3BLPX

Role of aromatic residues in human salivary alpha-amylase
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
496
structure length
496
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRARQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase 1
publication title Structure-function relationships in human salivary alpha-amylase: role of aromatic residues in a secondary binding site
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 176
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00128 Alpha-amylase Alpha amylase, catalytic domain
X PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3blpX02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3blpX01
3VIOA 2VVSA 1EDTA 3UR8A 1W1PA 4PMUA 5C71A 2OSYA 3APGA 4U3CA 1TA3A 1MWOA 1XH2A 2VRQA 3I3DA 4P8WA 5A8PA 3KE0A 1OM0A 3A4WA 5A2AA 1CXKA 5CSUA 2G3MA 4Y7EA 3UCQA 3SUVA 2DSZA 3AXXA 2WC4A 2ZXQA 4JFTA 4PSPA 4TUFA 4AZ7A 4CU8A 1BVNP 4JAWA 4ATDA 3AHZA 1TQVA 1R85A 4CKQA 1HKKA 1V6WA 1XD1A 2X0HA 4W85A 2DIJA 2WVTA 3VU2A 5HNNA 1X6LA 3WD2A 3WFLA 1B1YA 1UR9A 4F79A 3AIVA 1C7SA 4QCFA 3SUTA 4W86A 3LXCA 1QHOA 1MQQA 2Y4SA 4GIAA 5D4YA 1ITXA 3CC1A 1V6YA 3GXNA 1W2VA 4NZJA 5EFFA 3D4ZA 2WLYA 3VIPA 3CGTA 3WF3A 3VIGA 3AHTA 5A6BA 3WKZA 3ZJ7A 1FFQA 1E4MM 3NSMA 1TCMA 4IPLA 2ESCA 4M82A 5FOOA 5DFAA 3VIHA 2JFEX 1KB3A 1B3WA 1H5VA 4D6HA 4QDMA 1V3LA 1KBBA 3K4AA 3VGGA 4YHGA 4MJ2A 3MSDA 2WHKA 3K8KA 1XGZA 1JDDA 1CLXA 2YA1A 2J4GA 4N42A 3CZSA 1XCXA 4E2OA 2TAAA 1BTCA 5D8WA 2WMKA 3SCUA 1C93A 3VIMA 1TA3B 2WC3A 3RJXA 4TTGA 4H2CA 4WIWA 2FYVA 3LPOA 4CD4A 3VGHA 3ARQA 2IXUA 3VKKA 2E40A 1D2KA 3OGVA 4A3HA 1K6AA 1VFUA 2EJ1A 5M3WA 5CQ1A 1K9EA 5DF0A 1U30A 1HXKA 1J11A 4X0VA 3LRLA 1W32A 4FNRA 3VX1A 2WBKA 3ARSA 1WB0A 3ARPA 3L4WA 3SEPA 1G94A 1CWYA 3VSTA 5DEZA 2OWXA 4WF7A 5M03A 4GQQA 2CETA 2EPOA 4AY1A 1E4IA 4OOUA 3KL5A 1DWHM 3H53A 2X1IA 1NM9A 4GZEA 4C7FA 2GDUA 3WQ4A 5JUVA 2BVYA 3ZT5A 5ABHA 1OIMA 3OG2A 2WANA 5IXEA 3E1F1 1R8LA 4BCEA 2E0PA 3F4VA 3AROA 4CU7A 1ZBWA 4AC1X 3PTQA 4UQEA 4CCEA 2VOTA 2JE8A 5JBFA 3WBEA 3ARRA 4FMVA 2ZIDA 1Z32X 3U5UA 3ZOAA 1GOIA 4R27A 1WNOA 1HL9A 2ZXDA 2OW7A 4MJ4A 2D0GA 4JFVA 2VCAA 3WUFA 4AYGA 3GXTA 4LQ1A 2VMFA 3WUEA 1G1YA 3AICA 2ZOXA 4UQCA 2V3DA 4JL2A 1M53A 5HPCA 2PWFA 1E6XM 4NZCA 3WSUA 4FF5A 4QLJA 4P7OA 1B2YA 3NDYA 4NX0A 1JZ5A 1QI5A 4H8UA 3A4XA 3EDKA 3LMYA 3SCQA 2CERA 3EMCA 4PN2A 1BLIA 4TVUA 2GJPA 2XM1A 3VOCA 1CGVA 4AMCA 1UR2A 5A8QA 1GW1A 1SZNA 3WH9A 4UCFA 2YL9A 1CECA 4AMWA 4XV0A 5I79A 3DYOA 1KTCA 1MFVA 3PTKA 1TR1A 2VX4A 2VQUA 3T0BA 3GNPA 3EDEA 3AXHA 5CJ5A 3WL1A 4WK9A 4GQRA 1GQLA 5HOSA 2XGBA 1GUVA 2W61A 4TX8A 3MMUA 3N1AA 1XRVA 3IJ8A 2W4XA 1J12A 4HOXA 3N12A 1CLVA 2PWDA 4AZHA 1LLOA 1QI2A 2FDMA 1WZKA 5LA1A 1GONA 2CNCA 2W63A 1GOQA 3CZJA 3VPLA 4WKHA 1JD7A 5ECUA 3AJ7A 1PX8A 5A69A 2XPKA 4EKJA 1UWRA 1HXJA 1CYGA 3VMOA 3OIHA 1E73M 3AMDA 3M46A 7TAAA 3FNDA 1WPCA 2YBTA 4EK7A 1UWQA 3MUZ1 3D51A 4OBRA 3CIVA 3S6TA 3GXPA 2ZX8A 3BH4A 5E0FA 2OYKA 1GORA 2XGIA 2CPUA 3UG3A 4FLRA 2YOCA 5E6YA 3SCSA 3WDPP 2YBUA 1NWTA 3MUY1 4BZYA 5DT7A 1DWJM 1VBRA 2Y24A 2QMJA 3VIIA 8A3HA 3O9NA 3T0DA 1CENA 1HKJA 2PWEA 2JEPA 4LYQA 1H0GA 1UWUA 2PBGA 4PEEA 3EBVA 4H41A 4DO6A 1W1TA 1WP6A 1Y7VA 2VZVA 3ZSSA 1KQZA 4PTMA 5BWFA 1LWJA 3RIKA 4V28A 5CXPA 1JIBA 3CUIA 2XUCA 4GXPA 4MDOA 1JI1A 2WWDA 5A6SA 3SCRA 1UOKA 3CZNA 4B9YA 2A3EA 4H8VA 4P7QA 4BQ2A 4UQBA 2CBJA 3DX3A 4AIEA 2PBOA 3HMCA 1BYCA 2BY3A 5JIPA 1WDSA 1F4HA 3AS2A 3AMKA 2GFTA 3H54A 4FLOA 1P6WA 2RGMA 4HMDA 3WMCA 1XH1A 4DWSC 3CZKA 1UUQA 2BY0A 1JI2A 1PPIA 2UY3A 2G41A 4OBSA 2V3EA 2X8RA 4ZE4A 2E3ZA 1GOOA 4HZ7A 4PSRA 1EDGA 1B3VA 4QLLA 3S2CA 4WSKA 3AISA 3CPUA 1NQ6A 1VF8A 4MADA 3ZT7A 3A5VA 4AD1A 1Q4NX 2J74A 5I6SA 2XIIA 4J3WA 3WNOA 1XSJA 1JNEA 3MANA 4RL3A 3GXDA 5HXMA 3WH6A 1PS3A 1FP8A 5AYBA 3IANA 3N18A 5IFPA 3QGVA 3DDFA 2C0HA 1JF6A 1GZJA 2J25A 2WSPA 2WBGA 4JCLA 2CHOA 1C92A 5F7UA 1CEOA 1PZ3A 1UYQA 3L4VA 1FHLA 3PHAA 1UKQA 3L4UA 2O92A 1XCWA 4CD5A 5C8BB 1GOWA 5E6ZA 1GHSA 1KGXA 4U2ZA 1UR0A 1ISYA 1ZJAA 1HJSA 4Z2IA 4MNLA 1KXQA 3VDCA 1Q6DA 3BUBA 5FL0A 3BCDA 3BMVA 2PB1A 3WEMA 1W9XA 2EPMX 3PN8A 1W2PA 4KRUA 4WKAA 1W9BM 2G3IA 3RM4A 3CHEA 4NXSA 1UR8A 1XSIA 1OGGA 5CG0A 4AZ6A 1MFUA 3D4YA 1TFVA 2NT0A 1PIGA 4FLSA 1PEZA 3CZEA 3VNZA 1B3XA 4XZWA 2HVMA 1XHGA 4MNKA 5JIWA 2CCRA 4AXNA 2D22A 3L4YA 3WDHA 1VIWA 2VZOA 1V3JA 1US2A 3WEOA 3KL3A 2ZX7A 2VR4A 1JYWA 2QPUA 2V38A 5I77A 2VX6A 3M7SA 3AIBA 5CPTA 4M1RA 4CD6A 2IUZA 1OCQA 4NRSA 1JYNA 1UASA 2O9PA 2WCSA 3VDHA 4W7WA 3HG2A 1JG9A 1XD0A 1IT0A 1W3KA 2WMIA 1LL4A 2XM2A 3WNMA 2X0YA 5BRQA 2BHYA 3W38A 3ARVA 3T0AA 3ZSTA 1MW1A 4QFUA 3ZR5A 1W9PA 3O2LA 1JD9A 1UA3A 3WH7A 1NOUA 5A6LA 1TQSA 1KQYA 4OZOA 2WLZA 3DDGA 1MVYA 2GJXB 4AWEA 3CV5A 2VX7A 3OA5A 3W24A 3N17A 3VGBA 3L4ZA 3UR7A 4M8UA 2J77A 3EMQA 4QLKA 3T08A 1E71M 5A2BA 4PMZA 4BQ4A 1B3YA 1FH7A 4AD4A 2VCCA 4DO5A 1MQPA 4L4OA 1TUXA 1UD3A 9CGTA 3I3BA 2G4FA 3L4XA 3B9EA 2DPEA 3U7VA 1QNQA 1JAKA 4JFSA 4KGJA 1QX1A 1QI0A 3WF1A 4DUXA 1U2YA 5CPQA 4UZUA 2A3BA 4CD7A 2ZUSA 4XX6A 4E8DA 3AYSA 3WUGA 5JBDA 3NYDA 3WQ5A 3WDJA 3OBAA 4MB3A 4E4PA 3CO4A 2X2YA 3VGEA 3WY4A 2JEQA 3RO8A 1HT6A 1E0XA 4AEEA 