3BSHA

Barley alpha-amylase isozyme 1 (amy1) double mutant y105a/y380a in complex with inhibitor acarbose
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
404
structure length
404
Chain Sequence
HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIACIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGSRADVGAVIPAGFVTSAHGNDYAVWEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multi-site substrate binding and interplay in barley alpha-amylase 1
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
molecule keywords Alpha-amylase type A isozyme
total genus 127
structure length 404
sequence length 404
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bshA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bshA01
3LPOA 1OD8A 4AYSA 4YPJA 4UQBA 3VD3A 1UD2A 7TAAA 1WKYA 3VDBA 3GBDA 2VCCA 4GQRA 1QI2A 2FDMA 3K4DA 3SURA 2XN2A 2B31A 1W9BM 3RJYA 1GCYA 3TV8A 1TVPA 2G4FA 3PZ9A 2VX6A 1W3JA 1XYFA 5F7UA 1BPLB 1J11A 2QLYA 4AD1A 3VMNA 4NZFA 2ZUTA 1KXTA 4RE3A 2WCAA 3QHMA 3VGDA 3OG2A 3FN9A 2ZXBA 3DX1A 4MNKA 4BQ5A 1UKSA 4HZ7A 2CHOA 4UNIA 3I3BA 3VPLA 4WSJA 4JL1A 5FL1A 6CGTA 4GXPA 1ZBWA 1UWUA 1GOQA 1VEOA 2W4XA 1DTUA 2DDXA 5A8NA 1PAMA 1UHVA 1PJ9A 1D3CA 4JKKA 5FKYA 4JZ5A 2WHJA 2EPNA 1W2PA 3HU7A 4J3UA 2YLAA 1CLXA 3D5HA 3IAQA 5DF0A 3FHAA 2CKSA 1W1TA 2XVPA 3LX9A 4OIFA 4WLCA 4DWSC 4ZE4A 1E4IA 4CD8A 3VO0A 3KEHA 2WZIA 1LQ0A 3EMQA 5A8QA 1E0WA 4OBRA 5FCZA 4W89A 2DSWA 5JIWA 5ABFA 4YHGA 4MADA 1V3LA 1UR8A 3BUPA 1GZJA 3SCNA 3VNZA 4LYPA 1O7DC 3W29A 2VURA 1KCKA 1E1FA 2WBKA 4ZENA 4PUEA 1HKIA 1ZBCA 3A5VA 4DUVA 3WH9A 1LLOA 1XYZA 4A3HA 1T0OA 3DX3A 3UERA 4BZYA 3VX0A 4D1JA 1B3VA 2NW0A 1LL7A 1W32A 4BQ4A 1UUQA 1Q6FA 1E71M 1XSJA 5AYIA 5A6LA 5HXMA 2E0PA 4DO6A 1GVYA 1QWNA 3LXAA 3WDPP 2F18A 1TFVA 3N18A 3ARZA 1JYVA 3AIBA 2CBJA 5LA2A 2XVNA 3RM8A 4NRSA 2GDVA 4EAMA 5IXEA 3BUBA 1QI0A 2XYLA 1GJUA 3S6TA 3SCVA 5A8OA 1UQYA 3WBAA 4MPKA 2E9MA 1KR1A 3KE0A 3AHZA 1HJQA 4PUDA 5LYRA 3MANA 2D24A 2J7HA 1R46A 4AXNA 2GUYA 1UWTA 3GDBA 3GTNA 4EK7A 2WXDM 4JFVA 4H04A 3WH6A 1CXKA 3VIMA 3IANA 3OLIA 2V3EA 2VVSA 1QX1A 2CHNA 3MS8A 4CD6A 2BNJA 3O6AA 3ZSSA 3QHOA 2VRJA 1H41A 3LRLA 5GQBA 5M17A 5I24A 1FHDA 3FNDA 1FP8A 2WM0A 3MO4A 3AS2A 2FHFA 1KWKA 2J8FA 2J74A 1NWSA 1EOMA 4V27A 2E9BA 1VBRA 3W37A 1NOUA 3RCNA 1UH2A 4R5EA 1XH1A 1OCQA 2WSKA 1OGBA 3CUJA 3SCTA 3EDJA 1KB3A 2Q8XA 3SEPA 1EDTA 4CVUA 1WDRA 1G01A 1PZ2A 3WF1A 3TOPA 4W87A 2ALWA 4UQDA 4ACZB 1SYTA 5I6SA 2DT3A 4B3KA 1X6LA 3WQ5A 5D8WA 5D9MA 3WUBA 1OT2A 1IZKA 1B1YA 3HJEA 3K8LA 3WF3A 4D72A 3ZOAA 4QDMA 1E3XA 1GOIA 2G3JA 3AMKA 1HJSA 2X2YA 1KCLA 1MFVA 1C7SA 4AD5A 1XD0A 4KWUA 3NYDA 4TVCA 1DWAM 2FH6A 4QAWA 5CG0A 2GFTA 2UY3A 2DSKA 4CN4A 5A6BD 2WMHA 1BF2A 3AXHA 4AD0A 5DMYA 1R7OA 4PMQA 2ZOXA 1DWHM 5CPSA 3ARTA 1B0IA 3WUEA 1J0HA 1JIBA 4GPNA 3AFBA 2OW6A 4M80A 1QI4A 3WFZA 2IXUA 2DPEA 3BAYA 3L4WA 4L4PA 4EKJA 3BAXA 2YBTA 1DWIM 2XFYA 5I78A 3K8KA 2CKRA 2JIWA 4IUGA 1H5VA 1WDPA 3HZ3A 5JBDA 1RH9A 3WSUA 2YL9A 3VIOA 3FW6A 5I3DA 4GKLA 3U5UA 3VNYA 5E6ZA 1LF1A 2JEQA 4W7WA 4AISA 3H55A 4UOQA 3ARVA 3CZNA 1CGTA 1XRVA 3RILA 3NSNA 3F5LA 3CZLA 4OZOA 1AMYA 3VGFA 5CJ5A 4U31A 4HMCA 5E0CA 3AISA 3AXXA 1E4NA 4PCTA 1X6NA 4P8WA 4PTXA 1J9YA 2JIEA 1JD9A 3WIJA 3CTTA 4AD2A 1R87A 2O9RA 2A3HA 2PC8A 2A3EA 3M6DA 1UH3A 2AOSA 1NARA 1UWQA 1Q6CA 1HJVA 3DHPA 2F7PA 1CLVA 4BCEA 3VD4A 3A21A 4JIEA 4W7VA 4V28A 1B3ZA 2J7GA 3GXPA 1EDQA 2ZUNA 2FHCA 1CPUA 3WD3A 3CHDA 2D1ZA 1E73M 3RDKA 2J7DA 4E2OA 4Z2GA 2DIJA 3D52A 1DEDA 1R7AA 1KGXA 3EJSA 3A47A 2YLLA 1C3FA 1C8XA 1RD6A 4DWSA 3LMYA 4P7NA 1CNVA 1ZBKA 1XGZA 1M7XA 1EO7A 2WNWA 4YN5A 3MV11 1H09A 3AI0A 1UOKA 1J0IA 2HISA 4UOZA 1ZB5A 3WL0A 5E9AA 5D9OA 2VR4A 5C8BB 3VKKA 3U5YA 2DT2A 1HKMA 2XM1A 1WZKA 2D20A 4P7LA 4FNQA 3VSVA 1ZS2A 2WWDA 4HA1A 2QMJA 3W28A 3OLEA 2JALA 4GI6A 5FIPA 2UY5A 2YL8A 2NSXA 4MNMA 1ITXA 4HMDA 2YA0A 1AQ0A 1WB0A 1BAGA 3K8MA 2W92A 2ZUWA 3D50A 2WLZA 1UR9A 3LXCA 3I3DA 5HOSA 3APGA 3EMZA 1AQHA 4FNUA 1VENA 4MB3A 1I1WA 4OGZA 3VSUA 2WBGA 3EDKA 1E15A 1VFMA 1UQZA 3BSHA 1TQVA 3WDJA 3BAWA 4MTVA 1KTBA 4D6JA 5JBFA 5M03A 4CVWA 8CGTA 3A4AA 4N0RA 4PTMA 1V3KA 2WK2A 4FF5A 4AEFA 1OWQA 1ITCA 1B9ZA 2ZX8A 4JFUA 2WKGA 5D9NA 4AIOA 2WHMA 4AD4A 3ZJ6A 4R27A 1A47A 1CXEA 1B3YA 1JZ2A 4IPLA 1E5NA 5BXPA 4FLRA 3ARUA 4WIWA 3AYRA 4F9DA 3CBWA 3ALFA 3VDCA 1QNRA 1E43A 2VX7A 1L0PA 3BC9A 5TD4A 1WE5A 4LX4A 5A2BA 1RPKA 1WDSA 3WL1A 2FH8A 2FYVA 3UETA 1XCWA 3ZR5A 3B9AA 3WNMA 3WELA 3BXWA 2E8YA 3ZT6A 3EJTA 1Z32X 2VZOA 1UYQA 1N82A 2WPGA 4KMQA 4FK9A 4M1RA 2WMFA 1CDGA 4ZXLA 3ARWA 2X8RA 4S3JA 3SCUA 4WKFA 4ATLA 1QNQA 2OWCA 4NXKA 1ESWA 3VGGA 1FFQA 7A3HA 1BLIA 4NI3A 1KQZA 3WNNA 4MJ4A 4M29A 1C7TA 4AZ7A 1V02A 1KGWA 1BGGA 4L4OA 3WN6A 4MB1A 3EDDA 3PZOA 3RMEA 3BAIA 4AZIA 2BY2A 1PX3A 8A3HA 3NDYA 4GINA 2WLYA 4ZE5A 3AS1A 5LA0A 1W1PA 1JAKA 2EPLX 3CH9A 4LGXA 3T0BA 2YJQA 1EIBA 2BVTA 5D9PA 4IPNB 3OLGA 1CXFA 1R75A 2BFGA 4D6IA 4J3XA 3W24A 4P7QA 3T2PA 1U2YA 3G6LA 1JGIA 3VINA 1Q6EA 2J7FA 1V3IA 3CO4A 1OT1A 2W66A 1PX4A 3VIFA 1JD7A 3AS0A 4C7FA 4DWSB 2WW5A 3HN3A 2VCAA 1G9HA 1J0JA 4WSKA 4J3SA 2E3ZA 1TCMA 1PS3A 1V0LA 3IJ9A 4RE4A 3VD7A 2XGIA 3MMWA 1MW2A 