3BSHA

Barley alpha-amylase isozyme 1 (amy1) double mutant y105a/y380a in complex with inhibitor acarbose
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
404
structure length
404
Chain Sequence
HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIACIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGSRADVGAVIPAGFVTSAHGNDYAVWEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Alpha-amylase type A isozyme
publication title Multi-site substrate binding and interplay in barley alpha-amylase 1
pubmed doi rcsb
source organism Hordeum vulgare
total genus 127
structure length 404
sequence length 404
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bshA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bshA01
1E4IA 2JIEA 3APGA 4HA4A 1KWGA 3I3EA 3LMYA 3D4YA 3PTQA 3GNPA 4AIOA 3EDFA 1K9FA 3TONA 1E6ZA 1W9BM 4D6FA 2GJXB 1HIZA 3WNPA 2Y8VA 1TVNA 2CXGA 4FLOA 3UG5A 4CD8A 1B3ZA 4W5ZA 2E0PA 3WUFA 2IXVA 3WH7A 3VM7A 5KEZA 1KTCA 2BXZA 1J0ZA 2VR4A 1J11A 1H11A 7TAAA 4R27A 1HTYA 3CTTA 3BLPX 3ZM8A 1AQMA 5BYWA 1C7SA 1Q4NX 1B9ZA 1CGVA 1HVXA 1ZJBA 2X8RA 2VMFA 3THDA 4JCLA 1RH9A 3L2MA 2ZUWA 1EGZA 3ZT7A 1OWQA 3D4ZA 1WZKA 1WAWA 2ZXDA 2YIHA 4UQ9A 3T0DA 1WB0A 2D0FA 3CHFA 3U7BA 4AD3A 4AZCB 2W67A 3SCNA 1ECEA 2VL4A 4MB4A 3T09A 2GUYA 3VIJA 3VOCA 4N0RA 2PBGA 4KWUA 2D73A 4J7RA 3EJQA 5DFAA 3L4WA 2J4GA 3BVUA 3I3BA 3CZ8A 4HA3A 4CU7A 2WVVA 4IISA 3FW6A 3GXIA 3AS3A 2EXOA 1QW8A 1R34A 1KB3A 4X9YA 2FH6A 1UKPA 2VCCA 4URIA 3WMSA 4MNMA 4D1JA 2J7GA 1DWIM 2X1IA 3THCA 4AMXA 1GOIA 4IM4A 1W1PA 3OB8A 3WF3A 1J9YA 1VJZA 4NX0A 4PMXA 3HMCA 2VVSA 2E9LA 4HA1A 3AHTA 2GDUA 5A6BD 4ACZB 3GDBA 4U5KA 3MUIA 4J3VA 3CH9A 2YL9A 2JF7A 1B30A 2GVYA 2MANA 3O6AA 1CDGA 2E9MA 1E4NA 1KCLA 3AISA 3RM8A 3VIPA 5A6MA 1VF8A 1NWUA 1X6NA 4H8HA 2W63A 4ZXOA 1DP0A 1B3YA 3OGSA 2G8ZA 5I2UA 1GOOA 1XH0A 3DX2A 4AXNA 1OIMA 3GH7A 3OZPA 4MJ2A 2XIIA 5D9PA 4J3SA 4HMEA 5CPTA 3N9KA 4ML4A 4M24A 3AHZA 4TVCA 4HTYA 3RM4A 4AZBA 3UG4A 1PBGA 1F4AA 3FNDA 2CETA 1WP6A 5AC4A 3FAXA 3MS8A 1US2A 1IT0A 4DM2A 1UKOA 2DPEA 1E40A 3N18A 3PZVA 3W25A 3BMVA 4GZIA 4AW7A 3EYPA 1HKKA 4A3YA 2Q8XA 1HNYA 1GQKA 3DHPA 4FNPA 3L4YA 3WY2A 5A2CA 1ISXA 1OGBA 2XFFA 3UESA 2C7FA 3HG2A 1WDPA 1QBBA 1XH2A 1HWWA 3CLWA 4D6CA 1HJQA 1V6VA 2VO5A 4OIFA 4HMDA 3QOMA 4DUWA 4S3KA 1DWAM 5BXTA 3PZIA 3TP4A 1UWUA 1BVZA 4W84A 3KL0A 1EQPA 4IPNB 3KLLA 4UQAA 1E15A 1JFXA 2JE8A 5E1QA 1CNVA 3A3HA 2WPGA 3VU2A 4OBRA 3OA5A 3VIIA 4MAVA 1WKYA 3N1AA 1GZJA 3MI6A 3HN3A 2V3GA 1CWYA 1D3CA 1OB0A 2V38A 2CHOA 2IGTA 3B8SA 5GNYA 1JZ5A 5A6BA 4Z2GA 3VMOA 3WQ8A 3ZJ8A 1WCGA 4S3JA 3VD3A 2YLAA 3NJ3A 5JUVA 1ZBVA 5BROA 3WY3A 2QMJA 3AIWA 2J7EA 4EAMA 1J0YA 1UR8A 2WHLA 2XFYA 1UD4A 4EK7A 2VOTA 2YJQA 1ZJAA 4JIEA 1PZ2A 4M1RA 2BVYA 3CGTA 1YHTA 2YKKA 3SCTA 3BCDA 3IAQA 4IPLA 5FKYA 3ZSTA 1JAEA 1H4PA 4W5UA 3J7HA 3WNLA 4ZEPA 4FF5A 1H3GA 1SMAA 1UD2A 4GIAA 1CZ1A 5I77A 4P7LA 2YA1A 4OGZA 1QI3A 2WMJA 5A3HA 1EHAA 2XIBA 2W62A 1M53A 4J27A 1NOWA 4UZSA 3F5KA 3VX0A 3ZT6A 1MQPA 3U57A 3N04A 3K4AA 1XSKA 1VEMA 1UZ4A 1JYXA 1QHPA 3CUGA 2CESA 1J0JA 2NW0A 1WDQA 1WNOA 3PTMA 2ZUUA 1W3LA 1W3JA 5HNNA 2E3ZA 2WVVB 3PZGA 3W26A 2FE0A 2G3JA 3TOPA 3WDJA 4JFUA 3A4WA 1QW9A 3A24A 1MVYA 2G4FA 2CIPA 3ZOAA 3DYMA 2VX6A 5E6YA 4RE4A 2W61A 1B1YA 1HX0A 3RM9A 1QHOA 4GI9A 4W88A 4KGLA 2XGBA 1W2VA 4X0NA 2EPKX 4BZYA 3K8MA 2YFNA 3AHVA 2ZOXA 4E8CA 4CN6A 2ZWZA 1FOBA 3BC9A 3VGEA 1ZU8A 4D6DA 3WH6A 1H0GA 3OLIA 4UOJA 3MUY1 4QCEA 5CSYA 1FH8A 1UR9A 4ATWA 3ALFA 4TOQA 4F8XA 1JF6A 3VIKA 4UOZA 2PWDA 4NRRA 3KE0A 1OINA 1E56A 2J25A 1J10A 1E6XM 1JAKA 4D72A 2WVSA 4V27A 1BSIA 4GO8A 3VVGA 4L4OA 1XSIA 3HG4A 3A47A 4PYSA 4E8DA 3T2OA 2J7HA 1WZLA 5IFPA 2XG9A 4PUEA 2UY2A 1S46A 3K8KA 3A4XA 1QX1A 4YHGA 1AQHA 2VCAA 4A3HA 2GDVA 2YDRA 2CEQA 4WIWA 5I3DA 2CBJA 3MO4A 2DGAA 4QAWA 2D3NA 4KMQA 3PN8A 4PMQA 1KFWA 3IANA 1BPLB 1CENA 3VGGA 4D6JA 1H09A 4DO5A 5IHRA 3WL1A 2XN1A 1EO7A 2ZWYA 1ODZA 3PZUA 4C7FA 4DO4A 3POCA 1VFUA 1P6WA 1ITCA 2EPNA 1ISWA 5C8BB 3AHYA 3SURA 1BGGA 4JFSA 4B16A 3EJRA 3A21A 5A8QA 2XN0A 2OW6A 1UZ1A 2EBNA 1TMQA 4X0VA 1MQQA 3W24A 2DDXA 4XZWA 1V3KA 4JZ5A 1SYTA 3KEHA 4B9YA 2O92A 4AY1A 3RPMA 1NWRA 1V3IA 8CGTA 4XB3A 2G3MA 3BUQA 1R47A 2UY4A 2DT1A 2UWFA 1R75A 1TCMA 2ZX9A 2ZE0A 3BXWA 2X09A 2QMKA 4OUEA 3VNYA 5ABFA 1HP4A 3BAYA 2DSVA 2WAGA 4CD5A 2YOCA 1ZL1A 3WD3A 1TFVA 4GQQA 1W3KA 4BS0A 4WSJA 3DECA 1GOMA 3CZNA 4M80A 2WBGA 1G5AA 5EBAA 2YL6A 3VGDA 1E72M 1UQZA 1UYQA 3MMDA 2F1BA 3W28A 4W85A 2YDQA 3VKKA 5DO8A 5E0CA 4JHZA 1LWHA 3ECQA 1A3HA 2WLYA 1LJYA 3KL5A 3LPPA 1RPKA 3AIBA 4TUFA 1HXJA 1BYAA 3CMGA 2QLYA 3EBVA 1G94A 1UQYA 5D9OA 3FHAA 3EMZA 5BXPA 2WCSA 4Y7EA 2D3LA 2V5CA 3D5HA 1UD6A 5ECUA 4A4AA 1O7AA 1B31A 3VNZA 1TR1A 4AYSA 3LXCA 4GINA 5A95A 5BXRA 4Z2JA 3ZR6A 4UQCA 3VDHA 1JXKA 3ARUA 3U5UA 3IAPA 2ZX7A 2DIEA 3MU7A 4WKFA 2F7PA 1JFHA 1R87A 1GW1A 3SUSA 1NARA 3WQ6A 1CTNA 2EAEA 1MW1A 4U3AA 3W6LA 4UCFA 3POHA 2A3EA 1W1TA 1MW3A 3WNMA 2D2OA 1CXLA 2CBUA 1CXFA 3CHEA 1ZB5A 4TTGA 4FNTA 5D9NA 2XGIA 6CGTA 3WL0A 3MV11 1L0PA 3N13A 1KGUA 1V02A 3WSUA 2PWHA 4F9DA 3OGRA 2GSJA 3ARRA 2OSXA 1V3HA 2XVPA 3DX0A 3AMGA 2VNCA 2ZUMA 4Z2LA 2EPMX 4H04A 