4A05A

Structure of the catalytic core domain of the cellobiohydrolase, cel6a, from chaetomium thermophilum
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
360
structure length
360
Chain Sequence
YNGNPFSGVQLWANTYYSSEVHTLAIPSLSPELAAKAAKVAEVPSFQWLDRNVTVDTLFSGTLAEIRAANQRGANPPYAGIFVVYDLPDRDCAAAASNGEWSIANNGANNYKRYIDRIRELLIQYSDIRTILVIEPDSLANMVTNMNVQKCSNAASTYKELTVYALKQLNLPHVAMYMDAGHAGWLGWPANIQPAAELFAQIYRDAGRPAAVRGLATNVANYNAWSIASPPSYTSPNPNYDEKHYIEAFAPLLRNQGFDAKFIVDTGRNGKQPTGQLEWGHWCNVKGTGFGVRPTANTGHELVDAFVWVKPGGESDGTSDTSAARYDYHCGLSDALTPAPEAGQWFQAYFEQLLINANPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords CELLOBIOHYDROLASE FAMILY 6
publication title Structure of the Catalytic Core Module of the Chaetomium Thermophilum Family Gh6 Cellobiohydrolase Cel6A.
pubmed doi rcsb
source organism Chaetomium thermophilum
total genus 138
structure length 360
sequence length 360
ec nomenclature ec 3.2.1.91: Cellulose 1,4-beta-cellobiosidase (non-reducing end).
pdb deposition date 2011-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 4a05A00
1UP3A 4B4HA 4I5RA 1CB2A 3A9BA 1UP2A 2BVWA 3VOHA 4AU0A 1HGYA 2BOEX 4I5UA 2BOFX 4AVOA 1GZ1A 3ABXA 1QK2A 4AVNA 3RPTA 4B4FA 1OC7A 1UOZA 4AX7A 1OC5A 1DYSA 3VOGA 1HGWA 2BOGX 1QK0A 3A64A 1UP0A 2BODX 1QJWA 3RU8X 1BVWA 1OCBA 3VOIA 4A05A 4AX6A 1TMLA 3VOFA 1OCNA 1OC6A 1OCJA 3VOJA
chains in the Genus database with same CATH superfamily
1AZ2A 3W4RA 1DHKA 4XVEA 3UXAA 2YLLA 1K02A 4JQ4A 1XRSA 2RGMA 1CNVA 5JVLA 3MYPA 3VGEA 3DFTA 3IAPA 3WMSA 2ZC1A 2G3FA 3ARYA 3W7MA 1P7TB 3U3HA 9CGTA 4O1EA 3QV9A 4M1BA 2PBGA 5A2BA 1G4TA 3GHTA 1BG9A 1WP6A 1PZ0A 4PRTA 5A6KA 3LM3A 2VOTA 4BF7A 1CW2A 1KM2A 4LYRA 2QCGA 5I23A 2PDYA 3CWOX 2P5NA 5D2WA 5GNYA 2GWGA 2O92A 4CNNA 3N73A 3QQ1A 3CGTA 5BCAA 4FF7A 3MHFA 2B0MA 4MDOA 2DSVA 5JBDA 2DVTA 3PVFA 3ARTA 5D33A 4JICA 5ABTA 4F2BA 2Z1KA 3N3TA 2FB2A 3RMJA 3L0NA 3SGGA 3USBA 1FWHC 3KDNA 4BI6A 2Z6JA 4LUJA 1OK6A 1XCXA 4GFSA 1GVEA 2DH3A 5CAKA 3BW2A 2E3ZA 4XVDA 3TW7A 3MBFA 3LENA 4A2RA 3EB3A 5DRCA 4FO4A 1HL8A 2J6VA 3DOPA 4GOAA 3VILA 1R2TA 3AHTA 5TNVA 3CL8A 2OQHA 5TBOA 4JY8A 2OWXA 3FJ4A 5G4HC 2CNCA 1WPCA 3LMYA 2WW5A 4MFDA 3HPAA 4QCEA 1FDJA 1VC4A 4EE9A 4YN5A 5DMLA 1PVNA 1T99A 2PTDA 4U3AA 3K4DA 1RCXB 3SI9A 4L9ZA 3BMXA 3VU2A 4AEEA 5LNWA 4V15A 5CQ1A 4E2VA 3WH8A 4H00A 1IWAA 3QR3A 3UJRA 4GK8A 3S9IA 5CPMA 1I2NA 3EX3A 1NAL1 4HYVA 2I17A 2OX1A 3TQPA 4J28A 4IIBA 3VD9A 3CZKA 4ADUA 2WNWA 3CQHA 3ES7A 4H8VA 3DG3A 4DBEA 1QW7A 1RXOB 3DGBA 1EPXA 5E5CA 3L68A 3AIRA 2VFDA 2XH0A 1VS1A 2E1WA 1NOWA 2PRLA 2VFEA 4AZIA 2VX6A 3TJIA 3M43A 1UKOA 1JQVA 5JXQA 1XQKA 4UZUA 1P0EA 4XD4A 2FKPA 4DJDA 3MJYA 4FNUA 1FRBA 3PPGA 2QCDB 3PWIA 4WF7A 3DC0A 1P0BA 1ZALA 2DIEA 4DWSD 2G97A 2ACRA 1KD0A 1GQKA 1J6OA 2B81A 2GL5A 3GVRA 2Z6IA 3VINA 3ITYA 1VHNA 3D47A 3CTTA 3CBWA 1JDEA 3L0GA 1W9BM 3S46A 1Y5VA 1AFSA 4BZYA 1UD5A 3EA3A 5CPOA 1I6NA 1QMLA 4ZO6A 3JW7A 2C13A 4F4RA 3T55A 1TZ9A 3BWWA 3NYDA 3U7BA 4FPSA 4IG2B 1UOKA 2J75A 1TPC1 2CERA 1QO2A 1E15A 3STPA 3AYSA 3INPA 5JUVA 1R9YA 2A7PA 4O15A 3SUVA 3H7VA 4XZWA 2PSNA 3TC7A 4H9UA 3VZXA 5CJNA 1QPRA 4L7ZA 3HFYA 1YPXA 3SJNA 1NARA 3NZRA 2BX7A 2OSWA 1W3LA 2X7WA 2GQ8A 2QT3A 1GVOA 4QEHA 2DIKA 3B9EA 1MEWA 2Y7DA 1QPKA 1JG9A 1IE7C 5FJUA 1ISXA 2W67A 3ATYA 5K3VA 3WK1A 1JRCA 3WDHA 3QZ6A 5FI8A 4XZBA 3VZZA 3CV1A 3GWQA 4B5NA 2EPLX 1XYZA 4B91A 3WH9A 3OLGA 4BEQA 5HNTA 3AQUA 3LBCA 1RLDA 3FEMA 4H6KA 3L2MA 3H4XA 1OYBA 3SIZA 3K30A 4AZCB 1EUAA 3KAOA 4PL1A 2O0TA 5H91A 1WE5A 2DZUA 1F05A 3F4NA 3DKLA 4J3TA 3B97A 3WLIA 4WXYA 2BVWA 4GUFA 4I7UA 1YXCA 3ABXA 6XIMA 4L4MA 3OP2A 5CJ5A 2EPOA 5HNNA 4WLCA 1PCWA 2H6RA 1OK4A 1DYSA 4L6OA 4BA0A 3UA4A 3JZUA 2E9MA 3C0QA 4ZQCA 2HSAA 1ALDA 2ZADA 1F3EA 3N9KA 3M6YA 4JDYA 1S3TC 2VX5A 1UUQA 4WJEA 3QLDA 1GOOA 4H9VA 1CTNA 4R9OA 1JAKA 3S2CA 1CZ1A 1OINA 1Q63A 3WEZA 1HKMA 1XHGA 2C7FA 4HPHA 2P50A 3A24A 2HROA 1V02E 1NOFA 1TVPA 5A8NA 3HG4A 1TJ2A 1M5WA 1VF8A 4KFOA 4TMCA 1GT8A 1DP0A 3U48A 2DT3A 4AX7A 3UZWA 3OGSA 1TCDA 3HM7A 1VAHA 2C8NA 3FA5A 3CPUA 4JQ1A 3UJSA 1SZNA 1TPWA 2DY3A 4Y8FA 1EQCA 3LEPA 4WDWA 1S2CA 1YX1A 1EZ2A 4LYQA 1W5PA 2FDSA 1G01A 2Z1BA 3MUAA 4ACYA 1O6IA 4LEFA 4HN8A 3KCOA 1F6KA 1W9VA 5HJYA 4PUUA 4NZFA 2O9TA 1OX6A 4AEOA 3QOMA 3KWSA 5E09A 1H51A 4IP7A 3E3HA 3UBPC 3WEOA 2X0HA 1EB3A 1ZAJA 4PUEA 3VTRA 3CH9A 2QUNA 4XZ9A 4JS3A 2ZXAA 3TQVA 1UH4A 2J74A 3LXAA 1CB2A 4LF1A 3W6LA 4MNMA 4U4MA 1HKVA 4E8DA 4AHPA 1PHWA 3Q94A 5LIWX 1GYLA 3TYUA 4O1BA 1XYBA 3GIYA 1WOAA 3VD7A 1EJTC 3NIYA 1R47A 1KWGA 3M6DA 5F2GA 2D2OA 1X1OA 4HHLA 3W00A 3K13A 3WH6A 3IGXA 2WNQA 3WJSA 1UROA 1L0PA 2OQYA 2DZSA 3MI2A 4AF0B 1I9CB 1P6WA 2PWFA 3HURA 4K39A 3QYSA 3NYZA 5I3DA 1FH8A 1S5VA 3UT0A 4JTTA 5A95A 1QASA 4GE8A 3KWXA 5D02A 2I5IA 1EEXA 3I3BA 4B5TA 1W17A 2WMIA 4ILSA 3WUBA 2Y5JA 4C6FA 1OIFA 1ECEA 4WQ6A 2BDQA 4LV4A 1E6NA 2OT0A 3VNIA 2V5BA 4M56A 1J0JA 1KFEA 3VIKA 3N2TA 3W7NA 3G18A 4TV5A 3W7OA 4JTDA 4OUEA 4C91A 3UU0A 1O7AA 4YTSA 1WZLA 2V5DA 5EU9A 1W5OA 5F2IA 4QISA 4BI5A 1FTXA 4D6JA 3KL0A 3W81A 4W4QA 1RVGA 3NTYA 3WK2A 1A4LA 1GJPA 1OT1A 2F2HA 4QGCA 2JKEA 4C1NA 1XSJA 4DZ5A 2A21A 3VIIA 2J25A 4D6DA 3SRFA 3LHYA 2PBOA 4A3YA 6ENLA 1J5SA 