3S2CA 4W5ZA 1SR0A 3RPMA 2BXZA 1QNPA 3GXDA 3FXYA 2J7EA 1Y7VA 2F1AA 3OZPA 1JDAA 3BSGA 2YA1A 2QHAA 3VMOA 4UFIA 2ZWYA 1CIUA 2GK1A 4NXSA 1V0MA 4LYRA 1CXHA 4HA4A 1U33A 1J0KA 3M7SA 2NT1A 2WANA 2JE8A 3AZSA 2HVMA 1JXJA 1FOBA 1OIMA 1JFXA 1HVQA 2Y8VA 3VDAA 3IJ7A 3OGRA 2EABA 2GJXA 4H8HA 3WH8A 5CLWA 4HA3A 7CGTA 1TQWA 1R85A 1VEMA 1E72M 3EDEA 2VRQA 4DM2A 3DDFA 5FL0A 5A69A 1W91A 5AC4A 5CLTA 3WEMA 3ZSTA 1PPIA 3PHAA 1OM0A 1GJWA 1V6XA 1HWWA 2YIHA 1V6UA 3S5YA 2JF7A 4AZHA 4PRWA 1UD8A 4CU6A 2O9OA 4PMUA 4AW7A 4QLLA 3CUFA 1ODUA 3L4TA 1LG1A 2ZX7A 4D6CA 4FNSA 1W3HA 2V3DA 2IXVA 2WMIA 1KXVA 4MB4A 4A3YA 3VGHA 1UKQA 4CU8A 2PBGA 2VQTA 5JUVA 2NT0A 3WNLA 2OYLA 2WVVB 3OLDA 2WVVA 4BQ3A 3WY2A 2C8NA 5CXPA 1NQ6A 4AZBA 4D6DA 2QPSA 2OSXA 1BG4A 3ARYA 4BF7A 2YKKA 4U3AA 5HPOA 3NUKA 4UFHA 1GOOA 4H41A 1E0VA 3J7HA 3AXIA 1WNOA 1C90A 1WZAA 1OSEA 3WDQA 4IISA 2YDSA 1H4PA 1FH9A 4U5IA 4JHOA 1J0ZA 1QVBA 2W61A 1NWUA 5A6MA 1J18A 4J28A 3AICA 3QGVA 3KL3A 4UOJA 4PMDA 4AEEA 4D1IA 4M24A 1GW1A 1CYGA 1XSIA 1NP0A 1PBGA 1IT0A 2Z1KA 2CXGA 1C93A 1MQRA 2XVLA 2O9PA 3WF0A 1QI3A 1PIGA 2DEPA 1KWGA 3AHYA 1R86A 1BSIA 3CPUA 1HKKA 4LQ1A 3WMCA 2CBVA 4UFMA 1G1YA 3M07A 2WAGA 3A22A 3OZOA 2WC3A 3L4ZA 3N9KA 1G94A 3JUGA 2BXYA 1GHRA 1V6WA 3UG3A 3CLWA 3BVUA 5CZKA 3WH7A 3K1DA 1TVNA 3B9EA 3W53A 3GXIA 2GJPA 1JF6A 4K68A 5M5DA 1PZ3A 3BLBA 1ISWA 2EPMX 3PBGA 5DEZA 3MV01 4PN2A 2ZXDA 2E9LA 3VIGA 1L8NA 2V5CA 4PTWA 3VU2A 4AIEA 3OGSA 5ABFB 1JDDA 1ISZA 4PCSA 4NSBA 2XGBA 5A94A 3D51A 1YHTA 4GZEA 2WCSA 1HF6A 5ABGA 4EE9A 1C8QA 1DHKA 3AIUA 4CD4A 3GYCA 1QW9A 4ZEPA 1UR2A 1HJWA 3BVXA 3N04A 2QPUA 2RGLA 1PX8A 4QLJA 3A3HA 5ECUA 3CZEA 4FNRA 1C91A 1D2KA 1JNDA 2PWFA 1J01A 4B9YA 2UY4A 3DYMA 3N17A 4J27A 5IDIA 6A3HA 1CECA 3TTQA 1FH7A 4UTFA 1UKPA 2JFEX 3GNRA 3K46A 4AC1X 4IM4A 3VIHA 3EJRA 2F7OA 1GVIA 3AJ7A 3WY1A 2QV4A 1ZJBA 3WUFA 1BG9A 3FAXA 4U2ZA 1O7AA 2XIBA 2VZVA 2EPOA 4W5UA 2F1BA 2ESCA 3VD5A 3UG5A 1BVNP 1WPCA 3PN8A 2G3MA 3AIWA 1EHAA 2YFOA 1NWRA 1EA9C 1M04A 5BRQA 1OGSA 3VIJA 1VBUA 2PWDA 4UFKA 3DYOA 3HG4A 4Z2IA 3S5ZA 4AZ5A 2VNCA 3ZIZA 2Y24A 3UR8A 5I79A 3GZAA 4LYQA 2IUZA 2J75A 3NSXA 4D6HA 3A23A 2FE0A 3ZT5A 4DM1A 4AZCB 2XIIA 2ZXAA 1B30A 2VI0A 3VMPA 5GNZA 1J10A 1UH4A 2GSJA 4W84A 2DT1A 3UEQA 5BXSA 4CGTA 1FHLA 3H53A 2WMGA 1QI5A 2WC4A 2D3LA 1C92A 4TXEA 4ACZA 1DP0A 4MB5A 3T0AA 3ZT7A 4JFSA 3A4XA 4J3VA 4YHEA 4QFUA 3WENA 3DX4A 2BS9A 3N1AA 1UZ4A 1NOFA 1WAWA 4D71A 4JKLA 1XC6A 5C70A 4W7UA 1OBAA 2G8ZA 4KRUA 4PMZA 3PZTA 1W9PA 3RIKA 1H1NA 1V08A 3M46A 1CXLA 5CSUA 1OGGA 2WZEA 2XWDA 1GOMA 4M81A 4UR9A 3LRKA 4AMCA 3OB8A 1B90A 4AZCA 4GI8A 4RL3A 1TE1A 3CGTA 3K4AA 2D0GA 4ML4A 4B9ZA 2PWGA 1XH2A 3DHUA 4UQAA 3T0DA 2CESA 1UD4A 5A8PA 1KFWA 3SCWA 2QMKA 4GQQA 5C71A 3O9NA 1IV8A 3NCOA 3GNOA 3W0KA 5AYBA 1DWFM 3BGAA 5M3WA 3D3AA 2C7FA 1KGUA 1UA3A 4PMVA 3VSTA 1GOWA 1QNSA 2QF8A 2IGTA 3KWXA 3F4VA 4HTYA 1HJUA 4CU7A 1A3HA 4DWSD 4TTUA 4CN1A 5HPCA 3BUQA 3BVTA 5ABHA 4X0NA 3CHEA 1FA2A 2CERA 4QLKA 1MFUA 1UR1A 1JXKA 4TUFA 4B15A 3VIPA 3CZKA 2XG9A 5HNNA 1MVYA 2V38A 2PWHA 2V3GA 2XUCA 4P8UA 4CD5A 2V5DA 5AY7A 5A2AA 5D4YA 4CCCA 2VVNA 1OB0A 1MXGA 4HZ6A 3WQ8A 4HZ8A 1W3KA 2CYGA 3GXTA 3GH4A 4FMVA 1E4LA 5BXTA 2AMGA 1DWJM 1R8LA 4AZ6A 4H8VA 3BAKA 3WMSA 2WMKA 1BTCA 1US2A 2XFFA 3BUDA 2ZX9A 1UD6A 3L4YA 1NP2A 2PI6A 3PZVA 2YBUA 1UG6A 3BUIA 4UFLA 2CIPA 2WSPA 5BROA 2J79A 3WQWA 4MDOA 4HOWA 5BRPA 2CNCA 2WHKA 1H49A 4QCEA 2OSWA 1H0IA 3MMDA 2F7RA 1W1YA 1X1NA 1ZL1A 2ZUVA 3EDFA 5JIPA 5DT5A 3TP4A 1F4AA 4JFWA 1B3WA 2MANA 3GXFA 4KGJA 1MQQA 3AZRA 1UWSA 2EPKX 2X05A 2CBUA 3IK2A 1JI1A 1H11A 1UR4A 3SUUA 4W8AA 4P7RA 3MSDA 4M82A 4GZIA 1QW8A 2WC7A 1KBKA 1CGVA 2X2JA 3WY3A 1IZJA 3MMUA 1WCGA 3EJQA 3RM4A 4PMOA 4X9YA 1V3HA 5DO8A 1KQYA 1BYBA 1W1VA 1HL9A 4E4PA 3D4YA 1H2JA 4CUCA 2E40A 1UR0A 3AHTA 4TOQA 1E0XA 1E1EA 3ARRA 3W81A 1QWUA 1JNEA 4JFTA 1JZ5A 1HP4A 2XSBA 2WVSA 2VR5A 3LPGA 1EQCA 2WKLA 4ATDA 3PZMA 5KEZA 3GNPA 1HIZA 3F5JA 4AWEA 3A4WA 4Z2LA 3W27A 3MUY1 3DDGA 4UZUA 4WK9A 5BYWA 2X2HA 3GXNA 3SCOA 3MUIA 2J25A 4U33A 5CSYA 1FH8A 1CENA 3SCRA 3WY4A 1VAHA 3VM5A 1SFSA 1K9DA 1BFNA 1TMQA 1AVAA 2ZX5A 2F61A 3WKZA 2VX4A 3ARXA 2DIEA 1JDCA 2FGLA 4NF7A 1OINA 1I75A 3LXBA 3PTMA 2EACA 5E70A 5BXRA 3CHCA 5D8ZA 1U30A 2VOTA 1BYCA 2DH2A 3MUZ1 4XX6A 2J7CA 3WDHA 1XH0A 3NJ3A 3SIMA 3AYSA 4TVDA 1KBBA 5FD0A 5CPTA 1K6AA 1MQPA 3QR3A 2D2OA 3CZGA 3AMLA 3WDIA 1ISXA 4PSPA 2PB1A 2X1IA 3EMCA 3PTKA 5A3HA 5GPRA 1OIFA 1EH9A 1Q4NX 2VZTA 4WKAA 4X0VA 3SCQA 1HNYA 3KL0A 1VF8A 1MWOA 4OKDA 3PZNA 5BCAA 3BVVA 1BHGA 3GM8A 1KR0A 1GQIA 2VUYA 3B9DA 2BVYA 1GOKA 2UY2A 1ODZA 4PMRA 3VTRA 3MSGA 4OUEA 3SUVA 1JZ3A 1SZNA 3IGUA 3U57A 2EADA 4M56A 3UG4A 3PZUA 4HU0A 4DUXA 4AZGA 4U2YA 2BHUA 4ATWA 3FY1A 2FHBA 2DT0A 2XPKA 2ZXQA 4DO5A 2PWEA 3I3EA 1HKJA 4E8DA 2Y8KA 3WNKA 5I2UA 1V0KA 1TZ7A 2ZE0A 1W9XA 2BHYA 1LL4A 3W6MA 5DFAA 3GH7A 1ZBVA 1E3ZA 4UCFA 1V02E 4PMYA 3ZJKA 4H2CA 5A2CA 1W9VA 2Y2WA 1MW1A 3AMCA 1F4HA 4W8BA 2WWCA 2EXOA 1EXPA 2W91A 1E6ZA 2A3AA 1Q6DA 1E56A 2XM2A 1JI2A 4WKHA 2XJ7A 2AAAA 2VJXA 1M03A 1EQPA 1XV8A 4W93A 2BY3A 4ZXOA 3SUSA 4TX6A 4XB3A 3G6MA 4MAZA 3ZMRA 1JAEA 3W38A 3TONA 1MW3A 3E1F1 4C7GA 2YDQA 3BCDA 3KZSA 