1G4EA

Thiamin phosphate synthase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
226
structure length
219
Chain Sequence
HGIRMTRISREMMKELLSVYFIMGSNNTKADPVTVVQKALKGGATLYQFREKGGDALTGEARIKFAEKAQAACREAGVPFIVNDDVELALNLKADGIHIGQANAKEVRAAIGDMILGVAAHTMSEVKQAEEDGADYVGLGPIYPTTRAVQGVSLIEAVRRQGISIPIVGIGGITIDNAAPVIQAGADGVSMISAISQAEDPESAARKFREEIQTYKTGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords THIAMIN PHOSPHATE SYNTHASE
publication title Structural characterization of the enzyme-substrate, enzyme-intermediate, and enzyme-product complexes of thiamin phosphate synthase.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 79
structure length 219
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.5.1.3: Thiamine phosphate synthase.
pdb deposition date 2000-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1g4eA00
1QAPA 2QDGA 2V0TA 3PG8A 3T55A 5C6MA 1W54A 3C3NA 5CZ0A 3TQVA 3NA8A 4FNUA 1XI3A 3U6WA 4NJHA 1ZHAA 4FNQA 3UZ5A 2WOQA 1UJPA 1RQBA 1M7OA 2FB3A 4RZ6A 2GJLA 3W7OA 3HGJA 3HJZA 2B7OA 1PIIA 2NWSA 3BARA 3EEGA 3S1VA 3PB2A 1TRDA 3EKZA 4AAJA 3EWUA 1VH7A 1OFBA 3C56A 2ZRWA 1H63A 2A85A 3LHYA 2ZZ3A 3MYOA 3GAYA 3TR2A 3SY5A 1TTPA 5F1UA 3NPVA 1ZCOA 3BLIA 1XFBA 4QM1A 5CKSA 4UUIA 3LV6A 4PTNA 1LORA 3USBA 2Y6ZA 4J9JA 3WJZA 1CI1A 1JUBA 3S42A 5CGQA 4MLRA 2FTPA 4X9SA 1LZOA 5AFDA 4JTTA 2ZZ2A 1XBVA 1K7XA 3BW2A 3QZEA 2QCHA 1AMKA 3DFOA 1ME7A 1O94A 3H54A 2Y62A 4IMDA 3NR0A 2Y7GA 4UFLA 2CZ5A 4MKNA 3KVLA 1LROA 3TXZA 1G67A 4HPXA 3EX4A 1DORA 3NAVA 1BTMA 5FF4A 2ZTKA 1OFEA 4A21A 1Z48A 3GKAA 1OX6A 2VFFA 1OFPA 2ISVA 1VLWA 3IVSA 3DI0A 5ABTA 1C29A 1WX0A 3TFXA 5F2LA 4JN6A 3VKJA 3CM4A 3IVUA 3SIZA 5G2HA 4M19A 3TW7A 1LOQA 4NX5A 5D2TA 3I7SA 4MUZA 1F73A 1KV8A 3M0ZA 4ZL1A 4NU7A 3DFPA 5EA9A 3W71A 5HWMA 5AHMA 1H62A 1W5OA 2Y70A 3CQ0A 5EL1A 3C8FA 2FPTA 3W1TA 1SFLA 1L9WA 3GAKA 5D03A 3SECA 4AWTA 3LCFA 2Q3OA 5FI8A 2J9ZA 3M6YA 1PHQA 1X8FA 3QMRA 1H7NA 4LT9A 4OBTA 3BV4A 1H7WA 3HG2A 4OHQA 1G4EA 2BWGA 3G1XA 3W88A 2QKFA 2LLEA 3NZ1A 3L5LA 3OBKA 4QAIA 2WJZA 3E12A 2Z1BA 2AGKA 5F2IA 2XN2A 2JK2A 4FXRA 2ABAA 4HSNA 3NL3A 5KSWA 1ONRA 4JX6A 5KZEA 3HGOA 4RLIA 2QAFA 2FLIA 1H7XA 5E93A 5TIMA 2EKCA 1WYIA 3MBDA 2X1UA 2G96A 3W7CA 1MZHA 1OX4B 3JS3A 4XBSA 3UPBA 3LXAA 4DO6A 5K4XA 1EWDA 2EHHA 3WFAA 1H61A 4AB4A 2NV2A 2V30A 4Z08A 3RU6A 3TC7A 3W3OA 2QCCA 5HQEA 5K4ZA 1N8FA 3TCEA 2V5BA 1RZMA 3VNDA 3E96A 1G4TA 3NQ6A 2G5WA 4UTTC 1MXSA 4N6FA 3DFSA 3L21A 3QEZA 4O53A 5K7JA 4NNBA 1EUAA 4MZ1A 3QM3A 4TU1A 5D37A 3PVFA 2NX9A 1JR1A 3HQ1A 3TDFA 4MOZA 3O6DA 4N9DA 4O10A 1JUKA 5EYWA 1F7BA 4TR9A 3B0VC 1VQTA 3LTPA 3CT7A 2I14A 4GC4A 1XXXA 2TYSA 1EA0A 4OT7A 4UTTA 4QISA 4ZQMA 4H6KA 2TSYA 4N9CA 3IRDA 5K9CA 3DHFA 4Q32A 3CTLA 3NQ2A 5C5YA 2V82A 5DXYA 1W0MA 3O07A 3B06A 1YTEA 5HWNA 2O7QA 3TQKA 1PL9A 3C2RA 1WOAA 4JTUA 3TU9A 1SW7A 4E0CA 2CFFA 3OVRA 3PM6A 2I1OA 4M7TA 1AL7A 3JRKA 3M5ZA 3A21A 4WY0A 1GVFA 5FEXA 1SZFA 1JRBA 5DELA 2VEKA 3DFQA 4O13A 3TJXA 4MFEA 1VLIA 1H7PA 1UBSA 1L2UA 3C2VA 2CLLA 4POCA 5FEWA 1Y0EA 4E2DA 3B8DA 2ZA1A 3M47A 3TJLA 4LV4A 1GYLA 5AHIA 3GR8A 2QUUA 1NFBA 1LLWA 3A23A 1LBFA 1X6UA 3EKLA 3OEXA 5D32A 3W1PA 2JKAA 4O1AA 4HIBA 4MY9A 4JYFA 3W2NA 2ATMA 5EBUA 3MHGA 4ZVJA 2CW6A 2ZFAA 2VENA 5F4WA 2YDAA 3IIPA 4FHAA 1TTQA 3NEVA 4K36A 3LCGA 5CZTA 3NXFA 4O0ZA 5AHNA 1FWWA 1SSDA 3M41A 1GVQA 4M6QA 4LRTA 2FPVA 4CQAA 4IMEA 5AYZA 1Q3NA 1O95A 4YXGA 1TSIA 1KFJA 3STGA 1ZJIA 4DPQA 4Y9AA 1DQXA 4JTLA 3GXTA 1H50A 3T7VA 4UTMA 3W70A 1KLZA 1KTBA 3W7HA 1GVOA 1IF2A 4RK8A 1TV5A 4Z1BA 1TREA 3MW7A 1LYXA 4K8EA 2Y7EA 1LM1A 4UFIA 1TPFA 1D3HA 3NQGA 2VFEA 5HULA 5G1YA 4TX9A 2XFWA 4EOUA 4IOTA 2NUWA 1PV8A 3ABSA 1SO6A 1YPIA 4BF9A 1TPVA 4OQVA 3IIOA 1XKYA 3GK0A 4DO5A 1YXDA 2A21A 2C0AA 1SU5A 1Q6LA 1SR9A 3LHVA 3O1NA 1W5MA 3GVGA 4RX0A 4KFNA 1QCWA 2R8WA 3ANYA 5LHEA 3VE7A 1THFD 1TQXA 4IWWA 3LERA 3ZWTA 4YCOA 2ZZ1A 4FNPA 3L65A 3UNDA 3KHJA 1JCJA 1OF8A 5I3FA 3NM3A 3LCLA 5K2ZA 4LVGA 3PUDA 4MLJA 3BW3A 1ADOA 2QJHA 3BGJA 3GDLA 3L68A 3B04A 1LOSA 3G1HA 3NQFA 4LU0A 5G5IA 1JCNA 5D05A 4Q33A 1JCMP 3A5FA 3W7NA 5C55A 3O05A 2J6XA 2ISSA 5D2YA 1MSSA 2A7NA 2C3ZA 2QUVA 3NGJA 4A3UA 4HNVA 2OMAA 3EXTA 1H7OA 4WY0B 3W7IA 3PC0A 3W73A 4HT3A 1VR6A 4ORIA 4JTEA 1TTJA 4AVFA 4XBKA 3KRUA 2QCMA 2VFDA 2QF7A 5LZLA 2QCDA 3LDVA 4BWLC 1A5BA 2CWNA 1FCUA 4IGHA 4GUJA 1R30A 3PS7A 1FDJA 3LM7A 3WK1A 3LRMA 1GTEA 3TMLA 3NQVA 4AF0A 3W84A 1WBHA 2QCLA 1H7RA 1QNVA 4KWVA 3UQNA 3HF3A 3S1XA 4PCFA 3B4UA 3PB0A 4UFHA 4K37A 2GPTA 4XQ6A 2PRLA 3QH2A 2CLEA 3EX2A 3TROA 3CIXA 2CLHA 3C61A 3MUXA 1AW2A 4YWIA 4OWGA 1OK6A 5LNUA 5G4EA 1QPOA 4LC8A 1K7EA 1TV8A 3QC3A 3W7RA 2TRSA 4GUIA 3ZS4A 3P84A 3W22A 3NM1A 3QW4B 2BTMA 1RV8A 2PRHA 4UTUA 2Y7DA 5F1VA 3DI1A 1VZWA 1FXPA 2A7PA 4CNPA 4I7WA 3NQ8A 4PFMA 5BRBA 1ZENA 1W56A 4L4MA 5DBTA 3W9ZA 1VC4A 1OYBA 2QDHA 3TKFA 2ALDA 1S3HA 4E2BA 3IIXA 4O8RA 4K7YA 3THAA 4YLWA 1YDVA 3OG3A 2VFGA 4ALDA 1SSGA 1DKWA 3N2XA 1P0KA 5FEZA 4RR4A 5D38A 2F84A 1KM2A 3O63A 4NXKA 6ALDA 4JGDA 1FXQA 1ZY9A 1NF0A 2B7QA 3MO7A 3GNNA 1A50A 4CCEA 3IV3A 3CEPA 4FF7A 2W79A 3HG3A 5AYYA 1I2PA 1OABA 1YLVA 4QSHA 1UCWA 1KFBA 4MJMA 1YADA 2VFIA 3OVQA 3PAJA 1ME8A 1XUZA 3PBUA 