3CTLA

Crystal structure of d-allulose 6-phosphate 3-epimerase from escherichia coli k12 complexed with d-glucitol 6-phosphate and magnesium
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
219
structure length
219
Chain Sequence
MKISPSLMCMDLLKFKEQIEFIDSHADYFHIDIMDGHFVPNLTLSPFFVSQVKKLATKPLDCHLMVTRPQDYIAQLARAGADFITLHPETINGQAFRLIDEIRRHDMKVGLILNPETPVEAMKYYIHKADKITVMTVDPGFAGQPFIPEMLDKLAELKAWREREGLEYEIEVDGSCNQATYEKLMAAGADVFIVGTSGLFNHAENIDEAWRIMTAQILA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords D-allulose-6-phosphate 3-epimerase
publication title Structural basis for substrate specificity in phosphate binding (beta/alpha)8-barrels: D-allulose 6-phosphate 3-epimerase from Escherichia coli K-12.
pubmed doi rcsb
source organism Escherichia coli
total genus 72
structure length 219
sequence length 219
chains with identical sequence B, C, D, E, F
ec nomenclature ec 5.1.3.-:
pdb deposition date 2008-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ctlA00
4N6EA 1W8SA 1VYRA 4DEFA 1XBZA 3GLCA 4HPJA 4GJ1A 1JJKA 4UR8A 5TQLA 3HGJA 2VENA 1S5WA 4BR1A 4MZYA 3UNDA 1FDYA 2AQWA 2PC4A 1H50A 4TX9A 3TC7A 1WBHA 3DFTA 4OV9A 3W83A 3QC3A 2QJHA 1VRDA 1H5YA 3W7HA 4ML9A 2G97A 1H7XA 1GVQA 1XM3A 5CPNA 4AAJA 1LRQA 4YMZA 5DY2A 2NX1A 4RV8A 1QOQA 2J9YA 1I2RA 4NVTA 2X16A 1FQ0A 3FS2A 3T7VA 2H90A 1FWSA 2QUTA 2Y61A 5LNRA 3LXCA 2QAFA 4MZ1A 2EAWA 4CNOA 4RXGA 1W5QA 3GKFA 3N9SA 3R89A 3HG5A 1R2RA 3TQVA 2NUYA 3W2NA 3KVMA 3MMTA 1W5MA 1DOSA 3UWWA 2A7RA 5LSMA 1M7OA 4Y96A 4M5PA 1R47A 3LCHA 1TPFA 1F76A 3TQ0A 1SZFA 3OBKA 3TH6A 2V9DA 2D73A 2Y88A 3O05A 3HGSA 3SECA 3PUEA 3LLFA 3S1XA 1EP3A 1KBJA 1SQ7A 3NVTA 1FWTA 3G22A 1TTPA 4K36A 3SY5A 1A5SA 5D04C 5G1TA 5IBXA 4O12A 2ZRZA 4DPPA 1F5ZA 2WNQA 4EVZA 3W2UA 5KZDA 2BLEA 5CGQA 3W86A 3HMJG 1QFEA 1VJIA 1ZAIA 3LTYA 5AYYA 3UZ5A 2OT1A 3K30A 3W88A 3L5MA 1ZHAA 2C13A 2YPIA 3EWXA 3A23A 4JYEA 3C56A 4NZFA 3NL6A 4GUJA 4QSHA 5BOOA 4JTGA 3Q37A 2RDTA 2Y6ZA 1K3UA 4O17A 1VCFA 3TMLA 4NJHA 2WSYA 4HNVA 3QSTA 3L21A 5I3IA 3SZ8A 3W7QA 4FHAA 2PURA 2GVJA 2DJLA 2E5CA 3B03A 3BGJA 3P82A 1ZY9A 3LCWA 3O1NA 1A50A 3STEA 1MEHA 4UFKA 1OX4A 1YDNA 4QAIA 3BLFA 3FA5A 4K7YA 1JCYA 3QEZA 4O0ZA 4XTDA 3HIJA 4JTJA 3MP3A 4LVGA 1L6SA 5EPDA 2UV8G 3W2MA 4GWEA 3W7DA 3G1FA 4N4QA 3QMRA 1WOBA 2NXHA 2HSAA 3THAA 2ZZ1A 4WJEA 4AHOA 3E02A 4JXCA 1LZOA 3I68A 2X1UA 5J5DA 3MWAA 3LDVA 5GVJA 1TPH1 4QM1A 4RZ5A 1JUEA 3NPWA 1H60A 4DELA 3BO9A 5G2WA 3W9ZA 3CHVA 1FCUA 2A21A 5AC8A 2G5WA 2JGYA 1AW1A 1KFCA 3PSVA 5F1VA 3TSMA 1YADA 3QH2A 5D03A 3BARA 3W70A 5ABTA 5F1UA 1K8XA 1OFDA 2G96A 6TIMA 4MFEA 1LBMA 1YXCA 2QCMA 2QUVA 4A21A 4AHQA 3PF3A 2QF7A 1Q45A 1PIIA 3BG3A 3EWYA 3OHIA 3PAJA 1V7YA 3M9YA 2VEPA 4ZZ9A 2DZSA 5G1YA 4FX6M 3TMQA 3H54A 3BK0A 1LYXA 5L6UA 4JX4A 4L4MA 4PL1A 4X2RA 3RFAA 3TC6A 4FNQA 1PHWA 1XI3A 3FIGA 3SJ3A 2NV2A 3G0XA 2V0TA 3AJXA 2GOUA 1WV2A 1IXQA 1H61A 4O8RA 1O5XA 1QPRA 5D2WA 1BWLA 2QEZA 3P67A 5AB3A 2ZRWA 1UUOA 4Q32A 4BI6A 2ZRUA 3W75A 1ZAHA 1EA0A 2DP3A 2EGZA 5C6MA 3NQVA 5HINA 1GT8A 4RZ6A 2TMDA 1YTKA 5D05A 3UWVA 1G7VA 1TRIA 5FF0A 4CQ9A 1O4UA 4YL2A 3TU9A 5A8GA 1LM1A 2FPVA 1JQXA 1B4KA 1GVRA 3NM1A 2CLIA 3CB8A 3NQ2A 1Z41A 3IIVA 3TXZA 1QWGA 2TYSA 3W1RA 1SW0A 3BG5A 1KW1A 3IVTA 3P60A 1DL3A 4K8HA 3JR2A 3W85A 3INPA 4LC6A 4XBKA 4GNJA 3O8AA 5CG7A 4GUGA 4AHPA 1GVFA 4OWGA 3EWZA 1DJQA 3B0VC 1TTQA 5DCBA 4ZQNA 3CWNA 1KM1A 4MYXA 6ALDA 4LS2A 3UY7A 4O1DA 2ZA2A 1EUNA 1LLZA 4K37A 4IQLA 1N7KA 3W7CA 4WXYA 4N9BA 1KTBA 1W5OA 4BK9A 1CI1A 4JTKA 2J6XA 3TSBA 1W3TA 4WD0A 3FLUA 5BW6A 2Z6JA 3RLVA 2YX0A 1LBFA 2Z6IA 3IGXA 1KFLA 1YLVA 3STCA 4DBDA 3KRUA 5I3HA 4AB4A 3VE9A 3EX1A 5DBTA 1SZGA 2W6RA 4RR4A 1HFBA 4JX6A 1ZENA 2E09A 3NA8A 3W7GA 1H7PA 3P7YA 1OFEA 3PBVA 1SO6A 1E51A 4MJMA 5C5YA 5AC7A 1BWKA 3AO0A 1OX6A 1TJRA 1M6JA 5KZEA 1FXQA 2C16A 5D2TA 5F4WA 4QQ3A 2R14A 2FJKA 4FNRA 4GXMA 4AMAA 2DU2A 1DQXA 4PC8A 3TUUA 1SR9A 1N8FA 1KM2A 3NEVA 3MI3A 3GDLA 4FF7A 3TNOA 3P5ZA 2ATSA 3C8FA 5C55A 1GOXA 3NPUA 2FB2A 1SUXA 5BMXA 1B3OA 5F2IA 3VI2A 1YPFA 1OHLA 3IRDA 1ADOA 3IIPA 3TAOA 1EP2A 5K4XA 2J27A 3OG3A 1T96A 4Y9AA 4IJBA 1WOAA 5AFDA 1I2PA 5D38A 4UTHA 1TPWA 4MYAA 2O7QA 5D33A 2Q8ZA 2A4AA 5F2LA 2Q3RA 3PULA 4HHPA 4IPJA 3TFCA 5HWJA 2ZFAA 4DO5A 3NM3A 1FWRA 4XWUA 1OX4B 4ZQCA 3W2KA 3DFPA 3ZR4A 3O15A 2CLHA 2Y62A 4ADTA 2B7QA 3WK0A 3BLIA 5D02A 1LOSA 3EXSA 1XBVA 4A29A 2VFIA 1TPDA 2E6YA 1NEYA 1AW5A 2A1YA 4AEOA 3W23A 4K39A 1TREA 4GRSA 1BTMA 3NL5A 4ZL1A 4QJ1A 1IXNA 3M5YA 1EX5A 4IWWA 3I7SA 4ZQMA 3QRHA 1XCFA 4ZQOA 4S2BA 3IGUA 2ABBA 5CZSA 1OYAA 1Q6LA 2GJLA 5HWMA 1QO2A 1I2NA 2QAPA 3IVSA 1OJXA 3KX6A 4UXDA 2H6RA 1AMKA 2ZZ3A 2ZZ6A 1OYCA 3E12A 3LCGA 3KAOA 3I6RA 4YXGA 2V5BA 4O19A 3UWUA 3WJWA 2V2HA 3M5ZA 3EWWA 4MLRA 4P61A 1GYNA 1HUVA 1DVJA 4YCPA 1VZWA 2B4GA 2R94A 2NX9A 3P5YA 1VCVA 3S8HA 3F4WA 1QMLA 1OFBA 1MXSA 3HB9A 4LU0A 4KFOA 2X30A 3GDTA 3NPVA 2E5BA 2CFFA 4WXZA 1WYIA 5AYZA 4BWLC 2VFGA 4TU1A 5K9CA 1AL7A 2C1HA 1VLIA 3N9RA 3JRKA 1K7XA 2YFNA 4ZVJA 3Q58A 1K7EA 5FEXA 1LROA 3L0GA 4N4PA 3VNDA 1Y0EA 1SW3A 4WZHA 3T44A 3C0JA 3C2FA 5F2MA 3W22A 3QPZA 4K8EA 3BLEA 3W3OA 1XC4A 2FPYA 1TV7A 3P62A 2V8ZA 2TSYA 4R7JA 3LM7A 5LZLA 3EX3A 3W7OA 