3CUFA

Cellulomonas fimi xylanase/cellulase cex (cf xyn10a) in complex with cellobiose-like isofagomine
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
314
structure length
314
Chain Sequence
b'ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAFGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exo-beta-1,4-glucanase
publication title Probing the binding sites of Family 10 and 11 Xylanases with extended Oligosaccharides
rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
total genus 132
structure length 314
sequence length 314
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cufA00
5A6SA 2J7CA 3AYRA 1HJQA 3DC0A 4F66A 4W8AA 4M24A 4GI8A 1F4AA 4W87A 2VUYA 2VZTA 4GI9A 3ZSTA 2WZEA 1RPKA 3AMDA 3MO4A 4UFMA 1XH2A 5EFDA 3WFZA 1OM0A 4DWSB 2BY0A 1ZS2A 3A47A 2WANA 1AQ0A 1MFUA 1UH2A 2VX4A 1J18A 1NOUA 1UR1A 3IJ9A 5A6LA 2DH2A 1Q4NX 1WAWA 4M81A 3VMNA 1UWSA 3GM8A 2FGLA 2UY5A 4U5KA 3OIHA 2GK1B 5HXMA 1VAHA 1BGAA 2G8ZA 1FH7A 1MVYA 4W8BA 2OSXA 5ECUA 2W67A 5DF0A 4F8XA 3AHXA 1WCGA 3EDDA 3SCPA 2AAAA 2OSWA 2J47A 4RE2A 4JFVA 3ZSSA 5F7UA 3ZJ8A 2GJPA 5JBFA 5AYIA 1OBAA 1CECA 1J0JA 1DWJM 4HZ7A 3CLWA 3AIUA 3OG2A 3WNMA 1GORA 5C8BB 3M07A 4CD8A 3TP4A 2XVGA 1J12A 1CXHA 1LWJA 4CU7A 1JZ4A 4BCEA 5IHRA 1J0IA 2BVDA 1WP6A 1NP2A 2Y2WA 3MMUA 3BLPX 5ABGA 4AD4A 1BVZA 5HPCA 4UOZA 4ZXOA 1CENA 2X09A 1CGWA 4J3WA 1NQ6A 1HP5A 4B16A 3DYMA 2CBJA 2DIJA 4JFUA 4WJXA 4AZ7A 3CMGA 3T2PA 2WCSA 3SCSA 2D1ZA 1QNRA 3VU2A 2PWEA 1UZ1A 1DP0A 4PBGA 4A4AA 1FHDA 2YIHA 1TE1A 1E1EA 2F8QA 1J0KA 4L4OA 2JF7A 1XD1A 3BH4A 5M03A 4F79A 4N42A 2FH6A 3QHNA 3T0AA 5A95A 2WYSA 1W9DM 1C8QA 1GQIA 1CGVA 1OT1A 1V6UA 5LA1A 3AISA 2O9PA 3GBDA 4X0VA 1CGTA 1UR9A 2VQTA 4M29A 4KMQA 4AZCA 4MJ2A 2CYGA 1KWGA 4XX6A 3N9KA 4H8HA 1MQPA 1JZ6A 3WL0A 2HISA 1R7AA 4UQBA 4JL1A 2XJ7A 3L4TA 1QNOA 1QNPA 2VTFA 4E4PA 3GZAA 2J62A 3N18A 1KXTA 2VRQA 3WH9A 1SMAA 1KB3A 3GDBA 4CVWA 1XSKA 3FHAA 3OLEA 4W7WA 1U2YA 4PMXA 1VFUA 2XPKA 1UR0A 1H0GA 3PZGA 1EHNA 4L4PA 2J74A 3BAKA 3AJ7A 5FD0A 3CHDA 2ZOXA 4P8WA 3HMCA 5ABHA 3QOMA 3VD9A 4TVCA 2Y8VA 4OOZA 3WD3A 2J4GA 1HKMA 1W32A 4MNJA 3MUY1 2W63A 2W62A 3VDCA 4PMZA 1AQMA 3F4VA 2X05A 1HL8A 4WSJA 5JIWA 1Q6DA 3OZPA 3AIRA 4QCEA 4AZGA 4GKLA 2GSJA 4DUWA 1ZBKA 3AS1A 3CBWA 2XM2A 1VEPA 4K68A 4Y7EA 4W5UA 2FHFA 3M7SA 2GJXA 3AHTA 3BSHA 1V02E 1VFMA 5I23A 4KH2A 3PZIA 1V0KA 4MAVA 2EO7A 2EQDA 1AMYA 3ARQA 3M6DA 1GQJA 4GO8A 2GDUA 4GZEA 4NRRA 3RJXA 3MSDA 3S6TA 3WDHA 5I6SA 2VRKA 3SCOA 1W1PA 2WVVA 2PWHA 2VO5A 3LPOA 1V0MA 3VMPA 3K1DA 3WFLA 3WQWA 2D0GA 1LG2A 4AZ5A 4P7NA 6CGTA 4DWSC 3UG5A 1NP0A 3RCNA 2WC7A 4U3CA 3UR8A 1SFSA 3ALFA 2YDSA 1PIFA 1HJWA 3FY1A 1GOKA 4PTMA 4U5IA 1OD0A 1UR8A 3THCA 4EE9A 2W91A 4D71A 4CN4A 1UD8A 1N82A 3A4XA 3D3AA 2MANA 3VX0A 4HMCA 3PZUA 3UR7A 1UR4A 3VIFA 1V6YA 2EEXA 3ZJ7A 4J3UA 3ARWA 1BSIA 3DECA 3VM5A 1JZ2A 2ZWZA 3PZVA 1MQQA 2XIBA 4FK9A 1CDGA 2V5DA 1D7FA 4CD4A 2WZHA 2Y5EA 1M04A 4CCCA 1XV8A 5DT7A 4QFUA 1LL6A 4HOWA 1H2JA 4BZYA 2YDQA 1TCMA 3ZJKA 4AWEA 3TONA 5CPTA 3OZOA 3VIGA 3T09A 4FLOA 1V6WA 3N04A 1JF5A 3RM4A 4D1IA 5CXPA 2WMHA 4UFIA 1R7OA 1WDPA 3W53A 4J3SA 4E8DA 1KXHA 1HKJA 2QHAA 1JYWA 4WKHA 2WWDA 2D3LA 3MUZ1 4PTXA 1V0LA 1MXGA 2CKRA 1PJ9A 4GINA 1NOFA 1ECEA 4PEEA 3ARVA 1I1XA 4FMVA 4LYRA 4Z2HA 3W26A 2VL4A 5JBEA 2ZXBA 3N15A 1E6QM 2XGIA 1EHAA 2G41A 5D4YA 5A6BD 1J0ZA 5A8PA 3AZSA 3WUFA 3N12A 3WMCA 4NSBA 2WSKA 1W3KA 1A47A 4JHZA 1CXEA 4W7UA 1GHRA 2VZSA 3BGAA 3UETA 5CJ5A 6TAAA 4TTGA 1CBGA 1ITCA 3U7VA 5M5DA 2V3EA 3L4WA 3BCFA 2GDVA 3OGSA 2V5CA 3ZT5A 2CESA 3CUJA 1BFNA 3ARRA 4FLRA 2D0HA 2XVNA 4PMQA 5FKYA 3AXIA 4KRTA 4M82A 2E9LA 1JZ8A 1GJUA 1DWGM 2J78A 2OLHA 4TVDA 1PX3A 2J8GA 2WHMA 5C71A 3K4DA 4Z2GA 2AOSA 2CNCA 2XSAA 1Z32X 1G0CA 1JD7A 4AIOA 3IK2A 3AIWA 1W2VA 3CZEA 1ISZA 1E5NA 1K9EA 1VJSA 1V02A 1C90A 5BRPA 2EJ1A 2VR5A 1VF8A 3ALGA 4UFJA 1US2A 1WZKA 4IUGA 2CERA 2F2HA 4GI6A 1HP4A 4OIFA 3WD2A 2EPNA 2X0HA 4TXEA 1E70M 1DEDA 3VM7A 1GNXA 2DT2A 1JXKA 4JCLA 2W4XA 1CZ1A 1B30A 2ZIDA 1JFHA 3KE0A 5D9OA 3SCTA 1H0IA 3EYPA 2WSPA 4ZEPA 5A2CA 3WH5A 2VZVA 3SUSA 1E56A 4H2CA 3NYDA 5AYBA 4PMNA 2WMIB 4H41A 1MW3A 1EIBA 4C7DA 1DTUA 1SR0A 3NSXA 5AY7A 4PTWA 1WE5A 3N17A 2XWEA 5A8MA 1FA2A 1HJXA 2DPEA 3UCQA 4DUXA 5E6ZA 1KXVA 2G3MA 3MU7A 1VFOA 2WZIA 4HPHA 1WDRA 1CXFA 3OLDA 1V3LA 3APGA 1OCQA 1B3WA 2EPMX 5ABFA 2O9RA 1E3ZA 3WL1A 2J25A 1QI5A 1H09A 3KL3A 1QOXA 5IXEA 3WBAA 5D8ZA 1BYBA 3AICA 1K9DA 3MV01 1QI3A 1JI2A 1FFRA 4CKQA 3WH8A 1TR1A 4FLSA 1KGWA 2ZICA 2HVMA 3K46A 1ITXA 2JIEA 5AC5A 2YKKA 4ZE4A 1HXJA 2PWGA 2D0FA 3PZ9A 2EPOA 3WD0A 1WKYA 1IZKA 3U57A 4UFLA 1ZU8A 1CGUA 8A3HA 1GQLA 4W89A 1BYDA 1W9UA 1KCKA 5BXTA 3CUHA 4PTVA 4BQ3A 1V0NA 4PMRA 2IXVA 3EDKA 2A3AA 1XRVA 2E8YA 3DHPA 2VVSA 3MKKA 3WF3A 3AHVA 2WPGA 1C92A 1UOKA 2NT1A 4NF7A 1GPFA 2WHKA 1QI2A 4E8CA 3KWXA 1XC6A 1XYZA 3POHA 1P6WA 3WQ6A 4MAZA 4W93A 4Z2KA 3VUPA 2WKLA 4QLKA 4LX4A 1H49A 4AMCA 1EO5A 3AQUA 5I2UA 3CHCA 4UQ9A 4Z2LA 3TTQA 2W66A 4ML4A 3SCWA 1E15A 1V3JA 1FHLA 2PF0A 4UQEA 1QBBA 7A3HA 2DT0A 5D9MA 2ZX8A 4IM4A 4YHGA 3VIPA 2YA0A 1OT2A 1WDSA 2WM0A 3AMGA 3WQ5A 4ATLA 1NARA 4HZ6A 4P7RA 5HBFA 4P8VA 2WKGA 4TOQA 