1EOMA

Crystal structure of the complex of endo-beta-n-acetylglucosaminidase f3 with a biantennary complex octasaccharide
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
283
structure length
283
Chain Sequence
NGVCIAYYITDGRNPTFKLKDIPDKVDMVILFGLKYWSLQDTTKLPGGTGMMGSFKSYKDLDTQIRSLQSRGIKVLQNIDDDVSWQSSKPGGFASAAAYGDAIKSIVIDKWKLDGISLDIEHSGAKPNPIPTFPGYAATGYNGWYSGSMAATPAFLNVISELTKYFGTTAPNNKQLQIASGIDVYAWNKIMENFRNNFNYIQLQSYGANVSRTQLMMNYATGTNKIPASKMVFGAYAEGGTNQANDVEVAKWTPTQGAKGGMMIYTYNSNVSYANAVRDAVKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDO-BETA-N-ACETYLGLUCOSAMINIDASE F3
publication title Structural basis for the substrate specificity of endo-beta-N-acetylglucosaminidase F(3).
pubmed doi rcsb
source organism Elizabethkingia meningoseptica
total genus 103
structure length 283
sequence length 283
ec nomenclature ec 3.2.1.96: Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase.
pdb deposition date 2000-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1eomA00
3VDAA 1C7SA 5BCAA 3SUWA 5FKYA 4DM1A 2J62A 1JNEA 1UUQA 3MUZ1 1VFMA 2V3GA 3TONA 2VCCA 2YIHA 3AHTA 3GM8A 1PPIA 4QCFA 1ISZA 1MYRA 3ZT5A 1E15A 1AQHA 3TP4A 3WD1A 3CGTA 4PMYA 1V6VA 3OGRA 4WLCA 2XVPA 4Z2IA 3GXMA 6CGTA 1DWJM 4TUFA 1JZ6A 1UYQA 3ARTA 5BXPA 2BY2A 2CETA 1P6WA 5JBDA 3ZJ8A 2OSWA 1US2A 1R7OA 3WUEA 4TVUA 3ZJ6A 4WF7A 3NSXA 2BVDA 2GJPA 4W5ZA 3BAWA 2VZUA 4A4AA 2XPKA 3WDRA 4AD1A 3WBAA 1CEOA 2V5CA 1E6ZA 4HOXA 3AIRA 4UFHA 2NSXA 2VTFA 1NARA 4PN2A 3VD4A 5A95A 4QAWA 1G0CA 4PMUA 4NI3A 3VPLA 2VX5A 1N82A 3GXIA 2D2OA 1HJQA 4JKKA 4C7GA 3W38A 3VILA 5KZ6A 1V0KA 1QNQA 1GCYA 2WLZA 4CD5A 4UQBA 5IDIA 4DWSA 3ZT6A 2JEPA 4FMVA 1J18A 4OBRA 1H09A 2JALA 1TUXA 1V08A 3VGBA 4PMQA 1XYZA 4AIOA 2VZVA 3AZRA 3RMEA 1V02E 2GSJA 1GJWA 1MFVA 1IZJA 4AIUA 1O7AA 1PZ2A 1W9PA 3WH8A 5DO8A 2AOSA 4MB4A 3BH4A 4ACYA 4S3KA 4ATDA 4UFIA 1Y7VA 4XZWA 4WSJA 1BYAA 2GK1A 3IK2A 4CU7A 4BQ5A 3CZJA 3WMBA 4MNKA 4GI9A 4QFUA 3FNDA 3SCNA 2JEQA 4W7VA 2WVSA 1JXKA 1BF2A 2DSUA 3N9KA 2VQTA 1JDAA 4D6GA 1HJVA 1D3CA 2G41A 2CEQA 3MV11 3WQ4A 4CVUA 3WQ8A 5I23A 1XD1A 3WQ5A 2DIEA 3AMKA 1B0IA 4F79A 1C8YA 2EPKX 2ESCA 1HN1A 4M80A 2QPUA 2BY1A 2WSPA 1JZ5A 4OBSA 2CYGA 2DEPA 2IXUA 2W67A 3AHYA 3VTRA 4M8UA 3IJ8A 3THDA 4BS0A 5LA2A 2EPNA 1JZ7A 1H11A 1EDGA 2DH3A 1BYCA 4MTVA 4YPJA 3N1AA 2YLAA 3WDHA 4ZE4A 2QF8A 1JAEA 3L4YA 5A1AA 1E6NA 2A3HA 1JZ8A 3WUFA 4H7VA 1E5NA 3WQVA 1MXGA 5E09A 1RD6A 2JIEA 2VZOA 4P7RA 3RIKA 1J0JA 4Y7EA 5EBAA 5M5DA 4XZBA 4HZ6A 1PX8A 1EA9C 3U5YA 1BVNP 1E72M 2ZUTA 1TVPA 4UNIA 3PHAA 2EPMX 2GFTA 3CUHA 4TXEA 5D9NA 4LXFA 5BXTA 3IANA 1B1YA 1CDGA 1HP5A 4ML4A 3T0AA 2ZXAA 1W3JA 1GQIA 4BQ3A 2DIJA 1KWKA 3G6LA 3WENA 5IHSA 3RDKA 3VVGA 2BVYA 2XVKA 4OIFA 2YDRA 2WMFA 5BYWA 1E1EA 5AY7A 1GNXA 4LYRA 2A3CA 3SUVA 1E55A 3PZQA 6TAAA 2AMGA 5CSUA 2XFFA 4KRUA 4PMRA 4ATWA 3BLPX 2PWDA 4JAWA 3T2QA 4AD3A 4MPKA 4AD5A 3CMGA 3DHPA 1JI1A 3AIWA 3WNNA 2XWEA 4Z2KA 2V38A 2XM1A 1UZ4A 1I75A 4GO9A 1ITXA 1NOFA 3VIJA 1SMDA 2VX4A 1VFOA 2J4GA 3WDIA 2J7GA 1JZ4A 3WH7A 1GVIA 1AVAA 2J7BA 5ABHA 2W61A 2WKGA 3BLKA 3CUGA 1GORA 1LWHA 2PI6A 4AC1X 1C91A 1E73M 4D6FA 3WFZA 3BXWA 3OGVA 2JF6A 3SCSA 2OSYA 1UD2A 2RGMA 3VDCA 1UR8A 2VQUA 1DHKA 1EO7A 1B31A 5DMYA 3AIEA 2YJQA 1CYGA 1JG9A 1ZS2A 1L0PA 4R5EA 3WNKA 1XRVA 3T2PA 5A94A 2E8ZA 4AD0A 2OWWA 2WHLA 1KR1A 4V27A 4CD4A 1E1FA 4KMQA 3VX1A 3NJ3A 3AMCA 1E6QM 3A47A 5I5RA 1FP9A 4GIAA 1WNOA 1UH2A 1V6WA 4UFMA 2FHBA 3L4TA 2WBGA 3FW6A 1HJSA 3WQWA 5A8NA 3VNZA 3VGEA 1B3XA 2J79A 5BROA 1GHRA 4AMCA 2UY3A 4W84A 2BV9A 2J75A 3MANA 4NZCA 1V6YA 2ZE0A 1QI2A 4PTWA 1C3FA 2WVVA 4J27A 2Y5EA 3VUPA 4CN4A 2YL9A 5A8PA 3WD4A 4U3AA 2WYSA 1SR0A 3N15A 2QMKA 3OG2A 4DM2A 1MVYA 1NWSA 4JFUA 4CCDA 5JBFA 4H04A 2F8QA 2Y8KA 1VB9A 2NW0A 4XV0A 4F66A 2Z1SA 2VR4A 3DC0A 2GUYA 4AWEA 5HPCA 1KQYA 3TOPA 1GUVA 1XH0A 4MNLA 1FFRA 4GO8A 3VGHA 3HU7A 2V3DA 2F2HA 3CIVA 3FHQA 5CGTA 5FIPA 1UD6A 1GOOA 3IJ7A 4J3UA 1HKJA 2X1IA 1JZ2A 1CBGA 1XSKA 4MJ2A 4ZENA 4ZXLA 1ISVA 3SCTA 2W62A 3KEHA 3BAIA 2NT1A 1WO2A 5FD0A 2G4FA 4GQRA 2WWCA 3ARPA 4MNMA 4MDPA 4U5KA 3MU7A 3OBAA 3AROA 1Q6FA 3MMUA 3WL1A 1C90A 4D6IA 5HOSA 2CKSA 2D1ZA 2ZWZA 4CGTA 3AZTA 3MV01 2FGZA 1M53A 1KBKA 5A6BA 1K6AA 3PZTA 1UWQA 4WIWA 1L8NA 2EQDA 3WNMA 4AISA 1Q6CA 1WDRA 3VIPA 3O2LA 1IT0A 3G6MA 3U7BA 2IUZA 1HF6A 2V3FA 3I3DA 4WKFA 2XGIA 3SCQA 2E4TA 4LYPA 4S3JA 1W3KA 2CHOA 3VIIA 3WFLA 2D0FA 3AS0A 1ZBCA 2Y8VA 3QR3A 1IZKA 1R87A 2J7HA 3RJYA 4E8DA 2E9BA 3EDKA 4FLQA 3BSGA 4BA0A 2WC7A 3VM7A 1VAHA 1UD8A 3CZEA 3CUIA 3A4WA 4W88A 4Z2LA 1GQJA 4YHGA 4RE3A 3B9DA 1HKIA 3GBDA 2ZIDA 1VEOA 3SCOA 1H0IA 3WF4A 1XCXA 3BC9A 2YOCA 1MW0A 1B2YA 1CXHA 3EYPA 1AMYA 2WNWA 2VZSA 1H2JA 1D7FA 4LQ1A 3PTKA 2X8RA 3LPPA 3CLWA 3VIGA 4JFVA 4PEEA 1S46A 2WM0A 3SIMA 3GYCA 2DT3A 1B9ZA 4YN5A 1C8XA 1E6PA 2WHMA 3CBWA 2D0GA 3GNOA 3WH9A 4D6JA 2J8FA 1MFUA 3N12A 5FL1A 1W9UA 3APGA 2ZX6A 4HMCA 2OYLA 4BZYA 1GOMA 1VFUA 4HTYA 3FAWA 1AQ0A 1DP0A 1UQYA 1W32A 2VCBA 1E4IA 2VURA 1E4MM 4ZFMA 1JYNA 1BGGA 3GXDA 2X09A 2C8NA 4EE9A 1LLOA 1E9LA 2JIWA 1C8QA 2D3LA 4U3CA 2CXGA 2WLYA 3WF0A 3HMCA 4TTUA 4A3HA 2YL6A 1W1YA 4TOQA 4B15A 2QMJA 4N0RA 4D72A 3UESA 4W93A 3WBEA 1KWGA 3IAQA 3T0DA 