3C3NA

Crystal structure of dihydroorotate dehydrogenase from trypanosoma cruzi strain y
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
311
structure length
311
Chain Sequence
b'CLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAVPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase
publication title Crystal structure of Trypanosoma cruzi dihydroorotate dehydrogenase from Y strain
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase
total genus 109
structure length 311
sequence length 311
chains with identical sequence B, C, D
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2008-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3c3nA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3c3nA01
1R47A 2QCFA 3QEZA 3B06A 4IMFA 1EB3A 5H2ZA 1TPH1 5I3FA 2CLOA 2P10A 1H7RA 4JDYA 4UFJA 5AFDA 1H7PA 2WNNA 4DF2A 3B03A 2A1YA 1KBJA 3OVQA 4JTHA 1XCFA 3G8EA 4PFMA 2GJLA 3QQ0A 1FBAA 3G24A 2G96A 2JKAA 4LRTA 2QUTA 3LCIA 4XBKA 5C2XA 3UWUA 1DHPA 1K7FA 3NPXA 1FY6A 3TC7A 4C1KA 3BV4A 3MI2A 3IVUA 3F1QA 3VKJA 5D32A 2Q8ZA 2CW6A 3LI0A 4EF9A 1X7FA 3FEMA 1SZGA 2VFHA 3TMLA 2X1RA 1I8JA 1H7XA 2RDTA 1DV7A 4Z1BA 2OZ0A 1JQVA 1GWJA 3LV6A 1XDLA 4AVFA 2A2IA 2ZZ3A 3O6YX 3IIZA 2WJZA 5I3HA 4CQ8A 1TRIA 1AW2A 3W88A 3EEGA 4LT9A 1AK5A 2BWGA 3FJ6A 3LCLA 1X1OA 4O16A 1OX6A 4KFOA 4EWND 1WV2A 2XN2A 3PBVA 5DXYA 2QCHA 1JCNA 3RFAA 5HQEA 3EB2A 2FIQA 3NQDA 3S5NA 3BK0A 3F03K 3M0ZA 3P80A 1N7KA 3GX9A 1KLYA 4H6KA 4M6QA 4LU0A 1RQBA 1VGAA 3ZS4A 4WOQA 2HS8A 1KM6A 3U8GA 1H60A 3W7NA 1UBSA 2R94A 1KM4A 3H54A 5CPNA 3HG3A 3GAKA 4ONVA 2QDHA 3CWNA 4TO8A 1IXOA 2A5HA 3C0JA 1I4NA 4QITA 4UTHA 2PRHA 2V5LA 1U83A 1F76A 1F6PA 3IIOA 3P62A 4XUGA 4PC8A 1MXSA 4N02A 4X3ZA 4LVGA 4O19A 1GJPA 1JUEA 2X1UA 4IPIA 4CNNA 3EX2A 4JYEA 2J9ZA 4IXXA 1SZFA 4JTEA 3R5EA 5D2WA 2GOUA 2V2DA 3CT7A 1LRQA 5AC8A 1WXJA 2X1SA 3ABQA 3WJXA 3UWWA 5HNRA 2C6QA 5CPOA 4KFNA 2WSRA 4BFAA 3LGEA 3TMQA 1MO0A 3C2FA 3AO0A 4NJKA 2B7PA 4O50A 1YTKA 3NPUA 3DU0A 2DZWA 2ZBTA 3P5YA 5HR6A 3RMJA 3WJWA 4FIQA 3ATZA 5D2YA 2Z2UA 4AWSA 3C4UA 3HJZA 2DORA 4UC5A 4NUWA 3W1AA 1SW7A 3LM7A 4AHQA 2CZ5A 4QQ3A 1DKWA 2C3ZA 3PBYA 1VHCA 1VRDA 3SR7A 1T96A 2HSAA 3NPVA 3HOJA 2GQ9A 3QW3A 3GKFA 4Y9AA 2ZQ0A 3M44A 2NX3A 4Y90A 4RV8A 1G4EA 1TV5A 1AW1A 3PB2A 2GUUA 1TIMA 2CLIA 3MI3A 3TU9A 3S1UA 3W7MA 4FNQA 1FWTA 5EBUA 4AEOA 3R13A 5GVJA 3WK3A 4FIRA 1TV7A 1TTIA 3G1DA 4JX4A 3PULA 3NL6A 2ZDRA 4AMAA 1OJXA 1V7YA 4DO4A 3TJXA 1WQ5A 2JKPA 1KBIA 1W56A 3GXPA 3ANYA 2FB2A 3EX6A 3LCFA 2VFIA 2B7OA 4BI5A 1Q3NA 4NJIA 5AN7A 1F73A 3L67A 2NX1A 2B7QA 3SY5A 1LORA 1WBHA 2G5WA 4K7VA 4MPQA 1OFQA 3QM3A 4B5NA 1KW1A 2C16A 1VQTA 3THAA 4ZZ9A 3P67A 3BW4A 5CPMA 1OX4A 1W3NA 1WBJA 3TQKA 2ISWA 5DBUA 3W83A 5FI8A 2TYSA 3L5LA 1ME8A 2GJNA 3R89A 4UFMA 2X16A 4FB7A 3EXSA 3GNNA 4UR7A 1OX4B 2EHHA 5D04C 1UJPA 3S9YA 4G1KA 5D2TA 3S5ZA 1EWDA 3T78A 4MFEA 5KZDA 5TIMA 3A5FA 3W1QA 3QC3A 4EOUA 3DHFA 3MBDA 4LW7A 4RZ4A 2XN0A 2R8WA 2Y70A 1LBLA 5HR7A 2B7NA 2J27A 4N9CA 1C29A 3DI0A 1H1YA 2C0AA 4JN6A 4JY8A 2P1FA 4UNLA 3Q58A 4O57A 2EAWA 4CCCA 1IIGA 3IRDA 4HNUA 4YCPA 3MHGA 3QSRA 1Q6QA 3MYOA 4XWUA 2J9YA 4MJZA 1X8FA 5F4WA 3GYEA 1UCWA 1HUVA 1PHWA 2A6LA 4O28A 1FXPA 3T40A 4FXRA 4IMGA 3S6DA 3H53A 3NL3A 4GFSA 1AL8A 3EXRA 1W3IA 4K39A 1S5VA 4R53A 1G6CA 1OF6A 5AOUA 5CZ0A 4IMCA 5F4XA 2QEZA 2J24A 1IF2A 3NL2A 4O1CA 1PCKA 3S8HA 4K7YA 1D3HA 4CCDA 3TQVA 2NXIA 2A7NA 3CWOX 4AB4A 3DAQA 3LHWA 4JTGA 3BGGA 1VS1A 1YXCA 4UFKA 3W9ZA 2QAFA 3A24A 2QR6A 3L21A 5U7SA 3OIXA 2ZRUA 1JCMP 1TMHA 2YR1A 5L6UA 1K8XA 2QCEA 4X9SA 4JIQA 3W1XA 3JR2A 4MY9A 3STFA 3BG9A 4E38A 4BWLC 3EWWA 4MZYA 3UY8A 4DBEA 1A53A 3OBKA 4K8HA 2PE4A 4O0KA 5K2ZA 1S3HA 2O7QA 3BO9A 3O8AA 1VLIA 1LLZA 4XTIA 5HWJA 1PCWA 3HBLA 3JRKA 3Q94A 4PL1A 3QPZA 4UMCA 1NSJA 1WX0A 4XTDA 3EWBX 1H5YA 3IVTA 3W7CA 4UMBA 4X2RA 1XFBA 1BWKA 1JRBA 2ZRZA 1LYXA 3CIWA 1RD5A 4O1BA 4JTFA 2W6RA 3PY2A 3F4NA 4N6EA 1FWWA 3MUXA 4ADSA 2Y7EA 3NQAA 5D2VA 4DELA 2DZPA 3WK1A 1P0KA 3G18A 3A9IA 5L9FA 1KFKA 4UFHA 3MYPA 1GYNA 2F84A 4IX0A 4HN4A 1A5BA 1HL2A 2OT0A 1GVQA 3PS7A 5DY2A 1OK6A 1KM2A 1GEQA 4RZ6A 2QDGA 3DKLA 3B0UX 2CLKA 2E77A 2NUWA 3FYOA 3WJSA 5FESA 2W79A 1XBYA 2NXHA 4Y96A 1IXPA 3FKRA 4FO4A 4BK9A 1SZNA 4POCA 3NZ1A 4DPQA 3GDKA 1PV8A 2HTMA 1P0NA 5CPLA 2DJXA 1R30A 2FDSA 3M6YA 1O5KA 4HPXA 3HPSA 3OG3A 4O17A 3V75A 3CLMA 3PG9A 1OFBA 4QSHA 5DXXA 4QNWA 1W31A 4I7UA 3LRMA 1H63A 3NQFA 2AGKA 3NQMA 1BKSA 3W2LA 4UCGA 4JGDA 4NJHA 3HGJA 2E5BA 2G95A 3BW3A 1VZWA 5G4EA 5K4ZA 4QIUA 1HTIA 1SW3A 3EKZA 3BPWA 2A0NA 1EPXA 3QJAA 5F2MA 1J4EA 4IPJA 3PVFA 1U5JA 1NVMA 3W07A 2QJHA 5K9CA 1OF8A 1OYBA 3BLIA 3QMRA 1TSIA 4KWWA 4FNTA 3LXBA 3PBUA 1DORA 2V2HA 4YCOA 1EUAA 3UWYA 1HFBA 3LX9A 1HG3A 3PB0A 1BWLA 3LCWA 2J9XA 4IGHA 5FEZA 5DY3A 4OT7A 3K30A 1ME9A 5D2XA 4N9EA 1UUOA 3EWYA 1GYLA 1TV8A 4UTWA 1EP3A 2YFOA 4ORMA 2DZTA 2ZFAA 3DFTA 3I7QA 4ZQOA 1KM3A 3SIZA 1T8XA 2I1OA 1H7WA 1G7VA 5HINA 1H7OA 5C54A 3NVTA 1LZOA 5DCBA 3GDRA 3GZ3A 2C19A 2ZZ7A 5KMYA 3MHUA 3B04A 4I9AA 4GUJA 2Z6JA 4UUIA 5U4NA 1QDSA 4JTIA 3TV8A 1G7UA 4WY0A 4UTTA 1QFEA 2WSYA 4TIMA 4JIPA 3NOEA 3CEPA 4JTTA 3TH6A 3U2OA 4A3UA 2YDAA 