3BLPX

Role of aromatic residues in human salivary alpha-amylase
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
496
structure length
496
Chain Sequence
b'EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRARQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase 1
molecule tags Hydrolase
source organism Homo sapiens
publication title Structure-function relationships in human salivary alpha-amylase: role of aromatic residues in a secondary binding site
doi rcsb
total genus 176
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00128 Alpha-amylase Alpha amylase, catalytic domain
X PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3blpX02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3blpX01
2XM2A 2XSBA 4BF7A 1JAKA 3OG2A 3BCFA 4AZ5A 1QX1A 4V2XA 2EAEA 1TFVA 3VTRA 3SCRA 1GJUA 3ZJ6A 3VIGA 2X0YA 3POCA 4LX4A 3PZVA 5CXPA 4RE3A 3TTSA 3PZGA 1DWGM 3KLKA 1GOQA 1AQHA 2VC9A 4B16A 1PPIA 4N42A 2D23A 4FK9A 3N1AA 2O9RA 2XVPA 3RM8A 5A2AA 4OIFA 4WSKA 3WFLA 3WMSA 3AROA 4HPHA 3TONA 3WEMA 2QHAA 1ZS2A 1C8XA 1J18A 3OBAA 1ZL1A 1E73M 2WPGA 2VX7A 4F9DA 4FNUA 3RMEA 5FCZA 1KTCA 3TOPA 1W1PA 2EABA 1UD2A 4OUEA 2WVTA 2J78A 1G9HA 2FGLA 3PZTA 2VRQA 3AHZA 1VFMA 4QLJA 1WCGA 2GJXA 1QWNA 2OSWA 2IUZA 5DF0A 5F7UA 5CPSA 3VINA 2Y8KA 1UA7A 4B9ZA 1W9PA 3L4UA 1JZ6A 4UQCA 2VURA 4UQEA 3SCOA 4J3VA 4JKKA 4PTWA 1B3WA 1GQLA 3A4WA 4A3YA 3IAQA 4DM1A 3ECQA 4CVUA 1W3LA 1TUXA 3NDZA 4HOZA 1UH4A 1ZJBA 2D3LA 2CPUA 2DSUA 3EJRA 1XSJA 1HJQA 1LL6A 1E3XA 5EBAA 1WDQA 1LWHA 1XV8A 1EXPA 2VRKA 4EK7A 5IHSA 2ZXAA 1VBUA 3D4ZA 3VDHA 3TP4A 2EPKX 3SIMA 2XVGA 2VL4A 3ZOAA 2DH3A 2XPKA 1J0IA 2BXYA 2PBOA 2E9LA 4GKLA 5BRQA 4AZ7A 3CH9A 1UUQA 1ITXA 1CXFA 3LXAA 4H7VA 1ISZA 2WNWA 3ZIZA 2DSZA 1UZ4A 4OOZA 3LPPA 3MMWA 3W28A 1UQZA 3EMCA 1GCYA 5JIPA 1GQKA 5M17A 3FAWA 1JFXA 4MNMA 1J9YA 3CZKA 3ARWA 5A8NA 2WYSA 1W32A 3EMQA 1E40A 2V5DA 2VT0A 1JI2A 2WHKA 4OBRA 1XH1A 1CZ1A 1YHTA 2V3GA 1E5JA 2WMKA 5GNXA 2C8NA 1O6IA 1R75A 2OYLA 3AHTA 1JXKA 5JBEA 2D73A 3NIYA 5ECUA 4OJYA 1HKIA 4NRSA 3I3EA 1UWIA 2PB1A 2EACA 1OB0A 3DYPA 4ML4A 1RP9A 4WIWA 3ARRA 1OGBA 2EO7A 3EDFA 3LPOA 3CUJA 4H8UA 2CYGA 1XCXA 1PIFA 4IPNB 1G0CA 4PMQA 1BVZA 2J79A 3L4XA 5CPQA 2Y4SA 4AEEA 3MMUA 6TAAA 1W3KA 4GPNA 4AD4A 3VIFA 2FH6A 3EDEA 4AZCA 1HL8A 3VOCA 3MSDA 4UCFA 4DWSC 4HU8A 1PEZA 1GQJA 4UFKA 1B90A 5A6LA 2CERA 2W4XA 3D50A 4H8VA 6A3HA 1JDAA 1HVQA 2DSVA 3ARVA 4JFTA 5EFFA 2X09A 1KR1A 3D52A 4CCEA 3WDPP 1V3IA 5A6KA 4BQ4A 2Q8XA 3MO4A 4IISA 1KQYA 4D72A 1J0KA 2PI6A 1V6YA 1K6AA 3ARQA 4ZENA 3MANA 3VD5A 2G3MA 5E9AA 2XGBA 1QOXA 1V3HA 2IGTA 3QOKA 3SUWA 2PBGA 4AZGA 1KBKA 1R34A 4WKAA 4NX0A 2XIIA 7TAAA 1MQQA 3CUFA 2OW6A 3VILA 1UWSA 5JBDA 5HPOA 2BNJA 1F4AA 4CD8A 3BAYA 2VO5A 4Y7EA 2CCRA 1V02A 1PJ9A 1G1YA 3QGVA 1CGXA 1HJSA 1UKOA 1B3VA 2XN0A 1WDRA 2W63A 3KWXA 3O2LA 4GINA 3ZT6A 3WNKA 4W7VA 3W27A 1VB9A 2BHUA 3CZ8A 3MV11 2F2HA 4JIEA 1GVIA 3LRKA 3RM9A 3MUZ1 2QMKA 2YBUA 1CENA 3VIJA 3A23A 2CHOA 4CN1A 2X8RA 3K8MA 1JD9A 2V3EA 4Q7NA 1MQRA 3AS0A 1HKMA 3N17A 3F5LA 4D6CA 2YJQA 2EPOA 1NARA 1XHGA 2CBJA 3CO4A 2NT0A 1SFSA 2XVKA 3DECA 1EGZA 1VEMA 4PEEA 1K9FA 2XTKA 1EQCA 3ZJ8A 1N82A 3BSHA 4U5KA 3WENA 2CHNA 1JXJA 2D20A 3SUSA 1EO5A 5LA1A 4W86A 3EMZA 2HISA 3JUGA 4JL2A 4MJ4A 4D6EA 3RIKA 2YDSA 3VM7A 3ZSTA 3SUVA 3OGSA 4ATLA 1IT0A 4XB3A 2WANA 2VZOA 3A4AA 4UFIA 3QR3A 1C7TA 3AIBA 2Y2WA 1TQWA 1JG9A 4GIAA 4NF7A 4YN5A 1E1EA 3AHYA 2WBGA 4J7RA 4PCTA 1OINA 4ZXLA 1CTNA 3IGUA 1E4NA 1LQ0A 2DT2A 4AMWA 1U2YA 4FNRA 2JEQA 4Z2JA 1HTYA 4TX8A 2XWDA 5BCAA 3N18A 2WWCA 3QHOA 3PZOA 3HG3A 1XSIA 4CD4A 1MFUA 5FL1A 1OWQA 4GI9A 2BVDA 1W9XA 1VJSA 3KLLA 5D9OA 2BY1A 4OZOA 2FHCA 4H04A 5A6MA 1CIUA 1V0LA 3BVUA 1V6WA 3SCWA 4D6DA 5FOOA 1V03A 2E4TA 2F18A 1MW0A 2FHFA 4NRRA 3A22A 3EDJA 1MQPA 2VNCA 3WNNA 3WN6A 3GXFA 1PX8A 1HP4A 2WHMA 2JALA 4KRUA 3HN3A 4UR9A 1L8NA 5HXMA 5ABFA 1EDQA 1SZNA 4UOQA 2J7GA 3CMGA 3UERA 1QW9A 2X0HA 2BXZA 3OA5A 4E8DA 3RO8A 4AIEA 1E4MM 2DDXA 1CXEA 1EIBA 1OM0A 3PTMA 1KXHA 1HX0A 3WDHA 3AIEA 3THDA 1DWIM 1ZB5A 2VVSA 1JZ3A 1B2YA 1DP0A 1X6NA 3RCNA 3WY3A 3PN8A 2GVYA 3AZTA 2WVVB 4ZE5A 2DPEA 4PMNA 3I3DA 3TV8A 2EQDA 1V0KA 2YL6A 1CGWA 1KTBA 1FFQA 3G6LA 3HJEA 3GNPA 1E1FA 2BY3A 4AD5A 3DYOA 3T0BA 1JYWA 4HTYA 1J0HA 2JF7A 2IXVA 4X9YA 1LF1A 1R87A 1WB0A 2O92A 2W5FA 2DH2A 2WCSA 5AY7A 4MNJA 4ATDA 1UKSA 3KE0A 1B30A 1LWJA 4AY1A 2W67A 2C7FA 1UR1A 1WZAA 2J25A 1UH2A 4ATWA 3WBEA 3MUY1 4R27A 1O7AA 1GOWA 4PRWA 4D6GA 2J7EA 4QCEA 2VMFA 2QV4A 1CGUA 3VMOA 2J8FA 3K1DA 4W5ZA 1LG1A 2CETA 3LPGA 3UEQA 2XYLA 4QLLA 2VCCA 3RJXA 4UQAA 4UOJA 3VNZA 1VEPA 2G41A 5ABHA 1VIWA 1MW3A 3GH4A 1CWYA 5A94A 1TVNA 1W91A 4AZIA 2VR5A 2ZXDA 5ABGA 1UKPA 3K4DA 3S2CA 1T0OA 2GK1A 1PBGA 4HU0A 4JKLA 3I3BA 1H41A 2YDRA 1CLVA 3CZJA 4W8LA 3UG4A 4BQ3A 5IDIA 2J7FA 2CXGA 1EOKA 5JUVA 1BSIA 4F8XA 2J74A 2WMGA 3VD7A 4B3KA 4DO4A 1DWHM 4BQ2A 1CBGA 2E9MA 5CLWA 3H54A 4HPGA 1UR2A 5HPCA 3BUDA 3OLEA 3SCTA 3AXIA 2CNCA 3FHAA 3DX4A 3VKKA 3BVXA 3PTQA 3H55A 3ZJ7A 3N15A 3UCQA 3UG3A 2VQUA 1HT6A 5GQBA 1OGSA 1E9LA 1Z32X 5BROA 1CEOA 4NXSA 1TQTA 2O9PA 4W93A 1KCLA 3OGVA 1Q6GA 4N0RA 1JYXA 1UKTA 4GI8A 1MWOA 3DX1A 3WD3A 3SCPA 