3BSHA

Barley alpha-amylase isozyme 1 (amy1) double mutant y105a/y380a in complex with inhibitor acarbose
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
404
structure length
404
Chain Sequence
HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIACIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGSRADVGAVIPAGFVTSAHGNDYAVWEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multi-site substrate binding and interplay in barley alpha-amylase 1
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
molecule keywords Alpha-amylase type A isozyme
total genus 127
structure length 404
sequence length 404
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bshA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bshA01
3NIYA 3A22A 1VFUA 2G3NA 3IAPA 2F7RA 4PMNA 3G6MA 4XV0A 4AEFA 1NARA 1JNDA 3VDHA 4UFHA 3ECQA 4EK7A 4ZEPA 1UH3A 4X0NA 3VUPA 3F5KA 1HXJA 2V3FA 1PX8A 2DH2A 3W37A 1TFVA 1XCXA 1JZ7A 2BHUA 1UWTA 1WKYA 2O9OA 1PPIA 4U3AA 1HP5A 4D6GA 2D2OA 1KGWA 1UD4A 2WCSA 4AD4A 3VNZA 4C7DA 1BG4A 1O6IA 4P8UA 1UD6A 1GQLA 2CESA 1W2VA 3W24A 4A3YA 3POHA 1R75A 4M29A 4UZUA 2BY1A 3VO0A 1IZJA 3EDKA 2VX7A 5JIWA 1E6QM 1XH2A 4FNUA 1Z32X 3WNOA 4WIWA 3LXBA 1UUQA 3AICA 4R5EA 5A6BD 3GBDA 3FAWA 3KL3A 4ZXOA 3QHOA 4L4PA 1HL9A 1R8LA 3CH9A 3AMDA 4FNSA 1TA3A 2VX4A 3GH4A 2XWEA 2YFOA 2Q8XA 2J7EA 1PZ3A 1ISVA 4PMXA 1XD1A 3CZGA 4HPHA 2WC3A 1HN1A 2X2IA 3SUWA 4OGZA 1M01A 1HXKA 1PJ9A 5E9AA 1JI2A 3ZJ6A 1KGUA 3WL1A 2GVYA 1J0ZA 3GM8A 3NSXA 3BAWA 2JF6A 1FH8A 2YOCA 4J3VA 2J7HA 1CEOA 2J77A 1E6RA 2X0YA 4MNMA 3S6TA 4ATLA 2IXUA 1W9UA 3PZ9A 4JKKA 3A21A 2XVLA 2YBUA 4NZCA 5ABHA 4PMQA 1W1VA 1HTYA 4FK9A 1LL4A 4AD1A 2W91A 3VMOA 1G9HA 2DSZA 3WDRA 4HZ7A 4MJ4A 7TAAA 2YLAA 4JL1A 3UEQA 2DSUA 1GJWA 4AIOA 3VM7A 3WQVA 1HP4A 1EDGA 3SCOA 3W81A 3D52A 3VMNA 2YIHA 1JXKA 1O7DC 3FAXA 2XJ7A 3EJRA 1V3IA 1FP9A 2WWDA 1I1XA 4NI3A 1MXGA 1HF6A 1SFSA 1OINA 3WQ4A 1OGBA 4CN1A 2GJXA 1MW2A 3J7HA 2ZWZA 2E8YA 2ZXAA 3CZLA 5C70A 5HPCA 1J0JA 1TE1A 4C7GA 3BSHA 1KGXA 1S46A 1AQMA 4LQ1A 3THDA 4IPLA 3EDJA 4NZJA 1PZ2A 2GJXB 4CCDA 2ZX9A 3BMWA 3TTSA 2GK1A 5A6AA 1DWGM 4RE3A 1PEZA 4UQDA 3ZJKA 3H53A 3AIBA 1XSKA 1GQIA 4WSJA 1ZBWA 1LL6A 5A2BA 1GOIA 1JAKA 3PTKA 2XPKA 4CD8A 3RPMA 3WEMA 2CNCA 2WB5A 1A3HA 5CLWA 2PWGA 3W4RA 4E8DA 4Z2GA 4PCSA 2DIEA 2ZUSA 1GNXA 2OWWA 1QBBA 3A4WA 1WNOA 3L4UA 4JFTA 3UR8A 2E40A 3KL5A 1PIGA 2WHLA 1VJZA 4GPNA 3WEOA 2DH3A 3B8SA 5CZKA 4M56A 3ZT7A 1BGGA 3WY1A 2GJPA 4UQEA 4OJYA 1ITXA 3AHYA 4H04A 3UETA 1LWHA 2WZHA 1DEDA 3CUIA 1NOUA 1OM0A 4TTGA 5A1AA 1GZJA 3MV01 4GI6A 2OLHA 1E6NA 3ARQA 3CZKA 4MNKA 1JDDA 3W27A 1E4IA 3AIVA 4S3JA 1UHVA 2VR4A 3AS0A 3WENA 2EACA 1WP6A 5CLTA 4AZIA 4AZHA 3WNMA 1J9YA 3SCRA 2ZXDA 2XIBA 2BXYA 1US2A 2ZIDA 1X6NA 3OGVA 4U5KA 4YHGA 1GVYA 3VMPA 5JBFA 1W2PA 4TOQA 4JIEA 3ZO9A 5M3WA 2CPUA 2J25A 3WD0A 4TX6A 4GZEA 4HOXA 1E6PA 3WUBA 2OYLA 1W1PA 1EHAA 1H0IA 1JIBA 1HVXA 5BWFA 3D5HA 2VUYA 1GORA 1VRXA 4W8LA 1KFWA 1V0LA 3VGBA 5EFDA 4ZE4A 3WF2A 4F66A 2FH8A 2VCAA 3AMCA 3WQ6A 1BVNP 4NXSA 5E70A 2WVUA 5DF0A 1GHSA 5E1QA 5BXPA 4W7WA 4MB3A 1VJSA 5D9OA 3II1A 4UQ9A 4RL3A 1HT6A 1TQUA 3POCA 1CECA 3DYPA 1CDGA 3TONA 4UTFA 1WB0A 4GKLA 3BH4A 3O9NA 3VU2A 3WF4A 1CENA 1OSEA 4Z2IA 3SCSA 3T0AA 1BSIA 2BVDA 3SCTA 2DDXA 5GPRA 3ZT5A 2GUYA 3D4YA 3VD3A 4AW7A 3NDYA 1H0GA 2WW5A 2ZUTA 3AIEA 4FNPA 1Y7VA 4LYQA 5BYWA 1V0MA 5DT5A 1U2YA 1VENA 3W38A 1UA7A 3CV5A 5I77A 3AHTA 1QVBA 1CXFA 1AVAA 3IJ9A 2DT0A 4TUFA 1L0PA 4QCFA 1NP0A 3ZIZA 1MYRA 4KRTA 4BF7A 1U30A 1LF1A 1KWGA 3A3HA 3VNYA 1V08A 3BUDA 1F4AA 1KCLA 2E3ZA 3MSDA 1BPLB 1N82A 3VGHA 3AXIA 1V6VA 4PTMA 1C8XA 2V38A 3GZAA 3HG2A 1HX0A 4GI9A 2ESCA 3BVVA 3VIHA 3U7BA 1HNYA 4ACZA 1UKOA 2DGAA 1QHOA 1EQCA 1SMDA 2BNJA 3AHVA 3M46A 3QHMA 6TAAA 2WVVA 1E4LA 1ISYA 3A23A 3MSGA 2CCRA 4DO5A 4W89A 2O9RA 2WCAA 4XZBA 1OIMA 3CGTA 1W3HA 5C71A 4GZJA 3NDZA 2VVSA 3BAXA 3VSUA 4UNIA 4GXPA 5BRQA 2C0HA 4ML4A 3BCFA 2DT3A 2EPLX 2WHMA 2W66A 3IANA 3VGEA 1RP8A 4AEEA 1E73M 2PF0A 3FN9A 3SURA 3CLWA 1WDSA 5BXRA 2OWXA 1M7XA 2EPKX 2VRJA 4AISA 2VTFA 1HL8A 3SCVA 1W3LA 3TTQA 1HKIA 4QLKA 1D3CA 4HP5A 1H5VA 1M04A 2CIPA 2C8NA 3WDPP 2PC8A 1JYXA 4DWSB 5AC4A 1J12A 2O9TA 5I78A 5IXEA 4MNLA 3LPFA 1W9VA 2W5FA 2CBVA 4Y7EA 2VX5A 1MQRA 3LX9A 3HG4A 1EQPA 1ISWA 2WZIA 2WSKA 3N17A 1NH6A 1BAGA 1UR2A 4FNRA 3UR7A 5A8QA 3CMGA 3T2QA 3L2MA 2XVPA 1B2YA 4PMYA 1JZ8A 4HA3A 5D9MA 4S3KA 3RIKA 4CD4A 2WKLA 4UFJA 4X0VA 3WY4A 3CUHA 1MW3A 1WAWA 3CHFA 4KGLA 5CPQA 1KQZA 5EBAA 4U2ZA 1H11A 5A8NA 5FL0A 4IPNB 2XN1A 1ZU8A 3PZVA 1VFOA 1GOKA 3EJPA 3WNKA 3EYPA 3ARVA 3PBGA 4L4OA 3PZUA 8A3HA 2NT1A 2ZUMA 4AZGA 3PZQA 1CNVA 1JF5A 1UD3A 3O2LA 3I3DA 3BVTA 5E09A 2GJRA 5EMYA 2A3AA 5LYRA 2YL5A 3HMCA 5M17A 4LX4A 3CZNA 1H1NA 3VD7A 1ZBVA 4WKFA 1QI0A 1TQWA 4QFUA 3WY2A 2NT0A 3OLDA 5ABFB 4ATWA 5KEZA 3A6OA 3ZOAA 2O92A 1OT2A 4JFSA 2XUCA 4D6IA 5A8OA 2XGBA 3AYRA 1KR0A 5AC5A 1QI5A 2DT1A 2XHYA 6A3HA 2V3EA 3LXAA 1J0YA 3O6AA 1DP0A 2PBOA 3W28A 4DWSA 4KH2A 4P7RA 5D4YA 4AC1X 1E1FA 2UY4A 3N11A 5FOOA 3NCOA 3PZGA 1P6WA 4M8UA 3WNNA 3DX3A 2WYSA 2D23A 4GZIA 1VBUA 2WK2A 1WPCA 4XZWA 4D6EA 1XV8A 3OLEA 1NOWA 2F18A 1ZS2A 3FHQA 1G1YA 