1NH6A 3MKKA 2G3NA 4LX4A 3F4VA 4W87A 1FFRA 4GZEA 4PMOA 1UWIA 1OCQA 4CCCA 3CZSA 2XFRA 5C70A 1UG6A 1V6XA 4OOZA 3VD5A 3GNRA 5DT5A 3BAWA 5KZ6A 4CU8A 4QDMA 3SCQA 3BGAA 4F9JA 2J74A 3DYPA 3B9DA 4PSPA 1JI2A 2CNCA 1CBGA 4UQBA 3CZLA 3WUEA 3ARSA 3BAJA 2BHYA 3GXPA 3RIKA 3ARYA 4YHEA 3BAIA 3WENA 2OWXA 2VZVA 5AC5A 3SCUA 3VIOA 3KL3A 2D0GA 5A8PA 2BFGA 1CGYA 3BSGA 3VMNA 3OG2A 2Y2WA 1V0LA 2C8NA 4CVWA 5I23A 3L4UA 4AZHA 4B9ZA 7A3HA 2QPSA 1GOWA 3L4ZA 5CZKA 3W81A 5E09A 2AMGA 4N42A 4XZBA 2EACA 1EA9C 2DSWA 1VIWA 3RO8A 4CD7A 3AHXA 2X2JA 3EJSA 3LPGA 3W0KA 3GH4A 2IXUA 2NT1A 1Q6CA 1US3A 2Y8KA 4KH2A 4U2YA 1FA2A 1HP5A 3GXMA 1TQUA 3QHMA 2ZX8A 4QP0A 2WMHA 4EE9A 5GNXA 5ABFB 1N82A 4OJYA 1GJUA 3RILA 3UR7A 2FGLA 3W53A 5A2BA 1UR2A 4LYPA 4Z2HA 4UFMA 5A6LA 3VINA 1JZ3A 2IUZA 4LXFA 1JIBA 4KRTA 4GI6A 5AYIA 3CUHA 3RMEA 3SCWA 3U5YA 3VIHA 3AIVA 1XCXA 3S2CA 5CGTA 2X2HA 3AXIA 2BS9A 3RJXA 3VSUA 4BCEA 4TX6A 2VQTA 4QFUA 4HPHA 1EXPA 2WMIA 1E3ZA 3ZJKA 1CIUA 1HF6A 4KGJA 3SCRA 3ZSSA 4U5IA 3NUKA 2D22A 3W4RA 4DUVA 1GOQA 4QCFA 4CD6A 2GJPA 4XX6A 1EDGA 4TX8A 1J01A 3WF1A 4HOXA 5CG0A 3ARWA 1H2JA 4JKKA 4MB5A 5D4YA 4EANA 2YFOA 1V6WA 1JNDA 4GKLA 3BLBA 1K9DA 4D6EA 4JFWA 3W6MA 1XV8A 3WBAA 1BQCA 4PUDA 5FL0A 5M17A 1QI5A 3H55A 1OIFA 3DDFA 1HJSA 2WZIA 5JBEA 3HU7A 2A3CA 3WDRA 4AMWA 3L2LA 4H8UA 4M8UA 5GPRA 5JIPA 1BHGA 3DX1A 1NWSA 5LA1A 2WHJA 1UUQA 3PZ9A 1PAMA 1C7TA 4CKQA 9CGTA 1CGXA 4J3WA 5CPQA 1PIFA 1CPUA 1QWNA 3WH8A 2J79A 2OWWA 2XTKA 2CKSA 3EMCA 1C8XA 2Z1KA 1MYRA 1OGSA 4HOWA 2VRKA 3VDAA 4CUCA 2WHKA 3LPOA 4AD0A 1R46A 1K9TA 2GK1A 3T0AA 4DWSD 3U7VA 1XC6A 1VJSA 4AZ5A 2VRJA 3UG3A 3IJ7A 4CGTA 3WD1A 3BUBA 2V3FA 2A3BA 1CGTA 2O9RA 2YLLA 3WELA 1TQTA 2XSAA 1PZ3A 1EO5A 4JL2A 2W91A 1WE5A 1JXJA 3MV01 5M3WA 2QHAA 3BVTA 4BQ4A 3WNKA 3SUVA 1Q6DA 3SEPA 2XVNA 1NOFA 4GQRA 1H1NA 3CZEA 1E4LA 2E40A 4FNSA 5A2AA 3WKZA 3SCPA 1O6IA 5DMYA 3VUPA 2JEQA 2DSZA 5HXMA 2UY5A 3AZSA 1UWRA 2XWEA 4R5EA 2X2YA 1V3LA 4GPNA 2J75A 1A47A 1NM9A 1LG1A 3WD4A 4J3UA 2OWCA 1HKJA 1R7OA 3A4AA 1UH4A 2BY0A 4QLJA 2E8YA 4RE2A 3ZJ7A 1K9EA 1R7AA 2WHMA 3MMWA 4MADA 2X2IA 5ABGA 1IV8A 5BWFA 1GVIA 3A22A 2B31A 2WCGA 3EMQA 4AZ6A 4WSKA 2YA0A 3DX4A 3OIHA 1JGIA 3TTSA 4P8VA 4WLCA 4AMCA 1JZ8A 2J78A 3G6MA 1VBUA 1JZ4A 1VENA 3FN9A 1PIGA 3WEOA 3CUFA 4F79A 4AEEA 4LYRA 3BMWA 1H41A 3WFZA 2JIWA 1CEOA 5EMYA 2F1AA 4PMYA 1R8LA 2F61A 2WNWA 1GVYA 4GO9A 1H5VA 3AYSA 4BA0A 1ESWA 1W1VA 5C71A 1G9HA 1CGUA 1E0XA 2WB5A 1J0HA 5I0DA 3EDEA 2VT0A 4DWSA 4ZENA 3II1A 4B15A 2WMIB 1JYWA 1GHRA 3AJ7A 3GBDA 5FOOA 2F2HA 2WMFA 1D2KA 1CXIA 3AICA 3RJYA 3MSGA 3WH5A 3M07A 1WDSA 2WC3A 2WZHA 3N15A 2CPUA 3WMBA 1WPCA 4JL1A 1BG4A 3VDBA 2OSYA 5D8ZA 4YPJA 1RD6A 1JD7A 4P8WA 4ATLA 4HZ6A 2AOSA 4M82A 1PPIA 2WMKA 4AZGA 2VZOA 1UKQA 4DWSC 2XJ7A 3WDHA 3WIJA 5IXEA 1XH1A 2FGZA 1E5JA 1DWFM 4M29A 2PI6A 2CITA 1NWTA 2O9OA 1NOUA 1KR0A 3WEZA 3H54A 1E1FA 3DDGA 4BQ3A 1MFVA 1XGZA 3FY1A 3EJTA 3HJEA 1XYFA 4P7RA 1E6QM 1T0OA 1OD0A 3KZSA 4V28A 1QHZA 1WO2A 2RGMA 1E9LA 2BHUA 3OLDA 3ALGA 3WD0A 3WNOA 2OYLA 4XV0A 1B0IA 3S5ZA 3UCQA 2WC7A 4FLSA 3K46A 4E4PA 3N11A 1M01A 2GK1B 5JIWA 2XUCA 3ARPA 2VRQA 1TUXA 3WDPP 4AISA 4DUXA 2W92A 2XN2A 1JZ6A 2VC9A 5D8WA 2EPLX 3WF4A 1QI2A 3WMCA 4AEFA 1JDDA 3TTOA 4MTVA 2DT3A 2FYVA 1UR1A 5A69A 3DHUA 1CLVA 2XVKA 1KBKA 8A3HA 2V3EA 1LL4A 4PBGA 4P7QA 2NT0A 2FH8A 3W82A 1ZS2A 2EEXA 2XWDA 5EB8A 3WD2A 3BAKA 1SMDA 1CXKA 1TQWA 1FH9A 1VEOA 5AY7A 2Z1SA 3BUDA 1Z32X 1DEDA 1KGXA 3AZRA 1XRVA 3SCVA 3OZOA 5D9MA 1C93A 2EO7A 1FHDA 2DSUA 1NP0A 4TVUA 4HU0A 2VJXA 4FNRA 5I5RA 1KXVA 1M04A 1QBAA 5IFTA 2WWDA 3W38A 5FD0A 3KLKA 3AS2A 3MUAA 2FHBA 4AWEA 4JCMA 3WUGA 3WF2A 1GQLA 4HMCA 1AQ0A 2WK2A 5EFFA 1BG9A 2JFEX 1HJXA 2WLZA 3PZNA 4F66A 4CCEA 1V0NA 4DO6A 2CBIA 1MFUA 4CVUA 3AFBA 2WKLA 2VZSA 4NSBA 1WDRA 3WBEA 4H7VA 1UA7A 5IHSA 3K1DA 4PTWA 4GXPA 1UHVA 4OKDA 1FFQA 2VX4A 4LYQA 4AD4A 1E6SM 2PBOA 4H41A 1ZBKA 3CZGA 2ZX6A 3VILA 2QV4A 3W37A 1B2YA 4Q22A 1PJ9A 3AMKA 2BHZA 1IZKA 1UKTA 2F7RA 1R33A 2EJ1A 5BRQA 4RL3A 5BXSA 3CMJA 3ARZA 1B3XA 1LLOA 1J12A 3SCOA 4MB3A 5E0FA 2X05A 1Q6EA 2WXDM 2J47A 1O7DC 3AIEA 4PRWA 2F7OA 3OLGA 3AIQA 4FNUA 2J7DA 4NZCA 4DWSB 1W32A 4BF7A 2J8GA 4CN4A 4WKHA 3T2QA 3UR8A 2BY2A 2VQUA 4PMRA 4HZ8A 1QVBA 3S6TA 5HPOA 2F18A 1I1XA 1JZ7A 1DHKA 3AMLA 1GCYA 4AIUA 2W4XA 1OSEA 3AMDA 4B3KA 2YBTA 1J0IA 2PWEA 1V0MA 1J0KA 1BLIA 3F5LA 2VX7A 1V03A 2DH2A 3VGBA 1GJWA 1L8NA 2D1ZA 2EADA 4J28A 3CHCA 1UASA 1ISYA 3BAXA 4Q7NA 5M5DA 1HL8A 3GXTA 1TA3B 3JUGA 3PZQA 4FLRA 3L4VA 1C3FA 2WKGA 1XCWA 4W8AA 4P7OA 2ZXBA 3CBWA 4W7UA 3VX1A 1HKMA 1V6UA 1SZNA 1FHLA 5DF0A 5AYBA 1DTUA 1QNOA 2VCBA 1JNEA 1K6AA 3NDZA 4ZXLA 3AXHA 1EIBA 2XVGA 3ZIZA 1EOMA 2Y24A 1KTBA 3BUIA 4P7NA 1UH3A 1RP8A 3WUBA 3CC1A 3WQ4A 1HN1A 1E73M 2CCRA 2PC8A 2Y4SA 5A1AA 3BVWA 4PEEA 4JKLA 5E70A 4MB1A 3VSVA 1NQ6A 1CXHA 3MUZ1 4MNKA 3NSMA 1ZBCA 2WC4A 4C7DA 1OM0A 3AROA 3QOKA 2WW5A 3PZMA 1C91A 2BVTA 1ISVA 1Y7VA 1QNPA 2E8ZA 1E70M 4D6IA 4D6HA 5DEZA 5EFDA 1XD1A 4U31A 1JYNA 1VFMA 1E0VA 4J3XA 5E6ZA 2VZUA 1VFOA 3T0BA 1GHSA 4UR9A 1KQZA 2CERA 1W1YA 2J7FA 2HISA 1W9XA 3ARVA 4OOUA 2WBKA 3PBGA 2ZUTA 2J8FA 2D0HA 1H49A 2WANA 1B90A 5I6SA 1E3XA 2EABA 2DT2A 