3UXDA 5D30A 3TSBA 3CB8A 1AL7A 5DCDA 1L6SA 1VCGA 3PC0A 4WY0B 4JX5A 3L5AA 3B0PA 1VR6A 2VFFA 4UTIA 3W7DA 1KA9F 4FNSA 1VJIA 2DZXA 3N3MA 1LROA 1TPUA 1MEIA 3TCEA 1KV5A 1I2NA 4NT0A 1FWSA 1XL9A 4MFDA 3IGUA 3SI9A 4DQWA 3L5MA 3RLVA 4C1LA 4HNNA 2UV8G 1XM3A 3IGXA 3NQ8A 2EGZA 5KSWA 3A22A 4Z0SA 3QZEA 2QCDA 5DLCA 3W1NA 3A21A 4WQ6A 3W73A 3FKKA 3NG3A 2QCDB 3MP5A 2O7SA 4ZQRA 1QWGA 1TPC1 2FLIA 4DF1A 4DF0A 4NVTA 1SU5A 3O6DA 1KFLA 3NQGA 4WX2A 4I7WA 3S42A 4LS1A 4AH7A 1W1ZA 5CZJA 1EA0A 1F5ZA 2YZRA 4RLIA 4ZQCA 4MLJA 1XUZA 3NPWA 4DXVA 1NEYA 3G1HA 4ZL1A 1DOSA 4NNAA 3NQCA 4K8EA 5DN1A 1O94A 2YXGA 3C2EA 1ME7A 2ZTKA 5IM51 3M5YA 4M7SA 1XBXA 2RH9A 5G5IA 2BSLA 1FQ0A 3C2VA 4LUJA 2GQ8A 3C2OA 1A5CA 1W5NA 3G3DA 3PM6A 1XI3A 1FCVA 2QCGA 4IMEA 3I68A 3HGRA 3CU2A 1TQJA 4O1AA 1Q6RA 4KFPA 1OFOA 5HULA 3LB0A 1JR1A 2ALDA 3P84A 4AXKA 3M16A 1CX9A 2ZA1A 3MI6A 1R2SA 3UQNA 4Z08A 3KX6A 5C5YA 3UPBA 5LNRA 4A21A 4AWTA 4JDBA 4FX7A 3CM4A 1B4EA 5D09A 5DELA 2FB3A 2E6YA 1A5AA 3DFSA 1MZHA 2VFGA 4WXYA 4MZ8A 1OG0A 4NZJA 4GUHA 1FWRA 3I7SA 3UNDA 2VFDA 3W7RA 3W71A 2PURA 1QCWA 1JVNA 3MP3A 5A5WA 3T44A 1FCBA 4JTUA 5AC7A 3IIVA 2FFCA 3L66A 1EIXA 1SO3A 4LRSA 2OX1A 3OA3A 4JR5A 2XN1A 1FCUA 4LY8A 3SSJA 4OWGA 1SFLA 2HMCA 4RK8A 3SZ8A 1LOLA 2VEMA 2Y7GA 4FX6M 4LS2A 1R2RA 1M7PA 5AHEA 1PVNA 4BR1A 3LBCA 4P61A 4PL2A 3BARA 1TCDA 4LNYA 4UR8A 4JX6A 1RZMA 4PEKA 3ABOA 1TRDA 2C15A 3M5ZA 5CZSA 2AAMA 3DZ1A 5CG7A 4O0ZA 1PHQA 2WKJA 3I65A 3D0CA 3UWZA 3G1FA 3NR0A 4NJGA 4EIVA 1LOSA 2BTMA 3M5XA 3KRUA 3W75A 3W7OA 3NAVA 3QFEA 5F2GA 4MJMA 1P4CA 3TROA 3WK2A 3QRHA 1NF0A 1IIHA 3CC1A 3LRLA 5D33A 4M19A 5AHMA 3C8FA 1LRTA 1Q6OA 4HHPA 5LNVA 3TK7A 4N2YA 3R8RA 5D03A 2DJLA 1K7XA 4OHQA 1LM1A 2QUUA 3W7KA 1YTEA 4BF9A 4M6VA 1VHNA 3RNDA 3MO7A 3DH7A 4OU1A 2QJGA 4HSOA 1EP2A 2CZEA 3UD6A 3W7HA 4FXSA 4QISA 1TQXA 3S5YA 3QF0A 1H7NA 4JTKA 1TREA 1LLWA 2A7PA 5ABTA 3W3OA 2GVGA 2NLIA 2FQIA 5SWUA 3L0GA 2ZA2A 4UTKA 4WXZA 1W5PA 4N4PA 1G67A 3HQ1A 1JJKA 4KWVA 4XKYA 2CFFA 1KM0A 1W3TA 3UPWA 1GTHA 3NNTA 3NZRA 3DGRA 3B8DA 1X1ZA 4UTUA 2NX9A 3RU6A 1GQNA 1ONRA 2QJIA 4XKYB 1VYRA 3GDTA 2E5CA 2VEIA 4QAIA 4GE8A 3PBWA 5FF7A 4N9DA 2X1TA 3FLUA 4K6AA 3B05A 3P7YA 4NZFA 2BLEA 5D05A 1X6UA 4JTJA 1W8SA 4UTMA 4AHOA 3PSVA 2ZCGA 4E2DA 1SSGA 2ATSA 3CTLA 4M7TA 1YYAA 1TJRA 4FX8A 3C3NA 3E12A 3M47A 4MKNA 1TPDA 1OHLA 1YXYA 4MY1A 1Y0EA 1FWNA 2WNQA 5I3GA 4OQVA 4DO5A 1W37A 1OFEA 2WV8A 4LV9A 2E09A 3QSTA 4ZVJA 4UFLA 1NF7A 1O60A 3LLFA 2BXVA 4O4VA 2ZRWA 2H8ZA 4PH6A 2YFNA 3L0KA 4AF0A 3GR8A 3TR2A 3W1UA 1W54A 3O63A 4JNMA 4MY8A 4OGZA 4HNVA 3NQVA 1A50A 1M6JA 3DXIA 3LTYA 4BI6A 5FF3A 4AF0B 4QNEA 1KTBA 1IXQA 1TO3A 2FPVA 5CKSA 1FX6A 2C18A 3I6RA 5I3KA 2Y7DA 5IBXC 4WUIA 1OFDA 3F4WA 3GB6A 1UUMA 5HMSA 3MHFA 1VH7A 3GDMA 3NGJA 1DJQA 4JXCA 1KTNA 3RF9A 2DU2A 3QMTA 2VKZG 3VCRA 2YSWA 4RJEA 4Q32A 5F1VA 3LHTA 3KVJA 5EA9A 4ORIA 1EP1A 1QNVA 2TSYA 3GDLA 3KVMA 1TPB1 3WFAA 1VCVA 3NM3A 4QM1A 1GZGA 3W2UA 1XC4A 5BMXA 1LTDA 1O4UA 1W0MA 2Z1BA 3S1WA 2VEPA 3W7LA 4NQ1A 4O54A 2DZVA 4J9JA 1TPWA 4GXMA 2YW3A 4JEQA 3W22A 3DHDA 3OVPA 3GXTA 3TW6A 2WOQA 3GR7A 5E0KA 1ADOA 5FF0A 5EKYA 2GVJA 4LVBA 3QW4B 3P5ZA 3W2JA 4LWWA 1I45A 5G2HA 3NA8A 4RZ5A 5LGZA 1DL3A 1DBTA 3HG4A 3JS3A 1RQHA 1JUKA 3VNDA 2Q3RA 2PC4A 3LDVA 4LUIA 4EF8A 2JGQA 3QYQA 3W1MA 3HO8A 3R2GA 3B4UA 2GVLA 2ABBA 5KINA 3O05A 5BW6A 4HPJA 4Y8FA 4JD4A 2NUYA 4N4QA 2OJPA 4ZQNA 1TB3A 3DENA 3LHUA 5HWNA 3P82A 4GUFA 1WOBA 3M5VA 5G4WA 1RR2A 3TQ0A 4I7VA 4JYDA 4GUGA 4IWWA 1JQXA 3TAKA 3UZ5A 2EPHA 1SO6A 1SPQA 3W70A 2ZRXA 1IGSA 2PRLA 4OE7A 3BVJA 3H55A 4PTNA 3TFCA 1OABA 1L6YA 1NAL1 5F2IA 5KZEA 1B9BA 5FF4A 4YXGA 3EWZA 3E9AA 3M9YA 6TIMA 1GVOA 2E68A 1F74A 2AQWA 4LVAA 2Y85A 3STGA 1V5XA 4HSNA 1I2RA 3ZR4A 2RDUA 2A21A 3T55A 2RHGA 3N9SA 5LGXA 1ZENA 2FJKA 1OFAA 2Z6IA 4U28A 3P8JA 5T26A 1GPWA 2HS6A 4NU7A 2A85A 4H3DA 1JRCA 4CQ9A 3S5OA 4A2RA 1ZALA 4BWLA 4S2CA 4XBSA 2QF7A 5LNSA 1O5XA 3OEXA 4O18A 2ZYFA 3Q37A 2I9EA 5TQLA 4BI7A 2ZRYA 3UXAA 3WK0A 3UWVA 1RV8A 1WAUA 4GNJA 3EKLA 4CNOA 2VENA 5D37A 3FFSA 3NXFA 2A6NA 1QPQA 2QAPA 2R14A 1QOPA 1QPNA 2FPYA 5AC6A 5LNWA 3M41A 5EY5A 2CZDA 4RXFA 1ICPA 2W0UA 3MP4A 4LVFA 3WJZA 3LV5A 3LLDA 3MWAA 2H8XA 3S1VA 4JTLA 5FF2A 3VE7A 1KV8A 1OFRA 1GOXA 1YLVA 1AW5A 1HO4A 1O95A 3BGJA 3W7EA 1FUYA 4WJEA 3PR2A 2ISVA 3DKJA 1ZNNA 1QO2A 3W74A 1THFD 2X2GA 5G1TA 1JCYA 4LC8A 4UNKA 3PUOA 3EWUA 3MJYA 4Z1DA 1GTEA 1H51A 1VPXA 1SSDA 1TPFA 2RDWA 3CHVA 5K9DA 4E0CA 3G0SA 1K7EA 3SGZA 2R91A 3LI1A 2VC6A 5H91A 4TMBA 1VYPX 1Z41A 1SO5A 4AWUA 1N55A 3ELFA 3HMJG 1GVRA 3PF3A 2WPBA 2NZLA 1WDWA 4GWEA 1Q45A 2NUXA 3P81A 2ZZ1A 4UIOA 1ZAIA 3O6CA 1SQ7A 1YPIA 3G1XA 4DEFA 3HGOA 3LHZA 3CIXA 1C8VA 3NQ2A 4FNUA 4CLMA 1TYGA 4DPPA 3CPRA 2H90A 4O52A 1F7BA 4JYFA 2KZHA 3E02A 3PG8A 1XBVA 3TSDA 4MYAA 4QJ1A 2PCQA 3QMSA 2VFEA 4HNTA 2QCCA 1XXXA 2CLEA 3O1NA 2LLEA 3KOFA 2D73A 1EEPA 5BMWA 1MEHA 2OT1A 1F6KA 7TIMA 2E6AA 1TJPA 1UASA 2GQAA 3KRSA 4OBTA 1LRNA 4ADTA 1I2PA 2WQPA 4Z1CA 5F1UA 1Z44A 8TIMA 1QPOA 1DVJA 1TTJA 3G1AA 1EX5A 3GNDA 2Y63A 1ICQA 3LBMA 2JBMA 1P5BA 1TTQA 1GVSA 5AHIA 3SGUA 4YWIA 1CI1A 1NFBA 3A23A 3MW7A 2VXNA 4IUOA 1G69A 4CCEA 3P74A 3A5VA 4MYXA 5AB3A 4U4MA 2WNZA 