3CUFA

Cellulomonas fimi xylanase/cellulase cex (cf xyn10a) in complex with cellobiose-like isofagomine
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
314
structure length
314
Chain Sequence
ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAFGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the binding sites of Family 10 and 11 Xylanases with extended Oligosaccharides
rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
molecule keywords Exo-beta-1,4-glucanase
total genus 132
structure length 314
sequence length 314
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cufA00
2VCAA 3SCQA 3OZPA 3BAWA 5JIWA 3UCQA 4AEFA 5EBAA 4PTMA 3WDIA 1YQ2A 2HISA 2WWCA 3OLDA 3W0KA 5BCAA 3SURA 3WF3A 3ARXA 1BF2A 1OINA 2E9MA 5CPTA 1DWAM 3ARWA 3A4XA 4MB4A 1EO5A 4TVUA 2C8NA 1HJSA 1TZ7A 1UD4A 4NI3A 1BGGA 1V02A 4F9JA 4H8HA 1WZKA 5CLTA 1ZBKA 3VM5A 4PMNA 1H1NA 2Y24A 1UH4A 5M5DA 3UERA 5AY7A 1HNYA 2GDUA 1VIWA 2JE8A 2XFRA 3AMLA 2WSPA 3AIBA 2PC8A 4XX6A 1UD2A 3TP4A 1E0VA 1PX3A 1AVAA 1UWSA 2DPEA 1VJZA 4M80A 1JZ3A 4AZIA 4MAVA 3CHCA 5CGMA 2D1ZA 3U7BA 4HZ8A 2CBUA 3AHYA 1J0JA 1ITXA 1EHAA 1G1YA 3NSMA 2WCSA 3WNPA 4EK7A 3ARZA 4TX6A 2E40A 2XUCA 3ZR5A 3FW6A 3LMYA 4UQ9A 4B15A 1J9YA 1TR1A 3ALGA 1PIFA 2VZUA 3PZMA 3DYOA 3EDEA 1V6UA 2WAGA 3MS8A 1WDRA 3TOPA 2VZOA 4JL1A 3F5JA 1EQCA 4GZEA 3WEMA 5HPCA 2E8YA 3K8MA 2VQUA 5CQ1A 1BVZA 2WXDM 2ZWZA 1LL6A 1JZ2A 1OT1A 4ACYA 2JIWA 3WQ4A 4H04A 2GUYA 4HPHA 4DWSD 1E0WA 3MO4A 3AXHA 4N0RA 1DP0A 1BTCA 2DSUA 3ALFA 3I3DA 3KZSA 3PZ9A 3WD3A 1MXGA 4AXNA 1LLOA 1K6AA 4V2XA 1W9XA 5E6YA 2XWEA 2IUZA 3WELA 5DMYA 3L4TA 3OLEA 3AHXA 1LWHA 4BCEA 1W3HA 4WIWA 2CXGA 3SUSA 1VFOA 2VR4A 1QHZA 4L4PA 3U7VA 1QW9A 3WY1A 4LXFA 5ABFA 4CGTA 1GOOA 2ZUMA 1OIMA 3GXIA 4UQCA 3KEHA 4GIAA 1JFXA 4J3SA 1VFMA 2GJRA 4JAWA 1CGTA 1GJUA 2CERA 4W93A 4PUDA 2NW0A 1BG9A 2GJXB 3N15A 3L4XA 2D20A 1VFFA 1V08A 1QI3A 2Z1SA 1TVPA 4WSJA 4U31A 3RMEA 4UFKA 5D8WA 1W2VA 3WD0A 3VPLA 1UG6A 2XIIA 3WF0A 2WBKA 2WCGA 3CZKA 1EDGA 2W5FA 2EPLX 3ZQ9A 2G4FA 1JDAA 1SMAA 1NOFA 4PBGA 4AD0A 5JBFA 2A3EA 2YDSA 3TTOA 4DUWA 2XGIA 3KL5A 2J8GA 1KQZA 3CZLA 3AMGA 1Q6FA 1CXFA 1H11A 1C8YA 3L4YA 1JDDA 2DIEA 1HJUA 5A1AA 1BVNP 3ARUA 1WE5A 5CGTA 2WK2A 5HDRA 1PAMA 1I75A 2Y5EA 1HXJA 1LG2A 3BAKA 5I5RA 3ZSTA 3II1A 1LG1A 5DO8A 4JFVA 5A8PA 3AISA 1E1FA 1JZ7A 2YDQA 1VEOA 2PF0A 2WVUA 1QI2A 4UFIA 1CGYA 4FLQA 4W88A 2XGBA 1H09A 2XSAA 3N11A 3WNMA 4CCCA 4OZOA 1FH9A 1E6XM 4UCFA 3MUZ1 1PX4A 3WBAA 2YL6A 5C71A 1R7OA 2WNWA 3RO8A 4ZENA 1FOBA 2ZIDA 2DT2A 1WCGA 4LYRA 2XJ7A 1H0IA 1FP8A 5C8BB 3D5HA 3UR7A 4V28A 2IXUA 3PZNA 3WF1A 3CUIA 5A95A 1Q4NX 5DF0A 4WLCA 1E73M 1WDPA 4DM2A 2BNJA 4HMEA 3UG5A 4OBSA 1W3KA 4CVUA 5IHRA 2XVPA 3WFLA 2G3IA 1JDCA 1ISWA 2BFGA 3CUGA 2J7GA 5HPOA 1V3JA 1ISXA 3AMCA 3WL0A 1U30A 2VX5A 1DEDA 1W1YA 2CBIA 5EB8A 1VENA 4P7LA 4RE3A 1NH6A 4PMRA 3LPPA 1CXLA 4MNKA 3W38A 4GI9A 3AQUA 4H2CA 4AISA 3A6OA 5FL1A 5GNZA 3VOCA 3AZTA 2OSWA 1E6QM 1JFHA 1AMYA 2A3AA 2XVLA 3OLIA 1HT6A 3IJ7A 1ECEA 2WHKA 1R86A 3WMCA 1JYXA 1C91A 2BVTA 4PMQA 2D3LA 4PTWA 3FHQA 3GXFA 1UUQA 2VZSA 2QF8A 3S6TA 1NARA 1J12A 1UWQA 2D22A 1Y7VA 2WSKA 3CIVA 4ZEPA 3MSGA 4PEEA 1DTUA 1E4MM 2WHLA 3WQVA 2Y8KA 3OGVA 4M56A 7A3HA 3NCOA 3PTKA 1B3XA 3GNOA 2D23A 2ZX9A 4ZE5A 4D1IA 4XZWA 1GVYA 2VCBA 2W91A 1GPFA 2Y4SA 3AIEA 1PZ2A 1W32A 4W85A 1HKKA 4TOQA 2ESCA 4UQEA 2VI0A 1CXHA 3L2LA 2OYKA 5A6KA 3NSNA 3B9AA 4U5IA 2ZX6A 1D2KA 1E6ZA 4AD1A 3QHOA 4AZGA 1DHKA 2GJXA 1V03A 3EDKA 4CD7A 1NP2A 5I0DA 2WHMA 4CCEA 3WD4A 1UR1A 4OKDA 1GOIA 1DWHM 3BH4A 3MANA 2JIEA 3AMKA 1UR9A 1XH2A 3AIUA 5AYIA 1EDQA 5A8NA 3U57A 5CPQA 1Q6EA 4FF5A 3AS3A 2RGMA 4AWEA 2Q8XA 4MJ2A 1WB0A 1BYCA 3WH5A 3W81A 1K9EA 3AYRA 3SCWA 4AW7A 1QBAA 1NOUA 3W25A 5DT5A 1SR0A 2J77A 2WYSA 4A3YA 3SUTA 1JZ6A 2J47A 4JL2A 4YN5A 1V6WA 2F2HA 4MAZA 5HOSA 2PWFA 3CH9A 3BAYA 3DYMA 3NUKA 4IM4A 4TX8A 1UD3A 1QHPA 1B0IA 1TUXA 1UD8A 1W1VA 4HZ6A 2EO7A 7TAAA 4GXPA 5BROA 3WEZA 4TVCA 4A4AA 3U5YA 3ECQA 3PZTA 2WMIB 1CTNA 1HP4A 2X8RA 3CMGA 2XHYA 5JUVA 4UFMA 3ZSSA 1EH9A 2YKKA 4J3UA 3SUVA 1E3XA 2WMFA 3AIWA 5BRPA 1E3ZA 3JUGA 4CUCA 4OOUA 3GYCA 1B2YA 3W4RA 2DT3A 3B9DA 1JL8A 1V0KA 2PWGA 1W1TA 3N13A 1QNRA 2XG9A 3FY1A 1I1XA 5A3HA 3BAIA 1UR0A 1FFRA 1ZJAA 3TA9A 4QAWA 1X1NA 3AICA 4W8AA 1JD9A 3AIQA 4D71A 2HVMA 4JCLA 4YHEA 4ZXOA 2BY0A 3WN6A 2VJXA 4W5UA 3I3BA 3AHTA 4LYQA 3BLKA 4HOXA 3OBAA 4AD4A 1KXHA 3WKZA 1JI1A 3VIFA 4KRUA 3OZOA 2CIPA 1RH9A 3G6LA 3BSHA 3WL1A 1W9DM 1ZBVA 3CHFA 4AYSA 1CYGA 1EXPA 1LQ0A 2VL4A 3CBWA 2X0YA 2IXVA 2WZIA 1VAHA 2UY4A 1EGZA 2XVKA 1QNSA 5A8OA 3WDPP 4MNJA 4XV0A 3GH5A 2C7FA 4GKLA 4B9YA 2NT1A 2X2YA 1J0ZA 1H5VA 3EDJA 4M82A 3WFZA 1JF5A 3IAPA 3EDFA 4JFSA 1BGAA 5D9OA 1W9VA 3SCTA 4WSKA 1JD7A 1E4IA 2FHCA 2BS9A 3NDYA 1BAGA 4CN1A 3MUY1 4KGLA 1OM0A 3WUEA 1RP8A 3CO4A 4UFLA 5EMYA 5D9PA 2J7BA 1XSIA 1QNQA 4CD8A 3GBDA 1M01A 4PSPA 1F4HA 2YLLA 2WZHA 4GI6A 2PBGA 5BXSA 1E9LA 2E4TA 3GNRA 1C7TA 4FLRA 4J3WA 2OWCA 4WF7A 3UETA 4UTFA 4H41A 4AIOA 1W91A 4JCMA 1Q6DA 4KH2A 5I23A 1E70M 1J0YA 2WANA 1WZAA 4URIA 4UOQA 3SCOA 2YLAA 4NSBA 1UR4A 4DWSB 1B31A 1CGUA 1NOWA 3S2CA 3WEOA 5ABFB 2WVVB 3I3EA 1OGSA 