4TTUA 1NH6A 1HKKA 3BCDA 1VRXA 2OSXA 2XIBA 3WD1A 1UG6A 4MNKA 3VDBA 3AS2A 3VX0A 1J0ZA 4ZE4A 4AMXA 3SCVA 2WC3A 1X6LA 3AFBA 1B31A 3E1F1 3L2LA 1D7FA 3TTOA 1HXJA 3SUUA 3VGDA 3ARZA 3OLIA 3IK2A 3CZLA 2WMIB 1E71M 3T0DA 1H0GA 1KFWA 3SCNA 2QPSA 1CNVA 3CLWA 3ZMRA 1FH7A 3K4AA 3MS8A 2PF0A 1JDDA 3W0KA 4BQ5A 5ABEA 2GK1B 4HMCA 1NWUA 2EADA 3LPFA 4AZCB 4PYSA 3WKZA 3MUAA 2WC4A 2VZUA 4XUYA 4AZ6A 1TQSA 1UR4A 3KZSA 4AYGA 2DGAA 2XUCA 1M04A 1Q6CA 3AXHA 2X2IA 4LYRA 1CLXA 2AAAA 2YKKA 4U3CA 3CPUA 4JFSA 2D1ZA 4GXPA 4CCCA 1QI3A 1FA2A 3LMYA 3WH6A 3U7BA 1V6UA 4PMXA 3WDJA 4YPJA 1OSEA 1QNRA 2F1AA 5GPRA 2ZUVA 1F4HA 2CBVA 3WSUA 5IHRA 5LA2A 4FLQA 3VX1A 3WEOA 2CKSA 1G5AA 4M8UA 1NOUA 3VGGA 5LA0A 1B0IA 3ZR6A 4XX6A 3BLPX 3DX3A 3LX9A 1V02E 3G6MA 1ZJAA 3F5KA 1ZBVA 3WH5A 2WK2A 3EJQA 4EKJA 1KQZA 1ODZA 1K9DA 1R85A 5HNNA 1JDCA 1D3CA 1WNOA 4HMDA 3W53A 3TTQA 4Z2IA 3OGRA 3RILA 3PZMA 3QOMA 1MXGA 1I1XA 1R47A 3K8KA 1X1NA 3AMGA 4KH2A 4W85A 4GI6A 3CHEA 4JCMA 2JE8A 3FN9A 4NZCA 2ZUWA 2G3IA 2EBNA 3RPMA 2DIEA 3S5YA 4CD7A 1NP2A 2A3EA 1R7OA 3H53A 2JF6A 4JCLA 2UY5A 1QNOA 2XN1A 1TQVA 2EPNA 1BLIA 1GNXA 1MFVA 1R7AA 4C7DA 1JNDA 3DHUA 3GNOA 4J3SA 4D6IA 1B9ZA 2WSKA 2ZOXA 1V08A 1J11A 4HA3A 1V6VA 3RJYA 3ZSSA 1AQ0A 1J10A 3MV01 3HG5A 4AYSA 3M6DA 1V6XA 3FW6A 5M03A 2XVLA 2VCBA 3MI6A 3BUQA 3K8LA 1Q4NX 4LYQA 5EMYA 5BXRA 2WKLA 2WVVA 1EH9A 1ISXA 4TTGA 2MANA 2QLYA 1C91A 1H4PA 4UFHA 5DEZA 3KL3A 1KGWA 2XFYA 1J0YA 3WNLA 2OYMA 2UY4A 1LJYA 1NOWA 1FOBA 1XH2A 1V3LA 1JGIA 3CIVA 4PMVA 4Z2LA 3GH5A 3L4VA 3FNDA 4MTVA 2WMHA 4UFMA 4Z2HA 1C8QA 1Q6FA 2VCAA 3VIHA 3BXWA 5CZKA 3VD3A 3WD0A 3BSGA 2J77A 1VAHA 1XGZA 5A2BA 2X05A 3CZSA 1PX3A 3BMWA 1UD6A 4E2OA 1NM9A 1OCQA 3SUTA 3LRLA 4UQ9A 1WE5A 3AHVA 4DWSA 2WCAA 4W7WA 1BG9A 3AI0A 1JZ2A 2F1BA 1DWFM 6CGTA 3VGEA 3ARYA 1GORA 4D71A 1H1NA 1LL7A 5JIWA 2RGMA 5ABFB 1M7XA 1US3A 3QHNA 2W91A 2WCGA 2BY0A 1JD7A 1E0XA 4J3XA 2ZX6A 4TX6A 1M53A 4DUXA 2WLZA 2VZTA 5D4YA 2E8YA 1UWTA 5AYBA 1PZ3A 3W6LA 2BHYA 1QHPA 1SYTA 3EJTA 4MAVA 3GXDA 3WUEA 4M56A 2OSYA 3MSGA 3BLBA 1PZ2A 3CGTA 2J7DA 4FLOA 1GOIA 2BY2A 1BF2A 4UQBA 2V5CA 1Q6DA 4D6JA 3VIOA 5M5DA 1IZKA 2YA0A 1KXQA 4L4PA 3ZT7A 3U5UA 2J75A 3CZNA 4WF7A 2ZE0A 1BYCA 4UZUA 4LXFA 2J7BA 1B3ZA 2CIPA 1UR9A 5BXTA 1CXIA 1W9DM 5BXSA 3BC9A 2F7PA 2F61A 1E43A 2EJ1A 2Z1SA 4AIUA 2WW5A 4OGZA 2J47A 2PWGA 2XSAA 1TQUA 2EPMX 1UD8A 3GXTA 1TA3A 4FLSA 4DO6A 5CGTA 4HMEA 1NWRA 5DFAA 2BFGA 1Q6EA 5D8WA 5GNYA 1E6ZA 1BPLB 3AYRA 4U33A 2YDQA 5A6SA 3PZNA 3W38A 2WWDA 2DT1A 3WD2A 2VUYA 1HJVA 1GZJA 3SCUA 5A1AA 1JI1A 4PMOA 3RDKA 1QI5A 1W1TA 1QWUA 5A8OA 2BV9A 1ITCA 1JL8A 3WDIA 3ZR5A 1W3HA 1JF5A 4XV0A 1C8YA 1JIBA 3ZJKA 1J01A 1MXDA 1E70M 3ZQ9A 1VBRA 4CD5A 2J7HA 1RD6A 2CBIA 4MB1A 4PUEA 3KL5A 3PBGA 3VIIA 3VGFA 4XZWA 3CUHA 3CUGA 4CVWA 4KRTA 3CHDA 1E3ZA 3FAXA 5A6AA 3A24A 2WMIA 3WDQA 4PSRA 1FH9A 4AD3A 3UETA 1O7DC 4GQQA 4FF5A 3WMCA 1XRVA 1XH0A 4FMVA 4NSBA 1W1VA 1UWUA 3GXPA 3GDBA 3HG2A 4A4AA 2QF8A 3AMCA 3WQWA 1V0NA 7A3HA 3WH7A 2D22A 1QPKA 3EDDA 3NUKA 1M03A 3GBDA 4HZ8A 1ISWA 2VI0A 1CYGA 1HXKA 3A5VA 3O6AA 1EA9C 3PHAA 3A4XA 1TR1A 4AZHA 2CESA 3WELA 2GSJA 5A3HA 2FGZA 1WPCA 3N04A 4M1RA 3WF3A 2NT1A 4PTMA 1VJZA 4AD2A 1GHSA 3CZGA 4AC1X 1U30A 2XFFA 3WF4A 2ZX5A 2WVUA 4CGTA 1OIMA 1UOKA 1EDGA 1EO7A 3DX2A 3WIJA 4BA0A 3WH9A 3MUIA 4JZ5A 1K9TA 1OD0A 3GH7A 1CGVA 1NP0A 5IFTA 5A6JA 1B3XA 2WZIA 3EYPA 4Q22A 1FP8A 1HN1A 4RL3A 2FDMA 3NJ3A 1V3JA 2X1IA 4MB3A 4P7OA 3VPLA 1C3FA 7CGTA 3AIQA 4H41A 3AYSA 2W66A 4ACYA 2ZX9A 2XHYA 5I2UA 1E55A 4P8XA 4PBGA 2VX6A 3W25A 2YFNA 4M24A 3WL1A 3MMDA 3FHQA 2WZEA 3W81A 2WVSA 3EBVA 3SEPA 3D51A 5A95A 1A47A 1HIZA 4Z2GA 2D3NA 2OWXA 4PCSA 4LYPA 1DWAM 1WP6A 5E6ZA 4B3LA 1TVPA 4GZIA 3AZRA 3ARSA 2WBKA 2JEPA 1B1YA 2ALWA 4H2CA 3FXYA 4EANA 2D0HA 1ZBKA 4PMDA 1EHNA 2ESCA 1W2VA 1XYFA 3DYMA 3WY1A 4M80A 3AMDA 1H2JA 5E0CA 2FH8A 3BAXA 1BVNP 4AIOA 3AISA 3A47A 2OYKA 2PWDA 1G01A 1LG2A 3AS1A 3K46A 1JZ8A 2XM1A 1UZ1A 1J12A 4PMUA 2WAGA 2PWFA 4W88A 3OLDA 1QBBA 1BYDA 4X0VA 3CUIA 2YL5A 1W3JA 5FIPA 3BAJA 3ARPA 3HMCA 5I5RA 4TOQA 1JFHA 3DDGA 1ZBWA 4AMCA 5A8QA 1OD8A 1XD1A 3VU2A 1RPKA 5C70A 1PX4A 3HZ3A 3T09A 3WNMA 4XZBA 3II1A 5I79A 1HKJA 1KWKA 3TTYA 3PZ9A 1A3HA 4QDMA 4UTFA 3BUBA 4OOUA 4MJ2A 2QPUA 4DM2A 5DT5A 3UR7A 2G3NA 2PWEA 2XJ7A 3W24A 3WNPA 4PMZA 4DUVA 2BVYA 2WZHA 1GW1A 1KXTA 3D3AA 3OZOA 4M81A 5AC4A 1UYQA 3FY1A 1BHGA 3QHMA 4ZEPA 2UY2A 3WUGA 1GVYA 3A3HA 4F9JA 3AMLA 1WAWA 1S46A 1NOFA 5KEZA 3VVGA 4ZXOA 4J3TA 1UA3A 3S5ZA 3VDAA 2CITA 2A3CA 2GJXB 1XSKA 4U31A 4D1JA 3HU7A 1KB3A 4E4PA 1XCWA 3GZAA 4GZJA 4CUCA 5IXEA 1UWQA 2YA1A 5C71A 2ZX8A 4U2ZA 1MYRA 5I78A 1E56A 2VVNA 1SR0A 3VUPA 1TA3B 1E6RA 3EJPA 2ZXBA 1E6SM 4P7LA 2X2JA 3IJ8A 2WMFA 2AMGA 4BS0A 2UWFA 1E6NA 4TXEA 4RE2A 2DEPA 4P8VA 3VDCA 3AICA 2XGIA 5HBFA 1I1WA 4P8WA 4V28A 3WF1A 2WMJA 1E15A 3WDRA 4IUGA 1NQ6A 2JIEA 3RM4A 3B9EA 2E9BA 3WF2A 4BCEA 4TVCA 1FHLA 3NSNA 2XN2A 1WZKA 1NWTA 4GQRA 3DC0A 5D8ZA 2J62A 1V3MA 1GHRA 2G4FA 1I75A 2A3HA 3CV5A 1UH3A 2ZIDA 1J0JA 1AMYA 4J27A 2ZUNA 1G94A 3POHA 4JHZA 1UHVA 2W61A 3BUPA 2W62A 1PS3A 3VD9A 4BZYA 1PIGA 1SMAA 2WC7A 1W1YA 1E6PA 1BAGA 3CHFA 1CXHA 2YOCA 3GTNA 4TVDA 2ZX7A 3IJ7A 4KGJA 5FD0A 