3BLPX

Role of aromatic residues in human salivary alpha-amylase
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
496
structure length
496
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRARQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Alpha-amylase 1
publication title Structure-function relationships in human salivary alpha-amylase: role of aromatic residues in a secondary binding site
doi rcsb
source organism Homo sapiens
total genus 176
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00128 Alpha-amylase Alpha amylase, catalytic domain
X PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3blpX02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3blpX01
1MW2A 4QDMA 1UWQA 2D22A 3NIYA 2D0HA 4OJYA 2IXUA 3MUIA 2J4GA 1GOMA 1E73M 1G5AA 5BRPA 1JL8A 5EFFA 3W0KA 3K8LA 1O6IA 2XM2A 2OWWA 3VIJA 3MS8A 1ISYA 1L0PA 3OGRA 3HG3A 1FFQA 5A8NA 1B3XA 2A3HA 2BY3A 2EABA 5HBFA 4Q7NA 1CNVA 1HKJA 4NXKA 1KXHA 1E1FA 1D3CA 2FYVA 4HZ6A 3K4DA 4Q22A 2V3DA 2BY2A 4LQ1A 5D9PA 4J27A 3AHYA 3EJUA 5JBDA 1GOQA 1KBBA 2W4XA 5A6MA 3W4RA 1JNEA 4FF5A 1WDRA 2WANA 3D52A 3M07A 1JFXA 2EPMX 1FP8A 1WB0A 2BNJA 1KBKA 4P8VA 3AIEA 2A3EA 1TFVA 2VOTA 4CU7A 2NT0A 4ZXLA 3RJYA 4P8WA 2ZUMA 2ZXAA 1V03A 3EJRA 4GZIA 5ABEA 2PBGA 5JBEA 3AHTA 1XYFA 4GI6A 3OLGA 3VSVA 3UETA 2DSKA 2CERA 3CTTA 5CGTA 5E70A 4FK9A 3L4XA 2VCCA 4YN5A 4HPHA 3N9KA 3A24A 1UA3A 1VB9A 3WQ8A 4HMCA 1VEOA 1PEZA 2YKKA 1B2YA 1BHGA 1WCGA 4FNUA 4W5ZA 3FW6A 3PTMA 4D1IA 2XFFA 4M8UA 3LXBA 1QWUA 4TOQA 2G3IA 4BA0A 1UQYA 2WVVA 1QX1A 4DUXA 2QMJA 3H53A 2CNCA 1W9UA 1WAWA 2VI0A 1IZJA 4UQDA 2G3MA 3ZT7A 3BH4A 1HJUA 2YL5A 2W5FA 1J10A 2GK1A 3CUFA 2W61A 2J7DA 4K68A 1AVAA 3VIMA 3SUUA 3BAKA 4GO9A 1GNXA 4CD7A 4A3HA 5I5RA 3PTQA 1UD3A 1V3JA 3BVVA 1EDQA 4AZCA 2WCGA 3HU7A 2ZWYA 4WF7A 1GOOA 2E9BA 1H09A 1JXKA 1JDDA 1C93A 5I6SA 1YHTA 1HKIA 5E1QA 3OB8A 1BF2A 5IHSA 2YOCA 3H55A 3OLEA 2CITA 5FCZA 3WELA 3RM4A 2GJRA 5D9OA 1M03A 3L4WA 3AMCA 3I3EA 4P7QA 3RILA 3ZJ7A 1QI3A 1J01A 3ARTA 1H41A 3VD9A 1BPLB 2EPNA 5E0FA 4PMQA 2GUYA 4HU8A 1W2PA 1W9PA 3AYSA 3KL5A 1QPKA 3VINA 3D51A 3WSUA 3AMLA 3PZNA 5GPRA 4F8XA 2FHFA 2X0HA 4JKLA 1G9HA 4AD1A 1TQTA 4GQQA 1B1YA 2ZXBA 3AQUA 2F7QA 4LPCA 2XGBA 4Z2LA 3U7BA 1QW8A 1Y7VA 3PZOA 1OB0A 2WSKA 1HXJA 4JFSA 4DO6A 3VMPA 2B31A 3KLKA 4ZENA 2DDXA 1JI2A 1HJVA 2PB1A 3AHZA 3S2CA 4ZXOA 5BXRA 3VDBA 1QWNA 1V0NA 1MW1A 1UYQA 1CDGA 1EO5A 2DIEA 4P7NA 4DM1A 1DWIM 3IK2A 3T2QA 1GQKA 5HDRA 3G6MA 1CGWA 1LWJA 3F5KA 4PTWA 4PBGA 1US2A 1BFNA 2XTKA 3K46A 1JGIA 1O7AA 4PCSA 1JFHA 2F1BA 4MADA 3WY4A 1VF8A 1UKSA 1GOWA 4OBRA 4HOZA 1R87A 1C92A 1J9YA 3CZSA 1LQ0A 4FLQA 3LPPA 1MQPA 2WMJA 1K9EA 5BXPA 4QAWA 3VO0A 1Q6GA 1U2YA 2EEXA 3DHPA 3WN6A 4OOUA 4CD8A 1EQCA 1H0IA 4OBSA 1CIUA 1NP2A 1Z32X 4QFUA 5I0DA 3ARPA 1UR8A 1A3HA 4EANA 2EACA 3A23A 1NP0A 4PUEA 2Y4SA 3L4ZA 4LGXA 2NT1A 2JIEA 3U5UA 3UEQA 2WWDA 2PWFA 1PIGA 3WQ4A 1BVZA 4MJ4A 4GZEA 4UOJA 1QW9A 3RIKA 1VEPA 3VGHA 2XG9A 1V0KA 4HMDA 4JAWA 3CMGA 3BVTA 3VGDA 1HTYA 4YPJA 1XH0A 3LX9A 4XB3A 4BQ4A 2WBKA 3BUIA 3B8SA 3EDJA 4P7RA 3WH8A 3A6OA 5KEZA 2D2OA 1ESWA 3BXWA 5HOSA 1XH2A 4OOZA 3ZIZA 1RP9A 3WY1A 1ECEA 5E0CA 4B3KA 3CH9A 2AAAA 5AC5A 2ZUUA 2EXOA 3QOMA 1TQVA 4GXPA 4M29A 3BLBA 1KXVA 2WMKA 2BS9A 3L2LA 4XV0A 1NWTA 4H8HA 5EMYA 1V08A 2QF8A 4TX6A 2ZICA 1UD6A 3BMWA 5ABFA 3AYRA 1TQWA 1JDAA 3PHAA 3KE0A 2DSZA 1JZ8A 2E8ZA 2J7FA 3PZUA 4U5IA 3VD4A 4MTVA 2JEQA 3BCFA 3PZIA 1TR1A 2OWXA 3ALGA 4TVUA 1HF6A 1M01A 4P8XA 1NWRA 1R86A 2XJ7A 3WQWA 2OYMA 3SUWA 1B30A 2ZOXA 3GNPA 2EPKX 1UR4A 2W66A 3AIUA 1DWGM 2JALA 2J7EA 4CD5A 3CO4A 5I23A 1E6SM 2ZUWA 2WC3A 6A3HA 1CGYA 4BZYA 5JIPA 3ALFA 4AD3A 1N82A 1E9LA 3ARRA 3VIGA 2OWCA 4KRUA 4C7GA 4V27A 3CZ8A 3MO4A 2VZVA 3KLLA 2VVSA 1D7FA 1HWWA 1TVNA 3T0DA 2VR5A 3EMZA 2WCSA 3A5VA 1QHZA 3CZGA 1UKQA 3FHAA 4HZ7A 4V28A 3ARVA 3A4XA 1MQRA 2ZUSA 2XGIA 2WMGA 2OW7A 1EGZA 1EHAA 4CCCA 3AMKA 2V3GA 1VJSA 3QR3A 1H5VA 3PZ9A 4DM2A 2YFNA 1MXGA 2F8QA 3U7VA 3DX4A 4JZ5A 3HG4A 4M1RA 4ATWA 3LRMA 2CXGA 3N18A 4H8UA 4AD4A 5A95A 2Z1SA 1E72M 3MV01 4CVUA 3GH7A 1NQ6A 2O9TA 2WB5A 4BS0A 4WIWA 4D6HA 1LG2A 2CHOA 3ZO9A 3SCSA 4AZBA 3POHA 5E9AA 2VRJA 2C0HA 3EJPA 4RE2A 2CHNA 3FXYA 4OGZA 3N04A 1M53A 2W91A 1W1YA 4GIAA 4NSBA 1UKTA 3ARXA 2F7PA 3THCA 3LPOA 3EDKA 3GBEA 2GJXB 2IUZA 2WHLA 3ZSTA 5GQBA 4UFLA 4X0VA 2NSXA 2BXZA 1R85A 2XM1A 3M7SA 2XVGA 5CG0A 4U33A 3WQVA 2Y8KA 2J7BA 4JIEA 1ZBVA 1YQ2A 1WZLA 1GVYA 2FH6A 4X9YA 2CKSA 4ACZA 1G0CA 4JFWA 3FN9A 2VMFA 1XH1A 5DT7A 5LA0A 1Q6FA 3MSDA 5EBAA 3MU7A 3PZGA 3QHMA 3WUEA 3CHEA 2DH2A 1BGAA 1H0GA 4PMRA 1UG6A 4RL3A 5BROA 1SMDA 4AW7A 3E1F1 3WDQA 3ZMRA 2YJQA 1B31A 3UR8A 1RP8A 4FNPA 3BAWA 1HL9A 5DT5A 1R33A 3MUAA 5HXMA 2ZUNA 5DMYA 3N11A 2ZX5A 2WMIB 3L2MA 1NARA 4XUYA 1G1YA 2PWGA 1GORA 1ODZA 2VQUA 1UD4A 2OSWA 2VT0A 4YHGA 1FOBA 1QBBA 1VJZA 1UHVA 1WZKA 1BTCA 1W2VA 4KMQA 1R34A 5GNXA 2EQDA 3CZEA 3PZVA 4HPGA 2WK2A 2G3JA 1CXHA 5BRQA 3BAJA 1UWRA 2DSWA 1I1WA 1W3JA 1TMQA 1KWGA 3AMGA 3UESA 4N0RA 3A3HA 1L8NA 2CPUA 4PSRA 3WUGA 3O6AA 3FAWA 1AMYA 4GINA 2WHMA 3GXIA 4UFHA 4W87A 1QHPA 1V0LA 1U33A 3BAIA 4FNQA 3M6DA 4TTUA 1KWKA 3N15A 1MYRA 1J0JA 1JYXA 4B3LA 