2ZTKA

Crystal structure of homocitrate synthase from thermus thermophilus complexed with homocitrate
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
320
structure length
312
Chain Sequence
MREWKIIDSTLREGEQFEKANFSTQDKVEIAKALDEFGIEYIEVTTPVASPQSRKDAEVLASLGLKAKVVTHIQCRLDAAKVAVETGVQGIDLLFGTGRDIPRIIEEAKEVIAYIREAAPHVEVRFSAEDTFRSEEQDLLAVYEAVAPYVDRVGLADTVGVATPRQVYALVREVRRVVGPRVDIEFHGHNDTGCAIANAYEAIEAGATHVDTTILGIGERNGITPLGGFLARMYTLQPEYVRRKYKLEMLPELDRMVARMVGVEIPFNNYITGETAFSHKAGMHLKAIYINPEAYEPYPPEVFGVKRKLIIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Homocitrate synthase
publication title Mechanism of substrate recognition and insight into feedback inhibition of homocitrate synthase from Thermus thermophilus
pubmed doi rcsb
source organism Thermus thermophilus
total genus 117
structure length 312
sequence length 320
ec nomenclature ec 2.3.3.14: Homocitrate synthase.
pdb deposition date 2008-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00682 HMGL-like HMGL-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2ztkA01
4R34A 3M7WA 4JS3A 1QPNA 5LHEA 3PG9A 1MXSA 3EXSA 3EX4A 1QPOA 3W07A 3PSVA 2GOUA 3P84A 3PUEA 3QPYA 4JTTA 1O4UA 2ZQ0A 4FXSA 5TIMA 4OV4A 2NXIA 3P60A 1GT8A 4JXCA 4RZ5A 3NPWA 2QJIA 4BF9A 2YYUA 2WNZA 1W31A 4FX6M 2FJKA 4RZ4A 3WK3A 3S0CA 3E96A 2ISSA 4LOCA 1SO5A 3WJYA 5CZTA 2ZCGA 1LORA 3JS3A 3HPXA 3B0VC 1SO4A 3DFQA 4QNWA 4J9JA 1CW2A 1XI3A 2VEMA 4JTUA 4W9TA 4XZ9A 5IM51 5C54A 1EP2A 1SSGA 2FTPA 2J24A 2EHHA 4Z1DA 2R14A 4MPQA 3ZS4A 4YLWA 2B7NA 4S2CA 3GAYA 3MI3A 2ABBA 3VKJA 4NVTA 5DY3A 2YPIA 4JR5A 1ZY9A 2JK2A 3LCLA 3MYOA 5DBTA 1MEHA 1I2RA 3W7RA 2QCEA 3HPZA 4ZQOA 4IMEA 1PV8A 4YMZA 3L65A 4MLJA 3NPXA 2NV1A 2GJLA 3W7KA 4A2RA 3L5AA 4X9SA 4GXMA 2CU0A 1I45A 1JCXA 1GVQA 1QDSA 3E49A 4I7WA 1G7UA 4UTIA 4DQWA 2RH9A 4FO4A 3GXTA 3IVTA 1H7WA 3DHFA 4UFIA 1THFD 4JTJA 3W2NA 6ALDA 4ZQPA 2A6LA 2V2CA 4QIUA 5HWNA 4EF8A 1F5ZA 1SUXA 2VC6A 3DI1A 4EOUA 3TC6A 4A3UA 1VYSX 4O16A 3TFXA 5EBUA 1SO3A 5D04C 1AL8A 4R53A 3C56A 1KFCA 2A7RA 5AC8A 5K7JA 5D2VA 2VEPA 3FS2A 5AHNA 3FJ6A 4KFNA 1VS1A 1K02A 3STCA 3T4CA 4UR8A 3E9AA 4N4PA 1W5PA 3ABOA 2ZZ7A 2RHGA 5HNRA 4OU1A 2QF7A 4UCGA 3PM6A 4U4MA 4C1LA 4WQ6A 3GK0A 2GVGA 3W7LA 3UWUA 3IVSA 1KFLA 4IGHA 1LROA 2EF9A 4K6AA 3MP4A 3NVTA 2JKAA 3DFNA 1Q6QA 3QQ0A 4R33A 3NQ6A 1E51A 4NNBA 4LVDA 1FQ0A 3QMRA 4TIMA 3SSJA 4NU7A 1CX9A 5AYZA 5C6MA 4AHPA 3PY2A 3STEA 2BLEA 3SFKA 2NZLA 3LXAA 4LT9A 1TTIA 4GBUA 4FEZA 1XBXA 1K7XA 1D3GA 3QMTA 1X1ZA 1LBFA 1NF7A 1WOAA 1SU5A 2CZDA 1CI1A 4JTSA 2VFHA 4FB7A 1V5XA 1AW5A 2ZDRA 3G1VA 3NQDA 1IXOA 1ZHAA 4DPQA 2ISWA 1JRCA 1H50A 2WSYA 3TMQA 3NL5A 1WBHA 1H7OA 3LHVA 4MJZA 3KFTA 3RMJA 1OFPA 1XUZA 4Y9AA 3GDKA 1VZWA 3CHVA 3QW3A 4K38A 1JCYA 2FIQA 4CCEA 4BI7A 3LCHA 2HSAA 1ZALA 1KM2A 5F2IA 4CCDA 3MO7A 4FHAA 4POCA 3LCXA 3KX6A 3LRMA 3LRLA 1ME8A 1H61A 1X1OA 4UMBA 3PAJA 3BG3A 3QFEA 5KTLA 2TYSA 5T26A 1WV2A 3TU9A 3W1PA 1LTDA 4UFMA 4MYXA 4NNAA 1LCOA 1PIIA 4X3ZA 5CPMA 2YX0A 5EA9A 1N55A 1IGSA 1F76A 3PG8A 4FNSA 1A53A 2GJNA 4AF0B 1S5VA 3OA3A 4Q33A 1HO1A 5HUPA 4UTTC 5LNSA 1K03A 1YYAA 3GDTA 4WY0A 3BV4A 3B0PA 4A29A 4UFHA 4I7UA 3GKAA 1WBJA 3NO5A 3S5YA 4RR4A 2YZRA 1PCWA 1JQVA 2I9EA 1OFDA 5E93A 5HR6A 1OG0A 1F2JA 1S5TA 3TXZA 1IIGA 1ML1A 3W7CA 4IUOA 1FY6A 2B0MA 2GQ9A 3BW2A 3A5VA 4NT0A 2C3ZA 1KV5A 1OFOA 4JTHA 4O54A 5F1UA 2QCGA 3IRDA 5IBXC 1SFJA 5H2ZA 1TPWA 1LRQA 3G3MA 3A9IA 1XCFA 4O28A 1Q3NA 3QM3A 2ALDA 3EWYA 2XN2A 5AB3A 3NM3A 1WXJA 3M41A 2E1DA 3TSMA 3CB8A 4Y8FA 3QC3A 3UD6A 1XBZA 2GVJA 1TB3A 4LVAA 1YXDA 3OVRA 2WKJA 3M9YA 1QOPA 4EVZA 5CKSA 2RKXA 4K7YA 3BLIA 1DQXA 5D30A 1OFAA 2QJHA 1RQHA 1FDZA 2FPTA 5U4NA 3O63A 4O8RA 4PA8A 4GWEA 1J5TA 5K9CA 1ZENA 1QO5A 3C61A 4GC4A 1TJPA 1W1ZA 4QITA 1W8SA 5FEPA 1AL7A 2ATMA 4O15A 4IQLA 3ZFHA 1RZMA 1G4TA 3O05A 4RX0A 2G96A 5F2MA 3UXAA 5D02A 5D05A 1EB3A 2JGYA 4FNQA 5CZJA 3O07A 4NJGA 3PBUA 1PL9A 2NLIA 2VEKA 5MHBA 3LX9A 1AW1A 3G24A 3BG9A 1X6UA 3CIWA 2FFCA 3SGZA 2QCDA 1B4KA 4EF9A 1YPIA 3NOEA 1Q6OA 2X2GA 3W70A 2EGZA 1LOQA 1KM6A 1JVNA 3BARA 2Y63A 4TMCA 3W7IA 1OHLA 3NEVA 4ZMGA 5HR7A 1F6PA 4UTJA 1D3HA 3DZ1A 3LCIA 3AJXA 3B0UX 3Q94A 3CTLA 3B06A 3IEBA 4GE8A 6TIMA 3VE7A 1MEWA 2FB2A 1TIMA 3HPSA 1G4EA 1JRBA 5HINA 4QNEA 2F7FA 3LHYA 3W2KA 1W56A 3DBPA 4JTKA 4JIQA 5CPNA 3CU2A 3ATYA 1N7KA 2V5BA 1TSIA 3CLMA 2J27A 3C2VA 4CQ9A 3TROA 3W71A 1PE1A 1Q6LA 1W3NA 3O15A 4NX0A 3HG4A 2DZSA 1M5WA 4OT7A 3GX9A 4ALDA 5FEXA 3V75A 2J6XA 3OEXA 4LW7A 3NQVA 1DKWA 3GKFA 4KFOA 1K8ZA 1XUUA 1OFEA 1G4SA 5HUOA 4FNRA 4E0CA 1K3UA 2Z6IA 1TREA 2Y89A 1KM5A 2Y6ZA 1VRDA 3O6YX 4E2DA 1R2TA 3L21A 4MFDA 5K4ZA 4QISA 1YDNA 5HWJA 1EX5A 1T8XA 2PURA 3O16A 4JYFA 4RXFA 4JYEA 2QUVA 2H8ZA 4MY9A 3SY5A 1KW1A 1O60A 2OJPA 4O53A 4XBKA 5K3VA 2DZUA 4PL2A 1VHCA 3C2RA 4TO8A 5LGXA 4JN6A 2Z2UA 5LNVA 4JX4A 3K30A 1QAPA 3UWQA 4CCCA 3NZRA 4HPJA 3FIGA 3W72A 1GOXA 2JKEA 3WJWA 5F4WA 1HFBA 3RFAA 5GVJA 3W1AA 3TW6A 3A5FA 3TIMA 3L66A 3GZ3A 5G2WA 5A8GA 4AH7A 2VOMA 3BW3A 4GUJA 1EUNA 3EWUA 1KM3A 3KVJA 2WSRA 1Y0EA 4LUIA 3GVGA 5CSSA 4LS1A 1YTDA 2HTMA 5D2YA 4WXZA 1DJNA 1B57A 3PR2A 1JUBA 5LZLA 3FKKA 1JULA 1JCMP 5DELA 4IWWA 3DFOA 1DL3A 1I2QA 2ZA1A 3IV3A 4FIRA 2OZ0A 