1G4EA

Thiamin phosphate synthase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
226
structure length
219
Chain Sequence
HGIRMTRISREMMKELLSVYFIMGSNNTKADPVTVVQKALKGGATLYQFREKGGDALTGEARIKFAEKAQAACREAGVPFIVNDDVELALNLKADGIHIGQANAKEVRAAIGDMILGVAAHTMSEVKQAEEDGADYVGLGPIYPTTRAVQGVSLIEAVRRQGISIPIVGIGGITIDNAAPVIQAGADGVSMISAISQAEDPESAARKFREEIQTYKTGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the enzyme-substrate, enzyme-intermediate, and enzyme-product complexes of thiamin phosphate synthase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords THIAMIN PHOSPHATE SYNTHASE
total genus 79
structure length 219
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.5.1.3: Thiamine phosphate synthase.
pdb deposition date 2000-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1g4eA00
4CCEA 1RD5A 4MY8A 5HINA 1H7OA 1M7PA 3MI6A 2R8WA 4DELA 3NQVA 1LCOA 3CLMA 2X1SA 5FEPA 4GUFA 4AAJA 5FEWA 5TQLA 3W7KA 4LY8A 3W1AA 3MHFA 3H54A 2VXNA 4S2CA 4O15A 4JDYA 4PEKA 4A2SA 5IM51 2B7QA 3W6YA 1K3UA 1LORA 1F76A 1RVGA 3CIXA 3LM7A 4MY1A 4FNPA 1ADOA 2DORA 2V9DA 4KFNA 1GVSA 2V0TA 1K8ZA 3W2KA 3LX9A 3NDOA 2E6YA 2QCDB 4FNRA 1P0NA 4ZZ9A 2GJLA 4GBUA 3QC3A 1GG1A 3VE9A 1PCKA 1I2OA 2VOMA 4O0KA 1OYBA 3KXQA 4R7JA 2QCNA 3NPXA 2OMAA 1F73A 2C18A 4G1KA 4OT7A 3OVPA 5AB3A 1VCGA 1FDJA 2QAFA 4NX0A 4JX4A 5CZTA 3U2OA 1DVJA 5F1UA 3LCLA 3HOJA 4QJ1A 2H6RA 3G3DA 3B0PA 3CC1A 2TYSA 3ATYA 5MHBA 4ZQPA 3B0UX 4UTHA 1WA3A 4FHAA 4JD4A 1XXXA 3FKRA 4C1LA 2LLEA 4O54A 3IEBA 2FTPA 1NAL1 1MO0A 1A5AA 4CQAA 2QR6A 3OA3A 1LLZA 3IIVA 5DBUA 3BW2A 4O53A 2RKXA 1T96A 4GE8A 2VEKA 3QW4B 1JCXA 4BFAA 1D9EA 2DJLA 3NYZA 2H8XA 5AHMA 3R8RA 5KINA 4UC5A 5CPMA 1JR1A 2JGQA 4A3UA 5CGQA 4RKAA 1AL8A 3DI0A 5AC6A 3O15A 1JCMP 3EWYA 3C56A 2Y88A 3LTYA 3O63A 4M7TA 1DL3A 3KHJA 4FXSA 5D37A 4JTTA 3SI9A 1G4EA 4IPJA 1TQJA 2YX0A 4IOTA 2GUUA 3WK1A 3UZJA 1JCLA 3BVJA 1YXCA 1FWTA 1ME8A 5LNVA 5D05A 4A2RA 5KITA 4LVFA 3NQGA 5AHNA 2RH9A 4O12A 3QPYA 2QJGA 1UUMA 3TJLA 3TSDA 1FCUA 3N2MA 1F7BA 4UFLA 5DCEA 4DQWA 2W0UA 3EXRA 1QOPA 5FF7A 2RDWA 4MZ1A 4LW7A 2A6LA 5AHLA 5CKSA 1IXQA 5G4EA 3N14A 1WV2A 3BW4A 4ZQRA 4HSOA 1L9WA 4UFIA 3G1VA 4NT0A 3UWWA 2ZZ6A 3CB8A 3A5FA 4ADSA 3P84A 1H1ZA 3TX9A 3PAJA 2ZRYA 5G1TA 2JBMA 3QFEA 1F6KA 1TV7A 4LVGA 3M5ZA 3P80A 1TYGA 3I7QA 1OFPA 5I3HA 3G0SA 2C1HA 4RLIA 5K9XA 2JGYA 3A23A 1W56A 1FQ0A 3EWXA 3DFNA 2GQ8A 2E1DA 4IWWA 1F5ZA 3SGZA 2W79A 3LRMA 4MFEA 2F7FA 1X7FA 3W88A 1IIHA 1XKYA 1UJPA 2C0AA 3L9CA 3TCEA 2P10A 3FIGA 5HWJA 4UFMA 2H8ZA 3E12A 1KM5A 1N8FA 2EKCA 3S5OA 3MBFA 4XBKA 3W1NA 3P62A 4I7VA 1DORA 3TA6A 3SFKA 4KFOA 3MWAA 4LC6A 4K8EA 2Y62A 3N9RA 4JR5A 4O17A 3C52A 1I4NA 2E5DA 4QNWA 2YPIA 3PBVA 1P5BA 1XC4A 5G2WA 4BK9A 1TIMA 5HNRA 4O1DA 2VENA 5FF0A 5BMWA 4MLJA 4GJ1A 3QMSA 3W7NA 2YFNA 3YPIA 3DFTA 1H62A 2ZZ1A 4NNCA 1HO4A 5AHEA 2RDUA 2QJHA 2VKZG 1LZOA 2A5HA 2YGYA 4MZ8A 3HMJG 2B4GA 3EX1A 2QAPA 3M44A 1IGSA 3OVRA 1WBJA 3L0NA 4FB7A 3PBYA 4IGHA 2KZHA 1YTKA 4FO4A 2CWNA 1VHCA 1TB3A 4RX0A 4LOCA 1EPXA 3EKZA 4OU1A 3NOEA 5EYWA 4KWVA 2IQTA 5L9FA 1XBYA 4N2YA 5FF4A 5AOUA 3W9ZA 1PE1A 4ZL1A 3NQ6A 3WFAA 2CZDA 3RMJA 3TQKA 4CQ8A 3GNNA 5E0KA 2ZZ3A 4QIUA 1P1XA 3NQAA 3C2FA 1YDVA 1G6CA 4MJZA 4OE7A 2Y7DA 4DF0A 3W87A 3IRDA 3MHUA 2FPTA 4Y96A 1XDMA 3TE9A 1H50A 5F2MA 4FX8A 2XFWA 3G22A 3PSWA 2BLEA 3FS2A 1PCWA 1AW5A 1G67A 4M7SA 3EX3A 4D2JA 3PG9A 2UV8G 3GB6A 1LOSA 4UTTC 3L21A 2FFCA 2HS6A 1KM6A 3Q37A 3DENA 3P61A 1VCVA 1FXQA 2ZZ4A 1EB3A 3L68A 1WBHA 1TPDA 6ALDA 3GKAA 2Y7FA 2D73A 1FCVA 4JTSA 5D30A 4E0CA 1K8YA 1OFEA 3W7PA 2A0NA 4L4LA 3NZ1A 5DELA 1KV8A 2VEPA 2O7SA 4TMCA 2NX1A 5BNKA 3M5VA 1RQEA 1FWWA 4L4MA 3GXNA 2FB3A 1THFD 1FDYA 2VFDA 3PG8A 1L2UA 2WSYA 3O6YX 3TSMA 4K37A 4K7VA 4AHOA 1KV5A 4LWWA 1TPFA 5D02A 1TV8A 5CZJA 3B4UA 4HNNA 3PULA 8TIMA 3P7YA 3SIZA 5D03A 4O19A 2Y63A 3CQ0A 3G8EA 5CG7A 1T8XA 1OYAA 4NNAA 2V82A 4KFPA 2ZRZA 3DHFA 1G7UA 3TC6A 4AH7A 1ZAIA 3JS3A 3RLVA 2FPVA 3O6DA 3QMTA 2ZQ0A 3ANYA 2E68A 2RHGA 3MUXA 4DXVA 1SZFA 3MI2A 3I7RA 2V2DA 3HGRA 3S5ZA 3SECA 5K4ZA 3DU0A 4N9EA 1YTDA 3VCRA 4AEOA 3DZ1A 3E0IA 1W37A 1JUKA 3T44A 2G95A 3R5EA 1GZGA 2QKFA 3G0XA 1JULA 3KFTA 2QUUA 3LI0A 4WZHA 2PURA 1OABA 2BZNA 3C6CA 2FIQA 3GNDA 2ABAA 3NNTA 4PODA 3OHIA 2AGKA 2V8ZA 4LVDA 1CI1A 1IXOA 2NXHA 1Z41A 4PC8A 1ZFJA 5D2XA 3W86A 2YR1A 1K7EA 5HQEA 2YCEA 3MP3A 3T40A 2DZSA 1OX4B 3L67A 1XBZA 1YDNA 2E6DA 3EX6A 1QPRA 3DFQA 3KRZA 1QWGA 5G4WA 3S6DA 3TQVA 5A8GA 1B3OA 1B57A 1SR9A 3TFXA 3UWVA 4Z08A 3W84A 4XZ9A 5IBXA 2OT0A 3EKLA 5DCBA 2FQIA 1DHPA 3PBWA 1LBLA 2JKAA 4ORMA 3CPRA 4OHQA 2WJZA 1JCJA 2NUXA 3W2LA 4P61A 2ISVA 2NWRA 4RJEA 3LCIA 3QZEA 3A22A 4AWTA 1LTDA 3C4UA 1ICQA 3GYEA 2A4AA 4CCCA 1KTNA 1H51A 2XN2A 4ZVJA 1UCWA 2CLLA 2WNNA 3WJWA 4JTLA 5BRBA 4A22A 4UR7A 2E6AA 3SR7A 2HMCA 1KM0A 1Q6LA 4MZYA 1Q45A 4RV8A 1Z44A 1YPFA 1W5NA 2CZ5A 1EUAA 4O50A 5LZLA 3W1TA 1RQBA 3IVUA 2DZVA 1F2JA 1H61A 2Z1BA 3W71A 2A2IA 1LLWA 4LRSA 2YYTA 5G1YA 3G1HA 2ATSA 1ZCOA 3GDMA 3PB2A 4U4MA 1WX0A 4PL2A 1QO2A 3H55A 4Z0JA 1KBJA 3P5ZA 3PVFA 4NNBA 3ABQA 3KVLA 4PH6A 1X1OA 4TMBA 4AHQA 3F4NA 1SW3A 1TRIA 3OIXA 4S2BA 3S5YA 4E2DA 3DBPA 5E1QA 1LOLA 1SO5A 4O4VA 4WUIA 