4LSBA

Crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
277
structure length
277
Chain Sequence
DLQARHAEAFRALHTRPGAFIIPNPWDAGTARLLAMAGFEALATTSAGYAFSKGQPDNAIDRDAMLDHIADLVAAGGLPVSADLENGFGDAPGTVAETIRLAAEAGAVGGSIEDATGRADTPIYARDASVERIAAAVDAARALPFPFTLTARCENYLHGRRDLDDTIARLVAYRDAGADVLYAPGITDADEIAAVTRAVGAPVNVVMGLQGGLLSLDELAALGVKRVSVGGALARAALGAFLRAATEMRRDGTFTFTQAAVPGRDINRWFAAPDNSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative lyase/mutase from Burkholderia cenocepacia J2315
rcsb
source organism Burkholderia cenocepacia
molecule tags Lyase
molecule keywords lyase/mutase
total genus 107
structure length 277
sequence length 277
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 4lsbA01
3QV6A 1XG4A 3OQ8A 4TV6A 1PYMA 3QV8A 3HQOA 1O68A 1VBHA 3VAVA 3SRFA 3KHDA 2DIKA 2XZ9A 3KTXA 4IMAA 1A49A 1A3XA 3B8IA 2XZ7A 4B5WA 4G1NA 3QV7A 4QG6A 2BG5A 3E0WA 3SRDA 4B5XA 2HROA 2HRWA 1F3WA 4KRZA 4QGCA 3EOEA 1DXEA 2OLSA 2L5HA 3LG3A 1F61A 2ZE3A 3SRHA 2VWTA 1UJQA 3U2ZA 1OQFA 1S2TA 1ZLPA 1F8IA 3H6OA 4B5SA 1DQUA 4KCTA 4L9YA 1S2WA 1IGWA 3GR4A 3QTGA 4IP7A 2G50A 1M1BA 4L7ZA 4L80A 1OY0A 3BJFA 1M3UA 1O5QA 5JVLA 1S2VA 3OYZA 3EZ4A 4LSBA 2WQDA 1O66A 1PKNA 1PKYA 1U5VA 2V5KA 3LYEA 1AQFA 1KBLA 1S2UA 1A3WA 3QV9A 4KCWA 3G2GA 3N25A 4MG4A 3GQYA 1JDEA 1ZJHA 4YJ5A 3T07A 3EOOA 1VBGA 3P0XA 1Z6KA 4B5TA 4IQEA 2KX9A 1E0UA 1T5AA 4FXFA 4TV5A 1MUMA 3SRKA 2E28A 4HYVA 3T05A 3R4IA 2R82A 4JPGA 3OYXA 3QLLA 1KC7A 1E0TA 4MF4A 3E5BA 3E0VA 3I4EA 1XG3A 4B2DA 2X0SA 3IS4A 2HWGA 4KS0A 3PUGA 1GGOA 2VWSA 3FA3A 4B5VA 1PKMA 4IQDA 1PKLA 3HQNA 4B5UA 4YNGA 4WJ8A 2HJPA 3FA4A 2VGIA 4B2DD 4KCUA 2DUAA 1DIKA 4L9ZA 2VGFA 1U5HA 4ROQA 1IZCA 2QIWA 1F3XA 1DXFA 3QQWA 4KCVA 2VGGA 3T0TA 4DRSA 3GG8A 4QG9A 2XDFA 2V5JA 3PP7A 4HYWA 3QZ6A 4RPPA 2VGBA 3BJTA 3M0JA 4QG8A 1SGJA 4FXJA 5TAOA 1F8MA 3MA8A 3ME3A 3HQPA 1A5UA 3EOLA 3M0KA
chains in the Genus database with same CATH superfamily
3AXKA 3M5VA 3UZZA 2FQIA 5EY5A 4JQ1A 4XQ6A 3TONA 1RJQA 4OIFA 2VENA 1JUBA 4H8VA 3WBAA 3DN5A 4KFNA 3MS8A 4RV3A 5FA5A 4XD5A 1KFEA 3PR2A 4ZO8A 1K9DA 2EBNA 4BQ4A 4AY7A 3QGKC 2AQOA 3WDJA 3WD4A 2X42A 4QJ1A 3WY1A 4NAFB 4K6AA 3GAKA 4FIRA 3BLIA 5FJPA 1TVLA 4HHHA 3I10A 1ADOA 2REQB 3SCRA 2YFNA 1BXCA 4W85A 3W72A 1B1YA 3VVGA 5K9XA 3BCFA 3A13A 1KBLA 1Q6QA 2PTXA 4IFRA 5CAHA 1YDOA 2J13A 3H4WA 2VCBA 1EQCA 5CC3A 4BI5A 4H19A 5I3DA 3R0KA 2NQHA 1MVYA 3N13A 6XIMA 4N4QA 2VZVA 2GJNA 4DM2A 1LM1A 1D9EA 1DQWA 1PHWA 2YYTA 3F4WA 3C6CA 4ICCX 4BWLC 3DENA 3SBFA 5CPTA 4XAPA 4RNFA 1HZYA 3IJ8A 2DUAA 3EDKA 5D37A 4OOUA 3KOWA 4O15A 2FDSA 4FMVA 2WSPA 2XH4A 4GVIA 3TOPA 4GUGA 6A3HA 2EJAA 1SR0A 3T2QA 5HNNA 2IQDA 1K03A 4R5EA 3O63A 3EOLA 4O10A 1XRVA 2PLJA 2NW0A 1GYNA 2GLKA 1VBHA 3WLOA 3WEMA 2CHRA 1T41A 3HGJA 3QHNA 3WQWA 5H91A 3MI3A 5HMDA 4Q8VA 4ATWA 4UCFA 3UR2A 4REQA 3S1VA 3I7RA 3IIXA 4GVGA 5JUVA 3AXIA 4N4PA 3U4AA 4HNLA 4QXIA 4C65A 1VQTA 3WF4A 2D24A 2GQ8A 2OSYA 3URAA 2XG9A 4WKHA 2GVEA 4IH3A 2O55A 2XVLA 2Y8UA 3HZ3A 1TR1A 4DWSD 3WQ6A 3GNNA 3O07A 4FPSA 3CEPA 3PTMA 4GH3A 2WWCA 3K1DA 1KBBA 3CZEA 1J6OA 1UIPA 1NOFA 1FHDA 1QO2A 2IKHA 2X40A 3B4YA 4Q4OA 3GBEA 1J11A 5L9FA 4CNOA 2WMHA 1TV3A 3NZ1A 1D8WA 3TC6A 4BKNA 4U4MA 3PBYA 1PKMA 5EA9A 4HIBA 3NO1A 5AFDA 1R46A 1LOQA 3W02A 2JGYA 4QJ5B 2D2HA 1CLKA 3ENLA 3OVRA 4W8AA 3VIMA 2ATMA 1ZBWA 4PTVA 3NDOA 4ERGA 3BV4A 2INFA 3MYOA 1AMYA 4JIHA 2HS8A 3OA3A 1KLYA 4EPDC 4FA3A 1AFSA 1B0IA 2PA6A 3R2GA 4Q7NA 4UNKA 4B91A 2QCDA 3P74A 1NTHA 5HPCA 5T8GA 2WCGA 4IP5A 3WJWA 3KBMA 2ZC1A 1GK8A 3LCLA 1F3WA 1MYRA 4IMFA 3E74A 3V5FA 2DZVA 2DORA 4B90A 1N7KA 5HWJA 2PDQA 2WHJA 5BOOA 2ZZ3A 3KFTA 1MW2A 2X1SA 2JF7A 2XPKA 1K6AA 2PC4A 2BODX 1KCZA 2HSAA 3VGDA 3CWOX 3WK0A 1KBIA 3OPSA 3GFYA 4HCHA 3ZSSA 1PAMA 1B3XA 3B9OA 1TYGA 1GJWA 2XIBA 5FJTA 3CMFA 4BR1A 4EAYA 1I6NA 3TUUA 3SECA 1KB3A 3VOCA 3BUVA 4MJMA 7ENLA 2A0NA 1K6WA 1CB2A 1BYAA 4GINA 2O9PA 1C8XA 2RH9A 3I6RA 3W1PA 1B5TA 4A22A 3EKLA 3MDUA 4OECA 4CCDA 3FV9A 5FJUA 4H9XA 3STEA 2OWCA 3WO8A 3WDIA 1BYDA 1S1RA 1W91A 3AYRA 4Q3MA 2UZ9A 3GHUA 3DH7A 4PMRA 1YNPA 1E3ZA 4AX7A 3QGAC 1XIDA 4HOXA 4QLKA 3AC0A 3C61A 2YL5A 4GYPC 4CQ9A 1A4LA 4OWGA 2DVXA 2J66A 1KRMA 3RAOA 3BC9A 4GIRA 4J2PA 3KHDA 1E4IA 2B7NA 4DXVA 1TUFA 4F9DA 4AX6A 1EEXA 3TZFA 4AZGA 2RGLA 1FCBA 4KEZA 2JBMA 4X2PA 1KRBC 2F2KA 3DAQA 1BXNA 4YTTA 3OVQA 3CUIA 3VILA 4DELA 2FH8A 3VKJA 1GHRA 5DT5A 2G50A 1WKDA 2FVMA 1SMAA 4Y9NA 1TZZA 4LCQA 3WMSA 4UTJA 2FTWA 3G1AA 4MB1A 4NYYA 3AAMA 3U4FA 1DJZA 5A94A 2PDHA 3T8LA 2G3NA 5KZEA 2VX7A 2A3CA 1BPLB 4QS6A 4Q8OA 4UIOA 4HPGA 1CYGA 2PFHA 2V3GA 4AF0B 4M6VA 1Z9AA 1W56A 4UR8A 3L0GA 4M6PA 4C6CA 1YKWA 2X09A 2WVVB 2Z1SA 3FSUA 3UR5A 1K8XA 2WLZA 2HS6A 4AYSA 5D9OA 4WJ8A 1Q4NX 5HATA 4ZB5A 3VYLA 4DYJA 2GVGA 3SY1A 1EDTA 1TPH1 2VP8A 1SO5A 3PUDA 3G0SA 4LS0A 2G5WA 3ARUA 1FCQA 3LXCA 3V3WA 4I5UA 3WDPP 4LEQA 2GJLA 4LUTB 4WR3A 4IOTA 3N19B 1G01A 2E68A 3EDEA 3WLTA 1MUCA 3BL3A 4AZ5A 2YDRA 3OO2A 3DFPA 1MQPA 4Y90A 4BI7A 1JXKA 3TWBA 1MNSA 2OFJA 4RJEA 4W87A 5IXEA 4QROA 1JL8A 4ADSA 2XSAA 3OG3A 1M1BA 1JAKA 4EACA 1UWIA 2RUSA 4Y9MA 4MB5A 2PZNA 3ITGA 3GR7A 3V5OA 2XFYA 3BANA 3SCQA 3TQKA 4P8UA 3C0JA 3FXYA 2OSWA 