3BSHA

Barley alpha-amylase isozyme 1 (amy1) double mutant y105a/y380a in complex with inhibitor acarbose
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
404
structure length
404
Chain Sequence
HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIACIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGSRADVGAVIPAGFVTSAHGNDYAVWEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multi-site substrate binding and interplay in barley alpha-amylase 1
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
molecule keywords Alpha-amylase type A isozyme
total genus 127
structure length 404
sequence length 404
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bshA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bshA01
1H5VA 2ZWYA 5CGTA 2GUYA 1JAEA 1J0HA 4P7OA 2J77A 4W89A 2VRKA 2GJXA 1IZJA 2G4FA 1XSIA 4B9ZA 4Z2LA 4CCCA 2ZE0A 5ABFB 1QX1A 4PMXA 2YBUA 3KZSA 1CIUA 4TVCA 5CXPA 1EHAA 4H8HA 1O7DC 4UZSA 3RILA 1GOMA 3HJEA 4P8UA 3AS0A 1V3IA 4E2OA 4W7VA 1GOOA 3BLKA 3EDFA 3BAWA 1E1FA 1E0WA 3VSVA 5D9PA 4PMDA 2PF0A 3WELA 1OWQA 4W8BA 3GH5A 2J79A 4U5KA 5CLWA 1LWHA 2XVLA 4FMVA 1GVYA 1J01A 3VIIA 5AY7A 3T2PA 2XN1A 5A2BA 1HL8A 4BS0A 3BAKA 1JL8A 3WBEA 4J3XA 1B3VA 2YL8A 5FOOA 2VTFA 3QOKA 1CPUA 4ZXLA 4UNIA 3UR8A 3MO4A 1ZBVA 2WC7A 2WCGA 1J0IA 4OKDA 4ACZB 4EKJA 2ZICA 1VENA 5HNNA 1TCMA 3PZVA 3BCFA 3WUGA 2ZXAA 2ZX7A 2GDVA 4AD3A 1OBAA 3WF3A 1LL7A 3W38A 1W1YA 1J0JA 2WMIB 4W8LA 3IJ8A 3VIJA 4J3SA 1CZ1A 4XUYA 4OGZA 1V6UA 2XHYA 3SCSA 2EADA 1ISWA 3VGGA 3CLWA 3CTTA 3GZAA 3VD3A 3GM8A 1HP4A 2WVVA 2WHMA 2XUCA 1H09A 4EE9A 1V6YA 2VX5A 3CH9A 5BCAA 1XH1A 3UESA 1LQ0A 1X6LA 1W9XA 4E4PA 2DT3A 3FAXA 2EO7A 3ARTA 1PIFA 1PPIA 3ZT5A 4J28A 4PTVA 4ATWA 2XFFA 5AYIA 4JHZA 1ITCA 4LXFA 3M07A 5HXMA 4UOZA 2BVYA 4J27A 4WK9A 4ML4A 1G1YA 1NARA 5D9MA 3TTSA 3CPUA 1V3MA 3K4AA 3VIPA 3CZ8A 1TVPA 3K8KA 2DSUA 1NM9A 3IGUA 2WMHA 1SMDA 3W24A 1ZS2A 2D20A 1R7AA 3W82A 1W2PA 4GIAA 2Y4SA 1E71M 3CHDA 3WFLA 3HU7A 1QI2A 4C7GA 4E8CA 1H0GA 4ATLA 4M81A 3WY1A 1B30A 1AQHA 3AHZA 4PYSA 1QHOA 4HPHA 1EOKA 1E0XA 4EANA 1H41A 5A8PA 1QBBA 4CCEA 4CVUA 4S3JA 3SUUA 1UWIA 1QI4A 1GJUA 3VIKA 1Q4NX 1OT1A 4U3CA 4DWSA 1K9FA 3AMGA 5CZKA 4PMQA 1SR0A 2ESCA 2D22A 5E09A 1ZB5A 4MAVA 2NSXA 1UKOA 1UQYA 1LWJA 1QW9A 1TQWA 1OD8A 2CHNA 2IUZA 2UY2A 4QCFA 1HKIA 1WZAA 1W1PA 1UD8A 2E0PA 4H8UA 2OWXA 4FNRA 4BQ3A 3KWXA 3ARZA 3SCWA 1UWRA 3GTNA 4P8WA 2X2HA 1Z32X 2UY4A 1JG9A 4H04A 3SCVA 2E3ZA 3KLLA 1KR1A 1K9DA 3T0DA 3M7SA 3VD9A 3EDJA 3VIMA 1GPFA 4DWSB 3RCNA 3IJ9A 1XCWA 2ZUSA 1F4AA 3CGTA 2PWEA 4PUDA 3WH9A 1MVYA 1V6VA 1TQUA 2PWDA 3FW6A 2OWCA 1UKQA 1FHDA 4PTXA 2BVTA 4HMDA 1WZMA 3ARXA 2Y2WA 5BXPA 5EFDA 3L4XA 4FLRA 3AIUA 1J10A 3ZIZA 5A1AA 2DT2A 1WDQA 2JEQA 3LX9A 4JFVA 1JDDA 3QOMA 4HOZA 2JF6A 1X1NA 3GNPA 2QV4A 4NXKA 2PBGA 1UHVA 3D4ZA 4CD4A 3ZT6A 2DT1A 1JZ4A 1KBKA 3LXCA 4WKFA 2CERA 3WF2A 3VIGA 1QNQA 3WMCA 3PZNA 3GXDA 1EHNA 3WQVA 2GJPA 2V3DA 1XHGA 3B9EA 1V3KA 3DDFA 5DO8A 1PBGA 2WPGA 2F61A 1PIGA 1UWQA 2W92A 1HJWA 4W7UA 1JZ3A 1EDGA 2DQXA 2ZUUA 1OSEA 4JHOA 4GQRA 1FOBA 4ZE4A 4D6FA 2VCAA 1UKSA 2WWCA 3I3EA 3TTOA 1GONA 4N0RA 5FKYA 1KWGA 1E72M 1CGXA 4DM1A 3OGVA 2Q8XA 5CPQA 3A4WA 1Q6GA 1JZ5A 2G3IA 1E0VA 2EPOA 3OIHA 2RGLA 3W6MA 2VRQA 2A3AA 4AW7A 1GQKA 5LA2A 1XRVA 5JIPA 2J7DA 1V3HA 3WDHA 4MJ4A 1DP0A 3EJPA 5IDIA 4AZ6A 4NI3A 3LMYA 5CJ5A 4OJYA 3DDGA 1PEZA 4CN1A 4ATDA 2WYSA 3PZMA 2A3BA 1KXVA 2E8ZA 1HT6A 4PMOA 1UD5A 2VJXA 1CXEA 1WKYA 4RE4A 2EABA 1VB9A 2QMJA 3WKZA 1GQLA 3ZSTA 5D4YA 5A95A 2FGZA 1ESWA 1G9HA 1TUXA 1UR1A 4MB1A 1UKTA 3EJQA 4X9YA 3G6MA 4TTGA 1KXHA 3WF4A 4FNPA 2PC8A 3AIQA 1W3LA 1XH0A 3GH4A 5BXTA 1HKKA 3HG3A 2X8RA 2WKGA 1JI2A 3BAJA 2CHOA 2W61A 4XZBA 4D72A 1NQ6A 3VSTA 3PTKA 2V3EA 5A6SA 4Z2JA 3VGEA 3A6OA 3MSDA 1CLVA 4GQQA 5M03A 1CGVA 1N82A 1QBAA 2D0FA 1UA7A 4TUFA 4TVUA 1QVBA 3EDEA 1J0ZA 1E6QM 3TTYA 1ITXA 4PN2A 1C3FA 4DM2A 1CDGA 2VOTA 3WH5A 1X6NA 2OW6A 5CPSA 1E6SM 5LA1A 1RP9A 3EJUA 3WY3A 3VDAA 3CIVA 1MFVA 4W5ZA 1V0LA 4KRUA 1NWRA 1G01A 1TVNA 4AYSA 2HISA 2FHBA 2BFGA 3RDKA 2YFOA 1CTNA 3W4RA 2W62A 2EEXA 4FNQA 3IAPA 1SZNA 3L2MA 1M53A 4ACYA 1JDCA 1LLOA 2ZIDA 1FP8A 1V6WA 5DF0A 1XSJA 4AEEA 1UR2A 1JYXA 3A22A 4GKLA 4FK9A 5IXEA 1TZ7A 1J0YA 1D3CA 1MW2A 3ZMRA 5A6BD 4JFTA 1KXQA 1BSIA 1JI1A 3LPOA 4B3KA 3SCPA 4FF5A 1C7SA 4NZJA 1CECA 3N18A 5GNXA 4HP5A 2OWWA 1V3JA 1U33A 3MS8A 3PZ9A 3CZKA 4OIFA 3WQWA 3PZIA 1Q6EA 1RP8A 1HL9A 3SEPA 2VVNA 4GINA 2O9TA 1NWSA 1W32A 2J7CA 4UQCA 4MB4A 3WMBA 2OYMA 2JALA 3WNOA 3OZOA 1UG6A 3WEZA 5FL0A 3DX0A 1OIMA 3D52A 2ZOXA 3FAWA 3AQUA 2DSVA 4IUGA 3N15A 2X2JA 1C90A 3AXIA 4UOJA 3UCQA 1FHLA 3UEQA 5I77A 3ZJ6A 1JD7A 3BGAA 2UY5A 4UOQA 2AOSA 2Y8VA 1KCKA 4AYGA 1H11A 1CNVA 3DYOA 4Z2GA 1HKJA 3UETA 1WDRA 4PCTA 1MW1A 1PX4A 1GOIA 4HU8A 5GNZA 5IFPA 1JNDA 1V02E 3CHEA 1WZLA 3LPPA 3WNNA 4QLLA 1WP6A 2E8YA 2CKRA 4AZBA 3WN6A 1UWUA 2WC3A 3CHFA 2ZUMA 3GXNA 4FNTA 4MJ2A 1CYGA 4UCFA 4AIUA 2XWEA 3OZPA 5ABEA 2WAGA 1K9TA 1M7XA 4JKKA 1J0KA 4D6IA 5EB8A 3MANA 3VPLA 2EBNA 5DMYA 2YDSA 1W3KA 5ABHA 1H2JA 1VIWA 1WNOA 1E6NA 3AXHA 3ZR5A 3WH8A 3GNRA 1CGWA 4J3WA 2X1IA 3NYDA 5A6JA 2GJRA 3MMUA 1V03A 1BHGA 1RD6A 4Y7EA 