3CUFA

Cellulomonas fimi xylanase/cellulase cex (cf xyn10a) in complex with cellobiose-like isofagomine
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
314
structure length
314
Chain Sequence
ATTLKEAADGAGRDFGFALDPNRLSEAQYKAIADSEFNLVVAENAMKWDATEPSQNSFSFGAGDRVASYAADTGKELYGHTLVWHSQLPDWAKNLNGSAFESAMVNHVTKVADHFEGKVASWDVVNEAFADGGGRRQDSAFQQKLGNGYIETAFRAARAADPTAKLCINDYNVEGINAKSNSLYDLVKDFKARGVPLDCVGFQSHLIVGQVPGDFRQNLQRFADLGVDVRITELDIRMRTPSDATKLATQAADYKKVVQACMQVTRCQGVTVWGITDKYSWVPDVFPGEGAALVWDASYAKKPAYAAVMEAFGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Exo-beta-1,4-glucanase
publication title Probing the binding sites of Family 10 and 11 Xylanases with extended Oligosaccharides
rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase
total genus 132
structure length 314
sequence length 314
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2008-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3cufA00
3S6TA 4E2OA 4HOWA 3TOPA 1DWIM 2EQDA 2YL6A 4AYSA 1XHGA 4XZBA 2BHZA 2V38A 2YOCA 2PWHA 4HA3A 4JFSA 1W1VA 1OCQA 2BV9A 2VUYA 4AZHA 2YL5A 1E6XM 1CGUA 1V6YA 2NT1A 1W9XA 1JYNA 2DH2A 1ZU8A 3CMGA 4OIFA 4BA0A 1UR9A 3KL5A 3AMKA 2VNCA 1JIBA 1W1YA 4W85A 4HPGA 3LPFA 1ZB5A 1E3ZA 5LA2A 3HU7A 1E5JA 1C7SA 2GJRA 3T0DA 3CMJA 1ZBCA 2D20A 2XSAA 1C3FA 2G8ZA 2PWGA 3WFZA 1BG9A 1IZJA 3SCUA 1QPKA 2Y8VA 4L4OA 4J7RA 4IUGA 3W26A 1UH2A 2X2YA 1E4NA 4RE3A 3CZEA 1GCYA 5A2AA 4P8UA 1WAWA 3VNZA 2VCBA 3WENA 3RM4A 4TVCA 4JKMA 5E70A 4MNJA 2GJPA 3ZO9A 4GI8A 1U2YA 2VCCA 5A6BD 5A8QA 4GI9A 1CPUA 1SYTA 2CBJA 1XCWA 1JDCA 1V0KA 3SCPA 4AC1X 3VD9A 3PBGA 4EAMA 2YA2A 4JL2A 3BAXA 1J9YA 4CUCA 2W67A 3AS2A 4AZIA 4WJXA 2WHKA 3L4TA 3MUIA 2W63A 3FXYA 2YLAA 1IZKA 4PRWA 1HX0A 1UA7A 2VI0A 1EDQA 4MB1A 2CEQA 3AMDA 4A4AA 1KR1A 1ODZA 3VGGA 1D2KA 3WD1A 4UR9A 1VBUA 3ZJ8A 5I2UA 2WKGA 2J74A 3WDIA 2XFRA 5LA0A 2VMFA 1VEMA 3ZOAA 1BG4A 1W3LA 2JIEA 4JCLA 5A6LA 3U7VA 3N18A 2YBUA 5CGTA 4D6EA 5FOOA 2EPKX 2YDRA 1JZ7A 3ARSA 1JGIA 4L4PA 4PMYA 4HMCA 1EHAA 1HXJA 1JFXA 4F9DA 1UR8A 2PI6A 4N0RA 3L2LA 1JYXA 5BCAA 4UQAA 1B3VA 2V3GA 1WP6A 2WVVA 3F5LA 1J0KA 3FW6A 1BYBA 1HJSA 1GOWA 2OYLA 3B9AA 3BAIA 3UETA 3UG5A 2A3HA 2VZUA 4GQRA 1VJSA 3ZJ7A 2VX4A 3QHNA 4KH2A 1Q6CA 4JFTA 1TA3B 3PZIA 2ZICA 2EBNA 3T09A 