3C3NA

Crystal structure of dihydroorotate dehydrogenase from trypanosoma cruzi strain y
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
311
structure length
311
Chain Sequence
CLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAVPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase
publication title Crystal structure of Trypanosoma cruzi dihydroorotate dehydrogenase from Y strain
pubmed doi rcsb
source organism Trypanosoma cruzi
total genus 109
structure length 311
sequence length 311
chains with identical sequence B, C, D
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2008-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3c3nA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3c3nA01
1ME8A 3DFSA 2J27A 5HQEA 4CLMA 3W7DA 3W1QA 4KFOA 3TK7A 1GPWA 1SW3A 5K4ZA 3EXRA 2QAPA 4Q33A 3LTYA 4LV4A 3LLFA 1N8FA 3RLVA 3N34A 1KLYA 3Q2DA 3W1TA 1RD5A 4S2CA 4UFHA 3P5YA 4MZ1A 1H1ZA 1K8XA 1R2SA 4KFPA 4UIOA 3O16A 3W7MA 1VCFA 4N2YA 3DZ1A 1SU5A 2NX3A 2XFWA 5FESA 2HTMA 1XM3A 2W79A 2QCCA 3LB0A 4O1DA 3P8JA 4U28A 1Z41A 5D38A 1JUEA 1F7BA 1T96A 4UMAA 1R2TA 3OBKA 3P84A 1D3HA 3UWYA 2VFGA 3P80A 2A6NA 3HOJA 3W75A 3S0CA 4KKXA 3UY8A 1W8SA 2Q3OA 1DJQA 4IX0A 1DBTA 3HG2A 5EPDA 3DBPA 4ZQRA 3TR2A 5DCEA 2XN1A 2RDTA 4BWLA 4IMGA 5HWMA 1QOQA 2ABBA 1MSSA 3EX2A 4R7JA 5F4WA 2FIQA 3W1LA 1LLWA 5E0KA 2B7QA 1KM1A 1OF8A 1KTBA 1R2RA 1JCXA 1W3TA 2H90A 1H61A 1IF2A 3E96A 1QDSA 4HPJA 3W07A 1ML1A 4X9SA 4H6KA 2TPSA 4FEZA 1A53A 3QJAA 2CLFA 3G1FA 5AYXA 4K36A 4WY0B 4YWIA 4NJHA 1K8ZA 3OVQA 3U8GA 1VCGA 4JTUA 3W1RA 1M6JA 2A7PA 3NVTA 4E2BA 3AO0A 3TW7A 2PC4A 4NJKA 3W7CA 2HMCA 1TSIA 4ORIA 5TIMA 3V1PA 4JS3A 1F73A 2ZRWA 4GUIA 3BPWA 2ZRXA 3T40A 3IV3A 1NF0A 3SI9A 1TPVA 3P74A 4ZQNA 5FEXA 1DKWA 3GDLA 1C29A 1KM2A 2B0MA 2QUUA 3MW7A 5D30A 3E49A 1SO5A 3WK2A 4JTEA 2CWNA 3NQ7A 3DENA 1VYSX 3S5NA 2F84A 4AWTA 4Z1DA 3DFNA 1FCQA 5LHEA 3B0UX 2I9EA 1TPWA 2BWGA 2Z2UA 2NXIA 2A2IA 3CPRA 3IVSA 3DI0A 3P60A 2VELA 5IM51 4GUJA 3DKJA 3LCGA 2Y63A 4O50A 3TFCA 3NYZA 2JKAA 3MHUA 1G69A 5EKYA 1UBSA 2WSRA 3PBWA 5KMYA 3FA5A 3GDKA 3E12A 1S5VA 3VE9A 3L0KA 5HINA 1NSJA 4GXMA 1JR1A 3QM3A 5DELA 1HL2A 2LLEA 2J88A 4XBSA 4ADTA 1F05A 3DAQA 5D33A 3EWWA 1KFJA 5BNKA 3RU6A 2DJXA 1VS1A 4AHQA 3ZWSA 4JTTA 1TV7A 4BI6A 1WQ5A 4UTLA 1XI3A 4LS0A 4JDBA 1KTCA 3L0GA 1YDVA 3SGZA 3ABSA 5F1UA 2AGKA 3TSDA 2QJIA 1KBJA 1WBJA 2PE4A 3KVLA 3O06A 5C54A 4O28A 3FYPA 3W70A 5FF7A 3TSBA 5LNWA 1P0NA 2Q8LA 2D73A 5CZTA 3LHTA 4UFMA 1ZNNA 5E93A 4FIRA 2NXHA 2C19A 1SUXA 1Z42A 2BXVA 3SW6A 4TU1A 1YPFA 4IUOA 2DZTA 4WOQA 3W7OA 1FWTA 1XBXA 3WJWA 4O4VA 1VRDA 3TSMA 1DHPA 3O6YX 5CSRA 3P8IA 2O7SA 4O15A 2ZRZA 2TSYA 3WJZA 1A5AA 2G95A 2VKZG 1XFBA 2Q8ZA 4CNPA 4Y90A 1YADA 3LCXA 3GNNA 3G1DA 2V2HA 4M7SA 1JRBA 1SSGA 1J5TA 1MO0A 4NUWA 3IRDA 3HGSA 2X16A 3N2XA 1DQXA 3PB2A 1IGSA 3W2KA 3NQ8A 4LV9A 4QNEA 3QPZA 2VOMA 2XN0A 2GUUA 4O19A 3GNDA 3UQNA 3T4CA 3M6YA 3LHYA 1H63A 2FFCA 1GJPA 4JICA 2NZLA 3T44A 4FX6M 1UUMA 4O1BA 4RZ6A 3H55A 3QQ0A 4LW7A 1FXQA 1SR9A 4FF7A 4ZQPA 1K7XA 3H54A 1Q6QA 1UUOA 3R89A 1KV5A 1QO5A 3BARA 4FNTA 2V81A 1YPIA 2DP3A 1F6KA 1QR7A 1RQBA 5AHFA 5AOUA 3GXPA 2DZSA 3HO8A 5L9FA 4EIVA 1TQXA 4FNQA 6TIMA 3N9RA 1QAPA 5HR7A 4GC4A 3NQMA 1TCDA 3INPA 5HJLA 3KFTA 3S42A 3GDRA 5K9XA 4XWUA 1W5QA 2GVLA 3PAJA 1OJXA 3OA3A 1W31A 3UNDA 2DZPA 5FI8A 3RF9A 5CPNA 4GUHA 3EWUA 2FDSA 4O1AA 3JRKA 4BK9A 3LI1A 3BW2A 2HSAA 1OVDA 1WV2A 3NM1A 3UYCA 1ZAJA 5F2MA 2V9DA 4M7TA 4S1FA 3UWUA 3NL3A 3QYQA 1R47A 3I7QA 3N2MA 4O54A 5HULA 4ORMA 1FDJA 3E0IA 3TC6A 3QSTA 1SZGA 3LTSA 3NQEA 1F74A 2UV8G 4NT0A 4MLJA 1W5NA 1ICQA 2H6RA 2WPBA 1P1XA 4NJIA 1TPEA 1XL9A 5U7SA 4K8HA 5G5IA 2P10A 2CLKA 3FKRA 1GYNA 1W5OA 3GAYA 1W5PA 5EL1A 5HR6A 3CIXA 3T55A 3TMQA 1FBAA 2QCHA 3TQ0A 3STGA 4C1LA 1I2OA 3FYOA 1H7OA 2EPHA 3G1SA 4RK8A 1JQVA 4RZ5A 1X6UA 1I8JA 3GB6A 4CNNA 2Q3RA 1QWGA 4OT7A 2QCDA 1KFCA 1GTHA 3FEMA 2QKFA 4B5NA 3LHWA 3W74A 1G4TA 4YMZA 3W83A 2WNZA 4RR4A 3OVPA 1FDYA 5E1QA 3ZFHA 3A21A 3WJYA 1K02A 4A22A 3W7HA 4M6QA 4JTLA 2OCZA 3LI0A 1PVNA 1TPB1 4IMCA 3SR7A 1PHQA 4FNUA 4GFSA 5EA9A 1OFDA 1UJPA 3ABOA 4FXSA 3W1MA 1W54A 4FNSA 4MFEA 1JQXA 3ZR4A 1O95A 1AG1O 3ABQA 3CEUA 1GG1A 2KZHA 1GT8A 4J9JA 2AAMA 4LWWA 2FPTA 2CZDA 3M41A 2V5LA 1XBZA 3IIZA 4S2BA 2OX1A 4Y96A 3BW3A 4ZMGA 1Q45A 3G24A 1WBHA 4RZ4A 2GOUA 2PURA 1Q6OA 1SFLA 2B4GA 1JVNA 1TTPA 4AHOA 2RFGA 4IMEA 1W5MA 2DZWA 1TTJA 3UZJA 5DLCA 4LRSA 1JCYA 4Z0JA 1A5SA 1DVJA 1MEWA 4N9EA 1W1ZA 3MBDA 5DN1A 5G1TA 4DPQA 3IGSA 1C9DA 3ELFA 3TW6A 4JN6A 2JGQA 2NX1A 1YTKA 1M7PA 1B4KA 1OFOA 2YFOA 2E6YA 5J5DA 3QMRA 4NZFA 3CTLA 1KFBA 3R13A 5CZJA 5U4NA 1GVOA 3QSRA 5L6UA 4CQAA 2ZA3A 3BGJA 5LNVA 2JBMA 2RKXA 4JEQA 2R91A 3S5ZA 3B04A 3CEPA 1ZY9A 2QR6A 2NV1A 5I3FA 3TMLA 5EY5A 6ALDA 4O57A 1HG3A 3NQDA 1TMHA 3FJ6A 4I7WA 4A21A 4O11A 3W1NA 4JTKA 5KZEA 1EP1A 3HBLA 2Y6ZA 1M5WA 2WSYA 2NUWA 1EP3A 4W9TA 5CKSA 4X22A 3G1AA 1RV8A 1Q6LA 1WYIA 1KM4A 4ZVJA 2F7FA 3NL6A 1KFEA 4HHPA 3CM4A 1BEUA 3PB0A 4NNBA 3DFTA 1V5XA 4AMAA 1N55A 5TQLA 1XBVA 2QCNA 5MHBA 1O60A 3CHVA 4DBDA 3GKFA 3GR8A 1TREA 3Q37A 1OF6A 5AHLA 4Z1BA 4AHPA 3R2GA 3QPYA 1SO4A 5KTLA 1TYGA 1WOAA 