1UG6A 5A1AA 3AHZA 1XSJA 1UD5A 4MB1A 4CUCA 2FHCA 1E72M 2FH8A 5BXPA 1UKSA 4Z2JA 5AC4A 3VIOA 3ZT6A 1QHOA 4F9DA 4MDOA 2CPUA 1E6RA 5BCAA 2A3HA 1E3XA 1J10A 2QPSA 4A3YA 2ZUUA 3GXMA 3AS3A 4EAMA 1Y7VA 1GUVA 5I78A 3WF4A 2RGLA 4AD3A 5CZKA 4U3AA 4J7RA 1QHPA 2J7HA 1TA3A 3RJYA 4AXNA 1QHZA 5A69A 2DIEA 4J3VA 1BVNP 1FP9A 1GOQA 1QI0A 2QV4A 4PMVA 2PWDA 3CHEA 2YA2A 1RD6A 3AOFA 3BLKA 4AISA 1NWRA 5CGTA 1KBKA 3EDEA 1E4NA 1ZBWA 1OIFA 4M8UA 4NRSA 4B3KA 1E0VA 3VTRA 4U31A 3IJ7A 3NCOA 1JD9A 4ATWA 1V6XA 1BPLB 3AS0A 4WF7A 4HOZA 4UCFA 3B9AA 4HU0A 5BYWA 3VD7A 1TUXA 3VD4A 1V08A 4AZCB 4AYSA 2XFYA 3WSUA 3K4AA 3W81A 2D23A 4BQ4A 1WZMA 1K6AA 2PI6A 2CETA 2CBIA 1J11A 4JKKA 4QLLA 1G94A 3O2LA 5FIPA 3L4XA 1IT0A 2BXZA 2YJQA 2J7BA 1B3ZA 1KWKA 1EA9C 3QHOA 1IV8A 2FDMA 3HU7A 2EPLX 1UD4A 1E43A 2WLZA 1M53A 1MW0A 4OZOA 1BF2A 1HJSA 2WBKA 1JZ7A 3AXHA 1W91A 4V2XA 2GJRA 3EMZA 5E70A 2WMFA 3MMDA 3WD1A 5IFTA 3ECQA 2XFRA 1J9YA 1GONA 4AC1X 2EBNA 1ZJBA 2QF8A 3WQ4A 5HPOA 2Z1SA 3SUUA 2VC9A 3J7HA 2Z1KA 1QW9A 1LG1A 1GZJA 2PWFA 4W88A 2ZUVA 5CSYA 1A3HA 3K8MA 2WK2A 2VMFA 1WZAA 1UWIA 5DEZA 4AZIA 1UH4A 1B2YA 1CXLA 1W3HA 2E8ZA 4AIEA 4TVUA 4ZENA 4R5EA 3W6LA 2BY1A 4UFKA 3A4AA 4BS0A 1V6VA 1B0IA 5LYRA 1ISVA 1PAMA 2V3GA 4PMUA 1UQYA 1DWHM 1HKIA 4UR9A 1I75A 5A2AA 1E6SM 4LPCA 4ZXLA 4BA0A 2DT3A 3SEPA 3IANA 2UWFA 2VX6A 1EQPA 5A94A 4YN5A 1J0HA 3SCQA 1CGYA 2CHNA 4ACZB 1Q6EA 3HN3A 2BNJA 1E0WA 1E0XA 1R86A 4J27A 2WVVB 4U2YA 2J7FA 4HTYA 1JXJA 5D9NA 1OWQA 3VIKA 3RPMA 4ZE5A 3CO4A 3EBVA 4CGTA 4J3TA 2ZUMA 1AQHA 3FW6A 5GQBA 3WNNA 3VGHA 4CU6A 2VCAA 3PTMA 5C70A 3VDAA 2VCBA 4D6IA 3VIIA 4NI3A 4AZHA 1GOWA 5I24A 3OLGA 1TMQA 3G6MA 2VZUA 5A8NA 1KCLA 1XGZA 1PZ3A 3BXWA 2DEPA 3WF1A 3WEZA 1JF6A 1X6NA 8CGTA 1M03A 4UQAA 4ZFMA 5M17A 4PCSA 4GO9A 1JL8A 1NWTA 4FLQA 4AD5A 1HN1A 1KFWA 3U7BA 1LJYA 4PN2A 4HZ8A 5A6MA 1HNYA 3GNRA 1VIWA 4HMDA 4MADA 4FF5A 5E0FA 4W85A 4WKFA 3RM9A 2OWXA 3AHYA 5CLWA 1CEOA 1TFVA 1DWAM 4UZSA 3A4WA 3WEMA 4HMEA 5EMYA 1W9XA 2DSVA 3CZ8A 2VJXA 3TTYA 2CCRA 1V3KA 4KWUA 1CIUA 3NJ3A 4LYQA 3EMQA 5A3HA 3W24A 5EBAA 3OBAA 1YQ2A 3WN6A 1HL9A 1E73M 2YBTA 1JIBA 5GNZA 5A6JA 3NIYA 3ARUA 1UUQA 4AY1A 2D22A 3AROA 3IJ8A 2BVTA 1MWOA 3AMCA 4QP0A 3VGEA 2YL6A 3LPGA 3VINA 1MFVA 3N1AA 1JNEA 3FHQA 3W6MA 4XZWA 5A6AA 1ZB5A 2C0HA 2JIWA 3RIKA 5LA0A 4D6DA 2ZUSA 4IPLA 1MYRA 5TD4A 2OYKA 4PMDA 2Q8XA 3POCA 4PYSA 1CXKA 3OB8A 3BAIA 2ZX5A 3WY1A 4AEEA 3GTNA 3OA5A 1JDCA 3SIMA 4PMYA 2UY2A 1JGIA 2WMGA 2CHOA 2E9MA 3UEQA 4DUVA 2G3JA 2WCAA 1O6IA 4JZ5A 1SMDA 4PUDA 4X9YA 5ABEA 3CTTA 4P8XA 5GNXA 3AIQA 4BF7A 2VNCA 3BMWA 1JZ3A 1QBAA 2VX7A 1E5JA 2ZUWA 4LGXA 3QHMA 1GOOA 4UZUA 4TX8A 2AMGA 2ZX6A 3VIHA 3IAQA 4D1JA 2ZXQA 2J79A 2G3IA 4JHOA 1UHVA 4RL3A 1OSEA 6A3HA 1E9LA 3VILA 2PB1A 1Q6FA 3VGBA 1EO7A 2CBUA 3NSNA 5I79A 1LF1A 2X2YA 3WKZA 1C91A 1M7XA 3HJEA 1KXQA 4D6CA 3WH6A 2WNWA 4WLCA 4OUEA 1H5VA 4BQ5A 3BAWA 4H8UA 3WDPP 1H41A 1CTNA 5GPRA 4BQ2A 3AIEA 4CU8A 1VEMA 3ZIZA 2WB5A 1PX8A 1CLVA 5KEZA 1KBBA 3CMJA 3T0BA 1E1FA 4JFWA 5IDIA 1SYTA 2Y4SA 5A6BA 1R87A 3PHAA 3NDYA 4R27A 2WVUA 1XH0A 2YL8A 3TA9A 1OGGA 5E6YA 2WXDM 4GQRA 1QPKA 5HOSA 2VRJA 2GFTA 1X6LA 2BY2A 2ZWYA 1OIMA 1FH9A 5M3WA 5A8QA 3VD3A 3ARTA 1BG4A 2QLYA 3CZLA 2CBVA 4GZJA 4HA4A 3BMVA 5GNYA 4LXFA 3VGFA 1E6PA 4CN6A 1QVBA 4OKDA 2DSKA 2G4FA 4P7QA 1EDTA 4MB4A 1V3HA 2XFFA 4D6JA 3WUBA 2E40A 1B3YA 3U5UA 3UESA 1Q6CA 3MUIA 2BS9A 1GJWA 1QI4A 1VENA 3AZRA 2JALA 1MXDA 4UNIA 5DT5A 3T08A 1OGSA 5ABFB 4W5ZA 2WW5A 5A8OA 1CLXA 1FOBA 2DH3A 3VGGA 1L0PA 1WDQA 3BC9A 2VURA 2NW0A 4HP5A 1E4LA 2W61A 5CLTA 4GIAA 4E2OA 2WLYA 3O9NA 2PBGA 3T2QA 1W9VA 4CD6A 1CXIA 2FGZA 3ARXA 2OWCA 1YHTA 4MPKA 1KQYA 2B31A 3AMLA 1HT6A 2TAAA 1J01A 1Q6GA 5BROA 3UG4A 3AIBA 5FL0A 3OGRA 3SCUA 4GZIA 3I3BA 1GQKA 4MNMA 3THDA 4DWSD 1OINA 5E9AA 3WF0A 5EFFA 1JZ5A 3ARZA 1E6NA 4PMOA 2YL5A 3WMSA 2D3NA 2DDXA 1TZ7A 1C7SA 3W82A 4N0RA 1GOMA 3W27A 3GXDA 1V3IA 4DM2A 1XCWA 1ODZA 3VIMA 5DMYA 4CVUA 4HA3A 4U2ZA 1E55A 3CH9A 2D2OA 4ATDA 3TTSA 4TX6A 3E1F1 4U33A 1JYXA 1AVAA 3ZJ6A 4JFTA 3AYSA 2CITA 5DFAA 7CGTA 3EDJA 1JAKA 2UY3A 3MANA 3MS8A 1KGUA 2NT0A 3RILA 3VVGA 1ESWA 3VDBA 3VIJA 2WHLA 1U33A 5CSUA 1DHKA 5FL1A 3WNLA 4B3LA 3KZSA 5I0DA 4M56A 4UOJA 3VPLA 4RE4A 2JF6A 2BHUA 3AIVA 1V3MA 4QDMA 1UD3A 2ZE0A 3D5HA 3CZJA 4DWSA 1UYQA 3WH7A 3FXYA 4UQDA 3ARSA 1CPUA 3CUGA 5JUVA 5CQ1A 1R85A 5I77A 4QLJA 3WNPA 1JYVA 1UWUA 2DT1A 1ISYA 4Z2IA 4J3XA 3F5JA 2XG9A 3OGVA 1UA7A 3LMYA 4H7VA 3VGDA 2GK1A 3GNOA 4M1RA 3K8KA 4D6EA 1U30A 3WDIA 4XUYA 3CIVA 4LYPA 3WNKA 2OYMA 4MB3A 1B3VA 3GH5A 7TAAA 1VRXA 1VB9A 3MV11 2VCCA 1ODUA 3WF2A 1UKTA 2A3BA 1B1YA 1EXPA 1HKKA 1XHGA 4JFSA 1S46A 1TA3B 3M46A 2V3FA 2XHYA 1D3CA 4W8LA 1W9BM 3ZR6A 5CPQA 1OB0A 3WUEA 3UERA 1LQ0A 3DYOA 3AFBA 4HA1A 3ZT7A 4JAWA 2DSZA 1B90A 3PZTA 1EOKA 3CUFA 5CG0A 3GYCA 1WNOA 3CGTA 3T0DA 4AEFA 4AIUA 1C8YA 4B9ZA 4S3KA 4CCDA 4OJYA 3CZGA 5HDRA 4WSKA 1XYFA 1WO2A 3ZO9A 4B9YA 4UFHA 4QAWA 1W1VA 3WDQA 4OOUA 3B9DA 1EDGA 4AD0A 1EQCA 1EDQA 3SUVA 1PBGA 2X8RA 1UQZA 2A3CA 3EDFA 3SUTA 2Y8KA 3GXIA 4CD7A 2E4TA 3ZOAA 3WEOA 2E0PA 3WD4A 1FP8A 2WMKA 3SCRA 2VI0A 1HX0A 1NWUA 2PBOA 4JKLA 1ZJAA 2DQXA 2X1IA 1VFFA 2NSXA 3W4RA 