1SO5A 1JCYA 4NZJA 3ABQA 4K7VA 3W2KA 1P0NA 4LS0A 4MVAA 2Y85A 3G22A 3NL2A 4JEQA 5FF2A 4UR8A 2JKEA 1U83A 1LCOA 3HO8A 3TIMA 1YXYA 3INPA 5I3HA 4AMAA 1UUMA 4GXMA 3V1PA 4UMCA 1FBAA 3WJYA 3GDTA 3W75A 5AOUA 2YZRA 2QAPA 1M7PA 1RQHA 3NQDA 3N19B 5HUPA 1LBLA 4A2SA 4E38A 1ZAIA 3P80A 2A6NA 2V5LA 4DBEA 4JTJA 4NVTA 2J9XA 5DN1A 3DKLA 5C2XA 1OX4A 4WD0A 4ADUA 4ZQOA 3QJAA 4RXFA 2WO5A 2ZBTA 3W86A 1KFCA 2W0UA 1KA9F 4S2BA 2QCDB 3M5YA 2C14A 3P82A 4PA8A 5CZSA 1K8ZA 3UWZA 1LP6A 1JQXA 4GWEA 4XWUA 3LRKA 3BO9A 2GQ8A 2E6AA 4DF1A 4UTJA 2VEMA 3KAOA 1W31A 4EF8A 1G7UA 3DZ1A 1F05A 2HTMA 3I68A 3S5ZA 4AF0B 3QQ0A 3BLEA 4RKAA 4OV9A 4WUIA 3N14A 4O57A 2WNNA 2E68A 4HNUA 4PODA 4NX0A 4JY9A 5IBXA 1HL2A 3NNTA 4RXGA 4S2CA 1RD5A 1Z41A 1G4PA 1GQNA 1PE1A 1WDWA 1K03A 4DBDA 1R46A 4CQ8A 4YL2A 3P62A 4GNJA 4LTSA 2X16A 4XTDA 4AHQA 1D3GA 2GVGA 3GDMA 4GE8A 3RK8A 2A1YA 3OIXA 2P10A 1H51A 1LRTA 3W7QA 5F2GA 3NL6A 4FX7A 3G8RA 3G1DA 2ZRXA 5AHLA 3UD6A 3Q37A 2VFHA 2A2IA 5D33A 1NEYA 5HNRA 2C6QA 3E9AA 3P5YA 3TSBA 1FCVA 5LNVA 4Y90A 3DFTA 3CLMA 1GVSA 3C52A 4O18A 1KBIA 1JJKA 1YYAA 2ZZ7A 3LCIA 4QIUA 3W1NA 2V8ZA 3CIWA 4Z1CA 2YW4A 3C2FA 1T0OA 3C6CA 3B0UX 3NL5A 2C1HA 3T4CA 2J27A 4RV8A 4LVDA 1P4CA 2OJPA 4IXHA 1XBXA 2FJKA 4NNCA 3UWQA 1EP2A 1Q6OA 4O4WA 4N6EA 3SZ8A 2ZQ0A 4FNSA 1I45A 3QSTA 1R2TA 7TIMA 2DZSA 3HPXA 4HNNA 1OFOA 4HKPA 1GOXA 2ABBA 3S6DA 3LXBA 1SO3A 2FPYA 4A22A 1NVMA 1ICQA 1YPFA 4A29A 2RKXA 3LI0A 1X7FA 4HHPA 2WPBA 1G7VA 1LBMA 3LV5A 2HS6A 3E49A 1LRQA 2TMDA 4QNWA 3Q2DA 2VKZG 2DZVA 3G8EA 3AO0A 4NQ1A 2CLOA 4GJ1A 1HO1A 2A5HA 2H8XA 5U4NA 1FQ0A 3L67A 4MJZA 4UFJA 1TCDA 3PR2A 4QITA 1TPWA 3EWXA 2QCGA 4UIOA 3GIYA 3LBMA 4M6VA 1X1ZA 3VCRA 3W7JA 3QPZA 1H60A 1HUVA 1GG1A 4JDYA 3EXRA 2G95A 2PE4A 4O4VA 3F4NA 3M5VA 1M5WA 3FLUA 4UMAA 3Q94A 3QFEA 4MYAA 3SI9A 2E09A 4NJGA 3NZRA 1EPXA 1TQJA 4GBUA 4JTHA 3LHWA 3SGUA 4GUFA 4JIQA 1FWTA 3GXNA 3G1AA 1SQ7A 5F2MA 1ZALA 2WSQA 3IIZA 3UWWA 1NAL1 1M6JA 3LCHA 2X1SA 1J5TA 1LDCA 4JNMA 2NXHA 3LTYA 1VHCA 4R34A 5FF7A 3R8RA 2A4AA 1FUYA 3NQMA 3B0PA 3W23A 2QCEA 2RFGA 3G1FA 1K3UA 3TMQA 4WJEA 3ABRA 5KMYA 5D04C 2WV8A 4ICNA 3KRSA 5AHEA 3IIVA 3I7RA 4KKXA 4Z0JA 1JRCA 5AN7A 1DHPA 4A2RA 1LRNA 3W2UA 3T44A 5HUOA 3RNDA 4LRSA 3S1WA 1R47A 1ICSA 3GKFA 4O0KA 1I2NA 4WZHA 3W7GA 1EP1A 1F2JA 4BFAA 1R2RA 1IXPA 1IIHA 3O6YX 4R53A 3T40A 3HGRA 3GYEA 4ZMGA 2F7FA 4FXSA 5KZMA 3KXQA 1SPQA 4BR1A 2NWRA 1VGAA 1EWEA 5H2ZA 3P60A 2QJIA 4UMBA 4XKYA 4H3DA 5D02A 1FY6A 1XL9A 2ZTJA 1WA3A 2OCZA 5A8GA 2H3DA 4UNLA 4OGZA 2JGQA 3NYZA 4LOCA 1KFEA 4Y8FA 4GFSA 3P8JA 3L9CA 1MEWA 2FB2A 3TAKA 3OVPA 2ZDRA 2H8ZA 5CSSA 3FJ6A 1FWRA 5BNKA 3DKJA 3R13A 5L6UA 4LV9A 1KFLA 2PURA 4CCDA 1EEPA 2QUTA 3QSRA 1WOBA 4C1LA 4EIVA 2R94A 2HSAA 3FKRA 3M7WA 2V2HA 3HIJA 2H90A 3TX9A 3W7MA 1TRIA 2Q3RA 3MBFA 1FWSA 2QEZA 3BG9A 1EIXA 4TIMA 1P5BA 2BXVA 4U28A 2YGYA 2GQAA 3F1QA 3LRLA 1XDMA 3RMJA 3W7DA 1VCGA 1CW2A 3GZ3A 2PRMA 3MP4A 4UTHA 3QYQA 3UXAA 3MYPA 3S9YA 4X2RA 3W1XA 5D2VA 1EUNA 5HJLA 3NOEA 3A24A 4DF0A 4RZ4A 4IMFA 2RH9A 1YDNA 2E77A 3C4UA 4PL2A 5CZJA 3R12A 4CLMA 3TH6A 1OJXA 4NZFA 4WY0F 4OE7A 5K3VA 3LLDA 2DORA 4LW7A 4O12A 3P81A 3PULA 4DXVA 3BK0A 4QJ1A 2NV1A 1JQVA 3FYPA 3GLCA 2ZA2A 4JS3A 1EB3A 4JX5A 5I3KA 4P2VA 1VJIA 5AHFA 4FNTA 1R2SA 4L4LA 2EGZA 3W2JA 5K9DA 4QQ3A 3STEA 3PBVA 3QMTA 2OZ0A 3PBYA 4IXXA 4O1CA 3HPZA 1G4SA 1SO4A 1F5ZA 1F6PA 4N4PA 1FDYA 4YMZA 2CLIA 2VOMA 1OVDA 3CPRA 2A6LA 1A5SA 1ZFJA 3NPXA 4DEFA 3TSMA 3LX9A 1UUOA 2VEPA 2OT0A 1XUUA 2X1TA 1TPUA 3H55A 4XKYB 1OFQA 1AL8A 1RQEA 2W6RA 3M5XA 4TO8A 3W07A 3O16A 3WK2A 4EF9A 4NJJA 4X22A 3RFAA 4ZZ9A 1DBTA 4OV4A 3U2OA 1XBZA 3DAQA 2HMCA 2X2GA 5DBUA 1GPWA 1VRDA 4KFOA 2B7PA 3PBWA 5FF3A 4MY1A 3F03K 3L5AA 5EY5A 4FO4A 3W87A 1DJNA 2DZWA 1QPRA 3S0CA 3KVJA 4NNAA 2NUXA 4K38A 5TQLA 3GXPA 1TPB1 4K39A 1TPC1 5IM51 1SW0A 3P7YA 3PSWA 1H1YA 4ZQCA 1I2RA 2EPHA 5L9FA 3O06A 1WAUA 3W1AA 5AC6A 3E02A 1CX9A 3EWZA 2VEIA 1F6KA 1FCBA 4TMBA 3PG9A 1DJQA 3THQA 5F4XA 1MO0A 3AJXA 1K8YA 3ELFA 3D0CA 1OYAA 2B4GA 4BWLA 4NJIA 2R91A 4HSOA 4JTFA 3MI3A 2QJGA 1QOQA 5F4SA 5T26A 3FA5A 4Q4KA 3FJLA 2YFOA 2Y63A 2C16A 2X1RA 1QMLA 4ONVA 1GYNA 5I3JA 5U7SA 2BLEA 4IMGA 2RDUA 4OU1A 3GDRA 3HOJA 5LNSA 1GG0A 2QCNA 3FS2A 2ATSA 2Y88A 4JX4A 1VYPX 3I6RA 1JVNA 3RLVA 1Q6RA 3A5VA 4ZQRA 4C1KA 4LS2A 5KZDA 3PUOA 4WXYA 4DELA 2XN1A 3SGZA 3M9YA 3SSJA 3S5YA 4N02A 5HWJA 5C54A 3EWYA 2YX0A 1O5XA 5EPDA 3L0KA 3NQEA 3G3DA 5AYXA 1XC4A 2E5CA 2GVLA 3W2MA 5I3GA 2ISWA 1B3OA 3N3MA 3MWAA 3FFSA 4CNOA 1HTIA 4M5PA 1HFBA 2A0NA 1HG3A 3O6CA 2ZA3A 4N2YA 3R2GA 2Q8ZA 4O1DA 3TSDA 1G69A 1F74A 4ML9A 4UTWC 3OA3A 1J4EA 3T78A 3TFCA 1W1ZA 3ATYA 4TMCA 5G2WA 1VCVA 3UWVA 3BLFA 2ZZ5A 3L66A 4IPJA 2V9DA 3HGSA 4UTLA 6TIMA 3DHDA 4IX2A 2JKPA 1TTIA 4NXSA 3WJWA 2VXNA 4S1FA 2FDSA 5GVJA 3A9IA 4LS1A 1Q6QA 4JTKA 1H1ZA 3VE9A 3IVTA 2ZZ6A 3LTSA 2E6YA 5HINA 3NPUA 4IMCA 1O60A 3A22A 1FCQA 2WKJA 2GOUA 3DFNA 1BWLA 4IQLA 1S5VA 1UB3A 1TPEA 1IIGA 1L6YA 2O7SA 2A7RA 1JCLA 4XUGA 2WQPA 3PF3A 1P1XA 4CNNA 3QPYA 2E5DA 1KW1A 4CCCA 1LTDA 1BKSA 2DP3A 4JTGA 4N9BA 1N55A 4JY8A 3LCXA 1GJPA 1QPQA 1DQWA 2NUYA 3M44A 1B57A 4W9TA 5G1TA 1XM3A 4O28A 2NZLA 4GUHA 8TIMA 3HG5A 1SZEA 5AC8A 3UWYA 3G3MA 