3BLPX

Role of aromatic residues in human salivary alpha-amylase
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
496
structure length
496
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRARQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-function relationships in human salivary alpha-amylase: role of aromatic residues in a secondary binding site
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-amylase 1
total genus 176
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00128 Alpha-amylase Alpha amylase, catalytic domain
X PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3blpX02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3blpX01
4PMDA 4NZFA 3VPLA 4B16A 1UR4A 2CBIA 3DX2A 1XD0A 1E1FA 2YJQA 2VT0A 4TUFA 3SCTA 3AHYA 3PTQA 4B15A 4WK9A 3WDHA 2A3BA 3WKZA 4D1JA 3EMQA 3VX1A 2EJ1A 5EFDA 2XVLA 3L4YA 1E70M 4W5ZA 4NZCA 2J7CA 3UR8A 4R5EA 4DWSC 3ARZA 4HOWA 4ATDA 4AZCA 4C7GA 1MXDA 4HOZA 3BSGA 3SCOA 1E6ZA 4HU0A 2O9TA 1UD6A 3ARRA 3BLKA 3OLEA 4DWSD 2EACA 2WHLA 1ZU8A 2WMHA 1W2PA 5E9AA 4HA1A 4M1RA 3WD4A 1UQYA 1MVYA 3WF0A 3KLKA 3IJ9A 1V3LA 4H8VA 3HG2A 1B3YA 2F1BA 3LPGA 4AXNA 4AMXA 3CHDA 2CHNA 5HNNA 2E4TA 3KE0A 4KRUA 1T0OA 3VGDA 1WZLA 3MSDA 1JZ2A 5I24A 1QI2A 3K8LA 4PCSA 5KEZA 1HXKA 1EOKA 3SEPA 1CGVA 4OUEA 2PI6A 2CKRA 2V3GA 1UOKA 5FL1A 5FKYA 3VMPA 1BVNP 4U2ZA 2VVNA 4ZE4A 4JKLA 2FYVA 3ZIZA 3PZVA 4CD5A 1PS3A 4HPHA 3WQ5A 2DEPA 2VCBA 3AICA 2YLAA 3QR3A 3UETA 2WC4A 2DDXA 3VM5A 3WQWA 5E6YA 3N13A 3MUZ1 2WLYA 1QPKA 4D6HA 4GI6A 1E6PA 4UFMA 3AZRA 1XYZA 4AD4A 5M5DA 2JEPA 2ZWZA 3DDGA 3N15A 1M04A 1QI4A 4TTUA 1Q6DA 1G01A 1UWIA 3TA9A 3DHUA 1UUQA 1CWYA 5CQ1A 3BC9A 2DIEA 4W5UA 1HF6A 1JZ3A 4W8AA 3GXPA 4MAVA 1BYCA 2PB1A 5CPQA 8A3HA 3D52A 1MXGA 3A4WA 2Z1KA 2X09A 4OBSA 4CUCA 3ARWA 2VRJA 2PBOA 1UASA 3BAJA 1GUVA 3RPMA 5A2BA 3ARUA 1OT1A 1QNOA 1NM9A 3ZJ6A 1D2KA 3GH4A 3WF3A 2X2HA 4PUDA 3TTQA 3T2PA 3RM4A 2EQDA 3CUFA 2CXGA 3AHZA 2F18A 4TVUA 1NQ6A 3VDCA 1HX0A 1HJXA 1ZL1A 2VURA 1E73M 6CGTA 3DC0A 3S5ZA 3AIQA 4DUWA 4NI3A 2O9RA 3A22A 4W89A 4K68A 3I3BA 1WP6A 4C7FA 3BVUA 4CVWA 1H09A 5ABFB 4IUGA 1UA3A 3VGFA 4AYGA 2WMFA 3WQ6A 3A21A 4UOZA 5F7UA 1V08A 4UNIA 3RJYA 1GW1A 2OWCA 3UERA 4GPNA 3F5LA 7TAAA 4X0VA 1IV8A 2WNWA 1ZJAA 3WEOA 3EJPA 1HKJA 3GXIA 2GJXB 1Q4NX 2WSPA 3QGVA 2XSBA 1AQ0A 1BG4A 1HJVA 2WZHA 5TD4A 3HN3A 1B30A 1H11A 1OM0A 5CZKA 1X1NA 3AMCA 4KGJA 4GIAA 2V5DA 4WKHA 4FNSA 3W26A 3GXMA 3WEZA 3CTTA 3VSUA 3WMBA 3BAIA 1G9HA 5CPTA 1MQRA 2F8QA 5JBDA 2OW7A 1TVPA 3BVXA 4M82A 2DT1A 5AYBA 2C8NA 4UTFA 3AROA 1DWGM 5LA1A 3WDJA 3ZR5A 3PZUA 2QPUA 3VILA 4A3HA 1JD9A 3BAWA 2YOCA 1WKYA 2J8FA 3L4VA 5M3WA 2VI0A 1UH4A 3W53A 2E9BA 3SIMA 3FHQA 4HMDA 3LX9A 1D7FA 3D4YA 2J79A 5A8PA 1OBAA 2VZTA 1UYQA 3F5JA 3CGTA 3HZ3A 2BY0A 2YL6A 3VNZA 4P8WA 3GH5A 4U5IA 2J62A 1KFWA 3SCRA 5D9OA 1WNOA 2EABA 1GPFA 1CXFA 3L4TA 2W66A 4HZ7A 1KXHA 3OGRA 2QPSA 4M80A 4UQ9A 4HMEA 3WMSA 4UQBA 2W92A 1CBGA 1PX3A 1LL4A 4JKKA 4H8UA 4PSRA 5I78A 3WDQA 1WDPA 2VZVA 3PTMA 1XC6A 4EK7A 1ZBKA 3SCVA 4FLSA 1QHPA 3SCSA 1ITXA 3VIJA 1C8YA 4P8UA 2GJRA 5A2CA 3BVWA 1W9XA 1UKPA 4LYQA 2EPKX 2WWCA 1HL8A 3VTRA 8CGTA 2BY1A 1G0CA 1UKQA 4PMZA 4U3AA 1JXKA 4JFWA 1EOMA 4FNRA 4PMRA 1JIBA 2GDUA 1B2YA 3S5YA 1UZ4A 5ABEA 3K46A 4MJ2A 3BUIA 2W5FA 4CU8A 1C7SA 4X9YA 4WIWA 3ZT7A 4JKMA 1QI5A 4QLJA 4URIA 4CD7A 2ZWYA 1HP4A 3CZKA 3PTKA 3FNDA 1NWRA 4P7NA 5DO8A 4D71A 2OW6A 2OWWA 2B31A 3NSMA 5HDRA 2CBUA 1ESWA 4UFLA 3BGAA 1KBBA 2GUYA 3L4ZA 3WNNA 3UG3A 1W91A 2PBGA 5A69A 3AS3A 3UCQA 2D22A 1HJUA 4H04A 1E55A 1H0IA 2XUCA 4D6FA 4N0RA 5A3HA 3L4XA 3CMJA 2WPGA 3WH5A 4AY1A 2VR5A 2WSKA 5ABHA 4W8BA 2ZXBA 3O9NA 2OSWA 4AWEA 3UEQA 2VQUA 2D23A 2BXYA 4FF5A 5BXTA 2CIPA 1C92A 3LPOA 1RH9A 1M01A 1VEPA 1BYBA 2J7EA 1US2A 3NSXA 3DX1A 2GK1A 4QCEA 2WMIA 4J3VA 1KXQA 4XB3A 3CBWA 2PWGA 5IFPA 4AEEA 2D73A 3WD2A 4MJ4A 4CD4A 1UR9A 3SUTA 1FH9A 1Z32X 2FHFA 4GI9A 3RDKA 2E40A 1WB0A 3O2LA 4GO9A 4LGXA 2E8YA 1HTYA 2EPMX 2CPUA 1HKKA 4ATLA 2X2YA 2WMKA 2XVGA 1E4LA 3WIJA 2XFRA 3MUY1 1BSIA 4BQ4A 1VENA 2DSVA 2J78A 5LYRA 2C0HA 2EPNA 2WVSA 5AYIA 3LRLA 4HPGA 5EFFA 4MAZA 4J3WA 2VNCA 1UKSA 2EXOA 1TUXA 3OB8A 2PWFA 5BXRA 2DSZA 2ZUUA 2ZUMA 4TXEA 3SCPA 1JDDA 2XIIA 1J18A 3II1A 2ZX5A 3PZMA 1GHRA 1BPLB 1EDGA 3A47A 3DECA 2F61A 3WY4A 1UWSA 3M46A 4M56A 4F9JA 2XPKA 1CGYA 4B9ZA 5CJ5A 3IGUA 1DWAM 3IK2A 1JYNA 1V3MA 3RO8A 3W6LA 4MADA 2OYMA 1V6XA 1CZ1A 2CCRA 4GI8A 3ZJ7A 1O6IA 4ACZB 4N42A 2C7FA 1XSJA 4PMUA 3WDPP 2YA2A 4UFHA 3VKKA 4OGZA 5GPRA 4WF7A 3B9EA 3IJ8A 3S2CA 3WH9A 3PZIA 2ZUNA 2XWEA 4OIFA 4NRRA 4PTMA 5E09A 4CD8A 2V3FA 3VIGA 3WH7A 2EADA 4F9DA 4QCFA 1E6XM 4FK9A 3AIEA 4UFJA 4BS0A 2W91A 4AZ6A 1KWGA 4BA0A 3ZM8A 1I1XA 4F66A 1JL8A 4WLCA 3WN6A 1GQLA 1JZ5A 3D50A 3TTSA 3CZLA 3A4AA 4FLQA 4BQ3A 4D6CA 1E72M 2YL9A 3ZSSA 1GJWA 2FDMA 3KLLA 4TX8A 1I75A 3A23A 5E70A 4UFIA 4Z2GA 4J27A 1O7AA 3CZ8A 2GJXA 1TQVA 4AZ7A 1AQMA 3WQVA 2YKKA 2UY2A 4DUVA 2QV4A 4OJYA 2DIJA 2MANA 2XM2A 3VUPA 1DWFM 1QNQA 1XV8A 1LL7A 3GBEA 1IZKA 4MNKA 1HJQA 3UG5A 3EDJA 4GZIA 3CPUA 1PPIA 2Y24A 1B1YA 3ZR6A 1PX4A 3LPFA 3WDRA 3VIHA 2WAGA 1AVAA 2E9LA 4KWUA 3NSNA 5CG0A 1QBAA 3CHCA 1OGGA 2VO5A 