1EOMA

Crystal structure of the complex of endo-beta-n-acetylglucosaminidase f3 with a biantennary complex octasaccharide
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
283
structure length
283
Chain Sequence
NGVCIAYYITDGRNPTFKLKDIPDKVDMVILFGLKYWSLQDTTKLPGGTGMMGSFKSYKDLDTQIRSLQSRGIKVLQNIDDDVSWQSSKPGGFASAAAYGDAIKSIVIDKWKLDGISLDIEHSGAKPNPIPTFPGYAATGYNGWYSGSMAATPAFLNVISELTKYFGTTAPNNKQLQIASGIDVYAWNKIMENFRNNFNYIQLQSYGANVSRTQLMMNYATGTNKIPASKMVFGAYAEGGTNQANDVEVAKWTPTQGAKGGMMIYTYNSNVSYANAVRDAVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the substrate specificity of endo-beta-N-acetylglucosaminidase F(3).
pubmed doi rcsb
source organism Elizabethkingia meningoseptica
molecule tags Hydrolase
molecule keywords ENDO-BETA-N-ACETYLGLUCOSAMINIDASE F3
total genus 103
structure length 283
sequence length 283
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 2000-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1eomA00
1OGSA 3VGGA 2ZX9A 1EHAA 3GBEA 4U31A 1VRXA 2BXYA 1QNQA 5I0DA 1J10A 1GHSA 3MSGA 1HKIA 1ISZA 3BGAA 1AQ0A 1QHZA 4GI9A 3A3HA 1H0IA 1W1YA 4HP5A 1UYQA 4Z2HA 1X6NA 3GNOA 1NOUA 1R85A 1W1PA 3JUGA 4BS0A 3BAKA 3VD3A 1QPKA 1L8NA 1GW1A 1VIWA 3UESA 2YA1A 3VIMA 2JEPA 2J75A 1H4PA 2ZUSA 2WHLA 4MADA 9CGTA 1PBGA 4U2YA 3WNNA 3AXHA 4KGLA 2G3JA 3TTOA 4MJ2A 2WANA 2FHFA 2Y24A 4GKLA 2YDQA 2XFYA 1EOKA 1Q6DA 1TVNA 2PBOA 1W3HA 2CERA 5A3HA 4P7OA 2Q8XA 3ZR5A 4UQBA 2ESCA 1J0YA 3BAJA 5C71A 2DH2A 3ZT7A 4B16A 2D3NA 4OBSA 1WP6A 4J3VA 4TX8A 2WBKA 4ZENA 1CXEA 4AW7A 2YJQA 5EBAA 3N15A 5IXEA 4CUCA 1OD8A 3HJEA 3WDIA 1GOIA 3IJ7A 1K9EA 1JXJA 1TCMA 4OZOA 2D3LA 1B2YA 4NRSA 1AVAA 1W9VA 2XVNA 3TTQA 3VGFA 2CNCA 2PWEA 1KB3A 4PMQA 4MDPA 5BRPA 2W92A 1I75A 3LMYA 2J8GA 3SUWA 3MSDA 4BA0A 3CUHA 5LYRA 1R8LA 3WD3A 2VC9A 2XG9A 4H8VA 1W91A 1H3GA 2F61A 2X0YA 3MS8A 4JAWA 1HN1A 1NWUA 2TAAA 2X0HA 4M82A 3U57A 3WNOA 2WPGA 1HJSA 1UR9A 2WZHA 2BFGA 3LPOA 2Z1SA 2CETA 1VB9A 3OGRA 2GJXB 3I3EA 1R87A 1J9YA 1GOMA 3VDAA 1ZU8A 1O6IA 4LYPA 4AMCA 5DT7A 3D5HA 5IFTA 1DWJM 2WB5A 4EK7A 3VM5A 3FHQA 1DHKA 1E73M 4B9ZA 1B90A 2VZOA 4GQRA 4DUWA 1B3ZA 4L4OA 5CLWA 3AIEA 1EOMA 2YKKA 3WF1A 1DWFM 4X0NA 1BYBA 2BS9A 1C8QA 2V38A 1QNRA 4BQ3A 3ARZA 4FMVA 2GDUA 5CXPA 2VCAA 3SURA 4JZ5A 1B3XA 2ZUTA 3VO0A 5GNXA 3EDDA 2BVYA 4ZXLA 2VT0A 3BAWA 3N12A 4DWSD 2GSJA 1JXKA 1E1FA 2DSZA 1M04A 4F9DA 4P8VA 1Y7VA 3VMNA 4W5ZA 3QGVA 1WDSA 2GJRA 4IISA 4S3KA 5HBFA 1HJUA 4JKMA 2XTKA 1K9FA 3CZGA 3S6TA 1QI2A 3EBVA 3GDBA 2XFFA 3E1F1 3POCA 3DECA 3SEPA 2J74A 4AD0A 1NARA 2BHUA 3ZMRA 1GORA 1QNOA 1F4HA 1KR1A 4IUGA 3MV01 3VIKA 1HL9A 2WZIA 1V3IA 3WBAA 2CKSA 2WMIA 3GXMA 2UY5A 3VNYA 4XX6A 4ACZB 4AISA 2OSXA 5GNZA 4CD4A 1QW9A 3RO8A 2W91A 1WKYA 1L0PA 2JF7A 4LPCA 4U2ZA 3UR7A 1JL8A 4TOQA 1UR1A 3CPUA 3MMUA 3K1DA 1V3MA 1J18A 2C0HA 4AZIA 2VR5A 4TX6A 1CNVA 2JF6A 3MUY1 4CVWA 2CIPA 3AHVA 4AD2A 3CZJA 1C91A 2CYGA 4AZ5A 1CGYA 5CGMA 4GZEA 4HU0A 4E4PA 4RL3A 2GK1A 1IZJA 1HKMA 2G3NA 4KRUA 2YA0A 2JE8A 3WNLA 1QBBA 2WVVB 3WF4A 1OT1A 2UY3A 2OSWA 1RP9A 1H49A 3AFBA 2BNJA 1BSIA 4UOJA 1OD0A 1GQJA 1D2KA 3WFLA 3CMJA 3F5JA 4KWUA 4J28A 3WSUA 3ARSA 4PMZA 3WH9A 4AD5A 1CENA 5GQBA 1IV8A 4WSKA 2E8ZA 4E2OA 5LA0A 4P8XA 2G3MA 4M80A 3NSMA 3CO4A 1VJSA 1E6ZA 3IJ9A 5E9AA 1J11A 1V03A 2DT3A 2OYKA 6TAAA 1M53A 1D3CA 2E8YA 1Q6CA 2EJ1A 5AY7A 4UQCA 1MW1A 1EHNA 5DMYA 4AEFA 4EE9A 3PTQA 1OM0A 3PTKA 4AIEA 2ZE0A 4JKLA 4WKHA 1FH8A 3IAQA 5BXRA 3AHXA 1WE5A 1BAGA 4W84A 1K9TA 1W32A 8CGTA 3AQUA 1EO7A 4PMXA 4UTFA 1E4IA 2ZX5A 1V0LA 4JL2A 5FCZA 1ISXA 1UKQA 4Q22A 3WH7A 1UH3A 1B0IA 3EMZA 2BVTA 2WCGA 1E4LA 5A8OA 2G4FA 4J27A 5FKYA 4D6IA 4E8DA 3CUFA 4MB5A 2F2HA 3AIUA 2XIBA 4JFTA 1YQ2A 4L4PA 4J7RA 4W87A 5DF0A 1V02E 1E6NA 2FGLA 5DFAA 3A6OA 4UFHA 1H0GA 2VUYA 3SCNA 2IXVA 1CGVA 1U2YA 1MFUA 4MB1A 1UA3A 1JF6A 4QP0A 1QHOA 2O9OA 1KQZA 3K8LA 2CESA 5E6YA 1EDTA 1BG9A 4U33A 5ABHA 4TVUA 3VU2A 3PHAA 1UQZA 2IUZA 3WDHA 5A6SA 2QMJA 3N1AA 1Z32X 2ZWZA 2PB1A 2UWFA 1JGIA 1LL4A 4XZBA 3KE0A 4AZCA 4GI8A 4X9YA 1UH4A 4AZHA 1UKPA 4FLRA 3LPGA 4DWSB 2EPOA 2FDMA 5IHSA 5A95A 1FFRA 4JCMA 1QI0A 3PZGA 3ARXA 3U7VA 2J47A 4PYSA 3VILA 3AS3A 3NDYA 4BF7A 2E9LA 3EDEA 2QLYA 1TE1A 3PZOA 2DGAA 3SCPA 1VJZA 4GO8A 4U3CA 4CD7A 1EXPA 3GXIA 5E70A 1JZ5A 1EDQA 2WK2A 3PN8A 4LYQA 4CD6A 3GZAA 2WVTA 2CXGA 1EA9C 2G8ZA 3KZSA 2A3EA 2OLHA 2D0HA 3M6DA 3ECQA 4TTUA 2V3FA 1H1NA 3A47A 1HKKA 1UR4A 2XVKA 1P6WA 5CSYA 5BXTA 3AZRA 7A3HA 2YL8A 4U3AA 1KWGA 5IFPA 2QV4A 1EH9A 3W37A 1JFHA 4AC1X 5I78A 3EMCA 1EGZA 3WD4A 5M5DA 3QR3A 2AAAA 1A47A 1WB0A 3RJXA 2WM0A 4UQAA 1DEDA 2WBGA 2XVLA 1JFXA 2AOSA 3PZ9A 3VGHA 4U5KA 2VOTA 3T0BA 3VX1A 2WC3A 2RGMA 3BLKA 3RCNA 3ZT5A 3MANA 3RMEA 3RM4A 4IM4A 3WL0A 1GCYA 3GM8A 1QI5A 2A3HA 3EDFA 3AS1A 2WVUA 2YL9A 3EDJA 3A4WA 2G3IA 2OWWA 2A3AA 2YL6A 4MJ4A 4W86A 3NIYA 1XC6A 3N13A 2X8RA 4Z2JA 5A8QA 3NCOA 3AMKA 4LX4A 1NP0A 3N17A 3AIWA 2D2OA 4PMDA 4UOZA 2Z1KA 3CBWA 2DSUA 5A1AA 3I3DA 1Q6EA 3AS0A 1E9LA 2W61A 2BY0A 3M46A 4ML4A 5A2CA 4C7FA 1KWKA 4H7VA 4UCFA 3AMCA 2O92A 1JZ4A 2WSKA 1ODUA 1PJ9A 1HP5A 4OOZA 4W8AA 1ISYA 4J3XA 4MPKA 4YPJA 4UFLA 3UG3A 2FGZA 1GOOA 1UH2A 2PWFA 1NOWA 1SYTA 2O9TA 4A4AA 4DUXA 3VD5A 1UOKA 3N9KA 