3CQ0A 3VI2A 4K38A 3LXCA 4M6PA 5LNUA 4K36A 5BRBA 3VFLA 2CLMA 3TAOA 4OV4A 4L4MA 2JGYA 4RR4A 1LP6A 1JUBA 4HT3A 3HPZA 4FF7A 2NXGA 1D3GA 4FHAA 4MUZA 3STEA 1YTDA 1ZCOA 1ZJIA 4RXGA 3TIMA 1QOQA 1G4SA 2YPIA 4GRSA 1KFCA 3W72A 5C55A 1T0OA 2E5DA 5BOOA 1SZEA 2C13A 3FA5A 3IIXA 4S1FA 3C61A 3G0XA 1QAPA 1YADA 2Z0IA 1ZY9A 1I2OA 1RVGA 3RLUA 5FEPA 2CLHA 3W7JA 4L4LA 2NWSA 4X22A 1B3OA 3SFKA 4NXSA 1L9WA 1I2QA 3W84A 1GG1A 1OYCA 2V81A 3CEUA 4ALDA 2VEKA 5AHFA 1H1ZA 3G1YA 1B57A 3IVSA 2DP3A 1EUNA 1M7OA 1ZHAA 3IGSA 1JCLA 4IXHA 1WA3A 3W86A 3KXQA 4A2SA 3TXZA 2FTPA 1OFPA 3HIJA 4LVDA 4HKPA 4MOZA 3TE9A 2CU0A 3E96A 2E6FA 1PE1A 1WOAA 3OVRA 4IJBA 2DZUA 1GT8A 5KTLA 4R33A 4UTLA 3HG2A 3KFTA 4O10A 1J2WA 4N9BA 3W1PA 2X30A 2V9DA 3O16A 3DFOA 2EKCA 3O15A 4ICNA 4O4WA 1DJNA 3W1RA 1KFBA 2RFGA 2E6DA 4ADUA 3LHVA 3L9CA 2ZZ2A 1OK4A 4MLRA 2Q3OA 3MMTA 4NXKA 2JKEA 4PA8A 4UFIA 3P60A 3S0CA 1KFEA 4AAJA 2FPTA 5G1YA 2Y89A 4XZ9A 5EYWA 4UXDA 1LDCA 3N19B 4WZHA 3G22A 3FOKA 1R2TA 2BZNA 5KITA 2G97A 4YMZA 2V8ZA 1Q6LA 1L6WA 2V2CA 2B0MA 1EWEA 5DBTA 5D38A 5F4SA 2CLLA 3KRZA 5HUOA 2V82A 2JK2A 1D9EA 4NX0A 1XUUA 1RQEA 3BW2A 3Q2DA 1KTCA 5AHLA 4DO6A 4FNRA 2Y62A 3W7PA 3L0NA 3LERA 1PS9A 5DCEA 3W6YA 3GXNA 2RKXA 4K37A 3HPXA 4WY0F 3C52A 1QPRA 3EX4A 5TBOA 3LRKA 1FCQA 3DBPA 4XQ6A 4FNPA 3W2KA 5EMUA 1K8YA 3PAJA 2OCZA 1H61A 3NL5A 1W5QA 3KHJA 4LTSA 3DFPA 5FEXA 5F2LA 4TX9A 3TUUA 3W23A 1JCXA 4OV9A 3L2IA 3IIPA 1OVDA 3N9RA 5I3JA 4GJ1A 4O15A 4EVZA 4O13A 3PUDA 3W85A 2CZFA 3P61A 3G1VA 4P2VA 1K8ZA 3WJYA 3I7RA 4IX2A 3GKAA 2Y88A 1KLZA 5CSRA 3NEVA 4Z0JA 2V0TA 2YYTA 4JICA 2C1HA 3W1LA 1MEWA 5E93A 1CW2A 4RCXA 3TKFA 1OYAA 3KVKA 4LOCA 3HF3A 1QR7A 1OX5A 3M1ZA 3W7QA 2NV2A 4R34A 4RKAA 2TRSA 3NQ7A 4AHPA 1ZFJA 1SFJA 1G4PA 1ALDA 2J6XA 1VCFA 4IQLA 3C2RA 2OMAA 4MZ1A 1F2JA 4N6FA 4JTSA 3GLCA 3L68A 3T4CA 1M5WA 4NNBA 5K7JA 3DFQA 4O8RA 2ABAA 1XDMA 1K3UA 1KM1A 2BX7A 2F7FA 3BLEA 3TJLA 1BTMA 4MIMA 3KAOA 1FDYA 2DZSA 2ZA3A 1SW0A 4FEZA 4NJJA 3W7IA 1T99A 1H62A 4UTJA 5A8GA 3ATYA 3TSMA 3TW7A 3W1TA 2GPTA 5J5RA 3W76A 4S2BA 2H6RA 2IQTA 1LBFA 4Q33A 4PCFA 1ICSA 1FXQA 5K9XA 4NNCA 2Y61A 5EL1A 3OHIA 4D2JA 3M43A 1SR9A 1FDZA 2CLFA 2QCNA 4RX0A 1BEUA 3N2MA 3LCXA 5LSMA 3T7VA 2V30A 4O53A 1H50A 3STCA 5FEWA 3NM1A 3B0VC 4WOZA 3O07A 5K3VA 3UYCA 4O1DA 3N34A 1W5MA 1DQXA 4LC6A 2ISSA 4LS0A 2H3BA 2V5BA 3SW6A 1E51A 2PRMA 3UZJA 3NO5A 1TTPA 2C14A 1JULA 4TR9A 3ABSA 1YDOA 1LBMA 2ZZ5A 5D02A 1TPEA 4YLWA 3PSWA 2YCEA 3EXTA 3SJ3A 2A7RA 5HJLA 3IV3A 3AJXA 2CWNA 3W7GA 2Y7FA 1PIIA 1SO4A 4A22A 5LKYA 3C56A 2WSQA 1B4KA 5AYXA 3LTSA 1DQWA 2Y6ZA 3E0IA 3N2XA 1TPVA 2QUVA 3HG5A 1W5OA 1F05A 3DFNA 4GUIA 1S5WA 5EPDA 3FYPA 2I14A 4R7JA 5AYZA 1QMLA 4GC4A 3N73A 3UY7A 3U6WA 4IMDA 3P8IA 1HO1A 1JCJA 3ABRA 3KVLA 5E1QA 3W87A 4Y6GA 3USBA 4GBUA 3LCGA 4O12A 1ML1A 3MBFA 3BLFA 5G2IA 3NYZA 4ZMGA 2NWRA 3G8RA 2TMDA 5C6MA 3UWQA 1K03A 1MSSA 2QKFA 2ZZ4A 3ZWTA 1AG1O 2ZZ6A 3L65A 5I3IA 1LOQA 2XFWA 4UTWC 3DI1A 5IBXA 4CNPA 3LCHA 4E2BA 3G3MA 2YGYA 1YDNA 3G0UA 1R46A 4WD0A 3ZFHA 2YX0A 1L2UA 5CZTA 1VLWA 1ZAHA 3HB9A 3BG3A 1XKYA 5AHNA 1VYSX 4PODA 3IEBA 3NQ6A 1UB3A 3M7WA 3SECA 1Z48A 1N8FA 5LHFA 3O06A 4UTTC 3FS2A 3NDOA 3YPIA 3FJLA 1YXDA 3N14A 3LTPA 3G1SA 3GAYA 5CGQA 4DBDA 5KZMA 5K4XA 3NQEA 1XBZA 1K02A 1QO5A 4LV4A 4TU1A 2J88A 2VOMA 4CQAA 2A4AA 3EX3A 5G2WA 2QCLA 5J5DA 3TXVA 3S1XA 3LOTA 1C9DA 5LHEA 2EF9A 5HWMA 3PUEA 3HGSA 1GG0A 5LZLA 2WO5A 4JY9A 1VC4A 4W9TA 4O11A 3TX9A 3INPA 4IOTA 1YPFA 2E1DA 3LHYA 4TMCA 4KKXA 1LCOA 3C6CA 1KFJA 1J5TA 1AMKA 3QQ1A 4UMAA 3TDFA 2ZTJA 2ATMA 3THQA 4ZQMA 4H4IA 1PL9A 5AYYA 4MVAA 3PWAA 3R12A 2Q8LA 3GVGA 1A5SA 2YW4A 1G4TA 5CSSA 1P1XA 1GVFA 2P0OA 2ZRVA 3E49A 3FIGA 3GIYA 3TC6A 4A29A 4ZQPA 3VE9A 4M5PA 3BG5A 1Z42A 6ALDA 3RK8A 3TNOA 3LXAA 4NX5A 2H3DA 3W2MA 3TFXA 2NV1A 5HUPA 1WYIA 5BNKA 1IXNA 4ML9A 3QPYA 3GK0A 3W2NA 1FDJA 4O14A 3QH2A 4Q4KA 1KM5A 3TA6A 2YYUA 2B4GA 3EX1A 4JS3A 3V1PA 5MHBA 2QCMA 1RPXA 1SUXA 1YDVA 4Z1AA 4YL2A 2TPSA 1S5TA 1ZAJA 2VELA 4HIBA 3EWXA 3ZWSA
chains in the Genus database with same CATH superfamily
2QCFA 2F6XA 4IMFA 1KRMA 1I1XA 5CSUA 5H2ZA 4F4RA 3CUGA 3VNKA 2OLHA 5GNZA 3TR9A 2P10A 1B30A 4UFJA 1QNPA 4PMQA 2WNNA 4DF2A 4LBUA 5JUVA 3OVQA 4G7FA 1CECA 3QQ0A 1FBAA 3AYSA 1GCYA 1QNSA 2JKAA 4LRTA 3SRDA 3MSGA 3WF4A 1UWUA 3QVQA 4TVDA 1FY6A 4CD6A 5FL1A 3KCLA 3VKJA 2NLYA 1FH7A 1BKHA 2PDUA 4EF9A 2DUAA 3WBXA 3FEMA 1DXEA 3TMLA 1EXPA 3OLEA 4DB7A 4F79A 1JQVA 4ZENA 4AVFA 2A2IA 3HFTA 1AVAA 2ZZ3A 4LX4A 4E2VA 1BD0A 5I3HA 1TRIA 1EJRC 3RCNA 4KFOA 2QVNA 3D3AA 5DXYA 2ADAA 4KCVA 4NAEB 1JCNA 3EB2A 3N1AA 3S5NA 1AFSA 3UBPC 3OLGA 3M0ZA 3W27A 3GX9A 2WZHA 4DVOA 1NARA 4H6KA 4ZO6A 3A3XA 4M6QA 4JEJA 4QDPA 4XVDA 1YBQB 3U8GA 5DRCA 5FSDC 1OT1A 3AIRA 1KM4A 3HG3A 4HOZA 2IKGA 5A1AA 4IIBA 3WENA 1I4NA 4UTHA 2V5LA 5D9MA 4LVGA 4O19A 3AYTA 4AZHA 1JUEA 1R3QA 2X1UA 2XFRA 3GXFA 2ZX7A 4CNNA 1P6CA 2J9ZA 1B5TA 3AMGA 4D9PA 1SZFA 2NT0A 4JTEA 3R5EA 3ARTA 2GOUA 3MU7A 2VWTA 3RITA 2PDFA 4NAFA 1H1NA 3WJXA 3UWWA 4KBXA 3VO0A 4GYJA 2WSRA 1W1IE 4BFAA 4YYFA 2PD5A 4NJKA 2B7PA 4O50A 1MW3A 3CZ8A 5CAHA 4ZEPA 1Z8AA 3GBEA 3P5YA 4WLCA 4Y2WA 3WJWA 1CIUA 4E8GA 4G56A 3ATZA 2BODX 5D2YA 