1OVDA

The k136e mutant of lactococcus lactis dihydroorotate dehydrogenase a in complex with orotate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
311
structure length
311
Chain Sequence
MLNTTFANAKFANPFMNASGVHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLPRYVDLELGSINSMGLPNLGFDYYLDYVLKNQKENAQEGPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGEPQLAYDFEATEKLLKEVFTFFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLFIDPEAESVVIKPKDGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFDRIIKELEEIMNQKGYQSIADFHGKLKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords DIHYDROOROTATE DEHYDROGENASE A
publication title Lactococcus lactis dihydroorotate dehydrogenase A mutants reveal important facets of the enzymatic function.
pubmed doi rcsb
source organism Lactococcus lactis
total genus 115
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2003-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 1ovdA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1ovdA01
2WSRA 2HSAA 4O19A 4O1AA 1K7EA 1PVNA 2YPIA 1XBVA 3BLFA 1RD5A 3W84A 2Z6JA 1OYBA 3S1UA 3NQVA 2BXVA 1GWJA 2HTMA 1L6YA 2ISWA 1QR7A 3S42A 4HN4A 1GVSA 3MI3A 1T96A 2B4GA 5D2VA 5GVJA 5LNUA 2CZDA 3L5LA 3MP4A 3W86A 2BTMA 4LNYA 4O4VA 2A5HA 3H55A 5I3GA 5FESA 1H51A 2GQ9A 5CPMA 2V30A 4AAJA 4DF2A 1W5MA 4GBUA 1LP6A 3W7RA 4UTHA 3L0GA 4O12A 3LBCA 4JNMA 1FWWA 3P7YA 2WNNA 3WJYA 3STGA 5CZSA 3CEUA 4N9CA 3A21A 2Z1BA 6ALDA 3W7DA 1JCYA 1WOAA 3INPA 2EKCA 4UTIA 3MP3A 3QC3A 4AEOA 4RZ4A 1FUYA 2A6NA 1ZENA 4BI7A 4NJJA 4JTGA 1GG0A 5K9DA 3S9YA 3CT7A 5AHFA 1GVFA 3N2XA 4MKNA 2Y7EA 3QMSA 3P74A 1HL2A 5C5YA 1N55A 3NDOA 3EB2A 4O0KA 3OHIA 1TRDA 4UNLA 3O6DA 3NZRA 2WOQA 4EF9A 3EKLA 3FOKA 2TMDA 3QJAA 3MI2A 4JX4A 3LHTA 4FO4A 5AFDA 1JVNA 2HMCA 5EL1A 3W70A 1QO5A 1OK4A 2I14A 1GYLA 3MO7A 4IMFA 5TIMA 3NL5A 5MHBA 2VEMA 1L2UA 3W87A 2DZSA 1ML1A 2ZA1A 3IRDA 4UTTC 2V82A 1X6UA 4GUHA 4HPJA 3EXTA 4QNWA 1FWNA 3G1AA 1ZY9A 1R2RA 1WX0A 3W7JA 1VJIA 1L6SA 4KFPA 3BW4A 4WY0A 3UZ5A 2E5BA 1A5BA 3IGUA 3IVTA 3KRSA 4UNKA 1PIIA 3UPWA 5LZLA 3NQFA 3IGSA 3A22A 3LTPA 4N4QA 5D04C 2GJLA 1X7FA 1Q6RA 1FCUA 2NLIA 3LCLA 4RK8A 1KBIA 5HQEA 1NVMA 2QCLA 4CQ9A 3BG5A 1QPNA 2VFEA 1KTBA 3I65A 1X8FA 4X2RA 3A5FA 3ELFA 5DLCA 3HO8A 3P5ZA 3LLDA 3JRKA 4LVDA 3TSBA 3HPXA 5FEZA 1FCBA 5K9CA 1ICQA 2NXIA 3W2LA 2DZVA 4MVAA 3PVFA 5SWUA 1EPXA 2Y6ZA 5LNVA 3MYOA 5DBTA 1WQ5A 3W74A 4NNAA 5CSSA 1GOXA 3R12A 2A2IA 2V2HA 3O8AA 1WAUA 5KITA 3NQ8A 4IMGA 1YTEA 4E38A 2GVGA 4WD0A 2DZUA 4NU7A 4JTEA 3RFAA 5J5DA 3NM3A 4FNRA 1W31A 4JICA 2B7PA 4JDYA 1DV7A 3F4WA 4C1KA 3UWYA 1RR2A 1S3HA 2E6FA 3NGJA 3HGOA 3E12A 1GEQA 3I7SA 4IOTA 4FNQA 3THAA 4NJKA 4O0ZA 2ISSA 5AHMA 5LGZA 3UWWA 4RXFA 4KWWA 5CKSA 4JEQA 3MHGA 2A85A 4JTLA 3KVKA 4UMBA 3NYZA 2J9XA 1AG1O 1R46A 3GNNA 1TJPA 2ZZ5A 4NNCA 1VRDA 4ZQOA 4WX2A 3W7CA 3MMTA 5AC6A 3MUXA 2VC6A 4IXHA 4AB4A 3W2MA 5AHIA 2Y70A 2H8ZA 3A9IA 3QQ1A 5DELA 3W7OA 3IGXA 3ABQA 3STFA 3NQGA 2QCHA 1LRQA 4WOZA 5U7SA 4QAIA 3JR2A 3B4UA 4HT3A 3MWAA 1PS9A 2C15A 1FX6A 4OU1A 3CU2A 1H7PA 3QSTA 4XUGA 1YDVA 3WJSA 1OX4B 2H3BA 3TC6A 2E5CA 3W7GA 2VEKA 1VCGA 1BTMA 3UXDA 1SQ7A 3CWNA 3L67A 4ZVJA 3OG3A 3SGZA 4UC5A 2QUTA 3QF0A 3TR2A 1OFBA 4AMAA 4JTIA 4CQAA 3ABOA 2GPTA 2A0NA 3W2KA 4KKXA 1OFEA 3M9YA 8TIMA 2X1TA 1G4SA 1P0KA 1HG3A 4CCCA 1QCWA 4MLJA 2QF7A 4A29A 4NX0A 1G67A 1ADOA 3M5VA 4IUOA 1I2PA 1DHPA 5D33A 1HTIA 1R2SA 4TR9A 5DY2A 3USBA 4IMCA 3PB2A 4MJMA 1F73A 1XM3A 4WQ6A 2G96A 4YCPA 1BEUA 3TJLA 3G0SA 4X22A 3L9CA 2A6LA 3V75A 3C56A 3TW7A 1R30A 3G1SA 3PUDA 3GDLA 3I6RA 1B57A 2A7PA 1VHNA 3RK8A 3E02A 4QISA 3C2VA 3ZWTA 2Z2UA 4NJIA 2P1FA 2QCEA 3W6YA 2UV8G 3PY2A 2CWNA 2JGYA 1LCOA 2QR6A 4RXGA 4YCOA 2Y62A 2TPSA 3RU6A 3W83A 4LWWA 1AL7A 4DBDA 3UWZA 3Q37A 5CG7A 6TIMA 2A1YA 3MHFA 3FKKA 1EP1A 1ICSA 3S5OA 1WV2A 4NVTA 1XBZA 2Y7DA 3S5YA 3W1QA 5DXYA 1DVJA 1RZMA 3GVGA 1TREA 1GPWA 3P60A 5EYWA 5HUPA 3E96A 1SO4A 1RV8A 1TPC1 2YR1A 1O60A 2WKJA 4MJZA 1KM6A 1TV7A 4IXXA 1LBFA 3HGSA 3WFAA 5KMYA 3S0CA 4KFNA 3QM3A 4GXMA 5G2HA 2V2CA 2P10A 1IXOA 1ZALA 3BPWA 3P5YA 1R47A 1ME7A 4HKPA 2QCDA 4ORMA 1I4NA 1VH7A 4Z0JA 3HOJA 5EA9A 1CX9A 1Q6LA 3BV4A 3SZ8A 1R2TA 1K7XA 3IIXA 1VLWA 2Y7GA 3HGJA 1JJKA 2B7QA 1D3HA 5ABTA 3NQMA 1F76A 3W2NA 1NFBA 5D38A 3LRLA 3SECA 2BWGA 4LC8A 5CGQA 3GX9A 5I3JA 3TFCA 1YPFA 5CZJA 4ZL1A 3HG4A 1XDLA 2YFOA 4Q33A 3WJXA 3QYQA 4KFOA 1LLWA 1EP3A 4UTLA 1JULA 3G3DA 3QSRA 2FJKA 5DCDA 2BLEA 1XUUA 4RV8A 5BW6A 5HWNA 4A2RA 1B4EA 3I7RA 1IXQA 4NZJA 3DAQA 1H63A 1XI3A 3G22A 4OBTA 1UBSA 3N73A 3DGRA 4UMCA 4UTMA 1P0NA 1W3IA 4LS1A 4RLIA 4OQVA 5HR6A 4R7JA 5AHEA 1ME9A 1KFKA 1G7VA 1WXJA 5HWMA 3LX9A 1OFRA 3ZR4A 3L68A 3KRUA 3EEGA 4R33A 5F1VA 3A24A 3M0ZA 3OEXA 2W6RA 5AB3A 5I3HA 2FPVA 4PTNA 4AF0A 3PBVA 1EX5A 3B06A 3UPBA 1XCFA 1IIGA 3ZFHA 3N34A 1OHLA 4AWSA 1Q3NA 4LVFA 1NSJA 2DZXA 3O05A 2AAMA 2FDSA 1LOQA 4JTTA 1Q6QA 3OVPA 1IGSA 3KVLA 1GJPA 4A22A 5LSMA 3N19B 2I1OA 4O10A 3K30A 1Q6OA 3TJXA 2V2DA 4AWUA 4K7YA 1I8JA 3DFQA 5EPDA 2QAPA 3DFTA 4O14A 2BZNA 4AH7A 3CQ0A 5G5IA 1SSGA 3E9AA 3PG8A 3M5YA 2VEIA 4JDBA 2DZPA 2E77A 1TMHA 4EVZA 4O57A 4E0CA 2ABBA 5HJLA 4JR5A 3STEA 1GG1A 3I7QA 4WY0B 2PRHA 