4W8LA 1LF1A 3DYPA 2YIHA 4OOZA 1E40A 3LPPA 1JGIA 1UKTA 2JE8A 3CZSA 1BHGA 4H41A 4GQQA 1J0HA 1NOUA 3S6TA 3RIKA 5E6ZA 4HA3A 5IXEA 1H1NA 3T08A 2DSKA 1JI2A 4HU8A 2VL4A 4MDOA 3OGSA 4MDPA 2YBTA 4JIEA 5I6SA 2Z1SA 2XWDA 3ZQ9A 3H53A 1QI0A 4GINA 3D3AA 2ZICA 3EDDA 3A6OA 1LLOA 2W67A 2XVPA 2CYGA 1V6YA 3PZGA 3VGGA 1TZ7A 2ESCA 1UH2A 3SCQA 4D6GA 4DO4A 4OBRA 2ZUVA 4ACYA 3W37A 4YN5A 1CLXA 3MUAA 1ODUA 4WKAA 3FN9A 3A4XA 2WKLA 1R34A 1D3CA 4NF7A 4W93A 4JL1A 1X6LA 2FGLA 3AIVA 2VTFA 1JG9A 3MKKA 3HG4A 2NSXA 4DUXA 1XH1A 2WWDA 2PWEA 5BXPA 3RMEA 3FAWA 5BRPA 1BQCA 4P7QA 4AD3A 2XGBA 1B90A 3DDFA 1W3LA 1K9FA 3IAPA 4AD5A 3POCA 2A3EA 3AXXA 3RJXA 1QI3A 3AHTA 4HZ8A 1UQZA 1BGGA 3BUBA 2G41A 3CH9A 4CN1A 2XVNA 1M03A 3CHEA 3BCDA 4AD2A 2ALWA 4WJXA 1B0IA 5CXPA 5D4YA 1UD2A 1F4HA 4E8DA 3N04A 4PMNA 3W24A 3JUGA 4P7RA 3QOKA 3CZJA 4PEEA 3WF4A 1BF2A 2WXDM 2G3JA 5A2AA 3AHXA 1I1WA 5JBFA 3OBAA 3EMZA 1GJUA 2WKGA 2A3HA 1LL6A 3AMLA 3GXTA 4D6DA 2VMFA 2BVYA 3D5HA 1PIGA 1XH0A 2YDRA 5D8WA 3AXIA 2UY5A 3SURA 1TVNA 2F7OA 1K9TA 4JAWA 1ZBWA 1RP9A 4IM4A 3FXYA 1HKMA 4W85A 3W38A 4MB4A 3WL0A 1ZJBA 1ZBVA 3RM8A 1CNVA 5CGMA 3AS1A 1W32A 1N82A 2FH8A 4J3SA 4AZIA 1GVYA 1R87A 2CBVA 4PMYA 1H41A 4BCEA 2D2OA 4FLOA 1WPCA 5EMYA 2VZOA 3EJQA 3VIPA 1QW9A 2ZX7A 1GVIA 2XHYA 5JIPA 5I0DA 4NX0A 3L4WA 1J9YA 4W7VA 1VB9A 3LRMA 5KZ6A 3CV5A 3DYMA 1PZ2A 3VOCA 1YQ2A 1J0IA 1U33A 3CUHA 3VGEA 3AHVA 2ZX8A 2VJXA 1E5JA 4CCCA 1A47A 1KBKA 4E4PA 3L2MA 1R86A 3U57A 1CXIA 1XSKA 3UESA 3WD0A 3W82A 4JFUA 1JYVA 3SUVA 1HNYA 4UQAA 2F1AA 2ZXAA 2TAAA 3CUJA 5A6KA 1YHTA 4OOUA 2XN2A 5BCAA 4JCLA 1UKOA 3PZQA 3RILA 3HU7A 1JNDA 1K9DA 4B3KA 1CYGA 3AS2A 2WB5A 2IGTA 1E4IA 3T09A 3ZOAA 1TE1A 3VD3A 2A3CA 3CUGA 3I3DA 2WCGA 1ISYA 2ZX6A 1KXVA 2XG9A 4ATWA 4MNLA 4JZ5A 2DQXA 1LWJA 2J25A 3CMGA 3RM9A 4AIOA 2VCAA 1VFUA 3EJTA 2J77A 3VSVA 3WNKA 3MUIA 4Z2JA 4H8HA 1DWJM 3BLPX 1DTUA 4U5KA 5M17A 3WF1A 3VNYA 2FGZA 2EAEA 1V6UA 1U2YA 2X2IA 2WMGA 4HTYA 2PWDA 1XD1A 1OD0A 4Y7EA 3WY3A 4QLLA 5HBFA 3W81A 1NP0A 1JYWA 5C71A 2VX7A 3PZOA 2GSJA 5CPSA 2YLLA 1OIMA 4AMCA 4TVDA 3K8MA 1CGXA 1WZMA 2NT1A 1JF5A 2W62A 3GNPA 1KCLA 4J3XA 3OLGA 1J11A 2EEXA 3BUPA 4P7OA 1EO5A 1ISXA 2XJ7A 1RD6A 4ZFMA 3SCUA 3MU7A 4UQEA 1UD5A 3A5VA 5A8MA 4PTXA 5E0CA 2WBGA 7CGTA 3ZT5A 2J7BA 1E3XA 4S3JA 3AI0A 5A6SA 4DO5A 1GCYA 1CGUA 4L4OA 1PAMA 1E6QM 3MS8A 4YHGA 4NSBA 4YHEA 1W9BM 2YFNA 1V3HA 1HIZA 3VVGA 2QHAA 5IHRA 1FH7A 1Q6CA 3W6MA 5JIWA 1R85A 1UWQA 2XYLA 1BLIA 3WSUA 3AYSA 5I23A 3MSGA 5AC5A 1FP8A 2CEQA 4ML4A 3EJRA 4D6JA 1B3ZA 3WUEA 3N17A 2WYSA 3MMDA 4AZ5A 1Q6GA 2O92A 1UD3A 1V3KA 2ZUSA 1J0JA 4D6EA 4P8VA 3EDEA 1CEOA 3U5YA 1E43A 4GO8A 3W0KA 1KR1A 1Y7VA 4ZENA 1CECA 1JDCA 1OB0A 3FAXA 5LA0A 4OZOA 3ALFA 3FW6A 1VAHA 3TV8A 1W2VA 3CHFA 1CXKA 3GYCA 5A95A 1LG2A 4RL3A 3SCNA 1C8XA 1VBRA 5DF0A 6A3HA 4AD0A 1HP5A 3VDBA 2WHMA 5GNZA 3AZSA 3QHMA 4NRSA 1W1YA 2Y8KA 5GNYA 2A3AA 3VMOA 1KQZA 3HMCA 3L2LA 2WHJA 1O7DC 3OIHA 3FHAA 2BXZA 3OLDA 1W1TA 4YPJA 2Y5EA 5A6MA 4FNQA 1XYFA 2E0PA 3MI6A 1A3HA 1QWNA 3VSTA 4MNJA 3VIFA 2UY3A 1WO2A 2F7RA 1WCGA 3WY1A 2RGLA 2BFGA 2V38A 2BHZA 4UR9A 1QNRA 1KTCA 1OCQA 3LXBA 1C91A 4RE3A 3B8SA 2GFTA 1GHSA 3ARPA 2WHKA 1EH9A 1JZ4A 1R33A 4CD6A 4AIEA 3GNRA 1C90A 1VFOA 3ARYA 3TP4A 1ISVA 3MANA 3T0DA 3H54A 4PUEA 3VIOA 4TTGA 1NWSA 3WD3A 3WNLA 1HKIA 2BVDA 3BH4A 1PBGA 1QX1A 3AQUA 1BAGA 4Q22A 2WZIA 3WH8A 1S46A 4AC1X 4AMWA 1E6RA 1JFXA 4FMVA 1M53A 2DT0A 2IXVA 2WVUA 2ZIDA 5D8ZA 1V0LA 3PZTA 3GDBA 3VD4A 3QHNA 2XGIA 4PMVA 5AC4A 3LRKA 1CENA 1QVBA 1KR0A 1U30A 3VU2A 2VRKA 1LWHA 3GH7A 4J3UA 4JHZA 4LPCA 4JCMA 1OD8A 4MB1A 3NJ3A 1UG6A 4AZGA 1W9DM 3EBVA 3WUGA 3EDFA 3CO4A 4PBGA 5DMYA 1GOIA 5C8BB 3AIBA 1FHDA 1ECEA 2ZXQA 1V03A 2ZOXA 1QHZA 3BAXA 1HJWA 2XFFA 1JAEA 1MQQA 3KL0A 5JBEA 4EAMA 2JF7A 1NOFA 1XCWA 2CERA 2ZXDA 3ARSA 1EGZA 3BXWA 2X0HA 1V02E 1MW2A 1V3JA 1BFNA 5DT7A 5CSYA 2E8ZA 2YL8A 3WQ4A 3UG4A 2V5CA 3PHAA 4W7WA 4RE4A 1IZJA 4U33A 1NWUA 3IANA 3GXNA 1GOQA 1KGXA 1E9LA 1E5NA 4GZEA 1B3XA 4MB5A 1KCKA 1MW0A 3THDA 2JF6A 3BVTA 5LA2A 3ZJKA 5A8OA 1VJZA 4F8XA 1OGSA 2D24A 2BHYA 3N12A 3LXAA 1W9VA 1Q6FA 4J28A 1TQTA 1V0KA 5I77A 4GKLA 1E71M 4LYPA 5HXMA 2G8ZA 2D3NA 2VZUA 1E4MM 2VX4A 1JFHA 4FLRA 4HP5A 4A4AA 1H5VA 4LXFA 2WANA 3K8KA 3J7HA 4D6IA 1E0WA 1WZKA 3OZPA 2D0GA 3D51A 2CBJA 1GQIA 2J74A 2QMKA 1GORA 1DHKA 1QWUA 5C70A 4CU6A 2BS9A 1FFRA 4PN2A 1WZAA 2VZSA 2Q8XA 2QF8A 2XFYA 2BY3A 3KL5A 1SMAA 4Z2IA 3KEHA 5BWFA 2VR4A 4JFSA 2OLHA 1CDGA 4P8XA 4M29A 1EO7A 1NH6A 4ZXOA 3AZTA 1R8LA 3GZAA 2QLYA 4CU7A 1PIFA 4JFVA 4XX6A 3HG5A 1LQ0A 3WFZA 4V2XA 5A6AA 1UR8A 3NYDA 4PTVA 2VX6A 2DSWA 5GQBA 3N11A 1BGAA 3N18A 4HA4A 1IT0A 2AMGA 1E3ZA 2CNCA 3T2OA 4AYSA 2XTKA 1QNSA 1C7TA 1K6AA 2QMJA 1QNPA 1E1EA 5EB8A 1EDTA 3AOFA 3WNPA 1UA7A 1NARA 4RE2A 2OSXA 3VGBA 2J8GA 4MB3A 2G4FA 5ABGA 3DHPA 3ARQA 4IPNB 5FD0A 1B3WA 3OG2A 1MFVA 3D4ZA 2WVTA 3W27A 3BSHA 5HPOA 3WNOA 4S3KA 5CSUA 1K9EA 2X8RA 3BAYA 3AIRA 4CN6A 1JZ6A 4UFKA 3B9AA 1BG9A 1V3IA 4PYSA 3M6DA 2IUZA 3VIMA 1FH8A 2BY2A 1JDAA 4AEFA 3THCA 2G3NA 4W84A 2X05A 1J0YA 1AMYA 2XVKA 3BVVA 4PSPA 1JD7A 1DWIM 5JUVA 3FY1A 3T2QA 2YDSA 3F4VA 1XRVA 4R27A 5I5RA 3VINA 1GNXA 4KRTA 4UQDA 2PF0A 2GVYA 