1OVDA

The k136e mutant of lactococcus lactis dihydroorotate dehydrogenase a in complex with orotate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
311
structure length
311
Chain Sequence
MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLPRYVDLELGSINSMGLPNLGFDYYLDYVLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGEPQLAYDFEATEKLLKEVFTFFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLFIDPEAESVVIKPKDGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROOROTATE DEHYDROGENASE A
publication title Lactococcus lactis dihydroorotate dehydrogenase A mutants reveal important facets of the enzymatic function.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Oxidoreductase
total genus 115
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2003-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 1ovdA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ovdA01
4IXHA 3G0SA 1Z42A 4PTNA 4JTFA 3UWWA 3WK0A 3BW3A 5CPMA 2NZLA 1WBHA 1YPFA 1OG0A 1T99A 3C61A 2PE4A 4QQ3A 3S5OA 4R7JA 1OFEA 1VCVA 1X8FA 3S0CA 4N6EA 1ZENA 1RV8A 3RLUA 4TIMA 3L5MA 4E2DA 2DJLA 1XBYA 3WK2A 4C1KA 3T40A 3BG5A 5K9DA 2PRLA 4IGHA 5LNVA 3DFNA 4LRTA 5CSSA 4MY1A 4O53A 4JTGA 3A23A 4JTUA 1KBJA 3S5YA 5AHEA 1H50A 3MP5A 4WJEA 4XZ9A 3MHUA 3NL3A 3NM1A 4UTWC 4AB4A 1NSJA 1F6PA 3SFKA 2AQWA 5I3JA 3RF9A 1LRNA 4MYXA 2ABAA 3O6CA 4UFIA 3NOEA 3NQGA 3TU9A 4NXSA 3RU6A 3O05A 4N9CA 3W84A 1OFDA 1F74A 5G2WA 3G1XA 2ZBTA 3R13A 3NR0A 1THFD 3MMTA 3W87A 3LCLA 2GQ9A 3Q94A 2NXGA 4X3ZA 4X9SA 5DXYA 4Z1DA 1B4EA 4DPPA 3KVJA 5LGXA 3SR7A 3TIMA 2CLIA 4JNMA 2FLIA 2WSYA 4DO5A 5LHEA 5KITA 5HWJA 3KX6A 3UXDA 4BFAA 3W1QA 2WJZA 1Q3NA 2WNZA 3TQVA 1OF6A 3G24A 1TTQA 1ICPA 3EB2A 5AHNA 1ZHAA 3SECA 4AHQA 3MYOA 3C8FA 3NQDA 1W37A 2Y7EA 5J5RA 3S8HA 2E09A 1F2JA 3A21A 1B57A 3BO9A 3ZWTA 4PFMA 3W9ZA 1O60A 1ME7A 4WQ6A 5K4ZA 1VCGA 3R8RA 1KFEA 3LCHA 1SFJA 4OGZA 1GWJA 2CLHA 1QCWA 1X6UA 4WOQA 4KFNA 1FQ0A 2ZYFA 1SPQA 3THAA 2O7SA 2F84A 3UPWA 5H91A 4LS1A 5AFDA 1ZAHA 3DGRA 2I14A 2A6NA 4YCOA 5K9CA 3G1VA 4RCXA 3DZ1A 5EKYA 3V1PA 4YXGA 3L68A 1SUXA 4AXKA 4GUGA 3S6DA 5FEWA 4DQWA 4O54A 3WJZA 2TSYA 2QF7A 1VC4A 1VLIA 3FS2A 4BR1A 1W1ZA 4R34A 1SW0A 4FEZA 2X1RA 1SZNA 3PY2A 4UMAA 3EWYA 4Q32A 5G2IA 5AYZA 4MVAA 3PC0A 3ATZA 1NF0A 1DJNA 2FFCA 1FWWA 4GUHA 1KLZA 3C2OA 5EA9A 5D33A 1YXYA 3PAJA 1OX4B 5FEZA 4IUOA 3G22A 4LUJA 1I2QA 3BLIA 2G95A 4MZYA 4QNWA 1B9BA 3HG2A 3ABQA 4O52A 2P1FA 3GK0A 3A24A 5AYYA 5ABTA 1KW1A 1LOQA 2G97A 5DELA 4PH6A 1SR9A 5D09A 5DBUA 5D2VA 3FKRA 2QAPA 3VE7A 1TPDA 3GR7A 1H7OA 2O7QA 4FX8A 4AMAA 1JQVA 3BGJA 1KFKA 4CNPA 5C54A 3W1NA 3H55A 4O19A 2ZRWA 2JBMA 4R53A 3VCRA 4O16A 4YLWA 4FXSA 3LRMA 5CKSA 3GVGA 5L6UA 1UCWA 4YMZA 1TTJA 2VXNA 4XTIA 5E0KA 1VYRA 2ALDA 5G4WA 1WX0A 4K6AA 1L6YA 4JX4A 1VHCA 4K8HA 5D2TA 1ADOA 3LB0A 1K7XA 1VZWA 1HO1A 1R2SA 3KFTA 5H2ZA 2VFEA 3QMSA 3MI6A 3MUXA 1K3UA 2CZEA 3H53A 3RMJA 5DBTA 1QFEA 3P60A 4M6QA 4MZ8A 5I3GA 1CW2A 3I7QA 4Z08A 2HS8A 3P5YA 1EP3A 1G4EA 1NF7A 3MP3A 1FDZA 7TIMA 5HR6A 2ZZ1A 1FWNA 3G8RA 2OT1A 3NDOA 4DXVA 3C2RA 2GVGA 4IJBA 3W2LA 2X30A 2CLMA 3W3OA 4WUIA 3GXNA 3WJSA 3LLDA 5IM51 2XN0A 5AHIA 3TROA 1LRQA 3I68A 3P8JA 5HWNA 5K4XA 3NEVA 3TSBA 3LDVA 1I2RA 3W22A 4AWUA 1A5SA 1TJRA 1U83A 4GJ1A 4JDYA 4PC8A 5DN1A 4DF0A 4K7YA 5KZEA 1EP2A 1XBVA 2CLFA 4LNYA 4JY8A 5C2XA 3EX2A 1RD5A 4Z0JA 4NJGA 1KM1A 2Q8LA 1GVFA 1RVGA 2V5BA 3P7YA 4O11A 4A2RA 1UUMA 3CC1A 4QAIA 3IIVA 2V9DA 1PS9A 3LBCA 4MLRA 5D37A 2C19A 3MBDA 2CLEA 1LZOA 1YPIA 4NNBA 5T26A 3MJYA 5LNRA 2A6LA 4JDBA 3VKJA 1DL3A 3UWVA 3HMJG 1W5OA 4IX0A 2TPSA 3N9RA 1QWGA 4A29A 3CT7A 3N2XA 4OWGA 3CEUA 1GVQA 3M5XA 2Y88A 2QCNA 3R5EA 3T7VA 1XUZA 2VFFA 4GWEA 3W7IA 3C3NA 3L0GA 5AYXA 3LCGA 1HFBA 2YR1A 4O4VA 1VPXA 4MLJA 3ZS4A 4HPXA 2F7FA 3UXAA 2V30A 3VI2A 1SW3A 3B04A 1TTIA 1YXCA 4WX2A 3FJ6A 4FXRA 4XQ6A 3TR2A 2J6XA 1JUEA 1FWSA 2V8ZA 5D2XA 2W6RA 2CLLA 1PHQA 4FNRA 1JCLA 3UZJA 5I3IA 2X1SA 1G67A 3HF3A 4FF7A 1A53A 3LCWA 4JTIA 4AF0B 5HINA 4WY0A 4LVDA 2EF9A 3UWQA 2NWSA 3P8IA 4LVBA 2A5HA 4EVZA 3L0NA 3HGJA 3PBYA 1MZHA 3UQNA 4M7TA 2YXGA 3EX4A 3TAOA 3EKLA 3NAVA 1F05A 1M7PA 4R33A 1YTEA 2HMCA 3NZRA 4O18A 3MI3A 4J9JA 3WJYA 1E51A 3P84A 2A7NA 1JCNA 4Y9AA 1SO5A 2NX1A 3DKLA 4BI6A 3EWBX 5J5DA 2H8XA 3W70A 1W8SA 3EXTA 1ZJIA 1X7FA 3QYQA 1R2TA 2CWNA 4UFJA 3KRUA 3DHFA 4BF9A 5I3HA 1S3HA 4LRSA 1OYAA 2CFFA 1ZFJA 2OMAA 4MY8A 2QDGA 1Q6QA 4GC4A 1GYLA 2FPTA 1EPXA 1B3OA 1H7RA 3M9YA 5BNKA 2OCZA 1FBAA 2ISSA 1H61A 1K7EA 3LV6A 4JGDA 4N02A 5FF0A 4LS2A 2ATMA 4ZL1A 4JTLA 1FXQA 3W75A 3W7NA 4JR5A 3Q58A 2Y7FA 5K9XA 2YW3A 3W07A 1D9EA 3TAKA 4E38A 3FYPA 3NG3A 4AVFA 3FLUA 5CPNA 1MEWA 4FNPA 3UY7A 1TREA 1OFRA 3TC7A 2WSQA 4U28A 1QPQA 1W3TA 1O5KA 1MO0A 3N9SA 1P5BA 4QSHA 1I2NA 3ABSA 3NQVA 1LBMA 1W0MA 4O0KA 1QR7A 2Z0IA 3STFA 2AGKA 2KZHA 1IXPA 1C29A 1HTIA 1HO4A 3F4WA 3W73A 1TCDA 3AJXA 4GXMA 5KZDA 3GKFA 4IX2A 2QUUA 2ZA3A 1FWRA 3P61A 4O15A 3A5FA 1LP6A 2BZNA 4Z1CA 2ZZ6A 4ZQNA 4WZHA 3BVJA 1FX6A 4NJIA 4A21A 1Z44A 3W23A 4E0CA 2WOQA 1XI3A 2R91A 3QSRA 1KBIA 1W5NA 4PODA 1F73A 4H3DA 4K38A 3PM6A 4NNAA 1FDJA 4MJZA 3FYOA 1EEPA 2A4AA 1TPUA 4M5PA 4NJHA 1T96A 5F4XA 3G1SA 3SW6A 5D03A 