4N02A 4D2JA 5L6UA 3AJXA 3WK2A 1I2NA 3LCIA 1I2RA 3MBFA 2E09A 4GJ1A 4CLMA 1NAL1 1LZOA 1T8XA 4O11A 5CZTA 4TO8A 2H90A 1UJPA 1TPEA 4K36A 2YSWA 1RQBA 3TE9A 3KVJA 3VI2A 5F4SA 1GZGA 4ZQPA 2CLMA 3LCWA 2FPTA 4L4LA 3AO0A 3C3NA 2TSYA 3ABRA 4IPJA 4JYEA 3NM1A 1EUAA 3W73A 1LBMA 2X1SA 4NJHA 5LNSA 1VCVA 1EWEA 3LHZA 3W1XA 3WJZA 4UFMA 5C54A 3S5NA 3B0VC 3IVUA 3VE9A 3SSJA 4LC6A 3SFKA 3LI1A 1EWDA 3W1LA 2ZZ2A 5CZ0A 5F2LA 1VCFA 4NT0A 3CLMA 1YXYA 2E6AA 3C61A 2OZ0A 1DBTA 2ZZ1A 3C0JA 2JKAA 3LTYA 3TX9A 5HUOA 1W1ZA 2FIQA 3P67A 2B0MA 4I7WA 2WSQA 5LHFA 1P5BA 2CFFA 3PS7A 4ML9A 3TFXA 1YTKA 4PA8A 2BSLA 4MY8A 3FJ6A 3YPIA 1TPUA 1G7UA 1OK6A 3S1WA 3LTSA 3QZEA 3B03A 2WO5A 5L9FA 3NOEA 2A7RA 1X1OA 3DHDA 4I9AA 2PE4A 3CHVA 2OX1A 4R34A 5CPLA 3HJZA 3TSDA 3NL3A 3NO5A 3FYPA 4X3ZA 4JTUA 4O1CA 1DL3A 3N9RA 2VKZG 3EX3A 4AVFA 3S1XA 2R8WA 3L65A 4OT7A 1XC4A 2VFHA 3LHUA 3NAVA 5HWJA 3G1VA 2OCZA 3PBYA 4NNBA 4JGDA 4E2BA 3OIXA 4NQ1A 2PC4A 2JK2A 4N9BA 4M19A 4N6EA 1XXXA 1VQTA 4P61A 3GXNA 2BX7A 3W1PA 2F7FA 3S1VA 4PFMA 5TQLA 3GKAA 2QEZA 3B8DA 1QWGA 2W0UA 1VC4A 1K02A 2GUUA 2VEPA 5C55A 3RLVA 3MJYA 1JCXA 4S2CA 4LV4A 1HO1A 2QJHA 4H3DA 2DJXA 3QPZA 3TSMA 1ME8A 3W7EA 2EPHA 1QDSA 3MBDA 3OVQA 5D2XA 5E0KA 3UD6A 4R53A 4Z1CA 1FQ0A 4Q4KA 3DXIA 2ZQ0A 3M6YA 3BW2A 3O16A 2ABAA 3SY5A 1S5WA 1QMLA 4LT9A 1F5ZA 1KW1A 1OX5A 2PCQA 1AK5A 4MUZA 5A5WA 5AC8A 3EX4A 1KM4A 4BI6A 2DZTA 4ICNA 3NPUA 4EOUA 2ZTKA 4JS3A 5DBUA 5G2WA 1K8YA 3QPYA 1I2OA 3NQAA 3SI9A 4HHPA 3CC1A 3U8GA 4BWLC 3GR7A 4IMEA 4MOZA 3GZ3A 1SU5A 1TPH1 3BG9A 2ZBTA 4DBEA 2O7QA 4O4WA 5F2MA 4AXKA 1AW2A 3QMRA 3CWOX 4O18A 2EF9A 4DPQA 4IQLA 1M7PA 3FFSA 1J4EA 3EX2A 3O06A 2PRMA 4LU0A 3TKFA 1OF6A 2J24A 3HGRA 4RCXA 2CU0A 3DFOA 3LCHA 1I2QA 2FPYA 3HQ1A 3LCGA 1YXDA 2Q8ZA 3KX6A 1O5KA 3L5MA 4B5NA 1M7OA 3F03K 1EA0A 3P62A 4RR4A 3E0IA 3GAYA 3VFLA 2PRLA 3LXAA 4CQ8A 2D73A 3DU0A 4ZQNA 5CPOA 3W1RA 1UASA 2QAFA 5K7JA 5K9XA 5FF0A 1SR9A 2QCNA 4FX8A 2Y88A 4XQ6A 3DENA 3DKLA 4ONVA 2NXGA 1GT8A 1F6PA 1RVGA 4UCGA 2C18A 5HINA 4DEFA 3HG2A 3W22A 1DKWA 2QCDB 1ZJIA 3UNDA 5H91A 2Y61A 1GVQA 3SJ3A 1QOQA 1JCLA 2B7OA 2CW6A 3OBKA 4M6QA 4FNTA 1P1XA 1H50A 2ZZ4A 1BWLA 3Q2DA 1GVRA 1XL9A 2OJPA 2RDUA 3BG3A 5BRBA 1H62A 2RDWA 5LKYA 4QNEA 1TPFA 3P61A 4HPXA 5D09A 4PODA 3TDFA 4NXSA 2XN2A 5FF4A 4HNTA 3NPXA 4QJ1A 3GDTA 2QUVA 2R91A 5D2TA 5D30A 3W7IA 5HNRA 2WJZA 4M5PA 2JKPA 3BLIA 1WBJA 2EGZA 5K4XA 4UMAA 3CIWA 4WXYA 1YYAA 4HNVA 4JN6A 4LS2A 5F2IA 5K2ZA 4BWLA 2A4AA 3PSWA 5AC7A 1F7BA 1EIXA 4O17A 2ISVA 2X16A 1W3TA 3NG3A 5AN7A 1SZEA 3NA8A 3NR0A 1H7WA 1KM2A 1SFJA 1SSDA 4UTKA 1ZAHA 3W2UA 3GB6A 3PBWA 4H6KA 2DP3A 1H61A 2QDGA 3W23A 2DU2A 3L5AA 4XZ9A 3KXQA 4A2SA 3MHUA 2WNZA 3H54A 1F6KA 2X1RA 5AYZA 1TQXA 1TV8A 1EEPA 1WDWA 1JRCA 4AF0B 3G24A 2TYSA 4LVGA 4Z1AA 2C1HA 4NXKA 4OV4A 1KFJA 3PAJA 5DY3A 3VCRA 3M16A 3M41A 1A5CA 2ZTJA 4NJGA 2C13A 1VGAA 1JQXA 3UYCA 2E1DA 3GYEA 4MZ8A 1TQJA 4UXDA 3O63A 1OF8A 4DF1A 1IF2A 3NXFA 4XTDA 1G4TA 4GUIA 3TMLA 3G1HA 4UUIA 2P0OA 2CLLA 1DQXA 3DHFA 3HG3A 1K03A 3T4CA 3NL6A 3GXTA 5LGXA 7TIMA 5AOUA 1M5WA 3W1NA 5EBUA 1W5NA 3U6WA 4E2DA 1IXPA 2C14A 4JXCA 1VLIA 3LI0A 3HF3A 3C2OA 4BI5A 1H7RA 2GJNA 5HULA 2CLKA 1FXQA 5HR7A 1KM0A 3LB0A 4FX7A 4PL1A 4DQWA 1QO2A 3TK7A 3A23A 1Z44A 4G1KA 1FCQA 2HS8A 5BMWA 4GRSA 3TROA 1NEYA 3G0XA 1OFAA 1KM1A 2C3ZA 4JYDA 1DOSA 1OABA 3C8FA 5KZDA 1HUVA 3LRKA 3QW4B 3DI1A 4LRSA 4N6FA 1VZWA 3C4UA 4P2VA 3FIGA 3NZ1A 1NF7A 1YDOA 3TQKA 4X9SA 3PBUA 2E6YA 1H60A 1WOBA 1I45A 1MEWA 2WNQA 4ZQRA 2FFCA 2WSYA 2ALDA 3GR8A 3MW7A 2DJLA 1YDNA 5LNRA 3KOFA 4CNNA 1SW0A 4Y9AA 5DXXA 4FEZA 2WQPA 4RZ6A 4H4IA 3WK3A 3V1PA 1SZNA 4EF8A 2VXNA 4GUJA 1MO0A 4UTWA 3GIYA 3W75A 4KWVA 3LHVA 4YWIA 1TPDA 3WK1A 2B7NA 4O16A 3W7NA 1C29A 3TAKA 3MP5A 1W5OA 4YMZA 3DH7A 1TIMA 2Q8LA 2XN0A 3W1UA 1GQNA 2E68A 3N2MA 1IIHA 3PUEA 1FDJA 3NL2A 3LCFA 3EWXA 2R94A 3G1YA 1OFPA 4ZZ9A 1XBXA 1X1ZA 1JUEA 3M44A 1W56A 2KZHA 4GUGA 1A5SA 3UXAA 3ZWSA 1FCVA 5HMSA 3TV8A 5KINA 4BR1A 1FBAA 4XTIA 1OG0A 3HBLA 1MEIA 3NVTA 3T40A 2G97A 3LLFA 1OYAA 2NUXA 5AHLA 1O95A 3C2EA 5AHNA 3G8RA 2WV8A 2QKFA 1UB3A 2JGQA 3B05A 1Z42A 1ZFJA 4UTJA 1TJRA 3BO9A 5FF2A 5D2WA 3NPVA 3PUOA 4WY0F 2Z0IA 1QAPA 3IIPA 3TAOA 1PE1A 4ADSA 1SO5A 1QFEA 4AHPA 1LRNA 4JTHA 1W54A 4Y8FA 1JCJA 2ZZ7A 1V7YA 3P80A 2E6DA 3CEPA 4DF0A 2YYTA 3G0UA 4FX6M 1XBYA 1XKYA 3JS3A 4LW7A 4MYXA 4PC8A 4MLRA 3ATZA 3TIMA 1XUZA 4XKYA 3TC7A 1TV5A 4LOCA 3BVJA 4GFSA 1L6WA 1B9BA 3TNOA 1SO6A 1TSIA 5F1UA 4RJEA 3P84A 1QPQA 2ZCGA 4PCFA 3RMJA 2NZLA 3L0NA 2YFNA 3GKFA 5KTLA 3KRZA 4OWGA 4WUIA 2CLIA 4K8EA 3HG5A 2C6QA 1KFBA 4JD4A 1F74A 5U4NA 3T55A 1UUMA 3OVRA 4MFDA 2X1UA 3RF9A 2OT1A 3TUUA 4FXRA 5G4WA 1AMKA 1EP2A 3W1AA 4Z0SA 1O94A 3IVSA 2Z6IA 3PC0A 1C8VA 4DELA 2YGYA 4NUWA 5FF3A 4O53A 2EAWA 3PWAA 4MY1A 3B0PA 5F4WA 3PG9A 3W1TA 2AQWA 2FTPA 4C1LA 1HO4A 3TW6A 5IBXC 2YDAA 1FDZA 4OE7A 1EB3A 4K8HA 3DZ1A 5I3FA 4K6AA 3C2RA 3UWVA 4MZ1A 4YL2A 3W3OA 3W7HA 3TQVA 1VYPX 4ADTA 1VPXA 5CPNA 4AHQA 3FEMA 3UWQA 4M6PA 5I3IA 4M6VA 3QQ0A 2ZZ3A 1TPB1 5FEPA 3VE7A 1QOPA 3GK0A 4BFAA 2NV2A 2NX3A 1ZAJA 4PH6A 2J6XA 2H3DA 1LOSA 3QEZA 5G4EA 3ABSA 1QPRA 1LROA 3F1QA 4CCDA 3PM6A 3IV3A 3H53A 1NF0A 4XWUA 2R14A 2J9ZA 2VENA 3LERA 5KZEA 1PCWA 