3CTLA

Crystal structure of d-allulose 6-phosphate 3-epimerase from escherichia coli k12 complexed with d-glucitol 6-phosphate and magnesium
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
219
structure length
219
Chain Sequence
b'MKISPSLMCMDLLKFKEQIEFIDSHADYFHIDIMDGHFVPNLTLSPFFVSQVKKLATKPLDCHLMVTRPQDYIAQLARAGADFITLHPETINGQAFRLIDEIRRHDMKVGLILNPETPVEAMKYYIHKADKITVMTVDPGFAGQPFIPEMLDKLAELKAWREREGLEYEIEVDGSCNQATYEKLMAAGADVFIVGTSGLFNHAENIDEAWRIMTAQILA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-allulose-6-phosphate 3-epimerase
publication title Structural basis for substrate specificity in phosphate binding (beta/alpha)8-barrels: D-allulose 6-phosphate 3-epimerase from Escherichia coli K-12.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
total genus 72
structure length 219
sequence length 219
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.1.3.-:
pdb deposition date 2008-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ctlA00
3N2XA 1H1YA 4BK9A 5D2VA 3EWBX 1UJPA 3UQNA 2AGKA 4H6KA 2DZTA 3NM3A 5LGZA 1JCXA 3BG3A 2XN1A 1KFBA 1QCWA 2AQWA 4O0KA 8TIMA 2CLFA 1YTKA 4NVTA 3USBA 2I14A 3DXIA 2B7NA 5F2MA 3MYOA 5AN7A 4GUGA 3PG8A 2YYTA 5G2WA 4XKYA 1K03A 2OX1A 4TR9A 2FPVA 4QM1A 2VC6A 2ISSA 2NX9A 3JS3A 3KRSA 5KZDA 5LNSA 3HF3A 3WK0A 1YTDA 5CGQA 4UTKA 1AL7A 3Q94A 3UPWA 2VENA 5HNRA 5G4WA 2C6QA 2FFCA 5F2LA 2V30A 1I2QA 3E02A 4YWIA 1VCVA 1SSDA 1XL9A 4LS1A 2WPBA 3GKAA 5D09A 3L9CA 2EKCA 1G7VA 3MHUA 3W84A 4E38A 5LNUA 4D2JA 4LS0A 4PL1A 1OK6A 2ZRYA 4ICNA 5EYWA 1OX5A 1VH7A 2RFGA 1P0KA 1A5CA 1I45A 3LB0A 3BG9A 4ML9A 1K7EA 1XUUA 3NEVA 4DEFA 4O0ZA 3NPWA 5AC7A 3IVUA 4JX5A 3GX9A 4EF9A 3W1QA 3P8IA 3W7RA 3RMJA 1TPDA 3O06A 1OX6A 4TU1A 5KZEA 4WZHA 2QCFA 3MP4A 3SY5A 4QNEA 2AAMA 4O18A 5D2TA 3GXNA 4MVAA 3W7LA 3MBFA 1M5WA 4DO6A 4QNWA 2RDUA 3PSWA 4O8RA 4ZZ9A 2B7PA 3PAJA 3A9IA 3TQVA 4O14A 4FXSA 3HMJG 1LBFA 1QNVA 4L4LA 3KVJA 4N6EA 3GYEA 2C13A 3S6DA 2FTPA 1IIGA 2F7FA 2ZZ3A 1X8FA 2CZ5A 3NR0A 3IGXA 4PTNA 3S1VA 5HWMA 4CNOA 1XBYA 5U7SA 1VRDA 4UFHA 5HR6A 2C14A 2E5CA 4CNNA 3LCHA 5DBTA 1JCLA 4DBDA 3G24A 1W5QA 1A50A 1HFBA 3C2FA 1FX6A 3DHFA 1I2PA 3OVRA 3B0VC 4JX4A 2YW4A 1ZENA 3L0GA 4FF7A 1SW0A 1THFD 4JYFA 3TW6A 4DPPA 2BZNA 2RH9A 1TPFA 3SZ8A 4JNMA 4M5PA 5FF4A 2OJPA 3DKJA 1RD5A 2C19A 2ABBA 2J9XA 1KM4A 3FIGA 1IGSA 3P84A 2ZTKA 3QMTA 4HNTA 5C2XA 2ZA1A 3N34A 4LW7A 4WY0B 5K9DA 1KV8A 1QDSA 3SECA 3W3OA 1W5MA 4LWWA 1YDVA 3W1PA 5BMWA 2FLIA 5G5IA 5FF3A 4NJKA 2VFIA 4X2RA 2V0TA 3QM3A 3NO5A 4M7SA 2YDAA 3W2LA 5AHLA 3DAQA 3NGJA 1PCKA 4IX0A 2E6DA 4RLIA 4GJ1A 5DCEA 1PE1A 3LHVA 3OHIA 4UR8A 4N6FA 3L21A 1LRTA 2G95A 4MYAA 1FCQA 3NOEA 1OX4B 3EWWA 4DXVA 4WOQA 2Y7FA 3R8RA 1R46A 1LOQA 2I1OA 2JBMA 3HG5A 3W76A 2ZTJA 1S5VA 4S2BA 4MFDA 3LGEA 2V5LA 2C16A 3TKFA 3LHYA 3OVPA 1PIIA 3LV5A 3WFAA 1YYAA 1H63A 3N14A 3DFOA 4OHQA 3NL5A 1TV8A 2NV2A 4YCPA 1GVSA 5A5WA 4MLJA 3NAVA 1A5AA 2ZQ0A 1VCGA 3G8EA 4UXDA 3TR2A 3GVGA 3S0CA 3ZS4A 3SW6A 3NL2A 1CW2A 1GTEA 3EX3A 5DCDA 2C15A 1VYRA 3UY7A 3NM1A 1TPH1 4RZ4A 2H90A 3W1LA 3G1SA 5HJLA 5I3JA 3P61A 2EHHA 5FEZA 4O52A 2Y70A 3GXPA 4XWUA 1FCUA 2C1HA 3CEUA 3P74A 3DI0A 2R91A 2QCDB 1FWRA 4JX6A 4RR4A 1TPC1 1QPNA 1TIMA 4IMGA 4X3ZA 5DLCA 3G18A 3GXTA 4NXSA 1K8XA 4K39A 1FDZA 2Y7EA 1DQXA 4O19A 4FNTA 2G5WA 5K4ZA 5D38A 3C4UA 3STGA 3W7GA 1G6CA 1TTQA 1GVQA 1ZAHA 2O7QA 2QCMA 3FJLA 4FNRA 1SO5A 3N9SA 4JXCA 1C9DA 1OVDA 4Q33A 5DY2A 4DF1A 3PBUA 4CQ9A 3EWUA 3GDTA 5G4EA 1G7UA 3FKRA 1PV8A 3Q2DA 4OT7A 4HPXA 3CM4A 3GAKA 3ZR4A 1GEQA 3TSMA 4ZQMA 3CWOX 1Z48A 3LRLA 3I6RA 1W1ZA 1DBTA 3I7RA 1F2JA 3RK8A 4LY8A 3G22A 2VXNA 4HHPA 3WK3A 5F4XA 4H3DA 1SFLA 2WO5A 1LRQA 4RK8A 1O60A 1ZHAA 3KVMA 1W31A 3IIPA 2WNZA 1TQJA 3A23A 4O50A 3SGUA 1UASA 4N9CA 1LORA 1AK5A 3CQ0A 5KZMA 1HG3A 3FLUA 2GJNA 4IPIA 1MZHA 4HNUA 1KBJA 3BLIA 3DH7A 4UIOA 1AW2A 3BO9A 3OBKA 4IMCA 1LCOA 1OYBA 2ABAA 3VKJA 3BG5A 4RCXA 1GQNA 1LOLA 5D04C 2QEZA 4E0CA 4CCCA 1JUEA 1WAUA 1W3TA 2GVGA 3PSVA 4BWLA 1H7OA 1K02A 4NXKA 1GG0A 4NNAA 4PH6A 2VOMA 3P81A 3WJYA 3M43A 2NZLA 3LOTA 5FF7A 2RDTA 4JTKA 2NX3A 5K9XA 3L67A 1MXSA 3NQ7A 5D37A 1O94A 2X30A 3GR7A 2J9ZA 3SR7A 4JICA 1OFDA 1J5TA 1RZMA 1LROA 3M0ZA 3MMTA 1QPQA 4K6AA 2W0UA 1TPVA 4LVFA 5D33A 4GNJA 1KTBA 4WOZA 1XUZA 1RR2A 4GXMA 2GUUA 1IXPA 1W37A 4JTJA 4LC6A 3TSDA 2PE4A 3W7JA 2V81A 1VQTA 4O1BA 1DKWA 1WV2A 3STCA 3E9AA 1OJXA 1M6JA 3PBWA 3P67A 2LLEA 4MY8A 3SGZA 4HKPA 1G69A 3NZ1A 4MFEA 3L65A 2QCNA 2E5BA 2FIQA 2R8WA 3TMLA 4LRTA 4O12A 4DO4A 1K7FA 2DORA 4EF8A 2A4AA 4AWSA 1JJKA 1DL3A 5TIMA 1LTDA 4YMZA 4JEQA 3QH2A 1A5BA 3A21A 2CLHA 2J24A 3P7YA 4O13A 3PY2A 3TX9A 4AH7A 2FQIA 1J2WA 5KINA 3B05A 4B5NA 1SPQA 2WKJA 1M7OA 4KFOA 2R94A 3TCEA 1W3NA 4K8EA 1ICPA 1GOXA 1N7KA 4UNKA 2Q3RA 1TV7A 5FESA 3YPIA 2ISVA 3A22A 1D9EA 5HMSA 5I3FA 1EA0A 4O16A 1O5KA 2QCGA 5EBUA 2F84A 1WX0A 2RKXA 4JYDA 1BKSA 2CLOA 4LVAA 1G4PA 5H91A 1WBHA 5LSMA 3VE7A 4UFIA 4Y8FA 4QSHA 3EEGA 3S8HA 3HG2A 3O07A 3HQ1A 5AHFA 1F76A 2NV1A 3SSJA 3EXTA 2ZRUA 1VCFA 3BK0A 2ZFAA 3QF0A 1Y0EA 4CQAA 4FNUA 2J6XA 4O1AA 1SO3A 1Z41A 3HGSA 3TIMA 3CU2A 4XTIA 1PCWA 1QR7A 4W9TA 4A29A 4MY1A 3QQ0A 4GRSA 3TDFA 1HL2A 5J5RA 2ZZ5A 3IRDA 4K7YA 