3OGVA 2HISA 1WE5A 4Z2LA 5A6BD 1H4PA 1P6WA 1KB3A 4UCFA 5CLTA 3VIKA 3EJSA 3AFBA 4KMQA 1VBUA 1UHVA 4Z2KA 5FCZA 1GQJA 4CKQA 4PMQA 1PJ9A 5D9NA 1W9UA 1TR1A 2WK2A 3I3EA 2J7FA 4KH2A 2YBUA 3A24A 2F7PA 3AYRA 3UR7A 4JFTA 5HPCA 1H0GA 5BXSA 4QLKA 1HN1A 3AMGA 2WVVB 5ECUA 2XN0A 2VCCA 2AOSA 3EJUA 5IDIA 2J7GA 1R7AA 4DWSA 5D9MA 1JZ7A 2UWFA 1TMQA 4ZEPA 1QHOA 3ZJ8A 3WMCA 4P7LA 2WC3A 5E0FA 3GBDA 5BRQA 3TTOA 3WFLA 1X6NA 2WMIB 1NWTA 2WMJA 4WKFA 1J0ZA 3N9KA 2VC9A 1JI1A 1TA3A 3U7VA 2JFEX 3GTNA 4FNPA 1VFFA 2JEQA 3CUIA 3E1F1 3W25A 1OT2A 1UD4A 2DH3A 3ZO9A 1KQYA 4U3CA 1RPKA 1KXTA 1R47A 2W63A 3CC1A 1HXJA 2ZUWA 1V02A 3SUWA 4UQCA 2PWHA 2G3IA 2BVTA 1GZJA 1G94A 4AW7A 2XIBA 3B9DA 3CIVA 1W3KA 1WDRA 3K4DA 4BQ5A 4MTVA 1CGTA 4B3LA 2D0HA 3G6MA 1XH2A 1TFVA 3NDYA 1SYTA 3WBAA 3ECQA 2WM0A 1SFSA 4TOQA 4AISA 4PRWA 1ZS2A 1DWHM 3VIIA 4UOJA 1ZBCA 3BUDA 4Z2HA 4PTWA 4W86A 1BYAA 2J47A 3GXDA 5HOSA 2RGMA 3CLWA 2JIWA 1KGUA 3NCOA 4WSKA 5EBAA 1CGWA 3OA5A 1EQPA 2WCAA 4EE9A 4M81A 2OWXA 3IJ7A 1L0PA 2E9MA 2YDQA 2WLZA 1JAKA 2YA1A 1HVQA 1V6VA 2WBKA 4L4PA 1V0NA 1VEOA 5IHSA 1PX8A 4ZE5A 5BROA 5A8NA 1TCMA 3VDAA 1CXLA 3H55A 1UR2A 2DGAA 4LQ1A 4NXSA 1C93A 3VD9A 4CVUA 5D9PA 3AMDA 6TAAA 4TX6A 1OGBA 4W88A 2WW5A 1TQWA 2VX5A 1MQPA 2O9OA 1KTBA 1SZNA 1UR1A 2UY4A 4CGTA 1BYDA 2CETA 2VQTA 4M8UA 1TQSA 3NUKA 2WVVA 4W7UA 4UZSA 1SR0A 1B31A 2EPOA 3DYOA 2D20A 3CZEA 1F4AA 4WSJA 1VEMA 1R46A 3BCFA 2ZE0A 2X2JA 2VUYA 4HZ6A 4JL2A 1J0KA 4AZBA 4AZHA 5A1AA 4XV0A 3U5UA 4DWSB 4MNMA 2JIEA 5DT5A 1RP8A 3TTYA 3WUFA 3OLIA 3A3HA 3K1DA 4QAWA 4JHOA 3WELA 5AY7A 3WBEA 4J7RA 1E56A 4UZUA 3MO4A 1W1VA 3WD1A 2AAAA 1KWKA 4ZXLA 3W4RA 1EA9C 4KGLA 3ALGA 1EIBA 2CHOA 1PEZA 2BV9A 4V28A 3EMCA 1XHGA 2HVMA 1CPUA 1VFMA 1OIFA 1DEDA 5I3DA 2CESA 4QP0A 2W61A 2W4XA 3NDZA 5A94A 2J7DA 1E4NA 5I2UA 1CLVA 1C8QA 2GK1B 3G6LA 1QBBA 3SCWA 4HOXA 3AMKA 2NW0A 1FP9A 2O9PA 3MMWA 1V6WA 1OINA 1PZ3A 3L4UA 3ARXA 5A6BA 3LXCA 5DFAA 1QOXA 1FHLA 1E6NA 2WZEA 2FHCA 1W9PA 3F5KA 2F2HA 1GONA 2FHBA 3TONA 1UWTA 1NP2A 3CZNA 4FNTA 1H49A 2DT3A 1GOKA 3RCNA 1EHAA 2YL5A 2Y8VA 1E0VA 4HMCA 4EANA 4V27A 1HVXA 3AS0A 4J3TA 2PC8A 1J01A 3NIYA 1CXHA 1XCXA 2J75A 1NOWA 4LX4A 5FL0A 2V3DA 1M7XA 4X0NA 2D0FA 2OYLA 2V3EA 3PBGA 1WDSA 1E15A 3APGA 3VD5A 1HL9A 3AIWA 3T0BA 3BLBA 2YFOA 3AISA 2OYKA 4QDMA 3WNMA 4FNUA 2JALA 3POHA 3CZGA 1C3FA 1EQCA 4QFUA 2GDVA 5FOOA 1CXEA 2FH6A 3K4AA 1ISWA 1W3HA 1TQUA 5GNXA 3WQ8A 3EYPA 3DX3A 2CKSA 5FIPA 3MV11 3VDHA 3AXHA 3ZSTA 3VD7A 2D3LA 1B9ZA 3MV01 2EPLX 4IISA 1UH3A 5I79A 2GJPA 1WAWA 1UD8A 2J4GA 3HG3A 3WF2A 3ARVA 4PMXA 1GOOA 4AIUA 2Y2WA 1BVZA 1BTCA 3BMWA 4PCTA 4GZJA 1HJSA 4XZBA 5A6JA 1ODZA 2F7QA 3QOMA 1FA2A 1MFUA 1VF8A 2DT2A 1TG7A 4W87A 1V0MA 3IAQA 1MW3A 4U2YA 3WY2A 1LG1A 5DEZA 2DPEA 1ZB5A 1EHNA 5CLWA 3O6AA 1VJSA 1MYRA 9CGTA 4OKDA 1JYXA 3VMNA 3SUSA 7A3HA 1OWQA 3M7SA 3EDKA 4LYRA 1MW1A 4F79A 2X0YA 3QHOA 4TVCA 2XSAA 1XGZA 2ZUTA 3WENA 4GXPA 3KZSA 1R7OA 4PMOA 1KGWA 1JZ8A 3TOPA 3AIUA 1FOBA 4MPKA 4UOQA 3ARTA 2D1ZA 2OSYA 4C7DA 4ACZA 3PZ9A 1GQKA 2G3MA 3PN8A 3U7BA 2VRQA 1AQHA 2EO7A 1WDQA 1HT6A 3HJEA 1FFQA 3WUBA 3SUUA 3BAKA 4GQRA 2X1IA 4M24A 5CGTA 3T0AA 4U31A 3GNOA 3AJ7A 4D1IA 1MWOA 1ISZA 1GOMA 1JNEA 1H3GA 4IPLA 1VIWA 1E6SM 4E2OA 4CN4A 3M07A 1VRXA 4DO6A 4NXKA 4DM1A 1DP0A 4CCDA 1J12A 1W1PA 3DX0A 2CITA 4AZCB 2ZX9A 1JXJA 2BNJA 2DH2A 1J10A 3VGHA 3MMUA 1G5AA 3N1AA 1UR0A 1L8NA 4BQ2A 4XUYA 1EXPA 4B9YA 3ZT6A 3BMVA 4Q7NA 1G1YA 3VM7A 2Y4SA 3W29A 1QW8A 4AD1A 4DM2A 2WC7A 1E0XA 3WEMA 4EKJA 5M03A 2BHUA 2DSUA 4BF7A 5IFTA 1UZ1A 3OZOA 3WDIA 1EDQA 2VVSA 1JF6A 3DX4A 1UWRA 1HWWA 4H2CA 3PZNA 4XZWA 3WL1A 2XN1A 1TA3B 3ZMRA 2NT0A 4BZYA 1H2JA 3WH6A 5A8QA 3VX0A 1XSIA 1LJYA 1ITCA 2J7HA 4CCEA 1OSEA 1B3VA 1UWUA 2E3ZA 2IXUA 2YA0A 3GM8A 1R75A 4H7VA 1CTNA 1US3A 1GOWA 2EBNA 5BYWA 3BUQA 1CIUA 1SMDA 5ABFA 5A6LA 2FE0A 2XM1A 1W3JA 5E1QA 4A3YA 3GXFA 1Q6EA 4D72A 2WCSA 3LMYA 4E8CA 2VOTA 4NZJA 3VO0A 3W28A 3KL3A 3KWXA
chains in the Genus database with same CATH superfamily
4NZFA 1TLMA 1UJQA 3NFPA 4RA0C 4KEZA 4B16A 2HTLC 5GZOC 4L37B 4UTKA 4O02A 1E1FA 4XCYB 4TLSA 2YJQA 3WFCL 2H41A 1XKJA 4TUFA 4RFOH 3UPRA 2D69A 4KJQD 4LDEB 5I18L 1H60A 1PZ0A 5JHLH 5F9WC 1DQML 3TIDB 4M1GH 4C56E 1KENH 3EWXA 2A9NH 1E70M 4H5SA 3IT8D 5FCUH 2YXGA 4RDQF 1RALA 5CSZA 2QZ5A 4AGOA 1JHLL 4Y1AB 1EXHA 3QFJA 3ARZA 5F8QC 3OHMB 3KBHE 4HOZA 1AQFA 1ETZA 3TEXA 1ML0A 4HU0A 3SCOA 1EJUC 2O9TA 1T04B 2IXQB 1ASQA 4PJ5D 1NJJA 4JQXA 4DWSD 3NRPA 4GRLB 4WK4B 1E51A 4MOZA 2EACA 1E5AA 1HSBA 3B2UC 2QADD 4PGJA 2WHLA 2F53D 2Z00A 1ZU8A 4YCPA 2WMHA 1TPVA 3VJ6B 1FYTD 1F3JB 1HZHL 2PRMA 1HINL 5IHZA 2IS7A 3DI0A 2DWYA 3T3PF 1HYRC 1BOYA 4TNFA 4ETQB 1UQYA 4OECA 3WF0A 2WO3B 3KLKA 4N8CH 4HYWA 2NNAA 3HG2A 1S7VB 4H8VA 3VXNA 2C5DC 3LPGA 2FLBT 5TQ0H 4D9PA 4E38A 2CHNA 2ISWA 3ZHDA 3BWWA 1TF4A 1XP3A 1XMWA 4U1NA 3QWOB 4FEMA 1T0OA 2MPVA 4A2GA 4CBPA 2C7UA 4AW4A 1TO3A 2VDKL 3B7SA 4D94A 1WZLA 3MSDA 3DBXB 2KZ1B 3QXDB 4LHUA 1DSWA 1AE6H 5EOCL 1E50A 5A7BA 5I24A 3IVKA 4OFCA 4RLIA 3CMOL 3W7GA 4I5BA 1FBAA 5K3VA 3WIAA 1BF8A 2Y9RT 2PI6A 3BJFA 4Q8UA 3AG4B 2DWEA 3VOHA 4LUJA 4L8CB 2LHAA 4L3CA 4ADSA 3DN5A 2NX9A 2ZSWA 1PKMA 1UOKA 3MV8A 3KWWA 5FL1A 