4LQ1A 1E4LA 3WMBA 4ACZB 3VSTA 3AOFA 1UASA 1GUVA 2EPLX 1VENA 4PMRA 3N13A 1H3GA 3LXBA 3WL0A 4CU8A 3BAWA 1JZ4A 1WO2A 3WQVA 2OLHA 3PZIA 1HVXA 2AOSA 1DEDA 4TVUA 2ZWYA 1BGGA 2VZSA 1V0MA 3ALFA 5D9NA 5LYRA 4U2YA 4S3JA 1K9EA 2DSWA 3EJUA 2F8QA 5A6BD 3M46A 4PMYA 4MDPA 1FHDA 1IZJA 1JF6A 4W87A 3WQ8A 2Y5EA 1CXKA 5BRPA 2C0HA 1PAMA 3BGAA 1VFFA 1BQCA 1BGAA 1MW2A 1B3YA 1FFRA 1LLOA 2BS9A 2BHZA 4MB4A 2OW7A 1UD3A 1WZMA 2GFTA 2XG9A 2G3JA 4TUFA 4WLCA 1XC6A 1KCKA 1QI4A 4JFVA 2J4GA 3GM8A 4UFLA 2GJRA 4MNLA 1QI2A 1UKQA 1BYAA 4AD1A 4M29A 3WD4A 3MKKA 2GDUA 4P7RA 4WKFA 4CCDA 1JYVA 1H5VA 3VSVA 5E1QA 2ZWZA 2TAAA 1JNEA 1FH8A 4AEFA 3WF0A 5A69A 1OGGA 1BYBA 4S3KA 2DSKA 5BWFA 1US2A 5HOSA 4U5IA 3PZUA 1C90A 2D24A 2YLAA 1ISVA 2OWWA 3UG5A 4EAMA 3A21A 4NZFA 4EE9A 4PSPA 4H8HA 1L0PA 1NWSA 1UR0A 5DT7A 3VD4A 4W89A 2GUYA 1QNPA 1KGUA 3GXNA 2B31A 3T08A 2VZVA 2V38A 3T2OA 1SMDA 4DWSB 4DWSD 2ZICA 3VM5A 1W9VA 2OWCA 2O9TA 1GOKA 2ZUMA 1ZBCA 2IXUA 1OT1A 3M7SA 2YFOA 2E40A 3OZPA 2WM0A 1JZ5A 3OB8A 3IANA 1E0VA 2D2OA 2O9OA 3UR8A 1AQMA 3AIVA 4V27A 3GYCA 4HOXA 3UESA 1P6WA 2VR4A 1EOMA 4K68A 5E0FA 1VF8A 3B8SA 3ZT5A 4W8BA 1QNQA 3ARXA 3WFZA 2ZUTA 5TD4A 4NZJA 4M82A 3W6MA 5CPTA 1MW1A 3BMVA 3GXIA 3VSUA 5A8MA 3ARUA 2DT0A 3F5JA 2F7QA 5I3DA 3N11A 5GNZA 1CECA 3WY2A 3U57A 5A8PA 5DO8A 5BXPA 3M07A 1HNYA 4QFUA 5C8BB 4C7FA 3CZEA 5CJ5A 2WXDM 3CC1A 4CN6A 2XWEA 4FNSA 4YHGA 1ODUA 1TCMA 3F4VA 3OIHA 4YHEA 3L4ZA 4NI3A 2PC8A 3N12A 1HL9A 1KWGA 9CGTA 4MB5A 1ZU8A 1KR0A 4JKMA 2J7CA 4D1IA 5I24A 1VEOA 4MDOA 4X0NA 3W26A 1RH9A 4QCFA 5I6SA 5CSYA 4NXKA 2WSPA 1OT2A 5IFPA 3L4WA 4QLKA 2VX4A 4FNTA 3BVWA 3VGBA 3AIRA 1CGYA 2VQTA 4PTVA 4UZSA 1C7SA 3W82A 1D2KA 4W84A 3SCQA 2Z1KA 3D5HA 4AWEA 1QHOA 3U5YA 1QNSA 4KMQA 4AZBA 1WDSA 3BH4A 3LXCA 2G8ZA 2PWHA 1DWJM 1FP9A 3NSMA 4MADA 3KEHA 2X2HA 3IJ9A 3VIPA 3NCOA 4W5UA 1JAEA 1E72M 4MAZA 4J28A 1HJWA 3O9NA 1TMQA 4UOZA 4W7UA 3WEZA 1CPUA 1XD0A 4AXNA 1CXLA 5E70A 3NDYA 3S6TA 4FNPA 1UR8A 2X2YA 5DMYA 2VTFA 1HP5A 8CGTA 3EDKA 4PTXA 4DUWA 1BTCA 4HZ6A 2F7RA 1KXVA 3T2QA 5FL0A 4HA4A 4AW7A 5D9MA 4P8UA 2YL8A 4J3UA 1R8LA 1UQYA 3OLGA 4JHOA 4GZEA 3BVVA 1VFUA 4CU6A 1M01A 2WHJA 3VIKA 1C93A 1KBBA 1JYNA 2E8ZA 1RP8A 1QHZA 2YA2A 4U3AA 5A6BA 1E6QM 2VX5A 2UY3A 4OBSA 5CSUA 3CTTA 5EFDA 2A3AA 1HJXA 1KGXA 5I0DA 2WHLA 2JIWA 1UD5A 4GO9A 4J3WA 3AXXA 3CMJA 4JFWA 1W9BM 3MU7A 1EHAA 3ALGA 1GOMA 3WUBA 1AVAA 4WKHA 1DTUA 3DX0A 3WBAA 1YQ2A 3CHCA 1XYZA 3B9DA 2CBUA 3AIWA 3DHPA 5BYWA 1BG4A 3IAPA 3GBEA 4PUDA 3WUFA 5D9PA 1QW8A 3B9AA 1VFOA 4CU7A 2NW0A 1WDPA 2FHBA 4HA1A 2XFRA 1W2PA 3BAIA 1MVYA 3VMNA 4KGLA 3U7VA 2J8GA 1TZ7A 3WH8A 4JL1A 2FYVA 4MPKA 1WKYA 1UD4A 1H0IA 1GONA 2E3ZA 2F7OA 1E6XM 5I23A 5AC5A 2YBTA 5CG0A 5AYIA 2WKGA 2NSXA 2CEQA 4HZ7A 4C7GA 2YL9A 3J7HA 3NYDA 3BVTA 1CGTA 4WJXA 3GNRA 2D0GA 1C92A 3VO0A 3AZSA 1DHKA 3ZO9A 2HVMA 5CQ1A 5KZ6A 1E5NA 3AMKA 3W37A 2Y8VA 3GXMA 3T2PA 4CD6A 3L4TA 3LRMA 2GDVA 4ZFMA 4R5EA 1QI0A 1U33A 1OBAA 1R33A 3DDFA 3ARTA 4UFJA 3W4RA 1LL4A 1UWRA 4QP0A 2BVTA 2E0PA 4DO5A 3KL0A 2DIJA 2CKRA 4B15A 4D6FA 1V3KA 2Y24A 3PZQA 4Z2KA 4AISA 5HDRA 2EXOA 3SCSA 3BLKA 4FNQA 3W29A 2V3DA 1OIFA 3WQ4A 3ZM8A 1EQPA 4WK9A 3A6OA 1E0WA 4IM4A 2W92A 1ECEA 2YIHA 1H09A 3BAKA 1W9UA 1ISYA 4P7QA 1BFNA 5CGMA 2VOTA 4F66A 2WLYA 2QMJA 2ZUUA 3CBWA 3TA9A 4WSJA 4D6HA 2YLLA 5M3WA 4ACZA 1TG7A 3HG4A 4W8AA 5CLTA 2WB5A 3SURA 3AS3A 2FE0A 4UNIA 8A3HA 4QAWA 3PTKA 1ESWA 1CDGA 4E8CA 3WY4A 1QBAA 4LGXA 4HP5A 3WQ5A 4CN4A 3NSXA 4LPCA 1H11A 1Y7VA 3L2MA 4URIA 4FLRA 4RE4A 2A3BA 5JBFA 4L4OA 2VJXA 5EB8A 5A2CA 1R86A 1IV8A 5I77A 4A3HA 3APGA 2DQXA 2ZXQA 3VMPA 5E6YA 3N9KA 3BUIA 1EDTA 1TE1A 3AJ7A 2ZUSA 1H49A 2GJPA 1GQIA 1WZLA 1GOOA 4UQDA 1R46A 4PN2A 2EEXA 3L4YA 2VRJA 2RGLA 4JAWA 1GJWA 3THCA 3VNYA 1GPFA 3AHXA 4P7NA 2D0FA 4B9YA 3VGHA 4F79A 2XVNA 1QVBA 4CKQA 4AD0A 5E09A 3VIMA 3AQUA 4OKDA 4KWUA 2V3FA 1JZ7A 3EJSA 1HF6A 2JFEX 3WNOA 3AIUA 1HWWA 4JFUA 3T0AA 3WQ6A 1E4IA 1HJUA 4GO8A 2DT3A 3D4YA 4HOWA 5FKYA 4IPLA
chains in the Genus database with same CATH superfamily
2EDFA 4NZTL 3QLDA 1YSOA 3CL6A 4G59C 1RZIA 4KRNA 3VXSA 3FQXB 1UTDA 2LW3A 1BQKA 2JJSA 4IMLB 4UILL 5FO8A 1AGBA 3CSYB 4MJMA 2HFGH 1BXAA 3D0VB 3K74B 4R0LC 4O1DA 4AM0B 5C86A 4J8RB 2G5WA 4JDYA 1QRNA 3H9YA 2AL2B 2X0YA 4QSHA 3F8UB 3LKSA 2WQXA 2O7SA 2YK1L 3PFQA 4RE3A 2YSSB 5EZJB 3WLOA 2LU3A 3TTSA 3CV7A 3MNDA 1N7MH 2JKTM 3PABA 4AI7A 4JS7A 2Z7KA 5TE6L 4Z0JA 1KELH 2H6UA 3BZDA 5ERWA 1AW1A 1PTZA 2UZIL 4XBEH 3M1BB 4XN7A 1R2RA 1CL7I 3QYSA 3W7EA 4JPWL 4AWTA 1NC4D 3U7WL 4Y5XB 3BPOC 5CAHA 1NMBL 4Z0XB 5I74C 2CA3A 1AQHA 4ENZA 2A3TA 3EWWA 1PPIA 3GNXA 1X5FA 4D94A 1J88A 3JWNG 4Y2NA 3W56A 5T1DL 2VDGA 2D23A 4FK9A 4ONVA 1W72L 3QJFA 3SBFA 3P2DA 2GSGB 3ME0B 4PGCB 4TQHA 4JK0D 1DORA 4DXVA 5HGAA 1FNHA 2YPKB 5KBDA 2IH1B 4PJ9A 2ZRYA 1NGYA 4JTTA 3WFLA 4G42B 1NAKL 4HPHA 2HT3D 2JIXA 2GJNA 1KYDA 2QHAA 3LSBA 1U8MB 4RCAA 3CXFA 1NFKA 2PO6A 1E73M 2RFXB 2Z7ZA 4GKNB 4KX9A 2CIIA 4WW1A 1MFDH 1NAMA 3VXOB 4F9DA 3V0DA 3BKJL 3PBYA 4EF8A 1SBBA 3W0WE 5C6TL 2AEIT 5RUBA 1KTCA 1W1PA 2Z8WC 3DX7A 1OP3K 1E4HA 4NYLB 3MRLB 2ICWB 4HFUL 2WVTA 1ZLVH 5HGGS 4TR9A 2AXJA 1TTCA 3L4CA 5D7SH 4M93C 3T6CA 1U83A 2FGLA 3QBTB 