1KTBA

The structure of alpha-n-acetylgalactosaminidase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
388
structure length
388
Chain Sequence
b'LENGLARTPPMGWLAWERFRCNVNCREDPRQCISEMLFMEMADRIAEDGWRELGYKYINIDDCWAAKQRDAEGRLVPDPERFPRGIKALADYVHARGLKLGIYGDLGRLTCGGYPGTTLDRVEQDAQTFAEWGVDMLKLDGCYSSGKEQAQGYPQMARALNATGRPIVYSCSWPAYQGGLPPKVNYTLLGEICNLWRNYDDIQDSWDSVLSIVDWFFTNQDVLQPFAGPGHWNDPDMLIIGNFGLSYEQSRSQMALWTIMAAPLLMSTDLRTISPSAKKILQNRLMIQINQDPLGIQGRRIIKEGSHIEVFLRPLSQAASALVFFSRRTDMPFRYTTSLAKLGFPMGAAYEVQDVYSGKIISGLKTGDNFTVIINPSGVVMWYLCPKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-N-acetylgalactosaminidase
publication title The 1.9 A structure of alpha-N-acetylgalactosaminidase: molecular basis of glycosidase deficiency diseases
pubmed doi rcsb
source organism Gallus gallus
molecule tags Hydrolase
total genus 139
structure length 388
sequence length 388
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2002-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1ktbA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ktbA01
3HBLA 4LRSA 4GI6A 3P8JA 1CXHA 3O06A 1YDNA 5TQLA 5LHEA 4JX6A 4EF9A 2ZX7A 1DOSA 4JCLA 1NVMA 4PC8A 3WEOA 1ZCOA 3TU9A 1DORA 1MW2A 3PSVA 3DHFA 1WZMA 3ZO9A 1L0PA 3IIXA 1GVSA 6TIMA 5KTLA 3GBEA 3LRMA 5D38A 1SMDA 2RHGA 4NNAA 2FGZA 2Y7FA 2YGYA 2Y88A 2Y85A 3CZEA 2DIJA 1JUBA 5G2WA 4JTTA 1S5WA 3BAYA 3BLKA 2WNQA 3HGRA 1JDAA 3KOFA 4TMCA 3HQ1A 1HL9A 1E51A 1I2NA 1XH1A 4JGDA 1IGSA 1OT2A 1QPRA 1O60A 1WP6A 5AC7A 3TX9A 2OW7A 1ZS2A 4UNIA 2WC7A 4Z1AA 2VXNA 5HR6A 4BA0A 1NF0A 3HG5A 2IQTA 4K8HA 2X1TA 2WVTA 5E6ZA 1QPQA 3KRZA 1GVOA 5FEWA 2A7RA 2ZZ5A 1OYCA 3DFTA 2C0AA 4Z1CA 3QRHA 2B4GA 4KKXA 3L5MA 2GVLA 2FDSA 2R91A 3LTYA 1WQ5A 1JFHA 3QMSA 3TH6A 4UQAA 2QMKA 4GINA 3VI2A 5HINA 3Q37A 1VFUA 3QGVA 4QNEA 3MHFA 3EKZA 2DZXA 3EX2A 1XKYA 4IMDA 4MB1A 3VX0A 1O7DC 4UFJA 3KVLA 3CIXA 2P1FA 3R89A 2ISSA 2X16A 3G0XA 5CPLA 3LLFA 1CIUA 1SZFA 3KLLA 5DELA 1EB3A 4JY8A 1QHPA 1GVQA 1ICQA 3NQVA 2CLHA 1EP1A 1SFJA 2B0MA 4MYXA 4QISA 1EA0A 1FWRA 4YXGA 3BLIA 2QJIA 2GJRA 3FFSA 4O1DA 3DXIA 3GX9A 2NUYA 2CLIA 4JX5A 3GKFA 1JXJA 3W7QA 4GWEA 1KGWA 2E8YA 3OLIA 1TREA 4XTIA 1SO6A 2A4AA 2ZX9A 2FFCA 3D50A 5DFAA 1W3NA 3UG5A 1V3LA 5AN7A 2ZYFA 3LPOA 3W1MA 4JFSA 3KVKA 1H50A 1YPFA 5K2ZA 1OB0A 4GIAA 1DV7A 2W79A 2HTMA 1GYNA 4NJHA 1XUUA 1M6JA 1PAMA 1V5XA 1ZAHA 3C8FA 3W75A 1YPIA 5FF3A 1KFLA 5BMXA 2WPGA 4DF0A 1IF2A 1RP8A 1B2YA 2Z1BA 4KWWA 4MY9A 3SGZA 3KAOA 2V5LA 4O4VA 1MFVA 3KVJA 3G1FA 1RD5A 3M43A 4LVAA 3IIPA 4O16A 4O13A 4XUGA 5G2HA 3SZ8A 4AAJA 3STCA 1V3MA 2LLEA 2QUUA 1BWKA 1X1ZA 1QPKA 1XBXA 1WOAA 2UV8G 1FWTA 4M19A 5FEPA 2NZLA 4HNUA 1R2RA 1KXHA 1TQUA 3L4TA 1XGZA 3HGOA 3W88A 3U2OA 4JDBA 3UY7A 3W7EA 4UOQA 3EX3A 4ZMGA 5EL1A 4FLOA 3ZSTA 2X30A 2DIEA 1JULA 3W2LA 3W1TA 2GOUA 1SZEA 1QW9A 2J24A 4KMQA 4AWUA 2F18A 1HG3A 3PSWA 2AQWA 3CLWA 3OBKA 1W31A 1WPCA 1PEZA 1HO1A 1KBBA 1XH0A 2H8XA 1TTQA 1VLWA 3NQAA 5K9XA 4UTIA 3EXTA 2XN1A 3O6YX 2Y5EA 3KE0A 3W1NA 2ZRVA 2E5DA 3VE9A 2VNCA 3VO0A 1TTJA 1IZJA 5D03A 1M53A 3DFPA 2VEMA 1VFMA 2R14A 5CGQA 1CXIA 3LCWA 5HR7A 1CGUA 3DZ1A 2IGTA 4JIQA 4NJJA 5I3JA 4UFHA 3KX6A 3CZLA 5IBXA 4PH6A 1I4NA 2BHYA 1U2YA 1I2QA 3DKJA 4JYFA 2F84A 2VEPA 1JIBA 4XTDA 3W2NA 2BXZA 1UKSA 3VKJA 5DN1A 1G4TA 4UQEA 2BY3A 3W1UA 2CXGA 3GXTA 2ZUVA 1N8FA 6TAAA 1NSJA 1XSKA 1H7RA 4MPQA 3CWOX 1DHKA 1V3KA 1JJKA 5CXPA 3KFTA 4UTKA 3K8MA 1W56A 3QMRA 1TO3A 5D30A 1X6UA 4OIFA 1J0HA 4JDYA 4IUOA 5HQEA 2Y24A 3WK3A 3LCGA 1FWWA 2V2DA 4ZQCA 1JCXA 1IXPA 3BVWA 4LY8A 3B0PA 5AOUA 1P1XA 3A47A 4LVGA 4NNBA 2OJPA 2XFWA 2ZXQA 1UH2A 5FF2A 3VFLA 2ZZ2A 3CTTA 3NO5A 4O11A 4Y8FA 1VZWA 2YZRA 4C1KA 1F5ZA 2G96A 3V75A 2BY0A 2DJLA 3WJXA 3GDKA 3KLKA 2EPHA 1F76A 4ORIA 5D04C 1LM1A 2WOQA 3ZSSA 4K6AA 1KLZA 1AW5A 3M16A 4JYEA 3W38A 3IVTA 2CZFA 2GUUA 3CZGA 1V3JA 4N4PA 3W7PA 1YADA 4XKYA 4HIBA 4HOWA 1FDJA 3LI0A 3NQ2A 3P81A 4I7WA 3WJYA 3P80A 1QX1A 3OA3A 5TBOA 3P82A 1QMLA 3F1QA 1K8YA 1OF8A 3KL3A 4TIMA 4JCMA 3L2IA 3TSDA 1VQTA 2ZA1A 2G3NA 1MWOA 3H53A 4R7JA 3C52A 1QI4A 1IXNA 5HMSA 1H1ZA 2QV4A 4CVWA 5F1VA 2VRKA 1D9EA 3PBWA 5LZLA 3BUPA 5G4EA 1ME7A 1KGUA 5G1YA 2VFIA 2QPSA 4TMBA 4RLIA 5E93A 2VFFA 5KEZA 3LX9A 2J88A 3L0GA 2YPIA 5K9DA 1WX0A 4EF8A 3BUIA 1CXFA 3NQMA 3ZFHA 4W9TA 2C8NA 1FCUA 3EWWA 4JYDA 3EDEA 3ELFA 3MI2A 3ABSA 3QSTA 4MIMA 2C13A 1WE5A 1H60A 1W5QA 1OT1A 1N55A 4AIOA 4GFSA 3DENA 4L4MA 5CZTA 3BGJA 4KFNA 1TV5A 2CLEA 3TQVA 3LOTA 3PWAA 3NGJA 3MHGA 1HNYA 3H55A 4J3VA 1JCNA 2V82A 2HS6A 3NL2A 4OWGA 4AMXA 4W93A 1VCVA 4O50A 2ZX5A 1XBYA 3QEZA 4OHQA 1P5BA 2CFFA 3WEMA 4YLWA 2GUYA 2NWSA 4O53A 1D7FA 1PIGA 1S5VA 3BMVA 3CIWA 4RXGA 3UQNA 3IGSA 3TROA 3L4XA 2ZA3A 3IEBA 5HWMA 3DX1A 3GXNA 3WK2A 1CXEA 3DFNA 5E6YA 5D2VA 4R33A 3MW7A 2VEKA 4RZ6A 5K3VA 4JIPA 3CZNA 2QCNA 4UQ9A 3WN6A 2YXGA 3LHWA 3QC3A 1P6WA 2E5BA 1A53A 3HGSA 1BTMA 3TAOA 5LNVA 4PODA 2NX3A 2OX1A 3LHYA 1EO5A 1L9WA 4WUIA 5EYWA 1J2WA 1Z41A 4M6QA 4MZ8A 2WNNA 5AYXA 5G5IA 1IIHA 5AHLA 3INPA 1XV8A 3SSJA 1RV8A 3AXIA 3HJEA 2PRMA 3LERA 1C9DA 3PB2A 1XI3A 3E02A 3QW3A 4JR5A 5BNKA 2VKZG 2XWEA 4PCTA 4E2OA 2Y2WA 2RDWA 4MJZA 4O12A 5HJLA 3S1UA 4GQQA 1CDGA 1B9BA 3W1XA 3M7WA 2JKPA 3BAJA 2AGKA 2BXVA 