3GK8L 3QPKA 4U2ZA 4Y5YA 4ZE4A 3WLTA 4JKLA 1OTSC 2FYVA 3UTTE 4OZFB 4BH8A 3DX9A 2DQWA 1EWEA 3OKKA 3ZE2B 3PZVA 1H3XA 3QK0A 3FUEA 3C6LA 1E28B 4RW3A 2ED8A 4M62H 1AZ1A 2DEPA 4AVJA 3WQ5A 2EKCA 1E28A 3QR3A 3MGTB 4WFED 2CG9X 1LO3L 5E6YA 4JQVA 1R17A 3MUZ1 2WLYA 4OCSH 5K1VA 1EDYA 3IDJB 1T5XB 2ZF9A 4LOFA 5IR1A 1AD0A 1MJ7H 3ZTNH 1LOSA 4IDJL 4JGUA 5BPPA 3AZRA 3BKCL 4UCGA 3NGBC 3F7YA 4Y19B 4DZIA 4TLKA 3TO2A 1YEFH 1M41A 3AU1A 5J6SA 4Y0GA 3K5SA 1T8XA 5M5DA 4AQ8C 2JEPA 3EBGA 4Y9FA 5FA5A 3TU6A 3DDGA 5B8CB 2P5EE 4FQ2H 1TREA 2IO5A 3SYAA 1E5ZA 3ASOB 3QJHA 1Q6DA 2VE6B 4R7NA 4F7KA 4I48A 3N19B 1MWAL 3DHUA 3FT9A 3IGHX 2L4OA 1FVDA 1URLA 3BQUB 3IGAB 4K0OA 3U9PH 1AYOA 1CWYA 1REQA 3BSZH 3D85D 3KYMA 4R7JA 4HC1A 5CQ1A 5HULA 4ILSA 3BC9A 5L4MA 2Z31B 4J4PD 1F8IA 1Q65A 2OT0A 3KOZA 4EPSA 4W5UA 4XAGA 3DV6B 5FAJA 2PCFA 3QORD 5IVZA 3HZKA 2W0FB 3HUJF 2H26A 3GXPA 3DX8A 4I0PB 2EICA 1KY6A 2XICA 1EFXA 1U8LA 3ARFD 3BD5A 2PB1A 4MKSA 4APXA 3LK6A 3O41A 4RZ4A 5CPQA 2VWSA 1HOCB 4IFKB 3FT1A 8A3HA 3Q44A 1YN6B 1L9PA 1WIOA 3PUCA 5AOIA 5EU7E 1BGXL 3MLXH 4N8VB 3OGCA 3SOBL 1NAKL 4BKLA 4D8PB 4XISA 2YW3A 2R0ZH 1WYJA 2P8LA 1MNNA 3VCLA 4HU4A 5I6MA 1ZDSA 5T33L 3PIQA 3EZJB 4RPPA 2R4SL 4M03A 3T77A 1CFVL 5E6UB 5E09A 2I9LB 5I1JH 3ES6A 5GRYA 2J5WA 3WF3A 5J5DA 5SX4I 4EZKA 3F4NA 3LGGA 2CAKA 4YC2C 3ES6B 4XMVA 1B3JA 1T22B 3DI3B 3G6DH 1ZGLB 4KIRA 1T96A 2CXGA 3W7PA 1WEJL 5TE4H 1M65A 2X0WA 1U91A 1XG4A 2GHZA 3DVNA 5DJXB 3UIZA 4HWNA 4G8GB 2D31B 3ARBD 1BVKB 2NUTB 1NQ6A 2ALDA 1NCDH 3RGVA 4NQSA 3TZVA 1QPQA 1U58B 1QFWL 1U8QA 1WC7A 3B9KB 1F3WA 3FO1B 4A6YB 5J12B 1E73M 3AZUA 2W38A 3S5ZA 3FSZA 3V7AE 3M0VA 1U58A 1WC7B 4DYJA 3QPEA 2IWKA 1ZFJA 4NI3A 2O9RA 4IIGA 3IXAB 3NSJA 4U6VH 5CEYA 5ESQA 5GS3A 4LCCC 1QABA 1HIML 4PIBA 5J56B 2QAFA 2OTUB 4K68A 1VFHA 3I3BA 4FTDA 4HCRH 4Y7OC 3WL9A 1AGCB 3MV9E 2BOBB 2C3WA 2VC2L 4M93C 3FU9A 4CNIA 2WMFA 4JN2B 3S46A 4BQ6A 2GGHA 1OTTC 5E95B 4ABUA 2J8UB 4UOZA 4LEXL 3LV5A 3UO1H 2OEMA 1AR1B 4XVSL 5A6IA 4IGSA 2RDXA 1GY2A 2CUAA 1P5UC 3L17A 5KW9H 3BLDA 4HS8H 5EBGA 2JCCF 1IV8A 2DUAA 4XGZA 1JNLH 2QDDA 3MVTA 1ZJAA 3A64A 4UAOB 3LQLA 3T2NL 5TF0A 4XBPA 1JGVL 1U3HA 1YN7B 3FN3A 4HKZB 4ODUA 4QOKD 5IBUB 4AJ0A 1NAL1 3MBWB 2X4PB 2PR4L 3RX9A 3NSFA 3D0LB 1V6TA 2GJXB 4PJIE 3QGVA 2XSBA 2P26A 4ROPA 4GRSA 5DI8A 3GMOA 1BG4A 1CL7L 4YSQA 1SJHA 1HJVA 3HZMA 4ODWA 3HN3A 3FFCB 2FB3A 2EEBA 2AJZA 3BIBX 2DWDA 1B30A 4UC5A 3P3TA 1MXSA 4HIPA 2EECA 3RYMA 1EUAA 2GI7A 1HNGA 1ML1A 3VNIA 2CO2A 3NIFF 4XO4A 4OF7A 4ZX3A 4GUFA 4QXTA 1JUFA 3RFZA 4PJEB 3EKCA 4PGCA 5I1KH 3W26A 4IFRA 5U7SA 4N7QA 3MKGA 3EOYG 5HHOE 3L1GA 2YC1A 1FTXA 1O5XA 1G4TA 3RQ3A 4PS4H 4Y8EA 4LESA 1TSHA 1G9HA 2J1ZA 2BFVL 1UUNA 3CFKB 3CN3A 4XOEA 4BXSV 4Z23A 2F8QA 5C08B 4IU3A 4GGHA 4A3QA 2OCZA 1SJVA 2VDOH 4O4VA 1RZKH 5E94A 3R7MA 4AZ8A 2C8NA 4LT9A 4UTFA 4CW1A 1OF2B 1EJ6A 4PCKA 3WDJA 2XIJA 3DIFA 2EE9A 3C3NA 4DJEA 3CQPA 4GRMA 3DPBA 4PJCE 4XE5B 4CW1B 1JD9A 3HN5A 4B7LA 2J8FA 4A8RA 4MZ3A 2XV3A 5INDB 3BOFA 1U0QA 3IU4H 5FI8A 4JO8A 2VI0A 1UH4A 3N85H 1VR6A 3BUYB 1GPWA 2ZRVA 4MAYA 5T5NF 3W53A 3F84A 4JVUA 4WDIA 2JB6B 4Q4EA 2EKJA 2RFGA 3MJMA 2ORBH 4PWKA 1I7UB 4HCDA 4K3JL 4QI3A 5GRVK 1D7FA 3VI3E 3TUUA 4X6BA 3E6FB 2R23A 1OG0A 2GG1A 2J79A 4KVPA 5KSBA 4P23A 4PMEA 1K8XA 2X3AA 2ANUA 3UOAB 3G1AA 2VN3A 5B1JC 1YNTB 1FIEA 2YL6A 3FQTA 1OHZA 1YTEA 5FA3A 3N6JA 1KC5L 5CG7A 3GH5A 1QRND 4MAYD 3IGAA 2X4UB 3NQFA 3O3AA 2GUUA 1KFWA 3KCPB 1XYLA 2NWSA 3QG6B 4HZLB 2NY3D 4CC4C 2VE6A 5D9OA 1R5IB 4ATTA 4DJDD 3HOGA 2WXNA 3KPTA 3P54A 3VE7A 2OEJA 4UQ2A 4LLMB 2AKRB 3AU6A 5EEYA 4FALA 3N3EA 2G3XA 2Y22A 1TZIB 5ANMB 1PZBA 2QPSA 2VLJD 3MRNB 4E9SA 3EWYA 3IRDA 5JH2A 4L3EB 1T41A 4LDOB 1RCOB 4V1DD 1Q90A 4WWKB 1MHHA 1AHMA 3ABKB 3UZXA 2IALA 4YLCA 3S2JA 4HEMA 4LLWA 4TUKH 2WZTA 1ESOA 5CGYD 2CLKA 4Y8DC 2XZZA 5D2LB 1FHNA 3RA7L 1LL4A 5D02A 4DPCX 4JKKA 4PJAB 1S7SB 4PBXA 1KFJA 3U7AA 4UILH 2JIXD 4YQXL 1XC6A 1ZBKA 4LANA 2JKIS 3SCVA 1CDJA 1V27A 2PP7A 2QULA 4Y2DD 1C8YA 1KSRA 2DBLH 2YPVL 4AX7A 1ONQB 3FU7B 4RX4A 3V6OE 3QLDA 5TPWH 5C9JB 3WK0A 2OZNA 2WZ0A 4XN5A 3U4AA 4BINA 2XHNA 4Y9NA 3PAYA 5D1QC 2C18A 4I9MA 5GRUH 1HQ4B 4I0CC 1RJZA 4HPOL 1UKPA 2OZ4L 3UO1L 4KTGA 2R0KH 4ZNEE 3ZMNA 1U1UA 1UUSA 3BGMA 3AGVA 5LNDA 5IJCC 3OXRA 4PS4L 3RX4A 1EXBA 1BVKA 1BZOA 1F6AB 4WW1B 1HHKA 4F2MB 2DZSA 9XIAA 3OJMB 3IIXA 4Z7IA 2UXGA 3BD3A 2HMCA 2I5YL 3NABH 2H32B 4E9QA 4U4IA 3N3MA 1LT8A 2GOUA 4F40A 1ZP4A 2X4QB 3MZ2A 3G5VA 3O0RL 2XSXA 1JOIA 2DZAA 2OQHA 1LBFA 4FNRA 3X3GL 2IDCA 3BP6B 1IAKB 2XTJB 3I9AA 4WU5B 2OMWB 4L8SC 5ITFB 3CHXA 1I85C 3SYOA 4NWTL 2PTYA 5EBMA 2ACQA 2E7HA 3K46A 3UTPD 3NP3A 3QQ3A 5F21B 4KJQC 1NBVH 5AVVB 4CU8A 3NO3A 3AVEA 1JZEA 4JTRA 8XIMA 2HLFC 1A7NH 5IBTL 4AH2B 4KKAC 2V5SA 3V4VB 5I1DA 5K4XA 5F1NA 3S88L 4JFFD 3H3PL 4OFVA 2VLLA 5AOZA 1CFTB 2EIMB 1AGEB 2A74C 2FLMA 1S9YB 2IPUK 3G7TA 5I1JL 2P76A 1QI5A 3EGDB 5L8KB 3IJQA 3VRIB 5JUEL 3IU3A 3VKAA 1JZIA 4QYAA 4YLBA 1DBTA 2GJNA 4CD7A 1OANA 4ODTL 3D0LA 3BPNC 2VC2H 3TPKA 5IEHA 1PF3A 3KVJA 2EEAA 2V8MA 3QQDB 5DO8A 2KERA 2OW6A 5FO9A 1L9TA 4XBPB 3QIBD 2QDHA 2I9TB 1E4KC 2GBVA 4FYTA 3AAZA 5E8OA 5KVEL 4FI4A 1FLTX 5DZPA 2GTWA 3HI1A 4HISA 