1W1YA 2E9BA 1X1NA 1BGGA 3T2OA 2EXOA 4YPJA 3BSGA 2VT0A 3WNOA 4JCMA 1VEOA 2YLAA 2Y24A 3RO8A 2YOCA 1GVIA 2XGBA 1F4HA 3ARYA 3KEHA 1E71M 3CUIA 3GXFA 4KGJA 4M80A 1UH3A 3WDRA 1NWSA 1V03A 2O92A 4V27A 4XV0A 1RP8A 3II1A 3EMCA 2DGAA 3WENA 1FFQA 3B9EA 2OSYA 3L2MA 1HJVA 3W25A 4MJ4A 2VX5A 1PIGA 2JFEX 3PBGA 2GJXB 3RMEA 1DWFM 1E40A 2VQUA 2ZXAA 3W0KA 2XWDA 2XVKA 2IXUA 1XD0A 1BTCA 2FHBA 2G3NA 3PN8A 2WBGA 3NUKA 3G6LA 1PEZA 2JEQA 1GCYA 1QW8A 1ZBVA 5BWFA 4PSRA 5FOOA 3WIJA 3CPUA 4EKJA 2VR4A 1EOMA 1R8LA 2YDRA 1H11A 1W1TA 2J7DA 1XSIA 4CD5A 1H3GA 4CN1A 2VVNA 4GPNA 2A3EA 2J7EA 2D24A 4D6GA 3VNZA 5BXRA 1GW1A 1KR1A 3JUGA 4GXPA 3VX1A 3A3HA 1B31A 4UOQA 1UD2A 4B15A 5D8WA 1DWIM 2YLLA 1NOWA 2BHYA 2QMKA 1ISWA 3B8SA 2OYLA 4AD1A 4Q7NA 2VOTA 3L4VA 4EK7A 1UA3A 4ACZA 1HVXA 4D6FA 3W38A 2V38A 4AZBA 2ZUNA 1PPIA 3GBEA 2E3ZA 1D2KA 5FCZA 1UR2A 1BAGA 2WHJA 1JAEA 1W3JA 1WB0A 4C7FA 3UG3A 2JE8A 3L2LA 2BXYA 3AS2A 1G01A 1C3FA 2BHZA 3FNDA 2D20A 1GVYA 3KL5A 3VD5A 3VMOA 2IUZA 2WC4A 1LLOA 1ZBCA 1HVQA 1QNQA 1KGXA 2X0YA 3U5YA 3WDJA 4HPGA 5LA2A 3PZQA 3WMBA 3AMKA 4W7VA 1US3A 3VO0A 1TVNA 3AXXA 2O9TA 2J8FA 5I3DA 5I5RA 4V28A 4OBRA 3DHUA 5KZ6A 3WELA 2VZOA 1L8NA 1WZLA 2W92A 2UY4A 1JI1A 1CYGA 4IPNB 2PC8A 3PZNA 3NDZA 4AW7A 2XVPA 4DM1A 4KGLA 2ZX7A 4WKAA 1MW1A 2DSWA 3OLIA 3O6AA 4AD2A 2XSBA 1LL4A 3W28A 4CCEA 4H04A 1UWRA 3TTOA 1MW2A 2W5FA 1O7AA 4LQ1A 4W84A 1CWYA 1BHGA 3GNPA 2EPKX 2J77A 1G5AA 1MQRA 1KR0A 1B3XA 4P8UA 1W2PA 1JG9A 4PSPA 1OD8A 4TUFA 4KRUA 4UTFA 1C7TA 3RDKA 1HIZA 1UZ4A 4WK9A 1W9PA 1TG7A 2O9OA 5IHSA 2OWWA 4MNLA 1E4IA 1UWQA 4MNKA 5DO8A 2XM1A 3TOPA 3N13A 2C8NA 1JYNA 2XIIA 2JEPA 3PTKA 3VDHA 9CGTA 4W86A 1RP9A 5CPSA 1QNSA 5EB8A 3ZQ9A 3ZM8A 1UKPA 1E4MM 4MB5A 2RGMA 5HNNA 2WMJA 1WPCA 4OBSA 3FAWA 3QOKA 5A6KA 1BLIA 3ZR5A 3PTQA 1ZL1A 1BG9A 1E6XM 5IFPA 3MMWA 4AZ6A 2XYLA 1VJZA 5BXSA 4NZCA 3A6OA 1UD6A 2GUYA 3F5KA 4Q22A 4C7GA 4JKMA 1GHSA 2CIPA 2YBUA 1CGXA 3GH4A 4HU8A 3AZTA 3FAXA 1HJUA 3ZMRA 4JL2A 4PCTA 5A2BA 1VBRA 4RE3A 1JNDA 2DSUA 3K8LA 1K9TA 3BCDA 3L4UA 4JIEA 3KL0A 2ESCA 2CXGA 1HF6A 3AI0A 4A3HA 4S3JA 2BY3A 3N11A 4URIA 5E0CA 1IZJA 4MDPA 1M01A 4F9JA 5CGMA 2GVYA 4XB3A 3SURA 3WQ8A 2XTKA 5JBDA 2F61A 2XUCA 3MUAA 2BVYA 2J7GA 4XZBA 3SUWA 1VBUA 3L4YA 3BAXA 4H8VA 2WCGA 2XVLA 1PZ2A 1BYCA 4UQCA 3SCNA 1I1WA 1J0YA 2WVSA 5D9PA 2WMIA 3W29A 3WBEA 4P7OA 1UWTA 2YL9A 1E6ZA 1G9HA 4WIWA 4J28A 2CKSA 4TTUA 3I3EA 4QCFA 1GOIA 3W37A 1LL7A 2CEQA 3GH7A 4X0NA 4PRWA 3DYPA 1C8XA 4D6HA 3WQVA 2QMJA 5E09A 3ARPA 1EGZA 5JIPA 1B9ZA 3CHFA 1RH9A 1KQZA 2BV9A 1EH9A 2WVTA 4P7LA 1JFXA 1H4PA 3PZMA 1TVPA 1LWHA 1H1NA 3IAPA 2YA1A 1JDAA 4MTVA 2WWCA 2WC3A 3VKKA 2ZX9A 4YHEA 2BFGA 3SCVA 5BRQA 1C93A 4ACYA 3MSGA 4EANA 1NM9A 1PX4A 1ISXA 2WAGA 3BAJA 1FH8A 1JDDA 1UKQA 3F5LA 3RM8A 1XH1A 4HOXA 3LPPA 3QGVA 3WUGA 3I3DA 3CZKA 2C7FA 3QR3A 3L4ZA 4IISA 1CNVA 2ZXDA 1NH6A 1OGBA 3FN9A 1W3LA 1BQCA 2QPUA 3LPFA 1BYAA 2J75A 1G1YA 1XCXA 2ZUTA 3BAYA 3VOCA 3PZOA 3VNYA 3S2CA 1K9FA 2V3DA 3NSMA 4GQQA 4PUEA 4D72A 1UKOA
chains in the Genus database with same CATH superfamily
2ZA2A 3SRDA 4W8AA 3GDMA 4DJFC 2VUYA 3P5ZA 2WZEA 1RPKA 3AMDA 3L68A 4C91A 4I6KA 3CC1A 1OM0A 1K77A 2HVOA 2BY0A 1ZS2A 3SI9A 2WJDA 4QE4A 2V68A 1NY1A 4IPIA 1NOUA 3S42A 3B8IA 5MHBA 1HQTA 1M6JA 1UR1A 1Q4NX 3SN1A 5IM51 4M81A 1XUUA 3GM8A 2UY5A 1TTQA 2GK1B 1RPXA 5HXMA 2BODX 2G8ZA 2OPJA 3MWCA 4Q4OA 3VNKA 4UC5A 1MVYA 5DF0A 4F8XA 1GYNA 2DZVA 2PDYA 1EC9A 1OK6A 1XIDA 1UMYA 3EDDA 2AAAA 3PM6A 4JTAA 1ZAJA 4Q4RA 3HZ3A 5JBFA 3GIQA 4XBSA 5XIMA 3VC5A 2VC6A 5F2LA 3C5QA 3H7VA 3UCCA 5C5YA 2Q71A 4FXJA 2HZGA 2TMDA 1E9ZB 2VGBA 1J12A 1H62A 1CXHA 4MY1A 4CU7A 2BVDA 2BX7A 7TIMA 1AH0A 1WP6A 3MMUA 1GVFA 4H83A 1X7FA 3GVGA 2PDPA 3H4WA 2E6DA 1BKHA 3HG5A 2PDJA 1K3UA 3KBMA 2PCQA 3GTIA 4AZ7A 3W7MA 3S4TA 3T2PA 3QW3A 1XFBA 4FS9A 1XRTA 4PBGA 1FHDA 4JTIA 4FX6M 2F8QA 5K2ZA 4L4OA 5M03A 1NEYA 4F79A 4N42A 3QHNA 5KMYA 4MFEA 4XD3A 1K70A 5HMFA 1QMLA 3UZZA 3UNDA 2WYSA 5LNSA 4M51A 1W9DM 3SM0A 1FXPA 1G4PA 1CGVA 1V6UA 1NFGA 1PCWA 1VJIA 4MJ2A 2CYGA 3GFYA 1JZ6A 1MQPA 2HISA 1R7AA 4UQBA 4DYJA 5E0KA 2WQDA 1QNPA 5G1MA 3EA3A 7PTDA 1TIWA 3GZAA 1RY8A 1FRBA 1ME9A 1KXTA 3IARA 1JQVA 3WH9A 3S2NA 4V33A 4NI8A 3TJ4A 1SMAA 1LBMA 1DJGA 4W7WA 2NV1A 3U2CA 1GWJA 4Q8TA 3GRIA 1H0GA 3PZGA 4GMEA 1J6OA 3AXKA 3AJ7A 2G50A 1U22A 4J9JA 2ZOXA 3L0NA 1MMFA 4DNHA 3QOMA 3VD9A 2QCDA 2J4GA 1XLIA 3KCOA 2AL2A 1LROA 2W62A 4PMZA 4KCTA 4IFRA 4K7YA 4PUWA 3OZPA 3AIRA 3A12A 1ZBKA 3AS1A 3YPIA 2X1SA 1J8VA 2XM2A 4K68A 1WKDA 4ZQPA 3NQ7A 1W3NA 3CV7A 3AHTA 4O1AA 1V02E 3TTEA 1VBHA 3IIPA 1VFMA 2AL1A 5I23A 4KH2A 5BOFA 3PZIA 4ZOAA 2EO7A 2QXWA 1AMYA 5D38A 4LC6A 4KKXA 3R2GA 3M6DA 2X1UA 1F05A 4GZEA 1IWBA 4C6KA 1EFZA 5F4SA 2VRKA 2TYSA 5HATA 2WVVA 1IEQA 1S3TC 3WQWA 3G0XA 1IR1A 1ZRQA 3O8AA 3GU9A 2OTDA 4NZ5A 4DWSC 3W1AA 3RCNA 2DZWA 3EB2A 3KDNA 3M0VA 2ZADA 1SFSA 5LIYX 2I56A 4FB7A 1K03A 1GOKA 3W2MA 3SFWA 7XIMA 4KF1A 2A6NA 2XSXA 3N4EA 3VFCA 1LT8A 1OFDA 5HWJA 5C2GA 4EE9A 3KLKA 3RPDA 4QS6A 4CN4A 3TYDA 2GUUA 3A4XA 1LOQA 4HMCA 1UR4A 4Q32A 2EEXA 3FYPA 4IXXA 1TZZA 4IFKA 3VM5A 1DTNA 4YTSA 4FAMA 1M04A 3SSZA 1FUYA 1C9DA 3FIGA 4WXYA 4CCCA 3VOGA 