1KTBA

The structure of alpha-n-acetylgalactosaminidase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
388
structure length
388
Chain Sequence
LENGLARTPPMGWLAWERFRCNVNCREDPRQCISEMLFMEMADRIAEDGWRELGYKYINIDDCWAAKQRDAEGRLVPDPERFPRGIKALADYVHARGLKLGIYGDLGRLTCGGYPGTTLDRVEQDAQTFAEWGVDMLKLDGCYSSGKEQAQGYPQMARALNATGRPIVYSCSWPAYQGGLPPKVNYTLLGEICNLWRNYDDIQDSWDSVLSIVDWFFTNQDVLQPFAGPGHWNDPDMLIIGNFGLSYEQSRSQMALWTIMAAPLLMSTDLRTISPSAKKILQNRLMIQINQDPLGIQGRRIIKEGSHIEVFLRPLSQAASALVFFSRRTDMPFRYTTSLAKLGFPMGAAYEVQDVYSGKIISGLKTGDNFTVIINPSGVVMWYLCPKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-N-acetylgalactosaminidase
publication title The 1.9 A structure of alpha-N-acetylgalactosaminidase: molecular basis of glycosidase deficiency diseases
pubmed doi rcsb
source organism Gallus gallus
molecule tags Hydrolase
total genus 139
structure length 388
sequence length 388
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2002-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1ktbA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ktbA01
1UOKA 5FF4A 1H1ZA 2V8ZA 3LCWA 1GTEA 2VFDA 4K38A 4JTSA 5AC7A 1UASA 1VCVA 1IZKA 2FHFA 1VB9A 2ZXQA 1CXFA 1TPUA 3GKFA 2ZUVA 4UQ9A 1AW1A 2E9BA 4DF0A 4UTKA 5I23A 3WY1A 1LTDA 2RKXA 4N6FA 1F2JA 2TSYA 2FDSA 1HVXA 1RP8A 3W86A 1TCMA 2WSKA 3CEPA 3GAKA 3O15A 5A8GA 3ECQA 2QDGA 3G0SA 3B0UX 3FJLA 2ZX7A 1HL2A 1ZENA 2ZRZA 3LTSA 4X9SA 3ZWTA 1RPKA 2EKCA 4HNVA 2D3LA 2E8YA 3T40A 1E43A 4D2JA 4Q4KA 3BLPX 2E5BA 4CNNA 4IJBA 2HMCA 1O95A 1TSIA 1OX5A 3NZRA 3MI6A 1IIGA 2NV2A 3W7QA 1JG9A 2F7FA 3M07A 2X30A 5HMSA 4EVZA 3VGEA 2F7QA 2Y88A 5AHLA 3BAYA 1TTQA 4PL1A 3BVJA 2WNQA 1YLVA 3A21A 1KFKA 3DI1A 2ISSA 1ALDA 2QPSA 2C6QA 4WXYA 2GUYA 1GG0A 2ZXAA 3OLEA 3HO8A 3N19B 1KB3A 4AYSA 2X1UA 2ZWZA 1WO2A 1MEIA 4MY8A 4FIQA 5U4NA 5DFAA 3Q58A 3FS2A 3MBFA 2FIQA 1RVGA 5BOOA 2ZA3A 1Q45A 3BG5A 2D73A 2YFOA 4UMBA 3D50A 2YGYA 3TXVA 3CHVA 2E6YA 1WPCA 2E77A 3VGGA 4LS0A 1DJNA 2E4TA 1YXYA 4LVBA 4OHQA 4FNSA 1XCFA 3VNYA 3L9CA 3HOJA 3EWYA 4OU1A 3FAWA 4LRSA 3DX3A 3VGBA 3N3MA 1MXGA 1XL9A 3F4WA 3K1DA 2RFGA 3TDFA 1DTUA 4DO4A 2NWSA 1CXKA 1R75A 1CX9A 1VYSX 2CLEA 5HR6A 2CZEA 1OT1A 1LOQA 2C3ZA 1ZJBA 4RKAA 3DFOA 1VIWA 1LRQA 3IV3A 2HS8A 4UNIA 5TQLA 4N9BA 1D3HA 2WNWA 2WSPA 3DKJA 4HHPA 3P74A 4LS1A 3TX9A 3E12A 3TH6A 1SO6A 1VRDA 1G94A 2V0TA 8TIMA 3TUUA 5CZJA 5FEXA 3HG4A 1QI5A 4N9EA 2NV1A 1PVNA 4IQLA 4IPJA 3STFA 2G3MA 4LOCA 4JY8A 1XC4A 2ZZ5A 1XSJA 5KINA 2ZYFA 3OBKA 4JTJA 4RCXA 1W3TA 1A5CA 1JI1A 1YTEA 3NPVA 3ABSA 1R30A 1QI3A 3KRUA 2C15A 3B0PA 4FLQA 4OIFA 1VYPX 4CLMA 5LNVA 1H51A 7TAAA 1HG3A 3W37A 1B3OA 4UTTA 2Y2WA 4X3ZA 4O10A 1QO5A 1FWSA 1KBBA 2QCLA 4UTHA 2Y24A 2CLIA 4E0CA 3SGZA 1VLWA 2ZCGA 1UH3A 1H61A 3WEOA 1K02A 1NFBA 1XH0A 4NX0A 2V9DA 1PL9A 2ZFAA 4S2BA 1R34A 3DU0A 2XN0A 5EY5A 1KWKA 4IMDA 5HJLA 4UTUA 4UUIA 2O7SA 1PCWA 3FW6A 1XGZA 3HGJA 4U33A 2HTMA 3E96A 3HIJA 1QOQA 1EUAA 1UCWA 4JTHA 4CQ8A 2EF9A 3MI2A 1AL7A 3UYCA 2Z6JA 1TPEA 5G1TA 3FEMA 4OQVA 2F2HA 3OVQA 3L2MA 3IIPA 3CTTA 3M16A 1WOAA 5SWUA 2GVLA 2WJZA 5F2GA 1L9WA 4BK9A 1TYGA 1CGTA 1P4CA 1BTMA 5CGQA 5MHBA 1I45A 1KTNA 2GUUA 4JL1A 1TV7A 4HP5A 2ZXBA 4OT7A 3WK0A 3UERA 4NZFA 3TU9A 2ABAA 4JR5A 4UQCA 3Q94A 3WK1A 1SW3A 1W56A 1VJIA 2Y63A 3M5VA 3QMRA 4LY8A 4ZMGA 4O14A 2V3EA 2WKJA 1KV8A 5KMYA 3LCXA 2ZA2A 3W1AA 1DEDA 4H3DA 5I3GA 1HXKA 3DDGA 3EJPA 1HUVA 1PHQA 1V7YA 2CZFA 1UKTA 3VMPA 3PBWA 4I9AA 3NQDA 2B7QA 3C2OA 2BY0A 3TMQA 1M5WA 1HL9A 4JL2A 4HA1A 1FX6A 2FPVA 4WSJA 1QW8A 3WY4A 1I75A 4WJEA 4JNMA 1TQUA 4O28A 1OFPA 2EAEA 3WDHA 1XDLA 3PUEA 1SO5A 3WK2A 1T8XA 1SSGA 4HNUA 4GWEA 3IGUA 4O4VA 2CU0A 3BC9A 4B9ZA 1MXSA 3W7MA 3CB8A 4UFKA 3W76A 1A50A 1P6WA 2XVKA 4FNTA 4LC8A 3W7OA 2YA1A 3INPA 4AF0A 1LWJA 2GVGA 1FCVA 4O12A 1W5MA 3PSWA 3UWZA 4JD4A 4MIMA 3PBVA 2DP3A 4BFAA 4CCDA 3M6YA 1N8FA 1LLWA 2YYTA 4RV8A 4AF0B 4IMCA 4HKPA 2PWDA 3UCQA 1CI1A 1TMHA 2G97A 1OK4A 2PRMA 3PVFA 1PS3A 5F1UA 5CPMA 5I5RA 1KFEA 3GXMA 3C0JA 3KFTA 1EO7A 2TPSA 2GJLA 1KXTA 5HDRA 3DHDA 4QNEA 5HUPA 2VUYA 5CZ0A 1MW0A 3ZR6A 2P10A 1LM1A 3PUDA 2QUTA 5BRPA 3QPZA 3LXBA 4POCA 2CW6A 2ZRYA 5AYZA 4UCGA 3FKKA 4O1AA 1NVMA 3S5NA 3QSRA 4NXKA 1GYLA 3NVTA 2DZUA 5CZTA 3SJ3A 5D02A 4UTIA 3C61A 4MVAA 3CWNA 4HSOA 1ICSA 1PHWA 4NJHA 4AEEA 3USBA 4O11A 1DJQA 1WXJA 3MW7A 3MYPA 3W7RA 5EMUA 2ZZ1A 4LPCA 3BPWA 1ZCOA 2NWRA 2GOUA 3B04A 1RQBA 2JGQA 4ADTA 1CGVA 4FMVA 3EDDA 3M0ZA 3L5MA 3A24A 4ML9A 1YXDA 3BSHA 1LWHA 2FTPA 2BHYA 4QISA 3DX0A 2JKPA 3A22A 2I1OA 3TQ0A 2CLKA 3FJ6A 3I65A 3PUOA 1SQ7A 4K8EA 4RZ4A 3KVMA 3D51A 1VH7A 3EEGA 5D38A 3PG9A 3KAOA 1P0NA 1JQVA 1TQSA 1A53A 3PAJA 3G1HA 4Y6GA 3BAXA 2BY1A 4FLOA 1CXEA 4PODA 5HQEA 3T44A 1AK5A 3W7CA 4UR7A 1NF0A 1TPB1 3CU2A 1YDNA 3BVWA 3BLIA 2ZRVA 2XWEA 3IJ9A 1QDSA 3HQ1A 3ABRA 1L6SA 3S2CA 2IQTA 1X1OA 2Y61A 3M9YA 1OFAA 3TC6A 2CPUA 5D04C 4RLIA 3U2OA 5LHEA 2YIHA 3LGEA 1ZALA 1TRIA 2FYVA 1BG9A 4GRSA 5FF7A 4RJEA 3TJXA 5A2CA 4N9CA 3DENA 4GJ1A 3L4WA 4DEFA 2WVUA 2ZUWA 4WF7A 1JUKA 3N2MA 1Q6QA 4O0KA 3RIKA 4ONVA 3STCA 3K8MA 2J25A 2FH6A 3DX4A 4WLCA 3IEBA 4NX5A 1W5OA 2Q8ZA 3W87A 4A21A 4BI6A 4JFUA 4QAWA 1JL8A 3OEXA 4GE8A 1HX0A 5K9CA 4MKNA 6TAAA 4NI3A 3MYOA 5D2XA 2TAAA 4GKLA 