3CUFA

Cellulomonas fimi xylanase/cellulase cex (cf xyn10a) in complex with cellobiose-like isofagomine
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
314
structure length
314
Chain Sequence
ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAFGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exo-beta-1,4-glucanase
publication title Probing the binding sites of Family 10 and 11 Xylanases with extended Oligosaccharides
rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
total genus 132
structure length 314
sequence length 314
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cufA00
2OWXA 1OBAA 3CZGA 3EMCA 2PC8A 4KMQA 2WPGA 4JFWA 3ZIZA 1Q4NX 4MB5A 1MW0A 1BGAA 3HJEA 5DFAA 4N42A 2EPOA 3GXDA 3FXYA 3LPGA 2ZXAA 3WELA 3W81A 3EDDA 3BAYA 2EPMX 3EDKA 4PTXA 1TVPA 2DT1A 3SEPA 2WZIA 3TOPA 3FN9A 2XWEA 2CERA 3IJ8A 2YL9A 1WE5A 3F5KA 1FOBA 1V3HA 3TTQA 4S3KA 3T2OA 1GHSA 1MXDA 1GW1A 2JIEA 2CPUA 1J12A 2C7FA 1UD6A 4CCEA 3RM8A 4IM4A 3U5YA 2EXOA 1YHTA 2XGIA 4UFHA 1B30A 3CHEA 5M5DA 4C7DA 4ZE5A 3ZO9A 2VCCA 4ZXLA 1E6ZA 4GIAA 2J7EA 5CJ5A 4GO9A 4RE4A 2BVDA 4LXFA 3UCQA 3U5UA 3WF0A 2WVVB 2UWFA 1HJUA 2F8QA 1LG1A 5A1AA 1OT2A 1QI0A 4OJYA 4PTVA 3WMCA 5DT7A 3WH8A 3N12A 4HMEA 2HISA 1UD3A 3WNKA 1KR1A 3VU2A 1GVIA 4PRWA 3MUIA 1J0KA 5ABGA 4HOWA 2V3EA 3JUGA 3O9NA 2BHYA 2VX4A 4CGTA 3OA5A 4CD4A 3VIFA 4JFTA 3WFLA 3WH6A 3RIKA 1BPLB 3W28A 2YIHA 5BRPA 3CUJA 4NI3A 1BAGA 2OWWA 3N11A 2ZX5A 2CESA 1KFWA 3PZUA 4U2ZA 2VVNA 1BVNP 7CGTA 1CXKA 1GVYA 5A8NA 4YN5A 4J3XA 4XB3A 1KXVA 4PMXA 3SCTA 4JFSA 4ACYA 3LPOA 4LPCA 1C8QA 9CGTA 2FHFA 1OCQA 1C3FA 3AXIA 3W4RA 1B31A 5I77A 2PWEA 3D3AA 1W9XA 5CSUA 1CGYA 3N9KA 4MB3A 3UR7A 1MQQA 4NZCA 1CTNA 2DPEA 3N15A 7A3HA 1NP2A 4BQ5A 1CGTA 5JBEA 3EDFA 3WD2A 1OM0A 3TP4A 1HIZA 3M46A 2XYLA 2WVSA 2DSZA 2CYGA 3GBEA 4AMCA 3CZEA 3WBEA 4CKQA 3I3EA 4F8XA 3B8SA 4JHOA 2JE8A 1HVQA 1QW9A 2XJ7A 3SCUA 1H0GA 3A6OA 4UFLA 3RILA 1W2PA 4BQ3A 1WZLA 3KZSA 3GTNA 2ZUVA 1Z32X 3EMZA 5I24A 2JF6A 4XZBA 5BCAA 1CNVA 3BSGA 3L4TA 3AIRA 2DIJA 2W67A 2CKSA 1WDPA 1UH3A 3AIBA 1KBKA 4B15A 5C8BB 3VPLA 1A3HA 4DUVA 2TAAA 1O7AA 3T2QA 1D3CA 3DHUA 1ISVA 2WCGA 4U5KA 3NDZA 4W85A 4J27A 4PUEA 1SMDA 1U33A 3VIHA 5A8OA 1UKQA 4A3HA 5I3DA 2BXZA 2F2HA 3MKKA 4WKHA 3NCOA 2WCSA 5M17A 4CVUA 1CXIA 5FD0A 4PMVA 2GJXA 3VMPA 3ZT7A 1XSIA 2OSWA 3LMYA 2BV9A 2WHMA 3TTYA 3M07A 2FHCA 1FH9A 1NWRA 4TVCA 1TG7A 3AICA 4DUWA 1NWTA 3MUAA 4DM1A 4KGLA 4W5UA 2DSWA 2X05A 4ZFMA 3SUVA 2OYLA 3LPFA 4D1JA 4P7LA 2VX7A 3NUKA 1UR0A 2BY2A 2J7GA 4GI9A 3MU7A 4HZ7A 5BXRA 1OD8A 4OOUA 2YOCA 3CMGA 4RE2A 4Z2GA 4Z2IA 4DWSA 2YDRA 2W92A 3ZR5A 1JZ8A 3VDBA 3PZVA 3SCPA 1QVBA 1XGZA 1ISWA 3WH5A 3HMCA 3CGTA 1J0IA 3WDQA 1V6VA 4Q22A 1HJQA 1L0PA 1HT6A 2J7CA 2WHJA 1XHGA 3K8MA 4KRUA 4M81A 2XVLA 1JL8A 1BF2A 1V08A 3WIJA 4W8BA 4UQAA 4GXPA 5D9OA 4WKFA 3T0DA 2GVYA 1AMYA 2VRQA 4AZIA 2WWDA 3GXIA 3NSMA 1QNQA 1HKMA 3WF1A 1UZ4A 1J9YA 2JIWA 3VD9A 1GOKA 2XTKA 4UOQA 2J25A 2DSKA 3ZJ7A 5FIPA 1KXHA 1E40A 3ARUA 4K68A 3ZR6A 1BYDA 4OUEA 1KCLA 2YL6A 6A3HA 3ECQA 5JIPA 1QNPA 3TTOA 2QHAA 1OD0A 2CNCA 3ZSTA 2GSJA 1ZBVA 2Y8VA 4LQ1A 3ALFA 8CGTA 4UZSA 1W1YA 3WQVA 3K8KA 4B9ZA 4H7VA 3TTSA 3PTQA 4P8VA 4OBRA 2WHLA 4HTYA 1QOXA 4C7GA 3T09A 2O9RA 2CKRA 1X1NA 4UQCA 1SFSA 1GQLA 1BSIA 1MW2A 3ALGA 2ZX8A 3HN3A 3ZT6A 4JIEA 3A4WA 3RM9A 2WZEA 1BHGA 5BXPA 1C7SA 3BAXA 2D20A 3ZOAA 2V3FA 5A94A 1H11A 5LA1A 3QOKA 5D9MA 2VRJA 2O9PA 2WW5A 4J3UA 1E5JA 1WPCA 5AY7A 4P8UA 4UCFA 1J0JA 3WEOA 3MS8A 3AS3A 3NYDA 2ZX9A 3THDA 3VMOA 3KE0A 4ATDA 5I78A 3WH7A 1KB3A 5BXTA 1E9LA 5FL1A 3F5LA 4GINA 3WNNA 1HKIA 3K1DA 3PZ9A 6TAAA 3RCNA 3VINA 1IZJA 2ZICA 4BCEA 3A4AA 2E9MA 2G3JA 2X09A 5HBFA 2JALA 4AYSA 1GUVA 3TONA 1KQZA 3W6LA 3EDEA 4PCTA 3SUUA 4CCDA 1ZJBA 1VAHA 2OSYA 1QHPA 2WVTA 3G6MA 4AD0A 1MW1A 5AYBA 1QNOA 2VUYA 3UG3A 1HVXA 1J11A 3ARRA 4WIWA 3POHA 2ZX6A 4OZOA 1YQ2A 1HF6A 3CTTA 3PZNA 1UD2A 4W88A 1VRXA 3AS2A 3KL0A 4IISA 3AHYA 2VT0A 3WNPA 1JYXA 2W63A 2HVMA 3PN8A 3ZM8A 3CUFA 1JDDA 4WKAA 3GH4A 1LWJA 2YL5A 1B90A 1GNXA 5A95A 2ZIDA 5LYRA 5JBDA 1WZMA 4W87A 1QPKA 5EFFA 1UR2A 2W62A 3WQ4A 4B3KA 1JYNA 1WCGA 1US3A 2J7FA 5BYWA 2AMGA 3POCA 2YA1A 1LL7A 1NH6A 4H2CA 4LYRA 4XV0A 2A3AA 3B9DA 1KQYA 2D23A 3A4XA 2RGLA 3VILA 3VIPA 3THCA 3UEQA 4PMYA 5E0CA 4ZEPA 7TAAA 5C70A 1WZAA 4FF5A 2FH6A 4UFJA 4UQBA 1OSEA 4X0VA 2ZUTA 3ZJKA 4HZ6A 3NSXA 4AZ6A 1UA7A 4X0NA 5GNZA 2YLAA 3L4ZA 2VVSA 3APGA 4P7NA 1TA3A 2DQXA 5I23A 3NIYA 4A3YA 1R7AA 4Z2LA 2XIBA 1J10A 5TD4A 3VIMA 4HPGA 2FH8A 1G94A 4AIOA 2XVKA 3AROA 5BWFA 2WZHA 4QCEA 1F4AA 3PTKA 2DT3A 4PMQA 1WZKA 1E0XA 4JKKA 1V6XA 1FH7A 1CYGA 5CPTA 3VNZA 3PZOA 5A3HA 2F61A 3L2LA 3FNDA 4HP5A 4D6FA 2ZUMA 4AEFA 4TTGA 4JAWA 4B9YA 4AISA 4UQ9A 3G6LA 1N82A 3LPPA 4KGJA 4M1RA 3WBAA 3ARXA 4D6EA 3FHAA 2VNCA 1H09A 3WH9A 1X6LA 3BAWA 5A8MA 4P7OA 1K9FA 5CLTA 1EXPA 1C92A 2RGMA 3WFZA 2W5FA 4F9JA 1HKKA 1JNDA 2XFRA 2WCAA 1ESWA 2WMIA 2GJRA 3VGEA 2E3ZA 1O6IA 2VRKA 2J8GA 4GI6A 3FW6A 2J62A 1FP8A 1MFUA 1NP0A 3IJ9A 1UH4A 1CDGA 1H0IA 1M03A 2OYMA 2WSPA 4JCLA 4GQRA 5FKYA 4MNMA 1S46A 4JL1A 4N0RA 3AZRA 4KRTA 5AYIA 1LF1A 4AZCA 1PIFA 1ZJAA 3CLWA 2WMJA 5CLWA 