3DZ1A 4ZQPA 4XTIA 2VEIA 2YW4A 3R12A 2I9EA 1RZMA 3P8IA 3I7QA 3GX9A 3B04A 2ZDRA 4MOZA 1LOLA 4ADSA 5D2XA 2FB3A 2P10A 5KZMA 2P1FA 3R5EA 3B0PA 5K2ZA 3MBFA 2Q3OA 3G1DA 4JYDA 2OX1A 3L67A 3MHGA 1KM5A 3EX2A 1A5CA 1XXXA 1W5NA 4BI5A 2J88A 4O4WA 3NG3A 2Y7GA 4X3ZA 4EOUA 5AHLA 3U8GA 4LV4A 3N19B 2V2DA 4NX0A 2ZZ4A 4NUWA 2AGKA 3TDFA 4UNLA 1H62A 4UFLA 2V81A 3GXPA 4OHQA 3E96A 3CM4A 3LOTA 1GTEA 2NXIA 3G1XA 3W76A 4CNNA 4O4VA 2Y70A 1UUMA 2C19A 4IMGA 5KTLA 5FESA 4KFNA 4U28A 1TV8A 4MLJA 1W54A 1FWNA 3M1ZA 4NX5A 3HF3A 2QCDA 3TROA 1YTDA 8TIMA 1OK6A 4Y90A 1K02A 2B0MA 3PS7A 4UUIA 2QCCA 3BPWA 1ZJIA 2H3DA 3G1VA 4M6VA 1J4EA 2YYUA 1WBJA 2W0UA 4IX2A 1FBAA 2ZZ2A 2YW3A 1DHPA 1OK4A 2NWRA 1ICQA 4QNWA 4RJEA 5AHMA 1AW2A 2FPTA 3LRMA 5LNVA 3N14A 4Z0SA 1R2TA 2H8XA 2W79A 4E2DA 3M7WA 5LHEA 1QCWA 4UFIA 3GXNA 2YFOA 2OZ0A 5TBOA 5J5RA 1OVDA 4C1KA 3W7IA 4FB7A 2E1DA 2YXGA 4RKAA 3C3NA 5BMWA 5DXXA 4PH6A 1WAUA 3LV5A 4C1LA 2A5HA 4O16A 5F4XA 3KOFA 1JRBA 2RKXA 5KITA 1LDCA 2NLIA 3UWZA 3C2EA 1SZEA 3DAQA 3TE9A 4MUZA 2A2IA 5HULA 3LHZA 3H55A 2A85A 4FNTA 3ABRA 5EBUA 4NJGA 3UXDA 3LBMA 1P0NA 4IXXA 4AWSA 1IIGA 4FNPA 1H7NA 2DORA 1H51A 3TKFA 1QAPA 4JD4A 2VXNA 4D2JA 1YTEA 4LS1A 3L0NA 4UTLA 1A53A 3W6YA 1MZHA 2YSWA 3DBPA 3LERA 3KVLA 5CKSA 5K9XA 3SGUA 3NQGA 3W72A 3KVKA 5DCEA 3NR0A 4LWWA 4NZJA 1Z44A 1F73A 4O15A 1WDWA 3MUXA 2RFGA 3S5ZA 4I7VA 3F1QA 1SZNA 3L2IA 1PL9A 3UPWA 2YCEA 4JTSA 3GDRA 3W1UA 4YCOA 4PODA 2E5DA 1FCBA 1H1ZA 4IMEA 5CPMA 3L0KA 3PY2A 2Y63A 1PE1A 1SSDA 1YYAA 3M0ZA 1SFJA 4UNKA 2LLEA 4A3UA 5CPOA 1TPC1 1NF0A 4YWIA 4A22A 3MHFA 2X2GA 1SO4A 3R2GA 4OV4A 3LB0A 4DO6A 3DGRA 3GKAA 4FXSA 3P8JA 4PA8A 7TIMA 4DF0A 4POCA 2CZ5A 2QCGA 3UPBA 3DFNA 3G3DA 1TCDA 1JUBA 3GYEA 2FDSA 4JIQA 4LVDA 1QNVA 3S5NA 2VELA 2PE4A 3GAYA 2ZTKA 4E0CA 2DZWA 3GR8A 5H2ZA 1AG1O 1X1ZA 2GJNA 3LCIA 4FXRA 2C15A 3NQEA 3VFLA 3LHTA 1EB3A 5E1QA 3EWUA 2NWSA 4CNPA 4ICNA 1IIHA 2RDUA 1TPEA 4AH7A 1G7UA 5CSRA 4NNAA 4TO8A 2FIQA 3HG2A 4WX2A 3MW7A 3LHWA 5MHBA 4GE8A 5LHFA 1JVNA 1VLWA 3PWAA 1OF8A 1JQVA 2DJXA 3QW4B 1ZCOA 3DENA 3KFTA 3HG3A 2NZLA 2A7PA 1RQBA 1P1XA 3BG9A 1ZAJA 4KFPA 1X7FA 4UMAA 1LRTA 4N2YA 3QW3A 4JDYA 3TW7A 4DPQA 3ZFHA 4WQ6A 2WNZA 2NV1A 2QCNA 2RDWA 1ZFJA 1EIXA 3TSDA 4M6QA 2CZDA 3FYOA 4XZ9A 1FDZA 3NQ7A 1DQWA 1UBSA 1M5WA 4ONVA 3EB2A 3E9AA 3MP5A 5I3FA 2H3BA 5KMYA 3TXVA 3G24A 4AF0A 4UTUA 2EPHA 1YXDA 1W3NA 2GQAA 1ME7A 5AN7A 3UZJA 2EHHA 3IIZA 1ML1A 3L5AA 3GDMA 2VFDA 3GZ3A 3M41A 3QMSA 3NQ8A 1O95A 1OX5A 5HQEA 4O1BA 2WSRA 2QUUA 3RF9A 4GC4A 1JCLA 1V5XA 4I9AA 3W7NA 1G4PA 5EKYA 1Z42A 1WQ5A 5TIMA 3A24A 3M43A 3LCXA 1D3GA 1DBTA 1EWEA 3LXAA 3A21A 4PCFA 1JCMP 1S5TA 3NXFA 5HUOA 3FJLA 3MI6A 1XL9A 1VQTA 3I65A 5LGZA 3EEGA 4CQ8A 2A6NA 3ZS4A 1O5KA 2A6LA 2YGYA 2Z1BA 3IIXA 3M5XA 1KM3A 3CWOX 3GNDA 2E6AA 4XKYA 5AHEA 2QCDB 3LHVA 4GFSA 2HTMA 1K03A 2CLOA 4NNCA 4PFMA 4W9TA 1LP6A 3SW6A 1O94A 4UFHA 4DXVA 3EWBX 1A5BA 3JS3A 2NUWA 1HL2A 3B0UX 1T0OA 3G3MA 3O6DA 3FEMA 3UWQA 2VOMA 1AK5A 1HO4A 5DLCA 1A5AA 4A2SA 3CQ0A 3L5LA 3NO5A 4IOTA 3Q94A 2WQPA 2ZQ0A 3PUDA 5FF2A 5HMSA 3WFAA 3KRSA 3A5FA 2BTMA 3G1YA 3Q2DA 3ABOA 4PTNA 1KV5A 3PUOA 2Y7FA 1F7BA 3LX9A 3SSJA 5D2YA 1GTHA 5HR7A 1EWDA 2ALDA 2O7SA 4AWUA 2GPTA 2Y7DA 1W5PA 4YLWA 3O6YX 3PG8A 3MYOA 3W7EA 3SR7A 2E77A 1LORA 1F6KA 3G18A 5C54A 1PV8A 4JTFA 1EEPA 2CLKA 1LCOA 3BV4A 1IXPA 1K7FA 1XDMA 3W74A 2R8WA 2VFHA 1XFBA 1T99A 4WOZA 4MIMA 3BW2A 3LBCA 5CZTA 3C2OA 3W2LA 1H63A 3NQ6A 1W31A 3GIYA 5I3KA 1PHQA 1C9DA 5LNWA 3A22A 4J9JA 2QCEA 4HT3A 1ICPA 1KFBA 1GVSA 3NZ1A 4WY0F 4MY8A 3TAKA 2ZZ7A 3LTPA 4N02A 3VE7A 1KM4A 3MO7A 5LGXA 4IMCA 5I3JA 3CEPA 5D32A 1U5JA 5FI8A 4E2BA 4M7TA 4QITA 2CU0A 2ZTJA 4JTIA 2OT0A 3NPXA 3W73A 3EX4A 2PRHA 3NNTA 4N9DA 3B4UA 5FF3A 2RH9A 3CLMA 4BI7A 3DHFA 1LOQA 5K4ZA 2GUUA 3WJXA 1GPWA 1SO5A 4LOCA 3EXTA 1XBXA 4KWVA 2YDAA 4NQ1A 4DF2A 5LNUA 1DORA 3R13A 1F74A 1XUUA 4UTKA 1M7PA 3RLUA 4EF8A 1Q6OA 2IQTA 4ORMA 3SIZA 4DQWA 3WK3A 2JKEA 3M6YA 5DN1A 4LUJA 2RHGA 3TK7A 1K8ZA 3MHUA 3W2JA 1KFKA 4WUIA 1LTDA 2VKZG 1ICSA 1SW7A 3YPIA 4B5NA 1DJNA 3MYPA 2ZCGA 2WO5A 3TCEA 1VH7A 3N2MA 3NDOA 4JTLA 2JGQA 1TTIA 1Q6RA 3NGJA 1I4NA 3MJYA 2GQ9A 5EYWA 5G2HA 1H7WA 3UQNA 3CT7A 2ATMA 4XUGA 4MJZA 1OYBA 3I7RA 3U6WA 4L4LA 2ZRVA 3LGEA 4MVAA 4LV9A 4IMFA 4CCEA 1R30A 1J5TA 5H91A 2VEMA 3LRLA 1C8VA 4IUOA 3C6CA 1GVOA 4OGZA 5D2VA 3PR2A 3V75A 1QR7A 4TIMA 2CWNA 4IXHA 1L9WA 5D30A 1VCGA 1FDJA 4WY0A 1MO0A 3RMJA 3MP4A 3S1UA 2G95A 3T40A 2DZTA 4JTUA 4EIVA 4LC8A 3BGGA 4MFDA 3LCLA 4UTMA 1W56A 3IEBA 3NZRA 1TIMA 4KWWA 1I8JA 4HNNA 2QKFA 4GUHA 2QCFA 3LI0A 1RR2A 3P74A 2TRSA 2V2CA 1XUZA 3E49A 1O60A 4GUIA 3GAKA 5K3VA 1KBIA 1FWWA 4OQVA 2NX3A 3PBWA 3S5OA 2VEKA 1FXPA 3C2VA 4QNEA 4LNYA 4NJKA 5F4SA 4LUIA 4X9SA 2YR1A 4AF0B 3N34A 1XDLA 4EF9A 3C2RA 1THFD 1OF6A 1BKSA 1QDSA 4FNUA 3PBYA 4O18A 2Z2UA 3DFSA 4I7UA 4JGDA 3QMTA 4UFJA 3G1HA 1IGSA 4IX0A 4Z1DA 3P80A 3DI1A 2ZZ5A 4R33A 1RV8A 1OFPA 1YXYA 3GR7A 3LLDA 3TX9A 4JY9A 3WK1A 3GB6A 3NQCA 4UTWC 2ISSA 1JUKA 1TV5A 5CPLA 1QPNA 4JTTA 1NAL1 3O63A 4Y6GA 5EY5A 1J2WA 1X8FA 2PRMA 1UB3A 3OVPA 5FEPA 5SWUA 3KHJA 1SU5A 3HO8A 2WOQA 1KLYA 3NL2A 4XKYB 1GG1A 3QM3A 4O0KA 1GG0A 3NQFA 1RQHA 2HS6A 4BF9A 2R91A 1SSGA 4I7WA 4MPQA 