2QV4A 3OLIA 4IX0A 4RR4A 1IIHA 2FHCA 5DXYA 5G2HA 3WJXA 4AIEA 2QCCA 2J9YA 3TSMA 1W54A 2LLEA 4JEQA 1JF6A 3GLCA 3GBEA 1JR1A 1KGWA 1RV8A 3STGA 1DQWA 3W7GA 3H54A 1TJRA 3HMJG 2DIEA 3ELFA 3FOKA 3R12A 4PEEA 3ABOA 4B5NA 2BWGA 5E70A 2ZXDA 2GQ9A 3R13A 4N6EA 2A6NA 1SU5A 1K8ZA 3I7QA 1JRBA 3P80A 2YW3A 1SUXA 3SFKA 3W9ZA 3B8DA 3FYPA 3HPZA 4UMCA 4NZJA 1ZAJA 1AW5A 1M7OA 1ZJIA 3G1XA 2OW7A 2VRKA 1UKSA 1SSDA 4EWND 1LYXA 1GOXA 3PBYA 4H7VA 2EAWA 4QAIA 3HG5A 3RF9A 1SO4A 1PS9A 5I0DA 1E3ZA 1H7OA 3LI1A 3BCFA 3TMLA 3TROA 1SZFA 1S46A 1D9EA 3VX1A 3LBMA 1H60A 2OCZA 5FEZA 4JFVA 1TPWA 1KM2A 1UB3A 1H63A 4X9YA 2FQIA 3BUPA 1JUBA 4NJKA 4C1LA 3TFXA 3KVJA 1IZJA 3KL0A 3QW3A 3UG5A 3GDRA 4GI6A 4JIPA 1QWUA 1ZJAA 5D2WA 2B0MA 1L6WA 1QFEA 1WAUA 1KBKA 2NLIA 3RK8A 2WC7A 1LORA 4UCFA 5I3JA 3CM4A 4GI9A 2F1BA 5G5IA 3WY2A 4J3XA 2YCEA 3S0CA 1FDJA 4GUJA 4FX6M 2WPGA 3KWXA 1SFJA 5I24A 3VFLA 3WJSA 3LTPA 5EBUA 9CGTA 3NPXA 3RLUA 3P5ZA 2OW6A 2PE4A 1XV8A 5K9XA 1BWKA 3P5YA 3MI3A 1KM1A 1E3XA 2YXGA 1XD1A 2WKGA 2VFHA 2WSQA 1Z44A 5AYXA 5IBXC 1QCWA 1N7KA 2Q3RA 3DZ1A 4JX5A 4LS2A 1YDOA 3BW4A 3W1NA 5E0FA 5CKSA 2CLOA 2ZICA 1YDVA 4FX7A 2J24A 4UTJA 3SGUA 3RNDA 1KTCA 3NQMA 4UFLA 1TB3A 3EKZA 3DHPA 3FKRA 4LNYA 4N02A 5EKYA 1OFDA 4PFMA 1UD3A 2VEPA 4MFDA 2YZRA 1CIUA 3L21A 3WJZA 7TIMA 3BLBA 1G7VA 4WOQA 2Z2UA 4IMEA 3ZR5A 2B4GA 1G4TA 1QHPA 1NF7A 1QR7A 1O7DC 1WBJA 1IV8A 3SY5A 3DFSA 1XUZA 3BV4A 4J3VA 5AHIA 5CZSA 1YTDA 3IRDA 3CQ0A 3TXZA 3NQ6A 1PPIA 2V3DA 2OYLA 2A21A 5DO8A 1B0IA 1EPXA 3UEQA 4K7YA 4GUHA 1IXQA 2CLLA 1LCOA 3D52A 3BLFA 5F2MA 4I7VA 4J9JA 1SW0A 3S1UA 3NQAA 3WFZA 1U33A 1TQVA 1SO3A 1VCFA 1GVFA 1GVQA 1FXPA 3NDOA 1PIGA 3O63A 3KVLA 5KZEA 4AHQA 2PC4A 4IXHA 3W1UA 2VC6A 4KFPA 3M44A 1T96A 3I68A 3P8JA 3LCLA 2Y85A 4O54A 4GXMA 5F2IA 1U30A 2BTMA 4O1BA 4E2BA 1XFBA 5LSMA 2VFFA 4PSRA 1P0KA 5BRQA 5J5DA 4J3SA 3KL3A 1ME9A 1RPXA 1LBFA 5E6ZA 3N14A 4ZL1A 4DELA 4XQ6A 4ZQCA 2ZZ4A 2XVLA 5TIMA 2OSWA 4R53A 3LB0A 3UXDA 1MW1A 1JXKA 5A6LA 2DIJA 1I2OA 2QCDB 3BW2A 5G2IA 3GDLA 2F18A 1HL8A 3TR2A 1OJXA 5FF2A 4JFTA 3A9IA 4AWUA 3UPBA 4CNOA 1W0MA 2NX9A 2JGYA 3W7IA 2EJ1A 4DO5A 3CWOX 1G7UA 1KW1A 4LT9A 1TREA 1BLIA 3S5ZA 2E5DA 4FXRA 1J0KA 1JI2A 2PWEA 3BMWA 5CLWA 1GT8A 3U6WA 1TPC1 3V1PA 3NXFA 4QNWA 3PC0A 1CGWA 4WSKA 2V5LA 4ORIA 3L4YA 2YYUA 3VCRA 4Z1DA 2DH2A 4UZUA 4UQBA 4MB1A 3NOEA 1VAHA 4WUIA 5DN1A 1J0HA 4K36A 2A0NA 1JAEA 3EJRA 1QWGA 1SZGA 3NL6A 3TAOA 3DHUA 3L66A 4WD0A 1XBZA 2Y62A 4KWUA 2RDTA 2WANA 3W7NA 3DAQA 4UZSA 3NZ1A 3TTYA 4Z1AA 4U2ZA 1YXCA 2RDWA 3W7DA 2PWGA 3BLKA 1G67A 1BVZA 3DX2A 1CW2A 3EJUA 1TIMA 5D32A 5FF0A 5D30A 5E93A 2X2IA 1SFLA 3GXDA 1DHPA 3L0KA 3W71A 1UH2A 4FNQA 5F1VA 2G3NA 4MOZA 3L2LA 4JFSA 5GVJA 3LHVA 3MP3A 1CXIA 4CKQA 1VS1A 4O13A 4LUIA 3EX3A 4PC8A 5DY3A 3RMJA 3BAJA 3VM5A 4QITA 1MEHA 3G18A 1GVSA 3O06A 3CIWA 1XD0A 5HWMA 4L4MA 1LRNA 3M47A 3QYQA 2ZTKA 4R33A 2QAPA 5AC6A 3PULA 5LGXA 2BHZA 4DQWA 1GPWA 4HNTA 1T99A 1W3NA 1S3HA 2ZUUA 3GNNA 3SECA 3TSBA 4UFHA 3LOTA 3FYOA 4H8VA 2QCHA 1OFQA 4PH6A 4AMWA 4JS3A 1TRDA 1CXLA 1LRTA 2XVGA 2DZWA 2X1SA 2BZNA 2O7QA 3SZ8A 4IOTA 4AMAA 1QAPA 3T55A 2DJXA 3BH4A 3GXPA 1HTYA 3IJ8A 1G4SA 1J0JA 2DZPA 3NQ8A 1F73A 1XBVA 3GXNA 3PWAA 1UD6A 2I9EA 4FLSA 1XM3A 2E1DA 1BVNP 5KZMA 5G4EA 2F7OA 3PG8A 3SSJA 1NSJA 2R94A 1W9XA 3CZNA 4OGZA 5T26A 3VSVA 3GVGA 3DKLA 1X8FA 3QGVA 1NAL1 1TTJA 2QCEA 3KHJA 3LPPA 4L4LA 1Q6OA 4MAZA 2NT0A 2WNNA 4S1FA 2QJGA 3GZ3A 3O6DA 3UD6A 3G1YA 3IIZA 3W70A 4H8UA 3AJ7A 4AYGA 3BAWA 3HB9A 3NPUA 3S5OA 1UD5A 3LPOA 3NGJA 3IIOA 4UIOA 3W85A 3L4ZA 3JRKA 1XCWA 3ZS4A 1RQHA 4MYAA 3H55A 3E9AA 3KRZA 4M6VA 2D0GA 1SMDA 1UD8A 4DF1A 5HUOA 3TTSA 3QMTA 1KTBA 1M7PA 2FJKA 2Z0IA 3O05A 4CQ9A 5F4WA 1KV5A 3G0XA 3MHGA 3LV6A 3SW6A 2CZDA 1HNYA 3PB2A 4BR1A 2QCGA 2QUVA 1JDDA 1GVOA 3A5FA 3IVUA 3C2VA 5D09A 2NUYA 4FNRA 1Z32X 2QCNA 2C18A 2QR6A 3NQFA 3M5XA 3WNOA 3CTLA 3IIXA 3LLFA 3GR8A 2H8ZA 4MLRA 3AMKA 1ICPA 2ZWYA 3C52A 4Z08A 1DQXA 1XXXA 3LXCA 5KTLA 2ZE0A 1HO4A 4QQ3A 3HG2A 4H2CA 4YMZA 3KRSA 3FA5A 3T78A 5E0KA 3RLVA 5K9DA 4LQ1A 4KWVA 1WV2A 2C19A 1J2WA 4NVTA 3EDEA 3WNKA 3NQ2A 3N9SA 1BKSA 3WK3A 4BI7A 3NM1A 2E6DA 3WNPA 4CN4A 4GBUA 5EA9A 1F74A 1UUOA 3BMVA 1GWJA 3TK7A 3G3DA 3PF3A 4J27A 2FPYA 1P5BA 3GIYA 4AHOA 3BUIA 1OFRA 1Z48A 4GQQA 2ZTJA 1U2YA 1ADOA 1F76A 3EXTA 2ZX6A 4ZQRA 3WFAA 4MYXA 3EWZA 2A4AA 4Z0SA 3LRLA 3C4UA 1BAGA 1AQHA 3VMOA 1TPVA 1O5XA 4G1KA 5DCDA 1TPFA 4XKYB 2CFFA 3ZWSA 1GQNA 3TFCA 3K30A 1ZFJA 3OVRA 1GEQA 4AVFA 5AHMA 3BGGA 2RDUA 4OWGA 1OG0A 2PRLA 3L5LA 4HN4A 3BLEA 3ZR4A 3WELA 4LXFA 3VGFA 4GI8A 5E1QA 1HWWA 3UZ5A 3LDVA 3TE9A 1M7XA 1FY6A 1YTKA 1JD9A 2QMKA 3CC1A 4M56A 5G2WA 5HWJA 3THAA 5AB3A 4UNLA 1H50A 3K8KA 2HS6A 4O1DA 2CXGA 1MFVA 3L4TA 5J5RA 4WY0B 2BXZA 2ZIDA 2BHUA 1G6CA 1QNVA 2ZUSA 3CZEA 1QMLA 3LHUA 3IVTA 4XBKA 3L65A 1XH2A 2CLHA 1I8JA 2OX1A 3CV5A 1OT2A 5A6MA 2ZDRA 3QQ1A 4M19A 3WN6A 4Z1BA 3L4XA 1UD4A 4HPXA 1JXJA 2OSYA 4ZZ9A 1G5AA 1K8XA 3E0IA 2YJQA 1FWRA 2AAAA 2WCSA 3W3OA 1XBYA 1P1XA 3B03A 3W7PA 2Y70A 4IPIA 5IBXA 1AQMA 1LBLA 3IK2A 1TMQA 3TCEA 4NXSA 3LHTA 5LKYA 1K7XA 4NQ1A 5H91A 1FCQA 4H6KA 4KFNA 1B57A 1OABA 3ZSSA 3LCIA 2A5HA 2C16A 3GB6A 1FBAA 3HBLA 1WOBA 1OYAA 2E0PA 1OK6A 1TQJA 4GNJA 1JDAA 2YDAA 3TKFA 4MZ8A 