3BSHA

Barley alpha-amylase isozyme 1 (amy1) double mutant y105a/y380a in complex with inhibitor acarbose
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
404
structure length
404
Chain Sequence
b'HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIACIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGSRADVGAVIPAGFVTSAHGNDYAVWEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-amylase type A isozyme
publication title Multi-site substrate binding and interplay in barley alpha-amylase 1
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
total genus 127
structure length 404
sequence length 404
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bshA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bshA01
3KE0A 4UZUA 3MU7A 4JL1A 2D3NA 1F4AA 1XGZA 2J7HA 2CBUA 3HN3A 1MW1A 4UFMA 1TQWA 4MB4A 3T2PA 3SCUA 3OZPA 5CSUA 1BGAA 1E9LA 1ZBWA 3ZT5A 3A4AA 4P7LA 4UQAA 4UFJA 1ZBVA 4J3XA 5IHSA 4TVUA 3N9KA 2DT0A 3MANA 2WBKA 3EJRA 4CUCA 2ZUVA 3OGVA 2F7QA 1C7TA 1BG9A 5HNNA 1UHVA 5A8QA 3TTOA 4ZFMA 1IV8A 4QAWA 5IFPA 1UR0A 1UH2A 1ODUA 1E6SM 3U57A 1EIBA 1QNPA 3WMCA 1UA3A 3AYRA 4R5EA 3NJ3A 1Q6CA 1ISZA 3AJ7A 7CGTA 3GXFA 3B9AA 2DEPA 3W27A 4F66A 1Q6FA 5DMYA 1E56A 3VGBA 3THCA 1NOWA 2DIJA 4EKJA 3T09A 3UG4A 5I79A 4MTVA 1V0KA 3EJSA 1VB9A 2YKKA 1MW0A 2A3CA 1NWUA 3CZLA 4J3WA 3PHAA 3OLDA 4CCDA 4JCLA 2GSJA 3LMYA 1TFVA 2IXVA 4L4OA 4A3YA 2J7EA 3W28A 1JF5A 2CCRA 1OGGA 4WSJA 4CCEA 1CBGA 3RILA 1K9EA 1GJWA 1KWKA 3VIHA 4ATDA 2PWEA 4NX0A 5E0CA 1QI3A 1V6WA 5A8PA 1GOOA 4BQ4A 2XFRA 2WMGA 3QOKA 2O9TA 4P8XA 4MNJA 4JKKA 4CD7A 3MUIA 4UFKA 3VX1A 2VC9A 3AMGA 3VTRA 4FLSA 3WKZA 4ACYA 1V08A 1U30A 2YBTA 1JAEA 4JFVA 3RJYA 4PN2A 2JEQA 3S5YA 3GH7A 3WEMA 4TUFA 2F7RA 4FNUA 4KWUA 2WMIA 2OSXA 1QHZA 1DWGM 1UUQA 5CGTA 4W84A 1O7DC 4MNKA 5FL0A 1KQZA 3BH4A 4HA3A 2XVLA 3WY3A 4QP0A 2DDXA 1QHOA 2VT0A 4PEEA 3GZAA 1FA2A 3AISA 2BFGA 5I0DA 4BZYA 3NUKA 2Y8KA 4GO9A 1FHDA 3LPPA 3S2CA 2BS9A 4H8HA 4H8UA 3E1F1 1VEMA 3WF0A 5BXTA 1MXGA 1FHLA 5IFTA 2VR5A 2WCSA 4P7NA 1VBUA 1O6IA 2WZEA 3VM7A 1TCMA 3WEOA 5A8NA 2CBJA 3L4VA 4AD5A 1CXFA 1QVBA 4GI6A 2W63A 1CXKA 3HZ3A 2J7GA 3DECA 2YIHA 3WH6A 4W7WA 1O7AA 4M80A 1EQPA 4XB3A 4IUGA 3GXTA 3H55A 2E9LA 1J18A 6TAAA 3NSNA 4PMDA 2VR4A 1LL4A 4B9ZA 3VVGA 4U31A 3ALGA 4AIUA 5CLWA 3AXIA 4U33A 4FNQA 4AZ6A 1VRXA 2BXZA 4NSBA 4EK7A 1DHKA 2CEQA 2V3DA 2D22A 4WKFA 4U2ZA 3VX0A 4ZENA 4CVWA 3AHZA 4CCCA 4CD4A 4UCFA 3PTQA 3VM5A 2OYKA 1XC6A 1W9UA 4MB5A 3ZOAA 4W5ZA 4FNTA 3WDJA 1KR1A 1J01A 5A95A 4AZBA 1ECEA 1E1EA 1TQTA 1W9VA 3BGAA 2JIWA 1AQHA 4OOZA 2X2IA 1H49A 4FMVA 1JZ8A 1EO7A 2OSWA 4S3JA 2XUCA 1HVXA 3SIMA 5AYBA 2DSKA 1V6YA 2VVNA 1TVNA 2VQUA 2G3MA 4HOXA 3PZTA 4JFTA 4GQRA 3WNNA 2DIEA 3RDKA 2BHYA 4N42A 1G5AA 3A47A 4GKLA 3SEPA 3I3DA 1PZ3A 2X2HA 2D0GA 4PBGA 2WVTA 3WQ4A 1D3CA 2XSBA 3CGTA 4AW7A 4AY1A 1UR8A 3CBWA 5FD0A 1MYRA 3LPFA 2JIEA 3UG3A 1E4MM 1DP0A 2ZOXA 1IT0A 2D3LA 1BPLB 1EA9C 4PUEA 3BVVA 1WKYA 1B3WA 1VENA 2EBNA 3U7VA 4PCTA 4ML4A 4YN5A 1JI1A 3BLKA 4GI9A 2UY5A 4YPJA 3APGA 2D23A 1BLIA 4PTMA 3W24A 1FH8A 2BHZA 3VU2A 3GXPA 4ACZB 4DO4A 3BVXA 3EDJA 1GZJA 3OZOA 4MJ2A 3L4XA 4HZ6A 1W1YA 4TTUA 5BYWA 3MUAA 4MJ4A 2WHKA 2GJXB 2VRQA 3FW6A 3VD9A 2WBGA 3EMQA 4ZE5A 1JYVA 1HTYA 4LGXA 1V0MA 3WNLA 3VOCA 4GINA 2WMFA 3T0AA 2XPKA 3WD2A 1F4HA 5D8WA 2PWHA 2DQXA 2WVVA 4HOZA 4RL3A 1CGVA 2CIPA 1JDAA 1ODZA 1E6NA 3MI6A 1Q6DA 4XZBA 4LYPA 1CXHA 2WAGA 1W32A 3WDRA 1UWQA 3GBEA 5GNZA 1KBBA 1SR0A 1E5NA 3CHFA 1BQCA 4CU8A 3CUFA 3W6LA 3SUTA 4UFLA 4AIOA 1OINA 5D4YA 3LX9A 5HXMA 3CZJA 3AS3A 1R7OA 2FYVA 3VGEA 1PX3A 1J12A 1B3VA 1ZJBA 1PS3A 3WNMA 3O2LA 4M1RA 1ZBCA 3GNPA 4MADA 2WM0A 5E6YA 4IPLA 1HP5A 1W9BM 1NP0A 5EFDA 1UKTA 1E43A 2X05A 1U2YA 2ZWYA 4D6GA 1V3KA 2F18A 1PPIA 1XYZA 4RE3A 2V3FA 4GZEA 3WELA 3ZR6A 1HXKA 4HPGA 2EXOA 1IZJA 3PZ9A 2W67A 3QGVA 4W89A 4WKHA 3GBDA 3NYDA 1OSEA 5A69A 2YFOA 3BAJA 1R87A 2CHNA 1KB3A 4MNLA 1GJUA 3WH7A 3BLBA 3CPUA 1QBBA 4HZ7A 3RM4A 4F9DA 2WMJA 3BUQA 2OLHA 3ECQA 2QPUA 2CESA 1UQYA 2J7DA 1C90A 1HXJA 2XIIA 3CZKA 3AIBA 3HG2A 4AXNA 2WLYA 3WY2A 3KWXA 4CU7A 3VIIA 1CPUA 2VZTA 3W81A 4PYSA 3GH5A 2CPUA 1KCLA 3W37A 5JIWA 1NARA 3VILA 1CXEA 4AISA 1EHAA 1V03A 4KH2A 1GOQA 2VTFA 2X8RA 4ZE4A 1E6PA 4QCFA 4H41A 3W25A 3A21A 2BV9A 1EOKA 4D6IA 1JFXA 4W87A 3AS0A 2OW6A 1UOKA 2YA0A 1R75A 1V02A 2A3HA 4AYSA 3GH4A 4M82A 1MW2A 5LA0A 3MO4A 4OKDA 1T0OA 3DYMA 1CECA 1GHRA 2GDUA 1XV8A 3T08A 1KGWA 1BF2A 5E1QA 4Z2LA 2DH3A 4J3VA 1QPKA 1E6QM 1BAGA 4JL2A 4KRTA 4W8BA 2DH2A 3EJUA 1WDRA 4BQ3A 2CBIA 1HKMA 4E8CA 3AI0A 5AC4A 1OM0A 2WK2A 1GQKA 1AQMA 4PRWA 3OA5A 3OLEA 5D9OA 1JFHA 3SCTA 1VFOA 2PBOA 1GORA 1UR1A 1TQVA 1UD6A 3A4XA 3U7BA 2BNJA 1OB0A 3LXAA 3WDPP 3ALFA 2PF0A 2O9PA 1HL9A 5E70A 2YA1A 1JI2A 4AD4A 4ATWA 3ZM8A 3MSDA 5D9NA 3ZIZA 3LPOA 4LYRA 4AZGA 3CHDA 4LQ1A 4M81A 1OBAA 1R7AA 2E8YA 1WPCA 3SCNA 2F61A 1H41A 4WIWA 4C7FA 4Z2JA 1WZAA 4UFIA 4P8UA 2FH8A 4S3KA 1UA7A 5I23A 4W86A 4E2OA 1DEDA 3RCNA 2WMKA 4JFSA 3IJ8A 4PMNA 1UKOA 4PTXA 3CTTA 2J74A 3LXBA 3WDHA 1KXQA 3WBEA 1XCXA 1JXJA 4DWSB 1GVYA 3A24A 1K6AA 3WH9A 1JYWA 1XSIA 2YA2A 3LRKA 1JNDA 1OIMA 3M07A 3D50A 4D6JA 3VGHA 1KGXA 