1E3XA 1VAHA 1TCMA 3WNMA 2VNCA 4JL1A 3BVUA 3DDGA 1OSEA 5IFTA 1KR0A 3GBDA 4M56A 4UQCA 1C7SA 1CPUA 2RGLA 1CWYA 3WQ6A 2HISA 1US3A 1R46A 1ZBCA 4ZFMA 4DWSB 4FLOA 3AS1A 2DT0A 3CLWA 1WKYA 4W88A 4DUVA 1HKMA 4L4OA 1ITCA 3VTRA 1JYVA 1W32A 3VM5A 2EJ1A 4UOZA 3W6MA 3VIFA 4TVDA 2PWEA 3K4AA 2VX7A 5A8QA 7A3HA 1XYZA 3HJEA 1ZB5A 4LYRA 1GOIA 3VUPA 3SUSA 4KH2A 1HXKA 4WSJA 3EJSA 1M7XA 3JUGA 4PMZA 4YHEA 1AQMA 4ATDA 1HKKA 4OUEA 5BXSA 3OIHA 4B15A 4FNSA 1FA2A 3BUDA 2E3ZA 3N1AA 4PN2A 4KGLA 1HJWA 4B9YA 1PX4A 3WL0A 1TZ7A 4H04A 3T08A 1E4NA 4PSPA 3AISA 1E4MM 4TUFA 4HTYA 3K1DA 1EOKA 3SCTA 3ZOAA 5TD4A 4MB3A 1JG9A 3AS0A 1VENA 2ESCA 1KTCA 4JKMA 3DDFA 1CTNA 1QVBA 2BY1A 1J12A 2GJPA 1ISVA 3ZM8A 2BXYA 1OT2A 4EKJA 1DWJM 1E71M 2YBUA 3NSMA 2X0YA 3VIOA 5A6KA 2A3AA 3W28A 1NWUA 4CGTA 3QHNA 3MMDA 3WENA 1CENA 2YLAA 2XFRA 3HMCA 1XSIA 2ALWA 4M24A 4CCEA 4AEFA 5A6LA 4OZOA 2WVUA 3F4VA 4AD5A 2WHKA 3WMSA 1MW0A 1OGSA 3AXHA 3PZQA 2AMGA 1PX3A 2Q8XA 5I79A 2V38A 3J7HA 1JYNA 5D9NA 3L4VA 1EO7A 2G3NA 3WY3A 3SIMA 2WVTA 1V3IA 4NZJA 3VDAA 1JD9A 1R7OA 4KWUA 3VD5A 4J7RA 1TA3A 3GZAA 5CPSA 3LXCA 4D71A 2X1IA 3UR7A 1PZ3A 1W9BM 3UCQA 2XSBA 3ZT6A 2JF6A 1DEDA 4ATLA 4W93A 3NYDA 4UQ9A 2J74A 1OD0A 3BUQA 4UZSA 1JZ5A 4CU8A 2WXDM 3ECQA 4GO8A 4Z2KA 3WH5A 5CZKA 2O9OA 3SCUA 3A21A 3B9EA 3N12A 1K9FA 1W3HA 4AWEA 2UWFA 3A4WA 5E09A 3WDHA 4D6JA 4A3YA 1CGVA 2BVYA 2Y8VA 2CBVA 3U5YA 3OG2A 1SR0A 4AD2A 5D4YA 1KCKA 1K6AA 1G94A 4H7VA 1J0KA 4DWSD 1ISWA 2WPGA 1RD6A 4MNMA 2EPOA 3GYCA 1ZJBA 2XN0A 1E0WA 1UWUA 1BSIA 9CGTA 1V3HA 4AY1A 4AMXA 4FMVA 1PPIA 4H2CA 2WSPA 4RE4A 3LMYA 4U2YA 1HN1A 2YA1A 1W91A 5I77A 5A6SA 4AIEA 3MI6A 3MUY1 3EDFA 1V6WA 4XZBA 1TVPA 2PF0A 3WNKA 2DIJA 5ABHA 3HG5A 3NDZA 3VX1A 1QI2A 4CU6A 3GNRA 3WD0A 1FH9A 2VZSA 5FOOA 2J7HA 3SCPA 1KFWA 3AZTA 1FP9A 1KTBA 4QLLA 4PMYA 1KGUA 3WNNA 3OBAA 2XIIA 3UERA 3VSTA 4AZ7A 1QI4A 1SZNA 3WMBA 1BG9A 3AIWA 3EDDA 2J7GA 5CXPA 2J77A 4HA3A 4N42A 1UASA 4J3SA 3UG3A 3VGEA 4TXEA 3W37A 4W8LA 4JHOA 3D4ZA 3W81A 2YL9A 2YFOA 1R7AA 1V02E 3MSGA 5E6ZA 1CGUA 5LA1A 4AZIA 1HJSA 3D50A 3PBGA 3WFZA 3QGVA 3I3DA 2ZX6A 3O2LA 5ABGA 4ZE4A 4J28A 3IANA 3ZR6A 3FAXA 1EQPA 5CSUA 2OYKA 2WBGA 3GNOA 1A47A 4CD6A 3BSGA 1LG1A 4W86A 3ARZA 2ZE0A 4FLRA 1LL7A 1U30A 1UD5A 4OIFA 1XCWA 3W24A 5D9MA 1E6XM 3WD1A 1XD1A 1E56A 2DT3A 2D73A 3NUKA 1V6XA 2JF7A 2VO5A 7TAAA 4LYPA 3VGFA 4QCFA 4WJXA 3IJ8A 2VC9A 1C8YA 4PMNA 1KCLA 1GHRA 3SURA 1J0YA 1I1XA 2YIHA 1FHLA 2C7FA 4QP0A 3WH9A 4E4PA 2GFTA 3DX2A 3GXNA 1LWHA 1M04A 3BVWA 1PIFA 2F7RA 2DQXA 3VNYA 3LPFA 1GONA 1TE1A 4UFKA 1OGGA 2ZUTA 1WZMA 1H11A 2VURA 3NSXA 3QOKA 1TQSA 2DH3A 3LPGA 2D3NA 2JIWA 1HP5A 1E43A 3KZSA 1BG4A 1BQCA 1E5NA 2A3BA 4AZ6A 1SMAA 2TAAA 5A94A 3GXTA 3AFBA 5CSYA 5C70A 2A3CA 2WMHA 1BYCA 2OLHA 4D6FA 2XWDA 1P6WA 1Q4NX 3GXPA 3IAPA 3VD3A 3KL3A 1B9ZA 3T09A 3ARSA 3VILA 2V5DA 1CXLA 3ZJ6A 1LJYA 3CHDA 5ECUA 3BVXA 1KQZA 5CQ1A 3GH4A 5CGMA 1H4PA 2W62A 4AXNA 2PWDA 3CZJA 1J0ZA 3OZOA 3DX3A 4ML4A 1JZ6A 2JEPA 1UZ1A 2DT2A 1JNDA 4UQEA 2XSAA 1NWSA 2XVLA 3WNOA 1UWSA 3CZNA 2D23A 1X6LA 4IUGA 5LYRA 1QNSA 1KGWA 1LL4A 2BHYA 1UUQA 2J78A 4B16A 1OINA 4CN1A 1K9TA 5M03A 1MFUA 4W8BA 1PAMA 1JZ7A 2WZIA 1CBGA 5A6JA 2D1ZA 1Q6CA 1NOUA 4KRTA 2VX6A 1UQZA 2UY2A 3WKZA 3VGBA 8CGTA 3D3AA 2EAEA 1BAGA 1WDPA 1GQLA 3TONA 1C8QA 1CGTA 2V5CA 3W6LA 1GQJA 4IISA 5HNNA 2F18A 2DPEA 4J3UA 2WVSA 2WZEA 1E4IA 3RCNA 1EHNA 2CCRA 3GTNA 3VVGA 1JD7A 4NF7A 4P8UA 1OCQA 3WF4A 5DO8A 5KZ6A 3VU2A 3RM9A 4BCEA 1HJQA 3MV11 4E8DA 3CBWA 3TOPA 6TAAA 2BY0A 3CMJA 1EXPA 2ZIDA 3CUJA 1UR0A 2VR4A 2Y24A 1GW1A 4PMXA 1JF5A 4M82A 2RGMA 1GZJA 1UKPA 3BLKA 5A6BD 3A22A 3D4YA 3EDEA 4LYQA 1GUVA 3O9NA 1E3ZA 2WVVB 5IXEA 5FL0A 2CKRA 1RPKA 5FL1A 2F1AA 3VKKA 4D1JA 2YDQA 1VIWA 2XUCA 3DX0A 4P7OA 4MDOA 1E70M 3N17A 4J3XA 2EADA 3AXIA 2WC4A 4HOWA 3NJ3A 3WQ5A 4PTXA 1KB3A 5D8WA 3T2OA 2XN2A 1E6ZA 2GK1B 5JIWA 4D6CA 3AIBA 3MUZ1 2D0GA 3VSUA 1Q6DA 3W29A 3WH6A 2Z1KA 3VX0A 4MNKA 2WW5A 4NXSA 4J3VA 1ZJAA 4AZCB 1K9DA 5M17A 4U3CA 2ZWZA 1DTUA 1TUXA 2XWEA 4FNRA 3DX1A 1VFOA 1C90A 3TTQA 5BYWA 1EDTA 1QHOA 2PI6A 1CXKA 1UR1A 1E6NA 4W7UA 4HOXA 3WEMA 2DGAA 3FNDA 4AMCA 3EBVA 4ACYA 3FHQA 1W1VA 2D3LA 2XIBA 2GVYA 1GVIA 3N13A 1JIBA 2VVNA 1Q6EA 2VZTA 5M5DA 3T2PA 2WLYA 1QNPA 1QI5A 5C71A 3LRKA 3WY2A 4PMOA 2YL6A 4J3TA 3K8MA 2XPKA 1KR1A 1JDCA 3QHOA 4AZ5A 1ZU8A 3MMWA 3UG5A 4WKHA 2CBUA 1E6PA 1XSJA 1PBGA 4UFMA 5CPTA 3BLPX 1W9DM 4MNJA 5DEZA 4BF7A 4GQRA 1UD2A 1J18A 3VDHA 1QOXA 4URIA 4NZFA 3RO8A 3CHFA 3W53A 4D6GA 1UH3A 1WO2A 5CJ5A 1V6YA 1OIFA 1XRVA 3AHVA 1D2KA 3SUVA 5I2UA 2MANA 3OLIA 1JF6A 3BCDA 2E4TA 3S5ZA 2YDRA 2XVNA 3THDA 1JAKA 2WZHA 3AMDA 2OSXA 4JFUA 3B9AA 4MB5A 3SCQA 1B3VA 3IJ9A 4PRWA 4F9JA 2W67A 2C8NA 2VZUA 4CN4A 1MVYA 3L4TA 2BFGA 4PTVA 5CLTA 1W1TA 1HVXA 5FIPA 4ZEPA 3ZQ9A 4W84A 3VIKA 1HNYA 3VMOA 5AYBA 2WLZA 1HJXA 2J8GA 5F7UA 3VDCA 1DHKA 1ZBWA 4IM4A 3T0AA 3IAQA 3WH7A 3WEZA 4PEEA 4AZGA 3S5YA 2WYSA 5CPQA 1C91A 1V6UA 2FE0A 1WE5A 4AIUA 3VNZA 4NI3A 4F79A 2ZXQA 4AC1X 3NCOA 4A4AA 5AC4A 2J79A 2ZX7A 3CPUA 4W7WA 3WUBA 2GSJA 4AEEA 4C7FA 4V2XA 2G4FA 3W38A 1ISZA 2X8RA 2CYGA 3CUIA 4MDPA 2ZX9A 4W7VA 1LLOA 3VPLA 2YL8A 3MKKA 3BAXA 4WK9A 1BYDA 5CLWA 4MJ2A 