1KTBA

The structure of alpha-n-acetylgalactosaminidase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
388
structure length
388
Chain Sequence
LENGLARTPPMGWLAWERFRCNVNCREDPRQCISEMLFMEMADRIAEDGWRELGYKYINIDDCWAAKQRDAEGRLVPDPERFPRGIKALADYVHARGLKLGIYGDLGRLTCGGYPGTTLDRVEQDAQTFAEWGVDMLKLDGCYSSGKEQAQGYPQMARALNATGRPIVYSCSWPAYQGGLPPKVNYTLLGEICNLWRNYDDIQDSWDSVLSIVDWFFTNQDVLQPFAGPGHWNDPDMLIIGNFGLSYEQSRSQMALWTIMAAPLLMSTDLRTISPSAKKILQNRLMIQINQDPLGIQGRRIIKEGSHIEVFLRPLSQAASALVFFSRRTDMPFRYTTSLAKLGFPMGAAYEVQDVYSGKIISGLKTGDNFTVIINPSGVVMWYLCPKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The 1.9 A structure of alpha-N-acetylgalactosaminidase: molecular basis of glycosidase deficiency diseases
pubmed doi rcsb
source organism Gallus gallus
molecule tags Hydrolase
molecule keywords alpha-N-acetylgalactosaminidase
total genus 139
structure length 388
sequence length 388
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2002-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1ktbA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ktbA01
3HF3A 3HGOA 4CN6A 1JVNA 2BY1A 1AG1O 1LP6A 1X1ZA 1H7NA 4M7SA 4NQ1A 3U6WA 3WK1A 5KSWA 4UTIA 3GXNA 4Z1CA 3L4UA 3S8HA 3S5OA 4JTIA 3GXTA 4WXYA 5DXYA 1VYPX 4GFSA 3AMKA 2V30A 2FLIA 3PWAA 5BNKA 1QR7A 3EWWA 2FHCA 4B5NA 5A6MA 1LOLA 4NJIA 2PWEA 3CLWA 4H8HA 4YLWA 1VCFA 1BWKA 4E2BA 2DORA 5A6LA 2Z0IA 5AC6A 1OGSA 3P5ZA 1TCDA 2JGQA 4MVAA 4H8UA 1MW3A 3WJWA 5I3GA 1TV8A 1IZKA 1TQJA 2GJPA 3PSVA 1ZNNA 2QCNA 1W0MA 1WZKA 4NX5A 3PY2A 2W79A 4LPCA 2BXZA 2FPYA 4O57A 2XWEA 1LWJA 2Y4SA 3PB2A 2TMDA 2HTMA 5G5IA 2QCHA 1WA3A 3FEMA 5G1YA 1OYAA 3FS2A 1JQXA 1KA9F 4N9DA 2VFFA 3G18A 3P67A 4GBUA 2NXGA 3GDTA 2QDGA 1QW8A 3NQCA 5LNSA 4WLCA 5C2XA 5LZLA 2VRQA 1G7UA 3NL2A 3OVPA 3ABRA 3R5EA 1CW2A 1LZOA 5F4SA 4O28A 1HFBA 3DHDA 4J3WA 4Q33A 4M6VA 3TE9A 4YXGA 5BMXA 2DZXA 3MP5A 2ALDA 2ZX8A 4DF2A 3JR2A 3BLBA 1KBJA 4DO5A 3DX2A 1G6CA 1JRCA 2H6RA 2PWGA 2ABAA 1FXPA 3QMRA 2DIJA 1OJXA 5DY3A 3MHGA 1DTUA 4LY8A 1O60A 1S5WA 4OHQA 4JN6A 4UMAA 3EJUA 1EO7A 1G4TA 1UOKA 2ZBTA 2VKZG 4WQ6A 2OW6A 3G22A 4PSRA 1K02A 1Q6RA 1FWNA 3HG5A 3E02A 1MEWA 2EQDA 2ZXAA 2XWDA 4UQCA 3L4TA 3MP3A 3ATZA 3ECQA 4OV4A 2F84A 1OFBA 1LLWA 2A0NA 1ZJIA 2QV4A 1UB3A 4NXKA 4ORMA 2J9YA 3BAYA 2FPTA 3EJTA 1W1ZA 5CSSA 3QQ0A 3W85A 1FDZA 4DF1A 3L4ZA 1XDLA 3KLLA 3STEA 5T26A 1UH2A 3TMLA 2DZTA 3EX2A 2GVGA 2FE0A 4LUJA 3BVTA 1D7FA 1W31A 1G1YA 1DL3A 1MXDA 1JCMP 4A3UA 1ME9A 1WX0A 4KFPA 3GXPA 4O14A 5KZEA 2G3NA 1DOSA 3NEVA 5CLWA 1VGAA 1W8SA 3MBDA 4O13A 4CQ9A 6TAAA 2B7QA 3O06A 3VGGA 1JR1A 4AH7A 5D33A 3G0SA 3KL0A 1K8XA 2Y70A 3Q37A 2ZICA 4O12A 1GCYA 2V5BA 4FF7A 1ODUA 4QAIA 3W88A 1ZJBA 3FYPA 3GR7A 2DZWA 3DGRA 1Q6LA 4JDYA 3UWVA 4M6QA 1JRBA 3EWYA 5EMUA 4I7WA 2X2IA 1VYSX 4FNPA 4UTWC 1FCBA 1ZAIA 3LHVA 2X16A 2EPHA 3O07A 2VOMA 1JDAA 2Z1BA 1KBIA 2V81A 4OU1A 2GUYA 1OB0A 1DJQA 4BI7A 3KL3A 1JCJA 3DHUA 1QAPA 3EDFA 3UWYA 4S1FA 2YCEA 2QCDA 1KGWA 4J3UA 4WJEA 3N3MA 3BVJA 4HNTA 2C0AA 5AHIA 1XH0A 4MPQA 3WJYA 2I9EA 3LX9A 5C6MA 3VX1A 4LV9A 3RK8A 2CZEA 3PG8A 2GUUA 5EPDA 1H7WA 3QPZA 1GQNA 1OFQA 2E8YA 1GYNA 1H51A 3VMPA 3C2EA 1JULA 2OT1A 3THQA 1I2OA 3TCEA 1W37A 1KTNA 5D2TA 5H2ZA 1HT6A 1KFBA 3TONA 1DHPA 2YW4A 3GX9A 2C8NA 3NG3A 3O8AA 4Q32A 3W2LA 3NOEA 3PAJA 4NUWA 4CLMA 5K9XA 2C6QA 5HNRA 4JEQA 2YJQA 2JKEA 1VQTA 5CZ0A 1WOBA 2FTPA 2F61A 5LNWA 1FWTA 3O16A 1M6JA 3RU6A 4ADUA 3AO0A 4DEFA 3IIPA 3NXFA 3O6YX 1H5YA 3BC9A 3VCRA 5KTLA 4XQ6A 2ZRWA 1UASA 5DFAA 1S46A 4LWWA 1BLIA 3NQ8A 2A7RA 1MFUA 3W1QA 3BPWA 1CXIA 1EA9C 2CLIA 1LOSA 4S2CA 5AOUA 1K7FA 2ZX6A 3G1YA 2QJIA 3LGEA 3BVXA 3P8JA 1VPXA 1VIWA 4NJGA 3TAKA 1TPUA 1KM3A 3O05A 4UOQA 3VM5A 2G5WA 3TUUA 4Y90A 1HNYA 3U8GA 1U5JA 1CX9A 3VM7A 2WVUA 3G0UA 1WBHA 3HO8A 3IIZA 5TBOA 3SJ3A 1XSKA 1KM4A 4X22A 3NM3A 4UCGA 1R47A 3IJ9A 4ADSA 1NSJA 1I45A 2X2GA 4UTMA 3RFAA 1E43A 1EUAA 3EDEA 3IIOA 3IGSA 1LTDA 1VC4A 2BHUA 1DJNA 5HR6A 4H7VA 5K9DA 1KB3A 3SW6A 1SO4A 2WSQA 3O6CA 2XIIA 2ZX5A 3IVSA 4N6EA 4ZQMA 5D30A 1WBJA 4GXMA 1KFCA 1SZGA 2B4GA 3USBA 1JAEA 1Z32X 3A23A 4M8UA 4AHPA 1J2WA 1R2TA 4LC8A 4B9YA 1NF0A 1ALDA 1KM2A 5HWJA 3HG4A 3CM4A 3CWNA 1QCWA 3ZR6A 2R8WA 1SO5A 5G2HA 3LTYA 1PZ3A 4MY9A 1PS3A 3CZGA 1AMYA 4GUJA 1OT2A 1HG3A 3C2RA 2QF7A 4HSNA 4WY0F 2ZA3A 2QUUA 2BY0A 1GEQA 2F7FA 5CPLA 3QRHA 1KM1A 1QPQA 4CNOA 1TPFA 3KHJA 4OGZA 1M5WA 2CWNA 1ZS2A 1C9DA 2JKAA 5EA9A 1C8VA 1XL9A 2I14A 3WY3A 3IEBA 1MWOA 3PBUA 3VGFA 3N9RA 5EMYA 1E3XA 3CTLA 3TTSA 3MJYA 3VE7A 5GVJA 4OWGA 3L2LA 1TPEA 2X1TA 3QH2A 4TMBA 1FDYA 5LNVA 3SY5A 1ZAJA 1W5NA 1PE1A 4MZ1A 3QQ1A 4UTTA 3HGRA 5CPMA 4MAZA 3A4AA 3L9CA 5FF2A 3LCGA 4MUZA 5AHFA 2OCZA 3EXTA 2Z6JA 4D2JA 4KWUA 3II1A 3KFTA 3TC7A 5FESA 1PIFA 4GQQA 4Z0JA 3HGSA 3DH7A 5MHBA 4RJEA 4ZQRA 3INPA 4CNPA 1W5QA 3UERA 1I2RA 1Z48A 5HWMA 1NEYA 1JFHA 2FFCA 3O15A 1W56A 3ZT7A 3T55A 4FLSA 3ZSSA 1DQXA 2IGTA 3HG3A 1K8ZA 4LT9A 4FIQA 1SO3A 1YLVA 2NZLA 3DHFA 3LHUA 3LCXA 3ZWSA 1P0NA 1RQHA 3RILA 1YADA 4IXHA 5LKYA 4GI6A 3EJQA 3QEZA 3TJXA 4NXSA 4X9YA 3KE0A 1XD1A 2GVLA 4BK9A 1TQVA 3W86A 1XSIA 5DELA 4CGTA 2FJKA 1XXXA 2C1HA 2Q8LA 3HIJA 1TJRA 5HPOA 3JRKA 3MP4A 5TD4A 4H2CA 4FNUA 1IV8A 4BR1A 1SZNA 3P81A 3VO0A 3EXSA 4RLIA 