CYGA 1OIFA 3GE7A 1ZUAX 2Z4GA 4F4RA 1QOXA 3C0JA 1FHVA 4MJZA 2PDFA 1H1NA 1EXBA 1EXPA 3W22A 4O52A 3B9NA 3WH9A 5LIKX 4MUZA 1OEPA 3UJFA 4PA8A 4DPQA 2ZCGA 4O0KA 4GYPA 3W71A 1X8FA 2WK2A 4C6BA 1EC9A 2QW5A 3H8AA 4A3UA 3WFLA 3GTHA 1KO0A 3P60A 5HQEA 1JCLA 1FTXA 4FNPA 5HPCA 3PUEA 5G1YA 2VC9A 5BRBA 4QM1A 3AS0A 1U22A 1XM3A 1QK0A 1TPB1 4M0XA 3TTSA 1GQNA 3SCWA 1KXHA 1TIMA 5LA0A 1NDWA 3HPSA 3UPWA 4PE8A 3LQLA 3M16A 1E72M 1L6SA 3S1VA 5IXEA 5I06A 4Q22A 1V4YA 2QQ6A 3E6EA 3D3AA 3EOSA 1JZ7A 2Z28A 3MJYA 4GXMA 5BU6A 1DHKA 1OINA 3P62A 5F4SA 2CBUA 4GBUA 5HINA 5D02A 5G4EA 4AX7A 3GDMA 3NL3A 5C2GA 4IUOA 2HS6A 3WQFA 1XI3A 3U7VA 2J7HA 1JD7A 3VUSA 3STGA 4YMZA 5FF7A 2A3BA 3GHRA 3GNRA 4ZO6A 4HSHA 1QVBA 1QOPA 2VFFA 3UWUA 4JZ5A 1W3HA 1ME8A 1WB0A 4RV3A 3L4XA 3CQHA 3E2VA 3TTYA 4CNPA 4KBXA 1H7WA 1CXLA 3TYEA 4JHOA 4QS6A 5IBXA 1UR1A 1V6VA 5DMMA 1BF6A 5IHRA 2V3GA 2BHZA 5CZJA 3M6YA 3TCEA 2PD5A 1A5BA 1R86A 2D1ZA 3V35A 2WSYA 8A3HA 2WKJA 4C5ZA 5HQLA 1KCLA 4AWTA 1CXIA 2D23A 4ERAA 3R89A 1V03A 2ESCA 1FKXA 3NM3A 4JL1A 4JAWA 4ATDA 2FFIA 3N73A 1LTDA 2OQHA 2OGYA 2TODA 4JIQA 3AXIA 3R79A 5I00A 2Q3OA 3BGAA 1P6BA 4GHRA 4H6RA 3VC5A 1VFHA 4AD3A 1QHZA 2VZTA 4R53A 4ROQA 1QHPA 2GGHA 4DO7A 3LHVA 2WPGA 3EKGA 4ZGYA 4LYQA 1WZLA 3G5EA 2WMGA 3JW7A 1ONWA 3E12A 4JTTA 3FSUA 5ECVA 4EANA 4K36A 4CD7A 2DSVA 3MI2A 4AEOA 4FALA 3WN6A 4IL0A 1FHLA 1RA5A 4FNSA 1CGXA 2JIWA 2DV0A 1GK8A 4DUVA 3ZQ9A 1AMKA 2OG9A 3LCFA 3LCGA 5T9CE 2I1OA 4JNMA 3VX1A 3ZYZA 3NXLA 4GNJA 2JKAA 5JIPA 3V5CA 3TLQA 5F1UA 2VEIA 3F4DA 1GONA 1SZGA 1LUCB 4LB3A 3GDLA 3GRIA 5LHFA 4GX9A 1A5KC 3PUDA 1MUCA 3UG8A 4ACZA 4KF1A 4UNKA 4MB1A 3A22A 3DEQA 2VCAA 3N34A 1X6NA 3GG0A 1UMLA 4TVCA 3LEPA 4P7LA 1SMDA 4H7CA 1TV2A 4GBDA 1KLZA 3I6TA 5DCDA 3W37A 2FYMA 3UPBA 3CASA 3WNLA 1QUMA 3OBAA 4LF2A 1X1OA 4O15A 1N2VA 3KTCA 2E68A 4LJ3A 4HHMA 2Z1SA 4HYRA 2CWXA 3CM4A 1ODUA 2F61A 1NFGA 3UA3A 2PWVA 3M5ZA 4BI6A 2VELA 3HG2A 1JZ8A 3UXDA 2D73A 1KM3A 1O94A 4P2VA 3TYZA 1RJRA 1OB0A 2JEPA 3E2SA 3VMOA 1GVQA 1HKWA 3LGGA 4M24A 5I3JA 3WD2A 2J7EA 2VOMA 4I5RA 3OLEA 2PI6A 5AC8A 1A5UA 4HD5A 5I3FA 1OY0A 4NZCA 4E2DA 4D6EA 2Z1XA 1N8WA 1NDZA 1BFNA 3HO8A 4LAKA 3SECA 1CGYA 5HWJA 4LALA 3KOWA 3UZYA 2PWFA 4EK7A 1O66A 5EL1A 5C8BB 3R6IA 2KX9A 3GHTA 3TUUA 3S1UA 2YA1A 1M7OA 2EKGA 1TUFA 1FCUA 4JYDA 4I5XA 4S39A 4LANA 4NP7A 1J0IA 3P74A 1PEZA 2QCEA 4K2SA 3T0TA 2OZ8A 4L4MA 1VBGA 5KETA 4L7ZA 4Z2IA 2ACRA 2QJIA 3ARVA 4AG0A 2O9PA 4AISA 4W88A 4C6FA 4IX2A 2J25A 4S38A 4HA3A 1MEIA 2DZBA 8XIMA 5I79A 5F2MA 1HL2A 4IGNA 4NU7A 2WB5A 4H8UA 5GJNA 3GG7A 3UFYA 1YTKA 3PR2A 3W2JA 2IQTA 3ZT7A 3CWNA 1VR6A 2W61A 3PVFA 1KFEA 1PTAA 3ME3A 3AYVA 5M3WA 4FS9A 4KCTA 7TAAA 4Z2KA 4C6EA 1W3TA 3MJMA 1UKSA 3E2RA 3LPGA 4XZBA 1H50A 1JRCA 4FX7A 1E6ZA 5AECA 1L9WA 1EO7A 1CW2A 4PGLA 4X0NA 3I3BA 4QG8A 2LLEA 3W29A 3C3UA 3GVRA 1TJ1A 4I8YA 5I5RA 4JTHA 1HFBA 1PPIA 3LS9A 4WXYA 3LGEA 2DT1A 3HM7A 3IJDA 4LX4A 3UT0A 1MW1A 2QNEA 3W82A 2OKOA 2ZOXA 4PMUA 1UD5A 1IV8A 4IFOA 1NELA 3MUIA 2ATMA 1TO3A 1A3XA 1Q6OA 1QPKA 1UYQA 1PZ3A 3SCQA 5DEZA 3CZJA 3CT2A 1LORA 1K70A 2DSUA 1DTNA 3PBVA 1KKOA 3CLWA 4FPSA 1JPIA 5T9BG 4NRRA 4C7GA 4YJ5A 3HB9A 2V9DA 3VZZA 4QDPA 3GU1A 4YWIA 5F4XA 1XDJA 3BLFA 3NSNA 1DJXA 3H7UA 4DJDD 3A3HA 3G8RA 3M0VA 1DV7A 4C1KA 2PLJA 1KWKA 4V1XA 4UQDA 3LCXA 1QI4A 3HFTA 1XH1A 4L4LA 3VGHA 1LL7A 3R11A 2QCGA 4MTVA 1FOBA 4NG3A 5AYIA 2TPSA 1DJGA 2YL8A 3SUTA 4K1GA 4IMAA 2PGWA 1S38A 4ZTYA 2WAGA 4S23A 5CSYA 2W5FA 1PTDA 1XUUA 3GU2A 2YFNA 1G1YA 3EWUA 1V51A 5D8ZA 1P0KA 1VRXA 1E56A 3W1PA 4CEUC 3WDIA 3MU7A 4OBRA 5GNYA 4Y2WA 2ZXQA 3GNXA 1Z7AA 1MQQA 