3CTLA

Crystal structure of d-allulose 6-phosphate 3-epimerase from escherichia coli k12 complexed with d-glucitol 6-phosphate and magnesium
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
219
structure length
219
Chain Sequence
MKISPSLMCMDLLKFKEQIEFIDSHADYFHIDIMDGHFVPNLTLSPFFVSQVKKLATKPLDCHLMVTRPQDYIAQLARAGADFITLHPETINGQAFRLIDEIRRHDMKVGLILNPETPVEAMKYYIHKADKITVMTVDPGFAGQPFIPEMLDKLAELKAWREREGLEYEIEVDGSCNQATYEKLMAAGADVFIVGTSGLFNHAENIDEAWRIMTAQILA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate specificity in phosphate binding (beta/alpha)8-barrels: D-allulose 6-phosphate 3-epimerase from Escherichia coli K-12.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Isomerase
molecule keywords D-allulose-6-phosphate 3-epimerase
total genus 72
structure length 219
sequence length 219
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.1.3.-:
pdb deposition date 2008-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ctlA00
1TIMA 4POCA 3LRLA 3F4WA 3L5AA 3Q2DA 2I9EA 1OG0A 3BVJA 3E9AA 3MBDA 3PBWA 3BGGA 2C14A 3UZ5A 3O63A 4XKYB 1OX6A 5CSRA 1P0KA 2CZEA 4HPXA 1F2JA 3QH2A 3C61A 1ZJIA 3TMLA 2E77A 5AYXA 3EX3A 4UFJA 3R13A 1GVQA 1LOQA 4XBKA 2WSRA 2A6NA 2VFHA 4GUGA 2BZNA 1YXDA 2E5DA 2NUWA 1TTPA 3S9YA 1MO0A 2VELA 1LP6A 1YTKA 3PVFA 3FYPA 5C2XA 3GZ3A 3QMRA 4IQLA 3IVTA 3N19B 4LV9A 3TXVA 3O8AA 2A2IA 5BMWA 2YFOA 1R2TA 2ZRYA 5LNVA 3VFLA 4MY1A 1VQTA 2PC4A 6TIMA 2C0AA 3P84A 3PG8A 3GDTA 5DY3A 2V9DA 4LWWA 2DJLA 4WOQA 2RKXA 3CWNA 1ADOA 3NXFA 5HUPA 1KM0A 1GTHA 3LHVA 2QF7A 5A8GA 4EOUA 1LRNA 1WQ5A 3W7PA 4CNPA 2ZZ5A 4AHQA 2Z0IA 2YSWA 1SZNA 4OV4A 3P61A 3DKLA 1QO5A 3M5ZA 1YLVA 1HL2A 1WA3A 1K8XA 4GUFA 5I3GA 4RKAA 5U7SA 4DPPA 4NJIA 2HS6A 2V2CA 3DXIA 3TSBA 5CSSA 1QMLA 3GYEA 2YZRA 3NL3A 4O17A 5AN7A 1NF0A 1OF8A 2W6RA 1LYXA 3UWYA 1K7EA 3O16A 1K8YA 3GKFA 4UXDA 5U4NA 1OX4A 2FLIA 4YCOA 3BO9A 5A5WA 2FDSA 2WSYA 2ZFAA 3IIZA 1WV2A 1H5YA 4N4QA 2R91A 4K7YA 4UFLA 4R7JA 1TPH1 1YADA 4WY0A 4BI5A 1PL9A 5G4WA 3B8DA 1IIGA 1EA0A 4Y9AA 5E0KA 2JKAA 5G1YA 3C0JA 2H3DA 3CC1A 1HUVA 5LNWA 1VRDA 2CZ5A 5AHMA 5AB3A 4GFSA 2TMDA 5TBOA 3S0CA 4RXGA 2WKJA 3B4UA 4NQ1A 3LCFA 3A22A 3TIMA 4N02A 2TPSA 4MPQA 4UFIA 4UTHA 4R33A 1BWLA 1N55A 2EHHA 3UXDA 3BGJA 2PURA 4ZZ9A 1YXCA 4PFMA 1VS1A 1UJPA 2C3ZA 3C52A 2CLIA 2QUTA 5CPLA 3PBUA 3T40A 2Y7GA 3C2EA 1W0MA 1XDLA 3M1ZA 4O1CA 3EXTA 1AL7A 3TJXA 1MEIA 4EF8A 1JRCA 2ZCGA 1NVMA 2QCCA 2Z2UA 4N9CA 5SWUA 1SW0A 2ZDRA 1EWEA 3OVPA 3B04A 3W1TA 1A53A 1JCJA 3W86A 1TPB1 3PF3A 1YXYA 3QPZA 1LRTA 1S5WA 3W2KA 3DFPA 2YDAA 3CEUA 3W07A 4K6AA 2R8WA 4RZ4A 3NPXA 3NA8A 3OA3A 5H2ZA 1KA9F 4K37A 4JYDA 5LZLA 1HTIA 2C6QA 5DXYA 1JCXA 3NL5A 3N14A 3AJXA 1I45A 3LV6A 5J5DA 3S1XA 3KXQA 1O94A 1H7NA 4FNQA 5K9DA 1VYPX 3OEXA 3PC0A 2Y63A 4FX8A 2NXIA 4UC5A 2DP3A 3GXNA 3GDMA 3TFCA 3GDLA 4LC6A 4DO6A 4IXHA 3LLFA 3W9ZA 4UTIA 2CU0A 5C5YA 2BWGA 3PULA 4UR7A 2QDHA 4CCEA 2QCMA 1TPC1 1NSJA 1B4EA 1XBZA 4S2CA 1L6WA 4JTJA 1FX6A 1XXXA 4MLRA 3P81A 4OE7A 5LHFA 4ADSA 3QYQA 1LOLA 5D05A 4RZ5A 2QCFA 4ZMGA 2BLEA 1TRIA 3HGOA 3L0GA 3NVTA 3GDKA 4K38A 3IIXA 3TA6A 4RCXA 4UTTA 4JTUA 1RPXA 3OIXA 3R8RA 4NXKA 3O15A 1ME8A 2ZZ4A 4B5NA 1O60A 4DEFA 5CZTA 4XTIA 4O15A 1TTQA 3W22A 1G4TA 2Y7FA 3G0SA 2B7PA 4HN4A 2CLFA 4LVDA 3VE9A 2WNQA 3N3MA 1OFDA 2XN2A 5EA9A 5HWJA 4LU0A 1KFLA 1UUOA 2EAWA 2VEIA 3M16A 2C1HA 1KLYA 5DCDA 3QQ0A 4Z08A 3RLUA 4MFEA 3DHFA 4IX0A 1EX5A 3G3DA 4P2VA 1YPIA 5FF7A 3ABQA 2WO5A 3JS3A 1H7WA 4LS0A 3W1UA 4IMCA 2HS8A 4HNUA 1DOSA 4LRTA 3I7RA 4DO4A 4YWIA 2TRSA 4JN6A 2LLEA 1H61A 1FWRA 4HT3A 1FBAA 1ZCOA 2GOUA 4HPJA 1ZNNA 5KZDA 4JYFA 5DCEA 2E09A 3LTYA 1TB3A 4MY8A 3HBLA 1WOBA 4BFAA 1GYNA 1F7BA 4O1BA 1XC4A 3W70A 4LUJA 3GXTA 3SZ8A 1GG0A 1U83A 3I65A 4FNSA 4DELA 1W8SA 4JR5A 3PG9A 4GUIA 1X6UA 2A7RA 3BW2A 4MFDA 3UYCA 2YYTA 5F2MA 1XL9A 3GK0A 1TMHA 2X1TA 3NGJA 3ABSA 4UNLA 3GDRA 4DBEA 2BXVA 3NO5A 4U28A 1ME7A 3HF3A 1IXPA 3MHGA 2CLOA 4H3DA 5HUOA 2VEPA 5G2HA 2ABAA 3QC3A 1SPQA 3LHYA 5DXXA 3TNOA 3UY7A 2A5HA 4O1AA 2E6AA 4GWEA 1WBJA 4UTWC 1JCMP 3QFEA 3W7NA 1UBSA 2W79A 4C1KA 1LROA 3G3MA 3SIZA 5LNUA 1Q6LA 1F05A 4WZHA 3W1RA 2H8XA 3USBA 1QCWA 1FDJA 1WXJA 1QR7A 2DORA 2GVJA 2ZTJA 5E93A 3WK1A 1KTNA 4J9JA 5HR7A 1BEUA 3TROA 3PSVA 1IXOA 5CZ0A 3FLUA 1OX5A 3WK0A 4NJHA 1R2RA 3LXCA 3HG2A 4Z0SA 3W76A 1EB3A 3C3NA 1JQXA 3RLVA 3NYZA 3LCXA 3TQVA 2BTMA 4LVAA 4ORMA 4IMDA 1VHNA 2CLLA 1A50A 1DQWA 5EBUA 5FF2A 1IXNA 2ZQ0A 1OYAA 1DJQA 3EX6A 1F5ZA 3M5VA 4RJEA 1O4UA 3RU6A 3QQ1A 3UWVA 4M6QA 1PVNA 4FNUA 2G95A 5HINA 4TO8A 2NZLA 5D2TA 4PTNA 4LVBA 4XBSA 3DKJA 4KWWA 1SO5A 3Q37A 1RQBA 1SO4A 4NT0A 1GEQA 5AHIA 2V5LA 1VJIA 2YCEA 3W2UA 1FCVA 1J5TA 5FEZA 3FKRA 3VKJA 1I8JA 4Y6GA 3GX9A 2QKFA 4G1KA 5BW6A 3QRHA 1C29A 1L6YA 3GR7A 4O11A 3W7IA 3W23A 2R14A 5T26A 3SGUA 5IM51 2PRMA 3TSMA 3OHIA 1W56A 3T7VA 3KOFA 3P60A 1XDMA 1QPOA 2JGQA 1CI1A 2H6RA 3E49A 5D02A 3SECA 3G1XA 4OGZA 1YDOA 4E2BA 2OCZA 3KHJA 2ZRVA 3SGZA 2VFEA 1DKWA 4Y90A 2ZRZA 3N2XA 2RH9A 4RV8A 1RQHA 3UWQA 1KTCA 1JVNA 5K9XA 3QSTA 4O16A 3S1UA 1KM2A 4I7VA 3WJXA 3T55A 3UY8A 1E51A 5CPNA 4PA8A 1WDWA 3W3OA 3TCEA 3CQ0A 2CLEA 2C15A 4FEZA 4EVZA 3VNDA 3IIOA 4DBDA 3MUXA 1W3NA 3LBMA 3P82A 