4LSBA

Crystal structure of a putative lyase/mutase from burkholderia cenocepacia j2315
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
277
structure length
277
Chain Sequence
DLQARHAEAFRALHTRPGAFIIPNPWDAGTARLLAMAGFEALATTSAGYAFSKGQPDNAIDRDAMLDHIADLVAAGGLPVSADLENGFGDAPGTVAETIRLAAEAGAVGGSIEDATGRADTPIYARDASVERIAAAVDAARALPFPFTLTARCENYLHGRRDLDDTIARLVAYRDAGADVLYAPGITDADEIAAVTRAVGAPVNVVMGLQGGLLSLDELAALGVKRVSVGGALARAALGAFLRAATEMRRDGTFTFTQAAVPGRDINRWFAAPDNSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords lyase/mutase
publication title Crystal structure of a putative lyase/mutase from Burkholderia cenocepacia J2315
rcsb
source organism Burkholderia cenocepacia
total genus 107
structure length 277
sequence length 277
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13714 PEP_mutase Phosphoenolpyruvate phosphomutase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 4lsbA01
2BG5A 2ZE3A 1XG3A 3EOLA 1O5QA 4WJ8A 1F3WA 3BJFA 1DQUA 2VGFA 4KRZA 3QTGA 2R82A 2OLSA 1XG4A 3KHDA 3OYZA 4HYVA 5JVLA 3SRHA 3FA4A 3QZ6A 3KTXA 3QV6A 3PP7A 4B5XA 4YNGA 2VWSA 1E0UA 3GQYA 3I4EA 3OYXA 1PKLA 4B2DA 4L9YA 5TAOA 4FXJA 2L5HA 2XDFA 3T05A 4LSBA 3U2ZA 1E0TA 4QG9A 3SRFA 1AQFA 4KCUA 3PUGA 1F8MA 3EOOA 3T0TA 1S2UA 4MG4A 3VAVA 2VGBA 4DRSA 1VBHA 4RPPA 3IS4A 1OY0A 1OQFA 1S2WA 1A5UA 2HRWA 1U5HA 2WQDA 4TV5A 4B2DD 3QLLA 4IQDA 4QG6A 2QIWA 1PKYA 4QG8A 4QGCA 4B5TA 3QV7A 1O66A 3EOEA 2VGIA 4G1NA 1Z6KA 3BJTA 1T5AA 2HWGA 3E0WA 4HYWA 4KCTA 1IGWA 4L7ZA 2V5JA 3GR4A 4B5SA 4JPGA 3QV8A 2E28A 4YJ5A 1PKMA 2XZ9A 3ME3A 1KBLA 4B5UA 1F3XA 1GGOA 1PKNA 2DUAA 1ZJHA 1F61A 3SRDA 3T07A 2XZ7A 3M0JA 3GG8A 2KX9A 3E0VA 1A49A 3G2GA 1MUMA 4B5VA 4TV6A 1A3XA 3OQ8A 3M0KA 4KCVA 4ROQA 3EZ4A 2V5KA 1O68A 1DXEA 4IMAA 1DXFA 1VBGA 1F8IA 4KCWA 1KC7A 4KS0A 4B5WA 3B8IA 3R4IA 1M1BA 3LG3A 1PYMA 2VGGA 4FXFA 1IZCA 1M3UA 2HROA 4L80A 1JDEA 3LYEA 1U5VA 2G50A 3P0XA 1S2VA 3E5BA 2VWTA 3H6OA 3QV9A 3QQWA 1S2TA 3SRKA 2DIKA 4L9ZA 3HQPA 3MA8A 1SGJA 2X0SA 3N25A 4IQEA 1UJQA 4IP7A 4MF4A 2HJPA 3FA3A 3HQNA 1DIKA 1A3WA 3HQOA 1ZLPA
chains in the Genus database with same CATH superfamily
5F2MA 2PLKA 5AB3A 5A8PA 1VC4A 1ZB5A 3G6LA 1JYXA 5CPNA 1PHQA 2OLSA 2CLKA 3CL8A 3T8QA 1R3RA 1DV7A 3V5FA 1Y0EA 4HP5A 3CU2A 4DI8A 3W37A 3PUDA 3IGUA 1J2BA 3EA3A 2B81A 3WK1A 3LEPA 3EKGA 1BRLA 2AAAA 4GVFA 1AG1O 3ITLA 4QHRA 1E6QM 3MJMA 4AZIA 4WGXA 1RZMA 2A7PA 3LZ5A 4NIRA 3AROA 4HOWA 4ZQOA 3ID7A 5CAHA 2DH3A 3W2UA 3MZNA 3FN9A 3QZEA 1Q2SA 1LYXA 1UWAA 1XSKA 2WAGA 2DY3A 1B3ZA 3O15A 4JTAA 3F03K 1GZJA 1BYAA 3B0VC 4W7VA 2GQ9A 4BWLA 1IEQA 5HMDA 3FEQA 1XLEA 4CD6A 2PWHA 1KFWA 3W7PA 4QCEA 3M47A 3CH9A 1TPUA 3EZ4A 1UR0A 3QR0A 3MMUA 2JGYA 4GYPA 4MB5A 3U2CA 5CLTA 3S0CA 2WV8A 3BAYA 1W1ZA 4FXFA 2FZBA 1DWAM 2OO6A 3EDKA 3WDJA 1FCBA 4K8EA 1O5XA 1OJXA 3GH7A 2ZUUA 5AOUA 4I7WA 2ZRXA 4I6KA 2PWFA 6PTDA 1C9WA 5G2IA 3DFPA 3NO3A 4HPXA 3IACA 2VQUA 3WUFA 4RNFA 1PX8A 1RVGA 2W5FA 4K2SA 4MY1A 3U5YA 3PZVA 1EXBA 3W29A 3LHTA 1VLWA 2J77A 2QMKA 4H3DA 1Q8AA 3TN4A 1CX9A 3QM3A 5C9ZA 4WOQA 3FY1A 4D6CA 3HF3A 4YHEA 2ICSA 4V1XA 4LSBA 5KZDA 2AL2B 3W76A 1BAGA 4REQA 4DNHA 3GIPA 3UCDA 1JNEA 5C9UA 1S2UA 4JCLA 1W0MA 3R1ZA 3BLFA 2PODA 4WKHA 3FJ6A 2VFGA 2WZHA 4Q4RA 2YSWA 1PB0A 2ABBA 3SCNA 1T5AA 1AL7A 2V2DA 4C6NA 4GHRA 3B8DA 3WLIA 4US6A 3PUEA 4GA8A 1KBLA 1QPQA 4PB5A 2WPBA 2CXEA 2POTA 2OOFA 4Q8OA 4LALA 3VIIA 3M0JA 1LT7A 1OX4A 1S5TA 3UG4A 5C7HA 1JG9A 2A79A 2VP8A 3GNNA 1GVYA 1B90A 4LJ3A 2QQ6A 1A5BA 1DIEA 3BG9A 3BAWA 1KC7A 1XLAA 3LXCA 1IXOA 1W17A 3CJPA 4GBUA 3W23A 4F48A 1LOQA 1P48A 3FEMA 4LGXA 3UFYA 3BQ5A 3HJZA 3MTWA 4GYKA 3W0KA 3B9OA 3MV01 2RDXA 1UWSA 3WH8A 4AD4A 1HW6A 3N4EA 1LZOA 3MUCA 3PBGA 3G0SA 1P1MA 1M65A 4G5DA 2ZXBA 1QATA 4HPGA 3CQ0A 1TV5A 1P0KA 3OYZA 1K4HA 4JOMA 1GTHA 3SO7A 3N2BA 3EX1A 1PPIA 4C1NB 1M41A 3KRSA 2HVOA 3E2SA 1EP2A 3WNKA 2VHLA 3EWZA 4GABA 1E40A 3W07A 1BPLB 2WQDA 1P7TA 3BLPX 1QI5A 2P76A 3QLLA 3VGDA 5A69A 1U1UA 3TZFA 1EPVA 3VKCA 5CSUA 3G1DA 4UTWA 2PTDA 3HPXA 1NSJA 3MBFA 1XS2A 1POKA 5DCEA 1RCXB 4WLCA 3GR7A 5JMUA 3GD6A 3CB8A 1ZBCA 3GY1A 2WMKA 1GJUA 4DI9A 2VDHA 4F2UA 2F2KA 4PMZA 3KOFA 4PCSA 3KOXA 4D6JA 4XG1A 4ML4A 4MB1A 3RRXA 5EU9A 7ODCA 1W3IA 1P6BA 1H5YA 3RRAA 3RUBL 4RDYA 3H2CA 1MZHA 3IJLA 3V3WA 4JCMA 4I9JA 1PV8A 2C3ZA 3LG3A 1E70M 3N2MA 1VYPX 1B4KA 4AZCB 1NWUA 4B15A 3PSVA 3MCNA 1XRFA 4ERAA 1SW7A 2XSXA 1OZMA 3G8EA 3O0KA 2E09A 1MW1A 3URAA 1J2WA 3C2FA 3P93A 3PULA 4JTHA 4U2YA 5J5DA 1JQXA 2BDQA 2DT0A 2A4AA 2OSWA 3TAOA 5KMYA 4XZLX 4IFOA 3CNYA 1MVYA 2DZWA 3DGBA 3CT2A 1XI3A 3TVAA 4ZMGA 3HJEA 1LG2A 3T05A 4DF1A 3VNKA 1UBPC 3KVMA 2WKGA 3KBMA 1EB3A 2Z2BA 1FCUA 3DOPA 1LUCA 5E6YA 2PA6A 3W00A 1F3EA 1ISVA 5CPMA 3OVGA 4IXHA 3F2DA 3E1F1 1WDRA 2X1IA 2INEA 4AWEA 1D9EA 5CPTA 4NILA 3TSBA 3W75A 2V69A 4GZIA 1S5VA 5F2IA 5I00A 2Q09A 4OJYA 3IK4A 3BWWA 3CUHA 4GRSA 3U48A 2WSRA 2ZFAA 4LXFA 3THDA 4H2CA 3KP1A 3HA1A 2CETA 4L5ZA 1E71M 4KWSA 2PDWA 3H26A 1V0KA 2OO0A 2VKZG 3P67A 4JQ3A 2ALDA 2EPLX 4IMGA 3SBFA 4L1WA 2PZ0A 1QDSA 3WQEA 3E0LA 1IF2A 3D46A 4NSBA 5LIUX 2X0SA 3DFYA 3ZS4A 1ONXA 3MO4A 4KF1A 5I6SA 1JCJA 3QKEA 1GUVA 3V1HA 3ZR4A 3II1A 5HMSA 3W7DA 2OZ8A 3VKDA 2UY5A 2BBFA 