2DIEA 2XSAA 3CUFA 3W82A 1KXVA 1VJZA 4FLQA 4GZIA 2CIPA 1XH0A 1OSEA 1XSKA 2WWCA 3T2OA 1HP4A 3RILA 4P7NA 3W25A 1CXEA 4UFKA 3LPPA 1G5AA 1J9YA 4HU8A 2V3GA 2XVLA 3VD3A 1WCGA 4HU0A 6CGTA 2DSUA 2WVVA 1UD4A 5ABEA 1WO2A 1H2JA 1RP9A 5M17A 2PWGA 3CUHA 3II1A 4BS0A 1US3A 3D52A 4PMYA 3WNNA 4J7RA 4FNQA 1E5NA 3AZRA 2CBVA 1E0VA 2D23A 4DM2A 1R33A 1EQPA 1QHZA 4AISA 4WKFA 1T0OA 3FW6A 4JCMA 1LF1A 1ITCA 2YFNA 4D6GA 1JZ7A 1JDAA 1X1NA 2J7HA 1ZBCA 1F4AA 1OD8A 3WF2A 4ML4A 4W88A 3BMWA 1E6SM 1NH6A 2F8QA 4DWSB 2XG9A 4UQDA 1GJUA 3AHYA 5BXRA 4J3TA 3VM7A 1B90A 4CVWA 4QCEA 3THDA 2Z1SA 2WHJA 4LXFA 5BXSA 1EXPA 1UD8A 1QHPA 1NP2A 2Y5EA 3QOKA 4ATWA 3TA9A 5GNYA 4AEFA 1V3KA 5AYIA 1DWGM 1RH9A 4IUGA 2VZSA 4JZ5A 1V08A 3KL0A 3PZQA 2BNJA 2VI0A 2E8YA 1DHKA 3HJEA 4PRWA 2DEPA 1AMYA 4UOJA 2J7GA 1DWIM 5A6MA 1W91A 3VSUA 2A3AA 3ZMRA 4ZXLA 1W3JA 3S5YA 1BYDA 2YIHA 2UY5A 3IK2A 1MQRA 3J7HA 5EB8A 3SCVA 4J28A 3NDZA 2E9MA 4FNSA 4XB3A 1FH8A 1QNRA 2W5FA 3WY2A 1WDPA 1VEMA 4HA3A 3VILA 1HL8A 3DC0A 3N04A 3WNLA 1UH3A 1HNYA 3WF4A 3BAYA 5CSYA 2J7DA 5BXTA 1PZ2A 2AAAA 1W1VA 1V02E 4AD2A 4UOQA 3FAXA 3WH8A 1AQMA 4R5EA 1D3CA 2DSWA 2W67A 1YHTA 4CN6A 1CNVA 5CGMA 1ISWA 1E56A 4UFIA 3VIKA 5HDRA 4OKDA 1KXHA 2YL5A 3IAPA 1XC6A 3CZGA 4CN1A 3FAWA 5HBFA 3UETA 1ISXA 1TVPA 3WQ6A 1E72M 2YL6A 5E1QA 3CUJA 1CBGA 1VRXA 4ZXOA 3IAQA 2EABA 1KWKA 2E9LA 3GTNA 3EJSA 2V5DA 3QHNA 4JFWA 3AFBA 4UQ9A 2C7FA 3TOPA 4TVDA 4AD3A 2CHNA 5I2UA 4HTYA 2J79A 2DT2A 4P8UA 3WD4A 1BG4A 3VM5A 4CGTA 4MDPA 4KRTA 1JZ8A 3A6OA 3WD0A 2YDQA 4TVCA 4HA1A 1KWGA 1E15A 4M81A 4MNJA 4KMQA 3RM8A 3SIMA 1E4NA 2BFGA 2D2OA 1DTUA 3FXYA 3DHUA 4N0RA 3BLKA 4D72A 3WNPA 1AQHA 4WSJA 2EADA 2B31A 4ZE5A 4HP5A 4W5ZA 5FD0A 1LG2A 1NWUA 3TTYA 4RE2A 1JXKA 3W26A 3AS3A 4D1IA 3GDBA 2V3FA 1BG9A 3W37A 3PZNA 1HIZA 3WNKA 2CYGA 2ZWYA 1GOKA 4OJYA 2G3NA 4LX4A 1BHGA 2D3LA 5DMYA 1QNSA 4M56A 2XVPA 1WKYA 3A21A 1CPUA 4JKLA 3OGSA 5D9OA 3D5HA 3ZIZA 3VO0A 1XYFA 1E70M 1NWRA 4V2XA 3CHCA 1BVZA 1E40A 3A24A 1HN1A 1W3LA 1B30A 1QBAA 1LWHA 3FHQA 1UZ1A 4NSBA 1KCKA 1G0CA 3VMNA 2QPSA 2VC9A 4UQAA 3UEQA 3SCOA 2J7CA 1V6VA 4PMDA 2BV9A 2ZUWA 2DGAA 4S3JA 4Z2JA 3CMGA 1FA2A 2WZIA 5I23A 1CGXA 4W8BA 1TQTA 4UR9A 1JZ3A 4AZGA 4DWSD 3HZ3A 3AOFA 5D9MA 3HG3A 3TV8A 1O7AA 4D6CA 2ZUMA 1J01A 2X2HA 3MV01 2MANA 3CBWA 2EEXA 3WF0A 4UFJA 1JL8A 1BFNA 3AHVA 3BAXA 2VCBA 3W6LA 4B3LA 1GJWA 3PTMA 4FNUA 4MB1A 4W7UA 1KFWA 1I75A 1M7XA 2W91A 1QOXA 4J3UA 1VAHA 3BVXA 3ZM8A 2VUYA 2A3HA 5M5DA 2WAGA 3DYMA 3W4RA 5AC4A 2WMJA 2WB5A 3OGRA 4HA4A 1W9VA 3PZTA 1DP0A 1HVQA 2XVGA 1CXFA 1H0IA 1EHAA 5EBAA 1EOKA 3BAWA 4JL1A 2FHBA 4JFUA 2YA0A 2YA2A 1UQYA 4F66A 3NSNA 4A4AA 1H11A 4RE4A 2VRJA 3DX2A 2FH6A 1R87A 2G3JA 1O6IA 2F61A 3L4TA 1HJWA 2WM0A 4H8HA 4H7VA 1UKSA 1OINA 2EACA 4BQ3A 1PX3A 1H1NA 2WKGA 4TOQA 1HX0A 2UY2A 2WNWA 3VUPA 1TZ7A 5FKYA 2Y2WA 2ZE0A 4HPHA 2OLHA 1CTNA 3GYCA 4X9YA 2D20A 3B9AA 4F8XA 3EJRA 4U5KA 3BVVA 3RM9A 3L2MA 1CDGA 3FY1A 2WCGA 3PZOA 4JIEA 1CZ1A 4U5IA 2XN2A 5AC5A 2JF6A 1UWSA 5C70A 3CZLA 4AIOA 2XFFA 2YFOA 2OWCA 5A6BD 3VMPA 4ACZA 4UFMA 1EOMA 3ZT6A 1E6NA 1SMDA 4KH2A 3KWXA 2NSXA 1JZ4A 2XHYA 3QHMA 4YHEA 1E4LA 1JZ6A 5FL1A 1BYBA 5A95A 3RMEA 4S3KA 2ZXAA 1UH4A 3ARWA 1WDRA 4M29A 4YPJA 1V02A 1W9DM 2PI6A 2XYLA 5GQBA 3W29A 1D7FA 1JXJA 4DM1A 2DSKA 4GI6A 2WC7A 2JALA 2D73A 3AZTA 2BVDA 2AOSA 2HISA 2FH8A 4PMXA 3AIUA 1W9UA 1ECEA 1PX4A 2F7PA 1AQ0A 3THCA 5D9NA 1DWFM 1HF6A 2WMHA 4OOZA 4OGZA 4W5UA 1BQCA 1E9LA 1UR4A 3SUSA 1IZJA 1R7AA 2JF7A 4TXEA 3T2QA 4DUWA 1VENA 4ACYA 5A94A 3BLPX 1I1XA 1WZLA 1C3FA 1BPLB 1UD6A 2D1ZA 3GZAA 1OWQA 1V6UA 1MW2A 3BAJA 5BYWA 2QV4A 5EFDA 1JAEA 4J3XA 1GHRA 1WE5A 3BXWA 3DX4A 1GPFA 3M07A 4XZBA 4CN4A 4J27A 4HMEA 1Q6GA 2J78A 1EGZA 5ABGA 1VFOA 4ACZB 1DEDA 2CKRA 2ZWZA 1BAGA 3SCPA 2EPLX 3TTOA 3DHPA 3DX1A 1KR0A 3VD4A 4NXKA 4M24A 3EJQA 3AIQA 3W6MA 1J0IA 4C7DA 5CZKA 1BGGA 4MB5A 1E1EA 2WXDM 3EDFA 1QWUA 3BUQA 3WIJA 3K4DA 3PZVA 4CCDA 5DT5A 4GI8A 2PF0A 2ZUUA 3U57A 3QR3A 4AZ5A 5GPRA 5DO8A 1UD5A 3ARUA 3WDRA 4GO9A 4DUVA 4NRRA 5I0DA 3AIRA 3SURA 4PCSA 1CIUA 4U2YA 3VVGA 1V3MA 3OLEA 3SCNA 3KZSA 3OZPA 3RDKA 1KXTA 1M04A 1QW9A 5BRPA 5CPSA 5BCAA 2J8FA 2GSJA 1J0HA 4WJXA 1E55A 2YDRA 1V3HA 3GXFA 3EJPA 3OLIA 1HWWA 1HJXA 4HZ6A 5A6KA 1BF2A 4P7LA 2JIEA 3EDJA 4BF7A 3PZUA 4TTUA 4AD5A 1AVAA 2GDVA 2EO7A 4PUEA 1V0NA 4CU6A 4Z2LA 2WMFA 2GUYA 4DO4A 4UFLA 1CGUA 4A3YA 3SUWA 4PTXA 4H04A 1A47A 3GH7A 3W28A 4M80A 4KGLA 3IGUA 3VSVA 5LA0A 3WD1A 2J7EA 5AY7A 2EBNA 3A47A 3ECQA 4AZIA 2X05A 1JGIA 3JUGA 3AS0A 4HPGA 5LYRA 2IXVA 1UWIA 2WMIB 2QF8A 3WMBA 1FOBA 4J3SA 1HKMA 2PWHA 1QI3A 2O9RA 2XN0A 5I5RA 1PAMA 2FHFA 2W66A 2XJ7A 2WCAA 2WZEA 2Z1KA 3N11A 1ZS2A 4QP0A 3ZR6A 4GZJA 3LRMA 3LX9A 2CEQA 3WMSA 1ISZA 3AMGA 3ALFA 3PZ9A 4D6DA 4PTVA 1OGSA 3H55A 3CH9A 4MNMA 2YLAA 2J8GA 5I3DA 4LGXA 3GBDA 1RP8A 1MXGA 2CBUA 2OW6A 3BUPA 3LPFA 2GVYA 1UQZA 4ATLA 4NZFA 1L0PA 1KCLA 1ESWA 4P8XA 1QW8A 3VNYA 2E9BA 2NW0A 2XWDA 1R46A 2G8ZA 3GXMA 3RPMA 2J62A 1E0WA 4FNPA 3BGAA 4B16A 2W92A 2XFYA 1C8XA 2DT3A 3W0KA 3VD7A 3AIEA 1UH2A 4LPCA 5E70A 1B9ZA 1TQWA 2WMGA 1GNXA 3LPGA 3VGDA 5IHSA 2O9TA 1OGBA 1UA7A 2ZUNA 3U5YA 4HMCA 3MV11 2F7RA 3LXBA 3T09A 1KBKA 4PMNA 3QOMA 