3D5HA 3UG5A 3K46A 2ESCA 4CKQA 1K9DA 3VSVA 3OGSA 2AAAA 1QI0A 1UD2A 1KTBA 1QW8A 3WMSA 3TP4A 4FNRA 3OB8A 4UR9A 3DDFA 1UZ1A 2J7BA 2WMHA 1VBRA 1CGTA 1G1YA 4D72A 4YHEA 3GXNA 3O6AA 3L4ZA 2F1BA 4W7UA 1GHSA 4IM4A 3IJ9A 1AVAA 4NZFA 2X1IA 3OLIA 2D0FA 4D1JA 4HMDA 4MAZA 3WH8A 3SCPA 3CH9A 4ZXOA 1MFUA 4X0NA 3VIFA 2J77A 2WLZA 1QWUA 3CLWA 1V0LA 3W38A 2WKLA 3EJPA 3HG5A 2ZX8A 1OD0A 3WBAA 3ARZA 2E9MA 2XVGA 3DX2A 2Q8XA 2ZX7A 3ZJKA 1GONA 3N1AA 2G3IA 2ZUNA 5ABHA 2G3NA 5AY7A 3RJXA 3MSGA 2F1AA 4GZJA 1FH9A 1CENA 1JG9A 3FAWA 3SCQA 3KL0A 2NSXA 2ZUSA 3N15A 1UKSA 4AMCA 3LPGA 2ALWA 1ITCA 4OZOA 4DUXA 5A6BA 4OUEA 4AIEA 2NT1A 3CZNA 1E0WA 1R85A 4UFHA 4F79A 1XH0A 3DX1A 2WKGA 3W53A 3QHNA 1KWGA 1WCGA 5BXSA 1GVIA 1VAHA 2FDMA 3WF2A 4Z2GA 1LG1A 1J10A 3UETA 1JZ3A 1E4NA 1QNOA 1JNEA 2EO7A 1QHPA 4JAWA 3W82A 5JUVA 4QLJA 4IPNB 1XHGA 1V3IA 2EEXA 1WO2A 4D71A 1HL8A 1W9XA 3BUPA 3TA9A 4D6EA 3F5KA 1XD0A 3N04A 4BQ2A 2WW5A 3PBGA 1H09A 3AIEA 2ZX6A 3WUEA 4EAMA 3CV5A 4LX4A 2D24A 6CGTA 1HJQA 3EDDA 4H2CA 4U3CA 4LPCA 3CZEA 2JALA 2WPGA 1EHNA 2VX6A 2W91A 1Q6EA 2YFNA 4F8XA 4WKAA 1BYCA 1YQ2A 3T2QA 3CUIA 3L2LA 2CKRA 1C7SA 1VFUA 1BG4A 2YBUA 1HKKA 1CIUA 2EPNA 2EPMX 1VFMA 5M5DA 1TUXA 1TVPA 1V3JA 3U5YA 4UNIA 1W1TA 1TZ7A 3WD3A 1XH1A 4UQDA 3AFBA 1C3FA 1US3A 1WAWA 5BXRA 2FGLA 4U5IA 3AIWA 1KXHA 2VZVA 4KGLA 3SCRA 3PZNA 1B90A 3VMNA 1BGGA 2Z1SA 2WHMA 1YHTA 3F5LA 2F7PA 1V6XA 1VIWA 3AS1A 2BVYA 2VUYA 2YDSA 1JZ4A 1JXKA 1VF8A 4D6CA 3EMCA 2GVYA 2WCGA 3ARYA 5E6ZA 2ZXDA 5EFFA 3K4DA 3AHYA 2X0HA 4P8VA 3FHAA 1H11A 4JFUA 1KXVA 4XUYA 3CUGA 4ACZA 4CN6A 4W85A 2A3EA 2CYGA 3MMWA 3IGUA 2GJXA 1R86A 3PZMA 4UZSA 1OWQA 2J8GA 3FHQA 4UQ9A 5DEZA 1A47A 3ARUA 4CU6A 4HMEA 2XG9A 4AYGA 1RD6A 2F8QA 2V5CA 1EOMA 2VOTA 3CMGA 3KL3A 1HJWA 2EACA 3SCSA 3D4YA 3K1DA 1E5JA 4WF7A 2WB5A 1ISVA 2O92A 1OGSA 1E0VA 4QLKA 1HT6A 4AD0A 3AIUA 4MB1A 3EBVA 5F7UA 4U5KA 1DWHM 3EMZA 2VX4A 2ZWZA 1WDPA 2VVSA 4OIFA 2ZIDA 1Z32X 4M8UA 3WF1A 1N82A 4PMVA 1HP4A 2AOSA 2D20A 2EPKX 5AYIA 3WQ6A 5JBDA 3VD3A 5GQBA 4DM1A 2X2JA 4B15A 1CLVA 1NM9A 2F2HA 5CQ1A 2JFEX 1TR1A 4PCSA 1M53A 4L4PA 1KTCA 1VFFA 2VI0A 2XGIA 2A3BA 4AMWA 3GNRA 3VIPA 1E15A 5I77A 4DUVA 1GNXA 1UH3A 1GOWA 1OT2A 1PZ2A 1KR0A 3WD0A 2WC7A 2D0HA 4M56A 1HJXA 2BVDA 3II1A 2V3GA 5A6BD 3NSMA 3HU7A 2PWDA 2OWCA 1US2A 1WP6A 3KEHA 2QMKA 4LYQA 4NZJA 1V3HA 5BRPA 2XSAA 4D6FA 5FCZA 2XGBA 1KFWA 4FNPA 1OT1A 3VGDA 4N0RA 2WYSA 2VZOA 2QHAA 1JL8A 3BLPX 1GW1A 1H1NA 1UH4A 4ZEPA 2VJXA 4HA4A 1HJUA 1GQJA 2ZE0A 3HG3A 3RO8A 1M7XA 3A6OA 3PTKA 1MQPA 3L4WA 4Z2HA 2CERA 5JBFA 2X2YA 1NWRA 1JZ6A 4E8DA 4OBSA 1SYTA 1NP2A 4FK9A 1C8XA 2WHJA 2VO5A 4KRUA 2W4XA 1HJSA 1E6XM 1H0GA 5A6JA 1E70M 1MQRA 1K9FA 2E8ZA 3WUFA 1JYXA 5E9AA 4PSRA 3SCVA 1C8QA 3TONA 2DSZA 2CXGA 2CKSA 2GUYA 3IAQA 4U2YA 5C70A 2G4FA 4PSPA 5LA1A 4HP5A 1XD1A 2XYLA 1XH2A 3WN6A 2VNCA 3K4AA 1D7FA 4URIA 4RE4A 5LA2A 2XN2A 1C91A 7A3HA 1ISYA 1G0CA 4P7QA 2XVPA 3GXIA 2X09A 5LYRA 2YDRA 1MFVA 3UCQA 2XFYA 3SUVA 4GPNA 1AMYA 5D8ZA 5HDRA 4AZ5A 2ZX5A 3AROA 3LXCA 3TOPA 3GDBA 3KL5A 1CZ1A 4HOWA 3FY1A 3GYCA 2G3JA 1H2JA 3BCDA 4WJXA 1VEOA 4J3SA 4DO5A 2E3ZA 3T2OA 5BROA 1MVYA 2Z1KA 3PZIA 1BVZA 1E55A 3T0BA 3QR3A 5CZKA 3EYPA 2V38A 3RIKA 1WZLA 5TD4A 5I6SA 3CMJA 2EADA 3CZGA 3ARSA 3K8LA 5BWFA 5BCAA 3GNOA 2JF6A 3MUZ1 1BHGA 1PEZA 3THDA 4F9JA 4PUDA 4CD8A 3A4WA 5GNXA 2DT1A 4CN4A 3WQ5A 3AMDA 4MNMA 2CNCA 2PBGA 1FP8A 3UESA 3WD4A 1TQSA 4MDPA 3QHMA 4DWSA 4P7RA 1PIGA 3W26A 2GJPA 2HISA 3DX4A 4D6DA 3AHVA 5IDIA 3ZJ7A 3T0DA 3SURA 1UQZA 4HU8A 5A8MA 1UWUA 4AZCB 1BFNA 4QFUA 1P6WA 1ZB5A 3OG2A 2OYMA 3ZSTA 2EPLX 2BY1A 1E6RA 1AQ0A 4CVUA 3VNZA 3WFZA 3WNPA 3IJ7A 1G94A 4H7VA 4CGTA 4PMUA 1GOIA 2CITA 1D2KA 2J75A 3OBAA 5HPCA 2VCCA 2PC8A 1OD8A 4OGZA 1H4PA 1I1XA 1JZ7A 1I1WA 4J3TA 1XYFA 1UWRA 4A4AA 1QI4A 1QNQA 3WFLA 3WNOA 3H53A 3O9NA 4W8AA 1TE1A 5CPQA 1Q4NX 4DO6A 4V28A 2W5FA 1GQIA 3AS2A 4M24A 3BAXA 1V0NA 3DYPA 3M6DA 4BF7A 4PMZA 4TX8A 1HF6A 2XVNA 4JHZA 3N13A 1H5VA 1KBKA 3EDEA 5BXPA 1M04A 4CD6A 2XVKA 1LLOA 3WF3A 4JHOA 3WDIA 2VX7A 1ISXA 1TMQA 2XN1A 2FHBA 2JE8A 3DC0A 2G8ZA 3CZSA 4GIAA 1FFQA 1LWHA 2CETA 2YLLA 2DT3A 3VKKA 1DWIM 4PTWA 2E4TA 1XSJA 2BHUA 4TX6A 1TA3B 1B3YA 1E73M 2O9OA 3AQUA 2XTKA 5M17A 3S6TA 5E0FA 3BVUA 1DWJM 5FKYA 1GCYA 2V5DA 2FGZA 1DWAM 2FE0A 1MXDA 1J0IA 3NCOA 2WWCA 4B3KA 9CGTA 8A3HA 5M03A 4FLOA 1HN1A 3B9EA 4UQBA 2WANA 5IXEA 4J27A 2GK1B 2ZICA 5CGMA 5A2AA 4WSKA 2XM2A 1JZ5A 2YL6A 3HJEA 4PMYA 5A3HA 3NDYA 4KGJA 3WUGA 1W3JA 3F5JA 1W3KA 2Y4SA 2DSVA 1TQUA 1JD9A 5CSYA 1UYQA 2C8NA 1UR2A 1DWFM 5A6KA 3UERA 3AZRA 5AC5A 2VURA 2XN0A 1B30A 3UR7A 3BSHA 3NSXA 2VX5A 2VZSA 4X0VA 4J28A 3BUBA 1E4LA 1JGIA 1KQYA 2YDQA 5ABFB 1SMAA 3FAXA 1SFSA 1QNRA 1HKJA 1W91A 1RP9A 2PI6A 2J62A 4JCMA 2ZXBA 2J4GA 3BUDA 4XZWA 3VPLA 2YOCA 3UEQA 2XJ7A 3AXHA 3AIRA 3CZ8A 4IISA 3QHOA 4YHGA 3LRMA 3RM8A 3VD5A 1E72M 4J3UA 4C7GA 4XX6A 1UWTA 3BAKA 4W88A 3DDGA 3WF4A 2E0PA 3BVWA 1W9DM 1M03A 3K8MA 5A6LA 1ISWA 4MAVA 4R27A 2J8FA 3VMOA 1X1NA 4BA0A 1GPFA 3AMLA 3KLKA 3MMUA 5E09A 3ZT6A 1XSKA 3J7HA 3EJQA 3PZGA 1HWWA 2ZXQA 1B9ZA 1CXIA 3ARPA 1C92A 3OGRA 1E6ZA 3L4TA 4AMXA 3VIJA 4UQEA 1QWNA 3DHUA 5HOSA 1RPKA 4DWSD 5A2CA 1BYAA 