2Z2UA 4AWSA 3HJZA 5JBEA 5HJXA 3LM7A 1CCWB 3SQLA 3U5UA 1BG4A 4AD5A 3PBYA 2OFJA 1FOBA 1AQHA 3GBDA 1ZTVA 2HSAA 4QRNA 3S3GA 1UC5A 3IAQA 3GKFA 4Y9AA 3CUIA 7CGTA 2NX3A 4H8VA 4DY1A 2CLIA 3MI3A 4PMOA 4FNQA 5EBUA 4AEOA 5GVJA 3WK3A 4FF5A 3VNMA 1NWUA 2OX4A 2ZDRA 4AMAA 2Y2WA 2HISA 2X0SA 2JKPA 4JHOA 2J78A 4GY7A 1CDGA 4Q3MA 3WMSA 4H8NA 4OBRA 2VFIA 4C6FA 1NP0A 1Q3NA 1QOXA 4Z2GA 3A6OA 5AN7A 4LYPA 1G5AA 2XM2A 1LORA 2G5WA 3QM3A 4B5NA 4IISA 3WLRA 3WO8A 2GJRA 3VC5A 5BWAA 4PMZA 3P67A 2NVCA 3TQKA 5DBUA 3W83A 4LUYA 3T2PA 3T6CA 5EU9A 3ARZA 4CQBA 1FWEC 3EXSA 3GNNA 2YKKA 1UJPA 3H4GA 4G1KA 4F0LA 1KCKA 1S5MA 3CHDA 4V1YA 1UQZA 3T42A 1YE4A 2OGJA 3CWHA 3TA9A 3AS1A 3DHFA 3DEQA 4GIYA 3OO2A 4LW7A 2R8WA 2WKLA 2JE8A 1H3GA 1TWWA 5HR7A 2B7NA 4N9CA 3R0KA 4EPEC 4IFOA 3IK4A 1GZJA 4HK6A 3Q58A 1CGWA 1AH4A 3ZLFA 4O57A 3Q45A 2ZVIA 3FVMA 4HNUA 1C7SA 3MYOA 4H2HA 3OQEA 4XWUA 2J9YA 2Z7KA 4MJZA 1JD9A 4WDXA 5F4WA 3GYEA 2Z24A 3DC8A 2A6LA 4O28A 4GYPA 2XGIA 1US2A 2BGSA 2W4XA 3CXOA 4DJFD 1AL8A 1JZ6A 3EA2A 2OSXA 4E4PA 1BGGA 1UKSA 4Z42C 4XIMA 4F3HA 5AOUA 2Z7GA 4IMCA 5F4XA 3TYAA 1HN1A 4A3HA 4O1CA 3K8MA 4AZ7A 1WKYA 3WEZA 3TQVA 2A7NA 2BY3A 2FVLA 1VS1A 1UD2A 1N82A 2XHYA 2QPUA 3SCWA 1JD7A 4E4FA 2AGTA 3L21A 4WGHA 1IE7C 2YR1A 4J35A 4BF5A 4RE2A 4X9SA 3F7JA 3CHEA 3BG9A 4MZYA 1HKMA 2O9OA 1E9YB 2V3EA 3OBKA 1S3HA 1OCJA 1LLZA 5HNTA 1UR4A 3D6NA 2TODA 4XTIA 1GNXA 4AD4A 4PL1A 1NSJA 3QC0A 5I00A 2EXOA 2CBVA 3IJQA 4TVUA 1R3YA 1XFBA 1BWKA 2ZRZA 3REQB 4O1BA 1HF6A 4M56A 3BOLA 4PTDA 2W6RA 2PP0A 4ADSA 1GQJA 4NYYA 5D2VA 3R1ZA 4DELA 2DZPA 3B9DA 3G18A 3UT0A 4UR9A 5L9FA 2VZOA 3LD5A 3P3BA 1DWJM 4KEUA 1EGMA 3BCJA 5AZ1A 3PZGA 3VOFA 4HN4A 4DBUA 1HL2A 3R94A 1OK6A 3C86A 3CAQA 4NHVA 1WKDA 4GGHA 3AISA 1PDYA 3H8AA 2E77A 3LMZA 2NUWA 3E0LA 1DWIM 1QPKA 3KEHA 4XG1A 1EJXC 2NXHA 1ZSXA 3ARUA 2POTA 2PBOA 5LIKX 3NZ1A 3ENLA 5MKGA 4AY8A 1CTNA 4US6A 3NURA 1ONXA 1K9DA 2FDSA 3M6YA 1TZ9A 5B80A 3CLMA 3GG7A 2NSXA 4S3AA 4LAOA 3EBVA 3O0FA 2B81A 3PK7A 1W31A 4MWAB 2Z1VA 5CGMA 1BKSA 4R3UA 3HGJA 3BW3A 1PDZA 2FH8A 4ZTYA 1VZWA 1N8WA 1Z3NA 4NZ3A 4QIUA 1HTIA 3BPWA 2A0NA 3SDOA 4JNYA 2XH0A 1XGEA 1J4EA 3CHCA 4Z17A 3W25A 5A8MA 3VNZA 1KBLA 1L6GA 1TSIA 3LY0A 3LXBA 3PBUA 1J96A 4DWSC 3B4YA 4JKLA 3LCWA 1JZ2A 2J9XA 5FEZA 2QGHA 1XLHA 2GJXB 4S3EA 1V08A 4OT7A 4IICA 4J2MA 1UUOA 2YZ5A 3EWYA 1DIKA 1TV8A 3RHGA 4ORMA 2DZTA 3R79A 3W29A 3DFTA 1T8XA 4MAZA 2WZIA 4EE9A 3GDRA 1JDCA 1BYCA 1CNVA 1GKRA 5KMYA 2XJ7A 3E2QA 4G6CA 3LENA 3QY7A 5I0DA 2Z6JA 1QFEA 3KZSA 1EBHA 4TIMA 4ECLA 1EDQA 3TH6A 3TJ4A 4ZCWA 4A3UA 5E6YA 3UXDA 5DCDA 3QHMA 4WY0B 1E4NA 4JX5A 3QHOA 1JIBA 1WXYA 4DLFA 2XWEA 4IGMA 5DO8A 1PWMA 3SCSA 4GO8A 1MEIA 1P0BA 4S3GA 3KTCA 3N04A 3W02A 1J8VA 1QI2A 1OC5A 1HX0A 4RDZA 4Q6JA 4DQWA 3PPFA 4JQ1A 4F40A 2QUNA 5E09A 4DZIA 1V51A 5I78A 1V6VA 3VX0A 4Z0SA 1CLXA 4GGBA 3LNMA 1JPKA 5DLCA 4P8XA 3RLGA 4ERGA 5CZKA 2OKOA 4C6JA 1DIOA 3MSRA 2PA6A 4K68A 1K70A 3ORWA 3OODA 4DF0A 2VX7A 4KIEA 1QBAA 1TJ2A 1SU5A 3O6DA 3UP8A 4W7VA 3M0LA 4AH7A 5CZJA 4RLIA 4ZOBA 4ZQCA 1NEYA 3G1HA 4NRSA 4GQGA 4P7LA 1YW1A 1O94A 4NKCA 4UOJA 3C2EA 2REQA 1KWGA 1EO7A 1SMAA 3SCQA 1FQ0A 3L4YA 5I07A 1F4AA 1W5NA 2HNHA 5HPOA 1OT2A 1RH9A 2QCGA 1TVNA 3I68A 3CU2A 3SJNA 1TX2A 1TQJA 3NZQA 4GQ0A 3SY1A 3I6EA 5HULA 3NSXA 1C3FA 4I3GA 1CX9A 3MI6A 5AVNA 1R2SA 3LM3A 4LBRA 4AWTA 4FX7A 1FWBC 2V63A 1B4EA 3RR4A 2E6YA 1A5AA 3DFSA 1MZHA 2VFGA 4WXYA 4MZ8A 1OG0A 1I6NA 4GUHA 2EBNA 5J04A 3W71A 1ZZMA 3T44A 2PTXA 1UZDA 3ALGA 1HNYA 5AC7A 1OZMA 1KR1A 1N2VA 4HA0A 4HA4A 2OX1A 1B3XA 2XN1A 4E8DA 3W82A 3EOEA 1S1RA 4JTRA 2HMCA 3THUA 4EPBC 2Y7GA 3NFUA 4BR1A 2V5DA 1MFVA 4PCNA 3WL0A 3O7UA 3ABOA 1TRDA 2C15A 1TZ7A 3M5ZA 4I9MA 2INFA 2QPSA 4IUGA 4MGGA 1O1ZA 3AMLA 1RALA 2VGIA 1TR9A 1A5MC 3WQGA 1LOSA 4PRTA 1QI5A 4LEFA 4MJMA 1LWJA 3QRHA 4HQVA 4AX7A 1JFXA 1PKYA 3T8QA 5AHMA 3C8FA 1Q6OA 3U2CA 4J3XA 1FWHC 5LNVA 4ZO9A 3TK7A 1CXEA 3R8RA 3ZVHB 2PTZA 4U5KA 3LYEA 4ATDA 1ZJBA 2YL9A 2QUUA 3UYIA 5AZ0A 1VHNA 3DH7A 4LCQA 2PEVA 1J2BA 4FXSA 4IG2B 1H7NA 1EOKA 4JPGA 2A7PA 2WMHA 3WBWA 2NLIA 2ZA2A 1G94A 3OA5A 3OVGA 1ZRQA 1SJAA 4QXIA 3T0CA 4S3KA 4KWVA 2CFFA 1KM0A 3LBOA 2AMGA 1M1BA 3UPWA 1GTHA 4C65A 3NZRA 3B8DA 4PUEA 1LLOA 1VF8A 3QFWA 4P8VA 5JQ9A 4XKYB 1CGUA 4GE8A 2UBPC 5BYWA 2XU2A 1JYVA 3P7YA 3WL1A 2FZ8A 5D05A 1X6UA 2J7CA 2Z1XA 2VZUA 5ABGA 2I17A 3AICA 4AHOA 1XINA 2ZX5A 4CEXC 4DO7A 1YYAA 4AZCA 2RAGA 2OZ3A 3KBMA 1EBGA 5H8UA 1BFNA 3CZJA 5I3GA 4DO5A 4W5ZA 1OZQA 4TX8A 2WV8A 2E09A 4UFLA 6CGTA 2BXVA 2ZRWA 2H8ZA 3WD4A 3IACA 1F3XA 2WZMA 2A3LA 2WMGA 5C71A 5E70A 4H9YA 1W54A 4JIRA 3O63A 2PCEA 1KCZA 3VD5A 4HNVA 3UCQA 1BRLB 2OG9A 3BLPX 5C9UA 4PMDA 1ESWA 4QNEA 1KTBA 3BLOA 1TO3A 3TWBA 3GZAA 3LEPA 5CBIA 5I3KA 2BY2A 3F4WA 1QW7A 1UUMA 5HMSA 1VH7A 1DJQA 4JN7A 1KTNA 3AHTA 3HQNA 2O9TA 3QMTA 3UEQA 2QUMA 4RJEA 4Q32A 5F1VA 1PAMA 4ES4A 1EP1A 1DPMA 2VC9A 3NM3A 4B2DA 1NWRA 1EKOA 1W0MA 4IHCA 2Z1BA 3W7LA 3POCA 1E6SM 4O54A 4UOQA 4WDWA 1NOUA 1JEZA 4C1NA 3OVPA 3GXTA 4FR6A 4F9DA 4XVEA 3CYJA 3S2MA 2WOQA 3GR7A 1ADOA 3FAXA 3DHUA 1LL7A 3P5ZA 1VFSA 1QHPA 3W2JA 4LWWA 1M01A 1MW2A 4E3TA 1FA2A 4B5SA 3NA8A 4NI3A 1F4HA 1E6NA 4URIA 1JUKA 2PC4A 3LDVA 