3BLPX

Role of aromatic residues in human salivary alpha-amylase
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
496
structure length
496
Chain Sequence
EYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRARQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure-function relationships in human salivary alpha-amylase: role of aromatic residues in a secondary binding site
doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-amylase 1
total genus 176
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00128 Alpha-amylase Alpha amylase, catalytic domain
X PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3blpX02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3blpX01
1E3ZA 1MQQA 1WCGA 3L4UA 1ZBVA 2VO5A 3RDKA 3N04A 3AHXA 3VNYA 4CU6A 3WD4A 1QBBA 1J0HA 1UZ1A 2V5CA 1EH9A 3EJRA 1XSIA 1SR0A 5A69A 1XH1A 2OW7A 3O6AA 3DX4A 3ALFA 2IXUA 1JFHA 1AQ0A 1JZ4A 3PBGA 3L4XA 1VEPA 2A3AA 1US3A 4AISA 3ARRA 3W53A 3TTQA 2UWFA 3BVVA 1G1YA 1DWIM 5EBAA 4QAWA 1BFNA 3HG4A 3AZRA 4DM2A 4E4PA 2ZUSA 3AXXA 2J79A 1ZS2A 3PHAA 3MUAA 3NIYA 3ZJ7A 4C7GA 4MNKA 5ABFB 4A3HA 4GZEA 1OGSA 2VZSA 4U2YA 1YHTA 2A3CA 2OYMA 3TTYA 1XD1A 4UCFA 1E71M 1C8XA 2WMKA 2GJXA 1D7FA 3W25A 2ZIDA 3CUJA 3POCA 4FF5A 2YA1A 4ZE5A 3CHDA 3K8KA 4M82A 4OOUA 1E4NA 4Q7NA 4JFSA 1I1XA 1E9LA 3RM4A 1R46A 2Z1KA 2O92A 3SURA 5LA1A 1JFXA 4PMVA 3ARZA 3WQWA 1EO7A 3VM5A 3TTOA 1Q6DA 4UFJA 2C7FA 5F7UA 1BLIA 2DSVA 4F9JA 1ECEA 5IFTA 1ODZA 5JIPA 3TP4A 1JZ7A 3CMJA 1UR8A 2A3BA 3AIWA 2Y2WA 5LA0A 1EO5A 2CHNA 2CYGA 4PSPA 2ZX9A 2O9OA 1LL4A 1CGVA 3AHTA 1BYCA 3LMYA 3DYPA 2F7QA 2W4XA 1F4HA 3CPUA 3AXIA 4P8WA 1GPFA 1H49A 2FHFA 4LYPA 5E70A 4X0VA 1TQTA 1E5JA 4DO6A 1KR0A 3CZJA 4DUWA 3OGSA 2CXGA 4LXFA 1C8YA 5I77A 2XWDA 5D9NA 4UR9A 2JIEA 3BAIA 2WVUA 1HL8A 2XJ7A 5D9MA 2WHMA 1H5VA 2VJXA 1VJZA 3WNOA 1TZ7A 1CZ1A 2QF8A 3AIVA 3GNRA 2WC3A 1WKYA 1JZ5A 4BQ3A 4NI3A 1XC6A 1VFFA 4PTVA 1ISXA 3BC9A 4OGZA 5CSYA 3RILA 2RGLA 3ZSSA 3S2CA 1OM0A 2WWCA 3CO4A 3AS1A 1DEDA 4CN1A 5CG0A 2D22A 5E0CA 3WDQA 4C7FA 3WY2A 2VTFA 1ZBKA 4AZHA 5CGMA 1HVQA 3RCNA 1WZMA 3WELA 3SCOA 2Q8XA 5CSUA 3DYOA 1E5NA 2WVVB 1WZAA 1UOKA 1EDTA 4V27A 3H53A 4MADA 3WNPA 1ISWA 2J74A 4D6GA 4OUEA 4QDMA 3RIKA 1V3HA 1NM9A 3WD0A 3JUGA 4QLKA 3WQ6A 4AW7A 3B8SA 4CD5A 3T2PA 2WMGA 5CXPA 2PWGA 1JI2A 4BF7A 3OZPA 3MSGA 4RE3A 3SCWA 3WMCA 4JZ5A 3VVGA 2BHYA 5BWFA 2VQUA 5CPTA 1VBRA 3S5YA 3GXNA 1UWIA 3PZUA 3CZSA 3CUIA 4DWSD 3EDDA 1WNOA 3ARVA 2WW5A 5DFAA 2JF7A 4V28A 1H41A 3WBEA 3W37A 1ODUA 3ZT6A 1W32A 3SCSA 1WDPA 1UH3A 2EPMX 4L4PA 4MPKA 2GSJA 1KB3A 1CXEA 4KMQA 2XGIA 1I1WA 3AROA 3UR8A 4B15A 2F1BA 4UOZA 3FNDA 1UD2A 1UD8A 4W8BA 2WC7A 2OSYA 3WL0A 4B9ZA 4D71A 3CC1A 3W38A 3PZNA 1WP6A 5I78A 1R86A 4GQQA 1TMQA 3RPMA 4F9DA 3FN9A 1E1EA 3KL0A 2EADA 3S5ZA 4M29A 1OINA 5AYIA 3GH5A 4IM4A 1UD6A 2PWHA 1V02A 1J0KA 1HNYA 3WDRA 1J10A 2XSAA 1V3JA 3HG5A 3DYMA 3LRLA 3VSVA 2XVGA 1M03A 3O9NA 3ZIZA 4FNQA 3CBWA 2C0HA 1LG1A 3VD3A 4HA3A 4AMXA 1VRXA 1V6UA 2ZUNA 1DWHM 3ARTA 1PZ2A 3VIJA 1XRVA 1QI5A 3D3AA 4HMDA 5DO8A 3LXBA 1W1VA 2VMFA 4HZ6A 4OBRA 5JBDA 2WZHA 3CH9A 3AMKA 1HT6A 4AZ5A 3RJXA 3GNOA 3GNPA 1QHOA 1HJQA 3ECQA 3PZVA 3NSMA 4H2CA 4Z2JA 3MANA 3BSHA 3A24A 4DUVA 4ACYA 2CPUA 3ARUA 1MFUA 4GINA 3EMZA 3U7VA 3WBAA 1QVBA 1UQZA 1DP0A 1W9XA 2GJXB 4CCEA 2XIIA 3PTMA 1CYGA 2WHKA 1E1FA 1TQSA 3POHA 2WVSA 2CHOA 3TONA 4NSBA 4L4OA 3NCOA 3ZOAA 1JDAA 1JYNA 1FP8A 4AZIA 2BXZA 4Z2IA 1HKKA 1PIGA 2CKSA 1QI0A 2VX5A 4AD3A 4KRTA 2EBNA 3VKKA 3UEQA 3WSUA 4P8VA 2CEQA 4Z2KA 3MKKA 1BAGA 5D8WA 3IJ7A 4CCDA 1ZJAA 3A5VA 3BXWA 4HZ8A 4WLCA 1MQPA 4DWSA 1H1NA 4MB1A 2VZTA 5KZ6A 1PS3A 1EHNA 3T08A 3GXPA 4D6JA 2YDQA 3HJEA 5HXMA 1E6RA 4WKHA 2BY0A 2TAAA 5M3WA 2F7OA 4JFUA 2YJQA 2ZX8A 2WCSA 4HPHA 2W5FA 2AMGA 3OLIA 1FOBA 1G5AA 1VB9A 4JHZA 4JAWA 3RO8A 1VAHA 3VMNA 2OSXA 1Q6GA 2WM0A 2ZX7A 1O6IA 1UA7A 2J78A 1VFMA 3WF4A 3OLDA 4CGTA 3EJSA 5JUVA 1G0CA 1IT0A 1C3FA 5CQ1A 3OG2A 2NSXA 4NF7A 2DIJA 4JKKA 3PZGA 2J8FA 4D6IA 1I75A 4HPGA 1PJ9A 1KXQA 2F2HA 1BYAA 3AFBA 4TTGA 4QP0A 2VVSA 1MW3A 4BQ5A 3A22A 1FH8A 2EPKX 5E9AA 4W7WA 5DF0A 2ZUUA 3W26A 3VINA 1SYTA 5ABFA 3AHYA 2A3HA 1MYRA 1NWUA 2ZUVA 4PYSA 1XSJA 3LX9A 1WDSA 4J3XA 3VSTA 1V6VA 3EDKA 1W1PA 1HXKA 3VSUA 2DH2A 1CDGA 1ISYA 4AD4A 1E3XA 2XFYA 4NX0A 3A6OA 4UFLA 3J7HA 4DWSC 3BMVA 2DSWA 1J0JA 5ABEA 2VX7A 1GONA 1GJUA 1ZJBA 1W9PA 5CLTA 2XN0A 2YL8A 3PZOA 1E0WA 4PRWA 2YLLA 3B9AA 5FIPA 1XV8A 3CUHA 4FK9A 3I3DA 1OB0A 4PUDA 1ZBWA 1B3WA 1X6LA 4JCLA 3VX0A 2D2OA 1UWSA 4XV0A 3GBDA 2WHJA 4JCMA 2J4GA 4GI9A 4V2XA 3L4ZA 3VOCA 4S3KA 2G3IA 5AY7A 5A1AA 4ACZB 3QGVA 1MW1A 2WK2A 2XG9A 3PZ9A 3WUFA 2WCGA 2DT1A 3ZMRA 3ARSA 5GNYA 4TVUA 1U2YA 1QNOA 5M03A 5DT5A 3VGDA 3GH7A 1CGUA 4ML4A 1BVZA 1SFSA 3DX3A 2VZUA 5FKYA 4CD8A 1XGZA 3VDAA 3GXMA 4PBGA 1B90A 1C7SA 1HTYA 1JG9A 2D3NA 3WIJA 2ZUMA 1TA3A 3CHEA 1WAWA 1UWTA 1MWOA 3K1DA 3M07A 2WC4A 3CZKA 3ZR6A 3PZIA 5GQBA 3BVXA 4IISA 4W89A 1VIWA 3AMCA 4QFUA 1GQKA 1M7XA 5GNZA 1JXJA 3WEZA 3D50A 4AY1A 1VEOA 3AIUA 1U30A 2IXVA 4MB4A 1B3ZA 1HKMA 3ARPA 1V08A 1HJUA 3WF3A 1B2YA 4UQCA 3WY1A 4YPJA 4Q22A 5ABGA 2QLYA 1VJSA 5JIWA 3PZTA 2VL4A 2OW6A 1NOUA 1Q6EA 1W3JA 3KL5A 