4MPKA 5CJ5A 4P7OA 1B3ZA 3SCOA 4UTFA 2W61A 1QI5A 1LF1A 5A6SA 2W92A 1R46A 3H54A 4PMRA 3VDHA 4CD5A 4KMQA 3AOFA 3D51A 3F4VA 1CYGA 1VEPA 5JIPA 2J7CA 2V3EA 1CGUA 4QDMA 2HVMA 2WHLA 4JFWA 5I2UA 1JAKA 4DUWA 1J0ZA 2D1ZA 3VD7A 4H04A 3CUHA 5EB8A 3PZUA 3VGFA 1LWJA 2J7FA 4UOJA 2FH6A 2ZUTA 2Y8VA 4PMQA 5M3WA 1H0IA 1EO5A 5I3DA 1KGUA 3BSGA 2UWFA 1S46A 3CO4A 1CTNA 4UQCA 1ESWA 4ZXLA 5DFAA 4GI8A 3VNYA 5DT7A 1LJYA 1QW9A 3BMWA 1LG2A 2DSWA 1R8LA 3VDAA 4WLCA 5D9PA 3S5ZA 1W2PA 1UD5A 3VSUA 3VMPA 3VD4A 4AD2A 4BS0A 3AMKA 2MANA 3AMCA 1PX4A 2QPSA 2RGLA 4TTGA 2VCBA 3GXDA 4P8WA 4NI3A 4XV0A 4ATLA 2O9RA 2QV4A 3AZTA 5CPTA 1E71M 5A6AA 1EDTA 5BRQA 1C93A 5I5RA 3B9DA 3PZQA 2A3AA 2RGMA 3FXYA 4Z2KA 5CPSA 3UR8A 4OJYA 1EGZA 2C7FA 4BQ5A 2EJ1A 2JEPA 4TVCA 1R33A 4NRSA 4AEFA 4Y7EA 5DO8A 2QLYA 3ARXA 5A6MA 1W1VA 1BTCA 3DYOA 1FOBA 2XM1A 1ZBKA 3RPMA 4TOQA 2OSYA 5ABGA 1B1YA 7TAAA 4DWSC 1ZS2A 1L0PA 3BAIA 2F7OA 2GDVA 2EABA 3DX0A 3TTSA 3JUGA 2UY4A 3HMCA 3N18A 2ZUUA 2WC4A 3G6MA 3U5UA 1EDGA 4AWEA 3PTMA 4GO8A 1CGWA 1R34A 1WE5A 2YLAA 2YL8A 3FNDA 1BYBA 3N12A 3VIKA 1E4IA 2WZIA 4Q22A 3RMEA 3GXMA 3WL0A 1CXLA 3GTNA 3ARTA 4FNSA 3SCWA 3W0KA 4HPHA 2J78A 1QI2A 4QCEA 4EE9A 2FHFA 1XRVA 5D9MA 2DSUA 1EXPA 1E1FA 1GOKA 1W9PA 4HTYA 4U3AA 2YL9A 2J79A 1ZJAA 3WIJA 4RE2A 3AYSA 1EDQA 3WEZA 4X9YA 1TG7A 2WMIB 1VJSA 3BXWA 2WC3A 2C0HA 4EANA 3ZJ6A 1CDGA 4OOUA 3MV01 1R47A 3MUY1 2XWEA 3L4UA 5C71A 3BC9A 1W1PA 2OWWA 3B8SA 5A94A 4GZIA 2FHCA 2PB1A 1GOMA 2VL4A 3AZSA 2Y2WA 3MV11 3WH5A 2Y5EA 4GQQA 1OIFA 5A2BA 3SUWA 2VRJA 2VCAA 3ZQ9A 4J7RA 1FFRA 1QX1A 1HX0A 4PTVA 4JZ5A 2WVUA 2ZUWA 2BY0A 1PBGA 1RH9A 4AD3A 3WDQA 3GM8A 1J0HA 3PZOA 1NOFA 3KZSA 3ARVA 5FL1A 1B31A 1UD8A 1BVNP 3W6MA 1UR4A 4NXKA 2G41A 2XHYA 4HMCA 4OBRA 3G6LA 2J47A 4MB3A 4HA1A 3D52A 3VIGA 3MS8A 1WZKA 1GQLA 3D3AA 1ZL1A 2X0YA 3AICA 2QMJA 3WQVA 2BY3A 1EQCA 1KXTA 3KLLA 1X6LA 3VSTA 1WDQA 3ARRA 1SZNA 3WNKA 4AEEA 2B31A 2XFFA 5A8OA 3L2MA 3BUIA 1WB0A 2IXUA 4C7DA 2UY3A 1E3XA 2NW0A 1IZKA 2CBVA 4AZCA 3ZMRA 1LQ0A 3DHPA 2QF8A 3EJTA 5ABEA 3PN8A 1BYDA 3VINA 4Z2IA 1NOUA 1Y7VA 3A3HA 1MWOA 5KEZA 1QNSA 3PZVA 3AIQA 1E40A 1UKQA 3WY4A 2NT0A 5JBEA 3OIHA 2ZXAA 1MQQA 3TTQA 4UOZA 3M46A 1DTUA 2E40A 3MKKA 3K8KA 2BVTA 4W8LA 1UD3A 5KZ6A 4PMXA 4E4PA 4FLQA 2J25A 1UR9A 1HKIA 4AZ7A 4AZIA 1U33A 3ARWA 5FOOA 1J9YA 1CGXA 4CN1A 3SUUA 3D4ZA 1HJVA 3OLGA 4NRRA 4TXEA 3W4RA 5A1AA 2WVSA 1CNVA 3POCA 8CGTA 5GPRA 1HIZA 2IUZA 3VIMA 1W2VA 1JZ2A 3ZR5A 3WQ8A 2WXDM 1KCKA 1G01A 1K9TA 1W3LA 3BCFA 4V27A 3LRLA 1VJZA 1HVQA 1WZMA 1XCWA 1MW3A 1NQ6A 1FP9A 4NXSA 1HNYA 3ZJ8A 3VGGA 2GJRA 3FN9A 3CC1A 1V02E 3AHXA 1OCQA 2EPOA 2BXYA 1UWSA 4A3HA 4FF5A 2AMGA 1WNOA 2W66A 2E9BA 2VMFA 4TVDA 3QOMA 2XWDA 1A3HA 4M29A 1JDCA 4FLRA 2WWDA 3BAWA 3ZO9A 2WZHA 4Q7NA 5GNYA 3AIVA 1CEOA 3CHEA 1TA3A 1NWTA 3L4YA 1C8YA 3EDFA 5I78A 1JF6A 4LXFA 5EBAA 1OGBA 2OW7A 1X6NA 1CGYA 2ZX9A 3RM9A 2DGAA 1V6UA 3I3BA 4AD1A 3HG4A 1NH6A 3CUJA 1UD4A 4H8VA 1JDDA 4MDOA 1I75A 1V3MA 1NWSA 2GK1A 3ARQA 3WQWA 1RP8A 3BAYA 4JKLA 1UWIA 4W7VA 1UKPA 2VZUA 5EMYA 5DF0A 3A5VA 3A22A 3IK2A 1QOXA 2WSKA 2UY2A 1QBAA 3IANA 3SUSA 3EDKA 4UOQA 3MMDA 2WVVB 2TAAA 2BY2A 1ZU8A 3WSUA 1FH7A 3WY1A 5CLTA 5IHRA 4DM2A 3IAPA 3BMVA 1B2YA 2CHOA 1B0IA 4B16A 4BCEA 3WL1A 1CWYA 3VIOA 2D2OA 5ABFA 2VQTA 1WDSA 1E0XA 4D6HA 3VUPA 3A23A 4QLLA 5ECUA 1J0JA 1B3XA 1J0YA 5FIPA 3I3EA 1JD7A 5HPOA 1UG6A 2PWGA 1PX8A 2OWXA 3N11A 6A3HA 1J11A 3VDBA 1PIFA 2Y24A 1LL7A 1V6VA 3N17A 1CLXA 1SMDA 3BVTA 4HU0A 4AC1X 4JKMA 2EQDA 4NF7A 1E3ZA 1JYNA 2D73A 2WNWA 2YJQA 4B9YA 5I24A 4HZ8A 3WUBA 1GUVA 2OYLA 4K68A 3NDZA 1G9HA 2WSPA 3NIYA 3WD1A 3CHCA 1UZ4A 3POHA 1L8NA 2XIBA 3VDCA 1M01A 4AZHA 2YL5A 2DPEA 3M7SA 3ZSSA 1LL6A 4D1IA 3WENA 4W5UA 3DX3A 2GFTA 1J0KA 2IGTA 4NZCA 1PAMA 3VO0A 2EAEA 2W62A 4PMOA 5CG0A 3AXXA 3WMBA 4W93A 2JF7A 2DT2A 3ZT7A 1ITXA 1JIBA 5CXPA 3CIVA 1V3LA 1H3GA 2VRKA 3TTYA 3AHTA 2PWFA 1Q6GA 5C8BB 1W3HA 5DT5A 4GXPA 1BSIA 4JIEA 4WK9A 1PJ9A 3W29A 5HBFA 2WCAA 2ZUMA 3TV8A 4B3LA 1UASA 4V2XA 1EH9A
chains in the Genus database with same CATH superfamily
3WE6B 1F4AA 4OR1A 3R89A 3UP8A 4JGUA 1XLLA 1JV5A 3UH8A 3ISIX 1CL7L 2OZ4A 2YS4A 1FLRH 1SN2A 2ENYA 4UR7A 2EVFA 4H88H 5C0FB 1IFHH 1KOAA 3U57A 3FTZA 4FZIA 2OT0A 3AJ7A 3GBMH 3B9AA 4YDJB 1KYAA 1H15A 1E56A 2DIJA 3O3AB 4EKJA 3VI2A 5DZVA 3QUZC 3WO4B 5IBTL 1G7QA 5AHIA 3CZLA 1MHEB 5F6HJ 5LNVA 3GJEA 4B96A 5I75B 5GRUL 3ABXA 4JLRB 2KH2B 2V5RA 4P46C 1JF5A 1AZRA 4MZRA 3L9CA 4CCEA 3ZWSA 5SWSD 4ATDA 4NX0A 3PWPE 1V6WA 4IP7A 4O51B 2HYMA 1OFQA 3L9YA 1XIDA 4JY9A 1V08A 3QEQE 1HL4A 2QVMA 1MRAA 1U93A 1E8XA 3PHSA 2XTLA 5HHOB 3DOSB 4BWWA 5HHPA 2Z93A 4DJDC 4LEXL 5IUSA 1UUQA 4DGYL 5HGDB 3K1GA 3WG7B 3MCKA 1AZBA 1FNSH 3OODA 5HWJA 3RQ3A 4RAVA 3GZAA 3UQNA 3NQKA 4XO7A 2UXVA 4ODHH 4FALA 4H8HA 3QNFA 1VACA 1QRNE 3SGKA 1FE8L 4KVCH 3WD5H 2WOQA 3AUWB 4POCA 5C0NC 6TIMA 2W81C 2ICSA 4E0RA 4MIMA 3H2EA 2Z8SA 3IJSA 3Q1EA 5DLCA 1CT8A 3GXTA 5HYFA 5ILTL 4PMDA 4QUOA 4KC3B 4B9ZA 3MCYA 3MPGA 2ZOLB 3NJHA 4QEHA 3CUZA 4AZ6A 1PD6A 3D69B 2BXZA 1VYPX 3JV4B 3SGZA 1DHKA 4U2ZA 1ZV9A 4FULA 5CP7B 3PTQA 3KYMB 1ZVNA 4UINH 4N2OA 5IMKB 4HKXB 1CDBA 1WFMA 1OAKH 2V7HB 3MZGB 3RX4A 3B05A 