5FCZA 1DWGM 2BVYA 1QBBA 2VQUA 1CXFA 1H2JA 5DT5A 5CGTA 1KGXA 1V3IA 1JZ5A 1C90A 4U5IA 1ODUA 1A47A 1R87A 4GKLA 1Q6EA 2DDXA 4E8DA 3VIKA 4PMRA 2EPNA 5A6LA 2G41A 4ZE4A 2NT0A 1NOFA 1OINA 4QAWA 3GM8A 1QNRA 1PBGA 3WDIA 2XVNA 3FY1A 4LYQA 1VIWA 4PCSA 3CHCA 2VX6A 4TX6A 2QF8A 2XWDA 2GK1A 4U3CA 2V5CA 2YBUA 1V6YA 3VIGA 4M8UA 2IUZA 4BF7A 2A3EA 1MFVA 2CBVA 5HPCA 5AC4A 3AS0A 2X0YA 4F9DA 1KCKA 1EHNA 1BYCA 2J74A 2PWHA 3WDHA 1UH2A 1UWQA 2UY4A 4H41A 3MMWA 5A6AA 4EKJA 4DWSD 3AJ7A 1XD1A 3A3HA 4Z2KA 4NSBA 2WXDM 3PZIA 2D0GA 1JD9A 3ARPA 2GUYA 3K4AA 5DF0A 4V28A 3WY1A 2GJXB 3MO4A 4MNLA 1U2YA 2Y8KA 3WNLA 3MMDA 1CXEA 1UWSA 2UY3A 1PEZA 3WDRA 5A8PA 1QBAA 3W37A 4CN6A 1OIMA 4J3TA 1JD7A 2A3HA 4PTMA 3VIJA 4Z2JA 1EDQA 3ARVA 4CD5A 1DTUA 4BS0A 4L4PA 2ZUWA 2CHOA 1IT0A 4Q7NA 3CO4A 1UWUA 4AY1A 4CN1A 1XD0A 3O6AA 5D9NA 3VVGA 5CZKA 4IPNB 1BVZA 4HOXA 1R86A 4AEEA 3VIOA 1E6PA 4UFKA 3VO0A 1MQRA 3VDCA 1R8LA 2EPKX 2XVPA 1VENA 4OBSA 2CIPA 2W91A 2PWGA 2DIEA 4HU8A 1TMQA 4AIUA 4MDOA 2Y24A 1ISZA 3GBDA 4XZWA 1LL4A 3WDPP 1J01A 5AC5A 3QGVA 5IDIA 1UOKA 1E56A 1JXKA 1TVNA 4J7RA 1V0MA 1JF5A 2YA2A 2DSUA 1U30A 4R27A 4XUYA 4W7WA 4M80A 1Q6DA 3OLEA 2UY5A 4U31A 4YHGA 1UA3A 2E40A 1WO2A 3D5HA 2OWCA 1QNSA 1RPKA 1IZKA 2WMGA 4PSRA 4E8CA 1H3GA 4MB4A 2JEPA 5JUVA 3BMVA 1OGGA 1XCWA 3OLDA 4FK9A 3ZSSA 3VGFA 2PBOA 3KWXA 5I79A 1EOMA 5I0DA 1W9PA 1GORA 2WKGA 2X0HA 5A8QA 4QCFA 5ABFB 5A6JA 3WEZA 1UYQA 3AIVA 4HMCA 3AYSA 4J3VA 3MUY1 3OLGA 3WEMA 3IJ7A 4OOZA 1HN1A 1HP4A 3CIVA 2VCAA 3AMKA 2Z1KA 2D24A 4QP0A 1EDTA 1W1PA 1W32A 5FL0A 3K8LA 1BYAA 4UZUA 2WWCA 3WD0A 1JFXA 4HA4A 1MQPA 4AZ7A 1XH0A 3N1AA 3IAQA 5E6ZA 1UD5A 2W66A 2PBGA 3RJXA 4M82A 2C8NA 2VZSA 4LGXA 5DO8A 1PAMA 2O9OA 1GOOA 1KWGA 1UR9A 1E3ZA 3VX0A 1JZ7A 3DC0A 1QI4A 4BZYA 2VQTA 2Y4SA 3S6TA 5D4YA 2ZE0A 3SUTA 1EQCA 1B3XA 1ZBKA 4P7QA 3N17A 4MPKA 4UFMA 3OZPA 2D0HA 3E1F1 5GNXA 1V03A 1DWAM 3MMUA 5A6KA 4F66A 4TVDA 1XV8A 1FA2A 3VOCA 1UKSA 1C8XA 4UOJA 1UR4A 4KH2A 4MNJA 2E8YA 2VO5A 3EYPA 4V2XA 1AQMA 5ABEA 3BAKA 1UWIA 2FGLA 3AQUA 4W7UA 2ZXQA 1KGWA 2G3MA 2W61A 1SYTA 2DH2A 3GH5A 4D6CA 1GHRA 1EO7A 2X8RA 5HNNA 3AMCA 1K6AA 2C0HA 5FOOA 3VUPA 1F4HA 1ZBWA 2OSXA 5IFTA 3F5JA 3PHAA 2PWDA 4AD2A 3VGHA 4ZENA 1D7FA 2GFTA 2WMHA 4H8HA 4CUCA 4CVWA 1TCMA 3AYRA 1NARA 4BA0A 3WKZA 1RP9A 5IHRA 2J79A 1E1FA 4MDPA 1UR1A 1WB0A 1B2YA 1ZU8A 1E6XM 1E6RA 3CUHA 3IANA 1VFOA 2WANA 3WNMA 1H1NA 4JKLA 1V3MA 5BRQA 1G1YA 5GNYA 4YHEA 4W84A 4KWUA 2G8ZA 2Q8XA 1BYBA 1CXHA 2WK2A 5M3WA 1KGUA 2ZWYA 3WENA 2YBTA 3W27A 3VD3A 2J7DA 1PX4A 5IHSA 1E4IA 4ATLA 4CU6A 2DGAA 5I5RA 4EK7A 1HNYA 1XC6A 1QI3A 2FHBA 4W5ZA 4PSPA 1JZ3A 3ZJ8A 3BMWA 4WF7A 1GCYA 5DEZA 2XVGA 1HL9A 2A3CA 1JFHA 2ZUSA 2UY2A 1TFVA 2VL4A 3GNRA 5ABHA 2WYSA 1JAEA 2EJ1A 4MADA 3U57A 2VJXA 1E70M 4FLOA 1P6WA 5A69A 1WDQA 2W4XA 4PMZA 1H41A 2VX5A 3DHPA 1JZ6A 1CIUA 3VD4A 2WHKA 4E4PA 1OWQA 3GDBA 3M7SA 3RJYA 1UWTA 3CUGA 5D8ZA 2CXGA 3AOFA 1EA9C 5A6MA 2XHYA 1UWRA 4JKMA 1C8YA 4U33A 4GPNA 4CCCA 1H4PA 4TUFA 2Z1SA 3GNOA 4WJXA 2V5DA 5CPQA 4P8XA 3AXXA 4D6DA 1GOIA 3OGRA 3WQ8A 4E2OA 3CHFA 1QI5A 2WVUA 1B3VA 2WMIB 2NT1A 4P8WA 3K46A 5CQ1A 1XYZA 3EMQA 1V02E 4DUXA 5A6BA 1BLIA 4PTWA 4R5EA 4QDMA 4B16A 1W2VA 1W9BM 1FHDA 2XUCA 4PMDA 5A2CA 1JI2A 2BVTA 3B9EA 2EO7A 1G9HA 1WKYA 1VEOA 3SCWA 1H49A 1OGSA 2QMJA 4W89A 1ITXA 1J18A 4TOQA 3VKKA 4ACZA 1E71M 8A3HA 1R85A 4XX6A 3ZT5A 3BSHA 3W82A 1W9UA 2VZUA 4AZBA 3GYCA 3AZSA 5E70A 3RPMA 1LQ0A 1PZ3A 1BGGA 4Y7EA 5KZ6A 3OIHA 1V0LA 2ZXBA 3BC9A 3GXMA 1QHOA 2BY0A 1W1VA 3WMSA 5KEZA 5IXEA 1ZBCA 3O2LA 4D6HA 4M56A 2CBUA 1Q6GA 1CEOA 3PZQA 6CGTA 3W24A 1E0WA 3KL3A 3OG2A 1KXTA 4UFIA 2E4TA 3GNPA 3AISA 1EIBA 2WKLA 1W9VA 3VDHA 3B9AA 1G5AA 1G01A 1B0IA 3WUGA 3VGBA 4P7RA 1R7OA 1BQCA 2BY1A 1MW3A 3W29A 4JL2A 1ECEA 3VMNA 1GONA 4JHZA 2WLZA 1UKPA 3F4VA 1DWHM 1X6NA 4AXNA 1C93A 3CH9A 4S3JA 1JG9A 4UQDA 3W25A 3WN6A 1VFUA 4QLLA 1M7XA 1CGXA 2XSBA 1UD8A 4PBGA 3VM5A 4WSKA 2JFEX 1DWJM 4PMUA 4TVUA 4JFUA 3OGSA 3SCRA 1UKTA 3OLIA 4BQ4A 5I6SA 1AVAA 3A47A 2ZXDA 2QMKA 3PBGA 1KWKA 2VCBA 4CD8A 2Y5EA 3SCSA 3PTMA 4D6JA 3AMLA 1V3JA 1M53A 1GOMA 3SURA 1DP0A 4FLSA 1E73M 4GZIA 1GJUA 2VR4A 3CHDA 2YJQA 4CD6A 4RE3A 3U7BA 1J0HA 5CXPA 1RD6A 1JAKA 1PPIA 4HU0A 4FMVA 3VDAA 4Z2HA 3ARSA 4UQEA 1ODZA 1ITCA 1LLOA 3BAIA 1JDAA 2WNWA 1VEMA 4EE9A 4AD3A 1E1EA 5BXSA 3AI0A 5EBAA 4HA3A 2BXYA 3MSDA 1FFRA 1VF8A 1GJWA 3ZMRA 1LG2A 1EGZA 4MTVA 1HKJA 3SCNA 2ZWZA 1KR0A 1OB0A 3EBVA 3WQWA 1V6WA 3AFBA 3BLPX 4W8LA 4MNKA 1B3YA 4J28A 2WLYA 2ZX7A 5E0FA 4ML4A 2CBIA 2O92A 1NWUA 3VD5A 2X2YA 1UQZA 4PMNA 4EAMA 5F7UA 1SMAA 4W8AA 5LA0A 3GZAA 1HJWA 1UKOA 4X9YA 3T0AA 3PZMA 3W0KA 4UNIA 4QFUA 1DHKA 2BFGA 3K4DA 3NJ3A 2QLYA 4PUDA 3CUIA 1H5VA 4EANA 2WMKA 2J47A 2QV4A 3I3BA 2XM1A 3VM7A 5DMYA 4HOZA 3EDJA 1UR8A 4IPLA 1GQKA 1B3ZA 1UQYA 1UD4A 1VFFA 1ZL1A 1GPFA 2EEXA 2Y2WA 3UG4A 1IV8A 1E55A 3SCOA 4WK9A 3RM4A 3UESA 1JNEA 1V3LA 5HXMA 3OB8A 2OLHA 1EQPA 3CZKA 2J7HA 4WLCA 5M03A 1JGIA 2ZOXA 2CEQA 1VB9A 3T08A 4PEEA 2X1IA 1NWSA 3QHMA 5A2BA 2WMFA 1I75A 3ZQ9A 1LL6A 4QLKA 3II1A 4AW7A 2BHUA 2VR5A 2OYKA 1G0CA 1M01A 1ZS2A 4H04A 2CHNA 3WNOA 2XGBA 1JIBA 3VIIA 1XYFA 1GZJA 3TA9A 1DEDA 1CLVA 3AIQA 