1G4EA

Thiamin phosphate synthase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
226
structure length
219
Chain Sequence
b'HGIRMTRISREMMKELLSVYFIMGSNNTKADPVTVVQKALKGGATLYQFREKGGDALTGEARIKFAEKAQAACREAGVPFIVNDDVELALNLKADGIHIGQANAKEVRAAIGDMILGVAAHTMSEVKQAEEDGADYVGLGPIYPTTRAVQGVSLIEAVRRQGISIPIVGIGGITIDNAAPVIQAGADGVSMISAISQAEDPESAARKFREEIQTYKTGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIAMIN PHOSPHATE SYNTHASE
publication title Structural characterization of the enzyme-substrate, enzyme-intermediate, and enzyme-product complexes of thiamin phosphate synthase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 79
structure length 219
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.5.1.3: Thiamine phosphate synthase.
pdb deposition date 2000-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1g4eA00
3ABSA 1OG0A 4O11A 3WFAA 1LYXA 3NQDA 3DAQA 3B03A 4FNQA 4HHPA 3O06A 4AWSA 1GOXA 3NPXA 2WSQA 3AO0A 3W75A 4IWWA 3W2UA 2ZZ1A 5HR6A 1JUKA 3RLUA 1JVNA 4MUZA 1J5TA 1W3NA 1WA3A 3G1YA 1OFQA 3T78A 2OX1A 1BKSA 1B4EA 1VPXA 4N6FA 3M47A 3TW6A 5HMSA 4XTDA 5LZLA 4M7SA 3G3DA 4ZQPA 1C9DA 4OWGA 2YX0A 3P84A 3IGSA 5CKSA 2CWNA 3P82A 4MFDA 5DBUA 4FIRA 1W37A 2BTMA 1KM4A 1LLZA 3HMJG 1JCXA 3QRHA 2H6RA 5DN1A 3M43A 2CLKA 1QMLA 1V7YA 1LRTA 2VELA 3CTLA 1MSSA 1W5NA 1YLVA 5F1UA 5LHFA 3W84A 4N02A 2BZNA 4LY8A 2A0NA 1P1XA 1NFBA 1K02A 4GE8A 2YFNA 4NJJA 1DBTA 1VH7A 3KRSA 3TROA 1I45A 4QQ3A 4ORIA 1B4KA 1KM3A 4JX4A 2D73A 4NT0A 5E93A 2ZRZA 3QEZA 3W1UA 3FLUA 1NEYA 2QAFA 3S9YA 1QDSA 3EWWA 1QFEA 2X1UA 2DZPA 4PH6A 3IEBA 3TU9A 5BMWA 4R34A 1FDYA 5AN7A 3LLFA 2J88A 2GQ8A 4IMEA 4P2VA 2EGZA 1L6WA 1TPB1 3DFTA 3GXPA 1S5WA 3OA3A 2E6DA 1WQ5A 1KFEA 2JBMA 2JKEA 4JY9A 3FA5A 2OT1A 3WK2A 4XQ6A 4Z0SA 4UNLA 2NZLA 1UASA 5LNRA 1W5MA 3MP5A 4Y9AA 1Z42A 1G4TA 1MZHA 1LTDA 4B5NA 4K6AA 3DGRA 5HJLA 1OFBA 2BXVA 3LV5A 3SY5A 1DOSA 4M6VA 1WXJA 3O15A 1TB3A 4UFKA 3W7KA 1EX5A 1HG3A 1RPXA 2CLIA 1W5PA 4ZL1A 4GWEA 3K30A 2CZEA 3AJXA 1G4EA 2GVLA 3EXRA 3CEPA 1A5CA 4J9JA 1TPUA 1JCNA 1ICSA 3NQ2A 1FUYA 1OFAA 1A5SA 2A7PA 4PA8A 5AHMA 4QM1A 5AYXA 4CQ8A 3W7NA 5LGZA 3H55A 4HNUA 2C14A 1WOAA 5FF3A 3P60A 3L5LA 2QDGA 3PBWA 1R2SA 3NM1A 4S2CA 1Q6OA 3YPIA 5KTLA 3EX6A 2NX3A 5F4SA 4POCA 3W2NA 3A22A 4ADSA 1DHPA 2VEPA 3NZ1A 1I2NA 5CZ0A 1A53A 1VQTA 3DFQA 1SSGA 4JTGA 4XKYA 4O53A 2CZDA 4O50A 1XI3A 3TNOA 4UFLA 5I3KA 3TC6A 3TIMA 3G1XA 3G8EA 3TQKA 3G1SA 3B04A 3BW4A 5HUPA 4QSHA 2A6NA 5D37A 2VFEA 2TSYA 4HN4A 2ISVA 3PC0A 1JCMP 3NM3A 3HGSA 2ZRVA 3ANYA 4NZJA 4GUJA 1WAUA 2FB2A 1SW7A 4A29A 4RXGA 3MHGA 1ZJIA 3PB0A 1MEIA 5J5DA 4O52A 2OT0A 3OVRA 1G67A 2F84A 3GXNA 3EWYA 1FQ0A 2F7FA 2I9EA 3W87A 5HWNA 3BPWA 2C0AA 3PY2A 4UR7A 2V5LA 1TPC1 3SGZA 3IVUA 1T0OA 2Q3RA 1RQBA 3TKFA 1OX5A 4M6QA 3O63A 3P5ZA 1NF0A 5EYWA 3LTYA 3DXIA 2FPTA 5C55A 1UUOA 4K8HA 5D2YA 5CSRA 3PUEA 4JTTA 3P74A 3S5NA 3PG8A 4AMAA 4LVGA 1PE1A 3FKRA 4E2BA 1KTCA 4DELA 4WY0A 5D32A 1TPH1 3GB6A 4MFEA 2CLFA 3U8GA 3NPWA 1JUBA 1R46A 1MEWA 3PBVA 3C0JA 1YXYA 4RLIA 5ABTA 2WOQA 6TIMA 1RR2A 3O1NA 4ML9A 2NX1A 1G69A 1GTHA 2GVJA 4FXSA 2J6XA 2HSAA 5CG7A 4BI7A 1IIGA 1M7OA 2YFOA 5FF0A 4O18A 1XXXA 1KLZA 1XDMA 3CB8A 4X9SA 1HO1A 5F2MA 1CI1A 2NUWA 3S8HA 3G0UA 1D3HA 3CEUA 3EKZA 4MIMA 5DXXA 5I3FA 4GXMA 2RDTA 4LVDA 5LNUA 4AAJA 3RMJA 3PBYA 5DELA 3TSBA 1SO5A 3TH6A 1UBSA 3C2FA 4MZYA 2RFGA 1VJIA 1XDLA 4O17A 5J5RA 1KBJA 4MZ8A 5BRBA 1W56A 3EXTA 3W1AA 3RK8A 3MI6A 4LOCA 3VI2A 2DZXA 2XN2A 3MYOA 4E2DA 3MI2A 1PCWA 4JTSA 3DFSA 3GIYA 1GVQA 4GUHA 2C13A 4S1FA 4RV8A 3BLEA 4JEQA 4NUWA 1LORA 1VC4A 3DKLA 1SUXA 3LCLA 4W9TA 4O28A 3OVPA 4AWUA 3T44A 3UXDA 3E02A 4NVTA 3S5YA 2PE4A 2W6RA 3OHIA 2IQTA 1KTBA 3INPA 2Z6IA 3M5YA 1H1YA 2WQPA 3P62A 4LS1A 3L0KA 4FNRA 4ZVJA 1F76A 3Q58A 4QNWA 3EX1A 1OFEA 4O15A 5AB3A 3L67A 3HPZA 3W7QA 4C1KA 4O13A 4RZ5A 4AHOA 4YMZA 1GVFA 3W23A 4DBEA 4IMDA 5F1VA 2ZA2A 4O4VA 3LXCA 4LS0A 3NQVA 3M7WA 4RXFA 3PS7A 1KM2A 1GPWA 1BEUA 4H3DA 3RFAA 1HFBA 1GWJA 1KBIA 3UWYA 2C18A 3LV6A 4IOTA 1JR1A 2YYTA 2E6AA 1TTPA 4CNNA 3ZR4A 1EEPA 4AHPA 2X1SA 1XC4A 3W1RA 3T4CA 1IF2A 2FLIA 3HIJA 4O4WA 4O1AA 3O05A 4TR9A 2Z6JA 4FNPA 3S6DA 1QOPA 3P80A 2Q8LA 1W5QA 2OJPA 3KFTA 3PAJA 2V82A 1Z41A 1OX6A 4JTKA 1LZOA 4NJIA 3DZ1A 4M6PA 1VCGA 1TPDA 4CCDA 4CCCA 3R13A 1BWKA 1H7NA 2V2HA 2QCDA 1XFBA 2FPVA 2RKXA 1YXDA 4NZFA 5E0KA 1SW3A 4LRSA 4ADUA 1JCYA 4IXHA 3FJ6A 4UMBA 1H7WA 4YWIA 3TR2A 3E96A 4WX2A 3FYOA 2H3DA 4TMBA 5T26A 1EPXA 3BW2A 3TSMA 4PODA 5KINA 3FEMA 3QM3A 4UC5A 1YTEA 4KFPA 4RCXA 3IV3A 3QMSA 3LHTA 3OIXA 5CZTA 1W3TA 4M5PA 5K2ZA 1FCQA 2ZFAA 4IXXA 2YR1A 4DF0A 1PL9A 1ALDA 2Q3OA 4LVAA 4N6EA 1SZFA 3LXBA 2VFGA 2RDWA 3FOKA 1F05A 4IJBA 1KLYA 5HINA 4K38A 5AFDA 4M19A 4AH7A 3CC1A 2VENA 1WOBA 1T99A 3NQEA 4I9AA 1ME9A 1ME7A 1G7UA 4FHAA 2V2CA 2B0MA 3NNTA 1H51A 1KFBA 3G1AA 1ML1A 3R5EA 1JCJA 3W9ZA 1UUMA 3HGOA 5DCEA 2CZ5A 2E5BA 1DJQA 1F7BA 2R8WA 1O95A 1F6PA 1KA9F 1KM0A 5HUOA 2JGYA 3W7PA 4LUIA 2CLHA 1I2QA 1VLWA 1SFJA 3LDVA 3OG3A 2E1DA 4QITA 2ATSA 4UTJA 1XM3A 3CM4A 4UCGA 3W7JA 3VCRA 1LRQA 3KRZA 2BWGA 1QPOA 5EKYA 1EUAA 1VHNA 4OU1A 4DO4A 2C1HA 1AK5A 4FNUA 3STGA 3P5YA 2J24A 4MKNA 2QCFA 3TK7A 4HSOA 