3PR2A 3HG3A 2ZA1A 4JYFA 5EPDA 1PHWA 3W1MA 3NQEA 4ZQMA 2RHGA 3QW4B 2QR6A 4JICA 2OX1A 3GR8A 1UUOA 2H3BA 1SO4A 2FIQA 4NU7A 3O07A 3QW3A 5CZTA 3SI9A 1KTNA 4MUZA 3LTYA 4Z1AA 1VS1A 4Y90A 4B5NA 1KM0A 3TE9A 1VJIA 1SO3A 3HPSA 5U4NA 1IIGA 3LHTA 1CX9A 4FIQA 2GQAA 5KZMA 3FEMA 2ISWA 1JQXA 1O4UA 3HJZA 2ZZ4A 5AN7A 4C1LA 3W83A 1O94A 1H1YA 2NWRA 4Z0SA 4MJMA 1DORA 4NX0A 2R8WA 2A7PA 3PULA 4LC8A 4RK8A 3HBLA 3DI0A 3F1QA 4CCEA 5EL1A 3HQ1A 3EEGA 2B7OA 3RK8A 4NX5A 4OV4A 3BG3A 1L6WA 3EWXA 3Q37A 2ISVA 2J9XA 3PSWA 4IWWA 2YW4A 1HG3A 3EWUA 3KVKA 4GRSA 1OABA 4AEOA 1H62A 2A1YA 3HB9A 2Y89A 2QCDB 2ZRYA 2J9YA 3NNTA 5FESA 1BWLA 1KFLA 2CW6A 3STGA 4M7SA 2J88A 6TIMA 4LV9A 3GB6A 1TRIA 4LY8A 3TSDA 3W2KA 3KRSA 4JY9A 2YDAA 4HKPA 2GVLA 3STEA 1FXPA 1XDLA 3CHVA 5HR7A 1H7WA 3IIXA 2FQIA 3PB2A 3MYPA 2GVJA 2DZVA 2C0AA 3H54A 5LHFA 4OQVA 2YSWA 4UMBA 3GAYA 4TU1A 1KM3A 3T55A 5HJLA 2RH9A 4OBTA 4NXKA 1QOPA 4UNLA 1G4TA 1VLWA 1TPWA 3QQ1A 3LLFA 4TMBA 1TPH1 2C1HA 3KAOA 1PCWA 2RDTA 1NAL1 4LWWA 4JD4A 3JS3A 2NUWA 5LSMA 3QC3A 5I3FA 3E02A 5BMXA 2PC4A 4WD0A 1TPFA 1WDWA 1FCBA 2YYUA 1H7NA 3C56A 3TFCA 2Z2UA 2LLEA 4UTIA 2ZZ5A 2FPVA 3O6YX 2Y63A 3L9CA 3JR2A 1DOSA 5I3KA 1ALDA 3B05A 2NX9A 3P80A 2G5WA 3E96A 4AWTA 4WXZA 3G3MA 2YPIA 4IOTA 4FB7A 3M7WA 2CLKA 1SU5A 4QISA 1GT8A 2ZZ2A 3SSJA 1H60A 2A7RA 4O4WA 4JX5A 2VEKA 4N4QA 4QJ1A 2XN1A 3LTSA 3MP4A 3W76A 3S1VA 3GKAA 1OFBA 5KSWA 2FB2A 3N14A 3S1XA 1O95A 4TX9A 1YXDA 5FF4A 4UTTC 3GXPA 3OBKA 3UNDA 1YDNA 1W56A 3TQ0A 3TW7A 4UFKA 4GUIA 2VEIA 1Z48A 3A22A 1RQBA 3B06A 2NV1A 4UTWA 4Z1BA 4OV9A 3WK3A 2OT0A 2QCHA 4N9DA 1SO6A 2VENA 4FNQA 2FTPA 4ALDA 1GVOA 2PURA 3NGJA 1AW5A 3DFOA 3W2MA 3BV4A 1GZGA 2ZRZA 3B0PA 2QCEA 2Y61A 2ZZ3A 3WK1A 4Y96A 2V81A 1YLVA 1IGSA 1GG1A 2ZZ7A 3P82A 5AOUA 4WY0F 3G1DA 3PB0A 3QMRA 1GVRA 1Q6LA 1R30A 1VGAA 3W1XA 1EX5A 1GQNA 3GLCA 3CLMA 3W85A 1RQEA 1MEIA 3DBPA 4JTEA 4EOUA 5BW6A 1QO5A 3DU0A 3IV3A 1LM1A 3BARA 3NQ7A 1A5BA 3GIYA 1BKSA 4NJJA 4XKYA 3B4UA 1JRCA 5D32A 3S9YA 1G7UA 3HIJA 4UCGA 1N55A 4N9BA 3W7EA 1GVSA 3QMTA 1AW2A 4HNVA 2QJIA 1SZEA 1EP1A 3LHVA 4FX7A 1LORA 4O28A 4O0ZA 2Y70A 4HN4A 1FCUA 2XFWA 1F6KA 1G7VA 3S5ZA 4YWIA 2DZWA 1GEQA 3G1YA 3PG8A 4DO4A 3NO5A 5GVJA 3ELFA 3I7RA 4LOCA 3HGOA 3N19B 3L5AA 4HNTA 2VFHA 3P5ZA 4HIBA 3HGRA 3N2MA 3IEBA 3HOJA 2DZUA 4DBDA 1C9DA 4NVTA 5TQLA 3TNOA 1S5WA 4ORMA 1KLYA 4EF8A 5G1TA 4PL2A 2CLOA 3BLEA 4OE7A 3E49A 1JCJA 2PRMA 4ADUA 1JCYA 3CWNA 4ZQCA 1H7XA 3L21A 1LOLA 4JIPA 4O1CA 4BK9A 3INPA 2R94A 3IVTA 2C3ZA 3K30A 3LM7A 3EXSA 4GNJA 4N9EA 5HWMA 3DHDA 3L5LA 2OJPA 1QNVA 1H63A 3W88A 1H7PA 4UTTA 1TV7A 3O8AA 3C4UA 2WNNA 3IRDA 1HL2A 3C2EA 2H3DA 4NQ1A 3OIXA 1LRTA 2RKXA 2Y62A 4XTDA 3TMLA 2JKAA 3P67A 3LHUA 4O10A 3M0ZA 4PL1A 1N7KA 1XBZA 4KWWA 3ABOA 1J5TA 3MWAA 4MFDA 4FX6M 3I65A 5CZ0A 3GZ3A 3ANYA 1DHPA 4UTLA 1AMKA 2Z1BA 1WYIA 1EA0A 1L6SA 4N4PA 1H51A 4IMDA 4UUIA 3R2GA 1SSGA 4RZ4A 3S42A 4DEFA 1FWTA 4CCCA 3M6YA 4A22A 3IGSA 1LDCA 3LCXA 4P2VA 1A5AA 2NXHA 3DAQA 1DJQA 1P1XA 3G8EA 3FIGA 4M6VA 5AHFA 2IQTA 1I45A 4CQ8A 3BG9A 1L9WA 5HNRA 1K03A 1QPOA 1A5CA 5LNWA 3TSMA 4XBSA 2I9EA 4O17A 1R47A 1GYNA 4UC5A 5G4EA 1M7OA 2V2DA 5EY5A 2CU0A 2GOUA 1JR1A 3M1ZA 4L4MA 1Q6OA 3UYCA 3NQ2A 3KVLA 3PVFA 1H5YA 4MFEA 3TK7A 4O1BA 1F7BA 1DV7A 5DCEA 1XM3A 3NQ8A 3TJLA 3PWAA 1KM5A 3BK0A 3P74A 1DKWA 3LERA 5C5YA 4LTSA 4ZZ9A 3W7LA 4A2SA 5FF7A 2ZTKA 4BWLC 3GX9A 3QRHA 3TH6A 4IMFA 1T8XA 3W7HA 1YYAA 1LYXA 1QPNA 1TIMA 3QPYA 3N73A 4YL2A 4MY9A 3VE9A 1EWDA 5KINA 5FF3A 4DF1A 1KTCA 4JTHA 3FOKA 4KFOA 1SZGA 1TB3A 5G5IA 3CIWA 2VC6A 3SGZA 3BPWA 1XBXA 5D2YA 3MHGA 2ZCGA 3R12A 2QDHA 1LBLA 3GDMA 2A2IA 3EKZA 3AO0A 4HNUA 4X2RA 1BEUA 3LOTA 2EAWA 2Y85A 4FHAA 4RV8A 5U7SA 4QM1A 1BTMA 4Q4KA 2Z6JA 2VFIA 1TSIA 3C0JA 3L65A 3FA5A 4MZ1A 5D05A 5MHBA 4I7WA 4MIMA 3NZ1A 4UTKA 3IGXA 2QCFA 2I1OA 4UMCA 2YGYA 2JKPA 2YYTA 3TKFA 5LGZA 1KM6A 1ICSA 1B4KA 3IVUA 3TFXA 4DO6A 2QAFA 3D0CA 3W74A 1N8FA 1A50A 2E5BA 1V5XA 4XBKA 3THQA 3U6WA 1OX5A 5FI8A 2HTMA 4M6PA 3GYEA 2W0UA 4FNSA 1KA9F 3IIOA 3OVPA 2W79A 3U2OA 4BI5A 3PBVA 3GNNA 2G96A 4IMCA 3QJAA 3S5NA 3TA6A 5EMUA 1IXOA 3M5VA 2QEZA 2JGQA 4JYDA 3O1NA 3PSVA 3DKJA 3LV5A 3B03A 5DY2A 1VCFA 1RZMA 5KTLA 3ABRA 3W7MA 2TYSA 5LNSA 1TRDA 3GDKA 4FO4A 4UXDA 2VEPA 4HNNA 3QPZA 2H8ZA 2WNQA 1ONRA 3HG5A 8TIMA 5F2GA 5HULA 2NUYA 3ZWSA 3PUOA 1UJPA 2BLEA 3W7GA 3TW6A 1ICQA 5F1UA 1OK4A 2DP3A 4H6KA 2DZTA 4LC6A 4PCFA 5D04C 1WOBA 5CSRA 4UTHA 3GDRA 3RLVA 2Q3RA 3OHIA 4FNTA 3FFSA 4FIRA 4KKXA 1OX4A 1ZY9A 2BTMA 4RR4A 4BWLA 2Q3OA 4JX6A 3NQAA 4QIUA 4K36A 1AG1O 1PV8A 1JJKA 2FB3A 1XKYA 3G18A 4NJKA 3NQMA 1PVNA 3QF0A 5DXXA 3W7CA 4AAJA 2ZDRA 1OK6A 2PRHA 2BXVA 5FEPA 1JUKA 2QUTA 1VR6A 4NZJA 4OT7A 1ME8A 3YPIA 2NX3A 3HO8A 3KHJA 3M41A 1OHLA 4XUGA 4WY0B 1AK5A 4U4MA 4H4IA 1NFBA 3HPXA 1DQWA 4UTMA 3TMQA 2WO5A 3G0XA 2NXIA 4GE8A 4O1AA 2VKZG 1AL7A 1ZALA 5LZLA 3OEXA 3M5YA 4LVFA 2P0OA 1K8XA 1V7YA 5HUPA 2QJHA 4I9AA 1W54A 3W1UA 3W1LA 1ZAIA 1TJPA 2DZPA 3EX6A 3EXRA 1TPB1 4S1FA 4E2BA 4PEKA 5FEXA 4G1KA 3M43A 2V2HA 3LBMA 4LUIA 4NNCA 3UZ5A 2V5LA 3M44A 4O57A 1X1OA 4CQ9A 5AC8A 2Q8ZA 2Y7GA 1EIXA 1W5MA 1ME9A 1KFJA 1G4PA 1H1ZA 1FCVA 5AC7A 3TV8A 1P0NA 2X2GA 2ABBA 2ZTJA 4AHOA 2C16A 2QCGA 