1JGMA 4GFTB 3M0XA 4ES9A 3ML8A 2Z31A 4OM0H 4XNXL 3PZTA 4Y1SA 4Y5YB 1XLCA 5I3GA 3U9WA 4GYPC 4BJLA 1VFMA 5F8RC 5IQ9B 1KENL 4A7TA 3PJTA 2WNKA 2OSWA 2WWNA 4HC1L 5DZ9A 4HFWA 4FGMA 1AQDB 3NJMA 4Y19E 2LV4A 2GPZA 2W65A 3AREA 1Q0XL 3F84A 3LOWA 4B9ZA 5ESVB 5CEZD 5BRZA 4UQ2A 2AMXA 2DF3A 3O41B 4FQXA 3G8RA 3ONBA 1JZ6A 3SOTA 4ZQMA 1TTIA 3P0YL 5MEOB 4X9GA 3MGOA 2VXTH 3FL7A 5SV3A 4BCXA 3UZWA 1UR3M 4JKKA 4N2EA 3WSQH 4I7WA 4UTMA 1M5WA 1W5NA 3CZFA 1ONWA 3UGXA 1KPVA 3UROR 3VJ6A 3QRFM 2BZDA 2WY3B 3I6RA 3OTRA 4CVUA 1XL6A 1H8LA 1TUXA 1XCTB 3SPGA 3KS0J 2AW2A 4TSAH 3PG2A 4I5XA 1YC8A 5K59F 3RVVC 4FJ6A 3N9GL 4S1QL 4BD4A 2CPUA 2GJZB 1MUMA 1XSJA 2UBPC 1HJQA 1LWHA 5AHLA 1EXPA 2VRKA 2Z0UA 4MNQD 4RMQA 5CP3H 1U1HA 3QW4B 4Q4PA 5IHSA 1VBUA 3D4ZA 1EANA 3TP4A 3KDMB 1GTFA 4WK0B 3SIMA 2XVGA 3IJQA 3F3HA 2DH3A 3KBVA 4I3RL 3TH6A 2MRYA 2BXYA 3KYMA 4QYAA 5DU7A 2H6OA 1BM3L 2CBMA 2W94A 2VDKB 2XXGA 3EYOA 3OC5A 4GKLA 5DD3L 2DEYX 4X7TA 5B4MC 2E9LA 2PBOA 1MSPA 3KOZA 1C5CL 4I9TA 4R4FH 3I4EA 4PRDA 3QIUC 3LXAA 4PFMA 3V1HA 4OCNC 1OAUH 4H7VA 2WNWA 5G4OA 1KB5A 3K6SA 5D96B 3KX6A 3ZIZA 2P9RA 2DSZA 1GMIA 3QXUA 4OOZA 1LQAA 1Q8MA 1VD6A 2P49B 5C97A 4WKZA 5GGRB 5T5FL 1FNSL 2PP8A 2VDQL 2WIIB 3MLRH 3O3DA 5E2VL 2OI9B 4A6YH 4YBHA 4FQQA 3ZDWA 5KTEH 1XFCA 5M17A 1CVRA 3TCEA 4JANB 4DAIA 4FFZL 3CNYA 3DGDA 3FU9A 4G6KL 4U4IA 8XIMA 3X3FH 2RFXA 5AVTB 2WYSA 1LNUB 4MJ5A 4XCEB 4P2AA 3PP4L 1W32A 1XUUA 4H1ZA 1NAMB 3G1XA 4JTQA 3IGAA 4GBXB 4OBRA 3ZL4H 1YHTA 3AACA 4S2SB 4JRXB 3GBNH 3EZ4A 5FF0A 3NQGA 2XFXB 4GMSL 2MOQA 4LP4A 1FFNA 4O00A 3WO4C 1LEIA 1ML1A 5GNXA 5B1KA 5XINA 1JGDB 1E27A 4KU1A 5AYTA 3IBEA 4C56D 5JIQA 4M5SA 1TZ8A 4MKVA 2W9DL 3TEXA 4XZNX 2BHFA 4XBPA 3NQBA 3NIYA 3HE7A 3B2UC 4PRHD 2FPVA 4NRSA 4AQ8C 5TF1L 3P9LA 4F7TA 4B96A 1TWWA 4UT6H 2ROXA 3UYRH 4GSQA 3NIFB 1TZOA 4LLMA 5IB2A 3FT2A 1P5VA 2PB1A 1T03L 3LKNA 3N14A 4LCIH 4N26A 1OLLA 2VAAA 3F58L 1AQDA 3D3VE 5ANMB 4AIXA 3D8MA 3CX2A 1OALA 3L6FA 3MR9A 3QO0A 4DGVH 5LGHL 3AYVA 4ZR8A 4UT6A 4WIWA 4YHYB 4NAQA 5D6DA 1CD8A 2Z4GA 2HCZX 2BM3A 1KEMH 1ZWIB 5DO2C 2GK0A 3UL4A 4JM4L 1HH9B 3LGEA 3DURB 5D09A 1KLFA 2CYGA 3L66A 1SXAA 3UOAB 1XCXA 5JLZB 1YTEA 4IPNB 1G0CA 4GXMA 4PMQA 3WJMA 1UA6L 1NDMA 3NA9H 3NSDA 2HPMA 4YDMA 1FWJC 5IHRA 1NGWB 1FGNH 2Y7MA 3D0LA 3B2VL 2Y4SA 3MMUA 1Q4WA 5JNYA 4AD4A 2F53A 1BV8A 2MCPH 1GW6A 4UAOB 5BW7C 4C6FA 5CEYA 1HL8A 1SO3A 3NABH 4G71B 4JX0A 4M1CC 5ESAB 5ISZD 4UCFA 3CFMA 2Z8VC 1TJMA 3DVIA 4PY8I 3W88A 1I4FB 2V5SA 4NNPL 4LBRA 3GDTA 1TZ9A 1Q1JH 4P2CG 4WUKL 4JFDE 4OI8A 1L6XA 4M3PA 2QSCH 4XVJL 4Y89A 2CDGA 3IV8A 6A3HA 4NUJA 1ES0B 1ND0B 4OKVB 2WUBH 2EE2A 2NY6B 3WDPP 2OJZL 2B1AH 4N1CA 3ROOB 2VXQA 1V3IA 1MZRA 1DBKH 4FX7A 4K3EH 3MO4A 2P8PB 3TUUA 5C2CA 2PPGA 3IDXH 1KQYA 5BUGA 1H7RA 43CAB 5B3SB 5FF6A 4S2BA 2EDTA 4WU7B 2ZG2A 1SR9A 5L4FA 3CFIC 1K6AA 1FPTL 2EE3A 2F15A 4NNPH 3SKOB 1V6YA 3HVNA 5AW3B 5HMFA 4W4QA 4WUUD 5IVXB 4ZENA 5DLLA 4IGBA 3VD5A 4G8TA 5E9AA 1INQA 2E1DA 5FAGA 1RUPH 3OQRA 1V3HA 1TJRA 4B60A 3QOKA 1D3HA 2ZUXA 3WU1A 4IP4A 1IJNA 3OJVC 3TCLA 1PY0A 1TPVA 5EBUA 4H0IA 2C7UB 4LEOA 4PULA 3MRBB 3IIZA 3U6XS 3GSWB 1A0EA 1WV2A 1V7AA 4AWUA 1CDYA 1R34A 2V17L 4WKAA 4NX0A 5EA9A 1A6VL 4GBXA 3AABA 1JWMB 4GW4B 2X0UA 5CLZA 4CC1A 5DC2A 3VRLF 4PS8A 7TAAA 1MQQA 2ACRA 3CFBB 3QR0A 1A3LL 5EIVA 1RZIB 3EWYA 1RIVH 3QS2A 4HWUA 1N0XL 3NZ8B 1E4XL 5D72L 4EN2A 5HPOA 1SN0A 2BNJA 1TYJA 4IMDA 2QQNL 4X7DC 4UCGA 3ZKMD 2QADD 3LN5A 3APCA 1A4MA 2C16A 4JIIX 1M7PA 2VO5A 3W11C 4B95C 1S7TA 4XVTL 1XVSA 3FXIC 4LDOB 1MI5E 5I75C 3WBDA 2NXGA 3HLAA 3OAYK 5CM1A 1V02A 4M5PA 1LILA 2CKNA 3WK3A 3OKNA 3P3TA 2FJFB 3TPUB 3BUYB 4Q7DA 1FL6A 5D7IB 4G6AC 2XN0A 1BYOA 3O2LA 4AF0A 4BKLA 1C5BL 1EGMA 1G6VK 2Y7QA 4UTBL 3QN3A 3W7HA 5BVPH 1HE7A 4LOEA 2GVGA 3EGXB 3GBLA 3TC9A 1YN7B 4MSWB 1LZOA 4X9IA 4B3ZA 3AREC 1M2VA 4LS2A 3LRKA 1CGSH 4RNIA 3VXRA 3WIFA 1D5XA 2BC4A 3GYEA 3P80A 3VWKD 4FALA 2CHOA 4FOUA 3NGBB 2V3EA 1MQRA 5DA0B 4FFZH 3F5LA 3N17A 1UB5B 1FWWA 3L3HA 2CBJA 3E9TA 5KTEL 3FC8A 4XZIA 1HHJA 2AQ2A 2JB5H 5IB5B 3UACA 3JUZA 3VFMA 4DF9A 4DJMA 4UM9D 5JHLL 1IQWL 1SFSA 5K3VA 4GYPA 4LAUA 2HRLA 2XVKA 3LB6C 4M00A 3LB6D 4DGUA 3ESMA 4IT1A 2CKBH 2BIPA 1IFGA 1IAOB 4KY2A 1K9FA 5HD8C 3PTDA 4GI4A 3W0WB 1H50A 2DRUA 3IACA 1X5GA 1GGYA 3E8UL 3ZE1B 5BQDA 1N82A 2CRYA 3BSHA 4U5KA 5ICYB 5KVFL 2C3WA 2B2XL 2CHNA 5MENA 3P3BA 3SUSA 5LSMA 4RNHA 4W86A 1JPFB 2HISA 3EMZA 3UNDA 4YIQB 4JL2A 4MJ4A 4ZFOA 4GRMB 4Y4FB 4HBQA 4KKBD 4QYOA 3RIKA 2APWA 3RZCC 1KFEA 2RHEA 3AB0B 3MV7E 1ME7A 4BQ6A 3DOSA 2X2GA 4U6YA 3GX9A 3NL2A 3ZVIA 2KLRA 5SX5K 1N8IA 4QWWC 4Y2WA 3TZVD 4KHXH 4DKFH 2RDTA 5L7XH 1NANH 3E6HA 3HC2A 4Y5VC 5LJYH 3A4AA 2ATKB 1TV2A 1ZD6A 3K1KC 3MUJA 5EO0A 3STEA 1WD8A 3V95A 4DP5X 3US1A 4UFIA 1MEXH 2HLAB 4E5XB 3AIBA 1BECA 2Y2WA 3QFDA 3SYOA 3DENA 4Y9PA 2XBTA 2Q0ZX 1KIQB 1L6GA 1FBIL 3AHYA 3GSUA 2PPCA 4J7RA 5DLMH 4IBTA 1CTNA 4N5ED 3IGUA 5FGBC 1WUNT 3F5WB 2EDKA 2R0LL 3UAJD 2I5IA 3C6CA 3QSRA 3P0YH 1JMXA 5I07A 4Z17A 1U2YA 4FXGB 5KVEH 3MLWL 3EWDA 1GZHC 3HTLX 5DA4A 3CD4A 4KZEH 2Q8LA 4Z2JA 4KKBC 2BCMA 1UM4L 2ICEA 2X9XA 2QDVA 2B4CH 3PWUA 4E9YA 1WWCA 5DJ2A 5E0KA 3EGSB 5DD6B 5CKSA 3N18A 1XLDA 4YGVA 5DBUA 2J2ZB 