3LSBA 4JQAA 2PU0A 1QI3A 2FKPA 3RAOA 4GQQA 3PY2A 4J28A 3UR2A 4WGHA 4NY2A 1R3SA 4TXEA 3WELA 3MA8A 4IGMA 3JU2A 2VRJA 3TV8A 1R3VA 4ZE5A 4IM4A 5A5WA 3VD3A 4L6HA 3TP4A 1KFCA 4UR7A 1NQKA 3Q65A 3RGTA 3N6QA 4H04A 1VFFA 3W2LA 1QATA 1H5VA 5DLCA 1OM0A 4AFYA 1S5VA 3EX1A 1H0GA 2WV8A 1XLGA 1KV5A 2J77A 2ZWYA 3WQWA 4IJRA 2PZ0A 2DW6A 4HB7A 4FOUA 4PN2A 3KOFA 2QAFA 3RNDA 2WCSA 3QV8A 2BB0A 4OOUA 1GYLA 1BLIA 3O63A 4GVGA 2R6OA 1F9CA 3ZVHB 1TZ9A 3GU9A 5FIPA 2X1RA 8RUCA 1A5LC 2EG6A 4MUPA 1W1IE 3TC3A 3RUBL 4C6DA 3KL5A 1WZMA 4P61A 1MXGA 1TFVA 2A21A 4RR4A 4UOQA 2OR2A 1OYAA 4A2SA 3OQEA 3FVDA 1KA9F 3N2MA 3VDAA 3AXMA 2P76A 2KAUC 2UY3A 3BAJA 1QPNA 3NM1A 1SSDA 4N9EA 2VYOA 1Q8AA 1EGMA 2OODA 3GC5A 1OYCA 1QNSA 5E09A 3KEHA 2VKZG 1E9YB 1MSSA 3LI1A 1XC4A 4Y96A 4JX6A 1AG1O 1JXKA 1TV7A 4GACA 1WDPA 3O6AA 4L80A 2C1IA 3PWIA 4FK9A 2WSRA 1WXZA 3PM6A 1MMFA 2BOGX 4I7VA 5FSEC 4GC4A 4YTUA 2Z6IA 3GR4A 4AHQA 3KHDA 3W07A 2A79A 4KT2A 4G7FA 5DBTA 4PMJA 4PR4A 3HURA 2Z25A 1H11A 2GWNA 3NDYA 4RPPA 3FGCB 4GY0A 2V6AA 3VOHA 3WF4A 4LC6A 1BVNP 4GYFA 4YIWA 3WBEA 1E4LA 3DHPA 3A21A 1CZ1A 2ACSA 2C13A 1OBAA 4M51A 3THQA 4BHYA 4PL2A 2WZIA 3WD4A 4UBPC 3M0IA 1XC6A 2GUUA 4DNMA 3URAA 4EX4A 2GDUA 1M6JA 5DMLA 4IIDA 2GVLA 3TAOA 3SRHA 5CC3A 2H3BA 3CL6A 3JVAA 4G2DA 3DAQA 2GGJA 4PFHA 2FMOA 3SCTA 1B9ZA 3GZ3A 3IGXA 1KTCA 3FJLA 4UTWC 2EKCA 5BXSA 3CGTA 3CV2A 5L9FA 1IF2A 1F2JA 2CLKA 1I9CB 4K8HA 4WEVX 3OIXA 2QVNA 2B31A 1C8XA 4ADSA 4W7VA 3UP8A 3W7CA 3EXTA 3BOXA 5LNSA 2GUBA 3EPOA 3AICA 1TYGA 4FNTA 2PUZA 3UZZA 4AEFA 1RAKA 4GD0A 4K6AA 3WLSA 3MWCA 2JQXA 4J3VA 2CLLA 1KQZA 3KLLA 3TA9A 2HXUA 1T8XA 4U3CA 4NZFA 1YPIA 1Z69A 3VNMA 1OCJA 1N55A 2WJFA 3MVTA 1BTMA 4LV9A 5H8MA 4CCDA 5AHFA 4OBSA 3NCOA 4GUJA 3BG5A 4UZUA 4IISA 3TYDA 4JTLA 1ADOA 1VEPA 1PVNA 3CV6A 1AQ0A 5HMFA 3TN6A 5XIMA 3WG6A 3A23A 1ISVA 1PE1A 3PB2A 3Q58A 4DI9A 2Y5JA 4QX4A 2JIEA 3SBFA 5DQPA 3WK0A 1I45A 3BG3A 2BGQA 3M0LA 2EAWA 4XZHA 5KZMA 4E38A 2ASHA 3CHFA 2QJHA 1Q2RA 1ZZMA 3LCIA 3ABXA 1YXYA 4JPGA 2Y62A 3KP1A 1RPXA 2BX7A 3MMWA 1U1HA 4H8VA 1QFEA 4AZIA 5CCZA 4X22A 3B0PA 1KNWA 1BYDA 4DJFC 3H23A 1TUXA 3L5AA 1VAHA 5IOBA 4CQDA 4GVIA 4Z1BA 5BXPA 2PDLA 3C8FA 1UJQA 2Y7DA 1KLYA 2PDPA 3MO4A 2RDUA 1OCQA 1XBXA 2FPVA 3SCPA 3U3HA 3SQLA 3QHMA 3UY8A 4FXJA 2W6RA 6ALDA 3OLGA 4W8BA 3ZVIA 2OB3A 2YBUA 1HKIA 1YE4A 2OX4A 4YLWA 5IHSA 1H60A 3SSZA 4Q4PA 3BURA 1FDYA 1W0MA 2NQZA 1E9IA 3VM5A 4PCSA 1GGOA 5A95A 1RJQA 2XH7A 3T7VA 4XKYA 3IIZA 3UJSA 3WK3A 3ABQA 1TX2A 4CQ9A 2YLAA 4C6MA 1RA0A 3P8IA 3IARA 2HRWA 3LTSA 2ZKMX 4NRSA 4O50A 2CZDA 4K7YA 1TVNA 1R5YA 3LBOA 3DI1A 5K9XA 2HNHA 2OWCA 3PZIA 4ONVA 1M1BA 3NL6A 3BAYA 4XAYA 1TV8A 5E5CA 3WNMA 2JGYA 3R12A 3N2CA 2VDIA 3DG6A 1PAMA 4G9PA 1XCFA 1MVYA 1XBYA 2FVLA 3WJXA 4CNOA 1B5TA 4V1YA 4O53A 5KINA 2GJRA 1A49A 2ATSA 1F61A 1GVYA 4XV0A 4H9TA 3N4EA 4A8RA 2J88A 4QP0A 5AYZA 1UWRA 3W7JA 5DCBA 2W67A 1YDVA 4M1BA 3UWWA 3OYZA 1UPPA 1ZU8A 2D2HA 3MWAA 3QPZA 4JIEA 1W5NA 2XFWA 5BROA 1HZYA 1YPFA 4M6VA 3RMEA 2GFTA 1OD0A 4IT1A 2P1FA 3PUGA 1XGEA 3C6CA 4O57A 2FZBA 3IGUA 5GNXA 4KKXA 2OWWA 3KDOA 4AIUA 3WJYA 2WQDA 2X7VA 4YS1A 1V7YA 3AO0A 3UD6A 3O05A 2VVSA 1RK6A 2ZUNA 4HPXA 4MLJA 1SZNA 3ANUA 1TWSA 2FIQA 3RCYA 1IIGA 3CB8A 4WDXA 3S46A 5ENLA 2DT0A 3CIXA 4AZBA 2PWHA 3BLKA 2FJUB 1RP9A 3PB0A 4DO6A 3I6RA 3TJIA 1U5JA 3EEGA 1THFD 3KW3A 4R9XA 1OF6A 1EKOA 3QLLA 2QJJA 4DAFA 4RDWA 4PUUA 3DYPA 3VGEA 2RH9A 3VYLA 1UA7A 4NXSA 3MW7A 3UW6A 4LVFA 2BOFX 2HWGA 4LW7A 2G5WA 1N8FA 4ZTXA 1LOLA 5D33A 3QSTA 2PDNA 3LI0A 4HKPA 2C14A 4ATWA 3B9EA 5I02A 4M5PA 5JUVA 4S3BA 1UOZA 1Q4WA 2YX0A 2YPIA 3S2LA 1G9HA 