4LSBA

Crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
277
structure length
277
Chain Sequence
DLQARHAEAFRALHTRPGAFIIPNPWDAGTARLLAMAGFEALATTSAGYAFSKGQPDNAIDRDAMLDHIADLVAAGGLPVSADLENGFGDAPGTVAETIRLAAEAGAVGGSIEDATGRADTPIYARDASVERIAAAVDAARALPFPFTLTARCENYLHGRRDLDDTIARLVAYRDAGADVLYAPGITDADEIAAVTRAVGAPVNVVMGLQGGLLSLDELAALGVKRVSVGGALARAALGAFLRAATEMRRDGTFTFTQAAVPGRDINRWFAAPDNSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative lyase/mutase from Burkholderia cenocepacia J2315
rcsb
source organism Burkholderia cenocepacia
molecule tags Lyase
molecule keywords lyase/mutase
total genus 107
structure length 277
sequence length 277
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 4lsbA01
4IMAA 3SRKA 4LSBA 4IQDA 2WQDA 1XG4A 3ME3A 4IQEA 4KCVA 1OY0A 1SGJA 4QG8A 2VGBA 3QTGA 3QV8A 4QGCA 1M3UA 3GQYA 3QQWA 1XG3A 3BJFA 3OYXA 3HQNA 1O5QA 1PKNA 3I4EA 1VBHA 2G50A 3E0WA 3PUGA 4WJ8A 4L9YA 2E28A 1PKLA 3G2GA 2QIWA 2XZ7A 1S2TA 3VAVA 1E0UA 2HRWA 1ZLPA 3QV6A 4YJ5A 3QZ6A 1A49A 3N25A 1U5HA 4KS0A 4B2DD 1U5VA 4JPGA 1DIKA 1T5AA 4MG4A 4KRZA 4RPPA 3H6OA 2VGFA 2XZ9A 3QLLA 3IS4A 1A3WA 3FA3A 1UJQA 1IZCA 3LYEA 4DRSA 2HJPA 1S2UA 2L5HA 1F61A 2V5JA 3E5BA 1VBGA 1M1BA 3EOLA 4B5UA 1F8MA 4MF4A 2XDFA 4KCWA 3FA4A 4ROQA 3QV9A 4B5SA 3M0JA 2ZE3A 3SRFA 1DXEA 4HYWA 1DXFA 1O66A 3E0VA 2OLSA 2VWSA 4TV6A 3EOEA 3SRHA 2V5KA 3LG3A 3MA8A 4KCUA 2DUAA 1S2WA 2X0SA 3B8IA 3T0TA 1KC7A 1A5UA 2VWTA 3GG8A 3OYZA 1MUMA 3HQPA 4FXFA 5JVLA 4B5WA 1PKMA 4L80A 4FXJA 3GR4A 1AQFA 3P0XA 4B5TA 3EZ4A 4QG9A 3SRDA 2R82A 3U2ZA 1S2VA 4HYVA 1GGOA 3PP7A 4QG6A 1KBLA 1F3XA 2VGIA 4IP7A 1IGWA 1Z6KA 4YNGA 3T05A 4L7ZA 4KCTA 4B2DA 2DIKA 2KX9A 4TV5A 1E0TA 1F8IA 1PKYA 1PYMA 1ZJHA 3QV7A 3R4IA 2HWGA 4B5VA 3OQ8A 3HQOA 4B5XA 2VGGA 1DQUA 3KTXA 1F3WA 4L9ZA 4G1NA 1JDEA 2BG5A 1A3XA 1O68A 5TAOA 3EOOA 2HROA 3T07A 3BJTA 3M0KA 1OQFA 3KHDA
chains in the Genus database with same CATH superfamily
3G0UA 3SCUA 3PZIA 4ICMA 3WLRA 5G4WA 2PRLA 2VGBA 1F7BA 1POKA 1S3HA 1CXEA 2ALRA 1TFVA 1H41A 3N2TA 4Z1YA 4E2VA 3CL8A 3B3DA 4MLRA 1WZAA 3LM7A 1W1YA 1RZMA 2PGRA 3D0CA 3UETA 2IKJA 5I77A 4GH1A 2WSPA 3W7IA 1QT1A 1SJAA 4I7UA 1ZJBA 1XRFA 3B9NA 1S3TC 1VEOA 1VH7A 3MP4A 1BRLB 2J4GA 3M64A 3WBEA 4LNCA 4C7DA 4UTLA 1UA7A 3S42A 1FCVA 2OTDA 3CWNA 4U4MA 3K13A 1G5AA 2F9RA 7TAAA 3UPBA 3G6LA 4L56A 1TJRA 1KBIA 5E9AA 2J7BA 1YKWA 2BVDA 4GUJA 3QMRA 4YVXA 2NQJA 3OYZA 1O5RA 4NT0A 2Y70A 4AIOA 1P5BA 5DBTA 1R2TA 2NQ9A 3NA8A 4JTGA 3NQ6A 4TV5A 3NWRA 3BLDA 3WLLA 3KZPA 3EXTA 2QPXA 3N9RA 5I6SA 2WCGA 3AYSA 2WZMA 3QEZA 4N9CA 2Y6ZA 4NP7A 3H54A 3RR1A 2WZHA 3CH9A 3V5CA 4MDOA 4GNKB 4KERA 3GIPA 3WD1A 1YEYA 3DFSA 4MY9A 5C2XA 3JVAA 4PYSA 2JEPA 2Z1WA 4Z0SA 2Z24A 5CSUA 4GG9A 5BMXA 3M0XA 1US3A 1MUCA 5H6HA 1MFUA 1PDYA 1OYAA 3CUHA 1BVNP 2PBOA 1FWEC 3EX2A 4JPGA 3RU6A 4K2SA 2Z28A 1NVMA 2Z1VA 2OU4A 1EXPA 4JEJA 1Q8AA 1M7OA 2HJPA 2UY2A 3RN6A 4MF4A 5AYYA 2PDBA 4M0XA 4BCEA 4HNOA 2Y8VA 4GZ7A 1MW3A 2YDAA 2A4AA 2EG8A 5I2UA 2DY3A 3W7KA 2PZNA 1TWDA 3FSTA 4H9ZA 3LXBA 4QLLA 4M82A 4G7EB 3VGBA 1TPB1 1WCGA 1V6VA 3WQPA 3BZJA 4KGJA 3WLQA 3DFOA 1FKXA 1EB3A 2GFTA 5G2WA 1OFOA 3K46A 1WDPA 4OWGA 3GYCA 1MQRA 5FSDC 1HUVA 3GDRA 2ZX9A 4WSJA 3BLOA 1UZHA 3VINA 4AZ6A 1N2VA 4MGGA 5DCBA 4N6FA 1KGXA 2BGSA 4S3JA 1TE1A 1Q6LA 1HJSA 2BODX 3N04A 3PUDA 1TE6A 1TPDA 2UY4A 1X1ZA 2O92A 1XGEA 3PNUA 1E6RA 2ZWYA 3GH4A 2AQOA 5FIPA 4MZ1A 4OOUA 5HPOA 1AJ0A 1A49A 4PZVA 3SCVA 2XIIA 2VEIA 2DZPA 3ARYA 2XPKA 2VEPA 4FNUA 1QTWA 4TVDA 3H2EA 1ZALA 1GVQA 4N0RA 3RLGA 1ODZA 2NX3A 1CX9A 3RYSA 1E4MM 3II1A 2E6AA 1F4HA 3FA5A 1UKOA 1GQLA 3OG3A 2VTFA 1LL6A 2HMCA 4UZUA 5IXEA 3AS0A 4S3DA 3VNLA 2PRHA 4J3UA 2Z1BA 3B8IA 2QJJA 4IIFA 2R1MA 2E0PA 1FH7A 4PSRA 1RV8A 3MU7A 1QNPA 4ERGA 2DZSA 3GTIA 3HGOA 3LQGA 1V0LA 4PH6A 1XUZA 4DIAA 4Z1CA 4AEOA 1TPH1 3LS9A 1THFD 4AISA 4HU8A 4FHAA 4GX8A 4X60A 4FX7A 2DJLA 5BZAA 2XUCA 2O9OA 5G1TA 4IMCA 4RNHA 2XISA 3IIXA 3FVMA 1TRDA 1VCGA 4E4FA 1SMDA 4JQAA 2WMIB 3W4RA 5HPCA 3M43A 4FA3A 1AZ2A 3VZZA 4AMAA 4O0ZA 3UJRA 4L61A 3B0YA 3LCLA 4HU0A 1LP6A 1LG2A 4AZIA 3WMLA 3ZSSA 3WK2A 3O07A 4Y9AA 1U33A 2P50A 3HPAA 1XINA 1TO3A 2B7OA 3V1PA 3GUWA 2VCBA 2HPIA 2YJQA 1WZLA 1JAKA 3W83A 5AVNA 1TYGA 4Q8VA 1ZL1A 3GXFA 2VKZG 3SIMA 3TQVA 4H8NA 4WQ6A 5I5RA 5FJUA 2PTYA 2PB1A 4LF1A 4XKMA 3RRAA 2PDCA 4JIRA 4A35A 1UR9A 3WQWA 3H70A 1NWRA 4ML4A 2YPIA 4PN2A 4LVDA 3RPTA 4QHRA 4HYWA 1OABA 3B4YA 5IBXC 4JTEA 4JTRA 4KFOA 3EWYA 1OT2A 2VD9A 5CSSA 1OADA 5PTDA 5EMMA 2VURA 3QR1A 2Y61A 4C6EA 5XIAA 5AC6A 3NO1A 3W1LA 3SCWA 4QIUA 2NV1A 2YKKA 4CLMA 4WEVX 3WDQA 1DORA 2ZRYA 1JYWA 3KCOA 5CG7A 5IHSA 3O6DA 2FFCA 4LVAA 2GGEA 1JF5A 2FKPA 5D32A 4BY3A 3EB2A 2VFHA 1EXBA 4LAMA 1GK8A 4NAEB 3NL2A 3VNMA 2CEQA 3SCOA 1M68A 4URIA 5MF5A 5IFPA 4HTYA 3C0QA 1PS9A 2ZCGA 3PFRA 3H24A 1RJQA 3DIPA 2ON3A 4HNTA 1J6OA 4LYRA 1XPGA 1FWTA 1CDGA 3NL5A 1FWJC 1PL9A 3BV7A 4CNUA 2H9AA 1GORA 4DZAA 4GQBA 5T9BG 3G6MA 3NOEA 4LWWA 3AXMA 1MW2A 4HZ6A 4W87A 3MUCA 3AIWA 2B0MA 4QBXA 2IPWA 3MJMA 5H2ZA 2I5QA 1NOFA 2EAWA 2Z2AA 1B1YA 4A4AA 4S39A 3V4BA 2ESCA 3SGUA 2O55A 2GYIA 3PY2A 5FL0A 1FWIC 1T8XA 3WQFA 1TZ7A 3KZSA 3SB0A 3CHCA 5KSWA 1GHRA 5E5CA 