4UFHA 4UMCA 3LV5A 5D2YA 4NZFA 3M0ZA 1W5PA 2ZRUA 5FEPA 2V3EA 3K8KA 1JD7A 3BVUA 3N19B 4JTKA 1XH2A 3CEPA 1RQEA 1JJKA 2ZZ1A 4TX9A 5F4XA 1SW7A 2YDAA 3UWUA 3TQKA 5U4NA 1G9HA 3C52A 3EWUA 4EF9A 1GT8A 4IX0A 5E0KA 2H8ZA 2OX1A 3CQ0A 4H3DA 4MKNA 3A5VA 3WNNA 2OW7A 4UTJA 5H91A 5HR7A 1Q45A 1D3HA 4AHQA 1I2QA 1U83A 4N2YA 1TQWA 3FJLA 4WUIA 2F7PA 3PF3A 4KFOA 4U31A 2XVKA 2BWGA 5D32A 2ZE0A 2ISWA 1DHKA 4NNAA 1QI5A 3TW7A 1SFLA 3TIMA 1XM3A 4HOZA 4WY0A 3FAWA 4JGDA 3GDMA 3ZQ9A 1MFVA 1UH3A 2HS8A 1TPWA 3W71A 2OSYA 4FIRA 5AYXA 4RCXA 1I2PA 4UFIA 1QWGA 1Z44A 5F7UA 3QSTA 1KFLA 3M43A 5K2ZA 4GINA 3BW2A 1GZGA 3BG5A 3TDFA 2OYKA 2YZRA 2PWDA 3C56A 3RNDA 1L6SA 3DFNA 3QSRA 2Y7FA 1H7RA 2GOUA 2H8XA 5EL1A 2PRHA 3MO7A 2F1BA 3B8DA 1OSEA 2X1UA 2LLEA 2ZZ6A 1CIUA 4AEOA 5IM51 3WNPA 1BSIA 3UWQA 2D0GA 3OLEA 4PH6A 3GBDA 1QX1A 4O15A 3M41A 3FIGA 3EX4A 3V1PA 5ABTA 1W5OA 3L5MA 4GUFA 4CCDA 4HIBA 3BUPA 5CXPA 3VSVA 1LRTA 4UTLA 3B0UX 1P6WA 3OLDA 1YTEA 4RX0A 4TMCA 2D0HA 3L5AA 2ATMA 4J3TA 3ZFHA 3WK3A 2YFOA 3GDKA 2Q3RA 3TOPA 5BOOA 1ONRA 4TR9A 4MYAA 3TSBA 1THFD 3BV4A 4JTEA 2OJPA 2WPGA 1OYBA 5AHNA 2ISVA 3BGGA 3W1AA 1H3GA 3M7WA 3E96A 1G67A 4OT7A 3C61A 4TU1A 2XN2A 5BMWA 3W72A 1RV8A 4YCOA 1IZJA 1F05A 1QOQA 3UYCA 2WCSA 1O4UA 4HOWA 4PL2A 4AHOA 1DEDA 5J5DA 2TPSA 3S1WA 3OVRA 1EO5A 4J3XA 1KM0A 2GPTA 4NU7A 4PA8A 4K7YA 3AXIA 5AHEA 3K1DA 1XKYA 5FEWA 4FX8A 1A47A 1AQHA 3UG4A 3W70A 1GYLA 1KWKA 3KEHA 4OE7A 3KRZA 1XC4A 1O5XA 4JYEA 1GTHA 2ZZ5A 3TA6A 1WE5A 4KWVA 2YPIA 2E9BA 3HJZA 1DORA 2Y89A 3MHUA 8CGTA 1HL2A 2EABA 2Y7EA 5CGTA 2BSLA 4PFMA 1VFUA 3UPBA 3W74A 3GTNA 4MJMA 2A7PA 4J7RA 3I7QA 1QI3A 3LLDA 4QNEA 2E4TA 1NOFA 3BK0A 2RFGA 4FO4A 4ADTA 1VS1A 2Z1KA 3N9SA 2E6AA 2WVVA 3VMNA 2FB2A 4EOUA 3WK0A 1VAHA 3THAA 1XUUA 3ANYA 2QUTA 5AFDA 5F2MA 1SW3A 3NQVA 4IMCA 1F74A 3QW3A 3P82A 1HL8A 1KTBA 2CZ5A 5K7JA 3LXAA 1XBVA 2NUWA 1NM9A 3NPUA 4FMVA 2RKXA 3B05A 4ICNA 3A21A 3FYOA 1CLVA 3PM6A 4L4MA 1A5CA 1TTQA 4JTLA 3IGXA 3NL3A 4CQ8A 2Y2WA 1JCNA 3PUEA 4MOZA 3MUXA 5CPNA 4LRSA 4FNSA 3ZOAA 1OG0A 3P5YA 2CLEA 4PEKA 3NQ7A 1TRIA 3HPZA 1EH9A 3TSMA 3LOTA 4J9JA 4HOXA 4O11A 6ALDA 4U28A 3NA8A 1ME7A 3U2OA 5E70A 4I9AA 2VFEA 4LS1A 1QWUA 1GVFA 2P1FA 1UD6A 4R33A 4GNJA 2BX7A 3W37A 1YDNA 3NPXA 4I7UA 4W9TA 3NQDA 3ZT5A 4B9ZA 3GDRA 1WO2A 3WN6A 3W3OA 5E6YA 4LVGA 3LTSA 4AAJA 2DZUA 2NUXA 1HTYA 1A53A 3ZSTA 2GQ9A 1KCKA 1HVXA 2Y5EA 2V2DA 2V5LA 2V8ZA 3I7RA 3GAYA 5FF4A 1H1ZA 1IXQA 1O7DC 3KLKA 3NAVA 2VEIA 5KEZA 5DCBA 1EUNA 1Q6OA 1YPFA 2BZNA 2ZTKA 4NNBA 2X1RA 1QDSA 3T78A 2E0PA 1IF2A 1RPKA 1J0IA 3W6YA 1GVRA 1CGWA 2HSAA 3TSDA 4UFMA 3S5YA 1GWJA 1CI1A 2CXGA 2PWHA 2QPUA 1QNVA 4O0ZA 3I6RA 4PEEA 4RR4A 2QAPA 1E51A 1KV5A 1X8FA 1M7PA 4UOZA 3VGHA 1DV7A 3LLFA 3R12A 3HG2A 1H60A 2CLKA 1Y7VA 1B0IA 2FIQA 1HWWA 1EP2A 3GKAA 4LVBA 4HNUA 4X3ZA 1XCWA 2VFDA 4LVAA 2YR1A 3LBMA 3EJPA 3BO9A 1EX5A 1ZCOA 2OT0A 4N4QA 5FF0A 3L2MA 4WSKA 1OX6A 4Z1BA 1EB3A 4MYXA 2EKCA 1G94A 1MSSA 1HUVA 3IRDA 1EP3A 1ZY9A 3LCHA 3OLGA 4JFWA 5E93A 2FYVA 1AW2A 4Q4KA 4JFVA 3PVFA 1BPLB 2BHZA 1TRDA 1WV2A 2X2HA 1AW1A 1Q6QA 3NPVA 4FHAA 3E12A 1JCLA 1HXKA 2Y7DA 1AL8A 1XV8A 3DFOA 1TB3A 3OG3A 1KFEA 3OVQA 1R30A 2PC4A 6TIMA 1BTMA 2XVGA 2EEXA 4IQLA 1QHOA 1TMHA 1H50A 1P4CA 2CFFA 3CEUA 1RD5A 3W7MA 2XFWA 1CXFA 4WOQA 3C2OA 1OFPA 1PL9A 1BWLA 4DPPA 2G95A 4NJJA 5K4XA 1DQWA 1K7EA 4UNKA 2V9DA 2CLOA 4O54A 4Z0SA 4AWUA 4RV8A 4CN1A 4LU0A 4QAWA 4HPJA 2WQPA 3SI9A 4GWEA 5DCEA 3UXDA 3UG3A 5F4WA 2EADA 1LM1A 4NX0A 5HUOA 4ZL1A 1F6KA 1KM5A 2GQAA 1LRNA 1HO4A 3KVLA 3LPPA 4NI3A 1WQ5A 1UKTA 2OSXA 3HPXA 4GJ1A 4ZQNA 2WANA 3L0NA 1X7FA 5I3JA 2CLLA 2FH6A 3TKFA 2NV1A 4DO4A 3IIVA 1OFOA 4LRTA 3K8LA 4JICA 1KW1A 1VH7A 4JYDA 4O1DA 3W1TA 2Y7GA 3IVUA 4E2DA 4RXGA 3NQGA 1XDMA 4WZHA 3WNLA 2NX1A 3LCFA 5E6ZA 1ZENA 4WXZA 4IMGA 3EX1A 3BGJA 3WNMA 5HUPA 2PRMA 3TXVA 4HT3A 1OHLA 2A6NA 4CCEA 1OFRA 1S5VA 1QO5A 1GJPA 5CGMA 1F6PA 3GXDA 1VR6A 4BWLC 3DU0A 3CLMA 5D38A 4FB7A 2EAWA 4CN4A 4NJKA 1UA7A 1VCVA 3DENA 3F1QA 5TIMA 3VNZA 4U2ZA 3FOKA 1ZJAA 3DX4A 1FXQA 3ABOA 3ABQA 2ZX9A 1T8XA 3B4UA 5K4ZA 2C18A 3NVTA 1XCXA 2CZDA 3B03A 3G0XA 1SSGA 2Q8ZA 1JUKA 2FDSA 5AYZA 4E38A 1OX5A 2GVJA 1DKWA 3BAXA 4MZ8A 5KITA 3TTYA 3L4XA 2NV2A 3UCQA 3LHTA 3TX9A 4HP5A 4O17A 4HNNA 3KAOA 1XBYA 4EWND 4AEFA 1H63A 1MXGA 1G69A 4HKPA 2ZUVA 3C4UA 2VRKA 4AIOA 3GB6A 1B3OA 4N9CA 3STFA 1OVDA 5FF7A 3DFSA 4GO8A 1FBAA 4AWTA 4JXCA 1HX0A 3B0PA 1VJSA 1XH1A 3M44A 3EWXA 1CXEA 1AVAA 3EJRA 1SMDA 4J3SA 4EVZA 3W7JA 2XIBA 4UIOA 3PULA 1LORA 1LBFA 3TMQA 2WVVB 1O95A 4LC6A 2ZRZA 3G1AA 3SGZA 3C2VA 1PIIA 5F2LA 3CU2A 3B04A 3KRUA 1RVGA 2XN0A 1TJPA 2PWFA 3L4YA 4XTIA 1OF6A 2YFNA 1TTPA 2ZX7A 3TK7A 3FFSA 5I3FA 1ADOA 3G1SA 3LDVA 5F2GA 5G2IA 3Q2DA 1K8YA 3MW7A 5C5YA 4GO9A 1LOQA 7CGTA 5U7SA 2TRSA 1H1YA 4K6AA 4JYFA 4IXXA 2YX0A 5LGXA 3A9IA 4IGHA 3TQVA 3CC1A 3NQEA 3S5NA 1JXKA 3GYEA 2ZXDA 2C3ZA 1VCGA 1VHCA 2OMAA 2WSKA 4IOTA 1N55A 4K36A 3BUQA 2R94A 4QISA 4WF7A 3DFTA 3TNOA 5D02A 3TROA 1LDCA 3LBCA 3W1PA 2DZSA 2YOCA 3WJZA 4OIFA 1L9WA 2QCCA 3W75A 5A8GA 1RR2A 1QFEA 4BA0A 3FLUA 3N2MA 3TFXA 5SWUA 3WDHA 2E6DA 2EAEA 1PIGA 3G1VA 4XBKA 4H8VA 2UV8G 1R2SA 1JGIA 3DX3A 4O18A 1UD8A 3S0CA 3GDLA 3N34A 1JL8A 1QO2A 2EACA 1TPDA 3TFCA 3W1LA 1EHAA 