3P80A 3IIXA 1JUEA 3N73A 4UFKA 1A5BA 3CQ0A 1DJQA 3CPRA 4YCPA 3WFAA 3N14A 1M6JA 4LVGA 3UNDA 2Q3OA 2J9YA 3QH2A 4JIPA 4DO4A 1ZAJA 4DELA 1O95A 3BW4A 1BTMA 1HO4A 5D2WA 1KFKA 4N2YA 2YW3A 3W7MA 2ZTKA 3UXDA 1LLZA 4Z1CA 3R8RA 3STFA 2CZEA 2Y85A 3I7SA 4GNJA 3DENA 1ONRA 5E1QA 4WXYA 4TMBA 3KRSA 3W1MA 1FCQA 1AMKA 3BPWA 3O6DA 8TIMA 3SIZA 2DU2A 3ZR4A 4O1CA 5LSMA 4CQ8A 4UNLA 5KINA 1K7FA 2YCEA 1TPDA 3B4UA 3G1YA 3W73A 2B4GA 5I3HA 2DP3A 4HSOA 4UTHA 1GVSA 1TV5A 1KM1A 5KITA 3L2IA 5G1YA 3LHTA 4KFPA 3CM4A 5D09A 3EKZA 4OE7A 2W6RA 2I14A 4DBEA 3VE9A 1EP3A 4AF0A 4NNCA 4UMAA 2BSLA 4IOTA 3MP5A 1GG1A 1GPWA 2V9DA 1TTPA 3P8IA 4C1KA 3F4NA 5TQLA 4N02A 5G1TA 3EWWA 3N9SA 3W74A 1L2UA 3L68A 2JKPA 3OG3A 3E12A 3G0SA 1R47A 1B4EA 4O17A 3WK1A 1TV8A 1QNVA 4NJHA 1RQBA 4LY8A 1OX5A 2QR6A 2RDUA 2YYTA 3MI2A 1YLVA 2GVLA 4M6PA 1YTKA 1LDCA 4UIOA 4PC8A 5K2ZA 5EPDA 4ORIA 5AHFA 3H53A 5F4SA 1WX0A 2DZTA 3W86A 2Y88A 5FEWA 4MY1A 4MVAA 2NX9A 3W1LA 4MJMA 3W1RA 1XL9A 4LS0A 2W79A 2QEZA 3TA6A 1F73A 3LHUA 4D2JA 3I65A 5FF7A 4BWLA 1L6YA 3S42A 1TPUA 4HNUA 4ZZ9A 4XUGA 2D73A 1B9BA 4WJEA 3C3NA 4NZFA 2RFGA 2VFEA 5DY2A 3B8DA 3S8HA 1TJRA 3HG3A 5L9FA 1VH7A 5DN1A 3WK0A 5F4XA 1G7VA 2A85A 1TRIA 1SR9A 4RZ6A 2LLEA 1RR2A 4PL1A 4NX5A 3TNOA 1OYCA 3MHFA 2TPSA 3TV8A 3W23A 1EWDA 1R46A 3W2UA 3QSRA 3IIOA 2H3DA 1MEIA 2I1OA 2V2HA 2DZXA 3C4UA 2NXHA 2V82A 4QQ3A 1KBJA 3L0GA 3H54A 4O4WA 1XXXA 3B04A 4NXSA 3EEGA 4O1DA 4FF7A 1U83A 1EEPA 3W1TA 3L0NA 5AC6A 5FEZA 4DXVA 3W7EA 4RKAA 1QPRA 5BMWA 2H90A 2YSWA 4PEKA 2QCHA 3LV5A 3IGSA 4Z0SA 3UWVA 4RJEA 3R89A 4Y90A 1BKSA 4JDYA 5D32A 4PODA 3EX6A 2O7SA 4ZL1A 3DHDA 5J5RA 3KOFA 3GLCA 5J5DA 4LV4A 3NPVA 2WO5A 2RDTA 3O6CA 4YCOA 1OF6A 1FWRA 1ZJIA 5TBOA 1W5QA 1EIXA 1MO0A 3N2XA 2Z0IA 3W84A 1EUAA 1GVFA 2CLIA 4HNTA 1KA9F 2V8ZA 5EMUA 3PBWA 4Z0JA 4LC8A 4I7VA 1FWNA 1ZAIA 3PF3A 5H91A 4UTWA 4A21A 4LVBA 4O52A 1A50A 2BWGA 4ML9A 1H62A 3HG5A 1SFLA 4JTEA 4UFJA 3M47A 3FYPA 3P8JA 4LV9A 2Q8LA 2B7PA 1YADA 3UQNA 5LNWA 3GDMA 3SGUA 2NUYA 3BK0A 1RQEA 3N2MA 4M19A 3NGJA 1OABA 3KHJA 1TV7A 3OIXA 3NZ1A 1VCVA 3TE9A 4LVFA 3S1WA 3DGRA 3M43A 5FF2A 3SI9A 3QRHA 2A4AA 1H63A 1O5XA 3HO8A 4GRSA 2FDSA 4E2BA 2YXGA 4UXDA 2J9XA 5I3GA 2A7NA 3LXBA 3S1XA 2C0AA 3GDLA 3T55A 2TMDA 4LU0A 1DHPA 3GXNA 2E6DA 3G18A 3W7DA 4DPPA 1I2PA 5DCBA 1DORA 5LNRA 3FOKA 2JGQA 1A5CA 3O1NA 3KVKA 4N6FA 4NJIA 2C13A 3T78A 2TRSA 4ADUA 1L6WA 5KMYA 1LRNA 3NL3A 4UTMA 1S5WA 3SR7A 2P10A 2E68A 1K7EA 3NG3A 1LRTA 2W0UA 3V1PA 3P67A 5F1VA 3LOTA 1OX4B 3PB0A 4EWND 2R91A 3JRKA 1GTEA 3M5XA 2A0NA 2BXVA 1KBIA 3LCFA 4RLIA 1W5MA 5CPLA 2ZFAA 4XTIA 4ZQCA 1FWWA 4GUHA 2QCLA 2ATSA 3I7QA 1TPEA 3BVJA 3P5YA 4N9EA 3W88A 3DKLA 3PUDA 3G0XA 3W7NA 2DORA 1SZFA 1KTNA 3OHIA 5F2GA 4OGZA 2E5CA 4RXGA 3OBKA 4FNUA 2JBMA 2X1UA 3KVLA 2ZZ2A 3N19B 5KZDA 1UCWA 1T0OA 3Q58A 1HUVA 3TDFA 2PCQA 3O06A 2WNQA 1VC4A 1O5KA 1OK6A 2V81A 4O0ZA 1W3IA 1L6SA 4AEOA 5BW6A 4WZHA 4IMDA 2E6FA 1IXNA 4UTKA 2ZBTA 4I9AA 3GYEA 1PHWA 1SZEA 1IXPA 1YPFA 1IF2A 2EPHA 2E5BA 3EWZA 2FQIA 4KKXA 3G1AA 2XN0A 2C14A 3TX9A 3TQKA 3ABRA 2FLIA 2ZYFA 4DO6A 2VFGA 2Y7GA 1LOSA 3QMSA 3HBLA 1ZNNA 4LWWA 4XKYB 4IJBA 2C19A 1L9WA 2EAWA 3LGEA 1Q6RA 3P61A 2C16A 4YXGA 1AG1O 3TSDA 3QQ1A 4JEQA 4O14A 2Z6JA 4ZQMA 1FDJA 2P1FA 1IIHA 5HJLA 4XBSA 1GWJA 2GUUA 3S5OA 1DV7A 3E0IA 4HKPA 5G2IA 4CLMA 3ZWSA 1NVMA 4XTDA 4O10A 5G2HA 1GEQA 5DBUA 1P1XA 5EYWA 4LRSA 1PHQA 3O8AA 2ISVA 5D03A 3EWXA 4NQ1A 1G69A 3C2OA 3INPA 4IXXA 5FI8A 4TR9A 4K7VA 2OCZA 1DQWA 3FFSA 1UJPA 3VNDA 2DZVA 3W7JA 2A6NA 3KXQA 4YL2A 5K9XA 3P74A 1WOBA 3QSTA 4BWLC 3SJ3A 2J88A 1FUYA 4BFAA 4BI6A 5DXYA 3LXCA 2ZA3A 1JQXA 3FJLA 2VELA 3W1NA 1YXCA 2ZZ3A 1ZFJA 3W2MA 3NPUA 1RD5A 1JCJA 4JTGA 1KLYA 2ZZ1A 3HGRA 1ZCOA 3MHGA 3C8FA 3ANYA 1QR7A 4ICNA 3TUUA 2HMCA 5EY5A 1NFBA 4ONVA 1H1ZA 2QUTA 1FCBA 1FWTA 5F2LA 3EX1A 1F05A 2H8XA 4MIMA 4NJJA 3DAQA 3LLDA 3CWOX 2F84A 2QCFA 2QCNA 5AC7A 1A5AA 1C29A 1SW0A 3UYCA 4MLRA 4JTLA 2Y70A 3UPWA 2V2DA 3WK2A 5AOUA 2R94A 4TX9A 3B05A 3DFSA 2Y7DA 2Y7FA 1TPC1 4JYDA 4WOZA 4IMFA 2QJGA 3FEMA 2CLLA 2J9ZA 2QKFA 2WPBA 4TU1A 4M7SA 3GDRA 1P4CA 3QZEA 3DU0A 2R8WA 3NA8A 3DH7A 2YR1A 4ZVJA 1OF8A 4M5PA 3ATZA 4OWGA 3THQA 4A22A 3M16A 4UC5A 2QDGA 4N6EA 1VCFA 4H3DA 1KFJA 5G4EA 1T99A 3GIYA 3NQ8A 3UY7A 5D2TA 5LNUA 1K8YA 4LRTA 3W83A 3WJSA 3ZWTA 1XFBA 3LI0A 2KZHA 3GNDA 3I7RA 5AHLA 1IXQA 2G95A 4ADTA 3TAOA 3TJLA 2Y62A 3LDVA 1I8JA 1H7XA 4HPXA 3S1UA 1UUOA 2WSQA 3HQ1A 1RVGA 3R13A 5I3JA 4MZ8A 1H1YA 1WQ5A 4H6KA 4HNNA 4FX7A 4FNTA 4QSHA 4M6QA 2QAPA 1B3OA 3BGGA 3NXFA 1TPH1 3NQEA 3HIJA 3MWAA 1KV8A 3G1DA 4S2BA 3TK7A 1EP1A 3STGA 4UTWC 3DFTA 3IVUA 2PRHA 2V0TA 3NAVA 1KFBA 1Q45A 4P61A 3EXRA 5AN7A 1FXPA 3NQGA 5K4XA 3RF9A 3UPBA 4AWSA 1ZAHA 4RCXA 1TQJA 2E77A 4JICA 4OHQA 5AYYA 3MHUA 3FLUA 2E6AA 1GTHA 4Y6GA 4RK8A 3ELFA 2E6YA 2Y7EA 4AVFA 3W7OA 4LUJA 3HGOA 2UV8G 1OYBA 5CG7A 4Z1AA 4IPIA 5FF0A 3ABQA 3QJAA 1OFBA 3PULA 3BG5A 4O13A 2BTMA 1TTJA 3FA5A 3MI6A 4Q32A 1JCLA 3PB2A 4Z08A 5HWMA 4BI5A 3VCRA 1HL2A 1QCWA 4O57A 3NQAA 5DLCA 3FYOA 5L6UA 4WY0F 1SO6A 1GG0A 3WJZA 3L9CA 4ADSA 2ZRUA 3L5MA 4N4QA 5C2XA 3UWWA 1SSDA 1W3TA 3QEZA 3UZJA 4PCFA 4LTSA 1QMLA 2NWRA 2QCDB 2NXGA 1V7YA 2C15A 1Z48A 2A21A 4B5NA 1OX4A 3G8EA 2CLMA 4OV9A 