3SCQA 1R7OA 1TFVA 3GXFA 1CXFA 2DSKA 3OZPA 1UQYA 4NSBA 3VDCA 1O7AA 2PWHA 1KGXA 3GBDA 3IAPA 4CCEA 3K8MA 1US3A 5A6LA 1CTNA 2CBJA 2XWEA 5FL0A 3WNPA 1R86A 2ZX7A 3WQ5A 2EPNA 3WH8A 2VNCA 1GONA 2E0PA 2ZUWA 1AQHA 3BLPX 1JAKA 3WMCA 4JCLA 2WC4A 4LXFA 3CHEA 3FN9A 2WWDA 3QHMA 1UR8A 3PZMA 4FF5A 4UFKA 3N18A 4PTMA 2J7BA 4CCDA 4CU8A 1W9PA 3WENA 3OIHA 1GUVA 1NWRA 1E40A 5HXMA 1FOBA 4Z2IA 1GQLA 1NM9A 3TONA 1AQMA 3IJ8A 3RIKA 2J8FA 3WUEA 5FL1A 2VJXA 2VRKA 4AYSA 3GH7A 3MV11 4ZEPA 1OIFA 1W9BM 2XWDA 3QOKA 4UR9A 2J4GA 1UUQA 3DC0A 3ARQA 4XZWA 1XH2A 3BSGA 3WD0A 1BVZA 4X0VA 1GVIA 1HNYA 3IANA 3WQ8A 3ALFA 5I5RA 4CN4A 4PMRA 3UEQA 3FHAA 1WZMA 2VZTA 1HVQA 1Q6FA 2ZX6A 4HOZA 1GOKA 3HN3A 3VD9A 4CU6A 1Q6GA 1G1YA 4C7DA 1XD1A 1B3WA 1EQPA 3GTNA 1ZJBA 4TVCA 5CPTA 1JYVA 1WDRA 3WD2A 1HJQA 1J12A 1VFFA 3L4XA 5HPCA 3W38A 3WMBA 3SCSA 3L4ZA 4HA1A 4ACZA 4UFMA 2C7FA 3L2MA 3FNDA 2WXDM 3SUTA 2WNWA 4D71A 3KWXA 3AI0A 3AHZA 1BTCA 4HTYA 1PIFA 5AYIA 2OSYA 1LWJA 4D1IA 4H8UA 2PWGA 1JIBA 2CHNA 2EO7A 3KL0A 5AC5A 4IPNB 1V3HA 2VTFA 4WJXA 3POHA 1KBKA 1UWIA 1WCGA 5I3DA 5A94A 4JFUA 2V3GA 2J25A 1ZBKA 2DT2A 3L2LA 3W27A 1W9UA 2OYMA 4JIEA 1ZBCA 1F4AA 1E0WA 3EMQA 3LPFA 1J01A 2YL5A 2J78A 1X1NA 2YLAA 3VX0A 1BYDA 2VX7A 4PMUA 3CUJA 3SUSA 3B9DA 5D4YA 2DIJA 4DWSA 3BMVA 1XSIA 2ZXBA 2WLYA 2YBUA 1XYZA 1KCLA 1TG7A 2X1IA 3SUUA 4A3HA 3WELA 3APGA 3CGTA 1SR0A 1GOWA 4HPGA 3W28A 4PUEA 3K8KA 1DTUA 1JYWA 5CQ1A 1LLOA 1JF5A 3ZJ7A 2GJXA 3W29A 4PTWA 2VURA 3G6LA 4F9JA 4V2XA 3IK2A 1JAEA 1HKJA 1PX4A 2VVNA 1KGWA 2UY2A 3L4UA 3WQWA 4FLQA 2B31A 2Y8VA 1JZ6A 1SMDA 2EXOA 4TTGA 2DH3A 1DWAM 1FP8A 4PTVA 1QOXA 4P8WA 4GI6A 4P8UA 3AS2A 5ABEA 3FW6A 1H09A 5D8ZA 1MQRA 3WIJA 1TUXA 1ZL1A 1S46A 3W4RA 5JBDA 1RP8A 3K4DA 1C90A 1E56A 4FK9A 3WDRA 3WFZA 1NH6A 3U7BA 3WY1A 2J7CA 4JFWA 3PZQA 3WN6A 1C7TA 2XM1A 1XRVA 2VRQA 3HU7A 3VVGA 4GXPA 4F66A 2JIEA 2RGLA 5LA2A 2O9PA 3RM8A 4D6GA 3MUZ1 1KXHA 4HPHA 4K68A 4PSPA 1GNXA 3ARVA 3WUGA 3KL3A 2CITA 4GIAA 4GINA 2ZOXA 2NSXA 2WAGA 4QDMA 2ZUNA 4Y7EA 1J0KA 3VIGA 4OOUA 1E6RA 3NUKA 4J3TA 2DDXA 1XD0A 3UG4A 5IHRA 2BY3A 1C3FA 5A2BA 1K6AA 3TOPA 5BRQA 3DHUA 3GNRA 4ZXOA 3RM9A 5A6JA 1SMAA 2VZVA 3L4WA 3CHCA 4MNMA 4OBRA 4OIFA 3WUBA 1FHLA 3SCVA 2E4TA 3SCRA 1TA3A 1R7AA 3WH6A 2OWXA 2WC7A 1ESWA 1XCWA 5HOSA 4LQ1A 1FFQA 3OGSA 4D72A 5CLTA 4J3WA 3ZSSA 4AWEA 1OIMA 5DT5A 1E3ZA 3ALGA 1WO2A 4M56A 1VAHA 4D6DA 4NZCA 4JHZA 4AIOA 4CU7A 4WKFA 1BF2A 3B9EA 4JFSA 3WQ6A 1X6LA 4W93A 2D23A 3G6MA 2BY2A 2EPMX 2WLZA 3ARPA 3GH5A 1LG2A 3VD7A 1MW0A 4ZE5A 1PX3A 3N11A 2VQTA 4RE2A 8A3HA 1VBRA 5HNNA 2A3BA 1JYNA 2O9RA 1C92A 1PZ2A 3MKKA 1W1TA 3BAXA 1J0IA 4XUYA 3QHNA 4ATLA 1OSEA 1CGUA 3QHOA 3UETA 3NSNA 2CBIA 4N42A 5E09A 4Z2KA 4W8BA 4W7WA 3WUFA 1M03A 5C8BB 1UD2A 1CIUA 3T0DA 3WDJA 1US2A 3WD1A 1QBAA 3II1A 3W24A 1E0XA 3AIVA 3AHYA 1V3KA 2WMIB 3VDBA 3T2QA 5AYBA 4XV0A 1LQ0A 1CPUA 4MB3A 1Q4NX 1V02A 1XCXA 4NRRA 3CMGA 1IZKA 2UY4A 3OLGA 2HISA 3CIVA 1V6UA 3GXDA 1KR0A 2IXUA 1MXDA 3AMGA 3I3BA 2WMFA 2GUYA 2W66A 4Q7NA 2VMFA 3AIQA 4ZE4A 3VIOA 1JZ8A 4OUEA 1J0ZA 4B3LA 1BYAA 2WWCA 1HJXA 3ZSTA 5I2UA 2BHYA 4B3KA 4HZ8A 1HP4A 1EIBA 4CCCA 1E55A 1K9DA 1BLIA 2W67A 2X2YA 5LA1A 4HZ7A 4KGJA 4CD8A 2DIEA 1YHTA 3M7SA 1V0MA 2DT0A 4HMCA 1JD9A 1E4NA 4GZIA 5D9NA 5ABGA 4EKJA 1E1EA 3OZOA 1JZ2A 4P7NA 3OA5A 2WMJA 4LYRA 5I23A 4MDOA 3O9NA 4AZ7A 1M01A 1C8YA 3CZEA 3SUVA 4D6JA 1TR1A 2WMHA 3PTMA 2W4XA 2WYSA 1HL8A 1XSJA 1BPLB 3KL5A 4RE3A 1MWOA 5BWFA 2GFTA 3VPLA 5KEZA 4HMDA 4M29A 1PAMA 1CDGA 1UA7A 4QLLA 3PBGA 3ZQ9A 1GVYA 3MMWA 2J7HA 4WK9A 1CLXA 3T09A 2ZXQA 1CBGA 2ZXDA 4JL1A 1ODZA 1W3KA 4DM1A 2VX4A 1CXHA 1XYFA 2PBGA 4GZJA 1FP9A 2VCCA 1KXTA 1C8XA 1GPFA 3N04A 1NWTA 3F5LA 1E4MM 4AZCB 2GK1B 2YOCA 1BYCA 3OLEA 1UKTA 3NYDA 3ZO9A 4YN5A 1ITXA 4DM2A 3AYSA 1H2JA 2BY1A 3AYRA 3DYPA 4QLJA 5D9MA 1U30A 3SCOA 4HZ6A 2J7FA 1JDCA 3CZKA 1OT2A 3GYCA 2ZXAA 3AXXA 4PTXA 3RILA 1G5AA 3MMDA 4TUFA 1KFWA 1I1XA 3VMOA 1G01A 5E0CA 4UQ9A 1CXIA 3T0AA 1ECEA 5CSUA 2ZUUA 2D0FA 1GQIA 1B1YA 4ATDA 5E0FA 3EDKA 3OB8A 3ARUA 3W25A 1E43A 4PEEA 2WCSA 1G94A 3B9AA 1E70M 2ZWYA 1KGUA 4PMOA 5HDRA 3PZUA 1CXKA 1H11A 4WIWA 5EB8A 2XPKA 1H41A 3AISA 1RD6A 2QPUA 1V6XA 1FH7A 1HJWA 4B9YA 2VVSA 3CUIA 1C7SA 3CHDA 1LWHA 2CBVA 3UERA 3W81A 2HVMA 1TMQA 3BCFA 2OYLA 3CTTA 1HXJA 1QVBA 2NT1A 2WMKA 3ARTA 1GQKA 5IDIA 2J79A 2VX6A 4UZSA 3UCQA 2D20A 2F8QA 5CGTA 1XH1A 1JI2A 3ZOAA 1JDAA 2XUCA 4P7RA 3WDQA 1B9ZA 4N0RA 2WVSA 3FY1A 1GZJA 4WKAA 1B30A 1JI1A 1E72M 3DHPA 2FHCA 4PRWA 1RPKA 1WZLA 4F79A 5CPQA 3SCUA 1OB0A 1M7XA 1V0NA 5D9PA 5GNYA 3THDA 4HOWA 2FHBA 3VTRA 2W63A 4NF7A 3O2LA 4PUDA 3TTYA 1UR0A 1VF8A 3THCA 5C70A 5HPOA 2YA2A 4YHEA 3ZJ6A 4EAMA 5M3WA 4UQDA 4H41A 2ZIDA 3VIIA 2V3DA 1W9XA 1KBBA 3PZIA 4AZ6A 3EYPA 4IPLA 1UKOA 2WKGA 5A2AA 4R27A 4MTVA 4W85A 4U5IA 2X05A 2ZUMA 3ZT6A 1OGBA 2J7EA 2WHKA 4CGTA 3AHTA 1V6VA 4PMNA 4Z2GA 1CYGA 3AIBA 1VFUA 4XB3A 1DP0A 2XGIA 4A3YA 3VINA 5F7UA 2XJ7A 1E0VA 4B15A 1KQYA 4W7VA 1UZ1A 1JG9A 1CGWA 3BMWA 3AZSA 5ECUA 3WKZA 4MAVA 1ZJAA 3M07A 1NOFA 2A3CA 1CECA 1UD4A 5JBFA 2FH8A 3AIRA 2VX5A 5BYWA 3PZVA 3VOCA 6A3HA 1MW2A 5I77A 4PCTA 4BQ2A 1DWIM 5M03A 2GVYA 2JALA 1MVYA 3WF0A 4GO9A 2YLLA 1HX0A 2PF0A 1E3XA 3VD4A 4QFUA 4D6HA 