2VO8A 4QIUA 1F1AA 3BGAA 3L4ZA 2GUYA 4YN3A 4YXKH 5CHNA 5T3XH 3UG3A 3FSUA 4Z08A 2ZZ7A 1DQVA 2PDLA 4RRPM 5JQ6L 4NP4L 4YZFE 5DC9B 3AS3A 5SX5K 1FWFC 5T5FL 2D22A 3M44A 3STFA 4D7BA 2P10A 1EO8H 1E55A 1LP9A 1HXMB 2R1YA 2ITFA 2XUCA 3U6WA 4K8RH 3B2XA 1MCNA 3CMJA 4FR6A 4I8YA 1ZAIA 3H2EA 4LK4A 4Q9CA 2XBZA 1O5QA 1PCXA 5ABHA 3EYFB 1MWAH 2HQAA 1MCSA 5HHNB 2WXRA 4W8BA 4M4RA 5DCBA 4HJEA 3KXFE 5CEZD 4TRPH 5FYKU 4K38A 3PRZA 2GIXA 4GG8A 1J1XL 5FUOL 4QF1A 3XISA 2VDLH 4DPBX 4MJIA 1D5MA 2AP2A 2X88A 3ZJAA 3ZRCC 2AQWA 3P8JA 4YVVA 2BXYA 3HQ1A 2VM8A 3HC0A 4AQOA 2C1OA 3PAZA 1BD2A 5I8CA 3C4UA 2F58H 2YJLA 1FL3B 1BFVL 4BUGA 4K15A 2QHLA 3AQDA 2ZA2A 5IQ9A 2A4ZA 1P6BA 3NQBA 1ID5I 5LIKX 3LEYH 3QXTA 1M01A 2NXHA 4ELMB 3KXFA 1KRAC 4HIJB 3DUSA 2UZXA 2F54D 3HGSA 1NFPA 1QRKA 2IH8A 2A9AA 2W8CA 3GSQB 1N8ZB 2QR0B 3J27A 3QPQD 4X6DF 5DLMH 4KITB 5HYEA 3IUDA 1KB9K 1HE8A 4XB3A 3FQTB 4NYYA 4XP4L 4NKMB 2PWGA 5DMGD 3GC2A 5E9XA 1J5HA 4G9FB 3AW5A 3EO9H 1MI5B 1WCBA 3HZYA 3FT2B 3RVXD 5ADPL 2RHGA 1FH9A 1MCOL 1BFOA 1Z32X 1FQ0A 3B04A 3H2NA 3I85A 2INZA 3TQ0A 4YR6B 1AH0A 4HIIB 1CIDA 1KG0A 1WB0A 2VXUH 4GJIA 4R8WL 1B6DA 1BV8A 4R96A 2JTDA 5DJ2A 5KVGE 1TIMA 2QCNA 1NAMA 1YDVA 3N6HA 1RZPA 1NCNA 1M9SA 3PWVB 2WAHA 2OEKA 3NFNB 5GGVY 1A3WA 2ZKMX 4MLIA 3FO9A 3S6CA 5FEZA 5D2LA 3MHGA 2JQMA 2CR0A 4XN4A 2AEQL 2EPMX 4KKCC 1P1VA 1G6RH 2IALB 1OM3H 3RL1A 1HKKA 2R1LA 4NUQA 4X5WB 2V67A 2JWYA 3OGOE 4JFDA 2EH7H 3HE6A 1W5PA 3S1VA 2X2YA 5EEXA 1ZPLA 4V1DB 2Z2AA 3V95A 3X3FH 1UZ8B 3MRCB 4GAYA 4QG6A 3VH8A 4HETA 2XVGA 3F8UB 1T1WB 2DQCH 4AQEA 5HGBA 2XFRA 4JTEA 4U7SA 4PJBF 4BQ4A 4Z7UB 2QKIC 7A3HA 4C5YA 5LYRA 3L5MA 2UXTA 4HHAA 1QSEA 2WVSA 5DHVH 2NCEA 3LRLA 1H62A 1EXUA 3IWUA 2WHVA 1E4WH 1BYPA 4MAZA 5BRZE 5G1TA 2W27A 3SE3C 2Y07H 1SHWA 1JS4A 4OLZL 4UT6L 1OQXA 5HBBA 1NDZA 1TUXA 5A6SA 2GJ6A 4PJDA 4ZSOB 5BXRA 3Q8BA 4NHUB 5LG6A 3S8WA 4XP1H 5J13C 2HH0L 4PUJA 1MJJB 5IMLA 1X7TA 3FRUB 3I6EA 2Z8SA 4JZNB 3W11C 2BPBA 4WW1A 2ZUMA 5C0RH 3ABXA 3O06A 1WBYA 3D47A 4PMJA 2PDPA 3GMNB 2XIIA 3QUYC 1XUZA 4EPDC 2VDRL 1BRLB 1J18A 1H7NA 1PZCA 2ADAA 3APTA 3ULUC 3BW9B 3ROLB 1BLNB 3LKOA 4RIRA 2ZX5A 4PJ8B 2INFA 3V5FA 3BW9A 3ROLA 3MLYH 1GHRA 1BPLB 5AD0A 2XQBL 3PBUA 2O7QA 1HINH 4J6IA 4IFKA 3A47A 1M42A 2X9WA 2A1WL 3T3PE 3TM6A 4BM7A 3KOFA 5AWNH 5BWAA 1MCHA 4ODVH 2F61A 2V5RA 3GSWA 2FIKB 4HU3A 5HYSB 4WEBH 5CJ5A 3INUH 3IGUA 4S1RH 2WZPD 3GSWB 1L3NA 3RY5A 2XA8L 3KPNA 4KRPD 4PRPE 4JTHA 1CFSB 1V3MA 1FAIH 1HSAB 5PTDA 3S4SG 4OGQC 3PHSA 1ZA3A 1KTRL 1TWZA 4MADA 2QGBA 1SJXA 3KYAA 3DSNB 4UTBA 1V6XA 3PWUB 3ZPDA 1FO0B 1CZ1A 2XWRA 3BEWA 3F7PC 3HBGA 1O6IA 3ZJ7A 1DBBL 2Q10A 1DJIA 1DN2A 1XSJA 4XZUA 2HJKA 4O02H 2YA2A 3RLSA 4PMUA 3U36A 3VKKA 4J12A 2QQKH 4PRNB 4XZUB 5DZJA 2LABA 4WF7A 1ASPA 2DFAA 4GG6B 3CS2A 3GM0A 1A4BA 2CK0H 4L8SA 5DJXA 5C8JA 3SE4C 4CD8A 4JAMA 4DJFA 5C9XA 2V3FA 1UC4A 2QT3A 3HUJE 1PLBA 5IESH 4YFEA 5DGQA 1E6XM 2GGGA 4P57B 3SDCD 4K3ZA 4TR9A 5L2KB 4M48H 3IFOA 3RX8A 2R1XB 4GWEA 4ZTEA 1KWGA 1LO2L 3V1PA 1KIPA 1A6ZB 1DE4A 3B2PA 4BA0A 1U2HA 1U8IA 5CEYB 3HS9A 5IESL 2GPTA 3W1UA 1I1XA 4DPAX 2IAAC 2YBVA 3BLFA 4L4VB 4O15A 1FNEA 2ZZ4A 4Y2DC 1KDIA 1INQA 5HDBF 4P2RB 3N40P 1FH5H 3WN6A 4A63A 3QFGA 1JZ5A 4AY7A 4JHMA 2O30A 4P2RA 5JHLL 3EAKA 2OZTA 2QCHA 1MAML 2OL3A 1D5MB 4L4MA 1Z0NA 2K3HA 4NNCA 4DBEA 2VZ1A 1F00I 4AC4A 3IJ6A 1VYRA 5FESA 4RGNE 1UT2A 1GEQA 2VLRB 5D2WA 3WLPA 4UTJA 3ZSSA 4RNRB 4PRIE 2JI3A 1OLZA 3FH7A 2FYYA 1QNZL 2Y07L 4OLZH 4UT6H 1TVHA 2VR9A 3TYGL 4NQDA 4F33A 1AIFA 2FDMA 2PSNA 2I07A 3GR7A 5JW3H 5DHEA 1XICA 3EA3A 1QSFB 1V7MH 3KPRE 4LLDA 3LNPA 1CB4A 2HFEB 3KXFB 2PN5A 2FRGP 2GJXA 1SDDB 1Z9NA 3G5ZA 5IIEA 2BNRB 2EKGA 1W5OA 2HZGA 4PY8J 2Z7GA 5EPDA 4H83A 4NPKA 1U8PA 4G6AD 4TQEL 4OJYA 1U8NA 1UFUA 4NCC1 2OMUB 1EYWA 3BOLA 2GPZA 3COTA 4LNYA 1MY5A 4H8NA 2EYRA 1MREL 1U8NB 1OM3L 3RX5A 3FOKA 2X89A 1OP3K 4FFYL 3PG9A 3VUPA 2X1PA 3LHWA 3H3KA 4X42A 3G1RA 2GJ6E 4MAUH 1OHLA 3BP7A 3HI5H 3ZYJA 4QQUA 1FWXA 3O8XB 1IZKA 4XXDB 1A3RH 4JQ3A 3RGHA 5L88H 4G6CA 2IBGA 1D5ZA 3W3OA 5T1MA 2HMID 1S9WA 5LNUA 1NLDL 4GAAA 3B9KD 3C8FA 3IFNL 3EDJA 4DEPC 5FO8B 4O1EA 1JRHI 1PPIA 1B1YA 3ZR6A 5BMXA 3VIHA 3EPNA 4KWUA 3W76A 5ENLA 1X1OA 4O50A 3PY2A 1IQ8A 1YJDC 4JZJA 5IM7A 3JVGA 4KCWA 2UZPA 1FO0L 4CJ0A 2FUTA 1JUBA 2QTEA 3P77A 1W6TA 2QGYA 3CHCA 1TWDA 3GSVB 3H42L 1OGGA 2OSLA 3P4LA 3SDXB 1EJ7L 4TMCA 4JZOB 1G7JA 2Q5BA 1XDTT 3Q3GB 4M5PA 2PWVA 2W5PA 1B5TA 2PETA 2Z8VC 3MRPB 3MLPA 3R12A 3VAVA 1BXCA 3KR3H 1BWMA 2P80D 1OFOA 5E0KA 2XKUA 2GK2A 3LEYL 2ZG1A 1TZ9A 1J0HA 1P6FA 2CJUL 3QJVB 1HHIA 1NOUA 3AT0A 3GSOB 1DBJH 4ODHH 4BJLA 2D03H 3MGTA 1J8RA 2ZAIA 4LFHG 3ILQD 5J13B 1IE5A 2CDEA 5CKGA 4BK5A 5KSBB 4BY3A 3BKMH 1S6NA 3ME0B 4AUUA 5DUJA 4HWEH 3UBPC 3USZA 5IVXA 1VRSA 4MNGE 2N1KA 4MQ7B 5I75B 5B8CA 4YMZA 3R8HA 3GSMA 4PGZA 3H23A 3UGEA 5I6SA 2BK8A 4IIQC 4JIEA 4Z7OF 1GVFA 4TULL 3AWOA 2PDMA 4N0YH 3H53A 4JFPB 4XNMA 3SO5A 3P7YA 3D3AA 1QNVA 1LEKA 3SAZA 4LLAA 5I26A 1S5HA 4K8RD 2AMUA 5ETUB 2AKRA 3G1FA 3ULVL 2N7AA 1RK6A 3OX8A 1JGLL 1QPRA 1MI5E 1L3WA 3T6VA 2QT6A 3VI3A 4YMPA 2A6IA 3ARDB 5CU5A 5EBWB 4PB3A 3WN5A 2Z2BA 3UYRL 3UPMA 2J43A 5AYQA 3VGGA 3FRPB 4K23L 1UH2A 3SCQA 4D6GA 