3L2IA 5BOOA 3KVKA 4FX8A 1O4UA 1KM0A 2AAMA 3GX9A 3B05A 3G1VA 2Z6IA 1FX6A 1W3IA 4H4IA 1V7YA 3E0IA 1V5XA 5BW6A 3TA6A 2DJLA 3NO5A 3S5NA 5D09A 4Y6GA 2DZUA 1KV5A 2TPSA 2YPIA 2ZRUA 3PSVA 3UYCA 1TV7A 2NX3A 5LHFA 3MHFA 1X1OA 3PWAA 3LHTA 3C0JA 3W1MA 3BGGA 1OFDA 1TMHA 2XN0A 3EX1A 3G1SA 4PEKA 2DZPA 1GWJA 2H3BA 3W6YA 1K8XA 1QO5A 3ABOA 1ZAHA 3GDKA 4K8HA 1H5YA 2P0OA 1ZAJA 2YXGA 3P5ZA 4DPPA 2I9EA 5DCBA 4JICA 2JBMA 3LXCA 1IXNA 4JYEA 1KM5A 1LOLA 4JIPA 1S5TA 1KLYA 3R5EA 3QF0A 2YYTA 1OFAA 4HN4A 1I8JA 1Z44A 2B0MA 2V2DA 4I7UA 2D73A 2HS8A 3DU0A 3LBCA 3W7KA 3BPWA 2C19A 5E0KA 1TJPA 2CLMA 1VHNA 2QR6A 2ZYFA 3G18A 1YTDA 1Z42A 2GUUA 1AK5A 1BWKA 4BI5A 1B4EA 3W7EA 2RDWA 3QRHA 4HNTA 2NXIA 2R14A 3ZWSA 3W2LA 2PCQA 2V81A 2ZRVA 1G6CA 1PCKA 2PC4A 3VI2A 3QQ1A 1SZGA 4EVZA 1OHLA 4AWSA 1ICPA 5KTLA 2YCEA 1T8XA 3IGXA 1IXQA 5E1QA 4ZQPA 2YSWA 5G2IA 3SJ3A 3FYOA 4GUGA 3FEMA 2C15A 2J24A 4UFKA 3W1UA 1IGSA 5EKYA 1J2WA 2E6DA 1GVRA 4FIQA 2VELA 4MPQA 2EF9A 4ADTA 3TV8A 1GEQA 1RPXA 4M6PA 1DL3A 2GQ9A 4PL1A 4BK9A 3HBLA 3EB2A 1W5NA 1XDLA 1VYRA 2Y89A 5CPOA 2WSRA 5D2WA 3P74A 5FEPA 2NX1A 4IUOA 4MZYA 1FDZA 3L0NA 1AW1A 4HPJA 3DENA 3N73A 1DVJA 3GB6A 1QO2A 3O15A 3TE9A 1RR2A 1SUXA 4ADSA 3CU2A 3STCA 3L5MA 3N34A 3RLUA 2DJXA 3M1ZA 3PUEA 2E6FA 5BMWA 3WK3A 2OX1A 2CZEA 3UWUA 3EX3A 4P61A 2B7NA 1AG1O 1TB3A 1ALDA 1A5CA 4N9EA 3CWNA 2CZDA 1XCFA 2Z6JA 2IQTA 4O1BA 1UASA 5DCEA 3MHUA 4LNYA 1WQ5A 1OFRA 2ZRYA 2RHGA 4UCGA 1WV2A 3IEBA 5CPMA 4JD4A 1KM3A 1TIMA 4I9AA 2C13A 1BEUA 1O5KA 2C18A 3MI6A 3DBPA 3M43A 3C2OA 1FWNA 3UZJA 3HG4A 3TUUA 4BI7A 3DXIA 3NVTA 1JUEA 1LLZA 4Z1DA 4JTIA 3BG5A 2CLFA 1OYCA 3V75A 1T99A 4B5NA 1A53A 1GZGA 3R89A 4AWUA 2E1DA 5I3IA 5LSMA 4WQ6A 2Z0IA 4O50A 3I65A 5BMXA 3KOFA 5AB3A 4X3ZA 2JGYA 2Y61A 1TO3A 1RVGA 3I7QA 1VCFA 3CHVA 2BZNA 3SFKA 2BSLA 1I2QA 3EXSA 5HMSA 3NPWA 4Z1AA 3TNOA 1I4NA 4AH7A 3FKKA 4DO4A 3KFTA 4K6AA 2J9YA 1SW3A 2WSYA 3IGUA 4MYXA 3UXDA 1JCXA 2RDTA 1YXCA 2CZFA 4LUIA 4R33A 3FIGA 4IJBA 4O19A 5DCDA 2OT1A 5CPNA 1KFKA 3SR7A 3EX6A 5CG7A 3TQ0A 3W85A 3GNDA 3DGRA 1T96A 5J5DA 4LVBA 1OK4A 1DV7A 1W3NA 2Z2UA 1SZNA 4WXZA 3WK0A 1SFJA 3YPIA 3NQAA 4RCXA 1EP3A 1NF7A 2YR1A 3B03A 4UR7A 3TW6A 1U5JA 4XZ9A 3HMJG 5G4WA 4KWWA 2EAWA 4UFMA 1HO4A 1K7FA 1K02A 3LOTA 4Z0SA 1TPDA 3K30A 3NDOA 2J88A 5LGXA 2ZZ4A 4CQ9A 1PVNA 2BX7A 2ZRZA 3W76A 5SWUA 2GVJA 1PS9A 4WOZA 5KINA 3F4WA 5HR6A 3MP5A 3UY7A 3UY8A 1Q45A 1OG0A 1C8VA 3LB0A 2CLKA 2DU2A 3QW3A 5MHBA 3KVMA 4AHOA 3QMSA 3S8HA 3P61A 4N4QA 4M7SA 4LC6A 2DZXA 3P8IA 3W7PA 1VS1A 4ZQNA 4RZ5A 3ZR4A 4R7JA 1W8SA 4NJKA 3G0SA 5LKYA 2FFCA 5AC7A 4ORMA 4UNKA 5FESA 1W5PA 3LCWA 1EX5A 3BG3A 3G1YA 5TBOA 2X30A 4JXCA 3RF9A 1E51A 4JDBA 3CWOX 1B9BA 1OX5A 4MZ8A 3G0XA 1AW5A 4BI6A 3LHZA 4O14A 5FF0A 1B4KA 3CB8A 2FQIA 1C9DA 3W74A 2GJNA 3LI1A 5LNWA 3WJXA 3BW4A 3W72A 2DZTA 4PH6A 4FNRA 1DOSA 4JTSA 4MIMA 4I7VA 4WOQA 5KITA 3MI2A 4Y96A 1N7KA 3TC6A 1W5QA 3JR2A 3W1QA 3N9RA 3ATZA 3CEUA 4O15A 1TYGA 3O8AA 2E5BA 3L0GA 1KM1A 5H91A 3NQCA 4GRSA 1WXJA 1QOPA 2WNQA 1VYSX 3N9SA 5DXXA 1MEHA 4IX0A 1PCWA 4XTIA 3C2EA 3PY2A 4FEZA 1QR7A 5K9XA 4DF2A 1ZNNA 1WBJA 4EWND 3W7LA 2QCFA 4IPIA 4O17A 4D2JA 3LLFA 2FIQA 3LHUA 1KTNA 2KZHA 1NSJA 4LUJA 2YYUA 3G0UA 4O11A 1QWGA 4WX2A 5LGZA 2NXGA 2G97A 3EWBX 5DY2A 3GR7A 4FX6M 3FOKA 4G1KA 1KM4A 4KFPA 3NQ7A 3G24A 5HR7A 3MP3A 1ML1A 4AHPA 3WJSA 1QFEA 5EMUA 3TXVA 1IXOA 2CU0A 4RJEA 1F76A 2AQWA 2V2CA 3TK7A 3UPWA 4FIRA 3NG3A 3S5OA 2YW3A 4AXKA 5DLCA 2P1FA 4LY8A 1L6WA 4JR5A 4O16A 1QPNA 5CPLA 4JYDA 3M16A 5DY3A 1QDSA 2ZCGA 1GTHA 3Q58A 2H6RA 3ZFHA 3VFLA 1JULA 3W83A 3EWWA 1OF6A 4NT0A 3MJYA 3SW6A 2VC6A 4QNEA 4O54A 1PHWA 2Q8LA 5CSRA 1YTKA 4UTIA 1KM6A 1I2OA 5D30A 1KTCA 4AEOA 4UTKA 1XBYA 4LVFA 2YFNA 4UC5A 1L6SA 3P67A 1ME9A 3IGSA 1A5AA 4DQWA 1W37A 1MEIA 2Y7FA 3N2MA 1VPXA 4UTWA 3DH7A 3BVJA 3MMTA 5LNRA 4LVAA 4MFDA 1KBJA 4O52A 4PC8A 3HB9A 3TAOA 1GT8A 3HPSA 1D9EA 4LWWA 3W1RA 3KRZA 3CC1A 2WNZA 4U4MA 3U8GA 4UXDA 4MY8A 1S5WA 1TPH1 5IBXC 4NUWA 3LGEA 5D2XA 5J5RA 3OHIA 3S1UA 3KX6A 2UV8G 3W1LA 1W3TA 1YDOA 3H53A 4YCPA 3STFA 2NLIA 4FB7A 5A5WA 1TJRA
chains in the Genus database with same CATH superfamily
1BD0A 2QDGA 2VD9A 2ICSA 3PUGA 3NA8A 1G5AA 1ZHAA 2YL9A 5E5CA 4JKMA 1W9VA 4JQ4A 1K9FA 3WLOA 4BHYA 1E43A 1TRDA 2ESCA 3EWUA 2ZRWA 2A85A 3MYOA 1TA3B 1EPVA 5MKGA 3NPVA 5HNUA 3LPPA 3QR1A 5CKSA 4UUIA 3LV6A 4PTNA 2GK1B 1B90A 3ARYA 3VA8A 3VGHA 1W6TA 1CI1A 2XIMA 1P6BA 5CGQA 4X9SA 1UG6A 2QIIA 2ZZ2A 1XBVA 1MNSA 2OGYA 1AMKA 1RAKA 2J79A 4LSBA 3H54A 2W92A 2GSHA 1Z32X 2CZ5A 1Y7VA 3VUPA 2XSXA 1KC7A 1C8XA 4GQ0A 4DBUA 2B81A 5CJMA 4MWAC 3KDOA 3DFYA 3GKAA 1IWPA 3DI0A 1C29A 3VKJA 3IVUA 4NX5A 4R3UA 3I7SA 1KV8A 2YCIX 3W71A 5HWMA 1CXIA 5C71A 1W5OA 4GI4A 2Y70A 3VKKA 2XPKA 1M7XA 1V3KA 2V3EA 2VZUA 2FPTA 4QFUA 1SFLA 3RU8X 3SECA 4AWTA 3WZ0E 4QJ5B 1ELSA 1QT1A 1H7NA 4OBTA 1YEYA 2Y8UA 3HG2A 8A3HA 4OHQA 4DO7A 2BWGA 1XISA 3L5LA 3AYVA 1XLAA 2WJZA 2DPEA 2AGKA 5F2IA 4B9ZA 3VTRA 2PDGA 2AL1A 4PUKA 4CNUA 5H8UA 3PZUA 4RLIA 3IAQA 2QAFA 1UQZA 3DGBA 4C6BA 2BY1A 5FJTA 5TIMA 1WYIA 2X1UA 1DWGM 5AYIA 5A2AA 3QV6A 2X7VA 1QI3A 3LXAA 4JNZA 5LXXA 4BCEA 3TN6A 1QU4A 4Z08A 5I6SA 4LGXA 1PKNA 3P2VA 1TWWA 5EBAA 5GJPA 1CGUA 