1LRTA 2GJLA 2VZOA 3LCWA 2RGLA 5LIUX 1XR2A 1XWYA 1R7OA 4C6BA 3QC3A 2XFYA 4JNYA 3JRKA 2OOFA 2IW0A 2D69A 3E0LA 1Z6KA 5C2CA 1R5YA 4CQ8A 4V1XA 3RCNA 1I2RA 5HAOA 4E3VA 1US2A 3I7SA 1SO6A 3VXGA 4QBXA 1D7KA 3C8NA 1TV3A 5HUOA 1G94A 1BYCA 3HV8A 4IL2A 5G5IA 5AZ1A 4EP8C 3TAKA 2QW5A 4B5WA 1KWKA 2OZTA 3E6EA 3G24A 4DYEA 1RQHA 3L65A 1FCBA 4JEJA 5ECVA 4MKNA 1XKJA 1Z44A 3P6LA 1J6PA 2NQ5A 1JF6A 4FXJA 2X8RA 3EZ4A 1A3XA 5EKYA 4F0HA 3M9YA 3ZVHB 1W9UA 3V5OA 3RM9A 2E9BA 3R58A 4D6HA 3II1A 4PBGA 4QS5A 3ZVHA 3QY7A 4LVFA 2CWNA 4JTGA 3BTNA 4ECLA 5I3KA 2W6RA 5HPCA 1B1YA 1RUSA 3A3WA 4O4VA 1VH7A 4N7QA 5IXEA 1ZY9A 3H24A 2OO6A 3LQGA 3G1AA 3LN3A 3W2UA 4ZENA 2HS6A 2MUCA 3FSTA 4PYSA 4L9XA 1RBOB 3B3DA 2BG5A 2I57A 4DUVA 4E4FA 1BHGA 1C8YA 1UJQA 1ZUAX 2PDXA 4ZTXA 3LA4A 4Q8QA 4JXCA 4DX3A 1IQ8A 2F84A 3DFSA 4DJEA 3LCLA 1L6WA 3OOQA 3LG3A 2ZRYA 5XIAA 2HISA 1VB9A 1UWSA 4KEVA 1F76A 1WXJA 2NX9A 2A6LA 2VP8A 2QCCA 1KA9F 2PDIA 1WKYA 4JOMA 3PBMA 4IJBA 4DWSC 1ELSA 1VJIA 2C0AA 3GFZA 5AYIA 5JIPA 3S0CA 1L2QA 3KZPA 3BANA 1E1FA 1H7OA 1WBJA 4RX0A 3QHMA 4MKVA 2GDQA 5HATA 1Q7ZA 2D2HA 1VYPX 2QMKA 2WC3A 4IJRA 2CHRA 4Q4SA 2EPKX 1O1HA 1UBSA 1XLDA 5DRIA 1A5CA 4OE7A 1DE5A 2OGYA 4PE8A 3GRIA 1CGTA 4GABA 2QKFA 3TR2A 3FS2A 1BPLB 1R8LA 3CQKA 2XN1A 4CVWA 2H3BA 3I3DA 3MO7A 2XM2A 3M47A 4H83A 2ACQA 3EXSA 3HF3A 1T40A 2R1MA 3W2JA 5FEZA 2AKMA 3H54A 3AS2A 3UZZA 4NZJA 1V7YA 2WKLA 2QR6A 3F5KA 3KL5A 5FOOA 4W86A 1K7XA 4A3RA 2XVGA 2OKTA 4MG4A 4MYXA 1UQYA 1XFCA 7A3HA 4DJFC 2F38A 5BWAA 3SSZA 5HOSA 4J2PA 4Z1YA 3U2CA 1TQXA 1Z3NA 2Z24A 3FFSA 4GY1A 2GGHA 3PBVA 5FL1A 3R6IA 5IHRA 4DUOA 2E5BA 3BQ6A 3L5AA 2VGBA 4M1RA 1CBGA 4Z1DA 4JHZA 2WLYA 3VPLA 4RNIA 4OQVA 3W26A 3HQNA 4RDYA 2ADAA 3ABRA 1P48A 4HYRA 4DBDA 3GH4A 1JCXA 3I6TA 3MVIA 3U4AA 2DZVA 1NM9A 3CMJA 1XRTA 2OU4A 4H6QA 4AIBA 3BDKA 5J8LA 1EHNA 1X97A 1JPMA 2WM1A 4U10A 1FWNA 1QHZA 4TVDA 1CXIA 1DPMA 1O12A 1XDMA 3HBLA 1PWMA 3EWYA 1OC7A 2CESA 3GXPA 1BYDA 4A8LA 1W91A 3RPDA 3ZR6A 4H04A 5REQB 4UC5A 5DN1A 4I8DA 3VABA 3OBEA 2GJRA 3CUJA 2QJIA 5DO8A 2FLIA 1XYMA 3FDGA 3CAQA 4FLQA 1QOPA 2A3EA 1F6PA 5EGRA 1CXKA 3M44A 1EC8A 4O57A 4A3QA 3L4YA 1W3JA 1TMQA 4JHMA 1XIMA 2B7OA 1XLCA 3HN3A 2CXGA 1LG1A 3SQSA 1LL4A 1W2PA 3ZSSA 3VFCA 5CZSA 5EMJA 4FI4A 4EOUA 4AD0A 1R3QA 4PULA 4NZ4A 4DO6A 3W87A 4AVNA 2XM1A 1TCMA 5ECUA 2DSKA 2ODOA 1KQYA 1Q66A 4B92A 2JEPA 3MI6A 4HA4A 3SO7A 2PF0A 1W0MA 1LLOA 4X2RA 4LBRA 2PTZA 3UXIA 3TU9A 2VTFA 3B8DA 3OTRA 4MY1A 4XBJA 4MFEA 1JR1A 3NPXA 3EWCA 1XCWA 5LZLA 4MB5A 2DVXA 1XISA 3ITGA 1M03A 2RDUA 3H23A 1ADSA 4ICCX 4IGNA 1U1UA 1ZSXA 5D2VA 2HE5A 3W02A 1BYBA 4ZE5A 3LPFA 4JNMA 4WSKA 3RM4A 3TMQA 1EDQA 2A0NA 3UGVA 5AOUA 2PODA 3VMOA 1VHCA 1QJWA 4UBPC 4H9MA 2V8ZA 1F3WA 1E9LA 4FLOA 4UXDA 1JRBA 1C29A 3NPUA 1GORA 4YVPA 3L5MA 2HDJA 4Q7IA 3C2OA 4E8CA 2FZ9A 1UWQA 3GVWA 5A69A 1X6UA 1DWJM 4NUWA 2ISFA 3NUKA 1VIZA 3GFXA 4ZOEA 3P0XA 3MHGA 2HWGA 4WVXA 2YZ5A 1EJSC 4D6GA 1PIIA 1H63A 3QBUA 4F48A 1TV8A 1VCFA 4QAWA 3WLKX 3KOXA 1NWRA 4NAEB 3QSTA 1T6MA 2WNNA 1AJ2A 1MXSA 3DFOA 4PMDA 3U4FA 4OFCA 4P7RA 1LF1A 2YXXA 3LCGA 2V82A 3E2VA 3PBUA 2E5DA 1GQJA 3O63A 3C5QA 2QJMA 5HR6A 4O54A 4LVDA 4FSAA 4J27A 2V6AA 2NX3A 3DFHA 3UG5A 2NUYA 3PG9A 4I3GA 1EOKA 4RE3A 3UQNA 5HMDA 2BBFA 4S3CA 4UQCA 3POCA 5CZKA 3VK5A 1M01A 1NFGA 1XLKA 5CCZA 3L4WA 1B3YA 1MVYA 2NQ9A 3U7VA 1QK2A 4AH7A 1SO3A 1E70M 3IVSA 4F79A 2I14A 4UR8A 3RCMA 1JEZA 1VYRA 5BROA 3UXLA 2E28A 3VYLA 1XGZA 3ONBA 3NZGA 3IIOA 1CWYA 3CJPA 4IMFA 2PTYA 1EP1A 4XKYA 4F3HA 2I1OA 1TJ1A 1BKHA 1JCYA 5D04C 1ZP3A 4WKHA 3MCMA 5DXXA 2IPWA 3GS6A 3BG5A 1J0ZA 1H50A 3LERA 1WXZA 5FKYA 1XX1A 2WVVB 2E6FA 1MW1A 2GQ3A 1GHRA 5CPSA 1LROA 3NL5A 1LZOA 1HIZA 2WVVA 5D38A 3QHNA 3S6TA 5BRQA 2V38A 1QFEA 1RJRA 4QS6A 3KBWA 3EKLA 2EEXA 2P76A 2YDRA 1JDFA 3IACA 2JBMA 4GQGA 1UWTA 3TKFA 1S5TA 4LFYA 1LJYA 1YBQA 2IKHA 3S1VA 4WY0F 1KGWA 4H9YA 4ZQMA 1TJ0A 1MUMA 1EX5A 1EBGA 3HGJA 2GGJA 4UTKA 4K68A 2WWDA 4DWSA 3WY1A 1YRRA 4J35A 2WC7A 3VOGA 1G4EA 5LIXX 3N4EA 1UHVA 1X8FA 1NDYA 3TYAA 1UWAA 3QQWA 1RJPA 1EH9A 4GIRA 4GVIA 5LNUA 3MMUA 3VGDA 1UR4A 4IH3A 5D9OA 1GKQA 3AJ7A 3PJUA 3UA3A 2OYLA 3M0YA 3NL3A 5DLCA 5IM51 5XINA 1QO5A 2PEVA 5JH2A 1G1YA 1F73A 2VZVA 2YA1A 3GKFA 4KKXA 3IK2A 2E6YA 3DYOA 3EOUA 4O8AA 5BU9A 3R0UA 4HJWA 3ZLGA 3B8WA 2YL9A 4Z1AA 3WX7A 1KR0A 3TNOA 4PCSA 1KNWA 3H2AA 1O5QA 4LYKA 3SDOA 1GPFA 4D2JA 1LBLA 3BL3A 4QNWA 1A47A 4LBUA 1B4EA 2WJZA 1XLLA 2XIBA 3SAZA 4AD4A 2EJ1A 4XZMX 1D3CA 3W7LA 1QNRA 2CZ5A 2QV4A 3NZQA 3NOYA 4WOQA 5IFTA 1GYNA 2GVJA 3O0KA 4L1GA 4EKJA 5G4WA 1S2UA 4RNHA 1TPB1 2J27A 1UMLA 5E9XA 1JCNA 2R1NA 2Y63A 4TQTA 3V16A 2QPUA 4O17A 1CXHA 1ONEA 5CKSA 3G8RA 3BAJA 3CPRA 2IPFA 3QOKA 5GNXA 1EXBA 1T41A 1YIXA 3MANA 3IGUA 4O0ZA 3NZPA 1W1A1 2D24A 1FHLA 1KFKA 2CLFA 3BG3A 3WIJA 1US3A 4PSRA 1CT5A 4NILA 4MJ2A 2VELA 3NL6A 1VFHA 3TLLA 3A9BA 2VFFA 1HJWA 1JXJA 1Q6QA 4KEZA 3SY8A 4UQEA 2YA2A 1KXTA 5TIMA 3WLRA 4DXKA 3SCVA 1PE1A 4JTEA 5G2IA 2X1IA 1HG3A 3VIOA 2GJXB 2CZDA 1JAEA 3TFXA 1EA0A 4YTRA 5C71A 3W7KA 5G1YA 3TDFA 1BWKA 4W87A 1S38A 3L5LA 2EQDA 4LUTB 2W0UA 2XZ7A 1IEWA 1XBZA 2XH4A 3ORWA 4IJCA 4B16A 1L6YA 1BWLA 3O3RA 1UQZA 1ISZA 2PI6A 5FCZA 3T4WA 4CQBA 1PTDA 4M3PA 2PWVA 3HQOA 1NEYA 1H2JA 