2VEKA 4GX8A 1PEZA 2VC6A 4TQTA 1CLKA 2DZTA 2Z25A 1UQYA 3T1GA 3GQYA 3E0IA 1ALDA 5D02A 1KW1A 1VLIA 5BXPA 1NFPA 3L5LA 2PDMA 1LL4A 3R8RA 3NO1A 3S2NA 5BW6A 1CEOA 4GQGA 4Q8MA 4PUKA 5AHNA 2A2IA 2XN0A 2R91A 5AYYA 1LBFA 4WHBA 3BURA 3B8WA 3CLWA 2OEMA 1MI3A 3R2GA 5KINA 2CBUA 4I3GA 4H7ZA 2FZNA 3NEVA 3FHAA 1DPMA 1OYAA 1HX0A 3UGVA 2V38A 1NU5A 1Y5XA 3CPGA 4AD3A 3CUFA 4LBSA 3C86A 4JNMA 3TQPA 2VZSA 3KLLA 3IRDA 2QS8A 5AYXA 3NQ8A 3GWQA 4XWUA 1DXFA 4TR9A 3U9IA 2Y7GA 2H3BA 4R27A 4WJXA 3N2XA 3FGCA 5JBDA 2GJXB 1EDQA 3L4UA 1ICPA 1J0YA 2PDFA 2FH6A 2HNEA 1LWJA 4U28A 4G2DA 2W79A 1GVOA 3PZGA 4TVDA 4P61A 3W72A 1JF6A 4QQUA 3E2QA 2GFTA 5AFDA 3RLHA 3ITYA 3WJWA 3W7QA 1V79A 5K2ZA 4JICA 4FNPA 3SGGA 3HTWA 3D6NA 4HCLA 3NGJA 4E5TA 1F9CA 4Z17A 1UR4A 5DXXA 4C7GA 4O0ZA 3QR1A 3WLTA 1XYZA 3BANA 5T8GA 3SN0A 2X1TA 1FA2A 3UZXA 1FRBA 1JZ5A 1FDZA 1MFUA 6ENLA 5LGZA 3SUTA 3P7YA 4C6OA 1Q6FA 1TMQA 4KH2A 3N17A 1OIMA 4X0NA 1JL8A 2JKEA 4IISA 4IQLA 4GUJA 1XPGA 1ENUA 1JPIA 3OEXA 1V6VA 3G1YA 2XVLA 2J25A 4H9TA 1E1CB 4U31A 3CZLA 1ZS2A 2G50A 5DMLA 2XFFA 4NNCA 4MWAB 4DEFA 3QKZA 3N25A 4GMEA 3O63A 3QGKC 2R1LA 1JDAA 3ITCA 1AUSL 3DHUA 1LWHA 4NP7A 1GOIA 1GG0A 4JYDA 3AXHA 2W92A 3NURA 3O3RA 1VHCA 4ZO6A 4RNJA 1KM5A 4EPKA 2XJ7A 5JIWA 1L9WA 3NPUA 1KFKA 4MLJA 3S2LA 5EMUA 3W7KA 2ZXDA 3AYSA 1ADOA 1D8WA 4ZTYA 3CTTA 1UA7A 2D3LA 2ZCGA 4S38A 3IUHA 4WR3A 1KLZA 2G0WA 4H9YA 2WKJA 3WX7A 3GG1A 4LWWA 1HZYA 3MI3A 4NNBA 1H7XA 4BQ5A 4NI3A 3TFCA 3HPSA 3OQEA 3K5XA 2YB1A 4C6KA 1PKNA 1J79A 3A13A 3M1ZA 1UB3A 3W1RA 4O52A 4M51A 1H7NA 5ECUA 1KLYA 3W86A 1I2RA 3WFZA 1O7AA 1KBKA 1WKDA 4K68A 4LRSA 3VO0A 2J7HA 2IMRA 1H0IA 1K8ZA 4ICNA 2VGGA 1V6UA 3S4TA 1G01A 4C6CA 4IMCA 4HHHA 1YMYA 1A0EA 2YDAA 2ZRWA 3BARA 3QQWA 4CCDA 5I03A 1Q7QA 1SGJA 2UV8G 2NQLA 2CHOA 3TYEA 3H2FA 2R24A 2OEKA 3G1FA 4U5IA 4ZE5A 1ZBKA 3EX3A 3I6TA 2Z27A 4FXSA 1GEHA 2FZ9A 4H9VA 3E2RA 3AHVA 4ZOCA 2C91A 3WD0A 3AJXA 3MV11 3REQA 2Z6IA 3PWAA 3FVDA 1OX5A 4DX3A 4CCCA 3GX9A 3USZA 1C8XA 3SUVA 1SSGA 3HGJA 1NWRA 1YNYA 1RQHA 3K4DA 5I78A 4AB4A 2J74A 1VPQA 1VRXA 3O2LA 3PJXA 5HK4A 4ZXOA 2Q02A 4K6AA 4LBRA 1XCWA 3QQ1A 4ZQMA 3KRUA 4KWVA 1Q65A 3UWYA 5FL0A 1GGOA 1KQYA 5FJPA 1DP0A 3UJEA 4YWSA 5BNKA 3NQDA 3W2MA 2EF9A 2Z00A 1O68A 1YNPA 2CCRA 4QROA 3AIBA 3DYMA 3ANYA 1R3WA 4JEQA 4I8YA 4FALA 2DDXA 2VC9A 4PEKA 3AJ7A 4KEVA 3WK2A 2J13A 3W2JA 5B80A 3VI2A 1OT2A 3Q67A 5AVNA 2C18A 3WMBA 4OUEA 3M46A 4AF0B 3CHFA 5A2CA 1UUOA 3RCMA 3NWRA 1K7FA 2X7VA 3W1PA 3L4WA 3SY5A 3I4KA 4ZENA 4GVIA 4J3SA 4N42A 3LD5A 3VNMA 2YFNA 3QSTA 4GXPA 2ZC8A 2QJJA 1NQKA 4AZ5A 5CZSA 1EZ2A 1LRTA 4ZFCA 2F6KA 1J11A 4K39A 4L4LA 4BA0A 3VGGA 3MWAA 4MFEA 3DG7A 4WOZA 3FSTA 3EMQA 1KFEA 3ALFA 4W85A 5RUBA 4BK9A 4IFKA 3MHFA 3RO6A 4PTXA 2WJDA 4YTQA 1BWVA 4MB3A 5F4XA 2QIIA 1F4HA 4RK8A 4XAPA 1TREA 3AYRA 2CLOA 1F6KA 3Q37A 3E0WA 3LMZA 4A29A 4DWSC 1JJKA 3IRSA 1AVAA 4AIUA 1BXNA 2IPFA 1F3XA 4KWUA 4UB9A 3FYOA 4XZBA 4X3ZA 1CLXA 4XBKA 3WYZA 1R9XA 4Z08A 4DBWA 4ZGYA 2YIHA 5HMFA 3S2JA 1DXEA 3N3MA 2Y62A 1YW1A 1WDQA 3OJGA 3BAXA 1UW9A 3KCLA 4GJIA 1QK0A 5HAOA 3WENA 1R8LA 2XTKA 4CNSA 3VIOA 3LQLA 3LPGA 2GSHA 1KRCC 2A7RA 6XIMA 7ENLA 1QW8A 2EHHA 2DU2A 1KFLA 1J9YA 4PODA 2XVPA 3T81A 5I3GA 5IM51 1Z69A 4GIRA 3W7EA 2V8ZA 5BOOA 4D1IA 1YDNA 1IEXA 4GGHA 3WLMA 5DXYA 1BRLB 3BSGA 3RK8A 2BXYA 3QR3A 3THUA 2D0FA 5DBUA 3T2QA 1EJVC 2Q8ZA 4HK5A 3W7CA 4PCFA 1KKRA 3TN3A 1Z48A 4IJRA 4CD7A 1M7PA 1P4CA 4UUIA 1NEYA 7A3HA 3A21A 2JEPA 3N12A 1WKFA 3BXWA 1N8FA 3BLLA 1EUAA 2WZIA 2JKAA 4K37A 1NP0A 3PPFA 4PUDA 4IPJA 1JQVA 1RLCL 4YWIA 4NAFA 4QEEA 3S5ZA 3E38A 4XAZA 5AKQA 3VMNA 2OX4A 2PS2A 3GTHA 3H7VA 1ME9A 3W01A 4W8BA 1NFGA 2B7OA 4OQVA 1KV5A 4XBJA 4DLFA 5CLWA 4EF8A 4V2XA 3QN3A 1VFTA 3ITTA 1OX6A 1PE1A 2DQXA 4EP8C 3UPWA 1OGGA 5KITA 1V6XA 3NO5A 3L5MA 2OFJA 3GTNA 3MHGA 4E4PA 4NHVA 5I3DA 1WO2A 3FNDA 1NDVA 1XDJA 2MNRA 4NXSA 1ZAHA 1KXQA 3LHZA 4GQQA 2I17A 3BE7A 4HU8A 3IJ8A 1TG7A 4S2CA 1J12A 3JRKA 1VIWA 4REQB 5FJRA 3KHJA 3U2ZA 3IIZA 1YDOA 4BQ2A 3HB9A 3BTNA 2ABAA 4IQDA 3UXAA 1OFEA 4NI8A 1R7AA 2OQLA 1R6WA 1TUFA 2HE8A 2WMIA 4EXAA 2ZX6A 3R6IA 3TW7A 1RY0A 3GNPA 3QYQA 4RE2A 3S1GA 3ZZ1A 4JFWA 4HB7A 1OFQA 1EH9A 5A94A 2GSEA 1L0PA 2YB4A 1OX4B 1UZ1A 4MY8A 4GWEA 1A53A 2P50A 4KT2A 2WHKA 3TQVA 3SZ8A 1PIGA 4UTJA 4OOUA 1YLVA 2PBGA 2J79A 3LB0A 1EKOA 3ZLFA 1XW8A 3RCNA 4CU8A 3ARWA 3DKLA 3M43A 1FFQA 3FLUA 2W62A 1H2JA 2R8WA 4YTRA 3HIJA 3H55A 1YXCA 2HXTA 2CXGA 3DXIA 3L67A 3WJZA 3JZUA 1QI3A 3OB8A 5GPRA 1LLWA 3UQNA 2WANA 2R1NA 5C2GA 1ZBWA 1BQCA 1XG3A 5EPDA 1TWDA 1F3WA 2J8FA 2NUYA 2ON3A 2Z1XA 2YX0A 8CGTA 1EYWA 5AZ1A 1X6NA 3W73A 2OWCA 3PJTA 3WH6A 1XH1A 2PE4A 1XIHA 2H6RA 1JRBA 2GJPA 2E0PA 3KBVA 3WLJA 4UCFA 4NASA 4B5NA 1BEUA 1P7TB 1X38A 3AU6A 2D22A 4Q8TA 4O54A 4JKLA 3BLOA 1XRVA 3CAVA 1XGZA 2QIWA 4BF5A 3V0TA 4QCFA 3CZKA 4CQ9A 5AHLA 4GXMA 2DP3A 1BYBA 2OLAA 3H2MA 3QPYA 2HZGA 1FP8A 3T42A 3SCVA 1B54A 4WKFA 5D37A 2DZXA 3VOGA 1OYBA 4UTTC 3SEPA 1QASA 4HHPA 1DE5A 1LOSA 2YL9A 1KD0A 1QOXA 5BRPA 3M0MA 2E1DA 4L6OA 3WK0A 2WZEA 2YYTA 3PZNA 3M44A 8RUCA 4F0MA 1XIFA 1IGSA 3LHWA 1XJBA 4JS3A 2V82A 1RBAA 4O1AA 5GJPA 4IIGA 3C2EA 4N4PA 2P8BA 2TRSA 3WLNA 5A3HA 2W6RA 2VI0A 3DESA 3C3UA 3EDEA 1UKOA 