1H7PA 1KFJA 4MLJA 2QUUA 5D37A 1LDCA 3VX0A 1UD2A 2D0FA 1KXVA 4HIBA 2NX3A 4X0NA 1KFBA 4Y96A 2DU2A 4MPQA 4JYEA 4ATWA 2ZX9A 1JCXA 3MP5A 1GYNA 4A3UA 1MVYA 1A5BA 4IMFA 1GTHA 3HGSA 1UBSA 3QF0A 1DHKA 1B4EA 3L68A 1JDCA 4UTTC 1FWNA 2V2HA 5FEWA 3NM3A 1UA7A 4PEKA 3WDIA 3BUDA 2NUWA 3CZSA 2ZX8A 1NM9A 4HSNA 2WKLA 3I7SA 5EL1A 3UWUA 3LX9A 4J3TA 1S5TA 4K37A 2C1HA 1MW2A 2ATSA 1AMKA 1Y7VA 5KEZA 2E6FA 4RZ5A 4MFEA 1PAMA 2PRHA 4NJJA 4FF7A 3W2UA 2YA2A 5DBTA 4GFSA 4NUWA 3STEA 1CYGA 4RX0A 4XZ9A 5K3VA 2Y7FA 2GJRA 3BAIA 1IXOA 1XBXA 5F4XA 3G24A 4M8UA 4CN1A 1N55A 3S5YA 2W0UA 4AIOA 5D2VA 2F7PA 3VE7A 2QMJA 1OX6A 3BAKA 5HULA 3KLKA 1KXQA 3UPWA 5FEPA 1QPKA 4J7RA 4U28A 1NOFA 3BARA 1V3LA 3QH2A 1BPLB 1O5KA 1C9DA 4FNUA 2VFGA 2EO7A 5DLCA 2GJNA 3GDKA 3KX6A 2V81A 2X2GA 2QJHA 1Q6RA 1JF5A 2NSXA 1JCNA 1KLZA 1GJPA 4GUFA 3ZOAA 3KL5A 1WBHA 2JKEA 3G8RA 3HGRA 4CVWA 4K8HA 4LVGA 4AB4A 1WZLA 3CLWA 2DZXA 1O60A 1ZY9A 4JXCA 2I14A 1IXPA 2WQPA 4CCCA 3C8FA 3KE0A 1TV5A 4UFIA 3L2IA 3W7HA 3TW7A 4E2OA 1RZMA 2VFIA 3NG3A 4HPJA 5AOUA 1WDWA 2FGZA 3MMTA 1V3KA 3MUXA 4X22A 4UC5A 3L0GA 4AEOA 5LGZA 3QC3A 2GJPA 1H7NA 1QO2A 1FDZA 1ZHAA 1Q3NA 4ADSA 2EPHA 2WO5A 2VR5A 2X1TA 1H7RA 2EHHA 5ABTA 2X16A 3V75A 3EXSA 4U31A 3OA3A 1UUMA 1I2PA 2YFNA 2ZRWA 1D3GA 1XDMA 1CXHA 4UTWC 1JGIA 3G22A 3CIXA 1WZKA 3A47A 1RD5A 1JVNA 1MO0A 2A85A 3UNDA 3F03K 3HG3A 4GINA 4JCMA 1J4EA 3NEVA 1OSEA 4W9TA 4Y90A 3GYEA 4MJMA 2G5WA 5K4ZA 2W79A 1Z41A 3AO0A 1GVIA 3I6RA 4I7UA 5L6UA 4JTUA 4XWUA 3ANYA 2FHBA 1W5PA 3BG3A 4IXXA 1RR2A 4OKDA 2EACA 2ZZ6A 3C2EA 2Z1BA 1MWOA 2V2CA 4BA0A 3OVPA 5HNRA 3PS7A 3VKJA 3G3MA 1FWTA 1EH9A 2VEKA 3D4ZA 3EDFA 2VOMA 4DPQA 1FUYA 1ODUA 1U5JA 3SR7A 5AHEA 3MBDA 3VGHA 4EIVA 1XSIA 3NPWA 3BUBA 1BF2A 5F2LA 5D33A 3GXTA 1R33A 2EQDA 4JX6A 4LUJA 1B4KA 4YCOA 1BWLA 3WJYA 2Y4SA 4AWSA 4AEFA 5HINA 4J28A 4O16A 5E6YA 5HXMA 1KFLA 4DBEA 3LCGA 1LROA 4AWTA 3VMNA 1OFEA 3ZT6A 2KZHA 4O18A 5D2TA 2E8ZA 3KLLA 2BSLA 1KFCA 5U7SA 3UY8A 4UTMA 1MXDA 5FESA 1AW2A 4A2RA 2PCQA 4O50A 5C6MA 2QCMA 4LRTA 3VO0A 1VGAA 1FQ0A 3WMSA 4HOXA 3GNDA 1K7EA 4DBDA 1JRCA 3GK0A 2XN2A 4JTEA 4N4PA 3WY3A 3LHWA 3QPYA 3SIZA 4RZ6A 2QCDA 4HPHA 3QZEA 5TBOA 4BWLC 4FEZA 4M6QA 1UKQA 1SPQA 3PBUA 4M7SA 2PURA 1ME7A 5LZLA 2GQ8A 1TO3A 2ZZ3A 2WVVB 2QKFA 3LERA 5EPDA 3F4NA 3PB0A 3G1FA 4UQEA 1L0PA 3TC7A 3HPSA 1MW3A 3GX9A 4UQAA 1V5XA 1QX1A 3TQKA 2VEMA 4LTSA 2R8WA 3MJYA 2WOQA 1KM4A 3UG3A 4JN6A 3I7RA 1ML1A 1MEWA 4LU0A 1IXNA 2B7PA 5DCEA 4LVFA 3NQ7A 1VFMA 3WNNA 4HOZA 3W2JA 1ICQA 4JDBA 1ME8A 1VC4A 3G1AA 1EHAA 3BW3A 2Z1KA 4OE7A 3EWWA 3WNMA 2QCFA 1W5NA 4MY1A 4JYDA 2J6XA 2UV8G 2QDHA 1OYBA 1TQWA 3O6YX 3L5AA 1D3CA 4CN6A 1KM3A 1WQ5A 5K7JA 2CLMA 1VHCA 3C2FA 2ZX5A 3KEHA 4ZQPA 4N9DA 3O16A 2H90A 1I2QA 3FFSA 1QWNA 3QEZA 4FX8A 2GQAA 4Y9AA 4WX2A 2RHGA 1EX5A 3B4UA 1C8QA 4HT3A 4UFJA 4CNPA 1FCBA 3EDJA 4LVAA 4GUGA 3PR2A 3LHZA 1QPRA 1TTPA 3IIVA 2OT1A 2WNZA 1CDGA 4I7WA 1R2TA 1OFOA 1QPQA 3G1VA 2AAMA 5HPOA 1L2UA 3K8LA 1JFHA 1UA3A 3O8AA 3M5ZA 1SMAA 3VE9A 3FAXA 3A4AA 4WXZA 2BLEA 3M41A 1A5AA 1JJKA 3JS3A 3PY2A 3W2LA 2VT0A 4ORMA 4TU1A 3DFNA 4MY9A 5KZDA 1H7WA 3P62A 3P81A 4TMBA 2CHNA 3Q37A 2V2DA 4R7JA 3MWAA 4EOUA 3W6YA 1I2RA 5LNUA 1VPXA 3TW6A 1WYIA 1HT6A 1H7XA 1EP1A 2GVJA 1VLIA 4JTFA 1CGYA 5D05A 4RK8A 1AL8A 4BI5A 3BVXA 1O94A 4NNAA 1JCYA 3O1NA 3R8RA 4PCSA 5BNKA 2EADA 2D0HA 3AXHA 2ZZ7A 4K39A 5C55A 1PZ3A 1DBTA 2C7FA 1K03A 1W8SA 2FFCA 5CPLA 3BK0A 1KBIA 3RFAA 1PZ2A 1WP6A 3EX2A 4XTIA 4UOQA 1IGSA 3B06A 3EJSA 1EUNA 2VXNA 1LP6A 3EX4A 3UXAA 3SI9A 3AJXA 4KMQA 4KFOA 1OF6A 1EWDA 4KWWA 3E02A 3Q2DA 1FWWA 1F7BA 3TNOA 3W1PA 2ALDA 2DZSA 2J27A 1ZAHA 2GPTA 1OYCA 2V82A 2B7OA 2R14A 2WV8A 4M7TA 3W73A 3W74A 2BXVA 5CGMA 3W1RA 3JR2A 3W7JA 1GJUA 4HNNA 1QPNA 1H3GA 2TRSA 4M6PA 4ZQNA 3W7LA 3R2GA 1THFD 2QF7A 4NNCA 1PIIA 3VU2A 3QFEA 1XCXA 4DXVA 3B0VC 2D3NA 2BX7A 1Y0EA 4UMAA 3G1DA 1BSIA 5DELA 4NNBA 1TV8A 1H62A 3L4UA 3KOFA 2NUXA 1ONRA 3HJEA 1BEUA 4QSHA 4QM1A 4TIMA 2B7NA 3LCFA 3W88A 3P67A 3CPRA 3S1XA 2BY3A 3EKLA 3OLDA 2YR1A 4TVUA 1V3JA 2E5CA 3DBPA 4DF2A 1RQEA 4OV9A 1TJPA 4H4IA 2EGZA 1VZWA 2WSRA 3B05A 3UWQA 3NNTA 2YOCA 4MZYA 2ABBA 3FIGA 3HF3A 3KXQA 3H53A 2C13A 3WEMA 4OBTA 2ALWA 4Z1CA 5E9AA 3L67A 1G1YA 1PEZA 2YX0A 3UG4A 1JIBA 1G4PA 4LV9A 3A23A 1VJSA 3BVVA 2CLFA 4TX9A 2YPIA 1GG1A 4XBSA 3WJWA 4JTIA 1JUEA 2XN1A 1GVRA 2C0AA 4GC4A 4R34A 2VRQA 2A6LA 2C8NA 1F6PA 4TO8A 1V3MA 3T7VA 4NJGA 4A2SA 2F61A 4C1KA 2DJLA 2RH9A 3EJTA 2FB3A 2V3FA 3WENA 1XKYA 2ATMA 2D2OA 1LOSA 5KSWA 4RXGA 3S6DA 2A2IA 4U3CA 2Z6IA 4ADUA 1Z42A 4DO6A 2VEIA 3TA6A 4WZHA 1NEYA 2FLIA 1W5QA 3NYZA 4JTTA 3YPIA 4H8HA 3LXAA 3CPUA 4K6AA 4ZQMA 2P1FA 3II1A 3OIXA 4J3UA 1S5WA 4FLRA 2J88A 4O19A 1JULA 4RXFA 5AN7A 1KA9F 1DL3A 3ZQ9A 4UQDA 3VNDA 3HZ3A 1TQXA 1QI4A 5F4SA 3EX6A 1K3UA 1CGUA 3W75A 1LBMA 2XWDA 1O4UA 3ZO9A 5K4XA 4XKYA 1B2YA 3O07A 3W1QA 2VELA 2Y5EA 3UWWA 1CLVA 1FCUA 3DGRA 4Q33A 3M43A 2G95A 4B9YA 1HO1A 3ZSTA 1DOSA 4JTGA 4KKXA 3QQ0A 3W83A 1HFBA 3W1TA 3LI0A 3EDKA 3C56A 3D0CA 1SR9A 1EA0A 1K7FA 1VQTA 4MJZA 5CLTA 1DV7A 5CG7A 5CPNA 2DZVA 2QPUA 3LHYA 1UH4A 3LM7A 3LBCA 4GO8A 1JQXA 2DZTA 3W1XA 4AHPA 2E6AA 4AMXA 1W1ZA 4YCPA 3QRHA 5LHFA 5C54A 5LNSA 5CSSA 1E51A 6ALDA 1S5VA 5AHNA 4UXDA 4WY0F 