1SZFA 4BI7A 3C2VA 3CIXA 2J27A 3KRZA 5F4SA 2V0TA 4JEQA 5G1YA 2DU2A 1YDOA 3QEZA 5F2LA 5A8GA 3CPRA 3R89A 1O5XA 3IGUA 5SWUA 2E5CA 3NQ6A 1PIIA 2WPBA 1W31A 5L9FA 3W7RA 3UPBA 2FPYA 3P62A 4LW7A 3B0UX 1EWEA 2ATSA 1P4CA 3RFAA 5F1VA 1LBFA 3DI1A 1K7FA 2J9ZA 1I4NA 3V75A 3LXAA 4W9TA 1JRBA 1LOSA 4A3UA 3N34A 4TO8A 4IQLA 3O06A 3W2JA 5F4WA 2WKJA 3L0KA 5KMYA 1T0OA 1RPXA 4ZQRA 3GAKA 2C14A 1SQ7A 3NPVA 4ONVA 5HMSA 3LX9A 4HT3A 5CZJA 1QDSA 5D30A 5DY3A 1YDVA 2X1TA 1WV2A 1M5WA 1OFQA 1IXNA 2EPHA 3NPWA 1DVJA 1I8JA 3BW2A 3JRKA 2B4GA 1GOXA 3W1AA 4ZMGA 3FJLA 2EGZA 4QNEA 3G3DA 4UFHA 2E1DA 3EX1A 4HHPA 2YX0A 2HS6A 4DPQA 3TX9A 3LHWA 4N6FA 5CPLA 3C52A 5K3VA 5IBXC 3GDLA 5D02A 4NUWA 4OU1A 1TPEA 2ZFAA 1TPVA 2QCLA 3C2FA 5K2ZA 3GDTA 5AB3A 2V2CA 1LCOA 4ZQPA 2QUVA 3W7JA 3I6RA 2RFGA 3RNDA 1VQTA 3LI0A 4ORIA 1W3NA 1WXJA 2C15A 4O1DA 2NV2A 4WXYA 4GBUA 3QZEA 4UNKA 2ZQ0A 4AF0A 2C18A 1G69A 1LLWA 3L2IA 1WA3A 1KM2A 5K7JA 2VOMA 3O16A 2DJXA 3G1FA 3A9IA 1TQXA 3LXCA 2X1UA 1PE1A 5CGQA 3GXTA 1OYBA 3UY8A 5HQEA 4KWVA 5D38A 4ZQOA 2X16A 3NPXA 1RQHA 4LV4A 2BSLA 2FJKA 3PBWA 1K02A 2Y7DA 5TBOA 3QH2A 1XL9A 3W7KA 3O15A 3ZR4A 1MXSA 3EWWA 4MKNA 1KV8A 4UIOA 4P61A 4K7VA 1D3GA 3BLFA 5LNUA 1TMHA 2C6QA 1YTDA 1TV8A 1TV5A 1L2UA 2WQPA 1OYCA 4LS0A 1UB3A 3E12A 4LVAA 2R14A 3PUDA 4CQAA 1K8YA 3NXFA 2GJLA 2YCEA 4UR7A 3W2UA 3CU2A 1TYGA 2P10A 3ATYA 5LKYA 1P0KA 3W7QA 3LCFA 4K37A 4KFPA 4CNOA 1IIHA 3TXVA 4HSOA 3NA8A 4EIVA 1EB3A 1WBJA 1VHNA 4LT9A 4RLIA 4GUJA 3USBA 2E68A 5D2WA 4K39A 4JYEA 1HUVA 3CM4A 4RZ6A 3TUUA 4DELA 5F2MA 3QSTA 1QAPA 6ALDA 5F2IA 1ZNNA 2UV8G 2OZ0A 1QOQA 3L67A 3NM3A 3EWZA 2VEMA 3LGEA 5HUOA 4IMEA 2YZRA 4Q33A 5BMWA 1YADA 1F5ZA 3OVQA 3NYZA 3PF3A 3PS7A 2QKFA 2ZRVA 1EUAA 3KXQA 3BW4A 1ZAJA 1K8ZA 4LU0A 4TR9A 2A0NA 1XXXA 5BRBA 2DORA 4AWSA 4PA8A 5IBXA 1NEYA 3C6CA 2GUUA 4WOZA 2WV8A 1G6CA 3PG9A 3SIZA 4EWND 3GNDA 5AHMA 1DQXA 4I7VA 3QFEA 1XC4A 1KM4A 3LTPA 2ZRUA 1SW7A 1JCXA 1W5QA 3ZFHA 1XUUA 1GTEA 1JULA 2A85A 4O12A 4UFMA 1GJPA 4DBEA 2PCQA 5FF2A 1SFLA 4JTTA 2TMDA 3DFTA 4CNNA 2GQ8A 1F76A 2YFNA 5DCBA 3LRLA 3Q2DA 4POCA 1AW1A 1FUYA 2B7QA 3W2NA 2E6YA 2ZA2A 4ML9A 1VYPX 3OVRA 2Y6ZA 1G4SA 3IIPA 3G0UA 1TO3A 2B7PA 2JGYA 3WJXA 4D2JA 2VFGA 1Z41A 3NL2A 2RDUA 2A21A 1JCMP 5G2HA 4N2YA 1GG0A 5DLCA 2HSAA 4GUFA 2D73A 1M6JA 1Q6RA 2EKCA 4JTJA 4CLMA 4AHPA 4RZ5A 1X1ZA 3M16A 1OJXA 1W5PA 3UWUA 1PCKA 3MBFA 1ML1A 1OF8A 2GJNA 3CTLA 3M5ZA 1YTKA 1QO2A 1IF2A 1R46A 3TXZA 4RX0A 2DZXA 1FY6A 4UR8A 3QQ0A 4NT0A 1UBSA 3DH7A 3TDFA 4AH7A 1LLZA 2QCCA 5EBUA 3T78A 4IXXA 1TPC1 5E1QA 4OHQA 1OFPA 2QJGA 4IPIA 1LTDA 3TQKA 4TMCA 5AC6A 1SSDA 3G1HA 4RJEA 4Y8FA 3T4CA 2V82A 3TCEA 4ADTA 1XFBA 3O63A 3SZ8A 2XN2A 2DZSA 3DFSA 3N3MA 1OVDA 2CZDA 4ZVJA 1Y0EA 5CG7A 5E93A 3MI2A 3UWYA 3A5VA 3CB8A 5BOOA 2VELA 3LRKA 4GFSA 4O14A 3W7OA 2AAMA 2CZ5A 3NPUA 1UASA 4HPJA 4ADSA 3CEPA 4M19A 3NQCA 1J4EA 3W72A 1S5TA 3CWOX 3SJ3A 4Y6GA 1JUBA 1TQJA 3MHFA 2JKEA 1W3IA 4RXGA 2H6RA 4O13A 2RDWA 3LI1A 1I2OA 3E0IA 3T44A 2QCDA 1TTPA 2FDSA 3KOFA 2C13A 4EF9A 3FKKA 3CQ0A 3PBUA 3MO7A 2TRSA 1DBTA 3LHYA 5EYWA 2NUXA 2ZRXA 1MEHA 4XKYB 4I7UA 3M47A 5A5WA 5C55A 4O50A 1XCFA 4O8RA 1KFBA 3LCIA 2YFOA 3STCA 1ZCOA 3W6YA 1OX6A 2Z6IA 5C6MA 2JK2A 4JTSA 1FCQA 4QITA 3HG4A 3VFLA 1CI1A 3L66A 4LVGA 3SGUA 3NL5A 2B0MA 3NVTA 4JIQA 3TJXA 3OG3A 4UFLA 3W71A 3IVSA 1I2PA 3W7PA 3UWZA 2B7NA 3OA3A 2H90A 4MOZA 3BGGA 1D3HA 4JS3A 1J2WA 1QPRA 1WOAA 4X22A 2E5DA 2E6FA 4MYAA 3QM3A 3NL6A 2CZFA 4ICNA 3VNDA 3S1UA 4JXCA 4MPQA 2WSRA 3B8DA 1EUNA 3W1RA 3G1AA 3F03K 1XDMA 3SY5A 3TC6A 4L4LA 2GPTA 3PUEA 1JVNA 1FDYA 2NLIA 3DENA 4NZFA 3WFAA 5CZSA 4RXFA 1OFOA 3LHZA 3S1WA 1KTBA 4RKAA 3LXBA 3HGSA 4IMGA 4YCPA 5CPOA 1OFAA 1QMLA 3WJWA 1MSSA 3P81A 1C8VA 1GPWA 1U5JA 3F4NA 5TIMA 3W7DA 3B0VC 3U8GA 3UD6A 4CCDA 4XWUA 2E77A 3DXIA 1NVMA 4S2BA 1LROA 4HSNA 1BWKA 1S5VA 1VH7A 3DFQA 5DCDA 4JN6A 1AL8A 1IXQA 1VRDA 1PL9A 4K8EA 2E6DA 1GTHA 4UTUA 1RR2A 1KV5A 3W86A 2J24A 1Q45A 3DFPA 1VYSX 2EHHA 3IIZA 3HPZA 5AHLA 2VFDA 4S2CA 4JTKA 3W1TA 3KVMA 3MW7A 1KFCA 1R2RA 3O6DA 4UTJA 2BX7A 3E9AA 3EX3A 2E6AA 4DF2A 4FNUA 2BWGA 3W1PA 2QCMA 4IPJA 1WAUA 3NQFA 3I7SA 1WQ5A
chains in the Genus database with same CATH superfamily
3G0SA 4JTFA 4GCXA 4EE9A 3TQPA 5CPMA 4C1NA 5BU9A 1XIEA 2NZLA 1YPFA 3C61A 3S5OA 2PBOA 1RBOB 1OFEA 1XFCA 1JAKA 1UWRA 1X8FA 4LAZA 2VCBA 4TIMA 2PWUA 2YIHA 3WK2A 1AA1B 4IT1A 2PRLA 1SYTA 4D6CA 1A49A 1W3JA 5LNVA 1H2JA 3GFYA 3A64A 4B2DD 1CECA 4JTGA 2AMXA 2VTFA 3MUY1 4JTUA 1KBJA 5AHEA 5JH2A 1H50A 3AWOA 4CN1A 4QRNA 4M82A 3WLLA 4L65A 3TYAA 4AB4A 4HOZA 2AQWA 7REQB 5CGMA 3CJPA 4Y9NA 3NQGA 3TU9A 4NXSA 3MA8A 4MM1A 4N9CA 3W84A 1OFDA 2OKOA 1WZAA 3VYLA 2ZBTA 3NZPA 3VGFA 3UNTA 1R6WA 1THFD 3MMTA 4RW3A 3W87A 3VOIA 1OGGA 1FWAC 3K4WA 4X3ZA 4PUKA 2PCEA 3B97A 3SUVA 3SR7A 3IWPA 3TIMA 3VM5A 4JNMA 2FLIA 3V18A 4NYUA 1ITXA 4DO5A 1XGDA 4GK8A 1I9CB 5KITA 5HWJA 4H8UA 2FZ8A 2FMNA 4DYKA 3W1QA 2WJZA 2WNZA 4JKLA 1OF6A 5T9CE 2XVGA 1TTQA 1JYWA 1NOUA 3K8MA 1F6YA 5D9NA 1ZHAA 2AAAA 1QHPA 3DUGA 3FVMA 1OCBA 4AIEA 5J5RA 2E09A 3A21A 1B57A 3BO9A 1QOXA 2OZ3A 3CK5A 4HYVA 1ME7A 5I78A 4L4OA 4OGZA 1B0IA 1QCWA 1GOKA 1LG2A 1RBAA 4DX3A 3ZOAA 4GG9A 3N6HA 3KOWA 3II1A 1UYQA 2A6NA 