1WAUA 1PCKA 3G1XA 4LS2A 4CNOA 2FPVA 1C9DA 1TMHA 2Y61A 4CNNA 3TKFA 3CIXA 3GR8A 5D2XA 3W1XA 1LM1A 3GR7A 4KWWA 4AHOA 2CZ5A 1PVNA 1O94A 1I4NA 3LCGA 3TQ0A 2C18A 1JUKA 4M6VA 1S3HA 2P0OA 2QCMA 1BWLA 1H51A 1SZGA 1Z44A 2ZZ5A 3IGXA 3UZ5A 3IIZA 1W5OA 1Z42A 1VJIA 3UWZA 4N9DA 1WDWA 3G0UA 5G5IA 4ORMA 3I6RA 4FX8A 3JR2A 1SZNA 3DXIA 3SECA 1R2SA 3TSBA 3RNDA 5BMXA 3W2LA 4GUFA 3W6YA 3VI2A 2GPTA 2XFWA 4JY8A 4BK9A 3KAOA 3N3MA 2DJLA 5D33A 4AB4A 3A21A 1KTCA 3F1QA 3TW7A 2BX7A 4DF0A 3F03K 4Y96A 2ZZ6A 4O11A 3TAKA 4O1AA 5KZMA 4AWUA 5U7SA 2B7QA 4L4LA 4JDBA 3M0ZA 3TFCA 1M7PA 2TSYA 1LP6A 4XKYA 4BR1A 4QAIA 3M6YA 5AHEA 1I2OA 1VLWA 4U28A 3MJYA 4JGDA 4GUGA 4UTLA 5KZEA 3MUXA 1GQNA 4IX0A 4DF2A 3FKRA 2RDWA 4UNKA 4X2RA 3TMLA 3MBDA 3R5EA 4K8HA 1DOSA 2A2IA 3NL6A 1J2WA 1NSJA 4P2VA 3TXVA 3DFPA 2CLFA 4IMCA 2G5WA 4IMGA 4E38A 1OJXA 3S9YA 3LBCA 3G8RA 1XC4A 2NX1A 5A5WA 2WNNA 4UMCA 3S5ZA 4H4IA 1LZOA 3EX2A 3U2OA 3PSWA 1QO2A 3C2EA 1OFRA 1WA3A 1H60A 1OVDA 2VKZG 1D9EA 2VFIA 3N9RA 5AHIA 3NQCA 3DKJA 4QM1A 1NF0A 4AMAA 1LYXA 1Z41A 2C6QA 2X1TA 1F6KA 4DBDA 3DI0A 3PVFA 2VEIA 3NL2A 5BOOA 3LV6A 1YTEA 2X16A 3G1HA 4MY8A 4HSNA 4KWVA 1QFEA 1TPVA 1VPXA 3W75A 4O50A 2ZRYA 4GJ1A 3HOJA 4M7TA 4O12A 5SWUA 3EXTA 4O1BA 5AFDA 3PBYA 1XBVA 3C6CA 1HG3A 3A22A 1FDYA 3AO0A 4CNPA 2QCCA 5C5YA 3R12A 2NUWA 4FIQA 4NJKA 5K9DA 4WD0A 1TYGA 3TR2A 1XBYA 1J4EA 3MP3A 1TPFA 2VFDA 2V30A 3BLFA 5C55A 1MSSA 3IGUA 4NXKA 2ZRXA 1KM0A 1X7FA 4RV8A 3L0KA 5DXXA 5I3FA 1H7PA 3NQFA 4XWUA 3TH6A 5CGQA 1QWGA 1PS9A 1VCGA 3C0JA 1UASA 3OVQA 3ABSA 1ME7A 2ZRWA 2ZRVA 3QYQA 1I2NA 2HS6A 3EWBX 4MOZA 3C52A 3A24A 1ADOA 4HNVA 4MFEA 1VGAA 2DJXA 2NWSA 4WOQA 5FF4A 4EIVA 1F7BA 3TCEA 4K37A 4N9BA 1EWEA 3W7PA 2PRMA 5I3KA 4JD4A 3W1UA 2YW4A 1VHNA 2C1HA 3M1ZA 4ZQNA 1GZGA 3PS7A 3B03A 1G6CA 1ICPA 1VQTA 3RLUA 2V5LA 3VFLA 2A1YA 2OT1A 2QUUA 4MZYA 3BGJA 2NX3A 1A5SA 4DF1A 2PRLA 4N9CA 1H7RA 2WV8A 2CZFA 3MYPA 2NUXA 1TO3A 4IXHA 5AYXA 1QOQA 5HULA 1W5NA 1JJKA 5LGZA 5EKYA 4K36A 2QDHA 3LHWA 2X30A 4WX2A 3RLVA 3UY8A 3M5YA 1GVRA 1H7NA 2VENA 2YFOA 3USBA 3LBMA 4Q4KA 1P5BA 3NDOA 4HN4A 2BZNA 3IIPA 2Z1BA 3HJZA 4JTIA 1ICSA 4O0KA 2AGKA 1ALDA 5LKYA 3P82A 2FPYA 3NQMA 3BO9A 1FCVA 4PTNA 4AHQA 3U8GA 1TQXA 3MW7A 3MMTA 5I3IA 2WQPA 1OFQA 3W1QA 2X1RA 3P81A 3TQVA 3LTSA 4MYAA 2NV2A 3P5ZA 1XDMA 4JY9A 4K39A 4Z1BA 3R2GA 2ZZ4A 3THAA 2B7OA 1FBAA 1KFEA 3HF3A 4FNPA 1G4PA 4JX5A 3W7QA 2VFFA 4AXKA 3HGJA 5CZ0A 4GUIA 4CQAA 4ZQRA 3W85A 2ZRZA 3NYZA 2GQ8A 3W76A 3RU6A 5AHMA 1T96A 3W3OA 4PFMA 1GJPA 3LB0A 1KTBA 3P62A 1ICQA 1OK4A 2ZA2A 3Q2DA 2PE4A 3G3DA 4LNYA 1JCNA 3G1SA 2GQAA 4NUWA 1VR6A 5CPOA 3TC7A 3WJXA 1FWSA 5EL1A 5DCEA 1W54A 1XDLA 1JR1A 4LC6A 4DEFA 1R2RA 1TTQA 2X1SA 3F4WA 1YXYA 1TPB1 3MBFA 1YDVA 2DZPA 3M44A 3CWNA 2A7PA 1P0KA 3KRZA 3GNNA 2ZTJA 1M7OA 1OYAA 5KSWA 2XN1A 2OMAA 3W7GA 1R30A 5G4WA 3HB9A 3N34A 1GYLA 1G67A 3KVMA 3M5VA 3LTPA 3E02A 3C2FA 1HTIA 1FXQA 4HIBA 4O4VA 1AK5A 3UWYA 1EPXA 3LCWA 1NEYA 1TCDA 4O18A 4YWIA 3LI1A 1UUMA 3NQ7A 2CFFA 2YDAA 2WJZA 3D0CA 3KRUA 3GXPA 3CC1A 3G22A 3W2JA 1DVJA 2H6RA 1DBTA 3EB2A 1UB3A 3QW4B 4OQVA 4UUIA 5HMSA 1FX6A 2CWNA 2ABAA 3CEUA 5BNKA 2OX1A 3OVPA 3W87A 1RV8A 4G1KA 2Q3RA 4S1FA 2AQWA 4L4MA 1WYIA 4FXRA 5ABTA 5FESA 3NR0A 4MUZA 1XM3A 1LLWA 3S1VA 3LERA 2VXNA 2CLHA 1P0NA 1LBMA 3I68A 3W9ZA 3PBVA 2O7QA 1LBLA 3SZ8A 3LRKA 3W22A 2QAFA 3PC0A 4OBTA 4HHPA 2IQTA 3S6DA 2H3BA 3HGSA 1GYNA 2CLOA 5BRBA 1AW2A 3BLEA 3YPIA 3M5ZA 4UFLA 1EA0A 1H5YA 2Q8ZA 1UBSA 3TJXA 4IX2A 3SW6A 4XQ6A 1VYRA 1BWKA 1LOLA 3L5LA 4O19A 1SPQA 4DO5A 3LHZA 4UTUA 1X8FA 5D38A 3CT7A 1OX6A 2PC4A 1N8FA 3P7YA 3LLFA 1KM4A 1W37A 2DZWA 1VLIA 4JX6A 5D37A 4K8EA 1FCUA 2G97A 5DCDA 2YFNA 3S5NA 2CLEA 4WY0B 4UTTA 3IIVA 3HG2A 1W0MA 4HT3A 1RPXA 1QPQA 2A5HA 3GAKA 3LTYA 2CW6A 1SW7A 1KLZA 3RK8A 3A23A 1C8VA 1ME9A 4R7JA 1NAL1 2E5DA 4WUIA 4MKNA 2FB3A 4AWTA 7TIMA 4IPJA 3CEPA 4JTFA 3T7VA 3PWAA 2YGYA 4PH6A 5FF3A 2CLKA 3QPZA 1U5JA 3NQ2A 3NNTA 1MZHA 1F74A 3HMJG 2WOQA 4MZ1A 4X22A 3T44A 4NZJA 3U6WA 3G1FA 3PUOA 5E0KA 1GVOA 4JNMA 2OT0A 3H55A 4QJ1A 5HQEA 5IBXA 1VYPX 3QF0A 1TRDA 4A2SA 3W7HA 1K8XA 1SW3A 3L67A 5CZSA 4AAJA 3T40A 1XKYA 3EX3A 3Q37A 2EKCA 3LM7A 3GB6A 2AAMA 4GFSA 5CSRA 1SQ7A 1BEUA 1YDOA 3EKLA 2E09A 4UR7A 3NM1A 5LHFA 2HS8A
chains in the Genus database with same CATH superfamily
2ADAA 3M7WA 4JS3A 5LHEA 4Z2LA 3TQPA 1MXSA 1QPOA 3OTRA 1CENA 3WCZA 2QVNA 1GGOA 1UZ1A 4H19A 4DJFD 2ZQ0A 1GUVA 5TIMA 4S3BA 3NPWA 1ZBKA 4PUWA 4EE9A 1ISXA 2YYUA 3AXIA 1PJ9A 5GQBA 1MXGA 2WNZA 1XIDA 2QVHA 4OVXA 5ECVA 3EYPA 1T40A 3CTTA 2ISSA 1L6FA 1SO5A 5CZTA 3JS3A 5T91A 5I00A 2QV4A 1OM0A 3MA8A 3FVDA 3LZ3A 4W9TA 4F4RA 5IM51 3NTYA 2FTPA 1GZJA 4MPQA 3MI3A 2ABBA 1RAKA 4NVTA 1ZY9A 2ZICA 2VUNA 1MEHA 1CXHA 3OQEA 3HPZA 1PV8A 1VFLA 2WW5A 3L65A 4MLJA 4PCPA 3NPXA 2NV1A 3BLDA 5AY7A 4NZ3A 2ZUNA 1ZZMA 3N15A 4CVUA 1T8QA 4LUTB 2BODX 2IQ0A 2ZXDA 3EBVA 3A4AA 4CU8A 1EJSC 3E49A 1S2UA 5AYIA 1G7UA 4WIWA 2WBKA 5A6AA 1J5SA 3KCJA 4JTJA 1VAHA 3W00A 2V2CA 4GD0A 4GJJA 2CBIA 4QIUA 4EF8A 1F5ZA 3M46A 1E9YB 2G3FA 4UR9A 3DI1A 5ABEA 4OUIA 3PPGA 4OOZA 2GYIA 3TFXA 4XG1A 5D04C 3C56A 1KFCA 1KR1A 3FJ6A 1TV3A 4KFNA 2J7GA 3M64A 3MB9A 4X0NA 3STCA 3IJQA 3WFLA 2HRWA 3ABOA 2NV9A 1JYNA 3WMLA 