1ITXA 1LJYA 1TQUA 3OZOA 2OLHA 1UR0A 3DX2A 3T09A 2FYVA 5LA2A 3VIHA 2BS9A 2J7GA 1OD8A 1FH9A 1V6WA 3BVWA 2CBVA 3GM8A 4P7LA 1HN1A 2OWWA 1NWSA 1UD5A 2D73A 1OCQA 2FE0A 2W66A 1J0IA 1W9BM 2CNCA 5E09A 3BLBA 1CBGA 2XVPA 4R27A 2FHBA 2YA2A 4TOQA 3GH4A 3ZJKA 5E0FA 1JF6A 4D1JA 5HOSA 4CN6A 4DUXA 1GORA 1JNEA 2G3JA 4M80A 3TA9A 1QWNA 2PWFA 4TX8A 2WWDA 3WMSA 2OYKA 5D4YA 1TQWA 1D3CA 4K68A 3WDIA 2XM1A 4JHOA 4PMYA 2WBGA 2BY3A 7CGTA 3ARXA 2VUYA 1C92A 3HMCA 1HWWA 1V0LA 1JIBA 4AZCA 2PF0A 4F79A 4PTXA 1KBKA 4W5ZA 2YLAA 1BHGA 1OGBA 4TVCA 1V0NA 3W29A 1JDCA 1H4PA 3N15A 2V5DA 1CXLA 1UG6A 2PB1A 2V3EA 3AIRA 1WB0A 3SCPA 1RP8A 5C8BB 3CZLA 3KLLA 4NRSA 3M46A 3NUKA 2J8GA 1GUVA 1XHGA 5A2AA 4M8UA 4H04A 4W8LA 5ABHA 2ESCA 1KTCA 4XZBA 1PX3A 4HMCA 4JFTA 1HJXA 5A6LA 3SUUA 2GJPA 2VOTA 4UQEA 2D24A 3U5UA 3W81A 1GOOA 1MW2A 4D6CA 2E0PA 3DX1A 3GXFA 1JYVA 5HNNA 3VX1A 2CBUA 3OB8A 5A95A 5E6ZA 3PN8A 3DX0A 1MQRA 3VD9A 1KCLA 1L8NA 4KWUA 2V3GA 3AISA 2NW0A 1MXGA 1PX4A 4S3JA 2QPUA 3AMLA 2PC8A 1UWQA 3BMWA 2EEXA 1J0YA 3VMOA 3AIEA 2WHLA 1E6PA 4NZCA 2J7EA 1LLOA 3LPFA 4UQ9A 2XUCA 2XPKA 2XIBA 3LPPA 4RE2A 5I2UA 1DWFM 3F4VA 1E4MM 1BQCA 2UY3A 2FHCA 1MVYA 3IANA 3VNZA 1QBAA 1X6NA 5IDIA 2Z1SA 2PWEA 5CZKA 4QCEA 5FOOA 4BA0A 2CITA 3WEOA 1PBGA 2PBOA 4D6DA 3PZMA 4Y7EA 1MW0A 4WJXA 4GPNA 3SUWA 3U57A 3VPLA 1OBAA 3GTNA 1ITCA 3BUBA 1HJWA 3CHCA 3ZR5A 4W93A 5A2BA 2ZUWA 1QOXA 3KLKA 1JYXA 4W7VA 2JEQA 5HPCA 3L4VA 5EFDA 1LWHA 1QNPA 1GOQA 3KZSA 4EAMA 2D0HA 5A3HA 1HX0A 3AZTA 2XFRA 2X8RA 6A3HA 5GPRA 4W5UA 1QNRA 1V3MA 2ZOXA 1JDDA 3SUTA 2VCCA 1A47A 4FLQA 3BAWA 3WNMA 1YQ2A 3N13A 4AIOA 2XGBA 3VDBA 2ZUTA 1E0VA 1UR1A 3MU7A 2ZXAA 4WIWA 1ZL1A 3K8LA 1JL8A 1EDQA 3CV5A 1UWUA 2BVTA 4XUYA 1KBBA 5BXPA 3K46A 3SCVA 3WH5A 2GFTA 1AQHA 1E40A 1H3GA 3QHNA 1GOIA 3AIQA 1KXTA 1WZLA 3WD2A 4J3TA 5A8OA 3SCRA 4B9YA 4W86A 1J12A 1UR4A 5A6AA 4LX4A 2DIEA 1S46A 1VFUA 3L4YA 4FNTA 2HISA 2DDXA 3RM9A 5C70A 1GVIA 3KL3A 5A6BA 2B31A 1QW8A 3D5HA 2DPEA 2NT0A 4YHGA 3BAKA 2WLZA 3DDFA 1KGXA 1V3LA 3FAWA 2YIHA 2VT0A 3WNKA 3DECA 1AMYA 3OA5A 4MAZA 1E15A 1UQYA 4NXSA 1DTUA 1D2KA 3EYPA 3FW6A 4U5IA 3SCQA 2ZWZA 3APGA 3WFZA 3A47A 3LPOA 4HOWA 3WN6A 1Y7VA 1ZBCA 1V02E 1OSEA 2A3EA 3CUFA 3IAQA 1HKIA 3WQ8A 2G3NA 4TX6A 2E9BA 1HP5A 2DSUA 1M53A 1PEZA 2DH3A 4GXPA 1TFVA 4URIA 1WE5A 1VBUA 3LRKA 2BVYA 2F7RA 2X05A 3ZJ6A 4EK7A 2VVNA 4IPNB 3VIPA 3ARYA 1WZKA 2EPLX 1KWKA 3EMCA 5A2CA 1XH2A 4AIUA 4NRRA 4EANA 3GXIA 3FXYA 2XSBA 4H8UA 3A21A 1U33A 2V3DA 3OLGA 1B1YA 4MDPA 2WVTA 5M17A 1BPLB 3VIOA 2WSPA 1TR1A 4AWEA 1TCMA 2E4TA 4PN2A 1XSKA 3W6MA 4FNPA 3AQUA 4U33A 2J7DA 5JBEA 1VENA 3BGAA 4OBSA 2JIWA 1KGWA 4UQAA 4JKMA 1V6XA 3AJ7A 3OGRA 1Z32X 2OWCA 4J3WA 1EXPA 1E6ZA 4B3KA 1CPUA 3FAXA 4NZJA 3T0BA 3UG4A 3AHZA 1W1YA 3KE0A 4AD1A 2X0YA 4RL3A 3UERA 1TVNA 4GZJA 2VRQA 1W3LA 2DT2A 2ZXQA 4XB3A 4MDOA 3WUGA 1JZ3A 1JYWA 1O7AA 1E6SM 3WF0A 5IFPA 1GQLA 5HBFA 2WANA 2EJ1A 1J0ZA 4HZ7A 3A23A 1IZKA 4A3YA 3CZ8A 5HPOA 5A8MA 2W92A 2BY2A 4PMNA 2WLYA 2XYLA 3IK2A 1J18A 1RH9A 1EQCA 5IHRA 2XTKA 1WDQA 2WCAA 3IJ9A 3SUVA 1EHAA 1KXHA 5BRPA 1H09A 1GHRA 2GUYA 2IUZA 3A3HA 3U5YA 3II1A 1BVNP 3AIBA 4PMZA 1KFWA 3D4YA 1XD0A 1P6WA 4PMOA 5A6BD 5TD4A 1KQZA 1VEMA 2GJRA 2NT1A 4GO9A 4AEEA 1FFQA 3GXDA 5BROA 5DEZA 4U3CA 1TQVA 2EQDA 1GOMA 1V3KA 4UFHA 4PEEA 2PI6A 1FA2A 2XN1A 4U31A 3D52A 4MNLA 4FLSA 3VGEA 2UY4A 3D4ZA 1OT1A 3N12A 3VDCA 4XX6A 1R85A 2VX4A 3SUSA 1B3YA 4FNUA 5E6YA 1K9FA 4ZFMA 3AICA 4CU8A 2J77A 3VO0A 3WDPP 1KR1A 4ZENA 4ATLA 2GVYA 2X2YA 2YBUA 2VCAA 1HL9A 4D1IA 2IGTA 3VIFA 4M81A 3WY3A 2DT3A 1E4LA 4Z2HA 3CMGA 3VGFA 3WQ5A 3K4DA 3MMWA 4FMVA 1EOMA 2J7BA 3EBVA 4W8AA 4JKLA 5AC4A 3ARWA 1Q6CA 4LYQA 4HA4A 2Y24A 2D1ZA 3PTQA 3VD5A 3DHPA 3F5KA 3MSDA 3BAJA 4WF7A 2X2HA 4M1RA 2WMIA 4W84A 4M24A 3PTKA 4TVDA 3M7SA 3AYRA 1W9UA 3HG3A 2JF6A 2VNCA 4U3AA 5A6SA 3VD7A 2EO7A 1UKTA 1K6AA 4FNRA 3WFLA 3BAYA 1WDRA 4AD5A 2X09A 1OD0A 5A6MA 4WK9A 2F61A 1FH7A 3THCA 3M6DA 2J75A 3NSXA 3CLWA 1J01A 4ZXOA 2VZOA 1QI4A 4DO4A 3A4WA 3AS2A 3MV01 3VIMA 3QR3A 4AZBA 1CGYA 1C91A 1KQYA 1C90A 4AC1X 4P7NA 3HZ3A 1HJVA 3D51A 3HG2A 2GK1B 1B3VA 3LXCA 4MJ2A 1GQJA 3WF2A 1EA9C 4AD0A 1CECA 4CVWA 4QLJA 1EGZA 1R7OA 1LWJA 3WH9A 2VI0A 1HKJA 2BFGA 2WBKA 3W6LA 1JXKA 1GOWA 1XCWA 4MNMA 1BYBA 1J11A 1NOWA 3ALGA 4CN4A 1JAEA 2BV9A 3CIVA 3VTRA 3VUPA 3W82A 4B16A 3T2QA 3VILA 1C93A 3CTTA 4PMQA 4OJYA 3IGUA 2ZXBA 3CHFA 2WSKA 1NQ6A 2PBGA 5BYWA 3EJPA 1CGWA 3WDJA 1CWYA 5A8PA 2D3LA 4PCSA 1E6NA 5CPSA 4PTMA 5EFFA 4W88A 2QV4A 4M56A 5AYBA 4CUCA 1CGXA 2DQXA 4FLRA 1SMDA 3WH8A 2WYSA 3VM7A 2GK1A 1CGTA 3VGBA 1IZJA 1QHZA 7A3HA 4UOQA 3WL1A 1BGAA 3MI6A 2DSKA 4CD6A 3IAPA 2YL9A 3QHMA 4P7OA 5C71A 3B9EA 5DMYA 3CZGA 3THDA 2X2IA 2EACA 2W61A 4F8XA 4UZUA 1E72M 5BXRA 5JBFA 1JZ8A 1UASA 3K8MA 4JFVA 1UH4A 1JZ6A 5A94A 1HIZA 3MV11 4CKQA 1AVAA 3BUDA 1PAMA 1XYZA 1K9EA 1C8QA 5CPQA 3VIKA 1CTNA 3SCUA 5BCAA 4H41A 5ECUA 3G6LA 2PWDA 3VDHA 2W91A 4UNIA 2XVNA 4J3VA 2J7FA 2J7CA 2ZE0A 1GZJA 1NH6A 2OSWA 2BHUA 1UZ4A 3EDEA 5BRQA 2D0GA 3UG3A 3OIHA 1QI2A 4UTFA 2Y8VA 1CENA 4H8HA 2WAGA 5I24A 2D20A 2E9MA 3FHQA 2FDMA 5M5DA 4B3LA 3DDGA 3EJTA 4YHEA 4MJ4A 4LQ1A 3BAXA 4EKJA 5D9OA 1W2PA 4W87A 5GNXA 