3KS6A 1KM1A 3N2XA 3S2MA 2V30A 2P5NA 3CZEA 4UTTC 1EA0A 1ZBCA 1SM9A 2FB2A 3EXRA 3SCRA 4D8AA 3WQEA 2XH0A 2UZ9A 4O8AA 2CLPA 4L6OA 5CPLA 4O1AA 4WY0F 5FJRA 5REQB 3FKRA 3SRKA 1XQKA 3G3DA 5IDIA 4FIQA 1CT5A 3EX4A 2OYLA 2D22A 3LTYA 4S2BA 2J13A 3WDHA 4PRTA 4RE3A 4XKMA 4LUSB 1T41A 1JZ2A 4LUTA 4NVTA 2NUYA 1CTNA 1WXYA 2E25A 3ISIX 1U1UA 3CV1A 1KR0A 1JDDA 1GOOA 1RXOB 3VILA 4LT9A 1ZP4A 4NUWA 3L21A 7A3HA 4DAIA 1IWBA 4JEQA 2GZXA 4UR9A 3GY1A 1QNQA 5ABFB 1PKNA 3VIOA 1KFKA 2VT0A 2Z7KA 3R4IA 2YA2A 2QJGA 3BSMA 1D7FA 3H2NA 5BZAA 2QUNA 2FZ9A 3EDJA 5AHMA 1Q6FA 1DORA 4XBSA 4C6KA 3HG3A 1DIDA 3PZ9A 3R10A 3VOJA 5CGTA 2DY3A 3G6MA 4GISA 2QGHA 2I57A 4DUXA 3RRXA 4BQ2A 1TVLA 2CBJA 2HK1A 3CIWA 1QASA 3FLUA 1B0IA 3FAWA 4H00A 3S9YA 4MIMA 5LSMA 1W9BM 4HOZA 4A4AA 4OQVA 1JFHA 2ZTKA 4YL2A 4I3GA 3M0XA 2XGBA 1R85A 5F2IA 1TG7A 1EX1A 1LLOA 1EJWC 4J4KA 2XIQA 1QI5A 1EQPA 4IJBA 1U1JA 1VFLA 3PTDA 2NUXA 2Y4SA 1MUMA 1X6UA 3NQAA 4BWLC 3LB0A 4PUDA 5FKYA 1W1YA 4PCTA 2C0HA 4KQNA 4BI5A 3MKCA 3KS5A 3NR0A 5CGMA 2BGSA 1XUZA 5BMXA 1NDVA 2XHYA 3LHWA 4KRUA 3ANVA 2NX3A 1KRAC 3L65A 4I9TA 1LCOA 2FGZA 4NIRA 2QF7A 5DMNA 5AHLA 3PJTA 1JCTA 3HPFA 1NF7A 4DF2A 3O0FA 4AXKA 4AW7A 2J24A 1YEYA 3LMZA 1LQ0A 2F6UA 1EZWA 1U30A 5JH2A 1KM5A 3L5MA 1JGIA 3EWXA 3K4DA 4AYSA 1IXNA 2IXVA 3PPGA 1V3JA 4YNGA 3LCWA 3UR8A 4DNHA 4LQ1A 3UG3A 1RH9A 4US5D 3O3RA 1XICA 3M47A 5J5RA 1XPYA 1C29A 1PBGA 1QW8A 4LVDA 3O1NA 3OLDA 4NYYA 2BHUA 4MLRA 1HW6A 1TZZA 2ZUWA 1A3HA 2PDMA 4ATLA 2QKFA 5M03A 4H6KA 2A2IA 3M0YA 5I3GA 3NGFA 4RUBA 3N25A 3GTXA 3B3DA 2PWGA 1ITCA 4HNUA 4PRWA 1F8IA 4DB7A 4GIAA 3S2CA 4QE4A 4FI4A 2TRSA 5ABGA 1DXFA 5A8MA 3VXGA 2AKMA 3B8IA 3MDWA 2DGAA 1J18A 4CU6A 3VOGA 3U0HA 2AMGA 3NVTA 1W1ZA 4UQAA 4U2ZA 3T44A 2P8BA 1FWJC 4Z2LA 1F6PA 1US2A 3EB2A 3W1TA 2VDGA 1JD9A 1ISZA 3CPGA 1UP3A 2DORA 4YCOA 3HN3A 1PHQA 1H2JA 2J27A 3WLLA 4JTCA 3V0SA 1G4EA 5LNRA 3S6DA 2I17A 2XWEA 5C9ZA 4IMGA 3W1RA 5U7SA 1AJZA 2GSHA 4PTXA 2E28A 4DUOA 4I9AA 1OG0A 2C1HA 2H90A 1GT8A 3C2YA 1JIBA 4DY1A 4RLIA 2PLKA 3H2FA 4UUIA 1CIUA 7REQB 4XO6A 5CKSA 1I0DA 1X7IA 1ISYA 2AGKA 4F0LA 4BFAA 1P5BA 1SO5A 4J27A 3NOEA 3WIJA 5HULA 1DWFM 1UKOA 3KBNA 2DVTA 1FXPA 3AROA 1ZNNA 3W85A 3VCRA 4IMCA 4LWWA 1H7PA 3W1XA 2ISWA 2HQAA 2OSXA 4YYFA 2IUZA 2PA6A 4HPGA 3NZGA 3MY9A 3GVGA 1J11A 4BJHA 5FAJA 1CXEA 4BF9A 4XZIA 1IWAA 3GNDA 2YL5A 1K9FA 1BYAA 3QHNA 2ZFAA 1PX4A 4FLOA 1BXBA 2EG8A 3GK0A 4K8EA 2DVUA 1ZAIA 3QXBA 5CZKA 1HP4A 2PDGA 3UVIA 1AJ0A 3WH7A 4ZFCA 4WJEA 2XN0A 3VCCA 1V6XA 4WY0A 2QR6A 2HV5A 4E5TA 3IUHA 1FDZA 4PCNA 2E6DA 5F2LA 4H19A 1E73M 5FEWA 1H49A 1QNRA 1R30A 4GVFA 3OZMA 2EJAA 4G7EA 1UKPA 5HANA 1TRDA 5KEZA 1TIWA 5MF5A 3ITGA 2GJXA 2VHLA 4JQ2A 3PULA 2CKSA 4AD0A 1W3NA 2FJKA 1K9DA 2WHMA 4GZIA 3VDGA 3T40A 4HNNA 2A85A 5C2CA 3IJLA 3L23A 2G95A 1G4TA 1Q5MA 4DJEC 3PG9A 5A6SA 4LS0A 2VZVA 2DW7A 1KTBA 1JYXA 3UG5A 2EXOA 2OVLA 1E0WA 4RK8A 5A6MA 2WVTA 3HGRA 1TPFA 3L2IA 2YSWA 1UPMB 3EPNA 4GO8A 4C1NA 1LWIA 2X1IA 2XH4A 2G96A 2VD8A 4AZCA 1YIXA 5C0QA 1HG3A 1K8YA 5FAGA 4N7QA 3RM4A 2FH6A 2V5JA 1EA9C 4IH3A 5K7JA 1VCFA 2E8YA 1C92A 1E6NA 1EFZA 4FSAA 6TAAA 4W9TA 2WNQA 3P6LA 1UZDA 4JKKA 2ON3A 1BQGA 3DFQA 1SZEA 4ICMA 1VENA 1GHSA 2B81A 3L67A 1P6WA 3W2NA 3IAPA 2OELA 4CNUA 1GW1A 2E1DA 4GFSA 1Q85A 3H12A 3N29A 3AQUA 3H55A 2Y7GA 5A3HA 1UKQA 4OV9A 3WEZA 3SRFA 3IRSA 1E15A 3Q45A 1SYTA 4PMZA 4B4HA 5LNUA 3ZSSA 3CZKA 5I7GA 1XIHA 2ZXBA 4H01A 2WSQA 3MDUA 4FF5A 2R14A 3HV9A 4DO5A 3KOYA 3RCNA 2E8ZA 5I23A 1MDLA 2F6KA 3WL0A 1Q6RA 2F2KA 2V2DA 4LTSA 5E93A 3IK4A 3GUWA 5BXTA 2ZZ4A 4Q7IA 2INEA 2XIOA 2BNJA 4KWOA 5EU9A 4ZQMA 