3C3NA

Crystal structure of dihydroorotate dehydrogenase from trypanosoma cruzi strain y
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
311
structure length
311
Chain Sequence
CLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAVPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase
publication title Crystal structure of Trypanosoma cruzi dihydroorotate dehydrogenase from Y strain
pubmed doi rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase
total genus 109
structure length 311
sequence length 311
chains with identical sequence B, C, D
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2008-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3c3nA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3c3nA01
3RF9A 2ZA3A 3RFAA 4FXSA 3FYPA 1W3IA 3DI1A 3LCGA 1I2PA 4WXZA 2OJPA 1FWWA 3HOJA 3NDOA 4K7VA 4PH6A 1R30A 2PE4A 2HS8A 3ABRA 3H55A 1VCFA 2PRMA 1H1ZA 4PC8A 1OX5A 4UFJA 1Q45A 3R12A 3SFKA 2BTMA 1P1XA 3IVUA 3S5ZA 4HSOA 4O28A 4E38A 1TQJA 3SGZA 3UYCA 1W1ZA 3HO8A 2WO5A 3W7IA 3MHFA 4IMEA 4PA8A 1H51A 3NQ8A 5HR6A 4UTUA 3KVLA 4IX2A 4ZQPA 4CCDA 1P0NA 1YPFA 2Y6ZA 3HIJA 1PCWA 1Z44A 2P10A 3L65A 4MY8A 4BR1A 4CCCA 1YYAA 3PVFA 1W5MA 2H90A 1KFLA 3UQNA 3P82A 3PR2A 3TE9A 1PE1A 4CNPA 3TU9A 3UPWA 4KWWA 3W3OA 2QR6A 1FXQA 1KLYA 4O15A 1JRCA 1LRNA 3L2IA 4CQ9A 1EPXA 4NVTA 2BLEA 4NNCA 1JCNA 4M7TA 2RDUA 1P0KA 4Y9AA 1KV8A 3B04A 2J9ZA 1SO5A 4GRSA 1KM3A 3EB2A 5K4ZA 4O19A 2E68A 4LV4A 3TFXA 2EGZA 2BSLA 2NXHA 1B4KA 5AYZA 3R89A 4CCEA 4O18A 1I2OA 1Y0EA 1G67A 1F76A 4AF0A 1T96A 4KKXA 2J9YA 4Y6GA 3UNDA 2ATSA 3O15A 3ABSA 2OT0A 3PBYA 3BLIA 4XWUA 3K30A 3TV8A 3DKLA 3KOFA 2V2CA 1LZOA 4RCXA 3F4WA 1K8ZA 3G0XA 4JY8A 5D30A 3R13A 1FCVA 3NL3A 4QQ3A 5G5IA 5K2ZA 3KFTA 1QNVA 1OFDA 1KM2A 1LCOA 3IGXA 3LHUA 4KWVA 4UXDA 1LP6A 1WAUA 3W2MA 5AC8A 1OHLA 1RQHA 5C6MA 3A24A 2DZWA 3W86A 5DXXA 4O57A 5KSWA 2WNZA 1NVMA 4O54A 5ABTA 3GIYA 4GJ1A 3N19B 1TPB1 3L5AA 4I9AA 3M43A 4XTDA 3NQFA 4RXGA 5BOOA 3QQ0A 3A22A 4JTUA 2Y7FA 1YXCA 5I3FA 3NO5A 3UWYA 1BEUA 2TRSA 1I8JA 1LORA 3LCWA 4UFLA 3WJZA 4JX6A 3R2GA 4XKYA 2PRLA 1N55A 1H7RA 3ZWTA 3W1XA 5D38A 4M6VA 1GYNA 3GDKA 1KM1A 3O05A 1Z48A 1KFCA 4LS2A 2R94A 1P5BA 3U6WA 4OT7A 1O4UA 2YW4A 4Z1DA 1OABA 1LLZA 3STGA 3ZR4A 3BW2A 3W2UA 5L9FA 1XCFA 1SZNA 4GUJA 2CZEA 5F2GA 4DELA 4M7SA 4BFAA 5CZSA 4ZQOA 3SSJA 2C3ZA 3OVQA 4OE7A 4AB4A 1EIXA 2WSRA 3QH2A 4K38A 3W7DA 4Q33A 2ISVA 3N9SA 4ZMGA 4EVZA 4N9EA 2IQTA 4O52A 1RZMA 5F4WA 2B7QA 3NM3A 4ORMA 1GG1A 5KINA 1XC4A 3P67A 2B7PA 2NWRA 3QJAA 4M5PA 3ZS4A 3MHUA 1DJNA 3IIVA 4MIMA 4TU1A 3PC0A 2BWGA 3EKZA 3PBUA 4BF9A 3W7CA 1LLWA 2CZDA 1SFJA 4JTLA 2NUWA 3BG5A 3QPZA 2VOMA 4QM1A 2DZVA 2X2GA 3LTPA 5HR7A 1W8SA 3LRKA 3TA6A 3V75A 3QSTA 4O1BA 1XUUA 1HL2A 4WX2A 2ALDA 3QW3A 3UY7A 1OFOA 3W83A 3HQ1A 3G1SA 3ATZA 4QIUA 3LHYA 3MO7A 1RV8A 2ABBA 1PL9A 3O6DA 1SO6A 3JS3A 4C1KA 1A5BA 3OEXA 3TW7A 2R91A 4AH7A 3NM1A 4AHOA 3W1TA 3EKLA 3WFAA 3C2OA 3PB2A 1R46A 1IXQA 3DH7A 1VHCA 1K7FA 1NAL1 3N2XA 3AO0A 3O63A 5F1UA 3FKRA 1AMKA 1H61A 3TKFA 1GG0A 3W88A 4A3UA 3EWXA 1WX0A 4JNMA 5CPLA 4JTSA 5H2ZA 3KXQA 1U5JA 4O8RA 3OVPA 4ADSA 2HTMA 1FDJA 3PG9A 4IX0A 3TSDA 4QISA 3GK0A 1OX6A 1LBFA 3I65A 3LHTA 5D32A 1GTHA 3M7WA 4PTNA 4IJBA 3VNDA 2GUUA 3W70A 1TPFA 3BW4A 3TJLA 4UC5A 1OF6A 2WJZA 3P84A 4YCPA 2Q8ZA 4N6EA 4NU7A 1HTIA 4LTSA 2C1HA 2DORA 4JTIA 1SW7A 2ZZ2A 3LCFA 1G4EA 1UUMA 4GUFA 2RKXA 4JDYA 3E9AA 1EWEA 4IUOA 2C0AA 1JJKA 2CLOA 3W6YA 4K36A 3USBA 2ZZ5A 1JCYA 2GVGA 2Q3RA 3W73A 4ZZ9A 4JYDA 3G8EA 3HG5A 8TIMA 2O7QA 4O1DA 1Q6RA 2WOQA 4FNPA 1UJPA 3Q2DA 3S6DA 1VLIA 3PY2A 2NXGA 1N7KA 1KBJA 1SR9A 3W7QA 4O1AA 4M6QA 3DXIA 1C29A 3LOTA 3T44A 2VFFA 1JULA 4JYFA 2CLMA 1S5WA 1DOSA 1I45A 3PSWA 2QJHA 3M0ZA 4UTTA 1XUZA 4K8EA 4O4VA 5CZ0A 2YSWA 3SIZA 3BGJA 3EX3A 3C2RA 4GE8A 1TB3A 5KITA 3EWYA 4ALDA 3LCLA 3QZEA 3TQ0A 3BLEA 3FS2A 5DBTA 1EP1A 2NXIA 2EF9A 1PCKA 1R47A 1TRIA 3I7SA 4GWEA 4ZL1A 1FCBA 4BWLC 3L5LA 3W7RA 1QWGA 2JKEA 3DHFA 1N8FA 5LNSA 2WKJA 2ZRXA 1S3HA 2WSQA 4R7JA 3G22A 4LU0A 1S5VA 1PS9A 3NPUA 3Q58A 2GJLA 1RPXA 4HKPA 3GDLA 4N02A 1HUVA 5G4WA 2PC4A 1G7VA 4LVGA 2XN2A 2OCZA 4FNTA 1F74A 2WV8A 1DJQA 5LZLA 1O95A 2W79A 1GZGA 3UWWA 2AQWA 3LV5A 3STEA 5EKYA 4ZQNA 5G1YA 4TMCA 1XM3A 4AWTA 3NQCA 3IV3A 2P1FA 5A8GA 3G18A 1WBJA 1TMHA 1ZNNA 4KFPA 2ABAA 1KLZA 3B05A 3GNNA 4JEQA 3NQDA 3SR7A 4Z1BA 3N34A 1NFBA 1T0OA 4DF1A 5C54A 5BMWA 2V30A 5AHIA 2Y89A 1VZWA 3PULA 3TSMA 2QCHA 4ZQMA 3FIGA 2XN1A 4KFOA 2WSYA 2YW3A 4Q32A 5CPNA 2A6LA 3FJLA 5D05A 1FWTA 3BVJA 3NQMA 1ZHAA 1FXPA 4GNJA 3C8FA 3NL2A 1LBMA 1SO4A 4WD0A 2A7RA 2Z2UA 3I68A 5AFDA 1K8YA 4NJJA 4JY9A 4ML9A 3UXDA 5E0KA 1XBVA 3S5YA 1QPQA 4LRTA 3O06A 3STFA 2ZTKA 2CW6A 1VCGA 4U28A 3FJ6A 2G96A 3MI3A 4I7UA 4AXKA 2G97A 2VELA 1OF8A 3LI0A 4G1KA 4LS0A 3O6YX 3NL6A 3I6RA 4NQ1A 1SW3A 3HG2A 1OX4B 2HS6A 3TC7A 4NJIA 2VFIA 2YFNA 5A5WA 2DP3A 1W54A 2TSYA 2E1DA 5I3JA 3EWBX 1K02A 3CIXA 1W31A 1HG3A 1XI3A 3B03A 1GVFA 4JTGA 4LVBA 3W7MA 4H6KA 1ICSA 3KVJA 2E09A 2B7NA 3O8AA 4GBUA 2YYUA 1L6YA 1QFEA 4JXCA 3IIZA 2I9EA 3D0CA 3TROA 3LHZA 1UCWA 1OYAA 1BWLA 3RNDA 3R8RA 5LNWA 2JKAA 4DO6A 1X6UA 1TO3A 3TMLA 4UTTC 1ZALA 