1KTBA

The structure of alpha-n-acetylgalactosaminidase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
388
structure length
388
Chain Sequence
LENGLARTPPMGWLAWERFRCNVNCREDPRQCISEMLFMEMADRIAEDGWRELGYKYINIDDCWAAKQRDAEGRLVPDPERFPRGIKALADYVHARGLKLGIYGDLGRLTCGGYPGTTLDRVEQDAQTFAEWGVDMLKLDGCYSSGKEQAQGYPQMARALNATGRPIVYSCSWPAYQGGLPPKVNYTLLGEICNLWRNYDDIQDSWDSVLSIVDWFFTNQDVLQPFAGPGHWNDPDMLIIGNFGLSYEQSRSQMALWTIMAAPLLMSTDLRTISPSAKKILQNRLMIQINQDPLGIQGRRIIKEGSHIEVFLRPLSQAASALVFFSRRTDMPFRYTTSLAKLGFPMGAAYEVQDVYSGKIISGLKTGDNFTVIINPSGVVMWYLCPKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-N-acetylgalactosaminidase
publication title The 1.9 A structure of alpha-N-acetylgalactosaminidase: molecular basis of glycosidase deficiency diseases
pubmed doi rcsb
source organism Gallus gallus
molecule tags Hydrolase
total genus 139
structure length 388
sequence length 388
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2002-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1ktbA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ktbA01
4JX6A 1RR2A 1QO2A 4UFMA 1XSKA 2WVUA 1F76A 1K02A 4JR5A 3AMLA 3BLBA 4UNIA 4J3UA 4JCLA 1CDGA 3RILA 4JTKA 2ZA1A 2BY3A 5DCEA 4O15A 1CGTA 1UB3A 1OX5A 1PCKA 2AMGA 3P62A 4FNUA 1MW1A 1ZY9A 3S1UA 3V75A 4DBEA 4Q33A 4ZQCA 1PAMA 3KL3A 3KWXA 5AHMA 2VFEA 1SUXA 3GX9A 1TQSA 4RZ5A 5FF2A 3K8LA 1JCJA 1OJXA 5FEXA 3GNDA 2E4TA 3IVSA 1BF2A 1E40A 2I1OA 3LCHA 4A22A 3ABQA 1GVSA 2ISSA 3WFAA 1OFOA 3W70A 3SZ8A 3DZ1A 1CXKA 3N9RA 3C2EA 1DL3A 5EMUA 4HSNA 1EX5A 1W8SA 3W1XA 3JR2A 3M16A 3HJZA 1HL9A 1KV5A 1XCFA 4HA1A 3TXZA 2DZVA 4K38A 3L5LA 2BHUA 3TU9A 4FIQA 1J0HA 1R75A 1D3CA 1BPLB 3ANYA 3W73A 4LC6A 3CZGA 2Q3RA 1Q6LA 2QJGA 2FHBA 3UG5A 3HBLA 3PM6A 1CXEA 1ZCOA 3E96A 1SZEA 3P82A 1T96A 3QC3A 1C29A 1LWJA 4QAIA 3DFPA 4YXGA 2OSYA 1JGIA 2Y6ZA 1WPCA 2YSWA 4CQAA 1AL8A 3NQGA 1FDJA 1IIHA 4O50A 4ZL1A 1FXQA 3HG2A 2BXYA 2YIHA 4CCEA 2YW3A 3LRKA 4CLMA 4EF8A 1LBMA 1K7XA 1RQEA 1T8XA 3P5YA 3SFKA 2WSPA 1PPIA 2QPSA 3MI3A 2WPBA 3W7HA 1XD0A 3BSHA 4D2JA 5TBOA 3BLEA 3NEVA 1SSDA 3EKLA 1GT8A 1P0KA 3WEOA 2YGYA 3CIWA 2QDHA 3W2UA 6ALDA 4Y8FA 3IGUA 1TPEA 3S5ZA 3UXDA 4Y9AA 3F4WA 4FNPA 1QWUA 2CLLA 2FTPA 4L4MA 3BG3A 5DLCA 3TK7A 2V2CA 5F4WA 3FIGA 4UTUA 3W88A 2ZWZA 4HSOA 4JIQA 4GI9A 5A6MA 3WY3A 2QCDB 1VJSA 1AVAA 4JICA 2FPVA 3MWAA 5G1TA 5AC6A 3B06A 2A2IA 4S2BA 3I6RA 1SMDA 3H53A 2V2HA 3A23A 3CPUA 2VEIA 1V5XA 4PC8A 4MJZA 1WZMA 1UASA 1JCMP 7TAAA 2VFGA 2FB3A 4UQAA 4AIOA 5C54A 2C14A 3NQFA 3CT7A 1DEDA 1WQ5A 3RNDA 4WSJA 2D2OA 2TPSA 4AYSA 3ZWTA 5HULA 3IJ9A 4DELA 1I45A 1HFBA 1VCGA 4FLRA 2BWGA 4UXDA 5CZSA 5L6UA 3S2CA 5D04C 4XZ9A 1I2PA 2ZZ1A 1A5BA 3LHYA 4NU7A 3MP5A 3W7LA 4BF9A 1KTBA 4DQWA 4LRTA 3SSJA 2O7SA 4K8EA 1WP6A 5DELA 3QF0A 3B0VC 4OJYA 4CKQA 2RH9A 3S1XA 3ECQA 2DJXA 1J2WA 1SZFA 3DDGA 4XQ6A 4UFKA 3LRMA 2NXGA 5BW6A 4FIRA 4IMDA 2R91A 3QMRA 9CGTA 3W7MA 1QPKA 4M8UA 3KXQA 4GUJA 3C8FA 4CN1A 1DV7A 1HUVA 1QPNA 3WN6A 4GUGA 3B8DA 1QI5A 3UG3A 1EUAA 3BMWA 2ZBTA 3GTNA 3L4UA 3WNPA 3W75A 3BAXA 2HSAA 1X7FA 3WNOA 3C4UA 1MEHA 5F2GA 1G9HA 3N19B 4O11A 1YXCA 2ABBA 5HWMA 4MY1A 3NQ2A 2WJZA 3UWUA 3M43A 4M19A 3T55A 3VO0A 4WF7A 4S1FA 3DKLA 3RU6A 1K03A 4LT9A 4LVFA 3BVJA 3BARA 2D3NA 2Z1BA 4FXSA 3DHDA 2BLEA 3W7IA 4NXKA 1OFRA 4YLWA 2Z2UA 2NWRA 3G1FA 1TV8A 2ZXQA 3KOFA 4K8HA 4WY0F 1XH0A 3WJYA 2QF7A 1JI2A 4UNLA 1FCQA 1KW1A 3E0IA 3E49A 2A7RA 3BSGA 1GTEA 1U83A 1I4NA 3QJAA 3LGEA 1N55A 1TPFA 2Y62A 1XDLA 4UQ9A 4U2ZA 2A1YA 3W7JA 1QCWA 1KFJA 3VNDA 4A3UA 3LCXA 2VRKA 2KZHA 3WNMA 3N2MA 4FO4A 1R33A 8TIMA 4LVBA 1CLVA 1LDCA 4GKLA 2DZSA 2C15A 2XVLA 2A21A 3DXIA 1KM4A 1LOSA 5AB3A 1DHKA 2YKKA 4FNQA 1JCNA 5HJLA 1JCXA 4CNPA 4KFPA 3U2OA 2YYUA 4UCFA 4H8UA 1ZS2A 3T4CA 4QJ1A 5FF7A 3SR7A 4AWUA 2C13A 4PCSA 3ZT7A 2FHCA 1AMKA 3HPXA 1VR6A 2EAEA 5KEZA 2H90A 4WXYA 3D50A 3OG3A 5EL1A 4U3CA 1JR1A 3EDKA 1OT1A 4W93A 4PSRA 1E51A 1L6WA 2ZX8A 3NQDA 2F1BA 5HDRA 1KM5A 1XL9A 2QCFA 2CFFA 2J88A 4RKAA 2HTMA 1Z48A 3NNTA 5EYWA 1UKSA 1RQHA 3VGBA 1W31A 5TQLA 4DF1A 3M41A 3I7QA 3ZO9A 4ONVA 1GVIA 3DENA 3BUBA 4GI6A 2BY2A 1VLWA 3B0PA 3LXBA 1G67A 1JUBA 3FOKA 2PWFA 1XUUA 1EWDA 5I3FA 3LV5A 1EH9A 3W1QA 4PH6A 5K2ZA 3TQVA 2VFIA 5HXMA 5HR7A 1B0IA 4RXGA 3NQVA 4FX7A 4IPIA 2YFOA 2ZX5A 4IMFA 4ZQOA 4WOZA 3UEQA 2DIJA 3DU0A 4UR8A 1XBVA 5KITA 2E9BA 1SO4A 2H3DA 4XB3A 1CGXA 1W0MA 2ZZ7A 3STGA 3VMOA 2GVLA 1HX0A 3P80A 4JTLA 5DFAA 4PSPA 5K9DA 2ZRWA 5E93A 2DZXA 3PVFA 5DXYA 1HVXA 4FXRA 4CN6A 1F05A 4NQ1A 4U4MA 1WBJA 3L0KA 3TW6A 3GAKA 3ATYA 5TIMA 3SECA 1XSJA 3A22A 2RDWA 3TW7A 1HL8A 1XDMA 3CZSA 3WY1A 3CIXA 2VKZG 1SFLA 1LM1A 2CLMA 4AMAA 1HO1A 4ATWA 1GVFA 2YFNA 2GQ8A 4K39A 3UWZA 3DFQA 1WZKA 4UFHA 3BVXA 3DX2A 1V7YA 3HG5A 1LP6A 5A2CA 3EWXA 4FNTA 4OGZA 1JCYA 3A5VA 1HO4A 2QCDA 3QQ1A 2HMCA 2EAWA 5I5RA 3TAKA 1JCLA 4LOCA 1XV8A 4UTIA 2XVGA 3A9IA 4CQ9A 2Z1KA 1IF2A 3BW2A 3C6CA 4WXZA 3O63A 5I3IA 2WCSA 1SZGA 4KWUA 4H3DA 3NPWA 3BVVA 4MFEA 3KRUA 2OSXA 3DI1A 2PWEA 3P61A 4LW7A 1NVMA 5GVJA 4M7TA 1IZKA 1IXPA 4MZYA 1LROA 2FHFA 3TTYA 5KZMA 3G24A 4GC4A 1Q6RA 3UQNA 3EJSA 3FW6A 3ZOAA 2BSLA 1A50A 2PWGA 1LOLA 3DDFA 4J27A 3PF3A 3KVJA 1T0OA 1TCMA 1YPFA 3G1SA 4TX9A 3L21A 3LLFA 2ZRZA 4X9YA 