3BSHA

Barley alpha-amylase isozyme 1 (amy1) double mutant y105a/y380a in complex with inhibitor acarbose
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
404
structure length
404
Chain Sequence
HQVLFQGFNWESWKQSGGWYNMMMGKVDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADYKDSRGIACIFEGGTSDGRLDWGPHMICRDDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDAWRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHRQNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVMGWWPAKAVTFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDHFFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKIGSRADVGAVIPAGFVTSAHGNDYAVWEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-amylase type A isozyme
publication title Multi-site substrate binding and interplay in barley alpha-amylase 1
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Hydrolase
total genus 127
structure length 404
sequence length 404
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-12-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF07821 Alpha-amyl_C2 Alpha-amylase C-terminal beta-sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bshA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bshA01
1HKKA 4NZJA 2YOCA 2QMJA 4W8LA 1MW0A 1QI3A 4CCCA 4AZGA 3AICA 4MDPA 3VIMA 3VX0A 3SCPA 3AI0A 3W53A 1VEMA 3LPFA 4KGJA 3K8MA 2F1AA 4PMVA 1E6PA 3OGVA 4U5KA 4FNUA 4JCMA 3L2MA 2F18A 2WB5A 4W87A 1UR2A 3GNPA 4OJYA 4HA1A 4AZCA 5IFTA 3B8SA 1W2PA 1GUVA 5E6ZA 1R7OA 2J62A 5JUVA 3CZJA 2EPMX 4IUGA 3ALFA 4UFIA 4CVUA 4JKKA 3UESA 3BAJA 1CBGA 2D1ZA 3NYDA 5KZ6A 1J0ZA 4PMNA 2XG9A 2OSXA 2F7PA 5A2AA 1V6VA 3FHQA 5I79A 2CBVA 5HOSA 3WBEA 2WZHA 2CITA 5E0CA 5DFAA 2ZWZA 4J3SA 3TTSA 1E6SM 2G3MA 2VCCA 4D6GA 4GXPA 3VX1A 1KB3A 1TQVA 2YFOA 4AZHA 4ACZA 3BAYA 4FNQA 4DM1A 1WCGA 4UOQA 5LA2A 4WIWA 2DT1A 1GNXA 1JI2A 1UQYA 1H41A 4GIAA 1SFSA 1BYAA 1MFUA 5A8OA 2O9TA 1W3HA 2QF8A 4RE4A 3GXFA 1CGYA 4AZ7A 3AIVA 4CN1A 1QBAA 4CU7A 2Y24A 3VNYA 4UFMA 5M03A 1XSKA 3TTOA 1SMDA 5BXSA 2WHJA 1HXJA 2VNCA 2DGAA 2V5DA 1UHVA 5BROA 4AYSA 2X8RA 1UD3A 4BCEA 3WY2A 3VM5A 2YLAA 3W38A 1VJZA 3CZGA 1ZBKA 4AD4A 4UOZA 4UNIA 1W1TA 4NXSA 2JALA 2WKGA 4LXFA 5E6YA 4M81A 1WPCA 2BXYA 4QLLA 1Q6EA 3L2LA 1E5JA 2PI6A 4J3WA 3VPLA 5D4YA 4IPLA 3ZT6A 1OGGA 4GZJA 1PS3A 4D6DA 2X09A 3CH9A 5D9MA 1H11A 3OZPA 2IGTA 2EAEA 3IAPA 6TAAA 4U2ZA 2FDMA 3K1DA 3U5YA 2ZX5A 1IV8A 4GZEA 2WVSA 4J27A 2JF7A 4J3XA 4C7DA 4J3VA 1E40A 2F8QA 4BQ2A 4PMUA 5CGTA 1WDSA 2Z1SA 1C8YA 2FGLA 6CGTA 2WZIA 4GO8A 4AIUA 1QI4A 4U3AA 4DO5A 1EQCA 2ZXQA 1G0CA 4NRSA 3BAWA 2DPEA 3RJXA 4JFSA 4HP5A 1CGWA 1FP9A 4ATLA 3TOPA 2A3AA 4MAZA 3BVTA 5I24A 3ZSSA 1CGTA 2OWXA 4K68A 4OOUA 4BQ5A 4UTFA 3CC1A 2C8NA 3BUBA 4PBGA 1BPLB 1W91A 4H8UA 1VENA 1PJ9A 2VR5A 1OB0A 3WDPP 1LQ0A 3WEMA 1KWGA 4HA4A 1QHOA 1UR0A 3BLPX 3MUZ1 4W89A 3DHPA 3F5JA 1R87A 4H8HA 3VIHA 1OBAA 1H3GA 1E55A 1VF8A 3LPGA 3AXXA 4YHEA 4FLSA 1UWIA 3AIUA 1TVPA 5I3DA 3A5VA 3VIIA 5JBEA 3EDJA 5AC5A 1R86A 4U33A 3L4ZA 1V3JA 4GQQA 3AHTA 3AS3A 3BSGA 1WP6A 3WNLA 3ZO9A 3CUHA 4JKLA 4W7VA 2FHCA 3EDKA 1C7TA 3EMQA 4M8UA 3A6OA 1JAKA 3IJ8A 1DP0A 1H49A 2EABA 3D4YA 4GI8A 2D3NA 2ALWA 3RMEA 2QPSA 5I0DA 3W0KA 2WC3A 2XSAA 4E4PA 2WC4A 1OM0A 4HOXA 1WZLA 4CD5A 1BG4A 2YL8A 2WVVB 1QWUA 4AWEA 5GNXA 3WQ6A 3PZMA 3A24A 1BVZA 1IZKA 1OGBA 1EQPA 1KR0A 4P8XA 3SUSA 1J9YA 3ZJ8A 3VD7A 1J12A 1W9BM 4P7LA 2YDQA 3HG4A 1UG6A 3NJ3A 1XSJA 1H5VA 1FA2A 3WUGA 1WO2A 4WKAA 3M6DA 1I1XA 4S3JA 2VVSA 2UWFA 3RPMA 4CD6A 2BHYA 4RL3A 1KCLA 2G3IA 3MSGA 3GNRA 1ITCA 2A3HA 2QMKA 4UCFA 4KRTA 3ZM8A 4OIFA 5TD4A 2WSPA 3MUAA 3BVUA 4P7RA 1QI0A 4A4AA 3ZR6A 1B9ZA 4UFKA 1PZ3A 1UA3A 4JZ5A 1GVYA 4LQ1A 2VRJA 3WD4A 3GTNA 2YL6A 2GJRA 1H0IA 1MFVA 4UFLA 4PMZA 3T2OA 2Y4SA 3RIKA 4FK9A 3W29A 1GW1A 2J47A 3SCNA 3O6AA 3GXIA 2XUCA 1H0GA 2GK1A 1UA7A 2DT0A 2DSZA 7A3HA 1B3VA 3EJSA 1H2JA 4HOWA 1WAWA 2DT3A 2ZX7A 1EO5A 3EJQA 4BZYA 3CMGA 2W63A 4TVCA 4CGTA 4XZWA 5EFDA 1ZU8A 1HX0A 1ODZA 2VO5A 3W25A 4AXNA 1CNVA 5AC4A 3CZNA 4GI9A 3CHDA 1KTCA 4UZSA 1UD6A 1W2VA 3L4TA 1X1NA 2VOTA 4W84A 2W4XA 2OYMA 5CPQA 1TUXA 5HBFA 4A3YA 3VGHA 2D0GA 3PZQA 2FHBA 2XGIA 4R27A 3VSUA 4DWSA 4HPGA 2XYLA 3CHEA 1QNRA 1TQTA 1Q6FA 5A6MA 3L4YA 4NXKA 3CO4A 2TAAA 1QX1A 3ZJKA 4GI6A 1RP9A 1SYTA 4AEEA 5A2CA 1E5NA 1UASA 3BLBA 1L0PA 4W88A 1US2A 1KGXA 1E6RA 2VZVA 4JFTA 3CBWA 4TXEA 2WCGA 3QHOA 1DHKA 1GQIA 1L8NA 2VQUA 6A3HA 1LL7A 3T0AA 1MQQA 4L4OA 3K46A 3AIWA 4PYSA 5AYIA 1JIBA 2VX6A 3N04A 4F9JA 1GHSA 4P8UA 1U30A 2PB1A 4U2YA 1NWUA 3K8KA 3GYCA 4AZ5A 1GOMA 3BCDA 3AIRA 2QHAA 3HMCA 5CQ1A 5BYWA 3FAXA 4DUVA 5LA0A 2E9MA 4FNRA 5LA1A 4HZ6A 2EPOA 1MW3A 2ZUWA 2XIIA 4TX6A 1C7SA 3APGA 1TZ7A 3B9AA 2XFFA 3LXBA 1V6UA 5DEZA 3W6LA 5BRPA 3WMCA 3WIJA 4AZBA 2CERA 3I3DA 5D9PA 2YLLA 1O6IA 2DEPA 1G94A 1KWKA 1JGIA 5ABFA 3WUBA 3CZSA 4A3HA 1BLIA 1HNYA 4KRUA 3RJYA 1DWJM 3IAQA 1VB9A 1WB0A 2VRKA 3SCVA 1AVAA 1W9VA 1EDTA 1V3KA 3CZEA 2VQTA 1QPKA 1UKSA 3BMVA 2X0HA 3WL0A 3WQ5A 2UY5A 2XJ7A 3EJUA 4PMXA 3FW6A 1GOIA 2VX4A 1ESWA 4TVDA 2GVYA 3GXTA 4PCSA 1GOWA 2CBJA 1V6WA 1UWQA 2J7DA 2WLZA 3A47A 4N42A 1GCYA 3MANA 3AMGA 3CUIA 1HIZA 4NX0A 4Z2IA 4AIOA 2DIJA 3LXCA 5ABGA 3WL1A 1G01A 2E40A 3SEPA 4WKHA 1HVQA 