1JD9A 1U30A 4OZOA 3NSXA 2X0YA 4BQ2A 3EDJA 1V3MA 1KWKA 2V5DA 1EH9A 3D51A 2C0HA 4C7GA 3WY4A 4PTXA 1DWHM 4UNIA 3CZJA 2DEPA 1UWTA 1UKSA 1UD5A 3GXFA 3VGFA 3ZO9A 3W27A 4JHOA 1LQ0A 1J18A 2A3HA 1QPKA 2CYGA 3CHDA 4LGXA 1MWOA 3GZAA 4K68A 4QLLA 3SUTA 2W5FA 3N17A 3VIMA 3KWXA 3GXNA 1BTCA 3E1F1 1F4HA 3EDDA 3VO0A 1M03A 3M6DA 1TVPA 4U33A 5I79A 3A5VA 3ARQA 4LPCA 5FCZA 4LQ1A 3CPUA 3WQ5A 3PZOA 4UFKA 1C92A 2JF6A 4NF7A 2WSPA 2JEPA 4AD2A 4GI8A 3VD4A 1GONA 2YBUA 5I24A 5LYRA 4PMUA 4W89A 4ZE5A 5LA2A 1LL6A 3M7SA 1QOXA 4U3CA 1MQRA 4KRUA 1OBAA 2EPOA 3FAWA 4Z2IA 2GFTA 4XUYA 3NYDA 1UA3A 6TAAA 2BNJA 3VIFA 3AYRA 1XHGA 1Q6GA 3SIMA 4FMVA 1LL7A 5HPCA 4MPKA 1VBRA 4BQ5A 4AD1A 2OLHA 4L4PA 2QPUA 4B3LA 5JBDA 1BYBA 2XSBA 3LXAA 1OT2A 4UQDA 4D6GA 4W8LA 5IDIA 3PTKA 3HZ3A 3TTQA 3FXYA 3GM8A 4AYGA 4M56A 4U2ZA 1W91A 2WMGA 1C8YA 1E1EA 2VX5A 1UWQA 3LRLA 4MAZA 1EOKA 3F5JA 2D23A 4PN2A 2ZUSA 2VI0A 4HOZA 2GJRA 3ZT5A 1W3HA 2XM1A 3EJUA 1E55A 1HKIA 3AQUA 1OT1A 5FL1A 4AC1X 4W86A 1E6NA 2XVLA 1E71M 2ESCA 5CSUA 1VAHA 1R85A 1ISZA 4PSRA 3B9AA 4MNLA 4PMNA 3CZKA 5CJ5A 3D52A 1ODUA 5A6JA 1HJWA 2YDSA 7CGTA 3AOFA 5A8MA 2VURA 1B3WA 2ZXQA 2X0HA 1TQSA 3A23A 5BCAA 4NZJA 3VMPA 4D71A 5CLTA 5I78A 1TE1A 2PF0A 2CBVA 4DM1A 2ZICA 3AS0A 4MDPA 4NRSA 3MANA 5A6KA 1V3JA 1YQ2A 2J7BA 3QR3A 4P8UA 3WF0A 1EQCA 4H8VA 4PTVA 1QI4A 3RDKA 1GPFA 3AS1A 1BYCA 3DX3A 1JDAA 2ZUVA 1GQIA 5CGMA 1ITXA 2G41A 1MW2A 2WVUA 4E2OA 3SCSA 3A6OA 1BVNP 1XD0A 4JKMA 2QF8A 3D50A 2ZUNA 4NI3A 3IGUA 1CLXA 3GYCA 3GNOA 1LWJA 2WCAA 4WKAA 1UR4A 2E4TA 5TD4A 4W8BA 1U2YA 3PZTA 4MDOA 1M7XA 1OD8A 1VB9A 4QLKA 2HVMA 1PX3A 4GZJA 1UOKA 3AIUA 1QNQA 4P8XA 1X1NA 4JFTA 1JZ2A 3ZJ6A 1I1WA 5M03A 2ZXAA 5GQBA 4UFHA 2BV9A 1VFFA 3H53A 4W7VA 1PEZA 5LA0A 3BSHA 1JL8A 4RE3A 1GOKA 1VRXA 5F7UA 5HDRA 1KQYA 3S5YA 4W93A 1C90A 3AMCA 1XYZA 3CO4A 1QNSA 2WSKA 1KXHA 2BY1A 2PWFA 1GORA 3IJ9A 4ZE4A 1BYDA 4UFLA 3I3DA 2F7QA 4W7WA 4JFVA 3PHAA 3WNNA 3GH5A 2D20A 1AVAA 3G6LA 4J3TA 4CD4A 1KXTA 1TA3A 2OW7A 4V2XA 3QGVA 3VGHA 3CUJA 3MMUA 1GQJA 4Z2KA 1C8QA 1TZ7A 2TAAA 3AZTA 5A94A 1CECA 1CXEA 3VPLA 2OSWA 3M46A 1G0CA 4PMVA 3O2LA 4UZUA 1I75A 4ZFMA 1KGWA 2YL5A 4TTUA 4CU6A 2J7CA 1QNRA 3CUIA 2Y5EA 3CIVA 1W9VA 4HPGA 4TXEA 3VD9A 1E4MM 1HXKA 3ZMRA 5BRPA 2AAAA 2NSXA 1AMYA 1H0IA 1KBBA 1X6LA 3OGVA 1SR0A 5ABHA 1CGWA 1JF5A 3WQWA 1KCKA 3BCFA 3T08A 2ZX5A 5CPSA 4HZ7A 1TG7A 2GJXA 5HOSA 2WWCA 3WY1A 2WVTA 1V08A 3VTRA 1FP8A 2V3DA 1W9PA 1GNXA 3WEMA 1JDCA 4JAWA 3WDQA 1HL9A 3CV5A 1QI0A 3RCNA 5FIPA 4PCSA 2XYLA 5ABEA 3TTYA 1IZJA 1R86A 1QWUA 3HG3A 3NCOA 1V02E 1HJVA 1U33A 1JI1A 2UY3A 1UD8A 3WFLA 1UH2A 1KR1A 1MXDA 1B3VA 3ARXA 4MNJA 1VEPA 3LXBA 1SFSA 2PWGA 2OYKA 4WF7A 4NXKA 1HT6A 4H2CA 1G01A 3SUWA 5CQ1A 3K8LA 2DQXA 2G3IA 1UWSA 1EDTA 1WZMA 3OLEA 4ACYA 2CKRA 4UFJA 2FHCA 2O9PA 1KXQA 5HBFA 1MW0A 1W9DM 2DH3A 1UR0A 3IK2A 4PMZA 3AIRA 3B9EA 1DWJM 1D7FA 2VZTA 5E9AA 4AZCA 1PX4A 1LG2A 3UEQA 5A6AA 3EJPA 3LPFA 1BAGA 1CYGA 4FK9A 4AIEA 2BY3A 1NP2A 3N12A 4M81A 4PCTA 1OGGA 2DSKA 4PTMA 3BUPA 4NXSA 5DT7A 3LX9A 1FP9A 4ATDA 1E0WA 1V6YA 2W66A 5JBFA 1G1YA 5A8NA 2FHFA 4TVDA 1HJUA 3GXDA 3WN6A 2D24A 3UETA 2JALA 4CN1A 1Q6FA 3T2PA 3MSDA 2DIJA 4UTFA 3BVVA 4PMDA 1JYVA 2OYMA 4WJXA 4NZFA 4HP5A 3VD7A 4MJ4A 2DT0A 3LRKA 3SUUA 5CLWA 4IUGA 3NSNA 3L4XA 4D1IA 4EKJA 4ACZA 3BH4A 3ZR5A 3FHQA 2XPKA 4FNQA 4AZIA 2EQDA 3NDYA 1V0KA 2YL8A 1JG9A 3VM5A 1BF2A 1UD3A 3K4DA 2VR5A 2J77A 3EDKA 3D3AA 4WK9A 1ZBWA 1WZAA 1EDQA 1E6PA 3VSTA 1E5NA 3QHNA 1RP9A 4FLQA 3VIGA 2ALWA 1BGAA 4YN5A 2BXYA 1TQVA 2WM0A 4AD5A 1E43A 4UFIA 1LF1A 2VTFA 4OBSA 3LRMA 4CCDA 3DC0A 3NIYA 1XSJA 3WQVA 2VUYA 2YA2A 3IJ8A 3TV8A 2CHNA 2ZIDA 1FH7A 2A3AA 2PB1A 3GBEA 4UOQA 3AI0A 1HVQA 1MXGA 3BVXA 2XM2A 3L4TA 1GUVA 5A6SA 3O9NA 2VVNA 3WDIA 2BVDA 4UQEA 2F8QA 1DWGM 1W2PA 3TA9A 2J62A 1E6RA 1PX8A 1W9UA 2WZEA 4AZ7A 3OBAA 3AXXA 2RGLA 3DYOA 1PS3A 3QHOA 3ZQ9A 3WH9A 3UERA 5A8OA 4HU8A 3ARTA 3BLKA 5CXPA 3VDCA 3GTNA 2E9BA 5GNZA 2XHYA 3W29A 1EHNA 2WYSA 2O9TA 3HG5A 6A3HA 2FDMA 1BFNA
chains in the Genus database with same CATH superfamily
1FP5A 3UGEA 3BZEB 4HA4A 1ASQA 4TV6A 3I3EA 4MJIB 3PTQA 1MH5B 1MHCB 3DSFH 2A99A 4D0BB 1WOBA 3HZMB 1U1HA 4AWSA 2XZ7A 4OSUH 2Y36L 5MF5A 3MNVA 4IS6B 2X42A 1XP3A 2O4QA 5E6RB 1J11A 4AEIL 4WGKA 1KYDA 3OJDA 1YTKA 3KPSB 3HFTA 1EHKB 4Z7WF 5IHZB 2TSBA 4X2RA 1KLFB 4AH2B 1KTLA 4QCIB 1X5HA 5KZCD 5EV7A 2HJLA 4OV6F 2A74A 3T09A 3VIJA 4L4VB 1VJIA 4N0RA 5LNSA 4J7RA 1GEHA 3BVUA 3WEXA 1E42A 5D1XA 3FQNB 4L6OA 2H6OA 1EF3A 1I8KA 4QXWA 2J6EH 2IDCA 2WAQA 1S5MA 1EZUA 4NX0A 1ZP4A 4NYLA 1UATA 5T5FL 5B1BB 3VE0A 3JV6A 3W9DB 3NPSB 3SPGA 4XZ4A 2AL2B 1LNUB 5KBKA 3O6AA 4MZRA 2FLIA 1VRDA 4FKHA 4U1SA 1S6NA 2J73A 4YDIL 3MLRL 2XIJA 3VXME 4YXKH 4PI0A 1D5ZA 4MJ2A 4XNYH 4Y4HB 3U30C 4HHHA 8RUCA 4Q14A 4HTYA 1SGKA 4IRJC 2DD8H 4AVKA 1NQBA 2Y2TA 4FA7B 2N3JA 2QW5A 3NGJA 3TVMD 4ELME 2VLRE 5DUBA 2C1HA 4L2LA 5JPNA 3P62A 3BMVA 1KIQA 1OCJA 3C0QA 1CIDA 1IZCA 4A3YA 1CFQA 1GGUA 1JCTA 2A6DA 4D6CA 2DWYA 4OR1A 4G6FD 3N25A 1OK0A 4KIRA 4MKTA 4LASH 5CP7A 4QRRD 2XBTA 3MJ9A 4X9GA 1W37A 4PJ5D 3HMXH 1QOKA 3MLWL 5EF1A 3Q1SL 3QUXA 2QZRA 3B8SA 4ZSOA 2FJHB 4Z2GA 2NY6B 3FGCB 2WYIA 2GQ3A 