4ZE4A 2PBOA 1UR8A 2BY3A 3OGSA 3WDQA 5FCZA 3W82A 3T0BA 4XZBA 4KWUA 3N1AA 3BAJA 4PN2A 3WNLA 2EBNA 2D0HA 1GJWA 3MKKA 4W7UA 4JKKA 4E8DA 1LL4A 4NRRA 3GBEA 1KR1A 4AD5A 1HL8A 4W89A 1VEPA 4CU6A 3RM9A 3CTTA 3AXIA 3WENA 4CCDA 1RD6A 4JFTA 2QPSA 4ATDA 1WO2A 1CDGA 1JYNA 1ZBCA 1FHLA 4IPNB 2VRQA 1WDQA 1C7SA 1UKQA 3IK2A 4GO9A 3VMOA 1IT0A 3LPOA 3TONA 5BXTA 3VDHA 5IHSA 3AHVA 3VIGA 1Q6CA 2O92A 3L4ZA 2OLHA 1QVBA 1W9BM 1XC6A 4UR9A 2NT0A 4HA3A 1HJVA 2A3HA 3SEPA 1CGWA 4W84A 2CHNA 3F4VA 2Z1KA 2J7FA 4QP0A 3W6MA 3T09A 3TTQA 1M04A 4QFUA 2V3GA 1E43A 3WMBA 2DH3A 5ECUA 4W5ZA 1GONA 3ZM8A 4Z2IA 4JFWA 2WMGA 3CGTA 3HN3A 5M3WA 3ZT6A 1G9HA 2WC4A 2UY5A 2VO5A 2OWWA 3ZO9A 4BQ4A 3VDCA 3BSGA 4HOZA 4Y7EA 1E40A 1OT2A 2PB1A 3NJ3A 3UG3A 1H0GA 4ZFMA 2V3EA 1B9ZA 2V3DA 1UH3A 3AOFA 4MNMA 1QI5A 4DWSA 1BSIA 4U3AA 4HOWA 3WH8A 1QI4A 3J7HA 3B8SA 4YPJA 1IZKA 4DUVA 3VIOA 2EPKX 2ZUUA 1KWGA 4OBRA 1PIGA 1UKPA 1EHNA 1TMQA 1V6XA 2CPUA 1EA9C 5HNNA 2GSJA 1JZ8A 3RJYA 3VGGA 2EPMX 1LL7A 4MDPA 5JIPA 5LA1A 1DWFM 1GQKA 1M7XA 5I77A 3W28A 5E6ZA 3SCUA 4UFHA 4UZUA 1QNOA 2YBUA 1PJ9A 3K4DA 4J7RA 2YL9A 2XM1A 4C7GA 3AROA 3UR8A 5EFFA 1TA3B 3SIMA 4CD6A 1GQIA 4UOZA 3U5UA 1GNXA 5BXPA 5A94A 4WKHA 3ZIZA 4P7RA 2VCCA 2J25A 3OB8A 1XRVA 3FAWA 3ZT5A 2AAAA 2D2OA 3ARTA 3N17A 2D24A 3O9NA 5A2AA 5E9AA 8CGTA 1TE1A 1SMDA 3G6MA 2ZXDA 2BY2A 1H4PA 1FFQA 1XGZA 1GZJA 2E0PA 3VMNA 2ZUVA 4NRSA 5KZ6A 4LPCA 5IXEA 1ITCA 3POCA 2QV4A 5TD4A 4W8BA 1UA7A 3ARYA 3EBVA 3GXMA 4HMCA 1J10A 4UZSA 4Z2GA 3RM8A 1GOWA 4D6FA 4MB1A 2BXYA 1MWOA 1OBAA 4GQRA 1LJYA 2O9OA 3WH7A 1PPIA 4Z2KA 2QHAA 1US2A 2FHFA 4CU7A 2G8ZA 3VD5A 4GZJA 2J78A 1J0HA 1V3KA 3ZT7A 1XH0A 5CZKA 3ARRA 4NF7A 3A4AA 3HJEA 6A3HA 3MUIA 6TAAA 1V02E 2J8FA 3WQ8A 1WDSA 1EOKA 4GQQA 5A6MA 1CEOA 1UD5A 1L8NA 2ZICA 4P7OA 2DEPA 1JNDA 1KBBA 4JZ5A 1JF6A 4ACZA 2V3FA 3CHEA 3M07A 2J7HA 1OIFA 2JEPA 1WNOA 4HA1A 4N42A 3VMPA 2BY1A 2QMKA 4MTVA 3VDBA 2Y2WA 4XUYA 5D9MA 2BXZA 3PZUA 3K46A 2CEQA 4R5EA 3N12A 1E6PA 2VVSA 1J0KA 1BQCA 5A2CA 3MMDA 1BPLB 3PTMA 2XSBA 4AIUA 1H49A 4CVWA 2CKSA 3EDDA 5FD0A 3QR3A 1R7AA 1EOMA 4H8UA 4QLKA 1JXKA 1VBUA 2DDXA 4P8VA 2WC7A 4LGXA 3MUAA 1X6NA 5I79A 3MMWA 1TCMA 3BGAA 1ZBWA 1VRXA 5D9NA 3MSDA 1ODUA 2WM0A 3A3HA 3O2LA 2DT0A 1UKOA 1NWTA 3SCSA 4EANA 4AD3A 1ZJBA 2DQXA 2F61A 1C93A 2FGZA 1E5JA 1ISZA 4U5KA 1HP5A 3ZJ8A 3DHUA 2XVNA 1C90A 3DECA 2EQDA 3VUPA 1HVXA 4Q22A 1JIBA 5HBFA 2YOCA 3BMVA 1MXDA 1XCXA 5A6BA 1E6RA 2WZEA 2W92A 3WDJA 4L4OA 1AQ0A 5IFPA 2UY3A 1KWKA 2CYGA 2PWDA 1CPUA 1XH1A 1VJSA 3VGHA 1W1PA 3UEQA 1PX8A 4UQAA 2JFEX 4GZIA 1CNVA 1PEZA 2ZUWA 1O7AA 4BZYA 4DWSC 1JGIA 1KBKA 3ZJKA 3VILA 1QBBA 1UZ4A 2E8ZA 1D3CA 5I6SA 3GM8A 1CBGA 3AIVA 2W61A 1CXEA 1EDTA 4J27A 2GK1A 4AZHA 2ZUSA 4MB5A 1W3JA 4B3KA 3CUJA 3WUGA 2WMHA 1MW2A 2A3BA 1U33A 1HN1A 1HJWA 2OSYA 1B3WA 1CXIA 1V3MA 1EQPA 5CSUA 1ZB5A 2G3JA 4E8CA 3CPUA 3VTRA 2E9LA 3DHPA 5A6LA 5A6JA 6CGTA 4BS0A 4KRTA 1UWRA 3VX1A 3OLGA 4S3KA 1L0PA 3TTSA 1FP9A 1XYFA 3DYPA 4D6GA 3PHAA 3WF2A 2B31A 2CCRA 2C0HA 2JEQA 4B16A 4WK9A 2Y8VA 2V5DA 1E55A 1IV8A 4C7DA 3BCDA 4CD4A 2OWXA 1RPKA 2OSXA 4D6HA 4D6IA 2VMFA 3W27A 3GZAA 2G3MA 2DT1A 3ARVA 2GDVA 5BWFA 5ABHA 1JZ5A 4X9YA 1ODZA 2FGLA 4AZCA 4BQ3A 2D3NA 4WKFA 1UKTA 1HL9A 3CHDA 4AD2A 1GOMA 4FMVA 1UWIA 2WPGA 2YJQA 4IUGA 2WLYA 4V27A 1W9PA 2ZX8A 3WBEA 3PZIA 3LPGA 1M53A 1R8LA 1XD1A 4XB3A 2CITA 3AS2A 4JHZA 5E09A 9CGTA 4AZBA 4CKQA 4OIFA 1G0CA 1ZU8A 4D6CA 4LYPA 4KMQA 4QDMA 1W9UA 7CGTA 2EPNA 1DWJM 2BVDA 3VGDA 1SFSA 3AJ7A 3FN9A 1E1EA 1V6YA 4JFUA 2OYLA 3K8KA 3RCNA 3FAXA 4F9DA 2VOTA 4PMUA 3MMUA 3VDAA 3WIJA 1O6IA 1C3FA 1R85A 2FH8A 3AIRA 4GO8A 1BYBA 3WQWA 5D8ZA 3OG2A 2J74A 4HPGA 1JXJA 2MANA 1AQMA 2V38A 1FH8A 1UKSA 4DUXA 5CG0A 3GH7A 3SCRA 3AS0A 2WC3A 5A6BD 3WF4A 1UR2A 2FHBA 4GPNA 1HKJA 2VQTA 2YDRA 3CZJA 3N18A 1MFVA 4QCFA 5KEZA 1PBGA 4PMXA 4PMZA 3OA5A 3WUFA 4JKLA 3PZOA 4PCTA 2J4GA 2WKLA 3IJ8A 3KL3A 5CPSA 4HTYA 1UQYA 4Q7NA 4Z2LA 1W2PA 2VRJA 2EEXA 3TTYA 4R27A 2W63A 2VX4A 3UG4A 1BG4A 5AC4A 3RIKA 1KFWA 3IJ9A 1KXQA 1BYDA 2D0GA 1S46A 2BHYA 3W26A 3BCFA 5DT7A 3K4AA 3RDKA 3O6AA 4OJYA 1FHDA 3VNZA 5FKYA 5ABEA 1KGXA 4J3VA 4P7QA 1V3LA 2ZXAA 1I1WA 4AZ7A 4D1JA 4WKAA 4W86A 3FXYA 5I78A 1CLVA 4TXEA 2VZTA 1JYWA 4QCEA 3T0DA 4AC1X 1GW1A 5GNXA 4EE9A 4OUEA 1ISVA 2YA0A 3T2OA 3QOKA 2CHOA 3PN8A 1E6SM 2J7CA 4LQ1A 2JF6A 5GQBA 2VX6A 1W3LA 4S3JA 1V6VA 1B1YA 2GVYA 4E2OA 3K1DA 5LA0A 3W6LA 2G41A 3QHNA 3T0AA 2WW5A 3A4WA 3HU7A 4FLOA 5JBDA 4M81A 4UOJA 3WMSA 4M24A 1B90A 2WMKA 3N04A 4J3XA 4JIEA 5D4YA 3VGBA 5I3DA 1R87A 1V3HA 3SCNA 5FOOA 2ZE0A 5JBEA 1TG7A 1LF1A 3VINA 1Z32X 1G01A 1NWUA 3IAQA 1FA2A 3WNOA 4TVDA 4TTGA 4PMYA 4J28A 1MQQA 1CXKA 3VD4A 5A6AA 1E4NA 1E6NA 3N9KA 3WH6A 3RPMA 5DEZA 2AOSA 2J62A 3GNPA 3WSUA 3GH4A 3CZ8A 1XSKA 3VO0A 1QPKA 1MW3A 4P7NA 5HXMA 1JI2A 1E72M 2X0HA 1UQZA 4HZ7A 1CLXA 1E0XA 1HX0A 1K9DA 3AHZA 3VGFA 5LA2A 5BXRA 1CENA 1MQPA 4J3TA 1GHSA 1CIUA 2CETA 4GI8A 1E56A 2XFYA 3WH9A 2OYMA 5FL0A 1J18A 1SYTA 3T08A 3POHA 3EMQA 4F79A 1HVQA 3EMZA 1KB3A 4E4PA 2DSKA 4PMVA 2A3CA 5I24A 1V3IA 4UNIA 2WBGA 4UQBA 1ISYA 2WLZA 1TVNA 3VX0A 1QOXA 2XIBA 3FNDA 4NZCA 3GXDA 4AEEA 3F5KA 1JNEA 3LPFA 5A6SA 