3BSHA

Barley alpha-amylase isozyme 1 (amy1) double mutant y105a/y380a in complex with inhibitor acarbose
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
404
structure length
404
Chain Sequence
HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIACIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGSRADVGAVIPAGFVTSAHGNDYAVWEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-amylase type A isozyme
publication title Multi-site substrate binding and interplay in barley alpha-amylase 1
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
total genus 127
structure length 404
sequence length 404
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bshA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bshA01
2WC4A 2GUYA 1BG9A 2RGMA 4XX6A 4GXPA 2FYVA 1ISVA 2PBGA 2E9BA 4J3XA 4GI8A 2E8YA 4GQRA 4WKHA 3VD5A 4V27A 3OZOA 4MNKA 4DUVA 4C7GA 4D6EA 4CVUA 4JCMA 3O9NA 3KL5A 3WFZA 1NWRA 2WZHA 5ABGA 3N1AA 4D1IA 1E4MM 4UFKA 1VB9A 4H8VA 4UZUA 3WF0A 2DSKA 1JYNA 1G01A 1WNOA 2VOTA 3IAPA 1H5VA 2V3EA 2WBKA 4X9YA 2J7BA 1V08A 1JXJA 4QCEA 3DX0A 3PZ9A 2G8ZA 1G94A 3OLGA 2YBUA 2EPNA 2EO7A 1JDCA 3WQ5A 2WMGA 5IDIA 1R34A 3AIWA 3H53A 4FNTA 1C8XA 1EOKA 1HL8A 3GH4A 4UFMA 3VGFA 1HP5A 3DYMA 4H04A 1TZ7A 3AHZA 1HVXA 1ESWA 1UQZA 4D6HA 3IJ8A 1CBGA 1B30A 1XH1A 3RILA 3BAYA 2EPKX 4XZBA 3T09A 4AD2A 4DUXA 1MW0A 4D6FA 2DDXA 2XUCA 5DT5A 4DUWA 2CPUA 5EMYA 1JZ7A 3AOFA 1E5JA 3THDA 1KWKA 1NWUA 5DMYA 3A3HA 4UOJA 4X0NA 1XSKA 3QHOA 4M24A 1JAKA 2VZOA 1J18A 1DWAM 1KBBA 2ZXAA 4QCFA 3GXTA 1OSEA 2WANA 1US2A 2JE8A 2PWFA 2OW7A 4X0VA 3KL0A 1HJSA 6CGTA 4EKJA 3AMKA 1JNEA 5BXRA 1C7SA 4ZE4A 3PZTA 1BVNP 3VIOA 3CPUA 2D24A 4FK9A 3H54A 1FH7A 2E40A 2CHOA 2CCRA 3RM8A 4PMDA 3CMJA 1V3HA 5D9MA 4HA3A 2JEQA 2ESCA 4BCEA 5FL0A 2XG9A 2YDRA 3SCWA 3DX4A 2CBVA 3SUUA 3EMZA 3BC9A 2BY1A 3ZIZA 1ITXA 3ZT6A 3S6TA 2YL6A 3KL3A 3QR3A 1KTBA 3LPOA 5FIPA 4NXKA 4JFSA 1OD8A 4JKKA 4CD8A 3U7BA 1GVYA 2QV4A 1RP9A 2J7HA 1FP9A 1BQCA 2XN2A 4WK9A 2C0HA 3PTMA 5HXMA 3AS3A 5I3DA 9CGTA 1XYZA 3BLKA 5C71A 1WAWA 2EJ1A 3VGDA 5TD4A 3WY2A 2CETA 1GHRA 5A2CA 4L4PA 4A3HA 2WK2A 5M17A 2ZXBA 2VVNA 2WYSA 2OWCA 4AD5A 1UWQA 2C7FA 1CXHA 4KRUA 3WNOA 2DSWA 2VJXA 1MW1A 1GOIA 1WPCA 1GPFA 3WD3A 1UWRA 2J8FA 1WP6A 2D2OA 2O92A 2E9MA 4DWSA 4B9YA 4CGTA 3NIYA 1B31A 1CGYA 1CGTA 3MO4A 1EDQA 2VCAA 3TTYA 3WEMA 2VZTA 1FH9A 3VGBA 4TX8A 3WDRA 4HOXA 2W61A 3AZRA 3OGRA 2EPLX 1VEMA 4LQ1A 1HJXA 1UR8A 2ZOXA 4MPKA 2X0HA 3ARWA 4PMRA 2YL9A 4CCEA 2F7PA 2VZUA 1GQLA 4DWSB 5CPTA 4M80A 5I5RA 1DWGM 3DHPA 1FOBA 3GXIA 4OJYA 1UD3A 1HF6A 1XV8A 1K9DA 2TAAA 4L4OA 2XGIA 3WUBA 2CKSA 2WC3A 4C7FA 4A4AA 3MV01 1QBBA 2YFOA 3ARUA 1E0WA 3VIMA 1NOUA 3WL0A 3AISA 1E5NA 1GHSA 2EPMX 2ZIDA 2GJXA 2EPOA 2XVLA 4PCTA 1MFUA 3L4ZA 1V6WA 3L4WA 5A6MA 1H0GA 1AVAA 1PEZA 2XIIA 2IUZA 3GXNA 4C7DA 2BY3A 3BGAA 4UTFA 1C8QA 3BVTA 3ZR5A 4S3KA 4XZWA 1QHPA 1KQZA 1SR0A 5CG0A 4GIAA 2GJRA 1WZLA 4BS0A 2W67A 1CLVA 4MB1A 3G6LA 3VNZA 1WDPA 1OD0A 1W2VA 4MDOA 1IZJA 1ISXA 1VENA 4YN5A 4AIUA 1HN1A 2GJXB 4PSRA 2PC8A 4BQ4A 4YPJA 2VUYA 1HKJA 5EFFA 5GPRA 3AHTA 2WSKA 1VBRA 4IM4A 2CEQA 5LYRA 3CUGA 3QHMA 1LJYA 3D52A 4UFIA 2YA1A 2WLYA 3DECA 1UWSA 4CD6A 1KXTA 4W7WA 1SMAA 4GQQA 1E0VA 1Y7VA 2JF6A 3SCOA 1E70M 1OGGA 4NRRA 1CPUA 4E2OA 6A3HA 3D5HA 1DEDA 1TVNA 3L4TA 1H2JA 2ZUSA 3WDQA 1C91A 3SUTA 4U3CA 2WMFA 3CZGA 2FHFA 3A23A 4NF7A 3LRKA 5A6LA 3CO4A 5A6SA 1C92A 3PZVA 5E0CA 1MQPA 3CIVA 4LXFA 3SCSA 2Y24A 1PZ2A 3SIMA 2YDSA 3CH9A 1O6IA 2ZXDA 3FW6A 4MB3A 4P7LA 3VIKA 1U2YA 1B3WA 1JXKA 3AROA 5D4YA 3EJQA 4WKFA 1OCQA 3K8MA 2NW0A 1H1NA 1E71M 1YQ2A 4D6CA 3LPFA 1WDSA 1J12A 4S3JA 2YLLA 4F8XA 3EDFA 3WH9A 1QW9A 3CHFA 4CVWA 2XYLA 2FGLA 4U2ZA 4PMUA 4AD1A 2WW5A 3OA5A 3ARPA 4Z2KA 2YL5A 4GO8A 1UH4A 2XWEA 3ZM8A 4FNSA 1QW8A 3CHCA 5JBFA 2ZWZA 4J3WA 2BXYA 4FNRA 1FH8A 5IFPA 3F5KA 1M03A 1C8YA 1E73M 4JFVA 5BXSA 2YDQA 3WQWA 3UR7A 3PN8A 4NX0A 3IGUA 2OYMA 4RE2A 3N04A 3W6LA 1W9UA 1GQIA 2GDUA 4JFUA 4AYGA 1P6WA 7TAAA 3LMYA 3D4ZA 3WF4A 3WNNA 2E8ZA 1OINA 1BSIA 4P8VA 1PIGA 3VIJA 4A3YA 4GI9A 1J01A 4UQ9A 3SUVA 2ZX5A 1E4LA 2VNCA 1GVIA 2NT1A 1PPIA 3WL1A 3GBEA 1EXPA 4PMZA 4QLLA 1QI3A 1TQSA 1EIBA 3SCQA 2WVUA 4BF7A 3IK2A 1GOMA 4M29A 1KXVA 1BAGA 4CN4A 2BV9A 4HMEA 4DO4A 4CCDA 1ODUA 1TQTA 3RJYA 1UD2A 3ARYA 4H8HA 4PMXA 3ZJ8A 2XM1A 4MADA 1LL6A 3E1F1 3APGA 4UFJA 1Z32X 4HU0A 5EBAA 1PX3A 3WNPA 4EANA 2XPKA 4W5ZA 4FNQA 1QNRA 1GW1A 1BGAA 2D20A 4AD0A 4PMQA 2YL8A 4CCCA 3BSGA 2IXVA 2CNCA 3I3EA 3B9EA 1MQRA 1GONA 4OKDA 3VD3A 5A8NA 2D0HA 5FL1A 4PSPA 3VTRA 2VVSA 5A1AA 1L0PA 3GYCA 1H49A 1ODZA 2CHNA 1L8NA 4P7QA 2F18A 4MAVA 4IPNB 3LXCA 4H8UA 4B9ZA 1IV8A 4FNPA 2PWEA 2OYLA 1D7FA 1QHZA 5EFDA 1NWSA 1XCWA 2VURA 1WZKA 3MSGA 3TP4A 3L4XA 1R87A 1QWNA 1W9XA 2CXGA 2J7GA 2W63A 3OB8A 2Q8XA 1KTCA 1UWUA 3BAWA 1WE5A 3EMCA 5CLWA 3AICA 2WSPA 4JAWA 5A8OA 1OWQA 1BPLB 2Y5EA 5LA2A 1ZS2A 2VZSA 3WF3A 3VDHA 4R5EA 2G3JA 2IGTA 3BVVA 4TTUA 4JZ5A 4WF7A 2X2HA 3VIFA 4UOZA 3U5YA 2GFTA 3IAQA 3IANA 2J79A 3EDEA 1TQWA 1F4HA 4E4PA 1QWUA 3BVXA 3WMCA 3N15A 1HJUA 2VL4A 3OIHA 2W5FA 4CU8A 4U3AA 5I2UA 3B9DA 2PWDA 3EDDA 3EDKA 5CZKA 2XVNA 4E8DA 4Z2LA 5JBDA 2CERA 