3M41A 2AGTA 3RO8A 4US6A 3GFYA 1MWOA 1E9YB 2R82A 3BQ6A 2OGYA 4S2BA 1PIFA 3H8AA 1R9YA 1DJQA 1W54A 4AEEA 3NUKA 4B5NA 3P5YA 4QLJA 1H11A 1XLKA 3PWGA 4IMDA 5TQLA 3GRIA 2CLPA 2ZRWA 5DRCA 2A3LA 3O2LA 5DEZA 3CLMA 1FCQA 2V3DA 3W84A 4DBWA 3C2YA 1TPWA 2Y89A 5C0QA 5K2ZA 2RFGA 3A21A 3U2CA 5AHNA 5K9CA 3ATZA 4K1WA 2X16A 1V77A 1I9CB 3W53A 3A4JA 1F73A 2NT1A 5BXRA 1CTNA 2VCAA 4JL1A 6XIAA 2YR1A 3AQUA 3BLPX 1GOIA 3WLMA 2X05A 2X7VA 3SCSA 1B54A 3NCOA 4XAGA 2PGFA 2CLHA 2QF7A 3LGDA 2NWRA 2PDHA 3F5JA 4GIEA 1J0IA 1VJZA 2ZXAA 4LB4A 4CN1A 3JUGA 3K4AA 3T2QA 4ERAA 4ZQMA 1SYTA 3OVGA 3O6CA 2AKZA 3CK5A 1P0DA 1PCWA 4U5IA 4R9OA 1P6WA 1FWRA 3WDIA 5ENLA 4QE4A 2WC3A 1H49A 2IKHA 1FDZA 2QCMA 1YDVA 1DJZA 4L4LA 1RVGA 3TEVA 1XH1A 3OGRA 3HPFA 3KL0A 2QUTA 1GWJA 1Z69A 3REQA 4L1GA 3SCTA 5A95A 3KRBA 3A12A 3B0XA 4YNGA 2WZEA 4Q33A 2B7NA 1UR1A 5EMKA 1BGGA 3D3FA 4MUZA 1SFJA 3LLDA 3P80A 4MKSA 3QSTA 4HU3A 5G4EA 2RDWA 3IAQA 2PRMA 4KESA 1UKSA 5K9DA 3W2UA 3L66A 2XVPA 5CPNA 2VC9A 4ZEPA 1B0IA 1J10A 5HMDA 3TVAA 1D2KA 3NURA 1OFRA 1MRQA 2HBXA 2RDTA 3WF1A 1KM6A 4CD8A 1LORA 1W9VA 1OGSA 3GR8A 2GSHA 4MWAC 1KFBA 4WCJA 1GVSA 1LCOA 1BWKA 2GJPA 5I00A 2CLIA 2Q8ZA 1QI0A 2QUNA 2OX4A 5EBUA 4NZ3A 2BTMA 1QI2A 3BG5A 3VMPA 1BRLA 1NM9A 3E2RA 4U3CA 4HK6A 2OODA 2ZZ1A 1OT1A 3CTTA 1KCXA 3T1GA 1S1RA 4GFSA 5REQB 2WVVB 4ZOCA 1V6UA 2FZDA 3VX1A 3GO2A 2TYSA 4KWOA 2CLKA 1X8FA 2BXZA 3TUUA 6ALDA 3FY1A 3DXIA 3WJSA 1DWIM 1YPIA 2ZZ3A 2OZ0A 3KRUA 3F1QA 3LHZA 2QCFA 1ZCOA 8XIMA 2WBKA 4HPHA 2P53A 3CMGA 2OZ8A 1KBLA 3IIOA 4EVZA 1EHAA 2QCEA 3W2MA 5HMFA 3I3DA 4QLKA 3SFKA 2FH8A 3TN6A 3ZQ9A 1XYZA 3MQTA 1RCQA 3U0HA 2FB2A 3CQJA 3HGSA 3K4WA 1RBOB 2TMDA 1JDEA 3DC8A 4Y9NA 4ACZB 2WPGA 1NELA 2ISSA 1GVFA 1GZJA 5HK4A 1R7OA 5D8ZA 3VGGA 4R33A 1E5NA 1S38A 2VR2A 3OZMA 1FWDC 1CLKA 5C9XA 3W38A 2OJPA 1OC6A 1UWIA 4Y7EA 4GISA 4XG1A 1VYSX 5DQPA 2XGIA 5CLTA 3RXZA 3NQMA 4Z2IA 3ABXA 3DG3A 3VAVA 1D8CA 2BOFX 4X9SA 3LI1A 2PP3A 2J7GA 1R3VA 4OUEA 3P8JA 4Z17A 1EJXC 4UQEA 2OT1A 3R43A 4QM1A 1TVPA 4A8IA 1LL4A 5JXQA 3F03K 1Q6EA 2PTWA 1MRAA 3LDVA 3N6JA 2H3DA 4IFKB 2FPYA 1SW3A 4PRWA 1W56A 4OT7A 2RAGA 2ZTJA 3GW3A 4NXSA 1KC7A 1DIDA 1O5XA 4JN7A 2CZDA 3MBDA 1KXQA 3USZA 4IUGA 4EPDC 1ODUA 1WAUA 5BOOA 3P62A 2CYGA 1IZKA 3MMDA 4W8AA 3O63A 3GXMA 2A6LA 3W7LA 4KFNA 4DXXA 1H60A 4NAFB 3BPWA 5C6MA 3BAXA 4N2YA 4CNPA 3UNDA 4B5XA 3PM6A 1HKVA 3LZ5A 3NQFA 4IH3A 2J8FA 4QP0A 4UR8A 4UQAA 3VM7A 3L5AA 1GW1A 4E6MA 4LAOA 3M0KA 3OB8A 3CV2A 3RJXA 1FKWA 1WUFA 2FVMA 7ODCA 2CITA 2CHNA 2XH4A 1GHSA 4DWSB 1JDCA 4PMUA 5DN1A 1P0EA 3AIUA 1V79A 1ONRA 1C8VA 2WCAA 4IIBA 3VILA 4HN8A 3QQ0A 3QF0A 4YS1A 2PDIA 4MWAB 3QFEA 4RZ4A 2PE4A 1ADDA 1MDLA 4V1XA 4IWWA 3GIQA 4W9TA 3L4YA 3UJSA 2E67A 3S2NA 1UD6A 1F8MA 3HTWA 4WDUA 4E5TA 3SAZA 5AHEA 3OLGA 1EIXA 3QKZA 3DFPA 1FDYA 3SECA 1SFTA 3A22A 2A5HA 3L9CA 2DSZA 2VWTA 3MV01 2VL4A 4P7RA 3QZAA 3DYMA 3URAA 4AMCA 4J9JA 3VIMA 4AYGA 1UKPA 4TR9A 3AYTA 1REQA 4C1NB 1ISXA 3FDGA 4GVIA 4LUJA 1HO4A 3W76A 2BY1A 2C1HA 3COTA 1IHIA 4QE5A 1JZ5A 4INFA 3IJQA 2J7FA 1NSJA 1K7FA 1NDVA 3HF3A 1CYGA 4GJJA 3W1UA 4OOZA 2WYSA 4GZJA 3K8MA 3KRZA 3NPVA 1L9WA 4GMEA 4H9XA 3C0LA 1VEPA 4FNQA 3HOJA 3E02A 3URBA 3MO4A 1MMFA 4RE3A 3LMZA 5CPSA 1RAKA 4IGSA 5FJOA 1ME7A 4UR9A 3WLPA 3V3WA 4K8GA 1N7KA 3MI2A 3GB6A 3LN3A 1XV8A 3P74A 2RGLA 1Z7AA 2ZVIA 2CLLA 4A3HA 4XUGA 1BTMA 5EPDA 3NXLA 4NZJA 3H21A 1BVWA 3LX9A 1K9EA 3M7WA 1ZNNA 5CSYA 3QV9A 5J5DA 4GCXA 3OIXA 3TU9A 4ZTYA 5FI8A 1KFKA 3IVSA 3AIRA 1OD8A 1W1VA 1XIEA 2VZOA 3N11A 4K8HA 4DJDD 2ZUUA 1P6CA 2I9EA 1BKHA 4EF9A 3L2MA 3GVQA 2V2CA 3QHMA 4PTVA 3U9IA 2GGHA 1JVNA 2NVCA 4GO8A 1HJWA 4QJ1A 1PZ3A 1A4LA 4WSHA 4P8UA 1EYWA 4Y2WA 2AQVA 1VBRA 3S5YA 3GLCA 2A7NA 2FDMA 1UUMA 1XC4A 4PMVA 3T07A 4J3XA 1JEZA 1EOMA 4ZE5A 1UR4A 3LERA 2CBVA 1ESWA 5FJRA 4F40A 4WZHA 1XICA 2PC8A 4Q6JA 2XZ7A 2AAMA 1XIIA 4GKLA 2J7HA 5HUPA 4CEXC 4H1ZA 1DIKA 1TIMA 3L4TA 1QMLA 3ZJ8A 4TU1A 2VX4A 5F2GA 1BAGA 4D71A 4QFUA 2BBFA 4UQCA 3HIJA 3VTRA 4K3ZA 5BNKA 1V3JA 1VIWA 1VFSA 3W23A 3HB9A 5T26A 1J8VA 1Q5MA 4QCFA 1BWVA 3HQPA 2HVOA 3BOXA 1C7TA 3NDYA 1EUAA 4DF2A 3N15A 5EFFA 2XINA 2FMOA 4UQ9A 4FLSA 3C2RA 3N2OA 3BCJA 2GUUA 3TSBA 1WA3A 1F74A 2W66A 1Q6OA 2CESA 2F8QA 4KPLA 4AFYA 4GQ0A 1W3JA 1QNVA 3UNTA 3OA3A 1OVDA 2J62A 5JUVA 4LYQA 4HJFA 3ARWA 1A5SA 3WQGA 2ZZ4A 1YX1A 2Y7EA 5D2VA 1XI3A 3W01A 2DZTA 4PC8A 1P6BA 1EBHA 4REQA 4B4HA 4NNBA 4MWAA 1V6XA 3AS3A 1UW9A 3BCDA 4AZBA 3S8HA 3FYYA 2E3ZA 3U6WA 4O8AA 4GUGA 1UP3A 3HJZA 5HQMA 2WHJA 1HGWA 1IQ8A 1JUEA 1W91A 1J96A 4WKAA 4D6CA 1FWNA 2XSBA 3KS6A 3YPIA 4OBRA 2A7RA 4GVGA 1BXBA 1QXLA 3EKGA 1XD1A 1WKYA 1K9DA 2G5WA 3DI1A 3TW9A 1IXPA 3O3RA 1UZ4A 4DXKA 3VM5A 4LUTB 4D2JA 4CCCA 3UR7A 4JTTA 2MUCA 3NZPA 4OIFA 4O4WA 1K9FA 2WW5A 3HV8A 2E9MA 1GJPA 3WJXA 3M7SA 3W85A 3W88A 3EEZA 2UV8G 2XJ7A 1V02E 4A3RA 4AD1A 1S5TA 2D2JA 2WKLA 1MXSA 3APTA 1R7AA 3ZWSA 3CHVA 3F4CA 1IF2A 2QJNA 1K4GA 1CPUA 4OBTA 3O06A 3A3WA 2Z0IA 3U7BA 3USBA 5D33A 2QZRA 1AG1O 2B31A 3TCSA 3HQ1A 2Z29A 4YN5A 5D8WA 1UP2A 4KWVA 1GG1A 5TAOA 4P61A 4PTMA 3CV6A 2GZXA 2Y63A 2OQHA 2CZ5A 1RQEA 4GNVA 1XYCA 2AOSA 2C16A 1IT7A 2EHHA 1XSJA 5DMNA 1MVYA 3MHUA 1VJIA 5AKQA 1KWKA 1LBMA 1Z8AA 