3Q94A 2EPHA 3HPXA 2V30A 1OX5A 3LHZA 5T26A 1L6SA 4I7UA 1SZNA 1EUNA 1U5JA 5AC8A 1AW2A 1O94A 3HG3A 3KRSA 4Q32A 1JJKA 1CW2A 4IMCA 3OEXA 2VFHA 3EEGA 4XWUA 3TJXA 3S1WA 3MP4A 3TR2A 3LCWA 1SPQA 5FF3A 3IIXA 5DLCA 1VGAA 1FXPA 2FDSA 4JTIA 4WXYA 1H7XA 3LXBA 3O1NA 5DXXA 3S9YA 3S0CA 4IPIA 4X22A 4WQ6A 3CU2A 4UR8A 1B4KA 1QPOA 4UTWC 3HPZA 5U7SA 4W9TA 3TROA 4OV9A 4IJBA 1GYNA 1R30A 3G8RA 4GWEA 3UNDA 5BOOA 4JTEA 3T78A 3LHYA 1Q6QA 5K3VA 2WPBA 2I9EA 3K30A 1HO1A 2WV8A 3NM1A 4EOUA 4HN4A 2ZCGA 1N7KA 4M6QA 4OV4A 3GLCA 4DO5A 1KFBA 4UTKA 4JS3A 4XUGA 3WK3A 3QRHA 2GVGA 3ELFA 2Y85A 4ZQCA 5HR6A 5CZ0A 4JYEA 5G2IA 2QF7A 1YLVA 3MYPA 1H63A 4JYDA 4QSHA 2GQAA 4GRSA 3HG5A 1KM3A 1V7YA 4LTSA 4LRTA 2Y70A 3W7CA 2YDAA 5C5YA 4NZFA 3NQFA 1H7PA 1R46A 5DBTA 3UY7A 3W7QA 4GFSA 4AB4A 4Z1DA 3STCA 1LP6A 4NJKA 3P8JA 4QAIA 2BXVA 3E96A 1QFEA 1CX9A 3W3OA 2GPTA 2DJXA 3UWUA 3W1RA 3Q2DA 3QM3A 3ZFHA 1TTJA 3QH2A 3JR2A 5C6MA 3BG3A 1HUVA 4IMGA 3THQA 5FEXA 3W73A 1B4EA 4MLRA 1J4EA 1Z48A 1GVOA 3DKJA 4TIMA 5K9CA 4JY9A 3WJSA 5LHEA 2GQ9A 1KFJA 2QDGA 2CLIA 2NX3A 1LDCA 2FLIA 3LV6A 1VLWA 5C2XA 1PL9A 4NJIA 2NUWA 4JTUA 3PUDA 3CEUA 5L6UA 1OX6A 4RK8A 3S5NA 1ZENA 4MPQA 1Q6OA 4LS0A 5AYZA 3T7VA 4QM1A 3PM6A 3EWUA 2ALDA 2JKEA 2I14A 1G4TA 1Y0EA 3LERA 3G1FA 4JXCA 2GVJA 3L0GA 3AO0A 4LT9A 3STEA 3HJZA 2Z0IA 1DJNA 3RFAA 1XFBA 3NQ7A 1NEYA 5I3IA 1OHLA 2ZZ7A 1GG0A 3EXSA 1DKWA 1YXYA 3B06A 2A85A 2DZPA 4ALDA 1SW0A 4OWGA 4NVTA 1MEIA 1UB3A 3GXPA 2FPYA 2TSYA 1XDLA 4FNTA 5DN1A 4OBTA 5G5IA 1V5XA 1H1YA 5AHFA 1D3HA 4HPJA 3LHUA 3W22A 4BI7A 3SJ3A 1AMKA 3NO5A 2CLOA 2XN0A 3CWOX 2C3ZA 1GTEA 2X30A 3W75A 3W1PA 3TXVA 3LV5A 4JN6A 2R14A 3DKLA 3T55A 4UTLA 3DH7A 3CWNA 4LS2A 3HQ1A 4YLWA 1LOQA 3P67A 3PBUA 1KLYA 1ICSA 3S1XA 3QMRA 1BTMA 3QEZA 4FNQA 4Z0SA 3L5MA 1YXDA 3RU6A 5AHIA 5EPDA 2CLKA 4POCA 4P2VA 2ZZ2A 4GUGA 5D38A 4ML9A 1SW7A 4UFHA 4NX5A 3SY5A 3M1ZA 3W83A 4MIMA 2WSQA 4QITA 3TW6A 5CPOA 4LUIA 3TAOA 5I3KA 5C54A 4N6EA 4DO6A 3W76A 1J2WA 3W1XA 1C9DA 1QAPA 3FEMA 2ZBTA 4N6FA 1GWJA 4FIRA 4BR1A 1VYPX 3LRLA 4N9DA 2VFEA 4YXGA 1DV7A 1YYAA 2QCFA 5KSWA 1H7WA 3LHTA 3H53A 5FEZA 2V5BA 3A9IA 3C2OA 1I2PA 3CEPA 2G97A 1EA0A 1Q6RA 1FX6A 3BLIA 3P74A 3P82A 2VFFA 3IGUA 4GUHA 5H2ZA 3LB0A 3TXZA 3LXCA 4BI5A 4O4WA 3EWBX 1SO4A 3MYOA 1LM1A 1GYLA 4R53A 3PSVA 4O1BA 3UPBA 5G2HA 1T99A 1ZAJA 5HJLA 3ZS4A 1UBSA 3R2GA 1QPNA 2E5CA 1NVMA 4HSNA 2EF9A 5HMSA 1SSGA 3R13A 1OG0A 4GC4A 5D33A 1M5WA 1VQTA 3UZ5A 3VKJA 5LKYA 1SFLA 1K7FA 3Q58A 1OF6A 3LTPA 4IXXA 2B0MA 2QCHA 2BX7A 4WOZA 1RR2A 5F4XA 4M5PA 3GDRA 1ML1A 4O11A 1LBFA 1K03A 1N55A 3S8HA 4GXMA 3C3NA 3OG3A 2NXIA 3EWZA 3E49A 3NPWA 4O13A 3M16A 3N73A 3HGSA 3O8AA 5HR7A 1TPVA 4K6AA 1W5PA 4HIBA 3L66A 3BG9A 1G69A 3DXIA 1UASA 3DHDA 1NSJA 1IF2A 4JTFA 5F2IA 1E51A 1GT8A 1BEUA 1TTIA 5CPNA 2W6RA 4TR9A 3F03K 1EP2A 1W54A 3W23A 1EX5A 2ZRWA 3STGA 2TMDA 4CCDA 1I2QA 1H5YA 1TPEA 4J9JA 1FBAA 1JUBA 5K4XA 1VYRA 1XUZA 1KBIA 4ADTA 2QEZA 1TRDA 2FJKA 1EEPA 1PS9A 4PA8A 4DBDA 3C0JA 2F84A 2C6QA 3W1QA 3NL2A 1J5TA 3R89A 3PY2A 4LVAA 3STFA 2B7NA 3UQNA 5BMXA 2V2HA 4LVBA 3RLUA 1WOAA 1ZAHA 4M6VA 1JUEA 1OF8A 2Y6ZA 3UWZA 3CT7A 3FYPA 3M5XA 3C61A 1RV8A 4UCGA 3A21A 3TSBA 3W2UA 7TIMA 2ATMA 3EX4A 4EF8A 1EP3A 5DCDA 1F6PA 3PUEA 1SO3A 4MYXA 3TK7A 4RR4A 1DBTA 3NQ2A 2AAMA 2DZWA 3CTLA 2QCMA 4NJGA 4UMAA 1GTHA 3TU9A 5KZEA 4MJMA 4NQ1A 1KA9F 2EHHA 2GOUA 4AF0B 2A21A 1QO5A 2A7PA 3BV4A 1XL9A 3NQDA 4UTIA 1EP1A 3P81A 2OCZA 4MYAA 2I1OA 4AWUA 2OX1A 3PR2A 1I2NA 1X1ZA 2WOQA 4M6PA 3TW7A 4AWSA 3LCHA 3QSTA 4HT3A 2J24A 2DZTA 4PTNA 4O16A 2ZA1A 2O7QA 5CSSA 1L6YA 1TPH1 1H7NA 3UXAA 3MI3A 1TTQA 3QW3A 5LHFA 1S3HA 4TO8A 3N34A 1WQ5A 4XTIA 1R2TA 3RNDA 3W07A 5U4NA 4LUJA 5AC7A 1OJXA 1QR7A 2YZRA 1VH7A 3DAQA 4UMBA 4YWIA 2OT1A 3GX9A 2A1YA 1OFOA 3BLFA 3U8GA 1BKSA 1O60A 3O07A 4EWND 5D32A 2Q3OA 4UUIA 3CM4A 1IXNA 4ADUA 2NXGA 3MBDA 1A5CA 4K8HA 3RK8A 3NEVA 3NL5A 3GIYA 2PC4A 1DOSA 3GK0A 1W5QA 3G0UA 4UNKA 3W7HA 2VEMA 3LRKA 5LNWA 5EBUA 3GDLA 3TC7A 1B9BA 5AYXA 2QUVA 3BARA 3O05A 3VFLA 1VR6A 2NV1A 4XKYA 1GJPA 2E09A 2RFGA 3G18A 1WAUA 5K9DA 4DO4A 1QMLA 1ZHAA 3IGSA 3B8DA 3IVSA 1TPB1 1K02A 1U83A 2XN1A 4UNLA 3GKFA 1RZMA 4BI6A 3W7DA 1ZALA 2NZLA 2CU0A 4WD0A 1SUXA 3LHWA 3IVTA 4LNYA 3W1MA 3FJLA 3BG5A 3FOKA 1P4CA 5CPLA 3TKFA 1UUOA 4HKPA 3F4WA 4X2RA 2C13A 3KOFA 3LCXA 4AVFA 2ZA2A 1HG3A 5D09A 1VYSX 1OFDA 3KX6A 5HWNA 1VHNA 1W5MA 1H60A 3C8FA 3VNDA 3HG4A 4MY9A 2ISWA 5KTLA 3UYCA 3FFSA 2Q8LA 6TIMA 1A5SA 3G24A 1GEQA 5CZSA 4RCXA 3SZ8A 5K7JA 4WOQA 1ICPA 5D2WA 4K7YA 3QSRA 1QCWA 1ZY9A 4UFKA 1JRCA 1A5BA 4PFMA 5DY2A 1VRDA 3LLDA 3UD6A 3P5YA 2YFOA 2ZTKA 2R94A 2PRMA 1TJPA 1TV5A 2YSWA 3IIOA 3W2NA 1S5WA 1W3TA 3L0KA 3NPUA 3UWYA 1O5KA 4R34A 1Z42A 1K7XA 3WJYA 2C15A 3JRKA 3NPVA 5LNUA 2QDHA 4EIVA 3N19B 4LV4A 3OVQA 1VLIA 4NXSA 4RXGA 3L5LA 4JX5A 5DXYA 3NQEA 3BGGA 3BLEA 5HWMA 2V2CA 2DU2A 1AG1O 2PE4A 3W7IA 4O1CA 1LRTA 2QUTA 1JVNA 2Z6JA 5SWUA 3R12A 5FESA 4X3ZA 4QQ3A 2VFGA 1P0KA 1QPQA 3G1YA 1LROA 4UTMA 2QCGA 2H3BA 2Z2UA 2A7NA 2E5BA 4O8RA 3TH6A 5LGXA 4IMEA 2PRLA 4XKYB 1TJRA 3QPZA 1AL7A 1FCQA 2ABBA 2Y7EA 3W7OA 3NL6A 3KVMA 3NG3A 2V5LA 3M6YA 4N4QA 1PVNA 4AXKA 4FF7A 1LBMA 3TIMA 3SGUA 4AMAA 2ISSA 2TPSA 