5JIHA 4ACYA 2DYRB 3BLEA 2DN7A 1RULH 4Q4IA 5HYIA 1ODUA 1GOFA 2H32H 2YRPA 2XN9E 3DJTA 5HVGB 1XDMA 4O1AA 3UVAA 1CK0L 3QXVA 1N8IA 4LUSA 1ORSA 2IH9A 3ATYA 4Y5XA 4KO5A 1E30A 4WKZB 5JMRA 1R3RA 1MHEB 2F1EA 4OFYD 5F4SA 5IFJB 5E5RB 5D55A 3NEEA 3NAAH 4JL1A 4R84A 4ONVA 4LMQI 1X6LA 4HK0A 1QO3B 3H3PH 3BANA 3QDMB 1RA0A 3TA3A 3QYCA 5F7DA 1JZHA 1QO3A 3KHQA 3HG4A 5M95B 1DHPA 1OX4A 2NSQA 2CCWA 2UXFA 1KBLA 4DUXA 2NQ9A 1XH1A 3P30L 2PWEA 2WWDA 2BZCA 1UM4L 1A9BB 3BHBB 1M68A 5BXPA 2DYPD 3FBQA 3VXUB 4PJ9C 2QS8A 2E25A 3T4YB 2H8PB 5DVKA 2NY2B 3EGJA 4L64A 4AMAA 2AW2A 2NYYC 2P24A 3KPLB 4L5FH 4W68A 3SKJH 2CLMA 4LPYA 3RGVB 3SCMC 3TZVB 1W3LA 2PLMA 4L4VA 1T40A 4DVRH 4S3GA 1YAIA 4AD5A 2A3EA 3EJZD 3PWPD 1SJCA 3SECA 3L9BA 1A6ZA 1DE4B 3MLSH 4C4KO 2OQJA 5FPIA 5LGHH 2OX1A 2Z25A 3QQ0A 3SSJA 5I09A 4HZ8A 3R5EA 1RZ8A 5I16B 1INQB 3AQXA 1NGWB 1QLRB 2QDEA 1QEWA 3SY5A 4S1QL 1D7DA 3MV9D 4X4XB 4Z7NE 3P4NA 1M7DB 3CHEA 4L4VD 1VS1A 4AD2A 3P0VH 2DU2A 2CO7B 5GIRB 2AK4D 1RY8A 4CVXB 1UA6L 4HUCA 5DUML 1YRKA 3O4LD 3S36X 4QEHA 3N04A 1YPZB 2KZBA 4X2PA 5HDLA 3RP1A 4UNLA 2R1KA 3FKRA 3JUGA 1S5TA 3QOKA 5C0AA 3GUTB 5KBMA 1KRBC 4OFIA 1FNSL 1D6VH 3BPOB 1BJ1J 4FQHA 4ISVB 2MUCA 2EC9U 3NZQA 3TA3D 4M7TA 1BF2A 3WF4A 3QQDA 4LKCA 5A2AA 3M8OL 1DXEA 3M5VA 3SGZA 2VDLB 2C4FU 3OBAA 4OD2B 3VYPA 1GJUA 8PAZA 4UIKL 3S8GB 2Y61A 3MV7E 3EMZA 1GW9A 2ATSA 1GS8A 2A3HA 1KN4H 3ULVD 1DBML 1MWAB 2WYZA 4QE4A 3RWGB 5ILTL 2BVYA 2QADB 4CVZA 1OPGL 5C0BA 2QDGA 4K5LA 1RLCL 3MI3A 4HHPA 3WJMA 2YLHA 1IM9A 3MRMA 5C86A 3E9AA 4GVFA 4N4QA 1OAKH 4ZD3L 1TVNA 2EXWC 3DK0A 4NN7C 5FK9B 1O1ZA 1WQ5A 1DKWA 1Q0EA 2C15A 3HBQA 3NQGA 4ZQOA 5C9WA 3HA1A 3FXYA 5IMOB 1CB2A 1SUJA 3EA2A 1G9ML 4JHAL 1CICB 3ZKMD 1MEHA 2WSRA 3NJGA 3LNMA 4PH6A 5C6TH 3BT0A 4AQ8A 1W0VB 5IM7B 3RM8A 4Z3EA 1DUYB 4XNBA 5IOPB 4G5DA 4QF1B 5CGMA 4UTUA 3ZE2E 4HJSA 2R2HA 2H3NB 3LIZL 1N82A 1E2ZA 5A2KH 4J3SA 4H0LC 2MQ0A 5HGDB 3JTTA 3VABA 2RDUA 3OL2A 1R87A 4D0CA 1XM3A 2OMZA 1F5ZA 3SZ8A 2ICCA 3TVMB 2CBVA 5JIMA 5L9DH 3OB0H 2VYRE 1COBA 1H41A 2AAMA 1NCCH 2WZAA 3IUIA 5MENB 1K5WA 1A6WH 4JW3A 5LBSH 3UBXB 3GSOA 3B8DA 1K02A 1AC6A 2V5YA 4I3RH 5DJ6B 3U9UA 4HG4K 1P2CB 2RJHA 4M7LT 1UTDA 3VIPA 5D7LD 1INDL 2IQ0A 1QW9A 1G9NC 4M7KL 5SV3A 4BWWA 1ZV9A 4E36A 3QJZA 1TJGL 2XRAH 5I0DA 5JIPA 3L4WA 4BKSC 3ULUH 2R9HC 3H4XA 1I7UA 4LVHB 4DZ8B 3H2QA 3MNZA 2J88A 2Y89A 2BNRD 3LRMA 5CN2A 4PP1C 1EJFA 4R26H 4WCYH 3ILQC 1RIUL 3G08A 4JFEA 4OD3H 1TE6A 1U33A 2Z0BA 2VDOL 4XHQA 5IB1B 4RGOL 1QWGA 3NWRA 1C5BL 3FDKA 3UTPE 2ZX8A 3CVHL 5FA3B 3REQB 5KITA 2R15A 4ZT1A 1TV4A 1JGUH 4CCCA 5D1QA 4E4PA 2J9ZA 5J6GB 1L6YA 1SFHA 1MRDL 3PQYA 1CXIA 3PWVA 2V69A 3U57A 3UYRH 4DJDA 4JFYA 1GA2A 4IK6A 3O2VL 3HFYA 3UESA 4P59H 3OWEA 1FE8H 4DN4L 2EDOA 4EUPB 1AFSA 1KM4A 2J8TA 4FMKA 4JO5A 3MCYA 4LP5A 3CM4A 2D3JA 3C5XA 3VFLA 1P4CA 3SDYL 3ZDXB 2QKIB 2F68X 3QPXH 1YHTA 1RURL 1MG2C 1ZOXA 2OA9A 1JGDA 1S2WA 4OOUA 3CHOA 3LKPB 2JKLA 2M8XA 2XN2A 3IU4L 4EWND 2VLKA 3FYIB 4HKBB 4PJ7B 2NCMA 3BN9D 1JNJA 5CJXA 1CURA 4QXGH 1UKOA 1U92B 1A02N 4HQVA 2X89D 3GDCA 2I26N 1WAAA 4PJ7A 1IXOA 3HU7A 1JNLL 2LLLA 1D5XB 3L8QA 4HZ1A 2AL1A 3IM1A 5B1BB 4XG1A 5DLCA 1CLOL 2CUHA 4G43B 2BLFA 4ZS7H 1RZIA 1I4FB 4XC3H 4JBSA 5D7JC 2Y1ZA 3FSWA 1FF5A 3WJYA 4KNSA 3KPQA 4WY7L 3LCGA 3BGMB 5BW7A 4IGBA 3K4ZA 1TE1A 2Q7YA 3VD3A 1Q66A 3K6SA 3PUDA 3M0KA 1GZPA 4U1GB 5EU3B 3CC5B 1WD9A 3K6SB 1FSKC 4MYAA 3PL6C 2A3CA 3MXVH 3KPLA 4ZQKA 2P7TA 5SX4H 3H21A 3QUMA 3TLLA 2YGNA 2A74B 3V6FA 2ZX6A 1SXSA 2JCWA 2H8PA 3GSRB 4M7ZC 1ITUA 3K5RA 4JFQB 4B3VA 2CQVA 5EEWA 1KCRH 3I84A 1U1JA 4H00A 1FGVL 3BP4A 5I19L 3M5YA 5CEXB 1XCQA 4R3SB 3G24A 1XZ0B 5F1SA 3EYQD 1UWXH 3MHUA 2J25A 1NGWA 5KVDE 1QQDA 1SYVB 2XKSA 5T8IA 3MCLL 5C3IA 3V0EA 2K7QA 4NVTA 5U4NA 3TJXA 5EG6C 5SWZD 4AIOA 4JTJA 3O0LA 2VCAA 2EIJB 3EJTA 3OW1A 4JYEA 3WNKA 4O16A 1YPZE 2ODOA 2ZBTA 4Z2JA 1FDLH 3DG6A 3QUKA 2OR7A 1I7TA 4WJ5B 4XBMA 2LU5A 3SE4A 3WMPA 1DWJM 4U5KA 5M17A 5DR5H 4BE6A 2YCJA 3WF1A 2IPTL 3LNHA 3MXWL 1IEBA 4GMTH 4OZIA 2EAEA 5KJ7E 4J2XA 4PLOB 4MJ6A 4QOKA 1J5SA 3TJIA 3Q2NA 4Q0XL 3GUTA 5C07D 1TV5A 4HTYA 4K2SA 2Y7MA 4PJ9A 1FO0A 3VQ2C 1OD0A 3IU3B 1WOAA 1PQZA 3S97C 3QPYA 4Y7EA 3T44A 1NJ9B 2VDOB 4JOMA 4ENLA 2XBTA 4APQC 5KVDH 3MBWA 3ABRA 3BE7A 1DO5A 5HHOA 4PZVA 1GCFA 2EDQA 2VX7A 1MCIA 4FKEA 2CRIA 3R7QA 2GSJA 5CPSA 3NVTA 1Y0EA 1GGCH 2GY7B 5GGSY 3M64A 4QSFA 2G60L 3F5WA 2FQEA 2IBZY 5C0BE 3GGWA 3KH3A 1XGDA 3D39D 1M6OB 1WWBX 3OYXA 3SN6N 1ZD6A 3RWIB 3UU0A 3L23A 4YDJA 3NZSA 1LRQA 2IG2H 4PLKD 2W62A 3GNPA 1KCLA 3ZVVA 5H8PA 4LPUA 3EYFA 2W81C 5EPMA 4YTQA 5F4WA 1J11A 4BFGA 1G69A 1JPSL 2EEXA 2J5LC 5HDWA 3HURA 2NLYA 3FCUB 3ZDYF 3N34A 1EO5A 2XWXA 3CUPB 5CBAA 4RNFA 1C16A 3ARBA 3HE7D 4MXQC 1RD6A 1AL7A 2PDXA 5F0PB 3TJ4A 3VTAA 3MU7A 1BIIA 3SCUA 3IDGA 3KVDD 1I8IB 1S9VB 4DGVL 2TSYA 3LJ3A 3OKKB 4L4JA 4A39A 3QUXA 4GKNB 5J6HB 1UD5A 2NR6C 1EPVA 3A5VA 1R9YA 5TDNB 5L2JB 4MDRA 4N2KA 5FLVA 5A8MA 2YD5A 4HFUL 5CFHA 2J7BA 4YFLI 4C60A 3AM8C 1RVKA 3W7MA 3AI0A 4F1ZA 2C1OB 5I8CB 2VOMA 3THAA 2ZWNA 1GCYA 4LB8A 1CGUA 1PAMA 3H9HA 4WDIB 4YHGA 2DKUA 1GGBL 4M7LH 4KQNA 5B7ZA 4HD5A 2BW4A 4LLUA 3LDVA 4E2VA 1WHOA 5IQ7L 1U8OA 4WWOA 5FKPB 2CKBB 