1OVDA

The k136e mutant of lactococcus lactis dihydroorotate dehydrogenase a in complex with orotate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
311
structure length
311
Chain Sequence
b'MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLPRYVDLELGSINSMGLPNLGFDYYLDYVLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGEPQLAYDFEATEKLLKEVFTFFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLFIDPEAESVVIKPKDGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROOROTATE DEHYDROGENASE A
publication title Lactococcus lactis dihydroorotate dehydrogenase A mutants reveal important facets of the enzymatic function.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Oxidoreductase
total genus 115
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2003-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 1ovdA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ovdA01
3G18A 4FB7A 1VCVA 2R94A 3HPXA 4DXVA 5F2MA 1GVFA 3LB0A 4QAIA 4JN6A 3DHFA 4UTUA 4YCOA 4AXKA 3L2IA 3LHTA 3W1AA 2V8ZA 4DO5A 3OVQA 1XM3A 3C0JA 3LTPA 3TFXA 4JTUA 4IMGA 4EVZA 2H8XA 4TMBA 4BWLA 3CQ0A 1WBHA 4ZMGA 5EYWA 3FLUA 5IM51 3KVKA 3MW7A 1X1OA 5C55A 4L4MA 4JTLA 2ZZ2A 4EWND 4AHOA 2YDAA 1F74A 4O1CA 1OF8A 2C6QA 4UTTA 4YMZA 5D32A 4DPQA 1TQJA 5KZEA 3EWZA 3W7NA 4K6AA 4RX0A 3GAYA 2V30A 3LBCA 5F2LA 2ZFAA 1B4KA 2R14A 1VHCA 3W1NA 2XN2A 3V75A 3HF3A 2NX1A 4E38A 4PEKA 4IMFA 2EAWA 4LUJA 4RXFA 4JXCA 5TBOA 3GDLA 3NO5A 3IVSA 2NUXA 2P1FA 1R2TA 4RR4A 3DFSA 4NT0A 4LUIA 5G1YA 4CQAA 3NVTA 5F4SA 4GUGA 3TXZA 3NOEA 1TRIA 4LS0A 2CLMA 1OX6A 3DAQA 2WOQA 4XKYA 4RJEA 5MHBA 5G4WA 3E49A 1I45A 4ALDA 1JQVA 1ML1A 1B3OA 5CZSA 1DJQA 4PCFA 3O06A 4CCDA 3HGOA 2QCFA 3G1DA 4TMCA 2C0AA 3MI6A 4AAJA 3PB0A 3OIXA 1YTKA 3UXDA 2CLKA 3A22A 1TTIA 2I14A 2QCDA 1G69A 4OQVA 4FIQA 1FXPA 3G22A 4GRSA 3W7PA 3O07A 2I1OA 1ZCOA 1YXCA 2Y7GA 2DZXA 1X1ZA 2WJZA 1O5KA 1DJNA 1O94A 4JR5A 4OT7A 3EX6A 1NSJA 4WOZA 2E77A 3TV8A 1W54A 5D37A 1IXOA 1JUKA 5FEWA 1X8FA 2PRHA 3FA5A 3HPSA 3OG3A 1MSSA 4AVFA 5K7JA 3C2RA 3LHWA 1W56A 3HBLA 2QCGA 4O13A 4ZQMA 4ZQCA 4Z0SA 2E6YA 2NWSA 2YZRA 3TH6A 4AWUA 3S6DA 1W31A 4O11A 4RK8A 1WX0A 2ZZ1A 1TTJA 4NJJA 4TIMA 2BXVA 3NL6A 2RKXA 1KTCA 4IUOA 2BWGA 4FNSA 5BMWA 4HSNA 4NQ1A 1I2RA 5HWMA 3N9SA 1FCUA 3E0IA 2E6AA 4KFPA 3WJXA 1SZFA 2RDWA 1PHWA 3ZS4A 5HUOA 1JCLA 3CB8A 3S5ZA 4CQ8A 4JTTA 1LORA 3G0UA 3BVJA 4TX9A 4NX5A 4Y90A 3R12A 3O15A 2WQPA 3L5MA 3HG2A 3B8DA 3BLFA 1MEIA 4LNYA 2FIQA 4O28A 1GTEA 4GFSA 1SW7A 3LCIA 4K7VA 2QCHA 2B7NA 3H53A 3TNOA 1XKYA 4MFEA 3W7DA 2V2HA 4NVTA 3RMJA 5DN1A 1UBSA 2VFGA 4UFIA 1A5AA 4CNNA 3USBA 3AJXA 1KM1A 3DI0A 3M44A 1I2QA 3EXSA 3S5NA 3BW4A 4MYXA 1HUVA 4M19A 5HQEA 3LCFA 1GT8A 3PF3A 5AHMA 1H7OA 3C2FA 1NVMA 3W85A 4X2RA 1IIHA 1OF6A 3BG3A 1PCKA 1L9WA 3NL3A 1QR7A 3S8HA 4O14A 1HO4A 1EIXA 5DELA 1AG1O 2P10A 1Z42A 3TMLA 3NYZA 4ONVA 4PL1A 1NEYA 3B03A 4NNCA 4FX8A 2NX9A 5TIMA 5K9DA 5AHNA 4JEQA 5DCEA 1L6SA 1K7EA 4LVDA 1YXDA 2EGZA 2VFIA 1W5MA 2VFFA 4QNWA 3T55A 4QM1A 4C1KA 4PH6A 4JDBA 4QSHA 5AC7A 5LZLA 2ZA1A 5AHIA 6ALDA 2QF7A 4RV8A 3CEUA 5DCBA 2YPIA 3P7YA 1XCFA 3N2MA 1EX5A 1SPQA 4IPIA 2ZRWA 4TO8A 2B7OA 5BOOA 3UPWA 1LLZA 3W1UA 1TPWA 2ABAA 5K9CA 3IIZA 3UWQA 4BI5A 4ZL1A 1OFPA 5AYXA 3ZWTA 1AK5A 1K3UA 3PG8A 1SQ7A 4N6EA 3KFTA 1ME8A 3IVUA 1ADOA 1QAPA 1XI3A 1U5JA 4WXYA 4IMDA 1J4EA 2ZZ4A 1IXNA 3DFPA 3MP4A 5DLCA 4GNJA 3LERA 1PVNA 4AEOA 3GB6A 1QPNA 3TE9A 3NZ1A 2DZTA 4CQ9A 3STFA 3LRLA 3W2NA 1LBFA 3R2GA 3EWUA 2QCMA 4O15A 1H7NA 1IGSA 2JK2A 5EPDA 3TQKA 5IBXA 5D03A 5L9FA 4UTWC 5BNKA 4WD0A 4WQ6A 3C2EA 5CPNA 3EWWA 5GVJA 3W76A 2NXGA 2Z1BA 5CPOA 1V5XA 2QDGA 4BFAA 3TC6A 5LGZA 3HPZA 4O0KA 3LHYA 1K7XA 4WY0B 1FDYA 3PSWA 3SI9A 2QCCA 1NFBA 3W1MA 2QDHA 3CHVA 4NZFA 1SO5A 3VNDA 2PE4A 4D2JA 1R46A 1HG3A 4JY9A 1GZGA 4UTLA 2EHHA 4UUIA 3QF0A 3SZ8A 3P5YA 3P62A 4R53A 3HJZA 4WJEA 1G4EA 1AL8A 4C1LA 1VR6A 5D02A 2ZZ3A 3NQ8A 1ZAHA 3LX9A 3FKRA 3EWXA 4IQLA 2YW3A 5EA9A 2FPTA 5LKYA 1V7YA 2ZTKA 2VOMA 3QPZA 3UNDA 3L67A 4NJIA 2C19A 1LRQA 2DJXA 3PBUA 3G1VA 5LNWA 2JBMA 5TQLA 1W8SA 2Y61A 3N14A 2ATMA 6TIMA 2ZDRA 4O0ZA 2Y62A 3M7WA 4XTIA 3MI3A 4FXSA 4EF9A 3QZEA 4Z1CA 4JTSA 3KVLA 2ZQ0A 2V81A 5LNVA 3R8RA 4P61A 1TMHA 1XBXA 2HS8A 3TK7A 1JCYA 5FF4A 1VHNA 2G5WA 3TCEA 4JTKA 3W83A 2CLIA 3S5OA 1FDJA 1H1ZA 4Q32A 3L9CA 1GVQA 4PC8A 5F2IA 3L21A 3EXRA 2V0TA 3IIXA 3LHZA 4R7JA 1F5ZA 3NAVA 4O8RA 4WXZA 3L68A 2GQ8A 3TSMA 3FOKA 5K3VA 3W1XA 1D3HA 1LDCA 4NJKA 1ZAJA 1YLVA 1WQ5A 4O17A 1SZEA 5D33A 3C4UA 4K39A 3G8EA 2VENA 3KVJA 1Q6QA 5DXYA 3PSVA 4PA8A 1HTIA 1T99A 3HG5A 3GX9A 2FPYA 4ZQRA 4MY1A 1P4CA 3KRUA 3PBYA 1ME9A 3O8AA 2DP3A 3PUOA 2WSRA 2A7NA 4RXGA 3KAOA 5A8GA 4LVGA 1MEHA 1TREA 2CZFA 5C2XA 5HNRA 3PY2A 3MJYA 2R8WA 1H63A 4ML9A 3C3NA 4HKPA 3BG5A 3TQVA 3HGRA 3LLFA 2X2GA 1FWSA 1GYLA 1FBAA 3CU2A 4QJ1A 1R30A 5DBTA 4DBDA 3W7RA 2YCEA 2FFCA 4FXRA 2HTMA 4HNVA 3GK0A 1M5WA 1J5TA 1N8FA 2Q8LA 4CCCA 2JKPA 4N4PA 1TPC1 1ME7A 5AHEA 3M5XA 2A4AA 4UTIA 1TCDA 5FF0A 1ZENA 4UR7A 2VFDA 1C8VA 3TJLA 3B0PA 3VFLA 3W88A 5SWUA 1O4UA 5J5RA 1QOQA 4WOQA 3DENA 1LYXA 5LNRA 3EKLA 3I7QA 1KFEA 3TROA 1UB3A 3QPYA 1H7WA 1WV2A 1YPFA 1FDZA 4LRTA 4LVFA 2NV2A 3MMTA 