3CUFA

Cellulomonas fimi xylanase/cellulase cex (cf xyn10a) in complex with cellobiose-like isofagomine
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
314
structure length
314
Chain Sequence
ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAFGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the binding sites of Family 10 and 11 Xylanases with extended Oligosaccharides
rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
molecule keywords Exo-beta-1,4-glucanase
total genus 132
structure length 314
sequence length 314
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cufA00
1J0HA 3CMJA 4UQEA 2DQXA 4J3SA 5I3DA 1QNSA 4JFTA 5LA0A 2DT2A 4WSKA 1VF8A 1IZKA 4JL1A 4PN2A 2VQUA 4JCLA 1EO7A 2DSWA 3WMSA 3MMWA 3VDHA 4RE4A 1E72M 2CYGA 1H11A 1J01A 1V0LA 1C93A 1XYFA 1GZJA 1KQYA 3EYPA 4M82A 1WZLA 3O2LA 1JXJA 1KXVA 5I79A 1W1PA 1D2KA 2YLAA 4HOWA 4M1RA 4PCSA 2VJXA 5A8NA 1AQ0A 3VD3A 1JNEA 1JDAA 3W37A 1LQ0A 1MQRA 5D8WA 1JNDA 1NWTA 2XM2A 3WNKA 3W24A 2PWHA 2JIWA 1JG9A 2ZE0A 3ARUA 3CUJA 4JFWA 4NI3A 3RJYA 1JZ8A 1E1EA 2PF0A 4MPKA 3WD3A 1SR0A 2WW5A 4UQDA 1UH2A 1D7FA 1PIGA 3ZOAA 5CQ1A 2WMIA 1MVYA 1AQHA 1ITXA 4CCEA 2QV4A 5CZKA 2YA0A 1EO5A 1H4PA 3TA9A 5DT5A 4F9DA 3ZM8A 3BMVA 1GHRA 2Y2WA 3RO8A 3VIJA 1C8QA 3VGEA 2XVLA 1E71M 1M53A 2V3FA 4BQ4A 4M24A 1EDTA 2WLYA 5FCZA 1UKSA 4HPGA 3WH7A 2VC9A 4HPHA 1ISWA 1ZJAA 4JZ5A 4MNKA 3UG4A 4TX8A 1UUQA 1E55A 3MMDA 1E6ZA 1B1YA 3WDPP 3GXIA 2NW0A 3PZTA 3PZMA 5ABGA 5A95A 1CXLA 3CHEA 3T2QA 5CGMA 4MTVA 3POCA 3ZSSA 4AZHA 4AMCA 3WNNA 4YN5A 5I24A 5JBDA 1UR9A 3WEZA 5A6LA 3L4VA 2VR4A 2VX5A 1V3MA 3VNYA 1TFVA 4HA3A 3ECQA 1LLOA 4KGLA 1UH3A 4UFKA 2WBKA 8CGTA 4BQ3A 1IZJA 1QVBA 3W6LA 3ARXA 3GNRA 3DECA 1QI4A 2Y8VA 4S3JA 4ZEPA 1V3IA 2YDSA 3AMKA 1LL6A 2QPUA 4CD5A 3RCNA 3GZAA 3NCOA 2WPGA 1GW1A 5FOOA 4U33A 4B15A 1OT1A 2QF8A 3CUGA 4H04A 1XC6A 3N13A 3FXYA 3WSUA 2D0HA 2EPNA 1ZJBA 2VVSA 3VMPA 1GQKA 5IDIA 5IHRA 5I6SA 2DPEA 2D3NA 1UR8A 1FFQA 1WZKA 3TONA 3ZMRA 3VD5A 4AIEA 2VTFA 2C7FA 3VILA 3MMUA 1MWOA 3CUHA 4QCEA 3GYCA 1MW2A 1OD0A 2RGMA 4URIA 5D4YA 2D22A 4AZ5A 4PTWA 1H49A 4JL2A 3EMQA 5EFFA 3WF2A 4D71A 1TVNA 3OGRA 3BCFA 3CUIA 3VIMA 3APGA 1CIUA 3BSHA 4HMDA 5HDRA 2VI0A 4QP0A 2J78A 5D9NA 3OZOA 2WHLA 1G5AA 4JKMA 3SCSA 1GUVA 1W3LA 1CDGA 1BF2A 1CXHA 2XHYA 3M7SA 4JKLA 1NQ6A 4GI8A 3WH5A 2CESA 3RILA 3GNPA 1JDCA 4HU8A 4PBGA 4UQBA 1JF6A 4D6JA 2VX4A 2XVKA 1UD3A 2XYLA 2ZX9A 4U31A 2J7GA 3MUIA 3JUGA 4XV0A 3WD0A 1I1WA 4NF7A 2CEQA 2XGIA 1XV8A 2FGLA 3T2PA 1WDPA 4R5EA 1ZBKA 1AVAA 2YL9A 3L4UA 4K68A 1KQZA 4AISA 1PPIA 5D9OA 1JZ6A 2CHOA 2WWDA 5M03A 4XUYA 1MFUA 4CN4A 8A3HA 3ZT5A 1CXEA 2UWFA 3MUAA 1E4NA 4W8BA 4JFVA 2YA2A 5A1AA 1CGVA 4W8AA 1HVXA 1HKMA 1B3WA 4S3KA 4MJ4A 4EE9A 3IJ8A 4QFUA 5EBAA 1VRXA 4LX4A 2ZX5A 1G94A 3WFZA 1W1YA 1EXPA 4N0RA 4HOZA 1DEDA 4AXNA 1RP9A 4UTFA 3U7VA 2BFGA 3W6MA 2TAAA 5CG0A 1HF6A 4CU8A 3GH4A 3TOPA 1BFNA 1E56A 4LYQA 5BRPA 1HIZA 2BNJA 3L4XA 3UERA 3IK2A 3MSDA 1QNQA 4GQRA 3M6DA 2JEPA 3SUWA 1D3CA 1VBRA 1V02E 4KH2A 1CTNA 1YHTA 3SEPA 3K8KA 1NP0A 3VIIA 4W5ZA 5E9AA 3MV11 4OIFA 1SMDA 2J8GA 1KFWA 4MB5A 4CU6A 5TD4A 3PZGA 1EOKA 3VUPA 4HA1A 3SIMA 2VL4A 1EH9A 4XZBA 3I3EA 2BY2A 5KEZA 2XM1A 3F4VA 3D3AA 2F8QA 3UG5A 3O6AA 4MB4A 1VFFA 2J74A 2PBGA 3ARVA 4R27A 7TAAA 1C7SA 1BVNP 2BS9A 3S6TA 2X2YA 4MAZA 1QNRA 3GH5A 3OG2A 3AHYA 2DEPA 1JAKA 3AIVA 2WVVA 3N11A 3NIYA 4E2OA 4CKQA 3W4RA 1V0KA 3VIPA 3AFBA 4PMYA 1XD1A 1WDRA 3AS3A 4UFMA 4OJYA 3WL0A 2ESCA 1HJVA 2Y5EA 2WKGA 5AYBA 4MAVA 3FHQA 4M29A 3BLPX 5ECUA 4GZJA 4P7NA 2J7EA 5EMYA 2DGAA 4L4PA 1WNOA 4U2ZA 1Q6CA 4D6FA 4LYPA 3WNLA 2J7HA 4AD4A 4PUDA 2WNWA 1GNXA 4HZ7A 3WDQA 4AZGA 3AMDA 1XRVA 1XCXA 1KXTA 4ZXOA 1BYAA 2XWEA 1YQ2A 3AS2A 2CBJA 3NSMA 3MSGA 1LL4A 5HNNA 4BA0A 2XGBA 2CETA 1WZMA 1OGGA 2W92A 3OLIA 3CTTA 2PWEA 2WCAA 1PEZA 1DWAM 3K46A 4PTVA 4GZEA 4WLCA 3WY1A 1BG4A 1KBKA 2YDRA 3PTKA 2BY1A 2VNCA 1ISVA 1TA3B 4RE2A 1EDQA 5EB8A 3T0DA 1KR1A 5BWFA 1J18A 1UWTA 3PZUA 3KL5A 1E70M 1GVIA 1ISZA 4Q7NA 4PSPA 3FAXA 4AD2A 5E70A 1L8NA 4CD6A 4KWUA 4GZIA 5LA2A 1OD8A 3WNPA 4LGXA 1E43A 1W3HA 1PJ9A 2CHNA 3N12A 4F66A 1E4MM 3EDFA 4RE3A 4WKAA 3K4AA 3VOCA 2WK2A 3G6LA 3ZJ6A 1OBAA 2WC4A 2CBIA 3WD2A 2BV9A 1JFHA 1Z32X 3AIBA 5DT7A 4W93A 4CD8A 3AZTA 3M07A 2RGLA 4GQQA 2VZUA 2XVGA 1HJUA 1HP5A 1WB0A 5A8MA 2YDQA 1BAGA 4W89A 4EANA 2PWGA 3IANA 2VO5A 3CO4A 4P8UA 4BZYA 2WC3A 1LWHA 5GPRA 1BPLB 1KWGA 1B3XA 1FHDA 1ZL1A 2PBOA 5HPCA 4H8VA 4UOQA 2VRKA 1PZ3A 2Y4SA 4GI6A 3A4AA 2IUZA 1W2PA 4AEFA 1X6LA 2G3MA 2QMKA 3BMWA 4WIWA 2G3JA 2ZUNA 2WWCA 1JD7A 5CJ5A 1QHOA 3WELA 2EEXA 3WQ5A 9CGTA 1ITCA 4D1JA 1GOQA 2YBTA 4Z2LA 1J0ZA 4IPNB 3TTOA 2X0HA 1UD6A 4F8XA 1SYTA 5I23A 3WL1A 2WZIA 3VIGA 1JL8A 4TXEA 5CSUA 4C7DA 3UR8A 1X1NA 1UKOA 3AZRA 4B9YA 4NRRA 3CGTA 4XX6A 4Z2JA 3AMGA 1W1VA 3AIWA 1R8LA 2WLZA 4M8UA 1FP9A 2DIEA 1VEMA 5E6ZA 2J7CA 3WMBA 1WAWA 1GVYA 5E6YA 4AIUA 5A69A 1NARA 1K9TA 4CVUA 3CBWA 2D0GA 1B3YA 4GI9A 3VD4A 1V3JA 1DP0A 1UG6A 2YL6A 1XYZA 3SCTA 2J77A 2WB5A 2PWDA 5A2CA 3L2MA 3AISA 4PSRA 6A3HA 1FH7A 1J12A 2WAGA 3CPUA 4IISA 4CVWA 4EK7A 1UWRA 5JBEA 4MNMA 3SUTA 1W1TA 1AQMA 5GNYA 2V5DA 5C8BB 2ZXAA 