1KTBA

The structure of alpha-n-acetylgalactosaminidase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
388
structure length
388
Chain Sequence
LENGLARTPPMGWLAWERFRCNVNCREDPRQCISEMLFMEMADRIAEDGWRELGYKYINIDDCWAAKQRDAEGRLVPDPERFPRGIKALADYVHARGLKLGIYGDLGRLTCGGYPGTTLDRVEQDAQTFAEWGVDMLKLDGCYSSGKEQAQGYPQMARALNATGRPIVYSCSWPAYQGGLPPKVNYTLLGEICNLWRNYDDIQDSWDSVLSIVDWFFTNQDVLQPFAGPGHWNDPDMLIIGNFGLSYEQSRSQMALWTIMAAPLLMSTDLRTISPSAKKILQNRLMIQINQDPLGIQGRRIIKEGSHIEVFLRPLSQAASALVFFSRRTDMPFRYTTSLAKLGFPMGAAYEVQDVYSGKIISGLKTGDNFTVIINPSGVVMWYLCPKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The 1.9 A structure of alpha-N-acetylgalactosaminidase: molecular basis of glycosidase deficiency diseases
pubmed doi rcsb
source organism Gallus gallus
molecule tags Hydrolase
molecule keywords alpha-N-acetylgalactosaminidase
total genus 139
structure length 388
sequence length 388
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2002-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1ktbA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ktbA01
4FMVA 2ZX9A 3TW7A 3HG5A 4JCLA 4ZQRA 3WN6A 1KV5A 3KL3A 4K38A 3DKLA 5LZLA 3GXTA 1WOBA 5CGTA 1WXJA 3W7JA 4CVWA 2Q8ZA 3B0VC 3ZT6A 4M56A 4MJMA 1B2YA 3VSUA 1P5BA 1KTNA 1FBAA 3EX4A 3EDFA 3TR2A 4JFVA 1VFMA 2IQTA 1RP9A 2ZXBA 3BVVA 2OT1A 4UQAA 1XD1A 9CGTA 1S3HA 2UV8G 4DO6A 1IV8A 3WNMA 1DQXA 2Q3OA 3L4YA 3I7RA 1W5OA 1WZMA 1FWNA 2CLEA 1PIFA 1QPRA 2C18A 3PAJA 1XD0A 1PE1A 4IGHA 1TTJA 5F4WA 1QMLA 4O0KA 4GO9A 3E0IA 3NPWA 1EHAA 3DAQA 4ADSA 1KWGA 1AL7A 4GJ1A 4ADTA 3JR2A 4H8HA 5D30A 4AW7A 1M53A 2AMGA 1VCVA 3DKJA 4JTFA 3DENA 3LDVA 3IJ7A 3SFKA 1KM4A 2CW6A 4I7UA 5F2IA 3TSDA 1XXXA 1UBSA 2QCDA 3Q58A 3OLEA 1LRTA 1J0IA 5DN1A 1XH0A 2V82A 1G4EA 3HPSA 4ZQPA 4FXRA 4Z1DA 2QV4A 4AHPA 3TSMA 1AW1A 1Z41A 4WD0A 2ZRXA 5I3JA 1W5MA 3SSJA 4A22A 5F4SA 3UWZA 3MO7A 2VEMA 1XCFA 4PFMA 1H7WA 1Q3NA 4N6EA 1ICPA 4M8UA 2B7PA 1TQXA 4U2YA 3D0CA 5HUOA 2FFCA 4U4MA 4R33A 5CGQA 4UMBA 1KWKA 3L66A 1XC4A 1ODUA 4NXKA 3NQVA 1TTQA 3UWUA 3CWOX 4IMCA 4AB4A 4AIEA 1G69A 3CTTA 2P0OA 4FX7A 3PF3A 3DX1A 2EEXA 3NM1A 2BTMA 1CXKA 3BVXA 4K37A 2E6YA 2FPVA 3VX0A 1DJNA 3LB0A 3QEZA 4CNOA 1SO3A 4HNTA 1EPXA 1X8FA 5D05A 5LHEA 1A5CA 3L4ZA 4OV4A 3W1UA 3M44A 2XFWA 1SZGA 1LBMA 3LI0A 4O28A 1G1YA 1XV8A 1Q6LA 1MEIA 3B03A 1VHCA 3H53A 3GXNA 5A2BA 4AEEA 1TV7A 4G1KA 5D02A 1OX6A 1KFLA 4LRTA 4CGTA 3JRKA 4AHOA 4IWWA 4CN1A 4Y6GA 1UH4A 4P2VA 2NX9A 5K3VA 3VE9A 3P67A 4J9JA 3N34A 5TIMA 2X16A 3C3NA 2FB2A 1XDMA 1QW9A 3ECQA 3OVQA 2E09A 1H61A 3TNOA 2XN2A 3R12A 3I68A 4WOQA 5CLTA 1Y7VA 3PWAA 2E68A 2YXGA 3UD6A 3TONA 5DELA 1EP3A 4AMXA 4B5NA 1WV2A 3O1NA 1H7NA 3CB8A 4WY0A 1H7PA 1NM9A 4JTLA 1BLIA 1SR9A 5AC8A 5HWMA 1VS1A 3G3DA 5LHFA 3L65A 1GG0A 3L21A 4YWIA 4Q33A 3FA5A 2P10A 3TJXA 3MBDA 1QCWA 3QSTA 4PCSA 1IXOA 2OYKA 3RILA 2NV2A 1GJUA 5C5YA 5TD4A 2EAWA 4PL1A 2C15A 1V3JA 3DHFA 4YL2A 3W7RA 3ABOA 2ZXQA 5DBTA 2DH3A 3I7SA 4K39A 3TROA 4LOCA 4GUGA 1ZFJA 2GVGA 4UR8A 4LW7A 4UQ9A 1GYLA 3NXFA 2V9DA 1H60A 5AYZA 1LWHA 2CLFA 3GXMA 4WLCA 3FLUA 3QPYA 4CNNA 4NX5A 3UG4A 2C8NA 3CZKA 3PBUA 5F1UA 4K36A 1JGIA 3NL3A 2WOQA 1KTCA 3WY4A 1UKTA 5IM51 5D2WA 3W7CA 3HIJA 3EJSA 1M6JA 3E12A 5F2MA 5K4ZA 2ISVA 4BR1A 4N2YA 1Z48A 4IXHA 3W2UA 1XGZA 4JTGA 2C16A 1PPIA 3OLDA 3W7NA 3WENA 4JEQA 2GUYA 1I8JA 1KM3A 3BLFA 3L5MA 2BXZA 3W1NA 2E9BA 5FESA 4H8UA 2R8WA 5BMXA 3LCLA 3GNDA 3TQKA 1FCBA 2OYMA 1SO6A 3GAYA 5AHLA 5BRPA 4NNBA 1QDSA 3EJPA 2WJZA 1R30A 3NQEA 2W0UA 3NZRA 1QO2A 3THAA 2BZNA 2TYSA 4NUWA 1RQBA 1OF6A 2QCHA 1KXVA 1JVNA 5EL1A 4A2SA 3OIXA 3WY3A 3VGGA 1RZMA 2KZHA 2YFOA 4HHPA 3SR7A 4W93A 4XTDA 2RH9A 3T40A 1EO5A 2Y7EA 5F4XA 3OEXA 3G1XA 2WSQA 1BTMA 1I45A 2WQPA 3E49A 2WKJA 2X2JA 2EADA 4MY9A 1ZHAA 5FEXA 5I3IA 3A24A 1UCWA 1XBXA 4DELA 1UH3A 3A5VA 1H51A 1OK4A 4LS1A 2J24A 1MW1A 1W37A 4LY8A 2V5BA 1O5XA 4UFKA 1LZOA 2E5BA 3H54A 3FYPA 3VO0A 2FB3A 2QDGA 1MO0A 3PSWA 3LV5A 4AWSA 1Q45A 3N14A 1QO5A 1JCXA 3KHJA 5E0KA 2ZE0A 5A2AA 3KVKA 4JX4A 3ZR6A 2E6FA 3BMVA 4UFIA 4WQ6A 2Y2WA 3KRUA 2QCCA 1PS9A 3G3MA 2FJKA 3IIZA 4CQ8A 1W56A 2VXNA 4BFAA 4MB1A 2QAFA 1D7FA 1JCJA 3GKFA 3RU6A 1YYAA 3KEHA 1QI5A 2PWFA 5E0FA 1W3TA 4D2JA 1V5XA 4N9DA 5E9AA 1S5VA 1ZENA 2YSWA 3L9CA 5DBUA 4K8HA 1G4SA 4M6QA 3WK0A 3TE9A 1YTDA 4X3ZA 1TPH1 4FO4A 4MFDA 2AGKA 4AMWA 1Q6QA 3B06A 4UXDA 2QCDB 3TXVA 1VCFA 5AYXA 1DV7A 4UR7A 2OZ0A 1FWWA 3MWAA 2ZXDA 3EDDA 2VELA 3NR0A 2ZQ0A 3KL0A 3PB0A 4UTLA 3ABSA 3A22A 3MUXA 5AN7A 3M5XA 3DGRA 1SPQA 3W1TA 5EY5A 1UD5A 3E9AA 3NL6A 4RXFA 3GIYA 3W1LA 1GOXA 4LS2A 1WA3A 1GVOA 2CXGA 3SZ8A 3V1PA 5KZDA 4DQWA 5J5DA 3ZQ9A 1CX9A 3W3OA 5IBXC 1I2NA 2EGZA 4JTSA 3HGJA 4FLQA 3SI9A 2Y5EA 4J3UA 1OT1A 2OSXA 1JDAA 2FH8A 4M6PA 2ALWA 4AH7A 4FNPA 1KCKA 1KBIA 4HPJA 3MW7A 4BI6A 3EB2A 4ADUA 2XWDA 1KFCA 3VKJA 3WJSA 1FXQA 2DZSA 1TPEA 1ZY9A 3BMWA 3WK3A 3CLMA 2PE4A 4QNWA 2JKAA 3II1A 3LCXA 1H5YA 1SW3A 1JCNA 3FAXA 1ML1A 1VRDA 2ZTJA 5I24A 5A8GA 3KX6A 4O16A 3L2IA 3LLFA 4XZ9A 1QW8A 1G4TA 3UWYA 5CZJA 1LOSA 4RCXA 3MYPA 3PBVA 1TQUA 3E02A 4NI3A 1L6SA 2FTPA 4MPQA 4QAIA 2WVSA 1L2UA 4PTNA 4O1AA 1R34A 3ANYA 1VHNA 1WBHA 3TOPA 2ZXAA 3VGDA 3O07A 1XBVA 2Y6ZA 3PY2A 3W7EA 3WJZA 5L6UA 1RPXA 4RV8A 1AW2A 