4CCDA 1OSEA 1OT2A 3FAXA 1H2JA 1BGGA 1Y7VA 3KL3A 4ATLA 4NRSA 1HN1A 1PX4A 3EMZA 1NP2A 1EDTA 3WNNA 4P7LA 4Z2JA 4D6IA 5D4YA 2XPKA 4JKKA 5A8MA 4MPKA 1QNSA 5A8NA 1ZJAA 3SCQA 4PMRA 1H49A 2W66A 2WMFA 4M29A 1B0IA 1XC6A 5D9OA 4CVWA 2XGBA 4E8CA 1B3YA 2WSPA 3UR7A 5BXPA 1TE1A 1CLXA 1M53A 2QPSA 2FGZA 2ZXAA 4U33A 2AAAA 2DT2A 3VIKA 3LPOA 1C7TA 1X6LA 2ZXBA 2Y8KA 4OJYA 5JUVA 2FH8A 2CCRA 2X0YA 2XJ7A 4C7FA 3VD3A 4OOZA 1QNPA 2CITA 3DECA 3ZMRA 3SCOA 1V02A 1LL6A 3N17A 2UWFA 1HJQA 1DWFM 1US3A 5FD0A 3W6MA 5A6AA 4H04A 2CKRA 2J62A 1UD4A 3WDRA 2ZE0A 4H41A 1QOXA 1HJWA 1BVZA 4GZEA 3VOCA 1KXTA 1W2VA 4W93A 2YDSA 3BH4A 1GQKA 3NSXA 3K8LA 5A95A 2XTKA 2D2OA 4XX6A 2QMJA 1UZ1A 2CBIA 3TTQA 4CD8A 1W1PA 4D1JA 4EKJA 4QLLA 3SUWA 2CXGA 5M5DA 3TONA 3MSDA 4AZ7A 3UG4A 4PN2A 2ZUMA 1GHSA 1J01A 2FHCA 2BY1A 4P7RA 2BHYA 2OSWA 3TTSA 1BGAA 1XH2A 5GPRA 2ZUWA 1UUQA 4GO9A 4HTYA 5AC5A 3OGRA 1MW2A 3K4DA 1E6SM 3M6DA 2OYMA 4IISA 3LPPA 4LYQA 1DWGM 2WMGA 1B3XA 2QV4A 2JALA 1ZS2A 2C8NA 1TCMA 2IXUA 2WC4A 5D8WA 1BFNA 4ZXOA 1E6NA 1GVIA 3AXXA 3MMDA 2GK1B 1I1XA 2V3EA 3A4AA 4BCEA 2DGAA 4Z2IA 4TUFA 3GH4A 2CYGA 1K9EA 2EPMX 5EMYA 1H5VA 1VB9A 3K8KA 4WSKA 1GUVA 2YL8A 4J28A 1W1TA 4MB4A 1VEOA 4D6CA 2MANA 4PSPA 3CHCA 1QI0A 1Q4NX 4LX4A 3B9DA 5A6JA 4C7DA 1C91A 2UY4A 4QCFA 4TXEA 1MFVA 3DC0A 4TX8A 2YKKA 2J7BA 4MAVA 1E0VA 1G5AA 3AS0A 2G3IA 2BY0A 1E0XA 1FOBA 3NIYA 3PZQA 3MKKA 5C8BB 1UR0A 1PZ2A 3WMCA 2ZX5A 3GBDA 1H0GA 3AHTA 4CN6A 1EO5A 4U5KA 2VQUA 1DTUA 4JHOA 4P7NA 2DPEA 3WD0A 3WQ5A 5HOSA 1EOMA 2GK1A 3ARTA 2A3BA 3AISA 1XH0A 1JI2A 1W3HA 2A3EA 3MUAA 3EMCA 3VMPA 3WH7A 1V08A 3N1AA 5D9MA 3WUFA 4HPHA 3BAJA 1CXIA 1VBRA 1JF5A 1KGUA 5E6YA 1C90A 2XSBA 4AIEA 1W9DM 4KGJA 1WZAA 1UZ4A 4AW7A 3VU2A 2WANA 3AICA 1J0IA 4UZSA 2VC9A 1A47A 2YLLA 4V28A 3WEOA 3K46A 1GHRA 1OINA 4DM1A 1VJZA 2BXZA 3IK2A 3MUY1 1OB0A 4UFLA 1WCGA 3PHAA 5ABFB 2J7HA 3ARYA 1M01A 2O9PA 1GOIA 1HJUA 1W9VA 3ALGA 2B31A 5BROA 3VD4A 1UKOA 1QNQA 3BXWA 4N42A 2WWCA 2WC7A 3RJXA 1JDAA 2F61A 1GONA 1PIFA 4DWSB 3WUBA 2E9MA 5JBDA 1V3HA 3AMCA 2WCAA 1EGZA 2XIBA 3L4WA 2XHYA 5LYRA 2VVSA 1BTCA 1NP0A 4UFIA 1CYGA 2GJXB 3BGAA 1FP9A 3BMWA 4D6FA 1NWUA 2VO5A 1L8NA 4P8XA 3U5YA 1F4HA 2YDQA 4J3UA 2OYKA 2XUCA 1ISWA 3ZT7A 3CUFA 5AY7A 4MJ4A 4CD7A 4UQCA 1G9HA 1HF6A 2D0FA 4HOZA 3WEZA 