1B0IA 3VMOA 3PZGA 3SCTA 4OBRA 3L2MA 1O7AA 2BS9A 2BVDA 1GOQA 2VX7A 2D3NA 5ECUA 4LYQA 4AZ5A 1I1XA 3RPMA 1ZB5A 3AS1A 4PUEA 1MQQA 3ALGA 4HP5A 1NQ6A 1W3KA 1UHVA 5I79A 3AMLA 1NM9A 3CTTA 1AMYA 2XSBA 4WKAA 1V6YA 1KGWA 4DM1A 1J0HA 3VGEA 1DWHM 4UQBA 1UWTA 4HPGA 4HTYA 4V2XA 3PBGA 2CIPA 1W9PA 4QDMA 4AYSA 4W88A 3RJXA 4ACZA 2DIEA 2Y8KA 2X05A 1W1VA 1CTNA 4FF5A 1TVPA 1QVBA 2ALWA 3QOMA 2DH2A 3CZSA 3VOCA 3ZT5A 4W7UA 2XVKA 3RM4A 1M53A 3ZOAA 1FHLA 2EAEA 3OLIA 2OSWA 3VIHA 1XHGA 4U33A 2F8QA 3WDIA 4ACZB 5A6AA 2A3AA 4ML4A 1DWJM 4YHGA 1VJZA 3JUGA 3NSNA 1BVZA 3NDYA 2V3FA 3MI6A 1H41A 3AHVA 3AS2A 2VQTA 3WUGA 2V38A 1J0ZA 2CKRA 1US3A 3UR8A 2EADA 1V03A 4XV0A 2PI6A 5AC5A 2DPEA 1VIWA 4AIEA 1CLXA 3AHYA 2VQUA 3A21A 5A6KA 3W26A 3MMDA 8CGTA 2PBOA 1PJ9A 2F2HA 1B3XA 1HP4A 4HA1A 5M03A 1QNSA 4FMVA 1DHKA 2CYGA 1UD4A 2X8RA 3OLDA 4CN1A 3UG4A 2WVTA 2BFGA 5DFAA 3AMCA 4PTWA 4AXNA 4OZOA 1HKKA 2WCSA 4LYRA 1HT6A 5E6ZA 3VO0A 1G1YA 1D3CA 1V0NA 3I3BA 2JEPA 3SCNA 3AYRA 4ACYA 2WHLA 5IFTA 1W3JA 1DTUA 1V02A 3SURA 2V5CA 2CITA 3NCOA 3AYSA 1W32A 1H09A 1LWHA 1E6SM 1O7DC 2WHJA 2BHUA 1V0LA 3L4UA 3AFBA 3VMNA 2CESA 1CGWA 1CGXA 1WO2A 2PWHA 1XYFA 3N11A 4KMQA 3TV8A 1KQYA 3W6MA 4HA4A 4TOQA 2OSYA 3BSHA 1TUXA 3WSUA 4TVCA 1CZ1A 3ZO9A 5I23A 3D51A 4MAZA 1PX8A 3VDBA 3BMWA 2ZUTA 3WFLA 1EH9A 3W82A 4AZ6A 3AIEA 4RE3A 3L4VA 1JD9A 3W27A 1W1TA 1XSJA 3UCQA 2WNWA 4PBGA 2JF7A 4PMYA 1E1FA 1JNDA 3OBAA 1W3LA 3EJPA 1E40A 5E9AA 1R7OA 1WDQA 1W9BM 4F79A 2GSJA 3UETA 1XC6A 1E6RA 1JDDA 4UOQA 1UG6A 1UR2A 3GH5A 4TVUA 3W25A 1GJWA 1EO7A 1LF1A 3EJSA 4D6JA 2ZUNA 4N42A 3PZQA 2A3BA 4MTVA 1MWOA 1KBKA 5DEZA 4AY1A 3L2LA 3WY1A 4JHZA 2FH8A 1PS3A 3GDBA 2XWDA 1V3IA 5CGMA 2WXDM 3VIIA 5CPSA 2VRKA 4AW7A 3AZTA 1TQUA 1VBUA 3T2QA 4DO6A 1E9LA 3VNYA 2D23A 3VD9A 2F7QA 3VDCA 1F4AA 3II1A 3PZNA 2ZICA 5BCAA 3FXYA 2J4GA 3ZMRA 2VMFA 3ZJ7A 3UG3A 2BVYA 3ARSA 1J11A 1TMQA 1X6LA 2CBIA 4M1RA 4DO5A 5A8MA 2GK1A 4AD4A 4HOZA 3MUY1 2QPUA 2EQDA 4NZFA 5I24A 1BGGA 3W53A 2WAGA 3POCA 2G3NA 3FAXA 4B16A 1MW3A 4UQCA 4GKLA 5GQBA 3WNKA 4AMWA 1IZKA 2FE0A 3CZKA 3FHAA 4TX6A 4AEFA 1UZ4A 5LA1A 2W91A 3WQVA 3N9KA 1N82A 6TAAA 3VU2A 1R33A 3VIPA 2FHBA 2GK1B 1QBAA 4W5UA 5CSYA 3T2PA 3EYPA 4ZENA 5LA0A 2XTKA 2WMJA 3VILA 1OIMA 3EJUA 4Y7EA 3VINA 2J77A 3WD0A 5D9OA 4AZGA 5JBEA 5GNXA 2EXOA 3CZNA 1QNPA 1CXLA 2UY4A 1SMDA 2JIWA 1HJQA 1KCLA 2RGLA 5AY7A 2FHCA 4FLQA 4PMNA 4TTGA 1KCKA 1JZ5A 4PMVA 4AIOA 2YA0A 2YJQA 2XVGA 1NOFA 4V28A 4EK7A 3AQUA 1ZBVA 4U5IA 3BVWA 1UWIA 2XJ7A 3KE0A 2MANA 1TE1A 3CZLA 3TTOA 1JZ2A 2EABA 3HN3A 2XIBA 3K4AA 3GBDA 4J3TA 1H0IA 1R8LA 2DGAA 3HG2A 4LPCA 4FLRA 1QI0A 2WBGA 1QI5A 2WHKA 2DH3A 4ZFMA 2YKKA 2X0YA 4P8WA 2QHAA 3EBVA 5ABEA 4CD5A 3WY3A 4GINA 3CMGA 3ZSTA 2WLZA 4PTVA 1QI2A 3AIBA 2BY2A 3LPGA 1M04A 2BNJA 3EDJA 1HWWA 1UOKA 1ITCA 1GOWA 1WDRA 2O9TA 2BVTA 2F1BA 4ATLA 1OGSA 5IHRA 3BUIA 7A3HA 2XN1A 2ZE0A 1B2YA 3TONA 2WWDA 2XHYA 1UR1A 2ZUVA 1Q6DA 2PF0A 2UY2A 4J28A 1WZAA 1DWIM 4CN6A 3BH4A 4D6IA 1VFOA 4JFTA 5A8PA 4OOUA 7CGTA 2VRQA 1U30A 4FNUA 4LGXA 2QMKA 5BXPA 2YLAA 3WMSA 3AIUA 4XB3A 4KGJA 2J74A 3PZMA 1RP8A 5CSUA 5DF0A 3A6OA 4F66A 3D4YA 2VT0A 1JZ8A 1UUQA 4HZ7A 1V3MA 3BCFA 3RCNA 3K46A 2X09A 2G41A 1EQCA 5E1QA 4AISA 1XRVA 3WNLA 3W38A 4JFWA 1OM0A 3A4XA 4B15A 1JYVA 3UG5A 1RD6A 4MB4A 3WBEA 4TXEA 4WLCA 2Y4SA 3N13A 5I78A 4YHEA 1QI4A 3U7VA 2F61A 3HG4A 3SCPA 2VZVA 3KLLA 1LWJA 1KGUA 5A69A 4PYSA 4QP0A 4D72A 1CXKA 4WJXA 1ZL1A 2G3MA 1CWYA 3D3AA 5E70A 1JI2A 4GO9A 2AAAA 1JL8A 4PMOA 1E4NA 1JAEA 4J3SA 1HX0A 3OGVA 2X1IA 3CZ8A 4W86A 4MNLA 4PRWA 5CLTA 3TOPA 3CUFA 5AYBA 2VCCA 4W84A 4W8BA 1D2KA 3GNOA 5BRPA 3AXIA 3CBWA 3A4WA 1H3GA 1G0CA 3NYDA 5I0DA 2J75A 5I77A 3WEOA 1VFUA 1KB3A 3VSUA 3LX9A 2O9PA 1CECA 1LL7A 2OWWA 3TA9A 1UZ1A 3HG3A 1KWGA 3CZJA 3WBAA 1K9EA 1JYXA 4PCSA 2CBUA 5FOOA 5E6YA 2FH6A 3EJTA 1UD5A 1UKPA 1HKMA 2D0GA 2VO5A 4H2CA 1K9FA 4TUFA 2F7RA 1JZ3A 4E8CA 3EMQA 1SFSA 3CGTA 2GVYA 3SUSA 1MXGA 1WCGA 3NSMA 5M5DA 3VPLA 2YIHA 1S46A 1J0IA 4M81A 3BUBA 1JI1A 4QAWA 2JALA 1AQHA 4ATWA 1YHTA 2BHZA 2D1ZA 1GJUA 3M07A 4HZ6A 2OW6A 1JFXA 2FGZA 2XSAA 2F7OA 2E9LA 4OUEA 1ISZA 3G6MA 1C3FA 5E09A 1Q6FA 3ZT7A 2WMKA 3WQ4A 3WD2A 3U5UA 4PEEA 1FHDA 1TA3A 1PAMA 1GOOA 1ISYA 3K8LA 4RL3A 3M6DA 1OB0A 2DSUA 3W29A 1UR4A 2WVSA 3ZJKA 2VCBA 5BWFA 3WDPP 3GNPA 5HOSA 4KWUA 4EE9A 1HVQA 3S5ZA 5BXTA 4U31A 3VSTA 4IUGA 3FY1A 2XVPA 1XH2A 4NXSA 1TR1A 2J7DA 1X6NA 4UNIA 1TA3B 1UA3A 4F9JA 1XCXA 5CJ5A 1UASA 3FNDA 2NSXA 2VC9A 2EACA 1GNXA 1ZBCA 4LX4A 3T0AA 3DX1A 1W9DM 1LG2A 1OIFA 4BQ3A 2J25A 5FKYA 4J7RA 3AXHA 3AIQA 3N12A 4UCFA 4WSJA 5AC4A 3DHUA 8A3HA 4CUCA 4UQEA 2V5DA 2GJPA 3N17A 3VM7A 3S5YA 5ABHA 5D8WA 3WDHA 1E43A 4AZ7A 3MS8A 2HVMA 3CUHA 1B3VA 3EJRA 4JKMA 5D9NA 3FHQA 1GOKA 3ARRA 2UWFA 3GXFA 4QLKA 2DIJA 4AZIA 3LXBA 1MFVA 3A22A 3B9AA 4QLJA 4NI3A 4LYPA 3BUPA 3W0KA 3HZ3A 3MUZ1 5D9PA 1FFQA 1C93A 3MUAA 2GDVA 3KWXA 1V0KA 2J7CA 3O2LA 3WQ6A 3RDKA 2ZUWA 2A3HA 4OOZA 5HPCA 1CYGA 3GXDA 4EAMA 4HU8A 2CBJA 1VEPA 2DEPA 4JIEA 3K1DA 1UR0A 3CV5A 4HOWA 1BFNA 1LQ0A 2J7EA 4DM2A 1RPKA 1MW2A 4P7RA 4W8LA 2ZXQA 2YBTA 2J7FA 3S2CA 2X2IA 4D71A 1BLIA 1EO5A 1E6NA 4KH2A 4UFHA 4Q22A 3K8KA 3OG2A 3BAJA 1I75A 3K4DA 