1XV8A 4MKVA 4WSHA 6PTDA 1LL6A 1KRMA 4H2HA 3G18A 3AO0A 4BZYA 4GJJA 5FJJA 3IEBA 2RFGA 5CPTA 4O10A 5JXQA 1EC7A 1HKWA 4DZ5A 3NQ6A 3O07A 3B04A 3CNYA 2WMHA 3QR1A 4UFIA 4HPJA 4DBWA 3G1SA 4M3PA 4R3UA 1Q7QA 3RR4A 2DQWA 2ISSA 3PPFA 1FWHC 4XKYB 4IL2A 5I09A 1U1UA 1SJDA 5FSDC 5IBXC 2CKRA 1BXNA 3LTSA 1NOFA 1VFTA 1ECEA 3ARVA 4YWSA 5JBEA 3LSBA 1E6QM 1XYCA 3KUMA 3LZ5A 4RPQA 3QC0A 4KETA 3WMCA 4AXKA 2WSKA 3G0UA 4I7UA 1A47A 4JHZA 1CXEA 3NQBA 6TAAA 4TTGA 1CBGA 1ITCA 1AJ2A 4DAIA 2V3EA 1Q63A 3LY0A 1OG6A 5D04C 3BANA 1OX4B 1OHLA 4NHVA 2V5CA 3WK1A 3ZT5A 2CESA 4B5UA 1H7OA 1Z41A 3D3FA 3ARRA 4RK8A 2XVNA 3EXRA 2E9LA 1GJUA 4YTRA 1EJTC 2F38A 2J8GA 1XR2A 5C71A 4JYDA 2CNCA 3OU8A 1Z32X 3IK2A 3CZEA 3FCPA 1P0NA 1EP2A 4NAFA 3WJXA 3NGJA 2QJGA 5AHFA 3WK0A 5BRPA 2EJ1A 3TIMA 1EJSC 4UFJA 4UTWC 1UC5A 3DFQA 1XIHA 2CERA 4RW3A 4B2DA 3E38A 1DEDA 5DQPA 3T1GA 2MUCA 4DJEC 2Q09A 4FA3A 1PSCA 1CZ1A 3WQPA 2ISFA 4YMZA 3MKCA 3UGRA 5D9OA 3P3BA 3M0ZA 3PY2A 1UJPA 2DVUA 3CXOA 1AK5A 3C61A 1S2AA 2OELA 4H41A 1MW3A 1EIBA 4C7DA 4KQNA 1DTUA 1NF7A 3NSXA 5EMJA 1KM6A 3H54A 5B7ZA 1G4SA 3M43A 4PTWA 4HB7A 1DKWA 2I5GA 1FA2A 1HJXA 4DUXA 4JNYA 1S38A 2G3MA 3AJXA 1W3TA 3OLDA 1V3LA 4RR4A 1UP0A 4H3DA 4JTDA 1FWAC 5ABFA 2WJZA 2J25A 5AHIA 4GNJA 4L6DA 2G95A 1S5VA 4GG9A 1MSSA 4XAFA 3WBAA 5DCDA 3H53A 1FFRA 4CKQA 3G0SA 2QKFA 2JIEA 3UVIA 3MI6A 3PZ9A 1LWIA 4QR6A 1YPFA 3U57A 3IPWA 1LM1A 3V0SA 5C6MA 3EEZA 4LANA 4W89A 5K4XA 6ALDA 4JTRA 2NQ9A 3UFYA 2V5JA 1KCKA 2V6AA 2AQVA 3OVRA 4BQ3A 2C18A 3M0KA 4PMRA 2ISVA 3DHPA 2VVSA 1A4LA 1BXCA 1O12A 2WPGA 1M5WA 1MUWA 3H23A 1S2WA 1A0EA 1GQNA 5AZ0A 4K37A 1DJNA 4MAZA 4RCXA 2EAWA 4QM1A 3GK0A 4LVFA 3RUBL 2VGGA 3U6WA 1M1BA 3TVAA 2V2CA 3NO3A 3CHCA 6ENLA 3FVDA 1MNSA 3SCWA 2DT0A 2ZX8A 3S5NA 4FOKA 2VENA 4YHGA 3LEPA 4ZCWA 1UUOA 4YS1A 2WM0A 4ATLA 1J6PA 1NARA 4HZ6A 4NZ4A 4P8VA 2WKGA 4TOQA 3CK5A 3B3DA 3UPWA 4CUCA 2FHCA 1E72M 3CL6A 3DU0A 1OF8A 5BXPA 1IXQA 5AC4A 3SR7A 4MDOA 2CPUA 2DUAA 4HSHA 4LUJA 3RX2A 1E3XA 2QPSA 4MYAA 2ZUUA 3GXMA 3AS3A 4EAMA 2ODOA 2OT1A 2BLEA 1Y7VA 3NR0A 5T91A 3D0CA 2P76A 3W22A 3WF4A 5MKGB 3MY9A 4LVDA 4NP7A 1OFBA 4QE1A 1TA3A 5CPOA 1TJRA 5A69A 3W7EA 2EGZA 3LLXA 3PBVA 3M6YA 1GOQA 4A05A 2YA2A 1ONWA 1RD6A 4ZB5A 4LCRA 3AOFA 1NWRA 1O5RA 3GU2A 1K4HA 2O56A 1E4NA 4MZYA 3N2OA 3ONBA 3PS7A 4OGZA 5C2XA 2VFGA 4J1OA 4FX8A 1BPLB 4C6EA 3AS0A 4WF7A 1I0DA 3O7UA 1KFCA 4HU0A 2GZXA 3VD7A 1U83A 4X60A 1V08A 2FMOA 3WSUA 4NG3A 2PI6A 4GHRA 4NNBA 1J11A 1UBPC 4REQB 5FIPA 3L4XA 3STGA 3C6CA 4US5D 5KTLA 3CT2A 5J5DA 3LGGA 1EA9C 2EPLX 1LRNA 1DJIA 5JU6A 3NA8A 4JNMA 2ISWA 1TPFA 2QDEA 3NL6A 4LEQA 2WBKA 1K8ZA 3SW6A 1MEWA 1B9BA 1XDJA 2XFRA 1J9YA 5H8UA 1GONA 4PH6A 1ELSA 2EBNA 1R3QA 3PANA 5HPOA 3DFPA 3HGRA 3J7HA 3SUUA 4CNPA 2Z1KA 4O1FA 1BTMA 1YDNA 4S3BA 1DJZA 3VNMA 2C14A 2PWFA 4AWUA 1RD5A 2ZUVA 1A3HA 2VMFA 3H2CA 4F0SA 4MWAD 2YGYA 1UWIA 2EF9A 4Q4PA 4AZIA 1LQ2A 3GTFA 3LQGA 3N4AA 3FDKA 4TVUA 1EJ7L 1Q2SA 1G7VA 2PMQA 3W02A 1A3WA 1WQ5A 3F4WA 4PMUA 1R3TA 5LIKX 4DO5A 2WNNA 5FAGA 5J5RA 2VC7A 5HULA 4YN5A 2V2HA 4QEHA 1H50A 3GG1A 3MB9A 4ICCX 4E2BA 4ACZB 1R86A 1E0XA 4IG2B 5D9NA 2XH7A 3VIKA 1AUSL 5CH9A 3EWDA 4ZE5A 3EBVA 1AJZA 3OOQA 1NFBA 5GQBA 3WNNA 4YNGA 3V5FA 1YE4A 3BWWA 3PTMA 2VCBA 4UTJA 3BCJA 2AQWA 4AZHA 5I24A 1TMQA 5A8NA 1KCLA 4AWSA 3GE7A 1RK5A 1TELA 2C16A 4DJFD 3KBVA 2VWTA 1JF6A 3N2BA 4ICNA 3M0YA 8CGTA 4ZFMA 1CB2A 4GO9A 1LLZA 3R8RA 1PE1A 4GUGA 3CTLA 2IQ0A 1EP3A 4GYFA 3PB2A 3GW0A 2Y7EA 3GNRA 4MADA 1EJWC 3GUWA 1W17A 4P5UA 2YX0A 3RM9A 4CQ8A 3GX9A 1DWAM 2PGRA 3P93A 6TIMA 1FBAA 1JQXA 5EMYA 2DSVA 1DXEA 2VJXA 3TTYA 5BMWA 3NJ3A 2BGQA 4CQDA 3B9NA 3EMQA 3W24A 3MDUA 3OBAA 2YBTA 1JIBA 4B92A 3MCNA 1R3RA 3IGXA 4JN7A 3LPGA 3E02A 3A9BA 3FHQA 5A6AA 3AU2A 4L7ZA 1WAUA 2OLAA 4PMDA 3PG8A 1YLVA 4GFIA 1CXKA 3CL7A 3AWNA 3OB8A 1Q8AA 1ZPTA 2ZX5A 3QVQA 6XIMA 2DZBA 1W1B1 3UY7A 3OA5A 3SIMA 5DCBA 1GG1A 1PHQA 1VGAA 3RAOA 1NQKA 2CHOA 4DUVA 1DJHA 1PUDA 1O6IA 4OU1A 1PHWA 5ABEA 4P8XA 1WUEA 3A4JA 3G1HA 2VNCA 4NJHA 2AAMA 4LGXA 4GJIA 4GBDA 3FEMA 5U4NA 4O11A 1B3OA 2ZX6A 4D1JA 2ZXQA 4O50A 1K8CA 4JHOA 3LM7A 1FWBC 3B4YA 2VOMA 3VILA 3E0FA 1Q6FA 4JIHA 4FNTA 1HO1A 1LF1A 3CHVA 4Y96A 3GTHA 3HGJA 1KXQA 4HD5A 4JTCA 3TFCA 1LBFA 1PDZA 1TPWA 1G6CA 3K4WA 3PBYA 3ZIZA 4QROA 4LBRA 2C71A 3CMJA 3T0BA 5U7SA 4LAUA 1EJUC 3TK7A 4C6LA 1S1RA 5IDIA 4WD0A 1VFHA 1R87A 3S3GA 3RLUA 1FCVA 1EWDA 3CT7A 1FDJA 2WVUA 2YL8A 5G4EA 4DO7A 2PGEA 3KTXA 2VRJA 2GFTA 1R9ZA 1X6LA 2ZWYA 4FP1A 1DOSA 2PDNA 1PVNA 2A7NA 4IZGA 1T99A 3TWBA 5PTDA 1GEHA 1BG4A 2QLYA 3UXKA 1SZRA 4GZJA 4AC7C 1ZAIA 3LTPA 4LXFA 3VGFA 2VDIA 3P82A 3W75A 4EWND 3C0JA 2PTYA 2G4FA 2P88A 4DXVA 3LX9A 2O55A 1S1PA 1V3HA 1D3HA 4GE8A 2E40A 1B3YA 2QVHA 3C56A 4LCSA 3MUIA 4K1GA 3G1FA 4TR9A 1QI4A 1VENA 4ZFCA 1P0KA 3T08A 5DT5A 1OGSA 4QS5A 2Z6JA 4IIGA 1CLXA 3VGGA 1L0PA 4DLFA 3MKVA 3BC9A 2R94A 1RSCA 4M7TA 3MTWA 1E4LA 4E2OA 1RV8A 1W9VA 2FGZA 1H60A 1J01A 5CG7A 3ZLHA 4KFPA 1XJBA 2P3EA 4C6BA 2J6VA 3I3BA 2NV9A 4DWSD 3DERA 1FY6A 5E9AA 4YTUA 1H7WA 1OYCA 3P7YA 4AF0B 3KOFA 4S3DA 4AHPA 4G9PA 1QWGA 4NL1A 1E6NA 1X97A 4IMDA 4PMOA 4GNKB 3T55A 2YL5A 1AH4A 4X61A 1RAKA 4N0RA 4QAIA 1O60A 