1YLBB 1OEPA 3LKQB 1R3VA 3CVIL 3QFDB 3IETA 1XO8A 1MFEL 5AOJA 4WK2B 3V5DA 2D2GA 1ONQA 2EINB 4GG8B 4V1DE 1F07A 2RQEA 2HE5A 4IPLA 4NQVA 5ANMB 5IW1B 5DJ8A 1OGAE 1KFAH 3HPJB 5K9CA 4OZHF 3PWPA 5JW5B 4HSQA 2Y06L 4J27A 1NOWA 2FTPA 3FXGA 3VXUA 5CLXA 3N6YA 3ASWA 1KB5B 4YSDA 3PDGA 3MLZH 2JVUA 5IF0B 1U2CA 5LIYX 1JPFB 4ZNEA 3NH7H 2ADIB 2XBZA 2BM3A 3VUAA 1L6WA 2HKAA 5LWYL 1TTRA 2G4FA 4PWEA 3RY4A 3ZOAA 5HPMB 2XI9A 2R0ZL 4MRCA 2VX6A 3AAMA 3MMTA 3S7GA 4GLEA 4N2YA 4W9JC 2X9WA 4GI9A 3SY0A 1P9MA 1J7VR 4WV1A 4D6DA 5FECA 5TDNA 3OLIA 4XX5A 1JNHA 4PGDB 5FXCH 1GY1A 5E95B 3U4KA 3UOAB 5HI4D 1AGDB 3CMOL 3A47A 3BLEA 4HLEA 3QCVH 5AZUA 2AV7B 4ODXB 2GDVA 4ALAL 2HFEA 2J1ZA 4XXDB 2ZWYA 3E0VA 2ZRWA 3FH7A 1IC7H 3JV4B 1ITCA 2V9RA 3KLDA 4MYWB 3L3IB 3ZQWA 3KGUA 2ARJB 1A3ZA 3NIGF 1U92B 3CQKA 3M88A 4JREC 4A39A 4EACA 3O6FD 5IB4A 4M6ML 3UIZA 4DPPA 1RMFL 2QMKA 3BQ6A 1EJXC 2J88H 3CB8A 1TSRA 2BNRB 3CXHK 4WSJA 2HPIA 3UABA 5LZLA 4FZEL 1SGJA 1XDLA 3GVVA 2YDQA 2E86A 2RJGA 1UFUA 3FB8A 3KEDA 1A3HA 3UP6A 5KTEL 4JTUA 1KEGH 3N40F 1KGJA 1G1CA 3RIAK 2V5CA 1E5BA 1UD6A 1YEDA 3LH9A 4NKMA 5FYKU 4LUSA 3LXCA 1NCDL 4JX6A 2D7NA 1DBTA 1WVZA 1KXVC 5EN2A 3W70A 1VCVA 2GABA 1KV5A 4UTAH 1RU9H 1E1CA 1WUNT 2B1OA 3RF9A 4OUOA 4ZW6A 1C9WA 4U3AA 4HS6A 5KTLA 4P2AA 1XIBA 3F85A 4EBQL 6PCYA 2D2OA 1XF4A 2CBUA 1SY6A 4E41D 1OV8A 1IC4L 3PJLA 5D2VA 1NLBH 3TAKA 2QTVA 3UZXA 3WXVL 3C2RA 4TULL 2ZAIA 1KM4A 4JO8A 4DQAA 4AG0A 2OXHA 3K6FA 4AL8L 1Z5YD 1UVQA 4MXQD 3FO2B 4OOZA 1FIGH 3EOTH 1S9VB 4QDMA 4GRSA 4ONHB 1YY8B 3ICJA 4OFPA 1A7NL 2J74A 2UBPC 3UJIL 2NY0B 2D9QB 4WJEA 5D4HA 1IEVA 1JZDC 4ZTYA 1Q65A 1SDDA 2EXWD 3NPWA 4BWTA 3ARGC 2I60L 3GUFA 1KKRA 1J5CA 4P5KA 3MHGA 1CGYA 1PY0A 3FCBA 2QUNA 3GINA 1SXCA 5D9SB 2DIBA 1ZTXE 4LLUA 2H0PA 4PJBB 1FNGB 2HE8A 3OVRA 4JDTH 3QZBA 3EGDA 2N1KA 1NCHA 5SWZB 5D71L 2H1LM 2DIAA 3KHOA 3EUUA 3MYZA 4QE5A 4WHTB 5JXAH 3GIQA 1VYSX 2YQ2A 2KPNA 4PYGA 2DQCH 2CLPA 4MJ6B 1XCXA 3S2CA 3UJJL 3BQUA 4DB7A 3GMNB 3FBKA 4NFBA 5I66B 4I0PB 2G2RB 1M6OB 3LHAA 5E2VL 3U9UA 2C4FU 2EDTA 1MLBB 3STFA 2VXUL 4LRIC 4XOAA 4EIBA 3UD6A 3ARWA 5AOMA 4O10A 2PYFA 4XPGL 1JNDA 1TFPA 4D6EA 4X99B 1IGFH 2YXWA 3F83A 3FSVA 4FTVA 2C3WA 3GC5A 4NNXA 5DS1A 1BQCA 4GGBA 1EAPA 4H7CA 3F2DA 5J9PA 1Z7AA 1C12A 1YDPB 4E36A 3NSCA 3TH3T 2A3CA 3WDRA 5DX7A 1VGAA 3BGFB 4B27A 2WUCL 2EKJA 43C9B 4N2FA 1GW9A 4Q6XA 1OAJA 2UVFA 4BWLA 4RDQG 1SVCP 2Z25A 1IVLA 2AK4A 5E6ID 1VJSA 3T05A 3P4NA 4PGEB 2F8IA 3QA3B 3AUJA 3M17B 5FW6A 1ZRQA 2XSAA 2RDWA 1DQQA 4Y19E 5GZOC 2YR1A 4HUMB 5M3WA 4O57A 2EDJA 3SDAB 3URNA 4U1IA 3C60A 3DG6A 4W6WB 3TO2B 2IAMD 4Z7OB 2B1HL 3TWYA 5IOKA 2PDXA 3K0YA 3ABLB 3H8AA 4JHWH 3OAZH 2E8YA 5F0PB 3JU2A 3F6LA 2XC8A 4AZ6A 3MI2A 1L9WA 3A6BH 1AGCB 1JZ8A 1JZ4A 3CUFA 4OFYA 1FO0A 4BF9A 1I3RA 3MBWB 5GGTA 3CVHH 1L5GB 3LN5B 4NGHL 5DMIL 1A5BA 4G2DA 4UOW0 2IGLA 3RCMA 3D12B 1ZGLP 2WHVA 3PCYA 3O0KA 4Q0XL 2IMNA 2Z92A 4C58B 1DJWA 3REWB 3NG3A 2XIOA 3JS3A 2Y1YA 3MAWA 5INDB 4PRIA 2BCKB 3RL2A 2W95A 2GY7B 3WMQA 4Y2OB 3K2IA 2CPUA 3C87A 4M5YL 1OSZB 4UR7A 5DS2A 3AUOA 3PV6B 2KLRA 4DWSC 2XJ7A 1YEHH 4LLQB 3GU9A 3O0FA 3TM6A 1T83A 3OXSA 2B5IB 5IUCA 3PB0A 3RWIA 3OKDA 2MEJB 4HK3J 5CHNA 3T71A 2XFWA 2EDKA 5HWNA 1O6TA 3RTQC 4QYAA 2E56A 1DQKA 3A67H 5E9DA 1D6EA 3INUH 4XZUB 3B40A 4U6XB 5C0BD 3I9PA 3DFPA 4W70A 1ZHNA 3IDYB 1RCOB 1XC4A 3DVGA 2K4AA 3DO3A 2X44D 4LP8A 6ALDA 1Z9PA 4QG9A 3ZX1A 3O3AA 2ZNXA 3L17A 4QT5A 4YN3A 2XPYA 4FXLA 2VJXA 1MCWM 5I5RA 1M04A 3BRFA 2ROYA 4M4RA 1ACCA 4JPWH 1NBYB 4FEMA 3L12A 5EOTB 2FQIA 1USQA 4R4BA 3IRSA 4F2MA 1ITBB 2JFEX 2XZZA 4A6YL 1HJXA 4D9LL 1V0NA 2FJGB 2FX9L 2PP7A 4LSSH 4NSBA 3U4FA 3D47A 5C0CB 3XINA 3P3YA 4PTWA 3AREB 4LYQA 3K2MC 1V6TA 1MFDL 1JTOA 2JJUA 3B0XA 1GKPA 3WHE0 1VGEL 3BKMH 1KV7A 4Z6AT 4RLDA 4G5ZH 4P2OB 2LU7A 1G4MA 2Y7QB 2O6EA 4BH7A 3JTSB 1BCIA 3VI4B 3ZKND 4YLWA 3SQBB 2GWNA 1XLEA 3OHIA 4NQCB 4BF7A 3ARBC 1MPAL 3V5HA 4LVHB 3NQEA 4POZC 1LK3L 4JJ5A 2CALA 4BEQA 4M9PA 1NMBL 1G9NH 4C5YA 4MXVE 3G9VA 1OG0A 5B4MC 3V0EA 2XTJD 3VOIA 3SYOA 1XS2A 3BAXA 4UQ3B 1G9ML 1G7MA 2NNFA 2K9FB 5GJTH 3L4VA 4HIJB 3CSYA 1W0YT 4ZXLA 1Q1JH 1OABA 4GXVH 2GVLA 3MV8B 1PG7X 2VYRE 1EIBA 4G80A 1OC6A 3LS5L 4G7FA 4QDGA 1ZA6B 1WFTA 3EX3A 4AKOA 3P14A 3FKKA 5HYFA 3IMSA 5A1AA 5FUOH 4D9RE 3WTSA 3T9WA 3KOXA 5E94B 3RGVA 1WF5A 4QRUB 1CICA 3ZUCA 4UM8A 3FFCB 1QNPA 4J3BA 4TO8A 1RD5A 3CH8A 3W7QA 1YUHA 3MRQB 4US6A 2WANA 1AHKA 3IDJA 1FC1A 3U6XA 4HW6A 1EH9A 3DFNA 5BS0E 5I00A 1BWLA 1IYXA 3FKRA 3D85D 4G7VL 1UROA 1UD5A 3IDXL 4BQCA 1DBAL 5BZDB 4GO6B 4AVOA 1LEIA 3E1F1 1M03A 2QKFA 4QHUB 4TMPA 5AB3A 4XCCL 1NUNB 1JUFB 2P88A 4Y9CA 4UFKA 3S96B 2VJ8A 2JF6A 4NF7A 2E5CA 4LUYA 4U1MB 2FT6A 1W8NA 3L5HA 4ZQKB 5DXWA 3VKAA 3MNZA 4GUIA 3SCMB 1ZHLA 2VDQH 2YBUA 3MP4A 3IACA 4WHYH 1XXXA 4Q2ZB 2JSFA 3T0XA 2OCZA 2EPOA 5HYJD 3JQOB 1G6CA 2PCEA 3H0TB 1HH9A 2PTYA 2JLLA 4QLWA 4HUKB 4M7LL 1TB3A 5T8GA 5FESA 5BJTB 1AXSB 3L45A 1GJPA 2OZNA 1NCGA 3WK3A 5IEKA 1S5TA 1YMMB 4Q9RL 4XCEB 2BDNL 1NOAA 4U10A 1E55A 3I7QA 3LERA 4X63A 2XVLA 1VAHA 1UOWA 3C09C 1Y0LA 1AACA 3IU3A 2G60L 1HJWA 1U4FA 5FM5M 2DUXA 1TNMA 3H6JA 2RJHA 1TJHH 3LZOA 3EOBB 2H8XA 3P54A 5CPLA 1A7RL 4D71A 4XIAA 