1VCFA 1XLAA 3AXXA 1SMDA 3WDHA 1G4EA 4H00A 1E0UA 2OO6A 1VF8A 2YJQA 3UG3A 2DW6A 3QEZA 1XM3A 2V3EA 2ISWA 2ZTKA 3ARXA 2X1UA 4C6BA 3L5MA 3TN3A 2VI0A 2JQXA 1XIEA 4LUYA 4PA8A 3SEPA 3W1AA 2XFFA 3L4XA 2C14A 1U1UA 1TE1A 3DGRA 5A3HA 3RU6A 4E8CA 2Y8KA 4KEMA 2PE4A 1PX4A 1XIFA 1GQNA 4JTDA 4B2DD 2AQVA 2NZLA 3P8JA 1GPFA 4BQ5A 1CLVA 1RALA 2CBVA 4GUFA 3TN5A 3R25A 3V16A 3VDGA 1EIXA 3N17A 3ECQA 4QNEA 3NQDA 3UY7A 3QV7A 2Z1WA 4LJ3A 4AD2A 4BY3A 3ZT6A 4MTVA 3KWSA 3UG5A 4GX8A 1NQ6A 3N2MA 1Q7MA 5A95A 3UXLA 4L9XA 4G56A 1KW1A 2C91A 5KZ6A 1SO4A 3IV8A 3UJEA 2I7GA 1FRBA 1YTDA 1DYSA 1F4AA 1DXEA 2IQTA 3JZUA 1PL9A 1ZSXA 4IIBA 3ZQ9A 1I2RA 1VPXA 3NVDA 1X39A 1LT7A 1KBKA 2JF6A 3NOEA 4DJED 2GDQA 2CZFA 4WRHA 1GG1A 3IWPA 1KFWA 1WA3A 4KPLA 4U31A 5CAKA 4GZ7A 4YWSA 5G2WA 1FWIC 1OX5A 1Y5WA 4DJFD 3L67A 3EMQA 3RPDA 2W63A 4A8RA 4V1XA 5TBOA 4OHQA 4TR9A 3RG6A 5F2LA 4UQDA 1V6TA 1R3SA 3OGVA 3IS4A 4L6OA 2FGZA 4OGZA 2P5NA 3UJSA 3IUHA 3PPHA 4B5UA 4H9MA 4ZOAA 2XUCA 5MF5A 1YXCA 3AHVA 4DPQA 3W7RA 6PTDA 2Y7DA 3VM7A 3VU2A 3KOYA 1E6NA 3W38A 2WW5A 3KRSA 5AB3A 4AEOA 4CLMA 2IMRA 2OMAA 1J0HA 3BAWA 1I75A 4M1BA 2CLEA 2DSZA 1E0WA 1NARA 2P3ZA 3TEVA 1LWJA 3DFHA 4UOJA 4OBSA 2F7FA 4EIVA 3VZZA 1TMHA 2HVMA 1UWSA 2NQLA 2CZ5A 3C0SA 3RUBL 8RUCA 4IT1A 1MXGA 5GQBA 3G6MA 2O4MA 2VFEA 3IJQA 4I90A 4C90A 3IIVA 4QQUA 2YCIX 4UTIA 1WKYA 3UERA 3LSCA 2PDBA 5CG7A 2Z28A 3FX4A 2CNCA 3W25A 3WLSA 3QN3A 4WJEA 3CWNA 4A29A 2Q02A 4N9BA 2V5KA 2PDLA 4JTAA 1YLVA 3O0KA 2PDWA 4HSNA 3MV01 5CSYA 1HT6A 4F0MA 4GGHA 4GC3A 1T5AA 3QKEA 3E0FA 6ALDA 4S3EA 2YA2A 3DFYA 1OFRA 1KM4A 3TYEA 4EPBC 4HHPA 5BWAA 6XIAA 1VFOA 3ANUA 3A21A 2PPGA 3PPGA 2J7DA 1E40A 4AVOA 2GDUA 3POHA 4KETA 3W7QA 1TWIA 4Z1DA 1ZCOA 3THDA 3UWEA 2HJPA 3Q65A 3OVGA 4UB9A 3DU0A 3CYVA 2PD9A 4PUEA 4HMNA 4LVBA 4UNIA 4UOZA 3KVMA 4F2BA 4JTJA 1TUXA 4KRUA 3UBPC 5C9UA 3ZJKA 3SN4A 2Y61A 3TTYA 2V0TA 3DZ1A 2OXNA 4GXPA 5CKSA 4GI6A 2UY2A 4QSFA 2I57A 2J4GA 4IGSA 1JRBA 3PULA 4W7VA 2YX0A 4ZSUA 1FDYA 1QOQA 4RXFA 5AHEA 3P8IA 2CKSA 1EXBA 1ZFJA 2R6OA 2Z2UA 1BEUA 1XFCA 3SSZA 1BSIA 2R1LA 4JHMA 3PG9A 1TPFA 3UYIA 2Y24A 4LCRA 5GJPA 1F8IA 4QAIA 3AIVA 4MAVA 4A35A 3R89A 3UWQA 4MZ8A 1W32A 3WD0A 4KFOA 1E71M 4D6DA 3TNOA 4MZYA 3T1GA 2QGYA 1P6WA 2Y7FA 2X7WA 4O4WA 4PTDA 3FDKA 1WOBA 4DUVA 3P62A 3UWZA 2YXXA 1W1VA 5CZKA 3TCSA 1XLEA 3KS5A 1PS9A 3LLFA 4GO8A 3W2JA 2CEQA 3VMNA 4CKQA 1SJAA 3UZXA 4CQ8A 4RDYA 2EG8A 1HTIA 1E0TA 1K8ZA 4E4FA 2AGTA 1QHZA 3W1MA 1E9LA 1RSCA 2IXUA 4OV4A 1Z7AA 4IG2A 1DIKA 4QM1A 1U5HA 4FX7A 4MZ1A 1QBAA 4FX6M 2DDXA 4I6KA 1KXVA 4YTQA 4M56A 9CGTA 5E9XA 2OEJA 2DT3A 2WVUA 3BSGA 2OCZA 3FLUA 4Q4QA 4E2VA 2J79A 2JEQA 1WXZA 2DT2A 5EMMA 4MFDA 2VX5A 3KBSA 1T0OA 4TTUA 5LYRA 4AZHA 4AD0A 3QFWA 3MTWA 1KFKA 3AWOA 4M82A 2OZTA 3FXGA 2POZA 3EOEA 3ZJ6A 3BG5A 3GFXA 3T0AA 1CX9A 4D1JA 4PH6A 4EF8A 1IQ8A 1K9FA 2JFEX 2QPSA 4Z0JA 3W1QA 4E2OA 1OBAA 1U1JA 1UZDA 1V3IA 3BJFA 4B15A 4BF9A 1IT0A 1OM0A 4MKNA 1KV8A 3BURA 3VIJA 1XH1A 1KFLA 3S6OA 5LA1A 2VX6A 3PG8A 4JTRA 4MY8A 3IJDA 4GPNA 3TZNA 2XGZA 3LZ3A 3LMZA 3NL2A 3RFAA 2A21A 3C8FA 4RXGA 1CECA 3GFZA 4BJHA 2A7PA 2BX7A 4HZ8A 3CH0A 5AZ0A 1ZL1A 1UKTA 1XG3A 3DX5A 1EXPA 4S3FA 4Z1YA 3T6CA 3H21A 1RLDA 5J8LA 4XKYB 3LNPA 5M3WA 5B7ZA 4RDVA 2VJXA 4GACA 5KZMA 3CO4A 4WY0A 3NPWA 4EWJA 1JG9A 1JPKA 3YPIA 4PFHA 3FN9A 4X60A 4WKFA 2QUUA 1LOSA 1R3YA 1Q63A 1W8GA 4GC4A 2FKPA 2V5LA 4L4LA 1PX3A 3P14A 4WUIA 3TSMA 1R2TA 3VOGA 2GVJA 3TTEA 2DSVA 1QDSA 4OE7A 3G1HA 3QTPA 3NFUA 1GKQA 2GGEA 4N02A 1WKFA 3WQEA 5FESA 5D2XA 4UBPC 3DEQA 3GM8A 1S2VA 2QF7A 4R88A 1H1ZA 4E4UA 1AK5A 5GNXA 1U5VA 1YPXA 4JCMA 1XRSA 3ZR6A 2RJGA 5HR7A 5C2XA 3IVTA 3UVIA 4JDYA 1UQZA 4QR6A 4WZHA 3CGTA 3RU8X 4AD4A 2EAWA 1ZZMA 3T2OA 1Z44A 1H2JA 1I0BA 3DHFA 1EFZA 1AMKA 2GGJA 4HOZA 4RE2A 4LBUA 2CWXA 4A6GA 4L61A 1E70M 4M7SA 1GVFA 2G95A 2F84A 3IVUA 4IPPA 3UXAA 4QE5A 4RDZA 1B9ZA 1DXFA 1YXYA 1P7TB 3DXIA 1DJHA 2EPHA 1UBSA 1G4SA 4M3PA 3M0JA 4NZJA 1QFEA 3RM4A 5HBFA 4GQBA 5A1AA 5EYWA 3B9DA 5DEZA 2EHHA 1OFBA 1HNYA 1GEQA 1V0LA 3WENA 1O68A 3K30A 5ABHA 3MHGA 4J3UA 4KMQA 2P1FA 2VZSA 2J9XA 1W1B1 2E0PA 1BLIA 4DWDA 3D5HA 4FALA 1GTEA 3RILA 4WIWA 1SJCA 5A8GA 3CUHA 1NIUA 3BGAA 4L80A 5KITA 2BVDA 4M1RA 2KAUC 3MWCA 1PVNA 2X0HA 1S2UA 2Z2AA 1XYCA 2J7FA 3U3HA 3ATZA 2P76A 1KGWA 2LLEA 3GE7A 1DVJA 4AY1A 3UPMA 2ZQ0A 3VCNA 5HJXA 1NWRA 2VRQA 3H7UA 3C3NA 2Z26A 3CU2A 4IXHA 1F74A 4NI8A 2VM8A 1X98A 2QIIA 4US6A 1QPNA 2XTKA 3MQTA 3WQPA 2D69A 3BSMA 2F6UA 4TX9A 2V5BA 4V33A 3W00A 4UTUA 2A7NA 5EMUA 3BG3A 3NQMA 1OWQA 4EXAA 3DFTA 5LNUA 2V69A 6TAAA 5FIPA 2PDXA 4C7FA 2WSRA 4MAZA 1Q45A 4XWUA 2WLYA 3T0BA 4DWSA 3ARWA 2ZXDA 4GZJA 2OQYA 3LOTA 5G1MA 1Q8AA 3BSHA 4GFIA 5AC6A 4CEUC 5F4WA 3CC1A 1E4LA 3E3HA 3LHUA 4F2TA 3QM3A 3QZAA 5BZAA 2O9RA 5HMEA 3L0NA 1NP0A 3GR8A 7ODCA 1SFSA 4M6QA 4GIEA 2PDIA 4PB3A 2FPTA 4LOCA 3WFZA 1ZJHA 1AH0A 5FKYA 3MP3A 1CXEA 1GHSA 1TSIA 1EJVC 1TWSA 1BKSA 1HX0A 4C91A 2ISVA 2F38A 4DLMA 3IEBA 3OYXA 4ADTA 4PC8A 1XBZA 1JIBA 2J8GA 3MUCA 3WF1A 2XH7A 3DFSA 5TF0A 1JPMA 4WEVX 3GXFA 4EAMA 4H2CA 1OIMA 4Z17A 2X1IA 1JCMP 4M0XA 3LNMA 4DJEC 3VGHA 3C2FA 1RP8A 2D2OA 2J47A 4RPPA 1K1DA 1EYEA 3TTOA 1VJSA 3MA8A 3M64A 3URBA 4XBJA 