3CZ8A 3TA9A 1RP9A 1CZ1A 4FLQA 2WMIB 1HN1A 3BLKA 3AIVA 3CIVA 4BQ2A 2DSVA 4M8UA 3KLKA 3U7VA 4F79A 4MAVA 1BQCA 3U7BA 3AIRA 4AYGA 2X0HA 5HBFA 3CZJA 1R47A 4GI9A 5A8MA 3CHFA 4GO9A 4MNLA 1UD5A 1B3XA 2CEQA 4KGLA 3W6LA 5A1AA 2EEXA 1HJXA 1UKTA 5CQ1A 4TTGA 1NH6A 1E6RA 2VC9A 1MW0A 2EQDA 3UCQA 5A6BA 1QBBA 3WBEA 2TAAA 3FHQA 1VJSA 4NZCA 1R34A 2ZX6A 3VM7A 2OWWA 6TAAA 4Q7NA 1NM9A 2DSZA 4PSRA 4J7RA 1K9FA 2WMJA 3N12A 3WNOA 1P6WA 1JZ4A 1LJYA 2PBOA 3QOKA 2FGZA 3BMWA 3POHA 3POCA 4AIUA 4LXFA 4HP5A 1LL6A 1NOWA 4XZWA 3GBEA 1BYAA 2YOCA 3UR7A 1XCXA 5EBAA 2VO5A 2ZICA 1LWJA 3NDZA 1BVZA 1FP9A 1KTCA 3N15A 1K9TA 3II1A 3WD4A 4JAWA 2GVYA 3EJUA 4QP0A 1UZ1A 5I0DA 1XHGA 2J4GA 4PMNA 2J77A 1E70M 4W8LA 3ZO9A 4MDPA 1HXJA 3HG5A 1E6SM 4Z2HA 2A3BA 1TA3B 1VJZA 5EFDA 1HL8A 2J8GA 1AQMA 2PF0A 3AHVA 1ZU8A 1QHPA 2DGAA 3MU7A 3EJPA 2GK1B 4PEEA 4QCFA 1XSKA 5CPQA 3BAJA 1V0NA 2XSAA 3CUGA 2XVGA 5CGTA 2D0HA 1GONA 2DQXA 3QHNA 3AS3A 2VRKA 2ZUSA 4OBSA 2WVUA 1XD1A 1M53A 1BGAA 1GQKA 4F66A 5E6YA 3AQUA 2VTFA 2EJ1A 2VMFA 4P8XA 1TR1A 3CZSA 3KLLA 1QHZA 3WQ4A 2E8ZA 2WVTA 3B8SA 3CUIA 2BY1A 2G3IA 4MJ2A 1D7FA 3WFLA 2ZUMA 3OGVA 3VD9A 3DX2A 4AMWA 4U3CA 4Y7EA 4P8VA 4HU8A 1CGXA 2BV9A 1YQ2A 1MXDA 1HTYA 3WUGA 4EANA 3OIHA 3KL5A 1QPKA 3CMGA 2D3NA 1JYXA 4UQ9A 4H8UA 1UD3A 2V3FA 4CD7A 4HOZA 1GQLA 1HP5A 3L4VA 1EGZA 3WF2A 3WMBA 1G0CA 3NSMA 4LPCA 4KRTA 2CITA 2OW7A 3ARSA 3RO8A 1E55A 4HPGA 2O92A 1UWRA 2ZIDA 2W5FA 4KH2A 3T08A 3SUTA 1B31A 4FNTA 2OWXA 3ZM8A 5FOOA 1SMAA 3AHXA 2VX5A 3GXMA 3TTOA 2XFRA 3L4XA 4HPHA 1FFRA 2WYSA 1CTNA 2XVKA 1EHNA 4PMXA 4ACYA 2W67A 4AMXA 3L4UA 3SCSA 2F7QA 1TA3A 2EAEA 4HMEA 1Q6GA 1E6PA 1V3JA 1ISVA 2Z1SA 9CGTA 1E6XM 1JYWA 3PZIA 1EDGA 1VRXA 1TG7A 5A95A 4PBGA 1EOKA 4CKQA 5I23A 1E4MM 4FLOA 1CGYA 4S3KA 5E0FA 4JCMA 3IAPA 1JF5A 2CPUA 1K9EA 5IFTA 4Z2KA 2C0HA 3IJ8A 4E8CA 1CEOA 1GORA 2XHYA 3BVWA 2GDUA 2BVDA 5ABEA 1SMDA 5IHSA 3VIIA 1O6IA 3ZJ7A 1DWGM 2D0FA 5IHRA 3DECA 5E09A 4URIA 4WJXA 2YFNA 1JZ7A 4PTVA 3BCFA 3AIEA 1LG2A 4CCDA 4MNJA 2Y5EA 1B2YA 2WZHA 4JHZA 3WD0A 1TQUA 1EO5A 1UKOA 2RGMA 1V03A 1QBAA 5HDRA 2G41A 4GO8A 1W9UA 3BMVA 2XN1A 2EO7A 3RJXA 3H54A 2ZWZA 4HOXA 2F2HA 3VGBA 3AIQA 1TQSA 4U5KA 2OYKA 1CWYA 2E4TA 3WH5A 2OSYA 4XUYA 1E40A 1W3LA 1WZLA 4J3TA 3LPFA 5I5RA 1V3MA 2O9TA 3VOCA 2YL5A 4UQCA 1HX0A 4N42A 3WF4A 2GJXB 2J78A 5CGMA 5AC5A 1HT6A 1GPFA 2DSUA 4OOUA 2J7BA 1PEZA 1VFUA 5BWFA 5DT7A 3ECQA 4W88A 1JYNA 2CCRA 3VUPA 4JCLA 3ZQ9A 3THDA 2J62A 4H7VA 3D4ZA 2WHLA 4FLSA 1GNXA 3PZGA 4BS0A 1HXKA 1JZ8A 5A6KA 3HG2A 4D6GA 3LPPA 4W85A 3A24A 3OA5A 4XV0A 1E6NA 2VCBA 3VX1A 2W62A 1UA7A 3AROA 3VVGA 2VL4A 2CETA 3WQVA 1R33A 2F8QA 4RE2A 1UWIA 1HVXA 3CMJA 3VIKA 3FAWA 4W86A 2JF6A 2X0YA 1PIFA 1JG9A 1E5JA 2D22A 5EB8A 4CN6A 5GNYA 4UQEA 4UZSA 5GNXA 2VT0A 2XWEA 5A6JA 3EYPA 1US3A 4OOZA 4D6FA 3W25A 3NIYA 3CC1A 1G5AA 1JL8A 4TX8A 4Q22A 3AZTA 4GZJA 2YDRA 3WD2A 1QOXA 3W82A 3AMGA 3WQ6A 3UESA 1KXQA 1TQTA 2X2IA 1I1XA 4CCEA 3PZQA 3EBVA 3DX0A 1QHOA 3SUWA 3WDRA 3BH4A 3TTYA 3HG3A 2D23A 5JBEA 2OYMA 5KZ6A 3W4RA 1ISYA 3O2LA 2XN0A 3N13A 3TTSA 2CBIA 3DC0A 4A4AA 5EMYA 3ZR6A 1CGUA 2VZSA 4PYSA 3AOFA 1CBGA 4P7OA 1V6YA 2YA2A 1UASA 2BHZA 3N11A 3GH5A 2WB5A 5EFFA 2VZUA 3ARQA 4V2XA 2W63A 1ZJAA 4J3WA 1J12A 5A6AA 5LA1A 4F9JA 3L2MA 4TVUA 2GJRA 4GIAA 1VEPA 3T2OA 3VILA 2DH3A 3W26A 1TUXA 4FNPA 1GQJA 4Z2JA 1WZMA 2JEPA 4B16A 1WP6A 3ARPA 3CV5A 4NX0A 3MKKA 3VDHA 3PTQA 1VIWA 1KXHA 4DO4A 1E9LA 3ALGA 2EBNA 2X09A 5A6SA 3T09A 2VQUA 4NRRA 3MUAA 5I77A 1JZ6A 4DUWA 2Y4SA 2XTKA 2WCGA 1CGWA 1GUVA 5E1QA 3WEZA 5IFPA 1CXIA 2D73A 4UFJA 3OBAA 3L2LA 1C8YA 3SCPA 1V6VA 2A3CA 3THCA 3MI6A 2G3NA 1BYDA 3CUHA 3DYPA 2BY0A 2UWFA 1E6QM 1M01A 3F5KA 3BLPX 3T2QA 1VFFA 4WF7A 3RM9A 4C7DA 1ECEA 2J47A 1S46A 2ZUUA 1OD0A 1JFHA 1GHSA 1W9DM 1WO2A 3QOMA 1WDQA 3VGEA 1QNOA 3AMDA 4D6EA 4NZJA 4JL2A 3HMCA 3WNPA 4ZFMA 1MYRA 3ZJ8A 4F8XA 1NWTA 1VB9A 4JKMA 1LWHA 3WD1A 3LRMA 1J0YA 3WEOA 1VFOA 1H0GA 2OLHA 3A6OA 4BA0A 1H3GA 4OJYA 4B3LA 4AY1A 1W2VA 4XZBA 4AD3A 2YL6A 1RP8A
chains in the Genus database with same CATH superfamily
1KIUA 4HSQA 4AYSA 3UABA 1KG0A 2AQRA 2KLTA 4GKSA 5ILTH 3FSTA 4BFKA 1XFCA 1T2QL 4UIKL 2DYPB 3QF0A 3W2DL 7TAAA 2FQFA 1WIOA 3RUBL 5D2LA 4GQRA 4IBWA 2ZYFA 4YS4A 1W6TA 3CFTA 2PRMA 3EWUA 4UTTA 2XN2A 4A04A 2R9HD 2XPYA 3RPKA 1RQ5A 5EF2A 2B31A 4NEHB 4X5RA 5KANG 5HWJA 2E86A 1WBJA 4FXGB 4OCYH 1THFD 4M4PA 1OFQA 1KYDA 2G4FA 5B1KA 2W81C 3PZ9A 4XKYA 1ANUA 3UR5A 5JPMB 2VX6A 1W3JA 4MWFB 4NUGL 5F7UA 1BPLB 5JXAL 4CEUC 4U1IA 4NENA 4AD1A 1CICD 3HUJE 3UZVB 3VMNA 2PDJA 2XVBA 3MA7A 4JBRA 3AQXA 4EVZA 1OF8A 1OY0A 2FDBP 3G0SA 3UPAA 2A6JA 4RE3A 3ATZA 1C16B 4Z18A 3CX5K 1AR1B 2ADAA 2DZSA 3DO7A 1RURL 3UC2A 4ISVA 2CO4A 4A1RA 4G8EB 2GSEA 3CFKB 1IXQA 3VFGL 4M1BA 3TA3D 1CFQB 1PY4A 4Y4HB 4PJ9C 2Z0UA 2YARA 1FVPA 3QA3B 4HX1B 4PJXE 1MQKH 4WSJA 1NELA 1P7QA 1S7TB 2JK2A 4JL1A 1H5BB 3RZWA 1OW0C 3MJYA 1PLGL 1SHXA 2X16A 4M43H 5AW1B 3Q2VA 4EE2A 1VEOA 3JWNG 4AQZA 2O7SA 3PJLA 4RWYH 3ISWA 1I7UA 4R2GC 5C08B 3ZIYA 5JW4R 5LNGA 1OFPA 1QHQA 3N41F 5IBUB 2W4XA 5GS1A 3PABA 2W0KA 1V7ML 1O5XA 1F74A 4A55A 5T5FA 2DDXA 3OJGA 1A7NL 4ORIA 1UHVA 1XLFA 1RY0A 3V9FA 3WFCH 4A8LA 5HVHC 