3C2RA 1OFBA 2ISWA 4MJZA 3TQ0A 3SY5A 3FFSA 4UUIA 3DENA 3LTPA 3S5OA 4ADUA 4WX2A 3GKAA 1CW2A 1W37A 1DORA 1ZHAA 1YDVA 3I68A 3TFXA 2GQAA 4NZJA 3G8RA 4JYEA 3L0NA 4JDBA 1SSDA 2JK2A 3IV3A 3N34A 1K8ZA 4N9BA 3W2JA 1G69A 4IMEA 1SO6A 4AWUA 4W9TA 3W7MA 5BNKA 1JRBA 1XFBA 5K3VA 1DBTA 4A21A 1W5OA 4UR8A 4BK9A 4O8RA 4GNJA 4PH6A 4MUZA 4JY9A 3ATYA 2CWNA 1O5KA 3TW6A 3CIXA 3LCWA 4FX7A 4DPQA 3H53A 3OVRA 1OVDA 2Y89A 8TIMA 4MYXA 3W7OA 2GPTA 2Y70A 2FB2A 3KFTA 2NXGA 2E5BA 5AHNA 3NM3A 4DO5A 4M7SA 3K30A 3NQ2A 1QDSA 4PC8A 4E38A 5EKYA 1PCKA 4S2BA 4RXFA 5AC6A 3TKFA 3WK3A 3LGEA 3TQKA 2BSLA 3W85A 3LM7A 4GBUA 4OU1A 1L2UA 5F4WA 3CB8A 5LNRA 4XUGA 4K36A 3QJAA 5F4XA 3W75A 1H1ZA 1RZMA 2Y6ZA 4UTJA 5IBXA 4HKPA 3L65A 1F6KA 4PCFA 2EPHA 1VCVA 1AL8A 5D37A 2E6YA 3EKLA 3L66A 2PE4A 4JDYA 5KSWA 4Z1CA 2ABBA 3NR0A 4AF0A 5D04C 4A3UA 2P0OA 3O6CA 4JY8A 1SSGA 2QJHA 3MYOA 4JTKA 1QPRA 3G0UA 1GZGA 1H7XA 5G5IA 4ZVJA 4YMZA 3SR7A 3W7EA 2TYSA 1T8XA 1UB3A 2D73A 3QF0A 3RMJA 4N9DA 1NEYA 1H7OA 1JCLA 5F2IA 1LDCA 2YW4A 3NPUA 3R2GA 1XBYA 4AWTA 5C55A 5E1QA 2AGKA 4TU1A 2OJPA 5I3IA 1AW2A 2FQIA 3CT7A 4NJGA 3PY2A 2Z1BA 2VEKA 5AC8A 1TV7A 4O4VA 3KVLA 1NAL1 3N9RA 2V82A 3EWUA 2J88A 4LRSA 2GQ9A 2RDUA 3P5YA 5DCBA 4CQ8A 1OYCA 3LX9A 4Z1AA 3IGXA 3UWUA 4AXKA 3MP4A 1GPWA 3A24A 3QZEA 1VYSX 3G1YA 3NQ6A 1DHPA 2ISSA 4NNCA 5FF4A 3MP5A 5HNRA 3W7JA 3CHVA 3TK7A 1H1YA 1UCWA 5FI8A 5AHLA 3QSRA 1L6SA 3TE9A 4GXMA 2ATSA 1R46A 2FJKA 2ZTKA 1TJPA 4ML9A 3KAOA 2Y88A 4AMAA 3ZWSA 4JX4A 3C6CA 1VCGA 2YYUA 3L9CA 5D09A 1KW1A 2W0UA 5HULA 3LB0A 3S5YA 1T96A 3IRDA 4MLJA 3U8GA 3O6YX 2PRHA 1SW3A 2RDTA 1P5BA 3S42A 4DXVA 3PSWA 3OBKA 5K7JA 3WJYA 1QFEA 3BV4A 4AVFA 4MOZA 2WSQA 2DZWA 4JTLA 5AHFA 3QM3A 1P1XA 1SFJA 5AFDA 3DFNA 3C8FA 3Q58A 5K9CA 3B0VC 3TW7A 1DJNA 1GG1A 4L4LA 3GAYA 4JS3A 1N8FA 3RFAA 1AG1O 3EX1A 1F74A 2G97A 4DF1A 3WJWA 4JTEA 1WAUA 1R2SA 2NX3A 4N6EA 4ZQPA 1TJRA 7TIMA 4OT7A 3HO8A 2OMAA 3BG3A 1T99A 1FDYA 2Q3RA 1SZGA 3S1WA 3PUDA 2B7QA 3DI1A 4HIBA 2ZZ6A 3NQGA 4JNMA 4IPIA 3LRKA 1H7RA 2YGYA 5CZSA 5D2XA 4CQAA 4LVGA 2YPIA 2A0NA 3KVJA 3NG3A 3W1QA 5LKYA 4BWLC 3LERA 3MBFA 4BF9A 1I2RA 3GNNA 3CU2A 1XI3A 2Y85A 5DBUA 3T78A 3T4CA 5KTLA 3IGSA 3IIPA 3E12A 4QSHA 4NNBA 4IJBA 3LHZA 1S3HA 3CPRA 4H4IA 3HPSA 3I6RA 1Q45A 4XZ9A 1JUKA 5EL1A 4C1LA 1EPXA 3M41A 1XBVA 1X1OA 2B0MA 2Q8LA 2QCNA 3A9IA 4KFNA 4NNAA 3W1NA 3MYPA 1I4NA 4O54A 1DL3A 1TPFA 1LLZA 1RV8A 3KVMA 2A85A 4JIQA 2WNNA 2F84A 3UZJA 3BARA 1C9DA 5BMXA 3TUUA 5ABTA 2J27A 1D9EA 3L67A 1FWTA 5J5RA 1TYGA 3W7KA 4RR4A 1TQJA 3PM6A 2H8ZA 3IEBA 2FB3A 1FDZA 4FIRA 4RLIA 4R53A 2JGYA 3P8IA 1XM3A 1SQ7A 1B3OA 3GAKA 3W7QA 3S1VA 1Q3NA 1LBLA 2CW6A 4OQVA 4CNOA 3A21A 2F7FA 4ICNA 4UFMA 1KM6A 2GJLA 1RD5A 5KZMA 4LV4A 4O50A 3W7CA 3W7RA 2X30A 1AK5A 4Z1BA 3QW3A 4PL1A 2Z6IA 2QUUA 3M5XA 4JD4A 2C16A 4A22A 2X1SA 4AHPA 1G4EA 2QDGA 4LVFA 5AYZA 1RQEA 2DZSA 1J4EA 4I7UA 1NFBA 2J9YA 1SU5A 1MXSA 3M47A 4H6KA 1GQNA 1KM5A 2RDWA 3ABRA 2WNZA 3NZ1A 1OFEA 3UPWA 2C19A 3HG5A 4LW7A 1Z44A 3HGJA 1F73A 1SR9A 1TCDA 4N2YA 1ZAJA 1A5SA 2B7OA 5D2WA 5K4ZA 3N9SA 4NUWA 1IXQA 2GJNA 3W6YA 1GYLA 3KRZA 2ZA1A 2ISVA 4X22A 5AHEA 5BRBA 2Z6JA 3NOEA 4UMCA 4D2JA 2NX9A 3SSJA 1TV8A 4MZYA 1V5XA 1RR2A 3KVKA 4XWUA 1VYRA 1PIIA 4UCGA 1PCWA 4OBTA 4UTWA 3DFSA 3O1NA 1VPXA 2Q8ZA 3W1AA 1FQ0A 3HPZA 4JX5A 3P80A 1TPWA 3SW6A 2ZRXA 1H63A 1Q6QA 4WY0B 1F76A 1G4SA 4K7VA 2XN0A 4KKXA 3CM4A 2JBMA 1F6PA 1Y0EA 1XUUA 1K7FA 2VENA 3M9YA 1GVRA 1AW1A 4PODA 4ALDA 1A5BA 4LS2A 1QOPA 3NPVA 4R34A 4WXYA 3MHFA 3P5ZA 4IMGA 4X9SA 3MHUA 4M19A 3LI1A 3CTLA 3DH7A 4IX2A 3N73A 3CEPA 3R89A 2X1RA 3C56A 3EWBX 1EP1A 3PB0A 4CNNA 3LOTA 3O07A 1X8FA 2R94A 3U2OA 2C13A 4FF7A 1JQVA 2EKCA 3B0PA 3L2IA 4MY9A 3GXPA 1B4KA 4IGHA 1JCYA 3W2LA 1IGSA 1ONRA 4E0CA 1UASA 3TAOA 1I2PA 3FJ6A 4A29A 4XKYA 3LV5A 4FNTA 1QPQA 4A2RA 1PHQA 1ZAIA 4O28A 4GUJA 1OHLA 5CGQA 3LRMA 1H60A 1W5NA 4QIUA 4O1DA 2ZZ3A 2QAFA 1KTBA 4P61A 4NJJA 4UTTC 5D33A 2XFWA 2OT1A 4WXZA 2DU2A 4MYAA 5CKSA 2CZFA 1HO1A 1IF2A 4DQWA 2A6LA 3W84A 5F4SA 5F2GA 3L0KA 1H7PA 3TDFA 4O18A 3S5NA 4UMAA 1I2QA 3DZ1A 4BI6A 4HSOA 2V5BA 3ANYA 3G0XA 4JEQA 4AAJA 3LHTA 4K8HA 3NZRA 3HG3A 2O7QA 3O05A 3H54A 1Z41A 4TMCA 5EPDA 1IIHA 4FNPA 2J9ZA 3ZR4A 3EXRA 5CZJA 4UFKA 3CWOX 3RNDA 2I1OA 4HNTA 2YW3A 2XN1A 1SFLA 3A23A 1TPEA 1LBFA 1TPUA 4RX0A 3G1DA 4Y96A 1SO3A 4FX6M 1ALDA 2P10A 3C4UA 1KFBA 1K03A 2FPTA 3UPBA 3LCLA 1QOQA 2I14A 5BOOA 1FXQA 3DI0A 1JUBA 1X1ZA 2J6XA 4NZFA 3H55A 1THFD 2VC6A 1VR6A 1VZWA 4HSNA 3S6DA 2GVLA 1TTJA 2NUYA 3O6DA 4LC8A 5HJLA 3W7DA 3G1SA 4BI7A 2V81A 3UQNA 4EIVA 1ZFJA 3G24A 4HNNA 4WY0F 4TR9A 3C2OA 1KFKA 1MSSA 1PV8A 1XBXA 1G7VA 1M7PA 1VLWA 1G4PA 3HG4A 1LOSA 4ONVA 4UTKA 3V1PA 2C18A 5F1UA 3W71A 1H62A 1M7OA 3MO7A 1OFAA 3BG5A 1W5PA 1WYIA 2B4GA 4TMBA 5G4EA 3MI2A 3QMSA 2OX1A 3NL6A 5D38A 2UV8G 4ZQCA 4GUHA 2DJXA 5G2WA 3ZFHA 2HTMA 4O0ZA 3W83A 5KINA 4QQ3A 1LTDA 1ZAHA 3OVQA 3BLIA 4BR1A 2FFCA 4GRSA 3A5VA 4U4MA 4MJMA 3I7SA 3IGUA 3IVUA 4KWVA 2NV1A 4I7WA 1W1ZA 1I2OA 2V2HA 4ZL1A 3HGSA 3MWAA 2O7SA 2B7NA 4NVTA 4MZ1A 5D30A 2Y7DA 2A7NA 4WOZA 3VCRA 2Q3OA 3W2NA 1GTEA 2GVGA 2EGZA 3W7HA 4FB7A 2ZBTA 5C54A 2EF9A 4N6FA 4QITA 3W1MA 4AB4A 5MHBA 1LM1A 2V8ZA 3O06A 1JUEA 1MZHA 1W5MA 