1G4EA

Thiamin phosphate synthase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
226
structure length
219
Chain Sequence
HGIRMTRISREMMKELLSVYFIMGSNNTKADPVTVVQKALKGGATLYQFREKGGDALTGEARIKFAEKAQAACREAGVPFIVNDDVELALNLKADGIHIGQANAKEVRAAIGDMILGVAAHTMSEVKQAEEDGADYVGLGPIYPTTRAVQGVSLIEAVRRQGISIPIVGIGGITIDNAAPVIQAGADGVSMISAISQAEDPESAARKFREEIQTYKTGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIAMIN PHOSPHATE SYNTHASE
publication title Structural characterization of the enzyme-substrate, enzyme-intermediate, and enzyme-product complexes of thiamin phosphate synthase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 79
structure length 219
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.5.1.3: Thiamine phosphate synthase.
pdb deposition date 2000-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02581 TMP-TENI Thiamine monophosphate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1g4eA00
3SIZA 3MWAA 1VLWA 4O52A 4M6QA 3LHVA 3IVTA 1EP3A 3CB8A 1J5TA 2F84A 3PUEA 2A4AA 1CW2A 1C29A 4R53A 3QH2A 1Q45A 4FB7A 1LP6A 2A5HA 2GQ8A 1RV8A 1Z41A 1I8JA 2HSAA 3P81A 4Q33A 5D03A 4Y90A 4S2CA 4M19A 5AC6A 2UV8G 1W5NA 1LYXA 2PURA 4JEQA 4P2VA 3FIGA 5D2YA 2V30A 2X1UA 3N34A 4N02A 1MXSA 4AEOA 3NQ2A 3BVJA 3L5MA 4QSHA 2Z6JA 4JDBA 1QNVA 4Q4KA 1TTPA 3QW3A 3GR8A 4MZYA 4AWSA 1THFD 3A21A 3G24A 3R2GA 4O4VA 2A1YA 5I3GA 4NJJA 5CPNA 4EF9A 4CCCA 3W7HA 3EX6A 3ATZA 5F2IA 3DHFA 5DY3A 2Q8LA 2YX0A 1JJKA 1H1ZA 3KRZA 4GFSA 3TC6A 4NNCA 1XDMA 5C54A 3BGGA 1LTDA 3N2MA 1DOSA 3W23A 1T8XA 2C6QA 3PUOA 1UUOA 3G22A 3HMJG 4KKXA 3GX9A 3P67A 5CPMA 5EY5A 1EWEA 2EPHA 1GVOA 3TMLA 2NLIA 4GE8A 1UBSA 4LVGA 5KZDA 1G7UA 2VKZG 3N73A 4CCEA 3HG5A 3LI0A 3TQKA 5E93A 2ZZ7A 3NQ8A 4WUIA 1XDLA 3GDLA 5U7SA 3NQGA 1XL9A 1QMLA 5AYYA 4O16A 4QQ3A 4Y9AA 1DBTA 4UFKA 5G2HA 1K8XA 2E5CA 1SZFA 1VYSX 2I1OA 3W73A 5C2XA 3W76A 2NX3A 1FXPA 3SR7A 2E68A 3SY5A 3O1NA 4UTWC 2WO5A 1TJRA 4JX6A 1FBAA 3CT7A 3HO8A 4MZ1A 1H1YA 1OYBA 5MHBA 3MI3A 1TPDA 3TQ0A 5FF2A 1MO0A 1AL8A 1P5BA 5FF4A 3GVGA 4UTIA 1OFAA 4PL1A 3CEUA 1G4PA 4NX0A 4PEKA 4LS2A 1KFCA 4ADTA 1P0KA 4JTSA 3BG9A 2OCZA 3N9SA 3NPWA 5AYZA 2FLIA 4O19A 3GDRA 2QKFA 4TIMA 4I9AA 4LC6A 4R7JA 1TJPA 4UR8A 4LVFA 1XUUA 5CSSA 4BK9A 4UUIA 1J4EA 2F7FA 3I65A 2Y7GA 5KMYA 1GG0A 1U83A 4O1BA 3QZEA 3SW6A 1R47A 4NJGA 3KRSA 5I3KA 5DCEA 5K4ZA 2QUVA 3FS2A 1Z48A 2OX1A 2RHGA 4BI7A 3O05A 2NX1A 5KZMA 4K6AA 4FIQA 4MY9A 3LCHA 4Z1BA 1K7EA 3C2OA 1A5BA 3MW7A 1JRBA 2V2CA 3SZ8A 3UWVA 4BF9A 4YXGA 1RR2A 3NL2A 3AO0A 4FNRA 4LU0A 1JUBA 4UTTC 1SR9A 2C3ZA 3GXTA 3EXSA 4JD4A 1HFBA 3UWYA 2NV2A 4LVAA 2EKCA 3HPSA 4EF8A 4EIVA 4GBUA 3N2XA 1FDZA 1OFOA 2TSYA 1VCFA 1ONRA 1W5OA 3G1XA 4OQVA 1S5VA 5K9XA 3HF3A 4WZHA 2QAPA 2BZNA 3KXQA 5C5YA 1GVQA 5AHLA 1VCVA 4HSNA 4PCFA 2RDTA 3S5YA 3EEGA 4AHPA 4MFDA 2DZXA 4ONVA 1GEQA 2NXGA 1EB3A 1L6YA 3BPWA 3MBFA 1R2SA 3H55A 3M5ZA 3ZWSA 2J9YA 4CQ9A 4LRSA 1FCQA 2C14A 2A6LA 3LLDA 3KVKA 4L4MA 2BLEA 3TW6A 3CIXA 3P80A 3DENA 3PR2A 3UY8A 3NQFA 1RQBA 3KVJA 1WBJA 5F2GA 4IWWA 2YXGA 1KLYA 4JS3A 1W3IA 5FF0A 4O54A 3W1MA 2O7QA 1P4CA 4TR9A 1F7BA 3LB0A 3KX6A 3LXCA 3UZ5A 5E0KA 1JCLA 3W22A 3NM3A 5LHFA 3O6DA 2EAWA 2NXIA 3WJWA 3LHYA 3L21A 1RVGA 4BWLA 1DL3A 5AB3A 3W72A 4O1CA 3I7SA 3PG9A 4RX0A 3LTYA 1V5XA 2BSLA 3CU2A 3G8EA 3LXAA 4FNQA 4JX4A 5BOOA 5HINA 1GG1A 4TMBA 2ISWA 1X6UA 4A2RA 3GKAA 3DFPA 4M5PA 1JCNA 2Q8ZA 5D2WA 4W9TA 1TV8A 4MOZA 3CHVA 1JCMP 4FXRA 1Z44A 1H51A 1LBFA 3W7MA 5K7JA 2XFWA 1PE1A 2OT1A 3QEZA 4O50A 3EWUA 3P5YA 1RPXA 4MLJA 1Q3NA 4MLRA 4K37A 5AN7A 1NVMA 2W0UA 2BTMA 4UNLA 3TJXA 3CLMA 2LLEA 1JUKA 2VFIA 1EX5A 3R5EA 2E5DA 2VFEA 3LBMA 2Z6IA 4N6EA 1BWLA 1R2TA 3M47A 2J88A 5HJLA 1WOAA 2E77A 2JBMA 4ZQNA 1GOXA 5EBUA 4CLMA 2NV1A 3EKZA 3LI1A 3G1YA 1ME7A 4MY1A 5AFDA 1QWGA 4M7SA 3QQ0A 1M7OA 3IGSA 2WKJA 2R94A 2ATMA 4NZJA 6ALDA 3TKFA 2VELA 1O5KA 2CLMA 4K8EA 1FCBA 3S8HA 1UCWA 5SWUA 3B0PA 5AHIA 2WSYA 3QPYA 4XUGA 3OG3A 5HULA 3DI1A 3GIYA 3S1WA 4IMGA 4P61A 4O18A 3LHTA 3P8JA 3SJ3A 1DJNA 1HO4A 3TSMA 1KFKA 3WK2A 5D2XA 1GJPA 3QPZA 2E6YA 1B4EA 2GQ9A 1I4NA 3DFSA 3PAJA 2CLKA 3TU9A 4IOTA 2A0NA 2CZFA 1OFEA 2GUUA 1EUNA 1WA3A 3LRMA 3LCFA 5IM51 5BMXA 3ABSA 4MVAA 3TA6A 3QSRA 1WQ5A 1TB3A 4UIOA 4QIUA 3SECA 4WXYA 2C16A 4R33A 5TQLA 2Y7EA 3MP4A 3KFTA 1SSGA 1KM0A 2FJKA 3IVSA 3A22A 5AC7A 2CLHA 1AK5A 3PWAA 3P82A 3W74A 1KM4A 4RKAA 5LHEA 3W7RA 3FYPA 2EHHA 3SI9A 2WOQA 4GUGA 1TRDA 3NPVA 4HT3A 4LTSA 2ZRWA 4DF2A 4BFAA 2GJLA 3EKLA 1VJIA 3FKRA 3T55A 1KTNA 3HGOA 3C6CA 5KINA 3S1VA 3PS7A 1DJQA 5LSMA 3CM4A 2D73A 1LCOA 4MY8A 5D37A 1ZFJA 1H7NA 3DI0A 1K7FA 5D38A 2QAFA 2QUTA 1O4UA 4KWWA 4OV9A 2CLOA 2NUWA 3CTLA 2VC6A 1VQTA 3QMSA 1SO5A 2YFNA 4IMDA 1ALDA 5E1QA 2ZYFA 3G1DA 1VR6A 1RQHA 1JVNA 3EX3A 1LOQA 3KAOA 5CSRA 3LDVA 4JTFA 1TQJA 3P8IA 5C55A 3C4UA 2B7NA 3BLEA 1F6PA 3HOJA 4RV8A 1W5QA 4TX9A 1HL2A 1IF2A 3NGJA 2Y7FA 3P60A 1TO3A 1HUVA 1Q6RA 3T44A 4NUWA 1K8ZA 1OFDA 1TYGA 4Y6GA 3C0JA 4JICA 3THAA 3GAKA 5CPOA 1VHNA 1ML1A 1G67A 2EF9A 1TRIA 5BMWA 2ZBTA 1EP2A 1EEPA 3KOFA 2JGYA 5L6UA 2I14A 2X1TA 1D3GA 4IMFA 3DZ1A 3TSBA 4AMAA 1WX0A 5HWNA 1DHPA 4X22A 1OHLA 3LERA 3RMJA 1EUAA 1I2OA 1EA0A 3IV3A 5IBXA 3PF3A 4PTNA 2BX7A 