2ZFAA 1XL9A 3L4VA 2W79A 3EYPA 3MC5A 1DJYA 3W1TA 4AMAA 1UA7A 1K8YA 4GYJA 3WQWA 4WJ8A 1YE6A 3PZTA 3MMDA 4IPPA 1FWTA 4LNCA 2OX4A 3AXXA 3TJXA 3N19B 1A0EA 1YDNA 3GZ3A 5FL0A 4DAIA 2ZE0A 4MVAA 5KZEA 2QIWA 3ABOA 3C6CA 3FKKA 3K1DA 4OBTA 5MHBA 3BPWA 1RCOB 1VBGA 3PZ9A 1DTNA 4CD7A 1XSIA 1J9YA 2TODA 3FY1A 4ICNA 4WZHA 1IF2A 2CZFA 4JTHA 4Z2IA 1LG2A 1EDTA 4YLWA 3AWOA 4WJXA 2FH8A 3C2EA 1GG0A 4ZEPA 1NDWA 4I7VA 1G7VA 2UZ9A 1K4HA 4PB3A 3VNYA 3A5FA 4RLIA 4Q7NA 4O28A 4NAFA 3FEQA 4DF1A 3ZJ8A 3CMGA 3W25A 1R86A 3MP4A 4JTIA 4E0CA 1A0DA 2V0TA 3DHDA 5KINA 4ZQOA 3XIMA 1EYEA 2E40A 4PTMA 1KM5A 1O94A 3IARA 3C3NA 2CBUA 3O05A 3BE7A 2CLEA 2ZA2A 2NV1A 3OLEA 2R91A 3MDWA 3W85A 1Q65A 4KFPA 1TTJA 3O7UA 3MA8A 4B9ZA 3RMEA 1KC7A 4HSNA 2G3MA 4D1JA 4NIRA 3QTPA 1BG4A 2FQIA 4IPLA 3RPMA 2QCMA 2XJ7A 3TZFA 3EWDA 2OSXA 1EGZA 2NQLA 1PAMA 1EJ7L 4FHAA 2CZEA 5LXEA 1RJQA 4NYYA 3WD0A 1XBXA 3WQVA 4XISA 3AO0A 5D03A 2PB1A 4ASTA 1PKNA 4IFKB 3C3UA 4PUMA 1O5KA 3ZLFA 5FAGA 1JI1A 1DE6A 1G69A 2DSUA 3WG6A 3CH0A 3M0JA 1GNXA 3ALFA 3T9PA 3OA3A 1NU5A 3GE7A 4O50A 3EA2A 5C7VA 3DCPA 4TX8A 4GY0A 3HO8A 1SR0A 4Q8WA 4YHGA 3V75A 6REQA 1TMHA 3GNDA 4DI9A 3FA3A 5BXPA 3R13A 1B9ZA 2ISDA 4WCJA 1V51A 5FA5A 4AVFA 3GM8A 3FVMA 3WFAA 4FLRA 2ZUMA 4G9PA 4PMNA 4YYCA 2FJUB 1BVWA 2F6XA 8A3HA 3VE7A 3B40A 4X2PA 4EIVA 2VGFA 3PNUA 4RW5A 4ZQRA 3QYQA 2H9AA 5AHNA 4HNNA 3M0LA 2FTPA 2ZX9A 2G4FA 2ZYFA 3SUTA 4JN7A 3AHYA 1SJAA 1F6YA 3VNKA 3JR2A 2YL6A 3FGCB 2WSRA 2YYTA 3SRDA 2RH9A 5HMEA 4NJJA 1HJQA 2HRWA 4UQAA 3VDBA 1UR3M 1FP8A 3TYBA 2G3NA 4WSJA 2W92A 4EACA 4GACA 4MLRA 5DMYA 3EPNA 5EL1A 5M3WA 3QY8A 1QXLA 2PDCA 2QJGA 4XV0A 2RHGA 3QW3A 1Q85A 4W84A 5AYXA 3BLEA 3BH4A 3WEMA 3B0UX 3UWVA 4H3DA 5D2XA 3TW6A 1AH0A 1UC5A 4TXEA 1V5XA 3OGVA 3IUHA 3W53A 1Q4NX 3A12A 2ZUSA 1MQQA 2DSWA 3LK6A 5FJIA 1BXNA 2J7CA 3GHUA 3N04A 3RIKA 5LA1A 3P82A 4C5ZA 1C7TA 4MNLA 1R87A 1MFVA 9RUBA 5F1VA 3VDCA 3B05A 4B3ZA 2OZ8A 3OHMB 3GU2A 4CNSA 2P53A 3GTNA 4C6CA 2YOCA 2WSYA 4HJFA 1RBAA 3W24A 4BQ3A 2IPGA 4QJ1A 1SZGA 2QIIA 3WNMA 2VC6A 5I3HA 5BZAA 3WH5A 2P8BA 5FIPA 1TMLA 4QG6A 2YDAA 1D2KA 2PDGA 4JTAA 2XFFA 5I3GA 5AHMA 5HWMA 2PPGA 3V1HA 3IJ7A 4CNOA 1HL9A 4GBUA 1MWOA 3LI0A 1UR9A 4QROA 1OX4A 4LBSA 1Q6DA 4MB4A 4TUFA 1KLYA 3R94A 4FR1A 3AWNA 1TV2A 1B3ZA 3H55A 3T4CA 1BAGA 1KGXA 3D3FA 3G6MA 1ZRQA 4R7JA 4IPJA 1W9PA 2BHZA 3WK0A 3NCOA 4BKNA 3QR0A 1IZCA 4Q22A 3OO2A 1VBUA 3CUXA 3NQCA 4WXZA 4PMZA 1ESWA 1F3TA 3T44A 2XISA 2BFGA 3NEHA 3H2FA 1AQHA 2VD8A 3A4JA 3EWXA 3I68A 3RDKA 4GXPA 4G7FA 3EWZA 2GPTA 3GYEA 4DLFA 1EJRC 1NJJA 1OWQA 4HU4A 4I6VA 4QG8A 4KWWA 5HQMA 1U2YA 2QUVA 4CU8A 3AS1A 4FNTA 3GIQA 2TAAA 3EWBX 1BVNP 3KX6A 3T42A 3Q65A 4LC8A 2E8YA 4D6CA 4RKAA 1C7SA 1KCXA 4OHQA 5B80A 2E9LA 3ELFA 2CKRA 5I03A 5HBFA 1I75A 1GJUA 3LNPA 1JZ6A 2A3LA 6PTDA 1N8IA 1NF0A 2B4GA 3FSUA 1G9HA 4IP4A 4IFRA 3OZYA 3NGJA 4EPDC 2YPIA 3VOHA 2FFIA 4QHRA 1C93A 4K37A 3QGAC 4BF9A 5I6SA 2O7QA 1TVLA 1PV8A 2DVUA 2QV5A 3W1MA 3PZQA 4CKQA 4FB7A 3SQLA 1QWKA 3W7HA 5DY3A 1IR1A 2P8CA 4ML9A 4HOWA 4IWWA 1YXYA 4LALA 3GNXA 1DXFA 2VR4A 3GLCA 4PMXA 5FJRA 1SU5A 1T0OA 1JFXA 3F7JA 4UFHA 4ZOAA 1PO9A 3LX9A 4ZO8A 3SN4A 4KRUA 2A7RA 2QCLA 4LXFA 1ITXA 4RL3A 1EXPA 4X0VA 1DJWA 3HJZA 5IHSA 4DJDD 3DI1A 5CEWA 4UWMA 1X6LA 3LD5A 3BV7A 1Q2RA 4IFOA 3KBJA 4XZNX 1VCVA 5JU6A 2GSEA 3IJDA 3M7WA 2CPUA 2DQXA 5T8GA 3W82A 1XW8A 3UZ5A 3QEZA 2QCNA 1EKOA 3N6HA 2IPJA 3QZEA 2OJPA 2YR1A 5MF5A 2Y5SA 5ABFB 5G2WA 4EXAA 3ID7A 5D9NA 3ZT6A 4GCAA 2GYIA 3HGRA 3CUFA 3WQEA 1AQ0A 1H7RA 1XG4A 1DEDA 7XIMA 3SY1A 4RE0A 1SFTA 1OCBA 3CEPA 1DTUA 2B31A 3KCJA 1TJPA 2Z28A 1Q6LA 4Q6XA 3KTXA 5KITA 4HA0A 4X9SA 3IEBA 3IRSA 4CNPA 4Y9AA 2FVKA 2OEMA 2XPKA 2X2YA 3GR7A 3VGHA 4X22A 1XIDA 3RYSA 5DCDA 2OB3A 5G2HA 1SSDA 2PC8A 4GHRA 3NM3A 3CIXA 3GG0A 3GXFA 5EPDA 2XN0A 3GIPA 5CC5A 2WB5A 3QM3A 3NQGA 2DEPA 2YDSA 1E5NA 3DFYA 1F2JA 1J18A 4NRSA 1MXDA 1QCWA 1WDWA 3VKKA 1SGJA 3WKZA 4UZSA 4RNFA 1MW0A 1RY0A 2WJFA 4BR1A 2P10A 5ABHA 3UD6A 1VR6A 3JU2A 5H8MA 3CUHA 3W6YA 2R94A 3FKRA 2BY2A 1UWUA 1E0TA 3FV9A 4LTSA 2PWHA 1JCMP 3S1GA 1VBHA 3ZJ7A 5CZ0A 5A8MA 3RLHA 3W74A 3WFZA 2WMGA 3WJXA 5BU6A 1NQ6A 2OVLA 4GIAA 2P0IA 2TPSA 1XIGA 3O15A 2B7QA 4A22A 1RHCA 1BGAA 3BZJA 5F4SA 2WPGA 4U28A 4ERGA 4JYEA 1EDGA 4LNYA 4GJJA 2WKGA 3KOWA 1FFRA 4X3ZA 4E5TA 3VNJA 2WZTA 4UUIA 4XD3A 3TCEA 1ZBVA 3SECA 1XG3A 3P8IA 3LI1A 2R9RA 1VP5A 3UERA 1YDOA 2W61A 1N7KA 4B5SA 1ZCCA 4JR5A 1F7BA 4JN8A 2YB1A 1S39A 4LS2A 4I5UA 2BOFX 1TWDA 1T7LA 5A8OA 2CKSA 3AICA 3VD4A 1VRXA 3F1QA 2R8WA 3N9SA 3OLIA 3GXNA 2Y24A 4AFYA 4TOQA 1LUCB 1VYSX 4WDXA 2C1IA 3PZGA 4UNLA 3NM1A 2PRMA 3W2LA 3GHRA 3H4WA 4AQLA 1LRNA 1H11A 3STGA 1Y5WA 4H4IA 5A6TC 3UJ2A 3BQ5A 1E9ZB 3NQFA 1XBYA 3WCZA 4AMCA 4DPPA 2ZE3A 3O1NA 3M46A 4CCCA 4E2BA 3KRSA 3NR0A 4OV4A 4G1KA 3SQMA 1W5NA 3K2GA 2WYSA 2D2GA 2ZTKA 4QEEA 3ITXA 1G6CA 1KBBA 2GOUA 2WQDA 1JNDA 4KWVA 3ZOAA 5FD0A 4BQ4A 3R10A 4Z1BA 3QVQA 1BQCA 2UWFA 1GWJA 1ZTVA 2V68A 2ANUA 2NWSA 3V36A 2GGEA 3NXFA 4IISA 1PCKA 3S5ZA 4GVGA 1W1YA 4S2BA 3ARWA 1IWPA 3AI0A 1IEVA 3C2YA 3BLKA 3SCOA 4JTUA 3U57A 3GDMA 1U5HA 3WDRA 3QHOA 4DUWA 1YLVA 4YIWA 3PB0A 1T8XA 1W5QA 5CPLA 5K9CA 2FZDA 1YPFA 5HWNA 1AA1B 3ITCA 2A3BA 1VRDA 4PBEA 2ZQ0A 1T8QA 4YHEA 2HEJA 