1XV8A 4PMYA 3RJYA 1GHRA 5BXSA 4MNLA 1OWQA 3T2OA 3WBEA 2XM2A 1NQ6A 3AICA 1BFNA 3GH4A 4FLOA 4AD1A 1WAWA 1E5JA 4BCEA 3VIHA 2QMKA 4H8HA 1FH9A 1G0CA 4MB4A 2AMGA 3BXWA 1E71M 4GPNA 2V5CA 2DEPA 4DWSC 1GOQA 3OLIA 1UWUA 3HMCA 4BZYA 3K4AA 2D1ZA 2YBTA 3NDZA 1BHGA 5D8WA 4QAWA 1A3HA 1NWSA 1KXVA 3QOMA 2EBNA 4BQ4A 2XSAA 2NT0A 3W0KA 1VEOA 3WMSA 1ZBWA 4NI3A 4R5EA 2VR4A 1WZAA 5JIWA 2VL4A 2VO5A 1UWQA 1HT6A 5CJ5A 3MU7A 4C7GA 3CLWA 4W5UA 4H2CA 3W26A 4V28A 2XVGA 3A4XA 4M8UA 2CKRA 1HVXA 1ZBVA 2OWCA 4AEEA 3VMPA 2DT1A 3TP4A 4W89A 4PMVA 7TAAA 1CGTA 4DUVA 5A6MA 1WDQA 1LF1A 3KEHA 1EDGA 5JBEA 2DQXA 1MYRA 4WSJA 4WF7A 1GJWA 3AOFA 3BAIA 4M1RA 4HOXA 3FAXA 3ZR6A 1E6QM 1H5VA 3BCDA 3AJ7A 1RH9A 4W8LA 1J0HA 3D3AA 1W1VA 2PC8A 4M24A 4CVUA 1OBAA 3OG2A 1E6PA 1JYXA 3ZIZA 5JIPA 2J77A 1QHPA 4AXNA 4F8XA 2G41A 1DWHM 3A4AA 2BHZA 1UD5A 1OGGA 4D6EA 3BC9A 2YIHA 2WSPA 2VI0A 5A69A 5GPRA 1UZ4A 3BSHA 3VUPA 1B3YA 1OCQA 2ZUVA 1XHGA 4UZUA 1HJVA 1UWRA 1ZB5A 3CHFA 4H04A 4URIA 2WW5A 4JFVA 1KCKA 1JZ3A 3UR8A 3WH5A 1B3VA 7CGTA 2D0GA 2J7GA 1E6XM 2EPKX 1JNEA 1CLVA 1QNPA 3SCWA 4OJYA 3VGBA 3L4TA 1VFMA 3AZTA 3BAYA 1UWSA 4AZBA 4W88A 5A6BA 1JDDA 1V3LA 1DWGM 2XFRA 2XGBA 2D24A 4UFIA 3DYMA 1IT0A 3L4YA 2YDRA 3WNMA 5EFFA 1QI3A 5KZ6A 5M17A 5EMYA 1LG1A 4AIUA 3NSXA 4V27A 1MXGA 1ZS2A 4JHOA 3F4VA 4HU8A 2CCRA 5D9OA 4AZGA 1VEPA 1GJUA 2WMGA 4JKKA 4CD5A 1BGAA 2VZUA 1UD6A 3S2CA 2XVPA 3VGDA 3AROA 4KMQA 3VIFA 4QLKA 1E6SM 4D6FA 2ZX8A 4FLSA 1VENA 1N82A 4E8CA 1SFSA 1NP2A 3TTSA 2X09A 5A6KA 2WHMA 2GJPA 3B8SA 3ZJ8A 3WEZA 3U5YA 4P7LA 3WL1A 3ZM8A 4RE4A 2J62A 4MNJA 1CZ1A 4AD4A 1W3LA 1W3JA 2JIWA 3UG5A 1UD3A 1UHVA 2VRJA 4MAZA 1WPCA 1MQPA 4QCFA 1QNSA 1W9DM 4D6CA 2V3EA 3K46A 4UNIA 4HMEA 5I6SA 4J3UA 4KH2A 1ITCA 2CEQA 1G9HA 1D7FA 1V0KA 1HF6A 1BGGA 5A6BD 1UD8A 3SIMA 1ISVA 2VQUA 5E6ZA 4AD3A 1LL7A 5DO8A 4WLCA 5BCAA 3T08A 3GNPA 4PCSA 3CZLA 2CHOA 2VCBA 1QI4A 1U33A 1E5NA 2CBUA 1MQQA 5CZKA 3AMDA 3ZJKA 2BVDA 5ABFA 2NW0A 3F5KA 3MO4A 4ATWA 2WHJA 5FD0A 5A8NA 2PWDA 1B31A 2EPLX 2J7DA 1FHDA 2XIIA 1C93A 2QHAA 2WZEA 5AC4A 4ZFMA 4EANA 4AY1A 1KXQA 4GQQA 2DSVA 1WNOA 4PBGA 1W2PA 1PZ3A 3VKKA 5ABFB 3VGEA 2DPEA 3WF3A 6CGTA 3RDKA 3VIPA 4TXEA 3AXIA 3MUIA 2QF8A 5A8PA 1ISWA 1BQCA 2JFEX 4PN2A 1J0JA 3CUGA 1XSKA 3ARRA 2CPUA 3U5UA 1CXLA 2E40A 4TVDA 3W6MA 1V3JA 2WKLA 1LL6A 3ARWA 2V5DA 1XH0A 5DEZA 1TA3B 4J3SA 2BXZA 3WF2A 2VZSA 4KRTA 2WCAA 2C8NA 1XGZA 1EQCA 4HA3A 1PX8A 2JEQA 1CWYA 1VEMA 3CH9A 3NJ3A 4UFJA 3WNKA 3BH4A 5BROA 4CN6A 2W5FA 3CZ8A 1WDPA 2FH6A 1BG4A 4P7QA 4LGXA 4ACYA 1V6YA 1VFOA 4MNKA 1V08A 2Y2WA 3WEMA 5EFDA 1QW8A 3OBAA 5I79A 3VM7A 1WZKA 2Y4SA 2W62A 2YDSA 3MUAA 3PZTA 4D1JA 4OKDA 1LJYA 3VDHA 5A8MA 2E3ZA 2XSBA 1FA2A 1MFVA 3ARYA 3FAWA 5FOOA 2PI6A 3TA9A 4BQ5A 5FIPA 1TZ7A 3OLDA 3WQVA 4YHGA 2EEXA 2XYLA 3DYOA 3W53A 1JD7A 5A6AA 2D22A 2GDVA 3J7HA 3O6AA 3PZNA 3SCTA 4CKQA 1I1WA 1UR2A 5CG0A 2QPSA 3LPPA 1JZ7A 1HIZA 2Y8KA 3W82A 1MW3A 3W6LA 2Y5EA 4QCEA 3FXYA 3RPMA 2EQDA 5TD4A 4Z2LA 4M81A 1W2VA 1BVNP 4CN1A 4S3JA 3VIJA 2XHYA 3VNZA 3T2PA 5JUVA 1UWTA 1UKSA 3WEOA 1OINA 1VBUA 1CGXA 1JNDA 1PPIA 2E9MA 2DSWA 1CEOA 2WVVA 4HA4A 3AMLA 3WQ4A 1AMYA 3OGVA 2E9BA 4UOQA 4PSRA 2ZICA 1TVPA 2BV9A 1EO5A 5CPSA 1PIGA 1PEZA 1E15A 3WDPP 5I24A 1V6WA 1UG6A 4W7UA 5BXPA 3L4VA 4UQEA 2MANA
chains in the Genus database with same CATH superfamily
4LJ3A 5FSEC 1EB3A 2ZX9A 2Y7FA 3M5YA 1XUUA 3LTSA 3G0UA 4FIRA 3QTPA 1QNQA 5BOEA 1J10A 7XIMA 1W0MA 3MSGA 1DJIA 1HKIA 2QJHA 4GI9A 4NZJA 1FWAC 3A3HA 3PY2A 3URAA 4DO6A 1H0IA 5LHFA 4XTIA 3TC6A 3W1NA 3NFUA 1SJDA 3RN6A 4DQWA 5A6TC 3GNOA 3QLLA 1NOUA 4CNOA 1W1PA 3GAKA 3MUCA 5JMUA 1QPKA 2X7VA 4MY9A 3HQ1A 2QCLA 3KVMA 4L4MA 5DRCA 3F1QA 2XGZA 1GW1A 4QNEA 4Y96A 2B7NA 3Q4DA 2ZC8A 2JEPA 3QJAA 2XINA 1YNYA 3ABRA 2C19A 2D73A 4FR6A 3QN3A 4K37A 4YVPA 2R1KA 1MEHA 3WNNA 1JQXA 1NJJA 3AXHA 3QTGA 1FWSA 2G3JA 3TTOA 2GQ8A 4G2DA 2WANA 4H7ZA 4MJ2A 2XFYA 3H7UA 2R91A 5C9WA 1EOKA 4ZQRA 2GDQA 2CERA 3P61A 5A3HA 1WDWA 2Q8XA 4UQBA 4OBSA 4AF0B 3VYLA 2WBKA 1UR3M 4AW7A 4XKYB 1OD8A 1GOIA 1YPIA 3CL7A 4OV4A 2PSNA 4DF2A 1VJIA 4NRSA 5L6UA 2XVNA 3GG0A 1HFBA 4C6PA 2RDUA 2Q02A 1P43A 1T0OA 3LMYA 4IICA 3EKZA 4WOZA 1R8LA 2VC9A 2XG9A 3I6EA 3LXBA 1QXLA 4RNJA 1VFLA 1JQVA 4IFKB 3UWQA 2ZZ6A 2X0HA 1W56A 1V5XA 3WNOA 2YCJA 3LPOA 2BFGA 2Z1SA 2ISFA 1EYEA 5CZJA 1VB9A 5BNKA 3I3EA 3VDAA 1O6IA 4R7WA 3LCXA 5IFTA 3FHQA 1E73M 4GQRA 3E74A 3FK4A 2QJNA 3GIYA 3GTIA 5CLWA 4ZSUA 2YKKA 4H3DA 3WF1A 4HCHA 1BYBA 2BS9A 1V6TA 1QNRA 4GX9A 1OHLA 3SURA 3QKZA 1GEHA 3B8VA 3VO0A 1UP3A 3BW2A 2HBXA 1MRQA 5FEZA 3BAWA 4EWND 4O10A 2MNRA 1JXKA 2BASA 2YGYA 1M04A 3E96A 4PMJA 3WLPA 4IJCA 1Y7VA 4O53A 4RV8A 3VMNA 3IJQA 2RFGA 4CQDA 3QGVA 2UBPC 1O12A 1PHWA 1ECQA 1EXBA 1QPQA 3EBVA 4WY0F 2XFFA 3E1F1 3GFYA 3SEPA 3ZMRA 4GYKA 1GORA 3OVPA 1GGOA 1VC4A 3MV01 4RW3A 3WBAA 2CKSA 1YIXA 3GXMA 4EIVA 3FCPA 6PTDA 2OSXA 3PUGA 5GNZA 4MKNA 2JGQA 4CD4A 1QW9A 4PUUA 2W91A 1WKYA 4LPCA 1N8IA 3UR7A 2HEJA 3CAKA 3LTPA 1J18A 3IJ6A 4AZIA 2JF6A 3MUY1 2CIPA 3KBWA 4K7VA 3CZJA 4GMEA 5CGMA 4GZEA 4R9OA 4LSBA 3QPEA 2AMXA 2JE8A 1IIGA 4HPJA 2ICSA 3WF4A 1WUEA 2UY3A 3V5FA 3VZXA 1BSIA 4DXKA 1GQJA 1D2KA 2HBVA 3CMJA 3M44A 4ZGYA 1ADSA 1DL3A 3WSUA 1R5YA 