4H19A 4CLMA 1FWBC 4N6EA 2D2JA 5D30A 3RCYA 4TMBA 3K8KA 4F0LA 3CMFA 2OELA 4PTNA 3NOEA 3KE0A 3GDBA 1PS9A 3M7SA 4Y7EA 1K7XA 4FNRA 2OMAA 4QLLA 1N2VA 2QR6A 3EBVA 2VVSA 5I09A 2J7GA 3BGGA 2XIBA 5I5RA 1FH7A 1FXPA 1LUCB 4FNUA 1W8SA 3MVIA 1K4GA 3MZ2A 3W6YA 5BOEA 2FTYA 4Q22A 4HNUA 3WQVA 4X63A 2XIQA 4ZB5A 4S3FA 2GDUA 3RILA 4GFSA 1L2QA 5ABHA 3SQLA 2YFOA 3SURA 3FVMA 4OOZA 5DT7A 1YTDA 3NQFA 1IHIA 5G2HA 4O57A 3DBNA 4Z0SA 3ZT7A 2P8CA 2PDCA 1Q4NX 2RJGA 5BWAA 5U7SA 1A80A 3EA2A 3RMJA 1Q7ZA 3B4YA 4KETA 1R2SA 3AMKA 4ZO9A 3EX2A 4GE8A 3FAWA 2GJNA 2FVLA 1CZ1A 3DG6A 2Z0IA 4YYFA 2WNNA 4WCJA 4IP7A 2G3NA 3V4BA 1SO4A 3TA9A 3W82A 1TVLA 2NQHA 3UR2A 4LANA 1A5AA 3M5ZA 3MUIA 5PTDA 2QCEA 1W1IE 2BODX 1JXJA 1GW9A 4Q6JA 1N55A 3SCPA 3I3EA 5CPQA 3RXZA 1KR1A 1I0BA 3NL3A 3CT7A 3MCMA 4TUFA 1B2YA 3M5YA 1WXYA 1RJPA 1I1WA 5AC5A 4DAFA 2F8QA 5IXEA 4AY7A 4YIWA 1DWHM 1HGWA 3HG3A 1H1ZA 4M29A 4IG2A 2BY3A 3DI0A 4ERIA 3B40A 3B3DA 2DVXA 3RM4A 1QBAA 4UTMA 1H49A 4D6DA 1ITQA 1BD0A 5T26A 4IUOA 4FNTA 4J27A 2CLMA 4P7RA 1I4NA 1KRBC 3FGCB 5CSSA 4NRSA 3CIVA 2MANA 4YHGA 1X96A 4E38A 4XZWA 2WSKA 3A5FA 1E6NA 2VX4A 1KBIA 1BVNP 4GINA 3FW6A 4ACYA 4QS5A 3QY7A 2H9AA 2OJPA 1JZ6A 3MT1A 1XIBA 3GVGA 3A47A 4Z1BA 3SIMA 3S3GA 4ZCWA 3V75A 2HVNA 4C6QA 3FA4A 3W2KA 3AUOA 1IQ8A 3FHQA 3LLXA 2ISWA 4P7NA 4ZO7A 3TTEA 1SFJA 2FHCA 1ZUAX 3CB3A 1YDYA 3MU7A 4DJEA 1TIMA 3WLQA 4UTHA 4HPNA 4XKYA 2CZEA 4B4HA 1F6YA 2F9RA 1J0KA 2J27A 3O6AA 2BHYA 2ZWZA 3VIKA 1UG6A 3GXNA 5HNRA 4BJHA 4JTUA 2GOKA 2VZOA 2UBPC 3W7GA 3WLRA 1W9XA 4JL1A 2E6AA 5DQPA 3V0SA 2E40A 2QVNA 3QPZA 4JTEA 1XLHA 1EC9A 3MYOA 1CYGA 3QMRA 5IBXC 1E6ZA 2GJRA 1A5OC 1JZ8A 1BF6A 1UZ4A 2NUWA 4S3GA 4Z2LA 3HPAA 2O9TA 1TWWA 2XN1A 1CGTA 3ISIX 2Q8LA 2EBNA 3VIFA 1PJ9A 2X0HA 1IIGA 4DO5A 1KGXA 3GUWA 4OV4A 4D72A 2BZNA 1XSIA 2E6DA 3QRHA 5A6AA 3SCWA 1UR9A 2D2GA 3U8GA 3FSUA 3RM9A 3VGFA 2QKFA 4GCXA 4O53A 3TMLA 5EYWA 5A6SA 3CZEA 5TBOA 3TEVA 4D1JA 4JIPA 3CQHA 1VAHA 2FDSA 2ZZ2A 2GPTA 3LCGA 4YVVA 1Q6QA 3SY1A 4ZQRA 2VOTA 4H01A 2XIIA 1H7PA 3QHMA 5FI8A 4O4VA 1O4UA 3VD9A 3TONA 2F6UA 4E2OA 3QOKA 3ABOA 3ITVA 1K8CA 4K7VA 2X16A 2G3MA 2ODOA 4G7EA 3VNLA 2ZTJA 2EAWA 2VX6A 3N29A 3TUUA 1CGWA 3UVAA 3HFTA 4QS6A 4ZEPA 2FYMA 2P0IA 2ISVA 4KW2A 2UY4A 2XFRA 1FUYA 5FIPA 3OLGA 2JFEX 3L65A 3ZFHA 3A5VA 3QV8A 2I16A 3M0IA 2J6XA 4JXCA 1LQAA 3NQAA 3NR0A 1UZDA 2GQAA 2BGQA 4DBDA 3WQ8A 2P3EA 3AS2A 4JQ4A 1G4SA 2CU0A 3WL1A 3BPWA 3TTQA 5BXRA 5KZ6A 1N7KA 2YA0A 2E9BA 2VFEA 4HKPA 3NYZA 3FOKA 4DO4A 3M0VA 3AZTA 3HPZA 6CGTA 2XFWA 1MMFA 4ZB2A 2VCBA 4GY7A 3B4UA 3TYAA 1K8YA 4ADSA 2OR2A 2CLEA 3LI0A 1IEVA 3ARTA 1LF1A 1UBSA 2GGJA 3LY0A 2JGQA 1B3XA 4HNOA 3WBEA 3SGUA 4AIOA 1HO1A 4LFYA 5DMYA 1XICA 1QCWA 2R82A 5K7JA 3VNZA 2NQ5A 4TX9A 3REQB 2DV0A 2J7CA 3QYSA 3S1WA 4FXJA 4JNYA 1TPEA 2IPJA 2BLEA 5LNUA 4MJ4A 1K1DA 4AW7A 4MJMA 4DJFD 3CPRA 1M68A 4AX6A 1MEWA 1X39A 4PMDA 5DX7A 1Z41A 1EBGA 1NARA 4MKNA 1OC7A 4DZHA 4LAUA 3TNBA 3DC0A 1FVPA 3LK6A 2PDQA 3ZXWA 1Z3NA 4W5UA 3LCLA 1O6IA 4YTUA 3E02A 4JFSA 3FKKA 3W1NA 2OT1A 3CWNA 1E73M 3UA4A 1JUBA 3C5QA 3PB2A 3E12A 3VE9A 1EQCA 1VGAA 1FWFC 1TR1A 2GWNA 1ECQA 4DBSA 2PDYA 3HU7A 1UUQA 5A5WA 1EDGA 2VCCA 3SCSA 3MI6A 4C6DA 2NLIA 1HJQA 1I60A 5CSYA 4US5A 5I06A 3BGJA 4FLSA 3G1VA 1QI0A 3MO7A 3TWBA 4OFCA 1RJQA 3ARYA 1GHSA 3MWCA 2A7NA 1BF2A 4KPLA 2Y63A 5C71A 4FEZA 3CV1A 2VEPA 3OLDA 4HT3A 4L56A 4TO8A 1F74A 1OFPA 4OHQA 1VCFA 1G7VA 4Q4QA 1ZTVA 2Y89A 3M64A 3KTXA 3QFWA 4MZYA 3NQVA 5F1VA 3L2LA 1DIOA 3JVAA 3EPNA 5A6MA 3A4AA 1AQMA 2PRLA 4ZBCA 4IFKB 1S5WA 1HT6A 3RAOA 1F73A 1L2UA 1GW1A 5EMKA 3STEA 3OP2A 4NUWA 1GOOA 3K1GA 3BH4A 3IEBA 4DUWA 5C6MA 1XLKA 5G2WA 3GLCA 3M9YA 3ANUA 3PTMA 5HNTA 4PN2A 3UY7A 3SRDA 1MW0A 1JUKA 3C0JA 4MFDA 4P2VA 2PP0A 4AYSA 4QSFA 3CO4A 3GNDA 4FX7A 3RU6A 5A2BA 1HL9A 1MDRA 2CYGA 4NNAA 2G5WA 4ORIA 1WPCA 1QW7A 4TX6A 1Q8JA 3S8HA 2ALRA 4PUEA 4AHQA 1A47A 2BX7A 1W1YA 1YXYA 2FGBA 4XV0A 3M4HA 4C5ZA 2ZVRA 3OZOA 3P0XA 4W4QA 3K8MA 3PFMA 2JIWA 3K30A 3IJ7A 2QCGA 1I75A 1F05A 4L1GA 3VKAA 3S5SA 3UJFA 4F4RA 2WB5A 4JTRA 4ZOEA 2OZTA 5AHEA 3KHDA 1YDVA 4IX0A 3QV6A 3BV7A 1SO5A 4EVZA 4ZB0A 2XVKA 4IZGA 2WPGA 4OVXA 1VBUA 4UMBA 3RPTA 1HQTA 1JZ7A 3EXTA 3BSMA 2E9MA 1OWQA 2OKOA 4A3QA 5EY5A 3APTA 3I65A 1HG3A 2XM2A 3CZ8A 4KESA 3CQJA 4BZYA 4H9MA 1CW2A 2GVJA 1UD3A 3RPDA 1FP9A 3C4UA 4M6QA 5ABTA 2PFHA 3KS5A 1KGUA 3CUJA 1GTEA 2BMBA 4QJ4B 4QE1A 4S3DA 4K3ZA 4M56A 3HN3A 2R9RA 1XYBA 3I6RA 2YDRA 3BJSA 4NAFB 3EWYA 1TJ1A 3RX4A 3E0VA 2JF6A 5DFAA 4DB7A 4LYPA 3QMTA 4U4MA 3MP3A 2H3DA 1B9ZA 4MTVA 3IVSA 4RDZA 4HMNA 3U5UA 1EFZA 2X1UA 4QITA 3VTRA 1Z44A 2BGSA 3ZLHA 5J5RA 3ALGA 5EFFA 2WVSA 4K8GA 1R9ZA 3T0DA 4XO6A 1YRRA 2PD9A 3NSNA 3W28A 4P8VA 2C19A 3LRLA 5GNYA 2XYLA 3M5XA 2VZUA 1ZSXA 3NL6A 4WXYA 2QCCA 5DY2A 5I2UA 5HDRA 1OADA 2GDQA 2ZUVA 4BCEA 3PTKA 1R86A 1EOMA 2P3ZA 2ZZ7A 4N02A 3FDGA 3LSCA 3PAJA 1W91A 2PDIA 3NA8A 5E09A 1MW3A 2TODA 3PBMA 4ZQNA 1JDDA 1FKWA 1WAUA 2WVVA 4DWSA 3ZT5A 2WMIB 1JCTA 3OU8A 1NDZA 2HWGA 2FMOA 4CD4A 2CW6A 4UWMA 4YTSA 3EX6A 3C0LA 2YDSA 1O12A 4PTMA 4QNEA 3VABA 4EXQA 3WEZA 4JQ1A 3WBXA 3WQPA 1JCYA 5C9RA 1V5XA 1A3XA 4E2DA 3T40A 3DHFA 5DELA 4D6HA 1OEPA 3NQ6A 2VR4A 3LPPA 4QISA 4M82A 4O8RA 2E25A 3KRBA 