3CHDA 2QMKA 2EQDA 1NWTA 3OB8A 2C7FA 1QOXA 2EPMX 1E15A 3UERA 5A3HA 1JYNA 3FXYA 5AY7A 3OGRA 1E3ZA 1VB9A 2PWFA 1C7TA 4P7OA 3WD3A 3AXXA 1GOWA 3DC0A 3ZM8A 1E0VA 2F7PA 1C8QA 3WUFA 1V03A 5DT7A 3F5JA 1UD8A 1XD0A 1D2KA 2J7CA 2WMIA 4NXKA 2E8ZA 3K4DA 1UZ1A 2CHOA 1ZJAA 4IUGA 4OZOA 4AZBA 3BUPA 4IM4A 1GOOA 2J7DA 4ZE5A 2JIEA 2VZTA 1FP8A 1QNRA 1EXPA 2WSPA 1UASA 2HISA 4EANA 1TCMA 4BS0A 3VDAA 3GNPA 1UD2A 1UYQA 3AHZA 2QF8A 5KZ6A 2YA0A 1HJUA 3MKKA 2WWCA 1QWUA 3HU7A 1EGZA 2G3IA 4DUWA 4FMVA 4P8WA 3EMCA 4TX8A 3KLLA 1SMAA 3W6LA 5HDRA 1UD5A 1E5JA 1FHLA 2GDVA 3K1DA 4Z2LA 1J10A 4WJXA 3AZTA 5CQ1A 3T09A 2X2YA 4AMXA 4W85A 5JIPA 1MW1A 1E5NA 5CSUA 1UR1A 2VCBA 2W61A 2X8RA 3OBAA 3GYCA 1ODUA 1H3GA 2BY2A 1ISZA 3TP4A 3DECA 1JZ6A 2CKRA 4OBRA 2ZX6A 3BMVA 1RPKA 5GNZA 2D0HA 3WKZA 3D4ZA 4U2YA 1ODZA 3CMJA 1W9XA 4W7VA 1UR4A 3H54A 2YL6A 2VI0A 4HZ6A 3HJEA 1OCQA 4PTXA 4Z2KA 2OYMA 2JIWA 3CZSA 1UZ4A 1PS3A 4W5ZA 3ARZA 1NP2A 1UOKA 4CD5A 3WH5A 4PMVA 2F1AA 5CGMA 4Q7NA 3WD4A 3HN3A 2AAAA 1C90A 2GK1B 1H49A 1K9EA 3AS2A 1CWYA 4IISA 1JYWA 1E40A 1FH9A 1KTCA 1CGTA 1EA9C 3I3EA 1UH2A 4V2XA 3WY3A 3WF3A 4MAZA 4A3HA 3W25A 2X2JA 2BV9A 2WZEA 3L4VA 2HVMA 3CPUA 3WF1A 1XSIA 1H2JA 2W63A 4TVDA 3DX2A 3QOMA 3N9KA 5HXMA 1JL8A 3VVGA 1JXJA 3RCNA 1VFMA 3TTYA 2EJ1A 3N13A 2ZWYA 1HKKA 4DWSD 2DEPA 2J62A 3W6MA 3WBEA 2DSWA 1WDPA 3AMKA 4CN4A 3EDFA 1WZKA 1CGWA 2GDUA 4QCEA 3RJYA 2WC4A 1K9TA 1RP9A 1PX3A 4UFLA 1UG6A 4M1RA 3WFZA 3ARSA 4M81A 3N18A 5I24A 3BCDA 3ZSTA 1R7OA 4AMCA 2D73A 5GQBA 1W91A 1LL7A 2ZE0A 3AS3A 4QLLA 1OGSA 1ECEA 5I23A 2E9LA 1J0IA 2F1BA 1J0HA 2XVGA 4PUEA 4DO4A 3BUIA 1B3ZA 4QP0A 3DYOA 4JCLA 1UWSA 4PRWA 4MDPA 3PZNA 3EMZA 3GXNA 4FNQA 3NUKA 3AYSA 3DHPA 4H8VA 3RM8A 3M6DA 1MXDA 2YL8A 1R33A 2VR5A 3MUIA 3N04A 1JD9A 2ZOXA 4LYRA 1GOQA 2UY5A 3N12A 3KWXA 5E0FA 3WFLA 3W53A 1V3JA 4NRSA 2DQXA 1R86A 4BCEA 4BZYA 2WKGA 3ARPA 4KMQA 5A8MA 4YHEA 1CXKA 2UWFA 2JEPA 1XH0A 1GUVA 5A6MA 4LYPA 1C92A 2W92A 4U3CA 1DWFM 3WSUA 4KGJA 4TXEA 4JFUA 1EOMA 1MWOA 2V5DA 1UA3A 5LA2A 2XTKA 3CIVA 3ZSSA 1YQ2A 1X1NA 3VX1A 3WMCA 3ALFA 4CD7A 3AZSA 1ZBCA 3PN8A 1TMQA 1DWAM 4LGXA 2DSKA 1HJQA 1BF2A 4U33A 3MS8A 1Q6DA 2Y8KA 1QI4A 1WO2A 3DX1A 1GCYA 3ZQ9A 5IDIA 3VPLA 4QDMA 5A6SA 1GOMA 2VURA 2XVNA 3MUZ1 4PUDA 3BAKA 4MJ2A 1JZ2A 1KBBA 4F8XA 3WDIA 4PSPA 3ZJ7A 1VBRA 2W4XA 2XIIA 1E6XM 4HA1A 4UQAA 3A4XA 1JFXA 2WCGA 3WUGA 2G3MA 4PMDA 5DFAA 2VZUA 4BA0A 4UZSA 4H2CA 2PBGA 4PTWA 4B15A 1BVZA 1QHPA 2TAAA 2VOTA 1B31A 4H41A 3N15A 1YHTA 2WPGA 1UKQA 2E4TA 1O7AA 1XGZA 4JAWA 3M07A 2CEQA 1W32A 3S2CA 3WMBA 1GQKA 1HWWA 1KXTA 1TVNA 2D22A 2YDRA 1CIUA 2QMJA 4FF5A 4W8AA 1R34A 3CZ8A 3WDHA 5FD0A 3SUTA 2UY2A 1WZMA 3QOKA 3WBAA 2EPNA 1EDTA 1R7AA 3AIRA 3VIJA 4D1IA 3HG5A 3VSTA 3WL0A 7A3HA 1AQHA 1EHNA 1UQZA 3ZMRA 1K9FA 4BQ5A 4HMCA 2Y2WA 3ARYA 3WELA 1KQYA 2GFTA 3VGFA 4Z2JA 2NW0A 5F7UA 1GQJA 3K8KA 3CUFA 2YLLA 3GH7A 2EABA 3L2LA 2J75A 4W84A 4GO8A 1HIZA 3DX0A 2O9PA 4AZ6A 3VD9A 1R46A 3W26A 3AISA 3IAQA 3ARUA 4CU6A 1GHRA 4C7FA 3L4WA 2DT2A 3AIWA 2F8QA 3H55A 4MB5A 3VD4A 1E3XA 3WDJA 3APGA 5CG0A 2XFFA 1OD8A 2G8ZA 4DUXA 4DO6A 3U5YA 3VDBA 1C3FA 5M03A 5A95A 1WZAA 2Z1SA 4QLJA 2X0HA 4BQ4A 3PZOA 4F9JA 1CXLA 2E9MA 1Q6CA 2XYLA 2CHNA 2XM1A 4HA4A 2DPEA 4CN6A 3D3AA 1CTNA 3MMUA 1BHGA 4HOZA 3T08A 5A6JA 2J7BA 2J8FA 2VMFA 1Q6GA 4BQ3A 2Y4SA 3BUBA 1BYCA 1OD0A 4ACZB 1NOFA 3AHXA 4ZXLA 3B9AA 1I75A 1V0KA 4D6HA 4F79A 3VGDA 1LJYA 2XFYA 5A6BA 4P7NA 4HTYA 4PMUA 4B9ZA 3GNOA 1CLVA 3PZTA 3JUGA 3AROA 3K8MA 1NWSA 3AS1A 1QW9A 2NSXA 3A4AA 1OT1A 3L4YA 2XSAA 3AJ7A 1UWQA 5ABEA 1MVYA 2E9BA 3NYDA 4W88A 2F2HA 3NSMA 3GXTA 3WF0A 3WUEA 4KWUA 4OUEA 1VEOA 3UG5A 5AYBA 5HBFA 4PMZA 1EDQA 2YDQA 4U5IA 3AXHA 1KBKA 3A5VA 4AZCA 4OKDA 2YKKA 5I2UA 1WE5A 1QBAA 2OSXA 1V6UA 5I0DA 2CERA 4HMDA 4FLRA 5A6LA 3WN6A 3DHUA 3LPPA 3OZOA 4JCMA 2J8GA 2PB1A 4NF7A 2YA1A 1LG2A 2UY3A 2A3EA 4M82A 4JHOA 2J47A 1VAHA 4JKLA 5E0CA 3CUGA 2FHFA 2CBJA 4ZFMA 3OLIA 3S5ZA 1C8YA 1XHGA 3OGSA 4EE9A 4MNJA 3MV11 4TVUA 4NRRA 4W93A 2BHZA 1E70M 1TQTA 4V27A 2QPSA 1R87A 3PTMA 1NQ6A 1XSJA 1HJWA 3UG3A 3VIGA 1QW8A 1XYFA 4UQBA 4MB4A 3WQ8A 4PTVA 4D72A 3U7VA 4ATDA 1IZKA 5A2AA 1JI1A 1QI3A 3AFBA 5E6YA 1E43A 5D8ZA 2FHBA 2J4GA 2ZUVA 2ZICA 4V28A 3GNRA 4CU7A 2XFRA 3VGGA 1JNEA 1V3MA 1XCWA 4MTVA 3IGUA 2W62A 4AIUA 4WLCA 1UR9A 2VCCA 1FFQA 5EB8A 4GQRA 2G41A 2CBUA 2D24A 1C7SA 4LPCA 3SEPA 5CXPA 4W7UA 1QHZA 3BUQA 1E71M 1RD6A 2A3HA 2OW7A 5A69A 1C93A 1AQ0A 1L8NA 1J11A 1OBAA 1DWHM 1CGUA 1G0CA 3VILA 3CBWA 3G6LA 3GBEA 2RGMA 3DX4A 1HKMA 2DIJA 1C91A 2PI6A 3RJXA 1SYTA 2G4FA 4JZ5A 4MDOA 2YA2A 4NX0A 2VJXA 1KTBA 2CBIA 1W1TA 4HZ8A 4W5UA 1VEPA 2VQUA 4X9YA 3BAJA 2J74A 1GPFA 3NJ3A 1Q6EA 4J27A 2VRQA 1E0WA 4PN2A 2YFNA 4JFWA 1UWIA 4A4AA 1JG9A 3GTNA 1TR1A 3WH8A 1E9LA 1B0IA 4JL2A 1KCKA 1TQSA 2WVSA 1V02E 1VF8A 3EJSA 3WQ5A 3UCQA 2ZUWA 1E4MM 1UR8A 1BYAA 5D9PA 1V3LA 3VOCA 2JFEX 3VDCA 3BLBA 2D0GA 1PBGA 3SCUA 4K68A 3EJQA 1U33A 4M24A 2B31A 4AXNA 3WIJA 1H41A 4UFIA 2X05A 4MAVA 2JALA 4P8VA 1BG9A 4AZ5A 3GXDA 5FL1A 2OSYA 1UWRA 1CZ1A 4D6FA 2WBKA 1VEMA 3D50A 3LRMA 2XN0A 3L4ZA 2WVTA 1BYDA 2CITA 4GIAA 4J7RA 2VQTA 3EBVA 2J7GA 4ACYA 1KXVA 3UG4A 3BSGA 5LA1A 2IGTA 2X1IA 