1JYWA 3CZLA 3AIWA 4WSJA 1EXPA 1UZ1A 1QI0A 8A3HA 2C7FA 4HZ6A 4FLQA 1E73M 2CKSA 2VZOA 3MMDA 4KMQA 1KGUA 3VGFA 1W9BM 3ARYA 2J25A 3WNKA 1G5AA 2PWFA 5M3WA 3AS1A 3IJ7A 5M17A 3QGVA 4M56A 1EDQA 2E4TA 4ZXOA 4IPLA 3GXIA 4W86A 4FNSA 5HDRA 1S46A 2XPKA 1AMYA 1KBBA 3A24A 2CEQA 3A4AA 4HTYA 1L0PA 4FNUA 2YL5A 2BXYA 5A6LA 2HVMA 3BH4A 3TONA 1B31A 3FNDA 2CBVA 3ARQA 1DWHM 4AC1X 2FE0A 1BLIA 4HZ8A 3QHOA 3VX0A 4UFIA 4WSKA 1BYCA 1B3YA 4ZENA 5A8OA 1I1XA 2X2IA 5E0FA 5C71A 4PCSA 3MKKA 1E4MM 5CLTA 5GQBA 4AD4A 2JF7A 1EQPA 3GH7A 2J78A 3MV11 5A8MA 1DHKA 4NX0A 2QF8A 3VGBA 4CD6A 3N1AA 1UR4A 5BRQA 3BUIA 1MQRA 1E4IA 2VUYA 1TA3A 1VF8A 4AXNA 5ECUA 2NT0A 1OCQA 3L2LA 1CGTA 3AYRA 8CGTA 1VEOA 2XM2A 3OA5A 3KL5A 2OLHA 4KRTA 3AHTA 3WBAA 3NSNA 1E1EA 1TQTA 2WZEA 3A5VA 2WZIA 3CZGA 3D3AA 4DUVA 1WZKA 2Y8KA 5HPCA 2ALWA 5A6AA 5I79A 2ZX8A 2CESA 1DWGM 4A3HA 2YDQA 1KGXA 5KZ6A 4HZ7A 3WEMA 1B90A 4HA4A 2VI0A 1EH9A 5I78A 2DIJA 2VMFA 3RMEA 2WCAA 4M80A 3UG5A 2IXUA 3J7HA 3PHAA 1OIFA 3MU7A 1E43A 4GI6A 2F7RA 1JYVA 2TAAA 4WIWA 1CGYA 4M1RA 4K68A 4JKMA 3L4UA 2VNCA 3VMNA 1VBRA 3LRKA 1UQZA 2D2OA 3BUQA 2C0HA 2PWGA 1B3XA 2BY1A 2OYLA 3ARUA 4EK7A 2VR4A 1V0KA 5E9AA 3WUBA 1E6XM 4WKHA 3ECQA 3NUKA 3GNOA 4A4AA 1JZ7A 4F9DA 2JFEX 3CO4A 1KTBA 1HP5A 5FL1A 4NF7A 4U33A 3F4VA 3WY4A 1JXJA 3ALFA 4UR9A 4RL3A 1GW1A 3OLDA 2ZUTA 2WANA 3A47A 3CZEA 1CBGA 5JBEA 2YL6A 4UFJA 3T08A 3VNYA 3EMQA 4PSPA 4AWEA 1V3LA 2EPNA 4URIA 4H8VA 1A3HA 1E3ZA 2OYKA 2BHYA 1UD6A 1XSKA 3T2OA 4D6DA 3WNPA 2DSZA 2VZTA 4CKQA 1NP2A 1HKMA 2J75A 4LQ1A 4ACZA 1WAWA 1GORA 3JUGA 4GO9A 4UTFA 3VIOA 5C70A 1CXHA 3AHYA 2DH2A 2OSYA 3MV01 1E70M 5F7UA 4F9JA 3DECA 1HXKA 3AIVA 4MDPA 3S5YA 1C8XA 3AS2A 2VQTA 5DFAA 3L4ZA 1E6ZA 1YQ2A 1W1TA 2F2HA 3BSHA 2X0HA 3WUFA 3II1A 1ISYA 1HJUA 4OZOA 1UH4A 4H7VA 3VILA 4W88A 3ARWA 1E55A 2VX7A 3M6DA 4CU6A 3VX1A 3WFZA 2WSKA 2WBGA 4DO5A 5I24A 3CUIA 2X0YA 1QWNA 4B16A 3PBGA 2YLLA 3SUSA 3SCOA 5BXRA 1HJQA 4OOUA 3K8LA 5D8WA 4MNMA 1H49A 2EJ1A 3BUDA 3B9DA 1UOKA 3L4TA 3BMVA 5EFFA 2Y24A 3SURA 4AD5A 4MAZA 3GBEA 2ZUVA 1TQSA 3VGHA 2WMKA 1UA3A 3W25A 4OUEA 1ZBCA 1GOWA 5BYWA 4V28A 4M29A 3ZR6A 1HJSA 1G94A 4AMXA 3VKKA 3TV8A 1QHZA 1Q6FA 1E4NA 2J7EA 5EMYA 5A6KA 4CU7A 2AAAA 4IPNB 4YN5A 3M46A 3VUPA 2CYGA 4D1JA 4PMUA 3SCUA 3PZUA 1W9UA 3FN9A 2WMGA 1PX3A 3PTMA 4QLKA 5CQ1A 1CXFA 2F7OA 4CN6A 1BG4A 3HN3A 4PMRA 4J3VA 1MQQA 3F5JA 3WQ4A 1BQCA 1QW8A 2YA1A 2YLAA 2WZHA 2DH3A 2XJ7A 3LPFA 3ZJ8A 4MB3A 3RO8A 2G41A 1BYAA 3A4XA 2YA2A 3CUJA 2WCSA 1JGIA 2WHJA 4Z2KA 2XGIA 1ZBKA 1W9DM 2XVGA 3CV5A 2YA0A 2XIBA 4UFHA 1BFNA 3I3DA 2EXOA 1ZL1A 1W1VA 2XVPA 1F4HA 2D3LA 4CUCA 4HA1A 2CBUA 2O92A 4DO4A 3ARRA 1GHRA 1BTCA 3AOFA 2V3GA 3OGRA 3W0KA 3AZTA 3DX4A 3AI0A 1AQMA 3SCQA 2XSAA 3VNZA 4PTMA 4V2XA 2VX4A 3B9AA 3RPMA 2G3MA 3WF0A 3ZM8A 2EAEA 3DX2A 4PEEA 6A3HA 2VZVA 1VBUA 4CU8A 1NP0A 4Z2IA 1VJSA 2W63A 3GBDA 1OINA 3IANA 3W81A 5IHRA 2CPUA 2DEPA 3WL0A 3WDPP 1HJXA 4JAWA 3LPGA 1XH2A 4LYQA 4ZE5A 4LYRA 1E15A 2JEPA 3BC9A 4TOQA 4HOWA 1OT2A 1DWIM 5I0DA 4AZ7A 2WHKA 2CIPA 3EJRA 3SIMA 4GZEA 1ISZA 4AMCA 3EJTA 3WY2A 2DIEA 4NRSA 2VO5A 1HJVA 4MDOA 4AIOA 1MYRA 9CGTA 3D50A 5D8ZA 1W9VA 1EGZA 2NT1A 1UR9A 4BQ2A 3W6LA 1LF1A 2XIIA 4PSRA 2FDMA 4OBSA 1KXTA 5A2CA 2XSBA 2IXVA 1JXKA 3AMKA 2X2YA 2GSJA 1MXGA 3K4DA 4CN4A 4F66A 3LRMA 1GQIA 5A2AA 4NZCA 1PZ2A 1DWJM 5D9OA 1R47A 1EOMA 1V02A 5I2UA 1OGGA 4U3AA 3DX1A 1MXDA 3WH6A 1UWTA 2EPMX 3ZSSA 1QNPA 2CETA 2UY3A 3HG4A 2EPKX 3T09A 2WNWA 4KGJA 4NSBA 3A23A 2WWDA 2CITA 1UD2A 3WQ6A 1CENA 3UG3A 4F8XA 1SMAA 1QHPA 1UYQA 2VVSA 2BVDA 2PWHA 2PB1A 1EDTA 1E56A 5CSYA 3GXMA 1H4PA 3VM5A 1TG7A 3WDIA 2WBKA 4YHEA 4H2CA 3VMPA 2YFNA 4UQAA 1H1NA 1LG2A 3PZGA 5IFTA 1U30A 2BV9A 1C7TA 3AIEA 3W27A 2GK1A 2UWFA 2CBJA 4CGTA 1D7FA 2WHLA 1V08A 2QLYA 3BAIA 5LYRA 4CD7A 2Z1KA 3G6LA 1LL4A 3WNMA 1HXJA 4QAWA 2XVNA 1XCXA 3HG5A 4N42A 2BY3A 1ZJAA 4LX4A 3VD4A 1E6RA 1V0NA 1ODUA 3ZJKA 1WPCA 3A21A 1U2YA 5E6YA 3RM4A 2A3HA 3OLIA 1W3HA 5HPOA 2W4XA 1CXIA 2G8ZA 1EA9C 1XYFA 4AZCA 2J62A 1UD3A 3U5YA 5CG0A 4MTVA 3CBWA 2CCRA 2BHZA 1WE5A 1B1YA 2F8QA 3W28A 3WD0A 1BF2A 3UR7A 1JNEA 4JL2A 3DC0A 3D4YA 4TVDA 5A3HA 1CXKA 2J74A 2D3NA 1FFQA 2BHUA 2BXZA 1J9YA 3T0BA 1GJWA 2QMKA 2VC9A 2QPSA 5DEZA 3CMGA 4RE2A 2F1BA 2FHFA 3GXPA 1VEMA 1DEDA 4DUWA 4D71A 1PS3A 1BAGA 5GPRA 2OW7A 2WVSA 2WC4A 5GNYA 5AC4A 3O2LA 3F5LA 4JCLA 1SFSA 1P6WA 2NW0A 4BQ5A 3AMLA 5E0CA 4D6GA 3APGA 4FLSA 1B0IA 4LPCA 3BVVA 4X0NA 2J7BA 3CMJA 5AC5A 3AIBA 1C92A 3LXBA 4UFLA 1KCLA 2DPEA 1QI5A 3BMWA 5FD0A 1TMQA 1CGUA 4GI8A 4AMWA 2MANA 1GQJA 2F18A 2V38A 3AYSA 1HVXA 2WVUA 3WQ8A 2VCCA 3DYPA 3EMZA 3U7BA 3U7VA 1GOQA 1HN1A 4IISA 1PX8A 2WKLA 1J18A 4PMNA 4W7WA 3BVUA 4EAMA 4DWSC 4B9YA 2J7FA 3RIKA 2FH6A 3SCRA 4WF7A 3BLBA 1M01A 1R7OA 3WD2A 3WDRA 4D6EA 3QHNA 1IZKA 3CUGA 3W53A 1OGBA 1PZ3A 1R46A 3NSXA 2WVVB 2XGBA 4KH2A 5CSUA 2YBTA 5D9NA 1UZ4A 1GOKA 1MFUA 3AISA 5AYBA 3VDHA 2XTKA 4ZEPA 5BXSA 1UASA 3T2QA 2V5DA 2XN0A 1C8YA 2DGAA 1BPLB 7CGTA 4BF7A 2XFRA 4UQDA 4FLOA 1QNRA 1R8LA 4JKLA 2VR5A 4AIEA 2CXGA 3RJYA 3NJ3A 3WD4A 3GXTA 7TAAA 1FH9A 4AZGA 5FCZA 1R86A 3K8MA 4R27A 3S2CA 7A3HA 2BNJA 5ABFA 5I6SA 4QP0A 2X09A 4WJXA 5EBAA 4GPNA 4W8AA 