2WCGA 3OIXA 3B03A 4TX9A 4K1GA 1AK5A 1Q3NA 4YCOA 1YADA 3AXHA 2C16A 3TYEA 2J7FA 4R9XA 2XVKA 1EFZA 1UUOA 3GX9A 1I4NA 4Q6JA 4F2TA 4CQAA 4GX8A 3W70A 2FGLA 2Q02A 1TE1A 3G1SA 2Z1WA 4KH2A 2WCAA 1D3HA 2C14A 2J6XA 3BVJA 2AGTA 4D8LA 1YYAA 1WOBA 1ZJHA 4IGHA 2ZKMX 3P81A 1WDDA 3W84A 1VBRA 3M7SA 5HQEA 3T05A 3ARXA 4LYPA 4PC8A 3W86A 3TVAA 2NLIA 1LWHA 2YCJA 1BSLA 3T81A 3TOYA 3QF0A 1FH9A 3L2IA 1IXQA 1E56A 4BQ2A 4J3ZA 4XAFA 3T09A 3GQYA 1FVPA 3HGSA 3W7EA 5DCEA 4HOXA 2FVLA 5RUBA 2VX4A 1V0MA 3ARVA 2YCLB 1CDGA 1TTPA 1CGVA 2Y8KA 2IKIA 2QDHA 5BWFA 4YL2A 3AOFA 4KT2A 5BW6A 3MW7A 1KTNA 2NV2A 5HWJA 3VDGA 3APTA 2XSBA 3P2VA 4DVOA 3BICA 4KETA 3S8HA 1MDRA 3WQCA 3RJXA 1FKWA 3IIVA 1A53A 4H8HA 4N9CA 1OSEA 4GCXA 1F3XA 1ZZMA 1M7JA 1WZMA 2ISWA 1QPQA 1EIBA 5FSEC 1VZWA 4IGMA 2FGBA 3TXVA 3CQIA 1EUNA 4UFIA 3NGFA 2V9DA 1UUMA 2BVTA 3UWUA 2VXNA 4IIHA 5HXMA 2ALDA 4DBSA 5CC7A 1BFNA 2A3AA 2XFWA 3A22A 1OGBA 3KOYA 2FIQA 5BYWA 1GTHA 3GC4A 2Y2WA 3HMCA 1QPNA 1TRDA 3LPGA 3A5VA 3OVPA 3ZVIA 1F8MA 4N0RA 3MZ2A 3R43A 2DIJA 3VA8A 4S1FA 2WANA 4KRTA 5C9ZA 1Z41A 1R6WA 2PP0A 5DELA 4B5UA 2BVYA 3KP1A 3RXZA 1E40A 2VZUA 1CXEA 1KM4A 4H2CA 4A35A 4DO5A 4L4OA 4JBRA 5FEWA 1Z89A 3DHFA 4N6EA 4P8XA 2ZZ7A 4LWWA 3PC0A 2V5KA 2WHMA 4DN1A 3C61A 4D72A 4TIMA 2FHCA 2ACSA 1W1VA 5AC6A 4JFUA 1R3RA 4MYAA 4I90A 3CHCA 3CAKA 2DZTA 3S9ZA 1CB7B 1US0A 3NXLA 3TP4A 4QXIA 5LA0A 4IX2A 2ZOXA 1RZMA 3GUGA 5FSDC 4BJHA 5M2FX 4HQVA 4LF2A 4LRSA 2IUZA 2XVLA 3EDEA 1S2WA 1E6PA 3GKAA 5LSMA 1UKTA 2FZBA 1PXGA 3L4XA 5J5DA 1JZ4A 3ARUA 2PCQA 1AH4A 4HHHA 1I1XA 3RK8A 2GVYA 4DJED 3R12A 3RILA 3W2NA 1UIOA 1JYVA 3WNNA 3MY9A 2WJEA 4J9JA 1GK8A 4DJDC 3LSCA 3CHDA 4JN6A 4NQ1A 3DFNA 3IUIA 1PWLA 1HXJA 4JTKA 2RFGA 4K8GA 3TR9A 4DZIA 2O4QA 3GDTA 2J8TA 2RDWA 5KZ6A 4NXSA 4QIUA 5D09A 4XIMA 1QW8A 2AQOA 3SM0A 3RG6A 3N2MA 4BI7A 3L66A 4CN4A 3LV5A 4HNOA 2NZLA 4DPQA 4IT1A 2YSWA 1PDZA 3AIEA 1BRLA 1TPH1 3DECA 3MCOA 2WVSA 1B5TA 4MUZA 5HINA 2PS2A 4IUOA 5E9AA 4MUPA 1J93A 4XKMA 1TIWA 3RAOA 3CAVA 2PDPA 1LL7A 2YCEA 2OLSA 3VKCA 4L61A 2EG7A 4S39A 8CGTA 3ZZ1A 4HK5A 2VCBA 3Q45A 4S3FA 2VYOA 1F07A 1P0KA 4NY2A 2CZVA 2OGJA 3QRHA 3B4YA 1W1B1 1CPUA 3UVIA 3H22A 2BZNA 4CD4A 1Y0EA 4Q4PA 4WK9A 1UD6A 5C70A 3MYOA 3SCTA 3CQJA 2PZ0A 4EXBA 2CLMA 3WD3A 4CCEA 4KEMA 5DX7A 1XM3A 3ZWSA 4JIRA 1JUKA 1LT7A 2GVEA 2VMFA 2W5FA 4XUYA 4EAYA 2Q3RA 3IWPA 1JCTA 2PGFA 2Z00A 3H2EA 3TWBA 3FHQA 3MVTA 2XYLA 1CI1A 5MKGB 1OFQA 1W8GA 3WUFA 4A8RA 3PR2A 5HUPA 3GVVA 4XK2A 1W37A 3AC0A 4GXMA 1EJVC 1GVYA 3WQOA 4RXFA 3ZMRA 4HU3A 3JUGA 1GOIA 4M29A 4MJZA 3BMVA 3DX5A 1YXDA 4PA8A 2X30A 2W3ZA 4AD1A 3IIXA 2J62A 1MMFA 4DYKA 3DESA 3WFLA 3GG1A 3SUSA 3CQ0A 4GVFA 1NDZA 4PCPA 1SFSA 3DUGA 4M82A 1NF7A 2WWCA 1IHIA 1W2VA 3GBEA 4LX4A 4JQ3A 3RR4A 1TELA 2EPMX 4K3ZA 1H4PA 1J0KA 1OFRA 2PDNA 1AL8A 4OJYA 4YWSA 3S4TA 4S23A 4KQNA 1E0XA 2W27A 4AHOA 3B0YA 1C8VA 1PZ3A 4JX4A 4AIEA 1KM3A 3K4WA 4UTJA 3AZRA 3VE9A 1Z7AA 2A79A 3WLHA 3UCQA 5D2YA 3BW3A 2Y62A 5F4WA 3W07A 4R3UA 1CLXA 3MJMA 2DJLA 4GD0A 3AS0A 3SCQA 4LC6A 4Z42C 5CPNA 3IPWA 4ACZB 2DW6A 3GTIA 3YPIA 4WY0B 1BF2A 1P0DA 2QCHA 4AC1X 4HPNA 3KFTA 2WMHA 1ZP4A 3ABSA 4DYJA 4QLKA 4D71A 4ADTA 3ZSTA 3SADA 5LA2A 1OFPA 3O6YX 2DDXA 1OC6A 4INFA 3RU6A 2YKKA 2Z26A 2VWTA 1IYXA 3K8LA 3UG4A 3AHVA 1AW2A 1KV5A 4IMCA 4O19A 3ZR5A 3HPXA 3C52A 1XIBA 4PRRA 3WL0A 4H2HA 3SY5A 2XIOA 2YIHA 2I5QA 3AALA 3AIWA 2C3ZA 2J9ZA 2Y7GA 1RP8A 1C8XA 3B8TA 1E0WA 4GKLA 1HL2A 1XYCA 2VHLA 1UYQA 3K5XA 2REQA 3VX0A 1KFWA 2A3CA 4WKAA 3B9DA 4CLMA 3C2FA 1QI5A 3ARQA 3FAWA 3QR1A 4JL2A 4L1XA 2WSQA 3GFYA 4NSBA 2HK0A 4IIGA 2I9UA 4ZODA 3VOJA 2BY1A 3A3XA 3C8FA 4IL0A 1KQZA 7ENLA 1K3UA 4JTRA 2JE8A 3QGVA 4EK7A 1Q45A 2J77A 2DUAA 4DM2A 1JPHA 2FZMA 3KL3A 4AWEA 1AW1A 3CWHA 1HVQA 3P3BA 5ENLA 3QQ0A 3FVDA 4DXXA 3LLXA 3HPFA 4M80A 3RX4A 1K8ZA 3R0DA 4G1NA 5BOFA 4L1WA 4QM1A 3IIPA 1XRVA 5DY2A 2PDJA 3E74A 1JXKA 3EX4A 4GXWA 1A50A 1PEZA 1UZDA 3M41A 4ZB2A 3TTEA 4H8NA 3NQMA 5HA7A 1ME8A 1P7TA 4HK7A 2H8XA 3COTA 1JYXA 3KVKA 1V6TA 1GOMA 3CXOA 3WZ0E 3MMTA 3VNMA 2VC7A 1TPEA 5DANA 1F74A 3V3WA 4TVUA 3F2DA 2D0HA 3VOIA 4GRSA 5EFFA 2HCVA 3CWNA 1GEQA 4RXGA 1C8QA 1QUMA 4RK8A 1ZJIA 5A8PA 3QN3A 3MUCA 2BNJA 2PDMA 3B8IA 4C6IA 5C9XA 3LQLA 4AC7C 3HJEA 4Z08A 1UKQA 1Q8JA 1KRMA 3KEHA 2J4GA 1KFLA 3GXDA 3ITVA 4JFSA 3V18A 1GCYA 4JD4A 3WMCA 4MAZA 3WQDA 1OZQA 2X1SA 1PX8A 3S5YA 2CFFA 4US6A 1C91A 2DPEA 1DHPA 1JGIA 2V30A 4UOZA 3W1RA 4LANA 2R82A 2Q6ZA 3NQBA 2W91A 1F4HA 3I6RA 3GVGA 7TIMA 4AHQA 3B8SA 3KHJA 3REQB 4B5VA 1FWEC 3PZIA 4XD5A 3SZ8A 3UY7A 3V35A 1SQ7A 3C0LA 1W3KA 3REQA 5FJJA 3AMGA 3PWAA 1GVQA 2QQ6A 1Q2SA 1OADA 3GG8A 2FYMA 3ZLHA 3VFLA 3M16A 2NUWA 1MSSA 1XCFA 1E4MM 4KF1A 2JKAA 4O53A 4QRNA 2ZXBA 2F2KA 3O06A 1L8NA 4QCFA 4H7CA 4CD8A 5BMXA 2F7FA 1GYMA 1H1NA 4WRHA 2YW4A 4L9YA 4AAJA 2VZTA 3M4HA 5CSRA 2XVNA 3TA9A 2Y4SA 3SIMA 3S6DA 3CZEA 2BHYA 2FGZA 5DXYA 5E0KA 4ZR8A 1WAUA 4AWSA 1XC4A 3DFPA 2P3EA 3APGA 1VFTA 4PMQA 4TMBA 4FALA 5LGXA 3GNPA 5M17A 2Y5EA 4LAOA 3TZNA 2QGYA 2WZMA 3TQ0A 2QCDA 3TK7A 5IBXC 3GYCA 3QV7A 2I9EA 4W85A 1OFBA 4QSFA 1N8WA 1AW5A 1JPIA 1VEMA 2XH7A 3VIGA 3AS3A 3TJ4A 4AIUA 3SURA 1SR9A 3DERA 4FOKA 3KXQA 3P62A 4GC3A 3TE9A 5AHIA 1QNQA 4XBKA 3O16A 4NNBA 4YCPA 2VFIA 