3L66A 4OBTA 1NSJA 4CQAA 4LVFA 3OA3A 3O16A 2A7NA 3DFQA 3THQA 4E38A 1FCQA 4FIRA 3HJZA 1VC4A 3O07A 4TMBA 3PB2A 2JK2A 3WJZA 3SI9A 2PRLA 4UMCA 3KXQA 2I14A 2E6DA 2WSQA 3QZEA 2QDHA 3LI1A 2ISVA 3QPYA 4ORIA 3SFKA 3W7MA 4BWLA 3M47A 1W1ZA 3VKJA 4DO4A 5EA9A 1GZGA 1YPIA 2DZPA 4UR7A 2QJGA 1UASA 4LS0A 4OT7A 3KRZA 4MZ8A 5K9DA 4UTTC 4H3DA 4Z1CA 3WK2A 4Z0JA 2J24A 4JR5A 4TMCA 3DKLA 2BXVA 1G4TA 4JX5A 1OFRA 3OIXA 4OU1A 5EMUA 4NU7A 4O13A 3B06A 1WXJA 3G0SA 1TQXA 3P81A 4IMDA 3W1MA 3S1WA 3EX6A 1TPUA 1X1OA 3QYQA 3O06A 4IGHA 4HSNA 2DZVA 5E0KA 3WJYA 3W7LA 1H1YA 4NXSA 3DKJA 2B7NA 3USBA 4Y8FA 1KM6A 5BNKA 3A5VA 3E0IA 4O52A 3PG9A 3S5YA 3QF0A 4O54A 4HKPA 4LT9A 4NXKA 1ME8A 2X1SA 3C52A 4TR9A 4UTWA 4JN6A 1Q6QA 4JIPA 3TJLA 1IXOA 2JKPA 4JYFA 4S1FA 2DZXA 3TW6A 5KINA 1L6WA 1RVGA 2C6QA 1W0MA 4O1CA 4Q33A 1VR6A 2Y85A 1S3HA 4OE7A 4A2RA 4PEKA 1VHNA 2Y7EA 2OCZA 1YDVA 1EUAA 3M16A 3FOKA 2CLFA 3G1AA 2J9XA 1VHCA 3F4NA 1TQJA 1B4EA 3PVFA 3W7JA 3LCFA 3ZWSA 2XN2A 5G5IA 4HPXA 3IVUA 3DU0A 1KFJA 3CIXA 3P61A 4EWND 1SPQA 4BFAA 4RX0A 5U7SA 4UTJA 1P5BA 3N73A 3HQ1A 5T26A 4P2VA 1W3IA 2B7OA 2WJZA 1H7RA 3ANYA 4FX7A 1NF7A 2TPSA 2EKCA 5AC6A 3W1AA 1VYSX 5HNRA 3W1PA 1U83A 4WY0B 2CLEA 3W7RA 4N9EA 3S0CA 4XBSA 3B05A 4JICA 4O28A 2NXGA 3BW3A 3STFA 3DH7A 3L68A 2QCHA 1TRDA 1JCJA 3OEXA 3LHUA 4RXFA 3R8RA 4CCDA 4UTTA 1TB3A 1Z48A 2V5LA 1OG0A 3W84A 2V30A 3RK8A 3HPZA 1KLZA 4ALDA 2HMCA 5G4EA 3A9IA 4LRTA 3ELFA 3T55A 3PB0A 2NUXA 5DXYA 3W1QA 1R2SA 1DKWA 1I2OA 5L9FA 3CPRA 2CLLA 3MI2A 5U4NA 4NNBA 2WPBA 2ZRYA 1TMHA 4O57A 2VFFA 1HO1A 3T78A 4K7VA 2JBMA 3GVGA 5CZ0A 2OJPA 1FY6A 3UWYA 1I45A 1ZALA 1PVNA 1SFLA 2BX7A 3S9YA 1BEUA 2BZNA 1MSSA 4LRSA 1W37A 3UY8A 2C3ZA 1FX6A 1P0KA 4HNTA 3G0UA 3W1LA 3EKLA 1UCWA 3D0CA 1L6YA 2DZUA 5AHIA 3RNDA 1WA3A 1GJPA 1GEQA 5EL1A 1OFQA 2B7PA 1H7OA 4AVFA 4MY1A 5IM51 4Q4KA 1CW2A 3ABQA 3WJSA 3FFSA 4N6FA 3LXBA 4H6KA 2WV8A 2X1RA 3FKRA 1S5VA 4LVBA 4XQ6A 1TPVA 1TJPA 3DXIA 3IGSA 5HUPA 4UTIA 3BW4A 5AOUA 4R53A 4UC5A 4CCCA 3TA6A 3LTSA 1XKYA 3EKZA 3L65A 3OVQA 5F2GA 3NAVA 2ZYFA 1EPXA 1JR1A 1YDOA 4G1KA 3PC0A 3OVRA 3TFXA 4O10A 2P0OA 1I2QA 4AXKA 2WKJA 4MKNA 2AAMA 1EP1A 3NOEA 5KSWA 4FX8A 3BVJA 1RQEA 2YZRA 3VCRA 3W1NA 1KM0A 3NQMA 1SO3A 4JTHA 3QJAA 5BRBA 4NT0A 5LNSA 2FLIA 4GUFA 2QJIA 4NJIA 4LTSA 1KTCA 3HGOA 2FTPA 2A0NA 2CLMA 1ME9A 2F84A 2X1TA 1CX9A 1QPQA 5AHFA 4K38A 3NQAA 2GVGA 2V82A 4AWTA 1JRCA 1B9BA 4QISA 5AHNA 3PM6A 1TYGA 2ZBTA 1F05A 1KA9F 3MBDA 1C29A 3W7KA 3O6CA 3ABSA 4HIBA 3TJXA 2E68A 2WNNA 1HG3A 1G4EA 3QQ0A 2HS8A 1R46A 2FQIA 1G6CA 3HG4A 4CLMA 3ATZA 3DI0A 4NJJA 1ZNNA 5I3GA 3S1VA 1KV8A 4X22A 3HOJA 4M7SA 3C61A 1MEIA 1DV7A 3TQKA 1FCVA 4WOQA 4RLIA 1F6PA 1G67A 1KFEA 1F2JA 3QFEA 5CZJA 1TO3A 5G2IA 5FF7A 1T8XA 3G8RA 2CZEA 2C0AA 2Q8LA 2C14A 2ABAA 3S6DA 1LBLA 1QPOA 4O11A 4O50A 2BWGA 2OMAA 4O14A 2QDGA 1B57A 1NFBA 1TSIA 3S42A 3ZWTA 1TTJA 3LV6A 2CZFA 3QSRA 2EF9A 3UYCA 3CTLA 4FO4A 5HJLA 2GQ8A 2H8ZA 3UD6A 1PS9A 4UCGA 3TR2A 2YYTA 4LY8A 1QOPA 3GDKA 3EXRA 1K8YA 3G8EA 3RU6A 1G4SA 5DELA 5D37A 3HPSA 1GWJA 4U4MA 2ISWA 1PCKA 3L9CA 4FNSA 4JTEA 3T4CA 4JEQA 1VGAA 4K6AA 3HPXA 3STGA 3W87A 4UMBA 3NL3A 1HTIA 4Z1AA 3C4UA 3NYZA 3NQDA 4H4IA 4JDBA 4DF1A 4S2CA 1PCWA 1UJPA 2QCLA 3TIMA 4O1AA 5FEZA 1MEWA 3FJ6A 4DBEA 4UFMA 3SGZA 1VYPX 2C18A 3TV8A 1D3HA 5FF4A 2I1OA 4PL2A 3W1XA 1LLWA 3W1TA 1FUYA 4ZQRA 5A5WA 4KKXA 4QIUA 2XFWA 3IIOA 3HBLA 3HGRA 3N2XA 3H53A 4RZ4A 3PSWA 1KTNA 5FEWA 1OFAA 2CW6A 4LW7A 4FEZA 1RPXA 2VC6A 5C2XA 3DHDA 3KVJA 4RCXA 3UXAA 4HNUA 4HN4A 5DY3A 1X6UA 2BSLA 2ZRXA 1XBYA 3CU2A 3LRKA 4Z08A 1OABA 1L2UA 1G69A 3M44A 3GK0A 4M19A 2GVLA 4RK8A 1VPXA 5G4WA 1GYLA 4UIOA 1Q3NA 4R34A 1RD5A 3B8DA 2F7FA 2FFCA 5K7JA 2QR6A 4ADUA 1AL8A 4ZMGA 5LKYA 3CIWA 3GNNA 3ATYA 1GQNA 1IF2A 4GBUA 5AYXA 2ZA3A 5DBUA 1WX0A 3P84A 5DCDA 4LVAA 1TPB1 2XN0A 3CC1A 4HSOA 4MY9A 3W7PA 2JKAA 2Y89A 4N9CA 1QO5A 3CEUA 3PBUA 1ONRA 2Z0IA 1OFOA 3QQ1A 4IPIA 4JNMA 3W07A 1JCNA 3N3MA 4JY8A 4FIQA 3F03K 3FKKA 1P4CA 5HWNA 3IV3A 2PCQA 3FYPA 3M5VA 2ZA1A 5IBXC 4Z1BA 2E6FA 3GXTA 2XN1A 5HR6A 1D9EA 4O53A 1N55A 2VFEA 3DFOA 5E93A 1ALDA 5D09A 3W71A 4JS3A 3U2OA 3G1SA 3LHYA 4M6PA 1JCXA 1JULA 2J9ZA 1VS1A 1NVMA 3V1PA 5CSSA 2KZHA 1LRNA
chains in the Genus database with same CATH superfamily
4N6EA 3VD4A 1VYRA 4HJFA 2YL9A 4MKVA 1X6LA 1ENUA 3TA9A 4XAPA 5IFPA 1DJZA 3UGRA 1RA5A 1NWUA 2CIPA 3VNKA 1KNWA 3U4AA 1EXPA 1RCXB 4HA1A 4TX9A 3TC7A 4IGMA 3E0LA 1WBHA 4IP4A 3EMCA 4OV9A 3W83A 4S39A 1LT8A 4CU6A 2OLHA 1BVZA 4AAJA 3GXMA 3DC0A 1HL8A 1OADA 3EYPA 1UMLA 4DJEC 4G8TA 3AICA 1GOIA 3I4EA 4DWSC 1BQCA 3NCOA 3T7VA 1GONA 2G50A 1FWSA 1F6YA 5LNRA 1NQ6A 3LXCA 2QAFA 2RGMA 4F2BA 1XR2A 4RXGA 2WHKA 3HG5A 3QR3A 2WPGA 1I1XA 3W2NA 4W89A 2Z2BA 3SCTA 3GG0A 1DOSA 3GC4A 5LSMA 1A5LC 1XLLA 4M5PA 3GZAA 1R47A 3LS9A 3WQPA 4S3AA 1F76A 3QFWA 4OTKA 1SZFA 1C7SA 2J25A 1EQPA 4ZEPA 1XH2A 4R9XA 4ENLA 3CAQA 2JIEA 2Q6ZA 4R88A 1W1YA 1HKJA 1KBJA 2OXNA 1SQ7A 3GNXA 3NVTA 2WZMA 3RLHA 1EPVA 1XIIA 1A5SA 2PDYA 5G1TA 4O12A 2ZRZA 2YA0A 4KCWA 4BF5A 4QE1A 2WNQA 3W2UA 3E1F1 3CAKA 4ZSUA 3WMBA 1DIKA 1VJIA 3R1ZA 3K30A 3VOJA 4A8RA 1XYBA 3W88A 3ANUA 3TN5A 3EWXA 4HZMA 4JYEA 4S3DA 1EXBA 4QSHA 4JL2A 5LXXA 4I6VA 3AHXA 2WSYA 5FD0A 