3BLPX

Role of aromatic residues in human salivary alpha-amylase
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
496
structure length
496
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRARQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-function relationships in human salivary alpha-amylase: role of aromatic residues in a secondary binding site
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-amylase 1
total genus 176
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00128 Alpha-amylase Alpha amylase, catalytic domain
X PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3blpX02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3blpX01
3T0BA 3AIVA 3GM8A 1JL8A 5GNZA 1G01A 5M17A 1H0GA 2XN1A 3ZT5A 4ZENA 2GUYA 2JF6A 4DWSB 4L4OA 2CESA 3D50A 2ZXQA 1ISZA 1PBGA 3MUY1 1LG1A 2F7RA 4D6IA 3TOPA 3VINA 2WZEA 3WD2A 4KH2A 3L4VA 3GXMA 4H8UA 3K46A 2ZWYA 4HOXA 3WDIA 1ISXA 2JFEX 3AMKA 2XVPA 1J9YA 4OJYA 1O7AA 2XN0A 3WMCA 3VPLA 3W4RA 1KXHA 1R7AA 1SZNA 1PZ3A 1VAHA 3AIBA 5BRPA 4LYPA 1X1NA 4J3TA 3W81A 3VNZA 3PZQA 2IXVA 3OGVA 4DWSC 2F1BA 4M29A 3KWXA 1MQQA 2VURA 4WF7A 2V5CA 1UKPA 3VNYA 5CSYA 1JF6A 4AZ5A 2VZVA 3K8KA 3LPFA 1BG4A 1J0HA 1JIBA 1ZL1A 4HU0A 5CG0A 1D3CA 3VD4A 1E6PA 3WEZA 4CKQA 2UWFA 3BLBA 4H04A 4QP0A 5IXEA 1JZ8A 4GKLA 4U2ZA 2YDRA 3ZQ9A 3N11A 4C7GA 2OWXA 3CUHA 2DH2A 1W1TA 2WYSA 5LA0A 2G3MA 3NSXA 4J3VA 3O6AA 2FHBA 1EOMA 3AI0A 3U5UA 4L4PA 2W62A 1V3MA 1E6RA 1E1EA 3II1A 4ATWA 3LXBA 4PMDA 3WY3A 1EDGA 3PZMA 3K4DA 3JUGA 3CZKA 4PTXA 1NWUA 2VJXA 3ZO9A 3UETA 1LL7A 1RH9A 1HL8A 3ARTA 3WDJA 5JBFA 2CHOA 3WD3A 2FHFA 3AIUA 4IM4A 4JFUA 1KWGA 3WF0A 2D0HA 5FCZA 1GHSA 1HJXA 1Q6DA 3APGA 2J79A 2OSYA 2WMKA 3W27A 3VIHA 2YL5A 4LPCA 2CBIA 4BA0A 4CGTA 2FE0A 4V2XA 1VFMA 5DO8A 2WHJA 1HX0A 5BXTA 5CJ5A 4W7WA 2WMIB 2DIJA 3K4AA 1QVBA 3GBDA 3VIPA 1LWJA 4F9DA 4D71A 4JFVA 3OLIA 1GVIA 2XN2A 3SUSA 5D8ZA 2W66A 2CBVA 3GNPA 1N82A 5FOOA 3WDQA 2VX4A 3LPGA 3TV8A 1UWUA 3ZR5A 2D23A 4P8WA 3QOMA 3WDHA 4AXNA 1J0IA 2PBGA 4UFMA 1EQPA 5CGTA 4AZHA 4CN4A 1BLIA 2Y8VA 3POCA 2EBNA 4TX8A 3K8LA 4AD2A 1FP9A 4GI6A 1JNDA 4KGJA 1E56A 1BYAA 1VJZA 2D0GA 3EDJA 7TAAA 4AD4A 4Z2HA 5I79A 1FFQA 1HKIA 1FHDA 1EXPA 1E4IA 1HN1A 3I3BA 4CD7A 1ZBCA 2VCAA 1CXEA 4AZCB 3ECQA 5IFTA 1GJWA 3NIYA 1KXTA 1QWUA 3A4AA 4PCSA 3B8SA 3W29A 1XH0A 1OGGA 3ARSA 3GH5A 1CWYA 2XFRA 2V38A 1H09A 4CU7A 1TQVA 2QMJA 2YDSA 4D72A 2OSWA 4CU8A 1CGYA 5HBFA 3W0KA 3OGSA 1UR1A 3S5ZA 1M04A 3AZTA 5GNYA 2WZIA 4MPKA 3VM5A 1M01A 1W1PA 1VEOA 1B1YA 1PAMA 1NWTA 2W63A 5A8PA 1US3A 4AZBA 5ABEA 1J18A 3W82A 2GK1A 4UQDA 3WN6A 1WDQA 1W1YA 3MV11 4AYGA 4Z2KA 4U3AA 5GQBA 5A8NA 3LXAA 4GI8A 1HJWA 3S2CA 5CQ1A 3NCOA 1EOKA 3SEPA 1ZJBA 2C8NA 2F18A 1BG9A 2OWCA 4B9ZA 3AHYA 3U5YA 2XFFA 3HU7A 4HZ6A 1JZ3A 5DT7A 3F5LA 1ZBWA 3BAKA 3GYCA 1O7DC 2F7PA 2UY2A 1X6LA 3WY1A 2EPNA 4EAMA 4UQBA 4E2OA 1TVPA 1VFUA 4CD4A 1HJQA 4NZCA 1KB3A 5I3DA 1IV8A 5CZKA 3AMGA 4FNUA 1A3HA 2J75A 4JFSA 1TR1A 2J7FA 5A6AA 1OM0A 3A3HA 1GUVA 5I24A 2WMGA 3LRKA 1MW3A 3QHOA 1DWFM 2ZX5A 1QI2A 3LXCA 2CBUA 4CCEA 4CD5A 4X9YA 1V6UA 1UR2A 1CEOA 1CGXA 2CERA 2Y24A 5JIPA 2D3LA 1WDSA 1LLOA 1KFWA 5I77A 4XX6A 1WCGA 2A3EA 4PCTA 1CXLA 5JUVA 1QNPA 3WQ6A 4CD6A 3NSNA 4GPNA 2DSVA 3NSMA 1KR0A 2BFGA 2OYMA 3ALFA 5EFFA 1EDTA 1C8XA 4IPNB 3WFZA 1UWIA 3WF3A 2VOTA 4UFJA 2DDXA 2ZUSA 3L2LA 1WNOA 1QPKA 4YN5A 3ARVA 1MW0A 2IXUA 3QHNA 3EJTA 2X8RA 3HG2A 2VRJA 4DO5A 2BVYA 3T2OA 4ZEPA 1V0MA 4MAVA 4TTUA 4EK7A 1R33A 3WH8A 5DT5A 2CXGA 1NQ6A 1K6AA 3TA9A 4FNPA 1GOKA 1PJ9A 4FNTA 1H41A 5D4YA 3ZSSA 1OT1A 4NSBA 1C7TA 1KBBA 2XYLA 3UEQA 1MXDA 3VVGA 1B3WA 3BSHA 1E5NA 1KGWA 1UH2A 3N12A 1BFNA 3AS0A 4PRWA 4AW7A 1OINA 3KL5A 1OIMA 2MANA 4JCLA 3O2LA 1CXKA 3PZOA 2EACA 1LF1A 1ISWA 4HPGA 1EIBA 5BCAA 3SCSA 2QF8A 1J0YA 3CUIA 1CYGA 1OGSA 1B9ZA 4FK9A 1JI2A 3CMJA 3PZVA 1R47A 3CUGA 1KQZA 2Y4SA 4Q7NA 2BY0A 5FL1A 3HG5A 1KXQA 1TUXA 5A6JA 2WVUA 1V3JA 2YLAA 1NP2A 3TP4A 3EYPA 1VF8A 2DT3A 4M56A 1M53A 1C7SA 2A3BA 1JDDA 3CO4A 2J4GA 2FDMA 2E9BA 1JDCA 2ZX6A 4AZ7A 3MS8A 3EJRA 1LWHA 2DIEA 2XIIA 3BMVA 3SUTA 1SMDA 5I23A 3N17A 1VBRA 2EPKX 1QBBA 1ZJAA 1VIWA 3AYRA 1XSKA 1JF5A 4JKLA 3KLLA 4Y7EA 1KTCA 5A6MA 4ZFMA 2IGTA 1QI4A 4UZUA 4W85A 4PSPA 3VIFA 4OOUA 3AHTA 3WQ8A 3VGDA 3UERA 1HP5A 4XZWA 8CGTA 3TTQA 3OZPA 4FF5A 2D2OA 2WCGA 1CENA 1JFXA 2JF7A 2FGLA 2WVTA 3MSGA 3IJ7A 2WANA 4JKMA 1HL9A 3OIHA 4GIAA 1TVNA 3EJPA 3BUDA 1F4AA 5HPOA 2Z1SA 3CZLA 3EMQA 5E6YA 1TE1A 3BVVA 3DDFA 3VSVA 1DWIM 2DSKA 3RJXA 1W32A 1SR0A 1F4HA 3ARXA 1R34A 1JD7A 2F2HA 3WF4A 1TQSA 4GZJA 3ZOAA 1LL6A 4M82A 3WF1A 3A4WA 1UYQA 3CUJA 1B3ZA 3VGEA 3VD9A 1XC6A 1R86A 2CETA 4V28A 3PTKA 4M1RA 1I75A 4MNKA 1BVZA 3BAXA 3KL3A 1W9DM 2VC9A 2DSUA 4P7OA 1CXIA 1E9LA 1EA9C 1K9TA 1AMYA 3OLGA 2WLZA 3AXXA 2VX5A 1X6NA 1FP8A 1J0JA 4E8DA 3ARUA 2JIEA 4V27A 4HA4A 3D4YA 4CCCA 1CLVA 2WMFA 1W9VA 2O92A 3WIJA 3H55A 3DHUA 4RE4A 4KRUA 1NWSA 4Z2GA 3BAJA 1ZBVA 1FOBA 1Q6CA 3BGAA 4H8VA 1LL4A 2Q8XA 4F66A 3W38A 5DFAA 3UG3A 1MQRA 3GXIA 2VL4A 3AZSA 4MB4A 5FIPA 1G0CA 3PZUA 4AISA 4KRTA 4NRSA 1Z32X 3HJEA 5I2UA 1LG2A 4WLCA 2WCAA 2G3NA 5A2AA 1E72M 1L8NA 2NT1A 5HOSA 3KZSA 3ARYA 3AMDA 