4GI9A 1WO2A 1E5NA 4B15A 4JCMA 1UWSA 3N9KA 1IV8A 4C7FA 4D6JA 4L4PA 3WD3A 3NDZA 2WB5A 3VIHA 1I75A 4H41A 1VAHA 4P8VA 2EQDA 1H0IA 1JIBA 1XD1A 2W66A 3CUHA 1B3WA 3S6TA 1MWOA 3ZJ7A 3CZNA 4D6CA 4P7RA 3POHA 2VQUA 1VRXA 1KQYA 4XV0A 1EQCA 1BYBA 1NOUA 2E9MA 1W2VA 3IAQA 1AVAA 3VDBA 1E6PA 1OB0A 4JL1A 1QWUA 4P7QA 1J11A 4BA0A 2BS9A 5HBFA 1B9ZA 3FHAA 1L8NA 3DX3A 2FH8A 3CUFA 3H54A 1VFMA 4NXSA 1GUVA 1MW3A 3BSGA 4P8XA 2E40A 1E5JA 3BCDA 2YOCA 1EIBA 1TA3B 1C93A 2CNCA 3U5UA 5E6ZA 4AZ5A 2F1AA 2YIHA 1PAMA 2ZX9A 1Q6DA 3HG2A 3PZOA 1BG9A 4Q22A 1WDPA 4HMEA 2VURA 1XD0A 3L4WA 1Q6CA 3MUZ1 4M8UA 3NCOA 5I23A 3I3BA 2WVTA 3HZ3A 4TX6A 2XWDA 1CXLA 1NWTA 3CZJA 5A69A 1R87A 4PRWA 2PBOA 2D23A 2W91A 3MUIA 5C8BB 2XVKA 4XZWA 4UQ9A 1ISVA 1QNOA 2G3JA 3PZQA 4HU0A 1US2A 4GXPA 4KGLA 4NRRA 4AD1A 3E1F1 4GZIA 1XGZA 4HMCA 4HOXA 1LJYA 1HX0A 2D24A 4ZFMA 2Y5EA 1W9PA 3W29A 2G3NA 3LXAA 3W37A 2FGLA 2VL4A 1JYNA 1HTYA 4A3YA 4MPKA 1HWWA 2WM0A 2WK2A 2VCBA 2ZWZA 1DTUA 2J47A 3BVWA 3UG4A 4AY1A 4QLJA 3OG2A 1B3ZA 5E70A 1NWUA 2FYVA 3NDYA 3BUBA 5LA0A 1I1WA 1NOWA 4D6HA 3NIYA 1FP9A 3U57A 1KQZA 4LYPA 3VO0A 1UR0A 1BYDA 1XV8A 4S3KA 4DUXA 3FY1A 4PUEA 4CVWA 3AFBA 4RE3A 1H3GA 3AHXA 3MI6A 1OM0A 1UD4A 3KLKA 3VOCA 4V27A 2OSXA 1IT0A 2PI6A 2F7PA 5E1QA 1FA2A 2J4GA 1E3XA 4YPJA 3O9NA 1FH8A 1WDSA 2ZUWA 2X05A 3A3HA 1QPKA 3S5ZA 2QPUA 3DYMA 1AQ0A 2O9OA 4MNLA 1V6XA 3AHVA 4E8DA 3POCA 4JFUA 1RPKA 2WMIA 4BQ4A 5JBFA 1JFHA 3OLGA 1LG1A 3AXXA 2YJQA 4PMVA 5BWFA 3BUPA 3TOPA 1NH6A 1HVQA 1XYZA 1O6IA 1QI3A 3H55A 4PMYA 4WLCA 3WIJA 3MUY1 3N11A 1K9EA 4Q7NA 3LRLA 3WDQA 1A47A 5BROA 1HNYA 1FFRA 4AD0A 3ZO9A 2EACA 3VD5A 1GHSA 1CEOA 3QR3A 3TP4A 1K6AA 4W85A 1D2KA 3NSMA 2XG9A 3KL0A 3OBAA 2VX6A 4IM4A 1FH7A 1WB0A 4XB3A 2E9LA 1UUQA 2W67A 1ECEA 4BZYA 2BY0A 1DWAM 4C7DA 4F79A 1ODZA 5ABGA 5JBDA 4AZCB 1BGAA 2ZXQA 4OOZA 3HMCA 3GXFA 3CC1A 4GZJA 4M24A 3VGDA 2ZXBA 2WMFA 5A8NA 3ARVA 1M04A 1E40A 1EO5A 1W91A 2ZXDA 1JF6A 1GVIA 2ZX6A 2DSKA 1E4LA 4TX8A 3BVTA 4UQBA 3KEHA 3THDA 1R34A 3EMCA 2VRJA 3W26A 2WLYA 3VVGA 2QHAA 3EJSA 4UFKA 2D73A 4BCEA 1XC6A 4UQEA 4JFWA 2A3CA 4MNKA 2O9RA 2Z1SA 2JIEA 3WUEA 2DT0A 3WF1A 1JAKA 2GK1B 2JE8A 5DT5A 3SCNA 5A6BA 1KFWA 3VDCA 4CCDA 1KTCA 4TXEA 3VINA 4CD5A 5I3DA 3N17A 4MB5A 2GFTA 4PTWA 3AICA 3AZSA 4PMZA 3VSUA 5HOSA 1KR0A 1GZJA 1YHTA 3RM9A 1UH2A 3GYCA 1LL6A 4QDMA 1VFFA 2GJXB 2O9PA 1ZJBA 4R5EA 3T0AA 1VFOA 1W3JA 4AZIA 2YL9A 4M82A 3WNLA 1JZ2A 3FHQA 2J8GA 1NOFA 2WW5A 3CHCA 2OSWA 3FXYA 1ISXA 3H53A 5A6MA 3AIRA 4YHGA 4NZFA 1JFXA 2VZSA 1CWYA 5FIPA 1R33A 1ZBWA 2J8FA 1RH9A 3ARPA 3DHPA 1Y7VA 2FHCA 3VTRA 3IK2A 2J7HA 3ZOAA 1M03A 4DWSD 5A8QA 1MQPA 1OGSA 4XX6A 5IHSA 3MMWA 1DWFM 4U5IA 5A94A 6CGTA 3B8SA 3MSGA 1C8QA 1V0MA 2XM1A 5BRPA 2XN2A 4U2ZA 4DO6A 3MUAA 4AZHA 1UR8A 1JF5A 3ZQ9A 3UERA 2V3FA 5CGMA 3AJ7A 3WMSA 2YKKA 4UFMA 3VIFA 3BLPX 4AISA 3KE0A 2D0HA 5M5DA 3WEOA 3D5HA 3RM8A 2AMGA 2EPLX 3EDDA 3PN8A 3RJXA 4PBGA 4JFSA 3SUTA 2V5CA 1OD0A 2WMJA 1UKPA 3TTQA 1E9LA 3AMCA 4UZUA 2WLZA 3DHUA 3ARSA 3AROA 1SYTA 1BGGA 1HF6A 2E9BA 4QFUA 1TFVA 2D0GA 1C91A 3K46A 1KGWA 1JZ8A 1BVZA 1O7AA 3THCA 1EO7A 1QNSA 4W5UA 4W93A 1PJ9A 4JIEA 1TQVA 4J3UA 3SUWA 1TE1A 3TA9A 3WH7A 2XFYA 2J7GA 1WCGA 4L4OA 3AS3A 1KWKA 4CD8A 5TD4A 3KL3A 3WSUA 1UH3A 1GNXA 1R75A 3OB8A 2C8NA 3WDJA 3CZSA 4W87A 4JZ5A 2BY2A 4HA3A 4OBRA 1JDAA 3PTQA 3N13A 1KB3A 4P7LA 3WENA 4LGXA 3D51A 1JZ6A 3EBVA 3ZT7A 3SCTA 1VJZA 1G0CA 3EDKA 2A3EA 1ZU8A 3L4YA 1TR1A 4D1IA 4Z2HA 3WD1A 2DDXA 2WXDM 2D1ZA 4WKAA 5KEZA 1HIZA 1CLXA 3OLEA 1J12A 1R85A 2VZUA 3WQ5A 4J3TA 3N12A 3VU2A 3EYPA 4MADA 3BAXA 2CBIA 4J7RA 3OGSA 1JD9A 1QOXA 2GVYA 3QHMA 1B2YA 2ZUNA 3N04A 4U31A 5JUVA 2ZX5A 3BXWA 3VMOA 1US3A 3ALGA 4AEFA 3SUVA 2WSPA 2DSWA 3PZTA 4X0VA 2YDRA 5DT7A 6TAAA 1VEPA 4W84A 3O6AA 4TTUA 4GO8A 2GDUA 1BVNP 4AD2A 3BVXA 1T0OA 2XYLA 4KWUA 5CPTA 3L4VA 1VFUA 4B3LA 2F7QA 4QCEA 2RGMA 2B31A 2JIWA 3AZRA 4HPGA 3VD7A 1MW0A 4MNJA 4U2YA 3F5KA 3GDBA 3BAYA 5I5RA 3AMDA 1GCYA 3WL1A 2IGTA 5JIWA 2VT0A 2W5FA 3VM7A 3K1DA 4P7NA
chains in the Genus database with same CATH superfamily
1H5VA 3WYZA 4UM8B 1JCVA 1CFMA 3FTXA 1IARB 4NQCE 3BWUF 3P4MA 4XN8A 3T3PE 1FI8C 3MCLH 4RISL 5JQ6H 5E0QA 4P9HH 2GUYA 2W95A 3DXAD 2UXVA 5EUOF 4KI5C 3WGVB 4P7OA 3EH5B 2VRKA 2QCNA 4PRTA 3P14A 4HZLB 2DMHA 1XSIA 2ESVA 2IH3B 4Z2LA 5D70L 3KBHE 3FFCE 3TX4A 2OMYB 2ZE0A 4Z6AT 1RSCA 5FKPB 5DEGA 3EAUA 5ABFB 4GP5B 3MJ9H 2I9EA 2PD5A 1QUNB 2CDGA 4AGNA 2F5BH 3HPSA 4B2DA 4BKSC 3CAQA 1JPEA 1I82A 1GOMA 3E0VA 4AENB 2AKRB 4EJ1C 4XRCA 3B9NA 5BZWA 5ECVA 3AS0A 2KHAA 1S5VA 5LGXA 3T0EE 1M7DB 1RFDL 1UXLA 4H8PA 4W7VA 3BLKA 2VXQL 3GI8H 3ZLQC 1C08A 1B57A 4HT1H 2V68A 4M1GH 1UOLA 2WAHA 2PF0A 4W8BA 3K2IA 2CO6A 1HFBA 2P50A 4QF1B 3DXIA 2GJZB 5DDHB 3HTWA 1I4FA 3ZW3A 3BZ4B 4NAFA 4O0ZA 3EEZA 1LWHA 4FMVA 4RA3A 2E67A 3KUMA 3MX0B 3N91A 4E41E 5IQOA 1IBZA 2C4FU 5ERWB 4YXHL 3NZGA 2NUWA 3VIIA 1BJ8A 2G0WA 4MGXA 1QRNA 4OGAD 2UY6B 2ZYSA 3T2PA 3UBFA 5CCJA 3EFOB 2OULB 4LS1A 4O16A 3X3FL 4NM8L 3Q8CA 1CCWB 3TYGL 5G4WA 4TRPL 2EDYA 4AKPA 4MVAA 1MFDH 3ULUF 3GY1A 2L04A 2DQGH 3P4LA 2E6YA 2BVOA 2AI0L 3WBEA 4JRXE 1N9PA 3PNWA 3NJGA 4J3XA 2Q86B 5H8PA 3LIZH 4J8RB 4P2RA 5E8DH 3RZCD 