3N11A 1GJWA 3IJ8A 3OBAA 3GXTA 3H54A 1G94A 3L2LA 1AQMA 2X0HA 4FLOA 4U5KA 4YN5A 4WSJA 3MMDA 4GZIA 2UY2A 4GQRA 2DEPA 4TXEA 2HVMA 3NYDA 9CGTA 2YFNA 3L2MA 3B9DA 1O7DC 4W85A 4HOXA 3WD3A 3EMQA 3BVUA 1NWTA 5D9PA 1QI3A 1LL7A 2ZX6A 4MTVA 3MUIA 3W0KA 1BG4A 4JL2A 3WNNA 3OGVA 3A4XA 3MO4A 4Z2GA 2E3ZA 3AHVA 3BUQA 3NSNA 4UZSA 1KWGA 1E0XA 4XZWA 2FH8A 3UR7A 4NZFA 2F1AA 1RD6A 4OOZA 5CLWA 2X1IA 5I3DA 1BGGA 3T0AA 4HOZA 2Y5EA 4JFWA 5FL0A 2CBIA 1JZ2A 4MNJA 3PZQA 2AAAA 8CGTA 1XCXA 4D72A 1H0GA 1KGUA 3QOMA 1W2VA 3WUBA 3UCQA 1PIFA 3WY4A 2RGMA 1R75A 3SEPA 4AXNA 4P8XA 3BCFA 2VCBA 3MMUA 1CXIA 4GO8A 1E6QM 1V3IA 2Y8KA 2XVLA 4TTUA 2YA0A 1HF6A 2EXOA 1B0IA 2YL6A 4D6HA 2VC9A 1DHKA 3TV8A 3MUY1 1BG9A 1W9DM 1PZ3A 4BCEA 4C7DA 5A8QA 3WMBA 1X1NA 2F8QA 1E6XM 1Q6FA 3KWXA 4HU0A 2J7HA 4ZEPA 3FHAA 4BQ2A 1GNXA 2C8NA 3W4RA 2F7PA 4ZE4A 3RMEA 5I5RA 1UH2A 3VGGA 1TVPA 3WNLA 4P7QA 4UQDA 1VF8A 3F5LA 1ZB5A 1V03A 4LYRA 4E2OA 5D8ZA 2JFEX 1BSIA 2D0FA 1ESWA 3AXHA 3L4WA 1HXJA 3TOPA 2FH6A 1TUXA 2YDSA 1R33A 1UKQA 3WQVA 1R87A 3E1F1 3WH6A 1ISVA 3DC0A 4HTYA 4AZGA 6CGTA 3MUZ1 1ISZA 4HA1A 1QHPA 2EABA 2WMFA 4PMXA 1W1TA 2CCRA 2OYLA 2W67A 1EOKA 3HN3A 4BS0A 1GVYA 1HJSA 3I3EA 5BXTA 5IXEA 3OLEA 3BVTA 2DGAA 2QHAA 1QNQA 2GDUA 5FL1A 4HMEA 3GBEA 4R5EA 5HDRA 2O9RA 5I0DA 1LG2A 1B9ZA 1JI1A 1LL6A 1UWRA 3I3BA 2QPSA 1LF1A 3VD4A 1GQIA 2XM2A 2CESA 4OZOA 2WZEA 4DO5A 1W3KA 3LRMA 1JD7A 3CZNA 2MANA 3ARQA 2VX6A 4Z2LA 2WB5A 3ZT7A 3H55A 3RJYA 2E8YA 3SCTA 1US2A 1W9VA 1E73M 1F4AA 4GI8A 4J27A 4CVUA 4H8VA 4KRUA 4E8DA 1CXFA 1HVXA 4PTWA 1UD4A 4CD4A 3UETA 3AMGA 4P7RA 3MS8A 2EPNA 3VMPA 5EB8A 3SCNA 1EIBA 3BCDA 4UQBA 3BLPX 1QNSA 3ZQ9A 1J9YA 2CKRA 4CD7A 2BY1A 4ACZA 2QMJA 3GDBA 3AYSA 4ATDA 4PMDA 1CLVA 3CUGA 4N0RA 4BQ4A 2AOSA 2CIPA 1CNVA 4PMUA 1UA3A 5KEZA 4X9YA 1GHSA 1NARA 3VIGA 2E8ZA 1KTBA 2WMIB 1PX8A 2WZIA 3WQ4A 5CJ5A 4UFIA 3ZJ8A 1PPIA 6TAAA 2WPGA 4AMWA 1H11A 3CZEA 4ZXLA 1SZNA 1R34A 3N17A 1RP9A 4IPLA 1OWQA 4OKDA 1B3XA 3CGTA 3UG5A 3NDYA 1JGIA 4KGJA 4UFKA 4ATWA 1E55A 2XFFA 1JNDA 5E1QA 3NJ3A 1MXDA 3AOFA 8A3HA 1WPCA 2BXYA 2VQTA 1BYDA 3AS0A 5DT7A 1NP2A 1CLXA 3WD1A 3T2OA 2J47A 1CXHA 5A6JA 4NXKA 1WO2A 3DHUA 2CETA 1R47A 4PCTA 4UFMA 2WKLA 1OT2A 3EDFA 1E4IA 2ZXDA 2EAEA 3U7BA 1ZU8A 2FGZA 3T0DA 2WVVA 1UHVA 2QMKA 3S6TA 1XYFA 4UOJA 2WXDM 4DWSB 2DT0A 4WKFA 4JL1A 3ZSTA 1LQ0A 1JD9A 3EJQA 2G4FA 2UY5A 3NDZA 1KXVA 1JAKA 4AMCA 1G9HA 2BVDA 1V6YA 3BUPA 4LPCA 1JF5A 1OIFA 2DSZA 4AZCB 5FCZA 4PMRA 3W28A 2WMJA 4JIEA 2X2JA 4A4AA 1B30A 1R7AA 4EE9A 1OIMA 3KEHA 4W7UA 1K9TA 1DWAM 4MB3A 3VIIA 2ZX5A 1TG7A 1UUQA 4KH2A 3WF1A 4AIEA 1G01A 1T0OA 1UR9A 3O2LA 2O9TA 2BHZA 4WSKA 1CIUA 4N42A 2YKKA 2VURA 1GCYA 2VR5A 5A6KA 4AYSA 1DWJM 2W62A 3SIMA 2JE8A 1EDGA 1VFOA 5I23A 3AI0A 5A8NA 1NP0A 3GYCA 1UKOA 1UYQA 3LXAA 1UKPA 1UR2A 3N1AA 2V38A 2GDVA 4AZ7A 4IUGA 3N18A 4CU7A 3FY1A 1H0IA 1A3HA 4AYGA 2YFOA 3UESA 1XH0A 3GZAA 4QCFA 4F66A 1QWUA 1TE1A 3W27A 1DWGM 4J3UA 1SMAA 3BLKA 2E40A 1H2JA 4U2ZA 4BZYA 1OGGA 2E9LA 4TUFA 4H7VA 1CEOA 1W91A 4J7RA 1QW9A 1NWRA 2G41A 4FNSA 3QOKA 3BUIA 3WDHA 1FHDA 1CXKA 5FD0A 1RPKA 1HP4A 4D6FA 1KCKA 3BSGA 3AMDA 2YL5A 3HU7A 2WKGA 1GOKA 4MB5A 2G8ZA 1V0KA 3L4TA 3BH4A 4HP5A 1E70M 4WKAA 2VRKA 3A4AA 3WEMA 3W24A 2F18A 4MAVA 2EPOA 3AS3A 1TA3B 3ZT5A 2VZVA 1M04A 1QPKA 4P8UA 1QX1A 3WH7A 1EQPA 3AZSA 4D6EA 3EDJA 2CBJA 3LPGA 2D23A 4RE4A 4QLLA 2G3MA 4GIAA 1E43A 1Q4NX 1B31A 2XHYA 1FP9A 1K9DA 1UKSA 4AEFA 2YDRA 4J28A 4HU8A 1N82A 3VGHA 1FFRA 1C7TA 5I79A 1GW1A 3QHOA 3F5JA 5LYRA 3VU2A 2JALA 4OIFA 1IV8A 2XVKA 5EMYA 7TAAA 2JEPA 4AD2A 4DM1A 2CERA 2YBTA 2YOCA 3WKZA 3K4AA 3G6MA 5I6SA 4J3SA 2BNJA 1E56A 2XWEA 4LGXA 1NOFA 2VRJA 4KGLA 5CGTA 2J25A 3RM8A 1R8LA 2FGLA 2VR4A 4AZ6A 3EJUA 3WENA 4PUEA 2ZWYA 1UD3A 2OWXA 3ZO9A 2O9PA 1BTCA 1W3HA 1V0MA 4GI6A 4E8CA 1BF2A 4X0NA 1M01A 3TTSA 5AC5A 5BXSA 4GKLA 2XN2A 2WNWA 4PSRA 3WUEA 2J62A 5IHSA 1L0PA 3N9KA 4CCCA 3ZM8A 2Y4SA 2V3FA 1FHLA 2WMHA 2W63A 1MFVA 2ALWA 2ZICA
chains in the Genus database with same CATH superfamily
1MQQA 2I9TB 4A7VA 4NO3B 1X96A 3H6OA 5F3HB 4C90A 3LQLA 5F3BB 4DJDC 3WJMB 4UBDD 3RA7H 4WAFA 3VNYA 4L8SC 4OF5A 5E1AB 5EPMA 4CU6A 5KOVC 1J0HA 1NCDH 2QJDA 5D55A 1HZHH 1E4JA 2AQ1A 5DJYB 3WQPA 3VXRB 1BXVA 1EH9A 2W9LA 4Z3GA 4JTSA 4JZJC 5G2HA 4NYLA 4LBUA 3W0WE 1AMXA 4QYAA 5GS2H 4B9GA 3VNKA 2VERN 3L3KB 5F6IC 5I5IA 3EHBD 5A69A 3BGFC 1A5SA 3P3UA 2QV5A 3P4MB 1AIFA 4JRYA 3FKKA 3P4MA 3I02B 1FWDC 4XB7A 3MHFA 1ND0A 2VN6A 3FMGL 1LBFA 1I85C 4LLAA 4PIBA 4C57C 3GSXB 1QTYT 1VEPA 1P1XA 2IWGA 2IPGA 4Z7WE 3G9AB 2K8QA 2EAWA 3RWEB 1M6JA 4XPHH 2VAJA 5DQ9A 1OZMA 1MDLA 1UW9A 4F8XA 1QDSA 1ADQA 1TYJA 2GYSA 3TH4T 4AWJC 1X5AA 1R1CA 1T6WA 5D7IB 1DWIM 3IJQA 4ISVA 4PGLA 5LNRA 4QAWA 2VEIA 5D7JA 5EZLA 1SJBA 4M5PA 5FYKU 3PJUA 4PUUA 4A04A 1K7EA 4PRNA 2GDQA 2QVHA 2J79A 3HE6C 2KBGA 3C5SB 4Y2NA 3AWNA 3EWUA 4PY8J 3LZ3A 2FYYB 5BV7B 3G1YA 5E4EB 3R13A 3QAZC 4PJDF 4L4VA 2VZSA 2F6AA 3T81A 2RB8A 1RZJH 3U0PB 3V9EA 2HJLB 4APXA 2YRPA 1MCPL 1ESOA 1MAMH 2BSRA 4XMKL 1C8XA 2WMKA 1JQVA 4HPJA 5U7SA 1G43A 1R3JA 1DQMH 2Y36L 2GJXA 3COTA 1S5IL 5EIIG 4H19A 3BOXA 1QPOA 1Q45A 3D25B 1SXBA 2BVOA 4TNVK 5BNXD 5LGHL 4CJ0A 4CADB 4FF5A 3WIHL 