1E5JA 3QYQA 4ACYA 1W1B1 4GYFA 3T2QA 2GVLA 1CENA 3O05A 4HPJA 4Y9NA 2OJPA 3GYCA 3UCCA 4YN5A 5HWNA 2G3FA 3DGBA 4GUFA 3M5VA 3VMPA 4JYDA 3IRSA 1V3KA 5T9CE 2EPHA 1SPQA 1NQ6A 4L4PA 3H55A 4PTNA 3TFCA 1OABA 3GNOA 3NVDA 3OPSA 1B9BA 4EXAA 2J7DA 3E9AA 3M9YA 1GVOA 2G0WA 2AQWA 2BHZA 1VENA 3WLNA 4DI8A 3ZR4A 3M7SA 1BVZA 1ZENA 5MF5A 1OFAA 1CYGA 1U22A 1LG2A 3P8JA 1GPWA 4I5XA 1XIHA 1ZALA 2EPOA 4BWLA 5LNSA 3BH4A 3WLIA 3MUCA 4OKDA 1M53A 3WK0A 2HK0A 4V2XA 1TELA 3E74A 4GNJA 4CNOA 3MKKA 2VUNA 2E28A 5D37A 4DJED 3KBVA 4H83A 1FWIC 2QAPA 2R14A 4OUEA 1QPNA 3CUJA 5LNWA 3M41A 3T1GA 1ZB5A 3MP4A 5E9AA 1SFSA 3WJZA 2EO7A 1TWSA 3LV5A 3LLDA 2D69A 3S1VA 4JTLA 1KV8A 4IIHA 1GOXA 3H2CA 3T8LA 4XIAA 1GOIA 1AW5A 3BGJA 1FUYA 2AKZA 3PR2A 4PCPA 3SURA 1UWQA 1XISA 4B15A 2ISVA 3IJ9A 3W74A 1THFD 4BJHA 1RY0A 2YCLA 1XYCA 4DRSA 1VPYA 2ZUTA 1CB2A 3TYDA 1H51A 1VPXA 1XFCA 3AMKA 3VMNA 1E1EA 3TWAA 4S23A 2DPEA 2X05A 2R91A 2WK2A 3CQJA 2VC6A 1JZ7A 4KWSA 2O56A 1GVRA 2HBVA 2NZLA 1Q45A 1KQYA 5M03A 3O6CA 1UQYA 3O0KA 1DXFA 3U7VA 1SQ7A 3U4FA 4AZ6A 1RXOB 3HGOA 4QE5A 1YIXA 1DWAM 2J25A 2KZHA 3VIPA 7A3HA 1XBVA 5IOBA 4QJ1A 4P7QA 3TJIA 1QRQA 5EMKA 1W1PA 3PANA 3O1NA 3KOFA 2D73A 2CBIA 4GKTA 2YCKX 3QV8A 4ACZA 1HKVA 3VAVA 3NIYA 2GQAA 1LRNA 2QVHA 4M1BA 4Z1CA 5F1UA 3VNLA 3EMQA 1GOOA 2ACQA 2BVTA 1C91A 1UP2A 3V5FA 3G1RA 1Z44A 3H70A 9XIAA 5ABHA 1ICQA 4O8AA 4JTQA 3A23A 1G69A 1J0YA 4C6IA 3SEPA 4MYXA 3CQ0A 1XS2A 3AYVA 3ITYA 3TAOA 4OV4A 4L4MA 1LP6A 5BU6A 4K2SA 3HPZA 4EWJA 1P0EA 1D3GA 1YTDA 1VJZA 7REQA 4A8IA 4XO7A 3VKDA 3AZSA 4KRZA 2QNEA 1ZJIA 3TIMA 1QOQA 1G4SA 4GNKB 1KFCA 3W0KA 2E4TA 4Q7IA 2E5DA 1JG9A 2ZXDA 1PYFA 2DQXA 3FA5A 4GK8A 3S2JA 1WXZA 4DZAA 1SJBA 3RLUA 2CLHA 5E0CA 3RGTA 3SCOA 2IMRA 3W84A 2V3GA 3CEUA 4ALDA 4Z2JA 2VEKA 3IVSA 2DP3A 3GC4A 1EUNA 2VO5A 1M7OA 1F3EA 3QR0A 1GORA 3KXQA 1UKPA 1UR9A 2CU0A 2E6FA 1PE1A 3OVRA 4IJBA 1GT8A 4UTLA 2XVGA 1J2WA 3A47A 3B0XA 4HNOA 2KX9A 1T5AA 4JKMA 1MYRA 3O16A 3BTNA 1IWBA 2ZUMA 3PHAA 1KRAC 1WAWA 1KFBA 3WLLA 4D1JA 4W93A 4GABA 4J27A 1AQ0A 3M0VA 2ZZ2A 4H04A 2E25A 4AZIA 2JKEA 4LAZA 3S0CA 4AAJA 2WJFA 2FPTA 4AG0A 4Q4SA 2Y89A 4XZ9A 4US5A 5LA2A 2XIJA 3PWIA 3N19B 1X96A 3FOKA 2GOKA 1R2TA 3WYZA 2BZNA 1F3WA 4YMZA 2YXXA 2V2CA 2B0MA 2J79A 3B9NA 4U5IA 5DBTA 5C9WA 2DFAA 3KRZA 3FNDA 1JYXA 2ZWYA 3NSMA 2IKIA 2D2JA 5DMLA 1XLCA 4B90A 1KXHA 4DO6A 4FNRA 2Y62A 3W7PA 1PYMA 1JZ8A 1PS9A 4PMXA 1W1A1 1E6PA 3UJSA 3W6YA 5FJOA 4S39A 3GXNA 3DYMA 1Q85A 3C52A 3EX4A 4GYPC 3LRKA 2NQ9A 1FCQA 3QYSA 1ZP4A 5EMUA 1K8YA 3R10A 4QGCA 2W27A 5C7HA 1BG9A 3CAWA 4ZB5A 5F2LA 3TUUA 3ONCA 1JCXA 3L2IA 1OVDA 5G4HC 3L12A 3N11A 4H7ZA 2IPFA 3G1VA 4P2VA 4IX2A 2E9MA 4F0KA 4US5D 1OCNA 4G1NA 2V0TA 1NOFA 3W1LA 3S2CA 4D71A 3RRXA 3KVKA 3HF3A 3VXGA 1OX5A 3W7QA 2TRSA 3FSUA 3PTMA 5A2AA 4OOZA 4AHPA 1DP0A 1C7TA 7ENLA 5IHRA 3GU9A 3L68A 3VZXA 5K7JA 1RJPA 4F66A 1UA3A 2ABAA 3SCUA 2XIBA 3ARYA 2F7FA 3BLEA 3DUGA 4AY1A 1UWSA 4MIMA 2V38A 3MPGA 4G7EA 1SW0A 2W61A 1OWQA 1T99A 1H62A 2PDNA 3ATYA 3W1TA 5LA0A 1JI2A 2D24A 3OGRA 3CBWA 1Q4NX 4NNCA 2Y61A 1V0MA 3M43A 3PZ9A 3CASA 2VDGA 1B9ZA 2QGYA 2BFGA 3T7VA 2RJGA 2V30A 1H50A 3NM1A 1Q5MA 2WCAA 5K3VA 1K4HA 4O1DA 3N34A 5LIYX 2C7FA 2YDRA 1NDZA 2D20A 5A6AA 1YX1A 3KZPA 1QW9A 1E5NA 1LBMA 1RCQA 1YPXA 3MUY1 4LXFA 4DZ5A 4PUDA 1WE5A 2WLYA 4Q4PA 2ASHA 3UA4A 5CXPA 8RUCA 3B8SA 2V3DA 1YEYA 1SVDA 5REQA 4DI9A 4B5UA 5LIXX 3AUJA 1DQWA 1NWSA 1ADSA 3N2XA 1AH0A 3FJNA 1TIWA 1F05A 4GXPA 4S3CA 1E0VA 3DFNA 4GUIA 4LUTA 4R7JA 5AYZA 1HJVA 3UY7A 3N29A 1XIDA 4RZBA 1C93A 1JCJA 4PULA 3WMBA 4E6MA 5JBDA 2OO0A 3KVLA 3W87A 4U31A 4GBUA 2OEMA 3LCGA 4GY0A 5G2IA 1LWHA 1IR1A 2TMDA 3QR1A 1K03A 1MSSA 4WDTA 4MUPA 2PDJA 1LOQA 4C6DA 3DI1A 1HP4A 2ISDA 1R46A 4WD0A 2YX0A 1C92A 2BHUA 3QBUA 4IP7A 4JKKA 3GTFA 5AHNA 4IJCA 1Q65A 4DBSA 1UB3A 4DM2A 3ERPA 2INZA 4JTDA 1KRBC 3UFYA 1Q7MA 3MUIA 1K9TA 3WH6A 1EQCA 2BVDA 2A3BA 3WDRA 1YXDA 4QSFA 3GAYA 1LUCB 4DBDA 1CB7B 1RA0A 3UA3A 2YXOA 2H9AB 5DRIA 4IP4A 1GOWA 4CQAA 2A4AA 2VM8A 3TXVA 2Z29A 5LHEA 3IUDA 9RUBA 3JZUA 4L80A 3TX9A 3V18A 2E1DA 2WJDA 5A8QA 3QQ1A 5I5RA 4QE4A 4GIEA 4G9PA 2G50A 1RPKA 4MVAA 3RIKA 1I0DA 4GCAA 3TYEA 4GQQA 2HXUA 2VL4A 4JQ3A 4QP0A 5CSSA 1P1XA 4L9YA 5DQPA 5HDRA 1YRRA 4M5PA 1IHIA 2Z27A 3RK8A 3LXAA 1IZKA 1R3SA 5EGRA 3QKZA 5I6SA 1WYIA 1J12A 2J7GA 3V4BA 3GK0A 1BXNA 2HV5A 3MDUA 3QH2A 4Q4KA 1KM5A 4DAFA 1F6YA 3TA6A 9XIMA 3T9PA 4H19A 3RM9A 1AQMA 3HA1A 2ISFA 3VVGA 2PWVA 1EC8A 4Q8WA 4HIBA 4IPLA 3EWXA 3B06A 5FJPA 3LN3A 1XYFA 3BMWA 1TPH1 5I3FA 1G1YA 2VTFA 5EFFA 2CLOA 1ZBWA 1H7RA 4JDYA 4F48A 2W3ZA 2D3NA 1H7PA 2PMQA 2EKGA 4GG9A 3DIPA 3G24A 2G96A 1JCTA 1XP3A 4BZYA 2QUTA 4XBKA 3SN4A 4AEEA 3UPMA 1K7FA 4QJ4B 2PDYA 3NPXA 1R3TA 4P8UA 1REQA 3F1QA 5D32A 1A5KC 2BDQA 2WVVA 2E9BA 1X39A 2VFHA 3WN6A 4KERA 1CGXA 3GS6A 3LV6A 1XDLA 4PFHA 1E3XA 4FLSA 2XVLA 3LGGA 4JL2A 2WJZA 1W9PA 1B3ZA 4CQ8A 4LT9A 1XLKA 1VJSA 4O16A 3AYRA 1OX6A 3K5XA 2PC8A 1QJWA 4EWND 2QCHA 3PTQA 3RFAA 5B7YA 1ISWA 2FIQA 1FKXA 3NQDA 2ZX6A 1K6AA 1V79A 1KLYA 1RVKA 4LU0A 1VGAA 3PZVA 3AROA 2HS8A 3BLLA 4W88A 2EPKX 4A35A 1P48A 1Q2RA 3VGBA 1UBSA 3A9BA 2PU0A 4TO8A 1XLBA 4MNJA 3U9IA 3BAJA 1SGJA 3TEVA 3K4WA 1GJPA 