1PCKA 2QMJA 5ECVA 2C15A 4D8ZA 1SMAA 3TTYA 1GPWA 3THQA 3BW2A 3FA3A 4AYGA 3VDBA 4L64A 1DIDA 4Y9PA 1W5PA 5A8MA 2ZRZA 3L2MA 3P62A 1M6JA 1EGMA 1MEHA 2Z6JA 2W0UA 1G9HA 2BNJA 4PULA 2NLYA 4JHZA 4QXIA 1SZGA 1Q3NA 3R43A 1GKQA 5BRQA 2PGFA 3L4ZA 2QJHA 9CGTA 2F7FA 2I9UA 3OVRA 4AVFA 1FWTA 1EJRC 3QFEA 1XIGA 4XK2A 3MB9A 4YLWA 4WZHA 1V08A 2G8ZA 5BCAA 1P0EA 4RPQA 1GYMA 3VCCA 5FAJA 3KRZA 4DBUA 1UUMA 3OHIA 3DH7A 1SSDA 3IIPA 3PR2A 4N0RA 3OOQA 2PDPA 2C8NA 2DSKA 3HV8A 1JYWA 3ONBA 3GXPA 4JTTA 3KBWA 1TX2A 1EX1A 1CNVA 2WO5A 2GLKA 3T09A 1T6MA 3M0KA 4H8HA 1PL9A 3STGA 3BW3A 1WP6A 1A5NC 3KWXA 4NX0A 5LXEA 2EO7A 1F7BA 3GDLA 1V3LA 3TZNA 1FXQA 4PB3A 1C3FA 4BFAA 4ALDA 3UNDA 5J04A 4M1BA 3Q2DA 1PYFA 3TC7A 2BASA 1NDYA 3O9NA 2D73A 5KZMA 4HSOA 4FPSA 4HU0A 1Y5VA 3A23A 3EOLA 1TQJA 1YBQA 4NX5A 2PZNA 5LHEA 4FO4A 1GZGA 3IJQA 1EIBA 1PTDA 1RQEA 2EPMX 3OW1A 3SAZA 1YPFA 1DJYA 5H91A 5AYBA 3GSMA 3MBDA 1J6OA 5C2XA 3AMLA 4FIRA 3T2OA 5LSMA 5JH2A 4C91A 5I23A 4JBRA 1XV8A 5M1TA 5DMNA 5LKYA 3WMCA 4OZOA 1DQWA 1PZ3A 2QCNA 4PSPA 2PCEA 4RR4A 3PVFA 4EK7A 4XTIA 3VD4A 1WXZA 4GQ0A 3GW0A 4CEUC 4F0HA 1X6LA 1UIPA 4H2HA 3KFTA 4RW3A 3PHAA 2DUZA 4XX6A 4CU7A 4ZE4A 5DLCA 3R89A 4LV9A 2EG7A 3NAVA 4OTKA 1TJPA 3CV7A 2QJGA 4MJZA 1Z7AA 1UYQA 1ISXA 4IMAA 4Z1DA 4IPPA 1B5TA 3UCQA 2WMJA 1EBHA 4FLQA 2NVCA 3Q65A 3ABXA 2WW5A 1OIFA 3BICA 3VOFA 2BVWA 4PFMA 2NT1A 2QJMA 3B0XA 2DIKA 1D3HA 2AMXA 4O12A 4DN1A 3BSHA 2X8RA 3V35A 2E77A 4B3ZA 1TPB1 1VFFA 2OPJA 2GUBA 3L0KA 1DJXA 1FHVA 2VFHA 5FEWA 3CYVA 4IIEA 1GCYA 2YA2A 3AUJA 1LROA 2OXNA 2V6AA 3CZJA 4MADA 5EFDA 4DAIA 5HJXA 1PSCA 2ZTKA 4EAYA 1XM3A 4JX5A 3C8FA 2Y5SA 4W7WA 3CV6A 1RJRA 3B8VA 2WYSA 5FJUA 1XYFA 2PCQA 1VF8A 5G4HC 4PTVA 2HRWA 3OZMA 1CXLA 4NY2A 1FWIC 3EPOA 8TIMA 4HTYA 6REQA 1B1YA 3C3NA 3XINA 1E72M 1SUXA 4KMQA 1N82A 3PZQA 3UYIA 3CH0A 2DJLA 4B5SA 4UTTA 5HWNA 5BXTA 4IG2B 4LCRA 1IWAA 1LBMA 3GUGA 3WF1A 4LT9A 3ARVA 1LCOA 5HMEA 1E9YB 2JEQA 4AQLA 1OGBA 1NOUA 3M0XA 1UD5A 3CQIA 3ZMRA 3EMZA 4GISA 1UP3A 4QLKA 4C90A 2I5IA 3U7BA 4DVOA 4WX2A 4LB3A 1PWMA 1G69A 3D47A 3P82A 1JPHA 1U30A 1QNSA 2ZZ6A 4W9TA 2H9AB 4QLJA 3QOMA 4G7FA 3GDKA 4AD2A 2X2YA 1MWOA 3EX4A 1GVIA 1WDDA 3IJDA 3VMOA 5IRPA 5A6BA 1UWTA 3EWBX 2ISSA 4HOZA 3SI9A 1XRSA 1BQGA 4C65A 1JFXA 4UBPC 2QDDA 1LM1A 3P3BA 2YW3A 1J5SA 3B05A 5JIPA 3AI0A 5HUOA 1EF3A 4XKYB 2E7FA 4AZGA 3VGBA 2DSZA 3LPFA 4MWAC 4FLOA 3AIEA 4JQAA 5CQ1A 4DY1A 1XLIA 2NV9A 1LORA 1PAMA 4QGCA 4ATLA 3G3MA 1W5QA 2HE5A 3E6EA 4U10A 3UG3A 3UY8A 3WIJA 2PDNA 1JEZA 1Q6DA 3LBMA 1SZFA 2PTXA 2B7QA 4BKNA 1IV8A 3NSMA 1PZ1A 3TTOA 1PX3A 4ILSA 4FOJA 1CT5A 1MRQA 3DERA 1A0DA 4K7YA 3TLQA 1M7OA 1MXDA 1RY8A 2A21A 1F4AA 2PLMA 1X97A 3AHTA 4R85A 2XGBA 2FTWA 2HPIA 5L6UA 3CS2A 4ADUA 1M1BA 5LGXA 2VZTA 4F40A 2NVDA 1WX0A 2C13A 3ES7A 2I5QA 4NAEA 2GVEA 4TIMA 4A22A 3AHZA 1XH2A 1OSEA 4XD4A 4PCNA 2YOCA 5K9XA 1PIIA 3T4WA 4O17A 1JVNA 5AVHA 1XLBA 3PK7A 4TOQA 2FZMA 2QYGA 4E8CA 4H6QA 2OZ0A 3ERPA 1KKOA 3PS7A 4RV8A 1J6PA 1J10A 4GI4A 3APYA 3OBKA 5D2XA 4BHYA 3S6OA 4G7EB 1R9YA 1O60A 1UOKA 2YLLA 3COTA 2ATMA 4L4OA 2HBVA 6A3HA 1HJSA 3DFOA 2ACQA 2QUTA 3RM8A 3ABQA 1G5AA 5I3FA 4FZIA 2GL5A 1O66A 1OC6A 1HKJA 2CZVA 1GVRA 2HSAA 1UH4A 2G3JA 4L7ZA 3WF0A 3EEGA 1CB7B 2GUUA 3SUSA 3SIZA 4JX6A 2TAAA 3N1AA 3NSXA 1IXPA 4W89A 3CWHA 4IPLA 4O15A 3TROA 1PWLA 3IVTA 3KXQA 5I02A 4AWTA 4EE9A 4AD0A 1TB3A 2I5GA 4R88A 4O19A 4IGMA 1UWRA 1W1PA 4JGDA 3IARA 1E43A 2FVKA 3LYEA 4GVGA 2CEQA 3TLLA 3T0BA 4QJ5B 3NQCA 5T9BG 2DVTA 4W93A 2PSNA 3LI1A 3V16A 2DT3A 4G1KA 1G67A 4Q7NA 4M7TA 3GVWA 3TYBA 1XIJA 1JR1A 4R33A 1RBLA 1KBJA 4XAGA 3WELA 1TZ7A 1W5MA 3OG2A 1F76A 3UA3A 1XR2A 5FACA 4E4FA 1TV3A 4NZCA 1UC5A 4NXKA 4GY0A 3P61A 1KRAC 1GJPA 2ACSA 3GAYA 4UTIA 3BCDA 1RCQA 3VNDA 1IYXA 1L6WA 3PNUA 4B92A 4LRTA 4LS2A 2QUVA 3IIXA 3TP4A 2Z26A 4WDXA 3VK5A 4AAJA 3EEZA 5J8LA 1VH7A 3H4GA 3VNIA 3T0TA 2HDJA 4DWSD 1ISWA 3LCIA 4GLEA 3WD4A 3UG8A 1ESWA 1U5HA 4NJKA 1LBLA 1AH0A 2NXHA 1J0JA 5FSEC 4HA3A 5EBAA 3W1TA 4H8VA 1QPOA 3CM4A 3L0NA 4HPHA 4UQ9A 4RE4A 2GJLA 4GVHA 1V03A 2E67A 1QXLA 2ZDSA 1HJUA 5G4WA 3K1DA 4PH6A 5IOBA 2WNWA 2A5HA 2W91A 4HZMA 4A3YA 1TVPA 1E0WA 2Y0FA 1KQZA 3V5CA 2NSOA 1DJWA 4C6LA 5SWUA 4YYCA 4NU7A 3KDNA 3PZTA 1WV2A 2XINA 1XH0A 1AMKA 2VEMA 3IGXA 1GVSA 1U5VA 1W1VA 5HULA 3P81A 3B8TA 5CG7A 1X1OA 1KNWA 2R6OA 3TQKA 1TMLA 3MKCA 5HWJA 2O9OA 3BJFA 5FKYA 4LVBA 1H50A 1HNYA 4EWJA 3G8RA 1IXQA 2WC7A 1L6SA 2Q3OA 3CASA 3QPEA 5LIWX 3V0UA 3W25A 4B5XA 3ARUA 1O5KA 1VBJA 3ICJA 1MNZA 2G95A 5D9OA 3JZEA 3N6JA 2V63A 3CHEA 3VAVA 2G3IA 1DWJM 5DT5A 3AYTA 1FH9A 4QEHA 2D69A 2Q3RA 3B9EA 5G5IA 3DFSA 3N2OA 4PCTA 3KBJA 3P8IA 3G5EA 2VGIA 4AMCA 3ZSSA 1G6CA 5BYWA 1VPYA 2V3FA 2YCKX 1JI2A 3NZRA 3ITOA 1XBYA 1PKMA 2XZ9A 4JTKA 4OE7A 2J4GA 1FWEC 3BLIA 1UPMB 1SZEA 3CK5A 2REQA 3J7HA 5G1YA 1H51A 2EG8A 4ENLA 1F07A 3O6YX 1C93A 4YU1A 4AC1X 4MPKA 1N8WA 4JTLA 3W84A 1WZAA 3MDUA 1B3YA 2IQDA 4AD5A 1QBBA 4ONVA 4QAIA 4GQBA 4TVCA 4RE0A 2QDHA 2IS7A 5FF7A 3WNPA 7TIMA 1W3NA 2OLHA 4AWUA 1OG0A 4NZJA 2FFIA 1XF0A 3TXZA 5CPSA 2GWGA 5C0QA 5CZ0A 3TR2A 4B9YA 3G1XA 2QGHA 1FOBA 1O1HA 5I3KA 1UMLA 3UEQA 3WZ0E 2Y1HA 4AY8A 3HG5A 5I0DA 3GHTA 4Y9MA 1KRMA 3FK4A 3UCCA 5M3WA 4I9AA 3M0HA 4WQ6A 