5FI8A 4J3WA 1LLZA 4PTNA 4WY0A 3THQA 2OZ0A 3UQNA 3M1ZA 1YADA 3MP4A 4JY9A 2R91A 3DDFA 3W2MA 4CCEA 1TQTA 4CGTA 4YLWA 5DBUA 1KGUA 2YW4A 3GKAA 4O4WA 4UFMA 3C2RA 3O6CA 4O52A 5BRBA 1W37A 3W2NA 1EWEA 1FDYA 1R46A 3TAKA 2OT0A 1U83A 3TIMA 1CGXA 1EB3A 4FHAA 3BVUA 7CGTA 4PCTA 2EABA 4ZQOA 3W23A 3DX1A 2F1AA 4WQ6A 1AG1O 1OB0A 1DVJA 2XIIA 2OYMA 5IM51 3NQVA 3IGXA 3G1SA 2JK2A 2NXGA 3IVSA 4UTWA 5L9FA 3VGDA 2CZ5A 2YA0A 1G4EA 2WCGA 3DHFA 3EWXA 2PWFA 5LNRA 2QLYA 4IUOA 4QJ1A 5EYWA 2YKKA 1VFUA 5I3HA 3LLDA 3LRKA 2WVSA 2BXYA 2A7RA 2E68A 3NA8A 1MZHA 2H8XA 3GR7A 4PCFA 5K2ZA 5D03A 3DI0A 4IX2A 3W38A 1K8YA 2NZLA 4Y8FA 1UJPA 3R5EA 4JIQA 3BCDA 3UZJA 3P82A 1XUUA 3NQCA 2V30A 3P61A 2ZUTA 2OYKA 4S2CA 2Y7EA 1M6JA 4N2YA 4U4MA 4O8RA 1VFOA 3HJZA 1VR6A 4GO9A 5I3IA 3HPXA 2DORA 3U8GA 5DXXA 3IJ7A 4TMCA 1J5TA 5H2ZA 3WNLA 3BG9A 1MFUA 3EB2A 2AQWA 2HSAA 5TD4A 1E40A 3EWUA 4PSPA 5AC8A 4BF9A 5CGTA 1G9HA 2A7NA 3CT7A 3OLGA 2FPTA 2Q8LA 3UWVA 2AGKA 3G0UA 1PIFA 3N34A 3GDTA 5BMWA 1QW9A 1OX4A 3W2KA 1TTIA 4AW7A 3A5VA 1WA3A 1YPFA 4FIRA 4YWIA 3OG3A 1EA9C 2AMGA 1KBJA 3QJAA 1OX4B 5KITA 5DY2A 3VSTA 1OF8A 3GDMA 2F84A 2Y7DA 4EF8A 1KM6A 4BZYA 4Z0JA 2H3DA 2TYSA 4EF9A 4YXGA 5AFDA 1L6YA 2A1YA 3P8IA 1EO5A 4IWWA 3GTNA 3M5YA 4K7VA 1WE5A 3LCHA 3MO7A 3VSUA 8CGTA 2QAFA 4O1CA 1TPH1 5CXPA 3HGOA 5AHFA 4OV4A 4JFWA 4QIUA 3GXFA 1KM0A 2X2HA 4BWLA 2OSXA 3TV8A 1TCDA 4WOZA 3W1MA 1F5ZA 1R2SA 4OJYA 3LRMA 4JDYA 2NXHA 3ABQA 4IMGA 1WX0A 4CQAA 2ZRXA 4O53A 5BMXA 4ALDA 3ATZA 3P7YA 5FF3A 4N4QA 2NX1A 2BY2A 3TQVA 3W72A 1W31A 3W7EA 3TONA 2NXIA 2VFEA 3R89A 5EMYA 1X7FA 3W7KA 1KCKA 3M7WA 3MHUA 2WVTA 1QHOA 4NT0A 1C29A 2A7PA 2FH8A 4PL2A 1EEPA 1XI3A 1XH1A 3GAYA 1WZAA 3D4YA 2ISVA 4JICA 3S1WA 3DFPA 3DFTA 3TJLA 5A2BA 1GCYA 4LVDA 3GBDA 3AMLA 3PSVA 3PM6A 1A47A 2J9ZA 1KCLA 1KWGA 3NO5A 1C8VA 4O17A 5I3KA 1I4NA 2ZBTA 1T0OA 1I2NA 1F05A 2PWHA 2WPBA 4FO4A 4ZVJA 1CPUA 2JKAA 4O0ZA 3ZFHA 2DH3A 4X2RA 1J0IA 3W07A 5BW6A 1ZS2A 2OMAA 1MSSA 3CZGA 1D7FA 5G4WA 4E38A 1X6UA 2F7RA 2QEZA 2XIBA 4YL2A 5HR7A 3P60A 2FB2A 3L4VA 1ZNNA 4FXSA 3LTYA 2IGTA 5AYYA 3CLMA 1JD7A 1KXHA 3BSGA 1M53A 3W1LA 3BGJA 3C6CA 1WZMA 4P61A 2Y6ZA 1EP2A 1QPOA 5A5WA 4UTLA 5C5YA 3MHFA 1R2RA 3P84A 4GUIA 4IGHA 3FLUA 4MUZA 1VCGA 3QMSA 2OJPA 4U2YA 2TMDA 2GVYA 2V5BA 2ZRUA 2CWNA 4AAJA 2VENA 2ZA1A 3ATYA 1Q6LA 4Q32A 3EWBX 5F7UA 2ZQ0A 6CGTA 1GZGA 3N2XA 3QM3A 5CPOA 1OHLA 4DPPA 4HOWA 5HWNA 3CGTA 1GJWA 1Q4NX 4LC6A 2JBMA 1PJ9A 4FB7A 3BO9A 1B9BA 3TOPA 5I3FA 1DKWA 2VNCA 4A29A 1TPDA 3CEUA 3L0NA 4JTKA 1PV8A 1VHNA 2J9XA 1IF2A 3ZT7A 4JTLA 2G96A 1W3IA 2Y89A 4FNPA 4JX4A 3N73A 3RU6A 4O15A 2W6RA 1RP9A 5DCBA 4W93A 2X1RA 4LWWA 3KVKA 1AVAA 3G8EA 5G1YA 2H6RA 4MZ1A 1A5SA 4UR8A 3EX1A 1FXQA 3GXIA 3CZKA 3S1VA 3QW4B 3NAVA 3NL5A 2WSYA 2C14A 2XFWA 2Q3OA 2FE0A 1F6KA 3DH7A 1DORA 3E49A 3NQEA 2H3BA 4UOZA 1XSKA 3C3NA 5D2YA 3N9RA 3BUQA 1ZAIA 3BVTA 2YSWA 4E2DA 1VYRA 5LNWA 4JGDA 3S42A 1SW7A 4LV4A 1EIXA 3VNZA 3AXIA 4UNKA 3T4CA 6TIMA 1YYAA 4NU7A 3NL3A 1JCJA 4AXKA 5CSRA 3W84A 4JCLA 3NR0A 3UWYA 3W22A 4LW7A 4O57A 1SZEA 3CZLA 1PE1A 3S9YA 1HTIA 1G69A 4A22A 3ZT5A 3QSTA 2WVVA 4NJIA 3EJQA 2E09A 4XTDA 1KM5A 2QJIA 1R47A 1OGSA 4PA8A 3A6OA 3DFQA 3VM7A 4TR9A 1SZNA 5C2XA 3LV5A 3DC0A 4P2VA 4GQRA 1JCMP 1EP3A 1KGXA 1H1YA 3VI2A 3TSDA 1YPIA 4XUGA 4JYFA 2EEXA 1OVDA 3NL2A 3DXIA 1X1ZA 4M5PA 3OHIA 1H5YA 3NQGA 4AH7A 1KLYA 1JCLA 5A2AA 1OFBA 4GIAA 2ISWA 3S8HA 3RILA 3EXRA 2P0OA 1AMYA 1PCKA 2X2JA 4ICNA 2VKZG 3F1QA 2ZZ2A 3WDJA 4XB3A 3IGSA 1QOPA 2NT1A 3UY7A 1LOLA 1LZOA 2Y7GA
chains in the Genus database with same CATH superfamily
1MVUB 4W8BA 1UASA 1VB9A 5EBGA 4P4RB 15C8H 4IQJA 2HKAA 3ZTNL 2WWCA 43C9B 4O2EA 1LEIB 4CW1B 1XYAA 1QR1B 1WKEA 4DUWA 2Z7YA 3TV3H 1HL2A 3OTRA 2EKCA 3KD4A 3FTUA 4CNNA 2RDXA 3NZRA 3VGEA 5H4ZA 4PJ8B 4IGNA 2APTA 1P2CA 1UZ8A 3DI1A 1GNXA 1A7BA 2PPGA 4DJDD 3IMVA 4Z2KA 3FS2A 4DWSB 2CCRA 3I9GL 4XWOD 3FHAA 1O6TA 4BRJA 1FZKB 5T8GA 1NBZA 2XIQA 2XKSA 4D7BA 5D6CA 4L1BA 3WLMA 1V6VA 3WEXA 4ODTL 1MAJA 3CHPA 2VZTA 4R97B 1LOQA 4RKAA 2FX9L 2JKXA 3H7LA 4QRPD 2VD8A 3WYRA 5CMAA 8TIMA 2NQ3A 1BZDA 2LTQC 1PVNA 3T3ME 3S8GB 5HVWA 2WP3O 4QRPA 2VDOB 1BMWA 1MNNA 1QO3B 4JTJA 4RCXA 5L0QC 1WAAE 32C2B 1JI1A 2ZAHA 1KB5L 4EVNA 4FL4C 2C15A 4OIFA 3LN3A 1IGFL 5I1GL 1HHKA 3WO8A 1B3OA 2Y2WA 2F6KA 2BFGA 1P7TB 2WQSA 4AK2A 4AIBA 3HZYB 1R34A 2AK4B 1NPUA 1PCWA 3HGJA 3E96A 2H1PL 5D70H 4CSZA 2EEDA 3WFBL 3H7BA 4ZO6A 1RU9H 3RFRA 2F2HA 3TH2T 4S3KA 3EYOB 3A3WA 1E5AA 4HP5A 4OT7A 4UQCA 3Q94A 3VCCA 2WQDA 4NQUA 2FR4B 4DPBX 4IG2A 4I9AA 5DWUH 2WLLB 1U3HB 2ARWA 2NNAB 1H3VA 3EYQD 4YTSA 4QROA 3VJ6A 1TKWA 3P11L 4DZHA 1DFXA 4PRID 4LC8A 4AF0A 2H7WA 4AZ8B 5DZ9A 4MIMA 1HU8A 4AIZA 3CQFA 1KIRB 5CC5A 3ARGB 1H6UA 4RX4A 1GTFA 1HQ4B 3SDYH 2P10A 2FEEI 4DKTA 1EFXB 2IXUA 5KSAA 5CAKA 4MDIA 2F53D 3S5NA 4HBCH 4W9JC 3RPIB 2WUBH 5CG0A 5CZTA 1G6RH 4UTIA 1I7TA 5ICZA 3D0VB 3W7RA 3UADA 1ZCOA 3UJFA 1UG9A 1S1PA 3EO0B 1RJYA 2ESVE 3A24A 4E9TA 1L6PA 2VDKL 3TQ0A 3ZKND 4PJAA 2MNWA 4RZ4A 5LYRA 4S1RL 1KELL 4Q22A 4MCNA 3W7CA 3N41B 1JK9A 1TJMA 2ZRVA 2YRLA 3QQ3A 1OD7A 1TZHA 1FYTE 3ARDC 2O6FA 3UA3A 2VDPH 3IJEA 1TQBC 5F9JB 5LHEA 5KN5A 1OPGH 2W38A 4RDVA 1HL4A 1DBKL 1PYWA 4PRWA 3FB8A 3UAJA 4NQSB 1QSVA 2XX1A 