2OLHA 1ECEA 4ZE4A 4UQCA 4DUXA 4Z2KA 1FP8A 4GPNA 4W7VA 4WKHA 2J7DA 1B2YA 2E40A 1EQPA 1VFUA 3PZVA 3SURA 1DWHM 1V0NA 3EBVA 1CLXA 1CECA 5BROA 4HU0A 2VCAA 1ODZA 1GORA 2WBGA 1RPKA 2Y8KA 1MW3A 4W87A 3ZJ7A 1EOMA 2BXZA 2OSXA 2ZWZA 1UR4A 5I5RA 3WUBA 1VJSA 4PCTA 4MDOA 1UR0A 3W53A 1HKJA 4U3AA 3PZOA 1BGGA 3PBGA 4W7WA 1V6XA 1Q6EA 5A6AA 4J28A 1XSJA 4WF7A 3VINA 3BC9A 5BXPA 3THCA 2VCBA 1H3GA 3ALFA 2G4FA 1XH1A 3FW6A 1WP6A 2E3ZA 3AXIA 2X8RA 3K8MA 1TMQA 3ZSTA 4AYSA 1JXKA 1QOXA 3EDKA 3HJEA 1K6AA 5A8QA 3A6OA 1JGIA 1OGSA 3U57A 4AW7A 1WPCA 4D6GA 2O92A 3SUVA 1UYQA 1FOBA 2FH8A 1BYDA 3GM8A 4M56A 1H0GA 4H8UA 4KRUA 3RIKA 3IJ7A 2FHCA 4EAMA 4FLRA 3CHFA 3U5YA 2AMGA 4BF7A 1J0KA 3BLKA 1KCLA 3FN9A 2OWCA 2WMGA 3AMLA 2V3EA 1O6IA 3AYSA 3RJXA 2O9TA 2VOTA 3FY1A 2EXOA 3HMCA 1QW9A 1ZBVA 1JDDA 2ZICA 3WF1A 5A6BD 1NH6A 4OOUA 1OCQA 3KWXA 2BXYA 4B3LA 1V3KA 3AS1A 2D0FA 5A8PA 3B9DA 1KWKA 3OB8A 1V3HA 3ARZA 4H2CA 5BXTA 4QLKA 1C90A 2VVNA 2E4TA 1XD0A 1UR1A 1JAEA 1VJZA 2EBNA 3CZGA 4GO8A 3MU7A 3VX0A 1EHNA 3RM4A 4MDPA 4ACYA 1SMAA 3W82A 4U5KA 1C3FA 3ZT6A 1MQQA 3K8LA 1QI5A 1ODUA 1Q6GA 3OIHA 1ESWA 2YL8A 5JIPA 1QI3A 2DH2A 3J7HA 4LYRA 4HZ8A 1M01A 4J3WA 1UKQA 2ZX6A 2WMHA 2J7BA 2GFTA 1GOOA 4PMRA 3VGFA 3CLWA 2WHKA 2E9BA 1UZ4A 3AYRA 4UOZA 3WD4A 3VVGA 3EDJA 4BQ5A 2FGZA 3CZKA 3WDRA 2J75A 3PZNA 1J0IA 3BAXA 3ZR6A 3AIUA 3S2CA 2ZX8A 4MNJA 1CXFA 1VEOA 3TP4A 1BYCA 1G01A 4MB1A 3SCWA 2OWXA 4CN1A 4J3UA 5HOSA 1GQIA 1HKKA 3NDZA 3AIEA 3KZSA 1DHKA 4WKFA 4PMOA 2XFYA 1FH8A 2FDMA 3HN3A 4UFIA 1CEOA 2GJPA 3DYOA 4W8LA 2YJQA 1H5VA 5FD0A 1FA2A 4GKLA 5CPQA 1FFRA 1ZBWA 4L4OA 3VIHA 4QLLA 5A8OA 2EPLX 1EDGA 2WVUA 4JAWA 4HP5A 4GINA 4W84A 4GIAA 4FMVA 1E5JA 4J3XA 4C7FA 3W26A 4CN6A 3WQWA 4D6IA 4AZCA 2NT1A 3ARWA 2Z1SA 5CPSA 2WANA 3EMZA 4BQ2A 1BG9A 1LF1A 1QI0A 1W9UA 1E9LA 2WZHA 4TX6A 4AD3A 2YOCA 2W5FA 4J3VA 3BAKA 4Y7EA 3FNDA 1OM0A 1E40A 2G3IA 4P7QA 4BCEA 1EHAA 2JE8A 4HTYA 6CGTA 1V6VA 1UD4A 2WHJA 3GBDA 5IHSA 1KB3A 7A3HA 2D23A 4PTMA 3WF0A 3VIKA 1CBGA 2EPOA 3WH8A 1CYGA 2XVNA 1PIFA 3AIQA 3ZQ9A 2W62A 4IM4A 1FH9A 1HL9A 2EPMX 2WKLA 2CITA 3WQ8A 3T0BA 3VNZA 1VFMA 2VCCA 1EGZA 2E0PA 3L4TA 3PZ9A 3OGSA 1OGBA 1K9DA 2WMIB 4IPLA 1CENA 3WF4A 2A3BA 1UWSA 1QPKA 3BH4A 3VIFA 1IV8A 1UZ1A 4B9ZA 2F61A 1VIWA 5D9PA 3SCOA 2WM0A 4JHOA 1JZ4A 4PMZA 1XGZA 2W63A 1E6NA 5E0FA 1HT6A 4ATWA 2FHBA 1ZBCA 2XVPA 3BGAA 1JZ2A 3CZEA 2D24A 4BS0A 1OINA 4UFJA 4YHGA 1UR2A 1UOKA 2UY2A 1Q4NX 5E0CA 1Q6DA 1H1NA 2DDXA 1MFVA 3UCQA 1JYVA 3N15A 3CIVA 1UQZA 4UR9A 3WEOA 3ZIZA 3TTYA 1UKPA 1E5NA 1NOWA 5I78A 4TTGA 3K1DA 3I3DA 2JEQA 5DFAA 5FL0A 1US3A 4LXFA 5ABEA 1JD9A 3CZLA 5GNXA 4JFUA 4F9JA 4UCFA 4P7OA 3WD1A 3SUUA 4OBRA 1UQYA 1QI2A 3VMOA 3AMCA 2HISA 3WUFA 2PWFA 1EA9C 2J62A 1GOWA 1B0IA 3OLEA 1KCKA 4DWSC 1U33A 3GXMA 3WQ6A 1M7XA 5I77A 4TVDA 1QHPA 1US2A 1XSIA 1WKYA 4QCFA 3VU2A 4B16A 2WXDM 1NWUA 2W66A 3AHVA 3OZPA 2WSKA 4HMCA 4AD5A 2XG9A 2FH6A 3UR7A 4DM2A 1G9HA 3LPPA 3LPGA 1H09A 5A2AA 1HJQA 3WEMA 2NT0A 3KL0A 2PC8A 1UKTA 4OZOA 1KXHA 4EKJA 5BXRA 1GHSA 3WNMA 1E6RA 1G0CA 2UY5A 3GDBA 1TUXA 5HPOA 4P8XA 2X1IA 2XJ7A 1NOFA 3G6MA 1QBBA 5DO8A 1KXQA 3B9EA 4UNIA 4ATLA 2BY0A 1W2VA 3POHA 4UZUA 1CPUA 5CLWA 2XTKA 2QPSA 1B9ZA 3SCPA 3FHAA 1EQCA 4NRSA 4Q22A 3VM5A 2WCGA 4KGJA 5LA1A 1E6SM 3IJ9A 3NSXA 3AHXA 2ZUTA 3A3HA 3GNOA 2XSAA 4ACZB 2GK1B 3AHTA 2Q8XA 3GXFA 4UFHA 1CWYA 3AJ7A 3OGVA 2G41A 1PX8A 3UETA 2EPKX 1ISYA 4YHEA 4DWSD 1TCMA 2VZVA 1UD2A 1E0XA 2CXGA 3WQVA 1GOKA 1CZ1A 3E1F1 2CIPA 1LG1A 2ZUVA 1MYRA 2X09A 2XFFA 3N9KA 1MXDA 2D20A 2DSZA 4UZSA 1W9VA 4CUCA 2QLYA 3AZSA 1LWJA 1UWIA 2BVYA 4AEEA 1H2JA 1MW0A 1WZAA 5CSYA 4X0VA 5A6SA 4M80A 1OT2A 2OWWA 1B3VA 1BHGA 3NYDA 3OLGA 5ABFB 3L4WA 1TR1A 2E9MA 2DT0A 2OYMA 4XZWA 4F79A 4FLSA 2OSWA 2QMJA 2JIEA 4A3HA 3DHPA 2XIIA 4AZBA 4QDMA 3AROA 1GQLA 4FF5A 3PN8A 1NM9A 1QBAA 4HMEA 5IXEA 1QW8A 1VEPA 4OOZA 1TA3A 4J7RA 4PMXA 4XB3A 4E8DA 3VX1A 1E0VA 1KGWA 2JFEX 3BCDA 3GTNA 1WDQA 3AXXA 2YIHA 2WMKA 3KL3A 2ZIDA 3MUZ1 1J11A 2WVSA 2UY3A 5DF0A 2QHAA 2GJRA 1TZ7A 1E15A 3VGHA 5A6MA 4D6CA 5GNZA 4PYSA 1NWSA 2GUYA 3BAJA 4A3YA 2VQTA 2JF7A 1V03A 1ZU8A 3D5HA 1J0JA 4P8WA 3U5UA 2J47A 3AOFA 3MS8A 1CLVA 1V6UA 3L2LA 4PMQA 3ARYA 5FL1A 2DSKA 4U3CA 1F4HA 4ACZA 3LPOA 1CGTA 1U30A 3LMYA 1XCWA 3SUSA 2E8YA 3UEQA 4UFLA 1M03A 3ARTA 4JCMA 1E1FA 2UY4A 4TTUA 4UQ9A 5LYRA 2D3LA 4D6EA 3RM8A 3VMNA 4U5IA 3TTSA 5GQBA 3VGGA 5CPTA 2YLLA 3SCRA 4D1IA 5E09A 5CXPA 3O9NA 1P6WA 4D6DA 1XH0A 4PMVA 4OBSA 2XWDA 3W81A 2YL5A 3DHUA 4P7LA 5A6KA 1GONA 3WKZA 2J8FA 1E4IA 3RM9A 5AYIA 1GQJA 2C0HA 4UOJA 4DM1A 1H41A 3AI0A 5A3HA 2GVYA 1CGUA 4P7RA 1KBBA 5FIPA 1OWQA 3CUFA 1PAMA 3WUEA 4H8HA 3BAIA 2WVVB 5CLTA 1W9BM 3T2OA 3PTMA 4CD7A 4TVUA 7CGTA 1HKIA 4WJXA 4ML4A 3QGVA 3W38A 3WUGA 1HJWA 4D6HA 3RPMA 3PZQA 2A3EA 1E6XM 2IXVA 1JFXA 3PTQA 1CXKA 5ABFA 2VUYA 2VURA 2GDVA 3WH9A 2ZWYA 3AS0A 1IT0A 1WO2A 1E6QM 1JIBA 6TAAA 4HZ6A 4QAWA 1HN1A 2XSBA 1DWFM 3QR3A 3AICA 4ATDA 4TOQA 2WMFA 1V6YA 5DEZA 3QHNA 4AY1A 1UH4A 2OYLA 2VZTA 2D1ZA 3VDCA 3II1A 2DIJA 4MADA 1HL8A 3VGDA 3I3BA 3BXWA 3QHMA 1W91A 3CZ8A 3NUKA 1VAHA 2C8NA 1WE5A 1NWRA 2DT1A 1SFSA 1K9EA 1V02A 4X9YA 2HVMA 1OSEA 3SCVA 1S46A 