4PMZA 3IUIA 3QMRA 1V8EA 3L67A 3QPYA 2E8ZA 5LA0A 3NSMA 1VJSA 1E6ZA 4UUIA 1J11A 1JGMA 2ABAA 6TAAA 1M53A 3GS6A 2EJ1A 5CKSA 5AY7A 3TUUA 1MW1A 3COTA 4EE9A 2DIKA 1POJA 4AIEA 3SSZA 1AA1B 4L80A 1W37A 1DTNA 3UJEA 3GDRA 3NPVA 1K9TA 2VGBA 4CQAA 4JYFA 2WJDA 4XZ9A 1IT8A 1W6TA 2ZX5A 2P3EA 5AYYA 1XBVA 2VDHA 2BVTA 2WCGA 5A8OA 4QE5A 3GFZA 1SZEA 4IMFA 5I00A 2F2HA 3MVIA 3W88A 4ZB2A 2VFIA 3SGZA 4JFTA 4W87A 3LLDA 3N19B 3UW6A 3UVIA 3A6OA 4LFYA 1H0GA 3SCNA 1XIGA 5ENLA 3BJTA 4S3BA 1U2YA 2HSAA 2YXGA 3KLKA 4MB1A 2R24A 1JF6A 2O9OA 3HQOA 1KRCC 1BG9A 5FF4A 4O16A 4TMBA 3SADA 1A5CA 3LRKA 2VWTA 1IEVA 1AH4A 1UQZA 2QW5A 3WDHA 5I06A 1NU5A 3SDOA 1Z32X 1UBPC 3G3DA 2PB1A 2UWFA 1JGIA 5T26A 4HNUA 5AC6A 3KE0A 2F6XA 1VCGA 4GUJA 4FLRA 1FDJA 3LPGA 3G22A 1XF0A 4Z1BA 2FDMA 4HJFA 1FFRA 3GD6A 3CIWA 2ACSA 2DVXA 3WLJA 3PZGA 3ARXA 3PUEA 2J47A 3EXTA 3GYEA 2P53A 5AKQA 3S1UA 1R3WA 4BF7A 1TE1A 3ZXWA 1W31A 2ZTJA 3GQYA 3EX1A 3WLHA 5LXXA 1I2QA 3GXIA 4R53A 1EDQA 2WK2A 3PN8A 4LYQA 3GZAA 5ECVA 2WVTA 4K8HA 3B0UX 3LLXA 1C9DA 1Q4WA 3M6DA 1FQ0A 3A47A 2W6RA 3GFXA 1XFCA 2XVKA 5CCZA 5FA5A 1EJTC 4WD0A 2ZKMX 5BXTA 1KWGA 5IFPA 1FWBC 1JFHA 4NAEB 4X61A 4AC1X 1Q2SA 4NAFB 3WD4A 4QJ1A 5HR6A 3QR3A 3LYEA 5K7JA 1A47A 4UQAA 1EWEA 3HGRA 2WBGA 2XVLA 1JFXA 3THUA 4U5KA 4FX6M 3AWNA 3LGEA 3ZT5A 3RCNA 4M3PA 3PP7A 3IJDA 4I9AA 4DXXA 4AIBA 4DJFA 3EDFA 3AS1A 1XPGA 2WVUA 2C14A 3EDJA 1Q45A 1MO0A 3A4WA 3MSRA 2OWWA 1QK2A 1TPB1 1FKWA 3NCOA 3W1TA 1NP0A 4PMDA 4UOZA 3TXVA 3CBWA 2DSUA 4GUGA 1Q6EA 3AS0A 3I3DA 2W61A 8XIAA 1XISA 1PKMA 3TN3A 1I2OA 3GVWA 4IP5A 3SQMA 3G8RA 4OOZA 1PJ9A 1ISYA 4JQ3A 4MPKA 3UG3A 4UFLA 1GOOA 1Z6KA 3IS4A 3QQ0A 2H3DA 3R0DA 2PWFA 1FWDC 4C6MA 4A4AA 3R11A 3IUDA 3RCMA 4JNMA 3DHFA 1CX9A 2HVOA 4E2VA 1KA9F 1XLIA 1O1HA 4JICA 3A9BA 4FR1A 4CCEA 4IT1A 5A6LA 1CTNA 1V51A 1R86A 2BB0A 1UJPA 1YXYA 2ZX7A 4HVXA 2VNCA 2E0PA 2ZUWA 1R3QA 3S42A 1YEYA 1PKNA 2GGEA 4RK8A 3CHEA 3FN9A 4I6KA 1OVDA 3TU9A 3PZMA 1XKYA 2DZPA 3KUMA 4WCJA 3CU2A 3EEZA 5K4ZA 1NWRA 4O0ZA 1VH7A 3LUTA 3DAQA 1GQLA 4PEKA 1SFJA 3TKFA 1DXEA 2J8FA 4HU4A 3RIKA 3WUEA 4FALA 3DBNA 4GA8A 2VRKA 3UWEA 3CV7A 1XI3A 3B05A 1M1BA 4DI8A 1OIFA 1W9BM 5I7GA 4OU1A 3GXPA 3WD0A 1XRTA 2QR6A 1N55A 2DZXA 1XIEA 2RUSA 1SGJA 4IX2A 3UEQA 1MI3A 1XBXA 2ZX6A 2VWSA 3HZ3A 2RKXA 3LEPA 1TE6A 3PPCA 1G1YA 2E5DA 4HSNA 1TV2A 4C7DA 1XD1A 3A3WA 1EQPA 4TVCA 1JYVA 2GSEA 1L6WA 3WD2A 1HJQA 3G8EA 4V15A 2H3BA 3L4XA 3UVAA 3SFKA 4UXDA 1NDZA 4HA1A 4UFMA 4A8LA 3S2LA 2QJJA 3MI2A 3VKCA 2ZA1A 3M0IA 4B5UA 5AYIA 2BWGA 4D1IA 4H8UA 2PWGA 3RR1A 4YJ5A 2CZDA 3AAMA 3CM4A 1V3HA 3TFXA 3KOYA 3TYEA 4OT7A 1LQ2A 2ZC1A 3ONBA 3IIOA 1UWIA 2PDXA 1TTJA 5FEWA 3L2LA 6XIMA 1JUBA 3OVRA 4FPSA 1W9UA 7TIMA 4JY9A 3TX9A 4HSHA 3LG3A 1X1OA 2YL5A 1EBHA 2J78A 1ZUAX 5D2YA 2VELA 1Q65A 2GVEA 3I68A 4JX5A 2ZXBA 4JS3A 4BJHA 3ANYA 1I0DA 1SSGA 1Q5MA 2YBUA 3R58A 4O4VA 3GU2A 1UWAA 1KCLA 2X1IA 3SUUA 2ZRYA 4A3HA 2YX0A 3TNOA 3FKRA 2I5IA 2P5NA 4E3TA 9XIAA 3GDLA 3K8KA 5D32A 3RX3A 2PA6A 1JYWA 2BGQA 1LLOA 3ERPA 1JF5A 1Z3NA 3WQDA 1LLWA 3G6LA 4V2XA 4MWAC 3IK2A 2H9AB 1KGWA 2UY2A 3BVJA 1VKFA 3E0FA 3ZFHA 4QEEA 5IM51 4PTVA 2OX1A 1QOXA 4Y8FA 4GI6A 1ZRQA 2QCFA 5ABEA 1H09A 4B5TA 1H7PA 3N6JA 1MQRA 3T0CA 3RU8X 3WIJA 1ZL1A 3LSBA 4IJBA 1UIPA 4WXYA 3VK5A 4FK9A 2E6AA 3H21A 2B7PA 3WN6A 1C7TA 5FF7A 3RM8A 4DO5A 8TIMA 1TIMA 2Q71A 4L5ZA 4MWAA 4PSPA 1GNXA 3WUGA 4HA0A 2ZUNA 2WJFA 1J0KA 3UU0A 1XUZA 2QAPA 2Y7EA 3NUKA 4H9TA 4GBUA 5C2GA 3S6OA 4AHPA 4AYGA 3Q58A 1DXIA 5BW6A 2ZRZA 4PC8A 3GDMA 3TOPA 5BRQA 4R7OA 4JN6A 3TSBA 3RM9A 1TELA 4UCGA 4MNMA 2XU2A 4OIFA 3WUBA 1LT7A 4KCUA 2V63A 2AQOA 4CNNA 3SCVA 2E4TA 4AHOA 1TA3A 1R7AA 3DIPA 4PGLA 4KEVA 4RPPA 2OWXA 1ESWA 2WC7A 5LNWA 4LQ1A 1FFQA 3ALGA 3JVAA 5G1MA 4CU7A 5HINA 3B9EA 3OZYA 4ADUA 4F0KA 3WQCA 1ZZMA 3NO5A 2D23A 1QATA 4NNCA 4C6FA 1AODA 3GH5A 1LG2A 1VP5A 1M41A 4XBJA 4N02A 2A3BA 3LSCA 4JQ2A 2O9RA 3H4GA 4G56A 1UCWA 1W1TA 3G77A 3UJSA 4PUMA 5D2WA 2A5HA 1FCBA 4XUYA 5FF3A 3R12A 1A80A 2R9RA 2IPJA 2AKMA 1S2AA 4GGHA 1K77A 4EXQA 1L6SA 1EJWC 1CIUA 2A79A 1Y5VA 3II1A 3C86A 3FA5A 4S39A 2FZ9A 3STPA 3VDBA 3C56A 1LQ0A 3CUXA 2ZRWA 1IEXA 1DJYA 3CMGA 2F7FA 1IZKA 2UY4A 4HHLA 2W27A 2HISA 4M6UA 3CIVA 3EX2A 3NL2A 3GXDA 1DIKA 1KR0A 2ACQA 3U48A 3LBOA 2Q8ZA 3FYYA 4INFA 3AMGA 2IKJA 4MZYA 1QUMA 1FWRA 4NQ1A 4J40A 2VMFA 4ASTA 1EPXA 1TJPA 5AECA 3B8UA 5LNUA 1KFBA 1OEPA 1HJXA 4PUKA 1HP4A 1E55A 3QV9A 2GJNA 5KMYA 4HZ7A 4CD8A 4L1XA 2IMRA 3M7SA 5AHEA 4HMCA 5F4SA 2TODA 1JD9A 5D9NA 2O0TA 4H6KA 2Q09A 4GC4A 1RQEA 4JOMA 4O0QA 5AHLA 4YCOA 2WMJA 1ITUA 1IE7C 3ISIX 4KIEA 4LYRA 3F4DA 3KX6A 4AZ7A 1C8YA 4ZA0A 2J24A 3SUVA 4D6JA 1L6FA 1KBLA 2WMHA 3N9SA 2INEA 2W4XA 2X1UA 2WYSA 1LLZA 4JTSA 2F6KA 1W5OA 1XSJA 4QAIA 4Q8QA 1BPLB 4S2CA 5I3HA 5D04C 3VPLA 5KEZA 3VOIA 5BZAA 4ES4A 3HQPA 4ZOBA 3G18A 4LS2A 1GVYA 4WK9A 1CLXA 3SECA 1CBGA 3T8QA 4WXZA 3W86A 2VX4A 2YCIX 4A05A 4ZO8A 4HD5A 1LCOA 3C6CA 3D0CA 3NTYA 3V35A 1C8XA 1GPFA 2NSOA 5EMMA 4S3CA 3MPGA 3FGCB 1UKTA 3QXBA 3G1SA 4IIEA 1ITXA 2BY1A 1GVEA 3AYRA 4A3QA 4G1KA 3KBJA 4QLJA 4WHBA 3SCOA 2VEGA 1UC4A 2PTXA 5T9BG 4GXWA 4P61A 4HZ6A 4EF8A 3MMTA 2J7FA 4QDWA 3SQSA 1W8SA 3DFOA 1JDCA 3W2KA 5C9UA 4IPJA 3CZKA 1OT2A 3GYCA 