1VEOA 2ZUTA 3TTSA 1DWAM 5A1AA 2F7QA 4D6JA 6TAAA 3BLBA 3HG5A 3AI0A 3MSGA 3PZMA 3T2PA 1E3XA 2CESA 3ARTA 3A22A 1HVXA 4B9ZA 3AYRA 2WKLA 2X2JA 3CLWA 2EXOA 2F1AA 3AIWA 2OYLA 2BVTA 4UZSA 4MB4A 2WZHA 2DH3A 4TX6A 4W89A 1E6QM 4NI3A 2UY4A 2OYMA 3MU7A 3TP4A 3K8MA 2WVVB 3OZOA 3NUKA 3ARXA 3HN3A 2WW5A 1G01A 1FFRA 3AHXA 7CGTA 3U7BA 1E6RA 3WQ8A 4OIFA 4BA0A 1NARA 3PBGA 4PCTA 3W53A 1CGTA 4FK9A 1HKIA 1LL7A 1GVYA 4W93A 1E5JA 4D6EA 2VRKA 2DT1A 3SCWA 2EPNA 1VJSA 3NCOA 1KGUA 5GNZA 4KWUA 3W27A 4B15A 4BQ5A 2ZUVA 1M01A 1SR0A 1OT1A 5A2CA 1R7OA 2DT0A 2QHAA 1C90A 3BSHA 2WHLA 2J75A 1LL6A 2X09A 3QHOA 1J18A 1NWSA 1HJQA 3ARYA 3VDAA 2YL8A 1C91A 3WENA 3DX0A 1MYRA 1SFSA 1EH9A 4JKKA 1MXDA 3EJTA 1QBBA 3BAKA 1GOMA 1CXHA 4U33A 1V03A 3GBEA 1L8NA 4L4PA 1TG7A 1K9DA 1LG1A 2YDSA 4OUEA 3VTRA 4K68A 2CXGA 4FNTA 1IZKA 1EO7A 3AMCA 3A3HA 4JHOA 1FP9A 1CGYA 1EHNA 3I3EA 1SYTA 2VO5A 4W8AA 1R75A 2BY1A 3VIJA 3N13A 4PMVA 4D6FA 3VD5A 2F18A 2ZX6A 1QVBA 3LXAA 4Q22A 4QAWA 3S5ZA 3GNRA 5A6JA 2IGTA 2RGLA 3F5KA 3KLLA 4NF7A 3HG4A 2V5CA 2Q8XA 1UKPA 4AMXA 2XSBA 3K8LA 3L2LA 4UFHA 1E1FA 1IV8A 3OB8A 1RD6A 3WH5A 3N15A 4E8CA 2WSKA 2WYSA 1OB0A 3AQUA 1H3GA 3AZSA 2VNCA 1K9FA 3WDQA 4MAVA 2XWEA 5A8MA 1YQ2A 1C8QA 1HTYA 1LQ0A 2Y8KA 5D9PA 4LYRA 2UWFA 3ARZA 4XUYA 1V3IA 2XIBA 4EE9A 1O7DC 5JBEA 2VURA 2VT0A 2E8ZA 4AYSA 4AIUA 3BC9A 1BGAA 3VD9A 5A3HA 3SUUA 3GXIA 1ZJBA 3KEHA 4PMQA 1JNDA 4CCCA 1NOWA 1TQUA 2OWWA 3HU7A 4EAMA 1WZMA 3CMJA 2VZTA 1ZL1A 3F5LA 4PMRA 1I1WA 2AMGA 4PTWA 2FHCA 1JFHA 4LYPA 2BY2A 2BXZA 3CZ8A 1BYAA 1WAWA 3A23A 2F2HA 4HOZA 5I78A 2D0HA 5FIPA 2GK1A 1ZBVA 4MTVA 1R86A 5ABFA 2E4TA 2YKKA 3EYPA 3W81A 2VQTA 1X6NA 4MPKA 1QNOA 5E09A 5IDIA 1UHVA 1QPKA 1E3ZA 4AZCA 2DQXA 2J47A 4GINA 3D50A 4F9JA 1E43A 3BVTA 3K46A 4URIA 2DSVA 6A3HA 4YN5A 5I24A 2FGLA 1FHDA 5CLWA 1UZ4A 3AMLA 1GQIA 4GI9A 2J7FA 3CHDA 5FCZA 1H09A 3BSGA 1S46A 3MKKA 2OSWA 3BUIA 3D3AA 2XVKA 1C8YA 1VBUA 3RJYA 4PUDA 4JKMA 1UKOA 1HJUA 1OBAA 2FGZA 1R47A 1JZ2A 1V0MA 2F1BA 1ZB5A 3FN9A 1A3HA 4J3VA 1C7TA 3WUBA 2FE0A 1TMQA 3VGFA 2EPKX 1QWNA 4F9DA 1J0KA 2OSXA 5KEZA 1R34A 1V0LA 4CD8A 4RE3A 1EIBA 4GO8A 1NP0A 1E6ZA 5CLTA 4EANA 3WEZA 1PIFA 4WLCA 5D8ZA 1UR1A 2XTKA 4P7RA 4D6IA 2EQDA 1UKTA 4W84A 2O9OA 1JYVA 1FH9A 5HPOA 1H41A 4IISA 1M03A 4CVUA 2GK1B 5BROA 2CKSA 3MMDA 5ABFB 5A8NA 2ALWA 2XFRA 5E9AA 2YJQA 2ZX5A 2GJRA 3GH5A 1VFMA 2VR5A 1WZAA 1Q6CA 4UNIA 3VX0A 1JYXA 1NOFA 3BVWA 4AZCB 1TVNA 4ZEPA 4W7VA 3BCFA 4U3AA 1JF5A 1J0ZA 5EMYA 4HOWA 3ALGA 5KZ6A 3WELA 4Q7NA 3M6DA 1ZBKA 1B31A 3UG4A 1CXIA 1UG6A 3MI6A 3AXIA 4MAZA 2Y8VA 4Z2HA 3DECA 1HP5A 3WY1A 1WDQA 3IJ9A 5A8OA 4D1JA 1RPKA 3IJ7A 1B3ZA 2VVNA 1KR1A 1H49A 1SMAA 1GCYA 1W1YA 2JIWA 2GJXA 1ISVA 1QI4A 4JHZA 3KLKA 1N82A 3ZJKA 1PJ9A 3EDDA 3WD3A 5IFTA 7A3HA 1ODZA 4X0NA 1QNPA 1GVIA 5LA2A 5BXPA 3CUGA 3A4AA 3NIYA 3POHA 1GQJA 1KTBA 3WY3A 2VX5A 8CGTA 1JFXA 3B9DA 3VDBA 1ZU8A 4B3KA 2QMKA 4Z2GA 1Q6EA 2BS9A 3WBAA 1EA9C 4UTFA 3WN6A 3GM8A 4ZENA 2BXYA 1G9HA 3OLGA 1CXLA 1XV8A 2DDXA 4UOZA 1EQCA 4AZBA 1E6PA 3POCA 3ZQ9A 3TONA 1U33A 3MUAA 2BHUA 1K9TA 3UG5A 3RCNA 4AD0A 3N9KA 5GNXA 3CTTA 3GH4A 1VFFA 3EJUA 1Q6FA 3OLDA 3PZGA 5A6AA 3BVUA 3VIFA 2WK2A 1J0YA 2A3CA 3BAIA 3ZJ6A 3MUIA 3NSXA 1J0JA 1UWTA 4GPNA 1LJYA 4U31A 2C8NA 1VB9A 4HZ8A 4GKLA 1OIFA 3AS1A 4PMOA 1EDQA 3BUDA 4D71A 2D3NA 1ODUA 3WQVA 1JDCA 3SCTA 3G6LA 2VL4A 4IM4A 1CGWA 2J7BA 1TE1A 3WQWA 3K1DA 1H4PA 2WHMA 1OT2A 3G6MA 3ZJ8A 4AW7A 1OD0A 2CBIA 1VEPA 2VTFA 3UERA 3ZO9A 2X2IA 2W62A 3MO4A 4V27A 3CHFA 1PBGA 3PZIA 1B0IA 1EO5A 4W8LA 3DYPA 1BSIA 2VZUA 3MMWA 1V0KA 3MS8A 2XVNA 2XN1A 4ZFMA 1MW0A 4PYSA 2F7OA 2ZXBA 1J10A 2ZICA 2ZX9A 2QLYA 2D0FA 2WPGA 5TD4A 2YLLA 2BHZA 5IHRA 4DWSA 3FHAA 2D24A 4IPNB 4Z2KA 1XYZA 3F5JA 4PBGA 2VJXA 1V6XA 3UESA 3EMZA 3WFZA 4CUCA 3TTQA 2EAEA 3LRKA 3O6AA 1UD2A 1GQKA 2DH2A 2WVSA 3VINA 1HJVA 3B8SA 2NT1A 3WL0A 4P8VA 5CGTA 4C7GA 1W3HA 1KGWA 3NJ3A 5E0CA 2CITA 4W87A 2WVUA 2PC8A 3GNOA 1MW3A 3WDIA
chains in the Genus database with same CATH superfamily
1YYLH 1FNEA 1NDTA 1EDTA 4IF2A 3EA2A 2OSYA 1FWRA 4N9GA 4K39A 5CIPA 2FSEB 5GGUB 2WC4A 2ZXQA 2XH7A 2CM6A 4MBOA 2XNAB 4LEQA 1V10A 1MAKA 4AH2B 2WVTA 4G8AC 5ECJE 4FAAB 5HNNA 4LCCA 1WWBX 5L4IA 5GRVL 3FFDA 4MA1B 3M0JA 2Y4SA 4APQA 2PCEA 3LS5L 5E5MB 2DORA 2WV3A 4QRAA 4DTGH 3ZXWA 2YXGA 2ABBA 3AHTA 1E4MM 2I26N 1NMCB 4XUGA 1V3LA 5GGSY 2HX8A 4FPSA 1CLXA 4UM8A 1UWXK 1U8OA 2HMIC 1XWVA 4DNLA 3SCUA 1C93A 2ITDB 2MRYA 4HKXB 4ANWA 2ZZ5A 2A7BA 4JM2B 3PL6A 4ZAKC 3CM4A 3QC0A 1I8UA 1F3TA 2EE0A 3OGVA 1W0VB 2EXTA 5M3WA 4XAYA 3EBHA 1XGYH 2CCWA 4WF7A 1V51A 5J8OA 4F2UA 3SJVE 4UT6A 2XZ7A 2JLLA 1R8LA 3ETTA 1BWLA 3K0YA 5F9WC 2ADFH 2MCPL 5EPDA 4FMVA 4EXQA 4R27A 1FGVH 1II4E 5TQ0L 2G75B 3JUZA 1TTBA 5GS0H 2FECI 1S9WB 1SLVA 1N9PA 5I1HH 1PZ1A 2EXYD 1T66C 2VN5A 1E8WA 3WXWL 3RAJH 1BX2B 3FUDA 1N4XH 3LMYA 1UWGH 5T1MA 5IHZA 2PLTA 4CW1B 4QS5A 4RBPH 2Y7DA 2WNGA 2WLLA 4X80H 1DQTA 3WNJA 2EE6A 4PY7A 5EBWB 1LBLA 3DFHA 2NWSA 3URBA 3E12A 5I17A 3B3BA 1E4WL 1W8SA 4AUYA 1C9SA 5EEYA 1P7KB 4ZMNA 2W4XA 3UGUA 3OM3B 1I7ZB 1QI2A 2OX5B 5LA1A 5E2TL 1TV2A 5ECUA 1PX8A 1HCYA 1KFLA 4KF1A 1HXJA 5H8DA 3Q6FB 4HF5H 2FZ8A 5INCB 3UZQB 2X6BA 3HC4L 