3FHQA 1V3IA 5K9CA 1V3LA 5CLWA 3SCNA 1E56A 4ECLA 3WJZA 4P8UA 4GISA 1VLIA 3FS2A 4BR1A 4BJHA 3SBFA 5GJNA 3PY2A 5E0FA 5D9MA 4UMAA 4D1JA 4B5TA 5AYZA 4Q7NA 4MVAA 1OIMA 2X0YA 2FFCA 3UCDA 1E3XA 4J5NA 4LF2A 3LA4A 2BOGX 5FEZA 3SEPA 4MB3A 1B9BA 2DSZA 1LUCA 3S2MA 1OSEA 3GK0A 1P7TB 5DELA 1Q7ZA 4J3XA 5DBUA 4MNLA 3FKRA 2QAPA 4Q3MA 5HAOA 2PDGA 2PDHA 3O7UA 3UR8A 4Z2GA 1K9EA 3BCJA 1JQVA 1KFKA 1D8WA 3N9KA 4Q4QA 1TJ2A 2JBMA 1BG9A 3VCRA 1L2QA 5CKSA 1XLIA 3GVGA 4G56A 4KIRA 5L6UA 3VD3A 5LA1A 5HMFA 1EFZA 1EEXA 3GWQA 3ONBA 5DT5A 2WHJA 4J2MA 4YMZA 1P6BA 2FKPA 2OODA 2OO6A 5E0KA 3U7BA 2WMGA 2ALDA 3B0XA 3GDBA 1MW0A 4K6AA 3A4XA 1L6YA 4JX4A 1XYFA 3UCQA 4K8HA 1VZWA 3KFTA 2VFEA 3QMSA 3MI6A 4PTDA 3S2LA 1ZJHA 3RMJA 3RM9A 3P60A 4M6QA 4MZ8A 4ZO8A 1TR9A 7TAAA 2VT0A 1R3WA 5E09A 4L4PA 1NF7A 3WLPA 3G8RA 4GGBA 2OT1A 4K1WA 1MZRA 4DXVA 2GVGA 3C0LA 3W2LA 3BSGA 3MKVA 4HA0A 2EBNA 1MUMA 1SJCA 1E4IA 4WUIA 2BMBA 5AHIA 3TROA 1LRQA 3H2AA 2OKTA 3NEVA 3TSBA 5FAGA 3LDVA 2OVLA 4DM1A 2AL2A 2PC8A 2HPMA 4OKDA 3WUGA 1U1HA 1R9YA 5DN1A 2IQDA 4QEEA 4K7YA 1Q6DA 3CQIA 1B3XA 3MWCA 4QX4A 3BCFA 3M7SA 5BXSA 2Q8LA 2XWDA 2QVHA 3CYJA 3BGAA 3P7YA 4JTCA 4O11A 1W3KA 4GI8A 1VJSA 3LBCA 5D37A 1YBQA 2C19A 3E74A 1LZOA 4NNBA 2Q6ZA 3NO3A 2E40A 3MJYA 3CZJA 2ZC1A 3UWVA 1W5OA 4IX0A 3WMBA 2NQ9A 3N2XA 4OWGA 5BOFA 1E6XM 3ZXWA 3ZJKA 2DT1A 3RLHA 4LCRA 3L0GA 3IACA 4DUOA 1E4MM 3ZS4A 1AH0A 4XVDA 3FYYA 4G6CA 2W67A 3B04A 4GY7A 4EXAA 4XQ6A 2J6XA 1JUEA 1FWSA 1HKMA 1PIFA 3CQKA 2CLLA 1ITCA 2WJDA 1WE5A 4NI3A 4GIYA 3F7JA 3GW3A 4L61A 5J04A 2EF9A 1HP5A 5XIMA 4LVBA 3HGJA 3RU8X 3HV8A 3T81A 3EX4A 4DBSA 1OCQA 1M04A 2JF7A 1YTEA 3URNA 1XGEA 2XVNA 4J9JA 3WJYA 3P84A 3W24A 2A7NA 4L9XA 1SO5A 3DKLA 4CQBA 2R24A 1L8PA 2H8XA 2WMFA 3VZXA 3W70A 3AZSA 3EXTA 4E3TA 2Z2AA 3OQEA 2WVUA 5IDIA 3U57A 3ITXA 3QYQA 4UFJA 2ZXDA 1CNVA 3DHUA 4J1OA 4PCNA 3K8KA 4IQJA 2OMAA 4MY8A 1AQMA 4GC4A 1WKEA 7REQA 2XHYA 2FPTA 2VURA 2GUYA 4AD0A 1EPXA 1B3OA 2YJQA 3ENLA 1X1NA 2J7EA 2ATMA 1FXQA 2DW6A 1I75A 3EOOA 4JR5A 2DIEA 2Y7FA 3WLNA 3FYPA 3ITTA 1MEWA 1J10A 3EAUA 1YNYA 5BXRA 3SCUA 4IL2A 3ZO9A 3B9NA 1AD4A 3UA3A 3GG7A 4HD5A 3AYTA 2Z0IA 5EMYA 2DIJA 2KZHA 4MKSA 3QLLA 3F4WA 4IP5A 3PANA 2NV9A 2BODX 4H41A 2QUUA 2ZA3A 1BVZA 2PGRA 3MUCA 4YHGA 3HQOA 4ZQNA 3B8SA 4NJIA 2QUNA 3S4TA 3QN3A 1TV4A 3BLLA 1Z44A 3W23A 5A6MA 4E0CA 2WOQA 4W7VA 2DVTA 1KGWA 1NJJA 3C0SA 1MFUA 4QTGA 1FDJA 4MJZA 3UBPC 3FYOA 1XCWA 2A4AA 3SCRA 3WG6A 1VBGA 4M5PA 1T96A 3SFWA 3I10A 3SW6A 2J7CA 4PMDA 5D03A 3VOCA 3VVGA 4Q8PA 3PR2A 4JYFA 4HYRA 3WLQA 1UUOA 3B9DA 4F0LA 1BYAA 4RW5A 1S2AA 5HPOA 3O07A 1VEMA 1XRTA 4JN8A 1EJUC 3OBAA 3A3WA 4Z1AA 1VS1A 4XIMA 1KM0A 5IHRA 1VJIA 1VD6A 4XD3A 1DWHM 2CITA 3ZSTA 1X8CA 4XAFA 1DWFM 4XAGA 2E7FA 5JU6A 3FJNA 3VGBA 2GSEA 3PZVA 1XP3A 3HJZA 5LA2A 2ZZ4A 5AN7A 1E6RA 3L2LA 2A3EA 2OYLA 4C1LA 3QZAA 1MYRA 1KXHA 2SFPA 2J7DA 3L4YA 3F1QA 3RK8A 3Q37A 3SSZA 1A3WA 1HG3A 5B80A 4I8YA 2F2HA 4GQRA 1Z69A 2BG5A 3SQLA 3EA3A 2ZRYA 1U30A 2J9YA 1J79A 1PKNA 3O0KA 4ICMA 4LBRA 1V6XA 1OG6A 5I23A 3ES7A 1EC9A 9CGTA 2Z24A 3LZ5A 4LV9A 2E9BA 3GB6A 4LY8A 1JPDX 4QLLA 4GI6A 5JBFA 3KRSA 4JY9A 2PFHA 4RE0A 1YX1A 5LIWX 1US0A 3CHVA 5HR7A 1BLIA 3HFTA 2FQIA 2G8ZA 4HNLA 3MYPA 4W5UA 4JFTA 3V0SA 2ZUWA 1CLVA 3N2TA 3H54A 5JIWA 3GAYA 4LF1A 4TU1A 1A5KC 2NT0A 2RH9A 4UNLA 5E70A 4LCQA 5HNUA 3QQ1A 3LLFA 1KWGA 1TPH1 2P5NA 3KAOA 2OZ8A 1NAL1 4JD4A 3STPA 2WZTA 2V5KA 3PZIA 5I3FA 3E02A 4F0MA 3EDJA 1R7AA 4RE2A 2QGHA 3EDEA 3GC5A 5CJ5A 5PTDA 4E8CA 3SQMA 2PDWA 1E73M 4Y7EA 3UG3A 5I3KA 2NX9A 3BURA 4IGMA 4PULA 4UQ9A 3E96A 2XIJA 4ZCWA 3A3XA 2DFAA 1ONEA 1MNSA 3AZRA 2GJRA 2CKRA 3CZGA 1EX1A 3M7WA 3UETA 1US3A 3AU6A 3VOGA 2XSXA 1JI1A 3ABXA 4LUSB 3SSJA 1H60A 4KERA 4QJ3B 2VEKA 4L7ZA 3E3HA 3R7MA 2KX9A 2BY3A 4LAOA 3N14A 3T4WA 3FAWA 3K46A 4HU3A 4M0XA 4TX9A 5FF4A 1ISVA 3GVVA 3T0CA 3ARWA 3UNDA 3NYDA 2PTXA 1W56A 3TQ0A 1VFMA 1O6IA 3A22A 2NV1A 3DYPA 1XIDA 2OT0A 3MMWA 1B2YA 2Z1KA 4BQ5A 2WVTA 5CQ1A 4J2PA 3KBWA 4H1ZA 5GNZA 1FKWA 3DC8A 4ALDA 4PBEA 1RCOB 3E2RA 1AW5A 3CBWA 4C6FA 3BAWA 3B0PA 4QXIA 2V81A 1VRXA 2PP0A 1CYGA 3HJEA 1YIXA 3HN3A 4WY0F 4Q6JA 3QVQA 1FKXA 1NQKA 1DXIA 4HN8A 3EPMA 4AIUA 3TN6A 1GOIA 3W85A 4JTEA 1LM1A 3IUIA 2OX4A 1QASA 3LENA 4KEUA 1XW8A 3F5KA 1V03A 4CU8A 1BKSA 1UIOA 5JXQA 3LD5A 4V27A 1XLMA 4NJJA 3H22A 2OTDA 5D32A 3S9YA 3W7EA 3ARQA 1AW2A 4HNVA 2QJIA 1SZEA 1ZS2A 4O28A 4X60A 4C6JA 4GH1A 3T0BA 1FCUA 4LQ1A 2CYGA 2WM1A 4H7ZA 3S5ZA 1DQUA 1I60A 1XHGA 3WQGA 2DZWA 2ZUMA 4IL0A 3PG8A 4XSMA 3ZR5A 3ONCA 5H6HA 4LOCA 3HGOA 3OPSA 3N19B 4HNTA 3POCA 2VFHA 4XAPA 4QR6A 4DBDA 2DZUA 3FX4A 3M0VA 4EF8A 1XLBA 1H49A 3BLEA 4OE7A 3E49A 2ZXAA 4HZMA 3H4XA 3EOSA 1RLDA 1QI3A 1LOLA 4HMNA 4O1CA 3INPA 1VFTA 3H2NA 2R94A 2C3ZA 1S2VA 2ZDSA 2RAGA 3DHDA 3L5LA 8XIMA 1H63A 4DBWA 1J0HA 1TV7A 2OSXA 3LSBA 4XZIA 1OB0A 3C2EA 2H3DA 2WMIA 2RKXA 2OEMA 4XTDA 3WQCA 4AVNA 3TMLA 1HJVA 2D2GA 3VUPA 5B7YA 4O10A 3MDWA 3CZ8A 4KWWA 3S3GA 3ABOA 1GOMA 1CCWB 1UKQA 5C70A 1XSKA 2I7GA 2VRJA 5LXEA 1V0MA 4IPLA 3ES8A 2F2KA 4MB1A 4RNHA 4N4PA 1H51A 3R2GA 3GVQA 1SSGA 4MUPA 3S42A 4GY0A 3TOPA 4IJRA 2XM2A 3IGSA 3KEHA 3DAQA 4L56A 1P1XA 1EC7A 4M6VA 1I45A 4CQ8A 2VR4A 4I5RA 3BG9A 