2GSJA 1PX4A 1A47A 2J4GA 3WBAA 2JF6A 1BQCA 3ZJ8A 2IXUA 1HNYA 3MKKA 1QNOA 3M46A 3VD7A 4UQAA 4W5UA 1NP2A 3N17A 3QOKA 5C70A 1BSIA 2E8ZA 4E4PA 1R7OA 5D8ZA 1WCGA 1A3HA 2GJXA 3UG3A 2EJ1A 2PI6A 4ZE5A 2CNCA 1UWUA 4J27A 3UESA 5IFTA 2W4XA 1CNVA 4YPJA 1LG2A 1W9XA 1M04A 4LQ1A 3WDHA 2DT3A 3L4ZA 4AD1A 2BHYA 3WBEA 1JYNA 5A2BA 2O9RA 5I2UA 4MJ2A 1KR0A 1WDSA 4IUGA 4AC1X 2O9OA 4OKDA 1VFOA 4QLJA 1CGYA 1XHGA 4AZ6A 1MQPA 2XFRA 4D72A 1VENA 2BHUA 1VBUA 1O7AA 4DUVA 1JI1A 2JALA 3WENA 1R87A 4Z2HA 4PTXA 1HVQA 3MV01 2FHFA 3BSGA 3VO0A 2ZXQA 4E8CA 1Q6FA 3AXHA 3K4DA 1Y7VA 3ARRA 3IAQA 1UA3A 4KRTA 2GJXB 4JHZA 1GPFA 4V2XA 3WNOA 4X0NA 1TG7A 1J9YA 2VZOA 5A6JA 3F5JA 4GO9A 5JIWA 2V3DA 1FHLA 3A4XA 1UHVA 3NDYA 1PBGA 1LJYA 3GH7A 3T08A 4LPCA 5M5DA 4TVCA 3N04A 3DYPA 1R7AA 4ZENA 4CU7A 3PZIA 3AIRA 4JIEA 3VPLA 1E3ZA 1J10A 2VMFA 5HXMA 1ZB5A 2G3NA 5M17A 5BYWA 1CXIA 2WC7A 3MANA 1HP4A 1ISXA 2CPUA 4CCDA 4AZIA 1QNPA 2BVTA 3WDJA 2A3AA 1RH9A 3T0AA 3DYMA 4NSBA 2BY3A 4MB3A 1UD8A 3WF3A 1H0IA 1UWQA 3CH9A 2W67A 3NSNA 3SCQA 2V38A 1XH2A 5IFPA 1BGAA 3VDBA 1J0YA 1EIBA 2XPKA 4PMNA 1R86A 5JUVA 1BTCA 2GDUA 3OLDA 4DWSA 3QOMA 1B3ZA 2WYSA 2CBVA 4KMQA 4AWEA 3OBAA 1XSKA 1JZ3A 3W0KA 4AIOA 2NSXA 1OB0A 2OSYA 4V28A 5AC4A 2WCSA 3RDKA 3ZO9A 4WSJA 1GCYA 4PEEA 2W61A 3RMEA 5M3WA 2V5CA 3MO4A 2CKRA 3WFLA 3ZJKA 3BAYA 1C92A 3WH6A 1VB9A 5AC5A 3T09A 1OIFA 3A47A 1DWJM 1R85A 3DC0A 3SCUA 2ZUWA 2ZUSA 5A94A 2VR5A 5I0DA 3CHCA 1KGXA 4DUWA 1CGWA 1W32A 4H41A 2WSPA 4PUEA 3CHDA 1JZ7A 2CERA 2BVDA 3L4YA 1GOMA 1MXGA 2J25A 5EFDA 1W3JA 1BLIA 2XUCA 4HOXA 5BXSA 4H7VA 1B31A 4C7GA 2EO7A 5BRQA 3W28A 4Z2GA 2EQDA 3B8SA 5BCAA 2VZSA 2ZOXA 4ZXLA 2DH3A 3W29A 4M81A 3ZR5A 1HJSA 1W9DM 2X05A 2B31A 2MANA 4FLOA 4JKKA 1NOUA 3MUY1 3HU7A 3KE0A 2YBUA 3VDAA 3SCNA 3A4WA 4N42A 4ZFMA 4U2YA 5ABHA 2A3HA 1E3XA 2W91A 1ZS2A 5D9MA 2CBUA 5JBFA 3U7BA 2DSVA 1DWIM 2ZUMA 3W27A 2ZXDA 1E73M 1HX0A 1QHZA 2E9LA 4PRWA 1V08A 1CGXA 3WMCA 1AMYA 5FKYA 3OA5A 1UA7A 3EDDA 1X6NA 3BAWA 3FAWA 3VGBA 3ARSA 4DWSB 3WDIA 1V3LA 2VX6A 1W9PA 4V27A 3QHOA 4FLQA 1LL7A 3VM7A 3WIJA 4P8VA 3TTQA 4MNLA 2Z1KA 4W86A 3ALGA 4B3KA 4CGTA 1E4LA 2AAAA 1JI2A 1DTUA 2X0YA 4W88A 3N18A 4HA4A 5DMYA 2ZXBA 4TUFA 1E6PA 4W7UA 1C8YA 2PB1A 1PZ2A 5C71A 2CCRA 1KGUA 3ARQA 3VD9A 2YKKA 2ZUUA 3W25A 1JZ5A 1BVZA 1B90A 1G1YA 1F4AA 1HJXA 1JYWA 1V0MA 5CGTA 3F5LA 3AQUA 1L0PA 1C91A 2F2HA 2WVTA 2WZEA 1MW1A 1GJWA 3LPFA 2VRJA 3IAPA 3EDEA 1BYBA 3B9AA 1DWGM 1UD5A 2Y24A 3EMCA 4NZCA 2ZX7A 1I75A 3NJ3A 4FK9A 2J7FA 1N82A 2V3GA 1GJUA 1PX3A 1TVPA 2WMJA 3VTRA 4CCCA 4Z2IA 2O9PA 1C8XA 1K9FA 1JYXA 2CKSA 2OYKA 1C7TA 4JFSA 3VIOA 2D2OA 4RL3A 1B30A 2DSUA 1W3KA 3GXDA 5F7UA 3WQ4A 1I1XA 1JF5A 3VKKA 3GBEA 1GOIA 3KEHA 4AZCB 4PMUA 4W85A 5AY7A 2J79A 2YA1A 3ARPA 4A4AA 3CMGA 1OIMA 3WN6A 4PMDA 2XIBA 3THDA 1V6WA 2A3CA 2G8ZA 4AZ7A 4J3TA 2VX7A 1HXJA 2VRQA 3F5KA 4CD4A 3AHZA 2AOSA 5A6BA 3ZT7A 4GXPA 1U2YA 2VT0A 1E0WA 4AD0A 2GK1A 3PHAA 3CZJA 1TE1A 2WHMA 1RD6A 3N1AA 2BHZA 4WK9A 1RP8A 5HBFA 5KZ6A 4OUEA
chains in the Genus database with same CATH superfamily
5KZEA 2DQXA 4LT9A 3ONBA 2PDCA 5I3DA 4TO8A 1GW9A 2HROA 4GYKA 3M41A 1EX5A 4JFTA 3WQCA 5LA0A 4MUPA 3S5ZA 1XBYA 1IZKA 3ME3A 4PN2A 4JCLA 2DSWA 1Z44A 4KPLA 1E72M 1XLMA 5K4ZA 4UR7A 1OYBA 3BLFA 2RDWA 3O3RA 3U2ZA 1GZJA 3F2BA 5A5WA 3TR9A 3VNDA 3R12A 3N6HA 1D3HA 1JNEA 1JDAA 4LV9A 1JNDA 1F8MA 2IQTA 3H2CA 4IQJA 4O10A 3W24A 2JIWA 4NI3A 1GOXA 4MPKA 1KBLA 1UH2A 1D7FA 4GCXA 3A4JA 1YLVA 4I8YA 1ITXA 4CCEA 2F2KA 1GVSA 1NF0A 4F0LA 2YA0A 1H4PA 3TA9A 4AB4A 2Y2WA 1NEYA 5H6HA 4H9XA 2V3FA 2DIKA 1W5QA 4BQ4A 1EDTA 4RCXA 5FJUA 4HPGA 3JZEA 2XH2A 4HPHA 5AN7A 4MNKA 1MXSA 4TX8A 3W7DA 4JQ4A 1E55A 3EWYA 1B1YA 4ICNA 2O55A 3DG6A 1N8FA 3PZMA 3T1GA 5ABGA 3W7PA 1XLCA 1UUOA 2EG8A 3AWOA 4XKYB 5I24A 1UR9A 3M0HA 4N4QA 5HJLA 2A21A 4PCPA 1I2QA 3SIZA 4DEFA 1V3MA 3R89A 3AAMA 3HBLA 5G2IA 4O50A 1SR9A 2WBKA 2FIQA 4UTMA 3WK0A 2F84A 3WJYA 3H2FA 4JPGA 4MIMA 3KBNA 4GXMA 4Q8TA 4OECA 2Y8VA 4ZEPA 1U83A 5FSEC 3A9BA 3GZAA 4QTGA 5CEWA 4UC5A 3GU2A 3CUGA 2F6KA 2VFGA 3IIOA 1TMHA 3N13A 1DXFA 3FXYA 1FCQA 3UJ2A 2WSQA 3VMPA 1DJHA 3C0JA 2IKJA 3QXBA 5IDIA 5IHRA 4C5YA 1M1BA 1FFQA 4ZODA 4MY9A 3GXNA 3PPGA 1SUXA 4IPPA 2RKXA 2XZ7A 4IHCA 3LZ3A 3U9IA 3LZ5A 1OD0A 2QW5A 5D4YA 2D22A 4AZ5A 3B8TA 5I3FA 3CU2A 4OGZA 3KRBA 2FKPA 4FA3A 3EWBX 4D71A 3BCFA 1XGDA 4EPEC 3VIMA 1TPDA 2PGRA 2X1TA 3BSHA 5HMFA 3CK5A 5HDRA 3F2CA 3W7OA 3RN6A 3OW1A 4J9JA 1MRQA 5D9NA 2GVEA 3RLHA 3UVAA 2VR2A 4JKMA 3SCSA 4ZFCA 3OPSA 1MUCA 3B0PA 3M7SA 4ROPA 4O8AA 1Q7QA 4QR6A 4GI8A 4GQBA 1QFEA 3JU2A 1ADDA 4MGGA 3I10A 3Q65A 3GNPA 1JDCA 4FOKA 3C86A 4HU8A 4S23A 4D6JA 2OCZA 1EJXC 3GU1A 1UD3A 2WSRA 3L12A 4XV0A 3JUGA 3WD0A 7REQB 1ZQ5A 2CEQA 4MSSA 4ZQNA 2FGLA 3WJSA 4UTWA 1AVAA 1HO1A 1UROA 2XSXA 1JZ6A 3U3HA 2WWDA 3GVVA 4HIBA 4XUYA 1OFBA 8A3HA 3RHGA 3E0WA 1PCWA 1XM3A 1CXEA 3GYEA 3TKFA 3MPGA 1E4NA 3INPA 4IMAA 1KTNA 3LUTA 2OZ3A 5C7VA 5AHMA 3P60A 1SFTA 4LFYA 3F4WA 5M1TA 5D32A 3I6RA 4MJ4A 5AHNA 4K8GA 1P1MA 3T81A 4XZLX 1UIPA 4NIRA 4BEUA 2NWRA 3SJ3A 2R1PA 2QCDB 4N0RA 4K2SA 1RP9A 4UTFA 2WV8A 1Z8AA 4PB4A 1AA1B 5CGQA 3P62A 3MT1A 1E56A 4J2MA 2BNJA 1W0MA 3M6DA 