3R5EA 2QCLA 2VFFA 3E02A 2NUXA 1HG3A 4PEKA 2ATMA 5HQEA 1TSIA 1ML1A 2VXNA 2NV2A 5EY5A 4O4WA 4JTTA 2E1DA 3FOKA 4M6PA 3FJLA 5F2LA 5HMSA 4FXSA 3C2FA 3HIJA 5I3JA 4JTIA 4S1FA 1Z42A 2GUUA 4N4PA 2G96A 1W3IA 3G22A 4N9EA 2V0TA 4NXSA 3LHWA 3HGRA 4QM1A 4Q32A 5LSMA 1T0OA 3TJLA 3GLCA 3DFOA 1PHWA 5D2VA 3W74A 3W88A 3WJSA 3MI6A 3M44A 1VC4A 3PAJA 1L9WA 3EWXA 3MP3A 1VH7A 5K2ZA 4ZQOA 1AW5A 2ZRWA 3NQ8A 1LZOA 5KZEA 4IXXA 2A1YA 2ZA2A 3VI2A 3Q94A 4O19A 3NQVA 4CQ9A 1K7XA 5KITA 2V30A 1B57A 1W5QA 3LCGA 1LBMA 2X16A 1X7FA 3B06A 2DZVA 3FIGA 4JIPA 2QCDA 1KFJA 1M5WA 2JKEA 5LGXA 2RHGA 1DVJA 3I7QA 3TXZA 4UTLA 3W73A 1FWNA 1K3UA 3RF9A 5TIMA 1VHCA 4NX0A 5HR6A 1EP2A 4L4MA 4IPJA 1S5VA 1MEHA 2YR1A 3WFAA 4K39A 1MEWA 2WPBA 2WQPA 5HWMA 1YYAA 5CPMA 1W3TA 1GOXA 4DF2A 4IOTA 1FY6A 4CLMA 1W31A 2FIQA 3OG3A 1XKYA 1C8VA 2H90A 2Y61A 1H51A 5DLCA 2YXGA 1OFQA 4HHPA 3THAA 4Z0JA 2QCHA 5KMYA 1TPDA 4O14A 1QNVA 1GT8A 3PBVA 4AEOA 4LTSA 1EIXA 1BTMA 4JGDA 3WK2A 2WJZA 4E2DA 3ELFA 3W1LA 3LTSA 4FNRA 2YX0A 2E68A 1RVGA 3ZS4A 2VKZG 1VGAA 3GIYA 1EP3A 1QPNA 3DFTA 3AO0A 1CX9A 5EYWA 2CLMA 1SW7A 1LRQA 4QJ1A 4WD0A 4JTGA 1ME9A 2RFGA 1R30A 1V7YA 1M6JA 3BW3A 1FCBA 4OHQA 3L5LA 3QMTA 3UWZA 2BX7A 1ICSA 3G18A 4QNWA 3TC7A 1Z48A 4UFHA 1KLZA 1QAPA 2A21A 4FO4A 3LXBA 3F1QA 4UIOA 3UWWA 2DZUA 3L21A 1BKSA 1D3GA 3JRKA 4YCPA 2VFGA 5C6MA 4K8EA 2X1UA 2CFFA 1G6CA 2QAPA 3N2MA 2ZA3A 1FUYA 3NNTA 1YDNA 1OX4B 3M7WA 2H3BA 3C2VA 1KM3A 2E6DA 2ZZ7A 4IMFA 2V2DA 3RK8A 4JTFA 4X3ZA 1PE1A 3NQDA 4QAIA 3E96A 1FCQA 1O95A 5I3HA 4M5PA 2DZXA 3L68A 3TR2A 1ICPA 3LLDA 4IUOA 1HO4A 3KRUA 2KZHA 2ZRUA 3HMJG 1OYBA 3LBCA 2FPVA 4YL2A 4LY8A 3INPA 1KV5A 2NLIA 4XQ6A 4MIMA 2VEMA 4Q33A 3LCHA 3UD6A 5IBXC 4LOCA 5DBTA 1OK6A 1OFRA 3FA5A 2ZZ1A 4I9AA 2TSYA 3P74A 3HB9A 1FCUA 4JICA 4UTUA 3PR2A 3DU0A 4ZQMA 5FEPA 4FIQA 4O10A 3M43A 4CCDA 3UNDA 3EKZA 4LT9A 1FWSA 3STCA 4A2SA 3P8JA 1BWKA 3DGRA 1WX0A 3M6YA 3NEVA 1JULA 1ZALA 3STFA 5AC7A 3ZWTA 3NQ7A 1GVSA 2QJIA 4ZQRA 5LHEA 2CLKA 3MMTA 3IIVA 3G8EA 3EX2A 2QCDB 1D3HA 1SZFA 4MKNA 1U5JA 2NX1A 3ABOA 1KM1A 4NJKA 3DBPA 4RZ6A 3FEMA 3S5ZA 4FXRA 2A7PA 5DN1A 4JTHA 4Y8FA 2QUVA 3E0IA 3HOJA 3LDVA 3NQCA 1DQXA 1GVFA 4PL2A 3LI0A 4RK8A 2CLHA 1K02A 2VOMA 1VLIA 1LCOA 1WOAA 5FESA 4X2RA 2CZDA 1QO2A 5I3KA 2NWSA 3NDOA 5HWNA 1PS9A 1GWJA 3G1FA 1FWWA 3P67A 2JKPA 1NF7A 4KFPA 2FPYA 1YPFA 1JR1A 4KFOA 4ZQNA 4Q4KA 2QJGA 2QR6A 6ALDA 1P4CA 1J2WA 1EEPA 1UUMA 2ZZ2A 4MZ8A 3EX4A 1B9BA 1S5TA 3V75A 3U6WA 3CLMA 2OT0A 1HFBA 5AOUA 3PB2A 1TV5A 1GVOA 1R47A 1SZEA 5FEWA 3W7LA 1XCFA 2GQ8A 3LCIA 3KRSA 1P0NA 3EB2A 3TC6A 5LGZA 4EWND 3VE7A 3A5FA 4AH7A 2DZPA 4JTSA 2AAMA 3BG9A 4JX6A 1ZENA 4UMBA 1OK4A 4ORIA 1LORA 1TRDA 3EXSA 4JXCA 3HPXA 3WJZA 5GVJA 2AQWA 2QEZA 2ZYFA 3FKKA 2E6FA 2VFDA 2VFIA 3B05A 3B03A 3UXAA 4IWWA 4ADTA 5G1TA 1ZY9A 3TX9A 3TSDA 1YTEA 2QCEA 3EWYA 3CIWA 5DY2A 2NXHA 4O0KA 4UNKA 3BPWA 2OZ0A 1I2NA 3DFQA 2ALDA 4BWLA 2E5CA 1AMKA 1OF6A 1FXPA 3DHDA 2HMCA 2A4AA 4YLWA 3QPYA 5L6UA 2FTPA 3G1AA 3W7GA 5EMUA 4M7TA 5G2IA 3LXAA 1GJPA 1TQXA 1WBHA 5TQLA 3MJYA 3B0UX 4TX9A 1LLWA 2J9XA 4HNVA 1OFOA 1KFEA 3W72A 4WJEA 3JR2A 3NPWA 4OV9A 3L5MA 3M5YA 1XUZA 3BLEA 5D2YA 5DELA 5L9FA 3M0ZA 3G1VA 4OWGA 3GNDA 5FF3A 3ATZA 2YFNA 3LHUA 4UTMA 3F03K 3TV8A 4DF0A 5AYYA 2HSAA 1W54A 1KV8A 1TO3A 3P62A 4O57A 5F1VA 3P7YA 4LS1A 2NWRA 3BK0A 3EEGA 2J24A 4NX5A 2DZTA 3FYOA 3GVGA 4AHOA 5H91A 3THQA 3BW4A 2G5WA 4CCCA 3SI9A 1OFPA 1SUXA 5K4XA 3NQAA 3TU9A 4GC4A 3NQMA 4AWSA 3HQ1A 3SFKA 3HJZA 3D0CA 3W2MA 3MI3A 3W1PA 1A5CA 2IQTA 1ICQA 1G7UA 4FHAA 3YPIA 1KBIA 5CG7A 1KFCA 2PRLA 3R12A 2X2GA 4EF9A 3EWWA 3T44A 3GB6A 1TREA 3NL2A 1N7KA 1KM4A 3PWAA 4Z1DA 4QISA 2P1FA 3KX6A 1EWDA 1H50A 3GR8A 4GE8A 3PS7A 3STEA 5D03A 4QNEA 3DAQA 1KBJA 2PCQA 2WOQA 4WUIA 1YTDA 3F4NA 2Y7EA 3NQFA 4O53A 5FF0A 5I3FA 1EUNA 1TTIA 3G1HA 1JJKA 5FEXA 4O12A 4TIMA 1G67A 3NQEA 1O5XA 2WV8A 3IVSA 1Q6RA 3NM1A 4MVAA 4O13A 3TMQA 3W87A 5D32A 3MW7A 3S8HA 1TPVA 4GJ1A 3QEZA 4O52A 1EUAA 3STGA 1A5AA 3W1XA 3PUOA 1OABA 1QWGA 3SJ3A 4WQ6A 3PUEA 5CPOA 1DV7A 2QCGA 4XTDA 3TAKA 3NAVA 4M6VA 5LNSA 1JCNA 3BLFA 1VCFA 3QW4B 4YXGA 4LNYA 3EWZA 1Q6OA 2Y62A 4NU7A 3PBYA 3FS2A 4LUIA 4AF0B 1OJXA 3TH6A
chains in the Genus database with same CATH superfamily
5BZAA 1TIMA 4Y7EA 3NDYA 2I9EA 3E9AA 3TWBA 1R5YA 1IEVA 3O63A 1UKSA 4XKYB 4ROQA 1XR2A 1F2JA 4JL1A 2HXTA 1IGWA 3E74A 4E4FA 1MW3A 1BHGA 5E5CA 5AYXA 4X63A 3EX3A 1PBGA 1QW7A 3R13A 4XBKA 4L61A 2WC4A 2WSRA 1DEDA 2VFHA 3EGJA 1TTPA 5I24A 3BJFA 1RAKA 3UG5A 3FYPA 1JIBA 5C2XA 1S5MA 4IG2A 4IQLA 3UR7A 4REQB 4W7WA 2YFOA 1O1ZA 1V8EA 3VFLA 4Q4OA 2PC4A 6TIMA 4Q4PA 5DY3A 2V9DA 4LWWA 2DJLA 4WOQA 3CWNA 1C92A 3PZTA 2P8BA 3NXFA 5HUPA 1KM0A 1GTHA 3O3RA 4QG8A 3GBDA 1G94A 2EBNA 1WQ5A 4AHQA 2VX6A 1GKPA 1IR2A 2YSWA 2YB1A 1Q4NX 3TTSA 4OV4A 3DKLA 3H7UA 4RDYA 1XQKA 3V4BA 4AZBA 2EG7A 5A8OA 1Q66A 2G4JA 2IXVA 2V2CA 1IE7C 3OA5A 1P1MA 3OVGA 4B3LA 2YZRA 2DPEA 4O17A 3BH4A 5IHRA 3LGGA 2W6RA 1LYXA 4KW2A 1ZGDA 4GNVA 5U4NA 2O9OA 3W29A 1ZSXA 3BO9A 4ZXOA 1Q6EA 1WDQA 3K4WA 2WSYA 2ZFAA 3A3HA 4JIEA 2R91A 4K7YA 4LBSA 1PL9A 4LANA 1NOUA 4Y9AA 1MQRA 3POHA 5BOEA 3H2EA 4B5XA 5AB3A 4GFSA 2WKJA 3LCFA 4IPLA 5AZ0A 3TLLA 2BXZA 3T4WA 1C9WA 1N55A 1EFZA 