4WXYA 3CU2A 3LGEA 4AHQA 1U2YA 3AO0A 1VIWA 1JRCA 1IGSA 4CQAA 1RP8A 1UD6A 1G7UA 3LPPA 3TMLA 1GVFA 3N2MA 3SW6A 2I1OA 4CCDA 5HMSA 4UTWA 3BC9A 3BG3A 1MW3A 2EO7A 5D09A 3BAYA 3K1DA 2BLEA 5DO8A 5E1QA 2PWHA 2QPUA 3BV4A 3HBLA 2ISWA 1E3XA 3CPRA 2VNCA 3ZSTA 1JJKA 1JF6A 1O7DC 4XUGA 2H90A 4J7RA 4MY1A 1Z44A 3PBYA 4FB7A 4NXSA 3NDOA 4YLWA 1FCUA 3TSBA 3W2NA 2EHHA 2Y62A 4UZUA 1AL8A 4HPXA 4NJJA 5I23A 1OFDA 4PEKA 3EWUA 3WNOA 1F6KA 1XDLA 1QPQA 3KRSA 3EKZA 2ISSA 4CN4A 1MW0A 4O1BA 2C14A 1SMAA 1KM0A 4UTJA 5CZSA 4LVAA 2OMAA 3TIMA 1AG1O 3WNLA 4GI9A 3TQVA 5I0DA 1GEQA 3DFOA 2ZBTA 1F73A 4XWUA 1JCYA 4I9AA 2EAEA 4JTJA 2DJLA 4FIRA 1EEPA 3TDFA 3RLVA 2VFHA 3S1UA 3U8GA 2XWEA 2YA2A 2BX7A 3UZJA 4FNQA 2OT0A 4O8RA 1XBYA 1HO4A 2JKEA 3GVGA 3WFZA 1WDWA 3L4TA 4JFTA 3O6DA 1V7YA 1G6CA 3IVUA 4NQ1A 2BY0A 3G1SA 1TCDA 4UNKA 4WOZA 1JI2A 3TKFA 2VRQA 1R75A 3NPVA 1HTYA 4AYGA 1KCLA 1P4CA 2XVGA 2OJPA 1MXGA 1D3CA 4EF8A 3W1QA 5BRBA 1WQ5A 2ZA2A 3UYCA 4UOZA 1GTEA 1U33A 1JCMP 2FIQA 1KTBA 2QUUA 3CGTA 1VPXA 5G2IA 4PSRA 2WNNA 4K8EA 3LCIA 5DCBA 4LS0A 5IBXA 3EX6A 1JG9A 4PH6A 1C8VA 1DORA 4MJZA 5AHEA 4LTSA 2NWRA 3ZR4A 1R46A 2FDSA 2OW7A 3KFTA 3P5YA 4UMCA 1M7PA 1TPUA 1OGSA 3HG4A 3IGUA 3EXRA 3G8EA 3THQA 4MFEA 4MIMA 4HNUA 2V3DA 3CC1A 4JICA 4MOZA 1BVNP 4JXCA 1R2SA 4JCMA 1S5WA 3VMOA 4KFNA 2AQWA 2QJGA 2E6AA 1MFVA 1SU5A 3D4ZA 4E2DA 3L2LA 4IX2A 2WVTA 3GZ3A 3LHZA 2V81A 4LWWA 4KWUA 3LRKA 4DBDA 4JS3A 5A5WA 4S2BA 4UFMA 1MSSA 3CPUA 3L68A 2C6QA 3G0SA 3W1XA 1JDDA 2VUYA 2YA0A 4O54A 3TV8A 3BVJA 4UIOA 3LM7A 1B4KA 6ALDA 2Z2UA 2YZRA 4NJHA 3R8RA 4LXFA 1CXLA 4LRSA 4LQ1A 3W1AA 5CPLA 4JTTA 4UTKA 3QFEA 3M43A 8TIMA 3WDIA 1P0NA 1C29A 4ZQMA 2WVVB 2EJ1A 1EP2A 3VNZA 1LLZA 1VFUA 4MYAA 4HP5A 5HR7A 1EO7A 4B9ZA 1TPFA 2ZIDA 1VB9A 3DX0A 3IIOA 7CGTA 1FXPA 5FEPA 4HNVA 1PHWA 3G0UA 1A5AA 1MXDA 2Y24A 2FH6A 1F05A 5HR6A 4WSJA 4OQVA 3C8FA 5G1TA 1YXCA 4O53A 2Z1BA 2WVUA 4CCEA 1DKWA 5AHNA 2FPYA 2O7QA 1KM1A 3GXPA 5KSWA 1ZAIA 3OVRA 5TBOA 1TQJA 3LXAA 3W6YA 4IMGA 1AQMA 2BWGA 3W1MA 1IZKA 3WMSA 4HSOA 1TPB1 2VFFA 4O14A 2FHBA 2QCGA 3NA8A 3S8HA 2DZWA 4LT9A 3VFLA 4TMCA 5HWNA 4TVUA 2OSWA 4WZHA 5K9DA 3Q37A 1G94A 1UOKA 4RXGA 2O7SA 5LNSA 4E38A 3PBWA 3G1AA 3ZO9A 1KB3A 1J5TA 3K8MA 1OF8A 1L6YA 1GZGA 1TMQA 4J28A 3ATYA 1TB3A 4XB3A 3BG5A 3WDHA 3QMTA 3O6YX 1UA7A 1CGWA 3P81A 2E0PA 4JDBA 3T44A 3TTYA 2CWNA 3ZSSA 3T7VA 1LCOA 3NL5A 4JTEA 3W7DA 4MAZA 2I14A 1CGTA 3QMRA 3N9RA 2BHZA 3W75A 1SFLA 4KFPA 3OA3A 4AEOA 1CW2A 3PM6A 4GNJA 4KFOA 4CN6A 5GVJA 4GUIA 3EJTA 5K7JA 4UQEA 4ONVA 1LOLA 4WSKA 4JY8A 3MI2A 1DOSA 5KEZA 3FKRA 3CM4A 2GUUA 3DC0A 1SFJA 4O1CA 3PSVA 4PODA 4JTUA 2F18A 3MHUA 1TJRA 4MYXA 3WY1A 1KV8A 1ZJBA 3A47A 3Q94A 4UCGA 2NWSA 4OV9A 4JL1A 3IVTA 1O4UA 3L0GA 3RFAA 3GAKA 3UPBA 1KM6A 3HJEA 3BO9A 3DFTA 4GBUA 1R33A 4M7TA 1O95A 1QPOA 3EWXA 4OE7A 3KE0A 1CPUA 4UTTA 1OABA 1FX6A 4KMQA 3QC3A 1X7FA 1QWUA 4UCFA 3QM3A 1CGXA 2X1RA 3T55A 1SZNA 2ZUVA 4S1FA 1U83A 3P74A 4O50A 2ZRWA 3UQNA 4HOXA 2PRHA 3B0UX 4XQ6A 4EIVA 1TIMA 2RHGA 1LORA 4M5PA 1TQTA 1FWSA 5CXPA 3DFNA 3GDLA 2PC4A 3A21A 1I2RA 4CCCA 3P8JA 4UTWC 3K8LA 2FQIA 4M6VA 3SECA 5HNRA 1TTIA 2J27A 5LNRA 4OGZA 2ABBA 1JF5A 2WSKA 1W0MA 3NQ7A 3GK0A 1TV8A 4L4MA 2DZVA 3EWYA 4LV4A 3B05A 3W74A 5CPOA 2ZUUA 1J0KA 4N9EA 4O10A 3IEBA 3O63A 3G8RA 3ELFA 5D2TA 3ZOAA 4ALDA 5G1YA 3LX9A 2QMJA 3YPIA 1QOPA 4JR5A 5G5IA 2AAMA 3SJ3A 2F7QA 2D3NA 2QR6A 2ZZ7A 1CXFA 5DCEA 1F7BA 5AHFA 3UEQA 4OWGA 3FS2A 1QI3A 3RLUA 2WPGA 4BI7A 5D33A 4QSHA 5HDRA 1PIGA 2F1AA 3MJYA 1TPVA 2JK2A 3QRHA 4ZVJA 3IVSA 3DH7A 5D37A 2Y85A 2FGZA 4GUJA 4A3UA 2HMCA 4U2ZA 1GT8A 3NEVA 3W37A 1FDYA 3NYZA 4JX6A 1KBBA 1ADOA 3KVLA 1KBJA 4BA0A 1DL3A 5FEZA 3T4CA 1LRQA 2ZZ3A 3W7QA 1KFJA 5KZMA 4Q4KA 2CLIA 2V5LA 3VM5A 1GJPA 1H63A 3QGVA 1AW5A 3MMTA 1HTIA 3TX9A 3QQ0A 2PWDA 3NGJA 2G97A 4IPIA 1RPKA 2GVLA 2V30A 1YDVA 1PZ2A 2PWEA 1K8YA 3OLIA 1WE5A 1H1YA 1LDCA 1R47A 1ME9A 1TV5A 4JFSA 3UCQA 2X30A 2G96A 2E6DA 1MW2A 5C6MA 3QQ1A 2XN0A 4CLMA 1YDNA 4LU0A 3PVFA 3AXHA 3L4WA 3L0NA 1CYGA 1CXEA 2CLKA 5LNWA 1B57A 2YDAA 2WSYA 2LLEA 1HNYA 1OG0A 3T78A 3QW4B 3HB9A 4FXSA 1SW7A 2C7FA 2CZDA 2V0TA 3FEMA 1OX4B 1K8ZA 2DU2A 3DFPA 1L6WA 3M41A 4ZQCA 1EH9A 4O52A 1J2WA 5DXXA 1J0HA 2DJXA 3LHUA 4CKQA 3MP3A 6TAAA 3AJ7A 2ZZ2A 3F4WA 3WEMA 4DF1A 3TQ0A 3RMJA 5CPNA 1Q6RA 1H1ZA 3G18A 4JYDA 1R2RA 3OLGA 4L4LA 3D52A 5CSRA 4OJYA 3TXZA 2E4TA 2PCQA 4MLRA 2CU0A 5LKYA 3BSHA 5LGXA 3PB2A 2D2OA 4H2CA 5AYYA 3EXSA 4X9SA 4LC6A 2F2HA 1K7XA 3HPZA 4IMDA 1QWGA 3VNYA 3VSTA 2CPUA 2PURA 2ZCGA 4LUIA 5D04C 2A2IA 1AMKA 2RKXA 2G3NA 3NG3A 1ALDA 4ZZ9A 1K7FA 4OBTA 3WDJA 4MKNA 2QJHA 3GX9A 2G95A 1TSIA 2YIHA 4I7VA 3EXTA 3PULA 3DI1A 3S5NA 1O94A 2FLIA 4N02A 3MP5A 5DXYA 5D2VA 4JN6A 4QAWA 3LRMA 3GYEA 5F2LA 5KTLA 5DY2A 3SY5A 4AF0A 5K4XA 5BOOA 5LNUA 4LVBA 4Y8FA 3LBMA 3RK8A 1KXQA 1TRIA 3P60A 4LV9A 1J4EA 3C56A 1JD7A 1LOQA 3S5YA 1HFBA 4R7JA 4O15A 3VGFA 2ZUWA 1PEZA 1YADA 3CEUA 3G22A 4HOZA 2V8ZA 5A6LA 1BWKA 3GDRA 3ZT5A 3TU9A 3NQCA 3DFSA 1K8XA 3FJ6A 2VFEA 2WPBA 1T0OA 4H8VA 4QISA 1NFBA 3NNTA 3W83A 1SO5A 1FCQA 5EMYA 1I75A 1BWLA 1TTPA 3M0ZA 3VGBA 4DO5A 3PC0A 3CIXA 2IGTA 4FLRA 1H7XA 4GWEA 3RNDA 3O15A 4Z0SA 4UFHA 3C6CA 4GKLA 3UG3A 1HL8A 3HG2A 1D3GA 1WOAA 2ZZ5A 1KLYA 