4R85A 1EO7A 3EMZA 1Y65A 2PAJA 4UC5A 3W4RA 1F9CA 2YA1A 1M7OA 5EY5A 2CU0A 1S2WA 4W89A 1JR1A 1D8CA 2GGJA 1MI3A 4IIEA 3VIGA 5CPSA 5C9ZA 1IR1A 1IV8A 4GD0A 3TK7A 1F7BA 1PJ9A 1DV7A 5DCEA 2VD8A 1KM5A 5A6TC 3P74A 7ODCA 4LTSA 1OC7A 3TTEA 3TH6A 2XIMA 4H2HA 2FZBA 1TIWA 2G4JA 2J47A 2MNRA 4Y9OA 3VE9A 2X40A 3EWCA 4D8AA 1KTCA 4QJ5B 2FJUB 1SZGA 4XUYA 3UZYA 3P2VA 1JXJA 1EOMA 1U5VA 2QDHA 1LBLA 4EAYA 4QP0A 2A2IA 1A5UA 4WCJA 3EOEA 1BEUA 4YVPA 2E9MA 5CCZA 3CS2A 1TSIA 2I16A 3ARUA 5HQMA 2XINA 2YGYA 4XX6A 1TZZA 2JKPA 1KM6A 3BICA 1ICSA 5DT7A 1HNYA 4DO6A 1RSCA 2QAFA 1E3ZA 1GQJA 2RDXA 4WEVX 1N8FA 5C9XA 3BJSA 2EJAA 1NOWA 2GK1A 3U6WA 1AH3A 1NTHA 1GHSA 2HTMA 3SQSA 4FNSA 3KL3A 3IIOA 5C71A 1GPFA 4I9TA 3GNNA 4LBUA 3QJAA 4FOKA 2PLMA 3GIPA 3XIMA 1BGAA 2QEZA 5MF5A 2JGQA 3VIIA 4MJ2A 2CBUA 3KBMA 4M51A 3GU9A 4BEQA 1V3HA 3NVDA 1FP8A 1QATA 4GXWA 5KTLA 1DJWA 1TRDA 4E4PA 1Q6GA 2H8ZA 3HG5A 5C8BB 3C8NA 5F2GA 3FGCB 4C5ZA 5CBBA 3ZWSA 1CGVA 5A95A 2DH2A 3VDAA 2UY4A 5F1UA 4QFUA 5FSEC 1ZGDA 3P0WA 4ZFMA 5CSRA 1B1YA 3VNKA 4UTHA 2PDBA 2Q3RA 3IGHX 4FNTA 4RE4A 3FFSA 1ZY9A 3KBVA 4FI4A 4RR4A 3WBAA 4Q8MA 1O7AA 4QDPA 3NQAA 2L5HA 4UOZA 2RGLA 4K36A 1AG1O 1PV8A 1XD1A 2OLHA 3CV7A 1D3CA 4NJKA 2PF0A 3THCA 3A4AA 3NQMA 4JQ4A 3E6EA 2NSOA 3W7CA 4ZFCA 4AAJA 1E9YB 3EOUA 3PZGA 2BXVA 4HK7A 2NVDA 4OT7A 3U7VA 2NX3A 3UYIA 4XUGA 3TW9A 4DLMA 2YDRA 3T05A 1OY0A 4Z2HA 1NFBA 4NP7A 1NQ6A 4FXFA 2WO5A 3G0XA 2NXIA 3ALGA 4GE8A 2VKZG 5KEZA 5EFDA 3M5YA 4U10A 3PN8A 2G37A 1K8XA 1OM0A 2I56A 2QJHA 4JNYA 1TJPA 3EX6A 2P76A 1VBRA 4CNSA 1MQQA 3LBMA 2V5LA 4O57A 2PWHA 4CQ9A 5A6SA 3LMYA 3M0MA 3BH4A 4GX9A 4OECA 1TJ1A 1H1ZA 1FCVA 4KEVA 4XZNX 3NSXA 1VFOA 2IPJA 4ASTA 2J27A 1WXZA 2V0TA 1KCXA 3B40A 2DU2A 3AROA 4H9YA 4J3UA 3QEZA 1JZ6A 3IGUA 3NQ6A 4KCTA 1UUQA 2WPBA 3W7RA 2C71A 4NAEA 4B5UA 2FPYA 3GC2A 3QZ6A 4GI9A 1EWEA 1P4CA 2GSJA 1LBFA 4GIEA 1XWYA 3V75A 3LXAA 5D8ZA 2D24A 3PP7A 4TO8A 3O06A 1WNOA 3AJ7A 3V3WA 5F4WA 2IPFA 4FP1A 4E2OA 3JZUA 3L0KA 3VILA 3CL8A 1RPXA 4IFKA 3G1RA 2Z00A 1JL8A 1QNQA 1EXPA 1UKSA 5I3DA 3RCYA 1MW3A 4HT3A 1QDSA 4DM2A 3AXIA 2WJFA 3ZQ9A 4QE1A 3ARSA 2WBKA 3MV11 3GBEA 2GWNA 3TOYA 2VUYA 4FOUA 3GHSA 1M53A 3GNRA 4H8NA 2E1DA 1J0IA 1CZ1A 4HHPA 2P0IA 2HXTA 5IBXC 1J9YA 5D02A 4OU1A 2ZFAA 3E2SA 5K2ZA 3LGGA 1LCOA 4HA1A 3N4AA 2VP8A 1PUDA 3W7JA 4KCUA 3I6RA 2RFGA 4ORIA 1WXJA 3PJUA 1FHDA 1CLKA 1H5VA 3WH7A 2ZQ0A 1LLWA 4L6OA 2XFRA 4ZSUA 5K7JA 3O0FA 2DJXA 3U9IA 4DO7A 1W1A1 3G1FA 2W92A 1OYBA 1JPMA 4KWVA 5D38A 5DANA 5A6AA 5FL1A 5DF0A 4LV4A 2BSLA 4UQEA 2FJKA 1Q4NX 5FKYA 1J6PA 2Y7DA 4YTQA 5C9RA 1MXSA 4P61A 3O2LA 3CIVA 1UP2A 2VYOA 3A13A 2WQPA 1OYCA 4CU7A 4N42A 4DI9A 3PUDA 1K8YA 1XLDA 3CU2A 1Y7VA 3GG1A 3BJTA 4K37A 4CNOA 3S2JA 3TXVA 1LQAA 2WVVB 3M6DA 1M7XA 1PEZA 2QJMA 4GH3A 1WBJA 1VHNA 3GVRA 3LSCA 4LT9A 4RLIA 1M1BA 4CNUA 3CM4A 3TUUA 2VUNA 4MWAE 3BSHA 2R1LA 4PR4A 4ATWA 5BXPA 1VJZA 3GHUA 3OB8A 1VENA 3VNZA 1ZB5A 1ZNNA 4FR6A 3GUWA 1NWRA 1P0BA 3NM3A 4DAIA 1YADA 1F5ZA 3OVQA 4A4AA 4Z1YA 4L64A 3AIVA 4RNFA 3EB4A 5IBXA 3EGJA 3EKGA 1FTXA 1W9DM 2WV8A 1G6CA 1LJYA 2DSVA 3PG9A 3V0TA 4WIWA 5AHMA 1V77A 3THUA 1XC4A 4GIAA 2XPKA 1SW7A 2JQXA 1GTEA 1GJPA 2CEQA 2QIWA 4U5IA 4DBEA 3VNYA 3CHFA 2IKJA 3V16A 2XZ7A 2V69A 2YL9A 3GNOA 4QAWA 1S3TC 3LRLA 4POCA 3TTOA 2B7QA 3W2NA 4ML9A 2Y6ZA 1G4SA 3IIPA 3EYPA 2JGYA 4F40A 1Z41A 2PDXA 2RDUA 4B5SA 1WZKA 5G2HA 4N2YA 1GYMA 3SY8A 3KZPA 4RZ5A 4NILA 3HPAA 1W5PA 3URAA 1OQFA 2YBVA 1QO2A 1PTDA 1H1NA 1XKJA 2PDJA 4GINA 4AZIA 4QSFA 1UBSA 3DH7A 3TDFA 1EIBA 4AH7A 2XM1A 1LLZA 2ACSA 2YOCA 1XCXA 4EPDC 3IJDA 2G3FA 4DNMA 3T09A 3MU7A 3T78A 4ROQA 1OFPA 2QJGA 4ILSA 4TMCA 1SSDA 4Y8FA 3IAPA 2PDYA 3RRAA 2XN2A 4AEEA 2PDCA 4H19A 4ZVJA 3D3FA 2VGIA 1Y0EA 5E93A 3CHDA 3ITVA 2QJJA 3DCPA 2JF6A 3WD1A 3LRKA 4GFSA 3OLIA 1K77A 2AAMA 1R3TA 4Y8EA 4ADSA 4O1EA 4M19A 3CV1A 2B81A 4URIA 1S5TA 1GCYA 4Y6GA 2W61A 3D6NA 4LUTA 4AY8A 2RDWA 4TTUA 1YNQA 2QCDA 4LB3A 3KOFA 1FVPA 3O9NA 1KR1A 3H4WA 1TMQA 3KCLA 3ARZA 1J12A 4LANA 1HT6A 4A8IA 3AIQA 3CNYA 4MSSA 3UF9A 4O50A 2IXVA 2ZWYA 3T9PA 5HANA 3G6LA 2XIQA 2JK2A 4JTSA 1EGZA 1FCQA 2VDHA 1C91A 3BJFA 3HG4A 3VFLA 3GUGA 1OEPA 4LVGA 4MADA 4W8LA 4ERAA 3DYMA 5CPQA 2B0MA 1RHCA 1RH9A 4PTVA 3NVTA 2ZXQA 3TJXA 2BXZA 3G77A 3W71A 3IVSA 1I2PA 3W7PA 2H90A 2HVNA 3UW6A 3RHGA 3BWWA 2REQA 1I0DA 2CZFA 3BMWA 3O3RA 4GNVA 4ICNA 4GOAA 3VNDA 1H0GA 3LM3A 3DERA 3Q67A 4LNCA 4JXCA 3TN4A 4D6JA 3B8DA 1IZKA 3BTNA 1JPHA 2ZOXA 5C7VA 1E1CB 2E0PA 1JVNA 1FDYA 2OZTA 2WM0A 3S83A 1RP8A 1W1B1 4V1XA 3HGSA 4IMGA 4GLEA 5DMNA 1QMLA 1N8WA 1OGBA 5I77A 3FA4A 2WSPA 3UWEA 4E6MA 3K13A 3A9BA 3A47A 2XTKA 1NVMA 5A2AA 3KP0A 1Q6EA 1BWKA 1IXQA 3UERA 4K8EA 2E6DA 1Q63A 3Q65A 1GTHA 4UTUA 2XUCA 1Q45A 3EEZA 5CSUA 2UY2A 4A3YA 1XYAA 3W1TA 2BGNE 1PX8A 3GM8A 1C9WA 5XIAA 2A3AA 2E6AA 2HDJA 4DF2A 4FNUA 4U3CA 2CNCA 5I02A 3I4EA 3R8HA 4UTFA 4JX6A 1WUFA 1A47A 3BW3A 4W7UA 1WBHA 2PE4A 3IJ8A 3LK6A 2PTYA 4C6EA 1E1EA 2OLAA 8A3HA 1GZ1A 1VCVA 3S0CA 2C8NA 1P43A 1ZENA 1RV8A 3L5MA 4E2DA 4XV0A 4C1KA 1OCJA 4IGHA 1ZPTA 1JGMA 3AC0A 2YB1A 4NIRA 1HKJA 4O53A 1WDDA 2F9RA 2HROA 3S5YA 4XZ9A 3R25A 3TYCA 3MHUA 2ZICA 4UTWC 1NSJA 2WVVA 1BKHA 3RF9A 1LRNA 3GXDA 4UFIA 1S38A 