3OW1A 3CUZA 3FJ4A 1MFVA 1G4TA 2G5WA 4UTTC 4GGHA 4WKHA 3L21A 3F5JA 4WK9A 1XLMA 4QAWA 2QPSA 1ZB5A 4ACZA 4B4FA 3WNMA 2W66A 5E70A 3APYA 1JR1A 3HQ1A 2NQ9A 1DWFM 1UZDA 5D4YA 4EKJA 1JUKA 3B0VC 3WUBA 3TTQA 3UZYA 4KWUA 3T0AA 2D20A 1A5LC 1E4NA 1J79A 4ZQMA 2PTDA 5K9CA 1NP2A 3URAA 1XV8A 2G3NA 1MXDA 1UZ1A 1MQRA 1TV2A 2AKMA 5DRCA 2O7QA 4DHGA 1PTDA 7PTDA 3C2RA 4JTUA 3W00A 5LIXX 3EMCA 3TU9A 3GSMA 1YE4A 3CZEA 4E0CA 1F4AA 1J9YA 4LEFA 1E71M 3WLPA 1XRFA 3CAVA 4PMZA 1AL7A 2D2JA 3EDJA 3PZIA 1GVFA 5FEXA 2VEKA 2FZMA 4M1RA 3DFQA 4GLEA 3AMCA 4MFEA 1H7PA 1JG9A 1L2UA 1LLOA 2POTA 4POCA 2OVLA 3VNMA 5MF5A 5FEWA 1VBUA 2OEKA 5EMMA 3B8DA 1UOZA 3L7RA 4R5EA 1GYLA 1J11A 5AHIA 4YYFA 3MMDA 1NFBA 4B5SA 3OEXA 5EGRA 4O1AA 4XAYA 1EGVA 1IZCA 3S4TA 3MJMA 3ZR5A 3W2NA 7A3HA 2ATMA 3CHFA 2CW6A 2VENA 2V69A 3NEVA 4PULA 3M46A 5AHNA 3WNLA 1V3LA 1X39A 2J8GA 5J04A 4M6QA 4CQAA 5AYZA 3MY9A 4QS5A 1O95A 1TSIA 3KM8A 4DPQA 3N4FA 4RNHA 3T7VA 1XHGA 3WQ8A 1SMDA 1KTBA 4Q7IA 1LYXA 3TNBA 4K8EA 3WCZA 4UFIA 3H2FA 2I16A 5HULA 2OEMA 1B1YA 4TX9A 4EOUA 1B3ZA 1QVBA 4ZXLA 3GHRA 4RPQA 2A21A 1BSLA 1SU5A 5DANA 1BTCA 1Q6LA 2XGBA 1SR9A 3SDOA 1CT5A 3B9AA 3GXIA 2R8WA 3ANYA 4MWAE 1THFD 4AISA 4IWWA 3LERA 1HL9A 3GR4A 5BYWA 4AU0A 1I75A 1PJ9A 4QP0A 2ACRA 3IUHA 1VPYA 5K2ZA 4LBUA 1POJA 1BWVA 3BGJA 3B04A 3NQFA 5G5IA 3T4WA 3NXLA 5ABFA 1JCNA 5CLWA 4Q33A 3A5FA 3W7NA 4PMQA 6REQA 1QW8A 1JZ6A 2HBXA 1MSSA 2A7NA 4URIA 1E6QM 2QUVA 4WY0B 2FHFA 3C86A 2O4MA 2C91A 2QMJA 1UD5A 3KRUA 2QCMA 1E0XA 2CWNA 1FCUA 5HANA 4HU3A 3STPA 2WVVA 5CGMA 3VNZA 1GTEA 1GJUA 2Y0FA 4PCPA 3TMLA 4P7OA 1PKMA 3AYRA 5JXQA 1H7RA 4HU0A 4GQQA 3M0HA 3HF3A 3S1XA 1XKJA 3URQA 3GHTA 1P0EA 3CASA 3T6CA 3HPFA 1J2BA 3QH2A 1CXEA 3EX2A 3CIXA 3AHZA 1UMLA 3TZNA 5LNUA 4OWGA 4GI9A 4H83A 3RPDA 3V0UA 4GUIA 3ZS4A 1C3FA 1EC7A 3SRHA 2FGBA 3LGGA 2BTMA 2PRHA 4GIYA 3MO4A 3KL5A 3EWCA 3WF2A 4CNPA 4I7WA 5BRBA 1ZENA 4RL3A 1W56A 4JHZA 2IMRA 3BAXA 3W9ZA 3VD3A 1P43A 4AD3A 8XIAA 1VFSA 1GVIA 2CPUA 4K7YA 3THAA 3OG3A 2VFGA 2WAGA 4I9MA 2QJNA 4L65A 4ALDA 4FMVA 1OBAA 5FEZA 4W7WA 5D38A 4AZ5A 3QHNA 4JGDA 1BRLB 1ZY9A 2VZTA 3E2QA 3GNNA 3IV3A 1W3HA 4W89A 4KRUA 1YLVA 4QSHA 2CBJA 1XUZA 1EHAA 1JCYA 5D9OA 3W2KA 4P7QA 2JALA 3TN5A 2Y85A 1CENA 3NL2A 1VFMA 1LCOA 4GBDA 2XM2A 1YXYA 5M03A 1JZ2A 5I3HA 3FY1A 4V1XA 4Q8OA 3BC9A 4S3DA 1ISWA 3V1PA 3F2BA 3FN9A 1WKEA 4HN8A 1FBAA 3BOLA 5AOUA 1RQHA 5BU9A 1KRMA 1ONWA 1EZ2A 3WQDA 1LBLA 4E38A 1ZAIA 4JTJA 4NVTA 1A5MC 3GU1A 3ZQ9A 1TV3A 5LIWX 5A2CA 1OC5A 3VYLA 3FCPA 3OZOA 3EOEA 3W86A 2W0UA 2QCDB 3CS2A 4A3YA 4QDPA 1LP6A 1ONXA 2CHRA 2IPWA 4GWEA 3II1A 4AZ6A 1WZKA 4QCEA 2BOFX 2YLLA 4UTJA 3GXDA 1VKFA 1YQ2A 3OOQA 1F05A 4AF0B 2PCEA 4PUEA 2IXUA 3ICJA 3N14A 3HU7A 5LIKX 4HK6A 3NNTA 3AIRA 4AYSA 2WJDA 2P3ZA 3VNLA 1BAGA 3AICA 4D1JA 1R46A 4YL2A 1XGDA 3P62A 4LTSA 2X16A 2GGIA 1D3GA 2WPGA 3GDMA 4XAGA 3OIXA 1I9CB 2FVLA 1LRTA 4KT2A 1UR0A 2EPNA 1PBGA 3TONA 1A49A 1XRTA 4FX7A 3G8RA 3A3HA 4U5IA 1YMYA 2P3EA 5A6TC 3VOFA 4AWEA 3BLKA 1SM9A 5HNRA 1TVLA 1QNPA 3U7BA 1HKVA 1HP4A 2Z7KA 3WFZA 3TSBA 1FCVA 3WQOA 1JD9A 3IJ9A 4AX6A 1GVSA 3C52A 4O18A 2AMGA 1XX1A 3LCIA 3W1NA 4H19A 3TN4A 1T0OA 3AXKA 3VKCA 3B0UX 3ITVA 3T4CA 2J27A 1P4CA 3NO1A 4C6DA 1Q6OA 4O4WA 1EQCA 2YDQA 2ZQ0A 1IZJA 1R2TA 7TIMA 2DZSA 3R10A 4CKQA 2WSKA 1YPFA 4A29A 2RKXA 1VIZA 3KE0A 2WPBA 2HS6A 1NQ6A 3UXKA 1ZZMA 1LRQA 5DT7A 3G8EA 3GRIA 3W53A 2A5HA 2WBGA 1WKFA 5U4NA 1FWHC 4L1GA 3PR2A 4ILSA 1T6MA 3EWXA 3FA4A 3GYCA 1W1YA 4H9TA 4JIEA 1E4MM 4M80A 2OODA 3B8SA 4C5ZA 2J75A 2ALRA 1W1TA 3M5VA 2E40A 3T0BA 2FZ8A 1JCTA 4B15A 3NZRA 4IISA 3LHWA 2NT0A 2HROA 2RGLA 3G1AA 4C1NB 3W24A 3UWWA 3BMXA 4GQBA 4J3SA 5CPQA 3NSXA 4A8NA 1LDCA 3VIPA 1LG1A 2NXHA 1ZLPA 4J2MA 3SCRA 2O56A 2A4AA 3NQMA 4GFIA 3B0PA 3W23A 1US0A 1WDPA 2VNCA 4FR1A 3CXOA 2WCSA 3TMQA 4WJEA 3N6JA 3D5HA 3I7RA 4HYRA 1F3TA 1ECEA 3D46A 3WDQA 2NT1A 4QTGA 1LRNA 2OLSA 3IGHX 3T44A 2YXXA 3P14A 3GKFA 6TAAA 2PLMA 3RLHA 1EP1A 1F2JA 2V6AA 3EOOA 4G1NA 3USZA 4YNGA 4BFAA 1R2RA 4W5ZA 4TVDA 2EG8A 3T40A 3KLKA 3G6MA 3GYEA 3S5SA 1JYNA 5KZMA 3N6HA 2D0FA 3OGVA 2HEJA 2EPMX 1VGAA 4GYPA 2DIJA 1XDJA 3P60A 3RITA 5JH1A 4H3DA 2PTXA 5HDRA 2ZTJA 3WL1A 2OCZA 4KERA 1JI2A 1V3JA 2QIWA 4Q4RA 1GEHA 3I3DA 1NIUA 4L6DA 2PDIA 1MEWA 2ZDRA 2H8ZA 5CSSA 5I77A 3VABA 4EAMA 4S3JA 1W32A 2BBFA 3R13A 3IK4A 1K9EA 2VMFA 4G8TA 4RNFA 4IM4A 1EEPA 4C1LA 2JIWA 1VFHA 3FKRA 2V2HA 2H90A 3TX9A 3UGRA 3VZXA 3WQPA 2Q3RA 2QF8A 4IP4A 1U1JA 3BG9A 1P5BA 4HNLA 2BASA 5JU6A 4U28A 2YGYA 2GQAA 3LRLA 3E0FA 1XDMA 3LPOA 4F48A 3PTDA 1ISZA 3VDGA 2IQDA 3KBVA 1XYZA 3GTXA 4MUPA 3MP4A 3WLLA 3MYPA 3S9YA 3WNKA 1EUNA 3NOEA 1GJWA 3NEHA 3LD5A 4AW7A 4RZ4A 3WBAA 2D69A 4EWJA 3WUEA 1XD1A 2V5CA 3AXMA 4C60A 3MUCA 5K3VA 3B8UA 4O12A 3PULA 3BK0A 2YCLA 1JQVA 3FYPA 1V08A 4C6MA 1EXBA 1QHZA 2IPFA 4XAPA 1IE7C 4IMAA 3W2JA 2VX5A 4QQ3A 4B5WA 3HPAA 3GZAA 1G4SA 3GNOA 4MWAD 1OVDA 5BZAA 1A5SA 4ECLA 3ZSSA 5HPOA 1ZBCA 3LX9A 1HKJA 3WDIA 4QBXA 3A3WA 4AD1A 4GG9A 1XUUA 3AHXA 4XKYB 5ABHA 2W6RA 3XINA 4Y2WA 1JAEA 3O16A 3RM4A 4NJJA 3RFAA 1DBTA 1XBZA 1XCXA 3P6LA 5JIWA 2HMCA 5DBUA 4E4FA 1X6NA 4MY1A 3F03K 2PI6A 1YDYA 3L5AA 2NQHA 3B9DA 1QPRA 1EJRC 1RA0A 4NNAA 2NUXA 5A69A 