3OZOA 4DWSB 2YKKA 2BHZA 3MSGA 2XSAA 3QHOA 1MWOA 3DYMA 2DH3A 1BG4A 5JIWA 1XSJA 1UHVA 1GOWA 3NDYA 2J7BA 1QW8A 2ZUUA 2NSXA 1B9ZA 2WBKA 1AQHA 5A2AA 3L4VA 4V27A 3ARTA 1W3JA 4D1IA 1MVYA 1XRVA 4DM2A 1FP9A 4ATWA 5A6SA 3DECA 3BH4A 1M04A 2D2OA 3WL0A 5E6YA 1BTCA 1PZ2A 5E9AA 2VURA 1WNOA 3MUZ1 3SCVA 3VTRA 1EDGA 1OIFA 2VI0A 1E15A 1DWIM 4OKDA 3GH7A 1B3WA 5EFDA 2WC3A 2E8ZA 2WVVA 2CCRA 2XIIA 3WUBA 3N18A 2PB1A 4GZJA 1XCXA 1JF6A 3QR3A 4U3AA 1E3XA 2J4GA 3W53A 1GQJA 2WC7A 1QI2A 3WDJA 4CN4A 5ECUA 4BQ2A 4QLJA 1B1YA 1VJSA 1V02A 2JEQA 2YDQA 4JFVA 5BROA 1CWYA 1JYWA 3KEHA 2D1ZA 1XH2A 3UG5A 1JYVA 1UUQA 2CBJA 4TTUA 5E09A 4H8VA 4D71A 2QPUA 4MJ2A 2J8FA 3QHNA 4J3WA 1QHZA 5CG0A 5CGMA 5GQBA 1L8NA 1Q6CA 2VZTA 4RL3A 2GDUA 1CGVA 1WDRA 2EBNA 4CU7A 1LJYA 1NM9A 1NOUA 3AHZA 3IAPA 4M29A 3BGAA 3WF2A 2PI6A 4YPJA 3SCQA 4MAVA 3VNYA 5LA2A 3CBWA 3WQ5A 4UOZA 4JZ5A 4AWEA 1CZ1A 1FHLA 3AIUA 3FAWA 1SR0A 1XH1A 2O9TA 1I1XA 1HJSA 2DEPA 3S2CA 2XFFA 3BXWA 4U2YA 4AZHA 2G3IA 5A6BD 1E4LA 5HDRA 1E4MM 3CZLA 1BG9A 2WC4A 4D6IA 2FGZA 1JZ2A 1XSKA 4MJ4A 3AMDA 4MB1A 2IXUA 4M24A 2XG9A 1LWHA 2QPSA 4TXEA 3WSUA 1VFMA 2G3NA 1E43A 2ZUNA 2YDSA 1HP5A 3AXHA 2G4FA 1PX8A 1OGBA 3BCDA 1V6UA 1VJZA 2DSVA 5CSYA 5HOSA 4URIA 3W6MA 4FLQA 3WF4A 3W38A 4GO8A 1E0VA 3PZGA 3U7VA 2PF0A 1HL8A 3AS1A 2V3GA 3AMGA 1RP8A 3L4UA 5D8WA 2AAAA 2A3BA 3WD4A 2WAGA 3OGVA 3N13A 3I3DA 1V3KA 2YA0A 5GPRA 2B31A 2DT2A 3SUWA 4GQQA 4W86A 4J3SA 2VTFA 4MAZA 4GI8A 1V0NA 3WL1A 4LX4A 3WMBA 2VZOA 1WAWA 4W7VA 3MANA 5ABFA 1CECA 1E4NA 4OIFA 3WQ6A 4PYSA 1OT1A 3T0BA 1W3LA 1BFNA 3L4WA 2J78A 3WF3A 3AHXA 1E5NA 1CBGA 2E9BA 4HZ8A 4ACZB 1K9EA 3T2PA 3L4YA 3UR8A 2V3DA 1C91A 1HJVA 2XM2A 3VD7A 4AD5A 3DYOA 4AC1X 1JDCA 4B3LA 1TZ7A 2BS9A 4NF7A 1CENA 4AD4A 3NSNA 4UR9A 3RO8A 1TA3B 1NOWA 4ZXOA 1FFQA 1EO5A 3ARZA 3BCFA 1UG6A 3CPUA 1CPUA 4NRRA 2YLLA 2DT0A 4NRSA 3RMEA 1GOQA 1AQ0A 5D9PA 4A4AA 1VBRA 2J75A 4JCMA 5JBFA 3VX1A 2VMFA 1K9TA 1J0YA 1JI1A 1NQ6A 1PJ9A 2BNJA 3J7HA 3W26A 4HMDA 1JXJA 2D3LA 1TE1A 1EHAA 1JZ4A 3CMJA 2V38A 1US2A 3VGGA 1ZB5A 1KBBA 3MV01 3ZJ6A 1DWFM 1W91A 2XFYA 3ARQA 2E9LA 1PIGA 4D72A 4AZGA 2GJPA 3UETA 2D22A 3SIMA 3WUEA 3IK2A 4F79A 2JF7A 2GDVA 4AIEA 1HJXA 1WDSA 2IXVA 3CZ8A 1VEPA 1PX3A 3FAXA 1V0KA 3QOMA 1E6SM 3KL5A 2FDMA 1E6QM 1KXQA 4HA1A 4LYPA 2ESCA 1E6NA 4AD1A 4AZCB 1W3HA 3AIEA 4PN2A 1CXLA 2VOTA 4HPHA 3WD1A 2BY3A 1UZ1A 3GXFA 4DWSC 4IUGA 1Q6FA 3UERA 1I1WA 1HX0A 2WM0A 3PZTA 3HU7A 2E0PA 5EMYA 3SUSA 2EPLX 1RH9A 2CETA 1K9DA 5CPSA 4WSJA 5C71A 2D0FA 1ISYA 2MANA 2VC9A 1W1TA 5I2UA 1TUXA 2WBGA 5IFPA 2WSKA 1MYRA 3WD3A 1FH8A 1D2KA 1W9DM 1WP6A 3RDKA 2GK1B 1Y7VA 3AZTA 3BLKA 2CITA 3AHVA 2J77A 1CGWA 4CU8A 2AOSA 1J0ZA 3BAJA 1ISXA 3AIWA 4CD7A 2WB5A 3N04A 2NW0A 1W3KA 1CLXA 5EB8A 3MV11 3DYPA 3AHTA 3FHQA 3L2MA 3L4XA 3ARWA 4PMOA 3M6DA 3VGDA 4D6GA 4FLRA 4W93A 5HPOA 2VZVA 3WUFA 1GQIA 2PWFA 2YL8A 3ARYA 2XPKA 1TR1A 2EQDA 4C7FA 1CGUA 1C7TA 3CZJA 1EOKA 3OBAA 1VBUA 4GZEA 4L4OA 1E72M 4UTFA 4H8UA 2D3NA 1EH9A 1HXJA 4AZ5A 1MXGA 4TX8A
chains in the Genus database with same CATH superfamily
2OWXA 2GQ8A 1NAL1 3CZGA 4JX4A 4KMQA 4D2JA 4JFWA 3ZIZA 2H9AB 1BGAA 4UTIA 3W1QA 3AYTA 3KTSA 4Z17A 4MGGA 1DJWA 1PZ1A 1EF2A 3GXDA 3FXYA 1VGAA 1XX1A 1BWLA 4V1YA 4X2PA 3EDDA 2GWGA 3SEPA 3HGSA 3TOPA 4EP8C 3F5KA 5I3KA 1GEHA 4LUIA 3E0LA 1V7YA 1GW1A 1Z44A 3MBFA 5HANA 4CCEA 2G0WA 4GACA 3I68A 4QS6A 3WCZA 1EGMA 2YR1A 3N4AA 2EXOA 3MKCA 5M5DA 3CHEA 1H5YA 1B5TA 3M9YA 3K2GA 4FEZA 2VCCA 3ZWTA 1TJRA 4HCDA 3IACA 2H3DA 3C2YA 5CJ5A 4AH7A 4LAOA 4Y9AA 4EWJA 5TNVA 1E0TA 4LXFA 5KITA 3AXMA 3HO8A 1TV8A 3P61A 4ZOCA 1HJUA 2F8QA 5C9RA 5A1AA 5AB3A 3FYPA 4K6AA 4HMEA 4YJ5A 1UD3A 3VU2A 2ZVRA 3RPDA 5CBIA 1L9WA 3F4NA 2PDXA 1MMFA 3OA5A 4CD4A 3WFLA 5FJPA 3ANUA 2Q71A 3SSZA 1SJCA 1TREA 4FR6A 3WK1A 1UPPA 2OMAA 4NI3A 5FEZA 3DG6A 3ELFA 2CESA 1KFWA 4UC5A 1BXBA 4HU4A 1CXKA 1GVYA 1X8FA 4LPCA 4U10A 5HUPA 4DXVA 1OCQA 4FNTA 1B31A 5I77A 5CSUA 3M0MA 4MB3A 2XN0A 5G1YA 2V82A 3IGXA 4EX4A 4MKVA 1NP2A 4BQ5A 3VOFA 1K8XA 3WD2A 2XYLA 2WVSA 1V4YA 2CZDA 1R3TA 1YDOA 1S5NA 3CZEA 1BKHA 2VWSA 4NYYA 3IS4A 3I3EA 1YDVA 1IWPA 4F8XA 1FKXA 4E2BA 1RA0A 1H0GA 2PDPA 4S3DA 2PDYA 2Z6IA 4J35A 2BODX 2YW4A 3FA5A 2BOEX 1F74A 4XZBA 3DAQA 3NO5A 5K2ZA 1FWWA 3AIRA 2DIJA 3SN0A 3LERA 2CKSA 3B0YA 2X7WA 3AIBA 4DQWA 3KS5A 3W72A 3OHIA 2WJDA 3PF3A 4B15A 1FWJC 1A3HA 1XLEA 1J4EA 2INZA 3C86A 3CV2A 4WCJA 4Q8VA 1IWAA 2QCDB 4K8GA 2WCGA 4U5KA 1VYSX 3IJIA 2Y85A 4PUEA 4X2RA 3UNDA 5A8OA 4BEUA 5AHLA 2BXZA 4BF5A 2ZZ6A 4YLWA 5C2CA 1RCQA 1FDZA 4QITA 2GJXA 4LV9A 2OSWA 2WHMA 3TTYA 3LB0A 4BJHA 1NWRA 4DUWA 2I5IA 4UTLA 5HJLA 1HG3A 2VFDA 4XZLX 1YADA 3M0YA 1K03A 4DM1A 3MI2A 4HSNA 2X05A 1D8CA 3GYEA 3TYCA 1CT5A 1W0MA 4IQDA 4P7LA 2C13A 4GC4A 2WZMA 1GYLA 3G1YA 3PTDA 4ROQA 5JH1A 4RKAA 1OD8A 4Z2IA 2YDRA 2Q3OA 2W92A 4Q8PA 4KIEA 1OFRA 2OEKA 1UWAA 2DZXA 2Z6JA 3R0KA 1L8PA 1JZ8A 1RALA 2FZNA 1QVBA 3FFSA 1ISWA 3QH2A 2YZ5A 1K7EA 3NZRA 3CGTA 4H9MA 4QEEA 1ZP3A 3WDQA 4EACA 2FZDA 3R7MA 2FFIA 3FYYA 1V08A 3WIJA 4UQAA 1AMYA 4H1ZA 4RZBA 2WWDA 2Z28A 1DIDA 4JYEA 4TIMA 1HKMA 3LTYA 2JIWA 2Q09A 4GOAA 1GOKA 1RLCL 1A5NC 4R33A 4R85A 3ZJ7A 1KBIA 5FIPA 1KXHA 