3EB2A 4ZZ9A 5AYYA 3P81A 3E12A 4FNQA 1LBLA 1OX4B 4N2YA 3O6DA 1MZHA 1JJKA 3DKLA 3W1QA 4N6FA 1ZNNA 2ZZ7A 3HIJA 4KWWA 4XUGA 3LCWA 1I2NA 5KSWA 1OFBA 4BWLC 5T26A 4Q4KA 5I3FA 2YW4A 3B4UA 2X1SA 4WZHA 1KM3A 1A50A 1W3TA 1YADA 2J9YA 4Z0JA 4K8HA 3DU0A 3ATZA 5FEXA 3V1PA 4K38A 4UTTC 1RQBA 3W84A 5CSRA 4AF0B 4X3ZA 3UWZA 3F4NA 4E2BA 4UFKA 4MLRA 2E5CA 3B06A 4ZQNA 3DFQA 4O53A 4LVAA 3LXBA 3TQ0A 1L6WA 4L4LA 4ICNA 1G7UA 3VE9A 1LTDA 2ISVA 3NG3A 3NQEA 3INPA 1XBZA 3P80A 1NAL1 1M7PA 1OYCA 4UC5A 2A7RA 3GDKA 3N19B 1TV5A 3WK2A 3EWYA 3EWBX 4WY0A 4E0CA 5C5YA 1TIMA 2CZEA 4ADTA 3NQ2A 2E5DA 1XBVA 4S1FA 3FJ6A 3LCGA 3YPIA 1JRBA 4HIBA 3WFAA 4LVBA 2VC6A 5AYZA 3DFTA 4HNUA 1WXJA 2PC4A 3R5EA 4JDYA 3F03K 4CNPA 1F2JA 1A5CA 4IX0A 5G4EA 3N3MA 4IMEA 2QKFA 2NXIA 2V82A 1UJPA 4Z08A 1YTEA 3S9YA 3IVTA 2FPVA 5HR7A 3CWOX 1QO5A 2AAMA 1F73A 3W71A 3NDOA 2VXNA 4AWTA 5D09A 5D04C 4BR1A 3NR0A 2CLOA 4FX7A 3SECA 1DOSA 1SSDA 1LOQA 3W7LA 1WYIA 2C16A 1GWJA 3KVMA 4N9CA 3UWWA 1VJIA 5BMXA 1GVOA 3MWAA 4QISA 1KTBA 1HFBA 8TIMA 3P5ZA 1JCXA 4FNRA 2GPTA 4XTDA 3L66A 2X1RA 1X6UA 3TAKA 1KW1A 1EUNA 2J88A 3ZWSA 4LS1A 3QMTA 4U4MA 5DY3A 4JD4A 4QITA 1JVNA 2B7QA 5KZMA 2NX3A 1I8JA 1W5QA 3H54A 2QAFA 3L0NA 1H61A 1TPUA 3FYOA 3GVGA 4RCXA 3GR8A 1SW3A 3I68A 3QFEA 7TIMA 3N73A 1HO1A 2V5BA 3S1XA 4LY8A 1FUYA 3IV3A 2PRLA 4FNPA 3NPVA 5F4XA 4I7WA 3ABQA 5F1UA 2ZA2A 1N7KA 4O16A 3DXIA 2C15A 2QEZA 3DBPA 4JYDA 4LU0A 1QNVA 1EEPA 3UPBA 3W22A 3A9IA 3MP5A 1EA0A 2YSWA 2ATSA 1SU5A 3GYEA 1YTDA 3NPWA 4GUIA 4AHQA 1W5NA 4YL2A 2VEIA 3PVFA 4M6QA 1G4TA 2OT0A 1T0OA 3SR7A 4GXMA 4JX5A 3W7HA 4ADSA 3C61A 2GJNA 3W87A 2CLFA 4WY0F 3MI2A 4UTJA 1K8XA 3HG3A 4PODA 3KX6A 4N9DA 2NZLA 3I7RA 2TYSA 3BV4A 3WJZA 4DBEA 4JIPA 3IIOA 3PS7A 1BEUA 4CNOA 1TYGA 3HO8A 4MLJA 4BK9A 2DZSA 3ZFHA 2BX7A 1AL7A 4DQWA 3LBMA 1SSGA 3RNDA 3W7QA 2HSAA 3NNTA 4GUFA 3W75A 1RQEA 3A24A 2JKEA 4P2VA 5AB3A 3W3OA 1FWNA 4RZ5A 3H55A 3P74A 4ZVJA 3CIXA 3HMJG 1GTHA 4O52A 1IIGA 3KHJA 4G1KA 2Y6ZA 3SY5A 4FO4A 4O18A 1LCOA 2JGQA 4MY9A 4BI7A 2BSLA 1I4NA 3PULA 2PURA 3PC0A 3PM6A 5HUPA 1ZFJA 3O16A 1B57A 2VKZG 3NM3A 2PCQA 3TA6A 4O1AA 4EF8A 4UTHA 1VYPX 1OX4A 3D0CA 5F4WA 3FEMA 1TV7A 3G1AA 1F6KA 3PG9A 2ZRZA 3W86A 4NJHA 3GKAA 1VZWA 3THAA 4X22A 1VYSX 2QCLA 4AHPA 5EMUA 1H7PA 3EKZA 1GQNA 5LNUA 5G1TA 1TPB1 5KITA 1PCWA 1F05A 3U8GA 4FHAA 1LRNA 1KM5A 1KLZA 2ZTJA 3U6WA 5HULA 3LCXA 3NXFA 3GDMA 1QPOA 1YDOA 2C14A 3P61A 4AF0A 1X7FA 1AW2A 3TMQA 1O60A 3QMRA 2NWRA 1MO0A 3ATYA 1SW0A 1OFDA 2WNNA 1G7VA 3G0XA 1S5VA 5DBUA 3TU9A 2H90A 1TV8A 3VKJA 1QPRA 3SGUA 3G1FA 3STGA 3NPUA 2GQAA 1YDVA 1K8ZA 5D2XA 1DBTA 5I3JA 1W5OA 3SIZA 3N9RA 1JR1A 2Q3RA 3QW3A 2CLEA 1FWTA 3LI0A 2QJIA 4K7YA 5HR6A 3UWVA 4CCEA 5KINA 1EP3A 1TJRA 3ANYA 3Q2DA 3PUEA 1SZNA 1DVJA 3DFOA 4ZQOA 3UZJA 1HL2A 4NNBA 3O1NA 4UCGA 2FB3A 1DQXA 2GOUA 4MZYA 3M9YA 1JCMP 1MEWA 2J27A 2NLIA 2OX1A 3NQMA 1VGAA 3W1LA 1ZALA 2TPSA 4UMAA 3DI1A 2B7PA 1SO3A 3ELFA 1GPWA 2W6RA 2A6LA 2X1TA 3ABRA 2BLEA 3NZRA 4JIQA 1XDLA 2ALDA 4EOUA 3M43A 4K37A 2DZVA 3W2MA 2GVGA 2B4GA 4I9AA 4UNKA 2RHGA 5CZ0A 1EUAA 4MZ1A 3BPWA 1FCBA 1R2RA 3LRMA 3CC1A 2E1DA 2ZZ6A 2QCEA 4N9EA 1L2UA 2J6XA 4JYEA 2TSYA 4YXGA 3NQ6A 3A23A 2E09A 2F7FA 3W7EA 2HS6A 3BW3A 2FLIA 4BI6A 4IMCA 5CZJA 4S2CA 2ZRYA 1S5TA 3RK8A 3UZ5A 5U7SA 2A21A 3A21A 3T78A 3EX3A 3SW6A 1Q3NA 5L6UA 4LV4A 3MBFA 2WSQA 2CWNA 3OVRA 2JKAA 3EX4A 2AQWA 4R33A 4NU7A 4UTMA 1TSIA 3HQ1A 4FF7A 3PB2A 4Q33A 5K4ZA 3WK3A 3MUXA 3A5FA 3W7JA 4UTWA 3R89A 3TKFA 3BGJA 2CLLA 1QCWA 2GVJA 1KFCA 1RVGA 5AHLA 4M6PA 5KZDA 3UWYA 3VE7A 4MZ8A 3LV5A 2WPBA 1GYNA 4AMAA 3CT7A 1Q6RA 2Y88A 4TR9A 3LHVA 3BW2A 1AW1A 1BWKA 2YGYA 1I2OA 1W1ZA 3O6YX 2TMDA 3QC3A 3PR2A 1ZY9A 3W2JA 3M5VA 2DZWA 1TPH1 1KM6A 2F84A 3Q37A 1J2WA 4ORMA 3S1VA 2QAPA 1Q6OA 4JICA 1ICQA 1XFBA 3S42A 2DJLA 5FESA 3CTLA 4OHQA 4DF0A 1FCQA 1W3IA 3F4WA 3JR2A 4I7VA 2Y70A 5D05A 2G96A 2J9XA 4RZ6A 3O6CA 3EX2A 4UFMA 3DHDA 2A1YA 1GJPA 3P8IA 3I7SA 1KA9F 1RZMA 3HGJA 4MJMA 3LLDA 5HMSA 2NUYA 3BK0A 1KM0A 3WJYA 4FIRA 2FDSA 3E02A 1W37A 4MPQA 2DZUA 1K02A 1SR9A 5AC6A 2A2IA 1UCWA 3PBVA 4M7SA 3NQCA 1KFKA 3B04A 4NZJA 1WA3A 2LLEA 1LP6A 1EB3A 3THQA 5A5WA 5I3KA 4DEFA 3LGEA 4PFMA 5CZTA 3DKJA 1F7BA 4O54A 3QJAA 5AFDA 5EY5A 1LOSA 4GC4A 3MP3A 1LROA 2OT1A 1VCFA 2E6FA 3GXPA 5DCDA 1H7XA 4OGZA 3LTSA 1CX9A 5I3HA 2B0MA 2DU2A 4WUIA 1THFD 1VS1A 2Z6IA 1TB3A 3IIVA 1OG0A 4LTSA 3AO0A 3TW7A 4H3DA 3C52A 4NXKA 4WX2A 5D2YA 1O5XA 1RQHA 3W7MA 3O63A 3P8JA 3BGGA 3ZR4A 1B9BA 2HMCA 2YFNA 3CLMA 1NF7A 4YCPA 1KV5A 5CPLA 3TSBA 1RPXA 3WK1A 2Z6JA 2ZA3A 5C6MA 4FNTA 3QMSA 2CFFA 3RU6A 1OJXA 3TC7A 4U28A 1VC4A 3PUDA 3IGSA 3RFAA 3BLIA 4O4VA 3DGRA 4GWEA 1YYAA 1B4EA 3STEA 2V2DA 3TX9A 4LT9A 1AW5A 1FXQA 2GQ9A 2ZRXA 5HJLA 5D2VA 1XUUA 1VLWA 5E1QA 3CPRA 3W1TA 3CM4A 4OV9A 4K36A 3OVPA 2E6DA 4DF1A 3MO7A 3G0SA 1OFRA 1DV7A 4R34A 2GJLA 3GXNA 4IPJA 2ZRUA 3TXVA 4JGDA 1H60A 3A5VA 1SO4A 4KKXA 2H8ZA 1RR2A 4JX6A 3QH2A 3MHFA 4LC6A 1T96A 4JS3A 5K4XA 3GIYA 1ONRA 3NM1A 5H2ZA 1OABA 1RD5A 2O7QA 2Z0IA 5K2ZA 4A3UA 3M47A 2WNZA 5LGXA 2DORA 2G97A 2FQIA 3C2OA 1IF2A 1XL9A 3GDTA 3FS2A 5FF3A 3MHGA 4A29A 4HHPA 4O10A 2V2CA 3KXQA 2I9EA 5FF2A 3Q94A 5H91A 3C8FA 4JTJA 3UXAA 1SFJA 4N9BA 