5KEZA 2G3IA 4LXFA 3AXHA 3IJ8A 1S46A 1W1VA 2GJPA 2DT2A 1QNOA 1MWOA 4GQQA 4A3YA 1E3ZA 4HOZA 4UOQA 1I1WA 2HISA 3WBEA 4AZGA 1PS3A 6A3HA 3SCPA 3BCDA 1GOMA 2VX6A 1JZ4A 2CIPA 2WWCA 1CXFA 3ZSTA 2CBJA 3D5HA 1OB0A 4NXKA 3PHAA 3PZGA 3DYMA 1ZB5A 1HVQA 1DTUA 3GZAA 4P8VA 3A21A 1B3XA 5EFDA 1R75A 1TCMA 3EDFA 3QGVA 3L4YA 3WH6A 4W89A 2JEQA 5A6KA 3AMCA 4GO8A 4J3UA 2NSXA 2GFTA 2XM2A 3WQWA 1IT0A 4DUVA 2QV4A 2Y8KA 2QPUA 3DYOA 3GXTA 3RIKA 4NF7A 1UG6A 1J10A 4ATLA 5DEZA 1DWJM 1DWGM 3WFLA 3K8MA 2EEXA 1QHZA 5E09A 3WEOA 1BYCA 4PN2A 3GXNA 2E40A 1E6ZA 4XZBA 3OB8A 1YQ2A 5ABFB 1V0NA 5FD0A 4Z2LA 1NOWA 1VFOA 3EMCA 1H49A 4AMWA 1EO7A 2EAEA 3CBWA 1AQHA 3ZT7A 2WVSA 1OSEA 3FY1A 3CPUA 4OKDA 1K9FA 4DO4A 1E0WA 1Q6GA 1PIFA 1HP4A 4H2CA 2X0HA 5D8WA 1OD8A 3WNMA 2X2YA 1UUQA 4MJ4A 2CHNA 5HPCA 1UHVA 4UFLA 2WMHA 2CEQA 1GQLA 1K9DA 3BAYA 5DF0A 4BS0A 1CZ1A 1MW1A 1VEMA 2GK1B 1E71M 2F7OA 2XSAA 1UKQA 1QBAA 2WAGA 2WCSA 1U30A 3RMEA 4NX0A 2V3DA 3AS1A 2GSJA 4U5KA 4GINA 4RE3A 4WKFA 4QFUA 1JXJA 3VUPA 4J3XA 4QDMA 4W84A 1U33A 3F4VA 4FLRA 1OD0A 1GOWA 3VMPA 5C8BB 1K9EA 4AD1A 3BAWA 5LYRA 3D52A 5A8MA 4FLQA 2BXZA 1HT6A 1M7XA 3OBAA 3VO0A 1GQIA 1KBKA 3WH5A 3W24A 1US2A 2JEPA 3OGRA 1UWTA 5E6ZA 1JXKA 4FMVA 3ALGA 3BLPX 1FH9A 3NUKA 1EQCA 5ECUA 3VX0A 1Y7VA 4JKKA 2OYLA 1WP6A 3ARWA 2WSKA 3WUGA 5BYWA 4W7UA 1H2JA 4HOWA 1VENA 2ZX7A 2J8GA 3SCOA 1DWHM 4UFIA 3GBEA 2VCCA 1BYDA 1UR4A 3RDKA 1QW9A 4GI9A 4PMUA 3RM8A 2VZTA 4IUGA 1GHRA 1UD3A 3CTTA 1UWSA 2YL9A 3IJ9A 4TXEA 2WC3A 3IANA 1CXHA 3GTNA 2YA0A 3PTMA 4GXPA 2Z1KA 3PN8A 1SFSA 1WB0A 4B3LA 1G5AA 4WKAA 1H5VA 2J8FA 1CGWA 4UOJA 2VR5A 2WZHA 3DX3A 2E0PA 4OOZA 3ZJ6A 2X1IA 2BVTA 2DGAA 3AXIA 2PWEA 2VQTA 1V3HA 2DSWA 2PC8A 3IAQA 5D9PA 4GO9A 1UKSA 2OSXA 1H4PA 3WNOA 1W2PA 4JHOA 3VDBA 4ACYA 4HMEA 2ESCA 1GJUA 3RO8A 4QAWA 5AC5A 4H8HA 2VI0A 3SCQA 4AWEA 5E9AA 3BVXA 1MFUA 2DT1A 4OZOA 1I1XA 2XHYA 4B16A 2GDVA 1ESWA 3CHFA 3ARRA 4GZEA 3NJ3A 1BF2A 4U33A 2G8ZA 4JHZA 4UOZA 1V3LA 2XVGA 3PBGA 2F7QA 3DDGA 6CGTA 2DT0A 4MDPA 3MV01 1J01A 3M6DA 2DSZA 3CZSA 2BY1A 1R46A 3EDKA 1XH2A 1HXJA 2YBUA 2GJXA 4ML4A 2V3FA 4EANA 1W3HA 2XM1A 4AIUA 1CECA 5A6SA 1CLXA 5CLWA 5BROA 1WDRA 2Y2WA 1PPIA 2WMIA 3SCRA 2RGLA 1E3XA 3VD7A 4J7RA 1MQPA 4M8UA 4P8UA 1UH4A 3BCFA 3VGGA 2XPKA 3WENA 1J11A 4B3KA 4HZ7A 2O9OA 2WSPA 3KEHA 1E6QM 1W3JA 1BGAA 4CD8A 3SCNA 1SYTA 1PIGA 1HKKA 1OGBA 3AICA 3WKZA 3CZJA 1HF6A 1EO5A 1DHKA 5CLTA 4F79A 5GPRA 4DM1A 4BQ2A 4Z2IA 1UA3A 1NM9A 3W6MA 1CGVA 2ZWZA 3ARZA 4PUDA 4A3HA 4YHGA 4URIA 1QOXA 3AIRA 4EKJA 1VEPA 4R27A 1P6WA 3ZJ8A 3E1F1 1QNRA 4UQ9A 1YHTA 2XGBA 1JAEA 3S6TA 5CSUA 5DMYA 2O9PA 3AFBA 3GH7A 4DWSD 4UR9A 4MADA 2D22A 1V3IA 3WNNA 4FNQA 2B31A 1GOIA 3BAIA 3L4XA 1GNXA 3CGTA 1ITXA 1WDPA 4LYRA 4WSJA 2WHLA 2XVKA 3VU2A 4ZE4A 3BC9A 3S5YA 3WY4A 4HU8A 2YDQA 1FA2A 1KCKA 2UY4A 1QW8A 2PWHA 3WBAA 3W37A 3VIKA 4MNJA 1E5JA 2FGZA 3EDDA 3PTQA 3WD1A 1UOKA 4AY1A 3BSGA 2ZUMA 3SIMA 4KGLA 2W5FA 3WQ4A 3POHA 5IFPA 1W9UA 1QNSA 4AIOA 5A1AA 1UD4A 4GZIA 1QX1A 1QHPA 1R87A 1E6XM 5E0CA 3VIJA 4BQ3A 4D6JA 3VDAA 2PI6A 4WSKA 4N0RA 5BXRA 1XCXA 2VVSA 2FYVA 2BV9A 1ODUA 1V6VA 3VMOA 1NP0A 3RJYA 3VDHA 4UCFA 2CKSA 4JFTA 2BHYA 4AIEA 4W87A 5C71A 1SMAA 1QI0A 5HDRA 3VOCA 1WZAA 3AISA 3GDBA 2X0YA 2VX7A 5JBEA 1E4MM 3L4ZA 4W86A 2NW0A 1H11A 2V3GA 4PMRA 4UNIA 4Z2JA 3L4WA 1G94A 1M03A 3HG3A 3WL0A 1WE5A 3TTYA 3WH9A 5BXSA 1HTYA 2W67A 5CPSA 1WKYA 4PBGA 4CN6A 1UR9A 3VILA 3UR8A 1ISVA 4HA1A 7CGTA 1CTNA 4J3WA 2PWFA 2VTFA 5EBAA 5A94A 2UY5A 2WMJA 1C8QA 1BPLB 2ZXDA 4PEEA 2WWDA 2X09A 1UD2A 1DEDA 1E6SM 3B9DA 2VRKA 2EO7A 1V6XA 3BLKA 1JG9A 4PTWA 1MW2A 3RM9A 4BF7A 2VNCA 5HXMA 2YIHA 5A95A 2J77A 7A3HA 4B9YA 1RP8A 4LQ1A 3U7BA 1E73M 3MSDA 3J7HA 1WAWA 3M07A 4DUWA 4M81A 3VIOA 1QHOA 2YFNA 1UD8A 1JZ5A 1PX4A 2XVNA 4AD5A 3BUQA 3WL1A 3OLEA 2GJRA 2YA2A 3FW6A 4D6FA 1C3FA 3AMLA 1EH9A 5ABHA 3UESA 2GDUA 3W25A 4LYQA 5E1QA 4KWUA 3O9NA 5AC4A 2PB1A 2XWEA 2C7FA 3K1DA 3EBVA 3RILA 1W3KA 1KQYA 1UKOA 1QNQA 4AEFA 3HZ3A 4HTYA 4HPHA 1BVNP 4DO6A 2XJ7A 8A3HA 1KXVA 2OYKA 4TUFA 2JE8A 3G6MA 2YL6A 2BNJA 2GVYA 4PYSA 3WH7A 3MU7A 1EHNA 2VZSA 1VRXA 1W3LA 1J0KA 2XWDA 1W91A 2X2HA 4QCEA 3VDCA 1MXGA 3EJSA 2XFYA 2ZUNA 2DQXA 2D3NA 2YLLA 4U3CA 4FNRA 4PTMA 1WZKA 2QLYA 3U57A 3FXYA 1OIFA 1VFFA 2YBTA 2O9TA 2J47A 2G4FA 1E0VA 5F7UA 3W6LA 1PEZA 5CPQA 4ATDA 4GQRA 3H54A 4IISA 4ZE5A 5IDIA 4DWSA 4UQAA 3N13A 5A69A 2XGIA 4W88A 1FH8A 4NI3A 3CHCA 4YPJA 4H7VA 5CXPA 2WLYA 4PMZA 4ZXOA 3WD4A 4BQ4A 1W9XA 1KGUA 2E8ZA 3ARPA 5A3HA 3T09A 1G9HA 1BHGA 2VVNA 3N1AA 4HMCA 4YHEA 1MFVA 1NOUA 1UQYA 2X05A 4TX6A 2VUYA 1XD1A 3CC1A 4RL3A 5ABGA 1UASA 1B3VA 4AD0A 1CPUA 2ZXBA 1OCQA 1XYFA 1FHLA 3FN9A 4E4PA 1HJSA 4ZXLA 2D0FA 4JAWA 3PZ9A 5D9NA 1JGIA 2J25A 2QPSA 3MI6A 4NZJA 1GW1A 3VIIA 1PX8A 3LMYA 3DHPA 3OA5A 1Q6EA 3OZOA 3GXFA 2W61A 3T2QA 3WEMA 2J7EA 1WZLA 1VBUA 3A6OA 6TAAA 1XSJA 3BVWA 2QHAA 3CH9A 2WKGA 1PZ2A 2OW7A 4J28A 3ZM8A 4MB1A 1TFVA 3KLKA 2EABA 1UQZA 3OLDA 1ZBKA 2ALWA 3TTOA 2YJQA 2TAAA 2XG9A 1CNVA 5AYBA 4TVUA 2WC7A 9CGTA 5CPTA 4AZIA 2ZOXA 3AHZA 1KWKA 4P8XA 3MMUA 1HVXA 4U2YA 2ZIDA 1JYWA 1QI5A 1AVAA 1UH3A 1E1FA 1R7OA 2DPEA 4PUEA 1V6YA 5M03A 1GZJA 4D1JA 2BVDA 1BGGA 5A2CA 1BAGA 