1KTBA

The structure of alpha-n-acetylgalactosaminidase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
388
structure length
388
Chain Sequence
LENGLARTPPMGWLAWERFRCNVNCREDPRQCISEMLFMEMADRIAEDGWRELGYKYINIDDCWAAKQRDAEGRLVPDPERFPRGIKALADYVHARGLKLGIYGDLGRLTCGGYPGTTLDRVEQDAQTFAEWGVDMLKLDGCYSSGKEQAQGYPQMARALNATGRPIVYSCSWPAYQGGLPPKVNYTLLGEICNLWRNYDDIQDSWDSVLSIVDWFFTNQDVLQPFAGPGHWNDPDMLIIGNFGLSYEQSRSQMALWTIMAAPLLMSTDLRTISPSAKKILQNRLMIQINQDPLGIQGRRIIKEGSHIEVFLRPLSQAASALVFFSRRTDMPFRYTTSLAKLGFPMGAAYEVQDVYSGKIISGLKTGDNFTVIINPSGVVMWYLCPKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords alpha-N-acetylgalactosaminidase
publication title The 1.9 A structure of alpha-N-acetylgalactosaminidase: molecular basis of glycosidase deficiency diseases
pubmed doi rcsb
source organism Gallus gallus
total genus 139
structure length 388
sequence length 388
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2002-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1ktbA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ktbA01
1WV2A 3QMRA 4RCXA 1LOQA 2EABA 4H7VA 1WZAA 2Y63A 2VFIA 2CZDA 3FYPA 3HF3A 3UNDA 3QPZA 1FXQA 3VNZA 4L4MA 1FCBA 2W0UA 2ZUVA 3B4UA 2A7PA 1XI3A 4GNJA 4CN1A 3ZT5A 4JNMA 1VR6A 1D3HA 2ZA2A 1A5SA 3PUOA 4Z08A 3BG3A 3PAJA 2A0NA 2NSXA 1QDSA 4O1DA 4GINA 4QM1A 1LTDA 4WXZA 3DC0A 3W2NA 1R46A 1GYNA 1TTQA 4O13A 4OQVA 5AB3A 2EGZA 2F7RA 3P5ZA 4H6KA 4WUIA 3RU6A 3B04A 1VYRA 4GO9A 1F7BA 3FA5A 1J0HA 4UTTA 5K9DA 5KSWA 1TO3A 4MJZA 5TBOA 1W54A 3P61A 3W3OA 2EJ1A 3NQ8A 1QOPA 4MY8A 4PL1A 3L0KA 3PSVA 1KWGA 5LHFA 1O94A 1GWJA 2V2CA 3KFTA 3GYEA 3D51A 4HIBA 5D2TA 3B0PA 3WEMA 4JTGA 1OFOA 5A2BA 4PC8A 5I3KA 4KKXA 2TRSA 2ZXQA 3S1UA 5KZDA 3E12A 2OYMA 3DI1A 5AYYA 1R30A 5D02A 2OZ0A 5CGTA 4YLWA 1DQWA 3PBUA 4IXHA 1OVDA 2P1FA 2ZX9A 4N9CA 5K9CA 1TJPA 4UFJA 1Y0EA 1LBFA 1A50A 3UZJA 4TU1A 1O7DC 3M5ZA 1KFBA 2BX7A 4DQWA 5D05A 1S5WA 2E1DA 2F1AA 3HZ3A 1L6WA 1QWUA 1EWDA 4LRTA 1G1YA 2WO5A 1ZFJA 3D50A 5A2CA 4O1CA 4Q33A 1MXDA 4YXGA 1LBLA 2CXGA 1OT1A 1V7YA 5LNWA 3BLKA 3M41A 1YDNA 5D32A 4LVBA 1JUBA 1AG1O 4CCCA 1I75A 3AXIA 2XVGA 4PA8A 3UPWA 3B0UX 1TQTA 1T8XA 4LXFA 4J3XA 3WN6A 4CKQA 2TMDA 3LRLA 5D2WA 1DL3A 5CLTA 4U2ZA 3NZ1A 4KFPA 1K02A 2ZIDA 2DORA 3PULA 5L6UA 1QOQA 3DDGA 4W9TA 1AW2A 1JDDA 5E0KA 2WC7A 4MOZA 1VZWA 3FJ6A 3L0NA 2NUWA 3OA3A 2OW7A 3KLKA 4JTKA 1DV7A 3WDHA 2E6YA 2GJLA 1YTDA 1VJIA 3TJLA 4FLRA 3Q2DA 3W7GA 2Q3RA 4XKYA 3VO0A 3L4WA 4ZQRA 3W2KA 3BCDA 1XDLA 4O16A 4JD4A 3CIWA 3CZNA 3M44A 4J28A 3QMTA 3NNTA 1YLVA 1LWJA 1TPH1 3OVRA 3TK7A 3LCGA 5K7JA 5HPOA 5HR7A 1FY6A 4AIEA 1PCKA 1H7RA 3AO0A 4WOZA 5FF2A 4LU0A 3KL0A 2WCGA 4POCA 1SMAA 3UWVA 5DELA 3KLLA 4ZQPA 3DX3A 1QPQA 2Y5EA 4FNSA 2VFHA 2CLOA 3W1PA 3TCEA 3U2OA 1K8XA 1K8YA 1VCVA 5F7UA 1KM6A 4GUGA 1KLYA 4H8VA 5EBUA 1EP2A 3NL5A 1NF0A 3KVLA 2V82A 1XD0A 1XBVA 3LHZA 3PY2A 3RK8A 3B05A 2D3NA 4OGZA 5I3JA 1UBSA 3LX9A 1P4CA 2OT0A 2ZZ7A 4X9YA 1KB3A 2X16A 3TW6A 4DF1A 2AAAA 5DO8A 3AJXA 5G1YA 5AHEA 1S46A 5AHMA 1YXYA 5E70A 3BMWA 3S1WA 3I6RA 3AMKA 1TV8A 1QW9A 1JCXA 1K7EA 1OT2A 2NXHA 5I3FA 4Z1CA 1DTUA 3KVMA 2QJIA 4IPIA 2ZZ2A 3GDMA 3TXVA 1JXKA 2A85A 4JYEA 2FPTA 3GNDA 4R7JA 4ORIA 3W83A 2CLLA 2ZA3A 3M07A 5EYWA 1CGVA 3MI6A 2ZUTA 1YXCA 3DU0A 1UD3A 2CLIA 5LZLA 1IXPA 4OWGA 3HPSA 4O0KA 2XVKA 2RHGA 3BSGA 3VGFA 2VENA 4PL2A 3DHFA 3LTYA 1U5JA 3W1LA 1MFVA 2YZRA 5D37A 2J6XA 3UWWA 3LHVA 2GOUA 2E0PA 3GR8A 1KM3A 1SSGA 1A5BA 1BTMA 2VEKA 3CTLA 4BFAA 3EJUA 4CCDA 1ZCOA 1V5XA 3BW4A 1GVIA 4U2YA 1R2RA 1TRDA 1X1ZA 3ABQA 1QPOA 4JICA 2VFFA 1ZJIA 1CX9A 1W9XA 1TQXA 5F2IA 3N34A 2PWEA 2NXGA 3MP5A 5HNRA 2PRMA 5G4EA 1J0IA 3OHIA 3L2LA 1S3HA 2QCFA 1PZ2A 4RLIA 1A53A 4IMDA 1JCLA 1Q6RA 1MXGA 4JTEA 3M43A 1PEZA 3II1A 4J3WA 5CSRA 3G24A 1XCXA 4NJHA 3LXBA 3BSHA 1VPXA 5LNUA 4BI5A 1DORA 3VCRA 2ZUUA 4GE8A 3CIXA 4NJIA 1P0NA 4Z1DA 1XBZA 2QUVA 2YR1A 1DJNA 3DX2A 2QV4A 3HQ1A 2JKAA 3MI3A 1YADA 2DJXA 3TQ0A 1DHKA 1NFBA 1V3KA 4IUOA 1WP6A 1LDCA 3S5OA 3WJZA 3JRKA 4E2BA 1TIMA 2J25A 2WSQA 1F74A 1JL8A 4CLMA 2HS6A 5DCEA 3G0SA 1H63A 3LBCA 3GTNA 2E6DA 3A21A 4Y90A 1TTIA 3O6CA 3WJWA 1M7PA 3C2VA 1U83A 3QF0A 3PSWA 4MIMA 2TAAA 1HL8A 1VAHA 4MVAA 1E51A 1H7WA 3G0XA 3CEUA 3QFEA 2NWSA 5FEPA 5AYXA 1LRTA 3LBMA 4AMAA 3B0VC 2H8ZA 4WQ6A 4D2JA 4NNCA 3CHVA 1KLZA 3W9ZA 3CM4A 1VHCA 3EJRA 4NNAA 3GDLA 3NZRA 4JTSA 2E4TA 3KEHA 4AIOA 2YW4A 1WZLA 4JX4A 4DPPA 2ZA1A 3KVJA 4O18A 3F4NA 4LS0A 2W6RA 4R33A 3N3MA 2V5LA 1PE1A 4TX9A 3L21A 2WPGA 1KM0A 2B7PA 4X2RA 3CZEA 3MHGA 1GJWA 4RK8A 5FF4A 2FB3A 3ELFA 2CLHA 3IVUA 4JTTA 1UA3A 3BAYA 4E2OA 4A21A 5LNVA 1J2WA 4LT9A 2QCCA 3DKLA 3LCXA 5F4WA 2YA1A 1PHWA 3UWQA 2PE4A 2V2DA 2LLEA 1PAMA 2X1TA 1P5BA 2QCNA 4ADSA 3A5VA 1CGTA 3FYOA 3GB6A 1IXNA 2Y62A 4UZUA 1N55A 1C29A 2P10A 4KFNA 5IBXC 3PS7A 2OX1A 3PB2A 1M6JA 2QJHA 4YL2A 3ZWTA 2ZZ4A 3N2MA 5HQEA 1D3CA 4BWLA 5G2IA 3HG2A 3PWAA 4GJ1A 1JFHA 1OABA 3DXIA 2ATSA 5CSSA 1OFEA 1A5CA 3LCLA 5U4NA 3DFOA 3W84A 4WJEA 3G3MA 2QAPA 1XUUA 1TPWA 1RPKA 2C15A 3FS2A 3KL3A 3NO5A 3QGVA 1DBTA 3LHWA 3WK3A 5LNSA 1VJSA 3E96A 4M6PA 2QCDA 3A23A 3VM5A 3WK2A 1SUXA 1RZMA 2AGKA 1EUAA 4UNKA 1HTIA 1QWNA 1AW5A 2ZZ1A 2ZRXA 4MZYA 2YIHA 3MWAA 4H4IA 5CGMA 5CZ0A 1SW7A 