3RX8A 3MRDB 3S3GA 4UV4L 4HAGA 4MDPA 3MANA 1PTDA 1X44A 3QJHA 3M0IA 1SBSL 5D7KE 3I6SA 2EEDA 1UXMA 2ZKWA 4MJIE 4MMWA 5CGMA 3GRBA 3RKPA 1MW2A 3G5VA 4HPXA 5DFVD 4LTSA 5B3NA 4XP4H 3D50A 2NY5H 1OPGL 1T21B 3I9GL 1AGEB 5G5DA 3BD5A 5KVDH 4O54A 2OQHA 3O6YX 2VXVL 4MDOA 2E68A 4UM9D 4HVXA 3ZDXF 4DY1A 2EIZB 3FQ2A 5AOKA 5C9JB 4ZX6A 2VD9A 5T1DL 4M6OH 4NWUH 2NY3D 3SD5A 2V4LA 1JEZA 4QXVA 3LG3A 5F9WB 1Z9OA 3KCPB 1VCFA 3WLIA 4HF5H 1TV3A 3HQOA 3AMCA 4DLFA 1KIPB 5A2FA 1KXHA 4TN9A 2Q20A 3L7FA 5ABAA 4AHOA 4ZAKD 2X6CA 2QJMA 3QDJD 4RISL 3BJ91 3RX7A 4GBXD 3SGKA 1J8HB 3JR2A 3V0WH 2Q2EB 3UTPD 1H1YA 4QO1A 4G70B 5ALBH 3S37L 1AP2A 1PMYA 2YAHA 2HQAA 2EIDA 3PAOA 3OHMB 2FPYA 2ICCA 4RXGA 5JMOC 2E76C 2XACC 2NNRA 3WQWA 2ITEA 2WINA 3N9GH 5HOSA 1V08A 3VTRA 5K9XA 4KDTA 3OKKA 3WK1A 4ETYA 2LV4A 5ABEA 2IV9A 2QQQA 1HJVA 1T0MA 2Y7SA 5B38B 1ZLVH 5AB9A 1UWSA 3FT3A 1YKWA 2FATL 4OV4A 2DH3A 1CLYH 4PJDA 4LDOB 3UA3A 4UQ2A 1F3DH 1N8IA 1MHPH 4KAQL 1XGQA 4PTMA 2FB4L 4ATDA 4MZ3A 5IG7B 2YXFA 1IWAA 3SO3B 4GLRH 3RPIB 2V17H 3UETA 3MNWB 2MTAA 1CI1A 2X88A 1XZ0B 3HS8A 1JPSL 2AXGB 3GWQA 4KTGA 4XO9A 4IUGA 1ETZA 1RUAL 3BH4A 2ZPKH 3FQ4A 5EORH 3NN8A 4AZIA 1K8DA 3APMA 1V0KA 4I7ZC 4W6XB 2DQ6A 1KY7A 4A37A 5ANME 2WQSA 5M94B 3QI9A 3HHSB 3RVTD 2WO3B 3MUCA 3U46A 1YQVH 1ZIAA 1YEEL 3IGSA 5K9KA 3QXTA 3NPSC 2YA2A 3D46A 3GBEA 1XDMA 3LNMA 2VVNA 2NXZD 4XUGA 3QAZB 4UQEA 3RX2A 2J62A 1MIEH 2QCLA 2AQ3A 5EULV 5I73B 3T0WA 4Y4HC 4DEUA 4GVIA 4QIUA 3B3IA 3VDCA 2DWSA 3R58A 3S36L 6A3HA 3GG8A 5B7YA 4MS8D 1DSFH 3D2UA 3R8RA 1PL3A 4J2XA 6REQB 3LMYA 1LRQA 4AIOA 4LKCB 3OR6B 3Q2VA 5EF3A 1XJBA 1HOCA 1ROCA 3L95B 3W7MA 3ZE2B 3ROLB 4L4MA 1QFUH 3ZM8A 5BYWA 4WI0B 2H3XC 3WXWL 4P0DA 2J43A 1ZV5A 1ZJBA 3BW9A 4Y2LA 3QYMA 1AJ2A 4UQ9A 3ZXWA 1KFEA 2NY6C 1WBXB 4HG4K 2VOMA 4MWAE 5IMOB 4FIRA 2OULB 3I3BA 1KM5A 1E9YB 2IKJA 4FG4A 4D3CL 1A6UL 5J6HA 1B4JH 4MD5A 4J5VA 1P1ZA 1EKOA 3OB8A 5EU7C 4NZRH 2K0RA 4HKXB 1T0NB 3BIKB 2N4IA 3NXFA 2CR6A 4H26B 3RM8A 4IGBA 1MZRA 5A6MA 1OHZA 3ULVL 4ZMOA 4DOHB 1GOOA 1A65A 3QPXH 3FUKA 1YEIL 3GLZA 1U8IA 3ATBA 1EVUA 2XETA 2QGHA 3BFWA 3H6AA 2IH9A 2FBOJ 2ESVA 1QVOA 4Z0BH 1YXYA 1T96A 2BFVL 1H0DA 3ZZLA 2CETA 2Z31A 2IQDA 1N6UA 1LEKA 4PLJD 3HAEG 4K94L 2R56H 3N9RA 5FO2A 2AABH 4H8NA 2MH4A 3PZVA 3RVUD 2V2TB 1LD9A 1VCGA 3EO0A 4PRDA 3UF9A 3ENEA 5F1NB 3ORJA 5AKSA 3QUZD 1OGBA 2F53D 2PLTA 4AK1A 1QBBA 4B3ZA 3ME0A 2VO5A 5DJYB 4GUOA 1SQMA 1UWAA 1Q4WA 4PZVA 2DQFB 5ESAB 1C16A 2JE8A 2X6VA 1IGTB 3ITXA 1JV2A 4LLWB 1ZSDB 2H2SC 1AMXA 1RVFL 3CUXA 2VUOA 1F2QA 2WXLA 3FJNA 2X4UA 1ZGLB 1FWXA 1U5VA 1FWDC 2J8UF 2AK1H 1IGYA 5BROA 5I6XC 4MWAC 4GABA 3UO8B 3RLGA 4A6YA 2Y5QA 4OQ1A 3VXRE 1M9SA 3ZSTA 3IRDA 1QMLA 2Z7GA 1I7UB 3DK0A 2PZ0A 5AHMA 1C1EL 4GY4A 3V52H 4FYQA 3WLRA 4X4XB 2J56A 3ISYA 4OFVA 2I07A 2G5RA 4R88A 1QSEB 4PJBE 2W0FA 4XVEA 5GIRB 5CZTA 2YXOA 1O60A 4WWKB 2V33A 4F8OA 4UIMA 2F9BT 1YN7B 4JK0D 3TO4A 2WLLB 2IPFA 1IC0A 2E3ZA 3AU2A 3CDYA 3TOPA 3EW3B 3B9KB 3CDFA 1MVYA 1I0DA 4TVPD 1L6YA 4KKBD 4O5LH 5IB5B 1L7IH 2W61A 4LRNL 2OTUB 4L37A 1E67A 4U7SA 1Z0NA 4OCYH 1PFOA 5HANA 3K2UH 4GWEA 1T7VA 1R24B 1G1OA 4TOQA 4YPGA 4HKPA 1SOQA 4RBPH 5JO5B 4JQ1A 1T99A 2W9DL 3KWSA 4N6EA 5DXXA 3G08A 1QEXA 4Z7VB 2JXMA 4E8DA 1HKFA 2J7HA 3SZ6A 4PUEA 1PTZA 3PL6D 5HYSA 4BFRA 3FK4A 3V0TA 3ZE0F 4G43B 2OTWA 4PUMA 3EOAA 1U83A 4RMSA 1VZIA 1HEHC 2DGAA 2WWMC 1LP9B 2V81A 1EO7A 2IFFL 3SDYH 2ANUA 3IMVA 3UWYA 4FA6A 4H6EA 3ITYA 1WAAE 1JWMA 1RFDH 4F5CA 3N44B 4XHJC 1MI5B 1AR2A 3MA7B 1RSYA 4XB3A 1FFNB 4NERA 2BX7A 2A2QT 1HP4A 4NVTA 5FHBL 1NCTA 1P6FA 4KK9C 3GC3A 4BS0A 1A6WH 3OKYA 3H2AA 2DQIH 2J13A 4TNVF 2HDJA 3BG9A 3V75A 4KF1A 3F3HA 4ORIA 3M0YA 4DP4X 3MUHL 1DUZA 2BCMA 3IXTB 3QZOA 1KELL 2R2EA 2OEJA 4TUFA 4WY0B 3HIJA 1QNVA 5FJRA 2UY7B 1U6AH 2YOAA 1H62A 4I3RL 2WCSA 2GSEA 1L6XA 1TT6A 1FG9C 3PYCA 4BFIB 2Z93B 4ZMWA 3O0LA 4ZODA 4JVUA 2CCWA 1JK9A 2VAAB 1WAPA 1Z5LA 3BAEL 4M7ZC 1T8QA 2WQWA 1JXKA 1T5AA 4I0PC 3P74A 3R94A 1RIVH 3POHA 2OTPA 2BSRB 1IEWA 1E9IA 2HRPH 5ICUA 3JTTA 4MZ1A 3FO0H 3QXAA 4WD0A 3EOYG 3HC2A 2OMZA 2OJPA 1F3EA 4XD4A 5CZJA 4U6HB 5L2KE 5J56B 1ZV2A 3DWTA 1I7RA 3BGFC 2ZXGA 5SX4I 2CIKB 3NQDA 4TUKL 2FJFB 2W80C 3DTXB 2XBDA 1CFSB 2PR9A 4MLIA 3SCQA 2O7SA 1S7XA 2IV8A 3NQVA 5FF2A 3UA4A 1KBIA 3CZLA 3RFZB 3VCCA 1QJWA 4EUPA 2NRDA 3EKLA 5AC5A 3SCUA 3JWNH 1FGNH 5HHOD 3MBFA 3OG2A 3VMNA 3CYJA 1UZ8A 4MJHA 2BVPA 1FZMA 2IQ9H 4KK6D 2RJMA 5DRNA 1IQDB 1K02A 4J3OC 4RGNE 3S1VA 5DMNA 3EGSB 1XGDA 1F4YL 5L4IA 3AHXA 4Z77A 3SDAC 2ZUQB 3KS0H 3HGOA 3W1RA 4I7UA 2R14A 3MRLB 3LQGA 3HZYA 2HFFB 5TE6H 3ECBB 2R0WL 3GK0A 1A0CA 1R19A 1MVFA 3UPBA 1GZ1A 2B1AH 5C54A 4JPVH 1OALA 5DUPH 4KKRA 1TPH1 3WKPA 3JV5A 4NQEA 5KYUB 4N2BA 1CN4A 4WI6A 4Z7UF 4AI7A 2WMIA 2EIEA 2ZWNA 4Y4KB 1CIUA 1ZEAL 4XXWC 3M0VA 3V10A 4KJWD 3FDKA 5HDWA 2FZ9A 4QCFA 4YZFE 4P2RE 5DZOA 4PB0L 3QJZA 4JFFE 2Q7YA 2YPKA 1NGXA 2NV2A 1K9DA 5LDSA 1SVBA 4D8AA 1XV8A 3GDRA 5HQLA 5L9DL 5FACA 2PO6B 4MNQB 2ENSA 5D7LE 4DN4H 3FF8A 2H8ZA 1Q9WA 2QF7A 3GI9H 3S6CA 3S8GB 1E4XH 5ICYB 2D69A 5I07A 3Q6GL 1EXGA 4FP8L 1PAMA 4FPSA 4G7YH 1CF8L 1XCQB 1B3IA 2MUCA 1U3HB 3IS4A 3WQEA 3VI4E 3DRQB 1C8XA 3C5QA 2YC1B 4NQCE 4DJDC 4K8RL 2XRAL 