3IIZA 3W22A 1YDNA 5K9XA 2PURA 4FEZA 3A5VA 5CPNA 3UNDA 5DXYA 3NAVA 3S42A 3N73A 4LUJA 3VE9A 4IGHA 1KM6A 4MYXA 4UXDA 5AHLA 2JGQA 1N7KA 2ZYFA 1QPQA 2TPSA 3WK0A 1OK4A 2E5DA 5I3HA 3W3OA 4UTMA 3GDLA 3S5ZA 2V30A 2E68A 3M16A 4FX7A 4XTIA 4JTIA 1P0KA 3N34A 2WSYA 2NX9A 2Y88A 1FXPA 4A21A 2P10A 4QISA 1IXNA 2QJIA 1K03A 1AW1A 5AOUA 1T96A 1TV7A 3L2IA 4ONVA 4WD0A 3W83A 4IMGA 3HF3A 5TQLA 4R33A 5U7SA 1X8FA 3Q94A 3ELFA 1QPNA 2YXGA 3E49A 2ZRUA 2TMDA 2VFDA 5FF4A 2QCEA 3NEVA 1XBXA 4IX2A 1LOQA 3WJSA 1IXOA 3M44A 3O6DA 1LLWA 1W31A 5D2XA 1S5TA 4K8EA 4GNJA 1OYCA 3HGJA 5E1QA 4N9DA 3BW3A 4EF8A 4N9CA 3G0XA 4DO6A 1RQHA 3SW6A 4O8RA 2QUUA 3WK3A 2DJLA 3TFCA 2YW3A 2YW4A 3I68A 3TMQA 4XWUA 3NR0A 4LVBA 3LRKA 3CU2A 4LV9A 4WY0B 3TE9A 1DQWA 1AW2A 4GUGA 4KFNA 3W86A 3NXFA 3MMTA 2H90A 5K3VA 1TTQA 2C15A 3NOEA 1IIHA 1W54A 4MJZA 4FNSA 2QDHA 2V9DA 3NPUA 4AF0A 3CLMA 3A9IA 3SI9A 4NNCA 3TDFA 1G4SA 1LDCA 3QC3A 4K7YA 1L6YA 1O60A 4K36A 4BR1A 4LV4A 4UTWC 2DZUA 1FCBA 1KM1A 5K4XA 1LBMA 3U6WA 1ZNNA 4OE7A 3NGJA 3DBPA 4BWLC 3LBMA 3QPYA 4ZQMA 2V2DA 5LHEA 4MLJA 2O7SA 4U28A 3W1TA 2DZTA 3LCGA 4XUGA 1J4EA 2QR6A 1QAPA 2A4AA 4JN6A 5HNRA 2BX7A 1OYAA 2ZBTA 4H6KA 2G96A 4HNVA 2GJNA 3NQ7A 2WJZA 4FNTA 5LNSA 2EKCA 1DORA 4ZQCA 1SQ7A 1QR7A 3W1MA 3B0UX 5AHEA 3UWVA 2NWSA 2WNZA 1FCUA 3SSJA 4FF7A 3W2MA 1K8ZA 3KXQA 4YLWA 3W1LA 2GVGA 3I7SA 1FXQA 3LTSA 4MPQA 3TW7A 4D2JA 4DPPA 4CNOA 4MVAA 5DY3A 4ZMGA 2Y7EA 2EAWA 3SGUA 1TTJA 4GC4A 5AHNA 3HG3A 1VRDA 3NQMA 2NWRA 2ABBA 4WOQA 2Y7FA 4R7JA 2E77A 3W7OA 2DP3A 2FDSA 2QUVA 2YSWA 3FFSA 2DZWA 3DI0A 1JQXA 4AB4A 1X6UA 4DF1A 4WXYA 2HS8A 4KKXA 1QO2A 2J9YA 1AL7A 3STCA 2G97A 3LLDA 3LTPA 4EOUA 1KTNA 3UPWA 3LGEA 4JTLA 5F4WA 1GG0A 3W72A 2ZZ2A 4MZ1A 4EWND 5L6UA 1GZGA 3UZJA 2A2IA 3W70A 4O0KA 1HO4A 1SZNA 3NL6A 1LROA 3PSWA 3RLVA 1VCFA 1I2PA 1OX4B 1F5ZA 3L0GA 4JDYA 2QCCA 2ZRWA 5AC7A 1KV8A 3LHYA 2DORA 1LM1A 1OABA 4LRTA 1MEHA 4R53A 2X2GA 1MXSA 1MO0A 5I3IA 1EP1A 4UTTC 4BI6A 3N14A 1F2JA 3NQGA 3TMLA 3SR7A 3LHWA 4X2RA 3W7HA 1YTKA 1ZAJA 4UFHA 1QNVA 5A5WA 1O4UA 3M5ZA 2QAPA 3LRLA 2A85A 1I2OA 2DU2A 4YL2A 4LTSA 5BOOA 4ICNA 2NXHA 3M1ZA 3N2MA 5I3JA 3S1XA 2AGKA 4NU7A 3MYPA 5KITA 1CX9A 5EY5A 3O6CA 1XBZA 4OQVA 4FX8A 4UFMA 1FY6A 1I8JA 3DHFA 3IIVA 2FQIA 3SIZA 5FI8A 4YCOA 4GUFA 5EBUA 4C1LA 3GXTA 1N55A 1PS9A 5U4NA 3E12A 3HGRA 3ZWSA 1M5WA 1EUNA 1ZALA 4RKAA 2Y7DA 1JJKA 1EP2A 2VXNA 1O94A 4E0CA 4HPXA 4JTEA 3CIXA 1OVDA 5K9DA 4HNNA 3FKKA 1ICQA 1TSIA 2LLEA 3W6YA 3IGUA 3L9CA 4Y90A 4MYAA 1ONRA 4NX5A 2NXGA 1SU5A 3NA8A 2J9ZA 3TV8A 4Q33A 3TA6A 2VFFA 3M0ZA 4Z1DA 5D30A 4WXZA 3A5FA 1EB3A 1IXQA 1R2RA 3KOFA 2ZZ4A 4MY1A 1I2RA 4JYDA 3LOTA 3P67A 1TV5A 2B4GA 3GZ3A 1OF8A 3M41A 3PBUA 2EHHA 5TBOA 3QFEA 3S1VA 3EX3A 4FO4A 3WK1A 2NLIA 1GJPA 3NYZA 5KMYA 5LNVA 4AWTA 3G24A 3I6RA 1FDZA 2GOUA 4TMCA 3GYEA 3MUXA 3L21A 3LRMA 3GDMA 3C52A 4OBTA 4WQ6A 3QQ1A 3BG9A 1P5BA 4Y96A 4JTHA 2A1YA 4OV9A 2JK2A 5C6MA 2CLLA 3GKFA 4TX9A 1G4PA 1QCWA 1E51A 4GUIA 4IMCA 5CZJA 3QJAA 4FB7A 3LBCA 4OGZA 1VYPX 1NVMA 2YGYA 2WO5A 3UPBA 3ZFHA 1YDVA 4UTWA 4LT9A 1U83A 3LCWA 1WYIA 2WV8A 2VKZG 4NJKA 4LW7A 1GYLA 2C16A 3P7YA 5CSSA 2QKFA 3F4WA 1L2UA 3OVQA 4RJEA 4BWLA 1OHLA 3LHVA 4E38A 3IIPA 4LC6A 1SFLA 3BARA 3R89A 4DF2A 3W74A 2GQAA 5FEWA 4UTUA 3RF9A 5DCBA 3CT7A 3W07A 3F1QA 3PG9A 2WKJA 3GK0A 3TQVA 1EA0A 1GEQA 3W73A 3DI1A 2PCQA 4MOZA 2VEKA 4K37A 2GPTA 1TPWA 3HG5A 1RVGA 1K7FA 2QCHA 2WNQA 1SR9A 5CGQA 4AF0B 1SZEA 3ABRA 4PCFA 3DFOA 4CLMA 1QO5A 1H7RA 5DY2A 3TAKA 3TXZA 1Q6LA 2QUTA 2JKAA 1U5JA 1LP6A 3L65A 2QCNA 3A23A 3O8AA 4YXGA 5I3GA 5IM51 1TV8A 1X1ZA 3P8IA 5FEXA 5LNWA 4O57A 1IGSA 4A22A 3BVJA 3B0VC 3MBDA 1WX0A 3LI1A 1GT8A 4JS3A 3GNNA 5D03A 4DBDA 5KZEA 4Q4KA 4DPQA 4NXSA 1PHWA 3B0PA 1K7EA 3SJ3A 1V5XA 2WNNA 1ME8A 1BTMA 2J27A 1DJNA 3G1FA 1YADA 2X16A 3JS3A 3G1VA 3PM6A 1EP3A 3IIXA 1TO3A 5EMUA 3A24A 4XZ9A 1UB3A 4RR4A 3NG3A 2G5WA 4WZHA 3W88A 3FIGA 4Z1AA 1WV2A 1H50A 2AQWA 3G1DA 2E5CA 3G3MA 2DJXA 5MHBA 3M9YA 4IPIA 3BLIA 5H2ZA 1BWLA 2EF9A 3R8RA 3S1UA 3TC7A 5C5YA 4RZ6A 3R2GA 2YCEA 4UTHA 3KVLA 4O1BA 2V5BA 3C4UA 2NV1A 2QCGA 3MHFA 4KWWA 1A5BA 4UTTA 1X1OA 3BGJA 2ZCGA 2PRMA 3KVKA 3T7VA 4UTKA 2QEZA 4WY0F 3RNDA 4BK9A 3ABQA 1W1ZA 3C2EA 1NAL1 4AXKA 1GQNA 1ZAIA 4JDBA 3S5OA 4I7WA 5D04C 2CLEA 3E9AA 3GR8A 3N9RA 1JCLA 3N19B 1YYAA 1F74A 5C2XA 3C8FA 3OEXA 4MY8A 5AHFA 3I7QA 4PFMA 4NNAA 3WJYA 1NSJA 3VFLA 2XFWA 3H53A 3C61A 4GJ1A 2B7QA 1AMKA 1S3HA 2Z2UA 3HQ1A 1XUZA 3U2OA 4PL2A 2OMAA 2HMCA 2KZHA 2X30A 4HPJA 1VZWA 1XCFA 1TJPA 3W76A 1PV8A 1C29A 2RH9A 4BI5A 1LRNA 4EF9A 3EKLA 3KAOA 1ZENA 1ZCOA 1EWDA 5DBTA 3TFXA 3EX4A 2ZA1A 4Z1CA 4HT3A 1A50A 4ALDA 4H4IA 4LS2A 3KRUA 2YYUA 4XBSA 4CCEA 3BG5A 4QIUA 1Q3NA 4XKYB 4HIBA 3UWWA 1XUUA 5G4EA 4NJHA 2C19A 1G6CA 1LOLA 2YPIA 3ATYA 4JX5A 3UY8A 3MWAA 3Q37A 2P1FA 4Y8FA 5IBXC 4ADTA 2RHGA 4S2BA 2VFHA 3G0SA 2V0TA 2Y61A 2QJHA 2BLEA 1B3OA 3GDTA 4JGDA 2VOMA 2A7NA 1H63A 3EXSA 4JY8A 3LM7A 1EWEA 2R14A 5G2IA 3L68A 1XL9A 1TRDA 4NQ1A 1D9EA 5G2WA 2P0OA 3CIWA 4NXKA 3PR2A 3W7GA 1M6JA 3W2KA 4JICA 1X7FA 2FB3A 5D33A 4Z0JA 1Y0EA 1HL2A 5K9CA 3W1QA 3PUDA 3W7EA 5F2LA 4HNTA 4YCPA 4Z08A 5BMXA 5LKYA 2CLMA 4X3ZA 4AEOA 2DZVA 3W7IA 2Y63A 3QZEA 3OBKA 3T55A 