3QG6A 5KAQF 4UIKH 3FT9A 4LLDA 1MF2H 4E9SA 2K6ZA 3PVFA 5J56B 4ICWA 1AW2A 4EDXA 1BIIB 2NYYC 5FW6A 1ORQB 1OTSC 1G9ML 3TPUB 4WKZB 1QO5A 5F1OB 4ZX6A 5E03A 3DGBA 4PJDE 5AKTA 1TB3A 3O05A 4PTMA 1F3XA 2XUCA 4PFMA 4NAMA 5KJRL 1Z9NA 3QTPA 4OVVA 3SCRA 3BH9A 1CWVA 5IBLC 3URAA 3TVMB 2VDPH 2JLPA 3GSVB 1WZ1L 3RR4A 1SBSH 1GY1A 2V6AA 1F8TH 3GQYA 2WWOA 2BWGA 4EAEA 1KNWA 1JBJA 2Z64C 4OLEA 4BCZA 3CV6A 3V6ZB 2AJZA 4P59L 3TIDA 3WJXA 1I3GL 3ET9F 1OFAA 5I3FA 1XKYA 3OSVA 1J5IA 3C2AL 4UTAA 4JO8A 1INQB 5KINA 1RXOB 1DVZA 1GYNA 3NA9L 1NBVH 4E68A 2J25A 3KBPA 1UZ8B 3O4LB 1C92A 5HK4A 1UYQA 5IK3A 1UKQA 3L4UA 4NKOA 3W01A 3DGGB 5E6ZA 4Q6YA 5CP3H 2XU2A 1W5OA 1UR0A 5IMOB 3JV5A 1PTGA 3LENA 2EH8H 2YC1B 5SWZB 3S36H 1Q65A 2CO6B 1NLBH 3QULB 1O1HA 3C5XA 3D4YA 1OCOB 4QXWA 1ADQH 1PEZA 1OWRM 4FQ1L 3MLTA 3WK1A 2XWXA 4ODUA 4ZFGL 1NCTA 3A6CH 4E9WA 4CDGC 4R83A 2R0ZL 2IAND 5AKQA 4K7YA 5F1IA 1TTUA 2VXUL 3MJMA 2WCSA 4MQ7B 3ZTJH 1H7RA 3F6LA 3W11D 1KJVA 4IZGA 3JTBA 3TN0C 1IVLA 5HBBA 1WFMA 1AJ0A 3B4YA 4N0UE 1G9NH 3H70A 4FFZA 1FO0A 2B1HH 2QCFA 1Q7ZA 4OZOA 3D08A 2ZA1A 4LOUD 3FQNA 2P26A 5I18H 2VDGA 4BUGA 3RVTD 4X9IA 3T0CA 4KI5D 4IGBA 1N8FA 3SECA 1XF5B 4JIIX 3KYNA 5J9PA 2YYUA 3B7RL 2DV0A 2DKMA 3ZE2F 1F58H 3L3GB 5G4MA 4FQQA 5DLLA 2P8CA 4M9PA 5HHPA 3E6FA 2C1IA 2XKSA 3N25A 4QYOA 4QEGA 4L5FL 1MIEL 4HAGA 2QVNA 3FT0A 1OALA 3QJRB 5FV1L 5D2NC 2CIPA 5IQMA 4QUOA 4TSBL 3LSOA 5D5ME 4E5TA 3W25A 2ZRYA 4JHVA 5IB5A 1NGPH 1L6GA 1Q4WA 2VEGA 2HS6A 4JN8A 1IKNC 3VCLB 4ATTA 1H2JA 1UWEL 5L8LB 4MASA 4P0DA 2NXZD 3S96A 2HPMA 4HUVA 4ORIA 5CPOA 2HRPH 1XF3B 1ZVYA 1FYTE 1Z6JT 3W00A 4XN1A 4PTTA 1BJ8A 3DI0A 3DO7A 1NL0H 4GRWF 3M1BB 4GMTL 4D0CA 4O2CA 2FWUA 5J6GA 1Q3NA 3QQ4B 2N4IA 1N0XH 1XIFA 3LQZB 5T1LA 5I9QB 4JTHA 3PGCA 3QQ9C 2VH5L 4X99A 5BV7C 1PZSA 1UXWA 1OWWA 3UZEC 1O9WA 4XMTA 2Y5EA 3N14A 1AKJA 3LNFA 1OSPL 4U05A 2E8YA 4PRWA 1QU4A 4L3AA 5I28A 2N56A 1UP3A 4ONGL 2WBXA 3ML9A 3ZL1A 4PL1A 5C7HA 5EF1A 1TMLA 2A6DB 4JZNB 5EKYA 1I45A 2HKHL 2O6FA 2QVMA 4UBDD 5EPMB 4MSSA 3QUHA 4FZEL 3UC0H 3V4LA 1WCQA 1YMMD 1E8ZA 1AGCA 4K5MA 4QE5A 4DAGH 2CLOA 1KYDA 3SZ6A 1S1PA 2LOEA 1LO5A 2CO2A 2MTAA 1E72M 1I2PA 3FFCE 3QIWB 4YCPA 3IJ6A 3IAQA 1TJIH 1U6AL 1O5XA 3IJIA 2BOCB 1I1FB 3MRFA 3EFDH 4X6CB 4KK8D 4YSQA 3RM8A 3QXDA 2GT9A 3S9DB 4KJWD 4D72A 4DPBX 4ZE5A 1NAMA 3CVHA 3BQUC 4W5ZA 3FQ2A 4HH9B 4FG2A 1BG9A 4FS0A 5LAXB 4MJJA 1N7ML 1XIJA 3FO2B 5GSRB 4PJ9A 5DJAB 4GUGA 3A21A 2I07A 1WKYA 2DYPA 5EIIA 5KANI 4RNRB 1TJHL 4ENLA 3NZGA 1W8EA 1NWRA 1VCBC 2BP1A 1T99A 2MCAA 3W72A 1FCCA 4NSBA 2C79A 1YY8B 1G0CA 2FO8A 1Q8AA 1NY1A 1OTUD 4NQED 4KXAA 3NQAA 2XG4B 1CGXA 4XAFA 1JZ3A 1KCBA 3QLLA 5LN4A 5K9QI 5EMUA 3LKPB 3O6YX 4MOZA 2VFDA 4JY5L 5GISL 2R6OA 4FABL 1RFDH 1QOXA 3O7UA 1IT8A 4PJEF 4LPYA 5D2YA 2FB3A 3PZTA 4JM4H 4EF8A 1T7ZA 4OFKA 2APFA 2F54A 3IMVA 1UB5B 3PQYE 5KYXB 3I7QA 1MEIA 3NSNA 4NJ9L 1TYJA 1OE2A 3DX2A 3OKKA 2FH6A 4IL0A 5E4OA 4KUZH 2YD4A 3SKOA 2UY2A 2NR6A 32C2B 3NVTA 4PMEA 1RVKA 4CVXB 3R5EA 2OLHA 3RZCC 4L1BA 3RM9A 1Z9LA 2CLRA 3FY1A 1J5HA 1OAXL 1H8LA 2GVGA 1YDOA 2I5YH 3FB8B 2OTPA 4UFMA 4O8AA 2DVTA 1CLZL 4KJYA 1GTHA 1UGKA 2FQIA 5A95A 1OK4A 1ZHAA 2VN7A 1IF2A 5GQBA 1RIUL 5FF6B 4MA7H 2ZCGA 4Y4HC 2FR4B 1PZBA 3QNXB 3WKMH 4CVZB 1WICA 1NDGB 5KYNA 3NOYA 3QBUA 1EO8L 4TXEA 3EUDA 3T2QA 4FCHA 4C5YA 3NCXA 4ZT1A 3PP4H 3LSBA 2L0DA 4E42B 4PFEA 4R7OA 1CB4A 3NSFA 3RGVB 1RCXB 3M0VA 3OAYK 4ZW7A 4BK8A 4O2FB 4XNZC 4ACZB 4FHBD 1T7WA 2OSLA 3BPLC 2E6DA 1JERA 2WXOA 2GQ3A 4DX3A 2FL5A 2UWEA 4RUBA 1S7WA 3EDFA 2R2HA 3BUQA 4IRJA 5JDSA 4KQNA 4GI8A 3A9IA 3WJWA 3QSKB 3LNMA 3S35L 1T6WA 3KPMB 3FRPB 3VFGL 5D8JL 4TRPH 5JUEL 4PRHD 2D7NA 2MNUA 1O1ZA 3QDJE 3KZSA 3O2WL 2XH0A 5E2WL 3EJCA 1LBMA 4R26H 4S0SD 2CG9X 4P7LA 3C12A 3LRSB 4TTUA 1OX4A 1W80A 1SDDB 1IBBA 2DQFA 2GDVA 3TQKA 5JHAA 2NW2A 4XXDB 1BEUA 3KLQA 2YPLA 3HG1A 1E9QA 4QHLB 3NIDF 4NC1C 2PCQA 4Z7IA 3UBXG 2B77A 5DVPA 4BZ2L 2FEDC 3FTXA 3IGUA 2J7EA 4N5ED 2EIBA 2IDSA 4NUWA 5I6NA 4LEXL 2WMIB 3TO4B 4NQ1A 4UMGA 4MMXB 1K4HA 1XLEA 2WXKA 4G8GB 5DZAA 1ZS2A 3BRDA 1H3UA 3CVDA 5FOJA 5DUML 1EXHA 4LNRB 4BWTA 2WBJB 3BH8B 4PUMA 4OCNC 2DL2A 3OVPA 3IB4A 4TVPH 3DKLA 1IYXA 4QRRD 4O02A 4JZOA 1UQZA 2QS8A 1KCLA 2AQQA 1F56A 3VNYA 3RAOA 4JO4L 5DZJA 3NPUA 3EOUA 3AIEA 4ZOCA 5IJDC 3GYEA 1F6YA 2Y63A 2O93L 2WMGA 4UDUA 1RZKC 3RPDA 4U6VL 4INFA 3EOOA 5AN7A 5CD3B 5JYMA 2MHAA 2IDCA 3G1YA 1HHJA 1J8HB 3TBWB 4RGNE 3VW3L 3DGDA 2F8XC 3FQUB 4N0FB 3BGJA 3LHVA 1RCYA 5KSAB 3AI0A 2H26A 1ME9A 1J1PH 5ECGA 3CFTA 4WI9A 1CF8L 3HOJA 3VQ2C 1EHLL 5T9BG 3K8MA 4AQZA 1G6RL 1FBIH 2VGLM 3BN3B 4PS3A 3T78A 3PUOA 2W6RA 2HH0L 3O6FC 2ATPB 3VFSA 5EIIG 5TPWL 5D6DA 3HB3B 3S3DB 1E5JA 1Y6NR 2CRIA 1D8CA 4LUIA 5EC1B 5GNZA 4LSTL 4M5ZL 2P8BA 3RWDA 3MRDB 3GSMA 4C5ZA 1A80A 1FP5A 5H35B 1LL6A 3M41A 1VHNA 5GHWL 3KDMA 3VDAA 3AG4B 4LV9A 1XDMA 3QCTH 3AG2B 1A6TB 2RKXA 3A64A 4GIYA 4UWQB 1OB1B 2BSTB 4Y4FC 5CILH 1UQSA 4WENB 4WUUB 5EZJB 4ORMA 3WS6A 4LVNC 3TXZA 3MBXH 3DSFH 4JG1L 4A2MA 3S5ZA 5B8CB 1D9EA 5I8CB 2Q8XA 1E9YB 1D5MA 1N19A 4QDGA 2HJPA 4B3ZA 3W70A 1AFVL 1EJOH 1IARB 2VDKB 3MV8D 3W9EB 4RZCB 3WAKA 3FXIC 3AZSA 2VNCA 4NKIL 1L8PA 1T1YB 1G1OA 2X4RB 1ZT7A 2OO6A 1SO5A 