2WWCA 4YHNA 1XLAA 2B59A 3OVRA 3BCJA 1MFUA 2X6MA 5TF0A 1RLDA 2OAAA 2Y7NA 1OWQA 2CDFB 1MHEB 3MHUA 1JCKA 2Q8AH 3UAEA 1MY5A 2HTLC 1BXXA 4GRWE 3SCMC 4YCOA 1REQB 2CDEA 4TSBH 4KFZC 4XBGA 1EX1A 4FL4C 5D9OA 1XR8A 4JAMA 2UZXA 1E9QA 4I3SH 1N3NB 2EIEA 4NAMA 4G9FD 3INOA 2VWEE 4PGBA 4BK8A 2ZYIA 4MPQA 3BVUA 2OQJA 3KYOB 1V6WA 3SCWA 1J1PL 5E4IA 4D6DA 2MCG1 5FOOA 3P73B 1V03A 1W1A1 2OJPA 1MW0A 2OMVA 3HGOA 4NRRA 4QEHA 3A22A 3USBA 3UTZA 3WNNA 3H6OA 3ZLHA 4EI5A 1RKRA 3MAWA 1PX8A 1HP4A 3W2DL 1Z1WA 5IJVA 4WFFD 2N7BA 5CGBA 5HANA 3QE5A 3J07A 3C5JA 5HXMA 1T83A 2JH2A 3SW6A 1OFAA 3RGHA 2ZA3A 3JTBA 4DK5A 3BPNB 3U2EA 5JO5B 1WHOA 4P8QA 1VPYA 1UOZA 3I75B 3BHBA 1QNVA 1EDQA 1FL3B 3PP7A 4XZMX 1OO2A 5E7FA 5BO1H 4ZB0A 5T1DH 2VGLM 3G18A 1MIEL 1MELA 4LAQL 4FXSA 4H20H 3B97A 3VXTB 1KLGA 4W68A 1G87A 4L65A 3EOBB 1YVLA 4P57A 5AAMC 1IBYA 4LSSL 1M1XB 5C0DB 4ZSOE 4EI5D 3OA5A 1Y1UA 2PF8A 4GRLB 3V5DB 2REQB 4DAGH 1JGDA 1LGVA 1WBXA 4H1LB 4AIEA 1XGDA 1EIBA 1OM0A 3RO8A 5T5NF 1T2JA 4YTRA 2APXA 1G9MH 3UCRA 2X89D 1N6QL 4CNUA 4QXGH 1AJ7L 1PXGA 1HQ4B 2FR4B 1Q9OA 5AUMB 3LEVH 5CILL 3D05A 3IIVA 2DYPB 3THDA 1AZRA 4AYID 3PJLA 2OU4A 1AE6H 3PV6A 2KLSA 3JT2A 3VYNA 3TVMD 1G9MC 3G5XB 1XSOA 3GM0A 4XNAA 1Z2KA 2D9QB 5A2FA 1MXSA 1X6NA 3UTPD 2Y5SA 1YPFA 3FXGA 5I1AB 3PN8A 4Y9OA 1OQOA 1WSST 3CLEH 4FP8H 1A4JA 3GMPA 1PW3A 1AKJD 3X3GH 4O10A 5H8PA 2I9UA 4MWAA 4OD2A 5M7QA 3NFPB 4LVFA 4WO4D 3B2MA 1O5RA 3AZTA 3KPRE 2WHVA 2DPEA 3MBFA 4PMNA 3BI9X 1CZ8L 2QKSA 4XMZA 3EADA 4R4FL 1FCUA 3T55A 1V0KA 4RWYL 4HH9A 5DD3H 5E1AA 3QSTA 3B9VA 3EBIA 1Z9LA 5JQ6H 3O2DA 3ZYOA 3DV4A 3HJEA 4K38A 4DP6X 1E1FA 3RY4A 2A73B 3T1FB 4NJJA 2HZHA 4Z0XA 3WQFA 3V8OA 3JYCA 2VDPL 5F7DA 8FABA 4NP4L 4ELDA 1OOWA 1JYWA 4ANXA 5AW0B 1J1OL 4KJPD 1J0HA 3I6GA 3C5QA 2GSGA 3M0YA 4GQ0A 4DJEC 5LIWX 4E41D 3MJ7A 2PDCA 5BRZE 1GY1A 1WFUA 2EECA 4YSUA 1R87A 5SWUA 1RAMA 1A4KB 4Q8QA 5H35A 1JZGA 2DLGA 3KMDA 4PGBB 3FT9A 1EPXA 3W39B 5CZVH 3UTTB 4IQEA 4LUSA 3CLFL 4RFOL 4TNWF 1A6AA 2P3EA 4MYWB 3QUYC 5T8IA 4YL2A 1JZHA 4ATDA 4MJID 2FKPA 5C55A 5DUML 1KOAA 1B30A 2E75C 4NN7C 5T1LD 3B40A 1WZAA 1P4IH 3DVGB 4QXWA 4ATWA 4HQQH 1Z69A 4PR5A 3DVNA 5FK9B 2J88A 2JNZA 3B8YA 4F0MA 4X5QA 1E8ZA 1Q0XH 4IRJA 3W9EA 4CC4C 2X53A 2YAOA 2F38A 2UZYB 2J7EA 4NT0A 4IGHA 3W74A 1A4AA 5KZDA 1SEQL 3S8GB 4O5LH 3M1CA 2IG2L 4F15C 3BQ5A 4ALAL 1DDHA 4HG4J 4O50A 5HHNB 2A3LA 4JKPH 3K1DA 5MP6L 4LGSB 1X5MA 1DDTA 4PW3A 2CETA 3B7RL 4NT6B 5EZLA 4JPIA 3EXRA 1KY6A 3GS0A 1CDHA 3C0QA 4H7CA 4HCRA 3VZXA 4ZSTA 1AO7E 1L2QA 2GAZA 2JLPA 5ES4B 2G41A 3QV9A 1VCBC 4R96A 3MZTA 1GGIH 1JPHA 2Y88A 7PAZA 1CWYA 1VZGA 5A94A 4ZMWA 2Q3AA 3T44A 1W91A 2I69A 2ZNWA 5IVZB 4L6OA 3TW6A 3W23A 2Z91B 2AABL 3K4DA 1FL6B 4PUJA 2GK1A 4PJFA 3OWRA 2QHRH 4ZS6D 1BTMA 1X5LA 5JXEA 1NCBH 4KTDL 1MIEH 4LAQH 4X61A 4HJGB 4C6KA 4RAVB 2WJ7A 1SQMA 1TPXC 1X7SA 2VKXA 3OAZH 5BUAA 5DJ6B 3Q9PA 3VW3H 4NX5A 5BOOA 2KDYA 4KUCF 3Q6GH 3TCXA 3SN6N 5IQ7H 4WTXA 1FZMB 2CHDA 4QRAA 3QQWA 5D5ME 5JUVA 2A74A 3FZUD 4YO0B 4PV1C 2J74A 2OO6A 3GD6A 4GLRI 4MZRA 1RL1A 4IJ3B 1DWHM 3PAOA 4GB9A 1UWGH 4OTXL 4YDJB 2E9MA 2ZC1A 5CLWA 1UR2A 5JW4R 1KIPA 5FW8A 4QXTB 3FUEA 3OL2A 3BUDA 4KWVA 4N2YA 5HPCA 2VM3A 3FO2B 3N0PB 4KJQC 3IKCB 4OT1L 1NKRA 1CI5A 3M1OA 4GCXA 3KHJA 2QELA 4G1MB 4DB7A 1SYVB 1XGUA 1L0YA 2XJLA 3TMLA 1R0AH 2R8WA 1C1EL 3RGBA 1LEKB 3VFOB 3UCQA 3ZJ7A 4EOWL 4Q97A 2VQUA 5F4SA 1HT6A 3QO1A 1KCSH 1MLCB 1XLBA 4H26B 1CEOA 3DA0A 1J05A 4FA8A 3G0UA 1UM6L 4IM8A 5IRPA 5ADOL 4TULH 2FQIA 1QABA 2X44D 5D7IF 3H7VA 2MHAA 5DMIH 1CK0H 1UKTA 2Q6WB 4Y2DC 4GKTA 5HJYA 15C8L 1MWOA 2A9ML 1FWNA 3CHVA 3MVIA 3DX1A 5IM51 3DMMA 3WD3A 2ITDB 4MS8C 3EFFA 2I56A 1NH6A 2XQBL 2OVLA 1I1YA 4HS6B 3B9NA 3C60A 4A8NA 1IO4C 5E94B 2X28A 1MVUB 2GQ3A 1E27B 4NHCH 1SFTA 3W9EB 5FLVA 2XIBA 3EOTL 4J3ZA 3WD1A 1N0LB 3AS2A 3CN3A 1FZJB 3VX0A 1J0ZA 5LIYX 2ADGB 2GI0A 2APVA 4BQ9A 1OARL 3B8UA 3AFBA 1E7UA 2DWSA 3E1F1 3GJFB 3G08A 3DX5A 1T20A 2E77A 1XH3A 1A0CA 4PVBA 1JXGA 1DVFD 3E2HB 3RHWK 3VGDA 5IZ7A 3SUUA 3ARZA 4DP4X 3OLIA 3F6JA 2WN2A 3GSXB 1AHKA 2E9IA 4S0SD 5D7HA 1SU5A 2NQHA 2WMIB 5IKCB 4YGVB 3T0DA 4I2XB 1I9EA 2CUHA 3BD4A 1O5XA 3C4UA 2QPSA 4MA7L 3E0FA 2OMYB 2WJ5A 1E8YA 2Q01A 4ZQOA 3HBLA 1PS9A 3K4AA 5JW5A 2PF0A 1BJ1J 1SLUA 4PRPA 3DN5A 4DY1A 1Y0LA 4WWKA 1UFUA 2MNWA 1QCWA 4PJ5B 1HS6A 2XN9A 2GK1B 2M26A 5DX7A 1AKJA 3BDYL 2GGHA 3OZLA 5IQMA 2YC1A 1BD2E 3E8UH 3SKMA 1R24B 1DJZA 2A2QT 3RNQA 4WY7H 3AALA 3MA7B 5B8CB 4D9RE 5CEYB 3BIAX 4PYSA 4M48H 2J55A 3NP3A 3O6ML 4G7RB 3AC0A 4XVOA 4AZ6A 3DSNB 4KJQD 4GNVA 1DYZA 2XG4A 3LN9A 4Z76B 3SZ6A 1TJGH 4DYJA 3W7JA 5IHLB 2WXKA 4NAFB 4IWWA 3AXHA 2X2IA 5K9QG 4LYRA 2ZQKA 2GVLA 4S1SL 1LP9B 4MMYB 3MUGB 2PCPB 4FA6A 3ZYIA 1F3JB 3NCMA 3QIWD 4YBLB 3E6FB 3O8XA 4GG6E 1WCBA 2WP3O 4RIRA 5I6OA 2AL1A 2CO2A 4NAEA 5KBKA 3RWJB 3ZKXC 1NIFA 3U79A 3TAKA 5BW6A 3P14A 4MKSA 2P5EE 1M1SA 2CLRB 4LQFH 3BH9A 3BWAA 4OB5H 1S3TC 1LHZA 3S1GA 1VKXB 2O72A 3I2CH 5A5WA 4JFFB 4DGIL 1J7VR 4DJEA 2A6KB 1F4HA 4Q8TA 2IALA 3QDHA 4GRWF 5DJDB 3PL6C 4PJ8A 3T2NL 3WTVA 5EBLB 4MLSA 1KM1A 3SQSA 3PHSA 3WEOA 7ODCA 3G5VB 4TUUA 4AIUA 3NOEA 4FERA 7PCYA 1FC2D 4JX6A 3OW1A 5GZNA 2ENYA 1ICSA 2CJUL 3KPTA 2ODIA 3DX3A 