2DQXA 1MRQA 3THAA 1XX1A 2QMKA 2WM0A 3CHVA 4I9MA 4HNUA 3A3XA 4JR5A 3WD1A 4DIAA 2QGHA 4DYKA 1QI5A 1KCXA 2E25A 3M44A 3BCDA 4YLWA 2VO5A 1EP2A 4WVXA 3LHTA 1H0GA 5CPSA 5JIPA 1JZ7A 3OA5A 1LUCB 5A2CA 4JEQA 5E0KA 1V4YA 4IIFA 1ZJAA 2CZDA 1JZ3A 4J28A 4XTDA 4FI4A 4ZBCA 4B5NA 3UQNA 2FHFA 3RGTA 3C0LA 1TQJA 3S42A 3EXRA 4C60A 4QITA 3AJXA 3BG9A 4Q8PA 1EO5A 5M1TA 1IZKA 1KM1A 1J2WA 1TPWA 3TA6A 1XYLA 3R10A 2VCCA 4GCAA 2RFGA 5FAJA 1UR2A 2Z24A 4P2VA 5AC4A 4MUPA 2I56A 1GGOA 2VFFA 4IQJA 1RK6A 3T09A 3AS2A 4Z0SA 3W23A 4CNUA 2JIEA 3TIMA 1F76A 3VZXA 4CQCA 3WUEA 4QAWA 5G1YA 4PUWA 1UR3M 3FEMA 3EAUA 3UZ5A 2OLHA 2E1DA 1SZFA 2FZ8A 2OGJA 3N2CA 1B90A 3W75A 3KUMA 5AVNA 2ODOA 3F2CA 4EXBA 3VC5A 1PYMA 1WOAA 2R1PA 1VR6A 1LG2A 1XHGA 4I5RA 3LCXA 2E6FA 1NDVA 2JKPA 5B80A 4I5XA 4HT3A 2AL1A 3QFEA 1UR8A 3CMGA 4L4OA 3DBPA 3WBEA 3WK1A 1UH2A 2ZZ2A 4D6GA 4V27A 3C2RA 1Z41A 4H2HA 1F6YA 4JX6A 1FWTA 3P81A 4LAKA 4Z2HA 2V2CA 2R1MA 1JPIA 3N4AA 3S9ZA 4XSMA 3ZJ8A 1KXTA 1OX6A 3VIHA 1SJDA 4US5A 3OBAA 3PK7A 2PP3A 1EX5A 1Z6KA 2VDIA 1E15A 1UKOA 5BYWA 1E9ZB 1FWSA 3G1FA 3DYOA 2V81A 3GXIA 3VNYA 1DWAM 4YMZA 2TYSA 5AOUA 5BMXA 5KETA 2BOEX 1X8FA 1V0KA 4IQDA 2Y6ZA 4XVEA 3RM9A 2FZMA 5JH1A 4Z2IA 4NRRA 4DZIA 2FPVA 4WDUA 2B31A 3T0TA 1MQQA 3M0ZA 1KA9F 3UPBA 1OB0A 4IGMA 1GZ1A 1VYSX 2YCKX 4AZ7A 3TU9A 5A6KA 3W28A 1UH4A 1UD8A 4AYGA 3C5QA 3GWQA 4AAJA 5IM51 4MPQA 3I3BA 4AVFA 1H3GA 5LIUX 3ZFHA 1IXOA 3R94A 4GO9A 3VE9A 3UT0A 1WB0A 3LCHA 2G0WA 3WBXA 2E9LA 3GTNA 4MDPA 3UPWA 1E1CB 4K7VA 1YE6A 2IKJA 5I23A 4JBRA 1S1PA 3LXAA 3C0QA 3R1ZA 2AL2B 4UQAA 1C8YA 1RXOB 3D47A 4UTTA 5HOSA 4HZMA 1YDYA 1GOXA 3SCUA 1FHLA 2ZUUA 1CWYA 3D46A 3CZGA 3CS2A 3QC0A 4XO6A 1C7SA 1QMLA 3OQEA 5HWMA 1BGAA 2D2JA 3BAXA 4BQ3A 1P6BA 3P5YA 1OADA 4L4PA 4HB7A 1CDGA 1I2PA 2WZTA 3GC5A 2NQJA 4IX2A 5M17A 1HW6A 4PR4A 4IIGA 4AEEA 1MW0A 3KW3A 5FF7A 1NH6A 2BTMA 2PMQA 3GVQA 4YCOA 2ZADA 3PFMA 4DI8A 2AMXA 3MPGA 4W8LA 7TIMA 5HMSA 3W2KA 1AW2A 1QI4A 3UESA 2H9AB 2YCJA 4RNHA 3JR2A 4PUMA 4C6FA 1VKFA 1XIBA 4H8UA 4A2SA 4U3AA 3K4WA 1XSIA 1UZ4A 5C0QA 1RVGA 3CIWA 2FFCA 4J2MA 1CENA 2OKTA 2DVUA 3BCJA 1TZ7A 1EC9A 1WZLA 1V0NA 1W1ZA 3GTHA 1IEIA 1UCWA 2QPXA 4W86A 3MV11 4MDOA 4HCLA 3WLLA 3NCOA 4FNPA 2Z7KA 3G1DA 5F2GA 4NASA 3I6TA 1KGUA 2YBVA 3GIPA 1DJYA 2Z4GA 3EX6A 3AALA 2I5IA 3AI0A 3R79A 3HMJG 2B4GA 3PN8A 1UMYA 4MIMA 4YHEA 3BZJA 3IGSA 1SU5A 3ES7A 5C9WA 3NGFA 3W81A 3OIHA 3E5BA 4CD7A 7CGTA 4GXMA 4MMWA 2V63A 1GQLA 1L6WA 3LGDA 4O1BA 1OINA 1P5BA 1UWTA 1SUXA 5CC5A 4AHQA 3GDLA 4K68A 4QE1A 5K7JA 4J3VA 1EF3A 2R91A 1WZAA 2EXOA 1TKKA 3VDCA 2POTA 1ONWA 4LBSA 2XN2A 1KM2A 1S39A 3OLGA 1H51A 3PZ9A 1ECEA 3NQAA 1N55A 4NZ4A 2ISDA 2EJ1A 1FA2A 3KRZA 3KEHA 3W1TA 3N3MA 1RUSA 1K8CA 2BLEA 2CWNA 2C3ZA 6ENLA 2V3FA 3LPOA 3N15A 4HPNA 4R3UA 4QEHA 2OEKA 2YBUA 1EGZA 1XKJA 3CZJA 4RNIA 3PBGA 2QCLA 1RJPA 4HCDA 1K8YA 3NJ3A 1UZHA 2DT1A 5I03A 2FIQA 4LC6A 4QJ3B 2PWGA 1AQHA 1AL7A 4Q8NA 3HMCA 3HFYA 4P7QA 4BEUA 1LLWA 5K3VA 1HG3A 3GNOA 1FKXA 1W5QA 2WKGA 7REQB 2PTZA 5LGXA 3COTA 1XH2A 3LD5A 2BY0A 4P7OA 5CBBA 3UR8A 1O1ZA 1WAWA 3S1UA 2W3ZA 1UB3A 4RPQA 5HAOA 3U7VA 2BWGA 3MO4A 5BWFA 3PUOA 3E2VA 3HPAA 2NT1A 3G0UA 1J4EA 1NU5A 2CW6A 3MO7A 4DF0A 5T26A 4CU6A 1UWUA 4QCEA 3TMLA 1MNZA 3OEXA 2D2GA 3IK4A 2NVAA 1W9DM 4WK9A 3LGGA 4D6EA 3KHJA 4FOJA 1JNEA 3ARVA 3E2QA 4HTYA 3K2GA 2P53A 4KWSA 4HOWA 3U9IA 1LBMA 4OBTA 3VIFA 3KCLA 1WDPA 1AH3A 3UF9A 1LORA 3B8TA 4Q4PA 3VD5A 3HA1A 3A47A 3CHCA 2VZOA 1UG6A 1OY0A 2ON3A 2J7EA 3KXQA 2VELA 4BWLA 3FJNA 3K8MA 5D05A 5C9XA 4OJYA 1O66A 2NSXA 1FWRA 1I1XA 1GYMA 1DP0A 1R3RA 3SGGA 5DFAA 1DWFM 1W5PA 1O5XA 3VDHA 3A9BA 4ZZ9A 4Q4RA 2D0FA 4HYVA 2IQ0A 4QE4A 1FP8A 3FHQA 3ID7A 4ILSA 5FL0A 4ERAA 1R85A 3CHDA 1SZGA 2X0SA 3ZT5A 1RZMA 4O13A 4QDPA 4LVFA 3MHUA 5B7YA 1UD3A 2V2HA 1G1YA 4UZUA 4DJDA 1GTHA 4DZAA 4E4PA 1XYMA 1YNQA 5E6ZA 3W84A 1RV8A 4JTHA 1EDGA 4Q4MA 1LWHA 2YOCA 3BJTA 3SJNA 3PAJA 5ABFA 2E67A 3RM8A 2RHGA 4K8EA 3GXDA 4JTUA 4DHGA 1R5YA 3AMCA 1XF0A 4XZMX 2OYLA 3W7OA 3M7WA 4NZCA 1NFBA 2ZUSA 1G69A 1ME7A 1IF2A 3NDYA 1K9TA 4CVWA 3LX9A 5M5DA 1Y65A 4AIBA 1A0EA 1E55A 4D6FA 1A80A 3HGOA 2HNEA 5CC6A 1VJIA 2G4FA 1J5SA 3AMGA 4Q8QA 4I8DA 4GNJA 3U8GA 3VFCA 3EEZA 2Q71A 4IF2A 2YCLA 2Z1XA 3B3DA 3RNDA 4V1YA 2E4TA 1M7XA 1A3WA 4ZFMA 4MG4A 5D04C 1J5TA 4PMOA 3CZKA 1G5AA 3P93A 3USZA 1HGYA 1VCVA 2YIHA 2J7GA 1EA0A 1C91A 1OG6A 4RE4A 2ZFAA 1ITXA 2CBUA 5IFPA 1KM0A 5REQA 1SVDA 2P8BA 1SW3A 3I4EA 3G1RA 1XC6A 3WMLA 2WAGA 2DSWA 4FK9A 3U6WA 2V2DA 1XLGA 4E2DA 1XLFA 3GHRA 4PL1A 1KRAC 4S3DA 3TJLA 4UWMA 1HJVA 1IT7A 2VD8A 2GUBA 5HJLA 2FB2A 3F5KA 5XIAA 3ALFA 4A3QA 1X7IA 9XIMA 1H7PA 4GABA 1I4NA 2R14A 2GDVA 3W53A 1ODZA 4F48A 2BHYA 2WOQA 4JKLA 3WQ8A 3QMTA 4XBSA 5D8WA 1UJQA 1XYFA 3AXHA 1E1CA 1V3KA 4BZYA 3B8UA 4LS1A 3D3FA 3ERPA 1AUSL 4XIAA 1RCOB 2VEGA 1M03A 3PWGA 3HG2A 2W5FA 3E5PA 3APTA 1J93A 1AA1B 3LTPA 3S2MA 2PODA 3GIYA 2GUUA 3CL6A 5HDRA 3VC6A 2CXEA 2DZPA 4O8RA 1UASA 2WBGA 4UCGA 3WELA 5IDZA 4JFVA 3F2DA 1ZALA 3T07A 8CGTA 1NEYA 5BXRA 1B2YA 2XIQA 4OTKA 4YIWA 3LRKA 3BOXA 4UMBA 4LS2A 2BS9A 2CZVA 2DZXA 1RD5A 4MYAA 3GXMA 2OOFA 3NXFA 4M8UA 2R1NA 3FYPA 1UOKA 3GTFA 3MWAA 4F9JA 3CIVA 1X1ZA 2WMIB 