1ODUA 3KRSA 1V3MA 1K3UA 2BTMA 4DF2A 5HINA 3EXRA 1TREA 1XH2A 3W1RA 2EQDA 1ALDA 3LERA 5BNKA 3QEZA 3M0ZA 1R2RA 3OA3A 3PC0A 1R2SA 5LSMA 3S0CA 2BXVA 1VHNA 2NUYA 5SWUA 4O52A 2FH8A 1C9DA 1TV7A 3PBYA 3EDJA 3DX4A 2I9EA 3PB2A 1GYLA 3PWAA 1JD7A 1QR7A 3AJ7A 3B0UX 3LHZA 3W2NA 3BGGA 3S6DA 1UH3A 2Y63A 3WY4A 3GKAA 3IIVA 3O6YX 4O17A 4ZQPA 1P0NA 1EA9C 2ZX7A 3G1VA 2X1RA 4FLOA 2CZFA 1M7OA 4HIBA 1KLZA 3VSUA 2WO5A 4QISA 2FLIA 2OYKA 2NXIA 3NA8A 4LVAA 1KFLA 1X1OA 2OJPA 3DH7A 2ZUUA 4LUIA 1RVGA 5CLWA 4TR9A 3TSBA 3NL6A 1XD1A 5LKYA 5BRPA 1NFBA 3W85A 5HNRA 3S9YA 1KBJA 1DTUA 1VYSX 3GXNA 3NQEA 1XI3A 1BEUA 1GYNA 4UIOA 4BR1A 1TTQA 3EXTA 1GG0A 1GOXA 3LHVA 3TTSA 4J3XA 1QO5A 2E77A 5CZ0A 5LNVA 1TIMA 5EPDA 1RD5A 3KVMA 4Z1CA 3W1PA 2DZTA 1OB0A 1EP3A 1UKQA 3IIZA 1V3JA 3DFOA 1AQHA 3W87A 2WKGA 2WQPA 3HIJA 4LS0A 3GDTA 3T40A 5LGZA 3W84A 2ZZ6A 1RP8A 3LTYA 4AHOA 4DO6A 5EA9A 2WOQA 2R14A 2A4AA 5FF3A 1TPB1 1O94A 3P84A 3M9YA 5AHEA 4Z1BA 4EOUA 2GJNA 5G1YA 1SO6A 1IV8A 3G1DA 3UZJA 5MHBA 4IUOA 1NF0A 5CXPA 3MP4A 1BWLA 4IX2A 4XTDA 1TRIA 2XVKA 4MZ1A 5G5IA 3GDMA 5C5YA 3GBDA 1KBBA 1SW7A 3WMSA 2Y7EA 2TAAA 3GZ3A 2VENA 3WENA 1M7XA 1EP1A 1TPC1 1Q45A 3NL5A 3DC0A 3R13A 4GJ1A 4MVAA 5BOOA 2CZ5A 1ZJIA 4GE8A 3W76A 4JYFA 1RV8A 4AHPA 1SU5A 1UJPA 1DHPA 1JRCA 3IRDA 3WDIA 2WSRA 2W79A 3GK0A 4FEZA 4CVWA 6CGTA 5DBUA 1VCFA 3WFZA 1R30A 3W7RA 2WNWA 3D0CA 5D2XA 4PEEA 5G4EA 1JI1A 3NDOA 1TCDA 2QUUA 3PBUA 1V3KA 1YYAA 1SQ7A 2A0NA 3TR2A 3C2FA 4FLSA 2V81A 4JY9A 4L4LA 3ELFA 2CHNA 2GUUA 2J24A 1AW1A 1KBKA 2EJ1A 2B7NA 5CSRA 1U33A 1TQWA 2V9DA 2ZUSA 3WY2A 2ALDA 2VOMA 1YADA 2X1UA 2Y7FA 4UTWC 3WDHA 3O1NA 3LBCA 2RDUA 1PHQA 2G3NA 3D4YA 3ABOA 1PS3A 3L68A 2FQIA 4NI3A 4QSHA 3TA6A 1A5AA 2D73A 1YXYA 3R2GA 1LCOA 2C7FA 5CGTA 3FA5A 2OT0A 1J5TA 4LTSA 3CEPA 5AHIA 4NNAA 3TAOA 1GJWA 5H2ZA 3IIPA 3UD6A 4GUIA 4LVDA 3OIXA 1BAGA 3LPPA 1FCUA 5D33A 5D37A 1VFOA 4GIAA 1HTYA 2D0GA 3O6DA 3PR2A 3BK0A 3QMTA 1T99A 1LBFA 5HUPA 1VB9A 1JJKA 1NAL1 2QCCA 3R12A 3WK2A 3FAWA 4O0KA 3TC6A 1JXJA 1CXFA 2VFFA 3AO0A 3TIMA 3TMQA 1U2YA 4JTEA 2XN1A 2ZTJA 4A2RA 3S5OA 4O16A 1EO7A 4BI6A 1MWOA 1WV2A 2WSYA 2VRQA 2NLIA 1L6YA 5CG7A 3W07A 2ZZ3A 3GAYA 4AAJA 1K8ZA 1IZJA 1JQVA 4JTGA 1UOKA 1BVZA 1XH1A 1TQJA 1ZALA 4UQDA 2GVYA 1OG0A 2A7NA 1MVYA 3CLWA 1ICQA 4N6FA 1Q4NX 5F4XA 5HWNA 2FJKA 4ALDA 5AOUA 2V3DA 5EKYA 1I2NA 4GI8A 1QW9A 1QI3A 3PUDA 3IK2A 5KZDA 3T7VA 3IJ8A 4HHPA 2EEXA 1LRTA 4K7VA 4CNNA 3F1QA 3P81A 1Q6QA 4ML9A 1KTCA 3NR0A 1W3NA 2A6NA 4BI7A 1BTMA 1BWKA 2V82A 2ZIDA 4ZMGA 4O18A 1WZAA 3BGJA 4M5PA 4B9YA 2ZUTA 4JDYA 4AMXA 3VGHA 3S1VA 1MEIA 4HOWA 3AMKA 4U2YA 2NSXA 2EACA 3SY5A 1B57A 3H55A 4WJEA 3N9SA 2VFHA 3EJRA 5DCDA 1M5WA 2QCMA 2ZCGA 2EPHA 4GNJA 4JX5A 3TQ0A 1ONRA 3M44A 2ZZ2A 1KTNA 1TTJA 2C19A 2VXNA 4OV9A 4K37A 1OX4B 4AIEA 3MI6A 1WYIA 5L9FA 3I7RA 1KXQA 3LTSA 2G3MA 1ZENA 4Z0SA 1TPH1 1AG1O 1ME8A 1EB3A 1WOAA 3VCRA 4DBDA 1Y7VA 2OT1A 1GVRA 3TFXA 4QIUA 4NVTA 2QR6A 1W9XA 3GBEA 1CGYA 3TONA 3IIOA 4WSKA 1SR9A 3BUDA 2C16A 3LHUA 3S42A 4NXSA 1H1ZA 1OFEA 1UD4A 3O8AA 1I2QA 1KB3A 3W1UA 4H4IA 1PJ9A 4UFJA 2E1DA 2TMDA 3HQ1A 5BMXA 2NX9A 5CPNA 2PRMA 3GKFA 2VNCA 3FKRA 2YCEA 3S1WA 3KAOA 2AGKA 5F1UA 5C6MA 4HNNA 1FCBA 3EB2A 5F1VA 4Z1DA 4HNUA 2ZXDA 3VM5A 4WOQA 1ZJBA 1O60A 3CB8A 3LCLA 2HS6A 1SMAA 4IX0A 2YA1A 2DZUA 3LTPA 3U6WA 4MAZA 1VC4A 4O53A 2ALWA 2QCGA 4BK9A 3BG5A 2PURA 3P8JA 1XUZA 4MPQA 4UMCA 3KL0A 4IMGA 1SO5A 4HOXA 4LNYA 4KWWA 2B4GA 5CGQA 3SJ3A 3NVTA 1FX6A 1WXJA 3W83A 4UTMA 4O54A 1GCYA 3BLPX 4FHAA 1GJPA 1MZHA 1UD5A 1WA3A 3W7EA 3KE0A 4JFUA 2BY1A 1CI1A 1OFAA 1YXDA 4X0NA 4ZQNA 3TDFA 3BVTA 3KLKA 1S5TA 1I2OA 2WSQA 5K3VA 3M7WA 4GQQA 2CU0A 1G4TA 1HTIA 4IMEA 1TQXA 1G94A 3KEHA 1JIBA 4LQ1A 3Q2DA 5H91A 2A5HA 1EO5A 3TV8A 4XUGA 3QPZA 3VE9A 2ZRYA 1G6CA 3LCGA 1MW0A 1FWTA 1G7VA 3EWWA 3TX9A 1TO3A 1OX6A 3DBPA 3QM3A 4UR7A 3NPVA 4ZVJA 5D2YA 3KLLA 3G1HA 4M56A 2IQTA 5DN1A 5FEWA 1F2JA 3OLGA 4O4WA 4QAWA 1KFBA 1QPOA 3WJXA 3GXFA 5D2VA 3MI2A 2YJQA 1UBSA 1FUYA 3NPUA 1MW3A 1AL7A 2RKXA 1MFUA 3HPSA 3BCDA 4WX2A 4RV8A 1CGUA 3IEBA 3O16A 1DQWA 2Y88A 3PB0A 5LNRA 1VFUA 1PEZA 1W3TA 5E9AA 2YXGA 5DCBA 4XWUA 3NQ8A 2Z0IA 3W7PA 1KLYA 1QOPA 3UWVA 1H50A 2XIBA 2B7PA 4J3TA 2DIEA 4ORMA 4ADUA 3M47A 3WJWA 2OW6A 4JFTA 3OLDA 1DJQA 1CXIA 5E6ZA 4IMCA 3N14A 3CTLA 4P2VA 1H61A 1XCWA 1VFMA 4XBKA 3PG8A 4Z08A 3L2IA 3IGXA 4UTTA 1R46A 1E3ZA 3PSVA 3IV3A 3PUOA 3DHUA 3VX1A 3GR8A 2Q8LA 1OABA 1C8VA 3NM1A 2X2IA 3GDRA 1VAHA 4QITA 4ORIA 3C52A 1TPDA 1DVJA 1QWNA 5AYZA 4E2OA 4EF9A 1XBYA 3ZSSA 4CGTA 2NV1A 4TO8A 3L9CA 2V3EA 3RIKA 3LX9A 3NM3A 3MMTA 3A47A 5KINA 1CIUA 3W2MA 1GG1A 2UV8G 3VGDA 3CU2A 3QW3A 2Z6IA 3HGRA 4RLIA 5DBTA 3G18A 2VR5A 2YA2A 3BUQA 3TJXA 1UCWA 3L66A 1B4EA 3B05A 3VGEA 3Q37A 2GOUA 5AYXA 4O12A 2ISWA 2Z6JA 4CCCA 1QWGA 3QFEA 3HG4A 1ZJAA 4MJMA 4OHQA 1JUKA 5G2IA 3O06A 5I3KA 3MYPA 3A6OA 4O1BA 4LUJA 3BAKA 2YDAA 4J9JA 1BVNP 2CLOA 4PFMA 5D30A 3SGZA 1D3GA 4HKPA 2CPUA 1LRQA 4UQBA 3BLIA 2X2GA 2ABAA 2YOCA 1IIGA 4JS3A 3QQ0A 2J6XA 4A29A 3THQA 4H8VA 2JBMA 3THAA 1MSSA 4O57A 1PZ3A 5K4ZA 4I7UA 2XN2A 5F2LA 3VNZA 2J9ZA 3BW3A 3D51A 1O4UA 1QI4A 2QCHA 4GINA 3EEGA 2FPYA 3CWNA 4RJEA 5D2WA 3AJXA 1KGUA 3W1MA 2E8ZA 4B9ZA 2B7QA 1WO2A 2F84A 4E38A 3BLKA 3CTTA 4OWGA 