1BBDH 1A7QL 3VOFA 4OTXH 4ZFFA 3EJJX 4L3EB 2V9DA 1XGTB 2PTTA 1H3PL 1ZHKB 5I6MA 5IQLA 5IV2B 4MMZC 2BP3A 3RGBA 3V0FA 3H70A 5FEBA 5FX3A 3OBKA 2BVQB 3LNPA 4H6KA 4RZ6A 2W88A 4KOBA 5BO1L 3NAAL 1ZBVA 1OB1A 3BUVA 3MO4A 2DW7A 4V1DE 5F8QC 1YYAA 2INZA 5KSBB 3JS3A 3CDCA 3PCYA 2CHWA 3TH3T 4HYTB 3PZVA 4Q6KA 3WUGA 3QUXB 1G6RA 4BELD 3QUML 3HGRA 1QTWA 1MWAL 1NIEA 3BP4A 3WLBB 1J0JA 4H26B 4FQ2L 4NRYA 3W38A 5DJAA 4OT1L 5F0JB 3FB5A 1KCRL 3EFFB 4W8LA 5H8UA 3C2VA 1CZ1A 4NI6A 2GIYA 4QXTB 3VIJA 4ZD3L 3SDYL 3KPRA 4EPSA 1NAL1 1V6UA 2J6XA 1FVCB 3KDMA 4ZI8A 4L61A 3ARGD 1LP9A 2ZDRA 2EADA 2J3SA 1BECA 1S3KL 4XCEA 1R0AH 2YSWA 1ISWA 2AEPH 4LGRB 2G2RB 2FX9H 1U8OB 1BFVL 2IH1A 3CFEB 3OZ9H 3M1BB 3GM8A 3ZDYE 3MUCA 1PZ1A 3RL1A 2YXFA 5AAWA 1EEUA 3DHJA 1OZMA 3Q1SL 4LOVA 4N2IA 5I1GL 3CDYA 1AH1A 4OZGB 3OZLA 2GDQA 3V0AC 3L9CA 4MGGA 4IDJH 1O5DT 2YKLL 5KMYA 1JVOA 4N8CH 4Q9BA 4NASA 4HUUA 4F9PC 3L5AA 1SW3A 4OM0H 2FQFA 2NY6D 4ORGA 1XIWC 1XGQA 4KRMB 1B6DA 4PV9B 2GVJA 2DT3A 1JCTA 3VXMD 1XGUB 2C7UA 3KG5A 2SEBA 3EGXA 2WHVA 3P77A 4G7SB 5FO8B 3ARTA 1QWGA 4HNCA 3NA9H 3NTCH 3ZT5A 1A1MB 3FTYA 3S6TA 4C6FA 2HVNA 1KENL 3MRCB 4J28A 3Q3GA 2VH5H 2XFFA 3O0RL 3RFZB 1UB5B 1DJGA 2YPVL 5AYIA 3QG6A 4JFXA 1P4BH 4RMQA 3NCYP 5K4XA 2M1KA 3OX8A 1OF0A 5F8RC 2IF7A 2JGYA 2HJLA 3N9SA 5J1SC 4PUUA 3FJTA 3E0GA 1U8CA 3ZE0B 5FAGA 1UM4L 1E9QB 1YEDB 3E2RA 2Y36L 3CQQA 4GQPH 3D3VD 3BQUB 4FXTA 2DSUA 1I3GL 4G8FB 2WMHA 2X7WA 1U93B 3F8UB 1W15A 2FYYB 1EBAA 3W24A 2OTUA 15C8H 3LTPA 2CKNA 3V4VH 2RKXA 4UT9L 4O12A 1ZS2A 4U1MB 3G5XA 4KWSA 2JTYA 2AQSA 5GGSA 4IOFD 2D20A 3N34A 1NC2B 3PL6A 1AGBA 3C9NA 3QZNA 1F05A 4A2DA 2B7QA 4G5AA 1I8KA 1UJ3B 5HANA 3S35L 1T96A 1GW0A 4MA8L 3WFLA 3HU7A 3LPWA 2WLNA 4H8WH 4W9JC 4X4MA 5GGUA 3MB9A 4NQCD 4E8CA 5ALBL 4ATLA 2EE6A 2NQHA 3JQOB 2A2QT 3DWTA 3GMNA 4JFOB 2ZCLH 3L3OC 1B30A 1KIQB 4RSYA 2GGJA 2G2NA 4LY8A 3VFLA 1EOKA 1E0XA 4PB9H 5D9SA 4CC4A 4I7WA 4PYHA 3CFKA 2WUBH 4ZUUB 4FHBD 4GP4B 3HFFA 2NXZD 4KETA 2PCFB 2YAFA 4GX9A 2PYFA 3VXMA 2WMIB 3TAOA 1QI4A 4DJDD 3F83A 3NACH 3HHRB 3GDCA 1Q4NX 1S7QB 2QVTA 4DP8X 3O8XD 3D3VE 1TSHA 4LLVA 3TT1L 2VN4A 3SGEH 4IQJA 1B0RB 3Q8AA 4XBEL 3GMPB 1IM9A 2XWRA 1S1PA 4Z9KB 4HNTA 4YHNB 3KPNB 1MREL 1UCBH 4K94C 2EYTA 4RLDA 4XVTL 3QXDA 1TPB1 4QX4A 1LLWA 3S96B 4YXKH 3MBEA 4NQQA 5K9KB 2VISA 4L8SB 1WA2X 5DJXA 3HTLX 2FYMA 2D22A 2OVLA 1JZDC 2WINA 2EKCA 1YN6A 1BIIA 1L5GA 3P2DA 2YSSA 1MI5A 5B1AB 1ME8A 4WHBA 2NV9A 1YXDA 4AWJC 2CLZA 5FHBH 4PJ8A 3ES7A 4H00A 3VOJA 3H2NA 1OQOA 1G87A 2W07B 3O4LA 3VCLB 4K6AA 3S9DB 3W2KA 2OFQA 4DGIL 1KIQA 4MJ5B 4EXBA 5DMLA 2CBOA 2VIRA 2KERA 5ETUB 4OECA 5J5DA 1KMGA 3ID7A 5CJOL 4DPRA 4DK5A 4WOQA 2CO7A 4GQ9H 3QJRB 1IKFH 3A6CL 3RJDA 3ROLA 5HHMB 3WZ0E 1G7MB 1G7IA 1E7UA 4GRLB 5KAQG 3SY0A 2CDFA 4ZG1A 1U21A 3STCA 1Z32X 4Z76A 4X8CA 5KVDL 4IHBA 2Q09A 2E3ZA 3RDTA 3B0VC 5C0RL 5I73C 5HYJA 3G5XB 4U1MA 2IPWA 1MG3C 3GIZL 4OCRH 5FYKH 3KDPB 5C1MB 1B3JA 1IE4A 4P46C 2NUXA 1SZGA 1X9RA 1WEJH 2YD5A 3SSGA 2WNGA 3EDJA 3RKDC 2HCVA 3BW3A 5M5DA 2R15A 1CD1A 3DO7B 2N01B 1KV8A 5CJQL 1KACB 4B50A 4HD9A 3QSKB 4LPUA 2IDSA 5F93C 2PWEA 1ZSDA 1A6AB 2HFEA 4U7KA 4PUDA 1FDYA 1I1RA 5DQDL 1WBXA 5CCGE 1U1HA 2A73A 3FW6A 1UKQA 4LB8A 4JIRA 1YEHH 1EERB 4E42A 2AGJH 4V1DB 4P5RA 2WBJB 2BVTA 1ORQA 3OZYA 4EEEA 3MSPA 4Z95L 1JCKA 1CL7L 1WZMA 5TQ2H 4N6RB 1R3IH 3ARXA 5EF0A 3LHPH 5KS9F 2Y2WA 4BFBD 4E5XB 3BVNB 1XC4A 4NN6C 1DXEA 2DM2A 4KO6A 5EOTB 4B5XA 5AZ2H 4N2MA 5IVNA 2RAGA 4TUOA 3WI9A 3G22A 4YBLC 2GUOA 2DY2A 3HMWL 1H3PH 4JUTA 5C6WH 1ICQA 2D2JA 2OZNA 4HUXB 1IGIL 3ZKMD 2DT2A 1GAFL 3DIDA 4NLAA 1ZVYA 5LXVA 1S8DA 2G60L 4EPKA 1MCOH 3Q6GH 3ECBA 3HLAB 2XDFA 2JF6A 3C2OA 4OFDA 4GXWA 1U8NB 4MDIA 5I0YA 1X1NA 3GNPA 2QV4A 3ASOB 4NYLA 2PBGA 5EU3A 1JZ4A 3WKMH 2N56A 2DT1A 3ITGA 3W72A 4OZIF 3OV6A 2O4EA 3R1GH 4RV8A 1KBKA 4JFDA 3K72B 1XF5A 1ACXA 5DVOA 1XF3B 5JXEA 1KJMA 43CAA 2CERA 3WF2A 2ZJSL 4AM0A 1KLFB 3KPQB 5E2VL 1GG0A 1OFPA 3VIGA 4BF5A 3HLKA 2MTPA 4ZUTB 2NNFA 4EUPH 1BZQK 3LRGA 1BVKA 1EHNA 3CCHB 4QRTA 3RX9A 1TJHL 3CIQA 1TX2A 2ICWA 1IM3A 2D3JA 4QHUA 4RFNC 3EBIA 3NCJH 2V3DA 1XHGA 4M3JA 3U1SL 4JIIX 3VFUB 3BIKB 1AZ1A 5T8IA 1T8QA 4X61A 4EOWL 3ZXWA 4MKVA 1PBGA 2PETA 2WPGA 1LK3L 3MCKB 1Y0LA 3U25A 2W92A 1OC5A 1HJWA 3EFDH 4HKJA 1UWQA 1ZTXH 4E38A 1WQVT 5DGRA 2VDKL 1NTHA 1KFAL 2OP4L 2BVQA 4U1LB 1FDJA 4R9OA 5MKGA 2CD0A 2ZUUA 4OKVA 2ZXCA 3CAFA 3W9ZA 1ZTXE 3FT1A 3UR5A 5LAPA 5CEZL 1DVXA 1JP5A 1FOBA 4NQ1A 2Q5BA 3LSOA 4M6NL 3V6OE 2VCAA 1M05B 2X4NA 2O5XH 2R91A 4JDVA 3G0UA 3FT2A 1H6UA 3AB0C 2CZEA 1B4JH 3DOSB 2DZBA 3K13A 3B6SA 3TTOA 2V6AA 4JHMA 2P4AB 4GC4A 1AGEA 1F6FB 4M48H 3ZVHB 1E72M 3BWUC 1VACA 3G6JB 5EBGA 4DAGH 2X4TB 4MTMA 1TUPA 2RMNA 2J6EH 2FWOA 4GAJL 3K74B 4JFFE 1A1NB 5E2UH 1Q6GA 5IMOB 2VWEC 3VXUA 4CEUC 1W5QA 3L65A 5I7GA 1NDTA 2PLMA 4YDNA 2ACRA 2E1DA 3W9DB 4ONOA 3CX2A 1V5XA 2I9LA 3OIHA 3W6MA 3WQCA 4CNOA 4ZTEA 4AW7A 3RU8L 5FKAA 4YHYC 1A1NA 3JWNE 3O8XC 1P69B 4PJ9B 5KJRL 1QOPA 3CEPA 3WL9A 1SBSL 4XMTA 1TKWA 1DP0A 4CMMB 3RWFA 4LS2A 5IDIA 3T78A 1FWJC 1DZ0A 3ES8A 4FI6A 5AYTA 4Z0BH 5HYFA 3STZA 2Z31D 1P4CA 5DELA 4JGDA 5ALCH 4S0HA 1AS7A 3MAWA 4HUKB 1DLHB 4UYQA 5I73B 1MZRA 1OWRM 