5A8QA 4WJXA 2GFTA 2ZXQA 1VF8A 2VRKA 1PZ3A 1MQRA 3GTNA 2AMGA 1F4AA 3VIPA 1J11A 1CECA 1LWJA 5GPRA 2X05A 1HIZA 3AI0A 4MDOA 2EXOA 2QPUA 2VT0A 5IFTA 2VC9A 5F7UA 3VIKA 1NP0A 2PI6A 2ZUTA 4HA4A 2RGLA 2E3ZA 1KCLA 4Z2JA 1JYVA 4U2YA 1E15A 1TA3A 1QI0A 5CXPA 2WB5A 1WPCA 4MJ4A 1JG9A 2XFFA 3ZOAA 1UOKA 2GJPA 4MNLA 3T2QA 1X6LA 4PTXA 3RJXA 5M03A 3AMDA 4M29A 2XPKA 4AZ5A 2XM2A 4K68A 1C8QA 2DH2A 5GNYA 3PZQA 3ARSA 1GHRA 2FDMA 3WDRA 3VD9A 4PTVA 5AYBA 4ML4A 4HU0A 1KQYA 1KR0A 3F5LA 1J0IA 5BRQA 4ATWA 1G94A 4ATLA 5I2UA 2VX7A 1GQLA 1EO7A 2ZWYA 3NSXA 3CUHA 1N82A 1VFUA 1UHVA 3WD2A 2UWFA 1GCYA 1GORA 1US3A 3CLWA 2EJ1A 3NYDA 5M17A 2W62A 5CJ5A 3VIHA 2QMJA 1JAKA 1ZL1A 1UH2A 1HJXA 2XWDA 3L2MA 4U3CA 1UD6A 4IISA 4B3LA 4CN6A 4IPLA 4AMCA 4EKJA 4PMOA 2EPOA 3W29A 5EFDA 3SCPA 3ZJ7A 1WP6A 1BHGA 2YIHA 1WZLA 1XD0A 1BLIA 1RP9A 3SCVA 1E4LA 1C92A 1P6WA 3AFBA 5IDIA 4QLJA 5LYRA 2J75A 3SUUA 4QLLA 1NWRA 2VVNA 4RE4A 4YHGA 3PZVA 2V5CA 1OGGA 1B30A 1V0MA 3SUWA 1GUVA 1KXVA 1OSEA 2PWEA 1U2YA 4W7WA 5A69A 1NQ6A 3AZSA 1UWTA 1E71M 4FK9A 1MW1A 1WKYA 4D72A 3AS1A 3OIHA 3BMWA 3WDHA 1QNPA 5CLWA 1CWYA 2JALA 4X0VA 1HJQA 1GVIA 4HU8A 4TUFA 5FIPA 2XVGA 3BXWA 2WVTA 3KL0A 3NDZA 3NIYA 4LX4A 2O9PA 2ZOXA 1XV8A 4JHOA 4U33A 2VTFA 1H3GA 4PUEA 5E0CA 1K9FA 4D6EA 1A3HA 5CSYA 3CMJA 1XCWA 3QOMA 2WKGA 8A3HA 2YA1A 2DSVA 4RE2A 1JAEA 1WAWA 5A8MA 1AQHA 1B3ZA 2YA2A 3VIJA 1KCKA 3WNKA 1BFNA 3BC9A 4FLSA 4PCSA 4M8UA 2BVYA 4OOZA 3FHAA 5E70A 2CBJA 5ABGA 3M46A 4JKMA 3PZGA 3MV01 3APGA 1D7FA 3WQ6A 4H8VA 3GDBA 2DIJA 4F8XA 1GOKA 2WMJA 1HKMA 4DM1A 1KGWA 2J7DA 1YHTA 1B3YA 1BYAA 1KXTA 4X0NA 2W4XA 4CN4A 1H41A 3A47A 1B3VA 4ACZB 3HMCA 2TAAA 2DSZA 3RILA 3W53A 1TFVA 4PYSA 3E1F1 2JF7A 1XHGA 3VVGA 4KGJA 1OD0A 2YL5A 3KE0A 4BQ2A 3M6DA 4H7VA 4MB3A 2NSXA 1QHOA 2BHUA 3VM7A 3QHMA 1A47A 2CBVA 4UFJA 2GK1B 1ESWA 1OCQA 3EMCA 3UESA 1HF6A 4MADA 3M7SA 3IANA 3DC0A 2D0FA 2X1IA 1V0LA 4BQ5A 1MW0A 3VD7A 2WCAA 1DWIM 3AZRA 2VNCA 2WVSA 1CGXA 4PRWA 1UYQA 3D3AA 3W37A 3L4WA 2E9BA 2VR5A 3RM4A 4EAMA 5C70A 4HMDA 2BV9A 5AC5A 2YBTA 1ZS2A 4P8XA 1G5AA 1MYRA 1NWSA 4PSRA 3VNYA 2XYLA 4W8LA 2ZX7A 1CZ1A 1J01A 3VIIA 1Q6GA 3K8LA 2G3NA 3WD1A 3CUFA 1CGVA 3WUBA 1DWGM 4P8UA 4MPKA 3VD3A 3OGRA 1OB0A 4B9ZA 3ZMRA 2W66A 3VGEA 4D6DA 1GOQA 3BAXA 3CZGA 3ARQA 5E0FA 3CZEA 4TTUA 1K9TA 4F66A 1MFUA 1WZMA 4ZXLA 4W7VA 3ZJ6A 1VEMA 3MV11 2XTKA 3ARPA 3B9EA 1C8XA 2J7EA 4AY1A 2VUYA 3W24A 1E5NA 5DFAA 3L4VA 4AIEA 2X09A 2DGAA 5A2BA 1IZJA 2UY2A 3PTQA 4U2ZA 4BA0A 3EYPA 2ZX5A 4C7FA 2DSWA 4CU8A 3WNNA 3MU7A 2CKRA 2J79A 4A3HA 2YL8A 4GINA 2O9RA 2FH6A 2O9TA 5BYWA 1UZ1A 1VBRA 1EIBA 2VURA 4PMDA 1OGBA 3VKKA 4W87A 1MVYA 3VIMA 4UQDA 2W67A 3KWXA 1GQJA 3L4UA 4P8WA 1M03A 3T2PA 4AZCB 3THDA 1V0NA 4Z2HA 2PWHA 4CD5A 3PBGA 4M1RA 3AXXA 1UWUA 4D6JA 3VU2A 3ZR6A 2WHJA 1JZ4A 2F8QA 4AZ6A 2VZVA 4RL3A 1VB9A 1FH7A 4BF7A 1HKIA 1QW8A 3AYSA 1UA3A 1H2JA 1KGUA 1NM9A 2WMIA 2WWDA 3WQ5A 1OD8A 1XSJA 4HP5A 2ZXBA 2CESA 1XYZA 3THCA 2WVVA 3QGVA 2ZUNA 1OWQA 2BHZA 2CNCA 2QLYA 3BLPX
chains in the Genus database with same CATH superfamily
1Y0EA 3E38A 3H2MA 1GT8A 4IMDA 2PLJA 3UCQA 2E1WA 1W1ZA 4X60A 3B0PA 2AMXA 1YQ2A 3M44A 4C1NB 1F8MA 3L23A 1T40A 4RK8A 1SR9A 3R6IA 4Z08A 3VKCA 1XFBA 1Y5WA 1HJSA 2BOGX 1KFEA 1V02A 4F9JA 1U1JA 4H8HA 1SW7A 5FI8A 3N6JA 4IIBA 1ZBKA 3RRAA 3VM5A 2PGRA 4PR4A 5AY7A 2JE8A 3AMLA 2XFRA 1J6OA 3AIBA 2B7QA 1E0VA 2AQVA 1PX3A 1AVAA 2CFFA 3U3HA 2DPEA 1B4KA 1VJZA 3FJLA 3W72A 4MAVA 3CHCA 4C6PA 2PURA 4FS9A 4KESA 1DJQA 2A4AA 1ITXA 4C5ZA 1EHAA 1G1YA 2WCSA 5K2ZA 4EK7A 3EX6A 2QUVA 2E40A 3LMYA 4UQ9A 1IXQA 1J9YA 3W73A 2JK2A 3PZMA 3EDEA 1V6UA 3Q2DA 2WAGA 3MS8A 4I7UA 1WDRA 4IIDA 3CEUA 3TOPA 4JL1A 1K1DA 4RZBA 4EACA 4GZEA 3UJ2A 3B40A 3WJXA 2PE4A 2VQUA 3C2FA 1F3TA 4ACYA 2GUYA 3LG3A 3ZR4A 1F6KA 3MO4A 4E38A 3AXHA 4N0RA 3ZZ1A 1BTCA 2Z6IA 4KCUA 5A5WA 1XRSA 1MXGA 1WAUA 2FZDA 3W7QA 1IGSA 4G7EA 1W9XA 4B92A 4L6OA 1M5WA 4KFPA 2RDTA 1FBAA 3ANYA 3WFAA 6REQA 2XN1A 3C8FA 4J2MA 1CCWB 2NXHA 3IIPA 1W3HA 4QXIA 3EWDA 3L66A 4HHLA 3SUSA 1QHZA 1QW9A 4IH3A 3H53A 3IRSA 4CGTA 3MTWA 4DJDD 3R13A 3M9YA 4Q3MA 5H1WA 1LOQA 1VJIA 2CZVA 1IZCA 1EC8A 3A5VA 2D2JA 4JAWA 4JQ2A 1CGTA 1GZGA 2Q3OA 3N15A 1SSGA 4KKXA 3G0XA 2H90A 1K6WA 1RCXB 3V0UA 4U31A 4UTKA 4ILSA 5T9BG 4E6MA 4UFKA 5I07A 1DXFA 1UG6A 1XM3A 2XIIA 2E67A 3NWRA 2FTYA 2OB3A 4KW2A 4QJ4B 2G4FA 1JJKA 4GUGA 1NOFA 3IVSA 3VNIA 3E2RA 2QCEA 2Y5JA 4DUWA 1J5SA 1JDEA 1P0DA 4LVGA 3L4YA 4LUTB 1I4NA 1W8SA 3B8DA 1I75A 3BAKA 4FOKA 3FS2A 1P43A 1LG1A 5DO8A 4IPJA 4E3TA 4JFVA 5A8PA 3AISA 3VC6A 4LAZA 3G1FA 2PF0A 4QE4A 3EPMA 1CGYA 4FLQA 2XGBA 1H09A 3APYA 4UTJA 4OZOA 4D8LA 1E6XM 3BG3A 3MUZ1 1PX4A 3SFKA 3NEHA 1FOBA 3GKAA 3MP5A 3K5XA 1YYAA 4DXVA 3W2MA 3NQVA 4KERA 3GDTA 1C9DA 3TN3A 3UR7A 2IXUA 3KCJA 1WV2A 3PZNA 3WF1A 1U1UA 3CJPA 4YLWA 2Y0FA 1WDPA 4HMEA 4CVUA 4JD4A 3WJZA 3HO8A 4FI4A 1QR7A 2X42A 3QPZA 2OZ0A 4Z1DA 2Y85A 4O1EA 4O28A 1O1HA 2PTDA 1DOSA 3GR7A 3LM3A 4JNZA 3E02A 3NXFA 4RE3A 1NH6A 4MNKA 4GI9A 1Q3NA 4PE8A 3N3MA 4NL1A 1LRTA 4Q8WA 1XC4A 4LEQA 4S3BA 3VOCA 3UZXA 2REQB 1E6QM 4Q33A 5LNRA 3V4BA 1O94A 3NQGA 4AY7A 4OGZA 1Q2RA 2NVDA 1JYXA 3WMCA 2BVTA 3NL3A 3U48A 3M0VA 