1KTBA

The structure of alpha-n-acetylgalactosaminidase
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
388
structure length
388
Chain Sequence
LENGLARTPPMGWLAWERFRCNVNCREDPRQCISEMLFMEMADRIAEDGWRELGYKYINIDDCWAAKQRDAEGRLVPDPERFPRGIKALADYVHARGLKLGIYGDLGRLTCGGYPGTTLDRVEQDAQTFAEWGVDMLKLDGCYSSGKEQAQGYPQMARALNATGRPIVYSCSWPAYQGGLPPKVNYTLLGEICNLWRNYDDIQDSWDSVLSIVDWFFTNQDVLQPFAGPGHWNDPDMLIIGNFGLSYEQSRSQMALWTIMAAPLLMSTDLRTISPSAKKILQNRLMIQINQDPLGIQGRRIIKEGSHIEVFLRPLSQAASALVFFSRRTDMPFRYTTSLAKLGFPMGAAYEVQDVYSGKIISGLKTGDNFTVIINPSGVVMWYLCPKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The 1.9 A structure of alpha-N-acetylgalactosaminidase: molecular basis of glycosidase deficiency diseases
pubmed doi rcsb
source organism Gallus gallus
molecule tags Hydrolase
molecule keywords alpha-N-acetylgalactosaminidase
total genus 139
structure length 388
sequence length 388
ec nomenclature ec 3.2.1.49: Alpha-N-acetylgalactosaminidase.
pdb deposition date 2002-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16499 Melibiase_2 Alpha galactosidase A
A PF17450 Melibiase_2_C Alpha galactosidase A C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1ktbA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ktbA01
3PULA 3SGUA 4NX5A 1TCMA 1VS1A 1W1ZA 2E0PA 2ZUVA 3P62A 3VFLA 1AW2A 5CPOA 2VRKA 2AMGA 5LHFA 3KVKA 4JTLA 5H2ZA 4LRSA 4M6PA 3SFKA 4HHPA 2Y88A 4U31A 1TPUA 2LLEA 3CLMA 5FEWA 4O18A 1LROA 1C8QA 1A5CA 4GKLA 4O12A 1ODUA 2GVLA 1SO5A 5KITA 5HUOA 2JKEA 1OX6A 3UWZA 3DX2A 2ZXBA 5G4EA 2NV1A 3M7WA 3U2OA 2E6YA 4K6AA 4N6FA 3CZEA 3EDFA 4XBSA 4WOZA 4AEOA 2VR5A 3EWUA 5CZ0A 1KBKA 4ADUA 5AYXA 5LHEA 5AHLA 1Q6QA 3ZT5A 5HPOA 2A2IA 4WY0B 3BGJA 1R34A 3NG3A 3GDMA 4LS0A 4OKDA 3ZSTA 3A22A 3S5YA 3GBEA 1W56A 2BXVA 1H3GA 3WMSA 1NSJA 1OF6A 4QIUA 3N14A 4Z0JA 1JCMP 3QW3A 4RK8A 4JL2A 3P74A 3VNZA 4NJKA 1TV8A 3TSBA 3MP4A 2FIQA 1XKYA 4WQ6A 1PS9A 1L6WA 3NPVA 2ZRZA 2A6LA 1FQ0A 1KGUA 2R8WA 2YKKA 1JF6A 2C16A 3EJTA 4CQ9A 1WE5A 3FIGA 4FIRA 5AHIA 4NXSA 1SQ7A 4ZQMA 2I9EA 3W7JA 4LPCA 3VGBA 4ZQRA 1J4EA 4NJJA 1DKWA 2QDGA 3UPBA 4BI7A 3DGRA 4YCPA 1VRDA 3W7HA 2QUUA 2ZICA 2ZZ5A 3LTPA 5D2YA 3LHUA 4N2YA 1DHPA 5BRPA 3CTLA 4K8HA 2RH9A 3ABQA 3BUIA 1NAL1 3DFQA 1MWOA 1G6CA 2ATMA 3KOFA 3D4ZA 3KRUA 2DZWA 2Q8ZA 4RZ6A 5DBTA 4QM1A 5K4ZA 5EA9A 4AEFA 2WKLA 1KFCA 3G1VA 1VYSX 1K7XA 3P60A 2WNZA 3BPWA 1OSEA 4P61A 4JL1A 1WV2A 1DL3A 4ZVJA 3SIZA 4LOCA 3GK0A 5D2TA 1GJUA 1QR7A 3RLVA 2J24A 2DZVA 1Q6OA 3QJAA 4OU1A 1CI1A 4JTKA 3L21A 3RK8A 3IRDA 1WOAA 1WBJA 4AB4A 2R94A 2AAMA 3VO0A 3CZKA 1T99A 2DU2A 2VFEA 5FI8A 4QSHA 5DN1A 3TTYA 2CZDA 2NSXA 4CCDA 3L5MA 3C2OA 1K03A 4J28A 2FHFA 4LXFA 4N9BA 1EWDA 3H55A 3VGHA 1SR9A 4O11A 1QMLA 4HT3A 1AK5A 2FPVA 2WPGA 3UXDA 3PUOA 1A5BA 2ZRVA 2ISVA 4ML9A 3RMJA 3GKFA 3U6WA 3RF9A 1HVXA 1WAUA 5A6LA 3TOPA 4E2OA 1G4SA 2YSWA 1SW0A 3BAXA 1GVRA 2OT0A 2X2IA 2YZRA 1HL9A 4UNLA 1OFQA 4J27A 1FBAA 3P67A 3G22A 1GG0A 3W7RA 1GJWA 1O60A 4FLOA 1CYGA 2AQWA 3EWBX 3DU0A 2ZUUA 3NAVA 2E6FA 3O16A 2X2JA 2P0OA 3TNOA 1PL9A 3DHDA 1LBLA 1PE1A 1CW2A 1F74A 5A8GA 1FX6A 3QSTA 3UCQA 3DHUA 1B57A 1J0KA 1OJXA 4IUOA 3MUXA 3TSMA 1TPDA 4KFPA 1TMQA 1UD2A 4JX6A 3LI1A 1HUVA 1Z42A 1JRBA 5CPLA 2X1UA 2H8ZA 1LLWA 1LZOA 3TE9A 3LCLA 2NUWA 3WEOA 4CVWA 4MLJA 5I3IA 3LGEA 4FNPA 2ZZ3A 3RFAA 2FE0A 1OT2A 1MXSA 2OCZA 3CB8A 2A85A 1I2NA 1KFBA 2DZSA 3F1QA 5D2VA 1RP8A 1CXEA 4H7VA 2QPUA 1F5ZA 2J9XA 2PURA 3A5VA 4BK9A 1QPRA 2EEXA 4UQBA 2QCEA 4X9SA 3A21A 4LNYA 3CGTA 3EWXA 2ZWYA 2OT1A 4NUWA 1JI1A 3THQA 4DF1A 4DPQA 1GVQA 1DEDA 1J0JA 2QUVA 3KX6A 4O17A 3W2KA 2ZIDA 4BR1A 1EA0A 1D7FA 3FYPA 5E6YA 5CGQA 1VHCA 1TQWA 2RKXA 4LV4A 3WDHA 3L68A 3K1DA 3PBWA 4Z1CA 1FXQA 3W7NA 4U33A 1SSGA 5J5DA 1TTIA 2E5DA 1QWUA 1ZFJA 3WFAA 3OHIA 4H8VA 1DQXA 1HXKA 4O1BA 1X6UA 4ORMA 3ZR6A 3OLEA 1JDAA 3WEMA 3FFSA 4H2CA 4CN1A 2F2HA 1IV8A 4FB7A 1OK4A 2A0NA 3GKAA 1Q6LA 3G1DA 3O06A 1SU5A 3W7GA 4IXHA 5CZTA 1LORA 4NZFA 3AXIA 5CGTA 2EHHA 1O5XA 1VJIA 2F84A 2ZTJA 3GYEA 1YTEA 3EX6A 3KVJA 1EUNA 3II1A 3QGVA 3W7PA 1JXJA 4JTGA 5I24A 4MYXA 5LGZA 1KA9F 3L5LA 3VSUA 4MIMA 3R12A 1FWNA 2FB2A 3P82A 5HR7A 4I7UA 4HKPA 3HPXA 5LKYA 2V8ZA 5TBOA 1JQXA 1V5XA 2VEPA 4CQ8A 5GVJA 4BA0A 1KWGA 1SW7A 1EPXA 3WY4A 4XQ6A 3W1RA 4C1KA 1I2PA 2NXHA 1WZAA 1RD5A 1AG1O 3B06A 3VKJA 5H91A 1OX4B 1DVJA 1V3JA 3DI0A 5CG7A 3GAYA 2QKFA 1D3HA 2WNQA 4QNWA 2J9YA 3W85A 1ME8A 3NNTA 1FDYA 1ADOA 3KAOA 1TSIA 1JG9A 1L6YA 1LP6A 5BRBA 3N73A 3KFTA 2ZRUA 3EX2A 1VJSA 2RFGA 3EXTA 1BEUA 1U30A 1L6SA 3CT7A 3WK1A 1JUBA 4HNNA 4EVZA 3B05A 4QITA 5LNUA 3S9YA 3CZLA 1ICSA 1K7FA 4GE8A 1DJNA 1WXJA 2WSRA 1QFEA 4PSPA 3UERA 3BVVA 1W37A 4GQRA 4KWWA 1Q4NX 1P5BA 3G1FA 1XSKA 2YDAA 3B04A 2W0UA 4GO8A 1KXHA 3UWVA 4OWGA 1VIWA 2JKPA 1W5NA 1YXYA 4UZUA 4WSJA 1PCWA 1FDZA 3DX1A 1PHWA 4PH6A 4PTNA 2Q3RA 1IZKA 1XV8A 1NFBA 2C6QA 3FA5A 3M47A 1UUMA 1OFDA 3B0UX 1ZS2A 3ABOA 3SW6A 1CGUA 2PWDA 3L4YA 1CLVA 2NV2A 3A24A 1OGSA 2OW7A 1DORA 2OYMA 2I14A 3NA8A 3VI2A 2O7SA 4AYSA 1I8JA 1WZMA 4HP5A 2QPSA 1FCVA 2ZA2A 4N9DA 2V0TA 3CQ0A 1H50A 1HL2A 1MFUA 1MW3A 3KL5A 3PY2A 3M0ZA 1XCWA 1YYAA 2XFWA 2QLYA 4AAJA 1XSIA 3D51A 3Q37A 3NL2A 3G0UA 3OA3A 1JCNA 2Y2WA 1UKSA 4K39A 4E0CA 1H7XA 2BY2A 1QHOA 2F7QA 