3L21A 2QIIA 3ZR5A 3B03A 3BGJA 3E6EA 1J0KA 3LCWA 1GEHA 3O1NA 3STEA 3MKKA 4REQA 1MW0A 3CAWA 3BZGA 3BLFA 4QAIA 4V1XA 4FOJA 1JCYA 4N0RA 2VUNA 3RO6A 3QEZA 4ZOAA 4HD5A 3CB3A 3QMRA 3ZLFA 3W26A 4LUSB 4ZCWA 3GE7A 1EQCA 1XRFA 4OJYA 3I68A 2X1UA 2QJJA 4ZE4A 5J5DA 3LDVA 3NPWA 4IG2A 4DELA 4B2DD 3CHVA 5HXMA 3T0AA 2O55A 1FHUA 1E3ZA 4RE3A 1DQUA 5M1TA 1H49A 5HNTA 4PTMA 4BY3A 4H9MA 2O4MA 3QH2A 2CNCA 3BARA 1LL6A 1TE6A 1K8XA 2VD9A 3GG1A 3WQVA 4MFEA 4B5SA 1ZBWA 3CMFA 1E43A 3T08A 2YDQA 3EWYA 3OHIA 4GK8A 4ES4A 2ONEA 3M9YA 2VEPA 1YE6A 1DXFA 1LYXA 3CYJA 1CB2A 3TC6A 3CL6A 5GNXA 2BHZA 4QSFA 4FP1A 3DN5A 3NXLA 2GOUA 4O8RA 1QPRA 1FH7A 1BWLA 2D0HA 4G9PA 4H7VA 3SFWA 4PRRA 2E7FA 4S23A 1EJUC 3MUAA 3NUKA 1ZAHA 1EA0A 2DP3A 2EGZA 2PDKA 3VD9A 1JZ3A 2YCJA 5C6MA 5HPCA 1QHZA 1Z7AA 5D05A 3UWVA 2O0TA 3G1RA 1Q4NX 4ZR8A 3AIBA 2CLPA 5A8GA 1V3HA 1UR8A 3AC0A 5FKYA 3CB8A 3NQ2A 1Z41A 1QWGA 3W1RA 4PMVA 2HE8A 2XIMA 2PDCA 3TN6A 3P60A 4UQ9A 2XVNA 1DL3A 4K8HA 2G3JA 1VBHA 4LC6A 4GNJA 1DJQA 6REQA 5DCBA 3CWNA 4QJ5B 4MYXA 1DWGM 4O1DA 5C7HA 1EUNA 2DUXA 1N7KA 4IQLA 3FYYA 4Q8WA 1KTBA 5CLWA 2J6XA 3PBMA 4QG8A 4V27A 3BURA 4QCEA 3LU2A 1UH2A 3M0KA 4H8UA 2YX0A 2Z6IA 4JFUA 4DVOA 2PFHA 1OG6A 2YLAA 3ITGA 4HNCA 3WUBA 5DBTA 1SZGA 2W6RA 4RR4A 3ZVHA 2WWDA 1H7PA 5EFFA 5CBBA 1E51A 4G1NA 5C5YA 1CXLA 2DQWA 1M7JA 2G3FA 3FEQA 1TJRA 2VI0A 1M6JA 2C16A 1WP6A 4HCHA 1RBAA 4Q7BA 2ZUUA 3MTWA 3IWPA 3RRXA 1DQXA 1DJXA 1W3KA 1KM2A 4HMNA 1BAGA 1NOUA 3GDLA 4Q8PA 5AZ0A 3M07A 2ATSA 3C8FA 3PJXA 3UA4A 2IS7A 5C55A 1R3RA 1DXIA 5BMXA 2J74A 1OHLA 2ADAA 1RPKA 2HROA 4RUBA 1HJXA 4LALA 2J27A 4IJBA 1KRCC 5AYBA 2RGLA 5AFDA 2NVAA 3GHSA 2A4AA 4C6OA 3NM3A 3G6LA 1FVPA 1FWRA 1HGWA 3DFPA 3R7MA 3ABXA 1EBGA 2EG8A 2CEQA 1BXCA 3MZ2A 2ZUVA 2VR2A 5A6BA 5C71A 3NL5A 1P1MA 4QJ1A 2ZUTA 3M5YA 4IWWA 1DHKA 4ZQOA 4S2BA 2XHYA 1R3VA 1OYAA 4XVEA 1QXLA 1Q6LA 4YWSA 4JTCA 2GJLA 3UGVA 1A3HA 4H9UA 5JIWA 5I03A 3ARPA 2QAPA 2XH2A 3IVSA 4RDWA 4NYUA 3ZMRA 4KCVA 4NIRA 1AMKA 2ZZ3A 3GW0A 2PBOA 1W9VA 4EE9A 3A4XA 3BE7A 4YXGA 3WJWA 3S4TA 4E4FA 3BAKA 3GG7A 1EC9A 2E28A 4MLRA 3IUHA 2ZXQA 1GYNA 3S2NA 1JXJA 3RUBL 4QJ3B 3UVIA 1QMLA 4MTVA 1MXSA 4GI4A 4LU0A 3NPVA 2E5BA 4C1NB 1S2AA 4WXZA 1HJVA 4TU1A 4WIWA 3AHTA 1AL7A 3JRKA 2YFNA 1K7EA 5FEXA 1LROA 3L0GA 4W8BA 4FR1A 4H2CA 2ANUA 1Y0EA 2X42A 2EPOA 1KCZA 3C0JA 3C2FA 3W22A 3QPZA 3ARUA 3BLEA 4K8EA 4LJ3A 2F6XA 2PZ0A 3W28A 3M4HA 4R7JA 4PTXA 2OU4A 2NT1A 4XTIA 3I4KA 2XSBA 1XYAA 1GW9A 3I7QA 1ONEA 1O1HA 4FLSA 2VZUA 3WBYA 4E8DA 2FB3A 3B0PA 1BSIA 3OQEA 5K2ZA 4QP0A 1J96A 2QUMA 1KM5A 4Y9OA 1JZ2A 1T7LA 4RPQA 4RNFA 2BXZA 4AY8A 4CCZA 2Y7GA 1P0BA 4X3ZA 2NVDA 1Q66A 5AHLA 1HZYA 1CBGA 1CGXA 4DZ5A 1PYMA 3UG8A 4C7GA 4NX0A 1QNOA 1TR9A 1N82A 3CM4A 3IJ9A 3LOTA 3CV7A 3G1XA 2Y24A 3FW6A 3W76A 4O4VA 2Y70A 4LXFA 1UUMA 2C19A 3WL0A 2J6VA 1TV8A 1W54A 1FWNA 3TROA 1OZMA 5DMNA 3M0IA 2ACSA 2FZDA 2JALA 8TIMA 1OK6A 1K02A 4WSKA 4K1WA 3PS7A 4UUIA 3RJXA 2YXXA 5I3DA 1J4EA 1LUCA 1ZPTA 1WBJA 4IX2A 2ZZ2A 2AKZA 2DVXA 2YW3A 1E9LA 1DHPA 3E2VA 1OK4A 2VGFA 5AHMA 2FPTA 5E0FA 3GH4A 5LNVA 3N14A 3WLRA 1R2TA 4PUWA 1S2UA 5I09A 4LUYA 3GXNA 2YFOA 3BJTA 1OVDA 4C1KA 3W7IA 4FB7A 2E1DA 3GNOA 1PB0A 3LV5A 2QPXA 2ZXAA 3GVVA 4C1LA 1ZGDA 3KOFA 1I9CB 4AZ7A 1TWIA 1SZEA 4RPPA 4MUZA 1ITQA 2A2IA 2PU1A 5M5DA 1QI5A 4FNTA 3ABRA 2QXWA 3LPFA 3O0KA 3QY7A 2ESCA 1P0NA 2REQB 4FNPA 4YHGA 4OUIA 1JPHA 4C5ZA 3URAA 2VXNA 4Z1YA 4ZFCA 3W25A 1A53A 1C93A 3CQIA 3CWHA 1MZHA 3DBPA 5H6HA 3GY1A 3L12A 1WZMA 5HANA 3BCJA 3CUGA 5CC6A 1GJUA 2HE5A 3L2IA 5LIUX 4F0RA 3EGJA 3TTOA 1PL9A 1TJ0A 2YCEA 4JTSA 3GDRA 4FLRA 1GOOA 1W32A 1E4LA 1FCBA 5CPMA 5BCAA 3M0ZA 2UWFA 3GXIA 1SFJA 1JDEA 1EOKA 2ICSA 4ZA0A 4QG9A 5CPOA 2DSVA 1NF0A 5CG0A 1CXFA 4A22A 1R7OA 2ZX7A 2X2GA 4XVDA 4H6EA 1K4GA 2PDGA 3CBWA 4PA8A 3UFYA 4O1EA 4DF0A 4US5D 2PC8A 2QCGA 3C86A 3DFNA 2CESA 3UPBA 2QNEA 4JN8A 3RR4A 3CHDA 1DWFM 4JFTA 3S47A 3E2SA 1JIBA 2GVYA 2ZTKA 3GR8A 1X1ZA 4NF7A 2C15A 3LHTA 4BEUA 4FK9A 3EWUA 3CUXA 3ARVA 2OO0A 1IIHA 3U0HA 2RDUA 5CSRA 4NNAA 3HG2A 1BVNP 4WX2A 4MNJA 1JVNA 3OPSA 1E72M 2DJXA 3DENA 1UHVA 1T40A 1RQBA 3BG9A 3SUTA 1B9ZA 4UMAA 7ODCA 4AIOA 1UD8A 3OP2A 1K9FA 1UD6A 3N17A 2GVEA 2NV1A 2JF7A 4XZMX 1SFTA 3TSDA 4JOMA 4M6QA 1K6AA 3FYOA 2G37A 3FAXA 3FGCA 3SRKA 3TOPA 3WBWA 1GQLA 5I23A 3QV8A 3EB2A 3EBVA 3MP5A 5I3FA 1WXYA 4WSHA 5KMYA 2CXEA 2FFIA 3TXVA 3WF1A 4UTUA 5C9RA 2EPHA 3BV7A 4QFUA 2GQAA 3UZJA 4PFHA 1UROA 4KGJA 1OX5A 1X98A 1DJWA 4GC4A 1KO0A 3PPFA 4EKJA 3EOSA 4D6GA 1XQKA 3CTTA 2PD9A 3A24A 3M43A 1D3GA 1TWWA 3B9OA 2Y1HA 5FJJA 1V3KA 3M0LA 3VDAA 3MI6A 1PTGA 4FS9A 3I65A 4DJDC 4G56A 3RIKA 1AH0A 4US6A 4B5WA 3OJGA 4D6IA 3EKGA 5AHEA 4W4QA 2HTMA 4Y9MA 3SW6A 3KTSA 1O94A 3NYDA 5REQB 3B0UX 1AA1B 1T0OA 5G4HC 2D23A 3FEMA 1ONWA 3R0UA 4HYRA 4A2SA 3PANA 3NTYA 1L8PA 3L5LA 3NO5A 5H8PA 2WQPA 2PF8A 4FOKA 3A5FA 2BTMA 3ABOA 2GJPA 2AQOA 3O0FA 1F7BA 1W2PA 1GTHA 4PZVA 3QBUA 1EWDA 4P7OA 2ISDA 3H8AA 4AWUA 2GPTA 3EWDA 1NFGA 2E40A 5J04A 4C6MA 2E77A 1F6KA 3SQLA 4JTFA 4AD1A 5C8BB 1DIDA 1WDPA 4MSSA 2W61A 1JAKA 4MIMA 1KRBC 3UT0A 1QTWA 2VP8A 3DX5A 3C2OA 1B30A 5B7YA 2Y0FA 1W31A 3IUDA 5LNWA 3OVGA 2QCEA 4HT3A 4D6FA 1KFBA 3BXWA 1GVSA 2WBKA 4WY0F 4MY8A 3T8LA 