1EO7A 3UG4A 3M07A 4D6HA 3GYCA 1I9CB 3CV2A 4C6QA 3SGUA 2WHKA 1X6LA 4IQLA 1H5YA 1U22A 3FS2A 5CH9A 3A4JA 3M6YA 3E1F1 2CXGA 4GUIA 3KRBA 2DZBA 5HR6A 3M0XA 5IBXA 4FXFA 1XIMA 1XIIA 3PZUA 1VYPX 3QV8A 1KKRA 4TX6A 1B31A 1TB3A 2GVLA 1POJA 4RE3A 1SM9A 5AHLA 5AYZA 3EBVA 1OT1A 1V5XA 3WLRA 4R33A 2J6XA 5J5DA 4LPCA 2NQ5A 3VGFA 1EBHA 3G5EA 4L7ZA 1KR1A 5I78A 1NWSA 3LCWA 2VX4A 1UROA 1EJUC 1U30A 1XIGA 3UWYA 5JH2A 1XINA 4K8HA 4MSSA 1QW9A 4A21A 1MW3A 4HZ6A 3UZYA 4O53A 4DO7A 3G1VA 4JTFA 4ONVA 4KFPA 3B0YA 3PAOA 2PDGA 1CGUA 2GPTA 1UH3A 2GZXA 3AXMA 4WHBA 4UTKA 3PPCA 3W1RA 3W85A 2NXGA 2WZHA 1N8WA 3E96A 3INPA 3LLDA 3AIQA 1E1FA 3RR4A 1LRNA 4MB4A 2WZEA 2A7RA 1I2OA 4DBWA 5C8BB 3LN3A 1JPDX 3EX4A 5G1TA 1JYWA 2J75A 1TG7A 5J04A 1RBOB 4IP4A 2OT1A 2V30A 3RPTA 2P50A 3IARA 3N3TA 3IJ6A 4O11A 3GRIA 2QCCA 2YYUA 4Z2JA 2AOSA 1EL3A 3MANA 3MP4A 1GUVA 4YN5A 2E8ZA 3PNUA 1Q2RA 2RAGA 4RX0A 4U2ZA 5DXYA 3VCCA 2O7SA 3M7SA 1MI3A 2HVOA 1VD6A 4KEUA 4NAEB 3JW7A 2QEZA 4KBXA 4S3BA 2CC0A 1R3WA 4FNTA 5AHIA 4PRRA 3GC4A 1M3UA 1LRQA 2OT0A 1X96A 4D9PA 4J3ZA 3TYBA 1P0BA 3AZSA 2VFDA 2J7BA 2PBGA 5C9RA 3IGUA 3PS7A 6REQB 3WLJA 2AAMA 2IPWA 3GH5A 4HK7A 5EFDA 4A8NA 1JFXA 1JUEA 3M0HA 4GQQA 3OVPA 2BY3A 4UTLA 4WSKA 3UW6A 4PMDA 1N2VA 1UP3A 1KC7A 2QJIA 1Q4WA 1ZAIA 4QCFA 1OABA 1FH7A 2X1RA 1TV5A 3OLIA 4LAOA 1UMLA 1KCKA 2J77A 3BAYA 3PWIA 3PZIA 3ARPA 1ADSA 3KBVA 5D32A 3EA1A 2BXZA 1HUVA 2ZUVA 4JY8A 3QLDA 1JF6A 4Z42C 1UD4A 5BRQA 1QASA 3TN6A 4DRSA 1NVMA 4ZQOA 4S38A 4J3WA 3PANA 2XIOA 1UR4A 3BV7A 3CK5A 4H7VA 1KWKA 1OFPA 4BFAA 1XD1A 1TV2A 1W17A 1HGWA 2HBXA 4ZODA 1DJGA 3HQOA 3GLCA 1OC7A 1Q5MA 2V67A 1UKQA 3FHAA 1A5KC 4I7UA 2PTYA 2V3DA 2ZCGA 3TK7A 4CD4A 5EFFA 1JI2A 1KBJA 3KAOA 2Q8LA 4UTMA 2DSKA 1VH7A 3KM8A 1BRLB 4JCLA 3L21A 3QQ0A 4IPJA 1GJPA 3B4UA 2DUXA 3AIBA 1E4MM 2VDHA 1G94A 4R27A 1F3EA 3URQA 1HL2A 3LBMA 1E6XM 3SN1A 3LYEA 1EYWA 4CCEA 3PZGA 3K1GA 1QPRA 3AJ7A 5PTDA 2DUZA 2NUYA 3SUUA 1PZ3A 3BJSA 4NQ1A 3S5NA 3WJZA 1XUUA 2C8NA 4H1ZA 4XD6A 6CGTA 1AJ0A 1K02A 2TSYA 2E28A 4K2SA 1VLIA 4NXKA 4ZEPA 2YW3A 2PCEA 1KXHA 3H2FA 1V7YA 3E0VA 2PWDA 3STPA 3VNZA 3W7IA 4B3KA 3VDBA 3WMBA 2NQ9A 3I3EA 5HXMA 2OB3A 2XN0A 1A3HA 2GGIA 2NUXA 3KDNA 2QCDB 3HQNA 3C8NA 1RQEA 3E0LA 2XISA 3MKVA 2CLKA 4MJZA 3EB2A 2ONEA 1EA9C 3T42A 2R1KA 3LU2A 4ZE5A 2QT3A 3UCQA 2DEPA 3HPSA 2BVTA 1QVBA 4MPKA 2J24A 3CZLA 4HHMA 4MKSA 1QXLA 3ELFA 3PZNA 3EA2A 3P7YA 1IEQA 4DAIA 4QP0A 1BAGA 1NDZA 4XSLA 4MWAB 3U5YA 2QJGA 2Y5SA 5DT7A 2Z1BA 1F6PA 1EJSC 4ZXLA 1PCKA 1MEHA 4FO4A 1IWBA 3VD3A 3WNOA 4A2RA 2OLSA 4HPJA 1XW8A 3URNA 2YB1A 3H55A 4D8AA 2H3BA 2GUYA 3STFA 2QQ6A 3VNMA 1JNDA 2FGBA 2VR2A 4ZA0A 1Q6CA 1X6NA 1YDNA 5HUPA 2VZTA 2O56A 2PRLA 2WVTA 3CUJA 4Q8MA 3LB0A 4PUUA 2VC7A 4LVDA 3WD3A 1R2RA 1R6WA 2GJRA 2A3AA 2WJEA 4WQ6A 1I60A 3EMZA 1EWEA 3G2GA 1GVRA 1W1A1 1AW1A 3NIYA 2GSJA 1HO4A 1G4PA 2V8ZA 1W3JA 3WJSA 4TV5A 5TD4A 3SRKA 3MCNA 3M5ZA 5AKQA 1YX1A 2OPJA 1WNOA 1JZ8A 4OVXA 3QYSA 1BF6A 3SAZA 1UWAA 2PGFA 5FF3A 4N9DA 4TMBA 1MEIA 2JK2A 1ZS2A 2XSXA 1HJSA 1XQLA 4MYXA 5M03A 2CLPA 5JBFA 4AG0A 3LV5A 1M6JA 4FLOA 5LNSA 3VCRA 4M5PA 5CPQA 1XLMA 5DCDA 4S3CA 4XVDA 1VFTA 4HA0A 1FWJC 4TQTA 5KZDA 2CLMA 4E0CA 1RPXA 3WFLA 1TA3B 3IAPA 3NL6A 4HD5A 4AIEA 4NL1A 1ZP4A 4WOZA 4IMAA 4M7TA 4BK9A 5GNYA 4DVOA 5C9ZA 2WNQA 4YVVA 3CLMA 4QGCA 1F07A 1M5WA 3G18A 4O0ZA 1ZP3A 4AXNA 5H2ZA 1VAHA 2WHMA 3WJXA 4WDXA 5DXXA 2PDYA 3NQEA 4L56A 3CNYA 3FAWA 5JVLA 3WH6A 1XH0A 4C6OA 3W7LA 1KWGA 1R3QA 3NYDA 3QQ1A 1GQIA 4D6IA 3PFRA 3N1AA 1VBGA 3VGGA 4JFWA 2B7OA 1N8IA 1ZAHA 3TN4A 1GOKA 2FTPA 1Q3NA 4GWEA 4ZGYA 3LHYA 2C6QA 3DHUA 4B3ZA 4IMEA 2QJNA 1RLCL 4X63A 4Y9AA 1JDDA 1C92A 2EG7A 3GW3A 3MP5A 4RUBA 4I9AA 3SSJA 3VKKA 2CHNA 1S3TC 1R9ZA 4UTTC 2VR4A 4H6QA 2PURA 2UBPC 4G7EB 3L4ZA 4LW7A 5AZ1A 1Q66A 3UD6A 3AOFA 3EOSA 1SO3A 2F9RA 4H6RA 5CCZA 1LBLA 3QHOA 3TX9A 3KDOA 5FD0A 4JIEA 3TFCA 2ZC8A 4DZ5A 3VAVA 4PSRA 3L5LA 2DIKA 4GQGA 1W54A 1E0VA 2GWNA 2YZRA 1GZGA 4QS5A 3AHZA 1EWDA 2VMFA 2DY3A 1TV4A 1FWGC 4CQAA 3DG3A 2JEPA 2OG9A 4KCTA 1P0DA 1XWYA 3FY1A 3MBDA 4FB7A 1OGGA 1DOSA 3ZZ1A 3MJYA 1IHIA 2WKJA 2HISA 3W7DA 1PSCA 2DW7A 4KESA 3WD2A 5EBUA 3BH4A 3IVSA 1TWWA 1PDZA 2A6LA 2HV5A 4ACZA 1G4TA 1TTPA 2HZGA 1CLXA 1CZ1A 4B5TA 4ECLA 1VEMA 4J4KA 3LPFA 1TE6A 1LQ0A 1EC7A 3DKJA 4QQ3A 1AVAA 2E5DA 4DM1A 1H41A 1F9CA 4AD3A 2ZWYA 3WN6A 4E38A 2VWSA 3EB3A 3PJTA 3L9CA 4PCSA 2XGIA 3SCWA 1TWZA 5E6YA 4JTLA 1VZWA 4C6KA 1XL9A 9XIAA 4DN1A 3ARYA 4JQ4A 3SB0A 3TA9A 2PSNA 3OODA 1SFTA 2QZRA 4FLQA 2GJXA 4MWAE 4W9TA 2W27A 3HF3A 2C0AA 3WLPA 2PRMA 2P8CA 3RX3A 2V38A 2Z0IA 4E6MA 3W86A 4MNMA 4KGLA 4YTUA 2WPBA 1Y8BA 2GVYA 3UWVA 1BTMA 1LWIA 4DEFA 4O16A 4LC8A 4CD8A 1QRQA 5DELA 3AWNA 1EHNA 1FDJA 4O50A 5LIWX 5D38A 3A3HA 4PBGA 1LDCA 1ME8A 4MUZA 1HQTA 3FVDA 1BWKA 2UY5A 1F3TA 1SFLA 4KKXA 1Z32X 1E9IA 3KVKA 2OSXA 5H8UA 4AWTA 3LBOA 5A8QA 1NP2A 3VNLA 3DC8A 3OGRA 3QY6A 3NAVA 4QFUA 4CD6A 2EKGA 1GONA 2X2YA 1CTNA 3HU7A 3BZGA 4JTKA 4XG1A 1ZRQA 3CQIA 1Q7ZA 1H61A 1PDYA 4JFUA 3G3DA 3TMQA 4N2YA 1W5NA 2Y0FA 2J25A 4IL2A 3WQCA 1L6SA 5CPLA 1V6YA 4DUXA 1SW7A 4QBXA 4IIEA 5HNTA 3M0IA 3W9ZA 4F2UA 3SY5A 2Z25A 1GPWA 4DY1A 1UD5A 4XZNX 1Q6DA 2XH0A 3C2YA 2UWFA 