2NVAA 2JK2A 3ZVIA 1TMLA 4OV9A 1OCBA 3VMOA 4XSMA 4AH7A 4DJFD 4UQ9A 1CXIA 2VC7A 1K7XA 1GQIA 4LVAA 3KWSA 3WJXA 1I2NA 3EDKA 3OB8A 3W25A 2WCSA 4Y9AA 2GYIA 3LM3A 4BEQA 1WAUA 1CXKA 5EB8A 2DZSA 3C5QA 5U7SA 4AVFA 2INFA 1C7SA 2J6XA 2CBVA 3UERA 1EGVA 2HVMA 1TMQA 4HN4A 2AL1A 2WNNA 3CTTA 3R4IA 3LNMA 4ZO9A 4JTQA 1KC7A 4IGHA 3QF0A 2VM8A 1B9BA 1XH1A 1JI2A 2XUCA 3WDQA 2PZNA 3LX9A 1A5MC 3UPMA 5AOUA 2E6YA 3GWQA 4RW5A 1E72M 1FDZA 3FV9A 2FHCA 4PRWA 1RPKA 1AJZA 2I57A 1Z42A 1T6MA 3PFRA 5FF0A 4RUBA 5GNYA 2PRMA 3PJUA 3VTRA 1YNPA 3TLQA 4NF7A 4BI5A 4PUDA 3G1XA 1UR0A 1K4GA 1VF8A 2HROA 2YFNA 3QVQA 1BD0A 2O56A 3VIIA 4HK7A 3NZ1A 4B90A 1W9XA 1ALDA 2FJKA 3KVLA 4TO8A 2WKGA 4HPNA 3RRXA 4PH6A 4R27A 1P0BA 2YCKX 3V4BA 4YWIA 1VCFA 3LU2A 4JQAA 4KQNA 4RZ4A 3T9PA 5C9ZA 2ZUMA 2C1IA 1OFQA 1V6VA 4PMNA 3GC4A 4KIRA 1HGWA 4LWWA 1VFUA 1DP0A 2OFJA 4WX2A 1L2UA 1M6JA 1EJSC 3SY5A 4JNYA 3VCCA 5DXXA 3CUZA 5EMUA 1VQTA 1ZTVA 1CECA 5JBFA 5KSWA 2GUBA 2FH8A 5BYWA 3PZVA 3VNJA 3KOFA 1MW2A 1TVLA 4BQ2A 3DG6A 1MVYA 3CK5A 2A3LA 3WF0A 4GO9A 5EGRA 1TMHA 2QXWA 1F8IA 3Q2DA 4Q8PA 2V5BA 5D2VA 1OWQA 3T2OA 3KBMA 2OQYA 3T4CA 1ZFJA 4NL1A 4AD1A 5EL1A 2BP1A 4H6EA 2DJXA 4TX9A 5HK4A 3VIHA 4E4FA 5MHBA 4H8HA 2Y8UA 1NF7A 4V33A 3NO1A 2AMGA 3BXWA 1E71M 3MVTA 5D33A 1RY0A 1I8JA 3QMTA 3BW3A 3CNYA 1A0EA 3K4AA 4AC7C 1VD6A 1JR1A 4QAWA 1A3HA 3FJNA 3C2EA 1KXVA 3QOMA 4IGSA 2XSAA 1XGEA 1VEOA 3PSVA 3WMSA 5BU6A 4NI3A 3W71A 4R5EA 1AJ0A 2VR4A 5JIWA 3NPXA 3A5VA 2VO5A 3DZ1A 4AQLA 2Y85A 3KCJA 5HMDA 3RLVA 4C7GA 3RF9A 3ONCA 4IFKA 3W26A 4V28A 1OG0A 5LXEA 4QXIA 4JY8A 5EKYA 3VMPA 4RDVA 1UBSA 1BRLA 2OU4A 1CGTA 3DI1A 3OHMB 3W70A 1WDQA 1LF1A 4FSAA 1EDGA 1OFEA 2DQXA 3W1LA 4G9PA 1MYRA 5HA7A 4EXAA 4WF7A 3W7CA 3ANVA 3TIMA 3FAXA 2JKAA 4Y9MA 3ZR6A 4BY3A 3A22A 4PODA 2R1MA 3AJ7A 5J5RA 1J0HA 3CV6A 5DN1A 3QYQA 1B3OA 4KS0A 4M6VA 2XN2A 3UQNA 4KWVA 4R7JA 2VD9A 1QHPA 4I5RA 4F8XA 2HPMA 2G41A 1M9HA 4HTBA 3A23A 3USZA 1AZ2A 4QSHA 2VI0A 1UZ4A 1Z9AA 1BSLA 1XLFA 3VUPA 2GUUA 3NM3A 2ZUVA 1XHGA 4UZUA 2XISA 1HJVA 4AAJA 3V16A 1POKA 4JFVA 1JZ3A 3AUOA 3UR8A 2YXOA 2F6UA 1UIOA 3AU6A 4GQ0A 1EJXC 3ZLHA 3PG8A 1IZCA 3CL6A 3LK6A 2HS8A 4EAYA 1EYWA 4DYEA 3ITYA 4OJYA 1OG6A 1YE6A 2GQAA 3L4TA 1VFMA 2Z25A 3P80A 3AZTA 3BG3A 1XR2A 2WJEA 3DERA 2NQJA 1XLDA 5KINA 3Q45A 2XGBA 3S9IA 1T40A 4UFIA 2PDUA 3ITGA 3DYMA 5CPOA 2P0OA 4J2MA 1UOZA 2V2DA 2Z27A 3N25A 1YTDA 2CU0A 3VE9A 1O5XA 1J93A 3G5EA 4HU8A 2CCRA 2NQ9A 3M7WA 3KCLA 2WMGA 4CD5A 2VZUA 1XLMA 1UD6A 3O8AA 2RAGA 1LUCA 4ZB5A 1HTIA 4Q32A 3HMJG 4QLKA 1E6SM 4IXHA 4FLSA 1VENA 3LI0A 4E8CA 2YZRA 3TTSA 4NAFA 1JPDX 3UZZA 3H53A 2FVKA 4RE4A 3KTXA 4MNJA 1CZ1A 2BZNA 4QQUA 3GY1A 4AD4A 1F07A 4IQEA 3C0JA 3UG5A 1GYMA 3EXRA 4O1DA 3B9NA 2QV5A 4IZGA 1W9DM 2OJPA 1GYLA 5I6SA 3KBVA 3GHRA 5CGQA 3GXNA 4GVGA 3UYCA 2VQUA 4I8DA 1BXCA 4XK2A 3T08A 3GNPA 3WQOA 2CHOA 4ZOEA 1U33A 1W1IE 1MQQA 4U28A 5CZKA 3WYZA 3ZJKA 5FJUA 3UR2A 3GHUA 1FWTA 3A21A 1OYAA 2O7SA 5FESA 2J7DA 2GGIA 4EANA 4S3FA 1BKSA 3UD6A 4PCPA 1TB3A 1FCUA 1WNOA 4PBGA 4Q6JA 3AU2A 3BG5A 3IJIA 4KKXA 3VGEA 4RZ6A 1RVKA 2NUXA 3O6DA 4HYRA 5A8PA 1UROA 3AXIA 3MUIA 2JFEX 3BURA 2C18A 1J0JA 3NR0A 4JD4A 2AKZA 3NNTA 3ARRA 3FSUA 1VS1A 3LV5A 1CXLA 1KRAC 4TVDA 1Z7AA 2I9UA 3LNPA 3W6MA 1REQA 1KRMA 2WSYA 5IBXA 5DEZA 1O66A 3N2MA 1TA3B 3EXSA 2YSWA 3RX4A 3WF2A 2VZSA 2WCAA 3ICJA 1XIDA 1QWKA 2C8NA 2PWVA 4I9MA 1XGZA 1EQCA 3EWCA 4IL2A 3C2OA 3WNKA 4UFJA 3ABZA 2GVGA 4EPBC 2DJLA 1V6YA 3V3WA 2JQXA 1K8XA 1P1MA 1QOPA 3L23A 4LU0A 1V08A 4GKTA 2G95A 2PE4A 5EFDA 2PUZA 3MO7A 4R88A 1T8QA 1XYAA 1QW8A 3OBAA 5I79A 3VM7A 1WZKA 2OMAA 2Y4SA 3S5ZA 3V0SA 3MUAA 5IDZA 4G7EB 3TYDA 4D1JA 1RA0A 2ATMA 2XSBA 3FAWA 5FOOA 3TA9A 5B80A 3BJFA 1TZ7A 4K1WA 1QPNA 3FA3A 3HV9A 5CZ0A 3O6AA 4CKQA 5CG0A 2QPSA 4HJWA 1JZ7A 3U2OA 1O5RA 3OO2A 1G4EA 4QCEA 4IF2A 2EQDA 4IIFA 2DY3A 2OELA 4JPGA 4S3JA 3ZZ1A 3BLOA 5TF0A 5JUVA 2OPJA 1EPVA 5I3FA 2A6LA 3WEOA 4IXXA 2HXTA 3BLEA 3C4UA 3SY1A 2J88A 3AMLA 3OGVA 4FIQA 1I4NA 3N9RA 1S38A 2ZICA 2QUVA 1NTHA 2BV9A 1EO5A 4P2VA 5CPSA 1PEZA 1NFGA 1UG6A 3A12A 1ZPTA 3P5YA 4UQEA 1CB2A 1EKOA 4MYXA 4GYJA 1DV7A 1TWIA 3G3MA 5I0DA 1GT8A 3EGJA 4H9MA 1GHSA 5H8UA 3WK1A 1Q7ZA 1ISZA 4C6DA 1AQ0A 2ADAA 2HNHA 1VHNA 2X7WA 1XIFA 4GCAA 3JU2A 3S46A 1W1YA 5KITA 1UYQA 1DJHA 3LHYA 1X6NA 3N14A 1XJBA 3A9IA 3JUGA 2ZRVA 3BAKA 3C2YA 3VD3A 1PSCA 3C2FA 4M5PA 4DELA 3I4EA 4FB7A 3MWCA 1W1B1 3APYA 2ZUSA 3TXZA 1WKDA 9CGTA 5LIUX 4Q4PA 5J5DA 1QR7A 2BX7A 4ENLA 2OZ8A 2YDQA 3VKDA 1Q6DA 1TVNA 3H54A 3WLNA 1W3HA 3VNIA 4LCRA 3JS3A 2ESCA 3BAJA 4KBXA 3B0XA 4ZZ9A 2DH2A 3ABXA 3O1NA 3OA3A 4LNYA 3UY7A 5D37A 4ZR8A 3QV6A 2Z2UA 1WP6A 4TX8A 3PBUA 4ZENA 1O5KA 2YJQA 3TJLA 5IXEA 2VD8A 3IJ7A 1JXJA 1TCMA 2FKPA 1EA0A 2CZVA 2RDWA 4OZOA 1OC7A 2D3LA 4ILSA 1B2YA 1U5JA 4A8RA 4ERIA 4DI9A 3CO8A 4GUIA 3BTNA 1KB3A 4BEUA 4CEXC 1S5VA 1BWLA 4PMQA 1P7TA 4K3ZA 3M0HA 5BRPA 2W92A 1I75A 5F4XA 3MSDA 4BA0A 1AD4A 3P8IA 1LOSA 2IKHA 4H8VA 1FWFC 2FJUB 2JKPA 4BHYA 6REQB 1W91A 2OR2A 1XW8A 2TAAA 4M82A 3CB8A 2WPGA 2ISVA 1Q6LA 4E5TA 3P0WA 4I9JA 1GOMA 1ZU8A 1S2WA 5DT7A 3D5HA 4EK7A 1W5MA 3VM5A 4HNVA 1HZYA 2VZOA 4JR5A 3N4AA 2FFIA 3BLLA 4DUWA 1B3ZA 1KM2A 3W23A 1EOMA 4BK9A 4QTGA 3VUSA 2GQ9A 