1HP5A 3WDHA 3VIJA 2DH3A 4UFJA 3ARWA 3GBEA 3OLIA 3AS0A 4OZOA 2Y5EA 3CHCA 1JZ5A 1JDCA 4P7NA 2J75A 2YJQA 1TQWA 1E71M 2BHUA 1MWOA 3EJRA 2CHOA 4W8BA 4R5EA 3QR3A 3IGUA 1NWTA 1E73M 3DX3A 1W9PA 1KXTA 1OIMA 4S3KA 2EO7A 3GBDA 2YL9A 2GJXA 1U33A 1OD8A 4FLQA 1HN1A 2YA0A 2CBIA 2WANA 3AS2A 4GZIA 2EXOA 4Y7EA 4F66A 4FF5A 5A8MA 4W86A 5BWFA 1HVXA 3PZUA 1LWJA 3NDYA 3N13A 3OLGA 2XIBA 3CTTA 1UR9A 2X2HA 2RGLA 1LL6A 2XVPA 3D3AA 2EADA 1Q6DA 4HMEA 3LX9A 3HG2A 1C91A 4D6HA 3MS8A 4H2CA 3SCRA 1E0WA 4E8DA 3ZMRA 4UZUA 2XGBA 3WNNA 2CBUA 2X0YA 3A23A 4TOQA 1NP2A 2QLYA 2XWEA 2D2OA 2B31A 2UY2A 4QDMA 4DWSC 3WDIA 2VVNA 1LF1A 1CXLA 3VSVA 1ZBVA 2V3FA 3AIBA 4HPHA 4AZCB 4V28A 1HKMA 1CDGA 3UR8A 3HN3A 2UY3A 1B1YA 2XM2A 3DX2A 1H4PA 2WMJA 2CIPA 3SCSA 3AJ7A 8A3HA 1HWWA 5EMYA 2VCBA 4NRRA 4EANA 2PBOA 3MUY1 1E70M 1CIUA 3BAKA 3DX0A 2VR4A 3TTQA 3WSUA 4NF7A 4C7FA 2X2YA 1G5AA 5I23A 1FOBA 1XYFA 4AC1X 4AZIA 4FMVA 3W28A 1W9UA 1VFMA 3CMJA 3GZAA 1DWFM 1CXHA 1ZBCA 1R33A 4P8WA 2PF0A 4YPJA 4ACZB 2Y8KA 3MV11 2XFRA 5CZKA 3S6TA 2XSBA 3VVGA 1W1YA 4PMQA 3DHUA 3S5ZA 5ABEA 1YQ2A 2NSXA 2WM0A 2A3BA 3VIOA 3CGTA 4PUDA 1ISVA 1F4AA 1OGSA 3ARQA 4X0VA 5CSYA 1UWSA 1A3HA 1B0IA 4U31A 5D8ZA 4NZFA 3RM8A 3DX4A 2WSKA 4B9ZA 3DDFA 5JIWA 3VGGA 4JL2A 2WYSA 1CYGA 4B3KA 3AOFA 3OBAA 4ML4A 1VFUA 4J3UA 2ZIDA 1JZ7A 1JXKA 4CCEA 4XZBA 4DM2A 4KGLA 3WQWA 1NH6A 3WY3A 4U5IA 1CTNA 3VILA 1N82A 3KLKA 1R46A 2DSKA 3VNZA 3PZ9A 3CIVA 5A6BA 2CPUA 3EDEA 4CVWA 4HZ7A 1QHZA 1UWTA 5A1AA 4W93A 4D6FA 2BS9A 2DSWA 1WNOA 1MW1A 2W61A 4GQRA 2ZOXA 3WD2A 4P7QA 1W3LA 1HKJA 3OB8A 1TFVA 5DT5A 2HVMA 1XCXA 1EO7A 2PWEA 4ZXLA 3AXIA 5CXPA 2ZUNA 3CUJA 2XN1A 1JFHA 3PHAA 2ZUSA 3B9EA 4E8CA 3QOKA 3BUPA 3LPOA 1FFRA 1ODUA 2ZXAA 3ZQ9A 4HTYA 1GPFA 1VFFA 1R85A 1EH9A 3GM8A 1FP8A 1BGAA 4D6EA 2XHYA 3VM7A 2Z1KA 3BCFA 3ARSA 4PTVA 3W26A 3BAXA 1KGWA 5LYRA 3WQVA 2CYGA 3QOMA 1XCWA 1GQJA 1UR1A 1V3LA 3A22A 2F7OA 1U2YA 1W3KA 3UERA 3AISA 1NOUA 2IXVA 1JL8A 1R8LA 1UR4A 4JHZA 1EDQA 3LPPA 4U3CA 5I6SA 2WBKA 5AY7A 2J7FA 3OGSA 1ZS2A 1ZJBA 3WELA 3HG5A 3AMDA 3II1A 2XVLA 3TP4A 4FNSA 1W1VA 2J7CA 2VRQA 1XRVA 3QHNA 2E4TA 4B15A 1GOQA 3CZLA 4BS0A 1CXEA 4M24A 1CZ1A 1AQHA 1UZ1A 1V0NA 4MB3A 2W92A 4D1JA 1LWHA 3LRMA 1KCKA 2WBGA 5IHRA 3VOCA 4Q22A 2BY3A 4AISA 4ZXOA 2BHZA 3AMCA 3ARZA 2VL4A 2EPKX 3G6LA 3EJTA 2DQXA 4JAWA 4D6IA 1VFOA 2IUZA 2ZUMA 1JI1A 5E0FA 1FFQA 4LGXA 2WHKA 3H53A 1BVNP 4AY1A 3ECQA 1G9HA 1R34A 3AIQA 2BXZA 4W8AA 2JEQA 1QWNA 3WKZA 3T0DA 3VINA 4CKQA 3OIHA 1E1EA 3ZT7A 2WK2A 3U7BA 3VDAA 1NOFA 1CPUA 1HT6A 1C93A 1T0OA 4PSPA 3WQ4A 2E0PA 4OUEA 3EDFA 4M82A 4MNLA 4AD2A 3VIKA 2XPKA 1Z32X 1D7FA 1CXKA 2W66A 2J79A 5A69A 3OLDA 4AW7A 4MNMA 3ZJ6A 1KTBA 3KL3A 2G41A 4UQ9A 3GH4A 1Y7VA 2E8YA 1J01A 3BVVA 3VO0A 2YIHA 1CLXA 3WNPA 3F5LA 2AMGA 1TA3A 8CGTA 2GDUA 1E6QM 2WWCA 4YHGA 4EKJA 3SCUA 1HJSA 1KBKA 2CKSA 2WMGA 3LRKA 2OWCA 4RE2A 4Z2JA 5HDRA 4W85A 2ZICA 1J0IA 5KEZA 5FCZA 4IPNB 2WPGA 1EDGA 2WVVA 2O9OA 3D5HA 5FIPA 3RILA 2J7GA 4CU6A 2EPLX 3MMDA 3EMZA 1NM9A 2NT0A 5CLTA 1UD4A 4PMOA 3GXNA 5CPTA 1KBBA 3FY1A 2ZX6A 4AD5A 3N9KA 1JZ8A 4CD4A 1K9DA 4KMQA 1E3XA 2GK1B 2JIWA 1J0JA 2ZWYA 2ZXDA 2WCSA 4PMDA 2DDXA 1QBBA 3POCA 1SZNA 1MQRA 4JHOA 3AMLA 3SUTA 1XH1A 3CZ8A 1OIFA 3PZOA 1GORA 4IM4A 4H41A 1J0KA 1HJUA 3THCA 5E70A 2F7QA 1VBRA 5M17A 3SUWA 3VKKA 4UQBA 4MB5A 1E6XM 3VGFA 2EBNA 1JYWA 3T08A 1ECEA 3WN6A 2V3DA 2FHFA 4ZEPA 2JF6A 1HXKA 4UFHA 2W91A 2D20A 4DWSB 5A8PA 5BCAA 5I77A 1O7AA 3NIYA 2YDSA 5EFFA 1C90A 1J18A 4M1RA 2D0FA 5GNYA 4WJXA 1TMQA 4CCDA 3I3EA 1CEOA 3GH5A 1B3YA 1D2KA 3VSTA 4OBSA 1M53A 4HMDA 4BF7A 1PIFA 2VT0A 1JYXA 3WQ8A 1SR0A 1V0KA 4M56A 2YA1A 3ARPA 3SCWA 4ZE5A 1OSEA 2CETA 2VMFA 1J0YA 1QI5A 1BGGA 4ATWA 1JAEA 1XGZA 2ZX8A 2J77A 3VD3A 1GJWA 1IZJA 3DC0A 5BXTA 1MXGA 4MTVA 1LL4A 1JF5A 4NI3A 4WSKA 2XVKA 1UYQA 4WK9A 4CUCA 1RH9A 2E9LA 3GXPA 2D23A 5BRQA 4PSRA 1XD0A 1JZ3A 1C8QA 1UH2A 2XVNA 2AOSA 2JFEX 5I2UA 1PBGA 1MQPA 2WKLA 1GVIA 4JL1A 4B9YA 3S2CA 2G8ZA 4MNKA 3SIMA 7TAAA 1MW2A 1KQZA 4QP0A 1JNEA 5FOOA 3SCOA 2WCAA 3SUVA 3PTKA 1MYRA 1W9DM 5C8BB 4PTWA 3RCNA 4WKFA 1XH2A 3BAIA 5M3WA 3ALGA 3CHFA 3U5UA 4XUYA 1WZAA 3FAWA 3VDHA 2PC8A 3L4VA 3WDRA 3AROA 4UR9A 2OYKA 1VBUA 2XN0A 3ARXA 3W37A 1X6NA 5HPCA 3U7VA 4H7VA 3VD4A 4Z2KA 4D72A 1DWAM 3AHVA 2UY4A 3WF3A 4W7UA 1DWHM 1VEOA 4HU0A 2J8GA 4PEEA 3M7SA 1KFWA 3N12A 2VX7A 3IANA 1TVNA 3ARVA 4HOZA 3M07A 3MU7A 3THDA 1GZJA 2J7BA 3AZTA 3EMCA 1AQ0A 1E6NA 3WEZA 2BVYA 5E1QA 5I5RA 1FH8A 1JF6A 2YBUA 4YN5A 2VZUA 2CNCA 1ITXA 1KXQA 2VJXA 2PBGA 4JCLA 3BXWA 1UWUA 5CGMA 1RPKA 2W67A 4GPNA 1XSIA 4J28A 5JBDA 1TR1A 1PPIA 1B3XA 5HNNA 5C71A 5C70A 4TUFA 2D24A 3MMUA 2JE8A 3D52A 2GSJA 2F1BA 2XN2A 3KZSA 4ZE4A 3N17A 4QLKA 1BF2A 2WMIB 1YHTA 2OWWA 1RD6A 2W62A 4FNPA 1HF6A 2A3EA 3ARRA 3WNKA 4AIEA 2DSVA 2VCAA 5FKYA 1KGUA 3VIGA 1GQLA 1E72M 1IT0A 1GONA 2DSUA 1C92A 3W4RA 2GJXB 4UQAA 3WD1A 1BYDA 3VD9A 5BXPA 3MMWA 3BC9A 2PWGA 2YKKA 3S5YA 2GUYA 3L4WA 5IXEA 4TVUA 3PZIA 1LJYA 1GQKA 2V3EA 3AYSA 5HPOA 3W82A 5A6LA 3GXDA 3GNOA 3WF1A 4FLOA 3W24A 3A21A 1W3JA 3H54A 1KQYA 4D6CA 4JFUA 5E09A 3AZRA 3BUQA 2IXUA 4B16A 1J10A 3MV01 1E4NA 3FHAA 3WUFA 3NSMA 2VTFA 3KL5A 2WXDM 2F7RA 1QNOA 5A6JA 2BY2A 3M46A 3ZOAA 1ZJAA 2CESA 1K6AA 2GJPA 