4GUIA 4OU1A 3L5LA 1RD5A 3AXHA 1VYPX 2G97A 1CDGA 3PBWA 1FWSA 2VFGA 4O4WA 1WZMA 3TONA 1GVSA 4UIOA 4UTLA 2NX9A 4RX0A 2GQAA 5AC7A 3ATYA 4MJMA 1XUZA 1OYCA 4O50A 1E43A 1WZKA 2C6QA 3NQ7A 1YDVA 4PSPA 2VFDA 4MPQA 3ZR5A 2CPUA 3EJTA 2WNNA 4A22A 2F7FA 1KV5A 4JTUA 1OX6A 3LOTA 4JTJA 2F2HA 4M6QA 1OFPA 3ZR4A 3W22A 1SQ7A 1MW1A 3U6WA 2J27A 5KEZA 1TQJA 3L0GA 1IF2A 3G8RA 4GBUA 3ECQA 3EX2A 3UERA 3ZWSA 3LDVA 1VLWA 3CPRA 4LV4A 4UMCA 2GUUA 1KGUA 5EMYA 1C9DA 4NQ1A 3RLVA 3WNLA 3UEQA 1F76A 1VC4A 3QZEA 4XUGA 1QMLA 1JR1A 1O5KA 2D73A 1KBJA 3FKRA 4HKPA 2EKCA 2CLKA 1QPNA 3DDFA 3BVWA 4WD0A 3CT7A 4NNBA 1JUEA 1W56A 5HUPA 2OSWA 3P60A 1KA9F 1ZENA 3G1FA 3C52A 3HGRA 1SO3A 4K8EA 4OV9A 3BARA 2C3ZA 1IIHA 3TH6A 2QR6A 2WSRA 3MP4A 2ALDA 3MI2A 1SU5A 3DFQA 2OCZA 2ZX8A 2BY0A 4ZQNA 1R75A 1TB3A 2V9DA 4OJYA 2VKZG 2ATMA 1TTJA 2NZLA 3MP3A 4NU7A 4AHQA 1PS9A 4DF2A 4ZL1A 5F4SA 1ZAJA 4LW7A 3NPVA 1F2JA 1Q6OA 4A2SA 2VUYA 4PH6A 4MYAA 1VS1A 3MUXA 5EPDA 5D30A 4WY0B 3GXNA 2ZX5A 4GUHA 3W7EA 1G9HA 4PCSA 4OHQA 1IGSA 1WOBA 4FXSA 4LUJA 3S5ZA 3T4CA 1KTCA 3S0CA 1L2UA 2PURA 1LRQA 4K39A 4RKAA 1IXOA 2OW6A 3W7DA 1W5PA 2NV2A 3O6YX 5TQLA 4QQ3A 1JIBA 3N2XA 3LCFA 1VCGA 1AK5A 5AHFA 1GG1A 3DX0A 5CKSA 1GEQA 3BO9A 2G5WA 4WXYA 4Z1AA 4JYFA 3BUIA 4UZSA 5C55A 2XIIA 2I14A 4CQAA 5HULA 2YA2A 2DIJA 3IGUA 1JCMP 1XKYA 3ZS4A 2BXZA 3HBLA 2Y85A 4ICNA 4BI6A 3DI0A 1KXTA 3P67A 1PIIA 5DXYA 3TSDA 4J3SA 2A7RA 4UR7A 2NLIA 1KV8A 5MHBA 1XCFA 2CW6A 1J0KA 1C8VA 3W87A 4FHAA 4N4PA 3WDJA 3VU2A 1OK4A 3W74A 1JF5A 1B57A 3EX3A 1H3GA 1DVJA 4NZJA 1QI3A 3N14A 1TCDA 3EWUA 4JXCA 3ZOAA 1GYLA 3MYOA 4PCFA 1SMDA 3M0ZA 4P2VA 2AMGA 2YKKA 2EHHA 4OV4A 2ZRZA 1QX1A 3QQ0A 1GPWA 3CV5A 5CZSA 3A4AA 4LY8A 4XB3A 3LPOA 1MW3A 4B9ZA 2Q8ZA 3CB8A 4S1FA 1FX6A 3EJQA 4U3CA 4R53A 4QJ1A 4BA0A 3A24A 3M1ZA 4QAIA 5C2XA 1SFJA 3CEPA 4A3UA 2E6AA 3ABOA 5I3IA 3SZ8A 2NUYA 3SI9A 4U33A 3LCHA 4ZVJA 1KM5A 3BGJA 4HSOA 1GVQA 3L4ZA 4U4MA 3E9AA 3A6OA 3LGEA 2CU0A 4N6EA 4CNOA 1D7FA 1TPEA 3BH4A 2NT0A 2H8XA 2EACA 2ZYFA 4KWWA 3HOJA 1RP9A 4GQRA 1JRBA 2FHCA 2GUYA 4FX8A 1OSEA 3N73A 1CXLA 1LBMA 3VSVA 1WDWA 4UCGA 4UFKA 1JF6A 4LNYA 4YCOA 3R5EA 1V3LA 2Y2WA 3LV6A 4UQCA 4RJEA 1F6PA 3EEGA 1S5TA 1OF8A 3TR2A 3DFNA 5J5DA 3UWYA 3L4YA 1KBKA 4NUWA 3BUDA 1IZJA 3D4ZA 3A5FA 3C56A 4B5NA 3H53A 4LVGA 4ATWA 2X1UA 4RZ4A 2CZEA 4JTFA 3NQVA 1ML1A 1MFUA 4XTIA 3PG9A 2QPUA 1LORA 5FESA 3P8JA 3WFZA 3EX1A 3L5MA 3W76A 3NQMA 1FDJA 1ADOA 2V5BA 2VC6A 4C1LA 2R91A 2FDSA 3QRHA 4XKYB 3OEXA 3O63A 1X8FA 2FQIA 3W86A 1OF6A 1JDAA 5E93A 1OB0A 1ZJBA 3VGEA 3NOEA 2YA0A 4KWVA 4UFLA 2ZRVA 1UKSA 2R94A 2W79A 2DZSA 4GO8A 3DHDA 2ZRWA 3W2LA 3LHTA 3HG4A 3FFSA 4H8UA 2ABBA 2YGYA 1OG0A 4TMBA 4XZ9A 4AEOA 2VRKA 4DELA 1W3NA 1RPXA 1RR2A 2VFEA 1H5YA 1SO4A 3TE9A 2EF9A 3SGUA 1AQMA 1QFEA 2WOQA 3DFSA 3G1AA 2R8WA 4LS1A 1EIXA 4HA1A 1ICSA 1R47A 1AL7A 3S42A 3VGDA 3CLWA 2QMKA 1TQSA 4FNQA 3ZT7A 1SZFA 3EB2A 2BZNA 3NL2A 3R8RA 2B0MA 1TREA 1CLVA 4AWSA 4AH7A 3GXIA 3H55A 3B8DA 3K1DA 3TJXA 1KFJA 5I5RA 1TSIA 2WVTA 2WPBA 1K3UA 2XFWA 4FLOA 2WVSA 1E40A 2QDGA 3EJPA 5CPOA 1JRCA 5DCBA 3ZFHA 2KZHA 4IGHA 2NT1A 1VFUA 1BVZA 1JXJA 9CGTA 1JCJA 3ZSSA 4JCLA 5G2HA 1JQXA 3CPUA 2DZTA 5BMWA 2BWGA 3NYZA 4ALDA 3IIOA 1TCMA 3VFLA 3L9CA 2PRHA 2QLYA 4R34A 1JCYA 3RILA 1UKTA 1WBJA 5A6MA 1YXDA 3Q58A 4IMCA 4C1KA 4NXSA 2X2HA 1U33A 3NQEA 1A5AA 4LV9A 1QHPA 3KX6A 2J9XA 5FEXA 2ZE0A 3TFCA 1HO1A 2ZXAA 2C13A 4S2CA 4UMAA 1TV7A 3GLCA 3W1UA 3EWWA 4O4VA 1PCWA 1EA0A 1B2YA 2E77A 2GVGA 3STEA 3CC1A 3W71A 3N19B 3NQAA 5K4ZA 4YCPA 2ABAA 3NXFA 4UOZA 1F6KA 3W23A 5HUOA 2GJRA 3VI2A 2DZXA 1QO2A 3M5VA 1VYSX 1OHLA 4WF7A 1CXHA 2D2OA 3BVXA 2WKJA 1BF2A 4AWTA 1JDCA 1CXEA 3EDEA 2YXGA 4JX5A 3W72A 1UA7A 1KXQA 4QSHA 1QWGA 4MFEA 1G4PA 1HNYA 2BY3A 4M7SA 1D3GA 3YPIA 4JIQA 1IIGA 1RQEA 3N9RA 2X2JA 1LP6A 1RV8A 1BSIA 4MFDA 4NXKA 3O07A 4FIQA 1W5MA 4ZMGA 5E6YA 1K03A 1UH3A 3P74A 1KM2A 3QW3A 3SSJA 4JDYA 4K8HA 1AMKA 4JFTA 2Z0IA 4X3ZA 3TQVA 5I3HA 4U28A 3TKFA 4KMQA 3EDDA 3CU2A 3LXCA 4LC6A 2BHUA 3G1SA 2BXYA 3TW7A 2DU2A 5HWNA 4MLJA 1FWTA 1W8SA 1CXFA 2JKEA 3W38A 3RNDA 3QQ1A 3LM7A 3MMTA 4Y96A 3NQGA 3UG4A 1TTPA 1LLWA 3P62A 4X0NA 3BAIA 1G7VA 5G4WA 1XH1A 2J24A 3OLIA 3BG9A 1WQ5A 2VNCA 3JR2A 3KL5A 4NX5A 1ZJAA 2BTMA 4HT3A 3WDIA 3W2MA 2RDWA 5BOOA 4Q32A 3STGA 3L66A 4OKDA 5LHEA 2FPYA 4UQ9A 3N9SA 1XBXA 3W7IA 3G1XA 1PZ3A 2NWRA 3IV3A 4FEZA 2B7QA 7TIMA 4FXRA 1KBBA 3IGXA 3O8AA 3STFA 3KAOA 1P0KA 3IGSA 3LRMA 3C2EA 4JR5A 2QCEA 4TR9A 3GXMA 4WY0F 4UXDA 4DXVA 2TPSA 3EX4A 4GUFA 3NVTA 2ZBTA 3VSUA 4ZQOA 1F5ZA 1VB9A 1V3JA 1ONRA 4Y8FA 1MW2A 3EKZA 1Q6LA 1OFRA 1TQWA 1QCWA 5L9FA 3GDRA 3DBPA 2FTPA 3P82A 4IMEA 3M6YA 2ZWZA 2ZWYA 1U2YA 4J3VA 2ISWA 5AC8A 1BVNP 2VOMA 3G8EA 1THFD 3TX9A 3WNNA 4UQBA 1H7OA 1Q3NA 5K3VA 3W1XA 3ZQ9A 2B7NA 3S1XA 3SR7A 1FCQA 4O54A 3I7RA 2YFOA 3BVVA 4I7WA 4DBDA 3GZ3A 3MBDA 4BK9A 4FX7A 2PRLA 5D04C 4MY1A 3L4TA 2QMJA 1RQHA 4JL1A 4ORMA 4AF0A 3DX1A 4K38A 3W73A 1SPQA 4NJKA 4LQ1A 3ZR6A 1FQ0A 2B4GA 2Y89A 1H1ZA 2QCLA 5IBXA 4MY9A 1OK6A 4BF9A 3LHYA 4GQQA 1ME7A 2GQ9A 3NQDA 2Y61A 2ZX6A 5F4XA 4GWEA 4N9DA 1FWWA 3GAKA 4E0CA 1JUKA 4QITA 3W7KA 5I0DA 2ZRYA 3O6DA 1JAEA 5G5IA 4WLCA 2I1OA 5KMYA 3WY4A 1X7FA 1VLIA 3G1VA 2TSYA 4RZ6A 1FUYA 3KRUA 2EADA 