4MB4A 1TWWA 3WG6A 3IVSA 4HSHA 1KRAC 1LROA 2AQVA 2EF9A 3B9EA 3D46A 3MP4A 4S3KA 1T6MA 4E3TA 7CGTA 1E51A 1J96A 4RE3A 3AIVA 3CAQA 2E28A 2D23A 2VDGA 1OCBA 1UIOA 2AQOA 4AHPA 3PAOA 2BLEA 2V5KA 4J35A 1GVYA 2R1PA 4Q22A 4GQ0A 4F2TA 4XZNX 1W1PA 1XBXA 1K7XA 2OG9A 3AMDA 1LBFA 2DUZA 4CU6A 2CZDA 2VFHA 2BASA 1S46A 4FB7A 1V5XA 2DSZA 3N13A 4RPPA 3NQDA 1UMLA 2ISWA 3ZOAA 2BHUA 1RH9A 1WBHA 3NL5A 5LIKX 2WQDA 3MY9A 3TYUA 2BGNE 3GDKA 2E8ZA 1W8GA 4KEVA 2G3IA 3QW3A 4H9TA 1JCYA 2FIQA 4LBSA 1ZALA 1XG3A 1KM2A 5F2IA 3MO7A 1C91A 3LRLA 1BVNP 2PBOA 4LUYA 4GQGA 2YCJA 3PAJA 3QFEA 3OGVA 1NOWA 5KTLA 2QUMA 5B80A 3TU9A 4JHOA 1Q8AA 4LCRA 2HWGA 5BWFA 4RL3A 3VM7A 1PIIA 2VCAA 4KBXA 5EA9A 4I8YA 4Y7EA 2GJNA 2YCLB 3VOIA 1TUFA 4OOUA 2PLCA 5LNSA 5PTDA 3FNDA 4KETA 5HQMA 3LSBA 4UFHA 3IK4A 3NO5A 3S5YA 1JQVA 1EL3A 4U31A 4IQEA 3F4CA 5E93A 3WD3A 1UR3M 1J0YA 1S5TA 3TXZA 4DUWA 4PTXA 3W7CA 3VD9A 1FY6A 4D6DA 3BW2A 1X38A 4NZCA 1BYDA 2CZVA 1KCLA 2IKHA 1DJYA 1VFUA 3SGGA 4ZR8A 2W67A 3G3MA 1Q65A 2Z26A 3ARQA 1FH9A 1Q3NA 1BD0A 4AIOA 3GH7A 3UD6A 1D7FA 2VRQA 2D3LA 2DVTA 1XBZA 1N2VA 4DJDC 4Q6XA 3ONBA 4LVAA 3THCA 6REQB 3OVRA 4AIBA 3HURA 2E0PA 1QOPA 4EVZA 4FS9A 1RQHA 1FDZA 3O63A 3MS8A 4HPHA 2VYOA 5K9CA 1Q6GA 4GC4A 3SCOA 3BV7A 1TJPA 1W8SA 4O15A 4BQ2A 1RZMA 1G4TA 1PAMA 5F2MA 4C6NA 2NQLA 1ZTVA 1C8YA 4DI9A 1EB3A 5CZJA 3SCPA 3RYSA 3M0YA 1C93A 3L4YA 1PL9A 2GDQA 2NLIA 4DUXA 1A80A 3R7MA 1AW1A 3G24A 1XJBA 3B8TA 4UZUA 2SFPA 4GQRA 1G1YA 3AFBA 4JTQA 1YPIA 3W70A 1E56A 3BARA 4H9ZA 1Z3NA 5HR7A 1GKQA 3DZ1A 3JUGA 3B0UX 4AEEA 3QV8A 3R8GA 1J11A 3KL5A 3VE7A 3TA9A 1MEWA 4IIFA 2ZWZA 2D0FA 3CPUA 1ODZA 2F7FA 3LHYA 2D22A 3CASA 4JIQA 4B3ZA 2DT0A 3ES7A 4Q4RA 2Y24A 3C2VA 3TROA 1W3NA 1P6WA 4PULA 2XH0A 2DZSA 4ZXLA 1V0NA 2HE8A 4IT1A 5FEXA 5EFDA 2J6XA 1ADSA 1BTCA 5A95A 1QI0A 3WF4A 5CC5A 1S3TC 3EMQA 2WZHA 5BRPA 1K3UA 4Z42C 1OGGA 3MCMA 4E6MA 2Y6ZA 4E2DA 3AIEA 3MUIA 3APTA 3TZNA 5HWJA 2OWXA 3QOKA 2DSVA 3SCTA 2REQA 2QUVA 4MJ2A 2JF7A 5CC3A 5CLTA 2OJPA 5K3VA 1Q8JA 1TWDA 1SGJA 2VMFA 5LGXA 1MZRA 4V15A 4ZA0A 3K30A 1UW9A 1XLFA 1XIHA 3FIGA 4FLSA 2VX7A 4GQQA 5BROA 3L66A 3GZ3A 5A8GA 2VOMA 3BW3A 1Y0EA 1BHGA 2V3GA 1EJTC 3OBAA 2WB5A 3MU7A 3TOPA 1MW3A 4JQ1A 2XH2A 1US2A 1D8CA 3KDOA 4A3HA 3JW7A 1EFZA 1B31A 3ZR5A 4Z2IA 3E0WA 3H7RA 1OZMA 2OZ0A 1JUEA 2ZX8A 4KIEA 1X6LA 4D6HA 4NAEB 3AIRA 2EG6A 2CWXA 3CQ0A 4DYJA 2E9LA 2PGRA 7REQA 4D8LA 1B54A 2B31A 3GO2A 5E09A 1E0TA 4JQ3A 2J9YA 4JIPA 2XG9A 4DELA 1O95A 5CPSA 1HO4A 2YW3A 4HK5A 1LLZA 4Z1CA 4J5NA 3STFA 5E1QA 4TMBA 4DAFA 3CZGA 3VAVA 2OO6A 8TIMA 2HEJA 3UCCA 2W27A 1PWMA 1TPDA 1FWAC 3NZQA 2DP3A 4QROA 1UUQA 1TV5A 3WL1A 1KM1A 3BOFA 1R7OA 1RUSA 3L2IA 3THUA 5D09A 1S2VA 3CJPA 2I14A 2FMOA 1PWLA 5I2UA 3LBOA 2BSLA 4TVDA 1GG1A 3MP5A 4C6EA 3B40A 4LH8A 4PRWA 1LLOA 1OC6A 3ALGA 5TQLA 3HPAA 3OG3A 3WX7A 3WK1A 4YHGA 1BYAA 2C1GA 4W7VA 4FMVA 3MTWA 4NJHA 3ABXA 3POHA 4HJWA 1RQBA 4GYFA 2DW6A 5FA5A 1K9TA 3NQBA 2CESA 2GSHA 2RDUA 2YYTA 2YIHA 3WLMA 3UJ2A 2F6XA 3LGDA 3UXKA 1MW0A 3OA5A 4PC8A 4GNKB 3M0JA 1CGYA 2NVDA 2XSAA 5K2ZA 4DZHA 4DX3A 1UWIA 3H53A 4QLJA 2DZTA 5C7HA 3BAYA 2Y88A 3A47A 4MVAA 2ZUWA 3W1LA 3W82A 3UVIA 3TA6A 3LHUA 4AYSA 3I65A 3T05A 2INZA 4JN7A 1TPUA 4L6OA 4ZZ9A 3C3NA 1W2PA 1FP8A 1TJRA 4H7ZA 1EX1A 3MQTA 1V93A 1VH7A 1W6TA 4AD1A 5F4XA 2IMRA 2A85A 1QHZA 1TRIA 5D8WA 3TNOA 3KL3A 2TPSA 3AYRA 3W23A 2WC3A 3RIKA 2DIJA 1JYVA 4A3QA 2KX9A 2BVWA 1KBJA 3L0GA 1GJUA 1JDDA 2QS8A 4PTMA 4YJ5A 3B04A 4NXSA 3CH0A 1UWQA 2Y0FA 3KBMA 3W1TA 1ZLPA 2ZE0A 2VWSA 1DIDA 2OX4A 4DXVA 4ZO6A 2ZX9A 1R85A 1K9DA 5JH1A 3T08A 1ZP3A 3BQ6A 1X97A 4K3ZA 1RA5A 2OZ8A 1H5VA 3RCMA 1BKSA 5D32A 1CLXA 4PODA 2O7SA 1DEDA 2HK1A 4GX9A 5J5DA 1QPKA 4MAVA 3ITOA 3WBAA 2WO5A 8XIMA 1FWRA 2E3ZA 2YXOA 5CEWA 3SEPA 2Z0IA 3W84A 3LPPA 2VM8A 2DT2A 4KQNA 3DERA 5EMUA 1E6ZA 3AIWA 1FWNA 1HKJA 1MW2A 5A6TC 4JFTA 4UTWA 1XIMA 1U22A 1SFLA 4AY1A 4UFJA 1EKOA 1GOOA 2Y8VA 1W1VA 3M47A 1UYQA 3PNUA 2Q8LA 3B8SA 1TMLA 3UQNA 3TZFA 2NUYA 3TJIA 2I16A 2V69A 4M19A 1J2BA 4XSLA 4LVFA 1XD1A 3DGRA 1JYXA 3KWSA 3K1GA 1JYWA 1H63A 1TVNA 1J93A 3HO8A 4E2BA 4EXQA 2GSJA 3MWCA 2PI6A 3ENLA 3H4WA 2VVSA 2AOSA 3NFUA 3T55A 1Q85A 1BSLA 3G18A 3W7DA 5DCBA 1AZ1A 6PTDA 3FOKA 3BGAA 1V3LA 3KVKA 1JAKA 4MWAA 2XFFA 1L6WA 3H2NA 1LRNA 1OADA 2P10A 4GY7A 3NG3A 1LRTA 2D69A 2W0UA 1E9IA 3IUDA 4GZEA 3P67A 5DRIA 1E72M 1H11A 5F1VA 4R3UA 5DQPA 2Y1HA 4GIEA 4ROQA 2A0NA 1V08A 3LMZA 3TYEA 1VIZA 2IPWA 4P7LA 3V3WA 2ATSA 5JMUA 3VC5A 4AD2A 3W88A 3DKLA 3PUDA 4C91A 1SZFA 2GWGA 4JCLA 4PMZA 2VC7A 4JTAA 1E6PA 4OGZA 1QNPA 4GG9A 3H7UA 4RXGA 1BG4A 3OBKA 4HCDA 4CD7A 3N19B 4XD4A 4FLRA 1UCWA 3Q4DA 4Z17A 4AWEA 2PCQA 2V81A 1GVEA 4AEOA 4D8AA 2G8ZA 4JL1A 4WZHA 3T0CA 1IXNA 4UTKA 3F2CA 4JEJA 4I9AA 1SZEA 2CKSA 1YPFA 2VZUA 1IF2A 3AI0A 2EPHA 2VGIA 3CS2A 5CCZA 3KLLA 3EWZA 4WGHA 3RHGA 1CXFA 4WLCA 3REQB 3G1AA 2C14A 4I6VA 3VGHA 1X8CA 4DO6A 2VFGA 1WDDA 3QMSA 3HBLA 5HDRA 3ONCA 1LT8A 4L80A 3WH5A 2QNEA 3MO4A 3R58A 3TONA 1FDJA 1GWJA 4HKPA 2YB1A 2XVPA 4CLMA 3SM0A 1NVMA 3FX4A 1HXJA 1EF2A 5EYWA 5MF5A 3ITTA 2D1ZA 1Q6CA 3H2FA 3O8AA 3T0TA 1MQPA 3C2OA 4AXNA 3O3RA 1R3QA 1LL4A 1DQWA 3AYTA 3LENA 3FFSA 1JDFA 2DZVA 2A6NA 5A8PA 1QTWA 1NDVA 1TUXA 3KWXA 3PBGA 3LS9A 