5DFAA 3ZM8A 1V3JA 3II1A 6A3HA 3UERA 2VO5A 2DT2A 5HPOA 5ABFA 4HOWA 3AICA 1QNSA 1UHVA 1E3XA 2VOTA 1C93A 2VNCA 1RP8A 5D9PA 3SUUA 1WDSA 3KWXA 3ARRA 3VGFA 5IFTA 3NCOA 1PAMA 4W5UA 5JIWA 1UG6A 2OWXA 3NIYA 4P7OA 4PMZA 1ZJAA 2XWDA 1PIFA 3AI0A 1BYBA 2G3NA 4UQDA 5I77A 4ACZB 1G01A 3OB8A 4QCEA 1OB0A 2J7FA 5A8OA 1CWYA 3UR8A 1YHTA 1OM0A 1EH9A 1DEDA 2YDQA 3VGGA 1BHGA 4JKMA 3NUKA 3NSNA 3D3AA 1OCQA 1RPKA 1RH9A 4RL3A 1CGVA 1UKOA 4GZIA 5FOOA 4MAVA 1E6SM 1XGZA 2D24A 2PWFA 3EDJA 2G3JA 3SCWA 2ZX7A 3WDQA 9CGTA 4HA4A 5CG0A 2WZEA 3WF2A 1EQCA 3F5KA 1XSIA 1CLVA 1J12A 4M56A 1OBAA 3BCDA 1ODZA 3GXFA 2J8GA 5I6SA 3N18A 3AYSA 2EPLX 2BVTA 4H8VA 1EDTA 2J7EA 1H1NA 3W28A 3UG5A 1JFHA 1TR1A 2XIBA 1HJXA 1GJUA 1KCKA 3ARSA 1DWFM 1PZ3A 1HJWA 2G8ZA 3NYDA 2W4XA 4NRSA 4L4PA 3VOCA 3BMWA 1W3LA 2ZICA 1G1YA 4UOZA 1GONA 4GQQA 3KL3A 1XH1A 5JUVA 2WK2A 2WVVB 4GZEA 3ZT7A 3MKKA 1LF1A 2PWGA 1QW9A 3L2LA 2ZUMA 1JYVA 5IXEA 2FHFA 4D1JA 2GDVA 4E4PA 5A2CA 1X1NA 2IXVA 2XVLA 4HZ8A 4CN1A 1LL6A 3W26A 3N13A 1I1XA 5C70A 3TTYA 3AISA 5LYRA 3QHNA 4NRRA 2DSVA 1V3LA 4GI6A 5HXMA 1HVXA 4PMOA 1E4NA 3L4WA 5BXRA 2CIPA 1CGXA 1KBBA 3FN9A 2MANA 3BAXA 1E0XA 3OLGA 3W6MA 2Y2WA 3W24A 2PBOA 3OLDA 2D0HA 4F9JA 4CCCA 3RPMA 2YL8A 2WMJA 3SUTA 2VX6A 7CGTA 1X6LA 4UCFA 2WHJA 2CBJA 3M6DA 2XVNA 5E9AA 2XFYA 2XYLA 2VC9A 3BGAA 3CHCA 3K8LA 4UOJA 1JGIA 4AZ6A 5CZKA 4DWSD 4MADA 4PCSA 3WNLA 3A6OA 3ECQA 1OD0A 4KH2A 1VFFA 4K68A 1GQKA 1JYWA 4TTGA 1OINA 2WMKA 3MUY1 1KQZA 1WCGA 2ZXBA 2EXOA 1NP0A 3OZPA 1J0HA 1PJ9A 3WL0A 2XVGA 3PZUA 2ZOXA 4W7WA 5E6YA 1UD5A 2VRKA 4PCTA 4HU8A 4J3WA 3VU2A 4C7FA 5M3WA 4OOZA 1B3YA 3VX0A 3WEOA 1OD8A 3VKKA 3PZNA 4FK9A 3SUSA 1ISWA 1X6NA 5LA0A 4X9YA 7TAAA 1KXQA 3WUGA 1VEMA 2FH6A 1R7AA 3ZJ7A 2A3AA 2XTKA 1ZB5A 4J7RA 5E0FA 2YA0A 5A6LA 5HDRA 4JHOA 3UEQA 3O9NA 4ACZA 4RE2A 1OGGA 3SEPA 1MW1A 1A47A 1CXIA 3SCVA 3W4RA 4F9DA 3CH9A 3WNOA 2CBUA 3F5LA 5D8WA 2O9TA 1HX0A 4U2ZA 3ZSTA 3VIOA 3KZSA 4NF7A 2VVNA 4DUXA 3RO8A 4D6CA 3BMVA 2D20A 3GH5A 3O6AA 1XHGA 1BG9A 1WZMA 2YLLA 3WDPP 2EJ1A 3VGDA 3ALFA 2XFRA 1J10A 1BPLB 1MWOA 1JI2A 3WN6A 1MW2A 3I3BA 3PTQA 1W2PA 1DWHM 4MB5A 3QHMA 2XSBA 5BRPA 1CXLA 4Q22A 1VIWA 1QPKA 4JKLA 3DYMA 1QBAA 3VD9A 4QDMA 2DH2A 3PTMA 1MW3A 2QPSA 1MQQA 1LG2A 5BXSA 3VMNA 1OIFA 3ZOAA 2D23A 3NSMA 1HKMA 2WMIB 2WKLA 4B3KA 2WCGA 2Y4SA 1R86A 4JZ5A 5D8ZA 3ARQA 1JD7A 4AD2A 1VBRA 4OKDA 1TZ7A 2ZX8A 5C71A 2O9OA 2WSKA 4PMVA 1HKKA 5GNXA 3ARVA 3WH6A 2UY5A 4J3SA 4XUYA 5EFFA 5ABFB 3F5JA 2DSKA 1ESWA 2FHCA 3T0BA 1MQRA 3K4DA 3N11A 1BVZA 3GTNA 2VT0A 3CHEA 4HP5A 1BGAA 2ZUWA 4FLSA 3AS2A 1UD3A 2WAGA 3FXYA 4JIEA 3IJ9A 1PEZA 3W29A 3NDYA 4FLRA 1VEPA 4WSKA 3GZAA 5AC5A 4AD4A 4AZGA 3DYPA 5HBFA 3OLEA 5E6ZA 3PZVA 1QNRA 1UR9A 5C8BB 4J28A 4AZ5A 2WHKA 4MJ4A 1EDQA 3K8KA 2V5DA 2WMHA 4GKLA 1GHSA 1W1TA 3W82A 3I3EA 3M7SA 5CPSA 1KXVA 3PZMA 3BAJA 4PYSA 1DWIM 2YBUA 2OSXA 2VZTA 5KEZA 3SURA 4J3TA 3QOKA 1NWRA 5BWFA 2ZX5A 2CBVA 2CBIA 3UR7A 1B30A 4ATLA 2JFEX 1FFQA 1HL9A 1UKSA 1FHDA 3GH4A 3BSHA 2OWCA 1KGXA 2V3EA 1E3ZA 4KRTA 1MQPA 1VENA 2UY2A 1JF6A 2J7DA 3L2MA 3VIKA 4PMDA 2WC3A 1NH6A 1WZKA 4X0VA 2WVUA 5D9OA 4JHZA 4QLJA 1E70M 2PC8A 2J77A 3PZGA 1W2VA 1NOWA 1CXKA 1JF5A 1V6UA 2VVSA 3UG3A 4WK9A 3S6TA 2B31A 4Z2JA 4JL1A 1MXDA 3VDBA 4MB1A 4Z2HA 3AS1A 3GBEA 4P7LA 4PUDA 1UWRA 1UKPA 4WJXA 2CKRA 3ZMRA 4M81A 1VJZA 4C7DA 3PZOA 3WSUA 1OGBA 3MUIA 1TE1A 4D6HA 1U33A 1E6RA 1J0IA 2FDMA 1V02A 2QV4A 4HMEA 3PN8A 1WZLA 3N17A 4PSRA 2JF7A 3M46A 5A2BA 1E43A 1K9DA 3VD3A 2F61A 4UQCA 1ZL1A 3AMLA 1CTNA 2ZUVA 3CZGA 1KCLA 3WH5A 4XX6A 1NQ6A 2YL5A 3BAKA 3EMZA 3WD0A 3ARZA 4PUEA 1ITCA 1BQCA 3IAPA 3AMGA 4PSPA 3LPOA 2WPGA 3DECA 5I78A 1JXJA 1ODUA 3K8MA 3WD2A 1HJUA 2PB1A 4BQ4A 1WDQA 4YHEA 4AW7A 4V28A 1EQPA 1E0WA 1US3A 1EXPA 1VBUA 1NWUA 3QHOA 4PTMA 1HNYA 3NDZA 2O9RA 3L4UA 1TFVA 3A3HA 4B9YA 5A6BD 4PRWA 1LQ0A 1M03A 1GZJA 1XC6A 2UWFA 4P7NA 3VM5A 1ZJBA 1PBGA 5GNYA 1QBBA 4A3YA 4MDOA 2WXDM 4KGLA 3LMYA 1XD0A 1M01A 1Q4NX 2WMIA 3WQ6A 2YKKA 1CLXA 1KFWA 3POCA 3VNYA 2W63A 2QHAA 3AIBA 1KXTA 3WELA 2PBGA 4GZJA 2WMGA 3PZ9A 1SYTA 1OWQA 4P8VA 1EHAA 4QLLA 3RILA 4W7UA 2E9MA 2WWDA 1QI0A 1B90A 1BTCA 2CHNA 2A3EA 1WPCA 4OZOA 1QVBA 4M1RA 1M7XA 5GQBA 4U31A 5A69A 3WEMA 4E2OA 3ARYA 2EEXA 1QI4A 1LJYA 1QHOA 1WE5A 1BG4A 1CGTA 4PBGA 3K46A 5I0DA 2WCSA 2ZXDA 4IPNB 5A6KA 4OUEA 2FH8A 1ZBVA 1GOKA 3JUGA 1HIZA 4HA3A 3L4XA 3T2OA 4HOZA 3W25A 2UY4A 2C7FA 4KWUA 3DYOA 5BRQA 3AJ7A 4EKJA 1W9VA 1KGWA 4W86A 3AYRA 1LL7A 1TCMA 3CPUA 1SFSA 2GJRA 4DUVA 4CUCA 5M17A 2CESA 5DF0A 3ZSSA 2DGAA 4JCLA 3SCUA 2E0PA 4D6EA 2VJXA 1LL4A 2Z1KA 3SCPA 1ZBKA 1ISXA 1JIBA 3BCFA 3A4AA 3EMQA 3W27A 4M82A 1W91A 5GNZA 1H5VA 4HPGA 1JZ3A 3CZKA 1K9EA 3CUFA 1B3WA 3OLIA 1EOMA 2BHZA 5E70A 2CPUA 2JE8A 2J78A 8CGTA 4B3LA 2C0HA 4MB3A 4M24A 2XG9A 1WKYA 3AHXA 1CGYA 1UH4A 3W6LA 1UKQA 3ARXA 1J11A 3ZO9A 2BHYA 3RM9A 3OIHA 4D6DA 4EK7A 3KL5A 1V0NA 2EPOA 2BNJA 5IHRA 3WMCA 3AMDA 3W0KA 1E40A 1FH8A 1EHNA 1XH2A 1H0GA 2BHUA 4TX8A 1WB0A 3AXXA 4BF7A 1TA3A 3ZR5A 2X05A 5DT5A 2J47A 1HP4A 1GOIA 3QOMA 1H41A 1QHPA 2OYMA 2VI0A 1DTUA 3T08A 5I24A 1QW8A 1ISYA 4H8HA 3WKZA 3W81A 3A4XA 4N42A 1V6XA 1H4PA 4QP0A 1B3VA 3B9AA 4OOUA 5ECUA 2GJXB 2BFGA 1IV8A 4AEEA 4CU6A 3VINA 4AZIA 