4RE0A 4WEBL 4PMOA 1UD5A 4EZKA 2X9ZA 2VABB 5F7FA 1TZGH 2R39A 3PGFL 4ZX6A 1DBML 3AT0A 2NY5C 3CWGA 4O10A 2Q9OA 4R83A 1USQA 4WD0A 3NG3A 3MLPA 1NEZB 4P2CG 4XN1A 3FB7A 5CU5A 3ZSTA 1KO0A 1Y5WA 2VM9A 3RE0A 1HINH 2DWDB 4IBYA 1NDZA 1OE2A 3VD0A 2XHNA 4GY4A 5BXFA 1C12B 4GQZA 1G9HA 1II4E 2ICWB 2VW7A 3QAZC 4QHUB 4R7NB 1TUXA 5CAYB 2Z26A 3HVDA 4X9YA 5I3FA 1KXHA 2E4FA 5CR1A 1EF2A 1K7EA 1G0YR 4FNPA 4KMTL 2DMBA 2X4QA 2V2DA 3UJRA 1W3LA 5GGSY 2OKOA 5GIRA 3LCYA 1F00I 3TBTB 2QV5A 1HE8A 3CVBA 5B80A 4X7DC 4PJ5D 2XKUA 3HG3A 4YTTA 3LMJL 2FJFB 3CVHA 1EJVC 2RIKA 2OR7A 3LTVA 1BEYL 3EBAA 4YSUA 1W80A 1AGDA 1ZUAX 2NOYA 1JPMA 5DHYA 1ASOA 2BSTB 4NYLB 2W61A 4R4NC 1NGYA 3RP1A 1NQ6A 2I5QA 3VTAA 2DUZA 3PTKA 4TNVK 5E4AA 2G0KA 1EHLL 3PUUA 5ITFA 3LCXA 3NCXA 5C08D 3W01A 3WOVA 3H8AA 3MSDA 2WYTA 3FCUB 1SJXA 4DGVH 1CLVA 2D7TL 2ZOTA 4XOEA 3LMZA 3RX4A 1E0TA 4Y1AA 4YXLH 4ZZFA 3ENEA 4ELME 3LLXA 2D0FA 3S4SG 3PE9A 4F9LA 1OCRB 5JIDA 2EVGA 1SGJA 2C1HA 1ND0B 4LSRH 3MUHL 1JZIA 2NQJA 4DN4H 4OF0A 5JDSB 1JRHI 2C1PB 1U8JB 2C5DC 4M8QB 4UAOB 3B1UA 1ZXKA 2ADIA 2ABAA 4N6QA 4DM2A 4UILH 2LU7A 2HWZH 2BIOA 1S5HB 1KGCE 4NN6B 3N5AA 4YIQA 5I1EH 2ZRUA 3WH5A 3U2IA 4ZX5A 2AK4A 3FQ4A 1JEZA 3CUXA 3D18B 4BIKA 1Q4WA 1N6UA 4R8WH 4XP5L 5ESQA 2OLDA 4S10A 4I6KA 1IBGH 2HRLA 3FT9A 3H3PH 4H44C 4ZFQA 2PF6A 2W65A 3CJJA 3GK8H 3CV1A 1OAQH 3PJNA 1SXSA 4RMBA 3MBDA 1T7YA 2VWTA 1LQSR 4HWZA 4M4RB 1BTMA 1JK9A 4NEHB 1V0LA 1RUQL 2YB4A 4LAKA 1R3JA 4UC5A 5I06A 5KANG 1KTDB 2IPUK 3N42B 3E8VA 3WO4B 4AYSA 5D5MB 1TVNA 2EIDA 2HISA 5D2NC 2ZC1A 1GYNA 3AY4C 3TVMD 1FHGA 3RGTA 1FIGH 3ZE0E 1EAPB 3VVWA 1QLFB 5DJCA 5FF0A 3V7PA 1P6FA 1WBYA 5GRYA 4J4PD 4JDBA 3L3DA 4MJMA 3L2MA 4LBEA 3CVHH 3VI3B 1LLOA 2ZIDA 5E9DE 5I8KH 1T0NA 3NESA 4M1CD 4M48L 4MA1C 4QHLB 3IJLA 2P48B 4AEEA 1U8JA 1QKZL 3MLYL 4PRAB 2BWGA 4FK9A 1MJJA 2P28B 1NCDH 3ESNA 3BGFC 5DYOB 3VI2A 1LUCB 1TZ7A 4LHQB 3Q13A 4HJSA 3TC3A 4M6VA 1BXVA 2IPKB 5CPOA 1NBVL 3T4AB 3ZMRA 43C9A 2QYGA 1B9KA 3TR9A 1JWSA 4YMZA 1OX4A 1F6LL 3FNKA 3W22A 3CZUB 1JI1A 2XTJC 1CGSH 3E3QE 4G9DA 3S0CA 3MBFA 3UMNA 1ZTXL 3EBHA 1W3TA 3V5FA 4INFA 2OXGA 1E3FA 2OXHB 3FQ2A 4ODSL 2FX8L 2EEAA 3JWOC 4N90E 3WJLA 4FF5A 5JDJA 1YLVA 3AAMA 4B97A 5C07D 1EEYB 1CECA 2DQFA 1XPYA 4OLYH 2PUZA 3TK7A 3VFSB 4KZDL 2KI6A 3N18A 2XACC 3OAWA 4HP5A 4WU5B 4E9VA 2OWWA 1JK8A 5JHDE 4GA8A 4MS6A 4ANWA 3PZ9A 4FXJA 1XCFA 2RBLA 3BSZA 3ZXAC 4FA8A 1HHKB 5EO1B 4KC3B 2I14A 5C2BH 1HL2A 5EUOE 3UJ2A 1AH4A 2XZAH 4J1OA 3TEYA 3FA3A 3STPA 3HI6H 1TTPA 5I1KL 1KC5H 3DSNB 3LSCA 3TCLB 1ZWIA 4GBXA 3ZKXC 1JRCA 4PJCF 3U2SB 1XMEB 3CXFA 1ME9A 4I7UA 3LEYH 1XX9C 4JG5A 1H1ZA 1W32A 4LAQH 3ZKXB 2J7CA 2HXUA 2QZQA 4AQ8C 2CHDA 5KSBE 2ANUA 4W4QA 3QWOA 3WMBA 1JV2B 3QCVH 2MJWA 2YN3A 4H1LH 1FKXA 1H7WA 1TZOA 1IGFL 1PKYA 3VWJA 1MCOL 5IW6B 1ET7A 1FWRA 3W2DL 2E25A 1LWIA 1XL6A 4I8DA 4YSTA 2BNQD 1OFQA 4FHAA 3R94A 3STGA 3CYJA 3G0XA 1OIMA 1QJWA 3IJDA 3S2MA 3QLDA 3P73A 4WI7A 4N9BA 1HHGA 5EBLA 4ZNEA 3B3IA 1LDCA 2DSVA 3L5LA 4IUGA 1LILA 1J8HE 2VDML 4C4KO 4DZBB 3DVIA 4JFFB 4I18A 1E0OB 4FLHA 4REQB 1RKRA 1U92A 3C87A 3O11A 5CILL 2R1YB 1R2SA 1R3IL 3QEUB 3UCQA 1JZHA 2XWJA 5EIIG 2AABL 3UEQA 4L9DA 2G3ZA 1R38A 5FOBA 4UTBH 1JD7A 3L5JA 4W4OC 1L0QA 3UADA 3MRLA 2UY5A 1FCGA 4CMMA 4M81A 1PLGH 2LVEA 4MYWB 3QYCA 4F7MA 3UJEA 3W70A 2X53A 2EUVA 5F1VA 1W72H 2C13A 1LOSA 2WWOA 4F0MA 1ZY9A 2PURA 5F2GA 4AYGA 2DOCA 1NGPH 2PRHA 1AFVH 1F8MA 5BUPA 1VH7A 3VDGA 3UETA 3S4SB 2X1TA 4YCOA 2OZTA 2ZRYA 3D9AL 4B7LA 3W07A 2VLME 2D4FA 2N59A 4NO0A 4QRPA 3ULVH 4XNQA 1GOIA 3F4DA 1J7VR 1E8YA 4X4YA 1ZS8A 3T71A 1M1SA 1G9NH 2GKIA 3CC5B 3QZWA 3G1HA 3KCOA 4DXXA 1BEXA 1NL0H 1E65A 4Z8FH 3GB6A 3WN6A 1RVKA 25C8L 2FQDA 3TPKA 2P5NA 3TJLA 4EPDC 4ENED 4NHCL 3UZVA 3D2UA 2W9MA 4Y7MA 2HLEB 4HU3A 5HGBB 3KRSA 4BK5C 2ZADA 2WWMC 1SN5A 1X4YA 1TJXA 4K5MA 4AIUA 1C5BL 4F0RA 4NNYB 2H6PA 3PGCA 3NQCA 1WXYA 3QGAC 2XZ9A 3SKMB 5BZDB 3WHXA 2Z4QA 1P7HL 3BD5A 2YPIA 4PTDA 4ZZKA 1UJTA 3GHTA 5GRVK 3C6LD 3KYMB 1J0KA 2EDHA 3KRZA 3NFNB 4D9QD 1NLBL 1BM3H 1WD9A 1YEJL 5DJDB 1YBQB 4N20A 4PJEB 4ZMWA 1CLOH 4GSQA 4G80B 5KVDE 1W3KA 2JXMA 2C6QA 2DVXA 1H2JA 2YDSA 3APNA 4JTUA 1VIWA 2BVEA 1U8HB 3LKOB 3MRRB 5DFVD 3PAZA 3EOUA 4GBXC 1Q0XL 2J72A 1WBJA 1UR3M 2NXHA 9RUBA 3FMGL 2VITA 4FEIA 3WQ8A 4J3WA 4JPWH 3B83A 2X1IA 4LB3A 1F4WH 3MRIB 4H2AA 1MHPH 1ZPTA 4DZ8A 1IFHL 1DVZA 3FJ4A 3UMTA 3NJHA 1MHHA 3NACL 4TLKA 5D7JD 4MZRA 1UIPA 3AIWA 4PL2A 1EXPA 4S1FA 1OGTA 1UENA 2C3ZA 4KW2A 4JG1H 2ONEA 1UPMB 4MDIB 4MXVE 4KMQA 5IQ9A 2XZQH 3G1DA 1Q0YH 5E2WH 1U8IB 2A6KB 4UANA 3K4ZA 4KHXL 4WJKB 3NMEA 2OJEB 3MLTA 1QNZH 2QADB 2VDOB 5CUSL 1FAIL 3WNKA 4XC3L 3SJVE 2DVUA 3MNZB 1Q72L 1C5BH 5M3WA 5GS0D 1QRNB 3HC2A 1D7DA 4N2DA 4QXWA 4WW2F 4HSNA 3QGVA 3SYQA 4MJZA 3RPDA 1CE1H 4ODBD 5HYEA 2OLSA 2E3VA 2VDKB 3TYEA 2XA3A 2EC9U 1UVQA 1S46A 3Q5OA 5HQMA 2OP4H 1L6FA 1N6VA 5DMKA 2O4QA 5E1GA 3RRQA 4HTYA 4LLUB 3CNYA 3GU9A 4ERIA 3BH4A 1OARL 1B31A 5B7ZA 5GVJA 3UO1L 4G3YH 5D6CA 2EHHA 1U42A 5LVEA 3NK3A 2R9HC 1SYVA 1TE6A 4ZQTA 4B4FA 3ZMNA 4RDQG 5DSCA 4AXWA 4H83A 1M2OA 4P5UA 1SBBA 1BLIA 1JWMB 4KCTA 4WFFD 3QHOA 5EO0B 3VX0A 4PL1A 5EOCJ 5LIYX 5DRCA 1AHMA 5AHLA 1OL0A 1RI8A 