1BQCA 1W9PA 3AHVA 4JZ5A 2FH8A 3AIQA 2J7CA 2J7HA 1JZ7A 3VM7A 3BUIA 2VT0A 4UZSA 3N9KA 2PBOA 3WY2A 1UZ1A 1JDAA 1JYXA 1UKTA 1EDQA 2E8YA 2PF0A 1ZU8A 2OW6A 2A3AA 3BVTA 3MMWA 4PMNA 2J7BA 1EHAA 2WXDM 1TQTA 3WUFA 2WHKA 4BCEA 1XYZA 1XHGA 1TQUA 2EPOA 3FHAA 3MKKA 1E0XA 4IPLA 3WMBA 1KGXA 2WM0A 5JBDA 5LA2A 1TQWA 1XH1A 3ARQA 4CVUA 3WNKA 2WK2A 1R85A 1ZS2A 4AZ6A 5ABFA 1JYVA 4QLLA 4P7RA 3CZ8A 1UZ4A 4MNLA 2ZX9A 1GONA 2WC4A 2XUCA 4JIEA 1XGZA 3L4TA 3KE0A 1CGTA 1OT2A 2X2IA 2VMFA 3DX1A 1CDGA 2OWWA 5JIWA 3VSUA 3F5KA 4XUYA 1AQMA 4PMOA 1J12A 5I5RA 1Q6FA 4AEEA 5D9MA 3ZIZA 3RPMA 2X2JA 1GQJA 2OLHA 2JIWA 1H1NA 3I3EA 3WF2A 1E43A 1CGUA 4P7NA 3TTSA 1HIZA 4MAZA 2VZUA 2YOCA 2G3JA 1QWNA 3N04A 1C93A 4OIFA 2A3CA 2J78A 5IHRA 5CGMA 5A6LA 1E55A 3AIEA 2AOSA 4MJ2A 4W8AA 2EJ1A 3G6LA 2YFOA 3VD3A 2ZUUA 1DP0A 3AYSA 4R5EA 3EMZA 1J0ZA 2WW5A 3NDYA 4LGXA 1RPKA 2PWGA 1C90A 3F5JA 1LQ0A 1D2KA 2D1ZA 4OBRA 3HN3A 3A4XA 4PMQA 3VSTA 3VGBA 2AAAA 3U7VA 2CPUA 3VGFA 3TONA 2CITA 4X0NA 5IHSA 2VCBA 3WMSA 1G1YA 3QR3A 2D73A 3WUBA 5D9OA 2ZUTA 4PMYA 2F1AA 4JFWA 3T2PA 3AZRA 4WJXA 4LX4A 4NRRA 2XVLA 2XSBA 3BUBA 1W2VA 1ODZA 3QOKA 3BH4A 3CHDA 2XIBA 1ECEA 3THCA 1NARA 4KMQA 5A2BA 4DM2A 4C7DA 1IZKA 1V02A 3VGHA 3NDZA 2CNCA 4CCDA 1GPFA 2BY3A 3IGUA 2UY3A 2WHMA 3EJQA 4D6DA 5I6SA 3MUIA 2E4TA 2BHZA 3W53A 1IZJA 1LJYA 3VIGA 4M24A 2FH6A 4OBSA 4W93A 1HWWA 3D51A 3A47A 3EDEA 5I78A 3DX2A 2WKLA 3RCNA 3SCUA 4JL2A 1FH7A 1MYRA 2E9LA 3NYDA 3IAPA 4NXSA 1RP9A 3VIMA 2BY2A 3LPPA 4TOQA 1ISYA 1TMQA 1B90A 4HMDA 4J3SA 3LPOA 2F61A 1JAKA 3A5VA 4J27A 1V6WA 3A22A 3PZTA 3MANA 5AY7A 3DC0A 2YA1A 4HP5A 5EMYA 3FAXA 1GOQA 2O9RA 1MVYA 1XSIA 2AMGA 4U5IA 3H53A 4Q22A 3ZJKA 2Y5EA 2EPLX 2JALA 1XRVA 4HZ8A 1TG7A 4BQ5A 1QI3A 4P7QA 4AMXA 2C0HA 2XTKA 3UR7A 1WZMA 2CYGA 1E4NA 2CKRA 1E70M 1JI1A 3CUFA 2E3ZA 1VJSA 1JNEA 1E15A 1C8YA 2EXOA 5A8OA 1KCLA 4D6GA 4K68A 4N42A 3GXPA 5BWFA 3SURA 3FHQA 3PZIA 2WVVA 3EJUA 3CZGA 2EPMX 4U31A 2DEPA 1UWQA 3IK2A 4AZCA 2YL8A 1VB9A 2W91A 1Q4NX 4W8BA 1V3KA 4MNMA 1OWQA 2PWDA 1H3GA 3DX4A 3AQUA 1B3YA 4UQEA 4MTVA 4D6CA 4AYSA 3DYPA 1JFHA 3HMCA 4EE9A 1UWRA 2ZX8A 3N15A 4DUXA 3SUWA 3CZEA 5A6BD 3L4UA 2VR4A 1V0LA 1JZ2A 2EADA 5BRQA 4AC1X 3CHEA 3MO4A 3QHMA 4CU6A 3BVUA 3MUZ1 4D6EA 4PMVA 1JZ6A 1JYNA 3CIVA 3VD5A 1KTBA 1HKJA 4UQCA 3CMGA 5HNNA 1B31A 4UFHA 3GXDA 2ZUVA 1V0KA 2HVMA 4W5UA 1WPCA 1BTCA 4NZFA 3WSUA 4E8CA 2J62A 1AQ0A 2FHCA 4PMXA 1R8LA 1OBAA 2WVVB 1H0IA 3VTRA 4QLKA 3A23A 3AHXA 1HNYA 1ITCA 3WNPA 4OUEA 1UD6A 3OG2A 2WBGA 5M3WA 1GQKA 1UA7A 2ZICA 1E40A 2W4XA 2V5DA 4BZYA 3PZNA 3SUVA 1CIUA 3A24A 5KZ6A 1A47A 1L0PA 3VX1A 1DWAM 5FKYA 1NH6A 2DH3A 4A4AA 1W9BM 4M80A 4XV0A 3T0DA 3ZT6A 5FL0A 4FLOA 3CV5A 4UTFA 4MDOA 3AJ7A 5M5DA 3AOFA 1B0IA 3VMNA 1T0OA 1U2YA 1KR1A 5LA1A 1UR8A 4RE2A 1XCWA 4FNSA 4S3JA 3B9AA 4QCFA 4UFKA 4TVCA 4OGZA 1GVYA 4MB3A 3BMWA 2EQDA 4JL1A 2IUZA 4S3KA 4AD3A 1BSIA 3M7SA 2WBKA 3HG4A 4TTGA 1V08A 1UD5A 3D3AA 5EB8A 1TA3A 1V02E 4PTVA 1GORA 1EGZA 1B2YA 3ZMRA 4WK9A 3M46A 1TZ7A 3FAWA 2BXYA 3AS2A 1GOOA 3GH4A 5AYIA 2VRQA 3MMDA 4QLJA 1FFRA 2VO5A 3B9EA 1WO2A 1E4LA 2WB5A 4D1IA 3SCVA 3DECA 5A6BA 2J7GA 3VKKA 2W92A 4X0VA 5E70A 2VQUA 3W26A 3LX9A 4JCMA 3WQ5A 3WQVA 1B30A 1CBGA 3W28A 4TVDA 3T08A 1HJUA 3RM4A 4W7VA 4MB5A 1PX3A 4FLSA 2BHUA 4C7FA 3BXWA 4D6HA 3GNOA 4CUCA 3ZR6A 2ZXAA 2RGMA 1XD0A 4XB3A 4ACZA 1V03A 3CZNA 3WELA 3L2MA 1TA3B 4W5ZA 3WNLA 4P7LA 1NWRA 4CN1A 3ZJ7A 5C70A 3UCQA 2A3HA 2QMKA 1XV8A 3THDA 2CCRA 3KL0A 1E6NA 2WNWA 2E9MA 3SCTA 2D20A 2WPGA 5I0DA 2ZE0A 5A8QA 2ZUWA 2YKKA 3N18A 5TD4A 1RD6A 4HA3A 3FNDA 1HKMA 1C91A 2VZOA 2F8QA 4AMCA 5BXPA 3AROA 4F9JA 4PSRA 4F8XA 1BYBA 3BUPA 3UG4A 4WIWA 3I3DA 3AIWA 4W8LA 3GNRA 2GJXB 1HJVA 3D4ZA 3SUUA 3UG5A 5E0FA 3AS3A 4WKHA 3SCWA 4B15A 1GCYA 2NT0A 4CVWA 3MUAA 3WD0A 5GNXA 2D24A 3WUEA 3LRLA 3WDPP 3DX0A 3LRMA 3WDRA 4H41A 2G41A 3CLWA 2J74A 2J7DA 3T0AA 1C92A 2V3EA 1JD9A 2BS9A 1D7FA 1HXKA 1O6IA 1NOFA 4ACZB 1UR0A
chains in the Genus database with same CATH superfamily
4N6QA 3T0BA 1U58B 3N55A 3HG1B 1I85A 5GIRB 5J9PB 5ESAB 3EF7A 1O68A 5M17A 4P5RA 2EICA 3PF2A 1C5CL 2W8CA 4F2BA 2JQZA 5ISZE 3GSMA 3A4DA 3CX2A 3MRBA 3QMSA 1X44A 3L5XH 2WINA 3JR2A 4L4OA 4AEHL 5E95B 1XMWA 3VWKB 1O9VA 2ODOA 4XMKL 5C9WA 4XE0A 2JJVA 1J8HE 4Z8FH 1UYWL 3TOPA 3BJ91 3L3DA 4NNXB 3QG7L 3TZNA 5L4JA 2CZVA 1HH6B 2DP3A 3DLQR 1MJJB 5E8NA 3DO4A 2X1UA 1JRHL 4Z7OF 3DGGA 4BCXA 3UY8A 2EXSA 1DVQA 1J5DA 4X4YA 2HEJA 3R43A 4WVRA 3AQZA 4Z1BA 4HBKA 3QJAA 3SDCB 1XLCA 4Z3HA 3H2NA 1JPEA 5FYJH 5BQ7B 1KXHA 4P9HL 2CLVB 1V6TA 3M7FB 4WCYL 1WZ1L 1KCUH 1PZ3A 4IRSC 2NCEA 4P2OC 3UTTA 4DZAA 3AIBA 5BRPA 1WYJA 4LYPA 2YPVA 2GEEA 3RU8H 2O5XH 3ZKNC 4I88A 5ID0A 1Q45A 4LL4A 1W3IA 4S1DD 1X1NA 4UDTA 2YSWA 3WDRA 1OZTG 4TNGA 3PZQA 3F7QA 3FB6B 1T22A 4GSDH 1E9QB 3OKMA 1PWMA 3T0TA 3VFUB 5IW6A 3LD5A 4KEZA 3TJLA 2G9HB 3PSWA 1RIUH 3FF7A 5LUMA 3EGDA 2XQYG 4M29A 3KWXA 4H8PA 1MQQA 1XXXA 2WXIA 1IC7H 3MOQA 1UKPA 3G5EA 1DVUA 2O55A 3WAJA 4HNLA 5C0GA 3V5HB 3QUZB 43C9A 4IOTA 2VZVA 4OLVL 3P4NB 3FB8A 4FXTA 3CZUB 5IREA 3SGJA 1DBKH 2XZQL 1JIBA 5MP6L 4HU0A 4JOMA 1JFQH 2QVKA 1DL7H 1IIKA 3H6AA 4NHCH 1Z5LB 3QAZB 5LCVH 3H56A 3E80A 1IFGA 3OB0H 4YSEA 