5AHLA 5CKSA 3W3OA 2ZE0A 3ZSTA 1H62A 1HXKA 3L4VA 4RZ6A 2WVTA 4Z0JA 3G8EA 2E6YA 1QHPA 3UNDA 3WJZA 3K1DA 4JFSA 5EMYA 4CQ8A 1K7FA 1OX4A 2VT0A 1S3HA 3MHGA 3G1YA 3LBMA 4N2YA 5K7JA 2PWDA 4JFWA 2TSYA 1W56A 1ZHAA 1A5SA 3W7NA 1IXNA 1F73A 3EDFA 2ZA2A 3WNKA 1IGSA 4AYGA 3II1A 4ZQRA 3GXDA 2J9YA 1UUOA 1AK5A 2OW7A 1CW2A 5HQEA 1FBAA 1JUEA 1TMQA 1N8FA 3QRHA 4QNEA 3W9ZA 1SSGA 3DX0A 4JTUA 1WBHA 2Y24A 1W5PA 2FH6A 3DKJA 5ABTA 4MLRA 4GBUA 2EADA 4JGDA 3WK3A 2PCQA 4RZ4A 2ZRUA 4POCA 3ABRA 1X6UA 1GTHA 1G4PA 3O07A 3TSMA 3P67A 3CM4A 1O7DC 3BV4A 3MBFA 4BWLA 4OBTA 3W72A 2ZX9A 3LDVA 1R47A 2PWHA 3D52A 1PVNA 4IWWA 3G0SA 3OVPA 4FB7A 5IBXA 1H7OA 2P0OA 4JEQA 4N9EA 4HNTA 3MHFA 2D0HA 5AC7A 1D9EA 1CXLA 3LHWA 3RLUA 4YCPA 4JTIA 3O15A 4QQ3A 5D09A 2ZUVA 3QZEA 1GPWA 5KZEA 4LV9A 2ATMA 5D03A 4HPHA 3L67A 4JCMA 1GVOA 1OF6A 2NUXA 2ZRXA 3UWYA 2ZWYA 1AW5A 3EDDA 1JD9A 1PE1A 3E9AA 4CN4A 3I68A 3M5ZA 4AVFA 4YL2A 3RK8A 2ZX6A 3JS3A 5KMYA 4FX6M 3OVRA 3EDEA 4JYDA 2X2JA 1H7PA 3NQMA 3CZLA 4JXCA 2ZXAA 2AQWA 3IJ7A 1LTDA 2Y4SA 1C8QA 1FWNA 5LHFA 1AMYA 1JFHA 4U33A 3TFCA 4HOZA 1FWWA 2DORA 2ZUWA 3TOPA 1HG3A 3NZ1A 4MB1A 1VLIA 1EPXA 4RK8A 4N9CA 2FGZA 1V3LA 3EJQA 4H2CA 1KXTA 2J9XA 3PUEA 3MBDA 1OFDA 3GNNA 3L0GA 3KL5A 2WANA 3NYZA 3LB0A 1XM3A 5BRBA 5HWJA 3CZEA 4GWEA 5T26A 1XFBA 4AB4A 2G96A 3HGSA 3K30A 4NT0A 5G2HA 1TPUA 5KSWA 4IJBA 3R5EA 2QAFA 2C3ZA 2RFGA 3E02A 1OGSA 4MYAA 3A4AA 1OVDA 3W1TA 3LRLA 4Q4KA 2ATSA 1KXVA 1AQMA 1LORA 2FFCA 4NUWA 3DHFA 3Q58A 2ZICA 2FB2A 1H7XA 4MIMA 4O8RA 4PTNA 2C1HA 3W22A 3DX3A 4E0CA 4JTSA 3RMJA 3WK1A 3HF3A 3N3MA 3VSVA 4KMQA 1G5AA 2GJLA 4X3ZA 2CWNA 3QMSA 1BKSA 1FWRA 2AAAA 3C56A 2VEPA 2E09A 1IXOA 1W1ZA 1PHWA 3GR7A 3VI2A 2V5LA 3VM7A 4X22A 7CGTA 3NO5A 1HT6A 4O1CA 5AC8A 1LOQA 3IIXA 2FE0A 4QNWA 3BO9A 1W5OA 3L4YA 3NQ6A 1R34A 4PODA 4C1KA 3CV5A 1JVNA 4LY8A 3STFA 3NZRA 1UH2A 1DJNA 2OZ0A 4GO9A 1NEYA 1MO0A 2X1SA 4M6VA 1KM3A 1F5ZA 1JL8A 1UD6A 2ISVA 2W0UA 1QW8A 1QHOA 3OLEA 3K8KA 2H8XA 3CPRA 3LXAA 5AHNA 2JKAA 2YZRA 2H3BA 4NJGA 1OFQA 3VMPA 1F6PA 4B5NA 2V3FA 3BLFA 8CGTA 3PULA 1VRDA 4RXFA 1PV8A 4NNBA 1EEPA 1SFJA 4JL1A 2GVJA 4UCGA 5D38A 2JKPA 1EA0A 5E0KA 1XKYA 2B7OA 2D3LA 3NAVA 2C8NA 1GVQA 1UD3A 1ZAJA 1MFVA 5LGXA 3NG3A 4LV4A 2V2DA 5AN7A 1SW3A 4IOTA 1XCXA 1DBTA 5G4WA 2NWSA 5I3JA 1H51A 3HB9A 2QCLA 2QMKA 1H60A 3P8IA 3L4TA 3BG9A 1L0PA 5CPMA 1B3OA 2F1AA 3SI9A 3UPWA 1BG9A 1QPQA 1W5MA 4IXXA 4UZSA 4R53A 3OLIA 3VNYA 1OYCA 2BX7A 1YDNA 1SO3A 2W6RA 1JRBA 3CQ0A 2NT0A 4GRSA 3VGGA 4NJJA 4TIMA 1FQ0A 1YPIA 2VC6A 3W86A 4AEOA 4LWWA 2WCGA 3V1PA 3ABSA 3NOEA 3B04A 4H7VA 1EHAA 1J0KA 2NV2A 5AHFA 1WAUA 1Q3NA 4UTHA 3TH6A 3NXFA 4IPJA 3LI0A 5CSSA 3OBKA 3HO8A 4N4QA 4JD4A 4JY8A 1FY6A 2GUYA 1Y0EA 4FNRA 4NJHA 2PC4A 1D7FA 4JTFA 1ZAIA 1THFD 1CYGA 3VSTA 1NSJA 1QMLA 5AFDA 4WUIA 1W5NA 3LHTA 5A8GA 3A5FA 2BHYA 1VCVA 1O5KA 5K4XA 3I65A 1U5JA 5TD4A 3EWUA 1GWJA 1RZMA 1KFEA 1VYPX 3GB6A 2X30A 4KFNA 1Z41A 3O6CA 4PL2A 3NL2A 3CGTA 3FEMA 3L5MA 5F2MA 2QJHA 3W2JA 2ZZ5A 3W7QA 1JDCA 2V30A 1EUNA 1TTIA 3GXPA 2G95A 3QPYA 3GYEA 3C61A 1TQTA 4MLJA 1QDSA 3QGVA 4PCFA 3LPOA 2ZYFA 3C3NA 1Z32X 2BY0A 1KV8A 3G22A 2F7PA 1OK6A 1YTEA 3KFTA 4JYEA 3M5YA 3N34A 1QX1A 4NX0A 3ZR4A 3NQAA 3L2LA 5FESA 4NJIA 5FI8A 4AEEA 3KVLA 4GUFA 3FYOA 1OYBA 1QPRA 2ZFAA 2Y5EA 2E68A 3WJSA 1XBZA 1B2YA 1UD2A 3EWBX 1I2RA 4O1AA 2Y2WA 2ZQ0A 2NT1A 1NOFA 3BUPA 1X8FA 3TE9A 3VE7A 4MZ8A 4JTTA 1B4KA 2P1FA 3A21A 4N4PA 5IM51 3BUIA 3W7DA 2DJLA 1PIIA 3PS7A 4I7VA 1DORA 3DHPA 3ZR6A 5A6LA 1OFPA 2LLEA 5U7SA 2A6LA 1FWSA 5U4NA 3LM7A 3EXSA 2WPGA 4N9BA 1H5YA 1GZGA 3EJUA 1H63A 1NF7A 3STEA 2Y85A 4I7WA 2A7PA 1PZ2A 2YX0A 5DO8A 3U8GA 1TSIA 1O95A 3GDKA 4O10A 4TU1A 1BLIA 3CEUA 5J5DA 1RPXA 2WV8A 5CZJA 1QNVA 4O14A 4J3VA 3DX1A 2EABA 1LWHA 4BZYA 2OX1A 3JRKA 1OSEA 3LI1A 4UMAA 3IVTA 3WELA 1XGZA 2I14A 4UOZA 4TVUA 1TMHA 2JGYA 3USBA 1ADOA 3C2RA 2OMAA 1F7BA 4M6PA 3G3MA 3W71A 3NQ7A 3PG9A 5I3GA 1CGWA 3GVGA 3M5VA 3W7CA 2QEZA 4EWND 3RLVA 1KM2A 1O5XA 2DU2A 2WSKA 3QW4B 1U30A 4UZUA 5F4SA 3EWYA 1FXPA 3MUXA 4HPXA 3SIZA 2DH2A 5LNSA 4AF0A 1GJUA 4AMWA 1CX9A 2ZXBA 3HPZA 1RPKA 1WDWA 1JAEA 4N9DA 2F18A 3TXVA 3MYOA 4BI5A 3LLDA 2X2HA 3C2OA 3CWOX 3L4WA 5C55A 3VKJA 1Z42A 2CLEA 1KXHA 2QJIA 1TRDA 2GJPA 1GEQA 3UERA 3FJ6A 2JKEA 2BZNA 4HT3A 3GIYA 2FYVA 2D0FA 4DO5A 5I23A 4JX4A 1H7RA 2ZA3A 4PCTA 1A53A 4FF7A 1SW0A 4IGHA 1MW2A 3QH2A 1G4EA 3EX2A 3L4ZA 1WZLA 4OQVA 5K9CA 4DO4A 4R34A 3EJTA 4R33A 4YWIA 4Z1AA 1ZFJA 4RR4A 3UXAA 4OT7A 1J0JA 4WY0A 3W1AA 3BAWA 3W37A 4X2RA 4HN4A 4M6QA 2V8ZA 3HGJA 1PIGA 3QSTA 3G0UA 3CLMA 2OYMA 5AYYA 1ME9A 4N6EA 1YDOA 4XKYA 5LZLA 3VMNA 4UFLA 3UZ5A 3AXIA 2B0MA 3WK0A 3I7SA 3EJPA 5I24A 1EP2A 2GQ9A 1ZNNA 3BCFA 3CC1A 1TQUA 1H7NA 6TAAA 3HOJA 3LCIA 3TJLA 4NZFA 3P74A 3NGJA 3UG4A 2PRHA 3H54A 3RF9A 4AWSA 3BAIA 4W9TA 4FLQA 4XBSA 2QLYA 1K7EA 1VYRA 4LC8A 2WNQA 2QKFA 1ZAHA 1M7PA 1BSIA 2WVVA 4LVGA 4JDBA 4UC5A 3UWQA 1KCKA 4YCOA 4CCDA 3WDJA 1OK4A 3DAQA 3S5NA 3HZ3A 3NPXA 5FF4A 1I75A 3PBWA 3S8HA 1N7KA 4GFSA 1OHLA 4QM1A 4XTIA 4OIFA 2CZEA 1JF5A 1LRNA 1YLVA 2IGTA 1S5VA 1Q6OA 2A85A 5G2WA 5F7UA 3W1LA 1UA7A 2R8WA 3INPA 2ZRVA 4Y6GA 2E5BA 3LCWA 3TNOA 4HPJA 2QCNA 4KFOA 5LNWA 1KM0A 1CXHA 2JK2A 4AXKA 4OV4A 1Z44A 4DPPA 5E0FA 3MW7A 