3LXBA 4FXRA 3LX9A 1WZAA 2W27A 2X1SA 4NJIA 3PBYA 3VINA 3EA2A 1NU5A 2RJGA 1CWYA 3AJ7A 1FWSA 2HS8A 3NO3A 2F38A 1F3XA 1IQ8A 2OXNA 3L4UA 4PSPA 5EFFA 3NQEA 2QCHA 4CU7A 1XIGA 3LV5A 4TMBA 2AMXA 3UQNA 1RD5A 1RQEA 2AQOA 5AB3A 3HA1A 1XRSA 3AMCA 5BW6A 2D3LA 2H8XA 4D72A 2ZVIA 2VWSA 3BV4A 1CGUA 6XIMA 1JDFA 1OG6A 1S2WA 1OGGA 4O1DA 5LNWA 3GXMA 4F0MA 3TNOA 2DT2A 4UTMA 4D6FA 4R27A 4K37A 3CUHA 5FEPA 4WKAA 2XM1A 1YXDA 5FCZA 1HKVA 1AMYA 3EPMA 1MDRA 1GCYA 4PTVA 1O95A 2D2JA 2C7FA 3NUKA 4MF4A 2BXYA 4GUIA 2DSWA 4JXCA 3K4WA 2E9BA 1W3JA 1UD3A 3MHUA 1XSIA 1UG6A 3IJQA 1CCWB 3SCOA 2AAMA 5HBFA 1RP8A 4B15A 4EP8C 3W26A 3KVLA 3N3MA 4R7JA 1US3A 4W93A 1IWPA 5TQLA 4RE4A 5CPSA 5MHBA 1J0HA 3FS2A 1SR0A 3GNPA 3K2GA 5XINA 4GLEA 4L9XA 4OV4A 3LBCA 4H8HA 2WANA 3CQKA 3DUGA 4J2MA 4OKDA 5HNNA 1C9WA 4HNVA 1IEVA 5AVNA 4UTWA 4AY8A 2RDXA 4J3ZA 4Y9MA 4M82A 3GYEA 4H9ZA 1QPRA 1GG0A 4PCPA 3TJLA 1O6IA 3M7SA 3MKKA 4BK9A 4JTFA 1TPUA 2FGBA 3VD4A 2A3CA 2QV4A 2CWNA 1UWIA 1W8SA 2OJPA 2FMNA 3YPIA 2HVNA 1VPYA 4AU0A 5AZ1A 4GCXA 4I7UA 3LK6A 3T2PA 1LRTA 2OMAA 2BBFA 4UQEA 1SU5A 4UOZA 1DIKA 1FQ0A 4DBSA 2D0HA 4W7WA 3VU2A 3U48A 3MMDA 4F9DA 3NQDA 1RZMA 3F2CA 4FA3A 5C9WA 2GVJA 4IIGA 1LZOA 1A0EA 4H6EA 3NZQA 4ACZB 1CPUA 4UQ9A 2MANA 1DQWA 1UH4A 2YBTA 1WE5A 5E6ZA 1OZQA 1EHAA 1PHWA 3ZZ1A 1ODZA 1XD1A 3TYCA 2PDUA 4Y9OA 1DQUA 4W89A 3A4XA 3G22A 1V77A 1XDMA 3HJEA 4HN4A 3VNJA 2PDJA 2VCCA 3CWHA 2HE5A 3JZUA 5D04C 2NVCA 5A6LA 3F4NA 2ONEA 3RJYA 1EYWA 3PAOA 5CJMA 3L4TA 4QBXA 2G4JA 3SJNA 4PEKA 5KITA 4DJFD 3HQNA 2VR4A 2Y8VA 3TQKA 3W86A 4DRSA 4OIFA 4AQLA 2A3EA 3K1GA 1LBFA 2G3NA 2QCMA 2YCLA 3M4HA 4DJFA 4DWSA 4MNJA 1HP5A 3SY1A 3VKKA 4MPKA 4Y90A 5A8GA 4IIBA 3TLLA 3QGAC 3NO1A 1DL3A 1VJIA 2YYUA 3LA4A 1E1FA 4GQ0A 3ZOAA 3E96A 3A6OA 2YXGA 3SCVA 3MMTA 3RU8X 3SIZA 3D46A 4KIEA 3DCPA 3UU0A 1EEPA 1DYSA 2Z1BA 4AYGA 3G1DA 3JUGA 3W76A 2NQHA 3LM7A 2ZUSA 2A7RA 1RALA 3WCZA 3AMDA 4LY4A 4LBRA 1XLKA 4JYFA 3WH8A 3WYZA 1F6YA 1H61A 5FEZA 4Q4OA 1XLLA 3IACA 5A2AA 4QDMA 3WLIA 1V79A 1PIIA 4H4IA 3VNLA 4DELA 3PZTA 4WOZA 4A2RA 3QOMA 1Q7ZA 1T99A 3QRHA 4B16A 4LEFA 3CUJA 1YRRA 2A4AA 1JG9A 5I09A 2YOCA 3DGBA 5FF3A 4H1ZA 1PZ1A 3ZJ6A 4BCEA 1IT7A 2ABAA 3TW9A 1CNVA 2F84A 1KKRA 1XLDA 1IIHA 3VVGA 3CLMA 1IT0A 1EQCA 2QXWA 4B5XA 4JTQA 4ZODA 3GWQA 3ARRA 1J0YA 3P81A 5DCEA 2FZDA 2ZA2A 2I56A 3PF3A 3URQA 5A6AA 3A47A 4G56A 3RITA 2XVKA 3DI0A 1NWRA 1Z9AA 1O60A 1Y8BA 4O1EA 1CEOA 3FCPA 3K13A 2E5DA 2KZHA 3P7YA 4GGBA 3I3EA 5JBDA 3PZQA 3BAXA 3KRBA 1UOKA 4O0QA 1KTNA 3AFBA 4JCLA 4QROA 5I24A 1LLWA 4A8IA 2Q02A 4RW5A 4CCEA 5CZSA 2QPXA 3MKVA 3XINA 4XB3A 1TV5A 3EXSA 3S2NA 3ARQA 3GFZA 3V5FA 3DYOA 3UR5A 3EOUA 1WDQA 3LYEA 3OODA 2WZMA 1FVPA 1TMLA 2GQ3A 2JKEA 1BG4A 1OK4A 3QTGA 4FX6M 2DP3A 1M5WA 2Y24A 4FNRA 3H6OA 3NYZA 1B3XA 3ALFA 3TTQA 3HPXA 3VX0A 1JZ4A 1G0CA 4HOWA 2VI0A 2ZZ1A 4Q4MA 3SY8A 3B8TA 2QMKA 3VDCA 4TR9A 2DUAA 1J79A 1RR2A 1T6MA 1EJTC 1EJRC 1QR7A 2XFYA 4I90A 4JKLA 4Z1CA 1GVIA 1LWHA 3VFLA 4TTGA 3FA3A 3EYPA 1K4GA 5EMYA 2YZRA 1VBHA 4KEZA 3ARWA 3MZ2A 5EFDA 4GI9A 2OU4A 2GJPA 3F4WA 3OGVA 4JTAA 3AU2A 4M7SA 1J93A 3QSRA 3C0QA 2VRKA 5A2CA 3AYSA 2XWDA 4EACA 2HROA 1EBGA 2XGIA 2J78A 3VNDA 1CXFA 4HP5A 1TPH1 2FVMA 4UTTA 1YYAA 5EBUA 3KX6A 1X39A 4GZJA 3V5OA 5E1QA 1OK6A 3GXDA 3T08A 3S5SA 5AKQA 3F4CA 1MZRA 1EUAA 7XIMA 1YPXA 2FLIA 3WQCA 3VKAA 2V69A 5D9NA 4S1FA 3ABZA 5C6MA 2NZLA 2I9EA 5FEXA 4ZB5A 3CNYA 1VFOA 3RX3A 5CQ1A 4EXQA 4XTDA 2CLIA 4HK6A 1Q2SA 1E0XA 2FQIA 2NT1A 2HBVA 5G4WA 1QDSA 4A8LA 1H62A 1XWYA 2OYMA 3GM8A 5CZTA 4EAYA 9XIMA 4PTNA 3FKKA 2XVNA 4DF0A 3RIKA 4JTRA 4AD2A 3WUGA 1KV8A 