4LB4A 4P4KA 3VVGA 2RA1A 1XL4A 4ERGA 1I9RL 2FWSA 4ZUSB 3VXTB 1FH7A 4PUNA 5I8OH 3W6MA 3B0YA 4DLFA 2NTFA 2XWJA 1UWQA 5GS2H 2JJTC 3TH4T 3KDOA 1PZSA 2CDGA 3MRRA 1XGQB 5I23A 5IY5B 1KCBA 4NUMA 4E5XG 2P8BA 3HE6D 1RJQA 3R6IA 4OGXH 1E1CB 4ML4A 5I7GA 5FS5A 4JFEB 3WUEA 3N17A 2CJTA 4PG9A 4TQHA 3GSNH 1Q1JL 2FX8H 4N9EA 4BCZA 1BMGA 1V3KA 2M1KA 4F9LA 4DF9A 4YXLL 1Q72H 1AMKA 4P8VA 1CEOA 1XT5A 2I5QA 1KM0A 4JZJB 4GO8A 1S7UA 3W0KA 4L3CB 4QY8A 4XHJD 4WFHD 4QYOA 1TPXB 4D8OA 2WKOF 1CECA 4PVLA 3L5IA 4L29A 2CZ5A 5H2BB 4JQ4A 1OB0A 1MCDA 3ZTNL 2FMNA 4ICCX 1G4SA 2TODA 3N73A 1IHIA 5BZZA 3ULAB 3FEQA 4I1RA 1X6UA 3ALFA 4JFDE 2GYSA 3SE9H 3FTWA 4HNOA 5F3BA 4ZFOL 3TJEL 2D9QB 3GSNL 1SBBA 4H0IA 1YEKH 1LG2A 2W59A 5A95A 1NA8A 2F6UA 3Q9PA 3LD8B 3CASA 3TK7A 4GA8A 1R3IH 8FABA 4P4RA 1PD0A 3UZQA 3H8AA 4UQ3B 1DDHA 5DMGC 4XN7A 5EN2A 4CMHB 3CU2A 3S5OA 1ZWIB 4J1OA 2DQEL 3AZSA 2WQXA 3V36A 2YD1A 4MS8D 4DGWC 5CD5C 1CYWA 2Z7UA 4HX1A 1ICQA 5IMLB 1PYWB 2EXTA 1A2YA 4IBQA 1NTDA 4JX5A 1EFZA 4NRZA 1DQMH 4HX1B 1MSSA 4DEUA 2A3AA 4O0KA 1DVFC 4KZEH 4AI7A 3T42A 1GS6X 4DH2A 2AGKA 3EYUL 2UVEA 3CFTA 1ZSDA 4YVNA 3B7UX 3MROA 4HJ1A 4MJID 2A6DB 3IXAA 2P45B 3UZEC 3SDAC 2WSQA 3DHFA 3OLDA 3HE7A 3KYOA 5HTSA 4WDTA 2Y5EA 4XBJA 2C1HA 3TVMD 5D38A 2E86A 1A3HA 2B1HH 2G5BA 3ZK0A 4AH7A 1WDWA 1JTOA 1MZRA 4MNJA 4C6DA 4NT6B 1YVLA 2F7RA 1KKOA 3MREB 2X6AA 2DQUL 4IU2B 1JNHA 4TXVB 5KSWA 4ECNA 1FYTA 3NIGE 3SKMA 4BBWA 3WIIL 2EXWD 4A22A 4IU2A 1GZQA 2F53A 2ZADA 1L7IL 1WH0A 2Q76A 3E0WA 2ZZ5A 3RIAF 3O11B 2X28A 4W9TA 3G04B 4OJDH 3LXBA 3L21A 3B8SA 1CF8L 3E8UL 1RZJC 3L45A 3QJUB 4QTIL 5EU5A 2NXYD 2H9AA 3O6DA 4M19A 4F7TA 1ONRA 1H3VA 3C5ZA 5TH2B 3TBVB 3VD2A 5I18H 2DQIH 2A6NA 2WHKA 1GR7A 4PRHE 3IKCB 2CLLA 1Q94B 2ABBA 1J8HB 1R3HB 5I1IH 3NPZB 3LMZA 2QDWA 1QDSA 1UCWA 3LNIA 4YS4A 2K3TA 2I9TA 3TF7C 2Q2EB 3OA3A 2YD8A 4J40A 4PJFB 4XP6H 5C0CB 3H9ZA 4IMEA 4GRWE 2HB0A 4E5XA 3H54A 1P7BA 3T0DA 5EEUA 3AO0A 3O6FA 3H7VA 4PUEA 4UWMA 5AZ0A 3VOJA 4DXXA 1IIIA 1TWSA 4Z7VB 5KSAC 1UXSB 5ALCH 3UJSA 5CC7A 3HE7C 3WNLA 2BVDA 3JWNC 4XCEB 1RZ8B 4HPXA 2CSPA 1UWFA 4M1DL 3P2DA 1CYXA 4ZSUA 4M43H 1PBGA 2J3SA 4P7OA 1VCFA 1WA1X 4P5SA 4S1DD 8TIMA 4BWUA 1WKDA 5DJCA 4F5CA 2ZCKH 2UV8G 4HBQA 3H2AA 3WH8A 2J8UE 1FRGH 5SWZB 2W0UA 4O2EA 4Y2DB 3IDGB 4QLWA 4X7SH 5FHBL 4HEME 4JM2F 5TDPB 1CS6A 4WHYG 3P2BA 1M53A 5T1LD 5D72H 3TJPA 1HI6B 2FJGA 4IHBA 2VGGA 3N40F 3B3DA 3QCUL 4GD0A 4NT0A 1SNRA 4PCFA 4BI5A 2EH8L 4C58B 5IROD 1NIFA 4HLZG 5D8ZA 5EBUA 1IKOP 3PZTA 3FQRB 5J11C 1WT5A 4UTCA 4DNLA 2YCLA 3B2VL 7PTDA 3TU9A 5B4MC 1OX6A 3SSZA 4I3GA 1NANI 4AGMA 3NJJA 4IJRA 3THQA 2BNUA 3QHNA 4G9FE 4OVXA 1YG9A 3WGVB 4K71C 3N9GH 3PY9A 3LV3B 3G5EA 4P59L 3NNTA 4L1XA 2VL5B 3LRKA 3RDTA 3U2CA 2X42A 4U1LB 4A21A 5ID1B 3LVTA 3WAJA 3DUGA 1U30A 1M05A 3ARGD 3VW3H 5H94A 3L5AA 2PURA 4MCZB 1LYXA 1CCZA 1H6UA 3QUZA 1ECYA 4HH8A 5H37A 4EBQL 4PREB 3BZ4B 2ARJA 1EZSA 2BIOA 1AJ7L 4J3UA 4EI6B 2VP8A 1KZYA 5DQPA 4LLMA 2EIZB 3PQYE 1T5WA 4P05A 5LGYA 4X5LA 4Z7WB 4ZFCA 2VQ1B 4OD3L 1S9WB 4LSTH 2Z92A 5D4HA 5EZIL 3FS2A 1OD8A 1WYIA 5F7EL 3W1ZA 3QY7A 5I3IA 2Z92B 2QJJA 3V79C 3LN5A 3PQYD 4I3SL 2XGZA 4AZGA 3SGDI 2HPMA 2AQPA 1FGVH 4AAJA 4D0CB 4AEHH 3HFMH 4V1DE 5A43C 2AKMA 4PBGA 4YEFA 2WJFA 5TFSL 1TXKA 5C8BB 3AIBA 5G2HA 2Q7NA 3EOBB 1EHXA 2ZOXA 3MOAL 1SO3A 2VFHA 5CLZA 3FTGB 2O61B 1A0QL 2ZVRA 2XFWA 4FX6M 5HA7A 3TURA 1NOFA 5F3BB 4QHMA 1UZ8A 3MRCA 5LKNA 5DMNA 2W1NA 2ZXDA 3QULB 4MAYC 3U2JA 4XP9L 4UTHA 3ME0A 4LF2A 6ENLA 4WCYL 1BFNA 5DT7A 4JRWA 5D7JD 2Z7KA 2E8ZA 5JQIB 3L5LA 3WQ4A 1MCQA 3AAMA 1EGJA 3L5HA 1P4IL 2V5CA 5D7EA 2YW4A 2F74A 3BQUC 3ABZA 4PJEE 4F9PC 2RUSA 4K1WA 5FEXA 5KSVA 4W7WA 3W9DA 1IZJA 3D6NA 3LEVH 5CCZA 3KHJA 4PTUA 4XNMB 1EA0A 1GOQA 2F54B 1D5BA 3BFOA 1E9LA 5KYUA 2YD7A 4YHNA 3W75A 5D2NC 4BEUA 1Z0MA 4HJ0D 2ZJSH 1QSZA 1WKEA 3GQYA 2PW1A 1T3FB 2WNZA 4H25A 3GD6A 5CZVH 4NU7A 4PJHE 3NIGF 3E2QA 1KBGL 4GIYA 4JFYB 3O7UA 5A8OA 4JFED 3IWVA 1MI5D 3HZKB 3QQ4A 1JVKA 2VABA 4F8XA 1M71A 2VN6A 1JTTA 3UP6A 2ZKXA 3C09C 2F8IA 3LKQA 2QEJA 4B5ZA 5ISZE 4FOKA 4RDBA 4OCWL 3AYTA 3LXAA 1VBJA 1VFLA 3DIVA 2OB3A 4YSPA 5GGQH 4J28A 1S7SA 1V0KA 3FQ2A 1P7QA 3BP5B 3MJ8A 4IHOB 1SY6L 3LNGA 3P9MB 5D1XD 5KSAA 1E71M 3ANVA 1YBQA 4CBZA 2WNQA 1F05A 2CCVA 2W9LA 2RH0A 3K91A 1TITA 4JZJC 4W4OA 2VZUA 3FULA 3EH5B 3O1NA 1PNDA 1OAYH 3NCYP 1YEIH 3ME3A 4DEFA 4BK9A 1ZLEA 3K7UA 4HVXA 1ZA3B 4FLRA 2VC7A 4NQVB 1N26A 3BEVB 1FZKA 5AW3B 4HMNA 5FO9B 1A0CA 1H5VA 3S2LA 1IBDA 4XAFA 5CC5A 3OXSB 2GQ9A 2WANA 4JN7A 4B5EA 4GLEA 1FKXA 3WHXB 2I16A 4YS1A 3TBBA 3BHBA 3N85L 4I13B 4CL7A 1RL1A 2BRQA 2CALA 1YE4A 2HEJA 4D6IA 4GSUA 1E0WA 1WZKA 3I9GL 2VCOA 4GEIA 1U6AL 1RZGA 3OZMA 2A74A 3OZPA 3O4LA 2EYTB 3KPOA 4ZAKC 5C07B 4LS2A 3H7LA 5F9JB 3CV2A 5SV4A 4OZGB 5KW9L 3SKJL 2GBUA 3TWCH 2V9RA 3V0UA 4NWUH 4OZHF 2PDIA 3FH5A 2QIIA 3W73A 2D7QA 3WIHH 5C70A 1UA6H 5DUMH 1OFRA 4CU6A 1FFRA 5C6TL 4GFIA 3RJDA 2P5PA 5H37G 4C1NA 1FNEB 3HS8A 3HZVA 3J2PA 4Y5VC 1FWEC 4IJCA 3WO8A 2AAVA 2DICA 1KYFA 3GJFK 1P0KA 5T5NG 5L6YL 4YDKH 3H4GA 3GNDA 2NY1D 5BWFA 2A83A 5FYJH 2QV2A 1KO0A 2HXTA 2OLHA 2P8CA 2ALRA 3DX7B 3JXAA 2DQJL 4UT9A 4P8XA 5CBEA 1EERB 5HINA 3LCXA 1NH6A 4ZXOA 