5KSBA 2Q01A 2UWFA 4F7KA 3D0CA 1PL3A 4N68A 2VEFA 4QP0A 1WK0A 5AW4B 1JZ8A 3PBVA 3UZVB 1A7PL 4GKLA 4X5XA 1XLGA 1DQTA 4U2ZA 4DP4X 1P4UA 5DUBA 5FO8B 3UZXA 5I73C 4TNVK 3ZQ9A 5C0DA 2YDRA 3LV5A 1OYBA 4HFUL 3C5QA 1BAFL 5I1DA 4M7JH 5C9UA 4YL2A 2C4FT 1TR7A 4YIQB 3H42L 2WYSA 3D7PA 3IE9A 4XHJD 3NSXA 1KPUB 1OFAA 1LMKA 1W5OA 1OARL 3P69A 1NF7A 2FBRA 3I74A 4NP9A 4WHCA 3AI0A 4KK8D 3SGZA 3U5UA 1V3MA 1N64H 1YMMB 1GW0A 3II1A 3LXBA 1SW7A 2NXIA 4YXHL 3WY3A 4HCHA 4JTFA 3BG3A 3NSFA 4MDJA 3AWGA 1EDGA 4I6VA 3PZMA 3MUCA 3QCUL 2FWOA 1NWUA 4NGHL 2DAVA 1TETL 4F7TA 3CXFA 1UZ8A 4UOW0 1RH9A 3GMLA 4N0YH 3BLFA 3HS0C 1HL2A 1N59A 5JBFA 4PRHE 3MRKA 5D93B 4DBEA 5FB8B 1XW8A 3O8XA 5K9KB 1N2VA 4P4RB 3R6IA 3MO1A 5F1UA 3VNKA 1UUSA 3D3VA 4CA4A 1ZSDB 3AIUA 2PETA 1IAKB 2Q8BL 1DIEA 3CDZB 1I3GL 2ICWJ 1CCWB 2BSEA 2R2EA 3EF4A 3RWGB 5LGYA 4QLRA 1HJXA 2D3JA 1Q6DA 2OSYA 2WMKA 4OLWH 3WFEH 3UWZA 4HEMA 4MX7A 5SX4H 2IG2H 4QEHA 4V2XA 3RA7H 5E4AA 3DX5A 3DVFA 4NBYB 1VFMA 4B9FA 1JHLH 2OEJA 4MNGE 4HWBH 4IP5A 3G77A 1KC7A 5CZSA 3BD3A 3SDCD 3HO8A 2PMQA 2P5WE 1SGJA 4W7WA 1X7QA 3TH3T 1A5FH 2WMIB 3MVTA 4UTHA 5DU7A 2OO0A 2FB3A 1FYHB 3KPNB 1U93A 4L1HA 4X98B 4UIMA 3ITOA 4X4ME 1RZPA 3GRWA 3I02B 2DQJH 2DRUA 3GYRA 4ONHB 3S6CA 1S7VB 3CYVA 2J44A 3GDKA 5DXYA 3SUSA 3O3BB 4UZGA 4LGSB 4Y90A 4LSTH 4QXGL 1V7ML 4KQ3L 4WR3A 3MLUH 1U0QA 1N82A 1YG9A 1BVLB 3C2RA 1YNTF 2VX4A 1SYSB 3LPGA 1HWHB 3T2NL 3PM6A 5BVJB 3TV8A 1JPGB 4Q6YA 3AREC 2D23A 4JFPA 1BZ7A 5DT1H 3KGTA 3SQBB 1SJHA 3RFZA 2FVKA 5IB3A 3JRKA 4FQXB 4FX5A 1U3HD 5G5DA 5CBBA 3KRUA 2CO6A 4ZZKA 4Y5XA 2PBGA 1KTLB 5F1IB 3TYDA 2XG5A 1KF9B 4YPGB 1EQPA 5CGTA 1TPDA 4PP1C 1X39A 2V2DA 4CN4A 1BLIA 2WO4A 3F2BA 5K1JA 5H37H 1VFAB 3POCA 3E0VA 3RGVA 2J9ZA 3UADA 3Q5YA 4CC4C 1LUCB 1XYBA 4JTRA 2R56L 4HCIA 1C16B 3K8LA 3KJ4C 3ZIMA 2CWNA 3QFDB 4K5NA 1SJEA 5ITFB 2MPAL 4JFQA 3W1TA 3MKGA 4UTCA 4GXVH 1JGLL 3X3FH 4EN2A 5KVFL 1LE5A 4DBWA 4GK8A 2ZG2A 5DD1L 3QJHB 1ZLWH 3SDXA 2YW3A 4EI5B 1Z6JT 1VJZA 2GJLA 1I8MB 3KM8A 3JWDH 1BAFH 1SUHA 3D3VB 3JWDC 3MUGB 3MJ7A 4XN2A 1KJ3L 4RZ4A 5C9KA 4AMKH 1T4WA 1WAPA 2Z64C 5AOMA 4H9ZA 1EB3A 5D4YA 1DJZA 2VLMD 1EXPA 3W1PA 4BF5A 5JR1H 5F1OB 1HN1A 3I3BA 1YNPA 2ACQA 2HT4C 1ZBCA 2VCAA 3O0KA 4G1KA 4YL4A 3HNVL 4EVNB 1T96A 3WS6A 5CJQH 4FN0A 1GZQB 3ENEA 4NKMB 4MZRA 2Z8SA 3D2UA 3A4AA 4TSCL 3TJHD 3ZK0A 3VFTB 1KV5A 4N2KA 4N8PA 1X9LA 3B8SA 4YSDA 1ML1A 1XH0A 3TUUA 4RDZA 3V7AG 4GUCA 3QUHA 5AOZA 1TJ2A 1EYEA 3GH5A 1CWYA 4I6KA 2WXPA 1H09A 4CU7A 1TQVA 1E3FA 3F12A 2DV6A 4L8BB 1LO0L 3BP4B 4L37A 3WFDH 3DVIA 1JDEA 5B7YA 2D7TH 4QHPA 3B9KC 5CZXC 1A5CA 2YUVA 5C97A 3GG7A 3LDBB 1HUVA 3C86A 4C4UA 3UJRA 2FZMA 3WIAA 3UGRA 2B81A 2PTXA 1MDLA 2CUIA 3RNKA 4YMPA 2BXVA 1UR1A 3W0KA 4AX3A 1AKJD 4GBXB 4PY8J 4OF3A 3L16A 4OF0A 1O0VA 4QTHA 4QRTB 4QY8A 4EI6B 5JNYB 1R0MA 4Z76A 1KIPA 2ZP8A 4OFPA 3ZU8A 3G6DL 3G18A 4F3FB 2VXNA 5D2NC 4FFTA 4QE1A 2DWSA 4KDWA 4XBGB 4HG4J 5EA0H 1NANI 1IEXA 1GMIA 4YSCA 4C6OA 2YAHA 5K9CA 4TQ8A 4DK3A 1EAQA 1ERNA 4F58L 3U6RB 4HJGA 1WYIA 3MREA 4X2RA 5GQBA 1O66A 5D6DC 4PHXA 1KULA 4GI8A 5F8QC 3PWNA 2WYTA 1EWEA 1VRDA 2EDMA 4CDGC 4KRPC 3VW3L 4Z7VE 1TJGL 5IJDC 1YEJL 5K9JL 3S2CA 2WQSA 2BINA 4GW5B 3NCOA 1V55B 1YC7A 3BQVA 1EJVC 3MUXA 3IRZA 3WMQA 1JHKL 2QR0B 1A4CA 1ZE3H 1BM7A 4L3EA 4NAMA 3O45B 2WZPA 3TBYB 2CIIB 2DEYX 4KXAA 4R7VA 2KX9A 3AHYA 3DRTB 4FXGB 4Z3GA 1X96A 1FCQA 4W9CC 1RMFL 2Q76A 4OCRL 2CO6B 4BCZA 4DQAA 5C0AA 1JCYA 1QSZA 4BK8A 1ZBWA 3CLMA 3NQBA 4XHJC 2Z1BA 4TNEA 4GIPD 2OMXB 2BVPB 4MQSB 4QHUB 2F7PA 4XHQA 2X7VA 4J40A 4FPSA 1HKLL 1QSEE 2XX0A 1T6BX 4RE0A 2P44B 4X6DA 4UQBA 2X1OA 4QXVA 4O4YH 4E2OA 5JIMA 2VGBA 4DEFA 1VFUA 4CD4A 2J5WA 1BQ5A 4AY0A 3ITXA 4JDVA 4TQHA 1KB3A 4MZ2A 4HJ1A 5CHNA 5EOCH 1DSFH 1W0WA 4LNRA 2H26A 5CZKA 3RHWF 5HJBA 3TEUA 2P52A 2C19A 3AMGA 1EV2E 1FSKC 4FNUA 5HYJD 1ONWA 4WZHA 3ESNA 3U9UB 4DGVL 3O0RL 5IIEA 1XGRB 4JM2F 2PP3A 3CAVA 2J71A 5FJTA 4N90D 2I5GA 5FJIA 3UWWA 4A04A 1TIWA 1WBZA 4UDUB 3A3HA 3QWQB 2INFA 3MV8D 1G7MB 4MZ3A 2H6RA 5FFGA 3EYOA 5BW7C 4GY4A 4U4MA 2MCMA 4IBQA 2ZX5A 1A6UL 1MCWM 3RTQD 1XF3A 3BEVA 1X4YA 4PVNA 3VFWB 1J5HA 1QI2A 4ZQOA 3IMBA 3T6XA 5EZIL 1DPMA 2GPTA 2O4MA 2R2HB 4WO0A 3CHQA 1X5KA 2PU0A 2VEKA 2O26U 3LB6D 3QIUC 5FFOA 4XAWL 2EVIA 1CEOA 4OFIA 1P48A 5JIPA 5F1NA 5B8CC 3E96A 4DUOA 1IM9A 5G4EA 3IE4A 3HBZA 5FXCH 1SBSH 2MOVA 3F4NA 5D7LD 5FF7A 4HZAA 3GJFB 2TRYA 4BINA 4QYOA 4YHPB 4LEOB 1Z9LA 3EXRA 4JNYA 5MEPA 4YLWA 3WQ6A 3N42F 3REWB 2R7EB 4GPNA 2DSVA 3N3EA 1II4E 3FO1A 4OD2B 4FA8A 3Q94A 2OYMA 4L9LA 2I9EA 5T9CE 5EFFA 3O2WH 4PYGA 1MWAB 1RFDH 2JJWA 2CIIA 1C8XA 3IGAA 4RRPG 2PDGA 3WFZA 5CJOL 2NY1C 1S5TA 1QFWI 1G7PA 5HGHB 3SHSA 4C56D 2VOTA 1AA1B 4X61A 2WKOA 3Q8AA 3QO0A 2PTUA 4PJCA 3WYRA 3B0PA 3K0YA 3UBXG 3L2LA 5IK3A 1G69A 2J8HA 1EZLA 4LCVA 1XF4B 4US6A 4YN5A 3CXDL 1U58A 5D1XD 1HCVA 5AWNL 4ZMQA 4LCIL 2IXUA 2RFGA 1FWHC 4LWWA 4XZ9A 5CC6A 4GW5A 4W4OA 4B9CA 4MCZA 4TV6A 1KFCA 3NXFA 3QPQD 2ZUXA 1KKOA 3LMJL 4F7EA 1AGCA 1M7DA 5GHWL 1J5SA 4FQJH 2B2XL 5FV1L 1CU4L 4A21A 4ZMZA 1AS8A 1AH4A 4TMPA 3ZWTA 1TQCC 3DFHA 4ZQRA 3V0FA 1OX5A 3SE6A 2Y5TB 3U2CA 1Q0YL 3WH8A 2CXGA 4IT1A 3FBQA 3V0EA 4HWBA 3SYQA 4APQD 2NX5D 