3ARXA 3VGHA 2J8GA 3WY4A 4AMXA 1ZU8A 3O6AA 2Z1SA 4H7VA 4JL1A 5ABFA 1TG7A 1MYRA 2ZUUA 1QX1A 3GM8A 3IJ9A 3WD4A 5C70A 3BXWA 1XD0A 2J78A 1W3HA 2WZIA 3FAWA 1E1EA 5KEZA 1WZMA 1UH2A 1KR1A 5A6BD 3GTNA 2ZX8A 4GPNA 1ZBWA 4URIA 3RMEA 1HKIA 3F5JA 1OGBA 4NRSA 4BA0A 3UEQA 5HPOA 5JIWA 3AMGA 2A3EA 3VSVA 2OWXA 2NT0A 1R75A 3M46A 5ABFB 4CKQA 3ARVA 1VF8A 4M82A 1JFHA 2AMGA 4RE4A 1NWTA 4W8AA 3BVUA 1CENA 4B3LA 3VM5A 3VIGA 2D0FA 2YA2A 4WSKA 3SUWA 5A8QA 1E72M 4IISA 4PTXA 3L4YA 1PIFA 4AZBA 2ZX7A 4Q7NA 1LL4A 5KZ6A 3HMCA 3A47A 2WHMA 3LRLA 4NZCA 4DWSC 1JF5A 3CHDA 1Q4NX 2W4XA 2WPGA 3MMWA 4P7NA 1GZJA 3T0DA 5EB8A 1AQ0A 3T2OA 2XGBA 3BLBA 2UY3A 1BHGA 1E0XA 1NH6A 3VVGA 1UKQA 2QMJA 3RIKA 1W2PA 4ATDA 5E0FA 1ECEA 2YFNA 3A5VA 1Q6GA 5JUVA 1V3KA 2DSZA 1PBGA 3OLEA 3CC1A 1QHOA 1QPKA 4UQDA 3AHXA 2WMHA 1A47A 1E15A 2OYKA 4CU6A 1B90A 1BG4A 5D8ZA 1VAHA 2E4TA 2E0PA 1ZBKA 2FDMA 2VX5A 5CPQA 1VJSA 2WWCA 2F1AA 1RH9A 4MNMA 3SCUA 3T0BA 1HXKA 3BAKA 3H55A 2VX6A 2PB1A 3WQ8A 3ECQA 3B8SA 4XUYA 1UD8A 3KEHA 1V02E 2VX4A 1E6XM 1AQMA 1BTCA 3BAXA 5HNNA 2C8NA 3SCVA 3HG5A 4IPLA 1E6PA 1B9ZA 1J10A 3GZAA 1GQKA 1GORA 1Q6CA 2G3IA 2W62A 5M3WA 1TQVA 2D3LA 4U2YA 4PUDA 4J3VA 1HNYA 3WH7A 2EEXA 4PN2A 1R47A 4ZXLA 4UFLA 5BROA 1B1YA 5BYWA 1JD7A 1KXQA 1R7AA 3PTQA 2XM2A 4HZ8A 5IHSA 2EBNA 1QOXA 3AI0A 4Z2HA 4ZEPA 1W1PA 2WKLA 4HPHA 3WUFA 5A3HA 1PZ3A 5A95A 3FN9A 2VR4A 3ZR6A 3WENA 4OBSA 1UKTA 3PZIA 3WIJA 1C90A 4AMCA 1XGZA 2DT0A 1VRXA 3AS0A 3CHEA 3GH7A 1KGXA 4J27A 1BYDA 2B31A 1TCMA 1VEOA 1GCYA 5IXEA 2D22A 3NDZA 1J0JA 1UD6A 1H11A 3ARTA 2X2YA 2XFYA 5I6SA 1HXJA 1JZ4A 3U57A 1A3HA 3A4AA 4AZCA 1LLOA 4HMDA 4AZHA 2WM0A 4BQ2A 4CD7A 3OZPA 4CD4A 3DDFA 4TVDA 4JKLA 1XH0A 1CDGA 4U5KA 1EOMA 2V3DA 1VFMA 2BXZA 1DP0A 2W66A 1M7XA 1UKSA 1SZNA 2DT2A 5A94A 2VR5A 2VRJA 3CLWA 3VGGA 1IT0A 4JCLA 1GQJA 1CXFA 1E3ZA 3WH6A 1WB0A 3RM9A 1HJVA 4GZEA 3DX3A 1JYWA 4AZCB 1V6UA 1G9HA 4OGZA 3WF2A 1KXHA 4Z2JA 4ZE5A 3WD1A 4CU7A 5FD0A 1B3YA 1SYTA 1E6ZA 1CGUA 1J0KA 3GXMA 3HU7A 3VX1A 3W81A 3AIRA 4GZIA 2YOCA 2BHYA 1FP8A 3DYOA 1M01A 2QF8A 3F4VA 3ZJ6A 1V3JA 3ARQA 1HJWA 2A3CA 1I1WA 3W37A 1V6VA 2WCAA 1HTYA 3HJEA 4BZYA 5AYIA 1W1YA 2VI0A 3W4RA 1XD1A 3QOKA 3T08A 1PX4A 3J7HA 3IJ7A 3BLPX 2BY0A 4JL2A 2ZX6A 1EQPA 1J9YA 3WH8A 1E55A 3QGVA 1JIBA 2DSVA 1QNOA 1C7TA 3DX2A 4NZJA 3ZSSA 2AOSA 3NJ3A 3OGSA 1OT1A 3BUQA 4M56A 3CZEA 3NSXA 1JZ6A 3MANA 4K68A 1R86A 3PZOA 4MB5A 3TTQA 2WCGA 4W7VA 1EDTA 3BAIA 2O9RA 1EHAA 1DWFM 2WKGA 1BF2A 5JIPA 1BYBA 2Y8VA 3VD4A 1JF6A 3UESA 5F7UA 1B3ZA 1K6AA 3TTSA 1BYAA 2OSXA 5BRQA 3GXPA 1TFVA 5GNZA 4DWSD 1HL9A 1UKOA 1UQYA 4HMCA 1G5AA 2DT1A 3MU7A 1VFFA 2WC7A 3VUPA 4Z2GA 2ZX9A 1LG1A 1WKYA 2Z1KA 2XFFA 3KLKA 4FLOA 1ZJBA 3ZQ9A 5HDRA 3MV11 1U33A 1OT2A 3BUDA 1ISWA 5CGTA 4P8UA 1MVYA 4H41A 1J0YA 3F5LA 3PTKA 2XFRA 4AD3A 1R85A 2DQXA 1CNVA 1E6QM 4MJ4A 1NOWA 2D73A 4QFUA 3WDJA 2PWGA 3SEPA 4F9DA 3CUJA 3I3DA 3WH5A 5A6BA 4W87A 5CXPA 2WZEA 1R46A 2Y2WA 4MNJA 4GZJA 3WEZA 3MKKA 4UQAA 3WF1A 2QLYA 2WB5A 3ALFA 1H4PA 4W85A 3QHNA 3BMVA 4D1JA 1FFRA 4FLSA 3PHAA 3DYPA 1V3LA 4J3UA 2JIEA 1T0OA 2X2JA 4UR9A 1EA9C 1ZJAA 3M7SA 4MJ2A 4N0RA 3VKKA 5DO8A 4AWEA 3N18A 3VDAA 5FCZA 3LPPA 3AJ7A 5A2BA 2J62A 1CIUA 4M8UA 3POHA 3THCA 5A2AA 3LRMA 3UERA 3SCRA 1HIZA 2ZUMA 3MUIA 2O9OA 4ZXOA 1E4IA 1EGZA 1UA7A 2WMIA 1EHNA 1W9VA 4Z2IA 5HBFA 1V6XA 1XSIA 4PTMA 4B3KA 2DT3A 1JG9A 1NARA 3WELA 3A24A 1NP0A 2ZWYA 1MXDA 2E3ZA 3PZUA 3AZSA 4AEEA 1CXEA 1GUVA 3WUEA 1BYCA 2UY5A 5A6JA 3WKZA 2W92A 2WMIB 2VTFA 4WIWA 2J47A 2HISA 1X1NA 4D6DA 4AC1X 2OLHA 4NSBA 3AXXA 1QNQA 5CQ1A 1NP2A 1CGVA 2WVVA 2QPSA 3MMUA 3D50A 3CUIA 3VD7A 3DC0A 3WNMA 4W93A 1W91A 1FA2A 1E56A 2V3GA 4BQ5A 1KFWA 1Q6EA 4D6GA 4P7OA 4UZSA 2IXUA 3VX0A 4P8XA 1V0MA 3AIVA 4KGLA 3DDGA 1JDAA 4GI6A 4JHOA 1K9TA 3WN6A 3WMBA 3W28A 1EDGA 3GNRA 1E3XA 3MSDA 3KZSA 4MDPA 2JFEX 1JGIA 3VMPA 3RO8A 2XN0A 5GNYA 3AMDA 1UR9A 5DT7A 4OIFA 3BCDA 4W89A 4KRTA 2WVVB 3LXAA 3ARZA 1UH3A 1UYQA 5C8BB 2G4FA 3NUKA 3W24A 1KR0A 1CEOA 4R27A 1OBAA 1CXIA
chains in the Genus database with same CATH superfamily
1YNYA 2GY7B 4GKZA 1EBGA 1A22B 5HI3C 4Y2OB 4EBQL 2PBGA 4HT3A 2DOCA 4HSQA 3DRQB 3UZYA 3E3QE 5DVOA 2QULA 3O4LD 4L4VD 5F88A 1S8DA 5CHNA 2NY1B 3TBTA 5CLZA 3ARBD 3N1AA 4L9DA 4OCXH 2CRYA 1U42A 5C2BH 2DUZA 4CBPA 2W6RA 3M1BB 5L4IA 4Z0JA 4OF6A 2WMGA 3WJMA 2XTLA 4N25A 2YB4A 3S34H 4HNLA 2CKBH 3AHZA 4M61B 2WWKO 4KCVA 4P2QE 1RMFH 3A6CH 3VXSD 1EVUA 4EXKA 3B34A 1IBYA 3QXBA 3MROB 5JW4R 4TNEA 3UJJL 3TN0B 2UX7A 3KR3L 4MA1B 4IICA 2NUYA 2ZXAA 1FAKT 1ZDSA 1HJSA 5IR1A 5HHNA 2YC1A 3N55A 5AVVB 4LCYA 3CH0A 1RUKH 4PMDA 3L6FA 2FEJA 3CFEA 3ERPA 1NDMB 2NXHA 1V54B 4AVIA 3FB6A 1P7TB 2DBJA 3PUEA 4ZUTB 5IQMA 3LLDA 3BPOB 1CDJA 2OLSA 3CX5J 1P9MA 3SQMA 2VEGA 2H0FA 4WWOA 1L7TL 2ADGB 1CFTA 4JFXA 1OTSD 2V5RA 2Z64C 5E6IA 3H7LA 2OWCA 1ZP4A 1K4DA 4H9TA 4LCWD 4UINH 3T0VA 2GCYA 3LZRA 2GT9A 1VEMA 3BL3A 2Y7DA 3GVRA 3MV8E 3FTGB 3QC6X 3RFAA 2YXGA 3BZFA 2APTA 1WBYB 5HGDA 5D1XA 1HHJB 3V4VL 1X5ZA 2VRAA 5ALCL 1T41A 2CZFA 1CDIA 1V77A 1WD9A 4M6OH 3EYFA 1BQGA 1Z89A 4X6DE 2EPMX 3RL1A 4LASL 3L4ZA 2PXYA 5HDWA 1AVAA 3LKQA 3GXNA 1EAPB 4C7DA 2BY3A 3F6JA 4JRXA 1SR0A 1IQDA 3VNZA 