3FS2A 5BNKA 3NZRA 1YPIA 3DH7A 3N2XA 2CFFA 3NVTA 5F4XA 1PVNA 1QOQA 3QQ0A 1EIXA 4A3UA 4O19A 1FWRA 1Q45A 4WUIA 2A6LA 1TPFA 3CWNA 3GLCA 4DO5A 4KWVA 1L9WA 4HSNA 4UTLA 5FESA 2QF7A 1VGAA 4QJ1A 4UR8A 5HR7A 3PF3A 1B9BA 1SO3A 5EPDA 2ISWA 1JUEA 4UMCA 4MJMA 3JRKA 3QF0A 3GAYA 2NUXA 4O10A 5DCDA 1GVRA 1OK6A 3TX9A 4TU1A 3CWOX 1YXCA 3PSVA 3STFA 2I1OA 1KV5A 2ZZ3A 1C8VA 4CNPA 3NL2A 5AYZA 1OFRA 1XBYA 2JKPA 3NPVA 5L9FA 5G4WA 1AL8A 1PHQA 3ABOA 5FF7A 1OFOA 3TUUA 3B06A 3HPSA 1DVJA 4UTIA 4JXCA 5F2IA 3BG3A 4M7TA 4ZQOA 3NL5A 2OCZA 1YDOA 3WJXA 3MW7A 4NX0A 4DEFA 2CZFA 1H7OA 2Y6ZA 1QWGA 1K8XA 1AW5A 3I65A 3NO5A 3LCIA 3QSTA 2ATMA 4HKPA 5HULA 3TXVA 1FX6A 1N8FA 2Y62A 2H8ZA 4Z1BA 3BO9A 2B7NA 5GVJA 4O1DA 3GDRA 5CPMA 1KW1A 2WPBA 1LBLA 3MP3A 2R94A 2RDUA 1FWTA 2J9XA 4FXRA 1H62A 3UXAA 5AYYA 4QNEA 3FJLA 1QPRA 3L0NA 4RZ4A 3UQNA 5G5IA 3FYPA 4A2SA 3PVFA 3KVMA 5HWMA 3M5VA 3W2JA 4L4LA 4P61A 3H54A 2XN0A 2YDAA 1VLIA 4N2YA 1YPFA 3KX6A 3F03K 3QYQA 3W7RA 3LX9A 1VYRA 4BFAA 4O14A 2ZTJA 3GX9A 5KZMA 1ICPA 1Z48A 3HJZA 4IQLA 1O5XA 4LWWA 2C6QA 1W3IA 3CQ0A 3NQFA 3EWXA 3IGXA 1F6KA 1KFKA 3I7RA 3W1PA 4Y6GA 1K8YA 1NF7A 3T40A 3IVSA 4RK8A 1R30A 4UIOA 3DFPA 2Y70A 4O1CA 2AAMA 3PUOA 5H91A 2WSRA 4O54A 3V75A 5HWJA 4IPJA 1SO4A 1L6SA 3W7LA 1DV7A 4GFSA 1A5AA 2QCDB 4IX0A 8TIMA 2VEIA 3A21A 4JD4A 4UNKA 1OFDA 5D05A 4A2RA 2YZRA 1FBAA 1H7PA 3EB2A 3EWUA 1SZGA 3WJWA 3GR7A 1D3GA 3IIOA 4PTNA 3MO7A 1FCVA 5CPOA 1VCVA 1I4NA 3NQ6A 1XKYA 4JR5A 5AC8A 1LOSA 5D2TA 3G8RA 1SW0A 1H61A 4K39A 2FJKA 5K7JA 1TCDA 2V81A 4K7VA 4PL1A 3CHVA 3EX2A 3P81A 5AC6A 4CQAA 2E6FA 3L66A 4ZZ9A 4ORMA 3W1NA 4I7UA 3ATZA 2ZQ0A 1WBHA 4AVFA 3KHJA 2C3ZA 1TPEA 2B7PA 3BK0A 2H8XA 1G7VA 2EPHA 3LB0A 3LXAA 1Q6RA 3M6YA 5A8GA 2W0UA 3G18A 1ZY9A 5IBXA 1Q6QA 5TIMA 4ZQNA 2GUUA 3F4NA 4UMAA 4N9BA 4CQ9A 2E09A 1F73A 1R2TA 5EA9A 1H60A 3W85A 2CW6A 4PC8A 1Z44A 4N9EA 1TPVA 3GDKA 2BSLA 2ZA3A 1W0MA 1JQVA 3QW4B 3HPXA 3JR2A 3HB9A 4O16A 4O0ZA 2CLOA 3VKJA 4JIQA 2XN1A 3BLFA 4UFJA 3PWAA 1K7XA 2ZTKA 4JTUA 2QCLA 1FWSA 5D2WA 2QJGA 3QW3A 5BW6A 1P0NA 3BV4A 5C54A 1KFJA 3D0CA 4OHQA 4GRSA 5KSWA 3PB2A 5D2VA 2VC6A 1H7XA 2W79A 3LERA 4MLRA 1TREA 3C6CA 5D38A 3GVGA 3Q2DA 3B4UA 3QH2A 1H5YA 1PIIA 4NJGA 1VYSX 1HTIA 1IXPA 3LHZA 3TJXA 1KFLA 3VNDA 2ZZ5A 3HOJA 4BF9A 2NXIA 3MBFA 5G1TA 3UY7A 3L5AA 3NL3A 4JX6A 5FEPA 2ZZ6A 4QAIA 3R12A 2I14A 2A7RA 1FDJA 4WJEA 4LVFA 2FFCA 4FIQA 2VEMA 3CPRA 1ZAHA 3GKAA 3ZWTA 3DENA 1R47A 2A5HA 1GYNA 3NQAA 5FF2A 3UYCA 2ZDRA 5LSMA 4N4PA 1TMHA 1O5KA 3SECA 3IRDA 2Z1BA 4UFIA 3MJYA 1W8SA 3S1WA 2HTMA 4LC8A 5FEZA 3TJLA 4EIVA 5LGXA 4N4QA 3V1PA 2PRLA 3LCXA 5K4ZA 2R91A 4JYEA 3C2OA 2G95A 3HO8A 3HG4A 3M5XA 3TCEA 3VE7A 1TJRA 1TYGA 3KVJA 2X1RA 2V8ZA 4L4MA 2ISSA 1J2WA 6ALDA 3NDOA 1TIMA 3MP4A 2H3BA 1GVOA 2VFIA 3W7MA 1XBVA 4X22A 5DLCA 1DL3A 3G1HA 4U4MA 1THFD 1AG1O 1VR6A 7TIMA 3W7DA 5KZDA 1TQXA 3GNDA 4NNBA 5G2HA 3UWQA 3EEGA 3QSRA 5CZSA 2QCMA 1ADOA 2E6YA 3RU6A 3W2LA 4KFOA 1TTIA 3LCFA 1OX4A 1UJPA 2ZRXA 1YTDA 3B8DA 1OJXA 2FTPA 1WBJA 5D02A 1DQXA 1JRBA 3O6YX 3DHDA 1UCWA 4JTJA 1JULA 1PCKA 2NUYA 3ZS4A 3P61A 3MHUA 3P8JA 1GVSA 1H1ZA 2DZSA 1ZFJA 1OYBA 3UZ5A 2O7QA 4JIPA 1M7PA 3B05A 3TQ0A 2A21A 3QMTA 1RD5A 3N9SA 3LHUA 2ZRYA 4JTFA 4OV4A 1GTEA 2FIQA 3SFKA 3C56A 1RZMA 3USBA 2PC4A 4DQWA 2Q8ZA 4O12A 5EL1A 4WOZA 2Y85A 4AHQA 2Y7GA 5CPLA 1RV8A 2HS6A 3GAKA 4G1KA 1ZHAA 1SO6A 1KM5A 3TAOA 1T8XA 2OZ0A 1OF6A 4TO8A 4TIMA 1W5OA 3BGGA 4LU0A 1LCOA 1CW2A 3N3MA 3THAA 2Y89A 3EWBX 3PULA 3STEA 5G1YA 1RQEA 2ABAA 1P4CA 4UUIA 3L5MA 3DKJA 1SPQA 4GBUA 4ZQRA 1B57A 3DFNA 3MI3A 3SZ8A 4LNYA 3O07A 1TQJA 5SWUA 3IVTA 3LCHA 2TRSA 3NQCA 4I7VA 1S5VA 1KFCA 1VS1A 3C3NA 4JNMA 2UV8G 1OFPA 3C2VA 3DU0A 3G22A 3TSDA 4JYFA 3LI0A 3EWZA 3E0IA 1FWNA 4IMFA 3HG2A 3QMRA 3THQA 3HBLA 3UD6A 4XBKA 4IUOA 3O16A 2FPYA 2X1TA 2NV2A 4OT7A 4FX6M 2PRHA 2B7OA 4MY9A 2GJLA 1LBFA 1DKWA 1SSDA 5F2GA 5HQEA 4PEKA 4EVZA 4DXVA 2TYSA 3W1XA 3WJZA 3S0CA 2CU0A 2ZZ7A 5AHIA 1K3UA 1TRIA 3QPZA 1FWWA 3UWZA 3W71A 3NQ8A 1HUVA 2ALDA 2GQ9A 3UWUA 4RX0A 5D09A 1VHCA 1WDWA 1JRCA 1GG1A 3C2RA 4Q32A 2Z0IA 3W7CA
chains in the Genus database with same CATH superfamily
3RO8A 2WVTA 2BOEX 2H9AA 3NQDA 3DAQA 3B03A 2BVWA 1B3YA 3NPXA 3QOMA 4J3ZA 4E2OA 4ENLA 3W75A 1E9ZB 4GI4A 4MADA 2Z1SA 4GVIA 1J5TA 3LZ3A 3BQ5A 1W3NA 3G1YA 2VZTA 2FTYA 2BY1A 3M47A 3WLLA 1R5YA 4XTDA 3W4RA 3R0UA 1MXDA 4JTRA 3P84A 1XSKA 4AZCB 5CKSA 2XINA 2AMXA 4W93A 5AC4A 7PTDA 2DSKA 3T07A 3VIJA 3WUFA 3GVRA 3QRHA 4F2UA 3S1GA 1ODUA 3UBPC 1QMLA 1K4GA 2EEXA 1TZZA 5HXMA 1W5NA 3AXIA 3MVIA 2A0NA 2ZX7A 1W1YA 1K02A 2YFNA 3KRSA 4B9ZA 5JBFA 3W6LA 1XLCA 2D3LA 1Q13A 2D73A 4HN8A 4LAZA 4KEVA 2WMKA 1ISYA 1NDVA 2O55A 4IIHA 3FLUA 1F6YA 2OZ3A 2J6VA 3N13A 4R5EA 4JKMA 3EWWA 1QFEA 2FHFA 2X1UA 2QS8A 4PH6A 5BMWA 1TV2A 4PMUA 4L9ZA 1JYWA 2J88A 2WCAA 3NO3A 2EGZA 1L6WA 3EOSA 1E55A 3OA3A 1WQ5A 1KFEA 3FA5A 2OT1A 1UA7A 1ISZA 1SGJA 1G4TA 3EDFA 4HZ7A 1PIFA 4B5XA 4C6BA 3DGRA 5HJLA 2BXVA 3SY5A 2V5JA 1R86A 1KGXA 2V67A 3AU6A 3VPLA 1V3HA 4D8AA 4BEQA 3O15A 4DNMA 3BTNA 4GWEA 3E5PA 4DJDA 5GQBA 4R7WA 4KIEA 2OQLA 3NWRA 3CEPA 4J9JA 1JD7A 1R3VA 3NQ2A 1CXLA 4MNMA 1A5SA 5GJPA 4MPKA 5I3DA 5AYXA 4CQ8A 3RXZA 5EMYA 3WNPA 