3BG3A 8TIMA 1KV8A 3UWWA 1FCUA 1MEIA 4O19A 1UD3A 1JDDA 5AHMA 2CW6A 2RDUA 5EYWA 3RLVA 1F73A 1OK6A 4KKXA 2WPBA 1YTDA 3OLIA 5BW6A 2YYUA 4AF0A 1JIBA 2F1AA 1SU5A 1FQ0A 1DBTA 1LRQA 3VGDA 2KZHA 2ZTJA 3JS3A 3AJXA 3NQAA 3L4VA 4UNLA 4A21A 5E0FA 4UZUA 2VEKA 2GJLA 1QI4A 3CZKA 2R14A 3QGVA 3ZO9A 3G1HA 3KVKA 3TXZA 3R13A 4IJBA 5KMYA 1FCVA 3P84A 2BXYA 1OX4A 3EX6A 2ZUTA 3PBWA 4QITA 3W83A 3G1FA 4ALDA 1H7XA 1KBKA 3CZLA 1AMKA 3NQFA 1YXDA 2PE4A 3CT7A 1WZMA 4K39A 1N8FA 1XI3A 1MEHA 2PCQA 3TW6A 2QKFA 2QCGA 4LTSA 4XB3A 4FX7A 3W7QA 3VI2A 1RZMA 3C8FA 2DU2A 4GUIA 1V7YA 2Y88A 2AGKA 2B7NA 4A2RA 4BI6A 4GUHA 1DVJA 3C3NA 1CDGA 2ZRVA 2YXGA 4AVFA 5AYYA 2WSRA 1MW0A 3G8RA 4MFEA 1ICQA 1J0JA 4UTWA 3VGEA 1R2RA 1EIXA 1XBXA 3KL5A 5I3HA 5LHEA 5FEXA 3VSUA 4XKYA 1IXPA 4WOZA 1NFBA 1EEPA 4PCFA 3HQ1A 3SGUA 1UCWA 4AYSA 1UJPA 3VNYA 3NZ1A 1ICSA 4LVFA 2A4AA 3UWZA 3NQ6A 2VENA 3S9YA 1Y0EA 2B0MA 3BAJA 3M16A 3W7DA 2F18A 4ONVA 4JY9A 4ZQPA 3W2JA 3CV5A 3L4WA 1A5SA 3WFAA 5I3KA 2D3NA 4U2YA 4JR5A 5D03A 5A5WA 1KM6A 3QMSA 3SZ8A 4LVDA 2NX9A 2NXIA 2BTMA 4UZSA 3N14A 1MO0A 2NWSA 3EKLA 4DF0A 1KXHA 1S3HA 3DDGA 5I5RA 4WX2A 4HPXA 4X0NA 1K3UA 1QPOA 4AF0B 3LB0A 1JI1A 3HB9A 2Y63A 2VXNA 4Y8FA 2C14A 5HXMA 3W7KA 3IK2A 1M7OA 3DBPA 2YW3A 4QJ1A 2VELA 4ZVJA 1YPIA 4XZ9A 1OABA 1G4EA 4O1AA 4HPHA 2HMCA 2ZRXA 1A50A 3NPWA 1W5MA 2RDTA 1V5XA 3PBYA 3T44A 4H6KA 3ZS4A 4UQ9A 3GXFA 1FWWA 2ZWYA 1WP6A 9CGTA 3L65A 5HQEA 3RMJA 4R34A 4WD0A 5D2XA 3CGTA 4UFJA 1NAL1 4X9SA 2NT1A 1QPNA 5EBUA 3MBFA 2H3DA 3I7SA 4NNCA 4A22A 1CXHA 1F76A 3DHPA 4IX2A 3UXAA 1KFJA 3L0KA 2AMGA 3HMJG 2C16A 4O53A 3DAQA 1LWHA 3O1NA 3W1MA 4DELA 1T96A 3LV6A 2PURA 2DJXA 2D0FA 1PHWA 2ZYFA 3P60A 3BCDA 3W84A 1U2YA 3GKFA 4UR7A 3M5XA 2B7PA 5BRQA 4MFDA 3KVJA 4Z1DA 2NUYA 4K8EA 4O50A 1U30A 1SFJA 1UUMA 3F4NA 1D3CA 1AQMA 4FNQA 2DZVA 2ZCGA 3PUDA 4JX6A 5E1QA 2YKKA 1CGTA 4YCPA 2NX3A 5DY2A 1GPWA 3K30A 1H61A 1P1XA 3GNDA 4O4WA 3PB0A 2V82A 4QM1A 4O8RA 1I2NA 3ZR4A 1VFOA 3OBKA 1GVQA 5KINA 2OYMA 5C55A 1FX6A 3BUBA 2QR6A 4IPIA 3TH6A 2WKJA 3KVMA 5DBUA 3K8MA 2EF9A 4WSJA 4JS3A 5CPOA 4MIMA 3KRSA 3PC0A 2GVYA 4JTFA 2J9XA 5G1TA 2YGYA 3B0VC 4ML9A 2Y6ZA 3EX3A 1XCFA 3M07A 5TQLA 3ZWTA 2QEZA 4JIPA 1NF7A 4GIAA 3C2FA 3BH4A 2AAMA 1JF6A 3DC0A 1H62A 2ZQ0A 4DBDA 4A2SA 1JCXA 4K38A 1PHQA 3CIXA 3PG9A 4A29A 4N6FA 2P0OA 2BXVA 4XTDA 2ALWA 5HJLA 3PBVA 3W7NA 2E5CA 4LNYA 3A22A 2C7FA 1KTCA 4QIUA 3LM7A 1G5AA 4AWSA 2GQ8A 3Q58A 1KBBA 4MY1A 1SMAA 4MLRA 1CPUA 1ME8A 1TQXA 3H55A 1L6YA 1F2JA 3WY4A 1IXNA 5CZJA 1TPC1 1CXKA 1BG9A 1C8QA 1R33A 3VE9A 1W9XA 3E9AA 3EDDA 1N7KA 3M5ZA 2V2CA 1SPQA 4UTHA 4JTHA 2VFHA 5DBTA 2O7SA 1AL7A 5A2BA 1PZ2A 4PSPA 1XSJA 5AC8A 4U3CA 2QCEA 1OK4A 3STGA 4X2RA 3BMVA 1HL9A 4AW7A 3R8RA 2QCLA 4JTTA 4K7VA 1OX4B 2A5HA 2QUVA 3HZ3A 5D05A 4RKAA 4BF9A 1UD5A 1VJIA 1V3KA 4UNIA 1TV5A 3RF9A 5LHFA 3BLPX 3WELA 3QW4B 1LROA 2QCMA 4UTUA 4G1KA 4LUIA 2DH2A 5DO8A 3W7LA 3BSGA 2F2HA 3GAKA 5A2AA 3VGBA 3D50A 1UUOA 3HOJA 1K7XA 1PAMA 3DFQA 3UPWA 1SQ7A 1OT1A 4R7JA 1W3TA 5DLCA 4AMXA 2ABBA 3AJ7A 1P5BA 2JK2A 1RP8A 3UNDA 4ATWA 1SR9A 3L68A 4CCCA 4FXRA 5HWNA 2WNWA 1LYXA 3W7RA 2IQTA 3MI2A 4KWWA 3LRMA 3I65A 4JCMA 2ZZ7A 4Z1AA 1O5KA 2WO5A 3ABSA 3GLCA 2YYTA 4E2OA 3MI3A 1EA0A 3NR0A 3L2IA 5I0DA 5FEZA 3D4ZA 4LS0A 3WNOA 1AW5A 3ELFA 3OHIA 3KOFA 4HA1A 1G7VA 5AC7A 2CLHA 2Y62A 1ZAHA 4HSOA 1ML1A 3IV3A 3W1NA 3S42A 1T99A 4HN4A 1UD4A 1QPRA 4MB1A 3DI0A 4E0CA 4QSHA 3CZNA 1S5TA 1QWNA 1A5BA 1KXQA 1D3GA 4XBSA 3TR2A 3LI1A 1P0KA 1K03A 3S6DA 3SR7A 5K3VA 1IGSA 3L21A 3F4WA 4XWUA 1F7BA 5D2VA 5G4WA 3MYPA 1WYIA 3EJSA 3G1XA 3QPYA 4QQ3A 1GOXA 1GG1A 4HHPA 2R91A 5I24A 3UY7A 1FWRA 1PS9A 4PCSA 1RPXA 1OF8A 2F7RA 3WEMA 5AN7A 1KCLA 2VEMA 1J0HA 3GXMA 2NLIA 1HO1A 2CU0A 1TCMA 1BVNP 3VFLA 3UZ5A 1GTEA 3G8EA 5CZSA 2FGZA 1M53A 1KLZA 3GR8A 2YA1A 4XUGA 1BF2A 3W7IA 5EY5A 2E6YA 2QDHA 4NT0A 3W1XA 2J27A 3W7GA 3W38A 2XN1A 4LQ1A 4PC8A 3EWBX 1IIGA 3L0GA 5A2CA 1MXSA 2CLFA 1EPXA 4CVWA 2D73A 1OFAA 2BHYA 2X30A 3DDFA 2DIEA 1OFDA 2ZA1A 4I7VA 5I23A 1TTJA 1MW2A 3W7CA 3Q94A 4U33A 1TMQA 5HDRA 3W23A 3BW3A 2DZPA 3LCLA 4EF8A 1TTIA 1TPB1 1SO6A 4JIQA 4GE8A 7TAAA 3HJEA 5BRPA 3WENA 2E5DA 5J5RA 3EXRA 5CKSA 3VSTA 4JTGA 3BLFA 3QF0A 4OKDA 3P8IA 1YXYA 4YL2A 5IBXA 4FLQA 4TVUA 3E0IA 2WV8A 2WKLA 3S1VA 1I75A 1FWSA 3M9YA 4AMAA 4PL1A 4ZMGA 3WJSA 3DI1A 3NL6A 3NL5A 2ZUUA 1RQBA 1TREA 5CZTA 3FW6A 4OQVA 1XUZA 1EWEA 1WDWA 3P7YA 3QZEA 3LHYA 3UEQA 2EO7A 3CPUA 2YSWA 2QJGA 1KLYA 3S2CA 3ZR5A 3DXIA 7TIMA 1CYGA 2WJZA 2VT0A 4UFKA 1UKSA 3CHVA 1O94A 3M1ZA 1XGZA 2YIHA 4M19A 4GI9A 1VRDA 2A21A 1R75A 2BLEA 3SIZA 1WZAA 2G96A 3QJAA 1SW0A 5F1VA 4CKQA 3DX0A 4JFTA 4TIMA 1Z41A 2V3DA 3LRKA 4LXFA 1JUBA 5DN1A 5IBXC 3S5ZA 4TO8A 3GIYA 1H7OA 1LCOA 4JY8A 2TSYA 3UZJA 3NQMA 1X1OA 1CGVA 4Z08A 4P61A 1J4EA 3GNNA 5LSMA 3BMWA 1GJUA 2F7OA 2ATSA 4NZJA 4MY8A 4FLRA 2QAFA 1CGUA 1PEZA 3CWOX 1RP9A 3NZRA 1J0KA 3D0CA 2AQWA 1BAGA 3GXIA 3WFZA 3VX0A 5LNUA 3IGUA 1JDCA 1L2UA 4MZYA 4JTUA 3SSJA 2QCFA 2J25A 2QMKA 3W7OA 1PPIA 3QYQA 3TQ0A 3W1RA 3BLIA 3W7PA 4FNTA 3EDJA 1B57A 2TYSA 2V0TA 5LGZA 1JUEA 3OEXA 4L4LA 2WCGA 1G4SA 1GG0A 3B06A 3FA5A 4O10A 2J6XA 2A85A 3O6DA 3W9ZA 4FNRA 2TAAA 1C29A 4GKLA 2CPUA 4EIVA 3C0JA 4FX6M 1PJ9A 1UKQA 1ICPA 4JL1A 4N9EA 