1ICPA 5EY5A 3IIXA 2A7NA 1V02E 3K8KA 3VIIA 4GC4A 4W5ZA 5E9AA 4B5NA 3MV11 4MB5A 1ME9A 3GK0A 3PZGA 4A8RA 3EKZA 4I5XA 4HA1A 4G7EB 2VL4A 3SDOA 2G4JA 2XM1A 3NL3A 4A3RA 3R11A 3O6AA 4MB4A 2J74A 2PBGA 1KM5A 3ARVA 1EGMA 1WBHA 3W1PA 1TSIA 3S6TA 4H00A 2ZA3A 3GH5A 1TWSA 3H2AA 3AIVA 3NIYA 4JYDA 1NJJA 1GTHA 3W4RA 4QX4A 3DGBA 2QJNA 2ESCA 1HJVA 2Y5EA 2WKGA 5AYBA 2PDXA 4M29A 4GGHA 3KHJA 3DN5A 3KBVA 4GZJA 2DGAA 3AYVA 2PWUA 5FF7A 1Q6CA 3SSJA 4D6FA 3UD6A 2WNWA 1K8ZA 1XLHA 2F7FA 3WLQA 4H01A 2OO0A 1BYAA 1YQ2A 2CBJA 4ML9A 4BA0A 2W92A 3OLIA 2WCAA 3VFCA 1Q6RA 4PTVA 3TYZA 1WQ5A 4GZEA 4GNKB 7ENLA 3G24A 3EKLA 4RPQA 2R6OA 1XF0A 1ISVA 3GAKA 3GR7A 1XFBA 1Y0EA 5EB8A 3T0DA 5BWFA 1XINA 3PG9A 3KL5A 1E70M 3PBMA 3T05A 1SJBA 3VKCA 2XIQA 2GYIA 3IV3A 1L8NA 1REQA 1C9WA 2ZTJA 2VENA 3KWSA 3WQGA 5JQ9A 1OYAA 2V5KA 1G7VA 1NVMA 1RBOB 3QMRA 2V68A 2OLSA 4JEJA 3EDFA 4RE3A 1Z48A 3CO8A 4R88A 4KQNA 4MKSA 5L6UA 1OBAA 4GABA 1KO0A 5CZJA 2DZUA 1RBLA 4UMCA 5AYXA 1XPYA 1PSCA 4K7YA 5DT7A 1LRNA 3U2OA 5LIYX 3ATYA 1BAGA 4EANA 1O1HA 4YL2A 3IANA 2VO5A 3CO4A 3GC4A 4I9MA 3S1GA 2HCVA 1IXOA 1B3XA 2PBOA 4UOQA 1IIGA 2Y4SA 3W00A 4ZA0A 1YTDA 2Y7DA 3P0WA 4DLMA 1JR1A 1W2PA 5F2LA 4AEFA 2G3MA 1VC4A 1I0DA 4UXDA 5CJ5A 1SW0A 3KDOA 2EEXA 3V5CA 4A05A 8RUCA 1IR1A 1ITCA 2Q09A 3KTXA 2Y61A 2C15A 3S5YA 1E0TA 4F8XA 4ZOCA 1E1CB 3F7JA 4D8ZA 5CSUA 2FZMA 3UZYA 3OO2A 1BVWA 1R9YA 2WNQA 3BLIA 4TX9A 4XX6A 2IS7A 5FJRA 4KF1A 1R8LA 3LHTA 1XIFA 2DIEA 1VEMA 5T91A 3PPHA 4MZYA 5HANA 1WAWA 1H7WA 5E6YA 4Z0SA 3VNIA 3CBWA 2D0GA 3VD4A 1J6PA 3NQMA 1DP0A 2CC0A 3ES7A 2YL6A 3QV7A 3SCTA 3B9OA 1F6PA 3CPUA 2E68A 5TF0A 1UWRA 3CQIA 4GUJA 4PCNA 1AQMA 3N9SA 4C6OA 4UQCA 1TVLA 4Z2KA 4GPNA 3PUEA 3WG6A 5C55A 1V5XA 3NR0A 3NG3A 4DO7A 4YWIA 2R82A 2E40A 4FHAA 3PZVA 3SURA 4EPKA 3ITXA 3KCJA 2O7QA 2WBGA 2ACUA 1VPXA 1MW3A 1S2WA 3NQ7A 2BXZA 1RJPA 3VNJA 3FGCB 2OSXA 2PDWA 2PLJA 1DHPA 3EWUA 3H8AA 1S5NA 3AUOA 1HQTA 1UR0A 2FZBA 1HKJA 5DELA 2J6VA 4W7WA 5DX7A 5A6AA 4WGXA 3M6YA 3BC9A 2X7VA 3THCA 3MDUA 4L61A 3FJNA 1WP6A 2E3ZA 2NV1A 2DORA 4ONVA 3ORWA 4AYSA 4OV9A 2HBXA 1OGSA 5LSMA 3H55A 3R79A 4DNMA 9XIMA 3V5OA 3C0SA 2RHGA 2QUNA 4INFA 1UYQA 4QJ5B 5EYWA 4PL2A 1N8WA 2P88A 3GTFA 4G56A 1H0GA 3RIKA 3MZ2A 3H53A 2ZQ0A 4K7VA 1AQFA 4BF7A 1O68A 3DDMA 3P67A 2WMGA 3QY7A 3NOEA 3UZ5A 4K1GA 2I7GA 2EXOA 3ISIX 4HHPA 1OG0A 1JDDA 2ZICA 3V4BA 3BV7A 5A6BD 1NH6A 4OOUA 3HTWA 1UC4A 1SO4A 4IGHA 2VGFA 1VLIA 1NQKA 1FWFC 3SGZA 1N55A 5A8PA 1OZMA 4IMFA 3ARZA 1C90A 2VVNA 2E4TA 3RO6A 3R6IA 5BZAA 3EKGA 3QSRA 4HGXA 4AUBA 4WXYA 4E4UA 1QI5A 2O7SA 3STGA 1Q6GA 1VPQA 2WQDA 1ESWA 1YDYA 1L6GA 3CB8A 4H6QA 4EF8A 3M5XA 3BJSA 2ZX6A 4L6OA 2WMHA 2V5BA 3SJNA 2WHKA 1VFLA 1L6SA 4DXXA 4PULA 3O6YX 3AYRA 2QUUA 4DVOA 4ZR8A 3WD4A 3VVGA 2DVXA 5JXQA 1O12A 3ITCA 1YTEA 4JY8A 3L0GA 2QGYA 3WDRA 4EIVA 1J0IA 3BAXA 3Q94A 3RRAA 4MNJA 2Q3OA 4NU7A 3RR4A 1BYCA 1XRTA 2HK1A 5D03A 1G01A 2YDAA 1XYLA 4MB1A 3SCWA 4J3UA 4CN1A 4C90A 1LCOA 1R3VA 4ERIA 3AIEA 3TMQA 1Y5XA 3SRFA 1FH8A 3P8IA 3GZ3A 5FJOA 4UFIA 3P3BA 4W8LA 1H5VA 1W56A 1REQB 5HAOA 2PF8A 3GUGA 4NYYA 5CG7A 4HJWA 3VIHA 1SZFA 3IGSA 4HP5A 4DZ5A 1J96A 2NXHA 2Z1XA 1E5JA 4J3XA 2HEJA 3C0QA 4C7FA 2BP1A 3W26A 4CN6A 2QJGA 3WQWA 2CZFA 4X2RA 1UP0A 4D6IA 2DZSA 3EMZA 5CC7A 1OK4A 4JIHA 4AD3A 1MUWA 2R24A 2G3IA 4S3CA 1NIUA 1EHAA 3N2XA 2QUMA 1UD4A 2YXGA 4Q8WA 3WF0A 1EC8A 5FAJA 3VIKA 2EPOA 1WBJA 3ZVHB 2GWGA 1J5SA 2YCJA 2EPMX 4DBUA 3VKBA 4NYUA 3AXKA 3WQ8A 4LCQA 1ALDA 3T0BA 3VNZA 1LM1A 2VCCA 2E0PA 3PZ9A 3TUUA 1Q5MA 3T07A 1XIMA 3KXQA 5CCZA 3VIFA 1UZ1A 4B9ZA 2F61A 5DBUA 1Q2SA 2QKFA 4JYEA 3W7CA 3CZEA 4BS0A 1B57A 3DG7A 3R0UA 4ZB0A 2UY2A 1Q4NX 1VBJA 4YCPA 1Q6DA 2DDXA 1MFVA 3UCQA 3PWIA 1JYVA 3O15A 3MBFA 2AQVA 5HA7A 3TAOA 3ZIZA 3URAA 1E5NA 1ENUA 3F2DA 4TTGA 3SZ8A 2EKGA 2JEQA 1US3A 1TWZA 1S3HA 1JD9A 2W9MA 1PZ0A 2QXWA 4CEXC 5LIKX 2XFWA 3WD1A 6ENLA 1DJGA 1UQYA 1QI2A 3NA8A 3VMOA 2Z6JA 2X0SA 4O18A 2HISA 4PZVA 2PWFA 4JTHA 1EA9C 5G2WA 3QSTA 1B0IA 3O1NA 4Z0JA 3WQ6A 5KZMA 1M7XA 5I77A 1HUVA 1QHPA 3MUXA 4QCFA 2PDJA 2ZE3A 4IFOA 3CQHA 2FH6A 1G9HA 1H09A 4JTUA 3PJXA 2GOKA 1HJQA 2FB2A 3N25A 2NT0A 1UKTA 1KXHA 1KLZA 3IIZA 4EKJA 4L64A 2R8WA 3GDBA 3W2KA 3MQTA 1ONRA 4P8XA 4G7EA 5KSWA 4KRZA 1I45A 1ONEA 4L65A 2E5DA 1FWNA 4R85A 5DO8A 1KXQA 3WCZA 3P93A 5D30A 1YXDA 2FZ9A 3N3MA 1CPUA 4MY1A 2QPSA 3DG3A 3SCPA 3U4AA 2Y89A 2WCGA 5LA1A 3NSXA 4HU4A 2ZUTA 4S3DA 2GK1B 1I2OA 2JKPA 2Q8XA 3GXFA 4LV4A 2HXTA 1CWYA 4E3VA 4I9TA 1QJWA 2PUZA 3W23A 3CT2A 5AVHA 1PX8A 4IMGA 1H62A 1TCMA 1UD2A 2CXGA 3WQVA 3BW2A 3H24A 3CIXA 2CIPA 3PANA 1QU4A 1FWCC 2XFFA 2OVLA 2CLLA 2FYMA 3CQJA 3H7UA 1D3GA 2FZDA 3R94A 4DAIA 2BVYA 1DIEA 1WZAA 1MW0A 5CSYA 5EGRA 3MJYA 1VD6A 1EP3A 4UTHA 2VEKA 4KIEA 3DOPA 3NYDA 1TR1A 4DY1A 2BX7A 4FLSA 3ZVIA 1ME7A 4S3AA 4MZ8A 3EX2A 1IHIA 1X1OA 2JIEA 3TA6A 1TQXA 2XZ9A 3SRKA 1XP3A 4FF5A 1R0MA 4KEVA 1NM9A 3TVAA 4QS5A 1X6UA 1QPNA 4JR5A 4XB3A 3VX1A 2JFEX 2VFEA 3BCDA 3QVQA 3GTNA 1WDQA 3AXXA 2YIHA 4FO4A 4H6EA 2WMKA 1O5KA 4PB5A 1V51A 2QHAA 4H9TA 1KFKA 1TV7A 1OX5A 1UCWA 5A6MA 1B54A 3FV9A 4O4VA 3TN3A 3IARA 2VQTA 5MKGB 3D5HA 3MVTA 3U5UA 2G50A 3AOFA 2HK0A 4L56A 1KRAC 1TQJA 1SZEA 