4H2CA 4W89A 1ZU8A 3FHAA 1JYXA 3EMCA 2PF0A 3FAXA 3ZIZA 1XCWA 2DSWA 4CVWA 2GVYA 3WF3A 4B9ZA 1V3MA 4U2YA 1J0KA 4TVCA 1VRXA 4JFWA 1UWSA 5ABGA 1XYFA 1NM9A 3RJXA 5FL0A 5EB8A 1PIGA 3VIMA 5D9MA 3VMPA 3MS8A 3TTQA 1W3HA 2J74A 1GQLA 3CMJA 1W1VA 5AC4A 4H8UA 3TTSA 2BXYA 1B3ZA 4DUWA 2DQXA 4AZCB 3UETA 1HVQA 3WY1A 1TVNA 1FOBA 3FY1A 5CSYA 2ZWYA 1G9HA 2WCAA 2CNCA 2D3NA 2J7CA 3F4VA 3AHVA 4JFSA 5EFDA 3RM8A 3M07A 2WBKA 3HJEA 4H41A 4MAZA 5CPTA 1NP2A 1FH7A 2W91A 3D5HA 5EMYA 2O92A 5M03A 3AZSA 5I3DA 4PTVA 2ZUUA 1HL8A 4L4OA 5F7UA 1W9BM 1C92A 1UR1A 1K9FA 3EDEA 4IISA 3AIUA 3VO0A 5A6MA 1CZ1A 2GDUA 4CN6A 1BLIA 4UZSA 4V2XA 2EO7A 2VRQA 5A6AA 1G5AA 2WZIA 3S2CA 1UZ1A 3WIJA 4UFLA 3CZ8A 3U5UA 1CXEA 3CUJA 2BS9A 4GPNA 4FF5A 5A2AA 3WD3A 5A8QA 1V03A 3ARUA 5CJ5A 5GPRA 3OA5A 1U30A 1ECEA 5DT7A 3AFBA 3K4AA 4PMNA 3POHA 4JL2A 5HNNA 1QOXA 4IPLA 4J3XA 4P7QA 2D22A 1JDCA 5D4YA 1RP9A 1Z32X 1E6XM 1JD9A 1CECA 2CITA 4HU0A 3W37A 1Q6DA 1GOQA 1UR2A 2ZXQA 1EOKA 1R85A 1CNVA 3GH7A 5DEZA 3ARWA 3TA9A 3HN3A 2YA1A 4CCEA 1FA2A 4HA1A 4WKHA 3B8SA 1J0YA 2PWEA 3GDBA 4GI8A 2X0HA 4MNJA 1J9YA 3U57A 1EO5A 1K9TA 3MSGA 2DDXA 3QGVA 4W8BA 4XB3A 4P8UA 1QI5A 2VL4A 5JIPA 1JL8A 5CPQA 4W87A 1KR0A 1J01A 2W66A 1OT1A 1W9XA 4HMDA 4U5IA 2BY3A 1I1WA 1OT2A 4GXPA 2G3IA 3GNPA 2A3BA 4RE4A 4E8CA 1V0LA 4M29A 4AEFA 3SCRA 4J3VA 3ZR6A 1QNPA 1Q6EA 3EBVA 1JFXA 3CHFA 1UH3A 4UFKA 3THCA 3ZJKA 1BFNA 5A8MA 1UKTA 2O9PA 1O6IA 1QNOA 2EBNA 2W92A 4BCEA 2J25A 5IFPA 2YBTA 2WVTA 1UA7A 4CU8A 1LWJA 1JAKA 3VD5A 2OYKA 5JBEA 2ZX9A 4UTFA 1G94A 3UG4A 4W85A 3OGSA 1TG7A 4EANA 1WDPA 2BXZA 2CERA 2VRJA 3AOFA 4NSBA 2GJXA 1V3HA 3VMOA 3VD7A 3VDHA 1WAWA 1E4LA 5A3HA 4UZUA 1CPUA 3L4ZA 1JDDA 4D71A 2FGLA 1UQZA 4LYQA 2DT0A 1LG1A 4F8XA 1HT6A 3PZIA 1A3HA 3B9EA 1PX4A 2DSZA 3PBGA 4D1IA 3WF1A 1NWTA 3GNRA 1QI3A 4BQ2A 3UCQA 5LA1A 1WZAA 2VX7A 1U2YA 4AZCA 3W53A 2QLYA 1CENA 2WC4A 1HXJA 1KGUA 4IUGA 2E8YA 4PMXA 1V3KA 4W8AA 3WNPA 1AQMA 4UOQA 7A3HA 3VIHA 4AZBA 4LPCA 3WDJA 1EGZA 3KE0A 4JCMA 4IM4A 3MUAA 1DWGM 3CZLA 4HPHA 3RCNA 5CLWA 2Y24A 5A6SA 4LX4A 1PX3A 1ZBWA 2HISA 4Z2GA 1JNDA 1V0MA 3ZQ9A 4CKQA 3MSDA 2XSAA 4QLKA 4DWSB 3VIFA 3E1F1 5CGMA 4W8LA 1TMQA 2AAAA 4KGJA 5E0CA 1BYDA 1TA3B 1E56A 8A3HA 2VUYA 2E3ZA 1E71M 1F4HA 3T09A 2E9LA 3LPGA 3RM4A 1KB3A 3J7HA 4UQ9A 3AS3A 1J0ZA 2YA2A 3AIVA 4U33A 3OZOA 4HZ7A 1FP8A 1CGWA 1XV8A 2XM2A 1DWAM 1UOKA 1E5JA 1GVYA 4ZE5A 4TVDA 1GPFA 1UD4A 5FCZA 1C7TA 2CCRA 4UQEA 3DHUA 1UR0A 2GK1B 4ZEPA 3WEZA 3CTTA 3WMSA 2PWHA 5I79A 4EAMA 1WP6A 3AXIA 4CD8A 2XIIA 5I2UA 1F4AA 3AQUA 4Q7NA 1FH9A 1UWUA 4B16A 4AIEA 4CD7A 4LGXA 1CXFA 5CQ1A 2RGLA 2WZHA 4GINA 2BY0A 2ZUSA 4TX6A 4UQAA 4URIA 1EIBA 4AYSA 4AZ7A 3KL0A 2HVMA 2NT0A 3CO4A 3TTOA 4JFTA 3N04A 1BSIA 5CXPA 1NOUA 2XJ7A 3AIQA 4FLOA 4WKAA 4AY1A 2VR5A 1UR4A 2W5FA 3WUBA 4UFJA 1KXHA 1VF8A 3AXHA 5CLTA 2WANA 1Q6GA 3AHZA 1CGUA 1W9DM 2DPEA 1W1PA 1R8LA 4AXNA 5ABEA 1YQ2A 1H3GA 5TD4A 4P8XA 1UA3A 1VJSA 1GOWA 3LPFA 1OIMA 4R27A 3L4VA 2VCAA 4OJYA 4X0NA 1OSEA 1BAGA 1FHLA 4AZHA 1QHZA 2WB5A 2ZUNA 5AYIA 5A6JA 2XHYA 1V3IA 3CHDA 2TAAA 3MMDA 1M04A 1CIUA 4P8WA 2X0YA 3BAYA 2XGBA 3EDFA 2X2YA 2Q8XA 1UWTA 2DT1A 2VMFA 3U7VA 4UR9A 1OGSA 4CD6A 1D2KA 1H49A 3MMWA 2YDSA 3MO4A 4PTXA 4DWSC 5AYBA 1XSJA 2G3MA 1E0VA 1GW1A 2E40A 3ALGA 3EDDA 4ZXOA 2XUCA 1SMAA 3K1DA 2OLHA 2WW5A 1UWIA
chains in the Genus database with same CATH superfamily
1Q66A 2XISA 4Q4QA 1MRAA 3SUWA 3L0NA 1EJTC 2J62A 5CZJA 2V3GA 3LHTA 3WLKX 3M9YA 2YIHA 3PPCA 1PPIA 1VH7A 4ALDA 4TO8A 3TP4A 4KCUA 5FSEC 1KNWA 2VDIA 2NQZA 2XVPA 4TUFA 5D2YA 1QPNA 4O15A 1YDOA 3E5PA 4FNPA 3BE7A 4H9ZA 1US2A 3GU9A 3IJQA 3WUEA 3R89A 2QAPA 3ITXA 4TX9A 4WF7A 1FDJA 3ATYA 1QT1A 2V5CA 1E6ZA 4CQDA 1XLCA 2A4AA 1IXQA 3TROA 1F8MA 1H50A 4QAWA 1OY0A 3VPLA 2VX5A 3GXIA 1SM9A 1HJQA 5MKGA 2YZRA 3UJSA 5D09A 2WLZA 4UQBA 4DWSA 1J5SA 2HBVA 3H8AA 1H09A 1TUXA 4PMQA 4N4PA 2X1SA 4R9OA 1XYZA 4HHPA 2V63A 4UMCA 5F2GA 3AZRA 4F0KA 2ZTKA 4AIUA 3UZWA 4E0CA 4C1NA 1W9PA 2QZRA 4JQ1A 1XM3A 4MB4A 4ACYA 4LV9A 5KTLA 3P5ZA 4IOTA 4XZWA 3ID7A 2Z7KA 3R8GA 4HIBA 3VYLA 2GK1A 4JTTA 1VCGA 1QWKA 4S3DA 1OYCA 2JEQA 2FJUB 2DSUA 4LF2A 2VQTA 5AECA 3LM3A 2H9AA 4JEJA 3WQ5A 1C8YA 2ESCA 3UWWA 4IFKB 2QPUA 2CYGA 2DEPA 3VTRA 3ZVHA 5F1UA 4R7JA 3H4XA 3IJ8A 3THDA 4ES4A 4BS0A 5LSMA 4G7EA 1EDGA 1BYCA 4S2BA 1WDWA 4ZE4A 3DEQA 4C90A 4XBJA 3M0YA 1JAEA 3TN6A 5C54A 5A1AA 1S5MA 5LNWA 3H24A 4WX2A 5E09A 4Z42C 3TVAA 1RD6A 2HROA 1Q5MA 2VHLA 5EBAA 2EJAA 1A53A 4XAFA 1EA9C 3U5YA 3H70A 1TVPA 1KM3A 2EPMX 2GFTA 4TXEA 4XO6A 4ECLA 1MNSA 1AZ2A 4DO7A 3DFOA 2NLYA 4KFOA 3T0AA 1XIGA 3GS6A 4LYKA 5KSWA 2ZXAA 1ONWA 3WQPA 1GQIA 4BQ3A 2DIJA 3VNMA 3G6LA 3UWYA 3VVGA 4BJHA 2GQ8A 4EF9A 2HS8A 1E1EA 3K2GA 1JCJA 1EC7A 3SUVA 4LY4A 2AMGA 3IIVA 5D2WA 4ATWA 4JAWA 2TRSA 2AGKA 4KRZA 2HSAA 2V8ZA 2Y7EA 2PDUA 1IWPA 4JQ3A 3GHUA 1KD0A 3P82A 2V38A 3KOXA 2QPXA 1LRTA 1WOBA 4JYDA 3WK0A 1FX6A 1I75A 1ADOA 1ITXA 2CZDA 3LERA 1NOFA 4GUJA 3QN3A 3GR4A 2VX4A 1VFOA 4Q8WA 3E2VA 2J7GA 2YDAA 4NXSA 3BG3A 9RUBA 4MWAA 3A9IA 2WKGA 4GACA 5IRPA 3CUGA 3GTXA 1LWHA 1KKOA 2RDXA 2HJPA 3DBNA 3BXWA 3OGVA 4CEUC 3CUXA 4ZA0A 3S5OA 2DQWA 4PE8A 1WKDA 1BD0A 2VQUA 1DHKA 4UTTC 1EO7A 3THQA 2YJQA 2VC6A 3ITOA 3GFYA 1XRVA 