1W31A 1KFKA 2YOCA 4J3SA 3W2MA 3ZFHA 2ZUSA 1W3IA 2WSRA 1OFEA 3BGGA 2Y61A 1XSJA 2WCGA 3DZ1A 4O57A 4AYSA 3UWVA 3BLBA 3DDGA 1QX1A 1WZAA 2WANA 4UTIA 3HG3A 1EWDA 2JGYA 4DO4A 2CZ5A 5FF7A 2Y89A 1JUBA 3NQFA 3WELA 1C9DA 1S5TA 3M9YA 1XUZA 4Z08A 2VFDA 3R89A 3BVWA 4AEFA 4LUJA 2A0NA 3GNNA 4DBEA 4I7WA 3TFCA 3I6RA 3IGSA 3OG3A 1WO2A 3S5ZA 2YR1A 3C61A 2E5DA 3DXIA 3TAKA 3UXAA 2QCEA 3M5YA 4MUZA 3PUDA 1P6WA 4GRSA 3NO5A 1QFEA 2GJNA 4S2CA 4HPHA 2WKLA 2A21A 3EKLA 2QCFA 1SW0A 1IXPA 4WXZA 5HQEA 1OSEA 1FCVA 2QCMA 2YW3A 3HGRA 2OYLA 2QMKA 1XCXA 1PV8A 3NPUA 4JTIA 1ZJAA 1O60A 2J9YA 2GQ8A 2G3MA 1T96A 4XBSA 3HO8A 4GI6A 1KXHA 3LLDA 3OVPA 4NJGA 4TO8A 5BNKA 3TCEA 4GINA 3BAIA 1IXQA 2A4AA 5D2YA 6TIMA 1OFPA 2NV1A 3P8IA 4TR9A 3IIXA 1BSIA 1J0JA 1ME8A 2Z6JA 2WV8A 4FF7A 3WJWA 3VU2A 2FE0A 3LHYA 2YKKA 3D4YA 3KVMA 4MLJA 1QWNA 1UUMA 1YLVA 4UQCA 3KLKA 1DQWA 3R5EA 3AXIA 5KINA 3B04A 5FF3A 2PWGA 3Q2DA 3KXQA 3EWWA 4TIMA 4HIBA 2ZA1A 1Y0EA 2YGYA 4HA1A 3FIGA 3FOKA 3M5VA 2GJRA 2ZUTA 2QCNA 4JD4A 4O17A 3MBFA 2ATSA 3W38A 3LOTA 4JYEA 3LPOA 2Y7DA 1LYXA 2R94A 5D03A 1EB3A 4N6FA 1WZKA 3W87A 3HMJG 4QITA 2TMDA 3O16A 3HOJA 1IIHA 1JULA 4Z0JA 3BW3A 2JGQA 4NU7A 4JDYA 4PSPA 1ME7A 3CZSA 2FHCA 3LV6A 4FX8A 1JXKA 4KWVA 4JX5A 4NZFA 4GQRA 4FHAA 2B7QA 2I9EA 1B0IA 3L4VA 3UY7A 3N2XA 3WK2A 3F03K 2CLHA 3W70A 1KGWA 3HPXA 1VAHA 4ORMA 1F76A 3PG8A 3GBEA 2NXGA 1W5QA 2VEIA 4U28A 5L9FA 1YTKA 4H3DA 3P84A 2VOMA 1PL9A 5HUPA 1XM3A 3S1VA 1OX5A 4BF9A 3EJQA 1FDZA 1GTHA 3NOEA 3M5ZA 3BAWA 5E93A 1QNVA 3WJXA 4IXXA 3GXDA 1B4EA 3NPXA 2QUVA 5BRQA 5ABTA 3LRLA 2H3DA 2DP3A 4FX6M 3FAWA 1CLVA 1QPNA 3KOFA 4UQBA 2ALDA 3S2CA 1ZS2A 2BXYA 1H7OA 1TQWA 3PG9A 3QW3A 4CQ9A 3QMSA 4Y90A 4EVZA 5HJLA 2PRLA 2ZWYA 1N7KA 3UY8A 2Y7FA 3EWBX 2VEPA 3JS3A 1EWEA 3NL2A 4ORIA 5I3GA 3D51A 4UTHA 3C52A 2D0HA 3DX4A 3BUDA 4NJKA 1HG3A 2VT0A 3GR8A 3P5ZA 3STEA 3G24A 3IV3A 1BAGA 1A50A 7TAAA 1F5ZA 1W54A 4N9CA 1MFUA 3ZR5A 4QJ1A 3MYOA 3BGJA 1YXYA 4IMEA 1OX4A 3SIZA 3C2VA 3LTYA 4X0NA 3LXBA 4GXMA 3RIKA 3QYQA 1U30A 1VFOA 1MEWA 1HXKA 2F61A 4FNRA 4IJBA 5D2XA 3NQ8A 5CZTA 3EDJA 3WNKA 3KWXA 1W5PA 4DEFA 1JCLA 1BG9A 3GLCA 3L5LA 4RLIA 3G1VA 1KFBA 3VMNA 4U3CA 3CHVA 3FYOA 1IZJA 3BAKA 1XKYA 5FF0A 5I3FA 1CGYA 2NXIA 1G9HA 1M7OA 1XBZA 4H4IA 2WNWA 1LM1A 2YYTA 4GIAA 4O18A 1KFEA 4X9YA 3B4UA 3CIWA 2R91A 4HOWA 2WNQA 3A5FA 1HX0A 1DTUA 1JQXA 4C1KA 1JXJA 4JFWA 4IPJA 4YCOA 1D9EA 5AOUA 2ZWZA 1G4PA 3M6YA 3NQGA 1JFHA 1W5NA 4O12A 4QIUA 4AF0B 2NUYA 4UUIA 3LTSA 2GQAA 1PAMA 4MZ8A 4RZ4A 4UFJA 2QUTA 4N4PA 3QPZA 2CFFA 4NNAA 3CTLA 4RX0A 3TC6A 1TO3A 3GXIA 4Z1CA 2A1YA 2X2IA 3BUQA 4Y96A 4AXKA 3FJLA 1KXTA 2NX3A 4MZYA 1FY6A 2QLYA 3PUEA 3CLWA 3VX1A 4ATWA 1V3MA 3BCDA 1OJXA 3W9ZA 3W88A 3W7LA 4UTMA 2BY3A 3LBCA 2EKCA 4GUHA 3AMKA 1YPIA 3EWZA 4M7SA 4PC8A 3M07A 4XBKA 2E8ZA 3PUOA 1X1ZA 1I2QA 1JIBA 3P82A 4C1LA 4CNPA 2ZRYA 4ZQNA 2F7OA 2OW6A 3DHDA 4NJIA 2DZXA 4XTIA 2XVLA 4H6KA 3UWWA 3G0XA 2WKGA 3PS7A 4ZQOA 1OHLA 1YTEA 1F2JA 1CDGA 3QZEA 4R34A 5G4WA 3W7OA 2NXHA 4O4WA 2J25A 2X1SA 5HINA 5CLWA 1EX5A 1K7EA 1KW1A 3S9YA 4WJEA 2H6RA 3N19B 2J9ZA 3GXFA 1MWOA 2QDHA 3BARA 5AHMA 2NT0A 1GG1A 2A5HA 1K3UA 2H8XA 3E96A 1E51A 4FLSA 5A6MA 1UA3A 1A47A 2V3EA 2ZX5A 3LHWA 2ZZ4A 3R13A 2ZRZA 3MI3A 5LGZA 2C0AA 1GCYA 2ZRUA 1CGVA 1KGUA 1XH1A 3A23A 1PJ9A 3BVUA 3BH4A 4E2OA 1N55A 3K30A 4RKAA 3UWQA 1TRDA 3DHPA 3CV5A 2XIIA 3IK2A 2EPHA 1FDJA 2VEKA 1GYNA 3RF9A 3VNDA 1H50A 4Z1AA 5G2WA 1VYPX 1IXNA 2J6XA 5SWUA 4LPCA 4Z1BA 3HQ1A 1DEDA 4KWWA 4NNCA 2QF7A 3G1DA 3WNNA 2C3ZA 3BUBA 4O13A 1K02A 5DCDA 4GC4A 1VLWA 4MVAA 2J88A 2VFIA 3BG9A 2GVYA 2D73A 5E6ZA 1WAUA 4ML9A 1A5SA 4HSNA 4GQQA 2ZA3A 3W7GA 2NZLA 2B4GA 2OSYA 1NEYA 2Z6IA 2NT1A 1XSKA 4AVFA 3STFA 4GFSA 3BSGA 4U31A 3CQ0A 2E1DA 5CGMA 4LVGA 4UC5A 5LSMA 1JQVA 3TC7A 4JIQA 1OYBA 3NQ6A 1DBTA 1OFRA 3LERA 4K7YA 3S1WA 1CIUA 1TQVA 1UH2A 1A53A 4PL2A 5HXMA 4J3VA 3C2EA 5FF2A 5FI8A 2RDTA 1WZLA 3QH2A 1TREA 2VKZG 2DIJA 3L67A 4OU1A 4AWUA 1AK5A 2DZUA 1KM2A 1Q4NX 5D38A 5G2HA 3KL5A 5A2CA 5DLCA 1WYIA 1BVZA 4Y9AA 2HS8A 1MVYA 3VMPA 3AMLA 4JNMA 3WFAA 3L5AA 3V75A 2D3LA 2P1FA 3BLPX 4KKXA 4LC8A 4MZ1A 1E40A 2YA1A 1V3LA 2CLMA 3LCFA 4WY0F 1YPFA 1MXSA 3UNDA 4ZMGA 3EDKA 3DU0A 3C4UA 1UKSA 1HVXA 3UXDA 2NLIA 2RDUA 5FEWA 2YJQA 4TU1A 4N9BA 5FF4A 3IJ8A 5F1VA 4UTUA 2XVKA 2HSAA 5T26A 1EP1A 3STCA 4HNNA 2ATMA 4AWTA 2A7NA 1CXHA 5H91A 1OT2A 2Q3RA 3C2FA 1U5JA 1OYCA 1DJQA 2H3BA 4EF9A 3BLEA 1LBLA 3GB6A 5EA9A 4RK8A 1FQ0A 2D0GA 4UZSA 2BSLA 3GDTA 4GE8A 3TK7A 2C19A 3N3MA 2F84A 3KAOA 4GI8A 1WP6A 3AJXA 4UMAA 2QJIA 3EX3A 5H2ZA 3EEGA 4JFUA 2VENA 2WSPA 1KM5A 1RQEA 4PCFA 3BW2A 2H8ZA 4NT0A 1D3HA 4UNIA 2ZX8A 3UG5A 1M7XA 3CZLA 3L2MA 1SZEA 4HKPA 3QSRA 2B0MA 2JKPA 2ZFAA 4MY8A 1SQ7A 4XKYA 1VGAA 3ATZA 4JL2A 2V2HA 3MHFA 3W07A 3CZGA 3W7PA 3MI6A 3KVJA 4GUFA 1DHKA 3C2RA 1KA9F 3LHVA 4NVTA 4FNTA 4A2RA 3TUUA 1GVIA 2OCZA 2A6LA 3FW6A 1EA9C 2E8YA 4OT7A 3GKAA 7TIMA 3TFXA 1JUEA 1L9WA 1I2PA 3NM3A 4RJEA 3A6OA 1PHQA 1IF2A 5AC6A 1W8SA 3BVTA 2Y88A 2BHYA 2DZTA 3TW6A 5AB3A 2ZYFA 1EUNA 1PIIA 3MP4A 5C2XA 4BWLC 1HL9A 2YW4A 2EABA 3BLKA 3S5OA 2Z0IA 1X6UA 3W1PA 3KRZA 5J5RA 1UASA 2BY1A 2X1TA 5K9CA 2Z1KA 4ZL1A 1KLZA 1PVNA 3M1ZA 4FEZA 3DI0A 3NZ1A 2GVJA 2NX1A 3CZNA 2F7PA 3CWNA 2X1UA 