2PURA 2ZZ6A 2E5DA 1GVOA 4AHOA 3QFEA 3UY8A 4AWTA 3EWWA 5E1QA 4XBKA 1IXNA 3PR2A 4HNNA 4GC4A 4UFLA 1FXPA 5EY5A 2J27A 2GVJA 3FLUA 4S1FA 1Z48A 3T78A 4LY8A 3LXCA 4FIQA 3O15A 3CPRA 2ATSA 1VS1A 3DBPA 1KM5A 1SUXA 2V5LA 3Q94A 1H5YA 4IGHA 5G1YA 2V0TA 4M7SA 1LOLA 4NZFA 5LHEA 1JRBA 2FLIA 1S5VA 4FHAA 2VFGA 2FQIA 2Y63A 1G6CA 3FS2A 1J5TA 2VFIA 1T99A 1B4KA 3NQCA 1TTJA 2J9YA 5D03A 5FI8A 1KTCA 3KHJA 1UCWA 2Y7FA 1JQVA 4MFEA 2NUWA 1TO3A 3MI6A 3KFTA 3RNDA 4HIBA 3D0CA 4OV9A 2C0AA 2F84A 1B3OA 3TCEA 2NV1A 3P8IA 1LLZA 3W72A 3KVMA 1K8XA 4HSNA 4S2BA 1LDCA 4O50A 4LS0A 3EXRA 3O6YX 5TBOA 1KV5A 3E49A 3S5ZA 1H7XA 5IBXA 4JY9A 2ZFAA 3DFSA 3NQEA 3P81A 4MIMA 2IQTA 1TYGA 3U2OA 1OFQA 1W0MA 1LRTA 1MZHA 2H6RA 2GOUA 3W9ZA 1T0OA 1W3NA 4JTFA 5BMXA 4Q32A 3LXBA 1JUKA 3QW3A 4UFIA 1ZCOA 1A50A 3IEBA 1CW2A 3CTLA 4JYFA 1Q45A 4JX6A 3L2IA 1KLYA 3IIVA 3BK0A 1LYXA 3NPWA 3FJLA 3DI0A 4MYAA 1OVDA 3LV6A 3QH2A 3BARA 1GTHA 3TQ0A 3LRMA 4Y96A 4O52A 4EWND 2Q3OA 1WBHA 1O4UA 3EWYA 1F2JA 4Z1BA 4ORIA 2V8ZA 3LOTA 3I68A 2RH9A 2ZRXA 3QRHA 4NX5A 3TXVA 1H1ZA 2V9DA 2XN1A 2C16A 4UTUA 2YXGA 3MYPA 2OMAA 3BW3A 3LHYA 4N2YA 4O8RA 1D9EA 2QJGA 3EWBX 4TMBA 1TTIA 2A7NA 2O7SA 3CM4A 1W5PA 1DQWA 5H2ZA 1WA3A 3GLCA 3C52A 3TMQA 1SZGA 4PEKA 1TPWA 2CLFA 4FIRA 1A5AA 2OT0A 1OJXA 1HFBA 5BOOA 3CIXA 3BGJA 2VOMA 1LM1A 1UUOA 4FXSA 1DJNA 4GWEA 4BF9A 4IPIA 3G1DA 3LGEA 3NQDA 3GAKA 3M43A 4GUFA 3SIZA 1P4CA 4OGZA 3N3MA 1PL9A 4K39A 5I3KA 3FA5A 1SW7A 4K7VA 3M47A 3T7VA 4DO6A 5D32A 1VR6A 1KA9F 4JY8A 2C19A 5K3VA 2FB3A 4O28A 1G4PA 3B04A 4UTTA 5G1TA 1LTDA 2DORA 2NX9A 5DCBA 1KV8A 3W1MA 4UFJA 4ZMGA 3W76A 4DXVA 4MZYA 2ZRVA 4DO5A 3IIZA 2QJIA 1U83A 2V5BA 4L4MA 2X2GA 4LVBA 4MPQA 3FKRA 2EHHA 2VELA 1K8ZA 4HSOA 1C9DA 3R5EA 1TCDA 3LCXA 4JTSA 5G2IA 4BK9A 4IMDA 3W71A 1BKSA 1M6JA 4RZ5A 3CB8A 1YLVA 3R13A 4IX2A 1ONRA 1GTEA 3TA6A 4CNOA 3HIJA 3L0KA 1TRIA 2ZRUA 3EXSA 3G3MA 3F4NA 1PV8A 5A8GA 3O6CA 3VNDA 3PF3A 5D02A 5EKYA 2FB2A 4JTKA 2Y85A 3VKJA 1ZAIA 4LVAA 3LDVA 1G4EA 5LNWA 4UFKA 3O1NA 3IIOA 3L66A 4N9DA 4ZQCA 5DCEA 2G95A 4POCA 5E93A 3LV5A 1L9WA 2QDHA 2DZWA 4UTWC 1JR1A 3EX6A 1RPXA 1RQEA 2V81A 3RLUA 1LORA 5C2XA 4FNPA 3R8RA 1YTDA 3T44A 1KFCA 4I7UA 1KFEA 4TU1A 2RFGA 2ZRZA 5K4ZA 4YXGA 3QMTA 3M5ZA 3PSVA 3W07A 3TU9A 3W7PA 3GXPA 3W88A 3FYOA 2WPBA 3THQA 2CLHA 3NNTA 2QCGA 2XFWA 3C6CA 2RKXA 1AW5A 4WJEA 2YZRA 1FWRA 5D05A 3Q58A 5F4XA 3ATYA 1H7NA 4TMCA 3G18A 4GNJA 2YW3A 2CZFA 1K3UA 4IJBA 3UQNA 3GDMA 3LHWA 1QPOA 5J5RA 1VHCA 3EX1A 2W79A 1MSSA 3W7LA 2NXHA 2NWSA 4TX9A 3WK0A 3R89A 1S5TA 1FWSA 2NUYA 2QCFA 2I9EA 4IX0A 4GE8A 4IWWA 1KBJA 3P8JA 3UZJA 5DN1A 3LM7A 4Z08A 1OYCA 3DFPA 2GQ8A 2YCEA 3NEVA 3N14A 4XKYB 1ICPA 4QIUA 2NX1A 4CNPA 1BWKA 1FY6A 1GYNA 3M7WA 2YW4A 2ZA3A 5D37A 2CZ5A 1N8FA 2VFFA 3ANYA 3HPSA 1JUBA 4XBSA 5AYXA 1W8SA 1CI1A 3DFNA 4K37A 4N9EA 5IM51 4JIQA 4CCEA 1U5JA 4QM1A 4ADUA 3NQ6A 5EMUA 4YLWA 4ZQMA 3NQ2A 4K38A 3P82A 1AW1A 1MXSA 2CZEA 4JTJA 1PHQA 4O1DA 4ALDA 1VYRA 1OX4A 3GDRA 5KSWA 3TXZA 3PB0A 5AYYA 4FNUA 4JIPA 1W37A 4U28A 4TIMA 4Z1DA 2RDTA 3S8HA 4QSHA 5FEWA 3SGUA 1O5XA 3SW6A 5F2GA 2JBMA 1AL8A 3HPZA 2LLEA 2QCMA 4Y90A 3EWZA 1ZHAA 4UR7A 2ZDRA 4FB7A 1OFOA 4U4MA 2ATMA 3ZS4A 3L21A 5T26A 4LUIA 3W2JA 1KTNA 3G8EA 1FWTA 2QCCA 4QQ3A 4W9TA 1G69A 2Y89A 4WOQA 2JKEA 3W85A 4HNUA 2ZYFA 1JCNA 1VYSX 1H1YA 3S6DA 3W7KA 5FEXA 4RKAA 4I7VA 4Y6GA 3LBMA 1XDMA 2TRSA 1KFLA 4WXZA 1QNVA 1TTPA 1SZFA 4FF7A 4LV9A 2NWRA 1YXCA 3UY7A 4LUJA 4JX5A 1MEHA 1KM3A 1K7FA 1J2WA 2YX0A 3GDKA 4EIVA 1RQHA 4PL2A 4WZHA 1E51A 1JCMP 1F05A 3G1XA 3WJWA 5FF7A 3KAOA 1XFBA 2H8XA 1SW3A 1SO3A 1TTQA 1PHWA 4FNSA 3BLEA 4A21A 3B0UX 1H7OA 2CLEA 2RHGA 2CLOA 4RX0A 5KZMA 5C6MA 1SPQA 2QUUA 1KLZA 3NQ7A 4O1BA 2YYUA 4O54A 1V5XA 3O07A 2HS6A 3W7QA 1THFD 3GNDA 3M5XA 1TB3A 3EKZA 1Z41A 1LBLA 3HB9A 3R2GA 3UWUA 2AGKA 4N4PA 3HMJG 2A21A 4DPPA 2VFDA 4QITA 2GVLA 2ZA2A 4O15A 1ALDA 3SR7A 1FDYA 1Y0EA 4O13A 4M7TA 1SFLA 1WYIA 4UR8A 2ZRYA 5CSRA 3TH6A 4J9JA 3N9SA 1N7KA 5D2YA 3G1FA 3STCA 1W5QA 1PCKA 4A3UA 3A5VA 3C2FA 3OA3A 1OFDA 2G5WA 1EUNA 4LTSA 2GQAA 4UIOA 1TPVA 1D3GA 1DORA 2X30A 1DJQA 4MY9A 4DO4A 1OX6A 2ZRWA 3EWUA 4OHQA 4LRTA 2J88A 1YPIA 3PULA 3M1ZA 4UFHA 1A53A 3BGGA 2Q3RA 3W7MA 3DKJA 1ZNNA 1YADA 5BNKA
chains in the Genus database with same CATH superfamily
1EC9A 2XZ9A 1LL4A 3A4JA 1PVNA 2YPIA 4U5IA 4N0RA 4KPLA 1W2VA 3S1UA 2WWDA 1WKDA 2XIOA 4MADA 2HDJA 1CGUA 3MWCA 1UMLA 2F6UA 4HN4A 5FD0A 2WSPA 1OWQA 1GVSA 1T96A 4ZE4A 1RJPA 3K2GA 3MP4A 1ODUA 5HXMA 2BTMA 3BJSA 3GWQA 1GW1A 3P0XA 5I3GA 2CBIA 2CNCA 1ZZMA 2V30A 4AAJA 1W5MA 2YCLB 2OO6A 4S3GA 1LP6A 2WMHA 3W7RA 3WH5A 4O12A 3LBCA 4D1JA 3HMCA 1UD4A 3WJYA 2WZIA 5CZSA 3CEUA 4N9CA 2Z1BA 1XIBA 1XLEA 6ALDA 1LT7A 3UA4A 3BAYA 3IWPA 3O7UA 3INPA 3N11A 1A5LC 4AEOA 2FZ8A 3F4CA 1ZENA 4BI7A 3UR5A 3LK6A 1C91A 1GG0A 2BB0A 3CMGA 2OSYA 3R79A 5AHFA 4NILA 4DM1A 2Y7EA 2J75A 1P6WA 1GCYA 3WL0A 3P74A 1HL2A 1ONWA 3VGEA 1K9EA 1N55A 5DEZA 2Z28A 3OHIA 1TRDA 2Z29A 3FOKA 3QJAA 5IXEA 5AFDA 1JVNA 2HMCA 5EL1A 1QO5A 1OK4A 3MO7A 1AQFA 4X61A 5TIMA 3LY0A 2O9RA 1L2UA 2WJEA 1C8QA 3TN6A 4GUHA 3EXTA 1I6NA 3UXLA 1XPYA 1VJIA 4F0RA 1L6SA 3WQEA 2PPGA 3RPTA 3BW4A 4WY0A 5T8GA 3UZ5A 4K8GA 3GNOA 3OB8A 5LZLA 1D8CA 