5A5WA 4IXHA 4CNPA 2J6XA 3PF3A 4ZMGA 1HTIA 4HPXA 2B7PA 3W70A 1HL2A 4O0ZA 5D2YA 3PWAA 2VELA 1W3NA 1I2RA 2EGZA 4LS1A 3W7EA 4O18A 1I45A 1QNVA 1XM3A 1R2RA 4O52A 5HULA 1MEWA 1FWRA 3NAVA 3USBA 5LNRA 3TFCA 2HSAA 4O57A 2H3DA 1GVFA 1XUUA 2HS8A 4E38A 2DZUA 4NZJA 1VC4A 3IGXA 5DY3A 1KM4A 1MXSA 4O10A 4ZQMA 3U6WA 5E93A 1MEHA 1TQXA 4GNJA 4RZ6A 1DQXA 1TPC1 3W7JA 4WJEA 3DGRA 1OFBA 1ALDA 3W2MA 4I7WA 1R2SA 3FKKA 3LGEA 3M43A 4EVZA 5EA9A 5EL1A 1EIXA 3M5YA 3NQMA 1KW1A 3QJAA 3FLUA 3GDKA 1XCFA 3VI2A 3B03A 4IQLA 1XBVA 1ME7A 3W7RA 3HG2A 1OX4A 1PV8A 1OVDA 4A29A 1VCFA 3BO9A 3GAKA 1LRNA 3A24A 3I6RA 3HF3A 1BWKA 3T4CA 3HGOA 1FCBA 3PS7A 1X6UA 1G7VA 2QJIA 3HBLA 4JNMA 3DFSA 2C16A 2X1UA 3LLFA 1W31A 2E6FA 3L5AA 3LI1A 3W85A 3S42A 2YW4A 5F2GA 3TDFA 1ONRA 4H3DA 1KFKA 3G1SA 3I68A 4PCFA 2WNQA 4CQ9A 4DF1A 1KFCA 3EX2A 2NLIA 1VJIA 5EMUA 4FXRA 3HPSA 1S5TA 3G1AA 4Q33A 1WOBA 4JTGA 4N02A 3I65A 3RF9A 4XBSA 1SSDA 2VEIA 2PRHA 1PHQA 5H91A 3S1UA 4KWWA 2AQWA 3W7LA 2ZRUA 2Q3RA 4MUZA 3W74A 1TO3A 5K2ZA 4K36A 2C19A 1HFBA 1K8XA 4YMZA 1M6JA 4MFDA 1RQHA 3ATZA 3N3MA 5IBXC 2JK2A 2NUYA 2WNZA 2J27A 3BW3A 3GXTA 2P1FA 2ZRXA 3S1VA 4CLMA 3DI1A 2GVLA 2BWGA 4KKXA 1I8JA 3ABOA 2B7OA 3DFPA 4FX7A 1C8VA 4UIOA 4N9CA 5KZDA 3BGJA 3KVJA 3PB0A 2QCDA 3MJYA 3M7WA 4C1KA 4GUJA 4JICA 2WKJA 1IIGA 3NQCA 5TIMA 1W3IA 2Y7GA 1DJQA 4JIQA 2X1RA 4NJHA 3IIPA 4AHPA 4O28A 1R47A 4X9SA 4WX2A 3LTSA 2TRSA 1JCNA 3UPWA 5AFDA 4UFJA 1GPWA 1ME9A 4O14A 5LGZA 4BWLC 4LU0A 2X16A 3C2EA 5I3JA 5D2TA 2ZRVA 3LCFA 4XQ6A 3KVKA 3VE7A 3G1XA 2E77A 4MOZA 3WJZA 3F1QA 5GVJA 4K39A 2G96A 3O16A 2A6NA 3I7SA 3M0ZA 3G1DA 3CIWA 4NUWA 2ZYFA 2Y61A 5J5DA 2J88A 4IUOA 3LCGA 4IMFA 2YW3A 1ZJIA 4RZ4A 4UTWA 5D2VA 5KMYA 1KTBA 5F2LA 2NX9A 5F4WA 4ZQNA 3MO7A 1FDZA 2CFFA 4UMCA 5C55A 1MZHA 1O4UA 3HO8A 2ZTJA 3FA5A 4GUIA 4H4IA 1VS1A 4I9AA 3W1LA 4JEQA 3QF0A 5D04C 4DPQA 4FNUA 4JYFA 3MHGA 4FNSA 3ABSA 4QNEA 3A5VA 3HB9A 3MP5A 3IIZA 1NFBA 3GAYA 3ZR4A 4O1AA 4N4PA 2CLFA 2WQPA 3GDTA 5LSMA 1FWSA 3OBKA 3FYOA 4UTTA 3N9SA 4LC8A 1S5VA 1W1ZA 3LHVA 1AK5A 1YTEA 4DPPA 3NVTA 4BWLA 4FIQA 3KAOA 1OFRA 4HNUA 3BPWA 3UWQA 2EAWA 1LRQA 1FUYA 4ZQOA 4NU7A 4WY0A 1SO6A 1AW1A 1MSSA 4CNOA 4UXDA 2Z6IA 4LV9A 4JX6A 2VC6A 2YXGA 3NQ8A 1OFAA 3EXTA 3G3MA 2Y89A 3LBCA 3B04A 5EY5A 5FI8A 2PCQA 1KFLA 3D0CA 3M41A 4YL2A 3LOTA 4JY8A 1OFQA 4Z1BA 1W5OA 1LYXA 1QDSA 3FJ6A 4YCPA 4A21A 1Q3NA 3ZWTA 4IX0A 2Q8ZA 1TMHA 1O5XA 1G4SA 2HTMA 1KFEA 3LDVA 4PL1A 2FB2A 1W8SA 4BF9A 2NWSA 1PIIA 4K38A 1A53A 2NV2A 1GVRA 4QISA 3UY8A 4TU1A 4AF0A 2H90A 4N9BA 3GZ3A 1JRBA 2OZ0A 3WK0A 4B5NA 3V1PA 1OK6A 3MW7A 3EWWA 2VFIA 3W2JA 2ZDRA 4E2BA 4RZ5A 4Y8FA 2J9XA 3PC0A 2J9ZA 4JTJA 1WDWA 4Q4KA 1KLZA 1TTPA 1YADA 3N2XA 3QQ0A 2ZA3A 4DBEA 4NXKA 4JTKA 1SQ7A 1JQXA 5FF2A 4UTJA 3EB2A 4M19A 1YDOA 1TPWA 4MVAA 3O6CA 2QCEA 1JCYA 3L2IA 5I3FA 3W1UA 5HUPA 3M47A 3C2VA 1BWLA 3NL3A 5AN7A 2BTMA 3NGJA 1IXPA 3MMTA 3CHVA 2DP3A 1QOQA 1W0MA 4Z1CA 1TPUA 3L65A 2GJNA 1GQNA 4OQVA 2ZZ5A 4DEFA 2C14A 4RXFA 1O95A 2WO5A 2ZFAA 3PUOA 1L6WA 3TMLA 2CLHA 1SZGA 4FX6M 4XTDA 3IV3A 4TX9A 2RDTA 5TBOA 3QQ1A 1TREA 1KM1A 1F05A 5F1VA 3UXDA 3KRUA 2P0OA 3LBMA 3C2RA 4JTHA 1GVQA 1NF7A 3DFOA 4HNTA 3ABRA 2X2GA 4CNNA 2J9YA 1FY6A 1X8FA 4JGDA 3TUUA 4WXZA 1OK4A 3M9YA 4EF9A 1VPXA 3LXAA 3NXFA 1SU5A 4Y6GA 1D3GA 4ONVA 4IX2A 5J5RA 5CSRA 3HIJA 4Z1AA 2R91A 3B0VC 4H6KA 2CW6A 5LNSA 1T0OA 1PHWA 2CZEA 4U28A 2X1TA 4HHPA 4YCOA 5BW6A 1SZEA 3ZWSA 4IMDA 2WSRA 3TNOA 3O06A 1TSIA 3THAA 2CZFA 3SSJA 3GR7A 3BK0A 3TV8A 4HNVA 3AJXA 3WJXA 3B05A 1A50A 4NJJA 3NR0A 1NF0A 4WY0B 3W7GA 3HGJA 3W72A 1DQWA 3E9AA 2YYUA 5I3GA 2OJPA 4UTUA 3W7MA 1ZNNA 1M7OA 3GR8A 3INPA 1C29A 2BSLA 3P60A 4FEZA 2DZXA 4ORIA 3QYQA 4MKNA 3SW6A 4OGZA 2A7RA 2CLEA 4ICNA 4R33A 1XI3A 2G5WA 1KM2A 1YPIA 1H7RA 3V75A 3NZRA 1G4PA 4JDBA 3WK2A 1VZWA 5AYYA 5KZMA 4S1FA 1GOXA 1F74A 2JKPA 1JQVA 2QCLA 3E02A 1TCDA 3NM3A 4Y9AA 3TQ0A 4DF2A 1RPXA 5F4SA 1FWNA 2CLMA 1EWDA 3P8IA 1OYCA 4Y90A 5HUOA 1WXJA 1WYIA 1SFJA 1EWEA 4WY0F 1KTCA 2QCCA 4JIPA 3NA8A 3GVGA 3TMQA 5ABTA 1XBXA 3TAKA 2V81A 5EKYA
chains in the Genus database with same CATH superfamily
2QLYA 4HA3A 5AVNA 3SUWA 2X0SA 4MY8A 4HJFA 5HINA 3CPGA 2R1LA 3K1GA 1H7OA 1M7PA 3MI6A 3CLMA 2X1SA 5CC7A 3W1AA 2VXNA 2P3EA 4JDYA 4PEKA 4XSMA 4A2SA 1W9DM 3EMQA 1F76A 3N6QA 3EEZA 3GG8A 4XK2A 2DORA 3L4XA 5D9PA 3NDOA 2C79A 3T09A 4IUGA 2Z24A 2GJLA 3SCNA 3AC0A 4AD4A 1PCKA 1I2OA 2OZ8A 2QCNA 3NPXA 4YU1A 1F73A 2YL9A 2C18A 3APYA 1CB2A 2HPIA 4OT7A 3AOFA 3GTHA 4QHRA 2BGNE 5AB3A 1CECA 1VCGA 2QAFA 4DBUA 4NX0A 3U2OA 1CXEA 3WX7A 3LCLA 2HISA 4F9DA 1WE5A 2RUSA 3TZFA 1F3TA 1A3HA 3ES8A 1PWMA 3GS6A 1K1DA 5HNNA 4P7OA 4UTHA 3UJEA 4JD4A 1XXXA 1CXKA 3FKRA 4C1LA 3PHAA 1A5AA 5H6HA 1XX1A 4B5UA 4PE8A 4CEUC 1TVLA 5IFPA 2GOKA 2VGFA 1T96A 4MB3A 3FDGA 2ACRA 1GZJA 1VJZA 1P43A 4PCNA 1JCXA 4BFAA 4ZO6A 1Z69A 1ISZA 1DPMA 3NYZA 2H8XA 1ZS2A 4AD5A 5CPMA 1WDQA 4RKAA 4H01A 4NYUA 1O1ZA 2YDQA 3KOXA 3O15A 5KETA 4KIEA 1S2UA 3C56A 4H8HA 2Y88A 3CAQA 4F0KA 4FXSA 5FIPA 4AEEA 2HNHA 4JTTA 5BCAA 4YWSA 4CN6A 2YX0A 4PB5A 2GUUA 1JCLA 5CG0A 1FWTA 5I0DA 3SQMA 3FVDA 1S1RA 3NQGA 3IUHA 3EDKA 4Y7EA 2QJGA 4S3DA 1POKA 2ISDA 4EKJA 2ZIDA 1FCUA 4AWEA 3K8LA 