2XVGA 2PGEA 4RE2A 3PJXA 4AEFA 3BE7A 3C0SA 2VVNA 2EPHA 1WAUA 2PUZA 1CX9A 3W82A 2VEIA 1S39A 4TMBA 1V0LA 3HURA 1DJQA 4ZOBA 3TJ4A 5BOEA 1MO0A 2VQUA 4TQTA 1WZAA 3EPMA 4NJIA 3VXGA 3NTYA 3SCQA 4HSOA 3RMEA 4JTFA 4W85A 4REQB 4JHOA 4CQDA 3ZM8A 3FA5A 3RO8A 5REQB 3FJLA 4C5YA 4QLJA 2Y63A 2X1RA 3FAXA 1BQCA 2QCNA 3FS2A 2ATSA 4C90A 3I6RA 2DSVA 1JVNA 4R85A 3WH6A 4DZAA 2GLKA 1KD0A 3I3EA 1W2PA 5I03A 3VDHA 2ZWZA 5KZDA 9XIAA 1TX2A 2WMGA 5AECA 2BMBA 4N02A 5HWJA 1UWAA 3EWYA 4QEHA 2YX0A 4PN2A 5CC5A 5A95A 3DESA 2Z4GA 2INZA 4C65A 2QUNA 2R1PA 3ARRA 2GFTA 2YCKX 1RSCA 2A0NA 1E56A 4KIEA 1JEZA 4N2YA 3UGVA 1UPMB 4UTWC 3OA3A 4HQVA 4ES4A 1VJSA 4TMCA 5G2WA 5JBEA 2GDVA 3HGSA 2O92A 3DHDA 4RW5A 4B3LA 4NXSA 1Q6EA 1WXYA 2VXNA 3RN6A 3T42A 2W9MA 1WAWA 4HHMA 2PMQA 3DG7A 2RUSA 4PSRA 3IJDA 3TOPA 1DHKA 3QV9A 4EAYA 1W2VA 1UA7A 4CU6A 3S1GA 5C9ZA 2NQLA 3ARXA 4XUGA 3E2SA 4PMOA 5CPSA 3AU6A 3B8VA 4HMCA 4DYKA 1P1XA 4J5NA 4IL0A 3O7UA 3QPYA 1W91A 4ZEPA 1KW1A 1A0EA 1LTDA 1IZKA 1N55A 2WKGA 3RJYA 3AJ7A 3H26A 3AU2A 3LSBA 1CYGA 3RJXA 8TIMA 1I6NA 3B4YA 4IG2A 1S2UA 1SZEA 5HK4A 2OOGA 3G3MA 1J18A 4H8VA 4MKVA 4EXBA 4I9JA 4JIRA 3TP4A 4PTXA 4W8BA 2J13A 1XYAA 3E0IA 4NF7A 5BW6A 3TA6A 3F5LA 3MSDA 1NU5A 1QNSA 4KEZA 3QYSA 1N82A 4K68A 3VK5A 4Y6GA 5A2BA 1RY8A 1KV5A 2TPSA 2YPIA 3OP2A 3UYCA 2NX3A 2Y5SA 4IH3A 2XH7A 3RR4A 3LA4A 3PWAA 3W1MA 3BGGA 1OFDA 1TMHA 2XN0A 3EX1A 3VD9A 2DIKA 4IHCA 5FJPA 1VP5A 5FSEC 4K8HA 3PZOA 1H5YA 1HP5A 3EMQA 3M0XA 2VI0A 3WQGA 1ZAJA 3P5ZA 3E0VA 4ICCX 2I9EA 4HJWA 1I1XA 1PYMA 3LXCA 5E0FA 1PEZA 1IXNA 3JZUA 2BXYA 5DEZA 1LOLA 3MMUA 3IJIA 4Q8QA 5FJRA 2XIOA 4FOKA 5C2GA 4GKLA 2C19A 4MB3A 4GABA 1VHNA 4I90A 2ZYFA 1YTDA 2GUUA 3GWQA 2RDWA 2HXUA 4E4PA 2R14A 4NL1A 3REQA 2PCQA 2ZRVA 4NI8A 2X7WA 1PCKA 3SFWA 3O6AA 2YSWA 4GCAA 3SCUA 4A3HA 3ZLGA 3SJ3A 3CHDA 3FXGA 1MWOA 2J24A 1TJ2A 4UFKA 1FWJC 3C8NA 4UR9A 3K5XA 1TVNA 4MPQA 2EF9A 1IEQA 1GEQA 2WM1A 3RO6A 5FCZA 4PL1A 1FWBC 4WIWA 3HBLA 4AVOA 1W5NA 1VYRA 3BV7A 4GYFA 2W67A 5DT5A 2QPXA 3MKVA 1MXGA 1FDZA 3G5EA 1CLXA 3N73A 1DVJA 3QOKA 4LYKA 2EPKX 2J47A 1SUXA 5DF0A 1ZUAX 1ITCA 3STCA 1XIIA 2DJXA 3RR1A 2D0HA 5BMWA 3G77A 3UWUA 4P61A 1BF2A 5LA0A 1AG1O 2WMKA 1XCFA 2Z6JA 4A05A 3GM8A 3M0JA 1TE6A 1VFLA 3GC5A 1C91A 1UASA 2YKKA 4PRWA 1UPPA 4IZGA 4A6GA 2VGIA 3A47A 1XIMA 4LUTB 4MNJA 3U4AA 3BAIA 3ZSTA 3MUAA 4JD4A 1QTWA 3B97A 4AQLA 4S23A 4BZYA 1DTNA 3M43A 2WMHA 1FWNA 3EWDA 3KTSA 1E6NA 1LLZA 1XLJA 1X38A 4ZFCA 1DYSA 4Z1DA 4JTIA 3BG5A 2CLFA 1OYCA 2C8NA 1T99A 1A53A 1GZGA 3LS9A 4PUNA 4HPHA 1HZYA 4J35A 4CD4A 2PDJA 1A5UA 2YOCA 3PFRA 5I06A 4FLRA 2JGYA 2Y61A 1RVGA 3CV2A 3WQ5A 4WHBA 3WQWA 2HK1A 2BZNA 3SFKA 1I2QA 3TNOA 4HZ8A 3WLIA 4DNMA 2F2HA 5CC3A 1F9CA 1E1CB 2ACSA 1SW3A 1OCBA 2ZOXA 3HTWA 1R3QA 2E4TA 3GQYA 2HV5A 4PMVA 4O19A 4D8LA 1UR1A 2OT1A 3FNDA 3SR7A 2JF6A 2VZSA 3DGRA 5J5DA 4ZTXA 2F8QA 1H5VA 2G4JA 1SZNA 2F61A 4L4PA 3K2GA 2DT1A 1C8QA 2CNCA 3BSGA 4WXZA 1UMYA 3S3GA 1TWDA 1UJQA 1FP9A 4UR7A 2YDSA 1T5AA 5KZ6A 4JEJA 2OYLA 1FHVA 4JCMA 3AAMA 4PEEA 1K02A 2BXZA 3ENLA 3LOTA 4D6EA 3JZEA 3UZWA 1R3RA 4Z0SA 3NDOA 3E38A 4L80A 2VRJA 2J88A 2QV4A 4RDVA 1E15A 4CQ9A 4F0RA 2O9OA 1PVNA 4WOZA 3WDHA 2HNEA 3UY7A 3NZPA 1Q45A 1L0PA 4MJ2A 3AOFA 4S38A 1YKWA 4S3GA 3QW3A 2BOGX 5MHBA 1XLIA 1HKKA 3KVMA 2NW0A 3S8HA 3ARZA 2ZE0A 4LC6A 1P48A 2OX4A 1VS1A 4ZQNA 3UF9A 2BGNE 3QGAC 1W8SA 4XZMX 1N2VA 4H9VA 3BG3A 3G1YA 2X30A 4L5ZA 3W37A 1HKMA 4YTTA 3MV01 3CUIA 3SCSA 1VF8A 1AJ2A 2PDKA 4MZ8A 2DT2A 4PRRA 3N15A 3TCSA 3LBOA 1XG4A 7XIMA 3MSRA 4EPKA 2J25A 3TYEA 4P7RA 3BW4A 3W72A 3WG6A 4PH6A 2OELA 2X0HA 2OO6A 4AUBA 4MIMA 4OJYA 1PKLA 3MI2A 1UR3M 3JR2A 3W1QA 3ATZA 1WXJA 4XUYA 1QOPA 2WNQA 2V3GA 5DXXA 4TV5A 4XTIA 1LL6A 3IS4A 1I1WA 1CZ1A 2JEPA 3M64A 5K9XA 2VEFA 1SJAA 1WBJA 5CAHA 1Q8AA 3F4CA 4EWND 2QCFA 3T8LA 1SJCA 2YB4A 2QLYA 2QHAA 5FJIA 2KZHA 1NSJA 2UY4A 4M8UA 4WDUA 3BWWA 1Q66A 2DZAA 5LGZA 1HJQA 2CHOA 5DY2A 3GR7A 4FX6M 2NVCA 3NQ7A 3ITCA 3G24A 1DE5A 3GXMA 3PZVA 4GX8A 3WJSA 5CBIA 3IWPA 1B3XA 2DV0A 3A9BA 1Q6FA 2XIJA 5BROA 4ROQA 2CU0A 1BYCA 2AQWA 3UPWA 1C90A 3NG3A 4LAKA 3KCLA 2P1FA 4JR5A 1WDQA 2AOSA 5DY3A 2ZCGA 5EB8A 3TYCA 1EYEA 1X6LA 4EPBC 1JULA 1HKIA 3W83A 3EWWA 1QBBA 2D2HA 1DIDA 3T07A 4O54A 5DRIA 5CSRA 1DTUA 3LMYA 3SQLA 4MB1A 1KM6A 1I2OA 2HK0A 1XP3A 2CXEA 4PSPA 1XBYA 2YBTA 2YFNA 1JAKA 4W93A 3B0YA 2ZUWA 1OIFA 2WMIA 1AODA 1A4MA 2Y7FA 4UTWA 3BVJA 2YCJA 4HCDA 3T9PA 4HZ6A 5BCAA 4DIAA 5C8BB 1D9EA 3WF0A 3MV11 1Z7AA 4U4MA 2BGQA 1TX0A 4DJDA 1TJ1A 2G50A 1TPH1 5IBXC 2QT3A 4NZCA 4NUWA 4QG6A 5A8MA 3H53A 1NFPA 2NLIA 1MW3A 4C7DA 5AVNA 3C0LA 3N9KA 3TQVA 3H22A 4FNUA 4NZ1A 2PDBA 1SJBA 4NJHA 1NOWA 2QJJA 3UZ5A 1UJPA 3MSGA 1M7OA 2FB3A 4RZ6A 2GJLA 3W7OA 3HGJA 1P0DA 2B7OA 3BARA 3THCA 4AAJA 1EZWA 1RLCL 2FH8A 3GHUA 2XWEA 2V5DA 4ZA0A 1PZ0A 4LCQA 1TTPA 3AFBA 4HMEA 3BLIA 4QM1A 3WF4A 3KDNA 3V18A 3V4BA 3KBSA 3AI0A 2Y6ZA 2YA1A 4IQDA 4Z42C 1YHTA 1JUBA 3S42A 2FTPA 1XSIA 5C9UA 3QZEA 1E3XA 4WDTA 4W5UA 1EJSC 4GACA 1O94A 4UQDA 4IMDA 4LYQA 4UFLA 4MKNA 4PB3A 3KVLA 1LROA 3EX4A 2WYSA 3VC6A 1JI1A 1DORA 1OGGA 2PDHA 3L4TA 4Q3MA 1Z48A 2I7GA 4A21A 1OFPA 1UR4A 1ZP3A 2WMFA 3D47A 2XIQA 2DSKA 3IPWA 3N3TA 4JN6A 3WLTA 