4H6RA 3HM7A 3LPOA 1CGTA 4LWWA 3DC8A 2NQHA 3UEQA 4UFLA 1WUEA 3CB3A 1AL8A 3AU2A 1JUKA 1NDZA 4RZ6A 5LYRA 2D3LA 4D6EA 2PU1A 1VLWA 3RM8A 3NL6A 4CQ9A 5GQBA 3VGGA 3WLMA 2YLLA 1Q2RA 3GE7A 3R4IA 1QPQA 3N4FA 3VKDA 4HD5A 3GG7A 5DXYA 1P6WA 2JQXA 5EKYA 3FA4A 4F2TA 2C0AA 4P7LA 3FVMA 2LLEA 4Q4KA 2J8FA 1SW7A 2PLMA 2PD5A 2J8TA 4RDVA 3HGRA 4DM1A 5A3HA 2GVYA 1QNVA 4Z42C 4WUIA 3TAKA 4P7RA 3TYCA 1PAMA 3BAIA 4FPSA 5CLTA 1W5MA 1Q45A 2WQPA 1XLKA 3P82A 3QGVA 1E51A 2ZZ1A 3K5XA 3RPMA 4MFDA 1YPXA 3PTQA 3ZLGA 4EXBA 4CNOA 2YXOA 1I6NA 2GLKA 4H9YA 5C9ZA 2X1RA 4ZCWA 5FF4A 1TWIA 2Y70A 5HMDA 4C6BA 3HOJA 1LUCA 1WO2A 4GXWA 1NSJA 1QWKA 2WZTA 4DJDA 1DIDA 3D0CA 1TTPA 1A53A 1DWFM 1G69A 1UMLA 1F73A 3BICA 4ATDA 2WMFA 1V6YA 4AVNA 1YW1A 2OYLA 1XIJA 2DIJA 1TPB1 4N9DA 4NASA 2GSEA 1W91A 3CZ8A 1VAHA 4MWAE 5KETA 1FX6A 2OU4A 2VEMA 5K2ZA 2VEGA 1TMLA 2GOUA 1JEZA 4X9YA 4HQVA 2EGZA 1P1XA 1OSEA 3VE7A 1KD0A 1WA3A 4LCSA 2GSJA 3W1AA 4NHVA 3N29A 1A47A 2J4GA 2JF6A 3P0XA 3Q2DA 3CV2A 1QNOA 3N6QA 3VD7A 3EWDA 4EAYA 3QOKA 5C70A 1BSIA 3E38A 1U1HA 3TFCA 1A3HA 1PIIA 2PI6A 3BVJA 3A64A 4ZO9A 3COTA 1M04A 2DQWA 3WDHA 2DT3A 3TROA 4B5XA 2VXNA 4WZHA 1JYNA 3Q37A 1MDRA 3VOJA 1KR0A 4R33A 2CWXA 3W2UA 4QLJA 4PUWA 2QDDA 3W76A 2VWTA 3T4WA 4ZBCA 1EEPA 4DWDA 1O7AA 4DUVA 3LM7A 2CLFA 3S42A 1HVQA 5LZLA 3REQB 1Z6KA 5BMXA 3K4DA 1XDMA 3ARRA 1DQUA 3G3DA 1SU5A 3EOOA 3LTSA 3WNOA 4V2XA 3WLTA 1XYBA 1OEPA 4NVTA 3F5JA 4KEZA 4I5UA 2Z27A 4BWLC 3EOUA 3OP2A 1LORA 4FX6M 1UHVA 2PDGA 3LX9A 1HO4A 3T6CA 5M5DA 4TVCA 3N04A 3DYPA 3QF0A 2V2HA 1TJRA 3GTHA 3PZIA 1F6KA 4JIEA 4LAKA 2Z1BA 3H21A 3GDKA 3MI3A 1GZGA 4FSAA 2PLKA 3PJTA 3VPLA 3ZWSA 1DJWA 2VMFA 1EJ7L 1ZB5A 1CXIA 2WC7A 4Y9MA 4Z1YA 3GW3A 4CCDA 2ZBTA 3U6WA 4WR3A 3O07A 2R91A 2DJLA 3SO7A 1BF6A 4NSBA 3WYZA 1MUMA 4MB3A 3WF3A 1S5VA 4MLJA 1NF7A 2V38A 5HNTA 4NILA 1JCXA 4RZBA 4A8IA 4PMNA 4YIWA 1M41A 3BW4A 2D2HA 3V7PA 3L23A 3ZO9A 1GCYA 1W1A1 3H26A 4GUHA 3W1TA 3ZJKA 3MCOA 4MMWA 1RD5A 4NNAA 3A47A 4EXQA 5CH9A 1CCWB 1DWJM 2Z26A 4JOMA 8XIAA 2ZUWA 4MYXA 3IJLA 2ZUSA 3W1NA 3BLLA 2A0NA 4FXJA 2EF9A 1CGWA 3RXZA 2A6NA 3CHDA 2C71A 4RK8A 1OJXA 1JZ7A 4XD6A 2BVDA 1E9ZB 3DFPA 1G6CA 5HWJA 1GOMA 3NPWA 2DJXA 2J25A 2ZDSA 1E9IA 2RAGA 1H50A 2YFNA 3GD6A 1K77A 1OFAA 3W28A 3KVLA 1W1IE 4M81A 3EWWA 1TJ1A 2B31A 3UPBA 1POKA 4JQ1A 3HU7A 3KE0A 2YBUA 3SCNA 3Q4DA 2XH7A 6XIMA 4A2RA 2E09A 3CYVA 4IJCA 2GQ3A 2AL1A 4DYJA 3F4CA 1E3XA 2W3ZA 1ZS2A 4LW7A 3RK8A 3LQGA 3WJXA 3SSZA 5JBFA 3JW7A 3WK2A 3WLOA 3NQFA 5JH1A 3W27A 2D2GA 3M9YA 2QDGA 3NXLA 4QISA 4XD5A 1LDCA 1V08A 4P61A 3UCDA 3RU6A 1GVQA 1UA7A 3VGBA 1QK0A 4C6PA 4C6FA 4DO6A 3P8JA 1V3LA 1WUFA 4V27A 1W9PA 3MA8A 3QHOA 4FLQA 1LL7A 3VM7A 3CAQA 4O1DA 2C3ZA 5DMNA 3TTQA 1YE6A 4NNCA 1CI1A 4W86A 4JQ2A 1X97A 3W2JA 1E4LA 3C2VA 1THFD 4QAIA 2AAAA 1DTUA 2X0YA 5XIMA 4W88A 2DZAA 3N18A 4QQ3A 3H2EA 3TW7A 5DXXA 2ZXBA 1FDJA 4RXGA 1TX2A 3LBMA 5C71A 3C0LA 2YKKA 2FB3A 4PEKA 3HFYA 3FVDA 3H4GA 2Z6IA 3LHYA 1G4SA 1W37A 2X2GA 1C91A 2F2HA 1S2VA 3LPFA 4ZQRA 2VRJA 4PUNA 4IIBA 1W5OA 1BYBA 2ALDA 1G4PA 1I75A 2ZX7A 2ISVA 4Q4OA 1DXEA 2NVDA 5PTDA 1K9FA 2YFOA 1C7TA 4RL3A 3QR0A 2NQZA 3HGSA 2ANUA 4K38A 1XYAA 3W2NA 5F7UA 4HYVA 3WLHA 3NXFA 3CHVA 4O1FA 4AZCB 1P6BA 2V69A 5AY7A 2J79A 2QJIA 2YA1A 4Y90A 4LAOA 3ABSA 1C8VA 4A4AA 2YX0A 3DESA 3BK0A 4IG2A 4U4MA 1KFJA 4AZ7A 1K7FA 1B3OA 2VRQA 4RXFA 4CD4A 5A6BA 1WKEA 2CU0A 1XRFA 2VFHA 3WO8A 3G1VA 3PHAA 4O17A 1W3NA 4RKAA 1DJNA 1RD6A 3N1AA 2BHZA 1RP8A 4UQEA 1LBFA 3AWNA 2C13A 1QNSA 3TWAA 4EVZA 4WSKA 4GY7A 4PUKA 3FDGA 2R9RA 2VQUA 3WMSA 1JCMP 3S0CA 3VDHA 3TNOA 2CYGA 1EJSC 4IIFA 3KOXA 4HB7A 3LXCA 4EACA 1WZLA 4US6A 1JXJA 1KXVA 2AAMA 1W1PA 1D2KA 2C91A 4M1RA 2GGHA 4PCSA 5DLCA 2VJXA 5A8NA 1AODA 1LQ0A 1FWIC 3E3HA 2I9EA 2BGQA 2ZA1A 2XM2A 3TC3A 1MSSA 2PWHA 2ZE0A 3RJYA 4R7OA 3ARUA 4JFWA 1JZ8A 2YCKX 1YEYA 2PF0A 2GUBA 3I4EA 1SR0A 4UQDA 1EL3A 1PIGA 3ZOAA 1A5UA 1IF2A 1MVYA 2BTMA 1P6CA 3EWCA 1XCFA 1AQHA 3ZLFA 4ZQOA 1NTHA 5DT5A 1PWLA 1Q63A 1C8QA 1FWRA 2XVLA 1OG6A 1LOQA 5D33A 4DHGA 4AG0A 4MJMA 5DCDA 2UZ9A 2V0TA 3R8HA 5HWMA 2NSOA 1ISWA 1IT8A 3IUDA 5D2TA 1YIXA 3MJMA 3CTLA 3UG4A 5DMMA 1UUQA 3MMDA 2C16A 4X60A 3WJWA 3MP4A 2NW0A 4OT7A 4H3DA 3NO1A 1GT8A 1UPPA 4IL0A 3POCA 4AZHA 3NVDA 4YN5A 1F76A 1A50A 5JBDA 3WEZA 4ZB5A 4QS6A 2FZ8A 2VX5A 3DBPA 3VNYA 3DUGA 2ADAA 3ECQA 4KGLA 3K13A 4ZTXA 2QT3A 1A49A 2ISWA 4FB7A 2PZNA 2HMCA 4S3JA 2YDSA 4CD5A 3RCNA 3TDFA 1UP3A 3NAVA 5C2XA 5DY2A 1ZSXA 3NCOA 2WPGA 2PDNA 3TJLA 1BWVA 1RK6A 3QFEA 4B15A 2QF8A 4H04A 2OKOA 3H12A 4G6CA 2HVOA 1VKFA 2VVSA 1EFZA 1OFPA 5G5IA 4XVEA 4ZOAA 4WHBA 4Q3MA 4Y8EA 2WNZA 1TPEA 1UR8A 4LALA 3TXVA 3TONA 2X7WA 4RLIA 1O60A 4AIEA 2VTFA 2C7FA 5F1UA 4CCZA 3MMUA 1ZRQA 1GVOA 1MWOA 4QCEA 1MW2A 2RGMA 4NZFA 6PTDA 2QUTA 4PTWA 1H49A 3W7RA 2OX4A 3EMQA 1TVNA 3ID7A 3HMJG 5FEWA 3QZEA 3CUIA 3APGA 1CIUA 3CL6A 3NZPA 4HMDA 2CZDA 2VI0A 1IWBA 2Y5JA 4QG6A 1A5SA 3GTXA 2Z0IA 4M6VA 1BF2A 5AC6A 1CXHA 1NQ6A 1ADSA 3WH5A 1XKJA 2QCMA 1IQ8A 3LCIA 1DORA 3NQCA 3RCYA 2XYLA 2ZX9A 4QITA 4J5NA 2XGIA 1XV8A 4KFOA 3LSBA 4Q6JA 1ZBKA 4IGMA 1XX1A 2YL9A 4ZSUA 3A23A 3GS6A 3L4UA 5BOOA 4K36A 1KQZA 4F0SA 3DU0A 4AISA 5D9OA 