3ARUA 3VOJA 1PIIA 2H3BA 4YS1A 4K68A 3BZJA 1KCLA 4HNOA 3BSMA 4PCNA 3L0KA 4RZ4A 3TFCA 3T44A 1YX1A 3IIOA 2PZNA 5I07A 3UVIA 2CNCA 3ZSTA 1MEWA 1HZYA 3ALFA 3GQYA 4UZSA 3E3HA 3JR2A 3K8KA 4UTUA 4E8GA 4H7VA 3L65A 2WHLA 4F2UA 3H2AA 4UQCA 1BSIA 3SGZA 3LBCA 2Y7GA 1MW2A 3HN3A 3NL6A 2PMQA 3LHUA 4YTTA 2WZEA 1AL7A 1BHGA 4Y96A 2C91A 3EX2A 4PUWA 3S5NA 4JXCA 1O5QA 3NQ7A 4O1FA 3QOKA 4H6RA 5D9MA 1B3OA 2WW5A 3GHUA 3M47A 3BLDA 4PULA 1UCWA 4JX5A 2OT1A 4XAPA 3I65A 2QVNA 1G69A 4ATDA 1WAUA 4PB5A 1XW8A 3F5LA 3WNNA 3UD6A 6TAAA 1KC7A 1IZJA 5D33A 4C6DA 3RK8A 2X09A 3GU2A 4GUHA 3TA6A 3QW3A 1GUVA 1S5WA 2QULA 7REQA 1W8GA 4QG9A 3EDEA 3SUUA 1P4CA 2QJNA 1VYRA 3GB6A 3N2OA 3VKJA 4GJIA 4WDWA 4PRRA 3NGJA 4QQ3A 5I00A 2G50A 3SM0A 4MWAC 4W88A 3TAOA 1XYMA 4LC6A 2W63A 3UJFA 1FXPA 1LBMA 3CUFA 3H2OA 8XIMA 2HEJA 1B90A 1GNXA 5LYRA 2DZVA 1WZMA 1RXOB 2IPFA 1UR2A 1FWBC 1NFBA 4B3KA 1LRNA 2Z1VA 4LEFA 1OK6A 2AMGA 2YA1A 1LOQA 1LL7A 2X1UA 3QC0A 2D23A 3VNMA 3TYDA 3DUGA 3H2NA 5J04A 3P8JA 4ZEPA 5C70A 1WZAA 4MY9A 3TYBA 3ZJKA 3ABZA 5H8PA 3EZ4A 1TQXA 2TMDA 4M1BA 4X0NA 4RLIA 3WK2A 4UTWC 5GNZA 2F38A 3APGA 4P7NA 2Y0FA 3W1TA 2AKZA 5I23A 3UJSA 3ITOA 4Z2LA 3V1HA 3VIMA 3SJNA 4HT3A 2XVKA 3UPWA 5BWFA 3W2KA 4I6VA 3LCXA 4PMQA 2NSOA 1V6XA 1W37A 4Q8TA 1OFQA 1P7TB 3NVTA 4KCTA 3E5BA 3EA2A 3P3BA 3QV7A 4G2DA 4N02A 4AEFA 3ORWA 4WGXA 3ARXA 3O16A 1H09A 4DXKA 5FJRA 3MP4A 3RX4A 1NFPA 3BANA 4P7OA 1MEIA 1DVJA 1C92A 3W83A 2PAJA 1JNDA 5B80A 3HB9A 3UXDA 1O6IA 3T8LA 2J62A 3TW7A 5AC8A 3HPAA 1PTDA 2ZRUA 4RX0A 2RDXA 1H0IA 2OYMA 2LLEA 1NSJA 3ZFHA 4JCLA 1S46A 1F73A 4JL1A 4N0RA 3DKJA 4TO8A 4AZCA 5KINA 2NUXA 1PIFA 4Z1YA 4S39A 3E96A 3NQMA 1P0KA 3PANA 1H2JA 4Y2WA 1XKJA 1KGXA 1JZ5A 3GVGA 4RDWA 3SB0A 3WLNA 3B9OA 3JS3A 5FA5A 1I4NA 3A4JA 4MFEA 2PP3A 2SFPA 4ZO6A 3VIKA 3FXGA 3V35A 3BJFA 1WDWA 2G41A 1YXCA 4ZE4A 3ZLHA 1JCMP 3KX6A 4G7EA 1ZZMA 3LA4A 4FX8A 3WDIA 3GXNA 4D8LA 2VX6A 1Z9AA 3UWQA 4L4LA 4D9PA 4Q32A 4F4RA 1UC5A 3S1VA 3E74A 2WJZA 3TSMA 1VPYA 2Y70A 3GFZA 5HPCA 4LVFA 4F9DA 3VE7A 2J74A 3T4WA 2GSHA 3R0UA 4HU3A 3IJDA 2GZXA 1ZAJA 4FIQA 1TSIA 4GQ0A 1ZGDA 3LQLA 3K4AA 3UXAA 3WY1A 3V75A 2Y8KA 4DNMA 2UY3A 1BD0A 2A3HA 2ZA3A 4FNSA 4FXFA 4HPXA 4PTMA 3L7RA 1EDQA 3ARVA 1DTUA 4BS0A 4EVZA 1O12A 4N4QA 4ZQPA 1UWUA 4Q4QA 4AY1A 4CN1A 1TPWA 1L2QA 3O6AA 1NDVA 5D9NA 4NP7A 1BRLA 4HOXA 3H7UA 3H22A 4UTHA 1R86A 2VEKA 4AEEA 1E6PA 4FXJA 3IIZA 1ICSA 4JDYA 1MQRA 3VO0A 4IL2A 2BDQA 2CIPA 4JNZA 1LORA 2W91A 3HGOA 4HU8A 4AIUA 2Y24A 2A7PA 3KDOA 5HJYA 2BXVA 3L0GA 3EB4A 4XZWA 3KBJA 5IOBA 1LL4A 3WDPP 3ZVHA 4M5PA 5AC5A 5LNUA 1E56A 1JXKA 3B8DA 5XINA 2OXNA 2A5HA 5T91A 4GUJA 3P67A 3M0XA 1I0BA 4W7WA 3RLHA 1Q7MA 4M80A 2WSYA 3N73A 1VP5A 4U31A 4X9SA 4YHGA 3VC5A 4B4FA 3KTXA 1JDEA 2REQA 3UYCA 4E8CA 4PSRA 1H3GA 4O1CA 2PCEA 4FK9A 1US0A 3GVRA 3VGFA 5EBUA 5I79A 3V5FA 5I0DA 1GORA 3BQ6A 3FOKA 1F6YA 3IVTA 5A8QA 2AL2B 4M6QA 4GNKB 1EJUC 3RMJA 3MUY1 3OLGA 4UXDA 4OOZA 3W70A 1GJPA 1LRTA 4ZSTA 3AMKA 2Z1KA 4QP0A 2VKZG 5F2GA 2HV5A 3V36A 4DIAA 5FL0A 1BYAA 3RR4A 4HA4A 5JH2A 4MWAA 2OELA 2Y1HA 3CAKA 4K38A 5CZJA 1S1RA 2DUXA 2PBGA 4F40A 3RJXA 4M82A 2C8NA 2D2GA 1CI1A 5DO8A 2ZRZA 2EPHA 1E3ZA 1JZ7A 1TRDA 1GGOA 4ZODA 2YPIA 1Z6KA 3ZVIA 3TQVA 3B03A 4QX4A 3UG8A 1JPHA 4UFMA 3TUUA 4LAZA 2HS6A 4H01A 4ORMA 3K5XA 1XV8A 3IPWA 1UKSA 3DI1A 2FDSA 4Y9OA 2YDAA 5ABEA 3OYXA 2FGLA 5MKGB 4W7UA 3H4GA 4UTWA 4KPLA 4GJJA 1UR3M 1VKFA 2DH2A 5LGZA 3GH5A 3G0XA 3NG3A 1QRQA 1EO7A 2X8RA 4O19A 1QPOA 1Z69A 3QLDA 1K6AA 5FOOA 1F4HA 3OIXA 1ZBWA 1JEZA 3HIJA 4FSAA 4R7JA 2WMHA 4CUCA 1KW1A 3AYRA 1IEVA 2OKTA 1NARA 2Y61A 2J79A 1ZU8A 1E6XM 4XKYB 4JIHA 1VFOA 2WANA 3WNMA 3QZEA 5FSDC 2VDGA 2QAFA 4HYRA 5CKSA 5BRQA 2G8ZA 4WJEA 2Q8XA 1ITQA 1IXQA 1ADOA 5CBJA 1KGUA 3KBMA 2YBTA 5EY5A 3VD3A 1VFLA 5F1UA 4AQLA 5IHSA 1WUEA 4CU6A 1KTNA 4ZOBA 5I5RA 3C0QA 1HNYA 1S5VA 4PE8A 4WY0B 5B7ZA 3ZJ8A 1BSLA 2Z2BA 2GJNA 5DEZA 5BU9A 1NY1A 3HG5A 3RXZA 1JFHA 2UY2A 1O94A 1SZRA 1F5ZA 2VL4A 5ABHA 1JAEA 1KKOA 3HOJA 5G5IA 4MADA 2DVUA 4HNNA 2QDDA 1P6WA 2OEMA 5HMDA 4QISA 3MTWA 1B54A 2IQTA 3VNLA 1LCOA 1H41A 2VX5A 2PTZA 4F0MA 1VHCA 2CFFA 4LF2A 3NURA 3GDBA 4LNYA 3CK5A 3B0UX 1JJKA 2P5NA 2PDGA 3A21A 3C61A 3P84A 3R5EA 1EA9C 2PU1A 4OFCA 1C8YA 4CCCA 1H4PA 2OZ0A 4ZMGA 3W7EA 3LRKA 4WJXA 2C18A 2V5DA 1XLKA 3AXXA 3PUGA 3F7JA 4M6VA 4OT7A 2UBPC 3CHFA 1QI5A 3EOOA 2PF8A 4F0RA 2HROA 1R46A 3CAVA 1KCZA 2ZKMX 2ZTJA 5HINA 4EIVA 3PAJA 5CQ1A 1XYZA 1LROA 1V6TA 4ZB2A 4GY1A 4L64A 2WNNA 3EWWA 4QDMA 1T5AA 3E0FA 1W9BM 3T7VA 3N2MA 1NF0A 2P3EA 5A2CA 1Z48A 4I9TA 4LAKA 1WKYA 4YNGA 5K9XA 1H49A 1A5MC 4W89A 1DIKA 4TOQA 3NNTA 4CNNA 3KVKA 4XX6A 3BSHA 3W82A 4MMWA 1GVOA 4RE0A 1K8CA 3QKZA 2A7NA 1LQ0A 4Q4OA 1BGGA 3RCMA 3NOEA 1H60A 3UWZA 4N6EA 1N8WA 2CBUA 3P62A 4RXGA 3W24A 1E0WA 2V5BA 5HNUA 3OG2A 4CNSA 3RRAA 1KXTA 2E4TA 2RUSA 4JY8A 5LZLA 3DERA 4GE8A 4WUIA 5EU9A 4QJ1A 4RDZA 1OABA 5CBBA 2AQOA 1B0IA 2QAPA 1R7OA 3P8IA 1MZHA 1RCXB 3DFQA 3W29A 2FYMA 1JR1A 4JHZA 1UKPA 3CH9A 4UQDA 1VFUA 2IPJA 5AFDA 3GHRA 1M7XA 5CC5A 2X1SA 4X3ZA 1SFJA 1WA3A 4JFUA 3OGSA 4H7ZA 2OOGA 3OLIA 2ZXDA 2OQLA 1KWKA 2Y5EA 5EMUA 5LGXA 4L6DA 3UT0A 2VGIA 4ZO7A 2GOKA 2YJQA 3U7BA 