3BGJA 3SN4A 2PURA 3GG8A 4PFMA 2C3ZA 3PBUA 1SJDA 3C2EA 3TZNA 1W0MA 1UR1A 1W3HA 5XIMA 4IL0A 3QV7A 4E8CA 3ZT7A 2Z2UA 2WANA 1H1NA 4BKNA 4BQ2A 4F8XA 4AC1X 1SW0A 5CLWA 1UP2A 3BMXA 2D22A 1N82A 1VFHA 3GXDA 3GFYA 5AYBA 2Y4SA 3ERPA 4EX4A 3DFPA 3STPA 4A3HA 3NPXA 4MADA 4U2ZA 1BF2A 5LZLA 2PP0A 4BF5A 4GABA 1A5NC 3WBAA 4DZAA 1EZWA 3NL5A 4EAYA 2PF8A 5BWAA 1JZ8A 1H41A 3TYDA 3KXQA 4RDVA 1O94A 4A3RA 1H7NA 3U2CA 3FN9A 4FNQA 5DMMA 2D0HA 4C6KA 3TWAA 4UC5A 2DP3A 3WMCA 3GDMA 3TFCA 3GDLA 2OG9A 1AH0A 3QPEA 4GY0A 3LLFA 1J96A 1E6QM 4UTIA 2DSZA 3UF9A 3BOXA 3VIFA 5A8NA 4CCEA 2QCMA 1TPC1 1B4EA 4AZCA 1XBZA 1L6WA 1P0EA 3BZGA 3WBYA 1FX6A 2ZXQA 2CXGA 4MLRA 3MV01 4ATWA 2PDGA 3L4TA 4MDPA 5GNYA 2BLEA 4Z2GA 2XHYA 3GDKA 2CITA 3WLLA 1W17A 1E72M 1RPXA 1XGZA 2R82A 4NXKA 1ME8A 4DEFA 1O60A 5CZTA 3CS2A 1TTQA 3EDEA 1R85A 1MFUA 2CLFA 4HN4A 4WDXA 3CAQA 1UUOA 2EAWA 2C1HA 1KLYA 5C2CA 1R3SA 1X97A 3BLOA 3LY0A 2IUZA 4P2VA 3OTRA 1QNRA 3W1UA 4IMCA 4LB4A 1HQTA 4OUIA 1BGAA 4XZLX 3KEHA 4YWIA 5HMFA 2LLEA 1VFOA 1FBAA 3SRHA 4HPJA 3U0HA 3KBVA 2E09A 3LTYA 3GH7A 2D3LA 4FZIA 3WO8A 2WHKA 4HQVA 1U2YA 2HRWA 1PSCA 1XC4A 3ITLA 3W70A 3UJFA 3GXTA 3SZ8A 4FNSA 1U83A 4DWSA 1EDTA 1J79A 1W8SA 4H8NA 4JR5A 1X6UA 1QJWA 1HF6A 1PYMA 1BVWA 3RM9A 1ECEA 2YYTA 5D4YA 2UY2A 1E6RA 3M4HA 3GK0A 5G4HC 4CD8A 1JPHA 3ABSA 1EJVC 1UWSA 1YPXA 5I06A 1LWHA 3URBA 3BCJA 2P8CA 1E1FA 2VEPA 3TNOA 2OLAA 4JQAA 3UY7A 5BXRA 2E6AA 5CC3A 3C0LA 1JCMP 3QFEA 1UIOA 4HHMA 1ZP4A 1U1JA 3UERA 4GIAA 4C1KA 1RBLA 3AIEA 3G3MA 4S3FA 4NG3A 1RBAA 1ITUA 1FDJA 1WXJA 3MT1A 2QPXA 4PMYA 2DORA 5E93A 4F9DA 2QDDA 4XO6A 3GC2A 5FL0A 4UZSA 4IFRA 3WK0A 4NJHA 1R2RA 2Q71A 1TE6A 3LXCA 3WLSA 3FK4A 2JFEX 3LCXA 4Q4SA 4ORMA 1EJRC 4IMDA 2VRKA 4JFTA 5FJIA 2ZQ0A 1OYAA 1DJQA 2WMHA 3EX6A 4F2UA 4HCDA 4RJEA 3RU6A 4IJRA 4XSMA 3UWVA 1PVNA 3TLQA 4H8VA 4YTTA 3CASA 5D2TA 4PMNA 4PTNA 3ZIZA 3W02A 2XPKA 1HN1A 3C0SA 1U30A 1RQBA 2GGHA 4A05A 1A0DA 1S2UA 4TOQA 4MSSA 3LSCA 2BOFX 4A3YA 1XLEA 3VMPA 3CO4A 4FXJA 4UOJA 3H2NA 5FEZA 3VKJA 1B30A 2UY3A 3QRHA 1L6YA 4O11A 4MKSA 3W23A 2R14A 1E5JA 4L9ZA 3DYOA 4DI8A 4HOWA 3KOFA 1CI1A 1MUMA 1CECA 4XIMA 2VX4A 3G1XA 1D7KA 5T8GA 1YDOA 3E2SA 1AZ1A 2A79A 3KHJA 3TW9A 4Y90A 3N2XA 2RH9A 2WZMA 3MSGA 4PUKA 1JVNA 1SJBA 4I7VA 3VNZA 3T55A 1HL9A 5M3WA 4A4AA 1VEOA 4AZHA 3MA8A 3VNDA 1EOKA 3IIOA 3MUXA 2XSBA 1KBKA 3WQGA 1FKXA 3VDAA 1MWOA 3LTPA 3VDBA 3WNNA 1XSKA 1RY8A 3N4EA 4L6OA 3I68A 3JVAA 4AY1A 6XIMA 4TUFA 4H01A 3N34A 3W2JA 1TJ1A 4US5A 1SMAA 4AWUA 4W9TA 5BNKA 3R8HA 2PP3A 1A5OC 1K70A 2PGEA 4Z42C 2VM8A 1DBTA 3CQHA 4XD3A 3N04A 2XJ7A 1DHKA 4PH6A 3VNKA 4B3ZA 4XZNX 4DUXA 2CWNA 3M0YA 4DPQA 1HVXA 3H53A 4Q8UA 4GIRA 2Y89A 8TIMA 3W7OA 4IPPA 2V68A 5ABFA 3KFTA 3FXGA 2NXGA 3G2GA 2INEA 1B54A 4M7SA 3NQ2A 4FR1A 4HNCA 1QDSA 3R58A 2NQZA 3SUWA 2D24A 4JIHA 2G50A 2QMJA 3PN8A 4S2BA 3H8AA 3LGEA 3TQKA 2ESCA 2BSLA 3MZ2A 4F66A 3LM7A 4OU1A 1OIMA 4AD0A 5F4WA 3ARVA 4XUGA 1KWGA 4AMCA 3K4DA 3PZNA 3UA3A 4TVDA 4PUNA 1NJJA 3VGHA 5D37A 5DMLA 1E0UA 4JDYA 2J7DA 4Z1CA 3VOIA 2ABBA 4QQUA 3DECA 4A3UA 2P0OA 3O6CA 4E4UA 1SSGA 4BEQA 3TJIA 2NV9A 2ZC8A 1VPQA 2EPNA 4XX6A 1RD6A 1T8XA 3QF0A 2VR5A 3RMJA 5GNZA 3FNDA 2WYSA 2WC3A 1LDCA 2PDHA 2FGZA 2OJPA 5I3IA 2FQIA 3WBEA 3CT7A 4NJGA 2Z1SA 1GW1A 3PY2A 1WZMA 2C79A 3AISA 3AXXA 4Q8PA 5AC8A 3N29A 3KVLA 1O6IA 1GONA 1VFLA 3N9RA 1YIXA 2GQ9A 1OYCA 3LX9A 1BYBA 1CYGA 1V03A 4AXKA 3CYVA 1VYSX 3NQ6A 1DHPA 4PTWA 1TCMA 4GX8A 2QW5A 1O1HA 1U5HA 5FI8A 1DWHM 5MF5A 4P7LA 1L6SA 4UQBA 2FZMA 3TE9A 1TZ9A 3MQTA 3P0XA 3C6CA 2YYUA 3L9CA 3DHUA 3MKVA 4LB3A 3LB0A 4X0VA 1T96A 1SMDA 4WDTA 1OT2A 4HHHA 2PRHA 4LAKA 5I00A 2AGTA 5K7JA 2D2HA 4BCEA 2C0HA 2DZWA 4GFIA 2BOEX 3K8KA 3QM3A 1P1XA 4TTUA 5T9CE 2BVWA 3NTYA 3C8FA 3O0KA 4W7VA 2ISDA 1DJNA 1H09A 1HGWA 4A8NA 3RFAA 3KL3A 1X39A 3IJIA 1VBHA 1XIEA 4QLKA 3DBNA 2WWDA 1CCWB 4IL2A 1T99A 3BG3A 3WD4A 1K1DA 2XGIA 2ZWZA 2ZZ6A 1UKOA 4J3UA 4MPKA 1VKFA 4WRHA 2YGYA 5D2XA 4PUJA 5A1AA 4HGXA 3FGCB 2A0NA 3M0MA 2E9BA 4BWLC 3R79A 1H0GA 4Q4MA 5CG0A 4O8AA 3BE7A 2NSXA 1XI3A 1KKOA 2Y85A 1L0PA 6ENLA 1ZB5A 4OUEA 4AVNA 4NNBA 4IJBA 1DIKA 3CAVA 2WLYA 4WKFA 5DMYA 5EL1A 5FJOA 5EFDA 2G3IA 1CB2A 3UGRA 1I4NA 4GVGA 2J75A 3M0IA 5CJNA 4MWAA 1QUMA 3ZO9A 3GTXA 4ZTXA 1C9DA 3H7VA 4NAEA 4UWMA 4DAIA 2JIWA 3L67A 2PI6A 2I5QA 1J18A 1Y5XA 2H8ZA 3IEBA 3SDOA 1WZLA 3R0DA 4DWSC 1RLCL 3FJ4A 2JGYA 1NU5A 2PS2A 1FP8A 4XZWA 4I5UA 4XD4A 2CW6A 3WELA 1ZTVA 2D3NA 1NDYA 4UFMA 1G0CA 1PTGA 1ZBVA 4LV4A 1L8PA 1QBBA 5ECVA 6REQA 2X30A 5AC4A 3NURA 3CGTA 1KB3A 4A22A 3URQA 1WDSA 1XPGA 4GVHA 1RVKA 2QDGA 2DZSA 4GKTA 4U5KA 1GKRA 2J9YA 1GQNA 1KM5A 2ZDSA 3W27A 5CZKA 2RDWA 5IRPA 1EDQA 2PSNA 3MVIA 1XINA 2GGEA 2C19A 1SR9A 4N2YA 4RE0A 4PRTA 5D2WA 1BYDA 4MB3A 1SZRA 1W6TA 3N9SA 3W6YA 3NZQA 2ZA1A 5HNNA 3CQIA 5BRBA 3HV8A 4QS6A 2NX9A 2YCIX 1RR2A 1T6MA 4XWUA 4AVOA 3PHAA 1JPIA 4IHCA 4UCGA 1PCWA 1EJ7L 1S3TC 4UTWA 1VFTA 3WH6A 3DFSA 3CV6A 4AXNA 3TA9A 1FQ0A 3R6IA 5I02A 3HTWA 1S2AA 3SW6A 5EU9A 3RPTA 1H63A 4WY0B 3OB8A 2OYKA 2XN0A 4KKXA 1HKMA 7A3HA 4XVDA 4MUPA 4G7EB 2VX7A 1F6PA 4S3KA 1JEZA 1S46A 1CENA 3L2LA 1AW1A 1A5BA 4LS2A 1QOPA 5HAOA 4GC3A 2BGSA 5BU9A 5A6BA 5LXEA 3LMYA 3EPMA 3DH7A 3CEPA 4AFYA 3PB0A 