4OV4A 2BZNA 2YXGA 1QOPA 2V5LA 1YDNA 2A6NA 2Y63A 5LHFA 1SFLA 3NL5A 3ABSA 2Y7EA 3MYOA 1GVRA 2RFGA 3CWNA 3GDRA 2VFHA 1XUZA 4ORIA 4IOTA 1H7RA 3LCLA 1JCJA 3BARA 4A21A 1JRCA 1OFOA 4RZ4A 1GOXA 1EP2A 2EF9A 1JCNA 1UUOA 3UY8A 4HT3A 3TJXA 5G2WA 3LM7A 3W9ZA 1VPXA 1KFBA 2EKCA 4OWGA 2ZYFA 1TPDA 5FF7A 1FQ0A 1OYAA 2W79A 3QSTA 4W9TA 1TJPA 1LM1A 2QCNA 1EWDA 1E51A 4XWUA 4X9SA 2A5HA 3LXAA 3VI2A 4K8EA 1DQWA 2OJPA 1K8YA 4MYAA 4O12A 4GJ1A 2YYTA 3BG9A 2H3BA 3PAJA 1GG1A 3M1ZA 3NQGA 5CSSA 3T44A 3M5YA 1Z48A 2RDTA 5CKSA 1LLWA 5BW6A 4JTHA 1QMLA 1KBIA 3TR2A 1T8XA 2QUUA 1KM4A 1F76A 2Y7DA 1H50A 3TAOA 2ABBA 1EP1A 3IEBA 1A53A 1QFEA 4KWVA 4XZ9A 5D38A 3MBDA 4QQ3A 3NQ7A 1KM2A 4NNAA 1TPFA 1PS9A 4PL2A 2J9ZA 2CLHA 4B5NA 4OU1A 3OHIA 4NX0A 1TPVA 3W1RA 1TQXA 5J5DA 1LZOA 3C56A 1FCVA 1QPQA 2RDUA 4A22A 1VH7A 2VEMA 1G4PA 4LWWA 3M5ZA 3QSRA 4E2DA 3GNNA 3TW6A 4I7UA 2NUWA 3FKKA 1LRTA 1EPXA 1M6JA 1TO3A 4IJBA 4JTGA 1U83A 1BKSA 5HINA 5AOUA 4HN4A 2X16A 4O1DA 4AB4A 5BRBA 5FEPA 3W7GA 4NUWA 3G24A 5U4NA 5CGQA 4RLIA 2A7PA 5AHFA 1DORA 1WDWA 3IGXA 1R47A 1DL3A 3I6RA 3FFSA 4UTKA 4LV9A 4UIOA 1OK4A 4DELA 4YLWA 2X1UA 4GUJA 1FX6A 1N55A 4A2RA 5KMYA 3UWUA 4UR8A 3RLUA 4IXHA 3W07A 3QYQA 1A5BA 5G5IA 5ABTA 2QJHA 3LV6A 3CIWA 4OBTA 4BF9A 1WBJA 3G3DA 3M41A 1H62A 3NQAA 3OBKA 1OHLA 3W2KA 3T4CA 3RLVA 2C18A 1O95A 1SO6A 4ADUA 1KBJA 1G6CA 2QJGA 2YFOA 5FEZA 4JTEA 4KFNA 1W5PA 2H3DA 1OX5A 1VRDA 1C9DA 4MJZA 1W0MA 4N4QA 4S2BA 1Q45A 3FYPA 4HNTA 2E68A 3O05A 5IBXC 4Z1DA 1MXSA 3E96A 3W7IA 4IGHA 5FI8A 4GE8A 3HG4A 3LOTA 3QQ1A 2VFEA 3F1QA 2QUVA 1Y0EA 3QW4B 1JUEA 2ZZ5A 3LDVA 1SZGA 3TIMA 1ZJIA 2Z2UA 3SFKA 2C3ZA 3HOJA 1VLIA 4Y6GA 4M6VA 1GG0A 1LOLA 4LW7A 1CW2A 4UNLA 3NGJA 1S3HA 3KOFA 4UXDA 2WSYA 3NEVA 4JY8A 3W23A 1KFJA 4CLMA 3MHUA 4GBUA 3N2XA 3W73A 3QRHA 1QDSA 2W0UA 3Q58A 1ALDA 3LI1A 1FWRA 2WNQA 4IWWA 3TUUA 2YYUA 2FB2A 1P5BA 5D2TA 3T40A 2G95A 3NA8A 4QNEA 3OEXA 2DZPA 2EPHA 4UFHA 2E5BA 5AC8A 3LHUA 2BTMA 4DF2A 5DY2A 2TRSA 4JTFA 4Z1AA 4NXSA 3SJ3A 1Z41A 3LTYA 1TPEA 5G2IA 5LHEA 2YX0A 2OMAA 2UV8G 2O7SA 3GZ3A 3G8RA 5CPMA 1OVDA 3UYCA 4FEZA 2Q8ZA 4TU1A 1R2SA 2AGKA 1VQTA 3PWAA 5DXXA 5EKYA 1OFAA 1YPIA 2FTPA 1DHPA 2P0OA 4Y9AA 3TDFA 4MUZA 3NPXA 1NF0A 1XC4A 2IQTA 2QR6A 1VCGA 2A85A 2CZ5A 3FJLA 4UFJA 5D30A 1PE1A 1F6PA 4YWIA 3C2VA 2YR1A 4O50A 1JULA 2CZDA 3OA3A 2Q3OA 2KZHA 3VCRA 2VELA 4FX6M 3S1UA 1G4SA 3W74A 4AWSA 1ICSA 3MYPA 4DO6A 4H4IA 3FIGA 1KFLA 3B0UX 2FJKA 2Y7FA 3SSJA 1SUXA 3NQVA 4MKNA 4LS2A 1QWGA 4MFDA 3UQNA 4HSOA 4LC8A 3NL2A 4O1BA 2PRMA 3KRSA 3W6YA 1DKWA 4O57A 3WJSA 3DH7A 1VYRA 5LNSA 4N02A 3S0CA 4LRSA 1WOBA 1H51A 1XXXA 2J24A 1IXPA 1S5WA 2Y85A 3EEGA 3GNDA 4XBKA 4AH7A 3STCA 4MY8A 1M7OA 5D2WA 3PBWA 3G1YA 3E9AA 4OE7A 3WJWA 2Y89A 4M5PA 5I3IA 4XKYB 3HB9A 1D9EA 4DO4A 1FWWA 3UY7A 1IXQA 2VEPA 3QQ0A 2ZBTA 5I3GA 1C29A 2WKJA 4NJGA 1D3GA 2R91A 2D73A 3L0GA 2ISSA 2NV1A 1Q6LA 3M16A 4KFOA 1KV8A 2V9DA 2H6RA 1OYBA 3KRZA 3B0VC 3L5AA 2QCDB 3QEZA 1OFQA 4EIVA 1YXYA 5C54A 1EWEA 4UMCA 3LRKA 3G1HA 3ABOA 4MIMA 4PTNA 3M0ZA 5F2GA 2QUTA 3DFNA 5CG7A 3JS3A 5G2HA 1LBMA 1UASA 3P84A 3QM3A 3W2LA 4Z1BA 2WV8A 4O19A 1KTNA 2OCZA 3W7KA 1PL9A 1ZHAA 3P67A 3W70A 1K03A 1ICPA 3BO9A 3GR7A 3R13A 1P0KA 1QO2A 1PHQA 1BTMA 1L6YA 4QIUA 1TTQA 4XBSA 2OZ0A 2ISWA 3HGSA 1H1YA 3S5YA 3CEPA 3LXCA 2RH9A 2ZRVA 3C6CA 3GLCA 5F1VA 5E0KA 4Y8FA 5EL1A 2JGYA 1TRDA 3W1PA 3NQDA 4J9JA 3S1WA 5HWJA 2XN0A 1A5SA 3RF9A 2CU0A 3M6YA 3UD6A 3W2UA 2XFWA 2CW6A 2C1HA 3P60A 4HNNA 4POCA 3IRDA 3T7VA 1PV8A 1W3NA 3GAKA 1OK6A 5E93A 4JYFA 4M7TA 1GEQA 4MOZA 3G1XA 4Y96A 1GVSA 3JRKA 1WAUA 2XN1A 2GVLA 3EXTA 4JTIA 1Z44A 3G1SA 5HWNA 5K9XA 2WO5A 1H5YA 3I65A 1JQXA 3W7CA 3LCHA 1UUMA 3L0KA 1RV8A 3SGZA 4A2SA 5AN7A 2A0NA 4JX4A 4O4WA 2VEKA 3G3MA 3IIPA 4ZQPA 1XDMA 1BWLA 1OFEA 1TTPA 3BLEA 4XQ6A 3L5LA 3NQFA 3TSDA 4DPPA 3P82A 4H6KA 1CI1A 3W72A 1I2PA 1ZAIA 1P1XA 5EBUA 3GXTA 4JNMA 3EX1A 1AMKA 3W7OA 1G67A 3GKFA 2X30A 4IXXA 4LOCA 1K7FA 3TFCA 3N34A 1JUBA 2ZCGA 5LSMA 2NXHA 3B05A 2C13A 3L65A 3U2OA 1FY6A 4HPJA 1PIIA 2GUUA 4IX2A 4UFLA 3DZ1A 4FNUA 1WOAA 5KTLA 4HPXA 4MVAA 4RKAA 4GUHA 4UMBA 1XBYA 1KLYA 3WK0A 3IGUA 3K30A 1P0NA
chains in the Genus database with same CATH superfamily
3G18A 1AFSA 3AWOA 4DXVA 5F2MA 3LB0A 1VFLA 3IJIA 3QXBA 1LF1A 2WM1A 4DI9A 3RU8X 4AXKA 5CGTA 4L6HA 4AD3A 4JFWA 4DI8A 4Q8QA 5CBBA 2OPJA 1XD1A 3UZWA 4PSPA 4DO5A 4BS0A 1XM3A 3POCA 1TMLA 4D6FA 3K46A 4HQVA 3VC6A 4EVZA 1K70A 2F9RA 4ERGA 3CQ0A 1WBHA 3AIEA 2I5QA 1CGYA 5EYWA 5IM51 4H1ZA 4XZHA 4L4MA 4JTLA 3RIKA 2YDAA 3C8NA 1E1CB 4L56A 2XDFA 1F74A 4O1CA 4DPQA 4J3WA 1TQJA 1AJZA 1BSLA 1Z6KA 4G7EA 2XN2A 1VHCA 3GRIA 5XIMA 3HF3A 3V75A 3KBNA 1FP9A 4JTCA 2NX1A 3QY8A 1YNPA 4IMFA 4LUJA 4KW2A 4RXFA 1VKFA 4JXCA 4K2SA 4YVXA 3M0JA 1JFXA 3GDLA 1FRBA 2NUXA 1R2TA 4RR4A 2OKTA 4PMUA 1H4PA 5G1YA 2IMRA 3RDKA 4M6UA 4LS0A 3MUCA 5DO8A 1I45A 4V1YA 4UQBA 1KC7A 1ML1A 1B3OA 3N6JA 4PCFA 1Y7VA 4PYSA 3O06A 4QJ3B 4H9XA 2QCFA 3G1DA 2C0AA 4AAJA 3GH5A 3WQOA 4YHGA 1Q7MA 4N42A 3SQMA 4AIEA 1L0PA 5HPOA 2QCDA 4JEJA 4OQVA 4FIQA 2EG8A 4C6QA 3GNOA 7PTDA 1XCWA 3V7PA 2WJZA 2DH2A 1K6AA 3IUIA 1O5KA 1UWSA 1DYSA 4JR5A 1NSJA 1PBGA 2E77A 1W54A 5D37A 4FLOA 3FSUA 1JZ7A 2DEPA 3C2RA 