5AHNA 4OU1A 2UV8G 5FF2A 3S1XA 4LUIA 5LHFA 1JCXA 1L2UA 1QAPA 2R8WA 3SY5A 3N9RA 4JTKA 1MSSA 5D04C 4JD4A 3L21A 3MMTA 4P61A 2J27A 2V82A 2D73A 3QRHA 3B06A 5CG7A 1A5SA 3DZ1A 4TMBA 4UTJA 4X3ZA 1VS1A 5AYYA 3C52A 3QF0A 2Y62A 1Q6OA 3NPXA 1DV7A 3P5ZA 1HO4A 4MJMA 4BI7A 4KFNA 3EX6A 1FDZA 4UNKA 3PBVA 1W37A 2DZXA 1K7XA 1TV8A 1AG1O 3TFCA 3IVSA 1YDVA 4QNWA 2FTPA 1VJIA 3A23A 2GQ8A 4TX9A 4TR9A 1DHPA 4O50A 2QUVA 1VQTA 4ORIA 4O11A 3L68A 3EXTA 2WQPA 1ALDA 7TIMA 3L0KA 3NQVA 4DPPA 1ZFJA 5LGXA 3CQ0A 2NX1A 3W7HA 1H7OA 2X16A 3ABOA 3W71A 3CHVA 4MLJA 2FIQA 1KFKA 4Y96A 2B4GA 1RVGA 5CZTA 4BI5A 3B0PA 5K4XA 4O10A 1TPH1 3W7KA 4JS3A 1TPDA 4LVAA 2CFFA 2C16A 3HPZA 4UFIA 3DFPA 3P8JA 4OV4A 2C19A 2TYSA 1JR1A 1GQNA 1FWRA 4UUIA 5AN7A 2VC6A 5HJLA 4XZ9A 2QAFA 1ZJIA 3NQ7A 4LNYA 2ISSA 5HULA 5TQLA 1J4EA 4O0KA 5CPOA 1FDYA 2NV2A 4NX5A 2X1RA 3LHVA 1TV5A 3NZRA 4NZJA 4QITA 2C13A 3BARA 4FX6M 3LBMA 1ZENA 4UMCA 5AHFA 3W1AA 5D33A 1GVRA 2V2DA 4LOCA 3S1VA 3TX9A 5BW6A 1H7NA 3AJXA 5KZDA 3NQEA 4UNLA 4DF0A 3PAJA 4MJZA 3IGUA 5D2TA 4YL2A 4I7VA 3S8HA 3B0VC 4EF8A 3LXBA 3WK1A 3OIXA 1T8XA 5GVJA 3M5VA 1SQ7A 1KFJA 2G95A 4XUGA 4FIQA 3PUEA 3C6CA 3C2VA 4UCGA 4GUGA 3FLUA 3F4NA 4NJGA 4MYAA 4DQWA 3G8RA 1L9WA 4N2YA 2ZZ1A 3G1VA 1TPVA 5F1VA 5HUPA 3S42A 3T40A 4UFKA 3HF3A 1G4PA 3INPA 2DU2A 2A6NA 3GKAA 4K8HA 4UFHA 4IMDA 3ATYA 1IGSA 2FQIA 3E96A 3S1UA 2F7FA 2NX3A 5G4EA 1OJXA 4NNAA 4Z08A 4JTTA 1JCLA 1H50A 1B3OA 4MY9A 1ME7A 1PHQA 3BV4A 4K7YA 2RHGA 3LXAA 3DI0A 5C55A 5EMUA 4H3DA 1GVSA 4MFEA 2Y63A 5I3GA 4LVDA 3L0GA 5F4SA 1C9DA 4L4LA 3U2OA 3CTLA 3SI9A 4IPIA 1YTEA 3LLDA 1G4SA 3W85A 2Y7EA 4EWND 1JUKA 4R53A 2QDGA 1QCWA 3QQ1A 4NXKA 1F7BA 3TCEA 1FUYA 1SSGA 2ZA1A 5AB3A 1TREA 4CNNA 3WJSA 4BWLA 5LGZA 1BTMA 2NX9A 4MKNA 3NQ2A 2E77A 3VFLA 1C8VA 2A7PA 3JRKA 2Q3OA 5HQEA 5CZJA 1DL3A 4JDBA 1WOAA 2BXVA 4UTWA 4NXSA 3PS7A 1FWSA 4LC8A 3MBFA 2W0UA 3EX2A 2CZ5A 4PEKA 1AL8A 4RKAA 2GVJA 4RK8A 4PL2A 3CWNA 1NF7A 4MZYA 4N6FA 2CLHA 1W5PA 3TXVA 5EA9A 1Q6QA 4AVFA 2A5HA 5CPMA 3UWQA 3QMSA 3T55A 1X1ZA 4IWWA 4HNUA 3GZ3A 3M1ZA 1OYBA 5F4XA 1B4EA 1IF2A 1MZHA 2QF7A 4O13A 3UY8A 1R2RA 4WOQA 5HWJA 4Z1AA 1Q6LA 4FF7A 1A5AA 3DFTA 1L6SA 3TNOA 1WXJA 5LNRA 3A21A 3MP4A 4S2CA 4FNQA 1XDLA 3KRSA 1EUNA 2GVLA 3LHWA 1ZY9A 2YFOA 3HGRA 3ANYA 3KHJA 3OG3A 4JTJA 1KM6A 3UXAA 5LSMA 3TDFA 1K8XA 3TQVA 2XN0A 4JX4A 1YPIA 4FHAA 3KX6A 1MEHA 1VYRA 3ABQA 4Z0SA 3WK2A 1OFAA 4UMAA 2J88A 1OFPA 5DCBA 3GXPA 1GVQA 2X1UA 1WA3A 3DFOA 5CGQA 4HNVA 1ZCOA 4MZ8A 4NT0A 4GUHA 4O4WA 1H5YA 4O17A 3PBWA 4HPXA 1EA0A 3IRDA 2QCDB 3P5YA 3LDVA 1GEQA 3IIXA 4AWUA 4BI6A 3NEVA 4H4IA 1CW2A 1I2RA 2YPIA 5DCEA 3IIPA 1TCDA 4PCFA 2HSAA 3IVTA 5AOUA 1A53A 1D3GA 4PFMA 3P61A 2Z6JA 1LOLA 3UWZA 3I7QA 4O14A 3TAKA 2GOUA 3YPIA 4GXMA 2WNQA 3T4CA 3QMRA 5AHLA 1KFEA 1SO3A 2OX1A 3NR0A 4AWSA 2VFHA 3NXFA 2DZPA 3W07A 2DZTA 5CKSA 1IIHA 4QSHA 1OFQA 3E12A 1U83A 5TIMA 1YTKA 6ALDA 2EHHA 1QPNA 2E5CA 5KTLA 4O16A 4MVAA 5D2WA 2RDTA 1IXNA 3E02A 2YR1A 1TPWA 1F6PA 1EX5A 1VR6A 3SW6A 1OK4A 2QJIA 5DBUA 2W6RA 1TSIA 4JIQA 4MUZA 5DXYA 1AW2A 1LM1A 3QYQA 4GC4A 3HGOA 3PM6A 1TTPA 3TH6A 1KM0A 4UTMA 1TV7A 5D2VA 4RLIA 3LRLA 3ELFA 5DELA 4LW7A 4HHPA 2ZRWA 1PHWA 2F84A 1K7EA 1OG0A 2VEKA 3BPWA 4WZHA 4YWIA 2Z6IA 3LX9A 5U7SA 5FESA 3H53A 2NWSA 3QSRA 5F2MA 4C1LA 1OVDA 4ICNA 1CX9A 3TJXA 4UTWC 3GDTA 1SU5A 5G2HA 4AEOA 3M6YA 5F2IA 1OX4A 2E6AA 1PVNA 2I1OA 2YDAA 3DENA 3GDMA 3M5XA 3W1UA 3G0UA 5FF7A 1AW5A 5K9CA 4FNRA 1KV5A 4FB7A 3CT7A 3NAVA 5FEPA 3OBKA 2CU0A 3L9CA 2C14A 1ML1A 1QO5A 1P4CA 3GVGA 3WJYA 1GWJA 4XTIA 3QM3A 4HN4A 5K3VA 3LXCA 2EKCA 4E0CA 3NL5A 3W2JA 3GAYA 1M7OA 4HIBA 2H8ZA 1DQXA 5BRBA 1D9EA 5AC7A 1EP3A 3UD6A 3BK0A 1IXPA 3MP5A 3W7NA 3FFSA 3QEZA 4JR5A 1ICPA 3W72A 4WXYA 4RZ5A 2Z1BA 1Q3NA 3SJ3A 3C61A 1R2SA 5D2YA 3G3MA 2J6XA 4HSNA 3M47A 4IQLA 3W7JA 2AGKA 3GXNA 1F73A 4YXGA 4FXRA 1T99A 4UTHA 3S0CA 1O5XA 2LLEA 4A29A 2QKFA 3EWZA 2V5BA 3NVTA 4MLRA 2FJKA 5D02A 3S5NA 4Y90A 4LC6A 4X9SA 1VC4A 2GQAA 4J9JA 2J9XA 4XBSA 3UZJA 3QC3A 4IOTA 4JYEA 3G1AA 3EEGA 1XBZA 1W3TA 1TYGA 4NX0A 5I3IA 5C2XA 2I14A 2ZZ4A 3IEBA 2OT1A 1VCVA 2CLEA 3LTSA 4NNBA 4S2BA 2OMAA 5KZEA 1I2NA 2V5LA 4ZQRA 4JTEA 1XBXA 3NYZA 1LOQA 2QCEA 4UFMA 3GLCA 2JKPA 3W2LA 1V5XA 3QW4B 3MHGA 4RX0A 3B0UX 1PIIA 2CWNA 1AK5A 1MEIA 1B57A 3EWUA 2RDWA 1QMLA 3HBLA 4CQAA 3KVMA 1IXOA 2ZZ7A 1X7FA 2B7OA 3FOKA 3HG3A 4UIOA 3VE9A 1OFRA 1SW0A 2X1TA 2X30A 2ZDRA 1YTDA 2JGYA 3HPXA 4O12A 4QJ1A 4AHQA 1EP2A 1L6WA 1WV2A 3R5EA 4K37A 2CLLA 1EEPA 2V9DA 2QCLA 1VH7A 2VFGA 5DCDA 1J2WA 3S5OA 3MP3A 3W22A 4CNOA 1IIGA 3RLUA 1H7PA 1QOQA 1SFLA 5LNUA 3F03K 3HGJA 3W1PA 3W1MA 3THAA 1KW1A 3KVKA 1WYIA 3MBDA 3Q94A 5EBUA 2FDSA 4WY0B 1TJPA 1VYSX 5AC6A 1NEYA 1LBLA 2VKZG 1JCMP 1F2JA 4RZ4A 2CLFA 5D03A 3M44A 2ZYFA 4A2SA 5BMXA 4IMGA 3NPVA 3PUDA 3EX1A 3L0NA 1MEWA 1TPEA 1X1OA 3LBCA 3CU2A 2VENA 4CLMA 1MO0A 3CC1A 4LS1A 3O07A 2ZTJA 3GKFA 3DGRA 1FCQA 3W2NA 1XBYA 3LCHA 5HMSA 1YXDA 2FPYA 4B5NA 5AHMA 2ISWA 1KBIA 3LCXA 4MZ1A 5HWNA 3S1WA 5EY5A 3W23A 2YYTA 3GR7A 4HNTA 3THQA 3W74A 1H7XA 1KFBA 4OWGA 1UASA 3G1FA 4DEFA 1H63A 5SWUA 4R33A 3T78A 2ZBTA 4AHPA 1GOXA 1SSDA 2C18A 3DAQA 2NUXA 2NV1A 3C0JA 5IBXA 3M9YA 2DZUA 