1Z9AA 4M19A 2WSPA 5CCZA 4ZL1A 1H62A 1HJUA 3UA3A 3WLHA 5EL1A 3RG6A 4JTAA 1P1MA 1XLFA 1OC6A 3GAKA 1NDYA 5D03A 2FMOA 4KWSA 5FI8A 3WBEA 3BV4A 1WPCA 3G1XA 4PMUA 3W88A 2QKFA 4IFRA 9RUBA 1BYDA 3NZ1A 3OBKA 1OM0A 1VBJA 4FSAA 1R85A 1OQFA 3S2JA 2BG5A 2XN2A 1EF3A 3ES7A 3P0XA 3SRDA 5KSWA 1ONRA 2XWDA 4DI8A 1H7XA 1X8CA 2QUMA 7ODCA 5E93A 1WDSA 1HL8A 1Y5VA 3MBDA 3W7CA 1MZHA 2WKLA 4QLLA 3QHMA 3WFAA 3FVDA 4AB4A 4GCXA 2V30A 3RU6A 3TC7A 1QNOA 1E9LA 3W3OA 4JIIX 1QI5A 1H0GA 5K4ZA 1LQAA 2ANUA 4GD0A 3VX0A 4XZHA 4Z2GA 3H12A 4C6JA 3VNDA 3E96A 1RHCA 1QRQA 4W8LA 1TCMA 1A0CA 3DFSA 3R94A 2W4XA 1R3YA 3QM3A 4TU1A 5MKGB 4JFVA 1PX3A 2NX9A 1N8IA 1JGMA 3O6DA 5C7VA 1MW1A 4O10A 3N04A 4PMRA 4RUBA 3OGSA 3CT7A 4GC4A 2TYSA 4C7FA 1F8MA 1EA0A 4OT7A 4H6KA 1L8PA 1LQ0A 1BPLB 3IRDA 4FXJA 2D3NA 1UA3A 3NGFA 5C5YA 3N4AA 2ADAA 2V82A 5FSDC 4MHBA 3WSUA 4KRTA 2DEPA 5HWNA 3GXFA 4DXKA 3FHAA 1OCJA 2OWCA 3OVRA 3BQ5A 5A6KA 8XIMA 1FH8A 2WZEA 4RZBA 2PS2A 3MANA 1IEVA 3JRKA 2IXVA 1S2WA 4K2SA 2C1GA 3FSTA 4MG4A 4MDOA 1PUDA 3FV9A 1VLIA 1O12A 4PUWA 2NV9A 3O0KA 4DJFD 3UJRA 3WQ4A 1GHSA 1Y0EA 2J62A 2WXDM 4MNLA 2ZA1A 3M47A 4LV4A 5FL0A 3RRAA 4QXIA 4IIDA 3VD7A 3WDPP 1LBFA 1R9ZA 3EKLA 5D32A 3A4WA 4HIBA 4YTQA 4MY9A 4A35A 2YDAA 1VIWA 3IIPA 2V3DA 3OPSA 5I00A 3KZSA 3FA3A 3COTA 4O0ZA 1FWWA 1SSDA 1UWUA 3KWSA 3KOXA 3WELA 3M41A 5A8PA 1B54A 1UH4A 3AYTA 3ZXWA 3K1DA 1EJVC 1ZJIA 3KW3A 4Y9AA 1V4YA 1V93A 2WZIA 4W88A 4IIBA 1TV5A 3UETA 1TREA 3WLMA 1XH2A 2Y7EA 1DE6A 1TPFA 4ACZB 1FA2A 3H8AA 5G1YA 4RDWA 2NUWA 5AY7A 3ABSA 1SO6A 4BF9A 3VX1A 2QULA 4OQVA 3H7UA 3IIOA 2DH2A 4EP8C 4PMNA 1XKYA 4DJED 4M24A 3QV8A 4GZIA 2C0AA 3GE7A 1RJRA 2J7DA 4GIEA 2EPLX 1W5MA 3N2TA 3LZ5A 4RX0A 2VC7A 4KFNA 1QCWA 3CMJA 4HK5A 5IRPA 1VBGA 3CO4A 3VE7A 1UH3A 3QGVA 4E8DA 1EQPA 2ACUA 1T7LA 4U33A 1TZZA 3L65A 4RNIA 4ATDA 1Q7MA 3VCCA 3LCLA 4GH1A 4LVGA 4MLJA 3CK5A 3BW3A 4D6GA 2QJHA 3GDLA 3W6MA 4LU0A 4WCJA 1W9UA 3CL6A 1JL8A 2ODOA 4K3ZA 3QXBA 1WDDA 2EQDA 4H8HA 1OADA 4H41A 2ISSA 1KB3A 3BTNA 4HP5A 1J0YA 1KXVA 3HFYA 1JZ5A 4QR6A 4ICMA 4HNVA 3EXTA 3W7IA 3W73A 3CZJA 1VR6A 5EU9A 1TTJA 1E4IA 2VFDA 2Y24A 2QF7A 4LQ1A 4BWLC 2I5GA 4F66A 1U22A 2VZVA 4GY1A 1FDJA 3PNUA 4NZ4A 1R3VA 2Z1WA 4B5UA 1BQGA 1EIBA 4F2UA 3IJLA 1HKWA 4N42A 1JPMA 1WBHA 1XQKA 3GU2A 3AMKA 1QNVA 2BY0A 4KWVA 2P53A 4NRRA 3UQNA 3K4WA 5LXEA 3SRFA 3B4UA 3PB0A 4UFHA 4K37A 4XQ6A 3ISIX 1RCOB 2ZXAA 4G6CA 2CLPA 1L6FA 7TAAA 5G4EA 1YNYA 3H2OA 1QPOA 1K7EA 3QC3A 5CSYA 1JDCA 2TRSA 2E3ZA 4ZSUA 3WLJA 4PUDA 3MU7A 5E9XA 1RV8A 1HJXA 3H24A 3M0MA 3K8LA 5F1VA 3DI1A 4J3TA 2CKSA 4PFMA 2Y4SA 4F3HA 1Y8BA 2QDHA 1IT7A 2ALDA 3IJQA 4LBRA 1ZJAA 3ITLA 2XGIA 1EKOA 1SSGA 1DKWA 1P0KA 3RX2A 4RR4A 2F84A 1GKRA 1KM2A 5C7HA 4AIBA 4NZ5A 3BSMA 4IP7A 1FXQA 3BMVA 3MA8A 2CBIA 4FF7A 2W79A 3HG3A 1I2PA 4MNKA 1YADA 2VFIA 1Y65A 3OLDA 3I10A 1ME8A 3MWCA 2ZX8A 3WY1A 4NZJA 1J0HA 3B3DA 1GW9A 2Q8XA 3G22A 3T0TA 4RNJA 1OG6A 3HO8A 2UZ9A 4AMAA 4GXMA 4DUWA 1SJDA 4IPPA 3W75A 3OZMA 2YZRA 2QAPA 1EGZA 2JE8A 1XLGA 3M0KA 3WNNA 5HUPA 6REQB 4A2SA 4GQRA 4UZUA 3NFUA 2FGLA 2J9XA 4HK7A 2GJXA 5DN1A 3DKLA 4DX3A 3AS2A 1F07A 4ZQOA 3PTQA 3CIVA 2ZBTA 1IT8A 1KFCA 3CHEA 2VX6A 3UWZA 1JQXA 2PAJA 3LRKA 2WVVB 1PSCA 1BG4A 3KAOA 1G7UA 2E9LA 3L23A 1Q65A 4WUIA 2OFJA 2QPUA 4PODA 4A8LA 4JY9A 1M65A 1ITUA 5IBXA 1WE5A 3K8KA 3WNOA 4C6EA 5AC4A 1G4PA 1GK8A 1GQNA 1WDWA 2FH6A 4L9ZA 4XTDA 1PDZA 1HQTA 2GVGA 2WMJA 5HBFA 1AQHA 2P10A 4B3KA 3ABXA 3U5UA 3NL6A 2O4QA 2UY5A 3LSCA 3G1DA 3D6NA 5AHLA 5BXRA 1W8GA 2W91A 2FZBA 3V0TA 3WF1A 3MUY1 3Q37A 3RX3A 2YLAA 3SUTA 5D33A 1NEYA 1UWIA 1HNYA 5A1AA 4Y90A 5JVLA 3KCOA 1DP0A 1NFGA 1JGIA 2OG9A 4QIUA 3GW3A 1CDGA 1U33A 3NL5A 1SFTA 5GNZA 1XD0A 3RRXA 4RV8A 4LVDA 1A80A 1RP8A 2VEGA 2FJKA 4N6EA 2EXOA 3NUKA 4RDYA 1RH9A 2FTYA 3SZ8A 4FNSA 1KGWA 1GQKA 4GNKB 3QSTA 2V63A 3WDRA 2VVSA 2HPMA 2HPIA 4HKPA 3S6DA 3LXBA 1SO3A 4A22A 2W61A 3LI0A 1X7FA 1GZJA 2UY3A 2PGRA 3LV5A 1V6YA 3E49A 3Q2DA 3KS5A 3AO0A 5AVHA 4ZSTA 1FQ0A 4Y9OA 1TCDA 3VNKA 5AC5A 4ZXOA 4KGLA 2WHJA 3LBMA 1MW2A 3WEZA 3T2PA 1X1ZA 3AHTA 3W7JA 3UG5A 1XLEA 4PE8A 4JDYA 3N12A 3SB0A 5IFTA 3GU9A 3F4NA 3AALA 3ZT5A 3QFEA 4FF5A 3N18A 3SI9A 4HOXA 1O66A 4JTHA 3C0QA 3SGUA 1E4LA 3V7PA 3GXNA 3ECQA 3TYZA 1GCYA 3U57A 4B92A 1JPHA 4LANA 1M6JA 3BLLA 3LCHA 4JNMA 5DMNA 4ZBCA 4KS0A 4R34A 4O8AA 2A3LA 1FUYA 2PDWA 3W0KA 1K3UA 1H2JA 5H8MA 5D04C 5HMFA 2WV8A 2PZNA 4WSJA 4ICNA 5AHEA 4KKXA 1B3YA 2PDCA 1DHPA 2RJHA 4GVFA 5HUOA 1UBPC 5G4HC 2EG7A 1ICSA 3E2RA 3W7GA 4HNCA 2R1KA 1IIHA 4US5D 3O6YX 2B31A 3W81A 1MVYA 1XF0A 4L61A 3HGRA 4ZMGA 2F7FA 4FXSA 3DBNA 4X61A 3NDZA 1SPQA 5H2ZA 4UMBA 2PWFA 1XL9A 4J3WA 4L56A 4DAFA 2E8ZA 1QW9A 3DFHA 4OGZA 2PEVA 2RJGA 3N2OA 3T2OA 3H23A 2XSBA 3R8HA 3TAKA 2FB2A 2Q6ZA 1NH6A 3PJWA 4CN4A 3ZVIA 1KR0A 4C91A 5A3HA 3MCNA 4GJIA 2IKHA 2RDXA 4S39A 4F4RA 2QUTA 3MT1A 1WOBA 3QSRA 3S6OA 4Y9NA 4EIVA 3F2DA 4MJ4A 1FFRA 4ZENA 3W7MA 1TRIA 4AYGA 2GGGA 1EIXA 3OTRA 4XVDA 1W1A1 4TIMA 2XTKA 3FVMA 4IJCA 3TTYA 1ZBWA 5I02A 2A3EA 4Z2HA 1VCGA 3WLNA 4PBGA 2PLKA 1YX1A 4PCTA 4X2RA 5HJLA 3LY0A 5HNNA 3JU2A 4H6RA 2PWVA 2RH9A 3V5FA 1LL4A 2E77A 3C4UA 4PL2A 1UKSA 4CLMA 2R82A 3WF3A 1OJXA 4WY0F 1V0KA 4G2DA 4OE7A 3LLDA 