2XZ9A 4JQ2A 4GY0A 5FFGA 3CE1A 4TYUA 5EBMB 5D38A 4GKLA 3LHUA 5FYLL 4PRPB 1A7QH 1MYRA 3ZYIA 3PBUA 3QZBA 3RGVD 1PKNA 2GABA 3KDOA 3KM1A 1M68A 4ELKB 3FPXA 2ZTKA 3SJVA 1G1KA 4A8RA 4XVOA 2WWOA 4LKCB 3NFSL 4V11A 1S9VA 1KGYE 4YLBA 4MJ4A 1K6QH 1G7LB 1VBHA 4WTWA 3R06A 5CGQA 1K02A 2OZ8A 4XZNX 2FT6A 2ZYIA 1HZHL 1YNKL 3PHQB 3T0AA 3WD2A 3UXFA 2IMNA 1FAKT 2VDMH 1HXYA 3OKDB 1Q6DA 3ZQXA 3EYOA 3TBBA 4MPQA 1EC9A 4X7SL 1R5IB 5CH9A 3LX9A 5CKAA 4RW5A 1FYTB 1B3VA 2AEQL 3HGRA 1H51A 1I9IH 1JPGA 4H20L 3PFQA 3BLFA 4AV4A 4DP7X 3OL2A 3EJCA 2X05A 4LOUC 3EOAB 1XLHA 4TVPH 4HNOA 3G1YA 1YNTB 1RHCA 5HULA 3NYDA 1GJUA 3BLBA 3C5ZB 1OSPL 2AK4B 2QPUA 3WKPA 4Q74A 3HNVL 4MXVE 4DUOA 2NDFA 3VCRA 5KSAD 1WICA 1Q9KB 1PZ5B 5HHXH 1NARA 1UC4A 1CXEA 2IKJA 1NGWA 4B95C 3FQXA 5HANA 3UJTH 3DK0A 4HK7A 3M43A 4PJHA 1NL0L 3UBXB 4N0FA 4F80A 2BLFA 5I1GH 4J1OA 2H9AB 3T6QC 3MO4A 1A1MA 4OKDA 4AQ1A 2YD8A 1OCJA 3UT0A 3UR5A 3NNTA 1WDRA 4FX6M 4M5ZH 1JFHA 2ZXGA 5D9OA 4P5TA 1C08B 3IBEA 4DVBA 2CJTA 5F2FA 1TELA 4Y90A 4JRXE 4PBFA 5HGAA 3TYGH 2GBAA 1NIBA 5KJ7E 2DDQH 1MFNA 1QXLA 1FDYA 3JTTA 3PDDA 1MRDH 4KNTA 1KBGH 4XG1A 3VYPA 3T0EB 4IBTA 4XE5B 5G1MA 4P8UA 1P0SE 3VH8A 3TN0B 2OL3L 4PMNA 2XWRA 2Z91B 5FW8A 1GGIL 1S4IA 2YEZB 5DURD 3F7QA 1P4BH 1LK3L 3PL6D 4D6JA 2Y5SA 2VDMB 5I71C 3ZDWA 4X2PA 3LCXA 2R2BB 3P4LA 2C3ZA 3KZPA 3TSBA 4OGXL 5ALCL 4UR9A 1TV4A 4TNGA 2LT9A 4OQVA 3C6LD 2R1XA 2KHAA 1EJTC 4IM4A 4QEEA 1ONQB 2HH0H 3Q9QA 4RFEA 1EZVX 2CGRH 3SGDI 4QHNB 3EJPA 3WBAA 1Z6KA 4EI5D 3CWOX 3V4UL 5HJ3A 3ZJKA 2Z1VA 2G3NA 3MSGA 3REVA 2GHWB 4Z9KB 1E4HA 4DKAA 4UI2A 1ITCA 3GIQA 2V2XA 2YMTA 2YBVA 2P0OA 3TR2A 3EA1A 1R85A 5DGQA 4F79A 4C91A 1DANT 5F0PB 3CH1A 3IGSA 2OSLA 1DSWA 1KPRA 3O4OC 3MA7B 3F5KA 1XD0A 3DPBA 1IAIM 3V0FA 4Z7NF 1LO4L 2BNQE 1FFPB 1F1DA 2Z9TA 4PFMA 2B3RA 5EO1B 4U3CA 2EE2A 2Y1VA 1RURL 2YFNA 4FTVE 2H1PH 4F8XA 3O8XA 4EVNB 4RMWA 5JDJA 1VFUA 4UTUA 3HGJA 2PDGA 1YDYA 4NAFA 1WIOA 3L3OC 1TPDA 1WAWA 4A7TA 4F7MB 3A6BL 3SKMB 4GAGH 3V9FA 4YMPA 1C16A 3BDXA 3X17A 3F6JA 3L67A 1IBBA 4GBXA 1TIWA 3KLQA 3PGCA 2YWZA 2DJMA 3DETD 4GYPC 2K6ZA 3CK0H 4K7FA 3MTRA 5CILL 3AU0A 1AE6L 3MDWA 4CN6A 4U1HB 5EWIH 4WHTB 1IE4A 1LO0L 4UZSA 2PNDA 1DQLH 5ADPH 3E5BA 4X4ME 5EU6B 2Y1HA 3N73A 3F62A 1XO8A 1ASPA 4JE0A 1S7QB 2A9NH 3HN5A 5CJXC 3IJDA 2W79A 3HTWA 4HYTB 1D5XA 4NZ5A 1K3UA 4MB1A 1YEDB 1AJ0A 4O50A 4M8UA 5KANG 3BZEA 3K6NA 1P0NA 2EDEA 4KZ0A 3VD3A 3SBWC 1M53A 4K4KA 2VSKB 2H47C 2P8CA 5E7BA 3SDCC 3CN0A 1T0PB 3WD0A 1RQHA 1G7IA 2BVDA 1K8CA 3H7UA 2G4JA 5JR1L 3KEHA 4JG0H 4U1SA 5F3FA 4F3FB 1REIA 5FCZA 5KSWA 2IF7A 1LBLA 2AQSA 4XZIA 1KGIA 1MQKH 1XLDA 1IC4L 4O1DA 3L3GA 5D8JH 4ZEPA 4FL4C 2VJXA 5CIPH 4B60A 3RFZA 4PWKA 2E7FA 5GGRB 3PTKA 1DE4B 3KLAB 1PKMA 1S3TC 1IR1A 5TPWL 1J96A 4LVHC 1SGKA 3G6DL 2GBTA 5D37A 4MG4A 3S0PA 5FLUA 1UT2A 3CDZA 2DSZA 1OP3H 3V4VH 4A3QA 3U36B 1I3RB 2VC2H 4BFRA 3QMTA 1G5GA 1LO5B 3UWYA 2PD9A 2RTTA 1KCBA 5A5WA 4WNJA 4ZTPH 4D2JA 2QVIA 4LCWD 1ZNNA 2XFYA 3SUVA 3DFTA 4ZQOA 2WUBL 1EMTL 2CR6A 3LXCA 3E2QA 4ABVA 1A4CA 4KXZI 3RITA 4UT9L 3CU2A 3Q6GL 2G3JA 1Z9SA 4J3SA 1V5XA 4LBUA 4A3RA 2APSA 2Z1KA 3PIQA 1TMCB 3DX9B 1VA9A 5CZKA 1XBRA 2FBJH 2G60H 3K8LA 4WOQA 1FCQA 1CG9B 1TQCC 4HIJA 3DNKA 4S3BA 1MSSA 3GGWB 2VFEA 3QHMA 4P7RA 5TGBA 1DYSA 4PP1D 1JWUB 4YFEA 5DMKB 3AQZA 4M6OH 2A2IA 2V82A 5FAJA 4RNIA 3VNZA 4GA8A 3MJMA 1QSVA 2AGTA 5HPCA 1DQMH 1KIQA 4N25A 2C9XA 5GGVL 2B7PA 4DOHE 4OGZA 1I1XA 2ZYFA 3ZYJA 1JZ7A 2B1HH 3U0TB 2VDIA 5I1DB 2X6UA 1QNQA 2N3JA 1YBQB 2WZ0A 3GMQB 2EDNA 3AS2A 4ODUB 5FO2A 4HHLA 3M6DA 3MZ2A 1FSKB 3TEYA 4I5UA 3B4UA 1OY3B 2F58H 4JTGA 2D9QB 3NVQA 4MX7B 2X41A 4X2UA 3DI3B 3EG9A 2D3JA 2QVFB 2FJGA 2JE8A 3V5DB 1IILE 2ZNXA 2OPJA 1FFQA 4Q6YA 4TIMA 3RLHA 5CBBA 1MCOH 4GW4A 2Y8UA 9RUBA 3QQ3B 3S6TA 4X6EA 2WBJC 2XZQH 3WJLA 9CGTA 1Q1PA 1NFBA 5AHMA 1RQ5A 4UQBA 3Q48A 4YXHH 2XNAB 3QULA 5HDBF 3B5TA 5CZXD 3BDYL 4AQLA 5DEFA 5BXFB 4YVXA 4PB3A 1QFPA 3EGXB 4HW6A 1UYQA 3TIDA 4J12A 1WA0X 2XN0A 2VC2B 4OZ4A 1W0VA 5CEXA 4CBPA 4Y2OA 1E4LA 2YDQA 4TR9A 1EC8A 1JCXA 4PJ9A 1IVLA 3MHGA 4XNYL 4GOSA 4Z23A 1OWRM 3BVNA 4XZWA 3VPLA 4HALA 3GDKA 2N01B 4RETB 3QHOA 5BU9A 2YD3A 4J3UA 3KPNA 2KT6A 3BSZL 4FFYH 4Q6IA 4WEUD 1W9DM 1M03A 3SAZA 3K8MA 2VDKB 2NYYC 4R96A 1X1NA 3M7FB 1MCRA 4XPBL 3M1CA 1GPOH 2A6JA 1XF3B 4LEOA 4B5NA 3INUL 1MCDA 3TJEL 4M4PA 3I6EA 2X1TA 4GIPD 3QJUB 1G7MA 4IS6A 3WEXB 3L8QA 1S7RA 3EFFA 4I7WA 3G9VA 4M6MH 2CIIA 2VDOH 2Y69B 3C09C 3EO9L 1U1UA 4JDZA 3IMRA 2IQ9H 3NRQA 4J4PA 3M0LA 1AZCA 3HBLA 4DUWA 3UYOD 3LDBC 3GS4A 1J0ZA 2X1PA 2WIIB 5LXEA 2DQTH 5F7MC 3DGDA 4HHMA 15C8H 5I1HL 4WWKC 1QUNA 1S5HA 4HQVA 2YC1B 4H44C 3CO4A 2Z7ZA 2PO6D 1ESWA 4X9GA 3L08A 4UTHA 3H2MA 1RZKL 1NCTA 3OHXB 4JJHA 2C14A 2BVOB 3OC5A 1PX4A 2RGLA 1X9QA 1CQKA 1SLUA 1B88A 1SN5A 4L3CA 5LVEA 1E71M 1JGLL 3C8FA 3WE1A 5CPSA 2Y1AA 1EGZA 2CZVA 1OZUA 3ZDYF 2R1MA 5F9WC 5J1AB 3SCMD 4PJDB 3TZVD 5C0CA 2EE6A 4P4RA 3FOMB 4OLXL 5IM7B 1XB3A 3UTSA 3EBHA 3T3MF 2BH0A 3EH5B 3EXLA 5HSFA 2WC4A 3TDFA 1RALA 2FDBP 4CL7A 3PJSA 1ZSDB 4PJEA 4WUUE 4GQ9L 2O6PA 3SCWA 3A13A 3TCSA 2C1GA 3MX0A 1XPYA 4R2GB 1XRVA 2YL9A 3T3PF 1YN7B 5I73C 4PLOB 1R47A 5LQBH 3O4LB 2ADIA 3MLYL 4NRYA 