5IOPA 2YKLH 4B0MM 3LX9A 8RUCA 4P5TB 5G5DB 1ZJAA 2GQAA 3HB9A 5BMFL 5CHNB 5GGSB 4E68A 2J9ZA 2ADIB 2A79A 4NYUA 2ZA1A 1BVOA 4GUGA 4PW4A 2WK2A 3VFGL 4HC1A 3TH2T 5TDOA 1TPEA 3Q43A 1INDL 4L9LC 1ODZA 1AD1A 4ERSH 1F6LL 2E6JA 2JELH 4QRRB 1JDCA 2PDJA 5HJBA 3GMPB 3LS5H 2OK0L 2V9QA 2O4MA 3WMQA 1GYMA 1M71A 4NB7A 2A0NA 2OMWB 2VEIA 3OGRA 4NUQA 2AF2A 2H2SD 3BN9D 2FJFA 3TPUA 4KH2A 3AMGA 2DQHL 5IJKA 1DIEA 4JTGA 2C1OA 1MCPL 3VFLA 1HZHH 1FAIL 1QKZL 2JI3A 4N0UA 2TRSA 3CSBA 4JCMA 2C9UA 2EKCA 3FN9A 4UTUA 4WJ5B 4NZCA 2ZUWA 2R4RH 5FA3B 4PA8A 3CU1A 2EBNA 1ALDA 3RPMA 3V6FB 2NY4B 3KLHD 4X4MA 2CBOA 1PV8A 2PW2B 3QJHB 3CFEB 5CPOA 3FUMA 3KOWA 3QI9B 1DBKL 2J56A 3AY2A 2HG0A 3W22A 2F19L 1IBHA 4YHKL 4YS4A 4REQA 2JF6A 1P53A 5ACZA 5D30A 2LFGA 2X3BA 1M9WA 1YN6B 2JSFA 3MBEB 2Z7UA 2UY5A 3PUCA 4XB8A 1DANU 1L7TH 4ZW6A 1E1CA 1A7QL 3IFLL 5AW1B 5IT2H 3GFUA 2NXIA 2IPFA 3V0UA 4WUKH 2XZAH 2HLFC 1JGUH 3NJFA 1GNXA 2IPJA 4I0PC 5B1AB 4RJEA 4BWUA 3B37A 3VXQA 4D0BB 2VR2A 3UTTA 1QO5A 3HZMB 5H37H 5LXVA 5F7MC 1W72B 3VRIB 2AEQH 4J3SA 4Z76A 4RX4A 5E8DL 3TZVA 4FYRA 1YNYA 5FYLL 4WKXA 4HMNA 1FF5A 1UWEH 2HXUA 2O55A 3AXLB 4PL2A 1BIHA 5C09D 4LP8A 3HGJA 3PG9A 1KUMA 1I8MA 3FU7A 2Y1ZA 4HA3A 2UYLA 3SPHA 1WA1X 1KB5H 4NKDA 3ZSSA 4ADUA 1J10A 1PKQB 4TQEL 1KRCC 4E4UA 4O51A 5GHWH 3HG5A 3L95A 3O4LD 1F9CA 4C6MA 3O9WD 4G9DA 4GKZA 4Q8BA 2PTVA 4G5AA 4X6EB 3QNZB 4F9LC 3MMEA 4AUYA 2A4CA 3M6DA 3ZLFA 3CX5J 4EPEC 3W86A 2PN5A 3MI6A 2W1NA 3BUQA 1Q4NX 1H9VA 2PTTB 4ZUSA 4L5FE 4B50A 1LROA 1ISXA 5J12B 5TNVA 1R3KA 2W80C 4C4KT 4TTGA 2MANA 3IU3A 3LI1A 1K03A 1PGRB 3KL3A 3O6KL 1Z9AA 1NLDL 1YMMB 2FDBP 1JTPA 4PD4K 4YFLI 4EQ3A 4ZXBA 2FYYB 1DBML 4MVBD 2X6VA 3NG3A 4IIDA 1T22A 2YQGA 4I0KA 1LJYA 4DH2A 1MWAH 3E12A 5EO9B 3VQ1C 1QO2A 1AP2B 4NZ1A 1Y1DA 1RQBA 3ZR4A 3THMH 3NJLA 4Z1YA 3BT0A 3GBNL 2VN6A 4FI8A 1TYGA 4D3CH 2WMHA 3K5RA 5D1XD 1HWGB 1C8QA 3MV9A 1KLYA 3LDBC 4YHLL 3K13A 2QJMA 3BD5A 5EF2A 3PP4H 2WOBA 4NQSB 5CZKA 1W37A 3BXWA 4ADSA 5C9ZA 4P5MB 2B59B 4KKAD 4M19A 3NQFA 4OFQA 2HN7A 1XGZA 5A2BA 3MKCA 1OAXH 4AYFB 3RI5F 1UD6A 1XL4A 4TM9A 4YO0A 4ERSL 5JMOC 1RJYB 3DLQR 4CEUC 5G4MA 5IGXL 3SUTA 4N0UB 5FF7A 3AHVA 5FEPA 3C8HA 3LG3A 4DWSA 4ZA0A 1OF6A 1LDSA 4IRSB 5TGBA 3BKCL 4G7YH 4W7WA 3Q2NA 3QJHA 5JQ9A 5L7XL 3HO8A 2V2TB 1IE5A 1T7WA 3SY1A 2MMXA 1F4XL 3SJVB 2YD5A 4AK1A 3URBA 1H1NA 1GH7A 4LNRA 3OZ9L 5C0AE 4KFOA 3DX9A 3FU6A 2J12B 1A6UL 1K4CA 3ESNA 3GHEH 1WBZB 4JDZA 4LEFA 1LL7A 4YHML 1BREA 2P4AB 3QJOA 3V52L 5CSZA 3BG3A 5FO9A 2ZKMX 4XMLL 1BFVH 3LRSA 4K7FA 4OF7A 1WZ1L 5KYWB 4UV7H 1J5OL 5CAKA 5HGDB 1JD7A 4UMCA 2AJUH 3LQMA 5DXXA 5E2TH 2FT7A 4R4NC 5CGYD 3EJCA 1MG3C 3FUKA 3ORJA 2VLRB 4DUXA 3F7LA 1XBVA 5CJOL 2ITDA 3HHRB 5GGVY 4K2SA 1ZSXA 3EJJX 1HSBA 4UB0L 3TWCL 5IBLC 3BG5A 1HNGA 4GAYB 5C8JA 3GU9A 1ZS8B 2Q86A 3MRLA 4PGEA 2REQA 1N8OE 2YQ3A 1PAZA 5ESQA 4KQ4L 1R2TA 1PZ3A 4PV8A 4L18A 1Y0EA 4QRQA 5GGQH 3WHE1 1V55B 2BHYA 3NK3A 1A0QH 3RBSA 4LSPL 2Z00A 4LKXB 4YL4A 3WUEA 4Y5YA 1PCXA 2FR4A 1AZVA 3JZ7A 3MLTB 5EC1A 3IVTA 3U4BL 1YMMD 4UB9A 4LFHD 4NJGA 1O0VA 3G08B 1TX2A 5EH1A 2LVCA 2B81A 3BLBA 1PZ2A 1ZVSB 2XH7A 3LLFA 2Q1EA 1GOIA 3H9SE 3A4JA 5LBSL 1ZLWH 1BF2A 2CLVB 4YHOL 1RBLA 2ABAA 4HUVB 3M9YA 2WBWB 2POTA 2V5CA 1OCWL 1WC7B 4WTZG 5A7BA 5IR1B 5FGSA 3AO0A 1NFAA 2KKQA 4G8FA 3HPXA 3LY0A 4I77H 4NKOB 3ILPB 4QHKI 4BQ8A 5D4JA 3KXQA 2DQTL 3MO1B 1OFQA 1VFAB 3QRLA 1KM3A 3T6VA 1TPC1 4MMXA 3T65B 3IJEA 2J75A 1ETA1 4B7LA 2FECI 4F33B 4ZD3H 2J7BA 3G6JA 5AOIA 4X4XB 5HYEA 3S46A 1CXIA 3S7GA 1CQYA 4XWUA 3XIMA 2F53D 5DGRA 3VFNB 2GGIA 2F8VA 3BC9A 4P5MA 3TVMA 5BXSA 2Y07L 2J8HA 3KLDA 4TL5A 4A04A 4NLHA 2ED8A 6PCYA 4NPKA 1NAKH 4DVRH 3NFNA 4NOFA 2WW5A 3W24A 1NKGA 1QD0A 2VWEC 4XPAH 3WO8A 3WEXA 5FYJH 4EP8C 1DBJL 1RJYA 1RZFH 2XBZA 3CHOA 5CN3A 1HTIA 3Q2CA 1SYSB 4LHJB 4Z7QF 5AVNA 3U3HA 3GXTA 4IQHA 4UMGA 1W72H 3VRJA 4Y4HD 1HO4A 3E8VA 4XMPL 2PNDA 5AW6B 4FLSA 4CW1B 1T8QA 3UFIA 3LZLA 4D0CA 3ULVH 5DFAA 1SNRA 2A2IA 5I1IH 2GJJA 3EYOB 1A5LC 1JPST 4AAJA 1WKEA 2BNQB 5GS1B 2AQVA 3O7UA 5GNYA 3RWJA 5L2KE 4Y4KC 4GP8B 1GKOA 4IIQC 4U0RC 4PGLA 3K6SB 1U4EA 3GRWA 5JZ7D 4TIMA 4W9FC 2DWTA 4FN0A 4R7NA 4LU5L 1EXUB 3GSQA 1VACA 4DZAA 3IDIA 4ZDHA 3MRQB 1AD4A 2DEXX 2J4WL 3DIDA 4G8IA 3D85B 3HI1B 4MUPA 2ABBA 3WD2A 4DVBB 1DIOA 5JOFB 1UIOA 1D5ZB 5C9UA 3T4AB 1XF3A 1OCBA 5TQ0H 3V7PA 3DRQA 4OWGA 5ENLA 4ZQKB 2VUNA 3T7VA 3F7YB 5EYWA 4O0ZA 1D6EA 2GCYB 1CCZA 2DLFL 4NZDA 3HI6L 1TDQA 1AGFA 1FQ9C 1BZ7B 1UENA 5ACMA 2V6AA 1HHHB 4GJTB 4NZTH 4OZGB 3TXAA 3V79C 1JPTL 2E5BA 3ZR5A 2HRGA 4N87A 2OG9A 5D93B 5KSUB 4FCAA 1EWEA 4JO4H 4Z3JA 4Y5XC 4XV0A 3CXOA 1ZAHA 3NPUA 2AVGA 2NQCA 1ZE3H 2EDYA 4U6VH 1IAIH 2AJVH 5IQ7L 3UXLA 3L9BA 4NRZA 1QATA 3AB0C 4TTDD 3ZQ9A 3W9DA 3GINA 5IHWA 3JZUA 2XH0A 2R0KH 1F05A 1CE6B 2BDQA 2PDYA 3A6BL 4HUUB 2HWZL 1SJAA 2J7HA 1RD6A 2X1RA 2QCLA 2R29A 1KBVA 3P77A 4YOKA 3ITYA 3QGAC 4HSCX 2ZSVA 2PW1B 3SQBA 5KZMA 3VAVA 2MQ0A 3ZJAA 2FGWL 3LKQB 1TF4A 3TBWB 1G9NC 3F2LA 4JFZH 3V6FA 1MREL 1IGTB 4MAYC 5ENWB 3VGFA 1CURA 6PTDA 3CUGA 4ZD3L 3HRZC 4PB3A 4CVWA 1DJGA 4JN2A 1U4FA 2DQGL 3WV0A 1QRQA 3FAXA 2FSEB 3FJTA 1UMLA 2F9RA 5B1CA 1NCIA 2AV1B 3RNKB 4XO6A 5EU9A 5A6AA 3OMAB 4WHYG 