5CPQA 1KBLA 2JF6A 1CXFA 1V6UA 4ZFMA 4IG2A 2NT1A 1P4CA 3RNDA 3MKKA 1TTIA 2DT0A 4IZGA 3PP7A 1I60A 4XIAA 1K03A 3RRAA 1OYAA 3BGAA 3STFA 1ENUA 4Q4RA 5J5RA 4P7OA 1AMYA 4Y8EA 1YPIA 3ZJKA 4PTVA 3AMCA 3PZOA 1JPKA 4DJEC 4N4PA 2ZDSA 2L5HA 1K4GA 2A85A 4POCA 3UPMA 4F40A 3W01A 3HG2A 4WDUA 3AYTA 4FEZA 3NJ3A 1J4EA 1EL3A 3C56A 3M5YA 1MEHA 2Z7GA 3TYDA 5IRPA 5IDZA 1E0VA 4DELA 1DVJA 3BLPX 5A6AA 5A6SA 4RDZA 3AIUA 2EG8A 2E8ZA 3PUDA 3Q4DA 1TTQA 2FDMA 3UGRA 3WLLA 3BURA 3ZJ6A 2QLYA 3MP3A 1ME9A 1YTDA 3ARSA 3LMZA 3TQKA 1DWHM 1I2QA 2E5CA 3A6OA 3TH6A 5I06A 2SFPA 1MW2A 4AZCA 2AAMA 2O9RA 5M1TA 6CGTA 1YDYA 4J3SA 3W3OA 5CBJA 4B90A 1YNYA 3TUUA 3OZMA 2QULA 2H90A 4CEUC 4P61A 3LCFA 3BLLA 3PPCA 3M64A 4Z2GA 1VEOA 5LGZA 3FYOA 1QI4A 5FF0A 1F61A 5EMMA 3E38A 4JZ5A 1H0GA 2WC4A 1UP3A 4FX8A 4YTTA 1M3UA 5HNRA 4GZIA 4E3TA 5JIWA 4BFAA 3N25A 2IQDA 3PULA 3QXBA 4CD5A 1WQ5A 3A21A 4MJ4A 3STCA 3S3GA 2VCCA 2WJDA 1EIXA 2QS8A 3ONCA 4MPQA 3XISA 1GOWA 4XSMA 1PZ1A 2ZX8A 3E02A 1A3HA 1CYGA 5CG0A 1B30A 1HJUA 1EJUC 1E4IA 1TR9A 3CO8A 4UNIA 3BSGA 2WOQA 3G0XA 1UJPA 5CSSA 4MHBA 2LLEA 3DBPA 5U4NA 4JFVA 4RDVA 4WIWA 3DHUA 2V63A 3HFTA 4GI9A 4WEVX 1XIIA 2ABBA 2EKCA 1LTDA 3FW6A 4KCWA 4F0LA 4MM1A 1GKRA 2EG6A 3RR1A 2E7FA 2WPBA 2AMGA 4RR4A 4UR7A 1R9ZA 2PAJA 2Z1XA 3THAA 2O9OA 2QF8A 3QKZA 2WHLA 1TSIA 2TYSA 1I0BA 2PTXA 2ZZ4A 2YL8A 1P6CA 1SYTA 1A5NC 4E2OA 1S3HA 1OY0A 4Q8MA 1UW9A 4ATDA 3OZOA 1ONWA 5BXSA 2PZNA 3VKAA 1BKSA 3O8AA 1SVDA 1R3WA 4MWAE 3GSMA 2YFOA 5BMWA 1SO4A 1YHTA 3W23A 3WLSA 1RD5A 2NT0A 5LKYA 4S3DA 1X96A 3NL2A 3CLWA 4C6LA 1XUUA 4BK9A 4QX4A 4L4LA 5I02A 1PIFA 1WZKA 3Q58A 2WQPA 2Y85A 5LNRA 1XSKA 2DFAA 3F5LA 4B4FA 4W9TA 3HA1A 3WBEA 1EHAA 1SSGA 5AYBA 5BRPA 5F7UA 1DIOA 3EXTA 3S6OA 2ZVIA 4O10A 4AF0A 2UY3A 5I3JA 1XPYA 2V3GA 4Y2WA 4RDWA 4PSPA 5I3IA 3I4EA 3A4AA 3WNPA 4A8IA 2V5JA 1XH0A 3LS9A 4TO8A 3GW3A 3T78A 1THFD 3NQ2A 3N4AA 2E77A 4NYUA 3BJFA 1SZRA 3BGGA 3NWRA 1UR1A 3ALGA 2PGWA 3WF1A 3OW1A 2OZ0A 3OEXA 3RX3A 1WX0A 5L6UA 1E73M 3MBDA 4WHBA 5G4EA 4F66A 3EMZA 2IXVA 4TVCA 3T2OA 3THQA 3A4XA 4DM1A 1AQMA 3AJXA 4TTGA 1H5YA 3MT1A 4H6EA 2BSLA 2E67A 3WDJA 3F4WA 4AVOA 1XRFA 3AIVA 1H0IA 3B8VA 3RITA 3TC6A 2DZXA 4M0XA 1PTGA 1Q6GA 1X1NA 2RUSA 3F4VA 4C6MA 2CLKA 3I6EA 1A0CA 4LUSB 4AXNA 4XX6A 4M6PA 5CSUA 1KR1A 3SCSA 3UVAA 1WDRA 3WJWA 1R46A 4GBDA 4F8XA 1E6ZA 4FS9A 1FXPA 4GLEA 4IP5A 4XG1A 4C6PA 3TEVA 3AFBA 1J10A 3TAOA 3LCHA 4NG3A 3U0HA 3GDLA 4IQDA 4YPJA 1KM0A 3A47A 2V2DA 1W1IE 2BXYA 4US5D 1ZBKA 1X7IA 3KBNA 3VOCA 3ZQ9A 5H2ZA 4AY1A 1QVBA 3BO9A 1JCLA 3QKEA 1GW1A 1GQIA 1R3VA 2QNEA 1OGGA 2BHUA 3W7JA 3OZPA 4BWLC 4M7SA 3S9YA 1A80A 5FF2A 4I8YA 1E72M 1E3ZA 5F2LA 2R24A 3HU7A 1QHOA 4GNKB 4LVAA 4MTVA 1ZAHA 1ME7A 3NVTA 1PDYA 5EMYA 1TPVA 3B9NA 3L12A 1W32A 2D3NA 2IMRA 1XLBA 3CU2A 4JQ2A 4ZCWA 1H7XA 2X0SA 3PZVA 4RZ6A 3T08A 2FJKA 3VNLA 1TREA 1V6XA 2J7HA 2Z29A 2HV5A 2IKJA 1VJSA 3KOZA 1WUEA 1UASA 3DKJA 4ZQPA 1TX0A 1OFOA 5C9UA 4NX0A 3R8GA 1V3HA 1K1DA 1OD8A 3IJ6A 4R53A 4ORMA 5IBXA 4Y9NA 1R7AA 4PL2A 2PF8A 1N8FA 2Y61A 2NXIA 2GDUA 2J9XA 4K7YA 4ZE4A 1KCLA 3ITLA 2VI0A 3PN8A 1GW9A 5XIMA 1VFLA 5AECA 3G2GA 5D8WA 3CUZA 1EPVA 4LS1A 1JJKA 4PUKA 5AVHA 1DKWA 3MUZ1 2D23A 5HMFA 5FAJA 1MFUA 3GK0A 4PH6A 2VT0A 3WL1A 5I00A 2PURA 1XD0A 4RPPA 1H62A 3WJZA 1V3LA 3MUIA 3EDFA 1HP5A 4ADSA 4NU7A 4R88A 1VLWA 1UC4A 1VIWA 2AQWA 3E5PA 1E9IA 3QTGA 3T0TA 2FB3A 1WNOA 1WYIA 4ZSTA 3P80A 3FN9A 5JBFA 3SBFA 4NT0A 4QP0A 4KESA 4AU0A 1H09A 3H2MA 3MZNA 4ZBCA 1FKXA 5A3HA 3BW4A 4RZ5A 4GO8A 1HO1A 1HN1A 4LSBA 2VCAA 3BAWA 3CHVA 1REQB 4J3VA 1RLCL 2WMJA 3B0XA 1AMKA 4WGXA 4J1OA 3TYCA 3NQ6A 2GLKA 1JVNA 3G1RA 3NVDA 5EB8A 1AODA 2VQUA 1M1BA 4D6EA 4G7EB 4IQLA 4QFUA 3WLJA 2WSKA 1DIEA 4CGTA 1H61A 1E1EA 5AZ0A 3VNDA 4G7EA 2QCFA 2VGIA 2PDQA 2XSXA 3UNTA 4AWUA 2TMDA 3MB9A 1W3IA 1A5UA 4HSHA 4X9YA 5LIYX 3OG2A 1JZ7A 2AAAA 5D32A 4ENLA 3FHAA 1PB0A 3BXWA 4Z2HA 1OABA 5E0CA 4NI3A 3R0KA 3N14A 4MLJA 3L23A 1EP3A 1Y5XA 4G5DA 5BNKA 5HJXA 3WMBA 3NQ7A 3LU2A 1U30A 2ICSA 5JMUA 1BTCA 5EY5A 3VIHA 2P3ZA 5CH9A 3PSVA 3LNMA 3CC1A 2GOKA 2CW6A 1ZB5A 1FWFC 3GTXA 3T1GA 2E68A 4NJIA 1U83A 1OEPA 2X41A 4IIEA 4CCDA 1KGUA 3P0WA 1W1PA 4H6RA 3FX4A 3EB2A 3PAJA 3IJQA 5A6LA 1GTEA 1GKPA 1V02A 4HSOA 3N17A 4UTWC 3LHUA 2HVOA 3H8AA 4LCQA 1BD0A 2AL2B 1NWTA 4PFMA 5AVNA 1TA3B 5AB3A 1ZJAA 2ATSA 3GHSA 2GVLA 4AISA 3GO2A 2W66A 2AGKA 4MF4A 1LCOA 7TAAA 4JTSA 3QMRA 3UYCA 2XGBA 3WO8A 3R25A 1N55A 5AN7A 3RFAA 4GZEA 4OT7A 4QQUA 1Q6EA 3CZLA 1OM0A 3FLUA 2UY2A 2ZX7A 5KETA 4GFIA 1LBFA 4PMRA 4X61A 3W29A 4L6HA 3G1YA 1UKSA 1OFAA 1DV7A 1LOSA 2P88A 3PZMA 1UH2A 3HB9A 3GDKA 4IIDA 3S1UA 3G8EA 3CYJA 4EWND 3THDA 3PG8A 2BGNE 3ABQA 3BCFA 3P7YA 5REQA 1I1WA 2PWGA 1IT0A 4P8UA 1JZ3A 2YCKX 1HUVA 3TN4A 3KOFA 4GH1A 2ZVRA 1SZFA 3W1PA 3OA5A 1L6SA 2E6AA 3QH2A 4MWAB 1P43A 1SO5A 2G37A 3W1LA 1PKYA 4MB3A 3AIQA 7REQB 3LPPA 4IQJA 1L9WA 2Z2AA 5EBUA 4Y90A 4QTGA 1H49A 4MWAA 3SCRA 3UWQA 4JIEA 4PTXA 1JZ2A 4LB3A 7REQA 1QI3A 3PTMA 4LPCA 2YBVA 4DI8A 2Q3OA 2Z27A 1FH7A 4UTTA 1M7PA 5D9MA 4HPJA 1FP9A 3CIWA 4DBUA 1AD4A 4MPKA 3LHTA 4XAYA 1L2UA 1TE6A 2C0HA 5BOOA 2J9YA 1LT8A 1R9XA 1UOZA 3R8RA 1QW9A 1P6BA 2ZTJA 1JIBA 2DZPA 4OV9A 3B4UA 1E4LA 5GNZA 5HPOA 4U3CA 1ICPA 3UPWA 2Y8VA 2C18A 