4A66A 3BLEA 1Z5YD 2OFQA 4EJ1C 3DRQA 2OWWA 4P61A 4V33A 2NX5B 3GG1A 1TTBA 1LLWA 1OIFA 2NY2C 5EEXA 1PAZA 5GXBB 1E0TA 2XWXA 2ZVRA 4R0LB 4LVBA 5LXGH 3LXUX 3P2BA 1BF6A 3VGAB 4XNXL 4MWAE 2VM4A 5C9UA 1GQLA 7PCYA 2QVTA 2YAPA 3NTYA 1JGEB 4GQZA 1S6NA 1KXTA 2VLJE 3TNBA 5HJYA 2VDOB 3RR1A 2CGZA 4JFYB 5A8OA 4PW9A 2CBVA 3DHPA 1BYDA 4DH2A 4GMSL 1K5WA 2RAMA 4F24A 3MNZA 3G1SA 2A6KB 4LSQL 3G2GA 1S2VA 3W7KA 2R2CA 3V6OA 4PMXA 5KZCD 1EP2A 5C0GA 2NY1B 3IWPA 3D4ZA 3HNSH 4PVNA 4YXKL 3B9KB 2WQPA 1VF5C 1IBDA 4BF5A 4PJ7B 3LRLA 3CHQA 1AZNA 2FVNA 4NXSA 5DC4B 4QG9A 3QEGL 4WDTA 2GJRA 5A8GA 1V02E 3OZ9L 5KVGE 4LVOC 1I1YA 1J1OL 2BP0A 1UWSA 1KCVH 4EIVA 1VBJA 2BP8B 1S7VA 1SEBA 3OPSA 1N0LA 3FKKA 4KQNA 1JDCA 4FLRA 1FN4A 1FCUA 4CADA 3SIKA 3MYPA 4W9ZA 3W0WA 5IB5B 1BVKB 4HNCA 2J9ZA 1DIOA 4XH2A 3AG4B 4MCMA 4YPGA 3S34H 2ED7A 4ZAKD 4YYCA 2PDUA 3T0TA 1C5DB 1HFBA 1G7HB 4TVPE 3K6SA 5T5FL 4JM2C 3H1ZA 3A5VA 1W5PA 1PSCA 1ZLWH 4F2FA 4ZTOL 1GGUA 2VAJA 3WLNA 4PB0H 3GTTA 3FSUA 3QUMA 1B2YA 4W9EC 3CJJA 3W2DL 3VIOA 1EXUA 2OXGA 3CSBA 4ZBJA 4UT6L 5IQLA 1BBJB 4D9QD 4QLLA 3MJ9L 2Z27A 3W71A 1I9RH 1PX8A 3BK0A 2O61A 3V7MA 1OF2B 1P4LB 2R6OA 3X1FA 3L3JB 3QW3A 5FDWA 1T21A 3VG0H 2LOEA 4QHPA 4AYFA 4C6QA 2WSPA 3MHZA 3LHVA 1FH5L 3D46A 4YAQA 3UX9B 4NQCE 4GSRA 4QQUA 5G1TA 3MHFA 4FQLH 1IARB 2IPFA 3MNWB 5LHFA 3PWJA 1KRCC 1FHNA 3CIVA 1PCWA 2W65B 1Q6GA 4OI7A 5DT5A 3W9DB 3QV9A 2VXTL 1ZLVK 2J27A 4PR5A 4BSWA 3MRGA 3URAA 4PJXE 4JVWA 2EKSB 2IH1B 2ARWA 1UURA 5IMLB 5K9OA 1OD9A 2G75A 4AQAA 3K91A 1JPST 4DP5X 1CR9H 1DQDH 1D5BB 5FA5A 1DPMA 3LM7A 3ZT5A 4IHBA 2O30A 1PWMA 2VLLB 3MMTA 1WFTA 4MRBA 2Y1ZA 3PQYD 2P8MB 1UHVA 3GSUA 4ZFMA 3SO3B 1ODUA 3CHRA 2K4WA 5DBUA 4KHXH 3ISYA 1RCQA 4MFEA 4F66A 4H4NA 4AWUA 4RBPH 3K3QA 2CRYA 1IWPA 1LOSA 3DG7A 4OT1L 4XPFH 2HKAA 3VJ6B 1OAZL 3KWSA 5XIAA 5F8RC 3S88L 1YECH 4IU3A 3TVAA 2ZKHL 1RJCA 5EBLB 5D70H 4H1LH 4J1UB 2IXVA 4N9OB 3EB2A 2QCDB 3GMMA 4OLZL 4RGNE 5LB1A 2XWTA 1KWKA 3BPWA 4WR3A 3B04A 3GKWH 2EECA 1U8QB 3KHOA 1ZHNA 5H8DA 4JPSA 2HBVA 1FNGA 4PMFA 2OLSA 4P8XA 4MNJA 2I5IA 3IF1A 3VX1A 4ACYA 2G2PA 2HPMA 3FQTA 2ODHA 1MXSA 4CAGA 1HXMB 3VA6A 3VFPA 2N0KA 3L3DB 4NO3A 2J6EA 4QTHA 4LBRA 2PP9A 1EJVC 1MMFA 3TO2A 4BK5C 3F7YB 2Z92A 5BMXA 1Q0EA 2DIAA 1BVNT 3X1EA 3S4TA 5IEHB 2WCSA 2ILLA 4LCWA 5IIEA 4OJDH 2ERJC 3GIZL 3CN4A 1E9QA 3KBFA 3TBVA 1X5YA 3CZUB 3LIZL 4WOZA 2EKCA 3AXMA 4AVIA 3OV6A 4HAKA 4G8AC 1GYVA 3SYQA 3T8VA 3OU8A 5MKGA 1UBSA 2XRAL 1G9MH 2QQ6A 5I6XC 5E4IA 1LL4A 3D39A 4QRFA 1W8OA 2Y85A 2G37A 3OYZA 3IMVA 1KCSH 1FFTB 4A7UA 4CVWA 3ZRFC 3HB9A 4WRLA 2ZRZA 3CWHA 3QLDA 1EBAA 3WDJA 1J01A 3PG8A 4XN4A 1TV7A 4OOZA 5FKAB 3QARA 1L7TL 4NJAL 5TNVA 4FKEA 3OJDB 4PVMA 1KNOA 2VM9A 3MR9A 1YHPA 3MROA 4PJFF 2XUWA 4ELMF 4DZHA 4BELD 1EVUA 3BWUF 1XB8A 1TVNA 2BERA 1GVRA 2J8TA 4O02A 4YHPA 5BV7H 4HKJB 3HZKB 4PBGA 3WQ4A 2C1HA 2XSBA 4AY1A 3CBWA 1MJJA 3BQUC 3UP6A 3HMXA 3SO5A 1VENA 3PWPB 4ZUTA 4XVJH 4PCTA 2G4EA 4GXUN 4L61A 2VLKD 1KTRL 3O2DL 1HZKA 1UM4L 6REQA 4UDUA 1OZQA 4LCIL 3QEQB 1AI1L 5DJYB 3CVIH 1FGVH 4WUKL 5BW7A 1GZJA 5AVUB 5KWYC 4BGDA 4HA0A 4MQ7A 4GRLC 5HUOA 3FSAA 3WFBL 1MUJA 2ACRA 1JUFB 1OC5A 2HCZX 5I3GA 3RPIA 3PV6B 2QSCH 5F7DA 3ATBA 5CHNB 1MSPA 3OX8A 3HR5B 3AWFA 1QRNB 3QM3A 1KIUB 3Q45A 4CU8A 2AJUH 3VRIA 5E6SB 1P7TA 2BGSA 5F0JB 3CPGA 4GJTB 4DIXA 4G6JL 4HJ0C 1MRFL 3GW0A 3WFEL 3WQOA 2JNZA 1E43A 5L7XH 3LGEA 1RY8A 4HS6A 1PPIA 1XAKA 3V10A 1A14L 3VRLF 1X7QA 4ZPVA 1MNUL 3QGVA 5A69A 5CSSA 2CHNA 1ZV2A 3Q2NA 1L6SA 3BUQA 2YBGA 2CESA 3QO0B 3FQWA 2CU9A 2K70A 3BXNB 2HVOA 1ZHLA 1B4LA 1G0YR 1DVJA 3LQMA 5DRXB 3NFPA 5GGSB 4PJ8C 2A2QT 4LHUA 3O3DB 4HK6A 2JQXA 3AS0A 5AAWA 5AKSA 2W95A 5AYUL 2DLTA 3TJHC 1FXQA 3E3HA 1MAMH 2QGEA 3DJRA 4AQ8A 3FTGB 1A4LA 1FFOA 2R69A 5BV7B 3MCOA 1SFDA 4E8CA 2WK2A 2HBXA 2QYGA 3GC2A 2GIXA 3SCTA 1Z42A 2PO6A 3DO4A 3QIUC 3LD5A 2FGBA 1F90H 4QS5A 1NVMA 1XR2A 3BG9A 5C07E 5AZEL 3EF4A 4LP8A 3OKLA 3ZM8A 4LYRA 3CHDA 3P2TA 1IAKB 1ACXA 2O4MA 2N56A 3SJVD 1A6UH 1N59A 4XC1H 5L8LB 5E4EC 3ZDXE 1XCFA 3IE9A 1WS7A 4LS2A 2XA8H 3P69A 5I6NA 3B4YA 1L0XA 3L3KB 2H8PA 5MP6L 3UPRA 3MRHB 5DD3H 5JIKA 2UWEB 2OZTA 3OKYA 3K46A 1FRGL 1JZGA 1CD8A 1AS8A 3QQDB 1E5AA 3IFLH 3KP0A 3WMSA 4FNRA 1X5FA 2IALB 1MY7A 4GLRI 3LD8C 4KQ0A 3KP1A 3OO2A 1G1YA 3HRPA 4QTIL 1BWWA 3EIFA 3L4ZA 4OF8A 4GSXA 3OAYH 5IEKA 2LR4A 4ES9A 4FFVC 4EF8A 4GSDH 3HURA 4Y2LA 1U8OB 3SYOA 1KB5L 1DE6A 1V8EA 2VN6A 2J77A 5FUZL 4GWEA 2DQMA 4Z3IA 4DAGL 2G3IA 1CFSB 4RK8A 2ALDA 1CENA 4IW4C 2VEKA 1R3LB 2NSXA 4BFKA 1H7NA 2CDGB 3TT1L 3TCLA 1E0WA 4UFHA 2RH9A 2ROXA 4JO8A 5CP3H 3RHGA 2X40A 4HX1B 5DJ8B 4GRWF 2ZTJA 4IPNB 2EEXA 5BNKA 4LU5H 1DZ0A 4EN3D 3C2AL 5MEPB 1EZVY 2WLIB 5I1JL 1F56A 2SFPA 5HJLA 2CWRA 1T5AA 5H8UA 4ZMVA 2JALA 1CTMA 4GAYA 5EOTA 2WNKA 5F6IB 5ALBH 4JRXB 1NAKH 4R3UA 1QT1A 3L2LA 1XBDA 1A9EB 3ZBMA 4NC0B 1UG9A 1VFMA 3QDMD 1P7KA 5K5YA 3IXAA 4P5TD 3BW2A 1US3A 1NEUA 3S2LA 1XP3A 3HZYB 5F70A 4W9DC 4YX2H 4RNRB 2Q7AA 3N44F 4M3JA 1KEML 3N41B 5FWRA 2KMWA 2F7PA 1V6XA 1ASQA 1JZ4A 3ALWA 1KIRB 1IE5A 1X3DA 4WEVX 4NM8H 4S11A 1YY9D 5T26A 1ZPTA 3FSTA 3ITGA 2P50A 4WW1A 1SO4A 5CZSA 4MQSB 3X3FH 3U0WL 4HZLA 2PTTA 5A7EA 3PZMA 4Q6XA 2FVKA 