3LTPA 4N4QA 3TYEA 3BAKA 4BHYA 2XYLA 3LCLA 1DJYA 1TWIA 2DQXA 1NVMA 1W9UA 4CQ9A 1QPNA 1HL8A 3CO8A 4X2RA 3O0FA 2P3ZA 2VUYA 1XIEA 4IIEA 5FEZA 4R9OA 5K9CA 1ICQA 2NXIA 1UZ4A 4AD2A 3RX4A 1GONA 5SWUA 2YBVA 2PDJA 1WQ5A 3W74A 3GE7A 1TX2A 1KXHA 4JFVA 5CSSA 2PZNA 3R12A 2A2IA 2D2HA 5A6SA 3ZLGA 4PUNA 1YTEA 4XIMA 4XAGA 1KRBC 2DZUA 1XG4A 1WDQA 3RFAA 4WDUA 1W31A 1EJWC 1PTAA 2KX9A 2E6FA 2VX4A 3NGJA 1KQYA 4FNQA 2OXNA 3N4AA 3THAA 4HU3A 1W1YA 2W3ZA 3UWWA 5G1MA 5C9UA 5CKSA 3KZSA 3MHGA 4FP1A 1PIGA 4UMBA 2D24A 1XLCA 2ZZ5A 1UD3A 3ZT7A 3CZGA 1JGIA 1BF6A 4KT2A 1EKOA 3MMTA 2J4GA 5DELA 4GH1A 3OZYA 4LCQA 3ABQA 4R88A 1ITQA 1LRQA 4BF7A 1V8EA 4DWSB 5EMYA 3POCA 1PS9A 3QGVA 3SRKA 3BICA 1OX4B 1LF1A 3TC6A 5A2AA 3IRSA 5IFPA 3CWNA 3L67A 3AS1A 3SGZA 1ZGDA 4DWSC 1MDRA 3M0JA 3QF0A 3AWOA 3A3HA 3IUHA 5BXSA 3W2KA 1OFEA 3M9YA 1G4SA 1P0KA 2V5JA 4A29A 1Q7ZA 3BLLA 6REQA 2AL2B 1G67A 1ADOA 1NWUA 4JKKA 4WJ8A 3WMBA 2GGHA 4MB1A 4CQCA 1HTIA 2XINA 2XVNA 5DY2A 4PMJA 3PB2A 4WQ6A 1BEUA 3UZXA 2D20A 1E4MM 3L9CA 1E6NA 1JD9A 4GLEA 3VDBA 2J25A 3PUDA 3I6RA 2CXEA 4B5SA 1HP5A 2A7PA 1VHNA 1XX1A 1H4PA 4FLRA 3QKEA 3ZWTA 2Z2UA 1HZYA 5JBDA 4EPDC 3W6YA 2CWNA 2NQLA 1OADA 1DYSA 2JGYA 3CHDA 3MCOA 1LCOA 2QR6A 2Y62A 1A4LA 4PR4A 1AA1B 3W25A 4JNZA 2WJDA 1AL7A 2WKGA 2VMFA 4DBDA 3QHMA 3EOUA 6TIMA 4CNUA 3QXBA 1ICSA 3D5HA 4LB3A 1H41A 4NVTA 1UOZA 2J66A 1XBZA 2CKSA 3EMZA 3ENLA 3AXMA 1NQKA 5AKQA 1DVJA 1NY1A 6XIMA 3GVGA 1GPWA 1MUMA 1UR2A 1PX8A 1RV8A 2Y4SA 1CGWA 4MJZA 4I5RA 1O5RA 3MUAA 3SUVA 5FJUA 5KMYA 3BTNA 2VD8A 4KFNA 3QM3A 4QAWA 1ZALA 1LL6A 1R47A 4KEZA 3CUIA 5LIWX 2QCDA 1I4NA 2FJUB 3IUDA 3GNXA 4C6BA 4YVPA 1YMYA 3SZ8A 1K7XA 1R8LA 3AJ7A 1VBUA 1R3WA 2VZSA 2HRWA 1G9HA 3W2NA 1EJXC 3LUTA 2BWGA 3VGGA 5CGQA 1LG2A 1TZ9A 3TFCA 4H7VA 3GU2A 4F2TA 3GBEA 1XDLA 1PUDA 3L7RA 1LWIA 3HQOA 3AUJA 4JL2A 1JULA 3OW1A 5DCDA 4UWMA 5BW6A 4E8CA 5HWNA 1V4YA 2G4JA 4A2RA 2WVTA 3JW7A 3DGRA 3GW0A 4UTMA 3DG3A 1JDAA 4LS1A 4OQVA 1G01A 2VCBA 1KFKA 1WXJA 3LX9A 1UA3A 1RLDA 4C6IA 4BKNA 3KRUA 4PB4A 3T0AA 1J0JA 2D69A 3A24A 2W6RA 1ODZA 4GGBA 3PBVA 2G3FA 4GXWA 1KC7A 4M51A 4Q7IA 1MYRA 3APYA 1NSJA 3O05A 3B9NA 4XB3A 4DXKA 4HB7A 2A3BA 1H49A 1KBKA 1QBBA 1QHPA 1SMDA 4AEFA 1GQIA 1YPXA 1I8JA 3EOSA 3KS6A 3MKVA 1SSGA 2CZVA 3FAXA 4H9UA 4UQEA 3G6LA 4US5D 3M5YA 4HZMA 4HJWA 2E77A 5ABFA 1PIFA 1V0MA 1E3XA 5HJLA 4W88A 4YTUA 3W82A 3XISA 3MSDA 4TVUA 1MI3A 3VNKA 4D2JA 1I2NA 3MBFA 1I2RA 4GJ1A 1DJHA 1LQ2A 1LZOA 4O11A 3PAOA 4YS1A 4TO8A 4K36A 3KVJA 3VI2A 5F4SA 1VBJA 5H8MA 3WFZA 4HYRA 3ORWA 4DJDD 2V5KA 4C6QA 3WLLA 3AIEA 2OQYA 2TSYA 1EDGA 3W73A 5LNSA 3UVAA 1VCVA 1VP5A 2Z1XA 1A0CA 3W1XA 1TA3A 4Q4RA 1S5MA 3B0VC 3B8IA 1FRBA 1WCGA 4GYFA 3AIUA 3SFKA 4MKVA 2I57A 3GG1A 3W1LA 2ZZ2A 1A49A 1VCFA 1Q85A 2E6AA 1WXYA 5EGRA 2FVKA 6ENLA 4NZ5A 1EQCA 1OCQA 3AQUA 4D1IA 2OOFA 1AODA 3VA8A 4GZEA 1F3EA 2B0MA 2BY2A 4US5A 3CUXA 3AC0A 5ECVA 5B7YA 3PS7A 2WVVB 3L2MA 1X97A 4TQTA 3VU2A 3XIMA 3S1WA 2VWSA 2PWEA 1XRSA 1X1OA 5HA7A 3VMPA 3DHDA 2PE4A 2OX1A 1F07A 1OEPA 3TSDA 5GQBA 2TAAA 3NO5A 3OGRA 2W91A 1JDEA 1RA0A 4CD7A 2IPJA 4JTUA 3CV1A 2E9MA 3HQPA 3I3EA 1DL3A 1JD7A 3N9RA 4RW5A 4DJDA 4OT7A 4H6EA 1RCQA 3HM7A 3RR4A 3K8LA 2QULA 4Q6XA 3EPMA 4XUYA 5HWJA 4E6MA 4JGDA 2FGZA 3WEOA 5LXXA 2JK2A 3FHQA 1RP8A 4DBUA 1VQTA 1ZS2A 2F6KA 1IZJA 4MNLA 5CJMA 3WQGA 5TQLA 3B8DA 1QWGA 2W0UA 3AZRA 4I3GA 2WCGA 1BQCA 4GH3A 4M24A 2ZX5A 2GJXB 1ME8A 1NDVA 4DAIA 3W7EA 2EPHA 3ISIX 3MBDA 3OVQA 1CDGA 4Z1CA 1FQ0A 4Q4KA 4LSBA 1OD8A 4PMOA 2ZQ0A 1KCLA 2CBVA 2ABAA 1S5WA 2ZVRA 1F5ZA 4AD4A 3PBMA 1EGZA 4AD0A 2UBPC 1K8CA 2VR5A 3R0KA 4NSBA 3NPUA 3R6IA 4D6GA 1I2OA 4QP0A 3CC1A 3KLKA 3WL1A 5I5RA 3T0BA 3GZ3A 1UD2A 1SU5A 3APTA 3ERPA 2F6XA 3PPFA 1BG4A 4JFWA 3AYVA 3NZPA 2ZBTA 1RP9A 1CNVA 4L6OA 2ZX8A 1BVNP 5F2MA 2VVSA 4QLKA 4IQLA 4Q6JA 2P5NA 3MUCA 1OF6A 2J24A 3H4XA 3LCGA 4RE0A 1MMFA 2Q8ZA 3RUBL 4B5NA 1EA0A 2C91A 1XYMA 5FIPA 3LXAA 5IHSA 4CQ8A 2D73A 1J0KA 3W1RA 2G3NA 2R82A 4GFIA 4CNSA 4QDPA 2QCNA 2DT1A 4FX8A 1KNWA 2Y88A 3DENA 4AU0A 1UD5A 3VD4A 3DKLA 5KETA 1RBLA 4ONVA 3NTYA 4HU8A 1GT8A 1F6PA 1ISZA 3L4WA 4UCGA 2C18A 4DEFA 3W22A 1DKWA 1C8YA 3UNDA 1VFTA 2Y61A 1U5HA 1JCLA 4ACZA 2B7OA 1PDZA 1ADSA 1V6VA 4FNTA 1UPPA 4W4QA 2R1NA 4EKJA 2ZZ4A 3IK2A 2PB1A 2P3EA 2PU1A 5H8PA 1XL9A 1A5KC 4MNMA 4I5UA 1UW9A 1PJ9A 5LKYA 4QNEA 4PSRA 4HPXA 1QK0A 4RPQA 4HNTA 3NPXA 2CPUA 2QUVA 4E2OA 2CBJA 2D0GA 1P0DA 1GKQA 1BFNA 2EGZA 4UMAA 1IEXA 3CIWA 3G77A 4JN6A 4H2HA 3W81A 4LS2A 3Q45A 4LEQA 1C9WA 3PSWA 3DERA 1OSEA 3GD6A 2BNJA 4AD5A 1TUFA 1MXDA 4HK7A 3PHAA 1SFJA 3BL3A 4UTKA 2YB1A 3W2UA 1H61A 2QDGA 1O1HA 2DVXA 3VYLA 3S9IA 1GNXA 4S39A 5FAJA 4AYSA 2X05A 3MHUA 2WNZA 3H54A 1OG6A 1XF0A 1F6KA 2WJFA 4GI9A 1PB0A 3K1DA 1TV8A 4GC3A 2AMGA 1JRCA 1V6XA 1MUWA 3QHOA 3HTWA 4OV4A 2PDPA 2OELA 2Z00A 3PAJA 4GJIA 1Q66A 1A5CA 3SCVA 2C13A 4CQBA 4EP8C 3MMUA 1OF8A 1F8MA 4HHLA 3ARXA 1UWIA 4J2MA 4GVGA 3AXXA 5C8BB 4O8AA 1GVYA 1R3VA 4UUIA 2W4XA 2WNWA 1VEOA 3WO8A 1K03A 3U4AA 2HBXA 2DQWA 3P3BA 5LGXA 2WYSA 3NYDA 5AOUA 4EXQA 3LPPA 4HSHA 2D2OA 4JXCA 3H8AA 3SRFA 3C2OA 1H7RA 1E6SM 1WO2A 5JUVA 4XZNX 2GJNA 4PUKA 5HR7A 2GVYA 4PL1A 3H7UA 4G1KA 2HS8A 5BMWA 3NZGA 1KM1A 2C3ZA 1OABA 1EJTC 3MS8A 5GPRA 