4EOUA 3HJZA 2VR5A 4HT3A 2EACA 2A6NA 2V2CA 2Y7GA 1VLIA 1Q6OA 3G1YA 3CT7A 2W79A 4K7VA 2W6RA 5EPDA 3W7IA 3B8DA 4FIQA 3EDEA 2ABAA 4UNLA 2V2DA 2QAPA 3UPWA 3P80A 5EYWA 4X22A 2EQDA 4AAJA 2AAAA 1ZNNA 4YMZA 2VC6A 3TTSA 1QHPA 1XL9A 1C8QA 4J27A 5KITA 4AMAA 1V3KA 1EUAA 1LWJA 1XSIA 2Y63A 5I3HA 3GTNA 1LRNA 3OHIA 3PR2A 1TPDA 1QI4A 3F1QA 2NSXA 2VRKA 1XFBA 1HUVA 1JL8A 5F2GA 1W3NA 1JAEA 1Z42A 3QF0A 1VJSA 5F7UA 1ZJIA 1G67A 4U33A 3HF3A 4OKDA 2GQ9A 3P61A 1WX0A 1RVGA 3S6DA 1OVDA 3VSVA 5E70A 4PA8A 1JUKA 4JTKA 1DHPA 2CLLA 3K8KA 1LROA 4OHQA 1HL2A 1ICQA 1LBFA 3DX3A 1RD5A 2HS6A 3N9SA 1H7RA 4WF7A 2WO5A 1VQTA 1ICSA 3WY2A 1RV8A 1G7VA 1QAPA 5AC7A 1UJPA 5DY3A 1VCGA 1A5BA 1HWWA 3W71A 2FPTA 2C13A 4J3TA 1JDCA 2Y4SA 2OX1A 1TQSA 1QR7A 1R2TA 1GVSA 4P61A 5CSSA 5KZEA 1XH2A 4TMBA 1BKSA 4POCA 3NVTA 3W2KA 3W7HA 1BPLB 1UD4A 3NAVA 2WC7A 1XCWA 3W73A 4JIPA 5CPMA 4O1DA 3ZWTA 3BAJA 3GDKA 2RFGA 4EWND 1EIXA 2TPSA 1XI3A 4UOQA 1VC4A 5HPOA 4DPPA 1ZAJA 1RQHA 5CZ0A 4RZ5A 2BXVA 3A9IA 3W22A 2RDWA 3NQ2A 3GDMA 3VM7A 1SO4A 3S0CA 1ZAHA 3IGXA 1ZALA 1GVRA 1H3GA 1OK6A 1I4NA 1TMHA 3M7WA 3BLIA 1YDOA 3BUIA 3WJYA 3VE7A 3F4NA 1SSGA 1TYGA 1B3OA 1OFOA 4UFLA 4WY0B 3W2JA 4QQ3A 3W85A 2FHFA 3O6CA 1AQHA 4UTTC 4JGDA 1MZHA 1NSJA 3I7QA 1CI1A 2DZPA 1SZFA 3W72A 5I5RA 1JD9A 2A7PA 1I2OA 5EBUA 4DPQA 2ZZ1A 1YXDA 4DF2A 2CHNA 1NOFA 4LVFA 3C2OA 5CKSA 4NX0A 3STGA 3HZ3A 3S1XA 1X1OA 4BWLA 3W1RA 3LTPA 2GPTA 3DBPA 1PCWA 1GWJA 5U4NA 3GBDA 2X2GA 3BW4A 1WPCA 3O8AA 4LVDA 4O4VA 5BMWA 3L0KA 3QJAA 4M19A 4DF0A 3FFSA 5TQLA 4X2RA 1JI1A 2TAAA 2YFNA 2WNZA 1QHOA 1UD3A 1M5WA 4QNEA 3LCGA 2WCSA 1TPC1 3P62A 4W9TA 1UD2A 1DVJA 3SGUA 2R14A 4RR4A 3TA6A 2ZX7A 4BZYA 3W86A 4LNYA 1IIGA 5G4EA 3W76A 1BEUA 2QCLA 1RR2A 3C0JA 2F7FA 1W1ZA 2EF9A 3VGHA 4UQDA 1UB3A 5HWJA 4B9YA 2HTMA 4PCTA 2X2HA 2YX0A 5K9XA 2YCEA 1SUXA 4A21A 3EJUA 2TSYA 2ZRVA 3LI1A 1H62A 2ZZ6A 1AMYA 1HO1A 4J3XA 4IUOA 2J9XA 3G1FA 4N4QA 2E77A 1CXIA 2BY2A 3O05A 3MHGA 3M47A 1N8FA 4JYFA 1NAL1 3P7YA 8CGTA 5I3KA 4GO8A 1VH7A 1LP6A 4DXVA 2DORA 3ZWSA 2A85A 3O06A 5C54A 1CGUA 4QM1A 3L4UA 1E43A 4WX2A 4RZ6A 1BF2A 3BK0A 3KLLA 1E3ZA 2PRMA 1VYSX 2Q8LA 5AFDA 3TJLA 3B0PA 4IOTA 2YPIA 1P1XA 1SSDA 4R53A 2E5CA 3WNPA 3ZS4A 4A29A 4WUIA 2ZDRA 1NVMA 1GVQA 3M16A 5EKYA 1AVAA 4FNSA 2JBMA 5C55A 1UKQA 2D0FA 3D50A 3BUPA 3U2OA 3VI2A 1KBKA 4XKYB 1B9BA 3ABRA 3R2GA 3WEOA 2GJLA 2CZEA 1OB0A 4H7VA 3NQDA 5KMYA 3EX1A 3BAXA 3INPA 4HN4A 4BI5A 3GR7A 4YXGA 3N73A 1K03A 4IMFA 1NF7A 6CGTA 4FNUA 1QPKA 3IRDA 3U6WA 2NUWA 5EMUA 2WVVA 1GQNA 1TCMA 4ICNA 3LXCA 2GOUA 2NUXA 2ZX6A 3WK1A 1VZWA 2YYUA 1VR6A 1HT6A 2BHUA 4O19A 1G5AA 1NF0A 1S46A 3TH6A 1JRBA 4IX0A 1THFD 1UUOA 5CG7A 3USBA 5K2ZA 4FLOA 1SMDA 2XIBA 1UD8A 3W84A 1OFAA 1OYAA 3H55A 3I65A 2XN1A 1Z32X 2C1HA 1P0KA 3NQMA 3ZT7A 4OIFA 3L4XA 1ONRA 1OFQA 2F1BA 3BPWA 1XUUA 2Y70A 1FWRA 2QPSA 4O11A 1T99A 1PZ3A 4PEEA 3IIVA 3ABQA 5HULA 3IJ9A 2TRSA 3LCHA 1GJWA 1QOQA 3EJRA 2VFGA 2V3FA 5BW6A 2DIEA 1T8XA 2ZICA 1OFBA 3UERA 1MEHA 1GPWA 4IQLA 4O0ZA 3W7MA 3A4AA 2B7NA 3W2LA 2QKFA 1KGXA 4BK9A 5AHIA 5U7SA 3IIPA 1LTDA 2F7RA 1O5KA 1TPWA 3DFQA 3HGOA 3S42A 1W9XA 5E6YA 3CZEA 3OBKA 3W7KA 1JR1A 1FWTA 2CZFA 3G1HA 1F74A 1LLWA 3UZ5A 2DH2A 3VGEA 2A7RA 3VCRA 2FYVA 1FUYA 4YCPA 4AIOA 3DDFA 1EA0A 3BCFA 1PCKA 1ZCOA 1VYRA 2CLOA 3TMQA 3HGSA 1VJIA 5LNVA 1WBJA 5MHBA 3SGZA 3CEPA 4K6AA 3DHUA 2GJPA 2ZTKA 3FKKA 1PS3A 5DFAA 1F6PA 4E0CA 3LCWA 4Q32A 2QEZA 5D32A 4NZJA 4TX9A 3W23A 4J3WA 4E2BA 2G5WA 3DX2A 3LHTA 3EX2A 1L0PA 3NQAA 2B7OA 4JY9A 4JTHA 1TJPA 3TAOA
chains in the Genus database with same CATH superfamily
2NY3B 2ZX9A 4FMVA 3QEGH 4YDLC 1N5AA 2X70B 3HG5A 4GKSB 1GORA 1CJYA 1KV5A 3KL3A 3UX9B 1DN0B 3ZE2F 4K38A 4D6IA 3GXTA 4JFOB 1X3DA 4GG8B 4C54A 4ZBCA 4AIUA 1BZ9A 2W9DL 2YUWA 4GMTL 4Q2ZA 3HN5A 3C60A 4X2UA 1FFPB 4X8CA 4CVWA 1WXZA 3MRIA 4Y5VB 1ACXA 3VSUA 4FS9A 1SDDB 4Y4HD 4G8GD 1CC3A 4IRSD 4PB0H 4PRIE 2H2SC 3EX4A 1BD2B 2ZWNA 4LLWB 4JFVA 4A1RA 3GHEH 3ARDA 1H3XA 2IQTA 2JCCF 1RP9A 2R29H 1OVZA 1Q0YL 3BVVA 2EUVA 1UP2A 2FVKA 2OT1A 4LLQB 2YZ5A 4AL8H 4U0QB 1NIFA 3AAZA 5KSBA 2UV8G 4Q14A 4LEBA 4MQXC 3WNMA 5ADPL 3H2CA 1GC1H 2BINA 2I07B 3L1FA 4PGCA 5F97E 3FUIA 3CFTA 4GXPA 5AY7A 1XD0A 2BK8A 3T4AC 1V0KA 2X4QA 1FTXA 3QUYC 1C93A 1E8ZA 3I6KA 4PWHA 2FEEL 1ZHNB 1KT2A 1QMLA 1ZGLP 3V8OA 4HEMA 4YXKH 1KTLB 2ADJA 3MKKA 1KWGA 1MCOH 3HEIB 5L8JB 3SUVA 4H8HA 3WLTA 5KYNA 5E9XA 2BWQA 4O58L 4AW7A 3VFWA 2FVMA 1TU2A 4PJBF 4B9JA 4MKTA 1M53A 2AMGA 1R3HB 1SOSA 3O3DA 3EFFA 4JRYB 2YD2A 4JHVA 3O2LA 3OGRA 5DO2C 2WZAA 1WIOA 1PDKB 1DVFC 4JPGA 2HT3C 3DENA 3LDVA 1YA5A 4WENB 4F9PC 3IJ7A 2RGLA 3SFKA 1NIDA 2O5XH 3F7QA 5GGTA 2B8OT 4D0CB 1KM4A 2O92A 4I7UA 1H15B 4AZHA 1RCQA 5DRZB 1S9YB 1T6MA 4X6CA 3OLEA 3TZVD 4DERA 4YYCA 5ACZB 1JHKL 5DN1A 2PCPA 5DCCA 3WEXB 1XH0A 5CBEA 3X17A 3ZVVA 1ZIBA 2BZ7A 4RX4D 5BWAA 1EBAA 1U3ZA 5MI0B 4XCNA 3VTAA 4QHUB 2OX5B 3SKUD 3GLAA 3D07A 3MX0B 3V0IA 5I15L 1AW1A 2Z34A 1U22A 3QZMA 4WD0A 5BOEA 5LA2A 5LJYH 2C5DC 2JTYA 2H1PH 2KX9A 1KYFA 4NSKA 1NGQL 2EYSB 3U79A 3UZVA 1W5MA 3APYA 3N40P 3SSJA 4WVRA 5ABFB 3GRWL 3WYZA 1NC2A 4WGHA 3SQSA 4LBEB 1FYHB 4M7KL 3SBWA 4KMTL 1H7WA 3OJGA 1J9QA 2Y07L 4L8DB 3VFUB 4N6EA 4RUBA 3K0YA 3QH3A 4M8UA 1KBGL 4H8WH 4U2YA 