4UUIA 1GYLA 3UWYA 4WJEA 1JUBA 1RQEA 2ZBTA 4IJBA 2XN2A 1LLWA 1XDLA 3TQKA 2BLEA 3KX6A 4WX2A 3TU9A 4UFMA 5EPDA 3W85A 3HPZA 5FI8A 3NA8A 5HUOA 3M9YA 3MJYA 5F4WA 4RXGA 3M41A 2YR1A 2E1DA 4Y6GA 1MSSA 1OX4A 4XTDA 2ZRWA 2Y6ZA 1F73A 1YXCA 4ORIA 2Y89A 2Y63A 3ATZA 4UTTC 4QISA 4N02A 2Y62A 1P5BA 4NX5A 2VFFA 1TPUA 1ZY9A 3PUEA 3T4CA 3WJZA 2ZRXA 2NXIA 4XUGA 3LXAA 4NNCA 1LP6A 3LBCA 1AL8A 3LCXA 2H8ZA 4NJGA 1G67A 1F05A 4MJMA 5LZLA 3W87A 2V2CA 3TMQA 1KM0A 2FPYA 5MHBA 3W9ZA 3LHTA 3BGJA 1A5SA 3T44A 1KM1A 1VHNA 3LM7A 3S1XA 4RX0A 4JTFA 4PA8A 4POCA 5F1VA 3LHWA 1FXPA 2CWNA 3GDLA 4FNSA 4DO5A 3DBPA 4LU0A 1H7PA 4Z1CA 4E2BA 1GT8A 2PRHA 2DP3A 4N9DA 4IXXA 1LBMA 1WBJA 3GNNA 3TXVA 5LGXA 4LVGA 3NXFA 1OHLA 4TIMA 5G1TA 3NPUA 2NWSA 1L2UA 3IIZA 4N4PA 1BTMA 4FNPA 1O5XA 3ZWSA 2QCDA 5AHIA 2E68A 3VE9A 1BWKA 3W72A 3RLUA 2HSAA 4FNQA 5KSWA 1TV5A 3W73A 3HIJA 3IGUA 1SW3A 3W7HA 1LRNA 3CC1A 2G96A 5CPNA 1SZGA 3I7QA 1T96A 4TMBA 7TIMA 5FEXA 3SFKA 1H5YA 3TC7A 4ALDA 2QCEA 3KRZA 2W79A 1E51A 3JRKA 2JKPA 3W1TA 2X1TA 4WXZA 1LZOA 2OT0A 1EUAA 1LM1A 3NZRA 2CZEA 1KFKA 1VR6A 2ZZ4A 1XFBA 1J4EA 3CEPA 1YDNA 3LCLA 2H3BA 2QAFA 5EMUA 2X1RA 4OV4A 3W7OA 4LS2A 3BVJA 3IIOA 3QW4B 3EX4A 4UR7A 1DHPA 3QJAA 2QDGA 3LTPA 1TSIA 2P1FA 1TMHA 5D2YA 3TSBA 5D03A 1I2OA 5D02A 3W1RA 3MWAA 5IM51 1ME9A 3SI9A 1FWNA 2Z6JA 1KV5A 3UZJA 3TA6A 1QFEA 1ME8A 1Q6RA 2YX0A 4GUHA 4L4MA 4QAIA 3KAOA 1TTPA 4WD0A 2NUWA 1ZAIA 3T78A 1VJIA 1F6PA 3E0IA 5CSRA 4S1FA 4OV9A 2OCZA 1X7FA 1VPXA 2BTMA 1QOQA 2A6NA 3PB2A 4Z08A 1O4UA 2GQ9A 3S1UA 5DELA 4JTUA 3ABOA 3W1AA 4NZJA 3RU6A 4OU1A 4IMDA 3C8FA 3EX6A 2DZVA 3PB0A 4OQVA 4MY9A 1VYSX 1X6UA 3BLFA 3WK2A 1DJQA 4X22A 1LBLA 2ZDRA 5E93A 5EKYA 4G1KA 1SSGA 3M6YA 2EGZA 1ICQA 2X2GA 1AW1A 2YPIA 3R89A 2A7RA 3PF3A 3G1DA 1B4KA 3NG3A 4CLMA 1QWGA 3LERA 5LNRA 4JTGA 3C56A 3NQ8A 3DFQA 3CT7A 1ICSA 3LCGA 1EPXA 3HOJA 5K3VA 3THAA 2CZFA 3W1NA 4UFJA 4BI7A 3UD6A 4FHAA 3HG4A 3W86A 4XBSA 4HSNA 3DFPA 5LHFA 3L68A 3PBYA 1S3HA 2J27A 5J5DA 4Y9AA 2Z2UA 3GZ3A 4TMCA 2YFNA 4K8HA 5D2XA 3RLVA 5C5YA 5SWUA 3BLEA 4O1CA 2FPTA 1H7XA 4OGZA 1EP2A 2TPSA 1EUNA 4H4IA 1XCFA 4KFNA 3O15A 4UC5A 4DQWA 3VNDA 4ZQNA 4YCOA 5F1UA 2GVLA 1UCWA 1D3GA 3IGSA 4IPJA 4FIRA 1H7WA 4FEZA 3W7QA 3W7EA 1L9WA 3G1AA 2WSQA 3TXZA 1DVJA 5CZTA 3W74A 1WXJA 3W2KA 1DV7A 4PODA 5FF0A 2B4GA 5CPOA 2ZCGA 2WV8A 3W75A 3UPBA 1GJPA 3P5ZA 1JRBA 4DF2A 2Y7GA 3EXSA 2PURA 4UTIA 3G0SA 1JCYA 4CQ8A 1TPEA 1R2TA 3AJXA 1KM3A 2E09A 4UCGA 3N3MA 3LTYA 1YDOA 4ZQPA 3MHFA 2B7QA 4AAJA 5HUPA 4HNNA 4UTWC 1G4EA 1LYXA 3QRHA 1H61A 2CLKA 2YSWA 4JYEA 1NVMA 1V7YA 4Z0SA 3F1QA 4CCDA 5EA9A 5LNVA 3L2IA 1Z42A 3HPXA 2D73A 2QR6A 2YXGA 3DHDA 4O53A 3HGRA 2YZRA 3TH6A 4A2RA 3R12A 1BEUA 3TUUA 3L0NA 4ADSA 2GPTA 2C18A 1DJNA 3WK1A 3NPXA 4LOCA 3TV8A 1RV8A 3W6YA 4O1DA 1FY6A 2FJKA 1SFJA 3LHZA 2A1YA 3UXDA 3DFSA 1YTEA 2DZSA 1I2RA 3W70A 3FYOA 4LUIA 1JVNA 1QOPA 4RKAA 4Z1AA 4O28A 1SZNA 4QITA 3MHGA 2CLIA 5CPMA 1H50A 4NZFA 1FCBA 2DZUA 3C61A 3QSRA 1CI1A 1ZNNA 4O11A 1H1ZA 1H51A 2A7NA 5GVJA 4Q32A 3W7MA 1GYNA 1TJPA 4I9AA 3S42A 3A5VA 3L5LA 2Z6IA 4UTLA 3ABRA 4J9JA 4FB7A 5G2IA 1OFEA 4NJIA 3LLDA 4A2SA 3TFCA 4UMAA 4MZYA 5HWNA 3QFEA 3EWZA 1AG1O 2VFGA 2Y85A 3BV4A 3G0XA 5K9CA 1I8JA 1F7BA 2NLIA 4PC8A 1S5WA 3GDKA 3CLMA 1HTIA 3LX9A 5AC6A 1ZCOA 2Q8ZA 4WQ6A 3LCWA 1VC4A 4NJHA 3LI1A 3CPRA 4CNPA 2ZZ2A 3QPYA 3DU0A 1KM5A 3L66A 3GR8A 1TRIA 3E49A 5HR7A 5C55A 2A5HA 3PBVA 4AHOA 5F2GA 3NL6A 5LKYA 4JY9A 4WY0F 5E0KA 1A53A 4JR5A 3U8GA 4A3UA 2YW3A 3MW7A 3W83A 1IXQA 2A6LA 1B4EA 4EVZA 3W7CA 2WJZA 2DU2A 3MI2A 1WOBA 3GKFA 3FFSA 5AFDA 3HO8A 2TSYA 3L5AA 4A21A 4ZQCA 5D05A 5I3KA 3O05A 1EWDA 1K7XA 3TC6A 2ZYFA 3QPZA 2EPHA 2WSRA 5TQLA 3UWUA 2CZDA 5AYXA 3M47A 4O4VA 3DZ1A 2PRMA 3ELFA 3DI1A 1T99A 1KM6A 3MBDA 5E1QA 4TX9A 2NXGA 2ZZ6A 2VEKA 4NU7A 5AC8A 4N9BA 2TYSA 3CIXA 1WA3A 3IVSA 2RDWA 1MO0A 3LRMA 4GUJA 3B0PA 1S5TA 1SUXA 3HBLA 1PHWA 3INPA 1FWWA 4AF0B 5K7JA 1O95A 3NQDA 1G4SA 1OFRA 3RNDA 1KLYA 5FEPA 3BARA 3O6YX 3MUXA 4UTTA 3HJZA 2QCCA 1Q6QA 4I7VA 3C2VA 4IMEA 3W2JA 3P8JA 1W5PA 2VFHA 2H3DA 2BX7A 3S5NA 4PEKA 5F2IA 2BWGA 1QPOA 1C8VA 1R47A 2Y7DA 1GG1A 1U5JA 3L0KA 2ATMA 3C2RA 2CLEA 3OG3A 1JCJA 2C3ZA 4ZL1A 5AB3A 3LXBA 3S5OA 1Z44A 2BSLA 3TJXA 2V82A 3A5FA 4JDBA 2JK2A 3OEXA 1TB3A 3LTSA 3M44A 4IX2A 3SIZA 1DQWA 5ABTA 1X1OA 2V5BA 5HINA 3K30A 3T40A 1TO3A 1TRDA 1XC4A 3PG9A 4PL2A 4XQ6A 4EIVA 2QUTA 4KFPA 3W71A 4AWTA 1EX5A 1OFOA 2HMCA 2C0AA 1IXNA 1GVOA 3ABSA 3L5MA 5BRBA 3H54A 3ATYA 3UWZA 5L9FA 2QJHA 4JGDA 5AHMA 1ML1A 4JTHA 1KLZA 1U83A 1YLVA 4JTSA 3ZWTA 6TIMA 4IQLA 2FB3A 2H8XA 1ZAJA 3EKZA 1R2SA 5C54A 1YPFA 3MYPA 3TK7A 1SQ7A 2ZRZA 4C1KA 3KOFA 3W7PA 4AWUA 4UMBA 4UTMA 2FB2A 1XBZA 2VEMA 1T8XA 1Q45A 3D0CA 3GLCA 1IF2A 3M1ZA 1KTNA 2RHGA 1FDYA 1QO2A 2B7OA 1B3OA 3H53A 3QEZA 3TNOA 1P0NA 2JKAA 5G2HA 5BMXA 3KFTA 1VLWA 3PULA 5DCBA 5CZSA 1QO5A 3DFTA 2JGYA 5FF2A 2EAWA 1IXOA 5HWJA 4I7WA 3MI6A 4WXYA 4GC4A 1XDMA 3MP5A 3FJ6A 4RXFA 3V75A 5C6MA 3B8DA 4MLRA 3TROA 4JTIA 2OMAA 2DZXA 1KFCA 1B9BA 3I65A 4LTSA 4NNBA 3G8RA 2TMDA 3B04A 1JCNA 3BW3A 1FQ0A 4ZVJA 4NT0A 1W5NA 1MEWA 3NQ6A 2TRSA 4RZ5A 2GOUA 3R13A 3P80A 5IBXC 1YADA 4NX0A 1PS9A 4XBKA 5LNWA 1UUMA 4R53A 4MZ1A 1P1XA 1TJRA 2X16A 3KVKA 