1BXNA 1MRQA 1ZLPA 1UJQA 3O07A 3RO8A 3U2OA 2C13A 4HNOA 5GJPA 3L2IA 2QPSA 4HA1A 1NY1A 3W2LA 1R0MA 1IGSA 1Z6KA 4E0CA 1I2PA 3EOOA 2CEQA 1HKWA 2WVSA 3ZXWA 4MWAB 4HMEA 1OHLA 4O1DA 3MSYA 5D33A 2XFWA 1UZ1A 3UYIA 4WXZA 4PB5A 4LNCA 2CZFA 1QNOA 4XZMX 3L0KA 1J9YA 4O18A 3U5YA 1I2QA 3DZ1A 2V5BA 1P48A 4HMCA 1EOMA 3IJQA 1DWIM 1X98A 3WH5A 1E71M 1H2JA 4FNPA 3EXRA 2YL9A 2GGGA 3F7JA 3PBMA 3RNDA 3RCMA 1ZS2A 2Z7GA 2YZ5A 3AYVA 3TNBA 1PKYA 1SFLA 3IUHA 1TPUA 4RX0A 1EJXC 4D6HA 1JNDA 4Y96A 3H2OA 1SO3A 5FJTA 2P10A 1KFBA 3WUEA 4ZOCA 3VNJA 1UC5A 3UPBA 1QOQA 1KXQA 1JUBA 3U4FA 2J6XA 4NZFA 4WJ8A 3OW1A 3OZMA 1VR6A 2WM0A 3I3EA 1ONWA 5A6JA 3MUY1 3GUGA 1ZFJA 2CPUA 1EF3A 4TR9A 1Z3NA 1MSSA 1XG3A 3UA4A 3WG6A 2IW0A 2C18A 2ZUNA 3ZOAA 1M7OA 3MO7A 1OFAA 3SBFA 1W5PA 4TMBA 5G4EA 4GIEA 2OX1A 4E3TA 1OADA 5D38A 4ZQCA 2DJXA 2FZ9A 4E8GA 1R9ZA 3EDJA 3ZFHA 3AYTA 5HJXA 1CXKA 3A5VA 4U4MA 4RDWA 2V38A 3IVUA 3TQPA 2R1KA 4D8AA 2GK1B 3MWAA 2O7SA 2B7NA 4YNGA 4DJFC 5D30A 2Y7DA 3S46A 4M1BA 3GU1A 4PTMA 1P43A 1GTEA 1Y7VA 4N6FA 4QLLA 2V8ZA 3PWIA 4D6JA 4E4PA 3BAYA 3LGDA 2XTKA 4XBJA 1W5MA 1GW9A 4FOUA 2PF0A 1R6WA 4PEKA 5HQEA 2VXNA 2NV2A 1US0A 1FFRA 5EY5A 4O4WA 4JTTA 3FOKA 5JIWA 3FJLA 1D7FA 1W1TA 1J2BA 1EPVA 3WFLA 3VAVA 3HIJA 5I3JA 3T0BA 1OINA 4MWAC 2OGJA 3K46A 3VKAA 2EKGA 2YL6A 4JQ3A 3I6TA 3L23A 3LHWA 4ZBCA 5H8PA 5I79A 3WF0A 2OZ3A 3G6MA 1M03A 3MP3A 1DXFA 3IANA 1A0EA 4DBWA 1UMYA 1AW5A 1E9IA 1YKWA 1UR0A 2QULA 4FP1A 3AS2A 3MSDA 4LF1A 2Z2BA 1NWRA 4ACZB 3BURA 3NQVA 1PTAA 1UH4A 1MW1A 4CQ9A 1W9VA 3W24A 1W5QA 2EG6A 4MJ2A 1X7FA 3AMCA 3B06A 3FIGA 1MQQA 1KFJA 3DFHA 2HK1A 5DEZA 1TUFA 3SN0A 1FWNA 1K3UA 3RF9A 5HR6A 1VHCA 2E8YA 2IKHA 4L4MA 3WUBA 1S5VA 2V5DA 4K39A 5HWMA 1TUXA 3H6OA 3N2BA 2FVKA 4HCLA 4YTSA 2P0IA 4C6NA 4AWEA 2J13A 2FZDA 4ZR8A 4FA3A 3ARPA 3WNLA 5DLCA 4HHPA 5GNXA 3BOFA 1V02A 4Z0JA 2QCHA 1GGOA 1O66A 3K4AA 3ITOA 4PMOA 1R3VA 2WPGA 1GT8A 4JGDA 4YHEA 4E2DA 4Y2WA 3R7MA 1RVGA 2VKZG 5FSDC 3FVDA 3R0KA 4OFCA 3GIYA 3LA4A 1E6PA 5LXXA 3MWCA 3XISA 3DFTA 3GHSA 1CX9A 1ME9A 3VIOA 2RFGA 1R30A 1M6JA 5BYWA 4O0QA 1E4NA 2R1MA 2R24A 3QMTA 1RA0A 3EMCA 3UWZA 2BX7A 1ICSA 2GL5A 3G18A 4QNWA 1Z48A 4GX9A 2PDNA 1E0XA 2A21A 1GZ1A 4TVCA 1BKSA 4YCPA 2VFGA 3KTSA 4H6EA 3WQFA 5REQA 1GVIA 3V35A 2CFFA 1RJQA 3GW3A 1DWJM 2PTYA 1FUYA 4F2BA 4S3DA 1YDNA 2JEQA 1K9TA 1OX4B 2X1IA 2H3BA 4GQ0A 1BF6A 3VGFA 4GVFA 2I5GA 4E5TA 1PE1A 1FWGC 4IIDA 2ONEA 2ZX5A 1YE4A 4S3AA 2DZXA 2EPKX 1ICPA 3WL0A 4IUOA 2GSEA 2KAUC 3HFYA 3MCOA 2ZRUA 4FLSA 3WF2A 3DIPA 3GNOA 5E9AA 4XQ6A 3GY1A 2VEMA 3LCHA 3QOMA 2WSKA 4LOCA 1MI3A 3FA5A 1JAEA 1EC7A 3AXIA 3HB9A 3GHUA 4JICA 5EMKA 4ZQMA 4JZ5A 3UNDA 4QAWA 3KM8A 2GDQA 2HPIA 3ANVA 1U1HA 2NVAA 2CERA 3NEVA 4HYWA 4MNMA 4QG6A 3T42A 3NQ7A 3ITXA 3W82A 5ECUA 1X38A 4KGLA 2CLKA 3HM7A 4QEEA 4OIFA 1S2CA 3EYPA 2FZ8A 3A6OA 1ZBCA 1U5JA 2Y8VA 3FSUA 1KM1A 5BRQA 3DYMA 4RZ6A 1V6YA 1XIHA 3B8VA 1OGSA 5I5RA 4GQRA 3SY1A 4P8WA 1UOKA 2XH7A 1RP9A 3NQCA 1FHDA 1VLIA 3N4FA 2OGYA 5FESA 1CLXA 4G6CA 3BAXA 1XYAA 3ARSA 5I3KA 2PDKA 3UVIA 1FWWA 2GJPA 3P67A 3UNTA 2UZ9A 4HOXA 4XZHA 3ZLFA 3RJYA 1AJZA 4AD2A 4Q4KA 2QJGA 1Z32X 2QR6A 6ALDA 1KR1A 2VL4A 1EEPA 1UUMA 5I77A 3CLMA 2GLKA 5AOUA 3VOJA 2GQ8A 3LCIA 4F79A 1WP6A 1POKA 2R1NA 3TC6A 1XYFA 3ZT6A 1UZDA 1NOWA 3VE7A 5BCAA 5C7VA 3UCQA 2GYIA 4AH7A 4P7NA 2INFA 3UXKA 1P6BA 2FTWA 4TQTA 1ZENA 1OK4A 2PGWA 4CEXC 5CQ1A 2AQWA 2QEZA 3FKKA 2VFDA 2PDIA 3B03A 4IQDA 4IWWA 5H8MA 4ADTA 1OBAA 1R9XA 4CUCA 4UNKA 1ISYA 3IPWA 2J8GA 3BPWA 2PGRA 1US2A 3VO0A 2PEVA 3KHDA 2ALDA 1CXHA 3VNYA 1CGTA 1FXPA 2HMCA 1UD5A 2DUXA 4YLWA 3W7GA 1PUDA 5EMUA 5G2IA 3LXAA 1NIUA 1WBHA 5TQLA 1AH3A 3L4XA 1TWWA 2NSOA 1TMQA 3CTTA 3W72A 4WJEA 3NXLA 3NPWA 2A3BA 1NARA 3L5MA 1RH9A 1L2QA 3WQ8A 2C1GA 4KETA 3B8IA 4DN1A 1UR9A 2Z4GA 1JZ4A 4UTMA 4V28A 5TF0A 4DF0A 3WLKX 1XC6A 1KV8A 1TO3A 4O57A 5F1VA 3CZLA 3MMWA 4LS1A 3AAMA 2NWRA 3BK0A 3EEGA 4ZB2A 3UG3A 4EKJA 1JYXA 4IISA 2DZTA 3FYOA 4AHOA 4F48A 3FA4A 1BKHA 5H91A 3THQA 4NKCA 3ARZA 3A47A 4NZ4A 1OFPA 5K4XA 1B3XA 1Q65A 3NQAA 4UQAA 4GC4A 3NQMA 4Q8VA 2BY1A 5DANA 2IQTA 4UOZA 3V0TA 1UA7A 3LBOA 5HQMA 1TR1A 1JZ6A 5CG7A 3R12A 4DX3A 1GPFA 1LL4A 1TREA 1N7KA 1BXBA 4FMVA 3FXYA 3KX6A 1EWDA 3GC5A 3OLGA 3PS7A 3AXKA 3STEA 1JZ3A 2X0SA 5D03A 4JEJA 3AHZA 2AL1A 1YTDA 3NQFA 4LAUA 3UFYA 2VGFA 2WHJA 2WV8A 4K3ZA 3NM1A 4O13A 1W9XA 4K8GA 1MMFA 3QEZA 1ISZA 4YYFA 2YXXA 1OABA 2Y0FA 4WQ6A 3FAXA 5CPOA 3H4WA 4DJFD 3QW4B 4WHBA 1P0DA 3GTNA 3PBYA 3FS2A 1R3TA 4FOJA 2Z29A 4POCA 4W7UA 2G3FA 1TZ7A 3LRLA 1RHCA 1C8YA 1E15A 2J77A 3F4WA 3Q2DA 1OG0A 1N2VA 4AD5A 4PTDA 2J47A 3UZ5A 1RSCA 3ONBA 4QCEA 1OX6A 2CZEA 1O5QA 2O92A 3QH2A 1ZJIA 3TMLA 4D6GA 1GVQA 3UU0A 1LOQA 1EX1A 1D3CA 2BZNA 1YXDA 1JD7A 5JXQA 3S9YA 1LP6A 1YTKA 2C8NA 4H7CA 2ZUMA 3ICJA 3PVFA 1PX8A 2HZGA 3GZ3A 1CLVA 5JMUA 1B0IA 1DP0A 3IVTA 3N19B 2VZOA 3SAZA 1J11A 2BMBA 4IICA 2ZUSA 3W4RA 3QV8A 2ZRYA 4MY1A 2C0AA 3P84A 3PG8A 3GDTA 4JTCA 2GZXA 1JXJA 2DUAA 1GKQA 2QF7A 5A8GA 4EOUA 3IJ6A 1UWAA 4JKMA 3DYPA 1Y5WA 3P61A 1DWGM 1GOOA 3Q4DA 2QJJA 4GUFA 4RKAA 5BXSA 4DZHA 4NJIA 3DXIA 4DNMA 1R8LA 5CSSA 2VWTA 3NL3A 2PDLA 2A3EA 1NF0A 3M6DA 1UD8A 1K8YA 1W1VA 4W8LA 3GKFA 2JF7A 1GZJA 4UXDA 2FLIA 4YCOA 4B5WA 