1UYQA 3VGDA 4QQUA 2ZICA 2EPMX 2CXGA 2V2DA 2Z28A 4J3VA 2RGMA 3QZ6A 3IS4A 1CGYA 3EB4A 2IUZA 5AC8A 1WXJA 2DSVA 3IK2A 3URNA 3WH7A 3QGKC 4PB5A 2V5KA 4AX6A 3C2FA 1UKTA 4HA1A 5JU6A 3NPUA 1QUMA 2DZWA 1XGZA 2FZ9A 2ZBTA 1W9XA 2IXUA 3V7PA 3WF1A 1JDAA 2C71A 3N2TA 3I4EA 4ERAA 4FOKA 4NUWA 2HJPA 4N7QA 5A8NA 2HVOA 4XISA 2PP3A 3E5PA 1GQLA 1T96A 3RLHA 1R7AA 2GQ9A 4LBSA 3QV9A 2G4FA 1E6QM 1AW1A 3PB2A 3W6MA 3WSUA 1TIMA 3TU9A 1E0UA 3D46A 3WH5A 4ILSA 1TV7A 2NV9A 1TTIA 4JX4A 3FCPA 4PUKA 3M6DA 4YVVA 2FFIA 1V7AA 3LPPA 4GZEA 3TJXA 4YIWA 1RK6A 4ASTA 5AYBA 2VQUA 5LXEA 2GZXA 1W56A 4U2ZA 3ANYA 1T8QA 4XD4A 4W8LA 2B7OA 4NJIA 2V68A 1WZAA 1VPQA 3SUWA 3SY5A 2HNEA 4HHLA 4MPQA 1OFQA 3VMOA 2YLLA 3GY1A 2C16A 2J47A 2WC4A 3PTDA 4G8TA 1OX4A 3V35A 1DTNA 2ISWA 1JPMA 3SUSA 1FHUA 2GJNA 1IT0A 1EIBA 4NZ5A 1NELA 2Y8UA 3C0QA 3GTHA 4UR7A 3M0XA 3IUIA 3S9YA 3RILA 2Q01A 5D2TA 1K8CA 3S5ZA 4JQ2A 4M6UA 4QROA 4QDMA 4MFEA 3A5FA 5F7UA 5TAOA 2AOSA 4R7OA 4D1IA 3RPMA 4UOZA 2XN0A 2Y70A 1GK8A 2PI6A 2I5QA 2C0AA 4LAKA 2AL1A 3GQYA 4REQB 3BJTA 2PWFA 5A95A 4JN8A 1X1NA 4CCCA 4K1WA 4GVHA 2XISA 2UZ9A 4JTAA 1CPUA 3UW6A 2Y5JA 1PHWA 1FXPA 4EPKA 2PDCA 4YVPA 4IMGA 2FGBA 2WYSA 3NL3A 4LF2A 5CLWA 3N2BA 3QOMA 4JFWA 2AQOA 3EMZA 5JIWA 4PMJA 2NQJA 2PDGA 3E0VA 4W87A 2J24A 3NL2A 1UG6A 1PCKA 3KUMA 4RNHA 3S8HA 3EDJA 1D3HA 2NXIA 4D6EA 3HJEA 4AB4A 4JTGA 3BGGA 5BXPA 1YXCA 4UFKA 1E56A 1ODUA 2QV5A 4B3LA 4HHMA 2QR6A 5U7SA 3ITLA 3OIXA 4NZ4A 2RJHA 3B9AA 4JIQA 3L4ZA 4BWLC 3T05A 3H22A 1EX1A 4X9YA 3QLDA 2ZIDA 1FHVA 2PP1A 2J75A 3KWXA 3BE7A 1PCWA 4EAMA 3QPZA 1LJYA 3EWBX 1H5YA 4UMBA 4X2RA 4WDUA 4Y9MA 1WCGA 1A47A 1LYXA 3CIWA 3S47A 5FOOA 3WF3A 4W7UA 5CJ5A 3PY2A 1FWWA 3MCOA 3QGAC 4GNVA 2J8TA 4XD6A 1U1JA 4UFHA 8CGTA 1NDVA 3OBAA 1MXDA 1BTCA 1M65A 3WNMA 1XCWA 3ITXA 1A5BA 5IRPA 2OT0A 4XO6A 1GOQA 1KM2A 3SIMA 4RZ6A 1SYTA 4KETA 1OIFA 3B0UX 1PIFA 2CLKA 2DH2A 3FYOA 1WDSA 1W2PA 1XBYA 4R9OA 3WNLA 2RUSA 3UXIA 4TVCA 3ITGA 4KQNA 2XFFA 5CPLA 1B90A 3CO8A 2QW5A 3OG3A 1UPMB 4O17A 3V75A 5BXRA 2A79A 3PG9A 1CGTA 2QLYA 2W66A 1J9YA 4MKSA 4QSHA 5DXXA 1N8IA 1ODZA 3LRMA 4WK9A 3NQFA 4JGDA 2GQ3A 3E2VA 2CKSA 1EF2A 4C6QA 1ITQA 4GQRA 4GCXA 1FWJC 4Q4QA 1EPXA 5GJNA 4IPJA 3PVFA 3W07A 3VCNA 3SQSA 2GWNA 1M7XA 2ACSA 2PF8A 1DORA 4NP7A 3GHTA 2V2HA 1EUAA 1VAHA 4XZWA 2WLZA 4XZIA 4JTCA 5GPRA 2BHYA 4PMRA 1OC7A 4JFSA 4ZXLA 1Z69A 3OIHA 2ZADA 2OWCA 3K30A 2G3JA 1POJA 2VHLA 4XKMA 3R8GA 1P7TA 4OIFA 2ZFAA 3UXKA 4ZQOA 1KM3A 3STPA 2I1OA 6XIAA 1G7VA 4WEVX 1H7OA 3NVTA 1LZOA 5DCBA 2POZA 4D8ZA 1GVIA 3EDEA 3GFXA 5HNNA 2VRQA 3ZVIA 3C3UA 5I79A 4L6OA 3K46A 2F6KA 4GUJA 4UUIA 4JTIA 1R38A 1G7UA 3UR2A 4IFKB 5M1TA 3U2OA 3KOXA 4ENLA 2YDAA 3CB8A 1Q8JA 1VCGA 2D23A 4Y9PA 3T07A 4PZVA 5BXSA 1VR6A 1OGGA 1A5OC 2GYIA 4DYEA 5HOSA 3TW9A 1MUWA 1VJIA 1LROA 5HJYA 2Y5SA 1I2NA 4PTXA 1D2KA 1S38A 3CMGA 2GSEA 4C1LA 2OQLA 4PUUA 3A22A 3V5CA 2DZAA 1NM9A 5HANA 2HPMA 1KCXA 2VCAA 1V3HA 4R27A 5A6MA 3GUGA 1HJXA 2O4MA 1JDDA 3A21A 4V1XA 3W28A 4L1WA 2QCDB 3MP5A 2O7SA 3CV1A 3UGRA 5CAKA 1RBLA 3WD1A 4NVTA 4L7ZA 5AVHA 3NQGA 3S42A 1EA0A 1E1CB 1F5ZA 2YZRA 4PTWA 3NPWA 4ZL1A 4PMUA 1DOSA 2ZUUA 4K8EA 2YXGA 1ME7A 3LNPA 1MQQA 4JCLA 5G5IA 2BSLA 2VGFA 3C2VA 4HCLA 2WM0A 3C2OA 1A5CA 1KXTA 3G3DA 3PM6A 1QK0A 4IMEA 2WWDA 4O1AA 1Q6RA 1R9YA 1OFOA 3I10A 1ZBCA 1UIOA 1W9DM 4AXKA 3TVAA 4XAZA 2WC3A 4FA3A 2PDQA 2NQHA 5C5YA 2GVYA 3VZZA 3VDHA 5LNRA 5D09A 1XICA 3IJ6A 4AZBA 2PGRA 4NZJA 2VFDA 1US3A 3CZGA 1E9ZB 1GOKA 2YL8A 2PURA 1MDLA 1QCWA 5A5WA 4C90A 1CXKA 4JTUA 1AJ2A 4CQDA 3PP7A 4EXQA 3XINA 2JQXA 4C6LA 3TTQA 3HURA 1OCQA 4RV3A 3OW1A 2CWXA 1SO3A 1UZ4A 1UIPA 4JR5A 3SSJA 2GK1B 4A3QA 3SZ8A 4HSHA 3BJFA 1BSLA 4FX6M 2DIEA 3ARPA 2WJEA 4LS2A 2DY3A 2VD9A 2OQYA 3BARA 1TCDA 1XRTA 3FGCB 4JNZA 4UR8A 3NWRA 3VFCA 4NI8A 3UZXA 3VKCA 2PWDA 5CZSA 2AAMA 1UC4A 3DZ1A 4HN8A 4HOXA 4L5ZA 2AMXA 4O0ZA 4F0RA 1PHQA 3ZXWA 1MW0A 3UWZA 4EIVA 4RW5A 4QJ5B 1BYDA 3M5XA 3KRUA 3NAVA 3TROA 3WNNA 1BHGA 4B9ZA 1QNOA 1NF0A 1NFPA 3ARVA 3LRLA 2ZXBA 2PU1A 4HHPA 4N2YA 4KCWA 2DJLA 2WPGA 3PPHA 3W7KA 1VEMA 1YTEA 5IHSA 4BF9A 3MO7A 4OU1A 4HSOA 1EP2A 2ZC8A 2IS7A 2PWEA 3W7HA 1XYAA 3UJFA 2XVPA 4BEUA 3Q67A 4JTKA 2XINA 1XG3A 1TREA 1LLWA 3AS3A 3BOFA 5ABTA 2GVGA 1W5PA 3TN4A 3VA8A 2C1IA 4LAUA 4GMEA 5CGTA 3UJEA 1G67A 3HQ1A 1BVNP 1JJKA 4YTUA 1EPVA 4OVXA 3DG7A 1X1ZA 3RX4A 4UTUA 2NX9A 1GQNA 2VD8A 3GDTA 1QASA 3AI0A 2E5CA 4DBWA 1ZBKA 5FF7A 5A8PA 4OOUA 4N9DA 5A8OA 3FLUA 3VOCA 3B05A 4P8WA 1PO9A 4E2OA 2BLEA 2IKJA 3MKVA 3AXIA 3S2NA 3QZAA 3C2YA 2ZCGA 4E2DA 1SSGA 4M7TA 1BVWA 1TJRA 5HBFA 1V3IA 2GUBA 4MY1A 1Y0EA 1XH0A 4OQVA 3V36A 1XSIA 1JI1A 3LLFA 4O4VA 2W91A 4FK9A 3PZTA 4Q7BA 3D3FA 4CVUA 3L0KA 3S83A 4AF0A 3TR2A 1J10A 3MO4A 1US0A 3VOJA 2JEQA 3R58A 4MSSA 3N15A 3NQVA 2IKHA 1M6JA 3DXIA 3LTYA 4GZ7A 4BI6A 1V77A 3ANUA 1UH3A 2C18A 3DBNA 3I6RA 2Y7DA 3LMYA 3CS2A 4WUIA 2CCRA 2WVSA 3GB6A 1FFQA 3MHFA 3OOQA 3NGJA 2DU2A 1W1VA 2VKZG 4HZ6A 3LHTA 3KVJA 1TPB1 1OC6A 1PBGA 3WFAA 3URAA 2G3NA 3WQVA 1GZGA 4L6DA 1LTDA 1XR2A 1TVLA 1XRSA 2VEPA 1JDEA 2DZVA 4J9JA 1TPWA 1XYBA 3GFYA 2ANUA 3HPFA 4YPJA 3APYA 3ZJKA 1S2AA 1ONWA 2YB1A 2YIHA 2PFHA 3W00A 3WQ8A 1MXGA 1I45A 2P8BA 3N3TA 