1K8ZA 1TRDA 2TRSA 4LVDA 3L0GA 3PSVA 1ZHAA 5I3GA 2A21A 3W1XA 4Z1DA 3IVUA 1HTIA 1E3ZA 1JIBA 2E5CA 3CLWA 1H7NA 5D05A 3CPRA 1KFKA 1JQVA 1YDOA 2QCMA 5BMXA 2QMKA 2E4TA 2A7NA 2E09A 3BG9A 3I7QA 3QYQA 4H6KA 3LM7A 4OJYA 1G4PA 1PJ9A 4RZ5A 4UNKA 4FEZA 2FH8A 3M07A 1CDGA 3DDGA 1Z48A 1W5OA 3NM1A 4AHOA 1P6WA 4JTTA 3LI0A 2ZRXA 5D09A 3MHFA 2FQIA 4CCEA 2VEIA 4UOQA 2Y4SA 4JDBA 3W76A 3BLPX 1TJPA 2X30A 3NYZA 4IXXA 3M43A 1TMHA 5K9DA 1V3MA 2DZXA 2QAFA 3PVFA 3OLDA 1BLIA 5CZJA 3P84A 3I7SA 4PEEA 2NXIA 1JCYA 1HG3A 3QQ0A 2V3FA 4Z1AA 4GUGA 5D04C 1VCGA 1Y7VA 2GQ9A 1KM2A 4OBTA 2OX1A 3FS2A 1NF0A 3SGZA 4O1CA 3LPPA 1NM9A 3M5VA 3BG3A 4JTHA 3STFA 2GQAA 1IF2A 3CTTA 1VYPX 2H6RA 4NI3A 2DZTA 4KFNA 3W1PA 1GYLA 4DPPA 2WPBA 3LHWA 3PF3A 3ZQ9A 4K7YA 5HULA 3VU2A 2VRQA 3NXFA 1JAEA 4LC8A 4ZQCA 3VGFA 5A6MA 4NJIA 1XI3A 5AHMA 2NZLA 4OIFA 2C8NA 3BARA 4O57A 1P0NA 2EF9A 3OEXA 3FW6A 1TJRA 2ZXDA 3KE0A 3GZ3A 3QF0A 3LXCA 1YADA 1KXVA 4HSNA 5EMYA 1F6KA 6ALDA 3DFSA 1OFOA 5I3HA 5U7SA 4GXMA 3BK0A 3HIJA 3FKKA 1P4CA 2YA2A 3L9CA 2PRMA 3N3MA 1SO6A 5BOOA 4UFJA 4NX0A 1VFOA 3MMTA 2PC4A 3TW6A 1XBZA 2WNNA 4TMBA 2F61A 5AHFA 1XDLA 4GUFA 3LHZA 3W9ZA 3G1YA 5TQLA 4E2BA 4XWUA 2FDSA 3L0KA 4ZMGA 3LLDA 3O6CA 4RX0A 1WA3A 1E51A 5G2HA 1U2YA 1V7YA 3AJXA 2NUXA 3N2MA 2ZDRA 4DQWA 1SO3A 1MW2A 4UTWC 3DHFA 1IXNA 1OABA 5D2WA 5I3FA 3S5ZA 1DBTA 3LCHA 3MW7A 1H63A 1EUAA 2Y62A 3NQGA 3NZ1A 5KMYA 4GINA 3UG4A 2ZYFA 2F7FA 2V30A 3UWUA 2GJRA 3VGDA 2RDUA 1VH7A 5G2IA 4BI6A 1TV5A 1ZCOA 4Y90A 4YLWA 3TCEA 1GVFA 2QCLA 2GOUA 4MJMA 4MVAA 1H5YA 4FNRA 5DY3A 1A50A 2GVJA 1I45A 3CZNA 3I68A 3TROA 1HO1A 3M5ZA 1ONRA 4MJZA 3FEMA 3ZT7A 3BAYA 1XL9A 1HL8A 1U33A 3KRZA 3PUEA 5DXXA 4M56A 2Y7EA 5FESA 5FF2A 3LPOA 3W2LA 3W7LA 5F4WA 2XIIA 3O1NA 1WZLA 1CPUA 3Q58A 3NL5A 2EO7A 1THFD 2YJQA 4J3WA 2WQPA 3P7YA 1Z41A 3KLLA 3V75A 1TQUA 3BVWA 2ZRYA 1JD9A 8CGTA 1SO4A 1H60A 1PIIA 1K8YA 3LXAA 2EACA 4UUIA 4RKAA 3HGRA 1H51A 3LBCA 4UCGA 3O8AA 5KZDA 3TU9A 4DO4A 2WSPA 4UFHA 1ZJBA 4CNOA 3F4WA 1KFJA 1X1OA 1SSDA 1MEWA 3BAKA 4LW7A 5BNKA 3MP3A 3UG3A 1ZAIA 2QCGA 2Z1BA 3PWAA 3UWQA 3YPIA 2Z0IA 1YTDA 4IWWA 1DOSA 1EA9C 4N02A 2B7PA 4A22A 4YWIA 2H90A 3N34A 4N9CA 4TVUA 2P1FA 4C1LA 4UIOA 4UCFA 1ALDA 3LBMA 2ZWZA 1YPFA 3T78A 2YA1A 5G1TA 4EIVA 5FF0A 4ZL1A 2XIBA 4JTIA 2BWGA 4AW7A 3NQFA 3VX1A 4AMWA 4J3SA 3WNMA 3TTSA 3TJLA 1TIMA 3GNNA 2BHZA 1EP3A 3L2MA 5BRQA 4WD0A 1CGYA 2Z6IA 4YL2A 3LV5A 1OYAA 4JIPA 4FF7A 3BAWA 4O0ZA 3WY1A 3NPXA 1M7OA 4JFTA 5TIMA 1VB9A 1M5WA 3L2LA 3G8RA 2A5HA 4KWVA 4JR5A 3WNPA 2TYSA 2CLOA 3SECA 4RCXA 3H53A 1UD8A 3BUDA 5EYWA 2YPIA 2D3LA 3VMNA 4UTHA 2VFHA 1J2WA 5D02A 4N6EA 1PIGA 2ZX5A 1NF7A 1AMYA 4GUHA 3LRMA 4CKQA 1C9DA 1TQVA 1S5TA 5G5IA 3ZWTA 1LRTA 3R5EA 1H7RA 5HQEA 4S2BA 4BZYA 5HWJA 4TMCA 4O16A 2EADA 4IMEA 3LCWA 4M6VA 2QEZA 2FFCA 4MFDA 3L4VA 1GEQA 3DFOA 2E9BA 3ZS4A 5FF7A 4XUGA 4AF0A 4WZHA 3ZWSA 1D9EA 1D3CA 4NNCA 1TO3A 5DLCA 1JCLA 1M7PA 3FAXA 2XN0A 3W1AA 5CGMA 1KLZA 1M6JA 3W87A 1AL7A 4GBUA 1TB3A 1U5JA 2CWNA 1OX4A 2BY0A 3R89A 3BW3A 4JTEA 2D3NA 3DHPA 1CXLA 4NT0A 3JR2A 4GI8A 3OVRA 4O10A 1AL8A 1IZJA 3UNDA 4UOZA 1XXXA 2Z2UA 4O0KA 4XKYA 1MSSA 3HGSA 1QOPA 2YX0A 1ZJIA 1CXFA 1OFRA 3G1AA 2VFDA 4MZYA 1W3IA 5DXYA 1QHPA 1QNVA 5I3JA 1QAPA 1VGAA 1XBXA 1A47A 1TQSA 2VELA 1TPVA 3ABSA 3DZ1A 1W31A 4UTIA 2DZPA 1OFBA 3HBLA 4OGZA 3GDTA 3GXIA 5LNVA 3BAJA 1HFBA 3KLKA 3SSJA 3WFZA 2WKGA 3BAIA 4K36A 5C2XA 3VSVA 2WVTA 2WSQA 1CGTA 3P81A 4BF9A 1JGIA 2QDHA 1MO0A 1QDSA 3OVPA 2NWRA 1GJPA 1JXKA 3A6OA 1O7DC 3G1XA 3DFNA 3DFTA 3NZRA 2JBMA 2F7PA 1SZFA 2CLLA 3B0PA 2C14A 1G69A 4OV4A 1KBIA 3PB0A 1AW5A 1XM3A 1UH4A 2GUUA 4O8RA 2ZZ6A 5FF4A 1P0KA 4Z0SA 2ZZ2A 4GC4A 1GTHA 1SMAA 2EQDA 3STGA 3L4WA 5E1QA 4B5NA 1KWKA 3NQ6A 2QJHA 3TQ0A 5K7JA 3MO7A 1VQTA 2ZUTA 1OX5A 3HJEA 2BY3A 1JL8A 3MP5A 1HX0A 3QSRA 5DCDA 2ZTKA 2IGTA 4R7JA 3K8MA 3T44A 2EAEA 1RQHA 1ME9A 2CW6A 4R53A 1SZEA 3EX4A 3BMWA 5D33A 1GTEA 4GI9A 4QAWA 2GJNA 4IMGA 4IGHA 5LGXA 1KXQA 5E0FA 3MI3A 1YDNA 2H8XA 1GVSA 3G0SA 5D37A 2FHCA 5FEXA 1SPQA 1QWGA 1QW9A 3L4UA 3F4NA 4HOXA 4MOZA 1LOLA 1QI3A 3C56A 3UWWA 5F1VA 1IGSA 1IXPA 1GT8A 4UQDA 3S1VA 2V5LA 2CFFA 1PPIA 2OSYA 1F76A 2CLMA 3S8HA 2RHGA 1UD6A 3W23A 3G24A 2RDWA 3HJZA 3ZFHA 3CEPA 3C8FA 3L4TA 3PM6A 4QQ3A 1JDCA 4DBEA 4JGDA 1H1ZA 3V1PA 4ICNA 5E6ZA 4ZQPA 3A5FA 2V2HA 3EDDA 3EXSA 3NQ2A 2B7NA 3AJ7A 3NEVA 2ZFAA 2CZFA 3S6DA 4CNNA 1E40A 4HIBA 3BVJA 2A4AA 2QF7A 1KW1A 1KV5A 3ZR4A 3HG3A 4H8UA 4JIQA 4EOUA 3VE9A 3RNDA 4RJEA 2F18A 2Y7DA 1R75A 4O28A 1ZAJA 3N9RA 2AGKA 4H8HA 4D2JA 1OVDA 1H7PA 1NOFA 3BLBA 4NZJA 3L67A 1FXPA 4ADTA 1XD1A 4CQAA 1UUOA 1W5QA 4AXKA 3DX3A 4H3DA 4AWSA 2P10A 5HWNA 3W37A 4WX2A 4DF2A 2DJXA 2ZUWA 2PCQA 5LNRA 3HG2A 1KM6A 2V3DA 3W1QA 4PFMA 1IIGA 2EAWA 2HTMA 3C52A 5AOUA 4AWTA 3QFEA 2VEKA 2FTPA 3E96A 3W2UA 5HUPA 2A7RA 1UH3A 1TPH1 5EPDA 1C29A 4XKYB 3MWAA 1LRNA 1BVZA 2VC6A 2WVUA 5I23A 3JRKA 1U83A 1IIHA 4EF9A 1J0HA 2C19A 4AVFA 2PWEA 1B4KA 3GR7A 2X2GA 3I6RA 4M5PA 1KTNA 1KLYA 1PZ3A 3HOJA 3NQEA 1XSJA 1YXCA 4A2SA 4S1FA 3C2EA 4K7VA 4LUIA 1KFEA 3NVTA 3F03K 2EPHA 4RZ4A 4POCA 4G1KA 5KZMA 1JJKA 4HNVA 1HNYA 1JDDA 1CGXA 5AC8A 3IIXA 3NQDA 1EP1A 1QCWA 5I5RA 3AO0A 2OSWA 1MXGA 2XVGA 1SW3A 4OV9A 1KM1A 4FXSA 1NVMA 3BW2A 3QC3A 2WSKA 4R33A 3EWZA 