3SEPA 1FFRA 3H54A 2VL4A 1XC6A 4W5UA 5GNZA 1X1NA 1S46A 3RM8A 3EMCA 4UOQA 1ZS2A 4E8CA 4PTMA 1DWHM 4F9DA 1V3MA 4ZE5A 4HA4A 1WDQA 2NW0A 3WNPA 4MAZA 7CGTA 3B9DA 2J47A 4MB4A 1XCXA 1GHSA 1GOKA 1UKOA 4PMDA 2GJXA 1LF1A 5ABFB 3OZPA 2QHAA 1C3FA 5A2BA 1CGXA 3ZR5A 3DYOA 3WD4A 5DFAA 3WMCA 4F66A 2X05A 3WL1A 2G41A 1V3LA 1EIBA 2PBOA 4H41A 3WD2A 5IHRA 2X2YA 3DYMA 1AQ0A 1W1PA 4FNTA 4D72A 2WAGA 5A8OA 4JFTA 4DO4A 3KL0A 4JCLA 1XGZA 1AQHA 4MB1A 2W92A 3I3BA 1CLVA 1E6QM 6CGTA 1PZ2A 3EYPA 3TTYA 4X0NA 3VGGA 4HA1A 3SCVA 3TA9A 1B0IA 2BHZA 4UTFA 4W8AA 1WZAA 1UH4A 1CXFA 1EA9C 1KXQA 1PJ9A 3KWXA 1MFVA 2O9RA 1J11A 3DECA 2OSYA 2F61A 3AOFA 5GNYA 3AXXA 2UY4A 1HIZA 4WKFA 3RJXA 2WMFA 3WF0A 1OGBA 2WMIA 3WUFA 3WBEA 2QPUA 4PMVA 3ARUA 2DSVA 5EB8A 1WNOA 3BMVA 4R27A 1H1NA 3ARYA 1QNOA 4HP5A 2VQTA 1UA7A 3OLDA 3AROA 2WHJA 3K8KA 1KGXA 3CIVA 2CBJA 3ZT5A 2GDUA 1WDSA 1UD8A 1E55A 3WDJA 5BWFA 2XN1A 4Y7EA 4EE9A 1EOMA 4Z2HA 2XVPA 3MMUA 3MANA 3PTKA 3S6TA 3AJ7A 5JUVA 2BVTA 4TTGA 3CHCA 3ZJ8A 3AI0A 2OYLA 3NDYA 3LRLA 4J3WA 3SCWA 2XHYA 3CV5A 2X2HA 4OKDA 1JAEA 1CXIA 2YDSA 1IT0A 2V3FA 3WNLA 4HMEA 2YA0A 4UR9A 4NRSA 2VX5A 4FLSA 4Z2JA 1OWQA 4XX6A 2VCAA 4AISA 1R75A 2EO7A 1VFUA 4D6EA 3CC1A 5A2AA 2X2JA 3GXFA 1NOFA 4DWSA 4AZHA 5FKYA 3L4UA 4NZCA 5A2CA 2UY5A 3DYPA 3ARQA 4ACZB 4W85A 3AHXA 2O92A 1GPFA 5A6AA 1UH2A 3BC9A 2VZOA 2FH8A 1VFFA 1HP4A 4AMWA 1BLIA 2PWHA 2ZXDA 4AIOA 2O9PA 1VFMA 2FGZA 4HU0A 2QMKA 2QLYA 4U3AA 3A4AA 4Z2GA 4E2OA 1R47A 1OD8A 1UR9A 3GH5A 3NSNA 3TP4A 2CBIA 4UFIA 2DSUA 3FY1A 2DT1A 1VBUA 3LXAA 3ARWA 1W3KA 4RE3A 1V02A 1VEMA 4TX8A 8A3HA 3T0BA 3WBAA 4JHZA 4IPNB 3BGAA 3BAYA 4GI8A 1UWIA 2OW6A 1DWFM 1E0VA 4BQ2A 3UG4A 3ZSSA 4S3JA 1RH9A 3WF3A 3WIJA 4UNIA 1SFSA 4KGJA 1BYBA 2Y2WA 4U31A 4B9ZA 4EAMA 2D20A 2J75A 1IZKA 4HZ8A 1HL8A 2QPSA 5D8ZA 3VIHA 1JI1A 5AYIA 4MNLA 2WKLA 3DHUA 1ITXA 1BYAA 4UCFA 3RPMA 3A47A 3GXDA 1JZ4A 2IXVA 2WNWA 2VUYA 4PCTA 2YBTA 3OGVA 3G6LA 3L4YA 1CECA 1C7TA 1OM0A 1ZL1A 2E9MA 2D24A 5DF0A 3WF2A 4IPLA 4XZWA 2GDVA 1CLXA 3WF1A 1QNRA 3HZ3A 1GJUA 1ZBKA 3CZLA 2VX4A 2V3EA 2XVKA 3EMQA 1E6RA 4JKKA 1NM9A 5I3DA 1MQQA 4P7LA 1E4LA 4GZJA 1VRXA 2IGTA 2HVMA 2BV9A 1DP0A 2ZX8A 1TQUA 1CXEA 5I24A 1JXJA 5A8MA 1B3ZA 3TTOA 3VD7A 2E9LA 1FHDA 2QV4A 4WSKA 4CN6A 3AZSA 1BVNP 4WLCA 1B90A 1EDGA 3VM7A 2CEQA 1G01A 3BUPA 2FGLA 2VCBA 1UR2A 1E5JA 3SCOA 4MPKA 3HN3A 1CYGA 2E8YA 1QNQA 5IFPA 4MAVA 3AIQA 3GDBA 1HT6A 1V3KA 1B3WA 3EJQA 3AICA 3U57A 4AYGA 4AD0A 4PMUA 1XV8A 3BSHA 1W9VA 2EBNA 5EFDA 2VJXA 2XFYA 4PUDA 2F2HA 5JBFA 1UZ4A 1HX0A 2X09A 4NRRA 3II1A 2WWCA 1MWOA 3AS3A 3WD3A 1E15A 1R8LA 1ODUA 5A1AA 1X6NA 2BHUA 3AIVA 2D0FA 4U2ZA 5HPCA 5A3HA 2E0PA 3M46A 3GXMA 1E0XA 4CUCA 2VRKA 3D5HA 4CCDA 4Z2IA 1QI0A 4DO5A 4TVCA 5I78A 1JYWA 4LXFA 1KXTA 2X2IA 4UQBA 1WP6A 3RMEA 1WPCA 3VOCA 1E1EA 1IV8A 2CIPA 3PZMA 3AZRA 2BVDA 3RDKA 5BXTA 1JZ2A 1XD0A 2WC7A 4JFVA 4DUWA 4QCEA 1FH8A 4JCMA 2VTFA 1GJWA 1W9XA 2CETA 3CGTA 1OBAA 2J8FA 3F5JA 3CUGA 1V6VA 2JE8A 3AIRA 3IGUA 4GI9A 4CKQA 1F4HA 2J25A 1GCYA 3SCRA 1MW3A 3W82A 1LL6A 2FHCA 4M80A 3W26A 3WEOA 1EH9A 1V0MA 5BCAA 2EPLX 4U5KA 2YA2A 3KEHA 1KQYA 1PX8A 4LX4A 2AOSA 4UQAA 1XHGA 5M3WA 1H2JA 1TG7A 1MXDA 2UY3A 3APGA 3BUBA 3TTSA 1HVQA 3OGSA 4C7DA 4L4PA 1TA3B 1OT1A 2FDMA 3HG2A 5C8BB 1GQIA 4PYSA 5HPOA 1I75A 2E40A 3F5LA 4QLKA 1E40A 1F4AA 4H8VA 3W27A 4BQ5A 5AY7A 3GM8A 1H49A 5FD0A 3SUTA 4UFJA 4CD4A 1B3YA 3SCNA 3WDPP 4UZUA 3CUHA 2XYLA 4NX0A 3W25A 4D6DA 4DWSC 1XSKA 3WDIA 2G8ZA 4R5EA 4JL2A 1O7DC 1J0HA 1H3GA 3VIIA 4QLJA 3TV8A 1J0IA 1UWTA 5A8PA 1C8XA 1PS3A 2WCAA 2DEPA 4WKAA 4GKLA 1ISXA 1NOWA 1NH6A 3IJ7A 1CZ1A 5A6BA 1CEOA 2J62A 3VIPA 1QBAA 2Y5EA 3PZTA 1OIMA 2WM0A 3WDRA 3PN8A 3DC0A 3EJTA 3CZKA 4W89A 1W3LA 1BGGA 5IDIA 2VRQA 3OA5A 2PC8A 5E6YA 2JFEX 2J7CA 2YLLA 1FH7A 4M81A 3WFLA 4BQ3A 4GPNA 2W63A 1T0OA 1UOKA 4D6IA 4AYSA 5A69A 2F7OA 1DWAM 5LA2A 4CVWA 1VBRA 1SYTA 2WKGA 3POCA 3AS2A 2CESA 2ZUVA 1JZ3A 4S3KA 4EK7A 2FHBA 3ZJKA 3VMNA
chains in the Genus database with same CATH superfamily
1PLGH 2IXUA 1KDJA 4GQBA 1IC7L 2YBGA 4TNVK 3B2UD 3M8OH 3TFKC 3RL1B 5A8NA 2A3HA 2H26B 1LRTA 2YAPA 1NCIA 1E1FA 4XWGL 4Q22A 4GKZA 1TTFA 1RULL 1G67A 3VH8A 2FBJH 2Z6FA 3LOWA 5JBDA 1FLRL 3T0TA 4L4TA 5A6MA 2ZSVA 1XS2A 4FF5A 3H2AA 1SPDA 3P60A 4PJCA 5DQDH 5E9DA 4P8VA 3TYGH 2ZTBA 1I7RA 5I1CL 1MNUL 4RZBA 4DVOA 3GWJA 3QI9D 4XNMA 3K74B 5JBEA 4N9DA 1BQUA 3U2SA 1IBYA 3PTDA 2VCCA 3CT7A 4N0CD 1VB9A 5EDSA 4F91B 2EYRB 3L5MA 1A9EB 4JM0A 3I6GA 3ATZA 3SRFA 1X7TA 3LN4B 4EVNA 4XZNX 2Z7YA 4WKZA 2QHLA 5D7LB 3TBVB 4KI5E 4MJJA 1MREL 1NC2D 5F7FA 4UTJA 1IBBA 3JZUA 2PP3A 2X4QA 1EDQA 3VNJA 3W7PA 1ZGLB 5F72S 2AXHA 4HX1A 3CLMA 3GO2A 4BEUA 1MG2C 5C9KA 4HFWB 1D9KA 3UFYA 1I8KA 3DUGA 1TPC1 1BX2B 1YEKL 5D72H 1IVLA 1BAFH 1F3JA 1WGVA 3VJ6B 4NQCE 3AQUA 2NXYB 1HXJA 5LSMA 4DO6A 3U30B 2W88A 4ZENA 1SEQH 1FZOB 1PKQA 1HINH 2AXGA 3SDCB 4ZXOA 3O3BB 5BXRA 3HA1A 2R0WL 1ZSHA 1XGTA 4H7ZA 1S5IL 3QC0A 3FXGA 1DQTA 4RGNE 1US2A 2XTKA 1R3TA 4PWGA 4DJEC 3FQWB 3UWWA 1YDNA 1C92A 3RWIA 3QWQB 4LLUA 3KOYA 3RGVC 4OFCA 5C2UB 1TREA 3VO0A 3VWJA 1U2YA 3DHPA 3WN6A 3LYRA 4F4RA 1H0IA 2JJTA 1ZAIA 5A2LH 4QMEA 3GDKA 2YZ1A 3H22A 3PGFH 3P0VL 3RL2A 4ZBCA 