3GBDA 3S5NA 1MSSA 2YSWA 2Y6ZA 2ZQ0A 2FE0A 2QCDB 2V8ZA 1LLZA 3CZKA 2ZZ6A 1D9EA 1TQUA 1H7PA 4TIMA 3EDKA 1QPKA 3TOPA 2VR5A 4AAJA 1PJ9A 4UTMA 2B7OA 1V3MA 4UFMA 4X22A 5CPMA 2X2IA 2Z1KA 4I9AA 3GDTA 1OFAA 3C8FA 1GVFA 1MZHA 3ZSTA 3PUEA 5KZMA 1AW1A 4NJJA 4ZZ9A 3TUUA 4KWUA 1FCVA 2V0TA 3DKJA 1QI4A 3NR0A 5A6LA 4QIUA 2JBMA 3TSMA 5J5RA 3BLIA 3S5YA 1EWEA 2EAWA 4Z0JA 1UOKA 2DH3A 1EX5A 4J7RA 3K8MA 1YPIA 2F1BA 3WMSA 3INPA 3CWNA 3M9YA 1AL8A 3SW6A 3VKJA 3THQA 1UKQA 2EQDA 4JFWA 1XDMA 1LROA 1H51A 3OIXA 1PS3A 3WNOA 2Q8LA 3TTYA 4O28A 3SFKA 3GBEA 1W3TA 3GR7A 4N6FA 3VSTA 3QYQA 2WSPA 3G18A 1G6CA 4HPHA 3L65A 2EPHA 4BR1A 3B06A 4IMGA 3BC9A 3TFXA 4FNTA 3VM7A 5D2XA 4AEFA 1OFDA 4NZFA 3STCA 4JIPA 2ZDRA 2ZXBA 4FF7A 3W07A 2H6RA 2ZUWA 1UD5A 2F84A 5A8GA 3GXTA 2ZXDA 1GCYA 4GI9A 1RVGA 2YDAA 3VMOA 3W1NA 4LWWA 2XWEA 4QAWA 4CVWA 3VMNA 1NEYA 3S8HA 3LERA 3CGTA 1G69A 3IVTA 5CG7A 2A6NA 2EEXA 3KVKA 3VX0A 5AN7A 1EUNA 1ME8A 2RFGA 3WK0A 2O7SA 3P8IA 4J9JA 2WSKA 1Z48A 1QHOA 6TAAA 1DOSA 2ISSA 1WAUA 4CNNA 3WNMA 1QO5A 1UJPA 3BAKA 3W1QA 1YYAA 1KFLA 3TXZA 3W1MA 4JTHA 2HTMA 3L67A 1EO7A 1EB3A 2BLEA 3DHUA 3EDFA 3Q37A 4JL2A 3GVGA 3HGOA 1CPUA 1GT8A 2CLMA 2OT1A 4U31A 1OX4A 1VFMA 5BNKA 4W93A 5F2MA 5E6ZA 1GJUA 4O11A 1VHNA 2AAMA 3VGGA 1J4EA 5D33A 3KWXA 3W1TA 1G7UA 4CN6A 5D38A 4M5PA 5C54A 3DFPA 3LCWA 1Y7VA 1UCWA 1HT6A 2E8YA 2GVJA 1XXXA 4JY8A 3WENA 1PVNA 5CZJA 1T0OA 1CGUA 2CFFA 2F7OA 2ZUSA 4AYGA 1WA3A 2WVVA 3I7QA 4LRSA 4FNPA 1R2SA 3BW3A 3GXPA 3R12A 5EL1A 3C2OA 1OFQA 1OYBA 4M8UA 4IPJA 3I7SA 3NM3A 1E3ZA 1PV8A 4EF8A 2VRQA 1DKWA 2R14A 1OYAA 3EX6A 3D0CA 4M56A 2FFCA 3C2RA 1L6SA 1ZS2A 2H90A 1LZOA 4UTUA 4O0ZA 4AEEA 4O15A 3WJXA 4GI8A 2WKLA 4AHPA 1B4EA 3G1DA 1ZAIA 2Y24A 1KFKA 4BI7A 5TD4A 4FO4A 2F7QA 1E3XA 3ABSA 1TPDA 3L4XA 2FH8A 1GQNA 2VEPA 3MHFA 3P7YA 4O1AA 2QCMA 2VXNA 3BUPA 3EDJA 2RH9A 4L4LA 5KITA 2YYTA 1VGAA 3OLEA 3FAXA 3BLEA 3OVPA 1HL2A 1K8ZA 3ANYA 4RXGA 2OMAA 4HHPA 3MHUA 2Z1BA 3FIGA 3TMLA 1B0IA 1WX0A 1GOXA 3USBA 2IGTA 5E9AA 4P61A 7CGTA 4MB1A 3QSRA 1IZKA 4FLQA 1CXIA 3WELA 1UD6A 1HL9A 2NUXA 4ZQMA 3TQKA 4AB4A 3C61A 2J9ZA 2X1SA 5TIMA 3W2UA 4QNWA 2QJGA 1P6WA 3AMLA 1XBYA 1G5AA 1W5QA 1UUOA 3TU9A 2AQWA 3PUDA 4PTNA 2PWGA 1TV5A 2WJZA 1C8QA 4N2YA 3GX9A 1G94A 1W1ZA 1RP8A 3DH7A 2O7QA 4UC5A 3FJLA 4XBKA 1OX5A 1G4SA 3VNYA 4JFVA 2RDUA 3VGHA 4MYXA 3KRZA 3OG3A 3DGRA 3TIMA 1GTEA 3IIZA 1XD1A 1GG0A 5HR6A 3SJ3A 5BW6A 2Y7EA 2E5BA 5CLWA 2XIBA 2WNWA 1Q6QA 3MO7A 4PEEA 4O1BA 3UD6A 1TMQA 3HPXA 4NX0A 3T44A 3C3NA 1FDZA 4UQDA 3BW2A 2D0FA 3JS3A 4GXMA 4FLSA 3S1VA 5F2GA 1H60A 5DLCA 1ICPA 3O1NA 5LGXA 3UZ5A 3NQ6A 5AOUA 4O19A 3QC3A 1M7XA 2FYVA 5CGQA 3NQFA 1I2NA 2PCQA 1SR9A 1OFBA 4UTIA 3BCFA 1BEUA 4G1KA 4DPQA 5E0FA 5K4XA 3CZGA 2WNQA 2YX0A 5AFDA 2PWHA 1Z41A 1XSKA 1G4TA 1KXVA 3FW6A 3O15A 1YTEA 4XBSA 5F1VA 1DJQA 4HP5A 5E1QA 4WY0A 2WANA 3L5AA 3M47A 3QJAA 5DXXA 4DO6A 1XGZA 5H2ZA 5A5WA 4I7UA 2JGYA 4LVDA 2Q3OA 5KINA 5FF0A 4UTWC 3LPPA 3TA6A 1JVNA 3W7PA 5KZEA 1HFBA 4WSKA 1U30A 5DBTA 3UWUA 4O17A 3NL3A 4UFIA 1I2PA 1W5OA 4FMVA 1CIUA 5AHLA 3UY7A 3V1PA 3EJSA 5T26A 1GTHA 1T96A 3IJ7A 4HPXA 3TAKA 4GI6A 3GXDA 4J3UA 3HJEA 2JK2A 2QKFA 2XN0A 2Y7FA 3H54A 2Z6JA 3FKKA 1SW0A 1EP1A 2PC4A 1WO2A 1YPFA 5C5YA 1P1XA 2C18A 4AW7A 2E8ZA 5CXPA 1G4EA 2Y70A 5CPLA 3CWOX 1H62A 2FJKA 3IJ9A 4JCMA 4GUJA 1EH9A 1KM4A 4MZ8A 3VE9A 3NG3A 3VMPA 2GJPA 1NOFA 3L4UA 3EXTA 4FX6M 3PBVA 3TC6A 2QPSA 2J9YA 1HX0A 2QCGA 4K37A 4MLRA 1KBIA 4A29A 2J88A 3SY5A 5LNRA 2NX1A 1X6UA 3VNDA 3BAJA 2H3DA 3LI0A 5C6MA 5FEZA 4Q4KA 1XM3A 1TJRA 1R34A 3BLBA 2YFNA 1MXSA 3NM1A 4QNEA 1I45A 2Z6IA 5LSMA 2VEMA 4MAZA 2F61A 1TPUA 4M7TA 4UNLA 3EXSA 1DEDA 2PWFA 4PODA 4JYDA 3FOKA 5EA9A 1AQHA 3W7CA 3D52A 4X9SA 2D0GA 4IX2A 1UD4A 2A21A 2X2GA 1HUVA 1KM1A 2JKPA 1R2TA 1VCFA 1YTKA 3B03A 3TMQA 1QAPA 4OIFA 2E5CA 3BUQA 1HXKA 6CGTA 1NSJA 1XCWA 3LB0A 3BVTA 1AMYA 5AYZA 5DFAA 2A4AA 2V30A 1SO5A 1EEPA 1YDOA 2CHNA 3V75A 3MJYA 3NAVA 2QAFA 1TYGA 4UTTC 2GVYA 5ABTA 2G3NA 1J0JA 1XV8A 4IJBA 2WQPA 1LWHA 4XWUA 2WSYA 1VQTA 5IM51 3IIPA 1KW1A 4Z1BA 2ZTKA 5BMXA 1HG3A 3W7QA 2QUUA 4IQLA 4EIVA 4GC4A 3GK0A 2XN1A 3L4VA 4HNTA 1NM9A 3ABRA 4RR4A 2DZUA 4NVTA 3W7LA 3QM3A 2GPTA 2RKXA 3DENA 4K6AA 2FGZA 4O8RA 2DH2A 2D0HA 1F05A 2HSAA 2ZFAA 2V3DA 2NX3A 1CGWA 4AHOA 3WJYA 2YYUA 3IK2A 2DZVA 3P81A 1BLIA 5D03A 2Y88A 2ZZ5A 3CTTA 1GZGA 1KWKA 3G3DA 4RXFA 3UXDA 3W75A 1UUMA 2OJPA 1MWOA 3UCQA 3W1RA 4EF9A 3LLDA 4JS3A 5EMUA 3QPYA 5K2ZA 3S2CA 4JTLA 4WZHA 2DIEA 4M19A 2PWDA 2X1RA 3W7JA 3W7OA 3C0JA 3EWYA 2QF7A 1QI5A 4YWIA 1LM1A 2GVLA 4H3DA 3BLPX 4NJGA 3W7NA 2Y4SA 5SWUA 5F2LA 1ZHAA 4I7VA 4AXKA 1XH0A 3HPZA 3DAQA 4LOCA 3BAXA 4IOTA 2FHBA 3WK1A 1XC4A 1CYGA 3UG5A 2ZZ3A 1KTNA 1XSIA 1Z42A 4NI3A 1ODUA 3PF3A 1I2QA 1EHAA 4UMBA 1HWWA 5BRBA 4E2DA 6ALDA 3DFTA 2V3EA 4EVZA 1B9BA 3UG3A 1MEWA 3NPUA 2BXVA 3QMSA 5CPNA 4RV8A 4JDBA 3PVFA 4IWWA 5HWMA 3WFAA 2WKGA 3TROA 3FLUA 3K8KA 3SIZA 4PCTA 2JGQA 1QNVA 4M6VA 3CQ0A 3I65A 1SSDA 4ADUA 4E38A 2ZX7A 5DBUA 1PIFA 4CN4A 1OJXA 2E68A 3FAWA 4AF0B 5I23A 4OT7A 3HG5A 4O52A 4IXXA 1F73A 3R13A 1WE5A 1AVAA 2HS8A 3SECA 2XN2A 1BG9A 5GVJA 1VIWA 3O05A 4IX0A 3WNKA 6TIMA 3BMVA 5DCDA 3T7VA 3Q94A 5AC6A 1EP3A 2CWNA 2BSLA 3GAYA 2H3BA 4LVFA 4UNIA 3GDKA 