1AG1O 1CX9A 1IXPA 2E1DA 2X30A 4JTUA 3DXIA 4QISA 4U28A 2AQWA 4MZ8A 1GYNA 1KM5A 1SW3A 2WJZA 2VFDA 1YTKA 4ZQPA 4UMBA 4DPPA 1B57A 2RFGA 2NX9A 2DP3A 4MFEA 1EWDA 1LOLA 1X7FA 2FTPA 2CLIA 4JR5A 3MHFA 4Z1AA 4OBTA 4O0ZA 4RZ5A 5CZSA 3GNNA 3BK0A 3RK8A 5I3JA 3FEMA 5AHNA 3IGUA 4AHOA 4MYAA 3NA8A 3MI6A 5CPLA 2B0MA 3NM1A 1JQXA 1MEIA 1Q6OA 1JRCA 1IXOA 1FXQA 3T7VA 1JUEA 3F03K 4ML9A 5AHMA 4BWLC 4AF0A 4MYXA 2DZPA 4M6VA 5K4XA 3W7PA 1VC4A 3MHUA 3NQEA 3LTPA 4OHQA 3DFTA 2YYTA 1YPFA 4LVDA 1A5AA 4ZZ9A 4ZQCA 3EWZA 2JKAA 1IGSA 5I3FA 2QJGA 1LLWA 3ABOA 4HN4A 2FPTA 1LLZA 4HPXA 4X3ZA 1ME8A 5KZEA 3A5FA 1F5ZA 5G1TA 4HKPA 3NPXA 3TXZA 3A9IA 5CG7A 1MZHA 3IRDA 1BEUA 3Q37A 1YDNA 3W2JA 2DZWA 4OV4A 3C8FA 2Y61A 3UZJA 5HNRA 3IGXA 5D2VA 4TU1A 3L5AA 1F05A 4QNEA 1GTHA 2ZRUA 1HO1A 3TCEA 4XWUA 3W7LA 2QCMA 3CQ0A 1TTQA 3HGSA 1SFJA 1TREA 3HIJA 4RK8A 2G5WA 3QRHA 3TAKA 3WJYA 5DN1A 2ABBA 1KFJA 2CWNA 1XKYA 4NXKA 4YL2A 4KWVA 3LRKA 4QITA 2H8XA 3G1HA 3L2IA 2QEZA 4ORIA 1G7VA 4ALDA 2E6FA 4Z1CA 1QO2A 4GNJA 1I2RA 3UWQA 3LCIA 2H90A 1HG3A 3RF9A 4O4WA 3UNDA 4UFJA 3BW2A 1VYPX 1WOBA 4LUJA 4N9CA 4ORMA 5I3IA 3IEBA 1KV8A 2RDUA 4X2RA 5EYWA 2ZRZA 1KFEA 3T4CA 1K7XA 3S42A 1ZAIA 4N2YA 4DO4A 1NF7A 3NL6A 4GUFA 3STFA 2B7QA 2FPVA 3G8RA 4FNUA 1XI3A 4WXZA 2CW6A 1TTIA 1W3NA 4NNAA 3HJZA 1UB3A 3A5VA 2CLLA 2B7OA 3BLIA 2C13A 4IPJA 4MPQA 3WK1A 3ZR4A 3K30A 3PG8A 1OK6A 1PHQA 1SZGA 1BKSA 2Y63A 1XBVA 3NAVA 4O12A 4DELA 1VRDA 2GOUA 3BW4A 1QR7A 3W7IA 3GYEA 3LV5A 2YW3A 3B0UX 2ZA2A 3O63A 4LY8A 3O6CA 4A22A 1OF6A 2V8ZA 1TV5A 4NQ1A 4G1KA 3JRKA 2FIQA 3EX1A 4EWND 1W54A 1BWKA 2DZVA 4A21A 3STEA 4I7UA 4JTHA 5A5WA 3QYQA 5K2ZA 4AVFA 3OEXA 3GR7A 3W7DA 3QM3A 3W70A 1V7YA 2B4GA 3GDMA 5LNWA 3NQCA 3OA3A 1QFEA 2W6RA 2ZDRA 2WQPA 3QJAA 2V82A 3G1VA 4Z0JA 1QPRA 4POCA 1ICQA 3G1AA 1O60A 2DZTA 3USBA 2CZDA 2XN0A 3T78A 5H2ZA 1VH7A 2VEMA 1NAL1 4AWUA 2E6AA 1R30A 3S6DA 1P0NA 4MUZA 4UMAA 3LCXA 1QPOA 3BG3A 5CKSA 4IGHA 5CZTA 1K03A 5FF3A 1YTEA 1TQXA 3WJZA 4EOUA 1KFLA 3UPBA 3EB2A 3ZS4A 1G69A 3L0KA 3TFXA 1YXYA 3L9CA 2EGZA 4FNPA 3LX9A 1YLVA 4I7VA 1W0MA 2BWGA 2YW4A 2ZQ0A 1GYLA 5CZ0A 1W37A 4N9BA 2DORA 2HS8A 2VFGA 2YCEA 3VKJA 1OYAA 4L4LA 2ZZ4A 5AYXA 3W1TA 3W6YA 4UTJA 5G2WA 2R8WA 1QOQA 2E6DA 1LRTA 3W1AA 1SUXA 1VCGA 3L5LA 3NQMA 2OMAA 4CNOA 2E5BA 4WOQA 1ZCOA 3B06A 3W7QA 2Y70A 1X1OA 3Q2DA 3ELFA 3L67A 2QJIA 3P5ZA 1SO3A 4CCDA 3ZWTA 1JQVA 4HNNA 3O06A 4QAIA 1B4KA 1W5MA 3B04A 1TPB1 5IBXC 3SSJA 1NF0A 2FB2A 3O8AA 3VE9A 2DZSA 4FIRA 1FWSA 3GDKA 3BLFA 1XUZA 1ICSA 3UXDA 1F76A 2ZRYA 5H91A 3P62A 4WY0A 1H62A 4C1LA 1PVNA 2CFFA 1H7PA 3LHZA 5K3VA 3GXPA 5CZJA 3I68A 2JK2A 3JS3A 3S5OA 1JR1A 5ABTA 3SFKA 3W2NA 5GVJA 5AOUA 3R89A 1W56A 1JCJA 3NZ1A 3S5ZA 5LKYA 1WV2A 3PVFA 3UWWA 1L6SA 4M6PA 4PFMA 5HWMA 3O6YX 3QFEA 1LZOA 2V5LA 4NU7A 2ZA1A 1H7WA 1LRQA 2QJHA 3DFNA 5F4WA 3NDOA 1WXJA 5FEWA 3MBDA 1KV5A 4K7VA 2JKPA 3BGJA 5FEPA 2JKEA 3MI2A 4MJZA 1AW5A 3W1QA 5LGXA 2WSQA 4UTMA 2A2IA 6TIMA 1G4TA 1LDCA 1K02A 1LM1A 4JTKA 4OE7A 3RNDA 5F1VA 2G97A 3UPWA 1O95A 2A21A 4AHQA 1W3TA 5HUOA 1OYCA 1SFLA 1TSIA 2FQIA 3DBPA 4FX6M 3NXFA 3N3MA 2OT0A 1LOSA 3OVRA 3PBYA 3DAQA 1GT8A 2PRMA 2V2HA 5J5DA 5T26A 5DLCA 1XM3A 3HPXA 4GWEA 3W85A 4UTLA 3UD6A 3L0GA 4FX8A 2ZTJA 2ZZ2A 2KZHA 3UXAA 1SO4A 2Q3OA 2Y88A 3B03A 2ZA3A 3M9YA 3M44A 5F4SA 2NWRA 3HG4A 1N8FA 3W7CA 3G3MA 4UFMA 1SU5A 1OFPA 2A7NA 5D33A 1S5TA 2CZ5A 2AAMA 5AHEA 1K3UA 2Y85A 4GJ1A 3W75A 2CZEA 3CIWA 1QDSA 4M7TA 1KM2A 3HG2A 5HWJA 3HG3A 4O0KA 1XCFA 3KVMA 4B5NA 4PC8A 1VLIA 3TFCA 4XKYA 3W1UA 2X2GA 3IIOA 4JIPA 2CLFA 1UJPA 2HTMA 3EWYA 1AMKA 3M6YA 3TW7A 2J27A 2TRSA 1H50A 1JCXA 3PBUA 4GUHA 4K7YA 3NL3A 1OVDA 1H7OA 4O28A 3EWBX 5DBUA 4O14A 2V9DA 1Q6LA 1O94A 2QCFA 2OJPA 3LLFA 3TE9A 5G2IA 2RKXA 4CNPA 1GVSA 3FYOA 4RCXA 4IXXA 3QC3A 3PC0A 1DV7A 1KM6A 1XFBA 3EXRA 3G3DA 4X9SA 4D2JA 4UTUA 4IMEA 3BW3A 4A3UA 3E96A 3TSDA 1XXXA 2YFOA 3OVQA 5DCBA 2WSRA 1YXCA 1PCWA 3FFSA 1VPXA 1MSSA 4IJBA 3IIXA 3VCRA 2QCNA 4YMZA 4UNKA 2RDWA 2QR6A 4A2SA 4LOCA 5CGQA 1TPVA 1N55A 3ABRA 3LCWA 3TR2A 1FY6A 3GZ3A 2QCHA 3B0VC 3FJLA 1J2WA 1SZNA 2CLEA 3L66A 2NWSA 3LXBA 2WNNA 3W2LA 1Q6QA 3HB9A 3U2OA 3SGUA 2WV8A 2BXVA 2O7SA 4RXGA 1ZJIA 5I3HA 1IIGA 1MEHA 4LRTA 3AJXA 3LHWA 3PB0A 2R91A 2GQAA 4LT9A 1GPWA 1MEWA 2ISVA 2TPSA 3QF0A 1OJXA 1VS1A 4BI5A 3O15A 4AB4A 2DZUA 1SW7A 5KSWA 4NNBA 2TMDA 3NQDA 5FF7A 4WOZA 1X1ZA 3TJLA 1JCYA 1OX4A 4K39A 2QCEA 4UMCA 2I9EA 5EA9A 4K36A 4I7WA 4JYFA 4FNSA 1PL9A 2QCDB 1ADOA 3F4NA 1OF8A 3E49A 3M43A 5D05A 3NL5A 2JGQA 4LS0A 5FEZA 2ZRXA 1M6JA 5BW6A 1FWTA 1LBMA 2YDAA 3N9RA 5LGZA 2G95A 1PV8A 2P10A 4RXFA 3PBVA 1PHWA 1AW2A 2C0AA 4KFPA 1D9EA 1SW0A 1XC4A 3WK3A 1R46A 2YPIA 5LNUA 4GC4A 4HNTA 4LS1A 3B8DA 4HPJA 3R12A 2YGYA 1KW1A 3TC7A 1RQEA 2QCLA 1KLZA 2GPTA 3G0SA 3R8RA 1TV7A 4AF0B 1OX5A 5DY2A 4WQ6A 1SZEA 3EWWA 4JGDA 1FUYA 3MYOA 3UY7A 3ANYA 4N9EA 3W71A 3W84A 3LBCA 1ZNNA 4DO5A 1PIIA 4ICNA 3CEPA 4CNNA 5KITA 3IVUA 1XBYA 1TMHA 4PH6A 4UFHA 3C2EA 3FKKA 2H8ZA 4UR7A 3TH6A 1E51A 4HNVA 1EIXA 1F6KA 1FDYA 1AW1A 1W5PA 1F2JA 1G4EA 3G0XA 2ZRVA 4ADUA 5DXXA 5J5RA 3A24A 3W7GA 5G4EA 2X1SA 1X8FA 1KM1A 3P7YA 5K9CA 4JDYA 3LCGA 2X16A 3O16A 3U8GA 3W2KA 2XN1A 3EWXA 1KBIA 4IQLA 2VEPA 1IXQA 