5BNKA 3G1YA 4I7UA 3BW2A 1AW5A 4U28A 2WNQA 5FEWA 1KBIA 4BFAA 3NQAA 4O57A 1FWTA 3MP3A 2J9YA 3IIXA 4KWWA 3LHUA 3O6CA 4C1LA 3G1XA 3W88A 4LT9A 3RF9A 3NQVA 5T26A 3W1XA 1KA9F 2CU0A 1JULA 4M6QA 3LCIA 1KM2A 1TTIA 3OIXA 3NVTA 1HUVA 1KTCA 2R14A 4LC8A 4ONVA 3W23A 2ALDA 1ALDA 1VYPX 3QMRA 3LV6A 1GTHA 3H55A 4IUOA 3P60A 3DENA 2I9EA 2XFWA 2GQAA 3G1VA 2NWRA 5DY3A 3PS7A 4AB4A 2YYUA 4BR1A 3UZ5A 3NQEA 1LLZA 4O54A 4O4WA 3F4NA 1TPWA 1WQ5A 5EY5A 6ALDA 1MEHA 3QSTA 3WJXA 4RZ6A 1H7NA 3LLFA 1YPIA 3UYCA 2Y88A 4AVFA 2H6RA 4LV9A 2HS8A 3MI3A 2NX1A 3G1HA 1VS1A 3I68A 1KFJA 3QYQA 5KITA 2QJGA 2E6AA 3EKLA 1IIHA 3GK0A 3ABQA 3PR2A 1TPB1 2X1UA 1OF6A 3JR2A 4Z1BA 1JR1A 3FYPA 5AHEA 1C29A 1W56A 3CB8A 2CFFA 3NNTA 4IMFA 4Y96A 4JS3A 4UNLA 1PVNA 1PHQA 1SZFA 1RQBA 1XBVA 3UWVA 2VELA 2XN0A 5F4SA 1ONRA 5HQEA 1ZALA 4IWWA 1Q3NA 5CZ0A 4K36A 4AHPA 1D3HA 1GVFA 1LDCA 5CPLA 4R7JA 3G0UA 1XXXA 2VEIA 3P5YA 4YL2A 1KFEA 3CIWA 3B06A 4MZ8A 2EF9A 3S1WA 1P4CA 2DZWA 4EOUA 1WYIA 3W2NA 3BPWA 1EB3A 2E6YA 3T7VA 3M5ZA 1HO4A 4YXGA 2V2DA 2VKZG 4IXHA 4K38A 4AEOA 4R33A 2V2HA 1OYAA 2WSYA 1VZWA 2A2IA 4LRSA 3EX1A 4HSOA 1Q6LA 3CWNA 1BWLA 1FCVA 2V9DA 2ISWA 2QCLA 4BF9A 2HS6A 2W6RA 3C2EA 1SO6A 4AHQA 4FO4A 1FXQA 4ADTA 5DXYA 4UTWA 1EWEA 5CZJA 2ZZ7A 4N9EA 3GIYA 3PVFA 5KMYA 4LUJA 2YGYA 4LVBA 1YXYA 3M16A 2PC4A 4GUIA 1T0OA 3FA5A 3S5YA 2OT1A 3CHVA 5H2ZA 2Z0IA 1NF7A 2G97A 1F5ZA 1H60A 4N4QA 3HPSA 4OWGA 4XKYB 5EL1A 2JGQA 2FDSA 3F03K 5HULA 3VCRA 3UWWA 4JTLA 5I3HA 1OABA 3QC3A 3O63A 3W22A 3W1MA 3IV3A 3S5ZA 1K3UA 1LOSA 1K8ZA 4GE8A 4MJZA 2BXVA 4U4MA 2KZHA 3R2GA 4BI5A 3M5XA 4NJJA 3MO7A 3TE9A 5K2ZA 4KKXA 1EP3A 1F74A 3W7NA 1NFBA 2A21A 4JN6A 5K4XA 5CG7A 2Q8LA 1CX9A 3R5EA 3C6CA 4AF0A 1MEIA 3TAOA 3LI0A 3B03A 5CKSA 3F4WA 4K37A 1JRCA 5CSSA 1UBSA 2JKEA 5DBUA 1WOAA 3V1PA 3U2OA 2PRLA 5G1YA 4IOTA 4M6PA 1KW1A 1N8FA 1F6KA 4K7VA 4UTHA 4LV4A 1K8YA 4M19A 4DELA 1OFBA 4HN4A 5D32A 1TYGA 4NUWA 3NL3A 1RVGA 4RJEA 4PCFA 3KHJA 1TREA 3IVTA 3NYZA 1PL9A 3NQMA 3LDVA 4FXRA 2ZRVA 3TJLA 4Y90A 2QF7A 3LBMA 4WUIA 1XKYA 1ZFJA 3C0JA 1GVRA 1QPRA 1W54A 1W8SA 2DJXA 4UFKA 4QQ3A 1ADOA 3UNDA 4ORMA 1GZGA 3LRKA 4DF0A 4O15A 4MOZA 5A8GA 5U4NA 3HG3A 5D2WA 2P0OA 2Y61A 1HO1A 3O16A 3THQA 3NDOA 3DFNA 4FX7A 2V8ZA 3G1FA 4KWVA 3FOKA 1SR9A 3PC0A 5I3GA 5AHNA 4GBUA 2J88A 4JY8A 3E96A 4JIPA 3RFAA 4MKNA 3W7DA 3S9YA 4GUFA 3HB9A 3GAYA 1TCDA 2B0MA 2UV8G 3EWYA 1OK4A 3UY8A 2A85A 2CLLA 3LCFA 5DXXA 5I3IA 3ANYA 3IIVA 4AXKA 5L6UA 1XI3A 1DOSA 1RPXA 3NPVA 1G4TA 2QDHA 3T55A 4HIBA 1OFAA 2NXHA 3CTLA 1W5OA 1SW7A 2QAPA 3W07A 1KFLA 1JCMP 3VI2A 3M5YA 4QJ1A 3W2MA 1FWSA 4Z0JA 1TTJA 1I4NA 1OYCA 2VFDA 1NAL1 4UTUA 1W3IA 1VGAA 3QQ1A 2PCQA 2NUYA 3P62A 1WDWA 2ZZ1A 3N9RA 4HPJA 3EB2A 2QCHA 1XM3A 4MPQA 1NEYA 5D30A 1YXDA 4ZQRA 2NUXA 1L6WA 1FBAA 3STEA 4RV8A 4PFMA 1DORA 2DJLA 3EXRA 1EEPA 3DGRA 4BI6A 3IEBA 3UWQA 4UFLA 3GDMA 1M7PA 1I2NA 3SJ3A 4P61A 3NQGA 1ZJIA 1JUKA 3OA3A 4X9SA 3GNDA 3G3MA 4FX6M 3I7SA 4GFSA 1R2RA 4YLWA 4HT3A 2YCEA 3LXCA 4OBTA 3KVLA 3BGGA 4GWEA 4TO8A 1SZEA 3FKKA 2QUUA 3PWAA 3VFLA 1QMLA 4EWND 4UMCA 1AMKA 3OVQA 4HNVA 2DZPA 2Q3OA 3O1NA 3HGOA 5TBOA 1OFPA 1XBXA 3O8AA 3ZFHA 2GJLA 1R30A 4MIMA 3KXQA 3BW4A 3NQ2A 3HGJA 1B57A 4CCEA 1SU5A 4Z1DA 3N73A 2QJIA 4ZQOA 1OG0A 1VHCA 3QW3A 4M6VA 3M5VA 3STFA 3TQ0A 2GVJA 1SO4A 3A24A 1L6SA 1N55A 2O7SA 2OZ0A 1FUYA 5KTLA 4JTEA 3DKLA 3G3DA 3U6WA 1GWJA 4IGHA 1QAPA 3PUOA 1NF0A 2E5DA 2QKFA 3Q58A 4S2CA 4BWLC 4O17A 2E6FA 1ME7A 1H62A 4R34A 1Q6OA 3C2OA 3FS2A 3W7KA 4ADUA 1EP1A 4XZ9A 4JTTA 3P82A 3GDRA 4N2YA 2ZA3A 3N2MA 1H7RA 1FDJA 2VEPA 2WNNA 3WJSA 2P10A 1V5XA 2CW6A 2ZA2A 3TFXA 2YFOA 5AYYA 4ZMGA 1NSJA 3PM6A 3E12A 3Q37A 1GPWA 3W7IA 3M7WA 3B0UX 3AO0A 1OFQA 2GQ8A 4OE7A 3W1UA 3C52A 4DBEA 1UUOA 4DPQA 1X1ZA 3TAKA 5DN1A 5AYZA 1L6YA 1JQVA 3GB6A 4JDYA 3WJWA 1VLIA 4LNYA 4NQ1A 1EIXA 1RQHA 3B4UA 3NQCA 5IBXA 4P2VA 3UXAA 2X1SA 4AMAA 4A22A 2A7PA 3QMSA 3W2UA 4WY0A 3C3NA 4LVDA 4QIUA 1OF8A 4MUZA 5BOOA 2VFEA 4UTJA 5BW6A 3KRUA 1UB3A 2A0NA 2HTMA 1TQXA 2WQPA 2ATSA 3TW7A 4M7TA 1W0MA 4FX8A 2Z1BA 3PUDA 4O10A 4MYXA 3QZEA 2E77A 3N19B 3EWXA 3O6DA 5LHEA 2QUVA 2IQTA 5AOUA 2WOQA 3FEMA 4JD4A 3EX2A 1JQXA 3NQFA 4E2DA 4Q4KA 4FIQA 2CLMA 4JIQA
chains in the Genus database with same CATH superfamily
1H1YA 5M1TA 4IIBA 2IKIA 5D2VA 4H8UA 1FWEC 3UQNA 4EPBC 3NM3A 4B2DD 4H7CA 3BG3A 1XFCA 1QCWA 1FHLA 1YTKA 3V36A 3DXIA 1KXTA 4WKFA 1HKJA 2BVYA 1PTGA 2ISSA 4L9ZA 4B5TA 1PJ9A 3SRDA 2BVDA 4ROPA 4W8LA 3UPWA 1MW1A 1G0CA 5G4WA 4B90A 4QGCA 2V30A 1I2QA 1JGMA 3C0QA 3BAKA 3E0WA 5CC3A 4LS1A 2G3MA 3GKAA 4LS0A 1KGXA 2ZRYA 2HEJA 1OX5A 2VD9A 1PZ3A 4DYKA 3BG9A 2XVPA 4DEFA 1R0MA 4L1XA 4EF9A 1Z32X 1N8IA 3MDUA 1TPDA 2W92A 4PMUA 1X7IA 1BYBA 2QCFA 2O9OA 3ZSTA 2AAMA 3CZGA 4O18A 2XSBA 1D3CA 4X60A 2NT1A 1KBLA 2VQTA 4H9MA 1CBGA 4G2DA 1CGTA 4JKKA 1IWPA 5C2CA 3PSWA 4O8RA 2UY2A 4Z2LA 1RUSA 1TE1A 4F79A 1VIZA 4N6EA 4WGHA 3GYEA 3L2LA 1D7KA 2FTPA 4MGGA 1NP0A 2PFHA 2ZZ3A 3S5SA 2CZ5A 2NQHA 1KCZA 1F3EA 3AU2A 2PDXA 4JTQA 3UGRA 4MADA 4A6GA 3BGAA 2C14A 1GOWA 3BLDA 3LCHA 5DBTA 1AH3A 5ECUA 4DBDA 4KWOA 1XQLA 3CYJA 3B0VC 2G4FA 1EZWA 3W02A 1ZENA 2G41A 4QX4A 3DESA 4ZFMA 4JYFA 2EEXA 2BZNA 2HZGA 1CWYA 2QQ6A 1XLGA 1CECA 3RAOA 2C19A 