4HNUA 1KGWA 7TAAA 5I3GA 4WSJA 1TMHA 3W7HA 1O5XA 3A22A 2QUTA 3F1QA 3S9YA 3M7WA 3O06A 5D09A 1L0PA 4PSRA 1MO0A 1Q45A 3D4YA 4B9YA 4LVAA 3LHUA 2ALWA 3DZ1A 4O14A 3HGSA 3NQCA 1JI2A 4CGTA 1WXJA 3EXRA 3THAA 2YJQA 1BPLB 1JQVA 2C1HA 3DHPA 5AHIA 4RZ5A 3G1YA 1LCOA 4DBEA 1JCNA 4Y6GA 1PHQA 2EO7A 2G96A 1FDYA 2GQ8A 3W70A 2F7PA 1N7KA 3CZSA 3LXAA 3ATZA 1FBAA 1ALDA 1B3OA 1IV8A 5EY5A 3RLUA 1EA9C 3KRSA 1WYIA 4OBTA 2ZICA 2P0OA 5LGZA 1ZALA 1WOAA 5I24A 5HDRA 1L6YA 5A2AA 2CZ5A 3FEMA 4LUIA 1L9WA 1FWRA 1W0MA 2FB2A 4LC8A 5BRPA 1MEHA 3BVUA 4DF0A 3S6DA 2OSXA 3HO8A 3TDFA 5AHNA 1HTYA 3NGJA 2XWDA 4H2CA 3NA8A 3IEBA 3A47A 1UH2A 2A1YA 1VH7A 1LRNA 1KXHA 2DZPA 4DO4A 3W37A 2QEZA 3NL6A 3UYCA 2FLIA 1UB3A 3TAOA 2F18A 3KE0A 1DHPA 2VT0A 1H7NA 4KFOA 4N4QA 3BGGA 4XQ6A 4ONVA 1SO6A 1QPRA 1W5NA 4MKNA 4WX2A 3HJZA 1H1YA 4UQEA 1WBHA 4JY9A 1K7FA 1UASA 2G95A 4AMWA 3G1HA 4HOXA 2ZTJA 4NT0A 2E6FA 3QSTA 1PL9A 3NEVA 3PBYA 3TTSA 2EAEA 4PEKA 3PG8A 3OBKA 3TSBA 3LTPA 3MYPA 2QCHA 1TPVA 3PM6A 1SZNA 3LTSA 3WNPA 3W1AA 2OYKA 4UOQA 4PFMA 4UCFA 1Q4NX 4UR8A 1KFCA 1SFLA 4HN4A 2YW3A 1KGXA 1JJKA 1CXKA 4FIRA 5FI8A 2BY1A 4FB7A 3TV8A 1CW2A 3G22A 3UPBA 4ZQCA 2ZCGA 4CQ8A 4FNRA 2FIQA 3BUBA 3QW4B 1JD7A 1MEIA 1SZEA 3F4WA 2ZRUA 3TC7A 3HMJG 4J3TA 1HVXA 1VFOA 1TPB1 5D2YA 5HMSA 3W7RA 3IVSA 3GKAA 3GIYA 4HOWA 3F03K 3BAWA 3WJSA 5DN1A 3UQNA 3E49A 5FF3A 3W88A 3M5XA 1OX4B 2ISVA 5EKYA 3T55A 3W2JA 5G2WA 3VX1A 1H7XA 4HNNA 3HG3A 3CZLA 4LTSA 3WY2A 5BRQA 4DEFA 1A47A 3NQ2A 1TPC1 3QH2A 4TO8A 4AVFA 1I2OA 1I4NA 1XFBA 3OLGA 1XH2A 1BWLA 2A7NA 3EWZA 4JFUA 1LOLA 4Z0SA 4A2RA 4JEQA 4N02A 4LPCA 2RDTA 1UD2A 1ME9A 2XVLA 2YOCA 3BG5A 2WVVB 3L2MA 1KFEA 3BLFA 3G0UA 2A5HA 1O4UA 4LS2A 3ZO9A 1B4KA 1BAGA 1XSJA 2OSYA 4BZYA 3KHJA 2C7FA 3R2GA 4QISA 3UXAA 3DX4A 3LCIA 3OLDA 4JX6A 2WCSA 4S2BA 1O95A 1MW0A 3L68A 1M53A 2IQTA 2G3MA 5D2VA 1M5WA 1GVOA 4HNVA 1W3IA 3K8LA 1QW8A 3TNOA 3VGBA 3U8GA 5U7SA 1Z32X 4K7YA 3W7MA 4IMFA 1LOSA 1JD9A 3LLFA 5FEWA 5HJLA 1S5VA 1R33A 3RMJA 3LV5A 2CLFA 2CLEA 4OE7A 3C6CA 3PC0A 2D3LA 4UQAA 1BKSA 8TIMA 2DP3A 3K30A 2DZWA 2WV8A 5G1TA 3P80A 4TVUA 3QEZA 2Y7DA 1IXQA 1FWNA 4EOUA 1UD8A 4CCEA 1KCKA 2YPIA 3R89A 1ICQA 2TYSA 3E02A 2BHZA 4O53A 1BWKA 1H50A 4UTKA 3W6YA 4J27A 3WY3A 1RQBA 3PR2A 4GIAA 3WY1A 1EO5A 1TQVA 4ADTA 4DO5A 3CLMA 3P5YA 4AYSA 2FPVA 2Y7GA 4JTIA 1FCUA 3GNNA 1OGSA 2E9BA 3M5YA 1LYXA 3NDOA 1GJPA 4UUIA 1KTBA 1ZY9A 3T78A 3VE7A 3I68A 1O60A 4XTDA 2A2IA 2GJNA 2VEIA 4GKLA 4UTHA 5F1UA 4BWLC 3GKFA 3UWZA 3C4UA 1FXPA 1PIGA 1JI1A 2E09A 3AJ7A 1VRDA 5DY3A 2V2HA 4H8HA 1SZGA 2FHFA 4HSNA 5K9XA 5HWJA 4AWUA 2BY2A 3T40A 4N9BA 1NAL1 1X1OA 1W31A 4AMXA 1KCLA 5DY2A 4JFSA 4CQ9A 2WNZA 2I9EA 1T99A 1NVMA 3IIXA 1CGXA 3RIKA 4JN6A 2QDHA 4N9EA 3KOFA 2FH6A 3BV4A 5HINA 5LKYA 1Z44A 3BVJA 1TRIA 3EWXA 3RFAA 1J5TA 4MZ1A 4O57A 4UFHA 1I2RA 2YCEA 1JGIA 3M16A 4JGDA 1ZAHA 3GXFA 5CZTA 1JULA 3HIJA 1QR7A 4K7VA 1SW3A 1MVYA 1HO4A 2C14A 4MUZA 4Y9AA 4HOZA 4O10A 1CI1A 1UH4A 1JG9A 5FF7A 3A9IA 2OYLA 3EKLA 5HXMA 1G67A 1I8JA 1GVRA 3L2IA 1M7OA 2C16A 1ZNNA 3W85A 3OVQA 1N8FA 1DQXA 2A6LA 3KXQA 1NF7A 4UTWA 1EPXA 4K36A 3LRKA 3WEOA 2E5DA 2UV8G 1H61A 5H91A 4GFSA 3HGJA 3UY8A 3E0IA 4YMZA 3PB0A 3ZT6A 3NPWA 3BK0A 3O16A 4HPJA 3IJ8A 2VELA 3MBFA 3C2FA 4O12A 4TMCA 2C8NA 1WPCA 4FNUA 3P84A 2X30A 2Z2UA 2C19A 1PPIA 2C0AA 8CGTA 3EWBX 1CGYA 1XL9A 2V81A 3IRDA 3MW7A 3RF9A 2DJLA 4ML9A 2HMCA 3SGZA 2WVUA 3IIVA 1TPFA 4CNPA 4UTJA 5KTLA 2NXIA 4WOQA 2BHYA 2V3FA 2NV1A 3BPWA 3HB9A 1K7XA 1W37A 3LI1A 4EWND 2CZFA 4GRSA 3NPXA
chains in the Genus database with same CATH superfamily
3B9OA 1XLGA 2EABA 2X9XA 3ERXA 3ESVF 4US5A 2CBPA 1W72B 4YHIB 4P2QD 2NNRA 4KXCA 2NSXA 1P6FA 1WCQA 3W2NA 1ZSHA 3EYSH 1AO7D 3IMWA 4RX4A 2DL2A 3N2BA 2NY3D 4NZ5A 2ETWA 3FO1A 4MY8A 3QG7H 3MKCA 3GFZA 2ADGB 1AGDB 2CLZB 3KFTA 1YY8B 3WO4B 3DNKA 4ELME 1OW0C 1WNOA 3MBWA 3ITTA 5DHEA 2NR6D 2H2SD 2VLJE 3O3EA 3UPRB 1FJ1A 1G1YA 5ILTL 5SX4I 4P2OB 3M8OH 3CDGB 2VW4A 1XJBA 3G5ZA 3KXFB 4JGUA 5B38B 3QQ9C 3GIQA 4KZDL 5C07E 1FE8L 4NHVA 4YFLI 2R1XB 2DQDL 2WINB 1KBVA 4PJ7B 4YS4A 1KTDB 4LESA 4LXFA 3DXAB 1EJTC 1DL3A 3MTWA 1K02A 5XINA 1UM4H 4Q74A 2OW7A 4JTKA 1JNHB 4JTRA 5EBWB 4RGNB 3ZBMA 4FLRA 1CLZH 2EIKB 4ZQRA 1WSST 3HA1A 2Y1AA 2APTA 1G84A 2VLLB 2G5RA 5I8EB 1T7LA 5HMEA 3BGAA 3QEQD 3A3HA 2BPBA 4ZQPA 4GG8A 5EN2B 4KQ4L 2YCLB 3NA9H 1REQA 4X0KB 2DDXA 1S5HB 4O9HL 4BYHA 1IB5A 1LO2H 4HFWB 3NJMA 4I9WD 3B4YA 1XD0A 5KUKA 3WUBA 5DJ8A 2I32A 3SYPA 3CDCA 4LVNB 5CZVL 3LEYL 3TW6A 3QHZH 1S46A 1DN0A 1CGSL 4F8NA 4NSKB 2IPJA 4Z1CA 2H6UA 4DYKA 1FN4B 1OARH 1QPXA 2Z6FA 3L7EA 2MNRA 1DJZA 4A1RA 4ORIA 4XPHL 1A1MA 2GL5A 2Y07H 3VGFA 3LTYA 3E0GA 1CT5A 1KM3A 4K0OA 4D0CA 5KSUB 1CZ8L 3WLSA 2W67A 4U2YA 3RWCB 1NCBL 4PY7B 1NFDF 3ROOB 3HHMA 2C9RA 3KPRB 2CUMA 2JKNA 4GW4A 1TLMA 5G4EA 2DLFL 2X6MA 3T0CA 1EAOA 1JCLA 3LXBA 3ASOB 3MI3A 3TQ0A 3L7FA 1BVNT 1R3KA 2IKJA 1UQYA 5DHVH 3FC8A 4S23A 5BZWA 5IKCA 5FO7A 1M05A 3LS5H 1QNIA 1JF1B 3EO9H 3NESA 1AHWB 1MUJA 2VGLM 5T8IA 4AMAA 2FLMA 1VHCA 1P2CB 2BW5A 5DA4A 3V0VB 2F68X 3MACL 4M82A 4AIOA 1FNAA 1QOXA 2J62A 5FUOH 5D93C 1FYTB 4G5ZH 4U10A 3CFCL 4G9FD 1FZOA 2XN9E 2WIMA 1EDTA 3NZGA 2X41A 5HDBB 3IDJB 2VC7A 3GQFA 4HCRL 1PFCA 2IV9A 1PQZB 2GJZB 3SKOB 