1ADOA 2Y7EA 1IZJA 1KRCC 2IQ0A 1MW3A 2OPJA 4ICMA 3BGJA 2C1GA 2YZRA 3AUOA 1S1PA 2R1KA 4NZCA 4P5UA 4L6DA 3A9IA 3MHUA 5FF3A 2ZRWA 1N82A 1ZL1A 1V0LA 1HNYA 2RDTA 4K8EA 4DB7A 3S47A 1KBJA 2FTYA 4O8RA 4DF2A 3S2JA 2PWUA 1QWGA 3C86A 4J3UA 1BLIA 1CECA 4ATWA 4E4UA 3GXMA 1A5AA 1R0MA 5KTLA 4QDPA 1KRAC 5PTDA 2NSXA 4A05A 1VBJA 4EANA 3L7RA 3IGHX 1QI2A 2HVMA 2WXDM 4DY1A 1OX5A 1S5WA 4R33A 1EGMA 5CXPA 2CBJA 1LOLA 3RHGA 4PODA 4AW7A 4BWLA 4NAEA 4U31A 5AFDA 5E1QA 4YVXA 1CGYA 3ANVA 4X60A 4UQBA 5K4XA 4KCTA 2YBUA 2VDGA 2OLHA 2HMCA 4ROPA 2OYMA 4DF0A 1PZ2A 3O6CA 1L8PA 3RGTA 3H2OA 4PUDA 4QQ3A 1Y65A 4HVXA 4H1ZA 5E6YA 3OYZA 5U7SA 4O13A 4CQCA 3ZR4A 1LQ2A 1XC6A 5LHEA 4GVHA 5D4YA 1ZPTA 2XIJA 4NRRA 1TB3A 2I5GA 3I4KA 2XIQA 1DXEA 4UMBA 2UY4A 1TPFA 4GUGA 3N9RA 3D3AA 5C54A 4GJ1A 4F0MA 2NQZA 3W27A 3CPGA 3T7VA 4GKTA 3PBWA 3ITTA 2Q8LA 2CC0A 1XXXA 1M6JA 4U5IA 5LIKX 1HKIA 2YCIX 2ZUVA 4KEUA 4OU1A 1RAKA 4M19A 1DJXA 3AROA 2OT1A 1ICQA 2VX7A 1VFSA 3HPZA 2PDBA 3LLFA 3G22A 1Q8AA 3QPEA 2INFA 1I2PA 1VKFA 1X98A 1W3TA 3V5FA 1HQTA 2FPYA 1NP2A 1JPDX 3LSBA 4OECA 3VO0A 4XTDA 3SCUA 3FYPA 3PS7A 3QV8A 4NASA 2G95A 3TIMA 4DO7A 4EPEC 1K9FA 1FWSA 4EPKA 3PTDA 1UZHA 3UYIA 1J12A 4ZO9A 1XYLA 4UMCA 1OD0A 1OJXA 4O1DA 4N6FA 3CUIA 1GZGA 4LT9A 1UP0A 3KP0A 3NZ1A 4PR4A 4AG0A 5AC4A 8XIMA 1FQ0A 3MU7A 4YU1A 1B9BA 2R6OA 4V27A 2JALA 3DAQA 4Y96A 3AHXA 4GIEA 5EFDA 4Z0SA 4LH8A 3QFWA 3TOPA 5HJLA 4JTCA 4PEKA 4HTYA 2ZZ6A 2X0YA 4JX5A 5KEZA 3WNLA 1QHPA 4HIBA 4S2CA 2A6NA 4HPGA 3VCNA 1G0CA 3NAVA 2IKGA 1B3VA 1CIUA 3RRXA 2CEQA 3KHDA 3R8HA 1UIPA 3E96A 4KWSA 1YMYA 4S38A 2DJXA 2RAGA 5FEXA 3GAYA 1GQNA 1KTBA 3ARPA 3PTKA 1ADDA 2ZUWA 2J88A 1K70A 3NOEA 1HJSA 4HYWA 3RLVA 5JH1A 3MI3A 3UJFA 1QPOA 2OZ3A 4HNTA 3F2BA 2BXZA 2EAWA 4J7RA 3W1XA 4FMVA 4QAIA 1NWSA 2EGZA 3S2MA 2VFGA 1ZNNA 5IDIA 5DQPA 4OBRA 2NV9A 1IWBA 4W7VA 1XIJA 2AKZA 2JQXA 3GXTA 5FF4A 1D9EA 1MUWA 4AD5A 1Q7MA 3AHZA 3IV8A 3MSRA 1EJXC 3NSMA 1PKMA 3E0VA 2RDXA 1Z42A 3CV7A 5KZDA 3CO4A 1GVFA 2NXHA 3T0CA 4F9DA 1W9XA 1V3MA 4JIPA 1L6GA 2EHHA 2DORA 2XH2A 2WSPA 2I16A 4JFTA 2J8GA 3QY6A 2HTMA 5HR7A 1LBMA 3VCCA 3S5NA 2J8FA 1AJZA 5K7JA 3T07A 4UTWA 5I09A 1EWEA 2VKZG 3WDPP 5C9RA 2IXUA 2NVCA 3URAA 5A1AA 1CGWA 3WQFA 4AEFA 2J79A 1YNQA 1TG7A 1KM1A 4DJFD 1DQWA 3EEGA 3KBVA 4OBSA 2A7NA 3PB2A 4CUCA 1V3JA 1EO7A 1FHVA 4FXFA 3R89A 1KRBC 3KZSA 3RN6A 1A5LC 3D5HA 3NSNA 2X09A 4JFWA 4OKDA 1NSJA 2Z7KA 2GJXA 1OF8A 2CWXA 1VFMA 3P14A 3E12A 1V77A 2NX1A 4OOUA 3S1XA 1HT6A 3EOLA 4LUTA 4E4PA 4F0SA 4P2VA 2JF7A 4Q8VA 4KW2A 4HZ7A 3R7MA 1O5RA 1QOQA 4NI8A 3H2CA 1G5AA 4CCZA 3AXIA 1EF2A 2TRSA 5CZJA 4PMVA 3W1NA 1LQ0A 3WD1A 1DWGM 3LBMA 3FYYA 2F9RA 2EPHA 1WKFA 4KRZA 4DUXA 1P0NA 1JYWA 2O7SA 2P1FA 2GJNA 3M0KA 2HNHA 2Y70A 3EOEA 1TWZA 1ZHAA 2WBGA 2BWGA 2ZZ3A 2DT2A 3ICJA 1GOXA 3BUVA 3I7RA 4OZOA 5KMYA 4GWEA 4S3AA 5BRBA 1FUYA 4KBXA 1V0KA 1Q13A 2VEMA 3WF0A 3RF9A 1FFQA 5AKQA 3PNZA 1KTCA 4PMUA 2XWEA 1TFVA 1GOQA 2J13A 3EX6A 4Q33A 5AC5A 4LAMA 5IFPA 4DXVA 1RR2A 2EJAA 3DIPA 3RLUA 2ZIDA 4C6JA 4PCTA 2YA0A 1O1ZA 1NH6A 3KW3A 2Q71A 5T26A 2DU2A 3KM8A 4LUYA 2ZZ2A 3ME3A 3R1ZA 1CENA 3WNOA 3ZO9A 4D6IA 5KZMA 3NEVA 3QC0A 4URIA 2DZWA 4XZIA 4R85A 4A21A 4P8WA 4M7TA 3UCDA 4GYKA 1HKJA 1MDLA 4HK6A 1K6AA 1DJNA 2V67A 2FVMA 1R30A 2D22A 1FHUA 5I24A 2JGQA 2Y7FA 3TFCA 5AY7A 4NKCA 1A3WA 4LQ1A 2Y88A 4ES4A 3NQAA 1TJRA 1MO0A 5HANA 4PCNA 3RCYA 3LRKA 4ORIA 2CITA 2VNCA 1WA3A 2HXUA 2POZA 1OYCA 1EP2A 2Q8ZA 4IICA 8TIMA 3W88A 1NFPA 1V6YA 5I07A 2ISSA 3KLKA 2CXEA 4X63A 3UETA 1MZHA 4PRWA 1BSIA 1I45A 3OJGA 2YBTA 2C1HA 2QZRA 2Z1VA 3QGKC 4IFKA 1RCQA 4UTUA 2YX0A 2QDGA 2GJPA 1MEIA 1OG0A 1XH1A 1CXLA 1ISWA 3D6NA 1IGWA 1JGMA 2ZCGA 3QJAA 4L4PA 4XB3A 4GC4A 3TLQA 1AZ1A 5K9XA 1NIUA 3BZGA 2BLEA 3WN6A 3NDOA 3M0VA 2J66A 4BF5A 1BWVA 3B9AA 3RO6A 1MZRA 3WF3A 2BP1A 4V28A 5D8ZA 4HOZA 4S3GA 2WMIB 2WBKA 1EWDA 4HA1A 4NNAA 1O66A 4O0KA 2BASA 2FMNA 1M41A 2NW0A 2NWRA 3V0UA 3IJ8A 3VUSA 1PL9A 2ZRVA 3NDZA 1ZU8A 5E93A 3T0DA 4C5YA 4B3KA 4H9XA 3OG3A 3PJXA 4ZL1A 3U5UA 3NPVA 2GQ9A 4ZGYA 3SCNA 4P8VA 1U5VA 1GUVA 3BCDA 2V5LA 2VGGA 2DZBA 2GZXA 3M0HA 3U2EA 2OCZA 2XU2A 2FMOA 2Y8UA 1W56A 1R2RA 2XVPA 3N1AA 4US5A 3FGCA 1K7FA 4FZIA 3W7QA 3VD3A 2Y1HA 2OXNA 4WR3A 1FXQA 2PGRA 4C1NB 3LCXA 2GUYA 2A5HA 3MP5A 2PU1A 1XF0A 1ZFJA 3QW4B 4NL1A 4KWUA 2ZUNA 1A5MC 2QMJA 3VIPA 5CGMA 3M07A 2CLOA 3OIHA 1R3TA 3A4WA 1RVKA 1UWRA 3PZNA 4F9JA 4YVVA 1XDJA 1D3GA 4GUHA 1GZ1A 3RPTA 4BHYA 1VPYA 4QITA 4DO4A 1V4YA 1FX6A 5A6BD 1R85A 1WBHA 3TXZA 4HMDA 3I10A 4NJHA 4JNZA 3NO3A 1OHLA 1J0YA 1HF6A 2ZA3A 1M68A 3WBWA 2PRHA 1AUSL 2G96A 1RPKA 4XWUA 5DMNA 1S46A 3JVAA 2R14A 1JDAA 4JKKA 1OZMA 4NJKA 3GR8A 3G6LA 1WZAA 4FNPA 5E6ZA 4DHGA 1XICA 2R1PA 2CU0A 3UEQA 5FJPA 3VMPA 2GDVA 1HFBA 1RQBA 4B9YA 5K9DA 1TWIA 2XINA 2WNZA 5SWUA 2YB4A 4GA8A 3SCPA 2VRKA 3R11A 1QR7A 4HU0A 2PP3A 3H7RA 1MRAA 4C6QA 3E0FA 5HK4A 1WKEA 4DBWA 3UWEA 3EKZA 3BJTA 2GSHA 2OMAA 1E6QM 4QLLA 3WELA 1WAWA 3VC5A 5K2ZA 3OGRA 3XINA 5FJOA 5FF7A 1LOQA 2BOGX 2J7DA 5I0DA 4JYFA 4G56A 1V6VA 1QNPA 3EDDA 1JI2A 4M6QA 1PX4A 3W28A 3K1GA 3VGGA 1EJWC 2HS8A 5HQLA 4MY8A 3F03K 2DP3A 3IIZA 3THUA 4JQAA 2D1ZA 1A5KC 2C71A 3CV6A 4AY7A 2V2HA 4YTQA 4FIRA 3VC6A 4N02A 1S5MA 5BOEA 4XTIA 1E3XA 