4LNYA 1TTJA 4RR4A 3TROA 5L9FA 1QO5A 4O53A 5AC8A 3M1ZA 4Y96A 1LORA 1QOPA 3P61A 2P0OA 1OG0A 5HMSA 1JULA 3M41A 2QCGA 4JTJA 3W1PA 3DFQA 4WX2A 2PRLA 2GVLA 4IX0A 3W1XA 2H3DA 5LNSA 1QCWA 4NXSA 2CU0A 2FFCA 3C2VA 3IIZA 3RU6A 3I6RA 1DVJA 3PB2A 2ALDA 3E0IA 3N14A 4OU1A 4FEZA 3S1XA 4EVZA 3W83A 4N4PA 4DO6A 2VEIA 3GXNA 4UTHA 2QF7A 3E02A 2C1HA 3W88A 3N19B 5BRBA 3P74A 3NNTA 5C6MA 3RLUA 2Z2UA 4JN6A 1A53A 4HNUA 4DF1A 4JXCA 4FNTA 1H5YA 3W07A 2A7RA 2H6RA 4OGZA 1B3OA 5A8GA 3MHGA 5D30A 5K9DA 1VYRA 3NEVA 3EXTA 3QMRA 3JR2A 2WPBA 4XTDA 1TPH1 3S9YA 4O17A 1A50A 3WJXA 3NG3A 3PM6A 4HIBA 3QW4B 3UWUA 2AGKA 4NT0A 4PODA 5D09A 1VZWA 2PC4A 3NQ7A 4OT7A 1SO6A 2PRHA 1Z42A 3NYZA 3I7QA 1GQNA 3MMTA 1LROA 4YCOA 3LHUA 4DPQA 1K8YA 4IX2A 3DU0A 4MJMA 1LRNA 4TO8A 4QNWA 1UASA 4JTIA 5F4XA 4RZ4A 3OBKA 1FCVA 3DKLA 3C52A 4E2BA 2RH9A 1T0OA 5LNRA 4U4MA 1BTMA 1SQ7A 1I2NA 5FEXA 3VE7A 4LUIA 4WJEA 3S5NA 4FX7A 2J9XA 3ZFHA 1F74A 4O15A 5DCDA 4YWIA 2Y6ZA 2QUUA 2J6XA 4IXHA 1DKWA 4O1DA 5D32A 3GAYA 2A6NA 4O13A 4CQAA 3KVLA 4LC8A 5HUPA 1WAUA 1DORA 3GDTA 1EPXA 1T96A 2VOMA 4XBKA 3M5YA 5EKYA 3S1UA 3LTSA 4DEFA 4Q32A 3E9AA 3W1LA 4JNMA 2FPYA 5D02A 4YLWA 2YYUA 1ZHAA 3Q58A 4S1FA 5D2TA 1IIHA 1YDVA 2C18A 5G5IA 1QAPA 3G1SA 4N9DA 3TIMA 4K8HA 3W1NA 4O11A 2ISSA 1L9WA 2V0TA 5FESA 3PSVA 3CWOX 3WJSA 1PCKA 3H54A 3I7RA 4KFOA 1ZAHA 2DJXA 3M5VA 1UUMA 1SPQA 1OABA 5DXYA 1SSDA 4GRSA 4O8RA 4BI6A 1PS9A 3C3NA 1S3HA 1YADA 2VFFA 1W31A 4S2BA 7TIMA 1AL7A 1TIMA 3PSWA 3UQNA 1FWRA 4LVBA 2VEKA 1RZMA 2YZRA 4H3DA 3HGJA 3W7JA 1H7XA 3GK0A 3NOEA 4JY8A 3LRLA 3PULA 3TXVA 3ATYA 2P1FA 1G4SA 3KRUA 4GUJA 4Y8FA 3TV8A 1KM3A 3CWNA 1M7PA 1RD5A 3INPA 4IUOA 1QPNA 2WNZA 2Z0IA 3MO7A 5EPDA 4DXVA 1QPQA 3M5XA 4WY0B 3CPRA 4Z08A 3GB6A 3MP3A 5LNVA 2QDGA 3FA5A 3SGZA 5U4NA 3MP5A 2FDSA 2Y89A 4FXSA 4JYEA 2GJNA 2V81A 4PA8A 1H7RA 2A7PA 1Y0EA 3L65A 2G96A 1DQWA 4GXMA 5TBOA 2DJLA 3W87A 2NUXA 3C56A 2FB3A 3LV6A 2C15A 3C2FA 4XTIA 1C9DA 5DELA 1NSJA 2Z1BA 5LZLA 3RFAA 2V5BA 1ZY9A 4JIQA 2Y62A 4ADSA 3DH7A 1WDWA 5HR6A 5KTLA 1KA9F 4UCGA 4JY9A 3LOTA 1I2QA 3DGRA 4DQWA 3TAOA 1ICPA 1FCUA 4FO4A 2ZZ5A 1WBHA 3C2RA 4GUIA 4JTLA 1DQXA 2Y7DA 2XN2A 8TIMA 1KTBA 2J9ZA 3WK0A 3R13A 3L0NA 5G1YA 4WD0A 1A5CA 2HMCA 1CI1A 4Z0SA 2ZTKA 1OFQA 4AXKA 4ZVJA 3PBWA 4YCPA 1H63A 2ATSA 4K38A 3LCLA 4MKNA 4JYDA 2DU2A 4MIMA 2C19A 1L6WA 3LGEA 3C61A 2J24A 2NUYA 5DBTA 3H53A 3V1PA 1ME9A 1GZGA 3YPIA 3KHJA 3NQVA 4UXDA 4DF0A 2A85A 3M0ZA 1TPEA 3W2MA 1O5XA 1H60A 1YYAA 1XBZA 1L2UA 2H3BA 3MJYA 3HQ1A 3UWZA 3W7KA 3TMQA 4Z1DA 1KBJA 1VGAA 3O07A 3TNOA 5HR7A 1EP1A 1H61A 3FJ6A 3W1RA 4NX5A 4N4QA 3G0UA 4XKYB 3IIPA 4XQ6A 3HGRA 3QSTA 4WY0F 5G4WA 3P84A 1YXDA 2NXHA 2ZFAA 5EL1A 3NQAA 4LWWA 4LV4A 2IQTA 4IPIA 3UYCA 3DHDA 4UTWA 3EX2A 3NZRA 3U6WA 1YTDA 4ZL1A 3STCA 3A23A 2ABAA 3VFLA 3W2UA 1ZENA 3W9ZA 4OWGA 3QQ1A 4RZ6A 2V2DA 4UFLA 3FLUA 1KFBA 4ZQOA 4RJEA 3S0CA 4E0CA 1YDOA 4NZFA 3W7NA 4XBSA 5FI8A 4RLIA 4UC5A 1D3HA 4JTGA 4UTKA 4ZMGA 1FWWA 4A29A 3IIVA 3TUUA 4NJIA 1GVRA 2E09A 2YSWA 3VNDA 5EMUA 3W7OA 1OK4A 3MUXA 4LW7A 2HS6A 3GKFA 3W3OA 5TIMA 1I45A 4NVTA 1GTEA 4JTTA 2YR1A 1GVFA 1FQ0A 4H4IA 4AAJA 4HSOA 4E2DA 4AWTA 3TDFA 2X1RA 2QDHA 4C1KA 2Q3RA 3TQVA 2QCCA 2VENA 5F1UA 2PE4A 1TPWA 2ZZ6A 1GWJA 3B4UA 4O1AA 3OHIA 3BO9A 1B9BA 3MYPA 3THQA 3HPZA 4BR1A 1HTIA 4KFNA 4QM1A 4NJHA 3D0CA 1R2RA 1F73A 1P1XA 3STGA 1W8SA 3CC1A 1TPFA 1FWNA 3DKJA 5F2LA 1I2PA 1TCDA 4QJ1A 2GVGA 2ZCGA 1LBLA 4H6KA 1TPC1 3BG5A 4UFIA 1OFBA 3E12A 3TX9A 2B7PA 4NJKA 5AHFA 1C8VA 3Q94A 5D04C 4DBEA 4JTEA 1N7KA 1T99A 3G18A 2NZLA 2ZZ3A 1OX4B 3OVPA 4J9JA 1YPIA 3OIXA 1NEYA 3QMTA 1M5WA 1VHCA 3EX4A 3GNDA 4O10A 1ZAJA 3V75A 1IXNA 3VI2A 2TYSA 4IMCA 1FDJA 3DFOA 3NVTA 4UTTA 1TPUA 3BARA 2R14A 4DBDA 4JX5A 3NPUA 3RLVA 4O57A 3HBLA 4AH7A 3TK7A 4CQ8A 4PL2A 3W7EA 1W1ZA 3WFAA 1ZALA 3M16A 3GLCA 3NR0A 3W86A 1OFRA 4XZ9A 5F2MA 3ABQA 1G6CA 2VXNA 2VFHA 3PUDA 3G1FA 4E38A 3BV4A 3L68A 4ZQMA 4ZQRA 4LV9A 2GVJA 3LM7A 1XBXA 1S5WA 3F4WA 3PY2A 1OX6A 2OZ0A 1FX6A 1KTCA 3M7WA 2ZZ1A 4TMCA 1WYIA 4FF7A 5BNKA 4HHPA 4R34A 3T40A 2WNQA 3F1QA 3NO5A 5HQEA 3FOKA 3B05A 4N6FA 1U5JA 2QCDA 1A5SA 2PCQA 3NQ6A 1NFBA 4FHAA 2W79A
chains in the Genus database with same CATH superfamily
3CUHA 4H8NA 1VLWA 1ZZMA 4M6QA 1EQPA 4J4KA 3VDGA 5I07A 3BUVA 3MMDA 3ZLHA 1C29A 2VHLA 3VX0A 1M7XA 1YE4A 3GU2A 4XIMA 5ABHA 4AVOA 1RV8A 4NAFB 3TC3A 1I8JA 4IZGA 2WB5A 3OTRA 3P81A 1E5JA 4Q33A 2VZOA 2CWXA 1LYXA 4M24A 2V30A 1Q6GA 3ABXA 4I9MA 1MXSA 4N02A 3BVJA 3TCSA 1K6AA 1KQZA 5AECA 4C6PA 3U5UA 4G1NA 2Z6JA 3VYLA 1BF2A 4JNYA 1W2VA 3KP0A 2F61A 4EPDC 1U33A 5BYWA 1TTPA 2OYLA 4AWSA 4KS0A 3CAKA 4UCFA 1W3LA 3N3TA 4DXKA 3W7HA 2Q8LA 2XSBA 5XIMA 1EDQA 2YX0A 2EKGA 4GFSA 1XDMA 4IF2A 2J6VA 3WCZA 3N2MA 1DOSA 3MS8A 1S39A 1T8XA 2C6QA 1QWKA 1VFFA 1E56A 3VINA 3G22A 2PB1A 1GW1A 4KKXA 1CBGA 2EPHA 1US0A 4R85A 2VKZG 4C90A 1QBAA 3QLDA 2V69A 3H2FA 3IJ8A 5I24A 2XGBA 1ZBWA 5U7SA 3NQGA 1J12A 5AYYA 4QQ3A 5JBDA 4Y9AA 4AC1X 3IK4A 1JDCA 1KC7A 3UA3A 4H1ZA 1SZFA 2I1OA 5C2XA 2NX3A 3H70A 1V3KA 1E4LA 4F0RA 4L61A 4NAEB 1FBAA 1HL8A 3TJ4A 1NWUA 2OOGA 1OYBA 1X38A 4TX8A 1A3XA 4L9YA 2C1GA 3UCDA 1BG4A 4RNJA 1R5YA 1DXEA 2ASHA 4PTMA 5FF4A 3GVGA 2ZKMX 5FOOA 4DM1A 