3P0VL 4ZMAT 4ODWA 1SJEA 1RJYA 5HHPB 1HKLL 1H1ZA 5DUPH 1RAMA 3CHDA 4XC3L 2DFAA 25C8H 4MUZA 4Q7NA 4CDGC 2VLMD 1I1XA 1R46A 3RU6A 1RL1A 3UAEA 5LA1A 1JFXA 1T3FA 3F5WB 4K5PA 3SGUA 1EO7A 4LEQA 3WQWA 5K2ZA 1WFNA 2ZKXA 3VM5A 3TTOA 1Q6DA 1IEXA 4X2UA 2EZ0D 2C7FA 2QPFA 4HC1L 2NYYC 4U0RB 3V7MA 3IGLA 1LLWA 3QFDA 4Q8VA 4G72B 1KIUB 5CEZH 5F7UA 1EPVA 4F9JA 4CVXA 5E8DL 3C2OA 1ODZA 3FT3A 2BRQA 5DZ9A 3STLA 1SJMA 2W9DL 2D69A 4GXFA 4XZMX 1JCVA 5L6UA 2VXTH 1RQ5A 4NQQA 2E27H 1OX5A 1RUQL 5TPWH 3CMJA 3KFTA 1PLBA 3GHTA 3QFJA 3Q1SH 2VLJE 1EO5A 4N20A 4WHDA 2Y7SA 5JZ7D 4XP5H 3ABRA 3RY6C 4H4IA 4QHMA 5EU9A 2NQJA 1D2PA 2AK4B 2H0PA 3U2SA 3PPFA 5E00A 3V52H 5LIUX 3D08A 1KCSL 4BEIA 3QQ9C 4Q9RL 1UOLA 3TBVA 1A7NH 4QI3A 4K39A 4LGPB 3QN3A 1I9EA 2X89A 1CGVA 4GS7B 4OF8A 5IVOA 2QQQA 3HNSH 4S1QH 1J05A 3QI9D 4G7SB 5F8RC 3S7GA 1ZTXH 2X7WA 3C5QA 4G9DB 12E8L 4Q8BA 2N4IA 3X14B 2GFBA 2YUZA 3C2EA 5HMFA 3MSPA 3VIGA 3LCIA 4GB9A 2FKPA 4XP1H 7PTDA 1VRSA 4P8WA 4NLHA 1OO2A 1AHWB 1OQOA 5CPNA 5E7BA 5EG6C 1I1FB 4Z7WB 4PGDB 4LYPA 1JGUH 4KOCA 3RWGB 4LL4A 3QYSA 2FZ3A 5IKCB 1L9NA 3BKYH 3MV9D 2RCSH 4TUOB 3TT3H 4ZZFA 3ZKXB 5MEOA 3TESA 1H2JA 1KM3A 2HKFL 3K7UA 4ZQCA 3CZJA 1KR0A 4DUWA 2MTAA 2JQMA 3S88H 4JFYB 3OGSA 1BZ7B 1HL4A 3GJFK 5CEXB 1IE4A 2CXGA 4LXFA 2VDLB 4P9HL 3N2OA 3C0JA 4F0HA 2J3SA 1DZBA 1GRWA 4PJ7A 4KXBA 2QR0A 1ORQA 4UIMB 1XZ0B 3PGCB 1A4BA 3HN8A 3BAIA 3QFDB 3T5WA 4ZQRA 2WVUA 1OF2A 4FR1A 5FAGA 1CFNA 2UY7A 1MFBL 4JKPL 1QFPA 3NP3A 1H5VA 3FKUS 3WNOA 1L5GA 3FF7A 5LBVA 2BGQA 2A1WH 4HU4A 3P5ZA 2LLNA 4H0LC 1JZ5A 1WKYA 1SPDA 3TKFA 4BQ3A 1U8OB 1RLDA 3P30L 1JGEA 3MREA 4J1OA 5I66A 2A9NL 3NJMA 4Q8QA 5LSMA 1ISXA 2C19A 2CJ3A 3BC9A 3HR6A 1ZV5A 2RGLA 3ZSSA 5EMKA 1SJEB 5I1KH 1OM0A 4CRPA 2WWCA 3NXLA 3O3AB 1AANA 1XIMA 2AANA 3SFKA 2Y5QA 1AC6A 4WFED 5EF3A 3WY2A 4AZHA 4P9MH 3IEAA 1GEQA 2R1KA 2VXVL 1FJ1B 4ALAL 3SSJA 2YN3A 1G9MH 5EBWA 5EZOH 4L65A 3PP4L 5I8OL 4P59H 2WXPA 5DS8A 5AYUH 1NAKH 2NY3B 4OTXL 1ZLEA 3TBYA 5FB8B 2E09A 3FCTB 3DFTA 4N2BA 3T6QC 2DJUA 4AEOA 3QC5X 5GJSL 3UO1L 2WVVB 4NP4H 1ECYA 1J8VA 5FEWA 1OVDA 3NQMA 3NZ1A 1NEZG 4OF6A 4X5XA 1EZ2A 2YUWA 2Y6ZA 4HKJB 1FAIL 1HZLA 2F8OA 3W85A 4EWND 3ZS4A 4IPIA 5E8OB 2H3DA 3OJGA 4MADA 3ABXA 4J2XA 4FXFA 1SXZA 4QJ4B 1GOGA 1GKEA 4PWEA 2YARA 4LKXA 2CLVA 3LZLA 4OUEA 3FO0H 2VSMB 1XGUA 4MQXC 4PV8B 4AJWA 3NCYS 1F42A 1BBDL 4WK4B 5C97A 1V3HA 5CSRA 4AZ8A 4FX8A 1UB6A 3MUJA 3B7TA 2LFGA 4UINH 3WQ6A 4AW7A 3B8SA 3GSNH 3SOBH 1T5KA 3W2DH 4XPBL 1KBGL 5FA4A 5BPPA 4GLEA 3FYIB 4BZ1L 4XKYA 3P0GB 3VUSA 3EOYG 3SW6A 5DMJB 2YCKX 4BF7A 1TZZA 4PFMA 5E8PB 2EVFA 3H24A 1N5AA 3SCWA 1G7LA 1FWJC 4ONVA 4JZ5A 3VVGA 3V7PA 4JUSA 1A14L 3HE6D 4F58L 5BV7C 4I7WA 4ZRGA 5HJXA 4PJBB 1FDLL 2EE6A 2B59B 2D4FA 4KK5C 1NGZB 2PW1B 1JK9B 4OCNC 2VXQL 2B5IB 3S5YA 3G1SA 2BVUA 4DWSD 4FG0A 4OQTH 3SQRA 1XB8A 4NO3A 1FVDA 1I3UA 2N7AA 2QFRA 3EYUL 1RSCA 5DFAA 1Z5LA 3M1OA 4G9FE 1YTEA 3STPA 3W1XA 1AZ1A 3P3YA 1U5JA 4IX0A 3EB2A 1IXQA 4JNZA 1F6AB 1MJJA 1K5WA 2Y85A 3IVSA 3ZT6A 4HPOH 3ANYA 3VRIA 4JFZH 3ZL2A 5MP6L 1UH3A 1NDGA 2BIPA 5E2TL 4N68A 3W7GA 1Y0LA 4UNTA 4M8QB 3CFEB 3WO3B 1KB3A 2R1YA 4Y2OA 3GMRA 3HAEH 4WHBA 3HLAB 3RRAA 4JAMB 4KI5E 5D6DA 1DOSA 4ELMF 4L1LA 4JYFA 5IVXA 3GWQA 4F0KA 1BLNB 2J21A 3VE7A 5KYXA 3CNKA 4ZS6C 2MUCA 1FZJB 3VXQB 1RU9H 1VGKA 5DMIL 1F58H 2CLZB 2BWDA 3MBEB 4B50A 3ULUH 1JDFA 3GFZA 1UD2A 1UD8A 2G0KA 2PXYC 4PTTB 2WC7A 2UWEA 2YZRA 3L7FB 4HIXH 1GYAA 3EEZA 3UBXA 3TF7C 1RZGB 4DW2H 5HVHB 1FKXA 1DVSA 1RPXA 5ERWB 3V5KB 1XIDA 3OZMA 3JYCA 4K9EL 4D71A 4LCYB 4ZQKB 4IBTA 1OAUL 1Z9AA 3CT2A 3P11H 3W1NA 1WIPA 3BEWA 5HYJE 2HT2D 2W6RA 4AXWB 3VFCA 4XNZC 2E74C 1UC5A 3U48A 2ZKHH 3WKML 4F9DA 4NI6A 1LOLA 5HDBE 1CI5A 1XINA 1ZVSA 2CSPA 4P46C 2PYED 5F7MC 1NLDH 4IF2A 3S5ZA 2IWKA 2RA1A 3IU3B 4M29A 5DK0B 5GGSY 3SKNB 2EXYC 3TTEA 1LO5B 4M1DH 1FC1A 3UYIA 3WQOA 2Q3RA 4DY1A 4LUSB 2DLHA 2KX9A 4L6DA 4IM4A 2PWHA 2F74A 3VRIB 2Z65C 1WTGT 2NY2B 3IMRA 4Q2ZA 4R4NC 4YHIA 1K8CA 2ZOWA 3HLKA 1UZDA 2VEKA 4MDJB 4LCCA 2E86A 4MDJA 4GKNB 5I1EH 3DROB 3HOJA 2WYIA 1J10A 4YHYC 1A1NA 3FA4A 4V2BA 3WDRA 3TSMA 1JNLL 1OAKH 1EEPA 4OZIE 4DF1A 3UROR 1KLYA 3RAOA 5HR7A 2VDRH 1GQNA 4R0LB 1IGCH 4FNQA 1KJVA 2GJJA 3HC0B 1KBIA 7FABH 4AY7A 3MT1A 1TV2A 3MLZH 3PFUA 1UB3A 3QPEA 5A6JA 2AJXH 1KLUA 4QUOA 3CFDB 5I1IH 1DWHM 4JTCA 1XRVA 2DICA 1WT5A 4JZNA 4HMDA 3OZKA 1R3IL 4X99A 3QQDB 5DO8A 1I2PA 3KW8A 4NRYA 2X1TA 3QIBC 2ZA2A 3NVTA 3TW7A 4MWFA 4U6YB 4U1IA 2Q8BL 1TVHB 3FFDB 4OBRA 4OBTA 3CH9A 4Q4KA 3QBUA 1HT6A 1ZDSA 3ARDA 5EO9B 4FFYA 3RJXA 3GNOA 5HBBA 5HJYA 4L3CB 4V1DA 5IW6A 1HJQA 3FMGH 2PDXA 1AZRA 2X9YA 2Z7YA 3E8UL 2WQPA 2V4LA 5CAKA 2FX7L 2ZZ3A 4Z76B 3RUGF 2XIJA 4HK3J 4D2NA 5EO0B 3SDAA 1S8DB 2IDUA 4DUVA 1XIGA 4P5TB 4JAMA 4G3YH 5CZXC 1W80A 3UF9A 1MUWA 1MFUA 4GINA 2GG1A 4N2OA 5F9OL 2GJZB 4GBDA 2X4QA 4ZX5A 3O2WH 2YLHA 5D1XE 3C6LB 5TFSH 2QBWA 2NQHA 3FSUA 1ZS8B 1Q90A 5JMOC 1IFHH 4JFQA 2X4TB 1FPTH 1FNGB 1W9XA 3OV6A 5GGTA 1NOAA 2XIIA 3GLCA 4UM8B 3LXUX 2Z27A 4WI2A 4KJQD 4MFEA 3UFIA 1OQXA 3D1MC 4Z7UF 1NKOA 2O5XL 3OU8A 2WVSA 5HMEA 3QLDA 3UC2A 2AAVA 3RNKA 3TVMB 4UTIA 4OJCA 3OG4B 2X4SB 3TYGH 3JZUA 2Z4TA 2BODX 3ZE1B 2Z2AA 2IO5A 4DN1A 1YPXA 