3G8EA 4DBEA 1PL9A 5I3HA 4OHQA 1DORA 3O1NA 1TTQA 2PRHA 3LV6A 1U5JA 2Y89A 3MYOA 2WJZA 3LRKA 5AC6A 2X1TA 3FS2A 1WX0A 3HQ1A 2V2DA 4WX2A 3TFXA 1DJNA 1QPRA 3NAVA 1IXPA 4JR5A 5G4EA 1V7YA 5AB3A 1RQEA 4YLWA 3TV8A 1KV8A 3PSWA 4BI5A 3C61A 4FB7A 2Y7EA 4ZZ9A 5EMUA 3TIMA 3FOKA 2E5CA 1TTIA 2A85A 3M43A 4RLIA 1E51A 3TU9A 3QF0A 4JDYA 3C2RA 4JD4A 5CPLA 3L5MA 2OZ0A 3W87A 4OWGA 3MBFA 3GXNA 1LOLA 2E6DA 1TRDA 1GVFA 2GPTA 3GYEA 3O63A 1GOXA 2WV8A 1FWSA 4G1KA 4DF2A 2OT0A 2ATSA 5DCBA 2FPYA 4LS1A 3UWZA 5D32A 4PFMA 1SZEA 2ZFAA 1FWNA 3KVKA 5D2TA 3F4WA 3IIXA 4GUGA 3THQA 4WD0A 2C14A 4NX0A 1ALDA 4UNLA 2OT1A 3NPUA 1OHLA 3MWAA 4GBUA 2QDGA 4WY0F 3P82A 2H8ZA 1DV7A 2CZEA 3G3DA 4GWEA 3P62A 2QCEA 2R8WA 1K8YA 3LHVA 1VH7A 1LLZA 2Y7FA 3G0UA 2A7NA 3B8DA 1ZALA 3P5ZA 3W7QA 4QIUA 1KBIA 2VEKA 3BV4A 4L4MA 3L66A 1KM5A 4ICNA 1PS9A 2A5HA 3ANYA 4HNNA 3HPXA 1J4EA 3QZEA 3L5AA 3C56A 5BW6A 3C2VA 3W73A 2HS6A 2YPIA 1YLVA 1LZOA 4H3DA 3CB8A 4LC8A 2GQ9A 3DFQA 2J24A 3G1XA 1DQWA 4CQ9A 2NV2A 3C2OA 4OQVA 3LTPA 1SZFA 1TPDA 5CZSA 5AFDA 5LNUA 1XBYA 3N73A 3WK3A 3FIGA 1KM0A 4CNOA 2QCLA 2RHGA 5D37A 3NPXA 2E5BA 3GVGA 1SPQA 4AEOA 4OV4A 1G4PA 3MI6A 3W86A 1TPUA 3HG5A 3NZ1A 2DZVA 4TO8A 4OU1A 5IBXA 2FPVA 3LCHA 1VGAA 1EPXA 1L6YA 3PS7A 1F2JA 2BTMA 7TIMA 1MEHA 1GQNA 1VZWA 5AC7A 4L4LA 3VKJA 4LUIA 3M9YA 3M16A 2DZUA 2P0OA 2DORA 4PEKA 3LLDA 2ZRVA 3OIXA 1H62A 4Q4KA 1I2PA 2VEMA 3MP5A 4O16A 4AXKA 1NFBA 2WKJA 5FEWA 2W6RA 3ABRA 3L68A 3TAOA 3GK0A 3W1UA 2ZRYA 4X3ZA 3RNDA 4JX4A 4RX0A 5K7JA 4OV9A 3QQ1A 2YCEA 3L9CA 3DGRA 5C2XA 2E6AA 4LRTA 3W7EA 4E38A 4DELA 3BO9A 3Q58A 4NXSA 3WJSA 3CQ0A 3CT7A 4ZQMA 2ZYFA 2J9ZA 4CCDA 2BX7A 4K38A 1LOSA 3E02A 2P1FA 3DI1A 2TYSA 3B4UA 2X1SA 3WK1A 3GX9A 5DCDA 2R14A 5HUPA 3BGGA 1YXYA 2ZQ0A 3OHIA 3W7GA 2YSWA 3NZRA 4NJJA 4O14A 1ICPA 3TJXA 4O0ZA 4WJEA 1NVMA 4YL2A 4AF0A 3LM7A 3M1ZA 2YYUA 3G22A 4JYFA 5CPOA 3CWOX 1BWLA 2QUTA 3PWAA 4DO4A 1G7VA 2J6XA 3SSJA 3W2JA 1H7NA 4TX9A 3QW3A 3W22A 3BG3A 2EAWA 4FO4A 4QM1A 1AW2A 4PA8A 1VYRA 1IXQA 1AW1A 1UCWA 3EKZA 3NPVA 3GR7A 1OFEA 4TMBA 1B3OA 3PM6A 4FIQA 3NXFA 3HPZA 1JULA 4FNRA 1O5XA 3TE9A 3N14A 4O0KA 1MXSA 4IGHA 2ZTJA 4HNTA 2ATMA 2QEZA 1GZGA 5G1YA 3C6CA 3AJXA 1DL3A 4PL2A 1OFPA 1LRNA 1O4UA 2JKEA 3W7NA 2ISSA 4CCCA 2YZRA 1EEPA 4K37A 5IBXC 5GVJA 1VJIA 3TXVA 4NU7A 1H7WA 3A24A 1TRIA 1SQ7A 3U6WA 4O17A 3W85A 4DPPA 1KLZA 3TROA 3W1AA 1WAUA 4BFAA 1IXOA 3S5OA 4JYDA 1H50A 4RXGA 1LRQA 3HGJA 2QCMA 2RDWA 1GG0A 4LU0A 4AWSA 1OX4B 1VYPX 5BMXA 3QFEA 5DBUA 4MVAA 1AW5A 3I7RA 1ME9A 4WOZA 1G6CA 4RV8A 1W56A 3TCEA 2VFDA 5F2IA 1VQTA 4D2JA 2CLHA 4NVTA 4AWUA 3SFKA 4XKYB 5LGZA 4WUIA 4MLRA 5CPMA 1EWEA 4NNCA 3L5LA 5H2ZA 4MY8A 3W2UA 2A7RA 3NQGA 3WK0A 3LHUA 3F4NA 5AC8A 4JNMA 1XXXA 5LZLA 3LOTA 4R34A 2JKPA 4LVGA 1PV8A 3VNDA 3P7YA 4OBTA 5A5WA 3RMJA 3LERA 4GJ1A 1QPNA 4WY0A 2G5WA 2X30A 1JCNA 3O6CA 5F2GA 2CLIA 4OE7A 4I7VA 2B7PA 4AB4A 3LRLA 4UTMA 4AH7A 2DZXA 1XCFA 5AHIA 5KINA 5H91A 2ALDA 3W7JA 5FF4A 4UXDA 2ZZ2A 3LGEA 4MZ8A 4X2RA 4E2DA 3IIVA 3V75A 3B03A 5K2ZA 2QUVA 4UFLA 3TQVA 1EB3A 4LC6A 2YW4A 2VENA 3LCLA 2ZZ7A 4IMFA 1GVQA 3ZWTA 2YYTA 1QOPA 1XC4A 3W76A 5TBOA 3TAKA 4YXGA 3FFSA 2VFEA 1H7RA 1OYBA 1TJRA 2Z1BA 3YPIA 3S8HA 2GJNA 3A5FA 4MIMA 1AK5A 5D2XA 4IX2A 2HS8A 3USBA 1VPXA 3BLEA 1Q6RA 3LDVA 1LYXA 2OJPA 4UTUA 3EWBX 2C1HA 3SJ3A 3O05A 1UB3A 4QNWA 4IJBA 4IPJA 3SIZA 5HNRA 4JYEA 5D04C 4MKNA 2ZA2A 4R33A 5C6MA 5AHMA 3M5ZA 1AL7A 1QNVA 2NX9A 4FX8A 1T99A 1D3GA 4QJ1A 3L0NA 4POCA 1K03A 4O12A 5J5RA 3M5VA 1N7KA 5FF2A 5HMSA 3CIWA 2PRMA 1CX9A 4O18A 2EGZA 1NEYA 4UTTA 3QMSA 3UZ5A 3NQ6A 3STFA 3P67A 2Y7GA 3NO5A 3DXIA 4JX5A 3NQ2A 2E1DA 1TPH1 3C3NA 4H4IA 1ZENA 3NGJA 3L21A 2GVGA 3S9YA 4WZHA 3S1UA 3HPSA 3DH7A 2V2CA 1K7FA 3HIJA 3BLIA 2QDHA 1OG0A 3HJZA 3UY7A 4LVAA 5I3JA 3MJYA 1GEQA 4C1KA 4KWVA 3TXZA 1HFBA 1XUZA 1X1ZA 1KM3A 1S3HA 3GAKA 2EF9A 2VEPA 3PUDA 3VFLA 4A29A 5K3VA 5DXXA 3EX6A 4GNJA 3H53A 3F03K 5LNRA 5G2HA 3A9IA 4UFKA 3VE7A 4JTGA 2G96A 5LNSA 3C2EA 3K30A 3KRSA 1K7EA 1YXDA 3R12A 4JTJA 4ZQCA 1GTEA 3O07A 4QISA 5KITA 4MY9A 3UWVA 1YDNA 2CFFA 1CW2A 4O4WA 3VCRA 3O8AA 4BR1A 1W3IA 4HNUA 3DFPA 3NR0A 4UTWA 3MP3A 5FF3A 3KRZA 4YCOA 2GQ8A 2FLIA 2ZZ1A 3W7KA 1WDWA 4TIMA 3NL2A 1FX6A 3TDFA 1EA0A 4NX5A 4P61A 1RPXA 2FB3A 4XBKA 1LBFA 3LHZA 1SO3A 2RDUA 3S6DA 3NA8A 2JK2A 2X2GA 1B4EA 1G7UA 2IQTA 3O15A 4Z0SA 3LXCA 3PG8A 4A2RA 3TH6A 3W2NA 3EWYA 1QMLA 1TO3A 3M44A 4K7YA 1IIHA 3W84A 4Y9AA 1BTMA 4HN4A 3BW4A 3NPWA 4ONVA 3PC0A 3W2MA 3IIPA 1RR2A 4UFJA 2NWRA 2ZZ3A 3JR2A 4P2VA 2WSQA 4UTTC 4HSOA 4JGDA 4N6EA 2C0AA 2E77A 3S1XA 4DO5A 4PTNA 3G0SA 3P81A 1TPC1 4AF0B 2QJHA 1JCLA 3N9SA 2YFNA 4IOTA 5D03A 3TJLA 4AVFA 3PVFA 1XKYA 3EB2A 1QFEA 3W7LA 1H5YA 4NQ1A 1SFJA 4NZJA 4TMCA 1VCVA 4MZYA 5T26A 1S5WA 3I68A 5CGQA 4N9DA 5G2WA 1FCBA 3G1YA 4UUIA 3LXAA 2NUYA 3UWWA 1P5BA 3LCFA 3EKLA 3MYPA 2C13A 1PCWA 3U2OA 4ZQOA 5F4XA 1JCMP 4UTJA 3D0CA 2EHHA 3HG4A 1I2QA 1T0OA 3PUOA 5LHFA 1VR6A 3P61A 3QMTA 5D2WA 3G1VA 3VI2A 3DKLA 4ZL1A 4XZ9A 4QQ3A 1Z44A 3IIOA 1GVRA 1HO1A 1R46A 2Y61A 3PBUA 1S5TA 3B0VC 1XDMA 5BOOA 3NEVA 4LVDA 2C6QA 3NQFA 4ALDA 3DFOA 3T78A 4FNPA 1WA3A 4LNYA 3TUUA 4NXKA 5D05A 2CLLA 3TC7A 2A0NA 4UTWC 3R5EA 