3POHA 1NOWA 4HTBA 4ZVJA 1W32A 1GG1A 3MDWA 4C6EA 3H4XA 4HA4A 1GOWA 3DDMA 3LV6A 4A21A 5D38A 4Q6XA 1E1FA 4V1YA 4IJBA 4W7UA 4NJJA 3NVDA 1XYMA 3OIHA 2GUYA 5BOFA 2J88A 2FJUB 3S83A 5BWFA 1Q66A 3W1LA 4QE5A 4GI9A 3T4CA 1QPNA 2FZDA 4LBUA 4QJ1A 4AC7C 3GG8A 4C5YA 3LQGA 5XIMA 4OV9A 2DVUA 3QC3A 3OGSA 1VFMA 3G1SA 4W8LA 2YKKA 3DENA 3IJIA 4WXZA 4Y8EA 3WQ4A 1GVQA 4JZ5A 5HA7A 1H5VA 2E68A 3QJAA 3AIWA 1R3TA 2ACUA 2I9EA 1VJZA 2YL5A 5CPOA 3URQA 3GIQA 1SZRA 1FDJA 4K38A 3VE7A 1WDPA 2HBXA 3U7VA 3PC0A 2YA1A 4LVDA 4E8GA 3K13A 4E3VA 3A3WA 3PJWA 1H1YA 4R9XA 1J8VA 3ZWTA 1CCWB 2A3BA 1SJAA 2X42A 4NYUA 3HMCA 4UZSA 5GNXA 3SR7A 2WVVB 4DWSB 1XLGA 2PAJA 1GKPA 3F5LA 4IWWA 1I45A 3A4XA 3H2EA 3KCOA 2XSBA 3NG3A 2TPSA 4S3EA 4UNLA 1KM3A 1YADA 4WDUA 3A24A 1KM6A 5HQEA 5ENLA 1XLLA 4B90A 3ATYA 4QJ3B 4PRWA 3L5AA 1GWJA 2W9MA 4OECA 3C0QA 1LLZA 3KDOA 2PGWA 3WLPA 4RZ6A 1NAL1 2A3EA 3NM1A 4UTWC 1KCLA 5HINA 4PMXA 1Q63A 3O6CA 4J9JA 1W1TA 4A4AA 1W3JA 1TSIA 2V30A 1RA5A 1UR3M 1JF5A 1HVXA 3WDIA 3O7UA 1ZNNA 5A6BD 4K1WA 4J3UA 4ASTA 3KBSA 2IKHA 1XLFA 4OBRA 3UYCA 1UROA 5E6ZA 3U0HA 4FAMA 3G77A 2YBTA 4GNVA 4JD4A 2PUZA 2XIOA 3I4EA 1U33A 4R53A 1EO5A 5LA1A 4KEUA 3GXDA 4ML9A 4EOUA 1TE6A 1VS1A 3BK0A 2VRQA 1FHLA 2J7FA 4TX8A 3UU0A 2VGBA 1TELA 1EGZA 3A3XA 3TJ4A 3MHUA 1VJIA 4S3JA 5REQA 2DW7A 4AVNA 4UTUA 2IPGA 1XBXA 3N11A 4ZSTA 2DT1A 4LB4A 2G97A 1K6AA 2VX5A 4XAFA 5BMWA 3DZ1A 1XCXA 3WQFA 5K4XA 2PWVA 4O0QA 3VD5A 2VDIA 2VOMA 1XCFA 4MNJA 2I1OA 2TSYA 3CIWA 1P6WA 1MUWA 1QFEA 1W3LA 4WKAA 5DF0A 4RW5A 4JIHA 3N04A 3ZOAA 3GTXA 3KZPA 1T7LA 3FXYA 3BOFA 1HP5A 3H24A 2J9YA 3KW3A 2XVNA 4NL1A 4NKCA 1HN1A 2QUNA 3W81A 4AIBA 1AQ0A 2UWFA 1WBJA 1TWIA 4KRUA 2OG9A 4O10A 1LJYA 3QY6A 3N14A 4RX0A 3W4RA 3SJNA 4CQAA 4AZ6A 2PDHA 1YBQB 4HZ6A 4L61A 3CWOX 3W1UA 1D8CA 5HR7A 4UFIA 4RXGA 4O1EA 4WJ8A 4A8LA 3V1PA 3JR2A 3PPGA 1QOQA 5FJIA 4EXBA 3BLDA 4F9DA 2ZX7A 4HPJA 5TAOA 3ANVA 1QJWA 4LNYA 1ITUA 1WZLA 1E4LA 3KLKA 3P5YA 4CN4A 3I7RA 3GR8A 5HOSA 4IHCA 3C2OA 1K9DA 3M07A 4GD0A 2VFFA 1X1NA 3ZQ9A 1YKWA 3CZGA 4QG8A 1IE7C 1GVEA 3L66A 3TW9A 2RKXA 3G1HA 4A3UA 1TTPA 4O16A 2WM1A 2PDXA 1FWHC 4ICMA 4K36A 4X22A 2WZMA 2OVLA 4GOAA 2VD9A 4IUGA 4S39A 3R10A 1P5BA 1SM9A 1QHOA 2FB2A 2GVYA 2O4QA 5H8PA 2WHJA 4WY0A 3NQ2A 1EC8A 1RK5A 2X09A 3CHCA 3RYSA 1EHAA 4JYEA 4N9DA 2ANUA 3VNYA 3C2YA 5CG0A 3MKKA 5H8MA 3KL3A 4MAVA 2OWXA 3W7RA 1DHPA 1UJQA 1ME7A 2GGHA 4A05A 1JPMA 3F4DA 4U3AA 1W3TA 1BGAA 4L65A 4C1LA 3WEMA 1FH8A 1G0CA 3ARRA 3VC6A 5FF0A 3V5OA 1JZ2A 3SCUA 3SCTA 4PEEA 5CC5A 1JGMA 1WZMA 3B04A 4P8WA 1LL6A 5LNVA 1TIWA 2QVHA 1RLDA 4GC4A 2GVGA 2PPGA 4HSNA 4M3PA 1M5WA 1US3A 1H09A 2Q01A 4I5XA 4JN6A 6REQB 2CZDA 1TPC1 4FOKA 2VR2A 4QG6A 4KBXA 2G96A 3STFA 4LW7A 2XIMA 3D3FA 4HYWA 5D2TA 7REQA 1TV7A 4OGZA 5DY3A 2WMFA 1E9ZB 2PBOA 2QAPA 4IPIA 2XG9A 4ACZA 3WUGA 2JIEA 2KX9A 4X0VA 3EOSA 3LGEA 5I3HA 2PGEA 3HM7A 4B9ZA 4S3KA 1FWCC 4I5UA 2BVTA 4HCDA 4J2PA 1QWGA 3QHOA 1OB0A 4HNTA 4Z1CA 5A1AA 3TN6A 3HQPA 3LU2A 4JFVA 4ZQPA 2C0AA 3UZJA 2O56A 4RL3A 2GZXA 4GUGA 3GVVA 3KBNA 2Y8KA 2EPHA 6TIMA 4PMQA 1TMHA 3GIYA 1O1ZA 4Z1YA 5FA5A 3E74A 1LQ2A 1OINA 4WSHA 3VDCA 1XX1A 1KM4A 3ZVIA 4W5ZA 1TE1A 3GZAA 5AC7A 3INPA 4F66A 4HNVA 4WK9A 1TJ2A 2E5DA 3SRFA 1WE5A 4Y9AA 1ZFJA 4JY8A 1KFJA 3I3BA 4AEFA 1MDLA 4GQRA 1EC7A 2X05A 1KWKA 4O8AA 3AWNA 3FYPA 4DWDA 3PAOA 2PDKA 1DEDA 1UOZA 4W88A 3NZPA 4GUIA 3W9ZA 2H8XA 3N2CA 2VX7A 1IGWA 3U4FA 1DYSA 3OA3A 4NF7A 3SB0A 3ME3A 4GZEA 1QOPA 1PTGA 1OFAA 1CXFA 3KX6A 6XIAA 1UIOA 1JCLA 2XZ7A 1ONRA 3HMJG 1GK8A 3F5KA 3HGSA 4WRHA 1XIMA 5CKSA 3UJSA 3LV5A 2VYOA 3RGTA 2VRJA 5EB8A 3T9PA 3LTPA 2GQ8A 4TVUA 1R46A 2VCAA 3NXLA 3FJ4A 5DBTA 3BO9A 3ZJKA 2CHNA 2YZ5A 3UP8A 4NAEB 5ABFA 3QEZA 1OYCA 2HPMA 2XHYA 3W7IA 4JTCA 4JY9A 4Y2WA 4DJDD 2RGLA 4HJFA 3W85A 4MZ1A 2W67A 1B3OA 5L9FA 1REQA 1RV8A 4JN8A 4ZA0A 2DFAA 4CQDA 2NVAA 4H9ZA 3NL2A 3WH5A 3WD2A 2VQTA 5CBBA 2Y4SA 3W71A 1M7JA 1LL7A 4MYAA 4PMVA 3RHGA 3T44A 3T2PA 3WG6A 1I2PA 4LTSA 1OHLA 1EXPA 4FOUA 2EG6A 1AQHA 2VT0A 4P7OA 2GJXA 4QP0A 1BKHA 2XN2A 2GGIA 1Q6OA 3WQWA 1EIXA 4B3LA 1RA0A 2WJFA 3WO8A 4PL1A 1K03A 4GPNA 2E4TA 3M41A 3GYEA 4CD8A 1QK2A 3E96A 1X8FA 1VBHA 5E0FA 5CGTA 2BS9A 3U2EA 3PFRA 4M81A 1DWIM 3HG4A 5D8WA 4M24A 3DHDA 4Q8QA 2BTMA 4AD1A 1M9HA 3LDVA 3UJ2A 1CXIA 4QAWA 2J8TA 3P6LA 3GU2A 3VOCA 2GGEA 3N13A 3NNTA 4JTJA 4HN4A 1JD9A 1N8IA 1DOSA 2Y5JA 3R0UA 3L12A 4LUIA 5EA9A 3IUDA 3GXTA 3MI2A 1EJWC 2ZIDA 3DX5A 2Z7GA 3W70A 4A8NA 3A22A 5IFTA 2HNHA 4XVDA 2PDUA 3ARSA 3AO0A 1EEXA 1DTUA 4AZBA 3R58A 3R7MA 1EJXC 1VR6A 1X6UA 1XIIA 4EWND 3BG5A 1VYRA 3GDRA 3BCFA 4H00A 4DUVA 1W5NA 3G6MA 3RDKA 3TU9A 1BTCA 3GNXA 3BQ6A 5K3VA 3ABSA 1RK6A 4XZIA 2L5HA 4JL2A 2EPNA 4Q8VA 4MUZA 3AC0A 4JN7A 3WCZA 1XGEA 1X1ZA 4LOCA 1EGVA 2D0HA 4KGLA 2CHRA 2NW0A 5CJ5A 3HO8A 4DZ5A 2BY1A 4DZIA 4IGSA 4BQ3A 1FQ0A 1T40A 1NWSA 4HA1A 4RNIA 1RXOB 5EMLA 1QUMA 4UFMA 5KETA 4IPNB 3HGRA 2CZ5A 3GAKA 4TTUA 4UXDA 4Q8NA 3D0CA 1R2RA 1RR2A 2OT0A 4KWOA 4PTWA 4FF7A 2HQAA 3MYPA 1HIZA 3O8AA 3B9AA 2KZHA 4M5PA 2RUSA 1Q6RA 1Y65A 1BWKA 1FY6A 3TKFA 4FX8A 4H1ZA 1V51A 4JTIA 3WH9A 3LZ3A 3OTRA 4FS9A 1KTBA 3P2VA 3TYDA 3QSRA 4LX4A 3PM6A 3WJSA 4ERGA 2OQHA 3ONCA 1V0NA 4PC8A 3W1QA 3BCJA 1QPKA 