3VZYA 1E71M 3HBLA 1VPQA 4ZQMA 2CBJA 4Q3MA 2YZRA 1W31A 1PTDA 1V93A 3OGSA 1VFSA 1C8QA 4FNSA 4CVUA 4HSNA 4NQ1A 5GNZA 5HWMA 4KFPA 3WJXA 1SZFA 7A3HA 1PHWA 3W82A 4H8NA 3CB8A 3S5ZA 3M46A 1QI2A 2WPGA 4XD4A 4Y90A 2BG5A 3L5MA 5XIAA 3BLFA 7ENLA 2PDYA 1GTEA 1SW7A 3U4FA 1BLIA 3TNOA 1FWAC 1XKYA 4MFEA 6XIAA 4NVTA 1ZTVA 5DN1A 3MUAA 2PWDA 1SMDA 1XLGA 3AJXA 1KD0A 1V6TA 3DI0A 4Z2GA 2WHLA 4LGXA 4RL3A 1OGSA 1QHPA 3BJSA 3PF3A 1NVMA 1EC7A 2QULA 3BV7A 4NL1A 4X2RA 1XX1A 3WMSA 4PMVA 1OF6A 1PCKA 1V02A 3T07A 1XH2A 5BZAA 3GR4A 1QR7A 3L23A 2HISA 1KGWA 4WLCA 2P10A 1S2UA 3OPSA 1FWBC 1PDYA 4ONVA 1O5RA 3B03A 2NX9A 1FA2A 5AHNA 4ZXLA 3WD3A 4JEQA 3UA4A 3GVWA 4J1OA 4LVDA 4YU1A 1GQLA 4IQEA 2VC9A 5BYWA 4QM1A 3VOJA 4YVPA 4C1KA 4JDBA 4QSHA 5AC7A 1XYCA 5DEZA 1MYRA 4RPQA 1NU5A 1BXNA 1E5JA 2QF7A 4RV8A 3TN5A 1M03A 2D2OA 3N2MA 4KT2A 3NEHA 2ZRWA 1TV4A 2PDPA 2ABAA 1TPWA 5M3WA 1AK5A 3CUJA 1FTXA 4K1GA 1ADOA 1VFMA 1QAPA 2E25A 1XI3A 4WXYA 6REQB 2YBUA 1EBHA 1E1CA 3DFPA 3MP4A 2FVLA 3BAKA 3N4EA 3LERA 1PVNA 3D3FA 4OKDA 1MW2A 3NZ1A 1R3VA 1S2CA 5I23A 1W9BM 2BGQA 1UKSA 5CSYA 1LBFA 2JQXA 4IPLA 5DT7A 1VIWA 3J7HA 4HU0A 1H7NA 2JK2A 4OTKA 4F2BA 1YE4A 3TQKA 1CT5A 4F0SA 3DGBA 1E3XA 5BNKA 4WD0A 2DVTA 4ZENA 3C2EA 3EWWA 3T09A 2DV0A 4EPEC 3HPZA 2P76A 1K7XA 1B3WA 2GVYA 3HZ3A 3SI9A 1NFBA 3CQJA 5GPRA 5FL1A 4NZFA 3QY6A 4PUNA 2PTXA 3VNDA 4B5XA 2PE4A 2F2KA 1R46A 3QF0A 3SZ8A 1E40A 3P5YA 2Z1VA 4P8WA 4R53A 3BTNA 3HJZA 3N2BA 1AL8A 4Q8UA 3A4XA 4C1LA 3NQ8A 3GTHA 1JGMA 3A3XA 4MMWA 5EA9A 3GTXA 4C6MA 1RA0A 3T0DA 1AQFA 1CTNA 2ZTKA 1CLKA 3FA3A 2C19A 2B31A 3PBUA 2JBMA 1BXBA 2ATMA 5A6AA 5A6MA 4MHBA 3UWEA 1R3RA 4GYKA 5BWFA 1BWVA 3B9OA 2ADAA 4FXSA 4EF9A 2OO0A 1LWHA 3KVLA 4AIBA 4DLMA 1QOXA 3PZNA 3MV11 2FFIA 4G6CA 4WF7A 1RVKA 2Q09A 3DHUA 3TYUA 3MCOA 2NT1A 4H01A 3LPGA 1ZJHA 2B81A 1HXJA 2FZDA 4DBSA 1H1ZA 2I56A 4ROQA 4PC8A 1E3ZA 3EXRA 4F0KA 2BY3A 3AU6A 1MW1A 3DHPA 3CS2A 4R7JA 2DPEA 4WXZA 4GZIA 5K3VA 3OZOA 3IJ8A 3AHXA 3W1XA 4LCRA 3WQPA 2Z1SA 1L8PA 4C6EA 5JUVA 1E9ZB 4CD8A 1XGDA 5D33A 5G1MA 1EJVC 2VENA 4FOJA 1Q6QA 1HTIA 3VX1A 2CKSA 3VGFA 2Y4SA 3BJFA 3GX9A 2FPYA 4MY1A 1P4CA 3PBYA 4LUTA 1ME9A 3GHTA 4AIUA 2WSRA 1P48A 2O92A 2A7NA 1I0DA 4PMJA 5A1AA 4LVGA 3PY2A 1ZSXA 3MJYA 3HQNA 4ML9A 3HGRA 3LLFA 1XLIA 2X2GA 1FWSA 3B8SA 1GYLA 1FBAA 3CU2A 5JIPA 3SCRA 1U5VA 2YCEA 2FFCA 4R7OA 3UR7A 2Q8LA 4CCCA 4N4PA 4AZGA 5AHEA 3REQB 4IL0A 3DC0A 3W28A 3TJLA 3B0PA 3VFLA 5J5RA 3NWRA 4WOQA 1LYXA 4ECLA 3TROA 3B8IA 4LRTA 2NV2A 3W81A 1WZLA 3FHAA 3PZUA 4C5YA 3P81A 4CCZA 3OZYA 1OX4B 3CNYA 5BOFA 3N6HA 3GNRA 2R1LA 3ARUA 3DKLA 4J3UA 2ZZ7A 1P0DA 4K3ZA 3BAIA 4PMQA 1EFZA 3GNXA 4JTAA 2YW4A 2ZXQA 2OOFA 1XIBA 4WZHA 1KM3A 1W3TA 3HTWA 6REQA 4LY4A 4NZ3A 2WSKA 1QI3A 5E9AA 4GZJA 3N18A 1EJUC 3DU0A 4P7NA 3V1PA 2IQ0A 3AROA 1S2WA 1R6WA 1F61A 4WDTA 3UWZA 4AF0B 4F48A 1C9WA 4UFKA 3H2MA 4V1XA 2E5CA 5ECVA 3G1RA 1CWYA 2J25A 4W8AA 1PIGA 1EQPA 3B40A 2E28A 1LTDA 2O4MA 4FPSA 3PP7A 3NQEA 2XTKA 1GOQA 1XBZA 3CMGA 3WMCA 4Z2IA 5BXSA 1TV5A 1EJWC 1XQKA 1XBVA 3L2LA 5KEZA 4JFSA 3U48A 3MS8A 1KR0A 3ZJ7A 4Q8VA 1BTCA 3EAUA 2PGWA 2PD9A 2G50A 1JF6A 2OLSA 1F2JA 1DIKA 3MSRA 2QKFA 3R0DA 5I02A 2QT3A 4Z08A 1TWZA 1P0EA 1Q6DA 1PYMA 1SZRA 5HR7A 3CWOX 1WXZA 2VXNA 3AIQA 3NR0A 1QHZA 4MTVA 3WQDA 3VOIA 1UA7A 4L1WA 1DOSA 3W7LA 3M0HA 3ZO9A 1GWJA 3KVMA 2INEA 3MWAA 1HFBA 2AKMA 4FNRA 4JL1A 3L66A 3CV6A 2X1RA 1Q7QA 2PCEA 1X6UA 3TAKA 1UZ1A 1KW1A 3E1F1 1VFFA 3ZWSA 3WUGA 1OC7A 2NX3A 1I8JA 2UY3A 2QAFA 1LJYA 2XSXA 2NLYA 1GVYA 1H61A 1FFQA 4QEHA 2MANA 4FLRA 4C65A 1X6NA 3VDAA 3GR8A 4Q4OA 2P3EA 3MMWA 4YIWA 3S1XA 4PCSA 4AD1A 3D3AA 4PULA 3RXZA 4FNPA 1PEZA 1V3IA 3N2CA 3EA1A 3GXFA 3DXIA 2C15A 4BF7A 3NIYA 5CEWA 1EEPA 3AYTA 2VRJA 2EBNA 3A9IA 1R3QA 2ATSA 4Q8WA 1EJXC 2YZ5A 3OGVA 3OBAA 2HWGA 2OOGA 3R58A 4HPHA 1W5NA 4M6QA 4GXMA 3ZR5A 3VIMA 3W7HA 4ADSA 2GJNA 2CLFA 4WY0F 4FR6A 1JG9A 1NARA 3MI2A 4UTJA 3EPOA 4YTQA 3KLKA 3I3EA 1PTGA 1E1FA 2ZWZA 3IIOA 2QJNA 4JCMA 1NJJA 5A6BA 2WC7A 4MLJA 1GYMA 1TJ0A 3ZJ6A 4DQWA 3WL0A 2J7CA 3WDHA 1IQ8A 1RQEA 1UROA 2JKEA 1FWNA 3CO8A 3REQA 3H55A 1H1NA 2ESCA 1DWHM 1GTHA 1TWIA 4G1KA 3KHJA 2Y6ZA 3EDKA 4O18A 4LB4A 1PZ3A 3P93A 2PURA 5HUPA 1ZFJA 3NM3A 3PZVA 3WBEA 3HFTA 1KFWA 4EF8A 1OX4A 1NP2A 2VT0A 3FEMA 1GORA 3WDIA 4ZE5A 4GQGA 2J6VA 5DT5A 4ZOBA 1VYSX 1XHGA 4C5ZA 5EMUA 1OT1A 4JKKA 5HBFA 4GGBA 2C71A 2OG9A 4JFVA 1KM5A 4U5KA 3A4AA 3B8WA 3S46A 1LQ2A 4ZB0A 1YDOA 2D0HA 4AF0A 1YNYA 2ZUWA 2PLCA 2NWRA 1MO0A 3ATYA 3JU2A 3CZLA 2VM8A 2WNNA 2D20A 5FAGA 5FAJA 3U9IA 1DPMA 2H90A 4U10A 5CBJA 3VKJA 1JNDA 4TVUA 5T8GA 3G1FA 1MFVA 2IPWA 1K8ZA 4IUGA 1AUSL 4DZAA 2CLEA 1FWTA 3LI0A 2QJIA 1R8LA 5KINA 4C7GA 4Q4RA 8XIMA 1V0NA 3LYEA 4WK9A 3ANYA 3PUEA 1E4NA 4S3CA 4AQLA 4N0RA 4MZYA 4KEZA 4F0LA 3TLQA 2XIMA 1QBBA 1UWAA 1QNQA 3NQMA 4PEEA 1ZALA 5LXEA 4WKHA 4AFYA 2INZA 3TP4A 1TVPA 2R82A 3NZQA 2GSEA 1PDZA 3GU9A 1UWIA 3NZRA 4JIQA 2X0SA 3H2OA 1P7TB 4JNZA 1J2BA 3OZPA 3RGTA 3ARVA 3H22A 1E4MM 5G4HC 4C7FA 2DZVA 5FJOA 2B4GA 4MDOA 4UNKA 5ABEA 1CGTA 4XAZA 3LRMA 3V4BA 2E1DA 1L2UA 4LEQA 4C91A 3TN4A 2E09A 3W7EA 5FJRA 4Z17A 3BW3A 1D3CA 3K8KA 4IH3A 4IMCA 5AY7A 2XYLA 1JYNA 3RK8A 4IM4A 3T0BA 4LV4A 5CSUA 2JKAA 2AQWA 