2V5BA 5L6UA 1KV5A 1VLIA 1KM2A 3OVQA 3PBVA 2DU2A 3QZEA 3W7KA 1TQXA 4XQ6A 4A21A 1H1YA 1MW3A 4IMEA 2CLOA 4EIVA 1UD5A 1K8ZA 3PBUA 7TAAA 2V8ZA 5CZ0A 1T99A 5HULA 1G7UA 4O19A 4U31A 2JK2A 2X1SA 1TCMA 1ODUA 3U8GA 1QOQA 3NZRA 4DF2A 3NQFA 4DPQA 3UWWA 2WKJA 3QFEA 3QJAA 1U33A 4R34A 2TYSA 1KM5A 4JFUA 4CCCA 2PCQA 2YA1A 4XWUA 5C2XA 3EDJA 4DEFA 5KZEA 4UFKA 2VFHA 2D73A 1I2RA 3WY2A 5A2BA 3A4AA 1KA9F 3FOKA 1PV8A 4O1CA 4AHPA 4JTHA 4O14A 4OQVA 1TTPA 3WY1A 2H90A 3TFCA 3H54A 4OE7A 4OU1A 2QCMA 5D2WA 2P10A 4RR4A 3QPZA 2WCGA 4LVBA 4KFPA 1EUNA 4J27A 3MI3A 3GZ3A 3D4YA 2BY1A 4NZFA 4MLRA 3FAWA 3TTSA 3MP5A 3WFZA 4AEOA 3BAWA 3UEQA 4HT3A 4LUJA 4Q33A 4BI6A 3AO0A 1TPVA 1LOQA 3LCLA 2ZWZA 4BWLC 3GXIA 2X2HA 2OYKA 3ZT7A 3VNDA 3W07A 4ADSA 1CGVA 1QWNA 3S5ZA 1F73A 4AW7A 1HXKA 5F2GA 4UQDA 1E3XA 1IV8A 1M5WA 4JY9A 1U5JA 1YLVA 4LWWA 1TPFA 2WJZA 1XDMA 4AMWA 1Y0EA 1P4CA 5I3IA 1OFQA 3S42A 4UR8A 4LQ1A 3LRLA 2YYUA 2A2IA 3W86A 1JCLA 4DBEA 2D0GA 2DZPA 1T0OA 4CGTA 2I9EA 3W87A 3VSVA 3EKLA 4UTWC 3PVFA 1V7YA 1UB3A 5A5WA 5F1UA 5HWNA 2GQAA 7TIMA 3EWZA 1FCVA 4UMBA 3TMLA 2YA2A 3W85A 3GKAA 4NQ1A 3DFSA 2F7PA 3LGEA 4LS0A 3CU2A 3W7GA 3ABOA 2ALDA 3M41A 3B03A 3M07A 1OK4A 3KWXA 2DH3A 4RJEA 4S1FA 1AL7A 3TCEA 1L6YA 1M7XA 4O10A 4UFIA 1KB3A 1PCWA 4WY0F 1UD3A 5K7JA 2B7OA 3N19B 4UTHA 2QCCA 1OX4B 2FLIA 1OHLA 1AQMA 2A7NA 3WY3A 3ZQ9A 3IRDA 2DH2A 3E0IA 1E40A 1EP2A 3S2CA 4MY8A 3LCXA 1OABA 4PL2A 2CWNA 5KITA 3MP3A 2GJNA 3G24A 4IPJA 1HVXA 3W2UA 3TOPA 3T55A 1A50A 4FNUA 1LZOA 2V3EA 3CZSA 2GQ8A 5EKYA 1GTHA 3W74A 2J6XA 3BVXA 4GRSA 1F6KA 1K7XA 4N6EA 4M8UA 4M5PA 1KTBA 2YKKA 4Y90A 5SWUA 5A6MA 4UNKA 3TDFA 2EKCA 1C29A 1H7WA 5D02A 1EH9A 2DP3A 1YXDA 4RV8A 5I3KA 1G1YA 3VGEA 1HTYA 2VFEA 1A5SA 3RLVA 3HO8A 1H7XA 1TYGA 4O57A 1IXQA 2YIHA 3M5VA 1G94A 2C16A 2OYLA 3KL0A 2D2OA 3FJLA 5DCEA 4H8HA 3UZJA 1LROA 1G9HA 4MVAA 2YFOA 1ZAJA 1R2SA 4AHOA 5FF0A 3NA8A 2OCZA 2YR1A 4UQBA 3DFQA 1FQ0A 1XSJA 2ISVA 1TV7A 4RX0A 4EWND 2CZEA 1EIXA 4IX2A 5G1TA 1NAL1 4OGZA 2E9BA 1W5PA 4GNJA 5AYYA 3O15A 2VELA 2JKEA 3NQ8A 2WVSA 3GR7A 3BAXA 2VR5A 1JDDA 3LHZA 3MBFA 1OYBA 4Z1BA 1JUKA 4G1KA 4K36A 5AHEA 3A6OA 1VFOA 4H6KA 3QSRA 1FXQA 3MJYA 3MMTA 4WF7A 3FEMA 2FH8A 3T44A 1MFUA 2EGZA 1VCFA 4FB7A 1BVNP 2FTPA 3M0ZA 3HG4A 1FWNA 2Z2UA 2XWDA 5E1QA 1FX6A 3EJUA 2WVUA 1KM1A 1TQSA 3GIYA 5AHMA 1RP9A 3BSHA 1XDLA 2PURA 3B0UX 5D2TA 1B57A 3HPXA 4RCXA 1EPXA 4AF0B 5LGXA 1RQHA 3JS3A 3TV8A 5EPDA 2QCDA 3QMTA 1DTUA 3W1QA 1OSEA 4MAZA 3WK1A 4NJKA 3UWVA 5CLWA 3BUDA 1LLWA 3GVGA 4LRTA 1GT8A 1YTDA 8TIMA 5EY5A 1LYXA 3W7DA 4UZUA 3B06A 2DZUA 1GYLA 1W3TA 3LXAA 1E3ZA 1JAEA 4FX6M 2NSXA 5BRQA 1H7OA 1R46A 3IJ9A 3F4NA 2QDHA 1JRBA 2B7NA 2ZCGA 1HFBA 4UOZA 4TO8A 1JR1A 1JF5A 2GVYA 2Z0IA 4HN4A 1IXOA 1UUOA 1CGTA 4OBTA 2C6QA 4WD0A 3WNOA 2Z6IA 4B9YA 1J0IA 3GXMA 4Q32A 4DXVA 1BLIA 3A23A 4NXKA 3IIZA 3TC6A 1FXPA 3W70A 3SIZA 4ZVJA 4X22A 4ATWA 4E2DA 4FLSA 3SI9A 4IWWA 4DQWA 1CPUA 4LV4A 1VYPX 2FB2A 3TXZA 1UKTA 1JCMP 3N2XA 3FLUA 3NL3A 4JTIA 2H3DA 4LNYA 4GE8A 1GVIA 1Q4NX 2PRHA 3G18A 4AMAA 2PWDA 4CKQA 3ZS4A 1RQBA 4QQ3A 1PHWA 4IMFA 4CN4A 1FDYA 2NX1A 3LBMA 4RK8A 3QQ0A 2CLMA 4LS1A 4N6FA 1QNVA 3EWXA 2NUXA 5LNUA 3WNNA 3G1HA 5LKYA 1VPXA 2V30A 1ICPA 2ZZ4A 1AMKA 2WNWA 3PBYA 5KZDA 3SFKA 1ADOA 1UCWA 2ZUSA 1T96A 3G22A 5TD4A 3I65A 1TMHA 2WSQA 5CGTA 1JCYA 1Q6QA 3W37A 1D3CA 2BLEA 4K7YA 4MKNA 2TSYA 3LCFA 1W5NA 4FIRA 5A2AA 1VB9A 2OZ0A 2W6RA 2Q8ZA 3K8LA 2A85A 2QKFA 3K30A 5LSMA 3W23A 3GNNA 4ZQOA 3P62A 2JGYA 5BMWA 3EDDA 4FNQA 1ZALA 2C7FA 4IXHA 4UCFA 1H62A 1A5BA 1MXSA 3B0VC 2XVGA 1D3HA 3GR8A 1WBHA 3L67A 1ME9A 1KCKA 2WVVB 3HG3A 2AMGA 1RQEA 1B3OA 2FHCA 2ZQ0A 5DBTA 1JF6A 2Y6ZA 1K8XA 4UTUA 1DJQA 2Y7EA 1KFKA 2XIBA 3QYQA 3W71A 1W0MA 4GI9A 1S3HA 2R94A 1B0IA 4MJMA 3NR0A 1GG1A 4MLJA 1CGXA 3LM7A 3WJSA 3OG3A 3M1ZA 1LORA 4JTJA 2VC6A 4Y9AA 1DQWA 4JTSA 4PCFA 4AHQA 3EXRA 4WOZA 5KSWA 3VNZA 1GPWA 3LI1A 2OYMA 4BF9A 4WY0B 5D32A 2H8ZA 5K9CA 1KCLA 1EHAA 2BSLA 2Y7DA 3MUXA 4UNLA 4QSHA 3QM3A 4H2CA 2DJXA 3IIVA 4JICA 2CU0A 5I24A 4HHPA 2G5WA 3IGXA 3YPIA 3O05A 3PM6A 5D09A 5D2XA 2VFGA 1ZJAA 1EX5A 1KW1A 1TPB1 1XBVA 3JRKA 4EVZA 1W5MA 1VCGA 3MHUA 2J9ZA 3WMSA 1MW0A 1X8FA 3EDFA 1Q45A 2NLIA 1AVAA 3IK2A 4J7RA 1VJIA 2F61A 1FWSA 4XBSA 3BPWA 4YWIA 2E77A 2DZTA 4AYGA 1RR2A 3CQ0A 1GWJA 2QCFA 2F7OA 3GDTA 3E12A 4K8EA 1FUYA 4WOQA 4AEEA 3L21A 4C1LA 3BVUA 3WNKA 1RPKA 2OSYA 2AAMA 3GAKA 5FESA 1WYIA 4Z08A 2PWGA 3G1DA 1ZENA 2CZ5A 1PHQA 5CLTA 5FF7A 5CKSA 1R75A 3OIXA 3S5OA 2ZUTA 1KBIA 1SO4A 3C0JA 1TMQA 3N9SA 5AC6A 2FE0A 3VX1A 2Y4SA 3ABQA 4WXZA 4AWSA 2VOMA 4FX8A 1TQVA 3ZT5A 5HWJA 4P61A 1UD8A 4UZSA 3KL5A 1KBKA 2F7QA 1DVJA 1DJNA 1WV2A 4NX0A 5DY3A 5DXXA 1LRQA 3NPXA 2Q3RA 6ALDA 3TK7A 1ZJBA 1SR9A 4M6PA 1J4EA 3VGFA 4O8RA 2NV2A 2FPVA 3CT7A 1DBTA 2J25A 5DXYA 4LV9A 2Q8LA 1R47A 2V2HA 4NNCA 3LV5A 1W5OA 3NEVA 2XVKA 1HL2A 5DCDA 3O63A 2B7QA 3W3OA 3CTLA 1W37A 4I7VA 3RK8A 2JGQA 4LU0A 4GUFA 3UYCA 3UY8A 1A47A 4OV4A 4DF1A 4UMAA 2WSPA 3DAQA 4OJYA 3DHDA 3NDOA 1FBAA 4PEKA 4HP5A 3RIKA 3TR2A 2EAWA 3BH4A 3LCIA 3A22A 1I75A 2GPTA 2BX7A 1KGXA 4AXKA 4IQLA 3G8EA 4X3ZA 4HPXA 3EDKA 4QITA 1KBJA 1SW0A 5AB3A 1IZKA 4PEEA 1OFDA 3DI0A 1PCKA 1BVZA 2YCEA 1KTNA 3TAKA 3NM3A 5LNWA 3BGGA 4LXFA 2I1OA 