2ABBA 2V5CA 3FIGA 5LIWX 3M0IA 2OKTA 3VGGA 5C2XA 4UOQA 2ZA1A 4LW7A 3VINA 3SECA 1PZ2A 1GHRA 3VKAA 5BMWA 3B0YA 4Q8UA 1MRAA 4NJKA 4PMVA 3SGGA 2H9AA 3NO5A 5DANA 2VVNA 3DAQA 3NGJA 2PZ0A 4ZTXA 5MKGA 4UR8A 3ECQA 1Q6DA 3L21A 1FCQA 1OX4B 3R8RA 5ENLA 4AIOA 1LOQA 3GVWA 2JBMA 2ZDSA 1RCOB 2ZTJA 2CXEA 3LGEA 4H9VA 3M0HA 2C16A 1EGMA 3TKFA 3OVPA 1HIZA 1WE5A 1YYAA 4GBDA 3CWHA 3G6LA 3DFOA 3KOXA 4YVXA 2HXTA 1K8CA 1TV8A 3H23A 3UWEA 2G3IA 4MLJA 1A5AA 1DPMA 1XJBA 2ZQ0A 3WQEA 1W9VA 1XICA 5FAGA 4EANA 1VBRA 1BFNA 1D2KA 1VYRA 3UY7A 3WX7A 4RZ4A 3C0LA 1R8LA 3XINA 3ZJ6A 4EPDC 4GHRA 3WLRA 4GO8A 5EFFA 3TLLA 3EEZA 4N0RA 1JF6A 3DI0A 4JX6A 4C91A 1TPC1 4IMGA 1J10A 2ZE3A 8RUCA 4X3ZA 2WZHA 1EJXC 5DLCA 4B3KA 3G18A 3GXTA 4C1NA 1UA7A 4O19A 4MKSA 1E0WA 2GGJA 4S3BA 2REQB 3RM4A 3FJLA 2PF8A 4R7OA 1YQ2A 3N9SA 1BF2A 5DY2A 3PBUA 3EWUA 3TYZA 2XGZA 6TAAA 2QJNA 3FKRA 5E09A 1PV8A 3WH8A 2J7EA 4QQUA 1H09A 1GW9A 3W82A 3L23A 1H49A 5AKQA 3N13A 4HHPA 3WK3A 4NI8A 1HJSA 2GSEA 3H2MA 3IIPA 1TQJA 3WQ6A 4PTWA 4E8CA 4N9CA 1IZJA 5I3DA 3V0UA 5KETA 1TMLA 5DRCA 3FLUA 2GJNA 4HNUA 1KBJA 3DH7A 4GY0A 4IMCA 3SBFA 1LCOA 4KGJA 1OYBA 1QOXA 3VKJA 2BOGX 1BQCA 3MVTA 1V02E 3RGTA 2DT0A 5D04C 4PMYA 3KS6A 4PRWA 2IQ0A 4WSHA 1P6WA 1E6QM 9XIMA 3MMDA 1W3TA 2GVGA 3RMEA 3WLHA 1UD8A 2Z2AA 4NXKA 2O4MA 4NNAA 4CKQA 4HNOA 1ZJHA 3A4XA 1E55A 5FF7A 4J3VA 1GOIA 2WBGA 4KGLA 1XIIA 3P14A 3M0VA 4S3AA 3ARRA 1C9WA 1VJZA 3V0TA 1J5TA 1JDFA 3HFYA 1RZMA 3N2TA 3VOCA 1QPQA 2XSAA 3ZT5A 3GXDA 2JF7A 2W0UA 2DV0A 3QPEA 4XUYA 4GXMA 1W37A 3W7JA 3TSDA 2PE4A 1GEHA 4S3EA 1VQTA 3E9AA 2LLEA 5A2CA 4L80A 3SGZA 4NZ3A 1G69A 2QCNA 3AROA 2R8WA 3H12A 4GIYA 1TJ1A 3T8QA 9CGTA 4DO4A 1K7FA 4B5WA 2E67A 2OEMA 3QH2A 5E9AA 4WKAA 4Y9NA 1PX4A 3TX9A 7A3HA 2CEQA 4GVIA 3T0DA 2Z28A 5KINA 1ZJBA 3KL0A 3FY1A 4HZ7A 4XZHA 3MSYA 3U7VA 1EH9A 1TV7A 4LAKA 2G0WA 3CHCA 1Q66A 4LJ3A 1GOQA 4RE3A 4LEQA 1O5KA 5EBUA 1WX0A 1V93A 2VDGA 3PWGA 1OIFA 4JYDA 2Z00A 3E6EA 2CLOA 1TVPA 5FL1A 1B3WA 5H91A 1WBHA 4QS6A 4Y8FA 1JCTA 4KRTA 3S8HA 3UR2A 3HQ1A 2D3NA 3EXTA 3JVAA 4LANA 3EB4A 2ZFAA 1RCQA 1MQPA 3BXWA 4ZE5A 3WF0A 2X0HA 2J6XA 1R7OA 3TONA 1Z41A 3CU2A 3CHDA 1S1RA 3CZJA 3E2QA 4C6FA 3QQ0A 1E6RA 3TDFA 1DIKA 1A3WA 3XISA 4W85A 4K7YA 1FHVA 2ACUA 4FPSA 1V3HA 5DO8A 2ZBTA 4IJBA 1KB3A 3GM8A 2XN2A 1LQ2A 4UFMA 3HPZA 2NVCA 4QDWA 3M41A 1BHGA 3QFWA 2Y6ZA 1XDJA 4HYVA 4ORIA 2IXVA 3ATZA 1KGUA 1ZU8A 2MNRA 4C6BA 1TPUA 1SJCA 1ZY9A 3URQA 4PMOA 1Z9AA 2F2HA 4OFCA 3CPUA 4C6IA 3LXAA 4PBGA 3IANA 2VYOA 3AUOA 2R1PA 4DWSD 2JIEA 2ZXDA 4PSRA 3WBEA 2V2CA 5DFAA 1A4LA 1UOZA 2FPYA 5MHBA 4P7NA 3VNZA 3O2LA 4KEUA 4AISA 2A3BA 2R1MA 3LM7A 3PK7A 3LHWA 4AD2A 3H8AA 4H6QA 4E2BA 1TVLA 4IXXA 2WMIA 3GNNA 3TXVA 4ENLA 1XG3A 3KUMA 4AEFA 4S3FA 3EDFA 5G1TA 3NPUA 5AVNA 2R1NA 1BTMA 3PPFA 3MUAA 3PZNA 1AQFA 3GHRA 3VE9A 1XF0A 3N9KA 5C7VA 2GJXB 3RPDA 1CEOA 2E4TA 2HV5A 1TV5A 2XUCA 3W73A 3HIJA 1VEOA 3PAOA 3RRAA 4BKNA 3WD2A 3W7HA 1W8GA 3UVIA 2FDMA 3UZWA 3ITCA 3I7QA 3W37A 4TMBA 3TWBA 7TIMA 4UTFA 5FEXA 3SFKA 3GBDA 1WB0A 3S2MA 3QV8A 1EO5A 4AX7A 2Z1VA 3JRKA 2JKPA 3BANA 1LZOA 2FYMA 4QHRA 1EUAA 5I78A 2DW7A 1IGWA 1VR6A 1J4EA 4GGBA 1UKOA 2NQZA 1YDNA 2H3BA 3CMFA 2FZ9A 4XAFA 3KLLA 3QBUA 5E0CA 4OV4A 4HPHA 4CD5A 3QW4B 5HA7A 3SCQA 1XS2A 1J0IA 4W87A 5D03A 1I2OA 3MWAA 2DDXA 4GFIA 1FWNA 1V0LA 3TA6A 2Z1WA 2DVXA 1Q6RA 1UH3A 2YX0A 1NWUA 3T78A 4AMCA 1J96A 3QQWA 2AKMA 5C0QA 5CJ5A 5C9UA 1VPXA 4O1FA 1QOQA 2GJRA 3THCA 2PWDA 3T0CA 3H7RA 1NWTA 3PTQA 3C8FA 3EX6A 2DZVA 4C60A 3PB0A 2QV5A 3AI0A 2AMXA 3KP0A 3ANVA 3MVIA 3O6AA 3PZTA 3N2BA 3RX3A 1M01A 4ACZB 3ZJKA 3UXKA 1JZ8A 5EKYA 4G1KA 3B0XA 1HJWA 8A3HA 2E1WA 4CU7A 3T2OA 3LZ5A 4JTGA 1UA3A 3NQ8A 3CT7A 3HFTA 3TYCA 2BY3A 3LCGA 3W1NA 4CN1A 2CETA 4PR4A 3W86A 2P76A 5TF0A 4XBSA 3MSRA 3DFPA 4EP8C 5GNZA 4ZR8A 3PBYA 1U1HA 2YXXA 4Q7IA 4KCTA 3BDKA 5HMFA 5C5YA 4TMCA 5SWUA 2WVUA 5HK4A 4AY8A 3OBAA 4M29A 1KC7A 4KEVA 4UZUA 5CC5A 2GVLA 1IWBA 2XTKA 7CGTA 4IPJA 3VPLA 3QY6A 1Q6FA 4LUSB 3W7EA 2WSQA 1DVJA 3W74A 1WXJA 4U3AA 1DV7A 3GTNA 3KHDA 1IYXA 5HXMA 4QROA 2B4GA 3VKCA 1P0DA 2ZCGA 1E6ZA 1JPKA 4FALA 1JRBA 1DTUA 1TWDA 1FA2A 1M03A 2Y7GA 2PURA 3G0SA 2FGBA 3ONBA 3GNXA 3AJXA 1M3UA 3NO1A 3N3MA 1V6WA 4AAJA 3DYOA 4TOQA 1H61A 2FHCA 2PS2A 1PTAA 4JYEA 3LZ3A 1NVMA 3W38A 1A5UA 1O7AA 4Q8OA 4DJDA 4UCFA 1Z42A 2QR6A 5IDIA 1IEIA 2D2JA 3ENLA 3R25A 3N3TA 3D5HA 3DHDA 5FCZA 3HGRA 3U5UA 2YZRA 3SRKA 1R85A 2ZWYA 4B4FA 1ITUA 1VFOA 1W1PA 1DJNA 3NPXA 4LOCA 3TV8A 3HURA 2FJKA 2IQDA 2YCLA 5HMDA 4L9XA 3LHZA 1QI5A 2WNWA 3CH9A 2A1YA 3DFSA 2ZX9A 1I2RA 5BYWA 4GVFA 4LUIA 2GVYA 3E38A 4O28A 1UR3M 3H4GA 5CPMA 1H50A 2ALRA 4GQRA 1FCBA 5C9XA 2DZUA 3C61A 2OPJA 1V0KA 1JNEA 3QSRA 4D6HA 2DH2A 5REQB 1IQ8A 3W7MA 3N1AA 1TJPA 3WDPP 2ZADA 4Z2HA 3S2JA 4PTDA 5A94A 5FAJA 2YDSA 1E1CB 2W61A 1U5VA 3W81A 4X61A 4Q7BA 3QFEA 3VOGA 1GJWA 2IW0A 2Y85A 3WBWA 2OG9A 3GC4A 1F7BA 1EDQA 1CB2A 3OZOA 2OWCA 5AC6A 2Q8ZA 3MKCA 4CNPA 3CPRA 2ZZ2A 3QPYA 1OCNA 5A3HA 1SM9A 5HR7A 5C55A 4NY2A 3OOQA 1L0PA 3PZMA 2DEPA 1H11A 1WKEA 3O9NA 3E3HA 4Q4SA 3P3BA 1L6GA 3ITTA 4PGLA 2A79A 4YVVA 4S3DA 3MW7A 3W83A 2OODA 1ZL1A 1IXQA 1B4EA 4EVZA 2DIKA 3VDGA 4JCLA 3T2PA 3FFSA 5AFDA 3HO8A 3L5AA 3GE7A 1QHZA 3O05A 