3RFAA 3BG5A 3HG3A 4N02A 3MHFA 3L65A 1P0KA 3SY5A 2C18A 4Q32A 1GWJA 2YGYA 1OYCA 4Z08A 3EX3A 2WNQA 4JX6A 4LTSA 5C55A 3KX6A 2WOQA 1KTNA 4R53A 3PBVA 1KM6A 3JS3A 3KHJA 4FXRA 3Q94A 3LBMA 2XN2A 3C52A 1YXCA 4ML9A 2Y7DA 1H7PA 1H51A 5FEPA 3EWZA 3A23A 1I45A 3L67A 1W3NA 5LKYA 3UPWA 4U4MA 1ZAHA 2VFIA 4PC8A 4K39A 2TRSA 4LY8A 4RJEA 1OFBA 2E6FA 3KRUA 4K8EA 2H3DA 4EF8A 3EX1A 1THFD 2A4AA 3IGUA 1X1OA 2Z6JA 4N6FA 2QJGA 3GDTA 1B57A 3EX4A 2QAFA 3PBYA 2O7QA 3LXBA 2CLEA 4M6PA 3GXTA 2ZDRA 1CI1A 2ZZ5A 2C16A 4HT3A 3HB9A 2Z6IA 2VFHA 4A3UA 5D2VA 4RXFA 3FKKA 3NQVA 3W88A 2E09A 1MZHA 5BMWA 1X8FA 1FQ0A 4GE8A 2PRLA 3OVRA 5DXYA 3NOEA 4O13A 4UTKA 1LDCA 3BLFA 1G67A 2W0UA 3N19B 1AMKA 5BRBA 4QITA 1RZMA 3C8FA 3G8RA 1LP6A 4IWWA 2V0TA 4MPQA 4HPXA 4Y6GA 3UXDA 1NAL1 1EIXA 4N9BA 1X7FA 1VLIA 4KFNA 2V5BA 1JJKA 4MJZA 1YTEA 1FUYA 3PULA 1A5CA 1VHCA 3ATZA 2YR1A 2A6LA 1EX5A 2ISVA 1EWDA 1H60A 3GKAA 4XTDA 1F5ZA 3SECA 2QCDB 1LM1A 2BLEA 2RH9A 3QW4B 4NNAA 3CU2A 2FB2A 3NDOA 4QSHA 2TMDA 3G18A 4NJGA 3G3MA 4XTIA 1OFQA 4BF9A 2J9YA 2CZ5A 4K6AA 2J9XA 4FX7A 1ME7A 4RCXA 4Z1CA 4K7VA 1KFKA 4MY1A 3E9AA 4JY9A 1ZHAA 2FTPA 4DXVA 2V8ZA 4XUGA 1GVSA 1H1YA 5F4SA 1LOQA 4A2SA 1MEIA 3O6DA 3BVJA 1ZFJA 1VHNA 4GRSA 3MHGA 5KSWA 3CC1A 3F1QA 2QCGA 4LVFA 2V82A 4BWLC 1OYAA 1JUKA 4N4QA 3EEGA 1WOBA 3T7VA 4AAJA 1PE1A 3TNOA 3N3MA 4HKPA 5K9DA 2VFFA 1Z48A 2ZCGA 4UFIA 1EUAA 4HNVA 3B05A 4JIQA 4DF1A 4EVZA 1J2WA 3S1WA 4PL1A 4UNKA 4PODA 3QEZA 1OABA 3RK8A 3WFAA 3C4UA 3MI3A 2ZZ6A 2YDAA 3W7PA 3QC3A 5ABTA 1LRTA 3M5XA 3CLMA 5K9CA 3NL5A 3BK0A 4QAIA 1TB3A 4LUJA 1JUBA 4N4PA 5AHNA 1QO2A 4OGZA 3HGOA 2WQPA 1DOSA 4XQ6A 4UTHA 2E68A 1A50A 3DHFA 1O94A 2NLIA 3LBCA 2AQWA 1L6SA 4ADSA 3NQAA 2Y62A 3CWNA 4MOZA 3UD6A 1A5BA 3M47A 2WNNA 5DBTA 1ICSA 1YYAA 1FWWA 1HTIA 3L2IA 2QCFA 5EYWA 3MUXA 1GYLA 3TQKA 3MP4A 2QF7A 3G0XA 3W6YA 2ZA1A 1OX6A 3IEBA 2NWSA 1FDZA 2CLOA 1T8XA 5AYYA 2A21A 3KAOA 4WXYA 1ZAIA 2DU2A 4LS2A 4PH6A 5F2LA 3OEXA 1YDOA 3A5VA 4ADUA 1G4SA 2PCQA 3KVMA 1TJPA 3LX9A 2B7OA 3IVTA 3NG3A 4E0CA 5I3GA 1U83A 5AHEA 1OFRA 2ZZ4A 3LCIA 1KW1A 3G1HA 5I3KA 5KZMA 3FJLA 4CQ8A 4DO6A 1C8VA 1EP2A 3I7SA 2G97A 3STEA 5HUOA 2Y85A 3KVJA 2NXGA 5D09A 1LTDA 2CZFA 3PUEA 5D2YA 3LRMA 1KFLA 1IIGA 3IGXA 1HO4A 4UMCA 2JGYA 1F6PA 3W9ZA 2E5DA 2H8XA 3HGRA 4LT9A 2CW6A 4O52A 4O10A 2Y70A 4I7UA 2I14A 3KOFA 1KA9F 4LVBA 3M5YA 1OK4A 5CSSA 4O53A 8TIMA 1SW0A 1SZNA 1XUUA 5FF0A 3M0ZA 4HIBA 3RLUA 1EUNA 3PSVA 1Y0EA 2FJKA 1FWRA 3GLCA 4CCEA 3C0JA 5DY3A 1L6WA 1NF7A 3QRHA 3S1VA 3PR2A 2Z0IA 4I9AA 3R8RA 1D9EA 4N9CA 1JCJA 1VC4A 2X1RA 4MUZA 3UXAA 5CZ0A 1JRCA 3NNTA 3LV5A 3NM3A 2R94A 3PG9A 4DEFA 1ZCOA 1OK6A 3W1PA 4PCFA 5LSMA 3B0PA 5C5YA 1I4NA 2I1OA 1HUVA 3W3OA 3W72A 4IMDA 2WO5A 4IXHA 3QH2A 4EF9A 3TA6A 4MYAA 4Y8FA 3THAA 3LCWA 4M6VA 5HWNA 4JXCA 1AL8A 1R30A 4IXXA 5FEZA 2NUXA 4RKAA 2GVJA 3KXQA 1BWKA 2BZNA 5D02A 3TKFA 3SZ8A 3I6RA 4IPIA 2B7NA 3SGUA 1L9WA 4JY8A 5AN7A 1UASA 1LROA 1P4CA 1L2UA 3MMTA 3W1XA 1LORA 1TV8A 4MYXA 2VC6A 5HWJA 4DQWA 4JTIA 3ATYA 2OMAA 1WXJA 5I3IA 5SWUA 1I2RA 2VEIA 2A1YA 4UR7A 3PF3A 1I2NA 2EKCA 3W7IA 3UWQA 5DY2A 3EXSA 2V30A 5A8GA 5G4WA 2C15A 1F76A 1ONRA 1LBLA 1SSDA 2C3ZA 3OG3A 2ZTKA 5KZDA 2ZRUA 3M7WA 4WXZA 3GDMA 1PCKA 4TR9A 1QPOA 3TX9A 1H7XA 1LCOA 3PY2A 4UMBA 1FCUA 2Y88A 4DF0A 4JTSA 1IXNA 4BI7A 1G4EA 1QPQA 1W37A 4LOCA 4EOUA 1BKSA 5CG7A 3ZS4A 1K3UA 2FQIA 4UCGA 2DJLA 1OX4A 1FXPA 3I65A 3W71A 1ZJIA 4KWWA 1ADOA 3W23A 3GZ3A 2X1UA 1OFAA 4O8RA 4FHAA 1VLWA 2H3BA 2YW3A 4YCPA 1RQHA 1TV5A 4XKYA 4JIPA 5EBUA 3UPBA 1QCWA 3MO7A 3DHDA 2BSLA 2ZBTA 5K4XA 1LBMA 4O1CA 1PHWA 3A22A 1SO6A 4Z1AA 1O5KA 4MFDA 4IQLA 3WJXA 1B9BA 1YTDA 5F1VA 1TQJA 3BG9A 4JTHA 3HMJG 3W2LA 1TPFA 4UR8A 1XDLA 1TIMA 4UC5A 1SW7A 1FCVA 3EXTA 3HF3A 3MI2A 3FLUA 4M5PA 4JTFA 1FY6A 1M7OA 3NQCA 3EWXA 4HSNA 1PIIA 3W7RA 2YXGA 4EWND 3GIYA 2CLMA 2YX0A 5AYZA 1W0MA 2GQAA 3S5YA 4GUFA 3IVUA 3B06A 3DU0A 4MJMA 2CU0A 4WQ6A 1Q3NA 2VXNA 3C2FA 5LGXA 1OX5A 1RVGA 2ABAA 4M19A 3STCA 4UTIA 2ISWA 2GJLA 5G2IA
chains in the Genus database with same CATH superfamily
1ZBWA 2WVSA 4UNIA 2F9RA 3W7DA 3TK7A 2R1KA 3C2YA 4PCNA 1XYMA 3EXRA 2QAPA 3TYBA 4H9ZA 3VKDA 3AHYA 3RHGA 2VDHA 2BB0A 1XPGA 2QYGA 1B5TA 3MCOA 5FJPA 3T0BA 4DJDA 4S2CA 4C1NB 3OP2A 1J8VA 3USZA 4MZ1A 1ELSA 2NSOA 4KFPA 4PB4A 3WLIA 3A9BA 3ECQA 1E0VA 1EJUC 1DWIM 2NX3A 2XFWA 5I0DA 1CGYA 4O1DA 2PDWA 1HF6A 1VJZA 2OQLA 5D38A 1F7BA 3N2TA 5FAJA 3WLOA 3DCPA 3P84A 4HNOA 1D3HA 2VFGA 2A3AA 5DO8A 2QVNA 1ITCA 5CJMA 4HD5A 4IX0A 1DJQA 3HG2A 4XAZA 3WSUA 5DCEA 1QOQA 2GSHA 4LAUA 5BCAA 1A0CA 2OFJA 5CSUA 5F4WA 3ARSA 3W1LA 3M64A 2QPXA 3L2MA 4DYKA 1KD0A 1IF2A 4PMOA 3E96A 3VIHA 3W07A 4QLKA 4ATWA 2FZBA 4H6KA 3VU2A 2Y8UA 1CXKA 1VD6A 2QDDA 1KGWA 4YWIA 3MDWA 4HHHA 4NJHA 4GQRA 1GOOA 4DM2A 3OZOA 4JTUA 1B3YA 1M6JA 3AO0A 1WKDA 4JPGA 4ERIA 1XLEA 2CLPA 4HMCA 4ZOBA 4B3LA 1TPVA 3P74A 5FEXA 1DKWA 1X97A 5FCZA 2Q02A 4JTCA 5D30A 1SO5A 4PUDA 4JTEA 4UQDA 1BXCA 3CQJA 2ADAA 4AWTA 4W8LA 5D9PA 2BWGA 4FR6A 1RD6A 2PP1A 3CPRA 3P60A 2VELA 4UB9A 3CMFA 3WUEA 4GUJA 3DKJA 2XISA 1QI4A 2UY5A 2QDEA 4KGJA 4YHEA 2VCAA 2JKAA 1TVNA 3AIWA 3BCFA 3PBWA 2IKIA 3L0KA 1UUQA 1NSJA 2PFHA 3QM3A 2QJNA 