4DI9A 1TUFA 3P81A 4HYWA 5M17A 2NV1A 2J8FA 4L64A 2CERA 2Z24A 3VO0A 1VJIA 4L4OA 1JZ7A 1OB0A 5I78A 3EOLA 4L4LA 2BVYA 1SMAA 1GQIA 2OZ0A 4OBRA 3BH4A 4LXFA 4O1CA 4DYJA 2CLIA 1KXQA 3BANA 3CPRA 2W63A 1UWSA 4Q8WA 3TSMA 4KBXA 1RCXB 3GIPA 4QE4A 1TPUA 1OFQA 3UERA 1WDRA 3M5XA 1CB7B 2PZ0A 3WK2A 1JD7A 2J78A 3R4IA 1GPWA 1VRDA 4LCSA 1DJNA 2DZWA 3OLEA 2VJXA 4K38A 3GXPA 4K39A 5IM51 4GGBA 2BDQA 2E0PA 3PSWA 1H1YA 4DUXA 1I2RA 5L9FA 3UCQA 1BVZA 4QJ3B 4CEUC 2NQJA 2OGJA 4G7FA 2R24A 3GVRA 3PG9A 3UXLA 1ZS2A 3D0CA 4BWLA 4JTQA 1OT1A 7CGTA 1V6XA 3GTFA 3B8TA 1ZPTA 2OO0A 4LYRA 5F4SA 4FLOA 3FSUA 3WD0A 2C16A 4ONVA 1M04A 5I3JA 4H9MA 3OGRA 4OU1A 3HOJA 1GG0A 2Y88A 3WLKX 3RLVA 4H6EA 4RV3A 2WZHA 4X0NA 5HPCA 1J93A 3EPNA 2HVOA 2XN1A 4DELA 3M9YA 3GIQA 3SSJA 3S5YA 2J66A 2CESA 3OU8A 5EPDA 1XYMA 2GZXA 2YBVA 5KEZA 2YCLB 4YHEA 3GNPA 4DRSA 3TYUA 3UZXA 1GHRA 3W2MA 2PBGA 3SCWA 1CCWB 3MWAA 4RW3A 1CBGA 2PP1A 3ARPA 3V35A 4NAEB 4DVOA 2OOFA 4S3AA 1HFBA 3UJEA 2C1IA 4DWSC 1HG3A 1CGWA 4M3PA 1DJIA 4KEMA 1XYFA 1R0MA 2Q8ZA 2QS8A 4J3XA 3BURA 2W3ZA 3ID7A 1KBLA 1J4EA 4IT1A 3DG3A 3T78A 1VCVA 3L66A 1F8IA 4IPJA 2V9DA 2CXGA 3TYAA 4QEEA 3BJTA 3GBEA 3WJWA 4S1FA 2FDSA 4AC1X 4JKLA 2I17A 4UZSA 3VE9A 1H1ZA 1M41A 2YB1A 4DWDA 2E6YA 3ALFA 4AD4A 1NTHA 4IMCA 3PBMA 4I5UA 3A22A 1S3TC 1BWLA 1FP8A 1UB3A 4NP7A 5T9BG 1UP0A 1L6YA 1JCLA 4MB4A 3VOHA 1KQZA 3PF3A 3A4JA 2WCAA 4CNNA 4W84A 4ZFMA 4AIEA 1BKSA 4JTGA 4N9BA 4PYSA 3URBA 5JBFA 1K8CA 1JZ8A 2GUYA 3EB3A 5AZ0A 3R7MA 3VIOA 3WD4A 1E6PA 3CB3A 2VHLA 3L2IA 4IUGA 1TMLA 1E72M 4HOWA 1O4UA 4O1EA 2AAMA 4D9PA 3B05A 4LEQA 5I24A 1FX6A 3LPFA 2VQTA 4S3FA 3VIJA 1V5XA 3VM7A 4W7VA 2ZVIA 5CAKA 3SADA 2XVPA 2BVWA 2JEQA 3S5NA 5D09A 4Q8VA 2DT3A 5JMUA 4XISA 2DZUA 3B9NA 1K9TA 3PSVA 1Q85A 1XYCA 4GVGA 4PTDA 1A5KC 3VU2A 1XIDA 3NSMA 3MHFA 3CT2A 2CITA 4OUIA 3EAUA 3G1SA 1GWJA 3W6YA 3MMWA 3ABOA 3U5YA 1ZAHA 1OCNA 3A3XA 4DPPA 4UNIA 4AZCB 5DCBA 2JBMA 3DYPA 1KM5A 4L7ZA 1S5TA 2VT0A 5A94A 3MZNA 2YYTA 4TX8A 2E8YA 4I7UA 1FWDC 3LBCA 3BPWA 4W86A 1Q7ZA 5C9WA 3E0WA 4P5UA 1FKXA 1JYWA 2CLMA 1HF6A 2HE5A 1P6WA 4XV0A 4UQAA 1AK5A 1BWKA 3W7EA 1EOMA 2WC7A 2NXIA 1Q7QA 4ZB5A 3NCOA 4B3ZA 1JF5A 2PC4A 3QQ1A 1SZGA 1ICPA 2YCEA 3FDKA 1UOKA 1MFUA 2FJUB 3FYOA 3FEMA 1S2TA 2AQVA 5EKYA 1J2WA 3CQHA 2VELA 4XO7A 1ISVA 3UA4A 3IAPA 4PUUA 4PCSA 1E0TA 3CO8A 4M6PA 4C7GA 1DL3A 2GQ9A 3FYYA 1OT2A 4J7RA 2WC4A 1WO2A 1ISXA 4IG2B 5D2WA 2BHZA 3NZGA 4MZYA 5HJXA 2XINA 4ZO8A 3LU2A 3MSYA 2EEXA 1V02E 1QUMA 2OEJA 3AWOA 1BLIA 5GPRA 3O15A 3TE9A 3UCCA 2X40A 3H6OA 1FHDA 3GS6A 3O3RA 1EO7A 4R7OA 1E0VA 3L5MA 2VL4A 3RLUA 4JN8A 3M1ZA 2E6FA 3WK3A 3U2EA 2IW0A 2B7NA 4U5KA 1TB3A 2IKGA 4IPNB 3CWNA 2CZDA 1JDAA 2FGZA 4JQAA 1XC6A 3ARQA 1I0DA 5GJNA 4YPJA 5DCEA 1FWCC 4LNYA 1UHVA 2X0SA 1GW1A 1S2CA 1WV2A 1H0IA 3VAVA 1OSEA 3PK7A 4BF7A 1O5KA 3GW0A 1VRXA 3MI6A 1QATA 3HG4A 1KWKA 4BI7A 2DUXA 4IP5A 1JUEA 2YL8A 1Q6CA 1E0UA 2HNHA 5BRQA 1R9XA 5F7UA 2X1IA 2E1DA 5FL1A 3CJPA 4XKMA 5HQMA 3LGDA 1GOQA 1B5TA 4JKKA 2PTWA 1O5RA 2CIPA 5BMXA 3KOFA 1R3WA 4X3ZA 4GINA 3H2AA 1XWYA 3E0LA 1VCFA 2BY2A 1C7SA 2BSLA 3ANVA 3UVIA 3NPWA 4A3QA 3APTA 4Z1AA 4R7WA 3REQB 4I5RA 1I4NA 3K4AA 1QK2A 3FKKA 4AH7A 3VILA 4UOZA 3KFTA 4K6AA 3MUZ1 2J9YA 3ITYA 1PX8A 4Q4PA 4EXAA 2WSYA 3UXDA 3VUSA 2CZFA 4R33A 4IJBA 1KFKA 1UKPA 3TQ0A 3BAKA 3W85A 3EKGA 1OK4A 1W3NA 3AROA 2Z2UA 2WK2A 2X42A 1IT0A 2ZUVA 3WH9A 1SFJA 3YPIA 4F40A 5I3DA 3B03A 2ZC1A 4PMYA 1U5JA 4XZ9A 1KQYA 2VURA 4KWWA 2EAWA 3K13A 1HO4A 3NZQA 4UFMA 4C6KA 2QQ6A 4HCHA 4LF1A 4D6DA 1KCXA 5LGXA 3U9IA 3WBYA 4NYUA 2BX7A 1UP2A 3IUIA 1XQLA 4LUSA 2GVJA 3AUOA 4E5TA 3WLQA 1DPMA 4OKDA 3MP5A 3LNMA 3UY8A 5D8ZA 1Z6KA 1OG0A 1C8VA 4C6CA 1ZCCA 4BQ5A 2CLKA 2F2KA 3NYDA 2ZXDA 3AISA 2DZXA 3P8IA 3W7PA 3H2CA 3UPMA 1QI0A 3TW9A 3E1F1 1FFQA 3GDBA 3G0SA 2YBUA 2FFCA 3C2YA 3S46A 1PTAA 5CPTA 2XIIA 4UNKA 2BGSA 1KRCC 5G1MA 1W5PA 3LCWA 1RALA 1QI4A 4XB3A 1ODZA 4ZR8A 3CV7A 1E51A 1M9HA 4XZLX 3HQOA 5I79A 4R9OA 5FF0A 1B4KA 3CB8A 1C93A 2FQIA 1LUCA 1FH9A 3LI1A 4GY7A 2EO7A 3B9OA 2DZTA 1BYBA 2BHYA 4GZEA 2XG9A 4JTSA 3S47A 4Q4SA 1XLDA 3AMLA 2WM0A 1N7KA 2CCRA 2GSJA 2AMXA 4O15A 4PGLA 3DIPA 3WBWA 1TYGA 3V5CA 1KM1A 1EDTA 2GGJA 2AGTA 1VYSX 2R9RA 3N9SA 1REQA 1PCWA 4WSHA 3ONBA 2VD8A 3WX7A 6A3HA 4DF2A 1ZNNA 3O2LA 4KEUA 4IPIA 4O17A 4D2JA 3LLFA 1ADSA 3DDMA 1QASA 1U5HA 1CEOA 4LUJA 2YYUA 3T05A 4O11A 1K77A 3OG2A 3J7HA 1XH0A 5CJ5A 1HJVA 4G1KA 3FOKA 4MNMA 1O68A 3N1AA 4Q6JA 5DO8A 1WNOA 1MUWA 8CGTA 3SY8A 4AHPA 3R0UA 4WVXA 1CXKA 1J6OA 3KCJA 3CV6A 5EMUA 1F76A 2V2CA 4AXKA 1KXTA 4LY8A 3JUGA 1B0IA 2X09A 3CPUA 5CPLA 4JYDA 3WEOA 1QDSA 4IICA 3T1GA 3V16A 2H6RA 4LAMA 3ZFHA 3MZ2A 4U10A 3VMNA 2GGEA 4JBRA 3QTGA 2Q09A 3I6TA 4WR3A 4N0RA 3SUUA 4UTIA 2FKPA 3VINA 1DIOA 4ERAA 4YYCA 4DWSA 2A79A 1KTCA 3ZVHA 4UTKA 3E74A 4LVFA 4UC5A 4HYVA 1PZ2A 2HJPA 4F2TA 3CZ8A 1A5AA 4DQWA 3U0HA 1W37A 1MEIA 1TZ9A 1VPXA 2TODA 2DY3A 2XZ9A 3RPMA 4GPNA 5LNRA 4LVAA 5FJUA 1V7AA 1TWIA 3RM8A 3TAOA 1GT8A 4XZWA 4LWWA 2PTYA 3W1RA 3KRZA 3CC1A 2P0IA 4J4KA 4N7QA 3Q67A 2HISA 3LGEA 5J5RA 4G7EA 2IPJA 2DW7A 3VOJA 4YCPA 4FB7A 5A5WA 1TJRA 2V0TA 1S1PA 5C6MA 2PF0A 1XI3A 3U6WA 1EA9C 4FNQA 5A8NA 5KETA 1RQBA 4PUMA 1V6TA 4I8YA 