2CHOA 4DO7A 4DQWA 2W0UA 3V7PA 3TZNA 1E43A 4YHGA 4HZ8A 2W67A 3AXMA 3UBPC 4HSOA 1IV8A 1U22A 4JPGA 3CB8A 5I7GA 3A5FA 3UVAA 4MNMA 5G1TA 2E1WA 4QP0A 3VKDA 3QFEA 1TV7A 4LVGA 3N1AA 4NHVA 3G0SA 1P6BA 3ISIX 1EHAA 3JZEA 3AI0A 3TYAA 4Z2LA 2NT1A 3MDUA 2W79A 3R4IA 1IIHA 1PKLA 3VAVA 5HWJA 3REQB 1Z89A 4C6OA 4HU3A 3MBFA 4L4OA 4W7WA 3SFKA 2EG7A 1B30A 4PULA 4K8EA 5FJRA 4PN2A 2Y62A 4EXAA 4XX6A 1I4NA 4QNWA 3R6IA 2XFYA 3CHEA 1TIMA 2RJHA 2DT3A 4LPCA 5LXEA 5C9RA 3CUGA 3YPIA 3H12A 1US3A 2E28A 2OEKA 1E56A 1QNQA 2VKZG 1PTDA 3UJRA 3BMWA 1EJWC 9CGTA 4AZ7A 3L0NA 1XIHA 3L4YA 3GVQA 4RDYA 4EXQA 3PBYA 3C0SA 1CWYA 1ITQA 1V08A 4XAPA 4RX0A 3FYYA 4LOCA 3NOEA 1EJ7L 3ZMRA 1QW8A 4DWSB 3W4RA 5FSEC 3ZT7A 2WCGA 2BGQA 5FF4A 3QQWA 3MV11 2DEPA 1FVPA 5BYWA 2CZDA 4DLMA 2XIIA 3C2FA 1J2BA 2ZE0A 3EBVA 2HXTA 4OE7A 3ERPA 3W87A 2IKGA 3B9DA 4D1IA 5M1TA 3T42A 1VKFA 2OLHA 3IRDA 3A47A 4GYPA 4ZTYA 2FPTA 3CUXA 4ZOAA 3UGVA 4Y96A 1XDMA 3VIJA 1CDGA 2QHAA 3DGBA 2BLEA 4ERIA 1JZ6A 3IANA 5HNUA 1AH0A 3AXIA 4HNOA 2FFCA 4HSHA 4YVXA 2VX7A 1NIUA 2HS6A 3I3BA 4B91A 2V6AA 1EB3A 1WBHA 1TPDA 3BICA 3GKAA 1VFOA 2Y7FA 3NXLA 3WH8A 1FWIC 4C5ZA 4D6HA 2VZOA 1U1HA 4V28A 1UR2A 1FCVA 3A13A 3WLTA 1YNPA 3A4WA 3VD3A 4E0CA 4GK8A 5BOEA 2F38A 4EANA 2VD9A 3SCRA 1AD4A 3BOFA 5DELA 4W5ZA 5C9WA 2HE8A 1OZQA 4TMCA 3W82A 1DJGA 1FWWA 4L4MA 3GXNA 3KZPA 3SM0A 1FDYA 3MSGA 3CBWA 3O6YX 3TSMA 1EGMA 4K7VA 4AHOA 1KV5A 2D22A 4WJXA 5CZJA 3B4UA 2XM2A 3NOYA 4HU8A 4A05A 1HJVA 5D03A 3R25A 4MJ4A 3CQ0A 2CBUA 1T8XA 2QDEA 3PBMA 2V82A 2PU1A 3E2SA 5EFFA 4Y8EA 1TJ1A 4W84A 2RHGA 4DXVA 1VD6A 2WC4A 3V3WA 2V2DA 3SECA 4V1XA 1YTDA 1V6WA 2HXUA 3KUMA 3UPMA 2ODOA 4GCXA 3K8KA 2W27A 1XWYA 2G95A 2HE5A 4L9XA 8A3HA 1GZGA 3G0XA 2CC0A 1IZCA 3VDGA 4MF4A 2PURA 3M0LA 1UZDA 3S2MA 2BZNA 2CZVA 2FIQA 5LIUX 2Z1VA 3UZZA 2ABAA 3NNTA 2JF7A 4PMVA 4HYRA 1U5HA 3A9BA 2NXHA 1DWHM 1ZFJA 4GQ0A 3W86A 4ZO8A 1BGAA 1KO0A 1YKWA 4I8YA 3TN3A 1V0LA 2DZSA 1H0GA 2YCJA 3UGRA 2E6DA 2GVEA 1MYRA 3DFQA 3S6DA 4L1XA 4CVUA 1L2QA 3TFXA 1B1YA 1R85A 1DHPA 1S3TC 3AHZA 4ORMA 5HMEA 3VGEA 2VRJA 4PMRA 2OEJA 4QE4A 4EACA 4JZ5A 3AXKA 1JCJA 2NUXA 1V0KA 3W2LA 4P61A 4RJEA 4IGSA 2PLMA 2HPMA 3QZEA 4IIBA 3TC3A 3C4UA 3SRFA 3UZXA 3HQOA 4DJFA 4ZVJA 3MUZ1 1YW1A 4EK7A 2HMCA 1YQ2A 2P8BA 3FAXA 2J7HA 5DMYA 3FA4A 3IVUA 1F2JA 1H61A 2Z1BA 1J6OA 2A3CA 3RPTA 3W71A 3L2MA 4LRSA 5E09A 5A8OA 3M0XA 3VKCA 4QG6A 1Z3NA 3V5CA 1KBJA 3P5ZA 3DHUA 1DHKA 3CJPA 2OSYA 4G9PA 4PH6A 2WHKA 3WKZA 3V4BA 4AHQA 4JTAA 4D6CA 1SW3A 2OOFA 4ZENA 3Q67A 5HA7A 2MNRA 4WKAA 5E1QA 3NJ3A 3QXBA 4XZNX 2ZXAA 4QDPA 2EPHA 3HPXA 2NVDA 2V30A 4DZAA 4AZ6A 2DH3A 3QGVA 3KBMA 1U5JA 3OA5A 3BSMA 3APGA 4J3TA 1R9YA 1MDLA 2FVLA 1UQZA 2YL6A 3HG3A 5EMLA 1J0JA 4Q4QA 1CW2A 1BAGA 1CLKA 1HGYA 3B0XA 3TJXA 3MP4A 3UXLA 1FXPA 2FDSA 2OQLA 1H7XA 1UP3A 2HK0A 2E8YA 3KCJA 1EFZA 2WVVA 3HPZA 2WMGA 1N2VA 4K1GA 4G7FA 4NYYA 4Q8QA 3IK4A 3N3TA 4NIRA 5K3VA 1D7KA 3GXIA 3NM1A 1HO1A 2WV8A 4EOUA 5B80A 3MC5A 3BWWA 3GLCA 1FRBA 4XUGA 3ELFA 1PX4A 4IICA 5G2IA 1ECEA 2NT0A 3KBVA 3F2CA 3LPPA 5EMJA 3BAXA 4GRSA 5JMUA 1KM3A 3EKGA 1GVIA 3GG0A 2YDAA 5E0FA 4XAZA 3M0IA 4PTWA 3NQFA 4K1WA 3UY7A 3W7QA 3AHXA 1UWIA 2J7DA 4GFSA 1V6VA 1GW1A 4Z1DA 4QCEA 3STCA 5JXQA 4NJKA 1PYFA 3P8JA 1HJUA 3W3OA 3TLLA 3QOMA 3W1RA 1CLVA 1LG2A 1X38A 2OKOA 3BG3A 1HUVA 2PA6A 1KBLA 2VCCA 3ZJKA 3MUIA 1RHCA 2W62A 2WJEA 1B4EA 4E4PA 5CZKA 5FAGA 1GVOA 1P1MA 5LHEA 2GQ9A 1KFJA 1XPGA 2NX3A 2VGBA 3LV6A 1QNSA 1VLWA 2NSOA 2DIEA 1KB3A 1OX6A 2OR2A 1Q6OA 5AYZA 3GQYA 1KBKA 2W3ZA 1UROA 3HA1A 5TF0A 3WNKA 3RLHA 4YHEA 4JXCA 4MJ2A 4LT9A 2Z0IA 5HBFA 3RFAA 1UH4A 2QPXA 1XFBA 3N17A 5I3IA 1OHLA 1HL9A 3VCCA 1LL4A 1MDRA 3OZYA 2ZZ7A 4N0RA 3GXFA 7CGTA 3ITTA 1SW0A 1MEIA 1BYAA 3DDMA 3T2PA 2EO7A 4HGXA 5AHFA 2GSEA 4HPJA 3VUPA 1V7AA 2C3ZA 5GJNA 4Q8PA 4FK9A 3W75A 2R14A 4GO9A 3CV2A 2HWGA 2FHFA 4EXBA 4HU0A 1E0TA 1YMYA 3HQ1A 4HA4A 1E0VA 1LOQA 3P67A 1KLYA 3QMRA 2QV5A 2RJGA 2BMBA 1FOBA 3K1DA 1YXDA 3ZT6A 1UD6A 3BAYA 2ZZ2A 4M0XA 1SW7A 4F4RA 2QPSA 1EZ2A 1HP5A 3W83A 1E9ZB 4MIMA 2DUXA 3R0UA 3VZXA 1EJSC 4INFA 1ELSA 3UU0A 3QLDA 1J2WA 4AQLA 1SMAA 2WJFA 1P0EA 1PTGA 1VYPX 4WVXA 4TXEA 2VFEA 3D6NA 4ZCWA 2YL5A 2DVUA 4YXGA 1DV7A 3CMJA 1H0IA 1WCGA 3OIHA 2WKLA 5FEZA 2V5BA 3CS2A 3VXGA 4F66A 4BCEA 1EA0A 2IPWA 1Q6RA 1FX6A 3BLIA 2F6XA 2E0PA 1TVNA 2AMGA 3P82A 4TQTA 1ODZA 3IGUA 1BSLA 3LS9A 1PBGA 3LXCA 1OIMA 4BI5A 4O4WA 3FHAA 4J3SA 1GYLA 1UC4A 3PSVA 3UPBA 5G2HA 2REQB 2XIBA 1ZAJA 3WN6A 3U4FA 1RALA 1TR9A 3ZS4A 4OOZA 3Q45A 5RUBA 2INFA 4GJIA 1SSGA 4HOZA 1MWOA 3OO2A 3QTGA 1OG0A 2VO5A 2SFPA 4DBWA 3QOKA 3VKJA 2D2JA 5I78A 1J96A 3Q58A 1OF6A 1R3VA 1V6TA 1ZBWA 2BDQA 4WOZA 4R7WA 4U2ZA 4O1EA 3ARYA 4GXMA 2CXGA 3OG3A 4KS0A 3GFZA 1UA3A 3NPWA 3AFBA 3M16A 3N73A 1EL3A 1M7XA 3HGSA 1VEPA 1XLBA 4PR4A 3D46A 3TCSA 3L66A 1OM0A 3BG9A 3EB4A 2HVOA 4FLOA 5F2IA 4DI8A 1TTIA 5CPNA 4KIRA 3M0YA 3F03K 3HV9A 3STGA 3ARZA 3MWCA 1MFUA 5K4XA 1VYRA 2GWGA 1EEPA 1PS9A 3WBEA 4B5VA 2C6QA 4E6MA 3NL2A 4JCLA 1FFQA 5I3DA 1JNEA 1HJXA 3STFA 5MKGA 3UQNA 5BMXA 1UP0A 2V2HA 4ASTA 3ARWA 1WOAA 4GINA 4P7QA 4L1WA 4RDZA 1H2JA 2Y6ZA 4CVWA 3M5XA 5FCZA 3B8WA 4EPDC 3NQBA 4PSRA 4WDXA 3RX2A 3EX4A 4EF8A 1EP3A 