4BFGA 2APTA 4FNLH 2IPKB 4QHKI 2AKRB 3QQDA 5DD1L 3LTPA 1FCVA 3AWNA 3RWJB 5M2FX 4OCSH 5LG1A 1RZGB 4DVRL 1FH5H 2B5IC 3FQYA 3DX8A 3PPCA 2EDNA 3MV01 1GGBL 3FQUB 2Q86B 4GD0A 4BQ4A 4K9JA 2OQYA 4MLJA 4GQRA 3FSZA 4WU5B 3M0MA 1CE6A 1SQ7A 4WW2A 4H7ZA 4JYDA 3LSOB 1RJPA 4OB5L 1J8KA 4NDMA 2XHNA 2H9AA 4N9GB 3OYXA 3NA9L 3TU6A 5DQJB 5DI8B 1BLNB 4C90A 4UTIA 4TVPH 4N5EC 2O5ZL 4JO2H 4MADA 1KDIA 4JZJB 4L5FE 1U8PA 4LVNB 3K72B 3ATZA 4QWWC 3TMLA 4ADJA 3K6DA 4HLZG 3QNFA 2ZC8A 1CT8B 3FFCE 5CD5D 4N3UA 4AF0B 2CMRH 4LAQH 1ZRUA 2AJSL 3RURA 4XCYB 3CX5K 3B05A 4X80H 1E0XA 4BH8A 2CO6B 5T5NF 2A9CA 3LNHA 4OZHB 5J8LA 1M7DA 3BSZL 4XB8A 3FTGB 1GC1L 2XJKA 5DD5H 2NVCA 5IW6B 4YFDB 2HNHA 25C8H 2X2GA 1J1PL 4P2OC 2GGHA 3GIVA 1GGTA 2C19A 2OBGA 2ERJC 1JD7A 2CRZA 4AZGA 4MMXB 2Q1EA 3OZLA 1GQNA 4ZZFA 1E5JA 2A4EA 4LVHC 2Q6ZA 4HJ1A 4BQ3A 3V5KA 1OF2A 3NDYE 3S6DA 1OD0A 1DN0B 3KZSA 1KCSH 4JFPA 4Q6YA 5J57B 4JTFA 5DC2A 4M3PA 2Q8AH 3ZXAC 3K46A 5HD8C 1QACA 3ARPA 4QXTB 5I1JH 1CFBA 4MTVA 4ZPVB 1BD0A 2V3EA 4P7QA 2WZAA 3CMFA 7REQA 5B1KA 1X1OA 3WUWA 4AG4L 4TNVK 1W3TA 5EB8A 3BAKA 5KJRH 4LCUA 4RIRA 3SJVB 4G42B 4UT9A 3B2DC 4ASTA 5C5YA 3DIDA 1RUKL 2BGSA 3B8YA 1VKFA 3MGTA 2O72A 3ARDA 1FORH 3SBWC 5L4FA 1T1YA 3UWQA 3NIGB 1Q6RA 5DURD 5A16B 1ORSB 1V7NH 3GKWL 5LXVA 1FAIH 4G6KL 4BDVB 2DN7A 3KWWA 3HM7A 1UBPC 2FJSA 5GHWH 4ZMAT 4BE5A 5GGSA 4FR1A 1ZBKA 3QZWA 3VI2A 1OP5H 5F7EL 2WKJA 3RVXD 4DQOH 1ZV9A 3WE6A 4OD2B 4EUPG 3H9SE 4AXKA 4ONFL 4BXSV 1AW2A 2J47A 1RJYB 4DH2A 3SYQA 4K6AA 5EUOA 5ISZA 2NQ9A 1VIZA 5I2IB 1L7TH 5GGRY 2F68X 3RITA 4XBGB 2QIWA 1Z48A 2DZTA 2WXPA 2V7HA 1JN6A 1POJA 1V03A 4L3EE 4LYKA 4LL1A 1LBFA 3MKVA 5LCVL 1G7QA 1NGPH 3B7UX 2L0DA 4NAJA 4APQB 1MCNA 3CBWA 5KVEL 5FGBC 1SZNA 5IVOA 4KV5E 3PPGA 1UJ3B 1NC4A 5DCEA 3VYOA 1IR2A 2KZHA 1S39A 1M7IA 2CDGB 3ZKQD 5F3FA 5I3GA 3N2XA 1ZLEA 4QXUL 4X6DF 2YSTA 3B34A 4GFXA 5JW4R 2DMCA 4D6HA 1OGTB 2BLFA 4WW1B 1JYNA 3KYAA 1D7BA 4M6VA 5EZOL 3C8KB 4BWWA 5D6CB 3G1VA 3CVBA 4RGOH 3UBFA 4L6DA 1E0TA 4OOUA 4LUTA 3OSKA 2J8FA 1I0BA 1YW1A 5LN8A 1X6UA 1WFOA 2XVBA 1A9BB 5EZIL 2A21A 1KPVB 4PJCB 1NJ9B 4FQXA 4N87A 1DL7L 5HBBA 2ID5A 4JOMA 4M7TA 1Y8BA 4OQVA 5EU6A 3CHDA 4LGXA 1MWOA 3ROOA 1N59B 1HKLH 1MEWA 1FVCA 2G5BA 3O8AA 3GIZL 4EI5B 2JKTM 4G8FA 2QHLA 1DQLL 5F9WC 4Y5YB 4L29A 3H9ZA 3ILDA 2B20A 2D7QA 4AQ8A 1RXLA 3TYFA 5AUMA 1KFLA 1A14L 5JOPD 4I4WA 3RLUA 1A1MB 3QRGL 3MCNA 5C3TA 3TCSA 1LDPH 3UJTH 1SJEA 3X3GL 1EFXD 3U9WA 3LA4A 3T40A 1LTXA 4O51B 3WYRA 1YPZF 4GRLD 4OT1L 1C8YA 4RSYA 2WMPA 4PN2A 4BGDA 1A1NB 4XE0A 5DUML 1T0PB 4W86A 4NCC1 1C08B 4PS4H 1CFNA 2XN9D 3B9AA 4MNLA 3GSXA 1KNOB 4ODTH 3QLDA 2ZXQA 1GGOA 3AT9A 1KN2L 2BRQA 5TGBB 3WV0A 2WV3A 4QEEA 2ZICA 1SOXA 3NJFA 3OKMB 2AJUH 3MFFB 2J7BA 5HUOA 5ETUA 3FYIB 2GW5A 1S9KC 1EQCA 1R9YA 4NX5A 4BKNA 3AUWB 3ARFD 2Z1XA 1BVNP 1CLZH 5EO1B 2HT2D 3ZYIA 5BRBA 4PLKD 1JV5A 2R1WB 1T1WB 1SHSA 3ZE2E 3KPQB 2NWSA 1I9RH 1QEWB 4TYUA 1XLDA 4L2YA 2R0LH 1QNQA 4FXGA 4UTWC 2AXHA 1CGSH 4ZTOH 5BNXD 1Y0EA 3SO3C 1ROWA 3ABRA 5LA0A 4ZVJA 4FS9A 3KTXA 4W93A 4DF2A 3I02B 2TSAA 4JQIL 2VXNA 1NWOA 2BY1A 4S10A 3BN3B 4DKDC 3E02A 3CQ0A 3V4UL 2P53A 3V0VB 3S5OA 1VYPX 5FLVA 2C9UA 1AVAA 3GMMA 2HVNA 1S8DB 4O18A 3UPRB 3D07A 2JK2A 1V8EA 2FEEL 4PMVA 2Q10A 3CHQA 3VJ6A 4TTUA 5CEXB 3DGGB 3O6LH 2CLOA 3HBQA 1UOZA 2M8XA 4HPOL 3IDIA 1I2OA 4GG6F 2H32B 1HHHB 5KSAD 4OI8A 2VWSA 3VWJB 3KPNA 1KIUA 2B9AA 3QAZC 4JJHA 1FFPB 4MXWL 1W9PA 3WEMA 4JAWA 4RMVA 3RCNA 3KHQA 3QZWG 3B9OA 1XLIA 1R86A 2X7WA 1HHJB 1JI1A 1QUNA 1QWKA 4TKWA 3TH4T 4DFIA 4F8QA 5HHMB 3FVMA 3D34A 4DBSA 4H5SA 3T1WA 2P80D 4H2CA 4B5WA 1OW0A 5LNWA 2QCCA 4CJ1A 1MW0A 2L7JA 1LYQA 2O5YL 2CHRA 4NO0B 3AIRA 2Z1VA 3KJ6L 5DT1H 4CBZA 3L3DB 2YD4A 4AYDC 5I6LA 1OSYA 3DX9B 3L2IA 3N12A 2E77A 3QG6A 4O4YH 3LX9A 3KPLA 4P5UA 3SDDB 4HJSA 2O4MA 3PSWA 3W3OA 5FX3A 1AIFB 5DTFA 4GQ9L 3WFCL 1PD1A 3MJ6A 4KQ4L 3V7PA 5AD0B 5C2UB 5FDYA 3JZ7A 5IBTH 1NEPA 4FALA 2CR0A 4Z95L 2VMDA 5J11B 4ACZA 1I1FA 2FECI 2X6UA 3FN0H 4JTDA 2AEPL 4D9QE 3K4DA 4FJYA 3CEUA 1TYJA 2PRMA 5B80A 3D0VA 3RX5A 1FL5B 1R0AL 2IC2A 3TROA 5ITFA 3FONA 1IF2A 2ALWA 1W5OA 1TQVA 2VTFA 1FWWA 2PYEE 3DC0A 4XP6H 3PNZA 4S23A 2PB1A 3FFDA 3NG5A 4ZSTA 3ESOA 3LNEA 1OF0A 5EYWA 4CMHB 5HINA 1FE8H 5A6SA 4UTCA 1OCNA 3O9NA 3EIFA 3QDMD 1OARH 2OODA 3MLXL 4UXDA 5GS0C 3QKZA 2P26A 2Q76B 3W74A 2R1KA 3M41A 1CMOA 5HHVH 1JHTB 4NZ5A 5MEPB 1FYTB 3PR2A 4P9HC 4O52A 2R2BB 3DMMB 2UUDK 3RG6A 5AVSB 3TZVB 3QO0A 3WCZA 1GR7A 3GRWL 4RQQB 4ESKA 5ADOH 3QFJE 1E6ZA 4PGBB 4Z7VE 1EO8L 5C08B 3WNPA 4N26A 3NEVA 5E2UH 3UG5A 1FL3A 4JY6B 1YY9D 1RL1A 1BF8A 2ASHA 4A55A 2TRSA 1LP9E 1BOGA 7ODCA 1NCWH 1LQSR 3GMPB 1HILB 3O9WA 1PKOA 3GDMA 4HWBA 1LO4L 1WAWA 3BZDA 1OIOA 3TSBA 1RJLA 2J24A 4K7PH 3P3TA 4PV8A 3VGAC 2C71A 2C7UB 3UY7A 3TUUA 4JANA 4YSCA 2RACA 3SDCD 4HA3A 4LBAA 4PJAA 3L3HB 3GS4A 4UT6A 2ACRA 5EF0A 3E6FA 3THCA 4JFOB 1HZLA 4G3YL 3NACH 3QUXD 1LLWA 3JT2A 4HA1A 3PGFH 5AYXA 3BSZA 4X6EA 3GDBA 3BGJA 2R0KH 1RZJL 4WWKC 3UZQB 3QUYB 3CH9A 1LOSA 1V79A 4F37F 3HFML 1O9ZA 1J6OA 4P59H 3C6LA 4FABH 4LP4A 1X8CA 5CD3B 1TMHA 1HYSD 1NF0A 3KPRB 3WTXA 4JPSA 3TN0A 5LKNA 2YD0A 4YBHA 3PWPD 2APSA 3FRUA 1FUNA 3TX9A 5T9BG 