1QWKA 2ALRA 3UYCA 1T1ZB 1GQNA 2Q3RA 4Z78A 4APQC 4XTRC 1YMHB 2FX9H 2DJXA 3SCSA 4K1GA 1NBZB 2N7SA 1EFZA 1KACB 2J1WA 2VAAB 2O92A 1OGSA 1YYLH 3O9WC 1E0VA 5C0AE 2JCCA 4U5KA 5I6OA 3EMZA 4KROC 1ZV5A 4GNVA 1GG1A 3WF1A 4LNCA 1N82A 1A3QA 3FONA 2NSOA 5JBDA 3BURA 4N8UA 4GG6F 4OWGA 4U3XA 4M5SA 1U2CA 5FCUL 2EIKB 2A38A 3DO3A 3CFBA 3QJXA 4GLRH 3QHZL 1G6RL 4H6KA 4CQBA 2H3DA 1YRRA 4N4YB 1IHIA 4NQTA 2DS4A 3JVFC 4WK2B 4NKIL 1S9WA 3GSNL 1Q9LA 2VABA 4YBHA 1MF2H 2R29L 3GJFK 1V3HA 4XCEA 4FNPA 2WYSA 3HZMA 4UWMA 3IMBA 4G8IA 4LS0A 5DK2A 3CWGA 4FTVB 3U4AA 2WWKO 5EUKA 3R2GA 3U2IA 1DFXA 1TTAA 5C08A 3SOTA 1JZ6A 3CLEL 2G4GA 3HMJG 2WHJA 2WSDA 4TNEA 3SQLA 1FIEA 2JWYA 3VH8G 1K9FA 3WUFA 2XZAH 4LF3A 3CN2A 3OAUL 1URLA 2PDYA 3FRPA 5B39B 1GS7A 1ETJA 3C8DA 2R8SH 2XYLA 3VW3H 3NOIA 1IYXA 2KZWA 4RE4A 2F53E 2E47A 1CD9B 1DDTA 4E9YA 1CN4A 7A3HA 1Q8AA 2JKTM 2DLHA 4NJ9L 1CFTB 3PQYA 1FDLH 3CZFB 4MD4B 1WDAA 4ZW7A 3MBWA 3WN5B 4GBXD 1U1JA 1MVYA 2BP5M 5H8MA 4YDKL 3CVHH 3T0BA 4GKNA 1DVFC 3QXBA 3RIKA 4PWGA 1MH5B 1YAIA 1HQTA 2XKNA 1EXHA 3Q43A 3B8IA 2JF6A 1JXFA 2DT1A 3GQYA 1G0XA 1FP8A 2EF9A 4NIYE 2GJPA 3KYOB 2G95A 3VFUB 1N4XL 1IGCL 1P6WA 3MA9L 3T0VA 3SGJA 4KKCD 1EEQA 1QASA 2FJSA 3B8VA 1PWLA 4QY8B 3TE9A 4PMUA 4CGTA 4MNGA 3BW3A 1BKHA 1MCIA 2PC8A 1EUNA 3WNIA 2YMOA 1TCDA 1SQMA 4A4AA 1QA9B 1DQJA 1WAEA 2CM6A 4QG8A 1L7IL 5CPQA 2W5FA 3PNZA 1G9EA 2FR4B 3QYSA 1WAAA 4HISA 4G1KA 2F5BH 1H5VA 1PQZB 3IDIB 2A1WL 2UY6B 4XGZB 3LKOB 1EEYB 4Z7QF 4HC1H 4LSUL 4DPCX 2BIMA 4L8BA 3VRJA 4IHCA 4N5EC 3BV4A 1RIHL 3PP3K 2AQRA 4NZTH 4TQIA 4O1FA 4KEUA 4FF9A 1XUZA 2LABA 1KZQA 3I9AA 1N5YH 1DWJM 3WKYA 5JHDE 3UBXI 5FKYA 4L3AA 4Y9CA 1SPDA 1DWAM 1MXDA 4D8OA 3P61A 5D96B 4IKIA 4NBXB 3US9A 4X0KB 3SDDD 2VDQH 5LIKX 3RVTC 2E6YA 1A25A 1YPZE 3GNNA 3N2OA 4GP8B 3VKJA 1UR2A 4L4TA 4NT6A 5GISL 3MOAH 4FFWC 5KBDA 3FU7A 4QRTB 1WX0A 1NJ9B 3DIFA 1U8LB 1FZOB 1JGIA 4WFGE 1NSNL 3W57A 3FAXA 5IOPA 1YEJL 3ATAA 4UZGA 4MKNA 3AQXA 2B2XH 2OTWA 4OLEA 2Z24A 3O45B 5F3HB 3SZKC 3ILQC 3WS6C 1PY0A 4K8RH 4MA3A 3BVWA 1EFXD 4R7WA 1N2RB 1ISWA 4BR1A 3CVHB 2YPVA 4Y4KC 3AMLA 2ZCKH 3QUYA 5L4JA 2VXVH 1B4JL 1HWWA 2NUTB 1JGUL 3W7OA 2HSIA 1USQA 3L4TA 4UMCA 4R26H 5FFLA 2VW6A 1QWNA 5F93C 3KCWA 2FWUA 2VLKA 4P7OA 1E90A 1WA1X 2DQIL 4BQ9A 5SWZE 3T4AB 4DOHB 3VI3F 3VWKB 4ADGA 4KRPC 4KMQA 1U58B 1QO2A 1AYRA 3ERXA 5FUOH 3CMOH 1TPC1 1S8DA 2W1NA 4ILDA 4DPRA 2IQTA 1CGUA 1XCQA 2VWSA 4MYWB 1AQ8A 3L65A 2VDLB 2J66A 5EORL 3NSCA 3FDWA 1AGDB 4LSSL 3VFMA 1MNZA 3MRDA 2CQVA 35C8L 4GKZA 1GYMA 4I2XA 1CTNA 3PP4H 5EOQH 3EAUA 3HUJE 1SJXA 2TRSA 2DSWA 3G6JA 1U83A 1O6VA 1ANUA 5D9PA 4AZ8B 1PSKH 3RA7L 3AMKA 3AMCA 2IH8A 4F2ME 4TTGA 4OVUA 3KW7A 4AQEA 4RISH 3F4NA 4XV0A 1SBSL 3R8HA 1D9EA 2WTPA 1ACYL 3B9DA 2RGMA 2OX5A 3VI4A 2C7FA 4KI5E 2XTJD 2JEPA 4I4WA 3BUYB 4L29A 2QCCA 2WGNB 1W1VA 4Y9BA 3KBWA 5FJUA 1I7ZB 5E5MA 2F7OA 3CC5A 1B2WH 1Q90A 5LJYH 2H9GA 4UB0H 2FEEL 3UC2A 3V4PA 3CSTA 1EDGA 3W7RA 1OTSC 3DSFL 1CLCA 4WI0A 2VDQB 1A8ZA 4MCZA 4YNYA 4TQTA 4KUZL 3VIKA 3IU3B 1UXSB 1KW1A 1A1NA 3BE1L 1QI2A 3O6ML 4QCEA 3NEXA 4UM8A 2W6RA 1E1FA 4G2AA 1QPXA 5HNUA 3WK0A 3WLMA 3MRBA 1K4CA 4PJ9D 1Y18B 4WNQB 1GYWA 1LEGB 3MKVA 3RU8X 4L9LA 3U1PA 4PG2C 5TDPA 4HKPA 1ZT1A 4GFTB 3L4UA 4S3EA 4PN6A 3REQA 2E09A 1NFKA 2PB1A 1GOMA 2P80A 3CUPB 3J07A 3C8NA 5JMUA 2O0TA 3MY9A 5C9WA 4FQCL 3H2PA 3DBXA 2EJAA 1MZRA 2PCYA 2UZXA 2BY0A 2RACA 4L56A 1U5JA 3DI2B 3HHMA 1BZ7B 5KN5B 4P2RE 3W6MA 4G80B 5DDHA 4QOKB 1NFDE 32C2A 2ZG1A 3ROLA 1ZS8B 4OIAA 4KERA 3RTQC 3VSTA 1WDQA 3ARRA 2WXKA 1YUKB 1G9NC 4C6FA 1BWMA 4J4PD 1AGFB 2WXIA 4ENZA 3PNRB 4WO4B 4AHPA 2JQMA 4P5KA 3D3FA 2OJEB 3TOYA 2FB4L 4H3DA 2CRMA 1G0DA 3F85A 1GW6A 2XVBA 1G1OA 5KVGH 1RHHB 4CN1A 3SDYH 3OP2A 3PB2A 3UZQA 2V81A 1UM5H 1ILUA 2WVSA 3VE0A 1TYGA 2GJ6E 2UWEE 1QO3A 4WKZA 5F7FA 4DF9A 3NO1A 1U3HB 2I9TB 1BBDH 2QHRH 3S35H 1RIVL 4CSZA 5F7BA 5HY9A 1NQ6A 4GIRA 4QF1B 2JJTC 3ZJ8A 3M5XA 1X5LA 1NWOA 2F6KA 3NH7L 3SY8A 1F6LL 3QOMA 3NURA 3BAWA 3NMEA 1FHGA 3BP6B 5C0CD 1F4WH 4WUUB 2VWTA 5CR8A 4P2QD 3UTSD 3L4YA 3E0FA 2BWGA 5B3JF 4LXFA 5C97A 2AJSH 1GRWA 2XI9A 1KFAL 2DFAA 1V6UA 3EH4B 4AD1A 1SR9A 3ZRSA 3QVAA 1UD4A 1I75A 2D7QA 1MAJA 4FX7A 4ZODA 4JHAL 2RDXA 2H3NA 2JLPA 5D7JD 2QQKL 4Y9EA 1TITA 1LQAA 3ARGD 4EN3A 5IHRA 4K3DL 5DHDA 4K8EA 2X4OA 2NVAA 1LE9A 4OLVH 5HVWA 2CO7B 1WDSA 4FEMA 2EDDA 5DVOA 5J7CC 3EJZD 3T9WA 1J0YA 3MBEA 5AW2B 2EC9T 1MLBA 5LGJB 4BZ2L 5CSZB 2OWXA 3FUIA 3FCSB 4OU3A 1PIFA 4MWAB 1KTKE 1V6VA 4KTDH 1WDDA 4IDJH 3QDMA 3RYSA 4EQ2A 4HU0A 1BZDA 4O11A 3ZL4L 2VLJB 3MUGB 1KTLB 5LN8A 1JYNA 5G4OA 2D73A 5D9SB 3A67L 4CILA 3X14A 4DLMA 4X8GA 2FQFA 5TIMA 3CFUA 1OARH 1JWMA 2F8OA 3KH3A 5HMSA 2IPKA 1S3KL 4DBSA 1U8HA 2W38A 3TEXA 3LMJH 3II3A 4MUZA 5IT2L 3PAZA 2C19A 3MRPB 4ZQCA 4O2EA 5J6HA 4NJGA 5HBFA 2XPZA 4G9DB 3W72A 4LPWA 2Q5BA 4HWBH 5F88B 4JDYA 1DHPA 1GOHA 1TQWA 4UQIM 5E9DA 3O2VL 2EYSA 3AXLA 1TVHB 4AL8H 3GSXA 1XBYA 3C87A 2D03H 4YHKL 4GY4A 3N9KA 5EU3B 3M64A 3HNTL 3EJRA 1OZMA 2PLMA 2QR6A 2CXEA 3TASA 5I1IL 1EEZA 3PFUA 2J1KA 5JOPD 3MLTB 1NLBL 2BSLA 4UANA 1NCWH 1WISA 1ISZA 3QW4B 3JWNG 1EWDA 3HS0C 4J2MA 1NCAL 4DRSA 4OZHA 3T09A 4M7LL 3W0WD 1MZHA 3QJAA 4J2QA 1IL1B 