1K7XA 3JU2A 3NCOA 2ZYFA 2FZNA 2WSRA 3WFLA 3ELFA 4GI9A 4B3ZA 1R3TA 1T99A 1DJZA 1ZSXA 5E1QA 2ZX7A 1MO0A 4GUJA 3B0PA 1X98A 1TZ7A 2A3LA 1SUXA 2RJGA 5M2FX 3M0XA 1VPQA 4DJFA 1CB7B 3AFBA 4EAMA 2XIJA 5JU6A 4D6EA 1XLFA 3M64A 2QXWA 2VFHA 4W5UA 2H3DA 3VKBA 3H21A 3UCQA 3AIEA 4D8AA 1UMYA 1JZ7A 1WDRA 5F2IA 2BWGA 4WVXA 5GJNA 3WF2A 1XPGA 2F8QA 3OHMB 4JL1A 2ATMA 3NSNA 2AGTA 4PEEA 4FLSA 1TUXA 1OBAA 4Z2KA 4XD6A 3VIGA 3AHTA 3OEXA 5LIYX 1MUCA 3UA4A 3SUUA 3RX2A 1TFVA 1IHIA 2HE5A 5ABTA 2IKGA 4QG9A 4NF7A 3T40A 1TO3A 3ZYZA 2QNEA 4LYKA 4PL2A 1Q6CA 2J79A 3B9EA 4JNYA 2HMCA 2C0AA 4PZVA 4DJDD 4ZE4A 3H54A 3H2FA 3W27A 4MJ2A 3GU1A 5AHMA 2WM0A 2FB3A 2H8XA 3EKZA 3FJNA 3TK7A 3AMLA 3BAXA 2QGHA 4C1KA 3KOFA 2OEJA 4U3CA 2I9UA 2FB2A 1Q45A 4UR9A 2JE8A 4CNUA 1CLKA 1IF2A 3M1ZA 1KTNA 3DIPA 3WQPA 1FDYA 1QO2A 1B3OA 1OZQA 3H53A 4DAIA 2YDQA 5DCBA 2YCKX 3DFTA 3EPNA 4I7WA 2FKPA 4GC4A 1F3WA 3CZKA 3V75A 3LA4A 4MLRA 2OQLA 3WUBA 2ONEA 3PBMA 3ITGA 3B97A 2OMAA 3GHUA 1WZKA 3I65A 4LTSA 3QZ6A 2CBIA 3OP2A 2TMDA 1JCNA 4I8YA 3BW3A 2Y2WA 4GGHA 1MEWA 2TRSA 2GOUA 3R13A 1JPHA 1PUDA 2J13A 1PS9A 3BE7A 1K9DA 1KO0A 2UY5A 2QW5A 1NWRA 4JQ4A 3KVKA 3VMPA 5DQPA 2WMFA 4A3YA 4E8GA 1PKLA 3OZPA 1P48A 3AS0A 3WQ8A 4LF2A 4O57A 3K8KA 3MP3A 4AQLA 4F8XA 3ZSSA 5M17A 3LHUA 3O6CA 3W88A 1B30A 4RDVA 1EQCA 1XH1A 4DY1A 1UZ4A 3NQVA 3H2EA 3CL7A 3W1XA 2PEVA 3R8GA 1LWJA 3L4UA 4PB3A 3NVTA 4ATDA 2A3AA 3NURA 4XZLX 1VYPX 3QMRA 3M07A 4IUOA 1FWDC 3O7UA 3EOOA 1DJXA 3UBPC 2X7VA 4JKLA 3PS7A 3NQEA 1H41A 1B5TA 1LLZA 1U1JA 4FP1A 2VGBA 3LG3A 1UQZA 3F4NA 4KIEA 1GJUA 1H7NA 3EOLA 3R11A 3SN1A 2XINA 2Y88A 4DJFD 3G6MA 1MDRA 3TN3A 1YBQA 3S2LA 5KITA 2QJGA 1M04A 3PPGA 3ABQA 2IKHA 2Z29A 1TPB1 2HCVA 1Q2SA 3FYPA 1C29A 2BB0A 4JS3A 2Y8VA 4UNLA 1PVNA 3PZUA 4MWAD 1I1WA 2DZAA 1R86A 1ZALA 1E9YB 4U2ZA 4R7JA 2CBVA 2VEIA 1EJSC 4W84A 4QTGA 1VFSA 5CQ1A 4MZ8A 2EF9A 4ZO7A 3S1WA 2NVDA 2VC5A 4ZOBA 1NDVA 4EOUA 1BD0A 1WYIA 3BPWA 4AZCA 4AEEA 3EBVA 4FXJA 3AYVA 1ECQA 4Y9OA 3VZZA 2V2DA 4AEOA 3B8SA 2B31A 4LRSA 3VCNA 3CWNA 5ECVA 2X0YA 2V9DA 1FCVA 5D8ZA 2QCLA 2ZWZA 4ZXOA 4LUJA 3GG0A 1E6XM 1FP8A 4LVBA 1CXHA 3M16A 2PC4A 1KWKA 4JTAA 3FA5A 2PDLA 4IPNB 2P8BA 2G97A 1F5ZA 1H60A 2ACRA 3HPSA 4OWGA 1EC9A 5HULA 3KW3A 4JTLA 4OTKA 1OABA 4W8AA 5M3WA 2FH6A 4X9YA 1F8MA 1TELA 1PX8A 4C6MA 2KZHA 3R2GA 4JN7A 2WANA 3MO7A 4BF5A 4KKXA 2J8FA 1HZYA 2A21A 2PGRA 5K4XA 2Q8LA 2PU1A 3T81A 3LI0A 3VNKA 1VD6A 3I3EA 2ON3A 2CNCA 2J75A 4ES4A 3ICJA 2JKEA 5DX7A 1R5YA 2FVMA 1F6KA 4LV4A 4YS1A 2OWWA 1HJQA 1TYGA 3NL3A 2P88A 4PCFA 3KHJA 3KOYA 3IVTA 3LGDA 1PL9A 3WF3A 3DGBA 5CPTA 4H1ZA 2OSWA 4Y90A 1XKYA 3A3HA 2PP1A 4DZIA 2CHNA 1GVRA 1NQKA 2DJXA 4UFKA 4QQ3A 3W25A 3N2OA 4WSKA 1DP0A 4GYJA 1UYQA 4MOZA 5A8GA 5CPSA 2P0OA 3FXGA 2X8RA 1BVNP 2WCGA 3THQA 3NDOA 3DFNA 2V8ZA 5I3GA 1IZKA 2QUMA 4A8LA 4JIPA 1XYBA 2IXUA 4A35A 5I02A 2C7FA 3S9YA 5LIXX 3HB9A 3GAYA 1DXIA 2B0MA 3UY8A 2A85A 5I3IA 2QZRA 5EMMA 1Q4NX 5JH1A 1CDGA 1W5OA 1SW7A 1JCMP 3M5YA 4WRHA 1I4NA 1DWGM 1PKNA 1HJXA 2OZ3A 3D47A 3H70A 3VK5A 3FVMA 1VGAA 3P62A 1LL6A 1GW1A 2ZZ1A 4BS0A 1FBAA 1ZGDA 3OJGA 3PN8A 4PFMA 3G77A 1EEPA 5ABEA 3IEBA 1EHAA 3GDMA 1M7PA 4AYGA 4P61A 2NW0A 2XZ7A 1ZJIA 3ISIX 3V4BA 2G8ZA 4IIHA 3OA3A 3GNDA 3POCA 5KEZA 1H0IA 1OCQA 3SUSA 4JNZA 4DM2A 3QC0A 3KVLA 1UMLA 3U4AA 3PWAA 3VFLA 4C65A 2XU2A 1QMLA 2PDYA 4UMCA 3OVQA 2DZPA 3O1NA 3O8AA 1RBOB 3KTSA 1TJ0A 2GJLA 1R30A 3ARPA 4MJ4A 4DBWA 3IJDA 3KXQA 5JBDA 2QVNA 1XIFA 3VIKA 2CHOA 1RY0A 1SU5A 3WLJA 4HU0A 2QJIA 1UWUA 4ZQOA 1OG0A 4NIRA 3M5VA 2GVJA 1SO4A 2Q71A 1N55A 3CZEA 2O7SA 2QMKA 1XGZA 5KTLA 4JTEA 3GVQA 3U6WA 1QAPA 1P6CA 3MSDA 3TYEA 4REQA 2E6FA 2PDJA 1K77A 1J0HA 3C2OA 1TE6A 1EP1A 4Q8PA 2CBUA 3CO4A 5I06A 3WDHA 4N2YA 1U5HA 3WQWA 4HPNA 3BWWA 2ACSA 1FDJA 2A3CA 2F38A 2VVSA 3WJSA 3T05A 2PBGA 3PM6A 2AMGA 3Q37A 4DO7A 1GPWA 4YWSA 3B0UX 1W1VA 3C52A 1XSIA 4HTYA 1UUOA 3B8WA 2AOSA 1JQVA 4Z2IA 4MHBA 3VD7A 3GHTA 3QVQA 5IBXA 3M0MA 3UVAA 3WLOA 2X1SA 3BURA 1JG9A 3TTSA 4AMAA 2A7PA 3QN3A 3QMSA 3C3NA 2WZTA 4IP7A 2F2KA 4QIUA 4MUZA 5BOOA 2VFEA 2OELA 5BW6A 3EMZA 3KRUA 2HTMA 2WQPA 3CJPA 3R7MA 2WC4A 4P8XA 4FX8A 4NZ4A 1CLVA 3MCMA 3KBMA 3PUDA 4O10A 4WGXA 1WUFA 3N19B 2VDHA 4RDWA 3EX2A 5DF0A 4S23A 2E3ZA 4FIQA 1VPYA 2CLMA 5CAHA 1I0BA 2AGKA 3AJ7A 2VZVA 1IEWA 3CASA 4QAWA 2HWGA 2VX7A 2IPGA 4DXXA 2G50A 2CZVA 3WDQA 1DWFM 1VENA 1B0IA 1DJWA 4Q4MA 3GW3A 2YYTA 5G2WA 3ZIZA 1GYMA 3WNLA 1K03A 2FPVA 1OQFA 4L61A 2NX9A 1W17A 3KRSA 2EO7A 3HF3A 3WK0A 1YTDA 5CGQA 4UTKA 2BGNE 2FFCA 3WNNA 3OVGA 5F2LA 4NL1A 4YWIA 4I9MA 5H8MA 5D09A 1G7VA 3MHUA 3W84A 1HW6A 1KCLA 3Q67A 4GNVA 1MMFA 1TWZA 3ARXA 1EFZA 1E6SM 5E6ZA 1RJPA 5E6YA 1PTDA 1XUUA 2BOEX 4YU1A 5AC7A 3NDZA 3F4CA 3MANA 3RMJA 2DH3A 3O06A 3MMUA 1DWJM 3SY5A 4XVDA 4MVAA 3JW7A 5F7UA 1LF1A 4F48A 2VP8A 5CAKA 4QNWA 3WNPA 3FDGA 2RDUA 1XP3A 4ZZ9A 3U2EA 3A9IA 1B1YA 4O14A 4FXSA 2BODX 3AUJA 3LS9A 1FWFC 3S6DA 2AL2B 1BG9A 4JIIX 3S46A 1X8FA 1S3TC 5BRQA 4PTNA 4CNOA 4KIRA 3FX4A 1VRDA 5HR6A 2E5CA 1W9BM 1JCLA 4LYQA 2AAAA 1SMAA 3G24A 3RO8A 3CPGA 3ZVIA 1KFWA 3VIFA 1I2PA 3OVRA 2Z2BA 1THFD 1XLAA 3TW6A 5BRPA 4GD0A 5LIKX 1F6YA 4A4AA 2RH9A 3LMYA 5TD4A 2CHRA 2OU4A 2OJPA 2EKGA 3OLDA 2VRJA 4HZMA 3EPMA 4HNTA 