1AQMA 4QR6A 3WQ6A 5C0QA 2FDSA 5AKQA 4GA8A 2DVUA 4N4QA 5HA7A 1TPH1 3VD9A 2PU0A 1OCBA 3B8DA 1EA0A 5E70A 2JKAA 5G1YA 2H3DA 2WVVB 3QBUA 4F40A 1U1UA 4OVXA 2BHUA 4ZEPA 3WEOA 2VP8A 2CZ5A 1E5NA 3AICA 5TBOA 3B4UA 3A22A 4N02A 4MPQA 1XX1A 4QEHA 2C7FA 4C60A 3MS8A 3UXDA 4GCAA 1ONEA 4X60A 3WEMA 5IOBA 2XUCA 1SJCA 1WXYA 3EA3A 3HN3A 2W91A 2QUTA 5CPLA 4IZGA 3T40A 2Y7GA 4YVXA 2OR2A 3M1ZA 1AL7A 4RE2A 3TJXA 2ICSA 2PODA 2W3ZA 1NVMA 5CAHA 1UQZA 4MMWA 3T0DA 3AUJA 4LF2A 1VBJA 3EEZA 1HJXA 2ZDRA 4BZYA 1EWEA 4JHOA 1JCJA 1AUSL 3W86A 4HU4A 3SY8A 1TPB1 5A8MA 2J7HA 1YXYA 3W25A 1E1CB 3GVVA 2YDAA 3CEUA 3W07A 3NA8A 3WDHA 3GVRA 3OA3A 5AVHA 2PDFA 1OEPA 1IT0A 4PUUA 3GTIA 2J6VA 4KEVA 5D9PA 2F8QA 1VFUA 5J5DA 3S1XA 4HJWA 4B3KA 4M81A 4JQ4A 3VKCA 3PC0A 2FVMA 1HT6A 1EJSC 1QHPA 4C7DA 1XLKA 4IXHA 2XZ7A 2BWGA 4UR7A 4HN8A 4ACYA 1UWUA 4S2CA 2E0PA 2TODA 4JTJA 1A3HA 4OE7A 3A12A 4DJDC 1KCZA 3QYQA 1NWSA 4ZMGA 1TRIA 3NVTA 2A3LA 3N25A 3TA6A 4PYSA 3N9KA 4AEEA 1BXCA 3VX1A 4DLFA 5BOFA 8XIAA 1G4TA 2Y7FA 2WNQA 2JALA 3IUIA 2XN2A 3SGGA 5EA9A 3GNRA 3IJLA 5HWJA 4DJDA 4LU0A 3F5KA 2F2HA 1KFLA 3TJ4A 2J74A 3ZT5A 3RM4A 5JBFA 4DWSB 3FDGA 4JFVA 3RLUA 1TV4A 2HNEA 3II1A 1ITQA 2V5CA 2WO5A 2YCKX 1H7WA 3RN6A 1TV2A 2HS8A 1AMYA 4HNUA 1DOSA 4LRTA 3I7RA 4NASA 1EKOA 2TRSA 1XLIA 2VHLA 5HJYA 4ML4A 1H61A 1FWRA 4HT3A 5BROA 5H6HA 3ALGA 3AQUA 3LYEA 5E0FA 3I6EA 1ZNNA 4GI8A 5KZDA 5DCEA 1TB3A 4MY8A 4QE4A 1UD3A 6CGTA 3I10A 1MDLA 4X2PA 4DELA 3E6EA 3I65A 3PG9A 4W88A 5AYIA 3LMZA 4Q7IA 3BW2A 4MFDA 1XLCA 4GCXA 2ZVIA 2DDXA 4B9ZA 1TMHA 4Q7NA 1JDCA 3WNOA 3ISIX 3CNYA 1QW8A 2BXVA 3NO5A 1W1IE 3MHGA 4YS1A 2CLOA 4H3DA 5HUOA 2QS8A 3W28A 4ES4A 3VOCA 1SPQA 3LHYA 1W1YA 2WWCA 4O1AA 2GUBA 4H6RA 1J5SA 1XCWA 1UBSA 2OU4A 2HK0A 1LROA 5LNUA 1Q6LA 3WNKA 3EOLA 2DT2A 4B2DD 2H8XA 1XICA 3SQSA 5DO8A 2D0FA 3QHOA 2X09A 1QR7A 1KTNA 4J9JA 3TROA 2BVTA 4D1IA 3CPGA 5CZ0A 3FLUA 4URIA 4LX4A 4R7OA 2WMIB 2YBUA 3GHRA 3HG2A 3OU8A 4Z0SA 3W76A 2PMQA 1EB3A 3C3NA 2P3EA 1JQXA 2V69A 3N12A 1DJHA 3TQVA 3UCCA 1EYEA 3UXLA 1VHNA 1A50A 1DQWA 1UR2A 5FF2A 3VM5A 3H22A 2ZWYA 2GDVA 4E2OA 3PPCA 3M5VA 3NJ3A 4TX8A 4JCLA 2JE8A 3NZGA 5HINA 4DWDA 4EWJA 4M6UA 4YVPA 3FA3A 2CC0A 2VVNA 4AZGA 1WDRA 4LVBA 4KWWA 3V18A 2GGJA 1W32A 3Q37A 3A9BA 3CH0A 1SO4A 3WDIA 2J4GA 1GEQA 1JDAA 1HKIA 1Z7AA 1J5TA 1I8JA 4MG4A 3RPMA 3UESA 3GX9A 1B90A 1PPIA 3W7IA 2XM2A 1AH4A 2IMRA 4JFUA 5T26A 2DSUA 3OHIA 1W56A 2J25A 1XDMA 5JBDA 1W2VA 2JGQA 1O68A 4QHRA 3UEQA 2H6RA 1BAGA 1UHVA 4NP7A 2VR2A 1CBGA 4PN2A 1WAWA 3QLDA 7ODCA 2VFEA 1DKWA 2CXEA 3UG8A 2PTXA 2QVHA 5K9XA 3S1UA 2WHLA 3WJXA 2OWXA 2CBUA 2YCLA 3OQEA 3HU7A 1WDWA 2GK1A 3I4EA 2C15A 4FEZA 1CGUA 4C6LA 1TVPA 1PXGA 1CEOA 1W3NA 3LBMA 3C2RA 1DE5A 3SY5A 5HPCA 3FFSA 4UUIA 3DENA 4UZUA 1OT1A 1BQCA 1XLLA 3BQ5A 3GVWA 3WDJA 4C6PA 1F3EA 3GKAA 2XH2A 3THUA 4L80A 2GQAA 3TFXA 4NZJA 3NO3A 2FZNA 4JDBA 3CMGA 3IV3A 1OCJA 1YW1A 3CUFA 4N9BA 1G69A 2DUZA 1SO6A 4ZFCA 1WKFA 1BVNP 1XFBA 5K3VA 3BLDA 4JHMA 1W5OA 3MB9A 3RU8X 4MUZA 3ATYA 3CUJA 5TD4A 3TW6A 3CIXA 1E4MM 1F4HA 3OVRA 4ZGYA 1GHSA 2FB2A 1E9ZB 4DO5A 3K30A 2A3CA 4MKVA 4PC8A 4UBPC 4AD4A 4RXFA 4J28A 3AS1A 3WK3A 1F6YA 1H3GA 3ABZA 3W85A 2PLCA 1L2UA 4GOAA 4GJJA 4PMXA 5LNRA 1K9EA 4K36A 1XD0A 2WCAA 3W75A 2Y6ZA 3L65A 4J40A 1F6KA 4PCFA 1IEQA 1YHTA 4Z2JA 1V3IA 2XIJA 1UIPA 3L66A 4M80A 4P8XA 3EBVA 3ITTA 5KSWA 4AF0A 2WSPA 3ZLHA 5HMEA 4JY8A 2QJHA 1QPRA 3AHTA 2XWDA 5LIUX 2J7CA 4JTRA 3LSBA 2HPMA 4YMZA 3W7EA 1OCNA 1UB3A 2D73A 3VUSA 1JCLA 5E6ZA 3JZEA 5F2IA 3BCFA 3I3DA 1GCYA 3R2GA 5E1QA 4FR6A 4B5UA 4HA0A 5A6MA 3MUZ1 4NI8A 3A3XA 2Z1BA 1BWVA 2VEKA 1L8NA 4HK7A 4NYUA 1GQLA 1TV7A 3KE0A 3BDKA 3HMCA 2DEPA 5HOSA 1O5RA 3P5YA 1V0NA 4CQ8A 3AU6A 3IGXA 4QE5A 3A24A 4OBRA 4F2TA 3WDRA 4PEEA 3W7JA 3CHVA 1QWKA 3QSRA 2XIIA 4GACA 3VIHA 4DVOA 1R46A 2AQOA 4AMAA 4ML9A 3KAOA 1X1NA 3ZWSA 4JX4A 3LUTA 2GSHA 2G37A 3T6CA 3ZYZA 4DIAA 4HZ6A 4PMZA 1PKMA 3EMZA 2PDQA 3NIYA 1SW3A 2W63A 3WJYA 1V3KA 3BV4A 1V6TA 2P50A 2WSQA 4W84A 5AHFA 3TYBA 3SCRA 2FVLA 1AVAA 5PTDA 3Q58A 2XDFA 4CEUC 3TW7A 1E6NA 3VMOA 4Z2LA 1ZUAX 4J2PA 5A2AA 1GG1A 4G9PA 1N8FA 1XDJA 3VINA 3AYRA 2XIBA 1WAUA 1M04A 4N6EA 4AZIA 2AAAA 3CL6A 5J8LA 4KH2A 4OT7A 2XYLA 1SGJA 3S1WA 5MKGA 3PUDA 4WKAA 4QGCA 2ANUA 5FKYA 3DI1A 3WMLA 4E3VA 2VWSA 3LNPA 3UPMA 1H7RA 3ES8A 5CZSA 3U5UA 4CQAA 2E7FA 2BY0A 2WC7A 3KVJA 2ZADA 3C86A 4LYKA 3LERA 3THDA 4K1WA 1S5NA 3GNNA 1PWLA 3T78A 3IGSA 4QSHA 3M07A 2VD8A 2JIEA 2PTDA 4U31A 3PZUA 3CH9A 3RR4A 3GSMA 3HPSA 4FSAA 3AALA 4XZ9A 4C90A 1JUKA 1EPXA 3UW6A 3EA1A 1X1OA 2B0MA 1RUSA 4QLJA 1TVLA 4R88A 2QCNA 3SN1A 4NNAA 4O54A 1YRRA 1TPFA 4W85A 4NAEB 1RV8A 1EIBA 2XVGA 4NRRA 3G5EA 3VIPA 2B31A 1KXHA 2QMKA 4J2MA 4JIQA 2CKRA 3OLIA 2XWEA 5ABTA 1D9EA 5C8BB 4RW5A 3ITCA 1FH9A 3W7KA 1EHNA 1RCOB 1TQJA 3NWRA 4P5UA 2W27A 1POJA 1B3YA 1FDZA 4J5NA 4RLIA 4R53A 3A4JA 1DXEA 1SQ7A 2J7FA 4MB5A 3GAKA 3W7QA 3S1VA 1Q3NA 1MNSA 2BB0A 4L1XA 4ENLA 1Z69A 1US3A 4O50A 3W7CA 3W7RA 1AK5A 4HYVA 2CCRA 1GQIA 2BHZA 2QUUA 4IGNA 2ZXAA 5HNUA 2DZAA 2C16A 4M0XA 4NZCA 1T41A 3WQWA 4G7FA 3CL8A 1XH2A 4AW7A 3F4CA 2ZX9A 3PZOA 1G1YA 1RQEA 4PE8A 1QHOA 2C91A 1SU5A 1XV8A 2OQHA 1WKDA 4AIBA 4U2YA 1Q7MA 4Q22A 3REQA 4S3CA 3NZ1A 