4PYSA 1ISXA 1NWRA 4E2OA 3MUY1 5GNYA 5D9NA 3PTQA 4DM1A 3WEZA 4Z2HA 1A47A 3OIHA 4UCFA 1W3JA 4OOUA 3KL0A 3LRKA 1KXQA 3ZR5A 3MU7A 2Z1KA 1KWKA 4MADA 3TOPA 1DWIM 2XN2A 1ZBKA 2WAGA 4OBSA 3T0DA 4TVCA 3N1AA 4QAWA 4AYGA 3MUAA 3EJTA 2FGLA 2ZXBA 2WLZA 3EDDA 4D6JA 4CGTA 3VIMA 3LXCA 3ZJ8A 1CXIA 3L4TA 3MMDA 4AD2A 4UQCA 4PBGA 4XUYA 1ZB5A 2XGIA 1JZ3A 1V3HA 1B3WA 1R47A 1E6ZA 2CYGA 4B3KA 1G5AA 2X09A 3BXWA 2VZOA 2CETA 2WMIB 5A6KA 4CCEA 1J01A 3MO4A 5FCZA 2BVTA 3OZPA 2ZX7A 4D6DA 3ALGA 3AOFA 4ZENA 1KB3A 1I1WA 3SCQA 3UESA 3PZMA 1UH4A 4YPJA 4E8CA 1FHDA 3RM9A 2VRKA 1V3KA 5BXTA 1OIFA 4JKMA 4PMRA 4RE2A 2BVYA 1GVIA 2W67A 4LXFA 4AD0A 4E4PA 5E6ZA 1XH1A 4PSRA 1QPKA 4GINA 5C8BB 1FA2A 2WHJA 8CGTA 3RILA 1ITCA 1UKTA 4WSKA 4J3TA 2VNCA 2VL4A 1CGXA 4H7VA 4CU8A 5A2CA 3WNPA 1M53A 1JZ4A 3FHAA 1UR0A 4PMOA 3HZ3A 2AMGA 2V3GA 4EAMA 1HVQA 4AY1A 4CD6A 2WNWA 3EMQA 5IHRA 1Q4NX 4XX6A 3T2OA 1QNSA 2EADA 4J28A 1B3YA 3AZRA 1W3KA 1E0XA 4WF7A 5ECUA 2GSJA 2J7FA 3VIFA 1HKJA 3VIOA 2PWHA 5CJ5A 5IFPA 2OW6A 2XWDA 1DHKA 3EJUA 2BXZA 2QLYA 1CXHA 3WH9A 1V6XA 5BCAA 1W1YA 1WDRA 4CUCA 1HJXA 1MFUA 3VD5A 3TTOA 3CO4A 3DYMA 5EFFA 4J3SA 2XSBA 2QV4A 3TA9A 1FOBA 4J3XA 1E55A 1Q6FA 1V6WA 4PEEA 3CTTA 2VZSA 1LG1A 3K4AA 3CC1A 1CGYA 2YL9A 4HU8A 4HOWA 1VIWA 3SCWA 3SCNA 3VM5A 1B1YA 1GONA 4WKHA 2EO7A 2OWCA 3ARRA 3B9EA 2OSWA 1V6YA 4AWEA 1CXEA 2ZX5A 4GO9A 1E6SM 3NSNA 3MANA 1X6LA 1B90A 2E0PA 1B3XA 3AMLA 1QX1A 1JDCA 2VT0A 2WMHA 2F7OA 1TZ7A 3BLPX 3DDFA 5ABGA 3AQUA 4R27A 1LLOA 1V0NA 3ARTA 1ESWA 3AIUA 3PZIA 3CUJA 1E72M 3L4XA 1QNQA 4CVWA 3FW6A 1W9DM 5GNXA 2YJQA 1PAMA 1CBGA 4AZ7A 2YDSA 2EAEA 4CKQA 4P7QA 1E4NA 4W86A 1GJUA 4WK9A 1W9PA 3OA5A 2EEXA 1KXHA 4F9DA 3A47A 1H09A 5D8WA 3GXPA 1QWNA 2JE8A 2A3BA 2G3JA 3ZR6A 1HJSA 2VO5A 1OWQA 3TV8A 4B9YA 3VKKA 4AMWA 5IFTA 1LWJA 2FH6A 3OLGA 2VZVA 2FHCA 4FLSA 1UKPA 2D0FA 3K46A 2WMJA 4W87A 3QR3A 5BXSA 3KZSA 3RM4A 2DSVA 1DTUA 1FFRA 4FLOA 1MFVA 1WCGA 5CGTA 2D1ZA 5A94A 3HG3A 1WDQA 3MMWA 4RE4A 4U31A 3FY1A 1TQVA 5HOSA 4OIFA 3GH5A 1MQQA 3I3BA 1UKSA 1PIFA 2Y5EA 1T0OA 4NZFA 4HU0A 1XYZA 2WXDM 5A8PA 5I3DA 4HPGA 3QGVA 3RMEA 4B3LA 4HMEA 3F5LA 5JBDA 1BTCA 4J3UA 2BS9A 9CGTA 3BVXA 2D20A 4AD3A 3BLKA 1PX4A 1TG7A 4OOZA 3IJ8A 5DEZA 4FNTA 1JD7A 2FDMA 1IT0A 1G94A 4Q22A 3U5UA 2MANA 2ZUUA 3LPGA 5LA0A 2OYKA 1CLXA 1TUXA 1B30A 1QI2A 1K9DA 3GXIA 3D51A 1BYBA 1F4HA 2WLYA 3MI6A 3SUUA 2WM0A 4B16A 3VSVA 1FH7A 1CGVA 4UFKA 1OB0A 1CYGA 4XB3A 3RDKA 4AZCB 3BVWA 5JBEA 4DM2A 3U57A 2WBGA 1E56A 2EBNA 1K6AA 1B9ZA 1D7FA 1WZLA 1BLIA 3AIQA 2XG9A 1JYVA 3IJ7A 2JEQA 2A3CA 2QPUA 4UOZA 4WKAA 1JDAA 2FE0A 6CGTA 2Y24A 1MW0A 4NSBA 1NWUA 3BGAA 3T2PA 4DWSC 2X2HA 3KLKA 4D1JA 5CPSA 4EKJA 5ABFA 4BQ2A 5FIPA 3WMSA 3KEHA 1LQ0A 3VIIA 4FLQA 1US3A 1W9BM 1XRVA 2WMFA 2D3NA 3GDBA 4MPKA 7CGTA 2WHKA 1G01A 4H8HA 2WMKA 2F61A 4D6CA 3LMYA 3VINA 4P8XA 3W82A 1AMYA 2ALWA 2CKSA 3ZT6A 3ARWA 2RGLA 3SUVA 4D71A 1CPUA 3THCA 4UR9A 5BROA 3GXFA 4AIEA 3BAIA 1V02A 3ARXA 2EPOA 2FGZA 2BY0A 1JGIA 5JUVA 1J0KA 2V5CA 1QNPA 5TD4A 1BGAA 2J78A 2QHAA 3W0KA 3E1F1 1EO7A 2PWDA 2WMGA 3WD2A 4H8UA 4CVUA 3WH6A 1NM9A 3DDGA 1QNOA 2VX6A 4J3WA 1M03A 5M5DA 1JAEA 5FKYA 3QHNA 2BFGA 4P7LA 1KR1A 5DMYA 4GI8A 1B3VA 2YBTA 3WD1A 1SZNA 2WANA 4UFMA 1XC6A 4PCTA 4URIA 3IK2A 5I5RA 2Y8VA 1BQCA 1ZL1A 2ZXQA 2VC9A 5I79A 2CXGA 4YN5A 4UOQA 1JZ5A 5IHSA 2PWEA 3PHAA 3LRLA 3T0BA 1TVPA 4TTUA 3CZJA 5CSYA 1JF6A 5CPTA 1GW1A 4W8BA 2ZX8A 3AMGA 3WDQA 2ZUNA 2EXOA 4MB1A 4M80A 5HNNA 2F7QA 3BVUA 2IUZA 3SUSA 4UOJA 1E1EA 4JFVA 3SCPA 1J18A 1MQPA 3WNLA 2V3DA 1IV8A 3BAYA 2BHYA 5I6SA 1EIBA 2FYVA 4AYSA 1BFNA 3SIMA 5BRPA 1TA3B 3CHEA 1ZJBA 3WH7A 1HJVA 3A24A 2XVKA 3BC9A 3VIKA 1RH9A 3CZEA 1SR0A 2WC7A 3WQWA 2AOSA 2D3LA 2J79A 2XM2A 4KRUA 1EOKA 3CHCA 1VFFA 2JF7A 2IXVA 2BY3A 1DWJM 3VIPA 5HPOA 3GXMA 3RO8A 4AD5A 3LPOA 4CCCA 1UWUA 1OGGA 3S5YA 2WVVB 3VTRA 1EH9A 3VX0A 5DO8A 1UQYA 4GQQA 4N0RA 3B9DA 1EO5A 3FNDA 3KE0A 2VVNA 3W29A 4DUVA 3AI0A 3OG2A 3M7SA 1H4PA 4N42A 3K8LA 1JFHA 1R85A 5AYIA 3F4VA 3EDEA 4JHZA
chains in the Genus database with same CATH superfamily
3BOXA 2V0TA 3GI9H 3A22A 3MV8B 2OXGA 1E8WA 1A6TB 1FXPA 1CDYA 1RULH 4AH7A 4BRJA 5B4MD 3RWFA 4OQVA 3ENLA 1FAKT 1FNFA 4ODUB 2J13A 2NDFA 4FHBD 1U9KA 3E2HB 2XQYK 1P84J 1REIA 1WAPA 3HZKB 5GRYA 5J5EA 2HPTA 2PUQT 2OMVB 1CB7B 4ZEPA 4CQDA 1A6TA 2I25N 2WHVA 3X14A 1QR1B 1CD9B 1O9VA 4JX4A 1WHPA 1ALDA 3VUPA 1S39A 3SBWA 4KTDH 3C3UA 1PY0A 3W37A 1NFKA 4JQVC 5D6CB 3VQ2C 1T1ZB 4L8SA 1JZ7A 2V2WB 5MI0B 5DMKB 4EI6A 3L7EA 2O9OA 1H5BB 3EOYG 1VFLA 4LLUA 3L3GB 3NIFB 4D9QE 3PWPD 4MVBD 4GUJA 2D2OA 4D6GA 2CJUL 2GITB 3V6FB 3UCDA 4AD4A 2X89A 4C7DA 3ERXA 2P26A 5IB5A 4N0UA 3QWRA 1QOKA 4TF4A 3ZU8A 5HJ3B 1I1CA 4P8UA 3L5LA 1OWRM 3KYMA 4PI0A 5T26A 1BMZA 3WK0A 4N2LA 4TVSa 2A6DB 4DTGL 3EB3A 3IGAA 3T3PF 3PAZA 3NCCB 4B2DD 4UZUA 5EN2B 2Y8UA 3H8AA 2BY1A 1TR9A 3T4YA 4YX2L 5FGCB 3S3CB 1E6QM 1KPRA 2XKNA 1Z32X 1JRHI 5GZNA 5EF0A 1MVUA 3WQOA 3H23A 3VWJC 4WIWA 4OW6A 4DXVA 5KSVA 4BSWA 4R5EA 5A6BD 2AI0L 3GMRB 5FUZL 1HAUA 2DUXA 5AW4B 3LGEA 4M48H 1DBTA 1JV5B 4I77L 5E1HB 3CH9A 6ENLA 2UX7A 3FU7B 2Z8RA 3EGSB 4R8WH 1S7SA 1SLXA 4MS6A 5C07A 2YFOA 1W8EA 4HCRL 5I1EL 4V1DB 3GMLA 