3N34A 1RSCA 2QS8A 3MY9A 5CSUA 1QDSA 3E2RA 3W3OA 4LWWA 2VT0A 1YDVA 1XLCA 1DIDA 1RHCA 1XISA 1DJHA 2PLJA 4ZFCA 2WJEA 4X2RA 3TQPA 1AJ0A 2RDXA 3RHGA 5T91A 3ARTA 1WUEA 1E71M 2NV9A 3WF1A 5CLWA 3MC5A 4RLIA 4EXAA 1TWIA 2R1KA 4GJ1A 4H00A 3OHIA 1GQKA 4N6FA 1LRTA 1H1NA 3IAPA 4NYUA 4BQ5A 5HDRA 1I75A 2Y7FA 2C8NA 2Q6ZA 3HG5A 4IPPA 3W76A 1S5VA 3UA3A 2HROA 7TAAA 4MFDA 3E2VA 5IOBA 3TYAA 1Y5WA 5C9ZA 3EDJA 4CD8A 2GGEA 5A6MA 3BSHA 3LV5A 2OX4A 1H63A 3N2CA 1AQ0A 4M82A 3UXLA 3N14A 1MXDA 4XX6A 4OHQA 1IV8A 3NL5A 3ITYA 5FJTA 4WCJA 1GKRA 1DYSA 4YCPA 5A5WA 4MNJA 3WH7A 1VCGA 1ZQ5A 4UXDA 2XHYA 3S0CA 3ARWA 2WM1A 4P5UA 3NL2A 1UR1A 3VIIA 2C15A 4J7RA 1V0MA 1RP8A 1Q4WA 4L4PA 3W1LA 5I3JA 2PLMA 5BU9A 5I2UA 2VMFA 4XWUA 1FCUA 2C1HA 1E73M 3CEUA 3P74A 2VX6A 2R91A 1FWRA 1QPNA 1TIMA 1KRAC 4OUIA 3EA1A 3I6TA 4KETA 2E9BA 3ITLA 4DHGA 5I6SA 1FDZA 2Y7EA 2ZUNA 2YBUA 3FAWA 3I3DA 5K4ZA 2PDCA 1FRBA 1B3YA 3KTXA 1G6CA 1GVQA 1ZAHA 2O7QA 2QCMA 4FNRA 4GZJA 4JXCA 4CQ9A 3L4YA 4WK9A 2FHFA 4Q4QA 3UG4A 3STPA 1GNXA 1WZMA 3PJXA 3UERA 1ZBWA 3GTIA 4KERA 3AXMA 3GAKA 3M4HA 1FWAC 3TSMA 1EKOA 2OKOA 3CWOX 1XLLA 2J7CA 1Z48A 1W6TA 1ZCCA 3T8LA 3I6RA 3R0UA 4GPNA 1W32A 1YKWA 3G22A 4S39A 4IQJA 1ONXA 2PDWA 3SFWA 1MDLA 2PA6A 4JHMA 5E9XA 1GOKA 4PBEA 2PWUA 3GXIA 4O50A 1P0BA 1AK5A 2J4GA 3GQYA 2OGYA 1EEXA 3CQ0A 3AWOA 4J3WA 1HG3A 1PSCA 1MZHA 1AFSA 3WQGA 1ADSA 2W66A 3OBKA 2ABAA 3T08A 3FK4A 3BG5A 3FGCB 1JF5A 4RCXA 4E0CA 4CCCA 1IT0A 2FFIA 3IK4A 2DT3A 1E0XA 3W6LA 3AXHA 4PUMA 1GG0A 3Q4DA 2P53A 1PZ1A 4PH6A 4DJDC 5FJJA 4J28A 4DUOA 4NYYA 2POZA 3B3DA 2NX3A 3ZVHB 3NQ7A 2F61A 1WDQA 1O94A 1V4YA 1S2WA 3SR7A 4JICA 1V02A 2D69A 2FZMA 2EJ1A 4KWUA 3MMTA 4JBRA 1UKTA 2GZXA 2WW5A 5I79A 1TPVA 4LVFA 4GNJA 3SY1A 3K8LA 1Q8AA 2AKZA 1TCMA 1RR2A 3C8NA 1VRXA 3MTWA 1KRCC 3HU7A 3W0KA 1OJXA 5TNVA 4MY8A 1QXLA 2IPFA 3I6EA 2BOFX 3CQJA 5CC7A 3TMLA 4DZAA 1PWMA 3UG5A 3FHAA 4EF8A 1QWKA 1DL3A 2RGLA 1LTDA 4YMZA 4JEQA 4P7OA 3RUBL 1PX3A 5C71A 2V67A 4A8IA 4B5NA 2WKJA 1M7OA 1UP0A 3PBGA 4KFOA 5DMYA 3TCEA 4DIAA 4K8EA 4PTMA 1ICPA 1V08A 2O9RA 3BQ5A 2UZ9A 1H0GA 4DNMA 4HN8A 1WZLA 3KS5A 1D9EA 3UF9A 2OYLA 3GG8A 1B9ZA 5I3FA 3IPWA 1EA0A 4H8VA 3UJEA 1VBUA 1FWBC 3SUTA 4LVAA 3L4XA 1C7SA 2WPGA 2GJPA 4UFIA 4YJ5A 2C0HA 5C8BB 4PULA 3EEGA 1S38A 4XIMA 3SSJA 2ZRUA 4I5RA 3BK0A 1Y0EA 4AC1X 4O1AA 4GVGA 4A29A 2XIBA 3R8HA 1UUQA 3HQPA 3UPMA 1HL2A 5J5RA 4L9YA 4GIAA 2V68A 3UWYA 3VX1A 4LUTB 4JZ5A 1JUBA 1RQEA 1YDYA 5IHRA 1LLWA 2WXDM 2FH8A 2BLEA 3TU9A 1TVNA 1MQRA 3W85A 3TOYA 5F4WA 4RXGA 5JIWA 4YTSA 4DJFC 1EXBA 4Q8NA 1OX4A 4AUBA 3GFZA 3IARA 4WSJA 1AD4A 4XTDA 2VO5A 1F73A 1YXCA 3K5XA 1BXCA 2Y89A 1H5VA 4QISA 3L4VA 4N02A 1V3JA 4FF5A 3MZNA 4NX5A 2VFFA 6PTDA 3FSUA 2R1LA 1RJQA 3WJZA 2ZRXA 2YOCA 3KBNA 4IG2B 4AZ5A 3LBCA 1YHTA 3WLIA 4M1BA 4NJGA 3SCWA 3CL6A 3WD3A 1PKYA 5ABHA 2VRQA 3TMQA 5GQBA 3OB8A 1XH2A 3W9ZA 3MV01 1K6AA 4LQ1A 4IGNA 1KM1A 1VHNA 3RXZA 4WDXA 4JTFA 4POCA 5F1VA 3UETA 4DLMA 1CTNA 4FNSA 4DO5A 3DBPA 4Z1CA 1GT8A 2DP3A 4OJYA 2EPMX 4J3ZA 1XLEA 5A6LA 4GACA 5LGXA 5HNNA 1OHLA 3TWAA 1GQIA 3MA8A 3T4WA 1O68A 4NRRA 4TIMA 5B7YA 1ODZA 4DUVA 1KRBC 3N4FA 3CS2A 4N4PA 2AL1A 1O5XA 4AIUA 2O92A 4PMZA 2E68A 3PJWA 3RLUA 1UR8A 3AQUA 2WJFA 1BAGA 5KSWA 3CT2A 4ZOAA 2YBTA 1HF6A 3CC1A 2G96A 1SZGA 1ZRQA 4MTVA 1QBAA 4PUKA 2QCEA 3KRZA 2W79A 2XIOA 3UEQA 4F0LA 4OECA 3ANUA 1V3IA 4WXZA 2OZTA 5CJMA 4XV0A 3NZRA 5EBAA 1KFKA 2ZZ4A 5A6AA 3CEPA 1XRSA 3A6OA 2VR2A 3UW6A 4GJJA 4M81A 2O9TA 3W7OA 3BVJA 3DC0A 4S3CA 3VABA 5BOEA 3EX4A 1I6NA 2QDGA 1A5LC 1P1MA 1TSIA 2P1FA 7REQA 3TSBA 5D2YA 1Q63A 5D02A 1ME9A 3SI9A 1WNOA 2AQVA 1UWIA 3GXFA 3WH6A 3KAOA 4WD0A 2NUWA 1VJIA 3QGVA 1KKRA 1F6PA 1RP9A 3E0IA 4S1FA 4OV9A 1CXLA 1RY8A 4AZGA 1K4HA 4MPKA 2A6NA 4F66A 1JGIA 3R94A 4J1OA 1SMDA 3ABOA 3W1AA 3B40A 3BSGA 4XISA 4OU1A 3RCNA 1WKFA 4MY9A 4KEMA 3VNJA 4XSLA 1VYSX 1A3HA 1B3ZA 3BLFA 2C71A 2ZVIA 2QDEA 2ZDRA 1RH9A 3SCTA 1B31A 5LA0A 1AW1A 1OEPA 4JFWA 3IJ7A 3G1DA 3SQLA 2ODOA 3WIJA 4PTXA 3HMCA 2YA1A 4PFHA 4IICA 3ZR5A 1IT8A 4RDYA 4DM1A 4AD3A 3DFQA 5BOFA 3MUZ1 1EPXA 2PDGA 3RITA 4UFJA 3UD6A 4C6LA 1US2A 5C9RA 4GX8A 1WXYA 3VDAA 1AQHA 2XJ7A 3ZO9A 4RL3A 1W2PA 2YXOA 3CAQA 3GZ3A 4K8HA 3W28A 3BLEA 2FPTA 1DJIA 1EP2A 1MUWA 3NJ3A 1EUNA 1XCFA 4DQWA 2KX9A 3ZLGA 2WMIB 4ZQNA 1CNVA 1EJRC 1D3GA 3IGSA 4RNJA 1A0DA 5FL0A 1OGSA 4MSSA 3NO3A 5HOSA 2WHJA 4CD7A 5CZTA 3HQOA 5LXXA 5CPOA 4TVUA 3MQTA 3QYSA 4RW5A 4Y7EA 3W75A 4DF2A 4ECLA 1JYNA 3OIHA 4UTIA 3GIPA 1JCYA 4CQ8A 1HJUA 5CBIA 3TTYA 3WUGA 1KCKA 4CQBA 2E09A 4UCGA 4ZQPA 3MHFA 2W63A 5HPOA 1G4EA 3QRHA 5CBJA 1R3RA 4M3PA 3VDBA 3TJIA 5EA9A 3L2IA 4IFKA 4DB7A 2HVNA 2YXGA 2VL4A 4XKMA 2VCAA 3TN4A 4O53A 3TH6A 4ZEPA 2BXZA 3TUUA 4PMRA 4IIFA 4ADSA 3PPHA 2C18A 1N82A 3FYYA 4O1DA 2JQXA 4Q6XA 3UXDA 2PSNA 2DZSA 2V5JA 4HZ8A 1QPKA 5FJIA 4RKAA 4Y9MA 4D6GA 1AVAA 2WZMA 4TXEA 4NZFA 3VOIA 1CI1A 4UQDA 1UR4A 3NGFA 2VQUA 1VP5A 1EJVC 4Q32A 4PMDA 5HBFA 4UQCA 2Z6IA 4UTLA 1T5AA 3GZAA 1GUVA 4KRZA 3U4FA 4FB7A 4PCTA 5G2IA 4NJIA 3LLDA 4AW7A 5JH2A 2E0PA 2WAGA 2TAAA 1HL9A 1KKOA 1CGYA 1V6VA 5K9CA 1A3XA 4X63A 3IJQA 4HJWA 3W00A 4U31A 3CLMA 1HTIA 4C5YA 5GJMA 1E3ZA 1KD0A 1KNWA 1W3HA 2RGMA 4NJHA 1VC4A 3QTGA 4UQAA 1KM5A 3OODA 