5A8GA 3PG9A 5I5RA 4Q4KA 1XBZA 3O8AA 1LCOA 3OHIA 3VSUA 2BZNA 1VHCA 1HUVA 4D2JA 3LBCA 4O0KA 3BAKA 1TPDA 2G97A 3UD6A 1QAPA 4O15A 3PG8A 2E4TA 2ZICA 1THFD 1HT6A 1G6CA 1Y7VA 4U2YA 4FNTA 1NF7A 3L0KA 3HGJA 4HPJA 3G1SA 1TSIA 2E6AA 4JNMA 2ABBA 2X1RA 1KXTA 3L4YA 4AYSA 2E68A 4HNVA 1AK5A 3T4CA 3TSBA 3DU0A 3L4ZA 2EACA 3AMLA 3TMQA 1CW2A 3L9CA 2ABAA 4IOTA 1KM6A 4FLRA 1TPEA 3DKLA 3W84A 2Y62A 2QDGA 3G1AA 3GDRA 1A5AA 3M5YA 4NUWA 5DBUA 2ZZ3A 4U3CA 5U4NA 4A29A 3CZKA 4BK9A 3BVVA 3LV6A 2Y70A 3T7VA 2NXIA 3O07A 5F2MA 1D3GA 1YXCA 1SPQA 1PJ9A 4PSPA 4FLQA 1TCDA 2XN2A 1CXKA 3P61A 1UBSA 4QAIA 5AHNA 1TQTA 1ZJIA 4AEFA 4CCEA 3NPVA 4JTUA 1DL3A 1J5TA 1X1OA 5CPMA 1OFAA 2PWEA 2A7PA 3TQ0A 5U7SA 3CEUA 2G95A 4Z0JA 1OX6A 1JD9A 1LWHA 4Z1DA 2D0FA 3W72A 2RH9A 3G3DA 4NT0A 5FEXA 4LS2A 3GTNA 1UKQA 3LTPA 3HJZA 1XM3A 2EO7A 2ATSA 1W54A 1Z48A 1R33A 3A9IA 3STEA 3BW2A 4ZQNA 3PY2A 1TPWA 1A5CA 3EWUA 4I7UA 4UFMA 3VU2A 3W2JA 4NI3A 1J0KA 3C2RA 3DH7A 3PS7A 4JEQA 1SQ7A 4JTEA 2GQ9A 4FXSA 1BEUA 4J3WA 3QQ1A 1O94A 2V3FA 4CQ8A 4H8UA 1WZLA 3TKFA 2TPSA 3LLDA 1UASA 3GDLA 5J5RA 4QM1A 4H8VA 4MFDA 1ZHAA 5DY2A 4HKPA 3WNMA 5E0KA 3UWYA 3VGDA 3NL6A 1KFEA 4YMZA 3NZ1A 2QPUA 4M56A 4JFWA 3EXSA 4UCGA 4IX0A 3P67A 1TJPA 2WKLA 2QMJA 4X2RA 1MVYA 3W6YA 1I2OA 5C54A 4NZJA 3W2KA 1G4PA 3S1XA 3VGBA 3OEXA 3N9RA 1ONRA 5CZSA 3VMOA 3GK0A 5KMYA 5E70A 1GEQA 1MSSA 1HO4A 3RMJA 4O28A 2ZIDA 4TX9A 4A2SA 5LNRA 1S5TA 2A6LA 4K7VA 4XB3A 4UC5A 4ZZ9A 2YA0A 2NT1A 1OFRA 2BWGA 3GAYA 2X2JA 2NXHA 3CB8A 4ORMA 3W76A 3P5ZA 1VYSX 1DQXA 5EMYA 3FYPA 3BCFA 2ZZ1A 1EWDA 1KFBA 5F4SA 5F4WA 3OVPA 1JRCA 2WANA 4NVTA 1M7OA 3BCDA 1GG0A 4Z0SA 1Z32X 4HPHA 4PA8A 3TTYA 3W7JA 4LW7A 4LC8A 4JTLA 4MZ1A 3A21A 9CGTA 2E0PA 1HTIA 4LTSA 3L2MA 3UCQA 5HDRA 4O1BA 4UTTC 2YOCA 1I2PA 1GVRA 4YCOA 1Q6LA 3LXBA 3BC9A 3TIMA 5BRPA 2CPUA 4CCDA 5K4ZA 3MBDA 2BXYA 3M5ZA 2ZUUA 1LTDA 1SU5A 1SZGA 5T26A 2ATMA 1G4EA 2E1DA 3I7QA 2Y7GA 3KRSA 3O6CA 3PUEA 3ZR4A 1W1ZA 3LB0A 3SGUA 2A21A 2RDUA 3HMJG 1H51A 1UOKA 1UJPA 1NM9A 1UD6A 1HL8A 3FYOA 1OFOA 3FA5A 3I7RA 1TPH1 3WELA 4MY1A 3BAIA 1XH2A 1CLVA 2YJQA 2QEZA 3L4WA 4BI5A 3ZOAA 1LWJA 2BTMA 3ABRA 1YTKA 2BHZA 2AAAA 2TAAA 3R5EA 1GJWA 1Q3NA 5FF4A 1H61A 4UFLA 3BK0A 4LC6A 3PUDA 1RVGA 4PSRA 3UWZA 4RKAA 3ZWSA 2C18A 3BUBA 3M5XA 4RZ5A 5E9AA 2FH6A 4DO6A 1BPLB 5CZJA 3GDMA 5IBXC 2RFGA 3SR7A 2FYVA 3N2MA 3WJWA 2EF9A 6CGTA 1RZMA 2DZSA 1OGSA 5H91A 2YYTA 4CNOA 5A2CA 4MZYA 4ALDA 1F05A 1NFBA 3O6DA 4UTJA 4AH7A 3P84A 2Y61A 5LNSA 3L2LA 4JD4A 1BF2A 1UD2A 3CGTA 3CWNA 4QJ1A 1MXGA 5BRBA 2ZX6A 1BG9A 1TPC1 4H7VA 1QOPA 3S1WA 5DCBA 3BG9A 4IGHA 3ZR5A 4CNPA 4GO9A 1HWWA 2FHBA 2QR6A 3IV3A 2ZZ6A 1MZHA 3EJTA 1QO5A 4WZHA 1ZAIA 1SSGA 4HSOA 3EX6A 4Y6GA 2ZFAA 5CSRA 3NG3A 5HPOA 3MI6A 1LOLA 3D51A 3C61A 2H6RA 4LVDA 4UUIA 3M6YA 1F7BA 4PTNA 2RDTA 3STFA 3BVTA 2WO5A 4FO4A 1VH7A 3I68A 1PIFA 1XSIA 2H3BA 4GBUA 1CGWA 3I6RA 1QDSA 2PWFA 4YCPA 4DO5A 2O7SA 3EJRA 4HA1A 1VJSA 3PUOA 3TONA 3WDHA 1JDCA 1JI1A 4X0NA 3P5YA 1NEYA 1XXXA 1XD0A 1TRIA 4ZL1A 3BG3A 5D05A 4J3XA 1UH4A 2Y63A 3N73A 2C15A 3HIJA 2QJGA 1U30A 2XVLA 3A24A 3GYEA 3RILA 2EABA 3EX4A 2ZXBA 1F6PA 2FB3A 2O7QA 1WBJA 3S0CA 1WO2A 4DO4A 1JG9A 4A2RA 1B4KA 4DPPA 1BSIA 1WA3A 1SUXA 3G8RA 3NQCA 1JUEA 4JL1A 1TB3A 3LDVA 4X9YA 4MYAA 1EEPA 1FCQA 2JBMA 4WLCA 3BLEA 2ZRWA 4UIOA 3L4VA 5IM51 4OV9A 3IJ7A 2QAPA 4CN1A 3VE7A 4HOZA 1RPXA 3AMKA 2DORA 3TFXA 3OLDA 2F1BA 1VC4A 3FJ6A 4IXXA 1OX4A 3R12A 4B5NA 2ZDRA 4O54A 1XFBA 2CLFA 1WZAA 3NVTA 1QFEA 1FCBA 2F7FA 2GVJA 1KXQA 3UZ5A 3W7LA 4GJ1A 3TW7A 1OFBA 1OJXA 1LDCA 3CPRA 4GUHA 1YDOA 4FEZA 4WX2A 4XZ9A 5LGZA 3EEGA 1PPIA 2F2HA 4O52A 3B05A 4BZYA 1ME8A 3N14A 1CI1A 4DBDA 1Q6OA 3C2VA 3W1AA 1M7PA 3ATZA 2WV8A 2A6NA 1CXLA 3LHVA 3NXFA 3M44A 1MXDA 1VYRA 2C1HA 5H2ZA 1MEIA 1KWKA 5AC8A 4LUIA 4GUGA 2WQPA 2ZTJA 4AB4A 2DZVA 4CQ9A 4BWLA 3BLPX 1UD4A 4CNNA 4TU1A 3U6WA 4J3SA 1OF6A 1LBFA 1TV8A 1VS1A 3NPUA 3ANYA 3NM1A 4FF7A 4N9BA 4O18A 3USBA 5CPOA 4WQ6A 1JCJA 2ZX8A 2FQIA 2ZBTA 3C6CA 3W7HA 3BUQA 4JFTA 1EA9C 3DX2A 3D0CA 1GJUA 1PS3A 5CGMA 3N34A 4B9ZA 1LBLA 3HG2A 2F1AA 1JGIA 3WFAA 5I3GA 4JXCA 1L6SA 4L4LA 1JQXA 4FIQA 4XKYB 3T78A 3E49A 3QPYA 3V1PA 4UTTA 4UTWA 3MP4A 2WSRA 1WXJA 1KM0A 2DZWA 2VENA 3C2FA 3QH2A 5AHIA 3CM4A 4O4WA 1VR6A 5C5YA 2ZTKA 3W1RA 1PZ3A 1AL8A 1ZNNA 4TVUA 1KM3A 5EBUA 1ZFJA 2C19A 4WJEA 4MOZA 1AQHA 2GJPA 3L68A 3NQGA 5AFDA 2HMCA 3VSTA 3R13A 4NJGA 1KM4A 4J3UA 2E09A 1QR7A 2BY2A 1FDZA 1PL9A 4N9CA 4CLMA 2FPTA 4QIUA 1G5AA 1OG0A 2V2CA 2Z6JA 3NQ6A 1B4EA 4JL2A 4UQCA 3HB9A 5MHBA 1W8SA 2ZUWA 2ZRYA 2V3DA 5HUPA 3FAXA 2ALWA 2NV1A 3RLUA 3RU6A 2X1UA 3HPSA 2HS8A 2P0OA 3A5VA 3G0SA 4KWVA 2PC4A 4X9SA 4AF0A 3VM5A 1CX9A 2C3ZA 3IIOA 4J9JA 1YXYA 2FIQA 1XCFA 3UXAA 3W2MA 3CEPA 4ZQMA 3TNOA 1K03A 2E5CA 4UTLA 1HX0A 4IMGA 4BI7A 3EWYA 2EJ1A 1KFJA 3P74A 3UPWA 1TIMA 2QCHA 4U28A 3PC0A 3UPBA 2OSWA 4JFVA 2RKXA 1BKSA 4HOXA 3VNYA 1I45A 2QCEA 3L4UA 4YL2A 3DDFA 2C14A 3EJPA 2OSXA 3EJQA 1GZGA 1L6WA 2NXGA 3SW6A 5AHFA 4CQAA 2ZRXA 1F74A 1H5YA 5CSSA 3GLCA 1KXVA 3WDIA 2NT0A 1MW1A 5FEZA 3S9YA 1R34A 1PZ2A 4WXYA 3A5FA 2NX9A 4FNSA 1XC4A 5FI8A 4JTKA 2TRSA 1S46A 3GXPA 5LHFA 2ZXAA 1K7EA 3MWAA 4LT9A 3EX1A 5AYZA 4POCA 2G3MA 2ZE0A 1VHNA 3SY5A 1H3GA 4GUJA 2CHNA 3WY4A 3F03K 