3TSDA 2VZSA 1GK8A 2QF8A 3SRHA 5JH1A 3S6TA 2NX9A 1J12A 3W07A 3ABRA 3IV3A 3CIVA 4PEEA 1W31A 1NTHA 3WQVA 3OGVA 1LOSA 2Z29A 1WXJA 5HR6A 2NQ5A 4QNWA 1GVYA 2VCBA 2W91A 1UPPA 3AIEA 1OQFA 4LB3A 1W32A 3GDRA 3WQGA 4XZHA 4IFRA 2D2HA 2NV1A 1XLEA 3TLQA 4U5IA 5AC6A 5FA5A 1E6ZA 3CT2A 1J96A 3RLVA 4CD7A 1GW9A 4QSFA 2WHMA 4J3ZA 1TPVA 2DUAA 4KBXA 3EWWA 1V7YA 3BH4A 3HV8A 3MANA 2R24A 4OTKA 3AMKA 4WDUA 4XBKA 5AYIA 4XVEA 1EDQA 1GKQA 1MEIA 1ZY9A 4PC8A 2VENA 3C86A 2HS8A 5G1MA 4DNHA 2Z1XA 4MJ2A 3E3HA 1YXDA 3AYRA 4R34A 1IXPA 4GC4A 4ZO8A 2J77A 4A3YA 2CC0A 4JL2A 4YN5A 2WSQA 2E25A 3VOGA 3NO1A 2VGGA 4LS1A 1QW7A 3NUKA 3LM7A 4TX8A 4PCPA 4GBDA 3LA4A 3FEMA 3BLLA 3TC3A 4TIMA 1X7FA 4PUNA 2NLIA 1PTDA 2EO7A 2DZVA 4JYFA 1ONWA 4RW5A 1XP3A 3ECQA 3PZTA 3WJYA 1CTNA 4XTDA 4UFMA 4MWAD 3W7LA 3BTNA 4LJ3A 2WMFA 5BRPA 4UB9A 1QO2A 4NZ3A 3WJWA 1VRDA 3M5YA 3P8IA 3HG4A 4PFMA 1S2CA 3VOJA 4TQTA 1R2RA 4US5D 1EXBA 4NJGA 3GTIA 1DVJA 1Y8BA 1JL8A 4N2YA 2AGKA 1V0KA 1L2QA 4WQ6A 2XH4A 3NQFA 3N13A 1FCUA 2VEGA 3FY1A 1MUCA 2A5HA 4O19A 3VAVA 1R47A 1ZJAA 4DJED 1QOPA 1X1NA 5LIYX 3QMRA 1DJIA 3AICA 1B4EA 2HVNA 4YHEA 4WJ8A 3GR8A 3WN6A 2VJXA 1GVQA 5ECVA 4B5SA 2CIPA 3O05A 2FVKA 4HSOA 1RH9A 3KW3A 5IBXC 2H3BA 3BSHA 3RITA 1ZBVA 3HOJA 3CHFA 3PWGA 3TXZA 3IUHA 1KM2A 4AYSA 2XH2A 1CYGA 5CSRA 2X0YA 1VAHA 2UY4A 3NFUA 1MUWA 4KQNA 1QNSA 4B9YA 2X2YA 1XUUA 3C2OA 3LGGA 5HK4A 2QJNA 4M82A 1KTNA 5D33A 1JF5A 1KFJA 3IAPA 1AK5A 3QBUA 3DC8A 3T78A 1W9VA 3SCTA 4A8NA 4A8RA 3HV9A 4WSKA 2BS9A 3R89A 2QUUA 4LYKA 3TV8A 1A5OC 1EJ7L 3I6EA 4UR7A 1AL7A 4YMZA 3WZ0E 1XSIA 3FCPA 1NU5A 3OTRA 4ORMA 5HNRA 1K8CA 1M01A 1F4HA 2WQPA 4HNNA 4WJEA 4B2DA 4LOCA 1ZPTA 2E4TA 1X8FA 4J3WA 2IPFA 1ADSA 5GJPA 3UETA 1KRCC 4AIOA 3EEZA 3L12A 3LRLA 4KH2A 3N4EA 4Q4PA 2D69A 1J0YA 1F05A 3KVKA 4IQLA 3S5SA 2QDDA 2C16A 3W1TA 1KRBC 1B9BA 1XYLA 2G37A 1VCGA 4JICA 1B31A 1VHCA 1A50A 1TJ0A 3REQA 4XQ6A 2IPJA 5ABFB 4HCLA 2ISFA 4RZ5A 2R8WA 1LOLA 1FWGC 1OVDA 1ICQA 3W86A 4QDWA 3LD5A 2XU2A 3W82A 2L5HA 3OYZA 3R2GA 3UZYA 5EKYA 3N1AA 3BAJA 3MWCA 2D0HA 3QVQA 1GJWA 1IXNA 1GYMA 3DFQA 2P3EA 1LL4A 1FWWA 1KR1A 4W89A 5CC6A 1RD6A 4ATDA 3NOEA 2C19A 1SO6A 1WDQA 1C7SA 1DTNA 2P8CA 3BOXA 3NGJA 3P5YA 1UKQA 3PR2A 5DANA 4G7EB 4FOUA 3TONA 1KC7A 5BXTA 1OFRA 6ENLA 3DENA 1HO4A 1TQJA 2ZVRA 4AG0A 2GZXA 2OLHA 1QVBA 2WM1A 4UR9A 2BB0A 3TUUA 3MJYA 3HQ1A 4IIGA 1V51A 5PTDA 4W84A 2QVNA 3MDWA 1JQVA 3N9RA 4QP0A 4POCA 3T09A 3CU2A 3ISIX 4RDZA 1S2VA 4Q8MA 2FZ9A 5ECUA 4JFWA 2WMGA 1TCDA 4PUJA 5IRPA 5DY3A 3HN3A 3CV1A 1G9HA 2HK1A 3IVUA 5LZLA 2PP3A 4MWAA 1E40A 4F2BA 5BOFA 2PB1A 1ZAIA 1B9ZA 5F4SA 1S5VA 4QHRA 1IIGA 5L6UA 4MNMA 1ML1A 3B0YA 2YB4A 2LLEA 3H54A 4BEQA 4DUVA 2HWGA 3VOFA 4ZSTA 3UZWA 3B3DA 2BGNE 1PIGA 1RY8A 5DXXA 1M65A 4GX9A 2VFDA 4WCJA 4HNUA 3R0KA 2IQDA 2GSJA 1GYNA 1KV8A 1TO3A 5CEWA 1F8IA 4MDPA 4I9MA 2WOQA 1GQKA 1YXYA 1U83A 2HCVA 3MKCA 1M7XA 2XFWA 2DZTA 3W28A 4UFHA 2R1MA 1OFOA 4O0QA 4J7RA 5AHMA 2W0UA 4C7GA 3AROA 3UR8A 5EFFA 4LVFA 1GNXA 3R0UA 3K1GA 4EF9A 3KXQA 3BQ6A 1XLLA 1XRVA 3FAWA 1W5QA 2D24A 3DG3A 5F1UA 2NXGA 4MIMA 1NF7A 2NQHA 2CLIA 4LSBA 2BY2A 4JN7A 3C8NA 4GUHA 3DI0A 1FFQA 2XIJA 4JPGA 3UWWA 4UMCA 3TEVA 4RCXA 5KZ6A 4LPCA 4XD3A 3POCA 4MFEA 5TD4A 4W8BA 4GD0A 3GXMA 4GY0A 1J10A 1E51A 2YCLB 2P50A 4GUJA 4E4UA 4MB1A 1OBAA 5HNTA 1PPIA 2QHAA 3HB9A 2G8ZA 4GZJA 3TW6A 3UWVA 1V3KA 1EWEA 3S1GA 5CZKA 3A4AA 3HJEA 6TAAA 3ZLGA 1JR1A 2R94A 4GQQA 4L65A 5A6MA 4D9PA 1S2AA 3GX9A 4XIAA 2E09A 1KBBA 4ACZA 2V3FA 1ZP3A 2Q01A 2XN0A 1IT7A 1SZNA 5DRIA 4MTVA 5D9MA 2E77A 4XUYA 5SWUA 4N9CA 1GVOA 2CEQA 4R5EA 3NQAA 3DKLA 3MMDA 1M7PA 3ME3A 1TRIA 2XH7A 3IV8A 4WEVX 3O63A 5FD0A 2Z1VA 4DO6A 5C7HA 1PE1A 1EOMA 2PAJA 4HZMA 4QLKA 2CWXA 1PIIA 1U5HA 4LGXA 3KTCA 3MMWA 1HGYA 3INPA 4R9XA 3HBLA 5B80A 4Q4OA 1K3UA 5IOBA 1R6WA 4GNVA 4QJ3B 3OVGA 2RUSA 3MSDA 2W79A 1ODUA 2WM0A 3A3HA 1IEXA 3PJWA 1UKOA 4AD3A 1ZJBA 2F61A 1E5JA 3ZFHA 2Z28A 3DECA 4IQDA 3VUPA 3P74A 5HBFA 3PFMA 1OG6A 4GABA 2PDHA 3BMVA 1XDLA 1A5UA 4PL1A 3EWBX 4CCZA 2X1UA 3RLUA 4L4OA 1AQ0A 3RLGA 1KWKA 2CYGA 2PWDA 4RNFA 1QPNA 4G56A 2V68A 3W7KA 2JFEX 2OZTA 2OQYA 4Y6GA 1PEZA 4ZB0A 3O8AA 5C55A 3UGRA 3TFCA 4PZVA 4DWSC 3NQMA 3KDOA 3UXLA 1OG0A 1EDTA 2GK1A 4AZHA 4IWWA 2G95A 2ZUSA 1W3JA 3CUJA 3NEVA 1MW2A 1XLBA 1RQBA 2FJUB 3TFXA 1ZB5A 3VTRA 6CGTA 4BS0A 3CQ0A 4PB5A 3VNMA 3VX1A 1KFBA 2DV0A 2P5NA 1FP9A 1XYFA 3DYPA 3H4WA 1Q2SA 3PHAA 3NQDA 2JEQA 4NNCA 1SW0A 4B16A 4WK9A 2V5DA 1E55A 8XIAA 1TWZA 4D6HA 2O55A 4WY0B 3GQYA 1OYBA 3GZAA 2G3MA 2DT1A 2GDVA 1ADOA 1JZ5A 1YKWA 5FESA 5K4XA 2FGLA 4AZCA 3PUEA 2D3NA 4GIRA 2X1RA 4AD2A 2QJIA 3CEPA 1UWIA 2WPGA 3T7VA 3AYTA 3Q45A 4V27A 1W9PA 2ZX8A 2VM8A 5EY5A 3PZIA 2OTDA 4QEEA 3AS2A 2V2CA 3VC5A 3EWYA 4PRRA 4QDMA 3ITCA 4B5UA 5U4NA 3FN9A 1NF0A 2OT0A 5FEWA 1YDOA 4MKNA 3RCNA 1TPUA 4F9DA 3IUIA 2VOTA 3MMUA 3WIJA 4CQBA 3GG7A 4IPIA 4GO8A 4A8LA 3AIRA 2F6UA 3OG2A 1Q65A 2J74A 4X22A 1FRBA 2MANA 4JX6A 5D2WA 3IIXA 1YPIA 3MJMA 4K39A 4DUXA 3AS0A 1UR2A 4CLMA 1NFPA 2VGIA 3DAQA 4JN6A 4A3RA 2C1HA 2CZFA 4PMZA 2VOMA 3OA5A 3I68A 4FNQA 5BZAA 2PWVA 2WKLA 1M6JA 1Q7ZA 1UQYA 3K13A 2PDXA 4JDBA 4R27A 3HG2A 4TMBA 3TCSA 1TYGA 3S1XA 1BYDA 