5DMLA 1MI3A 6A3HA 4XIAA 1US0A 2O9TA 3SW6A 3IPWA 4V27A 1J2BA 1VLIA 3WDPP 4UXDA 3GC4A 1OCBA 3T4WA 2WM1A 4YVPA 1K77A 1G69A 3LCGA 2VFIA 1VPXA 4JL2A 3ZJKA 3UG3A 1A3WA 5LNSA 1EP1A 4UTTA 5DELA 1XQLA 1ZSXA 1QCWA 3NL6A 4EPEC 3NZQA 3BG3A 4X9YA 1FVPA 1D3HA 4XAZA 1Q13A 1EDGA 1TVNA 4JY8A 3BAWA 1HP4A 4R5EA 2W63A 4JS3A 1N8IA 1YPFA 2CU0A 2H90A 2WZTA 2QXWA 2Q3OA 1QWGA 5KETA 4DF0A 2FIQA 1VFLA 4QS5A 1JCXA 1E0TA 1TWWA 4D6HA 3WQ8A 2ZKMX 2IXUA 3N9KA 4H6EA 4S3AA 4AIUA 3EEGA 3KBJA 1W9DM 4G1NA 5H8PA 3M4HA 2Y0FA 3VCNA 3PZTA 1ZHAA 1IZCA 1OIMA 1TELA 3NDZA 3AMLA 4RDWA 5G5IA 2J13A 3LD5A 3TV8A 4DZHA 3B0PA 3GW0A 3ZSTA 4MNKA 4F0HA 4P8VA 3DN5A 3IEBA 3FEMA 3XINA 1ZLPA 3NO3A 4FPSA 1GKRA 4H9UA 3P3BA 3I65A 4KRZA 2VRQA 4EX4A 4D9PA 3BCFA 2VHLA 1J0YA 2O7SA 2DSWA 1SUXA 2DIEA 3QHNA 4DBEA 3BARA 3WF3A 1XLIA 4ATWA 1XF0A 3SIZA 4FSAA 2WM0A 5BW6A 4B5SA 4NILA 3IJ6A 1P0KA 4GA8A 2R14A 3S6TA 2XFYA 3UBPC 3QPYA 4C6CA 2ISDA 3KOXA 2VQTA 2NZLA 3UT0A 3LBCA 1OF6A 5LIUX 1W1IE 1BWLA 1UPPA 2R1KA 4E8GA 4WLCA 3CZLA 1AQFA 3CHFA 2VRKA 1KXVA 1E9IA 1Q65A 3GG7A 2ZQ0A 3M46A 2CBUA 1UH4A 2RDXA 2ACUA 4HOWA 4OHQA 1E6PA 4IMEA 1F8IA 3R4IA 1PCKA 4F79A 2ZX8A 5AC5A 1MW0A 1PE1A 3WQDA 1EP3A 5I79A 4KFPA 5LIYX 4IHCA 1WDDA 3WELA 3P67A 5LA1A 1E72M 1BXCA 5GQBA 4WY0F 4MUPA 1KV5A 3I4EA 2G95A 2E28A 4M6PA 1YXCA 2ZUSA 1V93A 4HPXA 1JZ4A 3MVIA 3GZ3A 4PMNA 4UFHA 5C55A 1GYNA 3ZT6A 4R34A 1W1TA 3LI0A 4PUMA 3VCRA 1LTDA 5DY2A 5I07A 3FA3A 3TYCA 4YCOA 4I9JA 1QPKA 7A3HA 3LCIA 1R3QA 4ZTXA 2DQXA 4UOJA 4GX9A 1GYMA 3WK3A 4MKVA 5AECA 1GQNA 1PPIA 4CCZA 1SFSA 4A05A 1LLZA 1YW1A 3W24A 3K5XA 4XSMA 1GOXA 1KFJA 3AZTA 2BVTA 2DU2A 4F2UA 1RPXA 3LNPA 1AJZA 3N6HA 1P0BA 4CNTA 1T7LA 4IQJA 2XWEA 3NAVA 1BSIA 2Y5SA 3ARXA 4Q8NA 1XL9A 4JTUA 1XFCA 1PKYA 4BI5A 1JDDA 3V5OA 4FR1A 1SW7A 1SO4A 5AZ1A 3A4WA 4EANA 3G1SA 4XAFA 4KRTA 4GQQA 1ZJAA 5XINA 3G1AA 3NR0A 1QBBA 3G0SA 3W28A 2YCLB 4L9XA 3SRKA 1FDJA 1ADSA 3ID7A 1LROA 1E6SM 2ZVRA 2GJNA 2R91A 4HNCA 1F9CA 2Y7DA 1KRCC 1YE4A 1KFCA 1YHTA 4XTIA 3DFQA 2VFEA 3LHVA 2ZA3A 4WOQA 3U2EA 1MFVA 4HNVA 2CNCA 2GUBA 3T55A 3MKVA 1X6UA 2ABAA 4H9MA 2GGJA 2HBVA 3R89A 2DZXA 3NNTA 3M47A 1JULA 1E9LA 5AYIA 4MYAA 3UQNA 1RJRA 2DVXA 2NUYA 2OLHA 4EKJA 4F8XA 2DZVA 5A3HA 4L1XA 1PYFA 5FEPA 4BF9A 4GLEA 4U28A 4POCA 4YCPA 1SO3A 2A1YA 3PBWA 1R2SA 1EH9A 4JTDA 1SW0A 3CL6A 1P7TA 4JGDA 3W73A 3DEQA 3GH7A 4L6OA 4AVNA 1KM4A 1D8WA 1WB0A 4GPNA 1ONEA 3A4AA 3OA5A 3B8SA 3THQA 4MSSA 4OZOA 3F4WA 2C1GA 5A6BA 4E3TA 3HZ3A 2DVUA 3H2AA 1S5WA 2C7FA 3XISA 2WV8A 4A29A 1QPQA 3KAOA 4NIRA 5I3KA 1WUEA 4UC5A 3AHYA 4JFTA 4MFDA 1LQAA 3H4WA 1Z48A 3GHSA 1RCOB 4U5KA 2IW0A 3WEOA 2FZ8A 2NT0A 3DENA 4FNSA 2E5CA 2WMGA 1WAWA 5HAOA 4LV4A 4MJ4A 2ZZ2A 4MADA 2ANUA 1XYBA 3CB8A 1QR7A 2IMRA 1KM3A 1XYMA 5HWMA 4JCMA 2E1WA 3W3OA 3S9IA 2ZUWA 3FKKA 4DO7A 2RHGA 4JIHA 3AMGA 2X2GA 5F1VA 3FDKA 2F2HA 4BQ2A 1U30A 3FN9A 3OZOA 2NXIA 3TH6A 3TN3A 4NRRA 3VOJA 1H1ZA 3BJSA 1SZEA 5LA0A 1O95A 1QHOA 1S2UA 1CNVA 1K8XA 1XJBA 1PHWA 1O5KA 1XGDA 4Z2HA 4IMGA 1C91A 4J7RA 4ERIA 1SSDA 5BOEA 3TA6A 2V9DA 4R53A 4W85A 4UIOA 4QNWA 1VQTA 1TX2A 1ZUAX 2E09A 4E0CA 3WEMA 4QRNA 3OPSA 1E6NA 3SQSA 1DKWA 2HISA 1BLIA 3HFTA 1A5AA 2OO6A 4IIDA 4FAMA 4B5WA 3ITVA 2WJEA 5FEWA 4NJHA 2QMKA 3N3TA 4ZGYA 1NTHA 1S2AA 1JQXA 4ZE4A 1U1HA 9XIMA 2HE5A 3T4CA 4AC1X 4HMNA 2I5GA 4NX0A 1EYEA 1OFPA 1ZB5A 1H0IA 3GTHA 2VRJA 3WQVA 3WY1A 3GVRA 4LS0A 1LQ0A 4HA4A 3P93A 3UXKA 3VK5A 2Y7FA 4ZFMA 4HTBA 3E0FA 1QI3A 5CJ5A 5M17A 2V0TA 2X41A 5KTLA 3ECQA 4IX2A 4WY0A 4BR1A 2G50A 3KVKA 3FV9A 3QGKC 1JFXA 1Q4WA 4M80A 3T2PA 4GQGA 1XBVA 1EJSC 1MZRA 1CGUA 2VOTA 3BXWA 9XIAA 4B9YA 1BYAA 1UR2A 4WD0A 4N4PA 1K7EA 4AQLA 4UFMA 6PTDA 2ZICA 4TOQA 2DT3A 2JEQA 2NQHA 1DHPA 3M0YA 1WO2A 3V18A 1FOBA 3EMQA 4Y9MA 2GJXA 4LOCA 2VEKA 3U48A 1XLGA 3PTKA 4DYKA 4A3YA 2VZVA 3LSBA 1EJ7L 1GTEA 2FJKA 1B5TA 3PHAA 3G1FA 4GI9A 4WUIA 1RH9A 3LCFA 2E6DA 2RJGA 3CZGA 1KBKA 1RD6A 1G67A 2NX9A 5HJXA 1H5YA 4LC6A 1I2QA 2V6AA 3UXAA 2JGYA 3VI2A 2YA2A 3WLTA 4RXFA 3H2FA 3N73A 5CXPA 3TN4A 3GU2A 2ICSA 5JBDA 3I3BA 1V5XA 5JIPA 2ATSA 4BFAA 1Y5XA 4M6QA 3ARZA 1G4SA 1JJKA 1ZTVA 4NUWA 2JF6A 5EU9A 3AMKA 5DF0A 4JXCA 4HCHA 4C6PA 4MWAD 2AL1A 3L68A 5CC6A 3OQEA 2F6KA 1ICSA 3TTEA 1OM0A 1QOQA 2HS8A 3OYXA 3PJTA 1O5QA 1VBHA 1DJHA 4PB5A 2GSJA 2VFGA 1TG7A 3MWCA 1XC6A 6ENLA 2E4TA 1IIHA 4C91A 3U5YA 2VFFA 3AU6A 1IZJA 2PC4A 2IS7A 3ARSA 4NXKA 4B15A 1L8NA 1UASA 1R2RA 4OUIA 4UTIA 1H61A 1T41A 3FA4A 1XLAA 4ONVA 1LOSA 1VS1A 3MT1A 2QLYA 2RUSA 2FZMA 4PE8A 4J3VA 3CWHA 5BXSA 3S83A 4OKDA 5I0DA 2GSEA 3V7PA 3VNYA 3NQGA 1QPOA 1GOWA 4YTTA 3UWQA 3IAPA 1C8XA 4OFCA 3PZ9A 4ZB2A 3FOKA 3BANA 2X1IA 4S3KA 4H2HA 1X39A 4EE9A 3GNDA 2D22A 3BUVA 5K9XA 2DT1A 1B2YA 2XVNA 3NL3A 4YU1A 2D0GA 3LSCA 4J1OA 2QVHA 5M5DA 1A80A 3NOYA 1OC7A 1YTKA 4ZB5A 3MMUA 4NASA 5L6UA 4Y9OA 4TIMA 1VRXA 2QJIA 2MNRA 1AFSA 1TV8A 1JPKA 4Q4OA 3LB0A 1FXPA 5MKGB 1IGSA 3NSNA 4EIVA 4AAJA 2E7FA 3O6AA 4GYFA 4L5ZA 4LY4A 3PF3A 4DUOA 4BA0A 2J88A 1V0NA 4LC8A 2PF8A 1K02A 1WKFA 5MKGA 4S3CA 3N13A 1C9DA 1DE6A 3W7QA 1UD2A 3OTRA 5DCDA 3MSRA 3MYPA 4Q4KA 2C15A 3AHTA 2QULA 1BKSA 1NAL1 4F9DA 4YIWA 1KFEA 1IEQA 3S6DA 5I09A 4NNAA 1R30A 2TAAA 4UFLA 