3VNMA 5GNXA 2YCLA 5HDRA 3RU6A 3O05A 3H2FA 5G2WA 3WCZA 3R13A 3NR0A 1QTWA 2GVEA 3LCLA 2NXGA 5M2FX 3DYOA 4RUBA 4F0HA 4Z1DA 1B4EA 2AKZA 3BLDA 4I6VA 4XBJA 1QHOA 3AIWA 2WSYA 1R87A 3B3DA 3NIYA 1DTUA 3KX6A 1LQ2A 4BFAA 4OFCA 1R9ZA 1Q3NA 1QRQA 1UP3A 4J27A 5E0CA 4FLOA 2GL5A 1ZQ5A 2O4QA 3MYOA 3C8FA 3AZTA 1XH2A 2Y7EA 3DG7A 1F2JA 1EDGA 3ZWTA 2F61A 3M0JA 4WQ6A 5K4ZA 6A3HA 1O1HA 4GZ7A 1QT1A 3LCHA 1SFJA 3WQ5A 1X6UA 4GZEA 3BDKA 2QGYA 4KFNA 4YVXA 1FQ0A 2ZYFA 1E4LA 1XDJA 4LS1A 5AFDA 1ZAHA 3DGRA 3HA1A 3VIJA 4OOUA 4YCOA 3G1VA 3CAWA 5I5RA 3V1PA 4YXGA 1SUXA 4GUGA 1PKYA 3N15A 4O54A 2TSYA 1ZBWA 2QF7A 1VFSA 1SW0A 4ZE4A 3SUSA 2J7BA 4Q32A 1C3FA 2DUZA 1NP0A 1NF0A 4R7WA 1MUWA 1N8IA 1Y5WA 1XYCA 4XD5A 4LYRA 3MUZ1 3C2OA 3PAJA 1OX4B 4YU1A 1QJWA 3TONA 3RM4A 2G95A 3RAOA 1XR2A 4UQCA 4O52A 3WNMA 3AS2A 5JIPA 1GKPA 3A24A 3W27A 3JUGA 2D3NA 2J62A 4FA3A 3CUZA 4XZLX 5BOEA 3VE7A 2E9LA 2O7QA 4IIFA 1WKFA 3L4ZA 5C54A 3W1NA 3H55A 4O19A 3VZZA 2BB0A 4R53A 3SUWA 4GABA 3H24A 4G7EA 4PYSA 1H0IA 4D6FA 5ECUA 3ZVHA 4NZ5A 1DJZA 4ZODA 2I17A 2BP1A 3VFCA 3BLOA 4PGLA 4OVXA 1Q4WA 4KGJA 3LB0A 1QBAA 1K7XA 2CBIA 1JD9A 2WHLA 1TCMA 4QQUA 1ZP4A 2EXOA 2CZEA 1R8LA 4V2XA 3I7QA 3CUXA 1QUMA 1BVWA 1G4EA 3R94A 1FDZA 3QPEA 2CIPA 2ZZ1A 4RE3A 4YN5A 3NDOA 3BLPX 3C2RA 2VDGA 1JNDA 3GXNA 3WL0A 3W6LA 3WJSA 1XYBA 4IJCA 5CBIA 3BLKA 4GVHA 1EF2A 3FNDA 3I68A 3P8JA 2W91A 4FOJA 1MXDA 3MMDA 4EKJA 2V3GA 3WYZA 5I24A 2EJ1A 4JDYA 3H26A 1GZJA 1QK2A 1JPKA 3AAMA 1IZCA 1FWIC 3TYDA 4DF0A 4PMRA 1Y5VA 1EP2A 3RRXA 4GVFA 1AODA 4HU8A 5C2XA 3EX2A 4GO9A 1RVGA 2V5BA 4YS1A 3ITGA 4QAIA 3IIVA 3QOKA 2V9DA 4KGLA 1PS9A 4DXXA 4J3TA 2V67A 4DYJA 3OHMB 2D1ZA 3UXKA 2OLSA 1YPIA 3WH8A 3IJ7A 3OIHA 3F2BA 5LNRA 4JDBA 3VKJA 4F48A 2ON3A 4OBRA 2QDEA 3HMJG 1X6NA 3I4KA 4LALA 3N9RA 4LJ3A 1QWGA 1EJXC 3MPGA 3CEUA 1GVQA 1OT1A 3TN3A 2Y88A 2QCNA 1UPPA 2P8BA 4EANA 3HM7A 1XUZA 1EA9C 4EK7A 2GDUA 4MLJA 1EQPA 2V30A 1TE6A 1TTIA 1UD2A 4WX2A 1WPCA 3FJ6A 1W9XA 3KBNA 4U3AA 3VD5A 1WKYA 1KQYA 3WD3A 2J8GA 3AHTA 4DIAA 5D9PA 1JCLA 3UZJA 5I3IA 2X1SA 4FF7A 1A53A 3LCWA 4JTIA 5E9XA 5HINA 4WY0A 4AZ6A 5A6BD 3UWQA 2YA0A 2A5HA 4EVZA 3N6JA 2PTWA 3PBYA 4J40A 3B8IA 3GTXA 4S39A 4PRWA 2D69A 3VDGA 4B4HA 2V3DA 3NZRA 1E51A 1RCQA 3KWSA 4C6IA 4XO6A 4CN6A 2FHCA 3QY6A 3B9OA 4GPNA 4GX8A 3HPFA 4CN4A 4JTDA 1ZJIA 3TCSA 2VZTA 2CWNA 3T0DA 4LRSA 2CFFA 2C1IA 1BAGA 2QDGA 1Q6QA 2QQ6A 3MCMA 4BCEA 3M9YA 1H7RA 2OCZA 2ISSA 5FF0A 4JGDA 1XYMA 4H00A 4S3EA 5EMJA 1WZLA 3W75A 3W7NA 1NM9A 5A8QA 3KTCA 5K9XA 4Q8WA 2PBGA 2BV9A 3W07A 2OYKA 4L6DA 3FLUA 5CPNA 1S2UA 2HPIA 3ARRA 1TREA 4M3PA 4LYPA 4DWSB 3AI0A 1OFRA 3TC7A 1IHIA 2WSQA 3KCJA 2FH6A 3WF4A 1W3TA 3MQTA 1NARA 1LWJA 1MO0A 4XB3A 4GY1A 3WF0A 1SJDA 3N9SA 4QHRA 4CQDA 4DJFC 4QSHA 1B3ZA 2D0GA 2CETA 3SN1A 1IXPA 2A3LA 4E3VA 4GXMA 5KZDA 2MANA 3GKFA 4IX2A 5A6LA 3SRHA 3E2VA 1UD6A 2VX7A 2PWDA 4DZAA 1OINA 3OYZA 3T2OA 2ZZ6A 8XIAA 1FX6A 2YCKX 4X9YA 3UVAA 6REQB 2JEQA 3V36A 4D71A 1QNPA 4A21A 3AALA 1DYSA 2EG6A 1E6SM 1XI3A 1B3VA 4MJ4A 3QSRA 1W5NA 4KBXA 1F73A 2OO0A 3PM6A 4NYYA 1TE1A 2CPUA 3N25A 1HVQA 1TPUA 3D3AA 1BF2A 4GC3A 3QV7A 4HPNA 3G1SA 1F8MA 3PTMA 3F4DA 2QVNA 4GMEA 1C92A 3HG3A 5CGTA 2ZA1A 2E4TA 1HJWA 2RHGA 3QW4B 3CPUA 3DESA 3BMVA 3T07A 2H3BA 4DZ5A 3WLIA 1GJWA 1AJZA 5DX7A 5EBAA 2R1PA 3TTYA 4TTGA 1WB0A 5G1MA 4AZCB 3IARA 3QW3A 5CZTA 4C6BA 1WAWA 4Y90A 1J93A 1OWQA 1TA3A 2XGIA 2J6VA 5DMMA 1C7TA 1MDRA 3OO2A 1MRAA 2OOGA 5AECA 2GJXA 1C8YA 3LHTA 1P6WA 1CX9A 4LCSA 1EDTA 4FIQA 4W8BA 1V02E 4G7FA 3VIOA 2GQAA 3PBGA 1UR8A 1JXKA 3NZGA 2ISWA 3VKBA 1JQXA 5AC5A 5RUBA 1R9XA 3T2PA 3OGRA 4J7RA 4ZBCA 4Z0SA 1DORA 1XLHA 1XIJA 4H83A 2R8WA 3BOFA 3HBLA 2VR5A 4JIEA 1NDVA 4OV4A 3BG3A 4KESA 1YEYA 2VZUA 4DJFA 4AZGA 3EWUA 3KVKA 3RUBL 1Z89A 3CUGA 1YQ2A 2GSHA 2YKKA 4XKMA 1XV8A 2A1YA 2Y89A 1UZHA 5DEZA 1ZZMA 4REQB 2XGZA 2HBVA 1XICA 4C6NA 4S3JA 5C2CA 1ENUA 6TIMA 3BE7A 4C6OA 1DIDA 2DT0A 2YDAA 4HKPA 4M1BA 2X8RA 5JMUA 1XDLA 4U5KA 3GFXA 3KE0A 1H7WA 2BASA 3A3HA 3LS9A 1Z3NA 2GVJA 3DFHA 2C0AA 3M07A 4FAMA 3AMGA 2YSWA 1KM3A 3T55A 3TZNA 4E8GA 3SADA 5HJLA 2FDMA 4F79A 1G4TA 1VLWA 1TPWA 2GGHA 4MF4A 2C1HA 3CO4A 1W2PA 1F3WA 4LWWA 3JS3A 3WBWA 2Z25A 5LSMA 2WJEA 1S2TA 5JVLA 5BMXA 4WD0A 1UP0A 1TPFA 1WDWA 1CXFA 2Y8KA 2YYUA 2CZVA 4A6GA 4DWSC 1B31A 4GYPC 2ZZ5A 4B3LA 2V3FA 1MW2A 1DOSA 4DHGA 1LT7A 3P80A 1WDRA 1P0DA 3VPLA 2IW0A 1AFSA 1UG6A 4UWMA 2R1NA 4AWTA 1E6NA 2BHZA 4WXZA 4NZCA 2VRQA 1PZ3A 4FPSA 3G3MA 5BWFA 4D9PA 4IOTA 4R27A 2CLKA 1GKRA 4QISA 1E40A 1GT8A 4PMYA 4O4WA 1X6LA 3REQA 3SGGA 1K8CA 4KMQA 3W26A 5JBEA 4LH8A 4QJ1A 4KRTA 7PTDA 2NSXA 3WMLA 3N13A 3GKAA 4H8HA 1JDAA 5KSWA 5HBFA 2FB2A 3AHVA 3S1XA 1B30A 3PBMA 2PWEA 3OBKA 1YDNA 2WCGA 4GUIA 3BAIA 1RQBA 2J8FA 5GJPA 1G5AA 4FNQA 3WQ6A 3NGJA 2BY1A 2OR2A 2GOKA 3EMCA 4IG2A 3BV4A 2ZRZA 2VX4A 3WK1A 4Y96A 2E1WA 2EEXA 3W81A 2GWGA 1GG1A 4M24A 3NWRA 5AOUA 2PF8A 3QMRA 3VO0A 4QBXA 5J8LA 1ZTVA 1DPMA 1EJ7L 3RX2A 1VGAA 3GLCA 3CLMA 4OZOA 2CLPA 2PODA 2XVPA 5BW6A 1QO5A 3RR1A 5D8WA 1UIPA 2D23A 3BARA 3GIYA 1TR1A 4XKYA 3R0UA 3B4UA 4UBPC 1JRCA 1ZJBA 3VINA 1TUXA 4UCGA 2WQDA 1N55A 1GVSA 1IEXA 5FD0A 1EP1A 4FX7A 4HK5A 2ZIDA 4O0ZA 3JU2A 3VA8A 1JZ2A 2Y70A 2AQOA 3O6AA 