2ZA2A 1VFLA 5A6KA 1AD1A 2GYIA 1XHGA 3S9YA 1W5OA 2EQDA 2CFFA 1LRNA 3UWUA 5A6LA 4XIMA 3L2IA 4LV4A 5E70A 3P84A 1RCOB 3BC9A 1UKSA 3KTCA 5IHSA 3W38A 3KL5A 3M0YA 1R87A 3MSYA 4O18A 1Q6CA 2WVTA 3WK3A 3TR9A 2PP3A 2PTWA 3DYPA 2FPTA 4GACA 3IV8A 5DCBA 1T8QA 3IS4A 5U4NA 4MKVA 4B2DD 2TYSA 1FWRA 3G0XA 3GZ3A 3W7HA 1D3GA 2B7NA 2ZXAA 4AZHA 3NDOA 3S46A 1VKFA 4PMUA 3NUKA 4CN1A 2YL6A 1JNDA 3T7VA 2JE8A 3VM5A 3QHNA 2QT3A 1VEMA 2J62A 2V0TA 2FDMA 4UFKA 1G7UA 4UFLA 3JW7A 1U1HA 5CGMA 3F4VA 3CHDA 1FWJC 1W2PA 2AKMA 3R79A 2C1HA 1OK4A 2E1WA 3EWCA 4XUYA 4UOJA 3T0AA 4LAMA 3H53A 3T8LA 3AMGA 4G6CA 3WQCA 3WNNA 3L4YA 3B8SA 5C70A 4ZOBA 2WSQA 3ZJ8A 1A5KC 2ZUMA 1M01A 5DMMA 5AC6A 3ABZA 4GFIA 4E6MA 3R11A 1QNVA 5BZAA 1OABA 4UR9A 5C55A 2ATSA 1ISZA 2X30A 1L8PA 7PTDA 3EB4A 1W3KA 3IAPA 2D2OA 3MCOA 4L4PA 2FHBA 3A9BA 3WKZA 3E9AA 1SR0A 2XDFA 2Y85A 1WDSA 3VOHA 1ZALA 4AF0A 3E3HA 4Q33A 8XIMA 3WD3A 5CZJA 5GJMA 4Q7BA 3THCA 3GC2A 2NX9A 1UKQA 5LNSA 4IX2A 1E6SM 1HJWA 3EWXA 5FF2A 3S1VA 4M6PA 4RE3A 4PUNA 5HUPA 2O9PA 4KCTA 4MZ8A 2YCIX 1XBZA 3VA8A 4JNZA 4C6JA 1H4PA 3VZYA 3HQ1A 1UR1A 4O14A 1LWIA 3K2GA 4LC6A 4LY4A 1NVMA 5KZEA 3LA4A 4MIMA 2LLEA 3WF4A 3RN6A 4Y96A 4DHGA 1DL3A 5FL1A 2QCFA 2HS8A 3AOFA 1TJ0A 3S42A 3GFYA 4QDPA 3LOTA 3WNOA 4HSHA 1D3CA 2YL8A 3GTFA 3PBVA 5FJJA 4BY3A 4IJCA 4A8RA 1FWDC 5C9XA 1R3QA 1NY1A 3C52A 3O6DA 4O1CA 4DYJA 1HKKA 2ZE3A 4C6BA 1OM0A 2ESCA 4A8IA 1E6XM 1WUEA 3APGA 4O11A 4D8LA 5HATA 4I5RA 4MMWA 4DJFA 3OG3A 4H4IA 4Z1AA 1BVWA 2WZTA 1KM1A 1A4LA 4UMCA 5E0CA 2IXUA 3T08A 1CDGA 2O55A 4LAZA 5FJOA 2XSAA 2RFGA 4IXXA 3CYJA 1ADSA 5AYZA 5GNZA 1D7FA 2PC4A 1ZCCA 2G4JA 3IK2A 1GVFA 4GBDA 4XSMA 1EYEA 3S2CA 2JQXA 2PB1A 4F0RA 4LF1A 1WOAA 2VEFA 4HJWA 1KCXA 3VILA 3BAIA 5D05A 2XWEA 2OEJA 1CGVA 2GDVA 3OA5A 4F2BA 2RGMA 4DQWA 3PPCA 5D04C 4B5VA 3CAQA 1SYTA 1W3HA 2WSPA 3VPLA 4TMCA 4PBFA 2GGGA 1XLJA 3LCFA 3AQUA 1W31A 2VL4A 1XWYA 3RJXA 2VVNA 4UCGA 3UGRA 1OG6A 2YXGA 2IW0A 1EP3A 4NZFA 4F0SA 2C14A 3IPWA 1A3WA 4V28A 2AQVA 2NT0A 2I56A 2FH8A 1SO6A 1XISA 3KVKA 3PPHA 1BG4A 3LNMA 4HK7A 4B4FA 1V3KA 2Z4GA 2DUXA 1H11A 3V7PA 3OYXA 2PP1A 1CGUA 1T99A 4LEFA 5DO8A 3PG9A 4QG9A 2GK1A 1NFBA 2QZRA 3CEPA 3EDFA 1S2AA 1TRIA 1HKVA 2DIJA 1US2A 5I79A 5TF0A 5REQB 4AH7A 5CCZA 9XIAA 5LIXX 1XGDA 4GNJA 3EDDA 4B5TA 1Z42A 5DEZA 1HGYA 1ODZA 3W53A 2ZE0A 1Q45A 1ZPTA 4UQAA 1SFTA 4ZTXA 1V3IA 2DUAA 2QNEA 2DJXA 1K77A 4G56A 3W87A 4H83A 5ABEA 3RLUA 1S3HA 1KM0A 1BLIA 3LCHA 6ALDA 3KL0A 5IDIA 5A8QA 3N34A 2EJAA 1C7TA 3EXSA 1EP1A 4M19A 5E0KA 2ISDA 4IIHA 2NWSA 4Z2KA 4RZBA 1VCGA 2F6XA 2ASHA 1F3TA 1PYMA 1M3UA 4GIYA 2C1GA 3G0UA 2OKTA 4X9YA 2J66A 4I7VA 5LNWA 1B31A 3MA8A 4AHPA 2HK0A 3N4FA 3NIYA 5EMMA 3W2NA 3DGRA 3LTYA 2J8GA 4EX4A 3FS2A 1AZ2A 1UD6A 1JIBA 1WYIA 3WDQA 2G41A 4OT7A 3TC6A 2IUZA 3I10A 3A64A 1EX5A 3CQKA 3MW7A 4JFUA 4QM1A 1S46A 4HU4A 1YPIA 3IAQA 3EOUA 1WQ5A 4FIQA 2A3AA 5CJNA 3UR8A 4BF9A 3UD6A 3P0WA 4XZ9A 4B16A 4MDOA 4UQCA 2V5LA 2ZYFA 4CCEA 2ZRVA 5AHIA 1QI2A 4KIEA 3MSGA 1H63A 3R94A 3RR1A 2W61A 2VFDA 4CQ8A 2ZZ1A 5C5YA 5CSRA 3Q45A 1UR2A 3GO2A 1U22A 3LUTA 3Q94A 4Q8PA 4RUBA 1IEIA 4JHOA 3VXGA 5KTLA 3I7SA 2NXGA 2ADAA 3HFYA 2WWDA 1TFVA 2E3ZA 4L4MA 4POCA 4DPPA 1MW2A 4GO9A 4H9UA 3LMYA 3CBWA 2WLZA 4WF7A 4Q32A 2Y7EA 4WY0B 1F8IA 3BMWA 1TV4A 1SJCA 3E0FA 2D20A 1TCDA 3MQTA 4QBXA 1B0IA 4PL2A 3N3TA 5D9PA 4GX9A 4C7DA 5HANA 4RDVA 4YCOA 4GKTA 1Q6GA 2DGAA 3W88A 1O5QA 1CB2A 3NZ1A 3HPFA 1TYGA 2CC0A 2P5NA 4MWAD 4HYVA 1TA3A 1GOMA 2J6VA 4NG3A 2H90A 4MWAE 2EGZA 4JYFA 1KCZA 3IGHX 3WUEA 4FNQA 4KFOA 3R25A 4AVOA 3LX9A 4CD5A 2PI6A 4CCZA 2Q6ZA 2E5BA 5LXXA 1XUZA 4DZAA 5CC6A 7REQB 2ZA3A 2FQIA 1OFOA 3VUPA 2QF7A 5H2ZA 4MUPA 3W3OA 4Q4OA 5D32A 4DF2A 2PDBA 4ACZB 1OCNA 1XP3A 2FGZA 4DJEC 4PMOA 3WEOA 4AXKA 1JZ4A 4IIDA 4A35A 1KR0A 4L1XA 1I2QA 1K70A 1MXGA 1IWPA 1OGSA 4MLRA 1E56A 4RJEA 4JAWA 1ITCA 1I9CB 4KS0A 4NJGA 4H8NA 1IR2A 1KXTA 2OODA 2PWDA 1MSSA 4J3XA 3W83A 3WMSA 5A6JA 4ZO8A 3H6OA 4JKKA 3WN6A 3CHVA 5H1WA 1AA1B 2O0TA 3MUAA 4LUSA 4JR5A 4FR1A 3XISA 1U2YA 4HA0A 1W9BM 1VIZA 4PMYA 4JDYA 3H8AA 3PG8A 1QNRA 4C1KA 2WJEA 1B3VA 1Z9AA 4J7RA 5LYRA 4EPEC 1UD4A 1XD1A 5LIKX 1D2KA 4QDMA 4OWGA 4PZVA 2BV9A 3ZVHA 2CITA 5A95A 4BR1A 3G1RA 4LH8A 1WOBA 4LVAA 1PKYA 4MNMA 4Q3MA 3AWOA 4G1NA 4P5UA 1V3JA 4P7LA 5CH9A 1ZL1A 4B91A 1IT7A 4R7WA 1XBVA 1RP9A 3WSUA 1YHTA 2QCDA 4XD5A 2DORA 3ZR5A 4IICA 2O9RA 1Q7MA 3UR7A 3BDKA 5A8NA 3QC0A 3AHYA 3GH4A 1FWGC 2NX3A 1XC6A 1E51A 3K8LA 3C6CA 2VURA 2P88A 2D2HA 3ZIZA 4N2YA 1XL9A 5ABFB 1GJWA 1JDEA 4Q4KA 2A1YA 1REQB 2XH2A 3PB0A 1JYNA 1CPUA 3QV9A 4KERA 1CECA 1S2TA 3VVGA 3NJ3A 2CLPA 1TRDA 5E9XA 1JD7A 1E55A 2JALA 1P1XA 3WFAA 1C8VA 4FLRA 1EJUC 3H7UA 5JQ9A 2PC8A 2BHZA 3GVRA 1V77A 4WVXA 1V3HA 2YPIA 3W26A 1E0TA 1DE6A 2VR5A 4MOZA 1VJSA 3WLOA 3FX4A 4QFUA 3LXBA 4LVGA 3TV8A 4TV5A 4XB3A 2CKSA 1ONEA 1B57A 2VELA 3CMGA 3TJIA 1VFOA 2DZAA 4J1OA 1UMYA 2Y61A 1NP2A 4MYXA 2HVMA 4X61A 5K9DA 1DJNA 1IZKA 4GY1A 2IQ0A 3U3HA 4TU1A 3S5NA 1G4PA 2V67A 5MHBA 1WZKA 3GKFA 2Y88A 3URBA 1I6NA 6TAAA 2ZBTA 4KCWA 3GFZA 3LCWA 5AY7A 3VDGA 1T41A 4DJDC 3AS1A 2QULA 3WF2A 4D6GA 1TPVA 3RLVA 3TCSA 4X60A 2INFA 1CIUA 4ZFMA 3UZ5A 4K1GA 2IXVA 4B3KA 2VWTA 3L4XA 3WQOA 1JPKA 1S1PA 4D6EA 