8XIMA 3VDHA 4EAMA 1IEQA 4HJWA 1WOAA 3P60A 1GPFA 3M0YA 1E43A 4UQCA 3SN4A 5IRPA 3NM1A 4S2CA 2PD5A 3RPMA 2IKGA 1EJTC 3B40A 1IGWA 1K1DA 1DHPA 2DQXA 2VEPA 4YYFA 4IIFA 3T81A 1N8WA 2WSKA 3CQHA 1VQTA 1D3CA 3M7SA 5FJRA 4MSSA 3FAXA 5T9CE 1BPLB 3WNLA 1XI3A 3CGTA 3Q65A 4G1NA 3TIMA 2G3MA 3UR2A 3G1XA 3G8EA 3KLKA 4QSHA 4HN4A 1U22A 4CU8A 4EWJA 2ZX8A 2I7GA 3NM3A 5AYIA 4NZJA 1WAUA 1QJWA 3KTXA 4O52A 3KS5A 2OB3A 3GXNA 4I6KA 2I9EA 3RAOA 5HWNA 3LYEA 1REQB 3S9ZA 2PZNA 2BASA 4UR7A 2V5LA 2OWCA 2DT1A 1RQBA 4QEEA 3SCRA 5E6ZA 3UGVA 1OX5A 1UH2A 1UZHA 3O63A 3F2CA 2XFYA 3P5ZA 2Z1XA 4JTTA 3SUVA 3S5NA 1TR1A 2EJ1A 1R9ZA 4ERGA 3PG8A 5E5CA 1PE1A 3FKRA 3GB6A 4MFEA 3AIVA 3NPWA 3TQPA 1QUMA 1YXYA 1FWCC 4ML9A 2NX1A 1WZLA 1DTUA 4FXSA 2XIBA 4IFRA 5TAOA 4BI7A 1EOMA 5FOOA 4XX6A 1KLZA 4X9SA 2NUWA 5DT5A 3G0UA 5I3FA 3TYCA 3GUWA 2OLAA 2XM2A 4JKLA 3RMJA 2REQB 4MF4A 3AI0A 3FNDA 1SVDA 2MANA 1JFHA 3VIFA 1OT1A 4PGLA 3W1AA 4HA0A 1BXNA 3S2CA 2QVHA 4AD5A 3RCYA 2J7DA 3MYOA 4A3HA 2EG7A 2INFA 1PCWA 3WNKA 2BY2A 3DFSA 1MZRA 3GIYA 2C13A 3V5FA 3BLEA 3VNIA 3OVPA 4K8GA 4AWUA 3UXDA 4NVTA 3CJPA 2IQTA 3INPA 1YE4A 3WQ4A 2OFJA 3M5YA 2ZC8A 3OZPA 4LS1A 4ZVJA 1F76A 5LIKX 3EX1A 5CC7A 5M1TA 5CC3A 5G4HC 2VX6A 1QOXA 3L67A 1PWLA 2JEQA 3LGGA 4O13A 3KBNA 4RZ5A 4OKDA 1GVFA 4DBEA 2ZA2A 3HFYA 1CT5A 1ZJAA 3KCLA 1JDAA 2X40A 4RXFA 3PS7A 1KM2A 3AXKA 2E8YA 1TMQA 1R85A 2DSUA 3DDMA 4QFUA 4IOTA 1HQTA 2E6AA 4IP5A 4CNNA 1XQLA 1ZL1A 3MJMA 4AHPA 2A3CA 3W1RA 3K8LA 1IF2A 4H9TA 2FLIA 3HIJA 3CH9A 4O4WA 4FNPA 3P80A 1WXYA 4GISA 4B92A 4PMNA 4CCCA 5IHSA 1XISA 1WDSA 4FF5A 4QBXA 2NT0A 1ELSA 4AG0A 1KCKA 5E0KA 4LRSA 3O7UA 4P7RA 3FJ6A 4PUEA 4AY1A 1PX4A 1VFFA 4TMBA 3FHAA 3WF3A 3W53A 5KINA 3IJ9A 3SRKA 2GUYA 1YTEA 4I6VA 3VKKA 4GY1A 1S5NA 4B9YA 4LNCA 4HOWA 1JYXA 1FCQA 4Y2WA 2VNCA 1OIFA 2Q3OA 1E3XA 2RDWA 2HDJA 1KLYA 4NZ5A 1NTHA 1U1HA 1ME9A 3CUXA 4KEUA 1G7UA 4HU3A 4FHAA 3GSMA 3GD6A 3R5EA 3BZJA 3HQOA 1CGTA 3LLXA 4UQ9A 4GQQA 1O95A 1F6PA 4J3XA 1PZ1A 1ONXA 4HD5A 5HUOA 2CLHA 5A8QA 1VLWA 4C6EA 2O9RA 3HM7A 4QITA 1XG4A 3D3AA 4UTJA 1GQKA 3RGTA 4ZODA 4UBPC 3VCRA 1LRQA 4PBEA 1XF0A 5EKYA 2O4QA 2QPXA 1IWBA 1TA3B 2C1HA 2PWGA 3STGA 1AQFA 4CD7A 1EHNA 3IIZA 2JALA 4XD3A 2GDUA 3OO2A 2OU4A 5ECUA 3N73A 5ABGA 1QW8A 1W3KA 4ZE4A 1KM6A 2R9RA 3U7BA 1VP5A 4F2TA 1QPQA 3WCZA 1IQ8A 4QHRA 2UY4A 3GDLA 4AIEA 2YL5A 1E9IA 5H8UA 1MW3A 3S6OA 3MSGA 4QISA 4N0RA 3IARA 5AOUA 3OOQA 4ONVA 1BYCA 4L9XA 4XAYA 5TQLA 3Q94A 3WD1A 5XIAA 3ELFA 1QPNA 3AALA 3LSCA 2ZRUA 2WLZA 3NEVA 3K4AA 3LN3A 4IX2A 1CZ1A 4FXJA 1LLWA 1W31A 1E1CB 4WVXA 1NOUA 3WH8A 4K8EA 3LMZA 1OYCA 1X38A 1TMLA 1RQHA 3SW6A 4O8RA 1CBGA 1C9WA 3ECQA 3ARZA 2YW4A 1V4YA 2V3FA 3LRKA 1XPYA 4KFNA 1RPKA 3VGFA 3NXFA 2H90A 1CNVA 5XINA 3WD0A 2RUSA 1W54A 1Q6GA 2Z25A 1NOWA 3U4AA 2WAGA 4L6DA 3TDFA 1LDCA 1TUXA 3VUPA 1MW0A 1JDFA 1IT7A 4K36A 2PDPA 1MMFA 1EQPA 1OCQA 1WZMA 4JEJA 4PMRA 3NZGA 1HJVA 4M6UA 3WLNA 4OE7A 3NGJA 1MDLA 3AZTA 3LBMA 3CAWA 2O7SA 1J4EA 3P14A 3SQMA 3V5CA 3WQVA 3KP0A 2FGZA 1QAPA 2A4AA 3OW1A 2BX7A 4WCJA 1XLIA 1OYAA 2ZBTA 1QWKA 2GJNA 2WJZA 1CLVA 4ZQCA 1G1YA 1AQMA 4ASTA 5I03A 4H9YA 6PTDA 3UWVA 1RBAA 4F9JA 2ZOXA 1UR9A 1OWQA 3SSJA 4DRSA 1JXJA 3W2MA 3DG3A 2D69A 1PAMA 1XG3A 3O0FA 4HHLA 3LTSA 3FXYA 3KWSA 4O8AA 2Y7EA 4MNLA 3V0UA 1VRDA 3NQMA 3PHAA 4WOQA 4S3FA 3E0WA 3LQGA 3W7OA 2DP3A 2FDSA 5AZ0A 1J10A 4JFUA 2W4XA 3FGCA 3VDGA 1X6UA 1J0HA 1D8CA 5DO8A 1MXGA 3WLMA 1DIKA 4CNUA 4DF1A 3GXIA 1ITXA 1LF1A 3U4FA 1QO2A 3VMOA 4Z42C 4FP1A 1V3KA 4K1GA 4EOUA 3LLDA 3E1F1 4IIGA 3UPWA 3LGEA 3NDZA 5F4WA 3SDOA 4EWND 5L6UA 1EDQA 3W70A 1HO4A 4C6MA 3NL6A 4S3KA 3B9NA 1EJXC 1Q7MA 4RNJA 4MJ4A 1B3XA 5JH1A 3TOPA 1F5ZA 1GOIA 2CITA 4JDYA 2QCCA 3T8LA 2QMJA 3CYJA 2DORA 1XHGA 1MEHA 1K9DA 5I3IA 4AC7C 4BF5A 4IF2A 1YTKA 1QNVA 3QV6A 1O6IA 3PK7A 3BLDA 2A85A 2WMIA 4J40A 2PP0A 5I3JA 1IYXA 4REQA 2WM1A 5KITA 5LIUX 4GZJA 2C8NA 1FY6A 1I8JA 3F4VA 2DUZA 2FQIA 3SIZA 3O6AA 3FV9A 1TE6A 5EBUA 2OR2A 2E7FA 3GXTA 5U4NA 3GXMA 4A35A 3PFRA 2NLYA 1A0DA 2QUNA 1M5WA 4GACA 1EUNA 3UZYA 4PEEA 1EP2A 1O94A 2WMFA 1RCQA 1BVWA 4M8UA 1CXKA 1OVDA 5H6HA 3W6YA 3IGUA 4YTRA 2YCLB 1ONRA 3GVWA 4Q33A 2WLYA 2VFFA 3M0ZA 5D30A 4PUWA 4WXZA 2W63A 5F7UA 1EB3A 3I10A 1R2RA 3MZNA 4W8BA 1I2RA 3LOTA 5A6LA 1EDTA 4NG3A 2VCBA 1CGUA 1O5QA 3M41A 2V3GA 2EHHA 2GGJA 3PJUA 2ANUA 5I7GA 3B8WA 2NLIA 4QLJA 1XV8A 3KBJA 1SMAA 4C6OA 3CMFA 2Y8KA 3C52A 3UA4A 2WXDM 2QULA 4P7OA 5CC5A 3ZJKA 2F38A 3N6QA 1US2A 3GC2A 4KWUA 3BSHA 1ZUAX 3P2VA 2JK2A 1G4PA 4D71A 1QCWA 5A2BA 3BE7A 1FFRA 3MPGA 3PZ9A 3CHCA 5CZJA 3LBCA 4U5IA 4OGZA 2H9AB 1E4MM 2VR2A 3CV6A 1JPHA 2G0WA 4J2PA 3HQPA 2E9LA 2HQAA 1AZ2A 1GYLA 3GBEA 4C6NA 3LM3A 2C16A 2QKFA 5GPRA 2NVCA 1L2UA 4BWLA 2W62A 4AVOA 3O3RA 3R7MA 3VMNA 4AY7A 3IK2A 1DWIM 4LC6A 4HP5A 4DF2A 5FEWA 3RF9A 1XRVA 2DSWA 5DCBA 3W07A 3PG9A 2WKJA 3W73A 4S3GA 2PCQA 4MOZA 1IEIA 2XVGA 3AZSA 3U5YA 4UQBA 5IHRA 4AF0B 3ABRA 4ZO7A 3H2NA 1U5JA 4J5NA 3PN8A 3A23A 4X61A 5IM51 3BURA 4IJCA 5FEXA 4KCWA 3VM7A 5HA7A 1J6PA 1XP3A 4I9MA 3BVJA 3MBDA 1UP3A 3W28A 1RVKA 4GXWA 4TUFA 4NXSA 1PHWA 3NGFA 3MKCA 1K7EA 4JHOA 1G94A 5H8PA 1BTMA 1DJNA 3N04A 1ISXA 5JMUA 3PPFA 2V38A 3A24A 3WO8A 3E6EA 4B91A 3NG3A 