4M29A 1C8YA 3HJZA 2A3AA 3EEGA 3EKZA 3AS1A 4JFTA 1OFBA 3C56A 3LHYA 2DSZA 1E6SM 1MZRA 3OLGA 2ZX5A 2UWFA 2V3FA 4IGMA 5F1UA 1ZCOA 2XFRA 3BOXA 3NIYA 1LORA 3USBA 3MKKA 4J9JA 2X8RA 2VGFA 1R3TA 4IIHA 4MLRA 5AFDA 1LZOA 4WSKA 3CH9A 3BW2A 2QCHA 4DY1A 4Q6XA 3WDJA 3DFOA 5CXPA 2G3MA 2Y62A 4YS1A 2Y7GA 3ITXA 3WQVA 4FAMA 3TXZA 1TIWA 4HPXA 4HOZA 3NAVA 5FF4A 1EHNA 4V2XA 4LUYA 1EJWC 2CEQA 1OX6A 2VFFA 4GIAA 1BVWA 3PPGA 4BF5A 2ISVA 1VLWA 3K8MA 3TFXA 5F2LA 1EJXC 2Z28A 3SIZA 5BXPA 3TW7A 1LOQA 1P0BA 1JXJA 4MUZA 4NU7A 3DFPA 1DWJM 2UBPC 5AHMA 1DIEA 4PZVA 1XLCA 3W1TA 1L9WA 3H4WA 3LCFA 2Q3OA 4MWAA 5EMKA 1X8FA 4BQ2A 4C6FA 1MNZA 1RXOB 4LALA 4JTRA 2LLEA 4QAIA 4AC7C 1NELA 3E12A 2Z1BA 4DAIA 3WQCA 1W9DM 4FXRA 2ABAA 4F2BA 2QNEA 4HSNA 1VBRA 5IDZA 3NL3A 1XLBA 4F0SA 3HGOA 2FLIA 4B5TA 3EDDA 4UOJA 4Z2KA 4JPGA 1OX4B 3BLDA 1VENA 4DO6A 5HOSA 5K4XA 1EWDA 4IGNA 2VGGA 2NV2A 3AS3A 3VIIA 4JFSA 2QCCA 5HQEA 3MB9A 2ASHA 2IKIA 2V5BA 1YNQA 3WMSA 4N6FA 2VC9A 1UIOA 2OR2A 3QEZA 5K7JA 2XUCA 4H8NA 4NNBA 3SGGA 1EUAA 1OGSA 4U3AA 5D37A 3PVFA 1NY1A 4E3TA 3IARA 4O0QA 2I14A 3V5OA 1XXXA 5A6AA 3WQFA 3S2MA 1U2YA 1PX4A 2ZUSA 4UTTA 2YA2A 3PFMA 4QISA 4N9CA 4S3CA 5EFFA 3AXHA 4WEVX 1CGTA 4GIRA 1F4HA 3WMCA 5DXYA 2PF8A 3PANA 3AQUA 3B06A 4DWSD 2QJMA 2FVKA 3TQKA 4F0LA 3PPCA 3L2LA 1S46A 1SW7A 3ZIZA 2PDUA 3AHYA 3PM6A 2I1OA 3UESA 3LUTA 1E73M 4GO9A 4PUJA 1POKA 1XINA 5DELA 1F6YA 3TJXA 1UBSA 2PBOA 3LENA 3OODA 1W1VA 4HPNA 2CLLA 3NVDA 5FKYA 3WD2A 3TQPA 1E9IA 1B30A 4E2DA 1PAMA 3KL3A 4W7UA 1AJZA 4OVXA 1RUSA 3TJLA 2XH4A 2PTZA 3GR8A 2QUUA 1Y5WA 3A23A 3W1PA 3B0XA 3EB4A 1J96A 9XIMA 3KWXA 4JN7A 3VIKA 3FXYA 5BOFA 4JYFA 5EBUA 4ZVJA 2ZKMX 1GZ1A 2IUZA 1M3UA 4J27A 5CZTA 2GVYA 3DC8A 5FAGA 2VR2A 2XFFA 2J7HA 3HMCA 1V6UA 2FPVA 4IMEA 4WF7A 3R25A 1Q3NA 4YXGA 3STGA 3QKZA 3QPEA 4JTLA 5BWAA 1BXNA 2CKRA 3GXTA 1H50A 5I23A 4PMJA 1GVOA 2VX7A 4Z1BA 1X98A 3P3BA 1LM1A 2VFEA 2VRKA 3KOYA 2PDXA 2XFWA 1P7TA 1PV8A 1JYVA 4GOAA 1YPIA 1K6WA 3MKCA 1VAHA 1QXLA 2D24A 3PTMA 3GK0A 3WD3A 4UOQA 1YXDA 3W01A 3DX5A 4AZBA 4DB7A 3LHVA 1L6GA 2WNWA 5JUVA 3UBPC 1TQXA 1V3IA 1ZBVA 1IWAA 1TUXA 4KPLA 5HJYA 2ZZ1A 3ZO9A 3UNDA 3KHJA 5I3FA 2QMKA 3RX4A 4GVIA 1JDDA 1J12A 1W3LA 3S2NA 1PB0A 3UR8A 3G1HA 4QLKA 1K4HA 1E9YB 2FZ9A 1DWAM 3SUWA 4GZ7A 2PGFA 4PFHA 4C6IA 5C55A 2J6XA 4QGCA 5D2YA 1XGEA 1XJBA 4Z2JA 3HV9A 3WMBA 1M1BA 3DEQA 2OMAA 2WJEA 4HT3A 1UP3A 4ORIA 4AVFA 1J0JA 4IJRA 4XBKA 4ZTYA 3SQSA 4IGHA 2CBVA 1CGVA 3GVWA 3OQ8A 4IQEA 1FWFC 2Y8KA 4D1IA 4X63A 4EE9A 4HU8A 2QCLA 2FZDA 1AZ2A 2F9RA 3POHA 5FJOA 4PCFA 2ZVRA 4FOUA 3TROA 2CLHA 3U7VA 1AW2A 4B2DD 1OK6A 2J74A 1RBAA 2G3IA 4LC8A 3WQEA 4L1XA 4K1GA 4GYKA 3QOMA 3W22A 1OZMA 3NM1A 3QW4B 4W87A 4JTCA 2WLZA 2Y7DA 4ERGA 2VO5A 1EYWA 2A7PA 1SYTA 2QYGA 3NQ8A 3BMWA 3R11A 4CVUA 1UZ4A 1OYBA 2WWCA 5E09A 4H9YA 3PZGA 2AL2B 4GNVA 1BGGA 4O8RA 4YLWA 2X05A 4DM1A 4FP1A 3N2XA 5HA7A 2IPGA 3KLLA 3BUVA 3RGTA 4DLFA 4NXKA 6ALDA 1J8VA 3GUGA 1XR2A 2TAAA 3MO7A 2HQAA 2E67A 3BGAA 3CEPA 1IWBA 5AYYA 4HHHA 3URNA 2W27A 2D0GA 1OABA 1KFBA 4MJMA 1G1YA 3PAJA 3PBUA 1B3VA 1SO5A 1V8EA 1TWZA 2ZXBA 1P0NA 1VEPA 1OCQA 2GQ3A 4DM2A 2REQB 3VNIA 2WC3A 1MQQA 3AIQA 3AIWA 4JEQA 1XIBA 4UR8A 2JKEA 4L9XA 3INPA 2VUYA 1UUMA 4NRSA 3TLQA 4NKCA 1JYXA 1FTXA 3NQDA 3QQWA 1ZJHA 4J40A 1HX0A 4DJFC 1FWEC 4CCZA 2V5LA 5FD0A 1R3SA 1YPXA 1V51A 4H8UA 1R38A 4QS6A 4ADUA 3QJAA 4ZODA 2WO5A 1OWQA 1KA9F 4S2BA 4CEXC 5CZSA 1YBQA 4HA1A 1B3WA 4Q4MA 4XWUA 3BO9A 1UD8A 3M0YA 2GQ8A 1Q2SA 2E6AA 3VZYA 1XIGA 1UR2A 1E1FA 4DF1A 1W17A 4QJ4B 1DQUA 3SSZA 5A6BD 3I68A 3S5ZA 1EX1A 2V5KA 3BLEA 3T0CA 4LBSA 4RKAA 3HQPA 4O57A 4AFYA 1CXLA 2WNNA 1PWMA 1HL2A 2IKJA 4CQBA 5HAOA 4RXGA 1RD5A 3KBJA 3KTCA 3MDWA 1PYFA 3DC0A 4DBDA 4GKTA 1C9WA 4CQ8A 1ESWA 1BGAA 1QW7A 1NM9A 2ZUTA 3TC3A 4GXPA 4GE8A 3RK8A 2A1YA 3W7QA 5F2GA 4U31A 3KZPA 2WWDA 3UD6A 4DJEC 1E1EA 2VFHA 1A3HA 2A2IA 2ZWYA 4IQJA 2C6QA 4AZIA 4K1WA 3E9AA 5LNVA 3CLMA 3CQIA 4P8WA 4KQNA 1KBIA 1JJKA 2ZZ7A 6PTDA 2V8ZA 3CIWA 3C2FA 3C6CA 2R6OA 4O1FA 3LG3A 2C1HA 3SN0A 5IFPA 2OJPA 2PODA 4IXHA 1XBXA 3UWQA 1NDWA 3TR9A 4OOUA 3RDKA 3ARSA 2PWUA 1I45A 1X97A 3ZOAA 3N2CA 1UWRA 2Z25A 1OFOA 2P88A 1GOXA 4WJ8A 2FPYA 1GVEA 3WL0A 2PGWA 1PZ1A 4HHPA 2BHUA 2F38A 3MS8A 3PPFA 3DYOA 4ZOCA 2C7FA 4KWOA 4TV6A 1J5SA 3VZZA 3QFWA 2PDPA 4XO6A 1R5YA 3QV7A 3L67A 4MJZA 1CNVA 3UXIA 1ITXA 4IL2A 4UFJA 1M7JA 2QCGA 2ZDSA 2GJXB 3SRKA 1H1NA 1DXFA 4WJXA 1HVXA 3QPZA 1H60A 1HUVA 1KO0A 1JFXA 1GG1A 2VC5A 1ONEA 1CGYA 3MCOA 4G9PA 1AA1B 2PE4A 4O4VA 4BS0A 1WZLA 1M5WA 3FLUA 4UMAA 4B5VA 4L6OA 1RVKA 4MAVA 3Q94A 3W02A 4GJJA 4JIHA 3DYMA 4MYAA 4YN5A 4QRNA 5CG0A 4XIMA 2E09A 4ASTA 4NJGA 1EPXA 4X9YA 1K70A 4GUFA 4JIQA 1FWTA 4GMEA 1SQ7A 3EEZA 4Z17A 3PWIA 2WSQA 1PDYA 4X60A 1QHOA 1NOUA 3FDGA 1AH3A 2X1SA 3SN4A 2PDQA 1C7TA 3LTYA 1VHCA 3T08A 3T09A 5FF7A 2PFHA 3R8RA 3HFTA 2QCEA 1LJYA 3ME3A 2OSYA 1CTNA 4DBSA 5KMYA 4GI8A 3G1RA 1CXFA 3W26A 3IIVA 4HTBA 3OJGA 4GYPC 2DQWA 3N6QA 2XYLA 4WKFA 4NAFB 3W2UA 1ZSXA 2PDLA 2PWDA 4LRSA 3RNDA 1R47A 3H2EA 5AZ1A 4HHLA 4O0KA 1U1HA 1AVAA 1I2NA 4WZHA 3KBMA 3QR3A 3EMZA 2WHLA 1CLVA 1EC9A 2PD9A 1Q6DA 3OVGA 2W62A 1X7IA 3KXQA 1DIKA 2NWRA 2O9PA 5LA2A 3ERPA 5DMMA 2QJIA 2OU4A