3PUEA 3IPWA 2NV9A 4RR4A 4GPNA 4GZJA 1C92A 1S2CA 2ZUNA 3B9EA 1KCKA 3WG6A 3OP2A 3CTLA 4NJGA 1VFSA 5EMMA 4UQAA 4KF1A 2VX6A 3TU9A 2OLSA 3O9NA 2DW7A 1QO5A 4HTBA 4LNCA 4UTIA 3A3HA 3ZSTA 3P81A 4Y9PA 2PBOA 4MYAA 4AWUA 5A6JA 4H6RA 4M6PA 4GQBA 3TW7A 4AWSA 3WDJA 4PMDA 3TTSA 4HT3A 5HJYA 1GW9A 2BNJA 4O16A 1XHGA 2E8ZA 1L6YA 2J25A 2UY5A 4M80A 3VOIA 3UXAA 1TMQA 2YCKX 1FP8A 3F2DA 1TTQA 2G3MA 5CXPA 5CLTA 1WQ5A 3WLLA 3CV1A 4XTIA 2BVTA 3MVTA 3LG3A 1C3FA 3OODA 4LUJA 5AC7A 3K13A 3AXXA 1QR7A 2YZRA 2OO6A 3K2GA 4UMBA 2OT1A 2PP3A 3GX9A 1OQFA 1OFOA 3SN1A 3SUSA 2VCBA 3LQGA 1CYGA 1O60A 2HZGA 2VR5A 4UUIA 3F4CA 3BOLA 2XTKA 1J6PA 3GIYA 2OWWA 4F48A 3GK0A 3AMCA 1W5QA 4UNKA 3AHYA 3LRKA 1XCWA 2UY3A 1VFLA 1E40A 4ZOBA 2D3LA 1MUCA 1VR6A 4KWSA 1GJPA 2E09A 2D0HA 5K9DA 4GVIA 3E74A 3IVSA 1Q5MA 3GZAA 3VC5A 5C2CA 3A6OA 4LCRA 4BI6A 3W7DA 1ZALA 1W1A1 2CU0A 1QK2A 3LHWA 3MS8A 4AD1A 3LM3A 4GI6A 5MF5A 1QUMA 1UUOA 3MUCA 3AS1A 2C13A 3LCXA 4AVFA 2ZA2A 1BWVA 5GNXA 1VHNA 1W5MA 1H60A 3OYXA 4KERA 4AZ5A 2ISWA 3UYCA 4GD0A 1A5SA 2WMIB 3PZOA 4RCXA 1R3SA 4X0NA 5XINA 3TQPA 3N2BA 2CPUA 4NILA 2TAAA 3NSMA 1OCJA 3UD6A 1RPKA 4CN1A 1A5OC 3VZZA 3CYVA 4NL1A 2PRMA 1TJPA 1TV5A 2YSWA 3PWIA 4RZBA 1S5WA 3UWYA 4YTTA 3WJYA 2C15A 3AHVA 4PUJA 5LNUA 2PS2A 1EXPA 3KTXA 4KQNA 2R9RA 2QDHA 2XVLA 3N19B 3WDPP 3QGKC 4J40A 1ZCCA 3CO4A 1XLFA 4H41A 1BVZA 2Y8UA 4JX5A 4G2DA 2GSJA 3WUGA 1REQB 3V36A 4RL3A 3W7IA 1OD0A 2UWFA 2AAAA 2YBUA 1GHSA 2WZMA 2VFGA 1GQLA 1WKDA 2QCGA 4LYPA 2E5BA 3SEPA 4IMEA 2PRLA 1TJRA 1W1PA 3QPZA 1AL7A 2Y7EA 3B3DA 3TYUA 3NL6A 3KVMA 3ZZ1A 1W6TA 4TX8A 3WCZA 3M6YA 4OTKA 3U48A 1KC7A 1LBMA 3WLQA 2ZOXA 2TPSA 4FSAA 2J6XA 3CLWA 1EJUC 4J2PA 3FJNA 1F4AA 4RNJA 4J3VA 3SRDA 1R2RA 4O52A 1MEWA 3NAVA 1VFHA 2GFTA 1VC4A 4O10A 1UIOA 4UWMA 4Q4MA 2GDVA 1YNYA 1TPC1 4EAYA 1EJVC 5MKGB 4GIEA 4RPPA 5FJOA 3LGEA 2J66A 5A6AA 3VGHA 1KW1A 3B03A 4IQLA 1XBVA 3B8SA 1OX4A 3V5FA 3BO9A 1JL8A 4RV3A 3A24A 2OU4A 4L4PA 3D5HA 3T4CA 4B2DD 3NUKA 3RO6A 1IEVA 4JNMA 4MNLA 1S2VA 4JTRA 1OC5A 3MMWA 4MNJA 1NJJA 1UJQA 4IP4A 2HVNA 4CQ9A 1KFCA 3TYZA 1VJIA 4AEFA 4FXRA 3D3AA 5I24A 4JTGA 4N02A 1ADSA 3I65A 1B0IA 3RF9A 3IJ6A 2F8QA 3N2CA 4Q8NA 4KRTA 4WRHA 1PHQA 2G3FA 3MUY1 5K2ZA 2YLAA 1HFBA 4YMZA 3WBXA 2J74A 2WNZA 2YCIX 3BGAA 4GNKB 3BW3A 2PLJA 2P1FA 3H21A 2ZRXA 4H2HA 3H2NA 1V03A 3KL5A 2PP1A 1WAWA 3OGVA 3ABOA 3OU8A 4P8VA 3ALFA 1GOOA 4UIOA 1Y5WA 1RY0A 2IKIA 3WLJA 5KZDA 3BGJA 3UA4A 4GUJA 4JICA 1IIGA 1A5KC 5CQ1A 4JIQA 3RLGA 2X1RA 4O28A 3E2QA 1CGTA 5AYBA 2TRSA 4S23A 5AFDA 1RH9A 2GVYA 3GIPA 4UFJA 3BDKA 3OHMB 5G1MA 4C91A 2R24A 5M17A 1IZJA 4KGJA 1DXFA 5I2UA 5I3JA 2X16A 3C2EA 2B31A 4CNSA 3PK7A 4GO8A 4JHMA 1BYDA 3G1XA 1SZRA 2G96A 2A6NA 3WUBA 3NWRA 4J3XA 4GVFA 3WNLA 2JE8A 1JD9A 4JOMA 4MTVA 3UYIA 2ZYFA 4ZXLA 4B90A 4MWAC 5J5DA 2J88A 1XP3A 3LCGA 1UA7A 5F4WA 4ZQNA 1FDZA 4GVHA 4BA0A 2WHMA 3E0LA 2J62A 4ZR8A 3RX3A 3QF0A 4QCFA 3DC0A 3AMGA 4FNUA 4AIUA 3MHGA 4M1RA 5FD0A 1TIWA 3FSTA 4U3AA 2WMFA 4W93A 4NAFA 3GU1A 3GDTA 5DRCA 5LSMA 3CL8A 3G2GA 4LC8A 1IWBA 1S5VA 2VC7A 3LHVA 3NVTA 4BWLA 3AZRA 3BPWA 4HCHA 4MB4A 2EAWA 4ZQOA 1E0WA 4DBSA 4WY0A 4BEQA 1VENA 4XO7A 5A6LA 1MSSA 4LV9A 4JX6A 4OOUA 3NQ8A 3VA8A 3A4AA 3EXTA 2Y89A 3LBCA 3PZNA 5EY5A 3D0CA 3M41A 3T9PA 1OFQA 4Z1BA 1HP4A 5E6YA 1JZ7A 1LYXA 4RE3A 1Q3NA 4HA1A 1WDPA 3T6CA 1ISWA 2HTMA 3RUBL 3LDVA 3S47A 3UT0A 4WKHA 1RXOB 3H4WA 4QE1A 3QY7A 2VWSA 3LEPA 3UY8A 4DNMA 4N9BA 3UXIA 3CUJA 3UF9A 1UP2A 2OZ0A 3S5SA 3WK0A 2PLKA 4KWOA 2JIWA 1XF0A 3W2JA 2Z28A 4JFSA 2WZTA 2ZDRA 3E2RA 2J9XA 1OINA 1TTPA 4PFHA 1CGVA 4UTJA 1JFHA 5FJJA 5T8GA 3O6CA 1JCYA 3L2IA 5ABFB 1B31A 3MSRA 4W89A 5HUPA 2JF6A 1UW9A 1XQKA 3A64A 4Z1CA 1Y8BA 1TPUA 2NQZA 3FA3A 2C14A 1O95A 2ZFAA 3TMLA 5EGRA 1H5VA 3OLIA 4HMEA 3VFCA 4QJ5B 3S2CA 3VOJA 1TREA 3PPCA 1KM1A 4BY3A 1P48A 2ONEA 1HQTA 2Q6ZA 3ME3A 3ZJ8A 4E3VA 4PRRA 3C2RA 4JTHA 1GVQA 1J0HA 2OXNA 3SCTA 2P53A 3M46A 3LMYA 4IG2B 3NDYA 1NWTA 3WO8A 2BHUA 3N4AA 3WMSA 1XLMA 4S3AA 5J5RA 2DVTA 2IXUA 3HQPA 2R91A 3B0VC 4H6KA 1WZAA 2CW6A 1S2AA 4KRUA 2Z1KA 5BROA 2NQ5A 4U28A 4HHPA 2Y4SA 4GBDA 3CQIA 2D20A 2PDHA 2CZFA 3SSJA 1TV2A 4HNVA 3AJXA 3RAOA 3OQEA 4H19A 1A50A 3NGFA 2XYLA 1DE5A 1LLOA 3HTWA 3OG2A 1UWTA 3A12A 1TFVA 4ZB5A 3SUVA 2BSLA 1DTUA 3PZTA 4ORIA 2Q02A 1JGIA 2ACUA 3ZT5A 4ICNA 3GTIA 3DYOA 1TVPA 7REQA 3KWSA 2VVNA 3NZRA 1EA9C 1G4PA 1NELA 1SYTA 2GYIA 5KZMA 4S1FA 2XU2A 1FWCC 4PEEA 1JF6A 2QCLA 3ARUA 1EZWA 3TQ0A 4DF2A 3VD7A 3MDWA 3M7SA 2ZUTA 4GHRA 3KM8A 3NYDA 4Y90A 1XG4A 1WXJA 3H2FA 3O0FA 1C90A 3CGTA 2P50A 2QCCA 3Q65A 3FDKA 5B7ZA 4QLJA 2CBVA 5CAHA 4NP7A 1HKVA 1MRAA 3CH0A 4P7NA 4FR1A 1RD5A 1R3YA 2WJDA 1GPFA 3BLLA 2R8WA 1ZPTA 4GUFA 4AAJA 5FEWA 5JQ9A 4X0VA 3V0SA 3W7KA 1QOXA 3OYZA 3THCA 3CAKA 3V0TA 4O15A 1ZJBA 1W17A 2X42A 3RG6A 1JDEA 3AU6A 1RVGA 3CIXA 4MY1A 1Q66A 4KFNA 4IQDA 2W4XA 3W2KA 3GHRA 1F9CA 1F07A 1R3TA 3H2OA 4EPEC 2QVHA 3VE9A 1LUCB 1Y65A 3BAIA 4N7QA 4E8CA 3DIPA 1UR4A 1OYBA 3KXQA 1Z9AA 4I5RA 4TVDA 5JBDA 4E5TA 5FSDC 1V6UA 5CZTA 1DVJA 3WDIA 3N18A 3WQOA 2DSVA 4QJ1A 2H6RA 5FACA 4QE5A 3B0PA 5MHBA 1BVWA 1JD7A 2FTPA 4HP5A 4C7GA 1HKIA 2QULA 4LYRA 4GY0A 3NTYA 4HPHA 3ONCA 3LK6A 2VEKA 1W2VA 2P3ZA 1G94A 