3OHMB 2CPUA 2WXDM 2B31A 1I1XA 1HP4A 1KWGA 1K8XA 3OGRA 2PTZA 1DVJA 1V7YA 2YCLA 3LM3A 4CVWA 1NDWA 2OZ3A 2ONEA 2QJNA 3MPGA 1S39A 1BFNA 4XD6A 3LHUA 1Z32X 1IZJA 1AL8A 4YNGA 2FVMA 4GYFA 3ZYZA 1EJTC 2WLYA 2V68A 3WDPP 1EPXA 3GU9A 4KFNA 2CESA 1T8XA 3B97A 1TUXA 3N9KA 1BGGA 1NQ6A 1FBAA 3BUVA 4LUYA 2WSYA 2FJKA 4LEQA 3HG2A 2ZICA 4S3CA 2PF0A 1QPRA 3MMWA 5F4WA 5EMYA 5GJNA 5D2VA 2YZRA 2ZOXA 5CBJA 2QPXA 3WJYA 4HMEA 1FWSA 2X7WA 4JIEA 2HCVA 4M0XA 3LN3A 2ZRYA 2KAUC 2WBKA 5T91A 2O92A 2PU1A 2W4XA 5FJTA 4IH3A 4Y8FA 4GUFA 1HKWA 2BOFX 5TQLA 4RLIA 4E0CA 1WBHA 3IANA 3ITXA 2XISA 1CXEA 3UT0A 3N73A 2G3FA 4PB4A 1FWWA 1L6GA 3L23A 2Z24A 4D6IA 1KTCA 1UHVA 1CXKA 3FYYA 1YXDA 3KUMA 4GJ1A 1AODA 1HL8A 4Z2JA 4DM2A 3DI1A 3SRKA 2YBVA 5LNRA 1NH6A 1E4IA 4JTSA 1TO3A 2E6YA 5MKGA 2P1FA 3GNOA 4DNMA 1DJQA 1VPXA 5K9CA 1OK6A 3O06A 3HV9A 4S23A 3AMDA 3MVTA 2G37A 4XSLA 3RLGA 3I3DA 4EIVA 3JS3A 2ZUNA 1EZWA 1H41A 3N9SA 3EGJA 3PUOA 1WKEA 3FFSA 3R8GA 2JBMA 4YVPA 3EWDA 3STCA 2E5CA 3B0PA 1MUCA 3E2VA 1S38A 4XQ6A 2XFYA 5CJMA 3O0FA 1AW5A 4I7UA 3H4WA 4N9EA 2DW6A 4AEOA 1W9UA 2B7PA 3GBDA 3CMJA 3KCJA 3UZYA 1KCKA 4Y90A 3KZSA 2HXUA 4XIAA 3CUGA 4FHAA 1H7WA 2A3CA 4LYKA 3E5PA 2DSWA 4D8AA 3OZPA 3RJYA 2FTPA 4JEJA 4W8AA 2V5KA 2WJZA 5E5CA 5LA2A 4E4UA 5MF5A 3DYOA 4UFHA 4FI4A 1W1B1 3AIQA 4WDWA 1EQPA 1DJGA 3MANA 3BV4A 3LERA 1P0BA 3S6TA 2YGYA 3EWUA 5FEZA 1WAWA 5GVJA 2Z2AA 1J0IA 4LAOA 3M7WA 3TXVA 3W1AA 1W1A1 1B3WA 1B9BA 4L6DA 2HJPA 1J93A 1W56A 4ECLA 3BVJA 1K7EA 3KVJA 4PR4A 4PCPA 3QTGA 1R30A 2Y5EA 1SW0A 4WSJA 3SRHA 2ZUWA 1W9VA 4R7OA 4A2SA 3NFUA 1UH3A 4AG0A 2X0YA 2YYUA 3P80A 1PDZA 4HU3A 3HURA 5DRCA 4RZ4A 3M0LA 1UASA 3TYZA 1QNPA 3PUGA 3EOOA 5M5DA 3MSDA 5HNNA 1ONWA 1ZJBA 3H22A 3UZWA 4GI8A 3GBEA 4S1FA 3LCXA 4QQ3A 5CC3A 1QNOA 2XM1A 3TX9A 1RPKA 4JTDA 2WHLA 4EF9A 1M53A 1UA3A 2VZVA 1PDYA 3A3HA 2JKPA 5CGQA 1UC4A 3B8UA 1JFHA 1TV8A 3C0SA 3NTYA 1OT1A 3GKAA 3TA6A 3POCA 4LUTA 9RUBA 4H7CA 5CXPA 4OBSA 4I9TA 1H60A 2V5CA 3R5EA 3HGOA 1PX4A 1IZCA 4L80A 4AISA 3IV3A 1M04A 2E6FA 2OYMA 1Z8AA 8XIAA 2PRMA 4MF4A 2RDWA 4H04A 1XINA 1GKRA 4E3TA 3GHRA 5LA0A 1JXKA 1K9TA 4HMCA 4CNOA 1OZQA 4Q4PA 1V6YA 4DYEA 1WA3A 3VD3A 1UWUA 1WKYA 1W54A 1JYVA 2QDEA 2Z2UA 4DO6A 2CBVA 1RSCA 4X2PA 1HJXA 2YW4A 5TD4A 1GHRA 2Y8VA 4IIBA 3VGEA 3S9ZA 1UP2A 3TOPA 4OU1A 1S2WA 2J7BA 4NJHA 3S2MA 3PZMA 1WB0A 3PBYA 3OLIA 4OBTA 3QBUA 4ZOAA 4CNNA 2D3NA 2EKGA 1ZY9A 3GR4A 4J35A 3NPVA 1SFSA 1NM9A 1NTHA 2CNCA 3R8HA 3NQGA 3EKZA 2PWGA 3OZYA 3TJLA 2VD8A 3S1UA 3EB2A 3KP0A 4IIFA 2WHMA 2XUCA 3WLLA 4AU0A 4EAMA 3IJ6A 3ZJ6A 3GE7A 3K4AA 2D0GA 4EKJA 1IIHA 4X9SA 1RD5A 3E5BA 3OODA 4DLMA 1FX6A 1RBOB 2GOUA 2RAGA 1TWSA 2FLIA 3HOJA 1E5JA 1DIKA 2WCSA 4C6PA 1ZLPA 2E9LA 3WH7A 1ZCOA 5HR6A 4RNHA 3PNZA 1S3TC 3GC5A 3LGDA 3L7RA 4XD3A 1VFUA 4O1FA 1V8EA 3RO8A 3W22A 3JUGA 2GK1B 4YXGA 3TYUA 1R38A 2QAFA 3KOZA 2W3ZA 2G4FA 1VRDA 4IGHA 3UVIA 1JPDX 1L8NA 1JUEA 1PZ2A 2XVGA 1CBGA 1F2JA 1E15A 3GB6A 3RITA 2V9DA 1XYAA 4JIIX 3UXDA 1GPFA 2E28A 3MP4A 3TOYA 2XWDA 1DJIA 1TPFA 4NT0A 3RX2A 3TCEA 1ZU8A 1OCJA 2BY2A 2V3DA 1R0MA 5AYIA 5CBIA 3RF9A 1VEPA 1VBGA 3BW4A 3OVQA 2C71A 4GUHA 2F2HA 1A5MC 4R5EA 4RCXA 3PANA 3VIJA 1RHCA 3GW3A 3WQGA 2XH7A 3PJUA 1TWZA 3ZM8A 4GH3A 3ARXA 1AW1A 3DU0A 1CXHA 1QU4A 3DECA 5FSDC 4BI5A 1KO0A 1P6CA 3P74A 1I0DA 2PWEA 4YL2A 1NWTA 3EAUA 1EEPA 2J78A 1TTQA 3WQ6A 3PWIA 4P8UA 5AECA 4J4KA 3AIRA 2XPKA 2PU0A 3MMTA 1VCVA 4RXFA 1JAEA 1NELA 2PLJA 1R2TA 3ZSTA 2EPOA 4PMRA 4QX4A 2IKJA 3AMCA 1OY0A 3ZLGA 4XVEA 1OBAA 3IWPA 3VMPA 1TTIA 4IT1A 3KAOA 5EBUA 1YX1A 1EUNA 3G24A 4XKMA 1LT8A 4F8XA 2OGYA 4JIRA 3EA1A 4MB4A 1WXJA 3H2NA 4UQEA 1SFLA 1A3HA 1OD0A 5XINA 1A5SA 2FPVA 2QCMA 1VD6A 3HBLA 3B06A 2I14A 1AJZA 1K9EA 4MNLA 3I68A 3S9IA 3U57A 1MYRA 4S3BA 1US0A 1VFSA 2WC4A 3DKJA 2ZX9A 2WOQA 3WY1A 3T78A 1TV2A 3PZOA 1QNQA 2HS6A 5I24A 4MM1A 4P8XA 2J9XA 3MP5A 3TQ0A 2J7DA 2WNZA 3SCRA 1BHGA 3LHYA 3MY9A 4XO7A 2POZA 4O50A 3MMDA 1YE4A 1CWYA 5FEPA 1TA3B 3FKRA 4FA3A 3N6HA 2OYKA 1AW2A 1GORA 1VYSX 4HVXA 2AOSA 3F2CA 1TPH1 2VENA 3F7JA 4TXEA 2EPKX 1Q13A 1EF2A 1ZP4A 1GQIA 1F5ZA 3H70A 2NQJA 1YNQA 3KOYA 3SW6A 1OQFA 1Q6LA 3GHUA 4I9MA 3CAWA 1VFHA 1MRAA 1XQLA 2ZZ3A 3AISA 2B4GA 5LZLA 3PBUA 5AZ0A 2QPUA 3CC1A 3P8JA 1ZJHA 1PBGA 4KFPA 1DKWA 1JRCA 2ZKMX 2CLFA 3H2OA 4LCQA 3EKLA 4FX6M 4F2TA 4LPCA 1GQJA 1ZZMA 1HUVA 1XPYA 5KEZA 3VIMA 4Q4MA 5FEXA 3NDYA 1QRQA 4F79A 3OQ8A 3BZJA 5F7UA 4UIOA 4WD0A 4ZR8A 1KXHA 2ZDRA 4Z2GA 4L9XA 4PRRA 3N6QA 4HIBA 4PRTA 1BTMA 1XSJA 4MGGA 1E5NA 5DANA 3BLEA 4XBSA 4AX7A 3WLHA 1H1NA 3KTSA 2DSUA 2OU4A 4GKLA 1KFCA 2MUCA 4LUSB 4HNLA 1XXXA 3HQNA 5C7VA 3C2RA 3ES8A 1BYCA 1KA9F 3YPIA 3MC5A 2WMHA 2DPEA 5AC4A 2DEPA 2VGFA 4RDWA 2UY2A 7TAAA 1V93A 1MZRA 5BU9A 4Q8UA 3S5OA 3WNLA 1MO0A 1G4TA 3W6LA 1XFBA 3VGHA 1E3ZA 4I90A 2DZPA 2ZZ5A 2WK2A 3VM7A 3W7LA 1IT0A 1LOLA 2ZA1A 3ZVHB 1E4MM 5LIYX 1AQFA 4WEVX 3EWWA 3N15A 4IF2A 4I6VA 3VUSA 2WCAA 2BWGA 1V02A 3WQDA 4C6MA 3GDMA 2CIPA 2ZVIA 5D4YA 1JI1A 4QR6A 2QCDB 4MHBA 5D9NA 3PY2A 1VENA 3H23A 4JPGA 1S2CA 1THFD 3KS6A 5F4SA 5FAGA 5H6HA 1I2OA 2FMNA 3UWWA 1F61A 5A8GA 2FFCA 4JIQA 3KEHA 4ATDA 5DN1A 4R9OA 2DIEA 4J3TA 2DSVA 1YYAA 3N18A 4IMDA 2QW5A 1M03A 4PFHA 1RH9A 4N9BA 2X41A 