5JHBA 1NP0A 2A0NA 1EO8H 4MJMA 1N0LA 5F7DA 4PJ7A 4JVWA 5G5IA 1BVZA 5IMOA 2PP1A 3MHZA 2B4GA 1Q8MA 3JWDL 5I18L 4W9ZA 2NX9A 3ETTA 2MUCA 1UA6H 2BSEA 2ACQA 5DUPL 3R94A 1J1XH 3RKPA 4PW9A 1UFUA 4PTTB 5HJGA 4AYFA 1TOXA 1NGYB 2ZICA 3BMWA 2AW2A 2KDYA 2BOLA 4OLUH 4KZDH 3P14A 2JV6A 4KVNH 3T4YA 2NSMA 4IPJA 1L7TL 2NW3A 3OZLA 1PG7X 3LTPA 2XJ7A 4X4XA 3HJ0A 3SUWA 5I5JA 1DANT 3CSYB 2XISA 1U3HD 3F04A 2G9KA 4MGGA 4D0DA 4JO4L 1D6EA 2J7EA 4F92B 2FX7H 3JW7A 4J4PA 1IO4C 4OH2A 2ZUWA 3GK0A 3NOIA 1QFEA 2GABA 4PIRF 3RHGA 3QZAA 3P0YH 1CGYA 3KWVA 4BZYA 5LVEA 1NDYA 1JGLL 3MRIB 1LRQA 1Z6JT 3FCSB 2DFAA 4LANA 2WO3B 3FLUA 3TKFA 1R3IH 4Y9MA 3RWEB 5HHNA 1QHZA 5I03A 1HTIA 4V28A 2EDOA 4YDIL 1VPQA 4PFEA 1QEWB 4LV4A 2V3GA 1H5VA 4WK0B 3PB2A 5FV2A 1MXGA 2CO6B 4WW1B 2JK2A 4JHMA 4M1RA 4LK4A 1G7QB 1D9KC 4WUUA 4GSXA 4PJ5B 1HH6B 1LG2A 1XGUA 2E27L 1QDSA 3SRDA 4FG6D 3S48A 4D8PB 1HYSC 3LOTA 4G8EB 2JELL 5JPNA 3GBEA 3SECA 5IM7B 2X88A 3SQOL 5BRBA 2J7BA 3TNMA 3T1GA 1G4RA 4X9YA 4Q9CA 1UW9A 1GK8A 2Y25A 1TG8A 5IHZA 2JI3A 2V0TA 1GKEA 1QJWA 2OSLA 1AGBA 1KJ2L 1I0BA 2AXJA 4BQCA 3D3FA 1N7ML 3HI5H 3DSFH 2R82A 4ILSA 3I50H 1MFMA 3UR8A 3EX4A 3NPXA 1HL9A 4B0MM 3VWJC 2R29H 1G4TA 2JJTC 3NCFB 4XUYA 4JR9L 1QBBA 4JY5H 4FULA 2ARJQ 2CG9X 4QRRE 4JLRB 3DX7A 1I1WA 3KCLA 1DVZA 3AMGA 3ARDB 3FT3B 2NYKA 4L8BB 4UFHA 2DTSA 1TVLA 3QO1B 1SDDB 1X98A 1V0LA 3M6DA 4NCC1 4P5TA 4IBQA 3MA9L 2IMRA 2E1DA 2GUUA 3BPCA 4L1DA 1SXCA 5DA0B 3GUTB 4PJ7F 1CWYA 3FFOA 4DWSB 1O5RA 4GUFA 2ZD0A 1EHLH 1HKMA 3UXAA 2QPEB 4M5ZL 1JERA 1UEYA 2JKLA 4OJEH 4GLEA 2PEVA 2Z00A 4G9FB 3D0LB 3HC4H 2C9VA 3W7CA 4NJIA 5T1LA 4P5RA 4YDMA 4ANXA 4W6YB 2G50A 1IC7H 4G7QB 5F7WC 3BUDA 3WFHB 3L3KB 1OGPA 3LXUX 4OI9A 4CVXA 3VFVB 4J4PC 2HX8A 2Y5TB 2NY1C 3B3IB 4NO0A 2FSEB 1Y6MR 3V0GA 2ONEA 1T2JA 3I65A 4GG6A 1PKNA 2WV3A 3UW6A 1NAMA 3TFCA 3FVMA 5JW3L 4IGBD 2HJFA 4HWUA 3GMNA 3STLA 4W9EC 5A6LA 2HFTA 1BQHG 3UC2A 3L5WA 4LHUB 4MNGB 2ZA3A 1PX3A 2IDCA 1EO7A 3TCLB 3QZWB 3UQNA 4MYPA 4LP5A 1EYEA 3BFQG 3VFTB 2RHGA 4FIQA 4MNHA 4R53A 1G6RB 1U93A 5JPNC 1OD0A 3V4PA 4QTHA 4DJDD 5INDB 2Q0ZX 3SPHA 3FKUS 3M7FB 4R4ND 1QNZH 4NLAA 2IF7A 2G95A 4GK8A 3ARGD 1L6XA 5D4YA 1BVKA 5H4ZA 4RMRA 3WBYA 3ESPA 4MNMA 4FYRA 1QFUH 4AUJA 4OM0H 1BSIA 1KFEA 3UFIA 5I1IL 3FO0H 4RE4A 2FZDA 2PSNA 2F58L 1KXTB 1BM3L 3EYOB 3GVQA 3BKJH 3ILQC 2DIJA 3LS4H 5ABHA 7PTDA 4JFOB 2Q02A 4UZGA 3SE6A 3UERA 3G5WA 2GBVA 1FGNL 1ZLWK 1UB6B 2BGNE 1GVRA 4TXEA 4YUEL 1GYWA 3EAUA 1ETJA 3SN4A 4P5TC 2EEDA 2FLRT 4CGUB 2OAAA 4OQTL 2CHDA 1KRCC 4U1MB 1GW9A 2IWEA 2GGIA 2CHZA 5GS1B 7REQB 2NTSP 4RMWA 3OKNA 2R0WH 4QAIA 5CSUA 4ZDHA 4BZ1H 1ASPA 4ICMA 4OLYH 1ILSA 4Y4HB 1JWSB 1TEFA 3NJMA 3FU7A 4UIKH 3L3OA 1U30A 1TB3A 3TZNA 2CDEA 1TKKA 4RGOH 1CGSL 2QKIA 2VO5A 3DZ1A 3CFCL 4WJXA 2VERN 2G4GA 1KCLA 4LF3A 4LL1A 2YIHA 1VKXA 4FOJA 5I26A 5MEPA 4CBPA 3GVGA 3GXNA 1FL6B 5I82A 4N8VB 5HUOA 2X70A 1WZMA 5F6HJ 3LZNA 1HP5A 4XRCB 1BQCA 2L8AA 3W0WE 3IUIA 4GUPB 2WP3T 5DK3A 1HL2A 4XCYB 1T7WA 3B5TA 3ZJ6A 2OJEB 2ARJB 5DUPH 4GLRH 3MNVA 4KKBD 4HK6A 4M6UA 5HANA 3N4FA 1HC1A 5FAGA 1JK8B 4IIQB 2KQMA 2ZOWA 1UWSA 4EF9A 1EAOA 1FRGL 1KGWA 2Z93A 5JHLL 5IMKB 3M5YA 5DTFA 1RV6X 1OINA 3PF2A 1PAMA 3T0EB 5GGUB 4G5AA 3PGCA 5IQNA 5F6IB 1TTPA 2QTVA 3PV7A 1NEZG 2A79A 5EN3A 3W6LA 3MLSL 5EV7A 5D2LA 2WZEA 3FU0A 3KVPA 1K6WA 3GTNA 1DIDA 1GPWA 3BWSA 4Y5YA 3LCLA 2YD7A 2ZJSH 2ADJB 2XV2A 2W07A 4ORIA 3HZVA 4O0KA 2N0KA 2VN4A 2Y72A 3PUGA 3H2OA 4J3ZA 2A3TA 2VR4A 4LLMB 5I6LA 4KXAA 4M43L 2HTKC 1YMMB 4E9WA 2N0MA 1H61A 5IXEA 3E8UL 1OAQL 1OW0A 4M5YL 4OSUH 2VLKA 3PUUA 4JMXA 1D8CA 3S1GA 3PABA 1Z5HA 1ZWIB 3CDFA 4P2OA 3ZBMA 2R1WA 4GRWB 4CNIA 4LGPB 2Z24A 5JNYA 2PCXA 3H2EA 4ZD3L 5FYLD 4E2DA 2ITCA 4D9LL 3IS4A 5I9QC 4ONGL 2P5WA 1WS7A 3DX1A 3FB6A 1W72A 2F8OA 2I25N 4HSQA 5TDNA 8XIAA 2OMTB 2C1PB 1E6NA 3QTPA 3RFAA 3VFSB 4K1WA 1K8DA 4HUKB 1O9VA 2MNUA 1N7MH 3L3OC 1MFEH 1AKPA 3V8CA 2QKIC 1IGJB 3K8MA 5I6KA 1LEIA 4AGPA 5D4HA 4TLUA 2XTJE 1ZU8A 1CL7L 2GAZB 5IGXL 3G2GA 4C57C 1NEYA 4IBLT 2W27A 4BF7A 3HLAB 3Q37A 5CD3A 4D6GA 1UH3A 3OMZA 1IT9H 1XTLA 3S5ZA 1OM3H 2YUZA 3THDA 2YSTA 2HG5B 1GZQB 2D9QB 4JFED 2B7OA 2RH9A 1MVYA 1W1TA 4UWQB 2YARA 3TBCA 1CZ8L 4L37B 5J8OA 4I77H 3ZE0B 5C0NC 1LYQA 4IM4A 3TS8A 5EZIL 1AL7A 3WH7A 4BSJA 4Z7OF 4PBXA 5DD5L 2GC4C 3QY7A 1QA9B 2FE0A 2VDHA 3DC8A 1II4E 5IB3B 2WYTA 4AQ8A 4LSPL 3Q6GL 1UOVA 2HKHL 1YDVA 3R58A 2HJKB 2CLOA 4NT6A 2YL8A 1GA2A 2AAMA 3SCMB 5J4MA 5GNZA 5TGBB 1T1YB 1I9EA 3WJMB 3OHMB 4Y5YC 5E5RB 3WNPA 2DQTH 1XCXA 1FFPB 1VH7A 2VD9A 5IMMA 2VLRD 5ABFB 2I7GA 4HU2A 1C5CH 4PG9B 5K1NA 1A7NL 4L8DA 5E6ID 2YPVL 5BJTA 3EWWA 4QHRA 2QDEA 4FNTA 2WAGA 4WEBH 4UOW1 5D2LF 1CLVA 3TN0D 4QTGA 3FN0H 3L13A 1OW0C 3T0CA 4M6VA 4HA1A 1B0IA 2IDSA 3WS6A 4P2OC 3QQDB 2V7HB 2E5EA 3P4NA 1OPOA 1DL3A 3NCEB 2I85A 1UZGA 5DSCB 1NQBA 4GRMA 4UU9A 4X6CA 3RBGA 1LWRA 3R8QA 2OL3B 4MQSB 1UUOA 2CH8A 3SY0A 2XVPA 3RNKA 4L4LA 5HAOA 4WWKD 5CILL 4F58L 4NQED 5DS1A 1NFDE 5KYWB 3CV5A 3FB5A 3T05A 4RIRB 5EU5B 1GKRA 1MEIA 1N6QH 1NFGA 5IV2A 3MRCA 5DHDA 4K3HA 2O7QA 1R75A 4LSSL 4A6YA 4TN9A 2GJ6D 3RLSA 3QUXB 1JCJA 1QATA 3ASWA 3NABH 2FX8L 3CUZA 5GGRA 3V4PL 4FR6A 3H9SB 4BK9A 3LENA 3O4LA 2NLJB 