3SDOA 2VC5A 1K70A 3LI1A 1A4LA 3OEXA 2QJMA 3VDAA 2J24A 3KRUA 3QR0A 4HHLA 4Q4SA 5HR7A 4O57A 1VJIA 2E7FA 4IIHA 3MSDA 5DLCA 1OK4A 1VF8A 4ADSA 2ZZ2A 3OVQA 3QV9A 1EGZA 3B8WA 2KX9A 2QVHA 4WXYA 3SN1A 3WQWA 1AG1O 4I7UA 4MNKA 3CM4A 5L6UA 3QYSA 5E0FA 2WOQA 3N25A 2ZC8A 1FWGC 1UBSA 2X2YA 1UQZA 5MF5A 1BWVA 1HUVA 3ZR4A 3WX7A 1UKOA 4X9YA 3PZMA 3W87A 4QFUA 3A9IA 4MKSA 3ABXA 2QLYA 4PUDA 2BWGA 4B2DD 4EANA 4NZFA 3I3BA 5BMWA 3VM7A 3WLKX 4G6CA 3PFMA 3EPMA 4ZR8A 1UQYA 1OFEA 1EEPA 1VFFA 1XLCA 1GPFA 3WFAA 3BLIA 3V3WA 2XN2A 1NTHA 4JNYA 4HSOA 3GXTA 1JNEA 3FCPA 1EQPA 3TMQA 1GVEA 1AFSA 5M03A 5DANA 3WK3A 2ZOXA 2CEQA 2Z7KA 1R9ZA 1VB9A 4NXSA 2X1IA 4PEEA 1NWSA 1S3TC 3QHMA 3SRHA 2WMFA 3LK6A 5K9CA 1DJGA 3Q2DA 4GQGA 2R6OA 2BHUA 4DF1A 4DJDD 4IPPA 3USZA 3SQSA 4KERA 3G1AA 4LEQA 1ZS2A 3EX6A 3NQCA 1MUWA 1MRAA 1JIBA 1XYFA 3FSTA 4ZQMA 1I60A 1DQXA 5CPNA 2YKKA 2XSAA 3QHOA 2RHGA 4DBDA 3QPEA 4AAJA 1A53A 3EKZA 5JIWA 1UHVA 1GOWA 4L65A 1OFPA 3LEPA 2XN1A 4Z1BA 3T42A 2WO5A 4POCA 3W7NA 3EKLA 3P60A 3QW4B 3BCJA 1OYAA 3UJRA 4V27A 3P81A 1KFEA 3OODA 7XIMA 4U28A 1ZQ5A 3V16A 1FP9A 4ATWA 3QEZA 1OF8A 2PRMA 5E6YA 3HFTA 1PZ2A 5E9AA 1JVNA 4E4FA 1WNOA 1FWTA 3U2OA 4YTSA 4LFYA 4H2HA 1OJXA 1SZGA 1NU5A 4DVOA 3W7JA 3OQ8A 1JDFA 4OKDA 2DZPA 3XINA 1B3WA 5EFDA 2WC3A 2CCRA 3OQEA 4JTTA 1M6JA 1UZHA 3WK0A 3WUBA 3N18A 3GNNA 1JF6A 2PU0A 4U3AA 1E3XA 2J4GA 5ECUA 3RF9A 4KWOA 2DUZA 1B1YA 3W1LA 3GIYA 3PPCA 4C6FA 2YDQA 4EAYA 3Q45A 5BROA 2PDMA 3FDGA 1CWYA 1UPMB 2D1ZA 1LLZA 4M7TA 1KRCC 1QU4A 3UG5A 1JYVA 3Q65A 2C19A 4DY1A 4TTUA 4H8VA 3T05A 3N6JA 4O4VA 3QV8A 3M0LA 4MJ2A 4S1FA 2I7GA 3QHNA 1EYWA 5FAGA 3S5SA 5CGMA 4AFYA 3I4KA 3W73A 2NV9A 3EOLA 1Q6CA 4ZQNA 2GDUA 1CGVA 4ZO8A 2V0TA 3IAPA 3BGAA 1TIWA 2PI6A 3SCQA 3CBWA 1S38A 1K4HA 1UJQA 1FHLA 3FAWA 1EJ7L 3LHZA 2J6XA 1MSSA 4FALA 3ES7A 1HJSA 5FJJA 1W6TA 3B4YA 2FPVA 3S2CA 3R11A 1Q3NA 4E0CA 3BXWA 4IG2A 5I3FA 1IQ8A 5LNRA 3UCDA 1TPFA 1E4MM 2WC4A 4D6IA 3G1XA 2FGZA 2Y7EA 4DWDA 4M3PA 1FWCC 3APYA 3UYIA 2QPSA 3WSUA 3ENLA 2VEPA 1W56A 2QCMA 2ZZ3A 5HOSA 4NX5A 4URIA 3QY8A 4WZHA 3V7PA 4YU1A 4Z0SA 3S9ZA 3PZGA 3QQ1A 3U7VA 4QS5A 1XBXA 2YXXA 2EG8A 1RP8A 3B8VA 3WD4A 3OGVA 1AODA 4UUIA 4KCVA 3N13A 2PDBA 3I3DA 4A8IA 5GPRA 2B31A 3CH0A 5BRBA 4GQQA 3WLPA 4ZZ9A 4C91A 3ES8A 4J3SA 2VTFA 3AXKA 4GI8A 1V0NA 3IV3A 2FVKA 1TWIA 2VZOA 3MANA 5ECVA 3U48A 2Z1XA 1BFNA 2J78A 5I02A 4JR5A 2E9BA 4O15A 4HZ8A 1TV4A 4FB7A 5I3IA 4UBPC 3UWEA 3OZMA 2XU2A 1C91A 3NYZA 5GJPA 5HNTA 4AD5A 4IOTA 4B3LA 1TMHA 3AYVA 1JQVA 4M6PA 3GVQA 2BS9A 4NF7A 1CENA 1FFQA 3BCFA 2OLSA 1SUXA 4IQJA 3G3MA 3CQHA 4DXXA 4NRSA 2MUCA 1V51A 5E9XA 1AQ0A 3UXIA 3T1GA 2J75A 4G8TA 1I8JA 3W3OA 1SO3A 4ERIA 1PJ9A 2BNJA 1BF6A 2FLIA 1V79A 1HGYA 1JXJA 2D3LA 3MP5A 1R2SA 1EHAA 4RJEA 3G2GA 1KM2A 3MCMA 1DWFM 4OBTA 4MHBA 3ARQA 2E9LA 3VNDA 3W2LA 4O18A 2WV8A 4NI8A 2YSWA 3UETA 3RFAA 2RKXA 1XKYA 4F79A 3CZ8A 1VEPA 4O14A 3PWGA 2FZMA 3URNA 1E6SM 3RU8X 3C2OA 2JKAA 4LYPA 2ESCA 1P0NA 3IGUA 1GW9A 4AD1A 3A22A 4AZCB 2VOTA 4HCHA 5T9BG 5KZEA 3GXFA 2ON3A 3DH7A 3M64A 3CXOA 4O54A 4DLFA 1EJTC 3HU7A 4PODA 4FIRA 2E0PA 5EMYA 4PZVA 3U4FA 3TK7A 3A24A 2D0FA 4DBWA 3S5ZA 3FK4A 1EBGA 3JRKA 4IGNA 1RBOB 1TUXA 4LCSA 5IFPA 1E9IA 4YWSA 1UC4A 1XYAA 3SZ8A 4DRSA 3WD3A 3FJ4A 1W9DM 4CNTA 4YYFA 1H7WA 2V69A 4MY8A 1Y65A 3AC0A 1UOZA 1YDNA 3BLKA 3AHVA 5CH9A 1FHVA 3EOUA 1Q6QA 1AH0A 4O53A 1J0ZA 3MI3A 1ISXA 4S3CA 3N04A 4AC7C 4OE7A 2VXNA 5EB8A 1FDJA 3AHTA 1Q63A 2I1OA 3VGDA 3QZAA 4D6GA 1XLDA 2VZVA 1GQIA 1P43A 3ARYA 4IIEA 3LV6A 1NDWA 3PY2A 3GG8A 4DI9A 1VBUA 3HQPA 1MDLA 4IXXA 3DDMA 2VFGA 4AZ5A 3KOWA 4TX8A 3EMCA 2PC8A 3C4UA 1MEHA 3IJLA 4KS0A 3STCA 3HJEA 4ICNA 5DFAA 5EMMA 4N42A 4M6UA 1BRLB 3GVWA 1F3EA 2ISVA 4K1WA 3W81A 3W23A 1QO5A 3EDKA 3OJGA 2VGFA 2BGQA 2WZIA 4LRTA 4I5RA 3GTIA 1PVNA 3EWDA 3IARA 2DZTA 3OBKA 4IP5A 4QM1A 4LVAA 1OFBA 1V3HA 3GUWA 3GVVA 4IT1A 1SU5A 1GHSA 3T2OA 3R94A 2JIEA 2C7FA 1RQBA 4H9UA 2TPSA 4C1NA 1I6NA 1WOBA 5LIKX 1RAKA 2BASA 3O6DA 4HNTA 3LG3A 1N7KA 3ITYA 3ZO9A 2PP1A 1DJIA 5XIMA 3S0CA 3P93A 1K77A 1AL8A 1E6ZA 2XFWA 2ACSA 1H7OA 2QUMA 1EX1A 2REQB 4RUBA 3LZ3A 5CAHA 2HBXA 3WLTA 3QGKC 1XIEA 1EL3A 2AQWA 1AH4A 1RQHA 1QDSA 4JTHA 1ZAIA 1OT2A 4OJYA 5DT7A 3N12A 3MUCA 2OGJA 3QZ6A 3M1ZA 4V15A 3WNKA 4A8NA 1GVIA 4PRWA 3MQTA 2PGEA 1J0KA 4HOWA 4QSFA 3W74A 3B3DA 3JUGA 3TSBA 3O9NA 2BHYA 4CGTA 1XDMA 3NOYA 3WH6A 3RIKA 3SSJA 2OQYA 2YIHA 1OG6A 1NVMA 4H6EA 4MWAB 3GDRA 3N11A 2XIJA 4U2ZA 2VVNA 1BVNP 1DXIA 3VDGA 1FCUA 1X96A 4BY3A 2O0TA 1KXVA 4DAFA 2MNRA 4JFSA 4ACYA 5AHIA 2FJUB 9CGTA 3LUTA 1XDJA 2RAGA 2VUNA 2PWEA 1SR9A 3UZZA 2A7RA 1CGYA 1FCBA 3BO9A 2VEMA 4PA8A 7A3HA 5CC7A 3N15A 1OM0A 3TP4A 1R3WA 2DSZA 1JRBA 2CYGA 3GBEA 4CQCA 4XBKA 4KEZA 4Q4PA 4YIWA 2JE8A 1TJPA 4BI6A 1LQ2A 3KHDA 1WYIA 4M19A 2FTWA 1J5TA 2I5QA 4D8ZA 1XLBA 2CC0A 2NQZA 3A6OA 2R9RA 1J8VA 3RILA 2ODOA 1W2PA 1SFTA 1WZLA 2OZ8A 3TX9A 3F4WA 2ZUVA 3KP0A 1P1MA 1TX2A 2JF6A 5C7VA 5BCAA 3NZGA 1JUEA 3VKDA 5H6HA 3USBA 2Y62A 3MUXA 1TMLA 2W67A 4C6OA 1UH3A 4DHGA 1KBKA 2GVJA 3VPLA 3TMLA 3TIMA 4ONVA 3T2QA 4JX6A 4UMBA 3R89A 1YBQA 3M5VA 2PRHA 1D3CA 2EG7A 3W7OA 1RBLA 2Q6ZA 1T41A 1SMDA 1U33A 3QGAC 2YCLA 4XD5A 