3QGAC 1ZCCA 3VDCA 2J88A 1EXBA 3EDJA 2CITA 1RJRA 4BFAA 4G7FA 3LA4A 4QGCA 3UR2A 5EMMA 3WNNA 4QE4A 4JFWA 3W2MA 1NP0A 4PMRA 1LF1A 1XISA 1RCOB 2IPGA 4S3GA 3O0FA 4IGMA 3HGRA 3QLDA 3MHGA 3C8FA 3ERPA 3WD0A 2HMCA 2P3ZA 3WZ0E 5EY5A 1NFBA 1V6WA 4ONVA 3SUTA 2ODOA 5F2LA 3EX1A 3W0KA 1R3WA 3UJSA 3TTSA 4MIMA 3MZ2A 4NF7A 4HOWA 2PDBA 1BVWA 3R1ZA 1J8VA 1DIEA 3EOEA 3UNTA 1P43A 3UPWA 1HJSA 1CBGA 1S2TA 4ZSTA 1SZRA 3UG4A 1J0IA 4JYDA 4B91A 4QAWA 1Y65A 2CLLA 5H6HA 2QKFA 4CQDA 1JPHA 1DWGM 1P4CA 4QLLA 2R8WA 4GI8A 5GNZA 4RNFA 2EPMX 3ATZA 4OJYA 4KWSA 4A3YA 3M16A 5HQLA 4UC5A 2QDGA 2FZNA 4N6EA 3GVVA 1M41A 4Q7BA 1MNSA 3GIYA 1ZGDA 5D2TA 1K8YA 2OEJA 2Y5SA 5AHLA 2G95A 4ADTA 5BOEA 3IAPA 4GXPA 3TJLA 4W8BA 2X8RA 3LDVA 3QY7A 3A9BA 5FJIA 1UBPC 1RVGA 3HQ1A 3WLHA 2NSOA 4FALA 3OZPA 1WQ5A 4H6KA 1DWJM 1PZ0A 4QSHA 3NQEA 3VIIA 1XLIA 3MWAA 1KGXA 3G1DA 4AG0A 2VVNA 1EP1A 5DMYA 4UTWC 3ALFA 3UT0A 3NAVA 3TYAA 2OQLA 3VCNA 3KE0A 1Q45A 3EXRA 5AN7A 3KOZA 1P6BA 1IZKA 4PRRA 4F9DA 1XRFA 3UPBA 4AWSA 4RCXA 3D5HA 4JICA 3FLUA 1E6SM 4PMUA 2W62A 4Y6GA 4FA3A 4ZTXA 4GI6A 3WN6A 1AQ0A 2G4JA 3ELFA 4J3TA 2E6YA 4JNZA 3WQ6A 4GLEA 4K1GA 4EPKA 1H49A 1I6NA 1Q6DA 4WR3A 5D9PA 5FJTA 1U30A 3QJAA 1KO0A 3CQKA 3RGTA 3SUSA 4O13A 3FA5A 5AZ0A 3PZIA 1K6WA 3TEVA 3GBDA 1QI5A 1QCWA 2WJFA 3RRAA 1MDRA 3POCA 4MWAC 3WJZA 2ZRUA 3A12A 1J0ZA 4P7OA 4LF2A 5C2XA 3UWWA 2D0HA 4W87A 4AZIA 4PRTA 9RUBA 2VJXA 1O1HA 3VK5A 3S6TA 2NXGA 3K4AA 3AXXA 1OX4A 2HDJA 3CQIA 3G8EA 1QNOA 1E5JA 1TVPA 6A3HA 1EQCA 1IWPA 4PMOA 2FPVA 3SUWA 2Y61A 3T2PA 3BLPX 3H23A 3GR8A 1LM1A 3GR7A 4KWWA 4W8AA 3PUGA 1DP0A 2CZ5A 3CV2A 1A3XA 1BRLB 2P76A 4M6VA 1S3HA 3UJEA 1V6YA 3TN4A 3UZ5A 1B3VA 4R9XA 4FXFA 5G5IA 4ORMA 5DMMA 1XIBA 3NJ3A 3DXIA 4D6CA 3RNDA 5JBDA 3OU8A 3OB8A 1CXLA 4GUFA 3UWEA 3VI2A 4KIRA 1PX4A 2YA1A 4JY8A 2PPGA 4BK9A 2DJLA 3MDUA 5D33A 4URIA 4PB3A 1BYCA 4H7CA 3TW7A 4DF0A 2C7FA 1AH0A 4KW2A 2CXGA 4Y96A 1VEPA 5HMEA 1BYBA 1GW1A 5U7SA 4UBPC 2NQZA 4D6EA 3M0ZA 4J2PA 1I9CB 3FJNA 2HXTA 4QAIA 1GOQA 3M6YA 4CVWA 1VLWA 4H8UA 4JGDA 4ATWA 3WD1A 2J4GA 5E0FA 5LIUX 3RUBL 3FKRA 4UNKA 1WPCA 3MBDA 4EP8C 4RV3A 1IEWA 4CKQA 3S9YA 3G8RA 1DXEA 3KZPA 4H4IA 1LZOA 3AHXA 3IJ9A 3GM8A 4K1WA 2R24A 2VEFA 5D4YA 1D9EA 3N9RA 3NQCA 4W84A 3GC2A 4H8NA 1HJWA 3AAMA 4HK7A 2C6QA 2HCVA 1F6KA 4DBDA 1QHPA 1CCWB 2ZUUA 2Y4SA 3MUAA 4D6GA 3OG2A 4HSNA 1QFEA 2PWDA 4O50A 4QR6A 1GQJA 2ZRYA 3HOJA 4M7TA 4QG6A 1QI3A 1FWEC 3P6LA 3PANA 5IXEA 4O1BA 5AFDA 2A3AA 1V0MA 1XBVA 4ERAA 2XJ7A 3I3DA 1A3HA 3TYBA 3T0BA 5K9DA 3ANVA 1M7XA 4GKTA 3TR9A 3WUEA 1TPFA 3UEQA 2PP0A 1OY0A 3OBEA 4NXKA 1QUMA 2ZRXA 3R4IA 1OC5A 3L0KA 5DXXA 1XIEA 2Q8XA 3NQFA 3TH6A 5CGQA 6XIAA 1PIGA 1QWGA 3AU2A 2G4FA 3VX0A 3EAUA 1AD1A 3MMUA 1LWHA 5J8LA 2ZRWA 1ONEA 3EWBX 2DSKA 3LD5A 4I90A 1ADOA 4H9XA 3MVTA 1VGAA 1IEXA 1F7BA 4DZ5A 4B15A 4N9BA 1UQZA 1EWEA 4QEEA 2VZOA 5I3KA 4BF5A 4ZQNA 1ICPA 1KXTA 3QR0A 3NSMA 3OJGA 2V5LA 4E4FA 3VFLA 4AISA 2A1YA 1A5SA 1A49A 4DF1A 4N9CA 2RJGA 2WM0A 4IXHA 1B3XA 2EEXA 3B0YA 4K36A 2PDWA 1HJUA 3TN5A 4MDOA 1E0VA 4WX2A 1E3ZA 3RLVA 4B4FA 3ITXA 1Z32X 3USBA 1P5BA 1HKWA 1ISVA 3HJZA 4JTIA 5LKYA 1G01A 5BU6A 2FPYA 3NQMA 2PS2A 4RPQA 3BO9A 1SJDA 3IGHX 3C5QA 3SCVA 4MYAA 2WMIB 2NV2A 3RRXA 3P5ZA 1XX1A 1KD0A 1LL7A 2WHLA 4MDPA 5HJXA 2HXUA 4RUBA 3DHUA 1FBAA 1KFEA 2O9OA 4PZVA 4JX5A 3FA4A 1ODUA 3WLQA 4CQAA 3KP1A 2YLLA 3RU6A 2Q09A 5M3WA 2WLYA 4PFMA 1KTBA 3DFHA 4A8LA 3P62A 1ICQA 3FAXA 4H8HA 1OK4A 3MUY1 2WC7A 4M82A 1VR6A 3GFYA 4QDMA 2ZDSA 1XDLA 1JR1A 3BH4A 1SJCA 4LC6A 4DEFA 4S3EA 2D2JA 3PTDA 1YXYA 1TPB1 3V5FA 3MBFA 1YDVA 4Y2WA 4DHGA 4LUSB 1CNVA 4HMEA 3V0SA 2QLYA 2AKZA 3ZVHA 5RUBA 2XN1A 3N6JA 2XIQA 3RX4A 3W7GA 2VGGA 3HB9A 4D6FA 3BZJA 3KVMA 1ITQA 4IQJA 1HKKA 3XISA 3CUGA 1DJHA 2ZUSA 3LCWA 2AL2B 3VIMA 1AFSA 1LWIA 3GXPA 4GIYA 4A35A 4NYYA 1EGVA 1TG7A 3OLIA 5LIXX 3R79A 3L4WA 2BOGX 4ZFCA 2IUZA 4PBEA 2D3NA 1FX6A 1Q13A 4EKJA 5IDIA 2J13A 1XR2A 4ZB5A 4HTYA 2ZKMX 3DBNA 1RV8A 3J7HA 1X96A 3QXBA 3ARPA 3AU6A 5C2CA 3UCQA 5CSUA 4MUZA 1HGWA 1W1YA 1LLWA 1XM3A 4W89A 2Z1XA 2CLHA 3EMZA 1P0NA 2PDGA 3I68A 1SFSA 3RM9A 2O7QA 3PC0A 3N2BA 2IQTA 2H3BA 3HGSA 1GYNA 2A3LA 1BF2A 2J6VA 3WYZA 1AW2A 3LQLA 4L9YA 4UFLA 1H5YA 2Q8ZA 1UBSA 3TJXA 2E8YA 3HN3A 1LOLA 4GIAA 2ZXAA 4QDPA 5D38A 2PC4A 3KS5A 1VLIA 3VM5A 1EC7A 4K8EA 4MGGA 1FCUA 3R43A 4WY0B 1J12A 4HT3A 2I57A 4CEUC 1QPQA 3GAKA 2TODA 3GTHA 2CW6A 2WZMA 3GS6A 4JFVA 3A23A 1C8VA 4R7JA 2E5DA 4WUIA 4AZHA 3FGCA 4E3VA 4F48A 3CEPA 3T7VA 1VFFA 3QKEA 4R27A 1U5JA 1ECEA 5A2AA 3HMJG 2HISA 2GGJA 4NZJA 1A3WA 5XINA 3DG7A 5HQEA 3WKZA 5JXQA 3EA3A 3QF0A 1TRDA 4D9PA 5CZSA 3LZ5A 5EB8A 3IJ6A 3PHAA 4NRRA 1CGUA 3LM7A 1Y8BA 4GFSA 3WMCA 3PWIA 1YMYA 4LJ3A 3E3HA 1KBKA 1JD7A 5LHFA 3E2VA 4M24A 1RLDA 1XS2A 1QPNA 5LXEA 4LAOA 1A5KC 2X0HA 3QV9A 3EWDA 2Z00A 4NZ5A 1TR9A 4H6QA 2GOUA 3P84A 2JF6A 3H22A 1IEIA 1UA7A 2J7HA 4OV4A 4L65A 2GSEA 4JXCA 4ZODA 5C9XA 2O9PA 4BF9A 5FAJA 2OOGA 1S2CA 1SM9A 2OZ3A 4XZBA 3PZQA 3VD7A 1ENUA 4H8VA 4FX6M 4H6RA 4LAZA 3WK3A 3E96A 4HPGA 3WJYA 1AJ0A 3BMVA 3M0LA 3HPXA 5FJPA 3DFQA 4J9JA 1OGSA 1CW2A 3QTGA 4JTUA 1DXFA 2PA6A 1KCXA 2R14A 2WSPA 3P14A 3ZS4A 4YLWA 1ZBWA 2B7NA 3RLHA 3GAYA 1K70A 2B81A 3W38A 4JR5A 3CQJA 3MYOA 3KEHA 1I2RA 3W7RA 