1UROA 5J7CC 5I07A 1OGTA 2GJXB 1IBFA 5I17A 1H6FA 4I3RL 2CEQA 3RU8X 1BYNA 4JHAL 5GS1A 1U92A 3MCG1 5AW6B 3DECA 2YAMA 1R3YA 4CD6A 2JF6A 2X4OA 3PQYD 5D96B 3TT3L 3EZ8A 2LHAA 2WY3B 4A2GA 2Z7WA 2QSCH 1F4WH 2DQCH 1EF3A 2AK4E 1VCFA 1KXQE 3LZPA 1H15B 1VZIA 3TC7A 1OGAD 3D39A 1KXTB 2C1GA 2J57A 2LABA 4DBSA 1FV1B 3TV3L 3NFNB 2C1PA 4WKZB 5KOVC 3AROA 2XPYA 2J5WA 5C0BA 4XCEA 3GD6A 3QE5A 2XYLA 4Y9EA 4F2ME 3NPUA 2FTYA 4F7KA 2MTAA 4BCXA 3PL6D 2FPYA 2IWEA 1QW8A 5D2LA 1DHPA 3B9KC 3KXFB 4ZR8A 2AABL 1OB1A 5HAOA 2YDQA 4Z7QF 4BJLA 1FWEC 4C56D 5G4HC 5AAWC 4P05A 4NKIL 2ERJC 3D05A 4MCMA 3O45B 3N2TA 2YD9A 4MVBD 2VYOA 1J01A 3GSMA 1JPSH 1EO8H 3W1RA 3LB6D 2NT1A 3O0KA 3GSRB 1PPIA 1DN2A 2P45B 3HUJA 4KJQC 2WLLA 1IFGA 3P9MA 2J9YA 3PJWA 2H90A 5LG1A 2YEVB 3BH8A 1LWRA 2VXQL 2XYCA 4B7LA 2IWGA 4PJFF 2XPKA 4Z95L 3WLHA 4AD0A 2CIKB 2Q71A 1S3RA 3DK0A 2Y89A 3U4KA 4LSQL 2IXVA 5LQBH 2F5AL 1J7VR 3VD3A 1FWWA 1CD0A 2GC4C 2GQ8A 1AQ8A 1AS8A 3MRLB 5E2UL 1ODZA 4PJEB 5GS3A 2VDOL 1W72A 5HHOA 3RX3A 4B9ZA 1I1AB 3VRJA 4DJFD 4PJCF 3WJXA 4QWWC 5HTSA 2F54D 1XQLA 2J7GA 3RNKB 4HALA 4XVSH 3EZJB 2NY6B 3VFVA 2F9BT 4KF1A 3MCMA 2IDFA 2P5WD 5TE6L 3VOHA 4ODTH 4Y1AE 5F7FA 2CO3A 3HZMB 4WNQA 3VIFA 5EC1A 3IANA 2J6XA 2KX9A 1I31A 1TE6A 2A5HA 1JHTB 3MCOA 3WMCA 4WTZA 2X6AA 2NZ1A 5I5MA 3ZZ1A 1B57A 3TA3A 2ZD0A 2AJ3A 3VE0B 2R1MA 1TRIA 3UYRH 4E8DA 4Z2LA 5JBDA 3QUML 5E08L 1T20B 4YFLF 3RR4A 2ZG3A 4IGBB 3MHFA 2HFFA 2XQYG 3TZFA 3V7PA 5KZMA 4BCZA 2NW3B 1TO4A 1G7LB 2MPAL 5ANMA 2WXIA 3TYUA 4LLYB 2XJKA 4PV8A 4FP8H 3E12A 4A2SA 1VQTA 3MBED 3MLVH 2WOBA 4YTQA 2SEBB 3PHQB 2REQB 4ONOA 1RQHA 1Y6NR 1WG3A 4AC7C 3X1EA 1M53A 4KFPA 4A66A 4LHUA 2PYEB 4N2AA 5E00B 4UWQB 4UMGA 2DPEA 4WTQA 1HZHH 3GK8H 3VYNA 1EP3A 3C9NB 4Y9FA 2GIYA 2WIIA 3WJSA 4DAIA 3PJSA 3T4AA 5E9DE 3QXVA 3C8KB 1HOCA 2DDQH 5AAPA 2FR4A 3NSCA 3UG4A 2YUWA 2V5YA 2BFGA 4ZQTA 4FZ8H 2CA3A 5IJKA 3VO0A 1S7RB 1D3CA 3STLB 1KACB 4YDJA 2Z24A 3QPYA 3AYSA 3SN0A 3G1XA 3PDOB 1K7EA 1JMXA 2UUDK 1I45A 5GZOD 3GMNB 4K3EL 3USBA 2BVOA 1SO4A 3BSHA 3WSUA 4RPQA 3QPKA 2BWIA 3P3RA 2Z28A 5TDOB 3D51A 4MAZA 3HI5L 4RE3A 4YAQA 5KVFE 4Z3GA 1QBLH 4LAJH 1PHQA 1D7KA 4LKCA 4YPGA 4LVGA 3UETA 2HKFH 4HKBB 1I0DA 5ITFA 3M0LA 4KO9A 4HYVA 5L8LB 2Z6JA 1NDGB 4V15A 2BCMA 2OK0L 4A7UA 5ID0B 2XKUA 2IFFL 2ZKHL 4BA8A 4NQEB 4ODBD 4DESA 1TVBB 3AT9A 1NMAH 3QR1A 3S35L 2G96A 5D7LA 3FXYA 4XNZB 5ISZA 3OGCA 1HCFX 1N0XL 3WIFB 1BZEA 4N9OB 4DO5A 2QQQA 3NZ8B 5IFHL 2WAGA 3HE7B 2QL1A 3CUPA 1FVDB 4R90L 4POUB 4JIIX 3OJDA 3ZTNH 3G6AB 4K73A 4AEFA 4PJIA 3L3KB 3MO1A 3ZMNA 1R33A 2FHBA 4W5UA 4HOMA 4X50A 4BINA 2WUBL 2XTKA 5FFLA 4U05A 3X3FH 1XIWB 1JGMA 2X1UA 1U3YA 1OANA 4IBQA 4N02A 2R69A 4XODA 2XDFA 4X6CF 1HJQA 4XB7A 4HIHB 4DGVL 3KLDA 3SE9H 3M44A 1HXMB 3W7EA 3B7YA 1AS7A 2Z25A 4AIOA 4O2CA 2R1WA 1GYCA 1RIUH 3CMOL 1IGIL 4U5IA 2EABA 3BEVB 3GBDA 4N2FA 1RSFA 5DCEA 4MMZA 3BWSA 5IHUL 3EH3B 1ONQA 3TNMB 4ZX3A 1L9SA 3SGDI 3ARBC 3JZ7A 1R9FA 3RWDB 2ZRYA 1UT1A 2TPSA 1B2YA 1EPFA 3E2HB 3DO7B 3K13A 2A85A 3CDZA 5E99L 1OAZH 3CDCA 4R7DB 5JPNB 3Q43A 4PUWA 1M42A 1A9EB 3WMSA 2YLAA 3GQFA 4XOEA 4R9HA 4LUJA 2ZXCA 3ARDB 4BGLA 4GACA 2WXKA 2XDHA 3GMOB 5DJDB 3MI3A 4OZHE 3WFBH 1FXQA 4UQ3A 1RD6A 1HIMH 2FGBA 3F12A 4QP0A 2IGFL 4PJDE 4O10A 3MREB 3IF1A 3SSZA 2OMTA 1MIML 2P8CA 3GZKA 4W86A 1UZ8B 5JPMC 1W3IA 2VCCA 4QGYA 3GNOA 5BRPA 4L05A 5I0DA 5FCUL 1VFUA 3KYKL 4ZFZB 1NGPL 3CQPA 3MZ2A 1RLBA 3NQCA 3IN0A 1HK6A 4W81A 1JYXA 2XWZA 3IJ6A 2WZPD 1YN6B 1WCGA 1OX6A 1TSRA 1OD9A 1FFNA 1A0DA 1H6TA 3QYNA 1J1XL 2IADB 3TU6A 4C4KT 4KMLB 1SY6H 1VCBC 3LVEA 3IFOB 1UQSA 2R0LH 4DEPC 4GAYA 5CUSH 2EDYA 2WVSA 1XZ0A 3MRMA 3GRWH 2W0UA 4KMTL 1HVQA 4RRPM 3VI3B 1JJUA 4ZFOA 1A7PL 3Q6GH 2XVPA 2AF2A 2X89A 3ZUCA 1UA3A 3MRRB 5DDHB 5CSZA 2VC9A 4J7RA 3T4CA 1YEEH 4PY7A 1UMLA 3VW3H 2V5DA 2W9EH 1TJXA 2HVNA 1SJVA 2G4JA 2AL2A 1W3NA 3BUPA 5LNRA 4DN4L 2JCCF 3VKDA 1BOGB 4Q52A 1DSFL 4X5WA 4R4ND 3C6LA 3GXDA 3PWLB 3CV5A 3EKLA 5IGXH 2HG5A 5ITBL 2AQVA 4QHPA 5HMSA 4X8XA 2CUAA 5GGRA 4U10A 1FDLH 3LGDA 3OG2A 3K4DA 2HQAA 1O9WA 2I9EA 2PLCA 2ZUUA 4W9TA 1VFBB 1EXUA 3I7QA 1P4BL 5F1SA 3BWAB 3KPQA 3OD3A 3L3IA 4BQ9A 3CAWA 3MLUH 1TB3A 2PO6B 3UROR 2VWTA 2DMBA 2Q3OA 1KIRB 1JFQL 1P7TA 1JDFA 1DVFD 3IMUA 4GY4A 4LLVB 4FTVE 4N7QA 3MP5A 1GS7A 4LSDA 5IHHA 2V9DA 4Y88A 1TJGL 3S2NA 1ASOA 3PL6C 4WWID 2DWXA 1KIUA 3NCMA 2Z4GA 1DQLH 2IH3B 4NQCD 5IMLA 3II2A 1TJIL 3JVGA 4MKTA 4XNYH 3DEQA 3ATEA 3CBRA 4YLCA 5MP6H 2E77A 2BOEX 1D2PA 1RUQH 1KBLA 4G8IA 1GIGL 2DVUA 4PWGA 2B15A 1AQKH 3LB6C 3W7QA 4UQDA 3CVHA 2WMHA 3QWRD 1NCIA 1BQLL 4H1LG 5KETA 2VERA 5FO7A 3ZLQC 3GS4A 4JBSA 2FDMA 4PG2C 5CPQA 1PYWB 1HXKA 1DN0B 4MXVE 3PK7A 4XUYA 4UYPA 5I26A 1FORH 3TSDA 5K39B 3SDXA 9XIAA 2AFNA 3I6KB 1YKWA 3C5ZA 1YIXA 3HG5A 4AYMC 2WWOA 1R0AL 3HNTH 1PNDA 3MCKB 5KZDA 3MVSA 4P9HC 4XPBL 3V4UH 3NR0A 3TYBA 1CN4A 2XM2A 5C07A 3NQFA 2YKLH 5AWNH 1D3GA 1W1PA 4F24A 2AQNA 6PAZA 5A95A 2H47C 5F97E 4Y2DA 3NCFB 2FAUA 3NJHA 5IOBA 4K2SA 1QO3A 1KT2B 4ADUA 1IEXA 3UJIL 2BNRE 2XC8A 1GCYA 4MCZA 4C8XA 3Q3GB 2XFYA 1L5GB 3W07A 4EI5D 2F6XA 4AZHA 4MA3B 2HMCA 5FSEC 3DDFA 1JCMP 5DMLA 4LOVA 1UWGH 3R0UA 5A94A 4NP7A 2HH0L 2EO9A 2D7TL 3GKWL 2JQAA 