1K9FA 4NU7A 4UTMA 1TSIA 4YS1A 3WKZA 2YXXA 3JZUA 4UTWA 2GVJA 1RVGA 1TWDA 4MZ8A 1GYNA 4AMAA 2E4TA 5B7ZA 1Q6RA 4MGGA 2HVNA 1AW1A 2CERA 1I2OA 2TMDA 3PR2A 3SCWA 3W2JA 2DZWA 4UBPC 2QMJA 1J2WA 5LA1A 4JICA 1ICQA 1PO9A 3H2NA 1EOMA 1U1HA 1S5NA 1FCQA 4ZOCA 2G96A 3UJRA 3WY1A 2OSYA 3EDFA 2PWFA 3RRAA 1DJGA 3CZEA 3HU7A 3RUBL 2P8BA 3IJ6A 4MJMA 2BDQA 5C7HA 2VR5A 1W1VA 3E02A 1PWMA 1ODZA 2X2YA 1BD0A 4W86A 1RP8A 1F3TA 5XINA 6TAAA 3E38A 1LP6A 1JPHA 3THQA 2PA6A 3ITCA 2OYMA 3QR0A 4PFMA 3DKJA 4C6KA 4QLJA 2V3EA 1RY8A 1VCFA 3LTSA 1CX9A 4LAOA 1REQB 4D72A 2DU2A 1JI2A 1THFD 4A05A 4H2CA 1VS1A 1CXFA 4LTSA 3UP8A 4WX2A 2DT0A 1B9BA 3WYZA 2BOEX 3UF9A 3DG3A 2XSAA 2PTZA 1RPXA 4AD0A 1S38A 3S83A 3QZ6A 4GACA 5REQA 4HZ8A 3I4EA 2WBKA 2F2HA 3TC7A 4U28A 5ABFB 4H41A 1VBGA 2P53A 4MB4A 4XZLX 1PXGA 4E3TA 5CGMA 1XD0A 4WJXA 1AQ0A 1B4EA 3ITLA 1W2VA 1AW5A 3ITOA 5D2VA 1XUUA 4YYCA 3W37A 4H19A 4D6CA 2E6DA 4QRNA 5E70A 1NDWA 4R34A 4QHRA 3BMWA 3TXVA 3A5VA 2H8ZA 1RR2A 4JX6A 4QDPA 4MAZA 3AS3A 4JS3A 1AH3A 5H2ZA 4X61A 2OYLA 4B3ZA 2XG9A 1F3EA 4F2UA 2PPGA 3GD6A 3NDZA 5K2ZA 2IKGA 3M47A 3D47A 5LGXA 1P7TA 3IJDA 4IIBA 3B97A 1U1JA 4EPDC 1PZ1A 1UC4A 1UR1A 2Z1KA 1B0IA 2HCVA 2VX5A 2V2CA 1PTAA 3Q94A 4ZR8A 3VNLA 5H91A 3MPGA 4DN1A 1SFJA 4MNMA 2BZNA 1QOPA 5AC4A 2DW6A 2OWXA 2RFGA 1MI3A 4ORIA 3MKVA 1HP5A 1RSCA 1JRCA 4MKSA 4NKCA 2EF9A 4L4PA 4HT3A 3TJXA 3ZZ1A 5A8OA 1RCXB 1LQ0A 3Q67A 1CIUA 2ZYFA 3SRKA 3QYSA 2RAGA 1RLCL 2Y5EA 4ES4A 1H0GA 1GQIA 3OODA 1TJPA 1E51A 2PWUA 2TAAA 2A5HA 2I7GA 3LXAA 2WJEA 4US5A 1B3YA 4MYAA 2BB0A 3KBWA 1A47A 1LT7A 2YCJA 4ROPA 1VJZA 2JEQA 5CSSA 1SR0A 4QLKA 5CKSA 2PI6A 1GQKA 1U5HA 5BW6A 3N9KA 4JTHA 3DYMA 4W7UA 1ZBKA 2QUUA 3BURA 3TN3A 5D9PA 3E2QA 2ON3A 1JPKA 2Z27A 3MANA 2Y7DA 2ZUVA 5HQLA 2Z2AA 2ABBA 1EP1A 5HOSA 4JNYA 4IPPA 1QFEA 3HQOA 3MBDA 4ZXOA 4GX8A 1J12A 1TPFA 3A13A 3NCOA 4B9YA 3QHOA 4HA4A 3CASA 2HQAA 1PZ0A 1QPQA 1XRVA 2RDUA 2GJRA 1G4PA 4LWWA 3M5ZA 4E2DA 1REQA 2VR4A 3GNNA 3VD4A 2HXUA 4I7UA 1LRTA 3PZMA 2EEXA 2ASHA 3P0XA 1M6JA 1TO3A 3BLLA 4IJBA 4JTGA 1U83A 4MWAE 3KBMA 4HN8A 2F8QA 4O1DA 4U5IA 5FEPA 3G24A 3VABA 2PP1A 3WDRA 3BWWA 3GXIA 4KWOA 5AHFA 5ABFA 4IP4A 3PAOA 1CDGA 3WH7A 3A4WA 1YX1A 4BA0A 2X1UA 1N55A 1FHLA 1AH0A 4IXHA 3W07A 4GMEA 4AUBA 3QYQA 1Z3NA 2AQVA 5ABTA 2QJHA 4IICA 5DRIA 3CIWA 3M07A 1WBJA 3G3DA 4KCVA 1B54A 3RLVA 2C18A 1SO6A 4ADUA 2PU0A 1G6CA 2YFOA 1W5PA 2H3DA 3WSUA 3SY1A 3PFMA 4S2BA 4YTTA 1W9DM 3GTIA 3OIHA 3M6DA 3OW1A 5FI8A 3TONA 2VFEA 3CV1A 2KAUC 4B5SA 3KL3A 1MDRA 1SZGA 3TIMA 1ZJIA 3WH5A 2Z2UA 5PTDA 3EGJA 1IZJA 2C3ZA 4Y6GA 1LOLA 1CXHA 4W85A 1BYBA 1J01A 1JDDA 2O0TA 1S3HA 3A12A 3AICA 1E70M 3WQEA 2YL5A 3NEVA 3URNA 4JY8A 3BC9A 4CEUC 3W23A 4NIRA 1EDTA 3KCOA 2Q02A 3KL0A 3W73A 3TUUA 3LI1A 1FWRA 4IWWA 5RUBA 2VQTA 3UFYA 1TVLA 2Y5JA 4V15A 3T40A 1ZQ5A 1M53A 2DY3A 2YCKX 3NA8A 5TAOA 2DZPA 4X60A 4XKMA 2EPHA 1KXQA 3R8GA 4H9ZA 2DVUA 2BTMA 1U33A 4GO8A 2TRSA 4JTFA 2NSOA 3A4JA 1Z41A 4NZ1A 5CC5A 3TZFA 4TU1A 2PTDA 1VQTA 3LPFA 4GYPA 3WQCA 3PZIA 4OBSA 1DHPA 3HJEA 1MXGA 4MUZA 2IQTA 3NTYA 3FJLA 2A85A 1NOUA 5D30A 5C0QA 1F6PA 1D2KA 1JULA 3U5UA 2KZHA 1DJIA 3R25A 1BYCA 4UQ9A 3W74A 4CEXC 3R8HA 2XZ9A 4F0HA 1ICSA 4LJ3A 1YEYA 3LBOA 4B5VA 3B0UX 3QVQA 2Y7FA 4TX6A 3N04A 3NQVA 5LIWX 3DIPA 4ZA0A 2C8NA 4LAMA 3HN3A 1NTHA 4AZ7A 3BJTA 4LEFA 2PRMA 3KRSA 3W6YA 4O57A 1AD4A 1SJBA 1VYRA 3MCMA 5T9CE 3S0CA 1H51A 1S5WA 2O4QA 1M7OA 2CIPA 1M1BA 2BVWA 2XH0A 4OE7A 2E9LA 2RJGA 3LD5A 4XKYB 4E8CA 2CWXA 1UPPA 3VCNA 2VHLA 5HMEA 3WLQA 4UOZA 3WQFA 2VEPA 1E55A 1GJWA 3QQ0A 4NJGA 1D3GA 1UD2A 2R91A 2D3LA 1KV8A 2V9DA 2H6RA 2PDFA 3KRZA 5JVLA 3RX2A 3KM8A 1C7TA 4ICCX 3UG8A 2DZBA 3LRKA 3G1HA 3ABOA 4MIMA 2G3MA 3M0ZA 1GKRA 2QUTA 2R1PA 2WV8A 2OU4A 4CNTA 3UESA 1K03A 1Q7ZA 1A49A 1W91A 2GGHA 2NQHA 2ZDSA 4QEEA 1DWIM 1WDPA 1P0KA 3SFWA 3AOFA 1W3HA 3WNOA 1EYEA 4XBSA 2ISWA 3WN6A 3HGSA 4DWDA 1H1YA 4IIEA 3MKCA 2VCCA 3S5YA 3ES7A 3N17A 2IPJA 3C6CA 3VDHA 5E0KA 1R5YA 4LSBA 2IPFA 1N8WA 3KUMA 1A5SA 2CU0A 4QLLA 3L4TA 1HGYA 4HNNA 1PV8A 1R9XA 3GAKA 4S3JA 1AODA 2EKGA 1MZRA 1UQZA 1YIXA 2D22A 1ISZA 4Z2KA 1H5YA 5FJUA 2OFJA 4W87A 2BP1A 3L0KA 4S39A 4JX4A 4O4WA 3G3MA 3IIPA 1PUDA 2OO6A 4ZQPA 1XDMA 1KXHA 1UHVA 3IK2A 3BLEA 1IEQA 3NQFA 3P82A 3ZLFA 1RJQA 3NYDA 3W72A 5EBUA 1M9HA 1AMKA 4GY7A 4RE3A 2X30A 3TFCA 3HV9A 1ODUA 3N34A 1BGAA 2Z2BA 2ZCGA 2YLLA 3L65A 3U2OA 1CNVA 1V51A 2VCBA 1CGVA 1V6UA 1DXFA 3DZ1A 1J0JA 1WOAA 3TWBA 1UP0A 1B1YA 4C6PA 1DIDA 1DJXA 4P7LA 4UMBA 2PP0A 2HE5A 4FB7A 3B9AA 2DIEA 3KOWA 3HPXA 2X0YA 3CB3A 3M0YA 1GVFA 4TTUA 1EZWA 3DHFA 4GISA 3V5FA 1UWTA 4DJEA 1XLDA 3BSHA 3L2IA 4DXXA 1SGJA 4LYKA 5JXQA 3W1AA 2V8ZA 3WFLA 4MNLA 5EU9A 4HMDA 2GQ3A 1QT1A 2E9MA 2HPIA 4ZMGA 5E6YA 1X1OA 5C55A 1K9EA 5I06A 2QZRA 3TYBA 3LGDA 4U3CA 1GZJA 2WKLA 4AHOA 4EWND 4KCTA 5I03A 1JF5A 5D32A 4AX7A 5KZEA 4EXAA 4GVIA 3GAYA 2V30A 4H9UA 5F2LA 1B30A 3NSMA 1EHNA 1B4KA 2XFRA 1J8VA 2I5GA 1S1PA 5DX7A 5C70A 4W89A 4PEKA 2EAWA 2X8RA 2P1FA 2BBFA 1NQKA 4NT0A 3S1GA 3NVTA 1F6YA 1Q6GA 5DF0A 3VIKA 1V0LA 4AZHA 1WZAA 1TRIA 2ZWYA 1E4LA 1DE6A 1A5OC 3W01A 3IK4A 4DWSB 3DAQA 2WOQA 4NF7A 4XKYA 4RJEA 5MHBA 5G4WA 3PWIA 1W1YA 3GDBA 1JQVA 3H2AA 5EB8A 3HPFA 3PNUA 