1DWFM 3I7SA 2P10A 2V38A 3ORWA 1S39A 3G1VA 2IS7A 1SU5A 4JZ5A 1B3XA 2ZUTA 4NP7A 1SM9A 3LA4A 4XAPA 3S2MA 3EDDA 1TV7A 4ZXLA 3NQAA 4YXGA 3LS9A 1LDCA 3LRLA 3ABSA 2GSJA 4LV9A 3ZS4A 2JGYA 4GXMA 1UZHA 2REQA 1FXQA 1GOXA 4IISA 4S3KA 2VFGA 5HBFA 1HJUA 1OY0A 3CZGA 1QI2A 3POCA 4ZO7A 3DECA 5PTDA 1HW6A 2J74A 2BHUA 3NQ6A 1KR1A 3CTLA 2WZIA 1HO1A 1V3IA 4LF2A 2WMIA 2WZMA 2UY5A 4XX6A 2ZZ1A 5DBUA 3T4WA 3NYZA 3TR2A 4UTMA 2QZRA 4U2ZA 5EMKA 3W7QA 4TOQA 3F4WA 3OIXA 2NV9A 1V3MA 3VI2A 1CNVA 4CVWA 1C91A 2B4GA 4REQA 3W7EA 2G97A 2G3NA 1X97A 3PSWA 1UPPA 2Y61A 1QBBA 2WVVB 5LSMA 2OSWA 1RP9A 4QSFA 2PODA 4UOJA 1M65A 5HR7A 4QG8A 3H2FA 4BR1A 4KWUA 3DX5A 5HWNA 5HJLA 4AD5A 4WSKA 1R46A 4JHMA 2G3MA 3RG6A 2BDQA 4M80A 1FX6A 1V03A 1XRFA 4AUBA 1D3CA 1TO3A 3BDKA 4AFYA 1Y8BA 4UQCA 5DMYA 4AEFA 3NWRA 3PTQA 1KCZA 3PTKA 1ZJIA 3NEVA 3T78A 4WKHA 3IAQA 5DBTA 5BXRA 3AHXA 1WE5A 2PGRA 1BAGA 4AB4A 4A8IA 1P4CA 3F4NA 3PBMA 3NZRA 3STGA 1HUVA 4WVXA 3MDWA 1G7UA 2P8BA 1V0LA 1UKQA 3XISA 1Z48A 2ZDSA 3E02A 3O16A 3EMZA 4US5D 3LCGA 3TJ4A 3B8WA 5HAOA 2G4FA 3LLFA 2FTWA 2Q3RA 5I02A 3CUFA 4KPLA 1DJZA 3AIUA 4O14A 3W83A 4RE0A 1BWVA 2VGGA 1YQ2A 3PBYA 4J7RA 5DF0A 4P5UA 1V02E 2VUYA 3FX4A 3O15A 3CQ0A 3E38A 3SRHA 1CGVA 3ATYA 1BF6A 1E0TA 1RBLA 2HJPA 4NG3A 2DW6A 1QHOA 1DQXA 1KQZA 2XIOA 1UZDA 3SN0A 2BOEX 1EDTA 3I7QA 4C6BA 4U33A 5ABHA 4C60A 3LCHA 3PHAA 3OQ8A 2OVLA 3S9ZA 2EGZA 1RPXA 2QMJA 1LL4A 3S2NA 1E9ZB 1OQFA 1ZY9A 3UPBA 4RZBA 1UH4A 1RA5A 1A5LC 1PXGA 1ZENA 4DWSB 4G8TA 1ONWA 2EPOA 3W72A 1WXZA 1R9XA 1YKWA 4ECLA 3KAOA 1A50A 4Z1AA 1JCJA 3MZ2A 1ZSXA 5CJNA 3U7VA 2I7GA 5LKYA 1VBJA 4PYSA 1XYBA 3AS3A 3ZVHA 1BQGA 2E9LA 3EDEA 3PZOA 4XWUA 3AO0A 4ZMGA 4GO8A 3T42A 1KLZA 5LGZA 1YTKA 4AVOA 4PUNA 1TUFA 3LN3A 4U3CA 4CD7A 5E70A 2QUNA 3ANUA 3EAUA 3HB9A 5GJPA 2G8ZA 4L9XA 2YYTA 2VC5A 4UTTC 1KM5A 5IBXC 5I03A 3INPA 3W76A 4TMCA 3W84A 1XWYA 2YL8A 3V36A 3V5CA 1ZGDA 3EMCA 1I6NA 1SO3A 2AAAA 2QEZA 3E2SA 3GZ3A 4Q4OA 3H26A 3NOEA 2V82A 1RAKA 1DEDA 4DB7A 2AOSA 2VOTA 4Q4KA 3MCMA 3VX1A 2WC3A 2E1WA 3BLKA 1LBLA 3RMEA 3RM4A 4IPPA 7ODCA 4IM4A 1GCYA 4DLFA 4YVXA 3GM8A 1QI5A 3C0SA 1K4HA 2A3HA 4HPXA 4GQBA 2G3IA 2A3AA 3C61A 1XLBA 3NIYA 1AZ1A 1LRNA 1XC6A 3FIGA 2X8RA 5A8QA 3GW0A 3AMKA 1Y5WA 4WR3A 1XYCA 3AIWA 3R13A 2I9EA 4ZODA 3TOYA 5A1AA 5CAKA 1E9LA 4UTTA 2BY0A 4MSSA 5A2CA 4EPDC 1ENUA 3R25A 1KWKA 3EB2A 4H7VA 4UCFA 2O92A 3T1GA 2WSKA 4XSLA 1JZ4A 1JPHA 1XLLA 3E2RA 4C65A 3W85A 4B91A 1K8YA 1NOWA 4H9ZA 2F38A 4IWWA 1EP2A 3L5LA 4L61A 2DSKA 2B81A 3P84A 1UQYA 2G50A 1U1HA 3DFPA 1KCXA 4TR9A 1T8XA 3GBDA 3DKJA 1GYNA 4GVIA 5FACA 1GZGA 1US3A 3UNDA 1QO5A 2CBJA 2PDFA 1GONA 3ZWSA 4UBPC 1JAKA 3WMCA 1R30A 2DZVA 2NQHA 2WC4A 4JCLA 4LXFA 5LGXA 4UFKA 1JDEA 1O5QA 2Z2BA 3N18A 2J7BA 1W9PA 3WENA 4MMWA 3V18A 4Y9PA 4V1XA 1I9CB 4MWAD 1CT5A 2WQDA 2VGFA 4U4MA 1K1DA 3N2BA 5BOOA 2YCLA 4Z2IA 2PEVA 1AQMA 3IJ8A 4E0CA 1RALA 1A53A 3DUGA 3LZ3A 3IGHX 5FEXA 4XIMA 2C71A 4ZEPA 2XWDA 5XINA 4UR9A 3P62A 3DC0A 4XZWA 3BSGA 1BVZA 4X0VA 3WQ8A 3ALFA 4IJRA 5CC7A 4IIHA 4PMRA 5DLCA 3DBPA 1N2VA 1J8VA 4CNPA 1F3TA 3O3RA 5DX7A 3AALA 4QGCA 1Q6GA 3OODA 2F84A 5CPTA 4GZ7A 2V68A 3TN4A 3BO9A 4BI6A 4WGXA 3LDVA 1VFFA 5HPCA 4IMDA 4NNBA 3GTFA 3WLRA 3SCSA 1IWAA 3L4ZA 4RXFA 4Z0SA 3FNDA 2WXDM 3SUTA 1PB0A 2WNWA 4YLWA 1ZAJA 4HIBA 1XG3A 5KTLA 4QG9A 3S5OA 4HTYA 2HS6A 1F6PA 1SZGA 1LWJA 2CZFA 3EOOA 3W7KA 3POHA 1TKKA 5HNUA 3U0HA 4PCFA 2OZ3A 1WCGA 5A94A 2V3GA 4ORIA 1ZBKA 2DT2A 3RMJA 2FMOA 3W27A 4DJEA 3EKLA 4Q4QA 1F4AA 3UG8A 3UXLA 2OO0A 3BOFA 3BV7A 1X1NA 1VYPX 2DZTA 2VX7A 4PMUA 3WZ0E 3SUSA 1O60A 1K6WA 2DIJA 1XXXA 3G0XA 2YFOA 2PS2A 3KLLA 3LBCA 3KTCA 3CGTA 4OECA 3LQLA 2X1RA 1AW5A 1MUCA 3NQGA 4PUEA 2NV2A 5SWUA 3NQCA 3CC1A 1YPXA 3ZJ7A 3W29A 4PTWA 3TJIA 4B92A 3G0SA 1JAEA 2VVNA 3MSYA 3L4UA 4KFOA 1WUFA 3HPAA 3FKKA 3BZGA 4QG6A 4EPKA 1SMDA 1JPMA 2EXOA 1K03A 2DH3A 4JTIA 4FXFA 1PS9A 2FYMA 3KDOA 4NI8A 3FW6A 1XX1A 1QCWA 1LOLA 3SFWA 3TZNA 1S46A 3NZPA 3W4RA 1RP8A 2A7NA 3K4DA 3WFZA 1NH6A 3WY1A 2J7CA 2QUTA 2WKJA 3VVGA 3MI3A 2JIEA 2O9PA 2QCNA 3MUZ1 4K68A 4KW2A 3CQJA 5E93A 3R94A 2CITA 2G37A 4GINA 4GIAA 3TV8A 3FFSA 4QDMA 4CLMA 4Y7EA 4LBRA 1S3HA 3VIGA 4FP1A 4KEUA 1E6RA 4X60A 3M0LA 1XINA 2DDXA 4DJDD 3TSMA 3LTYA 2BY3A 3W7MA 1K6AA 4GX8A 1T7LA 3H2OA 3U6WA 2Y70A 3GNRA 3OVQA 4LAOA 2XH0A 5E9XA 2HE5A 3UP8A 5A6JA 4LUTA 3H55A 3CHCA 3FDKA 1B4EA 4IG2B 4XAYA 2UV8G 1UC5A 3SCRA 3KVKA 4YIWA 3ZSSA 5DT5A 1E3ZA 4EVZA 1IEWA 3GLCA 3GHSA 1TIWA 4NZCA 1ZAHA 4JHZA 4KWOA 4AIOA 5I3KA 2QCMA 1IXOA 1BF2A 4JFSA 3S8HA 5H91A 1X6LA 4FOUA 1FUYA 1RXOB 3BW4A 3M5XA 1PO9A 4E8GA 1JVNA 2EPMX 4XD6A 3W75A 4KCTA 3VD7A 1PX3A 3N11A 8A3HA 2WM1A 4A3RA 3HIJA 4IMGA 4HCDA 3MKKA 3CWNA 1KFJA 4Q4MA 1CGUA 3QSTA 3UETA 1XS2A 1KRBC 2CBIA 4N42A 3TAKA 5E09A 5CC6A 3S4TA 3W1AA 4W8BA 1DJGA 3GB6A 4WSHA 3EPMA 1TWWA 1US2A 5RUBA 3QRHA 3W24A 4LBSA 1KNWA 3T2QA 5CAHA 2YW3A 3WBXA 4DUOA 4MB3A 4Q3MA 1TPH1 1O95A 5AVNA 1PVNA 2XZ9A 4A8NA 5J8LA 4F3HA 4L6DA 2V81A 2Q8LA 3CQKA 2C13A 1D9EA 1KO0A 3CIXA 1HL2A 5G4WA 4Q7NA 3PG9A 1FWEC 3VIOA 1J0ZA 2VEMA 4KRZA 3FEQA 5I2UA 5BRBA 3TC3A 1EIBA 2QGHA 1NEYA 4JDBA 2W67A 3RK8A 4IUOA 4L9YA 4PFMA 3B3DA 4ZBCA 1OFOA 2DIEA 4ZVJA 4C1NA 2ISSA 1AQFA 1YHTA 