4F40A 3IFNL 2P50A 1PYFA 2I24N 5FKYA 1IAOB 3KJ4C 4G71B 5ESAB 2WHJA 3R79A 4JZ5A 1UWEH 3FA3A 5F7KC 5I8OH 3HU7A 3N06B 4KAQH 3IDYC 2FBRA 3GHPA 3O3BA 3K6SB 2A1YA 5MP6H 5J89A 1QZNA 2FECI 2VLRB 3VXRB 3D25A 2EVGA 2CKSA 1GAFH 2CHDA 2XVPA 3NOIA 4JB9L 3RY5A 1IKNC 4DGYH 1OK8A 1JBJA 1AZCA 4H6QA 3EGDB 1WBYA 2XXCB 2H2SD 2CG9X 5CCKH 4OTXL 4APXB 3VWKB 4MWAB 1JUBA 5GGRB 5I6PA 4XCCL 5TQ2H 5EOQH 5FCZA 1DQJB 4ZUTB 4LVOC 4D3CH 4WDUA 3Q94A 1KJMA 2Z7UA 2R1XA 2UUDH 4ORMA 5IMOA 3BUPA 1XB8A 5AL0A 5T1LD 4O51B 3BSMA 1PCWA 4H01A 2VD9A 3UP6A 1BFVL 4S2SB 4BR1A 5IOPA 3WLQA 3RNQA 4I85A 1YBQB 1H5BA 4PUEA 3HZKA 1T89C 1HYSC 2Y1ZA 5FACA 1M9SA 3QJTB 4Y4KB 4HWEL 5CINL 3NABL 2FQDA 3BP6B 4QRRB 5FYJE 1TQXA 1T04A 2B7PA 3TJ4A 4BZYA 4D1JA 3EPNA 3B56A 2VQ1A 3WJMA 3ZXWA 2UV3A 4NM8H 5KTLA 3KAAA 3CB3A 3MLUH 5DQDH 2CLIA 4PWFA 3MHUA 1KIQB 3H2QA 1WBXB 4I3GA 2EXWD 5TGBA 1J7VR 1PZ1A 2QQKH 2NY2B 4RZ4A 4GIPD 3O0RL 1H9DA 2FK9A 2AL1A 2E0PA 2GUOB 4ELKA 5C6TL 1TWIA 2PUQT 1QRKA 4RETB 5EWIH 2DQWA 2DZEA 5HDBE 4L6DA 4S2BA 2WQVA 3T1FB 1UWEL 3WDPP 5KZEA 2RHEA 3ZTJG 3EHBB 3L3GA 1J9TA 3VA6A 4Q4QA 2YCLA 3VD1A 4CNIA 1D5ZB 4Q9QL 4WWOA 1CC3A 1DQJA 1XF3A 2EC8A 3R11A 4KFPA 4NNXB 1XGQA 3H8AA 5LA2A 5C2GA 1NGXA 4K3DL 3H4GA 5EZJB 3D25B 3VK5A 3UBFA 4EAMA 1ADWA 5IXEA 4R85A 4KTYA 4NN6C 2EDRA 1GJUA 4EUPB 3P0YH 3WBAA 2YQBA 5C0AE 4MWAC 4WW2F 1HJQA 2V5SA 3N2JA 5DVKA 3S5OA 3XISA 4APQA 3OU8A 3DV4B 2D24A 3M5VA 4WAFA 1R46A 3IFPB 5C0AB 3TYUA 3IJIA 3TW7A 4JFHD 2FJFA 1G7JA 2OL3A 3GT6A 3QYNA 1FVCB 1IC1A 1SUHA 2JKTM 4IXXA 5BOEA 1DVZA 2L04A 4E41D 3EOEA 3KM8A 3WLRA 4DW2H 3WXVH 3WEXB 3IANA 3OLIA 2V3EA 3C09C 4RGNC 3CASA 4M1CD 4AEHL 4BY3A 4ONGL 2R23A 2NXZC 1FXQA 2YK1H 1A6AB 2CZNA 1D8WA 2F1EA 3PWVA 4YHIB 4CD6A 5BW6A 1KTRL 1WWWX 4U7MA 3KWUA 3RA7H 1I85C 1NIUA 3H3BC 4YHYC 3FNDA 1FHDA 3UXIA 2F54D 3FFDA 4F58H 2WM0A 1CDIA 2NTFA 3M8OH 4MNHB 1FP8A 1NFIB 4WGVB 5DMIH 2EUWA 2ARJQ 2CO6B 2VSDA 5GJTL 4RW3A 4A7GF 2J8FA 1VLIA 4HXBH 3V0AC 4L8DB 5EU4B 4GA8A 4U10A 4NN7C 4V27A 2P28B 1XT5A 2E9BA 1SXBA 2Q3OA 2UZ9A 2W79A 3R8GA 1MJ7L 3VWKD 2A4ZA 4MXWH 3ZE1B 3ZXAC 3FA4A 3I7QA 1WG3A 4MX7B 5FA3B 3PC0A 3V55A 3W2MA 4KT2A 3OVPA 2WXJA 3ZIMA 1FH5L 2ZNXA 3WD5L 1GJPA 4RDVA 2BH0A 1NM4A 2PW2A 4OLYH 1D5BA 3SEPA 1F4YH 1A02N 3IMUA 4CVUA 4ZYKA 1G7HB 4IMKC 1OG0A 3TSMA 4OJDH 4G80A 3QWRD 5LWYL 1MCPH 3LIUA 3UA3A 4BWLA 4JTLA 1BVKB 4W87A 3HI5L 3KYOA 1ONRA 4OLVH 1NMCC 3ID7A 4ACZB 1OAUH 3MNZA 1SYTA 4B3KA 1BJ8A 4ZG1A 1BWVA 3ARGB 5IUCA 1S7VB 5E2JA 4DBEA 3GD6A 4Y2DC 4G1MA 1OAZL 3QVAA 4K39A 4KMTH 1LLAA 2K7PA 1HCZA 3QUYC 1T4KB 4OTKA 5KW9H 2NV9A 3UZWA 1IZKA 2OJZL 4MNQA 3WUBA 1FVCA 3SSJA 4MKMA 2XT1B 3SZ8A 2I25N 4D72A 1RBAA 5AYTA 3N2MA 4QDMA 1E3XA 3GW3A 4NT6B 4X99B 4Y9EA 1NGQL 2GPTA 1MFVA 1PYWA 2YEZB 3WBXA 1JGEB 1JRHI 4Z7NF 3NYDA 2ZOLA 5F7LB 4GNVA 2V2HA 1AR1D 1T1XA 4L4TE 1R5WB 4WO4B 4ZTEA 2Q8AL 1WK0A 1A14H 4TVCA 4P5MA 4HIIB 4M7LH 3CSYB 4WCYL 1Y0EA 1XBXA 1BG1A 1ZAHA 3LQZA 3WJYA 2HPTA 4WKAA 3USBA 3QXDB 5K4XA 3FNKA 4L1TA 2EIZA 2IBZY 4KPHH 4CN4A 2W0UA 4J1OA 1CK0L 3AXHA 2D7TH 4X4YA 4AD0A 3RO6A 4LEFA 4Q2ZA 5E8OA 2J57A 1UZDA 1DWHM 2W38A 4X9BA 1TTBA 3D5OF 4DETA 1WKEA 1ET7A 1JIBA 4TR9A 1KLUB 4M80A 1MKFA 1W16A 3RQ3A 1I9JL 3IUHA 2OV0A 3LKQB 3WS6C 2DPEA 5C0QA 1UBPC 1X7IA 2XZAH 5SWSD 3FRPB 3P14A 4EKJA 1CT8B 2KZBA 3UGXA 3B9OA 3DZ1A 1FDYA 4AMKL 2HFTA 2FTWA 5LQBL 2CLFA 3MNZB 4HETA 3VI3E 5D5ME 2J7LA 3HQ1A 2BNQE 2YC1A 4P5SA 4IUGA 3MHZA 1MCQA 1JPTL 4H26B 4YIQB 5H8DA 1BEXA 3SZKC 3T3MB 2CH8A 3IN2A 4HZLB 4OIAA 5CZXD 4MAYD 2ZG2A 1M6OB 4XO6A 2B2XH 3FTVA 2E67A 5FM8A 4CDGC 3M6YA 4RW5A 4JGDA 4F7KA 4POUB 4GUQA 1AGEB 3WYRA 1XLBA 3CUXA 5F1VA 5EIQA 3WS3A 2JEQA 3FFOA 4ZPTB 4W7WA 1WZ1L 3H55A 2I7SA 3H2WA 1EJFA 1KN4L 4N2KA 4RAVB 4UOQA 4KZEL 4KWOA 1SLWA 5TH2B 3QCVL 5D2NB 3TV3H 4UM9B 1F5ZA 2BOEX 3NSNA 1A4JB 3INOA 3RL2B 4QMEA 3QQNA 5LXVA 2EIDA 3VGFA 3EOOA 5CJ5A 5HYQA 3L8QA 4DEFA 5FFGA 2QR6A 3UMTA 4HNOA 5LGHL 3AISA 5B39B 3AXXA 3C5ZC 3SE9L 4PQXA 2H47C 1X6NA 3D33A 3W7HA 3WIIH 3F4DA 3IDYB 2ZG3A 3MLRH 5IWLC 2FJHA 1R3YA 1UWAA 4ELMA 4FP1A 5HBBA 1NLBH 2OP4L 4MA3A 1KB5L 4H1LB 1J9YA 1QFOA 2R4SH 4R8WL 3LERA 2FX9L 4CW1A 4JTRA 5CJQL 2FB4L 2QR0A 4O1CA 4YXKL 3BISA 3CTTA 1IAIM 1CK0H 3IJSB 4LAQL 5JLZB 2Z6IA 3KVJA 2X4TA 5FO7B 2ZOWA 4ZXBA 2A3HA 3EYQC 3H9SA 1FJ1B 1OAKH 3FQRB 4K73A 2PC8A 5FDWB 5BPPA 5KYXA 4Y1SA 1CLOH 2ZSVB 1X5XA 5FV1L 4YVPA 4EPSA 2GGIA 3IS1X 3ISRA 1I9EA 1JV5B 5K69A 4CADB 1NGPH 2G5BA 1EEUA 5B1JA 2KQMA 5I30H 1U91A 3MVTA 3GM0A 3QRGL 1UJPA 2PWVA 4NNPL 2NCMA 4ENED 1EF2A 4BCEA 4KY1H 1PNCA 3PABB 4I9MA 4JIEA 2ZBTA 2XBDA 2Z28A 4I0PC 3N42F 4KCWA 1U1UA 3ZE1F 2NV2A 2EH7L 4OD3L 3QP3A 2J7GA 1EDQA 3GXPA 2E5EA 2AERT 4QHLB 5MENE 2EXYC 2LU5A 3V0FA 2KYIA 4J5VA 4KI1A 1XFBA 4GISA 2VH5L 2R9RA 1EEYA 2X4OB 4JRXB 4LVHB 3L4CA 3MJ9L 5D1ZB 1LGVA 3SQBB 1DXIA 3IJEB 1S5WA 2WP3O 5ANMA 1KJVB 1X4YA 3OM3B 3SKNB 3MCNA 1OAXH 1KGXA 3P77B 2WINA 4OLXL 2YLLA 1J1XL 3AT8A 1RD6A 1C8XA 3KTSA 4FOKA 4DWSA 4E42B 3VA8A 3G5YB 3ESUF 1AOZA 3QO0B 3HUJB 1M7XA 5KBDA 4NSKB 1O1HA 3GG1A 1RZMA 2DOCA 4RISL 1OP3H 3UMNA 2IAMB 4G7YL 4UT6A 2NY3B 2WOYA 2Z6FA 4GRWH 5F9AC 4QRPB 3TEZA 1AHWA 3REWA 2O61A 1H09A 