2IGLA 4AIOA 1RR2A 2QLYA 3A4AA 1OD8A 2Z29A 5GGTA 3K2KA 2VDPH 1P7QA 3TO4A 3OXRA 5EU6B 1AW2A 3DOHA 1LBMA 2GI0A 1F4WH 2I26N 4BWTA 4OQTH 3WFCL 4N02A 1H15A 2APXA 4TUKL 1URZA 5HPMB 2HS8A 3MO7A 4DBUA 4HZ8A 3E1ZA 1V7AA 3GKFA 2CZ5A 3G1HA 1FE8L 2FIKB 4AE1A 3FOLB 4QGYA 1BYAA 4UCFA 4AC7C 3ME0A 4Z77B 2IW0A 2CJUH 1UQSB 1UYWL 4AQ8C 5CLXA 4X80H 1CECA 5HQLA 3T04D 3AY4A 4LAZA 3LHAA 4NKQB 4UTUA 3HE7B 3WF1A 2DZSA 3RCYA 4KUCD 4GZJA 4QEHA 3V0AC 2IGTA 1NGXA 1JHLL 1F5ZA 1OG6A 1GOXA 3S35H 3C09B 2QV4A 4YXKH 1X9RA 4WSKA 4FX7A 1XEUA 2CEQA 5HNTA 4J8RB 2B0SL 2F19H 3VFNA 4H8NA 4LAQL 4NPYB 1IAIH 3QIBD 4N85A 4U6HB 2QEJA 2P53A 5BQ7A 4YHLL 4NOFA 4PMUA 5KAQG 1XV8A 4GQ9H 4E41A 4S3BA 1AXSA 5JDSB 3EOUA 5A16B 3DUSA 2X09A 43CAB 3S96B 4O2EA 1RURH 2ICWI 4BFRA 3WS6C 2UYLA 4IEFA 1A66A 3J27A 4QHLB 4WNQA 2BNQA 3T1WA 2VRKA 5FGCE 1W1B1 3DROB 1M42A 3TQ0A 3ZTNH 1E6OH 4ZW8A 1L5GB 3IU4H 5FO7A 1NCTA 5CSSA 4QCEA 4N0YL 4A7GF 1VCAA 5I00A 2HWGA 2J8UE 2AZAA 1FQ9C 5DJ8A 3X3GL 3U0HA 4PS4L 2J25A 4UDTB 2VXUH 4JY6B 3ULVC 5DMLA 2Z92B 3UAFA 2GVJA 2ZA2A 2QCDB 3GUWA 3S5SA 1PEWA 1UOWA 1UOZA 4ODSH 3FBKA 3W27A 4A8NA 3JSSA 5EMJA 3E8UH 1Y0LB 3CFEB 1JCXA 1OAQH 5LBSA 1KGJA 3EKCA 3UZVA 1YJDL 3T40A 1HCZA 3ULVF 1EC7A 1QFWM 4UTLA 3S4TA 3FUEA 5AN7A 2ZUQC 2EIKB 4EP8C 3VIPA 4NN5C 3EBIA 2NY7H 2DORA 3KS6A 3C0JA 3TO4C 2OP4L 3TYUA 1MAKA 2Q8AH 1P5BA 4ONGH 4M6OL 2J21A 1PZ5B 3OA5A 1QLFB 3G6DH 2IAMA 4AYSA 2O72A 5HMDA 1RK1A 1DDHA 1OAUH 3CEUA 5FKAB 3A9IA 4XMPH 1CLYH 1NCOA 4NNYA 2PODA 1X6UA 1L2UA 4EK7A 3BVJA 1M6OA 1IM9A 4PUJA 4QDMA 5C0AE 1IFRA 4G7YL 1P48A 1E73M 1VADB 3K8LA 3P2BA 3AY4C 4I9XA 2O93L 5DD3L 4RGMB 3L3JB 3CFDA 4HZ6A 3STCA 1S8DB 4DFIA 4KXDA 4NZDA 1A7OL 2HZHA 2BPBA 1OYCA 4FFZH 1GOQA 1T1ZA 1EJOH 3TCSA 4C6OA 4K38A 1W72L 2EDTA 1W1A1 2X4PA 4JZJA 1NFIB 2BDQA 3NOYA 2VOTA 2OLSA 4ZXLA 3RJYA 3UDWA 4OUUB 5DMNA 2UY7A 3T0WA 3KRBA 4PLOB 3E2QA 1XGYL 3SODB 2OXNA 3DMMB 4UIMB 2A6IA 1VCGA 4L6HA 4DOHB 5C0DB 4PYGA 4R34A 1PGRB 5EZIH 4MD0A 4AL8H 1TXKA 1UM5L 5KWYC 1W0MA 1RI8A 2YHGA 4HBCH 1KN4L 1TTUA 1K4HA 3FCPA 4D8LA 2XRAH 4NSKB 1KV8A 4LSPH 4DUXA 3VXRD 1RFDH 2W65B 3LY0A 1X96A 4KX8A 3JS3A 2DEXX 2Z7UA 1ZCRA 3GTIA 5FDWA 3DV4A 2QADB 2J43A 4W6XB 2ADIB 4Z5RA 3ZLFA 3AJXA 2CCWA 1DBAL 1AAJA 4K68A 2ED6A 4MQXC 3EKZA 4K71B 3UOAB 5EOCL 4N2NA 4GPVA 4CD7A 1N18A 1N5YL 5T8IA 4LEFA 3GE7A 2DKSA 4P2QE 3H26A 2CU0A 3BWZA 4P2RB 3CPRA 3EWBX 4AZUA 2CITA 2EIEA 4ZFGL 4LEXH 3T9WA 5CZRA 5L88L 5CSRA 2R7EB 1VGKA 4YXHH 3VFOB 2H1PL 2I17A 4KRPB 4KITB 2V81A 5IEKB 1B4TA 1G9HA 5DMIH 4G1EB 2B15A 2I16A 2YYUA 5D4IA 1T40A 5CZVH 4UB0L 1O7DE 4BZ2H 1MRCH 4RNJA 4PW3A 2IAMC 4G6CA 5JMOC 3N4AA 2I1OA 1KNOB 3CM4A 3B9KA 3UGVA 3WY4A 3K5RA 5RUBA 3L1FA 3CU7A 2W9DH 4PBFA 3ECVA 3DG6A 2WV8A 4ADJA 3NT0A 1VA9A 1FZJB 1WK0A 3RU8H 4JTAA 4OGAC 3MJ9L 5FO2A 1HHGB 3P0GB 5BXFA 1LM1A 5LGXA 4YVPA 1NCWL 4LSSH 3K5XA 1UR8A 1OX4B 4OZHE 1PIGA 4JO3L 3UP6A 4HS6B 2OJZH 2XG9A 2XV0A 3LQZA 1LBFA 4UTTA 4QGCA 1AXTL 3BVTA 1TUPA 2XQ0A 2PNDA 5I66B 2IOIA 4JZJC 3WZ0E 4P5MB 5HOSA 4NO3A 3WU1A 3LKSB 3UDWC 2EECA 1U3JA 2PDGA 1RP9A 5F9DC 2JTYA 3NCYS 2KHAA 3SDAB 3ULVL 4EPSA 3WFCH 3BAEH 2X10A 4KO6A 3KM2A 2ODIA 1UD6A 5I8EB 1QWGA 4FFVD 3GT6A 1I4FA 3D2UD 2B81A 4U5IA 3OKKB 2C4FT 2JKSA 1NMAH 1VDGA 3T6VA 1XUUA 1OGAD 3A3XA 3WLOA 1HQ4B 4YX2L 5C0QA 1B30A 2R29A 5FM5M 4H3DA 2EXYC 2VZ1A 3V0IA 1AZ2A 1TRIA 4TQ8A 3TROA 2D7OA 3GIYA 5B38A 1RXOB 1XQ4A 3N6QA 3GMOA 4QRFA 2VD8A 4WR3A 1G0XA 3TWYA 1PZUB 3LEPA 2J4WH 1YZZA 2VZVA 4UM8B 1Z9MA 4MA8H 1T6BX 4MXVE 5L4MA 1EGZA 4LLAA 3LNDA 6PTDA 2GSGA 2IANE 4ZW3A 1BVLB 4XOAA 1AP2A 4GVHA 1H1YA 3PWPE 1BJ8A 1OF2B 1K8CA 4WIWA 4HGWB 2NQHA 1CFSB 2WXJA 2C0HA 1OABA 3RWHB 1W1YA 3AU1A 1WXZA 1A3ZA 3S9YA 1EX1A 1DQIA 1E28A 4KX9A 2Y7SA 4IIDA 3QFJD 3RVXC 3MO1A 3GS6A 3G9VA 5B80A 1I8MB 3WLRA 4F7KA 5F97E 2HVKA 3MGOB 1UC4A 1CDCA 4KK6D 2DEWX 1D5MA 3AWOA 3QJHB 1MVFA 5HJYA 1ETZA 3HB9A 3B9KC 4PS4H 2RFXA 4JO8A 2NDGA 1US0A 2YN3A 3WDQA 1BM7A 2K6YA 1BQGA 2Y7MA 2PGEA 3F6JA 2AKZA 3BLLA 3NN8A 2DVTA 1YC7A 3QEQA 4OZIE 5D5MA 4FFWD 2WM1A 1B3IA 4G6AC 4H9XA 2XN9D 3V52H 3Q2DA 1LNUA 3EPOA 1BTCA 2ENQA 2X0UA 4YXLL 5DUJA 5GNXA 3YPIA 3RKDD 2HT2D 3VXME 1XL9A 5EC1B 3VQMA 3X1BA 4HCFA 5KYUB 3F2BA 4H0GA 1PY4A 2J66A 1PLGL 1L8NA 3S2JA 3WUWA 1XYBA 3WUGA 4YK4B 5GJSL 5F89B 3I9PA 4UTTC 1U8JA 4W87A 4UV7H 3O9WD 5KG9B 2OQLA 5K9KB 1KWKA 4MS8D 3M8OL 1XMWA 4OVXA 3WEXB 3DETD 1S6NA 3KG5A 3M1CA 3JT2A 3MLXH 4Y9FA 1A25A 2Z8RA 3VE0B 1LTXA 1CPUA 4QGTA 1R3RA 3FPXA 2AMXA 3SKOA 3CLWA 3QPEA 3B6SA 2NX5E 5K59E 3CXDH 1W32A 3E0GA 3TYGL 4TVDA 3PP3H 3UWVA 2PU1A 3UPRB 1ZGLM 3I2CH 5IW6A 5ID0A 3G3MA 3SJVD 3LZPA 3ZHDA 1A6VL 1AZ1A 4NJAL 5FUCE 5HGHA 3PNZA 4XHJD 4EXQA 3N1AA 4G6JH 3BPWA 3OOQA 4B9YA 3CH1A 5CFAA 4ANVA 5EZPA 1V5JA 4TUFA 5CR1A 2GGJA 2O5YH 3ZOAA 5FW7A 4NBYB 1A7OH 3UAJD 4ZQPA 3FB7A 4HFUH 4HV8B 3NNTA 4EKJA 4PUWA 4GRLB 2IJ0C 4N3TA 5SWZA 3KPMB 1ZHLB 2WYZA 3ZKSD 1XSIA 4J4KA 3VWKB 4G43A 3N2MA 1FA4A 3DIVA 3COOA 3CE1A 1IIKA 1XGPB 2Q8XA 2CLVB 1K7XA 3KXFD 3A3YB 4BZ1A 2WWKT 4PA8A 1JD9A 1IAMA 3KOZA 4PRIA 4D71A 5IBXA 2YCEA 4BFEA 3EA1A 1AD0A 2IKJA 2A4ZA 1GOHA 5KW9H 3EJCA 3WH5A 1T03H 3EYFB 3FFCD 3N12A 4MIMA 3MZNA 4Q7IA 