2BHYA 3BCFA 5DT7A 2DZSA 2QJJA 3K4AA 1BWKA 7PTDA 5FKYA 3C6CA 4J3VA 4XZ9A 4YYCA 1V5XA 1XBYA 4P7QA 4HHHA 4EOUA 4AZ7A 4D1JA 1ENUA 1KD0A 5B7ZA 2ZZ5A 5CBJA 2VGBA 4F40A 4NJJA 3QV6A 1SJDA 3QW3A 1CLVA 4GGHA 4AC1X 1GW1A 4EE9A 2E6FA 4LF1A 3P8JA 3BZJA 3T2OA 3RRXA 4H9MA 4LQ1A 2VX6A 1V6VA 1B1YA 3OO2A 4HKPA 2PDGA 3RCMA 1LT7A 3G24A 1X1OA 2WW5A 3W7IA 3TYUA 3V1HA 4UOJA 1UWAA 2CZDA 4M24A 1B90A 2QULA 3URQA 2BG5A 5D4YA 2VFEA 5I3DA 1H60A 1DQUA 3GVQA 3T81A 5JBEA 2I57A 3VINA 2ACSA 4I8YA 1NWUA 3VABA 4D2JA 1YX1A 3W1AA 4IL2A 4PMYA 1CXKA 4C65A 3WBXA 1E6NA 4Q8PA 3RPMA 2C3ZA 4PL2A 2VFGA 2YCKX 4IJCA 1JPMA 4R33A 3LUTA 1X96A 3KTXA 4PB4A 1Q85A 1FX6A 2XZ7A 4P7NA 1E72M 4C6NA 3LZ3A 3MSRA 3KTSA 4OT7A 4HPNA 1RBAA 3ZLFA 3LBOA 1QTWA 4P61A 5DMNA 3S0CA 3SBFA 1A3XA 1A5CA 5T8GA 1EJUC 2VFFA 2FJKA 4E4PA 4L61A 1KM6A 2HNHA 2G97A 2REQA 4HYRA 5I24A 1ISYA 3R58A 4J2PA 3EA2A 4DAIA 3AJXA 2XIBA 4NZCA 3GXDA 3CQKA 2CLHA 3QKEA 4IP5A 1A5BA 4PEKA 5A8QA 1ZALA 4WJXA 4LUYA 2VRKA 1PYFA 3SECA 3GTNA 3NZGA 3KBVA 1CECA 4CEXC 3PNUA 1TIWA 1TMHA 5F7UA 3N4AA 3TJIA 1NP0A 2ZUTA 5XIMA 3Q65A 1KCLA 4P5UA 1E15A 3OPSA 3LQGA 2WB5A 4GY1A 1CB7B 1WPCA 1KW1A 2XFFA 4RV3A 4MJMA 2GJPA 4MNLA 4PTXA 3RJXA 5M03A 3W70A 2XM2A 4K68A 4ZO6A 4FR1A 3NG3A 3IEBA 3VD9A 5AYBA 2X1TA 1KR0A 5DY2A 4O0KA 3PANA 4ATLA 2HQAA 1PS9A 2VX7A 3H8AA 1O5KA 1VFUA 3WD2A 1L6FA 1GORA 3GS6A 3ITLA 3NYDA 5CJ5A 4LANA 1UH2A 2XWDA 1UD6A 2B7PA 1WUEA 1TUFA 4C6OA 1VQTA 3QJAA 5FSEC 4AMCA 1EWDA 1XGEA 3WX7A 3W29A 5EFDA 3C2YA 3ZJ7A 4GY7A 1X6UA 3FYOA 3U4AA 1YE6A 4RXFA 3CL8A 4WY0A 5IDIA 1OY0A 3DBNA 1DQWA 4IPPA 4PMJA 1KLZA 3PZVA 1OYCA 4R53A 5FEPA 2V5CA 2DUZA 3B9OA 4L64A 1V0MA 4K2SA 2Z7GA 1XIIA 4UC5A 4L1WA 1L2UA 5A69A 3U0HA 2V2HA 5C9RA 1E71M 1P4CA 1WKYA 3CS2A 3TH6A 2DVXA 3BJSA 1FWJC 3BWWA 3PWIA 4OHQA 5DRCA 1H7NA 4HU8A 4TUFA 3SRFA 1TTQA 2XVGA 4MWAC 1UOZA 3KL0A 3NIYA 4LX4A 3LV6A 3W1MA 3H21A 3ZVIA 4LU0A 1XV8A 4C90A 3LGDA 1H3GA 3QXBA 5FJTA 4D6EA 5CSYA 1XLJA 1AH0A 2G5WA 3A5FA 1O68A 4RE2A 1JAEA 2BGSA 3ELFA 4KWOA 2Z4GA 1L6WA 2FTWA 4HT3A 3S5NA 3BLEA 3M0IA 1N7KA 3LCWA 2YA2A 4MWAE 3G18A 4MFDA 1BFNA 4M8UA 4OOZA 3FHAA 5HWNA 5BU6A 4JKMA 1F2JA 4F2TA 1FWAC 3GDBA 4F8XA 2BXVA 2YYUA 3W6YA 4UTTA 1KGWA 3S1WA 1DIKA 3TC7A 3QR0A 1B3VA 2TAAA 3B9NA 2JF7A 2EKCA 1TJRA 3VVGA 1GEQA 1TX0A 4KGJA 1FDJA 3M6DA 4H7VA 4GNKB 3ONCA 1S1RA 4MB3A 4F0HA 2GLKA 4N4PA 2QR6A 4IFKB 1MO0A 3RCYA 4H6QA 3EMCA 4IICA 1ZTVA 4S3AA 3TX9A 3KBJA 1SJCA 1V0LA 3F4NA 4HCHA 2V5KA 3SQMA 4UWMA 2PU0A 1BWLA 2E9BA 4GYKA 2RDUA 4ICNA 2QCDA 2YXGA 7REQA 4WDWA 5LXEA 1F07A 3VK5A 2JKAA 2YBTA 1ZS2A 1K03A 5HATA 5FSDC 1CLKA 2AKMA 4BI6A 1G5AA 3L67A 1NWSA 4W8LA 2BOFX 1J01A 3K8LA 1CGVA 1ZZMA 3OIXA 3RN6A 1DWGM 4QG6A 4XBSA 3L0GA 4XZNX 4M5PA 3PULA 1EP3A 4EPKA 4NXSA 3BAXA 3R11A 1YNPA 3NVDA 3F2DA 4TTUA 3LSBA 3B8TA 4ZSUA 5C54A 3PBYA 1TRDA 2OJPA 1PVNA 1VCVA 4MLRA 2NWRA 4QISA 4O1DA 3WLIA 1C8XA 3QRHA 4K1WA 1E5NA 5A2BA 2DGAA 1IZJA 3STPA 3WLPA 4IP7A 1TX2A 1ITUA 4NASA 4Q7IA 1E9ZB 2Y70A 4CU8A 2CKRA 4ML9A 3O15A 3DI1A 2O9RA 4B91A 2Y7GA 3CPGA 3SQLA 5BYWA 3BW2A 4E3VA 5MKGA 4MUZA 4OWGA 3T2PA 3UPBA 4AZCB 3KWSA 1V0NA 2H9AA 3PBGA 4GUFA 3AXXA 1UWUA 1WXZA 3CLMA 4D6JA 3UZJA 5KITA 1IGWA 2F8QA 1RA0A 2VZVA 2XN2A 3JRKA 3SY5A 1VB9A 1RAKA 3HQOA 1W0MA 1XJBA 1HKIA 2ANUA 4ZQNA 3CO8A 4QM1A 3NZQA 4A29A 4PUUA 1NM9A 3B0XA 3WQ5A 2ZXBA 1FHUA 3W75A 3W85A 2CNCA 1JEZA 2VCAA 1RPXA 3OZPA 3SO7A 1GJPA 3FGCB 1Q6RA 4LUSB 3CIWA 3SSZA 3ONBA 3S5ZA 4RLIA 3AALA 4RJEA 3OLDA 4UMBA 3WF3A 3CTLA 4ONVA 2SFPA 1WDDA 1BF2A 3RU6A 3A4XA 3W00A 2OMAA 4MB4A 3UZ5A 3GDKA 1A0CA 3MPGA 4K38A 1H51A 3GD6A 4IMEA 1WZKA 3OBKA 1VC4A 3ZWSA 4MGGA 1XL9A 1KCXA 1MUMA 2J8TA 4HU3A 5HMEA 2PPGA 3SGGA 3WQOA 2ZFAA 1YNQA 1OC5A 4AZIA 5GJNA 2QUNA 3UVAA 1OCNA 1WDWA 2CBUA 3MZNA 4Y9MA 4ROQA 3UPMA 3EKLA 3NSMA 3WNPA 2AAMA 2DUXA 4TX6A 2XUCA 3ZR5A 3FW6A 1TR1A 3ALGA 4JTRA 1ALDA 4JTCA 3DYOA 1F3WA 5HUOA 4M6PA 2OODA 4JQ1A 3F5JA 1EQCA 1OC6A 2PRLA 3WEMA 5HPCA 2E8YA 1ZSXA 1BVZA 3K4WA 2WXDM 3WQ4A 4KS0A 1WQ5A 4HPHA 2ZRXA 4ZMGA 1DP0A 4INFA 3I3DA 3PZ9A 5HMFA 1UC5A 1P0BA 3WD3A 1XS2A 2HV5A 3G1YA 4XAYA 7ENLA 4ZOEA 2XWEA 4M7TA 5BWAA 1XIBA 5DMYA 3BPWA 2ZADA 4GJJA 2PTXA 4G6CA 4BCEA 3JW7A 3GXTA 1WOBA 2CXGA 3FJNA 5ABFA 1GOOA 2P0IA 2ZUMA 1OIMA 2FMOA 3GXIA 3KVLA 2FPTA 1QNVA 3GWQA 4J3SA 3TROA 1SQ7A 3ABSA 4PGLA 2NW0A 4G7FA 1R38A 2W9MA 1V08A 1TWIA 1OZMA 1QI3A 3T8QA 1TVPA 1XG4A 3A9BA 2OX4A 4QIUA 1VYRA 2O7QA 1YXCA 4G8TA 3WF0A 2FPYA 2WCGA 4RNHA 3GSMA 4UXDA 5C5YA 2EPLX 3OQ8A 2PDLA 1JDAA 4J4KA 3VKJA 1SMAA 4PBGA 3NO3A 3TTOA 1XPGA 3KL5A 3GXPA 2QCMA 2J8GA 2DQWA 2JKPA 2ZQ0A 3AMGA 1Q6FA 5I03A 1H11A 5HQEA 4E0CA 3TIMA 1JDDA 5A1AA 1Q7QA 4JX5A 3ARUA 5CJMA 1UIPA 3FOKA 3S6OA 1K7XA 4K36A 3QZEA 1HXJA 1LG2A 1UJQA 1JCTA 1Z44A 2DJXA 2Y7DA 5CH9A 4I9JA 1MZHA 3IJLA 1KM4A 3TR2A 1TV8A 1E1FA 3C0SA 4HNLA 4BI7A 4K7VA 1TTPA 2WVUA 1QI2A 4ERGA 1AD4A 4UFIA 1FWEC 1P1MA 1YTEA 4W88A 6XIAA 3N11A 3WNMA 3I4KA 4NU7A 4UCFA 4UMAA 1JPIA 3VKBA 5C71A 4MYAA 5A8GA 4PUKA 2AQOA 1VZWA 4YNGA 3PF3A 3MHFA 3QFWA 4DQWA 4LNYA 1VFTA 2GGJA 4CEUC 3C2VA 3NQ8A 3CUXA 1Q4NX 4NX5A 4QQ3A 4GOAA 1E73M 3S9IA 3NZ1A 1W3KA 1YADA 2BZNA 3EB3A 