3ZXWA 3T8QA 3VOCA 3KL5A 5C2CA 3CZLA 3MU7A 1XLGA 3EMCA 5CZKA 3H2FA 3MUCA 4IPIA 2HE8A 3WBWA 4NRRA 1T5AA 4UR9A 1UQYA 3R2GA 2YCEA 3RHGA 2NV1A 2QCGA 3MHFA 3BGJA 2ZCGA 1Y5VA 4UTKA 4BK9A 1W1ZA 1OC6A 4Q8TA 3PZVA 1T41A 1NOFA 4PTXA 2G4FA 3N9RA 2DQWA 4FR6A 4ERAA 1YYAA 5C2XA 3C8FA 5AHFA 3BCFA 4PFMA 3WJYA 1NSJA 2XFWA 5ENLA 4GJ1A 2B7QA 4CCZA 2OMAA 4XVDA 4HPJA 3GTNA 1XCFA 2W61A 1TJ0A 3GVVA 3W76A 3S3GA 2RH9A 5A3HA 1LRNA 4EF9A 3EKLA 1VBUA 1FP8A 3AMGA 3OLGA 3ZJ7A 5DRCA 3QKEA 1PEZA 2OLHA 1XLLA 3FDGA 4H4IA 4HVXA 3BG5A 4TTUA 1Q3NA 4J28A 5FSDC 1XYLA 7A3HA 3CHEA 3DCPA 5FJJA 1XUUA 3VINA 3EPMA 3UY8A 3MWAA 2P1FA 4Y8FA 4ADTA 4S2BA 3GC5A 5JIPA 2VFHA 4WR3A 5HPOA 3WNOA 4PBGA 3GDTA 1CXEA 1BFNA 3EXSA 2R14A 1XINA 1XYCA 3K1DA 1A0EA 1GNXA 4WDWA 3L68A 2R82A 3U57A 4XAPA 4C1NA 4L6OA 1AJ2A 2PTWA 2DSVA 2P0OA 2ONEA 1M6JA 2VRKA 2YA1A 3W2KA 5C71A 1KKRA 3AROA 1GQIA 1X7FA 2FB3A 3R0KA 3JZUA 4FK9A 1EA9C 3PUDA 1MVYA 3W7EA 9RUBA 2CLMA 3TZNA 3FS2A 2F9RA 3DH7A 1UIPA 2ZUVA 3N2XA 2CFFA 3V7PA 4B2DD 4CN1A 5F4XA 1FOBA 1PVNA 1QOQA 3QQ0A 3S9IA 1Q45A 3GTXA 2FGLA 1L9WA 4HSNA 5FESA 2QF7A 1W32A 3FVDA 1VBRA 3AISA 4Z2GA 1B9BA 1SO3A 1E6XM 1JUEA 4MJMA 1BSLA 1R3RA 3S4TA 1QI2A 3AYSA 3CWOX 1YXCA 4GQRA 5BWFA 1KV5A 3NZPA 3W27A 3NL2A 4J3TA 2PGWA 2R6OA 1I6NA 5FF7A 1OFOA 3TUUA 1TV3A 2AL2A 1UWQA 3GU1A 3RU8X 3AZRA 1CXIA 3EZ4A 4M7TA 4ZQOA 1A5UA 3WJXA 4HU8A 3GFZA 1GGOA 1J6OA 4ERIA 2G50A 3S47A 4DM1A 1O7AA 4HKPA 3MANA 1EGVA 1N8FA 2Q01A 4AYSA 2H8ZA 4Z1BA 2XVKA 4X63A 4PMVA 3I4KA 1UA3A 3MKKA 5BOEA 5HNNA 4YN5A 4RZ4A 4GY7A 2E4TA 4A2SA 1TVNA 2WWDA 3ERPA 2DGAA 3DEQA 4L4LA 1T6MA 5JBDA 2XN0A 3OBEA 2YDAA 2J7EA 3BH4A 3GX9A 3IGHX 1H1NA 1O5XA 3K2GA 3VKDA 1HKKA 1NF7A 4RK8A 3DFPA 3UR8A 4GX8A 4EE9A 2CERA 4O1CA 1X6NA 4L1WA 3SSZA 1C91A 3V75A 4PN2A 2YIHA 3W7LA 1DV7A 5MF5A 1UR8A 2Q09A 3SCTA 3RILA 4JAWA 1XH0A 4W7WA 4U2ZA 2WYSA 3ISIX 1EOKA 4HTBA 4KRUA 3AIUA 1JZ8A 3TLLA 5AC8A 1EJRC 4GQ0A 1MQQA 1B54A 2WVUA 3S5SA 1GHSA 2JF6A 4MKVA 2Y2WA 2IS7A 3GHUA 2XUCA 3RIKA 4XBJA 3VD3A 3O9NA 1R6WA 4PTMA 2B7PA 1KCXA 3VNKA 3LXAA 2HK0A 5A95A 1SFTA 4UOZA 2W0UA 2ZUNA 3VIKA 4UOQA 3VGBA 2PDUA 1R2TA 1M3UA 1RAKA 4PC8A 5DMNA 4N9EA 3ZVIA 1E5JA 1UMYA 4XZWA 1R9XA 4HA4A 2P50A 2Y8UA 1Z3NA 3CUGA 3HB9A 2XN1A 4E6MA 2QCLA 2NVAA 4LAKA 5HQMA 3WX7A 2VR4A 3U5UA 3AHVA 4C60A 4JIIX 3D0CA 4ZO9A 6TAAA 3UZZA 3LERA 4PZVA 5A6JA 3DBNA 1X7IA 1TREA 5EB8A 1GW1A 3URAA 2XVLA 1H5YA 1HTIA 3PZOA 3W82A 1DQUA 1OY0A 1AH0A 4WDTA 5A6SA 3HOJA 2NXIA 3MBFA 5CEWA 3L4YA 3N2OA 4QAIA 3LENA 1L8PA 2I14A 2WZMA 4D1IA 4F8XA 4F66A 3LEPA 3I3EA 1AJZA 2ZE3A 3GKAA 1OGSA 1I1WA 1JZ4A 2A5HA 1GYNA 3NQAA 5FF2A 1BG4A 1TMHA 2MUCA 4DWSA 4JTQA 5LIXX 8A3HA 2Z1BA 5E6YA 3T0DA 3BOLA 5CAHA 1UD6A 1W8SA 1ZBWA 4LC8A 3T1GA 2RDXA 1UKSA 4CEUC 1BGAA 2X2YA 3GQYA 3ITYA 5LGXA 3V1PA 2HE5A 2PRLA 4V1XA 5K4ZA 1XC6A 1QTWA 4JYEA 3C2OA 5I00A 2G95A 2HROA 4IL2A 4ZB0A 3W37A 4L4MA 5D4YA 1VFLA 4Q4MA 6ALDA 1EJWC 3UA3A 4NAFB 2DT3A 2XHYA 4X0VA 5ABFB 3RCMA 5EU9A 4TTGA 3G1HA 1AG1O 2UY5A 2VCAA 3SO7A 3FA3A 1ZGDA 3QSRA 1B31A 4PCPA 2QCMA 3PTQA 1ADOA 2YDRA 2E28A 2E6YA 1SJAA 1GVEA 1HGWA 1TTIA 3LCFA 4P5UA 3RM8A 2Z1WA 3B8SA 1FWGC 2R24A 1LG2A 1WBJA 1IHIA 2BP1A 4XZIA 3BDKA 5DX7A 1XH2A 2NUYA 3ZS4A 3MHUA 3P8JA 2WZIA 5CGTA 3WLQA 1H1ZA 2GWGA 4ZCWA 2O7QA 3QY7A 3QMTA 2QIIA 3N9SA 3ZSTA 2PC8A 1WUFA 2OXNA 4JTFA 1WCGA 1K4HA 1GTEA 2IQDA 3J7HA 3OPSA 1ZRQA 3L4WA 3QQWA 1Z7AA 3E5BA 2DZBA 2Y85A 3L4XA 3FGCB 4H9UA 1NH6A 2E3ZA 1EF3A 3F5KA 3TAOA 4LJ3A 4KCVA 3HV8A 2Y1HA 4AISA 5CSYA 2OZ0A 3SCUA 3GU9A 1WDDA 1Q7QA 1E0TA 1U5VA 1O12A 4JN7A 1LCOA 1CW2A 3THAA 2VGIA 2Y89A 2ACQA 3PULA 4LFYA 3STEA 1NDYA 4ZQRA 4E8DA 4XAZA 1TQJA 2PA6A 1F4HA 4HBKA 1YDYA 3EBVA 2PDXA 3UXLA 3NQCA 4TV5A 1ONEA 1VS1A 4JNMA 4Q8UA 4K68A 2AAAA 1WNOA 3C2VA 3DU0A 4EP8C 2QT3A 2YCJA 3LI0A 2G8ZA 2WC7A 3GIPA 3CV7A 2DFAA 1GOMA 3D6NA 3O0KA 3DESA 3UD6A 4XBKA 3O16A 2NV2A 4FX6M 4YVXA 4DJEC 3NDYA 3R8HA 3EWCA 2PF0A 4FA3A 2WMIB 4EVZA 4DXVA 4JNZA 3WJZA 5AHIA 1TRIA 4Q4RA 3DYMA 1FWWA 3P0WA 1AODA 3W71A 1UR0A 3GNPA 1VHCA 5CJMA 1JRCA 2NQ9A 1J5SA 3ABSA 4GX9A 1W3LA 4GH1A 3LPFA 1GOXA 4S38A 3AO0A 2ZZ1A 5HR6A 1IZKA 3RLUA 1JVNA 4FOKA 3IJ6A 2F6UA 4LCSA 4MB4A 2CBIA 4GC3A 1WA3A 4MB5A 3T78A 2OX1A 1B4EA 1VPXA 1KRMA 3T09A 4N6FA 1RH9A 2CYGA 3G3DA 4JIRA 2IPWA 4RPQA 2YX0A 1BHGA 3IGSA 2CWNA 1QNPA 3P82A 3PJTA 4ZENA 3M4HA 2UBPC 4Q3MA 3OGVA 1JCXA 3VMPA 3RM4A 4S39A 5DN1A 1MDRA 1V93A 1V7YA 3BJTA 2VX4A 3ITVA 4B15A 3CB3A 1MSSA 4HU0A 3UP8A 4FLRA 5F1UA 3UYIA 3DECA 5J04A 3R79A 4LY8A 1DBTA 3WBXA 3PZIA 2P3ZA 4QQ3A 2ZVRA 1B4KA 1KM3A 3R43A 4LYKA 4EAYA 3VC6A 1PZ3A 1VFUA 1QASA 3QEZA 3W1UA 1CXFA 2QAFA 1QDSA 4QLKA 4ACZA 2DZPA 3NO1A 3IEBA 3TU9A 1FDYA 3LLFA 2XSBA 1L6GA 3BQ6A 4P2VA 2VL4A 4HZ8A 3DFTA 1S5WA 2V69A 1ZZMA 1TWZA 2PTZA 4RNHA 4Z0SA 2NZLA 6A3HA 1B9ZA 5BXRA 1W5MA 3POCA 4CNSA 1R7AA 1XFCA 3A3HA 4WKHA 4C6JA 4B5NA 1WZAA 3VAVA 2AKMA 1DOSA 4RV3A 2XIQA 2W91A 3KWXA 4C7FA 4GO9A 1HKJA 4UFKA 3VX0A 2O92A 3CL7A 1A5MC 3WH6A 3UCDA 2ZXQA 2CLIA 4XZMX 4AXNA 2VMFA 4ZL1A 1GJWA 1G4EA 3LZ5A 3WBYA 3EXRA 1T8QA 1M65A 1TPUA 2DUAA 4KH2A 1JCNA 4JIEA 5XIMA 3BZGA 4PA8A 5AHMA 3W7NA 2BVDA 3QR3A 2OYKA 1HJXA 5LGZA 3MUY1 4XD5A 2GWNA 