3VKAA 3A4WA 1FHNA 2J88H 1KM0A 4D2JA 1JGDB 5D72L 3RLHA 1E5YA 1BAFL 3RIAK 1RK0A 1TIMA 4FDWA 1H51A 3O3RA 3MSYA 1TPB1 2ZRYA 4PJ8A 4BKLB 5EOCH 4Z7QF 3R1GL 1F2XK 1SEQL 1A22B 3X1NA 1HINL 3NQIA 4H2CA 5CKGA 2YDAA 2G9HB 4JFPA 5M94B 1SYSB 4B5UA 1TLMA 4JX6A 2WLLA 1YNPA 5J1SC 2JQMA 4Z3FA 4JOMA 4C6QA 2K7QA 2A9NH 3SCPA 4YDLB 3ME3A 3AXMA 2D7MA 5HHOB 1SZNA 1TPDA 1NGZB 3GMMB 4IPIA 5B22A 5CXPA 3R18A 5F1VA 1RCQA 3EXLA 4EXAA 2DM2A 3PGFL 5BNXD 2IPKB 5CGBA 4AM0A 4HDIA 1KLUB 5D5MF 1EO8L 4ACPA 3S8FB 3L08A 3RNQB 1NCBH 2JKXA 4Y9BA 4LP8A 4ODWB 4NNXB 3I3DA 4AF0A 1NIAA 3WS3A 1PZCA 2V9TA 2HZGA 1UA6L 1WCBA 1YMHA 5J8LA 4YL9A 1J8SA 5D9MA 1J1XL 2YXOA 1YXCA 1NDVA 4UNTA 3NUKA 4HIJB 7TAAA 3BV4A 3UJEA 1UXLA 4LEEA 2HBXA 1G9NH 3N50A 1RZGB 1HXMB 1NCWH 3QFEA 2SFPA 2XH2A 2WTOA 3PJSB 1LWHA 4TLTA 4Z1YA 3QZLA 4KZDL 2DUAA 4KVNL 2X87A 1M3UA 2AJVH 4YHIB 5DJYB 5EDXA 4AT6B 5JIIA 3KBVA 3KPQB 4PJGE 3BTNA 1AXTH 3IAPA 3LSOA 4K5NA 4P9MH 4XP4L 2LT9A 4MJ6B 2E5BA 2CSPA 1EUAA 2FX7L 3T0VA 1YDPA 3STFA 3CZJA 3T6QC 2A7PA 1TV4A 3P0YL 4ECLA 2OOFA 1XDMA 4L05A 4XMXA 4GXUM 1PZSA 4AX3A 2D23A 4UMAA 1T7VA 3BO9A 2WXPA 1CFQA 4HJIA 5CAKA 2OZTA 4W81A 1Q7ZA 4R7VA 1MFUA 2GQ3A 5IBXC 1PLAA 1VYPX 1FWFC 1U6AL 4HCRL 3BLIA 1C8QA 3QCTH 3VFUA 2YPLE 3W87A 3OKDA 1KCXA 2AL2A 5DXYA 2MKLC 2ZKHH 3VFPA 3Q9PA 1JD7A 3E3QE 1O9ZA 4Y5VA 1CR9H 5K4ZA 1LVEA 3LEXB 4LKCB 1ESOA 1NMCC 1Q13A 4PJ8C 1HHKB 3GBLA 5GZND 3CQ0A 1V77A 1K4GA 2KUTA 1GW1A 5D1ZA 1KLGB 3UBHA 3B05A 2Y89A 5KTEH 2TRYA 3VKKA 2L7EA 1ZD6A 4MXQC 3BKCH 3HI5L 3DSFL 1ZSXA 4XNYH 2EADA 5HDBB 3P0WA 3I50L 5F7EH 1Z7JA 3FOKA 5HHXH 5GVJA 4Y16D 1K7EA 1ZHKB 4FQLL 6REQA 2JKTM 3ELFA 2WW5A 3DV6A 4JY5L 1K9DA 2HPIA 2NTFA 1G9ML 4N0FA 4ADIA 1C90A 1QHOA 2BS8A 2EE0A 1UR1A 3S37H 1M1XA 3G6AB 4G8GD 3FNDA 1UIPA 3VRJB 5D1QE 2I32A 3G08B 1R3KB 1JIBA 5KSAA 5GIRA 4MCMA 1V7MH 4PRBA 1FIGH 3OGCB 3IMSA 1QI5A 3L5JA 1TVDA 2PZ0A 2V2TA 1C29A 1RUSA 4DZBB 4WKHA 1EHLL 1U42A 4M4RB 1CURA 4YXLH 5CHNB 1YDYA 2FRGP 1AD9A 3HC4L 3C2VA 1EB3A 4GAGL 5GJSH 4JEQA 5EWIH 4ZAKD 3NPWA 4DK3A 1F8IA 3WXWH 2H8ZA 2BSTB 5IESH 1Y65A 2A9DA 4ZTPH 4R33A 1DJXA 5AYBA 4WXZA 1HJXA 2PXYD 3ZVHA 5ABDE 3KRUA 5EUOA 4FQQA 5DYOB 4F1SA 1MXSA 1P53A 5EH1A 4YGVB 1D2PA 4JDYA 3HNVH 1ISZA 1UCWA 4W7VA 2Y36H 1A6VH 4JANB 3HB3D 4NJAH 4XCEA 1FFRA 4GAAA 2VL4A 4KHTH 1S5MA 4ZO6A 3L7FA 3STPA 4PRRA 4FTVD 1KPRA 3L0GA 3A4EA 2QT3A 1A7PH 3PRZA 4DPQA 1OC5A 4WTQA 4Y5VC 4TXVB 3RI5K 3WD4A 3U6XS 4H41A 1AQ0A 2EG7A 1QNZL 1QRKA 4H20H 5D1ZC 3KL0A 5E1IA 4UNUA 2FZ3A 3DBPA 1AQHA 4OQTA 4W9TA 1KEMH 4QRPE 2PKDA 4A37A 4RDQF 1QFUL 2IDUA 1F6YA 2EG6A 4UT9H 2AV7A 1AS6A 5C0IA 3FTGB 4OM0L 3FTWA 2C7UB 1J11A 2ZOOA 3AXXA 3FO0L 1UP3A 3OVGA 4IFRA 3RJXA 4XBEL 1KCSH 3N0PB 2DJLA 3WKMH 5IB2B 4PMVA 3BKJL 2NX1A 3SBFA 3LS4L 1BWKA 4HGKC 5TE4H 3C6LD 4JY4A 1TV5A 4QTIL 4YHNB 5D32A 5EN2B 3K3QA 3ZDXF 3GKWH 2ZAIA 3RZWA 1GT8A 2EDQA 3GJEA 2CLFA 3LK6A 1EOMA 1H50A 3FA5A 4PHXA 3AJ7A 5T3ZD 2Z34A 3GNXA 3SSJA 5AW2B 2XHYA 2AK4E 5KSAC 2VX5A 3T65B 3R1GH 3MV9D 5FYJE 3H12A 3KBFA 1ZA3B 3PP4L 4U7KA 1DLHB 4BZ1L 2VDLB 1AYRA 4OLYL 5IQLA 4EX4A 4EIVA 4UNKA 4UIKL 4OJDH 4ACZB 5D93C 1WVZA 3MJWA 1BVOA 2MJWA 1LO4H 1A21A 3CASA 5K5YA 4RGOL 1T20A 1ECQA 4Y4FB 5I1DB 4H1LA 3PDOA 3LMJH 4NDMA 5JHLA 1YKWA 3VC5A 4ACTA 3FO1A 3LXAA 3CNKA 3BN3B 2YXMA 3UTTA 5BOJA 1DWFM 3FA4A 3ZO0A 1HKLH 2DLGA 3FQUB 3E2VA 4UNIA 4IP4A 3UTQA 3KLAA 1ZLDA 5DY2A 2YBRA 1EWEA 1XISA 1JPMA 1XB6A 4D2NA 2BP1A 5TH2A 4BA8A 3NPUA 4KFNA 2EDYA 2JK5B 2UVFA 4NGHH 3QC3A 4KV5F 2MQCA 2D24A 1PF3A 1F56A 1WKEA 4H8PA 3FSAA 4YGAB 4WEMB 3W2KA 3IDIB 2EDJA 3L6FB 5CS7A 3CZLA 1XIGA 5EUOF 3UZEA 4NT0A 3NL6A 3AG1B 5KSVA 4G5DA 1KGCD 2HVNA 2XX1A 2XXFA 3NVTA 5GSRB 1B90A 3VG0H 3SKMB 1SM3H 3U46B 3RWJB 2QYGA 5D70H 5ESQB 3U48A 5I71B 4GGBA 4XP4H 2XPZA 4PVLA 3BDKA 4EI5D 3OKLB 2INZA 1VLIA 2BCKA 2ZJSL 3OW1A 3JV5A 2G75A 2X6AA 1S7XA 2AITA 4AGNA 2VW4A 2XH7A 3GBMH 4N9GB 4U2ZA 4S10A 4O53A 1V4YA 3V6OA 1KKRA 1TQXA 1E0XA 3BFWA 1BIHA 3TQPA 3QORD 4BFNA 1WP6A 3FV9A 1WPCA 4OSUL 3TJLA 1E1EA 2CIPA 1U6AH 3QAZB 4HCRH 3NJFA 2O5ZH 3MA7A 3QH3B 4AYMC 5CSBA 1EJVC 3LH9A 2V67A 4JCMA 2VTFA 3IXTB 2IQAB 5D1XA 2DQFB 4C6MA 3MJ7B 5HHPA 2VDMB 2YRLA 3WEOA 3S97C 4QXTB 5C55A 1KQYA 1HXYA 4FFZA 1TG7A 4C7DA 2HRHA 1T7ZA 5CMAA 4JM2A 1QPOA 3H23A 1P5VB 1T6MA 1F4AA 4UFJA 1VRSA 4NIYE 3LJ3A 4YNYB 2H0PA 2O6DA 1FDJA 3KPPB 5CJMA 2IBZY 3QJOA 5DJ6A 5K1VA 1H3GA 2FJGB 1MFEL 5FEZA 1C8XA 3M1OA 1BMWA 2DEPA 2CA3A 3UT0A 4FQLH 1NOWA 3MRPA 3M41A 3VXSE 2XC8A 3OVRA 3NQGA 4H6KA 1GW6A 4B5ZA 4OUIA 3P4MA 1ULVA 5F0PB 4R2GC 5I16B 1ZLWH 1G9MH 2JFEX 32C2B 1FH7A 4M81A 3G6JE 3MRGB 4Z3TA 1IT9L 4WKXA 5BOZG 1OM3L 3HHRB 3FS9A 4HJUA 4U0RB 3ZRSA 2ROXA 4NCDA 4PJIF 4MWFB 3TBYA 2J56A 4IQJA 3NPSB 1IC1A 4P2AA 3X14A 3IJHB 2WW8A 1UWQA 5F1UA 1NCJA 2CBPA 2GHWB 4I77L 4BSWB 2YPVA 5DHYA 3PBWA 5AKRA 1B3XA 2IC2A 3S1XA 2X41A 4OFYD 5AYQA 4NXKA 5FF6B 1F05A 5TPWH 4AVHA 3X1FA 3UZEC 4MFEA 4TQPA 2V3DA 2BY2A 3DURA 1CE6B 2NNXA 2PCFB 5I73B 4HPYL 3W4RA 4ZMQA 5F7DB 4GAGH 1JHTB 1QLEB 1FP8A 1TT6A 1K4CB 4LBSA 3C4UA 1TFVA 4YYFA 2E7LA 1ZPLA 3QQ3B 3OR6B 3P73A 3MXVH 4HK7A 2Z25A 2EINB 3GLDA 3AVEA 5LGKA 4NYLB 2DQTL 3HPLB 3CTTA 5CGTA 1ZCOA 