5HANA 4N9EA 1R86A 4NYUA 1TRIA 1KXTA 3DGRA 3FJNA 4IFOA 1BG4A 4LQ1A 1EA0A 5CZJA 1IEIA 3TTSA 3QZEA 4MY1A 4WR3A 2YYUA 1IIGA 3EOSA 4NI8A 4JBRA 3VKKA 4TO8A 2NVDA 4TX6A 4W8BA 3QY7A 1AUSL 2DSKA 1KLYA 2WJZA 5LNRA 1K6WA 4X0VA 1D7FA 3BVJA 4RDYA 1BHGA 5D38A 1HVXA 4HU4A 4YXGA 3HMJG 3RJYA 1ITUA 4AF0A 1EZ2A 1QO5A 1TZZA 4H8HA 8CGTA 1OYCA 4A21A 4J3WA 1PJ9A 4E2DA 1DHKA 2RGMA 4L9YA 1YDYA 3LLXA 3ANUA 4LH8A 2C0AA 2XIJA 3ICJA 3N4AA 1KTNA 3T8QA 5C8BB 2OOGA 4JEQA 1U1UA 2OSXA 4UQDA 3LLFA 1SO5A 2E1DA 3ZR4A 4B9ZA 4CQDA 4I90A 5JIWA 2FPVA 3VYLA 1F4AA 4DB7A 3T9PA 1GW9A 1XHGA 4E2OA 4C90A 2H6RA 4LT9A 3QC3A 2V30A 2ADAA 1J01A 4BWLA 4J35A 3ZR5A 3QY8A 4FNPA 2BDQA 2BHYA 4X22A 1KM0A 1O1ZA 3SRDA 3AXIA 5DFAA 3ANYA 4M7TA 3T05A 4B2DA 4FOJA 3RLUA 5B7YA 2IKGA 3AAMA 2YDRA 1I0DA 3EWDA 3OGSA 5HNUA 3VC6A 3CLWA 2H3BA 1KNWA 4C7GA 1MUWA 3ZMRA 1JI2A 1LRTA 3ATYA 4HQVA 4PFHA 4PGLA 2FGBA 1I1XA 1MYRA 5I7GA 1UR8A 1EJUC 4KH2A 5C9WA 3O1NA 3PZUA 5IHRA 1B3OA 1UWUA 4FO4A 3TMQA 8RUCA 4KS0A 1ZAJA 3NQ8A 4DYEA 4IFKA 4W84A 2OWXA 3CV7A 3O0KA 3SFWA 3JZUA 1JDFA 5D02A 4HCLA 4Y6GA 2RH9A 2PZ0A 5FJPA 2EPOA 3NSXA 2P1FA 3PG8A 1J5SA 2A79A 3CQHA 2V67A 1TQXA 4O12A 2EKGA 2UZ9A 3OHIA 4M1RA 3ITCA 2EO7A 3TNOA 1DJXA 3U4FA 1KR1A 3G1HA 5J5RA 5EBAA 2W27A 1UC5A 1ISYA 1EJRC 1XM3A 2Y88A 2NLIA 5G2IA 4GC3A 4JFWA 2X09A 3E74A 4U3AA 2QYGA 2HNHA 1GGOA 3ALGA 1ECEA 4IP7A 1TJ0A 3WF4A 3TYZA 1VRDA 5CBJA 3PZQA 4BQ5A 2QJHA 1IEVA 3HPSA 2W67A 2BG5A 4OBSA 2WKGA 2QGYA 4K39A 4M29A 3KTCA 3NQ2A 5FJTA 1JPIA 4PEEA 3G18A 2YZ5A 1XCWA 2Y7GA 3P6LA 4Z2KA 4TMBA 1U83A 5CAHA 2V2HA 1K6AA 2ISWA 3P61A 5HULA 2RJHA 3KVJA 1R3SA 1CB2A 1UBSA 2Y8UA 4PL1A 3NQEA 2VJXA 4MTVA 4W8LA 2WK2A 3EWBX 2CERA 1DWAM 2E40A 4E4UA 3S1WA 1Q2SA 2ATMA 2QIIA 3LPFA 4HPNA 2BSLA 4J28A 4W93A 1OX4B 5HJLA 2WMJA 4GXMA 1PIGA 3DFYA 3MPGA 2CHOA 5HINA 1WXJA 2E9LA 3AOFA 4PTDA 3B04A 3V35A 3RPMA 3SDOA 3S5ZA 3MA8A 1Q6QA 3IGXA 5EY5A 1AZ1A 5C2CA 1RLCL 2OYLA 4PTNA 3EYPA 3WBWA 1S2VA 1OB0A 1PV8A 4PUUA 3NO5A 3HG3A 3C56A 3SY1A 5CPOA 1DWJM 1Z6KA 4QR6A 1FUYA 1HIZA 2ACRA 3HPXA 4D6DA 2WWCA 3WLNA 4IMFA 1TV3A 4NRSA 4ES4A 2PP0A 3RO6A 2OSWA 3DYOA 4I7VA 5M3WA 2Y24A 3O05A 5LNWA 1TR1A 2ISVA 5HUOA 4ZFCA 4FXJA 1R9XA 2OPJA 4LSBA 4AW7A 3FSUA 4EWND 2NQ5A 1XG4A 2ZDSA 1CEOA 1Y5VA 2ZRUA 3QH2A 2REQB 1M3UA 1V0MA 3QY6A 1K8ZA 1NU5A 3CZEA 1VYPX 4QDWA 3W7GA 4AX6A 3QN3A 3GNOA 1I8JA 2VR4A 3ZVHB 1K9TA 3OBKA 4QDPA 3KM8A 1HF6A 3WCZA 4A6GA 3M5XA 4MLJA 3G8EA 2PDMA 3CUZA 1AW5A 3CPRA 5FA5A 4XZNX 2OQYA 1J93A 4FX8A 4PL2A 3IRDA 1J9YA 1S5MA 1BF6A 2Y2WA 1V6YA 3WO8A 1TPVA 1J0KA 4HN4A 4C6FA 4LRTA 1Z3NA 3UR5A 3GVWA 1Q7ZA 3H7UA 3KUMA 3B9DA 3ELFA 3WF2A 3I7QA 4CNOA 3ZFHA 2QCDA 3LTSA 2Q8LA 3OEXA 1X1NA 2G0WA 1OYBA 2E8YA 2WSQA 1K70A 4L80A 4JNZA 3GR4A 3N1AA 3TFXA 3CO8A 1WKEA 2CBIA 3H26A 3IVTA 7REQA 4W88A 3FEQA 3H2CA 4AZ7A 1ZAHA 3GHTA 1EC7A 3OLEA 5LIWX 3OVQA 3THDA 4PUDA 1F3WA 5LXXA 1Q45A 5E6YA 2YL6A 2KZHA 3BOLA 1R3YA 3TONA 5FJIA 5J04A 3QOKA 1H4PA 4ALDA 3ISIX 3KBNA 4JHOA 6TAAA 3THUA 3ITYA 2AGKA 4H00A 1HGYA 3QV6A 1UROA 1JD7A 3EKLA 3FJ6A 4BI7A 3AMDA 1ZCCA 3AHVA 1YIXA 2VDGA 2XVKA 1L2QA 1JNDA 4ORMA 4EP8C 3EDFA 2I5IA 2P8CA 1DIEA 3IK2A 1VPQA 4OTKA 3MCNA 1VPYA 2DORA 2QQ6A 3GXTA 3W7MA 4A8NA 3R12A 3TDFA 2HSAA 4AHPA 1HFBA 1VR6A 3RNDA 4GIAA 4W89A 3TYBA 4JDYA 3PBGA 5JVLA 1QDSA 2YYTA 1O94A 1W2PA 3GTNA 1KKOA 4LB3A 1JAEA 4IL2A 4MFEA 1LM1A 3GH5A 3SN1A 1IXQA 1YADA 5CZKA 5HR7A 4M24A 2EPMX 4U2ZA 5T91A 1POJA 3KDOA 5CG0A 5HDRA 3WSUA 1DIOA 4IIGA 4KF1A 1NOUA 3TW6A 4NF7A 1XLBA 2A3EA 3E49A 5D09A 3WQ6A 3SO7A 2H8XA 1GPWA 4C1NA 2OELA 2ZUMA 3F4VA 3W87A 5CQ1A 2G41A 4XQ6A 3SEPA 2J25A 1FWWA 3DFTA 3CJPA 1YYAA 3S5OA 2Q02A 2XM2A 1UR0A 2WWDA 3QV8A 3WNMA 3VO0A 3C0JA 4I9AA 3W25A 1GPFA 3MB9A 1PHQA 1V0KA 3TXZA 3FHQA 3AFBA 4IPLA 3ENLA 3N2XA 4JIIX 4ZA0A 2EPKX 2PWUA 2G3IA 3IV8A 5JBFA 3EDJA 1L6WA 5LKYA 1IYXA 1JCTA 1UWQA 3TZNA 4E8CA 5K7JA 4M51A 1NEYA 4KIEA 1OG0A 3IS4A 3KL3A 4QJ4B 3C8FA 3RU8X 1JZ8A 4P2VA 4ZO7A 2ZXDA 2WKJA 3FGCB 4YLWA 2VDHA 3SJ3A 4HNLA 5AFDA 3L12A 4DWDA 2GQ8A 3QKEA 3GM8A 3E0LA 4JIQA 3AZSA 3W6MA 1L0PA 4CQCA 2XN1A 3AUOA 5ABHA 4P7QA 3EZ4A 4UFIA 3WENA 1VB9A 2DIKA 3EWCA 3EKZA 3DCPA 4H19A 3W0KA 3F2BA 1QBAA 4HMEA 2DQWA 1MXDA 3CTLA 2PDWA 2Y5EA 4DYJA 3WK1A 3SCRA 3AISA 1ADOA 5A6KA 4QNEA 2DDXA 3DHFA 2X0HA 1QFEA 1OD0A 3RPDA 3S9YA 2WNZA 4K6AA 5AHIA 3FKRA 5TD4A 1TZ9A 3C61A 3S2MA 2Z7KA 4V28A 1BXNA 2OOFA 4PB4A 4MDPA 3E0IA 4BS0A 2QIWA 3QW3A 4DO4A 1MEHA 2P0OA 1QW9A 2OYMA 1H7PA 3BG9A 2V3EA 1OX6A 3ABRA 1HP5A 3QLLA 3OU8A 1B3ZA 3K1GA 2PTZA 1O12A 2VEMA 5FESA 1UIPA 2DW7A 3EDKA 3NPWA 3I7SA 1EJWC 4Q6XA 3ZXWA 1TWSA 4GACA 5DXXA 2EXOA 2X40A 2YLLA 2OX1A 1ONWA 3RM9A 4RZ6A 4BEQA 2G4JA 4UBPC 4YYCA 2BHZA 5FD0A 3VIGA 1PX3A 3SN4A 2VZTA 1XIBA 3SUWA 4XBJA 1TR9A 3P8IA 2QVNA 3IVUA 3T40A 3TWBA 4ATDA 2H8ZA 1KBBA 1XLCA 3C2OA 1TPC1 4KEUA 1EDQA 2ODOA 2QNEA 3IJIA 4AF0B 2JBMA 3WJWA 1UD8A 1JYNA 3SR7A 2X1TA 1BD0A 3C6CA 5BCAA 4GY7A 1A53A 4GK8A 3TA9A 3FLUA 3G0XA 4G7EA 4HHHA 1R0MA 1GEHA 3WQ5A 1G4PA 3BURA 4PFMA 1LT8A 2D2HA 1UQZA 4N9DA 2F6XA 3M6DA 2Q3RA 3A3HA 4FF7A 3HU7A 4UMBA 8A3HA 1DV7A 4GVHA 2B81A 1UMYA 1KO0A 3H22A 3BOFA 3CIXA 4LAKA 3QMSA 2WAGA 3GNNA 