3ECQA 1E6QM 1M41A 4ERGA 3TVAA 4S3FA 4S3KA 5JBEA 1X38A 1XIFA 1KFJA 4LCQA 4QXIA 3W2MA 1XL9A 5JH1A 3U2CA 1IZCA 4KCUA 3UGVA 2W92A 3DFYA 2ZADA 1JCMP 3FDKA 3FX4A 4JDYA 4CNTA 3WEMA 3MANA 4IP7A 1B3WA 2FDMA 3E0WA 1E6RA 2WWDA 2IQDA 4OVXA 4UTUA 3MB9A 4TX6A 2QCLA 3E5PA 1M7JA 4IQDA 4HU4A 1HVQA 1KGUA 8XIAA 1WV2A 3TAKA 1E0TA 2CLMA 2W63A 2WNZA 3T8LA 2PDIA 3QW4B 5DANA 4W4QA 2QDEA 1XIBA 4CN1A 4JNYA 2WKLA 3T4CA 4E2BA 3F2BA 4CD8A 2WOQA 3LHUA 2B0MA 3WDJA 3FY1A 3VUPA 4Z2JA 5I3KA 3AS3A 4AWSA 4UXDA 3KUMA 4Q6JA 2PDKA 4LVGA 1AL7A 4B91A 4X2PA 1VIWA 1LF1A 3SFWA 5CSSA 2XJ7A 3WMCA 4EPKA 3WFZA 4Z17A 3I7SA 3OBKA 4B5VA 4MWAA 3QTPA 1O5KA 4ERIA 4QCEA 2YW4A 1GVEA 1VB9A 1QW7A 4TU1A 1XIDA 4JN6A 4K39A 4XSMA 3TZNA 2A3LA 2VEKA 2E9LA 1UR4A 3P82A 3W24A 3VD9A 4HPNA 1LBLA 1PCWA 1JNEA 5LXEA 1RJPA 4WHBA 4ZCWA 2ZVRA 1XCWA 4DEFA 3EKZA 1NWUA 1ENUA 3AXXA 4DF1A 3BMXA 3T8QA 3WLOA 3LZ5A 3WLNA 3TCSA 2V63A 1JJKA 3AYRA 4CN6A 3FYPA 4INFA 2XISA 1ALDA 5D2YA 3COTA 3LG3A 5D37A 4GXPA 3GVWA 3V0TA 3BZJA 1BXNA 5HWMA 4PODA 1V3MA 1PYMA 3BAIA 1A4MA 2BFGA 4C6QA 3L66A 3GHUA 5A6KA 1WAUA 1R6WA 4BKNA 1TWIA 1P0EA 1SFJA 2E1WA 1GKPA 4AD5A 3AYTA 4GMEA 7TIMA 4TV6A 3AXHA 5LGXA 1DJIA 1B2YA 4FB7A 3K1DA 3B9AA 7ENLA 3OVQA 2RDWA 4M7TA 4A3HA 4X61A 2F8QA 4UQBA 2CC0A 5I03A 3T55A 2OOGA 1HQTA 3EOLA 4C7DA 1W9XA 2HDJA 1BKSA 1GQLA 1DJYA 4LUYA 1E4IA 4PTDA 4XTIA 4H6QA 1HKJA 3OOQA 3GG8A 2H3DA 3QV7A 4S3GA 2A3HA 5AHEA 5EMUA 2ABBA 3WQ8A 4FAMA 1ZP3A 1P7TA 3E0VA 1QNOA 3H7RA 3BANA 3WF3A 1S2AA 2PD9A 3N13A 3E49A 3ITOA 1NSJA 1WKFA 3TWBA 1PZ2A 2A7NA 2I5QA 3L7RA 3BLEA 3G1FA 3XISA 5DXXA 3MUXA 1RCOB 1UZ4A 4IIFA 4BR1A 4O16A 1GJUA 1FDJA 1XGZA 1AW2A 3V75A 3IEBA 4ALDA 4OT7A 3WLMA 1XPGA 3UPMA 4HMNA 1R2TA 4UFJA 1B57A 2OLHA 1NWTA 1D8WA 4KWVA 4C60A 3QKZA 3OG3A 4UTKA 1PB0A 4GX8A 4ZVJA 4X60A 4IQJA 2GYIA 3PC0A 2A0NA 2VP8A 1VS1A 4JL2A 4ZQRA 4WD0A 3KWSA 4F3HA 2ZUTA 3L0KA 3NZRA 3VE9A 3UYIA 4G1KA 3PTKA 7CGTA 2ZE3A 3S2JA 1HF6A 4NI8A 4QJ3B 1O1HA 4H41A 1XG3A 3S47A 1GVRA 4E8GA 4EPEC 3KOZA 1LDCA 2PTZA 3B0UX 1YTEA 2PF8A 4LVAA 1SZFA 3S9IA 3GTIA 2OX1A 1EP2A 1PZ0A 1KXQA 1NOUA 1TELA 4S3AA 1XISA 1AH0A 4CD4A 4W87A 3QV6A 4B3KA 4HGXA 1EWDA 1PS9A 4Y9NA 3KRZA 4EKJA 1S5WA 4ENLA 4XISA 4XZWA 5C54A 1AQHA 2RGLA 2WNNA 2YCEA 4GH1A 2P53A 4LY8A 4XKYB 3GG1A 3T6CA 4DYJA 1ZBKA 2A1YA 4QTGA 3BVJA 1JI1A 2OYKA 4GWEA 2W4XA 4I9MA 1UZHA 4DJEA 2VFIA 4GK8A 5CPOA 4AVFA 4UFMA 4H9YA 3D6NA 3HOJA 1UBPC 2CEQA 3ZJ8A 4MGGA 3BGGA 4FP1A 1TJ2A 2X1TA 2W9MA 4F2TA 3VFCA 1R2SA 1SJBA 3T09A 4QDWA 1M3UA 1VD6A 4CN4A 3TR2A 2ALRA 3PNZA 5TF0A 3WY1A 4QE1A 3VIHA 3G2GA 4KFNA 4D6CA 1XH2A 4M56A 1NP0A 2V2CA 3ES8A 2C1GA 2WPBA 1AL8A 1U33A 4B3LA 3RM8A 1TE1A 4MZYA 3L4VA 2DDXA 3CYVA 3IUDA 1E71M 4OHQA 4JCMA 1A0CA 4US6A 3D0CA 1AVAA 2B7PA 2O9TA 3TXZA 1C9DA 4B5SA 4LBUA 2Z24A 1ZENA 4RDVA 2BASA 2VTFA 4CEXC 3W7DA 2PCQA 4QNEA 3BC9A 3P14A 1E0UA 1I1XA 2FGLA 4NZ5A 3GYCA 4K38A 1L6GA 4ICCX 5C5YA 2BY3A 2IKIA 4RV8A 3WJSA 1YDNA 2QAPA 1DJNA 1ONEA 2IPJA 3GH4A 1VPXA 2RHGA 2VO5A 2HCVA 3A4AA 3TN3A 4ZE4A 2CXGA 2ZRUA 3Q2DA 2DZXA 4JFUA 1NARA 4AWUA 5GJPA 2FFCA 3QBUA 4XD3A 5KZDA 4MG4A 4LBSA 5AY7A 4LNCA 2QGYA 4N0RA 4HZ6A 2JF7A 2WCGA 3APYA 1BHGA 1IGSA 2JALA 4JTJA 1A50A 1DXIA 2NQJA 2DZUA 2WMFA 5G2HA 5CJNA 3TKFA 3EWYA 2Y89A 4RPQA 3S6OA 1WCGA 2QV5A 1H41A 2IS7A 1NVMA 4IFKA 3TMQA 2ZRWA 2FTPA 3BARA 5CBIA 3S5ZA 4PB5A 1KXTA 1Y5XA 2DZVA 1AH4A 1HXJA 1CGVA 3SGZA 1K02A 1QTWA 2CIPA 4FEZA 3RK8A 2Y7FA 3L2LA 4KRZA 3ELFA 1IXQA 4L65A 4N9DA 3MUY1 1E55A 2PF0A 3URBA 1JAKA 1GHRA 3GC4A 2AQWA 3UJ2A 3WUFA 4O1CA 4QJ4B 3IPWA 3N9RA 1W1B1 1CX9A 3PANA 3RPTA 3VKDA 