4ZTYA 3GK0A 3K5XA 2DT0A 4DYKA 1E4NA 4GZIA 5ABGA 4NIRA 3S3GA 3QEZA 1E1EA 3OZOA 1ZJHA 3PWAA 3OA5A 3WQPA 2MUCA 1GEQA 1RBOB 1IF2A 1IWBA 5EPDA 1P7TB 3CZEA 4ROPA 5DY2A 4JN8A 1XIBA 1UP0A 3GG7A 3VNDA 3IGXA 4M7SA 2OLAA 1SO6A 2QKFA 5BWFA 2QUMA 4GIYA 4HMDA 4M29A 3PUDA 3P2VA 4F0SA 1UA7A 4QLLA 3H70A 4J2PA 1SZNA 4IMAA 3L65A 4JL1A 3MB9A 4HSOA 3SM0A 4FXJA 4DM1A 4QS6A 4EACA 3W2UA 4GZJA 1EZWA 2AGTA 2PDKA 3STFA 2BMBA 2VCCA 1KXTA 3RCYA 4LRSA 3NXLA 1PYMA 2GK1B 2YOCA 4XAZA 3NYDA 3ZO9A 4YN5A 2YW4A 3ENLA 3QYSA 4L64A 2QUUA 5JU6A 3T8LA 1H7OA 1LZOA 3DYPA 1U30A 3SN1A 1KV5A 4QR6A 4H9XA 1R3YA 2Z1XA 4K6AA 4CNTA 3KTSA 4NT0A 1EZ2A 5C7VA 1NDYA 5I09A 5AHMA 3AXKA 4PTXA 3W2MA 3PAJA 2IKIA 1Q3NA 4TUFA 4UMBA 3UZYA 5C7HA 5E0CA 4NYUA 4GNJA 1W3IA 3GHTA 2PTWA 1B1YA 2JKEA 4HNNA 5E0FA 3ARUA 4PEEA 2PP3A 2ZWYA 1KGUA 2Y7GA 3OBEA 4ZL1A 4WIWA 5G2WA 1P0DA 2XPKA 4H8NA 1H41A 3EWYA 1KM4A 2QPUA 1FH7A 2CZ5A 3I6TA 1H7RA 3W6YA 4F40A 3TFCA 3W81A 4ZQMA 4Z42C 2NT1A 2WMKA 1FCQA 3ARTA 1GQKA 5IDIA 2E1DA 3T0TA 1X38A 3UCQA 2D20A 2F8QA 2VEKA 3R1ZA 3MT1A 5CGTA 2ACRA 4XBSA 2DV0A 4P7RA 3ZOAA 1YDYA 5MKGA 4C5YA 1ZHAA 1Z41A 5FAGA 2WVSA 4Q8TA 4WKAA 2AQWA 1B30A 4PB4A 3WG6A 3O05A 4M19A 2EG6A 4F79A 3OQEA 5CPQA 1ZALA 1OB0A 1M7XA 1V0NA 2BGSA 4WY0B 5HMEA 3CPRA 5MF5A 4WDUA 2W63A 4L56A 3O2LA 3UYIA 3TTYA 4NILA 3S1XA 3BUVA 1ONEA 3THCA 5HPOA 4YHEA 3SI9A 3TC7A 1YRRA 4AX6A 2ZIDA 3PJTA 2XH7A 5A8GA 3PZIA 4R85A 1UKOA 3BANA 1IIHA 3W74A 3E0LA 1W54A 4MFDA 4FS9A 1MZRA 4W85A 4ADSA 4U5IA 2X05A 3ZT6A 2AQVA 1OGBA 4CGTA 4K1GA 3S5YA 1S2CA 4Z2GA 3AIBA 3TA6A 1V7AA 1FXPA 1W5PA 2DU2A 4A3YA 3VINA 2PD9A 1QMLA 4B15A 1E0VA 1DQUA 2ALRA 1JG9A 4DY1A 1CGWA 2J13A 3BMWA 2OTDA 4GCXA 2POTA 2QDGA 4MAVA 1ZJAA 1M5WA 2NX1A 4WJ8A 4OGZA 2A3CA 2VEFA 3VA8A 3DGRA 1GTHA 4QE4A 3LI1A 2JALA 1EEPA 5M1TA 1GVSA 3VAVA 3APTA 3O6CA 1HKVA 4D6HA 1OK6A 3LGDA 3UZWA 1GHRA 5BXSA 3S5NA 4ONVA 3H2NA 4LCSA 4LUSA 3VZYA 3KP1A 4BCEA 2R1NA 1R2SA 4ZFCA 3AWOA 1XLKA 4IP4A 4GPNA 2DEPA 1GOQA 3M5VA 3LY0A 4BFAA 4OQVA 3G2GA 3OP2A 3VZZA 1XPYA 3OG3A 3BG9A 2Z1BA 2D1ZA 4GJJA 3L66A 4R9XA 3D47A 2PD5A 4G6CA 4BQ4A 1QFEA 3W0KA 2NT0A 2Y6ZA 1ZBWA 3ITCA 1WZAA 3IUHA 4ZTXA 1O1ZA 1FY6A 4CNUA 4XZHA 4UTHA 3Q65A 3MU7A 1DKWA 3CLWA 4W5UA 5FJTA 4OWGA 1F73A 3A4XA 3CXOA 4M8UA 2CKRA 3UWWA 4ZOCA 1TQXA 4YTQA 4KEZA 3NZQA 2INZA 2Q01A 4W89A 4PMVA 4DUVA 1LORA 1ZQ5A 5JBEA 4J5NA 4WSJA 1MSSA 4JGDA 3M0YA 3BAIA 3HGSA 4L6HA 1PL9A 3QQ1A 5IRPA 3GAYA 4WOQA 3W7DA 1IT7A 5EA9A 1YDOA 3OPSA 1OBAA 3EOLA 2AAMA 4B4HA 1C29A 1YW1A 5LIKX 1G69A 1YXCA 3O6YX 3REQA 1YX1A 4LC6A 1DWHM 2E67A 1YDNA 3A4AA 2BHZA 3VC5A 3BC9A 5GPRA 2DW7A 3BSHA 4CNSA 1OCQA 4N2YA 3WMLA 3QSRA 3UZ5A 1J6OA 5FJIA 4URIA 2WW5A 3W07A 3WH5A 2QDDA 5TNVA 2FZ8A 1RZMA 2J7GA 1AH3A 1JNEA 4PL2A 1VZWA 4A3UA 3DEQA 5HJXA 3SCWA 1S2VA 3FSTA 3S6DA 2Y5JA 3VGBA 5LHEA 2X41A 1HO4A 3BAYA 5FEPA 4AZBA 1JDDA 3JR2A 1V3LA 4FF7A 1DWGM 2XFRA 4MY8A 3L4YA 1U5VA 1AJ2A 3WNMA 2A7RA 5EFFA 3N29A 4D2JA 1JPKA 3WBYA 5KZ6A 4IPIA 2W79A 3DFSA 4QQ3A 3R43A 3L0KA 3QR0A 4JHOA 3H4XA 1GVOA 2OXNA 3KHDA 1VEPA 1W5QA 2ZZ7A 1IXNA 3GKAA 3W7NA 1BGAA 1YXDA 3NOYA 4XAFA 4MM1A 2J66A 2E6DA 1T99A 4J1OA 4D6FA 2ZX8A 1N82A 1SFSA 2AL2B 2GOKA 2X09A 2ZA3A 5HUPA 3UY8A 1NFPA 1XBZA 2CLLA 2J62A 3UZXA 4ICMA 2IKGA 2CC0A 1BRLB 1W3LA 2PDHA 1QTWA 1EJ7L 1UD3A 3HPXA 4MAZA 1WPCA 2C6QA 4CQBA 4MZ1A 2TMDA 3W3OA 1WV2A 1SUXA 4H9YA 4E3VA 4ADTA 2P3ZA 3M0JA 3UPWA 4KH2A 1ADDA 1ITCA 1V0KA 4KERA 4WDTA 1HF6A 1BGGA 5CBIA 3SAZA 3KS5A 5E6ZA 3PWGA 5BCAA 4RNIA 5CC3A 4QE1A 1E1CA 3EWZA 1YTEA 1QI4A 1E5NA 3EB4A 2QCDB 3SSJA 4XZNX 4DO4A 2BVDA 2NW0A 1OC5A 3F5KA 3W7PA 2OT0A 4C6OA 1B31A 2EPLX 2NLIA 2XIIA 1FHDA 3OBKA 3P6LA 4LUYA 4O50A 4DZ5A 1Q2RA 1KXQA 4GQQA 4XQ6A 1W2PA 4S3AA 1RCOB 1Z44A 3VKKA 2DPEA 3MI6A 1UUOA 2OOGA 3WF3A 4DVOA 1E0UA 5BU9A 3RDKA 1WKFA 5I3IA 3FLUA 1RQBA 4LY4A 2QF8A 1XQLA 1OYBA 4XD4A 2ONEA 3SRDA 5AZ1A 1QASA 3GC2A 5HWJA 2CPUA 3P5ZA 1YADA 2E40A 2WKLA 1TV5A 5BMXA 3KOWA 2BXZA 3GW3A 2ANUA 2WNQA 3EB3A 3RX2A 3CH9A 3NJ3A 4GLEA 1KTNA 2FH6A 2JBMA 4P7QA 4LGXA 2HXUA 2CLEA 4QX4A 4MNKA 3QC0A 5JQ9A 4YU1A 3VNMA 3LGGA 1NY1A 3AC0A 1K02A 4LV4A 4Q8WA 3PZTA 6XIAA 2YZ5A 1R2RA 1LJYA 5A8MA 2E3ZA 1SW0A 3LENA 3TJXA 1U1JA 1FA2A 2C79A 2V8ZA 2XH2A 4LY8A 1G67A 1LQAA 1J5SA 4GG9A 3K30A 4M51A 3UJRA 3WQVA 4AWTA 4UNKA 2OQHA 3RRAA 2XYLA 3DYOA 3R5EA 3W53A 1JD7A 5A6AA 3PZNA 1I1WA 1UASA 1ZAIA 3LPPA 2Y8KA 3W01A 1XICA 3PJXA 1LP6A 1UW9A 2PDLA 3RPMA 3DFNA 3H8AA 3KZPA 2XHYA 3VNZA 3T2PA 2PDIA 5CSSA 1UKSA 1JCXA 4X9SA 3JRKA 1CEOA 4HA4A 1V7YA 3I65A 2OX4A 4LC8A 2E9BA 4GY7A 4UOQA 1TVPA 1E15A 5I24A 1V6WA 3WLSA 4W7UA 2GSHA 4H2HA 2FMNA 3GDKA 5H8PA 1D8CA 2FLIA 5GVJA 3L4VA 4QS5A 5DANA 2MANA 5H2ZA 3VGGA 3U4AA 1EHAA 3GR7A 4O12A 1I2PA 4HNCA 4E2DA 1X6UA 3USBA 5CZSA 3BGAA 4YTUA 1EF2A 1QHZA 3TQKA 2GZXA 4FZIA 1F3EA 4IQLA 1K7EA 3O0KA 2PP1A 3NVDA 2NWSA 4HP5A 4UTIA 4Z2HA 3H4WA 3STEA 2OG9A 4B2DA 2RJGA 1WYIA 2I16A 4KCVA 1L8NA 1PV8A 3PVFA 1VIWA 3E0VA 4HHHA 2GJLA 2YA1A 1QPOA 3DOPA 4PBEA 3B06A 1H4PA 2WHLA 3GVQA 1ICPA 3UA4A 1J96A 1VLIA 4IG2A 4U2YA 3PF3A 2QVHA 3F2DA 3U4FA 2Y24A 3DFYA 3ITTA 3RR4A 5D05A 4P7OA 4N9BA 3QPZA 1J0YA 2RDXA 2CW6A 3W2NA 4B16A 2NQLA 2QCDA 4J3VA 4H9VA 3REQB 