5TDOA 4FOJA 4IS6B 4IU2B 4P5KA 3VXNB 2WQXA 2H6PB 4HIJB 4PMRA 1GJPA 3A13A 4C6MA 2AAVA 5LG6A 4U1IA 3CSPA 4UXDA 4LC6A 1AH0A 2F2HA 4XODA 3Q5TA 2D0HA 4OZFH 4UMCA 4IDJH 5SWSE 2YKKA 3QJAA 2NX5E 1HINH 3K5SA 4TNFA 1QPKA 2L7EA 2A6IB 4F7CA 1NCJA 1YNKH 1JXGA 3ZKNC 1SGKA 3ZUCA 2IADB 3IFNH 2E6QA 5GRWA 1EEZB 4GI9A 1LWRA 5FCZA 3QDMB 4WJ8A 4BH8A 2XVKA 4OUIA 3WLBB 4AV0A 2R27A 4JDTH 4JKMA 3P9WB 4LQFH 3GUTA 2IVFC 1X7FA 3KYAA 3N55A 3R94A 4CNOA 3M5VA 4H9MA 4JTUA 1KM2A 5SV4A 4MFEA 1UM6L 4FX8A 4KO6A 1MHHA 1MCFA 3CU2A 1TYGA 1A1OA 3NIGE 1PIFA 2EQDA 1W3IA 3NQBA 1H41A 5HPOA 1YPZA 4CVUA 1JZGA 1FDJA 4Y5YA 2GJRA 3OQRA 1Z5LA 4G1EA 1ERNA 3DV6B 3MLRL 1H5BB 3CHVA 4HH8A 2ZOKA 2B9AA 3DH7A 3MGAA 5KZ6A 4GAJH 3LIZL 5FA4B 5I76B 2UZ9A 4JM2C 2FLIA 2QDWA 4PBXA 4DVBA 3QWOB 4FKEA 3T3PF 2Q8BL 2W8CA 3NSYA 1E8XA 1W1YA 4X4KA 2ZWLT 5F44A 4L1WA 4QI3A 4OI9A 1BZOA 2PTTB 5EMKA 1Y07A 3T4AA 1LEGB 2Z93A 3VXRA 3T6WA 5BOOA 5JHDA 4YHLH 3CUGA 1LEIB 1W6TA 1RHHB 2FMOA 3UOAB 1B9KA 3VKCA 1JFXA 4E4FA 4N2LA 4M7JH 4PLKD 3VDGA 1Z3RA 3CFBA 3SE4C 4Q4OA 4QDPA 4PWFA 2C26A 4IWWA 3FC8A 4WWPA 3DX5A 4WWID 2ADJB 3PGDB 4ZMVA 3OJDB 3GWQA 1GTEA 3BVUA 3T55A 2XINA 1QUNB 1JPGA 5KVFE 3BOXA 2GSMB 3EWDA 4J8RB 3UCDA 3B7UX 4DPCX 4FI4A 5FOBB 3B8WA 1C5BL 1CGWA 3TPKA 2DI9A 1M3IA 5HHOB 2DI8A 4FHKA 4IIGA 3W2KA 3K4ZA 2AJXL 5C9ZA 3CXHJ 3DYPA 4H2HA 4WCJA 1AYRA 4QRNA 1V0KA 3W0WA 2QJMA 1Q7QA 5FM5M 1UP0A 3KVLA 2A6KB 4XRCB 3W7NA 2NUTA 1J1OH 1E4JA 1ETJA 1M1XA 1T83C 1U3HB 4Z1AA 1HZYA 3IXAB 1DN0B 1GQKA 3T3ME 1MFBL 1LDPL 3PF2A 5E0CA 4K2SA 4C1LA 3EG9A 4X60A 2KLTA 4LU5H 4LCSA 4OV5B 4PMUA 2ADGB 5G55A 4Z0XB 5CLYA 2J1WA 4A6YL 2OEJA 2MPVA 1XGTB 2GYIA 1Y65A 1JPFA 3UXKA 3KPRD 2B7DT 1CDHA 4ATDA 4U10A 3AHZA 3GJEA 5C92A 2E3VA 4W85A 4LLVB 3T05A 1OE3A 1SHSA 5L6YH 5DLML 3KHJA 4F79A 1Z3GL 2QCHA 2ZOLA 1CB2A 1KV3A 2CKBL 2WLYA 3VIPA 3WF3A 3G9VA 3S3PA 4XO3A 5U7SA 3OC8A 1B3WA 1BVNT 3TNMB 3BN9C 3PTDA 1VPOL 3MSDA 1Y6MR 5K59F 4JPGA 4PD4K 2H47C 3VXTA 4P5MB 5KVEL 3F8UB 1BEXA 3V5FA 3O9WC 4FTVA 2D8KA 4CD4A 1D2KA 4A3HA 3OKDB 4M4RB 2J2ZB 1A7PH 4QRSB 1FZMB 4GH1A 2W1NA 3HV9A 3SEPA 2R1LA 1F2JA 1WV7T 2X0VA 3N1PC 3LCIA 3V7MA 4X0KA 2IH1B 4GYJA 3BTNA 2VO8A 3M7OA 3A3YB 4JAMA 4BXVA 2PGFA 1U8HB 3F4VA 4MMYB 4GBXB 1EDYA 1PKYA 4XVUC 1UROA 4HULB 1YEDB 5EEZA 3ZOAA 4ZSOB 4PRIB 5DRXA 3ZRSA 4JTAA 3Q4DA 3W1TA 2BS8A 2R69L 6REQB 3WUEA 1FVDA 2ZTJA 4BQCA 1TO3A 5D7IB 3PWJA 2CDEB 3VFVA 1TWWA 5FHBH 2VABB 4AHPA 5H37H 1AR2A 1VZHA 4JTEA 4E41D 1VHPA 2Z31D 4XNXH 1SZNA 4UCFA 3VB9A 3NQVA 3T0BA 1YSOA 1TRIA 2HAZA 5AG8A 2XY2A 4GQRA 3OF6A 3DFQA 5FJRA 2FBJH 1XRVA 5AL0A 1J12A 4HOXA 1M1BA 3BISA 2PWDA 3O8XB 2FDMA 4KT2A 5J89A 2YRPA 4LY8A 1GOQA 2W0LA 3DG6A 3DPDA 1RXLA 3EFFA 4X5XB 3M46A 3DIFA 4BFNA 2EDHA 5JW4M 2VQ1A 1PDZA 2ESVD 5CEXB 4O9HL 1B4EA 3MDWA 4HSAC 1MNZA 1A7QH 5D2NB 3PP7A 3TU6A 3ITTA 4XMLL 5C2XA 3TYUA 5HY9B 1WRFA 2Z3FA 1HKJA 1JHKL 4XMVA 5GZOA 3BSZL 4EN3D 1B4KA 4L9LB 3FTGA 2FO4B 2J21A 4TLTA 4XZLX 1LM1A 4U6YA 4S23A 5A2KH 2A3EA 3B2VH 5C0EA 3F7VB 1U91A 4M48L 1QRNA 4D9QE 5I9QC 1X5YA 3TZFA 5E8EA 2JI3A 4Q6IA 3NQIA 3FJ4A 1WWAX 1QASA 2YXFA 1QRQA 1XRSA 1K8DA 1W54A 3ZT7A 4X2RA 3HMWH 2WLHA 1L7IH 3MCOA 5IJKC 1E5UI 2XV6B 1JNEA 1TEYA 3VXSE 5CEYA 1OAYL 5B7EA 3D3VB 4NC2B 4FEIA 1ZNNA 2HK0A 2PTUA 3DC8A 2YXWA 5FHAL 5TH2B 5MERB 4K3EH 4ERAA 4JY9A 2VR2A 1D5IH 3GMMA 3BGFB 1GGTA 4F2EA 2HNEA 3RXZA 1HJSA 3QUYA 4ERSH 4PV8B 4MMZA 1W2PA 3RM4A 3FUIA 4IHOB 4DI8A 4PJCF 4MJHA 4WFFE 4K23H 2EO9A 4NQCD 1IQDA 5TDNA 4PJBA 1CGSL 2VZOA 1I9IH 3H9ZA 1BTMA 3PJWA 2V7NB 3HC0B 3KPOA 4HFWB 4OQVA 2EINB 2YUZA 3HHSA 4L23A 4GCXA 1IGYB 3M7SA 2I69A 4M1RA 4WI5A 5KITA 1B5TA 1XLDA 1SFHA 1TJ2A 3HHMA 1NFDE 5DJYB 3CYVA 2V5TA 3KYMB 5EUKA 4FX6M 9RUBA 2DWYA 4XP5H 1MZHA 2IH8A 3LOTA 4KQ0A 1BQKA 4FXGC 4Z7VB 3N17A 1RJLB 1NAML 3PHQA 3HGJA 3CVHL 4QJ4B 4QLKA 1I60A 1ZCCA 3WFBL 5C9KA 3B40A 3DFNA 3B9EA 3HE7A 1EKOA 1Z9SB 1B2WL 4IBUA 2HT4C 3HI1B 1GPOH 2D9QB 1AZRA 3ECBA 2ZUXA 1FH5H 5FECB 3QPYA 3AB0C 3VXME 4PRBB 2PTXA 4BI5A 3KBHE 4Y1AE 4MWAA 2FJGB 3RO8A 4PJ5B 2ZYIA 5HDOA 5J8LA 3O6MH 2F9BT 1JN6B 3W7HA 1TZGH 4G43A 4AQ8A 3RIFK 2EEDA 4HXAH 3WFHB 4GKSA 1ZGLB 1IBDA 3L3JB 3LJ3A 1XMWA 2H32A 3EO0A 2BDNH 4P3DA 1HKVA 1L5GB 5JHBA 2IALB 5E2UH 4G6FD 5GGTL 3PNWA 4LLMB 4O11A 1B57A 4J7RA 3IMRA 3JWDC 1HQTA 3KPTA 5IGXH 5I8EA 3NABL 3EH2A 3SOBH 2J7HA 2BTMA 4AM0A 1JPMA 5EC2A 2AQ2A 4NQUA 3HQNA 2DTML 1NH6A 1T04A 3RVXD 3RZCB 3ATZA 1K5WA 2DQDL 1QFOA 1FL6B 3P02A 3I9GH 2YEZA 1Z89A 1NP2A 4JO2H 1I9RH 5HYJA 2WZ6A 5AYIA 2YPVH 2QAPA 3EFOB 3RWHA 1FVPA 3P60A 4E36A 2EVGA 1XQKA 3CHPA 1W91A 4N9GB 5CIPB 1D7KA 1XGDA 4N0CC 1VH7A 3GFXA 3IK2A 5CGYC 2PRLA 3E0WA 2A83A 4XB3A 2WZPD 1WDPA 1VEMA 1RA5A 1CG9A 4EPEC 1G9EA 4L1SA 2BNQD 1BF5A 3DVNA 1V02E 1FFNA 3BVDB 4BYHA 2X4QB 4X4YA 3FO9B 2F38A 3LEYL 3MXWH 3CZGA 3SRKA 1ITBB 1W37A 5C9JB 1TVPA 2P3YA 5IVZA 1T7VA 2R0LH 1KXQE 4ZXOA 3GTNA 1OGPA 4QF1A 5C0DB 4K7PY 4LSQH 4XNZB 3ZE1E 1I8LA 4DJDA 4AW4A 3RYSA 6ALDA 4NRZB 4HA1A 1NCIA 2Z91B 4DF2A 1AH4A 1FTXA 4JW3A 1R3SA 1RV8A 3BE1H 3HKZA 1WH0A 3PL6B 2EKSA 3FQWB 4RE2A 2CLVA 4H4NA 4LLWA 4MD0A 3DK2A 4PBVC 4B97A 2G3NA 5HHVL 3G5VA 1YMHA 4P2QB 1DANT 1NBQA 3D5HA 4CQBA 