4LOCA 3OLEA 1TRDA 2BHUA 2QJHA 4ZQPA 2PWHA 5E0FA 3VGGA 3CPUA 1GQNA 4NJIA 2ZRZA 1P0NA 4KWUA 3TSMA 3VCRA 3RFAA 2I14A 4IMCA 3P8IA 1K3UA 3UXDA 3D52A 1QPNA 3LTSA 2VUYA 3B8DA 1TTIA 3UNDA 3PR2A 3DI1A 1LBMA 2EADA 1O5XA 1EUAA 1TQJA 1IIGA 4GXMA 5KINA 1BAGA 1KFCA 3AJ7A 3PF3A 5F2LA 4TR9A 4EOUA 5EA9A 4J3TA 1OFPA 1ZY9A 2VFDA 3TC7A 3F4WA 5HNRA 2EEXA 3WNLA 2CLLA 2GVGA 3W1LA 1SSDA 1L2UA 3WDJA 4U4MA 1BWLA 3B4UA 5ABTA 2X2IA 4NXSA 4JTFA 1LP6A 3M47A 2JKAA 1VIWA 3C2EA 3VMPA 3K1DA 8CGTA 1K7FA 2WVVA 1GCYA 1QI5A 1P0KA 3BO9A 3PAJA 4N9EA 2HSAA 1MO0A 2D0HA 4O1AA 3W7CA 3PB0A 3HZ3A 3CLMA 1E43A 1OX5A 1C8QA 4O17A 1EO7A 4UMCA 4LVFA 1SW3A 2OMAA 4QNWA 2OT1A 3QF0A 3O16A 3BLFA 3C3NA 3OVRA 3G1YA 3W7MA 3KRUA 3BARA 1AG1O 1AMYA 3DDGA 2EQDA 4WSKA 1GJPA 3UWUA 2YX0A 1H7NA 3THAA 4AWTA 3LRKA 5EMUA 1C8VA 4S2CA 1VAHA 2WSKA 3FIGA 1XCXA 1SO3A 4N02A 5I23A 1LRTA 4WY0A 4DELA 3LPPA 4IJBA 1R30A 4MFEA 3NPWA 3PULA 3HPZA 2XIIA 3MYPA 3G1XA 1X7FA 5L9FA 3ZT6A 1VGAA 3OLGA 1N7KA 2YFNA 3VM7A 1CGYA 4JN6A 3CV5A 3NOEA 3AXHA 4U2ZA 3SJ3A 3W1PA 3Q2DA 2XN0A 3BW3A 1U83A 3DHPA 1O4UA 2E6FA 1AW2A 2ISWA 4R53A 3UG4A 3W7NA 2ZRUA 3BG5A 2Q3OA 1PS9A 2QUVA 1EWEA 3O1NA 4FXRA 3GXFA 4U33A 3IVSA 1JXKA 1GVFA 1UUMA 5K4XA 2X2GA 3GBDA 3TA6A 4A3UA 4FMVA 2ZZ7A 1JQVA 3NQEA 3KXQA 4E38A 4JX4A 1WZKA 4PL1A 1XD1A 3T40A 2NUWA 2OW6A 3S6DA 4NU7A 2Z1KA 2QCGA 5DLCA 2WKGA 4GQRA 5HXMA 4BR1A 3II1A 5HUOA 1T8XA 3C56A 3UWQA 4UR7A 1QWGA 2VEIA 3WENA 4NX5A 3N3MA 3WNPA 5CG7A 2J27A 2QCLA 2YW4A 3HOJA 3KVMA 1OVDA 2B7PA 5F2IA 1WAUA 3Q94A 3MYOA 3CHVA 1OK6A 1H63A 4OKDA 1WDWA 3BV4A 3S5NA 2WCSA 3R2GA 3FKRA 1KLYA 1I8JA 2E8ZA 2J9XA 4GO8A 1LOSA 2J9YA 1KTCA 3W83A 2VT0A 3W9ZA 1O95A 2V81A 3P60A 3W7IA 1EP3A 4CN6A 2E6DA 5D33A 4RZ4A 4BFAA 2QAFA 2YSWA 1TJRA 4K39A 4AIEA 4PCSA 2R8WA 3EB2A 1YTEA 4GKLA 3IJ8A 5F4XA 3TJLA 5GVJA 3WJZA 1KV8A 4M7SA 1QO2A 1JD7A 2EAEA 2GJLA 3CC1A 7CGTA 3FS2A 1CYGA 5A6LA 1WOBA 3IVUA 3GNDA 1DHPA 3D4ZA 3LHTA 5G2IA 4QAWA 4J28A 3VMNA 3L0NA 1KWGA 2D3LA 3S5YA 1R2TA 1YYAA 3G1VA 2ZA2A 3GB6A 3DBPA 3RF9A 2FHFA 2ZXDA 1ALDA 3BMWA 5I3HA 3L66A 2QLYA 1XCWA 3G3MA 4MUZA 5D2YA 1JVNA 1XUZA 3UERA 1F2JA 3TE9A 3L65A 4LPCA 4ZQRA 3DX0A 4ONVA 5I0DA 1GOXA 2A5HA 3G0UA 3K8KA 1QPOA 4ML9A 1QI3A 4H4IA 3S8HA 1G67A 3NAVA 4GUIA 3DX3A 2WNZA 3BW4A 3E9AA 2E6YA 3HF3A 3IGUA 4A22A 3SECA 1FY6A 1Z42A 4ADUA 5C6MA 1UA7A 2TMDA 3DHUA 4FNRA 1AW1A 1QW8A 3DC0A 3NQDA 3ECQA 4I9AA 3TW6A 1XL9A 4UTMA 1NOFA 1K02A 3LHUA 4N4QA 4N2YA 2D3NA 1LRNA 4HNTA 4E2BA 3P7YA 1Z44A 5KZMA 5BW6A 4HNNA 3THQA 3WK0A 4IPIA 3AJXA 4M6VA 1SO5A 5G4WA 3LXCA 4KFOA 2YDAA 3W7RA 4S2BA 3NNTA 4O0ZA 3FW6A 5DO8A 2FJKA 1J0JA 1QWUA 3BVJA 1ICSA 3L5LA 5J5DA 1PVNA 2QF7A 2YW3A 3C4UA 3GXDA 4P2VA 3DGRA 2FPYA 4JTGA 2VRQA 2OT0A 3NL5A 5CPNA 3NYZA 4UXDA 2NWRA 4K38A 3TUUA 2QCDB 4E0CA 1O5KA 3MO7A 4K37A 5BOOA 2CZDA 3M9YA 4GI8A 1GTEA 1PIIA 5F7UA 3RNDA 1QCWA 4FHAA 3R8RA 1G7VA 1OYAA 5C55A 1G69A 5TIMA 1Q6RA 2W0UA 2CLKA 4FNPA 2PE4A 1UA3A 3NQ7A 3DFOA 1JL8A 1TQWA 3EWBX 3JR2A 2V9DA 3C2OA 1DEDA 3E96A 3S1VA 1SW7A 1VRDA 4ADTA 3W7OA 4OT7A 4WSJA 2QUTA 3ZWTA 3QW4B 4Y96A 3EJSA 3FKKA 2A0NA 3STGA 3TXVA 3W73A 1YDVA 1SFLA 3B04A 4RXFA 2KZHA 4PFMA 4H3DA 1PE1A 1OFEA 3BLBA 4XBKA 1QHOA 4ICNA 1SMAA 1W3IA 2A1YA 1LLZA 3BSGA 1UH3A 3KEHA 2PRLA 2Y89A 3TQKA 3L5AA 1W9XA 3ZR6A 1G4SA 1DKWA 2WPBA 3ATYA 3DX4A 3KHJA 4N9DA 4AVFA 4M7TA 4JS3A 1H7PA 3Q58A 2WSYA 3W22A 1ML1A 3TJXA 2ZWYA 1SZNA 4FX7A 3VGHA 1JI2A 3LCHA 1TPUA 4GC4A 3I7SA 4HSNA 2F7RA 3UG3A 2EHHA 1MEHA 5I3FA 1MEWA 2V0TA 5D37A 2CW6A
chains in the Genus database with same CATH superfamily
4GI6A 1XF3A 4R97B 4WFFE 3F83A 3P8JA 4LSUL 3UL4A 4BM7A 4PWFA 4YOKA 4RCAA 4ONHA 3C8KA 3VRLE 5IJCC 3DGGB 3WEOA 3TU9A 4IEFA 1UM5L 5C2CA 2NY6B 1W1PA 4F7EB 3ZTCC 1M04A 2G50A 2BP8A 1H3TA 2COVD 4U0RC 1CG9B 5DFWH 4B9GA 3MUIA 3V0FA 4LAQH 4ZMLA 3HGRA 1JDAA 2EE3A 1UXWA 2P8MB 3WIJA 5EC2B 2Y2YA 4WWOA 2VRAA 4V11A 3QIWD 5FEWA 4WEMB 2ZZ5A 1OYCA 5F7BA 3C5ZB 3DFTA 1HH9B 1A5OC 3D39E 4AEIL 5HINA 5JNYB 3Q37A 3QGVA 3WO4C 1DP0A 3KEDA 3T3MF 3NGFA 1XH3B 5CPLA 3EHBB 4Y5YA 2CG9X 4GVIA 5E2VH 3FU0A 3T4AC 2FBOJ 3VFRA 4NKCA 3F5JA 4HF5H 3FFCE 4LIQH 2Z31B 1GGBH 3S37L 4WW1A 1GMIA 1TREA 4EJ1C 1KGYE 3KW7A 5D7LA 3C6LC 4HXAL 5HPMA 2YB1A 4C6LA 3W1MA 4MTMA 3KVKA 1REQA 1GZHC 4JPVL 2VCBA 5FF3A 4PW4A 3REQA 2HVKB 5E9DD 4S0SD 3CMOH 3MJ8B 4NENB 3R79A 2YGOA 3O6FB 1NBYA 2JKTM 4JFXA 3MLVH 1WOAA 4X42A 3VW3H 3F00A 3BKYH 2J8UB 3K4AA 4ZB2A 5CLYA 2IALB 4NRXA 5FCSH 2X30A 1NMCC 1N8OE 1A6ZB 2WSDA 3OBKA 4F20A 3EXTA 4NSKB 3V0AC 4ODXA 1T80A 1T1YB 2X9WA 3VO0A 4I3RL 3EZJB 3AGVA 4WK4B 2IGTA 1GKRA 4K5LA 4QUOA 3LY6A 1NINA 1PNDA 1ZE3C 1I2QA 3TWYA 1JJUA 5KBNC 1U3HC 5IB5A 3WD4A 2WLYA 3CWHA 4AQAB 2IKHA 3HJ0A 1JPSL 3A4XA 1H7RA 3IETA 2MIZA 3QJXA 1DHKA 5CXPA 1A22B 1KB5A 3GMQA 5JHDB 4JDYA 4L2YA 1T7ZA 5ESAA 5DHVB 5HQEA 4Z7WA 3AG4B 1IGCH 4NHUA 1AGEA 3OW1A 2MPVA 3W0WA 4GNKB 4QXGH 4NC1C 1R3VA 3CFDA 1ANUA 4LLVB 3APDA 4ONFL 5AZEH 1F5ZA 3GHPA 1UP3A 4OCLC 4BD4A 1LM1A 1KTDA 2K6YA 5HDOA 2REQA 4G7EA 1V3JA 3BT2L 5DWPA 3GT6A 4DJFA 2G5RA 3ZIZA 1ZLUH 1GOOA 2LLGA 1VQTA 3SYCA 4TVSa 3X3GL 3DSFH 2CA4A 1KGUA 3CH1B 1FL3A 3QI9D 4QRSB 2VFIA 1XIHA 2WCAA 2VWTA 3M0KA 3SJVB 4N2CA 3ZFHA 1OZUA 4MIMA 3DV6B 