1A5NC 3HA1A 1QNVA 4UTJA 1Q6RA 4CUCA 5KETA 1K9EA 4MLRA 2Z28A 4EX4A 3TSDA 1AVAA 2C91A 3LHWA 3TTQA 2CNCA 1PE1A 4CCZA 1T5AA 2C3ZA 2J8GA 4O18A 3W02A 3SUWA 1C8VA 1XG4A 5LYRA 3WD3A 3N3MA 4LAUA 2I1OA 1PWLA 2HRWA 1H3GA 1JUEA 3PC0A 3MS8A 1V93A 3NQ7A 3T55A 3P3BA 4EXBA 1HJSA 1UR9A 3PFMA 2CETA 2PURA 2GJXB 4L7ZA 1R87A 1J9YA 1WBHA 4LYPA 4AMCA 1AMKA 1DWJM 2WB5A 3W73A 4ML9A 5HNRA 1A5AA 3RHGA 2G3FA 5I3GA 2IQTA 4I5XA 4UR8A 4A2RA 3AIEA 5MKGB 3LERA 1N8FA 4X0NA 1C8QA 4BQ3A 3ARZA 2ZRUA 1FWIC 4FMVA 5CXPA 3SIZA 3DHDA 5GNXA 4HNOA 1EWDA 2VT0A 2Z7KA 4LAMA 4ZO6A 1E1FA 2ZCGA 4F9DA 1Z69A 1Z89A 3GX9A 3ZLFA 3L21A 1SR9A 4W5ZA 4RNFA 2GJRA 2PDWA 3EX4A 3LZ5A 5E0KA 4LYKA 4XZLX 2QCCA 3DI0A 1CCWB 1K9FA 2J8TA 3S6TA 1RJQA 5REQA 1NARA 3EOSA 1U5HA 3HG2A 2VFFA 5ABTA 1BXBA 4L1GA 3HG5A 4IUGA 3MKVA 3PB0A 4L6OA 2PTYA 5DMLA 2PDGA 5HQLA 3EKGA 4ACZB 1RQHA 4AEOA 3RO8A 3V0UA 1L0PA 4NY2A 4DBWA 2WQPA 4H6QA 1RCXB 1UR1A 3MQTA 3GVVA 1R9ZA 2YBVA 4LUJA 2C0HA 5U4NA 2VR5A 3PB2A 1NDWA 4N9CA 3NL5A 1EBGA 4H1ZA 4JTUA 3LHVA 2FTPA 4AD2A 4G7EA 1AL7A 4AZ5A 2G4JA 1CGYA 4EP8C 1W3NA 4CQ8A 3PANA 1P0KA 2GK1A 1IZJA 1QU4A 4PZVA 2YA0A 5CJMA 2H6RA 3UXDA 5JH1A 1H1ZA 2XH4A 3HGOA 3DESA 1OD0A 2HK1A 4J28A 3ARSA 3T81A 1TPEA 1B4KA 1CENA 5GQBA 4L1WA 4E2OA 4K36A 2EJAA 2OYKA 4UTKA 1RK6A 2E8YA 4G5DA 3BQ5A 3UWZA 2PDYA 1OM0A 1RY8A 1LOQA 1SJBA 3PJWA 1FH8A 3SJ3A 2F9RA 3QC3A 3KDNA 4W84A 1B57A 3W7OA 4CQCA 8CGTA 4PMXA 4PFHA 4UTFA 4O8AA 5FCZA 1ISXA 3UBPC 2WV8A 3WH7A 1UH3A 2QQ6A 2VUNA 4I7WA 1E4LA 3TZFA 3NQFA 4J27A 5FKYA 5F2GA 4D6IA 3XIMA 1UPMB 5HANA 3CAVA 2PRHA 3E2VA 3RGTA 2L5HA 4EF9A 1HGYA 2BOFX 1VYSX 4NJHA 2HQAA 2XIBA 3H2CA 4H00A 5D2TA 4L4PA 3OU8A 1E6NA 2FGLA 4XZIA 3N73A 3TQPA 3CH0A 1AW1A 4GY1A 2IXVA 1EGMA 2G0WA 3V1PA 3SY8A 1UA3A 4QP0A 3TW6A 3VKBA 3MUXA 3K8LA 2CESA 3A3XA 2PU1A 3L7RA 3SW6A 4TVUA 3VU2A 5H1WA 4GOAA 5HULA 4EWJA 1ICQA 5JH2A 2BODX 2IUZA 3N1AA 5TAOA 3BJSA 4AXKA 1JDFA 4FO4A 4LBUA 4AZCA 4GI8A 4NUWA 4DJEC 6TIMA 1RJPA 3SRFA 4JIHA 1N8WA 3EOUA 5T9CE 2E7FA 5AVHA 3N4FA 1ONXA 3THAA 3SZ8A 1PKYA 5A95A 4MJZA 1QI0A 2ZVRA 1XDMA 3WQEA 3CAQA 3V0TA 1R38A 3KW3A 4UTWC 3FVDA 3W1UA 3M64A 3VILA 1P6BA 3NDYA 3VKJA 5JXQA 2DGAA 1OX5A 3SCPA 3U8GA 5HWMA 2WNZA 4UB9A 3CYVA 4F0MA 4RR4A 3BK0A 1PZ1A 3KBNA 2Q6ZA 1TREA 3GIPA 4LCQA 2YB4A 4C6JA 2YPIA 5KZEA 4RDWA 2Z26A 2OLHA 4RKAA 4TTUA 3R7MA 1H1NA 1HKKA 4HQVA 3P74A 1UR4A 4A22A 2J27A 3PUOA 4MUPA 3AZRA 2QV4A 1EH9A 3W37A 5I78A 4I7VA 4JX6A 4YVVA 3GU1A 1WB0A 3RJXA 4NXKA 2R94A 2WM0A 3FGCA 2B0MA 2GGJA 1ZCCA 3ME3A 3S1GA 3VGHA 3T0BA 3N34A 1PWMA 3MANA 2FVMA 3WL0A 1RJRA 4UTWA 2RJHA 1YDVA 3LCWA 2YL9A 4GVFA 1XP3A 2YL6A 4W86A 2DP3A 9RUBA 3N13A 3M47A 1RBAA 3QY8A 1EC9A 3BWWA 3N17A 2D2OA 2ZYFA 3N2OA 1Q13A 5CH9A 2TYSA 3M46A 4ML4A 4O17A 1FTXA 2PZ0A 1XRSA 3AMCA 4S3EA 2PAJA 1HP5A 4W8AA 3QW3A 3M9YA 4HBKA 1OJXA 2HE8A 1UH2A 1WX0A 2O4MA 4YMZA 3E9AA 1SYTA 4AG0A 3VD5A 1UOKA 4LVFA 3N9KA 4IQJA 1TFVA 3WJSA 3UXAA 3TNBA 1KFKA 3OZPA 4NSBA 1DJQA 1O7AA 3P60A 1U22A 1KGXA 4HK5A 3WX7A 2V67A 3K8MA 1BWKA 4C6IA 2XWEA 3WNPA 3UXIA 1EP3A 3VNLA 3WH8A 3Q94A 3B97A 4JYDA 3WK2A 2BXVA 1AQHA 1UR8A 3FS2A 3PPFA 4FF5A 1SJAA 4CU8A 1DPMA 3B8TA 4O1BA 1Q85A 1E40A 1Y0EA 3QV7A 1KW1A 1FOBA 2I56A 4L9ZA 2OEMA 5FL1A 3WJWA 4NZ1A 3UA3A 1V79A 1DORA 1KBJA 4AYSA 5CPMA 4GWEA 2VFHA 2VFEA 3MV11 2PDQA 2J4GA 3ARQA 1XH2A 4D8LA 4RCXA 5I3JA 1R3SA 3IANA 4Q8MA 3UCDA 1DBTA 5I5RA 2OEKA 2X30A 4PRTA 3QMSA 1WZMA 1I45A 1HVQA 4C6LA 4EOUA 1X1ZA 4BWLA 1Q8JA 4HOZA 4MKVA 3TR9A 4CU6A 4HYVA 1B3WA 1OZMA 3GTNA 1ZJBA 1KTBA 3NQMA 4XD5A 5AHNA 3TN5A 3E5PA 1M7PA 1WDRA 4DF1A 4QJ3B 3PR2A 3BCJA 4NAEA 3WMBA 4KETA 3W7LA 4AU0A 4ACZA 1QOQA 4JBRA 4AHQA 4H6RA 5AHIA 4YWSA 4D71A 3KWXA 3DKLA 3P82A 1OX6A 3AI0A 3AHZA 1XLEA 2OSYA 1K8CA 1JIBA 1Q66A 3R89A 1MUMA 5XIMA 4IPNB 4ORMA 3KHJA 3YPIA 3C0QA 5C0QA 4WJXA 5I07A 1R6WA 1KBKA 2QDHA 5C55A 5I3DA 4JFUA 2CFFA 1X96A 1GZ1A 1EJVC 1ZBCA 3P67A 4HHMA 3EMQA 1EJUC 4PRRA 5GJNA 1TRIA 2YLAA 3VX0A 3CUJA 3B9DA 1JPIA 5D4YA 4IIDA 1H63A 4DWSA 3BMVA 1XSIA 3VXGA 3H24A 3BLFA 2AGKA 1PIIA 1TJRA 1TG7A 3HG3A 5EMJA 2OZ0A 1O68A 2Z7GA 5FJPA 2DORA 5CQ1A 4ZSTA 1H60A 2GJXA 2VURA 2O55A 2CLIA 1HKJA 2ZBTA 2VHLA 3R2GA 2VDIA 2EKCA 3TWBA 3WQWA 2B31A 4GACA 1JZ6A 4U10A 4TTGA 4MGGA 3UWYA 2NXGA 1FP8A 2QGYA 3DFHA 4P8WA 3G1FA 4P8UA 1WA3A 4PB3A 4FOJA 3NPWA 4PR4A 3H22A 2X2GA 5HMFA 3GKFA 1UMYA 2XIMA 3PK7A 4B3ZA 3WDRA 3EX3A 1REQB 3U7BA 3GRIA 2ZA2A 4JFWA 4MY1A 3PZQA 1NELA 2XM1A 2VRQA 4HN8A 4KCWA 2VR2A 4F66A 2NXIA 5LA2A 4DBDA 2PMQA 4D6GA 4HPHA 3TAOA 2XN0A 3KL3A 3IIVA 4Q8VA 3MJMA 1Q63A 3MP5A 4O1CA 4MZ8A 4JXCA 3VCRA 3T6CA 1GKPA 1QRQA 4J9JA 2DQWA 3N4EA 2PDPA 1FWGC 3UG4A 5IHRA 4ICNA 4FI4A 2H8ZA 5A2BA 4LUSB 1IGSA 3W7GA 5LZLA 3DHUA 2V5JA 1L6YA 4ZXOA 4AY7A 1KFEA 1SMAA 2PDMA 2CHRA 2VZVA 4O1FA 3MKCA 1EC7A 5TIMA 1QK0A 2A21A 3GU9A 3FJLA 3PPHA 3PS7A 2V6AA 3I6RA 3VOGA 2HDJA 5HOSA 3B40A 3CV1A 4D72A 5CLTA 3FOKA 4LRTA 4AWEA 1VAHA 4DRSA 3AJXA 3MTWA 3N2CA 4QROA 4WKFA 4Z1DA 5HQMA 1SFTA 3E49A 1I2RA 4W93A 3FYPA 2A2IA 1TTPA 3IIPA 3G6MA 2E68A 3L12A 2WLZA 5C2XA 1MW0A 4ZE5A 4YYFA 1VBRA 4WDXA 5HNNA 1ZCOA 4GNKB 3ZVHB 3B0PA 4JIQA 1TTQA 3TE9A 2Y89A 2DUXA 3QHNA 4ATLA 3OVGA 2PGFA 3R10A 1DIOA