1L2QA 2CHOA 1DVJA 3DI1A 4DIAA 1MFUA 3ZT5A 1K7XA 3UWEA 1KV8A 2UWFA 2TMDA 2H9AB 1PZ1A 4XSMA 4LY4A 2BLEA 1HVXA 1EYEA 4JTSA 4D8AA 4QFUA 5EBAA 4LS2A 2ZX5A 1G94A 3W75A 3KLLA 1EXPA 2OJPA 4J40A 4HOZA 1DEDA 1UB3A 4JTCA 2IKIA 4NT0A 3U7VA 2BFGA 5HUPA 1F2JA 3GH4A 1FWWA 1WYIA 2PMQA 3KVJA 2QR6A 3H6OA 1PS9A 3UERA 4O15A 1AW1A 5DQPA 1VFTA 2G3FA 1CTNA 5LKYA 1FKXA 1A3WA 1NFGA 1IZCA 1K8CA 1EWEA 1SMDA 1F5ZA 3B4UA 2H3BA 5MKGA 2Z00A 3ZR4A 4IL2A 1EOKA 3GX9A 3SIMA 3CWOX 3SM0A 4R9OA 3UG8A 3F4VA 1NELA 6ALDA 2KZHA 4XTIA 2EJAA 5DRCA 1XPGA 1BVNP 3GNNA 1TUFA 1RQEA 4MWAB 5CPLA 2X2YA 3OG2A 3AHYA 2Y85A 2DEPA 4H19A 1F9CA 3W7IA 4GQ0A 4JX6A 3VIPA 3FSTA 4K3ZA 3AS3A 5BU9A 4OJYA 3KUMA 4PFHA 3W22A 3FHQA 4LJ3A 3MHUA 4PUMA 3BLPX 3AUJA 5C7HA 3RG6A 1G67A 3OG3A 2INFA 4R34A 4C6LA 3LEPA 3SGUA 4B3ZA 2IPFA 3EXTA 4LYPA 3WNLA 2J7HA 4AD4A 2Y7GA 3JZUA 3AMDA 1XRVA 3IUIA 4WJ8A 4ZXOA 5CAKA 3M0LA 2XWEA 3AS2A 4GJJA 1W5NA 3D46A 5F2GA 4Y9OA 1IWAA 2PWEA 3K46A 3G0XA 2QNEA 3B9NA 1LTDA 4WVXA 4O16A 4GX8A 2BY1A 1LLWA 5I3IA 1EJWC 1J18A 4IMDA 4HVXA 4Q7NA 3FAXA 3BWWA 4KWUA 4GZIA 3STEA 1OD8A 3WNPA 4NP7A 1MNSA 4A29A 1W3HA 3QLDA 2DFAA 4ERGA 5CZTA 1P0NA 2A7RA 3MUCA 4LH8A 3QQ0A 4WKAA 3LLXA 1JDEA 2WK2A 3P5ZA 3E2QA 3ZJ6A 1AMKA 3DENA 1H51A 2CBIA 2HSAA 1Z32X 4W93A 4CD8A 5GJMA 3WQOA 1FXQA 4KWOA 5A8MA 2I17A 2PWGA 3RR1A 3WQFA 3B8IA 4GNJA 1VJIA 2ZZ2A 2P8CA 3XINA 3CQ0A 3BG3A 2DV0A 1LWHA 3HG3A 4C5ZA 1KWGA 1FHDA 4WY0F 4O0ZA 4H8VA 4E3TA 3MDWA 4V1YA 1WKFA 1PZ3A 2E7FA 2CLHA 3QZAA 4PFMA 3ES8A 2WJZA 4WCJA 3DFYA 4IIHA 1Q8AA 1X6LA 3JRKA 3PP7A 2G3JA 2ZUNA 2WWCA 3B0VC 4LBRA 4RJEA 4L7ZA 9CGTA 3LRLA 2P53A 3CAKA 4QSFA 1MZRA 2NVAA 4FEZA 4Z2LA 2X0HA 1QAPA 5I23A 1YADA 4G1KA 3M43A 4US5A 2NLYA 3VIGA 4C7DA 1X1NA 3C61A 4M8UA 2FTYA 3W07A 2VKZG 4YU1A 4WDTA 3EX1A 1H7XA 2J7CA 5EMKA 4MUZA 1Z89A 4KKXA 1IXNA 3NFUA 1O5XA 2HXUA 1S5TA 3NO5A 3GXTA 5CAHA 4O4WA 5HK4A 3S1XA 2J77A 5A2CA 2NVCA 6A3HA 5JBEA 4MNMA 3SUTA 4PMJA 1W1TA 1FWEC 2ZXAA 1DPMA 4ZE4A 4DUXA 5E9XA 1FP8A 3RLVA 1G4EA 2E6FA 3ABOA 2XN2A 5I03A 1B2YA 3BPWA 4NUWA 1XL9A 3FOKA 3W88A 3VAVA 3BG9A 3K1GA 1GORA 4UWMA 2Y8KA 2ALRA 1EBGA 3WLJA 4CNTA 4NJIA 2REQB 2Y0FA 3CEPA 4W87A 1AL7A 1EOMA 3GHTA 4KCUA 4XO7A 2ZWZA 2DU2A 5IM51 1UR4A 3EX3A 1V4YA 2YYUA 1S5WA 1N7KA 4U3AA 1BGGA 1V6XA 3N2CA 2BOEX 1XSJA 3O06A 2VC5A 3SI9A 3LRMA 5D38A 2VCBA 4C65A 5FJJA 3FW6A 4FAMA 4ADSA 2J13A 4F40A 1H1ZA 3K8MA 1LYXA 3GXPA 1JXKA 1QOXA 3HJEA 1K6AA 1ML1A 3NQDA 1H63A 3STFA 1US0A 3S83A 4B5UA 1WPCA 5C5YA 1FOBA 3L5LA 4GBUA 4EPBC 4M56A 4H8UA 3HG5A 3KVKA 4MWAD 3ITOA 1RK5A 2FHCA 4FLRA 4AF0B 2BASA 1J0KA 3BLKA 5E93A 3T4CA 3AALA 4O14A 2V3EA 3UPWA 5AKQA 5LGXA 3FY1A 3HMCA 4JBRA 3L21A 1QW9A 3RPTA 1JCTA 1ZBVA 2A7PA 4ZMGA 4K37A 5HR6A 3UXIA 1OCQA 3PG8A 4F3HA 2BXYA 4LS0A 3N2TA 3V1PA 1V3KA 1W5PA 2IMRA 4L6DA 2X30A 5BXTA 1UP2A 1XD0A 1UR1A 1VJZA 2EBNA 1M5WA 5RUBA 1DOSA 3MU7A 3VX0A 2PRMA 1ZP4A 4MDPA 2ACSA 4FNUA 3K8LA 3RU8X 1OX4A 3OIHA 1Q4WA 4LYRA 4LUYA 4GG9A 3T55A 1XQKA 2ZA2A 5HINA 4HNUA 4KCVA 1P0KA 3VGFA 4DLFA 3W1MA 4ILSA 2ASHA 1Y5WA 4YTSA 5REQA 3T9PA 3ABXA 5D2WA 4H4IA 4AWUA 4JD4A 2J75A 2BMBA 3KW3A 3B8WA 3B03A 2OWXA 2VEPA 3GDLA 4WJEA 3MHFA 1GQIA 1HKKA 1XLFA 3NDZA 5C9UA 4QG8A 1DHKA 4WKFA 4PMOA 3GG0A 2FDMA 1ZCOA 3HN3A 1BXNA 2YXXA 1F74A 1CEOA 2D2JA 4AXKA 1X1ZA 2GUUA 1A5LC 4GKLA 5CPQA 3KBMA 3KP0A 1PTDA 1OFDA 4BKNA 5A8OA 4G2DA 4W84A 4JAWA 2X40A 2HZGA 4GIAA 1OC7A 3LCXA 1WAUA 3OQ8A 2NV9A 3ARWA 1ME8A 5LIUX 1EJUC 1QI0A 1W9UA 1E9LA 2WZHA 4TX6A 5CPMA 1XIDA 3QLLA 2QVHA 4AHOA 4HN8A 3BAKA 3R8GA 3UGRA 1OM0A 1DIKA 1XJBA 1C29A 2EKCA 4C1LA 2CZVA 2PDFA 3LU2A 6CGTA 2OZTA 5CC3A 3LOTA 2AQOA 5IHSA 4XAFA 4XTDA 1R3WA 4UR8A 5EU9A 1FUYA 3GLCA 3FKRA 1PIFA 3O6DA 3GFXA 2W62A 1VBHA 2C1IA 4C6EA 1L2UA 3DCPA 3P80A 5C2GA 1UR3M 1HW6A 1K70A 4EP8C 1VFMA 1OC6A 1QOPA 5BOEA 4Q4SA 2HV5A 1HTIA 1K9DA 5FAGA 3WF4A 2A3BA 1UWSA 1QPKA 1IV8A 3N73A 1R47A 1VIWA 2WM0A 4JHOA 4F0MA 3P84A 4J3ZA 4UTLA 1GYLA 4ATWA 2OZ0A 1ZBCA 2XVPA 3BGAA 1JZ2A 1AH0A 4QIUA 1OINA 5C0QA 4UFJA 3DFOA 4YHGA 5IDZA 3ANVA 3EB2A 4I9AA 3BL3A 3AO0A 3H54A 2PDPA 2RDTA 3N15A 3NEHA 3R1ZA 1AH3A 1HGYA 1UQZA 3KOWA 4UR9A 3QV8A 1B4EA 3TTYA 3WZ0E 4YVVA 1NOWA 5I78A 5DFAA 4RZ5A 1YBQB 4LXFA 1LZOA 2OOFA 4F9JA 4UCFA 4HHMA 1YDVA 2PRHA 4JTJA 1HKWA 2BZNA 2D69A 3M0MA 4MKVA 3UNTA 4JXCA 4LBUA 1KCKA 1J5TA 4IH3A 3W7JA 3TYDA 1US2A 1XSIA 1OX6A 2OZ8A 1X7FA 2XGZA 2KX9A 2W66A 4A8LA 4I7WA 4GVGA 4MWAC 3N2MA 5G4WA 3NNTA 4DM2A 5A2AA 3WLLA 3WEMA 2PC8A 3RCMA 4OZOA 3MSYA 4B5TA 2UY5A 4PRTA 3LM3A 4EWJA 1TUXA 1WXJA 4GJIA 1RR2A 2H3DA 1R6WA 1RBAA 1M7JA 4PUJA 3G6MA 3S2NA 5HATA 3NL5A 1K4HA 2P5NA 4UNIA 4ATLA 3ITVA 1T5AA 1W2VA 3POHA 4UZUA 2G0WA 2YW3A 2QCCA 1SFJA 3MSRA 5CLWA 3FLUA 3YPIA 1EQCA 3FGCA 1C9DA 2I56A 3IUHA 3VM5A 2ISFA 4KGJA 3IJ9A 3C2OA 3AHXA 1BRLA 3A3HA 1ITQA 3AHTA 3R25A 3T42A 2ZZ4A 3W7LA 4DJDD 3H4XA 4IIEA 1QASA 4IIGA 1OK6A 4S2BA 2E77A 1DE5A 2A3LA 3UETA 1TE6A 3MBDA 1KCXA 1LG1A 3BOXA 4RV8A 4Z1AA 2ZUVA 1EC9A 1MYRA 2ABBA 4UZSA 4LUJA 1W9VA 3S2MA 3STCA 2E6AA 3PUOA 1RQHA 1UWIA 2DUAA 3R8RA 4AEEA 5BMWA 1H2JA 3TEVA 3VNKA 3VI2A 4LANA 1OFQA 4M7TA 1YNPA 1WKDA 2J9XA 1O66A 3OLGA 5ABFB 3L4WA 