1KQYA 3L65A 4RL3A 1DJIA 3KRUA 2V5DA 1S2AA 4P8VA 3TQPA 1GZJA 3PSWA 4GBDA 1VHCA 1ZTVA 3AIWA 5JMUA 2DGAA 2EO7A 4FIQA 1JDFA 4ZQCA 2XIIA 3TDFA 3H6OA 3RRAA 1IGSA 3PBWA 4GXWA 1WQ5A 1V7AA 1JCXA 1H7WA 1J0YA 3HV8A 4MHBA 4C6PA 2BV9A 4OQVA 1R3VA 7REQA 4TVDA 1UA3A 2NVDA 1BYBA 4MLJA 2V5CA 4UFHA 3EOOA 3M6DA 2J7HA 1VLWA 3N11A 2PUZA 2V6AA 1NF7A 1ME9A 3NM1A 4G1KA 1MXSA 5FOOA 2Q6ZA 3CAKA 4K37A 1VEOA 4I7WA 5A6LA 1S2CA 2X2GA 3IANA 5DQPA 4XISA 1W3KA 3OJGA 3L23A 4L9ZA 3DCPA 3T44A 1EJXC 1XBYA 1S3HA 1OK6A 3ZVHA 2IKGA 3GG0A 1ODUA 2VGGA 5E0CA 3WDQA 3MUY1 2V5JA 3LA4A 2Y70A 4XUGA 3AS3A 3W6LA 1ONEA 3BXWA 4FSAA 5D2WA 3G1YA 4HJFA 3K8LA 1L2QA 4UTWC 1CXFA 3W2MA 2Y7GA 3PTKA 1QOXA 3V1HA 8XIMA 4A3HA 4ICNA 4LFYA 4HK5A 5EL1A 4AF0A 3N73A 2O92A 5D9MA 2AKZA 1W3IA 3T81A 3SRFA 1ICSA 4K36A 2XZ9A 3GKFA 4FNRA 1ZBKA 3W2LA 3WBWA 5G2HA 2ZRZA 1C9DA 2QCGA 3TAKA 4B92A 3GTIA 4YS1A 3MVTA 2WYSA 3MSYA 4QRNA 2XVPA 4O8AA 3TH6A 1P1MA 1TIWA 4UFMA 1EOMA 3S5ZA 1XDLA 2IPJA 1ESWA 1OYBA 4DJDD 1EJTC 4RCXA 4ZO6A 4PFMA 3TYAA 1FVPA 4E8GA 2HK0A 1VEPA 2CETA 1J0ZA 4HKPA 1W9BM 4XZBA 3RRXA 2ZZ6A 4DO4A 1XP3A 3I68A 1EGMA 3CPGA 3CZ8A 3TOYA 2WPGA 3B97A 3RO8A 1RQHA 1P4CA 3B40A 9RUBA 1YBQA 4I6VA 2DZWA 2ZA2A 1K4HA 1FXQA 4JS3A 5LHFA 5C55A 5EMLA 2OTDA 3ONCA 4HYWA 1LT8A 4IPLA 4P7NA 1CGWA 4P61A 3B0XA 4HBKA 4GX9A 3TAOA 1BGGA 3AU2A 1E6RA 5AYYA 1EZWA 1VYRA 2TODA 5FI8A 3DHDA 3DFQA 1K70A 4UFJA 4RNJA 2AKMA 3ABRA 3VM5A 3KTCA 2HRWA 1T6MA 2W6RA 4FXSA 2QUTA 3HGRA 2QVNA 5HQMA 2E40A 4AZCB 1JCJA 3NR0A 3IRDA 3NSNA 3Q94A 2WMIA 3CEUA 3SI9A 3V5CA 3IGHX 3OZOA 4ADUA 1BWLA 3VD4A 2GFTA 4TUFA 1MFVA 4XKYA 4H04A 3OLDA 3ITVA 1VCGA 3W0KA 4Z08A 3T0CA 4WDTA 2Q09A 2BB0A 5TNVA 4HVXA 2WNNA 3ZLGA 3I7SA 1K7XA 5I02A 2QAFA 1QK0A 4XTIA 4FAMA 3PUEA 1Y5VA 3ZYZA 3BMWA 5D2TA 2QNEA 3NQ8A 1A50A 3WCZA 1SZEA 1GKPA 1X97A 4LUSA 4YYFA 1RD6A 1AJ2A 4XX6A 1RA5A 4GIYA 2OU4A 2G4JA 3O6CA 3LLXA 1HF6A 3CHFA 3HQPA 4C6DA 3VOHA 3W82A 4KIRA 4GKTA 4C6MA 5AN7A 1ECQA 3GG7A 4NRSA 5MHBA 1JDAA 1WE5A 1L6GA 3NTYA 2VKZG 3WQGA 2GYIA 2YXOA 2I9EA 2W4XA 3P82A 1GKRA 4V2XA 2TPSA 5TIMA 1J79A 2PBOA 1WUFA 3HGSA 3ORWA 1S2WA 7A3HA 1HN1A 1QUMA 3OTRA 3DI1A 3EB4A 2QPUA 4Z1AA 1UP2A 3CPUA 5FEPA 4DZHA 3MUIA 1JCNA 5LIKX 4IPIA 3RX2A 3NYZA 4Q8UA 3EX3A 1W3TA 3QV9A 4UC5A 2D0HA 3DFNA 4KCWA 1JDEA 1F05A 1LF1A 1RA0A 1XC4A 1PE1A 3PB0A 3FOKA 2QDDA 4N42A 3VGEA 4PULA 4K1GA 4S2BA 3EWYA 3FIGA 4PRTA 4PUNA 4IPNB 1L8NA 4MNJA 4PCNA 3II1A 4LYRA 1NF0A 3GNPA 1E6PA 1V3JA 1B3ZA 1P0KA 4PCTA 3PZVA 1Q6EA 5C6MA 3GVWA 1VGAA 3RX4A 4MLRA 3CQ0A 1SZRA 1OX4A 3K4AA 1R86A 1EUAA 2E5BA 2X41A 1GJUA 2WMKA 2MANA 2WZIA 2PB1A 3VUSA 3N2OA 4Q8WA 2HE8A 3DC0A 3CO8A 2GQ9A 3SQLA 1FH9A 3CWHA 4KRZA 1FH8A 4KWOA 2A3HA 2I9UA 4JL1A 2UY3A 4O1EA 2IXVA 1L6FA 4HTBA 3B0VC 2H3DA 3KL5A 4D1IA 1QTWA 1TMQA 3M46A 1BVNP 3PZMA 4IGNA 4IIHA 3W6MA 8XIAA 3QHMA 1I8JA 3SCNA 4EOUA 3OBEA 2E8YA 1UKSA 4UOQA 5C7HA 4HA3A 1IEWA 4H83A 1R30A 3LRLA 4W8BA 1OZQA 2OJPA 3WUBA 2D73A 4H41A 1V79A 2X7VA 5HANA 3W24A 3GU2A 1QPQA 3FW6A 1KM3A 2J6VA 5DMMA 5ABGA 1EHAA 4FX8A 3H24A 1PUDA 5DRCA 4DBDA 1WP6A 1H7XA 2XIMA 1DKWA 3NQVA 3ZR4A 3BPWA 4AC7C 1IWAA 3QMSA 2J8FA 4ZB2A 3T9PA 3NQ7A 2Y85A 2W67A 3E6EA 1CGVA 2WCSA 3VKBA 4AWUA 3W22A 1PWMA 2XGBA 3SJ3A 1F6KA 3DBNA 2FH6A 2G41A 3RN6A 3L68A 5F2IA 3WLKX 1XYZA 2WB5A 1ONXA 1SPQA 3B8WA 4UQBA 1TPB1 5JU6A 4FOKA 3R58A 3MU7A 2CU0A 4EX4A 2ZRWA 3RCMA 1J0JA 3HURA 1XCFA 3S5YA 4GKLA 4PODA 3W1LA 4HPXA 3BLFA 4E3VA 3NPUA 4KWUA 1SFJA 3S2LA 1N8FA 3UA3A 4O14A 3LG3A 1TPDA 1PV8A 3UNDA 3SCTA 5K4ZA 4Z2LA 1J6PA 3C52A 4B5SA 4XK2A 1FCUA 5CZJA 1JZ2A 1BQCA 4YVXA 3L0KA 1V03A 3CB8A 4DF1A 1WCGA 3OYZA 1U5JA 1R2SA 3DECA 2R24A 2CHOA 1HKVA 2A6NA 4MGGA 1MDLA 4EK7A 3LHWA 4GJ1A 3HG5A 2QJHA 3CUXA 1R9XA 1Z69A 3QH2A 3VKDA 4IQEA 3S8HA 1MW1A 4S3AA 4YL2A 3M43A 4AMAA 3BGJA 3GXPA 3H2AA 2IW0A 3M4HA 3ZVHB 5T9BG 3QOMA 5U4NA 5JXQA 4ML9A 5HQLA 3IPWA 1JI1A 3GH7A 3W1NA 3GVGA 1EPVA 2WVVA 1ZPTA 1OF8A 3GDRA 1MEWA 4D8ZA 1TMLA 3SADA 1VP5A 1YE4A 1SGJA 1UKPA 1XR2A 2HMCA 4OOZA 2CBIA 3HPFA 3PM6A 4N7QA 4LB4A 3O6YX 1QNRA 1UP0A 3W71A 4GQ0A 4AZIA 3S46A 5CC7A 4JICA 1YRRA 2BGNE 4JIIX 2O9TA 2VUYA 1XS2A 4JDBA 3TSBA 5IBXC 2PC8A 1ZBCA 3VNKA 3RJXA 4QHRA 3NL5A 4CVUA 2XIJA 4XAZA 4NNCA 3UP8A 4H9ZA 2Z7GA 2L5HA 4ZCWA 1P43A 3BAKA 4ZQRA 4L9YA 4LXFA 2FJUB 3EEGA 3WNMA 2D3LA 1Q6GA 4DUOA 4GI8A 1QI2A 1HJQA 2AL2A 3EKGA 1DBTA 1TJ2A 1M53A 1ZGDA 3APGA 4G5DA 3NQGA 4CD5A 3VNIA 1UD2A 1LCOA 4NJJA 1CXHA 2W0UA 4L6DA 5FEWA 4RZ6A 3HIJA 1MUMA 2W9MA 3OZMA 3TXZA 1OJXA 2YCEA 1GVYA 4P7RA 4O18A 3IV3A 3WLIA 2HK1A 4HMCA 3BW4A 1H0IA 1IR1A 2J9YA 2YGYA 1OF6A 3VZYA 1EX1A 3EWWA 3ITOA 1M7PA 3ONBA 1H1YA 1JF5A 4NAFA 5CGQA 2VFGA 3R0UA 4S3JA 3V1PA 3NQBA 4N9CA 2Y62A 4A3UA 1OZMA 1GOOA 3TW7A 1US2A 4PTNA 4JY9A 2F6KA 5DY2A 3I65A 1L6YA 1GQKA 3VFLA 3OG2A 1OIFA 1B3YA 2Y89A 1Z8AA 3R13A 4HU4A 4ZOEA 1W1YA 1L9WA 3W74A 2EF9A 5H1WA 3I7QA 2HQAA 2VFHA 1UJPA 1UC5A 1BVZA 1WDRA 4WF7A 4PTXA 1U83A 4LU0A 2BGSA 2VZUA 1E73M 2AGKA 3FAXA 4LQ1A 3CTLA 3HB9A 1XIJA 3R6IA 4CNTA 5FF4A 3GDKA 4JTSA 4N0RA 2FHBA 4LAZA 5G4EA 3QYQA 5F7UA 1BVWA 1NELA 1VFLA 5A6SA 5E1QA 2WHLA 5JBEA 2NXIA 2EPMX 4UXDA 4W5ZA 1AD1A 1VC4A 3LI0A 3N14A 