4YXHL 1GAFH 1M05B 1VBRA 3N1MC 3RA7L 2VLKD 2Z8VC 2FIRT 4ZMWA 2EDHA 4NIRA 1CS6A 1KGWA 4LBUA 1TJRA 3U7AA 3FOKA 2KZKA 4TKWA 2BWGA 3LQAL 2HWGA 1A6PA 4D8AA 4HK7A 3KH3A 1CC3A 4JPSA 4ZEPA 4NHVA 5JW4Q 1I8LA 2WQVA 4N0UB 3CVHB 3DOHA 3QNXB 1QHQA 3BJLA 1JNHB 2OZNA 3F2DA 1ROWA 2ZSWA 5SX5K 2VDRH 4JHZA 4XMXA 1IEAA 2GUBA 1UZ4A 4WSHA 4GMTL 1AO7E 5D2NE 5BUPA 3SJVA 1NSNL 3O2VH 3O9WC 5GGSB 5K9XA 3VFMB 4I9TA 3S48A 1R24B 4BK5C 1NMBH 4A7VA 2LVEA 2WBGA 3F83A 3D08A 4G1MA 1A4LA 4UV7H 4B9FA 1GGOA 4IGSA 3QRGH 2YEQA 3MXVH 5CR8A 1NOUA 4JFZL 5BQDA 4PLKC 4ERSL 5FV2A 4E8GA 1I4FA 1F42A 1U8IB 3CQ0A 4KI5D 1KSRA 3REQB 2JQMA 2R69L 1LCOA 3KCOA 4IKNA 3KTSA 2R1YA 3NJKA 3RTQB 3C09B 2NR6D 3LZ5A 4Z7UA 1FXPA 4WZ9A 1PIGA 1JYVA 1HXYB 4AUJA 4OF8A 3O0KA 1QNOA 1JOIA 2NR6A 4M8QB 4FZEH 5DRXB 3TP4A 2EYSB 3MNDA 1Z3GL 3UGRA 4L0ZA 4Q4SA 4A8RA 4ZL1A 4ZQCA 2PDFA 4LARL 5HVFB 2NY0B 5AVYB 4BKLB 4JFTA 4ZMVA 1A65A 1U93A 3M1OA 3G6AB 4P9HL 4TV3A 1HJSA 4HK5A 2V7NA 4L1SA 3PIQA 4E9QA 4YSQA 1K77A 5FFLA 3PJWA 1H3XA 4A2EA 2FDBP 4G8GB 1HJBC 1XBZA 4GYPC 2DM4A 3TTYA 4EI5C 1QWHA 4IJRA 1N2RB 1F00I 3C0SA 5E93A 5E94A 1DHPA 4UM9D 1B6DA 1E4XI 4YDJA 1OWQA 3GSWB 5HHVH 3PL6C 5F6IB 3IDYB 3BXNB 1W80A 4UM9A 2PZNA 1G5GA 1O6VA 4ZNEA 4DN4L 3O06A 4TNWF 3VI4A 5FYJU 5IJDC 1OCNA 5IB1B 2XYLA 2V6HA 4HIPA 2B5IC 4PS4H 2ZUUA 4ADIA 4O2CB 1IGJB 1LRTA 3FKUS 4WFHE 5HHQA 4ZI8A 1NP0A 3GXNA 4W9HC 2I9EA 3V5HB 4LMQE 2CJ3A 1W1IE 2OWWA 3SSJA 1UQYA 4XD6A 3BH8B 4N2AA 1O68A 3A67L 4P5TA 3KXFB 1Q6OA 1RZPA 2P47B 3JWNG 3GH7A 3SDCB 3V0EA 2Z65C 5SX4I 3CL7A 2D0GA 2IW0A 4P2RE 1KTBA 2XZQL 1AZZC 3OX8B 3OKMB 1E5YA 3VXQB 1JEZA 3VXMB 1UA6L 4Y2WA 4Z42C 5A8PA 3NQFA 4L1HA 1EBHA 1E6PA 3GR8A 2J8UE 1S78C 3CZFB 3JV4B 2ZWYA 3LSBA 4WDXA 1U91B 3H6AA 1JWSB 3T65A 3OJ2C 4YHNB 2DZBA 3PGFL 2GJ6D 2FYYA 2DQDH 4TNVK 1U8JA 3MV8E 2JJTA 3G6JB 3MLYH 2GJ6A 4PTXA 4GW1A 4F8LA 4AOFA 2EDJA 4L6HA 2EG7A 5FJOA 2UY6B 1DBBH 1EDGA 1TPFA 2CFFA 3CZ8A 1ZFJA 4IT1A 3EH5B 3DUUB 1MI5D 1FSKB 5E1QA 4WU5A 2Z31B 2W59A 4FQJL 1MI5A 4ZXBD 1DQIA 1H50A 4O1DA 2HNHA 4ABQA 1LP9E 4L80A 2FECI 1ZSHA 2VDQH 4M19A 3RWDA 4AV5A 2OSYA 4PJEA 3W3OA 1P1XA 2UX6A 4L4VE 1LL6A 3COOA 2FDMA 1VFTA 5LKYA 1OM3L 1YEEH 4GVHA 3HBLA 4HT1H 4AE1A 1NELA 4RDQG 2P24B 1P4LB 5LG1A 5AW3B 2FIKA 2VW6A 4FHKA 1RZ8A 5FKPA 1O66A 3SRDA 2HJKA 1XHGA 4LUSA 5FHBL 4NNXB 4DVRH 4YH6A 1MJJB 2ICES 2NUWA 3ILPA 4KK9D 2PDLA 4NN7B 5LIKX 3VIIA 5MEPB 4M1CC 1PAMA 3CC5B 3Q6GL 4GFSA 1Z9SB 3QORB 4I0PD 3N15A 1KJVA 3UEZA 2DEYX 4I0PA 1XMWA 1BF8A 4C4UA 1RY0A 2VFGA 4OFCA 1HGWA 1DUZA 3GDKA 2E7BA 1JF5A 3RWHA 3T09A 3NJLA 4FXTA 8FABA 3G8RA 3HGRA 1S39A 2ICWI 4ORZC 2CIIB 3VG9C 2WCPA 2ORBL 4DKDC 1TV5A 4UFIA 5MENB 5GS1C 1OE2A 5AL8A 4X0VA 4PJIE 3DKHA 4PP1D 5HYIA 2IQAB 2VR5A 5I79A 1INDL 1Q8JA 5KSUB 4N22A 4C6OA 4RMBA 5IUCA 3QJFB 2VJXA 1B54A 4GIOA 4MSWB 2DWDB 5DYOA 3D18A 4OCRL 4GINA 1OSEA 3CFNA 3UTSB 4AE0A 1P5VA 4JTUA 5AVXB 3HBZA 4ELKA 3PS7A 2OG9A 4NQTA 5FC9A 3D4ZA 5HVGB 1TYRA 4PRPB 1W1A1 5E6ID 3W81A 3FUNA 5D33A 5IQNA 3VDBA 3QK0A 3B8YA 1IR2A 3GSUB 3SE8H 2CCVA 3U4EA 4PB5A 1G7PB 3V79C 4O18A 2KZHA 1CK0H 3TTEA 1AR1B 3VKCA 1T89C 4NRSA 2OJEA 5C6MA 1VFAA 3VO0A 3STLA 3QS2A 4WV1C 3ME3A 3RJDA 3QPYA 4MBOA 1RXLA 4GK8A 3CFDA 4FF5A 1UWQA 3DCPA 1EJ7L 2R23A 3LERA 5SWZD 2Y1AA 1RJLA 3GX9A 1U8NA 1QX1A 4KK6C 4M7KL 3W53A 1JPEA 3WLIA 2AZUA 3BTNA 1F1DA 5SWZA 1KTLB 4NIKB 1XIGA 1VFMA 2J88H 1FFTB 1A3XA 5MEOB 4C1NB 5IB5A 3KLHC 3QUMB 1U3YA 3TYCA 4PAZA 1OYBA 3O6YX 4YOKA 4N6QA 3E3HA 1TT6A 3S1GA 2GQAA 1KIQA 1CE6A 1YUKB 3MV7B 4UFJA 2MMXA 1TVPA 4NDMB 3FUEA 3BWAA 3LHZA 3PUUA 4NBZB 1L2UA 4BSJA 5BZZA 3OQ8A 1NGYB 5HYFA 4H25A 5IJKC 1PSKH 3PY2A 4QT5A 4LIQH 5FYJH 5E5MB 4WNQB 4QRNA 5EU3B 2J7FA 3NJNA 3B0YA 3KYKH 5IEKB 4LF3B 1VLIA 5FA4A 4MDOA 4WJXA 3BVXA 4XXWC 4NNAA 2XZAH 4NWUH 5HHPA 4OIAA 5DQDL 4NZCA 2ED6A 4UOQA 3E0GA 3KYNA 2PDKA 5J0BA 2GI7A 5FO2A 5D93B 1OF6A 4L6DA 2H9AA 4LKXB 4FXGC 5LDSA 2DYRB 2V82A 1J1XH 5DJZA 1R3RA 1AKJB 5CEYB 5ITBL 3JR2A 3IU4L 3W7JA 4Z7NB 4I2XB 5BJTA 1THFD 5F9AC 4DLFA 4IU2A 2E5EA 1MZZA 3B40A 3ARED 4GBXA 1HW6A 3W88A 3EFOA 1N5YL 1JV2A 5ELIA 1YIXA 4DF2A 1XLKA 1KDIA 2AKMA 3QR1A 5CD5C 3AREA 1VZWA 5I0YA 3E2HC 2C13A 4JLRA 2D7OA 3GHEL 3MRDA 3DGGB 3V4VB 2TSBA 1TMLA 4Q0XH 1L9OA 5EBMA 4OLXH 1GGBH 2QR0A 5T33H 4F9PA 4JPIB 5EF3A 4JNZA 2F61A 2YC1A 3EJTA 2GTZA 1EHLL 2PU0A 3ZVIA 1Z42A 1RUQH 5DC2A 2LE9A 3TURA 1C08B 4K6AA 4CKVX 1LE5B 4RISH 5MKGA 1K3UA 1O4UA 4XKYA 3FO0H 2VSCA 4WKZB 3LNGA 3VXUE 3PJSB 5E1HB 3HPLB 3ZSTA 5KETA 2VTFA 3RFZA 3D0CA 2OQJA 4NSBA 2R1MA 4ALAH 2QPUA 2BWDA 5JIDA 1ISXA 1J48A 5DD0L 4RDZA 4ZJ9A 3P2VA 4LRIA 4F93B 1H8LA 1S5VA 3AZSA 3JUGA 1BQLL 1YADA 4HFUL 4PV1C 3TCSA 1PZAA 1E27A 1U2CA 1W37A 3ZDXE 4XCYB 2J74A 3BP7B 1D5IH 2EABA 2FL5A 1ZB5A 4C91A 3N1AA 5M7QA 2YA0A 1G4EA 1LEGA 4K23H 1C5CH 1JGUL 5FHAH 2IWGA 4TRPL 3VI3B 3K5SA 4APQD 1E2VA 4YVNA 4MFHA 3WLNA 4TSBH 5ISZD 2WO4A 5KYXB 4S2CA 1ZWIB 3HJZA 3CSBA 3HNVH 1JZEA 2DORA 2KDGA 4TVSa 1I9IH 3H2AA 4N0FB 1E6SM 5IHLB 3OLGA 2Q8LA 1DUYA 4FI6A 4QLRA 1DQLL 3CVIL 3DIPA 1OV8A 1RZGA 1RUAH 1FIGL 2CLZB 2EPLX 2F84A 5AFDA 9PCYA 3N42B 2CDFA 1UXWA 5CXPA 2AQOA 4OV4A 4QIUA 1MELA 4MUPA 5I66A 5KZ6A 4MA1B 1W8EA 3LRMA 1OCZB 3KWVA 2FEEL 4NJ9H 1WYJA 2A6IB 