2E9MA 3PY2A 2BSLA 4UNKA 2VFFA 2PCEA 1XLDA 4XZWA 2GSHA 4F79A 3EPOA 2OSWA 5TQLA 2E5BA 2XN1A 2QF7A 3DX5A 4Q33A 2QMJA 3P6LA 1I9CB 3VZZA 3LV5A 4DNHA 4AZBA 3QN3A 3W7GA 3PN8A 1VRDA 4HMEA 5IXEA 1QW8A 2HJPA 1CW2A 4YVPA 3M47A 3VABA 1JGMA 1IEWA 2ZIDA 5BRBA 4S3FA 4H6KA 2UY3A 5DF0A 2QS8A 3HPXA 4HPJA 1DXIA 2G37A 1R9ZA 4C6DA 5GNZA 3EXRA 4H9MA 4JNMA 1NWSA 3ERPA 4A3YA 2NX1A 1ZU8A 1EF2A 1CLVA 3UWWA 1F05A 4U3CA 4ACZA 1TV8A 4KWVA 3BLEA 2V63A 1S1PA 3HQNA 1TWDA 4NJJA 4IWWA 5CC5A 4B92A 1XCWA 4O1CA 3UWZA 2E8YA 4YMZA 4KCWA 3ABRA 3V35A 4CNSA 3CAWA 5U4NA 2NQLA 4QRNA 3UT0A 1T41A 1X38A 1K4GA 4EXAA 1JUEA 1POJA 2OT0A 4B91A 3VMNA 3FIGA 1JRBA 3TTSA 2XIOA 3W2LA 5CPTA 3W7KA 3OVGA 5E09A 4MVAA 4AVOA 4M6UA 5CZ0A 5DBTA 4A2SA 2C1HA 1P7TB 2Y62A 3W81A 2YL5A 1CX9A 3QTGA 2F6XA 3RM9A 4HK7A 3W1QA 5XIAA 5LNUA 1MNZA 5AYIA 2C0HA 4GIEA 4AIBA 2ZC8A 4ZO7A 1FBAA 1Y65A 3GDMA 3GO2A 2H6RA 3H2MA 3I7RA 1KBBA 5FIPA 5KZDA 3SW6A 4PGLA 2FQIA 2WVVB 1XR2A 3QW4B 3BOLA 3NWRA 1YPFA 2WKJA 1W9BM 3PTMA 2MUCA 2FPYA 3HO8A 1IR2A 4ML4A 4H7ZA 3VDGA 1A4LA 1TPUA 2A3EA 1W8SA 1EGVA 1XS2A 1W8GA 1EZ2A 2VUYA 3DKLA 2VURA 3WH9A 3KTSA 5AYYA 2XINA 4UNLA 5F4XA 6TAAA 3W73A 1T6MA 4QXIA 3UXDA 1B4KA 4ZSTA 4DF2A 1GPWA 3ITTA 3S1WA 3EOLA 2ZZ5A 2OT1A 1KA9F 4AY1A 1UH4A 2W6RA 1DJQA 4HU3A 3I3BA 1XQLA 3E0LA 4HHLA 1P0EA 1YYAA 4AC7C 1XI3A 4YS1A 5CPOA 4POCA 1WE5A 2PTYA 3BARA 1NWRA 2DT1A 1FDYA 1SFSA 4UTWC 1K9EA 2VD8A 3O0KA 1FXPA 5F4SA 3WLSA 3SCVA 5C2CA 3VK5A 2INEA 1VYPX 3W7MA 1HNYA 1TTIA 4UQAA 4NNBA 4W5UA 4FNRA 3N17A 1JPHA 3TJIA 2E8ZA 4DZAA 1UJPA 2CLEA 4S38A 3U4FA 4E4PA 1LROA 5D8ZA 1WCGA 4KT2A 4JTFA 1A5NC 2VD9A 4LAUA 3UESA 4YYCA 3R5EA 4EPDC 2PDQA 5K7JA 3G1HA 3QY8A 4YPJA 4LQ1A 3D3FA 3L4ZA 3RNDA 3C3UA 3IRDA 3FDKA 4M0XA 2BHYA 1EEXA 1NU5A 5A2BA 4O13A 4MJ2A 2OPJA 4IUGA 4WDWA 2O9OA 1VFOA 4JIQA 1CGYA 2P0OA 2XFRA 3CH0A 3L68A 4NJGA 3BDKA 3WX7A 4Z2HA 4PTXA 1SQ7A 3MCMA 1A0DA 1Y5VA 4Q4MA 4GVFA 2AQWA 5FESA 2J24A 1UA3A 1PTGA 3M0ZA 5B7ZA 3PFRA 1UASA 1TG7A 1YTKA 4HN4A 5JIWA 2ZKMX 4WQ6A 4B4HA 3NPXA 3NDYA 4AEOA 1LJYA 7XIMA 3T08A 3PULA 3G1SA 3WLNA 1R7AA 4ZENA 3WJZA 1PVNA 2FJKA 3G3MA 5HR7A 2YCEA 1V77A 2G3NA 3CV1A 3B8VA 4L4LA 1HP4A 1ISXA 3TCSA 4MPQA 3WDJA 3QPYA 3HV8A 2Y6ZA 1H7OA 3T0AA 3M0XA 1EUNA 3RRXA 2DW7A 5BOFA 4BF9A 4HPXA 4KFPA 3RPDA 1HZYA 3CH9A 3HGOA 1RCOB 4QE1A 1BGAA 1J0YA 1EIBA 1QOQA 1R86A 3O0FA 2PRLA 5JUVA 1QDSA 3RITA 1BTCA 1J79A 2I16A 1B3ZA 2WYSA 4HHHA 3OBAA 3RX3A 1LUCB 4LSBA 3OVRA 1OB0A 4XVDA 5AC4A 2WCSA 3PUGA 3RDKA 3RMEA 4AVFA 2V5CA 2YW4A 3MO4A 3VCCA 3URNA 3WFLA 3H23A 3I7QA 1C92A 3WH6A 5AYZA 1IGSA 1VB9A 3SR7A 3T09A 1OIFA 3QH2A 4IXHA 5AECA 4MF4A 4DF0A 6TIMA 4XG1A 1LT8A 3G1AA 2OLAA 9XIAA 3SY1A 5A94A 4GIRA 1OF8A 2PGEA 4H41A 4O0QA 2FLIA 3PVFA 1NAL1 4XIMA 2Z4GA 4FOUA 1BLIA 3VYLA 4LOCA 5CKSA 1AJZA 1NFPA 1B31A 4C7GA 2EO7A 2FFIA 1TRDA 2NZLA 1MO0A 2ZOXA 4G5DA 3ZR5A 2FZNA 1A5CA 3RYSA 4FLOA 2MANA 3MUY1 8TIMA 3VDAA 3DFNA 1KM4A 4ZFMA 2V82A 5AC7A 1N2VA 4X3ZA 1KW1A 3ITLA 3ANYA 5D9MA 1RCXB 3GG8A 1DWIM 2ZUMA 2OEMA 1SO6A 2Z2BA 3GW0A 3UW6A 3IIVA 3IJIA 2HS6A 4RNHA 4NKCA 4DRSA 3LMZA 4FXSA 3ZLHA 1AMYA 5FKYA 3QJAA 2TRSA 4NX5A 1V93A 1S2UA 3PC0A 3FAWA 4Q8UA 4NZ4A 1VBGA 3DIPA 2J6XA 3WDIA 2VX6A 4HA0A 1MRAA 3S5SA 2HPMA 3WIJA 5CSSA 1XFCA 4MNLA 1RAKA 3NOYA 4IT1A 1JI2A 1VYRA 2PTZA 2EHHA 3UZZA 3A3WA 4W7UA 3SRHA 4X61A 3UWVA 3ARQA 3HPSA 3VD9A 2ZUUA 4Q8QA 1WDWA 5D2YA 3G77A 4GKTA 1DYSA 1DJXA 2ZZ3A 1B90A 1F4AA 1HJXA 2V67A 4IICA 3PBWA 4PBEA 5CGTA 5CBBA 2WZEA 1T96A 3W1LA 4B5SA 3ITGA 3EDEA 4CNPA 1PHWA 1ITUA 4QNEA 1ZAJA 1G7UA 2OR2A 3TC6A 1N82A 1GJUA 2WMJA 2HWGA 3WMLA 2ZRWA 3LHWA 3LGDA 3IGUA 3OJGA 5E5CA 2OQYA 1LOSA 5KMYA 2YCLA 2CKSA 1RA0A 2CLKA 2D2OA 3C2RA 3FYPA 2DSUA 3EEZA 1W3KA 1R3RA 1JF5A 1F07A 1UMYA 3MW7A 4GH1A 5AFDA 1PE1A 2G96A 3KZPA 3CUZA 4PMUA 5EA9A 1W31A 4E0CA 2RFGA 4RV3A 3AYTA 3Q58A 1GVFA 3THDA 1V6WA 2JK2A 4J3TA 1TCDA 5I07A 4REQA 3AHZA 1Z41A 2AOSA 3ZT7A 4GXPA 2OOGA 1M3UA 2GDQA 2F38A 4YTQA 2GK1A 3O05A 3LXAA 3KRSA 2WHMA 4WK9A 3W7NA 2QAPA 5HBFA 2A2IA 1J0HA 3CMJA 5EBUA 3S6DA 4UB9A 4XO6A 3W01A 2A85A 4E5TA 2B0MA 3LV6A 2BG5A 3HGJA 1EO7A 2A79A 3MMWA 1RXOB 4RE4A 4OQVA 1J01A 5A8GA 1V0LA 1C93A 1M68A 4FXRA 1XYFA 1F3XA 4M82A 3LI1A 3O2LA 5I79A 2YLAA 3TR2A 4DUOA 3VD3A 3W37A 1MQRA 4LYKA 3ZZ1A 1KFEA 2R1KA 2CLOA 1EX1A 3CUJA 3WK1A 5I09A 2QAFA 4M3PA 1VP5A 2VGGA 5CJNA 3TTEA 3WD3A 2I57A 2G97A 3MVIA 4CQAA 3A3XA 8XIMA 3B8UA 4I8DA 4BI7A 1R2TA 4QEEA 4ZVJA 4KERA 2QV4A 4S2CA 2PDMA 1GQNA 3BG5A 4QE4A 4F9DA 3BMXA 4MG4A 1GHRA 4O0KA 3RO8A 3I6TA 3MKCA 3VIJA 2OGYA 1M53A 1XW8A 4LUSA 1XYCA 4M24A 3WH7A 2VC9A 2J66A 3MWAA 5K9XA 3B06A 4JZ5A 5GVJA 4KS0A 1TJ0A 4XK2A 4JX5A 4L9XA 1O4UA 5K9CA 1GG1A 2XU2A 3S2LA 4ZL1A 3PZTA 1KBJA 1BSLA 3T2QA 4IMCA 5CGMA 4MTVA 4AMCA 3WQDA 3CMFA 3EB4A 4FR1A 1H5YA 5A6LA 5EMUA 3B0UX 1ONWA 1LOLA 1TFVA 5A6TC 1EJRC 1QVBA 2NX3A 4IF2A 1QI4A 1V3IA 1LL6A 3RUBL 4GD0A 4EOUA 3N4AA 5MHBA 3T78A 1VPYA 3PAOA 4GK8A 1GW1A 3EOEA 3LYEA 5FOOA 4U33A 3L0NA 1RY8A 1HGWA 1XC6A 1HKVA 5B7YA 4LUTA 1ZJBA 3VUSA 2QCLA 3QKZA 3B8DA 2HNHA 2DPEA 3DGRA 2D3NA 1WZKA 5XINA 3LENA 3NZRA 4AY7A 3VILA 3KRUA 2PDUA 1RZMA 2RDUA 2QJJA 3C5QA 