1A3XA 5AHMA 5KINA 2WM0A 2YIHA 3TP4A 5CGQA 1KRAC 3M0VA 4M7TA 4AW7A 1DL3A 5D37A 4H8UA 3M64A 1E6NA 4F40A 1G4EA 4GYJA 4IPJA 3PTDA 5LIXX 1AJ0A 1NWUA 4XZWA 1KKOA 1OGSA 2J8TA 1E1CA 3IS4A 3UZJA 2DT1A 3BVJA 3I3DA 4K68A 3VMPA 5DO8A 5KITA 1UUMA 2NQHA 3T0AA 3K4WA 3TSDA 3WL1A 3N2MA 1F7BA 4AC1X 3G1RA 3ABXA 3GFXA 1BVNP 4Q7NA 1UR3M 5ECUA 4PMOA 3EXRA 3FXYA 5FF7A 4MZ1A 5AHLA 1X6LA 3AAMA 1WV2A 3N14A 4ZQRA 3ZLGA 4DJFD 4QG9A 4AZCA 2W66A 2W9MA 3QKZA 3DX5A 5EMYA 3P14A 3TX9A 2PGRA 3PAJA 2ZRYA 4DWSD 2VZTA 5A95A 2VL4A 1LQ2A 3VKAA 4YTQA 3NFUA 4NZCA 1XKJA 1TYGA 5C7VA 2VI0A 3PZMA 1OFPA 3WBWA 4LH8A 1XIMA 3EA3A 4RLIA 2DVXA 5K9XA 1FWBC 3SUUA 3A23A 3MA8A 1FQ0A 3LA4A 3G5EA 3DFNA 4H1ZA 2GQ8A 3T4WA 1F5ZA 1X8CA 1JZ2A 1XKYA 3L9CA 3TCEA 4W8AA 2P10A 2X8RA 3FIGA 4BKNA 5ECVA 1G0CA 4LJ3A 4UFMA 3O3RA 4Q4PA 1KM5A 1P0BA 2EKCA 3OZOA 3XISA 4I7VA 3MWAA 2BXYA 3WMLA 2QPUA 3WEZA 5I5RA 4KT2A 2HJPA 3VGGA 4JN7A 4DVOA 2YPIA 1P5BA 2XH0A 5A6SA 1ISXA 5HNRA 4ZODA 1TWSA 4Z2GA 3LZ5A 1SJDA 2VENA 4GYKA 3MCNA 1UD2A 3LY0A 4GJ1A 3W37A 2YFNA 4V27A 1E4MM 1H62A 5LA0A 2ZZ1A 4W5UA 3BAWA 2EQDA 5CCZA 3VGFA 1LZOA 2YGYA 3HMJG 4MZ8A 1W91A 1IGSA 3E5PA 3SN4A 3OVRA 3BCDA 4QTGA 2ON3A 1Z6KA 1BPLB 4Q8UA 2CWNA 3URAA 1ITXA 1JFXA 3EKZA 1V6YA 4IPPA 1PDZA 6CGTA 2E9MA 4R5EA 2VC5A 3TQKA 4CQ8A 3GNNA 1H3GA 4QIUA 1L8NA 1P1XA 3NQAA 1QU4A 1G6CA 2J8FA 3LU2A 4EE9A 1XSIA 1IT0A 3EMZA 2EPNA 1JNDA 3VDAA 3MHUA 1H50A 3G22A 3FS2A 3VM5A 1EQCA 1AW5A 4XZMX 5BWAA 3PG9A 3PNUA 3GB6A 3L12A 1LOSA 1EPVA 3WEMA 3U9IA 3L21A 2PDYA 2QT3A 4ZOCA 1KM6A 3Q37A 4PYSA 3H26A 3IRSA 2XHYA 3VNZA 1U30A 4O0QA 5LA2A 3R58A 1JPMA 4J3UA 2Y2WA 2D73A 3LENA 4JTSA 3GIQA 5D30A 1K8YA 4KMQA 3W7PA 4L4LA 3C0QA 4H7VA 4HPGA 1KV8A 1FH8A 2O7SA 2XVPA 3TTQA 2WKGA 1E6QM 1DJZA 4M24A 1VIWA 1KXVA 1THFD 3VIFA 1L2UA 1VBRA 4HZ7A 4LWWA 5D02A 3EZ4A 4ERAA 1T41A 4O19A 2YZ5A 3G8EA 2UZ9A 1TX2A 2ZRZA 3DHFA 1G7UA 3TC6A 4AH7A 3ANUA 1ZAIA 7A3HA 3O6DA 4PTDA 3RDKA 2E68A 2PDLA 3MUXA 1SZFA 5DRIA 3N13A 1E6SM 3CHDA 3S5ZA 3UG8A 1MNZA 4B4HA 1VRXA 2GJXB 4XIAA 4AEOA 1PPIA 5GNYA 3DZ1A 4FALA 3XIMA 1JUKA 4HMCA 1DYSA 1VBGA 1F3XA 3HJEA 3CZGA 1H4PA 4CU6A 4AYGA 2QUUA 4WZHA 4E2OA 1KGWA 3EPOA 4LEFA 1QK0A 2YA1A 3GNDA 4C90A 1U5VA 4PODA 1WO2A 2V8ZA 4WR3A 1IXOA 1XH1A 4PC8A 2CIPA 1M53A 2YR1A 1K7EA 2YCEA 3T40A 4DUOA 4UQCA 1OX4B 1XBZA 3L67A 1AJZA 4QRNA 2OYKA 1HT6A 5G4WA 1GNXA 5A8GA 1B3OA 1B57A 3GVWA 4Z08A 3W84A 2OT0A 3WEOA 3EKLA 4L6OA 4V2XA 2VM8A 5FKYA 4F2BA 1V8EA 5IOBA 2WJZA 3B9OA 2ISVA 3UA3A 2R1PA 4NAEA 1LL7A 2PB1A 1E71M 2RDXA 1CXFA 1ICQA 1YHTA 3GYEA 2Z26A 4LEQA 4B5TA 1KTNA 2XN2A 4FXJA 1V4YA 1B3VA 1UCWA 1DJYA 3WJWA 3UJ2A 1ZBVA 5BRQA 3H70A 5BRBA 1GVYA 4UR7A 3SR7A 1Q6LA 4HPNA 5BU9A 3QZ6A 4JFUA 4RV8A 1YPFA 1CT5A 1L0PA 1RQBA 3W01A 4JFTA 2GGGA 1LLWA 1FWAC 3WLHA 3G1HA 2WMJA 1RA5A 1ZCOA 3GDMA 2ADAA 4U4MA 1WX0A 3H55A 3PVFA 1IEWA 4XAFA 3KVLA 2ZUVA 3UEQA 3I4EA 3APTA 4D6IA 4S39A 3WQEA 3H24A 1X1OA 1XLJA 4I9MA 2J13A 3F4NA 4PRWA 4PTXA 2PBGA 4E2DA 3CHFA 1R86A 2XVGA 1UOKA 1NQ6A 1LOLA 1SO5A 4WUIA 3DEQA 1VBJA 3IAQA 2O55A 1XYFA 1QPKA 2ZC8A 5T26A 4H9VA 3MTWA 4NRRA 4JKMA 3RO8A 2QUMA 1KWGA 1EUNA 4KEZA 2AGTA 5AC8A 3URNA 4IL2A 7ENLA 2VGGA 3DESA 4Q32A 1A80A 1JJKA 4MKSA 4REQB 4U2YA 3PP7A 3S1WA 2OWCA 1QBAA 5BOFA 3LCWA 2F2KA 3IIXA 1PIFA 1VGAA 3EDEA 1B3WA 3T8QA 2DFAA 3P6LA 2FHBA 3F7JA 5I09A 3I4KA 4X22A 1MQRA 3AISA 3P3BA 4UR8A 4PCTA 1QPOA 2X0HA 4LYKA 3UNTA 5U7SA 4W9TA 4KWUA 3WFLA 1X39A 2OQHA 4IJBA 4P7RA 7ODCA 2Z29A 1GYNA 1OEPA 1R30A 3GBEA 3UNDA 1M03A 5BOOA 3T78A 3FAWA 1R6WA 1XYBA 3LHYA 4DJED 3K30A 2ZCGA 1N7KA 4H83A 4M6QA 3WLIA 1E3ZA 1NFPA 4DY1A 4DO5A 1KFBA 3EDDA 3WK3A 5CZ0A 4JYEA 3AIUA 1IYXA 3H7RA 4JYDA 3FW6A 1UKSA 3CMFA 2HVMA 2WQDA 4CD4A 4LBRA 1W32A 4LRTA 2Y70A 1BGGA 1UHVA 3AZTA 4CUCA 4A8RA 5C5YA 2VRKA 4NZFA 1O7AA 1M1BA 4MKVA 5A2BA 3GU9A 4D72A 4L56A 4QAIA 2BXVA 3UJFA 3Q2DA 3KS5A 3DG6A 3ZFHA 1MI3A 1TTJA 1GJUA 1XLCA 3JR2A 3PAOA 4PUUA 4ATWA 2PC8A 1XFCA 5C7HA 4GXWA 3THQA 1VEOA 1J4EA 3KBWA 2G37A 3MCMA 4TIMA 1GKQA 2CLIA 1LDCA 2FLIA 1EEXA 5C2XA 1W1TA 2EKGA 4PUWA 2DSWA 1ZJHA 4ZB2A 2IS7A 5LIWX 5CC3A 2PDKA 3P93A 2XH4A 1J79A 1OIFA 2UBPC 4E8DA 1ZENA 4MPQA 4LS0A 3VUSA 4YIWA 3R0DA 1ZSXA 2JKEA 2I14A 6TAAA 4Q22A 3U0HA 2GL5A 3LERA 3G1FA 3GM8A 2GVJA 3KOYA 1JXKA 2DSZA 3LD5A 1DJNA 1ZZMA 3GTFA 1DKWA 1YXYA 2A85A 3T0BA 4V33A 4ALDA 2DIJA 1HNYA 3GXPA 4QFUA 2XFFA 1RBAA 1XDLA 4FNTA 5DN1A 4OBTA 1E1CB 3A3XA 1XGEA 2J75A 5G5IA 1J12A 1D3HA 4JQ3A 1GONA 2BASA 3BLPX 4MADA 1X97A 2ZUSA 3NO5A 1N8WA 2NVAA 2NW0A 3PZ9A 3H8AA 3DN5A 3W26A 3IUIA 1GTEA 1WUEA 3DKLA 2YLLA 1SM9A 3DH7A 3CWNA 5GQBA 1E6RA 1E5JA 1ICSA 3S1XA 1BTMA 3QEZA 4FNQA 2UY4A 2E9BA 5AHIA 2FGLA 1DIKA 2CLKA 4POCA 4LQ1A 1HVXA 4XAYA 3M1ZA 3VO0A 1RJRA 3PTQA 4QITA 2V67A 3FY1A 2ACQA 4DO6A 4TUFA 3W76A 1ZU8A 2WC3A 3W1XA 3WD1A 1QAPA 3FEMA 3GVRA 5BWFA 2ZBTA 1NY1A 1NTHA 4ZA0A 1Q2RA 3W29A 3VZYA 1YYAA 2QS8A 1AUSL 2WPGA 2NLYA 4B92A 3C2OA 1I2PA 3CEPA 3URQA 2G97A 3WD0A 3P74A 4H8VA 3POHA 4KRZA 4IFOA 1HGWA 3WQ6A 3AIRA 1LM1A 3B8IA 1S2WA 5IDZA 2IW0A 4XB3A 2DQWA 1FWEC 4EAMA 4JKLA 3UG5A 2WSKA 1P7TA 5CPQA 2OFJA 1UBSA 1C7SA 1V3IA 2Q09A 4D6JA 3R13A 5D33A 1F4HA 3QHOA 4Q4SA 1BYCA 