3WFLA 4WX2A 2Z1WA 1JDCA 4NZ1A 2J7GA 4Q32A 1RZMA 3V16A 2CZ5A 3S46A 3WL0A 4ADUA 4AMAA 6ALDA 4AB4A 3HJZA 4KETA 2OCZA 4AISA 3A6OA 3EZ4A 1BQGA 1JFHA 2ZC8A 4CNOA 1OX6A 3OLIA 1DJYA 2NLYA 2WHKA 2C13A 4BK9A 3H2FA 2O0TA 4LAKA 2Y5SA 5EPDA 3UWYA 4QEHA 4ZEPA 1SGJA 4B90A 5F2MA 1E4MM 2WHLA 5CSSA 3I6RA 4FEZA 3QGAC 1XIGA 5C9WA 3C5QA 3GNOA 3W7PA 2D23A 2ZX9A 1ZP4A 1J93A 1EIXA 2Y4SA 3KBNA 4IGMA 1YNYA 1TWSA 4E2DA 4L1XA 3NL5A 4OV4A 3QYSA 1YTDA 3DOPA 4AF0B 4UQEA 3L2LA 4N9DA 5A6KA 2ZX6A 1WKEA 4HYVA 3WBWA 4AD1A 3FIGA 4AZGA 3WG6A 2GJXA 3M7WA 4JTTA 3KS5A 4C6BA 1R3YA 1Z7AA 2DW6A 4KRZA 2ZBTA 5I0DA 4A35A 3M0YA 3UWQA 1S2TA 1GOIA 1DWHM 4XD4A 2JIEA 1YIXA 5A8NA 1A5AA 5CPQA 3TQ0A 3AS3A 1QT1A 4LY4A 3DU0A 4AWEA 2HXUA 2Q8XA 1BXNA 1BYCA 2A2IA 4GWEA 2I9EA 5G1TA 1OX4A 1K9EA 2V63A 1NOUA 4RZ6A 1T8QA 4WUIA 2WYSA 3QY6A 2A6NA 1XBVA 1V6WA 3DFTA 4MAZA 2WNQA 4PTNA 5D04C 3CH9A 2MNRA 1OFQA 4F0KA 3BAYA 3F7JA 3BSMA 3DFHA 1TV2A 3TZFA 1W3IA 7TAAA 3WEZA 1F3XA 3OQEA 2YXXA 3U5YA 3NOYA 3R0DA 3CMGA 5JUVA 4NIRA 4JNMA 1EH9A 2YKKA 3FA4A 4J3UA 3SUVA 2X40A 3AIWA 1F61A 3FGCA 3AXMA 2VELA 4CUCA 3TMQA 1XI3A 1N8WA 2C18A 3W4RA 3DBPA 4KCVA 3WBYA 5LHEA 1A4MA 1W1IE 2GGGA 1X8CA 1QNRA 2PGFA 1VH7A 3GU2A 3TQKA 2XG9A 2IKGA 4X63A 2GVJA 3BAIA 3N2TA 1CW2A 1FFRA 2YXOA 4JTFA 4LEFA 1BEUA 3NQCA 3T07A 3EEGA 2VC5A 2HVMA 2R6OA 4ZXOA 2BY0A 2YDAA 4LUTA 4LYQA 4IQJA 4HOXA 2INEA 3VIFA 4KRUA 1OABA 5LIUX 3BGGA 3KLLA 3G5EA 3KX6A 5AHFA 2QCNA 3G6LA 1EEPA 2XIMA 1W9DM 1DXIA 4Q4MA 3UCCA 4Y2WA 4QITA 1EXPA 5K9DA 3CBWA 2IXVA 5CBIA 2WZIA 1G4TA 4A21A 1K8YA 2PTZA 4MNJA 3GH5A 2C7FA 4GKLA 3PBVA 4HPXA 2NT1A 2C1GA 2WJFA 2R14A 3EDJA 3NQBA 4MUPA 1G6CA 4GKTA 3EDFA 4JFSA 4AYGA 2FHCA 2Y7FA 1BAGA 4KGLA 4HIBA 5HAOA 3T8LA 1RP8A 3B97A 4Y9PA 4CNTA 2DFAA 2AKZA 2ZYFA 3QSRA 3S9ZA 1PL9A 2WZHA 2PBGA 2QV5A 3GNRA 1C7TA 1SO5A 4MYXA 5CAKA 2V5JA 3W84A 3COTA 4H41A 1W91A 4LS2A 1FXQA 2ZZ2A 2PRHA 3V5FA 3LLXA 3SCOA 2YLAA 4NSBA 1PTAA 1TTIA 4A3UA 1QDSA 2OLSA 1NOWA 4JY8A 4HVXA 1QJWA 2P1FA 4GI4A 3WEOA 9XIAA 2WVVB 3AC0A 1OGSA 4NNBA 2ACRA 5FACA 4ZE4A 2DY3A 3E0LA 1ICPA 3LSCA 3QQWA 1CT5A 3WDQA 4F0MA 1OX5A 2X7WA 4NP7A 1DE5A 3MB9A 3R43A 3LB0A 2EBNA 4IIHA 4IFKA 2YCEA 3F2BA 1O1ZA 4JKKA 4E8DA 5EA9A 3B04A 4NRRA 4AD5A 1XGDA 4U28A 1UP3A 1VEPA 4NUWA 3AXIA 4CCDA 3MBFA 4O1CA 3QC3A 4QS5A 3QPYA 2QPSA 4I8DA 1IWPA 2QGYA 4I5RA 1CDGA 4C91A 1XLCA 4LBRA 3BDKA 3KOXA 3R94A 4GO9A 3VDHA 5IHSA 1LUCA 3M1ZA 4ZO9A 3OHMB 1W9BM 3QYQA 2VWTA 1S2WA 9XIMA 5AKQA 1HJVA 1O60A 3SEPA 3AUOA 1CGWA 3FYPA 2CHNA 2FZMA 2Z1KA 3TTQA 2AQWA 2ZA3A 4YTQA 1E43A 4LCSA 4ZTXA 2G50A 3I7RA 3CGTA 3M0JA 4NZFA 3SGUA 1T6MA 2OWWA 3CL6A 3P67A 3ZO9A 3VDCA 3BSGA 4HOZA 5DBTA 4JTDA 2DZBA 1HKWA 1TKKA 4R3UA 1G69A 2HTMA 3UG3A 4ZFMA 2V3EA 1J79A 2V3DA 1JQXA 2A1YA 1QI5A 3T9PA 9RUBA 2YZRA 3LXAA 3UJFA 4DPQA 4YPJA 3B8SA 5LNVA 4GXWA 2XIQA 5EGRA 2ZUUA 4KWSA 3QFEA 1G67A 2I16A 1TMQA 3HFYA 4HTBA 2CPUA 3CMFA 4C6IA 2A7PA 3G8RA 1JZ8A 3EB2A 2BP1A 3VGGA 1UP2A 2EPMX 4GVHA 4GQ0A 4JTJA 1LP6A 1VFLA 4WHBA 3NPXA 2ZVIA 2VKZG 4NHVA 1F7BA 4HNOA 1Q6OA 3VZYA 1O5QA 1QWGA 5KTLA 2YBVA 2YL9A 5CZSA 2XM1A 1GPWA 2ZE3A 1UR3M 3PPGA 2DP3A 3W7HA 3U5UA 1K8ZA 3TN5A 4S39A 4OBTA 2YFNA 3CL7A 3OB8A 3CM4A 2GPTA 2D2OA 2VC7A 4H19A 4TV5A 7XIMA 1SMDA 3G6MA 2ZXDA 4LC8A 1XLFA 5BOOA 1SVDA 4XD5A 3EGJA 3O1NA 4QJ5B 4FALA 3GG1A 4DJEC 2E0PA 5FJOA 3GHRA 3A21A 4AVFA 1H63A 3IUDA 2CLMA 2V69A 4XIMA 3H24A 1BRLA 2BVWA 3EOEA 1K77A 4GJ1A 1GOWA 4XK2A 4GQRA 3A3WA 2OELA 1YBQA 4Z2KA 1US2A 4KEUA 5C9ZA 2Z27A 2ISWA 1J0HA 3ZT7A 2QUMA 1RJQA 1KKOA 4NF7A 1LQAA 3MUIA 4AAJA 4GMEA 5HJLA 2G96A 1AQFA 2YX0A 3S2LA 5CAHA 1UD5A 1BRLB 2GJNA 4JZ5A 3AUJA 3M07A 3DCPA 1OIFA 2JEPA 4PH6A 3W7GA 1ME7A 1JUBA 3SY1A 4OV9A 3BQ5A 1ZRQA 1J0KA 1PCWA 3RX3A 1EUAA 5C0QA 1H49A 4B4FA 5JVLA 4H7ZA 2R82A 2DDXA 2EAWA 1XG3A 2WPBA 3ZXWA 1X6NA 4I5UA 5I79A 2HJPA 3B4UA 1UROA 3BGAA 5D9NA 2FMNA 1IEIA 3IIZA 2E6DA 3O2LA 2QCDB 1FVPA 3D3FA 4IG2A 3SCSA 1C93A 4U5KA 5FJUA 3ZJ8A 1HP5A 3DHUA 4UTHA 3DG6A 3AO0A 1C90A 3G1HA 3RX2A 1EF2A 2OZ8A 2EQDA 4MZ8A 3KCLA 4HNTA 4FR6A 1JIBA 2R91A 1FDYA 4Y9NA 2IQTA 2YOCA 4LRTA 3LYEA 5BW6A 1YDVA 2W92A 3WDJA 3HQPA 4LRSA 4O4WA 5E0KA 2UY3A 4L4MA 3TOYA 3R8RA 1AW1A 1CPUA 4R7WA 3NDOA 1PX8A 4UQAA 3S6DA 4GZIA 1EB3A 5F1VA 4LCQA 1Z89A 1I2RA 4AVOA 2TODA 4RUBA 5AFDA 3KDNA 1KBKA 3ZJKA 3VILA 2WJDA 1QBBA 1UZ4A 2E8ZA 2PWUA 1D3CA 1XX1A 6PTDA 1N2VA 1TQXA 2VDIA 2O4QA 1PV8A 4J27A 1UCWA 1DIDA 2O56A 4MB5A 3WUGA 2WMHA 1IQ8A 3PG8A 3TN6A 2W3ZA 1HN1A 1HJWA 2VD8A 2OSYA 1B3WA 2ZA2A 1BD0A 8XIMA 1EQPA 4E8CA 4M6UA 3VOHA 4NAEA 2E9LA 3SGZA 1QRQA 4FX8A 3EPNA 3RAOA 1L0PA 3GAKA 1N55A 3QLDA 4DB7A 4D6GA 3P0XA 2B31A 2CCRA 2C0HA 2Y8VA 1DL3A 2ZDRA 5AN7A 1IV8A 4C7DA 3I65A 1AH3A 5XINA 2OSXA 2PSNA 4D6IA 1XLDA 2VMFA 5BWFA 4H9YA 2GDQA 4X9YA 1ODZA 1R9ZA 3DGBA 4WKFA 3CHDA 3FV9A 1GOMA 1JCLA 2WLYA 4MG4A 3UQNA 1Q13A 1MI3A 2CW6A 3M0HA 1TV3A 3W1PA 1R8LA 2E1DA 4XB3A 1FWNA 1XBXA 4JHZA 1XRTA 4OIFA 1EJSC 3HIJA 3N9SA 4LYPA 1VFHA 7CGTA 3PJXA 3G77A 2JGYA 3VGDA 3GIYA 1V6YA 3K8KA 1P48A 5LIXX 3SSJA 2UZ9A 2GUBA 5T91A 3VDAA 3P5ZA 3B0UX 1KA9F 5HJYA 1BYBA 2PA6A 5D8ZA 2FGBA 1A53A 3TYAA 4HD5A 1AFSA 4MSSA 1XLMA 