2VUYA 3M6YA 1KM6A 3MJYA 1JXKA 4LS1A 4PL1A 2NUWA 4WLCA 3VFLA 1FDYA 3QSRA 2NZLA 1S5WA 1G1YA 3GDLA 4OU1A 3UPBA 1JDAA 1ME7A 4LPCA 4AEFA 3L65A 3GXMA 1J4EA 5LNUA 4J3WA 3W38A 3T44A 4S2CA 4KWVA 4BFAA 5D02A 2C6QA 5DXXA 1CGVA 4MKNA 2E6FA 2F7QA 3C2VA 4NZJA 1P4CA 1E3XA 1WE5A 4OE7A 4ADTA 4PEKA 2CLFA 4OKDA 3GLCA 3BVWA 1B9BA 2G5WA 3TCEA 3N73A 4E2DA 5CPLA 3S5YA 1WOBA 2EF9A 1IXQA 3C0JA 4LS2A 3PBVA 4HNVA 5HPOA 3L5AA 3BAYA 4AHQA 4GQRA 2FDSA 4Y96A 2VFDA 1KCLA 2J27A 1W37A 3KVKA 2PRLA 2YPIA 5I0DA 2NX1A 3KX6A 4UTLA 2V5BA 4Q32A 2XFWA 3N2XA 4MFDA 2TYSA 3LV6A 3OVQA 4Y90A 2YA0A 4JFVA 1KGXA 4LXFA 4WD0A 4EVZA 3TROA 4R7JA 3TUUA 5K9XA 1QAPA 4DEFA 3SGUA 2F7RA 3ZT5A 2GVGA 3DI0A 2Y7DA 4A21A 2Y89A 5BRQA 1G4SA 5EY5A 1TTPA 2EGZA 4WZHA 1SZNA 4NNCA 4UTJA 2CLKA 3P60A 2VEMA 3G3DA 1TJPA 3L0NA 1GQNA 1VS1A 1P5BA 4IXHA 2YYTA 4O28A 2CZDA 4ADSA 1HNYA 2WKLA 1TJRA 4UTTC 1P1XA 4PA8A 4DPQA 3W1NA 4GO8A 2FIQA 4UQCA 1FCVA 4O0ZA 1XSIA 4C1LA 3W7KA 2JGQA 1UKTA 1P6WA 5CPOA 1UUMA 1DOSA 1YTKA 2VELA 4A2SA 5BMWA 2WNNA 3G1AA 3BH4A 5KTLA 3CZNA 1DQXA 3HMJG 3EKZA 3BMVA 1OFBA 1X1ZA 1VH7A 5E70A 4MY9A 4U31A 2CW6A 1WX0A 2DZWA 3MHUA 3P5ZA 1KA9F 3AXHA 2OCZA 3PY2A 4J28A 4UTKA 1I8JA 2X1TA 4JN6A 3KHJA 1S46A 4K6AA 2CXGA 5CGMA 4JIPA 1M6JA 4ZQMA 4AW7A 5C2XA 5HUOA 3IGSA 1VJIA 1H1YA 4MUZA 1TB3A 1MXSA 3EX3A 3R8RA 1TPWA 5FEPA 3TQKA 5DY3A 4UFIA 3ZWSA 2GQAA 1LZOA 4MOZA 2E5DA 2EHHA 4HP5A 3WEMA 2BHZA 5A2BA 6TIMA 3B4UA 5F2IA 3BPWA 2XWEA 3ATZA 4H8HA 1R2TA 3PSWA 1HL2A 3FYPA 3W2LA 2DZPA 4H6KA 1ML1A 1G69A 2V0TA 3G1XA 3W7GA 2E6AA 3HJEA 3SW6A 4NX5A 1JULA 2Q3OA 1NM9A 1TQVA 2H8ZA 3LOTA 3TMLA 2C18A 1EIXA 1L2UA 3F4NA 4MY8A 2R94A 1FDZA 3K8MA 2QUVA 1W54A 1YTDA 4P61A 3PAJA 3BW4A 3M5XA 1J0IA 4BA0A 3OEXA 2FPTA 1LBLA 1PL9A 4X9SA 3EX6A 3TSDA 2NXHA 1ICSA 3W74A 1H3GA 1XC4A 1UA3A 1W5QA 4O4VA 1RP9A 1RQBA 1KM1A 4GXMA 2WC7A 1OYAA 2EKCA 3G8RA 3UY8A 1XXXA 4AWTA 1F74A 1VZWA 2Y7GA 3M1ZA 3E12A 3WNNA 5A2AA 3ZQ9A 3L4XA 2YR1A 3ZT6A 2QUTA 2F7OA 2OYLA 4UTWA 1UD8A 2YW4A 3O05A 2NX3A 1LLZA 2Y61A 4DF0A 4K7YA 4N02A 4MYXA 4WQ6A 3W2KA 2QAPA 2E8YA 1DKWA 1W3IA 4GUHA 3L2MA 3ZS4A 2ZTKA 1AW2A 3VGFA 1XBXA 1MXGA 4JTJA 2F7FA 3RFAA 2RHGA 2H6RA 2GPTA 3OHIA 2QPUA 2X16A 3DFTA 5D32A 4NJKA 4AF0B 4FNSA 4O1DA 1G7UA 4BWLC 1F6KA 7TIMA 1KGWA 4LU0A 1K8YA 3B03A 3UYCA 2BXZA 2QCEA 3STCA 5IBXC 2O7QA 5FEZA 1EWEA 2J25A 3KRZA 1L9WA 1QFEA 3MO7A 1PIFA 3A24A 2ZDRA 4K36A 4AH7A 2QV4A 1VHCA 4LRSA 2QDGA 4KKXA 1KBIA 3NQCA 3F03K 2G97A 2XIIA 3BC9A 4UNKA 3CHVA 1TV5A 2VEKA 1VQTA 1MXDA 3UCQA 2CLHA 3FAXA 2E5CA 3FKKA 5CLTA 4U28A 3TC7A 4E2BA 2WNZA 4WY0B 4RX0A 5HR6A 1A5CA 2CLIA 3WNLA 3UWWA 4FMVA 3YPIA 1E43A 2WVSA 4YMZA 3IVUA 3FLUA 1ICPA 3LCFA 2TRSA 4IQLA 4O19A 4UQEA 4J3SA 4XKYB 3UY7A 3FFSA 1OT2A 5A5WA 4RCXA 1TYGA 1M53A 3CZKA 2WKJA 5E6YA 2XN0A 4UMBA 3VX0A 1UH4A 4G1KA 1JQXA 3ZR5A 1KFCA 5D2TA 3ZFHA 2ZZ4A 3EX4A 4ICNA 4CNOA 3R89A 3TKFA 4O13A 5D05A 5LHEA 2Y70A 4UUIA 4J7RA 1KWKA 1PS9A 2F2HA 3W6YA 1A47A 4JNMA 1LYXA 1QOQA 2E6DA 1HWWA 3HGOA 4DXVA 3DFSA 1VIWA 1TPVA 3LXCA 2P10A 5I3HA 2OSWA 2F61A 1PCWA 1YDVA 1VGAA 2WVVB 3D4ZA 2PE4A 3W7OA 1CPUA 1SPQA 2EO7A 2Q8ZA 4JTHA 4M7SA 1VPXA 2DH3A 2RDTA 3HG3A 3FJLA 4TMCA 1OF8A 1MEWA 3EX1A 3Q94A 3EWZA 5DY2A 3VU2A 2E0PA 1JF6A 2GJRA 1KWGA 3DGRA 1L6SA 2HS8A 3NL3A 3QYQA 3GXIA 5E1QA 3FS2A 3W23A 1KFKA 2C0AA 2DP3A 2AAMA 2QMJA 4FX8A 1LLWA 3G0XA 3GXTA 2XWDA 5J5RA 1H7WA 3M07A 5HMSA 4TMBA 4EIVA 3T78A 1K8XA 3MP3A 4UOQA 5EBUA 5FF0A 1D3HA 3BVUA 4I9AA 3BAJA 5CZTA 3DFNA 1JG9A 4ZZ9A 4JL2A 3P7YA 1JDDA
chains in the Genus database with same CATH superfamily
1XF1A 3SPVA 4EZJA 2K7PA 1HXJA 3QXVA 1X8CA 1JXFA 3NCOA 3Q6FB 5FUOL 4HUVB 3LKSB 3IVSA 1FA4A 5JH2A 4IBVA 1GVSA 2FZ8A 4P46A 4PRHE 2SEBB 4M6ML 2IW0A 1TYRA 1FBIH 1XQKA 3WBEA 5DTFB 3F2CA 4AIBA 3X13B 4P0DA 2Q3RA 4BFOA 4TQHA 5D93B 4IIGA 4GYKA 3QC3A 1UP3A 2WBKA 1JGIA 1KRBC 4CQAA 3B8SA 1NKOA 3M0VA 4DP9X 3HG2A 2OMZB 4CCEA 2YW3A 1UWXH 1K7XA 2DPEA 1X9QA 4HAGA 2QGHA 2AI0L 2B81A 5TBOA 4DSYA 3KW8A 2OL3B 4Y8FA 2YXMA 4AQZA 1VFAA 5B7FA 3O0KA 3HZYA 5A8MA 2V5CA 5E7BA 2QCDB 4BY3A 3BIKB 1H0DA 4PRDA 2AQNA 4F9PC 3OKDB 6ENLA 3KOYA 5LYRA 3MRPA 2C14A 1BVLA 1R3WA 4OI7A 3ET9F 4NQVA 1G4RA 3NCFB 3SDXE 1I31A 4L4OA 1DWJM 4M4RB 2FO1A 4EPDC 1A9EB 4MAYA 3P4OA 5DELA 4OJYA 5IROA 2X6BA 1XGPA 1Y07A 3H6OA 5BW6A 3UTPD 4IMDA 4E4PA 3QMRA 3OZOA 2WMHA 3QFWA 4FOJA 5MEQB 2C3XA 4TOYL 3AS2A 2I56A 4E8GA 1UM5H 1UWTA 1HOEA 4IUGA 4XD4A 3ATAA 1ZTXL 3EG9B 1U0QA 5REQB 3OXRB 3C5QA 5HWMA 5IJVA 1SDDA 5D6CA 3CFJA 2P5WD 3U2ZA 4YHZL 1OSZA 4FXSA 2IOMA 3W0WE 4YTQA 1K6QH 1I4NA 4G6JL 4WUUD 1T5XB 2O6FA 2W59A 1QNOA 3GDBA 1JCNA 4LMQE 4YGAB 3LRSA 1PCSA 3F7JA 3BW9B 2IS7A 3FCPA 2H2SD 2W9LA 2GT9A 2VX4A 3B9EA 4YDJB 3MKCA 2CYGA 2N7BA 4HJGB 4Y16D 4PJIF 4XD6A 4R96B 5GSVB 4LP8A 3DK2A 1BECA 3MBWB 3G5EA 3DV6B 1UW9A 2ZX8A 4DT2A 1XL9A 2QCFA 3G6AA 4KKBD 1M9HA 3RTQA 1S9YB 3D87B 4KH2A 2ICEB 1VLWA 3B0PA 2RALA 4TULH 4M8RA 4EK7A 2X9YA 3JZEA 1WXZA 3L1OH 4JREB 2UYLA 4KWSA 4HS3B 1YMMB 5EC2A 1JGVL 1EZVX 3RL2B 4Z3FA 4D6DA 2F6AA 2WCPA 5C0GB 2OZNA 3R8QA 4RDQG 2Z28A 2ZZ7A 4ZYKA 1A6PA 4BFIA 4GIYA 4Z2LA 3FRUA 2DZAA 4HKBB 3VXSB 1VRXA 2DT0A 4P46D 3SECA 1XDMA 4XZUB 1TWSA 3CIXA 1PZ5B 5JBEA 2GSGB 4XZIA 1GVFA 