2Q8XA 4M6VA 2H8ZA 4QTGA 1UQZA 4KKXA 3QQ0A 5BXSA 1DJZA 1QO5A 3WNMA 3B0UX 1TX0A 2Z1SA 2ACRA 3QW3A 3KVLA 3UPMA 3UERA 2OYLA 3W74A 2YXXA 2V5DA 4CGTA 5M03A 3TC3A 1QW9A 3DAQA 4JFTA 1RAKA 4YCPA 4LY8A 4C6IA 3SY8A 2A3LA 3SGZA 4UTFA 2AAMA 2HEJA 2Z1WA 3F1QA 4WUIA 5K4ZA 2F84A 4IGNA 1ZGDA 2V81A 2CWXA 2V3GA 4AWSA 4M8UA 4AIEA 3CIXA 3QF0A 3PN8A 3CL6A 1EDTA 4MDPA 5FOOA 5HQMA 4PE8A 5D03A 4ZXLA 1J0ZA 4N9CA 5HNUA 3CAKA 1AD4A 3PBWA 2DT2A 5CZTA 1BSLA 1ZBVA 3MUXA 1AJ2A 3OBEA 2VEGA 3WBWA 1SJBA 3SECA 1UR8A 5CZKA 1UD8A 3TYCA 2RDTA 2J75A 1YQ2A 1ODUA 4GI6A 4K8HA 2Y2WA 3DN5A 5DCDA 4BEQA 1I2NA 4H9XA 2UZ9A 3FIGA 3RNDA 3NZGA 3QY8A 1HXJA 3UNTA 1EJSC 3I6EA 1E9IA 4KQNA 2DZBA 1SJDA 1KXVA 4DXKA 2QF8A 3B0YA 4TTGA 4G8TA 1H0GA 4KGJA 4FF5A 1DWFM 5AHMA 3TE9A 4PGLA 4LQ1A 2EEXA 4UR7A 5I7GA 3CEUA 3PSWA 4O13A 3VKKA 2J7EA 4HYRA 1QT1A 2YCLB 4CVUA 2RDUA 1H61A 2VUNA 4J3ZA 1EL3A 3QGAC 3O05A 4Y6GA 4CEXC 3ITGA 2VXNA 3BAKA 4O1BA 4U3CA 3NDZA 4MY9A 4J3WA 2J24A 4WY0F 4AHOA 1V6WA 5IBXA 1HO4A 1Y5WA 5BRBA 5G4EA 3DCPA 1VBRA 3U4AA 4JX4A 1PZ0A 1BVZA 4NZ3A 2Y24A 1QMLA 4HMDA 3SADA 3QMSA 4BF7A 3RG6A 1SU5A 3SQSA 4NRRA 1FWNA 4J2MA 4YVXA 3UW6A 2Z28A 4WJEA 1XIEA 1WUFA 3SSZA 4NQ1A 4IP4A 2WWCA 4FB7A 5CAKA 5D33A 2C16A 1AH3A 5D09A 4XUGA 4E8DA 3KM8A 1OFRA 3WFLA 1VP5A 1RPXA 1EJ7L 1O94A 3K46A 5A8OA 5M2FX 1XFCA 3TK7A 1XKJA 3AXKA 3H54A 1C90A 3WQ5A 4PUWA 1NIUA 4JTFA 5G1TA 3PZIA 3JU2A 1DXIA 2C0HA 3UR5A 4AMAA 3WLSA 3BOXA 1IWBA 1KTNA 2NZLA 4OKDA 3ZT6A 5E1QA 5MKGB 4CQCA 4ORMA 4NJIA 4D71A 2AL1A 2Z1KA 2PD5A 1R3YA 2OGJA 4N7QA 3GVQA 3P14A 2OTDA 1XYCA 2A3HA 2OOGA 3ARPA 4A2RA 1RALA 1AMYA 1QAPA 4ZQCA 3SUWA 1HFBA 3SJ3A 4HOXA 1C8QA 1Q2RA 1H3GA 3CL7A 2NQ9A 2QJIA 3S5YA 1XD0A 3VIGA 5IHRA 1R47A 7XIMA 4PMNA 4E2BA 3UXIA 1TJRA 2X1RA 4MJ2A 1TZZA 2YCEA 4H41A 4YMZA 5I77A 1JAKA 3VC5A 5HBFA 1H62A 3SDOA 1VQTA 3FV9A 3KOWA 1QWKA 4DYKA 2ZZ4A 4MKSA 4J5NA 1BWLA 1TR9A 2B0MA 2VRKA 3UG5A 3LENA 3L68A 4FR6A 3MUY1 4BWLC 2WBGA 1K02A 2W63A 4XTDA 3THAA 4DJDA 1YPXA 3C8NA 2XGZA 2BSLA 1A5LC 3RMEA 1IT8A 4R7JA 3B8IA 2PLCA 1JDCA 4C6FA 4GYPC 4ICCX 2YR1A 3AU2A 4PUMA 3MJYA 4IL2A 4EANA 5HJYA 3LXAA 5EMJA 3D5HA 4G9PA 1TPWA 4UTKA 3NXFA 1C29A 3TH6A 5BU6A 3DBPA 3BLKA 2BG5A 1AJ0A 4JTGA 5H8UA 1V3MA 1XLMA 1DQUA 2W66A 4MPQA 3EXRA 3FAXA 1HVQA 4RKAA 5JVLA 3BOLA 3DEQA 3PP7A 1ZJAA 2V3EA 4L9YA 5D2YA 1ITXA 1R5YA 3VX1A 4CUCA 3WF3A 4LYRA 3CPUA 4LAKA 4WDTA 4Q7IA 3VFCA 4UC5A 4J3VA 4H6KA 3VOIA 2YXOA 3TTSA 3AZSA 4URIA 3LGGA 1POJA 4HHMA 3QV7A 4OUIA 5I07A 3SQMA 3LHVA 4O28A 4N6FA 1PO9A 2WMGA 1SR9A 1E4NA 3AALA 3AHXA 3SM0A 1YTEA 3CTLA 5FF3A 4YJ5A 2GSJA 2PEVA 1IEWA 2AGKA 2BVYA 3TWAA 1JZ3A 4XISA 4YPJA 3VKJA 2FIQA 5C54A 4OIFA 2BVDA 4LUTB 3LS9A 5F1UA 3T6CA 2XGIA 3AS3A 4KCVA 1BKSA 3I7QA 3Q4DA 4NZ4A 3TSMA 4Q8WA 1UD2A 4J28A 3U6WA 3M16A 3QTPA 3G1AA 3FCPA 2CERA 2R1KA 5AC8A 2YJQA 3F2BA 2W27A 3WDRA 2IQTA 4PMJA 5G1MA 3LTSA 2E8YA 2ZRUA 5BMXA 3V36A 2QCLA 3UWEA 5CC7A 3P60A 2WC3A 1A50A 1LG1A 1YIXA 3M6DA 3GG0A 1GOQA 5DRIA 1PHWA 1XG4A 1MNSA 2HK1A 2QUUA 3AIVA 3GXFA 4KIRA 1ZP3A 1EHNA 3LSBA 4RZ5A 4FK9A 2VC5A 1JCXA 3WUBA 1DBTA 4RPPA 2OB3A 2R1PA 1TVNA 4LS1A 4V33A 3EOEA 3W6MA 1UWQA 1T96A 4ZZ9A 3VFLA 4S3AA 3B9DA 4NYYA 2V5JA 4J40A 4UR8A 1ICSA 3URNA 4PBEA 4KEMA 3G18A 2VM8A 3F4WA 4FMVA 3GNRA 1J18A 1KM2A 4H7VA 2AQOA 3W1MA 3G2GA 5FD0A 4TV6A 1D7KA 1JCNA 3UESA 1CLVA 2CBJA 4PBGA 1W9DM 3CUIA 2NX1A 4JDBA 1QR7A 3CV2A 3MS8A 3NGFA 4C7FA 3NVTA 1NF0A 2Q71A 1S2VA 4QRNA 3STPA 4GNKB 3HZ3A 3O07A 4IFRA 1L6YA 3GK0A 3QLDA 3ATZA 3R0KA 1AK5A 2PDLA 5ABGA 1F6PA 1W8GA 2PDJA 4LC8A 5C8BB 3FJLA 1PUDA 3VZXA 2I7GA 2RHGA 4DXXA 2VEIA 2FKPA 5HQLA 3RU8X 2PURA 1GONA 1X7FA 2BY0A 4YTTA 1E0UA 4B2DA 2OSYA 2FPYA 1KB3A 1P0DA 4DELA 1TTJA 1RVKA 5M17A 1P43A 2ZWYA 4HK6A 4EPBC 2AL2A 2Y7FA 1J5TA 1XIDA 1RP8A 1ZQ5A 4PUUA 3BGAA 4AXNA 2QCHA 1X98A 4LNCA 2OX1A 4IOTA 2FZ8A 1Z6KA 3IUIA 1IR1A 2CZFA 3SN4A 1V02E 5BROA 1S5MA 3L21A 1V6TA 3W7NA 1I8JA 3A9IA 2O7QA 3A4JA 3W1XA 1QTWA 2WQPA 4GK8A 3GYCA 4BS0A 3GS6A 1GT8A 4A3RA 2CBIA 3QZAA 1V4YA 4C60A 2CLLA 1MUMA 3CUXA 4HGXA 3UPBA 4A6GA 4JTQA 4IP5A 3UXKA 4XZHA 4BEUA 4R34A 4ZSUA 1ME8A 2QGYA 4LU0A 4XAYA 1FTXA 2VUYA 2ZX8A 4GG9A 4GCAA 3WDHA 4UZUA 1H7RA 1QHZA 4PYSA 2NSXA 4M6UA 4W87A 3N19B 4FXRA 4JQ2A 1EWEA 1V7AA 2UY3A 3RR4A 4F0KA 1WCGA 3FXGA 5JH1A 3O16A 1UPPA 1MXSA 4Z2HA 1E0XA 1B4EA 2E8ZA 4NVTA 4UNKA 4HD5A 4DUXA 4KRZA 3EDJA 1E0VA 3LRMA 4M7SA 1XDLA 4S2BA 3NQBA 1SVDA 2VTFA 3B9NA 1HF6A 4WSKA 1WDWA 5D2WA 2Y6ZA 2VC7A 4N4QA 3VNJA 1Q85A 4HNNA 1FHUA 1XKYA 4L6HA 1F8MA 1TZ9A 2R1MA 4UQDA 4C1NA 2QXWA 4ZODA 5F2LA 2BGNE 1MFVA 1CTNA 3LNPA 5TNVA 1EA0A 3BMVA 2WNQA 1Y7VA 3IJ9A 4WIWA 4DJED 4KRTA 3SFWA 1GOXA 1B30A 5HPCA 2Z7KA 1UP0A 3NQ7A 4KEZA 8A3HA 4D6FA 3DFQA 4RV3A 3A4WA 4DUOA 3W2LA 1SMDA 2HTMA 3C61A 4DM1A 3XIMA 5HPOA 3ARQA 1ML1A 1W9PA 3SUUA 2R94A 3H21A 1MEIA 4O0KA 3LPOA 3F5JA 1MQPA 1OC5A 1FKXA 3LLFA 1ECEA 4M80A 3L0GA 1HKMA 3SFKA 3CUZA 2CWNA 4LS0A 4FNSA 4D2JA 4GC3A 4PA8A 4ROPA 1VZWA 2XIJA 3OO2A 3SN1A 4NZ1A 4AZCA 4CNPA 5CPLA 3P5ZA 4CN6A 1NF7A 1Q4WA 3GU1A 3W24A 3NEHA 1EA9C 5JBEA 5B7ZA 5C9WA 2CLHA 3VIPA 3SCQA 1OCQA 4GIAA 2ZQ0A 3DG3A 3DHPA 4IMFA 2CKRA 3W7JA 3V18A 4HZ8A 1K3UA 2D23A 4GZJA 5IFPA 2OSXA