3RX5A 4E5XA 1LD9A 2GK0A 3NCOA 3L5XL 1JDAA 3T8MA 3ZOAA 1F9CA 2X88A 3BLEA 3LLXA 4PRRA 4GG8B 3ECVA 2WW8A 3I84A 3IS4A 2BXZA 2Q6WB 4ZYKB 2Z31C 1QLEB 4MKSA 1HKKA 1N8FA 3ECWA 3RR1A 2Q3ZA 2EH7L 2VLRA 3V4VA 2VX5A 4AD3A 3OKEA 3SKJL 4ILSA 4KRTA 4IMKC 5DELA 4JFDD 4C8XA 3EXJA 5I9QB 4J6IA 4JTRA 2X53A 1QVOB 4RNJA 1C16A 2R1WB 4NN6C 5FUCE 1X7QA 1UWGL 3AVEA 4U1JA 4HUVB 2GB2A 1E9YB 3IJ7A 4U1KA 3U79A 1ZJAA 2D31A 4U1KB 4DGIL 3A5VA 3CL6A 4IJCA 4RV3A 1TKKA 1TTFA 4L8DB 4PV9B 5ACMA 2DM7A 3CFBA 4QRAA 2G4GA 4L4VD 4PR5B 1POJA 1S7WB 5IBLD 1MQPA 1VLIA 2GWGA 4MB1A 3RY6A 4BFEA 4X6DE 3PAJA 3QY6A 5C0RH 4P0DA 5KZ6A 1EHNA 1PDKB 3T08A 3C0QA 2YDQA 4HNVA 5HXMA 1E6RA 4WKHA 4NC2B 2VXTL 3EX1A 2NY4C 1GVFA 1OFEA 3WFEL 4XAPA 4OU3A 2WKJA 3HRZB 5BVPL 1GW6A 2F7OA 5IQOA 4I9MA 2H26B 4CQBA 1P5UC 1TVBA 1UQSB 2IBZX 1IM9D 1MCWM 1UJ3C 2X1SA 3G5WA 2VRAA 2ITDA 1RK0B 1EJOL 4BWUA 4HPHA 3ETBJ 1G6RL 2W5FA 2YAQA 4G6JL 5DJ2A 4UB9A 4A2RA 2DD8H 2ZA1A 4XVSL 1V4YA 2Q6ZA 4WHYG 4OZ4B 3I65A 4UUJA 5B21A 4KPLA 5EU7C 1S7TB 3RYMA 4NZRL 1INEH 3IE4A 5DS1A 3DRTB 3EOUA 1GIGL 1A5AA 3SN0A 1ZSHA 1GY1A 2OZ4L 1NMCC 3O9WC 5F0MB 5E2VL 1RZ7L 3VMNA 3UCDA 1ZLSH 4E2VA 5L9FA 3OA3A 5JMRA 4PODA 2HG5A 4DXKA 4UYQA 5DD0H 1JGEB 5I26A 4I3SL 5ESVA 4GCAA 3PG2A 3IIXA 1CE6A 1VFLA 4X9FA 5KZMA 2FSDA 1SXSA 1YEIL 2C4FT 3DOSA 2IALA 5K9DA 2Z93A 3DDMA 2JKSA 1MPAH 1UA7A 3JVGC 3LG3A 3CLEL 4O11A 2X42A 3L1EA 4MF4A 1VFMA 1OB1B 2PR4H 3VXPA 2H8XA 3PB2A 3OLDA 3TX9A 3G5XA 4DB7A 3EJSA 2RJHA 1V51A 1G0CA 1RUPL 3GMOB 3U1SH 1MREH 1XZWA 3OG2A 4MGGA 3IJDA 5FJUA 3IUIA 3KVQA 4LY8A 2Y7EA 5IEKA 1K4DB 2XNAA 4YXLH 2AV7B 1IKFH 1MIEH 1ICQA 1WWAX 2J8OA 1LUCA 4NF7A 1N12A 2DIJA 3BN9D 2DLFH 3NEXA 4OD1H 4Y0GA 3DG3A 5BRZB 3GSXA 3U9WA 4EXPX 1DVXA 1L3WA 3VFNB 5DO2C 1BAWA 5FM5O 3HG1B 3BZ5A 5E6IB 3UPCA 2F2HA 4MSWA 1BYAA 2IMRA 5IMLB 3O8XD 1D5IL 2DZSA 4QP0A 2WBJA 5DJCB 1PTDA 4D6JA 2VVSA 1HH6A 1KDIA 5KTEL 2FWOA 3QUYB 4BQ5A 4Z7QF 3SGDH 5JNYA 2EPKX 5E9AA 3FONA 2HJLA 5E95B 3CH8A 1B9BA 5E0QA 1P7QA 4DJFA 3C87A 4ZUTA 2E67A 3VINA 1IM3B 2KZ1B 4WI8A 4EVNB 3UAFA 4RZBA 3KBHE 4MDIB 4FIQA 5KVDH 4OLYH 3EHBB 2R4RL 3WYZA 1TX2A 1I4FA 3NFNA 4OVXA 2VH5H 5ID1A 4NKMA 1EX0A 1MYRA 1X7FA 3B05A 1P6AB 3W1PA 4E2BA 5HYJA 4KK5D 2FPYA 4KNUA 1IEBA 4MPQA 1ZHLA 2Z3FA 4NPJA 2V63A 4PYSA 3DURA 2WCPA 3BP6A 4PRPB 1FLRL 4J3XA 5FK9A 4P5KA 4CNIB 2WNQA 3NQEA 1I85A 3R43A 1HXKA 1BTMA 1S9WB 1D5MA 1CDGA 2X7LB 1Z5YD 3NABH 3RPKA 3FU3A 1CLZH 3SDXE 2BSLA 4B15A 5IHHA 4F2ME 1KUMA 3VG0L 4JN1H 4DWSC 3BAEL 3FQ2A 4GRMB 3T8XB 3GR7A 3ME3A 3QY8A 2NXYB 3UPWA 1VFHA 3SOTA 1VFAA 3FJTA 3L9RB 5A6IA 2FZBA 2CBMA 3L9RA 1ZJBA 3N40P 2ZC1A 1MJ8L 4C83B 4FDWA 2XN0A 3LN4A 3ZGHA 2AQOA 4HUUB 4HHMA 3ME0A 4LRTA 3AWEA 4XD4A 2P49B 4HXBL 5ITBL 4XNMA 4N2HA 1JZDC 3JZYA 5EU4A 1E0WA 2Q01A 5GRZA 3BKML 3IKCA 1IEQA 1NY1A 2OMWB 3EGJA 1UEMA 3LEYL 1PS9A 1L2UA 5J3HD 1BQGA 1BW8A 2EKSB 3HEIB 5C0EA 1J5OL 1HINH 4UDUA 5TQ2L 5AOMA 3RY5A 4Z9KB 4ZMXA 3O0FA 3QDMB 3BZ4A 4WI5A 3OIXA 2LVCA 5LKNA 1RLCL 3LZQA 1E5AA 1Y0LB 1UWSA 3EA2A 1TJIL 2HRLA 3GSRA 4FKEA 4H0GA 5CZTA 3HNVH 4JCMA 2DZPA 5XIMA 2GAZA 4F8PA 4RGNC 4DN4L 3H7VA 5E2WL 4Y7MA 4EIVA 1IR1A 1BDYA 4NQDB 5GRVL 5J9PB 5FA5A 1FV1B 4Y90A 4XNUL 4N8CH 5AY7A 1MW1A 2WK2A 3VQMA 3EWXA 3T78A 4JE0A 2XG9A 5JHBA 3H7BB 1HYRC 3O3EA 4RAHA 4XVSH 3WUFA 3C52A 2ROYA 3V0VB 1A6UH 4AY0A 4HWNA 2WYTA 5JHDD 1U21A 3G77A 4U3SA 4NQ1A 5GNYA 4FMKA 5D5MB 4R4BB 2DMHA 1BQHG 1HHKA 4JO1L 4BZ2H 5M03A 3R58A 1SHMA 4J3OD 4DVRL 1WGVA 4WK2B 2JJSA 5C9KA 3TE9A 5KYNA 2XLLA 2DQJL 1JPEA 1CGUA 5I06A 1R5VA 3OVPA 4PU2A 1WISA 5CEZE 3GIYA 4ML4A 1WITA 1SFSA 1LO4L 4X3ZA 1YN6A 3RAJH 2QJHA 2ICSA 3N3TA 4JDZA 2QDGA 3NA9L 4OV5A 1QFEA 3G0XA 4PBGA 1B90A 4OLUH 2V8ZA 2JMRA 3INUL 3MUXA 2QVIA 1JG9A 1P1VA 2D3NA 3GWJA 3UZQA 3L23A 3F4NA 4JFHD 2PDKA 3G24A 3SQMA 3QPQC 2QSTA 3EJJX 4A22A 3L1FA 5ADOH 1KIQB 2B08A 4PJIB 2ZUMA 3BP6B 4CNIA 4WDWA 3CHEA 2PTZA 5B4MC 1MWOA 1JR1A 3CSPA 3KPSD 5EO1A 5J7CC 1XIWD 3GG7A 3SBWA 4EXAA 4GFIA 3WLJA 1VZIA 1MJUL 3H4FA 4UAHA 4MXVF 2DP3A 3BPLB 2OB3A 4G80A 3VWJC 3G8RA 4DJDA 4M1DL 4PRPE 2XWCA 5JPMA 2Z93B 4FQXD 3PFRA 1QFUH 3CZUB 1L6GA 1KRCC 5DA4A 3NL3A 3UABA 4HULB 2TSAA 3BVXA 5FYLD 1HCYA 3EOTL 1AGDA 3NDOA 4DNLA 4QFUA 3SIZA 4TQEH 3WK1A 1AQFA 1M7XA 5CJBA 2B1AL 1PE1A 2DYPB 2BNUB 3WLNA 2VKWA 4O57A 1PYWB 5C09E 2PCFB 3WKQA 1RY0A 2IQ9L 3VFWB 1LQBC 2VP8A 3I50L 4Y5YC 4F15B 4OCXH 3QR1A 1F6LL 5I5MA 4R26L 1HKMA 4YMPA 4H44C 4JFDE 2DZUA 2K1MA 3VXME 3MRPB 2AJXL 5B1AB 4FEZA 2HN7B 5LWYL 3M0KA 3O6KH 4D3CL 5CEZL 1ZPTA 5K9OA 1XW8A 3FS9A 4JFDA 2WXHA 1YY9C 2QLYA 3BPLC 3Q5TA 4RCAA 1FLRH 1ZLVH 3ZU8A 4LAJH 1VYPX 2Y61A 5JIWA 1MCJA 4JFFA 3PZTA 2INEA 1C9SA 3E3HA 1MLCA 1ORSB 4Z0SA 5C09A 2PGFA 2N01B 4F0SA 4YCPA 2OMTA 5EC2B 4DN3L 2QKIB 3MCYA 1E90A 3MJ7A 4XBPB 1LJYA 2CIIB 4PJEF 5DRZB 2HXTA 2XGZA 2PU0A 5D7LA 3OZOA 4MKMA 4YSTA 1KPRA 1UZGA 3BFOA 5T3ZL 2XX0A 3GSOA 5KYYB 1HHGA 1S9WA 3E8UH 3T09A 3DJ9A 2WJEA 1BZQK 4PP2A 2GPTA 1KY6A 3B9KA 4BK8A 1V6WA 1KT2B 4DELA 1G7PA 5I1GL 3TW9A 3BVWA 1SZEA 2CBVA 2ADFH 3GM8A 4P7LA 2AVGA 1NWSA 3DRTA 3L0KA 4LYKA 1YMMA 4LF3A 1UD5A 1MCPH 5E2UH 2ADYA 5L8JB 4FXKA 3BDXA 4F9PC 1J0IA 4FXSA 2GJ6D 4GYJA 4XCFL 