3WBWA 1E6OH 3WFBL 4GFSA 4I18A 4JTDA 1U8PA 5DSCB 5MP6H 5K9KA 1R86A 4H9XA 4MZ3A 1ZHKA 1HNYA 4J3VA 1JCNA 2EZ0D 1K3ZA 1SXSA 5A2LH 4M62H 3WQPA 2Y36L 4GRLC 3BMVA 4AD2A 3WK2A 5BS0A 1F86A 1D8WA 1PYMA 2NY4C 4KJWC 2D69A 3SD2A 4WKFA 3MUUA 4MZ8A 3EZ4A 5G5IA 4V1XA 2VR4A 3Q4DA 2VJXA 4RRPM 2GEQA 2UZ9A 3SO7A 4N42A 3BP4A 2Q3ZA 3E0GA 15C8H 1WQVT 4XQ6A 2VLRA 3QZ6A 5C86A 2NQ3A 3PBUA 5SWQA 5C0JB 3U2JA 4JAMB 5BVPH 2X1SA 1QOQA 4JHWH 1ZQ5A 3HC3L 2WZPD 4JFYA 2PCQA 3RJOA 2AHIA 1AQ0A 3OKLB 3SDYL 4PRBB 4JTHA 3RL1A 1EJXC 5JORA 3S5LA 3H23A 1XCQB 2PR4L 2K7PA 1P4BL 1AQKH 3O0LA 2XXMB 2ESVD 3FTZA 5ACZA 3S4TA 2R1WA 4Y7MA 1G7LA 3BAWA 4HT3A 1FNSL 3PY9A 4UR9A 4A6YL 3RNKB 4JZNA 2X2HA 5F6IB 3KYKL 4RFEA 1E5CA 4R97C 5BOFA 4LWWA 4C1NB 3UYRH 5IHUL 4Z2JA 4FEIA 1MCHA 1S7XB 2Z28A 4AM0A 2NY6C 4PQXA 5FKAB 4CGTA 2VDKH 1J6PA 4ZRGA 5DD0H 5F71A 2ZXGA 5F1UA 3IMBA 1GZJA 1N7ML 4D0BB 3BFOA 1EF3A 5HYSA 4AITA 3VXRD 1LE9A 3OKEB 1UZ6E 1LQSR 1DE4A 2J8OA 1NKRA 3MCMA 5LIKX 4WHTA 1I1FB 5IWLC 2NTFA 2ZCKH 4JG0H 3E0IA 2OMNA 1G9EA 4PL2A 3AG3B 3TOPA 2A77L 1FCGA 4X6CA 2WGXA 1IVLA 1WXZA 1A4JB 1U58B 3PLYA 4OI7A 1YXDA 1RUSA 4EIUA 5JO5A 3NMEA 4RV8A 3EHBC 2ZZUT 1ZWIA 2VLKD 3IDMA 4NNXA 5SWSA 4JDEA 1GAFH 4UNTA 3M5VA 1QBLH 2V38A 3CZFA 2V0AA 5E0QA 1S7QB 2VN5A 3VTRA 4BFIB 2YFOA 3S1GA 2Z31C 1QK2A 5H1WA 4LSPH 1O6TA 4UQBA 1TV7A 4DH2A 2CKRA 4N8VB 1W5PA 1IBGH 5AYIA 3UETA 4XZLX 1JDDA 2OSLB 3EFFB 4GUQA 1MJJA 3ISRA 1WUEA 3FEMA 3O6FC 1BVNP 1XF5A 3VINA 1UYWL 3FF7A 4E36A 4DP5X 1FX6A 3PJSB 1AO7B 3CDFA 3HPXA 1M2OA 5GGRY 1QUPA 3LQMA 5I8CB 3H42L 2VL5B 5CBEB 3RAJL 1OSEA 3ZDXB 1LLWA 1BECA 4LU5H 4UZUA 5EU6D 1PCSA 3QHTC 5E2TL 2F74A 2RD0A 4B9YA 4YHEA 4IUGA 4AVOA 1Q0YL 1AMXA 3ITLA 3TC6A 1T5AA 3SIZA 3NURA 4LEOB 5I03A 5KSAA 2ZF9A 1EHXA 2B59B 2ACUA 4PGDB 1Q4NX 1D5IH 5KUMA 1R3IH 4CKQA 4KPHL 1IQDB 4F80A 3LRSA 2APBA 3G5EA 1QNVA 3RDTB 1NDVA 4F8PA 1AD0A 1A6AA 3OQ8A 1ZRQA 2WSQA 1ZMYA 3FO2B 4U6YA 2SODB 2X41A 1E42A 2J20A 2EEAA 4YNYA 4TVDA 5FCUL 3O4LE 2CWRA 2I32A 4BUGA 3EJCA 2V5SA 3BAEL 4IXHA 2XVGA 3GR8A 4Z2GA 1A1OA 4FHKA 3PV7A 3RKPA 1AD9A 2LLNA 4OLUL 1DCLA 3HA0A 5I6SA 3MO4A 4ERIA 1S3HA 5ESQA 3CBKB 3SBWC 2XGIA 3OG3A 1MNNA 4DWSC 2VC6A 5AVYB 1DQWA 4WOZA 3SO3B 3NCYP 2Y5JA 3QQDA 1U8MB 4QOKE 3DUSB 3BZGA 1QSED 4KKCD 1BP3B 1ZJAA 1SJBA 5I28A 2HT2D 4PGBB 4QGCA 3MGTB 5M2FX 1KJ3L 4N9GB 2V6HA 1QEWA 4KKAD 2Q71A 3FK4A 3L3DA 2DS4A 2Q6ZA 3X3FH 3SQMA 3BCJA 3WNKA 3Q13A 4CD5A 1GCFA 5FF7A 1NUNB 1WG3A 1Q0XH 4OD2A 5IBTH 1LO0L 3QNYA 4WFHE 5GRUH 3CXDH 1HNGA 3ZT5A 4PJHF 3FU7B 1ZTMA 3CO4A 4HPOL 3GS4A 2EDKA 1J5HA 3RKDD 1YX1A 2YPLD 2XU2A 3OSVA 2V2HA 3U0TB 2DBLH 4NNCA 1E9PB 1W5OA 4PV8B 3DGDA 3G5ZA 2FATL 2WMIA 5C92A 1RZFL 1V7AA 2IQ9H 2CUAA 5BZAA 1X4XA 3AIVA 2H9GB 4BUQA 2ENYA 2PCPB 2HG5A 1FYHB 3U9PL 2OX5A 4HPXA 5MEND 1PYFA 2E6JA 2GTWA 4XC1L 1YPXA 5GZOA 1ADDA 5C7ZA 3RGTA 4LEXL 3HV8A 1WLHA 5JIMA 4ZI8A 5DS8B 2I1OA 4JJ5B 3GSOA 5IHBA 2QT6A 5I5RA 1G43A 3HS0B 1CZ8H 3NCEB 3MV9D 5EIIB 4CSPA 4CNSA 2E4TA 4AM0Q 2EDRA 2X6CA 4BQ5A 5FFGA 4B3EA 2GJ6A 2WJDA 1A80A 2VZOA 5E09A 4IBSA 3UP8A 4B2DA 5C2UB 2QDGA 1BFVL 1YNLH 2ATKA 1AZCA 2Z4TA 1LL4A 4HWZA 1OAQL 2H1PL 4PSPA 2VI0A 5ADPH 4AEFA 5EZIL 3QBUA 3DXAD 1XJBA 1W72B 3V4BA 4PRHA 2XINA 3WLNA 5T9CE 4R9HA 5JHLA 4IOFD 1OQXA 2PUZA 3LTPA 2XBZA 3KR3L 1UVQA 3T0EE 1A5CA 4JO5A 1PXGA 3RJXA 4WFGD 3SQRA 1QYGL 3OKYA 3EF7A 2EH8H 3ARQA 4MA8L 1BMGA 3Q8EA 3H9SA 3V0TA 1WT5A 3F2LA 2X0HA 3FBKA 4DI8A 5CD3B 3FGCA 1N8ZA 2OMWB 2AEIT 1HO4A 1OK8A 4TX9A 1KFGA 3QDAA 4EI6B 4OZIF 3U1SL 1X7QA 4JHZA 3P0VL 5C7XH 3V0HA 2HMID 4NVTA 4UQ3B 5BO0D 4PA8A 4TSBL 3WIFA 1Y0LA 1HTIA 5FM5O 4UTTC 3M45A 3U9IA 4AGNA 3GMOA 2FZ8A 3QDGB 3LPFA 3D39D 3VFOA 1BXBA 2XKSA 1G4RA 3VVVA 3PUEA 3ZR4A 1W1ZA 4DX3A 1ZA6A 1VPOL 4WGXA 2HTKD 1YEJL 3L3OB 3ENEA 4Y9NA 3FFCD 1QRNA 5E8PA 1TJIL 4R2GC 1JEZA 4ZS7L 1G0YR 4PSRA 1HEHC 1HHGB 3HPFA 1HJVA 2RFGA 4W4OC 1UWTA 1OGSA 5DYFA 2WBJA 4BINA 2YYTA 4KRTA 4FJYA 4NHVA 4FCHA 1YUHB 1Z69A 1FO0A 3S3SA 4JTRA 4LHUG 2DUAA 1CTNA 3BOXA 2CO6A 4ZFFB 2BVQA 4LVDA 3M6YA 3P2VA 2FT7A 3TN0A 2ICEB 3RDTC 3PUOA 3TONA 2FX8L 1DEEA 2J7FA 1MG3C 3JZ7A 1Y8BA 1A6UL 4OI8A 3L3GA 3AB0C 3HIJA 4GKSA 2GGEA 1ISZA 2VDRH 1TZAA 1RZKC 3IK4A 3QWOB 1JG9A 4UBDC 3NIGB 1LP9B 2J72A 4LALA 4WLCA 1SBBA 2QAPA 3UYPB 4XVSL 4WHBA 2J7DA 2CIKA 4QLJA 3FJ6A 1JRHI 4Q4EA 5IB1A 2MHAA 5DHYB 3E3QC 1WZAA 3TA3A 3PZTA 2UZYA 1SJEB 3T3ME 3SO3C 4WX2A 4FEZA 5LGZA 1MRCL 3BZFB 2VUKA 3QDMA 4U1SB 2FGLA 1KQYA 4LPVA 2OKMA 4M3PA 3M44A 5LKNA 2X6MA 2DPEA 4IP5A 4FN0A 4LUIA 1IBZA 4ZXLA 3ESOA 5KVEE 4I9MA 5G5DB 4EN3D 4F91B 3NPUA 3NM1A 4HSCX 4DW2L 2ADJB 4Y5VA 4X83A 2O6DA 3MKCA 4NQCD 4BQ8A 5CGMA 3ZKMD 2EDOA 3V0WL 1FWJC 1B9KA 5FECA 2JK5A 1A7NH 4UTWA 4YHIA 5CEXA 4HUWA 4PMRA 4MNQB 3V6ZA 3W1RA 1ZNNA 3JTTB 1AQHA 3VIFA 3EBAA 3VSTA 1SM3L 1MMFA 1JNLL 5J1AB 4N9CA 4C4BA 3GS0A 3Q5YA 1V8EA 1J18A 1Z5YD 3L3IB 4EUPA 3BZEA 1TU2B 3HPSA 2HS8A 3A5VA 3THML 2PC4A 3JWOL 1Q1JH 4Q8BA 5BMFL 1AS6A 1UC4A 2R9RA 2GLKA 4PTUA 4FQIH 4P57B 1JK9A 5C0EA 2X89D 2RKXA 1VFAB 1OCOB 1IGWA 3FQ4A 2QCEA 3INUH 3T8XA 5E08H 3VXSB 1H5YA 3NCCB 3WDIA 2NW2A 1KJMB 1MW1A 5IW1A 3S9YA 1D7DA 3P9MA 1M05A 4NQDE 4Y9FA 3GXPA 2XZQH 5CEZL 3UTQA 3BH8A 4GUJA 2CHNA 3F03K 2BHUA 3ARPA 