5JH1A 3UPWA 2DT1A 4LW7A 4PSPA 1E40A 1TCDA 4EPBC 3B9NA 4NF7A 4RZBA 3BOLA 3N15A 4DNHA 1S39A 2VTFA 3WL1A 1M3UA 3VC5A 3MUAA 4NUWA 1IXQA 5K4ZA 1GYLA 5A8PA 5T9BG 4GZEA 4X22A 4M1RA 5AECA 5CH9A 1VYRA 4OBTA 2OQLA 3OLDA 3M0LA 3GUWA 3W1AA 4GQGA 5I09A 5GPRA 3RX3A 2DSVA 3SCVA 1RCXB 4JFSA 2OLHA 5LA2A 2HVMA 2GGIA 1S1RA 5I03A 2JBMA 1Y0EA 1XUUA 4ALDA 2IPFA 1FTXA 4R34A 3UJ2A 3LK6A 4IX2A 2X1RA 1E1EA 1EO5A 2FGBA 1TE1A 2FH6A 3SUVA 1SJAA 3RCYA 3HURA 2NQJA 3PJWA 4KF1A 1KXVA 3VGEA 3K5XA 3VVGA 1Q6GA 3CUXA 1MYRA 3GXPA 4WVXA 1B4KA 4TVUA 4WJXA 2ACUA 5AY7A 3GHTA 3SCQA 3VIGA 3FJ6A 2EJ1A 4BQ4A 1GQKA 2ON3A 2E8ZA 1PHQA 3CUHA 4R3UA 4X9YA 3R11A 3LRMA 2RGMA 3TTOA 4LXFA 1W5NA 4NJJA 1PIGA 2OT1A 2CNCA 4PMRA 3UVAA 1V6WA 2O4MA 4ZENA 1UPPA 3PPHA 5CKSA 1IF2A 4DQWA 3W84A 4H19A 5F2GA 3WF4A 3S5NA 5I2UA 3A13A 5H8UA 4HSOA 4NYYA 4JEQA 3G6LA 4AAJA 1BSIA 3LHTA 3NZRA 3HG3A 4IJCA 1Z41A 1IIHA 2J9ZA 5ABFB 4LPCA 4HNTA 3VIJA 3A23A 3Q45A 3ARRA 3UJSA 3CLWA 3G1DA 2Y8UA 5A2CA 1ALDA 3C4UA 4EE9A 1SYTA 3ARQA 3P6LA 3UR2A 4US5D 4DJFA 3LCLA 3APGA 2OZ8A 2I14A 1OC7A 3DI0A 4OTKA 1KRCC 1THFD 3GG7A 3S6DA 3O6DA 4H9UA 2WW5A 1HKJA 3UQNA 5CPTA 2Z24A 5FA5A 2GDUA 2DIKA 3G24A 4MNJA 1Q6FA 1QBAA 1AD4A 3WH8A 3AS0A 3C2OA 1PV8A 4L4PA 1XYMA 1XIFA 4GK8A 1HL8A 4ONVA 3P93A 3W71A 5F1UA 1DPMA 3BG5A 2BASA 1P7TB 3WBXA 3AIRA 1A80A 5JU6A 2YLAA 3KBJA 1UYQA 1ZAHA 3OVQA 3TTEA 4BR1A 3ZLGA 4GRSA 4LUYA 4MJMA 3I7SA 4C5ZA 5M2FX 3PNUA 4KWVA 2NV1A 3NEHA 1I2OA 2V2HA 5KETA 3VILA 1UKPA 2A7NA 3KCOA 1IEWA 4LAMA 5BU6A 3VCRA 2V3FA 3OZPA 4EPKA 2EGZA 2GJRA 4LH8A 4QITA 5MHBA 1V6VA 1WZAA 1MZHA 1WO2A 3E5BA 2QCLA 3E02A 4MHBA 1HG3A 2ATMA 1XLBA 2W62A 1G9HA 4B92A 1QPKA 4M6PA 2E1DA 2PA6A 4ATLA 3TOPA 4D8ZA 3C2FA 3QHMA 4S1FA 2GUUA 4N4PA 1CWYA 1W3IA 3R0UA 4CU8A 4AUBA 3SUTA 2VJXA 4QX4A 4WK9A 3BAJA 4C6JA 3WY1A 3TJLA 3NYDA 3DFOA 1PHWA 5D2VA 2Q01A 3K13A 1L9WA 3C5QA 2VURA 3EWXA 1R9YA 1VH7A 3VFCA 1ENUA 5KZEA 1ODZA 3VNMA 3RPDA 4BQ3A 2WK2A 3VI2A 5C2GA 3T0AA 2BODX 4H6QA 4MB4A 3MDUA 1P6WA 2AMGA 3LCGA 2FJUB 1LBMA 2X16A 5HDRA 2DZVA 2W67A 4JNZA 2ZUWA 2VGGA 1X6NA 2JKEA 3WMBA 3TXZA 1BRLB 1V08A 5CLTA 2YR1A 2WPBA 4LFYA 2WQPA 2WLZA 3VZXA 3HFTA 4CU6A 1YYAA 1GOXA 3LEPA 1DIEA 2VQTA 4DF2A 2OEKA 1CZ1A 4GO9A 4IOTA 1FY6A 2DW7A 4EK7A 4CLMA 4Z1YA 1FWJC 1W31A 3WQPA 3OG3A 1BVZA 4IQJA 1UW9A 1H51A 2BNJA 2CHNA 4Q4QA 4J3XA 3QQWA 1H0IA 5KMYA 4O14A 4KWUA 3SFWA 1QNVA 2WZHA 3OHMB 3GU9A 3MVTA 4NSBA 3PBVA 2WZTA 2WJZA 1C90A 3ELFA 4HMDA 4PUWA 3MKCA 2OO6A 4FNRA 2BV9A 2P3ZA 1C91A 1VGAA 4ZA0A 4BQ5A 1UP3A 1EP3A 3SCPA 4F0HA 4DYJA 1PX3A 1Q8AA 4HK5A 3MPGA 3D6NA 5DT7A 4JTGA 4JBRA 1S2VA 5C7HA 4PUEA 4C6IA 1XD1A 1OQFA 1PX4A 3NFUA 4QXIA 3BANA 5F7UA 4U5IA 4JKKA 3NQBA 3GQYA 4DUOA 4FO4A 3EA2A 4RUBA 3TCSA 1G6CA 2QAPA 2ZA3A 2PTWA 5HATA 1TR9A 3K1GA 4V15A 3PZVA 2W5FA 3TYCA 4CCZA 3AHYA 3M7WA 3C2VA 1KM3A 2ZZ7A 4WKHA 2YA0A 3CPUA 3UR5A 3RK8A 4JTFA 3NQDA 4QAIA 4ZSUA 2FFIA 3L4WA 1RJRA 3MDWA 4TV6A 4HU0A 4KEZA 4M5PA 1KCXA 3P14A 3C3UA 4GG9A 2WJFA 2R6OA 1OYBA 3LBCA 3A4WA 4DBSA 2FPVA 4YL2A 1RLDA 5M5DA 2NLIA 4IM4A 4MIMA 3VK5A 4Q33A 3UD6A 1K6AA 3UXIA 5IBXC 1OFRA 5B80A 1QVBA 1KQYA 1TA3B 1FCUA 4A8RA 3PPGA 3DU0A 3BQ6A 4O10A 3M43A 2XU2A 4QDPA 1YBQB 1FWSA 4LCRA 4UQEA 4A2SA 2DGAA 3DGRA 3M7SA 3L12A 3UETA 2WBKA 1X96A 5DMNA 3CT2A 3DGBA 5FJJA 3B9DA 2WQDA 1GOQA 4FAMA 4GYFA 4PB4A 3BLPX 4PR4A 4XKMA 2PU1A 3B0YA 2NX1A 3N1AA 4AIOA 1E6ZA 1WKYA 4J27A 3T8LA 1W2PA 5JQ9A 3E0IA 3HOJA 3AUOA 1GVFA 3LI0A 1K02A 1V0KA 5DT5A 2VZTA 3W00A 3AXMA 3W26A 1BFNA 4IMAA 3T0TA 2NWSA 4HPNA 3VGGA 3ZJ7A 5M1TA 2PLMA 3QR3A 1HW6A 3UT0A 1NF7A 1UR4A 3V5CA 2XSAA 4ZB0A 4M51A 2VZUA 2FPYA 1YPFA 4CN4A 1P4CA 2ZZ2A 3D3FA 3EX4A 3AI0A 1B9BA 2HDJA 1F3XA 2OT0A 2PWGA 3DERA 1TV5A 1GVOA 4RE3A 4WSJA 4KT2A 3W7LA 1XCFA 1KKRA 3VUPA 3EB2A 4NL1A 2VC7A 2VEGA 1ZJAA 2DZPA 4MWAD 4JTSA 2PC8A 1V7AA 2AAMA 2FHCA 4ERIA 4UMBA 4ZOAA 1SFSA 1LORA 3EXSA 1ISVA 3HPXA 1SVDA 3GW0A 2E6FA 1AQ0A 6TAAA 3CQKA 2BGNE 1F8MA 4Y9MA 1ECQA 3AMDA 5G1TA 1J0HA 3V1HA 3TSDA 1XSJA 1KXTA 4V1XA 4BEUA 5LIYX 3Q65A 4HPGA 1LT7A 1DXIA 3SCWA 1C3FA 7CGTA 4FOKA 1KR0A 2E5CA 3KBNA 3QPYA 3RMEA 1T7LA 2FTPA 1XRVA 3WH7A 4KIRA 3IUDA 3ABXA 5C71A 4IIBA 3WFZA 3MJYA 4LAOA 2WCSA 4HNVA 4WLCA 1UR3M 2RJGA 4MGGA 5D2YA 3V5FA 3UCDA 3M0ZA 4OWGA 5FF3A 2CETA 3ATZA 3UBPC 3LHUA 4PZVA 1FH8A 5AYYA 2HSAA 5BXPA 1TJ2A 3ZJ8A 3OPSA 3P62A 2J24A 4NX5A 3U2EA 4JN7A 4ZTYA 4J3SA 1GHRA 2BY2A 4CCCA 2XIMA 3MCNA 5CBJA 3PZGA 4W8BA 3SM0A 4AX6A 2OQYA 2VCBA 4AWSA 3HQ1A 1RY0A 3VPLA 3ZVIA 3W1PA 1A5CA 2PDMA 3D5HA 3SADA 1V77A 4O1EA 1DTUA 2HVNA 5A6TC 2ODOA 1AQHA 1FWBC 5E09A 4GI9A 3T44A 4YJ5A 3IV8A 1ZQ5A 2YDQA 3GIQA 4ZODA 2P1FA 3B9AA 4GE8A 4LEQA 4D9PA 3DAQA 4WUIA 2VMFA 1H11A 1EUNA 1TTIA 3G1HA 3AIQA 4Z2KA 1JJKA 4DY1A 4O12A 1G67A 3IVSA 1Q6RA 4MVAA 4C1NB 1QI4A 1EUAA 3STGA 1B5TA 3W1XA 3FCPA 1DV7A 3NAVA 4C65A 4WR3A 1LWJA 4BJHA 2WM1A 1KCKA 4NU7A 4R9OA 3ITGA 3UZXA 2G3NA 4IP5A 4BY3A 2AL2A 3UZYA 4GZJA 3AOFA 3L5AA 1QNQA 3KCJA 5EFFA 3JZUA 3BGGA 2C14A 1L6FA 1P0KA 4HPXA 4XVEA 2X2YA 2E77A 4UFJA 4KCTA 2Z7KA 3SIMA 1UC4A 1Q8JA 3C2YA 4GUGA 3BSGA 4KCVA 2O4QA 2E5DA 3VMNA 2PB1A 3K1DA 2XVPA 1NQKA 3HV9A 3QMRA 3S9IA 3QHNA 1VIZA 1KWKA 1DJWA 4LV9A 3O8AA 