2VX5A 1NP0A 3H55A 4KH2A 4TTGA 1HJXA 4PTXA 5CJ5A 1PAMA 4LX4A 1PX4A 4FNTA 2J4GA 1W32A 1CWYA 3PBGA 3VGBA 4N0RA 3BH4A 4LYQA 3AHXA 1QNPA 4UQEA 1DWGM 1WZMA 5IFPA 2J74A 2DH2A 2ZUTA 1BTCA 1XC6A 1EHAA 3CV5A 3KE0A 1H1NA 1ISXA 2BVDA 2WWDA 2V3GA 1HJQA 1NOWA 2J7HA 1CGUA 3A4AA 2EACA 4XB3A 1UH4A 3WD0A 3K4DA 3WH5A 5CPSA 1JG9A 5F7UA 3OZOA 3NDZA 3RO8A 3QHMA 2E9BA 2ZE0A 2WAGA 3SCTA 1CXFA 3OA5A 3KEHA 4ATDA 1CLVA 3CPUA 5A6SA 5AYBA 1WE5A 3LXAA 2X2IA 3N18A 1C3FA 2WVUA 1B2YA 1EGZA 4MADA 1TCMA 5FD0A 1M01A 3VIPA 1VJSA 1JFXA 1PX3A 4ZFMA 3T0BA 3CZKA 2ZUUA 3I3BA 4GKLA 1PX8A 2WC7A 2BY1A 3CUGA 2A3CA 3POHA 1R47A 4PRWA 2BY0A 4AD0A 2BVTA 3WY4A 1E15A 1XYZA 4F9DA 1CXIA 3PZNA 3VDBA 1OT2A 1H09A 1E9LA 4LYPA 1US3A 2GFTA 3K8LA 5DT7A 1OINA 3D51A 4P8VA 1E0VA 4M29A 1LG1A 3KWXA 3UETA 4PUEA 2O92A 1ZBWA 4UOJA 1B3WA 2BV9A 2D73A 5A95A 1ISWA 1BFNA 3N15A 1V0LA 3OGRA 4NSBA 1UQZA 3BGAA 1W9XA 3ARYA 5DMYA 1S46A 5M5DA 3CLWA 4AEFA 2C0HA 2F2HA 4KWUA 4ACYA 3JUGA 1HL8A 3EYPA 2DT2A 1D3CA 1E4MM 1KR1A 3WFZA 3IK2A 2YA2A 2XM1A 3T2PA 1VEPA 4TTUA 1E3ZA 4DO6A 3HG3A 4WLCA 3CUFA 2CHNA 1W1PA 3VDCA 3VTRA 1UD8A 3VMNA 3VU2A 1V6YA 1E1FA 1QNQA 4P7OA 1G1YA 1XHGA 4W7WA 3MUIA 1DEDA 2VURA 3EBVA 3NUKA 1QVBA 3A3HA 2MANA 7CGTA 3WNMA 1JD7A 3K4AA 4V27A 2WHLA 3VD5A 4JIEA 1E43A 4JFWA 1BYCA 4PN2A 2FH8A 3WBAA 1I75A 1Q6GA 1LG2A 2VZTA 4PMYA 4CD7A 1K9FA 4PMRA 4GO9A 2WZEA 1CGXA 1VAHA 1BYBA 2G3NA 1UKPA 4HZ8A 2YDRA 3ZJ7A 3KLLA 3LMYA 2CEQA 3WFLA 2D3LA 2OSYA 3TA9A 4F8XA 4CN6A 4C7GA 2XWDA 2Y8VA 4V2XA 1UD5A 3UG4A 1UKTA 4MNJA 3F4VA 2AAAA 1EOKA 4DWSD 4GINA 2ESCA 1HJWA 5GQBA 1TG7A 2YBTA 1BSIA 2HISA 1J11A 2FYVA 2J8FA 1FHDA 9CGTA 1ZL1A 1MVYA 1QW8A 4CD8A 5A3HA 1UD2A 2J7EA 3VMOA 5HXMA 3D4ZA 4WF7A 3ZR5A 3GH7A 1RP8A 1V02E 4MDOA 3VMPA 1XV8A 5DF0A 3NSXA 1OT1A 2OW7A 3IJ7A 3PTQA 3BSHA 3A4XA 1V3HA 4URIA 3RM9A 3PZGA 3F5KA 3SCQA 1EHNA 1V02A 1M03A 3BLKA 4QLJA 4OKDA 2XFYA 3ZSTA 1HTYA 3LRLA 3U57A 1PEZA 3SUUA 2V38A 2VZSA 1GOKA 3EJPA 3HU7A 3WH8A 1SMAA 1GHRA 3WUEA 5ECUA 1J0HA 3WDJA 3N11A 4Z2GA 1TA3B 3WH7A 2CXGA 3D50A 3W81A 3WD3A 4MPKA 5GNZA 4Q7NA 1V6XA 1HKIA 4XX6A 3AXHA 3AIEA 4TX8A 1KXHA 4UQDA 4PTMA 4BQ3A 2O9RA 1NWRA 2PWHA 2RGMA 2FE0A 4MJ4A 2WHMA 3BUDA 2OYLA 1WDQA 4UQCA 4RE3A 4HU8A 3DECA 4WSJA 4QFUA 1LLOA 1P6WA 2E3ZA 4H8VA 3ARTA 4AMCA 1HL9A 2V5CA 5D9OA 2F61A 4LPCA 4X0NA 1FHLA 3BUIA 3MI6A 1E56A 3W6MA 4AZ6A 1V03A 4MJ2A 5CG0A 1X6LA 4EK7A 4D6JA 1BQCA 1CGVA 5DO8A 1QI2A 1QNSA 3G6MA 1JYVA 3PZVA 3FNDA 4IISA 1UH3A 2GDVA 1C8XA 3T2QA 2DIEA 4W5UA 4AD1A 2EEXA 1PIGA 1QW9A 3DYPA 4EE9A 3OG2A 1HJVA 3PN8A 3N1AA 3WH6A 3DYOA 1VRXA 1DTUA 1EIBA 1E0XA 4M80A 1AMYA 3WF0A 2OLHA 3ZIZA 2NW0A 1DWIM 2YFNA 4D71A 4L4PA 4BA0A 1CENA 1JZ2A 1K9EA 5CLWA 2PWFA 3GXMA 4QAWA 2EQDA 1UKQA 1B30A 3AYRA 1OCQA 1V3IA 3L4XA 1TE1A 3MKKA 2WVTA 1NARA 3AZSA 3B9DA 1I1WA 3PZTA 1CECA 1E4LA 2QV4A 5JBFA 2BNJA 1ISZA 4CN4A 3BVWA 1WZKA 1E4IA 2X05A 4MB1A 4D1IA 1BHGA 1EA9C 4ZENA 1B3ZA 1A47A 2ZXBA 1JNDA 2W5FA 4PCTA 3FXYA 1VIWA 1E6ZA 5FL0A 3BMWA 2YL5A 1ISYA 3UEQA 1B31A 2X2JA 1JZ6A 4DUWA 3VGDA 1TQSA 2OSWA 3OLEA 1B90A 2ZX9A 3TV8A 4LYRA 3MSDA 1F4HA 4NZCA 1JXJA 4OBRA 5A6KA 2EJ1A 4QCEA 1GJUA 2QPUA 3FN9A 1JZ4A 2FGZA 1FH7A 3TONA 4AD3A 1TQUA 3TTYA 3E1F1 3NCOA 3A4WA 1Q6CA 3KL0A 2Y2WA 2FH6A 1FH9A 3AS1A 3DYMA 2WMHA 1GOOA 3GDBA 1OD0A 2WMKA 3W27A 5A94A 4B3LA 1BG9A 2JIEA 5EBAA 1QOXA 3O9NA 3AHZA 1KXVA 2CCRA 2PWDA 5D9NA 4AMXA 3HJEA 5ABFB 2J78A 4OOZA 3DX1A 3VGEA 3EDDA 4JKMA 3ARUA 4JFVA 4W5ZA 1UOKA 1UUQA 1WDPA 5A6AA 1UKOA 3PTMA 3NSNA 1JD9A 2VZOA 3L4UA 1UWRA 1HP4A 5CSUA 2D22A 4MB4A 2XVGA 2G4FA 1XD1A 3UR7A 2WLYA 1R75A 4QCFA 3WF2A 3IJ9A 3O2LA 1M04A 3WY1A 2ZUVA 3WENA 2XTKA 3WEOA 4Z2HA 4HA3A 2BFGA 3VIFA 3RM4A 3WF4A 5GPRA 3UG3A 2X1IA 2J25A 1MXDA 4J7RA 3DDGA 2Q8XA 1WDRA 4E2OA 4CU8A 5D8WA 4MAVA 4XV0A 3WH9A 4DO4A 1QHPA 3QGVA 3VUPA 3J7HA 5A2BA 5IDIA 1WKYA 1XH0A 3AMKA 2WW5A 2O9PA 5A6BD 5FL1A 1Q4NX 4DUXA 3BVXA 3HZ3A 5BXRA 1JDDA 4H04A 5I78A 2JEPA 1JDAA 1M7XA 1OWQA 5JIPA 3ZT5A 3AQUA 1V0MA 5EB8A 2OW6A 3UG5A 2WMIA 1ZB5A 1NWSA 5A8QA 4FLRA 1K9TA 3WNOA 4OGZA 1O7DC 2G3JA 2VC9A 3SURA 2VUYA 1EXPA 3MO4A 2E8ZA 1EOMA 4AYGA 1R7AA 1NQ6A 4HMCA 1BAGA 3RDKA 1V3MA 2EPNA 3UCQA 4AMWA 4X9YA 4F79A 3T09A 5E9AA 1UR8A 2VI0A 3WMBA 2WMFA 4EAMA 5IHSA 3AHYA 2D0HA 1JYNA 2C7FA 4J3TA 2WNWA 1AQMA 4Z2LA 2CKRA 5A8NA 2NT1A 3WMSA 1V08A 5ABHA 1PZ2A 4BQ4A 3WDQA 1UZ4A 3AFBA
chains in the Genus database with same CATH superfamily
5TE4L 2HTKC 4N4PA 3FTZA 2Q71A 4Y1AB 1N59A 5LGZA 2XZAL 4DPPA 3I50L 5ABTA 1AI1H 3XISA 5EWIH 2WUBH 3ZZ1A 2OSLB 1KIPB 4MQ7B 1M9WA 1FHVA 4PRNB 1MUJA 3RNQB 4MUPA 1OPOA 1XIGA 1WT5A 3BAJA 4YS4A 4AEIL 1MY7A 3A6CH 3CEUA 3AWGA 2ZWZA 3B3IB 4Z0BL 5FW7A 3Q3GA 1GKEA 3CSGA 4UBDD 1GYMA 3NFPA 4ISVB 5GHWH 4GE8A 4LCYA 4WSHA 2WLMA 5M03A 3TTOA 3AWOA 4I90A 2OMTA 1BWKA 5C8JA 3VZXA 5BROA 4OZHE 4Y5XB 4BCEA 4POZD 4DIXA 1NOAA 2BCMA 2XPZA 1SEQH 5I1GH 4N0FA 5JZ7C 3O3AB 3G6DL 4NXSA 1WPCA 1UATA 2ERJB 4YC2C 4GNJA 5D4YA 4YDVA 1I9IL 4N8VA 3QW4B 3ERPA 4NAQA 4S1DC 3QKZA 5AZ1A 5DY3A 3IAPA 1L9PA 1ZE3H 2CHDA 4Z3HA 3MCLH 2DWSA 2ADFL 2HJFB 3EYVA 1OL0A 4DPBX 1O5KA 3CHSA 2BMKA 3V3WA 3M1OA 1T8QA 4PMUA 3O2VL 1INEL 1C8YA 5FO7A 3TX4A 3PGFL 2HE5A 2ZF9A 5LWYH 3V36A 1Q9LB 3BOVA 3HF3A 