4B91A 3NGFA 2F2HA 4O0KA 1KV8A 3MKKA 4LUJA 1OX6A 2WCSA 5M17A 1P1XA 2WZTA 4AEOA 3QFEA 4JEQA 4CVUA 3PSVA 2QW5A 1CXIA 3VMPA 3LMYA 2BV9A 1J96A 2FHCA 1FH9A 2XH7A 4J2MA 1XRSA 3EGJA 3GDTA 4J4KA 1RJRA 3CQIA 5DQPA 4GGBA 3TN6A 4IMAA 4AHOA 1ZUAX 2DSWA 4NZ1A 1B4KA 4PUNA 3VK5A 3H21A 2A0NA 3SUVA 2OYLA 2VFIA 3LPFA 4D1JA 4IZGA 1PHQA 2GGEA 2VX7A 3TV8A 4ALDA 3NUKA 1UR0A 2J7GA 3NAVA 4HZMA 4XK2A 2YOCA 3PWIA 2ZZ7A 4GJ1A 5DY3A 3E6EA 3PZVA 3SCPA 1CB2A 1XGZA 3WH5A 2V2HA 5AYXA 1GKPA 1SFLA 3DESA 5I3JA 1JPMA 4Q22A 3QY6A 1HJQA 1L0PA 1HT6A 3MCOA 4I3GA 4QG8A 1G4EA 1XIBA 1I0DA 3K8MA 4KRUA 2BMBA 2YCIX 1B9BA 2YX0A 4W8BA 4CQBA 1K6WA 4V33A 5LHEA 3QSTA 1DPMA 2GVYA 3VI2A 4NJJA 3NSMA 2O4MA 3WF1A 3N3TA 1J9YA 1XF0A 3B4UA 2XTKA 3V0TA 3ANYA 3M6YA 4UOQA 2J25A 3FGCA 3L9CA 4FX7A 4XO7A 1F07A 3LDVA 4K2SA 1E51A 3BTNA 2V81A 5JIPA 1QNPA 1IZCA 3BJTA 3TWAA 3QLLA 2GSJA 2BGSA 3HPFA 1ZBVA 1TJ1A 2PFHA 3MJMA 4ZQCA 1MNSA 4GD0A 2V67A 2Y63A 4IQEA 4B9ZA 3FVDA 4NHVA 3PTQA 4P8VA 1EJSC 1QOXA 4C7GA 3T09A 2O9RA 3MHGA 2BLEA 1GQLA 4KFPA 2Z7GA 4M7SA 4WDTA 3WYZA 1R38A 3MYPA 1C7SA 4Y9PA 2D20A 1JCYA 1T40A 2X41A 1E1CA 3LTPA 4WRHA 1IE7C 1RJQA 3HQ1A 1WPCA 1A5CA 5BW6A 3S46A 3DGRA 3WZ0E 4MJZA 1QO2A 3CPRA 4REQB 3MS8A 3C0JA 2ZX9A 1JCXA 3VCCA 3WH7A 1KB3A 1TIMA 1HKIA 3K1DA 3N4EA 4ZOEA 2PP0A 3NQ6A 2ZICA 3NL2A 2PLJA 4BCEA 4NIRA 3A4AA 3QMSA 5EMJA 3V4BA 2G3JA 2QIWA 1YPXA 4E6MA 1EEXA 4CCDA 3XIMA 1HFBA 1ZJBA 1H61A 1P6CA 4ERAA 3EA3A 2WVTA 3I6TA 3P80A 4BKNA 4DJFD 1HVXA 1J11A 2ZX6A 1K3UA 2NXIA 3PZNA 2NX3A 4V1XA 1VRXA 2CW6A 3AS2A 3KL0A 2Y7DA 1KM0A 2VT0A 3WNPA 1IYXA 1QPRA 4XD6A 1JDDA 3DI0A 2W3ZA 2P53A 5JBDA 4HK5A 5EFFA 2ONEA 1MDRA 5AHMA 4MWAE 4AU0A 3VABA 3VOIA 1FY6A 4LYRA 1AD4A 1M5WA 2A3AA 2C79A 3VIPA 3THCA 5JMUA 5AHEA 3FYOA 1WBHA 3TC3A 6REQA 5AVHA 4UFJA 1LOSA 2O7SA 3HG2A 4DJDC 1OSEA 3TXZA 4HZ6A 1EJWC 1BXNA 2BVWA 2W0UA 1UA7A 1CW2A 3NEHA 2YLAA 3H55A 2C1IA 5BWAA 1J10A 2Z29A 1BEUA 3LQGA 3K1GA 1GG0A 1H50A 2V6AA 2XGZA 4QCEA 3PTKA 4YL2A 3LCLA 1WZKA 1E0XA 3DFTA 2VYOA 2F61A 3L2LA 3FNDA 4HP5A 2GJLA 4GZ7A 5CSRA 2ZUMA 1J6OA 3LYEA 5IBXC 3G6LA 3R10A 1N82A 1Q65A 3LPPA 3HMJG 1N8FA 3BAWA 3S1WA 3P7YA 1XYCA 1TTQA 2RGMA 3T78A 4F9JA 3WLIA 2WCAA 5CPLA 2OGYA 3NQGA 2E3ZA 1O5XA 2VRKA 4GI6A 1ITUA 2E6AA 1V5XA 1ECQA 4NT0A 1OYBA 3DC8A 5FKYA 4MNMA 1LP6A 3CV6A 1RVGA 1RHCA 3AZRA 3CV1A 1LF1A 3UXKA 4F48A 4HIBA 3WJSA 4BFAA 1ZJAA 3CLWA 4O17A 5FCZA 2BVYA 3OG3A 2ATSA 4QDWA 2CLLA 4Z1AA 1W5NA 5DT5A 3UR2A 1V3IA 4K7YA 1C90A 6XIMA 1JUKA 4U5IA 5DELA 1QMLA 3PBVA 1RPXA 3LI0A 1KBJA 4I7VA 2DDXA 2ASHA 5CC6A 3VCNA 3UPBA 3WJZA 4DJEC 4C6BA 4QAWA 2X1TA 4OUIA 1HKVA 2FJKA 4LYQA 1VIWA 3CL8A 4AWTA 4TX6A 2QF8A 2XWDA 4U3CA 2YBUA 1V6YA 1T99A 1QATA 2R1PA 3W84A 4M8UA 2A3EA 2CBVA 3AS0A 4PCPA 1KCKA 3AWOA 4MPQA 2PWHA 4H41A 2DP3A 4DWSD 3KCLA 3A3HA 2HCVA 4Z2KA 4NSBA 2D0GA 1I2NA 3QRHA 1R3YA 1A80A 3DGBA 3U8GA 4HHHA 3MO4A 1TPH1 1U83A 4MNLA 1A5SA 4K37A 3MMDA 2VD8A 3HV9A 3PULA 1UWSA 5A8PA 3W37A 1H51A 3THQA 1TX0A 4CN6A 3VUSA 4IICA 3HZ3A 5D09A 5CZTA 4Z2JA 3E49A 4DUOA 1TWZA 2YYUA 3LCFA 1SSDA 3L21A 3EXTA 5C7HA 3UPMA 2FB2A 3T55A 1XS2A 2IS7A 1GPWA 3M16A 3KOXA 2BOGX 3VVGA 1S2AA 4IPNB 1BVZA 4QROA 3VDCA 1R8LA 1OFAA 4L1XA 4OBSA 1OCNA 4IG2B 4FO4A 3SO7A 1YIXA 4KIRA 2PWGA 1DJHA 2DIEA 3BV4A 1TMQA 2X2GA 3PPFA 4L5ZA 1KLZA 2JGQA 2YCKX 4GY0A 2QF7A 2NQHA 4OTKA 1J01A 5D2WA 3QGVA 4CEUC 1TVNA 1V0MA 1JF5A 2YA2A 2J13A 3BGGA 3GO2A 2PDQA 3O63A 4Q4MA 1XIIA 4XUYA 1H63A 3ISIX 3CT2A 4EPEC 1XYLA 5C9XA 2GYIA 5CG7A 2YB4A 3FV9A 1UA3A 2E40A 1G7VA 2PDLA 3B97A 3N2CA 1QNSA 1IZKA 3BOXA 2Y7FA 2G3FA 2R1KA 4PTNA 5JUVA 3BMVA 1OGGA 2GUUA 3OLDA 4JYFA 5F2IA 1XIFA 4C6CA 2QCGA 1IR1A 3EWBX 4MFDA 4DZIA 4GYFA 5CJMA 3CO8A 1OF6A 5A6JA 2H8ZA 4J3VA 1BTMA 4S3BA 3WEMA 3VFLA 1HN1A 1HP4A 3W7GA 3U3HA 1EDTA 1YE4A 1W1PA 4WY0F 3K8LA 3HPXA 4Q8QA 3PBWA 1GZGA 1ONWA 2VD9A 3EWZA 5DN1A 4B2DA 2FMNA 1XH0A 1T96A 3LGDA 1PE1A 2W66A 2PD9A 4ORIA 2J9XA 1PAMA 1GOOA 4PBFA 1O5RA 3WQDA 1UR9A 1YPIA 3VX0A 4BZYA 1UROA 2ZE0A 5DBUA 1AD1A 2XIMA 1B3XA 4OVXA 4S23A 1ZBKA 4P7QA 3N17A 3PAOA 4MPKA 3GZ3A 3OZPA 3I4EA 2D0HA 3TSDA 4B5XA 4Q4KA 3FSUA 3MMUA 5A6KA 7ODCA 4F66A 2PWVA 5A8GA 4QBXA 3VOCA 1XGEA 3W7DA 1UR4A 1AQMA 3QMTA 1UWIA 3MW7A 5EGRA 4NAEA 3COTA 5HR6A 3TTEA 4C65A 1K02A 5HQLA 4O4WA 1SW7A 5HNNA 3AMCA 3MHUA 3GRIA 1O66A 5IFTA 2G97A 3F5JA 3LHWA 3PHAA 3F1QA 4AD2A 3VGHA 4WGHA 4H8HA 4CVWA 4NZ5A 2NV1A 2Z1WA 4BA0A 4XAFA 3TJLA 1RP9A 5IHRA 1AH3A 3NA8A 1E1FA 4MDPA 1WB0A 3CUHA 3ITXA 1OADA 4JEJA 3BLEA 3AAMA 3P5ZA 4JKLA 4GUIA 3NQFA 5GNYA 4PL2A 3UWVA 4KWUA 5IBXA 2A6NA 2IKJA 1YNQA 5M3WA 2X1RA 3LRMA 3WENA 4EF9A 5G4EA 2J7DA 3THAA 1X39A 2F9RA 1PX4A 3N34A 2VFHA 1E4IA 2B7PA 2ICSA 1L6WA 1XC6A 4W5ZA 4PSPA 1FWIC 4M0XA 1FXQA 3BMWA 3VKBA 2PGFA 4E2VA 5JXQA 5FACA 2NV2A 2XVGA 1P0DA 3MZNA 1Z42A 1HL9A 1M68A 3PB0A 4XAYA 2ZUSA 1XUZA 3PJUA 4FNUA 3GNRA 2WYSA 2EJ1A 2HNHA 3GE7A 3A64A 2O56A 2GUBA 3N19B 2R1LA 4HNVA 4PMZA 3VD4A 1OWQA 1FQ0A 3M7SA 3G22A 3UGRA 5D8ZA 5DXXA 3AOFA 2GL5A 2XHYA 4IF2A 3QR1A 4JKMA 1DJNA 1J5SA 4GPNA 5DX7A 2F6UA 4GIEA 3NPVA 5FJIA 1SO5A 5CPQA 4LAUA 2OT0A 4P8XA 4D6DA 3OGRA 3HG4A 1XIJA 3NQVA 4GBUA 1CB7B 