4M81A 1QW9A 1YX1A 5I07A 3VE7A 4IMCA 1A5NC 2V3GA 1AMYA 3N2OA 3F5KA 1CPUA 4M7TA 3VZYA 4E2BA 4L65A 4JTIA 2XPKA 3VIKA 3IAQA 2P76A 1BYBA 4L64A 3WG6A 3G6MA 2PRHA 4N9DA 3B4UA 5FF3A 2RH9A 4BI7A 3WJXA 9XIAA 1GPWA 4DF2A 5LNUA 1DORA 1F74A 4UTKA 3RLUA 4EF8A 5HATA 3GW3A 2FGLA 3AMDA 3L7RA 1GOQA 4NASA 3M6YA 2EPLX 4DJDA 3IJ6A 2Z1KA 3KS6A 1QBBA 4LYRA 3TK7A 4LEFA 3MHUA 4L80A 1KFKA 3T0TA 3ZM8A 2OEMA 1SW7A 4DWSB 3K13A 1VFHA 2WO5A 3N2MA 3NDOA 4C6QA 3NGJA 2VCBA 3MJYA 5G2HA 1J0ZA 3FA4A 4MWAC 1V3LA 3CT7A 4XUGA 4J5NA 2BMBA 4J2MA 4V1YA 4MJZA 1OYBA 3I7RA 3U6WA 3B3DA 4H9YA 4CCEA 4MVAA 1R30A 1J5TA 5H91A 3GIQA 4JIRA 4HZ7A 4IUOA 3C6CA 3ITTA 4WVXA 4CEUC 4OGZA 1G94A 1VFUA 3WF4A 1QR7A 4IXHA 3C5QA 4U5IA 3KP0A 3TLLA 3TZNA 3VUSA 3MP4A 1JFXA 4IIDA 4JTUA 4LC8A 2EPNA 4LCRA 3RILA 1C8QA 2BVTA 4YYFA 3IEBA 1J2BA 5LA2A 1TIMA 1G9HA 4XKMA 5HBFA 1KQZA 2NQ5A 1XUZA 2J8FA 3E49A 1O60A 4GUIA 3Q65A 1KBIA 1FWWA 1G5AA 3OO2A 1Q2RA 1JYXA 1XYLA 4CEXC 5LXEA 1JZ8A 1JNDA 4F79A 2YCLB 5F4SA 3UXLA 4PMDA 3RU8X 2POTA 4AF0B 4FR6A 4EF9A 1THFD 1OF6A 1BKSA 2V38A 3MCOA 3PZNA 3DFSA 1H0GA 5DT5A 2JF6A 1K77A 4PGLA 3ONBA 2DT2A 3DI1A 1RUSA 4UBPC 1EEXA 1YXYA 3TX9A 3WK1A 4W93A 1L2QA 2ISSA 1OBAA 2BP1A 1JUKA 1TV5A 4EACA 3WYZA 3IK2A 4MWAA 1UB3A 3OVPA 1KLYA 4J3SA 2VEFA 3QM3A 5FOOA 3KLLA 3T2QA 1PKMA 1EJXC 2R91A 4MPQA 3CUHA 5JQ9A 3L2MA 3HFTA 3L66A 1NSJA 4CQAA 3OA3A 3MV11 3ITLA 1NOWA 1FCQA 3QHNA 4FIRA 4H00A 4D6DA 5AYIA 4TMBA 2JK2A 3POCA 3SI9A 4B5TA 3BICA 4MB1A 4UMCA 3KXQA 5FL1A 4CQCA 4WEVX 3QZ6A 1CYGA 4DNHA 2ISVA 5D9NA 3WQ8A 4BWLA 2HWGA 1W1ZA 2HRWA 2UY3A 4D6CA 4UR7A 4W7VA 1UASA 4B5XA 4LS0A 2WANA 3Q4DA 4AEEA 5K9DA 4E5TA 1MQRA 3VILA 3V0TA 2VX5A 2BDQA 2Q02A 4Z1CA 4Q8NA 2J24A 1TWZA 4Q7IA 1X96A 5FJUA 1OFRA 4O13A 3BAYA 1V0LA 3G0SA 1TQXA 4IMDA 4GJIA 3W1MA 3EX6A 4WKFA 3VGDA 3O06A 4IGHA 3WJYA 3V7PA 2YXOA 3WBXA 3ITVA 4PR4A 3USBA 4CUCA 2I7GA 2GWNA 3VKBA 3ARTA 4WRHA 3REQB 5BNKA 4KH2A 1RY8A 4B16A 3QF0A 4O54A 2D22A 1MUWA 2W66A 3CH9A 1RXOB 2WJDA 3GH7A 2YCIX 3QVQA 3VD5A 4MGGA 3SQMA 3MA8A 2HXUA 2OOFA 1TA3A 3TJLA 2JKPA 4YHEA 3SCWA 5KINA 1BTCA 1UIOA 2PLMA 3BSMA 2P0IA 1MFUA 4DZAA 4LBSA 2XDFA 4OE7A 4A35A 3RG6A 4LYQA 1J9YA 2OCZA 1JZ4A 1YDVA 3GBEA 4P8XA 3G1AA 1VHCA 4H2HA 4HYWA 4AWEA 4NZCA 3PVFA 4J3WA 4Z42C 1P6BA 1IZKA 3UW6A 3K8MA 1IQ8A 2B31A 5A1AA 1ZP4A 3UVAA 3P61A 4EWND 1HJQA 4TVDA 4HK6A 4BFAA 4DRSA 4RX0A 2RAGA 1CXIA 1P5BA 4CD8A 1DEDA 4XD3A 2B7OA 1H7RA 4DM1A 2TPSA 2EKCA 1KXVA 3W1AA 1VYSX 4I8YA 2DT1A 3W7RA 3S0CA 3CO8A 4ERGA 3L4XA 1GKRA 3CHEA 1XV8A 2NXGA 2G4JA 3STFA 1CENA 4PMXA 2QCHA 1FWJC 4U31A 4CCDA 1Z48A 3ARZA 1KLZA 3HPZA 4J7RA 5D9OA 4LRTA 2D24A 2OZ3A 4JPGA 3UG4A 3W1QA 1R2SA 1XISA 3KBNA 2YBVA 1R3YA 2D0GA 1ADDA 2ZRYA 2VFFA 3T78A 5T91A 4XD4A 2PP3A 1EF2A 3CV2A 4X60A 1EDGA 2BX7A 3EPOA 1MSSA 4KW2A 1W37A 1BXBA 3NZGA 3W1LA 1A47A 5AHIA 1PBGA 3FY1A 3RNDA 2MANA 5EL1A 2B7PA 4AVFA 5IM51 3OLEA 1F9CA 2ZUWA 1CW2A 2EG7A 3ABQA 4QX4A 1JF6A 2CKSA 3IJIA 3RCNA 4DUXA 3LXBA 2WV8A 1IZCA 2YDRA 1V0KA 2OYKA 4XQ6A 1TPVA 3UCCA 4JQ3A 1TJPA 3ZVIA 2FGZA 3P2VA 5AOUA 5XIAA 2D0FA 3SIMA 1O1ZA 3EKZA 4GG9A 2WKGA 3AYVA 1EPXA 1E70M 2GJXA 1R86A 1YDOA 4PTWA 5BROA 3N9KA 3OG2A 1I2QA 2WKJA 3NOEA 4QQUA 5GNYA 4AC1X 5KSWA 4FX8A 3BVJA 4Z2HA 2YZRA 3VCRA 1SO3A 4NILA 5CGMA 2W91A 1SM9A 3RM8A 1ZUAX 1O68A 1ME9A 2IQDA 2F84A 3TOYA 1QBAA 4GYPC 1VFSA 4AYGA 4GABA 2GVGA 1LJYA 3VIIA 3R79A 1RK6A 1D2KA 4QISA 3D3FA 2ZBTA 4S3FA 3MQTA 3QR1A 2BGNE 3E0WA 3DESA 2VM8A 4AY1A 3QOKA 3TJXA 5BXPA 1W1IE 1HG3A 3T8QA 1G4EA 3K1DA 3QQ0A 3WUFA 2Z24A 2X0SA 1R46A 1S1PA 3FHAA 2Y5EA 2Y5JA 2IW0A 3DI0A 1OC5A 2PTDA 3PNZA 4X22A 3H26A 3TQPA 4M7SA 3C61A 1ZSXA 1F2JA 5CZJA 1KGWA 1L6GA 3B9EA 3HFYA 2C0AA 2Q8LA 2C14A 1LBLA 3BOFA 1V3JA 2VZVA 3UJFA 1F3WA 3L4TA 3EA1A 3SSZA 5JH2A 3ZWTA 2WAGA 4GYFA 2DH2A 2UY4A 2DSKA 3KS5A 4QRNA 5CPQA 4FO4A 4NY2A 2GQ8A 4UZUA 4NKCA 1XSIA 4LY8A 1SGJA 1V79A 4AZ5A 1G4SA 3JVAA 3VGGA 2YA1A 4IGSA 1TX2A 3HPSA 1IYXA 4U4MA 1UYQA 2ISWA 1EIBA 3L9CA 4AQLA 1H0IA 3VGFA 3HPXA 1A80A 3R11A 3NL3A 1GQKA 3NQDA 1M53A 3T81A 1PX4A 4S2CA 4X0VA 2QCLA 1DJIA 3TIMA 3EWCA 2WM0A 4O1AA 5FEZA 3BWWA 3OBEA 3ZIZA 2ZICA 4GQGA 1D3HA 4JQ2A 3HM7A 4KEMA 4ZQRA 1Q7MA 4QIUA 3IIOA 1B90A 3HGRA 3PSWA 4M29A 4W5UA 1OFAA 3RR1A 4JHOA 3EPNA 4ROQA 2QQ6A 3WD1A 4FEZA 5C2XA 3KVJA 1PKLA 3AS0A 4RCXA 3UXAA 5DY3A 2ASHA 3QYSA 6ENLA 2GSEA 1E0TA 4GMEA 1CGTA 2HCVA 4U2ZA 1JF5A 4CKQA 3SBFA 1W1A1 4D8ZA 1U1HA 1FWEC 3PZGA 4JKLA 3ISIX 3TN3A 4R34A 2F7FA 2PP0A 2D69A 2FFCA 5K7JA 2PGWA 3WLMA 4ADUA 4ZMGA 5HMEA 5A6BD 2VC7A 3UR5A 2WSPA 3CIWA 3OGSA 2ZA3A 2OZTA 5DBUA 3P84A 3CV1A 2V3DA 1V6TA 4LVAA 2KX9A 2JKAA 3VDHA 2UY2A 4IPIA 3W07A 2XM2A 3AMGA 3ZLHA 4AIEA 1P4CA 1QHPA 2PCEA 3JZEA 2YA2A 2E6FA 3GXTA 5HQLA 2XN1A 5HR6A 3N18A 4O53A 1N55A 1IWBA 4H6QA 2J7CA 3FDGA 5E93A 4YVVA 5CJ5A 1R87A 4JS3A 3HU7A 3U2OA 3W71A 4M6PA 1GHRA 1JCXA 3T1GA 1NVMA 3V1PA 2KZHA 3Q45A 4DAIA 4J40A 1J0JA 1XBZA 5T8GA 3B8TA 5BRQA 4AISA 4MB3A 1OGGA 4GJ1A 4UNIA 5TQLA 1QI2A 4MZYA 1FDYA 2AQWA 4Y2WA 1H50A 2OGJA 1IGWA 4DY1A 3EA2A 3BMVA 2VUYA 3B40A 3USZA 4AD4A 3W7HA 4ML9A 2G97A 3H2MA 3AAMA 5GJNA 1H7XA 2OLSA 1QNPA 7PTDA 1PZ0A 2AL2B 5DY2A 2NX1A 4FSAA 1UP0A 4ZTXA 4C60A 1QOQA 2J78A 