3CEUA 1G4PA 2PUZA 3SM0A 3GM8A 1RJQA 3ME3A 3EDJA 4R7OA 1YE6A 4Z2HA 1JYWA 2QKFA 1DPMA 4TIMA 4I9AA 4R7JA 3W26A 3UG4A 5EBAA 1O5QA 1KD0A 1XYLA 3E0WA 4GK8A 1GG0A 4DNHA 3QZEA 4V28A 1A49A 1R47A 3DDMA 4NJGA 3KRSA 1FOBA 4LBUA 3R79A 4EPEC 3OO2A 4KBXA 1V0KA 1CXEA 1HJXA 8RUCA 2QUVA 4MWAE 4NI8A 4RE4A 2OX1A 4K3ZA 5KZMA 4MY9A 5ECUA 3MKKA 4Z1BA 1K7EA 3OA5A 5JXQA 3RR1A 1JRBA 2X8RA 4GVHA 2GGEA 3NSNA 2PDLA 1YIXA 3HZ3A 3KBNA 5A6BD 3IJQA 2PAJA 4ATWA 1UH2A 1U1HA 1CXFA 3EXSA 3HURA 1GPFA 4L80A 3UWYA 2NV2A 1V6WA 1E6ZA 3WDIA 3N4EA 4M1RA 2EKCA 4EF8A 4GBUA 1T7LA 2TSYA 4CGTA 2INEA 3V35A 1ONRA 3JU2A 2D2GA 5K9XA 3BXWA 1E3ZA 4WZHA 3KXQA 5CSYA 1XLFA 2OLSA 1A5MC 4ZO7A 2FGLA 4TTGA 3A12A 1IEVA 3BPWA 5GPRA 4GJIA 4ZTXA 3M5ZA 3RR4A 4CQ9A 1NM9A 3UR7A 3E5PA 4AD1A 2DIJA 4FR1A 2J8TA 3PR2A 3UY8A 3N9KA 4JS3A 5FF0A 4JIRA 3W1MA 2O7QA 2DW7A 4JEJA 1L8PA 1BRLB 3PWIA 3LXCA 5EU9A 5AYBA 1ESWA 4UNIA 1XLJA 4QQUA 5C71A 3FXGA 4Q8TA 3LPPA 2NXIA 4YNGA 1JNEA 3K1GA 3AHVA 3PJTA 1KKRA 1KXQA 5AB3A 5I02A 3UYIA 4GVFA 1MQRA 1GOMA 2J79A 5IDIA 3AMDA 2A3CA 3BL3A 2HV5A 3LXAA 4Y9MA 5HINA 3UGRA 5I79A 2CBJA 4CKQA 1JCNA 3AUJA 5D2WA 4FXRA 1Z44A 3T07A 4FXJA 1H51A 5K7JA 2XFWA 2R1LA 1SYTA 2KX9A 3GY1A 3P5YA 1V6YA 4MLJA 1Q3NA 2HWGA 3QKEA 4W8AA 2OSYA 3RX3A 2RUSA 3CLMA 1EX5A 3VNKA 2E5DA 2J7GA 1FH8A 2VRJA 2VUYA 4N6EA 1R9ZA 4GOAA 2ZVIA 2J88A 3KOWA 2VR5A 2DW6A 3R0KA 1Q7MA 1ZCCA 1A5NC 3Q4DA 1U30A 1YKWA 4IQJA 1Q66A 4LBRA 3EKZA 4H6EA 3N4FA 1ME7A 2QQ6A 5AFDA 1CPUA 3EDKA 5JIWA 2VJXA 1M7OA 3IGSA 2R94A 4ZODA 3ZJ7A 6ALDA 1ECQA 2FJUB 2VELA 3IJ6A 1S2CA 2FVKA 5SWUA 3DHUA 2WSYA 4XUGA 4ZE5A 3O2LA 4AUBA 1JPDX 3OG3A 3DI1A 1I9CB 1XPGA 4IQEA 2BY2A 1NTHA 3CUFA 2E9BA 1REQA 5CZKA 4MNMA 1GJPA 4MJ2A 1T8QA 1B4EA 2GQ9A 2YCLA 4HHHA 3DFSA 3AXXA 4AIBA 1EUNA 4GD0A 2GQ3A 4MVAA 3QSRA 1TB3A 4AIOA 1WDQA 2X0SA 3TZNA 5JUVA 3QTPA 3MANA 1R8LA 4R33A 1EH9A 3AFBA 3WNNA 3MCMA 1JZ4A 3WQVA 1H11A 4BS0A 3LA4A 1HF6A 1AK5A 2FFIA 3PWAA 5H6HA 5HA7A 3H7VA 3FYPA 4OIFA 3LM3A 1W2PA 2DZBA 4QP0A 1ITQA 4AEFA 3E2RA 3T55A 1EJSC 3HGOA 4JKKA 3E0VA 2RDXA 3PS7A 3WD3A 2G4JA 2O92A 3CM4A 2D73A 5A94A 1TG7A 4P8UA 4HOXA 2QAFA 1TWIA 4KWWA 2CLOA 1P7TB 2VC6A 3G1DA 1VR6A 1OC7A 4LXFA 5C70A 1JVNA 2Y8VA 3OLEA 5FACA 5CSRA 1UD4A 4TV5A 3P8IA 3MZ2A 2INZA 1AODA 4KCVA 4AG0A 1BVZA 4Z2KA 4H01A 3L4TA 2HXTA 3B8UA 4L6OA 3A4WA 2C91A 1S2VA 4X2PA 2Y7FA 2PF0A 4DRSA 1TCMA 5DANA 2NVAA 4WSKA 2VD8A 5CPOA 5BMWA 3MKCA 2IPJA 1R86A 1EEPA 4KERA 3RRAA 4E8DA 5HWNA 1WX0A 3MUY1 3LERA 3RMJA 3ITYA 1EUAA 1JF6A 5IBXA 5HJYA 2BX7A 4QISA 1AG1O 1IXPA 1E3XA 4XO7A 1FHLA 4E5TA 1KM5A 1BD0A 4UMBA 1B0IA 5CPSA 3H2NA 3S1GA 2FTPA 3IAQA 4Z1AA 2ADAA 1LQAA 3GNNA 5I3JA 2OR2A 1MEIA 3GZAA 1FXQA 3K4WA 1P43A 4H19A 4MYXA 4Y8EA 1KKOA 2QMJA 3B4YA 1VC4A 3MHUA 3BV7A 4OHQA 4RUBA 1A5LC 2VT0A 4ZZ9A 4WKHA 1J0IA 3ID7A 3LGDA 3H7UA 1EBGA 4QDMA 4IIBA 5I3FA 2QJGA 5CBJA 4X3ZA 5KZEA 1I1WA 4PMUA 4HKPA 1M04A 3OOQA 3A9IA 3IRDA 1UH3A 1XYZA 1YDNA 1TR9A 1UQYA 1VFHA 5CC5A 3UZJA 1UZ4A 1GVYA 5C2GA 4CD8A 1Z9AA 2J7CA 4DHGA 1HO1A 3R94A 4XWUA 3CQJA 1TTQA 2PFHA 1SFJA 3HIJA 4CCZA 3TAKA 1VBUA 1OGGA 1KFJA 3VFCA 4NXKA 3LRKA 3OYXA 3G1HA 2PTDA 1RALA 1G7VA 2QZRA 3H22A 3VC6A 1P6CA 5HAOA 4V15A 1PPIA 4LF2A 1HG3A 1UWIA 3UNDA 4BZYA 1OC6A 4UFJA 3ZSSA 3B9EA 4N9CA 5I3IA 3T9PA 2E0PA 4N2YA 4ZOBA 5JMUA 1XIJA 1OEPA 4J2MA 3DGBA 2B7QA 4K1GA 4WK9A 2F8QA 5HANA 4WXZA 2CW6A 4D6EA 3VZZA 5ABGA 1W3NA 4ZFMA 2VO5A 2CLLA 4MPQA 1OY0A 1OK6A 4CQCA 2QLYA 1XBVA 4O12A 3T81A 1VRDA 2GOUA 3BW4A 1GZ1A 3R0DA 1QR7A 4C7FA 3LV5A 3VUSA 2PODA 1LUCA 1Y5XA 3MV11 3B8WA 4EX4A 3B0UX 4DJEA 1FWCC 3DYPA 3O63A 1Z32X 3O6CA 4TVCA 3A13A 2JIWA 1TV5A 2V5DA 2OLAA 3S2MA 4FALA 3QYQA 5FJJA 5K2ZA 2NT0A 3W7DA 3W70A 3SN0A 2DY3A 2WMIA 5LNWA 4D6JA 2GVEA 4GH1A 4POCA 2DZTA 1UP2A 3IJ7A 3USBA 4E2VA 3GD6A 5C9UA 4XIAA 4WRHA 4S3GA 2E6AA 2FMNA 5FSEC 4MUZA 4UMAA 1YBQB 1RVKA 5CKSA 3UCQA 5CZTA 1VF8A 2DSKA 4C1NA 2XVGA 3M6DA 4F8XA 1TQXA 5E5CA 3UJRA 3UXIA 3LG3A 1KBKA 5A6MA 3ZS4A 3RM4A 1YXYA 1M41A 2EGZA 3MY9A 2OOFA 4I6KA 4K68A 2WANA 4I7VA 1W0MA 4AVNA 4Q4SA 1OCBA 2GOKA 1B5TA 3RYSA 4L4LA 3W6YA 2XZ7A 2YOCA 1O12A 1SUXA 1VCGA 1DWAM 4WOQA 3GTHA 3CH9A 3W7QA 2Z27A 1Z6KA 3Q2DA 3L67A 1SO3A 1MDLA 4AIEA 4XAZA 4HNNA 3UZYA 4QAIA 5IBXC 1UHVA 2FB2A 2G37A 1BVWA 1FWDC 3XIMA 1FWSA 1J8VA 3ZT7A 3GDKA 4NZ5A 3UXDA 4LFYA 1BPLB 1BYDA 4GYFA 1P0EA 3LHZA 2WLYA 2PU0A 5K3VA 1MW2A 3AZSA 3JS3A 4CUCA 1W91A 3CV2A 3TTOA 3SFKA 3GUWA 3KCJA 3W2NA 5GVJA 1EGVA 1W56A 4QFUA 3AWOA 3NZ1A 2D1ZA 1WV2A 3UWWA 3PWGA 9RUBA 3W4RA 4M6PA 3T0BA 1E4NA 2FHCA 2XH2A 4NU7A 1R7OA 2NQ9A 1DWHM 3W28A 5CLWA 4MM1A 2UZ9A 4QDPA 1KV5A 2DT3A 3BGJA 1AW5A 1E70M 2PSNA 2INFA 2A2IA 6TIMA 3TYEA 4JTKA 3BMXA 2A21A 1XINA 1K1DA 1UR2A 3M0KA 1TSIA 4FX6M 3N3MA 2OT0A 1LOSA 3PBYA 3HQNA 2D23A 4TV6A 7REQB 5T26A 2E25A 5M17A 3HPXA 4HMEA 4GWEA 3WNOA 3L0GA 1QK2A 4CN1A 2KZHA 4M56A 4B3KA 1QNSA 3NDYA 3M44A 5F4SA 3HG4A 1N8FA 4ZO9A 3MTWA 4GJ1A 2BFGA 2O4QA 1TV3A 2IKHA 4M7TA 5HWJA 4JIIX 1XCFA 3ALFA 3VU2A 4B5NA 3ZVHA 2Y0FA 4A3HA 1XIFA 3WN6A 2R24A 3IIOA 1YMYA 4EXAA 3O0FA 3WH6A 2VX4A 1F4AA 3EOUA 3OG2A 4IIHA 4QX4A 3KLLA 3TEVA 1CXHA 2Z1WA 1ZQ5A 4O28A 1IHIA 3EWBX 4DM2A 4GKTA 1XR2A 2V9DA 4Q8VA 1NWRA 