3WS3A 2MQGA 3PS7A 3ROLB 5HQEA 1PW3A 3PWAA 2IPTL 4APQA 2ATSA 1QEWB 3WKZA 2C15A 4AVJA 3QUMH 4G1MB 4RZKA 3WK2A 5AZ1A 4F7PA 3B43A 3K2IA 2QR0B 2PDBA 2BOGX 1FWSA 3UYOD 1MQRA 3B8IA 3FUDA 4XP9H 1G7QA 3EOUA 5HI3C 4WU5A 2JQZA 1G1OA 4L5FL 3BP4B 3WFDL 5E8EA 3EJTA 4P23B 4LDOB 4M6QA 4XWOD 1ORSA 1TA3B 4K7PL 5EU5A 4TVPE 1DJWA 4DVBB 5EOCJ 1KFAH 4PJ6A 1JGDA 4S3BA 5EMYA 3V5DB 4PJAB 4ZE4A 3VJ6A 5GIRA 3RJXA 3GLZA 1CDHA 1NGWB 4NNBA 1UA6L 1NGPL 3CNYA 4U7KA 2DQUH 3I9GH 3P60A 4MA1B 3G1FA 3QZAA 2BP0A 1TTGA 4ZFZA 3QUYB 4HEMA 2WSRA 4AG4H 3S8WA 5ABFA 1ZPUA 4ZQNA 3IFNH 4WR3A 4IKIA 3T0VA 2ITFA 4BXVA 4XC1H 4YHZH 1N4XH 5J9PB 4PG9B 5DA0B 2CG9X 1DVFD 5L2JB 3F84A 4AZ5A 1VCAA 1SEBA 4JHVA 4ZDHA 5T5FL 3QQDA 4S1QH 5F7KC 3B9KC 3EBAA 1EZ2A 3O6YX 4JOMA 4I0KA 4BK8A 4LKXA 1TPXB 4QRUA 5CKSA 4Y1AE 4HS3B 4PP1C 1Q1PA 1KCVH 4NUJB 4FQCL 1QACA 1IM3D 3TSDA 5JORB 1Q63A 3QNZB 4HH9A 4NQVB 4ZMNA 1T1XB 1HVQA 3P4NA 4P5KA 2WBJD 5KYNA 2ICEB 4JKLA 4RETB 5CZSA 1FVEA 1DO6A 2HUEA 2R9HD 4U3CA 1UOVA 1KYAA 3CEPA 4A3UA 5GGVH 1E5ZA 3EFFA 1JXGA 3DOSA 5ESQA 5JU6A 3MOAL 3RR1A 3BGJA 2A38A 1PB0A 3E9AA 3TN5A 2Y8KA 3ABXA 4JK0D 3V9EA 5KYWA 4FTVB 4YXKH 1OSEA 2X9ZA 4UCGA 2FSEB 3WFEH 1BQGA 3CS2A 2FWSA 4X9GA 3D6NA 3WG7B 3C9NA 4R88A 4B3LA 1RUPH 3AXMA 1LORA 5F44A 3CVHL 5IR1A 2AK4A 2W0FB 3OV6A 3W86A 2V7HB 1ID5I 3TBCA 3T3ME 1AZVA 5LQBH 2OTDA 2ABBA 5LBSL 4S0SD 5D1XE 3SGUA 1XXDC 3SDAD 2PYFA 3CXOA 2JF6A 2VDNH 1LUCA 4FFVC 4NQCE 2VQUA 5BQ7A 1VFUA 5BZDA 1AOZA 2G9HB 1MIMH 7REQA 4BCZA 4ALDA 4EANA 4Y5VB 4FA3A 2DLEA 3RY4A 3H3PH 3MRLB 3QIBB 4YUEL 1CBVH 3BZ5A 1A5AA 4LV9A 4CVZA 3IMRA 3BZDA 4LAUA 2FNWA 2J2ZA 5SX5H 1B2YA 2J4WH 4NGHL 2VZ1A 1LJYA 4XXCA 4UOZA 4X6FB 3LKNB 2VDPH 3BT0A 3TX4A 3KZPA 2CJ3A 5ISZB 1UZDA 3D18B 4D8LA 3QJHA 1HAUA 4TOYL 4C4UA 3MPCA 5DQJB 4YZFE 3SSJA 4Z7VF 4HZAA 4AENB 3EBHA 4M7JL 3CFUA 1FC2D 4X5WA 4GIRA 2CKBA 1ACZA 3W0WA 5HWNA 3ZU8A 2JKEA 5ERWA 3MMTA 5B3JF 3ZHKA 3DHJA 3FUHA 2BVOB 2IG2H 3QUZB 4NX5A 4HT3A 3ARRA 3TBYA 5B1AB 3G1XA 2B7QA 2WP3T 2WMIB 3G08B 4IHCA 3GNML 3PTQA 3WH7A 5DEZA 3NCMA 3CHQA 4DXVA 4GSXA 1VFLA 4KWSA 5JBFA 5KANI 4Y8FA 3B0YA 1T5AA 4B3VA 4DZIA 2ID5A 4DKEL 1D6VL 2B1HL 3P82A 1U2YA 4GFIA 4D0BA 5ECUA 3MQIA 3CN2A 3IETB 3NO3A 4MHHG 3LEXA 4BEIA 4FFYA 3T8QA 4MY1A 4PB9H 3IS1X 5C1MB 4JM2A 1MFAH 2YCIX 1P4IL 3BQUB 1NAMB 2E56A 3H42H 2P5ED 1YNYA 3MUGB 1NM4A 3LN3A 5FYJD 3EGJA 3VXSD 2TSYA 3TEWA 1I1AD 5J8LA 2N7AA 4GW1B 4K73A 1PTGA 4PE8A 1UJQA 1ZVSB 2JLPA 4KIEA 4ZW7A 4UFMA 2BSDA 1OT4A 4CNTA 5BOEA 1QI4A 3I4EA 5J5RA 3WIIH 4NT6A 1UVQB 4TXVB 4D9LL 3GIZH 5SV3A 2Y5QA 4ZX6A 4MWAA 4Y9GA 3VD4A 5E56A 3WMSA 1XH3A 4P2YA 5FC9A 4N1CA 5EWIL 4R7NB 1F6AB 3QYQA 4H13C 4G7EB 2Y5TA 1W8GA 5AKRA 2OR7A 4JFEA 2YD8A 4GUCA 4Z17A 3G6DH 4P5TD 1HYSC 1S3TC 4QTGA 1O68A 3IJIA 1LGVA 2WGXA 4EN3C 4WWKA 1CFVH 3W1QA 3KYKH 1YYAA 3TXZA 3L95A 3H6OA 3MGAA 3FTVA 3Q67A 4L1GA 3RWFB 2PDMA 3T04D 4URIA 1JPDX 1GOKA 3ASWA 4OUUB 4KRPD 3EH4B 4W93A 4BKTC 4HUMB 4BFEA 4L37A 3ZY7A 4M5PA 4M7LH 1HT6A 4F0SA 5B8CB 1SBSH 4IKKA 4WKXA 4LRSA 2NVCA 3GXPA 2HPMA 4I48A 4DGUA 3GMRA 2XKNA 1DKWA 4Q58C 3EX6A 1SLXA 2HE5A 4QXTB 1WQVT 2PPAA 2HJKA 2J66A 4U6XB 3LCYA 4PMYA 2Y24A 5GRVL 1ITBB 3CUPB 1FH2A 1M42A 1M41A 4AQ1C 2IQDA 4ZS6C 2VXNA 3UJJH 5DFWH 4R97B 1ZLWH 1XYMA 4GB9A 1K8ZA 4MNKA 1E6QM 2WIIB 3KXFD 1GOXA 3S9IA 4P61A 4QLJA 3BUVA 1NIDA 4QWWD 1OTUC 2BVDA 1IAKB 4MA3A 2AQWA 6REQB 1NWSA 2PWGA 3NYDA 1W1ZA 3D39E 4K68A 4G42A 4C58B 3ARFA 2XH0A 3KS0J 3ZDYB 1EQPA 3OG3A 4DVRH 2E76C 2ZKHH 1CFNA 4XHQA 5CLWA 4GX8A 2XIBA 1YZZA 1QUPA 5BUPA 1M71B 3IYLW 1W9DM 3BHBB 4WWID 1KFWA 4V27A 2VHLA 3WG6A 1OFBA 1Q1JL 5K4XA 5AFDA 5FIPA 3FW6A 4XC3L 3O15A 1K72A 4MQSB 1MFDL 3QAQA 3M47A 4BH8A 3AUJA 4IU2B 2IDSA 5KZEA 1XAUA 3PP3H 2AK1H 4G7YH 1GTHA 3UTZA 2PPDA 3MGOB 3MLYH 4L3CA 3N4FA 3PHSA 3B2PA 3AS1A 4PR5A 4I18A 1YMHA 5CXPA 3ZZLA 3VH8G 2R1LA 2OVLA 3B2VL 3C6LD 1HX0A 3B8UA 3GK8L 4QHPA 4GT7A 3K4DA 2PP9A 2EIBA 1BF8A 1HS6A 4ODVH 4N2NA 1R34A 3R18A 5LSMA 4YGVA 1N18A 4LLDA 3GMLB 3GHSA 1LK2B 1UBPC 3FK3A 4JMNA 1ISYA 3B03A 5C0EB 4MZIA 4O58H 5I75B 1DVZA 5H4YA 3BUQA 4DUWA 3QIWB 3ATAA 3NABH 3QFGA 1AZBA 4JG5A 4KY1H 5LIYX 2FIRT 3KRBA 1IAOA 5GSRA 5HHOE 5KSAC 4LUSA 5DD5H 4K3JH 1T20B 4N25A 4BK4A 3A67H 1U8CB 1NM9A 4XTRC 1GGTA 4TX8A 2P8CA 3T1GA 4LARL 4EO5A 3CBWA 4S3JA 2YYUA 1BLIA 1J0YA 5D03A 2Z4QA 1OTSC 2Y6TE 3A4DA 3MMEB 1R17A 3PABB 4Z1PA 1MIEL 7ODCA 3BPOC 4X98B 2QF7A 4QE4A 1JXFA 3HOGA 4XNZB 4NASA 2CXKA 1RBLA 2JKLA 5DJXB 4PJ9C 1X4YA 3B6SA 4HKZA 1E56A 4C5ZA 1XGDA 4ICCX 1IUZA 2YSSA 4ILSA 4S2SA 2CO3A 5EEYA 3LDBC 1MEWA 1K3IA 4GPNA 3FSUA 2WKGA 4AYID 4Q9RL 2OMBA 1UYQA 3PTDA 5IFJB 2CLPA 1T3FB 4H5SA 1X5LA 2XZQH 2NX5A 4FX5A 4XIAA 4TV5A 2J6EH 4A39A 4UNIA 4JKPL 3GHBH 3VXUA 2IANB 4ORGA 2QUTA 4WWNA 1BPLB 3MRBB 1D5XB 3UTPE 4N85A 4BZ2L 4Y6GA 3WSQL 3LXAA 1FBAA 3MNWB 1KELH 3DRTA 4UOW0 4UU9B 4DCQB 2OJZH 3CBRA 4HK3N 2MANA 2J7GA 5FCZA 5HDRA 1YEHL 1HQTA 1L9WA 1FWRA 3POCA 1EGJL 3DMMC 3IEBA 2BCKB 4KTEH 1KXHA 1DIOA 3VNJA 2DQTL 4IGBA 3H8NA 1VRSA 5C9XA 4Q8PA 5KZ6A 3FQNB 1RZ7H 1R9ZA 3GNXA 4JY9A 1K7FA 4XO7A 4B9CA 4NS0A 3FJTA 3W9DB 5HDWA 1GGYA 1UWXH 3V0IA 5FCUL 4YLQT 2K70A 1I3RB 4PFMA 3JW7A 3T5WA 2YW3A 3PP7A 3DSNA 4BZ1A 1DFXA 1DLHA 2G5BB 