1DHKA 4LVGA 3NQ2A 2OODA 3MUAA 5BW6A 3N6HA 3WG6A 4B2DA 4ZTXA 4B9ZA 1VBJA 2J74A 3EA3A 1Q13A 1S38A 2XFWA 2NSOA 3USBA 3PJWA 5J5RA 2FB3A 2VC5A 3DGBA 5BXSA 1AZ2A 3VPLA 2D3NA 3N9SA 1JCYA 4IWWA 4FXRA 4RZ5A 4S23A 1XD0A 4PMUA 5DY3A 3O2LA 5MKGA 2ZTJA 1E9YB 1UW9A 3BLOA 1XLJA 1W3NA 4NILA 2Y1HA 3MMDA 3VGBA 2ADAA 2WXDM 3NO5A 3M0KA 4INFA 1XG4A 3MDWA 4B3LA 1TTIA 1X1NA 1Z89A 1IXNA 3DYMA 3RXZA 4AMCA 2BXVA 3D6NA 1JZ4A 3KZSA 2CPUA 4JOMA 1MQRA 5AHFA 4LANA 4Z1CA 3MSRA 1PO9A 1NJJA 5GVJA 3W70A 1OFEA 4AIUA 5I3FA 4RW3A 3GR4A 1A5NC 3QSTA 1QNOA 4C5ZA 1HKKA 4JTIA 2PP1A 3P0WA 1IE7C 5DX7A 4GK8A 4LSBA 1HVXA 3A22A 1CGYA 4GJIA 5I09A 3MC5A 3CT7A 3G8EA 1Q6FA 4OZOA 3TKFA 1X38A 1YTEA 4MJ4A 2OR2A 5CPOA 3AIUA 4MWAD 4I7VA 5T9CE 4QNWA 2KX9A 4B9YA 2A85A 2A3LA 3GU1A 5I06A 4EXQA 3R43A 4JIQA 4HYRA 3GG1A 3TROA 3FDGA 2UV8G 2J62A 3QLLA 1H4PA 2BZNA 4NP7A 2WCAA 3U2CA 2XM2A 2YKKA 5D33A 1DL3A 5CJ5A 3HJZA 4U33A 4HA1A 3ISIX 1K77A 2BY2A 1ISVA 3LXBA 4TVCA 3WL0A 3ZSTA 4NNAA 5SWUA 2EG6A 4M19A 4PTMA 1W2PA 1LLOA 1ISWA 1F3XA 4V15A 3XISA 3H4XA 3O1NA 3PC0A 1DHPA 4LF1A 1BQGA 4YTRA 1KCLA 2OQHA 1EOKA 3NL3A 3UXDA 5TAOA 3GU9A 1XGEA 4FNUA 4CNSA 1P0EA 1JXJA 3BOFA 3O9NA 1TVNA 3BOLA 4DJFA 1QPOA 4M80A 2QCNA 4E5TA 3V18A 2PDNA 5BXTA 3H4GA 2WWDA 4IMDA 3C86A 3THQA 1R47A 5KINA 2DP3A 4UQEA 3GXTA 1W8SA 3EXSA 3QXBA 4PB4A 3OGSA 2DU2A 3W73A 4REQB 3P67A 1J9YA 1YXDA 1FBAA 4GH1A 3TYDA 5BCAA 2ZWZA 5DMLA 2WNWA 3CLWA 3TQ0A 3W7KA 2PU0A 3GIQA 3M47A 3OBKA 3TXVA 5LNVA 3BW3A 2O9OA 2FTYA 2G3MA 1JULA 5FACA 5C5YA 1ISYA 4B16A 4LF2A 3VIKA 1T7LA 4AFYA 1X7FA 2WSKA 3M0MA 4Q7IA 2ACUA 4WGXA 4AQLA 1FWCC 1AG1O 3KBJA 1GOMA 2ZA3A 5IOBA 3W7JA 1OEPA 2A5HA 1JPHA 4RV8A 1EP3A 4Q32A 4D72A 2QIWA 4W89A 4NZ5A 4H9YA 2AMGA 2XHYA 3A4XA 3VI2A 4WX2A 1KLZA 2XWDA 2E77A 2VTFA 3OQ8A 1TPVA 2VL4A 3U5UA 1WV2A 2X8RA 1IIHA 2FZDA 2FVLA 4ATLA 1MDRA 4PCPA 3C2VA 1G6CA 3CYJA 1BFNA 4RK8A 1JEZA 2ZE3A 2QCHA 3RLGA 1E51A 3UGVA 3HOJA 1UR9A 1OCBA 3ATYA 3GX9A 1CIUA 1TJPA 3QGVA 3W7GA 4ZSTA 4PUJA 3MT1A 2W79A 4M51A 5LIXX 1VHNA 3UCCA 1KR0A 4O12A 1WXJA 5H8PA 2E9MA 4ZENA 4PZVA 1QNPA 5I7GA 5AC7A 1AQFA 4YJ5A 2FFIA 2Z1VA 3VD7A 2C1HA 4X3ZA 2DPEA 4UR9A 3WNPA 3GTXA 2CZEA 4GVHA 3SCVA 2Z6IA 1B3VA 1CB7B 4Q4KA 3S2CA 3PBVA 3NQCA 2EPNA 3MKKA 4JTCA 4H3DA 4YYCA 3Q58A 4J3SA 3IIZA 4OBRA 1GG0A 1VRXA 4GUJA 3FCPA 1BD0A 3TE9A 1SYTA 1XIHA 5I2UA 4C6LA 4ZVJA 3ALGA 1X8CA 2WO5A 2JALA 4KCVA 3ITXA 5ABEA 4L64A 2FVKA 1S5NA 1FP9A 4LCSA 4GJJA 2X16A 3B9AA 3WNLA 3MZNA 1XUZA 2FZNA 3FKKA 4IJBA 3AZTA 1FXPA 4GI4A 4DXXA 1THFD 4Y7EA 1W1TA 4JTQA 4O1FA 1C8QA 4ZE4A 1ITUA 2P0OA 3STGA 3D0CA 1UWQA 4TOQA 3FYYA 1KFBA 1FKWA 3KP0A 4MM1A 2Z29A 2FJKA 3E38A 3ABSA 1TJ1A 2B7QA 1A4MA 1PTGA 3BGGA 3W1XA 1PWLA 2DFAA 4WSHA 3KL3A 2QCMA 1ZU8A 3IIPA 4IM4A 4U10A 2XWEA 4MWAA 2OO0A 5ABFB 3MYPA 1QK2A 2P10A 5C71A 1XV8A 1C3FA 1W3LA 1ITQA 4IMGA 3BLKA 2R9RA 4Y2WA 3VX0A 3WZ0E 1H49A 2Y63A 2PS2A 3QVQA 3G6LA 1UR0A 3J7HA 3LS9A 4GI9A 3S6TA 4PEKA 4NG3A 3VUPA 2CBJA 1VFFA 3GNXA 4CCZA 2I17A 4WGHA 1QJWA 4R7WA 3WF0A 3JUGA 4D2JA 3PVFA 3PNZA 4O28A 5I3HA 3EMCA 3W37A 3ITCA 1MWOA 1WAUA 2QJMA 1C8VA 4LV4A 1TPC1 3S83A 1DTNA 1MUWA 4RR4A 1VS1A 4JFSA 3POCA 3NUKA 1XYBA 3ANYA 1FHUA 4RDWA 3WLMA 2W92A 4A3YA 1VPQA 4JYEA 5CPMA 4LUSB 1V77A 1AODA 4GY0A 1HL8A 1W5OA 2HPIA 2Y5JA 3UFYA 3SUWA 4W93A 1R87A 3SFWA 1GW9A 4L1GA 2OELA 4ACYA 2YL6A 3M0LA 4LTSA 3P80A 3QC3A 5HK4A 1TFVA 2EKCA 1OFDA 1TIMA 3AISA 3BDKA 3QZEA 1VFSA 4H9UA 4TO8A 3LCGA 2BHZA 3QPEA 4N6FA 4AISA 3RK8A 1YPIA 1B57A 1GOWA 1OFOA 3FYOA 4MADA 4GY1A 1A5CA 4R9XA 1QI3A 1BYCA 3BLLA 4HU3A 3GG8A 5IRPA 2REQA 4J5NA 1MMFA 4XZWA 1PB0A 3WH9A 5LA0A 2JIWA 3V35A 4UQCA 3M5YA 1JD9A 3AUOA 4JNYA 5I3KA 1DIDA 1WDDA 1XLIA 2Z00A 4S3GA 2GOUA 3DI0A 1WX0A 4J3TA 5BU6A 3UU0A 1JD7A 2FPYA 1T8QA 1NWTA 5A6TC 1B4KA 1DWJM 2HROA 3C56A 1NFGA 1RR2A 3DIPA 1SR9A 4A3RA 1HVQA 3BE7A 1RY0A 3QTGA 1WXYA 1H09A 2QDEA 2JKEA 1BWVA 1GVOA 3AYSA 1TVPA 5I24A 1NQKA 4CN1A 1JQVA 3W27A 5A6AA 3GBDA 3UCDA 3UWUA 1UC4A 3LDVA 2VRKA 4WD0A 3TCEA 3MSDA 3OIXA 4NSBA 2JGQA 5FSDC 4CGTA 1ZY9A 1W37A 3W3OA 2OWWA 1I0DA 1UIOA 3R8GA 1SJBA 1Y0EA 3UG8A 3DFOA 3EX2A 4N6EA 2E09A 3GXNA 4KRTA 2ZRYA 3V0SA 4S1FA 1NDYA 1VFHA 4R7OA 5BRBA 5C2GA 3PUGA 3QY8A 1OCNA 5LXEA 4Q6XA 2YL8A 1OHLA 1V93A 2VGIA 3E2RA 3ARSA 3H70A 4P8WA 4JKMA 5HNUA 4I9JA 1WUEA 1RJRA 4PB5A 4NJGA 1LRTA 1K7EA 1M65A 4DNHA 3A6OA 1B54A 2ACSA 1XLKA 5LKYA 3WH8A 4HPHA 4KW2A 4XZ9A 4M6UA 4AD5A 4NNBA 3GS6A 3CV7A 3LCFA 1ZB5A 4S3KA 1JCLA 4PUKA 2C71A 4LYKA 5GJMA 4B5XA 3EWBX 3JVAA 3MUXA 2H6RA 3IRSA 1CEOA 5EMJA 1M9HA 3SRHA 3NSMA 3H22A 2YW4A 4HHLA 4Q4SA 2NT0A 2DJXA 3VO0A 2X05A 3WF2A 4IHCA 1SW0A 3EZ4A 4PMXA 2PDFA 2BOGX 4DNMA 2WC7A 3B03A 3VNJA 3VNDA 3RITA 1GORA 1HL9A 4X2RA 3ZT7A 1UUQA 3LPPA 4ZR8A 3BICA 1XKYA 3SUVA 3W7CA 4A05A 4AUBA 3I6EA 4HSOA 3LHVA 1W9UA 2CLHA 4K3ZA 4JQAA 4AH7A 4GBUA 1D3CA 1KGXA 3THUA 2BXYA 4NHVA 1JRCA 1REQB 4MY9A 4PN2A 1ZHAA 4WLCA 3KLLA 4FF5A 3KLKA 3AIRA 1F4HA 2BVWA 5A8OA 4LBRA 1L0PA 5EU9A 3AZRA 3H12A 5XIMA 4H9TA 1O95A 1X1OA 4LAMA 1C90A 2YR1A 4FHAA 2HXTA 4JKKA 1J0IA 3TW6A 3F2BA 1QWKA 2O4QA 3HM7A 2VDGA 3U0HA 2GQ3A 3V4BA 4NUWA 4GNKB 2CCRA 3H26A 4L1XA 3H2CA 2BASA 