1XP3A 2CETA 1GPFA 3QQWA 4NVTA 2X16A 3QHOA 3FS2A 3DBNA 4HA4A 5BXRA 2XINA 3FAWA 1TZ9A 1BXNA 2PMQA 4PUEA 3IPWA 1WKFA 4CNOA 1W5QA 3GKFA 3WQ6A 3R89A 1AODA 1R85A 3VDCA 3TQVA 2NUYA 1UIPA 3KL0A 1KQYA 1FKXA 1M7OA 4Y96A 3CAVA 2RDXA 3TQ0A 2VX4A 2GLKA 3TH6A 3E5PA 3UZXA 2V9DA 1PKNA 1RAKA 3HGSA 3IJDA 3SECA 2OB3A 4Q4MA 1EP3A 3PN8A 4E6MA 3WLPA 4AZHA 3ZT6A 3NURA 3M0MA 5D04C 4YN5A 3H2CA 1F5ZA 2EG6A 1M65A 4EVZA 1E6SM 4K8GA 2V6AA 1W9XA 5BWAA 5KZDA 3RX4A 1GOMA 5CGQA 1HVQA 3UG3A 2IPGA 1ZAIA 4NHVA 1JAEA 5AYYA 1SVDA 3RDKA 4WJ8A 2OT1A 3WFLA 3STPA 4NZFA 1CGYA 4B5UA 5BOOA 4JTGA 2RDTA 2Y6ZA 3IGHX 3QSTA 5I3IA 2MNRA 3SZ8A 2ZUMA 2GVJA 3VOFA 1M1BA 4YTRA 3P82A 4FAMA 4JIEA 1A50A 4UFKA 2O92A 3KZPA 1OX4A 3NQBA 3EPMA 1YBQB 3FA5A 4V33A 2OYMA 1E71M 3BL3A 2V67A 4XTDA 3SAZA 4PMRA 2UV8G 3W2MA 3MDWA 3VAVA 2F9RA 3G1FA 2OSYA 1FH8A 2NXHA 2HSAA 2CHOA 2QW5A 4WJEA 4AHOA 2YCKX 3WY1A 3NWRA 1LZOA 3H24A 4RZ5A 1UKSA 3M0JA 2VZOA 5G2WA 1KXHA 5ABFA 2QDEA 1YKWA 1PEZA 1A49A 5AC8A 1XLKA 1WDQA 1UR3M 3RX2A 3PSVA 4C6DA 5F1VA 5A8NA 1YADA 2D1ZA 5F1UA 1P43A 4H83A 1YXCA 4WGXA 3BLPX 3PHAA 1J8VA 1TR1A 2A3LA 3MMWA 4GQQA 1PIIA 3BG3A 4NAEA 3PAJA 4L1XA 2V5CA 1RHCA 3VMPA 1TZZA 1V6XA 3BSGA 3E0FA 2DZSA 3GU1A 3K2GA 1HP5A 3BK0A 4JX4A 4PL1A 1CLXA 1MDRA 2PDLA 3RFAA 4FNQA 1PHWA 1MYRA 3K5XA 4GVFA 1U1JA 4HN8A 3G0XA 2O9TA 2V0TA 3S2MA 1WV2A 3SDOA 2AOSA 5HQMA 2QEZA 5AB3A 4GPNA 4CVWA 3CZEA 3VX0A 1UUOA 2WYSA 4PCPA 1MNZA 2XVGA 2ZRUA 4JZ5A 3W75A 4GBDA 2HJPA 4RE2A 3NQVA 1XYZA 5HINA 1BFNA 3NO1A 1GT8A 3ZZ1A 5H1WA 3UP8A 2PDBA 1TRIA 4CQ9A 1ODUA 1EFZA 1LM1A 2FPVA 2D3LA 2VWTA 3VOIA 1B4KA 1V93A 4KCTA 3TXZA 2TYSA 1SMAA 2ZC8A 1SW0A 3BG5A 4QJ4B 2IXUA 3IVTA 5DMMA 3AS2A 3C8NA 1ISVA 3JR2A 4AX7A 3W85A 4XBKA 3H12A 3O8AA 2WZHA 3H23A 2E0PA 4IUGA 4GUGA 4AHPA 1B2YA 4OWGA 2FH6A 3EWZA 2WXDM 1KGXA 2QJNA 5AECA 4KRTA 1OQFA 3WEMA 2ZA2A 5JXQA 1LLZA 3W7CA 2QZRA 1GUVA 3TZFA 1CIUA 3WDHA 1W5OA 4J3VA 2E9MA 2BGSA 1W3TA 3VNJA 3VK5A 2VCAA 4PUNA 3RLVA 3IGXA 3STCA 3KRUA 3MMUA 4RNJA 3EX1A 1HFBA 4JX6A 3W7GA 3P7YA 1NARA 2FMOA 1OFEA 3PBVA 1OGSA 5I06A 2W27A 2GGEA 4K1GA 1FXQA 4OFCA 3QN3A 4FNRA 4AMAA 1EDQA 4PC8A 4PN2A 3QY8A 1N8FA 3NEVA 3H2EA 3MI3A 2DFAA 2J7EA 2PI6A 3CASA 1GOXA 1TVLA 4Q4OA 2FB2A 5F2IA 3IRDA 1ADOA 1UWAA 2G8ZA 4PB3A 4M8UA 3GVRA 1T96A 3GD6A 2ZC1A 4GJJA 5D38A 2O7QA 2ZXDA 1R3QA 4HHPA 4IPJA 5HWJA 1OZQA 3BQ5A 3KCJA 5A94A 3GTIA 4DO5A 2OKOA 3KOWA 3GS6A 3L4VA 3F4DA 3WMLA 4UQBA 3WK0A 1MUMA 1RALA 3BLIA 1D3CA 1H4PA 1LOSA 3WIJA 2VFIA 5DEZA 3AXHA 5CCZA 5G1MA 1NEYA 1POKA 4M24A 4AEOA 4K39A 1TREA 1Q7ZA 3V35A 1T41A 5FJPA 3I7SA 1FWHC 4ZQMA 3QRHA 1XCFA 3IGUA 4M0XA 5FA5A 3KWXA 1X8CA 1GKPA 3E3HA 2RJGA 1OJXA 4LFYA 2H6RA 1E1EA 3E12A 5AKQA 2P8CA 3KAOA 3TC3A 1KD0A 1UWTA 4O19A 1LQ0A 1Z69A 3M5ZA 3QTPA 4PBFA 3TTEA 3KDOA 3R10A 4CD7A 1DVJA 3B8SA 4YCPA 4PRTA 1VZWA 2NX9A 4HU0A 4WGHA 3S8HA 3H70A 3HB9A 3B8WA 2X30A 4TX8A 4DJDD 2VDHA 4H6RA 2DSZA 5E6ZA 2PDXA 3VNMA 4J35A 1VLIA 3N9RA 3VIFA 3Q58A 3DECA 4F2UA 1TKKA 3XIMA 1U22A 4H9TA 5F2MA 3W3OA 1BRLA 1TUFA 1XLFA 1F3XA 3HZ3A 3KL5A 5HAOA 2Q09A 3W7OA 4ZQPA 2PDHA 2I9EA 3GX9A 3IK4A 2ZDRA 2XGBA 1LOLA 3QLLA 4A05A 3MBFA 5TF0A 4JYDA 2ZXBA 2YDSA 1NWSA 2PWVA 3V5OA 1A5CA 1XXXA 1W5NA 1VIZA 2J88A 2GSJA 1R5YA 5CAKA 1HW6A 3APYA 4EOUA 4MB4A 3U8GA 4HTYA 1R3WA 1TMQA 1TVNA 2ZWYA 3N19B 3RN6A 5M17A 3TDFA 2GK1A 1H62A 2X0YA 4OHQA 4WHBA 2XJ7A 1V08A 2DSUA 4Q6XA 4NSBA 2V63A 5FESA 4KFNA 3K4DA 2J66A 3M1ZA 4NX5A 5EU9A 4BF7A 2QCDA 4HMEA 3UR8A 1YHTA 3PPGA 5DX7A 1A4MA 2VVSA 3CK5A 1ZJIA 2O9RA 2CZVA 2PUZA 4EK7A 3QKEA 3ANVA 2NWRA 8A3HA 4QNWA 3ZJ6A 3MKVA 1RA0A 3DDMA 3H4XA 3G77A 3N04A 3LRMA 4ICCX 1C3FA 2H8XA 1ZTVA 2I17A 2W79A 3PWIA 1UPMB 1QCWA 1FWCC 3WF0A 5J5RA 2ZADA 3N11A 4ZFMA 1H11A 4RKAA 3AIEA 2A5HA 4MWAD 1JFHA 1DJGA 5D9MA 1JRBA 4GIAA 3T05A 3R8GA 3C2EA 4HZ8A 1F3TA 3TE9A 1P0EA 4WDTA 3ABZA 3RXZA 3H55A 4DB7A 2A85A 2J7DA 4NZ1A 3UBPC 4GX9A 4IXXA 5EFDA 5CQ1A 1AJ0A 3WLKX 1H51A 4GA8A 3GVQA 1YTEA 3L0NA 3XINA 4WSJA 2GJRA 1FWGC 2YSWA 5CKSA 2E1WA 3KVKA 5DCEA 5A8PA 2W5FA 1Z44A 4O15A 1WDWA 3F1QA 4RV3A 5IHRA 1SZNA 2OSWA 3MZNA 2GDQA 4MUPA 3W1UA 5E5CA 4YCOA 4AXNA 4IMEA 1D7FA 3PY2A 1KC7A 4QLJA 1OY0A 1SSDA 1HKWA 1YYAA 2HXTA 4B90A 4KWUA 1TWSA 4JTQA 3N13A 5BWFA 3W82A 3EA3A 4KRUA 1VRXA 2OQLA 3B8UA 3MHFA 1ADSA 4A4AA 3GM8A 3R2GA 3EDEA 4MWAE 3LB0A 1PTDA 4IPNB 3LMZA 2Y8UA 1UPPA 7TIMA 3P8JA 1FP9A 4P5UA 4Z17A 1JUBA 1A0DA 4FXFA 2YJQA 2FDSA 3BOLA 1AJ2A 1QNVA 2AMGA 1XH1A 2PE4A 3UXKA 2BVWA 4IGNA 2FDMA 1OCQA 1W8GA 1Z3NA 2GJNA 2HEJA 1E6NA 3OHMB 4FXRA 4PCTA 3NQEA 3VFLA 1EB3A 5E1QA 4CNPA 2NWSA 4ICNA 3AIVA 4AH7A 4F9JA 4H1ZA 2POZA 1XIMA 4Q22A 1SZRA 3PJTA 3LHWA 3WDJA 1VLWA 1JQVA 1ZCOA 3MU7A 1UWIA 4AD2A 1ZAJA 4PMZA 3WLIA 3EMZA 3AXMA 4IMAA 3TTSA 4EXQA 1LRTA 4N2YA 3QW3A 3UWEA 4JDYA 3TW7A 4WLCA 2UBPC 3FCPA 3VIOA 3PUGA 1BLIA 4CNSA 1EIXA 1CECA 3LZ3A 4E2OA 4XZ9A 3D5HA 1DTUA 3RGTA 1OT1A 4ZO6A 3WLLA 1POJA 3E9AA 5FIPA 3TWBA 1XLAA 3MV01 4I6KA 4DI9A 3G24A 1XQLA 2CPUA 2INZA 3L5AA 3GDMA 4NAFB 4WKHA 4LNCA 1CDGA 5HQEA 2ZE0A 2WSRA 2QUUA 3RF9A 4TVUA 2G3MA 2PDUA 3CNYA 1KXQA 1TE1A 2PA6A 5TIMA 1VD6A 3C3UA 3LCXA 1WE5A 1C90A 1EWEA 3H2NA 3A21A 4U3CA 1S5TA 3J7HA 5HUOA 3FJLA 2W62A 3R0DA 