2P8BA 2AKMA 3HPAA 1DJIA 5EFFA 4C91A 3OGRA 3AXMA 3TYBA 5E0KA 5C9XA 1DV7A 4QP0A 2J78A 2X42A 5IBXA 1L6FA 4K1WA 3OZOA 5AHEA 2GL5A 3S9YA 1W3LA 4GE8A 1TRIA 3TLLA 4NI8A 2YR1A 3W71A 1F7BA 5T9BG 4HPNA 2Z7KA 2CESA 5J04A 3S5NA 4DJFA 2VUNA 4IZGA 1JPMA 4PBGA 4UQBA 4FZIA 2E25A 3OBKA 1GKPA 2XVKA 1VGAA 4U31A 2TPSA 1I1WA 4NF7A 3QV9A 4OWGA 1JUBA 4MM1A 4UBPC 3R10A 2EG6A 3KCOA 4H9VA 4K68A 3E0IA 1A80A 1PPIA 5D05A 5M03A 1QPRA 4ORIA 3PK7A 2I1OA 4CN4A 3LTYA 1P0BA 1WX0A 3LRKA 4JNZA 2PFHA 2PGFA 4W8BA 4JFVA 2YA2A 5A1AA 1CGVA 4UTTA 2QCGA 4S3KA 4EE9A 4C6QA 4LX4A 4AWTA 4CNUA 3LB0A 4AXNA 1I2PA 5FJIA 5I3KA 3GNXA 3GIYA 5CG0A 4ENLA 1I8JA 1HF6A 3I4KA 4O1EA 4NZ3A 4CU8A 3CPRA 4FOJA 4LYQA 1HIZA 3L4XA 1QNQA 2CZ5A 1O94A 3DFHA 1KRCC 3AC0A 2ZRUA 3SUWA 1XBXA 5FF0A 1T8QA 1VBRA 1KM0A 3LBCA 2I14A 3SEPA 4LNCA 4PR4A 2ONEA 4Y8FA 3GIPA 4CU6A 1LT7A 3SAZA 4ZZ9A 4RPPA 5G4HC 2QCFA 3FYYA 3UZWA 1XLLA 1EH9A 4XZBA 3B40A 2BY2A 4LVFA 5KEZA 4Q8MA 3B05A 2F8QA 5FEZA 2X16A 4CQDA 4Q8OA 2BS9A 3NQ2A 1QNRA 1S5MA 1JAKA 3M44A 2WVVA 3UYCA 4CKQA 4Q8PA 1V0KA 2AL2B 3B4YA 3CM4A 4PB3A 3WL0A 4MAVA 2PPGA 5DY3A 3GKAA 4V1XA 2NLIA 1CT5A 3LY0A 3K2GA 1F6YA 5EMYA 2PDBA 1WNOA 4RE0A 3H4WA 2OG9A 1TX0A 3M4HA 3TU9A 1XXXA 1RJRA 3A22A 2FGBA 2PP3A 2WO5A 4LAMA 4PUDA 3HFTA 5CSRA 1XCXA 1NDWA 1MEIA 1OYCA 4X9SA 1OCJA 3NSMA 1LL4A 5TIMA 2A4AA 4TMCA 4LF2A 2XGBA 3GRIA 1WZMA 1OX4B 3CTTA 2Q71A 5KITA 2FPTA 4JIPA 1PEZA 1DWAM 3LCWA 3PSWA 4WLCA 1KBKA 3PB2A 3PTKA 1TA3B 5DCEA 2R94A 3S46A 1EDQA 4TIMA 1EB3A 3ONCA 1IEXA 1KR1A 5EL1A 1UWTA 3PZUA 4IQLA 3TN4A 1ISZA 4PSPA 4AD2A 3A5FA 1QUMA 3UR5A 2RUSA 4C6KA 1O95A 1LBMA 1F8IA 3GSMA 3H70A 4LGXA 2ICSA 1Q6LA 3N12A 4F66A 3WK3A 3SFKA 3RLUA 5I3HA 1KCZA 4O11A 3VOCA 3G6LA 2WC4A 4M5PA 3WD2A 4UTTC 2BV9A 4X2PA 3M07A 4FS9A 2E5CA 3AJXA 4E2DA 3QKEA 2VZUA 2V5JA 4QQUA 4W89A 5HULA 3QEZA 4V33A 4ZO8A 4P8UA 4BZYA 1ADOA 4DAFA 1ZTVA 2GZXA 4GX9A 4S3BA 5HPCA 3I68A 2P76A 2VRKA 4AX7A 2V8ZA 4GI6A 3A4AA 1RV8A 1VS1A 3BTNA 3DFQA 5H8PA 4WIWA 1JD7A 2BGSA 2RDXA 3WELA 4B4FA 1TIWA 4JHMA 4D1JA 4M1BA 1GOQA 1J0ZA 4NL1A 1UD6A 4JN6A 3C2YA 4XAYA 4JTRA 4YJ5A 4N7QA 2C14A 5E1QA 1JL8A 4BJHA 4JTIA 3RAOA 2HDJA 3BANA 1QO5A 1K8YA 3AZRA 4NRRA 5K9DA 4Z2JA 1W1VA 3AIWA 2WLZA 4DX3A 5GJNA 1XLJA 3TMLA 1QW7A 5A69A 1NARA 1R46A 4DJFD 3QW3A 1K9TA 4GI4A 4GI9A 1BEUA 3OODA 4O52A 5G2HA 1V3JA 4PE8A 1XYZA 4WGHA 5CBIA 1DKWA 3FFSA 5LHEA 3L2MA 3AISA 4PSRA 3UXAA 4IISA 3IGHX 4EK7A 5BU6A 5G1MA 3M16A 3IS4A 1EBHA 2OLHA 3UJRA 3HQ1A 1YPIA 3CWHA 3B04A 4GY1A 3W2MA 4FALA 3CNYA 1XIEA 1JQVA 5C9WA 1DWHM 3CQKA 1V0NA 3DEQA 1CLXA 3EBVA 5I3GA 1CECA 4GA8A 4IFRA 4KIRA 5BROA 3PBVA 4DJDC 1ODZA 1T8XA 1RPKA 4ORMA 1J8VA 3ZJ7A 4HK5A 3LGGA 4QNWA 4RNIA 2G95A 4GUIA 1GJPA 3WUBA 1VJSA 3M5VA 3P2VA 3CYJA 3FSUA 4XAZA 3SY8A 4NZJA 4YTUA 3PBGA 4J28A 3UVIA 4WF7A 1EF3A 2H8ZA 4L9YA 5BXPA 2G4FA 1XH1A 3H22A 3AXIA 4NG3A 1TMQA 3ZSTA 1R3SA 5EMLA 3A6OA 1JGIA 5JMUA 4AW7A 2O92A 1BYDA 3HJZA 3GM8A 3CLMA 4KRUA 2PDKA 2YCLB 5H8UA 1PKNA 4EAMA 3CHFA 3KP1A 3U5YA 1KFLA 5TBOA 5IRPA 1R2RA 3SY5A 1OZQA 2C79A 4MOZA 1Q3NA 1LQ2A 3FXGA 3AMLA 4NXSA 1FHUA 3AYSA 2O9TA 2OXNA 2OGJA 5FF2A 2ZCGA 2POZA 3IWPA 1FWAC 5IBXC 2Q3RA 2B7QA 5JU6A 3E0VA 3OTRA 3WBWA 1R5YA 3AS1A 3LCHA 2P3EA 3UY8A 3BW3A 1D8CA 1XICA 2WJDA 3E74A 4FNTA 1WXZA 5ABTA 4YCOA 3CZGA 1EHNA 4A6GA 3S47A 4Z1DA 1SMAA 4HCDA 3W82A 1A5AA 3NQGA 3ZT6A 1ELSA 1MQQA 7TIMA 4O8RA 2YL8A 5JIPA 1T0OA 2DH2A 2EG7A 4ERAA 2E6DA 1AD4A 4HZ8A 1M01A 3CAVA 5ECVA 2NUWA 1YDNA 4J3WA 1UKQA 1BKHA 3QYQA 5DANA 1XRSA 3TZFA 3UJEA 2GFTA 3E6EA 4PMRA 1L6WA 4JTKA 3CLWA 3A13A 1WOAA 1UZ4A 3PNZA 2P0IA 4F2UA 3GVWA 3EDJA 1XG3A 3NEVA 3NL2A 4BQ5A 3JS3A 5LNRA 3L5AA 1YX1A 4N4PA 2FGZA 3CZKA 4BI6A 3PZNA 1XWYA 3ZR6A 1YXYA 2RJGA 2ZX8A 3KTCA 1CXFA 5FA5A 3UWUA 1GGOA 3TP4A 9RUBA 4XD4A 2PE4A 1TJPA 3HV9A 3O7UA 4L1XA 5T26A 3MYPA 1PWMA 5EMJA 5DRIA 2XFYA 1OFOA 3G0UA 4HKPA 3DYOA 1EUAA 3WBXA 4GYPA 4HYRA 2GQAA 2IKHA 1FA2A 4J35A 1EPXA 2Y88A 4L4OA 2POTA 1EDGA 4XQ6A 2WVUA 3FX4A 4GINA 4XSLA 3OYZA 2Z1WA 5H1WA 4BY3A 1EPVA 2J88A 4AZCA 4DO5A 2ZTKA 2WANA 4BQ2A 1BG9A 3P74A 1M9HA 4J3VA 3TN6A 1CLKA 1E40A 3QRHA 1ZPTA 3G8RA 4N9CA 4HTYA 4RW3A 2WHJA 3QC3A 7A3HA 4PTMA 2W79A 4FIQA 4AWSA 4W4QA 2REQA 1CYGA 1BWLA 4XWUA 2QEZA 3UPMA 3ZQ9A 5EPDA 4FNSA 2QGHA 4DI9A 1XDLA 1FH9A 4YWSA 1HL9A 1V7YA 5U7SA 1ICSA 5LXEA 2CITA 3IIPA 4HCHA 4E38A 3W6YA 1PHQA 2C19A 1EGZA 3L4TA 2UBPC 2ON3A 4IPLA 1CENA 4C6MA 1O1ZA 3BH4A 1LQAA 3SCOA 4L80A 3G1XA 1JZ4A 2P3ZA 4PMZA 1XGZA 1UWAA 2W63A 1PXGA 1HT6A 2FHBA 4BF5A 4A3UA 1FCBA 2D24A 4XBJA 2QV5A 3QY6A 2HNEA 3W7HA 4G8TA 5E0CA 1H1NA 1XLBA 2V5LA 3ELFA 3GDTA 2ISSA 4TV5A 3CL7A 3CIVA 3WEOA 4OFCA 1UKPA 2WJFA 2I5GA 1KM6A 1CB2A 2PWVA 1TPC1 3PSVA 5FL0A 5ABEA 2V9DA 3M0KA 4LVBA 3RGTA 3N19B 2CXEA 1FWBC 1ZY9A 5J5DA 2ZC1A 3FYOA 3AMCA 1ZJHA 4DBWA 1PDYA 2AMXA 1RJQA 2J62A 3TYAA 5CPNA 1GOWA 1U33A 1BTMA 3GXMA 3ENLA 4LC8A 3PB0A 4TVDA 1Q66A 1WV2A 4O12A 4QG9A 3IACA 1OQFA 5CZSA 3OVQA 4B16A 4HMCA 2XG9A 1MDLA 3VOFA 3WLIA 3LPGA 2DZWA 4WDUA 2XH4A 5G4EA 4ZQCA 1GHSA 4QJ4B 1E6RA 4KETA 4BI5A 3LCGA 1AW5A 5HPOA 3MKVA 4RDWA 1K7EA 2QQ6A 4Z08A 1SO5A 3W1XA 4LTSA 2QVNA 3TZNA 2X1IA 4R7WA