3QW4B 3DI1A 2VO5A 4S3AA 4P2VA 3FIGA 1NF7A 3UYIA 3F2CA 4ATLA 2WSYA 4DX3A 2ALDA 4DYEA 4PCSA 1ZBWA 1YDNA 5HNTA 1KD0A 4GINA 3URQA 3CUGA 4CNNA 5DXXA 1W3KA 3WK3A 3V1PA 1A3HA 1Q5MA 1DJZA 2VXNA 1ADDA 4HCHA 3H12A 3S3GA 6PTDA 2P50A 1HQTA 2FTYA 1V3IA 2X40A 4B90A 3VOGA 1POKA 3GTFA 3DH7A 1TIMA 3TOPA 1TVPA 3REQA 2XN0A 4TVDA 1V6YA 4HP5A 3S83A 3N2MA 1QW9A 4ZB2A 3SEPA 4A8RA 4LH8A 4AZIA 4V33A 3LCFA 3T08A 1EOMA 2CESA 1OFPA 4QX4A 4NKCA 1JUEA 3UXAA 3ZWSA 1A5SA 3UJFA 3CUJA 1W2PA 1FCVA 3L4TA 2PLCA 3VNYA 5KINA 4XTIA 1RA5A 1V08A 1MEIA 3ZM8A 1HGWA 3T40A 2GK1B 1OYAA 1W9PA 2NUXA 4G7EA 5EMLA 3N15A 4M0XA 1Y5VA 5AHNA 2JGQA 6A3HA 1ZFJA 4AZHA 1EBHA 5H6HA 1MZRA 4OVXA 3EDEA 3QGKC 2Z0IA 5AYIA 4J4KA 3GM8A 3TAOA 4S3DA 3WQ4A 4ADSA 4P7QA 1W3JA 1XS2A 4AHPA 4JTHA 1W54A 2OYMA 3UG3A 1F3XA 2OKTA 3P80A 2E6DA 3CEPA 3IANA 1E5JA 4B5UA 2YYTA 3G0UA 4C6LA 4FX6M 5ABHA 3JS3A 4MYXA 1I9CB 1NQ6A 2NVDA 4AMCA 4G9PA 2VTFA 4BCEA 2FFIA 4XKYA 1TV5A 4BZYA 4H19A 4FA3A 1B9BA 1SO6A 3VVGA 4RJEA 1QPQA 2ZCGA 4DBSA 2NZLA 4ZBCA 3R8HA 1AD4A 3FSTA 3WDJA 4ZFCA 2OKOA 4WUIA 2CLIA 4QG6A 4XIAA 1XYFA 3LU2A 2DPEA 1ZPTA 3WG6A 4Q4MA 3RF9A 4FXRA 5G4WA 4LBSA 2VWTA 1O94A 2FMOA 3IVSA 2Z6IA 1C8VA 4GZ7A 4DM2A 4CD4A 4MY1A 4XZBA 3B0PA 1EHAA 5F4WA 1E6RA 2XIIA 3IJLA 2AQWA 4DLFA 2FTPA 5DANA 1Q6CA 3TW6A 1XIMA 3S1GA 5CCZA 3UWVA 2QV4A 4MZ1A 2BDQA 3W3OA 3EB4A 3K46A 5MF5A 4C6JA 1R3QA 4I9JA 2ESCA 3FEMA 4M6PA 2D3NA 4BF5A 4C90A 2ZZ3A 4CEXC 5FEPA 2QJJA 3SCSA 4BFAA 1M01A 1CGXA 5XIMA 3V5CA 1IE7C 1NM9A 4PH6A 1PWLA 1WAWA 2H3DA 3FJ4A 4J3SA 3QEZA 3CZKA 1E71M 4NZ1A 5MKGB 4FS9A 4CCDA 3CL7A 1PTDA 1T7LA 5DMYA 2PDWA 3ITCA 5CEWA 2QT3A 2GJPA 5KZEA 2O9PA 1EOKA 4C6EA 2PURA 2E5DA 3QFEA 1QW7A 2WSKA 3IPWA 1AZ2A 4HNNA 5CXPA 1V0LA 2DT3A 4LY8A 3N6JA 1B54A 1Q13A 1F4HA 1Y7VA 3CPRA 3DBPA 3PZOA 3Q94A 1H5YA 4CU7A 4IGHA 2V0TA 5REQA 1M04A 5LHEA 1JRBA 3OYZA 2FQIA 1CIUA 4PSPA 3L12A 5KEZA 1A47A 3DG6A 1NDZA 1BYCA 3NQCA 4LYKA 1JPKA 5D03A 1A0DA 5FI8A 1KTCA 4AX7A 4HPNA 1JQVA 3MI6A 3S5SA 4IMAA 3RNDA 4FAMA 3PFRA 2C0AA 2F84A 4NZCA 1KKRA 1B3OA 3EPOA 2FYMA 2NV1A 1LLZA 1R3SA 2W66A 2NT1A 1LDCA 3CK5A 3WLOA 3T8QA 3O6YX 1TE6A 3URNA 3SFWA 2GGIA 4JY9A 2OSXA 3NQEA 4CVUA 2IQ0A 3U2OA 1W0MA 4YWSA 2GOUA 2PBOA 3OHMB 1T0OA 5BMXA 3N6HA 3S2CA 2PMQA 4KW2A 5FA5A 3OQEA 4OECA 1P7TA 3RAOA 5TNVA 3IEBA 1CW2A 3IIVA 4G8TA 3NPWA 4Z2GA 1OVDA 1UPMB 4GYPC 2DY3A 3BARA 4EWND 3EWCA 1KGWA 1PSCA 3I3BA 3VKCA 3EWYA 1KO0A 5C7VA 2RH9A 3QRHA 5BCAA 1H1ZA 3EKGA 1O7AA 2FDMA 4QDMA 5LA1A 2OMAA 1XINA 3UF9A 1UIOA 2E9LA 1Z69A 3EWBX 4PMQA 3W02A 1CXEA 2O7SA 1DQWA 3TTEA 3PPCA 4S3BA 4PEKA 2XVGA 1J10A 4L56A 3BGJA 3KE0A 3RRAA 1UUOA 1PX4A 4BF9A 2P76A 3DFYA 4XD3A 3NQDA 3GAKA 4AW7A 4K39A 5I3KA 3FA5A 3PN8A 3VTRA 1ZUAX 4DO6A 1GJUA 5EFFA 4JY8A 5DRIA 1UQZA 5G1TA 4KQNA 3C3UA 5DCBA 2PTWA 3W00A 3PZNA 4W7VA 2OGJA 2V5BA 1XKJA 1UA7A 5HDRA 3A12A 5C2GA 4MPQA 3FKRA 1PKNA 3R5EA 4JTSA 1PZ0A 4IMDA 4PMNA 3R13A 2YL8A 4HCLA 4YPJA 1UWSA 3WLIA 3BSHA 4CNOA 3HIJA 3L0KA 1WNOA 2Z26A 3EXSA 2HISA 1PV8A 1W9BM 3VNDA 4TUFA 4WDWA 2PF0A 2NQ9A 4KF1A 1ZAIA 2AKZA 4MTVA 5LNWA 3O1NA 1NH6A 4RNHA 2G95A 3AHXA 2XSBA 4POCA 4DI9A 5E93A 3LV5A 3T2OA 1E55A 1JR1A 2V67A 1RQEA 2V81A 3RLUA 1X96A 4HJFA 4I7UA 1KFEA 1KCKA 2RFGA 3P14A 4FLOA 2VC9A 2CETA 3F5KA 4YXGA 3QMTA 5LIYX 1JNEA 3W07A 2OTDA 1E73M 3GXPA 2WPBA 2PDQA 3U48A 2CLHA 1JXJA 1BLIA 2FHBA 2QCGA 1EJ7L 1FWRA 5F4XA 3Q58A 3KCJA 3MV01 2QGHA 2XWEA 1UR0A 1MVYA 1R6WA 2CZFA 4Q22A 4GCAA 3LHWA 3WNPA 4YTSA 1ZBCA 2HE8A 2W79A 3VD7A 3N13A 1TFVA 4LUSA 5I2UA 3WK0A 3R89A 2RDXA 1HJSA 5JIPA 2V3DA 2NUYA 1CLVA 1GQLA 2HVMA 4IWWA 5FSEC 1KBJA 4QG8A 3TONA 3S6TA 1VBHA 2GQ8A 4YJ5A 3NEVA 3ANVA 2HVNA 2Z1WA 1VKFA 4QIUA 4F2UA 2OWCA 3BLPX 4LNCA 1WKEA 1JZ4A 1FY6A 3U0HA 3C2YA 1ISYA 2ZA3A 3WF0A 1QI3A 2CZ5A 4LBUA 3FY1A 3ZR6A 5C9WA 2VFFA 4LY4A 1RBOB 2DSUA 4W85A 1XYAA 3L4UA 4XAYA 4C1NB 4H7ZA 3NQ2A 3P82A 1PZ2A 1VPYA 4JTJA 1XCXA 4ALDA 1VYRA 4L7ZA 2EJAA 4UB9A 5IOBA 3SQSA 4U33A 4U28A 5LIKX 2OEMA 3NSXA 4QSHA 2P88A 4XVDA 1O5XA 2WWCA 3MUY1 1GKRA 2JBMA 2XVKA 2QCMA 1ZHAA 2ZDRA 4FB7A 4MB3A 2QUNA 4EPKA 1X7IA 2PDUA 3ZS4A 3L21A 1OT1A 4LUIA 3WH8A 1KTNA 1FWTA 2QCCA 2H9AA 4QQ3A 4W9TA 3N12A 1F6YA 4X63A 3SN0A 1JPDX 1RCXB 1VIWA 4BS0A 1F4AA 4CD6A 3S6DA 1HW6A 1VFUA 4XK2A 4Y6GA 3ZSTA 4L4OA 2YA1A 1TV4A 3DCPA 4ERAA 4GY7A 4JHOA 4LUJA 3EDDA 5D4YA 4AC1X 1J2WA 3D6NA 4C6DA 4XAZA 3HN3A 2VGBA 1V79A 1F05A 1W17A 3G1XA 4GX9A 5GJMA 3WJWA 3UFYA 2YCJA 1SO3A 2R6OA 1H7OA 1KXTA 2CLOA 1SPQA 3NQ7A 2DSKA 2YYUA 5IFTA 4YTQA 1QNRA 1W32A 2QNEA 4AIBA 5IRPA 1TB3A 3UWUA 3AALA 4DPPA 3PUGA 4PRRA 2ZA2A 3C86A 3SR7A 2QS8A 4M1RA 1MW0A 3ZJKA 3N2BA 3P0WA 4AIEA 4O13A 4X9YA 4B92A 1GGOA 5CSRA 3EDKA 4J3VA 3N9SA 3UZZA 3N25A 5A8MA 3G1FA 4IIDA 4Q8PA 1TJ2A 1RJQA 4I9MA 5AC5A 1EH9A 3BLDA 3FA4A 1J2BA 4RE2A 4MY9A 4FR1A 5JU6A 1OX6A 1TMQA 4KGJA 3GXMA 3M1ZA 2WK2A 3VGDA 3WLMA 2WZHA 2HCVA 4WSKA 1NU5A 1TV2A 3RPMA 2Q3RA 3W7MA 4ZXLA 1UKTA 1YADA 5BNKA 2WSRA 4O1AA 1SFSA 3KCOA 4KRZA 1XBVA 1IEWA 1RD5A 3W84A 4XZWA 1OYBA 2GSEA 3H22A 1GWJA 2HTMA 4LAUA 3IJIA 1LG1A 4WKAA 3WLHA 1ESWA 1QR7A 4IJCA 1TWZA 2D2JA 1FOBA 3MI3A 1ZQ5A 2B4GA 1PZ1A 5EMKA 2CZDA 4LNYA 1I1WA 5FJIA 3RJYA 5FESA 2GQ9A 5CPMA 