4XD5A 4ZS7H 2N7BA 4F79A 1DWJM 3X11A 5HUOA 1WAAF 2VDPH 4NOFA 3SGKA 5I1GL 4ZYKB 3W11C 1NDVA 5IQOA 4UMBA 4CU8A 4WTZG 3S9DB 2ESCA 1B6DA 4OCWH 4EANA 2OJEB 3BW9B 3MBXH 5K59E 1WWWX 3U82B 3TWBA 4MS8D 4NRZA 2Q10A 1ODUA 3C3UA 4NXKA 3LQAH 1MJUL 3NJFA 1X7QB 3LM3A 3ARGB 2CITA 4DWSA 4L29A 4IMCA 1Z5HA 1RZ7H 2OMZA 2VDKL 4M1DH 3GHSA 5IM51 2NPLX 3H2AA 2H3NB 3MV9B 4FG4A 3BDYH 4XC3H 9PCYA 4Z1PA 5BZDA 5JHDD 4BK8A 1ESWA 1IWBA 3UJJH 3HQOA 1JGVL 4S1QL 4K7PY 4RAHA 1HJVA 4YS4A 3X2QB 4HX1A 1FDLL 2BTMA 3CJPA 1CXKA 4ES9A 5MENE 2JALA 3M0JA 2YN3A 4NGHH 3P4MA 1ED3B 5MEND 2E6YA 3MRHA 4CNOA 3CN2A 3LIZA 5AZUA 5EFIB 4HUWB 1BF6A 3ARSA 4H25B 4NPYA 1EPXA 1O5PA 1U8OB 2NY6D 1ML0A 3KNBA 3O4LA 2WHKA 4X5LA 4LJ3A 4PE8A 4N86A 4U1KB 5LHEA 3KPRA 1A5CA 3NDZA 1OPOA 1TJMA 3W1UA 1TG8A 1M2VB 2D31A 5CBAA 1D7KA 3F5KA 1HSAB 2XFWA 4N8VG 3UZZA 4ZW3A 3LI0A 4QXTB 1WC7A 1XWYA 1MEIA 4JHOA 2UWEF 1E9LA 4LT7A 3SOBL 1MNZA 1J1XL 3ASNB 3FUEA 2CHOA 1B2WL 2YXVA 5FXCH 2QGHA 2QIWA 1FYTB 3S83A 1U36A 4JTAA 1S3KH 2DL9A 3C75A 1AE6L 1CFSA 1QFWL 5HI3D 2AFNA 4O2FB 4L1WA 3P54A 4OT7A 1ZZMA 1QSED 3WZ0E 3LZNA 4NUMA 4CGUB 3FUDA 4IWWA 2VXQH 4W9GC 2O26U 4BQ8A 1RAKA 1NEUA 4Y6GA 1K72A 4NKDB 1Z3GH 1Y0LB 3SYCA 5GGSB 4MWAE 3MCMA 1U42A 4AVKA 4EO5A 4Z3IA 4O2CA 1KGCE 5FOBA 4YC2B 4KPLA 4P2VA 4Q6XA 5IMLA 4N0UA 5KW9H 4HMEA 5EU6E 4ZMYA 1JK8B 2WZMA 2YD4A 2XBZA 3HI6H 3V5HB 1XGDA 3N34A 1YY9D 4DKEL 4NYLB 1QW9A 1XDMA 5HPMA 3Q2LA 2CO1A 4AUUA 4C59B 1H61A 3KLHD 4X60A 3ZL4L 3S34H 4B4HA 2HCZX 4OKVA 3I68A 3R12A 4P7NA 3DX6B 4LLMA 1VDGA 5MEPA 4NQSB 2E68A 5DQDL 3E2RA 1OQOA 3FMGL 4KZEH 4H6EA 4BY3A 3AU6A 3BISA 4EN3C 2V2WB 2XTJE 4QRTA 5J1AA 3O0RL 4LL9A 4N25A 4WWKA 3H8NA 3VFMA 1YNQA 4PGDB 2PGFA 3N6QA 4B5NA 4WUKL 1DIDA 2BSTA 3CMOL 3O1NA 1T7ZA 4NWTH 5CH9A 3PWPE 4ZOBA 4JTLA 4PY7B 5DD5H 3UTPD 5DVOA 5DHVB 3VFSA 3AGWA 5HWMA 4KQ0A 3AS2A 2V0AA 5AW8B 1VKXA 3S2MA 3V79C 2KDGA 4PRHD 4XAKE 5AYUL 1LO2L 1NGZB 3PWUB 2YPLB 1OCCB 4KNSA 1GC1L 1JP5A 2FO4B 3QSTA 3MJ6A 5BRZD 4LEXH 1I1XA 1UUQA 2NV2A 1B3ZA 5C5YA 4UBDC 3V4VB 1C9SA 5EO9B 2OFJA 5KWYC 3FK4A 1JFQL 5F9DC 3SJVD 2C15A 3MCKA 4GIOA 3HHSB 3DHFA 4XIAA 4YL2A 1RK1A 1AIFB 3QS3A 2ZXQA 3LN5A 4R97C 4WEVX 3W7RA 5D1QE 1OK8A 4LOCA 4W9JC 1UENA 3D6GA 1WCGA 3AW5A 4UR8A 4NQXB 4HJGB 3CVHL 2NTFA 3WN5C 1CBGA 4UQ9A 1GYLA 3BHBA 3ECVA 5D7SL 1AJ2A 2A73A 3NH7L 5DEFA 3UJJL 3QPYA 4TNVF 2UVEA 1A6PA 3Q5YA 4X0KA 3QEGL 3G5ZA 3UG4A 4U4IA 4LASL 4F9PA 1C8XA 3QNXA 3TJPA 3ZJ8A 2BCMA 5PTDA 4PJHA 4OZIE 5G4OA 4DEPB 3NL3A 3FUNA 1XIGA 4EAMA 2WOQA 1GMEA 2PGRA 5I1DA 3V6FA 4NFBA 5B7FA 3U2JA 2VCAA 3MV9D 3HTWA 5F7FA 3EJSA 1M6JA 2P24A 3E12A 3U7YL 1AD9A 1L4IA 1JGDB 3ZJ7A 4FP8H 3GSOA 1G01A 3T6QC 1URLA 1OGAD 4JHBA 5E2UH 1OCQA 1KFGA 3NIFF 2D7MA 2HYMA 2GK0A 4IBQA 1CICC 1QD0A 1CU4H 1XGZA 4XVJH 4XP5L 2WYHA 2HQAA 1XT5A 3LHAA 5TE6L 1OPGL 4ES8A 1NOLA 4AYEC 3QY6A 5D70L 3NIDE 3K91A 1HXYB 4NUJA 4Y7OC 3RY6C 1KM3A 1PKQE 1I8JA 2DQDL 3BLFA 3W1NA 4X9IA 1KCSH 1S7SB 1Q0XL 2HLEB 3EBIA 3M86A 1NCCH 4FJYA 2R8WA 4HK6A 3E5PA 4CNUA 4FP1A 1RZIA 2P8LA 1U1UA 2G60H 4NQCD 3H1ZA 1BX2A 3UROR 3PQYA 4IGBD 5DK0A 2BSRA 4AZ8A 5AHLA 5IJBC 1TWSA 3SDCD 4DWDA 2EDMA 3CSFA 3EJPA 4DETA 3ITXA 3WH8A 3IAPA 1II4E 1WKYA 3MA8A 3S35L 4XP9L 3WTVA 4D6JA 2HPMA 2G0KA 1HU8A 4MLSA 3BCJA 3GC2A 2W1NA 4GVIA 1BQLL 2W0UA 1BFVH 2XN9A 4ONHB 4BXSV 3NZRA 1SQ2N 2X0HA 5TE4H 2TYSA 3AT8A 1U8MA 5ESAA 3CDZA 3UCDA 3NZGA 1JVNA 1R7OA 1D9KC 2CKBB 5JW3H 5IFAH 1KR0A 4R8WL 1F45A 3L3GB 4AEHL 3HZYB 3LKOA 3NPZB 3S9ZA 3VGGA 4FQ1L 3GNOA 1JPSL 5IW1B 4XTDA 3HBPA 3RWFA 3T40A 3UAJC 5MP6H 1EO5A 1NCDL 5EZJA 4L9ZA 5HHPA 3D8MA 4I77H 4JN1H 1A4MA 3ITCA 2BSED 1J10A 2DICA 3V4VL 1IAOB 4MA3B 3S6CA 4FA8A 2WQPA 1JV5B 4W7UA 3T0EC 4A66A 4GKOA 1ZHAA 1WDAA 1UCWA 4YPGB 2BP8B 2EC9U 4DELA 4BFGA 3IS0X 1UH3A 1WAPA 1H51A 3FH8A 3IJ6A 1UHVA 2J88H 5A7EA 4PJDA 1F4XH 3BWAB 3CVHB 4L9DA 2ISDA 1O5XA 1WXYA 2UY3A 5I1CL 2V5BA 2A6JB 2B1AH 4A8RA 3H54A 5LXXA 1CF8L 1AE6H 1QFWH 2Q20A 4PJEF 3GKWL 3HS0B 2FB3A 3CVIH 2VIRA 3P2BA 1JYWA 4HZ7A 3V7PA 1UWAA 3LV5A 1BD2A 1Q45A 3QXBA 2CO7A 3KHJA 2B39A 3VKAA 2KC0A 5A2AA 2DV0A 3EADA 3NRFA 1NGXA 3CN1A 3DXAA 4GBXA 3O2VL 4JX4A 5I6SA 3SSZA 4GRWB 3WG7B 4HJ0C 2W61A 1XIIA 4BK5C 5IESH 2C1OB 4C1NB 3G3MA 3VXRB 2I85A 2FJKA 4CQ8A 1V3HA 2X4QB 3V7MA 4ZUWB 1A4AA 4AUJA 1W56A 2VXNA 2CDEB 4HXBH 2QAFA 4YS1A 4TN9A 2PXYD 2R27A 4MHHI 1D7FA 1KT2B 1DWAM 4LVNB 3B3IB 4JN8A 1W3TA 3RU6A 4D2JA 5F9AC 4K2UH 3RWDA 4N9DA 4AGMA 1N7MH 2VLJE 4I9MA 3PL6A 4GAYA 3O6LL 4M5TA 1NWRA 2EKGA 3DWTA 4I5UA 4J3ZA 4YSCA 1Q5MA 5JXQA 3S8GB 4X4ZA 1G4SA 4XVUC 1EF2A 1QRKA 4DI9A 4RFEA 4Y7MA 1RPUA 3L3JA 3TE9A 4YLQT 2C26A 2OGYA 4P5MB 3ULUL 4A4AA 2NX5D 3M1CA 4X3ZA 1TPH1 2X6VA 3T6CA 2XIOA 4Z1YA 2F8OA 4X6BA 8PAZA 1SEQH 4UUJA 1S9YA 1E5AA 3ESMA 3OR6A 4P2QA 4LUTB 3CFQA 1C1EH 4X8XA 1GQIA 1DV7A 25C8H 3LD5A 2ZQKA 3KYKH 4LEOA 2ZXDA 3WFHB 3QK0A 2ICWJ 4OLWH 4QHUA 2CKBL 2Q8AH 1RUAL 1T83A 2Y8UA 5D7LE 3UBXA 2J73A 3MANA 2MNWA 3NR0A 2ZQ0A 2H9GB 3NSDA 1E0OB 1IIKA 2EJAA 2F0CA 2VW7A 1M1XA 1Y1DA 2V4LA 4WGWB 3M5XA 1SPQA 4O02L 4RIRB 3MLZH 3TGXA 2WLLB 2R69H 1A22B 4TS6A 1G0XA 1NC4B 3AHVA 3FEQA 1UD5A 2Z91A 3WUWG 3VXGA 4YHGA 3N42F 3GIYA 4IRZA 5FFOA 3VIKA 1GOXA 3WFEH 4YHLH 3VFVA 1DFBH 3V1PA 