3L5LA 1R2SA 5JUVA 3VYLA 1Q6OA 4J4KA 3YPIA 3UJRA 5J8LA 1AD4A 2NX3A 3KUMA 4PUDA 3A22A 4B3ZA 3NZ1A 3SUSA 2Z2AA 1EQCA 5CZ0A 1A53A 3DFQA 2GK1A 2I9UA 4HZ6A 4XKYA 1PDZA 2G3FA 4RE2A 2CZDA 1RP9A 3TNOA 3A4XA 4UFLA 2ZICA 4AD0A 4GI8A 5AVNA 2RJHA 4NRSA 5AZ1A 3BW4A 3GTHA 3HGSA 3TVAA 1SW7A 4Q4QA 1MEIA 1E15A 2Q8XA 1AMYA 4FZIA 4WKAA 4HGXA 2F84A 3EWYA 1FQ0A 1S46A 1W9PA 2F7FA 1UKPA 3BPWA 2ESCA 4B5SA 4QJ4B 1TX0A 5I2UA 5CGMA 1TPC1 1AZ1A 3SGZA 3IVUA 1T0OA 2VYOA 2Q3RA 1QHOA 3TKFA 5EFFA 1NF0A 3SFWA 4LAUA 2EPMX 3KDOA 5BRPA 1UUOA 2B31A 4F0HA 3PUEA 4QGCA 4ZXLA 3NIYA 1VF8A 4E2BA 5CH9A 4YTQA 1TPH1 1PXGA 2CLFA 4M1RA 1R46A 4C6FA 3PBVA 2ZE0A 1XR2A 2QXWA 1RR2A 1V0NA 3O1NA 4AWEA 1XH1A 2PWDA 1V03A 1WUEA 1GTHA 3LY0A 3KOYA 2J6XA 2YFOA 3AUOA 1OGBA 4H04A 3CB8A 3N15A 3N9KA 2XH4A 2A79A 4LEFA 2D23A 4LVDA 4AAJA 2JFEX 1SO5A 4AZ5A 1UD2A 3TH6A 3C2FA 4LCQA 2RFGA 2W9MA 1XW8A 4HOZA 2I5QA 4PSPA 3B8VA 4H2CA 5J5RA 3OU8A 3AHZA 4MZ8A 5BRBA 1W56A 2D0HA 4AFYA 1F4AA 2BY3A 3MI6A 4IGSA 4LOCA 1HZYA 2DZXA 1XSIA 2XN2A 4E2DA 4C1NB 3AMCA 1ZQ5A 4I8YA 1PUDA 2ISFA 1XDJA 1XGZA 2WWCA 3EMZA 4NUWA 4W9TA 3T44A 3ZLFA 3UCQA 1YHTA 1Q2RA 4GIEA 1JF6A 4BJHA 3QN3A 4QCFA 2Z6IA 4IPPA 2DIEA 3GO2A 3P62A 2HRWA 1UZ4A 2X09A 4UCFA 4V1YA 1A3WA 4O15A 2GZXA 3ARPA 4D6FA 2AMGA 3F5JA 4UWMA 3SRHA 4AHOA 4YMZA 3W23A 4IMDA 3LXCA 3M7WA 3G2GA 1GPWA 1BEUA 4GPNA 3R58A 1RK6A 1HFBA 1MWOA 5DMYA 2YYTA 4M3PA 1QI5A 4IQEA 2J62A 1XC4A 4ECLA 4H83A 3O05A 4V27A 2CC0A 1QOPA 1W5QA 1W1PA 2V82A 1ZBVA 1OX6A 4JTKA 1LZOA 2AL2B 3MB9A 1J8VA 1TPDA 4CCDA 1MNSA 3R13A 1BWKA 1PKLA 1B0IA 3AXMA 2RKXA 1YXDA 5D8WA 2XJ7A 4NZFA 1JCYA 3SN1A 5B7ZA 4UMBA 2P3EA 3Q67A 3VOIA 2Z7GA 5HPCA 1AVAA 1EPXA 3BW2A 3FEMA 2GFTA 3QM3A 4UC5A 2TODA 4RCXA 3LHTA 4KT2A 3D46A 1EJSC 3SY1A 2ZFAA 1TE1A 4IXXA 4HMNA 1ALDA 5A2CA 4LVAA 4L56A 1E4IA 1SZFA 4JPGA 4DJFA 2VC7A 1F05A 4IJBA 4JN8A 5HINA 1UUQA 3CC1A 3R25A 1DE6A 4I9AA 1Q8AA 3VX1A 1Z32X 5REQA 3RDKA 1IEWA 5C7HA 4XSMA 1H51A 1E71M 1F7BA 3KL3A 3W7PA 1VBHA 1I2QA 2OSYA 1F3TA 4G56A 4I9JA 1UQZA 3WDHA 3OG3A 1DPMA 1WKFA 1V51A 3CM4A 4GINA 4GIYA 1OC7A 2BWGA 1DXEA 4H8UA 1VHNA 4OU1A 4FNUA 2VUNA 2J24A 4MKNA 3TK7A 1TIWA 5FJOA 1OM0A 5K9XA 3W22A 1W2VA 4QAWA 4W89A 3UNDA 3S42A 3RUBL 4XZLX 3C0QA 4LUJA 1XX1A 3ENLA 3TR9A 3DC8A 1W1A1 4UXDA 2JGQA 3WK0A 1OK4A 1JZ7A 3ZT6A 4UTMA 2E68A 3M16A 1V3LA 1A5KC 4XTIA 4JTIA 1FTXA 2DVXA 3GM8A 4GHRA 3N34A 2A3EA 3TJIA 3OHMB 2NX9A 2EXOA 4A21A 2VX7A 4U31A 4YVVA 3UG3A 4H9VA 1T96A 3TYUA 3L2IA 2I16A 1XGDA 3GXFA 4IMGA 1IR2A 3HF3A 5T9BG 1M7JA 3OZOA 2OODA 2YXGA 2C7FA 1J96A 2QCEA 3DFHA 3DOPA 3VK5A 1LOQA 5IFPA 1RD6A 4B5TA 1IXOA 4EKJA 4HYRA 3ICJA 4LH8A 4GNJA 1W8GA 3NCOA 4IMAA 1EZ2A 3I3DA 3DG6A 2PD9A 1LL7A 1P6WA 2HVNA 2QUUA 3B9DA 1RA5A 3VUSA 1ZBKA 3TFCA 4EPBC 1HN1A 3TMQA 3I68A 3WMBA 3CU2A 3ITGA 4WY0B 3TE9A 1DQWA 2HJPA 2INEA 1KR0A 3UT0A 4RDWA 1UIOA 3Q4DA 1TTQA 4DI8A 2YKKA 2IKJA 1UZ1A 4FNSA 1M7XA 2QDHA 4H6QA 2V9DA 1F3WA 4HMCA 1R9YA 3CLMA 1CLXA 3F2BA 3BGAA 4UOJA 4JL1A 2E9MA 3QC3A 4K7YA 4EANA 2DV0A 4KESA 1GHRA 2OSXA 4UTWC 1B1YA 2A3LA 4OECA 4CQCA 1KM1A 1LBMA 2YCIX 3QR1A 2HISA 2X0SA 2IXUA 4C91A 3T6CA 4KQNA 5CPQA 4KIRA 2WANA 2W92A 3QPEA 3NTYA 3QPYA 3L23A 2V2DA 2DZTA 3LCGA 3ZR5A 2PU0A 2XZ9A 3WFZA 4JN6A 4DXKA 5M5DA 5HNRA 3GRIA 3TN4A 4H6KA 2G96A 4HNVA 5CG0A 5LNSA 2EKCA 3ZMRA 4QRNA 3W1MA 3TTSA 1KCLA 1WAWA 1FCUA 4NL1A 3KXQA 2IQ0A 3N2TA 3VKCA 4MPQA 5DY3A 6ENLA 1C8YA 1SR0A 2EAWA 1TTJA 3HPAA 3AOFA 1XSJA 1QATA 2A3HA 3PZQA 2NWRA 2ABBA 1UD5A 2XFFA 3CZ8A 3HJEA 3B97A 2CXGA 3PAOA 2JQXA 2E77A 3R94A 3UWEA 2QUVA 2YSWA 2C71A 4N42A 3VNZA 4RUBA 3WDQA 3LU2A 2NW0A 1UR1A 1HP5A 2HS8A 4KKXA 1LQAA 1P6CA 1UH4A 1ECEA 2CBVA 1DWHM 1KTNA 1VAHA 1R3WA 3ZVHA 1O68A 4E8GA 3M0XA 3UZJA 2VGGA 1HGYA 2WJEA 4I3GA 3M07A 1E0VA 4KW2A 1KXQA 3RLVA 2VC5A 1VCFA 3WQ5A 2OEKA 3PJXA 5HJXA 1OABA 4LRTA 2X2GA 3S83A 1EP1A 1W9UA 1N82A 4UTTC 4BI6A 2HNEA 4KMQA 3NQGA 3SJNA 3SR7A 1WB0A 3LHWA 3W7HA 3WQFA 1ZAJA 1PZ0A 4UFHA 4XISA 1E73M 3VNMA 1POJA 3ARTA 1BAGA 4R9XA 3SUWA 3M5ZA 3K5XA 2AL1A 2C91A 2GQ3A 4LTSA 2XSAA 4ICNA 5DQPA 3WBEA 3N2MA 3S1XA 3AS3A 5EY5A 2XH0A 1GVYA 3NSMA 4Z2IA 4FX8A 2UY2A 4UFMA 3IUIA 4KWSA 3SADA 3WMCA 3IIVA 4DJEA 4G7EA 4YCOA 4GUFA 3QTPA 2FYMA 2I57A 3NOYA 3II1A 1ZJHA 4US5A 1JJKA 4DJED 1LUCA 4JTEA 3UEQA 3CIXA 3FKKA 4IM4A 3QC0A 1ICQA 1TSIA 1VFHA 3VFCA 4Y90A 3NURA 4MYAA 4HPHA 1RUSA 1FHLA 2XYLA 5A8NA 3T4WA 3EB3A 4UZSA 4CKQA 1VRXA 4JOMA 3CAKA 4MG4A 1OF8A 3SBFA 3WMLA 1E6ZA 3QFEA 3S1VA 4D6IA 4FO4A 3WK1A 3N1AA 3NYZA 1BXCA 3TW9A 4AWTA 1R7OA 3I6RA 2GOUA 1A5NC 3TZFA 1E56A 4TMCA 3GYEA 4W4QA 5CJ5A 4WQ6A 4FLQA 1W91A 3I6TA 1IEVA 3S2NA 1QNOA 4JTHA 1HNYA 4OV9A 5C6MA 2CLLA 1W2PA 3MMUA 1E51A 1JGMA 4IMCA 3EMQA 3H23A 3QJAA 3SGGA 4DYEA 4OBRA 1VYPX 1NVMA 1FHUA 1EL3A 1YDVA 4HK6A 1U83A 3QVQA 4DUOA 4Q6XA 2WV8A 3MO4A 2XDFA 5CSSA 3F4WA 1JF5A 3OVQA 3RITA 3DGBA 2Z7KA 1OHLA 4J1OA 2X7WA 2ZWYA 2BMBA 2GGGA 3LHVA 4JQ1A 4E38A 4MWAB 1RP8A 3BARA 1P1MA 3R89A 3W74A 4QJ3B 3MZ2A 3KOZA 1JZ3A 4UTUA 3CT7A 3F1QA 1XLHA 3GK0A 2GPTA 2D24A 1K7FA 3MWCA 5CGQA 5HMFA 5ECVA 1SZEA 3A3XA 3HPFA 1H7RA 5DY2A 3TAKA 3TXZA 3MDUA 4AQLA 5A6MA 2JKAA 3L65A 3RLGA 3O8AA 2FH8A 3M0MA 4ZOEA 