2XFWA 1F6KA 1G7VA 3OLDA 4LBSA 3VX1A 4S3FA 1XG3A 4DWSA 3ID7A 4GYPA 1GEQA 4JQ3A 1UBPC 3G1YA 3SRKA 3WKZA 3ELFA 3URQA 3I7RA 1C8XA 3H2EA 3VU2A 2GVYA 2PDLA 6XIMA 3IEBA 3TNOA 3WQ4A 1KGUA 1DJXA 1S5WA 2OPJA 1GK8A 5D4YA 3BAJA 1ISWA 4YJ5A 2CLOA 3IUHA 3EPOA 1MFVA 2PGEA 1ECQA 3SIMA 4ZQCA 3NQBA 1E55A 3F2CA 2YXOA 3QOMA 4ACYA 2YBUA 5HWMA 1AH4A 4WJ8A 2OJPA 1LL7A 1JF6A 4AYSA 3C4UA 4IMAA 3WLTA 3MVIA 1HL2A 6CGTA 1FHLA 1U2YA 4GVIA 4BF7A 1UOKA 1LRTA 3M0YA 1OBAA 3KWXA 9XIAA 3MSDA 3GO2A 2Z7GA 4PL1A 3M0ZA 1N7KA 3UG4A 1B90A 1FH9A 1ONXA 3IJQA 3WQPA 1QW9A 4JHZA 4P7RA 4EXQA 2P50A 1J5TA 1M41A 3MWAA 4B91A 4MFDA 4FX6M 5CZ0A 3BUVA 2WZMA 3GC4A 1IT8A 4UTLA 3NXLA 2HNHA 4QS5A 1AMKA 3CB3A 1EA0A 1L6SA 3HQPA 3NSNA 1E6PA 1K1DA 4E4UA 3ITOA 4RZ4A 5M1TA 2GZXA 3AIBA 5HPCA 1AQ0A 3LCXA 2PWGA 4XISA 1BXNA 3L4WA 1IWBA 2PSNA 3G8EA 1V51A 5AHFA 4I6KA 1L9WA 5HNRA 1K03A 1QPOA 5LNWA 2I9EA 2QULA 2ADAA 2R82A 1GYNA 1CTNA 3VCCA 5G4EA 2V2DA 1BRLA 2GOUA 1QNRA 3M1ZA 3DC0A 4L4MA 1LUCB 3DECA 1Q6OA 1ZL1A 3NQ2A 4KW2A 3KVLA 1H5YA 4N0RA 1O5RA 3NEHA 3PFMA 4MFEA 4O1BA 3E1F1 3TJLA 3BK0A 1DKWA 3LERA 4ZZ9A 2WMJA 4HTYA 4A2SA 5FF7A 1CXIA 2ZTKA 2FFIA 4J28A 2H9AA 3GX9A 3WNNA 4FXJA 4MWAC 1YYAA 1TIMA 3WEMA 4RL3A 5KINA 1LQ0A 5LYRA 1W1TA 3FOKA 3FN9A 1LG1A 1VB9A 1RPKA 5G5IA 4P5UA 3BPWA 4PE8A 1XBXA 3BOXA 3VKDA 4HNUA 4X2RA 4KH2A 4GFIA 2Y85A 1EYWA 3GXMA 1BTMA 2X41A 2I57A 3C0JA 2OXNA 5MHBA 1ZRQA 2YXXA 4MIMA 3NZ1A 4UTKA 5CBJA 1HGYA 2VNCA 4E2VA 4PUEA 3FW6A 5LGZA 4JKMA 3BQ5A 1MDLA 1H4PA 3IVUA 2PI6A 5FIPA 2EPKX 3W74A 3PJTA 4L1WA 6ENLA 1V5XA 1OX5A 1A80A 3AS3A 1F8IA 1JZ7A 2W63A 3USZA 2W0UA 2V5JA 3OVPA 2W79A 1XGZA 3POHA 1WXYA 4BI5A 1YW1A 2G96A 4IMCA 3S5NA 5EFFA 3TA6A 3ABZA 3WD0A 4PUUA 1BQGA 4QE5A 4JYDA 3WDJA 4HA3A 3KS6A 3U4AA 1W9UA 3PSVA 4Q4RA 3DKJA 3LV5A 4B5VA 3ABRA 3GDKA 4FO4A 4UXDA 2WNQA 1EQCA 3GNXA 5HULA 2NUYA 3UP8A 3OOQA 1UJPA 2WCSA 3MKCA 1ICQA 5I0DA 1OK4A 3CAQA 4Q7BA 2DP3A 4H6KA 2DZTA 5T91A 2OSWA 4LC6A 3CV6A 3MSRA 4TVDA 5KZ6A 2VZSA 1KQZA 3LN3A 1J0YA 3THDA 2Q3OA 4TV5A 3T08A 4MWAA 4LEFA 3TC3A 1XKYA 3MTWA 1XLKA 5DXXA 2ALRA 2ZDRA 4QCFA 2C0HA 3MDUA 4NZJA 3YPIA 5C9UA 4E4FA 3HO8A 5FJOA 1J0ZA 4O8AA 1AK5A 4TQTA 1REQA 1VP5A 1C90A 4H4IA 3I3BA 1JNEA 3TMQA 1FWGC 1XIGA 4DJFD 3M0LA 4LVFA 4ML4A 2YA2A 4MG4A 3MY9A 4I9AA 3W1UA 3N2CA 5I06A 2VMFA 3EXRA 4E2BA 5FEXA 4G1KA 4C7FA 1KNWA 3VZYA 4LUIA 1UR4A 2PZNA 1X1OA 3BL3A 3L12A 1W3HA 5AC8A 2Q8ZA 1I1XA 2Y7GA 2YL8A 2ZTJA 1IE7C 3S47A 2DSUA 4QG6A 4AHOA 1XLEA 2HQAA 3IV8A 2DH3A 1SZFA 1W9VA 2DGAA 3Q45A 1CXKA 3C2VA 3CIXA 4HTBA 2PGFA 3KRZA 3WUEA 4QS6A 2BDQA 1YDOA 1ONWA 3CPRA 3CH9A 3F4CA 3PTDA 1O5XA 5SWUA 2E5CA 1AVAA 1W31A 4Z2LA 5C0QA 2I5IA 2XH0A 1G0CA 1NWUA 4PRRA 1K7FA 2ISFA 1PKLA 5CLTA 1I4NA 3CZKA 4W9TA 3N34A 3V0UA 2QXWA 3TNBA 1T8QA 4ZO6A 3WX7A 5M3WA 3EBVA 2C14A 2JFEX 5HMSA 3LX9A 5D30A 3R11A 2I5QA 2J78A 2CHOA 3FXGA 3NPWA 2EPHA 1EPVA 1I8JA 2DT3A 4S3AA 1A5NC 3W1AA 3B0YA 2P8CA 3AMCA 5CAKA 3FJLA 4ZOEA 3G3DA 3KL5A 4DJEC 4I8DA 1U1JA 4DI8A 2HCVA 1CXLA 4N6FA 5CPLA 5FJPA 1UHVA 4NUWA 1TPEA 3TYUA 1TPVA 2QCLA 3AYRA 2ZKMX 3C2FA 1XS2A 3GDTA 3KZSA 2OGJA 3RNDA 1VQTA 4PCSA 3WY1A 2WHMA 3LLXA 1G1YA 1GGOA 3D47A 4ZB5A 1JGIA 4GBUA 2ACQA 2D0FA 5DMYA 4ZGYA 1HW6A 4AF0A 1G69A 1X39A 3L2IA 2GDVA 3PZ9A 7A3HA 1KM2A 1R5YA 2CBVA 2VOMA 2VX5A 3LXCA 1PE1A 4S3BA 2ZVIA 4DUVA 4QE4A 1GVIA 4ZQOA 2X16A 1FA2A 3NPXA 3QTGA 1RQHA 4PSPA 3QHOA 1JYNA 1NDZA 5A6JA 3QHMA 4PMOA 3GY1A 3W7KA 3ZR4A 3TZFA 1CIUA 4MKNA 4DZHA 2VZOA 3WF2A 1LL6A 5LNUA 2IXUA 1OD8A 1KXVA 2BOFX 1TV5A 4B3ZA 1ADDA 1L2UA 3E12A 2R14A 5ABHA 4UR7A 1EBGA 3C5QA 4F3HA 1TYGA 1IT7A 2GGEA 3ATYA 3LCFA 4XK2A 3VGDA 4ZB0A 4HSOA 4RDYA 4GUJA 3USBA 2YCJA 1IQ8A 4K39A 1JD7A 4RZ6A 4LSBA 3AYVA 4DELA 4FLSA 2FGLA 5F2MA 4DWSD 1QAPA 1L0PA 3ECQA 1PKMA 2VEMA 3LGEA 5HUOA 4IMEA 5A8PA 2NQJA 3NYZA 3PF3A 2V5CA 4HVXA 1HJXA 3BW4A 5GJMA 4BEUA 4DJEA 4LU0A 3FY1A 1S1RA 3QFWA 5BRBA 1R7OA 1NEYA 3C6CA 3ZLHA 3BQ6A 3PJXA 1B5TA 4GGHA 3E38A 4IUGA 3LNPA 1BHGA 4I7VA 1XYZA 1JZ8A 1KM4A 1VFLA 3ZJ7A 3OVGA 1W5QA 3AMLA 1UA7A 2BS9A 2WKLA 1JULA 3ICJA 4UFMA 4GYKA 3TVAA 3CYVA 4GCAA 3GH7A 2GQ8A 3E5PA 3LNMA 4KS0A 1FUYA 1UD8A 4RPQA 1NP2A 3OVRA 4MNKA 3G0UA 1MW1A 2AGTA 2B7PA 5HOSA 1HKWA 4MNMA 1W1VA 1GG0A 3E0LA 2HSAA 5DO8A 2D73A 1M6JA 3P3BA 1OIFA 5CAHA 3M16A 1JEZA 3M46A 1PCKA 3MBFA 3WSUA 1KKOA 1KD0A 3DG6A 4JZ5A 3M5ZA 4D1IA 5BRPA 2GUBA 1SJBA 1YTKA 2YDSA 4AD4A 2DZXA 3MZ2A 4UR8A 3QQ0A 4NT0A 4P8VA 3CUHA 1XJBA 2W66A 5E1QA 2GGGA 3U5YA 2W4XA 5FAJA 3T4CA 3SZ8A 3QV8A 1JPIA 1AQFA 3AOFA 3MI2A 3PZUA 3UWYA 2V5DA 3A5VA 4MAVA 4JIIX 2VELA 5CEWA 4BS0A 2B31A 1IEIA 4C6LA 4M6UA 3NPUA 1UASA 4C6MA 2ZWZA 2R9RA 4Q8TA 3W72A 1JUBA 2XSBA 1TQJA 3MHFA 2JKEA 1W3IA 3SM0A 5T8GA 4ZO7A 3LI1A 1I2OA 1OZMA 4CNTA 3T44A 3GE7A 3OLGA 1JDDA 1RCXB 3FV9A 1UR2A 2TRSA 1WO2A 4Q4SA 3WQ8A 4X63A 1MEHA 1ADSA 4I7UA 3M47A 4DWDA 5A5WA 2E8ZA 4JTAA 4PTXA 3OODA 3UXLA 2OG9A 1QNOA 1KFBA 3LCIA 4MKVA 4H9MA 4XO7A 3A4JA 1ZCOA 1Q6CA 1OX6A 5C6MA 3B8TA 1ITQA 3PPGA 4HCHA 2W5FA 3SGUA 3NL5A 2FVKA 2OSYA 4BQ2A 3OG3A 2XG9A 3GG8A 3OA3A 3VGGA 3R43A 1UWSA 4ACZA 5FACA 3NL6A 4FZIA 1Y5XA 4GBDA 4NKCA 2GYIA 4W86A 2FZNA 3K2GA 4MPQA 1XH1A 9XIMA 4GKTA 3G1AA 