1Y1UA 3GRWA 5L4JA 1E50A 4YR6B 1G0YR 3TQVA 3D85B 4IRSD 3TONA 2ZP8A 1VPOL 5IIEB 2V7HA 4NT0A 1GW0A 3VDCA 5BU9A 5A2BA 4IRSA 3L95B 2R82A 4Z3HA 5CCKH 12E8H 2J9ZA 4RGND 1X7QA 1T0OA 4DB7A 4O0ZA 2HQAA 3JWOC 1EO8L 1Q9LA 3TWCH 2IGTA 3CK0H 1NDWA 5F1NB 3CLMA 4OUIA 4D8ZA 5EWIL 2CLVB 1A7QH 1GW9A 4WU7B 1ZTMA 4FFTA 5HBFA 4AVIA 3QMSA 4BINA 1RUPL 1IGIH 1TEGA 5EIIG 2ZQ0A 3DI3B 1JJUA 1AZRA 3BO9A 3GTXA 3FZUC 4Y9GA 2HNEA 2A4CA 4GSQA 5EZOH 3K71A 3ZT7A 2KERA 2QULA 5E6RB 5DCBA 4MWFA 4C7FA 1UXSA 5DD6B 2MSPA 3K2IA 4OLYH 3CNKA 1DVSA 1JTOA 4ENED 2EKGA 5ANMA 2EO1A 2OR2A 4LB4A 4F0HA 5CGYD 1KV7A 1SZEA 3VH8B 3HPAA 4Z0XB 5FDWB 2NLJA 2PPEA 1J05B 4G5AA 1XIHA 2CNYA 3GIVA 1X5MA 1C90A 3QAZC 3TS8A 1X1ZA 4HHGA 3SOBL 3VE0A 5GJMA 1OFBA 4GIAA 5BZDA 5CCHE 3MRNB 3S2LA 4V1DD 4F7EB 2VLRD 3VA8A 3MCMA 1LQ2A 4M6UA 3MPCA 3KTXA 4EXBA 1DE4B 3QCTL 1IZKA 4MJIA 4V1DA 2ZXQA 3H9SE 1TPUA 3GNPA 2VLRA 3AHXA 2DJMA 2NY2D 4PJGF 3JWNH 1UZDA 1TJHL 1RP8A 1A9BB 2J43A 4DZ8A 3T0WA 2YL8A 1Z3RA 3G0SA 3FJLA 1RPKA 2OP4L 2G0LA 4KKCC 3AQYA 4K3DH 1ODAA 3IXTB 4R7OA 2K3HA 1JZDC 3SQLA 4H88H 1IIGA 3SPIA 4EVZA 3QZOA 3L23A 2F7QA 3APNA 2MFNA 1T5KA 2IAAC 5LN8A 3EOLA 1MIEH 2AV7A 3CMJA 4HCRL 1KY6A 1SJCA 5I19H 4Z7VA 3FQ1A 1GOKA 1XH3A 2YGYA 4PYSA 3NABH 5AAMC 4CNIB 1AZBA 2E77A 4HV8B 5EOCJ 3SE4A 2CALA 3CUJA 4FQHA 3VGBA 4FMKA 4QXTA 2Y69B 4J8RB 3ARWA 4A6YB 3RPKA 4F9JA 5BW7C 1KTDA 2HS8A 2Y5QA 2HFFB 2YS4A 4N5EC 1H5BB 3FQXA 5GZND 4NS0A 4N0YH 2L4OA 1EVUA 3B83A 4NZRH 3H7UA 2W0FA 1ZHKB 3UVAA 2CGRH 4JY8A 2AEQH 2OQHA 3OBKA 2XTJB 5GZNA 1UJ3B 4QXGH 1L0QA 4UI2A 4B5EA 3BIBX 2Y1HA 3HZKB 1TUFA 3HG0A 3ARPA 4FAAB 1E6NA 2WO2B 2Z00A 1QLEH 3TO4B 5CJXC 3TBVA 2NZIA 1KBBA 4UTHA 5B1KA 2V9QA 2ZCGA 3F4CA 4FR6A 3MLRL 1LGVA 2CO7A 4IMDA 5IROD 3Q45A 1HHJB 1QOQA 4BZ1H 2EF9A 4DBUA 1B90A 1L0XA 3FEMA 5SWUA 2AV1B 2PDHA 1OP4A 4XZUB 4JQVC 4KQNA 1CQKA 1B3IA 2R39A 1W56A 3ROLA 3D5OF 3TYFB 3MOBH 4YHYB 2B7QA 2O5YL 4KY1L 1QW8A 4YHOH 1THCA 4OT1H 4O4YH 4XCNB 2X0WA 1AIFA 3M4HA 3QG7H 4PRHB 2NUTA 5I1IL 1CDYA 5J89A 3ECBB 3TO2A 4FNTA 3WIHH 4M8RA 4O1EA 1NBQA 1XF3A 1W5MA 4ROPA 4J5VA 1XHHA 1U8QA 2IADA 3W9DA 2YYTA 1IGYB 5C08D 5JXEC 3V5KB 1SZRA 1XIBA 3UJ2A 2I32A 4F92B 2VERA 2XETA 2BP0B 4KJPD 3AAZA 1GORA 5C08A 2HTLC 2VUYA 3FXIC 3K0YA 1LM1A 3F2BA 1CUOA 4NKMB 1SYTA 3VUAA 4OKVB 4LL4A 2YPLA 4M7JH 1EK3A 1EZWA 2UZYB 3USBA 5D7JB 3RHGA 2WBJB 4ISVA 5M94B 1PZ5A 1QUPA 4ILDA 1P5UB 1KNOB 5GS0H 3B8WA 4B9CA 1HHHA 1SLVA 3VUSA 3X14A 1M6OB 1RCQA 4X7FC 2OJZL 4S0SD 1MZYA 4Q6JA 3ALGA 3HQ1A 3ABRA 2A7BA 2X1QA 3ILQC 4XT1C 1L9SA 2FB4H 4HH9B 1REIA 2ROXA 4RJEA 4YHPB 5MP6H 3OWEA 4PVNA 4ONVA 3W87A 3GMMB 2MANA 4GE8A 1HX0A 3CL8A 3IUHA 4K94C 4ACZB 3EGDA 5G2HA 4JHVA 2J44A 2QCCA 1ZHLB 2FECL 5F7KC 4LVHB 4ANWA 3AWOA 3GBEA 3UP1A 5DEFB 4Z7WB 1ENUA 5EMJA 4P3CL 4A7TA 3MT1A 1MQKH 4CEXC 4FFZH 3W9ZA 4AQ1B 1VFLA 3H85A 5IHRA 1E3ZA 1FNHA 1UWYA 2VAJA 2DWYA 1VFHA 1K6QH 3O9NA 5FB8B 1U9KA 3PWJB 1UB3A 1MAMH 4UWQB 3KL0A 2VC2L 4ZMXA 1QFEA 3T9PA 4UCFA 4RMUA 1M71A 4LPVA 5DJXA 2MRYA 4C4KO 4ZW8A 4U6TA 5E4EB 3VFLA 1F90H 3SY8A 2BP1A 4JO3L 1NTHA 4C56D 3TZVB 1E3XA 1J5HA 1EXUB 5AYXA 1ZTXE 4L64A 1BQSA 2FVNA 5CKSA 4C56A 3IS0X 5GIRA 3DHPA 3CUPA 1J01A 1G6RA 1DJZA 4NZTL 1CIUA 1G7VA 1LO2H 4RMQA 4RFEB 5TQ2L 1QRND 3B8SA 1QR7A 3QJUB 1JWUB 4WK2B 1KBGH 1T40A 1YTDA 1Q38A 3CIVA 3IRDA 2AQPA 3NQ6A 4RFOL 2V3DA 1W3KA 3MCLH 2J8GA 5JHDB 1U8LB 2FUQA 5G55A 1IQWL 4D8PB 1FKXA 1IGMH 2VO8A 5FACA 1SDAB 4GVFA 3UT0A 3UZVB 4UDTA 4GPNA 1L0YA 3G5WA 4LGSB 5AOLA 1U6AH 2RFXA 5CLYA 1JNLL 2JNZA 4JX0A 1GZ1A 2HAZA 4G43A 4LSTL 4ZQKA 2DM3A 4JHWL 1PWLA 3VNKA 3A9IA 4NUMA 1HOCB 4TS6A 4PWFA 5DCCA 4AU0A 3OSKA 3NXFA 4H2AA 3L3HB 2E4FA 4DFIA 4AMKH 4Y88A 4MAYB 3DTXB 1F3EA 4ZUTA 1J0HA 1OHQA 1RUML 3RE0A 4AL8H 4P23B 5F44A 1S7UB 3S3PA 3G5ZA 4Z1AA 4IIBA 4EBQH 2VN6A 5D30A 3UXIA 4MWAA 2WC3A 3W71A 3FULA 1LDSA 3MP3A 5F7NC 3CHSA 4CADA 3CX5J 1FORL 2F1EA 4IHCA 4RRPG 5ESAB 1XL6A 4M1DL 2BHZA 3UBXA 4WWNA 3BCJA 1FHDA 5JO5B 4GG8B 2L5HA 1TVBB 2QUNA 4ECLA 4GAFB 2BMKA 1AACA 1NFAA 4KZCA 1GC1C 4XPHL 1IAOB 4MCYB 4HA4A 1QAPA 4A3YA 3GXPA 3BPLB 4HS8H 1OAQL 1C8PA 5K39B 3QDME 4ZFCA 4GAJL 2I26N 3H8NA 1NAL1 3LPPA 3WYZA 3NIGB 4AYEC 1DLFL 2O5NA 5I75C 1BPVA 2G5BA 5KVEE 1KBVA 4Z76A 3UACA 4LCCC 3B9OA 2IEPA 2HFGH 1VJZA 4UNVA 3BE1H 1LO5A 4EOWL 1M7PA 5AZ1A 4FG4A 1RURL 4P4KD 2Y3NA 3ESUF 4PYHA 1T0MA 5I06A 4J8QA 3RGBA 3M5XA 5CWSB 3IIXA 3OKOB 3LZFL 4FC3E 4DK6A 1AI1H 4H2CA 4XMZA 5MEQA 2K6YA 2R2BA 4FULA 4MD5B 1KENH 1FBIH 4HUUB 3TPKA 2NNRA 5E23A 1J8RA 5EU7E 1ZTXL 3NM1A 5CINH 4U1NA 1XRFA 3FNDA 4R7DB 4GQQA 2ZX6A 3WFAA 1KIPB 3VXOA 2A4AA 3RUBL 4DAFA 3HC2A 3GSOB 3MA7A 3K30A 1KYAA 1GQJA 1GEQA 3P3BA 5I77A 1ND0A 3ESNA 4PZVA 1E65A 4GI8A 1XLLA 3E2QA 3MLVL 3KDNA 2MOQA 2AQ3A 2MCPL 1OPOA 3N44F 2FT8A 1RLCL 4Q8WA 2BGQA 3M46A 2V17H 1A7PH 3F6LA 4MHBA 2HLFC 3FT0A 2HLEB 3QIUB 1TYEB 5AUMB 4JM2C 3KYMB 4PRNB 3U48A 1E71M 4AGOA 4PWEA 3TCEA 4ZD3L 1OABA 5HJ3B 1KFJA 1OALA 4PWGA 2BJMH 2E7DA 3KWSA 4MPQA 1JPGB 5SWSB 4PWJA 3RGHA 1NDZA 4H04A 3P3UA 2DQFA 3V6OE 4C59B 5I1CL 2VGGA 1YNKH 4DW2H 3ITTA 2ZPKH 5FEWA 3ZDYE 3SCMB 1WITA 1EXBA 5D1XC 4BQ4A 2WKLA 4O9HL 3I7SA 2BNRD 2DKUA 3II3A 6XIAA 5EBWA 2A73B 3DI2B 5KEZA 1ACCA 2WWMC 2PRHA 