3ZFHA 1FO0L 2F5BH 1HQRA 4FQIL 2OQJA 2J3SA 1G0DA 5CJXC 2KKQA 4IFOA 3JWOH 1BFOA 1P6BA 3NEHA 5D2NA 3H26A 4RX0A 3ZE1E 2NX5B 3R0KA 3U2ZA 5AYIA 5D1ZB 3HB3B 2VHLA 4XXDB 1NFDE 3LH2H 1OC7A 2X88A 3OKLB 2Y62A 3LXUX 4WWKB 2COQA 4X5RA 3L0NA 4G72B 1PY9A 4NZJA 3DBPA 3MBEC 4A04A 4K68A 2HWGA 4Y9CA 3FKRA 4MB5A 3TTQA 1Y5VA 5GJTL 4X4XA 4MCYA 2O9RA 2V2TB 1Q1PA 1U3ZA 5BV7C 2A4ZA 1LYXA 3G04A 1LQ2A 4AEIH 3W9DB 4K8EA 1I2PA 2C1OB 1MSPA 1G5AA 1JF1A 4YLQT 3FDKA 2Y7GA 5F96H 1Z9PA 4UANA 4IRJA 1EUTA 2ZP9A 1HJBC 4N9GA 3EH2A 5KSVA 1G7IB 2A1WL 3NYZA 5DQ9B 4FNLH 3VNMA 4P8UA 5BRBA 1NKRA 1BLNB 3PUGA 3QS3A 4HF5H 4JDBA 3ULVF 4F9DA 4W87A 5FUCE 5DEFA 4XO5A 1KCUH 3WF1A 4PJ7E 1HDMB 4EN3B 2FB4H 2ZZUT 2O61A 3H9SD 4H0LC 4JPKL 5IQ7H 5GZOC 4UR9A 4BXSV 5HBBA 3CH1A 3DPBA 3DOHA 1GSMA 1RZ8B 1N26A 2BZDA 1BJMA 4MZ2A 2BRRL 5EO0B 1XGQB 2VDML 1L6PA 1T5KA 5IHBA 4NJAL 4YHYB 4EOWH 2IH1A 3WUWA 3DKHA 3RWIB 5ESVA 2HS8A 4IIDA 4Z2IA 4P5UA 2HZHA 2YPLD 4NNYA 2XQYA 1RZKH 4XPFH 4HLEA 4CA4A 2E3ZA 2OR2A 1R30A 3WFAA 4ZXBD 2W92A 1HW6A 3SKMB 1UWYA 1EZWA 4HYTB 4XB8A 3ZKQD 3D50A 4I2XE 1X6UA 1IEAA 1G9MH 1ZV5A 4P7OA 5D8JH 5EYWA 3V2AR 3VXRB 2WNGA 1KM3A 3PS6A 5TE7L 1XF3B 4PJ9B 1ZAIA 4F3HA 1IC4L 3P60A 1YJDH 4XWUA 2W38A 5AVHA 4G8AC 4P2RA 4QJ5B 4YCOA 3TA4D 4HS3A 1AGEB 3VFWA 5E0KA 1AHWC 1ZHNA 1GTEA 1P4UA 4YHKH 1RL1A 2FFIA 4L56A 3O0RH 3HC0A 4G3YL 4O8RA 4KVCL 2WZHA 2R56H 2ZP8A 3BCJA 2XETA 4GKZB 3EH1A 3E0FA 4OB5L 2FGWH 3GC5A 3ATZA 1EIXA 4G1NA 5M7QA 4E68A 1GJIA 1L6XA 5F88B 1S8DB 5CHNB 4LWWA 2YQ3A 3IEBA 4K5LA 3TBTB 1DLFL 4NOFA 2HX8A 4H9ZA 4MD5A 2Y5QA 1ZSXA 3UDWA 4Z7UA 4KNTA 2UY6A 3CU7A 2MOVA 3GHUA 3WJMB 1OCZB 5EMYA 2ZFAA 4HA0A 4QMEA 3JUYA 3E9AA 4IIGA 2WANA 3RVTC 1US2A 2JE8A 3NQ6A 3MBDA 3TSBA 3GI8H 4YSSA 5IMMA 4XVDA 4S3EA 2ADFL 4HA3A 2A6KA 1R1CA 1IIIA 1JV2A 2FBJL 4YCPA 3ZDXE 4QRRA 1VACA 3S36X 5IR1B 5HHNB 2RJMA 3QHFL 5FEXA 2YC1B 1KCXA 4LCYB 1EEZA 2BVEA 5D1QA 1PZCA 3JTBA 4JKKA 3L6FB 3DFHA 3CFEB 3SW6A 4YWIA 4ZODA 4XTDA 3FB6B 4MA8H 4GAJH 2X0UA 3R4IA 3W87A 3VAVA 5A5WA 4NX5A 5G4NA 4P06A 5M17A 2WYSA 4B60A 5C0EA 4MKVA 1H6UA 1UWRA 1LGVA 3W2KA 1WFMA 1X4XA 4H9YA 1CFTB 4JFXB 3C2EA 3K7UA 1I8LC 1FH9A 4TX8A 5E6IB 4PBWD 4KNSA 2EPLX 3DJTA 2PC4A 4O9HL 1FH5L 2P24A 1K4DB 3STFA 3KXQA 3HV8A 1FZKA 2AI0H 2B59A 4NI6A 1N8FA 2YL9A 4LAOA 4LL4A 4JREC 3IMBA 5AKTA 5C09A 2GCYB 4FSAA 3HV9A 1RZGA 1GRWA 2MSPA 2GT9B 5EBLA 4C7FA 3QIWD 4KITB 3ARUA 3QZPA 3SRDA 1L9PA 3WL0A 4KIEA 3T3PB 5F9OL 3BQ6A 4Y9OA 3HR6A 3FU6A 3QQWA 3HBPA 3BZFB 4PR5A 3L3KA 3PJXA 3ZKND 2AMUA 5HGDB 5D1XB 1KBJA 1BFVL 3IVTA 5MEND 4JE0A 2VMDA 1F73A 3EYFB 3NM1A 4EEEA 2XOTA 3RL1B 1IE4A 2VUYA 2PXYB 3LKQB 1F18A 1KSRA 4KWSA 5LNWA 5GS0L 4JRXB 3D52A 3GSNL 5I3HA 1UWSA 1IQDB 5T3ZL 1SMAA 3HF3A 1OGTB 2EP6A 2MTPA 5I17B 4DJMA 3ICJA 1LMKA 3QQ1A 4F9LA 1T1ZA 4XBSA 5GS1B 1U92B 1DOSA 1CL7L 3SUTA 1K6QL 4C91A 2IALA 2B2XL 4PUJA 3UTQA 3QRLA 3H3KA 2X4OB 3UVIA 2Y24A 3P93A 1QPQA 1UA6H 2XZCL 1I9JL 4LPUA 1KOAA 3D39B 5D7HA 7REQA 2OQYA 3PNRB 4R4NC 2FGLA 2RDTA 3VOJA 1F7BA 2C1PB 3PXJA 5LGKA 4LCRA 4UNLA 4GZ7A 1MWAA 4PB5A 2G0KA 2R4SH 4YSUA 1JGEA 5C0BB 4QYOA 1RK7A 4KUZL 4XCEB 1UM4H 4DK5A 1XLIA 4P46A 2BDQA 4C5YA 3FMGL 4UT9A 1OM9A 2WO4A 1S3HA 3CV7A 4JVWA 5D2LB 2WXGA 4JFUA 3RP1A 3MY9A 2Q8AH 1OB1B 4ALAH 3PJLA 3PWUA 1IKFH 3TKFA 5LCVH 1P5UC 5E6RB 3WQEA 4XBGA 4KRZA 1DVFC 3S3CB 5E93A 4S1SH 1RZFL 1VP5A 3TCEA 1AGFA 3FNKA 2J1XA 4AHPA 1VLWA 3H3PH 3MYOA 3TFXA 3G7TA 4YGVA 4XKMA 1PX3A 2BP5M 4HLJA 4EANA 3HUJB 2WLLB 3NQEA 3P9MB 3I3EA 2IADA 2PP9A 1NCDL 3BH8B 1JV5A 2Y1ZA 3Q05A 1HI6A 5LXGH 2P50A 3BLOA 3RX9A 3NIFF 3D4GA 5EFDA 4XISA 3LENA 1TKKA 1WZKA 3L4XA 4FA6A 5DUPL 2O5YL 2M1KA 4EDWL 3IPEA 2AKMA 3RDTA 3BWWA 1W72B 5HHOB 3FA5A 3VRJB 3S1UA 1U5VA 1XMWA 2I5IA 4Y16C 3VDHA 5CSSA 4LEOA 2G3JA 3OKOA 1U21A 5F6IC 5KYXA 3KXFD 1MVFA 3OPZH 4K5PA 3VFVB 3EDEA 3ZKSD 4WW1A 3BVXA 2GUUA 5I2UA 1E8ZA 3B9DA 3KNBA 4KTEL 4XK2A 4NYUA 2AJUH 2RR3A 4WNQB 5I15L 5EC1B 2D3NA 2ZYFA 3B0YA 5ILTH 2CZ5A 1I1XA 3T81A 3E8VA 5CJQL 2Q3XA 2HROA 5I79A 2K70A 2BNQA 3ZYJA 4N2GA 4N0YL 4EI5C 2AJ3B 3AUJA 2WLHA 5SV3A 3M16A 5F7DA 2HVJA 1HKLH 1RIVH 3IIZA 4ZD3H 1A65A 2GBAA 2HFFB 4W4OC 4LYKA 4YDVA 1MLCA 3WXVL 2QZ5A 3J27A 2BVUA 5ANMB 1A5NC 2CUMA 1HZLA 2E6PA 1C08A 1X8CA 4PV8B 2GSIA 5L9FA 1XBXA 2DQIH 1Z5YD 1ILUA 2Y7SA 5ANHA 4OKVA 1OAUH 4H1LA 4O15A 3QJQB 3VXUE 3LBCA 4A8RA 1KLYA 3B1UA 4LHUB 4DPQA 3P6LA 3S37X 1QNSA 3QUKB 4PTWA 1Z41A 3WEXA 1DJGA 3GMPA 3D46A 2WIIB 1CICD 1LUCA 3PJSB 3DDMA 3T4AB 1RK6A 5DVKA 2Z1PA 1EGJL 2NY6D 1SFTA 4HETA 4ZMQA 1LWHA 5EIQA 1HOCB 3W1NA 5DCCA 2FR4B 2VLJE 2A4CA 2HNHA 2ENPA 1HH6A 4FQ1L 5DD1L 3OHIA 2DQEL 3F65A 5C6TH 4YDJB 3ZO9A 3KX6A 2I5GA 1O5XA 2H2SD 3U4AA 4NAFA 2D3VA 1HL4A 1UJTA 3OBAA 2C6QA 4DPPA 4OM1H 2BVOB 5E51A 3HNSL 4MASA 4HPOH 1UR2A 1GJWA 1EO7A 4TQPA 2BSTB 3KBFA 1K6WA 4H20L 4YAQB 2VDGA 1MCHA 1OYCA 1I3RA 3OJ2C 1ZTVA 3RUGA 2PDMA 2PTDA 4KWOA 1Q9WA 4YPGB 4X4ZA 4B0MM 2OT0A 4JMNA 5DJXA 5ITFB 4XAKE 5TTRA 2YXOA 2GJJA 3PZNA 1L9WA 3ZJ7A 4F2TA 1UM5H 3R1GL 1BP3B 4IMDA 1CK0L 4ZB5A 3Q3GA 3DKJA 2BWGA 1PG7H 3IGKA 5D7LB 5DD5L 3I10A 2EXWD 5ISZB 2RA1A 3OGCB 3DMMA 2AHIA 1N82A 4ZXBC 3DBSA 3HMXL 2BFVL 3CUPB 2IOMA 3EJUA 