1REQA 4URIA 2PU1A 1S46A 3HF3A 3S1GA 3O07A 4M8UA 1AUSL 3VABA 3CO8A 1EJUC 2RFGA 3RR1A 1K1DA 4O54A 4LXFA 1E43A 1EL3A 6REQB 3APTA 3MSGA 3VIJA 5L6UA 3HBLA 2OZ0A 4C5YA 4LUTB 3W83A 4YU1A 1DJWA 4L1WA 1POJA 2D24A 2V5CA 3G1SA 3ES7A 1F07A 3AIVA 2GVEA 3T9PA 2Y1HA 2DH3A 1CLVA 5HMEA 1EHNA 2ZTJA 1XP3A 2GWGA 2VX4A 1GOWA 3I7RA 2DZPA 4KEMA 2RUSA 1HKKA 4HHPA 3GDBA 2TMDA 4NSBA 2E40A 1YQ2A 1P43A 2Q3RA 4PTWA 4Z1AA 2JK2A 4XAFA 4NXKA 2WVVB 3BW4A 1UCWA 3SGUA 4Q7NA 3KP0A 1E9ZB 5HJLA 3U2ZA 3GXIA 5FF4A 4Q4KA 1XIJA 5F2GA 3QVQA 2VXNA 1EGZA 4E8CA 3DESA 4KERA 2YKKA 3WSUA 1MW3A 4C6PA 4G1NA 4ORMA 3EEZA 5CAKA 3BO9A 5GPRA 2BTMA 4O18A 2DU2A 1JDCA 1CDGA 5I6SA 4ZQNA 1Q65A 1KB3A 1KC7A 1VPQA 3A12A 3V7PA 3NPVA 3UYCA 1NF0A 3UZXA 3NQMA 1NOWA 3W7LA 3OG2A 2A6LA 1Z48A 2QHAA 3H2CA 2QPSA 3HQ1A 3QC3A 4V28A 1XW8A 2XIJA 3GVQA 3HU7A 2Q6ZA 3EMCA 3TOPA 1SFTA 2C18A 3CEPA 3CTLA 1BVZA 3IVTA 2ODOA 2UV8G 3LV6A 4O14A 1EJSC 1TCDA 1A4LA 4MOZA 3S1WA 1P1XA 4IFRA 1EGVA 4PRRA 2V81A 2BVYA 1E6XM 3ZR6A 1LL4A 2VFEA 3BTNA 1K77A 4RL3A 2PP3A 2X09A 1H63A 1RY8A 1OFEA 3A4JA 4HZMA 1TJPA 1G69A 3O15A 3TTEA 2INZA 4BEQA 4TV5A 4B4FA 1DE5A 1PWLA 4I6VA 1XYBA 4LB4A 5C7VA 3SO7A 4YVVA 1ZBVA 3TW7A 3QR3A 3T1GA 3AOFA 1RV8A 2ZX5A 3FSTA 4AZHA 2DJXA 1FWIC 4GJ1A 4WXZA 5F4WA 4P8VA 4J3TA 1DQXA 2AGTA 2ZRVA 3KZSA 4OZOA 3PSVA 1J0ZA 1DIOA 1KM2A 4JFWA 4N6EA 4FLQA 5CH9A 1XYMA 3CL7A 1Q8JA 2XIIA 3KL3A 1V08A 2BZNA 2X41A 4JFTA 1JYVA 2C6QA 3IIPA 3BK0A 2J9ZA 3SN4A 1DOSA 5A8NA 1SZRA 4AZ6A 3NWRA 2Z1WA 3W3OA 1OFBA 4ZXLA 3UESA 1Z3NA 1JR1A 4FO4A 2WNWA 3OLIA 5GJMA 3SURA 5AC7A 1C8QA 3KVJA 3RO6A 2H9AA 1NDYA 5HNRA 5D2XA 3DH7A 2WW5A 4LSBA 4J1OA 2EPKX 2E6YA 4KFOA 1QWKA 2ZDSA 1LOSA 3W4RA 4F0RA 3HQPA 3H26A 2VR5A 2BVDA 1M53A 2VFDA 2ZBTA 2ZC8A 4UFHA 4F8XA 3C8NA 4CVWA 3C86A 2BY0A 1JI2A 2VQTA 3S1XA 2GSJA 3N9SA 1B4EA 4IJCA 1NFPA 3DDMA 2J9XA 3C0SA 2XSXA 2X0SA 4U33A 3LHYA 4RDYA 1HL8A 4Q8QA 1FFRA 2F9RA 1EIXA 1NH6A 3II1A 3IJ6A 1Q45A 3CJPA 1VFTA 4S3DA 1BTCA 4MZ8A 1UP2A 1BSIA 4RZ4A 3WBYA 3NIYA 4IIEA 5AHNA 2J8FA 2O56A 3G0XA 5HMSA 4DN1A 3EZ4A 3DYMA 4W86A 4OUEA 1QK2A 4N4QA 2WQPA 3PBGA 3TDFA 1AQFA 3W6MA 4L61A 4UR8A 4JTEA 5T8GA 3CMGA 4U3AA 3S9ZA 1GKQA 2CNCA 3PFMA 5DY2A 1VRDA 4HCDA 1Q4NX 2XSBA 4UC5A 4PUEA 4Y9AA 4UFKA 1V3HA 2QCNA 4MY1A 1FHUA 1FP8A 4TMCA 3U8GA 4BF5A 3KWXA 1EPVA 3MZNA 4HCLA 3VI2A 1HO1A 2FTWA 1X7FA 3G0UA 3NJ3A 3W9ZA 4WR3A 7PTDA 3R7MA 5D9OA 3M43A 1TE6A 2GQAA 4B90A 2AOSA 1PYFA 3L68A 1J5SA 2XIMA 1DWGM 3QR0A 5EMJA 1GTHA 1R3RA 3VNZA 3L4YA 4NQ1A 4O0ZA 5BU9A 1GYNA 4PBEA 4C7FA 1QPOA 2R1KA 1PXGA 1WX0A 3HMCA 3WENA 1RVGA 4WY0B 5B7YA 3M0JA 5FJIA 2BVTA 3BXWA 5JMUA 1B3VA 4MY9A 1RLDA 1R7AA 2EPNA 3MQTA 4LF1A 4G7EB 2CBVA 1A3WA 4GE8A 3W81A 2GJXB 3NQVA 3TZFA 1G01A 2YDAA 2RAGA 4JNZA 3EAUA 4QJ5B 3CHEA 2PGEA 3VDBA 5C55A 2DUZA 1Y5WA 4JTGA 4IHCA 4XZLX 3TNBA 2POZA 2VWTA 3VIMA 3SAZA 5HMDA 5IRPA 1FH7A 3QMSA 4MFDA 2CZFA 3M46A 1ZPTA 1PKMA 3OGRA 3B04A 3T42A 2Z00A 5EPDA 1KCXA 4V2XA 1H09A 3UNTA 2HK0A 3O0KA 3TC7A 1R9YA 4C1NB 5ABEA 3TEVA 1X96A 3PP7A 5FOOA 3SCUA 5B7ZA 3VDHA 1IYXA 4QGCA 5D09A 3M0MA 1I2RA 1J6OA 4UFIA 4AZCB 3WLHA 5EA9A 3WQ5A 1VCVA 1P0NA 2A5HA 2Z1VA 2HZGA 5E9XA 4HOXA 4K1WA 4J5NA 4OUIA 3VGDA 2YL6A 4ILSA 5AYXA 1E40A 4DJDC 2YXOA 1DWIM 4WSKA 1QCWA 3KRSA 1AZ2A 1YX1A 3W23A 1ITUA 1BQCA 1TV4A 1OABA 3BCFA 1JCNA 2IMRA 1HIZA 2EQDA 3Q4DA 2VZOA 3QFWA 2HPIA 4HA0A 2AKZA 5AC5A 1F3WA 5EBAA 2XTKA 4JEJA 4BF7A 1J01A 1U2YA 3CTTA 3P0WA 4R7WA 3M5XA 1EP1A 2ZDRA 3ZLFA 5FJJA 2OEKA 3ARSA 3GDRA 1QNVA 3H24A 2Z6JA 1TTJA 3W7HA 4O8RA 3RLGA 1OVDA 3KHJA 4Q6XA 4WDUA 3AHYA 2QZRA 3DHFA 1ME7A 