1V6WA 1DWHM 4XZIA 3IAQA 3W4RA 3T55A 4AY8A 1TR9A 1P1XA 4GGBA 4IFOA 4LAUA 3TTSA 1D2KA 1MZRA 3A24A 5JIWA 3BAJA 1DWIM 3CXOA 4TU1A 4FZIA 3VIIA 1UOZA 1XLDA 2ZIDA 4Q33A 1D7KA 3MVIA 1T96A 1HIZA 2DVTA 5I79A 2EEXA 1XLLA 3L4WA 3AQUA 3GD6A 3CMJA 1QCWA 2ZICA 3R4IA 3ABZA 1E0XA 2NVCA 1TJRA 4C7DA 3WNNA 1F7BA 2WJFA 4F66A 1LROA 3H8AA 3R5EA 3DERA 5D4YA 3AMLA 4UUIA 2IPGA 3BAIA 2YL9A 1GNXA 4UTFA 1Y7VA 3U48A 4KCUA 3LGEA 2OLAA 4IFKA 1AH4A 4AWEA 1QWGA 3LQLA 2PDUA 3GO2A 4GISA 4F0LA 2A3BA 2WC4A 3HG3A 5BOEA 1V6XA 5L6UA 3ZLFA 2XN1A 4OV9A 3QR0A 4LUTA 2VRJA 2BVYA 1DE5A 3EWDA 4EANA 1FWFC 2E7FA 5CLTA 5EMKA 3O6AA 3FJLA 5A8NA 3G1XA 4JHZA 5C2CA 3T7VA 4KH2A 5A6MA 2NXHA 4Y9PA 1KD0A 3U2ZA 3RCYA 1NWUA 3N9RA 3W7EA 2J9ZA 1ISXA 4LY8A 3LSBA 4G9PA 2J8TA 3ZVIA 4DBUA 1O5QA 4FNQA 2I5GA 3MJMA 3WLQA 2WQDA 4K7YA 4ERIA 5A6BD 4KIEA 1M04A 1ZNNA 2ZZ4A 2GWGA 4RE0A 4IICA 2NWRA 2XYLA 4IL0A 1XDJA 2YPIA 5HQEA 3O15A 5FJRA 5DO8A 1CXIA 1OSEA 3RMEA 2VFIA 4ZO9A 3MMTA 3N18A 2DQWA 3PTDA 4QDWA 4H6EA 3F4NA 4JQ3A 2OGYA 2DJLA 4EKJA 1DEDA 4MB3A 3RMJA 1C29A 3LI1A 3Q37A 4N9EA 4JHOA 2JKAA 3NZRA 1VENA 2WMJA 2VEPA 2WMGA 2GSHA 3PHAA 1OFAA 4UNLA 3GNDA 4HNOA 4O1DA 4AZCA 1HKWA 5CG0A 2F61A 2XINA 4J27A 5A8MA 3QW3A 1GT8A 4DJEA 4IJCA 1AJZA 3CPRA 3I3DA 1XDMA 1JYNA 4NZFA 3NPVA 1W6TA 4BI6A 3O06A 3BLDA 2ZZ7A 3E0IA 1EQPA 2PF8A 3Q45A 3E0WA 3A4AA 3RR1A 5EB8A 4AEFA 2Y7EA 3WQFA 1PBGA 3JU2A 3NDZA 4C1NB 4XD4A 3GB6A 1T99A 4Y96A 4HP5A 3LPGA 3BTNA 3C3UA 3VIPA 5K9CA 2ZX6A 3QPYA 3WLHA 3F4CA 1ENUA 3TJ4A 3SZ8A 1O94A 3GVRA 5CZSA 1F5ZA 1PX8A 4ZQMA 4HNCA 3TTQA 3N12A 1WZKA 4W5UA 3QOKA 3VINA 3CQKA 4J40A 5IFTA 4CQDA 1W9VA 5F1VA 1V8EA 1PJ9A 2OZ0A 2W91A 5D8ZA 4BS0A 2H90A 4Q22A 1FWAC 4GNVA 4PMVA 3S5SA 1F73A 4PCFA 3NWRA 1Q6OA 2MUCA 1HKIA 3FSTA 4JAWA 1W9XA 2MNRA 3L4UA 1E6ZA 2VR5A 2PAJA 4W4QA 4DYEA 1ONRA 3W88A 4TX8A 2FLIA 1Z42A 4WSJA 2TRSA 1BTCA 2W62A 2ZX8A 4W84A 3XINA 1J12A 3V0UA 2VGBA 4AB4A 3BW2A 4QG8A 1HJXA 2ZA1A 3V75A 1ZQ5A 1G9HA 1IEVA 4JYFA 4X0NA 3WLNA 2BMBA 1CGXA 2Q8ZA 1NFPA 3WX7A 4YU1A 5G2IA 1VPYA 3OB8A 3QR3A 2VD9A 4G2DA 1EGVA 1O4UA 1XCXA 4NVTA 5HJYA 1KQZA 3APYA 4GMEA 2PZ0A 1RCQA 1NOWA 1EZ2A 3O3RA 3ARZA 4MOZA 2BHUA 4GE8A 3F4DA 3ZLHA 3GZAA 1FCVA 1DJNA 1TX2A 5F2MA 3MKCA 1EJRC 5CSRA 3U7BA 4AW7A 1WDQA 4B4FA 4Q8TA 4IZGA 1JFHA 5C70A 2Y8VA 2C13A 5DCEA 4ZXOA 3GDBA 1JUKA 2FZ9A 4ZO7A 1JGMA 2NV1A 2ZE0A 1RVKA 3FGCB 3OZPA 1A0CA 3ZOAA 1CXKA 3LENA 2ALRA 4PGLA 1DTUA 1TWDA 1JR1A 3N2TA 4MY1A 3W2NA 3EWZA 2HPMA 4U28A 3IACA 3W7MA 3FA3A 5HWNA 3AMDA 4X0VA 5FEXA 3V0TA 4D6CA 3EPMA 5D30A 5AHNA 4F4RA 2GL5A 4NZ1A 1HP5A 2ICSA 2C15A 3VIGA 2PP0A 1E4NA 4S2CA 4NJKA 1J01A 3BK0A 4HN4A 4U5KA 1A5OC 5ECUA 3RF9A 1CPUA 3SM0A 2G3FA 5AHMA 1W1IE 3DYPA 4FR6A 3TYCA 3OLEA 3T78A 1YPFA 3C4UA 1UZ1A 2PWEA 3ITYA 2GJPA 3JZEA 3KBWA 3XIMA 1Q6LA 2VQUA 1FWWA 5ABTA 4LUIA 5KSWA 3SRDA 3KCJA 3ZS4A 1B9BA 5F4SA 1ICQA 3T2PA 2WJZA 3R8HA 3QY7A 4GLEA 3S3GA 4ES4A 1ISZA 4IP7A 1G67A 3QJAA 1XGZA 5DF0A 2ZX9A 3CM4A 3H53A 2NX1A 2XFRA 4TTGA 1B30A 4EF9A 3GDTA 2R8WA 3B0UX 2YDSA 3GQYA 4EPKA 3PTQA 4LGXA 3ZJ7A 1HP4A 2QV5A 1POKA 4RW5A 4UTHA 3U57A 4TIMA 1MXDA 2B7PA 3O16A 4URIA 3Q67A 5E70A 1R7OA 3CL8A 4GYKA 1IR2A 1CNVA 4NT0A 1KFJA 2INZA 1CBGA 1QHPA 3FKRA 4FF7A 1EDQA 3LERA 3SDOA 1S5WA 1KM5A 3WDRA 1FOBA 1P0NA 2X0YA 4JX5A 2FHCA 3W01A 1OGSA 1IEXA 3UJRA 2D1ZA 1H7NA 3EWCA 3ZIZA 1E6QM 5AYXA 4QX4A 3MI6A 4FS9A 3SCPA 2Q3RA 4H9VA 1A5UA 1MSSA 3TLQA 5D2VA 4JTGA 3KS6A 1GWJA 5D9NA 5RUBA 2ZYFA 1GEHA 4FP1A 1Q6RA 3U2EA 1A5LC 4CUCA 4L5ZA 1SSGA 1TCDA 3F5JA 2QJJA 3H7RA 3E02A 3QRHA 2AQWA 4LNCA 3QMRA 3CIXA 2BOFX 2WV8A 4DJDC 4NYUA 4LWWA 1F2JA 3UVAA 4ORIA 3V7PA 1UBPC 3AHXA 4K8GA 4ZOCA 4YPJA 3S2NA 4E2BA 3QF0A 1TQXA 1RP9A 2G3IA 1KFCA 3PJUA 1YNYA 4Y8FA 1XLCA 5T91A 3QPZA 1QATA 4J35A 2YCLB 3P84A 5HINA 3AROA 5LHEA 2ZUTA 3VOJA 1I45A 2R82A 3CASA 1H50A 4IFKB 3NOYA 4XAGA 1WPCA 3C2EA 2ZVIA 3OHMB 2FMOA 3ARQA 5ENLA 3PPFA 2XU2A 3AUJA 4HGXA 1I1WA 1S5MA 2NUWA 3G24A 3BWWA 4J3XA 1DJWA 1FWDC 1M7JA 3PP7A 3LY0A 3LM3A 4HK6A 3RLHA 3T08A 1PYFA 4J9JA 2PGRA 4F0RA 2CKRA 1SO6A 4H7CA 2H8XA 4ZQPA 4AHOA 2G3JA 4C6NA 2WSQA 5CGMA 4LV9A 2EPKX 3SR7A 1WDWA 4DI9A 3VABA 4LT9A 3P2VA 2BG5A 4UQ9A 2GSEA 4F8XA 2VXNA 3UETA 3NQ6A 2YZ5A 5AY7A 5DMYA 3ABOA 1W0MA 1DQUA 4Z2KA 2D22A 2PD5A 4CEXC 1IT8A 4QIUA 4ZQNA 3P5ZA 3CH9A 3IJIA 2ASHA 5G4HC 2WSYA 4CCCA 1EBGA 3UNTA 1FQ0A 4NIRA 1DORA 1NOUA 3KVJA 2RKXA 4GUHA 4HMDA 3GUGA 4R53A 2GK1B 2I1OA 1WBJA 4FR1A 3KL0A 2Y5EA 1RPKA 3CUZA 3FA5A 4PL2A 5HPOA 3WK2A 1U33A 3V36A 3GHSA 3S2JA 2ZXAA 1XPYA 4BF7A 1FDZA 3WNKA 3OOQA 5JQ9A 1ADDA 3NQFA 5G5IA 1OK4A 1K4GA 2QF8A 2QUNA 2VQTA 1NAL1 3L4VA 4NF7A 3BLEA 3W7NA 2QCEA 2FMNA 1H7OA 1CGTA 2NV2A 3CBWA 5D03A 3ME3A 1ZCCA 1GQJA 3LZ5A 1WBHA 5HULA 2VHLA 4CNPA 4NZ3A 5C54A 2PLCA 4TV6A 4TXEA 3W76A 3KBNA 3S1XA 5JBDA 1TA3A 5I00A 1H1NA 4MFEA 3CUFA 5CBIA 3VTRA 1E3XA 4ZMGA 4JEJA 5D09A 1PXGA 1JDCA 4DWSC 3B8SA 1XLBA 3REQA 3FFSA 1PTDA 4GYPA 1LP6A 5KEZA 2YXGA 3SN0A 3N29A 2FDMA 3GZ3A 1TJ0A 4DBSA 1XYAA 3LK6A 4C7GA 1N82A 1O12A 3SURA 3SQMA 1P6CA 2V9DA 4JZ5A 3SY8A 3TFXA 3TJXA 3GK0A 2BSLA 1V6UA 5K4XA 4OFCA 4LRSA 4QISA 4XZHA 5H6HA 3SW6A 1GOIA 1CW2A 3WSUA 4LB3A 2WM1A 