3W7DA 4PQXA 2VRAA 3LEVL 2OL3H 3T07A 4BZ2A 1SJEA 2Z24A 4IMFA 4R90L 1SJAA 1OLZA 4ZX3A 1DVJA 2BV9A 4C1KA 1VADA 4S3JA 3LNIA 3CMGA 2WZIA 5EU5A 1H15B 4JFQA 2D2HA 4UINH 4F48A 4XMKH 5D9MA 2I57A 3N3EA 2ZUMA 1WD9A 1Z42A 4NKDA 5AYQA 4MMXC 2EEXA 4LP8A 3FX4A 2JJTA 3NMEA 4FNUA 1M7XA 2E1DA 3TFBA 2XWBA 1QSFE 2WMJA 3D46A 3OGRA 4HA4A 2WBJC 2HT2D 3V0TA 3S4TA 3UZ5A 4EUPG 3SPVB 1CXFA 2YQ2A 2X9XA 5IHZB 4ZBCA 5LHFA 4D9RD 4CNIA 3MDUA 2PYEE 5DYOB 3GI9L 4M3HA 2W9MA 4PUJA 5EBMB 1CICC 4NQSB 3VOFA 5KYWB 4PY7B 3M17A 3WBWA 1PDYA 4JFDD 1CBVH 3VOGA 4I1PA 3L6FB 3B9AA 4ERGA 4F0KA 5C54A 1CZ1A 5T1JA 4NO2B 4V2BA 4QOKB 3WJLC 1CD9B 1IAOB 5D2LB 3U0TA 1G6RA 4IFOA 1N8IA 3B43A 1HSAA 4LLDB 2X4NB 3V9CA 4YS4A 5KZMA 4G6ML 2WD0A 4EDXB 3CCHA 4TMPA 4LNYA 2XYLA 5I3JA 5AQ0A 1IGTB 1JXJA 1N6VA 4WO4D 3T6ZA 2BNUA 2JCCA 4WFGE 3NK4A 3PP3H 5XINA 1W9UA 4H8PA 3NQEA 1VLIA 2MOVA 3HB3C 2E7LC 3O6FB 1F4YL 1UR4A 4Z76B 4WQ6A 2POTA 4N7QA 3EEGA 3GUWA 5CCKL 4ONVA 3G1AA 1MW2A 3TIDB 1C1EL 2QV4A 5EFDA 4J3XA 3ARFA 4HV8A 1PG7H 1UXSA 3GZ3A 4DBUA 4ISVA 3EPOA 3DOHA 3E8VA 4W6WB 2J78A 5ABGA 1UACL 2CKRA 1RAKA 2EVHA 4HK3J 4N2KA 2EPLX 2VR6A 4O0ZA 1VIZA 2PURA 5TIMA 4M24A 1ACYL 4Z1CA 3QZBA 3X14A 5GS2H 7PAZA 1FE8L 4LVNB 4JLRA 1FQ0A 4LHUA 5B8CC 2VMEA 5DJDA 3MBEA 4XSMA 3TLRA 1A3LH 4H9YA 4JKPL 2FDSA 4GVGA 2UZYA 4JNZA 2N0KA 3FYPA 2J8FA 1UW9A 2Y5QA 1LRQA 3VQMA 1S7QA 5TK4A 3L7FA 5ICXA 3MLTB 1FVEB 4I3GA 2OXHA 4I87A 2IC2A 3KBEA 1XAKA 1YBQB 3M5ZA 4ODUB 5C0RL 3A5FA 5D30A 3SUWA 1DDHA 5KTEL 3BQVA 1A47A 5JU6A 2DAVA 4KGLA 2NY2B 2BH0A 4Z7NB 3VCNA 1N68A 4KVNL 4YK4B 5LYRA 5I5IA 2OTUA 1FWTA 2GJZA 3QUZD 3WMBA 2K45A 3QARA 4C6BA 1MG2C 5DJCB 1GRWA 4YBLB 3HZKA 4NBYB 1O5KA 3ESVF 1XYAA 3ORWA 3CS2A 1FO0B 4YSUA 4JNXA 2XPGB 5I30H 3ZN6A 1K4CB 3FQNB 4I48B 15C8L 3PWGA 2ASHA 2B4GA 1ZLUH 5DD0L 2FUQA 4A2DA 5HJLA 2GSEA 3LPFA 3KYNB 4OCWL 3KHQA 4F8OA 4OM1L 2E74C 1U3JA 3M8OH 4K36A 4FQQB 3QPQC 4YZWA 2GUOA 4YWGL 3UTOA 1BWMA 3IXTA 1OCNA 3E6FB 3Q5YA 4IIZA 5HYQA 5IHSA 5LIWX 3RNQB 1EQWA 5D7LA 3T09A 1UOLA 4Q6JA 1WD8A 2ZUTA 4PA8A 2R14A 4UNLA 2VYOA 5D7JA 4RPQA 3H2OA 2XIOA 1LRNA 4ZUVA 4PTDA 3LIZA 5EU6A 2R29H 1U2CA 3HE6D 3CIAA 5BS0A 4Q8NA 3UC2A 2Y0FA 1H5BC 2F1AA 4UILH 3UDWC 1KT2A 1CFVL 2BMKA 6TIMA 3KGUA 3NUKA 5DDHA 2WUCH 4OGYL 4FSAA 2V2CA 3SO3B 5HJGA 3C6LD 5J4MA 3DO7B 1TZIA 3IPWA 4WNSA 4Y9PA 4L61A 5J6GB 3TM6A 3UBXB 4US5A 5T1LB 2Q7NA 1KCXA 5AW8B 1RUML 3MXVH 4OJEH 2J6VA 3EOEA 3V0VA 2V2WA 2RDTA 1KD0A 3GI8L 3I4KA 1MAJA 1T21A 3DETD 4B5SA 1R0AH 5IQOA 4H1LG 3GDLA 2VDIA 5BRZA 3NPWA 2QLVB 3NURA 2GITA 1AGCB 3C56A 4LP4A 3N9RA 2GUUA 2DU2A 3LKOA 4UFHA 1E1FA 1GKEA 4Q9QH 4DEUA 2R4SH 5E8DH 2LLGA 4NGHH 4U6TA 5IWLA 4PW9A 1MWAB 3OKLA 1V7MH 4UT9H 4H0IA 2K4WA 2E68A 2VURA 3Q13A 2IWKA 2Y06H 4RMSA 1MELA 1XIWC 3SUUA 4ZD3L 1JNDA 5F9AC 2LLLA 2EAWA 2GT9B 3MLZL 3CQFA 4N2BA 1U3HC 2O7SA 4HN8A 3WNIA 1WAWA 5ID1A 3IEAA 5MKGA 1FFTB 5IBTL 4MTVA 1MCLA 5DD3L 3C5ZA 5A3ID 4A6YA 2Q3AA 3GW3A 5DQ9B 4PJ9B 3S88L 2ACQA 3IEBA 2DYPB 2ZSVA 4YTSA 4R3UA 5AD0B 1RK7A 2OJEA 1F45A 4NKCA 4NJAH 2HLAA 3F2CA 4AEIL 4L4LA 1GKOA 4GW5A 4QXIA 4FIRA 2A3LA 2XBTA 2CKBA 4DUOA 5E4IA 2EPKX 4ZOAA 2J1KA 3PWLA 4MZ2A 1S8DB 1AOZA 1EP3A 2NQCA 5E9XA 1SZEA 5E9DE 2XY1A 2ZRZA 2GK1B 1HJBC 5D72L 5ABFB 5EO0A 2XFRA 4GOAA 4EMZA 3EBIA 2X4TA 2G3ZA 4AZCB 2F54B 3LY0A 5ES4B 4YXLL 4LHUG 3GTHA 5M94B 2W81C 5BZWA 1CE1L 3GJFH 1PL3A 1Z5YD 3E0LA 5IJVB 4Z7UB 4MAZA 2VERA 3L5LA 4P57A 3V8CA 3SKOB 3O9WB 3QIUA 3IJ7A 1AH1A 2AKMA 3BRFA 3QH2A 2XFXA 1YDNA 4WTZA 2GJ6D 1LBFA 4KTGA 1P1XA 3WD3A 4N2OA 3E8UH 1A2YA 3IE4A 8CGTA 3P9MB 3V35A 2HZGA 4MQXC 3QMTA 1QR7A 4I9WD 1A5MC 1CXLA 4LAQH 4GBXC 2R69A 1EQCA 2RHGA 4GUPA 5AYUH 4IX0A 3TMLA 1BXNA 3RLHA 5J6HB 1IEWA 5GNXA 5U4NA 5I1EL 3STGA 4LT7A 4F2ME 4Q4MA 2WK2A 4DP0X 2NXYD 4CQCA 4ODSL 2QGDA 1PY0A 2HG5B 4GKLA 2FQDA 3UXFA 2ERJC 4PMOA 1L6XA 1GZGA 2RDXA 1X9QA 2KDGA 2XBDA 1D2PA 3PUDA 4G5ZH 1IC4L 1OT2A 1OD0A 1S4IA 3CSTA 3NAAL 1EUUA 1UPMB 5MENE 3OKMA 3CHFA 2OSLB 3MBWB 1SVCP 2ZSWA 1TJXA 4NP9A 4OJCA 3O8XC 2F7OA 2ZICA 2Z8RA 4XNMA 4L3EE 4IRJB 2XX1A 5JDSB 2Y7OA 3T0WA 1AMKA 3STEA 4FERA 2WXPA 4GSRA 3BSZA 2EDRA 4R4FL 1MIML 4Y19D 2KBGA 4WGHA 2MJWA 2P9RA 1KDJA 3SSJA 4GD0A 3WDIA 3H26A 5TE6L 4OTXH 1TA3A 1XH2A 1BW8A 3I3DA 5HHQA 2ZZ3A 1B6UA 4L9LC 1ZE3H 5E0KA 1Q1JH 2R1WB 2NW2B 2RB8A 2QIIA 4JFTA 3HG1B 5AKRA 2F53D 4EI5D 3PFMA 1L9MA 4XAWL 2W38A 5K1JA 2K78A 3VKDA 2PR4L 1B1YA 4OZHA 5M95B 1MCCA 2NQZA 1VACA 2VLJD 5DVKA 4A7UA 3LXCA 5D4YA 2XTLA 5DD1L 1BEYL 4NZJA 4KFZC 1A14L 4M82A 2V68A 3VCRA 5LZLA 4QDMA 1RY8A 1DJHA 2XOTA 2FB4H 1DUZA 1JDDA 3CZSA 3BUVA 1TYRA 4H2CA 3EB4A 4PUWA 1MZYA 3BGFC 5IFJB 1D3HA 4XBPB 2CBQA 2XGZA 4F58H 4PMFA 4MAYA 1XINA 3ABMB 3GINA 1XH3A 3B4UA 1W32A 3SRHA 3O0RL 2C14A 2CHRA 5AEAA 5GRXG 2MHAB 5M03A 1HHJB 1DZ0A 3NQKA 4ZXBD 4JRYE 2H26B 3JVGC 2BIQA 4HWZA 5MP6L 2E0PA 1H6FA 1P53A 5IM51 3Q48A 3DERA 3CXDH 4RDQG 4AL8H 1K6QL 3OMIB 4O5LL 1CZ8L 3CVIL 4JPVL 4XZ4A 4AX7A 1EMTL 3GZPA 1UM4L 1WLHA 3TN5A 3UGRA 3NDYA 1LO4H 4LF3A 2IFFH 4DN4L 2GY5A 1RUQH 3RWDB 1SYSA 4PN2A 3H9HA 2FFCA 4FXGB 4O13A 1QYGL 2YL9A 3PWUB 2HFEA 5FPIA 3GPEA 7XIMA 4OLYL 1I7TB 3VFOB 2BVPA 2HE5A 1PY9A 4O2EB 3N12A 2DYSB 