3LEXA 4E9SA 4BYHA 4PUBH 1SJDA 1LNUA 3LTPA 3N1FC 5FYJD 4C6PA 3TWCL 4UDUA 1DXEA 4DZHA 1S9WA 4M1DH 4KZEL 4UTUA 1IBYA 3O6LL 3PABB 2F8XC 4FQ1H 3R2GA 4LUTA 3FU7A 3ZSSA 4U6YB 4O0ZA 1M68A 5E1IA 3WV0A 2Y88A 4NASA 2XYLA 3SDYL 2BFVH 5FPIA 4NSBA 4Z95L 5IGXH 1U8HA 4XKYB 5K9QI 2FJGA 4KEVA 4OH2A 1HQ4A 3SQRA 5C3IA 2WO3B 1T1ZA 3N12A 5H2BA 3O06A 5JDSB 3VE7A 3EH5B 1BFNA 1O95A 3AS0A 4IFOA 5ECVA 4J35A 2IPTH 3WBYA 4AIBA 1FG2A 4N2GA 3S7GA 4JCLA 1QPXA 3WZ0E 4N02A 1EHKB 2BK8A 1CXKA 3MZGB 4C6NA 3OX8B 5L0QB 1MEIA 4HLEA 2DORA 5A2KH 2J2ZB 4XP9L 1W3TA 1UROA 4U1NB 2ITEA 4DVRH 5EEWA 3HCVA 2DIBA 3EIFA 5DS8B 1J0YA 4U7MA 3MRRA 3FFDB 1CYGA 4U4BA 2HKFL 3ZKMD 1CDIA 1TCRB 4V1DB 3MBDA 2CXKA 1RUQH 1P5VB 3IT8D 4GJIA 3T0CA 1JI2A 3B9KD 4G7RB 2N7SA 4GW1B 2PTVA 4H0GA 1N67A 1RK1B 1Z9SB 1R47A 2FD6L 4GRLC 4OT1H 1KFEA 4QMEA 1KQZA 1I8IA 2Y4SA 3Q5OA 2VKXA 2XWXA 2MH4A 1GOXA 4JKPL 3NJNA 4N0FA 1UVQB 4BQ6A 3GDMA 5HI3C 1ITBB 4CILA 3N2BA 3AQYA 3EKGA 5KANG 1INDL 5E4EC 4Q58C 3ES8A 4L61A 3VNJA 1WWWX 5ACZB 2P0IA 3TNMA 4Z7IA 1HEJC 2P45B 5DUBB 2CO1A 2MEJB 4XT1C 4K9EL 4C65A 1INEL 3ATZA 2Z8RA 2HRHA 2X4UA 4ZTPL 5BVPH 1NP2A 2R9HC 1DUZB 3EH3B 4XODA 5HJ3B 1Y6MR 4KWVA 5CWSB 1A7BA 4GT0A 4QGYA 4ZL1A 1OAZL 1JDDA 1RH8A 1XH3A 1PZ5B 5F89B 3WKYA 4Z5RB 4KJWC 1BXBA 1F9CA 4IRJD 3N3TA 1S4IA 1DTNA 5FWQA 3KPRE 2NOYA 1S3RA 3MV7E 2CLHA 2IQDA 1YEWA 2J4GA 3HB3B 4KIRA 2P4AB 4X7TA 3B2PA 3VCNA 5C08A 2WAQA 3FYIB 4RWHA 4OCWH 5D7KD 4YSTA 5CZTA 4J9JA 3OKDA 4AZ7A 4L0YA 3CEUA 3CDFA 2A1WH 4FQQB 4JRYB 1LWHA 1HL5A 2DIEA 5FWRA 3LCIA 1XIBA 4EAYA 4DZIA 1L6GA 3PL6A 4QRRA 4HU2A 2GI7A 2QUUA 4JJHA 1E27B 1A6PA 3RDTB 1B3JA 1IKFH 2X4RA 5T1LD 3KTCA 2VDNH 4ZO7A 5FYLD 2Z1VA 1IEWA 2FDBP 5E99L 5AVTB 2Y5TA 1KIUB 1MCCA 2X5PA 4F33B 4AQ8C 4YNYB 5LN4A 4MYWB 1OC7A 1LM1A 1ECYA 2XA3A 4PH8A 4PSPA 3FQUA 4ZUUB 1AD9B 4PIRF 3QRBA 5SWSB 2GBAA 4ZDHA 3VGDA 4K8EA 1KT2A 5DJXA 4JLRA 4WW1B 3UERA 4MBOA 2QCEA 2W80C 3RLGA 2FEEI 2HKHH 2BG5A 1US0A 5FDYA 1JCTA 3L65A 3TTQA 5E00A 4MD5B 3IXTA 5T3XD 4Z3FA 4FF5A 2R69A 3SGEI 3EGXB 1ZV9A 4F2FA 1GGBL 1CENA 4ZVJA 5BJTB 2JF7A 4Y16D 2EO9A 1T0NA 4G8FA 4IS6A 3P11H 1KZQA 4J8RB 4JDTH 4OR1A 4QRSA 1D8CA 3MACH 1A1MA 1HL9A 1SXNA 2R1WA 1MHPL 3BUDA 1BIHA 1OCWH 4KTYA 2QL1A 3HG0A 2LU4A 2RTTA 3O9WD 3GAYA 4XCFH 2WUBH 5EU6B 3CNYA 1DQJB 2HJLB 3RWFB 5AG9A 1FXPA 4AL8C 1S3KL 3OKLB 3WBXA 2P8CA 1FPTH 2RHGA 3RTQB 3HLAB 1GGYA 3DDFA 4OI9A 4PBVC 2BNRE 1OP3H 4HWBL 1W32A 1K8DA 4QRUB 3VRIB 3FUEA 3QR0A 3O6FD 1F6PA 3WJZA 2UZ9A 3S9IA 5AFDA 4JFPB 1NLDL 1R34A 4DF1A 4OLWL 1JD7A 3WFEL 3WF4A 3QEQD 2XINA 3SR7A 3DRQB 5EO1A 1OFEA 3RGVD 1OHZA 5IQ7L 3GHRA 1M6OA 2VXVH 3ZOAA 3JZEA 3SO3B 1QZ1A 3BIAX 1UYQA 4FHBD 3CUJA 2WNKA 3MRMB 5AYTA 4NO2A 3NIFF 5TK4A 4WXZA 4D6CA 3VGEA 4AWTA 3VD9A 5I3JA 3RAJL 3EKLA 1V27A 2RQEA 1PG7X 1GJPA 3EEZA 1LO5A 3QQ4B 1S7RA 5D6CB 3PTKA 2VC9A 2A7BA 3P0YL 1BFOB 3CFNA 1KBVA 5JZ7D 1IBHA 4JTEA 4B91A 3SQOH 4GOSA 3UJJH 3H2FA 3T4AA 3LHPH 1N64L 5HJ3A 4A63A 3HPAA 4O18A 3QZNA 1Y18A 3RX8A 3EYQC 4DNLA 2K3TA 5K5YA 3GMNA 5CZRA 4ABVA 4PI2A 4LRSA 1YC8A 4LLUB 4JS7A 4WU7B 5DK0B 2JIEA 4PJ7B 3RPIA 3D4YA 3FB6A 4HA4A 4KXDA 4Y4FD 3NACH 1BOGB 3N40F 1NBVH 4P3CH 5E9XA 3J07A 4J3OD 2VLKD 5A43C 5IW6B 3MV9D 3ZFHA 3L2IA 4JRYA 2AQOA 5C07E 1USZA 4FERA 2EDJA 5FDWB 1MVFA 5F3HA 3TJXA 3UPMA 4NRXA 4DEWA 4ZMGA 5G1YA 3H55A 4IS6B 4R7DA 4MWFB 4WW2B 3W70A 5AW5B 2YPLD 3GTTA 2IAMA 2OGYA 4I2XA 3BW3A 2OFJA 4V33A 3DEQA 4M7TA 1NFDE 1G9NL 2BP0B 1NUFA 3ZKMC 3BAJA 2Y2YA 3QA3A 5JHMA 1D3GA 1LLWA 3WLNA 3T1GA 5EZOH 1W5NA 5CD5C 4IGBA 1E6OL 1ADWA 3QG6A 4D94A 4BUGA 3PANA 1VHPA 1LL4A 1V05A 1VFHA 1KT2B 5DJXB 3VFSA 2Q8XA 3BCJA 2ITCB 4FX8A 2QZRA 2L0DA 3VXTB 2VRAA 3OJMB 1JVKA 2WJEA 3UZ5A 2VL4A 1I9CB 3N40P 2CDFA 4GRMA 1ZT1B 3RB5A 1RV8A 3BV4A 2KUTA 4YIQA 1YNLL 3H2MA 2IDCA 1OZUA 3VCLA 1WBHA 3SM0A 3S9DB 3VXSA 1JGVL 2WBWB 4AISA 1F8MA 2WNQA 3FTZA 2CZNA 4KRTA 1KCUL 3PU7A 5CLYA 1Z32X 3P6LA 3TSMA 3DGCR 5EC2A 1J1OL 4HHHA 1MCFA 4WLCA 1DLHB 3MA7B 5E2WL 1XB6A 3VKJA 2I14A 3QDGB 4HUVA 2ABBA 4Q56A 2G3NA 1VKXB 1Q72H 1BFOA 2V63A 4FQIH 4C5ZA 4GLEA 4PJ8A 3LY6A 1MEHA 3S2AA 1FAKT 3AMDA 3IGKA 1SU5A 2NQZA 4MAUL 2ZRWA 3SCMA 5IB5A 1S2TA 1FHUA 2CPCA 3VFVB 3IJ6A 1D8WA 1BIIA 4JIHA 1S7SA 5TE6H 3M8OH 4V1DE 2EDRA 4LASH 2Z6FA 3R8QA 1QNOA 1XHHA 1N70A 4AJYV 4AUUA 2VR3A 4GQQA 4R8WL 5KSAA 4INFA 4A3YA 3UO1L 1E3ZA 4PB3A 4LLMA 1CLZH 1PS3A 1RZFL 4Z18A 3SCPA 4MF4A 2NR6D 1FIGL 3N85L 4MJIB 4XCYA 3I9AA 1GOMA 3BRDA 4HS3A 5C0EA 3T0EC 3VI3F 4X83A 4UXDA 3UYCA 5E1HB 1Q0XH 2ADFL 3O3AA 4C6FA 4W9KC 3HAEH 1R3WA 1JPST 1RUPH 1FDLL 5EG6C 2FJHA 4OQ1A 1ZB5A 2AI0H 1BA9A 4I5XA 2ZPKL 1CE1H 3NYZA 1IC4H 2OZ0A 4PGEB 3MQTA 1IC4L 1MI5A 4CSTA 3A21A 3QA3B 5FOBB 4Y6GA 4CD7A 2O6CA 9RUBA 4F40A 2X40A 3RWHA 1QLFB 3HI5L 2QKIB 5D7JC 5EBMA 3ULUF 1U8OB 3GY1A 1A9BB 4N9DA 3S5NA 2HXTA 5CJ8A 1R75A 4M6NH 3PG8A 4RDBA 4LE8A 2XWCA 3T1FB 1IGIL 3KNBB 4JICA 1OK8A 2DM4A 1T6VN 2AEQL 2F74B 4GE8A 4LOUD 1G7HB 3QGVA 1X8FA 2A9DA 1DFBL 2OPCA 2R2HA 5KTEH 1TXKA 4FFYL 2QVIA 1FHVA 4RRPM 3NK4A 2INZA 3WH6A 3CU1A 5CU5A 2AK4A 3GAKA 4W89A 4ECLA 2YPKA 3FCUB 1HILB 4Z7OB 5DGRA 2F53E 4HLJA 5BV7B 4OZIF 4I9TA 1E9PB 3R8RA 3GJFA 4XN8A 1R3RA 2OM5A 