2CYGA 5DLCA 1PZ0A 1JYVA 3EWUA 4C1LA 3G0XA 1FWNA 4EWND 2C1IA 1HJWA 3KCOA 4OT7A 1CI1A 4QLJA 4I9TA 3IUIA 3WUGA 2ZRXA 5BXPA 3F7JA 3SIMA 5CBJA 1IV8A 3A5FA 1EH9A 4LH8A 1V02E 3T4WA 4DX3A 1IXQA 2E9BA 4K1WA 4DWSB 4G8TA 8TIMA 1OC6A 1LJYA 1RK5A 3W29A 3B06A 1TCMA 3MB9A 1ML1A 2FZBA 3CAWA 4BF5A 2PEVA 1V0MA 1OT2A 4GD0A 4C6EA 1H7RA 1M7OA 2BY1A 1R0MA 2XZ7A 4WKAA 4B5WA 3A3WA 2PU1A 2VT0A 4H8NA 4F0HA 3DOPA 2PI6A 5FF2A 1UYQA 2UY4A 4JNZA 3BLPX 3REQB 1D7FA 1V08A 1VRDA 1E43A 4LYPA 4CU8A 2DZSA 4AVNA 4NKCA 3HTWA 6TIMA 1W3HA 4NJHA 5D2YA 3N25A 4L65A 3BVJA 4LYQA 4LUJA 3NEVA 4GA8A 2RJHA 3IK2A 1OVDA 3LV6A 5EMYA 1RY8A 5GPRA 2PTWA 4IIDA 1RHCA 2Q3OA 2QUMA 3BQ5A 3HO8A 1L8PA 4CQBA 2HBVA 4DO6A 6REQA 1YMYA 1RAKA 4GHRA 5E9AA 3SGZA 5AC8A 3LMYA 4X9SA 1DWGM 2Y4SA 5I6SA 8A3HA 2ZUWA 4OKDA 3LQGA 5KTLA 1A0DA 5LNWA 4J7RA 4Y6GA 4BCEA 3GUWA 1CT5A 5BOFA 2ZDSA 3P3BA 2YB4A 1DE6A 3HPXA 5GJNA 3QV6A 4JFTA 5FAGA 4KF1A 1KTCA 3S1WA 1OYCA 3UEQA 2XVGA 4W7UA 5CJNA 4PEEA 2G96A 1DQXA 3H23A 1H5VA 1I2NA 1O1HA 4XIMA 4DJFC 3TR2A 1XPGA 2QDGA 4JN7A 1REQA 3CAQA 3ZWSA 1JVNA 1UR1A 3VOFA 3EPNA 1AQ0A 4DO5A 4NX5A 3WUFA 3NA8A 3W6YA 2QUVA 3ITTA 3P61A 1ZAJA 1JQXA 4EVZA 1Q7QA 3HQ1A 2P88A 1KM6A 3K4DA 3FEQA 5IHSA 2RDTA 4RZ4A 4WCJA 1YADA 3S5OA 3B05A 2JE8A 1VB9A 3M0VA 4LEFA 5AC5A 1PIIA 1TX0A 3MY9A 3GNRA 3SCOA 4M24A 4GYJA 2HNHA 4KS0A 5A8PA 3L4YA 1C7TA 5HNRA 3Q2DA 3RLUA 2PWUA 4LY4A 2ESCA 3TNBA 3LCIA 2VGFA 2XVNA 1IZCA 5A69A 5FCZA 2RDWA 1J2BA 3O6DA 2VC9A 5KMYA 4PUDA 3KOZA 3LTYA 3LUTA 2HVNA 2HE5A 3TWAA 3OP2A 4O0QA 3R7MA 1PZ2A 1OCJA 2ALDA 2VOMA 5BROA 3UZJA 5EBAA 3UGRA 2IPFA 1DV7A 1K3UA 4G1NA 2E6AA 4ML4A 1JZ5A 1EJWC 4US5D 5REQB 1OYAA 4RKAA 3L4TA 1YIXA 2HXUA 1MFUA 4A4AA 4GIAA 2BGQA 1J8VA 2XJ7A 4UTWA 3S9IA 2ZDRA 2WC3A 4BQ2A 1BG4A 5A6BA 1E5NA 3H2NA 3TP4A 1KNWA 1H60A 1W9PA 4A8IA 1G7VA 4WOQA 2ZKMX 1BG9A 4YXGA 1UUOA 4JD4A 1OC5A 2YLAA 3PY2A 1KTNA 2NX9A 2QDHA 4GYFA 3WH7A 2Y88A 4IJRA 1D3GA 4XAFA 3RCNA 1R9YA 1NY1A 4KQNA 1GYLA 4HA4A 3W7HA 3GDMA 4O17A 1GVEA 4EPEC 1XBXA 2A2IA 4H6KA 1QNQA 5DRIA 2GGHA 1YQ2A 5HUOA 2G37A 1XRFA 4FNSA 4DPPA 3WKZA 4PMJA 4FLSA 1QPKA 3B0PA 3H2OA 3CT2A 1RQBA 1E56A 2OQLA 7XIMA 5DBTA 4FXJA 2VC6A 4HZ7A 1T40A 1R3TA 1JGIA 3T05A 4DBEA 2QS8A 1UA7A 1V02A 3GSMA 2C0HA 3WEOA 3K13A 4O54A 3IJLA 5CPNA 2DZUA 3CHEA 3K5XA 4QG6A 3T8QA 4G6CA 3M16A 1P7TA 4QTGA 1ZJIA 4O52A 1BXBA 1EUNA 4R85A 2QCFA 3ABXA 2GK1A 1OFQA 2Z6JA 1E6SM 3OW1A 4WDWA 4YWIA 4YCPA 3F4VA 1QHOA 1OGBA 2CFFA 1RCXB 3CUGA 4D6JA 3T4CA 3T0DA 1PTAA 4LRTA 5ECVA 4JX4A 2DZTA 2QW5A 2XSBA 1EC8A 1TTQA 3ANVA 5FJIA 5CJMA 4PTWA 1S5TA 2ISFA 1JYXA 4F0SA 3I4KA 3LRMA 3SFKA 3VK5A 3IGXA 3MBFA 1SSDA 1S46A 3JS3A 3CV6A 2Z27A 3EWXA 1XFBA 5IDIA 3AHYA 2PGEA 4O19A 4F3HA 2QXWA 2WZMA 5I5RA 2GOKA 4H4IA 1Q2SA 3TQVA 3HV9A 5K9DA 1TRIA 3F1QA 3NZGA 3AS0A 3WH5A 4ROPA 2HTMA 2YLLA 4PRWA 1SZNA 4PBFA 2QKFA 4UFLA 2PLKA 3GKAA 1H63A 2HDJA 1S2TA 4XD3A 3NXLA 3B04A 4LNYA 2PF0A 1IGWA 3CAVA 3M5XA 1IIGA 2BFGA 2C1GA 2HEJA 1OG0A 2PDPA 4GZEA 3TC7A 3NEHA 3EDDA 4GFSA 3VKCA 1LL6A 3IJ9A 5LXXA 2TAAA 1IWPA 4AWSA 3WIJA 4GG9A 1R7AA 1FWHC 4JIRA 2PDJA 3KZPA 4QJ4B 4QEEA 1V3LA 5XINA 3K46A 4ALDA 3DUGA 3GH4A 4CN6A 2OOGA 3HJEA 3NSXA 2IS7A 4OUEA 1ICPA 4JIPA 3SO7A 3H2MA 3D3AA 2C18A 4KERA 4XO7A 4V28A 1XISA 1HXJA 4UFKA 2A1YA 1VJZA 2C7FA 2A3EA 3R8RA 2DZAA 3TVAA 1A5SA 1YDVA 3WQOA 3DG6A 4AU0A 4JL2A 4P7LA 4Y8EA 2VEIA 5CZ0A 1Z48A 5BNKA 4IXXA 4ICMA 4S39A 3TYZA 1A47A 1Q85A 3K8KA 3QZ6A 4Z2GA 2XVKA 5A2AA 5F1UA 3IUDA 1E1EA 3EX1A 3M9YA 3BO9A 2PWHA 1GOQA 1YYAA 2Z1KA 3LEPA 2GJXB 2O0TA 4G7FA 1TREA 1UHVA 3VX1A 1A5BA 3EXTA 1AD4A 1FX6A 3W1UA 1OQFA 4HNVA 3N34A 3H2EA 2J88A 3OHIA 1R38A 4AD1A 3UYCA 1IYXA 3WJYA 4NI3A 2YBTA 1VBRA 3EDJA 2WVSA 1EB3A 2B0MA 4ZB0A 3ZWTA 3OU8A 1BF2A 2WANA 3ICJA 3A5VA 4XB3A 4JNMA 4LALA 1TZ9A 1US3A 3WK3A 1LQ2A 2WBKA 2E3ZA 2ZOXA 2ABAA 2IKIA 1H11A 4BEQA 3G8RA 5A5WA 1UUMA 3BMXA 3G22A 5DMNA 4KWVA 1HFBA 3TSDA 4AXKA 5HA7A 2BNJA 4FOUA 1O7AA 3ZXWA 1U2YA 1PKLA 3R11A 2QULA 4JGDA 4GVFA 1SQ7A 4HNTA 3GHTA 2P3EA 3E12A 5DCBA 1BHGA 4ORMA 2I14A 3E2SA 4ACZB 2WMFA 1G7UA 1OX4B 3UZWA 2DIEA 3A9IA 4RLIA 1M68A 2FYMA 1PCWA 1LOLA 1D8CA 1UQYA 4JQ2A 3EKZA 1JCTA 4IGHA 1UD6A 3AYVA 2DH3A 1T8XA 2WKLA 1O5KA 3T40A 3O7UA 4ASTA 4KT2A 3W07A 2VOTA 3ITLA 2PRHA 3RLVA 1ZLPA 3KP1A 4X22A 2BBFA 2ABBA 1J18A 1PZ1A 3U2OA 3M0YA 1AQMA 1X6UA 4NY2A 1K9EA 3GY1A 2IUZA 4XAYA 1RH9A 4NAEA 2PDMA 2VYOA 4LX4A 3CL7A 2I5QA 4MKVA 3WQDA 3RJYA 2YDAA 5LGZA 5I0DA 4PMYA 1UPPA 1J0KA 3BQ6A 3AHTA 4PBEA 3MW7A 2Y2WA 2PGWA 3ZMRA 4P5UA 2F2HA 2ZVRA 5E0FA 1TRDA 2OYKA 3PBUA 4MNKA 3VE7A 5D9PA 1QOPA 4EE9A 2YDQA 3N9KA 3TJIA 2PTDA 2VEKA 4Z1BA 3O0FA 1J10A 4IX0A 2VCAA 5E09A 3PSVA 1LG1A 3NM3A 5GNZA 5HMFA 4L6HA 4W7WA 5BU9A 1VFUA 5FJJA 3W2UA 1Z3NA 3LM7A 4J1OA 1A3XA 1NM9A 3AICA 4IG2B 4QDMA 3DDMA 2YSWA 3PWAA 2OKOA 3SQSA 2VURA 4U2YA 2PDKA 1LUCA 1WO2A 4ENLA 4HSHA 1GVSA 1B4EA 2F6XA 3HFTA 3JRKA 4PSPA 4WY0B 1XQKA 4AZ6A 4JXCA 2ZXBA 4O1CA 2ATSA 1GW1A 2P0IA 4GCXA 2A4AA 1ZENA 3AYTA 4CNNA 3SIZA 1I2QA 3CJPA 3PBMA 4GOAA 4IUOA 1QI0A 2V82A 1PIGA 4BA0A 1EJ7L 4C6IA 5C7VA 3EYPA 3N6JA 1TV8A 1W5MA 1EKOA 2NWSA 3WQVA 2DIJA 4K38A 2ZZ1A 3HBLA 1E5JA 1QBBA 1V3H