4Q8TA 4UBPC 1Y65A 5LGZA 1DBTA 3JS3A 2J6VA 1WKEA 4HD5A 3GSMA 3B4UA 2ABBA 4QJ3B 4J3SA 4Z1YA 4Y8FA 2NUYA 4AYSA 3MCMA 2BB0A 3VDAA 4ZQNA 5EMMA 3DENA 4B9YA 3QY6A 2WMFA 4X0NA 3P82A 3QQWA 4JL1A 4I7VA 5AC5A 4NZ1A 4GI9A 3TAKA 2DVXA 1SO6A 2WAGA 2BXYA 2C79A 2ZRXA 1G9HA 1XQKA 1V3JA 3WQ5A 3GE7A 1PZ2A 2JF7A 5F2IA 2I5IA 3TNBA 3EWZA 3WNKA 1F74A 3U4AA 3CV7A 5CC3A 5ECUA 3PJUA 4LVAA 1W1YA 3STGA 3MSYA 5A6KA 2Z25A 4HSNA 3TOYA 1ITUA 1TJ1A 2RHGA 3N9SA 1E4MM 5LGXA 1ONEA 4UQAA 2QJJA 5ABFB 2Z6IA 3ZMRA 5T26A 2HS6A 3UNTA 4NU7A 4KESA 1AJ0A 4H3DA 2Y0FA 4CQ9A 2OLSA 1Q13A 4GHRA 4XBSA 2QF7A 2VCCA 2IXVA 1NIUA 1ZPTA 4JQ4A 2ZRYA 3BURA 2FHFA 4PBGA 2VOTA 2PUZA 1HGWA 3QY8A 3WQCA 2P5NA 2F8QA 3U0HA 2A6NA 3VKAA 1P0DA 1QPQA 2FPYA 2V6AA 3AWOA 5KZ6A 5AC6A 4JQAA 1H41A 1ICPA 4HVXA 2XGBA 3AXHA 3SB0A 3W38A 3KCOA 1OFRA 2PDMA 4E5TA 2HVNA 4KS0A 3H2EA 1GHSA 3H24A 3E1F1 4UQDA 5G1TA 4LC8A 4B92A 3PUOA 3WD0A 4PE8A 2X7WA 1EC7A 1FWCC 3MJYA 1RUSA 2INEA 4Z1DA 4JAWA 5LYRA 3MY9A 1SSDA 2RDWA 4PN2A 1UUQA 1W17A 4UZUA 4IP5A 4E0CA 2NVDA 3G0SA 4C5ZA 4Q8NA 4TMBA 3OYZA 1OINA 1SO5A 1KXVA 3GH7A 3PF3A 1EO5A 2WPBA 6XIMA 5E6ZA 4C6CA 4GWEA 2ZZ1A 1X7IA 4KH2A 1ZAIA 2I5GA 2FYMA 1IEXA 4ZB0A 2WBGA 3G1XA 3LHZA 3QN3A 1XG4A 3WEOA 4BQ5A 1AUSL 3AIBA 3NQ2A 4DPPA 4O52A 4JYFA 3VGGA 3PG8A 1U5VA 3TYUA 2YL5A 1JXKA 3TSDA 4AD3A 2PCQA 2VFEA 4HNTA 2DEPA 4HU3A 2LLEA 1UH4A 1VFFA 2PD9A 1EEPA 3ARRA 5DT7A 1MEHA 2QDDA 1ZQ5A 3A3WA 1F6KA 3W24A 7TIMA 5C9RA 2OWXA 1I2PA 2WQPA 2J8FA 4ZFCA 3ZJ8A 1BXBA 2DT2A 3U3HA 4KWUA 1EX5A 3VIJA 6ENLA 3WELA 1TTQA 2YA2A 3ARWA 1CI1A 3EAUA 4F9JA 4IUOA 3KS6A 4CCEA 3K1GA 4DWSB 2QMKA 4U4MA 3U2ZA 5AB3A 2FZNA 4K38A 5LNUA 1WDDA 5KEZA 1HVQA 3GIQA 3B8VA 1V4YA 6REQB 7XIMA 1RBAA 1RY8A 4EAYA 2JGYA 3PAOA 2PGWA 4XSMA 4YYCA 1JUBA 4HT3A 1UMYA 1UH2A 3DFHA 4MUZA 1XD1A 3RCYA 1B3VA 2ZOXA 2YPIA 2CC0A 2W63A 3W72A 4D8LA 3WG6A 2C13A 1F61A 2HQAA 3IIXA 1A49A 2O9PA 3CUZA 1S2VA 1YADA 4JCMA 1ZY9A 4XB3A 1I2OA 1JNDA 4PUNA 2NWSA 4X22A 5XINA 4X60A 4NXSA 3VZYA 5LIWX 2V81A 4C7DA 5AHFA 1H1ZA 3G1YA 5D8WA 1ZHAA 4O0QA 4NYUA 1T6MA 4D6HA 3TXZA 3VIOA 4DN1A 1PJ9A 4XAGA 4C7FA 5KTLA 4F2TA 1FFRA 3GG1A 4YS1A 2FHCA 3RJXA 4I9TA 2V9DA 2WHMA 3UVIA 1YE6A 3G6LA 2P88A 3WLKX 4NIRA 1GEHA 3O15A 1DJNA 2C91A 1R5YA 2E6DA 1L2QA 1EJSC 2CETA 3L9CA 4FMVA 2QIWA 3IJIA 3MQTA 4GVFA 1TA3B 4MLRA 2Q3OA 3MMTA 3PZOA 3PPCA 2R6OA 4PA8A 1H2JA 4XZMX 1EJTC 1MNZA 2CLPA 5EYWA 1LDCA 1YHTA 1V93A 3WDHA 1XIJA 2YBVA 1OD0A 4EP8C 3CUFA 4UCFA 1BQGA 2HPIA 5KITA 3WH9A 4Q4RA 2RDXA 1XLMA 1UKQA 3DCPA 5TF0A 2CLLA 1D9EA 2A3HA 4L9XA 4NX0A 3SRFA 1ISVA 1E4IA 3OU8A 4PMYA 3BZGA 1S2UA 1KTCA 4GX9A 4XZHA 3R11A 1HZYA 3EYPA 4K37A 1E0WA 3SM0A 2PTDA 1BF2A 3AALA 1QPRA 3BJSA 2AL2B 4Q7NA 1TV3A 3W2KA 1H61A 3NL5A 2QIIA 1RA5A 2VZVA 2QDEA 1CWYA 1C8XA 2Q71A 4YTTA 4LF1A 3TYZA 4DJFA 4O15A 3PUDA 3W85A 2CZFA 1XRVA 2WKGA 3GHRA 3N17A 3WJYA 1AD4A 4V33A 3I7RA 4QTGA 3WBEA 1S2TA 2Y88A 2AKMA 5CSRA 2YA1A 3NEVA 5DT5A 2QS8A 1XJBA 1SM9A 2BOEX 3B8IA 4JICA 4D6JA 1XLFA 1MEWA 1GONA 2XFYA 4PMVA 4J7RA 3TKFA 1OYAA 2Z26A 2XH4A 4GISA 5ENLA 3QTPA 3M1ZA 4R34A 4LPCA 1HIZA 3UESA 4C6OA 2X40A 1EXBA 1SFJA 1ALDA 1VCFA 1ITXA 4IQLA 4NNBA 4YHEA 4O8RA 3SCPA 1HJSA 1PB0A 2Q02A 1KM1A 2BGQA 1AMYA 1BTMA 1FDYA 2DZSA 5BWFA 1L8PA 3LZ3A 3AHYA 1FP8A 3W7IA 1G0CA 2ZX8A 2GPTA 2OSWA 4S2BA 1P43A 4LH8A 4PCTA 4BQ4A 4GACA 1LBFA 4Q33A 4PCFA 5K9XA 4QBXA 1DWGM 3OHIA 1JYNA 1SR9A 1QHZA 2QCNA 3FEQA 1V02E 4CN1A 3COTA 1HKJA 5FIPA 2GGJA 3WQ6A 1VFUA 2VEFA 2W5FA 2PWHA 4WOZA 3FA3A 1XYMA 5C2GA 4F8XA 4LC6A 1E9IA 1E0TA 3SW6A 1E51A 3UZJA 4H8HA 2NQZA 5CPTA 1W9VA 5I23A 4TQTA 2ICSA 2ZZ5A 5D02A 1TPEA 5T91A 4YLWA 3R0DA 3PSWA 1JPIA 1PZ3A 2YCEA 1PEZA 2A7RA 5HJLA 2QHAA 3IV3A 3AJXA 2O4QA 3W7GA 2Y7FA 4A22A 4GX8A 3CL8A 2FHBA 5AKQA 3CUHA 3R8HA 2E67A 5GJPA 3SAZA 2Y6ZA 2QUVA 3HG5A 3I3BA 2WB5A 3BGAA 1QMLA 3W4RA 3PZNA 1BWVA 4IMDA 1HO1A 3M0MA 3WQDA 1I9CB 3ABRA 2PBGA 3USBA 3AXXA 4O12A 4Y7EA 3BLFA 4DUOA 4ZMGA 4GVIA 1W3LA 2QKFA 3ZWTA 1KCLA 1FWFC 1WDPA 3CJPA 1PX4A 2XFWA 3RN6A 4H41A 3HV9A 3EB3A 1GYMA 1J5SA 1L2UA 5CZTA 1VLWA 3K4AA 2W92A 3BG3A 3DG6A 3MB9A 3BXWA 1XKYA 4PODA 3IEBA 1HVXA 1H5VA 2A3CA 4CN6A 3I6TA 3SECA 1IR2A 5HNUA 3NDOA 2WMIB 3YPIA 2OLAA 3IWPA 4X61A 2ZX9A 3G1SA 1MQRA 4JZ5A 1X8CA 3NZPA 3H6OA 3FN9A 1ZGDA 3HV8A 4LUSB 5K4XA 2XH7A 1QI4A 1QXLA 3VDCA 4O1FA 5HMEA 1HJWA 4TU1A 1V6TA 5I09A 4FALA 1CLKA 2VI0A 3FK4A 2QCLA 5J5DA 3S1XA 1U2YA 2PDXA 1L6FA 3WFLA 4ZXOA 3H2MA 2V69A 4F2UA 1LG1A 1VC4A 3UR8A 1LQ2A 4O11A 3INPA 4IOTA 2F38A 3T81A 4TMCA 1E15A 4EPDC 1X38A 1RAKA 2XIMA 1KFJA 4UMAA 3ZO9A 2ZTJA 4ZQMA 2PODA 1U1HA 4HCDA 3PWAA 3R12A 1Y7VA 3F5LA 3GVGA 1E72M 2YW4A 1G4TA 5TD4A 1V6YA 3TC6A 3E49A 4A29A 3FIGA 2DUZA 2ZE3A 4PYSA 2EPLX 1Z42A 1HT6A 6ALDA 4G5DA 2O9RA 2NV1A 1UZHA 5BNKA 4DM1A 4ML9A 3QPYA 3BWWA 2OOFA 2E9LA 3WIJA 4MMWA 4NL1A 3A12A 3KP1A 2BOGX 5D9OA 3M0HA 2YYUA 1S2WA 3PTKA 3A4AA 1K1DA 3K8LA 3OZOA 4AD0A 2B4GA 2E7FA 4P5UA 4JS3A 3V1PA 2QCMA 2PB1A 1RPXA 3CNYA 4W89A 5CJNA 2HK1A 2TPSA 2MNRA 2GLKA 1ZAJA 2PZ0A 4DNHA 1J93A 2Y1HA 3TTOA 3ZWSA 2DIKA 3NZGA 2G3IA 3PJTA 3QEZA 3CMFA 2PDIA 3M46A 3PJXA 3V0UA 2HRWA 1QI3A 3OZMA 1MUCA 3AHZA 2Z1KA 3B03A 