1VAHA 3CC1A 4FX6M 3M5XA 4FO4A 3TJXA 4IMDA 5I3KA 2W6RA 4M8UA 4UR7A 2DP3A 5HR6A 1OFAA 1I75A 3ANYA 3HB9A 3WDJA 2QV4A 5E70A 2TAAA 3WY2A 4JTJA 2VENA 3GR8A 5K9XA 4J9JA 1XD0A 1SMDA 1Q3NA 2JK2A 1J5TA 1MW0A 2DIEA 1YXDA 1IXOA 3IV3A 1N55A 3L0NA 4FIQA 2ATSA 1AQMA 3LERA 4IMCA 1R2SA 5F1UA 2F1BA 3D52A 3L65A 1LRQA 4JDYA 4MUZA 3ATZA 3QPYA 4JXCA 3C4UA 1F05A 1F73A 5DY2A 3O6YX 1W8SA 5HMSA 2B7QA 2NX9A 3S42A 1QPKA 1KM0A 2QJIA 3NGJA 1GOXA 3LB0A 3IJ8A 4AMAA 2VUYA 4N4PA 2Z6JA 3NL6A 3WK3A 3GDLA 3TV8A 3MBFA 8TIMA 3TMQA 1LBMA 2AAAA 1FWWA 4HNTA 4JFUA 1Q45A 2QJGA 2W79A 4HNUA 5D38A 1UD5A 2ISSA 1B4EA 4ORIA 1CXKA 1RV8A 2E6DA 1LM1A 3IIOA 4JS3A 5CPNA 3W88A 1EEPA 3BG5A 4JX5A 2OJPA 3TQVA 1UA3A 1XCFA 3LOTA 2WJZA 4PC8A 3W38A 3IIZA 5AHEA 3DKLA 3BC9A 3EJPA 4IPJA 2OYKA 4MAZA 2Y7FA 1UKQA 4L4MA 3LX9A 3AXHA 2FB3A 3KL3A 4M19A 3IGXA 3LCFA 5AYYA 1VYRA 4TU1A 1UD3A 1R2RA 2J27A 4FMVA 4W93A 4LT9A 1BAGA 3WNNA 1EX5A 3KVMA 1VLIA 2CLKA 4UMCA 3S1WA 6CGTA 4NJHA 3O07A 2QR6A 1D3GA 3FJLA 3E49A 5CSRA 3NOEA 4IJBA 1VFMA 3TX9A 1PCKA 2BHUA 1XUZA 4X2RA 1G7UA 1XGZA 1GPWA 3FJ6A 1G9HA 1TRIA 1QI5A 3EWWA 1G7VA 3QRHA 3IGSA 3W1UA 1H7WA 3GLCA 3L2IA 4BWLC 1VCFA 7TAAA 4AMXA 2WCGA 3BSHA 2YCEA 3UYCA 1WPCA 4HSOA 4M7SA 2F1AA 1FDJA 1ML1A 1YDVA 2JKAA 2CHNA 5LZLA 1PVNA 3VM5A 1G1YA 4RR4A 1SZGA 2C13A 3C2FA 4MKNA 3S1UA 3W07A 2YFNA 1S5WA 2WANA 2YR1A 3KHJA 3G18A 3PR2A 4UMBA 1E43A 3K30A 4PL2A 1I2RA 4UTJA 5C55A 1UD4A 1EP2A 1WOBA 3LRLA 4CLMA 1W5MA 3Q94A 3NO5A 3T4CA 3M16A 3B8DA 4AEEA 3TXZA 3O6DA 2XVLA 3H54A 3QM3A 4Z1BA 1FWTA 6TIMA 2GUYA 1LWJA 1VFUA 1OFPA 1EB3A 2FH6A 3L66A 5KEZA 3C0JA 4LC6A 4ZQOA 4JY8A 1V3KA 4JNMA 1PAMA 3IJ7A 3ELFA 1PEZA 3LCIA 4UZSA 2B7OA 2C18A 2F7OA 4HN4A 5D03A 4FLQA 1JUKA 4GWEA 2CXGA 4IX0A 4JYDA 4MZ8A 4A21A 3OBKA 1JFHA 4UFKA 3S5NA 3BVTA 3EB2A 2WSYA 5DCEA 4GNJA 3OVQA 3VGEA 4E38A 4FLRA 2ZBTA 3BLKA 1SUXA 3GXMA 4RXGA 2ZXQA 2XVKA 2J9ZA 2CPUA 4LTSA 4UTMA 3VM7A 5KSWA 3S0CA 3LV6A 1LLZA 1LBFA 2ZUSA 1YPIA 2VKZG 5K4XA 4GUIA 2NX3A 2A1YA 3CIWA 1BKSA 1PZ2A 3UPWA 1RP9A 4GQQA 1TREA 2YXGA 5AN7A 4WUIA 1K7EA 3FKRA 3UEQA 1JCJA 4LS2A 1FCBA 3AMKA 4WXYA 4GO9A 2WKJA 1HT6A 4CN4A 3WJZA 1JF5A 2HS8A 3IEBA 1MEIA 1SFLA 2XWEA 1MW1A 2PWGA 3IIVA 2R14A 3P5ZA 3VMPA 3W75A 3L5AA 3EX3A 4M7TA 4XTIA 4XB3A 2V2DA 3OLGA 1TV7A 5IBXC 5C5YA 4A29A 1K02A 4DXVA 4JCMA 4DELA 1TTQA 2TMDA 4KKXA 5IBXA 1WO2A 3HO8A 1RQBA 1XC4A 3DKJA 3IJ9A 3TH6A 3K8KA 5CLTA 2NXGA 1S46A 3TMLA 3GNDA 3W22A 2BX7A 4UXDA 1H61A 5EL1A 4Q33A 1EIXA 3W6YA 4O13A 3DC0A 1DV7A 4A2RA 4DF0A 3NQCA 2X2HA 4JTUA 1MZHA 4RLIA 1JVNA 1W3NA 5A5WA 1OFEA 4LV9A 3O05A 4CNPA 3GXFA 3WJWA 2V5BA 3MYPA 1K8XA 1PS3A 1ZNNA 1A5AA 2BXZA 1O94A 4B9YA 4GI6A 5CXPA 4WY0A 1BF2A 5A2AA 1GWJA 5HINA 1SZNA 3EDKA 1OT1A 1O4UA 3DX4A 3W72A 3BUPA 2QCCA 1KCLA 4QNEA 5G2WA 2Y24A 3W70A 1W5PA 2DJLA 1I2OA 4LVBA 5LSMA 2ZE0A 3ATYA 3LDVA 3W7QA 1PIFA 1RVGA 3LTYA 1GVIA 4FX8A 3EJSA 4AF0B 2JGYA 3E9AA 3CV5A 5MHBA 2JGQA 1WZKA 1K3UA 1PHQA 3EWYA 2NT0A 3W74A 2ZCGA 3G3MA 2PRHA 2QMJA 4GUJA 1TPB1 1KBBA 4IMFA 4O14A 3VMOA 4DEFA 2ZA3A 2C3ZA 2Y61A 3SZ8A 4YMZA 1OB0A 5J5RA 1R47A 1F6PA 2Y7GA 1TCDA 2VEMA 1TYGA 2QCHA 3WJXA 1KBJA 3BCFA 2ZZ7A 2Z1KA 3BUQA 2DH2A 1LOQA 3GDRA 2G96A 5E0KA 3W83A 1LTDA 3BW4A 3OIXA 3GX9A 1YLVA 5EKYA 1M53A 3K8LA 3P8IA 5AFDA 1B9BA 1C8VA 1RQEA 4KWUA 3BLFA 1WDWA 1WP6A 4IX2A 1G4TA 5DO8A 3LTSA 2VOMA 2ZA1A 4K38A 4S2CA 3WNLA 2NT1A 2G3NA 1BWLA 5FEPA 3T55A 2FJKA 3QMRA 1QWNA 3NQ8A 3CPUA 2Q8LA 2NUYA 1KGXA 3B0VC 4FNUA 2VT0A 4OHQA 3W1MA 4J7RA 2BY1A 3W7OA 4X9YA 1X1ZA 4PODA 1JRCA 4JFVA 4JX4A 3PBYA 3PUDA 2A6NA 1O95A 4Y6GA 5EBUA 4FNQA 4NJGA 2Y70A 2I1OA 2X16A 1W54A 2WOQA 3FYOA 4WXZA 1R33A 3BVUA 1TQXA 5BW6A 1UOKA 5KINA 3GDKA 3HF3A 1FCQA 3GAKA 4XTDA 4EF8A 1F2JA 3ZOAA 3OLIA 4KMQA 3IVSA 2GVYA 3NQ7A 1ZALA 4PL1A 3VE7A 3DH7A 4ONVA 1XCXA 2ABBA 3W73A 1B3OA 6TAAA 3QMTA 4GJ1A 5L9FA 1DTUA 3BMVA 4LWWA 2NLIA 2PWHA 3GXTA 4U4MA 1OYBA 1HWWA 3L4ZA 2X1RA 1H1YA 4Q4KA 1KM3A 4MY1A 4O19A 1M7XA 4Y8FA 5D32A 4UFIA 3N9SA 4UFMA 1FCUA 2ZZ4A 4LRTA 1UKTA 5AHNA 1FWRA 4UNIA 3BGGA 1TPWA 5SWUA 1JCXA 4U3CA 4WLCA 4FXRA 1EO7A 3W7CA 4I7VA 3C2RA 5F7UA 4Y96A 1O5KA 3HMJG 1OF8A 4HPXA 3ZR5A 5HXMA 3N19B 1VPXA 5F2GA 1CGWA 3UY7A 1LOSA 1S5VA 3UY8A 4EWND 1GCYA 4L4LA 3TFCA 4MZ1A 3W3OA 4DBDA 3PB2A 3TQKA 5K3VA 3KEHA 3WK0A 1CX9A 3INPA 5A2BA 3ZSSA 3T40A 4RV8A 3NL3A 4KFOA 2CLHA 1PV8A 3L4XA 1VC4A 4TX9A 3KVLA 1QPQA 3UZJA 7CGTA 5F4XA 3PBVA 4FHAA 4UC5A 4X22A 5CLWA 1XUUA 2NWSA 3C6CA 4QJ1A 1EHAA 2OYLA 3DBPA 2HSAA 4IQLA 5IM51 1VZWA 4CN6A 3BV4A 3G8EA 3PAJA 4JYFA 3ECQA 3TC7A 2ZX6A 3RILA 3N2XA 2ZRWA 2A7PA 4RXFA 2BSLA 2FPTA 2V82A 1CXHA 5HWMA 3MBDA 1JD7A 4TO8A 3MYOA 4O1AA 4UTWA 4YXGA 2CZEA 3AMLA 1XH2A 4N9EA 4JEQA 2GPTA 3E02A 4NQ1A 1WQ5A 3UWYA 2Y5EA 2FGZA 2E8ZA 5TD4A 9CGTA 3A4AA 3QQ1A 1RR2A 2BLEA 2GQ8A 3G1HA 3QH2A 4I7WA 1OK6A 2VFIA 4ZQNA 1UJPA 1Y0EA 4IOTA 4JD4A 3RU6A 3S1XA 2Y89A 1MVYA 1DJQA 3LHVA 4MYAA 3TK7A 3GIYA 3MI6A 1Q6RA 4J3UA 4GFSA 1H7OA 1V3LA 1X8FA 3DDFA 3UXAA 3JS3A 1S3HA 3R2GA 2BHYA 2C15A 2J25A 1RPKA 2ZX7A 4PEKA 2CU0A 5FF3A 2J6XA 3HG4A 3UD6A 1G5AA 3LCXA 4HPHA 4NNAA 3W84A 1J0IA 2BTMA 3QEZA 2OMAA 3IVTA 4OT7A 1OG0A 5LNWA 4U28A 3WJSA 1RPXA 1FWSA 2CLIA 4CGTA 4JFSA 1TPFA 5AB3A 2DH3A 3TDFA 2D73A 2D0FA 1KCKA 