1OJXA 3HM7A 1UR3M 4GFIA 3P8IA 1UP2A 5AN7A 3A22A 3GFZA 3EOEA 3W6YA 3QTGA 4JDBA 4Q8MA 4GIAA 1V6WA 3I4EA 3L4TA 1PVNA 2Y7DA 4BF9A 1TPVA 2ZZ7A 2AKZA 1TPDA 2POZA 2J79A 4YYCA 4O8RA 2CZFA 2UY3A 1FUYA 3LX9A 2BV9A 1F7BA 4WD0A 4J27A 5EMKA 1P43A 4IMGA 2ZA1A 3LA4A 1M7OA 3WQDA 4G9PA 2YL9A 4QGCA 2E28A 4U3AA 4Q4SA 3DG3A 3O0KA 4DM2A 1O66A 4JFUA 3ITVA 1A5UA 3BG9A 2RJHA 1MMFA 1TQXA 2AL2A 4DAFA 1W3IA 2Z27A 4QJ3B 1GUVA 1ZP4A 4GGHA 3SY8A 4FB7A 2TYSA 4H9XA 2V3DA 3CIVA 2R6OA 3LZ3A 4OE7A 4L7ZA 5CGTA 5FIPA 1UD6A 3T1GA 4J3UA 2VKZG 1CBGA 1OF8A 4MJ2A 9XIAA 2QXWA 4J2MA 3MWCA 4Y8EA 4MHBA 3PULA 1GG0A 2Z29A 4AF0A 4NAEA 3TJLA 1KRMA 2WWCA 3MBDA 4MDPA 4Y9MA 3RRAA 3MMUA 2B4GA 1J96A 3VI2A 5I3FA 2G3FA 3AZTA 3MV01 2JK2A 5A6BA 3PZTA 1SZNA 1WQ5A 2V68A 1JGMA 1Q6CA 1OFOA 4KIEA 3W70A 4MUZA 1WDRA 2YFNA 3U7BA 3PWIA 3I3DA 1M3UA 3K5XA 2E68A 3RYSA 4L4LA 3SCQA 5TIMA 5RUBA 1Z7AA 1S2TA 5G2HA 4QG9A 1AQFA 4S3JA 5BU9A 1J4EA 2WZMA 4C6NA 2D0FA 3CLMA 2HE5A 3CPGA 1E9IA 7REQA 3DFSA 4QIUA 3LGEA 1R2SA 1JCLA 3ABXA 1PYFA 4C6IA 2JBMA 5BOEA 3H2MA 4YWSA 3RJYA 2V2HA 4ADTA 2E9BA 1DPMA 3BSGA 5IBXC 5C5YA 1JCXA 3KCOA 4NAFA 1F6PA 3CZEA 3CUIA 3A4WA 3RHGA 1SZGA 4YHGA 4RE3A 2D2GA 4C1KA 3WLIA 3S1UA 5EL1A 1OADA 2YOCA 1MW0A 3B0PA 3MT1A 1W3TA 2A1YA 4ROPA 3UY8A 3GG8A 5LIWX 4G7EB 3RLUA 4PEEA 2HNEA 4NJJA 3W01A 3LGGA 1S46A 1O94A 4JX4A 2DT3A 4D8ZA 2C91A 1QOQA 3GNOA 2J8FA 2Q3OA 3WQOA 3S6DA 5AHNA 3EX2A 1WYIA 1W9UA 4BZYA 1U22A 3LHYA 1ZGDA 4HTYA 3FAWA 1DP0A 4NI8A 1X1OA 3BZGA 3TFCA 3UA4A 3WLSA 4B5NA 1JYNA 4JX6A 2X09A 3XISA 4WRHA 1TVLA 3C3UA 2NSOA 1TTQA 2QCCA 5DXYA 1IEWA 3KX6A 3H54A 4TU1A 1W1YA 5CZSA 2NV9A 4EXQA 5F4XA 3KLLA 3P74A 3BLDA 4F4RA 5DFAA 3ZM8A 3II1A 4DF2A 4FNRA 4XBSA 5ABFA 1UHVA 2VOTA 1C93A 2VNCA 5D9PA 2Z1VA 1F07A 3SUUA 1WDSA 3KWXA 3MC5A 3A5FA 3NCOA 1PAMA 2PLJA 4W5UA 1UG6A 4UBPC 2NXIA 4AY8A 4P7OA 4PMZA 1ZJAA 3O05A 4ZQMA 4JTHA 3GIYA 3LTSA 3I4KA 1BYBA 3DFHA 5DN1A 1RBOB 4ACZB 4QCEA 3H12A 3W1NA 4AWTA 3BV7A 3L5AA 4F2BA 1BHGA 5D32A 3N6QA 4IQDA 5AYZA 1NJJA 4MWAB 2PDQA 4PTNA 4DI8A 1XLKA 1P4CA 5FOOA 1E6SM 2PWFA 3T4CA 3UW6A 4PC8A 4IPPA 1J2WA 4Y96A 3SCWA 5XIMA 1S5WA 2ZDRA 3L0KA 4QSHA 2E6YA 4C6DA 5CG0A 2WZEA 1TIWA 3TLLA 3N4AA 3FCPA 4K8GA 4IMEA 3DGBA 3CB8A 3R10A 2VWSA 1ODZA 4N9EA 4GVGA 2ZDSA 2Z1XA 3QV7A 3OZMA 4RK8A 1Y5WA 4NASA 4CLMA 4QE5A 3UG5A 1TR1A 2XIBA 1HJXA 3ARSA 1PZ3A 1HJWA 1QK0A 2CWNA 3NYDA 2W4XA 3STPA 1XGEA 3LCIA 1PS9A 1BWLA 4HNOA 4UOZA 3P2VA 2TSYA 1XIEA 4DJFC 3UJEA 3KL3A 4GIEA 1XI3A 1F5ZA 4DNHA 4WJEA 5EA9A 5IXEA 2JQXA 4GC4A 1L2UA 3PPHA 1LL6A 3W26A 2IKIA 2AL2B 1I1XA 1XIJA 3TNOA 3E6EA 3QHNA 1SVDA 2VC7A 5HXMA 1TV8A 2VEIA 3W1UA 1IEXA 1E4NA 1RA0A 2QDGA 3W1QA 1KTCA 2R91A 4TQTA 4ZTYA 4IMCA 1VFHA 3KHDA 2P0IA 2INEA 4Q3MA 1W54A 3OYXA 3NPWA 3W1MA 3W6MA 3W24A 1T8QA 2D0HA 4REQA 4PA8A 3A12A 2DUZA 2YL8A 5K9CA 3LLXA 3MHUA 3XIMA 1X6LA 4UCFA 2VELA 2CBJA 5C9ZA 2P88A 2XFYA 3RF9A 3CHCA 2PDLA 2RKXA 4AZ6A 5CZKA 2GUBA 2EF9A 1VFFA 3FDKA 4MPQA 4HNVA 3UZ5A 4C6PA 4O12A 2QJJA 1NY1A 1NP0A 4B5XA 1PJ9A 1S3HA 1P7TB 4JQ2A 2ZOXA 3MI2A 4J3WA 3WEOA 1B3YA 3IUIA 4DVOA 1QMLA 3M64A 5LA0A 1KXQA 3WUGA 2FH6A 2PA6A 1PWLA 4ERAA 7REQB 2GOKA 4H19A 1R7AA 1LLWA 4NYYA 2VEMA 1YBQB 1KBLA 4H83A 2A3AA 2QV5A 4J7RA 3HFYA 2PDYA 2YA0A 2HVNA 5HDRA 2BODX 2J6XA 2P53A 4C6LA 2H8ZA 3AYTA 2Y1HA 1TUFA 3GDTA 2QS8A 1CXIA 1QNVA 3CV6A 3LYEA 4KT2A 3SCVA 4H01A 4M7SA 2O9TA 1HX0A 1SQ7A 4O54A 3ZSTA 4JICA 3IJIA 3VIOA 1XINA 3KZSA 4GYPC 3P60A 5AHEA 4DUXA 3HOJA 5KZMA 1WZMA 2EJ1A 4CNOA 1XQLA 3ALFA 2XFRA 5BOOA 1JCTA 4ERGA 3W9ZA 4LRSA 2V6AA 4DYKA 1VP5A 3DERA 1MW2A 3WN6A 4HNTA 2DZAA 4MB5A 4CNUA 3WO8A 3T4WA 4JKLA 1NDWA 1I2RA 3N34A 4OBTA 4LSBA 2DW7A 3ZYZA 1JQVA 4I5XA 1TV4A 3DI1A 4RJEA 4Z1BA 3PTMA 4HYVA 1LG2A 1R3TA 6ALDA 1OIFA 5DCDA 3NSMA 1HKMA 3FJLA 3JZEA 4B3KA 5HR6A 4OKDA 2ZX8A 5C71A 2WSKA 3UJRA 4PMVA 1HKKA 5GNXA 3ARVA 1PDYA 2QDDA 4GQ0A 4XUYA 5ABFB 2FHCA 4DJDA 3N11A 4MIMA 1BGAA 1XUZA 3HZ3A 3H23A 1WUFA 3W29A 3FSUA 3EXSA 1FWIC 4OUIA 1JULA 3GZAA 4H9VA 4AD4A 3P0WA 4O53A 3DYPA 5HBFA 3OLEA 2ATSA 5E6ZA 3VOIA 1UR9A 4ICCX 1TPB1 4AZ5A 2QUUA 2WHKA 4XZNX 4IIGA 4MJ4A 1IIHA 1TJPA 1ML1A 3W82A 4GH3A 4H9TA 3M7SA 1TRIA 3PZMA 1FQ0A 1DWIM 1EB3A 3IARA 1JCMP 2ZX5A 4EPBC 2CBVA 3WLJA 2PWUA 3GO2A 1S39A 3GR8A 4M6UA 3OTRA 1FHDA 4XZIA 5DX7A 4I8DA 4QBXA 1UCWA 3BSHA 2V0TA 1KGXA 5AHFA 1T5AA 1E3ZA 2HTMA 1VENA 3DU0A 1R46A 3IJLA 3UQNA 3VIKA 4PMDA 4GXWA 2FPTA 5AKQA 3MTWA 2WC3A 1WZKA 1A0DA 3F4NA 4JHZA 4IZGA 4QLJA 3TKFA 1LROA 1W2VA 3O3RA 1OK6A 1JF5A 3UG3A 5C9RA 3C2YA 2DY3A 4MLRA 4Z2JA 3VDBA 2SFPA 1I6NA 4P7LA 4PUDA 3OPSA 1EWDA 4WJXA 1FKWA 1TWIA 5LXXA 4M5PA 1VJZA 3FFSA 3MUIA 4MWAE 1RK6A 1U33A 2OKTA 2HDJA 4FS9A 4OFCA 1X6UA 3N17A 5EYWA 4HNCA 1TWZA 3M46A 1E43A 3TSDA 3LU2A 2F61A 2R82A 4RZ4A 3WH5A 1NQ6A 3BAKA 2OO0A 3QSRA 3WD0A 1YMYA 5J8LA 3ARZA 4Q8VA 3MHGA 4Q6XA 4RXGA 4BK9A 4PTDA 3AMGA 2ZZ6A 5XINA 1Q3NA 4WEVX 2ZRWA 1WDQA 3WMLA 4C60A 1VBUA 3ABZA 5AVHA 3B0YA 4PTMA 3LCGA 4NVTA 4R85A 1IEQA 1RZMA 3CEUA 4HU4A 1KFLA 1M03A 2VUNA 3QY7A 1ITQA 1J93A 4R9XA 4P7NA 4ZOBA 4FR6A 1NELA 1U1JA 2QKFA 1ZALA 3SN1A 1OK4A 4KGLA 3S2JA 1PHQA 2YKKA 3RX3A 4XAGA 1KXTA 4R3UA 4FZIA 2B7NA 4QSFA 4P8VA 1OWQA 2O4QA 4EOUA 1BVWA 