3CB8A 2K9UA 4OVUA 1XO8A 1TZZA 2GVJA 1SYVB 2APWA 2AJSH 2Z4GA 4K2SA 4JOMA 2DQGL 3UTSE 1R3HB 4L37A 1FWWA 1HXKA 2WQUA 3ZDXE 1EB3A 4L23A 2QPXA 4JTUA 2J55A 1E6JL 4LLQA 2MQ0A 2FEEL 3M86A 4YLQT 4M0XA 3D69B 3ZJ6A 4KKQA 3ZKXB 1MJUH 1HSBB 3GM8A 1L6PA 4C56E 3AB0B 1AYOA 2JK5B 2LV4A 2WO5A 1AO7A 4MQ7B 1J9TA 3ZE2F 4FOUA 1DQVA 3NZUA 3DGDA 4LPVA 4J3VA 2HT3D 4EUPG 4XTDA 3CN2A 5AYUL 4G7EB 3K6NA 4V1DE 3LGGA 2IAMB 2CIIA 3TH2T 1J8KA 1RFDL 2LU5A 1WV7T 3EGDA 4J12A 4R0LC 1R3KA 3A21A 2XVLA 1DVXA 4YFLI 2INEA 1PDKB 4FEMA 4TV6A 3ZBMA 1IC0A 5AG9A 4RFNB 3DIPA 3EO1B 4F3HA 4FK9A 4LF1A 3JBG7 2W91A 4YNGA 2VXQH 3VMOA 2DSZA 4NAFB 3T0WA 2A7RA 4BEQA 4WEUD 4GRWH 3E1ZA 1S9KC 3HFTA 3WX7A 5JPMB 2PD5A 3RGVB 4U1SB 2OTWB 2Q3RA 1AGEA 3UTTB 3HIZA 3GBML 3IDGB 7TAAA 1JQXA 4G6ML 1AIFA 4W9LC 1ZMYA 4Z5RA 3UEQA 2Z93A 4ZSOB 4OD1L 1RCQA 3ZUCA 3L9EA 1GJWA 4AIOA 3ZXAC 4W4QA 5FWQA 1IFRA 3GKFA 1NCGA 2KC0A 4LEOB 3RUGE 3NZ8A 3CIQA 3O9WD 4PS4L 4XCYB 4UMCA 5ENLA 3OR6A 4UWQB 5KJ4A 3RKDC 3PWJB 5HR6A 3MRDA 1EF2A 3OD3A 2ICEA 3GUFA 5D1ZI 2X3AA 3KBWA 1WCQA 2YIHA 5D2NA 4HKZA 5TDNB 2DZUA 2YD3A 1C5BL 3C8NA 1V3IA 5TJWK 2WWDA 1KDIA 4XPHL 5ADOH 5MHSE 3OHMB 1AYRA 4NI3A 3GVGA 1SFSA 1UCBH 3BFQG 5HHXH 3AC0A 2EDRA 4HLZG 4X5XA 2UYLA 3VD0A 4QRAA 2VXVH 4MD4B 3W1LA 4XOCA 3SKNB 2HXTA 4KETA 2Y36L 1OE2A 5E2WH 3EOEA 5E8OA 1OGBA 1Z3NA 3U2EA 3OAYK 3V5KA 4RK8A 1N8FA 4NDMA 2ZWZA 5DN1A 2ZXAA 4L56A 2GYSA 5MERB 3GTXA 3SN0A 2CCLA 1DXEA 3COTA 3RX3A 4TULH 1WVZA 4PJDA 4OAWB 4C7GA 4ZMWA 4AYFB 3EFFA 4L4TD 5ITFA 3IJHB 3V75A 5HQEA 5J11B 5FCUH 1JCTA 1Z9MA 4XNXL 3QFJB 3EDJA 3OP2A 1PZ2A 3BWUC 1MRFL 5I8KH 2B9AA 3F7LA 3V5KB 4IWWA 4REQA 2R29A 3PJLA 4CCDA 5FYJL 5HHNA 1VIZA 2GK1A 3CH0A 1DWGM 4WY7H 3PWVB 1KCUH 4I2XB 2Q8BL 2OZ4A 3TNNA 3ZJKA 2WW8A 2ZT9C 3AIBA 1NY1A 1XSKA 4MJID 4WKZA 1I4NA 5IFHH 1IXNA 2Z0UA 2VDLL 3RVTC 1GQIA 3G5ZB 3T3ME 2QGBA 3MP5A 4H25A 3AUOA 3IRPX 2N7BA 1XWVA 5C7ZA 4W6XB 3G1SA 4K3EL 3S3DB 5GGSY 3G9AB 3ULVL 3NDOA 4CNOA 3UR2A 1L5GA 4QF1A 3SGKA 3N85L 4AQEA 5C08D 3HN5A 2YD2A 5CLWA 2E47A 2W3ZA 3L0GA 3NJHA 2ZUSA 1S5IL 1TV7A 1XIHA 3L3JB 1GNXA 1ZPTA 2B4CC 3A4WA 1DFBL 1I2RA 1M9WA 1CG9A 2XNAA 3L4UA 4OZFG 4JFTA 4XAKE 1LOSA 2QEZA 2WHLA 5K9KA 4KKCD 4NG3A 5FYJD 1L0XA 4ZQOA 3W7OA 4ZAKB 3QA3A 3ABXA 2W0LA 5CC5A 5CGQA 1L9PA 2G3ZA 1PGRB 1MWAA 4R7DA 1MVFA 4H40A 3UAEA 4NAEB 4CSPA 1RZ8A 1BVNT 2BSCA 3ZE1B 4OZHE 1BGGA 1IIHA 5EZIL 2GJPA 4L2YA 4UM9D 4JE0A 4AJYV 1KFEA 1DL7H 3IDXH 2WINA 4Y8FA 3SADA 5IY5B 4B9CA 2FBJH 3UETA 2A5UA 1LWHA 3JT0A 3V7AE 2NZ9D 2JNZA 3THMH 2J8UB 3QDJD 1DEDA 4H4NA 4Y9EA 2YR1A 3TYEA 4QNWA 1KTLA 2QGDA 3MV01 1UPPA 1ZWIB 4GI6A 2EKCA 4X7DC 4XMKH 3VG9B 2WQVA 1EEZA 1CFNA 2OR9H 3TASA 1B9KA 3IDIB 3CYVA 1QUMA 4PBDA 1K8YA 3CZKA 3MRMA 3X11A 1OD9A 1JDDA 4JB9L 4LT9A 1E9QB 5I1AA 4N68A 1XBZA 5BQ7A 4G43B 2FBRA 2IDQA 4R7VA 3MNWA 4OZGB 1W56A 2QCLA 1UHVA 1S9VB 4XVEA 2NPLX 4O2FB 3RJDA 3FQNA 1IM3D 4KAQH 1WP6A 2EIKB 3LEYH 4OZIA 4M6OH 3KNBB 2VDNH 3EYUH 5AD0B 3AFLA 4L1SA 5LIKX 3LEXB 3SCRA 4YHZH 1MCWW 5A7BA 1JNJA 1WICA 3B56A 1Y0LA 1A4KA 2ZIDA 4KK9D 4YE4H 1O0VA 1ASPA 3QEGH 4YPGB 2RQ8A 1KM1A 1X6NA 2P7TA 3L7FB 4JRXD 3OGVA 5D2YA 1FVCA 2WXJA 4P5KA 1AXTH 2H45A 2BZ7A 4MKSA 3L45A 4ZW5A 5TE6H 1MI5B 2W0FA 4NUGL 1UQSB 2J25A 1O6SA 3O2WL 4S1RL 3SE3C 4Q4QA 3LEXA 2YC1B 5CC6A 4W9CC 5JDSA 1A14H 3C2VA 5GJSH 3MLSL 4FFTA 3BUYA 5HYJE 3ZHNA 4ZFGL 1YEIL 1EHAA 5L4IA 4I0PD 1X6UA 5J5RA 1SHXA 4YHKL 1NPNA 4GKSA 3NL2A 3CVHL 5C0EA 5BWFA 2H3KA 3HUJA 3O4OC 3QY7A 2E6QA 3VRLE 3CTLA 1NCDL 4XMZA 3MRMB 1GGCH 4LCWB 2FWOB 3X11B 4EQ2A 5FEBA 1V0LA 4A6GA 1XRSA 2AJXL 2L4OA 1LNUB 3I85A 3H9HB 5T5FL 3U46B 3CM4A 4F66A 1D9KD 2BJML 4YYFA 1E4XI 3U6RA 3I6EA 3IXAB 5DWUH 1U6AL 1WD9A 1NZRA 4UB0H 4UQ2A 3WO4B 5BXFB 3CJPA 3S3PA 2KS0A 4H9MA 3LCHA 2C3VB 5GZOC 1BVWA 3WMQA 3PABA 4N9EA 1VGKA 2ON3A 3QORC 4LDEB 2PP7A 3QHZL 5E9DA 3SE6A 1J5OL 1XUUA 2WVUA 5DJ0A 1BVLB 4RAVA 1E4KC 1GHSA 4JUSA 5KTEL 4IHBA 3QN3A 2WMPB 3C8DA 4M62L 4MB3A 4NJAH 4RMBA 4XP4H 2E28A 4UYPA 2OJPA 1NSNL 1UG9A 5EIIA 2XIMA 4RL3A 3WMLA 1HT6A 1IILE 3SZKC 3PABB 4GP8B 4AVNA 4XC1L 2EZ0C 4OZFH 3UROR 2R9HC 3FU3A 1A5AA 1BG4A 3RY5A 4FG0A 1R0MA 4KKLD 1U5JA 3I4EA 4K2UL 3VXOA 3PM6A 3Q01A 1ZIBA 4ADJA 3DHJA 4AYID 3SPHA 3CVIH 4I8DA 3RPIB 3O9NA 3CWOX 4HGXA 3UNDA 4NJIA 1POKA 2AAMA 4HISA 3WF4A 1U8QB 2AJ3B 3EJZC 4EI0A 1T5KA 3LN5B 1F3EA 3DZ1A 5F1VA 4PJGA 2EJAA 2QR0B 3E0VA 4NQDB 3F4CA 2C3XA 4H9VA 4J3OG 3V7PA 1QFHA 3SDAA 4EBQL 3T0AA 4QXTB 1GAFL 4F2MB 2OFQA 4HHMA 5DVLA 2OMWA 1K4CA 3ML9A 5GS1A 1DE5A 2IKJA 1WISA 1Q9WB 3M1OA 3ZT5A 2GUYA 4RBPK 3VD3A 1H7NA 4AW7A 2Z6IA 4RX4D 1RBLA 1M9SA 3GM0A 2ZUTA 2Q20A 2WW5A 4NN5B 2OCFD 3AIEA 3BQUB 4Y19D 3F7VB 2WBJC 2EUXA 4UR8A 5DT5A 3DXAA 3QNZB 3PBUA 5AC7A 5SWUA 2V9UA 1AW5A 5I28A 5KS9A 3WFAA 4CDHA 4MZRA 4J3ZA 4UXDA 2QQKL 3VXPB 3NYKA 1OP3K 5IOPA 2X28A 4YMZA 4YDLB 5GRJH 1NP0A 1BVKA 1MYRA 3UT0A 4KRTA 4L6OA 1U30A 1KWGA 2KLSA 3B8IA 2NSQA 1KEML 3VNYA 4DETA 5JOEA 3RIAF 1V08A 5JZ7D 4L18A 3GVVA 1J2WA 4TPRL 5KANI 1XX9C 2NCMA 1WA0X 4NO5A 5D5ME 3LNIA 1OF0A 4A2HA 2DJUA 3TX4A 4PI2A 4PTMA 1CBVH 4XB8A 3UACA 3HS0A 4PP2B 1K5WA 4Q8PA 3L5HA 2ESCA 2VW4A 1A9BB 3E2HC 4DN3L 3MRKB 1KIRB 