3KDPB 5KETA 3EYFB 3QDHA 3D85B 1OLZA 1UB5A 3DARA 5DC4B 2AKMA 5D7IF 5CJ8A 5E09A 3UJ2A 4IGBD 3ML8A 1UG9A 4I90A 1HO4A 2FHBA 2NZ9D 2YA2A 4K07A 4R27A 1B0WA 5LBSA 4D7BA 4PLNC 2PDNA 2Z0IA 1X5ZA 1XPGA 3WD5L 3E74A 5E0FA 1ACZA 2FQEA 3VIHA 5E2WH 1PMYA 3DIFB 4ZTYA 4V1DD 4HH9B 3FUDA 1GORA 4C6FA 1MFAL 2JXMA 1F00I 4Z1PA 4CNPA 2EC9U 2NY5H 5IBLC 3SCMB 1G5GA 4DIAA 2AZAA 5I16A 3BDKA 1GGBL 3TA9A 1OCZB 5FR3A 2WOQA 1FNSH 4OTKA 2PWFA 3RVTC 1F2QA 2N3JA 1BVOA 4MY1A 4ZB5A 2VAAA 3FT3B 2VDOL 4MD0B 2XM1A 1BXNA 4NUMA 2HFFA 3Q5YA 4DKEL 3IAGC 4O1AA 3JV4B 4YZFE 2R6OA 3C8FA 1M2VB 3URNA 3ZDYE 3FB6A 2AEIT 2P80A 5AW6B 5FC9A 3HI1B 4XVTL 4WUUE 1JXFA 1HWWA 5T5FA 2V9RA 3H2WA 5EEVA 4ZO7A 4YTQA 4QXUH 4B4FA 4OTXH 3TJHC 1OAQL 1UWXK 3NL6A 2DLIA 4MBOA 4MJ5A 5IFAL 2Z8VC 3KTXA 3L68A 2FZDA 1OFBA 1MCLA 4W5ZA 4LBEB 3QDJA 5HYIA 4TVCA 1ZZMA 3G5YB 3F3HA 1JDCA 3LAFA 1GYVA 4UUJB 3EBGA 3G04B 1UG6A 3AIRA 5CD3A 3WU1A 4JFPA 2E6JA 4L1DA 4D9LL 2H4EA 4DF9A 1RP8A 1YC8A 2AJVH 3BN9C 4GH7B 4WW2B 4IBWA 3MWCA 3X13A 2EDOA 3MI3A 2FBJL 2R29H 1N8IA 5MEOB 1FORL 5CKSA 1BBDH 4S38A 2WZMA 2FLMA 3WOVA 2PCXA 4WU5A 4GVGA 1YRRA 3MOBL 4U1GB 1OC7A 3FO9B 4HPOL 2W0FB 3PWAA 4DEFA 1WA0X 2ADJB 4H40A 3ELAT 2FEJA 1Q0YH 3K6FA 4X6EA 4W6XB 4QJ3B 3O2VH 4HS6B 4HMCA 4X8XA 5IFJB 5D7IE 3BW3A 4AVOA 4RFOH 4N5UA 3W1TA 4B9IA 1A4MA 2QDVA 5DGRA 2YXXA 3SUUA 4V1XA 1EZWA 1LL1A 2VOTA 1H8SA 1TYEB 1UT9A 1LHZA 3KPMB 4KROC 1A14H 1L7IL 3EGDA 2F15A 3KCPB 4JHAH 4M5SA 4F58H 3U2SB 1TWDA 1QVOA 3U5UA 3GVQA 1KB5B 3B37A 4ANKA 3FTZA 3QE5A 3DX1A 5TIMA 1OGTB 4QNPE 1E6OL 4LU5H 3MBXH 3WSQH 1OF8A 5I0WA 4NOFA 4F7PA 3ZL4L 4LLQA 1JYVA 2LW3A 1WYJA 4HIXL 1JN6B 3VX1A 1BG1A 1IKFL 1MIEL 3HM7A 4LW7A 5AZ2L 2G2RB 1PTZA 1ETZB 1OTUD 1V7NL 4OJDH 1Z48A 2QPXA 4UMAA 4NVTA 4FS0A 1WUEA 3AQYA 3L7FA 2XJLA 2EE2A 3HI6H 4QXTA 4KY1H 3VD9A 2PU1A 1HQRB 2WP3T 1KCLA 4L37A 3ZDYF 3ZVVA 4KUZL 2QKIA 3D2TA 4KWUA 4XBPA 2WZPA 1KULA 1L8NA 1MXGA 4JZJA 3NIDE 1MH5A 2V3GA 4J9JA 1PX4A 3FTUA 1ZHNB 1HE7A 4WWKA 1UWQA 4L0ZA 2TRSA 2AQSA 1IIKA 1J0YA 2EEXA 1H7OA 4JJOA 3KPOB 4PJ6A 5I6KA 3HS0A 1G7HA 4G83A 3QEUB 3AIEA 4NZCA 3UJIH 1CDYA 3QHFH 1OFPA 1I9JL 4FABL 3JWDC 3KDOA 3QJFA 3UP8A 4HUWB 4GRWB 5REQA 5DHXB 2E6YA 5C2UB 1R3WA 1A0CA 4HYVA 2ICWB 1U8CB 1YY8B 1AKJD 3GZQA 3K80A 1OAUH 2EDRA 1A1OA 4W6WB 2YD2A 1XXDC 4ZFFB 1N7MH 2IPJA 4M93B 1BQCA 2UY3A 4JTDA 2IG2L 3WFBH 1QBAA 2IDFA 2VLJB 2Y6SD 1X6NA 4ZD3L 3V6ZB 4C6EA 4RGOL 2VFIA 3KDMB 4PH8A 1MWAH 5CZKA 1G7LB 4DYJA 9RUBA 1N5AB 4DLFA 1MNNA 4G80B 4YE4H 4QCEA 1TPH1 3NO3A 1P43A 5FOOA 4G9PA 3ZO0A 4BA0A 3B0UX 2BW5A 2YMXL 3HZMA 1FSKB 1LJMA 5CGBA 5FO9B 5IR1A 4EZLA 1Q85A 4UC5A 5MKGA 4PHXA 4MKNA 1SLUA 1QSED 4I5RA 3NWRA 4C56D 2FX7H 1FWAC 3H12A 3BUBA 3QJOA 4N4PA 5FM5M 5I16B 2EKJA 2F84A 3TBSA 3H2FA 2VIRA 3ECBA 4RCXA 4GUCA 4W7VA 3CASA 4FLHA 2XXCB 4M6OH 1ZY9A 2I5YH 4X6FB 3DGDA 3WEZA 2LU4A 5HPCA 4KVCL 3WBXA 1F6AA 1MJJB 3OJVC 1AUSL 5GGQL 1K4CB 2IXQA 1S7UA 4KXZH 2B4GA 2D0HA 4UUIA 1VZWA 2Z7UA 3AZTA 1N3NA 1UXSA 4RETB 1XM3A 4ZUUB 4EUPG 5MF5A 1Y07A 3OXRB 5H8DA 2IS7A 4KV5F 2PMZA 4U1MA 3C6CA 1JWUA 1SHXA 1M3UA 5J56B 2E9WA 1QQDA 1B57A 1IC5L 4XQ6A 2MTPA 4FLQA 4QKTA 3C4UA 4C4BA 5CGYD 1I7RA 2XBZA 3QIWC 1ACCA 4IMCA 4PJ5D 1E67A 1U3HB 2W60B 3L3OB 1XLAA 3LERA 4LGSB 2UZPA 5BRZD 4WIWA 3E2HC 5EB9A 3NJKA 3LNGA 3P1VA 1JL8A 5F9OH 1FWCC 1IAIL 1LNUA 4ZBJA 4A6YB 4JPIA 1O68A 4N6EA 4AX7A 3V6ZA 1YC7A 3WZ0E 2CKBH 1BQHA 2EDHA 1D6EA 2PTUA 2ZOOA 4P5MB 3KR3L 2K7QA 5G55A 1N0XL 4IGNA 1TV4A 1MXSA 1JPGB 5KJ4A 4N2DA 3BV4A 3ZDZF 3VWJA 2P5NA 2AEWA 1GAFH 3R18A 4KI5F 3UTZA 4B7IA 1FHUA 4PJCA 4ZJ9A 5C0AA 5TBOA 2K6ZA 5DJXA 3CFCH 1KB9J 4JCWA 5A8OA 4M8QA 3RK8A 1AI1H 3EJYD 1Q94A 3PV7A 1J12A 4JQIH 3GX9A 4HT1H 4JS3A 4LPXA 4MA8L 4CMHB 5E5LA 4IOFD 2FR4A 4LX4A 1WA3A 3S48A 1DBML 3EGSB 4JO5A 5EF0A 3W84A 3DV4B 3O9WA 4XBGB 4BFGA 3TIEB 1KPUA 3CWHA 3RF9A 3RGVD 5F6IB 1QUNB 3VGAB 1C08A 2YN5A 5LBGA 1OM3L 3B2DC 2CUMA 5IFHL 3CX2A 1M57B 3KL3A 4R84A 5TGBB 2O6CA 1CE1H 2WQVA 5EU3B 3SZ6A 3MJ9A 2C16A 3DCPA 3L9YA 1BFVL 1RZKH 3WUBA 4X60A 2E77A 4GKSB 5K9JH 1A4KA 4OZFH 1BM7A 1RFDH 2FNWA 3WJZA 2GBAA 4QHKJ 4U7MA 3CHVA 3K5SA 2OQYA 4MFDA 1QLEL 2F8IA 5EZPA 2NZIA 5I71B 3A64A 4PGEB 3OA5A 2IBZY 2ICCA 1Q7ZA 3GXUB 5EL1A 1FYTB 4LCWB 4NXSA 3RIAF 2I60H 1DTUA 4QHUB 5I6NA 1UQYA 4QDWA 2PP7A 2WYHA 1US0A 4X9SA 4MAUL 4KJYB 1FNEB 2PEVA 1T21B 3DBXB 5EOTA 4OZIA 1D5BB 1P7TA 4U5IA 3APGA 3WFZA 1L7TL 2XTJD 1KN4H 2Z0BA 2AJ3B 1E4HA 2RJMA 4YVNA 4HAFA 3TIDB 3TZVD 4GG6A 3DX5A 1I9RH 2YGOA 1ZBCA 1OM9A 4AKPA 1V02E 1WX0A 1YN6B 1OSEA 1CWVA 2AXWA 3RDJA 3ZDXF 2A3EA 3URBA 3WQ8A 1KTRL 1B0RA 1S7SA 2VL5A 4FQJH 3VFRA 3MROB 1M53A 1EAOA 4WFFE 2DH3A 3UJTH 4R9XA 3L45A 4P9ML 4WY0F 3OX8B 2HLFC 3N19B 4FX6M 4PW3A 2G75A 1M71A 2OJZH 2XN9E 3LCGA 3FXIC 4UT6L 1NGYB 2I9UA 3TASA 2Y5SA 4YIWA 1Z41A 3CXFA 5AG9A 2AJZB 1AH3A 5CP7B 3W73A 3RIAK 2V2TB 2CJUH 2FQIA 2ZTJA 3RN6A 5IBUB 1SFHA 3Q65A 2AKRB 4ZD3H 1FY6A 1I3RB 2CDEA 2YOAA 1XLGA 3GAKA 3QMSA 2ARWA 2YPLD 4NUGH 4N0UB 7PCYA 4XMXA 1XF5B 3BQUD 4H9UA 1U8KA 3DUSA 4AV5A 4KNQA 1U8KB 3DUSB 3Q5OA 3L66A 2GY5A 2C26A 4V1DE 1PZ5B 4NRRA 2EDMA 3GXIA 3FXYA 1L9PA 2XSBA 4JDTL 3A21A 4YHNA 4IRSA 3RX9A 2V3DA 3ARBA 