1VFMA 1V3JA 3A6OA 5G4EA 3M6YA 3TAOA 2ZA2A 3V75A 3GBEA 1VYRA 3P74A 3UD6A 4RZ6A 2BY3A 3D52A 1V3MA 4GUGA 5DXXA 4J27A 1EP1A 1XBZA 1UA3A 3W73A 1KWGA 1ZALA 3ATYA 1TPH1 2X1SA 2VEPA 1LLZA 2O7QA 4CNNA 2AAAA 1OFEA 4UMBA 3D4YA 3LXCA 2ZIDA 3WK2A 5D2WA 3PSWA 2XVLA 1D9EA 3W07A 4Y96A 1R46A 1E3ZA 3QM3A 4WY0B 1VZWA 1TIMA 1QW9A 2WC7A 3LPOA 1I8JA 2YA0A 4JTSA 1E40A 3S1XA 1NVMA 3W87A 3SFKA 4NVTA 1Q4NX 1PVNA 2ZZ4A 3CZEA 4IUOA 6CGTA 2ZUSA 3WDJA 2E77A 3WEOA 4UCFA 2V3FA 1B4EA 5D09A 1XFBA 2G3MA 3AMLA 4U4MA 1GJWA 1IXOA 1QMLA 2Z2UA 2OSWA 1Z42A 3HGJA 1XD0A 4W93A 3GZ3A 2DH3A 1SZEA 1UBSA 3LI0A 4CQAA 3DX1A 5DCDA 1GVSA 2CHNA 3W2NA 3CIWA 4IPJA 4POCA 2ZXBA 3H54A 2A2IA 5AHLA 2Z6IA 2Y61A 3P80A 4JDBA 1YTKA 1JXJA 3BAWA 3EB2A 1PV8A 1YDVA 2EJ1A 2QMJA 3ZT6A 2P10A 3EDKA 4S2BA 4JX4A 4UUIA 3RLUA 1BVZA 1JD9A 2ZXQA 2FB3A 1JCYA 3QMTA 4M7TA 4UXDA 4ZQCA 1YDOA 4N02A 3N73A 3C6CA 2VC6A 2Y24A 4PCTA 2J88A 3NM1A 4RK8A 3CB8A 2F7QA 1TSIA 3F03K 1KGXA 2WKGA 4GRSA 4K37A 4O1BA 1GVIA 2QJHA 1YXCA 3IVTA 1LBLA 4IMFA 4O1CA 2C13A 1X6UA 4BI5A 4UQDA 5BRBA 3QFEA 4YMZA 4UFLA 3W1UA 2VUYA 4GI8A 4AEEA 3P61A 3BAKA 4JFSA 1VB9A 4RZ5A 3LCWA 2V2HA 3VMOA 1KGUA 1QPKA 1AK5A 5CSRA 3LHWA 2Y85A 2A1YA 5CGQA 4JCLA 2ISSA 3BARA 1KFKA 1VHNA 4J3VA 4AIEA 5D37A 1IIHA 4K8HA 1OYCA 3CTTA 3EEGA 2QLYA 4O16A 4ORIA 2D3LA 3VU2A 2WNQA 1CXLA 1FUYA 3N2XA 3MYOA 2WNNA 2C15A 4N9BA 4AB4A 3S1UA 3DKLA 3GVGA 4QNWA 3FJ6A 2E09A 1G4PA 2Q3OA 4KMQA 5L9FA 2VFGA 4LW7A 3CPRA 3NGJA 1JI2A 4C1LA 4RZ4A 3G3MA 3STCA 3BLKA 4C1KA 2ZRYA 4LS2A 4BFAA 4HNVA 2DJLA 3SECA 2WSPA 1LBMA 4OV9A 2WOQA 2C19A 3O63A 4UR8A 3LRLA 4DPQA 2D2OA 4AMWA 2E5BA 2QCDB 2E1DA 4JL2A 5KZMA 2GJNA 3BW4A 5CLTA 1TO3A 1YYAA 1L0PA 3T40A 1TQUA 1WZLA 1SUXA 3BLEA 2BY2A 2ZUWA 2DP3A 3T7VA 4GC4A 4DO6A 1WOAA 2RH9A 4O52A 3PS7A 2E8ZA 3BG9A 2FHBA 4IMEA 1WAUA 1W3NA 2JGYA 3YPIA 3BCFA 4J28A 3KXQA 1M7XA 4KFNA 1VLIA 4OJYA 1VLWA 3BUIA 1A5AA 2ZZ2A 3I68A 3M5YA 2A6LA 1FCQA 3LXBA 3KWXA 3R2GA 3LCIA 4PTNA 3P62A 1B2YA 2FPVA 2WNZA 4DBEA 3IJ7A 1B4KA 3WJXA 4GQRA 3MI6A 2E68A 4M6PA 3LHZA 4O4VA 4OBTA 5G2WA 3WMSA 3W7EA 4ZZ9A 2HS6A 3CZSA 3BAIA 1W54A 3NYZA 3PR2A 2NWRA 4ZQOA 2FH8A 5CG7A 4DXVA 4LV4A 2NSXA 2CLMA 3D51A 1TV7A 1JG9A 1I4NA 1TQSA 4Y9AA 3LERA 2W6RA 1PCWA 1QHPA 1UD2A 2X2JA 1KXTA 4MLJA 1F5ZA 2A7NA 1V3LA 3WNKA 4FLOA 3FAXA 4YWIA 2EHHA 4JTJA 5AB3A 2ZFAA 2G97A 1CGXA 4JX5A 3A24A 1L6WA 4UC5A 4DQWA 3RIKA 3G3DA 1FDJA 4H4IA 2J24A 3KX6A 4O0KA 3VKJA 3BVVA 1ZHAA 4JD4A 3WY1A 2QPSA 3NO5A 2VFIA 1MVYA 1J5TA 1TPVA 5FI8A 3W2KA 4M56A 2FQIA 3BSHA 3DFPA 3BUDA 2YA2A 2JKPA 3FKKA 3OA3A 3W2UA 1UH4A 3BVWA 1BEUA 1BKSA 2NT0A 5L6UA 5D04C 4JFUA 3QC3A 4FEZA 1MZHA 2B7OA 2H3BA 3MMTA 5F1UA 1FY6A 1B9BA 3IJ8A 1Q3NA 4UQBA 3IIXA 4UTTC 5HINA 3OIXA 1QOPA 3L5LA 3FKRA 3UG5A 3PUOA 3TJLA 4LOCA 1R34A 3WDIA 4PODA 2NXHA 5F2IA 2RHGA 3UY8A 4UTKA 3A5FA 3G1DA 4JNMA 3LTPA 5EKYA 3NDOA 5I3IA 4NJHA 1WPCA 3W76A 1TQTA 1H7PA 1U33A 4N4PA 5HULA 5K9CA 5KZDA 2I1OA 2WSYA 3EKZA 2CZFA 1CGYA 3H53A 1SSDA 3TU9A 4M5PA 4UQAA 3UQNA 3HBLA 2GJRA 3E49A 4BZYA 4XKYB 4UQEA 1TYGA 1HTIA 3M5VA 3M47A 3MHFA 3L67A 3AXHA 3DZ1A 3NQ2A 3W7HA 4Y6GA 2ZZ3A 2ZWZA 5C54A 1MW1A 4IWWA 4R53A 3GK0A 2WVSA 3T4CA 5E9AA 3L66A 2WVTA 3HPSA 1SZFA 5FF3A 3VNDA 2RDWA 3TV8A 2JBMA 2OZ0A 2W0UA 1EWDA 2H90A 4AXKA 1KXVA 4BWLA 4IMDA 3W2MA 3NNTA 3G24A 2VNCA 4RXFA 2VR5A 1WXJA 1JQVA 3MWAA 3W22A 3TC6A 3DKJA 2E6FA 1W3IA 4P2VA 3R89A 5LNRA 5HMSA 3A47A 1ZFJA 2FHFA 4FXSA 3EWZA 4AYGA 2EGZA 2ZDRA 2J9ZA 2OYLA 1JF5A 2PRLA 1PCKA 4MJZA 3WY2A 1GVOA 1T0OA
chains in the Genus database with same CATH superfamily
1FH5L 1NMCB 5DGRA 4BA8A 5FUOL 3QQ9C 1AG1O 1LP6A 1X1ZA 3U6WA 3VFMA 1IUZA 3EH2A 4HIIA 3GXNA 4UTIA 3GNPA 3I6KA 3S8HA 1OPOA 1ZVSB 4JTIA 1AGCB 1FG2A 1R3HA 1IL1A 1EPFA 1VHPA 5BW7A 5JUEH 4EAEA 5KG9B 4WXYA 2V30A 4OD1H 1YYML 1QSEA 3P3RA 4Z0BH 2WXGA 3FK3A 1DBAL 2FHCA 3T8XB 1EUTA 5C0JB 2QZRA 3QJSB 3IEAA 1WKDA 3EYFB 4L29B 1TTGA 4GXFA 1LXMA 3LRSA 1YMME 4H8HA 2PGFA 1X38A 4U6YB 4W4OA 2R7EB 4RDWA 3KXFD 1X39A 3DYPA 2FGWH 1SJHA 1BWKA 4HISA 4X2PA 2UXVA 2WLIB 1S3KL 5A6LA 4HIJB 5AC6A 1OGSA 4Y7MA 1HH6A 3MRJB 3P5ZA 1DFBL 4Z7OF 1S5IL 1RZJC 2PR4L 2G41A 3QPEA 2Z1PA 4J2PA 4MVAA 3TN5A 3WJWA 1VADA 5I3GA 4MX7A 5FYKD 4PLNC 1G0CA 1IZKA 2JCCF 2XWTB 2XA8L 2ZWLT 3T8QA 2VLKB 3LEVL 4GAGH 4IBSA 4MA1B 3WCZA 1NWPA 2GJPA 2R83A 5EBGA 5C86A 1FYTD 3ARFB 1WZKA 1ZNNA 4C6LA 4OGXH 1BQUA 5TQ0L 4XC1H 1D8WA 1KBLA 2R4SL 2BXZA 3W9EA 1AY1L 2XWEA 4XGZB 3L3JA 2DPKA 4HSCX 4JDTH 4F2ME 3O3DB 4YHLL 1FSKC 3AWGA 1J1XL 3NRPA 3V7AE 1A7OL 2HTMA 2GHWB 3KD4A 1A5LC 4UB9A 1WA3A 5I76A 3OMAB 2ALAA 2OJEA 3NG5A 1HSAB 3AUVA 1OYAA 1NCOA 1D6VL 2IH3B 3IMVA 4Y2LA 4YDVA 1JQXA 4N9DA 2VDQB 2APXA 3CSGA 4P23D 1U8PA 2EEDA 3S6CA 1T1WB 3GDTA 4H9ZA 1MSPA 5A6KA 4XIAA 3DV6A 1EHLH 3LN4B 2IDUA 3FQ4A 3PHQA 1HWGB 4GQ9H 4JJOA 2HLAB 4WLCA 3LQLA 3IRSA 4EACA 2PLMA 4F0HA 4HS8L 3NL2A 4J8RB 4BJLA 4Q8PA 2E59A 4O51A 4NZ3A 1X9QA 1HSBB 1UXLA 1RJLA 2GQHA 4JRYB 4S1DC 1LZOA 2PDBA 1HFBA 3DHDA 2Z29A 1U8JA 5ECUA 4JRYD 3PBMA 2ORBL 4A63A 2ALDA 3MTRA 2UVFA 2VYOA 5ABGA 2JJSA 4DO5A 1LE9B 3DX2A 4Q9RL 4YPGA 5DWUH 5GZNC 2PWGA 4FKKA 4G9FB 1JRCA 1H3UA 3AS3A 1N5AB 3GKWL 1BFTA 1BJ1J 2AK1H 3TVMA 2CKBL 2DVUA 2C1GA 4MJJA 3MHGA 