4KVCL 1G6RB 2R23B 3VCRA 3BLDA 4KWUA 2CGZA 4PRDA 3CX5J 5J9PA 1VPQA 3QYNA 2XUWA 1TTIA 1U91A 5CIPA 3PR2A 4O58L 3LS5L 2ZUYA 4N3UA 2BMKB 4HTYA 3L12A 4G8IB 3LS9A 1R9FA 5A8PA 5F6HI 2XZCL 1SSDA 1KKRA 3B4UA 3HG1D 1MUJB 4X9IA 1AH0A 2J78A 5GNXA 3VACA 2O61A 4HCDA 1VEPA 4HHAA 3W7CA 5FJIA 1F6LL 3LHPH 3WD1A 3VI4A 3N9KA 4EAYA 3UFIA 2BRRL 2O5ZH 1GOQA 3RU8L 3THAA 2W9EL 4AWTA 5EMUA 4TSAH 2OPCA 3K6SB 2WSKA 1BJ1J 1TQBB 2WP3O 3NPWA 5D7KE 3GINA 1E4LA 3F6JA 4FAAB 4BS0A 4S1DD 1VGAA 2YFNA 3VM7A 2HK0A 3SJ3A 1HESA 1Z3RA 4XZIA 3MAWA 4Y2DD 4IMLB 4N7QA 3LRGA 3BJ91 1ZTXE 4BH7A 1A0QL 5KYXB 4KNQA 4CW1A 3BDKA 3HW7A 1XD1A 2NUWA 4BZ2L 1XIDA 1CLYH 4J8RB 1AGDB 4NX5A 4GW4B 1RXOB 3MGOA 3KWUA 2EPOA 4IOSA 2Y9RT 3OG2A 1QPPA 1KLYA 1LOSA 4RSVA 4BFAA 2A5UA 1IAIH 4K39A 1JN6B 1P6AB 1KV8A 4M6NL 2GDUA 1WK0A 1GYAA 2DQTL 3S3DB 3TJHD 5JIPA 4J28A 2MNUA 1GOGA 5MKGB 3WOVA 1LEIA 1PZCA 1TE1A 2WMJA 3ERPA 3G1VA 3GB6A 1T89C 8XIAA 3FQNA 4M4RA 4XAYA 3BDYL 1PLGL 2GSIB 1YNKH 5DC2A 4XV0A 1PTGA 1MFAL 2NX5B 2Y6TE 4N8PA 1XF0A 3NJFA 1QW8A 3I6SA 1AJ7H 3B7UX 4QXVA 1E8XA 1BVLB 5FYLL 4HV8A 2FDBP 5ENLA 5GQBA 4JDVB 3SY6A 4YBQC 3PWNA 3P7YA 1Z44A 3HC4H 2EDLA 3LU2A 5MEOB 3L5LA 1P4LA 2QF7A 3FRPA 1RCYA 3VXMB 1TTFA 1DWGM 3DGRA 4HK0B 1NWRA 5D5MF 4RE4A 4YLQT 4FHAA 3R8RA 3IDJB 5TIMA 1OTTC 3TWCL 2Y1AA 1KLGB 4GG6B 4KOCA 2RQEA 2OYPA 4OT7A 5DS2A 3V0UA 2AOSA 3FKKA 2ZKYA 5SX4H 2VB5A 1YDVA 3KBPA 2KZHA 1JMZA 3U2EA 3SCRA 1W3IA 1I60A 3FH5A 1DVZA 2Y89A 3O9WB 4XPAH 5FO8A 2FX9L 2WXFA 4M3KB 4LKCB 1ML1A 5F9OH 5B4MC 3P54A 4AD1A 3AM8C 3O4LD 3PWPA 3KPNA 3DHFA 2FQFA 4RX4D 1L0PA 3SQOH 2C79A 5KTLA 2QULA 3C86A 1F1AA 5DJZB 3DX8B 3S9DB 3SGJA 3S97C 3BLKA 3B6SA 3EA1A 3OKOA 4JB9H 2BSCA 5HDBB 2AGJH 1IGSA 4MLSA 2GUBA 3PHOB 4J2XA 4IPPA 3BL3A 4TUOB 3NVQA 1KYFA 3WL0A 3U9UB 1QPQA 3VXUA 2A7RA 4RA3A 2FDSA 1AZRA 3FA3A 3TH6A 2Z1PA 2Y7LA 1IAOB 5ANMB 43CAB 4DAGL 1OGAE 4OIIH 3GSVA 1UM6L 4HKXB 4AE0A 1PKLA 2J6EH 4YAQB 1P43A 4XB8A 3NZHH 4DUVA 5FO7B 1CWVA 5KVGE 3NQVA 1PWMA 3ZLHA 2QJIA 4X98A 1G0DA 2YUVA 1I3GH 2ARWA 1DWIM 1E0UA 4GWEA 2E8YA 3ELAT 3OLIA 3DTDA 5CGBA 3SDAA 3OZPA 5JW4M 2GT9B 2ZYFA 3UAJD 1H50A 2NYKA 5IHZA 4ZXBC 1V5XA 5TH2A 4AZIA 2MJWA 3V5HB 1WCGA 3V0EA 5G2HA 3S47A 3BRGC 1V3MA 4G7YH 5T1JA 3W88A 1DJHA 2X10A 2P24B 3EX3A 2YZ1A 5DD1L 5EG6C 3VWKB 2E59A 2VC2H 1NWSA 4RPPA 3N1MC 3FQ2A 1SOKA 1TTQA 1CF8L 2ZWKA 2LABA 3V4VB 4NO0A 4XRCA 1IZJA 2POZA 1J11A 1IFGA 3LBOA 3HTWA 3RX5A 5IBXA 4PH6A 2NYYD 3L48A 2OP4H 4HCRA 1NSNL 3W2NA 3JUYA 2Q8BH 5B1CA 3TBWB 2BY3A 3L23A 3QXVA 2P26A 3LDBB 3PPGA 2NCMA 1S7WB 4YSQA 3K8MA 1IGJA 1MI3A 4G43B 3CHSA 4PJ7F 3FQTB 2PUQT 4U1LA 4WGWB 3RY4A 4PIBA 3CFBB 1P1XA 5F1NA 1PF3A 4KI5C 4YQXH 2M26A 5JIQA 3H4WA 1XIWA 4ZPTA 5JR1H 3KLKA 1OSPH 3L5XH 5SV3A 4P8QA 2X4QA 3N0AA 3ZSSA 4X80L 4JYEA 3T0ED 5ADOH 1E90A 4PJHE 2CZFA 4AQ1B 2JEQA 1IC4L 4DP1X 2YD0A 5TBOA 4MDIA 3ZL4L 4HHGA 1YYCA 1CLZL 4YU1A 1RY7B 4KJPC 4BHYA 4TVPH 3WDRA 2J2ZB 4Y4HB 5CAYB 3RWGB 4TTUA 1FWGC 4L8SB 4JYDA 3KTCA 1VACA 2C13A 3PL6D 5D6DA 4D0DB 3DVGA 1OP5H 1KC5L 1IKFH 2LFEA 1YEGL 2CEQA 4ILDA 3ZKND 3NGJA 4DVRL 4G82A 2QTVA 4A3YA 2V82A 2XHYA 3ROOB 5GGUB 3RFZB 5DEGA 3SRHA 2GUYA 3N42B 3O0RL 3P6LA 5LXGH 1HHKA 3PABB 1NCGA 3EGDB 3ZJ8A 2X1IA 9XIAA 3RLHA 3TAOA 4M0XA 4Z42C 3RNQA 2PPEA 4PJ6A 3C6EA 4XWOD 2WNNA 2UY7A 3AXIA 3MRRB 5ABDE 5TAOA 4JKPH 4KZEH 3HEIB 1TELA 2DT0A 2CIIB 5EF2A 4N0FB 3G04A 3MLTA 5I6KA 1NC4A 1TCMA 4F2ME 3B56A 3M17B 1TZ8A 2H4EA 2YA1A 5I1LA 4JVWA 4LP8A 4M29A 4DEFA 5I73B 1I2RA 2V33A 3A4AA 4OQVA 4A39A 4GXWA 2IH8A 1I85C 5DUBA 2XIJA 3TZFA 4CD4A 2J66A 1MELA 3MP5A 3PGCB 2Y72A 3T6ZA 2YRBA 2BNQB 5HHOE 4BWLC 1UZHA 5HYQA 2BRQA 4Y2OB 2DL2A 4FL4B 1J79A 4NKIL 2WJZA 2QPXA 4LY4A 4OZIE 1US2A 5BZZA 3CUZA 4CJ1A 2PYEA 4C6MA 3EMZA 3KVDD 5H4ZA 3S6TA 3EKLA 2CDGB 1JWMB 5F93C 5IVZB 1S39A 3ESUF 5E6IC 1OEZW 4P46B 5FYKD 4C83B 3W2DH 5HHMB 3BQ6A 4P4KA 4MA3B 1H41A 1S7VB 5EGRA 3B0YA 4O10A 1KB3A 4UTHA 1AQMA 4XO3A 2QBWA 2YC1B 1W2KT 4FXGC 4JO4H 1EP2A 3CVIL 4IPJA 4YC2B 3CZSA 1S1PA 2Z29A 3KOZA 5CP7B 3WYZA 4PJFB 1G7MA 1H7WA 3OSKA 1A7OL 4LCCB 1EH9A 4MJIA 3EBIA 3UTZB 1MEXH 1HH6B 2VQ1A 4P7QA 3F2CA 4GQ9H 4FQQA 3VXNA 1G94A 1CB2A 5DCEA 4HS6A 1DQQA 4DKEH 2YR1A 1XR2A 4ZOEA 5G1TA 3REWA 3H7UA 3VK5A 2ILLA 3IJEA 5F97E 3C08L 2F9RA 1CDUA 4DYJA 3BT0A 3A6OA 6FABH 2ESVE 2FH8A 2W27A 3UAAA 1XEUA 2IANE 5E5MA 4TKWA 5E1QA 3RGVA 3PYCA 4QEEA 1UWEH 3W81A 1XDLA 1Z5LB 3FNDA 1DXEA 4AD3A 1RHHB 5CBAB 4P3DB 4NILA 5DO2C 4NBZB 5GSRA 2QCDA 1DBJL 2J56A 3S88L 1KRBC 1JBJA 4HFUL 1XGUA 2DQDL 3W7DA 1EEZB 4MWAA 1BJ1H 5D70H 4UT6L 3SKJL 2H41A 1BD2E 1ADQA 5FOBB 2J5LC 4HN4A 1UUOA 4NQDD 4K3EL 4ODHH 3QZWB 2DQWA 3CDZB 3IIZA 1JGUH 3SPVA 4LUYA 5HYJA 4UQ2A 3EYFB 4Y4KA 2B2XL 1NAMH 4KCUA 5JIHA 1NANI 1YUKB 1A5FH 5T8IA 3LDBC 2FB2A 3N2XA 3FLUA 4JTIA 5B1AB 4KX9A 3U48A 1HJSA 4ZX3A 3F7LA 2NX1A 1U22A 3PUUA 4O5LH 1J1OL 2XTLA 2Z91A 2D1ZA 4ZYKB 2I07A 4P5TB 4B3LA 3I6GA 2VLKE 2IC2A 1MH5A 1UM4L 4HETA 5IJVA 5CM1A 4CGUB 4MXQC 2BCKA 3VKBA 3MSYA 4F7TA 1RLBA 3IANA 1ZALA 1FA4A 3GNRA 4H8WH 4GZIA 3MCKB 1MSPA 3T05A 3P9WB 3OX8B 3F7QA 3NIDB 2ZXEB 5F7MC 4GZEA 2ICES 5EO0A 1B0IA 4FI7A 4MLJA 3ASNB 4HQQH 2N59A 1TR9A 4PS8A 3G6JA 5D7KD 3ZTJH 1CDYA 1N6QH 4PJIF 2PTXA 3RL2A 