4JX5A 4JTQA 1XCWA 1IWAA 4U2ZA 4ZZ9A 4JEJA 2ZRXA 4CQBA 3HO8A 4TX6A 2J27A 4U33A 1AVAA 1I2PA 1PZ0A 4L1WA 4AAJA 5D02A 4PODA 3DBPA 1EYWA 3MS8A 2IKGA 4FO4A 3RILA 1ESWA 3VDBA 4XTIA 2P0IA 1XYLA 3VIJA 4NY2A 1A5OC 1U33A 3QGAC 1XBVA 4LF2A 4JX4A 1DHKA 4N4QA 5CSUA 2DORA 4GC3A 3WNLA 4B3LA 3KZSA 3A13A 4O52A 3VPLA 3FGCB 2BHUA 4M7SA 3AIVA 1V3MA 3DGRA 2D2GA 3GUGA 2ZE0A 3D5HA 3BVJA 5H8MA 3OP2A 3ARSA 3CJPA 1CPUA 2VEFA 1OZQA 4QLJA 4GY1A 2DT1A 4LU0A 4LVGA 3A24A 4J3XA 2J9ZA 3PWAA 4M1RA 4ZSUA 3K8KA 3B9OA 4XUYA 5GJNA 3ENLA 4MWAE 4YU1A 4ZO6A 4DBUA 1FCUA 1LORA 3E5BA 3QV6A 4K7VA 2QUTA 4DELA 3MV11 1S5MA 1RA0A 1ODUA 4ASTA 2A3BA 4S3FA 1EXPA 1HKKA 4HHPA 3GKAA 3APYA 1LT7A 2C79A 3M46A 2V3FA 1D3CA 1VPYA 1AL8A 2DJXA 3QKEA 2PZ0A 1JRBA 2BP1A 2YB1A 4IOTA 3OODA 1I2NA 3CL8A 3CAVA 1UP3A 2FPVA 3WYZA 3W76A 1Z9AA 1DBTA 5K9XA 3CUFA 3UWYA 5DBUA 4J4KA 4QJ3B 3PNUA 4NZ3A 3EWXA 3ABZA 2DZAA 4GWEA 1TB3A 2CHRA 2V5LA 4FXFA 4WY0A 5HDRA 3VOIA 4L4LA 4QAWA 4PTNA 1V5XA 2FZBA 2TRSA 3SUTA 1KC7A 2Y8KA 3WQCA 4CD7A 2CXEA 1TE6A 3BV7A 1O5KA 4X63A 2Y5JA 4DJED 3G1XA 3WLSA 3WK3A 7REQB 2NUWA 3SCRA 4UTTC 2VI0A 4JKLA 1XI3A 4ZOCA 2X1IA 1VFFA 4REQA 1SJCA 3T2OA 2VKZG 1E0TA 3VKJA 4JCMA 3L21A 1TO3A 2FDSA 3ABSA 3SB0A 3QM3A 3PC0A 2CLOA 3ARYA 2EKGA 3C2VA 3S47A 3CUIA 4H9MA 4YXGA 2FJUB 3VKAA 1PWLA 3FFSA 5LIUX 3VOFA 3QV8A 3ID7A 3R8HA 1NWSA 4RJEA 1Q65A 3LI1A 3II1A 2YZ5A 2DGAA 4QJ4B 4R9OA 5JQ9A 1O4UA 4IP4A 2OSYA 3W25A 4MJ4A 3IUDA 2VX5A 4NT0A 2GJXB 3I7QA 3RMEA 2ZXAA 3LBCA 2XWDA 1LP6A 2FHBA 2G3NA 1RA5A 2ZVIA 3I6TA 5BWFA 4PSRA 5AC7A 3TKFA 1BWKA 4IX2A 3BW3A 2HQAA 4BY3A 4HZMA 1W1TA 2ZRYA 4P2VA 3O15A 2PRMA 4DXXA 3WLIA 2TPSA 4CD5A 1H3GA 4JIIX 1G69A 2J7EA 1VC4A 3KVJA 5D32A 5LGXA 3EOUA 2G97A 1KR1A 3JUGA 2ZC8A 4GXPA 4EPKA 1PXGA 4DQWA 4O54A 1DWIM 2BHYA 4AD1A 1ISWA 1Z89A 4HNNA 4IX0A 1IT7A 4US6A 4ACZA 1HVXA 3SN0A 2O4MA 3AXMA 1V6TA 3W1RA 2ZUNA 1PPIA 3FJLA 1D2KA 3N3TA 1W3JA 4S38A 1OC5A 3NDOA 3TJXA 4D8LA 2BHZA 3W1QA 4BWLA 5F1UA 3PFRA 3LCGA 4LF1A 4G6CA 3QEZA 3QMSA 3DFSA 3HQOA 3T0CA 5EKYA 4XSMA 1X7IA 2FB2A 2I5QA 3WJZA 4GY7A 3BOLA 1KGXA 3CO8A 1XRFA 1JUEA 2PTWA 3WDJA 4HPGA 2R1KA 3PZQA 3WMBA 4DVOA 4M19A 2PC4A 1JPMA 4O53A 1TVNA 3VO0A 4RZBA 3KCJA 1R9YA 3B0VC 1EBGA 3WELA 4NNCA 1ONEA 2VZOA 4PRTA 2HWGA 3SQSA 1O95A 4IPNB 3PZNA 3GFZA 2XVPA 4UXDA 4DM1A 1U5HA 3S1UA 1MW1A 2VFHA 3GR4A 4HK7A 4H9UA 4HU3A 2XSBA 4FNUA 2BWGA 2I5IA 1RY0A 1VP5A 4H9VA 2Z2AA 3V0UA 4H9ZA 3S2MA 4O1EA 4DLMA 3W2KA 2I1OA 1SO5A 2Z6IA 4X9SA 4P8UA 5CC7A 4R7WA 1QPRA 2XZ7A 4TUFA 3F2DA 1AZ2A 1C7TA 2FPYA 4WK9A 2E1WA 2ZRUA 3MP3A 2VEKA 3QC3A 5HANA 4YVPA 4XZMX 1UWQA 4MNKA 4OT7A 3N13A 4GUFA 2EG6A 3L2IA 1SZNA 5CPLA 3LLFA 2XIIA 2JEPA 4X3ZA 1FWGC 3UZXA 1P6CA 4N02A 4FPSA 3LHZA 3V5CA 4ROPA 3LBMA 1QNSA 2F7FA 2PU1A 1ZNNA 3KTSA 1FDZA 4Z17A 1WPCA 1YBQA 1BLIA 3THUA 1BG9A 3C3UA 3WFAA 3RN6A 4AZ6A 3NQCA 4NZCA 3WK2A 4LS2A 2GUYA 1NIUA 1ECQA 1RQHA 4C65A 1CI1A 3OZYA 5HMEA 2YBUA 1W37A 3GG8A 4GH3A 3GH4A 3AZTA 5D37A 3ZMRA 1GTEA 2QJHA 3P0WA 2PP3A 3CS2A 2CZDA 1OFQA 3C0SA 4GISA 1BRLB 2DSUA 3K8LA 5EBUA 1BWVA 1KRAC 3N11A 5M1TA 3NG3A 4Y9NA 1AW2A 4F9JA 2NQZA 3SURA 1OQFA 2XUCA 4MLJA 2BVYA 3OQ8A 2J7GA 4XZBA 4F2UA 2I7GA 3PWIA 3BAXA 3QN3A 2WCGA 3R0KA 3KRZA 2GJLA 3SO7A 4XVEA 1I1WA 1L2UA 2WVSA 1ZQ5A 5D9PA 3WLKX 3WLNA 1E6ZA 3W37A 4IP7A 4WGHA 1LL7A 3GH7A 1OX5A 2NWSA 3T9PA 3KDOA 3DYPA 1C8XA 1BWLA 1I4NA 4K38A 5E09A 4AWTA 2OEMA 4R7JA 3CHFA 3R25A 4PA8A 1KQZA 1EH9A 4C5YA 5DANA 4YVXA 1ZALA 4KT2A 1Q6QA 3HB9A 1H4PA 3H6OA 3BURA 3IIXA 1JDAA 4DZHA 1K7FA 3FJ6A 3VKKA 3NFUA 2C1IA 2GPTA 1NSJA 4ACYA 2GJNA 3MUXA 1PX4A 1ISXA 1IEVA 3QPYA 3BAJA 1ONXA 2QJNA 1BD0A 3F5LA 3RM8A 3SFKA 2WOQA 1XH1A 4MKSA 1RZMA 3SGGA 2INZA 2C7FA 3QR3A 2J88A 2GDQA 2Q8ZA 3WLLA 1OGBA 1U1HA 2MNRA 4FSAA 1W3LA 1BQCA 4LBUA 3LPFA 1G1YA 3BAYA 3UXAA 5HAOA 3G77A 3S2CA 3DIPA 4PUEA 2IQTA 2I17A 3AYRA 5T26A 4F66A 4M24A 4GI8A 1F4AA 4W87A 3Q45A 4GI9A 3KBSA 3LM3A 1XH2A 5EFDA 1PKLA 1YDOA 3WFZA 4DWSB 2WANA 3LLDA 1R3SA 3UYIA 1DIKA 4BF5A 5DN1A 2BOFX 3P14A 5A6LA 5RUBA 4DPQA 2BB0A 4HSNA 3VMNA 3VNIA 1N8FA 2B7QA 3MSYA 3B8DA 3FA3A 1XLGA 2E5BA 1F07A 2W67A 1WCGA 1AODA 3SCPA 1KBJA 2OSWA 4JFVA 5F7UA 4QTGA 1YYAA 2GJPA 5DMNA 1TV8A 3L5LA 2EJAA 4N6EA 2P10A 1ENUA 4ZODA 4DUOA 2QQ6A 3OA3A 1SJAA 1UP2A 3CLWA 3AIUA 4QG8A 3HM7A 5C8BB 1FWEC 2CLMA 2C19A 3LCFA 3U8GA 3M07A 3TP4A 1XUZA 2BGSA 4JQ4A 4BCEA 1MRQA 1NP2A 2Y2WA 1RJPA 5C55A 2HSAA 3W86A 1R30A 4GGBA 4UOZA 4ZXOA 4PCPA 2GWGA 4QG6A 2HE5A 2YYTA 4J3WA 3W9ZA 4IIFA 4B16A 3VNDA 3M0XA 3BLEA 5G5IA 3CMGA 3MZNA 3PUEA 3SCSA 2H3DA 4ZO8A 5B80A 3U3HA 4HPXA 3VU2A 2PWEA 1UZ1A 3LYEA 1DP0A 2IPGA 1H5YA 4XZ9A 4WHBA 1TVLA 4LY8A 3BH4A 1LLWA 5DY2A 1IXOA 1XW8A 2FH6A 4E4UA 2GQ8A 1C8QA 3WBXA 1P7TB 3KRBA 4TQTA 3RNDA 3PAJA 4M29A 3TLQA 1OFRA 4LUSB 4YYCA 5CEWA 2VTFA 4E4PA 1N8IA 5A8GA 4WDTA 3LRMA 3F03K 1KFBA 2BZNA 3Q37A 3FHAA 3OLEA 4PMXA 1VFUA 1GG0A 1UR0A 4JYEA 2GOUA 2Z4GA 2J74A 3BAKA 5FD0A 3FOKA 4MSSA 3CHDA 3BLOA 1YDYA 4AVNA 4C6PA 2C6QA 3IUIA 3HMCA 5ABHA 1K1DA 2E67A 4MY9A 4YL2A 2FVLA 3WD3A 1W32A 2EG7A 4MNJA 2W63A 3S6DA 3VDCA 1MZRA 3BE7A 1HL8A 4WSJA 1IIGA 5AHNA 5JIWA 4GVGA 2PDIA 4FOUA 4RUBA 1SGJA 