3CYJA 5CZSA 1GW9A 4CCDA 3HGOA 5FSEC 2YIHA 3PB0A 3OIXA 2OQLA 2XU2A 1TTIA 4NSBA 5GNYA 3W7PA 2UBPC 3O07A 1JZ5A 2P5NA 3QKZA 3AHYA 1YXCA 3O0FA 2YCLB 1OQFA 3K4DA 3ARPA 4JN8A 4GCXA 4OT7A 3EX6A 4EXBA 4WOZA 3TV8A 3D6NA 4NILA 1X8FA 2PRHA 3HPSA 3OG3A 5A6LA 5LIYX 4INFA 4AYSA 4O13A 1W9XA 2E6YA 2NWSA 2R6OA 2TODA 5CPQA 2ZZ1A 4FR1A 4NJJA 3NL6A 2RKXA 4IUOA 1OEPA 1FVPA 1I2RA 1FCUA 3E0IA 2E6AA 6XIMA 3WDJA 3E0WA 3FA4A 4I5XA 3G0UA 4Z2HA 1E6NA 4I9MA 3BMVA 4XBJA 3OVGA 2WYSA 4LNYA 2FIQA 1W1IE 4K7VA 2QCHA 2B7NA 4B3LA 3LG3A 3UG5A 3NZPA 1Q6FA 5BRQA 3MZNA 1XDJA 3APTA 3IJ7A 1KXVA 1ZP4A 1OSEA 1UBSA 4MADA 4PMYA 4H7VA 1R3SA 4ZOEA 3M44A 1I2QA 1RUSA 3BW4A 4MYXA 1HUVA 3T8QA 5HQEA 1GT8A 5AHMA 3CBWA 3WCZA 4DRSA 1IIHA 3EPMA 1L9WA 1HP4A 3NL3A 4REQB 4ZB2A 8CGTA 1HO4A 1O1ZA 4D71A 3SUWA 4L61A 3TMLA 3TA9A 4PL1A 4L6OA 4NNCA 3DX5A 3AS1A 3CIVA 5TIMA 3GG7A 1HKWA 3CQKA 1L6SA 4J4KA 1XGZA 3HQPA 1PB0A 1CZ1A 5KZ6A 2VFIA 3QV9A 1W5MA 2VFFA 3VKKA 4A4AA 2GVEA 4PH6A 5LZLA 5AHIA 4BQ4A 4GVHA 1UUQA 3CEUA 5DCBA 2VO5A 3WLNA 1ZLPA 3P7YA 2J7DA 1SPQA 4M1BA 1RAKA 3BZJA 4GYPC 4TO8A 4LAUA 1G01A 4ZBCA 2G0WA 2OB3A 2WQDA 2QVNA 2RDXA 5EMYA 3FHQA 1XIFA 2V38A 3WBXA 1R0MA 4XAYA 3ZWTA 2PDGA 4J28A 2ICSA 1OCNA 5AC5A 4N6EA 3THDA 1C3FA 1R3WA 1LT8A 4BQ2A 4NRRA 2XVNA 1LG1A 4KS0A 3VIOA 3KP1A 4HMNA 2X42A 3EB3A 1AZ2A 3WELA 1TJ1A 3GB6A 4C90A 4S23A 3R2GA 4KEMA 2QCMA 2YL8A 4XVEA 4EPKA 5D03A 3CH9A 5AECA 2WCSA 5L9FA 1X39A 3C5QA 1KO0A 5CPNA 1F4AA 5CPOA 4ICMA 1X96A 1V5XA 2H9AB 1I60A 2QDEA 3QBUA 2ZXAA 1FDYA 2I57A 3WQGA 2QCCA 1ADSA 2QDHA 1V6XA 2L5HA 4DWSA 3WLHA 3TTEA 3CUZA 4PN2A 4LBRA 4B9ZA 5TF0A 4Q22A 4D2JA 2PGEA 1BVZA 1GZGA 2O9PA 4UTLA 4AC7C 2ACSA 1G4EA 3QGVA 1ZAHA 3O3RA 2GUBA 4IQLA 5M2FX 2YW3A 2FPTA 5LKYA 3KBVA 2VOMA 3I3BA 2P88A 1UP3A 1OY0A 2YCLA 3A47A 2DJXA 3K1GA 1TWSA 3EOEA 3FW6A 5TQLA 1UJQA 4B4HA 6TIMA 2NVAA 1O68A 4HTBA 4TXEA 3NVDA 3M7WA 1V3HA 4JTSA 2ZQ0A 5LNVA 3MDUA 1YBQB 3FDKA 1IE7C 2AL2B 2HS8A 3TK7A 1ZRQA 1HKIA 3TCEA 3S2NA 3G5EA 2WMIB 1OBAA 3OLIA 2Z28A 1JFHA 3S5OA 3F5KA 3AIUA 4M3PA 4Q32A 4HU4A 3L9CA 1GVQA 2XIJA 4AVNA 4RPPA 2PDNA 1V4YA 2QLYA 1F5ZA 4O8RA 2XPKA 3WF3A 4NI8A 3TSMA 1D3HA 3OYZA 3AYSA 1LDCA 4NJKA 2VMFA 2GDUA 1V7AA 2C0HA 3RYSA 1YLVA 3GTNA 3ZOAA 4O17A 4RUBA 3LK6A 1A4LA 3BAWA 3G8EA 3CPUA 1VFUA 3VZXA 4E4FA 1T99A 3SCSA 3HG5A 4H00A 3KZPA 1E1EA 3KRUA 3KTSA 3PUOA 2XWEA 1D7FA 4RXGA 1EA9C 1FWGC 1MEHA 1TREA 2HV5A 3AJ7A 4REQA 1DEDA 3XISA 3K5XA 1H63A 1KCZA 4HKPA 1S46A 3BH4A 3TQVA 2ACUA 1R30A 1OB0A 3BSMA 4CVWA 3MA8A 3UR2A 1NOFA 1N8FA 4B2DD 2JKPA 3USZA 1TPC1 1ME7A 2A4AA 4UTIA 3PTDA 3VA8A 4UR7A 2VFDA 3S6OA 1C8VA 2J7HA 2XSBA 1QOQA 3VGBA 3DENA 1RK5A 2G37A 3QPYA 1WV2A 3I6EA 5CAHA 3MMTA 3HMCA 3VMPA 4FNQA 5HANA 4PMXA 3SEPA 1JJKA 4F8XA 2WVSA 3W1QA 1DWFM 1ZNNA 2GK1A 3HIJA 4XUGA 3SRDA 4D9PA 1OFBA 3T4WA 1FWEC 2BNJA 4QS5A 5B80A 3TN6A 3AHVA 1E15A 2ZVIA 4QS6A 1WP6A 4RE4A 5FEXA 4K38A 1RQBA 3W84A 3ME3A 3SIMA 5A8QA 3F4NA 4UQAA 2CBUA 1GGOA 3HM7A 3B06A 4DIAA 4ZQNA 4Y9NA 3TQ0A 1L6WA 3AIWA 5TD4A 4QTGA 2FGLA 5T9BG 1JZ8A 2ISVA 1KGXA 1ITQA 2H9AA 1HW6A 2HPMA 3DBNA 3KW3A 1LQAA 3EWBX 5C5YA 3W25A 5JH1A 2E5DA 3ALGA 3LCGA 2A3AA 2D1ZA 1JRBA 2WVVB 2X40A 2XJ7A 1VBHA 3DYPA 3DFTA 4HNUA 3S6TA 1WXJA 4YTUA 4CNPA 3VD7A 5G4EA 4XIAA 3QOMA 2V82A 1UC5A 4O1FA 4IQDA 3BGAA 3TTYA 3S9YA 2X7WA 2FPVA 1O1HA 2AQOA 3NDOA 5D04C 3NUKA 1JL8A 2GYIA 1SSDA 5DQPA 3UGVA 1WYIA 2C16A 2CITA 4N9CA 2WMKA 3VIFA 1ONXA 5BMXA 3OG2A 2WMHA 1H49A 3AQUA 3ITXA 4QISA 1KTBA 1CXKA 1HIZA 3IANA 3VXGA 1YBQA 4I6KA 2J88A 2AL2A 4LS1A 3ZVHB 3QMTA 2XGZA 4JD4A 3GHRA 1JVNA 2B7QA 5KZMA 1W5QA 2DQWA 1TZZA 1TPUA 4DZIA 4RCXA 1FWDC 2YBVA 3C0QA 4FXFA 4PUWA 4LY8A 4PMOA 1J0KA 4WKAA 2VZVA 2GWNA 2D0FA 3ABQA 4K68A 2ZA2A 1N7KA 5HA7A 1FWJC 2J4GA 1H5VA 4LU0A 2D69A 2YLAA 3W22A 5MF5A 1EA0A 3W29A 1SU5A 3GYEA 1YTDA 3G2GA 1GNXA 3NPWA 2UZ9A 4GABA 1NM9A 5HNTA 1OG6A 2VEIA 3PVFA 1T0OA 3C61A 2PAJA 4R85A 4E5TA 1RH9A 1W1B1 3GZAA 4JIHA 1FH7A 3N11A 4N9DA 3VC5A 4DBEA 4JIPA 3PS7A 4I5RA 2DZSA 3OYXA 3WNNA 3DCPA 2HK0A 3SN4A 9RUBA 3KZSA 4KMQA 3NNTA 4AG0A 3CK5A 4QJ5B 3A24A 4P2VA 5AB3A 3C3UA 1RXOB 4JHMA 3P74A 4J35A 5JIWA 1S3TC 4ZVJA 2Z4GA 3CIXA 5CBIA 3HMJG 3XIMA 1R9ZA 1IIGA 2VEFA 4FO4A 4MY9A 2BSLA 1I4NA 3PM6A 4DNHA 2XIIA 1WO2A 4PMRA 4AD4A 3QLDA 2NW0A 1W6TA 1HL9A 1TX2A 1VYPX 3PFRA 3W0KA 3VOHA 5F4WA 1TV7A 3G1AA 4JQ1A 1OIMA 1CB7B 3NJ3A 3W86A 1CEOA 4GLEA 3M0MA 3CL6A 2PTYA 3THAA 1RCOB 3EKZA 4GKTA 4AD2A 4P7OA 3H12A 1PCWA 1F05A 3WLIA 4D1JA 5FOOA 1GVIA 4I90A 1KLZA 5AVNA 3TYDA 5HULA 1FHDA 3BCFA 3NXFA 1W3LA 1R87A 1QPOA 3EDJA 3R11A 1X7FA 2PDXA 5D8ZA 3F2DA 4DAIA 2OSWA 2G4JA 1BG9A 2WZEA 4GFIA 1XIGA 3WIJA 1WNOA 4FALA 3WUBA 1HKJA 3SGUA 4NRSA 3GO2A 4H04A 3VO0A 2VRKA 3NPUA 2GQAA 1WUFA 2JF7A 5D2XA 1DBTA 5HJYA 1W5OA 5I3JA 4A3YA 1JR1A 2WVVA 4DWSC 1B9ZA 1WKYA 1ZGDA 4W8LA 1TJRA 1N82A 2FHCA 2INFA 4W7WA 1S1RA 4GGHA 3O1NA 1J93A 4AYGA 4UCGA 4LX4A 2FB3A 1DQXA 4W8BA 3M9YA 4RW3A 3LENA 1KR1A 1TA3A 3W1LA 2POTA 4L4OA 2J74A 3B8TA 3RR4A 1K8CA 1SO3A 3ELFA 2W6RA 1E6PA 3FSTA 2Q71A 3ABRA 2BLEA 3MSYA 1B3XA 1VB9A 1I6NA 3N15A 3WNKA 2VCAA 5BXPA 4AISA 3W2MA 3SDOA 5LYRA 5CZ0A 1Z8AA 4MZ1A 3ZVHA 3BPWA 1XGEA 4GIYA 3URQA 