4GCXA 4NJJA 2XKUA 5TE7H 1U8MA 2Z7KA 1CYGA 3CN4A 1YBQB 5K3VA 2Y7FA 2ZOLB 1O9WA 1UYWL 1SXSA 2IALA 3Q01A 1OX6A 1N0XH 1J11A 1QPKA 4J7RA 3PWUB 4C65A 4KROD 1A4KB 2FZ3A 3L7RA 2Q0ZX 4P5UA 2PCEA 5D4QA 1RA0A 2Y2YA 3EGXB 3IF1B 3HUJA 3M86A 3EFDH 5EORL 5GJTH 2VWTA 2HVJA 4RNIA 2ACRA 1KCXA 4U0RB 4D9QD 2GW5A 3FQTB 2OMUB 3SE3C 5H8DA 1RUKL 1QZNA 3AIRA 3L2IA 2WUCH 2HFTA 5GHWH 4XOEA 2FGZA 3UAAA 2H1LM 1S9KC 1J8VA 3C5JA 4N8UA 4JZOA 5E1AA 3RU8H 2EHHA 5ABTA 2NY5L 4OCXH 2R56H 2DPKA 3JTTB 1KN4H 1RZKH 5KVEL 4N20A 4XI5C 3EMCA 1ERNA 1WZKA 3OQRA 3S36H 1RD5A 3B7YA 2M1KA 1CZ8H 4S1QL 4JN2A 4XVUC 3NEVA 4PMFA 3QY8A 4LUTB 1E1EA 3HC0A 1WUZA 1A49A 3PV6A 4UDUB 1JK8B 1PY4A 1XCTB 5FJIA 4GRMA 4JX6A 3LS5H 3KLDA 5D9PA 1JRHI 3FFOA 3T0BA 1IBZA 4AWSA 5DT1H 4RNFA 5ESQB 4KOBA 3VDAA 1T5WA 3SGKC 1X5AA 1RKRA 5E1GA 3IJSA 4HIJB 4M03A 5TK4A 2Q8AL 1R9XA 4R88A 1GOWA 1EEZA 1K7EA 3K80A 1QNIA 3IMUA 4JPKH 4LQFH 5I1JL 4Q8TA 4GT7A 4UINH 5EFIB 1RZ7H 4PHXA 2QKFA 4W4OC 2PF0A 4MLIA 3MRLB 4UQEA 2NZ1A 3R43A 3NFNB 5REQB 1A5LC 1ZGLM 1ADQL 4EEEA 3UG3A 4GB9A 3K6DA 2PBOA 2XQBH 4OJFL 4OE7A 4MXVF 2VITB 4FTVB 3BN9D 1C5BH 5SV3A 3TYGH 3ZY7A 4ODWB 5BVJA 3GGWB 4B0MB 1FE8L 4N9DA 3O16A 43CAA 2ADFL 5C70A 5D7KE 1XYFA 4AZCB 3L5WA 4HPYH 3FQ2A 1AJZA 4FFYA 4U1GB 5H4YA 1IM3A 3BWUC 3ZE0B 4I7WA 2YD9A 4L61A 2HBVA 5IM7A 3FAXA 4ZFZB 3W2LA 1OARH 3GS7A 3P62A 2CBMA 3OJDA 3T0VA 3U4FA 1YY9D 4JTFA 5DFVC 4BI5A 1J12A 4AM0Q 4N85A 3R8RA 2EADA 1BBJB 1UZGA 1O5QA 1PZ3A 3WD2A 2VP8A 3WTVA 1NQKA 1OIMA 2XFFA 3QH3B 4DP2X 1QEWB 2EDTA 2GWNA 5CGMA 2XQ0A 1CCZA 3H4WA 3LHAA 1BSIA 2QSCL 3D6NA 3S46A 3HJEA 3KPPB 1DP0A 4JREC 2BY3A 4LL9A 2YR1A 3EMZA 3FA3A 1HJXA 3T2QA 5IW1A 2DD8H 4HJTA 2YOCA 3WEMA 2G30A 4DGYH 1RJZA 2R2HB 4ZFGL 5DMIL 3WJWA 2DEPA 1NMCC 3SO3C 2XV6B 1MUMA 3LEVH 1OGPA 4ADUA 4ZOCA 3LMYA 3OAYH 3GI8L 2PP0A 1SOKA 2BVOA 2J88A 5F7DB 2DQJH 3ZQ9A 2FJGA 4UQDA 1GYMA 3M7FB 2IBZX 3K2MC 1J9RA 1F1GA 2D2CC 4Z95H 3U3HA 1K9DA 2YAMA 4JO1H 1DIKA 4F2MB 2EVHA 4B95C 3MOQA 5CSYA 4NCC1 1K7FA 4X0KB 1IARB 4YHIA 3OOQA 4TN9A 4MJZA 5E99H 3T07A 1JPSL 1SXAA 2BG5A 3CXFA 4N28A 1KGIA 1A0EA 4YCPA 2JJSA 3B8TA 2APSA 2R1NA 5FYJD 3HN8A 5EU5A 3TXAA 1D8WA 2D7PA 1UWEH 1QJWA 2GLKA 4RX4D 1TE6A 3L3OA 5T3ZH 1AUSL 4FHAA 4ZQOA 3F58H 4IGMA 5KSAD 1KV3A 3NZ8A 4RWYL 1L7TH 5L9FA 4LEXH 4AJYV 2JVUA 3MVTA 5EBLB 2QLYA 2QDWA 5EYWA 2EUWA 5I3HA 4PUEA 5LGJB 2QDDA 4ETQA 4G6JH 1OD8A 2V30A 2B1OA 5EU4B 2BH0A 2XV0A 4R8WH 4E42B 1Q8MA 3QOMA 1BZ9A 4TTUA 3DG3A 4JDTH 1JZHA 2D69A 4KKLC 1WWAX 1ONEA 1ZPTA 4PY8J 4C6EA 2HSAA 4JQ4A 3N1FC 4LNVA 4HD5A 1PG7X 3IETB 3BZFA 1UZHA 4OSUL 2J56A 1F3DJ 4XVSH 4GRWE 2GYSA 4F1SA 4GC3A 3VFOB 4KX8A 4OIIH 3UAJD 1KCSL 4AGQA 2A1YA 1DBML 1PL3A 3R1ZA 3U9UA 1GOHA 1SBBA 4BWLA 2VWEC 3OAZH 3SKUD 5F3BA 3GHUA 4OJYA 3OPZH 4JDYA 2R29H 3NPSB 4L37B 4DP0X 4N4QA 2PF6A 5GGVY 2NXIA 3R89A 4G8EB 1NGQL 4PL2A 2QJNA 3K1KC 1I3RA 3DOSA 4GUQA 3S5SA 3SUUA 4LCUB 4F9LA 5AW2B 2AJUH 3VB9A 5TPWH 2VLJB 4H1ZA 4RBPH 1J0IA 4Z7OF 1YEHH 3LDBB 1A4MA 4BHUA 1BV8A 1N68A 4LAQH 2NZ9D 3B2XA 1KACB 4LLDA 1LO0H 3SJVD 1RMFH 2JH2A 3QR3A 2ZRUA 2PLCA 2VE6B 3BQUD 6CGTA 3N2XA 5CPOA 1XIWA 3T0EC 4DPPA 1VADA 4FB7A 3BO8B 2G3XA 3BQUA 1W72L 5EPMB 5E8EA 3B8IA 2W6RA 4Y19D 4KWSA 3MROB 3K6SB 1FXQA 4CMHC 2HE5A 4Y19A 3OYXA 4ZS6D 1HIMH 3GF8A 2CKBH 3C5ZC 4GKOA 3KHDA 4YDIL 2R59A 4MXQD 5C0ND 3C3NA 4U5IA 1J88A 4NU7A 1ZVNA 4G6MH 3W22A 4PB0H 5AVSB 4Q4EA 2HJFA 3EJQA 1KM5A 2J7DA 2QJIA 1L7IH 4P2VA 4BUGA 4XBPB 3FQUA 2CLRB 3OHIA 2AJZA 3ZZQA 5K9KA 3O6MH 3S8HA 5DTFA 2QKIC 4K2UH 3EYFA 6PTDA 3NGFA 2DW6A 2DQTL 2VDMB 2AVFA 3QCUL 1RZJH 4TLUA 1MCOH 2ZUVA 1AW1A 1X5HA 1DQUA 2QYGA 4Y16A 1BZ7B 2FLBT 4YFLI 3P9LB 3CEPA 2A1WH 3QPXH 2ZRZA 2J4WL 1LNUB 3ZWTA 3ZYIA 4IJBA 4YAQB 3MI6A 2OCJA 3HPFA 2X30A 5JPMA 1IILE 1XISA 4Q52A 2WAQA 3QI9C 3T0DA 1CFVL 4KUZL 2IDTA 3ZVHB 2ZWZA 5DFAA 1P9MA 3C75A 4U49A 5GISH 2YO3A 1G0XA 5C0FB 5D9MA 3WQ4A 1ZXQA 4KJWC 1GVEA 4LVBA 5J56B 3OZOA 4DAGL 2GABA 2WHVA 3TR9A 4J2MA 3NRPA 1XL9A 3B2VH 2R1WA 1D5MB 4J4PC 4DO4A 4ZAKB 5B3NA 5AB2A 4NZ4A 1A6VH 1IRAY 3H42H 3K72A 4WIWA 3G9AB 4N3TA 4RZKA 3GSQA 3X3FH 3EO1A 1S9YB 5DJ0A 2V0TA 4P5TD 4PMNA 1BLNB 3SE9H 3QIBA 1MDLA 3FQNA 3WHXA 1UQSB 4KHTH 5BYWA 1GVYA 1QI3A 1VEOA 4UQ2B 2R0ZL 2XWZA 1WDDA 2B81A 1JBJA 1SDDA 2C1OA 2Y24A 3NJGA 4LP5A 3CHOA 2WAGA 4NX0A 5ESVA 3DU0A 4OD3H 3L6FA 4UTUA 3B9NA 3ZL1A 1UHVA 1EUAA 3KPOB 3MGTB 3X2QB 3UYCA 4H8WH 3OVQA 2BP5M 2ROYA 2JTYA 4XHJC 1BTMA 2EIDA 7PTDA 4UWMA 4O5LH 2XXMB 3H12A 1T3FA 4OM1L 1NLDH 2ZXBA 4KRZA 3U83A 3WK0A 1E1CA 5T1LB 1TTAA 4ZMGA 2PYFB 4IBZA 1Q4WA 3EJPA 4N0CD 5I1EH 5J1TC 2KLTA 5JZ7C 1AZ2A 4JAWA 1XR8A 4HNCA 5ICXA 1ORQA 3BC9A 3WKMH 2NY1D 4B9ZA 3NZGA 3V6FB 1I1YB 4BWWA 3V36A 3QWQB 1IAII 4I18A 1ANUA 4JFYB 3L1EA 3VFWB 1XLJA 2UWEE 2PDQA 2YSSA 1IQDB 1N8FA 1DBAH 3C60D 1N7MH 3BP5A 5DJCB 3P0VH 2X1XR 5CHNA 1CENA 1OK4A 4YGVB 3C60A 2WMIA 2XPGB 3QPZA 3O2WL 2CW6A 1FWFC 2XNAB 4DGWC 5KSBF 1JFXA 3U2JA 4O58H 4NJHA 4AEEA 3MW7A 2QNEA 4MNGA 2P3YA 1US2A 5DQ9B 4LSVL 4K8RL 2BHYA 4P2OD 1K4CB 3JYCA 1Y0LB 5L8JB 4AM0A 5D38A 3PG9A 3KAOA 3FEQA 4P2OA 1UUSA 3T44A 3CU2A 3CXOA 4HVBA 1WDSA 2X10A 3D48R 3M9YA 5BS0E 1TMCB 3V4PB 3UC0H 5IMOB 4WF7A 1JUKA 4O0KA 1DWHM 3IDJA 1E6RA 3S96A 2CNZA 