5LKYA 2BOEX 1SFLA 4PTMA 4JTCA 3L2LA 1OT1A 2QDDA 4DXXA 4WLCA 1RR2A 1E1EA 3C3NA 1DE6A 3CQHA 2D0GA 1H1NA 3E49A 3EWZA 5AZ0A 4O13A 2P5NA 4F2TA 5I00A 2O0TA 4K6AA 4C6QA 3ARSA 4XKMA 3DXIA 1NSJA 1JYVA 1IF2A 3MMUA 2PU0A 4TR9A 3GNOA 1T8QA 2VD8A 1EX5A 4CCDA 2AL1A 3M0HA 1TPEA 1XIFA 2PZNA 1XUZA 4NZ4A 1KBIA 4PA8A 3TWAA 4DBDA 3W1QA 4LAOA 2J78A 4WIWA 3WFZA 1J5TA 1A47A 1IEQA 1JPKA 4UQBA 4H9MA 1KGUA 3ZVHA 1GYMA 1JUEA 3MJMA 4ZEPA 1OF8A 1V0MA 1AQFA 4ICMA 3S46A 3TSBA 3W2UA 1UR8A 1SFTA 1R3QA 3RN6A 3HPAA 4MAVA 2O92A 3TK7A 1KXHA 1DBTA 4DYJA 3LSBA 4LUTB 1NDVA 3AHTA 3VD5A 2DZWA 1F61A 4XZIA 2PGWA 1XIJA 4MJMA 1RAKA 4L80A 2A21A 1Q6CA 1JZ3A 3RRAA 1GQKA 1XIBA 4G56A 2KX9A 3GG1A 2OX1A 1CENA 4QBXA 1KRBC 4M51A 3UETA 2OQYA 5DT5A 3QSTA 4PTNA 2WZEA 3B9NA 4X63A 3N6JA 2O7QA 5CSSA 3WNPA 4NI3A 2XIJA 2YB1A 3MI3A 2WLYA 3GH7A 5LHFA 3AYTA 3JUGA 4TO8A 3WQ4A 1XIDA 3SADA 4Y9NA 1ZTVA 1GQJA 1R2TA 3CZKA 5A8QA 2V63A 3RNDA 5DANA 5U4NA 2DW6A 1VH7A 2EPMX 3VNIA 2CHNA 4S3BA 1TG7A 2A1YA 3N25A 3BLFA 3U8GA 4EWND 1BSIA 5D32A 3RMEA 4K8HA 3RK8A 1MW3A 3N4EA 4DUXA 1LQAA 1ZRQA 3B8VA 3DECA 5A6KA 1XLDA 1KR1A 1DOSA 1E4NA 1Q8JA 2Q8XA 2VEMA 4ACZA 5LNWA 5DFAA 2DSUA 2GJRA 1UWAA 4B5SA 3VCNA 2QUVA 3HFYA 3BARA 2DDXA 3CT2A 3SRHA 2NV1A 2E25A 1E3XA 4C6EA 3IGSA 3LN3A 1IT8A 3IK2A 4C6DA 1OC7A 2QMJA 2XN1A 3GKFA 4ACZB 2ZKMX 5AVHA 2NZLA 2Q71A 1SUXA 1K4GA 3IVTA 1NDYA 3IJ8A 3W1MA 3FJLA 3FOKA 1P4CA 1VPYA 5CPLA 4HKPA 4BZYA 4AU0A 1OFDA 3KX6A 2GK1A 3T81A 5HWNA 1R3WA 3GO2A 3N29A 3VNDA 4WGXA 3HG4A 4MY9A 4MWAB 3BCJA 3CUFA 3TJIA 1RJQA 3RU8X 1L6FA 4K7YA 3QSRA 1ZY9A 2IPFA 1JRCA 2BOGX 1A5BA 1CCWB 1W8GA 3D3FA 4CD8A 1EYEA 5DY2A 3LLDA 4D8ZA 2ZTKA 1W1VA 1QW9A 2CLPA 3IIOA 3NPUA 1O5KA 3KZSA 2G41A 4F0HA 2WYSA 5ENLA 3NPVA 3KP0A 2AQOA 4QQUA 4PUMA 1VLIA 3PPHA 4D1JA 1P6WA 4NXSA 3SUTA 3SRKA 1XYCA 5HWMA 3GBDA 2GGEA 5REQA 1AG1O 2PE4A 4Y9OA 4NASA 4DUVA 3VD4A 1MW1A 5SWUA 2Z6JA 3R12A 4E3TA 4X3ZA 1FHDA 3BV7A 3I10A 1QPQA 3G1YA 1LROA 2FZDA 4UTMA 4WDWA 4DI9A 1LWIA 4O8RA 2OZTA 3THDA 3RCMA 4A3RA 4ZSTA 3N9KA 1PYMA 3OZPA 1ZB5A 3TEVA 2PTYA 1WB0A 4FF7A 3KTCA 2ZXDA 3SGUA 4AMAA 1KXTA 4LAMA 2XJ7A 4IXHA 1DXEA 1FH7A 2CNCA 4ZMGA 1HTIA 1QHZA 2VUYA 3SN0A 1K4HA 2B7PA 3W70A 1HL2A 2Z1SA 5D2YA 2VELA 1I2RA 1WDDA 4LS1A 1I45A 1QNVA 3CQJA 4FZIA 2QMKA 5HMFA 1YBQB 1EF3A 3USBA 3TFCA 2O9OA 2H3DA 4D6EA 4GCAA 4LANA 3F5JA 4Z2KA 3EA2A 3IGXA 5DY3A 3S4TA 4ZQMA 5A6BD 4D6GA 4BQ3A 5E93A 1P0DA 1XLAA 3BAJA 1TQXA 3H2EA 3IUDA 5IFTA 1ALDA 3W2MA 2WVVB 1UD3A 3GHUA 5EL1A 1EIXA 1JDFA 4LF2A 5FJPA 3WLSA 4FPSA 1ONWA 3SO7A 4UCFA 4DJEA 1HKMA 4W86A 1IGWA 3UZWA 1PV8A 3S2NA 4M56A 4A29A 1PZ1A 3ZLFA 1LRNA 3WD3A 3I6RA 5E6ZA 1BWKA 4XIMA 3KOZA 1G7VA 1RSCA 3DFSA 2W5FA 2C16A 1SJBA 3CAWA 2E6FA 3W85A 3S42A 2YW4A 3TDFA 1ONRA 3G1SA 3I68A 4PCFA 4DYKA 3BCFA 4FF5A 4DF1A 4OKDA 1WKEA 3W6MA 4GY1A 1WOBA 4RE0A 2YOCA 2PDQA 1SSDA 2VEIA 2V3FA 4DAIA 5H91A 1GORA 3S1UA 4KWWA 2AQWA 2VJXA 2Q3RA 4MUZA 6REQB 3FSUA 3FV9A 1TO3A 5CBIA 2VHLA 4Q8TA 1VBUA 3AUOA 3S1VA 4CLMA 3GC2A 4MSSA 2BWGA 1I8JA 2VEFA 2B7OA 3PJTA 2F6UA 1QXLA 6REQA 3CUZA 1JPDX 4B9YA 4N9CA 4GZIA 2VZVA 4O1FA 2QCDA 3SCQA 3MJYA 2L5HA 5J04A 4YYCA 1Q8AA 3LUTA 4AHPA 4O8AA 4WHBA 2D1ZA 1A4MA 3WYZA 4MGGA 1FWFC 1ENUA 1ME9A 3LLXA 3KS6A 1A0DA 2WAGA 1S5MA 5LGZA 2PWUA 4QEHA 2V5KA 3CL6A 1DIEA 2I56A 1YE4A 4R9XA 1JGMA 2YDRA 3GHSA 3LCFA 1TWWA 3UCCA 1OZMA 3KVKA 4Z2JA 5GVJA 4GX8A 3O16A 3RPDA 2J7EA 1AD1A 3M0ZA 3CIWA 4NUWA 4RPQA 4WDTA 1MMFA 4IUOA 3KLLA 2YW3A 1KTBA 4GXPA 1MZHA 1O4UA 3HO8A 1Q6DA 2WVSA 3FA5A 3PANA 3BOXA 4B5XA 4R9OA 3TR9A 1PTAA 4H4IA 4I9AA 3W1LA 3KTSA 1AQHA 1E6PA 2AQVA 4JYFA 4FNSA 4UZUA 2HNEA 5BU6A 1EXBA 3FJ4A 4O1AA 4S3KA 4A3HA 4CGTA 4JIIX 3FYOA 4AZHA 4UTTA 2BVDA 1NQKA 3ES7A 3V16A 1OFRA 1HVQA 3RXZA 4HNUA 3UWQA 3OVGA 2DT2A 1B54A 5A6MA 1LL6A 2GWNA 4NU7A 4MM1A 4UQ9A 1AW1A 4CNOA 2OX4A 2PZ0A 2QQ6A 4UXDA 2YXGA 3N2TA 4LAUA 5GPRA 5EFDA 5HPOA 1OFAA 5DMNA 2BG5A 3GC5A 2FDMA 5C71A 1O5QA 1Q7ZA 4JY8A 3IJ7A 3W02A 1W5OA 3FJ6A 3F5KA 3ZWTA 2Q8ZA 3FK4A 4LBUA 2E7FA 3ITCA 1I1XA 3WF2A 2NV2A 2PWHA 3CPUA 3C3UA 4PMNA 4PMYA 2GGIA 4TU1A 5E9XA 1EYWA 2IQ0A 4FLRA 1JRBA 3REQA 3CB3A 1JG9A 1OK6A 4XZBA 2PDPA 3W6LA 4IISA 3E2VA 4Y8FA 3N4FA 2J9ZA 4PRTA 1KQZA 4AZGA 1HKWA 3EDFA 1SVDA 4JTKA 4NXKA 3B97A 4YS1A 3EB2A 1YDOA 4AIBA 4MVAA 4RUBA 3W1UA 1BWLA 2D2OA 3NL3A 3NGJA 1IXPA 3MMTA 2DP3A 4KETA 3L65A 4OQVA 1NWSA 2ZZ5A 1C7TA 4RXFA 5IHRA 3QBUA 3N6HA 2ZUWA 3IV3A 1Y7VA 1MVYA 5TBOA 3ARVA 1AMYA 1JI1A 4HU4A 3WD4A 1F05A 1I0BA 4Q8VA 2YBTA 5F1VA 3UXDA 3KRUA 4YVPA 1BFNA 1DWFM 3SSZA 3DFOA 1E4LA 4HNTA 5FOOA 4ZFCA 2XSBA 1W9XA 3ARXA 1X8FA 4JGDA 3TUUA 4PBEA 4A3QA 2E40A 1VPXA 4ONVA 2CEQA 1X6NA 5CGMA 4IP5A 4NY2A 1XCXA 1PHWA 2CZEA 1E15A 1OCQA 3TNOA 3O06A 4GZEA 5BXSA 1MW2A 3WJXA 5TNVA 4CU7A 3NSNA 4NJJA 3VNKA 2ISFA 1NOWA 3QHNA 2Y5SA 2NVCA 2ZX9A 3BLKA 1DQWA 4GG9A 3K5XA 2FGZA 1LWJA 3ZLHA 3ARRA 3GR8A 1C8XA 2WHJA 3INPA 1H41A 4PUEA 4MKNA 3SW6A 2A7RA 2CLEA 3UJSA 5JIWA 2QJMA 1YPIA 1H7RA 2GUYA 1UBPC 3WK2A 2YJQA 2NSXA 3GXDA 1VZWA 1AFSA 4HYVA 5HOSA 3WNMA 3ARTA 3OGRA 2XISA 2R1KA 1RPXA 4UOJA 5F4SA 4HK6A 1EWDA 3MUAA 3P8IA 5H1WA 1UD8A 4C7FA 4DZHA 4BQ2A 2I57A 1EWEA 4WF7A 1KTCA 4JIPA 