3DX2A 1PLCA 1UWQA 5I26A 3RPIB 5JIQA 4UTIA 5XIMA 4R7VA 1IF2A 4A8LA 3IFPB 4GQPH 5I3IA 3BEWA 1G9NL 1FNEB 4QGCA 1I3RA 2DLEA 3T0ED 5I1JL 2BGSA 7ENLA 3OB0K 1JVOA 3VI4F 5ABDE 4XNYL 3FZUC 2PD5A 2AQOA 3FW6A 5FA4B 1MCJA 3QDHA 3DDFA 3I9GH 3XISA 2CEQA 1V3MA 1HZKA 3KPPA 4X0VA 5ECUA 3Q3GB 3QEZA 5A7BA 1D8CA 2O6DA 4MMXB 1BQ5A 1C9DA 2FX9L 4HV8B 3DX4A 4LL4A 4JPWL 4LCWB 1HNGA 2FSEA 2WJDA 4ZXBC 2FNBA 1M7OA 4MKTA 4YFLI 2WO5A 4LVAA 4RFNB 3VABA 3LV3B 5BRPA 1N5YL 4IRZA 1DTUA 5KVEL 3IRZA 1GYNA 1U8NA 4RIRB 3OXSB 2IQ9L 4XNAA 3FNKA 1QNIA 3KVMA 1EP3A 1R17A 3QGKC 1V3JA 3ZIZA 4OCSL 5G1MA 3WLQA 5BVJB 3SY1A 2JSFA 1KZYA 4LS0A 4Q8MA 4QYOB 2XWRA 1LP9A 1QR1B 2VDKH 1E90A 3D46A 4W7UA 5G1YA 3R8GA 3I74A 2V5JA 4YGVB 4MUPA 2FNWA 2R56L 3WENA 1JHTB 1EP1A 2ITEA 2FR4A 2BRQA 2WLIA 4WWOA 8FABA 4JYFA 4TXEA 3GK0A 3JXAA 4CVWA 4WWKA 5IW3A 4MNGA 2DUXA 2ESVA 3NDOA 3QI9A 2VURA 2VABB 3ZZ1A 1MCBA 2V9DA 2CUIA 4UTWC 1IM9D 1C5DA 3D4YA 2GSIA 2IBGA 1TFPA 5I0YA 3KZPA 4D9RD 4ZOCA 5AHIA 5H2ZA 5ALBH 3UD6A 1BAGA 3GMPA 1XF2B 3L5HA 3E0LA 1JJKA 3WKML 3ARFB 2FB4L 1S7VA 2QUMA 1W1PA 5HHNB 2NUTB 1MWAB 1CECA 2Z00A 4LEXL 1L6YA 2AANA 4X8GA 4Y2LA 1L6PA 4HU4A 1TQJA 4G8FA 4Y5XB 2F7IA 4EN2A 1WEJH 3K1KC 3P93A 2FVMA 1IEBB 3H2WA 2KKQA 1EJSC 5EEYA 1WT5C 1NBVL 1RY8A 1ETB1 3IUIA 4IGBD 3FB5A 3VGHA 1CL7H 3EGDB 3W0WB 2COVD 5A2FA 1K85A 3WLIA 3L9RB 1KJ2L 3UBHA 2C79A 2I5QA 1PZ1A 4BK8A 2ZUQC 2Q76B 1HIML 2IQDA 2WQRA 4K37A 1OX4B 5F3BB 1TPH1 1MJ7L 4OJFH 1CLXA 3QO0B 2F5AH 3FSUA 1W15A 1QP1A 5J8OA 1I2QA 4QWWD 4Z7OE 2H1LM 1J1OL 1KKOA 2YCEA 1ZGLB 1RZKH 4Z1DA 5HK4A 2B2XL 1C08B 2X6VA 3AQYA 2J78A 1VC4A 2F0CA 1S7RA 1JGLL 1XUZA 1YC7A 4YFDB 3FT4A 3SJ3A 2VW7A 2CGRL 2F19L 3QIBD 1OPGH 3HFFA 2UY2A 4GXWA 3FJTA 2P50A 1SHWA 3GSVB 2DIBA 4G6AD 4PULA 3KOXA 1IGIL 2W8CA 4JO5A 4Y4HA 1FORL 4L1SA 5HHMB 1CJYA 5I75C 1E1CB 1NM4A 1NCDH 4M7LH 1U5VA 4O4WA 4QAWA 2OMYB 1KFBA 4NNPL 2B1HL 2N1TE 3T1FA 4YTTA 3MI2A 1NEZB 3BT0A 3ARBD 4AZ8B 2YXGA 1YCSA 3X1FA 2VLJD 2B7PA 2JQAA 3CFTA 3OQ3B 4W9JC 3RPBA 3U1SL 2V69A 1VFMA 1X4YA 1QVOB 3RO6A 2XN9B 4WWKD 3RHWK 5C8JB 3AREB 1ZBKA 3BPOC 2PCYA 2ESVD 3QI9D 25C8H 3CU2A 1N5AB 4XOBA 4DPRA 4I18A 3QUML 1HZYA 4LSVH 3B05A 3NZ8B 1P69B 1JTPA 4DVRL 4PMXA 3H6AA 4G2DA 4L8SA 4O1BA 2JB6B 4DEWA 4HKPA 2CPUA 4UQBA 5T3ZH 2AJVH 5E8DL 3FV9A 4H8VA 2ARJA 1QNSA 4JG1H 1JTTA 3Q7JA 3EEGA 1FC1A 1KGUA 2FEDC 4E38A 2KH2B 3AWEA 2J5WA 4PJBE 1MAKA 2EIJB 2VAAB 4KBPA 1EF3A 5TDPA 3GG7A 2ZUYA 2PWDA 2V2TB 5KYYB 2ZA2A 3PTQA 3FONB 2J9YA 3SJVE 5ICYA 4OUOA 1IT9H 3BH9A 1II4E 2AJUH 1MFCH 3V0VB 1CB2A 2PPAA 1R47A 1BD2D 2OSLB 2VQUA 3OVPA 1G87A 5D7HA 5IBXA 4B5TA 1G84A 1RKRA 5AC7A 1D9EA 1YEJL 2Y25A 2EYRB 4HXBH 3WSQH 2CR0A 4WW1B 5E4EC 5D03A 3IFNH 3BXNA 2V5TA 2HYMA 3P3RA 3GMNB 1Q0XL 3FT0A 4CN4A 2R24A 4KX7A 2HAZA 4W9LC 5FSEC 1JOIA 3PJUA 3TS8A 4JFHE 3AU2A 5F1NB 1LWRA 4GVFA 4M7ZB 2WQSA 1VLIA 4LCRA 3QGAC 2CSPA 1RJYA 2VX6A 3NYZA 1AKJB 1QWKA 3CZEA 4JRFA 1KCUH 5HTSA 1JWUB 1RIHH 3AMDA 1CIDA 2JK5B 4CADA 5HJ3B 3D48R 4K2UL 4TMPA 4Y4KD 4DJEC 5C08D 4H26B 1QI2A 1CTOA 3LRLA 2DZBA 4DLFA 2ZICA 3PZMA 4MCNA 4WKZB 2WMFA 4JTSA 4RMRA 3HF3A 2QEJA 3UTTE 4WGXA 3IDXH 3HUJF 2CWNA 4Y4HD 2AAAA 4LZKA 2EH8H 2OQLA 2YJLA 1LEGA 4PGZA 5EU7C 4O1CA 3GTTA 4KJWD 3ARDA 1EHLH 3BICA 4UDTA 4UAOB 1I1RA 1UH2A 2OZ0A 1MHPH 1ZVSB 3HCVA 3E2VA 4ZG1A 3GH7A 4MQTB 2AJXL 3M0MA 3ZE2F 3S5LG 4UIKH 1NUGA 3OO2A 3HE7C 5JOPE 3WQCA 2MCPH 1SFJA 4KUZL 2GVJA 5DD6B 5D38A 2VWTA 4ZMXA 3CYJA 2PXYB 1UD3A 5B3JE 2EZ0D 4KK9D 4Z7OB 1M1BA 4IOTA 2PTVA 1DBTA 2NWSA 2I60H 1L0PA 2JCWA 1W0WA 4UZSA 5KSBB 3EUDA 1MHHB 3NGFA 3GJFB 4UINL 3TWCL 2R4RH 5G5DA 4OZHA 2Q20A 4M5TA 2YBGA 3WLBA 1V6TA 2P26A 1FWEC 4RDVA 1FY6A 2FMOA 2Z7ZA 4HLJA 5I8EB 1DQVA 2PW1B 4G42A 3N2TA 1VCVA 1VSCA 3LU2A 3WKZA 2VMJA 4HWBA 3GZQA 3GB6A 3B0XA 1THAA 2YPKA 4CJ0A 1CTMA 3CFNA 5XINA 3C61A 3ZDXB 2PCFB 1YTEA 1CFVH 4JDVA 4HXAH 1CYWA 5C7VA 4LAOA 2VR8A 3RJDA 3BN9C 1JMXA 4MZ2A 1B2YA 5T3XH 3EFDL 3JWNG 1NCAH 3MBXH 5E5MA 3CUGA 4NN6C 4YBLC 4G9FA 4X8JB 1BZDA 2A6LA 5U4NA 1U6AL 2Q8XA 5E09A 3AFBA 3R58A 1D5IH 2PSNA 5J9PA 1BLIA 4JVUA 5ESQA 1F8IA 2EABA 1PFOA 3EO0A 4Z7UE 2CJ3A 1GGBL 1QTSA 4P23A 3BP7B 1FFNA 1MJJA 4NPKA 1I1AC 4UZUA 5LAPA 1WDWA 1URIA 3WV0A 1ZS8A 2SFPA 3UERA 4W4OC 3E8VA 3DXAE 4PCTA 4Z8FH 3IANA 4PJBB 3LIZA 3OF6D 2HG5B 4D1JA 4FZEH 5C9JB 4FL4C 1EX0A 3FSOA 1XIJA 2A0LD 1ZU8A 2OLDA 4K8RC 4X6CB 5J56B 5JMUA 3QO1A 1I8MA 4AZ6A 1UA6H 2WLYA 4L2LA 3SJVB 1W1YA 2NYYC 6TAAA 1XCQB 1EXUB 4FLQA 4GRWH 4C7FA 2QLYA 3O6FA 1U9KA 2E7HA 3WDJA 4QAMB 1KF9B 5KSAA 4D9LH 1TZAA 1N3NB 5IQ7L 1TVLA 2HROA 2R82A 4P7QA 2ZYHA 4I9XA 1OOWA 2XETA 3SYAA 4JM2C 5I74C 3DV4B 1QRNB 4KFOA 1Z5YD 3A4EA 1WFTA 3MJYA 3EH4B 1JNHA 4JAMB 1MLCB 1ME7A 2PO6C 2GWNA 5D02A 1ENUA 2DGAA 2F7QA 4HZ6A 4D1IA 4N0FA 1KB5A 4I48A 4GT7A 4PFHA 4Y7EA 5CPLA 2W63A 4X6DE 3PBVA 4MDJB 4A2MA 4S0TD 5IMOA 4H1LB 2MNJB 4PMNA 4Y9NA 3P0YL 4TYUA 2FRGP 3MB9A 3N2XA 4Y90A 3P73A 4Z1YA 2W65B 3TFKC 1TZ9A 4CNTA 3TUUA 1E56A 1AXTL 3MV7E 4PR4A 4QO1A 3UTTB 1JCVA 1E1EA 2DBLH 4R4FL 1T6WA 1FV1B 3MRNB 5BU6A 4LHUG 1VS1A 4IXHA 1B2WH 1HNYA 5BMFL 3ITOA 1CFBA 5KS9A 3IDJA 2OMVA 3FFDB 1SN0A 2CK0H 3LGDA 4C1LA 1RZFH 1TR1A 4AIZA 4HLEA 3S97C 5IEKA 1IFHL 3MLUL 1EAQA 2VN6A 1R3JB 1VH7A 