3BH4A 3GR8A 1TRIA 4YHGA 4FXFA 2A5HA 4XAYA 3MDWA 3IUHA 3V16A 4AHOA 1IE7C 1QNSA 1UD6A 4X0NA 1JL8A 4F4RA 2PODA 1F9CA 2OLHA 1A53A 4JR5A 4QJ3B 5CGMA 2FMNA 4OIFA 4A3UA 1JNDA 4MB1A 4NAEB 1Z3NA 2A6LA 4J40A 3RRXA 3W7CA 3VDHA 1JDAA 2DU2A 1NDYA 2GJXA 2TSYA 4RUBA 5HMEA 4ZQCA 1EWDA 3B9NA 4GINA 1MRQA 4WDWA 2J7HA 1GONA 3AMCA 4YTRA 3UWUA 5AYXA 3M47A 3DZ1A 1EBGA 3COTA 4KRUA 1J01A 3LPGA 5LXEA 4D6IA 2TYSA 3CIXA 3IVSA 3NZGA 2RDWA 1Y8BA 1S5TA 4PE8A 3AS3A 1BSLA 4AF0B 5K7JA 1W9PA 3ME3A 1OFRA 4WLCA 1KLYA 5BXSA 3H4WA 4YHEA 2VTFA 5FEPA 3BARA 2XGIA 2PWGA 3HPFA 4DN1A 3WQCA 1Q6QA 1KQYA 4GYFA 3URNA 1UZ1A 1KXVA 4IMEA 3MU7A 1W5PA 4EAYA 2BX7A 1ZBCA 4IF2A 1K9TA 3LYEA 3OPSA 1I1XA 3RM8A 1GKQA 1EDGA 1R47A 1LT8A 3ARVA 3I3BA 1GG1A 1U5JA 3C2RA 3OG3A 1XYMA 2IPJA 2BXYA 1WKDA 2BSLA 1VF8A 4I3GA 1J0KA 3A5FA 3KCOA 2JK2A 3A13A 2XM2A 4J3TA 4IX2A 3OQ8A 3EDEA 3SIZA 2EPLX 3M6DA 4U33A 4XB3A 2YCLB 4IT1A 5HINA 3K30A 1TRDA 4LAOA 4C7DA 1E9LA 1NWSA 3BJTA 1R3YA 5XIAA 1OD8A 1GVIA 3D46A 3QOKA 1RJRA 1GHSA 4EX4A 2XIMA 4GOAA 5L9FA 4D72A 5B7ZA 4Y2WA 4ACZA 4M56A 1KLZA 4EE9A 3UG8A 3ZWTA 4A3HA 1ONEA 6TIMA 3SQMA 1R2SA 4O1EA 2ZRZA 4I8DA 3CUGA 5FA5A 4UMBA 1E9ZB 1QK2A 2VEMA 4MB4A 4V28A 1T8XA 3GLCA 1NH6A 1DXEA 1ISYA 2C79A 2RHGA 3OZMA 1KXHA 1P0NA 2JKAA 5G2HA 3EAUA 5BMXA 2C1IA 1VLWA 5CZSA 1BG4A 2VEFA 5FF2A 5GNYA 3LENA 1TX2A 1HT6A 4L6DA 3JZUA 4RXFA 5C6MA 3S3GA 4INFA 2PB1A 4JTIA 1A5OC 4CGTA 2E40A 2XFYA 1H4PA 4FA3A 4NNBA 1U2YA 1FP9A 2HRWA 4NT0A 4AVOA 2Q02A 1R3WA 4XD4A 2DQWA 3P80A 5IBXC 4XBKA 1S2CA 1UUMA 3ARSA 3M0LA 4MZ1A 4LAZA 1P1XA 4LSBA 4DX3A 3RM9A 4IFRA 3G1YA 4FR1A 4I7UA 2EQDA 4U28A 1VEPA 1BYAA 4CVWA 5BXRA 3EA3A 2E9LA 3NQAA 1FWTA 3IIXA 2VUYA 3VGBA 4PSPA 5I0DA 1JI2A 3MUIA 4M0XA 4PUWA 1MW0A 2VHLA 4V1XA 2VZUA 1EOMA 2CU0A 4ZODA 3B8UA 3OIXA 1HUVA 3A3WA 2NT0A 1Q8JA 3W23A 3H2AA 1CZ1A 3LV6A 4FOUA 1TJ2A 1AMYA 2D3LA 3B9OA 2D23A 4B9ZA 1LT7A 4GJIA 3IJ9A 1FHDA 1OSEA 1RAKA 2NWRA 4XK2A 4FI4A 5BXTA 4AB4A 2W9MA 3L4ZA 2NLYA 4JOMA 1A5KC 3DFHA 1Q7MA 3CNYA 5EY5A 6ALDA 3KDNA 3QSTA 3GH7A 3WJXA 5IRPA 4ROQA 2XSXA 3LLFA 3WD1A 2H6RA 4LV9A 1JYWA 2NX1A 1VS1A 1KFJA 1G9HA 3V0SA 2E6AA 3GK0A 3WLKX 2J7DA 1R9ZA 1BXNA 4E4FA 2Z26A 1OF6A 4Z1BA 1W56A 4IMFA 4Y96A 3BOXA 1BGGA 1SZFA 1V3LA 3UWVA 2VELA 5F4SA 1X6LA 4IWWA 4E6MA 1Q3NA 4K36A 3QV7A 1E1CA 4IISA 1GVFA 1LDCA 2VR4A 3SM0A 3G0UA 1XXXA 4JTDA 2CWXA 3P5YA 1KFEA 3OQEA 1IR1A 4JQ1A 5I77A 4XZNX 2DZWA 1ISVA 1MZRA 3W2NA 1UKQA 4S38A 5DMMA 3WMCA 1EB3A 3BCDA 2BNJA 1A5NC 3M5ZA 1YIXA 4CVUA 4NP7A 2VKZG 4IXHA 5CJNA 2V2HA 3RJYA 3WSUA 2O0TA 4HHMA 3LK6A 4HSOA 2GK1A 5JUVA 1GVYA 1BWLA 4ZTYA 1CGUA 1WAWA 2W6RA 5DMLA 2DSKA 4PRTA 1FXQA 2CPUA 1JI1A 5CZJA 2ZZ7A 4HOXA 3DBNA 5KMYA 4F2TA 2OZ8A 4PUEA 3CTTA 1YXYA 4GUIA 3S5YA 1T0OA 4Z2GA 2OT1A 3CHVA 3VNIA 2Z0IA 4XKYB 1E4IA 1XIGA 3F03K 3UWWA 5CH9A 3FAXA 3QC3A 3W1MA 3E0LA 3BLKA 1K3UA 1UZHA 1LOSA 4ZB2A 3TTEA 1K8ZA 4GE8A 4U2YA 4EK7A 1PPIA 2BXVA 3O0FA 3IAQA 3S2CA 1UWRA 3M5XA 1ZB5A 4KCVA 4CN6A 3GFXA 4FLRA 4JN6A 3R5EA 1XIMA 3CMGA 5CKSA 2R6OA 4IGSA 5CSSA 1UR9A 1UBSA 2ZUMA 5DBUA 3H22A 1WOAA 4CN4A 1NM9A 2YL8A 3U2OA 4IOTA 1LQ0A 1K8YA 2DQXA 4BZYA 5D32A 2PLKA 2FZ8A 4NUWA 2CKRA 3F2DA 3R1ZA 2E28A 1EHNA 2ISFA 1NDWA 3NQMA 4FXRA 2ZRVA 4GY7A 4ZB5A 4WUIA 1ZFJA 4JQ3A 3C0JA 3NEHA 2X1IA 4DYEA 1W8SA 1VIWA 1ELSA 1ADOA 3UNDA 4G7EA 4ORMA 1UH2A 4TX8A 1CGXA 2V3FA 1AJ2A 4KEZA 4O15A 1M68A 2DVTA 3FXYA 3O16A 1OT1A 3G1FA 2XVGA 3FOKA 1SR9A 3ALFA 3PC0A 4GBUA 2J88A 3AIBA 3ES8A 3KBSA 2ZXBA 3WLSA 5AECA 2PDQA 4K2SA 3W7DA 4H19A 4GUFA 3CIVA 1P7TB 3VVGA 2CLLA 5AYBA 3IIVA 4AXKA 5L6UA 3WDIA 4ZO9A 1XI3A 1RPXA 3RR4A 4N7QA 1G4TA 4ICCX 2QDHA 4DWSA 4HIBA 2VCBA 3CTLA 4G5DA 2DUXA 2QAPA 3W07A 3VI2A 4S3GA 2QLYA 3W2MA 1FWSA 4DJEA 3APTA 1WXZA 2GGIA 1SJAA 2XISA 4J3XA 3SY8A 3QQ1A 5A8PA 4G1NA 1Z7AA 2PCEA 1YXDA 3HPAA 5BCAA 4ZQRA 4LEFA 2NUXA 1L6WA 3BTNA 2BASA 1DORA 3K46A 2OTDA 2V3EA 3TVAA 3WLNA 4BI6A 2P3EA 4UFLA 4ATWA 5H1WA 3AHVA 1I2NA 3SJ3A 3F5KA 3THDA 3G3MA 4RE4A 3ARUA 4FLQA 4GFSA 2HK0A 2YCEA 5I07A 3BGGA 4GWEA 4TO8A 1SZEA 1SR0A 3W29A 3VFCA 5A69A 1OC5A 1AMKA 4HNVA 2Q3OA 1OFPA 1XBXA 4C6OA 4JCMA 4X0VA 4MIMA 1VAHA 5GPRA 3BW4A 4ICMA 5FJRA 1U30A 3HGJA 1B57A 2BY1A 3WEZA 3P93A 3W6MA 3H2CA 4ZBCA 3QW3A 3QTPA 3HTWA 4ZSTA 1L6SA 1T40A 3KOWA 1SVDA 3OGSA 3N18A 5HQMA 3BAJA 3GG1A 4H6RA 4S2CA 4HQVA 3PUGA 1ZJAA 1ME7A 3OGRA 1H62A 4R34A 4ADUA 4JTTA 3GDRA 1F61A 3N2MA 1H7RA 3GO2A 3ZLFA 1BRLA 1DHKA 3VNMA 3VMNA 2YB4A 2CW6A 2ZA2A 4QS5A 5AYYA 1WKYA 1GQLA 1NSJA 1O5QA 1MFVA 4JQAA 4HGXA 5RUBA 2ZUUA 1GQJA 4CQCA 1HVXA 2GQ8A 4OE7A 5XIMA 2BDQA 4DPQA 4PMNA 1X1ZA 3TAKA 5AYZA 1GGOA 3GB6A 1RXOB 4JDYA 4TTGA 1REQB 1EIXA 3NQCA 2AQOA 3TTQA 1PIGA 2R82A 3WZ0E 5A6BD 3UXAA 4A22A 3ZM8A 3F2BA 4W5ZA 1TZ9A 4WY0A 1V3KA 3P6LA 3CV1A 2ATSA 4LBUA 1E5JA 4GZ7A 4NASA 3J7HA 2E77A 3EWXA 5LHEA 3DCPA 4H01A 3FEMA 4KMQA 2INFA 3GD6A 3WMSA 3NQFA 3IUDA 1W9DM 1KBKA 3N2XA 4L5ZA 4J2PA 4BK9A 3DG3A 4GABA 3EWBX 2EJAA 2FTYA 4H6KA 2DZTA 2OVLA 4PN2A 2AQWA 4O0KA 8TIMA 1JFHA 4NVTA 3USBA 2I14A 4JFUA 1MUMA 4HA3A 3CUXA 1E6PA 3MYOA 1Q2RA 1POKA 4GUGA 3PG8A 3G2GA 3WL0A 4AU0A 4TR9A 3KTCA 4G6CA 5KZDA 4G7FA 4AYSA 5LNSA 2PGFA 3RO6A 3SJNA 4DJED 2PDNA 1AL7A 4OZOA 