3T4AA 3L5WB 3TBVB 1EVTC 3QQ9D 2QQLL 1FNFA 3BGFB 1ZT1B 5TQ2H 1FRBA 2WNXA 5DC0A 3CYJA 2OAAA 5CPQA 1RJZB 3ITOA 1GKEA 5EKYA 3GH7A 1XBRA 4HGWA 3L16A 4GQGA 4FQLH 2XZAL 5H1WA 2IEPA 1YNQA 4OBRA 2BOCB 4E9TA 2VLKD 3GS0A 2YOCA 2GPZA 3N40F 1O4UA 5IHBA 3R2GA 2IS7A 4QISA 1K8DA 4M1GL 4Q52A 1O95A 1T1WA 3SDDA 3SUWA 5AYQA 2UXTA 1WUZA 4WW2A 4AVNA 3PNRB 2UUDH 3LLFA 1ET7A 1YYMH 1YMMA 5D2NB 3WXWL 4QRTA 3R89A 1W72H 1HZKA 4QTHA 2DMKA 4LEXL 3V4BA 1RQBA 3BSZA 4N9GA 1S2TA 4ADTA 5EC1B 4QHLA 2JJTA 3M5YA 3NDOA 1KTBA 5FYLD 5FW7A 3OA5A 4UTHA 3OZ9H 3GTXA 1UZ8A 4F3HA 1FXPA 1HZYA 2OKTA 3MMUA 2GKIA 2V2HA 1SZGA 1MVUA 2PEVA 2WMPA 3T40A 1RZGB 1MLCB 3GO1H 2WNZA 3EJZC 1T99A 4MNJA 1CGXA 5I1HL 3EWXA 2SFPA 4HEME 5DI8A 4DNHA 4W4OA 1I2RA 4WTQA 4OCMC 2PDYA 3DX9B 2X0YA 3US1A 2VN5A 1EYWA 4O10A 5HHQA 4G6FB 3OAZH 3G5EA 3F4VA 1A7QH 4LLUB 4NP9A 4JKKA 1IWPA 1DQXA 1V7NH 3ZKMD 3UY8A 3XIMA 3UBXA 4P57A 3ARBB 3NPWA 3CO4A 3I9IA 1ISWA 3SQSA 4NO3A 1PKMA 2V69A 3SCMA 5G5DA 2A0LD 3L54A 1QFHA 3CE1A 5DEFA 4XPFH 1CGYA 3IJDA 3IRDA 2R29L 3IIVA 4C6QA 4UTJA 3CH1B 3BPWA 3HB9A 4WFFD 4H25B 4JVWA 4QLLA 4M1DL 4KKLD 4N8CL 4YS1A 4WKFA 4L4MA 4HUVA 1W1IE 4CN1A 4JNMA 5GRXG 1GRWA 4Z08A 1FNSL 4PTTB 4HULB 4HOMA 3TPKA 1HKFA 3VTTA 4EPKA 3AYTA 1F3RB 2X9WA 3P61A 1OTTC 4H41A 1QOPA 1UWRA 1OCRB 3CHSA 4Y8DC 1TLKA 1SQMA 1WDRA 2V5TA 2YPLA 3VWJB 2EEFA 1TR9A 2AK4E 3E12A 2V9UA 4V1XA 2NVDA 3UR5A 1RY7B 5F7EL 4YLWA 5F89A 3QS3A 4ODUB 4HWZB 4OCLC 5HI3D 3EJCA 4JQXA 3M5ZA 4K8GA 2VR3A 3A12A 2F1AA 3HZ3A 3OG6B 2XC8A 1UGNA 4WU7B 2RFXB 3QUXC 5F9WB 5JPMB 5J12B 1D2OA 1EOKA 4LSTH 4LVBA 1JUBA 4ODWB 3EW3B 2DQHH 3UPWA 3D85A 1I1RA 3Q9PA 3O6MH 5LXGH 1T8XA 2QJNA 3NZ1A 4I5BA 4R8WH 2YLKA 1IMHC 2WHKA 2GQHA 1AFVL 2XWRA 1F9CA 1Y5VA 5KVEH 2NY0B 4Q4PA 1UB6A 1BQLL 2P7TA 1ZA6A 4QAMB 3NNTA 1LWJA 2FZ8A 4DZBA 3AXKA 4H1LB 1T6WA 4L1DA 5HR7A 3VXRA 1PCKA 4YL9A 4MAVA 1Z9PA 2QQNL 3MRDA 3O6LH 3B9KD 1A7PH 5E9NA 3VTAA 2B77A 1V6VA 1TYEB 1A5MC 3EGSB 2NW2A 2VUNA 4P2QB 1MHCB 3W0WE 5F0JB 4B2DA 4D6DA 4TF4A 3K6NA 2QJIA 1GZPA 5FV1L 1T7WA 3ZE2E 5C0GB 1AO7B 1IAIL 3I3EA 1L8PA 5C0DB 4JFZH 3ITVA 4MCYB 2NY3B 2K3HA 1UD3A 5AZ0A 1SN2A 2XQBL 2VENA 3AI0A 3F6JA 2O92A 5HPMA 3TEXA 3S4SB 2EZ0C 2GOUA 4JFQB 3JBG7 3VQ1C 3NEOA 2VEKA 4NN5B 2WC4A 1EAPB 4JHBA 1TRDA 2Z1VA 5HNRA 2AVFA 3L2LA 1DQVA 3NSMA 3VIFA 1RK5A 3S2MA 3L9BA 1A6WH 4HD9A 1NCDH 1ACYH 1TVNA 3TJEL 3RY6C 3M45A 1UFUA 3S2AA 1J9QA 2ZUUA 2DOCA 2Q86B 3SUUA 2KI6A 3TZFA 2E3ZA 4HSQA 3MRQA 1V54B 1TU2A 1TIMA 1WDAA 4BFFA 1GHSA 1H63A 4YBQD 1WXZA 5GGQH 4GSDL 3PSWA 1J9CT 3PWPA 5AYXA 4IF2A 3WKYA 2F53A 2NLYA 3ALFA 4F79A 2H8ZA 2WKOF 4H01A 2QYGA 4NAJA 4NNAA 3ZKQD 4F57L 2X0UA 4WHYG 2QGBA 2IWFA 2DSZA 3QEHB 1C16B 3KPLB 3QEQB 5FF4A 2FB3A 3VFNA 5JVLA 1J2WA 4MWAE 3H21A 3W56A 1BA9A 1DBBH 2LLEA 3R4DA 1RCYA 2HWGA 1CGTA 4LFYA 3V6OC 2CKNA 5KVGE 4I7ZC 3VQLA 1XR2A 5FFGA 2QJHA 4P9MH 1HNGA 4PRPA 1TNNA 1OG6A 4GJ1A 1K77A 1WD9A 4WCJA 1YN7A 4WJEA 1HEJC 3DO4A 2P3YA 3VDGA 3TZVA 5L7XL 5DEGA 2PYEA 3OHXB 4Q6XA 5ID1A 2JF7A 4UNKA 1WIOA 5T33H 2BSED 4RMRA 3BE7A 1AD4A 1I31A 1U8PA 3EBIA 4PSPA 4IG2A 1CK0L 4KKAC 2XZCL 1UXMA 4JTJA 1G0XA 1LM8V 4GZJA 2GK2A 3RGVA 3DUGA 1MCSA 3EBVA 3AT9A 3U6XA 2J7LA 2QSQA 4HJ0D 4W8LA 4EXPX 2Y6SC 1KUMA 2HT2C 4LANA 4PB5A 2WQDA 2ZXWB 3G9AB 1KA9F 2R24A 1GGCL 3CPLA 4TKWA 5FA5A 1S7VB 3MRRA 2GJXA 1MRAA 1Q7QA 2V9DA 1JNNL 3WXVH 2O6EA 4L5FE 5IVXA 1VS1A 4HT1L 4FCHA 2NQ9A 1OCBA 4MGXA 3T4CA 1JPGB 4F5CA 4EIUA 4O51A 4HN8A 2D7NA 4AVOA 2W07B 2QGHA 3O8XC 4WXYA 3DYOA 3IS4A 3ZVVA 4G9FB 1PCXA 1D6EA 1I9JL 1D9KC 3TA3A 1OEZW 5A95A 4DI8A 3E7JA 4AMKL 2GSEA 5CJQH 3BKMH 3ZTEA 2Y5JA 3D47A 3UEZA 1TE6A 2ZP0T 1GONA 2E25A 2UYLA 4F9DA 5DXWA 4NOBA 3M1ZA 2E6AA 2YC1B 3SZ8A 3NCCB 3QRLA 1RMFH 3OG4B 4AKQA 2P3EA 3ME3A 4WK4B 3BH4A 3V79C 1VBUA 4FXKB 1QATA 2ZYFA 2ATKB 2NXYC 5AAWA 4AG0A 2P8MA 4YTUA 4TPRH 3O9WC 3WUZA 3OKOA 5EUKA 1QRNA 1V3LA 1IKNC 1OCWL 5KZCD 3BQVA 3S3BB 3MUY1 4G6MH 3U83A 3PWJA 4XTIA 1A5UA 3HZMB 3PWNB 3W76A 3H6AA 4UIKH 2RJMA 4OKVA 1A6ZB 1X8FA 2FQIA 4EEEA 1B4RA 1XMWA 4H8NA 4KWVA 3C5JB 4LHJB 2ZUQC 2YGYA 4AEOA 1AIFA 2Z93B 1PY9A 2VFEA 4YHGA 3HE7A 2WOQA 3RU8H 1R47A 2DZAA 2FZBA 2G75B 1SZFA 5C0IA 2HN7A 2BZNA 1JHKL 3B8DA 3CUGA 4HU2A 5I5RA 1E40A 1G7IB 4OZFB 2LAGB 2HRPH 2F7IA 4MS6A 2FGWL 4HJ1A 1WKDA 5I1JH 4K7FB 5AY7A 4I3RH 5ALBL 4G2AA 1DVFB 5KBDA 3CPUA 3V16A 3F7VB 1A65A 4KVCH 3Q58A 4ZS6D 3U36A 3NQEA 1WA0X 1QKZL 3FSZA 4FHJA 3VI4F 1HO1A 1BQSA 5KYUA 3JTSB 5CPTA 1MCQA 5AVQB 2XOTA 2DIAA 2EEAA 1IM3B 1QO2A 3X2QB 3M5VA 1CE1L 3B3DA 4WF7A 2IKIA 2G4EA 4P2RD 5LAXB 1EGMA 1UA7A 4HUKB 1BEYH 2J8UB 2WBJB 2BY3A 1HH6B 2OS7A 5F1KC 1ID2A 3GSRB 4NXKA 1W5MA 3WQVA 1JVKA 3TQVA 5I3HA 4JZNA 2EE3A 4U1MB 2PDKA 3L5XH 2XG4A 2ALAA 4J23A 3LQAC 1RCOB 3C60D 2NX5E 5ANMB 2G4FA 4ZFGL 3JVGA 3FB8B 1E3FA 4Q2ZA 5KTEH 1WS8A 1XH1A 2K1MA 3BG9A 1VKFA 4PGDA 2RDWA 3RTQA 1MI5D 5C97A 1KG0B 4N2KA 1HSBA 4FEZA 1DXFA 3MTXA 3LRMA 3DVGA 2XJKA 2CXEA 3V52L 1CE6B 5TK2A 3D0VB 5I82A 3OQ3B 3LS9A 4ZW6A 1OFRA 4WDUA 4H44C 5AC8A 4QROA 1H7OA 5CKAA 5IESL 3S1XA 1VCBC 5EZLA 1QFOA 1U95A 3GVRA 3WLQA 3RL2A 2EDQA 5ADPL 3SDAB 3V0TA 3L4TA 4KH9A 4XO9A 2FO8A 3KW3A 3ZDXE 2B4GA 5DWPA 1NGYB 1W9BM 3AHTA 3MR9A 4GWEA 3L3GA 4NUMA 4KS0A 3X14A 