5K9OA 2FJGB 4WFHE 1PQZB 5GRZA 4L80A 1PIFA 4IRZL 2Y0FA 1KPRA 1B0RA 3IF1A 1NF0A 3NSCA 1KW1A 5K69A 3GBNH 1UFGA 1X5AA 1IGCL 5A6AA 4LKCB 1UR8A 2PR4H 2Q87A 1Q0YH 1N6UA 5C0FB 4PTVA 2J2ZB 4PJGA 5GGSA 4BZ2A 2NUPA 2Y7LA 2ZP0T 5DO2D 5FB8B 3N11A 5DRXA 1HTIA 3N18A 1HW6A 4AVHA 1DVQA 4ZUVB 1IT0A 3RLGA 1N8WA 1E3ZA 4HW6A 5FDWB 1NEPA 4DP7X 3NEHA 5C0BB 3HEIB 3L3GA 4L0YA 1ZQ5A 4GY1A 3CU7A 4GH7B 3UTSD 1NEUA 3M1OA 4EMZA 4LEXH 2P5EB 5E6SB 1D5ZB 3RUGF 1A4LA 2VFGA 1LP9B 2QMJA 1QNPA 3EX2A 2ZZ3A 5T33H 3AOFA 3WNPA 2DJUA 3WLOA 2NY4D 4ANKA 2ENSA 5CCJA 2X7LA 2J1XA 1A4KB 4P2YA 1KG0B 5EPMB 2J8GA 3IJYB 3TE9A 2XYCA 1RFDL 1H3UA 4KQ4H 4MB3A 3FUJA 1BGXH 3NIDE 1K8IB 1N2VA 4N4PA 2B0SL 2A7NA 2NY5L 3DHPA 4M6NL 4WTWA 5LCVH 3NR0A 4IPNB 1T1XB 2OLAA 3MZNA 3KBJA 2WQVA 5JORB 3ZDZE 1KPVB 4NFDA 2WVTA 3SPIA 3KHDA 3CN1A 2FEDC 3SDXA 4Q8PA 5FO7A 3W27A 4LCWE 1CGSH 4LDCA 3RWJB 4LRIA 3P80A 1ZVHA 3USBA 3HNVL 4GUOA 5HPOA 4KNQA 3H0TB 5LLIC 4S3KA 4L4TE 3QQ9D 3JZEA 1ZAJA 4E2BA 4CN6A 1JZ6A 1KJ2L 3DXAB 4ACTA 4UFKA 3QVAA 4I5RA 3B9AA 1K4DA 4IJTA 1UENA 3FQNB 1X9UA 3GUWA 2TPSA 4R9XA 3DXAA 4X3ZA 3AG1B 2PDBA 3HC4H 2WJDA 4GH3A 3GLCA 4AVKA 5AVRB 5JHDA 1EXUB 4FQ2L 4ZB2A 5AHNA 1EWHA 2OJPA 3QULA 3RU8L 4UMCA 2N59A 4YLWA 3HCVB 3LNFA 3I9IA 1MVFA 1XRFA 1KIQB 4WXYA 2G3NA 4G8GE 1NFDF 1RJCA 3BVVA 4PSPA 3RAJL 4IP5A 1JD7A 4UTIA 2WWNA 1HKLL 2P80A 3BKML 4HWEL 3TO2B 1PD1A 4JTGA 3FRUA 3OAUH 2AERT 3C6LD 3F5KA 3OG6B 3W9DB 2K0RA 2X4TA 3MQIA 3GZ3A 4K2UH 4X6CA 5DS1A 4LU0A 4WO4D 5D1QB 3D07A 5EMLA 2QSCL 1AJ7H 5KANG 2KLTA 3LAFA 4EZJA 1N64H 2GABA 2GVYA 2YEVB 5B7EA 5EO0A 4AEIL 2ACUA 5KBKA 2NOYA 4BCYA 5EO0B 2R2BA 5CLTA 4QG9A 4N9GB 4WEVX 3EJSA 3AFBA 4KMQA 3OKDA 4X9HA 3UJEA 5FCZA 4H9TA 4Q9RH 4KRLB 3SO3B 1JGDB 1TR1A 2A2IA 5HMFA 1A80A 4JFDB 4FTVB 1FG2B 2F7PA 1ZLSL 4BYHA 3CL6A 1VDGA 5C54A 4G5AA 5FJOA 4MASA 1Y5VA 3FFDA 2CIIB 1KJVB 2ADIB 5LHFA 2ARJQ 5HPCA 1H0GA 2ISFA 3LTPA 3CH1B 4FFWC 2AJUL 4B4FA 3UY7A 1H7PA 3V5KB 3QZNA 4K8EA 4CQAA 1Q4WA 2FJKA 1RCQA 2AOSA 2X87A 3CFBA 4KVCL 2OZ3A 1IYXA 2JTYA 5DC4B 2YPKA 1AI1L 4PGBB 4DWSA 2EC8A 4M43L 4TSAL 1HHKB 4U1MA 2OFJA 3JUYA 3LMJL 1F6YA 3IV3A 5EIIG 3ZDYE 5B4MD 1FWAC 3HFFA 4PR5A 2FZDA 3MSPA 3B9KA 4NO2B 4I4WB 1GOXA 4MSWB 3EGXA 3N1PC 3GBDA 1A4AA 2D31A 3QSKB 5BRQA 1I1AD 3I65A 4GC3A 2PC4A 4POZD 1OSYA 2EDBA 3BP6A 5ITBH 1NWTA 4QSHA 3FUMA 5AALA 3VXUD 4M6UA 3CPLB 2R94A 1INEH 1GYVA 1J0ZA 4IW4C 4RW5A 1YC8A 1SZGA 4US5A 3GMQB 1AC0A 2OTUA 1H51A 1NOLA 1JI1A 3GLZA 4OIBA 1XQLA 3IFPA 2AQVA 4GISA 4MSSA 1Q5MA 1VFFA 2ZOUA 2JFEX 2C19A 3W25A 4HHWA 3TO4A 3B9KC 1AODA 1AUSL 2DH3A 1Z5YD 1I31A 4KNUA 4X6DA 1AK5A 4O02L 1H7RA 4OF0A 3RWDA 5L88L 1RAKA 3LHPH 3MACH 5BV7C 5C0CD 4EVZA 1WTLA 4DJFD 3TNMB 3E8UH 2CKNA 1OGAA 2FEEI 4H6EA 4P2OD 3EOAA 3VUAA 5I76B 2XINA 1DL7H 3SUWA 4AG0A 5IB3B 1EJ8A 3VI4E 1EC7A 5C0FA 1ORQB 3ECUA 2ZYFA 3QP3A 4F7TB 1QYGL 2X6CA 3G5ZB 4LF3A 4Z7WE 5HJDA 5IIEB 5L2KD 1EYEA 2OELA 1NQBA 2POTA 2UZ9A 2CLRB 5D6CA 3RUGA 3UJTH 3KPMA 1EGVA 3WO4B 1K7FA 5D03A 2QVKA 2E7DA 4GAJH 4EI5C 5DI8B 1HEHC 3O07A 4MTVA 4B3LA 4ANVA 4P2RD 1GOHA 1XH2A 2E6AA 5E6IC 2FBOJ 3SKNA 2Y3AA 1KEMH 3QEUB 3SD2A 4X4YA 3NQAA 3DBPA 2WXGA 3FRPG 3NDYA 4QCIB 1SYTA 3KNBB 4H20L 1SFSA 1Y6KR 3T3MB 4YU1A 2JJSC 1JUFB 3VI4A 4DAGH 3RI5K 3TESA 1E4JA 2UVFA 3N1QC 3LHZA 4X4ZA 3VIIA 4UOJA 1ZBCA 1QPXA 2WJZA 4KK5D 4Z2HA 2HH0H 4URTB 4HZMA 3UGRA 4QX4A 3TDFA 1ILUA 2J47A 3X17A 1TVLA 2IKGA 3OJ2C 1G7PB 4N86A 4KDVA 1B6UA 4I9AA 4PL2A 1EAQA 3HI6H 2HS6A 2OMZB 3W7QA 1YW1A 2WLJA 4RNRA 3QFJB 1QLFB 3MBEB 5B22A 4L4TA 3F1QA 3NCOA 4WSKA 4FXKA 5E94B 2BOFX 2E47A 5EBAA 2JNZA 3DIDA 1N7ML 1CGWA 2Y5JA 3IJIA 4C4UA 3CQKA 4EE9A 4M81A 4MLJA 1JWUA 1XGUB 3LXUX 1CLCA 1SR9A 3IJ7A 5TIMA 1X1ZA 4LEBA 1B4KA 1FL6A 1G6RL 1JPGB 5BRZA 4U1HA 3SBQA 4KRPB 3WLMA 1Y0LB 4O00A 1VFBB 2HDJA 3CHQA 3OKOA 1WS8A 3NZ8B 3QT2A 4UINL 1KEGL 4NAMA 4XP5H 1ZT4B 1UMYA 4LRTA 5BZDA 5K9KB 2XTJC 2QVHA 4JQVC 5EOTB 3B83A 1S9XB 4YHMH 2C91A 1TVBB 2NLJA 3QVQA 3IGXA 1FP5A 4P2RE 2X4UA 3Q48A 5IREA 3QFWA 5CKSA 4OZIF 1H7WA 3L9CA 5AOUA 4KXCA 1XGRA 4UB0L 2O7SA 3HC4L 4RNHA 1CLYL 4WEBL 4OKVB 2G9KA 4XAZA 1SSGA 4FOUA 2IOIA 4FXKC 4GMSL 4LQ1A 1IGML 4X8JA 1S2TA 2BSCA 1SFTA 2BGNE 2EPHA 1S7UB 1W8EA 4X0KB 2WWMC 1X9RA 3PLYA 3U4KA 6PAZA 2YMOA 1K6QH 3C2SA 1AGDB 3O9WD 1LLWA 3L67A 4FXTA 5FSDC 6TAAA 3IETA 1VJIA 3ONCA 5D4IA 1S7QA 3CQHA 2Q8LA 4APXB 4DN3H 2WGXA 1TQWA 3ISYA 5DLML 3GSXB 3PWAA 1X7QB 1MQPA 4OQTL 3WTYA 3T6CA 1P4BH 5JVLA 4KV5F 2BBFA 3VC5A 2QFPA 1G43A 3BUVA 1KLZA 4OIAA 2CETA 3WBXA 4OIIL 2IQTA 2E6YA 4G6JL 4R5XA 3S36H 3A9BA 4N0UA 2VQTA 1BFTA 4FKKA 1NFBA 1FZJB 5JXEC 3PIQB 4LMQE 3R11A 4WFFE 5I15L 3HGJA 3UJIL 4W7UA 5CINH 3B8YA 3LRSB 4UZSA 2AQ1A 3DYOA 2CO6B 4X5QA 3T4AB 3CZEA 5C0NC 1BJMA 2ADIA 1O12A 1R46A 1A7OL 2OK0H 2XY2A 3QV6A 4HSNA 4G2AA 2ZE0A 4POUB 3C2EA 2VUYA 3PXJA 2XBDA 3KXFD 4H8WC 3STLA 1U8CB 2HRPH 4ZMYA 3O45A 3BJSA 4UQ3A 1Y07A 1OAZH 5A1AA 5MP6L 1PGRB 5IROC 1A9BA 1GW0A 3F2DA 2YAPA 2PCQA 4DWSB 1ZA6A 3O4LE 4PCYA 5DT5A 4ZTXA 3TTYA 3UADA 3ZR4A 3DV4B 4E6MA 1YIXA 4QAWA 3V5DB 1CQKA 1AYRA 2LE9A 2V7HA 3N4FA 1BM7A 1K03A 2ZA3A 3GB7A 1BYNA 4LBSA 4J7RA 2XTLA 5HQMA 2F9BT 4IJBA 1UQSB 2ZFAA 1VER