3Q45A 4C6NA 2I69A 5FM5O 2ESVB 2IH3A 1P5VB 1MQKL 3BICA 3MV7D 1ZANL 5C71A 1EWEA 4PCSA 4XMKH 1MRAA 1F3WA 1LVEA 3MKKA 1E4MM 1RR2A 3C0LA 3ARGC 1QK0A 4PN6A 4ZTXA 3I75B 1DYSA 4AD4A 3MSYA 4QRRE 3SN1A 4CMHC 2H6RA 4WWKD 4L2LA 1YEIL 3GJFB 3IE4A 3MV11 5ETUA 4DPBX 2EDKA 4NX0A 2PN5A 2QF8A 2H2SC 2EE2A 4Q6IA 3VGBA 3IV8A 4UV4H 2F1EA 5E7FA 1HHKA 1RUPL 5FW8A 4CD6A 3FN0H 3NYKA 4EI6B 1FWIC 2OMWB 5BRQA 4YDZA 3BZGA 4NSKB 1YN7A 7ENLA 4C90A 1MQRA 5I3JA 3LEYL 4Y4FA 1L5GB 1S38A 2QCEA 3BG5A 1VF8A 3OTRA 4OCXL 1NEUA 1QAWA 3CLFH 1F6PA 5ECUA 4AXNA 4PY8J 2AEQH 5AVNA 3ZRFC 3L2LA 1A7BA 4IGHA 3NIFE 1TWWA 2ZYFA 4Z7VA 3MLVL 3LCFA 3OZ9L 2LE9A 4YSDA 4GCAA 4KJYB 1CR9L 4P2YA 1HH6B 4R9XA 5AOZA 1FORL 5JHDB 1R4XA 3CH1A 4S2SA 4X7SL 1JPTH 4PD4K 2OLHA 4KRTA 3TC7A 2WTRA 4DKTA 3SN0A 3WBAA 3R12A 5HGGS 4LALA 1DANT 3TIDA 3TYFB 5CEXB 4HF5L 1S39A 3SGKC 5PAZA 3SJVB 1WUFA 3N19B 2ENQA 2PRLA 3MLVH 3HBZA 3DGCR 1WZKA 4DGYL 1YQVL 3QF0A 5GJMA 2A6IB 5HPCA 2P5WD 1AR1B 4K7FA 5BJTB 3DVGA 3K0YA 3ILEA 1A7PH 2X40A 3LZRA 4LLUA 5F3HB 3UJIL 2ZX8A 2PU0A 5I79A 4XVJL 1RVFL 3SKNB 3O3EA 1F8TL 3L7EA 2O6EA 4KVCL 3DERA 3FVMA 4AKQA 5J6GA 2VXTH 2SODB 3BKMH 4KQ4H 4D8OA 1AJ7L 1HEHC 4GKZB 1HGYA 3I65A 1I3VA 3MTXA 4F7TB 3Q2WA 2E7CA 5E23A 1ZLWH 1O60A 2FO8A 3FQNB 2WWMD 4WK2B 1H7RA 1HXMB 4IOTA 3UZZA 2PCYA 3LQGA 4MD5B 2QIWA 2ZXWB 3S98A 1B90A 1E51A 1NC2A 3PL6B 3ZIYA 3DC8A 4Y5VB 2VI0A 1EH9A 4IJ3C 1VGEH 3WO8A 2B39A 2CMRH 2IOMA 4NRXB 4PJGE 4OUIA 3RMEA 3QC6X 3UJJL 5HI5C 1IT9H 4M80A 4Z7VF 5DI8A 2IXUA 3BKCL 4IMLB 3CFTA 2X6UA 3USBA 2F7RA 2HVJA 2HT3D 4NQSA 4GEIA 4WEEA 3QDJB 1SVCP 1XIDA 2TAAA 1V5JA 4LMQE 3MRIA 2C0AA 4K68A 4M1RA 1BFTA 4E3TA 1E9QA 4JKMA 1CL7I 3R79A 2QCHA 4AMAA 2VNCA 4PWHA 2GJ6D 3O6CA 1E28A 3WQFA 4KO9A 1BA9A 4YQXL 1SFLA 3K2MC 4UM9D 3E9TA 4GG6B 2P24A 5I1CL 3R0DA 3GK8L 1NAKL 3HZYA 4Q74A 4XTRD 3ILPB 4EK7A 2VR4A 2R59A 3GRWA 3N1FC 3JT2A 3DOPA 1UB5A 5L6UA 4PJ6A 1BWWA 4F2EA 1R5VB 1DVSA 4OV5A 3ECQA 1N4XH 2VLJE 2VQ4A 2VSMB 5KBKA 1IO4C 3IM1A 1D6EA 5AYYA 5A6TC 1UACH 3LZFL 3KBSA 4GRSA 3GO1L 4PHXA 4F9DA 5DMMA 4HIQA 2F68X 3B2UD 3ARFB 3LHVA 5J6SA 3TBSA 5FL1A 4IIGA 2P8LA 2XIJA 3F4VA 4PH6A 2VM4A 4LCCB 3BG9A 3BWWA 4WFED 3WY4A 1JXJA 5DHYB 4OQVA 1G7QA 2AXFA 4QNPF 4AM0Q 1VPXA 4UTHA 3IRCA 2VLRA 2EE3A 3L5WA 1RAMA 3PHOB 4P59H 5AHNA 4WDWA 1CBGA 1SXZA 2MTAA 1CT5A 1PKLA 4OV4A 4N0YL 5EZJB 4QBXA 1YMMA 3WS3B 3IFOA 3W0WA 4AWEA 2A6DA 1V3LA 2GTZB 2NZ9D 4GSDL 1FZJA 4GRWH 1KIRA 2OX5A 1BZ7B 1ZT1A 2VLLA 4DVOA 4N4QA 1HWHB 1UD6A 2BHYA 4QXTA 5I9QC 1XSKA 3T2OA 1BEYH 2VE6A 2YAQA 2HWGA 1X7QA 3WNPA 5HNRA 3UF9A 3O4OB 1HKMA 4GH7B 3RKDD 1DVJA 2BCMA 4HYRA 7XIMA 4BUGA 2E09A 3ETSA 4YSEA 3U8GA 3MUUA 4LGPB 3ZMEA 5BS0D 5J04A 4X9BA 4NO3B 3JUGA 4ZK8A 1A4KB 3DRTA 4PUMA 3AHYA 4TQEH 3MVSA 3GTHA 4U6HB 1E70M 3QYNA 1N6QL 4NP4L 4K8RL 2K6WA 1URIA 4PJ8C 5DFAA 5H6HA 1AZVA 3RWFB 3LIZA 5J13C 4RNIA 1DBMH 3GIQA 3S6DA 3QKEA 4BHUA 3II1A 2QIIA 3H21A 4OZOA 1IXQA 1BQLL 4ZDHA 3IVKB 2B3IA 3VILA 4W88A 3ARWA 4AVFA 2D3VA 4XZ9A 1YXCA 4ELKB 3WFZA 4UV7H 2WSKA 4QS6A 4DO5A 4A7TA 2FIKB 5D7KE 2AV7B 2YQBA 3RNQA 5I24A 2Y70A 1AH0A 4WSHA 4KVPA 2E7LA 5ES4B 1XLJA 5ENLA 1FZJB 1ROCA 1F2QA 4J3OC 4NCDA 3SE4A 1QSEE 1T22A 4DOHB 3ULVL 2XZ7A 3UZEA 1VFHA 5KVEL 4OZ4A 2ETWA 4IHCA 4NIRA 4AH7A 1JGEB 1OCOB 2H0EA 2LV4A 3D39A 4PJAB 4YDVB 5FFLA 2BVWA 3K8LA 4JJ5B 4QROA 4QXIA 5D8WA 4KDWA 4NDMB 1H49A 2Z7KA 2Z92B 3F4WA 2A6LA 1Z1WA 3TQKA 4G5DA 4K3JH 1H19A 3KR3L 1AD9A 5LGJB 2CJUL 1D9KB 1GW6A 3L4TA 4MRBA 5B22A 3EX3A 1I1FB 2OEMA 3JV4B 2MUCA 3ORJA 1RUAL 4GUJA 1COBA 3GI9H 4YBQC 5EBMA 3PHSA 2OXGB 3SPGA 4YSAA 1SEBB 3PQYE 4DERA 2Z28A 4JR9L 3PF2A 1TQSA 4HQQL 4Y4FD 4G9DB 2VN7A 5E5LA 1VFAB 3QPQC 1UA3A 4QHPA 3BSMA 5E5CA 2PPCA 4ODWB 3HQ1A 2BSSB 4OUEA 4PWGA 3HPLA 1GYCA 3HURA 1EEQA 4Y96A 1WGOA 3VFUA 4M29A 1YA5A 1BBDL 1MKFA 1EHKB 3NFPA 3IVTA 3M0YA 5FCUL 1O7DE 3NZSA 5CSGA 2R0KL 3VKKA 1OFEA 1X5AA 2J7EA 3SCMC 3VA8A 3GSNL 2EEBA 4AT6B 5FYLH 2QSVA 5FJTA 3GD1C 1TEYA 3KZ8A 1QSED 3VUPA 1IEHA 4PRBA 3LD5A 4ZBJA 4IFKB 4JD4A 2ENYA 4JB9H 1OOAA 4JNZA 4DYKA 1IIKA 1L9QA 1KDIA 1XF3A 3CWNA 3BE1L 3FQYA 5DRWB 3S36H 3S48A 3ITLA 3HI6L 4G7VL 4GAFB 4P4RA 4QOKB 2XZAL 4XWGH 4Z23A 2FVMA 3FA4A 4LUSB 1P4IH 3QZMA 4M5PA 4D9QE 1MMFA 1YVLA 2H6OA 2XN9E 5CO1A 1AD1A 3A64A 3MV8B 1BYNA 3PTMA 1FCBA 4ODVH 1CXFA 2F7OA 1BG4A 4QHNB 4LBUA 1IAMA 4G1MA 2QCMA 4PMRA 2XTLA 1F9CA 3F5JA 3LG3A 4YHLL 1WIPA 4KPHH 2BP0A 4BI5A 1BREA 1BQCA 4HWBL 4HUXA 2ITDA 4XI5D 3K6IA 3W2DH 2IAND 2XBDA 5L9DH 3BRDA 4HAFA 2XQBH 4DEUA 5BVPL 4IRJA 5D7LD 5CJXA 4Q8QA 4XBGA 2Q8BH 3W1XA 4IK6A 3MBED 4UAHA 5DLMH 1NCTA 3S97C 3TL5A 1OC7A 3KHJA 3QIWD 2YAOA 2CRZA 5AYUH 3FFSA 3FJLA 3TVMA 3FBQA 2G2PA 4M6ML 2WNQA 5EDXA 2BSLA 1T22B 3E2SA 2DJMA 3FOLB 3D69A 3CUJA 4MYAA 3REVB 4JM2A 3MT1A 5D70H 2GJLA 4B60A 3EXTA 3VE0A 4F4RA 4G59C 2XVGA 3GLCA 4XZUB 1CW2A 5F7AA 4GS7C 3BPLB 3SKOB 5J0BA 1BFNA 4Q2ZB 5CZSA 1S78C 4X5WB 3RUGA 4FEZA 1T5XB 1FCCA 2V5RA 3I68A 1NTDA 4GISA 1L0YA 2D3LA 3TJXA 2W9DH 4HA1A 4MWAE 5TQ2L 1U8QB 1I7RB 2V5YA 3MLRL 1DBBH 3BO8A 4ZMYA 1K4HA 1PCWA 4H9TA 3N2MA 3F85A 4MFHA 4JYFA 5JXQA 4R2GC 2GBAA 1YNKH 2QQKH 2R51A 3JWOL 3OMAB 4FQQB 5I74B 3VB8A 3VFOA 