3FGCB 5BS0D 3BVVA 1FH5H 2O72A 2AW2A 5I74C 3E9TA 3TIMA 4NQXB 2HQAA 1EGJA 1Z3GL 1R4XA 1HGWA 2GJNA 2ADAA 1W2KT 1X5IA 2O4EA 1IQWL 4G8TA 5AOJA 1MCPH 2NYZA 2Z31C 4DKAA 5L2JB 1QPNA 5J6GB 3GUTB 1KV3A 4FQPA 3H85A 4NENB 2BNJA 2YCLA 3P14A 3M46A 1XEUA 2C6QA 1O68A 1UJ3A 2WVVA 4C5ZA 1P7TB 2OMTB 1E4LA 2L7JA 4YQXH 2Q10A 2JQMA 3A23A 4EN3B 5KZCD 3MSGA 5ICZA 5T8IA 3E3QE 2CCRA 4EIUA 2LT9A 4DO5A 3WJXA 4R4BA 3PWNB 2WCAA 1WDDA 5IIEA 3OMIB 1FDYA 4A2FA 1YPZB 3GDCA 3QZMA 4HUNB 1PTZA 2Y88A 2Z00A 4N9GB 4XMVA 2BB0A 5DO2C 3EWWA 2YXXA 4LBEA 1TZOA 3VKDA 4ZQTA 3NDZA 4ZOBA 5GRVK 4MD5A 3HJ0A 3O15A 4M93C 4YNYB 4ZYKB 2B4CH 3IJEB 3TF7C 4ZD3L 3UTOA 4KKBC 3SE3A 2YQBA 3F1QA 3GHRA 1RZPA 2C0HA 4BQ6A 2V68A 4RMQA 2QF7A 1KTRL 3LQAC 4JS3A 4F8QA 1QO5A 3GZQA 3QUZA 1A4JB 4XPBL 5K9QI 4PJGE 4HVXA 4KDTC 3V9CA 3QW4B 3P3BA 3D7PA 2NNCA 2OU4A 3TLLA 3PLYA 4K4KA 4AVIA 1NDWA 4MUZA 5BXRA 1Q1JL 4OFQA 3ZW3A 1J1XL 3QULA 2R27A 4G9FB 2YD7A 2EPKX 3GXUB 4AISA 4M61A 4GPVA 4ICMA 4IJRA 2V67A 2HX9A 4RETB 3VFTA 4UQIM 3ZL4L 1GZGA 2WTRA 1S5HA 4MYWB 1LDPL 4JFEE 5E6IA 3TGXA 3CHVA 5LNWA 2FZ3A 4HJJL 3WDPP 2ZJSH 4UT6L 2AQPA 3P4OB 5LBVA 1OQFA 3LKSB 5AC4A 2Z9TA 2VLKA 4MX7B 3F84A 4YL9A 5IXEA 4OUUA 4EDXA 1A3ZA 2J6XA 5A16B 1EZVX 5SX4I 2VUOA 4IX2A 1VCFA 4IMKC 3GRWH 5I1LB 2FB3A 1ET7A 1H6TA 3P60A 5E99H 4LTSA 3PUCA 2APVA 3BJFA 1IGIL 4XN9A 2FO4B 4WWOA 3AYVA 2VH5L 2ATMA 3NRQA 3LX9A 3HG4A 3ANYA 1TV8A 4HUCA 3C8FA 1MQKL 4KX9A 3CV1A 1BEYL 3BDYL 1BP3B 2X0SA 3HB9A 1NH6A 3PFQA 1EZSA 1R3JB 3QRBA 4DJED 3UR7A 1A5MC 5DD5L 4AUJA 1R3RA 1T41A 1JWMB 1IKFL 1HHIA 2BZDA 2LVEA 3FSVA 4TUKL 4YHLH 5DUML 3CFBA 4G1MB 5EOQL 2RGLA 2E6JA 2EDXA 1RVFL 5FXCH 3RPKA 4LAQL 3VFVB 4S3KA 1FWJC 3AWFA 3IJSB 4QI3A 3GSRB 3AY2A 4XZLX 1F13A 1LQ0A 4CD4A 3UTSD 4N2AA 2WWNA 1JNLH 3AU0A 3MFFA 4LHUD 4WU5A 3TYFA 4AV5A 4B3VA 1YDVA 3VNIA 1WEJH 2Q0ZX 2HMIC 2IANE 4JGUA 1HCVA 4J3OC 3W39A 1ITQA 3I9PA 3FUEA 4QMEA 5I8OH 1TQXA 3N2XA 3QEHA 2P5NA 4MXVE 4KY2A 4HIIA 1F3DJ 4LPYA 3HZKA 2VEKA 1JPTL 3BO9A 5TBOA 3NPSB 5CPQA 3SDCB 4D7BA 2NVCA 5D9SA 3HPXA 3LSOB 1LP6A 3VFNA 5B1AB 3VXSD 1A66A 5CEZH 1D3HA 4H4IA 4PP2A 1MLCB 2F5AH 2YZ8A 3IB4A 3LKQA 4ODWA 4F33A 5KSBF 1D9KA 1Q38A 4KFZC 5BRZB 3PZVA 1U36A 4G8GE 3ULVE 4YUEL 2DJXA 3FJ4A 3RWGB 3LSOA 3EJPA 4XSMA 4RDYA 1DCLA 3UYRH 1OAQH 1XR9B 4E68A 4PBWD 2Q8AH 1F90L 3F62A 1IGFH 2RDTA 4HK3N 3ARVA 5E8NB 4YWGL 4QF1B 3BVDB 1L5GB 5D7LA 4AQEB 4L4OA 3QI9D 4HK7A 1QABA 4BFFA 4DZ8A 3PZUA 1A7NH 1TSHA 1YEWA 1Y5XA 1YNQA 2FPVA 3QBTB 2HT4D 1ZHLA 1CNVA 1M05A 1GZHA 1UM4L 2H26A 3Q6FB 4FYQA 2YPKA 1Q7QA 2VLRE 5HVHB 3MV7E 2HRWA 2EYSB 4LNVA 4HAFA 5GIRB 3OW1A 2AVGA 3F7VA 2ISFA 4MIMA 5DBTA 2Y5QA 1ZGLB 4N2EA 3KPPB 1NDZA 3F2BA 3TU9A 2HMID 3H6OA 3EH3B 3PULA 2D9QB 2GJRA 3HAEB 3H9SB 5L7XL 4WWKC 4JYDA 4GLRH 1A6VL 3TIEB 2Z25A 3HMCA 3LHPL 5EB9A 5J56B 4LX4A 2DMHA 3GMRA 4JFEA 3VD7A 1KTNA 3W73A 1ZBVA 5GS2H 1KIPA 1I1AB 3LQAH 3WKNA 4YLCA 4JVPA 2YB1A 4Y8EA 3DGGB 5LQBL 4OJFL 2WZTA 4YJZL 5D2LA 3RR4A 4QXGL 3JZUA 5DY3A 3O6FB 2NT0A 4YAQB 4W9HC 2EXTA 2IDCA 2K8MA 3PREA 5F72S 3WY2A 2DORA 3HJZA 5ABFB 4ZXBA 4DF2A 1BD2B 4IRZH 2DVXA 3TJIA 5EBLA 5E8EB 3FO1A 1YYAA 4MNQE 4ZQRA 4MD4A 3GSWB 4QRPA 3FKKA 2GJ6A 4D6IA 4JG1L 3TSDA 4DNLA 3A12A 2H8ZA 5A8OA 1TWZA 5GVJA 2PWVA 4JG9A 2XA3A 3ENEA 4JFOA 3QUXB 5E6IB 3MO7A 2Z4QB 5JR1H 2FX7H 2DT1A 4GMSL 4DJDC 4P23C 1W3IA 3H22A 3DKHA 5L88H 4ECNA 1I1RA 2P5EB 1ZCCA 1DP0A 2ZOWA 3R06B 2ZYFA 4PJGF 3W28A 2LQRA 1GYMA 2YRPA 3N9RA 1TZHB 3DOIA 1K6WA 5DMLA 3ZN6A 2OT1A 1KC7A 2V2WA 5KG9B 1E1FA 3MV9B 5CZRA 5FOOA 5GS0H 2W95A 1YMYA 3V5DA 4LBUA 1P2CA 1FFOB 3PZGA 3QCVH 4GSUA 4XP5H 1A6AB 4M8UA 4KX8A 3DX3A 4ZW7A 4KQ0A 2HV5A 3WKML 2WYSA 3LYEA 5I8EA 4AWUA 3MDUA 1LNUA 1JZGA 1MDTA 5AL0A 3U46A 3RWEB 4B7IA 2FO8A 1U92B 3FXIC 1F58L 1WPCA 1XMEB 2WK2A 2P8PA 5IB2B 1A5NC 4N3TA 3HB3B 5IKCA 1U8CB 3EUUA 4M6VA 5CP7A 3VKJA 2YBRA 3IMSA 3C5JB 3KPQB 8TIMA 1OABA 2WKOF 3D9AL 4JFFD 1BZEA 4WHTA 1R3QA 1TPFA 1XF4A 4XWGL 4X0KB 3FHQA 4KOBA 3HC2A 1GR7A 3HPLA 3G1FA 1OW0C 3WS3B 2V69A 2GZXA 3K72B 4HB7A 4Y5YC 3ORWA 2VQ1B 2XWXA 4J1OA 2R0LL 1SRDA 4FJ6A 1QOXA 3PS7A 3TBYB 5HQLA 4JTGA 5A3HA 4ADSA 1BLNA 3U79A 3L1FA 1NBZB 3FOLA 5F0PB 2NY6B 3FXYA 5J1AB 1YPIA 3EAUA 3OGRA 1YYCA 1Q6LA 1TJ0A 1JHTA 5PTDA 3WD3A 2H2SC 1NMAL 2K3TA 4P4KB 3KBHE 5D8JH 3AXXA 3W1TA 5FYKL 4ZFOA 1UXWB 1RIVL 1XF1A 4F7TA 5FI8A 3WUFA 4U6HA 4XCCH 1KCRH 4YHPB 1XL4A 4X98B 5FF2A 4R90H 1D2KA 5HGAA 3DIFB 1AMXA 1Q8AA 2W81C 3K4DA 4L4PA 1GT8A 2W9MA 3URBA 1JHLH 2LVCA 2Y7SA 2CG9X 3EJCA 4MXVF 4IUGA 1KB9J 1CFNB 4AZBA 2AGTA 3VFSA 4G8FB 1GOOA 1NDTA 2YSWA 1DBAL 3NZPA 5FA3A 3QKZA 2G5BA 5F3HB 2JIEA 2A0LC 2EVIA 2GSIA 3MRPB 5K9JL 1FP8A 3DV4B 4AWSA 3DRTB 1IBGH 5IDZA 4A22A 5DR5L 1KTDB 4HS6B 5DDHB 3R13A 1WBZA 4XZ9A 3NQMA 4O1EA 2R24A 3GNPA 4IICA 1N26A 3O3DA 3WV0A 4LSTL 1H50A 4NKDB 4Y6GA 2VLJB 2VO8A 1FV1A 3MRQA 4TRPH 2V2CA 3MV8E 1IEAA 1O5DT 2YA0A 4IIQB 4N6QA 3CH8A 5F71A 3MKKA 5HHOD 5A8GA 1CD0A 2F08A 3OJMB 3OXSA 1RD5A 1JUFB 2NY6D 4GLEA 1D5IH 3N42F 2G3IA 3D07A 1F9CA 3TV3H 2I5YH 1G7VA 3MRBB 4GBXB 3B3DA 1U21A 4ZAKA 1MRDL 2YK1L 3NFUA 3G6AA 1CLZH 2XZCH 2AQTA 5HDRA 4PGZA 2ZPKH 4Z7WA 2ZP9A 1G7QB 5CJOL 4Z2LA 4ZPTA 