2PDFA 3VNLA 3VIMA 1OCBA 2HVOA 4O57A 2C0HA 3B0VC 1NQ6A 1WP6A 1GT8A 4JS3A 1NFGA 4DBDA 4Q4KA 3MSRA 4QE4A 3D3FA 4NYYA 2OPJA 4DPQA 1JYVA 3B0PA 4HNLA 5FJTA 2JEPA 1EGZA 5I24A 2WNNA 4HZMA 4W8LA 4EPKA 2X16A 2DVTA 3ZSSA 1KD0A 3PM6A 5HDRA 3A13A 3TN6A 4ZTXA 1EP3A 5EMUA 1UB3A 4H6RA 2G5WA 4WZHA 1JI1A 3W88A 1H4PA 4L61A 9CGTA 1H50A 4M80A 4IICA 1XIDA 1A4MA 4HPNA 2DJXA 3AXXA 2EF9A 3S1UA 5C5YA 2NSOA 1U1JA 3U2EA 3KVLA 2V5BA 2D2HA 3C4UA 1J0IA 1FWBC 3NFUA 1A5BA 4KWWA 4PTDA 1X1OA 4H8VA 4AEFA 4IQDA 3HV9A 2PRMA 3T7VA 2QEZA 3RNDA 4Z2LA 3C8NA 3EPNA 3ABQA 3AYVA 3ZR6A 4MB1A 3C2EA 2PODA 1GQNA 5FIPA 4DM2A 1CB2A 3S5OA 2F2HA 1GQLA 5D04C 3W81A 1JCLA 6CGTA 1Q4NX 1F74A 3OEXA 4MY8A 3WEOA 4AY8A 1GKQA 3IAQA 3VFLA 4CD6A 1UD3A 3N3TA 4K1WA 4AIBA 2Z2UA 3CQJA 4KPLA 2HMCA 3EKGA 1UD4A 1XLFA 3WLTA 1PV8A 1C7SA 2XSXA 4AW7A 1AFSA 3RR1A 2NSXA 4AMCA 7REQA 3KAOA 5A6AA 1EWDA 4PRRA 1M68A 1YE6A 3VC5A 3MC5A 1DXFA 2QDDA 1OSEA 4XZNX 5CPSA 4CCEA 4PE8A 1EGMA 2IKIA 1A80A 4XKYB 3V35A 4WSHA 5G4EA 1UJQA 5BU6A 4Z2HA 2C19A 1QNSA 3ATYA 4D6DA 3CYVA 3SCQA 4P7LA 4BHYA 2RHGA 1B3WA 2EQDA 4TVCA 1ZU8A 3QLDA 2BLEA 5A6BA 5IOBA 2HXUA 1E0WA 1S2TA 3LM7A 4G8TA 1FKXA 1VEMA 3F4DA 3QHOA 4DVOA 5A6BD 2BOGX 4A4AA 5G2WA 4W88A 4HA3A 2PTYA 3BCJA 3CUJA 3W7GA 1OADA 3N6JA 4Z0JA 4INFA 3UG8A 3M0KA 3FX4A 4OBSA 1NDWA 5K9CA 1OINA 5F2LA 4YCPA 4Z08A 5LKYA 5CJNA 4F0RA 2DZVA 2BB0A 2Y63A 3T55A 1AD1A 1HT6A 4U10A 1QXLA 4LQ1A 3KP1A 4C6DA 4F3HA 2Z00A 4XUYA 2QMKA 4MWAD 5AVHA 3RX4A 5H1WA 4A3UA 4O19A 2A6LA 1TPFA 1R0MA 4DO7A 4LUSA 1FWAC 3CWNA 4IIEA 2WHKA 4UR8A 4AVNA 1FH8A 3D5HA 1PKMA 5EPDA 1V3IA 1HVXA 1R3YA 3W02A 5DCDA 2VO5A 1GVRA 3TX9A 4M56A 1UG6A 3RRAA 2ZKMX 4GZIA 5AYZA 2G3IA 4NSBA 4XAGA 1U1UA 1SFSA 4UTIA 2V5DA 4IISA 1OCJA 4D8LA 3NL5A 1ADDA 3H4WA 3MW7A 4G9PA 3CZJA 2QPSA 4L9YA 1K8XA 1AW5A 2CKRA 1FX6A 4DUXA 4C5YA 3MY9A 5LA1A 3BO9A 1MFUA 3GUGA 5GVJA 2VURA 3MQTA 2BBFA 4R3UA 1S2VA 2WMGA 2R94A 2RDUA 1FWTA 2J9XA 5FKYA 3G1RA 5AYYA 1QPRA 3RRXA 1J93A 3WLJA 4IFOA 3B8IA 3FYPA 4FOJA 3PVFA 2YB4A 3KVMA 3M5VA 3W2JA 3OA5A 4N2YA 2WSPA 1YPFA 3GH4A 3F03K 3T0BA 3LX9A 1BGGA 1VYRA 2R1MA 1ICPA 1Z48A 3HJZA 2KAUC 4R27A 4GCXA 4LWWA 2C6QA 3CQ0A 3KE0A 3EWXA 1O1ZA 2XU2A 3A64A 3IVSA 2Y70A 1FWIC 2AAMA 1C8XA 3DUGA 3QV9A 1V6VA 1VJZA 1XRTA 1EZWA 4TVUA 4O54A 2EPLX 1L6SA 5HANA 1KQYA 4GFSA 4IX0A 3VGHA 1KRCC 2NQLA 1ONWA 1US3A 2X0YA 1SZGA 3WL1A 1BYBA 1D3GA 3IIOA 3P0XA 3MO7A 4LB3A 2WK2A 3A4WA 4ZXOA 1LWHA 3NQ6A 1J0YA 4JR5A 4XO7A 1UD8A 1EH9A 1X8CA 3FCPA 1LT7A 2V81A 1FHDA 2AKZA 2XIOA 1JPMA 3P81A 4UB9A 5AC6A 2E6FA 1KXHA 3L66A 3UG5A 3N2CA 4I7UA 4HYVA 3SM0A 4ZFMA 2ZX6A 5EMKA 3KHJA 2VZOA 3PTDA 4BY3A 3LB0A 3SCPA 3U7VA 5DANA 5IBXA 2OO6A 3TWBA 4ZQNA 2GUUA 2VI0A 4CQ9A 1F73A 5EA9A 4E4UA 1Z44A 3D47A 5CLWA 1TPVA 1WKDA 2BSLA 4HNOA 5DMLA 4AZCA 5EFDA 4Q8VA 2WC3A 3E2RA 3HPXA 2CETA 2D22A 4YHGA 2CLOA 4JIQA 1QNQA 3UXKA 3BLFA 4UFJA 1K7XA 4R7OA 2GVEA 4BF7A 2QJGA 3QW3A 3L4TA 3H26A 1W1IE 5C54A 4GRSA 5KSWA 1VFOA 2VQTA 3N25A 2P8BA 1H7XA 2IPFA 2CNCA 3AMLA 3EOLA 3Q2DA 3QH2A 3B4UA 5BWAA 4NJGA 3LSBA 3U9IA 1IXPA 3LHZA 2D0GA 3TJXA 4I8DA 3FW6A 4XIMA 2VJXA 3UY7A 1HKIA 1VEOA 3NL3A 4JX6A 3VIOA 1JPDX 4JTCA 3R12A 5FJIA 1CGYA 4WDUA 3T42A 4MWAE 3L4UA 1VKFA 2EBNA 4FIQA 1ZAHA 5LSMA 2BFGA 1O5KA 1Q7ZA 2WCSA 4U3CA 3VD9A 1R3QA 1DJYA 3AYRA 3SCSA 1HX0A 3TP4A 4UFIA 3H22A 3KW3A 2W5FA 3MJYA 4AZGA 2HBXA 4EIVA 4N4QA 3LCXA 2R91A 3CQKA 1K9TA 3HG4A 1FH9A 3VE7A 1TJRA 2OTDA 3M0VA 2X1RA 1CGWA 5ABHA 2ISSA 2ODOA 1MYRA 2JIEA 4QROA 3NDOA 1E9YB 3MP4A 1CGVA 2H3BA 1YNPA 3W7MA 4M0XA 1XBVA 4X22A 5E09A 1ZLPA 5FL1A 1VR6A 4QEHA 7TIMA 1TQXA 3DG7A 3HA1A 3WLSA 4DN1A 1ZP3A 3UWQA 1P6BA 3IJ8A 4LAOA 3W2LA 4IQJA 4KFOA 2BHUA 1V02E 2GJXB 1UJPA 2NQ5A 1TG7A 1MRQA 3B8DA 3U2CA 3BMWA 4MDPA 2PDBA 5D02A 1DQXA 1JRBA 2Y8VA 2WPGA 4MAZA 2IUZA 3CUZA 4Q8OA 4AZ7A 3P61A 4W85A 3WD2A 2POZA 4DJDC 4GGBA 1GVSA 2DZSA 1OYBA 3TQ0A 2PB1A 4LXFA 3WN6A 3CTTA 3LHUA 3IJ7A 4GO8A 2XTKA 4ZSTA 3A9BA 2VVNA 4S3AA 2FIQA 2IXVA 3W6MA 3VCCA 2GGEA 2Q8ZA 1PJ9A 3R6IA 4AHQA 1CENA 3QHMA 2ZUMA 2FVMA 4M24A 1SO6A 1KM5A 4NAEB 1GOOA 1T8XA 1WXZA 5GJMA 1MUWA 2YBTA 3N4AA 3T0AA 3WD4A 3UU0A 2IW0A 3ZVHB 1NP0A 1RQEA 4GYPC 2ABAA 3IAPA 3SZ8A 4HK7A 3V18A 2J25A 4CN6A 2VGFA 1YKWA 2Y5EA 4QS5A 3IVTA 3LCHA 3WUBA 4NZCA 4DAIA 2TRSA 4I7VA 4HYWA 4BQ3A 3XIMA 2OEJA 4GVHA 3G22A 3TSDA 4JYFA 3OLEA 4NILA 2XM1A 3CHDA 6XIAA 4FLOA 3MMDA 4IMFA 3AMDA 3THQA 3HBLA 4QJ5B 3EA1A 2B7OA 2V5KA 1HKMA 3WMSA 4KF1A 1LBFA 1SSDA 3ONCA 5F2GA 5DFAA 1I1XA 3BJSA 1J01A 3BAKA 2BOFX 3ZYZA 2CU0A 2XH7A 4A8NA 3QPZA 2TAAA 1NY1A 2J78A 2YOCA 4I9TA 3NQ8A 3UWUA 2XPKA 2HWGA 1WDWA 3CUIA 1GG1A 3C2RA 4NY2A 1YPXA 3W7CA 1X39A 4E5TA 1OG0A 3A12A 4IIBA 4XZHA 1E72M 2FZ9A 1F8IA 8RUCA 1CB7B 1RBOB 1NDZA 4HHPA 2QYGA 1EBHA 1BSIA 3VGGA 2B81A 2VGBA 2WSQA 5D9PA 1E3ZA 1LUCB 3AWNA 5FD0A 2P0IA 4F79A 4KCTA 4CD8A 2FGBA 3EA3A 5G1MA 4AD4A 4A3YA 4Q8QA 1OFQA 4KCUA 1BKSA 4AU0A 1R87A 3TW6A 5HMSA 4GKLA 5LZLA 4ZQPA 3OP2A 1C9DA 3M0IA 4OWGA 1HP4A 3SUUA 5BRQA 4GZEA 3ZLHA 2ZX9A 2X42A 2VHLA 2GYIA 2WKLA 8CGTA 4S3DA 3BLLA 4WEVX 1KM4A 1LLZA 3WUGA 1J18A 3CV1A 2E8ZA 3UGRA 1LRTA 4H8NA 4E4FA 2Z2BA 4C6KA 1E4NA 1RLCL 3W84A 4N02A 1EDGA 4NF7A 