4DP2X 5BZWB 3VXUD 1DFBL 5IESL 1EFZA 1A02N 4NKOA 3DBXA 4G7RB 4NIYE 2NUTA 4KO6A 4IBVA 1E40A 4HDIB 4ERAA 3OKNB 3FOMB 4JRYA 1U8LA 5TH2B 1KTDA 3ZKXB 1KENH 3G1RA 3DFTA 1ICPA 4JO4L 3G5ZA 1FUYA 2OMBA 2E6PA 4S3KA 5L6YL 4JYEA 3D7PA 4PBXA 4Q33A 3CU1A 4ZFZB 4TL4A 1UIOA 1Q9OA 5GGUA 3PM6A 5J3HC 1HHGA 3RUGE 5ILTL 5FWQA 4LDEB 4IU2B 1WS7A 4J5NA 1DLHA 3ZVIA 4F8NA 2QQNL 2Z2AA 1P53A 2DAVA 4D8PB 2P0OA 2ABBA 2YCJA 1IIHA 3OG6B 1I4FB 3RJQB 2XFYA 3KBFA 1H7RA 3V4PL 2YPLA 5CPNA 4ICWA 4S1SH 1B0GA 3IAQA 5JTWA 3QXWA 1FZKB 3UBXA 5JA9A 1XKJA 1CZ1A 1TZGH 2YA1A 4OGZA 4YL4A 1VC4A 1M3IA 1V54B 2EVHA 4CW1B 3BDBA 3VX0A 4E9WA 5IIEA 4GX8A 1YYML 2R2HB 2WQAA 1J6PA 2L3BA 2CWNA 2NW3A 1NDGA 4PJGE 2AXFB 1E28A 3DYMA 4ZD3L 1I85A 2DMBA 2L7UA 1B1YA 3LZLA 3ZDXB 2P1YA 2QV2A 1UMLA 2EPKX 2YZ1A 2OMWA 3MRMA 4KMTL 3MZNA 3WH6A 3WKQA 2IWKA 1XEDA 1RUPH 5F0LB 5AAMC 5LCVA 4B4FA 4UOZA 3NVTA 1OINA 3TN4A 2VLKA 5DHYA 4OH2A 3H3BC 4MQXD 5CEYB 1HINL 5F7WC 1JCKA 4ZS7H 2K8MA 3VFMB 4YHGA 4KRZA 4KU1A 1Z3NA 4O2FB 5BZZA 2VEIA 1QYGH 1KIRB 5TF0A 1KFWA 1KYFA 4XMKH 4JAMB 1ISWA 3F7VB 1AFVL 4N02A 4JFSA 4XNMA 4EDWL 2OW6A 2IDFA 1GVQA 4OI7A 5K9JH 4B9YA 3C08L 3RFZC 3QT2A 3BZFA 5KSVB 4C1KA 2P5WB 2GEEA 4I9TA 5IMLB 1GZQB 2ITDB 3AYVA 4H19A 2NQHA 1I9JH 1IGIL 1JMXA 1AL7A 5FYLD 2YOCA 4TLKA 2H47C 4X9FA 3C75A 4Z7NF 1E72M 1PKQA 2W88A 4M5SA 2VKWA 5LAXA 3A6CL 1IXQA 2DKSA 4W85A 4AGPA 4GXUN 2F19L 1R3JB 3AIBA 1WG3A 1HU8A 9RUBA 5CFAA 4AKPA 2CIIA 3HV9A 5IVXA 1ZFJA 5JNYB 4NN6B 5ECUA 1O7AA 4IIEA 1B31A 4L1WA 4YHPB 3T4AB 5T5FA 3U6XS 4NZTL 1NIUA 1A7OH 2X4OB 2WB7A 3P93A 2J4WH 3CU2A 4QY8B 2IOMA 3JWDL 3QNZA 4OKVA 4BIKA 1GZHA 3RY6A 1R9XA 3T3MF 1OAYL 1NARA 3B8DA 5BVPL 2FO8A 3MBEB 1U8MB 5LNEA 1KW1A 3ULUD 4Y7OC 3MV11 1TU2B 2A7BA 4F9DA 4O02L 1Q94A 4LNRB 1RJCA 4IUOA 3RNQA 4PG2C 3E3QE 4QJ1A 2JCCA 4ZGYA 3MKKA 2A9NH 2G3NA 1LE9A 1KC5L 2MWCA 2PO6C 2Z64C 5I19L 4JYFA 1EP3A 3CZSA 4O1CA 1H3UA 5DK0B 2XINA 4XPTH 1QLRA 1GOGA 1V93A 4JKWA 5AVYB 4LANA 4KZ0A 1HZHH 3C2OA 3BGMA 5F4WA 5I18H 1U3HC 1JCLA 4LK4A 2P49B 1CBGA 3O4LE 3MGOB 5CKGA 2WLIA 4FTVD 3ARSA 2GLKA 4N0YH 1C5CH 2BHYA 5CINH 4AVIA 4P5TB 4MLRA 4A05A 2OXNA 1VD6A 4P3DA 4WI3A 5A8PA 2GYSA 5EEWA 4LPYA 1HZKA 5GGQH 4DEPB 2VR3A 4ONGL 2R7EB 2DQMA 1DYZA 4XOBA 2DSWA 3KZ8A 1TWIA 3WLWD 3MJ9H 4TSAL 2KZKA 1ZKAA 3USZA 4Z76B 2YCIX 3GU2A 4KH2A 2P8MA 1DZ0A 1RZKC 3E2QA 1T89A 2AK4D 3C5ZB 1XGTA 1U5JA 4KKCC 4MCZA 2AJZB 5A6LA 4S1DC 4FQ2L 1PCSA 5B3SB 4OZIE 2I16A 4HYVA 3LMJL 4F37K 1NCCL 3C60D 4JZJC 4BCEA 2VQTA 4LVNC 3OBKA 5D2NA 1XIWA 4OFIA 3ZJKA 1AHWB 4GT0A 1N4XL 4PG9B 3UTSE 3W4RA 5CSSA 1K85A 3ZHNA 1PKMA 4ZT1A 1E4WH 3K0WA 3F2LA 3THAA 2W8CA 2YRZA 3SE9L 4MCYA 3E3QC 2QADD 2AEQH 1F9CA 2FEDC 5FL0A 5EO0B 3DERA 3DDFA 5JBEA 2C9VA 1F1DA 2V9UA 3L2LA 1MCCA 5T1MA 1BHGA 5IVZB 1IILE 4OFYD 5LXGH 3RLVA 3TNOA 2X4NB 1T20A 1KFJA 1SEBB 4J3WA 3MV9B 2V6HA 5GSVA 3S35H 2B59A 4IIFA 2PP0A 2VAJA 1IQWL 2IOOA 3LQZA 1U3JA 2FWSA 3K6SB 1JWUA 1MEHA 4WFGE 1IKNA 3UBXG 3GKFA 4O8AA 3F1QA 1DZBA 4S11A 3TT3L 4GISA 2VRJA 2FMOA 4CGTA 3MXVL 2V3FA 3QSKB 2YLLA 3GSOA 4WO4D 4YYCA 4PRID 1ZIBA 3C6SA 3M5ZA 3ASNB 4NKQB 4XGZB 3AG4B 3APCA 3EJYD 1H5BB 4K2UL 1E4LA 1EQWA 4IOFD 4H1LA 1O6IA 1E9QB 2W07B 3V7AE 4BKSC 2UY5A 3AZSA 3B03A 2LLEA 4U1JB 6FABL 1KB9K 1VGKA 4DGYL 3M7WA 4JN8A 3CWOX 2XKNB 2J75A 2VDKL 1PG7W 2EG7A 5GISH 4DVBA 5E8DL 3T07A 5IJKA 4WLCA 4Z18A 5CJXA 1VBUA 3QUML 5E9DD 1WYIA 1AJZA 4K1WA 5I15L 3D05A 1M65A 5EMYA 1AO7A 5F3BB 3DROB 4HUUA 2WQDA 1SEQL 3ASOB 5D70L 1GPOL 3TJHD 2XZ9A 1XICA 3KPSE 1MCEA 4WTZA 4A7GF 4X61A 1FGVH 3OV6A 1X98A 2WMFA 2G5UA 4CCZA 5H8MA 4QG6A 4L4VE 3TJEH 1MIML 4PJCE 4PTTA 1NFIB 4HS8H 1WV7T 1V77A 3V9EA 5I16B 1WPCA 5D2LA 1SY6H 3K74B 3P11H 1LILA 3FMGH 4CSPA 4CSZA 5MERA 1EBGA 2CLRA 3NQAA 3RDTB 5CIPH 3T6QC 3EB3A 2XIDA 3LKSA 1DQDL 1YMYA 2VXTH 1MFVA 3O8XA 2RGMA 2CZ5A 2WNKA 5FYLH 4DGVH 2J21A 2X9YA 4N2NA 3GRWA 3N11A 2GK1B 1B0WA 5KG9B 3G6JF 4ZTPH 4AISA 1HIML 5IQ7L 4APQC 3HRZA 4AEFA 2CGRL 2CNZA 2ITCB 1IL1A 3VNJA 4F7TB 4UNVA 3ONCA 1KYOJ 3TYGH 4LMQE 3ZE0B 5F4XA 1UJ3C 3W82A 4MNHA 3IFLH 2Y3AA 4FG2A 2CXEA 3JWOL 4N2HA 4NQSA 2A1WL 5DJ6B 1DEDA 3CHOA 2AI0H 3IU4H 1RUSA 4FNRA 4NQDB 3PNWA 4I89A 2ZYHA 3HKFA 4OM0H 2G0WA 4X5PA 4AWEA 4JCMA 3GMRB 3QFEA 1XDJA 3QWRD 2EKGA 5KN5B 3ULUH 4F66A 3WLMA 2YEZA 4Z8FH 3AFBA 3WBEA 3ANUA 4LAOA 1WTLA 2BZDA 2VM4A 1KGYE 5DRCA 5HVWA 1FFQA 3M44A 3GJFB 5I28A 5KSBB 7ENLA 5DU7A 1EBAA 5BXSA 3QR2A 3SCOA 3QIBB 4R85A 5DZVA 3AIEA 4FNUA 2BJMH 4OIIH 3KYOB 4JG0H 5EU7E 5XIMA 2J8GA 4WUUB 2WXFA 3GDKA 3TJXA 3PG2A 4Q4RA 1I1XA 3RGTA 4RFEB 1T5KA 1OSEA 4PY7A 1BLIA 1AH4A 3QHFH 1JGLH 1T2QL 1L8NA 4KKAC 1WV2A 1EJ6A 1HAWA 1B54A 2QSCH 2ED7A 1XCWA 5ECVA 1HKMA 4ICXA 1OP3H 3LN4B 1DPMA 3BH8A 2F58H 3DPBB 4M8QB 1M68A 5E51A 3N40P 1THCA 1JGEB 4X7SL 3NIFB 5KYNA 4C56B 5E4AA 2YZ8A 4RZ6A 4FQJH 3GVGA 1ZT4B 1CG9B 2X1OA 3BURA 4JTHA 2Y4SA 1OTSC 1CZ8H 2GTWB 4P06A 4XBEL 3H3KA 5IHUL 1KLYA 3MBDA 2C14A 5BQDA 1AAJA 3O2WL 4NJ9H 2ZP8A 1TVBA 4W9GC 2BVTA 1ISVA 1M05B 2K70A 4L0PB 4QOKA 3WFDL 4QTFA 3UG8A 2WBKA 5C3IA 4ORGB 1W72B 1EBPA 2NQLA 1PY9A 4YSTA 3MRIB 3LLFA 4Y5XA 4AM0B 2NV1A 5HJXA 3MC0A 3VXTA 5F1VA 5F89B 3T4YA 1XQKA 3U1SL 