2WWDA 1MO0A 2CHNA 1QVBA 1M7XA 3W7DA 2DVUA 3LSBA 1IQ8A 4E2OA 3R8RA 1QI4A 1QPRA 4PBGA 3DI0A 4YNGA 5I0DA 3CQIA 4IPNB 2B81A 4OUEA 2GZXA 5JQ9A 3L4XA 5CPOA 3T2OA 1H1ZA 4KWUA 4GUHA 3PF3A 1KGWA 4W86A 4ERIA 2OR2A 2C16A 4DF0A 4CUCA 2V5LA 2E0PA 5I3GA 3SCPA 1ZBKA 2ATMA 2YW3A 3BCFA 3TN4A 1VFSA 4UTWC 4LV4A 2YX0A 4Q8PA 4KQNA 3H2OA 3CQKA 3CUFA 3MJMA 2OVLA 2FZ9A 1TZ9A 5E70A 1FHUA 2JE8A 4B3LA 1XIIA 1EP2A 2C0HA 3NFUA 3CH0A 2AL1A 4M24A 3RNDA 2XG9A 3W6LA 4MOZA 2QEZA 1SFLA 3ZO9A 2DUAA 3RM9A 5L9FA 5CZ0A 2PTXA 2R1PA 4GQGA 2EPOA 2BNJA 4AH7A 5DRIA 3WMCA 3BLLA 2OCZA 1XH2A 3PJXA 2Y63A 5GJMA 1H0GA 1IGWA 3H2AA 4BWLC 4ZOAA 1TA3A 1W1A1 2X05A 2DZUA 2J47A 3KS6A 2OYMA 1DTUA 1W17A 4NJGA 3PWGA 3F4DA 3PJTA 5KETA 1ISYA 3ZFHA 5K2ZA 5CBBA 3M6YA 4GABA 1GKRA 4N42A 3G8EA 3BCJA 1B3VA 1TRDA 5ECUA 3UBPC 3LBMA 3HG5A 3F4CA 1P1MA 4CU6A 5DXXA 4FP1A 4AAJA 5CCZA 1KV8A 4H2CA 4DZ5A 4RNHA 3PAOA 2R1KA 4A05A 4HVXA 3G1FA 3WF3A 2OMAA 3E5BA 3W7LA 1R3QA 1YE4A 5D2XA 2DUXA 1ZFJA 5D9MA 1GGOA 3C2EA 1LORA 4M3PA 5FF2A 1DHPA 1W3HA 2J74A 3CMJA 3HPZA 1GK8A 1Q63A 4GY7A 5AC4A 2BXYA 4L56A 4PGLA 3UETA 4NJHA 3WY1A 2PDGA 5CSYA 1LUCA 3RM8A 3AHVA 1UP0A 2G97A 3M07A 2BWGA 3H7VA 4ZOCA 1CB2A 3PAJA 4MAZA 4DUOA 1IHIA 4RPPA 4AHOA 1XIDA 5M03A 5I3DA 3APTA 3WK1A 1HL8A 2QGHA 1UROA 1X38A 4C65A 1UR1A 3PNZA 1I4NA 3PB0A 3AIUA 3VO0A 1KRCC 5A6MA 3B8WA 2VDGA 3WQGA 5HWMA 1K8YA 4Z1CA 2INZA 5GJNA 3IUHA 1I45A 4V2XA 2WZIA 4JIPA 4GGBA 4O16A 2YZ5A 3M0IA 4FF5A 2ZYFA 3WD3A 4YTSA 3RU6A 1XRTA 2H8XA 4Q8NA 1U30A 3G1YA 5DT7A 1KO0A 3CO8A 3UVIA 5LNVA 4J3XA 2A85A 2Z4GA 3W23A 4GYJA 3IIOA 5LGZA 3W37A 3G1DA 4JTIA 1R85A 3H2FA 1TB3A 1IR2A 5DMNA 3O63A 3DXIA 1WXYA 2YA1A 4CCEA 4Q32A 3JVAA 3B8SA 3I68A 4XD3A 4ZQPA 4GI8A 1J9YA 4U28A 4O0ZA 2FPVA 3U57A 1K9TA 1C8VA 3NQ7A 3BGJA 5DANA 1H63A 4O10A 1K7XA 3DDMA 4XB3A 1QI5A 3QRHA 1EIXA 2BOFX 3T8LA 5JIPA 3IEBA 1PXGA 2NUYA 1NEYA 1HW6A 4KFNA 4DJFD 4W87A 3S47A 4NL1A 4Q8QA 2BY3A 3GNPA 4RE4A 3Q4DA 3M44A 4E8CA 1V0LA 3U3HA 3ZR6A 3SSJA 4GA8A 3LTYA 3OEXA 4EXAA 1EPVA 3DG6A 4OV9A 3WZ0E 5A8MA 2PTYA 1QUMA 2W92A 1S1RA 4BCEA 1XLEA 4Q4PA 5IFPA 1K1DA 4CU8A 3BL3A 1JAKA 1GVFA 2OYKA 2WZTA 5A6TC 3QY8A 3UG4A 4W85A 1TG7A 3TZFA 5PTDA 4AX6A 2VRJA 4NSBA 3GNDA 4H2HA 5LKYA 1KCXA 2JKAA 3KLKA 2GVJA 1GKPA 2EHHA 2YYTA 3M5ZA 3B0UX 4MWAD 3TA6A 3QZEA 1AJ0A 4LW7A 3YPIA 3CB3A 1K8CA 1IEIA 4D71A 2J66A 2PTDA 1LG1A 4HMNA 3TMQA 3PZIA 3B9EA 1OHLA 3H7UA 1PX4A 2DSZA 1JCNA 3SGZA 3PBGA 3W00A 2ANUA 5CJMA 1SJDA 3E96A 2ONEA 3E9AA 3UCQA 1WZAA 5K4ZA 4GJJA 2I16A 1O1HA 2W6RA 3AU6A 1YTDA 1CENA 3LHWA 1HXJA 3V0UA 1KGUA 4CNPA 1V3KA 4CNTA 1AK5A 3OP2A 1ZTVA 4AZBA 3WDJA 1DIOA 1ALDA 1IT8A 3MUAA 3CZLA 2NWSA 1PX3A 4FPSA 5FEWA 3FGCB 3MSDA 2O56A 5CGMA 4W8LA 1TMQA 4KGJA 1KC7A 1F3WA 5E0CA 1BYDA 3RGTA 3CIXA 1TA3B 3M0VA 1VBJA 5AVNA 3CHVA 4LUSA 5DY2A 1Y0EA 3U4FA 3WLLA 1J0ZA 3VCNA 5CAKA 1FP8A 5C0QA 1R6WA 1E5JA 3GXNA 2UBPC 1GPFA 4WSHA 1UR0A 3G0SA 3C8NA 3OVPA 3WMSA 3NVDA 2PWHA 5I79A 4EAMA 1WP6A 1H7NA 4WXZA 1R2RA 3RLHA 4XIAA 4AIEA 4LGXA 2ZA2A 5DCBA 5CQ1A 3G77A 2BY0A 2ZUSA 1XXXA 4URIA 3P7YA 4XKYA 2BLEA 3AJXA 3GW3A 5G4HC 3KBNA 1M7PA 5I09A 3KL0A 3CO4A 3TTOA 4JFTA 4IQJA 3KBWA 2GVEA 2QIWA 1NOUA 1HFBA 3GHSA 3AIQA 1ZP3A 1E1CA 2Z00A 4L4MA 3QEZA 3DH7A 4UTIA 3BSMA 3WUBA 3L12A 2FIQA 3T05A 2AKMA 1LUCB 4DB7A 3UZJA 1CGUA 3ONCA 1W1PA 1XFCA 2GQAA 4A8RA 4JTCA 5ABEA 1YQ2A 1L6SA 1UA3A 3LPFA 3R94A 4R27A 4ZVJA 4K7YA 4X0NA 1BAGA 3LB0A 2PGWA 4PBEA 1NSJA 1MSSA 2DJXA 4ZL1A 4HCHA 3E74A 3SAZA 1WV2A 2X0YA 3EDFA 2ZZ3A 2XIOA 1UWTA 2DT1A 4QJ1A 4UR9A 4Z0JA 2OLSA 1D2KA 1OFPA 4B4HA 4R88A 3E12A 1XSJA 2G3MA 1NU5A 4ZXOA 1M6JA 5AC8A 4O0QA 1U1UA 3VK5A 2OLHA 2PRHA 2WW5A 1NF7A 1C7SA 3TYBA 5FKYA 4DM1A 4IJBA 1VFMA 3TONA 2FTWA 4PB4A 4QCFA 3PSWA 1MYRA 1H7RA 3E38A 2PDJA 4UTKA 1FWFC 4PMYA 5EMMA 1V6VA 2I7GA 2OZTA 3OGRA 3GXMA 1N2VA 2GQ9A 6CGTA 4PFHA 5IOBA 2P8CA 5BXPA 2CETA 1P6WA 3ZJ8A 3GX9A 3TYDA 6REQB 1VYPX 3H26A 1R7OA 2GOUA 1OZMA 1SJCA 3NSXA 3C86A 4W5ZA 3RCYA 1RBAA 3BAWA 1H60A 3NTYA 4H6RA 3WBAA 5BZAA 5ENLA 3TU9A 4U10A 4UFHA 4O1DA 5CAHA 1K7EA 2NSXA 1VLIA 4PN2A 2PDNA 3VD4A 2ACQA 5A95A 1ITUA 5DMLA 4QTGA 4IIFA 4JKKA 1V0KA 2OOGA 2P50A 5IDIA 4ZQCA 2JEPA 4FMVA 4OBRA 2HWGA 3CAQA 1V08A 5EGRA 3VGBA 2FB2A 1ZUAX 4BFAA 2VZVA 3RMEA 3JS3A 1X98A 2GSJA 1GJWA 5FJOA 2PCQA 3GVVA 5DO8A 3LG3A 4GIYA 2YYUA 4KCVA 5FSDC 3KBJA 1BYAA 4CU7A 1ZSXA 4BQ5A 3M5XA 3UXAA 3CZJA 4G1NA 1VYSX 4GI9A 4QFUA 3FNDA 3SCNA 1VFTA 4G6CA 3GHRA 1JXKA 3OBKA 4B5TA 1BF2A 4GZ7A 4UTJA 4NX0A 4LC6A 5LNUA 1D3CA 2G41A 2CEQA 5EMJA 2I5GA 3LI1A 5E5CA 3LV6A 1O5KA 5I23A 5K9XA 4OWGA 3AMKA 5TF0A 1B0IA 4F79A 1MZHA 1EFZA 2CZVA 5HUOA 4HHLA 2BY1A 4RNFA 1JZ5A 2IXUA 4HSHA 3FKRA 3AHYA 4M8UA 4Y90A 4RXFA 3EX4A 2OJPA 2EPNA 2IQ0A 2X2GA 1AW1A 3N19B 3JR2A 4MTVA 4YPJA 4Q4OA 1VHNA 2QF8A 3ABQA 4A8LA 3L4YA 2C18A 3I7QA 2I5QA 3WUFA 4ML9A 3GTHA 4Y9OA 1DXEA 1GTHA 1KV5A 4GQBA 1E9ZB 1AMKA 3W2JA 1R3VA 2JIEA 1FDZA 4AMAA 4C6EA 1D9EA 5H8MA 3GRIA 3KUMA 5EPDA 5LIXX 4UNIA 3CUHA 2OT0A 5BXTA 1L9WA 5C2CA 1H7WA 3KS5A 3IANA 1U83A 1B1YA 3HJZA 1P1XA 2GUUA 3CV7A 1W3JA 3ITGA 3WENA 5IHSA 4US5D 1FWWA 4QEHA 4JEQA 3MP4A 3HF3A 4KWVA 2PDMA 3MKVA 5AY7A 1GNXA 4LYRA 2A3CA 3AUJA 4KBXA 1S38A 3MUCA 