4KMTH 3GDTA 3AAMA 1ZFJA 3LN5B 4FQIL 4AQ8A 3Q2NA 4CVXB 2EH8H 2QPUA 3DYOA 4BK4A 4QJ4B 2FZBA 3UZJA 1IXNA 2BVOB 1TMLA 1V7YA 4G56A 5J5DA 3L6FB 3OZMA 2AV1A 1S9YB 1NTHA 2C91A 1J10A 3LHAA 1W3NA 1EZSA 4KK9D 4D2NA 2E1WA 3LG3A 2C9SA 4Y2DA 2AEOA 3S2MA 1RVFL 3CLFH 1DWGM 3HC4H 3DXIA 5CG7A 4B5ZA 3WFLA 1AH0A 1X97A 5A6JA 3ICJA 2L7UA 3GRBA 4YHKL 4FZ8L 1KJ2B 5I1IL 2P5ED 4LBSA 1OQXA 1BYCA 5E09A 4KBXA 1E6ZA 4PJ6A 5F3BA 4H6RA 4JPIA 1BD2E 4XZBA 3OB8A 1IQ8A 3Q67A 3HAEB 4P4KA 2HX9A 4P23B 4F57H 5BXFA 4Q9QH 5ABFB 2PR9A 2V5RA 4KQNA 5FD0A 4UTTA 3DETD 3D33A 1VFOA 1NOWA 3JZ7A 3VXGA 2B1OA 1I4FA 1GVEA 3GSOA 5EOTB 4ODWB 1BQUA 4MMZB 4ZXOA 3F2CA 4K7PY 1E9OB 1I82A 4EBQL 2AHIA 3CBWA 4TUOB 3SN0A 1IWPA 4G6JL 5HDOA 5AUMB 2DMHA 1AXIB 3IEBA 1HP4A 3PJXA 2JKAA 2O4QA 2P7TA 4FTVD 2HK0A 1NFIB 1E4KC 1CYWA 4GPVA 4XNQA 1XO8A 1Q9WA 2RMNA 1EBHA 5B1JC 5ETUB 2OTWA 4LCUA 4UTAA 1C08A 1UHVA 3D09A 3SY1A 4XVSH 1VZIA 4S1SH 4NAFA 1VCAA 3WFCL 1CZ1A 4BQ8A 4IRZH 1RK0B 2Y2TA 1A7NH 2F7OA 2HFGL 1UFGA 3APNA 4Y16C 1OWRM 2XSAA 3SIZA 2ZOLA 3P61A 4S1FA 2B5IB 1DO5A 3MREB 4B92A 1BQSA 4FRWA 4IU2B 4RCAA 3NCFB 1OO2A 4XVTL 4A6YL 1F1DA 3Q3GA 3RMEA 1OCOB 4NX0A 2QF7A 1QQDA 2QSCL 1HEZA 2OX1A 3OAWA 2ZONA 4P5TD 4Y19E 4O4WA 5KMYA 1MZHA 3HMJG 3PWPE 1J9RA 3EBGA 5F2GA 2LFGA 3RR4A 4F2UA 5FO8A 4RMWA 2EE2A 2UXFA 1KFAL 4J3XA 3LCLA 3TYAA 1EHLL 3QZOA 3W72A 1XEUA 5I1DB 4HZLB 3VAEA 5LKNA 1SO5A 1YDPB 2B15A 2DUXA 4RFOH 2O5ZL 2OI9C 1K9EA 4AD1A 3ECBA 3U6RA 2VXVL 2JLPA 3B5HA 4X6DE 5BZWA 2V2TB 3GMQB 4ZAKD 4BH8A 2YN5A 3V55A 1FWCC 2Q3AA 2BXZA 1M7XA 5DHYB 1CL7I 4HJIA 5DFVC 2I25N 3VGAC 3KPRB 4IYKA 4KY2A 4Y0GA 4FB7A 4G6KL 4RIRA 1TUFA 5FLVA 2JEPA 3CVHL 3VTAA 4DAGH 5L9FA 4U0QB 3QF0A 1ZPTA 1J86A 3RRXA 1JXKA 3FK3A 4FMVA 2QPFA 3WXVH 1KYOJ 5ITBH 1AE6H 3U4FA 1Z41A 3VXRB 1EQCA 3VX0A 1PG7L 1Y7VA 3TN0A 2DQEH 1F6KA 4ROPA 3W02A 2OYLA 1WP6A 2XZCH 3ARWA 1ZGLM 4Z7UE 3PUOA 3WUGA 3O6DA 1H2JA 1KBIA 1LEGA 4F1ZA 1NFIA 2OOFA 3EO1A 3TEYA 3AM8C 2P3EA 3SCOA 2BH0A 4K07A 4X6DF 4YE4L 5LBGA 4FXKA 1S3HA 5I6KA 3S88H 3FOKA 3FUDA 5FYJU 3FDGA 4DBUA 3V8OA 4B96A 2XGZA 1DE5A 3DUUA 3GBEA 3ZIYA 1I4FB 1EANA 4OGYL 1JPKA 3D07A 4G6ML 2JKWA 2B4GA 3RM8A 1FC2D 3I9GL 1UB5A 1YEKL 1GHRA 2INEA 5T1JA 1UD3A 4JQ1A 1GZHA 4IBYA 4MNQD 4ONFH 3FBKA 7FABL 2CRMA 3KGUA 4O9HL 1NBZB 2AK4D 4A7VA 1HESA 1MRCL 3TIDA 5FJJA 2WC3A 3D0LB 2FIRT 2QFPA 1E7UA 3KYOA 3MBED 5DLMH 5FA3B 5SV4A 5KYYB 4PU2A 1Q85A 3G0SA 3PTMA 3SPHA 1OGAE 3K6NA 4KKAD 1LO4H 2QAPA 5K93A 2PN5A 3QIUA 3QZWA 4NENB 4HXAL 5AYQA 5J6HA 1SFSA 3UR2A 4ENED 1ZPUA 5G2WA 4DJFD 4YTSA 1L0QA 4PJGA 3EEGA 5JMRA 2R91A 3GZOA 2IQTA 5FEPA 3MLVL 2CKBB 3MRJB 2J8FA 3CFBA 1VCGA 4MJIE 4QDWA 1KLYA 4WOZA 3DX3A 2E5EA 1G7JA 1L6XA 3S34L 4FQXA 3GNML 4QHKJ 4L64A 1KJVB 2VQ1A 1T5KA 3NPXA 2P76A 5FO7A 1NAKL 2DGAA 1IC1A 4YE4H 4YJZL 4L48A 4ONVA 4N8VG 3DMMB 3IAQA 5IQNA 32C2A 3CSPA 3RK8A 3JWNG 1W2PA 1GEQA 3QNZA 2WLJA 4JM2A 2VFDA 1QRKA 1K8ZA 4Q9BA 5DVNA 4XXWC 5GGTL 1ZZMA 4HMEA 1BX2A 4F7EB 3OQEA 3QUYA 3KYNB 1GJUA 4QAWA 4WHYG 5DUJA 4Z7VF 3G1VA 5AC5A 2Y23A 1LE5B 1FZKA 1EFXA 1F3DJ 2OTPA 4H8HA 5DD5H 4HSAC 5MKGB 3R12A 3WFAA 4R26H 2HT2C 1I8MA 2QDHA 2VI0A 3SCQA 1MFAH 3QCTL 3W0WB 4X22A 5D4QA 2E6JA 3NFPA 2GDVA 3EYVB 4OM0L 1ESWA 1R38A 5AALA 4NZ3A 3RVVC 3P4MA 1B88A 5TAOA 3VGAB 2ZJSH 5E6IC 3EKCA 1TMHA 3NJ3A 4AYID 1KN4L 2GCYB 3RWDB 1BF2A 4JO5A 4U33A 3RY6C 4EF9A 3FU7B 2GW5A 4FALA 3TQVA 1F6AA 3PBGA 2F7QA 1IFHL 2PXYA 2WJ7A 2A6DB 2DT0A 2XKNB 4U1MB 1I6NA 1N7MH 1GSKA 2PO6C 5BZZA 1HHIB 4AEIH 4LL9A 1KTNA 3FU6A 1R5YA 2ACUA 3W0WD 3KHJA 3F4CA 4X8JB 4L37B 2R4RH 1IM3A 4DZBB 1EHLH 3B8IA 5CZ0A 3CZSA 2BY1A 4OFDA 5J06A 3WTUA 5DGQA 2VN5A 5CUSH 5IBTH 2LU5A 2GJXA 3UTZB 4YHNA 4OB5H 2ADIB 3MSDA 2W81C 4KPLA 1DJXA 4NQUA 2HJFB 5CCKL 3GVQA 4ABWA 2Z2BA 2XM1A 3N42B 4AIUA 5B39G 4WRLA 2Q3OA 3ATBA 3OXSA 4RETB 1XBVA 4AHOA 5A6SA 2B08A 3FT1A 3KVKA 2KZHA 1E8WA 5GGSA 4KOBA 3L68A 5CLWA 1WDRA 2Y2WA 4NRXB 5IHBA 2YD2A 2V0TA 3LERA 2XISA 3MDWA 3NSDA 4GJJA 2Y06H 4US5D 1E3XA 4P8UA 3UXIA 1YMME 1Y5WA 4GKZB 5DHMC 2XPKA 5T3XL 4DFHA 4NJGA 4S1SL 3KX6A 5HGDA 1B4KA 3H2AA 2O9OA 4LKXB 3NEXA 2XVBA 4QRPA 4Y1SA 4WO4A 2CZDA 4A2SA 1M2OA 1CWVA 5JH2A 1XIFA 4GABA 3SCNA 3RUGE 3WG7B 5EEYA 3TJEH 3GNXA 1E90A 3FQWB 1FO0H 4G6JH 4C56A 4AB4A 1NMBH 2CCWA 4NLHA 2FBJL 4IZGA 2A6JA 2IPUG 2YBRA 3D48R 4NDMA 2R29L 4IRSD 3CZJA 1HF6A 1HKKA 3P14A 2IPFA 1DHKA 1TYRA 5F96L 4UWQB 1KEML 2YZ1A 3ULSA 3QMRA 1T2JA 3ESMA 3S34H 4D0DA 4KO6A 1FAIL 2P42B 4Z2IA 4L1LA 2CM5A 3V6OC 4PUDA 4A3HA 2BSTB 3D30A 3FPYA 4KJQC 5DO2D 2HG5B 1YIXA 4EDXB 4GISA 2JTDA 4Z42C 2EKCA 3NR0A 4FFYA 4R84A 3FGCB 3S1VA 1I1YA 4JFQB 3B7RL 2HH0L 2XKNA 2KH2B 2XJLA 5I6NA 5EF2A 1UXWA 2GPZA 4JRXA 4EKJA 3AIRA 1A4JB 1VEPA 4R27A 1B4TA 3GBNL 3U0PB 4IPIA 4WK4B 3UTTB 4FQLH 4JX6A 4K8RL 3CSTA 3VXPB 1RVKA 1YEFL 4G3YL 5DMYA 4GLRI 3CQJA 4GRSA 2R15A 3KPRD 4G7YL 4PV1C 1TSIA 1T0MA 2Z91A 4LHJB 3FQ4A 4ZQKB 4OGQC 3L5MA 5GGVH 3ZWSA 4JFFB 3SFWA 4WKZA 2M2DA 2VLRD 2H3NA 3ZZQA 2X9XA 3UAJD 3WNNA 4FNQA 4UTJA 1N0XH 2WB1A 2BOFX 3I6EA 4Y5XC 2X88A 1ND0B 1U8PA 1NBQA 2EYRA 4IMCA 5TQLA 3CGTA 1S7TB 4RQQB 1ITXA 5KTEL 3S46A 1WDPA 1DFBH 1M71A 4WWOA 1VKFA 4ZSTA 2DLHA 1MFEH 2X7LB 