2HNEA 3S1GA 1XIIA 2RJHA 3WQFA 2GJLA 3W7KA 1RLCL 4MB1A 4F0HA 4UWMA 2ZADA 4L6DA 4A2RA 3L5AA 3IJIA 1I45A 3ARZA 4HB7A 9CGTA 4HMDA 1GVQA 1PSCA 4UTIA 3GXTA 1ONXA 4F66A 3ZJ8A 1H7WA 3ZYZA 4UFIA 5FD0A 4W7WA 4IGNA 3MANA 5HWNA 5EU9A 1SUXA 4EOUA 1UD4A 4NG3A 3N2TA 2GK1B 1G94A 2WMJA 3TC6A 3REQA 1LUCB 1OT2A 1Y5WA 3PJWA 4LAMA 3WNKA 5K7JA 2VEPA 3FS2A 1FH8A 3GG7A 1VS1A 4WSHA 3W02A 3T4CA 4UR8A 3E9AA 7XIMA 3TP4A 4RZBA 2ZZ7A 2RHGA 1EGMA 2QF7A 4UCGA 4E4PA 5FACA 3PM6A 4U4MA 4G1NA 4DLMA 3UWUA 3ARRA 3FV9A 3S2MA 2QJJA 4IGHA 4HYWA 4GOAA 4L5ZA 3NVTA 3DFNA 1Q6QA 5FAGA 5A8NA 4NNBA 5C70A 2PWGA 1M03A 4B5SA 4HA4A 4B3KA 4LVDA 4DN1A 1MUWA 2W4XA 1TWIA 4QJ5B 4NU7A 1H1NA 3S2NA 1VJSA 3S6OA 5C6MA 3GW3A 3IARA 4IP4A 2GGEA 4LT9A 4GBUA 1K1DA 4FEZA 4LY4A 2PP1A 3F5KA 1D3GA 4GI4A 4ZSUA 1SVDA 1BF6A 2J8TA 2P8CA 4BEQA 2PDKA 5BXSA 1E5NA 1AW5A 2VRKA 2VEGA 1IXOA 4DPQA 2VC5A 1H50A 2WSYA 3CMFA 3LHVA 3KFTA 3K2GA 1PEZA 5I77A 3GTNA 3QV6A 4DNMA 4EXBA 1GJWA 2PMQA 5LA1A 3FEQA 3WQGA 4KCVA 4BI7A 3VNJA 3PPHA 4GI9A 4B5VA 3SQLA 1VF8A 4CCDA 4FHAA 4POCA 3LCXA 4PGLA 3LRMA 5JVLA 2RGMA 4IG2A 4DJED 1ME8A 3GU2A 1H61A 1KFWA 4I5UA 3AICA 3BG3A 4IIDA 3VVGA 2ACUA 2TYSA 3NZGA 1WV2A 4D6JA 3W1PA 1ITXA 3MT1A 4MUPA 4U5IA 4J40A 1W91A 3B9AA 3MUCA 3RLGA 3S9IA 1LCOA 3PBMA 4X3ZA 2YX0A 3N6QA 1FH7A 4AF0B 4Y9OA 4Q33A 5HUPA 3T4WA 1BFNA 1H0IA 1UC4A 5G4HC 2GUBA 4MAZA 4ACZB 3SJNA 3VNKA 4CD8A 3GDTA 1VD6A 3B0PA 3IACA 4A29A 1VBHA 3GFZA 5DANA 4I7UA 3VMPA 3G5EA 1WBJA 3U2ZA 3UR5A 3E2RA 2I9EA 1IZJA 5HR6A 3AWOA 4GCXA 4PUDA 2DSUA 1KWKA 1IIGA 2WHMA 2WCAA 4J3WA 4NT0A 1WUFA 2C3ZA 3EOSA 1GEHA 1KV5A 1Z89A 4JTHA 5F1UA 2QCGA 2OU4A 1SFJA 1EF3A 1TPWA 3A9IA 4GGBA 3GXIA 3T9PA 2ALDA 1EGZA 3NM3A 4MJ4A 4B5XA 2FDMA 3TSMA 1EO5A 3CV7A 4Y9NA 2EQDA 1P48A 3WMSA 3PZUA 1YXDA 2GVEA 2WMHA 2Q6ZA 3E2QA 3NOYA 2YLAA 2YBUA 1WCGA 5CKSA 4MPKA 3BLIA 1DQXA 1OFAA 3PZOA 4BQ3A 3I10A 3KTXA 4US5A 3VFCA 1J5TA 1W1ZA 2WMFA 1AL7A 3UXAA 2G96A 1ZSXA 4PBGA 3KW3A 4FNQA 4O8AA 2QIIA 1XRTA 4UQAA 3O07A 5I03A 4CNUA 3GXFA 4Q4MA 1QWKA 4NJGA 3T2QA 2HZGA 4TVUA 5MHBA 4HOXA 4C7GA 2NQJA 3GYCA 1K4GA 3SGZA 1GK8A 3GRIA 3C0QA 4PSRA 2X2GA 3QPEA 2EGZA 4YTRA 1JVNA 2DIEA 2Y63A 1FFQA 1KXQA 3K13A 3SFWA 3LCIA 5I09A 3Q94A 1GQIA 3DFYA 3CTLA 4GE8A 1IV8A 1EEXA 3SCSA 4AYGA 4MHBA 2I17A 3CK5A 1FWBC 2ZX6A 4QNEA 1BG9A 2OVLA 2XSXA 3PZMA 1W56A 2C91A 5CPNA 1HNYA 1N7KA 1CPUA 3CLMA 2WSKA 1Q6LA 3O15A 4S23A 1NIUA 4OT7A 4MWAE 1QBAA 4P8WA 3GX9A 4ALDA 1E70M 5A8OA 3ZMRA 4PUEA 1DKWA 3KDNA 4KFOA 1K8ZA 1TKKA 1QASA 2DEPA 4LAKA 2J77A 4FNRA 1TA3A 9XIMA 2Z6IA 4AIEA 4XZLX 4CQCA 3O6YX 5K4ZA 3QN3A 4DWSD 3B9DA 2HBXA 1EX5A 3CO8A 1T8XA 3S9ZA 3VD4A 2CBUA 3SY5A 1HGYA 3TTOA 2YCKX 2QT3A 4BF7A 5BOFA 4U33A 1F9CA 1E73M 2YBVA 3E2SA 1HIZA 4JN6A 4G6CA 2QIWA 5LNVA 1QAPA 1E55A 4PE8A 3NZRA 3W72A 3TW6A 4H2HA 1JAEA 2HE5A 4AH7A 1TV2A 1R9XA 2WSRA 4LUIA 2D0GA 3GVGA 1E71M 1YTDA 1TZ7A 4PCTA 2XDFA 4C6BA 1JUBA 5BXTA 2XM1A 4AC1X 4G5DA 5DELA 2YZ5A 3DFOA 3CYVA 1I2QA 3LM3A 4LBRA 2ZA1A 4LYKA 3IV3A 4LYRA 1OC7A 4IMAA 1A5BA 1M6JA 3UNDA 2Q3OA 4NZ1A 4PUMA 1H3GA 1TZZA 2G0WA 5D2WA 1KFKA 2F8QA 4N2YA 1W32A 3DYMA 2ZTKA 4IP7A 3UXDA 3K8KA 2CZEA 2BP1A 3DENA 1Z9AA 3H2MA 4WXYA 2OYKA 3KRSA 3NXLA 1FCQA 1W3LA 1AMKA 4ICMA 1XGEA 3DCPA 3ARXA 1UKPA 1AODA 5KINA 1K7FA 2PDYA 4W5UA 2YCEA 4KEMA 3B4UA 2HQAA 4UTHA 3DG3A 2XGBA 5EBAA 2X40A 5KITA 5TF0A 4JKMA 5G1YA 2VZSA 5GJMA 2ZUMA 3WLRA 3EKZA 4OE7A 4DBEA 1OIFA 8XIAA 4YPJA 1TWZA 3EB4A 3WLKX 2MUCA 3NYDA 3P8IA 4C1KA 2PEVA 3F4NA 4N02A 2DT1A 3EWWA 3N9SA 4ATLA 4BY3A 1L2UA 1UD3A 5JBFA 2JKPA 3E12A 3EOOA 3G0SA 4K8GA 4H41A 4PUUA 4DNHA 3NVDA 2PC8A 2V3DA 4Q8MA 1OX5A 2QR6A 3G2GA 4XZMX 3RX2A 1YLVA 2GVLA 2PCEA 1CLVA 3TTQA 4M6PA 4UIOA 3UZZA 1AMYA 4JQAA 1SYTA 3BTNA 4TTGA 5AHFA 1WX0A 3W86A 1RJPA 4U2YA 4MY1A 1WKDA 1IT8A 3UU0A 4DRSA 2NX9A 3W1RA 1XL9A 3KBWA 2QEZA 4V27A 3V1HA 2WMIA 1BSIA 4H04A 5CC7A 1L6YA 4ZXOA 5EFFA 4K2SA 4HNUA 4XUGA 1XLCA 3BMXA 2ISFA 1R3VA 2ON3A 3O2LA 4WJEA 3BAJA 1DJXA 2RFGA 2F9RA 1FHLA 3B8DA 3S8HA 3OZYA 3HG3A 4DBWA 1NQKA 1G7VA 5FL0A 3IUIA 5MKGA 2LLEA 4A8IA 3A4JA 3MHFA 1Q6EA 4G7EA 3U7VA 4B9ZA 3QSRA 3IIOA 5CBBA 5ABHA 3N4AA 5CJNA 4J3ZA 2QDEA 4PMNA 3SCWA 2MANA 4HMCA 3H54A 1UD8A 4L61A 2NVAA 1XXXA 1XV8A 4YVXA 3EEGA 1M65A 2DH2A 4O1DA 2WMKA 4AVOA 1EEPA 4L4PA 1MRAA 3L0NA 5CC6A 3WLIA 5AC6A 2J74A 1WP6A 4UQEA 4PEKA 2PGEA 4CD4A 3UZYA 1UKSA 4J3XA 3UJRA 1NU5A 4Y90A 4GKLA 1O12A 1A5MC 3DGBA 2CETA 3WQWA 3KBJA 1EO7A 3UXIA 2I56A 1M01A 3QYSA 4YCOA 1OF6A 1GQKA 1W5QA 1MO0A 1Z7AA 3EOLA 5DMLA 3ZR6A 1FKWA 2V8ZA 1CYGA 3IV8A 3SRFA 3PBWA 4ZBCA 4Z0JA 1H41A 4LC8A 1ZAIA 5FJRA 3PF3A 2J7EA 5KETA 4A21A 2FGBA 1YQ2A 4O52A 2BWGA 4ML9A 1ITCA 3HG5A 1B9ZA 3EDDA 3HA1A 3H24A 3OVGA 2OB3A 2XU2A 3JZUA 3GDMA 3N4FA 2VC9A 3D6NA 1RVKA 3NGJA 3IPWA 3KHJA 3TE9A 4GYPA 3S1WA 3QKZA 1UZ4A 3SI9A 3QRHA 4GRSA 1TIWA 5I3GA 2A7NA 3S1XA 1E43A 3GDLA 5EMJA 3WD2A 3VIOA 1CXKA 3K4DA 4DPPA 1DORA 2JGQA 2J78A 2VHLA 4NJIA 1P0BA 4ADUA 4UTMA 5ABFB 1F3XA 3SR7A 3VIGA 3IJ8A 1K77A 5HPCA 1US3A 3WFZA 2WCSA 3M5XA 2ISDA 2DZAA 3IS4A 1XWYA 2BXVA 4I9JA 1NOFA 1W5MA 4F79A 2ZFAA 1OCNA 3W26A 3I4KA 2WJDA 1RSCA 5EGRA 2XWDA 2CCRA 3T09A 2A3HA 2WHKA 1TPEA 3BVJA 3P5YA 2XFRA 3GHUA 3P2VA 3CL8A 