3AMKA 4IIFA 4J3XA 2CWXA 4J3TA 5LA0A 2QHAA 1S46A 4UTHA 3RLGA 3L0GA 4TTGA 4HZ8A 3RO8A 2IPFA 2EG7A 2R1PA 1UIPA 2BGNE 3W7DA 4UTIA 3MP3A 4WLCA 3K4WA 3MO4A 2ZDSA 4RZ4A 1FUYA 4K3ZA 2BVTA 1B3VA 4PMZA 5BOFA 5K9DA 3S9YA 2IXUA 3PK7A 3MCNA 3QMSA 1FH7A 3L2LA 2PGRA 5C5YA 4UNLA 3VD9A 1GQKA 2TMDA 4RE3A 3MI2A 2BASA 5GNXA 1UKPA 1WDSA 1PKYA 1GYLA 4IMFA 3DESA 1TG7A 3A3XA 3U7VA 1DWJM 1E0XA 3W87A 3VNZA 1ML1A 3IRDA 3LA4A 4UTTC 1UZDA 2V82A 1UYQA 2J77A 4XKMA 4AZ7A 1X6UA 2PP3A 4HPJA 4QNWA 4HYWA 3LSBA 3ZOAA 1P48A 1ZY9A 1R2RA 1XIIA 3UZYA 1WX0A 3W7JA 1KB3A 2MNRA 2V5CA 4KFPA 1OCJA 1QI2A 1HJVA 2ZIDA 3BWWA 1UC4A 3N2CA 2C8NA 5LIUX 2OEKA 3KCLA 4XO7A 3WNLA 3UPWA 3NQFA 3IGSA 4L4PA 5D04C 5GNZA 5BU9A 1Q6RA 3WEZA 4RK8A 5HQEA 1JFHA 4XBJA 3NFUA 3VK5A 3JU2A 4PMYA 4D71A 5DLCA 1CLXA 2GLKA 3HO8A 3P5ZA 3SO7A 4LVDA 1J18A 1BG9A 1FCBA 1UP2A 3ALGA 4FF5A 3SURA 2WKLA 2DZVA 4EANA 3LPFA 4QGCA 3BOFA 2QDDA 3ARSA 5LNVA 2VZUA 3AAMA 3MYOA 1ECQA 5DBTA 4GCXA 1XGZA 4NNAA 4A8NA 1PX3A 1I0DA 5JVLA 3NQ8A 4IMGA 1RY8A 4DYJA 3M7SA 4JKMA 2E0PA 4NU7A 5J5DA 4FNRA 2B7PA 4DRSA 1DV7A 3VIOA 4IQJA 3E12A 1GEQA 3W6LA 4YTTA 4NJKA 3R8GA 3URBA 1AZ1A 2OQHA 5AHMA 3DGBA 4LAZA 3DG7A 4RXFA 2ODOA 4JTLA 1R46A 3H7VA 4NNCA 1VRDA 1ISWA 4M81A 4YHGA 4CN1A 3MUXA 2DZBA 2H8ZA 3A9IA 3QQ1A 2HBVA 3R11A 3STFA 1JYVA 2D2GA 4QAIA 4HT3A 3MWAA 1CPUA 2DW6A 3I6TA 4OU1A 2V3GA 3WJSA 1R9ZA 1POJA 5HBFA 1EHNA 3W7GA 2VEKA 2JEQA 1BTMA 5I78A 3F4DA 4Z2JA 3T0DA 3ZLFA 4WSHA 3GTIA 2FH6A 4AMAA 4JTIA 4CQAA 2Q01A 1E1CB 2GPTA 2A0NA 1XICA 1W1B1 4KKXA 3VDHA 1A3WA 1EJUC 4MLJA 2QF7A 2AMXA 4NX0A 2I7GA 4JBRA 3M5VA 1LUCB 3WQPA 4MJMA 1F73A 4YCPA 4H8UA 4DWSD 3TWBA 3G0SA 2WQDA 3Q65A 4AY8A 4YNGA 3UJ2A 1C8XA 3A4WA 3TW7A 1R30A 4RNFA 5CGMA 3G1SA 3V16A 3QVQA 2DSWA 3VMNA 1G0CA 3RX3A 2ZXBA 5FAGA 3E02A 3EA2A 1EDTA 2J8FA 3L23A 3GXIA 2QCEA 2BHYA 3PY2A 3VIKA 2VOTA 4RXGA 2TPSA 3VOFA 3RU6A 3QOMA 3W83A 1V0KA 4JIRA 3LBOA 5CG7A 2WHKA 4MNJA 2VGGA 3WD1A 4K2SA 3S5OA 2HPMA 1H1NA 4E3VA 5JIWA 3UNTA 4TVCA 5BYWA 3AMCA 5DXYA 2OLHA 5EYWA 1TJ0A 4DWDA 3OLIA 2YR1A 1O60A 2CHOA 2J74A 1TV7A 4A3YA 4RNIA 3HGSA 1CXHA 3S46A 2V2CA 3OOQA 2J7EA 3BPWA 2VM8A 1SZRA 1ME7A 1OGBA 4NHVA 1Q8AA 3RO6A 4DWSA 4E5TA 2BOGX 4XG1A 1CGYA 4HOXA 2PTZA 3MZ2A 4EAYA 5FL0A 5CBJA 2HK1A 5EA9A 1Q6LA 4E4UA 3H2MA 2W67A 3QZ6A 4A4AA 3HGJA 1A5OC 3NQMA 1F76A 1FWFC 3QR0A 4NI3A 4GBDA 2X0HA 5D38A 1NFBA 3LRLA 1BTCA 2PDIA 3UZWA 3HG4A 3ES8A 1ZJAA 2PP0A 2Z1VA 1E6XM 4IFOA 1LLWA 3AYTA 3G5EA 1EP3A 3UPMA 4AZ6A 3QSRA 1R3TA 3N18A 2XH4A 4O0QA 1XUUA 2PDYA 2BY1A 4RV8A 3FDKA 3RPDA 4C5YA 3T42A 2V3EA 1ZP4A 1EXPA 3DAQA 1H63A 1CB7B 4FI4A 4OBTA 2OVLA 3U2EA 7PTDA 2E1WA 3RR1A 4RLIA 2V5DA 5HR6A 4R7JA 3QZAA 3UG4A 2QJMA 1DWGM 4Q4PA 5HWMA 3IJ8A 1OFRA 4LAKA 3VNLA 1S2VA 5ABEA 5F1VA 4ZSTA 2P8CA 4J3WA 3CBWA 3DEQA 1GPFA 4HHMA 1E9LA 3GZAA 4PTNA 3QV7A 4GGHA 1EX5A 4DJFC 3AXKA 3KTXA 3SY1A 4KMQA 1IEVA 1XCFA 3WF3A 4U3CA 4GI8A 4B3ZA 2VCAA 2HWGA 4S3FA 1PBGA 3LSCA 3OVPA 1O66A 1IGSA 3BCDA 4XZLX 1GJPA 3VKBA 2FZNA 3M0HA 3ANUA 3N19B 4Q4QA 3TJXA 4K7YA 3DFQA 2QAPA 4IPLA 3FN9A 3CQ0A 4IPNB 3E9AA 3PG8A 3ZMRA 2VEIA 1WPCA 2WVUA 1WUEA 4EVZA 4E0CA 4C5ZA 1GG1A 1J0HA 4F79A 1AUSL 3I7QA 4WY0B 5I02A 5L6UA 2E09A 1P43A 4CLMA 1NAL1 3BSGA 3UWEA 2H90A 2YCKX 4Y9PA 4C6NA 1CB2A 1WDRA 1RQBA 3UR7A 4RDZA 3LCWA 2XUCA 2Y24A 1J6OA 2AKMA 3BQ5A 1NP0A 3RGTA 3WLRA 1XLBA 2EPNA 1EUAA 4L6DA 1S2WA 3GFXA 5LYRA 3N4EA 3WJZA 5C54A 3U5YA 3IVUA 3VE9A 1XSIA 3R58A 4B2DD 4YYFA 5CZ0A 3DYMA 1R7AA 1PAMA 1M53A 4GA8A 1YXYA 3B9EA 2PWDA 2PTDA 1DBTA 2JKAA 3LTYA 2IS7A 3F4VA 2J7CA 1EGMA 1W1ZA 3UXIA 1EXBA 2CFFA 4ML9A 1JF6A 2DEPA 2BSLA 1TWDA 1RY0A 3KHDA 1EFZA 1EIBA 3QZEA 2A7RA 4I9AA 3SCTA 4R34A 1CGVA 1CT5A 4WGHA 3M0VA 4O1CA 4W5UA 2VKZG 4MKSA 5I0DA 3S1XA 2VFHA 4WKHA 2OEJA 4U3AA 7CGTA 4AZCA 3TZFA 3H2CA 1H0IA 3G1VA 3A13A 3T6CA 4WDXA 4E2BA 3KP0A 4JHZA 4JIHA 3KP1A 4B2DA 1XXXA 4ATDA 2C79A 3GXNA 2BX7A 3W1PA 2F7FA 2W61A 4JQ2A 4PFMA 2HXUA 3GKAA 2GZXA 2QEZA 3I4EA 4LANA 1FHVA 2NQHA 1K02A 2GUUA 4R85A 2VEPA 3TYBA 2Z1SA 3RLVA 3MJYA 2HJPA 1JCXA 2KAUC 2QJHA 3TSMA 1C92A 3WDIA 4Q8VA 1QDSA 3UD6A 4LUYA 2FKPA 4ZENA 2Y0FA 1R87A 1H3GA 1KW1A 5DO8A 2C1IA 1WKFA 1OX5A 3M07A 5EMMA 1UD8A 5E6ZA 5AC8A 4QDWA 2QPSA 4R27A 5LIXX 5DBUA 1K8YA 3QPYA 1A4MA 4CU6A 3NQAA 2PDHA 3VOHA 1GZJA 1NFPA 1U1UA 1JEZA 4PTMA 4OFCA 1TPH1 3AHZA 1L2QA 1JCTA 3BG9A 2CXGA 2J8GA 4MAZA 3B3DA 2FGBA 1DJGA 3SSZA 1AW2A 3TYCA 4O18A 4ZB5A 3EX2A 2BOFX 3IJQA 1MXGA 3C0SA 2PF8A 1M7OA 3F03K 4D6IA 5AY7A 2YDRA 4LQ1A 3BJFA 1XYBA 2FZMA 1KXQA 3P62A 3E0IA 4H6QA 1EZ2A 3GAYA 1S2CA 2PRLA 1FFRA 3DU0A 4P5UA 5CPOA 2GSJA 4TTUA 1X39A 1I1XA 1UASA 2R24A 3U5UA 3C0QA 5K9XA 4MM1A 5B7ZA 1SR9A 3V3WA 4W5ZA 4E3TA 1LLOA 3S9ZA 3WLSA 4DUWA 3PZGA 3CZJA 2QCDB 3PJTA 3SJ3A 1GVQA 1JL8A 1JXKA 1QOQA 4X60A 1XYCA 3R0DA 3OBKA 3ARVA 2VRKA 1CTNA 1H50A 1BWLA 3TZNA 3GIPA 3TA9A 1QI5A 1ECEA 1TPFA 7ODCA 4KWSA 3CQKA 5I3DA 2XN2A 2J13A 1RHCA 4PTVA 1JAKA 5D2TA 2PLMA 3TJ4A 4WJXA 3VIMA 3TYAA 4NZ3A 4M5PA 2JKPA 3BLIA 3VIPA 4AWEA 4WXYA 2E67A 1YYAA 2ZKMX 4MG4A 4HNVA 5F2IA 5CBBA 3UJEA 1XLDA 1F3TA 1F7BA 3WQOA 4KH2A 2X16A 5AN7A 5FJTA 1SZEA 1FWEC 1OINA 2BBFA 1H7WA 1SSDA 3GUWA 3GB6A 3PBWA 2WC4A 1F61A 1WZKA 3L5AA 