4GY1A 4GCXA 3IRSA 1XG3A 2VQTA 4RCXA 1IE7C 3QC3A 1DE5A 3EXRA 1KM6A 3WMCA 4ZSTA 4D2JA 1T40A 4LGXA 3I3BA 3WLMA 2PDQA 3TSDA 2YFOA 1TWDA 3LY0A 1J9YA 1XLDA 3VKCA 3P93A 2OG9A 2WSRA 1PZ3A 1RCQA 1UKQA 5D8ZA 1US2A 3FFSA 4DJED 1MSSA 2GJXA 3K4DA 1DTNA 1QOXA 3MSRA 3VCRA 3GRIA 2CXEA 1O5RA 1DJIA 2I7GA 2XSAA 3TYBA 2YL5A 3TR2A 3FJLA 2CLEA 3VIKA 2NWSA 1R85A 4HTYA 2X1IA 4PMJA 3HPAA 3HB9A 2WV8A 2PZ0A 1ZJIA 1IIGA 4LRTA 3AJXA 1WO2A 2Z25A 3UU0A 2V5JA 2ISVA 2TPSA 4BI5A 1XX1A 3O15A 4AB4A 2DZUA 1TV4A 3NQDA 5FF7A 5BXSA 3H4WA 4K39A 4I7WA 3AI0A 1FP8A 3E49A 1BQGA 3NL5A 2ZRXA 5BW6A 2YDAA 3N9RA 2XIBA 2P10A 3CL7A 4KETA 1XYCA 4RXFA 1TVNA 4IFKA 4H6RA 4UQ9A 4S3BA 3UFYA 2WWDA 2YPIA 3AIRA 5LNUA 5FJTA 4LS1A 3R12A 4IGSA 4XK2A 4DBSA 3RPTA 4J7RA 1QBBA 3N25A 1K70A 1QI3A 5E6YA 3G0SA 1S38A 3OLDA 2VZSA 3BJTA 4AF0B 1QUMA 3ONCA 2OEMA 1W9DM 1H5VA 1TJ0A 2YJQA 4V1YA 1MW1A 6CGTA 3NCOA 1ZNNA 2IPFA 2G41A 3M0JA 4ICNA 2OWXA 2YCKX 3IVUA 3DX5A 4AC7C 2VZUA 3QXBA 2FZ9A 1OT1A 2I5IA 3IARA 1FWJC 3GVRA 1V0MA 4UR7A 1E51A 4HNVA 1F6KA 1GJUA 1CB7B 4EE9A 4JHOA 1F2JA 2CNCA 1KR1A 1G4EA 2GDQA 4XD4A 2ZRVA 3W01A 3W7GA 1L8NA 1TZZA 4NAFA 5G4EA 4PBGA 1KM1A 3DG7A 4JDYA 1QU4A 4BQ2A 4UQAA 2CKRA 4G5DA 3RHGA 5BXPA 3CGTA 3F4VA 1KBIA 1IXQA 4RR4A 3U2ZA 4L6DA 1ZBVA 4EKJA 5HMSA 1SMAA 3AC0A 2WVUA 1RA5A 3SCVA 2QCGA 1HNYA 3U5YA 1J93A 4WX2A 1UD3A 1G5AA 4IX0A 5LNSA 1L6FA 1QCWA 1E6SM 2CU0A 4BCEA 3IIZA 3M0XA 4ACZB 3N14A 3TN4A 2QF7A 1S1PA 3W88A 5BRBA 4JN6A 1A53A 4HNUA 4DF1A 4HZMA 5A8MA 1L6GA 5T8GA 5DMLA 2A7RA 3DOPA 1A3WA 4IJCA 5A8GA 1VYRA 3QMRA 4LX4A 4XTDA 4DNMA 4HIBA 3AYVA 4PODA 2GDUA 2O0TA 2CHNA 3BZGA 2VEFA 3NQ7A 1Z42A 1O7AA 3I7QA 1GQNA 4YCOA 1OGBA 4DPQA 4US5A 1TMLA 3DU0A 4IX2A 4MJMA 1TUXA 4XD6A 1XGZA 5I7GA 2VP8A 2HVMA 4RZ4A 5LIYX 2J4GA 4GO8A 4U4MA 4B9ZA 4Z17A 5FEXA 3M0MA 5TNVA 1F74A 4O15A 2Y6ZA 1GHRA 1LQ0A 2QUUA 1DKWA 3UXLA 2A6NA 1K9EA 4HZ6A 3ABZA 5EMJA 5HUPA 4CVWA 5CBIA 4RNFA 1T96A 1V02A 3M5YA 5EKYA 3S1UA 4DEFA 5REQB 4JNMA 3IWPA 3Q58A 1K9FA 3AIBA 4QGCA 2ON3A 5E09A 3G1SA 4N9DA 2VRQA 1EYEA 2ISSA 2UBPC 4O11A 3UG5A 2PD5A 1Q8JA 3WJSA 4OJYA 3H54A 5C9WA 1CGVA 2GGGA 4KFOA 4XZMX 4NF7A 3M5VA 1HKMA 2UY4A 5DXYA 4O8RA 3FV9A 4BI6A 2PDYA 2XINA 2J7DA 1Q2RA 3K13A 3GUGA 2OEKA 3GWQA 1TIMA 1EFZA 4GZEA 3UQNA 4WSHA 4M1BA 1C3FA 3C5QA 4F0LA 4LVBA 1M3UA 4RV3A 2OYMA 2RJHA 3W7JA 1PIGA 2FZ8A 5CGTA 5AC5A 5DF0A 1BFNA 4JY8A 2R6OA 3LRLA 1JXKA 4L7ZA 1TX2A 3PK7A 3R8HA 2DUAA 3ATYA 3TONA 3SCNA 4R9OA 3CWNA 1M7PA 2WBGA 3INPA 3SO7A 1QPNA 1YPXA 4GX9A 2Z0IA 4LYPA 1XHGA 1KGUA 3CPRA 3CXOA 3MP3A 2ZUWA 3FA5A 2FH6A 1TA3A 2FDSA 2WMKA 4JYEA 3W38A 5A69A 3GTFA 5I09A 2BOFX 1Y0EA 2DJLA 4GQBA 3LSCA 2FB3A 4XTIA 1C9DA 5DELA 1NSJA 3TW9A 1NWSA 4B4HA 3RFAA 2V5BA 1MUCA 2YB4A 1ZY9A 3BANA 3PUGA 3RCMA 3AWNA 1XF0A 3N29A 3AIUA 1K4HA 2EPLX 3WBYA 1I2QA 5FKYA 1BRLA 4KW2A 1ICPA 5BCAA 3OPSA 1E4IA 1WBHA 3GTXA 5C2CA 1ZRQA 2J9ZA 3JZUA 3R13A 1V93A 5G1YA 2J7HA 1XRVA 1XQLA 3IUIA 4OBRA 1OFQA 2OYKA 3FVMA 2AGTA 1H63A 3AAMA 2WJDA 2E67A 1X6LA 5JVLA 1A4LA 3LCLA 3NOYA 4BQ4A 1C7TA 1FRBA 3LGEA 3C61A 1UZDA 3PANA 3VIMA 1ME9A 1GZGA 1C8QA 4D6CA 1RY8A 3QR0A 5FAJA 4J3TA 1QHZA 3W6MA 3M0ZA 3EOOA 3POHA 4QG8A 3WD0A 3LYEA 4IIEA 1JAEA 4IM4A 3UWZA 3O7UA 3TMQA 2NQJA 4LAOA 3UJ2A 1GOIA 3LBOA 5HR7A 3A47A 4IFRA 4IG2B 2GZXA 3UG3A 4XQ6A 1E71M 1XGEA 3SUTA 3HGRA 3WBWA 3KUMA 2P5NA 3POCA 3P84A 2D2HA 2ZFAA 3BQ6A 4H7VA 5EL1A 3NQAA 2IQTA 2PWHA 3OZMA 9XIMA 4UTWA 3EX2A 3NZRA 4H04A 3PBGA 4GIYA 4H00A 3VNZA 4LPCA 3A23A 1UIPA 2V2DA 2W9MA 2A3LA 3HA1A 1V0NA 1N8WA 4RJEA 4Q22A 4E0CA 2VDIA 2D3NA 4NZFA 4XBSA 2DH3A 1XIBA 1D3HA 4ZMGA 1FWWA 3EB4A 3IIVA 4LYQA 3PPCA 1LL7A 3CQKA 4EXBA 4ZEPA 2YSWA 4YTTA 4JCLA 4LW7A 2XVLA 4PSPA 3GKFA 2P0IA 3GNOA 4JIEA 3B9DA 2VNCA 4NVTA 3T0DA 4JTTA 2YR1A 1GVFA 1E0TA 4BKNA 3QV7A 3CZKA 3B4UA 2E3ZA 2VRKA 2VGIA 3H7RA 3DBNA 4US5D 1GVEA 4W5UA 1J0ZA 3BO9A 1B9BA 3MYPA 3VDCA 3THQA 3HPZA 4ZB5A 3ZYZA 2DFAA 4AFYA 4DYEA 1PKNA 3D0CA 3P0WA 2VX7A 5CQ1A 3URNA 1W8SA 4YTSA 2EG8A 5F2LA 3DKJA 2QNEA 3SRDA 1I2PA 3RN6A 3QC0A 3VKBA 2ZCGA 1TPC1 4UFIA 3TX9A 2YDSA 3S2LA 3FA4A 1C8VA 4W93A 1N7KA 1T99A 2NZLA 1Q5MA 2ZZ3A 1OX4B 4JFTA 1YPIA 3RDKA 1XLHA 1ZGDA 3UWEA 3WLQA 3H12A 3QMTA 1VHCA 3V75A 3EX4A 4GQRA 1DIEA 2TYSA 3GVQA 3BARA 4JX5A 4PCTA 5T9BG 1LWIA 4S3CA 1HVXA 3S47A 3TK7A 3A4XA 1F3XA 4HSHA 5BZAA 3GLCA 3HM7A 1G6CA 2W3ZA 4HBKA 3FDKA 3E2SA 2JF7A 4MMWA 2ZUVA 3BV4A 4ZQMA 3C0QA 1JAKA 4A35A 4LV9A 1HP5A 1E0VA 3N2TA 1EJUC 4TMCA 2QXWA 3MMWA 3JZEA 1XPYA 1YNYA 3B05A 3MQTA 3DERA 1U5JA 3SQLA 3PTQA 2Z1SA 2NSOA 1FWFC 2PCQA 3VDAA 2W63A 4FHAA 2O9RA 4MB3A 3MWAA 4EP8C 5HATA 1EP3A 3WF0A 1CW2A 3UVIA 5E9XA 1LP6A 2GQ8A 4M29A 1Z41A 5T9CE 4DWSA 3ITTA 3MSYA 4M19A 2UV8G 3HMCA 3U2CA 1W5NA 3FIGA 2X1UA 3N34A 4QE4A 4F40A 4XSMA 4U2YA 3KBSA 1MQPA 1VPQA 1R0MA 4GO9A 4U5KA 2V5KA 2WCGA 3ITCA 3A21A 3R2GA 4O4VA 4I8YA 5CPNA 1LWJA 4CCCA 5AVHA 3EX6A 2HPMA 1EPVA 1Y65A 5DY3A 2Z7KA 3GE7A 1H1ZA 3KRZA 5A3HA 1M03A 3TC6A 1LTDA 3OQEA 5ENLA 3UVAA 3UJEA 1UUOA 1CGUA 3GX9A 1ZU8A 1EWEA 1PUDA 3IACA 3MDUA 3UA4A 2NLIA 1UBSA 2ZWYA 4W84A 1G7UA 4PRWA 3JVAA 3N73A 3HG5A 2J13A 3TQKA 3WQCA 3RRXA 1PYMA 1YNQA 1TJ2A 1E9YB 1QMLA 3MJMA 4O16A 1TFVA 3SN1A 