2EPHA 1JQXA 1W5OA 3CPRA 2VXNA 2QAPA 1RR2A 1LYXA 2GPTA 1OYCA 3NOEA 5EL1A 1AL7A 4WOZA 3C2EA 1B9BA 4RXFA 3I7RA 3HMJG 1YLVA 3TK7A 3Q37A 3MW7A 3PWAA 2V0TA 4IMCA 4M19A 4UTIA 3TAOA 3G24A 3KRZA 2WNNA 3LERA 3E49A 3LTYA 3M41A 1I4NA 2VEMA 4JTHA 3DHDA 1FCUA 1G6CA 1O94A 1V7YA 2CLIA 3O6CA 1YDOA 3GXTA 1A50A 4N9DA 3PSVA 4UR7A 4UMBA 4XQ6A 5KZMA 3CEUA 4Z1CA 5K9XA 1HFBA 3JR2A 1TPUA 1VPXA 4K6AA 4W9TA 3LB0A 5G2IA 2A0NA 4I7WA 4JICA 1JQVA 2JK2A 3HJZA 3F1QA 3UZ5A 1W0MA 1WBHA 3LV6A 1G4TA 3MYOA 3W7LA 2R14A 3BLFA 4OQVA 2J24A 3BO9A 1DQWA 3T7VA 2YCEA 3W7EA 1JUEA 3SZ8A 4TIMA 4DXVA 3EXSA 1UBSA 2C15A 3G1XA 3W1RA 1XL9A 5D09A 4Y8FA 2YGYA 2E6DA 5FEWA 3CB8A 2E5DA 4GFSA 1M6JA 2KZHA 1JUBA 2JBMA 3FEMA 1GYLA 3LM7A 4X22A 3PB0A 5EYWA 5J5DA 4X2RA 3MYPA 1M7PA 2A85A 3ZFHA 3W1LA 4A2RA 3LI1A 3CM4A 3TIMA 3TMQA 3A5VA 3N2MA 1S5TA 3NNTA 4FNUA 3UWUA 4QNEA 2A21A 3L5MA 1VHNA 3CIWA 3M5ZA 4IGHA 3OHIA 2ZZ3A 3P74A 4IMFA 4WQ6A 4MYXA 3V1PA 4UTLA 3UWVA 1A5CA 5K7JA 5HUOA 1THFD 4NUWA 5TBOA 5EPDA 5DLCA 2E5BA 1SZEA 3W1QA 1LOSA 4AAJA 4RV8A 1BWKA 2ATMA 3TW6A 2CZFA 2V2HA 2VEIA 3ZWSA 4JIPA 1KTNA 5FI8A 3TR2A 2QCGA 1UUOA 3NQ6A 3VKJA 4OV9A 4FX7A 1PV8A 4L4MA 3WK0A 4M6PA 4JX5A 3OVRA 4AF0B 2FB2A 1OFEA 2QCDA 4FO4A 2TMDA 5HWMA 1FX6A 2FLIA 2G5WA 3RLVA 1TTQA 5HNRA 4BK9A 1OK6A 4K39A 3EXRA 1NF0A 2Y85A 5IBXC 1F5ZA 1KTCA 2DZSA 2E6YA 4LUJA 2PURA 2ZRUA 3G3DA 5U4NA 1QR7A 5HINA 4O53A 4YMZA 5MHBA 3MJYA 3NA8A 3P80A 5DN1A 4XBKA 2EAWA 3KRUA 3W9ZA 3W1NA 3M16A 3L67A 5FF4A 2H3DA 1LRQA 1FQ0A 2V8ZA 5FEZA 1JRBA 3CEPA 4DBDA 4LVFA 4N4PA 4IXHA 3O16A 2PCQA 3GAKA 4ZVJA 1XDMA 5J5RA 5G1TA 3TSBA 1GPWA 3DU0A 3C56A 1DKWA 1SZGA 4ONVA 1BKSA 3LRMA 1M5WA 3CWOX 3U8GA 3FA5A 3O1NA 1SUXA 2ZFAA 3CLMA 1H60A 4AMAA 3PUOA 4E2DA 2VFEA 1SPQA 1QDSA 3DKJA 3NPWA 3TXZA 5K9DA 1G69A 1GTEA 1NSJA 2B0MA 3N73A 1LTDA 4UR8A 3MI2A 1O60A 3BW3A 4XKYB 3P60A 1AW1A 4U4MA 3G0SA 5CSSA 4MFDA 3G1HA 1W3NA 1I2QA 3P8IA 3W7OA 4QAIA 5AYXA 2YZRA 4EIVA 4TO8A 3FYOA 1TJRA 5L6UA 4Q4KA 2WPBA 2NZLA 5AHEA 4A21A 1QO2A 4JGDA 3LGEA 4S1FA 2Y88A 3BG9A 3DFNA 4HPJA 4N4QA 3B8DA 1GJPA 4WJEA 3HPSA 4LT9A 2O7SA 1ZAIA 1OFBA 1RD5A 4MOZA 1O5KA 2CLKA 3GYEA 1R2TA 1JCJA 1FWNA 4POCA 1VLWA 4JN6A 4DF2A 1ZAHA 2VEPA 4LWWA 5G2WA 2NLIA 4IXXA 2H3BA 3RMJA 3G1DA 3EWWA 1H7WA 3IGSA 3E0IA 1WOBA 4LRSA 2QEZA 1K03A 5DY2A 3STCA 1MXSA 4NZFA 1TTIA 1XKYA 2FB3A 5E93A 1Z41A 3GDRA 3P62A 1J5TA 3A5FA 3A9IA 1TRDA 1LROA 3MWAA 5LHEA 1WDWA 4LV9A 3WJWA 5IM51 1YXYA 2ZRVA 4EF9A 3HB9A 1QPRA 4ADUA 3W7GA 4YCOA 1H1YA 4E2BA 1YDNA 2QCFA 3QMTA 5BNKA 3IIOA 1KTBA 1DVJA 4RR4A 3NGJA 1UB3A 4O1CA 3SGUA 4JTFA 3NZ1A 1ME8A 2RFGA 1W5NA 2QUUA 2A1YA 2AAMA 2QCCA 2ZCGA 2QJGA 2YXGA 1EUAA 2V81A 3GX9A 3G1YA 3L66A 1RQBA 1TPC1 3P7YA 4ADTA 5FF0A 4MY1A 2BX7A 1TQXA 5LKYA 1VGAA 2PRHA 4D2JA 3B4UA 4UTKA 3GB6A 4R34A 3N14A 3TC6A 4YLWA 1CI1A 4NJHA 3SECA 2QCNA 3FKKA 3S9YA 3PG8A 1DBTA 4PODA 1H62A 1LRTA 4RZ6A 1DORA 2ZQ0A 1QPOA 3DBPA 1G7UA 1X8FA 3TQKA 1LDCA 1WQ5A 2FPVA 2RH9A 2VFDA 5D2XA 5H91A 2ZRZA 4N9BA 5LNVA 3NQAA 1GT8A 1QOPA 3W87A 3TUUA 4IPJA 3VCRA 5C5YA 1ONRA 2Y7GA 3MI6A 1XXXA 1FBAA 3EX4A 1TTJA 2H8XA 1XFBA 2QUTA 4WUIA 2GQ9A 4WY0A 4EOUA 2DJXA 1KA9F 1YADA 5D37A 2XFWA 1VYPX 5KMYA 4OBTA 3W2KA 2YX0A 4DPQA 3W7PA 3C4UA 3PF3A 3WJXA 1W5QA 2HMCA 2OZ0A 1W56A 5I3KA 1KM5A 4FNSA 2FFCA 4P2VA 2TPSA 2Y70A 2DJLA 1D3HA 1GVOA 1VRDA 4OHQA 3W75A 2ZZ6A 4LY8A 4DO4A 3DFSA 1JVNA 1RQEA 1Z42A 2GJNA 1SZFA 4FIRA 3W84A 4FX8A 3C2FA 3DFQA 2Y7DA 5DY3A 5E1QA 2A2IA 3QFEA 1ZAJA 1KM4A 2ZA2A 4DO5A 3QPYA 4Z0JA 3RU6A 4NJKA 2Q8LA 4FEZA 2QDHA 2QCMA 1E51A 5FF3A 3BGGA 2FPTA 4A22A 3C3NA 1EWDA 1TIMA 4CQ8A 1HO1A 3H54A 2C6QA 3MUXA 3VI2A 2A4AA 4OGZA 4N9CA 6TIMA 4HNNA 1K3UA 1FY6A 5CSRA 4O0ZA 3HG4A 4HT3A 4ZQCA 3P81A 1ME9A 2ZRYA 2P0OA 3LLFA 3LCIA 2H6RA 1EB3A 2E6FA 4DBEA 3N3MA 5FEXA 3VE7A 3UPBA 3GNDA 2JGQA 4RJEA 1F6KA 1ICQA 4PL1A 1ADOA 4MPQA 3KAOA 3NG3A 3NQGA 2NUYA 2Z0IA 3BG3A 3W76A 3WK3A 3RK8A 2BZNA 1F05A 3OA3A 3HGSA 5F2LA 4GUIA 3M5YA 4WY0F 2Y61A 5T26A 2A7NA 5I3HA 3GR8A 2X1SA
chains in the Genus database with same CATH superfamily
3MUAA 4IL0A 4KIEA 3RFAA 4MWAA 5I3DA 3TN4A 1W3IA 3DI1A 3AYVA 3LCGA 3W25A 3HV9A 4WXZA 2OJPA 1FWWA 4YS1A 1OWQA 4B2DA 1R30A 2PE4A 1PBGA 3II1A 4MKSA 4B5VA 1VCFA 4ZO9A 2WQDA 1VIWA 3PZIA 4FF5A 3SFKA 2DPEA 5IRPA 4H8UA 2J8FA 4CD8A 3PJTA 3IV8A 1P1XA 4QG9A 3S5ZA 4E38A 1XR2A 3UYCA 3HO8A 2YOCA 3W7IA 1H51A 4UTUA 4IX2A 4ZQPA 1YPFA 1KXHA 2Z25A 1E0WA 4CCCA 4AMCA 1YYAA 1RD6A 1W5MA 2H90A 1KFLA 2FH8A 3Q4DA 3KRBA 3TE9A 1FXQA 5I06A 3L2LA 5EFFA 1JRCA 3FAWA 2WXDM 4K8GA 4F2UA 3FDGA 2F61A 2RDUA 1P0KA 2J9ZA 3AXXA 1KM3A 3EB2A 4QTGA 3BZGA 2NXHA 1R9XA 2HEJA 4CCEA 4O18A 5FL1A 1XIMA 1Y0EA 3IJQA 2XH0A 4AF0A 1T96A 4AD1A 4ZO6A 3WNPA 2ATSA 3ZM8A 4L1WA 3O15A 4CQDA 1FKWA 1G01A 1R9YA 4Q8NA 4YPJA 3SRKA 2V2CA 5BRPA 3GQYA 1LZOA 4M24A 3AMKA 3FVDA 3ABXA 3I3BA 3R13A 4QQ3A 3V0SA 3KFTA 3GTXA 2O9RA 5ECUA 3IACA 4B5UA 3W2MA 1BFNA 1OHLA 3WQPA 3VIKA 3A24A 3QC0A 5DXXA 1BYAA 5LA1A 1JG9A 1XCWA 1PB0A 1QASA 4I9AA 2BGNE 3QQ0A 5H1WA 3GG1A 4HYRA 1UR4A 4E2OA 1Y8BA 3WJZA 4JX6A 3QGKC 3A3XA 3KWSA 1M03A 4XKYA 1GHSA 4B2DD 5ABFA 3PPHA 3W1XA 3CHFA 3OQEA 5D38A 2P8CA 4DWSB 1FFRA 