1P4IH 3F8UB 4OCSL 3WLBA 3WY4A 6FABH 2ED9A 3NAAH 2HDJA 2YDQA 2GJ6B 2VENA 1AC0A 4EQ3A 1DYZA 1QW8A 2XZCL 3VACA 5KSVB 2L3BA 5I9QC 5KAQF 2H5UA 5GJPA 2DZWA 5IWLA 1PYWA 4Z78B 2OMAA 4ZFCA 3K81A 1FBIL 3HRZA 3GF8A 5F9WC 3PTQA 1UOKA 1UWEH 3DTDA 4IOIA 1AYRA 4IRJB 4F93B 1MIEH 2OMWA 3LBOA 5C0JA 2IO5A 3HB3D 2ZPKH 2DQHH 3UPCA 1P69B 3HZYA 1NDGA 4Z7UA 4OZHE 2J8UA 1ZVSB 1GCFA 2EVHA 1W9UA 1JK9B 3B9NA 4PV9B 3KBSA 2OMTA 2FIQA 5FEWA 2WYIA 4NQED 5MEQB 4XMTA 5EYWA 4U3HA 4ZOEA 1CLYL 1IGCH 1WFNA 4UBDD 4YL9A 5J1SC 4E0RB 1S5WA 2W79A 4HPJA 1R1CA 3WBWA 3KXFD 1QYGL 3N1MC 5CNHA 5B3JF 1KBLA 1DVFB 3TMQA 3W3BA 1FNFA 4IHBA 4XRCA 2PDNA 3KDNA 3NTYA 5DFVD 5E0CA 4HUCA 4KI1A 3ZDXE 2HT4D 4MD0B 5KJRH 1T3FA 3MSYA 4BQ3A 4EK7A 5ALBH 1JHKH 1ORQB 3LQGA 5T26A 2QDEA 4WSKA 4F7MB 4XWOC 4BGLA 4NFDA 1L9MA 1TZIA 4U1IB 2O5YH 1TU2A 5K9OB 1Z1WA 3DRTA 4FXGA 5DMGC 1NP0A 3GX9A 2P46B 3MN8A 4GYBA 4A38A 3U0PA 4O1AA 4Z0BH 5GGVY 3RJYA 3VDHA 2W60A 1K8CA 1VCBC 1Y5VA 2R2EB 4AY7A 4X9SA 5DJ2A 4F58H 4LVFA 4LLUA 4WU7A 3LEXB 2P3ZA 4GX8A 5ABAA 2VSCA 4Y88A 3PWPA 1R6VA 5GXBB 5LNGA 2ZOKB 4L6HA 1FORH 2XKUA 3GS4A 4I8YA 1IAIL 3G6DH 4HH9B 1EZWA 3TNBA 1C9DA 3PGCB 4DPRA 3JQOB 1PVHA 3GDBA 3P30L 3RVTD 3ZL4H 2AV7B 4QWWC 4E68A 2I16A 4JHMA 5JBEA 1Q6QA 4TLKA 3RGVC 2Z31B 3L4ZA 4N2HA 5MERB 3FTGB 2AQSA 3WE6A 4AV4A 4CMMB 1H11A 3MNVA 4XP6L 5MEOB 1A5KC 1Y65A 3WLBB 1IGFL 3G04B 4HXBL 4P3WA 2H32H 3QJUB 3GSNH 4M4RA 5LWYL 4F37F 3I02A 2QPDB 1M03A 4NP7A 1AZCA 1TQBB 5AVUB 4KHXH 2VYOA 3RZCC 5LHFA 1BD0A 1JF1B 3S97C 4TNWK 3R13A 3G5VA 4PBGA 2C3ZA 1IUZA 2EJAA 1JPTH 3H2EA 2YXFA 4L6OA 4KXZI 4QAIA 2X4OB 4Y19B 1F4WH 4HA1A 4E3TA 1GTHA 3VXMB 4ETYA 1M3UA 2ZZ6A 1E5ZA 3TBWB 4XMVA 2PWFA 1X9QA 2ZF9A 4KCUA 3KWTA 3ABOA 3MZNA 1XCTB 3TOYA 4ZOBA 3RURA 5MHSE 3U0HA 2X7LA 1JUBA 4YHKH 2WMJA 1BPLB 4PEEA 3B3DA 4LSQL 3AG1B 4ZMWA 1DEDA 4HZ1A 4QPEA 4S0HA 1UVQA 3KVLA 3LDVA 5DXWA 3QSKB 2CLEA 2EO7A 3TVMD 3C4UA 3S3GA 5CC3A 2HCZX 2VNCA 2QPXA 3E6HA 5BO0D 3P3UA 4WHYH 5HHQA 1F61A 1XJBA 1TUPA 4B9YA 1CT8B 3MZTA 3U4KA 1XAKA 3HI6L 3O3EA 4H26A 2YQ2A 4WNJA 1U3HA 3HR5B 4HT1L 3TT3H 4AGOA 4X6EB 5HPMA 5IJVB 3C6LB 1S2CA 1DUZA 2ZNWA 4DPQA 2NCMA 3M07A 1DQWA 1ZVSA 3IV8A 4AI7A 3HPJB 3VIOA 1QHOA 4ALDA 3H12A 5D8JH 3F7YA 1XINA 2LLLA 1QOKA 4WWID 3DKJA 5CAHA 2HVBA 4CQBA 3C5ZC 2X1TA 4OV6F 4LLVB 4PJAB 1ZKAA 1JZ5A 4Y1AD 5JORA 4KX9A 5KSAB 2WWNA 2C9AA 1CDCA 3PWPB 3F7PC 2J73A 1E9IA 1FWRA 2AF2A 1RQBA 3TFBA 4U1GB 4MMXC 2AEQH 1WHOA 1SOSA 2PPAA 2FSEB 1V5JA 2R0KH 3FC8A 1QPNA 4FP8H 5I17A 2RDWA 2CBTA 2P26A 1C3FA 1O60A 5D30A 4QXGH 3VOIA 4LSTL 4M7KL 4NC1C 3TA4D 2Q87A 5H94B 2AK4E 3V4PA 3V0TA 1HEHC 2VDKL 3TCSA 4NI8A 3W25A 3B4NA 2HRWA 3QUXB 4BXSV 5AC4A 3W39A 5LAXA 3RUGB 1U1UA 1WFJA 2DQMA 1YPXA 2QADD 4A2EA 4FO4A 1QUNB 4LUSB 2C7FA 2WN2A 4CC1A 3EBVA 2W9MA 4MKVA 5AHFA 4OVVA 4U6HA 5EBMB 3LU2A 3V0UA 4EPEC 1XIWB 1RJQA 1JHTA 4K5MA 1G6VK 3K72A 1DDTA 3UZQB 2MNUA 4KT2A 1J2BA 4X2UA 1T1WB 1FFPB 4HTYA 3VJ6A 1ID2A 3U6WA 1U8HB 2ZG3A 1YEYA 8A3HA 1IGJB 4DKFL 5TNVA 2V33A 2OYKA 3VXMA 4XH2A 3BYYA 2VDML 1A53A 4Y9EA 3D9AL 3VFNB 4MA3A 2YL6A 3OQRA 5CCZA 1CJYA 5IFHL 1GIGL 4NZDA 1AGEA 3O2DA 2CDEB 2BASA 4PTUB 3V36A 4YDLC 2LQRA 2VFFA 5DSCA 3MY9A 3PULA 5I09A 1HILA 3AW5A 2YRBA 3UJTH 1EHNA 1ZA3A 4JHAL 4BIKA 2YYTA 3QH3B 5TF0A 4GP8B 3KBEA 2RDXA 3WI9A 2C6QA 3MLXH 4N0YL 2Z25A 3FU9A 4XVJH 3IJQA 3FFDA 5A5WA 1OPGH 1R3YA 3QTGA 2BVOA 1UWAA 4TMBA 4ZW3A 2VDNL 3OMNB 4V1DA 2AL1A 1OAXL 3H6JA 4X6EA 3M41A 1WT5C 1J1OH 3RJOA 1MDRA 2W9LA 4PCNA 2R59A 4NNPL 2ZCGA 4QCEA 2V7HB 5FYKU 1J8RA 4FR6A 3M6YA 2ARJB 5DVKA 3NO1A 2VDRB 3SGDH 2A74B 1H0DB 3DRQA 1LVEA 1EJSC 1JGVH 2D3NA 5C9JB 5SX5H 2DJXA 4PTMA 2NQJA 1UC6A 1WZKA 4P2OA 1DBAL 1JK8A 2BVPA 2BHFA 4L3CA 3EBAA 3RDTD 4ELDA 1GSMA 1F5ZA 2AJXH 1VFFA 2ZDRA 4M93B 4QHMB 1ZDSA 1ICTA 2H3KA 3LD8C 4UB0H 5DD6B 5JPMB 1N6QH 5D2VA 5AYZA 2XQBL 3TNMB 4ERSL 1CBVL 3W6LA 4X7EC 4ATDA 3VRLF 4IISA 1A7PH 4M43L 2WQVA 3D4CA 3IETB 2E7LA 3WJMA 2Z27A 3TO4D 1VF5C 1ZLWK 2ACSA 5BRZE 1FH8A 4LU5H 2R1NA 2ATPA 4HWZB 1DL7L 1Y18B 3AU1B 1G4PA 1GS7A 4NI3A 4QO1A 1EEZA 1XGYL 4B3EA 4LYKA 2ZT9C 4AH7A 3L7RA 3QYNA 4Q4IA 2HTLC 5E9DD 1MNSA 1HHHA 3DOHA 2NY1D 1EGVA 3X1FA 4OCYH 4D9RE 2DS4A 2E8ZA 4FOJA 1T1WA 4QQUA 3SGUA 2NTFB 3GD1C 1G9ML 5HGBB 3W75A 4ERSH 1V5XA 3JTSB 1LK3L 4BBWA 1U9KA 1NC4B 1NFDA 2VJ8A 5DTFB 4GG6E 2ABAA 2FD6H 4GUHA 2VVNA 1DEEB 4GSDL 1XGUB 4ZMPA 3N1AA 3GDRA 3ET9F 3KTXA 2X05A 7PCYA 1IQDB 1FNSH 2AITA 3PNZA 4TX6A 4FFZH 4P59H 1NCOA 5EMUA 3HE6B 2HSIA 3O6YX 4RL3A 4BI7A 5F7DB 4PFMA 2I9LB 3GKZA 1B3VA 2UUDK 3V0DA 3WQCA 3AGWA 1P0DA 3MO7A 3TYGH 2QCDA 2DQFB 5FF6B 4ZFOB 3T3PE 1YJDC 1OW0A 2LAGB 4A7GF 1PD0A 3R8HA 3ZKND 5CN2A 5HYQA 4EIZC 2Z35B 3FO1B 4OD2A 3AU2A 1UOWA 2IPTL 3QJFA 3FSTA 3FUHA 4RNRA 1ID5I 1LEIA 1EMTL 2QPSA 4HDIB 4NT6A 4MXVF 2YUXA 5BJTA 1MZRA 2Z0IA 4MGGA 4PUKA 2BNQD 1L2UA 1ZJIA 3NA4A 3FEQA 3K74B 4POYA 2A74A 4HH8A 1D7BA 2QGEA 2R8WA 3DHPA 5MHBA 1UGNA 1GIGH 3GXFA 3QPXH 4PB9H 4M1GH 4FQ1L 4PY8I 5D96B 4H25A 2J7EA 3L5XL 3XISA 1EJOL 3RLVA 3U9WA 3HZKB 3H2PA 2G0LA 3WEAA 5MEND 1R0AL 2I17A 1VBUA 2DY2A 3E2SA 4JYDA 1B3OA 4LRTA 4PMEA 1G6CA 4QJ1A 5AZ1A 3UZEC 5JOFB 1BLNB 3D34A 4Y9FA 5DJDA 3UTSA 