1GQIA 3WN5B 2W8CA 4GJJA 1KN2H 2HKAA 2BC4A 4KTDH 3VVVA 1QLFA 3EH2A 3QNYA 4GW5A 4M6NL 4FCAA 2HH0H 4XRCA 2VR5A 1X7IA 4AYDC 3VD5A 1YYLH 1OFAA 1YE6A 4OECA 3C8FA 3FB5B 1PSKL 4HALA 3ZSTA 5DHYB 1AW1A 3KPOA 5ICYB 4RISL 5A6LA 1NCHA 1O0VA 3BLIA 4XTRD 4ZGYA 1CB7B 1UWGH 4WEEA 4J7RA 3AQXA 3MRGA 2KDGA 4NO0A 1B6UA 2XIMA 1GQKA 1OTSD 3HRZB 2WUCL 4IBSA 2DEYX 2AEOA 4PCPA 1QO3A 1RZPA 2IAMC 4XZUB 4NP7A 3LERA 3IVTA 2A6NA 1I0DA 2R1YB 3UX9B 5B7MA 1YMME 3TNMA 1CLOL 4GXVH 2VJXA 3SQLA 1F11B 1FRGH 2FSDA 3JUYA 2W9DL 4JTQA 3RN6A 1JPIA 3FU8A 5REQA 2DJMA 1UEMA 1OF2A 3MCYA 2HRWA 2FK9A 4GQ9L 5DMKA 4ZI8A 3DJZA 3DFPA 1A6VH 2XIQA 1Y7VA 1GGIL 4YVNA 2Z31B 5KSBB 1AXIB 2A6IB 2R14A 2ROXA 3SPCA 4M56A 2PO6D 1N67A 1CL7H 3U0TB 3TURA 4MHBA 4AEEA 5DF0A 2JELH 4BI7A 3TFBA 1ECYA 2YMTA 3FOMA 1U9KA 4PZVA 1Q6CA 1HK6A 3FAXA 4ZT1A 2P5EB 1TV3A 3ZZQA 4X5RA 5TFSH 2XPYA 4FKKA 3QSRA 5EA0L 3FOLB 4RW3A 3Q6GH 5A6SA 4P2AA 3VXSB 5D7SH 3DMMD 5I15L 1I1AB 4H6EA 5HDQH 2Y1VA 4FQIL 4MYWB 1K4CB 1O5QA 1ZBKA 3VNYA 2ADAA 3QULB 5I16B 3N85H 3DGRA 4QLKA 2X6CA 3QXAB 3D12B 5EZJA 3T44A 4IRJA 3PZ9A 5E94A 3V55A 2PP7A 4AD2A 4X0VA 3DARA 4FADA 4ONHB 1PVHA 3ZQXA 1OPGL 4Q8UA 2YUWA 4G8FA 3NQBA 1OB1A 5LIWX 4P5TB 1B0WA 2YPVA 1FI8C 1UURA 4OJEH 1LO4L 3GUGA 2HG5A 1R3LB 4PUUA 3NL3A 4LPXA 3B7SA 5IV2B 1QFUH 4HU8A 4QXGH 1CIUA 3UY7A 2G30A 3NMEA 4X2PA 1JDFA 1T96A 4KRPB 3N1AA 1C1EL 3TYCA 2FJGA 1NAKL 2E8ZA 1AS7A 1H62A 2YPLE 4PMRA 3P4MA 3QDGD 4ZMQA 4I5XA 3PBVA 4LUTB 5E2VL 4XD5A 1BXAA 3BKJL 5TQ0H 3BP7A 3VNDA 2H3DA 3LI0A 4U1LA 3KPPA 2RALA 1YIXA 2ACQA 1XGRB 1J5IA 1XM3A 4NQTA 1XISA 2WXKA 5HQMA 1FGVL 3EXSA 3UJFA 4Y5YC 4X9SA 4HQVA 1KACB 1VCFA 4RFOL 1UZ6F 4GAYB 3E38A 5MEQB 3FQWB 4YE4L 1YDOA 2B9BA 1LO5A 4BUGA 5KVDE 3NP3A 1XPYA 4U6VL 1NDMA 2ICSA 2WTRA 4DJEC 4WV1C 1ZB5A 1RSFA 1SY6H 1DVYA 2DH2A 1KDIA 3LGGA 3PG2A 3NZQA 3TNNB 3RPIA 3NJVA 1PKNA 3CB3A 2CKBL 1WGVA 2A2QT 3MB9A 4PGBB 4IEFB 3QFDA 2Z92A 1OKEA 3C12A 2OR9L 3LZFH 4OZ4B 2R1WA 4LPTA 4O2CA 3EWYA 2AEPH 2JNZA 2Y4SA 4PJBA 5SWUA 2BOBA 3UVAA 4B9GA 3BUYA 4P7RA 3DAQA 3CVDA 2R0WH 2MWCA 2C3VB 4NI3A 1NFGA 3E0VA 4KZ0A 3KPSA 4YDNA 3R06A 3ITGA 1S7XA 4PTUB 3SGKC 3JWNH 1GYWA 1IO4C 3TROA 2FD6H 3VD1A 2CR3A 4PCTA 1HI6B 5JIPA 5DBUA 1FBIL 1J9RA 4FFYL 4WGWB 3GSNB 3SECA 3L3OA 5KSVB 4YAQB 4PI0A 3DUHA 3E2RA 1QLEL 3O06A 3J8F7 5B1BB 5HYSA 4PV1C 2ZADA 5EFFA 1R4XA 3C6LB 1E2WA 4P5SA 3E2VA 2F7PA 4QS5A 3C5ZA 4Y4FC 3PPEA 3KS6A 5LGZA 1OTTD 1SOXA 1JWSB 2A83B 3GFYA 4C6JA 4OZHF 4D9PA 4DKTA 3R4IA 3V0AC 2N4IA 3A47A 3TAOA 1ZHBA 3H2AA 4DKFL 3ARGD 4HQQL 2VT0A 1QBAA 5D71L 3TEVA 1W5NA 4XO4A 3L3JB 2NNAB 2HXTA 1WBZA 4AGLA 3LTPA 3PWPE 5KVGL 4OTXL 3CSYA 2F53E 4Z7WA 3EF4A 5A8QA 4KHTL 3SY6A 4C6OA 5DZPA 6A3HA 1DWJM 4X7FC 3HAEG 5D2YA 1DJYA 4IS6B 4RNRA 3BAWA 4YSUA 3SUVA 4JRXD 3CZFA 3VI3F 4P5MB 2E4FA 1RZIA 5FJJA 4XPGH 4OCNC 3DO7A 4JFXB 3CZLA 1UM6L 3VUPA 4AVFA 1OWQA 5FF6B 4MM1A 4Z0SA 5KN5B 4PRPE 5BO1L 1XSJA 2EDLA 3BIKB 2HNHA 2PYEE 1ZSDA 5JYLA 3NO1A 4POUB 1YJDH 4H8WH 3QHOA 1UWAA 4PRRA 3RMJA 2HRHA 3KEDA 3OQ8A 5FOOA 3TO4D 4UQAA 2Y7NA 2ARJB 2CE6A 3CAWA 3K30A 5G1TA 3RLHA 4QGTA 2APWA 2DIBA 5C3TA 1LEKA 2Y7DA 3EYPA 1V6WA 4C57C 1H19A 1YNLL 1RH9A 4QFUA 2J57A 2Z34A 5BJTA 4KF1A 2YD5A 2ZPKH 1IQ8A 4CJ1A 4DTGH 3X3GL 1AQKH 5EFDA 3KCPB 3ZKSD 3FYIB 1ZY9A 3AWNA 3ISRA 4UT6H 3UWZA 2YXWA 3DURA 4FEIA 1VFBB 4IICA 1I8KB 1LO3H 2EZ0D 4AMXA 4MD4A 3QWQB 4CQCA 1DYZA 1AQ8A 1OGAA 1KULA 3CFTA 4A6YH 4R9HA 1JZIA 4DWSC 1WUEA 3SDYL 1HZHL 4G9DB 1CBGA 5HHMD 4X6CA 5CEZH 3HIJA 4AD0A 4C47A 1IE5A 4EI5A 5IVXE 5E1AA 3TYAA 4HAKA 4FZ8H 1EBHA 4Z7AA 3GDBA 5E4EB 4HWEH 4F5CE 4AY0A 5LG1A 5CEXB 4KGLA 4KXDA 1KRMA 3BZJA 4NPYA 3ULUF 4AEIL 1QAWA 3QEUA 4UIMB 3LEVL 1ZV2A 3KPNB 4GRWH 3C2FA 1DUYB 4GG9A 1T6VN 1WPCA 3RHWF 2LHAA 3FULA 2EP6A 2VMJA 4LO9A 2NXIA 2VLKB 4EWND 4AQEB 3L3HA 2AV1B 3ARSA 3FUNA 3TCTA 1K9FA 3QAZB 1CD1B 4N90D 1FCBA 4F3FA 4GNJA 4H1LH 1R9YA 1H3PL 1VR6A 2CGZA 1A5SA 4C1NA 3RX7A 2IWEA 5SX5K 3K1GA 4IIQA 4GINA 3L2NA 4EOWL 5I0YA 2XX1A 4KO6A 5F2FA 2GC7C 5H37H 2EGZA 2F7RA 4H6KA 4M7ZC 5AVRB 3LK6A 5I6XC 3P1VA 5FA4B 4ZQKA 3W3OA 1ELSA 5I1DA 2BLFA 3F5WB 3G5WA 5LHFA 2MRYA 3V6BR 2V2CA 4OV5B 1F45A 3EYUH 2PU0A 2D7TL 2XTJC 3VFWB 4GVFA 3LNEA 2ZG2A 4LOFA 1U42A 6PCYA 1A3QA 5CGTA 4NKDB 4OGYL 3VKBA 1RZJH 4ZW8A 3UTTA 2FJHB 1O5DT 1A50A 4TU1A 2BK8A 3S3DB 2I5YL 3IU3A 1F6FB 3S7GA 4KKAD 5ALCH 4PRHD 4AWJC 1ZFJA 4X4XA 3MDJA 3CNKA 1KYOJ 3LKOB 1BF5A 1V27A 3G6MA 5I1AA 2I07A 2VM4A 2L7UA 3Q0HA 3BEVA 3VXOB 3L1OH 3B0UX 2Y6SD 3MDUA 3FCGA 2H6OA 5CLTA 2HT2D 1A6AA 4W9TA 5D5MB 1BZ8A 1I9CB 3OA3A 1WF5A 4S1RH 4B9IA 3F65A 3V7AG 1YDPA 4XKYA 4BGLA 1EJVC 1JZ5A 4O16A 1NANI 2EICA 4FQ2L 3WHE1 4CU8A 1HWHB 1G0CA 3SDCC 1P7KA 2P26A 2BWIA 1FY6A 5LKNA 2R69H 4ODXB 4ATTA 3OR6B 4FS9A 5JUVA 3W1PA 5KYYA 5I06A 2VDKB 1B31A 4Q14A 4I3GA 2CBJA 1EC7A 3O8XD 2IDCA 5E6IC 4PBDA 2XG9A 1D9KD 5I3JA 2OT0A 5JH2A 1L9PA 2PR4H 4XVOA 1KNWA 5CC3A 2HXAA 3E6HB 4ACZA 4NRZB 3WTWA 1OT2A 4JKNA 4PRWA 1MDTA 3LN9A 4DH2A 1LL1A 2NTSP 4A37A 3GDMA 2Q9OA 1G87A 2NTFB 2ZA3A 4HEPA 5EYWA 4ZE5A 1NGQL 2ZUTA 1NC4A 1H5VA 1ORQB 1KENH 2VX7A 3HRPA 2WXPA 3QWRD 1Q9OA 1BTMA 3MFFA 2TSAA 1JS4A 1VFTA 4ZMAT 2NXYD 3AAZA 4QYOB 2VFFA 1PYWA 2W81C 5DRWB 4ASTA 2PWEA 2PRMA 