4M6VA 2VR2A 3O05A 1KFCA 1OC6A 1PEZA 2Z28A 3M46A 1KKOA 1P5BA 1W2PA 2HK0A 1R3VA 3WQOA 1T8QA 3SEPA 2VP8A 2WCGA 2X40A 3VTRA 3BW2A 4GUJA 3U2CA 3SY8A 1M04A 2R1LA 4HGXA 4KW2A 1LLOA 2X09A 3MSDA 4AB4A 1EIXA 3AIWA 2X41A 3QH2A 3AHVA 4K38A 3W7DA 4Q33A 4WHBA 4ZE4A 5JIPA 4JFUA 2B7QA 3NM3A 4ORMA 5M2FX 2DSWA 4KPLA 1QTWA 4M5PA 4MIMA 3MS8A 3BE7A 4TU1A 3L4VA 1ZS2A 2BWGA 4P7LA 4JZ5A 2J7CA 4BF9A 3WQ8A 4J3TA 3O0KA 4XAPA 1A49A 5A2BA 3CQKA 3TA6A 3V75A 4BKNA 1XUUA 1HL2A 4WX2A 3GG8A 2ICSA 1FWCC 3W83A 4IIEA 1FKXA 3G1SA 3RJYA 2QQ6A 1X1NA 1E6ZA 1U1UA 1FH7A 4E5TA 1KRMA 4F9DA 3JS3A 2PGFA 4C1KA 3OEXA 3SCUA 1SVDA 1TWDA 3BLKA 4YVPA 3LN3A 3C2OA 2XGBA 2VQTA 3DH7A 5FJIA 1K7FA 3ZLGA 4GYKA 4C1NA 1H61A 3W88A 2ZX7A 1WX0A 4JNMA 3G6MA 3L4ZA 3AISA 1UR2A 3U48A 3OVPA 4W89A 1FDJA 3APYA 1UR0A 4QISA 1YIXA 1S39A 3CUJA 5D32A 4EX4A 4Q8UA 2HVOA 4IIFA 3VNDA 4TX6A 1I9CB 3W70A 4DNMA 3VDGA 1WDRA 4YCPA 3W01A 1J0JA 1LL6A 4N6EA 3JZEA 3HV8A 1HTIA 1M3UA 1E73M 2VR5A 1CGYA 3E3HA 4GUFA 2C0AA 1VFMA 4K36A 1JCYA 4DWDA 2Q3RA 1A80A 1Q6GA 2RJHA 1WAWA 3ARTA 4IPPA 1Q6RA 4FNPA 5B7YA 2FKPA 3V0TA 1VLIA 2NXGA 4NIRA 5HAOA 1KBJA 3IJ6A 1RXOB 3A4WA 3VKAA 1GOQA 4O1AA 4M6QA 4PRTA 3T44A 2OVLA 2VFFA 4KRUA 1CXIA 2R82A 2RGMA 3PJXA 5FSEC 4HOZA 4IQDA 4RNHA 2QJHA 2UZ9A 4QG6A 4AY7A 3WFLA 4H9TA 4O4VA 3BGJA 1FFQA 4NASA 5EB8A 5KITA 2FZNA 3RRAA 1IWAA 3LCLA 5DBTA 3FS2A 3A3WA 4RE2A 1FCBA 2XSBA 3O7UA 4IHCA 3W7RA 2PDUA 3RYSA 3AIRA 5FOOA 3KBJA 2VD8A 1EJSC 4D6JA 4D6FA 3Q58A 1RPXA 4LYKA 1DJXA 3EOUA 2OG9A 4N02A 3HQPA 4V28A 4LVGA 4PB4A 4W8BA 4OOUA 2AQWA 3STEA 1UH4A 1FWIC 1JPIA 4TMCA 3ABZA 4AWTA 2CBVA 3S9IA 1EBGA 3NQCA 3T09A 3IV3A 4I8YA 4D6DA 4L1GA 2P3ZA 2PBGA 1ZNNA 4S3BA 1V3IA 1S38A 2ABAA 4KS0A 4UQAA 1KLZA 2BY3A 4ACZB 3GNNA 3H4XA 1DIDA 3SR7A 1TJ0A 3N34A 1T0OA 2AL2B 5HMDA 4DF1A 5AHIA 3VUSA 3NZQA 2Y89A 2HBXA 3PULA 2VGGA 4KFOA 4Q32A 6ENLA 2A6LA 1NQ6A 5C2CA 1WZKA 4GFIA 1JGMA 2YXOA 5E70A 3HPFA 3BVJA 4GNJA 5A6SA 1F3XA 6TAAA 1BQCA 2R9RA 2P53A 4Q4SA 1D8WA 2GK1B 3I68A 1S2UA 3WQCA 2PLJA 3LBOA 3O06A 2G3FA 3STFA 1M9HA 4FSAA 4I7UA 3AUOA 2INFA 1OF8A 4G1KA 3NL6A 4NQ1A 1SW3A 3PTDA 2V3FA 2HS6A 2VFIA 4DUXA 2I7GA 3SUSA 2W4XA 2YFNA 1HQTA 2E1DA 3KP1A 5I3JA 1TKKA 3CIXA 1HG3A 2GJRA 1FWAC 4JTGA 1AZ2A 4X0VA 3KVJA 3V7PA 1WZLA 3IUHA 3RCYA 4MF4A 1WXYA 1OYAA 2KAUC 3N15A 4RNIA 3NGFA 5LNWA 4DO6A 1X6UA 1UD5A 3TMLA 4UTTC 4BQ2A 4ZO8A 2D2HA 3FW6A 3DEQA 1E0VA 1W1YA 4QE4A 3APTA 4LUIA 4CD7A 2ON3A 4GZJA 3SY5A 3N9RA 2BBFA 1I1WA 4JTKA 1V02A 3AS1A 4LUSA 1NFGA 4P61A 1A5LC 1KFWA 2REQB 2O9PA 3FXYA 5CG7A 1GUVA 1A5SA 1IYXA 4UTJA 1ZLPA 1FWJC 3M0YA 1VS1A 1AUSL 1DJWA 2PS2A 3PJWA 1ZP4A 3C52A 3QF0A 1Q6OA 3NPXA 1DV7A 3D3FA 3UG3A 1XIJA 3JUGA 3WZ0E 1FHLA 2XINA 3PBVA 2PI6A 2DZXA 3VC5A 1TV8A 3REQB 1BSIA 4GKLA 4CKQA 1PO9A 1AG1O 5E6YA 3IVSA 1RY8A 1VJIA 1BVZA 3S2JA 4TX9A 4TR9A 2QF8A 4O50A 2X05A 1HJWA 2HZGA 3KEHA 1VQTA 3LNPA 2WK2A 4O11A 3VA8A 1XW8A 3L68A 1NU5A 1ALDA 3L0KA 4KEVA 3L4YA 4DPPA 3BLLA 5LGXA 1S2AA 3CQ0A 3W71A 4AEEA 4MLJA 2FIQA 4Y96A 2B4GA 1RVGA 5CZTA 4BI5A 1W3HA 3W7KA 3CAQA 4LVAA 3XINA 3KL5A 4X9YA 2VCCA 1XSJA 1BF6A 4OV4A 3XIMA 3R4IA 2TYSA 3STPA 3N04A 5KEZA 3W4RA 4UQDA 5HULA 5TQLA 1J4EA 3VOFA 5MKGA 4F0KA 2NQZA 3CH9A 4TX8A 4RDWA 5EU9A 3CT2A 4FX6M 3LBMA 4DBSA 1ZENA 3RILA 3W1AA 3QKZA 1GVRA 5D33A 5D4YA 3SM0A 4F3HA 3E2SA 4OOZA 3NQEA 3AXIA 4HNLA 1PKMA 1W1A1 4FAMA 3WENA 3B0VC 4EF8A 3WDQA 3MUY1 1UW9A 1KFJA 3FSUA 2J7HA 4XUGA 3C2VA 3F4NA 4GCXA 4R7OA 4PGLA 4DZHA 1OZMA 2HXUA 1L9WA 5I5RA 1JPHA 1C9WA 5F1VA 2D0FA 4LB3A 4UFKA 1G4PA 3KBVA 2O4MA 2YKKA 4K8HA 1IZKA 2SFPA 4BCEA 4KRZA 3PZGA 5E5CA 3T08A 5G4EA 4NNAA 1CEOA 1EYEA 2NT0A 1JCLA 2QGYA 3BV4A 3VNKA 3O0FA 4XVDA 1GVSA 1NDYA 3DDMA 4HOWA 1K4HA 4LVDA 2WBKA 3CTTA 3OW1A 1C9DA 5CZKA 1R38A 4IPIA 1YTEA 4EXQA 4H00A 1AH3A 3W85A 3S2NA 4ZEPA 2IS7A 4GQQA 5A8PA 3VZZA 2QDGA 1F7BA 3TCEA 4YTTA 1FUYA 1SSGA 1JI2A 5PTDA 3GC2A 3GWQA 1IWBA 4CNNA 4BWLA 1XHGA 3MKVA 2QPSA 3NQ2A 1C8VA 3TTYA 5A8OA 4Q4PA 1DL3A 2BXVA 4NXSA 2CZ5A 2Y1HA 1AL8A 4RKAA 2GVJA 2F2HA 4AZCB 4MZYA 2CLHA 4J2MA 4BJHA 1QHPA 2VT0A 3CWHA 4DWSC 1RVKA 3DBNA 3OGVA 1MWOA 3KBSA 3GZ3A 1LT7A 3SSZA 1OYBA 1TJ2A 3R43A 3OQ8A 1MZHA 1R2RA 4WOQA 2IKJA 1Q6LA 4FF7A 1A5AA 4XZNX 2I17A 4B4FA 2X0HA 2GSJA 4AD0A 4PMYA 1L6SA 3TNOA 4YU1A 3KBNA 4NAFA 3WLHA 3A21A 2PGEA 3MP4A 3DX5A 4FNQA 3CV2A 1PKNA 1EUNA 5BU9A 4DJDC 2GVLA 1ZY9A 3ZJ6A 4KEMA 3OG3A 6REQB 5C71A 3RR1A 3TDFA 2VC7A 3PPGA 4JX4A 3GNRA 4FHAA 1TWSA 5HA7A 4NF7A 1PJ9A 3LSBA 4UMAA 4G56A 5CCZA 4EPEC 3DFOA 2R6OA 4FA3A 1S3TC 5LIWX 3GM8A 1QNQA 3PBMA 1ZCOA 1PX3A 1TVLA 2OLHA 4GUHA 4MGGA 3FHQA 5REQB 1EA0A 1GCYA 2QCDB 3TZFA 3R8GA 1GEQA 3CLWA 4CUCA 3IGHX 2P3EA 1RPKA 4TVCA 2HSAA 2CBJA 2IPWA 2OO6A 5AYIA 1H0GA 4YTQA 3F4DA 2OO0A 1LOLA 5EGRA 3YPIA 3T4CA 3A12A 3EKGA 5AHLA 1KFEA 3NR0A 4AWSA 2VFHA 1O66A 3QR1A 2DZTA 4I9JA 1I75A 4YIWA 3CUXA 2EHHA 4ZSTA 1QPNA 2E5CA 5KTLA 4LCSA 4C91A 1TPWA 4XUYA 2V6AA 3K46A 3SW6A 7REQB 5DBUA 1TSIA 1XIFA 5DXYA 3QYQA 3VGGA 1H2JA 3GW3A 1TV7A 3R58A 4PCPA 3ZVHB 3BCDA 3TWBA 4LW7A 4L9XA 3GNOA 4ZO7A 2F84A 1K7EA 2VEKA 5BXSA 5FESA 3UPMA 2PWHA 1DJIA 3DFYA 1OVDA 4TV6A 3DG7A 4UTWC 3GDTA 5G2HA 4AEOA 4KT2A 