4ZQCA 3WDQA 4G6MH 3CVHL 4M7KH 1WS7A 2XJKA 5FYKL 4DPAX 3ANYA 3P4MA 2DKUA 3ZKQD 4S3FA 2O5NA 3QPXL 1MFBH 4EBQL 3WMCA 4TTDC 1UBPC 3QAQA 2I25N 3HMWL 2VEGA 3CAVA 4FMVA 2OTUA 2AQNA 3NIDB 4JW3A 4YHOH 1W1VA 1V5XA 3PANA 1GJIA 2WYHA 3UCCA 1FIGL 1KIUA 3GXPA 5FWQA 3HG2A 4QHMA 5I1JL 2R1XB 3PY9A 3WQWA 2CO1A 4Z7WF 4A6YB 5KYNA 5PAZA 4ZSOA 1BBDL 4IBYA 3MCLH 3EYSL 3QVAA 1LT8A 2PD9A 3CQJA 3OODA 1T66C 4YWGL 2W0LA 3VKCA 3GVVA 2BG5A 1P4LA 2B3RA 3ROOA 1WQVT 1T7ZA 3S3PA 1GGBH 1Z9MA 4LBSA 1W31A 3BOFA 3GMNA 5CJXA 1YEHH 2N1TE 2BNQA 3LS9A 1MCJA 3E80A 3GBDA 3H6JA 3SKJL 4DQOH 3LIUA 1J87A 2D7TH 3RUGF 3VFWB 1Q7MA 2BJMH 1HXKA 2YUVA 3A5VA 2VDKH 4H8PA 1N2RB 1GT8A 1BAFH 3M45A 1X39A 4RV8A 3V5FA 1TZGH 3A4XA 1TR1A 2HFTA 5HHMD 4HK0B 3MHGA 4FRWA 5F72S 2CESA 1FVEB 1YUKB 4RSVA 1R3KB 2V9DA 1SM3L 2YD4A 3PU7A 4MVAA 2DMHA 4BK9A 4WWID 4DVBA 3ZBMA 3GXUB 2GSJA 2GL5A 4GY1A 3M0ZA 4OVXA 5GGUA 1IR2A 2AITA 5HJ3A 2NT1A 2A1WH 3I6TA 4PTMA 1VJZA 1X5KA 2CLHA 2R56H 2YAHA 3UTTE 1CDIA 1P6BA 2FIKB 4P3DB 3B43A 4C6OA 1KCZA 4F93B 1K8DA 5DI8B 5I6KA 2IFFL 1PDYA 5ACLA 3WF4A 1OTTC 5XIMA 2ZX5A 3E2SA 5HHPA 3RIAK 1CFQB 3B5HA 4P23A 3TEVA 5DD1H 4CGTA 4H9TA 1XIFA 5D37A 1EDGA 3RWDA 4JHAL 2F5BH 1IAIL 3WIJA 4G43A 3PS7A 5AOUA 2BP8A 2JKXA 2A77L 2F9BT 2WXGA 3RVTC 2V9RA 4XPHL 2A21A 1OEPA 4PJ9D 4Q8WA 1J5IA 4FQJL 2OMYA 4BKTC 1OK8A 2X9WA 5EIIA 1E6JH 3F00A 1OD0A 5C08D 1JCVA 3K6OA 3GH7A 5KVDL 3CH1A 3PWPE 5IFTA 3A5FA 5MHBA 4BHUI 3LENA 2AJZA 3MODL 4WU5B 3VCLB 3GUGA 2BZNA 3W00A 2DLFH 2WIMA 1QP1A 1H62A 3PJWA 2EDXA 2ZSVB 4IJRA 5G2WA 1MZYA 3L9RB 4FXTA 4GACA 3WFEL 2PYEE 2IQTA 1NF7A 3LKQA 3SBWA 1H7XA 1J8KA 1RI8A 4MB3A 2IKJA 1QFEA 2VD9A 2PU0A 4JQAA 1JWSB 4L1TA 3WE6A 3VQ2C 1JPMA 2IPTL 5AVYB 2MH4A 2R69H 2J4WH 3K0WA 5I5MA 1WDSA 4H41A 4GWEA 1EDYA 1W16A 3BO9A 4PWHA 3E9AA 3NQEA 4RDZA 2EE6A 1FDYA 3UW6A 3UJIH 2X16A 5T3XE 5HD8D 2V4LA 4XH2A 3TN0B 3PUDA 4G5DA 3P40A 4XP1L 3R5EA 3GB7B 1SMOA 4TPRL 2UY7A 3G1AA 3BZFB 3LIZH 1XM3A 3EOYG 3QEHA 2OZ4L 3EJZC 4WFHE 3QQ0A 3IRPX 3W25A 3EJZD 3FCUB 2R0WH 2X4OB 5I03A 2YFNA 2A6DA 4M24A 4X9SA 4AIZA 3QC0A 1TJHL 4M7JL 5J0BA 4WFGD 4PJGE 1P0NA 4I9MA 3FHQA 3RZCD 3DV6B 1OGTB 2AVFA 5DFVD 4MWFA 3O6FB 4X98B 1KKOA 3T6QC 1KJ2H 4Q9CA 5EBGA 1F18A 3KJ4C 1X5JA 5A95A 4XAWH 3AWNA 4Z2GA 1AR2A 1QLEB 3TBYA 3GMNB 1O9VA 1VFBB 2D3NA 1U9KA 1U3YA 2F58L 1TLMA 2UUDH 2VLJE 4WFGE 5GHWL 1FUYA 1TJPA 4UNKA 3NWRA 1CLKA 2DKSA 3G5VA 4AL8H 5BOZG 3CDGB 1NFIB 3P11H 5FB8A 1CL7H 4N24A 4OZ4A 4OZFB 5JR1L 3AZRA 2JEPA 3U4EA 3QZOA 2ALWA 3QUYB 1KJ3L 2I27N 2D0HA 3L5WB 1IVTA 3NH7L 1AH0A 4LGRB 3R8GA 3FCSB 3AMDA 4M80A 3I6SA 4HUVA 3MXWH 5E0CA 4Y1AB 2ZNXA 4C58B 4M9PA 4AIOA 2CHZA 4Z78B 2OYKA 3M0MA 3M43A 1UZ8B 4X42A 1ZV2A 2XM1A 4YR6A 4Y9MA 3FT4A 1KN2L 1HEHC 4WJKB 1ZVHA 4PMUA 3MO1A 5FEWA 1YPZB 2PWFA 3HE6D 3RWIB 3OLDA 4W88A 3L7EB 4PRPD 5F7KC 1WK0A 3OVUB 3CE1A 4LHUA 2ATSA 3UYCA 4PU2A 5MHSD 2I14A 5I00A 5DYOB 2D7MA 4N28A 4HIXL 1ESOA 2IWKA 2JKJA 1IT7A 4D7BA 3ZVHA 3HMCA 3M41A 1GS8A 1MCBA 4DP9X 3T2LA 1PWLA 3S2NA 2W0PA 5CPNA 2VABB 1ZBWA 4JJHA 5E5MA 2NLIA 3KLSA 4DZBA 2H0EA 3TFXA 2JKWA 2IMMA 5CJOH 5LNEA 5D1XC 1FSKB 1MEXL 3QDMA 2CLZA 1W6LA 2H5UA 1Z3GL 2IOMA 2J1WA 5SV4A 3T09A 4H9VA 5I79A 4AVFA 1ZGLP 4NO2A 1J5OH 3TN0D 4GQZA 1WBYA 3RMJA 2INZA 3OX8B 5DHVA 2J72A 3BUBA 1PSKL 3ZE2B 1A6UH 3DO3A 1NFPA 5HDOA 2DMBA 2JJTA 1ACYH 2QPUA 4NVTA 4DM2A 4TMCA 3AXLA 2FZ3B 3DO4A 4GMTL 3KPMB 3ZDZF 3GGWA 2PWEA 3IJHA 4NNXB 1WT5C 2XJ7A 1U3ZA 2WWMD 4HD9A 3WNPA 2CLEA 3FTGB 3S5LB 5IJDC 5DGQA 1GW1A 1WBHA 3AQDA 4M81A 3TXZA 5JPMC 2B2XH 4R6UA 1KG0B 4F9PC 3C08L 5IVNA 1UYQA 1GYAA 1FV1B 4HF5H 4K9EL 5DHDA 2J8TA 2XH2A 4UC5A 3C9NB 2PYFA 1MHCB 1QFOA 4NHUA 1Q9KB 4Y4HC 4H9MA 1N67A 4BIKA 4N8CL 2R1LA 1K8YA 2VP8A 4F9JA 2VCOA 1WAWA 3PWLA 2ZVIA 4HZMA 3SDXE 1C9WA 1NOFA 4NENA 5D8JL 3THQA 3KCJA 3QFWA 3VVGA 2G0LA 5L9DH 5F4WA 4GRLA 1AGDA 1RURL 3V5DA 3VDAA 2DYPD 3T3PF 3VK5A 3TTEA 1PLBA 1JE6A 3CPRA 2GJXB 2QVHA 1XSKA 5LGJB 1VH7A 4AJ0A 4PRPE 2X42A 4ZW8A 4MY1A 4JNYA 3MMTA 4D1JA 4CNPA 1Q9OB 1VADB 2KDGA 1S7SB 2Y3AA 3F7KA 3RUGE 2HRPH 4EKXA 1MRDL 1U58A 3HU7A 5CC3A 5DXYA 2OGYA 2WKOA 4MKMA 2LGNA 4PJEE 4QR7A 4U1NB 2PDGA 2HFEB 5GJTL 1UWQA 4B5WA 5C71A 1T89C 5C0BE 1U8HB 4LASL 4M48L 4D8OA 5I78A 4WY0F 4WO4B 5ICUA 4P0DA 1OFDA 1CLYL 5I8EB 3T04D 1TA3B 2ZUQC 3ZDXB 3MNWA 4YSCA 1EP3A 1KKRA 4IOSA 3KWUA 1IGTA 4M7LT 5IESL 2EUXA 2X2JA 4PJDB 5IV2B 4AC4A 2XZQH 4KWSA 4IICA 4QNEA 3WK1A 4KIRA 1PJWA 4F7CA 3UXFA 4JBSA 3SZKC 2VMCA 4DF1A 4NERA 4JZJB 1FIEA 3EB3A 5EN2B 2TSAA 3O2WL 4AXWA 5JA8B 4P8WA 4JD4A 4V28A 2ADFH 3A0OA 4L1BA 3URNA 2WMJA 4I7VA 3ECVA 4JFQA 2QCHA 1GTNA 2JIEA 3TBSA 2I9TA 5CD5C 1EXBA 4DZBB 4QUOA 1HEZA 2EYTA 2E9BA 3DKHA 1OGAD 4WFHD 1OLZA 2VLLA 2DIAA 2ZSWB 1OM3L 3KS0H 1I2RA 2CZFA 4O9HH 4OZGE 3MJYA 3NJXA 2N4IA 2W95A 4N3TA 4P4KB 3A6CL 3UGUA 2XN2A 3QWOA 4ZQRA 2VDRH 4U1GC 1BYNA 4KTEH 5I16B 3TF7C 1W5MA 3GD1C 5CSZB 3ISIX 1S9XA 5EZOL 3BVNB 4GQRA 2ISVA 5D9SA 4GUOA 3DC0A 1OFOA 35C8H 3RX5A 1F6AA 3WUWG 2XZAL 2H6PA 5IT2L 3DJZA 4AQAA 4GVHA 2VN3A 1KBGL 2VLRA 3HC0A 2H32A 3GMLB 3IDJB 4XC3L 1VRSA 1HE8A 4FKEA 3CV5A 4NP7A 2JK2A 1CB4A 2KBGA 2WV8A 1VDGA 2NZ9D 2WW8A 1N8ZA 5G4NA 1J0JA 3EBGA 1LBFA 