2Y7DA 1ISWA 2ETWA 3L81A 2WYHA 2CZVA 3VOJA 4AE1A 4PJEA 3Q1EA 4DPAX 3ANVA 3X14B 4L61A 1FKWA 5EU6E 4Z0XA 4L1TA 3MRBB 3NYKA 3GM8A 1OW0C 4EQ3A 2G2RB 4NZ5A 3MS8A 4YK4B 2PTTA 1RPKA 1DVFB 2H26A 4O02B 2QUNA 4Q3MA 1SO4A 1NBZA 3UBXA 5B8CB 4MJ6B 2QKSA 4JQIH 3C8HA 5DR5H 1HJXA 5FUCE 5I74B 3ZRSA 1EMTH 5GSVB 1QRQA 3HE7D 4Q8PA 1LE5B 2FPVA 3P4LA 4JKLA 4NQTA 3CHPA 4ZFGL 1CWYA 1A02N 5FGCB 4LOUD 5IUCA 2Z9TA 3QXDB 3W3OA 4GAAA 3HMXH 3BSZL 2PDIA 1UCTA 2WOBA 4NYUA 1DIEA 3QFDB 3RVVC 2PW2B 2A7BA 2Y7QA 1OCCB 1AJ2A 4OD1H 4ETQB 1MVUA 3QXTA 3KCJA 1PZAA 1AZZC 3DI0A 5I73C 4Z7NB 3NM3A 3K2UL 3ANUA 4KROB 3PG9A 3M86A 5TQ2L 5AB1A 4PUDA 3FTGB 1XXDC 2BV9A 2G97A 1QZ1A 4LPUA 4X0KA 4M6OL 3KVQA 1I9IH 4S11A 3E9UA 3GVQA 4HPJA 3G1SA 2WW8A 2X1RA 3TFKC 3L9CA 4B95C 5MF5A 4HMEA 4IKLA 4IGSA 3M5YA 2N1KA 1E4XH 4P9ML 2WY3B 3FH8A 4IL2A 3OR6A 4GSUA 3CUJA 3HFFA 5AVUB 3BVNA 1OP4A 2EUZA 4P46C 4CVUA 3F64A 5ESVA 1XZWA 4NT0A 3NJLA 4TULL 3KYOA 5JMUA 3ALWA 3ULUH 5REQA 3UJ2A 4ZE5A 4AZ8A 4E42A 5HYEA 5BUAA 4A8IA 3GMRB 4WWKC 5EORH 4IX0A 1TJPA 4YE4H 2WKLA 5BZDB 3MZTA 1J93A 4R90H 4PJ5B 2Z7YA 4LL4A 3HBGA 1BF5A 3H3KA 5LNRA 4APXB 4Y8AA 3SKUD 3HZYA 4PRWA 4L9LA 4OCMC 4ADGA 4GY0A 4MNKA 5C6WH 1M7OA 5MENE 1Z9AA 1A8ZA 3TYAA 4O2CB 4F9PA 3KHQA 5BRPA 1MVFA 1XF2B 1UKPA 1OGAD 2A74B 1EEUA 5D72L 1FC2D 4FYSA 1ED3A 2ITCB 3KRSA 1BM7A 3VCLA 3WELA 2QEZA 2JSFA 1AXTH 4EZKA 3HVNA 5D5ME 2TAAA 4OLZL 2VAAB 2F8VA 4BCZA 4EXPX 4KNSA 3BK0A 4JEGB 1BEYL 3RWFB 1WCBB 3KTXA 1E9QA 1HAWA 3ZWSA 3FN0H 4APQD 4DP9X 2Z7KA 1BEXA 4JHBA 3SR7A 1HEZA 4C56B 1ZD6A 4MD0B 6CGTA 2W0LA 2VABA 2Z24A 4MZYA 3DXAE 3O6DA 1D7BA 2HLFC 3B3IA 2P8BA 3CWNA 2ATPB 3MNWA 2XQBL 5GIRA 4NOFA 1HWWA 4U3SA 4LE8A 4KRPD 4XVUD 5E1IA 4WFGE 1QMUA 3TESA 3ULVL 3L5JA 4YIWA 1W0VA 4MKSA 4Y1AA 3WDHA 1VRXA 1JNNH 3VDGA 4P5TC 3P5YA 1F61A 5IREA 2CNCA 4J3XA 2VX7A 3QXAA 4KKLD 1YBQA 3QZNA 1LJYA 4YDKL 1YEKL 1E5ZA 1F6PA 1ES0B 3MUAA 4DO4A 5E6SB 2YLAA 1I8KB 2BOBA 1MHEA 4RMQA 3K91A 1D9KD 4PBGA 4S3FA 3EO1B 1BQHA 3P9LB 1RCXB 3IWVA 3ZTNL 1OFBA 5KTEL 3NDZE 1OP9A 5AB2A 3WTYA 3GY1A 2POTA 1CXLA 4LAOA 1H9DA 2DLIA 1T20B 2YPVH 2Y5SA 5JPMA 3P0WA 2QQNH 4ZB0A 4DZ8B 4JZ5A 1MQRA 2GHWB 1XYFA 1NQKA 1MCOL 2C1GA 2I17A 3QHFL 3VFNB 1YHPA 1XDJA 1JS4A 3QQ3B 5DMGD 2WZMA 1DVFC 1U8KB 2Z1WA 1S9VA 3GSWB 4HGMA 5BQDA 3RVWC 4I3GA 4H2HA 3UXKA 1IB5A 1EBHA 2H7WA 4ANKA 3LSCA 2EO1A 4LEFA 1FRBA 3CC5A 1FDZA 4GS7B 4Z7AA 2HFEA 2DQEH 1W8SA 4Y7OC 1LO5B 2V3DA 1JZ8A 4GKNB 2NV1A 1B3ZA 4R8WL 1T66D 1FA2A 4X7SH 1CX9A 4F8TA 4OLXH 4ROPA 4KH2A 4PLKD 4LB4A 4PBFA 3P74A 4P2AA 4FR1A 5C08B 4KK5D 2P9RA 4YL2A 2WQSA 4X50A 6XIAA 3QUXB 1DBAL 5CSSA 1MJUH 3GR4A 1AKPA 4ECNA 3QYMA 4KROC 4MQXD 4OZ4B 1WBZB 1XG3A 2PDUA 3LHAA 4PJ7E 1AIFA 3BYYA 4POCA 4OGXH 1FL6A 3CPUA 4NJIA 3QWRD 4KTGA 4GT0A 4XO5A 3GPEA 5F7EH 2P5WA 4HC1H 1HKIA 5I1CH 1S9YB 3OZKA 3Q67A 2XTKA 3FN9A 4NQCE 4GCAA 4X8JA 3J27A 3WH9A 1HSAB 1I3UA 5IKCB 1QNIA 4AENA 2DQXA 1S2WA 1GCYA 3PAJA 3D4CA 2GAZA 3HZ3A 4YR6A 4WRHA 5HHOD 4OCXL 1LMKA 3QORB 4PUUA 3H24A 3C3NA 3VC5A 1AMYA 5KYNA 2HT3D 5EZLB 3VTMA 1FH5H 5JQ6H 2Z65C 1QR1B 5CZRA 4B0MM 3IPWA 5L7XH 4S10A 3CUHA 1EGMA 3VA2C 5DMIL 4TQTA 1F1GA 3PWJB 4JM4H 3KDOA 2KQNA 4Q8UA 2ISWA 2PD9A 4HUMB 3IVSA 2EEDA 1I7UA 2ZZ7A 1ZK5A 2QNEA 3NO3A 2Z1KA 5CILL 3E2SA 2SEBA 3RUGF 1I3VA 1HCZA 2W0KA 5TTRA 4B5UA 3N3MA 4X5WA 2FQDA 3VA6A 2HYMA 1FFOA 2APWA 1H63A 3EYQD 2VDKB 5D1ZA 3LIUA 4AIEA 3AG1B 1QBML 2R69L 3K6FA 3TJLA 1AS7A 5IMMB 5I82A 1KTKE 4I9XA 3IVUA 5C3LD 3BUVA 1FHDA 3D85B 3SCMC 2J88L 3VGAC 1KELH 5BU6A 2G0WA 1R2TA 4LLUA 1ZTVA 1NCAH 3NTCL 4HS8H 2OL3L 3UTSB 1N59A 4KKBD 1MCEA 3HG1E 2J57A 2PD5A 5GPRA 3IGUA 4YHZL 1FY6A 1Z42A 2DEWX 2IAND 1T6BX 5LXXA 4NB7A 4LSBA 4MA7H 4TL5A 3MODL 1A5NC 1X96A 4C5ZA 2F38A 4AIXA 4OECA 4D7PA 3M8OH 4ENEC 4IPIA 5C7HA 5DWUL 4ORGA 4CVXB 3PN8A 5F0LB 3QUYA 2F54B 2P3EA 5CPNA 2CZDA 1E4WH 4DP4X 1BD2D 3RG6A 5C55A 1F4XL 4RQQA 3JR2A 3K6IA 3MA7B 4L9DA 4QNPF 2DLGA 3W7OA 4FYTA 1ZPUA 4LUSB 4XPHL 4MASA 3TTOA 3C5ZC 1PE1A 4XXDB 5FLUA 2A1YA 3K6OA 4KHXL 1PQZB 2XNAA 5AB0A 1BGAA 1M03A 5BU9A 1KBGH 3ECWA 4D9RE 3K1GA 3NGBB 3H2PA 1LF1A 1R3KB 1MEHA 1FV1B 4MF4A 2EH7H 4O51B 3P0XA 3O06A 1FORL 5TQLA 4MMYA 5F7DB 1SPDA 7PTDA 1E1EA 5E5RB 5D38A 5SWZD 3S7GA 1XDTT 4I0KA 2AJ3A 3LNHA 1QPRA 3G5XA 4QCIA 1T0MA 1J8SA 2VXNA 5KSUB 1P0EA 4WU5A 3TF7C 2R29H 3IFLH 3QRHA 3QMSA 2A9NL 3N44B 2QMKA 1S3KH 4TNEA 5I8EB 5DJ0A 2DJ4A 3L3JA 3WUWG 1G7HB 3GLEA 3HR5A 4C4KT 2H6PB 3L4CA 5C0DB 2X16A 5I1DA 3LLFA 5AG8A 1C16A 2QVFB 3UGEA 3LN4B 1T03L 4MYXA 3D33A 4B50A 5DK3A 1L5GB 4KJYA 2ACQA 4QGTA 4BSWA 2CMRL 3CQHA 2QDWA 2A4AA 3MKGA 2ZX9A 2INZA 5FDWA 4KK9C 1PGRB 1QQDA 3IBOA 3QUXC 2EUXA 2HTMA 3PZMA 1ECQA 2YSTA 5AW4B 1VESA 3SGZA 2FUQA 1LO2L 5F9DC 3EBGA 5EEUA 2WCPA 4QS6A 2BIOA 2ZAGA 3PZQA 1XGZA 3QJRB 5F96H 5LBGA 2M83A 2HDJA 3MN8A 3PSWA 3OKMA 3XISA 5T1LA 4G72B 3V2AR 4L4TD 4M8QB 2BOEX 3KH4A 3FO1A 1YN7B 2G75B 3NJVA 3F5WB 1G9ML 2AXHA 2VXQL 5HR7A 3DZ1A 2YBRB 2V9RA 1KB9K 3EOTH 1RUQL 1I4NA 2BHYA 1JZIA 2QSCL 1S4IA 3VAVA 4AC7C 2EIJB 4LVHB 4PJIE 1U8HA 1EJFA 5MI0B 3QORC 2HFGL 4QDPA 1IAMA 4JR9L 4M5YH 1KRMA 1M7IA 3O4OB 3EOSA 2YRZA 4W86A 3DIPA 5ECUA 3U0PA 3MRKA 1ND0A 2F6AA 5E5LA 3WHE1 2YO3A 4Q9BA 1A3XA 4L3CB 2VGGA 4WO4D 