3GDMA 5BOFA 5DJAB 4O52A 1DLHB 1DIEA 2XWRA 1KLUB 3Q2VA 1EUNA 2Z00A 1Q4WA 3MNMA 1EJUC 3LIZH 3RPKA 4UTFA 5EOQH 1Q94A 4YVUA 1AAJA 4PG2A 1CI5A 2G9HA 2LAGB 2JFCA 3EEZA 5CJOH 3SE8L 5CSZB 3WE6A 2O6CA 1BZQK 2X1TA 3AXXA 4F5CE 4FLSA 5L88H 3QUGA 1M65A 3VIIA 5EFIA 1PKYA 3D30A 3FSAA 4TSAL 3AHTA 1WP6A 4PAZA 4H4IA 5AW2B 1GS6X 4R7DB 2VLJE 4JFQB 1FFPB 3C5ZA 5I6OA 1NKRA 4P3CL 3NP4A 4FULA 3USBA 4JZNB 4K0OA 2WC4A 1DL7H 2DZBA 4Q56A 5IMOB 4NO2A 4NN6C 4PS4L 4BK5C 3UNTA 4ENED 1RERA 1NMBH 2OXGB 4LFYA 1KM5A 1FO0H 3WG7B 3LTYA 1UTDA 3KBJA 1RJZA 4AC2A 3MPCA 3QEZA 5A5WA 4KZCA 3SPVA 1ZWIA 5AVXB 5DWUL 1DUZA 3PV6B 4JY6A 4UM9B 2CLLA 2H6RA 4QKXB 4A4AA 3GBMH 4G7EA 2WPBA 4QD2E 1OFOA 4KO7A 1KCSL 1UM6H 3ZXWA 2VLRD 5C0AE 4MJZA 1ME8A 8XIMA 1O5DT 4KTGA 1UA7A 3UJFA 5DHXB 3STEA 3KPOA 4G1KA 1EHLL 3QSKB 4Z18A 3EJQA 2PR4L 2PXYD 2TRYA 4IBQA 4DPAX 4QQ3A 4ELKA 1CNVA 4X6FB 4A1RA 4XCFL 3VNIA 4GI9A 3CHDA 3AUOA 4UZSA 3X1BA 3UWWA 3EHBC 3VSQA 3FGCB 2AK4D 1K4CB 4ZOEA 3VGHA 5DR5H 1UOVA 2JK5B 4B9FA 3T05A 4IFKB 1A7OH 1FWEC 1IE7C 5L9FA 3T3MB 4GI6A 3DX7A 5A2CA 3T77B 1UASA 4KDTC 1E6RA 1NAMB 4M6NH 2VZVA 4JFTA 1AI1L 1L8NA 5EWIL 5AYXA 2WUBL 1PKQA 4G6KH 4HUKB 1Q0XH 1F61A 4Z1YA 1FYTD 2NY1C 5AYIA 2VITB 1NFAA 2HRGA 4EZKA 5B21A 3K8KA 5LIXX 1ACYH 2XFXB 3LB0A 3W00A 3H0TA 5JHBA 1HL2A 4DUVA 4AQAB 3L0KA 4PJXB 3EB3A 1IMHC 1SM9A 4HIIA 1CK0H 3TQ0A 1YBQA 5DVOA 3VG9C 2CERA 4F0KA 5DS8B 1O6IA 2BIHA 4R26L 5IBXC 2QZQA 2VGGA 3SN0A 3A67H 2X0HA 2XJ7A 1SEQL 3IDGB 4PMXA 1E2ZA 1GOIA 5DJDB 3ARGA 4M7JH 1YC8A 3K6SA 4K73A 1HIZA 3CUIA 2F74A 4AIOA 4GRMB 5EBUA 4UFJA 3MCLL 2VFHA 5BMXA 4HKPA 1SLUA 4I85A 1XDMA 3KLQA 3SZKC 4IOIB 1YRKA 3BP5B 3PAZA 4BZ1A 1SW0A 5LWYL 1AP2B 2JLPA 4AUJA 1VBJA 3ARBD 1GPWA 5BWFA 4LS2A 5FYLH 1O94A 3MA8A 2INZA 4ZFOA 3LQZB 3CTTA 4PJ7B 3VFRA 2DPKA 4ZOAA 1A80A 2R23A 5T3ZH 3EWCA 1ZTXH 3LIZL 4GAGL 5EOQL 2CGRH 3JVGC 4FP8L 2HN7B 1QRNB 4FXGA 4HAFA 4IGHA 1HC1A 4HKJA 5CJOL 4QF1B 4HKZB 4UIMB 4EI5A 3GB6A 4DWSC 4CRPA 5L88L 4EXAA 5HHQA 5EO9A 1LT8A 4O51A 1QEXA 1JZHA 4IOFC 4PV1C 1NANH 3P61A 2TSBA 4NO0B 2YPKA 3DX2A 2WMJA 1U5JA 3SCSA 1QCWA 3H9SE 3WLWD 4FYTA 4NRRA 3T40A 1E5YA 2AJVH 3D25A 4KVCH 4NF7A 2JKIS 1G5AA 1PLGH 1LD9A 4AZIA 1DL7L 2EKGA 3UPBA 1YADA 2V8ZA 2Z28A 1G87A 2BFVL 1U3NA 5KVFL 4P8WA 4PJIB 4YPJA 3V0GA 5AHMA 3PIQB 2RHEA 5BPPA 3HV9A 3QCVH 3CGTA 1JFQH 1FO0L 4B91A 3RM8A 4X6BB 3R89A 2FB3A 2OKOA 2Q6WA 1BZ7A 4C91A 3RY6C 4B5XA 3TBSA 1N5AB 4PWHA 3GBML 4KJPD 5DZLA 2QCGA 3KVKA 5D8JH 1BD0A 4PP1C 1I3GH 5MEQA 4KXZI 1UM6L 4ZO9A 1T7YA 3LAFA 3HG0A 4M93C 2X7WA 5DJ2B 1W5NA 5FX3A 1GZPA 2CFFA 3VD1A 1B4RA 3HMXH 3KWWB 2ISVA 4U6XB 5E6IA 5EC1A 3K81A 3LPOA 3NZRA 4ZXBB 2CR3A 4FG6C 1P6BA 4ZTEA 5MP6H 2V5JA 4PJ9C 4KZEL 5KUKA 3QOMA 2YO3A 1XCWA 3GSXB 3KBMA 3UERA 1NOUA 5DR5L 2IXVA 2OZNA 4YQXH 2F53A 4ATTA 2AJSL 3IMBA 4R3UA 2HK1A 2Z0BA 4X6DF 1P7QD 5EUKB 4FNSA 4JBSA 3QHNA 4HJ1A 4B15A 3NQAA 4M24A 2YYTA 1MAKA 3WJMA 2YCEA 1KC5H 1KG0A 1LWHA 3KPLA 1YPIA 1A0CA 1PMYA 5FCSH 1EZ2A 3O2WH 4G6KL 1TTRA 4REQB 3O4LD 3UJ2A 4BQBA 1VZGA 1GJIA 3OAZH 2P8MA 1QSVA 3TH3T 2VYOA 3V18A 4AIZB 1N8OE 4I77H 4CL7A 1Y0LA 1ACYL 3SDCC 3MP5A 3DCPA 2VD9A 4UMAA 4HFWA 1OOAA 3MTWA 4JFEB 1T3FB 1NOFA 5IEHB 4G5ZH 2HUHA 3KMDA 1CK0L 5FK9B 2B7OA 4M82A 4A6YH 4EBQH 4YMPA 5D93B 3SO3C 3KL3A 4L6HA 5D04C 3DVNA 3V6BR 2X0UA 4ZMYA 1IJNA 3A67L 3JZEA 5GGRA 3WNPA 2ZRVA 3TYCA 3EFOA 4GCAA 4M7JL 4Y7MA 4HUWA 3TYUA 2O9OA 2ZCHL 4ZUUA 1NM9A 3FSUA 3KPMB 4MA7L 1AG1O 4OFIA 3E2RA 4KI5D 2Q7YA 4Z76A 2JIWA 3LERA 2VLKA 3VE9A 2PZ0A 2XYBA 1OSYA 4N6RB 2ICWJ 4L2YA 4IM8A 1EJVC 5E70A 2CIKB 4WJKB 2NXHA 2H8PB 4JO1H 4P57B 1AGFB 3T0EB 4UQBA 4RGNC 2EDOA 2AXFB 4KRNA 5T3ZL 3QXUA 4LLUB 4E9LA 1PKNA 1WAPA 1ZTXL 5IVXB 3ZUCA 4BFJA 4X7DC 1LVEA 4UTTA 5J8OA 1W1ZA 4DHGA 2FKPA 5GNYA 2VC2B 3TJPA 4L1GA 4EOWH 5AG8A 3EBHA 3QR0A 1S9KC 5DD5L 3JTSA 4OBSA 5TTRA 3WLJA 1WX0A 1PIFA 3FTXA 1LQSR 5B4MD 4UTAA 1V0KA 2YWZA 4TS6A 1CDJA 1FNHA 3VD3A 2AJVL 4N2NA 4AV5A 1HL5A 1TO5A 5A8GA 4KVCL 1XYBA 4GSDH 2XVKA 1PLGL 3VRJB 5BRQA 2UXFA 2VWEE 3S3CB 2BIPA 4IGBC 2KZWA 3GSMA 1QFHA 4OUIA 3QCVL 1HI6B 3FH5A 1JFQL 5E95B 3UPMA 4HYWA 1QBLH 3L3DA 3VDHA 3TC7A 1CO1A 2V5BA 4O10A 2G5UA 4GRLB 2FJKA 5AVNA 3U7VA 3EF4A 3ZTNH 1NFDB 5HDWA 2UY4A 1QKZH 2QCNA 4HU0A 1JDEA 1BWLA 3N12A 1Z5HA 1P2CB 4KFMA 4FFZA 3THDA 1GZJA 2B4GA 3TW6A 4EZLA 5KSBA 3TJHC 3N2TA 3NQ7A 1K8ZA 4U6TA 3SJ3A 2W67A 3VI3B 2Z34A 3W0WA 2YAPA 1AR1C 3FQRA 3T55A 1YNTA 4UANA 2K7QA 2FEDD 4PRPB 4YLQT 1BF2A 3HMXL 2OWWA 1FWTA 4FNLH 4XKYB 1YNKL 2DJXA 4WNQA 5I16A 2W60B 2GJXB 5AW8B 5MP6L 4PH8A 2CGZA 4JOMA 5F0PB 4YU1A 1R3KB 4YQXL 2WLLA 4H0IA 4MNQA 2OMUB 2P0OA 2IDTA 1R5VB 1GQKA 2FO1A 5CEWA 2BSRA 5I8EB 1FWSA 4FLOA 1H6EA 3PG2A 4NQEA 5C92A 2X30A 2FWOB 1KC5L 1Y6MR 4MZ8A 4UMSA 3QYNA 3QRGH 3W7LA 3O2WL 2GJLA 3WUFA 2ESVB 3ITLA 1CR9H 1FNAA 3KL5A 4IUOA 5MEPB 3NZ8A 5JQHC 3E5PA 2VX5A 5F2LA 4E41D 2WO4A 4LCQA 4Y19A 3PBGA 1H15B 4KK6C 4N0RA 5C09A 3BO9A 4ZZFA 5KZMA 2HTMA 3RHWF 1VADB 3BPLC 2WZ0A 4URKA 4G5ZL 5CBEA 5E5CA 2OCJA 3WLBB 4OF8A 4A6YL 3NDZA 3L81A 1C8PA 2DJSA 1HILA 3CDYA 2V2CA 3O6FA 1HH6B 4WW1A 3PG8A 4EN3C 4KKBD 1GOFA 5IOKA 4GVFA 3I3BA 1AOHA 3D6GA 3W2UA 2DMKA 2PSNA 4TNVF 1HCZA 1KTRL 2BY0A 4H8NA 3O16A 1XGTB 3TBVA 5EY5A 5HHPA 