4M4RB 2ALAA 4P2QE 1G94A 1XQ4A 4ACPA 5F9OH 1ZLWK 3RCYA 2FX8L 5EOQH 2VDIA 4QTGA 1PS3A 2L7UA 1J9CT 1MCQA 1P7BA 1S78C 3D5OF 5E2WL 3G04A 4QT5A 1UACH 4PS3A 1L8PA 4U7SA 4LAMA 1PIGA 2BSTB 5SWSD 3N3TA 4HIBA 1HZHL 1USZA 1IYXA 5BUPA 1LLZA 2DQHH 2Q3XA 2V2WA 2DLEA 3S4SG 1OJXA 3H7LA 2YOCA 1CXHA 1GYVA 1KFBA 4FL4B 2FATH 3GTNA 1KACB 3KG5A 1KCUL 3H2PA 4ZOAA 2Z8SA 5K39B 1CLOH 4S1DD 2ZX7A 3RWDB 1BWMA 1OCNA 2RH0A 3IJ7A 1BEUA 4AH7A 2BSDA 2X4UA 2FVLA 1SOXA 1E5CA 4BE6A 5AWNL 1UASA 4Q8VA 4N2NA 3UABA 4MXQC 1FCCA 5GS0H 4Q8PA 3LZFL 3ZRFC 1ONEA 2DAVA 3WL0A 2WNXA 4JHUA 5FCSH 1TTAA 4MCYB 1GGOA 3BAWA 1UZHA 4UTWC 1OCCB 4PP1C 3T0ED 3WD5L 3WQVA 3FN0H 2OLHA 2CJUH 3EH4B 3SRHA 3OPZL 2X70A 4FFVD 2VX5A 3L9RA 4U1HB 2QADC 4E5XG 1ET5A 1JNHB 1U8NB 5CUSH 3FCPA 1U8LA 5D9NA 5LYRA 1R3HA 4Z7NF 2DSWA 1F42A 3TYFA 3W87A 5A6BD 4UT6L 4KTDH 3UYRL 4MDPA 1DBBH 3WQDA 1BMGA 4AM0Q 1JF6A 2R9HD 2R7EB 4DGIH 5D6CA 3EFDL 3SY5A 1M3IA 1WA0X 3LLDA 1OPGH 4W87A 3QZBA 1CXKA 5BRPA 5TTRA 5KVGH 3STZA 4A67A 4LMQI 1OX4B 1QWGA 5HSFA 4S1RH 1AIZA 3LV3A 4D8PB 3GDKA 2NY7H 2PDKA 4HIJA 2OW7A 4MJIA 4X63A 2EIKB 2E1WA 2JQMA 1H6UA 1BF8A 1THAA 5J04A 2NZ1A 4LB4A 4U6XA 3GNDA 3EGDB 4AWSA 4KNUA 4ZPVA 4HNLA 2V5TA 4KROB 1H6EA 4Q6YA 3GUWA 4WLCA 1KCKA 1URIA 3NSYA 3OZKA 1XT5A 3QO1B 3ZKMC 4O5LL 1NFDE 1ZSDA 3RFZC 4WEEA 3LCLA 2JKNA 2FK9A 2HT4C 3MLRL 2J4GA 4XPFH 3S83A 1OSZA 4UFLA 3D85A 4PJIE 5I16A 4GY7A 3NTYA 2FL5A 3PJXA 1KNWA 2IGFL 4Q8NA 5DJXB 3M5YA 3A13A 1KCXA 2IPGA 2KYIA 3HAEA 3VI4F 3T77B 4I0PB 2DL2A 1K3ZA 3KGSA 3R1GL 5FA4A 3VE9A 3MKGA 4HQQL 1PEWA 4F24A 5E1QA 4OVVA 1Y6NR 5FYJU 3S0PA 3ME0A 4PGCA 4OZFA 4OZ4B 3FYPA 3UXKA 4OJDH 4Q2ZB 3K5XA 1CFNA 1K6QH 4UIKH 5I2IB 2Y6TE 3QUYA 1FGVH 4Q8OA 3Q1EA 1E5AA 4OGYL 1BLNA 5HHOA 3GI8L 3KBPA 2QVNA 3PPCA 3CLFH 4IKIA 3S3DB 2H9AB 3NQDA 4MA7H 1ZP3A 2J24A 4B9JA 1BQGA 2D24A 4XVUC 2BSCA 2SEBA 3MROB 2R0ZL 4PB0L 5F3FA 4I13B 4QOKE 2NXZD 1U21A 4YR6B 2LTQB 4EZMA 2FDSA 3VI2A 2EDDA 3PWPA 1XMEB 3QWNA 4DN1A 4RFEB 2BOFX 5DS8A 4XZUB 4YDNA 4RA3A 3FSZA 3TIEB 1A02N 1AR1B 2H2SC 1ISVA 1PL9A 4EAMA 2X10A 1NC2B 3PGCA 3H42H 5DYOA 1BFOB 4H8HA 1PF3A 1NWSA 1X6UA 3TJXA 3C09C 1NDTA 1AD9B 4KKPA 2NOYA 5GRUL 3VD4A 3ZK0A 4W89A 1QNPA 1ZV9A 2VXTL 5C0CD 1XW8A 2RUSA 2XV3A 4AKOA 3LERA 4RAHA 4NHCL 3T2OA 3VD1A 1M7IB 2ZOWA 1XGYH 4X80H 3K4ZA 3DXAE 2PRMA 3KOYA 4HHHA 1QPNA 3W2KA 2OWCA 1MNZA 3FGCA 2XN9B 3Q01A 1W3IA 4HCHA 2ZUMA 3G1HA 4JPGA 4LANA 1HUVA 15C8H 1KTDB 2AJYH 3QYQA 3W73A 2AXGB 1IWPA 3GSNA 3P4MB 4N9DA 2DZUA 1JZ5A 2SODB 3ESPA 5AALA 1BQLL 5DMJB 4OM1L 1E0VA 4EXQA 1JVOA 4YPGA 2HWGA 5C0EA 4GNJA 1SF3A 4R7JA 4N20A 3L5IA 1G7PB 1JGLL 3PP3H 2ED7A 3O3AA 3GC5A 4QBXA 4FD0A 3CXHK 4GRWH 1MLBB 1F2XK 3HPLA 2Y7SA 1P6WA 1KM5A 3W71A 4EDWL 3S2MA 2AV7A 4WGXA 4KROD 5D1ZC 2C15A 3L7FB 5CJQL 4C57C 3ZT5A 2CZDA 3U30C 2EVJA 4OT1H 3BGJA 3TJLA 2ED6A 1MQ8A 5TK4A 2BINA 3UZQA 3WFZA 3GLAA 2YSWA 4M6QA 1HGWA 3W6MA 1QBLH 1MW1A 4JDTL 3W2UA 3VSUA 2QJHA 3ARUA 4R9OA 2NUTA 1ADDA 4X50A 1PTGA 2CFFA 4W4OA 5D7LB 4NNCA 3N11A 4YDIH 1WS8A 3I7QA 3WIHL 5GNZA 3N85H 1CECA 4JO2H 3WY2A 3QXAA 4ZFFB 5BZXA 2A6KA 3WYRA 4QFUA 2E7HA 4P3WA 4DPPA 3VXNB 1RCOB 3SCMD 5KZCB 4F3FA 5ID0B 3WIHH 3AGVA 1S7UA 4ZMAT 3LXUX 1SFDA 2OTDA 3P9WB 3P9MA 1Q45A 2CM5A 1F5ZA 4O18A 3VTTA 2DJMA 1S5IH 4JY9A 2UXTA 3US0A 3TZVC 3LSOA 1QXLA 1QSED 2MOVA 5I76A 4E41B 3IUHA 4IPIA 5BS0D 3ZXAC 3N12A 5EU3B 1KWGA 5ABTA 1AR1D 5AW2B 1ZU8A 2J8UA 2SEBB 3MNWB 4A2HA 5ETUA 3H21A 3WIIL 2APFA 4G7FA 4JRWA 1E5UI 4P05A 4IJTA 4N5UA 2NVAA 3L65A 4PYHA 2BB0A 4JO1H 4EXKA 1U8QB 4A66A 4LRNL 5I6SA 2K7PA 4ISVB 1MCLA 2VDMH 4PV9A 4PTTB 1FCQA 1OT2A 1K77A 4ZK8A 5EKYA 3EH5B 3MRHB 3Q0HA 5E08L 1BFSA 4JTAA 3FJ4A 2PF6A 3W7GA 4XO3A 4M6OH 3JBG7 4FNTA 3BVWA 3MRNB 3EUDA 3KM1A 5C9RA 4I18B 1CGYA 2VW4A 3DC8A 2VQTA 4PTVA 4UZSA 4WO0A 4YK4C 1Z9PA 4L1SA 3D69A 4KZEL 3PIQB 3GTTA 4X80L 2RACA 3KYKH 2Z1KA 5I1EL 1NCHA 3M17A 3OXSB 4HBCL 6ENLA 5CR1A 1QHOA 1W1B1 3T8QA 4JFYB 4GBUA 3F85A 1DXIA 2QCCA 4WUIA 1CS6A 2O0TA 5E4OA 3BZFA 1A4LA 4HA0A 4PJFE 4L23A 4ZMPA 3BOXA 1I7RA 3GY1A 2AQQA 3W1AA 5CZVL 4BSJA 4XMVA 4AQ1A 2X38A 1RPUA 4W9GC 5B38G 2G8ZA 3GKAA 5E23A 1QTPA 3CXDL 5DWPA 3KEHA 3SODB 1AI1L 3MV8D 3BGMA 4GBXC 5I18L 1EEPA 1RCQA 2X2HA 3K1GA 1KPUB 1IM9B 1ORQA 3IJ9A 3V7AE 3O16A 1Q72L 1BD2A 1JHLL 4LLYB 1VBGA 2B0MA 3TMQA 5HATA 4U6HA 5J56B 3I68A 2EILB 1JAEA 2GSIB 2H1XA 2GC4C 2VDPH 3MW7A 1AS7A 3SBQA 1P6CA 4N02A 4MAZA 4HS8L 3O9NA 3R8RA 2X0WA 2PTYA 1TMQA 4KJYB 4HU3A 4UOZA 4UIKL 3WEZA 3GNMH 2NUTB 3DU0A 5HJDA 2GEQA 3GHRA 4RWYH 2BS8A 4GKSA 2X2YA 1YPIA 4LCRA 3BWSA 3LMJH 1FWTA 1PYWB 3CWGA 4U0RB 4IRSC 5E99L 4RESB 2CKBL 4ZFFA 2VXVH 4JDVB 3VXUB 3H4GA 3SGKA 8CGTA 4ZI8A 4XKMA 2ESVE 5EZIH 4DUWA 4YHYC 5IFHH 3Q58A 5AKQA 3WFCH 4WU7A 4WFED 4HAKA 4HVBA 3U0TA 5J7CC 3QDJB 3QYCA 3SO5A 2OA9A 2DI7A 2I07A 1WEJL 4IIQA 4RGMC 4YDLC 3SPVB 1KM4A 2YL8A 4J6IA 5F6IB 1W6TA 1G84A 4XWGH 5J5RA 4JPVL 3BVVA 3QPQC 1LK3H 4CU6A 2WHJA 1O75A 3VIKA 3TKFA 1XIIA 1I3VA 1A7PL 1CDCA 3C5ZB 4P59L 4F7MA 1JYNA 2HTMA 4Y7EA 4IMCA 1NEZG 1AD0A 1SQ2N 2I5YL 2AJSL 2L7QA 2YO3A 2JMRA 1MI5D 1RP8A 5BZZA 4U3AA 4HETA 5KBMA 3ISRA 3Q05A 2UY3A 4LB8A 4E9SA 4KI5C 3PLYA 3MLXL 1KFJA 2P5NA 4L4TE