2X89A 5CC5A 4XPHL 2Q3AA 5EN2A 3M5ZA 4JAMA 1I7RB 2AXFB 3MPCA 4XAZA 2Q2LA 3QO1B 2A4EA 4PWFA 4IIHA 2X4TA 2LVCA 1K9EA 3R58A 1M65A 3EJYD 3LH2L 4RE0A 3V5CA 5LIYX 4MSSA 1WITA 2O9TA 2DWXA 1H61A 4G1NA 3R1ZA 2VQ1B 1RZ8B 4TV6A 2BSDA 3BG3A 3X2QB 2CBQA 4PJGA 3DHFA 3EOBB 3NZQA 2JI1A 2RB8A 5CBIA 1DSFL 2F19H 1EXGA 4HUCA 2DMKA 4EACA 3JWOC 5IVXE 2ISFA 2ADJA 4PJCE 3FT2B 1FA2A 1AH3A 3TU9A 3AISA 4M62H 1A21A 5HMDA 4NQCB 3VCLA 1FHDA 3XINA 5ANME 2X88A 2BS9A 4FOKA 4H8UA 3SY1A 5BXTA 4L0YA 1SOSA 3HBPA 2CLKA 2PGFA 3BKJL 2MNJB 3ZE1E 1DJWA 1X5MA 3HLAA 1UQSA 3EO0B 3PSVA 2L4OA 3SQOL 4PJXB 1QBMH 4KIRA 2B81A 5EU7C 3UXLA 5DQ9B 4GOAA 4C60A 2I16A 1T22B 4ODSL 3S1WA 2CZNA 3CBKB 1QP1A 5H2ZA 4IJTA 4WKFA 5SWQA 3GHBH 4JPKH 4I9WE 1DVQA 1NEZA 4IOFC 3VM5A 5AWNL 2V37A 1BZEA 1MCKA 4RAUA 2AI0L 5H94A 3HI1A 3BGAA 3N43B 1QATA 1P4IH 4N0YL 1H49A 1EO7A 3HS8A 1AJZA 4KQ3L 3KTXA 4E68A 1V6YA 1BIIB 1EJ7L 3KPQB 1M5WA 2DIEA 5G4WA 5LHEA 3GRIA 3P6LA 3TCXA 1GVQA 4DNHA 4FG0A 1OD7A 4D0BB 1IT0A 4RGNB 1V27A 2YPLE 3UO8B 5FGBA 4PJHF 2EBNA 4Q4EA 2FZNA 3IVSA 3BLKA 3HPJB 5AFAA 5K2ZA 3KPRD 1IM9B 4Q6JA 1KC5L 1G7VA 1GSMA 4Y8FA 3P3SA 1U8IA 1DIKA 1OX6A 1JERA 4TTUA 3UMTA 5D4IA 2FB2A 2WHKA 1FWDC 2VRQA 5FJOA 1GGYA 4P9HC 3NZPA 3P77B 5DT1H 1V0MA 2YR1A 4XBPB 3QG6A 3ARED 1F4HA 1TZHB 2V5JA 3SDDA 1S5WA 2Q02A 4XZBA 1H5BB 2P48B 5BVJB 3MJ6A 3ORWA 1Q72H 5D1XE 1AHKA 1PX3A 4E9TA 1Q63A 2C1PA 1NCBH 5D93B 4B9JA 2WM0A 1F4XH 3W6YA 2QTEA 3G0XA 1TJIH 2QELA 4YJZL 2W0FA 1N0XH 1U2YA 1AIFA 2VXUH 2GVJA 2J88A 3G5ZB 1LMKA 2DMHA 1E9PA 4O16A 4GZEA 1E4KA 1F61A 3TYEA 1IZJA 2J2ZB 2NY3C 2PDFA 3WH7A 1EFXA 2OAAA 4JEQA 4F9DA 4G9FA 4MXWL 3FUKA 2J7DA 5K39A 3D39D 4AXNA 2WLYA 3SSGA 2ZNWA 3UAJA 5IQ9A 4WGWB 3N25A 1SF3A 4PWHA 5TFSL 2PW2A 3GDRA 3P74A 4R9OA 3OAZK 4DXVA 4KV5F 1ZA3A 4UDTB 4G6KL 3QG7H 4NSKA 4IYKA 3ETBJ 3GDCA 1W1A1 2BV9A 2V0TA 5T33L 2E7MA 3ECBB 1KY6A 4XOBA 1BOYA 2E28A 3W39B 1OL0A 4OTXH 2J8UA 5IJCC 3M0XA 4R7DA 5DUML 1HJCA 4TF4A 5DS1A 3WJXA 1ZXQA 3UGXA 4HK3J 3BKCH 1TO5A 1AY1L 3GMOA 5AC4A 3OLEA 2B0SH 5TH2A 1JK9A 5GGQH 3GHSA 4GCAA 4Y4FC 2BIOA 3O8AA 2F8VA 4KXBA 3W11C 3WDPP 1FDJA 4ESKA 4TLKA 2YA1A 2UUDH 2QR0A 3WFAA 1XWVA 4OV5B 4XTIA 4M81A 2OULB 2E8YA 1WUZA 2F61A 5F1VA 4WIWA 4Z2JA 5BZDB 4S3KA 4PGDB 1VFBB 3N91A 1DO6A 2TSAA 4F2BA 3GC4A 4DZBA 5CD5D 4X9SA 3FSWA 2WMKA 3HC0B 2VDPH 1VGAA 3WDHA 4QLRA 3F7RA 5CIPB 4DWSB 3CO8A 1A50A 1TMLA 3RRAA 1KGXA 3RZCD 4QIUA 5CZTA 2YSSB 1DLFL 2V5MA 1CE1L 3NSDA 2W9LA 3G3DA 3GLAA 3JWDC 4Z7IA 4Y8AA 3V4VB 4D0DB 1QVOB 4YGVB 1AVAA 4JMXA 3ELQA 3KMDA 1QEWB 4Z7OF 4HUMB 5BWAA 5L8KB 5LNWA 3FCGA 4DQOH 3CFJB 3DK2A 4NI6A 4DEPB 2FZ9A 2NY5H 2AJ3A 4V1DE 2WZ5A 4MBRA 4HKBB 3P11H 3WIHA 5FEPA 2WP3O 4ZUVA 2ATSA 4AMCA 2ZCLH 1S78C 3FVDA 4OUEA 1DIEA 2AQ2A 4JN7A 4R90H 3MRJB 4XRCA 1E8YA 1HUVA 4JAWA 1ZFJA 1T8QA 3R6IA 3N2TA 1XHGA 3MTXA 2NW3B 3BUPA 3ES6A 4IOIB 2I9EA 3F4WA 1H09A 4LHUD 1MCHA 3NSJA 5CEZH 3MRCA 4JEGB 2WXQA 4FGMA 2GJJA 4OTKA 1I9CB 1N6QH 1AJ7L 4QOKE 3VFRA 3ZVVA 2I7SA 2HRPL 3UIZA 2QCHA 1HCZA 1I3VA 4NT0A 1FL5B 5C07B 1C7SA 5DD6A 2FT7A 2OMXB 5EO0A 2UZIL 1C3FA 2YZ5A 5C0QA 1S7XA 2CM5A 3ZDXB 3PZNA 1HH9A 1HSAA 3IDJB 3LB6C 5K9JH 2NZLA 3OJMB 1BQHB 4S3FA 1X4ZA 4KK6D 1HHIB 3LZOA 1P6FA 4Y16A 5E6ZA 4EX4A 4GG8A 2X0HA 4S1SH 5EZOL 3QIWC 5F0LB 1KXVA 5FK9A 1YPIA 5IVZA 5J1TC 3GR7A 4IGNA 5DEJA 3IGUA 4P2QA 2GJXA 4PL2A 1UC6A 4RH4A 1U8NA 2VUKA 4UQ9A 5CAKA 1FGNL 4CU6A 5KS9A 4HMEA 4MNHA 1YN6B 3UJSA 1RD6A 1SYSA 1EOMA 2DL2A 1UZDA 3LS5H 1EQWA 2IV8A 4PJ5E 4A2DA 3GZKA 4L3EB 1I60A 2VSMB 3QDGE 5D7JA 1XF2B 2H0EA 5CPLA 1UUOA 5E8DH 4KY2A 1VDGA 3P30L 4YWIA 3ARGA 4MDRA 3UPMA 2AHIA 3ABKB 2IPJA 2QJNA 3FQNB 3CIQA 2RHEA 2HAZA 4KKLC 2D20A 4LT7A 2CLLA 4IBWA 3FT9A 2RCSL 3F7KA 4LHUG 1R2SA 4JZNA 1IFRA 4L4PA 2JV6A 4GY1A 4KXAA 1A2YB 3GNRA 4N9GA 1E15A 4S1QH 5HGBB 4UU9A 1L0QA 5GGVY 3KBJA 4CEXC 3II1A 5DXWA 4BUQA 3X3GH 2J9YA 1LQ2A 4W70A 1Q0YL 5MF5A 4TTDD 4Y4HB 2O93L 1XDJA 5LNRA 3CSFA 3RR4A 4C1NA 1Z44A 2VZOA 4F15B 1UH4A 1FQ0A 1RFDL 1MCCA 3JT2A 2YRPA 5EFIA 1ADSA 2BMBA 1M3JA 4LK4A 4DN3L 4KPLA 4PIBA 2BDQA 4PR4A 5GIRB 5E9AA 1VH7A 4NERA 3ES7A 3BLIA 5AL0A 1NUFA 3U7YH 1ZPLA 4UBPC 2VISA 4DYJA 2F2KA 2BWQA 4PP2B 2XVPA 3GB7A 4XXWA 1W72L 1I8MA 4LP4A 4WFHE 5FKPA 3T8MA 3HI5H 4HOWA 4RQQB 4JQIA 2FATH 4JN1L 5IROC 2WWKT 4NNXB 4QWWD 5F4WA 2NY4B 4YIWA 5FDYA 3UNTA 1E6OL 3NZ8B 4NFCA 4G8FB 4Y19E 2P7TA 3ARSA 3CZGA 3SPVB 4NKCA 3NFNB 4JFOA 4UTMA 5C0AB 3VYOA 2CNCA 3WD4A 2EE9A 1T80A 1QABA 5BJTA 3PUDA 3OQ8A 3QQWA 5MHSD 1NMBH 2LVEA 4W9CC 4FEIA 2PODA 4XAPA 3M17B 5D02A 1JPKA 2QHLA 3GIPA 3CNYA 4ICNA 1AXTH 3UXAA 1BFTA 2VCCA 4RESB 3BEVB 4FIRA 3LIZA 5AB3A 1QI4A 4LUSA 2FQIA 4LESA 4E5XB 2FQEA 4Z8FL 3MUHL 1MWAA 4BF7A 4RMQA 4GO6B 1F73A 3M9YA 2ALAA 2BCKB 2Q7YB 3DXAB 1HINL 3OKNB 1MQ8A 2YKLH 2YLKA 3RGHA 5JPNB 4ZB2A 4MFHA 4F91B 4WD0A 1EPXA 1ZP3A 1X5GA 4PTWA 5DMIH 1OQOA 3TLLA 2OMWA 2W0KA 4HH9A 5H37H 1OANA 2W3ZA 1CGSL 1IMHC 2QDDA 3JV5A 5EMMA 3QAQA 4GT0A 1TWDA 5C08D 2PYEA 1QMLA 3CDYA 4ERSL 3LRHA 2JI3A 3VXQB 2F53B 5CGMA 4DZ8A 4L65A 4ZX5A 4P48A 3NDYA 1NGQL 2YQBA 4DGIL 4NPYB 2FZ3A 3ES8A 4KK9D 1HCYA 4YHNA 4EIBA 2QPXA 4FR1A 3NJIA 4CVZB 4I87A 3ILPA 4BH7A 2PP7A 