1IAOA 1O60A 1LDPL 3VXRB 4U4BA 3EJUA 5L0QC 2VKZG 2OW6A 1FZMB 3L3HB 1A22B 2P24A 3VFVB 4ERGA 3JUYA 2X87A 3C2AH 4M61A 4PSRA 1B0RA 3F7YB 3V4LA 5EU4B 3HG5A 2ARJA 1DEEA 4OJDH 5I6NA 1H0DB 3KBJA 1NKRA 5KSUB 1EZVX 4PP1C 3VFSA 1CG9B 4OLZH 3L4TA 3MP3A 4QRRD 4DP4X 2PUZA 5CS7A 1G9MH 4DJEA 1UPMB 2IQ9H 5I78A 4WGVB 2J77A 5EIIA 2AFNA 3D2UD 1FWHC 3R43A 1ZJIA 2LT9A 4A2LA 1X98A 2J9YA 1UACH 3WLWC 1JV2A 2BS71 3BDXA 2FPTA 1UM4H 2UZYA 3PYCA 4LLMB 3QR2A 5ERWA 3X3GH 4EZKA 1JYXA 1VIZA 5LIKX 3WQFA 3QQ3B 4YVVA 3EF7A 5LBVA 3CVHA 3UP1A 4DF1A 4UAHA 2WXQA 2IPTL 5TDOB 3UJ2A 4N0RA 1XDLA 1P4BH 1A8ZA 1I82A 4KTEH 4F0RA 3EX2A 1TJ0A 3ARED 1EAQA 1T8QA 2AXWA 4NQVA 3QJRB 3VXSD 2FE0A 2E27H 5DD1L 3VUAA 1GQJA 2GVGA 4HK0B 3ME3A 1FG9C 5D9SB 4ADIA 1DL3A 4A3UA 1SEQL 1MXDA 2GGIA 1KCRL 4DHGA 1ME9A 3KWVA 2B5IB 2X3CA 2YMTA 1TA3B 2O6FA 2VMJA 4QCIA 4DKTA 2R0ZH 2WNXA 2GY7B 2R29L 1Z3GL 1DOSA 2VR9A 5CLWA 2OOGA 2OI9B 3L2NA 4QF1B 2AQ1A 3BEVA 4JZJB 2CRMA 4BINA 1EEZB 6TAAA 2W27A 1YEGL 3C5SA 5BS0B 3TH3T 3O06A 2Q7NA 3EGXA 3BZ4B 4BK8A 1JR1A 5CC5A 2ENSA 5HHOB 1N64H 4X83A 2LLGA 5FYJD 3AT9A 5MI0B 2OULB 1CK0L 3Q37A 1IGJA 4M7JH 4Z7AA 5IROD 5I1CL 2V5BA 3BUVA 4U3XA 4YHOL 1ODUA 5JDJA 2FB4H 1MIEL 3I3EA 5B3JE 2HWZL 3HFFA 3KXFE 1KT2B 3HVNA 3Q2LA 4ODUA 2Z00A 3L9YA 4DFHA 4JKLA 3OZYA 1Q6LA 1F3XA 4G43A 2FIKA 3VD7A 2COVD 1ONQB 2I25N 1AGFA 1LD9B 4MA7H 2BC4A 5J89A 1XG4A 3RR1A 4WJ5A 1LO0L 2Z1SA 3MU7A 1BOGB 2UZ9A 2X2IA 1A6WL 1KXTB 2RBLA 3OX8B 4OZFA 2VMEA 4UTWC 1J48A 3FDWA 1T89C 3HIZA 3T1FA 2RAGA 4TYUA 2X16A 4HF5H 3QH3B 1BD2A 4I1PA 2QGHA 1HILB 2G30A 2Z1BA 4GY4A 3QYSA 3G5VA 2AEQH 2DICA 5F9WC 3VXSB 5IB4A 4KETA 1DJQA 1VSCA 2WXLA 3FZUC 4CMMB 5L2JB 3P4MA 1OM0A 4HIXH 3Q2VA 5CGBA 2VX6A 1EQPA 3UWYA 4S1FA 4BFIB 3QY7A 5HGAA 3JV0A 2P5ED 1TMCB 4J3UA 5DC2A 4J3OF 5F44A 2OZ4A 3V6FA 3WTWA 3FXIC 3QAZB 5AB1A 1MQQA 2ICCA 1OM3H 2OVLA 1ZU8A 3UP6A 5AHIA 5DJ2A 2P5EB 3VDHA 4IMAA 2AQNA 3RK8A 2H9AA 4FXKC 4PJDB 1L9SA 3GJFB 3MJ9H 1XF2B 5B1CA 2Z92A 4IKNA 3LNIA 3SPVB 2YEZB 3SCMA 1KB5L 4WFFD 1S2UA 1JN6A 2W1NA 3AS1A 4WAFA 3GZAA 5ECJE 3QPZA 3FCPA 1OFQA 4S1QL 3NAAH 1GYNA 4L5FL 3RVWD 1T1YB 4KI5E 3VMPA 1OK8A 1L6PA 1PJWA 1WFMA 3WLRA 3FO9A 5EBLB 3DV4A 4HWEH 2OT1A 1T5KA 3CFBB 3LH9A 3THQA 5HK4A 3PZUA 3LD5A 1PLBA 1FVCA 3TO4D 3HNTH 5KVGL 1V6YA 2BMBA 3BUYB 4G8FA 2QQKL 4LLWA 3SY0A 4LUTA 7PTDA 1ND0A 2D8KA 2ICES 2CYGA 2H32A 3E38A 2R23B 3C0QA 6XIAA 3S4SA 1TZHA 2ZJSH 2QTEA 2W65B 4GKNB 3DX9B 3EOBB 4IBTA 4TVPE 3PAJA 1OY3B 4W9LC 3ZVVA 3CUHA 4YXLH 2OV0A 4LLDA 5HNRA 3HPJB 4IU3B 4G6JL 1U5HA 3VI3F 1XTMA 2YJQA 4PVBA 1E6OH 3PXHA 1A4MA 5E2VL 3N6JA 3VJ6A 1W2VA 1A7PL 1QTSA 1OC6A 3CHCA 4DF9A 3NEHA 1IT7A 1XLHA 1B2WH 4UYPA 5DVMA 5JYMA 2J66A 1M6JA 4F7TB 3R7MA 3E0WA 3RU6A 5ABEA 1H6EA 2MPVA 5BW7C 1JUFB 2NUTB 3FFCE 1YPZE 5AVWB 3SDCA 3CN3A 1HUVA 1O1ZA 3AMGA 1LK3L 2Q7AA 4NN7C 5FJOA 4QJ5B 5EEUA 2PGEA 3AOFA 3COTA 3MYJA 1A7RL 1OCCB 2VDRL 2YQ2A 1HEHC 3C8DA 4ANUA 4EN3C 5KJRL 2GYIA 3IDUA 3E6EA 4JRLA 2XIMA 1MFUA 3JV5A 3L7FA 1NGWB 2J6WA 4X0KB 1C5DA 4Z7VA 2FEDD 2V9UA 3AHXA 3BOFA 2NY0C 4JPSA 2LU7A 4JY5L 4PTUB 3WIHH 1LQ2A 1CXIA 9XIAA 3V6OA 4KROC 1D9KD 5C0EB 1KY6A 2X05A 3QDJD 3HAEA 1SY6H 4IGBB 4ALAH 3QWNA 3MANA 3ZE1F 4UM9B 3IDYC 1VFHA 2QJIA 2WSDA 3IUDA 1WWCA 3LAFA 4ZCWA 5DHDA 1SBSL 5IMKB 2G75A 2NXYD 2Q86B 4JRXA 4J2MA 4U1LA 2EO9A 4EN2A 4OCXH 4NDMB 3TCLB 3U6RB 4EE2A 4Q9RH 5FL0A 1MFAL 1OCRB 4LSBA 5AW0B 3ULVE 3PABB 3T08A 4PGLA 4EVNB 3L9EA 2WVUA 2UXFA 3N3EA 4K23H 1OGGA 1QVBA 1CICD 3HO8A 4IFOA 3UTTE 5ADPL 1REIA 3TBSA 5TBOA 5C0DB 4Z3EA 1AGEA 3RGVA 3UTQB 5MHSE 2R39A 3GTHA 1TB3A 3EBHA 1MCWW 3SPGA 1I45A 3HG1A 3LS5L 3WMLA 5DRCA 3QHFL 1EUAA 1G7HA 2BNRE 2YKLL 3IGSA 4F8LA 3LZRA 4ZO8A 2V8LA 2RAMA 1QOXA 3ZJKA 3WBEA 5DEZA 1XPYA 5M94B 4P59H 5GRUL 1KB3A 5ABDE 1SO4A 3O6CA 1YRKA 3RLSA 4KEMA 4HWBA 1CD9B 2AJXH 3EYQD 4PY7A 5SWQB 1R3QA 3S3SA 3PRZA 3H2AA 4N6EA 4ZQMA 4GCAA 1CZ8H 4HUVA 1SOSA 4GXMA 5D30A 1SZGA 3USBA 3SJVA 1EEXA 1T3FA 1AJ2A 1FH8A 5D70L 2IQAB 2JB5L 3N85H 1QK0A 4NRSA 4MB5A 2JJSC 1W1TA 4AHPA 3CUPB 3RJQB 5CR8A 4KKLD 1CDJA 3CXHJ 4D7BA 1JXFA 4MDOA 3UZWA 5ICYA 3TVMC 2EKSA 4B9YA 3B4YA 4LC8A 1IKOP 2XN9E 1I7ZB 1EL3A 1XIFA 5HWJA 4NRXA 1Q9WB 1GOOA 5I18L 1QCWA 4PIBA 4X4ME 2R8WA 3SGJA 2VX4A 4Y19A 1WSST 1SO5A 3LZ3A 5IJKC 3SJNA 5G1MA 1QVOB 5FJJA 1AGBB 1RFDL 4UQ2B 3FO2A 2CESA 3M0LA 1A7NH 2D03L 2XUWA 4H0HB 4QMEA 3QJXA 4Y2NA 4YSRA 3ZHNA 4GUJA 2N4IA 1F3JB 2BIOA 4OU3A 3VFTA 3UAEA 4B0MM 3I9IA 1HK6A 5DJ6A 1IKNC 2JH2A 3AS2A 3VA2C 2VLKE 4IP7A 4WY0F 1J86A 2X4PA 4EF3A 3NOIA 5JPMB 3QRHA 1FL3A 1ZANL 4PB3A 2P3YA 5A6BA 1M5WA 2CWNA 4LALA 3ARDB 1YNTF 4XX1G 5FGBA 1BKHA 5FUCE 3FOMB 4LCWE 1KJ2L 5KVDH 4J3BA 5KSBB 5EA9A 4I1RA 3CQKA 5HYFA 4CQDA 1UFGA 3LY6A 3MX0A 4HPJA 3WY3A 4ZK8A 3IEBA 2Y5JA 5CZKA 2X0UA 3FPYA 5AYBA 3N9RA 5EMYA 3RFRA 2JVUA 4PLKD 4EI5C 1VPOH 2E9JA 3HBPA 3MJYA 1URIA 4MMWA 1JERA 1GJIA 2QF8A 4OWGA 1ZPTA 4U1GC 5F7NC 3C0SA 1QACA 3GTXA 1BXXA 3LHPH 3LXUX 1FQ9C 1W5NA 3KBSA 4OIIL 2OMYA 4NT6A 4ZQKA 2OXHB 4NRZA 4XP9H 4XPAL 5JHDE 2OZ4H 1PE1A 5CPMA 4JLRA 3LKNB 2EINB 3A4AA 1TTFA 1S9YB 6PAZA 1CMOA 2XVNA 4XBEL 1QBBA 3CYJA 3L9CA 4MUZA 4QHLB 3V3WA 3D0AA 2QHLA 1NP0A 3KFTA 1JP5A 2BOCB 3HE6B 3NTCL 4GQQA 5B8CB 2WBXA 