3GC5A 4JYEA 2TSYA 3ABXA 1NIUA 3NQ6A 2VGIA 5CH9A 4BI6A 1XLHA 5CZJA 3EBVA 3VKCA 4LFYA 1Q2RA 2ZE3A 2P3ZA 1BSIA 1A0DA 3UZ5A 4B16A 5U7SA 2A21A 2F61A 3A21A 2IKHA 1Q3NA 2ALRA 3UCQA 1HGWA 2FMOA 1FH8A 3QPEA 2CWNA 4LXFA 3KOYA 4FF7A 4XZMX 2O56A 3PB2A 2PC8A 4IHCA 3UR8A 1J0HA 3MUXA 3A5FA 3GTFA 3R89A 2CLLA 2XISA 5AHLA 3VYLA 3CZ8A 5KZDA 3UWYA 3LV5A 2HVMA 4UB9A 4A8RA 3CT7A 3V36A 1PJ9A 4TR9A 3VNMA 2YGYA 3O6YX 3NOYA 3I3DA 1J79A 1TPH1 1KM6A 3Q37A 4ORMA 2QAPA 2G3NA 3UXIA 3V5CA 1U1UA 3S42A 4LUYA 2A79A 4DF0A 1KQZA 2PF0A 1MUMA 2HVOA 3F4DA 1BGGA 3JR2A 4I7VA 1Q2SA 4LF2A 4RZ6A 3SCPA 3NZGA 4XO7A 4DHGA 1MMFA 2YDRA 2A1YA 3W02A 3Q65A 3HGJA 4DUOA 3LLDA 5BU6A 3KDNA 4KERA 3BK0A 4WEVX 2CLPA 3LA4A 2C91A 1UQYA 3W00A 1W37A 4MPQA 4NZ5A 1K02A 5AC6A 1UCWA 5LA0A 3B04A 3TW9A 2EJ1A 2ONEA 1NH6A 4U33A 5CZTA 1XW8A 4PUDA 4TV5A 5AFDA 1C93A 4R9XA 4F0MA 4GC4A 4CN4A 1LROA 1JDEA 3DESA 3GIPA 4QGCA 3AWNA 2PBGA 3AHZA 5I3HA 4NASA 2B0MA 5CPSA 4WUIA 4AX6A 2Z6IA 1TB3A 3IAPA 4UR9A 3AO0A 1YQ2A 4H3DA 3C52A 3F5JA 3TW7A 1RQHA 3O63A 3P8JA 3MTWA 3BGGA 3ZR4A 2CXEA 3NQBA 3CV2A 4OOZA 1NF7A 3TYCA 4CU7A 5A8NA 1KV5A 2C79A 1C8XA 3R4IA 3WK1A 2PEVA 2ZA3A 1X97A 4FNTA 5D4YA 1N8IA 3H23A 2DQXA 4C6JA 3RU6A 1OJXA 1Q13A 2DGAA 1O7AA 1OCBA 1VC4A 1JGIA 3IGSA 3RFAA 1GOMA 1RK6A 1YYAA 3GG8A 3TX9A 1RA5A 2GQ9A 3C0SA 1FP8A 4A3RA 4FS9A 2D2GA 3CM4A 4NZ4A 3GFYA 4OV9A 4YTSA 4DF1A 1PZ2A 1OIFA 2HEJA 1OGBA 4YHEA 3G0SA 1OFRA 1D8CA 2ZUTA 2DH3A 4FOUA 6CGTA 1SO4A 2FZ8A 3K1DA 1T96A 1ONRA 1XRFA 3NM1A 2XGIA 3V35A 2Q01A 1OABA 2G8ZA 2O7QA 1G94A 2Z0IA 4A3UA 2WNZA 4QP0A 4PRTA 2FVKA 2Y1HA 1POKA 3GHUA 2FQIA 2ZUNA 4CQDA 5HJXA 2OGYA 3RHGA 4PBEA 1R7AA 3I4KA 3MHGA 5I09A 3BAYA 3KXQA 2HNEA 2I9EA 2MNRA 4ZGYA 1UIPA 1XYMA 2Y2WA 3CHEA 3ZT7A 2GGJA 1J9YA 4N9BA 4OV4A 3ZVIA 3PNZA 2QIWA 1Z89A 4YYFA 3WNPA 2VJXA 2VQUA 4KGLA 4S3KA 3AIBA 3AZTA 2XIBA 3IGHX 3MYOA 1GVRA 3GDRA 1XUZA 4IOTA 3AYVA 3UT0A 3AXKA 4Q4MA 3KLLA 2VX6A 4AD5A 1J96A 1DE5A 3TCSA 4C6DA 4RZ4A 2FH6A 3KTCA 2Y24A 3UY8A 1ZBWA 1KCLA 1VPXA 4AWEA 1WDRA 1G5AA 3B0YA 3QSTA 1MWOA 3VGDA 4DM1A 3UR5A 1VEMA 2PGFA 3W53A 3OO2A 2W91A 1US2A 1JPMA 3H7VA 3BICA 1V3JA 1L6GA 1NFGA 4JQ3A 2E9BA 2VUYA 1A4MA 1UD8A 2H3BA 5I07A 3PAJA 3L2MA 3M1ZA 4B3KA 4GNKB 2E7FA 7REQB 3AS2A 3T44A 1Z32X 2YA2A 1Z48A 2RDTA 2WVUA 1LLWA 4QAWA 1BVNP 1QMLA 3TR2A 1W2PA 4F79A 2YBTA 3T81A 1UR9A 5FJIA 1H50A 3TAOA 2XFFA 1P0BA 2FDMA 1A53A 3IEBA 5D38A 2ZIDA 4QQ3A 1KM2A 2BMBA 3STPA 3TQPA 4Y9PA 3MV01 3RCYA 2V67A 2QPUA 2GSHA 5E0FA 1ONEA 3W1RA 5J5DA 1RHCA 3C56A 1EQCA 3VUSA 2VP8A 1E0VA 4E8GA 1EPXA 1ZBCA 1KKRA 1NP0A 3PZQA 3RM9A 1XISA 3VNIA 1OD0A 5EMJA 3SSZA 1ZUAX 3SB0A 1IT8A 3MSGA 2C7FA 5BRBA 1U22A 3W7GA 4NUWA 3ZQ9A 1SM9A 3VD5A 1WDWA 3IGXA 5A69A 1DL3A 3ZSTA 4UTKA 1UMLA 4UIOA 4EE9A 1HJUA 4F66A 1MDLA 4GUJA 1FX6A 1EEXA 4CNUA 3UWUA 3E0LA 3K2GA 4H9VA 2VWTA 4H9MA 4M8UA 1Z69A 3FN9A 3TOYA 3APGA 3EA3A 1Z9AA 4OBTA 4BF9A 4QROA 3U4AA 3NQAA 1C91A 5EBAA 3T4CA 1PIFA 1KBJA 5JBFA 3WLKX 2QJGA 3EPNA 5FEZA 1DHKA 2V3GA 1C9DA 4MJZA 5EGRA 3GYCA 1UIOA 4H6QA 4HNTA 3H2CA 5IBXC 5A6BD 1MXSA 3W7IA 2EQDA 4GJIA 1XIEA 4DZHA 3LOTA 3F1QA 1YRRA 1Y0EA 1CCWB 2VR2A 3QW4B 4BZYA 1JUEA 2ZZ5A 4I6VA 3SN0A 1KWKA 4G1NA 4WJ8A 3SFKA 3II1A 4MF4A 1AA1B 4UTFA 2EJAA 3EOLA 4RNHA 4HCDA 1K4HA 1IT7A 3KOFA 1T5AA 4PB3A 3WD0A 5D9NA 3S9IA 4UXDA 4A6GA 4RE0A 4DUWA 1MQPA 1KFJA 4UCFA 3MHUA 1UWUA 4L1XA 5FD0A 3WNLA 3QRHA 2W0UA 2DT3A 1XPYA 1W9UA 2FB2A 5D2TA 3R94A 1T40A 5DFAA 4Y8EA 1F3WA 3PPHA 3V5OA 1KBKA 2G41A 4KF1A 4HNOA 3GFZA 1S2TA 2RGMA 4TVCA 1P1MA 3SJ3A 2Z26A 3LTYA 1TPEA 5G2IA 5LHEA 2YOCA 2OMAA 2UV8G 2OX4A 3OTRA 2QPXA 3UZZA 5DXXA 3GNPA 1OFAA 1YPIA 2P0OA 3M0IA 1NF0A 4YWIA 3R0KA 4LAZA 3VCRA 3GBEA 4FX6M 3S1UA 4BF5A 1G4SA 4PUJA 4AWSA 3E2SA 3QHNA 4GY0A 2OWWA 1OC6A 4H4IA 3RCNA 1AQMA 3ARTA 7REQA 1XICA 3GUGA 3EA2A 4GI4A 3UQNA 4MKVA 3RRXA 4RDZA 3U7VA 4BKNA 1DKWA 5I00A 3TC3A 3TR9A 1WAWA 3DH7A 3F4VA 5C9RA 1ECEA 3ZSSA 3POHA 1T6MA 1IXPA 2Y85A 3PK7A 1HJSA 2R1MA 4AH7A 3EZ4A 1E9IA 5D2WA 3PBWA 4GD0A 1XYAA 3GBDA 1XKJA 3WLSA 1RBLA 2Y89A 3B3DA 5I3IA 3VIPA 2PWVA 3SCQA 3MU7A 3AYRA 3QHMA 4DO4A 1F8MA 1QK2A 3KTXA 1XH0A 4GNVA 1UH3A 3OB8A 3CTTA 4ATWA 5I3GA 1HL8A 2WKJA 3KWXA 4XAPA 3L0GA 3WLOA 2NV1A 3M16A 3CAVA 1EJRC 1V77A 2WJFA 3B0VC 3H24A 1Q8AA 4EIVA 3TJIA 3FXYA 1YXYA 1A5NC 3DFNA 1QPKA 3QM3A 1UASA 3P84A 3W2LA 1Q6CA 1KTNA 1A5KC 3CUIA 1QNRA 3W70A 4LCQA 3BO9A 3GR7A 2V3DA 4RNJA 3IV8A 2R1NA 1QO2A 5CC7A 1TTQA 1UA3A 1W32A 5M03A 1GOKA 3RLGA 4AXNA 3CEPA 2RH9A 1FFRA 2J79A 2ZRVA 1NOWA 2DSWA 5EL1A 2YL9A 1QNPA 2JGYA 1TRDA 2V63A 3NQDA 2ZX7A 4C6FA 3S1WA 5HWJA 4FXJA 3RF9A 1BYAA 4BHYA 4GPNA 3W2UA 3CO4A 3NGFA 5H6HA 3P60A 1TJ2A 4POCA 3IRDA 3SGGA 1TV3A 3SCOA 5E93A 4A3HA 1R38A 1V6VA 4Y96A 3ZT5A 4D8ZA 1A0EA 2VDGA 3JRKA 1WAUA 1K1DA 3G1SA 3URAA 1YDYA 1EH9A 1JQXA 2CEQA 1R86A 4JN7A 3WLTA 1UUMA 4LAKA 4A2SA 2A0NA 4MB1A 4UZSA 3VMOA 1HQTA 4IQJA 3T8LA 3ANUA 4GYFA 2C1GA 1BWLA 3CHCA 3ARZA 3ANVA 1V3LA 4HA1A 1CI1A 1TKKA 1I2PA 2OZ8A 4HNLA 1E56A 3GXTA 4FOKA 4E8DA 1K7FA 2XHYA 4HMEA 4PBFA 3E5BA 3B05A 3MMDA 1IEXA 2W4XA 1FY6A 3TTQA 4IX2A 2GUUA 2YJQA 4H8UA 1IZCA 4JQ2A 4GUHA 1IWPA 3OQEA 4D1IA 3K30A 4XZWA 1NY1A 2R94A 5M17A 5HNNA 