4H00A 4HTYA 2C7FA 2X1RA 1ISXA 1MW3A 2TYSA 4LVGA 1ZCCA 3FNDA 3WD2A 1JYNA 4DIAA 2CERA 4IL2A 4NJGA 4UBPC 3V7PA 1XLFA 3GYEA 4MZ8A 1XLJA 2DT0A 1CECA 3O63A 5I09A 3ZZ1A 2VRJA 5EU9A 2QV5A 3RU8X 1U1HA 2ALRA 3G1HA 2CHRA 1PPIA 1JZ5A 2X8RA 2XVPA 5A95A 2L5HA 3DHFA 1FKWA 1XRFA 2OLSA 1R0MA 2DW7A 4QE5A 5A3HA 4MPKA 2PWGA 4ZE5A 7TIMA 3PBGA 1RBAA 3AMGA 2GGGA 4MSSA 1MQRA 5ABFB 1D8WA 1T6MA 3U6WA 1IXPA 4Z1YA 3LI0A 3HF3A 1HP4A 4IICA 1AVAA 5T91A 1KM0A 2V68A 1QO2A 1C7TA 3SAZA 3VC5A 1Z44A 3HPFA 1FCQA 3QQWA 4U2YA 3R7MA 4GRSA 4B9ZA 3IJ7A 3BMWA 2GGJA 4PRTA 1XSJA 1J93A 5KZDA 1HUVA 4N6FA 1BYAA 3WN6A 3C4UA 3R25A 1YDOA 3TQKA 3GQYA 3PBUA 2PDKA 1E4IA 4DAFA 4OBSA 3PZQA 3MW7A 3G6MA 1JGMA 5LNRA 2V38A 3KOFA 4GG9A 1NTHA 2HE5A 2OSWA 1NDWA 4FEZA 3LLXA 5D9MA 2X41A 1GUVA 3LGDA 4ASTA 4Q8WA 1F3WA 4UTWA 1AMYA 2F9RA 2Z24A 4AEEA 1FWIC 1QVBA 1TPDA 2YDQA 1V6UA 4UOJA 3SDOA 4H6RA 3W7NA 1PTGA 4HNOA 2IUZA 4WDTA 4YMZA 3RM8A 2Q8LA 3BOXA 3KOZA 3W1UA 3L4ZA 1GQNA 3BXWA 2E68A 3PUEA 1FDJA 5FJPA 1H5VA 2VDHA 5CLWA 3DDMA 4IM4A 1AH4A 3G1YA 1X1ZA 2KZHA 5ABGA 5CAHA 5HMSA 4D6DA 5E0CA 2OYLA 1TMLA 3K4DA 4BR1A 3VILA 2INEA 2HEJA 1EC8A 4Y9MA 4A8LA 1O95A 1P0EA 3C2EA 4H9TA 1EA9C 1J5SA 2HVOA 1UB3A 2QKFA 3B05A 3E3HA 3LS9A 5FF2A 5D2WA 3NPVA 3PUOA 3VNJA 3PZTA 4PFHA 3VOJA 1PE1A 1IHIA 3S2LA 1SO5A 1S2TA 4KETA 1JCJA 2ZZ7A 4D6JA 4BQ5A 4DJDC 1PO9A 3S2NA 4GO8A 2BOEX 4H83A 4PC8A 3GIQA 4MLRA 1OC6A 4IGMA 3TIMA 1XUZA 2UY5A 1XIDA 3BVJA 4XD6A 3TNOA 2OFJA 2QIWA 1TSIA 5F1UA 4PCFA 3E2QA 2YFNA 1YNPA 4KIRA 1KFBA 5CGTA 1ITCA 4MFDA 1E72M 3AHVA 4J1OA 1AMKA 1EP2A 1XJBA 1NOWA 5I79A 5HMDA 1TCMA 3GHTA 2DVUA 3NDYA 4GQRA 3W1TA 4GQGA 1KGXA 1NOUA 1S39A 1WP6A 3F5LA 4K8HA 4K6AA 5C0QA 1HL9A 3W7HA 1VYPX 5CPNA 3UWQA 3TLQA 1FWCC 1OBAA 1TVNA 4E8DA 4M6VA 4P7OA 3QQ0A 3SQLA 3CH0A 1I0BA 4L1XA 1QNSA 2ZICA 3KBWA 4Q4OA 2JFEX 3NSMA 4P7NA 3VNMA 1V6WA 3GSMA 3VXGA 1LOSA 1KFWA 4V1YA 2JQXA 3ABSA 4UQBA 3F1QA 4GQQA 1DPMA 3UCDA 2VENA 5HPOA 1BGAA 3LERA 1CEOA 3BCFA 1UBPC 1PCWA 5D8WA 2YB4A 2GK1A 2P53A 2ZZ6A 1VD6A 3AWNA 2PWVA 2XU2A 2IKGA 4AHOA 4IIBA 4AWTA 5M17A 3TN4A 1KRCC 2INZA 4XBKA 1F8IA 3VINA 4UFLA 2BHUA 1FXPA 3FLUA 2CIPA 3PZIA 1RSCA 3LXCA 4FIQA 4A35A 4ACZB 2ATSA 5BOEA 4XSMA 2XTKA 4RW3A 4M7SA 4LYQA 1S5VA 3BOLA 1W1IE 5CSYA 4GYKA 2VFIA 4MDPA 4H8HA 1TTJA 2VURA 2J9YA 1VFSA 5A2CA 3CZ8A 3KHJA 2NUWA 4IQEA 1B0IA 5HPCA 4Q8OA 4EK7A 4QFUA 4F2BA 3W72A 3KVMA 4GHRA 1K8XA 3WQCA 2E7FA 4LPCA 1KV5A 4MIMA 4M82A 1TYGA 1LRTA 4CCZA 3W9ZA 3CB3A 4JTFA 3PPGA 3LXBA 4DZAA 4GI6A 1BRLA 1A50A 1TZ7A 2EJ1A 2Q71A 4JX6A 9RUBA 3ZJ6A 3BK0A 3FJLA 3QH2A 4MUPA 1DIEA 4JTDA 3TQ0A 3LRMA 4Y96A 4O52A 4ERIA 4RZBA 3OIHA 1QJWA 1WBHA 2XZ7A 4JNYA 3KBNA 1O4UA 3II1A 4ORIA 2V8ZA 3ZT5A 2DSZA 4NX5A 3TXVA 2V9DA 9CGTA 3O9NA 2YJQA 2C16A 4UTUA 3MYPA 2DDXA 3BW3A 1BXNA 2A3HA 1E0UA 4N2YA 3SUTA 1DTUA 1WZLA 4P8WA 2QJGA 1LL7A 2A7NA 3TWAA 4AY1A 3AZSA 4NYYA 1WA3A 4M6UA 5MKGA 3GLCA 3C52A 1SZGA 1L8NA 4I6KA 2CLFA 4FIRA 3WD4A 4RDWA 2OT0A 5BOOA 3KBVA 2I5GA 3FVMA 3ITOA 4W8BA 3SUUA 4XAFA 3LGEA 4GUFA 4ECLA 1R9XA 1JDDA 4PN2A 5D32A 1N2VA 2C19A 2WM0A 5CQ1A 4O28A 3B8VA 3AUOA 3FCPA 4DO5A 1Q4WA 2QJIA 5CJ5A 2PSNA 2CLPA 2O56A 1HJWA 4S38A 2EHHA 2VELA 3TQPA 1K8ZA 2ZUWA 4P7LA 5CC5A 4HSOA 2XM2A 4DLMA 3LCXA 1B3XA 4IQDA 3N6QA 3NGFA 4MGGA 3WH7A 2X2YA 4S23A 7A3HA 4WSJA 3VGHA 2BGQA 3G3MA 3TN5A 5A8GA 4RDVA 3CIVA 4ZTYA 3PF3A 4DY1A 1MFUA 3USZA 1E0VA 4IG2A 4KGLA 1CGTA 2J6VA 3LDVA 1G4EA 2PWHA 1KR1A 5T9BG 4D8ZA 5E9XA 1IGWA 5E0FA 3EX6A 1RPXA 5BRPA 2XFRA 2YLLA 5C2XA 3C5QA 3T44A 1KFCA 4TU1A 3PWGA 2PC8A 2F2HA 1I60A 2ZRZA 3TOYA 3M5ZA 3FGCB 4C6FA 3W7PA 3TU9A 2INFA 5JH2A 3FYOA 1C7SA 4JTRA 4B91A 3VX1A 5F7UA 1JFXA 4GIRA 3UXKA 1AW5A 1DIKA 1ELSA 3NURA 4G7EB 3VIJA 4WK9A 3ATYA 2I16A 4TMCA 3G18A 1XYZA 1BWVA 3BMXA 1K3UA 4B3KA 5C7HA 3S4TA 1JZ7A 1XDJA 3WD3A 1VHCA 3N1AA 3H2OA 3EX1A 1X1NA 1MSSA 3W7LA 2DH2A 3QR1A 1NOFA 2NXHA 1JIBA 3KWSA 1DTNA 1JPMA 4Y9OA 2I9EA 3V18A 3HZ3A 4K1WA 4PUUA 1J01A 3C0LA 3OZMA 4FOJA 4Z08A 1OYCA 5CLTA 2XGBA 1VAHA 4XKYB 3BZJA 4OIFA 2VQUA 3E2RA 4CNPA 3M46A 1OY0A 1IR2A 3WBEA 1J12A 2YCIX 2V63A 2EO7A 1N8FA 3HPSA 3NIYA 1JUBA 4L64A 2HPIA 1M7XA 2VVNA 1CI1A 3DFNA 4K37A 4CCEA 1RALA 1R7OA 1GOIA 1U5JA 1VBGA 3GVWA 3NQ6A 5DMMA 4NRSA 1IWPA 4O1DA 3MANA 3MDUA 5AYYA 4PRWA 1W37A 3QC0A 1UKOA 4LJ3A 1HXJA 4TIMA 2RDTA 3SGUA 2OG9A 1FFQA 5F2GA 4KRUA 3W24A 4CD5A 4D8AA 2DFAA 4QCEA 1QT1A 3WNOA 4HD5A 2PD9A 4U4MA 2BXZA 3TCSA 3W2JA 2YL9A 3G8EA 4CNTA 4JIEA 1G69A 3ZR5A 2HQAA 2ZYFA 4S3KA 1H1YA 1MQQA 1ZBKA 5CH9A 5FEXA 4I7VA 4IGNA 5HNUA 3HU7A 1W3HA 3LBMA 2TRSA 3V0TA 1KFLA 1S2AA 1TTPA 3BV7A 3WY1A 3MU7A 2NWRA 5HANA 3OLGA 4PUEA 3OYXA 3VOIA 2A3CA 2BODX 1RQHA 3WMLA 2ZWZA 3WD0A 5A8NA 3FW6A 3S47A 1JCMP 3PFMA 4YVVA 2VX7A 4LUTA 2YDSA 5HOSA 2H8XA 2PD5A 1PHWA 3BLEA 3UGVA 2CLEA 2GGEA 3WBYA 3VGBA 1PKMA 3UG8A 5C6MA 2MANA 4B5VA 4QE1A 2OO0A 3WH9A 2HK0A 1V5XA 3PZVA 2HS6A 4V28A 1THFD 3SQMA 3DHPA 4IT1A 4N4PA 9XIMA 2VD9A 1FH9A 4QITA 2ONEA 4XISA 5DX7A 4O15A 1ALDA 1V7AA 3BE7A 1Y0EA 1SFLA 4UR8A 3K4AA 1SJAA 3WSUA 3U2ZA 3BJTA 4IP7A 2PAJA 4JCLA 2PI6A 5A2BA 3C2FA 1OC7A 2ZX6A 1JI2A 2Y8UA 1YIXA 3CXOA 3ITTA 2A3EA 3VDGA 3QV9A 6TAAA 4UIOA 2X30A 4GK8A 4DO4A 1XIFA 