2MSPA 4HWBH 3PBMA 1G84A 4F2FA 2OTPA 4DQWA 2R2BB 4A7GF 1GOKA 3F4VA 4NNPL 1CX9A 2YRLA 3W3OA 2VXSH 2DIAA 4NRZB 4NRYA 4Y5YA 5LVEA 4FLQA 2EGZA 3HGJA 4JTSA 2BIMA 3ECBA 3XINA 1OT1A 3CJJA 5KZCB 1WTGT 2XQ0A 1IGJB 4OB5L 5I6XC 2P26A 4RW5A 2FH8A 5D7JB 2ALWA 1A3LL 4AH7A 3WLOA 3AS1A 3S3PA 4FNPA 1E6OL 1GSMA 4LF3A 2O9RA 1A66A 4HX1B 4RMBA 2E74C 3FYYA 2K4WA 4IMLB 3MW7A 4OHQA 2ID5A 2R51A 4K23H 1ECQA 5IJDC 5IHZA 4KVPA 4RBPH 4DJMA 1B0GB 3WKQA 1FXQA 1US3A 2V63A 1XGPB 4ASTA 32C2B 3CFEA 3NJMA 4EN3B 3WD3A 2YAEA 4GUPA 5BMFH 2X9XA 4DYJA 2UBPC 4Q3MA 3II1A 2EEAA 2NQ3A 4XP4H 1SW3A 2UXTA 3OKKA 1H2JA 3WFEL 1ML1A 1RIHH 2WMHA 5I82A 2DT3A 3T04D 5KTEH 3HAEA 3KX6A 4O16A 5EU9A 1T8QA 3L2IA 5DMKA 3LLFA 5AVZB 2OMBA 2P8BA 1SFTA 3KLSA 2QYGA 3ES8A 3NZPA 2QQLH 2UX6A 1KC5H 3EF7A 1I8IA 3MYPA 4PGLA 1A6VH 2H32A 3NXLA 1TQUA 1YNKH 3DV4B 1XGQA 2R1WA 2VAAA 1J12A 4AYFA 1CK0H 5F96H 3CFJB 4MPQA 4QAIA 4WVXA 1BZ9B 3ZJAA 2CLZB 1HJSA 2GUOA 3MRMA 4J2MA 2OMTA 5DRXA 2NUTA 3TEUA 1Y1UA 3Q3GA 4MX7B 3ETBJ 3VGDA 5FO8A 3WJZA 5I3DA 1EEYB 1J0ZA 2IKJA 1KJ3H 4DP2X 3BGMB 4DBUA 5FA3A 5KYUA 1U8LA 3GHPA 1AD1A 2Y2TA 4CQAA 4XNAA 3LNMA 2A1WL 1W0WA 1UD6A 2P5PA 4XZBA 4S11A 1SJEB 4OV5A 2LFEA 3QUYA 3ARDD 4G7SB 5IVXB 5T5FA 4IG2B 2WY3B 3QZWB 1WUNT 2I1OA 4CCDA 2NY3C 4O02B 1EANA 4YDLB 2EZ0C 4KO6A 1DANU 2CJTA 4NP9A 2UY6B 3AT0A 2HSIA 3QZOA 1B3XA 3MJMA 2EO7A 4WFED 1B4JL 1SMOA 1TDQA 3TYCA 3S3SA 2BLEA 2J8UE 5E1QA 3II2A 4ABVA 3D18B 2VGGA 4L4VD 4WWKB 4PTTA 2BGQA 2Q02A 3BV4A 4YK4B 1TZOA 2VNCA 4XN1A 3B8TA 2BSTB 3KVDD 4V2BA 2HK1A 4HUMB 5C09D 3E2SA 2Y06H 5G4NA 1V6TA 4HGKC 3SPHA 2VZUA 4ZO9A 5DHVA 4Z18A 3JUZA 3NACL 3VFSB 1UQYA 3BP6A 1Z44A 3UVAA 1I9JH 4Y2LA 1FLTX 4K3HA 2UZXB 1FCUA 4YE0A 1VADA 4XGZB 2Y62A 3NAAH 3NCCB 4ICWA 2UYLB 4YHNA 1AL8A 5I23A 3QIWD 1RY0A 4Y5XA 3FTZA 1OFDA 2PTZA 2YPLA 3R1GL 5C0BD 3VXTB 2W9MA 4JTDA 3WNOA 5T1KB 4U1MA 4AJWA 3VYNA 4CN4A 1MW0A 1RJCA 2WQRA 1JPKA 3CH1A 4TOYL 1TZIA 1H5BC 2C14A 3HC0B 3GZPA 4LK4A 1VBGA 2G41A 1D5MA 4MKMA 4CSZA 4GVFA 5JW4Q 1JZIA 5CZSA 2NQLA 4LVAA 3LN5B 3UXLA 2LU7A 5KZ6A 3WNLA 3BKCL 2WZ5A 4N0YH 4TVPH 1XGRA 3TQVA 1GEQA 4G6KL 2N59A 2BP0A 3NSYA 4HJGA 3FQWA 1JCYA 1XQ4A 4XAYA 2Y6SD 1EGVA 2W91A 1TQCB 3H9SA 4M7LH 1UM4L 3PZTA 2P48B 3G5ZB 5EBGA 3L7EB 5IBTH 3X3FL 3QNXB 1RA5A 1C08B 3S1UA 1LT7A 3R6IA 5DMGD 4L0YA 3U8GA 2YA2A 5C0CD 4F7TB 1TEFA 4M6NH 1UR2A 5BXSA 3N0AA 4IBYA 4FNQA 4HBKA 5AC5A 1IFHL 4XMTA 4Y8AA 1KB5A 2OT0A 1XBYA 4O8RA 1HO4A 1EOKA 1YUKB 2JKEA 5M17A 1WDWA 4JFTA 1AY1L 5CJOL 4WOZA 5ECVA 3ARGA 1PZ5A 2JLPA 3RDTD 3IXAB 3MRLB 4G42A 4FKHA 3WBDA 1XINA 4QG6A 4N8UA 4OF3A 3IU3A 1UXWA 2VLRB 2Y36H 2IFFL 3VCCA 1Q8MA 2EDDA 3EH3B 2DWSA 2DQFB 3P4MB 4RMVA 4QBXA 4RISH 3EGJA 3TPKA 2AKRB 3KR3H 1MWAA 4X5RA 5H2BB 2YGPA 1JCMP 3AIQA 3TA3D 4JO2L 4JJ5A 2VXTH 3MMDA 1OV8A 2PCFA 4Z76A 2QUUA 1HHJA 5F88A 3D3VA 4XWOC 5G2IA 2WNNA 2HTKC 2VXQA 1AZ2A 3LCIA 5CPSA 3SPIA 7ENLA 2FSEA 4LS0A 3VXQB 5A2LH 3ZE2E 4TVPD 4ZSOE 5JDSB 3B9NA 2DQEL 4OD1L 4QXTA 4XP5H 2ZSWB 3NYKA 3FTUA 3C2YA 4PZVA 1A1OA 2OW7A 3P5YA 1HIZA 2CKBA 2ARJA 1NIBA 1TPUA 1A4CA 1CFSB 3HG4A 5LDUA 3MJWA 2WHMA 1LL6A 1EHXA 3QCUL 4MFEA 3WHXA 4JZJA 4ERSL 4KRUA 4ZB2A 1OM9A 2F74B 3KPLB 2Q7NA 3B3BA 4LAQL 5GXBB 2JI1A 3AWOA 4GJJA 5DT1L 5BVJA 5IFHH 3BO8B 2R0ZL 2AQWA 4KFNA 4QDMA 3RG6A 3N5AA 3O6FC 4XRCA 5F0PB 4JFZH 1MNSA 5T3XH 1LP9A 1C8YA 2BP8A 4IX2A 4XVOA 2DVUA 2J4GA 3SDAB 4UT6H 4D1IA 3AB0B 4OLVL 3U4KA 4R84A 5DO2D 3AU1B 3ISWA 4YHZL 4YSUA 4DBDA 5LQBL 1XYMA 3VFOB 1S7VA 2NYZA 4UM9B 1M6UA 4CCZA 2A6JA 4PB9L 2WQUA 3PNWB 4UR9A 2ITDA 2CMRH 3LBCA 3WDQA 4ZFCA 3H3PH 2DJMA 2YA0A 3N0PB 2ZF9A 3KS0H 2IANA 3TV8A 1ZVSB 1FWEC 2WMIA 4QS6A 4JRXB 1MCLA 3VFMB 4QRTB 5J1AB 1INDH 2XI9A 1UYWL 2AL2A 1W72A 1IT0A 2YZRA 2CRIA 2OJ1A 3B9OA 4LRSA 3GPSA 5KANI 1BYBA 2CZNA 4B5EA 3EOTL 5D8JH 1OM0A 1TJGH 4JTTA 8TIMA 1FHLA 1YECL 3D69B 4XOBA 3B8UA 8FABB 5F3BB 1GZ1A 4XHQA 3RY4A 2BS8A 4Q4IA 2EO9A 3SY0B 3OYXA 2MPAH 1EO7A 2BLFA 3QJFA 4YWGL 5DVPA 5G4MA 4HK5A 5HR7A 2V6AA 2DIKA 1VB9A 1FZJB 4ZXBD 3IIOA 1JHTA 2ZOKA 1THCA 5FEPA 4HNVA 1YDYA 3EKCA 2CM5A 2Y24A 1ZK9A 4POYA 1CGSH 2G5RA 2H1XA 3DBXB 4M29A 4I9TA 5DQDH 5G1TA 4HLJA 5C2UB 2DJ4A 5FJPA 4O53A 1S7RA 1U95B 4CCEA 2QTVA 3LKRA 5CSZA 4E9YA 3ZL4H 2FPYA 4AQ8C 3MRRB 4OW6A 3FF7A 3GXPA 3N40F 2NTFB 1ZD6A 4M82A 4EZMA 3GSMA 1MQKH 1CE1L 2GIXA 4MA1B 4RGNB 1PO9A 2QVNA 1Q6DA 3SB0A 4REQB 2C34A 3VIPA 2I25N 4HSOA 1TVBA 3UPCA 2IBBA 3ECUA 1VGKB 1CTNA 2VFFA 1UQZA 2B7DT 3WFHA 3MROB 4OLYH 5C92A 2GHZA 4YE4L 3VFLA 2G5BA 1I31A 2ERJB 4MAUH 2YEQA 5C09B 2OSWA 3X12A 4DPAX 2JQAA 5BOZG 2WD0A 5K9DA 2FATL 5D1XC 2HK0A 2HT3D 3SM0A 1SUHA 2RQ8A 4RGND 3NZUA 1H5BA 4YSEA 4HU3A 2WINA 3BV7A 3PJLA 4E38A 3V10A 5B7ZA 2X4PB 3ISYA 3TZVC 5FHAL 4D71A 3K8MA 2J2ZA 3VAVA 5J1TC 1VKFA 2AGJL 3BH9A 2WLLA 1KJMB 1TMQA 4OFQA 3ATYA 2WLKA 4XB3A 1FL6B 3BG5A 3IDIA 2XWTB 3Q0HA 3ULUC 3RN6A 3P81A 5DD1H 4HJIA 3EOBA 1QATA 3TCTA 4JDBA 2FATH 2HFFB 3TTYA 1S7UB 5E56A 4PMXA 3T7VA 1LCOA 5D2NB 1CN4A 1AZRA 1BW8A 3ZKXB 3QMRA 4M80A 1EGJH 5LIXX 1TWDA 4M02A 4UV4H 1SFLA 4YGVA 1JTTA 3PXJA 3U30B 3QJOA 1HHKB 4X9FA 5CR8A 3GMLA 2FLRT 4P5TB 4XX5A 5AB1A 5K69A 2IMRA 4KFPA 3ZVIA 3OA3A 2BSRB 2JE8A 5D7JA 1AR1B 1SQMA 2BVYA 4URKA 4KFOA 1LMKA 2AC0A 