4CC0A 4ODBD 1RIUH 2COQA 1JAKA 4XMTA 2OMVA 3TA3D 2C1IA 1W72H 2WJDA 2PNDA 5MHBA 5I66A 1Z48A 1FFNB 3GB7A 1EGJL 3QXDB 4J1UB 4L4VB 1JGEA 3GSWB 3ZT7A 3WG6A 1QSEE 4FLSA 4E4FA 1ADQH 4RSYA 5H8PA 4KVNH 1QR4A 3SE3C 3HFTA 3PZIA 1ACYH 3KTXA 4P2RB 1K8ZA 2Q8XA 3V5CA 4NM4H 2ZRUA 4KPHL 4ZMAT 4FTVB 1DQJB 2X1IA 2GVEA 5KBLA 1GKEA 1FL5A 3LZOA 3ZWSA 2A3HA 3RILA 4IXHA 4GIOA 5DCCA 3T0BA 4GI6A 5D55A 3QEZA 4EUPG 1S2EA 4XAZA 3TJXA 4L5FH 4ZSUA 5D1ZB 4IOFC 1XD1A 3FXGA 3W86A 3KS0H 3LZLA 4L9LC 5AZ2L 1MRFH 1P0EA 3VC5A 2A1WH 4Z76B 4WWPA 5C2BL 3QXBA 2L4OA 5LYRA 2Q8LA 5GGSY 1BX2B 2ZSVB 3HIJA 3C75A 4GZIA 2C1OA 1V7AA 4B5XA 4GMSH 3H2EA 1IEXA 1NKGA 4NJ9H 4IIHA 3URQA 4TN9A 4NUPA 4FKHA 4XOBA 1V0LA 1E5YA 3C5QA 1ZCRA 3MV8D 2JKSA 3GXUB 1IV8A 5IV2B 2HMIC 4BR1A 3P81A 3DLQR 4N28A 2MFNA 2WXKA 4RFOL 4XZWA 2P49B 1LWRA 3TYAA 3LKQB 5K93A 4AUUA 1JF1A 1HOEA 4BWTA 3O9WC 2FZ8A 4UMCA 4M6ML 5D2YA 1CTNA 3LH8A 3STLA 3D0LA 1AZBA 2IJ0C 3NRQA 2ATPA 1KTJA 3OKMB 2V3EA 3K8KA 4PJBF 3HTLX 5AC5A 1QABA 4P04A 3WQ6A 2AJZA 3N6QA 4JTKA 4BFFA 1XH2A 3CHSA 3TWYA 3FQWB 1FGNL 3KR3L 2Q6WA 1NOWA 2YD5A 2BOLA 2DLGA 1BXBA 3NK4A 2RALA 4WK0B 3UTSD 3MNWB 1QYGH 1LEKA 1OHQA 2XPZA 3KVPA 5INCB 3V7MA 4JK0D 2VL4A 3MCLH 4JFFD 5CU5A 4AT6B 4JG1H 5MENE 4CQCA 3T6QC 1GYUA 4UU9A 3FH5A 5E0KA 3VWJB 2OX1A 4MKNA 1ZT4B 3A5VA 2OW7A 4NPKA 3FT3A 5A94A 3LQZB 3CQIA 3TZVB 4AMKL 5H91A 5E6IB 2AKRA 3WIHL 1O5PA 2DY3A 4ZGYA 4ILSA 4XX1E 3PHOA 3T4AC 5ACLA 4LIQE 3OTTA 5K9OB 2Y1HA 5B80A 3BDYH 3EJJX 4PJHB 1IJ9A 2W61A 4APXA 4M7KL 5DVPA 3VG9C 2O0TA 4WDWA 1C91A 1U83A 4N2YA 3WQOA 3ZVHA 1TQWA 3SE8L 4LVHB 1OWWA 1WCQA 3LYEA 4WUIA 4UM8A 1OEZW 4W68A 4KFOA 4U31A 2HLAA 3K6DA 4F2EA 2VHLA 4ODWA 1AZRA 1GHFH 2ZE0A 3II3A 5GSVB 4OV5A 3SDAD 3W87A 4HKXA 1QI5A 2N56A 3CBWA 1ONEA 1TZZA 3TW7A 4JGDA 2HAZA 4PRHB 3OC5A 5H94B 1RA5A 5HNUA 7REQA 3F3HA 5HSFA 4EN3A 4MB4A 4WI8A 2OLDA 1X4YA 4LF3B 1TPWA 2PZ0A 4P8WA 2BMKB 5IQMA 5K9JL 3QFJD 4P59L 3LG3A 4R7WA 2AJSH 2VUKA 4FTVA 3BHBA 5AYXA 5DMKB 4WW2F 3VTTA 1I2PA 3QGAC 5LG6A 2VC7A 4YLCA 1NC4A 3IPEA 4CD7A 3QUML 3ZX1A 3QY6A 3RL1B 3AU6A 1R9ZA 1POKA 3CHXA 1GZGA 1LUCB 2VLLA 2DSZA 4TNVF 5C0BB 3QWRD 4Z23A 1TO5A 3MLXH 1QEWA 1S7UA 4KH2A 1NBZB 2OMTB 4WTZG 2PCXA 4LY4A 4JTRA 1L6SA 4WY7H 4RL3A 4LF3A 3QXAA 5DD3L 2D9CA 3DARA 5E4EB 2DT0A 3MO7A 1HHJA 2F1BA 1OLLA 3EYFA 1ZGLM 2HTKC 4C5YA 4BEQA 1ZDQA 4E4UA 1OSEA 2ZZ6A 4LCYA 2OFQA 4AEOA 1S9YA 3EADA 1FRGH 1P6FA 2RGLA 4PS8A 2WCPA 3TCXA 2D0GA 1DANU 1G6RH 5A43C 5IFAL 2IDQA 3GBDA 1QX1A 2JIWA 3BANA 3RKDC 4M6UA 2VMDA 5I19L 4JNXA 1W5OA 4QHKJ 1EXUB 3AWFA 4PUBH 5B39G 1ITUA 4JQVC 3WH8A 4GQZA 4E8GA 4IHBA 4J6IA 3FUIA 4UTLA 1QLFA 3UBXB 4DN1A 3B0UX 2H41A 4V1DE 3QNYB 3OLDA 2D0HA 2K8MA 4L8CA 1QA9B 4FNLH 4BF5A 2Q3RA 1CGSH 1KOAA 1FVDA 2FRGP 4Z7VE 5I0VA 2VSMB 2XFRA 4A39A 4K7PX 1S7RA 1ONRA 1XIWC 35C8H 4QCEA 4TR9A 4ZZFA 5GJNA 1UR4A 4FS9A 3SEPA 1W1VA 4YNGA 1J9CT 1MCEA 2WUBH 1L0QA 3SKJH 5AD0A 2REQB 2VDIA 3RWDA 4AMCA 3ULSA 4ZAKA 2WK2A 4DJEC 1KIPB 1OYBA 3KPNB 1X5JA 1GGYA 3QUXB 3SCNA 4LKXA 1E4XL 1WRFA 3TJEL 1O1HA 3AALA 2CNZA 4NAQA 3H85A 3VXUD 3EYUL 1EXBA 3HU7A 1S1RA 1LGVA 1W72A 5JPMC 3AQUA 4U5KA 1S8DA 1OC7A 3WMQA 1KUMA 3LS4L 5HI5C 3E96A 1FUNA 1YMMA 3BZEA 2HRPH 4QOKD 2WB7A 3MFFB 3EO0B 4C59B 2YPLB 1E8YA 3KPRB 5BMWA 4URTB 3W72A 3PXLA 3MXWH 4D0CA 1F05A 2PPAA 5EPMA 2NVDA 5DA4A 4HTYA 2WXIA 4KAQL 2A9MH 1MN4A 1XHHA 2MQ0A 5EZOH 1UIPA 2C26A 4QDGA 1Z6JT 2OX5A 5IFJA 1TQCB 2EIZB 1EGJA 1T3FB 3ARQA 2VZTA 4H26A 1NGQH 1E4LA 1C16B 2G9KA 1KM0A 5B39A 1N6VA 1FHLA 2GPTA 4NU7A 2ZKYA 4NJAL 3FNKA 2ENQA 2RH0A 3I6LD 1I3RB 5FEWA 3V0EA 2DI7A 4NM4L 4BSWA 3HC4H 1A9EA 4JM2C 4E41E 4NC1C 4R83A 2V68A 3E8UL 3ALXA 1N59B 3ZDZE 5J8OA 3KEHA 1IBZA 1E42A 2IWFA 4JPVH 1MFDL 5A7EA 1XC4A 3HMXH 5MEPB 1MRCL 3VXOB 3GWJA 1NCWL 5H37H 4TVSa 2KAUC 4LSVL 4M48H 3JSSA 5AZ2H 1K4HA 2NQJA 2Z35A 3D69A 1YO4A 3M6DA 4YH6A 3QXDA 2MTAA 5DZPA 1CZ1A 4PD4J 1LL7A 4YR6A 4H1ZA 4J40A 4G6KL 4XNZC 5ICZA 1O0VA 1HH9A 1A14H 5D7JC 5ACZA 4REQB 4KBPA 1ZPUA 1MFEL 2Y89A 4WIWA 1BGXL 2JCCB 1WDAA 2D7TH 3G3LA 3UPBA 1FV1A 1KIRB 2Y2TA 5DU7A 5K39A 4TUJA 2DQGL 4U1LB 2JALA 3GIQA 4R3UA 3EEZA 2A7PA 5AOLA 4ODXA 3GDBA 5DD0L 2A3AA 3LLDA 1Y07A 3R0MA 3SD5A 2APTA 1UEYA 1E6PA 2YPLD 4OCMC 1DJWA 2J78A 3LLXA 2RFGA 4OUIA 3PQYE 4ADTA 4K1WA 3D4GA 2PYFB 1V6VA 1ENUA 2FB2A 3H12A 2OMYB 1N2RA 1CD0A 4NT6B 4ZQKB 3FN9A 1VAHA 2J88H 4N5EC 5E00B 1MCOH 4EI5B 1RHFA 4W5UA 5CC6A 3ETBJ 3G5WA 3MRBA 5F2MA 1K2DB 2V6HA 4NZUL 4WO4A 1Q6GA 4L8SC 4S3EA 4N1EA 4X50A 1ZAGA 4JIHA 3NQVA 3GFUA 4OZHE 3TM6A 3DUGA 1KJVA 2Z26A 4H7ZA 4NP7A 2VQUA 2UXGA 4KZCA 1HL8A 5D2NB 4I2XE 3P82A 4FEIA 1J2BA 3D1MC 5GGRY 5I15L 1UG9A 5K7JA 3LXAA 4XAYA 3NPUA 5LNDA 1W9BM 3EPOA 4IQHA 4NC0B 4DGIL 1R5VA 1PKQE 2O6DA 2DT3A 1Z0NA 3H8NA 1A5CA 1D5BB 3LQAL 2CJUL 3VE0A 3D39B 5FHBL 3KPMB 4PS7A 5PCYA 1H2JA 4CQ8A 2Y2WA 4PRIA 5G5DB 4F8OA 1XLDA 2ZSWB 1RZIB 2PF6A 3O0LA 5CPNA 4NWUL 4P5TA 1WISA 4OFVA 4LRSA 3E9TA 1IAIM 1GOMA 3ML8A 5A3IC 2A4EA 2JE8A 5D7LB 3ASOB 1MF2L 3CVBA 4TOQA 3HPZA 1IBYA 1F56A 1EH9A 5FOBB 2F6AA 4C6BA 3ITYA 1AGBA 3SDAC 4MNKA 2A0LD 2QVTA 1VFFA 4YIQA 1JZEA 1Q38A 3REVA 4I9AA 3B9VA 3CNYA 1F8TH 2W62A 1PU0A 4LS1A 3RRAA 1GVFA 1PX8A 2VC2L 3QEQE 4DP1X 3IXAA 3QYMA 3KYKH 