1V8EA 2QF8A 3MCOA 4W7UA 2ZVIA 4HMNA 3SY8A 3RCYA 2E5CA 3VA8A 4US6A 4C1NB 2BNJA 4AZCB 1WDPA 2X1UA 4F8XA 2X0SA 4EAYA 4B2DA 3AXMA 5KZDA 1T0OA 3Q58A 1HUVA 5KEZA 3LMYA 2E6FA 1PHWA 3AC0A 1IXPA 3AMGA 1R3SA 3R11A 3A4XA 3LNMA 4HCHA 1UD6A 1E6XM 3W6LA 2ZVRA 2DFAA 4KKXA 2GGIA 2NW0A 2NVCA 2FLIA 2ZYFA 2X2YA 1LOSA 1ZNNA 3GVRA 4XKYB 4BA0A 1MUMA 3LGEA 1Q6RA 3P61A 4YXGA 3EMCA 3QQ1A 1S38A 4Q8NA 4ZQMA 5HJLA 3S5OA 2H9AA 3R0UA 4XTDA 3GU1A 2P8BA 4O10A 4PCSA 5BXPA 1Q2RA 1P1XA 3U4AA 1PHQA 1NJJA 1WDSA 2ISVA 5D03A 1RP8A 1G69A 3INPA 4IXXA 3EGJA 4TR9A 5HMDA 1FRBA 1RP9A 2PGWA 1CWYA 4KS0A 4GA8A 1UJPA 3VNDA 3QLLA 1AQFA 2DSWA 3UGRA 3KXQA 3PN8A 1XYZA 2QZRA 4G9PA 5C9RA 1C9WA 1XDJA 2OWCA 3UESA 4LYPA 1S5MA 3CMJA 2VELA 1XSJA 2OO0A 1EXPA 4S3JA 3SBFA 4LXFA 1RD5A 1SMAA 2FHCA 3HQPA 3W01A 1LUCA 5JBEA 5CAKA 2W91A 3KCOA 1OZQA 1ZJHA 2P3EA 1NWUA 2PDUA 1ZUAX 2BY3A 2VQTA 1FWTA 4LX4A 1UZHA 1UG6A 3VUSA 1R8LA 4JHMA 4LSBA 2F84A 3E38A 4F9JA 1A5AA 3UPMA 1B3ZA 3E6EA 3UYCA 4YYCA 1XP3A 5FCZA 1EDGA 1XCWA 2Y70A 3TTYA 1XW8A 1LQ0A 1QW9A 2V2DA 3E74A 5AOUA 4TX9A 2CPUA 2AKMA 2Y7DA 4Q8VA 2V3FA 3FEMA 2J9ZA 2O56A 2R1KA 2WPBA 4KEZA 4M7SA 3GDRA 2CBJA 1CDGA 3BURA 3QZEA 3DU0A 2V63A 4KCWA 1WXYA 3GH5A 4WKHA 2E4TA 1RALA 4GINA 1VCFA 1KFJA 4IJRA 5G4EA 2BVYA 1T99A 3UY7A 3WENA 2E1WA 1AVAA 4LRTA 4OECA 5JU6A 4YHEA 1KXVA 4HGXA 4FF5A 3TCSA 3DOPA 2WSQA 3R13A 3VD3A 4U5KA 1MRQA 1UZDA 1BVZA 4HZ8A 1IT0A 4HNNA 3SN0A 4LBUA 1OB0A 2QMJA 3L23A 4M6QA 1HN1A 4Z2KA 2QAPA 3BGGA 3NXFA 3GTXA 3HIJA 1KV8A 4QX4A 2NQ9A 3GH4A 4XIMA 3CQHA 4LYQA 3IVUA 2Y5JA 2PRHA 2V0TA 2VTFA 5D9NA 2FZ8A 2BY1A 1QW7A 4ACYA 7ODCA 5K4XA 2D2HA 4H2CA 4NP7A 1TQJA 2E77A 4EACA 1E4MM 4OHQA 4GYPC 3SCUA 1FWGC 2Y2WA 2GL5A 4DJDA 4AVFA 2UV8G 5CG7A 4WDTA 3SIMA 3M6DA 5DT7A 4ZE5A 1OFBA 1NARA 1E4IA 1B5TA 1TTJA 1NDZA 1JCLA 1D2KA 3PB2A 4Z08A 1HL2A 4O57A 3ES8A 1HJQA 1V03A 5DLCA 1DE5A 5L6UA 1U5HA 1SO6A 3PFMA 4WY0F 3U5YA 2W5FA 3L5MA 4N42A 3GG1A 1S1RA 4GPNA 3QEZA 1GHRA 3AYSA 1ZJAA 3AIUA 4PCFA 3QR3A 2NWRA 1V7YA 2PWFA 1Z48A 4H9YA 4OV9A 1WAUA 3M0IA 1PCKA 3G1XA 1TMHA 4NL1A 4WHBA 3CIXA 5D2XA 4ERGA 4AHOA 2VOTA 1PVNA 3LCGA 2C18A 1JUKA 2DT3A 1H51A 1Z44A 3ISIX 3IIZA 1H2JA 1W5OA 1Z42A 1V6VA 4S3FA 3GWQA 1WZAA 1A5LC 1VJIA 3N29A 2XZ9A 1HJVA 4J7RA 4FX8A 3URQA 1SZNA 1R2SA 6CGTA 2OEKA 3W2LA 1PXGA 3RILA 2W3ZA 3ECQA 3B9OA 2QMKA 1ISZA 4QS5A 1XPGA 3KAOA 4AB4A 3F4DA 4O11A 1E6NA 4AWUA 5KZMA 1B3YA 3TYZA 1N82A 1MMFA 1M7PA 2TSYA 1C8QA 4JHZA 1LP6A 2P0IA 1NTHA 5REQB 4BR1A 4RE4A 4I5XA 4U28A 3MJYA 2C0HA 1J6OA 3GVQA 1VB9A 1B3WA 2VO5A 3W24A 2PDMA 2PLKA 1GQNA 1T7LA 2RDWA 5A6JA 4X2RA 4P5UA 3VIHA 1DOSA 3U2EA 1E1FA 4AZ5A 2CLFA 2G5WA 3PWGA 2XSBA 1OJXA 2WVVA 2ZX7A 3PSWA 4JQ4A 3VU2A 5HANA 4DYKA 1OVDA 1YDYA 3BE7A 3CWHA 2Q01A 3BAKA 4YIWA 1POJA 3DKJA 4GZJA 1I75A 2GUYA 2X1TA 2GDUA 3EDFA 3M0VA 2X16A 3CUXA 2Z24A 3U4FA 3H2AA 4C6FA 1KRMA 1VPXA 4CNSA 1HT6A 2UBPC 2GDVA 4QJ4B 3RG6A 3EXTA 2X41A 2PDLA 2OKTA 3NCOA 1FDYA 2W92A 1TR1A 2NUWA 4FIQA 1R87A 5H8PA 1NH6A 2BG5A 3LYEA 3OYXA 5C55A 2FHFA 4LB3A 1KM0A 5CGTA 4RV8A 5FJOA 5I3FA 1QJWA 4UOQA 1PS9A 1VCGA 3ABSA 3U57A 4H01A 2ZRVA 4MM1A 1I2NA 5FJJA 3BOXA 4TXEA 3A3HA 2DJXA 2NWSA 5FF4A 4EIVA 4BHYA 1H09A 3TCEA 3RM4A 2KAUC 3WQOA 3TOYA 1G9HA 1UWSA 4DJDD 3M1ZA 2XVLA 1GZGA 3PS7A 2J66A 1VQTA 4FI4A 2BVDA 2OT1A 1HW6A 4MZYA 3BAIA 3RJYA 1YE4A 5H1WA 4JIHA 2WV8A 4GVFA 4L1WA 2XPKA 1EYEA 1TO3A 5AYXA 1QOQA 4AUBA 1W5NA 5JIPA 1JJKA 1NDWA 5EKYA 1TJ0A 2YA2A 4HU0A 3UY8A 1GVRA 2VENA 4WRHA 1MFUA 2O4MA 1IWBA 4L6HA 4G8TA 4XAPA 1U2YA 4B4HA 3IIPA 3CZKA 3WY1A 3OQ8A 1ICSA 2XVNA 4O0KA 2AGKA 3DYPA 3P82A 3OODA 1FCVA 4AHQA 1R7AA 1EOMA 1XHGA 3MMTA 4AZ7A 1X7IA 3P81A 1U1HA 3TQVA 1XYAA 5I7GA 4XAFA 3NDYA 1E40A 4JY9A 4K39A 4Z1BA 1PBGA 2FGLA 3R2GA 1GKPA 4LNCA 3THAA 2B7OA 4FNPA 4KT2A 1G4PA 4PMYA 1CLKA 4D71A 3HGJA 5IHRA 1WE5A 4YVVA 2V5DA 1KB3A 2X09A 2ZRZA 4PYSA 4JTDA 3OLDA 1P1MA 4A4AA 4BQ5A 2CHOA 3SADA 4CNTA 1NY1A 1XLHA 2ZA2A 1J0KA 3BC9A 1YNQA 3VTRA 2XTKA 1OBAA 2HVNA 3G1SA 3GHTA 5CG0A 3KM8A 5KZ6A 5EL1A 1DWFM 1TTQA 3UGVA 1EJWC 3FJ4A 3VGEA 1W1B1 2EG7A 2FVKA 3NZPA 4DYEA 3M44A 3CWNA 3GNNA 3DEQA 4Y9PA 2PDCA 1M7OA 1OYAA 4LGXA 4NAFB 1DE6A 3N34A 1WAWA 1GYLA 3WQDA 1XYCA 1G67A 3M5VA 1FOBA 3E02A 3K8MA 1K9FA 1FXQA 1AK5A 1G0CA 5A6LA 3WBYA 4YWIA 3NQ7A 5I02A 2YDAA 1VEOA 1U1JA 1JZ3A 1FHUA 3G77A 4OTKA 1DVJA 2H6RA 1TMQA 4JN8A 2VR5A 1S1PA 5GNYA 5BNKA 5I3DA 1QW8A 2Q3RA 4S1FA 1VKFA 1LQ2A 2AQWA 2Z2AA 2DIKA 2DUAA 3ZLHA 3CBWA 5ABTA 3NR0A 3PZTA 3VABA 3GNPA 1DWAM 3OOQA 2VCBA 2XM2A 4U2ZA 3S46A 4E5TA 1WB0A 3GNOA 3W9ZA 3PBVA 1W9BM 4AMCA 1IT7A 3LRKA 3VX1A 2QAFA 4AIUA 1XLGA 3S6DA 1P7TB 3WIJA 2OLHA 2CLOA 4Z2HA 5T9CE 3BLEA 3YPIA 3MSYA 5M17A 3P93A 2D2OA 3LHZA 4UTUA 1RXOB 5HK4A 1JD9A 3CZEA 2QJMA 4YYFA 1KM4A 4JX6A 4IIEA 1F4AA 1MW1A 1E6RA 1BLIA 5DCDA 2YFNA 3OO2A 4S39A 2J7CA 3S5NA 3MKCA 1W0MA 3QTPA 1RPXA 2A5HA 2OELA 2W9MA 4IF2A 2WYSA 1PZ2A 1ME9A 1NAL1 3N4EA 3AISA 4IPJA 4JTFA 3PWAA 2YGYA 2BB0A 2ICSA 4L9ZA 3QPZA 3IJ7A 3BCDA 5IDZA 2WPGA 3CXOA 3EPNA 4ILSA 2WLZA 3U6WA 3VGGA 2OWWA 5E0KA 3LNPA 3ITGA 4DVOA 1ISYA 3GIPA 4Q8PA 3TTEA 4QJ1A 4AZ6A 2PUZA 1WZKA 1VYPX 4A2SA 1PUDA 2CIPA 3W7HA 1SW3A 3L67A 1RY8A 3I4EA 3T40A 2VRJA 3EX3A 3GB6A 