3B4UA 3TXVA 3RLUA 3EEGA 4K8EA 2DORA 4X0NA 1QO5A 3P61A 5ABTA 3RIKA 3EDEA 4WY0F 4FNTA 1MFVA 1XFBA 1XBYA 5EY5A 3W7DA 2ZX8A 3B03A 1QPOA 5KZEA 1KM5A 3CWNA 2E8YA 2E77A 3LHYA 4LVAA 4NVTA 5AC7A 3ZT6A 5C6MA 4WSKA 5CPMA 1ZJAA 4JICA 3TAOA 3R13A 4JY9A 4BFAA 4Y9AA 4FNSA 2DIJA 1XH1A 2VFGA 4JTSA 2ALWA 4AIEA 1N8FA 3BLIA 3BO9A 3G0XA 4O4WA 1L0PA 1L2UA 4JN6A 3CWOX 4LU0A 3GXNA 3MHGA 3P80A 4XBKA 4O53A 1G4EA 3NR0A 1WX0A 3GTNA 2PE4A 3VCRA 3IIPA 3NDOA 4MFEA 5DELA 2ZX9A 5HDRA 3LRKA 2GVGA 2VNCA 3THAA 5K2ZA 3WY3A 1B0IA 3TUUA 2WVVA 3G1SA 1DQWA 3TA6A 3CZGA 1W9XA 3M1ZA 1BVNP 3CZSA 3STEA 2D2OA 4IPIA 4UR8A 2H3DA 2FPYA 1QX1A 4UTTA 3OG3A 4JFWA 1JI2A 1OHLA 4JCLA 2YW3A 3W7EA 2YYUA 1RZMA 3FOKA 4MPQA 2C0AA 5F4SA 4ADSA 3W1LA 1KV8A 1EO5A 1I4NA 4JYEA 1BSIA 2XN1A 5F2LA 2X1SA 3NM3A 1LDCA 4X3ZA 4Z08A 2Q3OA 1A53A 4AHPA 3HG5A 1MXDA 2Y6ZA 3QW4B 2TSYA 2V2CA 3BSGA 3NQVA 1KM4A 5F2IA 3HQ1A 3DXIA 3HPZA 5F2MA 4UTKA 3BVXA 3A9IA 1A5SA 3UQNA 2B4GA 4I9AA 4TR9A 4N4QA 3TW7A 1FY6A 5EMUA 2D0HA 5D30A 5E93A 2F7RA 3VGGA 2ZQ0A 1ICQA 1TQJA 4O52A 4E2DA 2EABA 3DX0A 3ABRA 3UG5A 2G97A 3IK2A 1T96A 4OQVA 4TIMA 3KWXA 4LY8A 3TC6A 3A23A 2C1HA 4LVGA 4NNBA 1NEYA 3WJYA 5D2XA 1UB3A 2GJLA 2OZ0A 2QCNA 2VXNA 4J3VA 3GVGA 3E12A 2BXYA 3GXPA 1UA7A 2FHBA 2C7FA 5DBUA 1Z44A 4O1DA 3A47A 3QMSA 3DENA 3W71A 3O63A 1E3XA 5KTLA 3TSDA 4J3TA 3M6YA 2YA0A 3DAQA 3Q2DA 2R91A 4UQAA 1OYCA 1W3TA 5AC6A 1XH0A 1F7BA 4UQCA 4FX7A 4PSRA 1KXTA 1TTPA 3TAKA 2QCDA 4NXKA 4BI5A 4AHQA 4P2VA 1Z32X 4O50A 3P8JA 3EDJA 3MI2A 1HTYA 4WOQA 3S2CA 3U8GA 3NPUA 3VNDA 2FLIA 3PBUA 2NX1A 3W7MA 4HA1A 3NQAA 3CU2A 2D0GA 1EWEA 4BWLA 1YTKA 3I7RA 3G3DA 4OE7A 4W9TA 2WVVB 3PS7A 5BMWA 3LCGA 1T8XA 1CIUA 1KTCA 2CLEA 2G3MA 3SI9A 4WJEA 4QISA 4R34A 4MLRA 3VX0A 1LYXA 1W0MA 3WENA 3W7IA 2OW6A 3BH4A 3C61A 2CZ5A 5I0DA 1R46A 1GQNA 1ZAHA 1CXIA 4QAIA 3GBDA 3WELA 1N7KA 2HMCA 2WV8A 3SR7A 4DO6A 3LLFA 3R8RA 4GRSA 1TQTA 2QCFA 1R30A 1IXQA 4ATWA 1AMKA 2YGYA 1VHNA 3M41A 3T7VA 1AVAA 4UFLA 1KGWA 3W2JA 3W86A 4YCOA 3WN6A 3E0IA 1UH2A 2OSXA 5FEZA 3ZO9A 4WF7A 4MB1A 3GXDA 1VCVA 3D0CA 2GJPA 4O15A 4UTTC 2EGZA 3KRSA 1AW1A 2UV8G 1VLWA 2E6AA 2G5WA 4H4IA 1GYNA 1QOQA 3HGOA 2TPSA 3IGUA 3HZ3A 3STCA 3SJ3A 3WDIA 3W1NA 3W1TA 1UBSA 2IQTA 3NQMA 2X1TA 3TFXA 5DCBA 2CLFA 3PG9A 4UTUA 3GB6A 1FUYA 4MY9A 4AIOA 4HOZA 4LQ1A 1G94A 3CHVA 3TKFA 1QI4A 4A3UA 3PG8A 4AH7A 2YW4A 3W7KA 4GIAA 3LHTA 2ZXAA 1AQHA 3NPWA 3CM4A 3KL0A 4K37A 1BG9A 1TPC1 4JTFA 2G95A 2E5BA 1JULA 3C2VA 1B2YA 2J88A 3FLUA 4O4VA 4UTLA 5CZSA 1QW8A 2V3EA 3W2NA 4DO5A 5DFAA 2QCDB 3CIXA 2Y85A 1L9WA 3EJUA 4HOWA 1UCWA 2H3BA 3FAWA 5K9CA 1ZENA 5L6UA 1QPNA 3TIMA 3TR2A 2RDTA 3UZ5A 1EH9A 4PCFA 3BUBA 1BTMA 2PRLA 2E68A 1LWHA 1KB3A 4LVFA 1R2TA 3EKZA 2E1DA 3HPSA 4M6QA 1WYIA 1KTBA 3BCDA 3MJYA 3PSWA 1P1XA 2XWDA 3HGJA 3WNKA 2ZZ1A 1GG1A 3EKLA 2V9DA 3TONA 3WNOA 2BZNA 2HS6A 2WC7A 4LS1A 5G4WA 3USBA 2Y63A 2KZHA 4Q32A 5C54A 1X7FA 1ZY9A 1GZGA 2DZUA 3MHUA 3VSTA 3QZEA 2PWFA 1QO2A 1JR1A 4MY8A 4PA8A 1JUEA 2FYVA 2YYTA 3KXQA 2YFOA 2YIHA 3P5YA 2ISWA 2WVSA 1VR6A 4XZ9A 4J3XA 2WNWA 1T0OA 1BWKA 2EKCA 2VFFA 3EX1A 1DHKA 2B0MA 5HNRA 3DI1A 2ABAA 7TIMA 1TTJA 2EJ1A 3EJQA 1HO4A 3PC0A 4NU7A 4HPJA 3C3NA 1BPLB 5E9AA 3EXRA 2V81A 1ICPA 3O15A 2WO5A 1LCOA 3LXBA 1KFLA 3W2MA 4UQ9A 2ALDA 5T26A 4FLSA 2O7QA 3CEUA 4U2YA 5AYZA 3DFPA 4AWUA 2QAPA 3D50A 3EJRA 4U2ZA 3I65A 1CGVA 3VNYA 5CKSA 1GVOA 1XBVA 4UQEA 4PCTA 2QUTA 3WK2A 1ME7A 1TPEA 4LUJA 1XDMA 4ZZ9A 1I2QA 1WBHA 3M5YA 3D4YA 1G67A 5CSSA 1SFJA 4O54A 1UASA 3M9YA 4UMAA 4PCSA 4AYGA 4B9ZA 4ALDA 3M44A 1H62A 5HJLA 5U4NA 1MEHA 5LNSA 3QPZA 4CCCA 2XN2A 3SY5A 3BLEA 5G1YA 2YOCA 2WCSA 5A2CA 3S5OA
chains in the Genus database with same CATH superfamily
3PULA 3LKOA 1C5DA 4GQBA 3BDXA 3N4EA 3BXNA 4QY8B 4LT7A 3QIWD 4PRIB 3QI9A 3SQRA 3T8QA 3P3YA 5DZLA 1VS1A 2O6CA 1W1ZA 3PWGA 2VCBA 2J8OA 1AXSB 1JZEA 3H2QA 5I18L 3AYSA 4PCKA 4N24A 3FEQA 4G7FA 3GIVA 2VEFA 4JTLA 4QRTB 2IH1B 4K3ZA 3IS4A 4W89A 1K6WA 1FFPB 3TVMD 4WI2A 1OD0A 1P7TB 3QY8A 2VR9A 4XNUL 3LAFA 1LD9A 3C5JA 3SFKA 2Y88A 3NCFB 2ROXA 5GGUB 4JFDB 5E23A 2LLEA 5FEWA 4GMSH 4PB4A 3Q2LA 3CFTA 4GQ9L 4KFZC 4Z7VA 4W6XB 2PP7A 2AGTA 4O12A 3HNVL 1L8PA 4PREB 4YVXA 4J6RH 1ODUA 3TLLA 4POUB 4PRTA 5CBEA 3QHNA 4YQXL 3MLPA 1XF4A 3MLXH 3CSYA 2KC0A 3HFMH 1OX6A 4EVNA 1NGXB 2VC7A 1X5XA 2ZXBA 2VIRB 3SBPA 4AZCB 3KH4A 2NV1A 5FD0A 3TV3L 3KNBA 1QRNA 1IWAA 3ZDYB 4K6AA 3CZEA 1DVSA 3B1TA 3EDFA 4FMKA 4FXKB 4X6CA 3SPCA 2IPWA 5F7MC 3V4UL 3E2RA 4H7CA 4F66A 5BS0B 3DA0A 1HOCB 2E4FA 1X6NA 4G6AD 1FZJA 2GAZA 4ADUA 5C9RA 5AYXA 1BXXA 4TUKL 5AHLA 3ZT5A 3MRQB 5IB2B 3ULVL 4LS0A 3RWIB 3ZSTA 5IG7A 2AXWA 1B6UA 1MFDH 2GIYA 4XMKH 1RUQH 1DWJM 3WQ8A 3H9SB 5IDIA 2X42A 4Z7NE 1H3GA 2BXVA 1E4HA 1TQBB 2PYEB 2ZCHL 4G7SB 4QIUA 2Q7YB 2NX5A 4QHLA 1A6VL 1ANUA 3UBXG 4NJKA 5DRIA 1TV8A 2CM6A 2AITA 4R96B 3RX5A 3QHOA 4C5YA 4PS4L 2OMTB 5ERWB 2GSMB 1QLEL 1P7KA 2WJEA 1PS9A 4JO3L 1L6WA 2P43B 5BZXA 3NPVA 2Y6SD 2EECA 5B3JE 3QO0A 4G8AC 1VGKB 3CFJA 1KGUA 3TCLA 4F3FB 1U8OB 1C16A 4EXQA 4GHRA 3GFZA 4GGBA 2J8UE 1FH7A 3ZVHA 4FIRA 5CCKL 3S3DB 1SQ7A 4JFOB 3AWOA 2I9EA 1P4IH 1KUMA 2NNAB 1UENA 3X2QB 3SSGA 1QNZL 3SD2A 2QDVA 4ZQRA 3NCCB 5EU3B 4XZIA 1FIGH 4NJJA 2HT2D 1FP5A 1DKWA 2QDGA 3UPBA 1IBGL 3NACL 4LVHB 3QDMB 