3WDHA 2GPTA 3PUEA 1KXTA 3VDCA 8CGTA 1V0LA 3WFAA 4D6GA 3PTKA 3OBEA 4UZUA 3LHZA 4B15A 3S1WA 1KTBA 2OWXA 2XH4A 1J18A 4H6QA 7CGTA 2AMGA 3P81A 1GPWA 1U5JA 2WMIB 5TIMA 3W7DA 3U8GA 4PTWA 2E77A 3AXXA 3TWAA 4ZA0A 4PMZA 2WBGA 3PNUA 3RITA 5EGRA 1AL8A 4YTSA 1J96A 1L6GA 1EJWC 3MKKA 1R38A 2R1MA 2ZC8A 3DFPA 3F4VA 4HQVA 2JIEA 2VFDA 4JTKA 1DIOA 4C7GA 1X98A 1GUVA 2VJXA 2BX7A 1IEVA 4B5XA 1RJPA 2XVLA 2UY3A 4WSKA 5FJJA 5H8UA 1VIWA 3W1PA 3CZEA 1E6ZA 1WAUA 2J77A 4IPJA 3WQDA 3I7SA 3B8VA 3UWWA 2VO5A 1UKOA 3GSMA 2NT1A 2WLZA 4QQ3A 1OG0A 4AMCA 1D7KA 4R7JA 3AISA 4XAZA 3RLUA 1EJSC 3RPMA 1KO0A 5BROA 1XBYA 3DBNA 4OIFA 3T40A 3BG5A 5DFAA 4IQDA 4FSAA 2PTZA 3BV7A 1MUCA 4G1NA 4HBKA 4MY1A 5GQBA 3WH5A 1FWHC 5TNVA 3P93A 2C91A 5CC6A 1Y8BA 1DXEA 2D0HA 3PPFA 3SFKA 5MKGA 1ISXA 4MYXA 3O6CA 3OYXA 1J0KA 2FTYA 3G1XA 1A4MA 1JDFA 2A3HA 3SN4A 2GQ9A 3XINA 3RM8A 5DXYA 3UZXA 1TWSA 4DPPA 3KVJA 1Z32X 3VDHA 1KXQA 1BYBA 1ZUAX 5LHEA 3KL0A 4R3UA 3J7HA 3GW0A 3M64A 1A0EA 3VNLA 4CQCA 1BYCA 3G24A 3W28A 2Z28A 2R6OA 3K1GA 3KDOA 3WDRA 4B90A 4F4RA 1W37A 2GK1B 5E6ZA 3S8HA 2QPUA 1TX0A 2PA6A 4HMDA 3FSTA 2PLKA 2PU1A 1VCGA 3R8RA 1KFEA 1VIZA 4ATLA 2CLHA 4PZVA 1POJA 4WOQA 3OG2A 2Y1HA 4MMWA 3ARTA 3THAA 2O7SA 3U2ZA 2F84A 3UPWA 2DT2A 2I14A 2PDUA 2Y5SA 3IK2A 3DZ1A 3VMOA 1WCGA 4PMXA 4AXKA 5FEWA 4IPPA 4DQWA 1EC8A 3URBA 3VNIA 1W1ZA 4GJJA 2J74A 4HJFA 1A5LC 2DPEA 1P1MA 3ATZA 2P3EA 3GFZA 4C5YA 1KLZA 2DY3A 5EA9A 4UB9A 1RK6A 2ZUSA 4LUJA 1I2QA 1V3KA 3VXGA 1UD5A 4MZYA 3HG2A 3ABQA 3IS4A 3RCNA 1NWTA 3N12A 5ABTA 1LOQA 2VOTA 4PH6A 4RDVA 5D09A 2DW7A 5D2VA 2Z1VA 4E8DA 4Q8NA 1TPDA 2W3ZA 2D2OA 3ARXA 3BGJA 1O12A 3N04A 3U2EA 3PZTA 2ZRWA 4QJ4B 2JALA 4FK9A 4J35A 4O16A 4YLWA 4FXSA 4CCZA 4CUCA 5BXTA 4BQ4A 1UCWA 4P7OA 1TTJA 3PZMA 1E72M 1VYRA 5JQ9A 4IISA 1WX0A 2GDQA 4C90A 3COTA 4NHVA 4H6EA 1VHCA 3U4FA 2PDKA 4EPBC 3GTNA 5H2ZA 3MUXA 4KCWA 3H53A 3TYBA 4NRRA 5DBTA 1R3SA 3MC5A 5I3GA 1CW2A 2HS8A 3P5YA 2G3MA 2ZUTA 2INFA 3MP3A 7TIMA 5HR6A 1QI0A 4V33A 4KT2A 3GTHA 2CLMA 4DJED 3W3OA 2DQWA 3QQWA 1QK0A 4TV6A 4DZIA 1RA5A 2XN0A 2Z4GA 2D22A 1EZ2A 2INEA 3H4GA 5K4XA 2VC5A 4NAEB 3EPNA 3PHAA 2E8YA 3W22A 2ZX9A 1A5SA 4AWUA 1TJRA 3FHAA 1U83A 4GJ1A 3T42A 1DWIM 3UZZA 2QJNA 4JL1A 2IQ0A 3RX4A 1DWAM 1XBVA 4JY8A 4IFKB 4Z0JA 3W01A 1BTCA 1GVFA 3CC1A 1Q2SA 4MLRA 4TVCA 2QPXA 2O4MA 3AHXA 3WNLA 2I9UA 1HKVA 3KBJA 1DL3A 2PTDA 4AEFA 2AOSA 4A29A 3M5XA 4WKFA 2A79A 1QU4A 5C9WA 4I9JA 3CTTA 4PBFA 1PSCA 5AYXA 3C3NA 4C65A 3NDZA 1HFBA 4XSLA 2QNEA 4O4VA 1VPXA 3ME3A 5A8NA 3VI2A 1SW3A 1YXCA 1FHVA 4PFHA 1DIEA 3TR2A 2CESA 1YMYA 5D2XA 1FWFC 1W17A 1PHQA 5T9BG 3WNPA 3HF3A 1QPKA 4LVDA 1TWIA 2NWSA 1EYEA 2OOFA 4A3QA 6TAAA 2YXGA 3TAOA 3EKLA 4NAFA 1F05A 1K4HA 4IP4A 1US2A 2HMCA 4O18A 1GW1A 3NZQA 2VR2A 1RUSA 1JCNA 4WHBA 4Y9AA 4DN1A 4QEHA 3SO7A 4PMQA 1D2KA 4BI6A 3EWBX 2QMKA 5J5DA 3CHCA 4PB3A 4AY1A 1W8SA 4JL2A 1X7FA 4OOZA 1A5MC 5REQA 2XSAA 1VAHA 1R2TA 5CJNA 1JFHA 3KRUA 4BF9A 5I3HA 1OYAA 3GRIA 5ABFB 4W93A 4UNIA 3MSGA 5I79A 1Q2RA 4KIEA 1GYLA 4NI8A 3FDKA 4WSHA 3CMJA 5BNKA 1FBAA 3ZSSA 1W9PA 4JTLA 1E0WA 4F2BA 2G50A 1CXHA 4GYFA 2O9TA 5I7GA 2YW3A 3NG3A 2WCAA 3WLMA 3AXKA 1E70M 3RCMA 5AKQA 3UY7A 2POZA 2QIIA 4U28A 1QPQA 4IHCA 1POKA 4AX7A 2XYLA 3PZQA 2EG8A 1P5BA 2F8QA 4OJYA 3ABSA 3NQVA 4H9VA 4O0KA 5IRPA 1QR7A 4AY7A 5I03A 1C29A 1HTIA 3AXMA 3QHNA 3W73A 1TCDA 3AJXA 3OGSA 3DGBA 3CUJA 2Y5EA 4O15A 4A8LA 3K5XA 1LP6A 3OZMA 4Z1CA 3CL7A 3LQLA 4JNZA 1VEPA 2CWXA 3RN6A 4WKAA 4Y2WA 3VD9A 3MCNA 1KBIA 2IPWA 4S23A 2PDPA 4AZ5A 4K38A 4L6HA 4NNAA 1EEPA 4A3HA 3AXHA 1HKIA 5LA0A 1XLFA 4MDOA 1KBBA 3W0KA 1PTAA 1UH2A 4Q6XA 1XLJA 4MHBA 2QYGA 3AIRA 3HQNA 4IZGA 4Q8QA 5EPDA 3W1MA 3ITYA 2EKGA 3KS5A 1E4NA 4ZQMA 1UOZA 3EDKA 2TAAA 1I6NA 4JICA 3ZT5A 2OX1A 3WLRA 1YPXA 3WIJA 2FIQA 2HNEA 4QCEA 4HU4A 2X1IA 4U2YA 2OB3A 4M8UA 3SI9A 1KTNA 4WRHA 1UH4A 4U31A 1BF6A 4MUZA 3LTYA 5A3HA 4B5NA 3TE9A 1M9HA 9RUBA 2DUAA 1SO3A 2G3JA 4PUDA 4I5XA 2BVTA 4AZ7A 1WZMA 3VM7A 1ZCCA 2Y5JA 1RJRA 3H7RA 2HJPA 2XIOA 1OT2A 4WGHA 3VD4A 1HIZA 1O94A 1KRMA 1FH8A 2NWRA 4MJMA 2UZ9A 2A7PA 3PULA 4LC8A 1B3YA 3SCVA 3V1HA 3DI0A 3HQ1A 2B7OA 5CJMA 4NX5A 1L6WA 1HF6A 1CT5A 3PSWA 2YW4A 3GNPA 4WKHA 2WWCA 4ZEPA 1MXGA 3L4TA 4NSBA 3S9ZA 3SRFA 4LUTB 1H62A 2C79A 2VGBA 3D46A 5D9OA 3HB9A 1V6UA 3OZPA 4N7QA 2QCDB 2POTA 4JQ2A 3WBYA 1ZLPA 3I6TA 1BWLA 4G9PA 2CW6A 3STGA 4WF7A 4M7SA 2J88A 1R3QA 3MZNA 1XRVA 1TRIA 2O56A 1MNZA 1SR0A 1RXOB 1PPIA 4PB4A 2GVLA 3STEA 1X38A 1FXPA 1FWEC 1XLGA 3WLKX 4AXNA 4HMEA 4E5TA 3IIXA 5AC4A 1RAKA 3PZOA 4WDTA 1F3XA 2DZVA 3G2GA 3JVAA 1NFGA 2XZ9A 2JEPA 4OQVA 1AQHA 2WZEA 2PS2A 4D6HA 3LPFA 1EOKA 1QOPA 2J8TA 6PTDA 2XU2A 4D8ZA 2E25A 3T8LA 3KUMA 2REQB 1E43A 4V1YA 3H6OA 3CUIA 3QKEA 2PC4A 2VCCA 2A3BA 1FCBA 4ENLA 1H7NA 3C56A 3TFCA 2Z2UA 1FFQA 3AS0A 4UTIA 3O6YX 3UFYA 2Y63A 4C6PA 1RBLA 1FP9A 4V28A 4Y9PA 2HRWA 4ZOCA 2BGQA 2YPIA 1GONA 2OQLA 3S1GA 1ISYA 1W9BM 2ZZ2A 4QG9A 1E1FA 3IJ6A 1EJVC 5A69A 2XN1A 3MP4A 3UPMA 3W76A 3S1VA 5JH1A 1OFBA 1IR2A 2J66A 2CC0A 1O95A 1YXDA 3MUIA 1Q13A 3TW7A 4UFKA 4RDWA 4H9TA 1Z48A 1R0MA 4PCTA 1U5HA 4Z1BA 4OV9A 1OADA 2WZHA 3WK3A 4KEMA 2QCHA 4N9DA 2VENA 2FTPA 1GVOA 3VX0A 2PURA 3R58A 3W2MA 3VGEA 4KWOA 3EMQ