4PJAA 1R3JA 3OJDB 4G5AA 2P8LA 4X63A 4PJIB 4XAZA 1PVNA 2EEBA 1E6JH 3MO1B 1H8LA 5FEWA 5EB9A 2JJWA 4TTGA 4JRYB 3U0HA 2IQ9L 1NOFA 4I13B 3ES6A 3FJ6A 2XNAA 3CU1A 2EILB 2TSAA 1UWIA 4O58H 4OWGA 5DUBA 6REQA 1ZLUH 4FHJA 1TJ2A 1OAYH 4IBYA 2OMAA 4G71B 2FB2A 4LSUH 2WLZA 4O2CB 3KHJA 4I3GA 2R1WB 3MODL 2EDMA 3CVCA 5L7XH 2ZE0A 4NRYA 4N0FA 4EZKA 4MMZB 1K3UA 2E56A 1QFUH 1ONQB 4D8AA 1X9RA 4OOUA 4A35A 1GPOL 4JHWL 4A6YH 4DSYA 3V0WL 5GRJL 2L8AA 4GD0A 1DIOA 1SW3A 3V4BA 3CDZB 5DXYA 2AZUA 1XRVA 1OF6A 4WLCA 4MZIA 5CD5D 4YHEA 4M4RA 3U7VA 1WFJA 3KG5A 4EQ2A 4WUUE 2UY7A 4N26A 4C55A 4WXZA 1U8MA 4UQ3B 4QT5A 4P4RA 3F12B 5D7JC 4ZMTA 4AHOA 2WBXA 1ZP3A 3N6YA 3IF1B 1UT9A 1IC7L 2OMTB 3FCPA 4TM9A 4MS8D 3VNLA 1CG9A 1D9KC 4UIOA 3S3JA 2CU9A 1XF4A 4H2CA 4TUFA 1SEQL 3AACA 2XQYK 4QRSA 4ELMF 2VEMA 2ZCLH 3ZX1A 5I1JH 1NC2A 1N2VA 3QJTB 5HR7A 5C0CA 1HJCA 3RAOA 4DP9X 4I4WA 3WTSA 1FUNA 4XNAA 2GAZA 4KFOA 4Z1CA 5IDZA 5RUBA 2XIJA 2KQNA 2EDRA 1J5OH 1FFNB 1M71A 4V1XA 4RL3A 3PP7A 3AXLA 4WUKH 3SN1A 3NIDB 2Q3AA 4ZQKA 2X6BA 2WXOA 5IUSA 3QJUB 3A67L 1BD2D 5CEXA 2RBLA 4GKSA 4W9GC 4GQBA 1XH2A 5CCKL 1X6NA 1F6KA 5ICUA 1UQSB 4GAYB 3QIWC 3K6DA 4LFHG 3TBYA 1THCA 1XZ0B 3HFMH 3MRMB 4HHLA 4ICXA 4OI9A 4P2QA 4UCFA 4NGHH 5CJOH 1BAFH 4ZFOB 3ZKNC 5C2GA 1SYSA 4BK9A 2VJ8A 3CAKA 2I85A 5CSZB 4FQJL 1EX1A 3A22A 2BSCA 4NI3A 2K3HA 4PY7B 4N6FA 4UILH 4FQXA 4AH7A 1VCAA 1C8PA 4W6YB 2A3HA 4ZFFA 4OOZA 4HU8A 2CBJA 4WJ5A 3M7OA 2AL2B 4XC3H 3ITYA 4A29A 3EWYA 3W7GA 1IYXA 1V7YA 1PCXA 2EH8H 4KI5E 2HPMA 1E6NA 4X5WB 3BAJA 1XIGA 3C6LB 3ARGA 1PHWA 3H2OA 4J3OH 3O3EA 4O8AA 4UTJA 3ABXA 2A4EA 5ABFA 2HG5B 3S9ZA 2J78A 4NNAA 5GGRB 4URIA 2EC8A 5DZPA 2W07A 1GHFL 5BOPA 5HPOA 1A6UL 1O12A 3ZVHA 1LE5A 2GGEA 3GNML 2CLEA 2JGYA 1A7RH 1EXUB 3NO1A 1VF8A 1F2XK 1MELA 3CLEL 3UNTA 1TG8A 3KPQB 3MV8A 3L3IB 3VM5A 4WSKA 2VDPL 2DLTA 4PTXA 1FWAC 5G1YA 4QRQA 4Z1PA 4PLOB 1IE7C 3SE3A 1WWCA 5LCVA 2NQHA 2QQLH 2J21A 4TSCH 3OZKA 4N87A 1E0TA 2WPGA 2I07A 2PRLA 4YX2L 1ZV9A 4LBAA 4MLIA 1P4IL 4N90D 1XL6A 4X6DA 1KIUB 3MPGA 5SX4I 3UBPC 1ECEA 1V79A 1Q6GA 5IMLB 3LN4A 3GLZA 3OKMA 4ZK8A 1ZALA 5KSAA 3QJSB 1S5NA 1E15A 2KPNA 4EACA 4GH7B 1KM5A 2PTTA 5EU7E 1FPTL 4XBEL 1VAHA 3NQKA 4G8IB 4G6ML 1XR8A 4FXRA 1EK3A 4RGNE 3B05A 2VLME 3UO8B 3CVHB 1VBJA 2VW6A 4S11A 3MV7E 1F07A 5FO7B 3FTVA 4O02H 4QTIH 2P3YA 4GABA 2DMKA 4QAMB 5D93C 2AK4A 3R25A 5BROA 1BQUA 1KXQA 2Y7OA 1BXXA 4PRNA 5LN8A 1US0A 4NQVA 3SDXB 1FHVA 2EBNA 2VFIA 3M5ZA 2WXQA 3C5ZB 4JFEE 4HPHA 2K8MA 2OM5A 1PZ3A 3ZQXA 3MRQB 1C90A 5LG6A 1REQA 5EULV 3CHEA 3GINA 5C07B 4M6ML 3GW3A 3TN3A 3B8DA 1U8HA 5CZJA 5A2KH 5C9KA 4HBCH 4JO5A 4F2MA 5I16A 2NVCA 4Y2DB 2IOOA 4MYAA 1A8JH 1QO3B 1S3KL 2O5ZH 1CLYH 3OZPA 1TSIA 1ELSA 1CDGA 4U5KA 1J1PH 2X4PA 5C9XA 3O0FA 4MCZB 4JTGA 1RQEA 1UKSA 4WJG3 3QQNA 4LSVH 2O4EA 4EF8A 4O4VA 3GF8A 2HRLA 1T5AA 1OAKL 4LQFH 1J79A 2ZRXA 5I2IA 3E38A 3VX1A 2WJEA 2YD5A 1J87A 2IKHA 2E28A 1JNLH 1YYLH 2AJVL 3CN2A 1H7PA 2EKSA 3GLEA 4KRPD 4K38A 4JTRA 1HQRB 4X7TA 2OQJB 4QISA 1BFOB 4FA8A 1J8HE 5D2NB 3V3WA 1K7FA 3CYVA 3ZSSA 3NJ3A 3APCA 1W54A 2ZVIA 3QW9A 5BS0D 2ALAA 3TL5A 1XGRA 3MKCA 3JTSA 2P28B 1JR1A 3LKPA 5GRVK 3BV7A 1JF6A 4HNTA 5C0FA 2XSXA 3VXGA 4IL2A 2VM4A 3H0TA 5GNZA 4I18A 4WHCA 1QMLA 3WCZA 5AQ0A 5AKQA 3CHVA 2CFFA 4X4XB 4MCYB 5I1EH 1MPAL 5FGCE 1PCSA 3G04B 1J0YA 4J8RA 1TJ1A 1JF1B 3D25A 5EEUA 3KM1A 2PWGA 4F7MB 5JHBA 4IRJB 1FVEA 1RUSA 3U2JA 4OECA 4N9GB 5KSVB 3S42A 1CICC 1BWLA 3WJZA 3LHZA 4EI0A 2NY6C 2YQGA 1KF9B 2DYPA 1FFRA 4Y1AA 3FB8A 3LCHA 4U6YA 5AW3B 4Y2WA 4LCUA 3NTCH 2NNAA 3BESR 5DEFB 4S3AA 2P1FA 1MRFL 5CILH 4ADGA 2H2SC 5FWQA 2O61B 1ZQ5A 3WN5A 4XVJL 4QOKE 1AR2A 3IRZA 4DXVA 3A3WA 2EEDA 3OB0H 4H5SA 1H3UA 1OAXL 1FSKB 2GEQA 3CH1B 3DPBB 3FO1A 3Q2LA 3WELA 5JOEA 2ZWYA 5M94B 3AZSA 4AEEA 5CC5A 4OZGF 3ZVVA 3QGKC 2IH1B 2VEPA 4PG9A 1L7IH 3WUWB 2CM5A 5ESVB 4DEFA 3LZ3A 1V5JA 4GK8A 5GSVA 3ZRSA 4NNYB 3D0LA 4WWKD 3W7RA 3UGXA 4AB4A 3EFOA 4P8XA 3DHMA 5I1AA 1T7ZA 1EDGA 4KX9A 1OOWA 2ZKXA 5EC2A 1BWVA 5KTEH 1Z5HA 4M48H 1A6PA 3K0YA 4JANA 1IEAB 5SWZE 3W24A 1KR0A 1H7WA 1CXIA 4JFQA 4G80A 5E9DA 3NIGE 4P2RB 4DUVA 2EXWC 4D6EA 3MBXL 4K9EL 4HS3B 3WFZA 3VFWB 2UXFA 3V55A 1WUEA 5EO1A 3UTSE 1ZHNB 3NK3A 1JYNA 1TCDA 3ZDZF 4YE0A 2VOTA 3MNDA 4DLMA 3E9TA 3FUHA 1J9RA 4QQUA 1S9VA 1CDYA 3VH8G 4JUSA 2PDFA 2UV8G 3HC0B 2AJYH 3DN5A 4PTTA 4JZJA 3OOQA 4RZCA 4R33A 4XNBA 2QTEA 2VR2A 4Z7AA 2XBTA 1KBPA 4D6HA 2PPFA 3UWVA 2NY5C 3QUKA 4IU3A 3OJVC 4OAWA 4OLWH 4QHLA 4ES8A 4WK2B 5IY5B 1EEXA 3AG3B 4JO4H 4MD5B 3GXTA 4HKPA 3WLQA 3JWDL 4H88L 1IF2A 3IJHA 4Z7UB 4TSAL 4FK9A 2CLZA 3L5XL 2UY6B 4HPYH 1Q0EA 2DQHL 4XVTH 4JFHD 4CSSA 3UCCA 3OU8A 2AXJA 2O93L 5ACZA 5F1IA 4E8GA 4HIEA 3PNWA 3KLQA 3MJ8A 1OCNA 4AYID 3BP5A 2I16A 4GYPA 4LIQL 1PZ1A 4L1LA 5IMMB 1H1YA 3VXRD 2A6KB 2XN2A 1MCDA 2ZA3A 1CVRA 1JV2B 3FJ4A 4QRRB 2Y5SA 1VACB 3V52H 3BLKA 4ZZFA 2A3LA 2CETA 5A2CA 5CD5C 1EEZB 2BSTA 2B20A 5D1QB 2W94A 3BFWA 4AD5A 1ACCA 1YG9A 3HE7C 3WIIH 2QVFB 4B9YA 2GY5A 3S8FB 1CGYA 4I5XA 4JPQA 2Q6WA 2VZTA 1NSJA 1MKFA 1T2QL 2Q02A 3NWRA 4LQ1A 1UR8A 4N8VG 5DX7A 4F93B 5C0EB 2X0HA 4UB0H 3QVAA 3IJEA 5DMKA 1GQLA 5CPTA 2YOAA 4MS8C 1PKNA 1HXYA 1UD3A 5HK4A 1KRMA 