2HDJA 3BLDA 4M51A 2A6LA 2YGYA 2Z1BA 3IIXA 4IJCA 1US0A 3CWOX 4QAWA 2E6AA 4KWSA 4XKYA 3LHVA 4GFSA 3CUFA 3W6MA 2X40A 1YIXA 3ICJA 3CQHA 4UFHA 5A3HA 1WUEA 3RPTA 4PUJA 3WNLA 2VVNA 4PEEA 5CLTA 2NW0A 2NUWA 4V15A 1ZLPA 1UWSA 2WMIB 1O12A 3R0KA 3G3MA 1X1NA 5FL0A 2BVDA 3UWQA 4ZB0A 1AK5A 1A5AA 3CQ0A 1IHIA 4U10A 1Y5VA 2ZQ0A 5FF2A 3WFAA 3G1YA 4PTNA 1KV5A 1XYCA 3NSNA 2QPUA 3F5JA 1C7TA 2Y7DA 4Y9PA 3O6YX 3PG8A 1BYDA 4AIBA 1E5JA 3W7EA 3UYIA 3E2QA 1UR9A 4GQBA 2NQ9A 4F2TA 1LCOA 1HVXA 3BV4A 4IF2A 1RBLA 4MB5A 4IPPA 2VFHA 5XIMA 1DPMA 1XFBA 5D8ZA 4WOZA 4XO6A 3QPEA 5BZAA 3W2LA 1H63A 3GIYA 5I3KA 1D7KA 4ILSA 1C9DA 5CC5A 2VWSA 4J9JA 1ICPA 4DXXA 1MXGA 2ZZ7A 4N02A 4IQDA 3MO7A 3CEPA 3SN4A 2C0HA 2OWXA 2ZTJA 2OT0A 3NPXA 2CBVA 3NDYA 2JEPA 3EX4A 2CC0A 3O7UA 5IDIA 1UWUA 2IPFA 1LOQA 1CXEA 4W88A 4LOCA 1WZKA 2SFPA 3EXTA 1XBXA 4DWDA 2YDAA 1XUUA 2VNCA 1I75A 1M7PA 1FA2A 3K4AA 4JQ1A 4PB4A 4F9DA 3WL1A 1Q6OA 2IQTA 3F4CA 4ORMA 3MS8A 4IFKA 1S46A 1H2JA 1EGZA 4BEQA 4G2DA 3MYPA 2ZCGA 2VZTA 2PU0A 1VH7A 1VPQA 4JTLA 1TTIA 3OZYA 4IZGA 1I4NA 2A79A 1QI0A 3VD3A 1NWTA 2WVVB 3AWNA 2ATMA 1KCKA 3A13A 2A3HA 1XIFA 5ABFB 2EPMX 4XZWA 1K9DA 2ZRVA 3LGEA 4IMFA 2CHNA 3LRLA 1ZJHA 1C8VA 2ON3A 3MY9A 1RLDA 1IR1A 2CHRA 3H22A 4CVUA 3V75A 1L9WA 3NOYA 1FDJA 3WNMA 4NZ5A 2I56A 4K3ZA 3RMJA 4F40A 1JPMA 1V03A 3MUY1 3WDRA 3S1UA 2DIEA 2DZTA 3T40A 4JFSA 1E15A 1XRSA 2WBGA 3WSUA 3LCLA 3AFBA 1TZ7A 1UC5A 2PAJA 3MB9A 4HNNA 3R58A 4IIBA 4YTUA 1LQ2A 2OEJA 1RR2A 2TRSA 3TYCA 1YNPA 4PUMA 3GAKA 4PUDA 1F3EA 4BQ2A 4E4PA 2PTZA 1R8LA 5AC5A 3PBWA 4XZLX 1AQHA 2VEKA 5I78A 3C2VA 2E3ZA 4QNEA 3WUGA 4LUIA 4FA3A 2V5KA 3N34A 1TX0A 4A3QA 4JTAA 4FNUA 2J7FA 4XIAA 3CUZA 1IEQA 4O18A 2FYMA 5BOFA 4LCQA 3FVMA 3II1A 1UD3A 1XYMA 1RP8A 3BLLA 2YB4A 1UQYA 2QV5A 3OW1A 4HVXA 3DEQA 2FTYA 4JY9A 3N3TA 4W87A 3KUMA 1W17A 3AUOA 4UTWC 3SJNA 1E55A 3SCOA 4JTTA 1IWAA 3WF2A 1BGGA 2WNWA 1J2WA 1EBHA 1NFPA 1VP5A 5FEPA 1S2TA 1SU5A 3NL2A 1HP4A 3N2TA 1GG1A 1UD2A 4D8AA 3NQFA 3LNPA 1Z6KA 3AIUA 5GJPA 2UY5A 2QDDA 2A7NA 3THQA 5E9XA 3HJZA 3MSYA 3O07A 4TTGA 4CQBA 4LAOA 4DHGA 4I9JA 4JAWA 1OM0A 4AIUA 2XUCA 2E6DA 2DT3A 2FTWA 3LI1A 5EMLA 4U5KA 4ORIA 3SFKA 1E0VA 1EC8A 3W7MA 3MCMA 3VKJA 1GZGA 3KBWA 1TUXA 5TD4A 1EJTC 3TEVA 1CXKA 1FFQA 4UTTC 4H3DA 1F61A 1WZLA 4CU7A 3WK2A 3IANA 2D3NA 1LT7A 3DKLA 1UR2A 1G4TA 2BXVA 4OU1A 1TFVA 3AHYA 3B06A 1P0DA 2W9MA 3P81A 4BA0A 3PP7A 4E8GA 3QYQA 4TOQA 4AW7A 7REQB 4JFWA 2DZVA 5IFTA 5E0KA 2A3CA 2HPIA 1AQ0A 4NXSA 5JUVA 4NRRA 3DKJA 2B7NA 3CUJA 4Y8FA 3PFMA 3GTHA 2HNEA 1DXEA 2BOGX 4HKPA 4JN7A 4LB3A 4NXKA 4MMWA 3C52A 4UTWA 3L4UA 4Z2JA 4B4HA 1IXOA 4ZOEA 3TWAA 2WCSA 3VTRA 3FNDA 4MF4A 1RVGA 2C6QA 2GL5A 3A3XA 3W81A 2VOTA 3TTYA 4GLEA 4LB4A 1VHNA 2J13A 4ERAA 3MVIA 1GOKA 1B4EA 3RM9A 3RHGA 4U3AA 4HPXA 4QGCA 3ARRA 1QW8A 3CIXA 4GHRA 4DI8A 3MC5A 4XUYA 2GWGA 3FSUA 3HQ1A 4XZHA 4QS6A 4FX7A 4IJRA 2HZGA 1Y5WA 3E38A 1QK0A 4WY0B 3NVDA 4UR9A 4N9EA 1Y5XA 4XBSA 1IEVA 2B81A 2DGAA 3BW3A 2IPWA 3DH7A 1W9UA 3OEXA 4EANA 5CBJA 3V4BA 4UTTA 2ZDSA 1O6IA 3VU2A 1VJSA 3QTGA 4Y8EA 4ALDA 2F2KA 1A3XA 4QCFA 3DOPA 4DYEA 1ZB5A 4F4RA 3ELFA 3T55A 3PB0A 1JCTA 4ZO9A 1I2OA 5L9FA 3GHTA 1UP2A 2CLLA 3MI2A 5U4NA 2WPBA 1HNYA 1HO1A 4Q7NA 4J27A 1XIEA 1AD4A 3LD5A 5CZ0A 5DFAA 3VXGA 3O2LA 1PVNA 5A2BA 3S9YA 3N6JA 5MKGA 1BHGA 4ECLA 2C3ZA 1NJJA 1FX6A 4GVGA 3D47A 2NQZA 2VMFA 1R9YA 3W24A 2DZUA 1GJPA 3T0BA 4Q4KA 3THDA 1J79A 2OX4A 1QVBA 1KWGA 4H6KA 3AZSA 2PTWA 4LVBA 4B5VA 3DXIA 1E9ZB 1DIEA 3BW4A 4UC5A 4F0KA 4MM1A 3TA6A 2EPKX 3AMLA 3I10A 3LTSA 2WHMA 1HGYA 1XYFA 4N42A 3OVQA 2W4XA 2ZYFA 1JR1A 1KGUA 4AVNA 3VUPA 2P0OA 4WK9A 1CGUA 3P0WA 4MKNA 2EBNA 1HKIA 5KETA 1NDZA 9RUBA 3NQMA 5FAJA 1I0DA 3CUIA 1JDFA 5LNSA 4GUFA 1MI3A 4NJIA 3HGOA 4PMNA 2DZBA 4R5EA 1XSJA 1CX9A 5AHFA 3NQAA 1GK8A 3CZGA 5LA1A 4AWTA 4AZCA 3URNA 5BU6A 2L5HA 5AHNA 1REQB 1TYGA 1I6NA 4C6CA 3AU2A 3JUGA 4L6OA 1F8MA 3O6CA 3U7VA 4JFVA 3VX1A 4ZTYA 1MFVA 5A2AA 3GTXA 1YRRA 3N6QA 2H9AB 3C0LA 3QGAC 1Q2SA 2FZMA 4BQ4A 4G7EB 1G6CA 4JQAA 3HG4A 1TV4A 4CLMA 4NJJA 1KRMA 2XFFA 3T0DA 2WCGA 4KPLA 3K8KA 1UC4A 1DE6A 1KFEA 1PZ1A 4QROA 2P5NA 5G2IA 2INFA 5FF7A 1T8XA 4IQEA 4FXJA 4AMCA 2ABAA 5DRIA 3S6DA 2BWGA 4JKMA 4IP7A 1NFBA 1XG4A 1TTJA 3LV6A 3UYCA 3CTLA 5AZ1A 3S3GA 3AI0A 3GFZA 2PB1A 2R1MA 3UD6A 1PS9A 4WDXA 6XIAA 4UCGA 3TR2A 2YYTA 1VKFA 3SADA 3VCNA 2FHCA 3RU6A 1XGZA 1GWJA 4P7LA 1PCKA 4JTEA 4JEQA 3SUWA 3W87A 4UMBA 4XSMA 4DYJA 4AC7C 3NYZA 4H4IA 1BQGA 4MDOA 1UJPA 1JNEA 2ZKMX 2HVNA 1K8CA 4WDUA 4YVPA 1MEWA 3B8VA 4UFMA 3TV8A 2J79A 4FLQA 1LLWA 1Y65A 1FUYA 3MCNA 4KKXA 4LUSA 4I8DA 5EMYA 3HBLA 3N2XA 2CW6A 4CNUA 2QJMA 5A8QA 4GNVA 4HN4A 2BSLA 4ACZB 1XBYA 4MAVA 3L4ZA 1G69A 3DIPA 4LPCA 1P7TB 3MT1A 3M44A 3GK0A 3F2DA 4M19A 2GVLA 4B9ZA 1Q3NA 2HNHA 1T5AA 3V0SA 5FACA 4XAYA 4FZIA 3EB4A 4CD5A 3FA3A 3WD0A 2ZX9A 4ZE5A 2AQVA 1LWHA 1PJ9A 3PZUA 1U33A 3MO4A 3GNNA 1GQNA 1IF2A 4GBUA 5A8OA 1G1YA 5H8MA 4KWOA 1RP9A 1UKPA 1TPB1 2XN0A 1PWLA 3CC1A 1VIWA 2O4QA 3WD3A 2ZX6A 1W9DM 3GNPA 4N9CA 3CEUA 3NDZA 4GVIA 4LUTB 2Z0IA 1OFOA 2F61A 4RDZA 4PRWA 3N3MA 4FIQA 1AZ2A 2PCQA 5IBXC 1JPKA 1A3WA 1HQTA 3DC8A 4PSRA 3CIVA 3G1SA 3B4YA 3GR4A 4LYPA 2QMKA 4F0HA 2XH4A 2W3ZA 2GQ3A 1LRNA 2HK1A 