1TEGA 3G5ZA 4OLVH 4LHQB 5DHDA 4KQ3H 2CJUH 4U1JB 4Y4KB 5BJTB 2X5PA 3DJZA 2Y1HA 2G75B 4FTVD 3SDCB 1DBJL 3LZFL 4DFHA 3AHTA 4PY7B 4ZMPA 2N3JA 1NJJA 4D6JA 4GRLC 5FO9B 4G7RB 3PWJA 4N2MA 1BYNA 4N2YA 2ICEC 3UZXA 4W5ZA 1VRSA 2OMZB 3TZVD 3ABGA 5GRWA 3B7YA 3REQB 5IV2A 4HCLA 2ICES 3VXQA 1E0TA 1G6CA 1LQBC 4NKIH 1ZOXA 1FFQA 3GHPA 4JW3A 1KYDA 4EUPB 1DQLH 1ZSDB 2DZWA 3KRUA 2A3HA 4RZ6A 2VLRE 3EGXB 2CLZB 3HUJA 3NIGB 3T44A 4F40A 2LVEA 2WKLA 1C5DB 3I9GH 3UWEA 2E3VA 4Z42C 4DX3A 4PGEA 1VYSX 2V8LA 3L9EA 2AEIT 3T8XA 3CVIL 4LMQI 3ITCA 4XHQA 2VERA 4P61A 1XYLA 3DPBB 3FONA 2K3HA 2JJVA 3B3DA 4LOCA 3IJYA 4ZVJA 3CS2A 3W6MA 3VACA 5BMFH 1QR7A 4OFCA 2IWEA 3B2XA 1M68A 3B6SB 1FAIL 3CVHH 1VFBB 4OU1A 1CI1A 4L9YA 3GG0A 3WLOA 1BBJA 3EOYG 5DS1A 4X0VA 3F4CA 4IS6A 3RUGA 2R94A 1FWBC 3Q1EA 1ASQA 1DPMA 1BFNA 1K6AA 4BDVB 3H2EA 4YQXH 3GNXA 4Z1PA 1N6QH 2EEBA 2YPVH 2P5WB 2I17A 1AZVA 3H6OA 1J5OL 1FBIL 4N4YB 3MRCA 4J28A 1K03A 1LO4H 2IVFC 5EZPA 3FQTA 4OGAC 2NQZA 2YL6A 4N9BA 1U6AL 3H55A 4X2PA 3ULAB 1QU4A 2CA3A 4KBPA 5AOIA 1PYMA 1CR9L 3SE4A 2Y07L 2O6FA 4IGSA 2FMOA 3F5JA 2FPVA 5H94A 1GPFA 3QEQB 4DN4H 2CKNA 4FQXB 1I4FB 1R38A 4ML9A 2PW1A 4B0MB 4YE4L 4BRVA 3PDGA 4YWGH 2YPLD 3NCBB 1XYZA 3RM8A 1G4SA 3J27A 3GRBA 2J3SA 2NX5D 3QAZC 1KKRA 1CD1A 2NDFA 4G1MA 1HL9A 5JR1L 3G77A 3MROA 3BP6B 4RMWA 4P8QA 2HN7A 2YCLB 2DTMH 5C0QA 2NQJA 4V2XA 2UZIH 1KENH 5KBDA 3RX2A 4HUCA 2H3XC 4L48A 1WISA 1DJGA 5IB1A 2R1YA 1IC1A 1LJMA 2R1WB 3CDGB 4UDTB 3CUGA 3NN8A 3ZJ7A 1BM3L 2IKIA 2L0DA 3O16A 2WUBL 4WO4B 4FFWC 4X7TA 2WQSA 1CI3M 1PL9A 4ORZC 5AAMA 4PBGA 3DV6A 3GM8A 1PE1A 2B16A 3DHDA 1Q85A 4J3OD 1CW2A 3HNSL 5HOSA 4EI5B 3CHDA 4LCYA 1XR9B 1NFDA 5A8GA 4JFEE 1HOEA 3QSTA 3ABKB 3UJRA 3UCQA 3SDCC 1B57A 4NDMA 2CKBH 1I8MA 3G5ZB 4TNFA 1BG1A 4MAUH 5ICYB 4JVWA 1BXAA 3FTSA 2YUXA 3WFHB 1QATA 4G6JH 3TSMA 4F2BA 2O6PA 5B7ZA 3GTHA 2X7LA 2OFQA 4RETB 1A7OL 5IEKA 1F45A 5E8NA 3KCOA 3BFWA 4G7VH 4JFHD 1CBVL 1JRBA 5CPLA 3VNMA 2H8ZA 2NY2C 3O9WA 1LLWA 3FT2B 3Q44A 1E7UA 1GVEA 3TE9A 1PLCA 1WFMA 3WEOA 4CVWA 1SVCP 1NDMA 5EEWA 3LH2H 4K7VA 5GJPA 3SUTA 3V55A 1A80A 5BRZB 2EICA 4QG8A 4R9XA 4JQ2A 3RFAA 1KLGA 2AQNA 2FEEL 1AYRA 3BZ5A 5D2NA 1MXSA 3IETB 3NRPA 1ZIAA 1HDMB 4GYKA 4PJAF 5CSGA 5F8RC 5DHYA 2A85A 3P30L 3MRJB 3OV6A 3POHA 4HC1L 4YEFA 1VCAA 2WXHA 3ARBD 1MCWM 5GGVH 1RP8A 4HKXA 4F2ME 1XLGA 3HBZA 2AJUH 3U7WH 2QPUA 2BDNH 3QFDB 4L3EE 3BLLA 1UZ6E 1KDIA 2D03H 4IHOA 2EO9A 3N41B 4UOW0 2NSMA 5IQ9A 5J11B 2J9XA 3KOZA 3ZVIA 1TQBC 1KJVB 1P69B 4OZHE 4G6CA 4C6LA 2AF2A 3CXFA 4FSAA 3UF9A 4OCWL 4J8RA 5F88B 6FABL 1N6VA 2D2GA 1MUJB 3A21A 5D7SH 4LNYA 4PW9A 2V63A 3TFKC 3QN3A 4W4QA 2PLMA 2OT1A 4NUWA 1BMGA 4ES9A 3Q2NA 4DWSD 2VAAA 3D4GA 3QA3A 4N6RA 2QUVA 4O17A 5AYIA 3AIVA 1BXUA 2ZIDA 3KR3H 1LEIA 5BZDA 1FFOA 2APBA 4P99A 7FABH 4NWUL 4F33B 2G0KA 4FI4A 1SEQH 4WW1B 1K5NA 2CKSA 3L68A 4PBFA 3SKOB 1WICA 1NGZA 4KTDL 1KC5H 1PKNA 3PBWA 2HVJB 3SGJC 5KJRH 5GZOC 3M46A 5CN2A 3UO1L 4LARL 4ZENA 4YZWA 1E50A 4FOMA 1IGJB 3OHIA 2O55A 3LIZL 1N2RA 5C08D 1MG2C 4UT6A 1X6UA 2O5ZL 1EMTL 3WUZA 2L4OA 1JDAA 3DTUB 4LSSL 3FFSA 4HHGA 3FB7A 1OK4A 1QBML 1UTDA 2A0NA 1FE8H 3CSYB 4L65A 2G60L 3MT1A 4ILSA 1J1XH 4NNYB 4V1DD 2K7PA 3MAWA 4O58H 5FYLE 2ZZUT 4LO9A 4DQOH 4I3RH 4F57L 1SU5A 1F6AB 2DY3A 4EP8C 5KN5A 5JIKA 4HK5A 4HZ7A 4M93C 1F11A 4UT7H 5C0FA 1P5UC 3GM0A 1O5XA 1L9RA 4Z23A 2XVNA 3HV9A 5LN4A 4PJ7E 2YEVB 2YXVA 1GIGH 1MF2L 5HHMB 2WUBH 1S7XA 4RAHA 5FOBA 4JNZA 4XPFH 3NN8B 3II1A 5TDPB 4DBSA 1JXJA 1EIBA 2CGZA 5FYJH 2DL2A 1VJZA 2DQCH 1KA9F 3L5LA 2H26B 4NRYB 4MNGB 4OI9A 3GG8A 4HJIA 4MIMA 2FZ8A 3RHWF 2FB2A 2R24A 5I8OH 2F53A 4I7UA 4HKPA 4L23A 1NFDB 1EJOH 3RWDB 2PDJA 1FZMA 3MA8A 3REVB 1RUKH 4O5LH 3QIUD 4HSCX 3O4LE 1SW7A 3K13A 5GVJA 2CO6B 2E86A 3WY4A 4WVXA 5TPWL 3FU7B 5I9QC 3MC5A 3VW3L 4GRWH 3WL1A 5HDOA 1I2PA 1F2QA 1H0IA 2X4QB 1JFQL 4W4NA 2GY7B 2D4FA 1BW8A 1E8WA 1SJHA 1WZAA 2CUHA 4AE0A 4Z76B 5C0GB 2ZP9A 1Z1WA 3CH1B 1AG1O 1HGYA 3EJZC 3B06A 3MLYH 1UZGA 5T91A 1EJFA 1H3PH 2J4WH 1NGPL 3GUFA 4FEMA 1Q6CA 3CO4A 3LMJH 4GZEA 2J1XA 1O9ZA 4NAFB 5H91A 1SN5A 3QNXA 5J5EA 4Z95L 1OAQL 3C5ZD 1WAAA 3SO3B 3I3BA 3HKFA 4AGPA 4OVUA 1JGLL 1KGYE 5BRZA 4LHUA 3OR6B 4X9BA 3VCLA 3NNTA 3UTTA 4NGHL 3LQZA 4K1WA 1LP6A 4GIPD 3V0JA 4HWBH 3N73A 3QEQE 3TJPA 3UTZA 4KVCL 3NURA 2BODX 4YWSA 4ZMAT 3HZVB 4LSTL 3F6IA 3CT7A 3U36A 3VIGA 5FL1A 3L3OA 1A4CA 3B05A 1DN0B 2OCJA 4KFMA 2W88A 3TTOA 5IVXA 3SUVA 5L2JA 2CIKB 5DRXB 4QRQA 1N59A 2AVGA 4AGQA 4YHNB 2XG4B 4JQ4A 3CZLA 3QIBB 3KPSD 4EUPA 1K7FA 3E0VA 4H13C 1JCVA 4NIRA 5C6WH 1IBGH 3NACH 1DJNA 1H6TA 3ESPA 3FZUD 4FXTA 3O41B 4KTEH 4PSPA 3U25A 3UERA 5JHDB 4JNXA 1RULL 3LRSB 4ZQKB 5I1AA 4DLMA 2AQRA 1KZYA 5F0PB 2AQSA 2X87A 5LHDA 4NWUH 3H21A 2YDAA 2W0UA 3SRFA 4FQIL 2DBLH 3B9KA 4D9LL 4GO8A 1Q8MA 1N5AA 5EOCH 2XWTB 4ZUUB 4R7WA 2O1AA 4OWGA 5E8PB 4NKIL 1JNHB 1YEEH 2HT3D 2IH3B 3KGRA 4IL2A 4G70B 2JKPA 1RY0A 2H0FA 4L64A 3JT0A 3UGUA 3CFBB 4PS4H 2XN9E 1SUJA 1TTRA 3IRZA 4IW4C 3T0TA 3VG9B 4FLHA 1PDZA 3GB7B 4QX4A 5JPNC 3FSUA 3DGGB 2QVTA 2Q3RA 3Q6FB 4ZUTB 4ZUWA 4LESA 3SQMA 2ZCZA 1XV8A 3EPNA 1B1YA 4IBUA 3EGSB 2C6QA 4FQPA 3N40P 1UUMA 1WT5A 3B0UX 1OV8A 4CAGA 2LLGA 3Q9QA 3IJIA 1EUUA 2EDQA 1RZKL 1SOXA 2X0YA 2X0UA 1A4MA 3K7UA 3NFPB 2OULB 2QKSA 