3S1GA 1A0EA 5FKYA 4I3GA 3MJYA 3RITA 1DJGA 1QVBA 4XAYA 4LVGA 3SBFA 4FOUA 4HP5A 4B5TA 4GYPA 4XZLX 3L67A 5AYXA 2NSXA 4IGMA 2ZE0A 3EWXA 4IJBA 3LHWA 1NH6A 1XS2A 5CSRA 2GL5A 1LBLA 1JCNA 2PMQA 4ZR8A 3MANA 1A3HA 2YA0A 3WJYA 2O56A 3CUIA 5DCEA 1EJVC 3AMCA 4G7FA 3VDGA 3AWNA 4D6GA 4AVOA 1CT5A 1FH8A 4I5UA 2Q8XA 4J5NA 3IACA 4ZO9A 3KVMA 1T6MA 4GBUA 1PAMA 3RK8A 1OC5A 2X1RA 2P88A 3TTYA 4RV8A 3M16A 4DLFA 1ZBVA 3V16A 3BLLA 1XYAA 3WBXA 5HR6A 1X7IA 2CKSA 2NW0A 5H1WA 2PF0A 3H55A 1ZENA 2YDQA 3RMJA 1XIDA 1ISWA 5RUBA 3E5PA 2WNNA 4GZIA 4GY1A 4PCFA 3H7RA 2ZC1A 4ADTA 3VU2A 3F2CA 2V5JA 4N4QA 1M1BA 2EGZA 2A7PA 2VCCA 3M0HA 3MMWA 2D0HA 4O14A 3C86A 4GXWA 4QCEA 4RDZA 3NSMA 3PBYA 4XD3A 1O66A 2B7PA 1RCXB 4PUKA 4WVXA 4UOZA 1PVNA 3QTPA 5D9PA 4O52A 2F7FA 3A64A 2YCIX 1GKQA 1PUDA 2PODA 3QMTA 4MZ8A 3UXLA 1PKMA 1SVDA 3LHYA 2DSVA 5HNNA 5G4HC 1W5MA 3VDBA 2OXNA 3I68A 1F3XA 3OIHA 3S47A 3GFXA 2XGBA 1UZDA 4IPNB 2VUYA 2XIMA 2F6UA 5IDIA 4PMXA 1G4TA 4ASTA 1XR2A 3PAJA 3ITXA 2F2KA 1E70M 2PGWA 3LEPA 3TE9A 4PCNA 2F84A 1IE7C 4B4FA 4WK9A 5D05A 2VD8A 3BSHA 4TVUA 4ADUA 5A69A 3MBFA 3A23A 3BJFA 4MJ2A 3W7NA 2ZBTA 3VZYA 4AEFA 5CBBA 3KBMA 4C6BA 4MMWA 4XZWA 4YJ5A 3QZ6A 3UGRA 1OINA 4M7SA 1TIWA 3HG2A 1U5VA 4DAFA 4FR6A 4O10A 4P7LA 3WD2A 4UTWA 3CS2A 4HZ8A 2YCEA 5I78A 1JCYA 3AYVA 5C71A 1GG0A 3U7VA 2PWFA 5C54A 3EGJA 4HMDA 4MB1A 1E9ZB 1LYXA 4AD3A 2W92A 4PUWA 5GPRA 4JHMA 2Z1XA 1TB3A 1S2WA 1SPQA 4MB4A 2WO5A 3WG6A 1G6CA 1I45A 4JZ5A 5TIMA 1FY6A 1PZ2A 1EP2A 3ZM8A 5A8PA 1W5PA 2OWCA 4BK9A 4KWSA 2R94A 2VGIA 1LUCB 3VZXA 1VIZA 1X6NA 1CLVA 2UBPC 4Z2GA 3URNA 2HWGA 5CKSA 3AI0A 3IUHA 3GC2A 1Y0EA 4NL1A 2ZOXA 4HK7A 1H2JA 1N55A 4AYSA 4EK7A 3TR9A 4RXGA 1OK6A 4EF8A 3W81A 5CBIA 3VIIA 1Z9AA 4XO7A 1VYRA 3UZXA 3HQNA 1MZHA 1W3LA 3W1AA 2P76A 1UWTA 4JTQA 3BL3A 1PBGA 4JQ1A 4LUSB 3WDRA 4I8YA 4Y96A 1C29A 2X1UA 4C1KA 4H9TA 1S5VA 1T5AA 3C4UA 1AW1A 1XIJA 1M7JA 1V02A 3KOWA 4R9XA 4PULA 3VD5A 4IIEA 1JIBA 5FF3A 3L65A 4LNYA 5CC7A 2A2IA 3V36A 4C6JA 3P82A 4RLIA 3FGCA 3AU2A 2YCKX 1TMHA 2D69A 1V51A 3HGJA 4I9TA 3KXQA 1ME9A 4E38A 1AJ2A 3VFCA 3OZPA 3B8VA 2IPGA 4R7OA 2W91A 4QQ3A 2O4MA 3ZR6A 2OLSA 3TQPA 2PBGA 4NAFA 2GWGA 1C3FA 4GNJA 1E0WA 2ZZ6A 1NWUA 4DM2A 4F3HA 3H23A 3GHRA 1PEZA 1EF2A 5LNUA 1HJXA 4PCTA 4PBFA 1UG6A 2V5BA 3F5LA 4FP1A 1I0BA 2VI0A 1TPFA 4JX5A 5CGMA 4LUTA 3WKZA 5GNXA 1TWIA 4QG6A 4XVEA 4MJZA 1QI5A 1XSKA 2JIWA 5F1UA 4IX0A 2HZGA 4GQRA 1KTCA 4ZO6A 2OG9A 4DUWA 5BRBA 1UD4A 4NQ1A 4I9MA 3IJ7A 5T9CE 1KRMA 1AQHA 3RR4A 2FLIA 3AXHA 3T09A 3W7EA 4U10A 3WYZA 2DZUA 4LUSA 3QSRA 1VHCA 2YDSA 2VOMA 2Z00A 5E9XA 2FMNA 4RE2A 3GQYA 5LYRA 1DJNA 3GDTA 1H7WA 3NZRA 5A6AA 5EMLA 3ZZ1A 3E2QA 3STGA 5A6JA 1R3TA 4DWSD 2PS2A 1N82A 1UD5A 4RPQA 3N29A 3LXAA 3CUGA 3LENA 3R10A 4O1FA 2QCLA 1YLVA 3BICA 2C6QA 3SADA 1D7KA 3N17A 1AA1B 3TAOA 1E56A 2J66A 3EBVA 4PUNA 1TX0A 1UKQA 1DP0A 3S2CA 4M3PA 5ABTA 1NY1A 4EXAA 3R58A 3QFWA 1EPVA 1XCFA 3BMVA 1LJYA 2G37A 2WXDM 5HQEA 1JZ7A 1LRNA 4UTJA 3P0XA 1M01A 1I2NA 5HXMA 1AL7A 1XXXA 1LLWA 2VX6A 2V5CA 2YXXA 4W7UA 3L4UA 1P4CA 2QR6A 3L7RA 4PEKA 3WL0A 3SURA 1KB3A 4I6VA 3G1YA 4W86A 3E1F1 3Q65A 1GNXA 3FXGA 4TTGA 2QCCA 3C2FA 2I7GA 1MW1A 2UY5A 3FS2A 1V4YA 2WQDA 3OP2A 5JH1A 1FWHC 4LX4A 1NIUA 3MTWA 3WL1A 5CZTA 3AIBA 4AXNA 3BGGA 4PBEA 2D20A 3PN8A 1KQZA 1RQBA 2I57A 3V0UA 3LV5A 3B40A 4M5PA 1TMQA 1M41A 4Z0JA 4UTHA 1KD0A 4ATLA 2VMFA 3UY7A 1Q7QA 4LU0A 1O6IA 1YMYA 3WNNA 2PGEA 2YL9A 1JCJA 1A5BA 1D9EA 4PMRA 4XO6A 3ZVIA 2VZSA 1H5VA 3VD9A 3DAQA 1XW8A 1QNSA 1KCZA 1MO0A 3RRXA 2JQXA 3IUIA 4GUFA 3MYOA 1IXNA 1X7FA 1AH0A 3W2NA 3RCMA 1CXHA 2QAFA 1W6TA 3NJ3A 2V5KA 3APYA 3W7DA 2BFGA 3UG8A 3M0ZA 3NQVA 3N4EA 5I06A 4CU6A 5DXYA 2DUXA 2X30A 1WPCA 4X63A 3GK0A 1ONXA 1JXJA 1EGMA 1TVLA 3MZ2A 4E4PA 4IT1A 2V2DA 5M2FX 3LY0A 1E1CA 1OZMA 3QV7A 2XGZA 3HQOA 3UG5A 1F76A 1DWGM 4CQ9A 1G7UA 3AZRA 4CN4A 3IK4A 4AD4A 1FQ0A 3N14A 1GONA 3GAKA 4V15A 4HB7A 3UEQA 3NVTA 5AN7A 1ZP3A 5AC8A 3CZ8A 4OQVA 2DEPA 3ME3A 1LBFA 3IANA 4CUCA 1FHLA 1WOAA 4OV9A 2G8ZA 4GJ1A 3ZIZA 4I5XA 3IGUA 1D3CA 2Z27A 1SMAA 3VNDA 3LBMA 1EKOA 4Q8WA 1YE6A 3WMSA 2W9MA 5I24A 3PNZA 2Q71A 4Q22A 3S2JA 2VT0A 3SSZA 1NFPA 1H0GA 3GE7A 1FX6A 2BHUA 4XIMA 4DUVA 5A8NA 1G7VA 2WHMA 5LNVA 3W6YA 2OGJA 4Q4MA 2ZX7A 3UF9A 4KEMA 1OX4A 3MCOA 4DZIA 4P5UA 3WDJA 1NQKA 3LK6A 3PG9A 4AY8A 1KV8A 4Q4SA 4UCGA 3G1XA 1V3KA 1RSCA 2JGQA 1A50A 3R8HA 4FX6M 2YL5A 3GG8A 3W1PA 1CZ1A 3BK0A 3D6NA 4AXKA 1GKPA 1HT6A 3CIVA 4O1CA 3QC0A 1UWRA 3APGA 4P8XA 4JYFA 4HPJA 1JZ3A 3UG4A 3P81A 4K38A 4DNMA 5IOBA 4DNHA 2Z2UA 3C3UA 5E93A 2OEJA 3C5QA 2ZRXA 1RPKA 4MNLA 4MM1A 4IGHA 4TMCA 1A3XA 1ZY9A 4HKPA 4PA8A 3KFTA 4LCSA 1OQFA 1C92A 3QPEA 4LW7A 5BYWA 3M44A 4KEVA 4LS1A 1V03A 2H9AB 1RVKA 3VIFA 4RV3A 2JF7A 1C8QA 1IR1A 1RA0A 4S3FA 1OK4A 1QK0A 2HDJA 3AXXA 3VIKA 2WQPA 4JTCA 4WXYA 3LV6A 4XBSA 3VIOA 4DLMA 3UESA 4DO6A 4CCDA 4M8UA 4OE7A 5A8OA 2FZBA 2O9RA 1E6QM 4ZSTA 2XIQA 4NHVA 3S46A 1QW8A 2HK1A 1VLWA 2QDGA 4NI3A 2I56A 3MUAA 4LBUA 3WK0A 3QGAC 3LOTA 1EX5A 4O50A 1W8GA 2GOUA 2ZUTA 3Q58A 2WC4A 3PZGA 3VC5A 2VWSA 4D6EA 1A5UA 4DF1A 4EXBA 2P5NA 1E71M 5F2MA 2ZA2A 2WJDA 4L4OA 3W2JA 4ACYA 4JKKA 3UWVA 3QM3A 3VNIA 3GTXA 1P43A 1UC4A 1Q7MA 