5H2ZA 4MJ6B 5FK9B 5H8PA 2X41A 1ZEAH 5A6IA 3KWWA 3AB0B 1Z9PA 3GAKA 1HHHA 4ODTH 1GYVA 2X7VA 5GGTA 1D5MB 2DFAA 3XINA 5CINH 4QDWA 5D6CB 2QMJA 1TSIA 4JIQA 1LMKA 3HZMA 4LYQA 3HBZA 1N2VA 3ULVF 4IXXA 1GKPA 4LL4A 4IG2A 1TV7A 4V28A 3N41F 4PWKA 4G9FD 2ZZ6A 5G1YA 3EPNA 1KFGA 4WTZG 5HGAA 4H8VA 2PBOA 2HYMA 1JVOA 2BY3A 4TX9A 1F4HA 4DWDA 3AMKA 1ICSA 3H54A 4FLOA 4HMDA 5FYJH 1P84J 5EZOH 1T5WB 2CBMA 2X8RA 5D1ZA 3RGTA 3ZGIA 2GJLA 4PW3A 4Z95L 4DW2L 4KO7A 1W0YT 4MY1A 2QADC 1Q4NX 4ZTPH 4B5UA 3DJ9A 1EZVY 1U41A 2YBVA 3VYPA 3OX8A 3WH6A 4A39A 5BMFH 3IANA 1MFAL 5D1QE 2BRRL 4C56E 5EO9B 4JQ3A 5CD5C 2IPKB 4DBDA 3ES6B 4OLUL 3L4VA 1EC9A 2WCPA 5EOCL 3DJTA 3ZDZE 3I6KB 3SIZA 1YMMA 1ZRQA 4H9ZA 2ZFAA 3BP7A 2Z0IA 4PUNA 5AHNA 3I2CL 3QWQB 1SM3L 3BUBA 5I0WA 1A9BA 2AF2A 4LCCC 3BMVA 3QFWA 4EWND 4H8WH 2Y9RT 1MHHB 2JTDA 4X6FB 4AZ6A 1FDZA 4TSAH 4APQC 4HALA 5C0JA 2J8OA 5DCDA 3W7LA 3QM3A 1GYUA 2VMJA 4NBXB 3NJHA 1IEVA 3WEOA 1V8HA 2C9SA 3ZKXC 1L9RA 1PNDA 2O5XL 3NG5A 2B0SL 2JMRA 4GUFA 2IUZA 1VFTA 2VR8A 4RDBA 1JDEA 5AZEL 4Q4KA 1AO7E 2IAAC 3HG2A 2P53A 1U1UA 3W73A 5K9QG 3PL6C 5FEWA 1O7VA 3KPPA 5IF0B 3W7JA 3TC9A 1N7KA 4L4JA 4S3FA 3GRGA 2ABAA 1TWIA 1JRHI 3IVUA 1DANU 2M1KA 1L6SA 5CJOL 3T4AB 3VXRB 4PJIE 4POYA 4Y88A 3QEQD 4OVXA 2Z2BA 3T08A 5JXED 2OYPA 5CUSH 3ZDYE 3OAZK 1MQPA 3JUYA 1TUXA 2QDDA 2JTYA 4NQEA 2RCSH 2VGGA 3ZE0E 3HFTA 3IRDA 4BJHA 4Y16D 2WMPA 2HVKA 2IQ0A 2MNRA 4NNPH 1CI1A 1S7TA 4A2EA 1U92A 2JWYA 4V1YA 3W82A 3VOIA 4F3HA 1OAZH 3PBMA 5JA8B 2V5MA 3M1CA 4ALAL 1I8IA 5IFHL 3P4LA 3NA8A 5CNHA 1S3TC 4Q4IA 2XVLA 3W1RA 3LH2H 2Y25A 5FJIA 4OB5H 1HH6A 4LRSA 3M5YA 3RA7H 1LP9A 3WNNA 2VM3A 2AERT 1U8IA 4LCRA 1E0VA 3IMSA 1CICB 1QHZA 4P06A 4WKFA 3TBTA 2VGIA 4O57A 5DFWH 1ZWIA 2XPZA 1IAIM 2Q76A 2GTWA 4ML4A 5T5NF 1M1XB 3PUUA 2Z7YA 3T1GA 4KAQH 2NTSP 3T8VA 5FUOH 2D31A 1KJ3L 4XNQB 4MNHA 1TVHB 1EXPA 4E3VA 1DBJL 3M45A 3VI3A 1SJCA 1OP9A 5FO2A 4QTIL 1DWGM 1FFOA 3QAZB 2C16A 3OZYA 3GTVA 4XE5B 2P5EE 4GT7A 2DEPA 3IU4L 2DKSA 2RMNA 3NEVA 4LCYA 3KPNA 5KVGL 2YDAA 5HGGS 4FR6A 1YXCA 3KTCA 1NSNH 2E7FA 1IQWH 2CAKA 3WY2A 3EX1A 2LV4A 3GJEB 1HNYA 1MDAA 5CSYA 2R9HC 2OZ4L 3BKMH 2ID5A 4UOQA 1JGVL 4S2BA 5FYJE 5EEVA 3G5EA 2KERA 3IAPA 5H8MA 1A4MA 1NAKL 3WQ6A 5DEFA 2F19H 2UX6A 3BO8A 3CUJA 1DBTA 4YBQC 4BY3A 3MRBB 3HS0A 4AD3A 5DANA 4JPIB 4OGAD 4UC5A 3VA2C 1DBBL 1QR1B 5FS5A 1E15A 2J12B 4WSGA 4XCEB 4XCFL 4Y9BA 1E9ZB 1KFKA 3S37X 4C57C 3TTYA 3GDBA 3W37A 1EJSC 4HSOA 3VOHA 4LGPB 4PRHA 1GOKA 1N70A 4MIMA 5AAMA 3PLYA 1CPUA 4JKLA 1FV1B 1CL7H 3VO0A 1ZSXA 2ATKA 4LAJH 2PWUA 2PWVA 5DT1L 4X0KB 3GDKA 3FHQA 1KCKA 5C3TA 4WX2A 3OXSA 4RISH 1FG9C 4JAMB 4FQJL 5H4YA 3UXIA 3F5WA 3RHWK 1DLHA 4XHJD 3IGKA 4IP4A 5KN5B 2NY2C 2FECL 3B9KD 4DWSD 4YK4C 3VFMA 3T0VA 1AZBA 3TV8A 5DRXB 1J01A 1IBHA 1AR1C 2MANA 3N2TA 4YBLC 5HD8D 2HNHA 3A4FA 3BE7A 4B0MB 4R8WL 4O1DA 5C09D 1DVSA 4GKNA 2DD8L 2OMYB 4LRTA 4JY6A 3VFVB 4JO5A 4WWNA 4LZKA 3WIHH 1W1IE 3DMMA 1H0IA 2BJML 4IGBC 5KVMC 2QHRL 2YA0A 5AKVA 2OJ1A 2KMWA 5DURB 3MHZA 4YR6A 4L3CA 4A05A 2XZAH 1AQFA 2G3JA 1BBJA 1HJWA 3K6DA 1GOGA 4YZFF 3Q8BA 4BQ3A 1PX3A 5D7IF 3USZA 4PS8A 3MJ9L 4M7LT 3W2DH 4ZUWA 4PB9H 2YGPA 3UJJL 3QSRA 2UZXB 1IGFH 1GY2A 3EFFB 4X7DC 3MV9A 3DIFB 1EWHA 1YHPA 4F0HA 4HT1L 3VFUB 5G2HA 4Z77B 1J93A 3EH3B 5FL1A 3HFYA 1N5YH 3EGSB 2I5QA 3DZ1A 1FWIC 2GY7B 2VLLA 3NP3A 3DXAB 1A5FH 1XZ0A 2DSKA 2JALA 2J56A 5J04A 3IFLL 2XTJE 1FAIH 4KBPA 4TVPE 5DXWA 1RSCA 3WXVL 3OG3A 1KN2H 1NPJA 5K3VA 5D1XE 3IT8D 3H2CA 1AQ0A 3SO3C 4U6YB 1T03L 3FSVA 4DQOL 2WJEA 3I6GA 5FDWA 3S3SA 2GAZA 1QRNB 1R5IB 5JPMA 4NO0B 1D8WA 1V6UA 2DQCL 3GVQA 4Q6IB 1KO0A 4FMKA 3U4BH 4BV1A 4O52A 2R4RL 1BM3L 4HMEA 2B4CC 1VFOA 1W56A 4MLJA 4QAMB 2IGLA 5CEYB 1VYRA 2Y1HA 4L37A 4PHZA 3WAJA 5JHMA 4HSQA 2NX3A 3LLDA 3H9SD 3SDOA 1TENA 1VBGA 1DE5A 2AJUH 3GAYA 3WLTA 4EUPB 1TJGH 3STPA 3HPLA 3GMMB 2BCMA 3SURA 2B1OA 2XT1B 1ECQA 4AY0A 1KNOA 1M3JA 1MI3A 5C0BD 2QUUA 4R88A 5BCAA 3ULUH 4I9XA 3V5KA 2XKNA 3MV8A 5A6KA 2ZTBA 4G82A 1OLLA 1AVAA 2PMQA 4Z2LA 2WMFA 3V5DA 1PFCA 5J57B 4MY8A 3KW8A 3KPOB 2VR7A 4PCKA 1XIWB 3HHSB 2OMWA 1S39A 5I0ZA 4J39A 3FS2A 3ECQA 4JYEA 1JGIA 1X5JA 2OKOA 2KQNA 3NJVA 3DTDA 3RFAA 1FOBA 4L1DA 2CLMA 4YGAB 1E7VA 5EUKB 1A9EB 3CHOA 5K9JH 3ZR6A 4XP9H 4NFBA 4PJ9C 4DPQA 1M7IB 3LEXB 1JK8A 3PHQB 4V1DB 3GBDA 2AJYL 2H9GB 2XN9D 2C9QA 1WQ5A 1O5RA 2PCFA 3UIZA 2X1OA 1ROCA 2EGZA 3MJWA 5DZPA 3ZZ1A 2X7LA 4FQCL 1PQZA 1ESWA 4ELMA 2Z4TA 5C1MB 3E9AA 3HE7B 1C8XA 3T7VA 4R3SB 5E70A 1S7VA 4L4TE 1GNXA 3Q8EA 3VGDA 1FAKT 3MB9A 1OGBA 3GHRA 3HBLA 1KULA 1KBKA 4RDVA 4H7CA 5DK2A 3COTA 1U58A 3QVQA 5GGVH 3G0UA 1S78D 1OGTB 3G3LA 3A22A 3QGAC 4GKSB 2CXEA 2NZ9C 4CQDA 2YCJA 4PCYA 1MUJA 5ESVA 2H32B 3EO0B 4P3DB 2FWSA 4NI3A 3MROB 3OVQA 4L9DA 3ARXA 2CHDA 3K91A 3PNWB 3P2BA 5GVJA 4XZIA 3NJGA 3HS9A 1Q9WA 3KFTA 3TYCA 3WQ8A 5HJYA 4MNGA 3DX9A 3WLWC 2DIAA 2OPCA 1H7XA 2NR6C 1DQQB 4D6EA 4D0DB 2EPNA 2WXRA 4AQ1A 3W27A 3UZYA 3T5WA 4S1DC 1T04B 4RSYA 1QLRA 5A2CA 3S3GA 2J75A 1UFUA 4DWHA 4MYAA 1J18A 3RN6A 3ARYA 3BKCL 3C8KA 1RZMA 1L9SA 4FTDA 1UVQB 4NP4L 2VDHA 3TCEA 2VXQH 1NUNB 5SX4H 1CXHA 3WOVA 4HJWA 3M0ZA 4FNTA 3NL3A 4DKTA 2OK0H 5ALBL 3WFEL 3G6JF 2H8ZA 4YUEL 3VG0L 