1DBTA 4UFKA 3SY8A 1L2QA 2E5CA 1VYSX 1FP9A 3W73A 1AQHA 4JFVA 3K2GA 3BOXA 2G4FA 4REQB 3SR7A 3WQ8A 4MG4A 3O1NA 4UTWC 2WO5A 3GXMA 1TJRA 3MVIA 4UTFA 2WNWA 1PIFA 1UROA 4PBEA 1CDGA 2VDHA 5MHBA 2WVTA 2E9LA 3DESA 4NP7A 1DJZA 3TQ0A 1R3SA 3GG1A 5FF2A 3TOYA 3OW1A 2ZC1A 3GC5A 5IRPA 7ODCA 1P5BA 1PKLA 3BOFA 4ICCX 2YCIX 3WUGA 4MADA 1J79A 4NX0A 2OZ8A 2EPKX 1FHDA 1KFCA 3SFWA 3BG9A 1SZRA 3N9SA 3NPWA 3N4AA 4KRUA 1JPHA 3GDRA 2NVCA 3K4AA 4MDPA 2XH0A 4PMYA 2VGGA 4UR8A 4QLLA 1QW7A 3T8LA 1X98A 4ICMA 4BK9A 4I9JA 3OBEA 1V02E 4FF5A 1VBHA 4NI3A 3CJPA 1U83A 2ZX9A 1XDJA 1VEMA 2I16A 4KF1A 4YU1A 2F38A 3E38A 4QG9A 5TAOA 4XUYA 1D2KA 4NRRA 2HZGA 5XINA 3QHNA 4IUGA 1W3JA 4U3CA 2YZ5A 1J96A 3THCA 3C2OA 3EKGA 1KWKA 4PUUA 1M53A 1S2TA 1WDRA 3THDA 3PZNA 4YXGA 2OU4A 3GW3A 2CPUA 1XLMA 4U5IA 5FJUA 4JN7A 5CAHA 2PTYA 4JD4A 1RJRA 1HFBA 1E9LA 3WUFA 3CL6A 1QT1A 1YBQA 2ZDSA 4YTUA 3CV1A 4EIVA 5DQPA 3N2XA 1VCFA 4PYSA 2BHZA 5GJMA 2QAPA 1FWBC 2G50A 3TN3A 2XM1A 4JFUA 4UR9A 3D46A 4XD5A 2DZXA 2Z2AA 1ZB5A 3WLRA 4H2CA 3ZWSA 4LRSA 1FCQA 2ZWZA 5CG0A 1FWIC 4GJJA 3P80A 3DENA 3CUZA 4F66A 3QOKA 5F2GA 4IWWA 2YXGA 3FYYA 2BS9A 5D8WA 1KNWA 2Z29A 4TR9A 3LB0A 4W89A 5I00A 1QNPA 3FX4A 3UZ5A 3ES8A 5E0KA 3SUVA 3W22A 2CKSA 3S46A 3UZZA 3NM3A 3C2YA 3IS4A 3QOMA 4DWSC 5LIXX 3EGJA 2PBGA 3LHYA 1RVGA 4EANA 3KW3A 4JZ5A 3W72A 4S39A 3KOYA 4BQ5A 3F2BA 4E4UA 2WZTA 3WD4A 5CC3A 3PG9A 4RX0A 1EKOA 3LTYA 3GBEA 4FNQA 1ZP4A 1GG1A 3ENLA 1DEDA 1UKTA 3GKAA 3QTGA 3RPMA 4G9PA 4W9TA 3B9NA 1TV8A 4DWSD 1MRAA 3CHVA 3IJDA 1KBBA 3WL0A 1AZ2A 1UC5A 3EWUA 2NW0A 1XIEA 4MLRA 5AN7A 5A95A 1NVMA 2W0UA 3SUSA 1H49A 3IUDA 1YHTA 2VFIA 1XLAA 3R5EA 1EOKA 5FJPA 2P88A 2Z6IA 1BWLA 1R2TA 3WQ5A 3GIQA 3M47A 4RL3A 4PEEA 4B92A 2XIOA 4UB9A 4D8LA 3TYDA 3LI1A 4BY3A 3G77A 1XRFA 4CU8A 2DIEA 3EOSA 4F9JA 3GYCA 4M7SA 2CBIA 2CLPA 2OPJA 1PWMA 3AS3A 1PTAA 1WZMA 3KRBA 3A4AA 1O6IA 7REQA 3CUIA 5EFDA 3S8HA 3WLPA 3B0PA 5AHIA 4NIRA 4LEQA 5HULA 2X0HA 1K4GA 4HGXA 3NZPA 6REQB 1P48A 3LHTA 3P8JA 3TSMA 5A6KA 1KFKA 3WK2A 3M07A 4MAZA 5D2XA 2HNHA 3SQMA 2C1IA 3SADA 3AQUA 4V2XA 3TTYA 3MSGA 2CLKA 3TU9A 4XZWA 2CEQA 1NDZA 1BAGA 1V3HA 2CZFA 1OFEA 3CZGA 5ABFB 3LRMA 5BMXA 3TA6A 1WQ5A 1XYAA 4WXYA 2C16A 5TQLA 2Y7EA 4UQBA 7ENLA 4YN5A 1TE1A 4KH2A 4WLCA 4A05A 7A3HA 3A22A 4QAWA 3VOHA 2CLHA 4HA1A 3P82A 4GNKB 1KM4A 4B5TA 3W7RA 3D47A 3R8GA 3SI9A 1JNDA 4HB7A 1TRDA 1RD6A 2ZRWA 4BFAA 1JZ3A 2G3JA 1QHPA 3V5OA 1NFPA 3A9BA 1VJIA 1P0DA 3KZPA 5M1TA 3FKRA 3NURA 3C6CA 5KINA 3R58A 4WCJA 5LSMA 4LYRA 3U4AA 5D37A 1ZFJA 1H7NA 3DI0A 1O4UA 4O0QA 4J3ZA 4OV9A 4AD5A 1VQTA 2XGZA 2PDGA 3AIQA 3QMSA 1ALDA 3SCSA 4OUIA 1RQHA 2RGMA 2CCRA 2OO6A 3LDVA 3U4FA 3LQGA 4JTFA 5HPCA 3ECQA 5C55A 3C4UA 3BLEA 1F6PA 2BMBA 3WBAA 1W5QA 1W1VA 3I4EA 1IF2A 4P8WA 3NGJA 1P6BA 2Y5SA 2V63A 1HUVA 1Q6RA 4NUWA 2YB1A 1K8ZA 1ZPTA 4Y6GA 3C0JA 5C9XA 4IP7A 3T09A 3THAA 1MNSA 3GAKA 1XH1A 1G67A 2EF9A 4Q4RA 4Y7EA 4H8HA 4D6FA 4A6GA 1S2UA 5L6UA 2I14A 1MYRA 3WQDA 4IMFA 2VX5A 3UR5A 3GXIA 2PCEA 4TTUA 1PAMA 2EJ1A 3O6AA 2DZAA 3IV3A 4IH3A 1WKFA 3MC5A 1C8YA 2AQWA 4MZ8A 1GYNA 1YTKA 3GHTA 3PP7A 4WDXA 2DP3A 4TVUA 1R3WA 1LOLA 3ANUA 4JQ3A 4AEEA 3OGVA 4L1XA 4O0ZA 3VM7A 4C6LA 3FEMA 2EEXA 4AYGA 2PDFA 4MYAA 3MI6A 1JQXA 5FL1A 3GVVA 5CH9A 3S4TA 3T7VA 4HU3A 3F03K 3R0UA 5HQLA 5AHMA 1ELSA 3EDDA 4AF0A 4M6VA 3UZXA 4RPQA 3W7PA 3LTPA 1ITUA 2PDPA 1WKYA 4H8UA 3PZOA 1OZQA 3R4IA 1IGSA 4D9PA 1LLWA 2HJPA 3HFTA 3A5FA 2WLZA 2HNEA 2ACSA 1CNVA 1QNQA 3TXZA 5CG7A 4HPNA 2XH4A 4BEQA 3WBEA 3CMGA 2Y61A 4KRZA 1V77A 1JDAA 1A47A 4QNEA 1LL4A 2Y8KA 2ZRUA 4FOUA 4EAYA 2QCMA 3CQ0A 3TWAA 4ROQA 3PPGA 1VAHA 3RO6A 2WHKA 1XLBA 3ZOAA 2ABBA 4DI8A 2CWNA 2I5GA 3TTEA 3GTNA 1TWSA 1OWQA 2H8XA 4ZOEA 4ERAA 5H1WA 4XISA 4K1WA 3WMSA 2FKPA 1LG1A 4GNJA 1T6MA 1X8CA 1MXGA 3MSDA 2QYGA 4PCSA 4JNZA 3BW2A 1VYPX 4LUJA 4ORMA 3IEBA 1KV8A 5EYWA 1K7XA 4ACZA 4DO4A 1DHKA 3H2EA 2W67A 1UWRA 3T2OA 3STFA 2FPVA 4C6DA 4FNUA 2WJEA 2G3MA 5E0FA 1H4PA 2X0YA 3HJZA 1UB3A 4WDUA 3BLIA 4RNIA 3WK1A 2IUZA 4W88A 1SZGA 1S5NA 1BKSA 2Y63A 3AHTA 3UETA 4A3QA 4ACYA 4G7FA 4GXWA 3GYEA 2DSVA 2YW3A 2PTZA 1XISA 2V8ZA 4G1KA 2ISFA 3USZA 2FIQA 4RZBA 3H21A 1BWKA 1F4HA 2DZVA 4A21A 2NVDA 3STEA 2WVVB 2YL8A 4C5ZA 3PJWA 3QM3A 1V7YA 3IUHA 4RDWA 3GU1A 1CLVA 3WD2A 3BC9A 1QFEA 1Z8AA 3BURA 4DYJA 4B3LA 3BCFA 4AX7A 2V3FA 2OXNA 2WAGA 3MT1A 2JIEA 1SVDA 4PE8A 2YBVA 1F6YA 3FN9A 1ICQA 1UD5A 3NWRA 2DIKA 2IKIA 3TN5A 3S9IA 1MZRA 2REQB 1EF3A 1R30A 1QPOA 2VC9A 2BY0A 4M0XA 1K03A 5GNYA 4FLOA 1YTEA 5FF3A 5REQA 1XYFA 1G69A 3H6OA 2OODA 2VVNA 3WMBA 5E9AA 1OZMA 4FNPA 4JQ1A 1E72M 3WNMA 4O1EA 1W37A 3FDGA 2VFGA 2YCEA 3VKJA 3JW7A 3W1TA 1B3WA 5AYXA 4UTJA 3SCPA 5G1MA 1E40A 1QOQA 2NSXA 2E6DA 4QEHA 4ATDA 4RDZA 3AXMA 3NQMA 2OMAA 4CNOA 4V27A 1GOQA 3KS5A 3ARSA 2I9UA 3HTWA 3O06A 3B0YA 1W5MA 4R27A 1TPB1 4MTVA 1NF0A 1ZUAX 2WZEA 2DZSA 4JAWA 4PTWA 2CITA 4UZUA 3MMUA 4L1GA 4YYCA 4DVOA 1R3RA 4ECLA 4J1OA 3NSXA 1O66A 4C6NA 5H91A 2V3DA 1GQJA 4C1LA 5I5RA 5H8UA 3B40A 2VR4A 1VENA 2YLAA 2PWGA 3VIHA 5CZJA 5DMMA 2JK2A 3CPUA 5ABTA 3C0LA 5AOUA 1ISWA 1BTCA 3KLKA 1HN1A 1XIGA 3PVFA 1L6SA 2VGFA 5FD0A 2CBUA 2ZE0A 4PFMA 1XLCA 3O6YX 4PR4A 3GU9A 4H83A 1VFOA 4YVPA 1EJRC 1PO9A 3KDOA 1UKPA 