4JMNA 4DT2A 4E42B 2F38A 4DVBA 3NO1A 4OIAA 2YD8A 4AEIH 1MAJA 3RIFK 3DJSA 1MN4A 1S9XB 4GMSL 4JFQA 4N8CH 4BK5C 1CICC 3BP4B 4FA8A 4YHOL 2O7SA 4ZOAA 1ZRUA 3P77A 3SE3C 3RU8X 3MU3A 1CYXA 2ZA2A 2FO8A 2ZYIA 2AP2A 2DIKA 1OSZB 1A1NA 3AQXA 2EDXA 4N5ED 2AQTA 3ABZA 4WAFA 3CHEA 4NQTA 4JFDA 1KYOK 1MFUA 3X14A 5DUBB 2Y07H 1YN7B 2C3HA 1V08A 2HISA 4HYRA 4ERGA 1LP9F 4REQA 1EUTA 4P23C 2XFWA 1Z2KA 2YCLA 3Q37A 1WIPA 2VW7A 3W9DB 2PTTB 3DI3B 5D6CB 5HGAA 2EVHA 3G0UA 3OA3A 4CC1A 1JCNA 1UKSA 2WP3T 3QQDA 3PGFL 1H7XA 1NWSA 4HNCA 1BZ7B 3ALXA 4LVDA 2X1QA 4GLEA 3G2GA 5I3GA 1KN2L 3EBIA 4DRSA 4JFYB 5CEZE 5IHUL 2CHOA 4I8YA 2PO6C 3MBEA 3WUWG 3WH9A 2VXSL 1E3ZA 1I1RA 4UILL 3QUYA 1E42A 2CM5A 2GAZB 1P9MC 2E7BA 5K9OA 4NYUA 3FV9A 1DQML 4GABA 3EA3A 4W7UA 4E9LA 1H7NA 1TYRA 1DVFD 5HGDA 1KFKA 2DSWA 1EDHA 1YY9D 5BMXA 3AY4C 4UB9A 2MSPA 4WTWA 5TE4H 2IPUK 3VCLB 3BG9A 4P4KB 1PJ9A 1C12B 2IDQA 4RZ5A 1SQ2N 1E65A 1CF8L 4NM8L 4QXUL 4QCFA 1CDGA 3D2UD 3NM1A 3T6QC 2JCCE 2NQCA 5E2TH 3EMZA 1SEBA 4KRPC 1J18A 1MNUL 4C7GA 4AHOA 4LLWA 3TN6A 1TZ9A 2ZRXA 3MHFA 4FOJA 1ET5A 2YPKB 3DMMD 4HKJA 2OPCA 5IVOA 4ATTA 2Y4SA 4K15A 4EXKA 4WDXA 4EACA 1REQB 3QO0B 4E5XA 1YMMD 1TJPA 1GSKA 4PWGA 2X30A 4ZO8A 2NLJB 1CICB 1ZVSB 5AW8B 3NYZA 3NJFA 1ROWA 2UWEA 3QORD 4J40A 1C16B 5K9DA 4PYSA 3G5VA 3HE6B 2IWFA 5CM1A 5F1NB 1JN6A 3BWWA 1I8LC 3JWNH 2GK1A 3KPNB 1HG3A 1INDL 1DBJH 2VJ0A 2V3FA 3C6LD 4OSUL 3WLQA 4GFTB 1BZOA 1UACH 2AANA 3OJDB 5I19H 5D04C 4AQLA 2XWTA 1TR1A 5DQDH 1FFNA 1VCGA 3Q4DA 1Y7VA 1B90A 1Z0MA 3V0VB 1GGUA 3HBQA 3A3YB 2OX1A 4OBTA 4OJFH 3QR2A 2YQ2A 4M9PA 4QHNB 4DGUA 2DL9A 2V5KA 1NF0A 2DLFL 3P9MB 5HHOD 3WLMA 3WFEH 1NM9A 1CFSB 3ILPA 1CE6B 1PF3A 2C1OB 4P8WA 2GQAA 3HHMA 1KYFA 3ELQA 2QSQA 3KGSA 2CKRA 4CC4C 2H6RA 4NI3A 5HYQA 4KFNA 1OGAA 1ZK9A 1HXYA 2GT9A 3LHWA 5D1XE 5GGVL 4I4WB 4K7YA 5HULA 3VU2A 3UR8A 5BZDB 2KAUC 2X41A 35C8L 4NG3A 3PPFA 4P04A 5IHLB 4B3KA 4DB7A 5I15H 1B0RA 3UZEA 2GOKA 4KX8A 3N1MC 2R23A 1WUNT 3VFPA 4RESB 5KETA 1DE6A 1T2JA 1XF2B 5F3BB 4FPSA 4KY1H 3QXUA 1WC7B 1QFUL 3H9HA 2AJ3B 3IAQA 4MJID 4X99B 2SEBA 2WB5A 2IAAC 3AZUA 2R4RL 3NCYP 5L0QC 1JTPA 1MPAL 1P0NA 2EF9A 2HVMA 4EXBA 1I7RA 1B0GA 3VWKC 4XOCA 4IL0A 5A7EA 3KE0A 2Q3AA 1S7SB 1XO8A 3L5WA 5JPMC 1V0MA 3GZ3A 1A7OH 3U2SA 4QSFA 4EIBA 1IAOA 5KVGE 3UCDA 3VFGH 3AQYA 5CMAA 1N5YH 3CHPA 3DFSA 1OFOA 3WN5A 4IOIB 1E6PA 5I3HA 4EPDC 4KIRA 1HXJA 4ZDHA 3B4NA 5DA0B 4RQQB 2QKIA 1TQCC 3D0VA 5M95B 1P4CA 4U4IA 1E6NA 2PRMA 5D6CA 4M1GH 1ZTVA 5EFIA 5I1JL 2KDGA 3V0WL 4UTAH 3MRCB 3MMTA 2PC4A 3KPLA 1HU8A 1I31A 2NY1C 4QRRE 1A5NC 1XBZA 2WNNA 5DRWA 4KKBC 4OBSA 2YL9A 5CP3H 3BP7A 5AHFA 5HHNB 4L1DA 1CFQA 5KVFH 1HZYA 1AZCA 4OD2B 4E2BA 1W1VA 5JIPA 4F48A 3GJFH 4HEMA 4RX0A 4LCWA 2NUXA 1A22B 2PXYC 3KYMB 1SO3A 2YD5A 1MW2A 1JP5A 5E9NA 3OPUA 3MRDB 4FN0A 4S1DD 3RNKA 3DHFA 1RHCA 2UZXB 2EXYC 1A1OA 4DCQA 4ZPVB 1C7SA 2R82A 2QKIC 1E5JA 1GYVA 1W8OA 4BFIB 1DANU 1DBBL 1IM3B 1UURA 4ZMVA 2Q6WB 3TA3D 2V37A 1X8CA 1H63A 3NZ1A 3CXHJ 2WP3O 1XLKA 3UWUA 2YMTA 3VB9A 3B0YA 3R89A 3WHE0 2B3RA 2BHFA 4LHUD 1EZLA 4Q97A 2YPKA 3PFQA 4HKJB 2BOBB 3SM0A 5E8DH 5GISH 5E1HB 3IRSA 4Y90A 2IQAB 4UU9A 3QJSB 3TCEA 1J87A 4H1LG 3W2DL 1GVFA 2NLJA 1H3WM 5C0IB 4MJMA 1J10A 5C09D 2OLSA 3PL6B 4PJ9B 4OY9A 4B9JA 2HX7A 4MAYC 5AC5A 1YC7A 5B4MC 1U8QB 4M29A 1A50A 3CCHA 4B5XA 3UESA 1A9EA 3KP0A 5EMKA 3VB8A 1NCAL 2A9AA 4U6YB 3WQPA 1J8VA 4BY3A 3VI3A 1K70A 3FF8A 3M5ZA 1ONRA 3OKLB 5KW9L 1C1EH 2C4FU 3UPRA 3BAYA 3NEXA 3IJQA 3IU3B 1WA2X 3QQXA 4YBLB 2AJZA 3F84A 3ULUF 2EPOA 2OMTA 4JTRA 4G9FB 4ETQA 4KJPC 3ES8A 4JKMA 4M80A 3GHSA 4QHUB 2Y7EA 4GRLB 4J3OF 4NO2B 4BZ1H 3H7VA 3LPOA 5CLZA 1VGKA 3CFJB 1CVSC 5EWIL 2JJWA 1RD6A 1ONEA 3HQNA 3SD5A 3SYPA 3OG6B 2N1KA 5DURD 4C1NB 1THFD 5KYYB 3V75A 1Q72H 4XXDB 5D1QA 4I13B 2FTWA 1FVCB 4TNWF 5TH2B 2DQCL 2ZSVA 3BVWA 3MNZA 2CDGB 4MDJB 4X8GA 3BPCA 2F8QA 2SFPA 1SO4A 1SF3A 3KPRD 1UR3M 3UG8A 1K8YA 4Z78A 2EACA 4N9DA 4WEVX 4RKAA 1UCBL 2VN6A 4F5CA 4UCGA 4WFGE 4I9MA 3V8OA 4ZMQA 3HKZA 5H37G 1XF2A 1I9EA 5KZDA 3TU9A 1JYXA 1HDMA 4UFHA 1MWAL 4GRWB 2Y69B 4A67A 4K3JL 2E28A 3RY6C 2JI3A 1SSDA 3O4LA 3H4WA 1OIFA 2XRAL 3IFLH 3KYOA 2ASHA 2VDRL 2OMZA 2PBGA 1ACYL 1R87A 3PWAA 4E9WA 3L9BA 3U2SB 2DPEA 3E2HC 2Z0IA 1YEIH 43C9B 1HHIA 3QQ4A 4D9LH 1YTDA 2P76A 4MD0B 2GSJA 4IWWA 4Z2GA 1EA9C 1XLCA 2B7PA 1NEUA 1T2XA 4TUOB 2R4RH 2PGRA 3LN5A 3WQ4A 1CWVA 3BWUF 2Z0BA 3QDGE 2H90A 4YO0B 3BZJA 3IMWA 3WTWA 1NGYB 4OCSH 4POZD 4TVUA 3U1SH 1EEXA 2EXYD 3QFWA 3UO1H 2E46A 1BQKA 3T0XA 1RALA 1TTFA 4OIIH 3GNPA 3B2PA 4QOKE 2BCMA 4G8IA 4KI1A 4GS7C 2J20A 3ZYZA 1XLAA 4Y4FD 2BWGA 5KSAA 4BGLA 1NCJA 3BP7B 4M1CC 5F96H 1T5XA 3IRPX 1BAWA 4J3SA 4WTQA 1S9WA 3WNMA 4R7XA 3QPEA 2FCBA 5FO8A 1TIMA 3GNNA 1RL1A 3O3DA 1CGYA 2HTKD 4IS6B 1GMEA 4LPXA 4MD4A 5DHEA 5TDOA 1GOQA 2Z6IA 1EQWA 1OYAA 2ICWI 3QDJB 1BLNA 4ZMLA 3PTDA 4IIEA 3PZQA 3BAWA 4MMXA 1YDPA 2J1KA 3NPXA 3MRDA 3BPOB 4ODTH 5E8EB 4F91B 1GZJA 4F8LA 1JFXA 4X6DF 5EIQA 3L2LA 4PE8A 2FT8A 1FORH 1OW0A 1W0VB 2Z91B 3KPMB 4JR5A 3WNPA 2Y5SA 3CFUA 2W62A 2TYSA 1KTLA 4AVJA 3SECA 1BF6A 1MZYA 3EGJA 1XCTA 1IIIA 3CV6A 1V93A 4NUGH 4HKBA 4M61A 3VXMB 4RFEB 5FB8B 2D3LA 2A74C 1SZRA 4WU7B 1AO7D 2OZNA 3L3JA 5D02A 3FO2B 1N18A 2CWXA 4N6EA 1PIGA 3MDWA 1NF7A 5LWYL 1ZHNA 