4AG0A 2XDFA 2PDKA 2J7BA 2Y4SA 3CL8A 2YZ5A 2VENA 5HNRA 3QGKC 4JAWA 1TUFA 5T8GA 4B5VA 2C6QA 1OADA 3E02A 1VCVA 4CUCA 5ABGA 1SSDA 1AH4A 1UWAA 3R43A 4NSBA 2WWDA 2YL9A 3HV8A 1C8YA 4W7WA 1JDEA 4UOJA 2FHBA 2VRKA 1OK6A 4ICNA 4GY1A 4IPLA 5EYWA 1QW9A 4HU8A 2RFGA 1P0KA 2Q8XA 1QNQA 1I45A 4U5IA 1K7EA 2WHLA 3IVUA 4JX5A 3GX9A 5A8OA 3WELA 2BFGA 3W1QA 4FOJA 1TA3A 4TU1A 3LD5A 4WZHA 4H6EA 5FKYA 3WQOA 1BLIA 1DE6A 4QNEA 1B2YA 4PTVA 1PZ0A 5DMNA 3W7LA 3WYZA 1M5WA 9RUBA 4ZENA 5D4YA 3VIPA 2B7PA 1ZLPA 1DWAM 2WHMA 3TQVA 4QXIA 2E8ZA 1QNVA 2X2YA 3IGHX 4L4LA 2W62A 1Z89A 3T1GA 3VUSA 1J0ZA 2JEQA 1IIGA 1K6WA 3PNUA 4HSHA 1KR1A 3NR0A 4WKHA 1GCYA 2QF8A 4YVPA 4R5EA 3S1VA 3AIVA 1UWTA 1VFTA 1QW7A 4GI8A 4JL2A 4AX6A 1HFBA 3C2FA 1FX6A 4H04A 3DHPA 2GFTA 3DHFA 4C5ZA 2GSHA 3AIWA 4F9DA 3L0GA 4FF7A 4GIRA 4WEVX 4ILSA 4DPPA 2OXNA 3HJEA 2GGHA 1TPFA 1MXGA 1UPPA 1I0DA 3OGVA 4JNMA 5FF4A 3NFUA 3DKJA 1E1FA 1RD5A 3S2NA 1XSKA 3SN0A 1IEQA 4HNLA 3QMTA 2ZTKA 3B8IA 4NHVA 3APGA 1W5MA 5IFPA 1UWQA 2FLIA 1QASA 2VFIA 2PWEA 2V0TA 1Q13A 3QM3A 2YDAA 3W2LA 1PCKA 3FV9A 4IX0A 2ZIDA 3K2GA 4F40A 3K4AA 4FK9A 2E7FA 2WMKA 1PE1A 3LHVA 1JD7A 2G95A 2YJQA 3D3AA 3D3FA 3U57A 2NVAA 1R46A 1YPXA 3CHEA 1WO2A 2QPXA 1QK0A 1E0VA 4Q6JA 3R6IA 4S2BA 1X6NA 3AHZA 1QBBA 3QLDA 3PZIA 2CYGA 4Q8WA 4HK5A 4AD4A 3R4IA 3LEPA 3WO8A 3URBA 3N6HA 3QHOA 3WD0A 2BS9A 2GWGA 3F2CA 1XQKA 1GVEA 4ZSUA 4AD1A 3WY1A 4GLEA 3NAVA 2D2GA 4XAPA 3LY0A 3TR2A 1LWHA 3ZS4A 2YCIX 3QHMA 1GTEA 3EX3A 5DCDA 2QIWA 3NM1A 3EOEA 3K4DA 3BZGA 2DFAA 1RBLA 4J35A 4NZ1A 3P61A 4JIEA 5FEZA 4UQBA 2DY3A 1ENUA 4GH3A 2YL6A 4RR4A 2QCDB 5HAOA 3ARZA 4A05A 2I5QA 2WC3A 2BGQA 4D71A 2OLSA 1JAEA 4DLFA 3TNBA 4BF7A 2WVVA 3REQA 4NXSA 1K8XA 5LIUX 3VAVA 4H41A 4FNTA 3E74A 1WDSA 5D38A 1XV8A 3C4UA 3S47A 3HQNA 1KCXA 1V6YA 4AZ6A 4E3VA 1CXEA 1SO5A 4DF1A 1C9DA 4XAGA 3GDTA 1EX1A 4O8AA 5G4EA 3UU0A 1EBHA 3VCCA 3Q2DA 1E4NA 3H2OA 2QMJA 3A4JA 2WMJA 1GEQA 3IK2A 1UIOA 3A4WA 5AZ1A 3ZR4A 4CU6A 4ZQMA 2PP3A 3LRLA 3PTMA 1W1ZA 5EFDA 1DBTA 1Z69A 4LY8A 3C3UA 3FJ4A 4ERAA 2VXNA 5F4XA 1SFLA 2WO5A 1LRQA 1ITXA 2ZUVA 3DDMA 1E40A 1F3TA 2X0SA 1ZHAA 4FR6A 4IGMA 1JAKA 2GDVA 1PIFA 1W31A 2WNZA 3QXBA 3ZT7A 3A23A 5EU9A 3SGUA 1UASA 4H8HA 2GDQA 1LORA 3VC6A 2WQDA 4UB9A 4IPIA 3OW1A 3BLIA 5I00A 4UIOA 4NAFB 1AW2A 3BO9A 4AZIA 3N17A 4E2VA 3ZR6A 4YTTA 1GQNA 1LOLA 2QEZA 3AALA 5ABFB 2W27A 1JUEA 1WAUA 4L4OA 1MVYA 1I9CB 3CB3A 1K02A 4DVOA 3UT0A 1XG4A 1FWHC 2OQYA 3K4WA 3N15A 3P81A 1A0EA 2NZLA 3LOTA 3L67A 4G9PA 1MXSA 2RUSA 4C6EA 2X30A 3GR7A 4WDTA 1OFDA 4MUPA 2HNHA 1LROA 3M0ZA 3AMDA 4K6AA 2XIQA 2Z1KA 4Q7NA 5FJOA 2ZX5A 2J8TA 4PMQA 2Y5EA 1BSIA 5D33A 2RJHA 4WOZA 1XUZA 3SUVA 2GUUA 1IXPA 3GSMA 4LC6A 4JTJA 1EL3A 4I5XA 1DKWA 4GYKA 3STCA 1EOKA 1AD1A 1M6JA 3PBWA 3P67A 3DOPA 4HKPA 3L65A 1UP2A 4M80A 1E72M 2P5NA 5EGRA 3R58A 1IEVA 4AWSA 1JJKA 4QEHA 1FFRA 4E4UA 2IMRA 3DG6A 1A5BA 2FZDA 3A21A 4LB4A 4P8WA 2J24A 4GNKB 4H9UA 3A9BA 4O13A 2ZC8A 5FIPA 1J2WA 3B05A 4F0RA 1SPQA 2PBOA 2R94A 4FSAA 1W3NA 3OBEA 2AL2A 2Q3RA 4TVCA 3KDOA 1XLMA 5FESA 3MCOA 4OOZA 4RZBA 3A22A 3GXMA 5FSDC 4O16A 2QCGA 2F84A 2PWFA 3GWQA 2HK1A 4H9XA 1CXIA 1V8EA 1HVQA 3VOJA 3UZYA 2YA0A 6XIMA 1B90A 1BKSA 1G4PA 1LL7A 2PZNA 4TX6A 3DYMA 4MWAA 5LSMA 4OBSA 1UD5A 4AZ7A 1SFTA 3O07A 2PUZA 1F76A 2NV1A 3BJSA 4IH3A 4R27A 4LFYA 3FW6A 1A47A 1VCFA 1EYWA 2WWCA 4I6KA 3TLQA 5A6KA 1WDPA 5D9PA 1K70A 1SO3A 3ITVA 3PFMA 3HGSA 3TIMA 4XTIA 1PCWA 1QR7A 3AISA 3BAWA 4W9TA 4GRSA 3FVDA 2Y8KA 3VNLA 3TYUA 2ZZ5A 2XWDA 3HV9A 1C8XA 3TQKA 3KX6A 4WX2A 2BBFA 5EPDA 5JQ9A 3H4XA 3NA8A 3M9YA 5FJPA 3FCPA 1M53A 2E1DA 1DTNA 2DUAA 3GC2A 2FGLA 1Q85A 2Y62A 3DFYA 3T4CA 4Z2JA 3KWXA 4ERGA 4Q4PA 2HVMA 3LGGA 1X96A 1JFXA 4RNFA 1AL8A 1BXBA 3LCXA 1NU5A 1F05A 5LZLA 2Q01A 1G5AA 4Y8EA 2I56A 3BGJA 1CENA 4G56A 1A5SA 2J7GA 4HYWA 5CLTA 3S1XA 3SURA 4PA8A 2ZUTA 1OGGA 2WVSA 3RLGA 1UC5A 4FOKA 4KPLA 3GVVA 2OSYA 3GDLA 1XGDA 1H2JA 3EMQA 1CYGA 1MFUA 1CCWB 1H7PA 3VGFA 2PRHA 1JYXA 4Q8TA 1WBJA 4E8DA 1XRVA 4LVGA 1JXKA 1HKKA 3NXFA 4YIWA 1DJYA 4CQDA 2VGIA 1CXKA 1OB0A 3FNDA 3M0KA 1L2UA 2D20A 1E3XA 1EXPA 3IJ8A 4FNPA 4MNKA 1RK6A 3WQFA 1BWKA 2PDBA 3D6NA 3EA2A 4UWMA 4AIBA 2VNCA 1SGJA 3RDKA 4WJ8A 1W3JA 4PUJA 3MKKA 5CPNA 2Z25A 3ZQ9A 1DJGA 3FDKA 3RR1A 1T96A 4DI8A 1GK8A 4D6DA 3TC7A 4PBFA 1LUCB 3W1TA 3VILA 2OT0A 1LM1A 4IFOA 3P2VA 2CZEA 3NXLA 3DX5A 1XFBA 4DUWA 3UZZA 3WMBA 4KWSA 5CPQA 4JIHA 3DYPA 1YMYA 1XPYA 3DEQA 4CU8A 1XD1A 2CKSA 3OLIA 3VM7A 4UR7A 3AZTA 4GC3A 3IJIA 2HVOA 3MPGA 3RCMA 3LTPA 4MB5A 4RDZA 1TMHA 4WDUA 2NQJA 3RYSA 1ZUAX 7ENLA 1S2UA 3W1RA 2Z6JA 1UIPA 1EGVA 4BQ2A 5KZ6A 2HXUA 2V5DA 4GUHA 2J77A 4PUDA 4QAIA 5D9NA 4EKJA 1S2TA 1OGBA 5CSRA 2YKKA 2OCZA 1IR2A 3FGCA 3U2CA 1O4UA 2GQ9A 4JTUA 3GIQA 3UCDA 3CUIA 1X39A 3NIYA 1GPFA 1KXQA 4IMDA 4OQVA 4QFUA 2X42A 1XYFA 4D1JA 1AQMA 1X6UA 3M0JA 1DJQA 4X22A 1MNZA 1J6OA 2R9RA 3M6YA 2YA2A 2W5FA 2EGZA 1OD0A 3GG7A 1ICQA 2X2GA 4DBSA 1UP3A 4MMWA 3ZVHA 2A7RA 3PF3A 2ACQA 3NG3A 3C2YA 4CLMA 1VBHA 4QSFA 4LCQA 5I03A 3AIUA 3LERA 3MJMA 3NZQA 4C6JA 1UKPA 2BHZA 2CZFA 3QKEA 1POJA 2IUZA 3HG4A 3WUFA 3W26A 5H8PA 3BLOA 1J18A 4HSNA 5LHFA 4GK8A 3N4EA 2PGWA 1JXJA 5IHSA 1LL4A 1J2BA 1S3HA 4ZXLA 3GYCA 2J27A 2Z2UA 5D2XA 4F3HA