4BK5C 2EF9A 2I32A 3AZTA 3AABA 1XKYA 2OMNA 4FQXA 3B2XA 2CGRL 3IPWA 5JIHA 3E6HB 5C9RA 4JZNB 3IM1A 5IREA 2VL5B 3GKAA 2O5XL 1AI1H 2AXFB 7PTDA 4XWOC 4MNQD 5I71C 1UR1A 3WIFA 3HR5B 1E67A 2VE6B 3B2DC 2B16A 4KROD 4DGYL 4QRQB 1PQZA 2VCBA 2X2UA 1P0EA 2FPYA 4GOAA 3P9MB 4L2LA 2A1WL 1MJ8L 3RHGA 4DZIA 1RPQA 2F53D 3DECA 4KKLC 4EXKA 5C0FB 1EHLL 4I90A 4UB9A 2CO2A 1KM5A 3LQZB 3UJIH 4REQB 2O5XH 2Y9RT 3Q2NA 3KBSA 2OL3B 3NZSA 3QUKB 1FFOA 4JVWA 4ZMVA 4IIQA 1WA3A 5DQJA 5GNZA 5IF0A 1IWPA 1XBDA 4YHML 1I8MB 2NTFA 3UAAA 4W7VA 1YNLL 4GJTB 1NLDL 3MJMA 5C0CE 3D39A 2VI0A 3EOAA 3MO1A 2GFBA 1RCXB 1A7QH 4HNCA 3MOAL 1I8IA 4UTTC 3SJNA 2WXOA 2JJTA 2ADIA 5ID1A 1OCQA 2XZCL 3RWJA 2DY3A 2HE5A 3NQEA 3Q4DA 1C5DB 1MCFA 3EBGA 5E8DH 2EXYC 4OZFA 1T7ZA 4PVNA 1UFGA 3CSTA 3G5VA 5KW9L 2C1IA 5I3IA 4H8NA 2OMUB 2ZUQB 1QSFE 5ISZD 1T2QL 2I9LB 2NWSA 3R0DA 4PIRF 3PQYA 3R79A 5DMGD 2DJ4A 4TRPL 2G4GA 4QY8B 3TA3B 3WH5A 3GHEH 5HNUA 5AW8B 5CCKL 3U7WL 1FDZA 3PGCA 4YWIA 4PVBA 2GTZB 4XOAA 2P53A 1E4WH 3D3VD 1N64L 3FT3A 3RBSA 1LYXA 2X1WL 5C0BD 1JWUB 1V05A 3TA6A 4AZHA 2ATAA 3QQ3A 4F91B 2YAOA 3BPLB 2KZBA 4Z7UA 1JYWA 1SXZA 3Q8EA 3JTBA 4KERA 1E40A 2R0KH 4WSGA 5BZZA 4GUGA 4X63A 1KTCA 4A55A 2YMTA 5JOPE 3I3EA 4JM4L 4V2XA 3ARGB 5E2UH 4IPJA 1IXOA 2WGNB 4R96B 5B1BB 4GT7A 5EPMB 1E2ZA 4U4BA 5IM7B 1FX6A 3L65A 5BNKA 4ZB0A 2BV9A 3L4VA 3KWWA 2YGVA 4Y5VC 4ETYA 3CPUA 3VK5A 1SPDA 4AX3A 4M8QA 4TVDA 1AJ7H 5IM51 3DX2A 3RVXC 1E9OB 1HZYA 3F6JA 4H44C 2OAAA 3CL8A 1ADQL 3IETB 4HGWA 4EXAA 5I07A 5FA4B 3W86A 5HXMA 1JL8A 4UIMB 3VVGA 1QFUH 4DGVL 4PUNA 4O16A 4KTEL 4E3VA 3CLFH 2LLLA 4Z42C 2L7UA 1UGKA 2F19L 2VJ8A 1E4XL 3KCWA 3N13A 2VSCA 1JJKA 2VDRB 5A2IH 1E9ZB 5DI8B 1HKKA 4V1YA 2J62A 3WBEA 2MRYA 1SYVA 1WDPA 2R2EA 2C26A 4CN4A 2XWRA 4L1TA 3LV3B 3TBTA 1OK0A 3A13A 4O19A 4KRPD 5DK2A 1YUKB 3ZVHA 2CK0H 4OIIL 5JIQA 5K4ZA 2WC4A 1M7DA 1N7KA 4LOUD 1F4WH 2FQDA 4GIEA 1HKLL 4RMSA 1PCKA 1SM9A 3QZAA 4M1RA 1KIUB 2XV6B 4IDLA 4KITB 2HSIA 3WFZA 3HI6L 4M7LL 1QLRA 5T3XE 1F6KA 3TJLA 2NR6C 2ZRZA 1F58H 3WQFA 5JDJA 1R7OA 3PNWB 5JOFA 4RX0A 1TMCB 2VDOH 3FCSA 1TVHA 1OX4B 3U6WA 1RK1B 1FGVH 3MU3A 1W91A 4E2BA 3BJLA 4PP1D 4C56D 2XPZA 4DGVH 5K5YA 1CFTB 1GGUA 2BZNA 2YS4A 1WG3A 3FZUD 5GS0L 3N1QC 1M1XA 2A77L 1SN2A 2W1NA 2Z31A 4PJ5A 4BBWA 2XVGA 1XINA 3N6QA 4JJHA 3UBPC 1TSIA 4Z17A 1W0WA 3ZLGA 3NCBB 1O1HA 1RLCL 4NNYA 4K9EH 4OCSL 2JKSA 1TUFA 1L3WA 1CUOA 1H6FA 3TWAA 1QOQA 4M5TA 1UWSA 3UXAA 5AVWB 1EGJH 1S38A 1IGWA 1RXLA 4NQCD 4P46B 2ZRYA 3AYSA 3CV7A 3DHPA 4H8VA 1G7PA 3REWA 4H3DA 4ZFOL 1G87A 4YHYC 1SVCP 3RM8A 1T5XA 4WCJA 2VELA 3G3DA 5H2BA 2ZRWA 1ZY9A 1I8MA 1RZJC 3IDJB 4NM8H 3TQKA 2DF3A 2VR5A 3MUIA 3IEBA 2CDGA 4LRSA 2XV0A 1JD9A 2C9QA 3F7RA 2JV6A 3FONB 3Q13A 1KYUA 3LMJH 3N6JA 5AHFA 4FALA 3KWVA 2MTAA 3O3UN 2I57A 2ED7A 2ZOXA 1FGNH 4G5DA 4JIRA 4LYRA 2N1TE 3ROLA 5JQHC 2ODHA 3X1GA 2A6KB 1GOQA 3DTXB 3UAJA 3AUJA 3HI6H 4IJ3C 4PC8A 1NDMA 1V3JA 3LKRA 5BUGA 1SUJA 5IR1B 4BCEA 3PY9A 3QFJD 4Z7WF 4LSSL 3VI3B 2WOQA 4OU1A 4NQVB 3C5ZA 3VCRA 5JUEL 1SW0A 2CU9A 3MCKA 3ARBD 2L5HA 4HCDA 3VTTA 5A8MA 1OSPL 3OVUB 3S36X 3UTQB 1E0TA 1OC7A 3LKQB 2OEMA 4YXKL 2V5LA 3HLKA 4HV8A 3BVNB 5HJXA 3RPDA 4NP4L 4E41D 5KN5B 1BAFH 1SLUA 3LB6D 1SEBA 2VEIA 3C6CA 4WDIA 1A7QL 5E6ID 1MCEA 4U3CA 4D7PA 1KN2L 3IAGC 1QK2A 1MWOA 2I14A 4LPTA 3HTWA 4HUVB 1UA3A 4OLYH 5FLVA 1A6UH 2P80D 3VJ6A 3CIVA 4HNOA 1OAQL 3V3WA 1CFSA 2VLME 3VX1A 3WMCA 4CD7A 3QO0A 3AZSA 2FECL 5KJRL 1QLFB 3HZVA 4RVBA 2A9AA 3PN8A 2Y25A 1LUCA 3TW6A 1I7ZB 4PTUA 3H4HA 5IBUB 3E8VA 1WK0A 4CA4A 3R19A 2FVLA 1S8DA 2ZCKH 4IS6B 4MJIE 4OLXH 1R3YA 2BGSA 4IZGA 3IRZA 4PL2A 4IMAA 3HZYA 1TX0A 3GI8H 2X0UA 2WOBA 1PLCA 4Z95H 4MWAD 1J86A 1FSKC 1JPTH 1F1DA 3ZQ9A 2ADYA 2NQHA 4RSVA 4OI8A 4DAGL 5K9QG 1ZA6B 3UABA 2ZOTA 1P4IH 2HK1A 3K30A 2XVNA 3EO9H 1ZPUA 2X44D 4Z77B 1OFOA 4KROC 3D69A 2A5HA 3D85D 1LZOA 4LLQB 3GLDA 1EXUA 5DD1L 5DI8A 4LLDB 3QHFH 4PGJA 1FL5A 4CMHB 3WN5C 1KA9F 2QS8A 1HWGB 4P46C 1M6UA 2WN2A 3EKZA 2B1AH 2CHXA 4X7TA 2BSSB 4QJ3B 3FUIA 5F1NA 3TO4D 3WYRA 4YBLB 3B7UX 4HA1A 4YR6A 1XGQB 1E6XM 1A7OH 3V18A 3VA8A 4ERIA 2VXTH 4R7NA 4YK4C 5DT1H 3D08A 4OTXL 3IV3A 4XVJL 1IE4A 1SJCA 4QBXA 4UZSA 3W2LA 1DE4A 4PTWA 3QXDB 4HS3B 3GIYA 5T8GA 1BVZA 4B15A 4DO7A 4PH8A 1VKXB 3KZPA 2VDPB 3FYEB 4E5TA 4HXBL 5CN2A 5GGVL 1UTDA 4NJHA 5DJAA 5CSGA 5FF7A 4AK2A 2EDOA 3V16A 4H41A 2WPGA 2GBTA 1UKQA 4NO3B 5JXEC 5LNDA 1X44A 2ISDA 5L2KA 3AXKA 3BPCA 3BK0A 1GSMA 3GZPA 3M07A 1C29A 2CEQA 1DJGA 1JVKA 3QZLA 4XRCB 3X3FH 2GL5A 2X7WA 4LVGA 3UF9A 3S2CA 1JQVA 3J27A 3WMBA 1HWWA 3EADA 2D22A 5KOMC 4DHGA 4FF5A 1B4RA 4MNGA 2K45A 3WDHA 4KFPA 4ELME 1W6LA 2AAVA 2PPEA 4P3CH 1TITA 5D7IA 5AVNA 1JHLL 5E9NA 4LS0A 1WZMA 3QOKA 2A1WH 3NSDA 3FQWB 3SJVB 3S6DA 4UAOC 4MBRA 2J6EL 1ACCA 1ORSB 1J1XH 2E7HA 1R7AA 3AIRA 1SJVA 2PDKA 3CH1A 3VIJA 4DUOA 1OAXL 1P1ZB 1F07A 3NIDB 5I1HH 4IRSC 4RAUB 1EHNA 1A4LA 4QJ4B 4BQ5A 4O2EB 3ONCA 1VRDA 1L6XA 3F6LA 4XPBH 1OP9A 4HMCA 1XB6A 3ULVC 1RIVH 2ABBA 2QADC 3WELA 1JGUH 4BY3A 4U1LA 2BSBA 2BVQB 1HZHL 3VGFA 3UQNA 2NW0A 3FU0A 4U1JB 1TZHA 1P4LA 2BNRB 3ML8A 4DOHB 3CUFA 2DP3A 1YAZA 1YC7A 3GH7A 4PEKA 2D7QA 4LNRA 3TWCH 4Q9CA 5CJOH 5EN3A 2ADGA 5HNRA 