3UBHA 3BT2H 3WLHA 4PMVA 3KH4A 4Z18A 2X0SA 1IT9L 3DVFA 2A83B 4J3OG 3ABLB 1YO4A 4PJGE 1CG9B 2G0LA 3SHSA 4HUWB 5DD6B 1EEYA 1MCBA 2VD9A 3EGXA 2F0CA 3DVNB 2D4DA 1ZANH 5BQ7A 4OIIL 1W0WB 4GLRI 4F33A 3N15A 4X4YB 1OD9A 1VCAA 3WD5L 1W72L 1C8QA 1KM3A 3UMNA 2ERJB 3APMA 3HI6L 4PRRA 3C5SA 5JBEA 2UXTA 4QF1B 4YDIH 1ZJBA 1L6FA 4BHYA 5AVRB 4CCCA 1TJPA 2RH9A 1Q45A 5HDBB 2MIZA 3L13A 2BBFA 6PAZA 3J07A 1SQMA 4IRJC 1D6VL 1JVNA 1LGVA 4JB9L 3LN4A 1WUNT 2VDQH 1OL0A 3A23A 4UM9D 3BG5A 1KG0B 1M5WA 2EKSB 4I4WB 5E8OA 1ZBVA 1LORA 4AXWA 2G5UA 4LLWB 4MD0B 1X6NA 5D4HA 4XT1C 3K3QA 4NQDB 3PG2A 1PKMA 4N0YL 1YMHB 2KUTA 1F3JB 2Z35B 4F9JA 1G4SA 4W9FC 1WAPA 1OCJA 3UCRA 2EVFA 1TFHA 3BP5A 1KGIA 1MREL 4P2RE 3KPRA 4PN6A 1VADB 4J6RL 3UGXA 3V5CA 4XAKD 1NIEA 5EU5B 2X3AA 4F2BA 5LNRA 1YN7B 3ALXA 4N8VA 1YEHL 4JFQB 3OEXA 5AVNA 4RH4A 1HHGA 5F7EH 1GVOA 2DS4A 4NKDB 3WG6A 4DP7X 3H24A 1PBYA 1FORH 1G7UA 4ADUA 2NUPA 5FCUL 3E0FA 3RNKB 2A2IA 2BSED 1FH9A 1M03A 4GXFA 5HPMA 5BROA 3HIJA 1GGBL 2K9FB 4ICCX 4H1LB 2DQUH 1RUSA 4UYQA 4WVRA 4G71B 4X98B 1XLMA 5LB1A 3BCFA 4ZQRA 2X1WL 3LHZA 3UG4A 4IMAA 4JTRA 2NQ3A 3AXIA 3M17B 3RWJB 1F02I 3DECA 4L8SA 1IM9D 3PG9A 2IDTA 3LAFA 2H3NB 4IQEA 3PXJA 2JI1A 4RMBA 4ETYA 1H49A 4Z0BH 5J6SA 1OYBA 1IEAA 2IQ9H 5MEQA 3SYQA 1YXYA 4I3SL 3D2UD 1GVIA 4AMKH 2HJFB 4E0RA 3D1MC 5EZIL 3O6LL 1RPUA 1EJ7L 4D3CH 1ZT4B 1G6RB 2QMKA 2BS9A 1EA9C 4UTFA 3WN6A 4GE8A 3FT1A 4NSKA 4Z3FA 3RPTA 4UOZA 3CCHB 1P2CA 4PJAA 2H1LM 3VA6A 5MI0B 2WXJA 3SPIA 4NO5A 1C8VA 1H5YA 2BNUB 2JCCB 3ELQA 1N0LB 4O51A 5DS2A 3N9KA 4FZ8H 1Z7JA 3X17A 2G0KA 4F7PB 4OFDA 5D6DC 4Z08A 4WI6A 4GKZB 4XN8A 1QSZA 4AGLA 4Y9GA 4GPNA 1KCUH 1OSYA 1KFJA 1TQBB 4U1SA 1CUOA 2VWEE 1LROA 4BWLA 3ARFB 3GSRA 4HV8B 2J7BA 2E9WA 5F4WA 4ISVB 4OD1H 2KHAA 1EPXA 3RVWC 2GABA 4OCXH 4JR9L 4RZ6A 5GRYA 1W17A 5C0CD 1C5CH 4MLSA 3D30A 3PB0A 2XN1A 1VS1A 1P4BH 3WS6C 3W5MA 3OKYA 2WPGA 1G87A 4PJHA 5E2JA 1S5HB 4QG6A 3FHAA 1R6WA 3HZYB 5KUMA 4GAFB 3C09B 1M57B 4PBGA 1S5IH 4JLRB 4LSDA 1RZ7H 1WFOA 4ICNA 3NSDA 2EAEA 1YTKA 3MBEB 4QITA 2QQ6A 2DH2A 3X3GH 1QAWA 1TLMA 4XVTH 2NT1A 5BO1H 1K85A 3MA8A 2EIJB 4W87A 1NCAL 3O3BA 3PJLA 1NGYB 2SEBA 4FA6A 4YIWA 1S7QB 3TT1H 3WV0A 5ICXB 3FCTA 5T8IA 3A4WA 2QR0B 1SJHA 5C08D 4LVHC 1SJXA 1MNUH 2YD2A 4AFYA 2CGRH 4S1FA 5FI8A 1DDHB 3BP4A 1H7OA 3W7EA 4PVMA 2BP0A 4DGWC 1PD0A 3BKJL 4O28A 3WD2A 2E7HA 1XIDA 2D2JA 4N1CA 2OTUB 2MNJB 3GSNH 2GJZB 1EHXA 3T6XA 1LCOA 2I25N 3T71A 3W1MA 1NFIB 1LD9A 3G18A 1XG3A 1DBMH 1I4FA 1OF2B 4EIVA 3MDJA 3RUGE 2QADB 5AC6A 4Y90A 3TBBA 4F37K 1F18A 1NLDH 1FNEB 4XKYA 5DMIL 1YG9A 2ZBTA 2JJVA 3A4EA 4IW4C 5HYQB 3PWPE 3LD8C 3NL2A 4Q9CA 2W80C 4LCCB 4DP2X 5DEZA 3VSTA 2OWXA 5IFAH 3ZIMA 4LSUL 3FFDB 4NQCA 2X1IA 1ONQA 3JV0A 1TDQA 4APQB 4K0OA 1DQLH 3EGDA 1Q1PA 4IPPA 3OVGA 4Y5YC 5EU6B 4DGIL 1TTRA 4QRPD 1UCTA 4AC1X 1EZLA 3ZKXB 3N34A 1BZ8A 2W9EH 3LB0A 4UM8B 3TYGH 4FFYH 1O6TA 1U8OB 3THAA 4G7RB 4QSHA 2D0GA 3MHFA 1KBWA 2HLFD 1LJMA 3CSGA 3WJYA 3TO2A 25C8L 2AABL 3AICA 4R9XA 1GXEA 4GX9A 2PWFA 2NY4B 5ADPL 3MP4A 3V0WH 4F9LA 1WFUA 3BAEH 3VD1A 5AVHA 3UABA 3BJFA 1D9KD 2G5BA 4TV5A 4H8UA 3T4AC 2VFGA 1ZLSH 3H7LA 1B3OA 4H4IA 1PUDA 3KUMA 3URQA 1F0LA 3QUXD 1Q8JA 4ECLA 4JM2F 4XNBA 4N8VG 4Q8MA 4XNYL 3XIMA 2QVFB 3FK3A 1WFIA 1PD1A 5AB9A 4AZHA 4TNWF 2IKJA 4ROQA 4OLWH 4XOAA 1Z6KA 2W63A 7PTDA 1BXVA 2J8HA 2VLRE 4K7VA 5DY2A 4S3AA 2FQEA 4L1XA 4YU1A 3AMDA 5BRZB 5DRIA 4FI8A 1PKQE 4KVPA 4DYKA 1GORA 1CS6A 1MAML 3QORD 3ITVA 3GW0A 4KWOA 3PDOA 3SJNA 4R7LA 4R4BA 1VBRA 4M5PA 5BVPL 5I00A 2PWEA 5IB4A 1HFBA 3P4OA 3HF3A 5T1MB 3MWCA 3OKLB 2YLKA 2FX9L 1V55B 1LWJA 5F6HI 3L08A 1JIBA 2WLLB 4GXPA 2WHVA 1JZDC 3LVTA 3ZLGA 4TULL 2CBJA 5I17B 3IPFA 3HMCA 1SHXA 1GHFL 4KZDL 5XIMA 3OHIA 3P0VH 1CLYL 2UY3A 1XS2A 5C6TL 5I7GA 5ID1B 5MKGB 2WYTA 2Z7WA 1DLFL 4QLLA 1G9MC 4TPRL 1Y0LA 1ZVSA 4AGPA 4LVBA 3MSPA 3QG6B 1S5MA 3QAZC 3HGRA 3CV1A 4GG6A 5HXMA 5AYBA 4LUSA 4ACPA 1GQNA 3ARBD 2OZ4A 2HLAB 2ZCKL 1PZ3A 2P5PA 3PHAA 3ANVA 4GW5B 3OZLA 3FB6A 1GOWA 1Z48A 5KJ4A 4L64A 1RK1A 3RCMA 4E2VA 3W83A 4MNLA 5C2GA 3VDCA 5FL0A 3BH9B 3QNFA 1L7TL 3ZK0A 5BQDA 1MCIA 1E9PA 4NXSA 4F0RA 1TFVA 1WAAF 2PGRA 2MOGA 2AJZB 3MI2A 2ZPKH 1XHGA 2CCRA 3O63A 3WO3B 4MTMA 2FYYA 2UXVA 4YGVA 1L6ZA 4GYPA 3S35X 4ILSA 5F3HA 2VXTL 2VR4A 2X4TB 3FONA 3FDWA 4H20L 4RWYH 4KO9A 3R19A 1UM5L 5KS9E 5T33L 4NRSA 1KTLA 3KJ4B 1YQVL 5EOTA 2Y0SA 4H9VA 3UYRL 1IXPA 4PW4A 2TSBA 2EF9A 3AAZA 4AJYV 5F96L 3SE8H 1WSST 3UZWA 5IK3B 5JMUA 2F5BL 3MZ2A 4NKOB 5FKAA 2X40A 2A6LA 4O1EA 5JW4Q 3S5OA 3DDGA 2ZJSH 1J6OA 4DBWA 1TELA 4PP1C 3JBG7 4CNTA 4AKOA 5H6HA 4OLZH 2VC2L 3F2BA 2J77A 5I5JA 3G6AA 4PG2A 3GKWH 1A2YB 5BZDA 2ARWA 4DO5A 4ZS6D 4GUIA 4OT7A 2G4EA 4JY8A 4N9CA 2Z0UA 2BW5A 3PAYA 4UZUA 4IDLA 3JS3A 4GUPB 3W3BA 1DSFH 5F1IB 4MB3A 4E4PA 3B5HA 4K3DL 2M8XA 5F0MB 2VIRA 4HPNA 4PR4A 3LTYA 1AR1B 4KWSA 1KBGL 5DN1A 4XZNX 1KJVB 2QPDB 3UWEA 1YECH 2E6PA 3D87B 1SVBA 3GHTA 5I1KL 1KY6A 2YARA 3TJLA 1A3RH 1BXCA 1SFJA 4ONHA 1ASQA 3MJ9A 4S38A 3B97A 2XZCH 3HPXA 2YGVA 4IGBB 1T22A 4DXXA 2FD6H 1O94A 4IK6A 5J9PB 4XNUL 3OKMB 3MYPA 5G2NA 3EYSL 2V5YA 4JFDA 4HS8L 4P5TD 1Z7AA 2Q1EA 4XNMB 5HHPB 3L5WA 2R56L 1ZCOA 1ZTXL 4ODBD 3ISIX 2YGOA