1AQMA 5FJPA 1SFJA 3WO8A 5LGZA 3SCRA 5A6BD 3KS6A 3RXZA 4JBRA 4GPNA 4XSLA 5C9XA 2YDRA 1YPXA 3N18A 1MFVA 3FSUA 4O11A 3PZOA 3LZ5A 3B0VC 3CAQA 1FKXA 3UNTA 3BMXA 1W2PA 2GOUA 2ZRYA 1O5RA 3UP8A 2W63A 3DHFA 3IJ9A 1KXQA 2ALRA 2D0GA 1S46A 1BVWA 3M5ZA 2I5GA 4WDTA 3C0LA 3RDKA 2WZTA 3O6AA 3VNZA 2V82A 5HUPA 3BE7A 2NX3A 3F4DA 4WY0F 3FXYA 4Q8OA 4QCEA 3ANUA 3IWPA 4WXZA 2YA0A 3BOLA 3WLNA 3PN8A 2J7CA 1W3LA 4S3JA 2GVYA 3GG8A 5CBBA 1PHWA 5LA0A 3W6LA 5D2TA 2CHRA 3A4WA 3HU7A 4M81A 3UGVA 3U2CA 3WMSA 5EYWA 4J3XA 4JIEA 1OC7A 1R87A 3SCNA 5FOOA 4S3EA 2ZE0A 3GDMA 1LF1A 4N7QA 1F6PA 3RNDA 1PKLA 5HMSA 5F4XA 2V81A 1FA2A 3OOQA 3QF0A 1VPQA 5A6AA 3N9KA 3WH6A 5ENLA 4DBUA 3LGEA 4XAGA 4YTUA 5I3KA 4GACA 2J62A 1V7AA 3HGRA 3WSUA 2UBPC 3F4CA 3LHUA 3C2RA 3GH4A 3CZ8A 1XSKA 4QSHA 4Z1CA 2TMDA 2DU2A 1GTEA 1JI2A 4HZ7A 3ZLHA 2X2GA 4DIAA 1CENA 3U9IA 1GHSA 1CIUA 2NZLA 3M6YA 2CETA 2HNEA 4QG9A 7REQB 2PDBA 1SM9A 1I45A 2ZZ4A 1E56A 1EYWA 2OYMA 3POHA 4G1KA 4DJDA 1U5VA 3EMZA 1KB3A 2DSKA 1NFBA 3TYZA 3MVTA 4UNIA 2WBGA 4AU0A 4UQBA 5HA7A 1A80A 4BKNA 3M43A 5EU9A 2C14A 4G1NA 2PDMA 4AEEA 3KCOA 3F5KA 3LPFA 1M68A 3GY1A 2ZXQA 1WOAA 1MQRA 1ZCCA 1J11A 1ZHAA 3OU8A 1HIZA 1QU4A 4O8RA 4GH1A 1WXYA 2J9YA 3AI0A 1ICSA 3CYJA 2VT0A 1W17A 1R2TA 2VC9A 3VIKA 5JQ9A 3H2OA 2PI6A 4EX4A 5F2GA 2Y88A 4GUIA 3L5MA 5CXPA 4FNSA 1OFBA 3Q58A 3GKFA 3PM6A 3PSWA 3IARA 3T2QA 2JQXA 3AMDA 1TPWA 1OF8A 2XPKA 5I3JA 5GNYA 1C8QA 1GHRA 3PB2A 1KQYA 3OZYA 3SY8A 1J0IA 3KOWA 4ATWA 1A0EA 2VXNA 5I2UA 1GOXA 4XKMA 2FZBA 1I6NA 1UHVA 1GCYA 4YVPA 1UMYA 1US3A 5E1QA 2EJ1A 3D0CA 3MO7A 5M1TA 1ONXA 1V8EA 4KFNA 4ADTA 1ZL1A 1OFEA 4JTIA 1HJXA 4YXGA 3L2MA 1IXOA 4IISA 4N6EA 4IPLA 1AZ2A 3RGTA 1TV4A 2X7VA 1PSCA 4EIVA 4NT0A 2Q3RA 3RF9A 1BHGA 2YIHA 1XD0A 3SCVA 1E4LA 1C92A 1P6WA 1K4HA 3C56A 4QLJA 5LYRA 2J75A 4LVDA 4H6EA 1NWRA 1PDZA 1VLIA 5HNUA 4RE4A 4YHGA 3Q4DA 1UB3A 4FXSA 4CNNA 3GK0A 3H4XA 3OHIA 2QPXA 1NQ6A 2Z24A 3AZSA 1ZQ5A 1MW1A 2I56A 1IT8A 3OIHA 4D72A 3KHDA 3TR9A 1VD6A 1POJA 1QNPA 3UVIA 5CLWA 1DE6A 2JALA 1HJQA 3N2MA 4JDYA 5FIPA 1EBGA 3BXWA 2ZRWA 5JXQA 4YCPA 3LLFA 2O9PA 4NILA 4JHOA 5E0CA 4UUIA 3SJ3A 1O4UA 3V75A 2INZA 3CMJA 3QOMA 1VPXA 1LBMA 3P84A 2DSVA 3T0CA 3QV7A 5A8MA 5K4ZA 1FCBA 4O1FA 4LFYA 1AQHA 2BOEX 3TYEA 4F0SA 3DZ1A 4AWTA 3NZRA 4PCSA 4NVTA 3U2ZA 3TMLA 5E70A 2CBJA 4E8GA 1LUCB 3M46A 2FZ8A 3HG3A 4H8VA 3JZEA 2WMJA 1XCFA 1XRFA 4GYJA 4IMCA 1BYAA 1KXTA 4IMAA 2ZZ3A 3LI0A 4JIRA 3W83A 5HR7A 2GQ8A 3C3UA 1SFTA 4HYWA 2W27A 1KM5A 3GE7A 2V67A 1A47A 3HG5A 4DY1A 3STGA 4HN4A 3DFYA 4MADA 1HF6A 4JYDA 2Y8UA 3IANA 1BKSA 1JCJA 3HQNA 3VD7A 2WVSA 2A7NA 2F38A 3LK6A 3D3AA 1XISA 3L4WA 3HPFA 3RM4A 3TCEA 3WLMA 4DF0A 1BTMA 1AODA 1PHQA 4Y8EA 3MCNA 1ELSA 3VNYA 2XYLA 3K2GA 2ZX7A 1Q6GA 4N9BA 3WD1A 2IKJA 4A05A 3CH0A 3CUFA 3HURA 1I2NA 4MPKA 1A5LC 3OGRA 1NSJA 1X1ZA 3RG6A 3IJQA 1XYMA 4YTTA 2V30A 1GOQA 1D3HA 3ARQA 1XKJA 1UASA 3CZEA 1AW2A 2OOGA 3MQTA 1T96A 2J88A 3T40A 3GFZA 3HGJA 1MFUA 2VFHA 1WZMA 3EX2A 4JN8A 3VZZA 1TWWA 2H8ZA 3F1QA 4W7VA 4IGHA 4K6AA 1VEMA 2G0WA 2XTKA 3UWZA 3B9EA 4AY1A 2WNNA 4ZOBA 4ZFCA 3L4VA 5CPNA 3UJEA 4N02A 4IFOA 3KRBA 1DKWA 4BA0A 2Q71A 1R3WA 2DSWA 4WR3A 3WNNA 1DIEA 3MU7A 1EYEA 1DJHA 1PWMA 2J79A 4L6DA 4GINA 3RHGA 2E28A 2WSYA 3PG9A 2FH6A 4K37A 2O9TA 4JIQA 1VBRA 3RU8X 4ZTYA 4W4QA 2VURA 4PMDA 1ME9A 1G7UA 2V9DA 1OGBA 1TREA 4RDWA 2NUWA 1MVYA 3VIMA 4UQDA 1XIEA 4P8WA 4LY8A 5FAGA 3THDA 1LDCA 2GSHA 4Z2HA 2PWHA 4CD5A 4M1RA 1NJJA 4AVNA 3ZR6A 4O4VA 4UIOA 3NNTA 4RL3A 1NDZA 2A0NA 5KZEA 1FH7A 4A22A 1TPDA 2VYOA 5LNUA 1YDNA 3EOSA 4BF7A 3B05A 3M0MA 1XWYA 1KM0A 1UA3A 1KGUA 2WMIA 1OD8A 1XYZA 2WVVA 1SW3A 2ZUNA 1OWQA 3LCXA 1Z41A 5AYXA 3OEXA 4PUWA 3LCGA 3BZGA 5G2HA 4TMCA 4GFSA 3BAWA 4AEFA 4GNJA 5DMLA 3WDIA 1UP0A 2PTWA 2GL5A 2IQ0A 1HO1A 5BCAA 2NWSA 1Q6LA 3NR0A 3ARXA 1VFSA 4O10A 1QAPA 4FXJA 1QATA 4NAFB 1DWAM 2PDIA 1F74A 4HB7A 4JIIX 1A49A 1EO5A 4ICCX 1XLAA 4NI3A 1BGGA 5CLTA 1XR2A 2OKTA 4PMNA 2Y24A 1UH4A 1RK6A 5M5DA 3UERA 4DF1A 2GDUA 1W5PA 2HK0A 3H4GA 4EP8C 3WJSA 4XX6A 4BEUA 2E5DA 3TP4A 1BXBA 4Q8QA 1EEXA 1DJWA 4XO6A 4GXMA 4M80A 2GQ9A 2PDUA 3DIPA 3B4YA 5HQMA 3E49A 5CGMA 2ZA1A 3AHYA 1J0JA 2XISA 4QGCA 1R9XA 3V0SA 3FJ4A 4QE1A 4C6KA 4H9XA 1U5JA 3ATZA 1PIFA 3VNJA 2AL2B 4HCDA 4IHCA 2VZOA 4IP4A 5TNVA 3FKRA 3K8MA 1RSCA 1ZAHA 2GWGA 5CQ1A 3IACA 2AGTA 3BLIA 1OT1A 2JIWA 3N6QA 3NYZA 4GCXA 4H04A 4H8NA 4DWSD 1E0WA 3DEQA 3LEPA 1K4GA 3W01A 3ALFA 4UTUA 3KZSA 5HWJA 4DBEA 4L9YA 1SZGA 5REQA 3PBMA 4MY9A 1TTJA 4LVBA 1LLOA 4UR8A 1K6AA 2PP1A 4V2XA 3WELA 1W5OA 3EB4A 1SSDA 3AHXA 3E2VA 4GYPA 5MF5A 4DYKA 1WBJA 2Y7EA 1QWKA 3FVDA 3MSYA 4YIWA 1UZDA 3WQEA 3I7QA 1VFOA 3NQ6A 1A5NC 4L4PA 3U7VA 1HKVA 3WY1A 1LRNA 4LXFA 5HULA 4GIEA 5FJJA 3ABQA 1NY1A 4UQCA 5AHIA 3ITYA 3H2EA 1GVEA 4GIAA 5HANA 2QJHA 1JFXA 1VFMA 3E9AA 1RXOB 4UTMA 3STEA 2CERA 4W93A 4IUOA 4PUDA 1PB0A 1YDYA 2CLFA 2GJXB 3PS7A 2Z1SA 3P62A 3GR4A 4ZR8A 5AHEA 5D8WA 3CWHA 3VPLA 2WBKA 1UUMA 1H7WA 4Q6XA 2WJEA 2HROA 1I0BA 1AW5A 1KQZA 3VFCA 3STFA 1CXFA 4R85A 1NVMA 2DIEA 2I7GA 1BVNP 3QGKC 3YPIA 1WE5A 5CGTA 2WK2A 1PAMA 4UTIA 2Y5EA 1DQXA 2QDEA 5I5RA 3ZSTA 2FKPA 3GC5A 3U4FA 1MRAA 1JZ7A 3TKFA 2YDQA 