3AWNA 3QC3A 2AI0L 3PBWA 4XAFA 1EB3A 2C71A 3G6JA 4UOZA 4L9LA 2F58L 3TFCA 3PGCB 5E9AA 3UEZA 1SF5A 1DBBL 3KBHE 3A3XA 4PJ5E 1BQGA 1I7RB 3N29A 4QHPA 4Z7NB 2J9XA 2XM1A 2EDWA 4LB3A 4QT5A 2X6UA 4E5XB 3G24A 4LCIH 4YHZL 3VNIA 2WNZA 3HRPA 1IGWA 4BYHA 1XLJA 2CWRA 1EA0A 3OX8B 4K7FA 5EO1A 1VFAB 3HZYB 4HS6A 4P2YA 5T8IA 1T0NB 3NEHA 1INQB 3HHSA 2C19A 3SD5A 3VYOA 2HLEB 4A3QA 4NUJB 1OOWA 1RZ8A 3EH4B 3STLA 4A39A 3T8LA 4MXVF 1E0OB 1BKHA 1PG7X 4PUWA 2R2CA 5FA4A 2IDCA 5FIPA 2LW3A 3G3LA 2NSXA 3TT1H 5BU9A 5CEWA 3MMEB 1LRNA 2DBLL 2Z31A 4D8PA 4F33B 4IRJC 3MC0A 1QNZL 3TVMD 5SWQB 1G7QB 1WA1X 1RPUA 3Q43A 3RVWD 2M8XA 3ES6A 3HE7D 1ZD6A 2W92A 3MLWH 3MV7E 1BEYL 2C0AA 2ZUWA 3BW2A 3BWAB 2V0AA 4XP4H 2WLZA 5DZNA 1UR9A 3BDYH 4L4TD 3ZGIA 4EOWL 4LEXH 1IGFH 3LXCA 1FWAC 3I3DA 3BANA 5HOSA 1NTHA 4KEMA 3WUWA 1I82A 2ITCA 4XH2B 2CLPA 2VERA 1S7QB 5I1DA 4XWGL 3CAFA 5EPMA 1UEYA 2FEDD 1VENA 3GK8L 2Z7ZA 1T1ZB 3FFSA 2VW4A 1I1WA 3CPGA 2DQTL 3OR7A 1JGUL 1BZDA 4EQ2A 4FZIA 1VFMA 3ATYA 3BQ6A 2Z4GA 1TQVA 2LLLA 3JQOB 4LB8A 4C47A 3UD6A 1F42A 3BAWA 4WHCA 1X5AA 3RX9A 3GB6A 4K36A 2VO8A 4JMXA 4R5XA 1E8YA 5HHPB 4F2MB 3VXOB 2GGJA 3ABXA 3ULUL 3N85H 3WKQA 3U6RA 4Z3IA 5IB3B 4JD4A 5LXXA 3HAEG 3TBWA 4CVWA 4M03A 3UYPA 3VXTB 4P05A 1H8NA 1XF5A 3TBVB 3A4AA 5HQLA 4JM2A 4Q6IA 2X1TA 4KZ0A 1VPOL 4HZMA 4Q89A 1IBZA 1KPUB 3B8VA 4ANWA 2C4XA 1EAOA 3QUMH 4WY7H 3C5XA 3VYNA 1F8TL 3TN5A 3DI3B 4IQJA 4KRLB 4LHUG 3JV5A 5BS0D 2WK2A 3E6FB 4RESB 5D4IA 3CDFA 4JDBA 5T9BG 4X7SH 2VYOA 3WO8A 1AXIB 2ZX8A 4PTUB 4E5TA 3ABOA 2WKGA 3VC5A 5D9NA 2VR3A 2OZNA 3T0XA 5IV2B 5ERWA 1YHPA 1CG9B 4AH2A 9PCYA 3GIQA 4GIYA 4PLKC 3WJWA 5FEXA 3QDJA 4ZOEA 1XL9A 1J9SA 1P9MA 2MMXA 4N8VG 1NINA 4CSPA 2FZ3B 5DVNA 4G6ML 4Y9GA 1GGBH 1GVFA 3GZOA 3UH8A 3KPSB 3TBYA 2MOQA 5C07B 1E5NA 4CVXB 3EWYA 4WWKA 2NZIA 2EZ0D 3WKPA 1PS9A 5J7CC 2FJGB 4BUHA 4F8TA 4X4KA 2XTJC 4R7VA 5L6YL 3SOBH 4WIWA 4DM2A 4OI8A 4PGLA 1JZJA 3BHBA 4EMZA 2KH2B 2VX7A 3BC9A 3NTCL 3QISA 3LSBA 2BG5A 2XV3A 2CDGA 3AU6A 4Z7VF 4TTDD 4LSBA 4JO5A 2ZONA 3T81A 5L4MA 2VN7A 2FH8A 3O3DA 5LLIC 1NSJA 3NPWA 1RK0B 4HJTA 2KS0A 2Z91A 3HBQA 3V0WH 2AP2A 4Z8FL 2C1OB 3QZWB 4W4NA 1JCTA 1I3RA 3MOAH 4YDJA 3JWNE 5A6TC 5K9QI 3E0LA 2X1OA 3IXAB 3U25A 1R3QA 1VCFA 4Y90A 5HUPA 4MZ3A 4XN1A 5CFAA 1Z32X 2VZOA 2ZWSA 1AZRA 5IOPB 1I45A 4NT6A 3DFNA 1U83A 3B9KB 4MD5B 3WAJA 1N82A 1JK8A 1I9RH 1EXBA 1RHHB 4L80A 3ET9F 2DTML 2R69L 4K3JH 1YEYA 4PCPA 2D7MA 4JVWA 3KVMA 2P10A 5KMYA 4WHBA 4UTKA 1XLHA 1MVUA 2OJPA 1SZRA 2JQMA 3MRFB 4B5UA 4YHML 4NB7A 3QIWC 3LN5B 4PR4A 1JNLL 4ZXLA 3N25A 1UB5A 3ARWA 4ODXB 2X8RA 3BESR 4OF3A 3BMXA 4GUHA 4S3JA 3WJXA 4WKFA 2CCLA 3RTQA 3WEAA 4CQBA 5DJ6A 1RJYA 4UMCA 4FQJH 5TPWL 2OWCA 3LN4A 1QBLL 4JO3L 3VGGA 1ESWA 5CIPH 5CBIA 2GZXA 4P48A 1FWNA 4NNPH 3GSQB 2JELH 4M29A 3UJIH 1KBIA 2V8ZA 4YDVB 3DTUB 1U95B 1ROCA 4XOCA 3ROLB 5IG7A 5IQ9B 3KPSA 1I3VA 1PX3A 4U1GB 3N3TA 3NDYA 4JYEA 2PR4H 1F4WH 1GKEA 4AEHH 2XPZA 4KKBD 2O56A 2QCMA 4ZE5A 4TNWK 4QCIA 1JAKA 1R5VA 2HT4C 4FFZA 1W1PA 2VEIA 1EJWC 1JRHH 2FEEL 4ZMLA 1P5UC 4L1SA 1ADQL 1NTDA 3VXMA 4JKWA 1A4KA 5DD6A 1ZZMA 2BX5A 3JUZA 4R90L 1X5LA 3R4IA 4N90D 5ABTA 2YJQA 2PUZA 4YWGL 2NYYC 5TE6H 4JRXA 1VFBA 4M3HA 1HSBA 1R75A 3NFNB 3FS9A 4DJEC 1UMLA 4WFEE 3G6LA 1MAJA 3VINA 1U8KA 4W9HC 5J6GB 1Q6EA 3QPQD 4O52A 5DUMH 1CURA 3N3MA 3UBPC 5C86A 4PMJA 4L0PB 2CHXA 3TO4A 5T3ZD 1EXGA 2I5YH 3VIFA 1JD7A 3GMQA 3BIAX 2JIXB 4YEEA 4AVHA 2IWFA 3G5YA 1QFWM 2A5HA 3HN3A 1I8IA 3RVTD 5I3JA 5HYEA 5B8CA 3HOJA 2ZKYA 1TSHA 1J0JA 1ZT7A 3L5HA 5DEFA 2JJSA 3G04B 4CVZA 4F48A 1F4XL 1PS3A 3WGVB 3IJ9A 1U8JB 4APQB 4D0DA 1I3GL 1NDGB 3FO2A 3IIOA 3OJMB 4KCUA 5JLZA 4M7TA 1EUUA 4NUQA 4D9LL 4C6BA 2XFWA 3HPAA 2J8TA 2OT1A 2GB2A 3RTQB 4C56E 1SR0A 3FV9A 1W3NA 3JV4A 4HDIB 5ALBL 3GSNB 1MZYA 3SDYH 2JI1A 2FJHB 1QNPA 1BQLH 2Z2UA 3PNWB 3RPIB 5GRUL 4S1DD 1MLBA 1AACA 4I89A 1IT9L 4KK5C 2EIJB 4S3AA 3DX7B 1MHEA 4URKA 3ZW3A 3W0WD 4P04A 4G42A 2A77H 5LGJA 2H90A 2ZWYA 3BICA 3BW9B 3M0VA 2V2WB 4DYJA 4NXSA 4TV3A 2GK1A 3O0FA 2W6RA 4JRXD 5J12C 4OM1L 2H0FA 3EBIA 4GKOA 5E5RB 4Z0BL 1CN4A 1EBGA 2WANA 4UT9H 5LIKX 4RQQA 1OAQL 2P5EB 1L3NA 4RDYA 3QH3A 2EKSB 2FYMA 4DKAA 3SJVB 2IADA 4NZ8A 1JXJA 4M6NL 1FOBA 4JQVC 3CQFA 1JFXA 4QRQB 1KLFA 1USQA 5FPIA 1PTGA 3S0CA 3PJUA 5I3KA 3F64A 1YEFH 4GRWF 3N1QC 4WW2A 4J2MA 1ZRQA 1M9HA 1G1KA 2WV8A 4XBJA 4N9GB 5EU3B 2GJXA 2FWOB 2VDRB 3QCTL 4KVNL 4NKMB 3RWFA 3J27A 3U4EA 2RDWA 3NQBA 3V36A 4G1EA 5DJ0B 3WH8A 2WJZA 3IAGC 5DC2A 3NZQA 3NO5A 1XDTT 4NJGA 4RX0A 3TYZA 3OKOA 4WK0B 5JQHC 1VPOH 4WJ5B 1WGOA 2ADGB 1GYCA 2D03L 4DP4X 1SXCA 4L8BA 4NENB 1XM3A 3AYTA 3FKRA 5FL0A 4BKLA 3BKMH 2WZPD 1W91A 3A9BA 4OF6A 3ZSTA 4YZWA 4ETQA 1OQFA 2HG0A 1IAIL 1JFQH 4WV1B 5E2TL 4DXVA 2VEFA 3JTTA 1A7QH 2H45A 5HVHB 1GMIA 1Z0NA 1MPAH 3SODB 3V4PH 2YRPA 4XZHA 1V6UA 2JF7A 4CU6A 2KL6A 1QNSA 1UD8A 2H9AB 4PRWA 4HHGA 4PMUA 1CT5A 2IGFH 2IWGA 4NO3A 1QUPA 12E8L 5SX5K 4DJDA 3ATBA 1I8AA 4B53A 3AITA 2ZX7A 4FL4B 3MCMA 2Y88A 2PXYD 1KCXA 5IW1B 3MYJA 1XGDA 1ZWIB 3B8DA 1FZJA 2OXNA 2BSBA 3H85A 4MB4A 3LEPA 3OEXA 5DK3A 1PYWB 4IBUA 2HYMA 4KI5C 1X3DA 2E1WA 3H3KA 2BVQB 5K39A 4NKCA 1XBZA 2VQTA 4HJ0C 3OKKB 2NLJB 2NT0A 4K23L 