4DW2H 4IMKC 2H32A 2CW6A 3WIIL 1WX0A 3P5ZA 1KA9F 2QSCL 2A9BA 1FHGA 1OP4A 4NZUH 5EF0A 3HR5B 3I50L 1E4WH 3GSUB 3N6HA 2G2RB 2OTDA 2UZ9A 4H6KA 2QZQA 4XX1G 3S4SB 1S78D 4NX5A 3H6JA 1RH9A 3DG3A 5DI8B 4P23D 5CUSL 4HW6A 1R3KB 4QG6A 3TSDA 1Y6NR 2NXHA 2K4AA 2O72A 1NARA 1U5HA 1GQIA 4QRNA 4QDWA 3EYOB 4JZJA 4RQQA 4DN1A 2F7OA 2R29H 4IU3B 3K2GA 1BZ7A 2A6JA 3VFMA 1W3IA 3D85A 3AXMA 3CU1A 4Q8WA 5CAKA 5AB1A 3GLZA 1G7UA 3EYQD 5DD0L 2A3BA 2XTJD 8XIAA 3N42B 2WXPA 4AK1A 3LIUA 1ONQA 2I57A 1AGCA 4IOFC 1JUFB 3FAXA 5MEPA 2WNZA 1ZA6A 3UWWA 1OZUA 2JCCF 2QGBA 4O19A 3H2AA 1UCTA 4D6HA 1SVZA 2IG2L 4M6UA 1UXWA 3AS1A 1DZ0A 4GG6E 3TA3C 4MWAC 3B43A 4U6VL 2WYZA 4M3KB 1X1NA 2Y70A 4Z17A 1WA2X 4J7RA 3UEZA 1IC0A 3OZPA 3W6YA 3RDTA 1A47A 4JNMA 4Z7UB 3AT0A 4PS4H 3CAWA 1EV2E 3ZJAA 4N28A 4FTDA 3PDOA 1MEWA 2XNAA 3L6FB 3DGRA 2BVEA 3NL3A 1XCTA 4H9MA 2NNCA 3T2NL 3GXTA 4QI3A 5J5RA 1UENA 4JHUA 4XMLH 4ZUSB 1IB5A 4QG8A 2PBGA 4YHIB 4LKCB 4RW3A 5J3HD 1P5VA 1A6AB 1E0VA 1KIPA 1OF2A 1RUKH 4D94A 5LQBH 4JTKA 1A14L 5DCEA 3QIUD 4JRXD 1CGTA 4MKVA 5DJ6A 5A6JA 1P4LA 5FF2A 4PJ9D 2CGZA 4HS6B 3NOYA 3NCMA 3AIVA 3VWKA 3DZ1A 1HJWA 5E9DE 1M05A 2GJZB 4J8RB 5CP3A 1ORQB 3SCNA 5FGSA 2R0WH 3HTWA 4LLQB 1NPNA 5KVDL 2R1MA 4WRHA 5ERWB 4KEMA 3IDUA 3PZGA 2XQBH 4W9CC 4RFOL 5EBWA 4QAIA 3LN3A 1QNZL 3BPLB 1TQBB 1RHHB 5IK3B 2MFNA 3VXPB 4MMZC 3UR7A 3MREA 2DWDB 4NO2B 1ACYL 2JLPA 3L3GA 1TMLA 1AQFA 4JPQA 2O6PA 1Z5LA 2QDHA 4PTMA 2A73B 1R6WA 4WJ5B 4APQA 4B0MB 1LO5B 5CCGE 3AYSA 3LH9A 4YHYC 1JF1B 3R7QA 3T8XA 5E94B 3I6RA 2ZWKA 4NGHH 3ESUF 3IGFA 3LCYA 3VC5A 4G9DA 4YNYA 4HJ0D 3VXTB 4X6DB 1WQ5A 1EAPB 4LHUA 4ODVH 3J27A 5HULA 3M45A 3C60D 3F5LA 5IW6A 5DQPA 3TBVB 1M4KA 4XB8A 4IL0A 1IUZA 3TCLB 1I2PA 4BF9A 1RZGB 3S1XA 1ZPTA 2EE3A 3MV7B 4GKOA 3O41A 3CMOH 4CMMA 2OM5A 5DRIA 2QW5A 1M71A 5F21B 2YN3A 3CH9A 4XBPB 3B8DA 1UZ4A 2CIKA 1V77A 2HCVA 1M3JA 1AD9A 5KYUA 4GSDL 5B8CB 5BW7A 2VYOA 3CHFA 2GJXB 4JFZL 1DBML 1OFRA 4NXKA 5FV2A 1AH4A 1MPAL 3U9WA 4BDVA 4UNLA 1FCQA 1N55A 4B4HA 5FUZH 2QTVA 2DZSA 4LYRA 3T9PA 2HRGA 5AKQA 3GTVA 3UW6A 5T33H 4CNPA 5JHLL 4LCVA 4PP2A 1AMKA 3QUXC 2PLJA 4MD0B 5EL1A 5AW5B 5I1KH 1AXSA 3CXFA 5T5FA 3NNTA 5EOQL 3I7QA 3MXVH 2GVEA 3IMRA 1G67A 1VFSA 1XTLA 5EZOH 1YEGH 1UWIA 1BYCA 2AXGA 5FUCC 1DBKL 3FN0L 2G5BB 2Z64C 5HR7A 3CB3A 5GS1B 4IPIA 5ANME 1MWAL 2ZX5A 4L8CA 2P8LA 2H3DA 3S0PA 1CGXA 4M93C 3HR6A 3STGA 5CPQA 1CDBA 1FN4B 1U3HC 3TN6A 4PG2A 3K6IA 3QFDA 4KOBA 1NBYB 3VWKD 5SWSE 4U4MA 1QUNB 5CIPH 4N85A 4O0QA 3SDDC 3RVUD 2JJUA 2BCKA 1QLRA 2VKZG 4FABL 2BP3A 4MYPA 4XBMA 1XIIA 3HG5A 3A5VA 3MLWH 1WFUA 3L5XH 4IQHA 2Z4QA 4PYGA 2EKSA 3C8DA 1E2WA 3BW2A 2FGBA 4GZEA 1B3JA 4WXZA 3ALFA 4H3DA 3BVVA 5BV7H 2EDFA 4AC4A 4AKOA 1JZ2A 1TX2A 4Q8UA 1WBZB 4GG6B 4LW7A 2JJSA 4JO4H 5AUMA 1GZ1A 5CC3A 3UQNA 3IDIB 1TQCC 1Y6KR 3U30B 1OEPA 3PREA 2EEFA 3PPSA 3KRSA 5J04A 1U8QA 2DSUA 3O8XA 2ZTBA 3MC0A 3EXRA 5HINA 1MFMA 3OA3A 1INEH 2FH8A 4FG6D 4FXGB 4QHKJ 4BKNA 4LHUD 4ZQPA 3CNYA 2DAVA 2EXSA 2OYKA 2ITDA 4HDIB 3MLYH 1H6UA 2RQEA 3FULA 1IBBA 4NZ8A 1AFSA 4UIOA 5E9DB 3QG6A 5TFSH 4UWQB 5LDUA 4KI1A 1SZRA 2ZSWB 5AOIA 4Z1CA 2EYTB 3UTQB 1IKNA 3KBVA 2WQPA 4LVOC 2D3JA 2PTWA 1D5BB 3W84A 2ZZ6A 4FP8L 1X5MA 1NCWH 4UT6H 4Z78A 1R7OA 3TBBA 3CQFA 3MA9H 5CXPA 4IX2A 4BJLA 4ZAKB 1G7IB 1A65A 3BO8B 1TPC1 6A3HA 1ZJIA 4WI5A 2P76A 3M1OA 3VINA 5EIIB 4R4BB 3GWQA 2WNWA 1BFVL 3UZQB 2GGJA 2HPMA 1HE7A 2IPJA 3ABMB 5D7LE 3V8CA 4U3AA 3VNKA 1XB6A 2EJ1A 3WU1A 2DKMA 4E4FA 3WDHA 1IGYB 4C6KA 1FF5A 3QZ6A 3RU8H 5FEBA 4NQCA 2F6KA 2A2QT 2Q01A 1JP5A 2NZ9D 3TAOA 4FZ8L 2EVIA 2CO4A 2VJ0A 1OO2A 4URTB 2VRJA 1T1YA 4YBQC 1VD6A 1DVZA 4A2RA 2P43B 3DETD 1ITBB 1V6UA 4F58H 5IFAH 1K8ZA 1JFXA 1HKLH 1ZL1A 2DSWA 3NFPB 4JQIL 4OJCA 1UFGA 3O7UA 3SQSA 4OQTL 2AQVA 4H7CA 5BRZE 1GORA 1YUHB 4GRMB 2WXOA 3NR0A 1W3NA 1FZJA 3QFJA 3M1BA 5DS8B 3L95B 3L17A 3MFFB 1NWRA 2TSBA 3WL0A 2R1XA 4HC1A 4IKIA 4ONFH 3N9SA 3DVGB 3PHSA 3FTXA 4WW2A 5D70L 4E5TA 3M44A 1Y0LA 4P9HC 1XGEA 1S5IH 1WYIA 2ADIA 5IW1A 1X6NA 2G30A 4JFOA 2QDEA 5GGVL 3KOZA 1AGFB 1W9XA 4E41E 1EGJL 3IIOA 2FWOA 1MOEA 1H1ZA 5CEZH 1PJ9A 2DOCA 3O8XD 4LSTL 4XAKD 4OD1L 3MUCA 3HMCA 2ETWA 2AV1A 3LTPA 4MAZA 4BRJA 2QCGA 4KK8D 3JU2A 4OLVL 4RE2A 1AD0B 3PBMA 1BW8A 2GAZB 3T8LA 4AQLA 3H9ZA 1ML0A 3TYUA 4ODXB 1AZUA 1B3XA 4XNZB 3CIQA 2XKSA 3OKEB 3O3AB 1PQZA 3GHTA 4JNYA 4F33B 1Z3RA 1HTIA 2AK4A 1OGTB 5SWSB 3S9ZA 3KTCA 2VM8A 1BXAA 1MI5E 4JJ5B 5C0AA 4XX5A 4KI5C 3K71B 3DJSA 3V5CA 1TZGL 4RA0C 1FLTX 2EH7L 2VITB 1ZA3B 4P3DA 1ZT4B 3CVHA 4XP9H 5HY9A 1JPTL 4R26L 3HS0A 1C9WA 4UTTA 1OP3H 3VRLE 2WMPB 3MKKA 1VAHA 4PRAA 5I1EH 2ADYA 4PJCA 2CBOA 5ICZA 2B4CC 5HYQB 3CYVA 2WMGA 2O55A 2XTLA 2WBJB 5LBSL 3GZOA 1OCOB 3V3WA 3R1GL 3RPDA 1AUSL 3BKJL 2HMID 4XC3L 2XZ9A 1KBGL 3NK3A 6REQB 2GW5A 3OHXB 1ZT7B 4AM0Q 3H3BC 3UA4A 4NBYB 4M48L 2HBVA 1LO3L 1FNAA 2A9NH 1O4UA 4O58H 4MJ5A 1UC5A 4B16A 3W1MA 4B9ZA 4JB9L 2CWRA 1DXIA 3UNDA 1QKZL 5EMYA 3WS6C 2FKPA 3LBMA 4H5SA 4NQXA 3GD6A 2TSYA 2Z8SA 3W7NA 1IXNA 1Q1JH 2H1PL 1UUOA 3RPTA 4TSBH 3QRHA 4X63A 3VZZA 3QFJD 4NJAH 3KLAB 5D7IF 2PCPA 4I4WB 2PCQA 3VNMA 1DJIA 5CJQL 1YHTA 5DJ0B 3K2MC 3CM4A 1HKFA 4XZMX 4BWLA 3P3SA 2ZX9A 3SB0A 1R0MA 3CVIL 1MLBB 4EI5D 3R79A 5HJBA 5SV4A 4NO0A 1TTFA 