3TMQA 1A5UA 4GQGA 1XBXA 1E70M 1E5NA 1TA3B 3VOGA 1RCOB 4MUPA 1WNOA 1TUFA 3NDZA 3UP8A 1E1FA 4DELA 3MPGA 5FL1A 5FEPA 3SQLA 3WSUA 3I6TA 1E9YB 4LY8A 4XZHA 2ACSA 3ZSSA 3K46A 2B7QA 3W6YA 2C71A 2DT0A 4HA0A 4FNPA 4Q4OA 4CCZA 1ITCA 1ADOA 4UOQA 4GABA 4ZO9A 5E0CA 2QCDB 4FNRA 1P0NA 3PNZA 3WLNA 4ZZ9A 3CWHA 4O0KA 1UYQA 3R1ZA 3LSCA 4R7JA 4AD2A 4G1KA 3OVPA 4IIHA 3H2AA 7PTDA 4Z1YA 4F3HA 1BXCA 4JX4A 3WF1A 5F1UA 3N15A 3G3DA 3CC1A 4ZB0A 1EC8A 3ATYA 3TLQA 4W8LA 3UWEA 3B0UX 1WA3A 2QGHA 4FHAA 3CTTA 2LLEA 4O54A 4BF5A 3IEBA 4PZVA 1MO0A 2ZX8A 4CQAA 2QR6A 3OA3A 2FH8A 1LLZA 3BW2A 4O53A 2RKXA 3A4JA 1R38A 5C9UA 2FJUB 5T9BG 4H6EA 1HW6A 2ANUA 4IFRA 1U1UA 3BLDA 1D9EA 2VDGA 3BJSA 2DJLA 4OVXA 3F4DA 4UC5A 1JR1A 2OTDA 1AL8A 4R27A 4YYFA 5AC6A 1AH4A 1LUCA 3LTYA 1CGYA 4A8LA 1R5YA 2FZMA 4PCSA 4H9UA 3DG7A 1TQJA 3OLDA 1YX1A 3WK1A 3VDCA 3WMBA 1YXCA 3GSMA 5D05A 4A2RA 4RNIA 1EDGA 2I9UA 2R6OA 2RH9A 1Q7MA 3QPYA 3HV8A 4DX3A 3RCNA 4QDMA 4DJDA 3U3HA 2YKKA 4GYFA 4U3CA 2PLCA 2Y8KA 5DCEA 2Y5EA 4HNLA 1OD8A 3AQUA 4RNHA 2RDWA 3MKVA 4H7ZA 5JH1A 2A6LA 3T0CA 4ATDA 1Q6GA 3BW4A 4MAZA 1QVBA 3S9IA 1RLDA 4UFIA 3IJQA 1KXQA 4EPKA 2ZZ6A 4ADSA 3P84A 3JVAA 4L9YA 1JI2A 1OC6A 2JBMA 4BEUA 1F6KA 3KHDA 5I6SA 3R94A 1UR1A 3I7QA 3E0VA 1YE6A 2JGYA 3EAUA 4C60A 1UPMB 4TOQA 3QZAA 1IEXA 3SGZA 5HQLA 2CWXA 3VNLA 3LRMA 1JEZA 2F7FA 3W88A 1NP0A 4P8WA 2C0AA 4HQVA 2RAGA 1N8FA 3S5OA 3P62A 1V0NA 3VNMA 3COTA 3VILA 4DUWA 3GUGA 4JR5A 2V5CA 3VOCA 4FOJA 3PBVA 5G2WA 5ABGA 4BK9A 4PMUA 2XPKA 3EOLA 5EU9A 4O1DA 3AWNA 1B5TA 3BZJA 5FF0A 5BMWA 4MLJA 1JYNA 4GLEA 3W7NA 1UH3A 2PTXA 3N2OA 5A2AA 3HN3A 4NNCA 2OGYA 1HO4A 4HMDA 2RDUA 2A5HA 1XLKA 2B4GA 1EJTC 2QAPA 3M44A 4TVCA 2CITA 1O66A 1WBJA 4LX4A 2FMNA 4MHBA 4FB7A 3QVQA 2KZHA 4IGHA 4FO4A 1UWQA 1TB3A 4AD0A 5LIKX 1EPXA 1QNPA 2XVKA 3SB0A 1LG1A 1WZMA 2A3HA 5EYWA 5D4YA 2VTFA 1FH9A 1ZL1A 1O12A 4N2YA 3CV7A 2OOGA 1PE1A 1EX1A 2WWCA 3NQ6A 4NAEB 2IPGA 3WFAA 5E0KA 3UR2A 4YTSA 1RK5A 1YDVA 3MO4A 4IL0A 2DY3A 2Y7DA 3S2LA 4K8GA 4DF0A 1M65A 4PUDA 1K9DA 4AVNA 1AZ2A 1B3ZA 1IWPA 3TE9A 2XFWA 5A8PA 1VF8A 1XRFA 2WB5A 5FA5A 1G67A 1AA1B 3EX3A 1EO7A 2PD9A 2UV8G 1MQPA 4UTTC 3H2MA 2HV5A 3AXHA 1J5SA 4XBJA 5CSYA 3U7VA 2ZZ4A 3R8GA 4TTUA 6ALDA 4C6JA 2OB3A 2PDWA 3H6OA 2PTDA 3AIWA 3PBGA 4ILSA 5A6TC 4HHMA 4ACYA 4Z17A 2VGIA 4GKLA 2VEPA 3E38A 1QATA 2NX1A 4CD7A 5BNKA 3G6MA 3EPNA 5CJMA 2VURA 4A3YA 1POJA 2VFDA 3PG8A 5C8BB 1DWJM 3SCOA 4AC7C 6PTDA 3HFTA 1FWDC 1TPFA 3CL7A 4QS6A 4HNNA 3T0TA 8TIMA 4GKTA 3BAKA 1E73M 4D6DA 2Y63A 2PD5A 1OYAA 3PFRA 5HXMA 4KFPA 3WF4A 1JZ8A 3RLVA 3JS3A 2FPVA 1KKRA 1UWSA 2XH2A 3WDRA 1PWLA 4KGLA 4W85A 1HJWA 3FGCB 3MI2A 4DM2A 3LPOA 3HGRA 3DU0A 4JFWA 4N9EA 3S1GA 2P88A 3E5BA 3EOUA 4JEJA 3KWXA 2HK1A 1K9EA 1W37A 1MQQA 1QI2A 3I3EA 3T44A 4YTUA 1Z8AA 3R5EA 4GA8A 2YA0A 1KWKA 3RRXA 3QGAC 1AVAA 2QIIA 3LI0A 3NSXA 1KRCC 1NDZA 1OABA 3C6CA 4AY1A 2O4MA 1FHVA 2D23A 1UKOA 4OBSA 2AGKA 4LVDA 3AS3A 4D6FA 5D2XA 2PDGA 2XIOA 5HQEA 4IQJA 4MDOA 2DQXA 2GZXA 2Y5JA 3MKCA 2BS9A 2BVWA 3EX6A 1QPRA 3KRZA 1MW0A 1SR9A 1GK8A 2POTA 3UWVA 2PF8A 4GGBA 3MQTA 3WENA 2VR4A 1LBLA 4GIYA 3WQDA 4GI9A 4OHQA 2HROA 5I02A 4B3ZA 1UKPA 1QHPA 2NWRA 3A22A 5CJ5A 1H51A 2J7BA 1WUFA 3ZIZA 2WNNA 4W4QA 1XS2A 1EDQA 2BY2A 4BF7A 3OB8A 1Z44A 1W5NA 3S6TA 1EUAA 4O50A 1KGXA 2DZVA 3AMDA 2G0WA 1J9YA 4IM4A 3OQ8A 2IUZA 5G1YA 1K6AA 2ATSA 3BQ5A 5XIMA 1QO2A 4XD5A 4NNBA 3ABQA 4RW5A 3CK5A 4QSFA 1UZHA 3E0WA 4JTDA 3B40A 3QV9A 4TMBA 1TRIA 3OIXA 4S2BA 3A3WA 3DOPA 3DBPA 2NQJA 3KL3A 4OJYA 4O4VA 4C1NB 5HQMA 3ZQ9A 3H7VA 3B9AA 1M7JA 1L6SA 1S38A 4I7UA 5AY7A 3KLKA 3GVVA 1T40A 1YRRA 3THUA 1AW2A 3KRSA 3BSGA 4XVEA 3OEXA 3IJLA 4B9ZA 3EEGA 4XWUA 4F0SA 1IR1A 3PPFA 4RE4A 1SPQA 2I5QA 3T05A 1T6MA 5DXXA 2XVNA 3S9YA 3S0CA 1ONXA 3CU2A 3AYRA 1P6CA 4JHOA 1B4KA 4UTWC 3TYDA 2J77A 4IPNB 1TZZA 2POZA 1KBBA 4HZMA 1XQLA 5J8LA 2VQUA 3G8RA 4GWEA 3AIVA 4JTEA 1Q6QA 4G1NA 1BXNA 4LFYA 3VABA 1K8CA 4ATLA 4DWDA 3PJWA 2D0FA 4UTKA 1V3HA 4GISA 3QRHA 2GVGA 3DC8A 5HR6A 5HAOA 4DNHA 2QVNA 1C91A 9XIAA 3T8LA 1DTNA 4JQ4A 1T5AA 2GQAA 3BH4A 3W28A 2PPGA 1V7YA 4JNYA 4TV6A 4REQA 5CBJA 1ESWA 4V15A 2E67A 1H7PA 1R46A 1I75A 2FYMA 4MMWA 2I17A 3TONA 4I8DA 4NZ5A 3JW7A 2BY1A 1IT7A 1RBOB 3PPGA 1R87A 2JEQA 1UD5A 2EG6A 4DJFC 3E96A 1QFEA 4S3JA 1CX9A 3AMKA 4WSKA 2GPTA 2DJXA 1Y5XA 3SCSA 1JZ5A 3QM3A 1M04A 4JQAA 3GY1A 5H8UA 2DSKA 4HJWA 2I5IA 1BQGA 1PX3A 4US6A 3W73A 4JHZA 3L7RA 1JDDA 1Z48A 1JYXA 2BHYA 9XIMA 4ZE4A 1EOKA 3NZQA 4JY9A 1JXJA 2XGIA 3PJXA 2QDGA 4ERGA 2NUWA 4JTUA 3PUDA 1Q13A 4MWAD 3CEUA 3QC0A 5EMKA 2FTWA 4LAKA 3EWUA 1Q2SA 1Q7QA 3L0GA 3AO0A 3STEA 1UIPA 3HJZA 3BTNA 3CXOA 4MWAE 3NQ7A 5CBBA 3DFYA 1K77A 1S2TA 3EXSA 4WKFA 3R10A 3KP1A 3WH5A 4OWGA 2G3NA 4NVTA 4GMEA 1ITUA 3SBFA 2TSYA 4M81A 1XYLA 2FHCA 3LHUA 3PN8A 3SJ3A 1GGOA 3IJDA 2CLOA 3CZLA 2XN0A 4FR6A 3CWOX 1V79A 2OGJA 2X30A 3AS2A 3W1PA 3TXVA 1HXJA 3LV5A 1A3WA 2X7VA 4UTLA 5TD4A 4LS2A 3E1F1 4WEVX 1W3KA 4Z0SA 1GKPA 2PDFA 3JZUA 2WHLA 3MT1A 3RU6A 2PMQA 5EPDA 4P2VA 5D38A 3RJXA 3C2YA 1EO5A 4NX5A 4LB4A 1NOUA 2V3EA 1HJQA 2WSQA 2WCAA 3TAOA 7TAAA 3QTPA 5C54A 4N6EA 1B3XA 1FTXA 1RVKA 1C9DA 1VB9A 3M0JA 8RUCA 1XC6A 4H2CA 4XZLX 4N9DA 3TA9A 3CUIA