3GTVA 4FQPA 2BCMA 2J62A 2WLNA 4ACPA 3L5HA 1E5YA 2Y7QA 2NZ9C 1RXOB 5D2VA 4KMTL 5F97E 3RVWD 4EXBA 3VD5A 4C7GA 2Q10A 3SOBL 1NCOA 3CV2A 3V1PA 2H5UA 2XA3A 4HU4A 1QDSA 5A6LA 3MLPA 3CEPA 3PP7A 1D9KB 1RY7B 1IKFL 5BOEA 5JZ7D 3M0JA 1TPVA 4OCWH 4XOEA 3ZPDA 3CHPA 3NCYP 2HEJA 3Q2VA 1YTDA 3MWCA 2ZWLT 1QNVA 3KPRA 5I2IB 3VXTA 2OMVB 4P5MA 4KCUA 2VMCA 4I5BA 5JO5B 3D1MC 3QZNA 4QMEA 1F74A 1SLWA 1VEPA 1DCLA 4TOYL 2WHLA 4JFWA 1BXUA 2DJSA 3WQEA 5T1DL 2GFBB 3VXME 3AREA 1O75A 1KPVB 3TYFA 1Z9NA 1ZXKA 5FS5A 1ID5I 4UUIA 3TBSA 4JY8A 2ZUTA 2AP2A 3ANUA 1J1XH 5HYJE 2QPFA 3LOTA 1F3JB 3RWDB 1AQKH 4PMQA 2NLJA 3IBOA 3CDCA 5HVHC 3UFYA 2UWFA 5EMLA 5ES4B 4NHUA 1TLMA 3PWAA 3QZMA 3UJEA 3D85A 3WGUB 1TOXA 3ULUL 5JHDB 4OQTL 3FRPG 3U4EB 3ITYA 4UTCA 1KFKA 4Z2KA 3DRTA 2X9ZA 1LO2H 3FZUC 3N14A 1QPRA 1YPZB 3RPMA 1L0PA 3MUUA 3W7QA 1U41A 2BOFX 3H2CA 4KQ4H 3KS0H 3X13A 4LCUB 1J1PL 3TJPA 4QRSB 5I19H 4ZZKA 3G3MA 3FNDA 4LSBA 1OK8A 3DA0A 1CS6A 2P44B 5EV7A 4FFTA 3UTTB 4L4TD 4LCCC 4LBSA 4V2BA 2QGDA 4HPHA 4KY1H 4A6YL 3C5SB 3B0YA 4BWUA 1KM3A 4OD3H 3VC5A 4ZFOA 2HRHA 2WAQA 3QZEA 1RIUH 2KUTA 2OKOA 3S3PA 2E6PA 4M6QA 4Y5XA 3PWLA 2XX1A 2NY0B 2NX9A 3KDPB 4LVAA 5JPMA 1CF1A 1HAUA 5SWZB 4XP1L 3UOAB 4GC4A 3EBAA 4O1BA 4BSVA 3QUYD 3IIVA 2EDKA 5I8EB 1A22B 4DPAX 4OZIF 7ODCA 1Z0NA 3DVGA 2EPHA 1GIGH 2Y7FA 1BVNP 2CK0H 4OBRA 2BK8A 2IDTA 3ZS4A 1T0MB 2WPBA 2X0YA 3DUHA 1XGYH 4H1LB 3UW6A 2E27L 3BP5B 2Z65C 4C8XA 2Y7LA 2NR6A 1AZUA 2NY6D 3BARA 2B31A 3TT3H 1EFQA 4Z1AA 1TUPA 3VINA 3HUJB 1MWOA 1EHLL 3DVFA 2HTLD 1EUUA 5AB1A 1MQQA 3OJGA 4JO3L 3B0UX 3CHOA 3RZCA 2BVTA 1ZT7A 4A1RA 4F2MB 2RQEA 1HKIA 5U4NA 2IPTH 3ARWA 1AL7A 3MACH 1EBGA 3STBA 1N67A 1CBVH 3RNKA 1HIZA 3ZE2F 3CXHK 1OGAA 1ZK9A 5BZZA 1YE6A 3HB3D 2GTZA 3B3BA 4PS7A 1MW3A 2ODIA 3CX2A 3DWTA 1CT5A 5HJBA 4HLZG 3R0NA 1FV1B 2V5KA 1XDMA 2FPTA 1JF6A 3G0UA 4AMAA 5IFAL 1AK5A 4GW1A 2DGAA 3I3BA 2F7IA 4I6VA 2NXIA 4WFFE 4H8VA 1KEGH 2C3VB 2PC4A 2G2RA 1DKWA 1RP8A 1P1ZA 3NA9H 4BKNA 2DJUA 2VZUA 3CSPA 3T2NL 1E28B 1DDHA 3B83A 4K5OA 3RX2A 3U0PB 2TAAA 4ERGA 4JFQA 3KD4A 2CHOA 2H6PA 1ML0A 2QIWA 4FQJH 4X22A 1IKNC 3ULVL 4H8QA 3I3EA 3U4BL 4P2RB 3KHQA 4MNQE 2QKIC 1RVKA 1LL7A 1OX4B 1VCAA 1NFDB 2R51A 2P80D 4AC1X 4JKMA 4HAGA 4AC2A 2Z34A 2REQA 1OK4A 3OG4B 1EK3A 1BFVH 2I5GA 1XIJA 3M1OA 2ADFL 1LL6A 5AVXB 1QFHA 3S2MA 5HI4D 4GFSA 1PFCA 3K72A 1H7OA 4NS0A 4LBEB 5AW0B 2PPGA 2OJZL 2VRKA 1OAUL 3TTYA 5IK3B 3QY6A 3QFGA 3GUGA 2AEPH 1H0DA 3PGFH 1VIZA 1QSFE 2CKBL 3WQGA 2NXZD 2GJ6B 4B3LA 1D5IH 3O6LL 4U1NB 2H2SD 3U6RA 4GH3A 4OV6F 4XP5H 2J7HA 5FOJA 3TWAA 5BZWA 2YRLA 5KUMA 2B08A 2JFCA 3BUVA 4WJ5A 1A02N 4I0PA 2WBKA 3CQIA 3DFOA 3TTOA 1W17A 1EIBA 1QFEA 3UYRH 4L3EE 5B38B 1WA2X 3HFMH 2A9DA 5BS0E 3LOWA 4N1CA 5DMYA 1KY7A 3IVKB 3IKCB 4EXPX 4MMWA 3UG4A 5DZJA 3F4CA 2M8XA 1XLAA 4GYBA 2HVNA 4P2OC 5FGCE 2XZCL 4LPYA 1TFVA 1TXKA 4PUBH 4A3YA 4J39A 3DOIA 1E6JL 3VCCA 5G2WA 3MLWH 1EF2A 5TDNB 2APXA 3WJJA 1Z7JA 5CJNA 2AJVL 4X6CE 1LUCB 3OVGA 4TNWF 1HHJA 2FGWL 3MLSH 3JVGA 1JZJA 1EJ6A 3U3HA 5CAYB 4RMUA 4TULL 4E3TA 3QHFH 3TBTB 1CFNA 1UZGA 3MBED 2OSXA 3QUXC 4F7CB 1GTHA 3MRMA 1R3JB 4HGXA 5PTDA 4QJ3B 2FLBT 2GIYA 4K2UL 5CEZE 1Y1UA 2DLFL 1DFBL 2Z31A 3NUKA 1FVDB 1NLDH 3VFTA 1YMME 2I60L 4GACA 3QC0A 5FB8B 2NQ3A 2JB6A 2R2HA 3BZDA 3D3VA 3TXAA 2DVUA 4FQHB 3UWEA 1CXKA 3RPKA 5GHWL 3WH6A 5KZEA 5E51A 3WTYA 1EQPA 3WJYA 4XB3A 4JFZL 2QEJA 2GW5A 1H8OA 3WO3B 1U8JA 3ZL1A 3LZLA 4I77H 1MJ7L 2V5TA 1RH8A 4L8SA 1BQLL 1WC7B 3UC0H 1IEAB 4LASL 2ZCGA 2EIDA 2G30A 4ZO6A 3KW3A 2OYKA 2QT6A 4O00A 1LK2A 1MI5A 4FNTA 5E9DD 5LIWX 2ZCHH 3JRKA 1TQTA 1UIOA 3SN0A 3LHPL 1N8WA 2DKMA 3SKOB 3T8XA 4N2HA 3WXWL 2CO2A 2OSWA 1TPXB 2BS71 1AYOA 4WSGA 3SIMA 1ZHKA 1ECYA 4U3HA 1J5CA 4GQRA 5D7LE 4X98A 4G7YL 2D0GA 3BN9C 1WGVA 3BVJA 3IIZA 5E2VL 2HDJA 4QEGA 2R24A 3U2ZA 3NJKA 3I2CH 2PXYC 4MM1A 2ICCA 4WUIA 3OGOE 1KB9K 3KR3L 1TJHL 4ML4A 3UABA 2X89D 4YPJA 2YD5A 3HC3L 1QTSA 7ENLA 4AYID 2AQQA 4BHUI 3GVQA 4BRJA 4S1RH 1JVNA 1I1AB 4UV7H 1NC2B 3DXAE 4OM1H 3H9SA 1W1YA 2E5EA 2C79A 4FXFA 2V9DA 3VFSA 3B5HA 4NQQA 4OB5L 5IVXB 1I1FB 4IZGA 5D8WA 4PJCB 3S83A 3WUWB 3MNDA 1A5NC 4RL3A 1R2TA 5DJXA 1K70A 4QQ3A 3KRZA 5ANMB 2WO3B 4OGQC 5CJMA 3U6WA 3NACL 4Q33A 1KBBA 3ZE1B 1PLBA 3LMZA 2Q2EB 4Q8VA 1XXDC 4HS8H 5AVZB 5TQ2L 1F2QA 3V8OA 1ZJBA 3U4KA 4A8NA 2Y0SA 1DO5A 4A63A 1Y5VA 4D0CB 3EGDA 1UKTA 4XVTH 2HJLB 3AAZA 4PRIE 5JMRA 4PVLA 1FLRL 2DBLL 2OQLA 1KENH 4HJUA 4JDEB 3DURB 4H8WC 2XV3A 4A2GA 3LSBA 2CUMA 1KN2H 4QRUB 4KO5A 2CCLA 2YFOA 2WLKA 3CPUA 5JHBA 4R4FH 2NUWA 5D4QA 3GBML 1I0DA 2X2GA 4PREB 2WOYA 2EO1A 4NZUH 3VYLA 3CT7A 1E65A 2ENSA 2PURA 3EAKA 2ZWSA 3W81A 3O3BB 3BQVA 2XXGA 2YUXA 1BZOA 1KRBC 3N42F 5KYYB 1J9SA 2X8RA 3Q5TA 5T1LA 4FN0A 4YS4A 2PGEA 1KIPA 2SEBA 1JFXA 5A2KH 1TPH1 3QDJA 3FIGA 3N9SA 1NEYA 5E4OA 2A3HA 4X9IA 2YPLB 2OB3A 4ICWA 2EC8A 4OBTA 3QZPA 1MRQA 1TJ0A 1UCWA 1BAGA 2CU0A 2CBIA 4W1TA 3QPYA 4H00A 4LWWA 4QGYA 3B37A 1F6PA 1GAFH 4QITA 2XOTA 4WI7A 2Q8AL 1NBVH 5H1WA 3L3OB 1J4EA 1TQVA 4EIUA 1LWRA 3A4XA 4QXWA 3LXAA 4PYGA 4ATWA 1XGQB 3SQBB 3DMMC 2MQGA 3IJLA 4XP4L 4FXRA 4MY8A 4W4OA 1UA7A 1WFJA 2PCEA 1ZZMA 2VGIA 3SY0A 2R0KH 3MRIB 2OEKA 5F9OH 4QRRA 3H8AA