4QCEA 5BU6A 4GKLA 1ADOA 2GSJA 3T4WA 4O57A 3RRAA 1VEPA 1JEZA 2FHFA 2GJXA 1K8YA 1V0KA 4MAVA 4MZ8A 5FF7A 4J35A 3ARQA 2TSYA 3TYUA 4WXZA 3BG5A 4JIPA 1GQJA 2H9AA 2R8WA 4GO8A 4NVTA 2Y7GA 5BNKA 1MO0A 3RJXA 3S6TA 3WDHA 5I6SA 3AU6A 5K4ZA 3ANUA 1V0MA 3WFLA 1KO0A 4LRSA 1LG2A 2F6XA 2PA6A 3KOZA 2OO0A 1O68A 1P0EA 1WKEA 4EPEC 3UQNA 2WJEA 1M68A 1PIFA 4KERA 2GGGA 1XIGA 4RV8A 3VCNA 1W5NA 4QEEA 4U5IA 1OD0A 3QBUA 4EAYA 4E8GA 3THCA 3E0IA 4BHYA 1UD8A 1N82A 1PV8A 3D3AA 3VX0A 5SWUA 1XBZA 2VELA 5DBTA 3ZJ7A 4J3UA 3ARWA 4UB9A 2ZWZA 3PZVA 4FALA 4FK9A 2QULA 2V5DA 2WZHA 2Y5EA 5HNRA 1VCGA 3ZYZA 4RLIA 2YDQA 4IJBA 2PDGA 3S9YA 4C6MA 2CC0A 3IWPA 3W3OA 5G1YA 4PC8A 2QIIA 3VIGA 1W1ZA 5H2ZA 1VQTA 2CFFA 3NPWA 1V6WA 4KIEA 1JF5A 3O1NA 3B05A 4JQ2A 3W53A 3CQIA 4J3SA 4E8DA 1KXHA 4D9PA 1HKJA 1GYMA 3MYOA 2Y88A 1IEIA 1H51A 2VUNA 3ZVHB 2D3LA 4PTXA 2O0TA 4PCFA 1U5VA 3WQGA 3TSDA 4GINA 5BWAA 1DJXA 3PJXA 2OEKA 5D2YA 3GYEA 1EHAA 5D4YA 5A6BD 3AZSA 3TV8A 3K2GA 1S3HA 4NSBA 2OODA 2QUUA 1XLLA 2FTYA 1GVSA 3W6YA 2ABBA 2ALRA 3UETA 4RV3A 5CZSA 3OGSA 4IT1A 3BOXA 4HU4A 4PULA 4KEZA 4W4QA 1CW2A 1W54A 2XH0A 3K30A 3RR1A 1BFNA 4DYEA 4FLRA 3MHUA 4B5XA 2PODA 2Z2UA 4PMQA 3AXIA 4M82A 2J78A 2OLHA 1RBLA 1P1XA 4J40A 4TVDA 2WHMA 3M16A 3N3MA 4A6GA 2HE8A 1H7RA 2XSAA 1Q5MA 3R0UA 1I2OA 3ABOA 3TN3A 1QR7A 1F8IA 1REQB 2VFEA 1E5NA 1K9EA 1VJSA 2HK0A 1V02A 3W7PA 3L66A 3FS2A 3W88A 1C90A 3G3MA 3QW4B 2VR5A 3ALGA 3ME3A 3ITGA 4PUJA 2F2HA 1QT1A 1T40A 5D30A 4QHRA 2QAPA 1ICSA 4C6JA 2A5HA 1GNXA 2DT2A 1DE6A 3GAKA 2WO5A 4LVAA 3R7MA 1JFHA 1J2BA 3QSRA 3EYPA 5G2WA 4ZEPA 3NWRA 5A2CA 1BRLA 2VZVA 1F7BA 1E56A 4H2CA 4XVDA 2FZDA 4F3HA 1L6FA 1NDVA 1XCFA 2RDXA 1SR0A 3H7UA 5AY7A 1TWZA 4TIMA 4G8TA 2Y61A 2XWEA 3V0TA 2FYMA 2AKZA 5LNWA 3N19B 4EACA 1ADDA 3N29A 3UCQA 1XGEA 1B54A 5E6ZA 1KXVA 4OVXA 4HPHA 4HYWA 3MQTA 3S5SA 1VFSA 1X98A 2OMAA 1SW3A 3APGA 2EPMX 4R85A 3WL1A 3SBFA 1QI5A 3KL3A 1TV2A 1HGYA 1MDLA 4GUIA 4JN8A 4H6RA 5D8ZA 3P2VA 4BWLC 1QI3A 4IIHA 4O8RA 5AHEA 1GOXA 3UD6A 1TR1A 2ZICA 1KRCC 5FF0A 3Q2DA 4C1NB 3K46A 5AC5A 2YKKA 3FJ4A 1HXJA 5ENLA 3PWGA 3H2EA 1WKYA 2NQ5A 1IZKA 1XXXA 1GQLA 3BLFA 1KD0A 4WY0F 2J9YA 3NOEA 3VKDA 5B7YA 1N7KA 3S5OA 3CUHA 4OE7A 5KETA 1PS9A 2IXVA 4LOCA 1NFPA 1VIZA 1XRVA 2E8YA 2WZTA 1THFD 4CQAA 5CPMA 1XLBA 3NPVA 3NOYA 2NQJA 4E8CA 3KWXA 4L9ZA 5H8PA 4I5RA 1OADA 3L0KA 5F1VA 5HMDA 1P6WA 4JY9A 4MGGA 3VUPA 4IWWA 3LHUA 3EWWA 4K1WA 3U0HA 3AQUA 1ML1A 1BKSA 4QISA 2FVMA 4Z2LA 3TTQA 2W66A 3KX6A 4ML4A 3CYJA 1E15A 1S2UA 5LXXA 3CM4A 2PF0A 4A2RA 1QBBA 3EXSA 3SJNA 7A3HA 4GXWA 4JYFA 3MVTA 4IM4A 3QTGA 3VIPA 4A29A 4DJDA 3MWAA 5D05A 1HW6A 1DIEA 3WQ5A 3G8EA 4P7RA 3G5EA 5A1AA 5E5CA 3AHZA 1UD5A 5FF4A 5ECVA 1SZEA 3OVPA 4MB1A 2QGYA 2FZMA 3NAVA 3VIOA 2NUYA 2YB4A 1E6RA 4F2TA 4RZ5A 2DUXA 1NVMA 1J10A 1EF2A 3OYZA 1KV5A 1TPEA 3QQ0A 1OFAA 2H6RA 3GC2A 1MUCA 5CZKA 3N25A 4U3AA 1J5SA 1TPH1 1A53A 4YWIA 1SM9A 3CWNA 3LCXA 3IACA 3M5VA 4PMVA 1S39A 1PKNA 3BLKA 5FI8A 3LGDA 4YLWA 2GL5A 1TCDA 2QEZA 5DXYA 5AECA 3KCLA 4AG0A 4XBKA 2ZZ5A 4M8UA 4B3KA 4ROQA 4U31A 5GVJA 3NCOA 3VTRA 4BR1A 3CASA 1YEYA 1IT8A 2Y7DA 5BYWA 1TUXA 2PDWA 3VD4A 3RX3A 4AYSA 3K4AA 4MLRA 2PAJA 2D23A 3C86A 3STPA 2FGBA 3S9IA 5FEZA 3NL3A 2PD9A 3ELFA 2BXZA 1NDZA 2C3ZA 2J7BA 3SADA 1KWKA 3QYSA 3P6LA 3UA4A 3QHOA 3W7LA 1P7TA 3HU7A 3EWBX 1UD4A 4E2DA 3NZQA 1XIJA 2ALDA 1MW0A 1EJRC 4FOJA 3TC7A 1JZ7A 3AXHA 4V2XA 3UXIA 3MMDA 3WD1A 4LV9A 3ECQA 2OG9A 3FJNA 3ISIX 4LUYA 3HPZA 4AC1X 1P4CA 1WUFA 3PUGA 2QF8A 2XN2A 2QCDB 5AOUA 2GGHA 4K36A 2I57A 1QW9A 3H12A 1GZJA 2AL2B 5CSYA 3K8MA 3RXZA 2WK2A 1W8GA 3KBWA 5HNTA 1WZAA 4RKAA 5TF0A 3UW6A 1EPVA 3GB6A 2PF8A 1UH4A 3INPA 1B2YA 1CXLA 2HXTA 3DHFA 5G4WA 3BICA 4ZENA 3MHFA 4HGXA 2QJIA 1F3XA 4AHOA 2GOKA 2HPIA 4INFA 1ISVA 1W6TA 4EXAA 1UQYA 2P8CA 1HKIA 4UR9A 2QPXA 3EX4A 2VGIA 3IIZA 4BA0A 1XL9A 4GD0A 3IANA 1GW9A 2VEIA 3CAQA 2OX4A 1CGYA 4OQVA 1M3UA 5EMKA 3B0UX 2WVVB 5E93A 4UMAA 1VLWA 1RHCA 4HTYA 1JXJA 2Y0FA 3CO4A 4J3TA 4KPLA 2ZUMA 1GVOA 1XG4A 1OABA 3UPBA 1RJRA 3VDAA 3EPNA 4D6IA 1F76A 1EBHA 5TAOA 3OLGA 4BF9A 3G6MA 2VZUA 6REQA 3SSJA 1DYSA 1M03A 3NXFA 4MF4A 4PCSA 3CUZA 3TYZA 5G2IA 2B0MA 1A5KC 2A21A 1JL8A 1UB3A 4FLQA 2XIQA 1YNPA 1HN1A 1LJYA 1LRQA 4FF7A 3NQ8A 5A6MA 3GNXA 1VIWA 3LHYA 4WKFA 3LHTA 2PCEA 3AHYA 4GKTA 4IUOA 4S1FA 4RZ4A 4Z1DA 5CLWA 5T8GA 5FJPA 2HJPA 3RO6A 3P74A 1VZWA 3NM3A 4XTDA 3A4WA 3MCOA 3WEMA 4HMEA 3GXPA 3E74A 4DF1A 4KWUA 1CIUA 3GHUA 1I6NA 5KITA 3UA3A 4UBPC 3LCHA 5LGZA 5DY3A 3THQA 1KA9F 1E73M 5AYYA 1JRCA 5GNZA 2PP0A 3WBYA 4Z08A 1Q45A 4G7EA 2D22A 4PRRA 5AYXA 2BVTA 3AMCA 3B06A 4QP0A 2FZNA 4J3ZA 3VINA 3N1AA 1JNEA 3UWQA 2VM8A 1KM5A 2ZUSA 5REQB 3HPXA 5TD4A 2OYKA 2ZRWA 2Q02A 4A2SA 2BBFA 1OFPA 3WY1A 4HNTA 4B5WA 2F84A 3HV9A 3S2JA 1F2JA 1JDCA 2NZLA 9RUBA 4PMYA 2UY2A 4ZBCA 2G3JA 4Y9PA 3UGVA 3ZVHA 1P1MA 1V77A 3CTTA 3EWZA 2GVLA 1JZ3A 1QBAA 2VX7A 3TZFA 4EXQA 4N9EA 3FXGA 1DQUA 2AMGA 3VIHA 1TPUA 3IAQA 3IGUA 2CZEA 2J79A 1JCLA 1A0DA 4RL3A 2PB1A 1SZGA 4JICA 5HR6A 3WKZA 3HGSA 4C6OA 4PBEA 2HS8A 3E2VA 1H5VA 4NAFB 1W5PA 4C6DA 4D8ZA 1S2VA 2VHLA 3WDPP 1H41A 1CTNA 5GPRA 3AIEA 4CU8A 4Q7IA 5JVLA 1OYBA 3LGEA 2QGHA 4JFWA 