1CXIA 4ERGA 2FB2A 4DCQA 3WUWB 3X12A 3DEQA 2NQZA 3JZUA 2ENYA 1GZGA 1C1EH 1AS6A 4PUEA 3ZL2A 5GRUH 1EBPA 3RGVC 4UIKL 3ABSA 4OUUA 1L6XA 5DD1H 3ARYA 4Q4OA 1IGTB 2BP0B 4TUJB 3SB3A 2VQ1B 1YUHA 5FM8A 4GG6A 4JO1L 3WG6A 4DO6A 1JGLH 2HBVA 2AV7A 4P7OA 3G04A 3LI1A 3T2NH 3QXDB 5BRZA 5HDBE 4JREC 1CTMA 5IY5B 1NGWA 4LL4A 4DY1A 2YSSA 3BJLA 3HG1A 1Q6GA 2I07A 3OJMB 3TO4C 3URNA 2J1YA 3LNEA 4CNOA 4EOWL 5F1IB 4LUIA 4PP2A 4QRFA 4Q6XA 4GO6B 1ZE3C 3THAA 3FQNB 3WIIH 3PWVB 4N7QA 4L4JA 4FQJH 3ZPDA 5CH9A 1UKTA 3HTWA 4XZIA 5CZ0A 2ESCA 4GSDL 1TV4A 4NKMA 3PFUA 2HJLB 2A74A 1MVYA 1I6NA 2R24A 1R5WB 5T1KA 4JTUA 1LQAA 3ARDA 3U7WH 2BJML 2OMYB 1DDHB 1X8CA 3FB6A 1OT1A 5I1DA 4S3CA 4FX6M 1QBLL 1T96A 3E0LA 3MR9B 3KGTA 3GRIA 3AYTA 1OW0C 1PS9A 1FAIH 3ZTNL 1XLFA 2V38A 1QO5A 3SZ6A 2PN5A 2AEQH 4BQCA 4PJBB 1CFQA 4N3UA 4Q7NA 3MJ8B 2Y25A 3B43A 4OV5A 2PPAA 1ZA3B 2OELA 3EOOA 4JNZA 1J5CA 4MJ4A 3VTTA 2E25A 3W5NA 3APDA 5D7JC 2E3ZA 2D7OA 4H8VA 2OMNA 2EG6A 4AX6A 3LKPB 2F61A 4B5UA 1K7EA 4NAFA 3MA7A 4H6RA 5REQB 4FNLL 3C6SA 4WWKD 2I9LA 3IE9A 2PKDA 1OF8A 2BIMA 1CGVA 1CE6A 1XZ0A 3T4AB 3UXDA 1G6RA 3QXWA 3DMMB 3UWYA 5E9DE 1DTUA 2PDJA 3U6XS 4AQ8C 1EIBA 3GSUB 5J7CC 5ADOH 1QAPA 2Y5QA 4H1LB 2SEBA 4L3ED 4YHLH 3P3YA 5J11B 3QRGL 2DKUA 2JQAA 3PZTA 1CR9L 5DX7A 3BVWA 5LBSH 4X4XB 1BYOA 3MRFA 4GKSA 3QZLA 3TU6A 3D3VD 5J0BA 4UDTB 3BZFB 4PJ5A 3NXLA 5DMGC 3C9NB 3UTPD 3KJ6L 5CU9A 3OLEA 1LL1A 1M9SA 1A6ZA 1LWRA 2AJ3B 5I73B 2R69A 5F7MC 3PM6A 3NCOA 2NLIA 1GXEA 3RPTA 3QIBC 2FH6A 3DYMA 4IICA 5D55A 3TN0B 3VYOA 1XRSA 3RURA 1JCKA 5A6IA 5DHYB 3D18A 1E0OB 2AJXH 4C6NA 3U2JA 5JDJA 4O02A 1UOKA 4AF0A 4N22A 1S5HA 2E6QA 2ZSWA 2P26A 2D22A 2XVGA 3RWEB 2NYKA 1C1EL 2A5HA 1XIHA 5E08H 5IOBA 3US1A 1MQKL 5GRUL 4HJTA 1RV6X 3V95A 1Z44A 4ZUTB 3P74A 5BO0D 3MJGX 3QRBA 4E2OA 2H0EA 4O0QA 4H25A 4OCXH 4B4HA 3MMEA 1PKOA 2BW5A 3FMGH 1JGLL 3AMKA 3NO5A 5FM4A 4I5RA 1F3WA 1J1PH 4QRAA 1WWAX 4A2SA 5JIPA 3NZGA 3NJMA 2V5YA 2CHXA 4FF9A 3NJVA 4HJ0C 4JTEA 5CR1A 4TQTA 1HSAB 1ODAA 1O7DC 3UTTA 2VUYA 2MNUA 5ESVA 1EOMA 5ACZA 4QR7A 4CQCA 3M1BB 2JKJA 1A5AA 3WIIL 1YMMD 3FT0A 1JPDX 4Y9CA 4FQJL 3JT2A 1YSOA 3U1SH 2J8UE 3LHWA 3LNMA 4PRHD 3VGAC 1MAMH 5F7FA 1JZIA 3P1VA 3SDOA 3LDBC 1PZ2A 1FVPA 2Z1XA 4FI4A 5B7MA 5IMKB 3U7WL 2UY6A 1L7IH 2WAQA 4TNWK 5CSBA 1DVSA 3NM1A 2OMBA 1N7ML 4OJYA 3V1HA 1FAIL 3BWSA 2ITCB 4G8GB 2AEQL 1TNNA 2J62A 3O8AA 1ACXA 3CZJA 4M8VA 1ND0A 5A2JH 5JHDA 3I84A 2WOBA 1S2CA 4JDEA 2PTYA 4HULB 1KXVC 2DW7A 4M03A 3G6JE 1E6SM 1M7IA 2FO4A 2G3MA 3QJFB 4XWUA 1ZZMA 1SJHB 1NGXB 3MZ2A 1CYWA 3EH5B 1WXZA 5B38A 4XI5C 4BD4A 4I9MA 1LO0L 3SM0A 4HIJA 3QZEA 5BXSA 4GRWB 3WNIA 2V5DA 4NP4H 4OIIL 5DJ0B 2XH7A 3ASOB 4ICCX 3U0TA 3QUXA 1OP5H 4QXUL 4OECA 5KZDA 3F7KA 2AQWA 4GZJA 2OGJA 3CH9A 4F57H 2QS8A 1H11A 3RGHA 1FLTX 2IGTA 3I68A 1P69B 2FDMA 3HQOA 4C83A 4XKMA 2YRZA 3IWVA 2E6AA 1HKLH 3ARFB 1KW1A 2DM7A 4A2LA 4J3VA 2OULB 4NZ8A 1JSYA 1NEUA 4RNFA 4P9MH 2WV3A 5LBSL 3FK4A 4IBVA 2PRLA 1DJXA 4HPXA 3BPCB 4NWUH 3VXSB 4P2QD 3F7QA 1JGEB 4JFSA 3IDJA 2X7LB 1AD9A 3W02A 4R0LB 2OL3H 3RRAA 4F7TB 3T7VA 3H7VA 1GKOA 3BUBA 3L9CA 4AWSA 2VR5A 1YUKB 5EZJB 1U95B 5T1JA 3WEMA 1K4DB 2NTSP 4XVTH 1RZFH 1X5AA 4B9IA 4YHEA 4AEOA 3TYAA 1R1CA 1HJBC 4HS6A 1ZENA 3UC2A 3D3FA 3A5VA 1GL4B 3KPRE 4FKEA 4HYVA 3CDCA 3KGRA 4MD4B 5EF3A 4RRPA 4TNEA 1WA1X 2FHCA 4TQEH 4G1MA 1MH5B 2EABA 3D4YA 4IOTA 5KBKA 1I7RA 4JQ3A 3NGBC 2F58H 4D94A 1DQLH 1NDGB 2X42A 1AW1A 5L2KD 2X9WA 4AWEA 5GNXA 1SOXA 5E08L 3V75A 1HOCB 3W1TA 2OR9L 3I74A 5TF1H 1OGBA 1KR0A 2KKQA 1UPMB 3B05A 3MV9A 2N4IA 3TFKC 1YMHA 4AQ1C 1R4XA 3KYMB 3M6DA 4OCXL 3RPMA 1JUBA 5HY9A 3UVAA 1QWKA 3QJHA 1CGSH 7ENLA 3HZYB 4XN7A 2OJEB 3M7OA 3BVUA 1O7DE 1TTAA 4QHRA 3HRZA 1J1PL 3QK0A 1PZ3A 1Q5MA 3ETSA 4JZ5A 4HGKC 3RPIB 4BRJA 2F38A 3M0MA 4NKDA 2ISFA 2XT1B 4E4FA 2RTTA 4KHTH 3ZYIA 2OEJA 3DGBA 4B50A 4WGVB 5E8EA 2DSZA 5KSBF 4YSOA 1EO5A 3QSTA 2HK0A 2REQB 2VO5A 1ODZA 2NQLA 1YNTF 4PTNA 1MAML 5CKGA 4MBRA 4HPGA 5KWYC 1M68A 3L5MA 3FF8A 3L4YA 3CO4A 1L7IL 3RBGA 1T1XB 3BH9B 3T0WA 1WC7B 5AKVA 5FAGA 5G2NA 5T3XL 3UZXA 4PJFE 3KWSA 1CJYA 4IRZA 3C3NA 4P5RA 5DZPA 3CFBA 5E8OA 2WNXA 2YAOA 3DURA 2VDLB 4E9YA 3GHRA 4MZ1A 5GGSY 1KTLB 1EAQA 2XA8H 4A21A 1IGYA 4QLRA 2J44A 2Z1WA 3F3HA 3GMLA 3LV3A 5AW3B 3DESA 4UYPA 4RZBA 4AFYA 3GNNA 5DXXA 4L8SA 2AVFA 2XIIA 5KANG 2WO2B 1L5GB 5D7LD 4KEUA 1I1RA 3WMCA 1D5MB 1MI5A 4AWTA 3ABRA 1HNYA 1EKOA 5FDWB 3E74A 1GIGH 4NP4L 1J88A 1FUYA 2Q87A 1S4IA 4IRJA 4GEJA 1BBJA 4WIQA 1AYOA 1SGKA 4YR6A 1EBGA 1EDYA 4W4NA 3SJVE 4GK8A 4GIEA 1Q6OA 5CBBA 4F57L 2R4SL 4Z2IA 3L3GA 1XDTT 1OOWA 2IBGA 1ZAJA 1HVQA 3II2A 3KBWA 4A8IA 1RUQH 4E2VA 3O81A 2J75A 2XYCA 2YJQA 1HKLL 4FC3E 4PB9H 4W8BA 2NNXA 4MQXD 5XINA 1TZOA 3NDYE 3PBUA 2WGXA 5FYJU 3IDMB 4GZIA 2QCMA 3NZQA 5XIMA 4M6AA 5EUOB 1UR9A 4AKPA 2OL3L 2PU1A 3RL2B 4HMEA 3HG2A 5SWZD 4GG6F 4QOKE 3VAVA 2YZ8A 1U8QA 2GWGA 4XVTL 2QTVA 2WBWB 1NF7A 1VCGA 1LF1A 4KK5C 2V3FA 4HPHA 3SKNB 1TPDA 1K8IA 2OJ1A 2C3VA 3Q8BA 4L4VA 4XNYH 1M6JA 3HPLB 1TJPA 5EYWA 4TQEL 4IP4A 1Y6NR 4CNNA 5F93C 4ONFL 1HXYA 1Q66A 3WLMA 2F58L 2GSGB 3AC0A 4HWZB 3V55A 2QPDB 1DQLL 2BVEA 1FWXA 2NXZC 3L3HA 1A5UA 1RSFA 3W9ZA 1KPRA 2HVJA 4X0KA 1ISVA 2X28A 2ZKYA 1W37A 3I6GA 4U1LB 4KPLA 3K91A 3IMSA 