3HHSA 4Z7IA 5KN5B 4IU2B 1HUVA 4OR1A 4ODUA 3VZYA 4AWUA 3KVQA 4ZS6C 5F0MB 3TCTA 3ULUD 2VD8A 3AI0A 3V3WA 4PE8A 3M17A 2ZE3A 3WEBA 4PTMA 1C5DA 3ROLB 5HULA 3WE1A 3B9AA 1ZA3B 1JTTA 5HHPA 3F01A 5I75C 4R5TA 3MRJB 4WUKH 1CFNA 3ZL2A 1NGXB 4APQD 3ZM8A 1VDGA 2EAEA 2Y9RT 5C0DA 2HUHA 1MCJA 2AITA 3DX2A 3OQEA 3EOOA 3HI1A 1A3LH 1I7UA 3NRQA 3QXWA 4I0PA 4JDZA 4CU8A 2CLOA 2REQB 3GHUA 1DVTA 1NP0A 4YXGA 1BXXA 4R4FL 3CV6A 4R8WL 2K8QA 4XP5H 5AW7B 4LDCA 5IFAH 3GBDA 1AKJA 4ZPVB 3SCMA 1EJUC 3H9ZA 1IHIA 2UXFA 1ONRA 2H9AB 2QHRL 4GUIA 4UILL 3I84A 2WTPA 1BZEA 2JELL 3HUJA 4HXBH 3QDJE 1YHPA 2W0PA 1NU5A 3PY2A 4YTQA 3L95A 5ISZA 5A8GA 3PHOA 4OD1L 3RWCA 5DK2B 5JW4N 1GOFA 3EX4A 4WDUA 1YYMH 4R0LB 2PP8A 3BC9A 4NJIA 4DVRL 1BD2B 4R3UA 2G75A 3D85D 2BWDA 3JTSB 4PG2C 3SFWA 2HPIA 3AREA 3U0TB 1PLCA 5DEFA 2OCZA 4AZ7A 4H25B 3QARA 4YHPA 5J5EA 2OMTB 3N29A 1GRWA 4WJ5A 2WHKA 4XAGA 1I8IB 5BOZG 3S3DB 1D9KC 2OGYA 5EN2A 4GZEA 4AMCA 2DIEA 4QRQA 2DZEA 3OAZK 4BZ2H 5D9SB 1HJVA 4WK4B 2O5ZL 4Y2DC 3VRIA 2DUXA 2GQ8A 4MDOA 4HVXA 5C2CA 1MWAB 3DX7A 1NM4A 2DQMA 2A1WL 2HWZL 3TEXA 4GEJA 5I1EL 2FJKA 1YEKL 2B5IC 4N8VA 3WBDA 1DJZA 3HI5H 3SDXA 1EFXA 1UR9A 4D0BA 2VGGA 5DS2A 3TEVA 3O0LA 7FABL 3H56A 3W6LA 1LF1A 2HN7A 3QC3A 4OBSA 3VXUB 1QSFD 3C3UA 4ICMA 4B4HA 1DJHA 2NYYC 1SEQH 2R27A 4IIQB 3C6LC 2WQAA 4TM9A 2JJUA 4L4TA 3BKJL 4YS4A 1REQA 1I9EA 2Y5JA 2D7TH 4DBDA 2P5WE 2E6AA 2G9KA 1OTSC 4C4KT 4EF8A 1Z6JT 3B9KB 5F2IA 8PAZA 1GZPB 4GJ1A 4Z5RA 1QO2A 4F66A 2EIZB 1B3OA 3DKHA 4B9FA 2VDNL 1DO5A 1OY0A 3I50L 2JI2A 5EOCH 5A2AA 3T1WA 1GQIA 2CIKA 5F7YC 3UBXI 1R47A 3LRSB 4JFQA 2H1XA 4GKSB 3W5MA 3W1RA 1ZEAL 1B4EA 1EAQA 4Q89A 1IQ8A 4XX1E 4NOBA 3WH6A 3M9YA 4RNRA 4Y8EA 2HJLB 2EPMX 5GS2H 4A8LA 1GKEA 2JXMB 3I2CL 1KXVC 3I9PA 3SO5A 2UY3A 3C8HA 2WNWA 3JYCA 4JY6B 1S5IH 4YNGA 2OB3A 3SKNA 1AZRA 1UD2A 2HVKB 4GAGH 4D8LA 5DMNA 4ZSUA 3WQOA 1TTGA 4CRPA 1ESOA 1YMHA 2GSGB 4AX6A 2ZQ0A 1M9WA 1SMAA 2DKUA 3RTQB 3RWGA 1KG0B 3UTTA 4BSVB 2Z4QB 4GLRI 3Q67A 2QL1A 2WYHA 2V9QA 1W3IA 3GRBA 3WTXA 4FXGB 3S8WA 2X4PA 1BQ5A 4Q4KA 3IPEA 3LHYA 1OSZB 4JFED 5FGCB 1EDTA 4K3DL 1QLEB 3GSOB 4L1HA 5CSZA 5KG9A 5CSYA 3HGOA 3ZS4A 1H4PA 3E5BA 4L8CB 1XIHA 1QFEA 1HXYB 2DJSA 4BRVA 2N0KA 5BMWA 3UVIA 3TH6A 3CU1A 3D09A 3NTCL 4MNHA 2F84A 3URNA 4KFMA 1P5UB 1G6VK 1L3NA 3G6DH 1E9ZB 2OO6A 4D94A 2ZZ1A 4DJED 3E1ZA 3VMPA 5CINL 1ZS8B 4M6NH 2R9HD 4LSSH 4YDIH 4DT2A 1LG2A 4XCEB 1KJ2H 4Z18A 2WIMA 3ALWA 1TZZA 1TV2A 3KBWA 3PZGA 5AVZB 4M7LL 1VESA 3X1GA 3KYAA 4M02A 1QLEL 2ADFL 1T1ZB 4XPBL 4LL9A 5J3HD 2OMBA 2OSLB 3GUTA 3AIEA 3COTA 3W27A 5K9QI 3HB9A 3T42A 1N0XH 3LB6C 3Q1SH 4LPWA 4F2MA 4MY1A 1EMTH 3GJFA 4MAYC 4OLWH 5GS0H 1OEPA 1V08A 1BFVH 4PBEA 1GGBH 2QLYA 5FUZL 1NCNA 2Z0UA 3BAIA 5LYRA 1D5XB 3ESUF 2Z1KA 4DPQA 3G6LA 1E4HA 5IJKA 1NC4D 5CLYA 4H7ZA 4NBZB 4XBPA 1IUZA 1LL4A 3WNMA 4F33A 2C3WA 1DEEB 3KLAA 1M1XA 3TFKC 1Q8AA 5DN1A 5KINA 1ZKAA 2JB5L 1MCEA 1XCXA 4N42A 1ZZMA 3DJZA 3NT0A 3QXAB 4GFXA 3U83A 2XPZA 1GVFA 4LX4A 2XA8H 2XETA 3QUHA 1MVFA 3VXOA 1G84A 4LLMB 4X6FB 4HPXA 5ANHA 4UAOC 5E9DA 3P80A 4MWAC 4FB7A 3FQUB 1NDWA 5T1LD 2BFVL 3BYYA 3G5ZA 3LS4H 4PGBB 3BPOB 3OWEA 2V6HA 1W3HA 4PJIA 2DQTH 1VERA 5JOFB 2W4XA 2QR0A 3QIUB 4WWID 5AOLA 2G8ZA 2J62A 2J4WH 4XO3A 1PZSA 3QIUC 4R53A 2YD8A 3FQXB 4JRYE 1K8DB 1DIDA 3RNKA 5GZND 2CCRA 5K4ZA 3TBVA 4HCFA 1XH3A 3SE3C 1B1YA 2C18A 2QJGA 4LGSB 4FOJA 3W28A 3GSWA 5DD3H 3UR7A 3BKYH 1CBJA 1Y6NR 4QEEA 1JNEA 5IB3A 3CN3A 2GTWA 1H7PA 3QQ4A 4AQAA 4TVDA 1AR1C 4I5BB 1CO1A 5HJYA 1ADWA 2AQVA 5D6DC 1GJIA 4RMVA 3SB3A 2OMNA 1D9KD 1E2VA 1FFQA 2WNXA 1H8NA 2CO1A 2BXZA 3FA5A 4MUZA 3VNLA 2X0VA 3RRXA 4HGXA 2XH4A 2VLRE 3Q6GL 3ZE1B 5FKPA 2YZRA 1AZNA 4HT1L 1PFOA 1NBCA 3JRKA 4JGUA 4TSBH 3RX3A 4HZLA 2QTVA 5K9OA 2F1BA 1Z42A 5DZOA 4JBSA 1TWDA 1HYSC 4JIPA 4NJJA 4KH9A 3RGVD 4DUWA 3TCSA 3W86A 4DP9X 5L8LB 1T6BX 3H42L 4FL4B 4Q7BA 1AO7E 1GYLA 4HQQH 3T0ED 3DHDA 4P3WA 2WC4A 1XFPA 3GM0A 1V7YA 2WD0A 5KUKA 2DQUL 5AC4A 1OEZW 3JZEA 1O1HA 1SFSA 1NCAH 2PKDA 2Q3XA 1IKFL 2IEPA 2NW0A 4YHOL 3Q2VA 5CGBA 3GMNB 5DJCB 1Z66A 1IGTB 2BNQA 2DYPB 3AMLA 4N2AA 3US0A 2Y62A 3APGA 3T8XB 4WXZA 2Y5SA 3PFMA 3CIAA 4QRAA 4LPCA 1RJYB 3BVVA 3QVQA 3WBXA 3E3HA 4N9CA 4TOYH 3ISYA 4GG9A 5AC5A 3AIBA 2Z6IA 4ILDA 3LXBA 3RAJH 1SQ7A 1ZHLA 2GBVA 1KCLA 3AABA 3MLWL 3M0HA 3UP1A 1OTTC 3GVWA 2PTVA 4PD4J 3TQVA 1ITUA 3BMWA 2UZYA 3T8MA 2AAMA 3KEDA 1TMQA 3L3JB 1CGUA 3G77A 2WJ5A 4W6XB 1R5WB 2IPTL 4H9XA 4JJ5A 3QEGH 5FHAH 2QULA 3TMQA 5B21A 4F57H 1D5BB 3MUJA 1PKQB 1T6WA 2E86A 3QUXC 5C0AA 2WWKT 3AYSA 4RR4A 2WVUA 1MCBA 3FEQA 1A5LC 4MXVF 4Z7QB 1K03A 1KRBC 2QDWA 4A8IA 2P8MB 4N0YH 5D1QE 5JQIB 5B7FA 1HN1A 4P59L 2DD8H 3KYKL 1KCWA 1I8MB 4LPXA 4MMZA 4O0KA 4I88A 1FBIL 1J18A 1S7XB 3KGSA 4EAMA 1N2RB 2JJWA 4DWSC 4TUJB 3Q3GB 3F7PC 3ATFA 1K7XA 3QV9A 3B8DA 3GU1A 3KWSA 3G3LA 1GSKA 1MEXH 1P1MA 3GVQA 4WF7A 4HYVA 3U4KA 4FQ1H 4BJLA 3PWNB 4QRRD 4GBUA 4OD3L 1G4SA 1E9OB 4Y2LA 3AAZA 2G50A 2Q6WA 2XDHA 3B2XA 4F8TA 4G83A 1A4KA 3DRTB 3P5YA 3SKJH 5CSSA 1IZKA 1KZQA 3TO4D 1A8JH 2VQ1A 2AJ3A 4P49A 4DVBB 1QSVA 1R46A 4XIAA 1E0UA 1T41A 4MBOA 2OI9C 3FUKA 3WKNA 3MRDA 4FQCL 1N67A 4OCSH 2GY5A 5FGSA 3L95B 3RL1B 5KW9H 4AVOA 1DVYA 3JTTA 