3ZR4A 2Y4SA 4XISA 3PHAA 3NDYA 1VLIA 3KS6A 1RBAA 3H70A 1XH0A 3SQLA 4LVBA 5E6YA 4GQRA 1REQA 4H9TA 2HV5A 4XSLA 1AW1A 3TNBA 2BY2A 4HQVA 3C0LA 3DCPA 4RE0A 3TQPA 5M3WA 5A8QA 1WBJA 1QPOA 1DIDA 5JH2A 1KM0A 4GLEA 1KM3A 4HA4A 2GSHA 4OECA 4L64A 3IK4A 3VCCA 1E6PA 3BOFA 4CN6A 1TRIA 3GS6A 2V2DA 4OKDA 2Z0IA 4MB4A 2WJFA 3FX4A 3QZEA 5FF3A 4KFNA 3P61A 3WUBA 1TREA 1Q6CA 2BS9A 4OBTA 1TQXA 4C6IA 3PAOA 3T7VA 1MXDA 4PB5A 5ABFB 1Z48A 4W5ZA 2WNZA 3KRUA 1WDQA 4GVHA 1RXOB 3NEVA 1EIXA 2PDBA 5F4WA 2NW0A 4HP5A 2CLLA 2W61A 5LNUA 3IUHA 2WLYA 3PSVA 4CD6A 3U2OA 2NSOA 1EZ2A 2B31A 1HT6A 2TAAA 4Z42C 1S2CA 1T8XA 4DXKA 3UG4A 1UCWA 2DZPA 3OGRA 3LBOA 1GQKA 3N2XA 2VR2A 4AHQA 5I3GA 2Y8UA 3UYCA 3BJTA 2RHGA 1R5YA 3MO7A 2Z1BA 3HBLA 2NX3A 2OVLA 3GG7A 2D3NA 4WCJA 1BQGA 4C1NA 3I4EA 3IJLA 4Z0JA 1GOMA 2OX1A 3NQAA 3W27A 2X7VA 3P80A 1RK6A 1YPXA 3VIMA 5DMYA 1X39A 2PDLA 3MJMA 3CH9A 1P0BA 2D2OA 4ATDA 3E1F1 3W2NA 4G7FA 3HFYA 2PE4A 1WDWA 3CH0A 2V8ZA 4JFTA 3QY6A 1JJKA 3EDJA 2NT0A 3TN5A 3VVGA 4Q7BA 3SY1A 1C9WA 4F0KA 4PMJA 5A5WA 4I3GA 3A3WA 4ERAA 2NLIA 2SFPA 3ABQA 4ALDA 1UD3A 1ME8A 2DY3A 3S9ZA 4UTIA 4XZHA 1X8FA 1KM4A 3WNPA 4IIEA 3ZVIA 1JYVA 2W6RA 2QUNA 2VEPA 5FJTA 3BO9A 2XG9A 3T42A 1KW1A 6XIAA 1KV8A 1EL3A 3VGDA 3BW4A 3LOTA 1O94A 3GNOA 4QNEA 1RCXB 4JTFA 3WDIA 1H7NA 4DBEA 3GSMA 3DGBA 2R1LA 2OYMA 3NGFA 4MB3A 1B3VA 7TAAA 4B5SA 2JKEA 4LFYA 2JGYA 2PURA 3L65A 2V63A 4U4MA 3HG4A 3WF2A 3OO2A 4JFSA 1PTGA 1TA3B 3JW7A 2ZZ7A 3ZR6A 3KRSA 1OYAA 3WUEA 3PG9A 4PUNA 2H90A 4E38A 3ZWTA 1DVJA 1LQ0A 4L65A 3ZT7A 4IMAA 4B5VA 2DSZA 4KEMA 1B90A 1F74A 3PJUA 5K7JA 3CGTA 2ZA1A 3G1DA 4NXKA 2PEVA 2Z2BA 4AIUA 3E96A 3SJ3A 1UPMB 1JPHA 4J5NA 4OJYA 3CZGA 1PTAA 4DHGA 3APTA 3WDQA 3E5PA 5K3VA 2CW6A 3B9DA 4JXCA 1EQCA 4LUTA 3M5YA 3V18A 4UNKA 2VDGA 1YX1A 2J6XA 2ASHA 3F7JA 3UBPC 2HCVA 3PP7A 3WEOA 2E0PA 4ZQMA 3WD4A 2GQ3A 1A5BA 2WQPA 1FP8A 2WMKA 3W7RA 1HX0A 2PZNA 3MP4A 3U2EA 2XIMA 4LEFA 4DF0A 1TZ9A 4GOAA 3LCWA 3BJFA 4JIQA 1BGGA 3C52A 1PTDA 1I60A 4UNLA 4PEKA 4Q4QA 4GYPA 1O1ZA 2Y24A 3NZRA 1GVIA 3LCLA 1K7XA 1A49A 3UXLA 3LV6A 4KGJA 1E51A 3KM8A 4M80A 2A4AA 1UZHA 4JTLA 1TX2A 2Y7FA 3NVTA 4JS3A 3EMCA 3WENA 4FNPA 1X1ZA 4S2BA 3L2MA 1HJVA 4M0XA 2GVGA 1PIGA 3B8TA 4Q8NA 3O3RA 1VFLA 1Y65A 1DWFM 1E40A 2VQUA 3DZ1A 3W0KA 1W3IA 1BVWA 4OV4A 1SZFA 2XVKA 2IXUA 1XD0A 3GR8A 1FKXA 3WLHA 2JEQA 1QW8A 3P8IA 2PUZA 2OT0A 5E1QA 3EOSA 3OVQA 4EKJA 4NXSA 3LRKA 2VR4A 1EOMA 2YDRA 2JK2A 3W83A 5D2XA 3WQEA 2E6YA 1I2RA 1XSIA 1WXZA 2VVNA 4GPNA 2A3EA 5BXRA 2DP3A 2GVJA 2XH2A 3A3HA 4B15A 5D8WA 3QJAA 4A22A 2YYUA 2QMKA 2OQLA 4HN8A 4JTHA 1WYIA 3RG6A 2VOTA 4EK7A 1UA3A 3HQNA 3TCSA 4XKMA 1DXIA 4MWAA 4BI6A 3GBEA 2E3ZA 5FCZA 1KKRA 4MZ1A 3DESA 1W5QA 4C7FA 4LAZA 3C2OA 4UMBA 5L9FA 4AMAA 1GVYA 3QLDA 3KL5A 3VD5A 4X22A 4EF8A 1T6MA 4Q8WA 3DH7A 3IJ6A 4AB4A 2VYOA 1Q8JA 1QNQA 4AEOA 1FXQA 3R4IA 1AD1A 3FEQA 4KESA 1KNWA 5LA2A 3LXCA 4ZTXA 1US3A 4QJ5B 2PRHA 2VFDA 3NZGA 4Z1YA 5I3DA 4LAOA 4OBRA 3DHUA 5KZ6A 4L1GA 4IQJA 1KFEA 1L6WA 2XU2A 5FJRA 1WZLA 2B7NA 2W92A 4TV6A 2YCLB 3M0JA 3U2ZA 1JI1A 2PLJA 3TE9A 2DVXA 3OLIA 2CLFA 3W72A 3LN3A 4Q4MA 4Q8PA 4H04A 5EY5A 1UWRA 3TUUA 2W5FA 3BGJA 2ATSA 3LNPA 1CWYA 4R9XA 2J77A 1G5AA 3OTRA 2GVEA 1F61A 9XIAA 1W2PA 4DI9A 1JG9A 5REQA 3NURA 3FYOA 4DNMA 1VKFA 3E2QA 1QPQA 1A4MA 3AALA 4JTJA 5BMXA 3RDKA 2OKOA 5C0QA 1HIZA 3TA6A 3RFAA 2C1GA 2O7QA 2D69A 3RU8X 4Z1AA 1F3TA 5IHSA 1Z44A 5D2TA 4HN4A 2OWWA 2DVTA 4O28A 2IPWA 1E4IA 3VA8A 5H1WA 2NV2A 3JVAA 1G7UA 4F48A 1JYNA 2LLEA 3KZPA 1ZENA 3PTKA 3L67A 1TYGA 1TIMA 4W86A 2WSYA 4C5ZA 1X96A 2FIQA 4XIAA 1XWYA 3ZM8A 1TTIA 4EOUA 3XIMA 2OOFA 3AYVA 1JPKA 3L0GA 3QPZA 3EX3A 4ZTYA 3FAWA 5A6KA 4HHMA 3CV1A 4PR4A 5AC6A 2XYLA 3A6OA 5D2VA 1UD6A 1KCZA 4JKMA 3RLHA 1VS1A 4HU8A 5CC6A 1HJUA 3PNZA 4JL2A 3COTA 3BCDA 4GUHA 4JOMA 1E1CB 2R14A 1HF6A 4A3HA 4S3JA 3WX7A 4DX3A 3RU6A 2BY3A 5E0CA 2PDMA 1IZJA 3O06A 4MDPA 1M01A 5CGMA 1XIFA 3KP1A 2F61A 3SUWA 1TTPA 1BYCA 2PFHA 4UQCA 1A5MC 2DJLA 3P84A 3SCNA 5I06A 2E28A 1J0YA 4LUIA 2WMIA 3ABXA 3W29A 1UWTA 4FHAA 4TTUA 3CIXA 2OKTA 2PDCA 1A5NC 4X0NA 4C6FA 1YADA 2WZMA 3QF0A 3WQVA 1Q6LA 1EGZA 2GGJA 1IYXA 1RH9A 2ZC1A 2BV9A 3KFTA 1JFXA 3PZMA 1H1NA 2YA1A 4RDZA 3H2NA 4HNOA 1GVQA 2E68A 2ZVRA 1BSLA 2PDKA 3THAA 3O0FA 2NVCA 5I3HA 2ZX9A 4PB4A 2BFGA 3SCVA 1HGWA 5BRQA 1C93A 1Y5WA 3LXAA 5LHEA 3NPUA 1NM9A 3DKLA 1SU5A 2Z29A 1F6PA 1UZDA 3HIJA 3LPPA 3QGVA 3WUGA 4I5XA 4HOXA 2P5NA 3GHRA 4QBXA 3W7DA 1OCNA 1G4TA 1YNYA 4N6FA 1CNVA 3OYXA 5J8LA 4NU7A 3BQ6A 3FN9A 3LK6A 4X2PA 4JBRA 2ZZ6A 3ICJA 3R89A 4QNWA 3F2CA 3I4KA 3HTWA 1IIHA 1BYAA 3N4FA 2OZ3A 1EUNA 4ZO9A 1VCFA 3PZOA 3O0KA 4GQQA 3LMZA 3UPMA 4D72A 3HF3A 4WJEA 1EPXA 3T40A 2J7CA 3WBWA 3LZ3A 1SR9A 2OOGA 2VZTA 4G5DA 4IPJA 5CPNA 1UOZA 3NQDA 1TSIA 4UFMA 4WZHA 3UVAA 1AQ0A 4PCNA 1MFUA 1UH2A 3ZLGA 3LNMA 4B4HA 1J18A 1WAWA 3BLLA 2ABAA 3SY8A 1UWSA 4C60A 2INFA 4U5KA 1WOBA 3OIHA 1BGAA 1LUCA 4TX9A 5HK4A 3LA4A 4W8BA 2OSXA 3BDKA 1SJBA 3AHXA 3W74A 4IFOA 2IW0A 3DX5A 3HFTA 2J47A 2CLEA 4RE2A 4YVVA 3ZJ8A 2Q3RA 2QDDA 4O13A 1XGDA 1IQ8A 4F0HA 3FVMA 4MKNA 1OBAA 1E9IA 1CECA 1LZOA 3W7OA 2I9EA 3OG2A 5CJNA 3WNMA 1B5TA 2ACQA 1LTDA 3F4NA 1ITUA 3QQWA 