4Q7NA 3EMQA 1H7WA 3LNPA 1WXJA 3MBDA 2NV9A 3ZJ6A 5JBEA 3ARVA 5FEPA 1P0BA 3W1QA 4DN1A 5LGXA 3PN8A 2X42A 4NL1A 3R10A 2AAAA 2PP0A 4AHQA 3VGBA 3L2LA 3DBPA 3NXFA 1ZBCA 1V6UA 1TVPA 3FHQA 5FSDC 1VFLA 5DLCA 4W7UA 1XM3A 2B31A 2PDHA 1FWEC 2ZTJA 2OKOA 1SO4A 2Q3OA 3B03A 2ZA3A 4Q8UA 2NWRA 5DFAA 1Y8BA 3W7CA 2PLJA 1A5KC 1OFPA 2D2OA 2A7NA 3V16A 5D33A 4YHGA 4IISA 4QJ3B 2OSXA 3PTKA 4DZAA 3HG3A 4Q6JA 1IT0A 2J47A 4J27A 2DT0A 3TFCA 3EMCA 4AX6A 6TAAA 2CLFA 1VIZA 1UJPA 2HTMA 4DLFA 1Q7QA 2FVLA 3M6YA 1ZS2A 2WMGA 1PZ1A 4AZCA 2J27A 4Y9NA 2V3EA 3S6OA 2CC0A 4GUHA 4K7YA 2D0HA 3NL3A 4K8GA 2FVMA 1H7OA 4PCPA 3LEPA 1U1UA 4AXNA 1O94A 4GXPA 4WSJA 5HNTA 2QCFA 2PDXA 4F3HA 1I0DA 3WH5A 2V5CA 4JKMA 4IXXA 3PC0A 1YQ2A 1X7IA 3GTIA 3BLDA 1BVNP 3CHFA 3BW3A 4A3UA 3E96A 3UGVA 3OVQA 2IW0A 3DN5A 3TWBA 1CGTA 5C8BB 1YXCA 3R43A 2PA6A 3R11A 3IIXA 3GBDA 4FOKA 5CXPA 5A1AA 2YBUA 5CGQA 1TPVA 3ABRA 3GC4A 3N2BA 1FY6A 3GZ3A 2QCHA 4F0MA 3B0VC 1J2WA 1SZNA 2Z1XA 4GHRA 2A79A 1LF1A 3CV7A 4MWAC 1JXJA 3W2LA 1Q6QA 4TQTA 3SGUA 2O7SA 5I3HA 1MEHA 2FZMA 1AH0A 1IT8A 1UR8A 3LHWA 2R91A 4HOZA 4R5EA 3EDFA 4LT9A 2GK1A 2MANA 1MEWA 3GHRA 4WDTA 1OJXA 1VS1A 3UJSA 2V68A 3TLLA 1HKIA 5KSWA 1KXTA 2OFJA 2DVUA 4NNBA 4I5RA 4WOZA 1E43A 1X1ZA 2D3LA 3K1DA 1JCYA 1OX4A 2QCEA 2I9EA 4K36A 4JYFA 2QCDB 3RU8X 3VC5A 4MWAD 1OF8A 2X41A 5FEZA 2JGQA 1FWTA 1RXOB 2G95A 1PV8A 3ARQA 5KEZA 2XUCA 3XISA 3S2CA 2C0AA 4IT1A 2QGHA 4P7QA 4KFPA 2OLHA 1D9EA 1SW0A 1WP6A 4GC4A 4HNTA 1E0WA 2WBKA 1KW1A 4X0NA 5J8LA 3EPOA 3RIKA 4IIFA 4EPKA 1RQEA 4PRRA 3W27A 3T8QA 2QCLA 2JEPA 4W7VA 1BGAA 1TV7A 5EMMA 3ZMRA 5DY2A 4NASA 2DSWA 4JGDA 1W9UA 2IXVA 3EWWA 3F5JA 3VOJA 1FUYA 4N9EA 3W71A 1UR9A 1HKKA 3QPEA 2PU1A 3M0LA 5KITA 1AQFA 4Z42C 4PUMA 1ZP3A 2W61A 2CETA 3SJNA 4UFHA 1EA9C 5HBFA 2A3HA 4HTBA 3QFWA 1EIXA 1FDYA 1HZYA 2Z1KA 3WFLA 4B5VA 2O9PA 3NFUA 3AU6A 4GKLA 3A24A 1F07A 3RJXA 1ADSA 3URQA 3QHMA 1X8FA 2X09A 1B54A 5HPOA 2HBVA 5CPTA 3O16A 3CV6A 3CWHA 3GH4A 3EWXA 4IQLA 1QNRA 3HQPA 4CNSA 4LNYA 5L9FA 1XW8A 2PGRA 2KAUC 1PDZA 3WSUA 3PNZA 4B91A 4HU8A 1JULA 3CLWA 3M41A 5FL0A 3URBA 3W53A 2XGIA 4JTDA 2PRLA 4PFHA 1UG6A 4FR6A 5BRQA 5A8OA 2GVLA 1PX4A 3W1XA 2H3DA 4L1WA 2RJGA 2FFCA 1DVJA 4XZBA 1WUFA 2Q71A 3S1XA 4EVZA 3VX1A 1JYNA 2I17A 1GQLA 4C6KA 2G8ZA 2ZX6A 3W83A 4DO6A 4QTGA 4CQBA 3BAXA 3P74A 5C6MA 1W1YA 3RLUA 2Z2UA 1K77A 1AH4A 1NARA 4RDYA 4AZGA 1H5YA 3W07A 4YWSA 4ROPA 1GQKA 2H6RA 1XJBA 5DMNA 3MHGA 4NRSA 3JR2A 4GBDA 1TPH1 1OIFA 1GGOA 1I1XA 3NEHA 1UC4A 1N82A 3QN3A 3VIJA 4NT0A 4KQNA 3H2AA 3RITA 4OT7A 1AFSA 1KXHA 2PRHA 3M0VA 4FPSA 1LROA 4AIUA 4C6MA 1VIWA 3BQ5A 3L4ZA 1IGWA 3ZQ9A 1NDVA 4AD4A 1C91A 3WLOA 5HQMA 5BXRA 4REQA 1LRNA 2Y5EA 1A0EA 1OD8A 4LYKA 4TO8A 4QNWA 4JTIA 2R1PA 4D6HA 3DKLA 1JDEA 3D3FA 2RH9A 3XINA 1I2NA 2V3GA 4OTKA 4MB1A 3S5NA 4JL1A 3ZFHA 1HKJA 2P76A 3OODA 1TKKA 4J5NA 4YWIA 4DAFA 3GW0A 3WLNA 4O13A 3UT0A 4CVUA 2A3BA 4A3YA 3VGHA 3GDTA 1MI3A 4H9UA 1LQ2A 4U31A 5LXXA 2RAGA 4J3XA 5LA2A 4YLWA 1VRXA 5D2TA 4HA0A 1YDVA 5G5IA 4HPHA 4LSBA 2FTYA 2VL4A 3SBFA 3TIMA 3WH8A 3W1NA 5FESA 5PTDA 1E6QM 3CWOX 1PCKA 1GKPA 1SSDA 3C3NA 4IPNB 1OIMA 1W31A 4KCTA 3EWDA 3PSWA 4KMQA 3U3HA 2FYMA 4U3AA 3OBAA 4HP5A 3R7MA 4FAMA 4AD0A 4Q6XA 1RZMA 1GQIA 4GQGA 1V8EA 4MNKA 3NIYA 4W86A 1X39A 3LK6A 4W8BA 1KCZA 1G4SA 4GUJA 3T6CA 1XLGA 3CTTA 1HT6A 4GA8A 1MUMA 2WNZA 5HMDA 4UBPC 3W37A 5EPDA 4DXVA 1V3JA 4WY0B 4Z08A 4E4FA 3GB6A 2QDGA 4DJDA 1BXNA 1DJGA 4YIWA 3WDJA 1H0IA 2V81A 3FAXA 3ZR6A 2A7PA 1B3ZA 3A3XA 4KEUA 2XU2A 4GXMA 5TBOA 1R3QA 3C56A 1OBAA 4QHRA 1FA2A 1JPIA 5LIWX 3DH7A 7PTDA 5HR6A 1UZ1A 2FZDA 4JY9A 4NZ1A 4AD2A 3TAOA 1JCTA 1FCUA 4GUIA 1RJPA 4JTLA 3OVGA 2WHMA 4M51A 3L0NA 4XKMA 4LEFA 1A5CA 1JGIA 2HMCA 3BTNA 2WMHA 4FXFA 4ZVJA 4YCPA 1E1CA 1NQ6A 2ATSA 5A6JA 1DP0A 3QY6A 4OKDA 3TA9A 1UP0A 2C19A 3SN4A 4DBUA 3QYSA 2J24A 1SJCA 4RPPA 5A2BA 3H53A 3PZUA 3KHJA 3PZGA 3GH5A 1QI0A 3NQVA 1CT5A 3NUKA 3BH4A 2Z2BA 2EPOA 1EZWA 2GJRA 3GQYA 4FSAA 2POTA 2Z4GA 4YVXA 3VGEA 2F6UA 4ZOAA 1O5XA 1XSJA 2PEVA 1REQB 4Z1DA 1EGMA 1KBJA 1VGAA 2GWGA 1W3KA 1A0CA 1EP1A 2YCLB 3ARRA 2QUNA 1POKA 4J35A 4Z2LA 2AKZA 4N4QA 4XKYB 5DRIA 4IIGA 2VZVA 1XP3A 3KWSA 3QSTA 4WY0F 4YTQA 1FKWA 1HJQA 3AS0A 1RLDA 2VGBA 3CH0A 3H2CA 2Y8UA 4IPIA 4P7OA 2GGJA 4GZIA 2AL2B 3AMLA 4OBSA 2YXOA 3W2UA 2F2KA 4PSRA 1HJVA 3V5FA 3QR1A 2BGNE 2P8BA 2G3NA 2QF8A 4ZQOA 1XH0A 5FI8A 4XG1A 4RLIA 5I78A 1SM9A 1V51A 1W1B1 4UTKA 5IHRA 1BF6A 2J77A 3WEOA 1XSKA 3LGGA 4NJIA 1GVRA 6REQA 3QKZA 1D7KA 5TIMA 1I45A 1GTEA 3KP1A 1Q13A 1ZBKA 1FQ0A 1RK5A 3EAUA 4XAFA 5HNNA 3WH7A 1NOFA 2QDHA 4C1KA 3IPWA 5ABFA 2ZIDA 2WZIA 1NOWA 4E3VA 4BR1A 2DT1A 3QZ6A 4QCFA 3FAWA 4WJ8A 4NJHA 3KE0A 1F73A 4GX8A 2PGWA 4DJFA 4I8DA 2O56A 3BJFA 2R1MA 2BXYA 1FWNA 2VCBA 4BEUA 3RILA 4QJ1A 2GVGA 4AZIA 2WKLA 3E12A 4C6OA 3QGVA 5GNZA 5D04C 4JTEA 3ITXA 4PUWA 4L4OA 4J9JA 2PDNA 3OIXA 3GNDA 1BKHA 1IXNA 2OELA 6ENLA 1FDJA 3DFOA 3NVTA 3N2CA 2R14A 3P2VA 3DUGA 2Q02A 3HBLA 4AH7A 1W1ZA 3OB8A 3WFAA 3WDHA 3CO4A 1PKMA 1XIMA 1OFRA 3T0TA 4HYVA 4XZ9A 1C7SA 5F2MA 3ABQA 2YIHA 2YCJA 3G1FA 5EB8A 4LUSA 1R3YA 1EJ7L 1XG4A 2GVJA 1XBXA 1GOKA 2OZ0A 3I3DA 1FX6A 1KTCA 2ZZ1A 3E74A 1MUWA 3OHMB 4R34A 2PDUA 3VOCA 3RX2A 3NO5A 