1KBPA 2P44B 4S3FA 4IRSC 3R4RA 4G42A 5HJGA 2BIHA 2OR7A 1BYNA 3F83A 2WVTA 1EEUA 4JMXA 4PW9A 4OQTA 1XLCA 3LKSB 1K72A 4NHUA 5DTFB 4TUKH 1XSKA 1OY0A 2DKSA 4QRPD 4BZ1H 3KRSA 3WYRA 2Z35A 4LOUC 2YZ8A 3RWEA 2P8CA 3VG9C 2V33A 1TTQA 1CFTA 4LAOA 2VQ4A 1N4XL 2X6BA 3HKZA 2XQYA 4MJID 3GZPA 3THMH 8RUCA 4BDVB 5JBEA 3O81A 1VENA 4GP8B 4BDVA 3KM1A 5H37A 1I1FA 1KGWA 4U49A 4B3VA 3USZA 4M6NL 2AV7A 4NN5B 4TLKA 5AL8A 2APFA 1MZRA 1R17A 1Z32X 4HJ0D 1Y65A 2J66A 2WLHA 3CJJA 5LGYA 4DKDC 1E6ZA 5LBSL 5EBLB 4O2CA 4AQ8C 1JZFA 1OFRA 4PLJD 3E2SA 4NP7A 5LNUA 2NXHA 4NZJA 3RGBA 4AQ8A 1S5NA 4KX8A 4NHCH 4GIRA 4H0HB 4JY5H 4J39A 3QG7L 2X0YA 2J1ZA 3RDTB 3PUEA 1KO0A 4GZJA 3Q1EA 2GBVA 1CE6B 4MDOA 4XPTH 3GHBL 4ZYKA 3DJTA 1KBVA 2IFGA 3NIFB 4ODHH 4PJXF 1G9NH 3WGUB 3BP7A 1P7QB 3H9SE 3M7OA 1J1XH 3US1A 3S34H 3OHXB 5I74B 1EF2A 4XC1H 1QR1A 4O0ZA 3MUGB 5HBFA 2PPAA 2QGHA 4HZ7A 1J2WA 3IXAA 3GNML 2X4SA 4XO3A 5C6PB 4FB7A 5D09A 7XIMA 4UILL 5GS1C 2NQCA 4OLEA 3VYLA 4Q0XH 1QLEH 1XIWB 3TBBA 2ATSA 2CO4A 5BS0D 1SSDA 1RH9A 2Z2UA 5KYWB 4IIBA 4EN3B 5IHRA 2VQ1A 1O7VA 4OLXH 3UPRA 5CPMA 5IEKB 3C6LA 4JFFB 5DYOB 3SDYL 2AHIA 4MHBA 2ATAA 1LDCA 3MRRB 4W9HC 3MA9H 1ZV2A 4H13C 2F54B 4RMUA 4F40A 3UJFA 1NGQL 2NY6B 2N7BA 4WI7A 4Y5VB 2BP8A 5EDSA 2NNAA 4N2AA 3IU4H 3DIDA 4CMMA 4NKQB 4M62L 1BWKA 1GHRA 2P3EA 2IUZA 3ZZQA 3H2OA 3W7RA 4CNTA 2PGWA 3NJHA 4FAMA 4L5FE 3MCLH 5CSGA 3MBFA 4KCTA 4GAGL 43C9A 3HGRA 1WFMA 2G60H 3D4YA 2ORBL 5FO2A 1NGPH 3ZUCA 3LS9A 3G6AB 1FZKB 2HVKA 1T5WB 2WLKA 2GSIB 2NT1A 4GO9A 4FADA 3TN0B 4ZSUA 3U0HA 5AL0A 4H20H 3DFOA 3EA1A 1RURH 3RJQB 1F5WA 4PRDA 3U4KA 4YDLC 2V9UA 1PVHA 2VLRB 3HIZA 1TMHA 4NZ5A 1TQVA 1P5UB 1U8LA 5IROC 1GOMA 3TZVB 3P5YA 4UFHA 3RGTA 5B1BB 3MVIA 1KRBC 4MNLA 3ABGA 3D52A 1NBZB 3KX6A 4K3DL 4Z17A 4FTVB 2F58L 4ADGA 3EO1A 4C65A 4TTDD 1SLVA 3ARGA 5BVJB 1EMTL 4NNXA 1LT7A 2Z92A 5JW3L 4R0LA 4WI6A 1PTGA 3ARGC 4XX6A 2QSCH 3SUSA 1B3YA 2PSNA 3VNJA 1A21A 1ZT7B 2Z00A 2YAPA 1AA1B 4KETA 4YTUA 1MJ7L 5I1JL 2IDSA 4LVOB 1NWPA 5CMAA 4HVBA 2J77A 3MRDB 1BEUA 3Q06A 2NX9A 3O6KL 4D3CH 3GFYA 5E1HB 1R2RA 4FS9A 2WAHA 4RGOH 4YVVA 5GGTH 3UU0A 4EAEA 1T0NB 4LPVA 1NC2B 3CBRA 1R5VB 1DJWA 5LO7A 2Q71A 3H0TA 5DA0B 5F7BA 1XF2B 1XX9C 2YPLA 4D1IA 1MFNA 4DBUA 3ESVF 2C4XA 2GGEA 3TMQA 1K85A 1BFOA 1DR9A 1NBVH 3WY3A 1YMME 2GY7B 1E28B 2NY3D 3CMGA 5ENWB 4ORMA 2AV1B 3QFJE 1X7TA 4NFCA 3MC0A 5T3XD 3HV8A 5IF0A 3AFLA 4A2DA 4RISH 3SYOA 4KKXA 3PUUA 1OF0A 3V1HA 5J9PA 3K0WA 3OGCB 4KX9A 4X4ZA 3PNWA 4JGDA 1OCWL 1N6UA 3MV9B 3UZEC 3KPNA 2YD6A 4J12A 2A9BA 1KTNA 5AC4A 3FQUA 4XR8C 1Q6CA 5FGBA 2FJHA 3QYQA 1VCAA 3N43F 5CAYB 5CJOL 4ZODA 2F7IA 3VD5A 2D1ZA 5C08A 3F5KA 2OU4A 3QEGH 4W4OC 3BEVA 4AYID 3SDCC 3B04A 3TAOA 3RWJB 5JQIB 5DBUA 4EEEA 3WFCL 1FDLH 4JFFE 3QDAA 5AAPA 4KZDH 1OGAD 4QS6A 3BW9B 3EJYC 2JSFA 1RIVL 2HVJB 1ADQH 2ZCHH 4GEJA 1OW0C 3SN1A 3HFMH 3L2NA 4M1RA 4HLZH 4K3EH 4HCRL 1PD1A 3HC2A 4DERA 2C1GA 5CN2A 3O3DB 2L4OA 3QF0A 4MWAB 2XVBA 2H2SD 3LKRB 1XR9A 1EAQA 5C3IA 3BRGC 4CQCA 4TVDA 2HKAA 4TNFA 3M7SA 4JIHA 4LMQI 2J57A 3H2EA 5I8EB 5DK2A 3Q2NA 5E99L 3VXUE 2FDBP 4E9TA 2W27A 4DZ8B 5BO0D 3GIPA 4U3AA 3ECBB 3NJXA 2WTOA 4EIBA 1YNTB 3VD7A 1Y18A 2ADIA 1BFOB 3NEEA 3S9DB 2V5MA 4ORZC 4HCLA 3RRQA 1ZANL 5CU9A 3D18B 4DEPB 5BMFL 1GC1H 4PP1C 1NDZA 1WDRA 2NTSP 3QWOA 1AMKA 1HCFX 2JQXA 4XSLA 4DGVH 5A6MA 3Q94A 5TE6L 4TS6A 3LSOA 1Q66A 3DXIA 4FTVE 3KHQA 5B22A 2FIKB 1NDMA 4PV1C 4GY0A 3M6DA 3BOFA 3BZEA 1NC4D 3UMNA 1AI1L 4EJ1C 3GI9H 2KLSA 1YRKA 4ACPA 4ZW3A 2VZOA 3JTSB 4AX6A 1QI4A 4QRFA 4AC4A 1MHEB 3PM6A 4GAGH 3TX4A 2CRMA 4MYXA 1A5FH 5DQJB 2XZAH 3A4WA 4L1SA 4C1KA 5JW4R 4AZBA 2PXYD 3QCUH 1C91A 1CD1B 2E7CA 4AENA 3L08A 2C1HA 2DBJA 1KQYA 5GRYA 4AC1X 4JKWA 5DQDH 3HZ3A 2YD5A 4NB7A 5J1AA 3FL7A 4OLXL 4XGZB 2R1YB 3MLYL 1GQJA 4GWEA 1E27B 4YS1A 4IHBA 3IV8A 4RW5A 3WF2A 5CCJA 4KK9C 2HCVA 4HA0A 3STGA 3NQ6A 4LOFA 2P5PA 3WUWG 4AWSA 4C47A 4LHUD 4ZQTA 5EY5A 2B4CH 4HIEB 3NVDA 1PKQE 4CVWA 3HKFA 1EGZA 3FA3A 3NZQA 4UTAH 2VSDA 3QDMD 4WWPA 5JXEA 3WH9A 3QIUC 3ENLA 1IGYB 4DAIA 1HC1A 1HKJA 2XPGB 2OMWA 3EO0B 4YK4B 1IJ9A 4IRZH 4PZVA 2FGWH 4E9VA 2CLLA 3VFMB 5HHNA 2GJNA 2G9HB 3HVDA 3VXPB 4LRIC 4AEIH 3P84A 1XCWA 4ZQKA 3D8MA 1YYMH 4KQ4H 3QA3B 1FWFC 1USZA 1YJDH 3HFYA 1NOWA 1I2RA 4EF3A 1JAEA 3ALGA 2GOUA 3KWVA 3CIVA 4O17A 2AC0A 3MLTA 1XJBA 3W82A 1A8ZA 4WRLA 3LNMA 2OG9A 4UTBH 4YTSA 4QXGH 4PMQA 4X6CF 1QFWM 2G3FA 3MRQA 3HS0C 4LHQB 1U2HA 4L4VE 1Z9SB 4IRJB 1GG1A 2PS2A 3CHFA 3CSYA 3A5FA 5FJTA 2RMNA 3BCJA 4QPEA 4S1RL 5AZ2H 4YN3A 1GJPA 5D5ME 2PBGA 2FCBA 3EJPA 3ABZA 1E9IA 4HGXA 2R1XB 2P50A 3MXWL 2NX5B 5AZEL 3L95A 3QCVL 1TCDA 2CO3A 5FI8A 1OE1A 5F7HA 4WDXA 3KP0A 3BTNA 3H9ZA 1OOAA 5L7XL 3H23A 4ZNEA 2OEJA 2DL9A 1TUPA 1ZA3A 4PCSA 3WE6B 4O1FA 1S2EA 2Q76A 4UYPA 5GHWH 5EFFA 1MCDA 3ZKMD 2DWDA 3IPFA 3S1WA 2HT4D 1KN2L 1SOXA 1AZ2A 2OL3B 4POCA 3QAQA 4J3OH 4HH9A 1SMDA 5E8OA 5IBUG 3VM7A 5LXGH 5D4HA 3OQRA 5ALBL 5GIRA 4QX4A 3LNFA 3R0DA 4DNHA 4UM9B 2CLOA 2QJJA 2QEJA 4UOQA 4HQVA 4JOMA 3WL1A 3DX6B 1AO7E 1VPYA 4JY9A 5DCBA 1HDMA 1KFEA 4WW2A 4OE7A 3W0WA 5IJDC 5BZXA 1IGSA 2HMIC 3MRLA 3B9OA 2YL9A 2WNXA 5E6IC 5AW2B 5C71A 2A77L 2XC8A 3LZNA 2OMNA 3CZGA 5AOZA 4O19A 4AXNA 