4ZS6C 1ZANL 4UIMA 3ZKND 3DX8A 2FZ3B 1U3YA 1QPXA 1YPZA 2BNUB 5TDNB 1IJNA 2XN9B 2RACA 1HKMA 4AXWB 4X5XA 4JO4H 5IHZB 2FJUB 4B92A 1DOSA 4O2EA 1R8LA 3KBHE 2GEEA 5BUPA 1SFJA 3RGTA 3MBXL 3PSVA 5IQ7L 1W3KA 3SIKA 3WTYA 1XYLA 5KSAD 5KBMA 5FM8A 2VN3A 1ZGLM 3F4CA 3S8FB 4IMKA 3SUWA 2NWSA 3ZE0E 2G2PA 1UR0A 4GKSA 1CL7H 1U3NA 4JRYD 4D8ZA 1FCGA 5DMKB 2YPKA 4R2GC 1IFRA 1IARB 3VKKA 3GS4A 4BFRA 3RFAA 4K4KA 1EXUB 1YVLA 1I8IB 3GSNL 1V8EA 3C60B 4HWBL 4WEEA 3BO9A 3GRWH 4AY1A 3MRIB 3NZHL 4Y5VA 3DFTA 2GBTA 4PMZA 3V0HA 3TH3T 1G4RA 5A2FA 2DBLL 3PP7A 2ZZUT 3X1BA 2GUOB 3QXTA 4NWUH 3WIAA 5E24E 2OMTB 4Z3GA 4FKEA 3HQPA 3N17A 4UTLA 5CJQH 1JCVA 4J4PA 3ZYOA 1FX6A 3H3KA 3MUZ1 2VIRB 3MOQA 4HV8B 3QC3A 4J3BA 3QRFM 3MTWA 3DMMC 1KPVA 3OB0H 1PLBA 3EMCA 1RJLA 3DVNB 3WD0A 2H2PC 3NSJA 1JHKH 5JOPD 3MPCA 4S1FA 4O50A 1XF5B 2ZRWA 1W0WB 4AE1A 3DC8A 3MODH 5D1QA 3EPMA 2ZPKL 3OU8A 2L7QA 3CHSA 4HOXA 4PMRA 4PULA 1OAKH 4LIQL 4Q6IC 4IPNB 2GC7C 5IVXA 1LORA 4XQ6A 5G4HC 4S2SA 5J56B 3OVGA 1IEWA 3ZZQA 2DMBA 4S3JA 3FT0A 1XDTT 1HKJA 4GZ7A 3DFNA 3S5SA 3L1EA 5GRYA 1KTLA 1UFUA 5C86A 2G4JA 4P2OC 3A21A 1FF5A 4AQAB 1G7HB 1EXGA 4PJFF 5DD6A 1D3GA 1I2RA 1Q9WA 2OK0H 2XQYG 4PJ5B 1BBDH 4TV3A 4O58H 2ZA2A 4UTWC 1PUDA 4M6VA 3MWCA 1DLFL 3F58L 4XNXH 2J27A 2VURA 4F48A 3QNYB 2J7HA 2WSKA 1X4ZA 3BP6B 1W0MA 4J4KA 2F8XC 3MRCA 2X6UA 4RDQF 4MQTB 3GK0A 3W1ZA 3L1OL 4MYWB 1KEGL 1E0XA 2YLAA 4YHNB 4W5UA 4FTVB 4U6HB 3ZXWA 3EWYA 1MZRA 1I8MA 4GEIA 3XISA 4XO6A 4HMCA 5J13C 5K9JL 1FAKT 3MNVA 2AQSA 2E7HA 1RH9A 2DVXA 3IEBA 2VXTL 1CI5A 3ELFA 4LUTA 4D9RE 4DN3H 4PGZA 3O0KA 5CZKA 5DUML 5FC9A 1KTDA 1K4HA 3UO1L 3QSKB 1D2PA 2OXHB 4R7DB 5GSRA 1QOPA 5E4AA 4MJJA 5C07B 5HJXA 1ECYA 3H9YA 1TQCC 5K93A 3SJ3A 4OLXL 4KGJA 3NIGE 3QDJB 4OM1H 2ZZ7A 3RX7A 5I5IA 5F89B 3N12A 1F7BA 4YVUA 1F6LL 4YUEL 4FOMA 3UEQA 4OWGA 3FQUB 3FS2A 3U7VA 1DQDH 5DEJA 2B2XH 4Q9RH 4H83A 2Z4GA 4BI7A 5D33A 4QSHA 3UXKA 2CGZA 3FCSB 1XLIA 5EFFA 1J9TA 1NJ9A 3X11B 3QIUC 3FU3A 3OSKA 1AO7D 4ZVJA 3J8F7 4X9BA 1NFDB 4S0SD 4MVBC 5HVGB 4XPHL 1W72L 2FGZA 4A3UA 3MA9L 2HMCA 3T1GA 2NXYC 1R9XA 4EIUA 3BH8B 12E8L 3N44B 4B3EA 1RJRA 2BWDA 2OMZB 5KVEE 4RV3A 2Q01A 4I1RA 5T9BG 5E08H 1GT8A 1CO1A 3N50A 1WVZA 3QPXH 3ZE0F 1V6WA 3BKMH 3IXAA 3MRLA 1ADOA 4L5ZA 3ARZA 1KBJA 2FZBA 3EMQA 1DQQA 1LK2B 2DLFH 3MLRL 4U0RB 1FO0B 1UP0A 4MXVF 3W7QA 4EPKA 1TETL 1I7RA 3CX5K 2WO3B 1F00I 1RUKH 3FONA 2QELA 1LE5B 2IS7A 4U0RC 3MCLH 1LO5B 4JG1H 4PV1C 3BAEH 4Y9BA 5D6DC 1AW5A 4OUUB 1NMBH 3TX9A 5DRNA 3OWRA 2YEVB 4BM7A 1AOHA 3NGJA 4JJ5B 2G97A 1J8VA 4PTVA 1FNSL 3OAYH 3QEQD 1N0XL 3DUSB 1AOZA 4K8RD 1IAIM 4OZGE 4F5CE 1GYVA 1WE5A 4YXHH 4UU9A 3WSQH 5JXEC 4GRWE 2IWGA 2Q86B 5IGXH 1TV5A 1K6QH 4WOQA 1ADSA 3W01A 2G3ZA 4BK5A 1EFXA 1MVUA 1A1OB 3GPEA 3UDWA 5LXGL 5C6MA 2DYPB 1S5IH 4CLMA 1YEKH 4G7EA 4XAWL 2CESA 4AYFB 3EOOA 3MLRH 4LHUA 3L4WA 1KB5L 3L0NA 4MMZA 3M0VA 5LNWA 2PXYC 2YDAA 5T5NG 1O6IA 3PZOA 2I5YH 3UDWC 1QFPA 1OG0A 4Q4EA 4U10A 3DHJA 3UIYA 1HXJA 2JK5A 2C7FA 2FWLB 4BH7A 1YIXA 2DVTA 3ZIZA 1OX4B 3RA7L 4LNVA 3FB7B 1JVOA 4DP0X 1L6WA 4LCRA 1Q7MA 2XN9D 1KXQE 1R5WA 1T4WA 1J0HA 4HBQA 1TZHA 1YZZA 3ES6B 2AOSA 3K2KA 3LHUA 3MP3A 3ELQA 6TAAA 4HNCA 2ZZ2A 4UM9A 3VFOA 4IG2A 5EWIH 4HUXA 3RMJA 1QR4A 1RXOB 2KLRA 4MSWA 4XB8A 1MREL 1P4UA 3LZOA 5GJTL 1UXSA 2K7PA 3PNWA 1SZRA 3DERA 3QZ6A 1R2RA 5CSRA 1ZVSA 3BD4A 3GC3A 4IU3B 4YUEH 2WMIB 2E4TA 2DMGA 3FNKA 2PCQA 2VM9A 1E71M 3OB0K 2D2OA 5JIIA 1BVKA 4XN2A 3KXFE 4XHJD 4X9SA 4R2GB 4GP5B 2PN5A 3FDKA 4HSCX 2F2HA 3ZU8A 2W0FB 2RJHA 3QRLA 5FCUL 1N8IA 5AZ0A 2BVUA 4P4KA 5EDSA 3QWNA 1RU9L 4F80A 2QZ5A 4R90H 2XZCL 5D04C 2X44D 4IKKA 1AMKA 1FP8A 4GIYA 2XH4A 4AD1A 2RKXA 5E8EB 2PWVA 5AW2B 1CYWA 3WQ8A 5FDWB 3SDYH 4PLJD 5T1KA 1ALDA 3QDMB 3SGGA 2ETWA 3P9MB 4ZZ9A 4L9LB 1K7FA 4OBTA 4UINH 1GNXA 3ARWA 2PBGA 1JWSA 1TSIA 1KFAH 3HMWL 1D5MB 3FO2B 4PV9A 2BP5M 3PULA 5H8DA 4K23L 3CBKB 1Q90A 2YAQA 2FLIA 4N02A 5DXYA 2CK2A 3PDGA 4W5ZA 1LO4H 2VZTA 4ZPVB 5BV7H 1RHHA 3LRMA 4P2RE 3GYEA 3PJUA 2EDFA 5K4XA 4F7PA 5KTLA 5BOOA 3ZBMA 4D6HA 4XP1H 1OAQH 4X0KB 4Y8FA 2FZMA 1OAXH 1F8IA 4RETB 3THCA 1IJ9A 1LK3H 1NKGA 3H56A 3SB3A 5HGHB 5D37A 1J4EA 4A6YL 4JFFA 4ZFFA 5M94B 5A40E 4H8PA 3V6FB 1DJIA 2AJ3B 3F6JA 5AAMA 1C08A 4R7JA 1OSPL 3W00A 1AANA 1AQ0A 1AGDB 1JNJA 3ARUA 3OKOB 3GMMA 2DQ6A 3IJEA 2I9UA 1SM3L 3EXJA 4IJTA 3QXDB 5IREA 1PEZA 2QVMA 4H0IA 3CEUA 3UGEA 1A8JH 1F2QA 4A38A 1KB5B 2QNEA 5IHSA 2V5RA 1UATA 4Z7VA 2XH0A 5D72L 5FK9B 1X9UA 1G0DA 3TQPA 1U3HD 1GXEA 3DFSA 4ZENA 1Z3GL 1RBAA 3FJ6A 1UVQA 4WTXA 3G3LA 4I87A 3DCPA 3LN3A 4D9PA 5DJXB 2VFEA 2VQ1A 3EXLA 2W66A 1MFBH 4DQAA 2UXGA 2X38A 1FRBA 1AYOA 4H8VA 3T0CA 4QISA 4AD5A 3DRQA 1PZ0A 4S1RH 3O9WD 4YHYB 2XA8H 3SO3C 2YL9A 5A6AA 1FCQA 3MV8E 2YL6A 2CKBH 2P8LB 1OQFA 4W89A 4Y9NA 4JM4L 1BX2B 1I75A 2ED7A 5KSAA 2IOIA 4LARH 1RHFA 2DIBA 5BZWA 3AYVA 3NIFE 4UT7L 4UILL 4ZTEA 1T03L 1XCTB 4GWEA 3RNDA 3Q2VA 4RDBA 3X1FA 2C3HA 4UFHA 4U6YA 2J1WA 4GKLA 4KNTA 1HL8A 3HG2A 2Z6FA 4QXGH 2ZOTA 4YL9A 1O9VA 5EUKB 4JFEB 1CF1A 4NO2A 4H44C 2ZZ5A 1FZOA 4GO6B 4PBVC 15C8H 1MFCL 1CFMA 4J3SA 3AABA 1L3NA 4IK7A 4MCZA 3K80A 3W2MA 1W17A 2WSRA 1L0XA 2NW2A 5F8RC 3L1GA 4O57A 2X7VA 2O4MA 5IW1A 1KN2L 4O2EB 5E03A 4WHYH 4BKLB 1PDYA 3DDGA 1BWLA 