1ECEA 4M24A 2R1LA 5BOFA 4PFMA 2G4JA 1S39A 1FVPA 4HB7A 2ACUA 1MNSA 1BF6A 2BNJA 7PTDA 5C2XA 4K8GA 3BV7A 3LGDA 1FWGC 5FSEC 3UWUA 4B3KA 1DHPA 1D8CA 2D2OA 2XSAA 4C1KA 2Z1WA 3BV4A 7TAAA 1HXJA 1R9XA 2Q8ZA 3G6MA 1X7FA 2HVMA 1NJJA 3VX1A 2X1RA 1I8JA 1H7XA 3PZUA 2OZ0A 1GWJA 1RLCL 1Q6DA 4DZHA 3O6YX 2QJMA 4NAEA 4FOJA 3GTIA 3UZZA 3W88A 4ZBCA 1CBGA 4QS6A 1AK5A 2BWGA 3FJ6A 3LCLA 3R7MA 1BPLB 2D0FA 1HW6A 3PBVA 2Q8XA 1KO0A 2ON3A 4MWAE 1YBQA 3F03K 4MNLA 3P80A 1N7KA 3OYXA 4WJXA 3GH4A 1RQBA 4CNTA 5M17A 3W7NA 2R94A 4M0XA 3H54A 4ONVA 4YTQA 3CWNA 4PB4A 3ECQA 4KGLA 1IXOA 3C0JA 3ZR6A 1XQLA 2GVEA 2W9MA 1U83A 1F6PA 3IIOA 1XLLA 3P62A 4PC8A 4QCFA 4N02A 3GU1A 4X3ZA 4DWSD 3T0DA 4IPIA 4XV0A 1V0NA 4IXXA 3URQA 3ITCA 5D2WA 3CT7A 1LRQA 1DE6A 1V02A 3MKCA 4MNKA 4RUBA 3VGHA 1UD8A 3U57A 4AXNA 4M80A 4L9ZA 1O66A 1J6PA 4KWOA 3AUOA 4NAFB 2J8GA 1EYWA 2KAUC 4XAFA 3MMUA 4NY2A 3R0UA 1MW1A 3DU0A 1DEDA 5HR6A 3RMJA 4FIQA 1POKA 1UW9A 4PTMA 4XZLX 2QT3A 2DORA 3D47A 2Z2BA 4UC5A 3HPAA 3SFWA 4A4AA 3W1AA 1SW7A 4A6GA 1XIMA 3C8NA 1DKWA 2C3ZA 4A3YA 1VHCA 3RO8A 3AU2A 1H0GA 4H7CA 3PN8A 2C1GA 3BUVA 3UR7A 2CHRA 2OU4A 1ZJHA 4Y90A 4BY3A 5CJMA 2I57A 4YTSA 1TV5A 1Q2SA 4W4QA 3S1UA 3W7MA 1FWTA 3R13A 4C5YA 1A0DA 2PSNA 3G1DA 2VJXA 3XISA 2BG5A 3TONA 1OJXA 1V7YA 3QKEA 5J8LA 1BXCA 4GC3A 2PPGA 5A6BD 3W01A 4IH3A 3BC9A 3RXZA 3EX6A 1KFWA 4BI5A 3EA3A 2WZEA 4C7GA 1PKMA 2CPUA 4IF2A 1F73A 2WHJA 3UERA 3L67A 3BAWA 3N13A 2NX1A 4DWDA 4K7VA 2EG6A 3ITOA 3DYPA 1KW1A 1DJYA 1VQTA 4ZZ9A 1XPYA 1EZ2A 2OO6A 3BW4A 5CPMA 3WLOA 1XLIA 3L5LA 1XLDA 5C7VA 3R89A 4U10A 2XVKA 3UJ2A 3E2RA 5BXTA 4AD2A 3H2AA 4EACA 2EHHA 3ZLGA 2X09A 3BLKA 3OGSA 1EWDA 3WFZA 4H8UA 3GW3A 3W1QA 1GPFA 4HTYA 1IYXA 3MBDA 4RZ4A 4AISA 1XIIA 1LBLA 3TZFA 2XGZA 2J27A 3CV2A 2PDPA 1C29A 3DI0A 1H1YA 1Q63A 1ZBVA 2P1FA 4ATWA 4C6EA 3VIGA 1IIGA 3IRDA 3EOOA 4XD5A 3BQ6A 4YCPA 3RPDA 3MHGA 4F0SA 2HBXA 2G37A 1Q6QA 2YDSA 3I4KA 2XSBA 3KTSA 4HA3A 3VCCA 5E9XA 2RGLA 1QATA 1UCWA 4I6KA 1HUVA 2UY5A 5JMUA 3H53A 4S3FA 4GFSA 2FH6A 4AW7A 2FMNA 1W3IA 1TWIA 4K39A 1S5VA 4H9UA 1X6NA 4PTVA 1NQKA 1OF6A 5CZ0A 1A5LC 4U2YA 1IF2A 4I5RA 1HGYA 4PCSA 2IW0A 3CUXA 4PEEA 4KCTA 4D6IA 3CWOX 3KBWA 3DAQA 3ZT7A 2V67A 1NDWA 1XC6A 3BLDA 3QOKA 1E3ZA 1K9FA 3N18A 4Q8UA 1TMHA 5DANA 1JXJA 3R43A 5I06A 3W1XA 3JR2A 4MY9A 4P7NA 4E38A 3EWWA 4DBEA 4ZGYA 4K8HA 4MPKA 2EG8A 4O0KA 4YHGA 1PKLA 3BO9A 1H4PA 2GL5A 2FJUB 3REQA 1PUDA 3JRKA 1LF1A 1OG6A 3SO7A 3VKBA 4AIBA 4FXFA 3SRKA 3W7CA 1W1TA 2NQ5A 5XIAA 2HE8A 3AOFA 1R3WA 2ACRA 3GFZA 3LPGA 1RD5A 3EDDA 3AAMA 3ITTA 4JTFA 1UPPA 1D7KA 3F4NA 4N6EA 3RU8X 4DJEA 4Q8MA 1M3UA 2AQVA 2PS2A 1XGDA 2WHLA 3C0LA 3NQAA 1PX3A 3QHNA 3BICA 4PSPA 1P0KA 1R8LA 3BAKA 3IJ8A 4C91A 5LXXA 1KFKA 5FACA 3ZSSA 1ZU8A 3MYPA 4JFUA 3WLPA 4IX0A 3EGJA 1GVQA 3PS7A 4ZA0A 4IPNB 1GEQA 1TUXA 1UP3A 5CLTA 4B4HA 3L4TA 4FR1A 4GIAA 1W3KA 5FESA 1UWRA 1TV4A 2WW5A 4HPNA 3DHPA 4Y96A 5HXMA 1IXPA 4BK9A 4POCA 4DPQA 3L7RA 4J3ZA 1PV8A 1W3JA 2NVAA 4AQLA 4MWAA 1R30A 3OLIA 4HPXA 4B5WA 1IEQA 3HM7A 3VNJA 1OFBA 5MKGB 1JZ3A 4QNWA 3SCRA 4WIWA 3GDBA 3NQMA 2B31A 3W2LA 2XG9A 1VFLA 3N6JA 4NJHA 4PSRA 2E5BA 2G95A 1ZJAA 5K4ZA 2WZTA 1SW3A 3GVRA 5KETA 3TN5A 4AY7A 2QF8A 1MUMA 5F2MA 3B8UA 1NVMA 4A8NA 4P7OA 4MADA 1OF8A 4IM4A 3BLIA 2GJXA 4KWWA 3LPFA 4YCOA 3WDPP 2OELA 3LX9A 2OTDA 2OYMA 5T9BG 1BWLA 1ME9A 5D2XA 4H6EA 4N9EA 4UTWA 1EP3A 3DESA 1D3CA 3I7QA 3SIZA 5HINA 1QI0A 4NZCA 3BQ5A 3GZ3A 1VFHA 2O55A 1VBRA 2C19A 3GWQA 5A69A 3MHUA 3R4IA 1FP9A 4I9AA 2QMJA 2CNCA 1XDJA 4MWAD 5U4NA 3TV8A 3CL6A 4WY0A 4UTTA 2WSYA 1X6LA 3I3EA 1IGWA 4H6QA 3CH0A 2PDWA 4WSJA 2VR2A 5D30A 2JFEX 3TSBA 1AL7A 3G5EA 3BSHA 3L5AA 3ZT6A 2W62A 3M0JA 4UTIA 4INFA 3ZIZA 4OFCA 4N42A 1JAEA 2GUYA 3D5HA 1TPUA 5H8MA 1GVYA 2VVNA 1ISXA 4KF1A 3IGUA 1E6RA 4TV6A 3SI9A 3L5MA 5HQMA 4HNNA 2UV8G 4LCRA 3IGXA 3NQ8A 1HP5A 3GHSA 5KSWA 3DDMA 5D9PA 1VD6A 3QZEA 1XIBA 1E55A 3W1NA 1JZ4A 4E8CA 2VDHA 5M2FX 4WQ6A 2PGEA 2DQWA 3VU2A 1J0HA 1WP6A 5A6JA 3SQMA 5EMJA 1QWGA 1TPC1 2XZ7A 3RAOA 1UOKA 1CXHA 1F3TA 3BAXA 4JOMA 1W1ZA 4LS1A 3UG8A 4EXBA 3WCZA 1TWZA 4NNAA 1JZ5A 4ZSUA 3GTNA 5JH1A 5DN1A 4B3ZA 5IM51 3M5YA 1CGVA 1EH9A 1IEIA 1XBXA 3VGFA 3GW0A 2YA0A 5FL0A 4LUJA 2FZDA 2FVKA 2WCGA 5CH9A 3V1HA 4NASA 4S3DA 2REQB 4A8LA 3LB0A 4FLOA 4CCZA 2ALDA 3P84A 1VBJA 3TTSA 1ZP3A 2ZA1A 4GO9A 4CVWA 4Z08A 3KX6A 4ZO7A 3ZLHA 5DELA 5I03A 4KPLA 4Q6XA 4R9XA 2IPWA 3I7SA 3UNDA 2DGAA 3K4DA 5FA5A 1EL3A 4Q22A 1NDYA 1FCBA 3BAYA 4H7VA 2FFCA 4UQ9A 3CLWA 3FHQA 3FW6A 3L66A 5CPSA 4LRSA 1Y5WA 2NQLA 3WLTA 1DE5A 3OA3A 3AZRA 4FLQA 1IWPA 1NTHA 1XLGA 4RK8A 4DJFC 4AUBA 1TVPA 2VEMA 2O0TA 5AHEA 5FJJA 3LBCA 4P61A 3CO4A 4TX6A 4PUMA 1O12A 4LNYA 3TP4A 1OGBA 1KD0A 4PEKA 4Q8QA 1U5HA 1E71M 3GC2A 2VC5A 1HKIA 1GW9A 1VKFA 3SUTA 3G1FA 3NR0A 4NJGA 3WMCA 3JZEA 5F2GA 3W75A 1CZ1A 1P4CA 4K1GA 3WK2A 3ARQA 3ZVHA 1HJQA 1IIHA 2XUCA 4D6DA 3CC1A 5G1MA 5D33A 4M19A 1Z7AA 1OBAA 3U48A 1IZCA 1V0LA 1C8QA 4MJ4A 2FTWA 3GNRA 2VGBA 3BDKA 5D03A 4GZIA 3A64A 3AIWA 1K7XA 2Y4SA 4IG2A 1H49A 2J7EA 1GJUA 1DIEA 2OPJA 3UF9A 4M6VA 3RNDA 2QJGA 2CZEA 3GXIA 3UD6A 4QISA 1BQCA 1E70M 3E6EA 4ZSTA 3QF0A 4GFIA 3NYDA 3GRIA 5HMFA 3E0WA 1HL9A 3W3OA 3VUSA