5DC0A 3QNFA 3L9RB 1C5CL 5DX7A 4OVVA 1QSED 4MA1B 2FR4A 1TIUA 2YKKA 4N90E 5ACZB 4POUB 2BO0A 4IMCA 4KFOA 3FW6A 3SGZA 5IHWA 1YMYA 3V6OC 1XF4B 4GO6B 4WEBL 4BA0A 3E2SA 4LRIA 3FN0L 4RMBA 5AB1A 2BZNA 4B50A 4I5UA 1H7WA 2OXGB 4GH3A 1J10A 1H63A 5D1XC 3WO3B 2BX7A 1FKXA 2X4RB 3MC5A 3RGTA 4A3HA 3ZKMD 5H37G 2HFEB 5HGBB 3QWNA 3H2FA 4JM2C 4FQHA 3H55A 3RZCD 3AMCA 2QSQA 4IMLB 4J6IA 2R94A 2VDKB 3KPSD 3NZPA 1H41A 1BPLB 3LERA 4CW1A 1OD9A 1N6QL 1ONQB 3WSUA 2YRBA 3PBYA 1HKWA 3SPIA 1A4KA 4AL8C 4XBEH 1LL1A 4JM2F 1VRDA 5IHHA 1SNRA 2ICCA 1T0NB 4YLBA 5KBPA 1WJ3A 3NABL 4QTIH 1U83A 3GVWA 2DAVA 2R6OA 2ITDA 5EBWB 5BVJB 4B9GA 4LCQA 3D7PA 2JCCA 3BARA 1JFHA 4Z18A 1FWCC 3PS7A 2PCPB 2VDPL 1A80A 5I17A 3L66A 1RZIB 3NO5A 3AACA 5BXPA 2DUXA 3QDAA 1F4WL 4K15A 5DXXA 4OOUA 1XR9A 4CBZA 1L9OA 4ESKA 4OAWA 3OXSB 3QNZA 3PP4H 3U8GA 4F2MB 4EANA 5TE6H 3AGVA 4Z7VE 1AHWA 1DL7L 3TYFB 3HUJF 4QHNA 1XZWA 4XVJH 3EJJX 3L81A 3W7JA 1QW9A 3IJYB 2CJUL 3Q58A 4LOEA 4X80L 3RVVC 5C9JA 4RAUB 1XH0A 4BQ4A 5EORH 3DRQA 2X1RA 1ESWA 5EIIA 3MNWB 2E7LC 2CWNA 3WBWA 2XV6B 5FJIA 2FCBA 5FA3B 1ECEA 3IDNB 5JUEH 3CH9A 5F1SA 3KP1A 2CKBB 3NOEA 4Q32A 3S35L 4AGOA 2Q86A 1DZBA 4YXKL 1WHOA 3L23A 1XLKA 4GSDH 3NIGF 2F19L 4LCWD 3FO9B 1IAIL 3PUOA 1RVGA 4QQUA 2Y7QA 3W9EB 4DP8X 1I3RA 3FFDB 2ZNWA 1J1PH 4JR5A 1OCZB 3MP5A 4P48A 1CG9A 4ZMZA 4ABVA 2X40A 5DI8A 4GQ9L 1KPUA 2XWJB 4LRIC 4PUUA 2EF9A 2APFA 3NSYA 3QDJA 4JDEA 4MJZA 1KLFA 1WIUA 5KTLA 5GRUH 3B43A 3V0VA 1RURL 4S1DD 3RF9A 8XIMA 3WQPA 4Y8EA 2HPMA 3TQKA 1FBIL 2NRDA 2WC3A 1E9LA 3ZXAC 2VDQH 4WJ5A 4N0UA 1EAPB 3ZTNL 1E6OL 4QRSA 3IU4L 2PDIA 3FHAA 4HZ7A 4FOMA 3UJRA 4KNTA 4CCCA 3S3JA 2XFXA 4DM2A 2CCLA 1NUNB 3KBSA 1H3XA 3EFOA 3UAAA 4L1GA 4Y9PA 2VXUL 5I0VA 5J7CC 3D69B 4BS0A 1U8MA 1M4KA 3LCYA 1TZIA 3O3DA 3ZO9A 3AGWA 3POHA 3CBKB 3BP4B 3ENLA 3N41F 4W9HC 4W9LC 1J05B 1XIWD 2BNRD 4ODSL 1Z9LA 2EDHA 1FN4A 3BE7A 3C8DA 4IQEA 1O95A 4UFLA 5I09A 2QT6A 4LNRA 1TKWA 2JKNA 5C1MB 1G1CA 1WZLA 4ETQA 4C54A 2FH6A 2CKSA 3GC5A 4X0KA 2Z31D 1Q6FA 5DRXA 3BZ4B 3TJXA 2NY7L 1A7QH 2P45B 1NPJA 2YJQA 4XN4A 1B31A 3NK3A 1VF5C 4G8TA 3OSVA 4FNPA 2Q8AL 1DVUA 5IR1B 3QP3A 1T2QH 3G6DL 5HWJA 1RZFL 2OSWA 4YHGA 2BOCA 2GGEA 4HSCX 1WFTA 1OAUL 2X6MA 2DV0A 1S2VA 1AHWC 5DJ2A 2JCCF 4XMPL 1CLYL 1IWAA 2OX5A 1MDRA 1W3JA 1TRDA 2EZ0D 2V5SA 3OAWA 4PI0A 3DX9A 4F0KA 1JWUB 4DYKA 4YS1A 1NIEA 1UJTA 4HWBH 1S7QB 4O4WA 4TIMA 3F7LA 4J3BA 1SFTA 5AVZB 3HZMA 4V11A 2XWTB 1GGUA 3CQHA 1KR0A 3VOHA 2CNZA 2VIRA 2HISA 4FFZL 1US3A 3IDYC 4N6EA 4ZX5A 1FSKB 2Y7LA 1EJOL 5E5UB 3MCG1 1EHKB 3WHXA 3BD4A 4M3HA 4LPVA 3BCJA 3HJEA 1VHNA 1ZB5A 2IV9A 5KVEE 2R1NA 4PMZA 4HCLA 3FB8A 4A8IA 2H8PA 3MUHL 3LAFA 4MDRA 4NJKA 5C0BE 4GUOA 2QGCA 4F7MB 4LVOC 3GIZH 2OFJA 1PX4A 4AL8L 4WCJA 3FSTA 4HBCL 4PCKA 4YDVB 4Q8OA 3F8UB 5I1GH 3Q5OA 2XRAL 4PR5B 5K39A 3V16A 5GISL 1TEYA 1RFDL 1YJDC 3DVFA 4HPYH 3CH0A 3PAJA 3EWYA 5D7SL 3WYRA 4DP6X 5G1YA 4KKBC 5D38A 4JRYA 3RWFB 1LD9B 1MW0A 4DVBB 3ULUD 2PPGA 1O6SB 4ZVJA 2IWKA 1L3NA 2WVTA 3REWA 1ADDA 3BOLA 1CDBA 5AKSA 3LXCA 1W5MA 1PZ3A 4QG9A 3V6ZB 3M5XA 1A3LH 4MDIB 4UQ9A 4BWUA 3S88H 1EZSA 4Z7NF 4XBGB 3PWJA 3EHBD 4LEXL 3PNWA 1KFAH 4L4VB 1C08A 1W3HA 3VXUA 4YXHL 3VH8G 4A7GA 3MJ9A 4D6JA 4P04A 4NQTA 3U6XA 4BIKA 3U5YA 3QJXA 1EYWA 5I8OH 1P0SE 2EG8A 4AD2A 1EEYB 4H7VA 4X98A 3LKNA 2WO5A 1CBJA 5IKCB 5DMIL 5E6IA 3B83A 4R9XA 4HLJA 1Q9OA 4WFGD 3SZ6A 3CPLA 3GGWB 5IDZA 3LMYA 5CZVL 4WFHE 4BZ2L 1MRCL 4OF6A 3BH8B 4AIEA 3MRQB 3DXAE 1MELA 1H6TA 2HK1A 5HYJE 1KZQA 2GL5A 2IIJA 3UWYA 2W9DL 5FOOA 4GP8B 2DQEH 5LIYX 2ZOLA 4RESB 4LPXA 1XH3B 3WMBA 2YAOA 3EDDA 3RU8L 3MNZA 2BRQA 4HHLA 4C91A 4XX5A 4JHOA 3N19B 4CEUC 3QV7A 2YCIX 2J7LA 2OJZL 1IJ9A 2YD1A 4LB3A 2OYKA 4QNWA 5JHDA 3WD5H 1SJXA 3HCVA 1H19A 1ZSDB 4FLRA 2WAHA 5A40E 3D48R 3VACA 4D3CH 4HS8H 5DU7A 4WHBA 3BAEL 3UTSE 2FJFA 3A9BA 3FKKA 3BW3A 3GF8A 2GFTA 4GIOA 5C09B 1DL7H 1TE1A 4N87A 3C86A 3NXFA 5ICZA 3S8WA 1NMAL 2ABAA 4OGQC 4RR4A 3IB4A 4K7PX 1W16A 3IGXA 3T6XA 3RIFF 2L7UA 2ZYRA 2OO0A 2P28B 2D2HA 2MKWA 1SLUA 4UQEA 1DZ0A 5F2MA 1MDLA 3QGAC 4LEOA 4Q4EA 2J4WL 3CQIA 1DQQB 1OL0A 1EXUA 5CC6A 4MA8L 4ZQTA 1UUQA 3VAVA 3R1ZA 4DXKA 1FWEC 3VI4B 2XIJA 3QA3B 1NLDH 4NUJA 1FNAA 2UY2A 2WXOA 3UADA 2I60H 1P4LA 2F1EA 1BD2A 5BS0B 2EYSB 2DW5A 2WLHA 5T3ZH 3JVAA 4N26A 1CDJA 2XXGA 1SJHA 3ATBA 4PWIA 3DIDA 3BOVA 4DPPA 4HKPA 2ZYIA 3NEEA 1FBIH 2ZG1A 2H9AB 2RUSA 2A6JA 1UC5A 1QFWI 5E6IC 5AZ1A 2PYEE 1CCWB 1U92B 2N3JA 1FVEA 3S36H 3BLKA 4GY7A 1VBGA 1TTIA 5FWQA 1LWIA 1EP1A 4LGSB 3TMLA 4F7EB 2AQ1A 1SW3A 1Q8JA 3I7RA 4Q14A 4F15B 1SBSH 4PVBA 3LU2A 4TNVF 1TPUA 3AXLB 3V52L 4KK8D 3MJMA 4JHBA 4Q97A 2XWEA 4EDWH 1A1OA 3MODH 3O3AB 3B1UA 1YSOA 3AABA 5HHQA 1VFOA 1AQ8A 2VQ1A 5KANI 4LSDA 4O16A 3SO3B 3STZA 1U9KA 1W1VA 3HMJG 4UV7L 1HEZA 3HGRA 1AZVA 4IHOA 1J5SA 3VI3E 2FECI 5KMYA 1TPXB 3MLXL 2R4RL 3QXAA 4K3ZA 4TMCA 4O50A 1NCHA 2I7OA 1YPFA 4G7EB 1RZFH 1S9KC 2BP0B 3MRCB 1ROWA 5F96H 4FFYH 2NZLA 3S6CA 2CBUA 1BOYA 2BM3A 5CPTA 3CXDL 5DEGA 3VDHA 3KVDD 4N9OB 1HNGA 1MCHA 1QSFA 1OFBA 1XF3B 3LZ3A 2DLHA 3WBXA 3I2CL 4LO9A 2IDTA 2E7FA 2YS4A 2XWZA 4G6JL 3S3BB 5CLTA 4P8QA 4ZEPA 3VMOA 4CQ9A 3BP6B 1OTUC 2O5YL 1FNGA 3HBPA 3AQZA 2DIKA 1R9FA 