4W5ZA 3BOLA 3O6AA 1BEUA 4D1IA 3EKLA 4HQVA 3RO6A 4JIRA 4ZE4A 1IYXA 3NM1A 3W4RA 4MF4A 3KUMA 3MDWA 4R34A 2O4QA 3GXDA 3PG9A 2AL1A 3EXSA 3GBEA 3PSVA 4CUCA 1W1A1 4KCTA 3PUEA 4MG4A 2OOFA 1XINA 4JTTA 2BFGA 4B16A 2ACSA 4FXSA 4C6CA 2BOEX 3EA2A 3P60A 4LF1A 4GZIA 2Y8UA 2QJIA 2VDIA 3VZYA 2MNRA 1W31A 3R8HA 1UA3A 5ABFA 3P0XA 1BWVA 4LOCA 2ZCGA 3WEZA 1ZL1A 4PUJA 2PU1A 1VEMA 3QC0A 3B0VC 4QNWA 5FKYA 4GO9A 1XI3A 1AZ2A 2VEMA 4XZ9A 3EPMA 5C54A 4ZEPA 1FA2A 1MFVA 3BJTA 4TUFA 3VKJA 4LFYA 5DY3A 2YPIA 2CERA 2JK2A 3LCLA 5HNTA 1E9ZB 4CN1A 4YMZA 1R5YA 4WVXA 1EIBA 1UP3A 4B5UA 4X9SA 4C1NA 4GXMA 3WNLA 4GFIA 5E70A 1QDSA 3UA4A 3E0VA 1FWIC 4I7WA 4DQWA 2RH9A 4FO4A 3DHFA 3CMGA 1THFD 2IPJA 2XFYA 4REQB 4AD5A 3W2NA 6ALDA 2A6LA 4D8ZA 4JZ5A 3LU2A 3VILA 4YS1A 2VC6A 1K6AA 2G50A 5EMLA 4F0SA 2Z29A 3D3AA 4Q3MA 1VYSX 3XIMA 3ZVIA 4MB5A 3GUWA 4O16A 1CGVA 5EBUA 1AL8A 1DTUA 3C3UA 5D2VA 1HJXA 4M3PA 1AUSL 1J9YA 2WHJA 2R6OA 1K02A 3T07A 3UW6A 4N4PA 1QATA 1DHKA 2V68A 5HNRA 4OU1A 2REQB 2XISA 4WQ6A 2PDHA 2AAAA 5M5DA 3GK0A 4PMQA 3W7LA 1YRRA 1GCYA 1KFLA 5AC5A 4K6AA 4IL0A 1R9ZA 3SDOA 4R7WA 4V1XA 1Q7QA 1FQ0A 4UCFA 4AZBA 1V3KA 3VOGA 2GJXB 3QMRA 5DX7A 3EKGA 3WDIA 3VDAA 3LXAA 5XIAA 3TN3A 4DUOA 4JTSA 1CI1A 2DVXA 3CUHA 3S83A 4AEFA 1XRSA 2OTDA 2ZDRA 3DIPA 4DY1A 4FPSA 1ZHAA 3KBVA 1R0MA 3AZRA 1H7OA 2Q71A 4MJZA 3RMJA 7REQB 4PEEA 1OFPA 4QEHA 4PMJA 2VX4A 4QCFA 3VZZA 2ACRA 3AOFA 4K38A 4HU3A 3WDJA 3CGTA 3ANUA 4CCEA 5LA0A 1EJUC 3LCHA 2J25A 1EJXC 1ZU8A 3PJTA 2Z1KA 1W9UA 2I5IA 1ZQ5A 1CTNA 1X1OA 4UMBA 1M7JA 4Q4PA 3VO0A 4AX7A 5T26A 1SMDA 4HNLA 3GY1A 3PP7A 4UFMA 1HL9A 3ZIZA 3VCCA 3QZ6A 1QXLA 1B2YA 4HN8A 5CPMA 3GQYA 1N55A 1IGSA 1MUCA 4FNSA 3PG8A 1A53A 2XHYA 5A6BA 3OA3A 3HV9A 4P7NA 3K46A 4JNYA 3APGA 4AVNA 3LUTA 4GACA 2BHZA 3N17A 3K8LA 3BV4A 4L64A 3GKAA 4YVPA 3VUPA 4Z2JA 4Y8EA 3U9IA 4RR4A 1PCWA 3W53A 4UOZA 1OFDA 5C9ZA 4MB3A 2AMXA 1F2JA 3PFRA 1ML1A 4P7QA 3T81A 1WKYA 2GQ9A 3C86A 4DM2A 3V36A 3PNZA 4J3SA 1OFOA 4BEUA 2G3NA 1A5UA 3NUKA 1S5NA 1J0JA 5DEZA 3R6IA 2BY0A 3IJDA 4O28A 1N8IA 1Z69A 1W9XA 7ENLA 3E0FA 3CB3A 2XN2A 5AB3A 4WSKA 4DJFA 2WXDM 2INEA 3QC3A 4MADA 2ONEA 1TB3A 4X2PA 4YWSA 3FHAA 2VDHA 2WKJA 3M9YA 2RKXA 1BPLB 1O7AA 5D30A 1C92A 2EPLX 2FPTA 5U4NA 4O8RA 4GWEA 1ZENA 3C61A 2GVYA 4LCQA 3N3TA 4QITA 2ATMA 3V35A 4IQLA 2QHAA 4ZB2A 3ZFHA 5D02A 4RX0A 4F3HA 5D05A 3HU7A 4NHVA 2FJUB 3VNLA 2WZTA 3ITCA 3WELA 2GJRA 2OLSA 1QI4A 3LX9A 4I6KA 1X6UA 4I9TA 4DAIA 2FZMA 2INFA 2BS9A 1B4KA 4EF9A 4QTGA 2PGFA 3NOEA 2JE8A 1LOQA 1KM6A 1CIUA 3CNYA 4TMCA 2J7DA 3RX3A 3NEVA 4ZMGA 2J8GA 1F6PA 5FIPA 1H4PA 1VFHA 1D3HA 3AJXA 1JZ4A 2DQXA 3B06A 1B30A 1PYFA 1YIXA 1ZRQA 3UP8A 2JALA 8CGTA 3HPSA 1G4EA 3M0KA 1JRBA 3LEPA 1VENA 4LUTA 3I3BA 1XH0A 3W2KA 4HK6A 5ABGA 3ZO9A 2BOFX 2PDJA 3CU2A 3ATYA 2V5BA 1TSIA 4PBFA 4GO8A 2J27A 1OSEA 1V77A 4CQ9A 2GQ3A 1KKRA 1PE1A 2O9RA 4ZENA 1P6CA 2OZTA 3OGRA 4ZO8A 3DC0A 3VGDA 1M5WA 4XZWA 4JL2A 2DZBA 4LW7A 3NQVA 3GKFA 1XUUA 1OFEA 1G4SA 3UG5A 4B9YA 5I5RA 4E0CA 3LN3A 2QXWA 3SO7A 2Y89A 3H2OA 4F0MA 2CHRA 1VRDA 4Q8UA 3L21A 3UZWA 2WZIA 4QISA 1YDNA 2GZXA 3SUUA 1WUEA 3O16A 4JYEA 4X0VA 1D8WA 1A47A 1RCXB 1NDYA 3D3FA 1JPKA 4X60A 1O60A 4O53A 4EWJA 4XBKA 2HPMA 3NWRA 1EC9A 4PL2A 1VHCA 4IIHA 3W27A 4JX4A 4CCCA 3M4HA 4AY8A 4HPJA 1GOXA 2JKEA 5F4WA 2XWEA 3RFAA 5GVJA 3W1AA 3OP2A 4TV5A 5B7YA 1EUNA 3EWUA 1KM3A 3M0HA 2HTMA 1JZ8A 5D2YA 1DJNA 1B57A 3PR2A 5C8BB 1HF6A 3FKKA 1QNSA 1JCMP 4UB9A 3FCPA 3UETA 4HJFA 3XINA 1DL3A 2PTDA 4FIRA 3GNRA 3IIXA 2VX6A 3W81A 1YPXA 1DJQA 5IHSA 4YCPA 1NWSA 3N14A 2HVOA 4LALA 3QH2A 4JFSA 4MWAD 4ENLA 3BW4A 1BTMA 4F2UA 2PDIA 1IZCA 1PPIA 2HBVA 3R8RA 2Y85A 4GNJA 3RXZA 2OEMA 3W1MA 1X98A 4OBRA 4C65A 3BPWA 3H4GA 3O6DA 4XB3A 2DU2A 2D20A 4O1CA 4CQ8A 5IFTA 9XIAA 4UNLA 3KTSA 1M9HA 2QULA 3WQPA 2ZC8A 3W73A 2B4GA 4HSOA 1UMYA 4RE2A 1E4LA 1JZ5A 1ZS2A 2ZOXA 4C5YA 3CM4A 3ZLGA 1O5QA 1EP3A 4L1XA 2YCLA 2WCGA 4UMAA 2IKIA 3BUVA 1VFMA 4KERA 1LG2A 1GPWA 2V9DA 5TNVA 1B1YA 2XIJA 4IL2A 4LEQA 3AS0A 5G1TA 4R88A 3W74A 1NP2A 3L68A 1R47A 3IWPA 3BQ5A 1TV8A 1QNVA 1V02A 5CLWA 4JTRA 3WL0A 4GISA 1CEOA 4Q8OA 3C0SA 4I3GA 2PWEA 1WDQA 4TOQA 1IHIA 1F3TA 4ORIA 4QE1A 2QW5A 4L4OA 3AROA 3VIKA 4DJFC 3KCLA 3DX5A 2W66A 5FEWA 3FW6A 3ZT7A 1QOXA 1E4NA 3OGSA 1KQYA 1V51A 1WXZA 7A3HA 1F73A 1AH3A 1IEVA 3HFYA 3W25A 4D2JA 5FF7A 1BKHA 6REQA 2J75A 2DV0A 4RDVA 3WH8A 3SY1A 2F6KA 2WK2A 4Y9MA 3CUIA 2Z7GA 5L9FA 3WH7A 2FFIA 5DN1A 3WK0A 4C6JA 3OLGA 4KF1A 1TCMA 2GJPA 1SR9A 4PL1A 4NX5A 4JTCA 1OYCA 2Z28A 2QPSA 3TV8A 4OIFA 3CLWA 3HTWA 4XVDA 1C90A 2H3DA 3ABZA 2I1OA 2V2HA 4N7QA 3H4XA 4WF7A 4LQ1A 2IKGA 3ITVA 2PTXA 4QQ3A 4C90A 1JFHA 5DO8A 4O4WA 2I5GA 2F6UA 3RPMA 3CT2A 2PDNA 4FF7A 3OLEA 1U83A 4D6IA 4WDUA 3W7EA 4BKNA 4NAFA 4HHHA 1QPRA 3CAWA 1PTDA 4OFCA 2YSWA 2QCHA 3IGSA 1J01A 4Z0SA 2OLAA 4AD4A 3UWVA 3R89A 3BWWA 5T8GA 4RDWA 4JDYA 3TWAA 2Y8KA 2WAGA 1DJZA 3DHDA 3SRHA 1HX0A 3FDGA 3G1RA 3N1AA 2P53A 5J5RA 3SQSA 3LSCA 3SURA 1KR0A 5CH9A 1I1XA 3NPVA 2AGTA 3S4TA 1Q7ZA 5BZAA 4J1OA 3O6CA 2WVSA 3WF0A 5TBOA 3JU2A 3H26A 1E0WA 1EIXA 2BY2A 4GNVA 1EUAA 5D9MA 1KA9F 1EBGA 4QRNA 4I7VA 1LWJA 1W17A 1EJRC 3ORWA 4LVBA 4IJCA 2DDXA 1A50A 1H62A 3B8VA 1P7TA 1DWHM 3FYPA 4WK9A 2G41A 3USZA 3U2CA 5CAHA