4AWSA 5GGQL 4BZ2L 4ODVL 4AK1A 1JVLA 4XD3A 2P24B 5JHAA 3GT6A 3O2WH 3U2CA 5I82A 1FZKB 2B59B 2P0OA 5C09B 1QFOA 1U4FA 2BS8A 4MFDA 1JCVA 3SRFA 1EZVX 4UTFA 1RZGB 3NAVA 2P7TA 5EBLB 4KEUA 3AQDA 5FHBL 1SM9A 3P77A 2XZ9A 4HPXA 1GAFL 2Y6TE 1W2VA 1VENA 2HTLD 4AIUA 3W02A 4PR5B 1T0NA 1HKJA 3MHUA 4GFTB 2JKRM 3MRGA 5JMRA 3S9DB 3UBGA 2CGRL 5KBLA 4TR9A 5A3ID 4W7WA 4JRYA 2KZWA 1UACL 3BI9X 3ZL4H 1HAUA 3QRGL 1NGXA 1UP3A 4J35A 1ETJA 2BVPA 2DI9A 3ARDC 1HINH 2JGQA 2UBPC 2VDLL 4OZHA 2DY3A 2ZF9A 4OIAA 1EJ7L 1RY7B 1ET7A 1TELA 1VFAA 2R29H 2NLYA 4HD5A 1T1ZB 4PJDA 4WFHD 1VLIA 3RU8H 4H6EA 4F37F 1UXWA 2IALB 2P5PA 3ZBMA 3UTQB 3RVTD 4WENB 4HIJA 2CKBA 4NPJA 4G7YL 1S7SA 1U3NA 3NZHH 4GO8A 3BYYA 2EGZA 4FNSA 4NY2A 2CBMA 1WBXA 7REQB 3EW3B 5B80A 1H7OA 3ESNA 1T89A 3IGUA 3BZGA 3TJHC 3W6LA 2AJSL 1ECQA 3QFDA 1MWAB 4ZQPA 3D4ZA 3WNNA 3UABA 1JGEB 4QYOB 3GHEL 1K8IA 4A3YA 5HJDA 4ZX6A 3W3OA 3D69A 4P46B 3LGEA 3V0AC 2EDLA 4WW2A 2IMNA 4UTWA 3LMJH 1VZHA 4E9TA 1QYGL 3OQ3B 2HX9A 1KBGL 4ES4A 4I1PA 4QRFA 3TCLA 5GRWA 3G6JE 2XI9A 3PWUB 4PUUA 4G6FD 1T4WA 5IG7A 3UIZA 1BIIA 4JRXD 4XBGB 5JHMA 5LBVA 4FNQA 4OQTL 3BPNB 5C55A 1DBKH 2NQ3A 3RCYA 1AGFB 4MQXD 3IJIA 3VTRA 5A1AA 1MVUA 3R8HA 4YGVB 2CUHA 3R0DA 1JHLH 3SZ6A 2ZUYA 1NCGA 3VFGL 4GI4A 4P9MH 4UTAL 4IPNB 2V2XA 4H8UA 4O02A 4UM9D 2NRDA 4FNPA 5MHBA 1JV5B 3CO8A 2QDEA 1R87A 1HI6B 1MCIA 3EMCA 3W7IA 2ILLA 1LQSR 3V95A 1DSWA 2IGTA 3PSVA 5GJPA 3BVVA 3LG3A 5C0BD 4KEZA 4HZLB 1W6LA 3IETA 3RDTB 1DJQA 4MLJA 4L4JA 5DMNA 1HJUA 3DJSA 5IFAH 4J5VA 3GTXA 2A99A 2DLFH 4LEOB 3OKOB 3OAUL 2PWDA 3EDKA 1HYSD 5KYXB 3WLJA 2Z93A 4FQCH 4AJWA 4AZ5A 2JK2A 4Z6AT 4WW1B 4LVOB 1XUZA 4FTVA 3KNBB 1UWTA 1W9PA 3L5MA 4QDMA 4X3ZA 3RJXA 5EF3A 5HJ3A 4NYLA 2WLKA 4WFED 3UAJA 2QDWA 2BNQB 3VOCA 3RIAF 4JO2H 3PUDA 3P0YL 1XLLA 5F7DB 2D7MA 6ENLA 2HVJB 2F8QA 4YSPA 3SPCA 4YHGA 1BVZA 4I88A 4YDVB 1MLCB 3SN4A 3PG9A 1PWLA 2VQUA 2EIMB 4M7LL 4LW7A 3AREA 1JPHA 2E7HA 3NACH 4R88A 1C08B 3GNDA 2GSIB 4KRPC 2DKUA 2IANE 3ECVA 2TRSA 4HCLA 5D02A 1TETL 1UJ3C 4KWWA 1RK1A 1AXTH 3RCMA 3I3BA 1PV8A 3FQ4A 4OKVB 1XBDA 1GZQA 4H1LB 4H8WL 1DTUA 4CVZA 2QUMA 3QV6A 4M8RA 3N1GC 5SX4H 4OM0L 5GGSY 3HPLA 1FWIC 3X1GA 2FTAA 2AC0A 1TV2A 3WEXB 3DVGB 3GMPB 1LUCB 2DQWA 1Y07A 2YAPA 2XWJA 1X9LA 3SYPA 3UCQA 3A4JA 5AW5B 4GSXA 4PMYA 1E1FA 1HH6B 3EJPA 4GC4A 3ALPA 4LBEA 3HS9A 3M0IA 3E5BA 3GFZA 4UOQA 1DQUA 2BNRA 3WEAA 1ZA3A 3AWFA 5GISH 1BF8A 2C3XA 4NAFB 4S1RH 2DM7A 1GK8A 3KW3A 4LOCA 2CKNA 1KN4L 3TA3D 1TV4A 2XWDA 1N0LA 1KTDA 4MMYA 2JBMA 3RYSA 4Y16D 5F3BA 2V5BA 1TJPA 1QSEE 3VE9A 3GDTA 1I3RB 3WQGA 3MRQA 3RUGB 2BVYA 1Q9WB 2CBIA 1W5OA 3W9ZA 1QK2A 5DJXB 3MUY1 5IHZA 2EQDA 1S5HA 3POCA 2QR6A 1MW3A 5E1IA 1RZJC 3ECBA 2VGIA 4C4BA 1KRCC 5CEYA 1NFDA 5EOCJ 3ARFA 3VIPA 3B0XA 4TOYH 4I9WD 3TEWA 4DY1A 3TYDA 4WWKC 3WS3A 4UTBL 2GSHA 1JK9A 5F3FA 3DMMB 4FXGC 2CJTA 4AMKH 4D3CL 4FR1A 4LRIA 4QYAA 2VD8A 3MQIA 5D7SH 3W86A 3NCJH 4Z7OB 4PJAB 1R3JB 4ENLA 2P8LB 4JCWA 3TFKD 1QSFE 3QQDA 1CLCA 2PA6A 3K4AA 3OKYA 4J3TA 1H0IA 4L6DA 3HG2A 2WBGA 3N4AA 1MXSA 4Y7MA 1VIZA 5T1KD 2FATH 4QPEA 3SE8L 2NY3D 3U2IA 1SNRA 3ES6B 2XNAB 1WDRA 2V17L 1TFPA 4PI0A 4PU2A 4QS6A 2XN1A 2X4TA 3KBVA 5DUBB 4HAGA 4BWLA 3N06B 6REQB 2RTTA 3WE6A 4PJ7A 4MAUL 3ITGA 3SFWA 3KFTA 4Y96A 1U30A 3MCLH 5FKAA 4JY6A 1MCOH 2VABA 5C5YA 3PZMA 1HHGA 5CSUA 4NRYB 4N0FB 4HZ7A 3TK7A 2G41A 1EQCA 2FX9H 3WNLA 4ORMA 5ELIA 1L9QA 4YHYC 3FQXA 4F7MA 2DJ4A 2VZVA 4NP4H 1F0LA 4J4KA 5KW9H 4AGQA 1CWYA 4LB4A 4REQA 5ABAA 2J9ZA 1JAEA 5H2ZA 1HX0A 2DAVA 3FB7A 5DUMH 4AVOA 4M4RB 4NZ5A 3CBWA 3ULUD 3S2JA 3FTUA 4ODHL 1PB0A 1HKVA 2FYYA 5FYLH 4I2XA 3CFIC 2UY7B 1J9QA 2B7NA 4MYXA 2FH6A 1U8MB 4RAVA 2I60L 1M68A 4QT5B 3BLFA 2LLNA 4CEUC 2VO5A 4YN3A 3U2OA 3IACA 4P4RB 1SFSA 4LU5L 1U8IA 4PJ9C 2E1WA 5M5DA 5B7ZA 1I3UA 3F7KA 1RZ7L 2VLKD 3V0JA 2VCOA 4Q8WA 1YHTA 1CG9B 3S0PA 3M07A 2HN7A 1XF4B 4KFZC 1KV5A 5E09A 1TPDA 4HBKA 4QRSB 1EHXA 4HS8L 2NUPA 3WD2A 4CQBA 2DLIA 1PAMA 1NC2B 1SFHA 5C0CB 1NLDL 4MWFA 4I4WB 3VFNA 2VCBA 5D4HA 3SBFA 2UZXA 2GAZB 3QEGH 5I0VA 1PD0A 3VH8A 5BXTA 1BDYA 4YUEL 4WHTA 5I5JA 4NXSA 1M71B 4F9JA 1JZDC 3M5XA 4WWPA 2EACA 1XGPA 5E5RB 2OX4A 3AXLB 1BMGA 4HSNA 4PJXF 3ABKB 4KKXA 4ZQKB 4Z7WF 2GK0A 4PUBL 5D70L 5CEXB 4GKSB 5CC3A 4FQ2L 3EYUH 1R3LA 1B3VA 1GYAA 1R5WA 5KZCD 3L9CA 1ZTXE 4DYJA 2BVQA 1ZVNA 3TBYB 1E5ZA 4HJEA 3LOTA 4LYPA 3TESA 4FA3A 5D9PA 4P2QB 2HTLC 3Q58A 4YXHH 1SYSB 4G7VL 4L1XA 2EE0A 1CDHA 4EAMA 4OLUL 5A3IC 3BLIA 4LSTH 2H1LM 3L9EA 4NFDA 4P7RA 2QKFA 2JKSA 2R29A 3FFCE 1EANA 2V7NA 1WUFA 4FQXB 4YYCA 2JI2A 2FX7L 3D33A 4ZFFB 4IOSA 5CGQA 2OZ4H 4HNOA 4WJ5B 2HA1A 3WK0A 1EWEA 2CJSA 2F6KA 5IROA 3NA8A 1ZCOA 4AITA 3B3BA 2AEWA 3DVIA 4WEUD 3ARGB 4YO0A 5FYJD 4LNCA 3O3EB 1UVQB 1GOGA 3W84A 4UB9A 1R75A 3GYEA 4CADA 5ABFB 4JQ4A 3WLTA 3RGBA 4HX1A 4N8VA 3JT2A 4B3LA 1IXNA 2W07B 6FABL 3ZVHB 3LERA 5JOPD 1LE5B 2YD8A 5D7JD 4NIRA 2CO1A 2GTZA 1DYZA 2Z0BA 1JF5A 4Q9RL 2EG7A 1D9KD 2PCQA 5HJXA 3MV8B 4RNHA 5G2NA 3N0AA 4M5ZH 1DFBH 4QRQB 5E0FA 1DCEA 3DFYA 3TMLA 2YFNA 5J04A 3A5VA 4Q6KA 2RB8A 4OF7A 2NR6A 4NNXA 4WQ6A 2I07B 5E8EA 2ZDRA 2CO6A 3PU7A 4QLRA 3EOAA 4X6DB 4LTSA 4M8VA 3MDWA 3SCUA 2IMMA 3LN4B 2J12B 3OKMB 4JPWH 