3IRSA 5EZJB 3OZLA 3HG3A 2JGYA 3TBCA 3CXDH 2CZ5A 1A4JA 1JGLH 1IC7L 9XIAA 2VR3A 4WFFD 1C9DA 5CIPH 3UC2A 4AZUA 4TVDA 2WXIA 3BVWA 2A0NA 5CKGA 4KDWA 4RSVA 4UV4L 3U4EB 3DHMA 2UY7A 2VP8A 4I7WA 4DBEA 2Y7QB 3FT2B 5B22A 1BBJB 4JQAA 5DEGB 2J8GA 3VXPA 1WO2A 4D2NA 6XIAA 3OR7A 5SWSE 3U4FA 3TX4A 5CNHA 4MUZA 1QSFB 3PUDA 7A3HA 5FO9B 1QABA 5J13B 1P6WA 4ELMF 3KYOA 4S2CA 5D4YA 4ECLA 1HESA 4HPHA 1K8CA 4WFGD 1O6VA 7PCYA 5IMKB 2PU1A 2EVIA 3RE0A 3ATAA 2ITDB 4A6YB 2GEQA 3QJHB 1AD0B 3UYRL 2VLKD 5D1ZI 4WI0B 1I3GH 2F5AL 2VX5A 1E4KC 1XEDA 4GT0A 5DJCB 1KPVB 1UC4A 2I57A 3NPUA 1XCXA 4YVVA 1ZANH 1H3PH 4PRAB 2J9YA 3K81A 2G3MA 1BM3L 2VX6A 3HO8A 4DY1A 3U2IA 2C1OA 3EOUA 4TUJA 1JNNL 3Q4DA 2Z7GA 1BLNA 3MRKA 5E00B 1ZUAX 3QJUB 4RNIA 3AWNA 4C7DA 2XSKA 1JRHL 2UZPA 3BAIA 3QUZA 1SVBA 1IXQA 4A3HA 1N6QH 1YNPA 2Y7MA 3B3IA 4KVNL 1W2VA 6TIMA 1Y5XA 3IIXA 1BSIA 2COQA 5CUSL 1YNLH 5E1AB 3BIKB 3ESUF 4J35A 4NO3A 4L8CA 4PJ5A 4HNLA 3R79A 3SO7A 2WV8A 4BBWA 1BG1A 1UEMA 2FE0A 2OMWA 5TDPB 3SGEI 3LHYA 3AZUA 4BEQA 4JE0A 3D4YA 1TTBA 3CX2A 2QXWA 4AK2A 4P5MA 5JW3L 5CAHA 3QNYA 4BGLA 1N2VA 1K9DA 2QKIB 4FEIA 3GUTA 2NQ5A 4Y2DC 3RVUD 3RCNA 1VPYA 2WOYA 4OLUH 1DQWA 2P76A 4XPFH 4V1DD 3BPOB 4FKKA 4L56A 5FLUA 2OJZH 4UUJB 5KINA 4M4PA 5FAAA 4NZUH 4K73A 4XCFH 5C9KA 1KV7A 1ETZB 3HUJA 3HLAB 4G11A 5L6YL 1B6UA 3CFMA 1NFPA 1Z9AA 2EXOA 2YGYA 3FFOA 4APQA 5D2NE 2ZA1A 4D9LH 3FIGA 3FOKA 5K9QI 5J5EA 5IJCC 2WWMC 2QCNA 1KCVH 1ROWA 5ERWA 2Q7YB 5EU6D 3UZEA 3FULA 3ABXA 1ZVHA 3BDKA 3GVVA 2Y7OA 3UTSA 2G75B 5KVMC 2F53A 4A3QA 3QXAB 2CLPA 2R94A 5D03A 4NN6B 3WEBA 3PUCA 5F9WC 3V55A 1M3IA 2I7GA 5IFPA 1MPAL 3BOVA 1Z6JT 3W87A 1U8NB 3O16A 4M1RA 1IIHA 2OZ4A 4MA8H 2CXEA 4QLKA 1IQWL 3I9IA 4PSPA 3HPAA 4X5QA 2Y61A 3QQ9D 4JX5A 3PGCB 4GQRA 4DN1A 2B7QA 2I9EA 3KEDA 3NP3A 1FL6A 5IM7B 2RUSA 3CAVA 3WK2A 3WQOA 1KGWA 4GIEA 3EOBB 1N0LA 3EYOB 4KWOA 4Y5YB 4XBSA 3QEQA 4AD3A 2YUVA 3CSGA 2X2UA 3ARFD 4U28A 3WIJA 1YTKA 2GFBA 2N56A 4KK8D 5IMOB 4DM1A 2VOMA 4S0HA 1E2VA 2XTSA 4HS3A 1ZTXL 1OX5A 3KBNA 5EU5B 3GMQB 3W5NA 4YIQB 2DB8A 4FXGB 4OM0L 1FDZA 1X4YA 3VFGH 2YZ1A 1INDL 5E93A 2N7AA 3WJXA 2DQGL 1A7PH 1LMIA 1UM6H 5ABTA 1AH3A 5B1BB 3ZKQD 3GJEA 5BUGA 1JNHB 4X5XB 1UACL 1IZCA 1QPNA 1I3UA 4Y8EA 3SDDA 3MTXA 1UURA 4UQBA 3L5IA 3PP4L 5E2JA 5E4EB 1ZS2A 1OCRB 2QDEA 3F7JA 1UA6H 1H7OA 2GDUA 5HGAB 3DUSA 4HISA 4Z7NB 5HYQB 4HIIB 3HAEB 2XWZA 4HQQH 1E65A 1OGTA 5T3ZH 4Q4MA 3QW3A 1ZB5A 1J05B 1U8IA 3H7BB 3HNSL 4GABA 4HHHA 1U6AH 5K9OB 1EFXB 4BZ1L 3VKBA 2K1MA 4GAJL 3UY8A 5IDZA 3MBWB 2ATPA 2VEPA 4G8GA 2NTSP 2IPKB 2CLZA 2J5LC 2R4SH 2GSEA 4UTHA 3OYZA 1PG7X 3C52A 1NLBH 1RFDH 4L5FL 5FYLD 3BUDA 1OLZA 2FUQA 4QMEA 1R19A 2C3VA 2JKNA 4BQ6A 1IWAA 2YMXH 3HE7D 4FHKA 2GCYB 2WBJA 4J1UA 2ICES 4UNVA 3G24A 1J1PL 3U7BA 1BAGA 4NUGL 4UUIA 1QSEB 1SY6L 7TAAA 1YYLL 4WJG3 2XV0A 1A25A 2RCSH 2F6AA 4KVCH 3ZR5A 1ZRQA 2WYSA 3BGJA 3MYOA 4IMEA 2OQYA 3U9PH 3S3JA 4LU5L 2OTUA 2HKFH 3LTYA 3AIBA 3WKYA 2EIJB 4W6XB 4G6MH 2PTUA 4O02A 5GRXG 3K74B 4HS6B 1HXKA 4HXAL 2QSCL 2OBGA 2X6AA 5D2XA 2Y25A 3NZ8A 3UBXI 1I9IL 1RZGB 4AVIA 1UM5H 3FB6B 4LGPB 4PGBB 4RAUA 4JB9L 4D0DA 2Z27A 3IE4A 3AZSA 4P7OA 3KWXA 4HKJB 4Y16D 3INUL 1E3FA 2P49B 3N04A 3R8QA 1PYWB 4HKBA 4JKWA 3V0EA 1JCLA 3SE8L 3GLCA 2CJ3A 3DEQA 3WL9B 5IG7B 1G0YR 2R23B 1VD6A 2APBA 5I74B 4P7RA 3DK0A 4G9PA 4ZSOB 3VH8B 1R3SA 5I1JH 1G5GA 4KJYB 4MDJB 1OKEA 5IEHB 3ZDZF 1TV2A 4AENB 5FF0A 3TC9A 1XBZA 4KUZH 4E8DA 4CMHB 4ZAKB 1LM1A 4RSYA 2MEJB 2ALRA 3W6MA 3TO4A 5H1WA 1NCBH 3OMIB 4YSDA 1H8OA 4C6QA 4LFHD 3CIWA 4RMUA 5FYJD 5HQMA 3GSXB 4Q8VA 3D0VB 2NNFA 5LBVA 4HFWB 4L9LA 5D1ZC 5BQ7A 4YHYC 5JA8B 1UOZA 1SBSH 2AL1A 4JX0A 5IHHA 4PY8J 2ZWKA 3VOHA 1UM4H 1SHSA 3EWCA 1F3WA 3C5SA 3WKML 3IARA 4QCIB 2EDTA 1P0EA 3B8VA 5MF5A 3LMZA 3Q45A 2YBGA 3M6YA 2QW5A 3NQGA 1BYPA 1W5NA 5TAOA 4M0XA 3A12A 3BN9D 1MI5E 4FOUA 3CZJA 4AF0B 4HJSA 1E2WA 1E9PB 2XCMC 3WIIL 3IFLH 4MNQD 4N2IA 4ZXBC 4ZNEA 4RZ4A 1ZK5A 2R9RA 2Z00A 5DU7A 3QPZA 2PDQA 1S7XA 3KH4A 4NZ4A 2A83B 1MKFA 1DSFL 3O8XD 4RX0A 4WJXA 3BZ4B 4NNYB 5C08D 1MDTA 4LQFH 5I2IA 2PP1A 1KXTB 3P11H 4XX6A 2V5JA 1HS6A 4Y1SA 2JIXD 1XLDA 2Z31C 1OTUC 4EQ3A 3F5LA 1CL7I 4OBSA 1X39A 3C5XA 2Z7WA 1MQRA 1MAML 4PJ9C 1BZDA 1JZFA 1PZ5B 2DWDB 4FXTA 4XNDA 2Y07H 1IM9D 4FI8A 4E42B 4Z7VB 2QLYA 3OJVC 2R8SL 2CCRA 4RGOH 4ATWA 5F21B 4MA7H 4L1TA 2PCXA 3AS0A 5F7WC 5C70A 3SO3B 5IOKA 4HCRL 2DQUL 5FV2A 2FSDA 4XX1G 2EPKX 4M7SA 2AQQA 2H1PL 2VDOH 2AJYH 3F2DA 2BVDA 3TF4A 3CN3A 3BZDA 1MWAB 4NQDE 1I2QA 3MV7B 3RHWK 2ZT9C 4MDOA 1B9KA 3E7JA 1V0LA 1EEZA 3OXSB 4N0UE 2UVFA 4X80L 4PAZA 5DFVC 2OMVB 2OW6A 1RJPA 4IRSA 4NJIA 1VFFA 2FSEB 2DZXA 3PJWA 4H6KA 4MD4B 2DQIH 2OLAA 3PS7A 4OT1H 1TNMA 4XP4L 3TBWA 3PXHA 1F2JA 3QZEA 3TJEH 4R34A 4X4ME 4WFEE 2NXHA 5LIUX 3W7OA 2YD5A 1MRFL 3PJNA 4JFEA 4NO2B 4UU9B 4H9UA 1RZ8A 2R56H 4OGXL 4UYQA 5ESVA 1RHCA 3PREA 4JIHA 4D1JA 5HR6A 4Z0BL 1IB5A 4R5EA 1EX5A 1OC5A 2O4EA 5FCSH 4I1PA 1K7EA 4XKMA 2V67A 4WJEA 3V5DB 2K6YA 4UOW0 1JZEA 3WNJA 5CPQA 5LCVA 2W9EH 1MWOA 4JG5A 2W07B 2J9ZA 2PXYA 2QDHA 4MMWA 3Q44A 2NY1C 4PG9A 1GG1A 2H8XA 1K3UA 4PCNA 5J6HA 1P5VA 5JH2A 1E51A 1IEBB 4EX4A 5A6MA 4KCVA 5JVLA 1EZWA 1G9EA 1A47A 4UWQB 2E5EA 4HLZH 4JQVA 2FJGB 1PWLA 2ZRZA 6ALDA 4QD2E 2RTTA 2ZRUA