4XN1A 3O9WD 2VOTA 3WGUB 5E00A 1G6RB 1XF2A 2Z31D 5HJGA 3SOBL 4U6YA 4U4IA 1VPXA 3FX4A 4HKJB 2YR1A 2BS8A 1DJNA 2G3XA 3U4FA 2BWQA 5IJKA 3CSGA 1WP6A 4U1JA 2IMMA 3S5OA 4KK5D 2ORBH 2QPXA 3E3QC 4AGOA 1JL8A 1VBRA 4TUJB 3LZRA 4XP1H 3G0SA 4JG0L 3A21A 4BKLB 1YPZB 1U83A 2D22A 3CL8A 2WAHA 4QSFA 5TJWK 2EPKX 2ZYIA 3LEPA 4N0CC 2VAJA 4YNYB 3BP6B 3LIZA 4JTSA 2EXWC 4DPPA 3KEHA 5GGRA 4JQVC 4MTVA 4IJTA 4AKOA 1BGAA 4GZ7A 2F0CA 3KBHE 1A6PA 1ZLWK 3BZFA 1JCTA 5C0BA 7FABL 3NEHA 1A3HA 3B9KB 2QCCA 5F4WA 4J2QA 2ED8A 3A5VA 5JUEH 4BQ2A 1T22B 3G6AB 3BSZL 3HG0A 2ZZ4A 1FZKB 1HJUA 3HG1D 1QVBA 3E3HA 1QSFA 3W84A 4EWJA 5IBTL 4YHML 2BDNH 4GFTB 4MAYA 2WQ8A 4Z3EA 2ZZ1A 1WWCA 3MLZL 3V8OA 3WH9A 4Q3MA 4ZFFA 4Q9QL 4JFDD 1TUPA 1IEWA 4RX0A 4ZUSB 2VDHA 2JI2A 4JDTL 1EJFA 4O50A 3NJXA 1W9UA 3KDMA 4BFNA 4QOKA 4HBQA 2BZ7A 4FXFA 4AX6A 4R9XA 3ZR4A 3MREA 3EOLA 4RWYH 2Y0FA 2DWYA 3TYUA 2WLIA 5IT2L 2NNFA 2WXMA 3TLQA 4L1SA 4OCYL 4JPQA 3HR5A 4NKIH 4YDKH 2A1WH 3UEQA 1F76A 4HKPA 2VQ1B 1D5ZA 1W0YT 2XGZA 3L5IA 3EOTL 4ZXLA 3NFPA 1ZENA 3EZ4A 3OZOA 3AU6A 1JPST 3AIUA 2FX8L 3C52A 1EDYA 4TUFA 1ZA3A 4ZYKB 3LKSB 4PWIA 5HY9A 1NMBH 1IWAA 4UDTB 4XBGA 3T8XB 1UXWB 4G1NA 4PH6A 4DSYA 4UINH 5E5CA 3BKCH 1WOBA 1X96A 4BQ4A 5MKGA 1VCGA 3IJEA 4DGWC 4HHGA 4XPTL 2ZKXA 1PY0A 4Z1AA 4OZFH 3BOFA 3ZS4A 2V6AA 2DI9A 4BI6A 3P67A 1DBJH 5AECA 3FQYA 4R26H 3W87A 4OCWL 4PRTA 1B57A 1M7DB 3MYOA 2D7QA 5D6CA 1CF1A 4OV4A 1NKRA 3FH5A 1XGQA 5BU9A 2Q6WB 2XSAA 4RIRB 1D5RA 4D9RD 4EX4A 4R53A 5I6LA 5F21B 4RA0C 4HIJB 4CNUA 1CUOA 4G8GD 4HSOA 1AS8A 3AB0C 4N6EA 2EACA 1UOLA 1AQDB 1EFQA 1K8CA 2GUYA 1KC5H 5B21A 2ZWKA 4XMXA 3T81A 4RJEA 1DQUA 3QWOB 3WBDA 2AFNA 4TV3A 3DTXB 4NUWA 3A5FA 2X1UA 4MQTB 1AP2A 5KVDL 3K81A 1TQBB 4QCIB 4DW2L 3P8JA 3WFZA 1VGKA 3VXPA 3UP8A 1JJUA 4XP6L 4C1LA 1QQDB 3OU8A 4AZ7A 4WVXA 2XI9A 1ZJBA 3VB8A 4Y9PA 3Q1SL 3W2LA 1TKWB 3FFSA 2VR7A 2WYZA 5AB0A 4FK9A 1H5YA 4Z2JA 2APFA 4B3ZA 3WF1A 3OJGA 3WFLA 4JPGA 4A4AA 1BSLA 2J8FA 1TQSA 4L4VD 2DYRB 1Z9SB 3REVA 1KPRA 3KDPB 3BRDA 1XLHA 1C08B 4QTIL 3VVWA 5D8JH 1JQXA 3NYZA 5F9OH 1UKTA 3MSDA 4XMKL 2J9XA 5KS9B 3Q8AA 3HMWH 2A4CA 4S2CA 3GLCA 4FZIA 4O4VA 4BFRA 2VGFA 3STEA 4Z7UF 4PULA 3VI2A 1L9RA 1H3VA 5DTFB 3WE6A 1BQHA 1JZ4A 4Z42C 2XETA 4HIXH 1UWXK 3MJGX 3KPSE 4Q89A 4KFMA 2BNQD 4IBUA 2VTFA 5BW7A 3M64A 3DSFH 3TCLA 1RBAA 1K03A 1XL4A 3P74A 3QZWG 4JDYA 2BV9A 3RPDA 2X6UA 5A40E 5GRUL 2BXYA 3MTRA 3TW7A 4WTZG 3FQUB 1TTPA 1F97A 3HVDA 3CMGA 3BAIA 1LK3H 2A6KA 3IB4A 3ABZA 2ZYRA 1T5WB 4OKDA 1PZ1A 3ULVE 2HLAB 3N9SA 4JPVH 5IBLC 5KZCB 5F7MC 4PRDA 1KYFA 2XU2A 1N0XH 4XO5A 3MA9H 3I6LD 3C2EA 4JR5A 3QRBA 3VG0H 1QK2A 1IFHL 3LTVA 1JBJA 3FU5A 3O3DB 1UC6A 4IMEA 2ZWZA 2FYMA 1FHLA 2V5KA 3SR7A 4PJIF 1NEZA 3BVVA 3CFNA 1DQQB 3FHEA 3CDZB 3QWNA 1IILE 1T1ZA 5GISL 3GSWA 2GJ6D 3GRGA 4L6HA 5FR3A 4AQAA 4IBZA 4PLOB 1T21A 5AB2A 5J7CC 3ARZA 1SPQA 3KHOA 4EDXB 4TUOA 1FQ0A 2VGBA 1PDKB 4HZLA 4BF9A 5JW5A 5FM5O 1OGPA 3LENA 4Z7WE 1QFPA 2I1OA 4ZTYA 2A9CA 1ZPTA 2V7NA 3SO7A 1DLFH 4AQ1B 5GS1A 2YSWA 3NFUA 4U1SB 2QCDB 3OM3B 4TIMA 4E41A 2Z3FA 5IHUH 1GIGL 4W9LC 3O6AA 5IG7A 2J6WA 1P7QD 3RJQB 4NJJA 1FFTB 1X44A 3TUUA 4YU1A 3C86A 5FYJH 4DJED 1EWEA 1EF2A 2R56L 2R59A 4QS6A 5ABGA 1UOKA 4P2RB 3GU9A 4X80H 5SWQA 3QDJA 3K8MA 3OAZK 5D9SB 4JO8A 2VN3A 4O28A 2H32H 3FPYA 3TYFB 3O41A 4MCZB 1R9XA 2WSPA 3R8BB 2EDNA 4XD4A 4H9ZA 5E2WH 5FL0A 3WLWC 2F84A 3MSGA 1HDMA 3EOYG 3CLFH 4M1BA 2HJLB 3P8IA 1T7VA 3C60B 3O2WL 2M26A 3GGWA 3BAKA 4GNKB 1S2VA 1MCIA 2X89D 4BA8A 1W6WA 1MCFA 1VIZA 1ZDSA 2E3VA 2WO3B 1MI5B 3N1QC 1IGTB 3TWYA 5K59E 1ZRUA 1FV1B 2ITEA 1EHLH 3KWXA 2CM6A 3MOQA 1OAJA 2MKLC 4JJOA 1U92A 2GVJA 1XXXA 1PVNA 5CZJA 4KX7A 2IH1A 5M3WA 1OFQA 1EEYA 1IC5H 1IM9A 4Y4KA 1XG4A 3UF9A 4XG1A 3II2A 3ZDWA 4UTUA 3VFCA 1E28A 2C1OB 4Q8BA 4ANUA 1JK8A 1OGAE 4TLSA 1BECA 4LEQA 15C8H 4NQXA 2ZNXA 2FH8A 3MRJB 4RMQA 4X6CE 1IGML 2HJFB 4MXWH 2B4CH 4DT2A 4MRBA 3LSCA 2MQCA 1QVOB 1SXCA 1WX0A 5DVLA 1PZ5B 2F1EA 3UZWA 3TBTA 2CHDA 7XIMA 2CA4A 4MDJA 2WWKT 2G50A 1XZ0B 4N2YA 5ESVB 3GX9A 5JPNA 4IDJL 1R3QA 1GG0A 5I1KL 4OLZL 4XR8C 4D6FA 3HPXA 2B81A 3IRCA 4N0YH 1R5WA 1F4WH 5DD1L 5T1DH 1ZLVH 2C26A 1IL1B 3AREA 5IRPA 2PCQA 5TTRA 4XBPB 4DPQA 1ITUA 1SDAB 3IDNA 5E0FA 4LCQA 1OSPL 1INQB 1FHNA 3BPOB 2PDWA 5E1QA 1OP9A 5KUMA 4CCZA 5IEKB 3I6KA 1KJ2A 4PJ9B 1MPAH 1FWXA 2WXGA 3QZPA 2B8OT 3HN5A 2GTWA 3W6LA 4UFIA 2F74A 3CWGA 4C6PA 5T26A 5I0VA 3LDBB 4X6DA 3PXLA 2Y7FA 3T9WA 2XZ9A 4BUHA 3KCJA 1WO2A 4HK0A 3QCVH 2Y70A 2PTXA 4MZ8A 2AJZA 5EG6C 1QU4A 3PAYA 5HPCA 2Y3AA 1UJ3B 3S5LB 1U4FA 1FVCB 4ZJ9A 1CDCA 1MUMA 3MCKB 5FEZA 1U3JA 4KDVA 3WLHA 4JY5H 1BD2D 2PO6B 1ZQ5A 4WI5A 4UNLA 2Z64C 4W7WA 1YHPA 2VSDA 2A21A 1HUVA 2YXOA 1J8KA 3LS4L 3S48A 4U1KB 1NSJA 4L18A 5L0QC 3RUBL 3VZXA 5DFAA 4HGXA 4OFYA 1RZ8A 2H4EA 3CH9A 1R3SA 4LSVH 4J39A 2BCMA 1NGZB 3S3SA 4MDRA 1OY0A 3IIPA 4LRIA 3DMMB 3VFSB 5A94A 3O4LD 1POKA 1KGCD 4LRNL 2YDQA 1L7TL 3GIPA 5FEBA 4O4YL 2J7DA 2D0HA 3EA2A 3ZYOA 2HSAA 3BANA 4F0MA 3UZVB 3IK2A 3KGTA 4RXFA 1RVFL 3JZYA 4PW4A 2V9RA 1A7RH 4GP8B 2GI7A 5K2ZA 1IAII 4S38A 1NDVA 3WCZA 2XU9A 4NJGA 1KCRH 1LL6A 1Q72L 4PRAB 4IL0A 4F8PA 3TBSA 1CYGA 3UGXA 3ZJKA 1W80A 4EVZA 4ZMXA 3R25A 4X7TB 3QMSA 1SN0A 4PP1D 3QA3A 2VSCA 3TWAA 1FDLH