5CZRA 5KSAB 4MFHA 2NY1D 3OVUB 4DQOH 5BO1H 2G37A 1BTCA 2D3JA 5DZVA 3C2VA 2PTTB 1E6PA 3GZAA 3B43A 5AUMB 1XR8B 4BELD 4U2YA 3W1QA 4J3VA 2HPOA 3CWOX 1JPFA 1JUFA 1SY6A 4MQXC 4RZ6A 4NJIA 2K6WA 2Z35A 4JG1L 4JPGA 2PDHA 2NZLA 1IAIL 4H9UA 5AOJA 3GRWA 3PAUA 4NZUL 1T7YA 3ZR6A 3T07A 2AK4B 2V63A 5HDLA 4X8JA 2UZYA 4AMCA 1BXAA 4MQTB 2ZE3A 4ZFGL 3FN3A 4PRNB 4DAGH 1BYDA 4NQVB 3TN0D 5LDSA 1W3TA 5J5RA 4KK8D 5K9OA 2W9DH 1CU4H 3IKKA 3AALA 1O5QA 2DZTA 3R89A 1JK8A 3C87A 1REQB 2QAFA 3FH5A 2RDWA 3PF3A 3FO0L 1SF3A 1U8HB 3IS0X 4LLWA 1CXFA 4UMBA 4F2MB 5I16B 1HJVA 3IM1A 1IC0A 4PRPE 3RTLA 3SGDH 2BH0A 1MFEH 5D2VA 4G2DA 2X4PB 2VXUH 1YMYA 3W7NA 1HYSC 3BK0A 3VJ6A 4NCC1 4X7SL 1MY5A 3K2IA 2G2NA 3XISA 3QXTA 1ADWA 1IBGH 1XD1A 4J1UA 1NEZG 5FSDC 5I2IB 4Y9PA 1JIBA 3G5ZA 4GUIA 2JELL 1WYJA 2EKSB 1GYLA 4J2XA 2NOYA 3G18A 4F20A 1IWPA 3DOIA 4X7TB 4ZW7A 4MJZA 3QMTA 4XBPA 3LNPA 1KNWA 3ZTDC 5BRZE 3GXPA 3W7CA 4WGWB 1EFXA 2ZWNA 1MI5E 3PWAA 3VUPA 5TDNA 1LG1A 2GGIA 3CXFA 1XGRB 1OCRB 3BPCA 3WLKX 3O2DH 3JTSB 5ESAA 3LKPB 1ZWIA 5HDRA 1U33A 5C0FB 1P0KA 3H0TB 1EC8A 2XFRA 5BWAA 1PKQE 4I18B 3NPXA 1CNVA 1F4YL 1ZV2A 1CGSL 1XTLA 1RJRA 2WZEA 2H6RA 2ZPKH 3P0VH 3VFTA 4J8RB 2PW2A 2VLRE 4Y2DD 3D25B 4HLZG 4MJ6A 4J3UA 4LO9A 1EA9C 2F58L 3LQAC 1MF2L 1FVEB 4ASTA 5FXCH 3POHA 5HNUA 1WIUA 5J3HD 2DYPB 4GA8A 1ONWA 4PYGA 4Y1AB 3FB8B 4U6YB 4K1GA 4LCUB 1V6XA 1S9WA 2NNAB 1MHHA 1Q0YH 4RSVA 1LILA 4ZMPA 3WUEA 3KPRE 4IXXA 2I24N 2XZ7A 4Y90A 2OO6A 3MLSL 3WN5B 4H5SB 4I7UA 3TA3C 1QNQA 5EZIH 3M1OA 2XX1A 1XS2A 2N0KA 3FO1B 4HZLA 1FA2A 3QDGE 5TDPA 1V0MA 3QZOA 3S4TA 4PG9B 4XPGL 2FQDA 5GSVB 1Q94A 4W89A 3D0LB 1A3ZA 3CNKA 4FXLA 5C8BB 4B3VA 2NZIA 2X53A 3EFOB 4YK4B 5I1AB 4Q4OA 2E9BA 3VXUA 5EC2B 1LLAA 5HWMA 3BW3A 4JANB 1A14L 4JCMA 3QSRA 4OV5A 4P8QA 3OYXA 4CQCA 4AG4H 4PAZA 1Z3GL 4E9QA 4JFQB 4G80B 3SDCA 2NY7H 3KPTA 5E9DB 3U3HA 3W7OA 1KBIA 1LZOA 4KXZI 3T4AC 4ONFH 2EO7A 5ADPL 2Y7NA 4F58L 2VLJA 1K03A 1R38A 2C18A 5EO1B 5BU9A 2UV3A 3BG3A 3GUTA 5IJKC 3QC3A 2XRAL 3TFKC 4M51A 1S9VB 3SKOA 4AD2A 4IMEA 4D6FA 3B7UX 4WY7L 1PKYA 3SZKC 2JKPA 4PTTB 4A7TA 4JZJB 4HLZH 3ISWA 1QR7A 4WV1C 2Y7MA 2NQ9A 4UDUA 4RZCB 3M86A 2C3GA 4OZFH 4M7TA 4X0VA 3KL0A 4G11A 2NY3C 1NGQL 3JQOB 3CQJA 3U9WA 3HIJA 2R2HB 1ZPTA 4IU3B 4OAWB 1GTFA 1I1AD 2PMQA 4QHLB 2JEQA 2ESCA 3DVGA 1RK5A 3GBLA 2WKOF 1A3QA 1DBMH 3IJHB 3PP4L 3QUGA 2CLZB 2XX0A 1KTBA 5DK0A 1Z8AA 1J8KA 5ERWA 1CR9L 2ZTKA 3PTMA 3HC2A 3AU6A 5ACZB 2BCKA 3LV6A 5F1IB 4N9BA 4HIEB 4WK0B 3GY1A 3PNWB 2OJPA 5DRWA 1WAWA 3MJ8B 2QVTA 2KT6A 43C9A 3BP5B 4Z5RA 1KC5L 5KG9A 4P3WA 2DSWA 2VJXA 2QJDA 3TUUA 2AEOA 1OXYA 3EF7A 3NP3A 2E5BA 3NIYA 3D5OF 2NPLX 2W80C 4OE7A 3TURA 1B0GA 2NNRA 3IMVA 2IV9A 3KOZA 3BDYH 4K15A 3PR2A 3ULUC 4IGBD 4LVBA 3U2EA 1JRHL 4DI8A 4N6RA 1A02N 3UJTH 4ANWA 3SIKA 2Q6WB 3JSSA 3LCXA 1X38A 4DVOA 4N2CA 2A0NA 1KPUA 3F2LA 1LDPL 1E0WA 5FI8A 5E4IA 1BJ1J 3COTA 3OA3A 3IJEB 5DMKB 1IGCH 4RZ5A 4UV4L 1HXYB 2PYED 5FYLE 5PAZA 1QHPA 1KQZA 3MJ9H 1IR1A 2R6OA 4MB1A 1SW7A 4WRHA 2D7PA 2Z1VA 3PYCA 2Y22A 4G6CA 3PWPE 4LLAA 2P7TB 4WU7A 1X9QA 1LJYA 3P77B 1N7MH 3I2CL 2PW1A 1EZLA 1AW2A 2D2HA 1T0NB 3PDDA 3MRGB 3MSYA 2E76C 3P11H 2XH7A 5EMKA 3BMXA 4PBVC 4PS4H 4OBTA 1QNZH 3AM8A 5XINA 4XP4H 4OCSL 2P3EA 4BFFA 4YHPA 2WUCH 2YDSA 1NGXB 2VW7A 4YEFA 1EZVY 4Z1BA 1J5CA 5FB8A 2BVPB 4TVPL 1B9KA 4WUUA 2ATKA 2OZ4A 4GG8A 2GPZA 4OZHB 3R13A 1LMIA 4QNEA 3DBNA 4DT2A 1E9IA 1VFAB 1G4EA 5DY2A 1PLGH 1C5DA 5FEBA 4Z77A 4PJDB 1KEMH 3N85H 1UXWB 1ETB1 4HIJB 4IJ3C 5F2MA 2DBLL 2CKBB 3S6OA 5BU6A 2YAQA 3UR7A 1L3WA 1S7SB 3ZRFC 4U1NA 4DBDA 4RDVA 3N04A 4IQLA 5C08E 2CC0A 2NQCA 2E75C 1GQIA 4NQED 3QCUH 3VXOA 1AP2A 1WBXB 5CJ8A 3ZTCC 2EE3A 5FV2A 4J3BA 1U93A 2CZNA 3UAAA 5I66A 4NC0B 1K4CA 3DSFL 3HE7D 3QFDB 2J8TA 5DXXA 4LPYA 5CEZE 1AZNA 2BV9A 1K8IB 1Q7MA 4J3OG 4OD1L 4FDWA 3D69B 2Z7ZA 8TIMA 1ADSA 3IU4L 1PKLA 2VXTL 3G6DL 4PMXA 4IQEA 2N4IA 4MADA 3E1F1 4WW2B 4BY3A 5I9QB 1V27A 1I2RA 3TCLB 1NDWA 1XIWD 5G1MA 2YL8A 5DQJA 4OI7A 3L5AA 1CF8L 4YC2C 3FUFA 5IG7B 1L2QA 1L0PA 1BIIB 4KXBA 1BXVA 2JB5L 1FL3A 2ICCA 3MN8A 1C29A 4O0QA 3L68A 1ACYL 1IV8A 5A2LH 1H63A 3BZJA 1OV8A 1SPDA 1MVUB 5EOCH 1WLHA 1W9XA 2CLPA 1KB5L 1GW9A 2FZ3B 4O1CA 1EEYA 2PAJA 3NCXA 1BPLB 2FZDA 2NY1C 2LTQB 5LA2A 4LSPL 2V2XB 1ZS2A 4O02B 2OKOA 2IFGA 3T3ME 2NCMA 1QUMA 3PNUA 4NOBA 1ZLVH 3C6LC 4YTUA 2CQVA 3S2MA 1JCTA 1FWTA 4M1GL 1S5IL 3I6EA 4IBUA 1S5TA 4BZ1L 5F9WB 2DI7A 3ARDD 2WGXA 4MHBA 3VMOA 2FVMA 2V8MA 2PR4H 5LAPA 3LBMA 4JDZA 1VBGA 5ADOH 3IETB 3TN0C 1PFCA 4MA1C 3AS1A 4PUEA 4G8EA 4GSQA 4YBHA 2NXGA 4KK8C 1NM9A 4RE0A 2LOEA 5FGBA 1GKQA 5DZOA 2TRHA 1UWAA 3VGEA 3PBGA 2Z93B 3B4YA 3AABA 2VDNH 4Z0SA 1NAL1 3CSGA 3SDOA 3K72A 3N6HA 1Q85A 5E9NA 4HWBL 4FTVB 1RKRA 2FMOA 1PBYA 3TOYA 3URAA 3JBG7 5FLUA 4F0MA 2OODA 1UVQA 1IKNA 1DWJM 1CFSA 5HJ3B 3TFBA 2QQKL 4NYLB 3PHOA 5K59E 3BPOC 2CAKA 3UR8A 2ZZ3A 3KWUA 3TJHD 4XV0A 3AUOA 4AIEA 1GZGA 3G22A 3DIPA 2DQDL 3OVRA 2ROYA 2P0IA 5C0NC 1YDYA 3BKJH 4HA1A 4M6AA 4K7PL 2R4RL 3EYSH 1DJNA 3OLDA 5DJ8A 4RH4A 3EYOA 4YHML 1RERA 2ZOWA 5I8EA 1V0NA 3AREB 2DLGA 3UGEA 1DORA 1MDTA 3MV7A 1TV7A 2WHJA 1AC0A 1C12A 4Q4MA 4OUUA 3QYMA 2CESA 4H9XA 2W9MA 1NC4A 4AYDC 1RK1B