2A2IA 1S38A 1J0KA 1K4GA 4DM2A 3EPOA 3D46A 3TONA 1V6XA 4EANA 3GIPA 2PLKA 2OXNA 3W7PA 4CNPA 2ZZ5A 1X8CA 4M82A 1E3ZA 2AQVA 4R7WA 1SZNA 2RUSA 5FOOA 1WXZA 2PCEA 5CBBA 3ZVHB 3TYEA 1HL2A 1K8XA 1XIBA 4DPPA 1REQB 1XGEA 3UZZA 2IKIA 2XVKA 1K7EA 1W3KA 4L6DA 4H7VA 1OX4A 3SO7A 5A5WA 1QK2A 2QJNA 1WV2A 1H5YA 4HU8A 4UFLA 4ZOEA 4BS0A 3GTFA 4WY0A 4BI5A 1R7AA 5G4WA 1IIGA 3IJDA 4DLMA 3BLLA 3WLHA 3C0JA 1CGVA 1CB7B 4F3HA 5DF0A 1CDGA 1HUVA 2QHAA 1MUCA 1VRDA 2D0GA 3AWOA 4LBRA 2TMDA 4GIYA 4RXGA 1E1CA 2TPSA 4Q8NA 1OZMA 4UFIA 4I9JA 1BWLA 4ZZ9A 2YOCA 1YXCA 4B90A 1UJPA 2QUMA 3C52A 1J10A 5M17A 2Y5SA 1XDLA 4GXWA 4O1CA 3EXTA 1AJ0A 3QLLA 2ZUVA 5ABGA 4EF8A 4PCNA 5E6YA 1JRCA 3KOZA 2QCCA 1QHZA 3BL3A 3H23A 5SWUA 1KQZA 5JBEA 1B31A 3URNA 2DH3A 1MW0A 3W1TA 1A53A 5M03A 3VABA 3N11A 3AZRA 3FYYA 3VA8A 1LRTA 1S5WA 3BUVA 3GDBA 3QY7A 2WMJA 5HQLA 4UTFA 5H2ZA 1KA9F 5FJRA 4JYDA 1HTIA 2C6QA 1E4IA 4OOZA 3GFZA 5DXYA 4DJEA 1JCXA 1CLKA 5T91A 4KQNA 2EJAA 3AJXA 1I45A 2VNCA 4XZBA 3OEXA 4RNJA 2Y63A 4FX8A 4PCSA 3RDKA 4LC6A 4UR9A 4A8IA 1V0LA 2EPOA 2CU0A 4ZXLA 2QDHA 2PD9A 1NOFA 1IZJA 3CZ8A 5JVLA 3LZ3A 1JDEA 2F2KA 4KESA 2E1WA 4PRRA 3GM8A 3BAIA 3QY6A 3P81A 3CAWA 4CNSA 4ADSA 6A3HA 3W6MA 2QCFA 2ZICA 4K38A 3HGOA 1IWBA 4KRUA 2Q6ZA 1JGIA 4UTTA 3IS4A 3UJRA 2ZZ4A 4B5NA 1E73M 3G0SA 4LVDA 4XUYA 4PMQA 1OFDA 3P3BA 4OBSA 1UROA 1MVYA 3S2CA 2VEIA 3M16A 1AD1A 1JPDX 2REQA 3HQPA 3QQ0A 4Z08A 2J78A 3DHFA 3WN6A 4HCHA 3D47A 2VI0A 5FF7A 3ABQA 4LS0A 4H8HA 5C9UA 1VEPA 3WMSA 3VD3A 4DO4A 1RK6A 3M0KA 2VC5A 2ISFA 4JHZA 1SR0A 4JN6A 4RPPA 1XP3A 1VJZA 5CSYA 1ZCOA 2GOUA 3H26A 4JFWA 4FF5A 2J79A 4IIGA 3HBLA 1TELA 2CLPA 1V3LA 1XIGA 3T0CA 1GYNA 3V7PA 1F7BA 4O1BA 3N2OA 4EXBA 2XH0A 3CV7A 5DFAA 1BG9A 4GD0A 3NGJA 1W9BM 4QRNA 5AVNA 1VAHA 3KOWA 3GDRA 3WUFA 4DBEA 1VBUA 1A3WA 4N0RA 1J93A 1ELSA 4U28A 1JG9A 1ME7A 4Q8OA 3HF3A 4W86A 2XFRA 2VZSA 1M01A 2ABAA 4GWEA 1WBJA 3BAWA 5LA0A 3OGSA 1J01A 2W79A 4Q7BA 3LPOA 1K9FA 2YXOA 3W1RA 3USBA 1QCWA 4C6EA 3T8QA 2GVJA 4ZE4A 3WK1A 1BEUA 4GI6A 3PNZA 1QI5A 1OX5A 1LG2A 3WH9A 2Z1XA 1Q2SA 3MO4A 4C7GA 1EGVA 1JYVA 3E0LA 4HJFA 1OGGA 1QK0A 4AQLA 3NYZA 3CUGA 4W89A 3N17A 2GFTA 4LVAA 2ACSA 3P2VA 3W53A 3IJ9A 2OB3A 2V3GA 3IK4A 4HTBA 1IXNA 4PBFA 1FP9A 2QDEA 2OFJA 1O4UA 3QQ1A 4M6QA 4XO7A 4GZ7A 2G95A 8XIMA 4TO8A 2EXOA 1WE5A 4ERGA 3U2ZA 1LQ0A 3GTHA 2Z00A 4AIUA 1SO5A 1F3TA 3IJ8A 4IF2A 1V51A 3POCA 5AHIA 2V5LA 2YB4A 1VJIA 1O7AA 3FX4A 4Q8TA 3W2UA 3DN5A 2NLYA 3FKRA 2OYMA 3IACA 4Y6GA 4G1KA 5BW6A 4Z17A 3KZPA 1C29A 3SGUA 2PDBA 2VCAA 3TSMA 3V36A 3T7VA 4W87A 2VO5A 4IIEA 3P60A 2BP1A 3ALFA 1IT8A 3E49A 5D02A 1P6CA 1R3RA 1FWCC 4OGZA 2AOSA 3GE7A 4PMVA 3HZ3A 1BSLA 3IJ7A 2ZRVA 4DXKA 3WZ0E 2ZRZA 3RR1A 3DG7A 2QXWA 1RQHA 3UWQA 1KTCA 3CXOA 3WQCA 3QSTA 1KM2A 4XAYA 1UBPC 3THCA 1E51A 1ZJBA 5CPNA 3SCTA 4B9YA 3RO6A 1ZU8A 3TCEA 3CQ0A 4XAZA 1MZRA 4DAFA 4DBDA 4XSLA 3B97A 2HE8A 1MFVA 3TQ0A 1AJ2A 1RJPA 4Z2IA 2HJPA 4ZE5A 4WX2A 3OG2A 1A0CA 4ICMA 1CW2A 1DORA 5D9MA 1YDVA 3DC8A 2J8FA 3G8RA 4AY8A 2PDYA 3B4YA 2EPLX 3AC0A 1K8ZA 3JUGA 1HZYA 3SUSA 1UUQA 2HXUA 4KRTA 3GRIA 4A21A 4DUVA 4BK9A 4GNJA 4IT1A 1EF2A 3LNMA 4JY9A 2DFAA 3K8MA 1V93A 3E5PA 2GWNA 1LL6A 5A6AA 4FX7A 4PTXA 2HBXA 2Y2WA 1QASA 1NDVA 5ABHA 4MYXA 2GPTA 2Y70A 1WNOA 5AHNA 4D6FA 1FH7A 2F61A 1HNYA 4S3JA 2PWFA 4E38A 3WD1A 1EH9A 1Q63A 1PCKA 2RDXA 1WUEA 3W0KA 4U3AA 1Q2RA 5H1WA 1S1PA 3CB8A 3QR0A 1XYLA 3H2FA 2Y1HA 2XH4A 3QJAA 2I7GA 3RITA 4UTJA 1RZMA 4P8VA 4HKPA 2EPHA 1AL8A 4PRWA 3ZR6A 1PKNA 2E6YA 3EKLA 4UQCA 1XIJA 2PE4A 4QJ5B 3F2CA 2NT1A 4PUMA 5D04C 4CNUA 3N6QA 4L1GA 3ZJKA 1TWZA 1CPUA 1BGGA 3MYOA 4JTKA 1JFXA 1IR1A 4N9DA 5EMMA 2BOGX 1H7OA 4MF4A 1OCQA 2YW4A 3NPUA 1XBYA 3MC5A 5C55A 2AGKA 1JF6A 4TU1A 4UOQA 1AW2A 1I75A 4GGBA 5HANA 2BFGA 4QFUA 4M8UA 5FCZA 3M0JA 4O4VA 4YN5A 3U7VA 2V82A 3U9IA 3EWUA 2J88A 4LRSA 1VBRA 3SB0A 2VZVA 3MP4A 1GPWA 2ISSA 4NNCA 4ZFMA 3TK7A 3FHAA 4UB9A 3DEQA 2D69A 4JTDA 2ZTKA 1TJPA 3G77A 4ZB5A 5G1MA 1EQPA 1HVQA 1UWQA 3E0VA 1XYZA 3Q67A 1CGXA 1ZZMA 3ZVHA 1KW1A 1TWIA 2W0UA 5HULA 2HEJA 3RYSA 3F4VA 1NH6A 1EBHA 4DO7A 9CGTA 3IRDA 4M29A 3U8GA 1LJYA 1FKWA 2WZEA 3O6YX 4S39A 1P5BA 2QV4A 3VKDA 3PSWA 4ICCX 3ZSSA 2QQ6A 4MOZA 4L64A 1D8CA 3HPFA 1FHUA 2ADAA 1YEYA 3LQLA 4J35A 2BG5A 1IQ8A 5AFDA 3EOSA 3DFNA 3XINA 3WLNA 1K77A 3CAKA 3OLEA 3H12A 2O56A 3PZMA 4K68A 2JQXA 4JS3A 1AG1O 1CTNA 3EX1A 2G97A 4DF1A 2XZ9A 2X8RA 3JW7A 2NX3A 3MJMA 4Q8QA 4ZQPA 1TJRA 3OBAA 2MUCA 4RNFA 2VDHA 3KS5A 1FDYA 2Q3RA 1SZGA 3TP4A 3FGCA 4C6BA 3NQGA 4IPIA 4OZOA 4AISA 2D2OA 3LRKA 2MNRA 3OIHA 4LVGA 1QTWA 2WKGA 4LUTA 3NG3A 4U33A 3NSXA 1EEXA 3TVAA 2AL2B 1I2RA 4WGXA 2DV0A 2OOFA 1EC8A 5DBUA 3N2TA 2OSWA 3T4CA 3IIPA 4HZ8A 4I5RA 4H9XA 2O9PA 3CPRA 3TYAA 3I6RA 1Q45A 4C1LA 3HQNA 2I17A 1XBVA 3AMKA 3M41A 4H9YA 5CBIA 2Q8LA 3WD3A 3A9IA 3N18A 3W1NA 3MYPA 2OWWA 1XQLA 3VD5A 1JZ2A 5A6SA 1PZ0A 2AKZA 1LLZA 1HP5A 3QKEA 4KBXA 3KVMA 4RL3A 2UBPC 4RNHA 4IP4A 4PBGA 2F84A 3UZJA 1N8WA 3BARA 1YNQA 1GJWA 5BMXA 3TUUA 3H24A 4GI4A 5J5RA 3B8UA 1TYGA 3U7BA 3WLIA 4AEFA 3QTGA 3ARWA 2FB3A 1EO7A 3F2BA 3P8IA 1WPCA 1XM3A 2VT0A 7REQA 2PGFA 2YCJA 1JI2A 4LCQA 4RE4A 4HSHA 4ZO8A 1XLGA 5IFPA 3A21A 2QZRA 3SCNA 1JYNA 1RD5A 5C9XA 1BTCA 3QW3A<