4HZMA 1VBGA 5CSUA 3MJYA 3CYJA 4PMRA 5L6UA 4AD3A 4GHRA 3G8RA 4L1WA 2HPIA 5CH9A 4ZTXA 3AIWA 4LS1A 1IT7A 4Z2KA 2ZE3A 5CJNA 2NV2A 1UZ4A 4GO9A 3P93A 4A3RA 4HPJA 2OZ0A 4LWWA 3CK5A 4JIRA 3VIJA 3SFKA 1RD5A 5DBTA 1OFEA 3SFWA 5FEXA 4E6MA 4Y6GA 1AVAA 3GHTA 2CLFA 2XSXA 1Q85A 3GNXA 2W61A 5K3VA 3UPBA 2ZC8A 3BLKA 1GORA 2PI6A 1AD4A 4DO5A 1E1CB 2NX1A 3B0XA 1O12A 3MVIA 4WZHA 3SCSA 2OSYA 3A4JA 3IJDA 4LOCA 1UD2A 4HJWA 2W3ZA 4BI5A 3LY0A 1RLDA 3QC0A 5D30A 3ZS4A 3D47A 1CYGA 1JG9A 5D2TA 5A5WA 1DE5A 3HTWA 2G4JA 3NZGA 4OVXA 1AD1A 4AD0A 2WHLA 1KR1A 4CD4A 3TOYA 3A47A 5I5RA 1FP9A 1FHVA 2AGTA 5GJPA 1DJGA 2FTYA 3LI0A 2WBGA 3CQJA 2F84A 3WQWA 4DLFA 1VHCA 3GDLA 2VFHA 4AMCA 1EKOA 3VZZA 4NZCA 3T6CA 2ZE0A 1WBHA 4PTWA 4EWND 1QJWA 3I7SA 1FCQA 2WSYA 3WD4A 2WYSA 6ENLA 2QMKA 3OG2A 2DW6A 1FWRA 5JBFA 2GYIA 3CJPA 2F8QA 4F66A 1NDVA 5I3KA 3DC0A 5E9XA 4HPXA 3TQVA 3TOPA 4M0XA 3STEA 1KRAC 3TCSA 2VGBA 3VGHA 4ZOEA 2F2HA 1R3YA 3WJXA 1M65A 3I7RA 4WHBA 1GOOA 2PGRA 2PDBA 2QNEA 1XSKA 2O0TA 3NL2A 4K8EA 4YIWA 3JW7A 3BAIA 2NT1A 4QNEA 1JCYA 5FD0A 3B04A 1ZCCA 4AU0A 1KM6A 3MU7A 3OBAA 3UWUA 3VKBA 3P5YA 4LAMA 3USZA 5CEWA 3C6CA 2D1ZA 1XUUA 4WGXA 4ZODA 4Q7IA 4CGTA 3NGFA 2FGZA 3GNNA 1UWQA 4WIWA 2EQDA 3WNMA 1UC4A 5CC6A 3SM0A 3NEVA 4IMAA 1XW8A 3VIPA 2GSEA 2GJNA 3G6MA 1C9DA 5F2MA 2XGIA 4DJDD 3L65A 1LOLA 1BRLA 1MUWA 4Z17A 1O60A 4E2VA 1W3KA 2CHOA 1HL2A 2GGEA 2D2HA 3CT2A 2YXOA 2Y8VA 5I00A 3IGSA 3RU8X 3QQWA 3NQFA 3QR3A 1HKVA 2J7HA 4YTUA 1FDYA 2NQLA 1QTWA 1XLHA 4KWOA 3EDKA 2HXTA 3C0JA 4S1FA 3GB6A 1VBHA 2RAGA 4GK8A 4O17A 4W88A 1VEOA 1B2YA 1SPQA 1EJRC 4I90A 1CXHA 3EZ4A 3EYPA 1NFGA 1H2JA 5DMMA 3LPPA 4LUTB 7TIMA 4OTKA 4O14A 4QXIA 2VGFA 1SJBA 4DELA 3NQEA 1B9ZA 5FF0A 1W3NA 2DFAA 1K8ZA 2IKGA 4IGHA 2G0WA 3C3NA 4IFOA 3N12A 2HMCA 5G1YA 5U4NA 1AL8A 3TC3A 1W6TA 1YE6A 2PP0A 4C6BA 6XIAA 3CAVA 1VFUA 2C3ZA 1JPIA 3BICA 4LJ3A 2OEMA 2VD9A 3DFNA 3W3OA 3MI6A 3QPYA 3WLNA 1E4IA 2I9EA 1KM2A 3G0UA 2WSQA 2VFEA 2C8NA 4DJEC 1XIFA 2JIWA 3CQ0A 3RN6A 1X7IA 1UBPC 2CXGA 2WLYA 3HMCA 3WF0A 4A3HA 3BOXA 1TELA 3C61A 1AZ1A 3OIXA 4N0RA 2X40A 4N02A 3T8QA 1FWDC 2P76A 3IAQA 3F7JA 4QQUA 6A3HA 3UERA 5HPOA 3CEPA 2R8WA 1QNSA 3GXPA 2PDFA 3PG8A 2MUCA 3VGFA 3NIYA 1JRBA 3AI0A 3VC5A 3I65A 2PC4A 2OGYA 1Q7ZA 3VABA 1IXNA 1OB0A 2Z2UA 3OYZA 2WQDA 3L5LA 1AH3A 1CWYA 4YU1A 1CLKA 1OM0A 2YDQA 3EOLA 4LB3A 5TBOA 3NM1A 3PB2A 3NUKA 3D3AA 3GC4A 4RL3A 1UKOA 2PTWA 1XGZA 1FWGC 1XG3A 1JDEA 3D46A 1PKMA 1T8XA 2ZX7A 2ZKMX 1EQCA 3UXKA 5CPMA 1XSIA 2Q6ZA 3VOGA 1J12A 4M56A 4LFYA 1QAPA 1YDYA 4E8GA 3GXFA 5I6SA 3HG2A 4LUIA 1B5TA 2BVTA 3R0DA 3SQLA 2V2DA 1Q6OA 3LNMA 4RX0A 2E5DA 4X9SA 1D8WA 2VXNA 1KCKA 3AWNA 4MKNA 1DWFM 3GXTA 2OT1A 2G8ZA 4NRSA 4L4PA 1T6MA 3BMWA 2IPGA 2ZICA 3ZLFA 5TAOA 3BURA 5D37A 1M7JA 1DJIA 3URBA 2WJEA 5JUVA 3ZT7A 3KZPA 1TX2A 4ZGYA 3V35A 1LF1A 3L2LA 1IYXA 3W7JA 3MB9A 1PSCA 2FHFA 4LANA 3N4FA 1TV5A 1XKYA 4HZ8A 3GUWA 1ICSA 1YADA 4YCPA 2X7VA 3KW3A 3AISA 4NRRA 2JGQA 1V3LA 4PMOA 4MYXA 3V5CA 3PBWA 4XK2A 3TDFA 3L4WA 5J5DA 2IPWA 4KCTA 2CIPA 1US0A 1K8XA 1KBBA 2IQTA 3FN9A 2MANA 4I7UA 3UZZA 2A6LA 1ZPTA 1E0XA 1XLMA 3OLGA 4A2SA 3KBMA 3ZLGA 2ZVRA 1GVRA 4PRRA 3H22A 1O68A 2VX6A 4LH8A 2XYLA 2VC9A 3KOZA 3F2CA 1JGIA 4NQ1A 3CV2A 4JTKA 2XGZA 1OG0A 4A8NA 3ECQA 2FZMA 4K68A 1JYWA 5BU6A 1OINA 2DVXA 3MSRA 2WMKA 4RZBA 5FEZA 3MUY1 2W79A 4FNTA 2VWTA 3NZQA 2GGHA 3M0ZA 1GYLA 3N2CA 3S2NA 4PBFA 8XIMA 3SADA 4C6MA 3FA4A 3WJWA 4W7WA 4PCTA 4YL2A 5M3WA 4C7FA 3O6DA 3VX0A 4WY0F 1OD8A 3VKKA 3PZNA 1KTBA 4CQAA 1ISWA 1X6NA 4HN4A 4X9YA 7TAAA 4JY9A 3GR7A 3CMFA 2XTKA 1RVGA 1PO9A 2NQ9A 1SSDA 4LBSA 5E0FA 2C15A 3DESA 3WBYA 3F4WA 3OU8A 3O9NA 3S5YA 2Y5SA 4RE2A 4LB4A 1RPXA 3HA1A 5I06A 3WNOA 4U2ZA 4O57A 4GYFA 3C2FA 4UIOA 4B90A 3GH5A 3O6AA 2C13A 1LOQA 1QCWA 1SZFA 3BJSA 4IJRA 2NX9A 1J10A 1BPLB 2V69A 1MWOA 1P48A 5SWUA 4GH1A 4WY0B 3I3BA 3GDMA 3C4UA 4JIHA 1A50A 2PS2A 4RUBA 5BRPA 1CXLA 1GPWA 1OFRA 3H2NA 1VIWA 4JNMA 4PRTA 4K2SA 3DYMA 2YFOA 4R33A 1VJIA 4H3DA 1ZLPA 4MG4A 1SSGA 1LBMA 1RJRA 2H3DA 2GDQA 5BXSA 3VMNA 1X1ZA 1MNZA 2D23A 3IS4A 5MF5A 3L9CA 1Z48A 3CWNA 1KFJA 3CL8A 4K8HA 1EX1A 5LGXA 4LNYA 2WKLA 1B3OA 2Y4SA 3B9OA 1UWAA 4AD2A 4XIMA 4K36A 1NDZA 1P0KA 2UY5A 4J3SA 5EFFA 3F5JA 4KEVA 1ESWA 3OZYA 3CL7A 3K4DA 4I9AA 1BVZA 1XP3A 2X30A 1ADSA 2VT0A 4HP5A 1XDJA 3RITA 4FLSA 3AS2A 4JIEA 3IJ9A 2Q71A 3NDYA 2FVLA 1C29A 4I9TA 4ORIA 4LF1A 3L68A 3TLQA 3GYEA 1XYAA 3JZUA 2I14A 1YNQA 2V5DA 1OFBA 1GHSA 1TQJA 5BW6A 1DYSA 1KXVA 1KFCA 4J5NA 4PYSA 2YBUA 4GE8A 1ZZMA 2GGGA 3LXAA 4PUJA 3SURA 1TR9A 2RDUA 2I56A 2FMNA 3S9YA 5KMYA 1PCKA 5AC6A 1UKSA 1HL9A 3WBXA 1XYMA 2OWCA 3KDNA 2EKGA 3W7EA 4FOJA 4KRTA 2ISFA 1JF6A 5LHEA 3ZR4A 4M6PA 4HYWA 4GD0A 3RR1A 2AQVA 2Q8ZA 3EB3A 3KVMA 3PG9A 3PZGA 3EX3A 1F3TA 3CC1A 3W7RA 4ZFCA 1V6UA 3TR9A 3S6TA 1PIIA 2B31A 5FJUA 1MXDA 3B05A 4Z2HA 1JPDX 1H7PA 3GBEA 1AH4A 4FXFA 3C0LA 1GJPA 2PDHA 3GG1A 5I07A 1UWRA 4Q8TA 1DVJA 2OU4A 4JHMA 4M81A 3HGOA 1RV8A 3Q2DA 3WSUA 2P0OA 3SY1A 4BY3A 1XYCA 2XH7A 1V02A 2Z1BA 4PSRA 1S3TC 2I5IA 2JF7A 3E2RA 5A2BA 3T42A 5HJYA 3W86A 1R5YA 1A4LA 3AMLA 3WJYA 1KCLA 2YL5A 3UZYA 3EMZA 1X39A 3LN3A 4PUEA 2KZHA 1ITCA 1BQCA 4S2CA 4NYUA 1YXDA 1KM5A 3U2OA 2PB1A 3AXMA 5J04A 4YHEA 