4XWGH 2BDNH 5J06A 3OKKB 3O41A 4MDJA 4OIBA 3TO2A 2Q6ZA 1L0YA 3QMSA 4QYOB 2IAMC 4P23C 3R7QA 1CGSL 2YBVA 4QRRD 3E3HA 5CN3A 4GVGA 4OZHB 4JX6A 3CWHA 2WQRA 1A64A 3N1GC 5C07E 2BVOA 4LDEB 2BNQA 3ATZA 3CQIA 1UWTA 3PSWA 3FO2B 3ZMEA 3GTTA 4JRYE 5L6YH 3BW4A 3FFOA 3RGTA 4KHTL 4GJIA 3TT1L 4JFOA 5K9OA 1JFHA 3WIHA 4AM0Q 3BUPA 1DE6A 5BVJB 5D1ZC 1Z8AA 4PLNC 3QNFA 3BSMA 1GQJA 1UR1A 5HYEA 1W3KA 3ZKNC 4DP4X 5MI0B 3HQPA 2P10A 4QTHB 1MCOH 4A2EA 3O4OC 4G43B 4S0HA 1WWWX 2J7CA 1XRVA 4BS0A 4YS1A 4OGXH 3HS0C 4FFYA 4WUIA 1ASQA 4AHPA 3GEWB 2GJ6A 1P6AB 4ZXOA 1LBLA 5ISZD 3Q13A 4Q8NA 3MRCA 4GI4A 4JAWA 4E3VA 4WTZA 4PB0H 5T8GA 1OCZB 5DRNB 4YDZA 3BE7A 3O0KA 4E42B 3T81A 5IJBC 4K23L 5FO2A 3C5JA 4Z17A 1Q45A 4Y9NA 3K6FA 2V8LA 2VLJB 3H70A 1S9WB 4JRXD 3K5RA 3VXQB 2R2CA 2Z93A 5INCA 1WGVA 1TJHH 1TIUA 1XICA 3WQ4A 3EDFA 5EL1A 4MWAE 5L2JB 5I2IB 3MNVB 1AJ0A 4M48H 3UTSD 1G6CA 2G41A 4AG0A 1GIGL 4C1KA 5CLYA 4G8IB 4PRIE 4TUKH 4RFNC 4BKTC 4EKJA 4RE2A 2F6XA 5KEZA 2C4FT 1FNEA 2BCKA 3D5HA 1T5XA 4OLXH 3FN0H 3G0SA 4EO5A 3EMZA 3U25A 5I71C 2H9AA 2NY6D 2CJSA 5TQ0H 1KBBA 1YEEH 2Y7QB 5ID0B 1RUQL 4I88A 1F4YH 2XRAH 2FRGP 4PB9L 4PWJA 1AO7D 1J0JA 4JNYA 2ZXDA 1EC9A 4EWND 5GRWA 3FULA 2GT9B 4JHOA 3VOGA 5C0AB 4ODVH 5KVGH 2NW2B 1USQA 2ZKHH 3H24A 1T03L 1EB3A 1XLGA 2EIEA 4OI9A 1UZHA 1XQ4A 3GEFA 1XGRB 3OQRA 5DJXB 5CCHE 3WN6A 4NYLB 5C3LD 3MLTB 2PDUA 3ETBF 5LDSA 4I1NB 3UJEA 1GYCA 2DJLA 1FSKB 2ZRWA 3NQFA 1FBIH 2NCEA 4D0BB 3C8NA 4PRBA 3ESVF 3CC5A 4RISH 3WQ8A 1BKHA 1LUCA 4XNYL 1JAEA 3KBPA 2QKSA 4XC3H 4J3BA 4MZ2A 3V5KA 1Q2SA 4QHNA 1PIIA 1WLHA 1XD0A 1UH2A 5A3IC 3SIZA 5F1VA 3SN4A 4B9YA 3TBWA 1Q6RA 4U49A 4AYID 3PL6C 1XLKA 4MS8D 4IFOA 3AROA 4XWGL 1A9EB 3QUMH 1MG3C 2XN0A 2BDNL 1GYLA 3VD4A 3B8YA 4Q52A 1A6AB 4MD0B 1IBGL 2GVGA 4OR1A 3GRWH 3IANA 3SN1A 1NPJA 2FBJH 4AIBA 4X5WB 5I3HA 2ICSA 3LIUA 4A8RA 1CFNA 1IX2A 4D9LL 2HBXA 5L6YL 1EA0A 3APYA 1OTTC 3KFTA 2D24A 4L37B 1RUAL 2JE8A 3URAA 1HEJC 2WMIB 2FIKA 1ZAHA 3KCPA 1DXFA 1VESA 5H8MA 3VFSA 1TEGA 4L18A 1G7IB 2Y36L 3LZ5A 4GJJA 4ZAKD 3W1RA 3VD9A 5DUBB 1FG2A 2KDGA 1NBYA 4N85A 3MMWA 4EIUA 4LSQL 4A2GA 3Q9PA 1IC7H 1MCOL 1UCWA 3PY2A 4NNXA 5DRZB 3ULAB 4ZT1A 3V16A 4KO6A 4NHUB 4JW3A 4YHIB 4RLIA 5E00B 1OIOA 2EILB 1QPNA 5LG6A 1S7UA 4TUOB 3V6OA 3RVXC 1OGTB 2VTFA 5EPDA 5I1KH 4XZMX 4GP8B 4LVEA 4PB0L 3QI9B 3ZUNC 3NCJH 3D85B 3TSBA 2C9RA 1PAMA 3VGBA 3SY0B 4O57A 3GMNA 3H9SB 5CR8A 4KESA 1F86A 1Q7MA 3D4CA 3CV5A 1QNZH 5DHVB 3BZEB 4NO5A 1A9VA 4HX1B 2EACA 5C7XH 5GRVK 4K5LA 3U2SA 4B5ZA 1JG9A 5GRJL 1U8JB 4RAVB 3OZOA 4O16A 2QUMA 3KP1A 1ZGLA 4B41A 2WMPB 4OF6A 2DQIH 4HYRA 5MERA 3LXAA 3DFYA 1YEDA 2GGHA 3IRDA 4TUKL 3FOKA 2NY0D 4G56A 2PCFB 2BNRA 3CZKA 4MVBD 1XP3A 2QDEA 4OLXL 3FN0L 4RNRA 5FF6B 3UXFA 1L2UA 5TQ0L 1YEEL 2ACUA 4FX8A 2O92A 1F4YL 1OARL 1KTJA 3WLIA 5A95A 4OZIE 1L6ZA 3R0KA 1FL6B 3BGAA 1A4BA 1QG3A 4ODVL 5KVGL 3EYPA 1MVUA 2ZKHL 2QSCL 4OKVB 3M45A 1T1WA 1EAPB 1TPH1 1E3ZA 4Z42C 5FWRA 4RMQA 2P24B 1F00I 1ZHKB 3OTTA 3NFUA 1E1FA 1JRHH 1FV1A 1K8DB 1QABA 3MREA 2VURA 5LQBH 3K4AA 2I7OA 4ORIA 1Q8MA 1JZFA 1BYCA 1HH9A 3LS4H 1FBIL 1I75A 4PCYA 4XXCA 1WBXB 1J8HA 2D03H 1M5WA 3HBQA 3MSYA 1ZHNA 1G5GA 2CRZA 2DI9A 3PQYE 2C1OB 4OD3H 3RX9A 3JZ7A 3ILPB 2G4JA 3E2QA 4XC3L 3UG4A 4MNJA 4AGMA 3EGDA 3GMRA 2QZRA 3WTYA 1FHDA 1Q9WB 1BZ9A 4LRIC 3FXIC 3VMOA 2NQCA 3BOFA 2WD0A 1SXBA 3F7VB 4MDOA 2ADJB 2OW7A 3IJ7A 2DN7A 2GUOB 3M7WA 3GTHA 1V02A 1Y65A 3QUML 2W81C 3ZSTA 4LCWA 1HTYA 2ATKA 1EXHA 1MCLA 1GHRA 1T6WA 3PJSB 4IIQB 3WH7A 1T0MB 3GRWL 1I8AA 1UPPA 2CD0A 1KCUH 2FBJL 1T20A 4ODWA 4KT2A 3GG0A 3LD8B 2A1YA 4BFGA 3NTCH 4HUXB 4EACA 2DWDB 2Y89A 1JPEA 2XPGB 3TNMA 1MQ8A 4QFUA 2DIKA 4FHKA 2IPJA 1HL9A 3STLA 5E2WH 3VRIB 5C9RA 3MI6A 4MXQD 4YUEH 4AJWA 3W3BA 5CG0A 3IIPA 3FUFA 4H9MA 3KRBA 1BPVA 4H01A 1OCNA 2FT8A 1U8KB 4Y4HB 3V2AR 5IROA 3EW3B 1IC7L 4UYQA 2PYEE 5E2JA 1DN0B 3AM8C 2A2IA 5D6CA 4I9WD 4KRLB 3STFA 2F5AH 5FEBA 3F7PC 5F88A 4QAWA 5K39A 2GHZA 2GCYB 1LLZA 3O8XA 3L4XA 3H1ZA 2FX8H 2RACA 2Z2AA 3MBDA 4LBRA 1CECA 2BNJA 5I1KL 1N67A 1E4IA 4X98B 4RETB 4DVOA 3NCJL 5D2WA 1RCQA 3G22A 1ISYA 2OFJA 5HYQB 3LMZA 1N3NA 3VGDA 4I5UA 1EEPA 4XCNB 2C0AA 2QPUA 4F9LC 2OFQA 3UBFA 2DB8A 1Q6CA 3KL0A 5I17B 5LBGA 1NFPA 2JI2A 4PTTB 1H8LA 1GOOA 3CSPA 3ITCA 3KLDA 1HCFX 4DGIH 3FFCA 5H6HA 4F33B 3A6CL 5G55A 2W0PA 3CT7A 1ZV9A 2X89D 2WP3T 3IJ6A 2GFBA 2GABA 1KYFA 1LTDA 3PTMA 7PTDA 5D05A 3ZX1A 3N3MA 5GHWL 2HG5A 1O4UA 4PFEA 1MCPH 1KF9B 3D39D 3GAYA 4PJEA 5D1XA 2X1IA 1EJOH 2DVTA 4UUJB 5F6HI 5I1GL 5LNUA 4CLMA 3UZ5A 1QHPA 4TIMA 4IPIA 1AH3A 2O9PA 1JRHL 4RDWA 5LQBL 2CZEA 5D96B 1SXSA 4XCYB 4HWBA 2D03L 1KLFA 3T04D 4HJIA 3V4PA 1XXDC 1FVCA 2Y8UA 3PXLA 4JVUA 5AYZA 3SGJA 4C47A 4OD3L 2PDQA 2OM5A 1NJ9A 4JE4B 3B3DA 4JX4A 4IS6A 3FCGA 1E8YA 2Z0IA 3OX8A 2WWMD 3SGDH 4PLKC 3RYSA 1V77A 2AGTA 5FCUH 2NVAA 2QSVA 3RY4A 7XIMA 5HUPA 3LNFA 1XUUA 2JBMA 1JPGA 3NEXA 4ZPVB 3MA9H 3TFXA 1MW0A 3OHXB 3F7JA 3RTQA 4BH8A 3RGBA 3LEVH 4ZD3H 1R9YA 3MBEC 3CFDB 3ERXA 4S11A 1Z9AA 1AJ7H 1P4CA 5E1GA 4ZX5A 3KEDA 1R7OA 3N2MA 1PZBA 2I5QA 3D48R 4F80A 1KCUL 2EE3A 4QRTA 2ICEB 3LRSB 4KY1H 3VG0H 5CF3A 5HYFA 3LNIA 3WBEA 2Z7ZA 5AVHA 1G69A 5AYQA 1U1JA 4R2GD 5HAOA 3TZVC 1AGCB 1MLBB 3KDMB 3NTCL 2VGIA 3WQCA 1FWBC 1NMBL 4ZTPH 