1S1PA 3CHDA 5HBFA 3JZEA 1V7AA 4O0KA 2INEA 2VZUA 1CXLA 3PZOA 4HIBA 2BOEX 3C2VA 5FEZA 3NTYA 4K8EA 2HS6A 3S1XA 1TUXA 3KBVA 1WKDA 4Z08A 2PD5A 1HKMA 2PA6A 1EX1A 3FJLA 1FH9A 4QGCA 3VX0A 3AJXA 4ACZA 4DBUA 2IQTA 3UU0A 4GINA 4EAYA 3G3MA 3PTMA 1SJDA 2PWGA 4YHGA 4CD6A 1U5HA 2VNCA 2YCJA 1EBGA 2YBUA 2R8WA 1X1OA 1BF2A 1HNYA 3LU2A 3ITOA 5AC4A 1YBQA 4B16A 1FWBC 1V7YA 2CLFA 3ABOA 4S2CA 3RLVA 4ZMGA 2CZFA 4J3SA 2ZA1A 1IEXA 4XWUA 1VEMA 1DBTA 3TTQA 3ES7A 4ZCWA 2VP8A 1EJTC 2V3GA 5CGQA 5I3JA 2JE8A 4JQ4A 3EOEA 1ZRQA 3GHUA 1TCMA 2VVNA 3ZT5A 3L4VA 3T8LA 3R1ZA 2LLEA 3W07A 4GIYA 2W6RA 3EPMA 4O11A 1XDMA 1K03A 3KCJA 5REQA 3R6IA 1Q6CA 1V8EA 5CLWA 1TMLA 1W5QA 4PUEA 3W1XA 1HJUA 2UY3A 1WP6A 2A85A 3GIYA 1OFAA 4L9ZA 4C5ZA 2QF8A 4JOMA 1XLMA 5J8LA 3DFNA 3TP4A 3VKBA 1ZZMA 4WHBA 4EPKA 3FXYA 5EB8A 1VP5A 1A5LC 1JQVA 2C71A 2ZUVA 4HK5A 3BLKA 4JX6A 5TNVA 2WHLA 4JYDA 1ICPA 1UH2A 1XUUA 3GAYA 1ITQA 1PKLA 4D1IA 4Z2JA 3G2GA 2WZIA 4F0KA 5DMMA 2WSKA 2J74A 1FHVA 4H04A 2C79A 4BF5A 3ZLGA 5D9OA 4AZCA 2Z26A 4BF7A 4J3TA 2VX5A 1RP8A 2AAAA 1QNRA 3L0NA 1FWGC 3EAUA 3K8LA 4O53A 3VE7A 3WFZA 3MDUA 4XUYA 1UWAA 4B5UA 2WC7A 1E51A 1GCYA 5A6SA 3DU0A 1CCWB 4F48A 4G56A 3GNPA 2CKRA 3SRHA 4XD5A 2PURA 4K68A 1B3YA 3W2KA 1QOXA 3BSGA 3A9BA 4HSOA 1RALA 3AHXA 4DI9A 3R11A 3Q4DA 3MW7A 1KFLA 5CGTA 3WFLA 2KAUC 1S39A 3T0BA 4O19A 1UJPA 1PB0A 5I3DA 5AHLA 1MQPA 1TPEA 3NPXA 3VDCA 3E38A 4JQ2A 4YVVA 1LT7A 5D04C 3WUGA 1JNEA 3STCA 1NF7A 3ONCA 5G1MA 3HN3A 4QS6A 4S38A 3O9NA 3QRHA 2J75A 1B90A 3PTDA 3O8AA 3W7JA 4WSKA 2C1IA 3C2EA 1IXOA 2GDQA 2HQAA 1VFHA 4IPIA 3UZYA 2E5BA 2PP1A 2V3FA 2YW4A 1L6SA 3THAA 2WJFA 4HSNA 1OX5A 1YPXA 2E6FA 3KE0A 4H41A 5LZLA 2PD9A 1SSGA 1JF6A 4Y90A 4DPQA 2PLKA 2ONEA 4BZYA 4DJDC 7REQB 3LYEA 4CQ8A 1B9ZA 3TC7A 4C6LA 4HNUA 5F4SA 3BGAA 1B3WA 2BASA 2PU0A 3AJ7A 4CQAA 1A5MC 3M0JA 3I6TA 3C52A 1E1CB 3SUVA 4E8DA 3THCA 3HURA 2A3HA 4H7ZA 1DTNA 3GWQA 4I6KA 3KOYA 3SCNA 1UD3A 3CXOA 3DUGA 1PXGA 2CPUA 3HM7A 4S1FA 3RMEA 1DXIA 3TKFA 3LTYA 4PR4A 2OB3A 4ZL1A 3LA4A 3VDAA 2EEXA 5FEXA 4IQLA 4K36A 3W74A 4NY2A 3NQ7A 3URQA 2PDUA 1PTAA 4M56A 4RX0A 2Q01A 2GVLA 3BJTA 4GVFA 4JTIA 4GABA 2CWNA 4HA3A 4WJXA 2REQA 3N2CA 4ICCX 2G97A 3VIPA 3UZZA 2PTXA 1W3NA 3SZ8A 4LGXA 4LVBA 3MMTA 3CUFA 1W1A1 2VX7A 1XKJA 3TTOA 4FS9A 3DI0A 4Q8UA 2NUWA 5I23A 3U2OA 3EWUA 1UJQA 2FTYA 1G1YA 2EPHA 1WDSA 4S3EA 3CPUA 2JKAA 1W3IA 4RZ5A 2ZXBA 4FB7A 2VQUA 4GZEA 2G3FA 2P8BA 3MSGA 3CT7A 4JYEA 4I7WA 4ZZ9A 1T96A 3UP8A 4ZENA 3F2DA 3JRKA 4EAMA 4GYJA 3T7VA 3T0DA 5DY3A 2J77A 2ABBA 1O60A 2QHAA 1OFEA 4MAZA 3TROA 3WLJA 3QOMA 1XDJA 4CU8A 5E70A 5EFDA 5D2WA 4ZOBA 4AB4A 4XBKA 3VNZA 5FF4A 1HKWA 2HVNA 2QAPA 3R0DA 3ES8A 3KOFA 2DW6A 4XZ9A 4IPJA 2QV4A 5E1QA 2EG6A 3PPGA 1H7NA 3AIEA 4DJEC 4C6KA 6CGTA 3GNRA 2J78A 4IQDA 3A9IA 2D3NA 1E1EA 2I1OA 9RUBA 1ZBCA 3UPWA 1JPMA 5JBEA 1XG3A 4EXQA 4MYXA 1DWHM 4DM1A 4J3ZA 2PUZA 2XFWA 4AIEA 2X8RA 4AU0A 5CCZA 3UR2A 4I8DA 3NQBA 3FJ4A 5CH9A 3LPPA 1EZWA 5LA2A 2IKIA 2OYKA 4G2DA 1US2A 5AHMA 5CJNA 1F5ZA 5DBUA 3UZJA 2L5HA 1OBAA 3FIGA 3PJUA 5IDZA 5XIMA 1X8CA 3FVDA 1QPNA 4HZ7A 2CZVA 1QUMA 1JRCA 4N42A 3VOFA 1QU4A 4MPQA 1EO5A 4JTAA 4C65A 2PEVA 2ZE3A 3WD3A 1WDRA 3N2BA 1W31A 2Y8KA 3FYOA 4XV0A 3NQDA 1HKJA 4F0LA 5HJYA 1JCLA 3T0TA 1NFBA 5FSEC 1CGVA 4DY1A 3WN6A 3ERPA 1NF0A 5BU6A 3D5HA 2PDPA 5I3HA 2ZWZA 3WQ4A 3MP5A 4JTFA 8TIMA 5DT7A 3R8RA 3ARQA 5D2YA 3OBEA 3O15A 3SGZA 3TAKA 4AZHA 5FOOA 2ZXQA 1DVJA 3NFUA 4AZ5A 3N34A 3STEA 1RQHA 1ELSA 4DI8A 1J4EA 5KEZA 3WLSA 3P0WA 2OWWA 5LSMA 1ZAIA 3DERA 5FAJA 3E12A 3DYPA 4IIHA 2YGYA 1FA2A 3W86A 3PFMA 3CEUA 2P10A 2PDQA 2NQZA 2J7DA 4HJWA 3ARVA 2RDUA 1L8PA 4LCRA 2W62A 3ZT7A 3MY9A 4QROA 1EO7A 2WVTA 4UFJA 3GC5A 1M7PA 5D30A 5AOUA 4GI6A 4WKFA 2GDUA 3OBAA 3CBWA 5D9NA 3W75A 3NZGA 3MUXA 1RR2A 2OFJA 5AHFA 3MI6A 1BQCA 4R85A 3ABZA 3VOCA 1ZBKA 4AD2A 1HVQA 4TV6A 3S5SA 4D6IA 4XAPA 4NSBA 3P60A 3ZO9A 4IP4A 1JYXA 4MIMA 4OVXA 3RAOA 3RF9A 5CPQA 2I14A 1F2JA 3BLIA 5CPMA 3L0KA 2V38A 4GIRA 3PP7A 5BRQA 3VVGA 2FVKA 2YSWA 4L7ZA 2CZEA 4Y8EA 1ZFJA 1H50A 3PPCA 4D8ZA 1L6GA 3IIPA 4Q7IA 1RJPA 2NXGA 3S6OA 4LY8A 1RA5A 3REQB 3MDWA 1VZWA 1HZYA 4RUBA 3TCEA 3CAWA 2Q6ZA 1JXKA 4E3VA 1SGJA 4AZGA 1E6XM 1ISZA 3LTPA 3UFYA 1XLJA 3GYEA 2VFDA 1NJJA 4Q4QA 5JQ9A 3L4ZA 3IGSA 1KCLA 4QJ5B 5A2AA 3IWPA 3VGDA 1YNPA 1J11A 3STFA 1W8SA 2C19A 4G1KA 1T40A 1MDRA 4TXEA 1FHDA 4V1YA 2HK0A 1AQ0A 2INZA 1W5OA 3EMZA 2FTWA 2Z6JA 2YFNA 4PSPA 5CC5A 3BW4A 3H4XA 3TSMA 2CCRA 1GYLA 3RUBL 2O0TA 2OR2A 1YTDA 3UW6A 4YTUA 1F6PA 5MHBA 3SRFA 1DXFA 3RM4A 4HA0A 2YCLA 2GUYA 2GVEA 4IPPA 1AL8A 1I4NA 4TQTA 4L4MA 4YTQA 1XPYA 1TV5A 2TPSA 4DUXA 1SZNA 3G1DA 3NYZA 2V5LA 2CXGA 4HHPA 4UTTC 4PRTA 2D24A 4KCTA 5TF0A 2XFRA 4MKNA 3M5VA 1BQGA 3O0FA 1H3GA 3K1DA 2VGGA 1PWMA 4FIRA 2WLYA 4O54A 3ITLA 3GDKA 3BV4A 3P14A 4RZBA 3SY5A 2Z25A 5HMSA 1GJWA 1B9BA 3TK7A 2HCVA 4OGZA 4UNIA 2EG7A 4GE8A 4AIBA 3WBAA 3H4GA 1VBJA 2PWVA 3VD3A 4Z1AA 4KT2A 1RP9A 3N25A 1SFLA 1UH3A 4J2MA 3TQ0A 2J9YA 1BTCA 3VFLA 3W22A 1JR1A 3QHOA 3NIYA 3GNXA 2DJXA 4NJIA 4O28A 1CIUA 3W7RA 3D46A 3WNPA 1ML1A 1LWJA 4FEZA 1E73M 2D73A 1S5NA 2A6NA 2QCNA 3DH7A 3TN5A 4H9YA 3SQLA 4U2YA 1E15A 2WMKA 1UOZA 3G8RA 1OFDA 