1PWMA 3N9SA 1R38A 1NWUA 3QHOA 3NDZA 2O9RA 3QR1A 4UB9A 1TFVA 2WO5A 4ZQNA 5F4SA 3HQPA 3KHJA 3ABRA 2UWFA 1GEQA 2VOMA 3VM5A 4H00A 4F0SA 3UWQA 1PBGA 4NT0A 2OQHA 4EIVA 3NAVA 2CW6A 2WMIA 4IT1A 1A3XA 1KFWA 3VNYA 1G6CA 4NJIA 3AIBA 2QHAA 1AFSA 4L9XA 3WELA 2PBGA 1B4KA 1EGVA 4XSLA 3G2GA 3L23A 5DBUA 5D2VA 1IXOA 3P0XA 3W2NA 2A0NA 1EF2A 4NY2A 3UPMA 3IVTA 1QI0A 1B90A 1BTCA 3DAQA 2PRMA 4INFA 1HKWA 3HPXA 3FIGA 1YDNA 2DV0A 4U31A 3FK4A 5T8GA 2OOFA 1Q6QA 2C1GA 5A6KA 3NR0A 3CM4A 1AG1O 3SRKA 2ZADA 4YVXA 1ZBVA 1GOKA 3JUGA 1HIZA 3W1LA 4TIMA 1D3GA 2CLIA 4HA3A 4HOZA 1DJYA 3AJ7A 1W56A 4MKVA 2PSNA 3AYRA 3M0MA 3NM3A 4NZ3A 3E02A 3L5MA 2CESA 3TXZA 1GYMA 4JCLA 2VJXA 2JGYA 3W84A 4B5SA 4RLIA 3T0TA 5C2XA 2ZVIA 3KRZA 1ZHAA 3A4AA 2R94A 3EMQA 3W27A 4M82A 1BSLA 1RSCA 1H5VA 3EWBX 4QG6A 4ONVA 2PLMA 1B3WA 4X63A 1QPQA 2CPUA 4RDWA 3VKJA 3THAA 1DJNA 2V5BA 4FX8A 3ARXA 1J11A 2P10A 3MW7A 3UFYA 3EOOA 3TIMA 4EK7A 4N7QA 3KL5A 3RX2A 3NZRA 5IHRA 1KKRA 1QW7A 5REQB 3W1XA 3AMDA 5AYXA 3WBWA 2VDHA 1FH8A 1BTMA 1EHNA 3M0XA 3NQAA 1ELSA 4DPPA 3W76A 5HA7A 4RNJA 4RKAA 4LUYA 3ZR5A 4GWEA 1GOIA 1W31A 2GLKA 4I3GA 3T08A 4Q8OA 1TTJA 1S2WA 4RR4A 4H8HA 2BGQA 1FVPA 3N73A 2ABAA 3ANUA 1H4PA 3TC6A 4ZO6A 3B9AA 1N55A 2GJXB 3UD6A 4AEEA 3ZWTA 3GU1A 3NQCA 3M41A 4U4MA 4AZIA 1RUSA 3S5NA 1AJ2A 3RPTA 4MUPA 4WVXA 1L6FA 3ZIZA 1XCWA 2FTPA 4UUIA 4XTDA 2NZLA 2R24A 4O1EA 3L21A 4U2YA 4JFWA 4X2PA 3N2OA 3EWDA 4DJED 5FL0A 4JXCA 5JH1A 2E7FA 2FGBA 1KCZA 3MS8A 1S1PA 1XLLA 3G1XA 3EA1A 1GQLA 4PUUA 4H8UA 3TTSA 1B3ZA 4E4UA 1DBTA 3DIPA 3LHUA 1FOBA 2CLLA 2ZC1A 2J7CA 4E4FA 5EFDA 4S3BA 4HHMA 2QCEA 4I6VA 2QJIA 3FOKA 3TE9A 1F74A 2ACUA 2DZPA 3PBMA 3GW0A 3W85A 3QSTA 1FWJC 2Y62A 5DY3A 3MDUA 3A3XA 2ZUUA 4IP7A 4FEZA 3W1RA 2OQLA 3LHVA 2BX7A 4Y8FA 5JU6A 1K9FA 3EDEA 4OQVA 2B0MA 3LS9A 3MHFA 3W7MA 1CZ1A 4O19A 2GDUA 4CNNA 4CN6A 2BOGX 3M0LA 2EO7A 5HAOA 2Y85A 2J9YA 3S2CA 1UZ1A 3OHIA 1KTNA 4F0HA 1R9ZA 4UFLA 2B7OA 2E09A 3U5UA 1CXEA 3CUJA 4A22A 4XAPA 1LBFA 4GNJA 5BNKA 1ECEA 3LBOA 3AFBA 5HMDA 4EP8C 1QOXA 2PWVA 3ZXWA 5D4YA 1AUSL 3UY7A 1Z32X 1JEZA 1E6XM 3DGRA 3CWHA 2AAMA 4W9TA 2YBVA 5DEZA 3WQCA 2H90A 3ARWA 3TA9A 1O4UA 3E3HA 1U5HA 1XLIA 4WKHA 4WXYA 4XD5A 3QMTA 4IH3A 1Q8AA 3FKKA 4LAKA 1N8WA 4HNLA 3ZWSA 4W8BA 4N6FA 5CPLA 3W83A 4QQ3A 2R14A 2VL4A 3HGJA 3W87A 1JDFA 2I57A 1Q2RA 4JGDA 1Q2SA 1TJ0A 1OT1A 4HMDA 3HO8A 4U5IA 4GKTA 1PZ1A 1VIZA 3C0QA 4J3VA 3CS2A 5FAJA 5G2IA 3TV8A 3URQA 1JFXA 3LCHA 1UH3A 3O1NA 1P0DA 5BRBA 3P8JA 5T26A 3BDKA 5I03A 3UXLA 1V5XA 3W7GA 2FZ8A 3ZJKA 1BFNA 3MUXA 1UKTA 1O6IA 4UR8A 1VD6A 2YBTA 3S1GA 2Y6ZA 2WVTA 4UTMA 1YPIA 3IUDA 2G50A 3G1SA 4OU1A 1V77A 3OGSA 4EANA 1WDPA 4TV5A 2CERA 3DHFA 1TYGA 4QM1A 4KKXA 1Q45A 1V3HA 3VMOA 1RALA 3OVQA 2J9ZA 4RDVA 3B97A 4UZUA 2Z6JA 3M1ZA 3UYCA 2IPJA 3L4ZA 1WOAA 3B4UA 2FGLA 4LYQA 2DT0A 3OHMB 2QCMA 2Q3RA 4F8XA 5HMEA 4NXKA 3QW4B 1VC4A 3SI9A 5DCEA 1F3EA 2QJNA 1EZ2A 1QDSA 1NWTA 3PR2A 3GNRA 4WDXA 1RA5A 2VX7A 4AZCA 5K4XA 2QYGA 3TQ0A 2ALDA 2WC4A 1P6CA 1J2BA 3LUTA 4PMXA 3GIPA 3RLVA 2J8TA 4AVFA 7A3HA 3SBFA 3VIHA 4F0RA 3DKLA 3KE0A 4JCMA 1I2NA 4IM4A 3NQVA 1DWGM 5CLWA 3RCNA 4MYAA 5A6SA 2EG6A 1JNDA 5MKGB 3ZQ9A 2P1FA 3TYZA 2XSAA 4DWSB 1XBVA 2VEGA 1A5MC 1XC4A 1KFEA 1NFBA 8A3HA 3CXOA 1XWYA 4RZ6A 3LPGA 2PFHA 5FJPA 3RM4A 1XBZA 3AS3A 2YA2A 3EB2A 3EWWA 2EG7A 4C1NB 4S3FA 3OZOA 1UUMA 3S4TA 1CGWA 1T0OA 4DNMA 1DWAM 4CCZA 5FCZA 3DHUA 3N2MA 2GK1B 4ZEPA 4XD6A 3WEZA 1XIHA 1YXYA 3AXIA 2YSWA 2XIIA 3LXBA 1F4AA 4Q7NA 1UWUA 2H9AB 3KBVA 1CXFA 2RGLA 4ZSTA 4IGMA 1EIBA 3S1VA 4O1CA 1ZCOA 4HSNA 4DPQA 1XF0A 1LBLA 3S3GA 4AZ7A 3VAVA 2IS7A 3ZVHB 1BSIA 1ZAJA 5CXPA 1RLCL 1REQA 4WKAA 1W37A 1J6OA 3G18A 2PU0A 4UFJA 3S46A 1VF8A 3AXHA 2WANA 1Q6GA 2TPSA 1JUBA 1XRFA 1R8LA 4H7CA 1GG1A 1F3XA 5TD4A 4HB7A 3MKCA 1CB7B 3QLLA 1OIMA 3OO2A 4Y9PA 4YS1A 4DI9A 1OSEA 2E6AA 1BEUA 1U5JA 1DKWA 1ZAHA 5I02A 3VNKA 1TO3A 5AYIA 1VQTA 3MMDA 4H1ZA 1V6TA 3TN3A 3U7VA 1OGSA 3OW1A 3S5ZA 2PURA 4KEZA 3LV5A 1RXOB 3MO4A 4DWSC 3VA8A 5AYBA 3O7UA 3R12A 5K7JA 1ZNNA 3HG4A 1GW9A 3EDDA 2XUCA 1FWNA 3K1DA 5E9AA 3K30A 5BCAA 4PZVA 3WK3A 3SDOA 2IW0A 1UUQA 3MUZ1 4BEQA 1FWHC 3GM8A 3TQKA 3H21A 2UZ9A 3ZT5A 1AQHA 2GGJA 3WD1A 3GAKA 3IIPA 1EEXA 1YKWA 5M2FX 4WLCA 4Z2IA 1JZ6A 3UVAA 1W5QA 4D8AA 2BY2A 2QR6A 3UT0A 3Q67A 2OSWA 1DJZA 1NF0A 3PPFA 2QW5A 2BVDA 2GJPA 3CT7A 1OCBA 2VZUA 3GTIA 3WDRA 1ZAIA 3BVJA 1CEOA 2AQWA 1VGAA 4HOXA 3AIRA 3OODA 4A6GA 1P5BA 4GVFA 1NARA 3HFTA 3U2EA 5AOUA 1FKXA 2D2OA 2Z25A 1WAUA 1XDLA 2V67A 5KZ6A 3LZ5A 1QNQA 1GCYA 1I0DA 3ZT6A 1J18A 2Y7GA 3N6JA 2EAWA 5DLCA 3KAOA 1V02E 3KTCA 4HSOA 5GVJA 1MFVA 3GLCA 1K70A 3GKAA 2KAUC 5AHLA 4HNUA 3QXBA 3WH8A 5F2LA 1TWSA 3BLOA 4S3KA 3QM3A 1UP3A 1XKJA 3W7HA 2C6QA 3IK2A 4AHPA 1ONRA 4DBSA 3W2KA 3N2XA 1UMYA 4LT9A 1IE7C 5FF7A 2BASA 3N9KA 4D6GA 1HJVA 4I9JA 3LNPA 2W27A 4EVZA 4CVUA 3WQ8A 3CASA 1XD1A 3QMRA 3UPWA 2DIEA 4FX6M 1UMLA 3K4WA 4FX7A 1MDRA 4M80A 1XJBA 1Z3NA 4ILSA 4JIQA 2WSPA 4OBSA 3TNBA 2OX1A 2Q01A 2W67A 3EWYA 3N3MA 3I10A 4XWUA 2PDCA 2DH3A 2PDPA 4F2UA 3CUZA 3WDHA 3N1AA 3S1WA 1E6NA 4F0MA 1JZ8A 1TPC1 4AWUA 1Z69A 4H7VA 4AF0B 1E5NA 4NAEB 3WQVA 1ADDA 4MWAC 5G1TA 1RBLA 4P7RA 2YXXA 3RIKA 3M0JA 5M5DA 4HZ6A 4I7WA 3LMZA 4KWSA 1TJ2A 3KRBA 