5F9OL 5GGTH 2BNRE 3ZL2A 5EU3A 3NQ2A 1FDLH 5GRUH 5GZNC 4PJIA 5TPWL 1UJQA 3VKJA 3BXNA 4POUB 4RNHA 4A7UA 5FCZA 2BRRL 2AQPA 5FHAL 1C92A 3T6VA 3FU6A 5FJOA 5AYUL 3MA9L 2EH7H 2GL5A 4H1LG 1TJPA 2KC0A 1XIIA 1A5SA 3G8RA 5LYRA 4N0UA 2P1FA 1LO2H 1Z2KA 3QPYA 4NM4H 3FAWA 5E24E 5J5DA 2GJZB 5H4ZA 3PUEA 3PY9A 1KLUB 1DQML 4DJEA 4AD1A 3GIPA 2ZOLB 5I0WA 3WKNA 4ISVB 2J20A 2VX5A 3RZCA 1VH7A 1EOKA 2VXSH 5L8KB 4BKLA 1N7MH 4E68A 4WEBL 3NEHA 2QQ6A 3ABMB 1OT1A 4IDLA 2BVQA 3MBXL 3P7YA 3G6DH 1KTRL 5KETA 4GKSA 4WTZG 5D1QA 3VWJC 4GAGL 1CX9A 4RAUB 3H4FA 3N50A 4NJAL 1SJBA 1G6RH 5GGVY 1U8QA 2R69H 1OCWH 4DP9X 2B7QA 1QI4A 1OC5A 1GS8A 3G5WA 1QSFA 3S42A 1LJMA 1NMAH 3OR7A 4ZK8A 3H8NA 5I8OL 1FJ1B 4U3HA 2MCAA 3GYCA 3BDKA 3UVIA 1L3NA 4KERA 4A1RA 3ZJ6A 4ZQCA 3LEYH 3SDDC 3CO8A 3EKGA 1CE1H 4FG6C 3G2GA 3QJFB 4IEFB 4J4PA 4ZXBB 2HKHL 4PGCB 5SWZE 4L9DA 1A3XA 4U6TA 5EC2B 5J11C 4YNGA 3W7EA 3LKPA 5LDUA 3L81A 3SKUD 1E2ZA 2BP1A 4AOFA 1BYDA 2F7QA 4AENA 1IJ9A 1GY2A 1D9KA 4K0OA 1THAA 4P4KB 1L6PA 3L3JA 1NIAA 3MHFA 2ZTKA 1C8QA 4Q8TA 4I2XA 3C2FA 3Q5TA 4DN1A 4UZUA 4N90E 4XI5C 2Y5EA 2CZEA 4TXEA 2VFHA 3N4AA 1II4E 3GTXA 4QRQA 1JR1A 4CMHC 4WSHA 1R3LB 3KPRE 4JKPH 1AOZA 3HMWL 2YMTA 4PJHA 2YAOA 1D8WA 4U4MA 3QI9D 2WWCA 2JJWA 1XRFA 1X5FA 3LENA 1MCPH 1F97A 4HSHA 4P2CG 1AA1B 3HG3A 5G1MA 2FQFA 4JCWA 3PBVA 4IBWA 4EOUA 2LLGA 5KBDA 4JFYB 3DMMC 3QWOB 5EZLA 1FG2B 3C2AL 1GGIH 1MY5A 4YAQB 3TZVC 4R7DB 1YJDH 4L80A 1XXDC 3IBEA 2NY0C 4H0IA 3NYZA 4IQHA 3G5YA 4WI8A 5C07A 4HKJA 2BOLA 3LPFA 4MM1A 2BOCA 4GP4B 4WVXA 1X5YA 3MT1A 3H7BA 5GJPA 3DRTA 3MRGA 2GGGA 1BXAA 3D2UD 4HGWB 2P43B 2GWGA 3MSDA 4Z7OE 4W4OC 2A73A 1BOYA 2RMNA 4F20A 1TRIA 4LGRB 2DT0A 2WZPA 2A79A 4H88L 3NZPA 4NPYB 1NFKA 2GC4C 3RX3A 4F3FA 4QRPD 3CNKA 3C5SB 1YA5A 1KJ3L 5D7IF 3EDKA 4RWYL 4ZUSA 3WJLA 4YLBA 4DJFC 3BT2H 4HUWB 3HNVH 4AD5A 4Q8BA 3S1XA 3UC0H 3OAYK 2IPGA 5G4EA 1U8OA 5KVMC 3ECVA 3QUYC 2V67A 2MHAA 5JHDB 4YE4L 1DFXA 1IFGA 2WBXA 4LBRA 3UYPA 3O45A 4PL1A 4TV3A 1DQXA 5C0FB 4HK0B 1W54A 4DGWC 4L0YA 4L4TB 3O2DL 5HGHB 2XHYA 2AQTA 2FDMA 1KWGA 2XZAL 5DQ9B 3ET9F 1CBVL 1VESA 5EC1B 2WZ6A 1BVKA 3OMNB 3CUPA 4LESA 4CD8A 4WDIA 4PREA 2ESVD 4P46D 1PSKL 4Q6KA 5JMRA 3BRDA 5EZPA 2PZNA 2VYOA 1AW1A 2PTZA 4ZS6C 4ROQA 3BLFA 4EN3A 3NL2A 1HVXA 3UO1L 3KPPA 1WISA 2QHRH 3THDA 4JCLA 2BWIA 4IU3A 4OW6A 3LKNB 4LCWA 5F1IA 2ODIA 1TETL 3QUMA 4X6BB 1REQB 1WKEA 2FCBA 2CZNA 1WB0A 3SCNA 1L9MA 3DDMA 3GT6A 4LPVA 1FLRH 3HAEH 3EJQA 5DFAA 3D3FA 3L4WA 3ESUF 2J4GA 2P5WE 3LGGA 5IJVA 3QPQD 1BEYL 3GXIA 4LLAA 2JJTC 4OLVL 1GVSA 4X9YA 3WMSA 3TX4A 4Z7WB 5IEHA 2VKXA 5LBVA 4MD4B 3V4BA 3MRBB 1FSKB 2J8HA 5HI3C 2FQEA 4MSWA 4XP1H 3H21A 2FDBP 1OADA 3DH7A 1NICA 4XKMA 4J3VA 3GJEB 1SDYA 4G9DA 5LN4A 5D4QA 3S98A 2BVWA 5TQ2H 1JVLA 2CZDA 4RPQA 2RTTA 2HTMA 3C86A 1Q0YH 3DX2A 5C0CE 4G56A 1NAML 5F2GA 3KPOA 3N9KA 5DY3A 2A9MH 1T6BX 1D9EA 4MX7B 2QSVA 5H4YA 3HG1A 3UAJA 1TWSA 4DAGH 1YN6B 3TO4D 4KVNL 1J1XH 1SJCA 1Q9KB 2OOGA 1P0KA 3W9ZA 5JR1H 1ISXA 2XFFA 2VN3A 1PHQA 2ZXEB 2HJKB 2K1MA 1NDWA 2KX9A 5E08L 3OZ9L 2XZCH 4NSKB 1QFWM 3IJEB 5BOJA 5BXTA 5DRWA 1NKOA 3PIQA 3MP5A 1WDDA 3VI3A 2FPVA 1DVFA 4PCPA 3BZ4B 3P4MB 1NELA 5SWSA 1KMGA 2V3GA 1UCBL 1Z44A 3WQ8A 3ZJ8A 2VDPH 5D6DC 3MV8E 1AKJA 2IJ0C 2WHLA 3IDYC 4IHCA 4P04A 2Q8BL 1N55A 4G8IA 1S5WA 3CH1B 3MYPA 4Z5RA 4K55A 4XKYA 2WMJA 2VISA 2VERN 1BIHA 1XF5A 3ZT6A 5LHDA 2Q7NA 4LFYA 1R3IL 3N04A 3TBSB 5HYSG 4QGCA 1JYXA 4M93B 4N2OA 1NGWA 2YPIA 3H2FA 5MHSD 5HNNA 2EICA 4MVBD 2KAUC 3DKLA 3DG3A 4DPQA 4UWMA 3NRPA 4XPGH 3R4DA 4NN6C 2Z00A 2XPGA 3HQ1A 1ID2A 2CLZB 3AREC 3T4AC 2J8OA 1XDTT 1W15A 3MJGX 4JN2B 2E67A 5J13B 4X6CF 2EDOA 3NJKA 3LGDA 4GKTA 4HH9B 1N2RA 4AWJC 3MBEC 4U1LA 3FUFA 5JPMB 8XIAA 4N4YB 1BSIA 3N2OA 3MNMA 3ITGA 2OPJA 2QV5A 1SM3H 1FFOA 3PFRA 4LPXA 4OLWH 3VQMA 4WIWA 5C6WH 2VLME 4UANA 4JTSA 4OZGF 2PCFA 4HX1A 4LKXA 1P6WA 1ZVSA 2WW8A 5C6TH 3IEBA 3R1ZA 2PDLA 4ZOAA 5C09B 3R10A 4GG6B 2H3NB 2OMTA 4ZMXA 1GS7A 5I3KA 4HH8A 2XCMC 4KQ3H 5C0JA 3IE9A 3MCKB 2ZE0A 1YMME 2PDFA 4P5TC 4KUCF 2X1PA 1HW6A 5E1AB 1DVYA 4JFDA 5EBAA 4DEPC 4LVDA 4BKTC 3S1GA 2KDGA 4AH7A 4LEOB 1TJ0A 5C86A 4JN1L 2G4GA 1VLIA 1LJYA 4QRTB 1NCBL 3BQVA 1QFWL 3FUNA 3CMGA 1CYXA 4IICA 3C5ZC 5GGRA 2FX8L 4WU7A 5HY9B 1TR1A 1ME9A 3KLQA 4RAHA 4UQCA 2QQKL 3WBWA 3U5UA 2NQJA 3L3GB 1P5BA 5HMSA 1F61A 1U93B 1EEXA 5DJXB 3GSMA 3T77B 4JPKL 4B5UA 3CHEA 3GSQA 5B7MA 3TNBA 1CDJA 4JTCA 2YKLL 3N13A 2R1XA 4RW3A 2JELL 3T4CA 3NZ8A 5EWIL 2VDMB 1W1B1 4DIAA 3ML8A 5T33H 1R2RA 2EPMX 3QEQB 3CLEL 5I1DB 4IFKB 3EA3A 3LHTA 1OVDA 4H00A 3SCMC 2H9GB 1TQXA 3FCSA 3URQA 3C0JA 3DXAA 2FDSA 1UG6A 1GSMA 5SV3A 1QLEH 3AG2B 3QJSB 1CFTB 4GMSL 4ZUWA 2HJFA 4YLQT 4NO2A 3DYPA 4MMYB 4F9LA 2A85A 1J8HE 1MG3C 2CU9A 5CSZB 3NBNA 3OVQA 5CBBA 4YHEA 3WENA 1QPOA 5HYIA 1MRDL 1BM3L 2OMVA 1YYCA 1SHMA 3HN5A 2C8NA 4ZFFB 5I23A 4JPIA 4LO9A 4N42A 4MCMA 1IIKA 1MZZA 2VC6A 1U8KB 1Q8JA 1IT8A 4XWUA 3OHXA 4DNLA 1PZBA 3FB5A 3L66A 4OFKA 1TPVA 4Y1AD 4YXLH 2W65A 5IRPA 4GMEA 5I9QB 5C0IB 4W4NA 2NNCA 5F88B 3LB6C 4AWTA 4B2DA 2HWZH 4H9ZA 1N6VA 3CV1A 1JNNL 4S3CA 3BLOA 2A9AA 1MMFA 4UB0H 3S34H 5HGDA 4KEMA 5CWSB 4Q8NA 1HG3A 3FPYA 5TK2A 2CO7A 4P48A 5HI5D 5FCUL