5H35B 3MT1A 2UZYB 1GVOA 2YD8A 5GGSA 5D7LB 3EDDA 1AW5A 4JRYB 5JQHC 2VLRB 3D9AL 4Z7WF 4QHKI 5D1XE 4XBEH 3RZCC 4Z7VA 2X4QA 4E9TA 4HOZA 1CYXA 1P1VA 4KCTA 5C0EA 1KXTA 1I7UA 2LE9A 5FM5O 3JQOB 5KZ6A 1OAZL 3P4MB 4FJZA 3FMGH 1UWRA 5T26A 5CJXA 4DP2X 5EFFA 4WKFA 5IHZA 1XGUA 4UM9B 3RPMA 5I5MA 1MNUH 3VWJB 4GBXA 3A4AA 1MJ8L 3WLMA 1EO8H 3HZMB 2WYTA 4A2FA 2FFCA 2XZQL 5EOCJ 2EKJA 3DX3A 1SOXA 1UXLA 1BMGA 3HHSA 2AK4D 4J4KA 3BE1H 4EQ2A 4LPUA 3S8FB 4WK2B 1BPVA 3LEXB 5DVNA 1U8KA 4EDXB 3WQ5A 2FJGA 1WWAX 3ESOA 3CDGA 1W80A 1YJDC 5FCSH 2V2WA 2CJUH 2OEJA 1Q9WA 4F8PA 3L9BA 1T7LA 3RJOA 4WUUA 3S8GB 2H3BA 3GVRA 1XIMA 4L1GA 5D1QE 4E41B 4H9YA 2GUOA 3PIQA 2OELA 1XKYA 5I02A 4EX4A 4Y16A 3O81A 4K3JH 1H51A 2QCLA 3QEQA 1AGBA 5GRZA 1DWIM 1OP5H 3CQ0A 2NT0A 3L9EA 2X7WA 1FQ0A 4AEOA 3W86A 1LQ2A 1DVFB 4AEHH 3ABSA 4OD3H 4LSRL 5DMLA 5A6IA 4F0SA 3KNBB 4H20H 5T9BG 3BLOA 4JK0D 3RG6A 4YHPB 1HL5A 1NSJA 3CZFB 2IPGA 1GZJA 1DBBH 3D0LA 1GHRA 1DWFM 1NCJA 4Z7QF 5K4XA 3RGVA 2HFEB 1UWGH 2W88A 3O6CA 3CK0H 1KZQA 1KTKE 3OAUL 5A3ID 3W2JA 4MLJA 2I5YL 3KCPA 2BY0A 3MV11 4FQQA 4FYRA 4NRYA 1U95A 4PUKA 3KVLA 4GRWB 4CNIB 4MS6A 1OYBA 3WJSA 2JIXD 3CJPA 1S3KH 1HKWA 3EWBX 3ULVC 1NFIB 5JDJA 2ZQ0A 2NT1A 3MRHA 3TE9A 1X9LA 3LPFA 4LCIL 4AVIA 2CMRL 3A21A 3DX7B 1FDLH 4IPLA 4XWGL 5HYSB 4D8OA 3SYOA 2DEWX 1Y1DA 3O2DH 2EP6A 1AZ2A 3T0EA 5EZPA 3JV4B 4J2MA 3V6OA 1DSYA 2AEWA 3U8GA 3DYPA 4NO0D 4HNLA 3ZVHB 1GZQB 1ETJA 3TEVA 1OSEA 3QUYC 2C4FU 1EJVC 3SD5A 1ZHNB 4GW5A 2GIYA 1D7KA 3W7CA 3RY4A 4R7DB 1T1ZB 3L5JA 1O5XA 4XUYA 3C2AL 3OGSA 3EWYA 4M43L 2NVCA 1ZJHA 2J7FA 4AQ1B 1Z66A 4HA4A 3SCUA 3TVMD 4XD5A 5DQJA 2OXGA 5C9XA 3L4WA 1E70M 5FJTA 4F92B 4NAMA 3MUUA 4KXCA 3QULB 3ONCA 4MAUL 1EUTA 3L3OC 4IGHA 1YMYA 3L4ZA 5K9CA 4GBXD 3OMZA 3NAAH 4PJ8B 4KCVA 4BKLB 3B9DA 2IFFH 1OG6A 1MRQA 2Y0SA 5LZLA 5EEUA 4YSPA 4YHML 4M61B 4M7JH 4U7SA 1VBGA 3BCFA 1VFHA 4Z3HA 4H8WL 3D4CA 3MRFB 1JZGA 2LTQC 3C5ZC 3H54A 4W9TA 4Y4FA 3VOJA 3LSOB 4XBSA 3SCPA 2CRYA 4W5UA 1I85A 4OCXH 3KDMA 2WZPD 4LVGA 1IAOA 4UC5A 1PZDA 1RHFA 1V0KA 5AW8B 1YIXA 3PWJB 4BH8A 1N7KA 4XTIA 4E8DA 1BVNT 3FQWA 1YLVA 3PWLA 3L5IA 4S1RH 1DVQA 1PNCA 3US1A 5I1HH 3TO4C 2FJFB 5D1XB 2GDVA 4LLWA 2YEZB 5HHQA 3MRQB 1TJHH 1IM9A 2C26A 3X2QB 4YDLB 5CH9A 5JW4R 4E9QA 3QEQD 1RZIB 3QJHB 4YE0A 4J3WA 3DIVA 2E6FA 2PPFA 1E9OA 1QXLA 4OKDA 4UB0H 2IAMC 1MFEH 4AMKH 3WFCH 2ICWA 1NGWB 4ZX6A 2YPIA 5I0DA 2EUZA 1EDQA 4XCNA 1L9OA 3ZTJG 3URQA 4F4RA 3NJKA 4R7JA 4TXVB 4Q7DA 1M7DA 5IEHA 3DJ9A 3SURA 3RGVD 1BJ1J 2PR4H 3RNQB 5JR1H 1G4SA 2CLKA 5DQDL 5LO7A 1TJPA 3RAJH 2UY5A 1WUEA 1WF5A 3FU3A 3B34A 3NVDA 2DSZA 1YNTB 5C09B 3B3BA 3NCWA 2H41A 3MRMB 4LSUL 2BZDA 4UQIM 3IVKA 2PUZA 3BJLA 4IGBA 2DLIA 1EIBA 1W8OA 1E27A 1GYAA 4R6UA 4BV1A 2HZHA 1HHIA 3PY2A 5F9WC 1E4IA 1TG7A 2BFGA 4HMNA 1NBCA 5D1QB 1C12B 5CGMA 3U3HA 1KGIA 3PQYB 1UZ1A 4EDWH 3P30L 4FQCL 3DBXB 5FEPA 2BOBA 4NFCA 4WHDA 2GQAA 1LZOA 4YEFA 3GSNL 4HGKC 1KDJA 5DRZA 1E9PA 2CLVB 2O6CA 3ZY7A 4NZDA 1UXMA 1KM1A 4GW1A 2EO9A 4JDTH 1RLDA 4GYPC 3QIBA 2CDEA 4IRSA 1Y5VA 3ZT6A 2QUTA 3BXWA 3L3IB 1JHKH 4DCQA 4QOKD 3GHBL 4DPCX 4R2GD 4B91A 4N20A 4YQXH 4L80A 3RFAA 1GUVA 3P9WB 4RNRB 4H13C 4PRHB 4C5YA 5HBFA 4ZTPH 3I6KB 1QFEA 2ZDRA 4OKVB 3KPOB 5EF2A 4LRSA 4ODUB 2WINA 4ODHH 4PJFE 2APFA 3HVNA 3D3FA 1CDJA 2B5IB 2VEKA 3LPGA 2YBRA 1UACL 1R6VA 3ARBA 1OXYA 4Y4FD 1WAAF 2VLJA 3QR0A 3WNIA 3O0LA 4ZO9A 1N0LB 4H2AA 4J1OA 1ZMYA 2XN0A 2YL6A 2AC0A 4D72A 4AH2B 4IYKA 3LNIA 3VYPA 1I8KB 4O13A 4Y89A 4S3DA 2EUXA 2V8MA 5HHXH 1HWWA 1TPVA 2WVVB 3GO1L 3VRIA 5L0QB 4TMCA 1SRDA 5DY2A 2WTRA 5BXRA 5IQMA 1ZT1A 2IH3A 1VDGA 4Q6XA 1UROA 1P4UA 3U9PL 3V8OA 2XG9A 5CZXD 1K8XA 3BVUA 5FXCH 3SDXB 4X4XB 3CUHA 4TL4A 1HHGB 3P11L 2N56A 3AMLA 4PJDA 4AV5A 3V5KB 2O5XL 1XIWB 4HYVA 1KJ2A 1RZQA 1T66C 3QS3A 1XF3A 1E9IA 4FFYL 2FD6H 3V4VA 4R9HA 1W8SA 4OQ1A 5J6HA 2X7LA 4FADA 1QFWL 4IM8A 1GQJA 1GAFL 4L05A 3LS4H 3OD3A 3UGEA 3INUH 1G6RL 2O1AA 4XCCH 3SE4A 2WLNA 1QA9B 3PFRA 1R9ZA 2A3AA 1N70A 4NZRH 1WCBA 1N8ZB 4YO0A 3ATBA 1KPRA 1BD2A 5HANA 1G5GA 2WSPA 1PPIA 1JYXA 3S5ZA 3H8AA 4AENA 4XVUC 4UV7H 1GTFA 5CEZE 4UTUA 2ZWZA 4NQSB 4KDVA 3RWGB 2XH0A 5LAXB 1SMDA 3GH5A 2E3VA 1QUPA 3WUZA 2VEIA 3TC3A 4ETQA 1JCMP 1H9VA 2FB3A 1VZIA 2CGYA 4WTWA 2QZ5A 3TJEH 2NQHA 3D0VB 1A5NC 1GKEA 1BQUA 3R06A 4XZ9A 4NKIH 4A1RA 1KQYA 3LHYA 2J8HA 4IRSD 1WP6A 4G8GE 4Y4KA 2RH9A 2C9QA 1ISYA 5C08A 4ES8A 3POCA 5CIPB 3CV6A 2G9HB 5JIMA 2WJ5A 4QHUA 1X5KA 2B3RA 5FYJU 2IPFA 3BAEH 4UI2A 3Q6GL 3GSRB 1FVCA 1CFNB 5C0RH 3GHEL 2BC4B 3Q2WA 4LPXA 4X7SL 2HKAA 3NO3A 3IU3B 1YY8B 3BARA 3DHDA 3WLOA 1HYSC 2XKNA 1CF8L 5EC1A 1A1NB 3ITLA 4A8NA 3WJYA 4PRBB 1L7TH 2XG4A 5BV7B 2IKIA 1SEBA 2C1GA 1TPFA 3WQEA 1IAIH 1E4NA 2V7NB 2PDCA 4FNQA 1UTDA 3RIFF 5E9NA 1E6XM 3VDBA 2DLHA 3SR7A 1IWAA 5GZNC 1FH5H 2HFTA 4N2EA 4TUOA 2BZ7A 2X1QA 4GKZB 3KM2A 1FFRA 5HDRA 2P3EA 4DF1A 1GYVA 4B7LA 4ONVA 4ZSOE 3WJLC 1LQAA 4LLVA 3EOOA 5FCUH 1X5HA 1OGBA 3SKOA 3KP0A 3ZRSA 4LGRB 2C9RA 4TVPL 3GLDA 3UBGA 15C8L 2XFFA 3MAWA 2JH2A 4Z23A 4FX7A 3WO8A 1V51A 1NBZA 5DJAB 3BP5A 2VW4A 3T4AA 2QADD 4ONGL 4I77L 1TZIB 4XO3A 5D2LE 4HCDA 3V55A 2WN3A 5E93A 2XXCB 4LARL 3PVFA 1Q65A 3DUUA 4W9ZA 4DWSB 5TIMA 4F7TB 2DBJA 2VC7A 2I9LB 1I8IA 2J4WH 2NSMA 5J1SC 