3VMOA 2PDCA 1NIUA 3B8TA 3EWUA 1P7TB 1UC5A 2J88A 3PULA 1Y5WA 4W87A 1A53A 4BQ3A 3WDQA 4H7CA 4I6VA 3GRIA 3BLFA 2Z6JA 3WFLA 1GOWA 3NQVA 2YL6A 4FXJA 4LGXA 2NV9A 2Y8VA 2XGZA 2GQ3A 1Q4NX 3K8MA 3S42A 3GO2A 3BCJA 4J3ZA 3UR8A 5D2VA 3DBNA 3OVGA 5GVJA 4XV0A 5LNUA 2BY0A 4O4VA 2OWXA 3H55A 1G1YA 2PS2A 3EEZA 2XH7A 3PZ9A 4GBUA 4L61A 1U1JA 2ON3A 5A6JA 1XD1A 1H2JA 3P6LA 3ARTA 3P7YA 3STGA 1VEMA 4I8DA 3STPA 3ITYA 2I5QA 1WOAA 3KUMA 3RM4A 2VUNA 2WHJA 2EKCA 5G4HC 1J79A 4G5DA 4Q8TA 4H9VA 3FHAA 4J5NA 2DSVA 4NJJA 4JTGA 2E28A 4ZB0A 3GBDA 3CT7A 1GVFA 3N2XA 2FHFA 4MKNA 5GJPA 1TUXA 3NDOA 3EB2A 3O6DA 3NZRA 4EF9A 4ICMA 4MWAB 4JX4A 4LYRA 5AZ0A 1UMYA 2WVSA 1WB0A 5A6BD 1CXFA 1CBGA 3NUKA 4CKQA 1KWGA 1V3MA 1RAKA 2DZSA 2ZA1A 1A5MC 4FLQA 3WQWA 3UJSA 3EAUA 1FWDC 3AIQA 1FWNA 4C91A 1UWRA 4MWAC 1SJBA 1DJWA 2NLYA 2G3IA 4RNJA 1U5VA 3VD3A 5BROA 2WAGA 3IGUA 2QIIA 2D3LA 2CITA 4QS5A 4NAFA 2ZE3A 4Y7EA 2HROA 1PKLA 1O6IA 3FEQA 1FCUA 2NLIA 4PGLA 4QR6A 1KBIA 1KTBA 3A5FA 1M3UA 3LLDA 1TV3A 3GFZA 1W8GA 3TSBA 2WZMA 4LFYA 4MVAA 3ZQ9A 3PVFA 3FA3A 2G41A 2PP1A 4QTGA 4R5EA 2YLAA 2QMKA 3SCQA 3UETA 3KOWA 1M1BA 3SJNA 1EC7A 4QRNA 2V2HA 2CHNA 2EBNA 3O8AA 1WAUA 2W62A 4O1FA 2SFPA 3RLHA 3KDNA 2YKKA 2AOSA 5A6BA 3NM3A 3AU6A 2GL5A 2ZXQA 2OZ8A 4JDYA 1ZLPA 4JIIX 4C1KA 1RR2A 1S3HA 1Z7AA 3HGOA 1FWHC 3W26A 4IOTA 4LUSB 5XIAA 2ISSA 2RJGA 5LGZA 1E9ZB 4KWWA 3LD5A 3MT1A 2A85A 2Z2BA 4IISA 3NYZA 2J9XA 3VM7A 1AG1O 1TJPA 1OIFA 1ZSXA 3OGVA 1BAGA 1EPVA 3MB9A 3MMDA 4HA1A 4REQA 2PBGA 3A6OA 4E4FA 3W7CA 5AC6A 2BVYA 4IXHA 3PNUA 3OG2A 4IIHA 4AB4A 3W2MA 2XIJA 4BJHA 2Y70A 1XWYA 5M3WA 1QPKA 1DIOA 3NQGA 2QCHA 3ARYA 1M03A 5U7SA 4PCNA 4ZCWA 4B4FA 1QRQA 2C15A 4IFKA 4ZR8A 2OR2A 1FWAC 3O2LA 4F0KA 1YDVA 3RIKA 3TTSA 3FVDA 1PYMA 1X98A 3LM3A 4J2PA 2NSOA 1VCGA 4QE4A 2HXTA 3UXDA 5EB8A 1AJ2A 1SQ7A 4IP4A 2QPUA 3CT2A 2QUTA 2GWGA 1VJZA 2IMRA 3ICJA 1OFBA 1PYFA 2FZ9A 3MTWA 4ML4A 1WZMA 4LAOA 1HG3A 4PB5A 4CCCA 4JTCA 2H9AB 3RRXA 4AVNA 1NARA 2DVTA 4KCUA 5D33A 1CZ1A 4WHBA 1R2SA 2G37A 2IW0A 1VRXA 4TR9A 4IZGA 4G6CA 1UUQA 4IMCA 3LQGA 4JCMA 2JALA 1DWHM 2NQ5A 4X22A 1RLCL 5B80A 3RYSA 4NYUA 3C56A 3VABA 5HMEA 4W86A 4IUGA 1EL3A 1B57A 1R5YA 3RK8A 4XZHA 4QISA 1W1VA 4A6GA 4S3EA 4NJIA 3E0WA 2P1FA 1U33A 2UV8G 4Y8EA 4W8LA 3GHSA 2C71A 4WF7A 3G1RA 1YBQA 1D7FA 1Q7MA 1GZ1A 3JZUA 1IT0A 2BMBA 2WLZA 1EP1A 8RUCA 1UH3A 1MRAA 1GK8A 3VC6A 4HK6A 2UZ9A 2WZEA 4Q8MA 1WV2A 3RJXA 1EO5A 4KS0A 1OGGA 2Y7DA 3S5YA 3M0YA 4M3PA 3W1QA 1OCNA 4W7UA 1RZMA 1XH0A 4ZEPA 2PUZA 1GOMA 3P60A 5HUPA 1KXVA 3E96A 4CD8A 3MSGA 1XQLA 1W1PA 1J0YA 2WKJA 1IT7A 1PDYA 4V15A 4IXXA 3TLLA 3B97A 3WFAA 3B8WA 3S0CA 5I06A 4GXMA 5G2HA 3QN3A 4Z2KA 2P10A 3GG8A 3DC0A 1REQA 4L1GA 2ZC8A 1VH7A 3VPLA 1IWBA 4Z0JA 1IT8A 3HOJA 1XYLA 3BV4A 4LXFA 1R2TA 3W6MA 1JJKA 2CKRA 1D3HA 5ABTA 2WMIA 1K9FA 2OU4A 2VDGA 2DUAA 3SECA 5IDIA 5I3JA 1YPFA 5CZJA 3TP4A 4ZL1A 1GHSA 1VJSA 2YFOA 4Q33A 1B30A 2Q6ZA 3HFYA 3FV9A 4UTLA 2QDEA 4C6MA 3G3DA 3WUBA 1SGJA 3TVAA 4X0VA 1XCWA 3VFCA 1ZTVA 4ZTXA 2J47A 4QEHA 1B4EA 2ZXAA 3I7RA 3T4WA 4NZJA 3GXDA 4HA4A 3G22A 4PYSA 3CZEA 2XH0A 4PULA 4Z42C 1T8QA 3CS2A 1P0NA 3AISA 1W3IA 3WQDA 3BAWA 4QCFA 2XH2A 4XD4A 5AHEA 4KWUA 1ME9A 3B9OA 3UJRA 4EAMA 3ZR4A 4R33A 3EEGA 4DN1A 2PLKA 1K9DA 1OGSA 3M0ZA 5DRCA 4J35A 3OJGA 4AF0A 2FPVA 6CGTA 4L6HA 5E9AA 1PEZA 3CL6A 3W29A 3ABXA 4TXEA 1FHUA 3BAIA 3E2VA 3MKCA 1OHLA 4RL3A 4LVFA 2C0HA 2AAMA 3RN6A 4JTTA 2P8BA 2WHLA 5FCZA 4K68A 3CHEA 3ZVHA 1A3XA 3NZQA 1EZWA 5LSMA 2I1OA 2REQA 4O10A 3K30A 1Q6OA 2ZOXA 1UP0A 2V2DA 5AECA 4AWUA 1ONEA 2XWDA 3DFTA 3I4KA 4CQDA 2P0IA 2BZNA 4AH7A 4PCTA 2AGTA 2EG6A 4DJFD 7ENLA 3EA1A 2FH8A 2DZPA 2GJRA 5D9NA 1AD1A 1TMHA 3MMWA 3ITXA 4O57A 3SBFA 3IGHX 4JR5A 3STEA 4LAMA 2PZ0A 1FHLA 3AHTA 4N02A 4F3HA 3WK2A 1F9CA 2WMGA 3WDHA 3FJNA 1T8XA 3TYDA 5CZTA 1UJPA 1TPEA 2ACSA 3PJXA 3MSRA 1JAEA 4FOKA 3TYUA 1W9VA 5I24A 5HQMA 3E74A 1JG9A 4X0NA 4L4LA 4PMXA 1E3ZA 4IPJA 4JYEA 4NJHA 3RHGA 2Y5JA 3WEMA 1L6GA 1V77A 2CBUA 1EWEA 3LHZA 1NP2A 4EWJA 2YL5A 2J7DA 5IDZA 1QI4A 1ENUA 4LC6A 3LI1A 1EWDA 3EBVA 3CLMA 1BHGA 1K6AA 1BGGA 1M9HA 4F8XA 3C61A 3LZ5A 3OP2A 4LEFA 1C90A 3DUGA 4WCJA 5A6MA 2VNCA 1Z6KA 3TX9A 2FTWA 4DJFA 4NZ4A 3P67A 2D1ZA 1AH3A 2UWFA 5LHFA 1P5BA 1BKHA 3HV9A 3WYZA 3TTOA 3CPGA 3EB3A 2YIHA 3BC9A 3FJ6A 4MY8A 1TPUA 4OZOA 3LTSA 2I56A 3SUSA 3B03A 3NO3A 1C93A 2WO5A 3NOEA 3DHUA 1QNQA 4O1EA 3GC5A 3TW9A 3CHVA 4GISA 1OM0A 3HJZA 3VKDA 4Q8UA 2DH3A 3NL3A 3EX3A 3FXGA 1Z9AA 4MWAE 2VEFA 4GKTA 3HFTA 4HNCA 3H2NA 3B9DA 3NAVA 5CC3A 5I23A 1E0WA 1US3A 1A5NC 3N3TA 3OIXA 2PC4A 2XHYA 4N9BA 4M19A 3WMSA 4IIGA 1XRTA 4P61A 3U57A 3QBUA 3GH5A 2PTXA 3L4VA 3GG0A 1BF2A 5PTDA 1V51A 4ZODA 4BA0A 4JEJA 4S2CA 4LV4A 2DJXA 3E0VA 1MW1A 3QV6A 1MNSA 2V6AA 3H26A 5E0KA 4R53A 3DXIA 3THUA 3O16A 1QK2A 2E8YA 3SY5A 1UHVA 1QMLA 4LT9A 5JMUA 1IR1A 3B4YA 2PCQA 1RK5A 4MUZA 5A5WA 1P0BA 3EX4A 1KM4A 4BI6A 3KL3A 4EOUA 2Z4GA 1E1FA 4JS3A 2QUMA 4KEVA 4ZO7A 3OO2A 3GU1A 3SI9A 4BQ2A 3ZJ7A 4BWLC 4XD5A 3WF1A 5D9PA 4PMRA 3ARZA 3IUIA 4GY0A 4S3CA 1FA2A 4O4WA 3NJ3A 8CGTA 2O4QA 3QMRA 3TTYA 2ANUA 3BLKA 1J4EA 2QVHA 3O06A 2PRMA 4LU0A 3TKFA 3RM9A 3UA3A 4DVOA 4RCXA 3VIIA 3J7HA 3DFOA 1YKWA 1I2QA 4QG9A 1O5KA 3L5MA 2DUZA 2OPJA