5IM51 4YZFF 1AS7A 5IHWA 1S7WB 4XWOD 4YUEL 1XSKA 1MO0A 4PB4A 5HK4A 4NNBA 4ONGH 5E94B 4QRPD 3SYOA 3VXUD 3VUAA 4EJ1C 2DKMA 3B40A 4MGGA 4QTIH 4IOSA 2IANB 3TBYB 2WKGA 5E6YA 3RY5A 2CCVA 2Z31D 4QHMA 1EX1A 2YC1B 3CVHA 1HQTA 4BZ1H 1THAA 4AY8A 4KKCD 1POJA 2F5AL 4IQJA 2V67A 2EE2A 2BMBA 5HDBB 2A6JA 1FWAC 3QB7C 4N0UE 1VF5C 2FX8L 2FIQA 3BP7A 3Q1SH 3RWDA 2L7EA 2JNZA 4XCEB 3LKQA 3LHUA 4NZUH 6CGTA 3CB3A 3FJ4A 3FUEA 3OAYH 2MEJB 1N19A 1A7OL 3CQHA 2EVJA 4KKAC 2H3NB 3HE6C 3ZKXC 4WO0A 3QJSB 1ERNA 3P73B 4M6NL 2R2HA 4FKKA 3UGUA 3LRGA 4OFYA 3X11B 4GMEA 1CVSC 5IHZA 4HA4A 4L4TD 3DC8A 4XP4H 1Q0XL 3VIHA 4DFIA 1SO3A 1MELA 1ZLVH 4DGIL 5JHMA 3AXKA 3B7TA 4IFRA 1ZY9A 1IL1B 4K3JH 2DAVA 1URLA 1JCLA 2GIMA 4FFWD 4R4FH 5BZZA 3EDKA 3EMQA 2ID5A 4Q8UA 1V8EA 1H49A 2GVLA 2IPGA 2H2PD 3KPTA 3DHJA 3GTFA 4G5DA 3ZDZF 1A4LA 5I6KA 3LHZA 3A24A 1MCPL 1IZKA 4GQZA 1ETZB 1YZZA 2JQZA 4KW2A 4JDZA 2DUAA 2KAUC 4DAFA 4P7LA 3WS3B 4P2RA 1EJOL 3HG4A 5JMUA 3WUGA 4C6OA 1TLKA 2IQTA 4RL3A 3WO4C 2G3IA 3GNRA 2QMKA 3S5LB 5DYFA 4B5SA 3GMQB 5HGGS 3DI1A 1TJXA 1IIIA 3NSDA 1BVLB 2HSIA 1QDSA 5E9DB 3MV8A 3FONB 4PMZA 3IJEB 3E6EA 1N2RB 1DJGA 1YJDH 4G6MH 2XUCA 3HC0B 3CFTA 1WAWA 2A5UA 1HE8A 4NQDE 4WU5B 4B27A 5FYLL 4M1BA 2W5PA 2FUQA 3I65A 4RA0C 2B7PA 5FUZH 3D0LA 2VOTA 4U1GB 2CGRL 4TRPH 4WHYH 2RJHA 5DDHA 3ULUF 4Y1TA 5FCUL 4F7MA 3UA3A 4ABQA 4R7VA 1AHWC 3EPMA 1PEWA 3H3PH 5D1QD 4IIFA 3LEVL 4ZD3L 2EG7A 1FH2A 1U2CA 4DN4H 2COQA 3TF4A 5A2FA 3HBPA 1AJ7L 4H13C 3R25A 2VW7A 4D7PA 3AIWA 4PYSA 1JIBA 5DC9B 2ZOKA 2POTA 2ZP0T 5C55A 4HU4A 3ATFA 1F1GA 1ENUA 3GMPB 5INDA 4KY1L 2B14A 2QHAA 4L9LB 3P5ZA 4ONVA 4IK7A 1TPUA 5I07A 4KCWA 2E9MA 3HGRA 2JJVA 3R5EA 4KNTA 4ZTPL 4IG2B 4Q89A 2NMSA 2J4WH 1XJBA 4PRRA 3MRDB 3EX3A 1UWXH 2Q5BA 2EE6A 3CZSA 1TT6A 2NUXA 3DXAA 1L9OA 1WB0A 1M6UA 2A4EA 3EO0A 2CLFA 2G50A 4QTIL 1SQ7A 5D8JL 3C6LC 1I3GL 2BX7A 2A9MH 4J3OD 2E7LC 3AFLA 4BZ1L 4F2MA 4UMGA 2EYSB 4LCCC 2XBDA 3SEPA 3L9YA 3T6ZA 4LNRA 5B1JC 4IBUA 3P14A 1BYNA 3NDOA 1BYPA 1PF3A 3CD4A 1E71M 2WXGA 1NWTA 3RF9A 3MKVA 1UG9A 1Z0NA 3DX3A 4F3FB 5BV7B 3Q1SL 1YDPB 3IIXA 3GBDA 3EEGA 2GQHA 5FC9A 3TS8A 4FLQA 5E24E 3QUZB 4P5KA 2HMIC 3S98A 4BWWA 3U1PA 2LVCA 4UTAH 4R3SA 3T42A 5AAPA 3R94A 4HGXA 2R27A 2DD8H 4OCSH 2QCDB 1HYSD 1RZGB 3PF2A 1E0WA 4EUPG 4UZUA 4XP4L 4ZK8A 4TOQA 5KSAC 1RZMA 2A6IB 2X1QA 1SZGA 1RFDH 3OVPA 5LGKA 1O9ZA 4E2BA 4P4KC 1KJMA 5I15H 4I77L 3DO3A 4K3JL 2YPLA 2FQGA 1PVNA 3OKNA 1TPVA 3BRDA 1A6PA 5ACMA 2OODA 4IRSC 5HANA 3BAKA 3M88A 1R2SA 3H7BA 3UL4A 4B5EA 4XVUC 3BX7C 4KTDH 5GIRB 2X4OB 4XPFH 1F4WH 4OAWA 5CBAB 3GZAA 5CEYA 4EBQL 3S2AA 2Y8KA 3QIWC 4FFZH 3S2NA 3SCMD 4YHPB 5C0RH 3Q0HA 3QR2A 5GSRB 1GYUA 1MFCH 4APQD 4O2CA 4ESKA 2QSQA 3MVTA 3W1MA 3DX4A 1HL4A 3QIUB 2WN2A 2W07A 2VJ0A 1X38A 2ZIDA 5LAXB 2VKZG 4XZBA 3REWB 4GMTH 4B9KC 1K8CA 4E0RB 2NYZA 1KCRH 1FKWA 5IG7B 1SJEB 2DY2A 1URZA 1BWMA 4RGNE 5EB9A 3IDYB 1TZHA 1JGDB 4C65A 1XCXA 4X4YA 3ZY7A 1KPVA 1IEAA 2PWEA 1UJ3B 3NZ1A 4XC1H 1R5IB 1IIKA 5K59E 3QFJA 2V82A 3U2ZA 3AG4B 2DQUH 1ODUA 2ZXAA 2W0UA 1GPFA 2NY7H 1R3HA 2XDHA 4F8NA 4FA7B 4GQPH 3HMJG 2O26U 3PV7A 4PRDA 1N9PA 5FUZL 2LU3A 1V3LA 5C0CD 4TRPL 2ZRYA 3AISA 4LVGA 1S8DA 1XCQB 1VC4A 3LPPA 5D1ZI 5LNEA 1TDQA 2QZ5A 2JI1A 2QT6A 2ENSA 1JWSB 3BGMB 3H3PL 3ULVD 4MB3A 1UA6H 1WEJH 1A5LC 3ML8A 4IF2A 3UDWC 1KCKA 4DN4L 3VTAA 4MAYD 3AJXA 4FQHA 3P69A 3VJ6A 5IB2A 3PWLA 4LY4A 1JI1A 3VFWB 4UR7A 1G9HA 3KPRB 3VI4E 5D33A 1F3RB 1HKWA 3ITVA 5E93A 4NNPH 2XA3A 1T5WB 1LK2A 3ZKQD 4LIQH 4XZHA 2Y7MA 2EDMA 2J4WL 4FJYA 4GB9A 5KBLA 4OUEA 3SD5A 4YLCA 1WT5C 4ZW7A 1QKZL 2YGQA 4LSTH 2OAAA 5M94B 1J01A 1S78D 3IF1A 5J6HB 3ZXAC 1XF3B 2NY2D 4QO1B 4PU2A 4YHGA 8CGTA 3C0SA 5KYYB 4NENB 1TSHA 2WMGA 4ADGA 1NDYA 5HHME 2A9ML 1MKFA 3HLAA 2WPGA 1OAUH 1T66D 1SJDA 3P4LA 4H20H 3DO7A 1UD4A 5BUAA 4QDGA 1JZ8A 3AZUA 4OCWH 3TVMD 4L0YA 3MVSA 2TRHA 4CQ9A 2G75B 5B8CB 3L5JA 4AV0A 3B97A 2WYZA 1BV8A 4MX7B 4BUGA 3N55A 3VGFA 4ZEPA 2G5WA 3SFWA 4ZBJA 1X7SA 2X4PA 4GAYB 2DD8L 3K3QA 1UW9A 2FJHB 4NS0A 3U4KA 1NIUA 1A4KA 5DFWH 2ATMA 1AG6A 1ZHAA 2YZ5A 1RFDL 4HLZG 4KVNH 3O0RH 2Y70A 4K9EH 5I15L 4BF7A 4P5TB 2CETA 2IH1B 4PJFB 3S34H 1UR3M 1JZDC 3C87A 2E9IA 1IC0A 4JYDA 1MXGA 4MTVA 3UO1H 1OFDA 1Z1WA 1FUNA 4KTDL 1F4WL 1C8QA 3W2KA 3QMTA 1JVLA 2YRBA 1ZCOA 3APTA 3SUVA 4FFZL 1OY3B 3RCNA 3V52H 5C0RL 3LK6A 2F8OA 1FVEA 1MFCL 4NRXA 4MCYA 2P76A 3AITA 4PGBB 3C60C 4UR9A 1LEKA 1BFVH 4AGOA 5F44A 1DWAM 4OFKA 1A7PH 5JA8B 1XH3A 4OV6F 2I14A 3FUHA 3CFJB 3D34A 2DP3A 5IEKA 1JV2B 1FRGH 5FKPB 2B0MA 1XYAA 2O5YH 1TV5A 5F89A 3ABMB 3PP4H 3P60A 1G6RH 5CN1A 3U6XA 2VZUA 3W07A 1XIWA 2RH9A 3I6EA 3SJVB 2AEPH 2NUPA 5LB1A 2BSED 5C71A 2OK0H 3E2HB 5DD1L 1CG9B 4TUFA 3X1GA 1P4LB 4GYPA 4XC1L 5EIQA 1W54A 4DNMA 1TVDA 4QLKA 1N0XH 2NQJA 2ISWA 2Y0FA 3PJLA 3CAVA 1LBMA 3SDAA 4L9ZA 4MKMA 2VCAA 1RUKH 2NY7L 3N2XA 5MENA 2OXHA 3T2NL 4D0CB 2CK2A 3B9OA 5HDLA 2C34A 4PJ6A 1K4GA 4O4WA 4JPIB 4N2GA 1TPC1 4KFNA 1IM3B 3GXDA 3H9HB 3UIZA 4RDQF 4JNXA 1UA6L 1WEJL 4D6CA 2P43B 1K6QH 4LV9A 4RZ4A 3AZRA 1PZCA 2ED8A 4XRCA 4QOKB 4B16A 2ZQ0A 2IQAA 2R69H 5FYJD 3OG3A 2JELH 1IWAA 2G0KA 4PTXA 2DUZA 2HXUA 1J9SA 3NIDE 5F9JB 4LYQA 1T5AA 4NNPL 4BR1A 2W79A 1M6OA 4ANWA 5HYSB 2WXMA 4LIQL 3C6EA 2PWVA 3QZ6A 4NCDA 1IAOA 