8CGTA 3AHVA 4QEEA 3GLCA 4UQAA 4KETA 2WMGA 1JJKA 3HGJA 1GORA 2VENA 4PUKA 3VGBA 1ZRQA 4BR1A 3A64A 2PC4A 4URIA 5CPTA 2O9OA 3GDBA 1VFOA 3DERA 3DFTA 2CXGA 5GQBA 3AU6A 1CCWB 3V36A 1H5YA 1S5NA 4AVOA 3FN9A 1GVQA 2FVMA 1XM3A 1FP8A 1EL3A 1LRQA 3CS2A 4YMZA 3URQA 3S9ZA 7A3HA 3LUTA 3AZRA 2YIHA 2Z7KA 2OPJA 3MUCA 2J9YA 1LG1A 2W63A 4WDWA 1Q85A 4PMJA 1MXDA 2H90A 5IXEA 6XIMA 3COTA 2Y61A 5A6LA 7XIMA 1ZQ5A 2D2OA 1YEYA 4MZ1A 3WKZA 3T0CA 2DIKA 4HYVA 2VRKA 3N9SA 1RY0A 4D6JA 1K70A 3KVMA 1Q13A 3OOQA 2J7BA 2A7RA 1ONXA 2WMJA 3VC5A 3LCHA 4BQ3A 5J8LA 1E4IA 1XCWA 4MHBA 5ABHA 3SCVA 1QT1A 2Y88A 2QF8A 3O05A 5ABEA 3EEZA 4GIYA 3PUEA 3LLFA 3WD4A 1VF8A 1FWTA 3G22A 4JTRA 4K36A 4QR6A 4E3TA 3N4FA 1UOZA 4QBXA 5IBXA 4DPPA 2VJXA 5LYRA 2BLEA 4CU8A 3ALFA 3WZ0E 3HMJG 3TW9A 1QFEA 3UZ5A 2PODA 3L5MA 4IH3A 2C13A 2YPIA 4LBRA 3A23A 1G0CA 2FKPA 3WMCA 4GUJA 1VBUA 2R24A 1E1CB 4O17A 4M6UA 1VCFA 4YNGA 3TMLA 4NJHA 4GY1A 4OIFA 4FHAA 4B3ZA 4XAFA 1ZY9A 3PZVA 3LG3A 1UKQA 3APGA 1YDNA 3WQCA 3O3RA 4K7YA 3RITA 1X38A 4O0ZA 1M7XA 2OQHA 3TP4A 3HIJA 4JTJA 1KCXA 1OWQA 2J75A 5EPDA 3QZAA 4HK5A 3W7DA 2QVNA 2DIJA 1S2VA 4N4QA 1WOBA 3B8IA 2ZZ1A 2WZEA 3E02A 2C1GA 2JFEX 4QM1A 1ECQA 3PTQA 1H60A 1C9WA 1TCMA 3KL3A 3BO9A 4LX4A 3W9ZA 2NQLA 2OTDA 1FCUA 3JU2A 3GTNA 1SJDA 3G5EA 2TODA 1F8IA 1XJBA 3S2JA 1US3A 3TSMA 3PJUA 1BGAA 3WH8A 5D03A 3WQOA 4F66A 3K1GA 5ABTA 3I3DA 2RUSA 2G96A 1KKOA 1LBMA 3IJLA 2QUVA 2ZIDA 1EO5A 2FZBA 1V3IA 1Q45A 4E8CA 3HURA 3L4WA 3OLDA 1VBJA 1GGOA 3CLWA 1PAMA 1MWOA 2FMNA 3GU2A 4ZZ9A 3W4RA 4BHYA 3TMQA 1W3JA 1PZ2A 3H54A 5L6UA 3BH4A 1V0NA 4C1NA 5HA7A 2X05A 3WLSA 3VNIA 1XI3A 4IIFA 3OGRA 4W7WA 1H61A 1Z32X 4XZBA 5D2WA 3P67A 3LQLA 1CLVA 3BZJA 2ZRWA 3VMNA 3CHCA 4Q32A 3GHUA 1NH6A 3U9IA 4NZ4A 1JZ5A 4WKAA 1WDRA 1XF0A 2QULA 2Z1WA 4EXAA 3THCA 4RZ6A 3WQEA 2YL8A 3VKDA 5E9AA 1YTKA 3F2CA 1XX1A 1XWYA 3VYLA 4EXBA 2EO7A 1G7VA 2X7WA 1EH9A 5FF0A 1O4UA 1UR4A 2PF0A 4L6DA 4YYCA 1B5TA 4QDPA 2QMJA 1GVRA 2CLIA 3PZOA 4Q8MA 2VX6A 1F07A 4AU0A 4GY7A 5FAGA 1UBPC 3UNTA 4GFIA 3B9NA 2WKLA 2OSXA 1F4HA 1QUMA 4ZQNA 6ALDA 3UY7A 4EAMA 4OBRA 2D2HA 4CGTA 5BRPA 2VQTA 3U4FA 2OR2A 4K37A 5B7ZA 1E3XA 2ZUNA 4QDWA 4K2SA 5DMLA 1CI1A 2PEVA 3AXIA 1Q7QA 3TSBA 1LG2A 3RAOA 3FLUA 5BW6A 1OSEA 1LBFA 4GO8A 3U2EA 1YLVA 1O5QA 1XSKA 4I9MA 5I3HA 1VAHA 4DUVA 2PLJA 1TJ1A 1DWAM 1HJUA 5HMFA 2E09A 3NA8A 2PDFA 1WPCA 4MJMA 1DP0A 2C7FA 1V6WA 5AC7A 2XZ7A 1BWKA 2AGTA 1FWIC 1LQAA 2VCCA 3WLHA 3W0KA 3DG6A 5KZEA 5CGTA 2PDQA 4KRZA 5D2TA 2VO5A 5F4WA 4QQ3A 1QATA 4MKSA 2R14A 3WNOA 2FJKA 4GXMA 2GSHA 5I79A 1PSCA 1SR9A 1WCGA 5AY7A 4ASTA 1OIMA 3VNZA 3P5ZA 3OYXA 1EHNA 3NPUA 5LA0A 2CBJA 1SUXA 2XISA 1GHSA 1YPFA 3RLGA 3IIPA 3TAOA 3WQ4A 3CO4A 3FK4A 3FSTA 1BYCA 2G3NA 2REQA 3OG3A 4UOJA 1WOAA 4HBKA 1I2PA 4UTHA 1XLIA 3RM4A 2Q3RA 3PULA 4NG3A 4E4UA 1RLCL 3OZMA 4UOZA 4WJXA 2DV0A 1MVYA 4ZQCA 4REQB 3W2KA 1J10A 3AUJA 3LSBA 1DYSA 2B7QA 5HNUA 3VA8A 4XZIA 1J6OA 5D02A 3EXSA 2WZIA 1XBVA 3PWGA 1FOBA 3FJ4A 1EYEA 4UQDA 1TPDA 3ES8A 5HJXA 2E6YA 3QV9A 1AW5A 3F7JA 3SRFA 1Y8BA 3BAIA 4GRSA 4KMQA 1BTMA 1IT7A 1NU5A 2VGGA 4AZ6A 2FVKA 3H2AA 4MNMA 2YB1A 4LY4A 5CZSA 4IG2B 2GZXA 2P3ZA 1QO2A 1I2NA 3OIHA 5AVHA 3KX6A 3KW3A 4UXDA 2GFTA 2ZZ6A 3WD2A 3LCGA 4C91A 1O66A 3I6RA 3AS1A 1XIDA 3FDKA 2V5BA 3OB8A 3IJQA 1ZP3A 2DT0A 3DHUA 4KGLA 2HVMA 2DZAA 1KCLA 1TVPA 3P5YA 1VCVA 4HMDA 2ZE3A 3VDGA 1Z8AA 1OFBA 4EAYA 1XDJA 1U5HA 2XH0A 3HA1A 5JBDA 4KFOA 3TNBA 3GDTA 2CFFA 1WYIA 4CNTA 5AYZA 4BWLC 4TUFA 5K9CA 2QYGA 2V69A 4M1RA 1K7XA 4ZVJA 4W86A 1GYMA 5KEZA 2CKRA 2YKKA 3VNDA 3M7SA 4WZHA 3T44A 3GXFA 3VFCA 1JI2A 2R9RA 2IKGA 4TQTA 3GTFA 3PBGA 2FPYA 3P62A 3T2PA 2TSYA 2Z27A 4Q4QA 3IARA 2OZ8A 5LZLA 3EX3A 3DZ1A 2WMFA 2OGYA 1RZMA 3P8IA 3N29A 1EGVA 3B04A 3KOYA 4MOZA 3CZ8A 5D2XA 4EPKA 2Q3OA 3KBVA 4ZSTA 1KRAC 3KOZA 3RX3A 1LL7A 4LAUA 1DIOA 1U1UA 4BI5A 1MW3A 3R4IA 4JCLA 2PTXA 2DEPA 1BF2A 1M68A 2ZZ4A 4NUWA 2BBFA 6REQB 2V81A 1Q6FA 3GXPA 3PTDA 3WH5A 4LEQA 3N4AA 4DUOA 3U57A 1GTEA 1AD1A 2NXIA 3VOHA 4P7QA 1OINA 4CNNA 4GH3A 2ACUA 3WEOA 3OZOA 4MLJA 3HF3A 1CTNA 3LPOA 4AZCB 1JZ7A 1YTDA 4AZIA 3M0XA 3VD7A 5REQA 2B0MA 4IIGA 3WDIA 4ML4A 2QCCA 3BPWA 1IE7C 3WX7A 3ZVHB 3G1VA 4M6VA 1Q65A 1C92A 2YYUA 2W0UA 1FBAA 5CBIA 1GQIA 3DHPA 4R85A 1ICQA 2VT0A 1AW2A 3G2GA 3MJMA 4Z0SA 4L5ZA 1EYWA 1JYWA 2XWDA 4E2DA 3M7WA 5LHEA 4HQVA 5TBOA 3OLIA 3ID7A 3C3NA 5BMWA 4PH6A 3KOXA 4O16A 5F4XA 4L4PA 3TYAA 3RRAA 2E8YA 1AQFA 5CZKA 4XIMA 1LDCA 2NLIA 3UWZA 2PDMA 3IRSA 3WQDA 1H09A 1FWFC 1MW2A 3LHZA 3A4AA 4ERIA 5EBUA 3P6LA 3LBMA 4AWSA 2BY3A 4IIEA 4UQCA 3BJFA 2DORA 3TKFA 4JD4A 5I24A 4D2JA 3EAUA 3CHFA 6A3HA 1PZ3A 3LERA 3SGUA 5K9XA 3ZOAA 3NQGA 3W72A 1ITCA 1XIBA 1RK5A 1F73A 2VC5A 3WQFA 2RFGA 4I7VA 3GIPA 4X63A 1EHAA 4LAZA 1T8QA 5EB8A 4FOUA 1H1ZA 2IPJA 3RO8A 3GO2A 3L0KA 1E9IA 3SRDA 2Y63A 3ORWA 3U48A 3LLXA 1V8EA 4A3UA 2LLEA 1UZ4A 3U5UA 1TPC1 4M3PA 4ZOBA 2VHLA 4GI9A 4DZHA 3SUUA 2QPSA 4DJEA 4DWSA 1E6RA 3M0HA 4OV4A 4DO6A 3GKAA 1GCYA 4ACYA 2BFGA 1CB7B 5HMDA 4POCA 4IICA 4N7QA 3G3DA 1TCDA 3IS4A 4D1JA 1ZBKA 1E1FA 4JIQA 3SUVA 3GAYA 4B92A 2ZUSA 4UOQA 4E0CA 5H2ZA 4QE5A 4F8XA 4UCFA 1GOWA 5GNZA 4X2PA 4D9PA 1TPEA 1G7UA 1YNYA 4LCSA 4TO8A 3MW7A 3MWCA 5EMJA 4YS1A 3GC2A 1W9PA