3GIPA 3GTXA 3CYVA 3THAA 2NQJA 4GQBA 4PCFA 3I10A 3IJ6A 3PB0A 1P0KA 3W1UA 5DQPA 3WBAA 2YL6A 4JQAA 2WNWA 3E96A 4AF0A 3N73A 4KEVA 4NX0A 3PTDA 2ZIDA 4H9TA 1VHNA 4H83A 4LYRA 2XJ7A 1S3TC 3V0TA 3NPVA 3N2OA 1FKWA 4V28A 3IS4A 3CUIA 1J4EA 5DF0A 3QY7A 4WLCA 3FDKA 1OFPA 2I14A 2PDNA 3IRDA 3UWEA 4XSMA 2BNJA 2HS6A 3AWOA 3S2NA 5IHRA 3RO6A 1YBQB 2BFGA 4X2PA 5HPOA 4HGXA 3HPAA 2ZRZA 3AMCA 4L9XA 1EJXC 2E7FA 5K7JA 4I9TA 3S3GA 2Y1HA 1DEDA 1W1YA 5EB8A 1L8PA 3M5XA 4P7LA 3W38A 1GKRA 3A23A 4PODA 2OSWA 3P81A 3WLKX 1L9WA 2QCLA 2XVLA 5F4WA 1HQTA 1QASA 3V7PA 2XZ9A 4Z1YA 1HT6A 1EUNA 3H26A 1HZYA 1ECEA 1U22A 1ZJHA 2OT1A 1C91A 4PMQA 1KFCA 4PTWA 1R9YA 3FHQA 3GXFA 3UJSA 1NARA 5LGXA 1UWQA 3H55A 3GVRA 1EX1A 2D22A 1Y7VA 2EPHA 3MSGA 6REQB 5EL1A 4RXGA 4WDXA 4EWND 1S5WA 4C1KA 3IJDA 3UZZA 4XUGA 4M56A 3VOIA 4ZQPA 3NCOA 4JYEA 3PTKA 3GW3A 1HG3A 3G1VA 4ZE5A 2BMBA 3GRIA 4XZWA 2PDJA 5I02A 1NAL1 1EX5A 1XUZA 4MKVA 4FF7A 4IOTA 2UV8G 4O18A 4TOQA 2Z25A 3W2JA 2F6XA 2HE8A 1CXHA 3GTFA 1X7IA 4ROPA 3VNKA 1EJVC 1IEWA 3NSNA 1JUKA 2I5QA 1D2KA 1YMYA 3TN4A 4GLEA 4YVXA 1S3HA 3BL3A 3UY8A 1UR1A 4KWWA 1XICA 1JPDX 1QUMA 1UR9A 4W9TA 1EZ2A 7ODCA 3D6NA 4KEZA 2QCGA 1H7XA 3U57A 4FF5A 2J24A 4EXBA 2RGMA 5CGQA 1UC4A 1K02A 3W3OA 1WB0A 3WH5A 3W81A 3I6TA 2IKIA 3H70A 4ZVJA 1TJ1A 4AW7A 1U1HA 2Y63A 3W25A 1SR0A 3I4EA 5LIKX 3SUTA 1JZ6A 4ZGYA 2J47A 2QEZA 3VXGA 3SM0A 5HOSA 2A21A 1RHCA 5KZMA 4DJDC 3DYMA 4IM4A 4NYYA 4QTGA 3BLFA 3O0FA 1XQLA 3WK3A 2PODA 1B0IA 1RQEA 4MKSA 1AUSL 4HZ6A 1OADA 4H1ZA 4GXPA 4TVCA 1UPMB 3WK1A 5AECA 4S3FA 4Y9OA 4ERAA 1HP4A 2X8RA 1B57A 3EOUA 5LXXA 3PUGA 3ZSSA 3CK5A 1I2QA 4D8ZA 4LH8A 2Z00A 1DXEA 3P0WA 1GVSA 3WLRA 3I7SA 4GG9A 3TNOA 4GE8A 4OOUA 4DZIA 1DJXA 2DT3A 4HK5A 3B9DA 1BKHA 4L7ZA 2CZEA 3CAVA 1W1TA 2HPIA 4KCWA 4US6A 3T4CA 4IMFA 3EX1A 1DV7A 6TIMA 1I1XA 3DESA 1THFD 5A3HA 1UR0A 3TA9A 5CC3A 2H8XA 2V8ZA 3NL6A 3TZNA 4QAWA 1PZ1A 3BG5A 4Q4RA 4EWJA 1FQ0A 1JD9A 2WQDA 3AIQA 1KCZA 4D71A 4JCLA 4KWVA 4L1GA 1D8CA 3I3BA 4M3PA 3QEZA 3BLKA 3UF9A 3WKZA 3LTPA 1JI1A 3NVTA 2X30A 3N19B 3C61A 2P53A 2P8BA 3WK2A 4WSHA 3WL1A 4BHYA 3E0WA 1CI1A 3BANA 1QO5A 4MOZA 4FIQA 4DN1A 1LQ0A 2HBVA 4C6MA 3ES8A 3M47A 1EGZA 1V77A 3M0ZA 2PTYA 3TWAA 3WDPP 3FJ6A 4XV0A 3E2SA 4ALDA 1Q6QA 4E2VA 4XISA 1J2WA 3PY2A 3WFZA 4ZZ9A 3OVPA 3MI3A 4X2RA 2ISVA 1OF6A 5KMYA 1BGAA 1R46A 5FJRA 5D9OA 1GVRA 2NUYA 1E4IA 4XG1A 3NDYA 4CN1A 2F2KA 3MUY1 3TSBA 1RY0A 3CO4A 4GH3A 4UFLA 5EMYA 4DVOA 4CD8A 4NJKA 4PSPA 1RJRA 4EPDC 4AEOA 4GI6A 5B7YA 5BXSA 1E9LA 2BTMA 4HU4A 1H7OA 3O3RA 2OWCA 4WF7A 4UTFA 4K8GA 1VS1A 1R3TA 4JCMA 1Q6DA 5I23A 5AVNA 3KRSA 1E70M 4Q4QA 1WZAA 4URIA 2PGWA 1UR4A 1NIUA 4DWSB 3EXRA 2Y6ZA 2EGZA 3VFLA 4YL2A 2IKHA 2PBOA 1UR8A 1VKFA 2PZNA 3PPFA 3HGSA 1IR2A 3KOFA 4TR9A 2GGIA 5FCZA 3KHJA 1KM1A 3T0BA 4RNIA 4JQ4A 3LCFA 1SU5A 1SFLA 3MT1A 4DRSA 4O16A 1K70A 3KZPA 3WNLA 4AX7A 3MKKA 2JGQA 4W7UA 4PTDA 2FB3A 1Q63A 5F2LA 1LBLA 2WO5A 2DVTA 1HL8A 2YSWA 5AC7A 3AU6A 3RM9A 2R1NA 3CTTA 3WENA 3TU9A 2WV8A 4JFTA 4CNPA 2AL1A 3R25A 4Z1BA 2MUCA 1WO2A 2ZKMX 4ZA0A 1ZBCA 1FHLA 4IPNB 2OO6A 3THQA 4P2VA 3TAKA 5LIWX 1IT0A 2OQLA 3SZ8A 3QKZA 5XIAA 4OU1A 3VIGA 2O92A 3ICJA 4B2DD 4NYUA 4GQGA 5CC7A 4B4HA 4YTRA 4HA3A 3P60A 2Z1BA 2A3HA 3KUMA 4B5NA 4O1BA 4FNPA 5JH2A 2J7FA 1A0DA 3W6MA 3CUZA 1D3GA 1SJAA 4ZL1A 1A5KC 4W5ZA 1GONA 3ZM8A 4Z2IA 3GNDA 5RUBA 2RKXA 4A2SA 3ZT6A 1BWVA 2WC4A 2VO5A 1B3OA 4A8IA 1Z8AA 4Y7EA 4GYFA 1XBZA 5LNWA 3NJ3A 1H0GA 3TLLA 1X97A 1RA5A 3LRMA 3AOFA 2B7NA 2HPMA 1RVKA 2QIWA 1BSIA 4HOWA 3WH8A 3E12A 4RPQA 3T44A 3N29A 1LCOA 1VYPX 2KZHA 4S3DA 3URAA 1EHNA 1V6XA 1US0A 3ABXA 5H91A 2PCEA 1EA9C 5HNNA 3E0IA 3RJYA 5DCEA 1JDFA 1HL2A 2ICSA 2FPVA 1LL7A 2EKGA 3A9IA 5JIPA 5LA1A 1DWFM 5I77A 1FTXA 5E6ZA 3SW6A 1QNOA 2YBUA 2QAFA 3H7VA 4NY2A 3V5OA 1KLYA 3O6CA 3CQJA 1EFZA 1EPVA 3SIMA 4CD6A 1JCYA 3P3BA 4UOZA 3Q94A 4LCRA 4KT2A 5A94A 4WKHA 2NVCA 4P7RA 3ABOA 2J25A 2ATSA 3ERPA 1G4SA 3ARTA 3N17A 4FO4A 1AL8A 3SN4A 3EAUA 3O9NA 5A2AA 5E9AA 1KV5A 1RUSA 3CT7A 3LU2A 3NQEA 1XGZA 1W8GA 1GZJA 2HDJA 4U10A 3VMNA 2ZUVA 5I7GA 3V1PA 4NRSA 1J2BA 2Z7KA 3ARYA 4UZSA 4BY3A 2ALDA 4QJ1A 4Z2GA 4LALA 3RM8A 4D6FA 3FFSA 1MWOA 1ZJIA 2ZCGA 3WH7A 5C2CA 3VD5A 2J78A 2DW7A 3ARRA 4UBPC 1OCBA 6A3HA 4XKYB 3M0KA 4JNYA 2J8FA 4H9ZA 2GUUA 1EOKA 1UZHA 2ZICA 4DXKA 2DEPA 4NZJA 1JNDA 1W6TA 1JF6A 2YW4A 3UU0A 3AXKA 3N3TA 4HA1A 4N42A 3T55A 1H61A 1XXXA 4LWWA 8TIMA 2Y2WA 1P0NA 3N25A 1VBHA 2DZXA 3K46A 1KBJA 3H23A 3LCLA 3N12A 1T7LA 1E6PA 4QE5A 1AMKA 1BQCA 3O7UA 5KETA 4ZODA 3PTMA 1BF6A 2PDCA 3GLCA 2ZTJA 4CVWA 2NUXA 4J5NA 2CKSA 1QK0A 2RJHA 3MCOA 1R7AA 3TTEA 4GC3A 1VBUA 3QV9A 4P8VA 2WC7A 1QCWA 3MUAA 4BF5A 2EF9A 1IE7C 1S38A 4QX4A 2ABAA 2BDQA 3B8WA 2DT0A 2FGZA 3QC0A 4M6QA 3BG9A 3KP0A 4YTSA 3LV5A 4IMGA 1HVXA 1OZQA 2Q09A 3KAOA 4HSHA 4Q22A 4IXHA 2XIOA 3S47A 1XDMA 3GB6A 2J6VA 3MWAA 2OKOA 3A3XA 1E1CB 1XCXA 5A6BA 3OBEA 2B7OA 1E6RA 2WZEA 5BRBA 5FF4A 3A64A 5U7SA 1XH1A 4J35A 5K9XA 1XLHA 1NFGA 4O57A 3PK7A 4MMWA 5H8MA 2ZUWA 4J1OA 2C71A 3WLLA 3FYYA 1JGIA 2OO0A 5CPMA 5A6TC 3UYCA 3N2CA 4OECA 5I6SA 3D47A 1CBGA 1XQKA 3GM8A 4LVAA 1TSIA 2QGHA 3AIVA 2W61A 2OX1A 3G2GA 4B3KA 1U33A 2TRSA 1REQA