1UH4A 4O02H 1MEWA 3RU8X 1NCHA 4A04A 3KTSA 4HJGB 1JGMA 3IN0A 4H9YA 1JWMA 4R4ND 1X9UA 3QLLA 3SCTA 3LSBA 2ZCZA 3BP6A 4LF2A 2ARJB 5F7EH 3X14B 3N18A 3BCJA 1OQOA 1O60A 3E6HB 1M56B 3U2IA 5FD0A 4ZQKB 1M01A 1GMIA 3QW3A 5KVFE 1UP0A 2GSHA 4WV1A 5G5DB 2I17A 1I7TA 1BMGA 1MOEA 5CEXB 1DQDH 2AQVA 5LLIC 3CVIH 2ADIA 2B0SH 5C0DB 4Z23A 4JFFD 1UACH 2LLNA 1OINA 2RH0A 4OCWL 5C07B 5HD8C 3IVKA 4JRYB 4HIXH 4KRPB 2VEPA 4ETQA 4TNFA 1L9TA 3L7EA 4Y4FD 4DPCX 3ORWA 2OO6A 4I7WA 3ISRA 1E4MM 3O3EB 2VUNA 2XM1A 4YSSA 3PWPA 1CF1A 3VDCA 1A2YA 3CMFA 3V5FA 1DEDA 5ADOL 4QQUA 5JORA 2WHLA 4YHLL 4JIEA 1PFOA 4EXQA 5F9WB 3D05A 5AB2A 3F4NA 1NUDA 1I8IB 3TW7A 1B4TA 2E77A 3O0RL 3O9WA 1IBHA 4K9EL 2X1UA 3F4WA 2LLEA 4RFEA 3CXFA 5ICXA 4R96A 5ESAA 4HCLA 3LM3A 4C7GA 2XWDA 3CV1A 2QHRH 4GINA 3HNVH 5HDQH 1A50A 1U8OB 3UO1L 4EVNB 4ZSOA 2VKXA 2F54A 3A9IA 5EU3A 4XZNX 1UD2A 5F0LB 1RP8A 1JEZA 1IEWA 3V52L 4RCXA 3GSNH 2ZD0A 1ZT1B 1YC7A 5LNSA 3UZYA 4C60A 5I1JH 2QJGA 2CR6A 2PO6B 2AJXL 4ZUSA 3V6FA 3BLKA 2ZTKA 5D38A 4Y9GA 3LZFH 4MWAB 2WXJA 1LO4H 3SUUA 1A7PL 1DJHA 3O11B 5JH2A 2YXXA 1CI3M 2G95A 3BPNC 2GSEA 5EBWB 1FRGL 1A1OB 2O5YL 3WBDA 5DHEA 4M1DH 2FSEB 3TCSA 3PP4L 4PRIB 4G6FB 2FBOJ 3P02A 1G6RL 1IBYA 1UQSB 1ECYA 4BQ3A 8TIMA 5DJYB 5EN3A 2AEPL 1NWRA 5BO1H 2P80D 1KLZA 3SB0A 3FO1B 2OK0L 4UQ2A 3OSKA 3BDBA 4FPSA 4PREB 1N0XL 1R3QA 4FX7A 3FMGL 1FNFA 3BSZH 1RUKL 1WHPA 3UCDA 5DO8A 3FRUA 2VKWA 1JYVA 1DQKA 1I45A 2PGEA 4I18B 3UXAA 2DWTA 3W57A 5JIIA 5ESQA 3F05A 1ZRQA 2DS4A 3FU6A 4QKTA 1D3GA 2ZXGA 3VWKD 2J9YA 3QG6A 1G1KA 4N5ED 5E6IC 2A9DA 4HMNA 5C0GA 4XX5A 2PWFA 2F19H 4DH2A 1K6QL 4UF7C 5H91A 3DJRA 1M4KA 1QJWA 1AS8A 5E23A 3U1SL 5I0YA 1XGYH 2R69L 4JFHE 5T3ZE 2JELL 2O7SA 1ZTXE 4TVPD 1OF6A 3SR7A 3LN5B 3BQVA 1E6ZA 5CEZH 1U92A 1ITUA 4DVRH 3SKMB 4NJIA 3QV8A 4GQ9H 1H19A 4NQCB 3CZFB 4YWSA 2AXHA 5EA9A 1W1IE 1K72A 5K4XA 2DJMA 4QCEA 2FGZA 1I1AA 4O02L 1SBSH 4YDLB 2P5WE 1F18A 1E9OA 2DYPA 3AS1A 1T99A 1ZFJA 3VFUB 1YY8B 1Y6KR 5IIEA 5F7EL 5E1AA 3NRQA 2KX9A 3HA1A 3MSRA 2DQDH 1AQDA 4JG5A 3C6CA 5I3GA 5LXEA 1UUQA 4XK2A 1DQDL 1PLAA 3CVIL 3UW6A 2IF7A 4MB4A 1UACL 2WLYA 1R75A 4Z8FH 1KBLA 2B1HH 1HFBA 2WXLA 4HIXL 5DGQA 3WF4A 2PW2B 3QXAA 3FCTB 4XH2B 1BZDA 3DDGA 3ZYJA 4CU8A 2WNGA 3P3BA 4MAVA 3MDUA 1XKYA 4P46D 1S1RA 3C2VA 5LNVA 3KS5A 2LLGA 3RDTB 4OLEA 3PAVA 3E6FA 5SV4A 3SPIA 2H47C 5AOIA 3B0XA 1RK7A 3UAAA 4WWID 1ZB5A 1T1YB 1ZJIA 3TH2T 4P9ML 1UBPC 2VC9A 2G3JA 1EERB 1M2OA 3CMOH 2Z6IA 4NWUL 2ZKWA 2HTLC 1BAGA 3PGDA 5JOFA 1JP5A 3P62A 3T09A 2QHRL 3FJLA 5D2XA 3HNVL 4IRZH 3MC0A 5HDQL 3HKFA 4WHCA 2QVKA 4GISA 5HQLA 5FUOH 2YOCA 1G7LA 1KZQA 3EOTH 1RZFL 4W8LA 1QLEB 3GSNL 3AI0A 1IBDA 1VEMA 3CV7A 4K37A 4PCFA 3MROB 4AZCA 1RU9H 1LO4L 5DY2A 1YDOA 4IQDA 5E6ZA 2EPMX 4IUGA 4UFIA 4HV8A 1GZQA 5HVFB 2A9NH 5SWQA 4M1DL 3BZ4A 5H2BA 2FT6A 2XSXA 2EXWD 5IW1B 4YGVA 4KEZA 5TF1L 1IM9B 5BO1L 1P1ZA 2IADA 1KB3A 2CA4A 3T9PA 3MV7D 1EUAA 4U0RB 2JKWA 4F7PB 3CIWA 2E46A 1ZOXA 2FR4B 1GVOA 1Z5YD 3ECBA 1GYAA 3D33A 3VNYA 3FRPB 3BSZL 3QWOB 3O3UN 2WHJA 3QJQB 2QXWA 2FWLB 4OZIB 1OQFA 1T8XA 4CADA 2VDMH 3VM5A 3A0OA 1PZSA 4UNIA 5KYXB 5HPMB 3TA3D 4XNZC 2CAKA 3CPRA 2QVFB 2X09A 3BW9A 1O9WA 3NFNB 4AE0A 5CP7B 3GTVA 4R9OA 1ED3B 4M62H 3U5YA 5E2UH 3ZRSA 5DC2A 2N1KA 5I74B 3UBXG 3V4LA 2QEZA 3ITGA 1ZTVA 5CKAA 4R97C 2F8QA 3K72B 1XGYL 1GTNA 1OGAE 4S1FA 4IMKC 4V1XA 1NMCB 3GLEA 1YG9A 4DO5A 2PTTB 4DVRL 4NUQA 1OGPA 1NCAH 2A3AA 3NP3A 2PW1A 4Y16B 2OGYA 2IH3A 4LVHC 1RLDA 1EJWC 4MKTA 3NRFA 5I18H 4CNTA 3QN3A 5I66A 2C3WA 1SBSL 1XO8A 4LNVA 4MLJA 3BLPX 1QU4A 4XX1E 3RZCA 4DZ8B 4H8HA 1AZNA 4P9HH 4WUUD 3GG1A 4DX3A 4I3GA 4NAMA 2D31B 5L4MA 2XA8L 5JBEA 1XIEA 4GQQA 1AD0A 4CILA 4MA8H 2DQDL 3IDIB 3H2OA 4NKCA 3GSVB 5C0BD 3OVQA 3US9A 3TBBA 2ALWA 2MPAH 3RMEA 5I0WA 1YX1A 3L1GA 5I0DA 2E7HA 2XWJB 4G9FE 4JO8A 2FEJA 4LLVB 1KIQB 3S9YA 4CEXC 4Z8FL 4QRNA 2B1HL 1HSBA 1Z6KA 2C91A 1O95A 5DK2A 2V9QA 1J12A 3VACA 3SY8A 4LLMA 1SDYA 3R1GH 5GZNA 1XF5B 1WIUA 1KCLA 1ITCA 2EYRA 3RKDD 4JM2B 1E2WA 1KM1A 4NUJB 1QOQA 1VYPX 1L6FA 3GHSA 3QC5X 2ICWA 1TUPA 2X4SB 2GWNA 1FRBA 3P2VA 3GTNA 1SN5A 1TV8A 2PYEB 1AZ2A 2J47A 1G4PA 1AH0A 3CMOL 1DQQA 4X60A 2CIIA 1SW7A 3RRQA 1ZXQA 4FFYH 2WQVA 1IBFA 3IFPB 4S39A 1DHPA 4KK9C 3BG3A 2AFNA 4KQ3H 3MHZA 3NRPA 1AZBA 2FHBA 4KF1A 5FS5A 5SX5H 1LEIA 3SRFA 3F65A 1S1PA 1P4BH 3L3KB 5FUOL 1KJVA 4EF9A 4U1MA 3EOTL 2ZWKA 4NXKA 5KBPA 1K7XA 4LHUA 5FV1L 1SYTA 1DUYA 3N0PB 1US2A 4ZS6D 1J2WA 1DE4A 6A3HA 3SPCA 3D87B 3CHRA 4V1DE 2I9UA 1RU9L 2OZ8A 1I8LC 5D7HA 4C1NA 4LOUC 4PJ8D 2UWEA 5TH2B 1SGJA 4K9EC 1U30A 2DOCA 3ARDC 2A9NL 4KJWD 2Y7LA 2WOYA 1YTKA 5DJ8A 4N90D 4Y1AD 1F11A 3JV4A 5LA1A 5D7IE 5C7VA 1NCDH 1SEBB 3R18A 4BDVA 3H6AA 1WCBB 5HGAB 1DFXA 2ZZ7A 5DMNA 3TYBA 1M71B 2A6KB 4YC2B 4G83A 1IGSA 4LVFA 3WGUB 2VDML 3SPJA 5G4EA 4R5TA 5I0VA 2UV3A 2CLVA 5HMEA 2W6RA 1IIGA 2DLHA 1PTAA 1GOWA 3EZ4A 1EHKB 3GJFK 4DJDA 4CCZA 3A47A 4K5NA 3AY4C 5EBMA 1T89A 2DIJA 4LOFA 4LAJH 4M02A 5HI4C 3GMMA 3KLHC 5I30H 2DIBA 2OOFA 5E2UL 2UBPC 1MWOA 4EAYA 3HZVB 3BFWA 2FCBA 4W9GC 3VQ2C 4S3KA 3NGFA 3EOBA 2XWZA 4XD3A 1J93A 5CJMA 1F73A 1U33A 1MCCA 2CBIA 1PD1A 2WANA 4F66A 4OZFB 2Z8SA 1YEKH 1NCAL 4OGAD 3RLUA 2IXQA 3QORC 4OGXL 2XVPA 1BOGA 2GLKA 4QSFA 3M8OH 5I18L 1K4HA 3UQNA