2K4WA 2VZ1A 2QQNL 1S5TA 1I4FA 5TDPA 3MRMA 5D9MA 5G5IA 3ZWTA 4K5MA 1G6RA 4A7SA 2BNQA 5B80A 4XNDA 4NCC1 5FR3A 4OLEA 4BZYA 1UW9A 2PDFA 1NTDA 1U3HB 4OW6A 3FT1A 2EDTA 2QVIA 5JIWA 2GBAA 3O6KL 1NBYB 2UWEE 4GKNA 4HALA 4LAQH 4UIMA 4X9IA 1VF5C 4UILH 3TJEL 3L4VA 3LKNB 3SGKC 3R8GA 5LIWX 2B81A 4PV9A 5KVEL 3UPRB 4GUCA 2YK1L 1QA9B 3HN3A 4XC3L 5GSRA 2FVMA 3B0XA 4LYRA 4GQ9H 4WZHA 4XZNX 1D9EA 2CLVB 4GIRA 5JIIA 4NNCA 4GKTA 4X7SL 1A3WA 4DBUA 4S1DC 4TOYL 3MMWA 1OP5H 3BYYA 4H0HB 1M7PA 4WO4A 2YBUA 3PPSA 5T1JA 2QPDB 2ILLA 2RDXA 4GBUA 3FHEA 2RALA 1WDRA 1OX4A 1U3JA 3BFOA 2BY0A 1OP5K 3QW9A 3OXRB 4ORGA 1ZB5A 1LM8V 2WIMA 4Z78B 4DO7A 3SDXB 3LS5L 2J6EL 3FSVA 3DHPA 5REQA 2XX0A 5C9KA 1CXLA 3C6LB 4XZ4A 1KSRA 1KBGH 4C6OA 4GI8A 3OVRA 2GITB 4QUOA 4XXWA 5I66A 5J7CC 1KD0A 2HH0L 3VXRD 3UNDA 3NYKA 3DIFA 1M05A 1ZEAL 3HGSA 1MIEL 3MMEB 3HURA 5J6HB 4KJWC 4IKKA 1EEZB 4M5ZL 4RGMC 3WSQL 2WINB 3OVGA 1F3DH 4EI5C 1PWMA 2WCPA 4MZYA 1Z6JT 2EVGA 3GMNB 2VDKH 3U2IA 1QNVA 1P5UA 2A74B 1QAPA 4QRQB 1A47A 1UZ4A 4Z1YA 3WH8A 4MD0A 3UXFA 4H83A 3U57A 2VELA 3GSMA 5ENWB 3BD4A 2K8MA 1SGKA 1NDMB 2BCKB 1CL7I 1CT5A 2E9MA 3WF2A 1ZT7B 1W31A 1ZQ5A 2YL8A 3TYUA 5L9DH 3UCCA 4E0CA 3W57A 4XN2A 1R3RA 1XGYL 5D96C 5JXAL 2NZIA 3BAJA 3QC6X 4C4KT 3S37H 1HFBA 3M0LA 1V7NH 3ZKXB 2Y23A 2Q6ZA 2SEBB 2WSQA 1PX3A 1PSKH 2B2XH 3H70A 1CGTA 1WS7A 3S88H 2XZAL 3LHPL 1QSVA 3WHXB 3NDYE 5D7JD 4KZEH 3MOBH 5ICXA 2XZ9A 4AFYA 4FERA 5FO8B 5GZOA 4BQBA 2IIJA 3RQ3A 2D7NA 2REQB 5DJYB 1PLGL 4YHMH 4YXKL 5B8CB 1LXMA 3G1XA 2ZF9A 2XGIA 4ODTL 2BWQA 1CDBA 4PWKA 4DOHE 2UY2A 4Z3GA 2V5JA 1IWBA 2V6AA 3S46A 4DN1A 4EPKA 1T6BX 3U4EB 1BFTA 1QHQA 1KBIA 3PB0A 3DRTA 3LUTA 3D3VB 1PKQB 3PWPD 4G71B 3U83A 4AT6B 4ELMF 1EF2A 4I8DA 5FF4A 1XAKA 2OP4H 3WIHH 4N8CL 1GJIA 4GJIA 4TUFA 4GC4A 3PHOA 4MYWB 1NC2D 2G2PA 3STGA 1UB5B 4OUIA 4ODVL 1KCWA 5J4MA 1S7UB 3WO4B 4U49A 2DYPB 1RUMH 2AXFA 3C6LC 3VU1A 3GVVA 2GPZA 4KNSA 2KPWA 5A69A 1NIUA 3I9GL 4R84A 2NY1B 5JW5A 3MP5A 3QEUA 1Q1JL 4ELME 2EDBA 5JBDA 2NYYD 3UR7A 2MUCA 1JZ4A 3EHBB 3K8MA 3LS4H 2I60H 3QCVH 2EAEA 4JRYD 2XACC 5ID1B 1SOKA 4QR6A 2BGNE 1GW0A 1WITA 2JJSA 1JPEA 3EHBC 3EX4A 4N26A 4DK6A 3B8VA 1WSST 3OHXB 5BV7H 3GSQB 1GTEA 2ICSA 2QGBA 3QDJE 1A3QA 2JKWA 4GKNB 1UZ1A 5EFFA 2BSTA 3SBFA 3A4WA 4U7SA 4N28A 2GJNA 4M3JA 4IMGA 2AL2A 2YEZB 1F11B 4HWZA 5IKCA 1PSCA 3CV7A 4YNGA 5E0FA 3GHEL 4JJ5B 2C34A 2EPLX 2FHCA 2W61A 3QQDB 5C2GA 5CILH 1QWGA 5D7IB 1G7MA 2VEGA 2XYLA 5DMJB 1OP3K 4F3FA 3D08A 3IGAA 1XVSA 3MUGA 4EMZA 1EX0A 5F1VA 3UWWA 1KCRH 5H2BA 1IGSA 4NKQB 1BXCA 1ADQH 3S1VA 1GS6X 1AAJA 3HE7C 2XQYG 4C90A 1PPIA 3KXFE 1F76A 1UUQA 1UD6A 1UA6L 3G24A 3W23A 2RDWA 5JYLA 1K8IA 4FG6C 1R8LA 4ZSOB 2VLJB 4Y8DC 4JZOA 3PM6A 1TZHB 1KIRB 3KGUA 1KPRB 1EXBA 1B3IA 4LASH 3DIVA 2FLBT 1V6VA 4PY7A 4YWGL 3IDJB 4PS7A 1G7HB 3SDDD 4ZQPA 3A5FA 3TP4A 3EXSA 2NW3A 2BIHA 4JFHE 4ODHH 3AJ7A 1VADA 2P9RA 1CQYA 2X4OB 2ZFAA 2CZFA 1M1SA 3L3HB 1INDH 4J1UA 4N9GB 2A4AA 1SJBA 2XI9A 1BREA 3R7QA 3I6LE 1REQA 4Q8OA 3C5XA 4PJ5D 1VFLA 3HG3A 1A6WL 1RJZA 1JOIA 2AV1B 2PP8A 4U1KA 3RVWC 3T77B 4EOUA 5TGBB 2L7QA 3VE9A 3ET9F 3RWEB 4Z7AA 3MFFB 3MRPA 4ODBD 1QLEH 3IYLW 2ED7A 4X83A 1TTBA 4XBEL 2WTRB 3LQMA 3DCPA 4O51A 5AB9A 4H8HA 1OVDA 5TQ2H 4L3ED 3S8GB 4TN9A 3SO3C 4Z0BL 4K0OA 2NYKA 5TE6H 5ESQB 5DHMC 5ALBL 4NZJA 2BGQA 2HX9A 3HVDA 1F4XL 1MHPL 1ETB1 3HAEB 2IG2H 2AEOA 1TVBA 4QLKA 5BZAA 3Q0HA 4W9GC 5PTDA 4PTUB 2X3BA 1UUOA 2QVKA 4AWSA 2P10A 3VNKA 2BRQA 4PLJC 4WX2A 3I3EA 4D0CB 4NPYB 2BFGA 3E2HB 5F70A 3I9AA 3VRJA 1PLBA 1LTXA 5ADOH 2EDMA 2DM7A 2KPNA 4URTB 5FHAL 4I4WA 3W1QA 3VZZA 2HJFA 4FFYH 4FFTA 2BMBA 2GW5A 4Y2WA 4AWTA 1FUNA 3ATEA 2QDEA 1EPFA 2VLKE 3G04B 2EDJA 3E96A 2V9UA 3JZUA 4YU1A 2UY7B 1T0MA 3MACL 3R8BB 2O9PA 1YYLH 5KSBB 5D6DA 3GH4A 3OB8A 3MLZH 4HJTA 4L8DA 4DJFD 3F7VB 1QR4A 2YZ1A 4MD4B 5EPDA 5HI3C 2BVOA 2K45A 3MLSH 1C29A 1K9DA 3MWAA 5F7NC 4HT1L 2VC6A 1HE7A 5I23A 3TYEA 4OIIL 1U83A 2UVEA 2IAMC 4N42A 4HPOH 3UJFA 4LL1A 2K6ZA 2E9IA 3OAYK 1YNKH 2PWEA 4Y5VB 2I9TB 1DQJB 1TUFA 3O2DL 4LLQA 1B4KA 5HBBA 4NQEE 3RFZC 1J96A 2R8SL 2QHLA 3RO8A 2BDNL 3GJFK 5CJ8A 3OHXA 1KTNA 3USZA 3VIPA 1PZ5B 1ID2A 2Z31B 2Y7OA 2GABA 3LNPA 4A2SA 3TZNA 4P2YA 3WXVH 1IC0A 3WBWA 2WQVA 4RWHA 1OZUA 5J0BA 1Q6DA 1OWWA 2I85A 3SOBL 1D5ZB 3NVTA 2E27H 1OE1A 4PV8A 3KBSA 4M48H 4POCA 4G1KA 4IRZH 4IRJC 5KZMA 4A05A 3JW7A 1GA2A 5C08B 5BVPH 1K4CB 1RJYB 1UKPA 1D9KC 3U1PA 1HNYA 2FDBP 2HKHH 3F3HA 4KI5C 4Y7OC 5CP7B 1OQOA 5GQBA 1NDTA 3QPXH 3IIXA 3NQDA 1QCWA 1KMGA 1WKYA 5ANHA 3K2MC 1E9ZB 4WHTA 2GQ3A 1SW3A 4OV9A 4B92A 3FFDA 1UJ3B 1YN7A 3HZKA 1UWYA 4JHWH 5DRNB 4PHZA 1G6VK 1KACB 2JB5H 3DVGA 3SGEH 1D7BA 1YJDL 2Z26A 1E70M 1KPRA 5FPIA 1KCVH 4XH2A 5KVDE 4FO4A 3TYDA 3TJXA 4HJWA 5D7IE 4LEBA 1J1PH 4HSAC 2F54E 2V2XB 4NAEA 1RERA 2N7BA 4WJG3 3ULUL 1PXGA 3ANYA 4GP8B 4XVJH 3HB9A 3CQQA 3D30A 4YHKL 4JRWA 5KOVC 3S4SB 2CDEA 4DZAA 2A9ML 3WY2A 5FYJU 4JTJA 4P5KB 4DEUA 2VENA 3GR8A 4F15C 2W5PA 3S5LA 3GHBL 3ILEA 5I09A 4IF2A 4CNTA 2XIJA 1SMDA 1OM3L 3L54A 3QOMA 1J5TA 4W9LC 2Z31D 4V1YA 1IXOA 3WO3B 4JHVA 1R3KA 2VITB 2DVUA 4FIQA 2ZF8A 4OZIF 1ORSA 3VQ1C 2CR6A 3K2UH 1IL1B 3CCHB 5F1UA 2I69A 1OWQA 2XJLA 3B83A 2PLKA 2PW2B 4HIHA 3WGVB 1LRQA 4WHBA 4LCUA 1R0MA 3PTQA 1XL4A 3QJXA 1EOKA 4XP6L 