1HL2A 1CENA 2CPUA 3OLGA 3VD4A 2XH7A 4TOQA 3L12A 4O8AA 4C6CA 4XBSA 3BQ6A 2XSXA 4IPNB 4IQDA 2YL5A 2DJXA 1G94A 1VS1A 1EJTC 1B31A 4JTTA 2Q09A 2YA1A 1TV7A 4I90A 2BXYA 1F3XA 1MXDA 2YCLA 3T07A 4PGLA 3V5OA 3EOEA 1JPHA 5LA2A 4UTLA 1XI3A 4FLQA 1KTCA 1I0BA 4LH8A 2JFEX 5H1WA 1X8CA 4AC1X 3GTNA 3GVQA 2QJIA 1QJWA 4AZHA 1UHVA 4O28A 2EBNA 3HURA 3KBMA 1JIBA 1P0NA 3FNDA 3RIKA 4F0MA 1AZ1A 1SJBA 2C19A 1SUXA 2D0FA 3QHMA 1E0XA 3E0LA 5A6JA 1MNZA 4TU1A 2DZTA 1M41A 3W6LA 1FWTA 2O9PA 3WJWA 1XLBA 3TSMA 1V6UA 2QS8A 1DWFM 3WL0A 2XH0A 3O6YX 3P8IA 4GJIA 3GU2A 2TSYA 1XFBA 4Z2KA 3TOPA 3DFHA 2WHLA 3G1DA 4M7SA 1SSGA 1BXBA 4QE1A 1W3KA 2QVHA 3RMEA 2J62A 3IRDA 3HGSA 2X16A 1DQXA 4YYCA 2BY2A 3LY0A 5ABFB 4LV9A 2VMFA 1HP5A 3WDJA 3GNDA 4PSPA 2NV9A 4GVHA 1GJPA 4JICA 2O9TA 1JZ5A 2RGMA 3CHEA 3WLTA 3MC5A 3JUGA 3QQ0A 3N11A 3SADA 1SR9A 2E3ZA 3H54A 1TUXA 1UUOA 2V81A 1YPIA 1AODA 2DP3A 1RQBA 2DZSA 5L9FA 3U2ZA 1TQXA 1J10A 4EIVA 2DUZA 6TIMA 3BE7A 1QAPA 2XWEA 4YU1A 1ITUA 4C60A 4AW7A 2FVKA 5JU6A 3NQMA 2PDXA 3FA4A 3GNPA 3INPA 1W5QA 1W31A 2W4XA 2FDSA 3ZO9A 3B9DA 1LUCB 3ZIZA 1V3LA 3NM1A 1FP8A 3CWHA 1E72M 1QWKA 2ZE3A 2XIMA 3EOSA 2EEXA 4LAOA 4O54A 4EE9A 3LQGA 5HULA 5M03A 3E0IA 3DHUA 1F74A 2UV8G 4M0XA 4NT0A 1ICQA 2D0HA 3GFXA 4PN2A 3HQNA 3KL5A 5U7SA 4Z2GA 4K8HA 5G5IA 3FGCA 1M01A 2P10A 3VIJA 3FKRA 4DHGA 2BMBA 5EL1A 3T55A 3TQ0A 4C1LA 1I2OA 4RK8A 4RZ5A 1X6UA 2FZ9A 1RJQA 1V77A 4ZENA 4QE4A 4CNNA 2Q3RA 5C9UA 1QWGA 3FEMA 2QKFA 2XU2A 2EO7A 1V6VA 4GYPC 3W74A 3WQ6A 4Q22A 3OODA 4RR4A 5E1QA 3A21A 4Z2JA 1EHAA 3O0KA 3SFWA 3MKCA 3R11A 4XAPA 1PVNA 1TPB1 4GFSA 3W1MA 1W54A 3BV7A 1JQXA 2X2YA 4MFEA 3D3AA 3OYZA 1AG1O 1BSIA 3NDZA 3CEUA 1ISXA 1GT8A 3WDIA 3PZTA 1VBHA 1IE7C 4ZOAA 1NQ6A 3GUGA 4HK6A 4ZMGA 3ARQA 1U1UA 2PLJA 1Q6OA 4H6EA 2EG7A 2WZTA 2B4GA 1JVNA 4IMEA 2DZWA 4LRSA 1US2A 1A5SA 2XWDA 1MEWA 4N9EA 4YNGA 3IJ9A 3MBDA 1DWJM 1XCWA 3T2OA 2XZ7A 5HATA 3ELFA 4JN6A 6CGTA 3FY1A 2NX1A 2VZOA 2YFOA 4RW3A 3F7JA 2E6YA 3QV8A 4PTVA 3EPMA 1KFBA 3QSRA 2W91A 4CQAA 4AZCA 3BGJA 2PD9A 2DGAA 5REQB 1JI1A 1MZRA 3KOYA 4QGCA 4DJEC 1CGWA 1O66A 4C91A 3RPMA 2R91A 1SMDA 3B04A 3UT0A 4QR6A 3CZ8A 3ZT7A 5I3FA 3N18A 3N2CA 2NQZA 4GINA 3BCDA 3CUIA 4I5XA 2Y6ZA 1SJAA 3SCNA 1M5WA 3U2EA 4JHZA 5CKSA 1R8LA 4CD6A 1BWVA 3G1AA 3KOZA 1XFCA 1RV8A 1WYIA 5EFDA 1HJVA 5C2CA 2ZKMX 3WD2A 4A3YA 1VEMA 3MUIA 4HHPA 4MDOA 5TQLA 1BQCA 4JHOA 2QCNA 1SVDA 4DBDA 3ZM8A 3FVMA 3W37A 1WOAA 4NKCA 3N13A 4H9YA 4XAYA 5G1MA 3JVAA 4BA0A 2E28A 3LRKA 4R27A 4GVGA 4KRTA 3R7MA 1WX0A 3E5PA 3TFXA 3OBAA 1DJNA 2WC3A 5LXEA 1QPRA 1J6OA 1DPMA 4OKDA 5A6KA 1U30A 1EZWA 4DJFA 3RRAA 1CXEA 4AFYA 2HBXA 1KV8A 2VM8A 1YQ2A 1CYGA 2Y2WA 1EGVA 4BI5A 2Y7EA 4ZZ9A 2WCAA 2E5CA 1NDVA 2PLKA 4Z17A 3TU9A 3QF0A 1DJWA 1GGOA 4X9YA 4JD4A 5CPLA 3TW9A 3AOFA 5FOOA 4FSAA 3W87A 1LOLA 2E6DA 3IWPA 3VUSA 2ON3A 1GVFA 2GPTA 3O63A 2VC9A 1FWSA 5B7YA 4G1KA 4DF2A 4QEEA 1M3UA 2OT0A 1XD0A 4GO8A 2FPYA 2HBVA 2ZFAA 3BICA 4GUGA 4WD0A 2C14A 3H4WA 4NX0A 2IPGA 1E6RA 1WAWA 2QDGA 4WY0F 7REQB 1KGUA 1DV7A 4XBJA 1ONEA 4BF7A 3WLNA 3UNTA 4XZBA 3B8DA 4QIUA 4F0HA 2VEKA 2MANA 4GQ0A 4L4MA 2BHUA 1KM5A 1S38A 4Q8WA 3C56A 3E1F1 4HZMA 3NQBA 2D20A 4LC8A 2GQ9A 3HQPA 3DFQA 4U3CA 2AQVA 2NV2A 3C2OA 1WZLA 3QKEA 3LTPA 1OCJA 4ZO7A 1SZFA 3CHFA 5LNUA 3WK3A 3OU8A 1OIFA 4Y8EA 5HANA 4CNOA 3GTIA 2EXOA 1JDFA 1XISA 4H19A 3GVGA 4P8XA 1GNXA 3RILA 1YE4A 3VIOA 4OV4A 1A47A 1M1BA 3MI6A 3W86A 2WB5A 1TPUA 3HG5A 3NZ1A 3N25A 2DZVA 4OU1A 2C71A 2P88A 4DWSB 1AD1A 3LCHA 3ME3A 1L6YA 1S46A 7TIMA 4E4PA 2CXEA 3A4AA 3VKJA 1UKSA 1OCBA 4RZBA 3M9YA 4TVUA 1CLVA 2DZUA 3MMUA 3OIXA 3II1A 3K46A 1KGXA 2PZNA 4RDZA 3UCCA 3POCA 1D8CA 2W6RA 1U22A 2ZRYA 4X3ZA 4KEMA 4RE2A 5IXEA 4OV9A 3L9CA 3W7EA 3BO9A 3IV8A 2HK1A 3Q58A 3OBEA 4NXSA 1X1NA 1JPDX 2ZYFA 2J9ZA 4CCDA 3S6TA 3DI1A 4EKJA 1E4IA 1I0DA 1Q6CA 4BQ4A 1SJDA 3R0KA 3OHIA 3W7GA 2ZICA 4NJJA 3DOPA 1EA9C 1ICPA 1UR4A 4AF0A 4XZHA 2YYUA 3G22A 3A64A 3VOIA 1KBLA 3GXDA 3PWAA 2YB1A 1IGWA 4AZ5A 3AXIA 4DN1A 1G7VA 4IH3A 7CGTA 1CXHA 3NZPA 3W22A 2HVMA 4FO4A 4LF1A 3CUFA 1DE6A 4QM1A 4ERAA 3ORWA 1KO0A 2QHAA 1VYRA 1IXQA 1AW1A 1UCWA 3MJMA 1ZUAX 5LIXX 2H9AA 1OFEA 4TMBA 1XSKA 4FIQA 3NXFA 1JULA 1O5XA 1OZQA 2NVDA 3N14A 1OGGA 1Q65A 2NVAA 4IGHA 2ZTJA 5AVHA 4L6DA 2W3ZA 2YDQA 4IIFA 4HNTA 2ATMA 3CZLA 2WYSA 5G1YA 3H6OA 4PSRA 1DL3A 2DSVA 3UR8A 3MVIA 1UBPC 5IFTA 1GVIA 3W7NA 1EEPA 3LU2A 2NW0A 4QFUA 2R24A 5CJNA 3CQKA 2GFTA 5M1TA 4B5XA 2DIJA 4H6QA 4JYDA 4RXGA 1LRQA 4J3ZA 4ZB2A 3SDOA 3CS2A 4G56A 5DBUA 3KBVA 2YCJA 2ZXDA 1Q13A 1EEXA 1NWSA 3BOLA 3TCEA 4H1ZA 2NLYA 1VQTA 4GO9A 2CLHA 4AWUA 3N6JA 3SFKA 1B1YA 3B8IA 5LGZA 3E2QA 1RCQA 4W89A 1KQYA 4LNCA 3LHUA 2OQYA 1YW1A 3EGJA 1H09A 4J3VA 5D4YA 4LVGA 3DG3A 2GSEA 4OBTA 4S3CA 5A5WA 1LQ2A 2HWGA 4WY0A 3QN3A 2BODX 1JCNA 3O6CA 4OE7A 3PP7A 2OGYA 4AB4A 3VIPA 3AC0A 1C8YA 2DZXA 2YLAA 5KINA 4W7VA 5H91A 5FF4A 2ZZ2A 1IYXA 4MZ8A 4X2RA 3WH6A 4INFA 3M46A 3IIVA 2OOFA 4GKLA 4UFLA 1E6QM 3WDRA 3ZWTA 2DVXA 1SMAA 2J77A 1XC4A 4P8VA 3QQWA 5TBOA 1XYCA 1ITQA 1H7RA 4L6HA 3YPIA 1XLCA 2GJNA 3A5FA 4MIMA 1AK5A 2X0HA 4P7RA 3CQHA 1VPXA 3KDNA 3SJ3A 1VBJA 1YNYA 3B9NA 2WM1A 3DFYA 1K9TA 3WLKX 2OWWA 2HISA 4OOZA 