4XCYA 1LO0L 3ROOA 2E9GA 5AAPA 4I5XA 2QSQA 4NZUH 3IEAA 4H88L 1SJHB 4YJ5A 4BQ3A 3UCDA 3KP0A 5AVRB 3WY2A 1QPNA 5IB2B 2C8NA 4UNLA 3HVNA 4P23B 2CU9A 4P23D 4PHXA 1DVFA 5CXPA 3KPMB 4OGYL 2BXVA 2ZRXA 4E0CA 2ORBL 4HAKA 1NEUA 4M1DL 3NL2A 4G1EB 5DJ0A 4XPGH 4L37A 3HC3H 4FG6C 4AY7A 5D2YA 4YHLH 4H9VA 1LJMA 4LL1A 1YDYA 5AHNA 3NUKA 2MNWA 2Y7NA 1TYRA 3AAZA 4H41A 3SRKA 2CIIB 4WHYH 2DV6A 1TV7A 1N6UA 3OBKA 4HBCL 1SHWA 5JOPD 1IEWA 4C4UA 5K1NA 2EF9A 3MUGB 1S9XB 2AVGA 3KGUA 1WNOA 2OELA 3L3OA 1M05A 3TIDA 2XI9A 3MUHL 1OSEA 1H5YA 3KM2A 5BS0A 2JLLA 1S7UA 2XISA 5FO9B 3MLXH 3QDMD 4CMMA 2GT9A 4QIRA 2TMDA 3B6SA 4NWUH 4RMTA 3SDXB 4JHOA 5I0ZA 3AUJA 3NYZA 1QVBA 4GW5A 1P7KB 2RFXB 3CU2A 3L9RB 1LUCB 4LCWB 3LRSB 1GGIH 5DJZB 1UM4L 3AICA 5KSVA 1YVLA 4X50A 3KL3A 1A4AA 2BSRB 3F7LA 5JOFA 2CO2A 2BV9A 3IVTA 3LTYA 1MCOL 2X4RA 5CEZL 4NBZB 3GRWH 4O2CA 5EUOF 3EA2A 4H25A 2M1KA 4ENZA 3LA4A 3KVKA 5H6HA 2PSNA 2WWMC 4HJ1A 2ZDRA 4WXYA 4XKMA 1KC7A 1UT2A 4JIHA 1XSIA 1U5JA 3S37X 4X60A 2V9TA 3DTXB 3K5SA 3O9WD 4FXKC 4IKLA 3ZKXC 1IT0A 4QS6A 2X28A 2YWZA 1PQZA 4XVUD 3X14A 3GJFK 3LLDA 1TJGH 1HL2A 2N0KA 1MQRA 3N6HA 3ATDA 1LP9A 1RUML 2I9TA 1YUHA 2YD4A 2B4CL 2ACQA 2V5KA 4NHVA 4YR6A 1QI3A 1RUKH 1KWGA 1MZZA 3MXVH 4MJID 4YTRA 4FABH 1UXSB 1ETZA 2CBVA 1N64L 1WT5C 2HRPL 4UFMA 1CLCA 1NSNL 3RU6A 1L4IA 3I75A 4HT1L 4V1DD 4X22A 3P9LB 4HKXB 2PP0A 5DUPH 5KSBA 3IIXA 5DQDL 3O6LL 5FAJA 4NP9A 5F7NC 3E3HA 3OZKA 2C79A 1EZVX 3N9KA 4O8RA 3QI9C 4KK6D 3D3VE 3W6YA 3HC2A 3QXAA 1UXLA 4AIBA 5IVXF 3DH7A 3FEMA 2WOQA 4OBTA 4B9FA 4DEPC 3W11C 5BVJB 3K1DA 2NR6D 3B9EA 1TVNA 3GC5A 3WH7A 3EF7A 2YPLD 4XRCB 5A7EA 1EC9A 2JH2A 2IAAC 2GJPA 3GXIA 1JF6A 2FVMA 5BV7B 1NFDF 5M5DA 1V10A 2EDHA 5I8EA 4BFGA 1BZQK 2IQAA 4GRWE 5CLXA 3WMQA 4C83B 4GI4A 1Y0LB 3MZNA 4QHUA 2GTZA 4US5D 2OXGA 3MV01 3K2GA 4F4RA 2R0LH 3RMJA 3FBKA 3VIGA 3MFFB 4B5EA 4RNRB 1JZEA 1Y5XA 3SE8H 3Q5TA 4RZKA 4FXFA 5DVMA 4J9JA 3TCEA 1TV4A 3W72A 1S7XA 2K4AA 4G9FA 1FCGA 2JB6A 2P8MA 2Q8BL 3OGSA 3QFWA 3KFTA 3I6KB 4EVNA 3CK5A 5G5IA 5J5RA 2GJ6B 4ELMF 3GU1A 1EEQA 1X9QA 3F8UB 4WWNA 1S1PA 1YHTA 4RH4A 1GOHA 4X8GA 1R2TA 2L7UA 2YD3A 2H1LM 3I6GA 4P5MB 1C8QA 4OVVA 1HF6A 4I9JA 1KRCC 3GYCA 4WJKB 5CS7A 2MKLC 3DI1A 2RDUA 1IILE 4G2DA 3BVXA 3GINA 4A8RA 4PJHF 4RFEB 2W0FA 3DBPA 4ZMGA 1MFBH 4X9IA 1K7FA 3BZDA 5KS9F 2BSLA 5GISL 2Y61A 5ECUA 3U3HA 3BLIA 3PGCA 5DX7A 1S9VB 2PWFA 2Y6SD 4PRPE 5C07E 3PREA 1J01A 3EKLA 2VXVL 3W1TA 2A0LC 5KSBE 2DYRB 1L3WA 5T3XH 2BP1A 3W7OA 1R3IL 6A3HA 4XWOC 4LUTB 2H0PA 4U28A 3C6SA 2GJ6D 4L05A 4M93B 1AYRA 5E08L 1YEFL 3K46A 4LSTH 1TPC1 3VIHA 3MV7D 3WLOA 3C09B 4WY0A 2F7OA 3AJ7A 1OPGH 5BZXA 5K9JH 5FJTA 4ZSOA 2QV4A 1ZJBA 3EYOA 4FQIL 4DN3L 3UAJD 5IM7A 3PWNB 4M48H 4R83A 2EC9U 1G7HA 1KJ2L 1PJWA 4OUOA 5AW0B 5JXEC 2PDPA 2EPOA 4JPKH 4DF2A 2MFNA 4YZFF 1QK2A 4M02A 1JCYA 1MLCA 2J6EH 2OKMA 3UG5A 4I9TA 4FXTA 4TSBL 4KXCA 4XPTH 3TT3L 3HKZA 3INUH 1LEIA 3TN0B 4HGKC 5MEPB 1P1XA 4CJ1A 3G6DH 4LZKA 3VH8B 1S38A 3ZN6A 4IRSB 4KTDH 3FQWA 4V1YA 4Q6IC 2OTDA 2W88A 2J1KA 3Q3GB 4G6MH 3TN0C 3GSWA 4HG4J 3CFIC 2XZZA 1XF5B 1QEWA 3CN1A 3MOQA 3TBVA 4Q8WA 5T1KD 4MDJA 3T71A 5IMOB 2DYSB 3MJWA 3BZEB 2PP1A 2WXMA 4WNJA 1T3FB 2BOBB 1Q85A 1MCPL 2PWDA 4UFKA 3I2CL 1LO5B 3L9CA 3Q37A 4HWZA 3UBXB 1T1ZA 3UJFA 4JY4B 2FNBA 1BJ1H 4ALDA 3QWOB 3WIHA 5GSVA 1PLBA 2Y24A 4K9JA 5IB1B 1TYGA 1S2WA 3SECA 1NQBA 3TA3C 4L6OA 5FYKL 1AO7B 4YLWA 4J6IA 4YBQD 3PGDB 2NUWA 4HIIA 1HHKA 1CICA 2FE0A 1PD6A 4LL9A 3KLQA 5L4FA 3PU7A 2HFGH 4AZCB 5D8JL 4DM1A 1OAYL 2EE6A 2CMRH 1J10A 1FCBA 1HAUA 2J4WL 4DBUA 2HKHL 4GBXB 1J8HE 5C3IA 1M7DB 4ZW7A 4W84A 1ASOA 3GXUB 3EGSA 2SEBA 1ETB1 4KI5F 3N44F 2WMGA 2DW5A 3K2KA 2OTWB 4LSUH 4PCYA 5JHDE 3UYOD 3SY5A 1QI5A 3TC6A 4GSRA 3OIXA 3M64A 3MI2A 4NZTH 2D3LA 1V93A 1SJHA 1FNAA 3LKNB 3O6FA 1IIIA 4TXEA 1JTPA 4XVOA 3IETB 1K8DB 4MB5A 1UZ8B 4RAVA 1HXYB 4P2QE 1OB1A 2R0WL 4Z7VA 1BXBA 1HHJB 1KJ3L 2YXMA 4J3OG 3TJEL 4B90A 2CRZA 4TUOB 5KAQF 4POYA 3U0WH 3A4XA 1MF2H 4J3VA 1S9YB 4YHEA 4O2EB 3RFZA 1C5DA 4GVFA 5HPMA 3DX4A 4HUXB 5F1IB 2CGYA 2OB3A 1NCGA 1MUCA 3KJ6H 4G7VL 3ESOA 5LGYA 4BEUA 4QKTA 5A3ID 5T26A 2IDTA 4AWJC 2CKNA 4Q8QA 2FIRT 4W7UA 4ZQKA 2YOAA 3Q01A 1DIKA 1OBAA 4KRUA 3E5BA 4PMZA 3EYFA 4NO5B 1W9PA 3RIKA 1I53A 2Z6JA 2QYGA 3REWB 3SKJL 1BOYA 3K13A 5D6CB 4DBSA 1AFVL 5TDNA 2GUUA 3M46A 3CWOX 1EO8H 1HYSD 3A4FA 2QLVB 4NLAA 2V30A 3VFPB 2WWKT 3KW3A 3U9UA 4XCNB 4DQOH 4HKBB 4YXLH 4JHVA 4IIQA 1VS1A 3ZTEA 4GBXA 5L8KB 2V4LA 1VPQA 5G4WA 4L29A 3GDCA 1TU2A 1UFUA 4FHBD 4LBEB 4ZW6A 3S35X 2PW1A 2OLAA 5DELA 5LIUX 4OAWA 4CQCA 5I07A 4E4UA 4L1BA 1MNZA 4K71C 4DN4L 3OB8A 3KHJA 4DP0X 4AZCA 1J79A 1OSPL 1P6AB 2NNFA 3PXJA 4QYOB 5KYYB 1JGDB 2GAZA 3NSJA 3W9DA 4JTKA 5ESVA 1M6UA 3K4AA 3TXZA 3CXHK 4OZGA 1UWGH 4P2RD 4U6XB 1HINL 3P9MA 2B14A 1XH2A 4UQAA 3ZS4A 2ICWB 1JJKA 3FSZA 4GP8B 2CESA 2P43B 1W15A 2J6EA 3IRCA 1BZ8A 4PRNB 4K9EC 2QKIA 2ALAA 4FKHA 4JPVL 1KFWA 3LKOB 2QMKA 2XWTA 1KT2A 2JF1A 1H8SA 1DJXA 1WTLA 4MBRA 1IV8A 4N0UB 5IJCC 2VLKD 3NCOA 1RK7A 2PTVA 5FAAA 3C2RA 4NVTA 3GDMA 2LAGB 3D7PA 4ADJA 5GGRA 3WZ0E 4TSCL 1GYWA 1KIRA 1RZFH 3G0XA 4AWTA 1DQWA 3DESA 4PMVA 3H0TA 5I28A 3TF4A 2QF8A 3GS6A 4HMNA 2A38A 