3N4FA 4H8NA 2Y6ZA 5DMYA 4H2CA 3VK5A 3LPOA 4YYCA 3R0KA 3PBUA 4C6NA 3CPRA 5M1TA 3H2EA 4QR6A 3UG4A 4POCA 3MP3A 3NQGA 2W62A 1XLAA 5EB8A 4KWUA 1DHPA 3R25A 3GXNA 3BMVA 4DIAA 1TRIA 2VGGA 1ZL1A 4QFUA 4B2DA 4LUIA 2X7WA 4B9YA 4C65A 3UCQA 2EPHA 3W7MA 3LLFA 2EHHA 5G1MA 2PE4A 1TMHA 3EX6A 3QPEA 5D30A 4LYRA 3WBAA 1A5OC 2P88A 3WH6A 4HU0A 5LYRA 1XR2A 2DVXA 1Q6GA 1WQ5A 2YR1A 4GJJA 2ZYFA 5D03A 1B1YA 2O4MA 3INPA 1EDTA 3E5BA 4WQ6A 1NEYA 1GOIA 4MKNA 2ACUA 4MY8A 2BXZA 4L1GA 1JULA 3B97A 3PN8A 1SO4A 2NV1A 2PDHA 3MCMA 2DFAA 1GWJA 1JPMA 4NILA 3STEA 1UBSA 3BSHA 4F40A 2J7CA 3DFNA 3ZJKA 2I5GA 5HOSA 4WUIA 3WLPA 1C91A 1CENA 3GAYA 1OYBA 4IF2A 1TR9A 5FESA 2QCFA 3O6DA 3EGJA 2R8WA 3UVAA 5C9UA 1TR1A 1IEXA 2GGEA 2V5LA 3M0HA 1OGSA 3DKLA 3R94A 5BYWA 1T8QA 1SO6A 2CHOA 1W31A 2E5CA 4K7VA 3GH5A 2OTDA 3VMPA 3SN1A 4LGXA 1GZJA 3OZOA 4E8DA 3I6EA 5BWAA 4GZ7A 3G1AA 4HPHA 2CESA 4ZENA 3W7RA 1JEZA 2OSYA 3DX5A 4A8NA 3QGVA 4PSRA 4IMEA 1FA2A 2Z27A 4HZ7A 2D0FA 1R9XA 1VH7A 4WOQA 4KETA 2GUYA 4ZOBA 3SJ3A 2YZ5A 2Q8XA 3EWCA 4I5UA 2PODA 3VM7A 3K46A 1IEWA 1F4AA 1JZ6A 1MQPA 3KTXA 3STPA 3CUFA 2V3FA 2Y5EA 3TFXA 2QUVA 5TIMA 3GXPA 1BSLA 2XM2A 4W8LA 5BOFA 1R3TA 5JXQA 1EEXA 5C9XA 4NZJA 5LKYA 5H8UA 3P5ZA 4E3TA 3E38A 1D3CA 5EKYA 4JFVA 1EO5A 2EPLX 5FD0A 1I0BA 1OFDA 2WVSA 4JY8A 2J62A 1JPKA 3EX3A 4D1IA 1C3FA 1XLMA 3SGGA 1ICPA 1QI0A 2YCIX 1W1VA 2V82A 4WK9A 3B03A 2X0YA 4RNJA 1WO2A 3D5HA 1VJSA 1BGGA 2EJ1A 4DYEA 3C2OA 4IPIA 3UA4A 5G1TA 5F7UA 2CXEA 4AZ5A 2Q09A 1XRVA 1JFXA 2GGIA 2ZXDA 4GXWA 4JKMA 2QIIA 4HPJA 1E0VA 2O4QA 1KR1A 4YVXA 3FOKA 3IV8A 2OQYA 4L4PA 1UC5A 2DZSA 1B3YA 4GYJA 3LRMA 2I7GA 4D1JA 1XS2A 3DFHA 2Z29A 2IXUA 3MVIA 3DG7A 1Q3NA 5M5DA 2V38A 4UTJA 2GL5A 3M44A 1DJHA 3CU2A 2D0GA 4HTYA 1KD0A 3WLTA 3UWZA 2NQLA 3CAKA 1A5CA 4PUMA 3LQGA 4OTKA 4DI8A 3BH4A 4ADTA 2YCLB 1VLWA 4RJEA 4A3QA 1BYBA 3FVMA 4P7QA 4DWSB 4KRTA 1LOQA 4L64A 2VC5A 4O1FA 2A3AA 3IJ7A 1ZCCA 5ECUA 2WVUA 2E7FA 3O2LA 1PWMA 3UJRA 3OBEA 3VD5A 4DXVA 1ITXA 4DBUA 6ENLA 3QKEA 4HU8A 3BW3A 4RZBA 1FWBC 3TQVA 5I78A 5IFTA 4LOCA 3QQ0A 3E0FA 1M9HA 5D9PA 4PEEA 2V2HA 3LSCA 3S5YA 4P7NA 5HXMA 3E0LA 4DWSC 3W1LA 2NLYA 1SVDA 2OO6A 3AIQA 1MFUA 1RCQA 3PJWA 4PMXA 1U5HA 1UD2A 1VP5A 1MRQA 3FYOA 3U2EA 4HIBA 5BRPA 1YNPA 1MZHA 4ZQPA 4EF9A 5I3DA 3WD0A 4GO9A 4NNCA 3BLPX 1MXSA 1X6LA 4X3ZA 3WQOA 3IS4A 2RGMA 1YXCA 2WHKA 2ZZ5A 3N15A 3SUSA 3T0DA 5BWFA 3THDA 3GH7A 6PTDA 2NSXA 3BSGA 4B9ZA 1S1RA 1ITQA 3H4XA 4DBDA 2ZX8A 4XSLA 3AIBA 3BJTA 2CU0A 1TPDA 1HO4A 4PB3A 2PP0A 2VFGA 4BQ5A 3TU9A 3PZMA 2PTXA 4X0VA 3VNIA 3MBDA 3TYBA 4S2CA 3N6JA 4ML9A 3B0VC 2VUNA 4MNMA 8CGTA 4UZSA 3JZEA 1XIEA 2C91A 1RY0A 3N2TA 3K8MA 4A3RA 3KE0A 2YW3A 3DHDA 3ZWTA 4NAEA 4RNFA 1S5MA 2WCAA 3OP2A 2QULA 2VGIA 4IXHA 3BCJA 4U10A 3UZ5A 3RPDA 2XN2A 1G67A 1PSCA 1V0KA 1UR8A 3P61A 3UJEA 2YA0A 1DWHM 3LUTA 1TB3A 2XINA 1EC7A 5M2FX 4CCCA 3OVGA 2Y7EA 2PBGA 3N19B 3WNKA 4PUKA 1Q6QA 5IDZA 4Y8EA 4A21A 3WQ6A 2WXDM 1Q13A 3MUZ1 1WBHA 1GVOA 2BVWA 1K6WA 1Q66A 5D2WA 3VNKA 3ZO9A 4XZNX 3ARYA 4YN5A 2W66A 2HXTA 2CHNA 2L5HA 3K4AA 4LFYA 1D9EA 3GKFA 3I3DA 3T0BA 2QJMA 4WDTA 1OSEA 1QI2A 4QS5A 3VC6A 2OFJA 1MWOA 3TIMA 2Z1KA 3G3MA 1H1YA 3KBVA 2C16A 1PCKA 1Z44A 4AZ7A 3ENLA 5C71A 3E74A 1WKDA 4DBEA 1I2OA 3CT7A 4D8LA 5CSRA 3HGOA 1H3GA 3BMWA 4O4WA 5AYYA 1XYLA 3AI0A 2VGFA 3DU0A 3F4VA 2G41A 3B4UA 1UROA 1UUQA 1SJAA 3W1MA 2O0TA 4F79A 1H7NA 2PRHA 2DSKA 4D8ZA 2WWCA 4W84A 4WJ8A 4LRTA 3V18A 1K7EA 3W88A 5C9RA 4O11A 2XG9A 3FK4A 1UQYA 1EYEA 4GOAA 3ZMRA 2E3ZA 1Z32X 4NASA 2CZEA 9XIAA 3SR7A 1B54A 1VEMA 3CXOA 3MO7A 2GVYA 4HMCA 2ANUA 5DXYA 4QNWA 1HJXA 3GIYA 