4OJYA 3FVDA 4QAIA 4A35A 2XFYA 3HURA 4YCOA 4J3XA 1B31A 5AZ0A 2PB1A 4AVOA 5CCZA 2BHYA 3E74A 1UPMB 4DZ5A 4GYJA 4IMGA 4NYYA 5FJTA 1E5NA 3VOFA 3ONBA 2BGNE 4TMBA 4C60A 4BWLA 1IZKA 3WG6A 1BFNA 3QFWA 3FLUA 3QR3A 4U3AA 2Y8UA 4FK9A 3MW7A 1EO5A 2PF8A 4HYWA 2YA0A 1Q8JA 4JQAA 4PCTA 4UTTA 4Z1YA 3BQ5A 3EWZA 3SCNA 1MNSA 3W7NA 3LBCA 2R14A 1I1WA 3CUHA 4E38A 3ZXWA 2V5JA 5CPTA 5TBOA 2WMGA 4O1EA 3AS0A 3NO5A 3IVSA 5HMDA 3RPDA 1C90A 3VNJA 3DFSA 4KPLA 3WDPP 4LUIA 5LIKX 1G0CA 3CZJA 4CQAA 2GFTA 1TX0A 3VGGA 2VI0A 4RZBA 1EXPA 2ZX6A 3WD4A 2CLMA 3E49A 3OHMB 4W93A 1DIEA 1DJQA 1TR9A 1XRTA 5KETA 2NQ9A 3UEQA 1UKTA 1XLLA 1YTKA 4QDWA 1TV2A 3WD1A 3UXDA 3A22A 2I14A 2J7BA 1Y8BA 2YB4A 3G22A 4GRSA 1S2AA 4B92A 1ZCOA 4O8AA 3O9NA 4AEEA 4HZMA 3MWCA 5IOBA 3F2CA 3D5HA 1JAKA 4OUIA 1H09A 1IXOA 3QTPA 1JUKA 5FEWA 3FA5A 1XS2A 4AVFA 5K7JA 1W56A 4RNFA 1JYWA 3TH6A 1U30A 3NO3A 1TTJA 1OZQA 2JF6A 4TIMA 8A3HA 3LZ3A 1GW1A 1KTCA 2BWGA 3W26A 1EDGA 5BMWA 1QU4A 3N9SA 2VOTA 1XFCA 2VD8A 2RDWA 5I5RA 3VDBA 5HUOA 2QJMA 3UVIA 4ACYA 5ABGA 4GQ0A 4JTTA 1LORA 4NAFB 4X0VA 3BVJA 4TX9A 2J77A 5CJNA 2OWCA 3QZAA 2PZ0A 3R12A 3O15A 2WQPA 2GOKA 3HG2A 4RDWA 1MEIA 2BS9A 4O28A 4US5D 4XUYA 2NQZA 3JZEA 3LCIA 4MDPA 3GVVA 4GIEA 2GJXB 4ZCWA 3W6LA 3BUVA 3TYAA 2WHKA 3AXXA 2V2HA 3VIGA 3RMJA 4JTQA 4M1RA 1XLJA 4UFIA 4CNNA 5C2GA 3USBA 3PJTA 3DERA 4S3DA 1UWQA 4J2PA 5J8LA 5DMMA 3LCFA 3C2FA 5CJ5A 3BG3A 3ZYZA 2DUXA 1O6IA 3S8HA 4Q8TA 5DELA 4DVOA 1AG1O 4PUKA 3EEZA 4G9PA 4HHLA 5TNVA 4GI8A 2NQ5A 1IR2A 1UD5A 3MZ2A 3WH9A 3QN3A 3W6MA 5DCEA 1K7EA 2EGZA 2YA1A 4KETA 4DX3A 4RNIA 4J40A 4QNWA 4JFUA 5EMLA 3KOZA 1VFOA 1KCKA 4B4FA 4AW7A 1JPDX 2ZA1A 1W9VA 6ALDA 1PKNA 2CHNA 3K13A 4DJFA 1NDZA 3AMGA 1EX5A 4S3FA 3TZNA 2PDCA 3WBWA 2ZC1A 3I6TA 2W62A 3W1UA 4LUSB 2Y0FA 3UWQA 4BI5A 4KEUA 1OFPA 2CESA 4F9JA 1SQ7A 1HJWA 3QQWA 1L8NA 4QFUA 1U5JA 3L4YA 4IMDA 2ZZ4A 3AIVA 5CQ1A 2PDQA 4AEOA 2DZTA 2WZHA 2DZAA 3HA1A 3UERA 2PWEA 1IGSA 5EPDA 4DJDA 2PBOA 5CLTA 1EJ7L 4Q6XA 2GDQA 1MXDA 4F40A 5GVJA 3W76A 1MRAA 2Z1BA 1GPFA 2QDGA 4PTMA 3LHYA 4TQTA 5LXXA 4JBRA 4WY0B 3PSWA 1QI0A 3W1MA 4MB5A 2CC0A 2D2HA 5AZ1A 3CHVA 2A3CA 2BVTA 2FZMA 3VOGA 1KB3A 1RD6A 4HU3A 3WQWA 2W67A 4JY9A 3AIRA 2EHHA 4UUIA 4W84A 4PMZA 3BCJA 3CZKA 4WJEA 4HMCA 4DXKA 5M5DA 4LBUA 3EWXA 3QPZA 1RLDA 3UNDA 2VEGA 3L67A 3MDWA 2OXNA 4NP7A 3KE0A 4CU8A 3G1VA 2W61A 3BXWA 1SJCA 1W8SA 2Y61A 2GL5A 1WKDA 3IACA 4TUFA 1RJRA 3NFUA 2ZDRA 5A2AA 2Y62A 4IIHA 4AY1A 4J3VA 3QZEA 4Z1CA 5FSDC 4QE4A 2W63A 1MUCA 2FTWA 4P61A 2BY0A 1XBXA 1JCYA 1I0BA 7XIMA 1VHNA 2G5WA 4DYKA 4R88A 3FAWA 4JTKA 2XM1A 2C1IA 5ENLA 2CLIA 3VIJA 1PX8A 1UD3A 3ARRA 5E6ZA 3DOPA 4CD7A 5F2IA 2EG7A 1E6RA 3L21A 1UP2A 4QJ4B 3PZOA 2V0TA 3WZ0E 5I2UA 3L68A 4P5UA 3FOKA 2XVGA 3SAZA 3B8VA 1ZAJA 3R6IA 3WF0A 2OVLA 3JVAA 1SZEA 2AAAA 4LANA 4J3SA 4KCUA 3KVJA 5DXYA 3PSVA 4IF2A 4GHRA 1HKKA 2GSJA 1V6YA 2Z7KA 2QDDA 4FSAA 5C9ZA 3T1GA 2E67A 4ZQRA 5IDZA 1J0IA 3O8AA 2DP3A 3S9ZA 3KAOA 5A8GA 9CGTA 1RCQA 3A64A 4UQDA 3GIQA 2EPNA 1UZDA 2OEMA 3C3NA 3NSNA 4G8TA 5A6JA 1QATA 1TG7A 1WUEA 1BQGA 4QJ1A 4N7QA 4DBDA 5DBTA 4L1GA 4FXRA 2HTMA 4ZFCA 3MC5A 4HNVA 3AMDA 1M5WA 1J5TA 2AL1A 3IJLA 4DM2A 3GY1A 2J8FA 3M5XA 5IHRA 1TCDA 5FF0A 3G6LA 3SJNA 1HKMA 3WLJA 5HK4A 2BHUA 3CHDA 5LNRA 3I7QA 1C92A 1KFEA 2PDBA 3ORWA 1H7WA 3K4AA 4MWAB 3H2FA 3WO8A 4LVFA 3EB2A 2G4FA 4LUSA 1HZYA 4HP5A 4ZZ9A 5AYYA 4BQ3A 4PR4A 4A8LA 3N12A 3O6DA 1MZHA 4CUCA 4N6FA 4IZGA 3DUGA 4J3TA 4KWWA 1I2NA 5KSWA 4BWLC 3ICJA 3ZM8A 2X1SA 4PTVA 3IS4A 1A50A 3N29A 4HU8A 4HTYA 1E73M 2J9YA 4Z0JA 4KRUA 1IR1A 4UTTC 2GGGA 4B91A 1GOIA 4W4QA 3BANA 4X3ZA 1OT2A 3WUFA 1UR8A 3VVGA 4E2BA 5HAOA 2FGZA 1UYQA 3QGKC 4O53A 3TLLA 4LVAA 3LXBA 4L4LA 1V0MA 3VE9A 1UWRA 1ISVA 3NG3A 1NAL1 1M7PA 1OYCA 4UC5A 2Z7GA 2XZ7A 4LYPA 3EWYA 3RPMA 4AZ6A 4WY0A 4E0CA 1G9HA 1TIMA 5D9MA 2CZEA 2JIWA 3NQ2A 3FDGA 4S3AA 1GQJA 4HJFA 5CZKA 3YPIA 2VC6A 2GWGA 2E8YA 1F9CA 2PC4A 3F03K 3WLRA 1A5CA 1E4IA 4IMEA 4NHVA 4GZ7A 4Q8PA 3KS5A 1XLKA 1JPIA 1UBPC 1IEVA 1F73A 5D09A 4ENLA 4BR1A 5A3HA 1T41A 2XIOA 4QQUA 2D2JA 3DG6A 1GONA 3SECA 3OA5A 5BCAA 3CAKA 2VC5A 1Y5XA 4HPGA 1O12A 1VJIA 4OECA 1GVOA 4GH1A 1JCXA 2Y8KA 1VFHA 3ZT6A 1LWIA 3QY7A 2GGIA 2ZKMX 1EUNA 2XM2A 4JIIX 4M81A 5DY3A 1XLEA 2CHOA 3H54A 1V8EA 3L0NA 4HA0A 3V1HA 4DJED 3VKAA 2POZA 3THUA 2OELA 3FYOA 3GVGA 4BCEA 4L80A 3QFEA 7TIMA 3N73A 1HO1A 2V5BA 4S38A 1FUYA 3IV3A 3NPVA 3W4RA 3CPGA 3CV7A 4W5UA 2OQHA 4Q7IA 1QK0A 3NXLA 1QTWA 4AZIA 1EOKA 3SUUA 1W3KA 3NURA 3MP5A 1OWQA 2YSWA 3WMBA 2BODX 4LPCA 1H11A 2WHJA 4KIEA 3SURA 5I3DA 2DSZA 3T05A 3UZYA 6PTDA 1G4TA 2OT0A 3SR7A 4QCFA 3WD2A 3W87A 1PKLA 3GWQA 2V5KA 4XK2A 3HG3A 1TCMA 1ISXA 4PODA 3M0VA 3KX6A 2NZLA 3I7RA 4HZ7A 2TYSA 3U5YA 2ZC8A 3FNDA 2OYKA 2Z1WA 3LEPA 3MB9A 1TYGA 4BK9A 3LBMA 1SSGA 3WH8A 3B4YA 1VEPA 3VPLA 5GJMA 2HSAA 1MFUA 3AHTA 4GUFA 3W75A 3H21A 3W3OA 3VM5A 3WNMA 4O52A 1OC5A 3WLPA 2VC7A 1LCOA 2JGQA 2NV9A 4DJFC 4BI7A 1V02E 3PC0A 4MWAA 3CMFA 4LUTB 1B57A 3M0LA 1F4HA 2PCQA 4O1AA 3QV7A 4E4UA 2WCAA 3U7BA 1F6KA 3PG9A 4NJHA 1UZ4A 4HK6A 6ENLA 3WQVA 2PP3A 3GKAA 1XSIA 2QCLA 4B5WA 4AHPA 3L4XA 2DVXA 1H7PA 2Q6ZA 2NVDA 4KGJA 3AI0A 3TVAA 5G1TA 1TPB1 5KITA 2BOGX 3U8GA 3VIHA </