1J0YA 3VKAA 1SJHA 1ZGDA 2IG2H 3HURA 1CBVH 2K8QA 1EQCA 3JQOB 1FDJA 3AZSA 3PPHA 3KOXA 3PWUB 1OF8A 1GPFA 2AXGA 4TTGA 1H3XA 5FW6A 1H1ZA 1C3FA 4WI7A 2NY5L 1TO4A 4KEMA 1SXNA 3MO1A 3WG7B 1D5ZA 1EDTA 3TYGH 4WY7L 3CQPA 4PYSA 2C8NA 4Z7UB 1LWRA 2P49B 3FZUC 5FB8A 5KJRH 4C6QA 4Y1TA 3CO8A 4Q8NA 3NZ8B 4UDTB 1O6IA 2YJLA 2QQQA 2AI0L 2GJJA 1S5VA 4RXGA 3SZKC 5K39A 4RE3A 3CZNA 2QCNA 1CT8B 1A53A 4XXCA 1DBKH 1XLDA 4A55A 3R4DA 2Z6FA 1ZA3B 5F6IC 2OO0A 5FYJD 3X12B 3TA4D 3RTQD 4NYLA 3U7WL 2EVFA 4A3QA 2R0LL 5AYXA 3QUZA 1E2WA 3FFOA 2VM4A 2LAAA 1Q94B 3V79C 2W92A 5IVXB 3LERA 1N9PA 4LCIL 1NEZB 3B5HA 5DS1A 1BSLA 3WL9B 1D6EB 3OVQA 2C0HA 2GJZA 4L1GA 5B7ZA 4JGUA 1H8LA 4LSTH 1PYWA 3MKVA 4UQIM 1YAZA 2XOTA 4K3JH 4PVBA 4JPSA 4DF2A 1NLDH 2A73A 2JNZA 1ZUAX 4U3AA 3DNKA 4R34A 1G7IA 1GZPA 4UFKA 4EXKA 3AI0A 1K1DA 1E15A 2ICWA 2HPMA 3ETBF 3NGBC 5HA7A 3R0KA 4X61A 1IC5H 1HHJA 3VI3B 1TPFA 2YMXL 1Y0EA 3KGRA 3G08B 4M7JL 2A2IA 3D0LA 1DSYA 3BH9A 1ZLWK 2DZPA 5CN2A 4YWSA 1HCYA 3II3A 3FULA 5FKPA 4Z5RB 4U3XA 5C97A 2VGFA 4D8LA 4NAJA 1OHLA 4PR5B 3WY3A 3T8LA 4DZBB 4R7VA 1TWSA 2GUOB 2VDRB 3DSNA 2G4EA 3A12A 2PDBA 4P4RA 4U0QB 5A6MA 2J7CA 4UNKA 5GZNA 4LNRB 2NY1B 1CE6B 3LZFL 2AK1L 2ENSA 3RVUD 2A99A 3HO8A 1SDDB 2H2SD 1UWQA 4LARL 1I31A 3Q43A 4GO6B 4K15A 3Q8BA 4G1NA 5E8DH 1QW7A 4HZ1A 2HE8A 1HP5A 5C70A 2R4SH 5DZAA 4TPRH 2DJUA 3CU7A 4L37A 3WHXA 4N2MA 3J2PA 4AYEC 3WIHL 3G5WA 4WI0B 3SZ6A 4QIRA 2PDXA 1ILUA 3UTOA 1OM3H 1BG4A 1P1VA 4P07A 1Y18B 4QRUA 3FB6B 2VDQL 1BLNA 3B0UX 4GXFA 3SY0B 3KUMA 3WMBA 1RZ8B 3BP6B 3JVGC 3DYPA 1BQLL 5GJSL 5HATA 1XISA 1NCBH 2DZUA 4C6FA 1H7OA 4PJDF 3DROA 4MNGE 1HHHB 5FYKE 3LEYL 1K9FA 3QZLA 2XQ0A 4TQPA 2V17H 4N0UA 3PZOA 1E8WA 2Q7NA 4IWWA 2D24A 1L9RA 5MI0C 4FLHA 4PMZA 2R0KH 3O4OC 1S7SA 4GMTL 1EGJA 1V77A 3QXUA 3IU4H 3TZVD 1WIPA 2ZOLB 1FDYA 3VILA 4PG2C 5IF0B 4UV7L 2APSA 1QVOA 1BWMA 2GBAA 5EF0A 3L08A 3CFEB 2QQLL 1JCYA 3H85A 5J7CC 4K7YA 4G9DA 1KEGL 4JFDD 1U6AL 1W6WA 2JGYA 3V5KA 4LK4A 3UVAA 2PWVA 5C0BE 2XZ7A 3UW6A 3UTTA 3STBA 2RQ8A 5AUMB 3C2SA 4AZGA 1Q65A 3O2WL 4O2FB 3WAJA 5CINL 2NVAA 4HHMA 2C3VA 4FQCH 4CC4A 3CASA 3CSFA 3O45A 4XNZB 3IKCA 5C0GB 1E9OA 4E41B 4WY0B 3QUMH 4YZFF 1EHAA 3MUXA 2AQVA 3FT3B 3KLAA 1F8TL 4YGVA 1OE2A 4XNBA 4GISA 5CZVL 4X8CA 1KW1A 3LNMA 3GHEH 2NY2D 1Z9LA 2HPTA 1AVAA 1MCWM 3V4PH 3DARA 4XBSA 2Y7NA 3FCSA 3E0LA 4YN5A 5JXQA 1XB8A 2PCFB 4YWGH 2G5BA 3QY7A 3L21A 4LCYB 3HS0C 3UMTA 1T3FB 2Z8SA 4HBQA 4R4BA 3EH5B 3HQPA 1FYTD 2JELL 4PLNC 1VGKA 3OBEA 1V79A 3ARBA 3QJFB 4XVJL 4M1DL 3SGKA 1WV2A 4H8QA 1NH6A 1BX2B 1TVPA 3KPPA 4P2RA 2DMGA 1NCWL 2EIEA 4MAVA 3BJFA 5DXYA 4TQIA 4RAUA 2WYIA 4DQOH 4Q6KA 4P2OB 4IH3A 2FT6A 5H35B 2B7QA 4WIQA 2VC5A 4GUFA 3VKCA 5D9OA 1OOAA 4OJYA 1LDPH 2Z2AA 2EAWA 3QEHB 2GPTA 4GG8A 5I2IB 3TYFB 4PZVA 4RAHA 3T4AA 4ACTA 3FQXB 4LXFA 4HEMA 1KPUB 4ODWA 4G6MH 4Z3TA 4LL9A 3C6LA 1OP3K 1NFDA 2VJ0A 3UGXA 1HT6A 1IM9D 1TSIA 2FWUA 4M43H 4U1HB 4R3SA 3O6LL 1KXTA 3ZDYF 3VUSA 4WW2F 3L4ZA 2DTML 4U05A 4FLRA 2I16A 4H83A 4IIGA 3T7VA 4J1UA 5E1AA 3QARA 4FLQA 3BE1L 3RUGE 3IBEA 3WFDH 4HG4K 4F0SA 5D7JB 3VH8B 1OTUD 3WQOA 4KZDL 3WLKX 5CPMA 4I2XB 2VXTL 2F8IA 1OX6A 2XTJD 4TYUA 3GTVA 4PP2B 4PRIA 2RH9A 3CSPA 5GS0C 3G3DA 3N6JA 3PDOB 32C2A 1UKQA 4D9RD 3CN1A 3A9IA 3SGEI 4JM2B 2B0SL 2G3FA 3VNIA 4REQB 1WZLA 4HU3A 3LLDA 3L3OC 2V5KA 3WNMA 4A8NA 1E6NA 1EHLH 3W6YA 3B2MA 3TVMB 4NM8L 3VGBA 4MZ2A 3VAEA 2AITA 3MV8B 1S5TA 4GCXA 4ORMA 3MY9A 4DP8X 4JLRB 1S7TA 3EFOA 4L1LA 1Z3GH 4UAOB 4PD4J 4UWQB 2UWFA 3B5TA 4CCDA 2EYRA 4HH9B 3SSZA 2ICEC 2ATMA 3I6KB 3WO8A 2XWTB 4DP7X 1XH2A 3L4WA 1UP2A 1QNRA 4PJGA 4LQFH 1T5XB 4GAYB 3PUGA 3L6FB 2P42B 4DZ5A 2VLJA 4LC6A 5HANA 1OAJA 4QNPE 4LF3A 1ELSA 3LNFA 4XVTL 4R9OA 4XPTL 5DT1L 4IISA 4ZSOA 2DZSA 4RE2A 5L4JA 2VUOA 1XLCA 3AGWA 4HJJL 2AK4E 3WH6A 3P84A 2JIXB 4GA8A 3BZ4A 4CU8A 4GRLA 5DVNA 1ZT1A 4KKNA 3OMAB 3GHBH 3LY0A 1QO5A 3H4GA 3GBNH 4Y5XB 2YXMA 1RV6X 4G8FA 3MI6A 1YRRA 1P9MC 4JFHD 2F58H 1Z66A 4DOHB 3HN8A 1UQYA 3VNLA 1VH7A 4RISL 4GB9A 1CGWA 1A9BA 3P4MA 1J8HB 2O7SA 3UACA 3O3EA 3U0WH 2W91A 3HFTA 3AMDA 4ZMWA 1A5MC 1FN4A 5JDJA 4QTHB 2C15A 4EE2A 2ZT9C 4S3BA 3DGBA 1E0XA 3W00A 3S0CA 1ZV2A 2HRGA 3MRFB 1WA3A 3QJTB 3APYA 2DT1A 1BZOA 2GDVA 3LDVA 3RWHB 3II2A 4Q8WA 1N2RB 5C9WA 4PJAB 5L4MA 5IM51 4OV9A 1JPIA 4CN1A 3I85A 3RRQA 2VC2B 2VC7A 1YPZA 3QG6A 4FQXB 4JRYB 3OYXA 4XNZC 4AYID 3QT2A 3KYAA 4ERAA 5I1JH 5BW7A 4KJQC 3OGVA 1BV8A 1FO0L 1FJ1A 3IRPX 1B9ZA 1XC6A 3LHVA 4NKDA 1HINH 4EZJA 4QRRA 4CQ9A 1JWUB 3BLPX 3ZVHB 4HIPA 1GIGH 3LMZA 5EOCL 1F4YH 1KY7A 1E4JA 2NY7L 3DGGA 4PVMA 3IDUA 4WEBH 5FUOL 1Q0EA 1NDTA 1JNEA 4FIQA 3U0HA 3EYOB 3TBTB 1QSVA 1WTLA 3HN3A 1W3LA 2BK8A 4MOZA 4AX6A 2L7QA 4WAFA 3W11D 1QR7A 4EDXA 2FPTA 5IWLA 4ZPVA 4XMWA 4AV5A 2X1UA 1S7RB 3CSYA 4AF0A 4L4PA 2C3ZA 1YXYA 1JFQH 4D8OA 4JFPB 1H15B 3EIFA 1NIUA 4PBVC 3ARSA 1CBGA 2VIRB 1XH3A 2CRYA 1DWFM 4LLYA 1JTPA 4UINH 4PV9B 2DW6A 1MCDA 3DDFA 2FJFA 4CQAA 1NCUA 4OZHB 3ZDWA 2V7NB 1YN6B 3R8QA 4C60A 3MXWL 2FBJH 1K7EA 3QWQB 4LT9A 1NMAH 1TQBC 1JZ2A 5K9OA 1IT9L 2ZE3A 2Z64C 2HTLD 4I6VA 1AR1B 1J86A 4NKMA 3ZMNA 1BXVA 4OIBA 1U8QA 4HALA 1IIGA 3CIQA 3P3TA 2XN9D 3BIAX 3ULSB 3WNLA 4UM9A 3TO2B 2YWYA 2BSRB 1D5XA 5D7JC 2VYOA 2RFXB 4JVUA 4UUJA