3GRGA 5KZCD 4S11A 2RJGA 3QPYA 4HUUA 4M3PA 3C4UA 3BWAA 4WGVB 3H4FA 5DMGD 3UAAA 3CYVA 3BUTA 3G7TA 3TV3H 4LF3A 3HNSH 4GRLA 4OJCA 2B7QA 4QGYA 1QPKA 2CXEA 4E5TA 3WLIA 3ATBA 4JM2C 2BG5A 5LBSA 1QUNB 3S6CA 1PY9A 2F8IA 3VW3H 5IEHA 1IUZA 3EH1A 4YAQB 2N56A 1MCHA 2Z6JA 2GSGB 3A64A 3ZRCC 3GDLA 2R59A 5D7LB 5CBBA 1HWHB 4AVHA 3GG7A 3R94A 2QHRH 3ZL2A 3WUGA 8TIMA 3ZHKA 1SDDB 3FB5A 4JO1H 1S38A 4KKCC 2Z7ZA 5HBFA 1FFNB 4I1NB 2BSSA 2HUEA 4PJ7A 1Q45A 2BZ7A 3LENA 3EOUA 2RBLA 2W79A 4HNUA 3SPVA 5D38A 2MH4A 2I27N 4K2UH 3RVVD 1X5JA 5C0RL 1B4EA 5ACZB 2ISSA 1RV8A 2OODA 3M0HA 1MH5A 2VOTA 3E7JA 4QJ3B 3ROLA 5BXFA 1R7AA 4JS3A 5CPNA 3W88A 4JRXE 1G7QA 3HI6H 3U9UA 4LDEB 4N20A 4AC7C 3WFDH 2DI9A 1NBZA 4NKOB 4Y5VA 1E2VA 1PNDA 3LOTA 2OL3L 1PQZB 1HHIB 3QQ4B 2VE6B 3AT8A 3H2CA 5G2NA 5LBSL 1Z9PA 1TELA 3DKLA 3EJPA 5IROD 4XPAH 2XT1B 3K2IA 1PKOA 4IPLA 2Y7FA 5CZKA 5L8LB 4L56A 2CK0L 3AXHA 3KL3A 4KXZH 2FB3A 3FQNA 3PDOB 4N86A 4R4FL 4GUQA 4LGXA 4H9VA 4FQHB 2DYPA 1SMOA 1IHIA 1VYRA 2XVBA 1Q6GA 4NQVA 2YPLB 1R2RA 2J27A 3BDYL 4FMVA 1HKLL 4W93A 4HK7A 3WNNA 5BUPA 4O2FB 4R0LC 4N9OB 2CLKA 3ZE0F 6CGTA 3FJLA 1D3GA 3HC3L 4A2FA 2B5IB 3UABA 3NOEA 4FTVA 4QG9A 3NIFF 5ITBH 3TX9A 1H8NA 4CCEA 1L0QA 4UNTA 3FJ6A 2PETA 2CUMA 3AUWB 1G9HA 2YWZA 3V4VH 3D4CA 2QJDA 5J12B 3BKYL 3QRHA 4F5CE 2PGWA 2PXYB 5DJ0A 2NXZD 2MQ0A 5DXWA 2BVPB 3CZJA 3QXBA 4BWLC 1AR2A 1VCFA 4WW2A 3HG0A 3NAAH 3SQBB 7TAAA 3IGKA 2QKIB 4KV5E 4A04A 4B15A 1QPPA 2YXXA 2DT0A 4XPHH 1Q1JH 1JZ8A 4YHPA 2F1AA 4RRPA 3ZDXB 4LVOC 1FDJA 4W88A 2EXTA 2P5WD 4NYLA 2PGFA 2M1KA 3GYRA 4ZT1A 4RR4A 1L5GB 2W9EH 1E55A 4E8CA 1FKWA 1SZGA 4Z76A 4MNJA 4MKNA 1KJ3L 4QRRD 2WANA 1EJ6A 1PD0A 1XDJA 2VR7A 1BQHB 1E43A 1JJUA 3ARRA 3KHJA 3PR2A 2WMHA 4S0HA 2AV7A 4XC1H 2ISDA 3ML9A 5AZEL 1I2RA 1OVZA 4QTFA 1LVEA 2R29H 4UTJA 5J1TC 3ZJAA 1JGUH 2UUDK 3D33A 2YRLA 4I3RL 1EL3A 3PHSA 1OD7A 4R90H 3W0WD 4CLMA 1VEMA 4JZOB 4S38A 3IU4L 3WG6A 5KTEH 5H6HA 2WN2A 3W82A 3MJ9L 4NO0D 1QW7A 1UM4L 3QUMB 2EJAA 2HK1A 2FBJH 3ZIYA 1VEPA 2AXGA 3OAUH 3QM3A 3GW3A 4Z1BA 4FXGC 1FWTA 2GUYA 4JX0A 5TFSH 5JDSB 2KBGA 3N1GC 1FH2A 2FH6A 3HZVA 4MXQD 4LCUB 1OADA 3CQJA 4BWUA 3L66A 4JY8A 4S39A 3EW3B 5IVXB 1Z9SB 3N1FC 1V3KA 4Z7QF 3UA4A 5BYWA 3TIDB 12E8L 2DQJL 5IBUB 1AO7A 2ZKXA 4A7TA 4AGOA 4CADA 4DPCX 4KXBA 1C3FA 4UZSA 2B7OA 5AVNA 1QRND 5SV4A 3MYJA 1JFHA 4UFKA 1MLBB 3MC0A 1K3ZA 2YAEA 2J8UB 4GEJA 4XP6H 1TKKA 3QGKC 2HH0H 1CFVH 1OK8A 1H5VA 4JVPA 4XVUC 1Q0XL 4NQDE 3RDTA 3VGEA 4E38A 4O51B 1R3HA 4XNBA 4Q4OA 3L1EA 2ZBTA 4WKFA 2OOFA 3NK3A 3PIQB 4AV4A 4KCWA 4ZAKC 1ESOA 2W9MA 3GXMA 3LKRB 7REQB 4JN2A 5AOJA 4HEME 3E3QC 2DBJA 5E2VH 4RXGA 5T1MB 2XVKA 4WI5A 1U3NA 1M05B 4QHUA 4Z95H 5EORH 2J9ZA 1NAMB 2MTAA 4JBRA 3VIMA 2Q0ZX 2VI0A 4A6YB 4W9TA 1UEMA 2K6YA 5GGQH 4D0CA 1EKOA 1LLZA 2XJKA 2WWDA 4FE9A 7XIMA 2ZUSA 5K4XA 4EDXA 2VJ8A 4ZUWB 1V7NL 3LPWA 2A4EA 3PRZA 2NX3A 5INCB 1AD0B 4PJFE 3S97C 1AS8A 3PP7A 5KYUA 5LNEA 3RURA 4R9OA 4KDTA 1OAQH 3G5YB 1PZ2A 2FJGA 4HN8A 3OKKA 4QHMB 3VFWB 4LLVA 1XGEA 4WUIA 1K7EA 1A3RL 4PP2A 1HSAB 4MJIE 3CLFH 2NCMA 5LBSH 4GO9A 5TF1L 4Q0XH 3DX5A 1HT6A 1GZPB 4M7JH 1E4KC 3FH7A 1YQ2A 2HS8A 3P77B 1SFLA 1UJTA 2XWEA 3W81A 4AV5A 3LD8C 5J06A 4UTBH 3ZL1A 4ADGA 2F6UA 3LKPA 5DJYA 3UTQB 4A68A 2DJSA 1EBGA 1HKWA 2R14A 2MNUA 3MJMA 4XB3A 2V2DA 3OLGA 1O68A 4ATDA 3B8IA 5I02A 3I2CL 1MHCB 3N85H 4A29A 4DXVA 4OR1A 1XR8B 1TTQA 2TMDA 3KW8A 1CLYL 3WX7A 1KCSH 1M1XA 3FRPB 5IBXA 4N2NA 1D5RA 2LR4A 3ARGA 2OMNA 3O2VL 1D5IL 1VERA 3IJ9A 4XP4L 1QSFA 3BAEH 1NCDH 2R15A 4PJGA 1NBVL 4D0DB 2GGEA 3K1GA 3L5HA 4JIIX 3WLLA 1T1WB 3B2VH 4KXZI 4MQXD 3F12A 4JFDD 2E75C 3VFVA 4C4BA 3MBEB 3R8HA 3QZNA 4PUEA 3W22A 1AIFB 5SWQB 4OZFG 5C9WA 2PO6A 5A16A 4KIEA 3NCJL 4NQDD 3W6YA 3LZPA 3MNDA 3B9AA 3WJLC 3SCWA 4A2RA 1UZ6F 1IM9D 4JHAL 1JPST 1DVYA 5BV7B 5JOFA 1MZHA 1OM0A 5F7BA 2VX7A 1UM4H 1W3NA 3FNDA 1R3TA 3AU1B 4P46A 1Y8BA 2KZKA 3LYEA 3KTXA 3QIWB 2Q7AA 3O8XD 2GTZA 1A3LL 4B9PA 1K9EA 3TBCA 1CL7L 1UM6L 3T0WA 2WXLA 1TV3A 4F27A 4GH1A 4F79A 1IC4L 3GXFA 3CH8A 3EOAA 2A0LC 5CU9A 1U5HA 4HS8L 5IQMA 2AL2B 1ZCRA 3MYPA 3NXLA 1PS3A 2I9LB 2BXZA 3KDMA 3S3GA 3MKCA 4ZQTA 1O94A 3D25A 4WEBL 3PWNB 5C3LD 1AO7B 1XIWA 1GWJA 2IBBA 3EDKA 2AQ2A 3K1KC 1T1YB 2EYTA 2I26N 1CICA 1ZVSA 4LKXB 4YBHA 3VXMD 1KKOA 4ZOBA 2WMJA 3DX4A 4Z0XB 3BUPA 3GFUA 1T7LA 1KCLA 4G5ZH 1DXFA 2J8UA 2QVFB 4R4NC 2YQBA 5IFPA 1W5PA 3ULUH 4Q8PA 4KK9C 2ICWB 2WWNA 3ZHDA 4HWBL 2DWEA 4GY7A 2G41A 3W7QA 1MI5E 3X3GL 1K85A 5DS8A 4ZTPH 3LY6A 3LTYA 3TJ4A 3CAKA 1TFPA 4N0YL 4XHJD 2VC2B 3VG0L 1A6ZA 1YHTA 3ITVA 3O6MH 4W8BA 2JGYA 3E9AA 1WBZA 4KNUA 4M4RA 4M93B 3O9WD 3RWHA 3CMGA 3S9DB 4KMTH 1K3UA 2ACQA 2ZCGA 2J78A 2ZXCA 2QMJA 3BTNA 2Q7NA 1W9DM 4GUJA 4H9YA 1T03L 5DHXB 4CMMA 4QJ4B 1KBBA 3UGRA 4NIYE 3JT2A 4DEFA 4L4VB 3SZ8A 2F74A 1VSCA 4QEEA 3O3AA 4Y4FB 1RZ7H 1FWEC 4NQCD 4P48A 1F6PA 2XVPA 2Y7GA 1TCDA 4YVPA 1QSEE 1M04A 2JFEX 1DL7L 3TVMC 4IIBA 3WIIH 1DBML 4ICWA 1TYGA 4CU8A 2GYIA 4KRZA 4PCPA 2YD1A 3RE0A 2WBGA 3BUQA 1TDQA 4C56B 4S3EA 5TE6L 2FJGB 3WKZA 1M57B 3WJJA 3EKGA 4H9MA 2HWZH 3A6CL 3T2NL 5L2KB 4YS4A 3V2AR 3OIXA 1P6CA 5DMIL 4DJEC 1GGBH 1A4AA 4GKZA 2HRPL 4HJJH 2QEJA 5F7DB 1YCSA 4G5DA 5CWSB 3SPJA 4LLYA 3BLFA 3CT2A 2ZUYA 4IFKA 4NQED 2QUMA 5IP4A 1G4TA 2B4CL 5DO8A