1XH0A 5F2IA 4R3UA 1OX4A 2E6AA 2I1OA 3G0UA 1B2YA 5FF7A 3SJNA 3T81A 1KV5A 3TYDA 4FB7A 3SURA 3F5LA 3KUMA 2PTYA 3WLOA 2XWEA 2OTDA 2WVVA 3LM3A 5H8MA 1JPDX 3GVGA 3WJYA 4DXXA 4M81A 3QM3A 4HN4A 4Y7EA 2EKCA 4E0CA 3W2JA 4XZBA 1DQXA 4P8WA 1DPMA 3BK0A 4W8LA 3FFSA 4Y9NA 1ICPA 4I5XA 1JYNA 3VGFA 1Q3NA 3NSNA 4NZ5A 5D2YA 3CK5A 2QMKA 4HSNA 3M47A 3W7JA 2Z1KA 3NURA 4WCJA 3BQ6A 1F73A 4YXGA 4FXRA 1QI2A 2GGEA 3VDHA 1OC5A 3I6TA 2UY5A 3NVTA 1XYBA 3WLNA 2J66A 4Y90A 4LC6A 1VC4A 5T8GA 2PFHA 2BOFX 1PTDA 1UHVA 3VKDA 5I3IA 4Q6XA 3H7RA 2YDSA 5D9MA 2I14A 2ZZ4A 3GZAA 3IEBA 2OT1A 2CLEA 3LTSA 4D6EA 3SIMA 1I2NA 3H70A 4JTEA 4ICCX 3N18A 3CUFA 2FMOA 2VVSA 2RUSA 1V5XA 3QW4B 3MHGA 3ENLA 3EPNA 1BD0A 3EWUA 3HBLA 4CQAA 2B7OA 3HPXA 1GZJA 1L6WA 4PMXA 2NQJA 1VH7A 1JAEA 4A35A 2JQXA 2EJAA 2RDXA 1HKJA 1PX8A 3W22A 3MWCA 3FXGA 1SFLA 1ISVA 3T8LA 5LNUA 1Q8JA 3F03K 4NRRA 3VIJA 2G4JA 3B40A 5EMKA 3GFYA 4PMNA 4GZEA 5ABEA 1NEYA 5A6AA 3B0YA 2ZYFA 4IMGA 3NPVA 2BS9A 3PUDA 4W7WA 3C0QA 3JVAA 2B31A 3CU2A 2VENA 4GI4A 4CLMA 1MUWA 4LS1A 3VGBA 4GQBA 3WH9A 5CQ1A 1VJZA 3VGDA 1XBYA 3CMFA 1BRLA 3T05A 3SQSA 4JL1A 1KRCC 2OWXA 2AMXA 3SUVA 4D6CA 2G3JA 4PUWA 2DFAA 4MZ1A 5HWNA 4IFKB 3W23A 4H41A 4H6EA 3CAWA 4HNTA 1L6FA 3T4WA 3A9BA 3AYTA 1Y7VA 1H63A 3V5FA 3CZEA 3T78A 2YA2A 1GOXA 2C18A 1YEYA 3M9YA 2YL8A 2QAPA 1LYXA 2WM1A 2GPTA 3IJLA 3S2LA 1G0CA 5AYBA 4WOZA 4K3ZA 4HMDA 4RXFA 1V4YA 3D6NA 3RAOA 4N7QA 1EXBA 2XIOA 3PWAA 2V0TA 4IMCA 2XWDA 4GQRA 3DHPA 3H2NA 3LMZA 3LTYA 1W1IE 3DHDA 4MB3A 1S2TA 5CSYA 1EIBA 1A50A 2XSXA 3SCPA 4UMBA 1XH2A 1VPXA 4K6AA 3ALGA 3KTXA 2XSAA 4I7WA 1UA7A 3UZ5A 1ZB5A 2GSHA 3W7LA 4MWAB 2J24A 3U4FA 4JFTA 1DQWA 2YCEA 1ONEA 3ARPA 3SZ8A 1MXDA 1W1VA 2MNRA 2C15A 4JQ2A 3QVQA 3ARVA 1LL4A 2E6DA 4UQBA 1M6JA 1IZCA 1JUBA 1FHDA 3WQ4A 2JBMA 4LAUA 3ARYA 5J5DA 1HGWA 3MYPA 1ZGDA 5JBDA 4B9ZA 3CM4A 4PN2A 3TIMA 3NJ3A 3A5VA 4NL1A 3WQEA 4FNUA 1HJUA 3GR4A 4QNEA 3U57A 2GGHA 1NARA 4JTQA 1BGAA 1XD0A 1EGZA 5A8QA 4IMFA 3ZR6A 4MYXA 3V1PA 3U2EA 3MQTA 1QK0A 2YCJA 4AAJA 4RV8A 5AZ0A 1RHCA 2BY1A 3CO4A 1H41A 3UFYA 3ZWSA 1KTNA 5FI8A 9XIMA 4PBGA 3RXZA 4HK5A 1UUOA 3N12A 3NQ6A 4S39A 3UJ2A 3VKJA 4OV9A 3S9ZA 4J5NA 3K13A 2NQ5A 4JX5A 2VM8A 2C0HA 4CQCA 4AF0B 3QR3A 4FLOA 1TVNA 1OFEA 3T07A 4ZA0A 1W9XA 3SCVA 2G5WA 1AQFA 2C71A 1MUCA 3MMUA 1JZ7A 1TTQA 1GW9A 3EXRA 1LWJA 3FEQA 1LUCA 4Q8VA 3GUWA 1IEXA 1MZRA 2PURA 2WM0A 5HINA 4YMZA 2V38A 5MHBA 3MJYA 3P80A 2PDFA 5DN1A 2E9MA 1FHUA 3E5BA 3LSCA 3AHTA 3KRUA 1FQ0A 2V8ZA 3U5YA 2PPGA 4N4PA 4IXHA 1SJBA 4ZVJA 3NFUA 2WCSA 3J7HA 1JZ2A 3TSBA 2EQDA 1M01A 1YPXA 3S2MA 5I07A 3FA5A 1BXCA 1AODA 2CC0A 5I0DA 1XYFA 2ZWYA 3CLMA 5DX7A 5ABHA 4PTXA 2NVCA 3DKJA 3NPWA 4GBDA 1G69A 1NSJA 1LTDA 1L6GA 4UR8A 4XKYB 2VNCA 3WH8A 1JAKA 2PGWA 4A8RA 5ABFB 2BP1A 5EMYA 3G0SA 1HVQA 1GW1A 2OPJA 5HJXA 5CSSA 1W3NA 3UYIA 4QAIA 5AYXA 2YZRA 4WJ8A 3FYOA 1UOZA 4US6A 4W93A 1UC5A 1XQLA 1QT1A 4Q4KA 3AMGA 4DM2A 3VOIA 2QPUA 1QO2A 5IDIA 3RUBL 3TQPA 2YB1A 5HATA 1MDLA 3IWPA 4HPJA 3PJUA 4W4QA 3KHDA 1ZAIA 1OFBA 2CLKA 3GYEA 1R2TA 2PAJA 4U5IA 4POCA 5A8MA 4PE8A 2BVWA 2VEPA 4F4RA 5G2WA 4D8LA 4KCWA 3VIHA 2JFEX 4LRSA 1Q65A 4F0SA 5DY2A 2YCLA 4NZFA 2FGLA 1YNPA 4ERGA 5E93A 7ENLA 3UR5A 1NWSA 3GDRA 1OCBA 2EXOA 2AOSA 1Z9AA 1V08A 2PWUA 1P6BA 3MWAA 5LHEA 1WDWA 1M68A 1YXYA 2YA0A 4PB3A 2ZRVA 3MKCA 1EJ7L 1XV8A 3P6LA 4GMEA 1JFHA 1TZ9A 1XSKA 2DH3A 1A5OC 2GJPA 1VFFA 1KTBA 4B5SA 5I09A 5LA0A 1V6UA 4HHHA 1LJYA 4RR4A 3E74A 2PMQA 1XICA 4JTFA 1P0BA 4TV5A 1K8CA 1ME8A 3VC6A 4MDPA 4GIAA 2QUUA 5A8NA 4LY4A 4XD3A 1T40A 1RALA 2ZCGA 3ONCA 2Q02A 2QJGA 2YXGA 1QI3A 1D8CA 1S46A 4WVXA 4C1NB 3G1YA 3FY1A 3PUGA 1TQXA 1V3LA 3AIVA 1VGAA 2PRHA 3NO3A 4GLEA 1AH0A 3LS9A 3CIVA 2VGBA 4XZHA 4YLWA 3SECA 4RE3A 2PDBA 4FS9A 2FGZA 5IFPA 4RZ6A 1HKWA 1DORA 1VEOA 1JD7A 4K1GA 3EDJA 1X8FA 3VYLA 4F40A 2VZTA 5LIYX 2ZRZA 1PXGA 3NQAA 5CEWA 3AJ7A 1GVEA 4IPJA 4F9JA 5C5YA 2Y7GA 3MI6A 3EX4A 4ILSA 4Z2IA 2H8XA 4AX6A 2F6XA 1XFBA 2WC3A 2GQ9A 4WY0A 3TZNA 3WLIA 3AXKA 5ENLA 4OBTA 4PTWA 4G7EA 3W7PA 9RUBA 1W5QA 2HMCA 1P6WA 3H23A 1JNDA 4KQNA 2WKLA 1KM5A 1P1MA 4CU8A 2TPSA 3QQWA 2Y70A 1GVOA 1O12A 4U10A 4DZAA 1HKIA 1JYXA 1EJTC 4V15A 2CWXA 4DO4A 2GJNA 1SZFA 5TAOA 4FIRA 3HURA 4FX8A 3C2FA 3DFQA 4XO7A 1IWPA 3QFEA 4Q8QA 1XLMA 5TNVA 2OYMA 1BYCA 2ZA2A 3RM8A 3QV6A 3RU6A 4L6DA 4NJKA 4REQA 3K4AA 4V1YA 2PDCA 3RITA 4H8NA 3THCA 5A6LA 3BGGA 1E6SM 1TIMA 1EWDA 4ES4A 3TCSA 3QKEA 3VMPA 4CQ8A 2ODOA 3VI2A 4OGZA 2A79A 2NT1A 1XINA 4PB5A 2BY0A 5CSRA 2UY2A 4HT3A 3WLKX 1Q6DA 2WSKA 3LPFA 3GBDA 3H2FA 3P81A 3LLFA 2A3EA 1GOWA 4GVIA 4P5UA 3CZJA 4KCTA 3P3BA 4CD6A 1B3XA 4A3HA 2JEPA 4ENLA 3NQGA 2NUYA 3BG3A 3P0XA 3WBEA 4H8HA 3WQ5A 4GUIA 1LF1A 1X8CA 1C8YA 2Y61A 3PNUA 4PEEA 3MVTA 2X1SA 3RF9A 1XX1A 1UQZA 2BXYA 1WDSA 2UWFA 1HP4A 5C9UA 4K7VA 3VD7A 1F8MA 3VMNA 2OEMA 1RA0A 1KXTA 3GFXA 3KCOA 4W85A 3N2TA 3WKZA 4NSBA 4UFJA 2YDRA 1J18A 2R1PA 1TE1A 4HSOA 4O28A 3SGZA 1W1ZA 1KRBC 4KERA 3SO7A 3MHFA 5HR6A 3M0KA 1LWHA 3KVLA 5GNZA 4JFVA 2AKMA 2Y6ZA 1E5JA 3CS2A 3RO6A 3WD3A 2GZXA 2OXNA 3PVFA 1MW0A 3MUCA 3LU2A 3OU8A 2ZXQA 3VNJA 3UQNA 1UROA 3P82A 3PR2A 1P48A 4WEVX 3W3OA 5J8LA 3MO4A 1LRNA 3L2IA 4CQ9A 2BLEA 4NNCA 