2YUWA 1F3XA 3RDTD 1XRVA 5DMGD 1WD9A 4BZ1A 1J5SA 1DJSA 4JEQA 5L7XH 2QADD 4D0DA 4LSRL 3H54A 5DGRA 3BVNB 3RDTA 5EF0A 2DJSA 3TASA 3ZRCC 2A6NA 3E8UH 1UPPA 1BOGB 4C8XA 3SFKA 3DPDA 1SHMA 5T3XH 3VD9A 3MNVA 4ZNCD 4KCWA 4IP7A 5E8NB 3NQKA 1E9PA 3BCFA 3REVA 3WIAA 4F5CE 2OCZA 4X5LA 2YD7A 1MWAB 1DVQA 4GI6A 3OB0K 5D2WA 2B0MA 2NTFB 3WIHA 2LT9A 1FWGC 2I5YL 5XINA 1HHGB 4HKBB 1BD0A 4L3FA 5FS5A 1KY7A 3LTPA 1IKOP 3RLUA 1NICA 4AX6A 2KQNA 2YPVL 4Q9QL 2J57A 3BH9B 1V03A 4FX7A 2JCCF 5DRZB 4W7WA 4Q89A 5ILTH 4UFLA 4QG8A 5EKYA 3SN1A 2IPUK 7TIMA 1NQBA 3ASNB 4PR4A 1AQKH 5FO9A 5T1MB 5GS0D 5A6IA 4PUWA 2HEJA 4YWGL 2CCLA 3FRUB 2C3VB 2A0LD 4NQCB 3MPGA 4PGEB 4K7YA 4DP4X 3I75B 2WWOA 4X4YA 1JHTA 4HGKC 4GMSL 4LOUC 5CFHA 5HHXL 3PWVA 1XG3A 4W86A 2OK0H 3WAKA 4S39A 4A7GF 1DCEA 1TF4A 5F2IA 1U30A 3S4SB 2GDQA 5KZCB 3VXRE 1L3WA 3R4DA 5TIMA 4P2CG 2YKLH 1FA4A 4FKKA 1UC4A 4P48A 1XO8A 1OJXA 3WTWA 3CWOX 1BLIA 1RZQA 3S5ZA 3ULUE 3ASWA 2XFXB 1JP5A 1N8IA 3FUMA 2JB5L 4L0PB 1CGWA 1A6AB 1TITA 1ZL1A 4LBAA 3DBXB 4Y5VA 1JN6B 3CAKA 1YRKA 3FYIB 1I85A 3INUH 1JAEA 1PKMA 5EU6B 4PJCF 1JRHL 4EPEC 1YEIH 5C0CD 3TJHC 5HHOE 2WTRA 1XIMA 2RDWA 1IC7H 3CSYB 4XP9H 4U1SB 1TIMA 3V6ZA 5C0CA 5GVJA 2J1ZA 3B4YA 2F5BL 3WN5C 1VS1A 4O13A 1AY1H 1ECZA 4F7CA 3EX3A 5DY3A 3MZ2A 4R85A 4LHQB 2FSEB 1Q1JH 2H41A 4X6DE 2WD0A 4L4MA 3NSXA 4KXAA 3KPRB 1TEFA 4ZOBA 4DETA 4ONHB 3HZMA 1XLDA 7FABH 4HNTA 2XWBB 4JZJA 4ADJA 1D9KA 4QG6A 4MRCA 3P9MB 1D5XA 3FYOA 3W5NA 1NWOA 4NP7A 4PH6A 5IVXF 4JS3A 4ERIA 3RL1A 5C6TH 4N1EA 1WFNA 3BH4A 3UP6A 4TUKL 4KK8C 2XVNA 4I77H 3M8OL 3GZOA 3NJIA 5JMOC 4OW6A 3QGVA 4GBXD 3MY9A 2NT0A 4OUOA 3QNFA 4PJBB 1MFBH 5J5EA 3KDMB 2CDGA 3AGVA 3AM8A 3H4GA 3BAWA 3NPUA 3IIOA 3IXAA 2XX0A 3ZS4A 1EJOH 1RQHA 4PG2C 5I30L 1BGXH 4P9MH 2KUTA 2JI1A 4ZSOB 5C6PB 3PHSA 3ML9A 4GT0A 3IVUA 1MREL 4U05A 1HKMA 4GZEA 2BDNH 4Y9FA 2H8ZA 3THDA 3AMKA 4X9GA 5DRWB 4L05A 4XN8A 5DS8B 1UCTA 1CDUA 2HA1A 4MZ2A 1JGEB 4QTGA 4YFDB 1IAKB 2BVQA 1WV2A 4U0QB 3EHBD 4ZFOB 3N9SA 5ADOH 2UY7B 4C6BA 2A3TA 3PF3A 1GGIL 4CGUB 4PBEA 2OMZB 1FNLA 4P06A 3ES6A 1KYUA 3CHRA 3REWA 4N0UE 4DVOA 1FL5A 4I48B 3ZWSA 3WUZA 4ZA0A 1QFWH 3QRBA 1DVFC 3C6LA 3IPWA 1OP5K 4AMCA 4MXWL 4HMCA 4J1UA 5EB8A 4M7LH 4GNKB 4ECNA 3T2OA 5CGBA 3GSNL 4AFYA 3NJVA 3K8KA 3U6XS 3FT2B 2VDOL 6REQA 2VUOA 2PDJA 1KYOK 5DUMH 2CBVA 3CZEA 2X4SA 2C1GA 3CFQA 3LKRB 3RVUC 1K4HA 4L56A 2VLLA 4WGHA 5CCJA 1FWRA 2PCPA 4DI8A 3LSOB 3WLHA 3GI9L 3EH3B 2NYYC 5D5MF 4B5TA 5AAWC 3VWJA 4YDKH 3WL0A 1B57A 2A5HA 3ARXA 1OYAA 2DN7A 2WGXA 4WJKB 4W81A 4Y4HC 2IPGA 4Q4OA 1REQA 4P5KA 4Y96A 3IJHB 3ULUL 3TBCA 5A40E 2CO6B 4MMZA 5EB9A 1R3IH 1GTHA 3PUGA 3AWEA 1IEBB 4GXPA 4JO4L 3L68A 2Z1PA 3SBQA 5DVKA 4QDPA 1IL1A 2KPWA 5AKSA 1UA7A 3GFXA 1SHSA 5A8NA 4WDIA 2ICWJ 4XKMA 3M0JA 3QWOA 3WO4B 1INQA 4MFEA 2HV5A 3VA2C 2YA2A 1AD9B 4BWUA 4KPHH 3GMQA 4BF7A 1CIDA 3PFUA 1XBXA 4I9JA 4RV3A 4CN1A 1UATA 5D2VA 3B4NA 3IWVA 2X70B 4W9CC 3IS4A 3LUTA 3H3KA 1V51A 1QA9B 5GGQH 4BKNA 1JXGA 2VCBA 4JN1H 5H94B 3GLAA 1KTJA 1CLZH 3A4XA 1JCNA 1ESWA 4AY8A 3ZYZA 4F7TB 2W9DH 4AC2A 3EJZD 3QUXC 1FL6B 3TGXA 2EVFA 2EE0A 4S10A 3ARBC 3L3GA 4DK3A 3LPFA 1R0MA 3C8FA 4JAMA 3S37L 2VXVL 1W8GA 5T9CE 4WGWB 4G8GE 3MMTA 3GVVA 3MMEB 5LGZA 4C58B 2XTLA 3LKQA 1GS7A 4QXIA 5HYJD 3SKOB 5AZ2L 5C0JB 5B7YA 1JGIA 8RUCA 8A3HA 5HYJA 3UNDA 3MLPA 1KPRA 2NY7H 3GYEA 5FPIA 3RUGE 4ES8A 1J7VR 4YSEA 4NAQA 2ICEB 3THMH 4OGYL 5D1ZD 1XGEA 1V7ML 4R27A 4X7TB 2V3GA 5BRZB 4XD4A 3HHRB 1EMTL 2XZZA 3CDGA 3LKSB 2YJLA 4J23A 1DDTA 2G2NA 2YDRA 3DRQA 5D1ZA 1FUYA 4DOHE 1U5JA 4UOW0 5DQJB 2IPJA 3MBDA 1N4XL 5AHEA 2Q7NA 1NAMH 4TVCA 5IR1B 3U4KA 4NO5B 1GY2A 3VYLA 3QAQA 4X42A 1BVWA 3ZMNA 3WJYA 1OM9A 3O3AB 2H6PA 5E6YA 4Z77B 3VINA 2FBJH 2XSKA 1ZA6B 5FLUA 4M6ML 3KXFE 3IJYA 3PPEA 1A7OH 4QRRD 3VNIA 3WHE1 5EIIA 2NRDA 3MLWL 1JRCA 1IGCH 3CVHL 5EN2A 1T66D 1EGJH 3TVMD 4QRRA 3EYPA 2NY6D 1RIVH 3A6CL 2GQ8A 2GDUA 2YD5A 1RH9A 4K7PL 3TVMA 5AW5B 1RULL 1MMFA 3HPSA 1DLHB 5GGRA 2VEMA 1MQQA 4LTSA 3W2DH 3WTTA 4LVFA 3AIEA 4MJID 1HILA 1OAKH 2GSGA 3NQ7A 1A5UA 3W2JA 1ICQA 4JDBA 3FHEA 2P1YA 1QW7A 4U1LB 1EERB 4JYDA 4Y4FA 4TL4A 4QRTA 5IREA 1MF2L 2DIKA 1QWNA 2RHGA 3TEXA 4PJCA 3G6JE 3WQ6A 1W3HA 3EDJA 1DO6A 1QPRA 3WLWC 1D7DA 3UJEA 1CDGA 3JT0A 5DD1H 5D9OA 3A3HA 4WW2F 3AG4B 1FVPA 2PO6C 1SMAA 2NVCA 4WFEE 2GSIA 4AJWA 1XT5A 1A7NH 3KZSA 5HNNA 3MWAA 5TDNA 4CJ1A 4ONOA 5EBAA 1QFHA 4PUMA 3WQEA 5I8EB 5BMFL 3U2IA 3O1NA 2NY4B 1OZUA 2L04A 4O2FA 2YAOA 1W8SA 1IGSA 1BFNA 3FUJA 2ALDA 5BXFA 3OC5A 1EAJA 1T0NA 4F2EA 2GK1A 1E4NA 5J13B 1PZDA 2XTSA 4M6PA 1MHPL 4L8DA 3RMEA 4JDEB 2OPCA 1LQ0A 4Z7QE 3GG0A 2MIZA 3FOLA 4UMGA 4LPYA 3MRPA 3S1XA 4BFJA 3ITVA 4ODUB 2EH7L 4JZNA 1R3TA 2EGZA 2WM0A 4BCEA 3QJHA 3VKDA 3HF3A 3DX6B 3NDYE 3KXQA 2IAMC 3QRLA 1PNDA 4FOJA 3RWJA 2YX0A 2DMGA 3UG4A 4LV9A 4D9RE 3A23A 1XTMA 4Q6YA 4GC4A 5I6KA 4JTAA 3QJTB 4WQOA 3T7VA 4KZEH 1HJQA 3FMGH 3BSMA 1E4XL 1BSLA 5A6BD 4MA3A 5D8JH 5B39G 3KBPA 1SXCA 1JCVA 3S6DA 3QDJB 1TZZA 5A6BA 1A5FL 7PAZA 2N7SA 4QE4A 1R3HA 3MUHL 3VXTA 4JG0L 2CBOA 5F1KC 5F3FA 5AAPA 4PTDA 5FJUA 1XJBA 1MCDA 2Y5EA 3FUHA 4Q33A 5T91A 1MQ8A 1HFBA 1A6UH 4RETB 1IBGH 4F33A 4OCYL 3C6SA 3UYRL 5MENE 3Q5TA 3OXSA 2DLFL 1YKWA 5KJ7E 5JBEA 4LCYA 5DEJA 2AFNA 3CZJ