2XVGA 3W1TA 1OFOA 3U48A 1KRBC 2QW5A 5IHRA 2ZRVA 3H26A 2IMRA 3AUJA 3BLPX 4AD4A 3P0XA 1CENA 2UZ9A 1EX1A 1CGWA 3B4UA 3DYMA 2CBJA 3GQYA 4WY0B 5CSSA 3E2SA 3UZJA 4JFUA 4WJXA 3CQHA 2WCSA 2FMNA 2D1ZA 5IBXA 3EAUA 3M64A 3Q65A 4H8NA 1TE1A 4MJMA 2JF7A 3IJQA 3N14A 1XD1A 4EPBC 1UUMA 3SRFA 4L4MA 3TN6A 4O19A 5DELA 2RDUA 5A95A 4V15A 4LV4A 4A8RA 3R10A 5DCEA 1OT1A 2I14A 3AISA 2A7PA 1RCOB 2XIOA 1CGTA 4AZCA 1CB7B 1KWGA 3N9KA 4H8HA 8XIMA 3HQPA 5FA5A 2D2JA 2XJ7A 1FWSA 1QNOA 2VFFA 2J62A 3TXZA 1CLKA 2VRQA 4ADSA 1XSKA 3DAQA 4K39A 1HFBA 5GJMA 2XPKA 1TPDA 4K3ZA 2GLKA 2EKCA 1T96A 1A50A 4IMCA 4KWSA 3M0HA 2PTDA 2QDHA 4IICA 5DMLA 2IQDA 1RVKA 3BUVA 4HCHA 4TU1A 1E9YB 4O1CA 4TVCA 2Y8VA 3QFEA 4UTWA 2V30A 4Q3MA 2B7PA 3KWSA 3B8VA 4NUWA 2QCFA 3UT0A 3CAKA 2WNQA 3F1QA 1XG3A 4DJEA 3PF3A 4AZGA 3CBWA 1H1ZA 4IHCA 4Y7EA 3RCYA 2REQA 3BSHA 5F4XA 2QDGA 1M65A 1D8WA 4C6CA 4GACA 1EUAA 3UF9A 1T0OA 1A5CA 4D2JA 1Z42A 3EA2A 2GDUA 1XRSA 4NRRA 1TWIA 4NZ1A 1NAL1 3E0VA 4Y8EA 4Q6JA 2PWHA 2VO5A 1LOLA 2NLYA 4H6EA 4RW5A 4FXRA 2D0GA 3MSRA 4AZ5A 4P7NA 3N2CA 1XFCA 1NP0A 3IJIA 1IXPA 2WC7A 4U3CA 2J24A 3UR8A 5XIAA 3ALFA 2YDSA 1HJWA 1Y5VA 3W7KA 4PTMA 3WLMA 3SAZA 1EKOA 4IIBA 2W91A 3ITYA 4D71A 4DF2A 2VWSA 3DI1A 2MANA 3UR5A 3PZUA 3UR7A 1V6YA 1VYRA 3AAMA 5G4HC 1JZ2A 4Q8UA 4DBDA 2XIBA 1D7FA 3R0DA 4QGCA 3BARA 3GIPA 2L5HA 2RDWA 5HMSA 1J93A 3S1GA 4HOWA 4AWEA 3TONA 3O16A 4XG1A 3OZOA 3T09A 7ODCA 3RYSA 1RCQA 4U28A 2Z00A 2HDJA 4D1IA 3GXTA 2DIKA 4GI4A 3VAVA 4IJCA 3EWYA 4FEZA 3KOYA 2ICSA 1TMLA 2YCLA 3FK4A 1CT5A 5F2GA 3PK7A 2HNEA 3TJIA 3JU2A 2BVWA 1V0LA 2YR1A 3I7RA 2YCEA 4O0ZA 1PJ9A 1TMHA 1I1XA 4FMVA 4Z2HA 4WDXA 3W26A 2A6LA 2PP1A 2ZBTA 1EGMA 1SSGA 2XGIA 2G41A 1J0ZA 2R9RA 2WSRA 2HBVA 4V1XA 1T5AA 3N12A 2GSEA 3TFXA 2PDHA 4KRZA 1W3KA 2E25A 1BEUA 4W7UA 2VZSA 3B97A 3BGAA 3W1NA 3QXBA 4XBJA 3UWWA 3U7VA 2BGNE 3L4WA 3BCFA 2GDVA 3G8RA 5CCZA 4L6OA 2BOEX 3GVVA 1TX0A 3CUJA 4QXIA 4QG9A 1YBQB 3T05A 1JCMP 2Z1WA 1GPWA 4XAZA 2Z1XA 4R88A 2B7OA 1DWGM 4FR1A 4IP5A 3MMTA 1W8SA 2PLCA 3DG6A 3QV9A 2YXGA 1EC8A 1JD7A 3QZAA 5T9BG 1RBOB 3N2MA 5CKSA 1AD4A 3W1LA 1ISZA 2NVDA 4WOZA 1MNZA 1JULA 4Y6GA 4I7VA 3CWOX 3M0IA 3R5EA 4L61A 1US2A 1WZKA 4IUGA 3EKZA 1Q3NA 1HP4A 4OIFA 4NJGA 3WD2A 2EPNA 2X0HA 4TXEA 3BLIA 4ORMA 3OHIA 3VM7A 1JXKA 4JCLA 1XPYA 2W4XA 1MEIA 3FA5A 3UJRA 1B30A 3KE0A 3SCTA 1JDEA 3OZMA 3WH5A 4AIBA 3TAOA 4UTKA 3VFLA 1UWAA 3SUSA 4CLMA 1JDFA 4MYXA 3LB0A 2PU0A 1E1CA 4Q8MA 5BW6A 3NYDA 5AYBA 3V75A 4PMNA 3UG8A 5EL1A 3VNLA 3MVIA 3WG6A 2DZSA 1UC4A 4GIYA 1WE5A 2OCZA 4I8DA 5A8MA 3V1HA 2AMXA 3IIOA 3MU7A 2WZIA 1VH7A 1JVNA 1WDRA 1CXFA 3U4AA 3NEHA 4HPNA 3MCMA 4MFDA 2FQIA 4RNFA 2O9RA 3L12A 3TAKA 2A1YA 1H09A 4AUBA 4H9XA 1FX6A 1QOXA 1P5BA 5IXEA 1BYBA 4IGHA 4A8LA 1K9DA 1NELA 3MV01 1V79A 1WOAA 4ZOEA 4B3ZA 3B03A 3WH8A 3VABA 4FLSA 1KGWA 2Q6ZA 2CZVA 4HVXA 1IGWA 1RALA 2PWGA 1VBGA 1PIIA 1FDYA 3WD0A 1MUMA 1V93A 2W0UA 3UJFA 1DJWA 1JUBA 1V7YA 4UFLA 1ZU8A 1CGUA 1M7JA 4JR5A 1BYDA 3ITOA 3UWEA 1W9UA 4ZR8A 4GYKA 1QW7A 5BXTA 3PPHA 3T07A 1IWPA 4M1BA 1I0BA 1V0NA 4CCZA 4GRSA 2A3AA 2XN0A 3DC8A 2VFIA 3WF3A 4LS0A 1DJYA 1UOKA 2NT1A 1A5LC 1GPFA 3OQEA 1QI2A 2ACSA 5I07A 3POHA 1M41A 1YNQA 2WKLA 1XLHA 4LX4A 4AMCA 2KX9A 2PRLA 1FHLA 1OFEA 5D9MA 3M1ZA 4PUKA 3IV3A 2E6AA 4O4WA 2YA0A 1DE5A 5I03A 3K13A 4FNSA 3ERPA 4S23A 4PUUA 2FKPA 5HBFA 1UBSA 4L1XA 3KVKA 5LZLA 3W84A 4LW7A 3D47A 2P3ZA 1OY0A 4F0MA 1Z7AA 3PUOA 3ZT6A 3R94A 4YTQA 5BCAA 4GIRA 2A3HA 1L6SA 2H3BA 3U9IA 3MC5A 3NPXA 3JR2A 2ZTKA 3LU2A 1GK8A 5I02A 4HJWA 4UR8A 4LTSA 4QITA 5HJYA 2R24A 4AFYA 3RJYA 3CYVA 1QHZA 4J3VA 3K5XA 3KBNA 1FP9A 1LOSA 5K9CA 4O4VA 4C1KA 4AISA 1EEPA 3VZYA 5CGTA 3REQA 1KBKA 3EDEA 5FEPA 1YTDA 5DLCA 3TWAA 2G3FA 1NJJA 2QYGA 4GBUA 3WCZA 1O5XA 3T8LA 3Q4DA 5LKYA 4NRSA 4K8GA 1E0VA 1JD9A 4ATWA 2RKXA 4HOZA 3LV5A 4E2VA 1UROA 2XFYA 9XIMA 1WZMA 3HGOA 2CETA 4BEQA 1G94A 3TU9A 3O2LA 1UASA 4UR7A 2YJQA 1ZY9A 1O1HA 4MVAA 4POCA 2OEJA 2POZA 1M7PA 3HV8A 1Y0EA 1R6WA 3PR2A 4NIRA 4OZOA 1HJSA 5BZAA 1SSDA 3EMZA 5E70A 2QV5A 4HCDA 5IFTA 5IOBA 3WJYA 3E9AA 3VUSA 3NQVA 5ABTA 2PDUA 4DB7A 2BDQA 2YW4A 1GYLA 4FXSA 4W88A 1PZ1A 4M6PA 3HG3A 5BOOA 5DEZA 4JDBA 3GDRA 1EX5A 3TQ0A 1W3HA 2E8ZA 4AIEA 3WQOA 1W5MA 3UP8A 1XLMA 3W6LA 4RDYA 2BY1A 4UFKA 4GQBA 3NZPA 3A4AA 3HA1A 4BS0A 1V6VA 5LYRA 3TROA 1PAMA 1DWHM 2PWVA 5A2AA 1I75A 3EWCA 2ZZ3A 1E6SM 3DDMA 3A64A 4HYVA 4BKNA 3B40A 3GFXA 5A94A 1GEQA 2H9AB 3G24A 3FLUA 3IVTA 3SCQA 3C8NA 1ZP4A 3CIWA 4ZL1A 2CHNA 3RGTA 3HN3A 2BNJA 1E0WA 4U2YA 3MA8A 1DHPA 2J7FA 2XZ9A 3IV8A 1OWQA 3CWHA 2XDFA 3RPMA 1S5TA 4CGTA 4DPPA 2OXNA 1SVDA 4WEVX 1AQHA 3FW6A 3VGHA 2VCAA 1R2TA 3MDWA 5C70A 5C9UA 1AJ0A 2V67A 3RHGA 3VC6A 1TKKA 2ZZ1A 3VIIA 4R7OA 4ADUA 1J5TA 1GOWA 1LCOA 4NAEA 4XD4A 2AGKA 4CNSA 1XGZA 1PZ3A 1JCJA 2DEPA 3WF1A 3ITLA 3MPGA 1OJXA 4YJ5A 1QASA 4WJ8A 3GHSA 1NWTA 5EA9A 1W0MA 4O8AA 3U7BA 4IJRA 4PN2A 1QU4A 1HNYA 1XDMA 4HMDA 4FF5A 5E0FA 1HL2A 4W85A 1CEOA 3CV6A 2NQHA 1OVDA 1WA3A 4UZSA 4MM1A 2NXGA 2ZFAA 3QMRA 2CCRA 4LYQA 1RVGA 5EBAA 3WN6A 1HL9A 5A6JA 3G1VA 4AY1A 5C7VA 3AROA 3IJ8A 3NQEA 3VGEA 2FPTA 3VNJA 1MFVA 3BK0A 3W6MA 3H2AA 2C0HA 3DN5A 2JIWA 3N2TA 4RDVA 5LA0A