5DMNA 4M7TA 4X63A 1V0LA 3N3TA 1BAGA 1KV8A 4LSBA 4AW7A 1DIOA 3G5EA 4FK9A 1SO5A 4GRSA 3CYVA 2E68A 4LV4A 5M5DA 2QUNA 2EGZA 1DTNA 5JBEA 1B4KA 3R89A 4GINA 1PZ3A 1LQ0A 3UZZA 2PC8A 3M0LA 2EPLX 1MW3A 2OT0A 3PBYA 1FRBA 4M80A 5D8WA 1XRVA 4LUSB 5CBIA 1GOIA 3DKLA 3GHRA 3W29A 2FHCA 1W1TA 1W9VA 2XVKA 4JY8A 4ZB2A 5D30A 3M4HA 4JTAA 2WMGA 3T6CA 1QNVA 2HWGA 3E2VA 3IGXA 3M07A 4IICA 2ZX8A 3KOZA 1PZ2A 1KQYA 3OGSA 1RQHA 3G2GA 3GVWA 4PUMA 4HP5A 3VVGA 3H26A 5KSWA 2WNZA 4A8IA 4HSHA 2VWTA 3GIYA 3A13A 4GJ1A 3ES8A 1TPB1 3L5AA 3K8KA 3NQFA 2VMFA 1Q2RA 4RXGA 3A22A 2D1ZA 2Y7FA 1ZCCA 1YXCA 5I3FA 1A3HA 1BEUA 2TRSA 1SM9A 3LCWA 2PDMA 4DZIA 3R2GA 2XDFA 3KOWA 3TW9A 1H7RA 2E7FA 3UETA 1K77A 1UD2A 4MM1A 3T0TA 2I16A 3WL1A 2PDNA 3BJFA 1GYNA 3GDKA 3UBPC 4DO7A 3M0XA 2W63A 4OT7A 3W0KA 1D2KA 2YW4A 3LPPA 1OEPA 3ZR4A 4P7NA 1WKYA 1UKPA 1V79A 2PGRA 3A4AA 4M7SA 3TVAA 5MKGB 3K8LA 5CZSA 4ZQOA 1H4PA 3OVQA 4IQEA 4CNSA 4A6GA 4QDWA 4EP8C 5BYWA 1DXFA 3N9SA 1AH4A 4EVZA 1J11A 4XVEA 4W88A 1VBRA 2Z1VA 3VCCA 3CHCA 1XRTA 1GG1A 1J12A 3P67A 1EHAA 4IIDA 1PX4A 5AVNA 3L4WA 3IAPA 3PBUA 1KCXA 3W7CA 1SFJA 3GY1A 4JTLA 1VB9A 1AQMA 3QPZA 4QM1A 4MJ4A 1E40A 3GD6A 3LTPA 1XYLA 3LRKA 2ISDA 4OVXA 1E55A 2ALDA 3QW3A 2QYGA 1I60A 5C9ZA 5DT5A 3ATZA 1UWIA 3OO2A 2Y8VA 3MO7A 4BHYA 3F2DA 1GHRA 3CYJA 1KD0A 1PL9A 4HMCA 1H0IA 4ZXOA 2IXUA 4H19A 1QNOA 3W1TA 3PZMA 2JF7A 3EKLA 3EA1A 3WFAA 3ECQA 4H9YA 1R46A 4QAWA 1C8QA 3QY6A 3O63A 5F1UA 1AMKA 3IPWA 3MSGA 4PR4A 4A3UA 4AFYA 1CBGA 3PZVA 5H2ZA 3WF0A 4JTRA 4HTBA 4O8RA 4Z2HA 2HTMA 1XGZA 1OM0A 3TSDA 2QJMA 2PLCA 1OX6A 1LBFA 3I65A 3LHTA 3ZSTA 3OPSA 3WQGA 2GUUA 1TPFA 3BW4A 4UC5A 1OF6A 2PB1A 3WNNA 3Q65A 3P84A 1XRSA 3QHNA 4PUDA 4NU7A 1XLJA 2J47A 5CH9A 3KDNA 1SW7A 1UZ4A 4JDYA 2RKXA 3E0WA 3EMQA 1EWEA 3RGTA 5HPCA 4WDTA 2WAGA 3EBVA 5HNUA 1J5SA 5A1AA 3R0DA 4MWAE 2PDHA 1JZ4A 3G8EA 3UJSA 1R0MA 2DSZA 1PKYA 3Q2DA 3S6DA 2E67A 4G8TA 1SR9A 3PPFA 1UP0A 3N2CA 4FMVA 3LOTA 4ATLA 4AYGA 1S5WA 3K4WA 4OFCA 2IPGA 5KETA 3GH7A 3M0ZA 4NAFB 4K8EA 1W1PA 4NI3A 1U2YA 3SIZA 2PD5A 4L4OA 3C2RA 4GE8A 2XVPA 3CZKA 4L65A 2Z4GA 4ATDA 3TQ0A 1EP1A 2NXIA 2EF9A 2EEXA 4GWEA 5DMMA 4EPDC 2CKSA 2JKEA 1XLAA 4C6MA 1YW1A 4NKCA 2FVKA 1QI4A 1N8FA 3DHFA 3KOXA 1S3HA 3FV9A 2VDGA 1T7LA 1S5VA 1PS9A 4B5XA 4Z42C 4CCZA 3BXWA 3WUFA 1WZMA 2QXWA 4EK7A 3PP7A 4GY1A 4HKPA 2HISA 2PC4A 5I23A 1G7VA 3T9PA 4RV3A 2XN2A 4DYJA 1DJQA 1HX0A 1Q7MA 1O95A 2W79A 4XB3A 1UP3A 5DANA 3UWWA 1FTXA 2D69A 4ZQNA 3R6IA 1ZU8A 5CPSA 4CVWA 3M6DA 2UY3A 5G1YA 1MQQA 2Y0FA 1P43A 3CNYA 1A5MC 8RUCA 5A8GA 2P1FA 1JZ3A 1J9YA 3NO1A 1RY0A 2ZWZA 3BLDA 1EQPA 2HQAA 3LYEA 2BG5A 4Z1BA 1NFBA 5C54A 1QW8A 5FACA 3TSMA 2QCHA 4PFHA 3FIGA 2I57A 4GISA 1FWTA 3I10A 3C8FA 4GHRA 1LBMA 4CU7A 4XV0A 3MCNA 2EKGA 1F6YA 5AFDA 1K8YA 2XTKA 1KKRA 3A3HA 4ML9A 3VU2A 5E0KA 1XBVA 3LMYA 2OZ8A 4MG4A 3FCPA 1VCGA 1E6RA 3SCRA 1W3KA 2CCRA 3W81A 3O6YX 1CDGA 3HG2A 1HP5A 1OX4B 3TC7A 4MB1A 8XIAA 5A5WA 3NCOA 2TSYA 1K02A 3C8NA 1W31A 1XI3A 4YWSA 3W7MA 1LG2A 3KL3A 3LA4A 1L6YA 3B8IA 4DUVA 3HN3A 4ZE5A 3LHZA 4CQBA 4EXBA 2JKAA 3N6QA 1TR9A 3U2ZA 1TO3A 3GC4A 2HROA 2XM2A 1ZALA 3ITOA 2PWFA 1EXPA 1YE4A 4DN1A 2UV8G 4B92A 3S1XA 1ZTVA 5DRIA 2NLYA 3AWOA 4XZWA 3IK4A 3MMTA 1UA3A 3S2CA 1UOKA 2D73A 3B06A 4CVUA 2VGIA 2FVMA 3DZ1A 3LY0A 4TMBA 4YTSA 4E3VA 3IUIA 4J3ZA 5AYYA 3MCMA 1UWAA 1OG6A 4V2XA 5A6BA 4ACYA 3RX4A 2YCIX 1UKTA 2WJDA 5FKYA 3BZJA 4GG9A 4AC1X 2YL6A 5BXRA 4KCVA 1UUQA 3BMVA 1XWYA 1YDVA 2GUBA 4KH2A 2QNEA 4H83A 1RCXB 3H2OA 4M0XA 1UZHA 2V5JA 1XIBA 3EXTA 1GQIA 1DIEA 2VD9A 4DYKA 4PMDA 2NX1A 3W7HA 1H7OA 2D23A 1X98A 2BDQA 1PIFA 2W9MA 5AVHA 5BWAA 3PZUA 2P5NA 3MV11 5K4XA 4JS3A 3HPZA 5JMUA 4UFIA 3OJGA 3UEQA 2PDWA 3F5JA 1GQNA 3OB8A 4QBXA 3OGRA 4XZ9A 4LNYA 4O0KA 4D8ZA 1SJDA 4QJ5B 1RBOB 2NV2A 2IPJA 2X1RA 3LHVA 1TV5A 1UR3M 4MTVA 4PYSA 3NZRA 4KETA 4LEQA 3N9KA 5FJJA 2V2DA 4LOCA 5BW6A 4JL2A 3WD4A 4S3DA 3PAJA 4R27A 3AALA 3XISA 3V5CA 4URIA 3GE7A 4YL2A 4I7VA 3LXBA 3WK1A 3OIXA 1BRLB 1NP0A 2G95A 4I8DA 3EMCA 3UCCA 1ONXA 1VF8A 4GUGA 1Z32X 4R5EA 4MYAA 4DQWA 3G8RA 4N2YA 4LAOA 3G1VA 4JFWA 5HUPA 3TR9A 3JU2A 4QHRA 3B9DA 1QHOA 2DU2A 1K6AA 1XLEA 3GKAA 4H9VA 3QPEA 4IMDA 3ATYA 2IMRA 4MDOA 4OJYA 1IGSA 3RCMA 2FQIA 4U2ZA 2F7FA 2WC4A 3Q45A 1XYMA 2WCAA 1B3OA 5A6BD 3AXHA 4EXAA 1PHQA 4ZXLA 3VD4A 4PRRA 3AMCA 5EMUA 4MFEA 4L64A 3M0VA 5F4SA 4L4LA 3U2OA 3GUGA 3WBAA 4AQLA 4R53A 3WIJA 1QCWA 3QQ1A 5AB3A 3QYSA 3R10A 3WJSA 1NJJA 5LGZA 2NX9A 1UR8A 1US2A 4MKNA 2O56A 1B31A 4TQTA 2E77A 3VFLA 1TVPA 1QJWA 3CPGA 3JRKA 2Q3OA 1SJAA 5FA5A 4LC8A 1UWSA 3NSXA 2W0UA 1J6PA 1JGIA 3PANA 6XIAA 4W5ZA 5EA9A 4AVFA 1EL3A 1EDTA 5CPMA 3C5QA 3WQWA 3U4AA 2ZC1A 2PF0A 2VRKA 3T55A 2Y2WA 4NYYA 1Q4NX 1RBAA 4IG2B 3ZXWA 4XO6A 1B4EA 1IF2A 1TX0A 1ITCA 2QF7A 4H2HA 3DFTA 4IF2A 3AICA 2JE8A 5IHRA 2PTDA 1CLKA 1Q85A 2CIPA 3WUEA 3T0BA 3KS5A 1XDLA 3LGDA 2BY2A 1DE5A 3HFTA 3HGRA 4JTJA 1K8XA 5XINA 3APGA 5C8BB 1XLFA 1YPIA 3KX6A 3NQBA 1MEHA 4W87A 1UKSA 3UR7A 3WK2A 5JH2A 2DW6A 2IQDA 5DCBA 3WQDA 3GXPA 2X1UA 1NTHA 1GQJA 2Z26A 5CGQA 3QOMA 3GXIA 4HNVA 2J25A 4MZ8A 1M53A 4YVVA 4QP0A 5D8ZA 3P5YA 4UQ9A 4KCUA 4AD2A 4AWUA 4MUPA 1GGOA 1F9CA 1CW2A 1WDQA 3IIPA 5ECVA 