3D46A 2Y6ZA 1DOSA 2QDDA 3GNOA 4C6KA 3DU0A 1OCJA 3EOSA 3FJLA 1J11A 4JKMA 4MY9A 4Z2KA 4CNTA 3EX1A 1B3OA 3APYA 3OQ8A 5CPTA 3W2KA 1K7EA 2VO5A 3B06A 3UWZA 3K4AA 1Z48A 3CB8A 4E8GA 1LQAA 3BOFA 1OG6A 2X40A 1AL7A 1GHSA 3WLQA 3KRZA 2FZ8A 3RX2A 2OWWA 4GUIA 4BQ5A 1ZLPA 3GH7A 1BF6A 4ZZ9A 1SJDA 1WO2A 3USZA 4FA3A 4OIFA 4PGLA 2VC9A 2OWCA 3PUEA 1ODZA 3JS3A 2PP1A 4ML4A 3TTYA 1KFCA 2OG9A 2ZZ1A 2X05A 4M8UA 4C60A 5CG7A 1EA9C 5CBBA 1UBPC 1UR0A 6A3HA 3TONA 3AIBA 4QJ4B 4ZXLA 4BCEA 1DJIA 1LORA 1D8WA 4KWOA 4YJ5A 4RNJA 2ZC8A 2PU0A 1ITCA 5TQLA 3CB3A 4Y9OA 3GTHA 6ALDA 1LWIA 4NHVA 4NZ5A 4RW3A 3LOTA 2PMQA 3HIJA 3U5YA 4MNKA 1MQPA 2I7GA 4MKSA 5D37A 1QOXA 3W9ZA 4GPNA 5E70A 3B0PA 1Q6OA 2WHKA 1XUZA 4Q8PA 1RY8A 4OGZA 5DCBA 3ZT7A 3W0KA 4DRSA 3T40A 4S3KA 4C7GA 3TNBA 3ITOA 4YMZA 3W7IA 4FP1A 2CCRA 4XBSA 1E6SM 1OCNA 3TWAA 4LCRA 3GB6A 3MKVA 4H7ZA 5EMUA 2CLPA 2QVHA 3G5EA 4UIOA 5ABFA 3M5XA 2HPIA 3L4TA 3P93A 1B57A 2YJQA 2ZXDA 1V3IA 4W88A 3BC9A 3GC5A 3GNNA 4HP5A 8XIAA 2UY5A 3N2BA 1XYFA 3WBAA 1UPPA 1QNVA 2EF9A 3AMKA 4GG9A 1KKOA 4P7LA 3LDVA 3BOXA 4JTJA 3N13A 3PWGA 4ERAA 1TX2A 4WX2A 1BVZA 4O0QA 4DWDA 3ERPA 4PN2A 1IXPA 1CGXA 2PGEA 5C8BB 3LGGA 1RBLA 3DC8A 4R5EA 4PCFA 4M51A 1J2WA 4AZ6A 4GNVA 3PAOA 1K9DA 2VVSA 4DAFA 2D2JA 3JZEA 2PDLA 5DBTA 3R5EA 4L65A 1AH3A 4UMAA 1RK6A 1WB0A 2INZA 3R4IA 1B54A 3WD2A 3FCPA 3QZAA 1OVDA 1NP0A 3G0SA 3KE0A 1QK0A 3J7HA 2X1TA 3RJYA 2PTWA 1AG1O 3VIFA 3CL6A 1XGEA 2FH6A 4ZB5A 2WZHA 2RKXA 1Z8AA 3DHPA 3SCWA 3URBA 4YYFA 5HNUA 3OVRA 5JBEA 3E2QA 2NVDA 3VIJA 3TTQA 1H7NA 3AZSA 4AYSA 1M65A 2DUZA 3THCA 1XGDA 5LNVA 3BSHA 1KXVA 3T2QA 4G6CA 2WLZA 4A4AA 3NNTA 4QE4A 3KVJA 4ZO7A 4LVBA 1HP4A 2X7VA 3N18A 3LBOA 3BJSA 1OBAA 4MSSA 3BCJA 4UQ9A 3HGOA 2QUUA 1TQJA 1EZWA 4MMWA 3MV01 4U33A 1FWGC 5H8PA 1WDQA 1TWSA 4FIQA 5BXRA 2J7BA 1RA5A 3O0FA 5GJMA 3HTWA 3AUJA 3IANA 3OB8A 1QNSA 5CC6A 2WKJA 3K8KA 1BQGA 1FWBC 4UOQA 3NURA 3D0CA 5M5DA 3O6AA 5C6MA 4PMOA 5KSWA 1W5MA 2PDWA 1M7XA 1LUCA 1B31A 1PTAA 1LRQA 1XBVA 1XIHA 1UD4A 1KBIA 1LLZA 1RD6A 3TYZA 4BS0A 2DH2A 1XLGA 1WV2A 1EOMA 3G3MA 4J3XA 3E9AA 3KS6A 1VFUA 1UR8A 4FK9A 5I7GA 1DIDA 3UXKA 1ICSA 2GQAA 3CT7A 3CLMA 3AYRA 1DQUA 4UFMA 2YW3A 3DG6A 3RLGA 2YXOA 4FNRA 2XZ9A 3VI2A 4UFLA 4LAKA 4DZHA 3GXIA 2YGYA 5CBIA 1UZ1A 2VRQA 2D0FA 5CAHA 3WQ4A 3QMTA 3L21A 3O07A 2QEZA 4GGBA 4EPBC 2PDFA 2PDUA 3N2OA 1DWAM 4CNUA 2EBNA 1OFDA 1FWDC 4I9JA 3UR5A 3DDMA 3TSBA 3S83A 1AD1A 1MI3A 3DYMA 1UR2A 1V0NA 1KXHA 4NF7A 1BEUA 1E1CB 2F8QA 3NQVA 1Y8BA 1M9HA 1JZ5A 1W3HA 2BGSA 3BLFA 1E1CA 1ML1A 4Q4KA 1OCQA 4UQDA 4AD3A 4A29A 2UV8G 1EX1A 3DEQA 3MSYA 4YTUA 4PUWA 4FNQA 3LZ3A 1ZAIA 1LYXA 3R2GA 3VUPA 1TV5A 5A2CA 4KCUA 3EPMA 1M04A 3S2NA 5F1UA 3KDOA 3W72A 3EAUA 2ASHA 1PKLA 1EQPA 1ZBCA 3UP8A 4KIEA 1A49A 1VLIA 4KGLA 4S3BA 2PA6A 4QSHA 3SGUA 2QCEA 4JCMA 4TU1A 3NA8A 3CZJA 3UXDA 2OELA 3LHZA 4J3WA 4DQWA 4OOZA 1W1ZA 4TV6A 4XKYB 4A3HA 2AQVA 1OT2A 3TTOA 2WCSA 2PWEA 2VZSA 1GGOA 1ZCOA 2X16A 3BLIA 1J0HA 2A3HA 3W1AA 2J24A 1J01A 3A13A 3VKBA 1D7FA 4J4KA 3VOFA 1WUFA 2OKOA 4N4QA 3UZJA 2A2IA 3GTFA 1IXNA 1C92A 4Q8UA 3EWWA 1TO3A 3VGBA 4CU6A 3QV6A 5CC3A 1IT8A 1T5AA 1W9DM 1Q4WA 1FWIC 1JQXA 1H3GA 4W7WA 2YCLA 3Q67A 4R27A 4JYDA 1XJBA 8RUCA 3CS2A 2GGGA 1YBQB 3AAMA 5AHEA 2E4TA 4OTKA 1ZQ5A 3W7RA 2PWDA 4HZ8A 4O1CA 3EDJA 3SEPA 4IOTA 2XIIA 3SJ3A 3LV6A 4KS0A 1XLIA 1ODUA 4ZXOA 2HPMA 1KFJA 3SN1A 4DWSB 2EXOA 1E6RA 4N2YA 4JIIX 1EC9A 4QG9A 5DT7A 1K9EA 3LXCA 4U5KA 2HBXA 1TV7A 1E55A 3BG9A 4OUIA 4E2DA 5DMMA 1YKWA 3TV8A 1D8CA 2XSAA 3MUY1 2NSOA 4M5PA 3CT2A 3ATZA 4O1FA 1V79A 3PBYA 4IXXA 4QJ5B 2WHJA 3W76A 1X1ZA 4IMDA 4C7FA 3IVTA 3L4UA 3FAXA 3BV4A 1F5ZA 3G1DA 3UJEA 3RUBL 4H41A 2ZUUA 3P5ZA 3TROA 2POTA 4CVUA 3SW6A 3AXKA 1SPQA 4V33A 3CK5A 1K6WA 3B04A 3PY2A 3TC3A 2NVAA 4XD6A 4GH3A 2G3JA 4KPLA 4LGXA 4V1YA 5AC7A 3ANYA 1VQTA 4O18A 3KRBA 2A4AA 4ZOBA 4ALDA 3H70A 3KVMA 4HZMA 2OR2A 4UCGA 1DWFM 2DZAA 3SB0A 5I3FA 3TCSA 2PDKA 5C9WA 2VUNA 1FCVA 4IQEA 1ONXA 2OTDA 1E71M 1UD3A 2QPXA 3DGRA 7ODCA 3POHA 4LUIA 1FWAC 1SJBA 1VPXA 4L64A 3WD4A 1HVXA 3S1WA 3WLOA 3LM7A 4HMNA 4DJFA 3W1UA 4PUJA 2VOMA 1ECQA 2RJHA 3L4ZA 3IRDA 4KGJA 4IMEA 1XLFA 4RE2A 3WQPA 1CCWB 2Z0IA 5G1TA 5H6HA 3SR7A 4W7UA 4PZVA 3M5ZA 4FX7A 2PE4A 4HNUA 2VM8A 2QDEA 4XUGA 4Y6GA 3EMCA 1LWJA 1S5NA 2JEQA 1IZKA 2ZX5A 4TR9A 3N34A 4GIYA 2BB0A 1NFBA 3TSMA 2VR5A 1IGSA 1DXIA 4Y9MA 3SFWA 1IEXA 4ZOCA 2YLAA 1HW6A 4DIAA 3ZS4A 2QAPA 5TD4A 3UCCA 3IJ9A 9XIAA 1PHQA 4CN1A 2Z4GA 4HZ6A 1UB3A 2ZA1A 1XIEA 1KCZA 4HU8A 4NNCA 3STEA 2C91A 4G8TA 4JEQA 4MJMA 1NVMA 2XGZA 3PANA 1GOKA 5H8UA 3LRMA 1YTKA 4H9TA 4CN6A 1RQEA 3MS8A 1JD9A 3MQTA 3NO5A 3QFEA 4LCSA 4I9AA 3OPSA 1PIGA 4J40A 4JKLA 4PMJA 3EB4A 1VGAA 2RJGA 4IX0A 2C6QA 2XFRA 3N2CA 2QJHA 4QLJA 2W62A 3N4FA 2XG9A 2QF7A 3IVUA 2GWNA 3RU8X 3SRHA 3CZ8A 2VENA 1PSCA 3PPHA 3P61A 1TVNA 1TUFA 1A5BA 1F4AA 3AZTA 2NQJA 4MIMA 3TJLA 2BGQA 3WQ8A 5FEPA 1KLZA 1HGWA 3IS4A 1JUBA 3MV11 4S3JA 3ISIX 1MNSA 1GG1A 2QAFA 1UKPA 4HMCA 4QNEA 3I65A 3EDKA 1HKKA 3S5SA 4A3UA 1VFFA 4LS0A 4U2YA 3LRLA 4DEFA 2E0PA 5I77A 4GZJA 3WQ6A 4L56A 3H2NA 5CJMA 3E2RA 3CASA 1MXGA 4AZGA 3NDYA 2J7GA 3FJ6A 1O5XA 2JGYA 3VCRA 5GJPA 3SRKA 1HZYA 3GC2A 2WM0A 5HMSA 1YW1A 3UWWA 2KX9A 4NAFB 3PTQA 3WQGA 1Q6CA 