2GOUA 1UWUA 1KBKA 2JKPA 3U4FA 1VJZA 1JF6A 2FVKA 3CO4A 4AZGA 1J12A 2J8TA 3FA5A 1YNQA 1EX5A 3I4EA 1DE6A 4E2OA 3FV9A 4A22A 3VIPA 5HK4A 1EJXC 2O7QA 1J9YA 2DH2A 4XAZA 5EGRA 1W2VA 3OYXA 1ZSXA 4R85A 4PMYA 5A8OA 1R0MA 4D2JA 3R5EA 2WSKA 5J8LA 2E9MA 4D6DA 1TKKA 1QRQA 3KBSA 4NAFA 4Q7BA 2ZUVA 3TMLA 1N8IA 4C6IA 1SQ7A 1XLFA 1WDWA 4QEEA 1E5NA 3I65A 1B9BA 4DUWA 2Q8LA 3PTQA 2AQVA 3CBWA 2QS8A 3WQGA 6REQA 2X8RA 1L8PA 1W5QA 1F05A 3PZGA 4LAUA 3H21A 1AQMA 2OZTA 4R34A 4ZSTA 3H4GA 3IGSA 3B9OA 4NJHA 2XVPA 2WHJA 3MHGA 2ZXAA 3MS8A 2UWFA 5FJTA 4WRHA 1WPCA 3L2MA 1ZGDA 4HK7A 3NEHA 3SZ8A 3NG3A 3PNUA 3STFA 1WOBA 1ADSA 1XSKA 1XBZA 3EDKA 1R9ZA 2C8NA 4JQ4A 1TZ7A 1F8MA 4FMVA 3K8LA 2WVVA 1ONRA 4ZB0A 3CHCA 4GCAA 5AFDA 1FH8A 3S5NA 3ARTA 1XV8A 3ABRA 1OX4A 1W17A 1SSGA 5CEWA 1XDLA 2NWSA 3O7UA 3W75A 4O4VA 1QNPA 2QVHA 4L9ZA 1YTDA 3LGDA 1K8ZA 2GVGA 4AWEA 4X9SA 4IMDA 3GXFA 2FZ8A 3DC8A 1VFSA 4IP5A 3H54A 1EDQA 3IVSA 3W00A 3WNOA 1YBQA 4KMQA 2JBMA 1UH2A 2J7GA 3QF0A 1U5VA 1XLCA 2BY2A 3WFAA 1YMYA 1GVFA 3QQ1A 4J40A 5A6BD 1G7UA 2EGZA 4PH6A 2W79A 1T7LA 4MWAB 2YL9A 1TREA 3KVKA 5A6BA 4NJJA 4JDBA 4EXAA 2V8ZA 4Q4QA 4XIMA 3G8EA 1B90A 5K2ZA 4HNOA 5CG0A 2X0HA 1RHCA 3W84A 3LMYA 3NOYA 1DPMA 2OCZA 4AHPA 1Q6CA 1OCNA 5HQMA 1GOKA 2IKGA 4IG2A 4EPDC 3KCOA 3DZ1A 4PMQA 2YCJA 1VYPX 3AMKA 1LLZA 2R1MA 1WDSA 1OX5A 4A3YA 2OOFA 3M41A 4FNUA 2XZ7A 4D9PA 3UERA 5DN1A 3FHQA 4KESA 4GZEA 1XLIA 3OPSA 3GTFA 1IZJA 3R0DA 1UP0A 3AZSA 1S2VA 3M64A 4J3XA 4Q32A 4MWAC 3IWPA 2XDFA 1FWHC 4KFPA 3VOFA 3SDOA 4U4MA 4RDZA 3F03K 3AC0A 5HDRA 4F48A 3OW1A 4XD5A 1LRQA 3SCSA 4GUGA 1DVJA 5AC6A 2X42A 5MKGA 3E9AA 3VOCA 2JE8A 3W27A 4Y6GA 2FHCA 3MSDA 3QY6A 3ABSA 2D69A 4LVBA 4OECA 3WDPP 4IP4A 5AHIA 4GUHA 3HGSA 4FOKA 3RJXA 1XYCA 1Y7VA 3C5QA 1EBHA 3CV7A 1CI1A 3ATYA 4YPJA 2CERA 1XYAA 3GNNA 2WMIA 3T78A 3OO2A 2X30A 3PUOA 3UXLA 2WMJA 1Q6LA 3GFXA 3U4AA 2Y5SA 4KEUA 4D6HA 1XYZA 1E4NA 3MBFA 4JR5A 2EEXA 4QLKA 1OFQA 5CPMA 4C6JA 1L8NA 4P8UA 4GNVA 3TSDA 1P7TB 1G94A 2ZQ0A 4PZVA 1MEHA 3W7NA 4UTIA 4A35A 1HX0A 4J35A 3Q94A 4AY1A 3N2BA 3TE9A 2VC6A 4GKLA 3VD7A 1ZHAA 5FJOA 4BZYA 4TIMA 4EPBC 5CPQA 1PJ9A 1ISWA 1E1CA 3NFUA 1UUOA 2Y0FA 4JN7A 4JTIA 3PZVA 1TPC1 1ZB5A 3EA1A 1OZMA 4MKSA 3M7WA 3TW6A 4MHBA 1XD0A 3HZ3A 4X2RA 5HATA 5CZ0A 1PX8A 3TR9A 4JQ1A 1UZ1A 1HN1A 2Y85A 4UFLA 4AH7A 3P80A 2ZA1A 1NM9A 2P50A 1BRLA 3RLUA 4CU8A 4HNTA 3A9IA 3TSMA 2YB1A 1UMYA 4KW2A 1GORA 4REQA 2YJQA 5AZ0A 2GK1B 4O10A 5CJ5A 2YDQA 4C91A 3RLHA 2VR2A 1A5AA 5A8PA 1XKYA 3AIWA 2BDQA 2VEMA 3LTPA 1D2KA 1OGBA 3M07A 1BD0A 2I16A 1C7SA 4MADA 4IX0A 3MPGA 4BQ3A 3CZGA 3DFPA 2DJLA 2XSAA 4JHMA 2O7SA 1HJWA 1AD4A 4FLSA 3A24A 1A5MC 1NFBA 2PB1A 1EB3A 5FJUA 4PFMA 3V1HA 3FJNA 1GZ1A 1H7OA 4NZ1A 1M68A 5TNVA 4G8TA 1GTEA 2R82A 4Y9PA 3LNPA 1UASA 3B8SA 1KCZA 5DY3A 4YTRA 1FWAC 3B0XA 3LY0A 2V68A 3CUXA 2HSAA 5BOEA 3QEZA 1C90A 3W7KA 3ZT6A 3QZEA 2X40A 2GJLA 3TTOA 4IPNB 2DIKA 3C56A 4DLMA 5C2XA 3BJFA 1FWDC 3HG4A 2ISDA 3EWWA 3KBMA 1GQIA 1FWCC 2OGJA 2X2YA 4QISA 4AB4A 5IM51 4QE5A 3PFRA 3L4ZA 1Y0EA 2A6NA 2OLSA 3W74A 1PKLA 1SGJA 1ECEA 3DN5A 4YTTA 1RLCL 4PUJA 3SW6A 3CYJA 4D6JA 2G50A 2WLYA 4QQ3A 4FLRA 2DEPA 1ZFJA 3W1QA 5LIYX 3HJZA 5E6YA 1WZKA 1V7AA 4IPJA 4OE7A 3USBA 1IEIA 5GVJA 3OIHA 5FA5A 1C8VA 3LN3A 3ATZA 1TJ0A 1VKFA 3WD3A 2WC7A 4DJDA 3GSMA 2UY2A 3GW0A 4Q8VA 2BOEX 4IGHA 2EG7A 3PAJA 4E4PA 3VKJA 3EMZA 5B80A 1TJRA 1UR9A 3RM9A 3SUVA 1R3WA 1JGMA 3FXGA 1UR0A 2BLEA 4GY1A 1XIIA 3UCCA 4GIYA 1MNZA 4PMRA 2CZ5A 3I4KA 2PSNA 4CQAA 1H0IA 1W37A 2R94A 3N18A 2EO7A 2IPWA 3TFCA 4XD6A 5FI8A 4QSHA 1E5JA 3CAWA 1I4NA 3SUUA 4BEUA 1H4PA 1VYSX 4GABA