1PPIA 4PCFA 2R24A 4AZ7A 2OSXA 1LUCB 1M7JA 2ACUA 3IVTA 5AOUA 2CLPA 4HCHA 1XLHA 4AZIA 5FAJA 4O8AA 1DEDA 3TEVA 1R9ZA 1JZ5A 3TAKA 5HOSA 4GXMA 2GWGA 4UZUA 3QMRA 3U5UA 3V3WA 4X0NA 5FJRA 1NDVA 2DZPA 4C6EA 3B8UA 4HNCA 1IEVA 1IIHA 1OFQA 2DEPA 3E12A 2ACSA 1U83A 1HT6A 4O16A 1HL9A 1UPPA 2EPOA 3UWEA 3G77A 3V18A 3VO0A 1OK4A 2QJIA 2ZX9A 3VKBA 2GOKA 1AW2A 1LM1A 4Q3MA 4CU6A 5C9XA 4IL2A 4AZ6A 1TTPA 3TH6A 1KM0A 4UTMA 4RLIA 3DCPA 5CAKA 3CQJA 4HHPA 3B0XA 4C6BA 1ADDA 4KF1A 1KXQA 4DX3A 4WZHA 4RDYA 2D24A 3LX9A 2NWSA 3WMBA 5F2MA 4ICNA 4HU0A 1IGWA 4GI6A 1IZJA 1PVNA 2YDAA 4RPQA 3TYBA 3M5XA 1E3ZA 4HTYA 5K9CA 4FNRA 3ZMRA 2QJNA 1UQYA 3CT7A 1S2CA 1HGYA 3OBKA 1C92A 1VAHA 1JDCA 3D5HA 1GWJA 2CBIA 2D20A 4XTIA 2FTYA 5K3VA 1M7OA 3UT0A 3CBWA 1D9EA 5AC7A 1IXPA 3MP5A 3VILA 4B3LA 4FLSA 4RZ5A 1SYTA 2Z1BA 5GJMA 2YCLB 3D46A 1R2SA 2CXEA 3H2CA 3RPMA 1VBHA 3RPDA 3WH7A 2GGGA 1US0A 5MF5A 4HN8A 3TN5A 3GXNA 1DWAM 2GWNA 1HF6A 2P0IA 3ARXA 3LQGA 1O5XA 3EZ4A 4ROQA 1UR9A 1CECA 2QKFA 3EWZA 4MLRA 4UQEA 4DY1A 1UPMB 5D02A 3S5NA 4X9SA 1TJ1A 1IEQA 4MNMA 4QJ3B 4XBSA 3HFYA 4JYEA 1W9UA 4XAGA 4DXKA 4NX0A 4LNCA 2WPGA 5DF0A 1VCVA 3GH5A 4NNBA 1OY0A 4S2BA 5KZEA 2V5LA 1ZL1A 1QNSA 4F0MA 2P76A 3GVQA 3NYZA 3UNTA 1HZYA 2QCEA 3GLCA 3W2LA 4OZOA 3V0UA 3SN4A 2CWNA 3I4EA 1AK5A 3WYZA 1GPFA 3GTFA 1QMLA 4DUOA 2X42A 3AIUA 3FOKA 1ELSA 3HQNA 3VNMA 4GVHA 1SW0A 2X1TA 2X30A 2ZDRA 2JGYA 3NYDA 2PZ0A 2QUMA 1WV2A 3R5EA 2CLLA 2QCLA 1V7AA 4LUYA 4C6LA 2QVNA 4N0RA 1J2WA 3S5OA 3E0FA 1O1ZA 4CNOA 2VGFA 4QQUA 3S5SA 1J01A 3SCSA 3UP8A 4W8AA 5AC4A 1OQFA 1VFLA 3SRFA 4RE4A 1WYIA 2D2OA 3Q94A 2YBUA 4WY0B 5AC6A 2VKZG 1IT7A 1JCMP 1RK6A 3GU2A 1EOMA 4RZ4A 2J6VA 1VKFA 2J62A 4JIEA 5FIPA 4IMAA 4W7UA 4G7EB 4HMNA 4CNTA 1MO0A 1QBAA 3GKFA 1XIHA 4FPSA 1FCQA 5HMSA 1Q13A 4J3VA 2WZEA 2XH2A 4M6UA 5CC6A 1HXJA 3QY8A 4I6VA 4TXEA 1E4LA 4LBUA 3S1WA 4PRWA 3BOFA 3GR7A 5CJNA 2PWDA 1H7XA 3MTWA 1QWKA 5E9XA 3AIQA 3ORWA 1E0UA 2ZBTA 4JQ4A 4AHPA 4GI8A 1TWIA 4Z17A 2Q8XA 2NV1A 5IBXA 2FDMA 2DZUA 4XIAA 4REQB 4FALA 2VXNA 2E9BA 5EMJA 2GUYA 1OYCA 3NOEA 4OECA 2EPKX 1AL7A 2Y8UA 2BGQA 2QLYA 2ZVRA 1JFXA 4IJRA 1EBHA 1OBAA 4FLRA 4UTIA 1ITUA 3UU0A 4QLJA 1B3VA 1E0TA 3KRZA 1B3ZA 1OADA 1G6CA 2CLIA 3GXTA 1TG7A 4WDXA 1NOWA 3PSVA 5KZMA 3LPGA 1HFBA 1TPUA 3LB0A 4IIGA 3PTKA 2A0NA 4JICA 3VPLA 3N1AA 4JNYA 3HJZA 2GGJA 3LV6A 4OIFA 2E0PA 3MYOA 3N11A 4F79A 4IISA 3K1DA 3T7VA 4PTMA 3VCNA 4BEUA 4HJFA 4DXVA 3GG0A 3KZSA 3HU7A 3IUDA 2YGYA 3CB3A 2E5DA 3LZ5A 4GFSA 1VRXA 2WMIA 1IR1A 1KB3A 4UOJA 1EDGA 3LM7A 3PB0A 4KBXA 2A85A 3V36A 3ZFHA 4A2RA 1YQ2A 3H21A 3QZ6A 2F2KA 3N2MA 3UJEA 1S5TA 4GGBA 3UWUA 3OZMA 2A21A 4NAEA 3O2LA 1TV4A 4IGHA 4MWAD 3E6EA 4WQ6A 4CN6A 5K7JA 4WSHA 2OOGA 1DTUA 5HUOA 5TBOA 1TV2A 5DLCA 2E5BA 3W1QA 4D1IA 2VURA 4RNFA 2ALRA 3SFWA 3UZWA 2V2HA 2X7WA 4JHOA 1CGUA 2CESA 8CGTA 2W91A 1IV8A 1CIUA 4L4MA 1IR2A 4QX4A 4KEUA 3ANVA 2BHUA 4L7ZA 1EEXA 1R3YA 5JXQA 4GYPA 1MW2A 2DSVA 1FX6A 4GK8A 3RLVA 1JDDA 5HNRA 3WDRA 3MB9A 4K39A 4E3TA 1XD1A 1NF0A 1F5ZA 1KTCA 2OWWA 4LUJA 3VFCA 1XYCA 2BNJA 4O53A 2DSKA 3AMLA 3U7BA 4EWJA 1GKPA 3MT1A 3W9ZA 2TODA 3M16A 2H3DA 1LRQA 3R79A 4RW5A 1JRBA 4NI8A 4NY2A 3O16A 2G4FA 1HJXA 3GAKA 2X1IA 5G1TA 4A3RA 1E1EA 1BKHA 3IJ7A 3VOCA 4PMUA 3C56A 1B90A 1SZGA 4M56A 1M5WA 4JQ1A 3O1NA 4C6PA 4ZTYA 1NQKA 3SUUA 1H60A 4E4FA 4AMAA 2VFEA 3WMSA 4XSMA 3TXZA 2Z29A 4J7RA 2VZOA 2PD9A 2VZSA 3MI2A 2G3NA 1E9IA 3PAOA 4U4MA 2V67A 3G1HA 3P8IA 3W7OA 3HMCA 4U5KA 2WJFA 1TJRA 2BOGX 4DBUA 3MDWA 4UZSA 2WPBA 2NZLA 5A95A 2WHLA 2F38A 4WJEA 4LT9A 3OHMB 5BCAA 1K6WA 1O5KA 1AJ0A 1JCJA 4LEFA 1FWNA 5EMLA 3WH5A 4JN6A 4DF2A 2X7VA 1GOKA 4EKJA 2NLIA 4IXXA 2H3BA 3RMJA 3G1DA 3EWWA 3E0IA 3R0KA 3VIMA 1ONWA 3STCA 2ZUTA 3KDOA 4V27A 1XKYA 2FB3A 4JHZA 3VGEA 2YA1A 1CGVA 2G50A 3AU2A 2DSUA 5I79A 3A9IA 1V3HA 1ZJHA 4GA8A 2WKGA 4LV9A 3WJWA 3GRIA 5IM51 4JQ3A 2YZ5A 4EF9A 3HB9A 3JZUA 3A4JA 1QPRA 3LPOA 4ADUA 3F7JA 4YCOA 2DQWA 1H1YA 3V5OA 2EPMX 2PDQA 1YNQA 1KR0A 4E2BA 2OLSA 5HNNA 1DVJA 2PDIA 2WANA 1W6TA 3QBUA 2RFGA 1W5NA 1V0MA 4D9PA 3WNOA 4JQAA 1E6PA 6A3HA 1MNZA 1EUAA 2V81A 3B8VA 1TPC1 4MY1A 5LKYA 3NUKA 1DWHM 1O5QA 1WUFA 4D2JA 1BXNA 1BWVA 4UTKA 1F4HA 3BL3A 3EA3A 5M17A 1A0EA 3MV01 2BGSA 1TMQA 3S9YA 3ITVA 1DBTA 4ZOBA 3W38A 4G9PA 1LRTA 1SFSA 4TUFA 2VHLA 3DBPA 3MU7A 1NDZA 3ES7A 3VAVA 3AMDA 3NTYA 4PCTA 1XJBA 2FPVA 3URNA 2RH9A 2VFDA 2VVNA 5D2XA 3CZGA 3SCTA 4JKMA 1K9DA 3SQMA 2G0WA 1ONRA 2MUCA 2HCVA 1HN1A 3HZ3A 2VEFA 3FX4A 2WMKA 4EOUA 5EBAA 2YDQA 5F7UA 3ZOAA 1Q66A 1YADA 2REQA 1DJGA 2QZRA 1VYPX 1A5NC 3EDFA 2WHJA 3UJRA 2YLAA 4DPQA 5ABGA 1R3RA 3WX7A 2J75A 2Q71A 1G1YA 1OGSA 1TWZA 1W56A 4WGHA 3IJIA 1D3HA 1NELA 2DT1A 4CGTA 1Q8AA 1VBJA 1W8GA 2Q09A 1UKOA 4ERAA 4LCRA 1C93A 4F0RA 2R1KA 1QI5A 1CCWB 4P7RA 3QPYA 4ICMA 4Z0JA 2Q8LA 2QDHA 3OBEA 3WH6A 4A22A 2FPTA 1HO1A 3H54A 1E1CA 2HBVA 4S3EA 3WNMA 2OX4A 1GVYA 2Z2AA 1Z69A 4K2SA 4R9XA 1JYVA 4N9CA 6TIMA 3CMGA 4HNNA 1KBKA 1MQRA 4AXNA 1FY6A 4J1OA 4O0ZA 3FA3A 4ZQCA 5LA2A 1QI0A 1GNXA 4X61A 3LCIA 4GJIA 4DBEA 5FEXA 2CYGA 4OBRA 3O6AA 3UPBA 1XLGA 3GNDA 4PMZA 1ICQA 1TUFA 4AIUA 5BROA 2GVYA 4XD6A 1V0NA 3OA3A 5F2LA 1AJZA 2FZBA 3I3EA 4JIHA 3S4TA 3HTWA 4FXSA 