3ITTA 1EC8A 4YHEA 5E0CA 1TJ2A 1YNQA 4Z1BA 3GVVA 4MNJA 4TUFA 6TIMA 3BO9A 4CNSA 4QDMA 1O1HA 3PULA 3MUZ1 3W70A 3M0VA 1TV2A 4Y8FA 3ZS4A 4JD4A 4MY8A 2YXGA 1C8YA 4M19A 5B7ZA 1EGVA 3P84A 3VGEA 4QQUA 3S3GA 1X38A 2FYMA 3ABSA 3E2SA 1RBLA 1YRRA 1N8WA 3SUUA 3L5MA 4ZQOA 3PWAA 3AIVA 3B05A 1HW6A 2WHKA 1H09A 1TWZA 4IL0A 1PKNA 4O13A 4X3ZA 1RXOB 4H7VA 2A3CA 1E0UA 1V3LA 4CN6A 1JZ2A 3EMCA 1XQKA 3LQLA 4N6EA 4ORIA 4RK8A 3MCMA 3CZKA 3AHZA 1HG3A 4CVWA 3MI3A 3WIJA 1LWIA 4AHOA 4JQ3A 5I3GA 4DX3A 2PI6A 3MKCA 1AODA 1Z42A 5L9FA 3QJAA 3AICA 1IWBA 4ZXLA 1RBAA 5AZ0A 4E2BA 2X42A 4AC7C 4DVOA 1TA3B 1Q8JA 4J4KA 4DBDA 4FALA 1CLXA 2POZA 1EFZA 1WBHA 2NWSA 2PDKA 4WIWA 4WY0B 4IXHA 4QG9A 3U2ZA 3BWWA 2BLEA 1TCDA 3GY1A 1K3UA 1LRQA 1SJCA 5EKYA 1IGWA 3ZOAA 4EPBC 3PBUA 4C1LA 5G2HA 1SZGA 4ZOAA 1Q2RA 1Z41A 2Z1KA 3DX5A 4JNYA 2NUXA 2QKFA 2E25A 1M65A 4GC4A 4UTUA 4V33A 3G1VA 1W3HA 4JTLA 4DPPA 5AYZA 1N8FA 2TODA 4LAZA 3CT2A 2BY3A 1CGWA 1DJYA 4PMZA 1I1WA 1R8LA 3HG5A 2GK1B 1FTXA 4GBDA 5ECVA 5EYWA 4JFSA 1I2PA 3PWIA 3UYIA 1FRBA 2NLYA 2YB4A 3E5BA 2WLZA 3OVPA 3CAVA 3GFZA 5E0KA 4KQNA 4LUIA 1C7SA 4XB3A 1TQJA 3T08A 1L6YA 4GCAA 3A5FA 3C8NA 2DUAA 1DEDA 1Z89A 2GOKA 4IFRA 4XTDA 3OO2A 3H2OA 1J79A 2JIEA 1F3TA 1M04A 1GUVA 3EPNA 3W7OA 2VR5A 4JR5A 5A8GA 1U2YA 1EGZA 1XISA 1W32A 3H2MA 3L4XA 4PMQA 4WDWA 4DAIA 2DV0A 1Q85A 3FNDA 3OG2A 3GXDA 3V0TA 1AD1A 3TYDA 2X1SA 1HJQA 3KBSA 1V3IA 5ABFB 1RK6A 4CD4A 1OCQA 1XLLA 4Q4RA 1RHCA 3GKAA 3T0CA 1FBAA 2XH2A 3OOQA 1WYIA 5KZ6A 1F05A 4FIQA 1AVAA 3GR7A 1XCXA 4RKAA 5M1TA 2UWFA 1MXGA 1DJIA 2XHYA 4ZB0A 1TUFA 3DBPA 3EWWA 1ISVA 3WH7A 1F6KA 3IJ9A 4LYKA 2OEMA 4ICNA 3WD0A 3W72A 4RCXA 2YW3A 2OT0A 3WLIA 2XH0A 2ZZ7A 2XDFA 1E40A 3GG1A 4ROQA 4UZSA 1HKIA 1BYBA 1YTEA 4HA1A 1KR0A 2I17A 4KRUA 3R0UA 1XSIA 3PK7A 2WSRA 3ZJ6A 3A24A 3U4AA 3G1RA 3E6EA 3HGRA 2FPTA 5I02A 3KBWA 2PWDA 2J9XA 4I5RA 1ZGDA 4C6DA 3W37A 4LV9A 3CMJA 4TX9A 2PU1A 4IJCA 1XFBA 1YDOA 2FGLA 2CBJA 3PUOA 3VKCA 3SUSA 3TX9A 4AUBA 4JTSA 4EWJA 4GUIA 4P8WA 5C7VA 2QEZA 2CWXA 3GD6A 3UPMA 1CW2A 1UOKA 3J7HA 3TIMA 5LIXX 1XDLA 1UZ1A 2A3AA 3H2NA 2WCSA 5FF7A 3UJEA 2R24A 4KCVA 7ENLA 3CU2A 2W5FA 3QQWA 1OGBA 3WDHA 1GOMA 2BNJA 2W4XA 4CCEA 4TTUA 2AL2A 1CGXA 1W37A 3QVQA 3S1UA 1OZQA 1WXYA 1TTPA 2XSAA 3B9OA 3U3HA 3RIKA 4B3LA 2R1PA 3DG7A 3ZYZA 3PBVA 4Q7BA 4ZQRA 1W5NA 4XVDA 2IPFA 3TYEA 4AG0A 1FFQA 2WNQA 5DRIA 2BS9A 3WH9A 3SUTA 5BWAA 3FK4A 1E43A 1LWHA 3GVGA 1H7XA 2Z1SA 5DO8A 4IP5A 4QISA 3FYPA 4FLQA 1FXQA 1U5JA 1E6ZA 4LEFA 2BV9A 1ZU8A 4PODA 3CASA 3UJ2A 5GJPA 4IF2A 4US5A 3RCNA 4PMDA 3R13A 3PJXA 5EMUA 4FXFA 4OJYA 4PUJA 3CO4A 4GI8A 2FHCA 3VUPA 4IUOA 5LIKX 1NP0A 3KTSA 1UB3A 3M5YA 1UP0A 3NDOA 1PYMA 2A0NA 4PTXA 4RL3A 5IFTA 1H1YA 4O1EA 2D1ZA 4UTMA 2XYLA 1Q6FA 4XSLA 1PZ0A 1ENUA 1B4EA 1WQ5A 4W5ZA 3GU9A 3IIVA 3I3EA 3GSMA 4C6IA 4YYFA 1BYCA 3VMNA 1QHZA 3PZNA 2YOCA 1BSLA 3NYDA 4MB3A 2XFFA 3DFHA 3ITGA 1H51A 3FW6A 2ISFA 3BAIA 1R6WA 3QPZA 1A0CA 1UBPC 2Y1HA 3CYJA 4ZXOA 3WNKA 3QW4B 3RDKA 2GQAA 1AMYA 3R5EA 3NEHA 3WLHA 2XG9A 1LQ2A 2BXVA 1BPLB 2OQLA 3IJ8A 4GFIA 1BEUA 1HXJA 4ZODA 4CD5A 3FX4A 4XKYB 1B31A 2WMFA 3LRLA 1AH4A 5SWUA 4J40A 1VHNA 3E0VA 1OWQA 4NAEA 4F0MA 1HL9A 1J0HA 4IISA 5A8QA 5FCZA 3LHUA 4GUHA 3O7UA 4UB9A 4OV4A 4MNMA 2G3NA 2BMBA 1JI1A 4JNMA 1I75A 5LXEA 2MANA 4RJEA 4DWSA 3C0SA 3SY8A 3KRSA 1GVOA 5ABEA 1UYQA 4NYYA 5FF2A 4NZFA 2VELA 4DJFC 3OQ8A 1M7XA 4KEZA 1P1MA 1CBGA 1YBQB 5ECUA 3WX7A 3PZMA 2FZNA 4Q8TA 1GQIA 3WLOA 4GY0A 1TJPA 3KW3A 3EB4A 4H4IA 4MHBA 2C13A 2Z2BA 4HVXA 7PTDA 3B8TA 3TQKA 2QDDA 1JRBA 3GU1A 2HEJA 2VYOA 4LRSA 1PSCA 4N7QA 2WMIA 3D3AA 1ICQA 3PSWA 2VO5A 4F0SA 5AB3A 5CPTA 1VKFA 3WZ0E 4D6JA 3GXPA 5HQLA 4M6VA 4C6QA 1KRBC 5C9ZA 4DJFA 1KFWA 1J18A 3R94A 4MPKA 3W1TA 4AD0A 5HOSA 4UTKA 1CXIA 4KGLA 2J8GA 4HMCA 4XX6A 2XIOA 1L2UA 2WNWA 1VBUA 3F5KA 4YTRA 4UNKA 3PTQA 4K1GA 3RG6A 4HCDA 3A6OA 1E3ZA 1VGAA 1NP2A 1VCFA 3W7CA 4MAVA 3W2LA 1OF8A 3GKFA 1X98A 1XP3A 2J7EA 1V6TA 3AC0A 4WJEA 1EDTA 2PCQA 2QV5A 2VUNA 3R2GA 5A6MA 3RX2A 1GZ1A 1GVIA 1IEWA 5D37A 4B92A 2DZWA 1QK2A 4XISA 1OIFA 1DOSA 1QO2A 1QNOA 4BKNA 1MEIA 1LOQA 1E5JA 4NZ4A 4IMAA 4RE0A 3OLDA 4CVUA 4Q32A 3B4UA 2OLAA 2FDSA 3CWOX 2EJAA 2ZADA 1EEXA 2OCZA 2HPMA 1HQTA 3KWXA 5H91A 4FNTA 4HYRA 1GOQA 1VFFA 2JFEX 1HX0A 3T42A 3SGGA 1GQJA 3BLFA 3W1QA 1OFBA 1JD9A 2P3ZA 4MG4A 4AY1A 2I16A 3N18A 1TSIA 3TJIA 3TMLA 5M03A 4TVCA 1T8QA 4AWUA 4F66A 1AH3A 3POCA 1DYSA 3UERA 3WH6A 5HMEA 3EWZA 3SN0A 2WANA 3R79A 3L0GA 2E9BA 4HNNA 3EX1A 3K8KA 4D8AA 1M6JA 1JL8A 5K3VA 7CGTA 2YBVA 1QHPA 4C7FA 3GX9A 1LG1A 1QJWA 2OKOA 3PAOA 5A6BD 2XU2A 1QATA 3G3DA 4GGBA 1NFGA 3W1RA 1VJSA 3I6RA 5FJJA 2DH2A 1GTHA 3MV11 3WQOA 3VD4A 3W29A 3LXCA 3VOGA 2E8ZA 1C9WA 3TR2A 1QASA 1UR3M 1ZJHA 1KA9F 4AD5A 1HL2A 2PDXA 3LBOA 4R3UA 3M0IA 1J12A 2DUZA 3KCLA 4CKQA 3EOOA 3GXNA 1KBJA 3CGTA 2E6YA 3LCXA 2HNEA 1YXYA 2ZRVA 5IM51 3EXRA 1H63A 4IQEA 2VC6A 3S0CA 4PMOA 1W1PA 3FAXA 3WEZA 3O16A 2V63A 4H6KA 2YL8A 1CWYA 2IXVA 3SCPA 4X2RA 1J5TA 3VUSA 5BROA 4HD5A 3GZAA 2YLAA 5BWFA 3FCPA 4PB3A 3WQEA 1B3VA 1WXZA 1T0OA 1EQCA 4RR4A 4F0RA 1QPRA 4R27A 3D47A 5A6TC 3I7RA 2A21A 4AWSA 3R25A 1A4MA 1WV2A 2JKEA 4XZMX 1GOOA 5CPLA 1XLFA 3CEPA 3BE7A 