2JCCF 2QGCA 5FS5A 2I9LB 1ZFJA 9XIAA 4JQ3A 2J1XA 1G9NC 3IVKA 1MUJA 4QXUL 4PJCA 1VYRA 2AJVH 4KERA 4YO0A 3CN0A 1Q7MA 2QKFA 3VCNA 1S3KL 3P2TA 2O5NA 2VFFA 5DMLA 1AGBB 4IRZH 4WFGE 3D69B 2VM4A 2X1WL 5BU6A 1ASQA 2CO7B 4QTIH 3SGKC 1MFUA 5E6IB 3BSZH 3KUMA 4NAEB 4Z0BH 2E7BA 2A7PA 2PWHA 4P8UA 1CTOA 3NOEA 2DLIA 3MGTA 4QRPD 2V5DA 4CD5A 1JPGB 1OKEA 1ALDA 1RVFL 4AHPA 1NEYA 4AAJA 4NAQA 3CXHJ 1O95A 4X6CE 1NDTA 3C6LB 4LCUA 5IBUG 1QYGL 1W3KA 3EX3A 1REQB 4HNLA 2DWEA 5JUEL 3DFYA 2IPKB 3C5SB 1UWFA 4JANA 4Z95H 1Q9OA 2AMGA 5JA8B 3ULVL 1K85A 1R9ZA 4H25B 1O68A 3IPEA 3BAKA 5I5MA 1A0CA 1TELA 1BTCA 2A6JB 2XFFA 2X0SA 2ZX9A 4MUPA 1A4CA 2BIHA 2PI6A 5D72H 5TQ0L 4OI9A 1IEHA 2UZIL 2Z31C 1UG6A 4K07A 3T4YB 4NNCA 5KYWA 1UG9A 1R0AH 1RSCA 1CI1A 2GSGA 4N2EA 5CJXC 4EN3C 1V6TA 2DZBA 3EBAA 4BZ1A 1TREA 1KLGB 1YEWA 4NHCH 5BROA 4BCYA 1TPVA 3IDIA 3R89A 3WQWA 4MDOA 2XPGB 4LARH 2CLRA 4KBPA 3FIGA 5IVXA 4QHKI 2BNRB 1BWWA 2VC2L 5GGTH 4B27A 2OO6A 4RMUA 4LVAA 2F7RA 3VXNA 3VVVA 1VADA 1RZKL 3EDFA 4YZFE 2C1IA 4ONFL 3LQZB 4K38A 1AH3A 5F1UA 3E1ZA 1F4AA 3QUXB 2UBPC 4G3YL 1LO2L 3OZYA 2MANA 1MQQA 3L13A 1K5NA 3I65A 4YSUA 2VN6A 5KBLA 2MEJB 2NY3C 3DGGB 3DVFA 3DX6A 2X05A 1INEL 4C57C 4KUZH 4W9JC 1IXNA 2YC1B 1G4PA 3SR7A 1DFBL 3IS4A 4ADUA 4WOZA 2J6WA 3IK2A 4H8QA 1GIGL 5D7JB 1ZK9A 5FX3A 3EPMA 4EXBA 1NKGA 1AHMA 4A6YL 2JB6B 4BUGA 4LPTA 3H4WA 1CX9A 3MSDA 3P30L 1ZXQA 2BFVH 1CGVA 5E8DH 4KRPD 7PTDA 1PF3A 3WY3A 1TZGH 2OXGB 3FT4A 1W0WB 3RX4A 4ODBD 3SGDH 1QRNB 3OG6B 1IL1B 1JNHB 2A9CA 2BP5M 3FN0H 5EYWA 5MEQA 3RM4A 2REQB 1QYGH 4NUMA 5DZVA 1WFNA 3PWPE 2WJEA 5F3BA 1OAUL 3T65A 1KELH 4F15C 5BQ7A 2YD7A 5JQ6H 1JCLA 1YTKA 2YDAA 3WHXA 3PWPB 3ANVA 1M5WA 2OMUA 4EXPX 2OX4A 1H50A 2QIIA 4IHOB 3D4YA 5FUCC 3Q9PA 3KH4A 4CUCA 1H2JA 4R3SA 3BRGC 1UR0A 2E40A 2J6XA 3DGRA 3NZGA 1KFEA 4TOQA 3P93A 1U8LA 5FHAL 3W1PA 5FWRA 1S9KC 3ITOA 2IDQA 1QTWA 2K0RA 2J13A 2R4SL 3QZWG 4QRTB 5I0YA 3GSXB 1J2WA 4WY0F 3REQA 3B5TA 2CWNA 1MCWM 4XZUA 4JREB 3QXBA 3RWGB 4ANKA 2DZUA 4LUSB 3WLTA 3QUGA 4CVXA 5U7SA 1IGTB 3N55A 5LAXB 4H40A 4PREA 4IG2A 2J20A 5EORL 2KZ1B 1FWXA 2XSBA 2VR5A 4IPJA 1OF2A 2OI9C 2X44D 4P46A 2OR2A 3QZ6A 4ATDA 4OM0L 4H9MA 1IEXA 3UW6A 2L7QA 3F5JA 1E0UA 1AQKH 3SBQA 1RQBA 3OMZA 1RZQA 4ZFFB 3W27A 3DDGA 3SGKA 2DY3A 3QFJA 1RK1B 4QITA 3CX2A 2R24A 3QUZC 2X5PA 5BYWA 4FQQA 3LQAH 5FESA 3GXNA 3PAOA 2BW5A 2CRIA 1WCBB 3AWGA 3CN3A 3O16A 2QDVA 4AGLA 3SCOA 3TQKA 3KOZA 3B5HA 3DVNB 3GSNH 1UVQA 1KTLA 2IGLA 1CENA 3SCRA 2C3VB 3BIKA 3QV8A 3NACL 5ICZA 2P7TA 4M4RB 4XE5B 1SFSA 5HHVH 5L2KA 3FYIB 4GW5B 1AVAA 1PZSA 2NXZD 4HIJB 4AQ1B 4CSTA 2OK0L 1A1OB 1FWDC 5HK4A 4MA7L 1XRTA 3FCSB 3AZUA 3L7EA 1CU4H 2DIEA 3ARXA 2VKXA 3E3QC 5ACMA 3ZTNH 3DJSA 3TOYA 1HIML 4MLSA 1F6YA 1I8KA 1D6VL 1PLGH 1UZ6E 2AK1H 2KC0A 2ROXA 3KXFB 4GG8A 5B38A 1OINA 4WI7A 2VZ3A 2X4QA 3SB3A 3V0WL 4F58L 4X0KA 4WKZB 3QHFL 3ILQD 1TCRA 4G72B 4JTDA 4L4TB 4FP8L 4TULH 1KB5B 4LW7A 4U1JA 2QQLH 5KVGH 5IREA 1QSFE 4N90E 5LGXA 1MWAB 4YWIA 4P3CH 5E70A 2XJLA 5D8ZA 4ODUB 2QFPA 3UG8A 3QPXH 2DH2A 3Q1SH 3MVSA 5IB4A 1TMCB 1XF4B 4MLJA 4DW2L 3W56A 2RHGA 2JKXA 4GLEA 5HDOA 5CEXB 1AE6L 3IGKA 1P0DA 3AYSA 2H5UA 2Z27A 5EIIB 3IJQA 4GAFB 1FWSA 1P6CA 4QRPA 3ZVVA 2ATSA 1QFHA 5AECA 3I9GH 3S47A 1U42A 4IBVA 1X5FA 5MERA 3AMLA 2JQZA 4KEZA 3KPTA 3QWQB 1ISXA 4FCHA 2G60H 3I84A 2PB1A 5K9QG 3RX3A 1EXHA 4HNTA 1RZ8B 3MQIA 5E4OA 5EOCJ 3DUUA 5FCSH 5T5NG 5A3HA 4IU2B 5IFAL 2UXFA 1OGTA 1UXWA 2IGFL 5GPRA 5JW5A 3PJWA 3O8XD 5KSUB 4ORGB 4NQVB 1EH9A 4I0CC 1DUYA 1ELSA 1I1RA 3HBGA 2CLOA 1OARL 3D34A 1DE6A 2WXPA 1THAA 2VZTA 4WVXA 1JVKA 3MBED 3EH1A 4JY5H 3D8MA 3EB2A 4HJGA 3QIBB 5CBJA 3GGWA 4MZRA 1N5YH 2QZRA 4WWID 3PZNA 5E6IC 3EYVB 4TUOA 1DCEA 3ZL4L 1TQCC 1I8UA 1GTHA 3D3VA 5I30L 2BDNL 3D85D 3HZMA 5AKSA 4FYTA 1MJ8H 3L67A 3TXAA 1CD1B 2HWZL 2VUYA 4Q8PA 2BVYA 4BKLB 3SPVB 4XB7A 3UTZA 3V0SA 2FL5A 1MFEH 3Q8EA 2Q8ZA 3C12A 2OLDA 4YTTA 3CU7A 2CKBB 2D7NA 3C0LA 4CNPA 2QVFB 4XAKE 1WDAA 2V17L 2O72A 4IZGA 1GZQB 5I26A 4POCA 1SZNA 3B37A 4F8PA 3IGUA 4PBFA 1PG7L 2Y5TB 1IB5A 2QJGA 3PZUA 4DUXA 1II4E 3WCYA 5ENLA 1E0TA 2CO3A 4KXZI 3SGUA 1OWWA 1M4KA 3TYCA 4AZGA 4X7FC 4DO5A 2GPZA 2PDUA 5JXED 4I5BA 4OJAA 4RZCA 3TN3A 4IL0A 4JEJA 1N0LB 1LP9F 1WAAE 4CNOA 4LLYA 4HK0A 3VI4F 4JNMA 1GRWA 5ITFA 1WQVT 4MVBD 5ILTL 3ZDYB 4I90A 1VLWA 2MHAA 2EKSA 4KZDH 3RWEB 4Q6JA 1TZ7A 4UV7L 4XO7A 1L6FA 2ZE0A 3QY8A 1NANI 1LL4A 3D39E 3W6MA 4ZTPH 4I0PA 3S96B 1ZBVA 5AW7B 4LP5A 4DWDA 4ZJ9A 5C9RA 4N6EA 4PMYA 3P0YL 1MCJA 3TH6A 3BH9A 1RK5A 5E2UH 4JFYA 4X4YB 1MELA 4LSDA 3TYBA 1P7TB 4M6OL 4N2AA 5K9OB 1XG3A 2IG2L 1ESOA 3VXQB 1LK2B 3GJFH 4PI0A 2EXOA 3GMNA 2WN3A 4PJ8A 1HHGB 2V2CA 4WTZA 3ERPA 4JQ4A 2OMWA 4PB0L 4HHWA 1T0PB 4Y8AA 3UPRA 1Q6DA 3DN5A 3LG3A 5DHMC 3NZPA 1JI2A 1U21A 4ZMQA 4ZGYA 5BOFA 2GK0A 4E41A 2AAAA 3MLYL 2XZAL 2VJXA 2Q0ZX 2HLAB 2PPCA 4TOYL 1EQPA 4DKDC 1M03A 4R96A 3CZFA 4TNVF 2HWGA 3G8RA 5B3JE 4W93A 5EY5A 4KROC 4HH9A 2BY3A 2ICSA 3HI1B 2HRPH 5FXCH 5I5JA 3IDXL 1FCCA 5B38G 1F3WA 3TNOA 1JGVL 4XB3A 4UQ3B 3G6MA 4K3EH 3I4KA 4MAZA 3BIBX 2WM1A 4LAMA 1DLHB 4XP1H 1TQCB 4N7QA 3OKMB 2C3HA 1G6VK 3UJJH 1QD0A 1XIWA 4RWYL 4GJ1A 3TMLA 1OQXA 3WO4B 1M57B 1EXUB 3TA9A 