4PMDA 2X8RA 1V0NA 4NY2A 4MKNA 1BVZA 5C9XA 1JPIA 3CT2A 2HE8A 3PZUA 1XW8A 2Y0FA 1AL7A 5AZ0A 4UWMA 4QJ1A 3L0NA 4F79A 4POCA 1H0GA 5J5RA 1IEWA 4D6CA 3R79A 3CJPA 4URIA 2QJJA 1NEYA 2XTKA 3QMSA 3UZ5A 3NO5A 3NQ2A 3PNZA 1TPH1 2E0PA 3CZGA 2J25A 4H4IA 1R3RA 4XZIA 3B9AA 2VVNA 3TC3A 2PWUA 1WP6A 4KRUA 3F2CA 3S5SA 3GU1A 4DNHA 3CASA 1OG0A 1J2BA 1WNOA 1TR1A 3V35A 3TXZA 5CG0A 4PMVA 3GAKA 2J7EA 3SEPA 4RNJA 5I3DA 3R4IA 4A29A 1Q4WA 5DXXA 3EX6A 4KRZA 3H53A 4IQEA 1E70M 2J7FA 4UFKA 1OZMA 4DIAA 1ZJBA 3NWRA 3K30A 3LPFA 2YA2A 4ZQCA 1G9HA 1GTEA 3KBNA 4QISA 5KITA 1XLGA 4LBSA 1DEDA 1CW2A 3VCRA 1W3IA 3NR0A 4N0RA 3H2CA 3N9KA 2ZZ1A 3CV1A 1TIWA 4RV3A 2PWDA 1WDWA 3N2BA 3VDHA 1FX6A 4JL2A 4UQBA 5FJRA 5I09A 4NX5A 4RPPA 4P61A 1EH9A 4AD1A 2FB3A 3LHZA 4J5NA 1O7AA 3NA8A 1EIBA 4FOKA 1LF1A 3R10A 1J96A 3CV6A 2BVYA 5DT7A 1KRBC 2INEA 1E0TA 1CT5A 4K7YA 3L4TA 2OYKA 2WQDA 4Y9AA 2R1PA 3PC0A 1TWWA 3EOLA 3K8MA 3PZOA 5I5RA 1UC4A 4IIEA 3JR2A 4XUYA 2VCCA 3R25A 2ZUTA 4PTXA 4UTTC 1E5NA 4ZBCA 4HSOA 1Z69A 2E77A 4DO5A 2YCLB 3G0SA 3KTXA 4Y9OA 2YFNA 3PVFA 1UPPA 1H5YA 1HN1A 1SFJA 5T26A 3I68A 5G2WA 3IK4A 3VMOA 4UUIA 2NUYA 4S3DA 2DSZA 1QI2A 4W5UA 3LCFA 4F2UA 3QHOA 2C13A 1JCMP 3D0CA 3IUHA 4BEUA 5LHFA 1EO7A 1VR6A 3P61A 3QMTA 4D6GA 1EJWC 4OUIA 3WBAA 3VI2A 2WWCA 4ACZB 1TX2A 3IIOA 2W92A 1HO1A 3RJXA 1R46A 2Y61A 1QHZA 2WCSA 2QW5A 3PPCA 1XDMA 5BOOA 4R85A 2C6QA 1SJCA 2IQ0A 3CZEA 1OT2A 3DFOA 4FNPA 4NXKA 1M68A 2Z1XA 4D6HA 2CLLA 4QSFA 2A0NA 3TC7A 1WXYA 3R5EA 3BG5A 4KERA 2XVGA 3AMDA 3TTOA 2E40A 3L65A 5CC7A 2C18A 2YGYA 2VL4A 3CH0A 5DF0A 4DJED 4GC3A 4C7GA 1VBUA 2WNQA 4LTSA 2DSKA 4D6DA 5CPSA 4LALA 3H70A 3U7VA 1BVWA 2XYLA 5CC6A 4DXKA 3VGFA 2XN2A 5HMFA 4ML9A 3SRKA 1H51A 7XIMA 3WD4A 2VGFA 2VWTA 1ZAHA 2V5DA 4K39A 1OINA 4GBDA 2E6FA 1GORA 2C1GA 1OBAA 4K8EA 3KW3A 1UQYA 2RAGA 1RCXB 5I2UA 4C6KA 5BRQA 2PDHA 4H9UA 2O7QA 4REQA 3PWIA 4QX4A 4M6PA 4MAVA 3GXTA 2ZDRA 4JN7A 2ZZ5A 2Z6IA 1WKYA 4XAGA 3SAZA 5D2VA 3VDGA 3NQVA 2HROA 2UY3A 1MZHA 1X8FA 2HEJA 5DXYA 1ITXA 4J3WA 3EWDA 4WKHA 4O13A 4Q8OA 2D2GA 1EL3A 1MDLA 3BLFA 3OLIA 5I78A 4ROQA 2W0UA 3MUY1 3FHQA 1E4NA 1MUWA 3IUIA 4QITA 1RZMA 1RVKA 1HL8A 2ZE0A 4MPQA 4OECA 3UXDA 4G1NA 2OKTA 1XF0A 3BLDA 2R6OA 3WQOA 1JJKA 4IT1A 3APYA 1IZCA 4MJZA 1GQIA 3U4AA 3RR1A 1VHCA 1Q5MA 3EB3A 4ZR8A 5E6ZA 2A6LA 1EX5A 2ISVA 1J6PA 2GOKA 1H60A 1F5ZA 3SECA 5LYRA 1LM1A 4I6KA 3HQOA 3CU2A 4IP5A 4NJGA 1PIGA 1UR8A 4MADA 4GQQA 2UY4A 4AD3A 1XHGA 4KESA 3RCNA 4G8TA 2YBVA 1HJUA 3GXMA 3OHMB 5IDIA 4MY1A 5LA0A 1ZHAA 3JZEA 2PGFA 2A3EA 5A6SA 1GZ1A 4D6JA 2YXXA 3BVJA 1VHNA 2VEFA 4LVFA 3TTQA 2O56A 1OYAA 3N3TA 1WOBA 2POZA 3T7VA 4E5TA 1PE1A 3N3MA 3TOYA 2VFFA 3PZGA 3MWCA 3PZVA 4UFIA 4HNVA 3B05A 4PEEA 4WJXA 4DF1A 1K9EA 1H1NA 3W24A 3CUXA 4G6CA 1OABA 4DLFA 2FHBA 2YDAA 1TE6A 3WDQA 4J2MA 1QO2A 1S1PA 2DT0A 2VNCA 1DOSA 4ZOEA 4D6FA 3PTMA 3DHFA 1O94A 3LBCA 4DZAA 2D24A 3SY8A 4AZCB 4KCTA 3B0XA 2Y62A 3UD6A 3H21A 4XG1A 4FA3A 3MSYA 3H26A 2W66A 2GUBA 8CGTA 3QTGA 3GDBA 3W6YA 1MFUA 1OX6A 1A5UA 3IEBA 4R88A 2ALRA 1FDZA 1T8XA 5A69A 3AUJA 3QZ6A 3LENA 2WJEA 3KAOA 4LS2A 4PH6A 4H6RA 4AEFA 5F2LA 1YDOA 4IF2A 2PCQA 1OC7A 3KVMA 2GJPA 4US5D 3LX9A 5HA7A 5HBFA 2WVVA 2B7OA 4HMDA 4QAWA 3H12A 5I3GA 3KS6A 1LWIA 1U83A 1PTGA 3G1HA 4XD5A 3CMGA 4H9MA 1C8VA 1EP2A 4MWAA 1RY8A 1P7TA 2I16A 5HUOA 3WQPA 1UWAA 2NXGA 3WG6A 4WGHA 1VKFA 1XSJA 3FDKA 2XH4A 1RSCA 4Z2HA 2IPFA 4ZXOA 4LT9A 2PUZA 3BAKA 1UKTA 4O52A 1KR0A 1NJJA 4KT2A 4C90A 3DG6A 3KOFA 1KA9F 3VZZA 4M24A 5CSSA 8TIMA 1SZNA 2Y5JA 2F6XA 1Y0EA 3VGEA 3GLCA 2QXWA 5KZ6A 1L6WA 3OZPA 3NZQA 3QRHA 2G3JA 4M51A 3O6AA 1KXHA 3H2EA 1T8QA 3STPA 4YN5A 2V3FA 5FJJA 2R94A 1ZCOA 6REQA 2IKJA 5LSMA 4HJWA 4DUOA 3ANVA 3QH2A 2VJXA 4MYAA 5M3WA 1R30A 1TVLA 1EGZA 2NUXA 3U4FA 4MPKA 2GVJA 3UBPC 3KXQA 1BWKA 2BZNA 5D02A 3SZ8A 2FKPA 3GXIA 5E9AA 4DZIA 2CBIA 3AALA 1NTHA 1AUSL 1P4CA 2EQDA 3MUZ1 4OFCA 4GIRA 4ASTA 2HE5A 3HPAA 1PJ9A 3PJWA 2VC6A 4DQWA 4KF1A 2ACQA 4JTIA 6ENLA 1Q7QA 4TQTA 1S1RA 5SWUA 4WGXA 4IFKA 5CGMA 2VEIA 2X40A 3ITTA 1FWEC 1EPVA 5A8GA 1G5AA 3N12A 2GGHA 4IHCA 3WUBA 1SSDA 2WHKA 1V6WA 1GQJA 3MUCA 1L0PA 4UMBA 4DF0A 5BU6A 1CTNA 4BI7A 1G4EA 2X42A 1BKSA 3M6DA 2E8ZA 4XD4A 4OTKA 3ZS4A 3W38A 4Q7BA 2Z2BA 4QP0A 3ARXA 3LLXA 3T8LA 2DZBA 3W71A 4MSSA 3I4KA 4J28A 3W23A 2FJUB 3MSDA 1VPYA 2YW3A 4YCPA 1RQHA 1TV5A 2CBJA 4XKYA 1QCWA 2BSLA 4O1CA 2DQWA 2V3GA 1SO6A 1OADA 3ICJA 2CHNA 3KTSA 3QV9A 3BG9A 4DBSA 4TUFA 3HMJG 2XHYA 3VNLA 1XDLA 1TIMA 1FCVA 3HF3A 1CXLA 3FLUA 3ITGA 1M7OA 3AIQA 3FV9A 4BY3A 4LXFA 2YXGA 4EWND 1BG9A 4AYGA 4Q4MA 2CLMA 3GM8A 4GUFA 3EWCA 1DTNA 3DU0A 1Q3NA 4CNSA 3QHNA 5LGXA 2OELA 4CD7A 3SQLA 3CBWA 4W8AA 4M19A 1L6FA 3EEZA 2GJLA 5G2IA 5I06A 5T9CE 2H9AB 3E2RA 1O5RA 3OGSA 4CLMA 2ZX8A 4QCFA 3W1QA 3ZT5A 4LUSA 3IJQA 3CAWA 1VF8A 1KCZA 1YKWA 4C6NA 4Q33A 2CITA 4GI4A 1JI2A 4YS1A 3PTQA 4D9PA 8RUCA 1LT8A 3WMLA 1M03A 4HA0A 3MVTA 4J3TA 5JBDA 3W1TA 4Q6JA 3TN4A 3EA2A 3ARYA 2INFA 3W0KA 1H1ZA 2O0TA 4F0RA 3WDPP 4L9ZA 2ODOA 3UW6A 4L1WA 4UIOA 3W7MA 3QFWA 2P5NA 3DZ1A 3VNMA 2YCIX 1XM3A 2QCCA 3LB0A 1DWGM 4F9DA 5EFFA 1JUEA 4YVPA 1NELA 1T96A 2PDMA 1B3WA 4U2ZA 3P80A 2A6NA 1V7AA 3W75A 1UKOA 5A8QA 9XIMA 