2QHAA 3CH9A 4ZMTA 3N5AA 3STEA 1MCDA 2C1PB 2ATKB 2OW7A 4HG4K 3K13A 2A83B 2RH9A 3P2BA 2XXGA 1QFEA 3QAZC 4ABQA 3WNJA 4WSHA 1P4LA 4XCFL 3O2VL 2UXTA 4XX5A 1OGTA 1G7IB 2HN7B 4BWLA 4RGNC 3GIZH 1UQZA 1U91B 3PSVA 1KM5A 1ZBKA 2ALWA 3C5SA 4XAZA 2YJQA 3P11L 4PGLA 1TLKA 4ORGB 4KC3B 4FA7B 5KG9A 2CLRB 4C54A 4GKOA 3G1YA 4Y8FA 1ESOA 1PVNA 1YNQA 2WC7A 2Y7NA 2QADC 4RIRB 1IT9H 5D9SA 5D1QE 2X1RA 4F8NA 5CPTA 4PRHD 5C07B 4RRPA 5I66A 4G82A 2CBMA 5BV7L 3EUDA 2ZOXA 3T9WA 2R0KL 4IX0A 4WY0A 3CX5J 2D7PA 2J72A 5IB1A 3ZTEA 3D39A 3UVAA 5HHPA 3MRQB 4PCKA 4AVKA 5EN2A 3TJPA 2XQYA 4P8XA 2YARA 3T4AB 3O2WL 2W59A 2YZRA 2I5YL 4UTBH 5EOQH 5C0RH 4UTKA 1HL4A 1OOAA 4UIOA 2HYMA 4CSPA 1OV8A 1R7OA 3M0XA 5HYSB 5HMFA 5H37G 1LOSA 5E1GA 1UB3A 2UZYA 1J9CT 1F2JA 1C12A 1V6YA 1VGAA 6PAZA 3E3HA 3CCHB 1IBBA 3PLYA 4JFHE 2PDJA 1ZHBB 3UFIA 3HPZA 3C12A 3LBMA 3AHVA 4BKSC 2DZVA 4JKNA 2PLJA 4I0PC 3MRPA 3QDMD 3ZBMA 3BSMA 5IROC 3C60B 4EXBA 3AT9A 3JWOH 1J93A 5HYSG 2F19L 1PIIA 3BUIA 3EFOB 3QI9A 3R7QA 4PJ8D 2GIXA 2FUQA 2RBLA 4LLQA 4UZSA 5A16A 3MHUA 5REQB 1AZBA 1I8IB 4ZOCA 5B1CA 3U6XS 1OWWA 4NQEA 4LSQH 1V51A 1TCDA 1CLKA 2PBOA 2VZ3A 4O1DA 3VZYA 2YPKB 2A9NL 3KXQA 4QRRE 2NZ9D 4JTTA 4QXTB 1QKZH 4JE4B 1EDQA 3GSRB 1PDKB 1SVZA 2E8YA 1CVSC 5DYFA 3D0LA 2AC0A 2VWEE 1BDYA 1FO0A 1FNEA 2OA9A 2OW6A 4ANKA 3BVTA 1ZU8A 1NGPL 4QRQA 3RR1A 4BR1A 3R4RA 4QKXB 3P8IA 3O41B 2WXDM 3KBFA 3LLDA 1GZPB 4OWGA 3P3TA 2ZKHH 1LEIB 1XR9B 2FX8L 5E5MA 3EO0A 1BYPA 1R5IA 4MQ7A 3M5ZA 3TV3H 2WM0A 3FT3B 5ESQB 5INDA 3M5YA 1WIUA 5ISZB 2NX1A 3NQ7A 1MUMA 4CEXC 3TTEA 5JBDA 5C9RA 2GAZB 4BCYA 1HNFA 3U46A 1SO6A 5EMLA 5LA2A 4DLMA 2WV3A 4GMTL 4OZFG 2BNUB 2C7UB 3WNKA 4Z3TA 3TESA 1R85A 1ZS2A 3W27A 1A7QL 1KYFA 4MD0A 5DQDL 5ABFA 4XXCC 1JBJA 2VLRA 1XZ0A 2CU9A 3H9ZA 3JWNE 2DMBA 3OAYK 4OCRH 1MHEB 4UV7H 4HKJB 3ROOB 5I8CA 4EP8C 4L1DA 5DEFA 4PRNB 1O12A 3NGBC 3HIZA 1KV8A 3Q13A 1OOWA 4WEVX 2WC4A 1JPMA 4U7KA 4K3GA 1WBYA 1UFUA 4NRZA 4NRYA 3DG3A 3B3IB 3SE9L 3QFGA 5D5ME 2EYTB 4ADSA 1XR8A 4AYDC 4BKNA 2QEZA 1KGCD 2XN9D 3MODH 1T1YB 4PRHB 2B59B 4YZFF 5C07D 2EDBA 1I1AA 5D9SB 5FHAH 3PG9A 4DJDC 5JIWA 3QAQA 1KGCE 2XN9E 3OSKA 2OK0H 1ZV5A 3ZE1E 2PXYB 5CKGA 3F5KA 1EKOA 5KJRL 2ROXA 1H1YA 1AQMA 3UC2A 4RXFA 4N9GA 1H6EA 2X1PA 3P80A 4IICA 1G9MC 5LNUA 4O2CB 1CD0A 4YX2H 4OBTA 5IBXC 3IKKA 5KITA 2IBZY 4FQCL 4DWHA 2CHWA 2G5UA 2X2JA 3ALXA 1PE1A 3LV3A 4OZGB 1G43A 1WAAA 2WP3T 4FHJA 3DX8B 1SN2A 1HIZA 1SR9A 5A8GA 4OLYH 4LAUA 1Y5XA 1T66C 3FOMA 2D31A 1U8CB 4HN8A 2Z2AA 3H7RA 1T04B 3LMJH 2A3CA 3O41A 5CGMA 1T83C 1A0CA 3TR9A 3LDBC 3MJ8A 2B4CL 2Y36H 3TT1L 1FCUA 3AIEA 3OMIB 1K8IA 4AC2A 1EJ7L 2HKAA 4MJ2A 2X1QA 5E8DH 3G6LA 4L29B 2YFOA 2PCXA 4J3OC 4A8RA 2EIJB 2HPOA 1T2XA 1J0ZA 2NQCA 3E8UH 4DGYH 2GJNA 1RPKA 2VGFA 4LGXA 4IIQA 3DJRA 3QC6X 1TO3A 3TYCA 4J1UA 1C90A 2Q02A 4YBQC 4D0DB 4OBRA 1MFEL 6FABL 1XKJA 3HN3A 2BMKA 5FW6A 3RX4A 1KFBA 2JCCF 4PV8A 4PMQA 1WWCA 2VZ1A 3NP4A 3U7VA 2CPUA 4LPYA 1V77A 3I6SA 2P80A 2CITA 4HGWA 3WMSA 4D8LA 1QNZL 1E28A 3T9PA 3QR3A 5FA4B 2WUCL 3WUBA 1W8GA 5D9OA 2IXQA 2VLKA 3VXRA 3MWAA 4PMYA 4DK5A 2F5BL 2YEQA 3GI9L 5DHXB 3NJJA 5I1KL 1YNKH 3AZRA 1S5HB 2YAMA 3KFTA 3NL5A 4NRRA 2XVLA 5AYUL 2TRSA 1TTFA 3BUBA 2A9CA 4GNVA 3GSWB 3EBIA 1CICC 4E3VA 3JZUA 3CHDA 2XIBA 1ECEA 1R3LA 5IMKA 1UMLA 3CTLA 4JPIB 4NZTH 4IH3A 1C9WA 3W7QA 1T1YA 3O4LD 1H6UA 1XBRA 1AG0A 3STLB 3V6FA 3WJJC 4LU0A 2CNCA 4CCDA 2G95A 3MLRH 3BPOB 2C9UA 1GPFA 2WKOF 3MP3A 4PJCF 3KLSA 2BY3A 3WUWB 2W9DH 3V4PB 1GPWA 4NAEB 3T3ME 2KDGA 1BZ9A 3QBTB 1C1EL 4X6CA 4XPTL 3B5TA 1ZGLA 1B0WA 4RGND 1J5OL 1LRNA 4OTKA 2M8XA 4UILH 4HWEH 3U48A 2IAMB 4WDXA 2UY3A 4YZWA 3BI9X 4UOW1 1M56B 4ZS7L 3DSFH 3T2LA 3DX7B 1D5IH 4KJQD 1TWDA 3BHBB 3P9LB 3LGGA 5FECB 4YU1A 4IBTA 3MUIA 3KPOA 3L3KB 4XNQB 2ZOTA 3M7WA 2AL2A 1C5DA 3BZFA 4P05A 3APTA 1AQDA 2MNJB 4ELKA 3W53A 3TJEL 4JD4A 3CSYB 1T83A 3CVCA 4O51A 1AL8A 3VIGA 2Q2LA 2FH6A 1SUXA 4IPJA 2JLLA 3D25A 3U6XA 5CBJA 1HWWA 4WSGA 4N9GB 4WI2A 5I78A 3CWGA 4NM4H 2BB0A 3N4EA 4E5TA 1ZANH 1O6TA 1JMZA 4PW4A 1THCA 3ARFA 2WKLA 2CW6A 2DWEA 3MDJA 2YZ5A 4I0PA 4JL2A 1FH7A 3GRWL 2X0UA 4PRIA 4TL4A 2W3ZA 3PL6D 4QRRD 1RPUA 2NXHA 3TCEA 1LHZA 5E51A 3SJNA 2NPLX 3CH0A 2K7PA 3B34A 1RP9A 4PS8A 5ERWB 4JXCA 4ONGH 5GGTA 3CFJA 5EOCJ 1L9OA 4WUUA 1ISYA 4TOQA 1FVEB 5GS0L 1NQKA 4XP5H 4J3SA 3SBWA 2RJGA 5ACZA 3QFDA 5HNUA 3LKRB 4NC0B 2JNZA 1BVLA 2PCQA 1QWGA 1BX2B 5AY7A 3DC0A 4HP5A 2XXCB 5F9AC 5TE7L 2HVKA 2O9RA 1MVYA 1XSIA 1WBJA 2AMGA 4LLDA 4PLJD 5DA0B 4JFHD 3PP7A 3NPSC 2NW3B 1YNTB 4WV1C 3MUHL 1OAUH 4MGXA 3BW2A 3DGDA 3DSNB 4X7SH 4OKVB 1S6NA 2Y70A 1OK4A 4JVUA 4UMSA 4WD0A 3X3GL 4IGNA 3MOBL 3L5LA 2HFFB 4IK6A 4GT7A 5LGHL 4AWJC 1Q1JL 1WZMA 5IV2A 3AGVA 2CKRA 2CYGA 2J6VA 1VPXA 3QJQB 3CUFA 5IEKA 1DJGA 1ZCCA 3NYKA 3P4OB 1A3RL 2I9UA 3RMJA 2DL2A 2VDLB 2K78A 3SDXB 5K9OA 3GR4A 3B2UC 2VUOA 5GRWA 4N42A 4JPGA 4M7JL 3GXPA 4PVMA 4ODUA 3OG6B 3SURA 3MJ7B 4X42A 2UXGA 4PUWA 5KSAD 3EJUA 1A6ZB 5CIPB 2LTQC 1A5NC 2GG1A 2X1XR 2X4TA 3KCWA 2ZP9A 3QCTH 1TTJA 1ZLPA 1QLFA 2AMXA 3A13A 5GVJA 2HS6A 2ZRVA 5D03A 1G67A 5FO9A 3CU7A 3ILPB 4LEFA 5DBTA 3C8NA 4RZCB 1X7IA 2FJUB 4GIEA 5JQ9A 1Q4NX 2OCCB 1NIUA 2HROA 4D9RD 2IOOA 2G9H