2BZNA 1N8IA 3F7JA 4IHCA 1P1XA 2QUMA 4GE8A 3TROA 4C6QA 1I45A 2RGLA 5M2FX 2AGTA 4NT0A 1I0BA 1FA2A 2FVLA 1Z8AA 3APGA 2BXYA 1NEYA 1CEOA 1UKQA 3H2MA 1K9FA 5BCAA 3B9AA 3L4ZA 3WQCA 1XRFA 3JW7A 3PZTA 5AN7A 4ES4A 1CLKA 2GQ8A 3QGVA 4X9YA 1TPB1 5FAJA 2Z1KA 1GK8A 1UKTA 2XIIA 4MM1A 3WK2A 4PSRA 4UNLA 1UASA 1NIUA 5LNRA 1C7TA 4Y9AA 1Z42A 3AXHA 4C90A 4G2DA 4K6AA 3LV5A 2OYMA 1NELA 3ARQA 3GE7A 1DJZA 1TB3A 1TWWA 1VFTA 3W7KA 1EX5A 1HG3A 1RPXA 2XIJA 3VVGA 3TC3A 1W5PA 2O0TA 1S2WA 2W3ZA 3K30A 2CZEA 2PLCA 3AJXA 2WNWA 2GVLA 1ODZA 3QYSA 1UR2A 4FSAA 1EJUC 1A5CA 2ON3A 4S3JA 2ASHA 1FUYA 2VTFA 2A7PA 2QDEA 2I56A 2C14A 1TA3A 2BGNE 5FF3A 3U0HA 5FSEC 2QDGA 3GIQA 3SAZA 5MKGA 2ZUTA 3CNYA 4ZO6A 5KTLA 3EX6A 5F4SA 1N2VA 2P8CA 3W2NA 1QI4A 3WF0A 4E2VA 1BVNP 4K2SA 4PCSA 4KEMA 2YBVA 4O53A 4O50A 3TC6A 4C6LA 3DHPA 4W7VA 3TQKA 3TA9A 5HUPA 2IPGA 2VFEA 4S3BA 3PC0A 5JBEA 4LSBA 1JCMP 4YS1A 2PMQA 1K70A 1J11A 2ZRVA 2ZIDA 4P8WA 3K13A 1HKWA 2FB2A 4RXGA 1ZJIA 5J5DA 1YX1A 2OT0A 1PKYA 1G67A 1HL9A 4ACYA 5EMLA 3RJXA 2ZC1A 1WO2A 4KGLA 3EAUA 2BY0A 2Z26A 1E1CA 3VGEA 4M6QA 1XQKA 3BAWA 1GYMA 3EOEA 1GORA 2QGHA 3LTYA 3VNYA 1EO5A 2FPTA 5C55A 4LB4A 4MDOA 3KOXA 4K8HA 5CSRA 3RR4A 3P74A 4LEQA 3MUZ1 4AMAA 1KTCA 5D32A 3WNNA 4QSFA 5EBAA 1JUBA 1MEWA 1KO0A 4RLIA 5ABTA 3C86A 3AHXA 1E1FA 2SFPA 2YB1A 2DH3A 2GGIA 3MA8A 2HSAA 1F61A 1CYGA 1R8LA 3MV01 5CG7A 1IIGA 1M7OA 5FF0A 3BV7A 4O18A 4C6CA 1XXXA 1TJ2A 1XDMA 4BEUA 1CI1A 3S8HA 3WLHA 4CD4A 2WVVB 3CEUA 3EKZA 5DXXA 4GXMA 4DLFA 2QHAA 2Z24A 5DELA 3LNMA 2XG9A 3IPWA 1UBSA 3RN6A 1E0UA 4MZYA 2V5CA 4O17A 1KBJA 1BQGA 4RNFA 3RK8A 1QU4A 3VDBA 3VI2A 1GUVA 3EYPA 3CK5A 2BV9A 4GIRA 3V1HA 5AKQA 4GUHA 1GVQA 4S1FA 1LORA 1VC4A 3UF9A 3LCLA 4I5RA 1BD0A 1XLMA 3OHIA 2W6RA 4ROPA 5CQ1A 3PTMA 1T40A 1DJIA 3L0KA 4FNRA 4Q4SA 1JXKA 3VILA 2VX5A 4QNWA 2P5NA 3OQ8A 4PMOA 3CAVA 3OODA 1OFEA 4ZOAA 1YQ2A 2W66A 5AB3A 2Y4SA 3HPZA 3TTYA 3W7QA 3BLKA 4C1KA 7XIMA 2VM8A 4WJXA 3THUA 4JQAA 4ZEPA 1JPKA 1L8NA 5F1VA 4AUBA 4LS0A 1QK2A 4RZBA 2E9BA 3CZEA 3WUEA 1E70M 3BCDA 3GH7A 1GCYA 2VRQA 1GWJA 3KS6A 3SY8A 4ICCX 1L2QA 4LYPA 1NQKA 1JR1A 4B16A 1TTPA 4RE3A 3ZR4A 4M82A 4GG9A 1GZJA 3T4CA 4NYUA 1PKNA 2PWFA 4O1AA 5LIWX 2CESA 3QR0A 1TVLA 2Q8LA 3SCNA 4NJIA 3DZ1A 4M6PA 5DEZA 2WMHA 3PWGA 2V2HA 1V77A 3KTSA 1KWKA 3GNXA 2JF7A 3DN5A 4BZYA 4IXHA 1H7WA 1KXVA 4WX2A 3FYOA 5T26A 3TSMA 1UWAA 3BAYA 3ITOA 2D2OA 4KFPA 4PCNA 1J0ZA 3GFYA 3QMSA 1ISVA 2DPEA 1PB0A 4G7FA 5CZTA 3G6MA 5I0DA 1W3TA 3WDIA 2GLKA 1PL9A 4HPGA 4N6EA 3LXBA 3GW3A 2VFGA 3FOKA 3ZT5A 3KRBA 4Q4OA 2I5GA 1DEDA 1T99A 2VZUA 3NQEA 1B3ZA 2V2CA 2B0MA 1W1TA 2V68A 2PWHA 3H7RA 3NNTA 1XPGA 1DIOA 1XLEA 3PJWA 3W9ZA 1UUMA 3HGOA 5TNVA 5DCEA 2XGZA 4IG2A 2E5BA 3FK4A 4XK2A 3GHRA 1F3EA 3AICA 2Y0FA 1KA9F 4LUTA 2JGYA 4S3EA 4LUIA 2QW5A 3CV2A 2IPJA 4LF2A 3LDVA 4GQBA 2E1DA 5BYWA 2ATSA 3ALGA 4GNKB 1XIBA 1OIMA 3ITTA 1XM3A 4JFWA 2J7BA 4UCGA 5JIWA 2GVYA 2CIPA 2Z4GA 1QPOA 1AK5A 4FALA 3VIHA 3GTFA 3OBAA 2QCFA 2XIMA 1YDNA 2PURA 4D9PA 1EFZA 1ZJBA 5CPNA 5DXYA 3VE9A 1K8CA 4UQDA 1UR3M 4MYXA 1N7KA 2ZXDA 4OOZA 2HPIA 2FFIA 2E5DA 4O0QA 5I3HA 3W3OA 3S46A 4YPJA 1P0KA 2J8TA 2Y88A 1L0PA 3V0SA 5AY7A 1TVPA 2PGRA 1QNRA 1IXNA 2QV5A 2YA2A 1TV7A 1DWAM 3BAXA 3RPTA 1X8FA 3E49A 3CLWA 3M6DA 5FF4A 1XBXA 2PI6A 3APYA 3S6TA 3QY8A 2Q02A 4NZ3A 3RYSA 5D2XA 1GONA 1EPVA 4TX8A 3BW3A 4EF8A 3VD4A 4IPNB 4B2DA 4N9CA 4DO6A 2V63A 2OWWA 3RPDA 3WK3A 1E9LA 2DJLA 1AH4A 3H2EA 5E0CA 4LVBA 2ADAA 1AW2A 4GUGA 2OOGA 3PZNA 3BLPX 5K3VA 3ONBA 2OELA 2C15A 4ZBCA 3NOEA 5CPTA 1IIHA 3NPUA 4AF0A 3A9IA 2J7CA 3SI9A 4NNCA 1ITUA 3R1ZA 4WIWA 1G4SA 3H24A 1H11A 1QRQA 4QG6A 1QI3A 4DB7A 4LV4A 2DZUA 2V3EA 2Y5JA 4I5UA 3U6WA 3QGAC 2ZWZA 4ZE5A 4HHHA 1ZNNA 2XGBA 3TN3A 4A05A 1UR4A 4FMVA 4BWLC 1EO7A 4IP4A 3WENA 1B2YA 4MLJA 3W1TA 4XUGA 2DIKA 2QR6A 4PYSA 4E4PA 4XAFA 4TV6A 4XZBA 1K6AA 1WDPA 1XLAA 3NQ7A 4FNTA 4IUGA 2WM0A 1BF2A 1FWFC 2QV4A 3B0UX 3KBVA 4Y8EA 3AIEA 1I9CB 2YDQA 3CIVA 2OZ8A 1K8ZA 4YLWA 2HXTA 3TLQA 3I7SA 1H0IA 3TW7A 3B9EA 1O1HA 4MVAA 4ZMGA 4JL2A 3N18A 4ZGYA 2PDQA 3SGUA 4HQVA 2J7HA 2WHJA 1XIJA 2VZVA 2Y7FA 4DHGA 3SRFA 1UPMB 4LAMA 4XD4A 3FFSA 3ARVA 3DI0A 2YLLA 1OEPA 5TF0A 2CKSA 4AB4A 3TYBA 4J3SA 4FOUA 2ZADA 2PDCA 2INZA 3MCNA 2XWEA 3RX3A 4EXAA 1UHVA 4KETA 4F0SA 2G97A 3LTPA 3R10A 2E25A 1JG9A 4DJDD 4HB7A 1GG0A 3W72A 2ZZ2A 3N12A 1GZGA 3TJ4A 1IEXA 4O0KA 1MFVA 4Y9PA 3H21A 4Q8NA 4BQ4A 1SM9A 4F0MA 3KZSA 1X97A 4HK5A 3QHNA 3L0GA 5AC7A 3PBGA 2FDMA 2CZVA 4R53A 3IK4A 1LWJA 1MO0A 2OWXA 3LQLA 3N14A 4GYPA 1F2JA 3AAMA 4X2RA 4AX7A 1BXBA 2DU2A 4PTWA 5BOOA 3QBUA 4XV0A 1DWJM 2NXHA 2BDQA 3M1ZA 5FCZA 1V3JA 1DYSA 4NU7A 3MYPA 3ZJ6A 1CX9A 4DY1A 3LA4A 4NKCA 1JZ5A 4XD6A 1ADSA 2CXEA 5GJNA 4ROQA 2PCEA 3DHFA 1Q63A 5FI8A 1WDRA 4JFVA 4C1LA 1PS9A 4JNYA 3HGRA 3BXWA 1WDQA 1H3GA 1OD0A 2Y7DA 4ZOCA 4NHVA 4QG8A 3WLRA 4E0CA 1NU5A 1Q6EA 5K9DA 4HNNA 5HNTA 3XISA 3UZWA 3L9CA 3LPOA 1C90A 4PUNA 2QJMA 1UW9A 3K1GA 2NXGA 1SU5A 3NA8A 3VOFA 2J9ZA 3TA6A 2XFRA 5I09A 3E2QA 3WQWA 1VPYA 1BKHA 2ZUWA 1IXQA 3KOFA 2ZZ4A 4JYDA 1B5TA 3P67A 1RJPA 4US6A 2ZDSA 3GZ3A 3GTIA 2YBUA 3V36A 3CT2A 1HL8A 2V6AA 3EX3A 1HJSA 4QTGA 4P8XA 4CD5A 5KMYA 5LNVA 4L4PA 3G24A 2FZMA 4DBUA 3MUXA