4MASA 3KUMA 1MRCL 4LBEA 3WK0A 3VKJA 2XWBB 3RTLA 1ZSDA 5BXRA 4G6ML 2XKSA 1JZ8A 4POUB 3KPMA 1UASA 3HUJA 4S1SH 3CB8A 1UH4A 4UI2A 1FE8H 1IAKB 1ZMYA 1V7AA 2B9AA 3DFQA 3HFTA 3QLLA 5HYSG 3TT1L 4DF0A 2IAMC 4N0YH 5DJ6B 3B3DA 2X38A 1P6FA 4ONHA 4RFEB 3HQNA 2AJVL 4L4TE 2CW6A 4HWBH 4G7YH 3PWNB 1K9EA 5FYJE 1CJYA 3V0SA 2O5YH 2IALB 4QJ5B 3PREA 4GFTB 1SM9A 4LC6A 1CTNA 3WIIL 3KJ4C 1YLBB 3PL6B 2YQGA 5CF3A 1NPJA 2BMKA 5BCAA 1H62A 4GY4A 1IBFA 4M4RB 3M0XA 3FQTA 1LWRA 1E50A 2W94A 5H94B 4LO9A 4A66A 5A2KH 4IIEA 3VDHA 4FC3E 3G7TA 2YBRA 4LEBA 3DERA 3VFGH 4W81A 3AU2A 4J3VA 1JUBA 2J7FA 4RFOL 2RBLA 2QW5A 2OSWA 3S34L 5E9DA 3EDEA 3I6LD 4S1DD 3CAVA 1AXSA 3OIHA 4UTFA 1MOEA 4DJMA 4JTEA 3NA8A 3OPUA 3BD5A 4HYRA 4WGWB 3P54A 1TVBB 4PQXA 5C6TH 1Z69A 2WAGA 1SZGA 1TPUA 2IQ0A 5AB9A 4QDPA 3RAJL 4B3LA 3EOBA 4L4VB 1GZHC 3W07A 4DJDD 3NA9H 2Q3AA 2FTAA 4MJ4A 3V79C 4LQ1A 4BFRA 2PPFA 4EKJA 1R2SA 3EYSL 3GMPA 4HGWA 3U2OA 2Y1HA 3LZRA 1I1CA 3BVDB 3MUUA 4YDZA 3OBAA 1A7NL 4Y1AA 1JGMA 3GXTA 4PR5A 3TJEH 2C3XA 4N90E 4Q8MA 2C4FU 4MD0A 5H91A 1NCAL 4BQCA 1TWZA 5C9JA 2X0HA 3C75A 4QOKD 4FLOA 3LJ3A 1JHTA 4NNPL 3Q3GA 1FFPA 2RDUA 3BDYH 2CIIA 4MNQE 1AD4A 1UFGA 2FZ3B 3WO4B 5IKCA 3NGJA 4TO8A 4BKSC 3LGDA 1MRQA 4GIEA 4QGTA 3FU6A 4U5KA 3SRDA 3TSBA 1XCFA 3TO4D 4JQ4A 3MMDA 1WHPA 3KCWA 2QQLL 4OUIA 2RCSL 4GQRA 4IRZA 5TE4L 3TT3L 4B3ZA 4RMVA 2HVMA 3UC0H 1F73A 1OGAE 4BJHA 5KBNC 5AW4B 3LKPA 1TOXA 5HHOB 4MQTB 2YFNA 2EDEA 2ZOKA 1S5VA 5FO7B 3I6RA 1Q63A 4GOSA 4YHMH 4M7TA 1PY0A 4E0CA 1MAKA 4WCJA 2BSSB 4ZUWA 2V5BA 4YWGH 4W85A 4ZPTB 2PODA 2FGWL 4X63A 1OC5A 3MJ9L 5HJ3B 2OR8A 1IAIH 4ICMA 5D9PA 3RHWF 3QJUB 4RRPA 3S8HA 1UUNA 4JM0A 3N3EA 2PTDA 1UMYA 1KN2H 2CKBL 3VFWA 4A67A 4F15C 1V6TA 3OHIA 4UR8A 5DK3A 4GSDH 4XCCL 2VDIA 1NL0L 4HIBA 4MTVA 2X1RA 3PHSA 3QUZD 2OEKA 1PZBA 2PDHA 3L3GB 4YC2C 1UEYA 2UX6A 3WNNA 1TZ9A 3O4LA 1YEWA 4KAQH 3MO4A 5FJIA 4Z2GA 5KSUA 2E3ZA 5GGVY 3AHVA 4OCRH 3FK4A 5E9XA 5CKGA 5XIAA 3WLKX 4XD5A 5SWZA 2J2ZB 1U95B 3X1BA 4F37K 4H4NA 3ES8A 1IM9B 2FH8A 5GGTL 3RVXD 2GVEA 2OMTB 1BD0A 1M9SA 5D7JB 4F27A 1QLFB 4MJ6B 4YHYB 1CO1A 1QLFA 1O5QA 4XWGH 4LV4A 1JOIA 4DYEA 1EPFA 5B38G 4A2GA 1TJHH 4C56E 4K1WA 4TF4A 1SJVA 2DQWA 4RE0A 4BHYA 5K1VA 5IB2B 1HNGA 1EJXC 1JPHA 1I8AA 2HKHH 4FGMA 4JFWA 1S5WA 3WJLC 5ETUB 3MBWA 4NUQA 4B91A 5AVVB 4Q3MA 3GK0A 2AAAA 2A9DA 4JO3L 4UIKH 8CGTA 2OOGA 5GGQH 3PZQA 4GUHA 1SY6A 4GFXA 3QOMA 4HNUA 1DFBL 3O6YX 1IGFH 4JRXE 3L13A 5MEQB 2I7GA 2GUOB 2CR0A 3BSMA 3GEWB 1S1PA 3ORJA 4C59B 1S7XB 1Q9OB 3SEPA 4Z7UB 3A3YB 3FJNA 3PWGA 4QRPA 4QRBA 3EAUA 3O8AA 4P8XA 3DMMA 3EYUH 1NCUA 1OW0A 4NWUL 5AKSA 1QPNA 1JV2B 1V3IA 4KWSA 1BQKA 4L9ZA 2J13A 1TE6A 4R7JA 1JWMB 1GKQA 1WBHA 3GAYA 3QDGE 2X2GA 4Y9MA 2YD4A 3NDZE 4RWYL 4B90A 1BG9A 4WWNA 2QNEA 3KLAB 4H1LG 2AEPL 2BNQD 4BH8B 4EI6B 4BH8A 4EI6A 2Z31B 3UYRL 5CR1A 3OOQA 3HZYB 3WMBA 4S1SL 2PPCA 2WXFA 1E6XM 4EDXB 1SXAA 3PY9A 5LIKX 1PIIA 2FJGA 3MXVH 2NY1C 4LUIA 4ZEPA 5PTDA 3SE9H 1W72H 1FBAA 2F38A 2Y8UA 3LNPA 2V37A 2VDKL 4MXWL 3TNNA 1I7ZA 3MNZB 4LCRA 3RMEA 4TXVB 4D8OA 5A2IH 3LS4L 2BCKA 3Q43A 5I5RA 1UH2A 3VGGA 4QRRB 2OMYB 3WNLA 1MDTA 1IIIA 2YSSB 1PZCA 4PJGE 4F8NA 3GU1A 4G6CA 3IVUA 4Q4QA 5BMXA 4PB0L 4TV3A 4M9PA 2FPVA 4PCKA 3Q4DA 1DVYA 4KFZC 5K93A 3F5LA 1WFIA 4FHKA 4ALDA 2H1PH 3U7AA 5D8ZA 2JFEX 1U8QB 4JX5A 3F58H 3Q8CA 5KOMC 4FZIA 2D0FA 2FSEA 1ULVA 3GD1C 2B39A 3AXHA 1ESWA 2OL3L 2V9TA 1MZYA 3E7JA 1FUYA 3TOPA 1HXJA 2C15A 2VDNB 2XRAL 2WKOF 3B2PA 3NAAL 4M5ZL 5DHMC 4N0UE 5DJDB 1L3NA 1Q3NA 1R33A 1WS8A 1TJIH 5T1MB 1JEZA 4QE1A 3TA6A 2OT0A 1VP5A 4KHXH 4Z8FL 3L9CA 3TM6A 1R2TA 3S83A 1NFDB 3KPQA 3SO3C 6CGTA 5KYXB 1RK6A 2ZRYA 3V52L 5E94B 1TJRA 2MIZA 3H2PA 4WHTB 5AVSB 1EJTC 4PBEA 1QHPA 2C9UA 1OGPA 3TZVA 1QLRA 4ZUSB 3ZKMC 1QFWH 3CQFA 3FB7B 3HBZA 5ICZB 1XBYA 3NPZB 2OMAA 3N6HA 1UROA 2WHVA 4U1LA 3VVVA 5A2LH 43CAB 5KVDE 3I3EA 5BXTA 5HULA 2C1IA 2ZRVA 5CINH 3B7UX 3OLEA 1W0WB 1L6FA 1KV7A 4DVRH 5F1IA 4C5YA 3SJ3A 2GSGA 4I18A 4Y16B 4O9HL 2EDJA 1XWYA 5FO8B 1I3RA 2C5DC 2CDEB 3C6LC 3CMOL 4ADIA 2O56A 2DBLH 3LY0A 5I0DA 3AU1B 2UZIL 3EFOB 3QZPA 3VCRA 1B9ZA 1JI1A 1FVDB 3SN6N 2Q8AH 5CP7A 1SUHA 4G6AC 1WAEA 3I3BA 2QPSA 1L5GB 3V7AE 5LIWX 1LF1A 4D8PA 4NC1E 4XE0A 4Z3IA 4Z1CA 3RL2B 2H6PB 3JTTB 2Z64C 1JGLH 1WG3A 3KPSB 4L2YA 5E23A 4MBRA 5I8KH 2MANA 4QGCA 2EXSA 1PNDA 4Z2LA 3DBSA 3RGVA 4D9PA 1AG1O 3GS0A 3PHQA 5FA4B 3UPMA 4PE8A 3FQYA 5FV2A 5AW9B 4APQD 3NEVA 2CRZA 1PUDA 4Z0XB 4ZSOE 3M45A 3H55A 5DFWH 5DZNA 4Z0XA 1W5PA 3GDLA 2VKZG 3RJYA 1BMWA 5ILTL 5EUKB 3CFBB 1US2A 3PF3A 1OX4B 1F4AA 1O60A 4GI8A 3VI3B 4F0MA 1EZVX 3NIFE 1MDAA 4GFSA 2DYPD 4KRUA 1HOCA 3WN5B 4ZW8A 1UZ8A 5D96B 4E8DA 5ECVA 1GY2A 2QUTA 1WXZA 4E0RA 1HVXA 1FSKC 3EX2A 4UR7A 1FZOA 4FULA 4X7EC 4CD4A 1X44A 2JIXD 4DKTA 4EIZC 3B03A 3MS8A 2EPNA 1EQWA 3WIFA 1R0AL 3KYAA 3QZ6A 5HAOA 4HFUH 1IL1A 1FPTL 1UWFA 4M4PA 4JHVA 2WO4A 4IRSB 3T2LA 4JM2C 4UQBA 4K6AA 1NTDA 3BLPX 3HMWL 3N4AA 3PUCA 1CICB 3KW7A 4I9TA 3EOBB 3FCPA 3CPLA 3E8VA 5HGHA 7TIMA 3FOMB 1VHPA 3HTLX 4QE5A 2BY1A 4XTRC 2VDPH 1C9WA 3REWB 1NCCL 1PCXA 5IV2B 3DJRA 4M7JL 4R33A 1X5YA 3P3BA 1OJXA 3BWAA 4XIMA 3ZLHA 1MDRA 1BWMA 2JI2A 3MKCA 4I1PA 4JX6A 4OM1L 2E8ZA 2WZIA 4F48