1Z89A 1U91A 3PV6B 2GDQA 2NX5B 3DX0A 2VP8A 4CVZA 5IBLC 1T6WA 3VD9A 3ITYA 4H1ZA 1NICA 3T71A 3LI0A 2GK2A 3G04B 3ARUA 4H8PA 4WW2C 5D2LF 3L4WA 3W11C 4XIMA 3RRXA 1TZIA 1MNNA 1PG7X 4UNKA 1VLXA 3RWFB 3KFTA 3RZCC 2ESVE 2DAVA 1OPOA 3LQZA 3ZHLA 4WHYG 3LZPA 1R3TA 2PDJA 3TA4D 5DD3H 1DL3A 5BV7C 1D9KC 1HIML 3LJ3A 2O5YH 2G8ZA 2IOIA 4DUXA 3QY8A 3KRBA 4IRZA 3D46A 1K85A 5DZVA 2Z1SA 4IKKA 1X7FA 2N7AA 2DVTA 1T21B 3EA3A 3GMNA 3QZ6A 1RK6A 1XYLA 4BQ4A 1IKNC 1Q7MA 2NX5E 3I9AA 2KT6A 1JRHL 1Q6CA 4KTGA 4JZOB 3UGRA 3HKZA 5K9JH 1HE8A 1FNSH 1P5UC 1PKQB 5BO1L 2XM1A 4HA4A 4HPNA 2BS71 3QISA 4KO9A 3D3AA 3VNMA 4N2OA 2NYYD 2SEBA 2Y7OA 4PGCB 4K5MA 4TVPL 5FWRA 3HE6D 3UYPB 4G7VL 4BUGA 3IV8A 3QLDA 1RJYB 4LGPB 4R53A 2QFRA 3T08A 3C08L 1S2AA 2X4TB 5DHVA 1EXHA 1O7DE 1LORA 5FS5A 1Q6GA 5IESH 3TVAA 3VCCA 3QDMA 4GMSH 1RA5A 3LGDA 3EOBA 1IQDB 2CK2A 3FTSA 4C6BA 2Y4SA 4OF0A 1EBAA 1KEMH 2J43A 5BV7B 3LIZH 3RX9A 4ACZB 1KB5L 3HA1A 2FIRT 1PFCA 5KSBA 3QZOA 3JUZA 4NX5A 1IVLA 3SGKC 1E8ZA 1U8LB 4XNYL 4QOKB 2BRRH 2OPJA 4FSAA 3EYQD 2PCFA 3CDGA 3MUHL 4RDBA 5HYFA 1V0KA 2WSQA 2DWDB 1FWEC 1R3SA 5HMEA 2FJUB 2NYYC 3FTYA 3RU8L 3VKCA 4QRRE 2FDBP 3C6LB 2K7QA 4NQCA 4B9KC 1I2NA 4NUMA 3NN8A 3ILQD 1OFDA 3KHDA 3P5ZA 4B9IA 3LDVA 3OG3A 1P4UA 2J1KA 2IQTA 4HWZA 3OJDB 1K8CA 3PZTA 1YA5A 4KMTH 4M1BA 1EEZB 1EP2A 2FZMA 2ZP0T 3AROA 2WNNA 3AS1A 4BIKA 3CX5K 3LHTA 1IAOB 3IDMB 4H7ZA 3ILDA 1MCDA 2VXUH 2WGXA 3A4AA 3BD3A 4MSWB 4XXWC 2MCG1 3RAJH 1OT1A 1A8JH 4KZDL 3L4YA 1C1EH 5IHHA 4PBFA 3AJ7A 1IGTB 5REQB 1MN4A 3NEEA 5ABEA 2X4SB 4GRMB 2PMZA 2E9BA 2ICEC 4MHHG 2Y1HA 1TNNA 2EKGA 1RERA 3NSMA 4FR1A 2YO3A 2Y7FA 3MGAA 1DIEA 4Y7OC 5AVHA 4J2MA 4PMZA 4YMPA 2JB5H 4X61A 1NCBH 1UB6B 4ZB2A 1TTQA 2VC7A 3KRSA 1F41A 5LGHH 4PBXA 1NCJA 1J05A 4LS2A 1KB5A 2EE0A 3UW6A 1K8DA 3C5QA 1WE5A 1PLAA 4P9HH 3JVGA 3EPMA 2I9UA 3OA3A 4OHQA 3HMWH 4QIUA 2GLKA 4ZFOB 4X8JA 1F97A 1FFPB 5IB1B 1EYEA 4TLTA 1KBPA 1NDYA 2JKLA 1XGUA 2C1GA 1JHTB 3S46A 3DETD 4NJAL 1XI3A 4FLRA 1K5NA 3QB7C 2ZZ2A 3PBYA 5DJCA 5T1DL 3UTPE 2NZIA 2OL3H 2QQLH 3VVWA 1R3KB 3EGJA 5CEZL 2J8GA 3RZWA 3BUYB 3LTYA 4AUUA 2PB1A 4NF7A 5D04C 1G7MB 5BZAA 3MLYH 3U9WA 4W9EC 3KMDA 2MWCA 3GSNA 5K1NA 2A3EA 2PLCA 1KG0B 2A74B 2KUTA 4K7PX 4AEIL 2ZQKA 2FX9H 4I5BA 4IEFB 4GXFA 4JKLA 4N0YL 2FHFA 4PJFB 3U1SL 2J6WA 3TEYA 3V79C 1VCVA 1R9XA 3ET9F 3OLIA 2VGLM 3S5ZA 3WLKX 1INQB 3WAJA 4Y19A 2WB7A 4K9EC 4IOFC 1QR7A 3ES7A 1XXFC 2P47B 2VDKB 3U9PL 4OJFH 3ELAT 4ZQPA 4GGBA 4AQ1A 2EIMB 4NRRA 4P5MB 1ZCOA 1S7TA 2A73B 3VYPA 3LHWA 2B08A 1GVSA 3W85A 1YNTB 1TPDA 1TQTA 1WAAA 1OY0A 3MLSH 5I74B 3P6LA 2MNJB 4JO3H 1N59B 3HVNA 1HJWA 5BQ7B 3DOSA 3BWUF 2G9HA 2V2XA 3FH8A 2J88L 4UU9B 5IGXL 1X96A 3WLTA 4NKDA 1XGRB 4W6WB 4DEWA 1I9CB 1UWEL 4TSAL 4GC3A 3OF6A 3SKNA 3TVMC 4F8LA 2OX5A 4H9YA 5BVPH 4JFOB 3VTMA 4PGDB 1X9RA 3L5JA 5AENA 1N7ML 2B0SH 2CUHA 5ELIA 4FI4A 4ATDA 1T5WA 4M6OL 3CVCA 5FC9A 5ACZA 3FA5A 4QHUB 4IIDA 4TN9A 3PWLA 4P4RA 3K3QA 2PSNA 3AW5A 1CFBA 4Y5YB 3VXTA 1G43A 5D1XA 1W72A 4O14A 2I7GA 5ABAA 4PR5A 2X9YA 1YXCA 2WUBL 4GIOA 2H8PB 3Q67A 3RNKB 4YVXA 2BC4A 2HCZX 4PJHB 5C6WH 3CQHA 3RGHA 5LIXX 2WBJA 2H1LM 4KHTL 1V3MA 4NN5C 5E9DE 2B7NA 4Q6IA 4YHPA 3IPFA 2Q3ZA 4WWKD 2NNFA 3HS9A 3WZ0E 2XA8H 4UUJA 4B5ZA 4AIUA 4G9PA 4ZOEA 1BRLA 1UR9A 1FDJA 2R7EA 2IADA 5EMJA 3MODL 4GNVA 5EBWA 2UWEA 3E2QA 5DEGA 1EWEA 2CBUA 4NJ9L 4G7RB 1L2UA 1ACYL 5GIRA 1OHQA 3UTSB 3X1BA 1C7SA 1MG2C 3ZDXF 4UT7H 1GY2A 2OI9B 4W7UA 2EYRB 1MHEB 1JNLL 1THFD 4PJ9B 1AQ8A 1QHZA 1X8FA 2NXHA 3TN3A 4Z76A 1N8OE 2QGYA 5C0RH 2A9NL 2OO0A 5C9JB 4Z08A 1JGEB 3MRCB 2N0KA 2J4WH 1RVFH 3K0YA 1KBIA 4X3ZA 5BOZG 1KV7A 5A69A 2FNWA 1C93A 4NO5B 4HZLA 4WW1B 3C5ZB 3LZOA 5FYKE 3TAKA 1JZJA 5F4SA 1CGUA 3PNZA 2EEAA 5CFAA 3T4CA 3VILA 4N1CA 2ACQA 3GG0A 4W4OA 1O12A 3CBWA 5DYOA 2XQYG 3G6LA 2WSRA 3F58H 3DXIA 4G5AA 2YXFA 1C91A 1KRBC 1N2RA 1IT7A 1TX2A 4TUJA 2FT6A 4MDOA 2YA2A 2VH5H 5HJYA 2CBIA 3GG8A 3OB0K 3G0UA 2R1XB 4G59C 5FYLD 3SBWC 3GTTA 3GIQA 3N85H 4NQEB 2QDEA 4HZ8A 3JWOC 2HROA 4L4JA 5KSBE 1MRAA 1IM3A 4X9YA 3BAJA 1HG3A 4GHRA 1NF7A 4ZUSA 1Z3GH 4QPEA 5EA0H 4HUKB 4D8OA 3FQYA 4OSUL 3UGXA 2H41A 4WWKA 3H9ZA 1Q6EA 3NOIA 3W22A 3QHTC 4J27A 3R8BB 1L9NA 2VRQA 3ZIMA 3M1CA 1CB4A 3OTTA 4HEME 1E0WA 4FS9A 5DCBA 5DJ8A 4PFMA 3OQ3B 1UWIA 5FAGA 1C16A 2H9GB 4XMPL 3SN1A 3QR2A 1JG9A 3TROA 4IMLA 1ZP3A 5M95B 1W0WB 2RCSL 3GSVB 1B0IA 1FYTD 2Z28A 3Q44A 4DJEC 1CYWA 1Q1JH 2WVSA 3NFNA 3WQ5A 1OVZA 4I5RA 1E7UA 1XFPA 2JB6B 2WXRA 1AY1H 1J48A 1YYMH 2BVPA 1NGYA 4PS3A 4TNWF 3JWDC 2ZKHL 2X1OA 5IEHA 5GRJL 5F88A 2OSLB 2EEBA 4BFNA 1M2OA 1V3LA 3EYFB 4IMLB 1E6OH 4PV1C 1PBGA 4K71C 3SCUA 3W2UA 3TYCA 1U33A 2FLMA 1D7KA 5AFAA 1OTUC 3WIJA 4YZFE 3TIDA 3BLEA 4A3RA 5CEYA 4MJMA 1TRIA 3QRGH 1DPMA 1BWWA 4OFVA 2OSYA 4UU9A 3S2AA 4F80A 3RYSA 4BF9A 1CZ1A 3ZE2B 3GW3A 3W1AA 1TR7A 3IJQA 1NGQH 3BZEB 3F2LA 4LCYB 2ZOOA 2PETA 1TCRB 5C08B 3FOKA 3ESPA 3GSQB 3EW3B 1XVSA 2DWYA 3BWAB 4HKXB 2OQJB 4MMXC 1TV5A 4Q4MA 4KZEL 2PXYB 4C1LA 4LOCA 4OD2A 1ELSA 1B4EA 3T3MF 2X6AA 1SHMA 3GMQB 3MV7A 4UT9L 2CITA 1INQA 2AEIT 4GIAA 4PW4A 1DBML 4UM8B 1ZLDA 3EBVA 1UYWL 4H04A 3VE7A 2DEYX 4YGVA 5D4HA 4ZDHB 1A53A 4QR6A 4ACYA 1SFDA 3VWKC 1KXVA 3VXNA 