4M7KH 4PJFB 3ZL1A 4QXUL 4WWPA 3JV6B 1FNHA 2VN5A 2HMCA 5M95B 1JCLA 1IWPA 3MRJB 3V6ZB 1JFQH 1SZGA 5FYJH 4AZBA 4I89A 3RKDD 3MPCA 1J1PL 2OMXA 3TOYA 1EFXD 4MZYA 2O4EA 5KZMA 3JTTA 1MY7A 5KWYC 1N9PA 5D55A 4FQ1H 3ZUNC 5FOBA 1E6NA 4OLXH 3GMRB 4O5LL 5A16A 4MA8L 3W1RA 4XPTH 3SCMB 3IJHA 3LGGA 2L7UA 4Q2ZA 3SDCC 4YR6B 3PBYA 3PB2A 2XIJA 3EFOA 3PWAA 5JXEA 2QPDB 2C9UA 2Y63A 3F12B 3RX9A 2BNQA 3IIVA 1J9QA 3QHOA 4J39A 1P0NA 5A7EA 1E5NA 4Z7VF 1FAIL 2IMRA 1ZDSA 2BP1A 2Q86B 3T0TA 4F57H 3RL1A 3OF6A 4LAZA 3SJNA 3ILPB 3KGTA 4I8DA 1OB0A 3MRGB 3SUUA 2X1OA 2QGDA 3HIJA 4UR9A 4WI8A 2W5PA 3WLHA 1ZANL 5HSFA 5KBLA 1X39A 2HH0L 3GM8A 4ZW7A 3WD2A 2BSSA 4NPYB 3TT3H 2YPLD 3UJJH 1Q13A 5A6KA 3ZL4L 2CALA 4MVAA 1EDGA 4HCLA 1R24A 4B3LA 3UROR 1MREH 4XXCA 1WBYB 5DBUA 2OX5A 3IN2A 1IGFL 5I30L 4RZCA 3GH4A 3WAKA 1JI1A 1I3GL 3AY4A 4X7FC 3UXFA 4MADA 5F7DA 3TR2A 4ORGB 3WLNA 2VOMA 3A9BA 4UDUB 1G7MB 4KCUA 1P7QD 3KAAA 4HETA 3KG5A 5J11B 1AACA 1DWGM 1KXQE 2XCMC 1NAKH 3GRWL 5EHFA 4DEPC 3PL6B 1HTYA 4OLYL 1PSKL 1NAL1 3D2UA 4QROA 4QRUB 3TMQA 4YU1A 4DAGH 4N68A 1EO7A 4HPOH 3LQAL 1A6ZB 1QYGL 3W5MA 4FR6A 1KBLA 3HAEH 2W81C 1OG0A 4EAMA 2F53E 1E4JA 3Q9PA 5EUOA 2OK0L 4QDMA 2R69A 1H19A 4A2DA 3HNTL 3P81A 5LG6A 1I9RH 1M1XA 3VFCA 2X53A 1BTMA 3D12B 4E68A 1QW7A 1SJXA 1CU4H 4U2YA 1EZLA 4KT2A 1XR9A 3N43B 4QRSB 1AQKL 1GL4B 3TQ0A 1MCEA 3LN9A 1TTJA 4F7CA 3FTUA 2NDGA 4LAUA 5B38G 4NSKA 2XYBA 1XR8B 1ZENA 1URLA 4WEUD 3EBGA 4B9IA 5SX5K 2NUPB 3V5HA 3HC3L 4MDIB 4HHWA 1I7RA 3CN4A 1FNGA 4Z5RB 2E1DA 3OB8A 1PO9A 3G5YB 4ZSOB 2B1OA 3S1WA 1ZLSL 1MRCH 1D5MB 5I8OL 1IGMH 4HKXB 4RZKA 1SMAA 4NHCL 2JJWA 5JXED 5F44A 1F9CA 1PZUB 4JRLA 2B4GA 4GISA 1DSFL 1Q85A 1RXOB 2BNQD 2RH0A 1UD5A 3RYMA 4PFEA 4AVNA 2ICSA 5D2LB 5I1DA 1S7WA 3AISA 3ARUA 4ABUA 3R11A 3GZKA 3U0PB 4LBEA 1BZOA 4JLRB 2QVIA 5IVZB 2QQKH 3CC5B 4KC3B 1I4FB 3DBPA 2C1PA 4M56A 2L04A 3ESNA 4KTGA 2XZAH 4DQOH 3WN5B 5DCCA 3B97A 4GNVA 5GNXA 3I4KA 1FUYA 1EXGA 1NCBH 1HQTA 3HPSA 5INCA 3O16A 4AL8L 3KWUA 4C56E 2A74C 4K4KA 2EE6A 1X3DA 4DOHE 4HJIA 4JHZA 1QOPA 2VH5L 2PPCA 4ZRGA 4EUPG 1JN6B 4KETA 3RCMA 3VX1A 3IT8D 2IXQA 1N68A 3DCPA 4XHJC 1DVJA 4EF9A 1KJVB 3KHOA 2Z1WA 1PDYA 3LAFA 3QW3A 4MWFB 2PC8A 2PODA 3ARGC 2HJKB 2YA2A 5L9DH 1ZKAA 1BWWA 2GOUA 2EE9A 3SKMA 3JZ7A 3SPCA 3EWDA 3KW7A 2CLOA 3C75A 2PTYA 5JOEA 4ELMA 3NQKA 3QIUA 4JRXA 1EHKB 1Z9SB 4HHAA 3D2UD 4FXKA 4JO1H 4YHLH 4PJ9A 2GCYA 3BLKA 5C0QA 3W3OA 3W39B 1TJGL 2JXMB 3RX7A 1HXKA 1H62A 1RLCL 1AYRA 4G6FB 1W56A 3G6DH 3LZRA 3S5LA 2HVBA 4Q97A 3FB8B 3GHUA 1UOLA 4ZDHB 5HQEA 1S7XA 1TMQA 3NIGE 1ZHLA 4PRPE 1A0EA 2DQDL 3UZVB 1X6UA 43CAA 2OTWA 2M8XA 2VB5A 5AG8A 1HIZA 2W60A 3V7PA 2YDSA 5D4JA 4QQ3A 1WB0A 1HINH 4AG4H 3QZEA 3AIQA 1GOFA 2ATMA 1C8YA 5EU5B 1T4KB 3B8IA 1FH8A 3I68A 2B59A 4S3EA 2OL3L 2IV8A 1TU2B 2ZG2A 4S1QH 5C6TL 4TUJB 4RSYA 4NZTH 3JUZA 1IJNA 4AQAB 4XNUL 3TOPA 2HPIA 1IEQA 3FQRB 1R3TA 3EYPA 1TTCA 4XISA 4B9KC 4XXDB 5H8UA 3X1EA 1WA1X 3C60A 2NY3D 1JZHA 5KUMA 1JGDB 4UTBL 4D6EA 3GMMB 1F90L 5BO0D 1HHHA 4IJBA 2DQ6A 2Y7QB 2C3ZA 3VE0B 2O92A 4BUQA 3HC0A 3RVWC 1UMLA 6FABL 2AL2A 1KG0A 3SCSA 3RN6A 1Z3NA 3LRHA 2F53B 3A4DA 3MA8A 2RFXB 1SQMA 3MBEB 5B38A 1B88A 5EPMA 3QKEA 4X22A 3EMZA 3IIXA 4JDZB 4PODA 1Z7AA 2P53A 3STFA 1U91B 3WFLA 2IPKB 5F1OB 4Y9OA 2X1SA 2M83A 1JL8A 4KKRA 4LCYA 4XIMA 1Z9PA 3VXRA 3CPRA 4XP4L 2W27A 1B30A 2EDXA 1N59B 8CGTA 1LP9F 5H94B 3TCTA 3BSMA 1EEPA 2ADJB 3LKNA 1G9MH 1EA0A 3N9KA 3L3HA 5LGXA 4U1MA 2CKBH 2ZOOA 5FW6A 3VXQA 1H60A 2WMJA 2YRZA 4CEXC 1DVSA 2F2KA 1KCVH 4F9JA 3MOAH 4M3JA 2W6RA 1ISZA 4XCEA 4DX3A 3NOEA 1I1YB 1FGVH 4GS7B 3ME0B 1Q3NA 2X0SA 5KVFH 3LI0A 1EAJA 1A7BA 2RGMA 2P3ZA 3KBEA 4JY8A 4FNRA 3N85H 2YC1B 4G8IB 2BHYA 3DXAB 1BAFL 4ZFFB 3L7EA 4CD4A 1OANA 2KS0A 3QHZL 2J6EL 3NL2A 4DPBX 2P42B 1AZCA 2J7LA 1EC9A 4EUPA 2FVLA 4KRLB 1FO0A 4K9JA 5JHBA 4QG9A 2K9FB 4WK9A 3G6JE 4GACA 1PB0A 1NGPH 3GS4A 4Z76B 1BWMA 3LKRB 4DOHB 4JHAH 3ZGIA 3MLXH 1ZHBA 5CD3A 2VR9A 4GKSA 4AZCA 2BVWA 1LO4L 2NW2A 2C3VB 4YFEA 4IMAA 3IDMB 2HTKD 3RX2A 5D8ZA 2AGTA 4YAQB 4PUBH 5LXVA 2WPGA 2BVPB 4JPKH 1GZGA 5TQ0H 2MTPA 5C0ND 2VRAA 2HA1A 3UDWA 5DO8A 3H7BB 4FCAA 4O10A 2WV8A 4X6EA 2BDNL 3IVTA 1VHPA 3T4YB 2XJ7A 4IG2B 4RGND 3C8KB 4I5UA 3UT0A 3SCWA 4X99B 1SOQA 5FKPB 5C0JB 1L6ZA 3GC4A 5F4SA 5INDA 1MQKH 4YSQA 3W56A 3A4XA 1A7QH 4RDQF 5FL1A 1T3FA 1RVFL 1Z6JT 1XF4A 2E56A 5AG9A 4NWTL 3UTZB 1GJIA 4JG5A 3PV7A 4OT7A 2V3GA 1XC6A 3CX2A 2A3HA 1PIGA 3BMXA 4N8UA 3ILDA 2FVKA 4Y88A 1WVZA 2A6IA 4DGUA 3MC5A 1J8SA 3QHFH 3NIGB 1QZ1A 4PRPB 1ZNNA 2LU7A 5AZUA 4AWSA 1UB5A 1VFBB 3CFDA 3Q1SH 3MSGA 1M56B 1F3DJ 5EBLB 1MIML 1W3LA 3VXRD 3ULUH 2CAKA 1E9QA 3LQMA 4QRTA 4EBQH 5E5UB 4OLUH 3EYSL 4UT9H 1Z44A 3MW7A 4PCNA 2VUYA 1X97A 1QEXA 4L8DA 1BQKA 2YHGA 4NOBA 1IBHA 2ZSVA 3M8OL 4S2CA 5AYUL 3JBG7 4NZJA 5HATA 4NYLA 2X4PB 1OTTC 1O1ZA 3AROA 2HUEA 1OAXL 2FDSA 4P7NA 4J3OH 4U1KB 4B5UA 5CEXB 3CQKA 4UOW1 5K93A 4O1FA 4BSVA 3DGDA 1LE5B 4JFVA 3GSWA 1MQRA 1DEEB 2YR3A 3HMXH 5BRQA 3MOQA 1SZNA 2BINA 2E9GA 3P60A 4HUUB 2VEMA 1P5BA 5E2TL 5IVXA 3CXHJ 3VI3A 1F4YH 4R4NC 4BGDA 2VDKB 2HSIA 4W4QA 1C91A 1XLEA 1DOSA 1R5VB 2ED8A 1IEXA 4P5UA 5IJDC 3RUGA 5CZVL 5GS2D 2NW3A 3QQ4A 2ZCKL 1KGCD 4DJFD 2C0HA 5FYJE 4YSAA 1I8JA 1RPQA 4JN6