2WMIB 3E0IA 3GKFA 5SWUA 3TU9A 2NVCA 1XIDA 3EMQA 1DBTA 2QCHA 1SSGA 1REQB 4IP4A 4PTWA 4NXKA 1TZZA 3R13A 3Q58A 1W2VA 3C2RA 1AW1A 2CLMA 2FIQA 2EO7A 3CPGA 1WKEA 1VEOA 4QJ3B 3HA1A 4OV4A 1P48A 1ITXA 3VKKA 2DVTA 4IMGA 8A3HA 4C1NB 2BGNE 2W9MA 5I03A 3UXLA 3GYCA 1AUSL 1KO0A 5E70A 3W7PA 4JIPA 4HYVA 1V0LA 3GXMA 3BC9A 1QHOA 3RAOA 4DYJA 5KEZA 5IXEA 3UZWA 2C1HA 4O13A 1VC4A 1Q6GA 1CEOA 3PZQA 2GWNA 4J40A 1Q66A 3IIVA 3S1GA 3LGEA 4A3UA 3GNPA 3AISA 1DE5A 1EIBA 3JZEA 2WKLA 1W9VA 3B9AA 3ZS4A 1G01A 2BY1A 2POTA 3SGUA 1MW3A 4DNHA 1GONA 2WLZA 2Y88A 1DWHM 4IQLA 1C93A 4S3JA 3WN6A 4TV5A 3B8IA 4DF0A 3GUGA 3LCGA 1CGXA 1OC5A 4PBGA 2ZQ0A 1PL9A 4MOZA 3EB2A 4BWLC 1MUMA 1DWJM 2EKGA 1RY0A 4TVUA 4BK9A 1UKTA 5DRIA 5I6SA 1AVAA 4AF0A 4H8NA 3FKKA 2QMKA 1KLYA 1TPUA 3LLFA 3PTMA 4D6JA 3AMLA 2J66A 1DP0A 4FLSA 1E73M 1GJUA 1R3QA 2OB3A 1R3RA 4CD6A 5H91A 1J0HA 3S5OA 3E5PA 5I7GA 2ISSA 3VZZA 3HM7A 4Z2HA 5FF3A 1XPYA 4JS3A 1KA9F 3STEA 1JDAA 1SZFA 4AD3A 1E1EA 3WO8A 2BXYA 2IMRA 3URAA 4GFSA 4I90A 1GJWA 1YRRA 2OZ3A 3IK4A 3UA3A 1I2PA 3SCNA 1KR0A 1HO1A 3EB3A 3EBVA 1V6WA 3AFBA 3MJYA 3NPXA 4J28A 3DG7A 4FAMA 2CBIA 1X98A 4NZJA 3ABRA 5F7UA 2CLHA 1SMAA 4W8AA 3W1UA 4PB4A 1I2RA 4JHMA 3T0AA 1EUNA 3QPYA 4UNIA 2X40A 3LCWA 4LBRA 2PWUA 3CWOX 1D8WA 2XH2A 2I5GA 4I8YA 2XZ7A 4A3QA 2J47A 2NQ5A 2GPTA 4PC8A 3H2MA 4HOZA 3ITVA 4IPLA 1O1ZA 4X61A 3UF9A 2YCLB 2OODA 4EXQA 2EEXA 1KFCA 2VEGA 1Q7ZA 1E55A 1A0DA 4WK9A 3PR2A 4C6IA 4IHCA 4MZ8A 3OB8A 4LVGA 2OLHA 2ACRA 2VDHA 3CZKA 4AYGA 2PZ0A 4ZSUA 1FWEC 1JCTA 3V0UA 1V7AA 1ZSXA 2IKHA 2Z1BA 3T08A 1OC7A 1NDZA 1I75A 4GRSA 1IGSA 3C3NA 4HNUA 2X7VA 2OYKA 3W7HA 1UMLA 3QY7A 3O8AA 1O5KA 1M01A 3GNDA 2FZ8A 3CWHA 3VIIA 4IFKB 2DZUA 3TA9A 3VNIA 1CLVA 4J3ZA 4FS9A 1JQXA 1JPDX 4QXIA 2HK0A 3IVUA 4A2RA 3DYMA 2KAUC 3UR5A 2DH3A 1X7IA 1XLAA 2HVOA 2ZZ5A 2A3LA 1QW8A 3NM1A 5B7YA 2INFA 2CLOA 4S38A 3L4VA 5AZ0A 3C3UA 3ARTA 1W3JA 4S2CA 3O15A 1XRVA 5A6SA 3DECA 3BH4A 1M04A 1H62A 3V0SA 4MYXA 3A3WA 2IKIA 3VTRA 2VI0A 5HK4A 3WBWA 3TR9A 1H7NA 4IX0A 4GXMA 3PM6A 4GNJA 3CL7A 2PPGA 2E8ZA 3C6CA 3GDLA 4IMEA 2VEFA 1ONEA 4QE4A 3W53A 1QI2A 3WDJA 2XDFA 4BQ2A 3TAKA 3L12A 4O1BA 5D02A 2NQ9A 3EWUA 1JYWA 3KEHA 1FKWA 1D7KA 2DFAA 4D71A 3KBWA 1KM5A 2QPUA 1V77A 2RDUA 3C5QA 5CG0A 1QHZA 2GVGA 4JIQA 1L8NA 4RL3A 5FF0A 4E3TA 5F2LA 2ZTKA 1NOUA 3AHZA 4YPJA 3WQ5A 4UOZA 2FVLA 4AWEA 1CZ1A 1QK2A 1SGJA 3WJXA 1SR0A 2V9DA 3LSBA 2CLPA 1I1XA 1YMYA 2OO6A 3IGHX 2XFFA 1ZRQA 4AZHA 3W7QA 1RBAA 3LMZA 3STGA 4Y6GA 4Y8FA 1BG9A 1JZ2A 4GKTA 4MJ4A 3PBYA 1B4EA 2FQIA 2IXUA 2G3NA 3H4WA 2ZUNA 3MDWA 1LT7A 3CJPA 1HP5A 1V6UA 1VJZA 1TRIA 2GGJA 4Y9MA 3WQPA 3W6MA 2DW6A 3W38A 3N2BA 3GS6A 2PF0A 5GJMA 4GBDA 5AC7A 3KTCA 3L4UA 2A3BA 4WJ8A 4A8LA 1XINA 4L7ZA 1A5OC 4H9TA 3SUWA 3HQOA 1XIGA 3N29A 2Z27A 1A5LC 1TTPA 4W86A 1UZDA 4GISA 4MAZA 3WL1A 1VHNA 4XISA 3K30A 4QAIA 1CECA 4PYSA 4BWLA 3L4WA 4BI5A 3WF3A 1QOPA 4O1DA 3AHXA 1CBGA 4HBKA 4ACZB 1A0CA 1K9EA 2KZHA 1NJJA 2HTMA 4H9YA 2G95A 3VD7A 3O6CA 5C6MA 1C29A 3GG0A 4AD4A 1OX4B 5E93A 2ACUA 1E9YB 1NOWA 3VCRA 4H6QA 3ARZA 4CQAA 4LUTA 1CPUA 3KLKA 2DT0A 4CQ8A 4LU0A 3G1VA 3RMEA 1M7PA 2J8TA 3UP8A 4A4AA 3KRZA 3SW6A 2IPWA 2VC6A 1EKOA 1J0YA 1JI1A 1VZWA 4GA8A 5FF7A 3CMFA 3M5YA 1QW7A 3J7HA 4HMDA 2YYTA 4PUMA 4DF2A 4GABA 3LU2A 1US2A 1ZB5A 3MV01 2XFYA 3RX2A 4FOKA 1S3HA 1PIGA 4AZGA 4FX6M 3FIGA 1A5BA 3WUEA 4MF4A 3UZ5A 4MYAA 1HJXA 4RNJA 2F7FA 4W9TA 2XSXA 2XIQA 3GLCA 3KL5A 1IIHA 1E6QM 5HWMA 5KZMA 1U1UA 2HMCA 4QG6A 3AIEA 2CLFA 2CHRA 4MUZA 4HPHA 3WD1A 3TXVA 4MVAA 4DZHA 4ML9A 3G24A 4DWSC 3TW9A 1Q85A 3C0SA 3MC5A 3FJNA 2ZRXA 2OPJA 2NXGA 3SUSA 4J1OA 2W6RA 3UU0A 3IWPA 1PO9A 2EPLX 1RH9A 2J27A 4AX6A 2CETA 4XVEA 5CPSA 1YXYA 1GYNA 1J2BA 3EKGA 3QQWA 5G1TA 3GFYA 5KTLA 3NQAA 4LB4A 3CS2A 5I06A 1XBZA 3LM3A 2EHHA 1ME8A 2WNQA 1WP6A 2OO0A 5HQEA 2PS2A 5FJUA 3AZTA 4C6NA 4Z08A 4LUSB 1CGWA 3R25A 4YWIA 3KVMA 3LGGA 3MI6A 4CD7A 2NW0A 2HS8A 4MLRA 5AOUA 3GXPA 2EF9A 3W75A 4Q33A 4A8RA 3CL6A 3ITGA 3L2MA 3ONBA 4PMOA 4IJCA 1JULA 3H2FA 3TCEA 1YEYA 2IQDA 4ASTA 1TR1A 1Z89A 2EQDA 4DPPA 3CUXA 3W2NA 3OA3A 1EB3A 1TWDA 3LLXA 1XRFA 4R3UA 3LNPA 1TZ9A 4GZEA 4L4OA 2D3NA 2HJPA 1W3NA 1EH9A 1HXJA 3BDKA 4JTFA 3W1RA 5ENLA 3C56A 1ML1A 4C6EA 1OBAA 2FPTA 3W1MA 1M7JA 4J2PA 2J6VA 1AJ2A 1F8MA 4DZ5A 4MB5A 2I9UA 2FTPA 4J9JA 3EPOA 2EPOA 4B5UA 2WSRA 4GX8A 4PB3A 4XWUA 3BAYA 2EPMX 3LXCA 2DT1A 4E3VA 2OEJA 2XWEA 3IJ8A 4O50A 2YL9A 1WE5A 5K7JA 4A05A 1CX9A 9XIAA 3FJLA 4S3KA 5FF4A 4AIBA 1MXDA 2QJHA 1F76A 1J12A 3URQA 3W7MA 3S8HA 2OFJA 2ZBTA 3U5YA 4DJFA 3RYSA 4LW7A 2QZRA 4C5YA 1YHTA 2DVXA 3T6CA 5E1QA 3U9IA 4C7DA 1JCNA 1WKFA 1VLIA 3CWNA 4ZXLA 4UR7A 3G0UA 2NXHA 1TV3A 4GO9A 5AHFA 3QXBA 2TSYA 2BVDA 3U5UA 3SFWA 3WF0A 4LUYA 4DZAA 2JGYA 2WVVB 1RR2A 3LXBA 2NWSA 4AX7A 1LG1A 4G7FA 4PTVA 3WLQA 4ZVJA 3WH8A 4JBRA 3SJ3A 5FAJA 3RPTA 1PKMA 4NNAA 4K36A 2PRLA 3MUIA 5ABGA 3GR8A 1MRQA 1T0OA 5XIAA 2VX4A 2YCJA 3VIFA 4JFTA 1MI3A 1HTIA 3Q37A 1DJYA 1BPLB 1M1BA 4DBUA 3CUJA 3OZYA 1ICPA 1W1ZA 4JN6A 3KOZA 3VZYA 2ZX5A 2ZRWA 3PZUA 3U2ZA 7CGTA 5A8NA 3E2VA 4XB3A 4GY7A 3GC5A 3SCTA 4DX3A 3LENA 4YMZA 1F05A 1C8QA 1ONXA 3AXIA 3MO7A 1VCGA 1UBPC 4MSSA 4KFOA 3D3AA 1W9XA 