2I56A 3FTXA 4XBEH 4X8XA 3BSGA 2AV1B 4FCAA 1EF3A 4XPTL 2D7PA 4KDWA 5HDBB 2YKLH 3MLTA 1ISXA 3CT7A 3NM3A 4RXGA 5ENWA 1J93A 3D6NA 4JFQB 4TYUA 4JREB 4ZW8A 4AL8H 3NWRA 1MJJA 3SDXB 3S6CA 4OZIF 3CWHA 1RIHH 1BQLL 3KS5A 5IFJA 3PANA 3WEZA 5I6LA 4P2CG 4J4PD 4L80A 3SRFA 3FSAA 5HHPA 1MCNA 1KJMA 2DS4A 3TW9A 4O0ZA 2J77A 2K4WA 3T6CA 1W3JA 5BU9A 1QP1A 3TJPA 3MOBH 1KF9B 1UOLA 5EBWB 1A3QA 5EO9B 3QJOA 1OP4A 3MU7A 3GKWL 3GNML 5KSAA 1DJZA 5DD0H 3U0WL 3IGLA 1I8JA 3MBFA 3F12A 4GMTH 3TOPA 4Q9QL 4P46D 5FJRA 4ZXBD 2XN2A 1DWIM 4X5WB 1CB2A 1ZS8B 4GP4B 4JPIA 4RGNB 4JTHA 3IJSA 1IEHA 4TVCA 3N1AA 1A3RH 1U8IB 4QAWA 3S97C 4AYGA 2AC0A 3BDKA 4PG2A 4LAMA 4U1MB 4LUYA 4FXLA 2H8PA 3ALWA 2PFHA 4M43L 1AQFA 2AJYH 4G6JH 4JQXC 4ZUVA 3TKFA 2OR7A 4H20L 5JU6A 4CGTA 1AGCB 3BXNA 3QDGA 1MUJA 2P42B 5DU7A 2Y06H 4JHWH 4DJMA 3L0NA 3VIMA 2E7BA 4XSLA 4KI5C 4E2DA 2X30A 1CXIA 3L4TA 3MMDA 4R5TA 4UQCA 3T42A 3SM0A 4PJFF 4HIJB 8PAZA 1SOKA 4JTAA 4MNGB 5KUMA 2WIIA 4NQUA 4ALAL 2XGIA 1RZFL 2AJZB 3C4UA 4H88H 4RGNE 4HGKC 5J8OA 1B3WA 1S9XA 1FHVA 3BIBX 2IH9A 3W2JA 1SXCA 3D18B 5CJBA 5D7LD 1TLMA 1O95A 4OV9A 3CK0H 4EIVA 5A6KA 2ZOUA 2UY7A 2GYIA 5DCDA 3INOA 3UIZA 3V6OC 1NWOA 3P4OA 4KAQL 1RVKA 5T3ZH 2XACC 3QUKA 4RSYA 1DQJA 2TPSA 1U8HB 3AOFA 2ARJQ 4AY0A 4MA7L 4APQA 5C7XL 4DP8X 5FUCE 4E4UA 3PZMA 2Z24A 1AGDB 3BIAX 4FQJL 5C0GA 3QC0A 4BEUA 5BUPA 3STPA 1FHDA 2HUHA 3WFDL 5BMXA 5C86A 4H13C 43CAB 3TEZA 3RM9A 2WBWB 4C4UA 4MD0B 4JKMA 1LQBC 2WN3A 1NMBL 5MEOB 3H2AA 1Z5LB 4OQTL 3WIHH 3M5ZA 4RPQA 1R3LB 4QE1A 3W23A 3WO8A 3QIUA 2Y7GA 2ZUXA 3PWPB 3ETTA 3Q5TA 1X8CA 4PB4A 4KTDL 4DAFA 5B8CC 4XO3A 5E6ZA 3NJGA 2NY7H 4MD0A 5LWYL 3W9DB 3TBWB 2P1YA 5K4XA 4FKKA 2OV0A 4NC1C 1JFQH 4PJIF 2CGZA 5IP4A 3B05A 4GINA 5MHSD 5C8BB 4P2YA 4RZ4A 2VC2L 2BIMA 3ITLA 2VMCA 5C07E 2NY7L 1ITCA 1QSEA 1RHFA 3MRBA 3NA9L 1UKTA 4A2DA 4R4BB 1SYSB 1REQA 1W31A 1EMTH 1G6RA 3KYOB 5EEXA 3P69A 4KRZA 2EKJA 5J11C 1RR2A 1ZTVA 2IPJA 3NQ8A 1QW7A 3KPMA 4CU8A 2OMTA 3QZBA 1JZ4A 4CVZB 2OFJA 4PH6A 5HI3D 1N6QL 4Z7VF 2VENA 4RAHA 5C0BB 1WKFA 2IG2L 1PL3A 2N3JA 1CGSH 3ZE0E 3BAEH 2V7HA 2V3GA 5KVEL 2ICWJ 4AY1A 1XGYL 2X4QB 1WFMA 3H3PH 3HHSA 2NNXA 1A6ZA 1BJ1H 1XLIA 4EZKA 4CD6A 1VGKB 3IIVA 1R5IB 3FRPB 2DV6A 1RZGA 4B50A 4M1DH 5AYIA 5D72L 4K5OA 3CAFA 1XCQA 3GNNA 4XX6A 1B0RA 2ZXCA 3FYYA 3AZRA 3ZHDA 2V2HA 5I0YA 5GS1C 5KSUB 4LSPL 2R4RL 2BXVA 1HYRC 3W01A 2VLLA 4LH8A 4WY0B 1KGCE 4ONFH 2J7FA 3S35X 4C8XA 3M64A 2ZYRA 2PWHA 2WXFA 3LCYA 4TM9A 3S2MA 4C6IA 3BKML 1JUEA 2OW6A 1DHKA 2DW6A 3QE5A 1MRFH 2BXZA 4X5WA 3Q94A 1CXHA 3L4CA 3EYVB 4XNXH 1V6XA 2Y7EA 3QV7A 2EH7H 1FTXA 2NYKA 2AEWA 1EXGA 2IJ0C 3V6BR 1E5UI 3CSFA 3QUZD 3VD5A 1KGJA 3TTOA 3DYMA 5KVFH 3N4FA 4RXFA 3KGSA 3AZUA 4MMYB 4R33A 5A6SA 3WLSA 3H12A 3VWJB 3S96B 3CASA 4LAOA 4XAKD 1FOBA 1KFAL 3CFJA 3KPRB 2AJYL 4G6JL 1BJ8A 2Z7UA 4XN1A 5IHWA 1Q6FA 2XQYA 2E6DA 3CTTA 4AQ8A 3K4AA 1UCBL 5D7HA 5AYQA 5GJPA 1CFQA 1FAIL 4PJXE 1MXSA 1X38A 3UZYA 1I31A 4WU7A 3ARBB 1HQ4A 1W16A 4Y5VA 2DJSA 2LAAA 5ANMB 4G7EA 2VDKH 4I0PB 4KV5E 4FABH 3SCNA 3TYZA 4EF8A 2EO7A 2OWCA 1SXAA 3AAMA 4S0SD 3O16A 1K5NB 1TU2B 1G9MC 4PRIB 4IHOA 1XGQA 2ZX5A 4GW4B 15C8L 4H8WL 1TQBC 1RZ7L 3RTQA 2YZRA 3NSNA 1JF1B 4OCYL 4GFSA 4X7TB 4PJ5B 2Y72A 1TO3A 3Q1SL 2NY5H 2D8KA 1YEEL 3NH7L 1R9FA 3TBBA 1JDCA 2J20A 3PF3A 1PYFA 3TK7A 4Y4KA 4KRLB 4PFEA 2R51A 4ZMLA 4PJXB 4HYTB 2WZPA 2F7OA 1TZ7A 4GX8A 5FJIA 3BHBA 4YTTA 3AQUA 3QK0A 4LSRL 4IBUA 4PCPA 4MMXA 3X3GL 2NUTB 4QHNB 5C0GB 2XDHA 5KYUA 4ZMZA 2IW0A 4Y2DD 2BP8A 2KERA 3D05A 4K7PL 4MJZA 4IGNA 3F05A 3VFMA 3IGHX 1YEGL 2FD6L 3BHBB 5C09D 3CQKA 4HHGA 4YXHH 5H8MA 5IJDC 4GBUA 3HBZA 3K4WA 1EWDA 3MDJA 2VDQL 3GIVB 5A6TC 4L9LA 4P2AA 1NFIB 1BF5A 2EAEA 4L4TB 4JLRA 4GYKA 1G9NL 4KKCC 1BWVA 1A5FL 5IW3A 4KY1H 2KH2B 4L65A 4NM4H 3IGAB 1DIOA 1S7RB 4RGOH 3WU1A 2R2CA 2WTPA 3LDBB 3PAUA 4AVFA 3NRFA 1CJYA 1E6JH 1GJUA 1I1YA 4WK9A 5F0LB 4CMMA 2Q5BA 2D31A 3OA5A 3UVAA 3X12B 5KYNA 3UADA 1GVEA 4G2DA 2R2HA 2QTEA 1O6VA 2K6YA 4DZHA 1WRFA 3QQNA 5DJ8B 4DJEA 3KWWB 1TT6A 5C6PB 3ATZA 4XPHH 5ADOL 4IJBA 3W7PA 2ZCLL 3N40P 1Y18A 1ZV2A 3MCKB 4OGQC 1QWNA 3GK8L 3M7FB 1NCHA 3TZVC 1OCNA 1H3UA 4H25B 3ZR6A 3GU1A 3PPFA 2H9GA 2ZCLH 4UV7H 1TKWA 1G5GA 1X9LA 4IRSD 2P7TB 2NNRA 4P2QA 4Y4FB 3OLGA 5AW7B 5A3ID 3EZ8A 2FHCA 4FLSA 4XMPH 4OD1H 4KWWA 1WIUA 4J8QA 2D0FA 4LAZA 4NKIL 2PCEA 2DZXA 3RXZA 1DIDA 4A8RA 4UF7C 5I1GH 3MXWL 2XX1A 1RCYA 4GQ0A 3EKGA 1IB5A 2DEWX 4OSUH 4IQDA 3EGXA 1FFRA 4J3OH 4TLSA 5I75C 1WCGA 1HL2A 4C91A 2A0NA 3Q9PA 3U1PA 1U42A 3B1TA 2VDQH 3MMWA 1FFPA 5IB1A 5LBSL 2HA1A 4YXHL 1ONXA 2C19A 3KRZA 4HS8L 4MJIB 3RX8A 1KLYA 1XYAA 3NG3A 2BWIA 4LLDA 1TQVA 3ZUNC 5H94B 3EWYA 3SPIA 3LCIA 5HOSA 2R2BA 1MQQA 2D7NA 4Z77A 3I3BA 4AM0B 1VHPA 2FDSA 3CBJB 4HIIB 4P05A 2WXIA 3X3GH 3TZNA 4PJCB 2NX5A 4PTTA 4QR7A 1PIFA 2F74A 4JZJB 1YRKA 1WFUA 3GMQA 1FKWA 4NZFA 4P4KD 3OKEA 5TQ0L 4HU0A 4X4MA 4I9JA 5C9ZA 1WS7A 5CBEB 1N4XH 5I1CL 3C0SA 4PUMA 2BO0A 4EI5D 1COBA 4MJ5A 3P73A 4B0MB 1JV2A 3GLEA 1L6SA 3MX0B 4XUGA 3NH7H 2A9NH 4JN7A 3VI3F 1AIFB 5BQDA 1EFXA 2PXYD 1NDGA 5DEGB 4HMEA 1PY9A 4NC2B 4PRPA 4FXGB 3WLRA 1GGTA 2IAMD 1BTCA 2XU9A 1MFBH 2K8QA 3WN5A 1A5CA 4HCRH 1XF0A 3S9YA