3EDEA 1RD5A 5TBOA 3IIZA 3M9YA 3MKKA 4RW3A 1UQYA 2NX1A 1W17A 2W3ZA 2E68A 2XTKA 4N9BA 3B0UX 4B91A 1A5NC 5AYBA 1H1NA 3N2MA 1IWAA 3VKDA 2BB0A 4C6OA 2J7CA 1M03A 1SJBA 2F38A 1VFUA 4NX5A 3B06A 5FAGA 3UD6A 5H8UA 2FGZA 3I6EA 4K7VA 1KKRA 4OU1A 3MO7A 2J6VA 4AWEA 1BG9A 3F4DA 3T44A 2OVLA 5U4NA 4A3QA 4OECA 4H7CA 3TJ4A 4GWEA 3RFAA 4HOXA 1UWSA 1EF3A 4QG8A 4O1BA 3LPOA 3R7MA 1KM2A 3LMYA 4W7VA 3LCHA 5CZ0A 1NDZA 4MVAA 2PDFA 4RE4A 3BAYA 1XIGA 4DXVA 4ZBCA 3UCQA 3HFYA 2D2GA 3HPZA 4PMYA 3KHJA 3JW7A 2V81A 3VOHA 5A2BA 4WOZA 4L4PA 1PDZA 1ITXA 2EJ1A 3IUDA 2HE8A 5GNYA 3S5NA 3ARTA 5FL1A 3KX6A 3PB2A 1TTQA 3UR8A 4DJED 4QAIA 3E9AA 1SQ7A 2W79A 3TW7A 3HG4A 4QEEA 2E5DA 4YMZA 5KZEA 4LEQA 2ALDA 2O9PA 5KZDA 1VAHA 3OLIA 2BVWA 5EMYA 1XYLA 1EUNA 3DDMA 2DT2A 3PPFA 3BMWA 5HNTA 3OJGA 1FCBA 3LG3A 4JIEA 1P48A 1TPUA 3GDMA 3VNJA 1TTJA 2YIHA 3S2LA 1RUSA 1MUMA 3ARUA 4JCLA 4IOTA 3EXSA 2V8ZA 2EPLX 4WF7A 4F2BA 2XN0A 2FTPA 3BQ5A 2AKMA 2BP1A 4QTGA 2D2OA 1XBXA 2GGIA 3V0SA 3MHFA 1MEWA 2NV9A 4FXSA 1PTDA 3V1HA 1XBZA 1SO6A 3TLQA 1RY8A 2VEFA 1EA9C 1HJVA 3LGEA 2XVGA 4IICA 4AZCB 3W9ZA 2NXHA 3RX4A 5BMWA 2HROA 1Q3NA 1DE5A 3KHDA 2QGHA 4ADSA 3AWOA 1DPMA 1TKKA 2VC7A 3U8GA 5D03A 1ZS2A 9CGTA 4HSHA 3WF0A 3BC9A 4LJ3A 4MB5A 3LCWA 1FP8A 4DZ5A 4R88A 4BI6A 4UMCA 2HRWA 4LCQA 2PWEA 3E2VA 4B2DD 5AC7A 4HHLA 5F4XA 3VD7A 3CL7A 3CV1A 1I2OA 3E96A 3VIHA 2PLJA 1W3TA 2Y4SA 3CQKA 4O17A 3QR0A 2PCEA 4ZQPA 4QSFA 1ECQA 3UVAA 3R8GA 1DXEA 3C3NA 4D1JA 2BOGX 4LBSA 1NDWA 4UUIA 3W00A 5BXPA 1W9PA 1K8YA 3N3MA 1TV7A 1F07A 3OODA 1OCJA 4G9PA 5C7HA 1R3RA 1WDQA 3NEVA 1EPXA 3UVIA 4KBXA 4CQBA 1DQWA 1J0JA 3DHPA 1VENA 4QX4A 3VOIA 3Q94A 1A5CA 4B3KA 4L64A 3KTXA 2VXNA 3DOPA 5H8MA 2ACSA 3MC5A 3LGGA 1R9ZA 4H83A 2DP3A 1PIIA 1WOBA 2GWNA 5EGRA 3TOPA 1OY0A 3BMXA 3SQMA 1Y5WA 3B9AA 3LRKA 4IJRA 1KM1A 1EWEA 5EL1A 4O0QA 5LHEA 5C70A 2GJXB 2D3LA 1XRTA 3UJFA 5GVJA 2RKXA 4W5UA 3K2GA 2GLKA 3ONBA 4JFUA 4RW5A 1OG6A 3W82A 3S1VA 1Z44A 4NG3A 3HBLA 3WH5A 2EKCA 1A0DA 5IRPA 1F61A 5KMYA 2ZRZA 3INPA 1XIFA 3OGVA 3CYVA 1KLZA 3T6CA 4KMQA 4YPJA 2VDIA 3ARPA 2TSYA 1JCMP 3U5UA 2V68A 2PTDA 4KCUA 2OKTA 4GO9A 3DZ1A 3HJEA 3L5LA 1UA3A 1DQXA 3Q37A 2P0IA 4UQBA 3NM1A 1O7AA 1XGZA 2EBNA 3VKJA 3WLKX 1DTUA 4IM4A 2FZ9A 1E4LA 3WBYA 3ALFA 1EIBA 3CAQA 3AXKA 3AROA 3NQCA 3KEHA 5K4ZA 2QPSA 2I9UA 1O68A 4DJFD 3EX3A 1UIOA 3G22A 2Z7GA 3AO0A 1GVEA 3DGBA 3V5FA 4FXRA 2R9RA 3GG0A 3WUEA 3IRSA 1R38A 3TYUA 3QTGA 2Y85A 4WDXA 3TC3A 1PZ1A 3Q67A 3LUTA 1CECA 4M81A 1LF1A 3PUGA 2PDNA 4WX2A 1JDAA 5KINA 1KRAC 1K7XA 2R1LA 3GDLA 4PMJA 2VEGA 2ZC8A 3DHUA 3TSDA 3EDDA 3GUGA 3H6OA 3UZWA 2ASHA 3T81A 1RY0A 3HMCA 2G96A 1SZRA 3NPUA 3KVLA 1MQQA 1R5YA 4FNRA 2DSUA 3EOLA 1JFHA 1V3HA 1XYFA 3CM4A 2G3JA 2Q09A 5DX7A 2DGAA 3T0AA 2HVMA 3T78A 3M5ZA 2GVGA 2HXTA 1E1FA 4DO5A 3MUY1 1FHUA 3RHGA 1GEQA 4BHYA 5DANA 3PB0A 4RDVA 3NVDA 1WDWA 4CGTA 1XX1A 1G0CA 1OHLA 4D8LA 1I6NA 1XH0A 3GBDA 3CNYA 4L6DA 4S23A 3BAJA 3CMFA 5CC3A 1QWKA 4HGXA 2FB3A 8XIAA 3TOYA 4LXFA 5C9UA 3VMOA 3RCYA 4GYKA 3MP3A 4LBRA 2YBTA 2P3EA 2WSYA 1D3GA 4Y9PA 4N02A 4UTFA 1ALDA 3B0VC 2IQDA 4Q8MA 2O4QA 1M9HA 1J0ZA 2J47A 4ZSUA 5AY7A 1I60A 4B3ZA 4J2PA 4C60A 4C6MA 3CPGA 3W1MA 3EB3A 1YQ2A 4CEUC 3B8UA 3QLDA 1XIMA 3LM3A 3Q45A 4C5YA 5HWJA 1E0VA 2FVLA 1DJWA 1P1XA 4X0NA 1I2RA 1OSEA 1XIHA 3UA3A 2AQWA 4L6HA 2BVYA 1CGYA 4WRHA 3BTNA 1G9HA 2QCDB 1T99A 1XLDA 1EOKA 5F7UA 4NU7A 1JG9A 3MS8A 3OZYA 4JICA 1QOPA 3ZVHA 1JUBA 1GJUA 1P0NA 4UR7A 2QPUA 4GHRA 4KWWA 2DZBA 3ABQA 3BH4A 4HZMA 4O1DA 2PLMA 4GGHA 3PUEA 4NZ1A 2OMAA 4LUYA 1GT8A 2QCHA 2TRSA 2CLEA 3RILA 1XBYA 1GVRA 2E77A 4MJMA 4XK2A 3A3XA 7XIMA 3TFCA 3S4TA 4LYPA 2DVTA 1XRSA 1VC4A 1VFOA 1MNSA 3ARRA 4PRRA 3TLLA 4GYPC 3BDKA 4B5VA 1CXFA 4Q4PA 5GJMA 3W7PA 3MSDA 1Q4NX 3HV9A 4ZQNA 4O16A 1UKTA 4JDBA 4HYVA 4XZHA 4A22A 2V82A 4XD4A 5EA9A 3SI9A 3DKJA 4JAWA 2PFHA 3DESA 2J79A 3EX6A 3P2VA 4XD6A 1U22A 3HO8A 1VD6A 3H7VA 2XWDA 2WMHA 2AMXA 5GNZA 3VCCA 3N4FA 3A4XA 3UZ5A 1A5KC 1AW2A 3EPOA 2J24A 4P7NA 4P7OA 3MVTA 2J8TA 2VENA 3GDBA 3BGJA 2NSOA 3MZNA 3NGFA 5CEWA 1AD4A 2PSNA 3PZVA 4PTWA 4DRSA 5A8MA 5LHFA 5C9RA 1ME8A 4NKCA 3AUJA 3KS5A 5A2CA 3M07A 1HTIA 1JGIA 5GJNA 3TYAA 3NGJA 3E3HA 1F3EA 2X0SA 5HNRA 1DL3A 1XRVA 1EQPA 4H8UA 4BQ3A 2ZX6A 4LFYA 3RX3A 4A2SA 2CIPA 2YXOA 1Q6DA 1DWFM 2BGQA 2PWHA 2CLMA 4J27A 2KX9A 4MWAE 3N12A 3I4KA 4DHGA 4TX8A 1WZMA 1DQUA 4PBGA 2WBGA 1J2WA 1ZBWA 4DJEA 1KW1A 3UA4A 1EHNA 4GJIA 2C14A 3QBUA 1W9UA 4DWSC 4LALA 5C5YA 4O15A 3K4DA 5BRPA 3LHTA 1KCKA 2B4GA 4FLRA 4ZQCA 4CU7A 3U57A 2FFIA 3VNKA 2A3BA 1LLOA 4JKMA 1S2TA 1REQB 3PSVA 3F4NA 4G8TA 3DC0A 4H9VA 1PWLA 1TV4A 3SJNA 4RPPA 2ZYFA 3WH8A 3CAKA 2VGFA 3SCQA 2WOQA 3SSJA 2C8NA 4JX4A 1MNZA 1S2CA 1X96A 3IGHX 3IJLA 3M1ZA 3UWWA 2GQ3A 2YX0A 2ZDRA 2Z6IA 5EMJA 1FWCC 1YXDA 4IG2B 1XD0A 1QW7A 3CB3A 3W26A 5B80A 5U7SA 2IQ0A 1GVYA 3BW3A 3A5VA 1QNQA 4NZCA 3W6LA 3W1NA 1IR2A 1Y7VA 3WUFA 1IWPA 4AY7A 5T8GA 2BXYA 1LDCA 3GS6A 3IARA 1EWDA 3ANVA 3KWSA 4HT3A 2J27A 1NARA 4BEUA 1R3WA 4BQ4A 3RLHA 1BGAA 2JALA 3BW2A 2C18A 1UUOA 1B3XA 2X0YA 3N9SA 4FMVA 3UWEA 3KL5A 1H7OA 3RGTA 1XKYA 2R1NA 5FF0A 4ML9A 3UWZA 5I3IA 3BAKA 1ZP4A 4GI4A 4NJKA 3W71A 3TJLA 1UUQA 4NZ5A 3UY8A 4IG2