3C8FA 3VNJA 4S3EA 4OECA 3UR7A 4EOUA 2QIIA 4XAZA 4IP7A 4NZCA 1CTNA 1OVDA 3P5YA 1HIZA 4QTGA 3ME3A 1LQAA 3W1XA 1PWMA 2QCCA 4E5TA 3B8SA 4JHOA 4F0SA 1HVQA 4O1AA 1QW9A 3S83A 2E25A 3SCUA 2E28A 1LTDA 4IMDA 2EJAA 4N4PA 1Q4WA 5EPDA 3DKLA 4BQ3A 4QR6A 2R91A 3KZSA 2QDGA 3GTNA 4F2TA 2HXUA 4LOCA 2RDWA 2DQWA 4XUGA 1HKWA 3NPWA 3TJXA 2FMOA 3L4TA 5ABTA 4JDBA 1EC9A 1EXBA 2ISWA 2Z2UA 5LXXA 1EFZA 1WDPA 4WX2A 1PHWA 3NXLA 3H8AA 5C8BB 1Y8BA 3LS9A 2AAMA 2WQDA 3CLMA 4LRSA 4DUVA 1O7AA 3ICJA 3WLRA 1QWKA 3MYOA 3DHUA 3PPHA 3WLMA 1O1HA 1ISVA 3NFUA 3NDZA 3NZPA 4J27A 4O28A 3QF0A 3LHYA 5DXYA 3NWRA 3M43A 1UKQA 3H24A 2V5LA 3W2MA 3H7RA 3IVSA 3NQDA 4Z0JA 7PTDA 3NCOA 2E6YA 4AHQA 5FD0A 4PMVA 1XQLA 1XSIA 1BQGA 1XLHA 4TVCA 2BBFA 3AICA 3MUAA 3LXAA 1W5OA 2ABAA 1XLGA 3MB9A 4KGLA 1SJAA 4JOMA 2HXTA 4ZFMA 3TW6A 2FGBA 1KM3A 3EX4A 1XG4A 2OG9A 2PUZA 2BY2A 1R0MA 3RLGA 1KRBC 1FWRA 3MU7A 3OTRA 4OOUA 4Z2GA 3CMGA 4DWSA 1IEQA 1L6YA 5FJOA 2PLCA 5D38A 1W54A 3RUBL 3VDBA 3HMCA 5FESA 1AA1B 1J0IA 5REQA 1UUOA 4RZ5A 3KVLA 1V6VA 2OLAA 3LRLA 3SIZA 1TB3A 4CQ9A 2WHJA 4I5XA 1XRTA 6ALDA 3CQKA 3OBEA 3MBDA 4BHYA 5HJXA 4WKFA 4AZIA 3FJ6A 1XM3A 4KW2A 5J8LA 3BPWA 2OOFA 3EEGA 2DSKA 1E40A 4NL1A 1MUCA 1ZLPA 3ZR6A 1BYDA 4H83A 2Y5SA 1AMKA 1F6PA 1J6PA 2NX9A 3SY1A 3KS6A 4LQ1A 1Q2RA 8CGTA 2AL2A 3P2VA 3WQVA 3M0KA 3PBUA 1RY8A 3TTSA 4OBRA 3DHDA 4HTYA 1W31A 2F6KA 1IEWA 4H9ZA 1FCQA 3M41A 2Q8ZA 2B4GA 4GVGA 2VM8A 2ZX8A 5D2YA 3E02A 1BKSA 3ZT6A 1DL3A 3E2SA 4JTEA 5TF0A 1A3XA 3RM9A 3RX3A 2Z2AA 4MG4A 2ATMA 3BAXA 2V3FA 1EZ2A 3CT7A 4OU1A 2O55A 4H9XA 5LIXX 1E5JA 4DBEA 1EJRC 2NQJA 4L6HA 5AY7A 4P8UA 4QRNA 3W71A 3A9BA 3BURA 1J0JA 3WEOA 1FHUA 8TIMA 1GG1A 3AS3A 1F9CA 2OX4A 3GD6A 3THDA 4AY7A 3EXSA 2A79A 1TQJA 3OW1A 3UQNA 3RCNA 1OFDA 3FEMA 4LYKA 3MVTA 4PUKA 1W3IA 2P50A 4HA0A 5FEWA 3TONA 1KQZA 3W6LA 1GVRA 4PCTA 2B81A 3VXGA 4AF0B 4I5UA 2P8BA 3QMRA 3YPIA 4WVXA 4AD0A 1PV8A 5AYBA 2VUYA 1DHPA 4Q4RA 1WBJA 1KD0A 3ARRA 3A23A 3W76A 3POHA 1YQ2A 4LS2A 1HF6A 3CTTA 1UD2A 3KRSA 4IISA 3AHYA 1JYXA 4XIMA 1LT8A 1GYMA 2HVMA 3PN8A 3ZM8A 3KDNA 3D46A 4JQ1A 1X97A 5A95A 2YL5A 1IF2A 4CEXC 4QHRA 4B5SA 1JYNA 4DBSA 5F1VA 1US3A 2J7FA 3POCA 1XXXA 2X42A 3B0PA 4LBSA 1T7LA 3OP2A 3B9DA 1KQYA 2OR2A 4FA3A 3A4XA 2RGLA 3VILA 3IGSA 3UEQA 2VWTA 7TAAA 4FF5A 2FH6A 4GMEA 4DEFA 2PODA 3W88A 3QPZA 2CZVA 3G0SA 5M2FX 2D69A 2V2DA 3G1FA 2OX1A 2POZA 2EG6A 2QEZA 4A3YA 2XIBA 4HPGA 2PA6A 4EPKA 1G94A 3TJIA 4S3GA 2NLYA 1OHLA 5T26A 2PURA 4AG0A 1VBJA 1F4AA 2DZWA 3C8NA 2GGIA 4JKKA 1FH7A 3VNZA 3PZOA 2GQAA 3BW2A 4ZQOA 4TTGA 3GG7A 4AISA 3UVAA 1ZTVA 4KEVA 2QT3A 2PDKA 4KGJA 4M1RA 4JTCA 3FHAA 3B40A 3T9PA 3PK7A 4FXSA 3ZZ1A 1EXPA 3F2CA 3WFZA 2W5FA 4X22A 4O8RA 1HKKA 4XVDA 2XFRA 4L6OA 2GJRA 1Q6RA 3W1AA 4X60A 3FW6A 2O4QA 2F84A 1TYGA 3IJ9A 4Q8MA 1CDGA 2CLIA 2GDQA 1XICA 3V1PA 4GQRA 3O07A 1XLMA 5CPOA 5AYIA 3L2IA 2WMJA 4GUGA 5CLWA 1QBBA 6TIMA 1RUSA 4JQ2A 1ELSA 5CGTA 2QUUA 3DXIA 2HE5A 3CB8A 2NUWA 3RCYA 1ODUA 4XTIA 4GK8A 1A47A 3Q94A 1R87A 4LS1A 4GKLA 1Q6EA 3DFHA 3BK0A 5D2VA 2CZFA 2VOMA 4E8DA 4PCFA 1P0EA 3B8TA 4PMRA 2EPNA 5A6LA 3ERPA 2NT0A 1NOFA 1OINA 4ZTYA 3GM8A 1QNRA 3VE9A 3GHTA 3SRFA 4GIYA 4C90A 2J9ZA 2XVNA 3FY1A 3C0LA 3CHCA 3ABSA 3BV7A 4ERGA 2V5CA 4OV9A 1R6WA 3VIGA 4GH3A 1GK8A 2IUZA 3UWYA 4BF7A 3R6IA 1AW5A 4GVIA 4XSMA 5HNRA 4FHAA 3H26A 2X0YA 5G4HC 3F4CA 1VR6A 1SPQA 4A3RA 3W22A 2FVMA 4EKJA 3AJ7A 2Q8LA 2EAWA 4LF1A 4JNMA 5T9CE 2WXDM 2OZTA 3NQ8A 3MSYA 3ARPA 2PTXA 5T8GA 5DF0A 3L0NA 2GJXB 4RW3A 3R79A 1U2YA 3I7SA 3WNLA 1CXEA 1PEZA 3KM8A 4B5VA 1OIMA 4J3TA 1Z7AA 4DO6A 1PUDA 4CD5A 4L4PA 1J93A 1IT0A 4Q7NA 3CO4A 3STFA 1IHIA 3RG6A 4CNUA 3UZJA 4R7OA 1YDYA 5D05A 1NDYA 4PUJA 1PKNA 1ZCCA 1P0BA 3GC2A 1VIZA 3W7RA 1DXEA 2A6LA 1IGWA 3W85A 1VCFA 2EPKX 1SO4A 2XVPA 1VENA 2TODA 3BE7A 5DMNA 4JY9A 1KTCA 3FA3A 1EWEA 1G4TA 1ISZA 4LB3A 3STPA 3GBDA 2FZBA 4JTDA 3VNKA 3NO3A 5IDIA 1UOKA 3MCNA 2G5WA 3DFNA 3VKCA 4HMNA 4KCWA 4HHMA 2HNEA 1A49A 3R1ZA 4R27A 4RV3A 2PTDA 1Q6DA 1W1IE 2UY5A 2DJLA 3PNZA 1RPKA 4MB4A 3M5ZA 3MVIA 2JEPA 3DEQA 1XCWA 2C15A 2PBOA 3KWXA 2Q02A 1EOMA 4A2SA 1W9PA 3FX4A 4C60A 3QYQA 4QCFA 2WJFA 5GVJA 1UYQA 4NQ1A 4HMCA 1X8CA 3OHMB 4FF7A 4XZIA 3RN6A 2V68A 2HSAA 3TKFA 3ID7A 4DN1A 2QUVA 4B3ZA 3CIVA 2VCAA 2AGTA 4ADUA 3S6DA 3PPGA 4IGSA 1UUMA 3M7WA 4E2DA 3C2EA 4I9AA 4UZUA 3O6YX 2VFFA 2WWCA 1JFXA 4MM1A 3IAQA 5E6ZA 1XBVA 4LGXA 4LUTB 1JCJA 1TPDA 1U5JA 2PDNA 2WSQA 1QI4A 1XGDA 2Y4SA 3ZYZA 5CCZA 1EYEA 3GR7A 5D4YA 1UW9A 2UV8G 5D2XA 3EA1A 5AKQA 4FNPA 3LN3A 3INPA 4WHBA 1TVLA 2WM1A 2OKOA 3ZXWA 4DLMA 5GNXA 2CWNA 3Q67A 3AWNA 1FTXA 4IJBA 3FVMA 2Z0IA 4GYPA 2HQAA 2GSEA 3GDKA 2E8YA 4JD4A 4V2XA 3EYPA 1A3WA 4ILSA 7REQB 3AQUA 4IIGA 2ZXQA 1KGWA 2OJPA 2G3MA 2P3ZA 1QUMA 3IUHA 3TJ4A 4D6CA 2NX1A 1YTKA 1ENUA 3VUPA 2AL1A 1S5MA 2OSXA 2QCLA 2XISA 2GFTA 1U5HA 3W02A 3L67A 1TCMA 3CTLA 3PBMA 1PB0A 3N6QA 1UR1A 2NLIA 1B2YA 3MMTA 4IXHA 5D04C 5G4WA 4IUOA 5HUOA 1GOXA 3TWBA 4AWUA 1V3MA 3OVPA 1OYCA 3GC4A 1CXHA 3S9YA 3A5FA 2WK2A 3W7CA 4ZB5A 3HG3A 5LNVA 4I7WA 3W27A 3BUVA 3AU2A 2Z25A 1Q8JA 1H7PA 2VP8A 2DGAA 4EK7A 4NJKA 4LJ3A 1QI3A 2VEIA 4H7CA 4WF7A 4RDYA 4QSHA 3V18A 3TFXA 2PDJA 4G9PA 5H2ZA