4UZUA 2Q3OA 2ZUNA 4LX4A 4ZSUA 5EPDA 3TR2A 1HT6A 3KP1A 3SCUA 3TYCA 1I6NA 1S2CA 2F6KA 3U5YA 4H9XA 4B92A 4RE4A 2PDJA 2B7QA 1KM1A 5GNYA 4H8UA 1R2RA 4TXEA 1H61A 3V16A 4BKNA 4X9SA 4FAMA 1JYXA 1A53A 3QJAA 2CLFA 4JKMA 4WY0B 2VR2A 3BAYA 1RBOB 1K8ZA 2QNEA 3ITCA 4IP7A 3U5UA 4E2BA 3NVTA 4PMQA 3W7CA 1DJGA 4ORIA 3V1PA 4E3TA 3RXZA 2F2KA 2ZRXA 3BPWA 3IV3A 3T40A 1NF0A 1BPLB 1TWIA 4LAKA 1GKQA 3GDLA 1KM2A 1TZ7A 3MW7A 1S39A 2ZXAA 1PAMA 3THUA 3KCJA 3VIKA 3WK2A 3UZWA 2CWNA 3NQ7A 3DENA 1VYSX 1G01A 3QKZA 4Z1DA 2ISDA 1VFOA 3B0UX 4PMYA 1KRCC 2I9EA 1TPWA 1WDPA 3DX5A 3RM8A 4PB5A 2DIKA 2ZIDA 5TAOA 3W82A 5AYBA 2Y63A 1P0DA 3TFCA 1UBSA 3GDKA 3TN5A 3VE9A 4B4FA 4QDWA 3CTTA 4GYFA 1W1TA 3GHTA 4K1GA 3GG7A 3IK2A 1T5AA 1E56A 3RM4A 3LM3A 2P8CA 5D33A 1R3SA 1KFJA 5BNKA 2BOEX 3SRHA 4HBKA 1SYTA 2P8BA 5ABHA 1CGXA 3B0YA 3ABSA 4US6A 3VNZA 1IEIA 1WUEA 1KBJA 3KVLA 3O06A 3TSBA 3W70A 3W02A 5CZTA 1ZNNA 1US0A 1LQ0A 1JDAA 4FIRA 4DAFA 3VM7A 8XIMA 5HXMA 1FWJC 1Z42A 2ZOXA 4HSHA 3CIVA 1YPFA 2XGIA 3M0YA 4JQ4A 2WSPA 3I10A 4XO7A 4YTSA 2EPMX 4O4VA 2WMIB 3AMGA 2E9BA 1DHPA 5A3HA 1FWCC 1X98A 5CSRA 3SQMA 4O15A 1UR0A 1A5AA 2BGSA 4U33A 4CNPA 1YADA 4XK2A 3LCXA 4MHBA 1FWGC 3M7SA 3WQFA 3N2XA 3ANUA 1WDDA 1MQRA 2W67A 3B8UA 2QQ6A 2NT1A 2HPIA 4JFTA 3ZYZA 3M6YA 3AZTA 1H63A 2IPWA 4DLMA 3VD7A 4WIWA 3T44A 3LSBA 1U33A 1VFSA 2VX5A 4W7WA 4Q8NA 4FF7A 1Q6QA 3V0UA 1KV5A 1QO5A 2XVPA 4FNTA 1F6KA 1QR7A 5AHFA 1UWTA 5AOUA 3S9IA 4H01A 2PCEA 4FNQA 3I6EA 6A3HA 1V6XA 4RUBA 4GC4A 1ZGDA 1TCDA 1N2VA 5EMYA 3PAJA 3KWSA 3OA3A 2X09A 1HQTA 5FI8A 5CPNA 1WE5A 3LBOA 4GUHA 3UA4A 2I17A 3LI1A 1E6ZA 3TJ4A 1WV2A 3AS3A 3UWUA 3GC2A 1TZ9A 1R47A 3N29A 4ORMA 1FH7A 3MA8A 3KBSA 3LTSA 4LCRA 4MLJA 3F5JA 4H9TA 3NSNA 4XAFA 4AWEA 1W1PA 1P1XA 1UH2A 1P0EA 3QTPA 1E9ZB 1XL9A 3TTEA 4DZ5A 3RLGA 3WD1A 3PZQA 4RNHA 1R6WA 4CN4A 1W5PA 1CBGA 2VT0A 1JAKA 4J40A 3TMQA 1FBAA 1LG1A 3WBWA 3G1SA 1JQVA 1I8JA 1Y5VA 4S3GA 3H2MA 4HNCA 4OT7A 4B5NA 1R38A 3W83A 1B54A 2WNZA 4GGBA 4CN1A 2ICSA 1E9YB 2DFAA 1MQQA 1UWUA 3SCSA 4M6QA 4JTLA 4O0QA 4I5UA 3SR7A 4IMCA 1XYFA 2GJRA 3G6LA 2EG8A 5EA9A 3BLKA 3ABOA 1BGGA 2E25A 5A8OA 1A5LC 3EOUA 4S39A 1TV3A 3UYIA 2BY1A 1O95A 3ABQA 4WDWA 4PBEA 4Q8MA 2KZHA 3EMQA 4EPDC 3EZ4A 3UESA 1HW6A 2AAMA 3M41A 3S3GA 2XVLA 2OX1A 4Y96A 3PTKA 1A5KC 3N6HA 3LPGA 4RZ4A 2BASA 5ENLA 4R7WA 1V79A 1SFLA 3AYSA 5MKGA 4AHOA 1F9CA 2PDBA 2Y8VA 3MKVA 3REQA 1HKVA 5HPCA 1XIJA 3EAUA 4FOUA 2FFIA 3F4CA 1DVJA 3NDYA 5CZKA 4DPQA 4NP7A 3KS5A 4GI8A 3RPTA 1RUSA 2V5JA 1YTKA 1B4KA 3QMRA 2VURA 5BRPA 2W9MA 5CZJA 5U4NA 3N1AA 5L6UA 2Z2AA 4AYSA 1VJSA 2RKXA 4JEQA 3CEPA 4ENLA 5HPOA 2NV1A 3SIMA 3UG3A 3VMNA 3TMLA 1HG3A 2IXUA 1E6PA 3RUBL 4UQ9A 3W1NA 2PF8A 3KL0A 5A6BD 3VNIA 2J7BA 5KZEA 1EP1A 2R82A 1ZPTA 2WSYA 1EP3A 5EMMA 2Y24A 5BOEA 1EC9A 1KM4A 2OZ8A 2YXOA 4ZVJA 1OC5A 2OSWA 3NL6A 1KFEA 5A94A 5BXPA 4LY4A 2W63A 1BSLA 4U31A 3CM4A 3DECA 4NNBA 3DFTA 1V5XA 4AMAA 1N55A 1F8IA 1O1HA 1LT7A 3UCQA 1XBVA 3WH5A 3GKFA 3GR8A 1OF6A 4AHPA 4Q8UA 3R2GA 3G8EA 3LQLA 2E8YA 1DORA 1TTQA 1W9BM 3MYOA 2XM1A 4EPKA 5AC6A 2C1IA 2Q6ZA 3HQ1A 3UG5A 2V2DA 4GQGA 1W3LA 3CUHA 3UF9A 2GDUA 3H24A 4DNMA 3GBDA 4JR5A 4XVEA 5AB3A 4YLWA 5D9OA 1W32A 3WF4A 3TV8A 2BBFA 3C61A 4J1OA 3TIMA 5XIMA 4A3HA 1TTIA 3M43A 4JAWA 4RLIA 3H7RA 2QIWA 3GS6A 4JDYA 3WH8A 5LIKX 3L5MA 2OZ0A 3MBFA 4AMCA 4WKFA 4KQNA 1TRDA 1UYQA 4HU3A 5LIWX 2WV8A 2HPMA 2ATSA 2J78A 3W53A 3FN9A 9CGTA 3UWZA 3P3BA 5DRCA 4PFMA 2CCRA 3LGDA 4L5ZA 5IFPA 1OSEA 1C91A 4QS5A 4PBFA 1ALDA 3NPUA 4GBUA 1UD8A 3P82A 2H8ZA 1P48A 3MZ2A 2CZEA 4AUBA 3S2CA 3QOKA 5I03A 2QCEA 3N17A 2OSYA 1K8YA 5FJUA 4GK8A 1AJ2A 2Y7FA 2A7NA 4YPJA 3P5ZA 1KBIA 3BV4A 5BU9A 4PTWA 2WVUA 2VYOA 3QZEA 4HHLA 2PDQA 1PDYA 1YE6A 1LZOA 3CB8A 3CLWA 2J24A 1SZRA 1DQWA 1W1YA 4NZ5A 4OQVA 3HPFA 2G4JA 1R9XA 3G2GA 5GPRA 5IHSA 1TPDA 1TJ1A 1I9CB 3ZXWA 4MWAB 2QCLA 1P7TB 2RHGA 4W85A 5BXTA 3NPXA 4B3ZA 4QQUA 3MDUA 1SPQA 3F4VA 1ZSXA 1G4PA 5GNZA 4TO8A 5IBXA 3HZ3A 2PU0A 5D9NA 4TX8A 1EPXA 1YBQA 2BTMA 3DN5A 4L6OA 3ZJ6A 3GTHA 3TYUA 4QLJA 2YCKX 2PWFA 4B2DA 3QYSA 2P0OA 2DORA 1L6GA 4PEKA 1RALA 3LLDA 2ZRVA 3IAPA 5JIWA 1XLDA 1H62A 1I2PA 2VEMA 3MP5A 4NYUA 5AVNA 2WKJA 3WLPA 4LYQA 4HB7A 3ABRA 3L68A 4IICA 3MMDA 3RNDA 4JX4A 3SCQA 1DJZA 3QQ1A 2E6AA 3JW7A 3APGA 4E6MA 2JIEA 4ZQMA 4CQCA 2DT3A 1CGVA 4K2SA 4K38A 4Q3MA 1LOSA 4N7QA 3MCNA 2FGZA 3B4UA 2X7VA 3H22A 1R7AA 5DCDA 1Q6FA 2ZQ0A 4V1XA 3NZRA 1H41A 3VKCA 5A6LA 1QPKA 4UQCA 4WJEA 1NVMA 1R0MA 4YL2A 2WAGA 3WQEA 4JYFA 3CWOX 2QUTA 1LWHA 2J6XA 4HZ8A 3W2JA 3MMWA 3T8QA 3BG3A 3GTXA 3MS8A 3TWBA 1FHUA 3QV6A 3CL6A 3BMVA 3C0QA 3EKZA 3NPVA 2OWCA 4GISA 4IFKB 2XG9A 4FNRA 2OLHA 4TV6A 2F8QA 3WQ5A 3EBVA 4O0KA 1MXSA 1A3HA 3EDDA 4E3VA 4GX8A 1TWZA 3C6CA 4PL2A 4QDMA 1OFPA 4HCHA 1OIMA 2OEKA 6XIMA 5GVJA 1PKYA 4RDWA 1VJIA 4NU7A 1SQ7A 3NSMA 2A3CA 4O17A 4DPPA 3TROA 4FXFA 1WAUA 3NZGA 2RDWA 4LU0A 1GG0A 4WRHA 1VYPX 1B3ZA 4DUVA 4GOAA 2GSJA 3KRBA 7ENLA 1RA5A 4WOZA 1G6CA 1W56A 3MV11 2VFDA 4PRWA 3QXBA 4NVTA 4KH2A 4XKYB 4WUIA 5CPMA 1EWEA 3BDKA 2YL6A 3L5LA 4PB3A 3W2UA 2J74A 2A7RA 3NQGA 3F4NA 2PMQA 4JNMA 5AC8A 1MW3A 1WCGA 1Z9AA 4R34A 2JKPA 3S1GA 1OM0A 3P7YA 5AY7A 4B5SA 4UOJA 4HYRA 