4ZFCA 1VD6A 1OFEA 3AISA 4GYPC 2NXGA 1XV8A 5MKGA 3V0TA 2GK1B 1AQFA 1GZJA 4PTNA 3WMLA 2BOEX 2Q09A 1FBAA 3A23A 4RJEA 1UMYA 2GK1A 4GQ0A 4A2SA 4Z0JA 3V4BA 3SFKA 1QT1A 2EO7A 2C79A 5CLTA 2D0GA 1EBHA 5DEZA 3QPYA 3BAXA 3WENA 4B2DD 1WDSA 3P67A 4OVXA 1ISYA 3LXBA 1TPDA 3WLMA 3HOJA 2G5WA 1VJZA 1JD7A 1XI3A 1E43A 4B15A 3H53A 3UNDA 2D73A 2OEJA 2VJXA 4NVTA 1S2VA 4FOJA 5GJNA 3VKJA 3VDHA 4W8AA 1X38A 4XAZA 4TTUA 1XD1A 2Q01A 1NY1A 3H6OA 6REQB 2WAGA 1XQLA 1WCGA 3W7DA 3Q37A 3RO8A 1CLKA 2ZX6A 3SSJA 4N42A 1I8JA 1IT7A 3M0XA 1X8CA 4UR9A 1H5VA 3PFMA 5T9CE 2XN2A 4ACZA 2CLIA 4D8AA 2WMFA 3C4UA 3DH7A 2BV9A 4W8LA 4MWAD 3LUTA 4GQQA 4WY0A 4LAZA 3P74A 4X0NA 1H60A 2KAUC 5LYRA 4YS1A 5ABGA 1FCUA 3OBAA 1QBAA 3PJWA 3LTSA 2VURA 2H9AB 4HBKA 3PK7A 3EPOA 3IUDA 3R79A 4GZ7A 3FOKA 2OOGA 4K8HA 4EWJA 1GVRA 1JUEA 2VWSA 3ZYZA 4C6OA 2V3DA 4I6KA 2HXTA 4M6VA 1XLMA 4LB4A 2OEKA 3AMDA 4PUNA 3SGZA 2PFHA 2V5CA 3BAIA 1W54A 3G77A 5A6BA 5AYZA 3WF2A 4H7VA 1XLAA 1V6WA 4XSLA 3ENLA 4N9BA 3OVQA 4NZ1A 1FWJC 3GW0A 3G1VA 6TAAA 1H7WA 2OQLA 3GDBA 1S2TA 3OBKA 1XDLA 4PB4A 1XIFA 4IUGA 3LZ5A 2CETA 3QPZA 1XLEA 4LW7A 3GZAA 5DBUA 4FOUA 4AY8A 3LB0A 1J5TA 2GUBA 4HHMA 1I0DA 4JIQA 4E38A 3BSMA 4EX4A 1TYGA 1J96A 3BLDA 1RPXA 2Z2BA 3ZFHA 4D8ZA 3UR2A 5F4XA 1B3WA 4HNVA 3G1XA 4Q7BA 4UTMA 2GGIA 2ZZ5A 1W31A 4H01A 3GBDA 3CUGA 2NQHA 3UWYA 1JCJA 4LY8A 3U6WA 1DL3A 2DV0A 1CX9A 3LY0A 1KCKA 4AZBA 3C0JA 3T0AA 4IM4A 5B7ZA 1PYMA 2FTWA 4RPQA 1PYFA 4GQRA 3C2VA 5CZTA 4DNMA 1JL8A 2G3IA 4BY3A 3B0VC 1V7AA 4UFJA 4PMYA 1BTMA 1Q5MA 2Y0FA 3QLLA 1JULA 3W75A 2MNRA 1HX0A 1LDCA 2ZRZA 1XFBA 3WUEA 3N11A 4LY4A 2WZEA 1OX4B 2PDHA 4WOZA 4KERA 3PUGA 3CMFA 1YE4A 4ZMGA 5AYYA 2WK2A 2W4XA 1OIMA 4RE4A 3UG8A 4UTIA 1EYWA 4ROQA 5CSYA 4JGDA 1EC7A 4O14A 1DJHA 1P1XA 4Q4OA 3CV2A 1BGGA 2W9MA 1FHDA 2HK1A 4GI6A 1C9WA 2BS9A 1ITUA 6XIAA 3GNRA 1EEPA 1QNOA 2VEFA 3CAWA 3E2SA 4NX5A 2CIPA 1TUXA 3IGSA 4R34A 2G4JA 4ERIA 2XTKA 4JX6A 5EMKA 3WH7A 3WLNA 5TF0A 4UFKA 5FJTA 4EVZA 3HQ1A 1J79A 5A6JA 2VDHA 1E6XM 1FWWA 3W7PA 3N29A 4AYGA 4K38A 4KCVA 4C6DA 1G4SA 3ZWTA 1X39A 4LJ3A 1SUXA 4RV8A 3B8UA 4BEUA 4UNKA 2BY0A 3OQEA 4P7NA 4G2DA 4M6UA 4TX6A 1JNEA 3C2RA 4Q4QA 1O95A 4XZHA 4LRTA 1NQKA 1YEYA 3T8QA 1N2VA 5AHFA 3ARRA 4MDPA 1V08A 4C6NA 3BK0A 5GQBA 3V1PA 3NQ8A 1UD8A 4AWTA 2JKPA 1U33A 4QJ3B 7CGTA 1J0IA 2V3FA 1FCQA 4C65A 1DJGA 3WSUA 2ZRXA 2CHOA 4MZYA 3WLTA 4W93A 1SFJA 3GG7A 2VR2A 3MCNA 1XLJA 3G3DA 3P60A 5T9BG 1NTHA 4I9MA 1C90A 1W8SA 5DT5A 4QE5A 5D9PA 1JZ8A 3BOLA 1QATA 4GY7A 2H3DA 1E0UA 3ECQA 3IJLA 4HKPA 1DORA 4O1AA 1U5JA 3RM8A 3H7UA 2JIEA 1XS2A 3AYVA 4D6FA 4GI8A 5TAOA 3ZXWA 3M0IA 4RZ4A 1OF6A 3WDQA 4AUBA 3PF3A 1SZEA 1FDYA 4IMGA 1KW1A 1QAPA 4MADA 1VFOA 4H8UA 4AZHA 1FWCC 4FAMA 1OB0A 4PTDA 4KMQA 6TIMA 3PHAA 1YQ2A 2QJNA 3KRUA 1ZJBA 3VKDA 1Q6RA 1ZS2A 3GU1A 3KBSA 3AU2A 1KV8A 2BODX 3MPGA 2X42A 5A2AA 1SFLA 1O4UA 1R2SA 1E51A 4B4HA 1MQRA 3WK3A 4E6MA 4Q4MA 3VMNA 4UTLA 3SUWA 1MUCA 3WDIA 1CGUA 1M53A 3CYVA 3M1ZA 2D20A 3LHVA 2G0WA 5EA9A 4FXRA 2DW7A 2Z1SA 3MMWA 4HT3A 2CLHA 3F2CA 5C0QA 4W8BA 4Q8OA 1SMDA 3G0UA 1XINA 4HNLA 2EKGA 1FA2A 1AVAA 4PB5A 1ZENA 1C3FA 2P0OA 5IOBA 1GVIA 4FR6A 1UD2A 3HG3A 5FACA 2ALRA 4HTBA 3MSDA 4GYPA 4H9ZA 1R3SA 2V3EA 4GQBA 2VC5A 1E9YB 4JL1A 2OSYA 1Y7VA 2QUMA 1PUDA 3O9NA 3AU6A 1F8IA 1A5OC 4IMAA 1JF5A 1YNPA 3N6JA 1G4PA 3SN0A 4IGSA 4PEEA 3VM7A 3TX9A 3UZXA 2ZWYA 3W22A 4D9PA 3FIGA 3NQDA 1LL6A 4ZA0A 3VIMA 4CQ9A 3DG7A 1IEQA 3M0MA 2WZIA 2B7PA 1UZ4A 5A8QA 2Z2UA 2IQTA 4FX6M 4Q32A 3CEUA 2ON3A 3S42A 7PTDA 4W5ZA 5A8GA 4NZ3A 1VPQA 3LYEA 4XAGA 4K1WA 2ZXQA 4O4WA 3UESA 3WNKA 1XP3A 3A64A 4KFNA 2PCEA 4FF5A 4AX6A 3DZ1A 2YFNA 3BAYA 1V93A 4PTWA 5L9FA 2PD9A 4IPIA 1J8VA 4LEQA 3OHIA 2WVTA 1HJVA 1SJCA 3MKCA 1XLHA 3CHEA 2Q8XA 3ANUA 5D30A 3EX2A 1HKWA 4GUJA 3SUUA 2HNEA 1IR2A 1V03A 5DF0A 1QU4A 3ZM8A 4JCLA 5C2XA 5EMLA 4K2SA 4N9DA 3AXMA 4GISA 2D3LA 2OODA 2VD9A 3G1HA 3UR7A 3Q2DA 4IXHA 5I2UA 2DSZA 3EEZA 3CNYA 3FA4A 3GU9A 3WQ5A 2H8ZA 1GVSA 4Z2LA 1M7OA 1CLVA 3C0SA 3GD6A 5I79A 2C19A 1GQLA 3E5BA 3K46A 1RP9A 1HJXA 2O4MA 3NO1A 3T6CA 3U9IA 2J78A 4FLSA 2G41A 2V69A 3UFYA 4F0RA 1ZBWA 4S3EA 3V7PA 2XDFA 3CZGA 1FY6A 4Y9PA 2PLCA 1JYNA 4GMEA 3PUOA 3EKGA 1XYAA 1EF3A 4A8NA 4YXGA 4H19A 4RV3A 1EGVA 5K4ZA 1FDZA 3CL7A 2IS7A 2F6KA 2B7NA 4K36A 4C1LA 3OU8A 3DBNA 1K9TA 1J2BA 2YYUA 2JK2A 2XUCA 3GY1A 3MDUA 1F9CA 1UCWA 4MWAC 1DJQA 4Y7EA 1U22A 4RCXA 2QUTA 4GNJA 2DUXA 1G7UA 1KB3A 4UTTC 3W83A 3F5JA 1UP2A 4AZ5A 2CBVA 1DBTA 1C9DA 2BXVA 3WBXA 2ZRUA 4CQDA 1XH2A 2I56A 3H12A 2R1LA 1YDVA 1OC5A 3E49A 4IPNB 4ONVA 4PFHA 3FK4A 1QDSA 3TW9A 1K8CA 3VD5A 4ZVJA 1V3KA 1RH9A 1R3YA 2GSJA 1NELA 1TPUA 3TN3A 4YNGA 3PM6A 2E1DA 4WDTA 3OLDA 1IIGA 3GH5A 5LHFA 3N15A 1LLWA 3TN6A 2QPSA 1X7FA 3OYXA 3CTLA 1LM1A 3UG3A 1JFHA 2HVNA 2Z25A 2HQAA 4U2ZA 4QR6A 5JQ9A 3VDAA 4C6EA 1A5SA 3EA1A 1H41A 1A4MA 1XKYA 2ONEA 3EXRA 3LTPA 2F6UA 2VDIA 4QDWA 1ISVA 4IF2A 1IEIA 3EMQA 3HG5A 3E1F1 2O55A 2QGHA 1KFBA 3CHFA 2VEPA 3H4GA 1IXOA 4HHPA 5D05A 3VAVA 4XZLX 4LUSA 1TZZA 4JDBA 4JHOA 4CU7A 2CBIA 3DYPA 1OQFA 1E4NA 3TSDA 2PLJA 5I78A 4GGHA 2X1RA 2FZNA 3MSGA 5GVJA 3TMLA 2ZDRA 1FWRA 3V0SA 4Z2JA 1MRQA 2PUZA 1TRIA 4JIHA 4JPGA 2ATMA 2GUUA 4HNCA 1SW7A 4HPXA 3ZT5A 3URQA 4MOZA <