4CSSA 3E38A 1JQVA 2A6DB 4HFUL 5ABZA 3USBA 3FYYA 2E47A 4FMFA 1QW7A 2O0TA 3WYZA 5IFJA 5AC4A 1AZRA 1ZJIA 4JIQA 3W38A 1BIIA 2BIQA 3OX8A 2HPOA 2VFEA 5C8JB 4HU3A 3ME0B 3H54A 5HWNA 3BZFA 4Q9RH 2Q7NA 2JGQA 1SW0A 4HNUA 3V5CA 5KW9L 2P24B 4ML9A 1T03L 5GISH 3WLKX 2OMWA 1ED3B 1OP5K 1V3LA 1TLKA 3KPRD 2J88L 4YSAA 5MEQA 4AK1A 4C58B 4ONVA 4LBUA 2MSPA 5D7SH 3TVMD 5EOTA 4YH6A 3QUZA 4KUCF 5FUZH 1RJQA 1KJ3H 1GYVA 2GSIB 3DGRA 3QWOA 2PWUA 2HV5A 1ET5A 2BHZA 2VB5A 4TQIA 5D2YA 3TFBA 3PJUA 1TQCB 4UQ3B 2YRZA 4L3ED 3M86A 5IG7A 2Y70A 2UY4A 3B7TA 4LQFH 4FCHA 5IHBA 4FC3E 4JPIA 4BCYA 2E6PA 3P9MB 4JFYB 5BPPA 4P5UA 4IEFB 4FEMA 5BZWA 4NUQA 1HG3A 3REVB 4PWJA 2A9NL 1H8NA 5BW6A 1Y6KR 2A1WH 1IXNA 1MUMA 5FIEA 4PJXB 3RX7A 4RMSA 2QPDB 3VA2C 2XSKA 3FDWA 1REQA 5KSBE 2OYLA 3ATEA 4ZTEA 2CLIA 1A6TB 4MYXA 5AVUB 1AGEB 1NCBL 1A5UA 4CQAA 2ZC1A 4GJIA 4YJZL 3RGBA 4D6EA 1MEHA 3GXFA 1NOFA 3ZE2F 2H6UA 4P4KD 1CI1A 4NNPH 5I1AB 3GX9A 4HUCA 4H5SB 1IL1A 1GYCA 3C2FA 1IEHA 4I3RH 3QV6A 5IREA 2B7DT 1ENUA 3MBXL 1K77A 1QR1B 4IBWA 1G9NL 1GZPA 5AHFA 2CBIA 4JFFD 1Q45A 2QJNA 1V02A 4TX8A 4NAMA 2P5EB 3ARBB 3O8XA 1E4HA 3BGAA 4XN9A 1OADA 4UQ2B 3LQAH 1OZUA 2AJVL 4HCRA 2B59B 1ICTA 3RPIA 4Q0XL 3UTZB 3NQFA 1QUMA 4XCNB 4V1DD 5FR3A 3D30A 4LL4A 4YAQB 3FQ4A 2WLIA 1EWDA 4P9ML 2QSVA 1A4JB 3Q8FA 4JM4L 4A2LA 4GFXA 3OGVA 1MUJB 4IQHA 3W7QA 4XZWA 5IVXB 5MKGA 4A8RA 2RTTA 1ZV9A 4IU2A 1CUOA 1ZIAA 3OF6A 3MU3A 4N2KA 4Y1AD 1DQVA 1YYAA 1DP0A 2ZX8A 3UIYA 1JPFB 5EU4B 2EE2A 1A1NB 1XYLA 1W54A 1BVNP 3ZKND 4HT1H 3UTOA 4ZUVA 3ZMEA 3B04A 2FB3A 3QCTL 4BEQA 3KDNA 3S1UA 1QNQA 4XBJA 4UAOB 4A2MA 1Q0EA 3QARA 1AZNA 2QDHA 3Q44A 2NY6C 4BXSV 3G0UA 3QUZC 2ZKHL 2C0AA 4AY7A 1QR4A 2PTYA 1CR9L 3L5HA 4PUDA 1TPVA 1S2EA 4FG4A 4NRRA 3TEXA 1NM4A 3II1A 3FSVA 3LA4A 2IADB 1WBXA 2H4EA 1KCWA 1T66C 4MNQE 2ESVE 1OGAA 3DBXA 5KTEL 2I9UA 2NY3B 1BP3B 2JJVA 3ITTA 3BKCL 3G22A 4F40A 4HEMA 4XNYL 5C0CB 1XD0A 4X99A 5F7EL 5GRZA 4U1SA 2E9IA 5HHXL 5J3HC 5AVHA 1YY8A 1MW3A 3L3DA 1ZVNA 3WUZA 4JTEA 2ACUA 2F74A 1ZT1B 1C5DA 2GBUA 2FBRA 1XAUA 3LKQA 2OCFD 3S37L 1PYMA 4CD4A 1NY1A 3WDPP 5C6MA 2DZPA 4LLQB 2D31A 3P3UA 4NAQA 3VUSA 2H1LM 4BD4A 1V7ML 1RQHA 3LRHA 3IT8D 4C47A 1FIGL 3G0XA 4ZS6D 3D3VE 1ZLEA 2Y0FA 2F54D 3ZKQD 4IJRA 5JQ6H 5C07E 1QUNA 3PZTA 4XK2A 1LGVA 4AB4A 3PG2A 3WDRA 3B7SA 4PTNA 4WWPA 4HH9A 1J8HA 1QQDB 3O8XC 3C3UA 3T3PE 4P0DA 2W63A 1U3ZA 5E1HB 1KZYA 1HI6A 1L6YA 4H88H 5EWIL 5JORA 3F5WA 1IE4A 4AQLA 4AIZA 3AS2A 2WNNA 4ODBD 5C9XA 2H7WA 3V6FA 3WXWL 5DZPA 4QDGA 5IESL 1TCRB 4PJAA 4ZTPL 1CT8B 1IVTA 3QF0A 4UR8A 2H45A 2R4RH 4X5WA 5BRPA 4C6PA 1O6IA 4H13C 2YXWA 4HLZH 3IWVA 3QUHA 3TYAA 3VRIB 1DIKA 1MJ8H 4DZHA 1NCUA 3CAVA 3HNVL 4TUOB 3VCRA 2PN5A 2X12A 5F0JB 3EGXB 2VKZG 1JFXA 2Y36L 1GVFA 3PQYE 3MLUH 3QRGH 2FAUA 4WI6A 2F53D 4KHTL 3PWLA 2MCMA 1FXQA 5ISZB 2FGWH 5ABEA 2CK2A 5FAAA 1A7PL 3AHTA 4IIHA 1J93A 4RAVB 2QNEA 1G9MC 5DGQA 5KN5B 1FQ0A 3MBFA 3WQ8A 1MCRA 1AMKA 2ALAA 2PDMA 2OYPA 1EFXD 1YPIA 4H20L 5IB5A 1KYFA 5H94A 4WTWA 3X13B 2QDGA 4F2FA 4X6BA 1B0GA 2X4UA 2IGFL 4JJ5A 1KEML 4KZCA 2RCSH 3F62A 2XCMC 4AHOA 2QJDA 3GTHA 4UT9L 1BLNA 4HHGA 3RUBL 5T1MA 2OZ8A 4A1RA 4L23A 5FYLH 4JPWH 3CUFA 1XF2B 3JV6B 4HUXA 1KCSL 3SPCA 3W23A 3WKML 4GO9A 5T1KA 4TU1A 3TH3T 4I9WD 5HI4C 4GVGA 3CAQA 3PTQA 4HIEA 3IIPA 5TE4L 1BZ7B 1XB3A 2I9TB 2K6ZA 2VEPA 3GKWL 4DFHA 1DIOA 1JVNA 2XG4B 3LS9A 3LN5A 3QJAA 1SOSA 3LNEA 3VXQA 3NURA 1P0NA 1YADA 2F6KA 4M61B 2F0CA 2GUYA 2CUAA 3CU2A 5HI3D 2PZNA 4F0HA 1M05A 2HLAA 4XMZA 3NJIA 4L9YA 4U10A 5T91A 5IF0B 3S5OA 3DRTB 3QT2A 4M5SA 1P4CA 4XSLA 4Z2LA 3CIAA 5F21B 3LRSA 3C8NA 2MEJB 4EZKA 3GVRA 3SD5A 1LO4L 3B7YA 3ABXA 4DM1A 1X5FA 1E50A 3LMJL 4A2DA 1LWJA 4PTWA 1YUKB 1K5NB 3W76A 2HVKB 5E03A 5REQA 4U1LB 1R87A 4WO4A 3A12A 1I7UA 5L2KE 2D03H 1HKLL 3K72A 1EQCA 3DERA 2V5YA 3ARFA 4FFWC 3OHIA 3BRFA 4YU1A 1QZNA 2B2XH 1A3HA 1E27A 2EACA 1ILUA 3L4ZA 2WWDA 2CBMA 5LUMA 3K6SA 2ISWA 4NGHL 3MBXH 4PJAF 4ZSOA 1HTYA 3UGUA 4BDVB 2VW6A 3MCYA 4PJFB 4XB3A 1ZY9A 1CFMA 4BH8A 3F7KA 3HBZA 3MV7B 3ULUH 3C5ZD 2E3VA 4D9RD 5INCB 1WBYA 3QOMA 3Q2LA 1G7IA 4GXVH 4YIQB 3W2DL 3GXUB 4Q0XH 2PDCA 3VG0L 1SM3L 1BQHB 2KQNA 2IBBA 3EOSA 1JZ8A 5D70L 1EDYA 3MLRH 4JM4H 3DJTA 4XTRD 1J5OH 2GITA 1SBBA 3WL9B 2XWBA 5T9CE 1TWIA 1TZ8A 1D6VH 2YXVA 3GBML 1WFNA 1DJNA 3ES8A 2XT1B 3QCVH 3UZ5A 5AVQB 4ZYKA 1AZBA 5GGQH 3GQYA 5CWSB 4TNEA 4FXGA 3A4XA 2EE9A 2O5ZL 2ZUSA 4HJGA 4M03A 1KV7A 3CWNA 5IK3B 2LAGB 4BGDA 5MEOA 2CXGA 4H8UA 1J6OA 3U7AA 3S42A 3L3HB 1BRLB 4NX5A 3O45A 1YN7A 2WZTA 4Q6IA 3N04A 2L7JA 2V69A 3G0SA 4N22A 5C0EA 1BG1A 4WVRA 4A2FA 3IDGA 5KVFE 3U6WA 3G3DA 4JRXD 1HYRC 3FN9A 1TTCA 5DT7A 4IU3A 1O7VA 2IQ0A 3H7VA 3PZGA 2O6CA 4PRDB 2IPUG 1NIBA 3MCNA 3FJNA 1H0GA 2Y2TA 5GZNA 5CFHA 3E1F1 2FZBA 4AFYA 4WO4C 4IX2A 3SGDH 1R33A 4U1KB 4U6XB 2HKAA 1GTFA 3N1PC 2AKMA 3ARFC 4LLDA 3ORJA 1Z41A 1K8YA 1WZKA 1B0RA 4KMQA 5AW9B 3RX4A 4U7SA 2NXIA 2DTML 2VGFA 1F73A 4N0RA 2C9XA 2LAAA 4KEMA 3VFRA 3LS5L 4ZFFB 3MV8B 4ZXBB 1Z9SB 3BL3A 3ITOA 1YBQA 1B88A 1W3NA 3MKCA 1TVBB 2W81C 4D8ZA 5TPWL 1L4IA 1LQBC 4I0PD 5DK0A 5HJ3A 5SWSB 4I0KA 2XZCL 4M56A 3QQ1A 2BWIA 4LS1A 3K4ZA 1N19A 1ZS8A 5C08E 4EMZA 1ZP3A 1UUNA 3KZ8A 1CVRA 3UVAA