3EMZA 4NAFA 2G5WA 3UU0A 2HQAA 1E0WA 2GGEA 3NJ3A 3SUTA 1Z89A 4OBSA 3RN6A 5AHIA 1LL4A 5J8LA 1AQFA 3W7JA 4WSHA 4UXDA 6PTDA 2Q8XA 2QUVA 4LC6A 4J3UA 1ZP4A 3TYEA 2YW4A 4DUXA 3LCLA 1DHKA 2ZZ7A 2WLZA 1GVQA 4M8UA 3K1GA 1ZRQA 1US3A 1C7TA 2BDQA 3BJSA 3OO2A 3FFSA 4GIEA 3L4VA 1OQFA 4AU0A 2Z1BA 3V18A 1EYEA 1PX8A 4NILA 3S8HA 5D2XA 4IZGA 1O1ZA 4IX2A 2HS8A 3USBA 4LUSB 3UR5A 1S2VA 3KE0A 3BLEA 5H8MA 1W17A 1C8QA 3E74A 1GOQA 5JH1A 3FHAA 5FL1A 3SIZA 3O2LA 2G37A 5D04C 4DWDA 1K9DA 4R33A 3LPPA 1EFZA 2NX9A 1E5JA 4FX8A 4JTQA 2GDQA 1D3GA 2Q71A 1K03A 2EG6A 5HMSA 3H4GA 1FFRA 2PRMA 4IG2A 3S2LA 4O18A 1EDQA 3SCTA 5HNNA 3STFA 3P67A 3W00A 1J01A 4JX5A 1UR1A 3IJ7A 1B9ZA 4HOWA 3QY6A 1ZENA 4F48A 1S2WA 3L21A 2OU4A 2XUCA 2GVGA 3K8KA 3S9YA 4WZHA 4H2HA 4UZSA 3SRFA 3DGBA 4P7OA 3WH7A 3PJUA 4A8IA 1XIBA 2V2CA 1K7FA 3HIJA 3BLIA 3OGVA 2QDHA 2FTWA 3H2FA 5I3JA 4J2PA 2FH6A 4C1KA 4KWVA 5HMEA 1HFBA 3GW0A 1XUZA 1ECQA 1KM3A 4JCMA 3VFLA 2AAAA 1EO5A 4GNJA 2O4QA 3F03K 5LNRA 1XIMA 3VE7A 4JTGA 4YYFA 2Z7GA 3C2EA 3R6IA 1K7EA 1PKMA 4JTJA 3O07A 3FK4A 3WLRA 2CFFA 5AKQA 3ARWA 4LUTA 4UTWA 3DYMA 2VTFA 2G3NA 3KRZA 4YCOA 4BJHA 4W87A 4C5ZA 3WDHA 5T91A 3W7KA 3DYOA 1U1JA 1FH9A 2VZSA 3TDFA 1UR2A 1RPXA 2XH2A 2WLYA 4KWUA 1XGDA 2VC5A 1G7UA 5CQ1A 2E67A 4X61A 2IQTA 4HQVA 3TONA 1DP0A 3BURA 4A2RA 3TH6A 1TO3A 2PBGA 2VDIA 3RR4A 1EDGA 1BTMA 3UZXA 3NPWA 4ONVA 1RJRA 1XQLA 2J13A 3F4DA 2WSQA 2RDXA 1NOWA 4MWAE 1XV8A 3B97A 1NOUA 4BHYA 4PTNA 2WSKA 4BF5A 4UTFA 3OB8A 1DIEA 1NFGA 4IOTA 5D03A 4AVFA 1XKYA 1QFEA 4H2CA 4NZJA 2X05A 4AD2A 1VCVA 4HZ6A 5CGQA 4N9DA 1FCBA 1MYRA 3UXIA 3LXAA 3NSXA 3A3HA 3RAOA 3MYPA 1PCWA 3COTA 2RUSA 2EHHA 2PWEA 4KS0A 4X63A 1T0OA 2X7WA 1SM9A 3OOQA 4HCDA 2OQHA 4QQ3A 1S2UA 4C6EA 2DH2A 5AC5A 4IFOA 2WMKA 3PBUA 3NEVA 3ZMRA 3BTNA 4LVDA 4D6EA 4ALDA 3CV2A 3T78A 2R1NA 4LNYA 1Y8BA 3B3DA 3PBMA 3M0IA 4U5IA 5C7VA 1C8XA 4Y9PA 3QZAA 4GHRA 4IIGA 1JYWA 1QK0A 1TJ0A 2GVYA 4HZ7A 3WLSA 4Z08A 3EX3A 3J7HA 4JX6A 2WKLA 1IV8A 5KETA 3KX6A 4DBWA 3ITYA 1XR2A 2WOQA 2Y5SA 3PZIA 4R53A 3PBVA 3JS3A 2DZAA 4DYJA 1NWRA 4FXRA 2YBTA 4S3BA 2XIQA 4GPNA 2Y7DA 2HDJA 3WNPA 2WJFA 4TTGA 4EAMA 4WJ8A 1I45A 2Z25A 3PFRA 4P8UA 4PC8A 3IANA 2F2HA 1OFBA 4RJEA 3RM9A 1QW9A 1W9DM 3KRUA 1QNPA 3V0SA 3KOWA 4L1GA 3EX1A 1DIOA 1THFD 2Z6JA 2XSBA 1Q6EA 1Q6GA 1AMYA 1JFXA 2QJGA 1WKFA 5EMLA 3EX4A 1IQ8A 2QAFA 3PBYA 1V3KA 2CLEA 4X2PA 3GTFA 2HXUA 4BCEA 1E1EA 2C16A 3CUGA 2VFHA 1HGYA 1AQHA 4RXFA 3WF3A 3ITXA 3W88A 4QHRA 2E09A 5BMWA 1FQ0A 1QHOA 3WL1A 2ZUUA 1XC6A 1XWYA 4UTKA 1JPKA 2BY3A 2WMFA 3VTRA 3FVDA 4J27A 4KEUA 3LEPA 1GOIA 2V0TA 4P7LA 4Y6GA 3A47A 3AYRA 1X7FA 2Z1WA 2V5BA 1XLKA 1UIOA 3S46A 3PULA 1A5CA 3ATZA 4JFVA 4QJ4B 3NIYA 4AG0A 2W27A 3FYYA 5CBIA 2TMDA 3G3MA 2FTYA 3P0XA 4XTIA 2IUZA 4BF9A 3AYVA 4KCUA 2VRQA 4JQAA 2OODA 2J9XA 1UD3A 1J0IA 3RLHA 1ME7A 3IJ6A 4Z1CA 4K7VA 1KFKA 3SUSA 2VO5A 3NTYA 4DXVA 4XUGA 4MDPA 4MNLA 1NDWA 2YZ5A 3V0TA 3WMSA 3BC9A 4BWLC 1YPXA 1JUKA 3SQSA 3GG0A 1QT1A 4AAJA 2AGTA 4HKPA 3P6LA 4JIQA 1GVEA 1WZAA 3SB0A 1B30A 2O4MA 3WYZA 4JCLA 1S2TA 4UNKA 3VMPA 5LXXA 3QEZA 4FLRA 3AUOA 1FWDC 2DEPA 3W7PA 2PTYA 3OLEA 3M5XA 3CLMA 4HMEA 4IMAA 5K9CA 3NL5A 3BK0A 1M7XA 1TB3A 5BXRA 1CGTA 1DIDA 5M2FX 1HP4A 4XQ6A 1HVXA 2NLIA 2AQWA 3HA1A 4JIEA 3AWOA 5DBTA 1FWWA 1HTIA 3H4XA 3GHSA 1UZ4A 1C9WA 4Q7NA 1GYLA 3ERPA 2DIEA 2QF7A 2HXTA 4F0SA 1F4HA 3M4HA 1E3XA 1LWJA 4GG9A 1OD0A 4WXYA 3VCCA 3A5VA 1W2PA 2QUMA 1TJPA 4K8GA 1VRXA 3WQDA 1OFRA 5AZ1A 2YA0A 4WHBA 4BQ2A 3A4JA 4V1YA 1Q7MA 4KETA 5I3KA 2VC7A 3FJLA 5KZMA 1AJ0A 4DO6A 4I9TA 1A5MC 1JZ8A 3I7SA 2G97A 4L9YA 3UZZA 4ERGA 4AD0A 3PBGA 2CZFA 4D71A 3BOXA 5D2YA 5CLWA 5A2BA 3LRMA 1DJIA 3IGXA 3C0SA 3WCZA 5JIPA 1XLIA 3HGRA 4Q6XA 3P14A 1H0IA 3L23A 1JZ2A 2DW7A 3E38A 1BYBA 2Y70A 3VOFA 4PUJA 1WPCA 5A1AA 3M5YA 5BXSA 5DMLA 4O53A 3T9PA 1SW0A 3PFMA 5FF0A 4HIBA 3LS9A 3RLUA 3PSVA 1W9XA 1FWRA 4PZVA 2V67A 3C0JA 3FAWA 3RCMA 2WZIA 2J7GA 2AOSA 3PZNA 3R8RA 3BANA 4YWSA 1ZJHA 1VC4A 4MUZA 3XINA 4LFYA 3UXAA 3NNTA 3CYVA 3VC6A 2OX4A 3A3WA 3VDBA 4I8DA 1OK6A 4L4OA 5GQBA 3TWAA 3WLJA 8XIAA 3B0PA 5C5YA 4QLLA 4L56A 1I4NA 2I1OA 1HUVA 3W72A 4IXHA 3A13A 4GD0A 1Q4NX 2XDFA 4JXCA 1AL8A 4IXXA 4RKAA 2X1IA 7PTDA 1L9WA 4JY8A 5AN7A 1ZU8A 4QG9A 1LROA 2Z28A 1TUFA 3MMTA 4ICCX 1TV8A 1QW7A 4MYXA 2OMAA 2XIJA 3OPSA 5I3IA 1CDGA 1QI0A 3IJIA 1I2NA 1IEXA 3W7IA 3H23A 2V30A 4XISA 1BRLA 4Q8QA 2ZADA 3VDAA 3P0WA 4IIDA 1W6TA 1GOMA 1LBLA 3OG3A 4LB3A 2VQUA 4HNLA 5KZDA 1UH4A 1NARA 3AROA 3T0AA 3W01A 1JDEA 3PY2A 4C65A 3TQPA 1W9UA 4DWSC 3AXHA 2V3DA 3UEQA 5ABFA 1F3WA 1K3UA 2G4FA 4V27A 1JL8A 1OX4A 1YBQB 3F2BA 1QXLA 1FXPA 4MUPA 1Z8AA 1WZMA 3AS0A 4DYEA 3VINA 5CPQA 1V8EA 1UD5A 3GD6A 5J04A 4FHAA 1A0DA 2WJDA 4JIPA 3WD3A 1PEZA 1AA1B 5K4XA 2F61A 3THCA 4R7OA 1Y5WA 4IQJA 3A22A 4IQLA 3KHDA 4MKSA 1Q2SA 3GUWA 4OZOA 5F1VA 2X0SA 3AXMA 2CHRA 1QHPA 1TPFA 3BAIA 3AHZA 4UC5A 2PAJA 4G7EA 4M5PA 1FY6A 1HNYA 3EWXA 2CKSA 1PIIA 3W7RA 1KKRA 2VHLA 1UPMB 2GQAA 3UVAA 4XSLA 4JZ5A 2G8ZA 4H7VA 2WXDM 5CSYA 2VXNA 4HYWA 4D6IA 2IW0A 1OX5A 2VGGA 1AVAA 2ABAA 3SCVA 3Q67A 3FCPA 4KBXA 4DRSA 1W3JA 2WNWA 3MB9A 1ME8A 3DFSA 1QNRA 1VFHA 2J27A 3B40A 5HQEA 4GYJA 1QI3A 1SW3A 3BLOA 