4PBVC 3C08L 1O6SB 1JPTH 3CC5B 3NQDA 4K8RD 2PDYA 4U1SB 1XHGA 3GNML 4N0UA 1S7TB 2PYEA 3W3OA 3HNSH 3W29A 4QRSA 4N24A 4MXWH 3GSUA 3NT0A 2NUXA 2WO3B 1QFWM 3U2EA 5CFHA 3LIZL 3MLRH 4HBCH 4GXVL 1KCKA 1D7KA 2WWMC 4PYGA 4DZBA 3QUXD 2XBTA 1AE6H 1KJMB 5EU5B 3NVDA 1H1ZA 4JBRA 5G5IA 2BP8A 1YLBB 4P5MA 3U46A 1P7KB 1UWEL 2ZNWA 1KJVB 1T7VA 4ZAKD 3VNJA 5KEZA 5D4JA 1E15A 3PFRA 3ZJ6A 3DJTA 4C6CA 2E86A 5IWLA 2VL5B 3I4EA 1GZPA 4PRPA 3MRBB 2ZTKA 3T78A 2X1RA 1E5CA 2ZP9A 3BKML 1ZHBA 1CD1B 3PWVA 2WHLA 3VFNB 3DFYA 3B43A 4N2CA 1G6RL 3T3MB 3IJHB 4JE0A 2ZWNA 5DK0B 4ZTOL 5I19H 4YDIH 4BZ2H 4ZXOA 2WQUA 1RHHB 3W11C 3N43B 3UYRH 3EYPA 2BIPA 1FH5H 2QPUA 3KCJA 3DIVA 3X13B 2QAPA 2NY6D 1TNNA 1KV5A 2XC8A 3VGHA 2CUIA 5T3ZL 3NQIA 4UM9A 1DV7A 2ZVRA 1H60A 3TWCH 3MUGB 5L6YH 1RPUA 5DD5H 4LVBA 2NW2A 1UXMA 1U4EA 3O6KH 4HWZA 2JJWA 3B97A 4ZD3H 2WUCH 3WSUA 2HVKB 5I1LA 4Z2HA 1OB1A 5FYJL 1RZQA 3RWFB 2O9OA 1DBAH 4TTDC 1G9MC 3DPBB 3T77B 1HJQA 4A4AA 4G2AA 4ANVA 1EX5A 5GGRA 1EO8H 1C9WA 2OT0A 4N4QA 5FF0A 5CD5D 2V5DA 3UESA 4FXTA 1EB3A 1W6LA 4Y4FA 1JUFA 4FFZL 2NUTA 3SDCB 1QBMH 4LPYA 2C9SA 2HT3C 5JXEC 2OFJA 2F0CA 4RFNB 2F74B 5EZJA 3ZTCC 5CEYA 3OLGA 4WCYH 4Q6YA 2HE5A 1PWMA 2FD6H 4PRTA 3DSFL 4N42A 4OGQC 3O8XB 4FSAA 2BHZA 1TRDA 4BFRA 5C2XA 1KGIA 3OR6B 5GJTL 5AAMC 2X2HA 5TFSH 1AW1A 5L7XL 1E6QM 1WV2A 5I1IL 3CUJA 4FHAA 1IAII 1NZRA 2V5SA 3PWVB 4PBGA 1JZDC 5TQ0H 3RO6A 3QUKA 3RPIA 4YDLB 2Y7DA 3BN9D 4JAMB 4PWKA 1AR2A 1KFEA 1EERB 4F27A 4N0YL 4JGJA 1R30A 5FF2A 6TIMA 2BVUA 4I8DA 5F6IB 5EOTB 4E5XA 1DPMA 1THCA 2XGZA 4DK3A 2WYHA 3U4BL 1T7LA 3CEUA 3TBVA 1JXGA 3JTTB 1OFPA 1L9RA 1VCBC 1YMMB 4G6ML 2WYTA 1PL9A 2F8QA 1NMAH 4HWZB 3T3PF 1GONA 4RSVA 4N7QA 2A6JB 1TJIH 3HC4L 3U0WH 2XZ7A 3OV6A 4GUPA 4ATTA 2Z8VC 4N0UB 4AQ8A 4LU0A 4L4VE 4HX1B 4OI9A 2GJZB 4QAWA 1Z5LA 3RZCC 3UC2A 5K59E 2WQPA 1Q1JL 4PMFA 3RWDB 2MSPA 4J4PC 1UZDA 2H0PA 2J7DA 3D33A 2BHFA 3EMCA 4ZL1A 1SHSA 5A8NA 1IAOB 3K6NA 1KM5A 2GQAA 3N12A 3DX6B 4YZFE 4A7UA 1I3GH 1P7BA 3MNVA 3DWTA 1A4KB 3MV9B 5DMGD 4G9FA 5CFAA 1WQ5A 2YL8A 4DJDD 2GUOA 2IGFH 4OFIA 4N6RA 1YZZA 3LD8C 5DJ0B 4BUQA 4JDZA 4R0LA 1MDAA 1SM9A 2CLLA 4HB7A 4DXXA 5I3JA 3TKFA 1YDPB 3K4WA 4PR5A 3D87B 3RWGB 3EJYD 3VNKA 4XTRC 4LVOB 1XCQA 4HS3A 5ETUB 3DGDA 4L05A 3UOAB 1VH7A 2J62A 3O3AB 5TDPA 3W1TA 3BQVA 4IGMA 2ZKMX 3VIPA 4X9GA 3IVUA 1XDMA 4GBXD 1UZHA 3S3PA 4Q52A 4WZHA 3C9NA 2LABA 3MA9H 4XO9A 2E40A 1ZENA 3GMQA 2GJXA 2OAAA 4OM1L 1E6ZA 3DETD 4GG9A 4NNYA 1HYSC 2X9WA 3MDJA 3X1FA 2LVEA 4DZIA 5JOPD 5D2NA 1VBHA 5KS9A 3BXNA 4FL4C 1JK8B 5LCVL 1S5VA 5ITFA 5CGMA 1F6PA 4ZSOB 1A9BA 3DU0A 1X5XA 2YAMA 4IRZL 3H42L 3IJDA 1ZVHA 4JHVA 5EFFA 5CBEA 3O0RH 5M2FX 4CN4A 1V0KA 4JO1H 2Y2YA 1VCVA 1A1NB 1R3WA 3QC0A 1UWGH 1EEZA 2J43A 4WFHD 4W8LA 2ZX9A 4KTYA 4YVNA 2C18A 1CFNB 2IKIA 3WD4A 2IH9A 2P48B 3ZTJG 2OJ1A 4KXDA 3DYOA 4TPRH 3BHBB 2NNAA 2LHAA 5D7LA 4MJ5A 1HQTA 1JUKA 1AYOA 5AYZA 2W9DH 1OAKL 2GVJA 1DKWA 1SJHB 1UATA 2YD0A 3ARRA 4HD9A 3A3XA 1PL3A 4L4VD 3K80A 3BAXA 4K5LA 3BH8A 3V0HA 2AKZA 3JV6B 1M68A 5K39B 3CT2A 4ZQCA 1KRBC 3WLIA 2ZWSA 3TX9A 4UT7L 4HP5A 2G2RA 1W1IE 4L4OA 4O17A 3IDMB 3V0DA 4GBDA 1TCRB 1IEBB 3UC0L 4G5ZL 2PDLA 5LGYA 2VCBA 1XBYA 3KAOA 4EWND 4AEFA 1A7QH 2ICEC 2NUPB 1N64L 4J2QA 2ZUVA 4L1SA 5EO0A 1TITA 4YSOA 3SZ6A 4OVUA 5I77A 4NNXA 3C08H 1WAAE 3D39D 3GB6A 5F0PB 4N9CA 4QNPF 1HXMA 1YJDC 4FFTA 4J39A 1OVDA 3SQOH 5FF7A 3KXFB 4PJXA 5IW1A 1J8KA 3WD5H 3QDGB 4UTBA 2OG9A 1K2DA 3TPUA 1V5JA 2JQZA 2ZCHL 3M44A 4NHUA 4I0PA 4DGYL 1O7AA 3ZL1A 1RK0A 3EJRA 1AVAA 2KUTA 3LIZH 1OSZA 3MLRL 2R4RL 4HUUA 4EVZA 4UIOA 2HVJA 1BQCA 1LO0H 1LORA 4QDWA 2AABH 2PYFA 4YC2B 5HAOA 3AGWA 2XYCA 1K9EA 2ZRZA 3G1AA 2NNFA 3US9A 1T4KB 2P50A 2QSQA 1NGPL 1H0DA 3UXIA 1SYSB 1XX1A 2VDMB 3KRUA 1IT8A 2XN0A 1TJPA 4NKDB 3NCBB 3GGWB 2PWFA 1JFXA 1AACA 2IC2A 2WINA 1OF6A 1YE6A 4M8QA 3WUWB 4D0CB 1TYJA 2GT9A 4Y1SA 4NO5B 5E4EC 2ZX7A 1EVUA 4U7KA 4KEVA 3TK7A 1NPUA 4JDVA 1I9RL 4BZ1A 4XC3L 3GUGA 2R0KL 4CVZB 1FJ1A 1U3HC 4PW3A 2WTPA 3SKMB 3TBYA 3SBWC 1XIIA 1ITXA 5F1SA 1HGWA 2CBIA 5DDHA 1TVBA 2WQVA 2AEPL 4YO0A 4MQXD 3QOMA 5DMYA 3HB3D 1YEJL 1BAFL 5DUMH 7CGTA 3FTXA 5U7SA 2NY1B 2EC9U 1K6QL 4DRSA 3D34A 1BYCA 3RE0A 4PMDA 1GGIH 3KYNB 2X4SB 4MCYA 3PPHA 1DVFB 1FZJA 1SJAA 5JA9A 4HA4A 1O6VA 5GRJH 1L9TA 2R69L 3S5NA 1TEYA 1M7UA 2P42B 4H04A 1JZJA 5CN1A 3U4EA 3MWCA 32C2B 1FSKB 2OTUA 1VCGA 2P5WD 3FSWA 5IOPA 3AXXA 5FAGA 4YSDA 4W9KC 4OZIA 4NZ1A 2GJJA 4IOTA 1MCNA 2I60L 3C6LC 3BUQA 2R94A 4K36A 4OD3H 2H8PB 4Q4PA 5RUBA 1F4YL 3H9SE 3TROA 3MRDB 3W1PA 1YSOA 3JTSB 4OIFA 4YXLL 1L9WA 2Y5SA 3WJZA 1DUYB 5E0CA 1UYWH 3SKNA 1CDIA 3I75A 3EYOB 1WA1X 4IOIA 4YSCA 1IO4C 2FUQA 3NQBA 1K3ZA 1T0NB 4WCYL 1WFJA 4BA0A 2UY3A 2CHZA 4XT1C 2C7UA 2VD9A 4ZEPA 4HUCA 4LKCA 4KI5C 4OFYA 4HFUH 1VADB 2BVQA 3NIFB 4M8RA 2WJ5A 4ONFH 3WDHA 3TFXA 1PIGA 1LJMA 4GNVA 4WEMB 4FA8A 1I31A 1ZHLA 2VISB 5EO1B 1UC6A 4JY6A 3DX3A 4PJ8C 1J01A 2EZ0C 4INFA 4O18A 1QZNA 2Z4QB 5E08H 4HH8A 2WM0A 1CF8L 1FBIL 2XI9A 4QHUB 3EF4A 4PJ5E 3KLHC 6PTDA 4KDTC 1MKFA 3E7JA 3ZUCA 1CT5A 4L29A 1TPDA 4PMYA 3W1LA 3FH8A 5A3HA 2ESVE 5AOZA 1JWMA 3ZZLA 4AZ7A 1OOWA 3GRWH 1YNYA 1KELH 4CU6A 4O1EA 1FCUA 2FYMA 4O19A 4Z8FH 4QRTB 2B14A 2VLLB 4PWGA 5EYWA 2FATL 3QV8A 5EA0H 