2Y7DA 4DJEA 2EH7L 1X7QB 2A9AA 5BZZA 1OP3H 5GIRB 4X6DA 5KVFL 3VOIA 1OE3A 3SFKA 2B1AH 1MEHA 3VI3F 1MCKA 1UZ4A 1BD2D 3AISA 4NI8A 4EZJA 4ZMGA 4JN2A 1DJNA 3FB5B 3CHPA 3W11C 1J96A 1AO7A 4PJBF 1YNPA 2NUYA 5CLXA 5EZPA 3EH4B 3OVPA 3LQZB 1GIGL 2LLEA 4YVPA 4KBPA 2CLEA 4A2SA 3L08A 5EO1A 1BPLB 1C8YA 1QLRB 2FTPA 3O6FC 1SOKA 2XBTA 3LKPA 4FLOA 4UQDA 5B8CB 1EJWC 3V0WH 3NZRA 2AXFB 3QFJA 2GVEA 1HHHB 2K0RA 4UTMA 2CXGA 2QPEB 5C0CE 4Z7VE 4ADJA 4EVNA 4FF7A 3WD4A 3S5LA 4ADTA 2KBGA 4GVFA 3JWDL 3IUDA 1PQZA 2JCCF 3CHQA 3LKNB 4L3EA 7TAAA 1FH9A 3VFOB 4S2BA 1URLA 2PO6D 1X5GA 4AZGA 3V4PA 3KDOA 4YU1A 1Q8MA 1ZA6B 1N55A 4LOCA 3MJYA 2Y36H 5C6MA 6REQA 4YIWA 1BZOA 1IR1A 2LOEA 2WSRA 1MNZA 2X09A 3B9KC 4LIQL 5TBOA 2E6JA 1GH7A 4GPNA 4W8AA 2GSIB 3QG7H 4GI9A 4GW5B 1U83A 2J88A 5DCBA 1WO2A 2EIJB 2H0FA 1E5NA 4JCMA 2JJSA 4ZXBA 5D72L 3TAKA 1IV8A 4XB7A 4C7FA 2BIMA 3FQWA 3DFPA 2A7RA 3IJIA 4EP8C 3REVA 3NDZA 4RX0A 2MQGA 4Y4FC 1XIBA 2D69A 2UZ9A 3VIHA 1CVRA 3QQDB 2FVNA 1JPFA 3IDUA 2B5IB 1VACB 3G6JA 3RX5A 2E5CA 4JO8A 3CFJA 4NENA 3MFGB 4H41A 2WJ7A 3CN1A 3LDBB 5J7CC 4FYQA 1CFNB 2P43B 5HHXL 4K9EL 4P8VA 1S7SA 5DJ2A 3M1CA 5EZOL 5H94A 1VCVA 1AKJD 2AJ3B 1JIBA 1XD1A 3SCMD 3D0AA 2E6DA 3CUHA 3SO3B 4CQ9A 2BP0B 2GEQA 3KJ4B 3RX7A 1B3WA 2D9QB 2NX5E 2BHFA 3CZNA 5CGYC 4QHNA 2XXCB 3IS0X 3GE7A 3VKDA 5IRPA 1LEKB 2Q3ZA 4P7RA 5CBJA 2VQUA 1AQKH 4ZUWA 4DP6X 2E59A 3BO8B 4KTYA 1UATA 1U8PB 3WLWD 4XTRC 3E9UA 2H3KA 3VAEA 1RZ8A 1BD2E 3W00A 1S7XA 2VERA 2BOBA 3QDGD 3NK4A 5BZXA 1A3RH 3ARFC 1BYBA 1RJQA 2GG1A 1ZGLM 1W2VA 2AK4B 3IAQA 2FBJL 4Q8NA 2FPVA 2R1WB 4C4UA 4P5TA 3X3FH 1BF8A 4JM2B 4BA0A 1R3LB 4EF3A 1A49A 4XOCA 5FDWA 1MZYA 4A2EA 5D71H 5HBFA 3MJ8A 3UPRA 3C6SA 2JMRA 4ABVA 5IVXF 1RLBA 3I6KA 3L7FB 5ABAA 1L8NA 2ISVA 3K72A 3HPLB 1T7WA 3IIZA 2MSPA 2E7DA 3QB7C 1ONQB 4POZD 4KKNA 4QTIH 4OZFA 3CUFA 3OG6B 1AJ2A 3H54A 4XVUC 1EP1A 2QSQA 4LU0A 4CA4A 2WXPA 2QQQA 1OLLA 1GYMA 1UP2A 5LB1A 2PNDA 2UZXB 4KVNL 3KPOB 1X1OA 5I1AA 1EIBA 3GR4A 3VZZA 3OTTA 2AI0H 3QNXB 3RHWK 4JRFA 2YZ1A 3E9AA 1FLTX 1JPSL 2X0UA 2WZMA 2CO4A 1HNGA 2WXRA 1JZFA 2WB7A 1WYJA 3HPAA 4AZ5A 1KM0A 1JGUH 2VL5A 4BQ9A 3LNIA 3MRQB 3SDAA 2YIHA 3F00A 1NF7A 2X1UA 2R1KA 3LV5A 3PZOA 1PDKB 2FJHB 5JHLH 3ASNB 4Q22A 5FXCH 3RPKA 2VURA 2BWIA 4F15C 3DO4A 5CINH 3GSUA 1WA3A 5GGRB 2OL3L 1NFKA 4AV5A 1G6RL 5I66B 3VE9A 1K6QL 1SY6L 2JB5H 2H2PC 2R1WA 5JPNC 4QRPE 3SBFA 1A02N 1WAPA 3I3BA 3U0WH 2WVTA 4LASL 2F7IA 1IE5A 2DWEB 2XWDA 3CZJA 5KSAC 2J27A 1KM3A 4GHRA 1JUFA 5HGHB 1XEUA 3OJDA 3DH7A 4BF9A 2NY5H 4PRWA 2OT0A 2EPHA 2NQ3A 4QDWA 2DDQL 3SDCD 1LORA 2PFHA 1I9IL 2NY0D 3PWUB 3FZUD 2C9VA 3MUGA 4LL1A 2Y06H 1KFBA 3BI9X 5T3ZH 4IEFB 4N2FA 3QY8A 4Y16A 3RWDA 1LEKA 4UQ9A 3P30H 4DP2X 2G3JA 3HC4H 4FDWA 1CFVH 5AVRB 1US2A 1TVBA 3MREB 5TF1L 3RDTB 1IAKA 5MEQB 3I6LD 2HX9A 4HMCA 1NFIA 5C0FA 2RCSL 4HOXA 3J07A 1LJYA 2NY3D 4GUHA 3I2CH 1LNUA 3PBMA 3JVAA 5G2IA 4ZFMA 5A2KH 2CSPA 3A6BH 4GZ7A 2G3NA 5E2TL 1EZ2A 4AYMC 1KIUA 5EKYA 3WQPA 3W37A 2ZTJA 1LMIA 4P9HL 1T2QH 3BYTA 1HKLH 2VIRB 4PJAA 4YDVA 2BLEA 1J5DA 3FB6B 3S5NA 2GGIA 2ISFA 2H0JA 1KPUB 2WK2A 5ECJE 5EH1A 2IQ0A 1XS2A 3UCCA 4EI5C 1QFWM 4FXKC 1DN0B 4RDYA 4JPKL 2CA3A 4RPPA 4Q58C 5K69A 2X1WL 1ZHBB 3L9YA 3PNUA 4AY1A 4QLJA 5CZXC 4ODTH 1TR9A 2FWUA 1S5IL 4O54A 4O2CA 4EBQH 4Z7WE 1LO3H 1XF0A 3OG2A 4B90A 3CBKB 1B3ZA 3GKAA 3GS6A 4EWJA 3K2UH 5E70A 5FCSH 3MMEA 5LA0A 1TWSA 4MWFB 1P0DA 2H8ZA 4HHLA 2CZNA 4LJ3A 2L7UA 5AALA 4JR5A 1S7QA 3VYLA 4C6IA 3U30C 4JANA 3LH2L 5LSMA 4LYPA 4S1QL 4IBLT 1J9QA 4P4KD 4TTDC 1D8WA 4U1LA 2YXVA 1RK5A 1KIPA 1AFVL 1ZXQA 1O5KA 4LLWB 3TMLA 1S7TB 4CNIA 1DBJH 1XV8A 1SJCA 4S3KA 3O6MH 4NZ8A 4GRWE 1PSCA 5LXGH 3E6HA 2BLFA 4F7CB 5EF2A 3QRLA 4JO3H 2QQLH 1TPXC 4JPVH 5JIKA 3N85H 2GGHA 2R6OA 2E68A 1H3GA 4WIQA 4QRTB 3APFA 1ADQH 3HS9A 4GW1A 4YVXA 3MI6A 1OM0A 2YEVB 2BNRE 3BLDA 4WTZG 2I26N 2Q76A 3PV6A 3V5CA 1SXNA 3DBXB 2EH8L 4LLYB 4Y4KD 1KIRB 1IAII 3KLKA 4AJYV 2QXWA 4PTTA 5IF0B 4U4MA 4GIPD 5AZ1A 2OSXA 1LD9A 3AU1B 3MFFB 3MBWA 5E94B 2EICA 4PCNA 2PI6A 5M7QA 3LTSA 4PHZA 3ESOA 4UT6H 3AW5A 3D9AH 4HA0A 2C4XA 1X5IA 4DRSA 1FA2A 4X3ZA 1JTOA 3OXSB 2ZOLB 3IJEA 4AVIA 2TODA 3N6HA 3M8OL 4DN3L 3OG4B 1X39A 2Y85A 3Q43A 1RZJC 2HFGL 3H0TA 3FOMB 4LVDA 4NRXA 4N5ED 3K1GA 2ZUWA 3NIFB 2X05A 1E9OA 3FTZA 1CI3M 4JHWH 4UTBL 2PDBA 3A3HA 2I5YL 1QPKA 4AWSA 2NQ9A 3THQA 4XNQB 4AG4H 3ZDXB 4MNLA 3AC0A 2BWQA 5AKTA 1QVOA 3C5JB 1QG3A 4P5MA 1YDYA 3GTTA 1RPKA 3WXWL 3AO0A 1FDLH 4RCXA 1DOSA 4LUSA 5JBFA 1JFHA 3OLGA 1LG1A 3G9VA 3CFDA 3K5RA 4IMKC 5J6GB 3T65B 2YJQA 4PMVA 5F9WB 1J1XH 2AK4E 4XHQA 3H3BC 1ILSA 4XWOD 3QEHA 2R23A 3JWOH 3JBG7 4RGNB 3MCNA 3QDGA 3M7OA 5EC1A 1HVQA 1FFPA 4GOAA 3MO7A 1AR2A 4HUWA 1U92B 1FF5A 2JNZA 4I9WE 4NN5C 5ANMA 5FYKE 3NJIA 1UEYA 3N11A 5C0BE 4G8EA 2K8MA 5BVJA 1K9EA 2Z1BA 4Q7NA 3QKZA 1A47A 2NY1D 4LHJB 3WDQA 4FYSA 4M7LH 4G8GB 1FFRA 3IJEB 4S2SB 1H5BA 1Q5MA 2PGRA 3VACA 4AD0A 3S37L 3TM6A 5H37A 2BZCA 5DQ9A 2CAKA 3QR3A 4GMSH 4NPJA 4BKLB 2ZOKA 3VWJB 1K6AA 3GNXA 1UWEL 3OKMA 3RB7A 2G2RA 2ZZ4A 3OBAA 3N73A 2VX6A 1VCAA 4CILA 3LS9A 3SN4A 4UWMA 1FH7A 5EFIA 1LP9B 1XDLA 5I8OH 1DJXA 1XYLA 3QISA 1IFRA 3OP2A 4Y9BA 1O5PA 3V52L 3ATEA 2G5BA