5K4ZA 4HU4A 1QRQA 3VGBA 4HGXA 1N8FA 3RLVA 1KLYA 5JVLA 3OW1A 1RD5A 5HDRA 1FHVA 2OLAA 4UFHA 3UG4A 1MW2A 4MJ4A 3P5YA 1DYSA 1K8XA 1R2SA 1AZ2A 3VIMA 3BL3A 4RE0A 1X7IA 3VIFA 2GL5A 2X0YA 4KMQA 4JOMA 4Q4QA 4LF2A 5HJYA 3P8JA 1Z41A 3CXOA 4MF4A 4U2YA 2SFPA 1XGZA 1R2TA 2PDYA 3HOJA 3S0CA 4KKXA 3UVIA 2VZUA 3DBPA 2OZ3A 2XN1A 4BWLA 4XO6A 4FK9A 5HWMA 2WC4A 1DWHM 1E55A 3EX2A 2QIIA 4B9YA 1HJSA 2ZC1A 1LLWA 1GVYA 4KCVA 1OF8A 1KTBA 1H3GA 3O9NA 2W62A 2Z1VA 1E73M 1ML1A 3L2LA 4JIIX 1IR1A 1C7SA 4FEZA 3G1FA 5CAKA 4K36A 1IT8A 1QNQA 1XLMA 3CO4A 2Z7KA 3W1RA 1ENUA 3BXWA 3R0DA 2PC4A 4GY0A 2HMCA 4NJKA 5FAGA 3PJXA 4V33A 5TIMA 1EJRC 1KKOA 4JS3A 1F73A 2ZRWA 5FL0A 2FZ8A 3K5XA 3ARTA 3SI9A 4MNMA 4ZQNA 1OCNA 1C29A 4QJ5B 2QUUA 1KXVA 3E49A 1XIIA 3ZZ1A 3GVRA 2F84A 4DBUA 1WDSA 3UJRA 1DXFA 3DFNA 3AIRA 2GLKA 1P6WA 5LHEA 2PDCA 3EYPA 4ZE5A 2Z2UA 2NXIA 1P43A 1XIEA 1IZJA 2FZDA 1UMLA 4AZ6A 4O50A 3NYZA 4W5ZA 4E2VA 1XIFA 3MHUA 2P50A 4MMWA 2ZX6A 2X41A 5EKYA 1JGIA 3GG8A 1ZL1A 5KMYA 1UC5A 1RK6A 3FA5A 7ODCA 5HINA 1GCYA 4GXMA 1HZYA 2XFFA 3VFCA 4XVDA 1EJ7L 1FWAC 4B5TA 2PS2A 3N2OA 4MNJA 1JD7A 1W2VA 3C5QA 1F05A 1E3ZA 1MFVA 3DUGA 1EXBA 3EWWA 5IRPA 1PSCA 4AHQA 4IG2B 5AC4A 1VEPA 4BI6A 1WQ5A 3LGGA 5IHRA 3QV7A 4E2OA 4JDBA 3L0GA 3WELA 2J7DA 5F1UA 2V3EA 5M5DA 3KOXA 2PE4A 5FF7A 2Q8LA 1E1FA 3MANA 4I5RA 4UFMA 3TLLA 3POHA 4CU7A 3VD5A 4AEEA 3FAXA 3NVDA 4XZLX 2NXHA 4HP5A 3SW6A 4IUOA 2A3HA 4A8RA 4WOQA 1XBXA 1J0KA 1M53A 3RO6A 3IJLA 2O7SA 3RG6A 1VBGA 3BMWA 2ZRZA 3WJZA 3WFLA 4MGGA 2PZ0A 2WANA 4PUMA 3GNNA 4HPHA 1J5TA 4NUWA 3ZSSA 3KZSA 4GYPA 5DRIA 1FVPA 5E6YA 3PB2A 5A8NA 4LUTB 3W2KA 2XN0A 2GUUA 4B91A 4O1FA 3UQNA 3LHYA 3CZKA 1LL7A 2QT3A 2NZLA 4WKAA 4FX6M 1UUMA 4LB4A 4LW7A 1JAEA 4ZQPA 1K7XA 1MW0A 2B81A 3R89A 2DH3A 2AKZA 4XB3A 3FJNA 3VAVA 3GXPA 4GH1A 1XICA 3HO8A 4H7ZA 1A3XA 1JG9A 3CGTA 2ZWZA 3BAXA 5HR7A 1A0EA 2BXZA 1JYVA 1J5SA 1UIPA 2WZMA 1J0JA 1I75A 1V02A 5HJLA 3IAQA 3S42A 3WQCA 3GDRA 4XWUA 4C6FA 1Q7ZA 5EMJA 3UETA 3DERA 3EWUA 3H8AA 4GCXA 1XGEA 3G77A 3CPGA 1O6IA 4BK9A 3BSHA 2DVUA 3VKAA 1RPKA 2VZTA 3FW6A 1OVDA 3QR0A 3UYCA 1ZAJA 2V9DA 4M7TA 4S1FA 3WNKA 3GW3A 4C5YA 3QYQA 3MCMA 3I7QA 3N2MA 4DJEA 3TN6A 2XZ9A 3TC6A 3RRXA 1E15A 3NQEA 3CHCA 4EXAA 1I60A 3VKBA 1GZJA 5EU9A 3VDCA 4IL2A 1TPEA 1KXTA 3U0HA 4CU8A 3WEMA 2D2HA 3QBUA 1VFTA 4F3HA 2CLKA 5HR6A 5DFAA 4UQAA 2QCHA 3STGA 3FYOA 4ZEPA 5ECUA 4XX6A 3ENLA 4IGMA 4ATDA 4N42A 2QCDA 4LAZA 1KFCA 3LHWA 1TKKA 4YMZA 2WK2A 1GOWA 3OVPA 1FDYA 3ZFHA 3UXLA 4ZFCA 4A22A 1BFNA 2VWSA 1UP3A 3PTDA 5HJXA 4B15A 4XV0A 4FXSA 3ONBA 3WY1A 3AZSA 4ZB5A 3M0LA 1JXJA 1MNSA 1XLFA 3R8GA 2D0GA 1GG1A 2J7CA 4FLSA 1VP5A 1VPQA 2CEQA 2FPTA 2CZDA 2J6VA 1XBZA 3IIZA 4S2BA 3BMXA 1WBHA 4YIWA 2QLYA 2GOUA 1WDQA 3VYLA 1K9FA 3ZLFA 2RFGA 1W5MA 1A49A 1TTJA 3WF0A 4GZIA 1XLAA 4Z0JA 3WLMA 1W1ZA 5H8UA 3ZLHA 5G1TA 2D3NA 3A6OA 3WUFA 4GMEA 3TW6A 5LA1A 2JGQA 2WW5A 3ES8A 3C8NA 1M7PA 5J5DA 2PTWA 3CTLA 3R13A 3TEVA 2FMOA 1W1VA 4Q8TA 5E9XA 5JUVA 2JBMA 2XFRA 2QULA 2EPOA 5LIYX 2D2JA 5T9BG 2IQDA 1Y65A 4DZHA 4B16A 5EY5A 2V5CA 3FJ6A 4I7WA 4A21A 4O11A 1TVPA 4NHVA 2XM2A 1R3QA 3ZQ9A 1PZ2A 1A4LA 2VD9A 4X22A 4HK7A 4PMZA 3EA1A 4IL0A 1M04A 1FTXA 2F7FA 2VQTA 4H41A 4JNYA 3RCYA 5GJMA 1E43A 1BEUA 5CEWA 3E2VA 1PO9A 4GH3A 4GX9A 5MHBA 1PIFA 1IWAA 2QV4A 3CHVA 3NO3A 1TREA 3WEOA 3Q37A 4Z1BA 3V5FA 5I77A 1SO4A 5KTLA 4K68A 2FGLA 3TA9A 1F61A 1EF2A 2Z1KA 4OHQA 4GA8A 4QE5A 2VEGA 2WMHA 2Q01A 3O1NA 2PRHA 1EC8A 3D6NA 1D7FA 1R3YA 2Y89A 3QLLA 4C6QA 1J0HA 4BS0A 2FYMA 3KLKA 2X1TA 2I5IA 1DTUA 4WX2A 3GR4A 2HVNA 1XX1A 3GHUA 1CLKA 1HJQA 1C3FA 1IXPA 2WHJA 1EKOA 1FKWA 2GUYA 1PTDA 3F5LA 2I9UA 3VPLA 7A3HA 4TX6A 1ISVA 2YBUA 3GBEA 3PSWA 2BOFX 4FB7A 5I02A 4US5A 4DB7A 2VP8A 2A85A 3AS2A 5E0FA 3C2RA 5E5CA 3K1DA 5CH9A 4JBRA 3BAWA 3EMCA 4PTDA 4Q4PA 3HM7A 3GYEA 5HOSA 1GOXA 1L2QA 3QC0A 4AY1A 3I4EA 4ZTXA 1YDYA 4CCZA 5BOFA 1SZEA 2HNEA 1WXZA 1XRSA 3F4WA 2PA6A 3IIXA 1UA7A 4G9PA 2OT1A 1OHLA 4DWSD 4OVXA 4J3SA 3BZJA 3G3DA 3P62A 2YOCA 2HJPA 3LHVA 1BQGA 1VH7A 3G0UA 1CWYA 1ZALA 4A4AA 3W7QA 2ESCA 4XD3A 3B9EA 1YRRA 2E7FA 4ICNA 4M1RA 1PS9A 2A5HA 1H11A 2Z24A 3U48A 2YPIA 4H3DA 2BGNE 2BVWA 2DT2A 2QF8A 1NP0A 1FWIC 3G1XA 4CQ9A 3MV01 5H8PA 3B8SA 2NVCA 1XBYA 1KWGA 4A6GA 1KM0A 4Q7IA 3W29A 4YJ5A 2PGRA 1UP2A 4AEOA 2NQHA 3MSGA 2JEQA 1F3TA 4B5UA 4PTMA 2UY2A 1TG7A 1VGAA 1XYBA 1F2JA 3GVVA 5C2GA 1RY0A 1GQNA 5AC7A 4DJFC 4L4LA 4KIRA 2ZC8A 3ZT6A 1NP2A 3K4AA 3FXYA 4JQ2A 4Q4KA 5DMYA 2GGGA 4O16A 4AXKA 5FEWA 1BVNP 3T05A 1IT0A 1TE1A 2FVLA 3FXGA 4KCWA 3ARZA 3AFBA 3FGCB 2YCEA 1UP0A 5C2XA 3PZ9A 4E38A 4CD4A 4ZB0A 5JH2A 3QOMA 3EOOA 1N8WA 3WJSA 2OSXA 3QGKC 1PX4A 3ZLGA 6XIAA 1A80A 2YIHA 3E02A 4KEZA 4BEQA 3DIPA 2TYSA 4KW2A 4EANA 3GX9A 3MQTA 5HUPA 1YXYA 2YSWA 3NOYA 4O14A 3TJXA 4O0ZA 4Y9MA 1QOXA 4EPBC 5CPOA 4AQLA 2DSWA 1H7NA 2C7FA 2OB3A 1R86A 1VENA 1MW1A 2XSAA 5I6SA 3QW3A 3PNUA 4HA3A 5CXPA 4I6VA 4GI9A 1F8MA 1AW2A 3SRDA 3CHDA 1LL6A 2O92A 1JZ3A 3PM6A 3HPZA 1JNDA 1OT1A 1RHCA 4ACZA 1TFVA 3F2DA 3TE9A 1BRLB 3WF1A 3B4YA 4JFUA 2QEZA 1GZGA 3T81A 5C0QA 2PLMA 1V03A 3BJFA 3AJXA 4IFRA 4S3KA 2J8GA 1LRNA 2DUAA 1O4UA 4GIYA 4CCCA 4K37A 4OUEA 3NO1A 4LBUA 1KBBA 1TZZA<