4F91B 1SM3L 1JEZA 1F73A 2DIBA 3GBMH 1EVTC 2IBZY 3RLGA 3M1CA 4N2EA 4NUJB 2D3VA 3ROLA 5BW6A 5JXEA 4AF0A 7ENLA 2F1AA 1SU5A 3MODH 1FQ0A 3PDDA 1LRQA 3BJFA 3LHAA 1SBSH 2X2UA 2SODB 1PNDA 3F7LA 2I26N 2W9EL 3LPFA 3JS3A 2XG4B 4YWIA 5GGVY 4UNLA 2XBDA 3U1PA 5C08B 3ML9A 2GJLA 4FOJA 4Z3GA 4HK3J 3S37H 4D8PA 4LSSH 4QHRA 1E6NA 3N1MC 4MDIB 1Y1DA 2WLNA 3M1BB 5D03A 2A79A 3FB6A 3QJFB 2L8AA 3RPMA 2DZEA 4Y4KA 3C2YA 5D71L 1OXYA 4OV5B 4ZPVA 3PBWA 3KBEA 4K3EL 3QHFH 5CSZB 3G1FA 2CR3A 3EGJA 2DWDA 1W9VA 3Q13A 4X4YB 2PODA 2RQ8A 2DLFH 3SN1A 2PE4A 3NFPA 4NP4H 1VF5C 5GRUH 4ZUVA 1X9UA 1W91A 4KOBA 1N8FA 2OL3H 4YK4C 4U7SA 4UT9H 1MEHA 2WQAA 2QKFA 1LUCA 3ECWA 4HCLA 4PG2C 1KIUA 2A6IA 4ZFZA 1CZ8L 1A4AA 2IADB 2N01B 3VI2A 1RBLA 4GUIA 1DQDH 4QRTA 4G8EA 4PGZA 4U7MA 1N8IA 4BSJA 2B7NA 3CBRA 4BI6A 1YC7A 4FRWA 3C3NA 3Q1SL 3M17A 5JO5B 4YBLB 5IBLD 3Q8AA 3NYDA 1J8SA 4QD2E 3IGFA 1VRSA 3G8RA 3I4KA 4FQHA 2A0LC 2X1OA 3LK6A 5B7EA 1ICQA 1R2RA 3H42H 3NIFF 4NZ8A 3QNFA 4JHWL 1IBDA 3KL5A 5J6GA 3TYBA 4JO1L 5FEXA 3VSUA 2J5LC 5IT2H 2Y3AA 4P4KB 4ALAC 4AC4A 1PZ5A 1K5NB 1GVYA 1U8IB 1F6LL 4E9RA 2NQZA 1CLCA 4PY7B 5SWQA 3UTOA 2CBOA 2I5YH 1UCWA 3CXHK 2R1WA 1T80A 5HDBF 4M6QA 3UZYA 1UJPA 1T22B 1ICSA 1KB9J 1OAKH 3NZ1A 3I75B 4IOIB 3F05A 2WWMD 4JRXD 4PJEE 4X7FC 4FERA 5E5LA 1M57B 4MAUL 2F54D 1DWHM 5C0RH 2VENA 4V15A 1T6BX 3M16A 3BAJA 2MNWA 4UT7H 2H8PA 2DM3A 1FNSL 2F18A 3TBTB 4ZFGH 1T41A 1BM3H 4TX8A 5CQ1A 4ZQPA 3IRZA 4JO8A 1T1XA 5AOMA 5IBUB 1V7NH 3UNTA 2PP0A 3IJIA 1MZYA 4BZ2A 2CUHA 1KMGA 5I3KA 5AWNL 4FADA 4XP6H 3APDA 5A5WA 5E9NA 1VPOL 5INCA 3QMSA 4WZ9A 4LVDA 3SZ8A 2CZNA 3W0WE 4RMWA 5EORL 4DFIA 3OF6A 1A5UA 2GIXA 2B4CC 1R0AL 2BTMA 5BZAA 1OE2A 5AB0A 4GEIA 3N14A 3LHPL 1GGTA 1NFKA 2IVFC 4O2CA 1KULA 4PP2A 2NWSA 2VDHA 2ZOLA 1VFBA 2XWXA 1W2KT 5H8MA 3PFQA 5E8NB 2BIMA 1DBBH 1S3HA 4L3EE 1V0MA 4U10A 1VFLA 5H4YA 2DBLH 5CCHE 1K3UA 2BM3A 1E4HA 4E9XA 3AUWB 3LB0A 3QRLA 4ZMOA 4JQ2A 3RCYA 1R5WA 2H2PD 4QXUL 2HXAA 2Y63A 4CC4C 4LLQA 3QZPA 3MYJB 5GS1C 4Y8FA 2WMPB 4YSTA 4CVUA 2CITA 3FA3A 43CAB 4PMNA 3T07A 1T21B 3RPIB 4ABWA 3WKYA 3NZGA 2G5BB 3OXSB 1KGCE 3IK2A 3N42B 1P5VA 4K4KA 3LS9A 1VBRA 3DBPA 1CQYA 3FUEA 4PRPE 1HKJA 5DLML 2VM3A 2VELA 4QJ1A 4ZVJA 5C6PB 2YD3A 4XP4H 3GC3A 1TE1A 3QHZH 4OLXH 4UYQA 5AUMA 4NRZB 1VGKB 4HPHA 4HT1L 4YAQA 2ZRXA 4YUEL 5E6SB 1A50A 5KVDE 2W94A 2CLZB 2LFGA 1V5XA 1I0DA 3I6GA 1R24B 4NFCA 4DH2A 3MC5A 3SCMD 4MQ7B 4ILDA 4GKNA 2Z31C 4NKCA 5F7FA 3MQIA 1K5WA 9CGTA 4J23A 4XNDA 5HQEA 4IG2A 3AITA 3N40F 4R34A 5C70A 3CGTA 3IJSA 4AXNA 2FJGB 5K1NA 2NT1A 4N2AA 2NNRA 5DD6B 2W4XA 3E5PA 5EBUA 3ONCA 4H2HA 4AK1A 5GZOA 3V36A 1ESWA 1CD8A 1GC1H 1MZZA 2I60H 1K9DA 4Y8DC 3F03K 1R3TA 4I9WE 4K3DH 1F4YH 5FF6A 3AUOA 1C9SA 2EO1A 1J1OH 5DHMC 2NR6D 2Y6TE 4JDEA 3X14A 3N1AA 1RURL 4B3KA 1OG6A 4UOW0 5BNXD 4O53A 5D2NE 3DAQA 5KVFE 5LXEA 3GYRA 2NNAB 3QZOA 5LBSA 3VFTB 3ISIX 3W1MA 1T96A 3QCTH 1KJ3H 2PURA 3FFDB 3FCTA 2V2TA 2FWUA 1PHWA 2ZYFA 3O3UN 3W84A 1MCRA 3W4RA 4UQ2A 1ZOXA 2DV6A 5BRQA 3QDHA 3IJEB 2B7PA 3KVJA 3M5XA 4QG9A 4Z1DA 4O8AA 1E5AA 5IVZB 2Z7ZA 3MJ8A 3L3OA 1D3CA 5AAPA 2P45B 4DVRL 4YXHH 2YD6A 2WOYA 3FCSB 5HYEA 2FTAA 1SZRA 2OX4A 1CGTA 2VGIA 3OOQA 3K30A 1H61A 3GNDA 1URLA 4JG1L 3L6FA 2XQBH 4MMZC 2UX6A 1TTCA 2AQ3A 2P8CA 3BVNA 4NGHL 5HHPB 1LLAA 4QM1A 1RSYA 2H3NA 4L9LB 4AJ0A 3ZR4A 3OJDA 3OBKA 4OZFB 1MJUL 1Z7AA 2WC3A 4PBEA 4IPNB 4P2OA 3TBCA 1OGTB 4I18B 1H3XA 1FX6A 3BUBA 4ZTYA 3C6LD 5DFWH 2Z7WA 1VFSA 1Q90A 4YBQD 3IANA 4IPIA 3KVMA 5DBUA 4S1DD 4PGDA 4MZRA 1XCQB 4FQ2H 4MIMA 3WJJA 4K2UH 2OMBA 2VR8A 1TTBA 1OKEA 1O6SA 3CC5A 2J9XA 5G1TA 2WZIA 4NPYA 1E9PA 3IDJA 4XNYH 2IGLA 5EOCJ 3H56A 1RJQA 4KK9C 5FOJA 5HGBB 1FJ1B 1MREH 2AITA 4XNBA 5EU3A 1NTDA 1U91B 3CNKA 1T6VN 1TV4A 4WVXA 2Z8RA 3OAYH 2R1XB 1JPDX 4UV7L 2AL1A 4GIAA 3C2FA 3CK0L 5SX5H 1JF6A 3DC0A 3OZ9L 4HA0A 4OZGF 3NSJA 1JCXA 2JEQA 4XN7A 4JIRA 3CIXA 5DQPA 3OMIB 3PG9A 4ISVB 1RUMH 1MAKA 5TE7L 4NAEA 3KGUA 1WVZA 1OIMA 4N6FA 4MJ6A 2DQFA 1UWXH 5K9JH 4L9DA 4KKZA 2BXVA 4HJSA 1L0XA 2ALWA 3L1GA 1HHHA 1YVLA 2GSHA 4PMVA 5HJLA 3S5SA 6ENLA 1BQGA 1T4KA 3MV9E 5IRPA 5DZ9A 2C7FA 4XMKH 4EQ2A 3TFBA 1KTCA 5F3HB 4QIUA 3LU2A 2AXGB 2E7LA 2GQ8A 3Q58A 3U0TB 4AWSA 2Q09A 1CPUA 1FWXA 3S5LA 2AQVA 4G70B 1BG9A 1BW8A 2CLRB 1IEHA 1L9PA 5KBNC 3VE9A 1W9XA 2VN4A 4G9DB 3VI3A 2YZ5A 3L8QA 1A1MB 4TM9A 4BH8A 4M5YH 3B8WA 3HG1B 4GVGA 4ZX3A 4YEFA 4RX4A 5J4MA 5TK2A 4QRFA 3VPLA 4UTHA 1XF4B 1PSKH 1TT6A 2LTQB 5DBTA 4HEMA 2O7SA 4X8CA 2HPOA 4Y7OC 4QE1A 4ZO6A 4M3JA 1T40A 3SPHA 4Y5YC 2H45A 3B1UA 1MQRA 3UP8A 1JCTA 3BP7B 1BQKA 4F7PA 3R7RA 1OK4A 5DEFB 1GSKA 3QUMA 4J4PA 4ANWA 4PJFA 5GRZA 5I6MA 2C9QA 3SO3C 1CE6A 1S7SB 1U8OB 2Y7QA 1OX4B 2A5HA 3HZ3A 3F7YA 1GZQA 5D05A 4RKAA 4B90A 1VJIA 4NAEB 4Z1YA 1UCBL 5DJYA 4PJGE 1ZEAH 2GIMA 1IEIA 3GO2A 3KOZA 1TV5A 4P46A 5JUEL 5T5FA 5KSBF 2P26A 4H9VA 3RF9A 4WKHA 5LHFA 3AXLB 1ZL1A 3A4FA 3BLPX 3BUYA 4G8FB 5AZUA 3SY0B 3UYPA 5F9JB 1KYOK 4LUTB 2Z35B 3D69B 2QW5A 4KITB 4G1KA 1TVLA 1QNOA 3G04B 1T1YA 1YG9A 4AENA 1MUWA 1H4PA 2FR4B 5HBBA 3QUZA 4OVVA 2ABBA 2B59B 3AJ7A 2MQ3A 2PP7A 4OZHA 1JGMA 1MPAL 1RP8A 4NYYA 3RVWC 4W84A 4MBRA 4IRSC 5D4QA 4ATWA 1SR9A 2WD0A 3FMGL 4OE7A 4CCCA 4X63A 2YK1H 2JK5B 2WJFA 2EIDA 2VH5H 2QL1A 3LRMA