2MANA 1I2PA 3PWIA 1Q4WA 3HOJA 1MW1A 1JF6A 3NDOA 4BQ4A 1NWTA 4PUUA 4PH6A 1SMDA 2HS8A 1P7TA 1CT5A 4JCMA 2PRMA 1H1ZA 1VFUA 5A6MA 4PC8A 1GQLA 3CL7A 3GXMA 5CLTA 1LQ2A 1ECQA 1JPMA 2BASA 2J7GA 2WO5A 3WLRA 2AKZA 4IMEA 4PA8A 4DJEA 3GH4A 4CCDA 3ZO9A 1JCTA 3HIJA 1PCWA 1Z44A 4HK6A 5E9AA 4E2VA 4MY8A 4ZSUA 4BR1A 4QS6A 1E4NA 1UH2A 5GNXA 1X38A 2QJJA 4CNPA 4KWWA 3I4KA 4O15A 1EPXA 2E8YA 6XIMA 3WLQA 3ZLFA 1VBUA 1XYZA 3H8AA 2XVGA 4Y9AA 2OEKA 3UGRA 2FYMA 5K4ZA 4O19A 3V35A 3CUZA 3L4UA 3DHUA 5AYZA 1AQ0A 4HMEA 1M65A 4M1BA 1G67A 3TJIA 4BQ5A 4KKXA 4V1XA 2J9YA 4KWUA 4HCLA 1IQ8A 3ABSA 4H9UA 2PDYA 3BLIA 3K30A 4RCXA 3TA9A 3F4WA 3KM8A 3GVVA 1X39A 4IP7A 1DP0A 3UZXA 4YN5A 1C7SA 5TD4A 5G5IA 3KCLA 1R85A 1KM2A 1LCOA 4U2YA 5T9CE 2ZE3A 3EB4A 2ZUWA 4L1XA 5AC8A 4ZOCA 3ZT6A 5C6MA 8XIMA 2WYSA 2NVAA 3W86A 1D7KA 1NVMA 4O54A 4L4PA 5ABTA 1XSIA 3N19B 5CAHA 3P93A 3ITLA 1QVBA 2C91A 4JTUA 1JIBA 3DOPA 1C90A 4CD5A 3WUGA 3VABA 1EC7A 2Y5EA 3UWYA 4YNGA 1GYMA 3E5PA 4ZENA 4AC7C 3DESA 1E9YB 2NQHA 2PRLA 1CLXA 5D9PA 1N55A 3SBFA 4LH8A 5I77A 3ZWTA 1EFZA 4WDUA 3WLTA 4KRTA 5RUBA 3K4DA 1Z48A 4LS2A 1W9BM 3ALFA 3NDYA 3U6WA 1O4UA 2JIWA 4Z1DA 1RBLA 1XG3A 1OABA 1LLZA 3STGA 1TFVA 4DJED 3O9NA 3W2UA 5REQA 5L9FA 2EO7A 1SZNA 4B4HA 2CZEA 3TONA 5F2GA 4F0LA 3GIQA 1C7TA 4MNJA 4Q8TA 1C8XA 4ZMGA 5AZ1A 1CENA 4N9EA 4O52A 3QLDA 1XDJA 1ZBVA 4W86A 2B81A 3A4XA 2OYKA 2OELA 5KINA 1XC4A 3MHUA 5G4HC 2QULA 3IIVA 3TLLA 4IT1A 3PC0A 1LLWA 4QLLA 3VDAA 4GVGA 3WF4A 4IIBA 4QEEA 2DZVA 5HR7A 3QSTA 3UVIA 3RX2A 4AIBA 3AOFA 3WQVA 3HQ1A 1T5AA 4NP7A 3GXFA 4QIUA 3LHYA 1RV8A 3WEZA 3C0LA 2ABBA 3LG3A 3O6DA 3T42A 4G5DA 1A5BA 3TW7A 2R91A 4AHOA 1XLKA 1CXHA 2W27A 1MQPA 4O1EA 5CC3A 2GJXA 2J8TA 2YL5A 1TV3A 3RRXA 2ANUA 2ONEA 1IXQA 4ZOEA 1RCQA 1VHCA 4U31A 1JYWA 3N2XA 4QE5A 2V3GA 3WDHA 3H2MA 3TKFA 4OTKA 1CB2A 3URAA 2HPIA 5C7HA 1U5JA 3BLOA 3MZ2A 2GDVA 3OVGA 3T0CA 2OQYA 4Q8WA 4R88A 1JDAA 3EWDA 1GTHA 3M7WA 4PTNA 1GJWA 4IJBA 4BZYA 4EACA 3SCWA 2VDHA 3VMOA 3E38A 1A47A 1MFUA 5LIKX 2DORA 1OIFA 2ZZ2A 1G4EA 1XLLA 3LCFA 3CZLA 1HW6A 3E9AA 1R3SA 4JIRA 1JJKA 2QV4A 2CLOA 4Q7IA 3USBA 2GVGA 4J2PA 2DT3A 3W73A 5LYRA 3VXGA 4C90A 3HG5A 4B15A 1QXLA 2WOQA 1UJPA 4AX7A 3PY2A 3QOKA 1N7KA 2PA6A 3W7QA 4N42A 1BTCA 3DXIA 1C29A 1JULA 4JYFA 2Q6ZA 2CLMA 3F5KA 1DOSA 3D3AA 1I45A 1TELA 1WKFA 4P8VA 2J7BA 1XUZA 5HBFA 5CZ0A 3EX3A 4MB5A 1TB3A 3V16A 3EWYA 4ALDA 3QZEA 1PUDA 3BLEA 3F4CA 3AROA 1PCKA 3I7SA 3PZTA 3L5LA 1DWIM 5LNSA 1UWRA 1EPVA 2ZRXA 3AHXA 3UXIA 2WSQA 3G22A 4V33A 2VEGA 3MSRA 2W62A 4GX8A 4LU0A 3ITCA 3E2RA 3BAKA 1MFVA 3GDLA 1HUVA 3GS6A 4PZVA 4LBSA 2D2JA 2WV8A 4QXIA 2IKGA 3LV5A 2YL9A 4X2PA 4QCFA 4U3CA 1YDYA 4GZ7A 4MB4A 1QNRA 1Q6CA 4IFRA 4GNVA 3G18A 4BF5A 1WBJA 1TMHA 4KFPA 4C5YA 3B05A 2GYIA 1CXLA 1HJQA 4HU4A 3IS4A 2V30A 5CJMA 4DJFA 3A64A 3KWXA 2YW3A 3FJLA 1EJVC 1Q7ZA 5D05A 4C65A 2Y8KA 4YHGA 2A3CA 3RHGA 1EA9C 1UBPC 4AVNA 2PZNA 4C5ZA 3NQMA 1FXPA 3KLLA 3M0JA 4WD0A 5B7ZA 2FH6A 2HE8A 2X0SA 5AKQA 1O68A 3T2OA 4FOKA 1ZP3A 2GDUA 4DIAA 2CNCA 2VI0A 3THDA 2G96A 3MI3A 4J35A 2PDGA 1OD8A 2VELA 3LI0A 4LS0A 2FJUB 4HK7A 1GQKA 1K9TA 4DM1A 2UBPC 4NJIA 3UESA 1ZQ5A 3VZYA 1TX2A 1HKMA 2C1GA 2DP3A 4B5TA 1F8IA 1W54A 4DVOA 1KGXA 3WL0A 2ZE0A 5CLWA 3UCDA 2WMFA 3B03A 1OSEA 4H6KA 4MNKA 2E09A 3O8AA 4W7VA 4AUBA 2Y24A 2YYUA 1VEPA 4JXCA 3IIZA 2I9EA 2OQLA 2Z00A 3EEZA 3T0AA 3D0CA 1UCWA 4HB7A 3U7VA 1BWLA 3FGCA 3RNDA 3R8RA 4LJ3A 1U5VA 2RGLA 3VX1A 1W91A 4ERIA 1L2UA 1UD8A 2R8WA 3TYAA 3WEMA 1MSSA 5D04C 3L21A 1NFPA 1WDPA 1NIUA 4WJXA 2J27A 2V82A 3QZAA 3QRHA 3ZJ7A 4R7WA 1Q2SA 1R7OA 4F2BA 1V0KA 3UZYA 4MKVA 2BHZA 4GO8A 4MJMA 4BI7A 4KFNA 2W92A 4MMWA 1FDZA 5LXEA 4MAVA 1V6VA 1W37A 2V69A 5A94A 7CGTA 1SGJA 3AS3A 4QNWA 2FTPA 1G5AA 2GQ8A 3ITXA 1DHPA 2QUVA 2WQPA 3H22A 4GIYA 4DJFD 1QU4A 3NQVA 5M03A 3CHVA 1KFKA 3QLLA 3IRSA 1TPH1 1TPDA 2ZKMX 2CFFA 1RAKA 2C16A 4I9MA 4LYRA 4Z2JA 3VIPA 2PU1A 1W1B1 3DFPA 3MPGA 3N25A 4PUKA 5CGTA 2C19A 2XIIA 1PTGA 3CQHA 3DG6A 1ZJIA 1V03A 3NQ7A 2ISSA 4G2DA 4MAZA 1FDYA 4NX5A 2GVEA 4B91A 3GHTA 4NZJA 2WBGA 3TYEA 2HNHA 4H6QA 5AHFA 2J4GA 3S1VA 3TX9A 1H7NA 3AJXA 2H9AA 4UNLA 2WZTA 4Q4QA 4MJZA 4Z2GA 3GU1A 3RJXA 3IGUA 5D2TA 4OUEA 3S8HA 3WBYA 3VK5A 5GVJA 1IEIA 3WDPP 1SQ7A 4FIQA 3PUEA 1US3A 4NRSA 4UCGA 1OCJA 1PYFA 2BVDA 3FLUA 4GABA 1HJSA 2RAGA 3BJTA 4AY1A 2XFRA 3S42A 1OC7A 1POJA 1BXBA 3KTSA 3W24A 3HF3A 3INPA 2OOFA 4M51A 5C9WA 4GKTA 3S1UA 1RCOB 2XIJA 1OJXA 4MY9A 2VC9A 1ME7A 4K7YA 3LXAA 4H3DA 3W00A 2Y63A 2EG6A 4GIEA 2PCEA 2OKOA 3SI9A 4EWND 1JUKA 1PZ1A 2VR4A 4NXKA 5E0FA 2ZA1A 2C8NA 3WO8A 4HA4A 2WC7A 4HOXA 3VNYA 3AI0A 5HXMA 2NQLA 1JZ8A 2A7PA 3RM9A 5H6HA 5CZJA 3PS7A 1FWSA 3EX2A 2QGHA 4KEZA 2EBNA 3IJDA 1PZ0A 4PL2A 2VJXA 3CWNA 1UD6A 1NF7A 4BS0A 1W5PA 3TXVA 4GY7A 1Q6QA 4EPBC 3EDKA 3WNLA 5JH1A 2ZOXA 5CPQA 2WMIB 2YBTA 3SN0A 3H6OA 1BQGA 2DT0A 1X1ZA 4QDPA 5F4XA 4O13A 3BC9A 2PBOA 4GI9A 1ZBCA 4IGMA 1DJZA 4JFSA 3UJFA 4NAEB 5LNRA 2XH4A 4S2CA 2O55A 3KLKA 4C6JA 4PUEA 4HJWA 1FVPA 2YFOA 3LHWA 3WLLA 3UXAA 3ANYA 3KHJA 4MJ2A 1KM6A 4TVUA 3C0SA 3TQVA 2XN0A 3AHZA 1XISA 3ABQA 4GQGA 4H9ZA 4UB9A 1XG4A 2PODA 2J88A 1OFPA 3CHEA 1JF5A 1GVQA 3MVIA 4D6GA 4S3GA 3D47A 3ZQ9A