4QROA 4J2PA 3PHAA 2CLHA 3W7OA 3HGSA 2PP1A 4LXFA 3KOWA 3PPGA 1CDGA 1HP5A 4JDYA 3FJ6A 3NZ1A 1XG4A 1EUNA 3RDKA 1EF3A 3PY2A 2BVYA 2XVKA 4OIFA 1VPQA 1B9BA 2YDRA 2WMFA 5BYWA 4CQCA 4OT7A 5F4WA 1OYAA 1GOXA 1PCWA 2XFFA 3AXKA 3GK0A 3ICJA 2REQA 4M6QA 3T2QA 4MPKA 4AD5A 4M1BA 3PVFA 1OF6A 3CMGA 3DOPA 1P0EA 3DHPA 1JI1A 3WNNA 5FJJA 2D73A 3T55A 3U0HA 2XWEA 5HJLA 2XM1A 3HQNA 4XZ9A 1XLDA 2ODOA 3P80A 1K03A 4NAFB 2J4GA 4BR1A 1FCUA 3WDIA 2C1HA 3WH7A 3MCOA 1I2QA 4FI4A 4J35A 4JS3A 2J7BA 2A6NA 3VFCA 1Z6KA 4AC1X 1RY8A 5BMWA 1E73M 1REQB 3WFZA 1SW3A 1GVQA 3H7RA 4LAOA 5C6MA 2JF6A 3SRFA 1A0EA 4IICA 3BMXA 2RGMA 3OVGA 3S83A 1UR8A 3VE7A 1B31A 5DMYA 1V93A 2PDXA 1TREA 4QR6A 1ZS2A 4R5EA 3U4AA 3JRKA 1FY6A 3WNKA 3T2PA 5A94A 1QRQA 3Q58A 3U2ZA 2J9XA 3PTDA 3L67A 3SRHA 4AYGA 3NJ3A 3URNA 3AMCA 1E6QM 2FHBA 3BW4A 1HJSA 1FBAA 2Y0FA 4C6JA 5A8NA 5IDZA 3VGEA 1B3XA 1V4YA 1V7AA 5BROA 1GHRA 1MUCA 4GUFA 4LUJA 2HK1A 3P62A 4DHGA 1DXIA 3V75A 4S38A 4QJ4B 3C5QA 3QGKC 1FWCC 3VUPA 3TTEA 5A8PA 5XIAA 1SR0A 3N15A 4UMBA 1KM1A 4JTGA 4CCDA 4BKNA 4H04A 4G2DA 2NW0A 1VZWA 4XV0A 4LCRA 2Z1SA 2OODA 2VR4A 5JVLA 5I3IA 2GUYA 2YPIA 3B03A 1XPYA 2QVNA 4MNLA 1EJUC 1DL3A 1WX0A 4UTTA 3HU7A 2WSRA 3N6HA 2QCLA 2X1UA 3IJ7A 2X1IA 1JZ2A 4UWMA 1Z9AA 3R7MA 4ZENA 4ZXLA 1ISVA 3EXTA 2W62A 1TE6A 3PUGA 3O15A 2ASHA 3CPRA 4IFRA 2X41A 4MKSA 4IL0A 1L6WA 2GWGA 2G4FA 2HS6A 4GQRA 4M6VA 2FVKA 1WXJA 4HTBA 2CU0A 3AROA 1A5OC 1F76A 1C90A 3GC5A 2ZWZA 1F61A 3FJNA 1KBKA 1WKEA 3R11A 4F2TA 1JJKA 2Y7FA 1XYBA 2IKHA 1VPXA 3SY5A 3LD5A 4IP5A 4K7VA 4B4FA 2OPJA 4K6AA 4JIIX 4X61A 3O2LA 2V3FA 3RMJA 6PTDA 3UWZA 3GTFA 3G1VA 3B8TA 3W02A 3WLRA 2E4TA 2IMRA 1QXLA 4LYPA 1Z8AA 1JR1A 2ZBTA 4I7VA 4YVVA 3CYVA 3WFLA 2O7QA 2BZNA 1EP3A 4PUNA 1G4PA 4JN6A 4N2YA 3VXGA 2B7QA 2FKPA 1AH0A 5B7ZA 3QVQA 1IZKA 1R87A 3NL5A 3SO7A 3BLIA 2CZ5A 3V18A 5FA5A 1I2OA 1YNPA 4BA0A 2WC7A 3VM7A 4BI7A 4Z2LA 1GQJA 3B9DA 1DOSA 3FS2A 3SCOA 1W1IE 3E0WA 4UCGA 3PJUA 1TWDA 4NNAA 2VZSA 5HNUA 3O07A 3ITCA 1D7FA 4A35A 1UZHA 3PTKA 3W7PA 2NQHA 2X8RA 3CLWA 4JFVA 1TV3A 2WM0A 5AHMA 4YN5A 2E5BA 2WHMA 3CBWA 2D0GA 4D6JA 2DVTA 2WM1A 4RDYA 2CZEA 2HBXA 4HJFA 3APGA 2ZX6A 4REQB 2OYLA 4XVDA 4P61A 3TK7A 2YGYA 3BV4A 1GWJA 1D7KA 4DBEA 4AIBA 1UQYA 1W32A 4YTRA 4RV8A 2VURA 3GXDA 4A3QA 2F9RA 3GVQA 4UTHA 4EE9A 4B91A 1LLOA 1HO1A 1E9LA 4B5VA 1C8QA 2D3LA 3PP7A 4MVAA 1JPHA 3R4IA 4YMZA 4AY7A 3HPFA 4DZIA 4TOQA 2QMJA 1UJQA 5IBXA 3UESA 2D69A 2P3EA 3T0DA 1V3JA 2QULA 1Q7MA 4HOWA 1FCVA 4Q4RA 2PRLA 1CI1A 2REQB 4FHAA 3L2IA 5IFTA 4HN8A 1GTEA 2FFCA 2XWDA 4DX3A 3W7IA 4ZR8A 4FXSA 4UQDA 3LXCA 2J7FA 4JTUA 1MEIA 1NFPA 5FJTA 2OXNA 1YHTA 1EH9A 1DEDA 4IGNA 4MY1A 3VGGA 1CW2A 5H6HA 1O5RA 2CC0A 5D04C 4EPKA 4JKMA 3NSNA 3UCCA 3BK0A 2OZ3A 3LRMA 1RPKA 4ENLA 2VFGA 3LOTA 1E0UA 4GZIA 3O6CA 4L65A 3K13A 2D24A 1EJ7L 3NDOA 3EDJA 2Q09A 3BGGA 2HCVA 4AC7C 2XINA 4HA4A 2BVWA 1RCXB 4DY1A 2PGFA 2F6UA 2VEPA 3F5KA 1UPMB 1CLVA 1OBAA 3BPWA 1HZYA 4N4QA 3BCDA 5LIKX 3GKFA 3TYCA 1G67A 3N18A 3AYSA 4HHHA 4P2VA 3HBLA 2Z1WA 1EDTA 1XGDA 4H8VA 4JTQA 2J7EA 4QHRA 3KOYA 1S2AA 5C7HA 1GJUA 4O50A 1XBXA 4KEMA 1YLVA 1TTPA 2YCJA 1W3LA 3JU2A 2CHRA 4OECA 1QO2A 4AFYA 1KBIA 1WUEA 1GONA 3RRXA 5HWNA 1A5CA 2B7PA 4LCSA 1BXBA 1XH1A 2QDHA 4FALA 2UV8G 4ZCWA 3MKKA 3GD6A 3RK8A 4DF1A 3IRDA 3KFTA 5C9UA 2ZUMA 1JYVA 1TMHA 2GDVA 4C1LA 1DJHA 1JRCA 1YTEA 1DJXA 1X1NA 2IXVA 5EMUA 1UJPA 2XVLA 1ME9A 2VFDA 4CN1A 1IWAA 5C70A 3LSCA 2QJGA 9XIMA 2BGSA 4C6OA 4GI6A 1HVXA 1OQFA 3W7QA 1L6YA 1CGXA 3BAXA 2VGGA 3M43A 3V16A 4F9JA 4CCCA 4MJMA 3M16A 2WNQA 3R2GA 3HQ1A 1XISA 3DENA 3VC6A 7CGTA 5H1WA 5D38A 2WHJA 1PKYA 3W71A 3QFEA 3M6DA 3QMSA 2XVNA 1G7VA 4ZBCA 4V15A 1FCBA 2QCNA 3K8LA 4X22A 4UOJA 4G5DA 1TJ1A 1XLAA 4DWSD 1OG6A 3E0FA 4PCSA 3MBFA 3A6OA 2H3BA 3TSMA 3IK4A 3MWAA 4I5RA 5FF3A 1SW7A 3KRUA 4DJFA 1KQZA 2ZXBA 1TIMA 3OZPA 3WL0A 3NPUA 4IX2A 2XU2A 1VPYA 3IGUA 3PZUA 1EEPA 1HG3A 3EAUA 4TR9A 2J27A 1A5AA 2VRKA 3BTNA 5T91A 3UGVA 1U5VA 4HU8A 4GLEA 2OLAA 3SUSA 1PB0A 2F38A 3FEMA 1VEMA 3A23A 3A21A 4DO6A 3BARA 1XIBA 3EXRA 1ZB5A 2AQOA 1O5XA 4G1KA 1WKFA 1G7UA 1YDVA 2ZZ2A 3UEQA 4ACZA 3NXLA 3SEPA 1MW1A 1A47A 3PM6A 4O4VA 3W4RA 4F9DA 3WQFA 2CBUA 4DJDC 5D8WA 1ZJIA 4FIQA 1VCFA 2YXGA 3QQ0A 2PLKA 2V30A 4DBDA 4LC8A 3RO8A 1Q13A 3QYSA 1GZ1A 2WJZA 3BMVA 1XHGA 2YLLA 1FWEC 3LCLA 2FQIA 1R2TA 2HNHA 2NXHA 2Z2AA 2Y5JA 1JI2A 4D8LA 1SR9A 3BLFA 3ERPA 1QFEA 4KFPA 1W2PA 3R58A 1X97A 3H55A 4PH6A 2QUTA 3GVRA 4N9CA 2XSBA 4KS0A 4Q22A 1QPKA 2I9UA 2ZZ4A 3M0HA 3LLDA 1QBAA 2J13A 4YTTA 3VE9A 1ONEA 4QDMA 2DH2A 4QS5A 2DZWA 4ZB5A 3MCMA 4RE0A 1YPXA 4ZMGA 1OABA 4PUWA 5DELA 1FWAC 4JZ5A 3ARQA 1JD7A 3EA2A 2OB3A 1VBRA 1TZ7A 3CV1A 2O9OA 3NO1A 3U8GA 5T9CE 3TUUA 3WH6A 1O1ZA 4MGGA 4O1FA 4EX4A 1MQRA 2FZDA 1UD3A 3FXYA 4GYPA 4GOAA 2WNNA 1PEZA 4AVNA 1VEPA 3WJZA 1UZDA 1EA0A 4AZGA 4DN1A 3PZVA 1QNRA 4PL2A 5C8BB 4J28A 1EBGA 4LY8A 4KW2A 5AB3A 2ISDA 1J6PA 1EDQA 3K8KA 1OC5A 1SO3A 4FNUA 4LNCA 3I3EA 4E2DA 1DQUA 3NQDA 3W73A 3G3DA 4QAIA 3A5VA 1YW1A 5KEZA 1RQEA 1NWRA 3KBSA 2ZRZA 7PTDA 1OCNA 3REQA 1B30A 2JFEX 1FFQA 3WCZA 3HMJG 1OC7A 3AO0A 3L2MA 3U48A 1T41A 1NH6A 4X0VA 2RFGA 1UB3A 3UWEA 5D9OA 4RV3A 3WLQA 2J77A 5BMXA 1ZJHA 1P7TA 3VNIA 4ICMA 5IM51 4RNIA