2VQUA 3FOKA 1IR2A 2IKGA 2BHUA 3EA2A 4F0SA 2D0FA 3SIZA 2R1NA 4B5SA 2WZMA 4Q7BA 4O52A 3LHVA 3CB8A 4N7QA 2F84A 3RJYA 3PUEA 5FCZA 4J2PA 2A4AA 4JOMA 4IL2A 4R53A 3QH2A 3EMZA 4FB7A 3LPOA 4O8AA 2A5HA 1JYVA 2ONEA 5D03A 4S2CA 5AC6A 3CUXA 4P2VA 3SCTA 4OUEA 2UY2A 4AEOA 1FHUA 3IAPA 1R3VA 2PBOA 3L5MA 4QSHA 1V4YA 4JDBA 1QNVA 1XLIA 4C91A 3UW6A 4Q4QA 3SRFA 3QW3A 1EX1A 3GR8A 3EBVA 1EO7A 4MZYA 1NDWA 5I3GA 4MAVA 4NJJA 4EF9A 4UOZA 3VD3A 5IFTA 5F2IA 3DFYA 1GVIA 4NNCA 5C54A 4Y2WA 3WEZA 4XD3A 1MWOA 3PFMA 3HMJG 5EY5A 2WQDA 1ZJAA 1GVOA 2G0WA 4LVGA 5KZDA 4LB4A 4CCEA 3CNYA 2WW5A 3NQ8A 3KBMA 2E40A 3ZVIA 4WUIA 1WNOA 1XDLA 3P6LA 4HU0A 5HDRA 3BMWA 1MFUA 1U5HA 3HN3A 2QS8A 3BSMA 1E6NA 4HA3A 4XAPA 4L6HA 4GH3A 1ISYA 4B2DA 1LUCB 1FXPA 3WH9A 5EMKA 4HCHA 2VWTA 4F2BA 1IEIA 3CT7A 3HO8A 4JBRA 4I5UA 1TPDA 3C0SA 1DJWA 1MO0A 5DT7A 2WKGA 1HL9A 1KBLA 1C92A 1AL8A 3AOFA 4PTDA 1IYXA 2WMIB 4PL1A 2C79A 1V3MA 4GYPA 5CJMA 1DXFA 3BJSA 4LS2A 1NOUA 4UOJA 2I56A 1VBJA 4IPPA 2HK0A 4QSFA 2OCZA 1W1IE 4DUVA 5AYZA 4PMVA 3RX4A 3RG6A 3S6TA 2FLIA 1LT8A 4C6EA 4MKVA 3MB9A 4LC6A 1XCWA 3VIOA 1X96A 3GNRA 4LVFA 1XUUA 5CSSA 1A3HA 1V6TA 3OLGA 1J4EA 3I65A 2Y7GA 4O1BA 4C1NB 1UWQA 4I9TA 4LALA 3U57A 1OC5A 2WVVA 3UR8A 1F3EA 3R25A 1F3TA 1OINA 1YRRA 3FS2A 2RHGA 4LQ1A 1XYBA 3DHPA 3O05A 4QE5A 4RDVA 1EF2A 2G3FA 4B5XA 4FIQA 4X0VA 3E0LA 3LCHA 3H24A 3UP8A 2NQLA 1A5BA 3LZ3A 3SCWA 3WQ6A 1NELA 3SZ8A 1F61A 1V3IA 4BF9A 3ITLA 2PZNA 3IV8A 2VC5A 3NL2A 4LU0A 3AO0A 3VIIA 1JUBA 1M7JA 2C3ZA 4TVDA 5EMLA 4DJFD 2REQA 3E1F1 1ZSXA 3PNUA 1NWTA 5C9ZA 3VM5A 4BJHA 1QHOA 1MVYA 1IEQA 2QJMA 2OKTA 4ILSA 3QY8A 1OFOA 3WFZA 3MUCA 3FNDA 3N6HA 4FS9A 1W5OA 1S5VA 3G2GA 3HF3A 3R6IA 1BGGA 5C5YA 1PKYA 1GVQA 4HSNA 2QHAA 3KL0A 4PCFA 5C0QA 4MFDA 2D0GA 1GEQA 1EB3A 1L6YA 3MBFA 3VDBA 2J9YA 4Z2JA 4M81A 4UWMA 2C14A 3LLDA 2A6LA 3WX7A 4AY1A 2QGYA 3KVKA 4L4MA 3SDOA 4JTQA 3CIXA 2F2HA 3WQ4A 1ZJBA 1XV8A 1Z7AA 3NQFA 1WBJA 4NILA 1KLYA 4KPLA 3KL3A 3VD9A 1P4CA 1F7BA 2E28A 1JCLA 1QASA 4JQ2A 5LHFA 1RP8A 4PBFA 3L21A 3ONBA 3QV8A 2PLKA 5A8QA 1P1MA 4BWLA 3WQGA 3EYPA 4A8NA 2PD9A 5B7YA 4O1CA 4IIDA 4F2UA 2W5FA 1EDGA 4MPKA 1V5XA 2BSLA 3G8EA 3OP2A 3OGSA 5BOOA 4PB4A 1X6UA 1Q6FA 2E1WA 2QDDA 4M5PA 5B7ZA 1JCMP 4HN8A 1LBFA 3RGTA 3QGAC 4B5UA 4O50A 5B80A 3N13A 1RPXA 1OD0A 2VD9A 4PZVA 2QPSA 3TJXA 4LCQA 2LLEA 1SJBA 3VVGA 3WLJA 1JUKA 3V4BA 3AZTA 4OOZA 3LBMA 3D3AA 2Q8XA 1JL8A 3SURA 5HJLA 1WOAA 2EG7A 4LB3A 1WZKA 2JBMA 1GOXA 5EBUA 3ZVHB 2NV1A 2Z28A 5HMFA 3G1YA 4MY1A 2YA1A 2XIJA 4D71A 3QLLA 3OU8A 1HJSA 3VZYA 2WKJA 1CYGA 2DPEA 3LS9A 5A8PA 3TVAA 4LUTB 1O5KA 5CPQA 2CLMA 4K8EA 4ES4A 4YVVA 1FCBA 1UCWA 4HD5A 3CASA 1OG6A 5BOEA 3AS2A 3GIYA 3S1WA 4ZOCA 1GCYA 1IZJA 4P61A 4O18A 1DJNA 1HO4A 3EOLA 1BXCA 4R3UA 3WLLA 1IQ8A 3CAVA 4LBSA 1HX0A 2FDMA 3VKKA 4WJXA 2J78A 1J0JA 4IOTA 1EZ2A 2BP1A 1R9XA 3TR9A 4IMAA 4GYPC 3ABSA 1PBGA 4ZB0A 1MFVA 4QIUA 4B2DD 3SECA 3GS6A 4S3EA 3LENA 4LUYA 4GMEA 2GJXB 4ZCWA 3RCYA 3MP4A 4DJEC 2XVKA 1W32A 1Y5VA 1KM0A 2XSXA 4GG9A 2FJKA 1UA3A 3W74A 5LHEA 4ZBCA 2EHHA 4MJ4A 5A6BA 4GUGA 2AMGA 3NPVA 1RBAA 4DF2A 1KRBC 3E5BA 5FA5A 2FZNA 1KTNA 1VEPA 4GQQA 1K8CA 2FH8A 3S1VA 1DJQA 1GOWA 1LCOA 1ISXA 5E6ZA 2FZBA 5D38A 2QUTA 1J6OA 2PDKA 1SO5A 2PWEA 1Q63A 2ZYFA 1RLCL 4WVXA 3EX3A 1LOQA 2NLYA 3KAOA 1H41A 2W66A 1HJUA 3HOJA 2VYOA 4RV8A 3L23A 2V38A 4XZNX 3KHDA 5JQ9A 4D6IA 1K9DA 1HL2A 4IFKB 3LD5A 4P7LA 4X63A 1A80A 4AYSA 3P60A 1V0LA 3UBPC 1TYGA 3VUPA 1GW9A 1VHNA 2BOGX 3LNMA 1EC9A 4GY0A 4H2HA 1TRIA 4AW7A 2ZBTA 4XZLX 2GSEA 2JQXA 1EP2A 3MVTA 2WSPA 3KOFA 3N11A 1WZAA 4P5UA 1D3GA 3RM9A 3DZ1A 4KEVA 4AMAA 4X22A 4FZIA 2HBXA 1I2OA 3RLGA 3DEQA 3PF3A 4JTUA 1CX9A 2Y5JA 3DXIA 4U28A 1QVBA 1RPKA 2WJZA 1FKXA 4ZQPA 2BGQA 4DPPA 2WCSA 1B57A 1AD4A 2RFGA 4ERGA 4MFEA 1EWDA 1G01A 1X7FA 3OZYA 4GY7A 3Q65A 1VKFA 1VFUA 3MHFA 1UOZA 2OWCA 1IWAA 4OBTA 1AA1B 1YNPA 5AHNA 4AHOA 3NA8A 4UQCA 2G3IA 2B0MA 3NM1A 1AZ1A 3SGGA 3AJ7A 1JUEA 4PMZA 4ML9A 4ENLA 4AD3A 1FWAC 3CZEA 4BWLC 2DZPA 3ALGA 2WXDM 4HQVA 1Q65A 1U2YA 4LVDA 1A5AA 1JD9A 3EWZA 1FWHC 2HCVA 3CPGA 3ABOA 4GC3A 4HN4A 2FPTA 1LLZA 1F5ZA 2OZ3A 4KWUA 2OB3A 4L64A 1JZ2A 1MZHA 4ZXOA 3Q37A 3GHUA 2XWEA 5BRPA 3W2JA 2DZWA 3C8FA 4V1XA 4LCRA 4B16A 3L5AA 1DJHA 1NIUA 1GTHA 3GG7A 3TCEA 1J0KA 4ZB2A 4QLJA 3QRHA 4X9YA 2PLMA 3WJYA 4NSBA 5D9MA 4AISA 2VR2A 4LY4A 4KWVA 4YL2A 4QITA 3W81A 2WC4A 4PTXA 3WY1A 3QGKC 4GI8A 3NZGA 4JQAA 4JTAA 2GFTA 2WM0A 3APGA 3UWQA 3BAJA 2H90A 4W87A 4FA3A 4O4WA 1A0DA 1WOBA 4MF4A 1J6PA 1WPCA 2RDUA 2ZRZA 4KRTA 2I57A 3P0XA 1ZAIA 4ZGYA 3VD7A 1NF7A 3NL6A 4GUFA 3VMPA 4KCUA 1XI3A 1TELA 1I0BA 1AQ0A 2ALRA 3CZLA 1DQUA 1W3HA 3WIJA 1V6XA 1NQKA 5GNXA 1EGZA 2PGFA 3CHCA 1B3VA 4DELA 1D3CA 1ISVA 2VZTA 3AROA 3W7IA 4NAEA 2GL5A 4LY8A 4UQEA 4NQ1A 2WVSA 4AZHA 3JRKA 1GHSA 1VFSA 2D2JA 3ITVA 4I7UA 4JTHA 3OEXA 3GR7A 3ANVA 3FCPA 3VD5A 3GDMA 3OA3A 4GI6A 1YW1A 2W6RA 4BHYA 2J7EA 2GUBA 5HOSA 2IXUA 3QJAA 2OEJA 2V82A 3G1VA 1HP4A 3FSTA 1XFCA 5JH2A 1RP9A 3NJ3A 5CEWA 4H9MA 5LXEA 4D6GA 2J8FA 2VEMA 4HNOA 1NAL1 1P0NA 3KBWA 1OSEA 3APTA 2BOEX 4JHZA 3GXFA 3UPBA 3L0KA 3TFXA 4E6MA 3L9CA 1H2JA 3U7VA 3LX9A 3PPFA 4XAGA 4TOQA 4H41A 2BWGA 2YW4A 2ZQ0A 1C93A 4LAZA 3COTA 1PZ0A 4N9BA 2YLLA