1CZ1A 3RWCB 1LEIB 1I1YA 2ENPA 4BJHA 5D4JA 5HJGA 1X5HA 3KLKA 3LAFA 3QJRB 5IT2H 1MJ7H 2Z91B 3VG9B 2Z2BA 3T6WA 4NOFA 1SM9A 4PJHA 3G18A 1OABA 4C6LA 5GRYA 3RNDA 3U7AA 3U7BA 3BQVA 2X0HA 3C2FA 4MGGA 2ZDSA 5A8MA 4ADIA 3S1GA 1RJYB 1M42A 4GO9A 4HUNB 4YGVA 3REVB 1TPB1 2CC0A 2CUMA 1F6FB 4HV8B 3FFCE 1UD5A 4FTDA 4FTVB 3UL4A 1EGVA 2TRYA 3P4NA 1B3XA 2CEQA 4KGLA 5A1AA 1BJMA 1LROA 5CQ1A 2CLEA 1TJ0A 3UY7A 4GBXC 3RFRA 3V1HA 2VC9A 2BK8A 4IJ3C 4DGUA 4NC1E 3H2OA 1J5DA 5TQ2L 5A6BA 2NVDA 2NLIA 2XACC 3WFDL 2P48B 1WS7A 1TZHB 3MV7B 3S5LG 2TAAA 4ZQRA 3WBEA 1VJSA 4YDVA 5AHIA 2LAAA 1R34A 1XQ4A 4KK9D 5FEBA 1PKYA 3KOYA 2ZX6A 4LMQI 4ODTH 3V0IA 3VM7A 3N9SA 3DBXB 1CLZL 4X7SL 2OWWA 6TAAA 4CCCA 4S3BA 4KXDA 1NM9A 3RVXD 3WLBA 4PSRA 2ATAA 1BVKA 5F6HI 5GRXG 3C8DA 1GTEA 5FFOA 4QRAA 2FJUB 3N12A 1PD0A 4R7DB 3WNOA 4XVDA 1ID2A 5E03A 1CFTB 1WDDA 3O2WL 5KWYC 1YEGL 4PAZA 3MSYA 3BMWA 5EA0H 3CFUA 2H3XC 3JTSA 4B95C 3KHOA 5DJ8B 4CGUB 4Z7IA 2WXGA 5T3XL 3BRDA 4JM2B 1I2RA 4XVEA 2H8PA 1ZVSA 4MNQE 4NASA 1BYAA 1OP5H 2Q10A 2YOCA 1TR9A 3UR7A 4F9DA 1UUMA 4PRIA 3NAAL 4KTGA 4N0YL 4RGMC 1J9RA 4PGZA 4HWBA 5EUKA 3AGVA 2AJXL 2DMHA 5DFWH 3TIEB 2PCYA 3F7QA 1BVZA 4XP9L 1YEHL 1FP9A 1KTCA 1M7JA 3MBWA 3N15A 2EVIA 5M2FX 4LSQL 5BNXD 1IM3A 3VUAA 1W5MA 5H8PA 3EJUA 3GI8H 4Y2DA 5I73B 1DPMA 4F91B 2TRSA 4G7EA 3TO2A 5I0DA 1YUHB 5GS0C 3MSRA 1IVLA 4C1KA 2I5YL 4O13A 3V0UA 7FABL 3WTUA 3QZEA 2ON3A 3D3VD 3ML8A 2OI9B 4MDPA 2VABB 1HXJA 2V2XB 3U4KA 2VC5A 4WUUA 3L3HB 4N9CA 4UV4H 1KYOK 3U46B 2JVUA 5DANA 2FVKA 1IC7L 4U1SA 15C8L 1ORSB 5FHBH 1QK0A 4GFSA 2R9HC 2J8GA 4L9LB 5D02A 3IS0X 3P67A 4QHMB 3U9UB 1DE4B 3NJMA 2ATMA 2OQLA 4YNGA 4PVNA 5SWQA 3CH1A 1F58H 3LB6C 1MNUH 5E4EC 4AXKA 3RTQD 1Z9SB 3BDYL 4XN5A 3EJPA 1EZLA 3FMGL 4MJJA 2BIIA 2R1YA 3D12B 3E8VA 4HGMA 3U82B 5FJIA 5LN4A 3FYPA 2WBXA 1RSFA 1PWLA 3SDCC 4OD2B 2B9BA 3BGMA 3X13B 5G2WA 3TA3A 4GAYA 2Y6TE 1I8LA 2Q3AA 3CIAA 3IFPA 3UOAB 1OW0A 1XLLA 2FTYA 4GJIA 4GUGA 5FEZA 2VAAB 2XVGA 2CUAA 4ENLA 3M7WA 4KDTC 2YW4A 2ZAGA 4J5NA 1RJQA 3QJUB 4NQEB 3NRQA 1MUJB 4NDMA 1FIEA 3TN4A 3B8YA 1DEEA 1UCTA 2VRKA 2ZUSA 1D9EA 1U5HA 3BPCA 4XNXH 4A2EA 5CD5C 2CHRA 1U9KA 1DR9A 4P07A 2FVNA 3G1FA 1EFXD 1JF1B 2NXYB 2CNZA 2POZA 2ZA2A 3D4CA 1GQKA 4DK5A 4IPIA 4KUCF 4Q4RA 3AQUA 2IOOA 2VMFA 2V7NA 4JFFD 2J72A 3W7CA 1NGZA 3OL2A 5D1ZC 4D0CA 2HPMA 4DJEA 2X4QB 3B5GA 2BVWA 1WV7T 4X6DA 5FLUA 2WVTA 1EUTA 3VFRB 4MJ2A 5ACZB 1SU5A 2XFXA 1D7FA 5CSZA 2QW5A 2YR1A 3CM4A 4IDLA 2ZUMA 4BELD 4RX4D 3HURA 3M9YA 4J12A 3GI8L 3OGVA 5HGHB 3NMEA 1F76A 3VD9A 1DVJA 3R1ZA 4YSDA 3GB7A 1UGNA 4OZHA 5DXWA 3NP3A 2Y1AA 4JZNA 1S8DB 4Y2OA 1PG7W 3L5MA 2OX1A 4A8NA 2AW2A 2QSTA 2N1KA 4IS6B 2CIKA 3GBML 2YCKX 2OCFD 3IJSA 2VWTA 2EUVA 3O8XB 3SDOA 4KZDL 5T1MA 3NIFE 2NZ9D 1AO7E 3EYSL 3BI9X 4IEFA 4KWSA 4EANA 5E0KA 4OD3H 1H0DA 3OKNB 3V7AE 3ZVHA 3QEUA 3NSCA 1M1SA 1JYXA 3S5LA 3SHSA 5IMKB 5K9KA 2WXKA 2D69A 2QGYA 1F58L 3CWNA 3NIDE 4U1MA 3D2UA 4LE8A 2CDFB 1WWBX 2JJTA 5C0EA 3FUFA 1CBVL 2VDOB 4HOZA 1NIEA 5DSCA 4ZSOE 3ROOB 2YGYA 1E2WA 1U91B 5AL8A 3LY0A 3WMBA 4IIQC 1ORQB 4NSBA 2A6IA 1HXMB 1PD1A 5T91A 1VKXB 4MNGB 5E00A 3WLJA 2E7LA 3DPBA 4AKPA 4AV0A 3RO8A 1WXJA 4MNGE 3QIBA 2Z35A 3NZSA 3EWZA 4J2PA 2ZIDA 1FRGH 3LRHA 3A0OA 1AHWC 1HHHA 1B31A 2A4AA 4FNTA 2DM7A 4JFDA 5CN2A 3LCHA 3COTA 3HG1B 3QDGB 4JS7A 1R3IH 2FZNA 3AG3B 1R0MA 1MOEA 3IV3A 3F2DA 3JWOC 3UJJL 3AHXA 1CZ8H 1SJEB 4ELDA 2P4AB 4JZNB 3W39A 2FGBA 3VW3H 3FT1A 4HPHA 2AKRA 1BVWA 3D47A 2I14A 3PSVA 5AW6B 4NN5B 3W83A 2X70A 4ADTA 2BJML 4LDOB 2NY6B 3GUGA 1EHNA 4PMXA 3TWBA 4ACYA 2QELA 3KXFE 3UO1L 1TTJA 5DMKB 4Z1AA 1I1AD 1OK0A 4UTHA 4I18B 3MNWB 3RX8A 1YEEH 1N2RB 3EHBD 3EOTL 4G8TA 3TJHC 3TYGL 5IVNA 2IBGA 1QO5A 1VACA 1U1HA 2GI0A 1RLBA 1V7MH 2W1NA 1QSFB 3QEHB 3H22A 1A7NH 3NGFA 3CMOH 2Z8SA 1V3JA 1CR9H 1P84J 3L5XH 1FVEA 2R14A 4JTGA 4PJEB 3MO1B 1U92B 4PG9B 5FR3A 1SVBA 3TEWA 4J4PD 9CGTA 3WFAA 2WKOA 2XZQH 1IGMH 1AK5A 1AZ1A 1TPFA 3BZFA 3X11A 4P4KC 1MFCL 4K3JL 5EULV 2XICA 4I7ZC 1J6PA 3VWJD 3RBSA 2PCFB 1EOKA 4MA8L 2QKSA 5H94B 1Z5YD 4CKQA 3L21A 5I8CA 3N4EA 3VZXA 4E9LA 2WBJD 4GQ9H 5DZOA 1RU9H 4Z76A 4BH7A 4N8CH 5IB5A 3O1NA 1JK9B 2AK1L 3FQTB 4ACTA 3GE7A 4WRLA 2YSWA 5E0FA 4Q4OA 3STZA 2PF6A 2MKWA 4N0UE 4G7RB 1DQLL 3IAPA 2CPUA 4Z95L 1A6TA 4AGMA 1SZFA 5KVGL 1WCBA 2VDNB 1X7TA 2CRYA 1R6WA 4LVGA 3UXKA 4DP6X 5EC2B 3IJ8A 3QSTA 3V16A 1JXDA 2AV1A 1T8XA 4R7LA 4GJJA 1G7MB 2ETWA 4Y1AB 1W8SA 4E8CA 1GORA 1BF5A 1S3RA 2XHYA 3ZDWA 2FWSA 4L3CA 4HZLA 2DEYX 2VITA 5AHMA 5ABEA 4XBGB 1P5VA 5M7QA 4NKDA 2AJXH 4JX6A 2XV2A 1O6IA 3ZJ7A 5EBLB 1F86A 3QRLA 5IHRA 4YSSA 4HKXA 1EXUA 1I0DA 5JU6A 2XSKA 1RUAH 4W9GC 1T66C 3A4DA 3RL1A 3FOMA 4PJ8C 1XO8A 2H32H 4NBXB 3SE4C 3S1UA 4M3KB 3W9EA 2A6KA 3Q65A 3OHXC 2Y5EA 3CYVA 1B2YA 4JHZA 5E56A 1J5SA 4GUIA 2VDKH 4UBDC 3ZE0B 1HEZA 5EZIH 3M1OA 1UKOA 4K7PH 5G4MA 1OARH 1UP0A 5ECVA 1QBAA 4O2FB 1QR1B 1LYXA 3VXSB 1TSRA 2G41A 2PYEB 4MKTA 5JIDA 4IRJA 4XNYL 2N01B 4YE4L 5K5YA 5EU6A 4NN7B 2FSEB 1W9UA 3H2MA 4XMZA 3BMVA 1DBJH 2H6PB 2FYYA 5TK4A 4U6HA 4RSVA 4LANA 1RAMA 3VD2A 1LORA 3KPMA 1BQ5A 1Q1JH 3FOLA 4Y9CA 1OSZB 2UWEB 2FCBA 5AENA 2P8PA 3FPYA 4ICXA 5DT1L 2WSQA 1NCAH 4GJTB 4G1NA