1TR1A 4AZBA 2G3MA 2X09A 3T0BA 3EYPA 1FFQA 4J3TA 4X9YA 4W84A 3W6LA 3ZT6A 2WBGA 1E1EA 4YN5A 3RO8A 1M03A 4AD5A 2BNJA 5DFAA 3WF0A 1DHKA 2DSWA 3AIBA 1UHVA 5GNYA 1Q6DA 4R27A 1VFMA 3A4XA 2UY3A 3RDKA 1KCLA 4PMUA 3VIIA 4HMDA 2JEPA 3UEQA 1JD7A 1SFSA 4W8LA 3OA5A 4BQ3A 1UR4A 3AMGA 5A3HA 2VZVA 3T2OA 1R8LA 1V3LA 2GJXA 4ZE5A 7A3HA 1OGGA 1VRXA 2VVNA 3U5UA 1JZ3A 2EXOA 2C0HA 1QI5A 4PTMA 3T08A 3T0AA 1MW3A 3GM8A 4QCEA 2TAAA 4JKLA 3SCSA 1ECEA 3WN6A 3RMEA 1IT0A 4CD6A 5AYBA 2FGLA 2WZHA 4TTUA 1X6NA 1XH1A 2E9BA 2EPLX 4H8UA 2ZXDA 1V02E 1B2YA 1H11A 2OSYA 1WZKA 3WF3A 1I1WA 1JI1A 3WQWA 4TVDA 1V6UA 1W9PA 1JDDA 4BS0A 2WVTA 4GO8A 3CTTA 3ARUA 2CBVA 1LQ0A 1J0HA 2RGMA 4GIAA 3K8MA 1HJVA 1E15A 1ITXA 1SR0A 3EDKA 1VENA 2W5FA 3AS3A 2WK2A 3BLKA 5KZ6A 4PMOA 2WVSA 4UOQA 3VX0A 2WW5A 3OGSA 1HVXA 1J10A 4DWSD 3AMLA 3BC9A 3WIJA 2CIPA 5I6SA 1HP4A 5A6KA 2FH6A 2J7GA 2WVUA 1GJWA 4CKQA 3MSGA 3WQ6A 4GPNA 1WKYA 3OBAA 2JF7A 1HL8A 1OGSA 2O92A 4LPCA 4WSJA 3EDDA 1JZ8A 1BYAA 3NSNA 1G0CA 3THDA 2VX6A 3THCA 2X1IA 4A3HA 1E4MM 1QVBA 3SUTA 2GDUA 2YIHA 4MJ2A 3ZSTA 1FP8A 4D71A 4AEFA 2XFYA 3MV11 3VDBA 3A6OA 2JEQA 5CSUA 3AZRA 1GOMA 4ATWA 2Q8XA 2ZUVA 3W37A 3IANA 3OGVA 4Q22A 2WVVB 4UNIA 3PZGA 1UQYA 3AXIA 1KQZA 3AIWA 4LGXA 1D7FA 6CGTA 3MU7A 3GNPA 1RP8A 4MDOA 3APGA 3CZGA 4W89A 4DM2A 1GOQA 3VGHA 2XIIA 4W5UA 1RPKA 4J27A 5AYIA 3AIEA 3WD3A 4Z2GA 2ZUTA 2QPUA 4XZWA 2G4FA 2HISA 1CXEA 4CU7A 3AI0A 2J75A 4S3JA 3VKKA 3VTRA 1K9DA 4W7WA 1OWQA 4CD5A 1NH6A 1UD3A 2CETA 1XYZA 3CZ8A 1OM0A 4E4PA 2NT0A 1KXVA 2J7EA 4LYPA 5E6ZA 4IPLA 3U57A 3VIGA 4AMCA 4M80A 1OIFA 3WNOA 1XCXA 5FL0A 3WQ8A 7TAAA 2EJ1A 3VPLA 2J4GA 3M07A 2FHFA 1EIBA 3QHOA 3SEPA 1LL4A 3QGVA 1GQLA 1MFUA 1V03A 5I78A 5I5RA 3K1DA 3VIFA 4TTGA 4PYSA 1WDSA 3OG2A 2Y4SA 2XVKA 4Z2KA 2CBUA 2EPOA 4QLJA 1LF1A 1UWUA 3J7HA 4KGLA 1JF6A 3DYMA 1CXKA 1R87A 1OT1A 1BHGA 4D6JA 3G6MA 3MMUA 3WDPP 1BF2A 3ARPA 4AIOA 1SMDA 2WWDA 2YL9A 2GVYA 1KFWA 3B8SA 3CIVA 3VO0A 3N15A 1UOKA 7CGTA 3CUIA 2D1ZA 1R7OA 4WIWA 4OUEA 1G94A 1EXPA 3QOKA 3N11A 4AZCA 3UR8A 4YHGA 1OD8A 1KGXA 3WSUA 5E0CA 3WDHA 5CJ5A 3ZM8A 2VCAA 2VTFA 4U5IA 2JFEX 4D6HA 4JFWA 3II1A 3MANA 2Y2WA 4M82A 3BSHA 1D3CA 1O7AA 2QHAA 1UH4A 4MNMA 5I79A 4XV0A 4MB3A 1HKJA 3ARWA 2PWEA 3D5HA 5IHSA 5BYWA 2ZUNA 3QOMA 1CXHA 1ZL1A 1DWHM 4D6GA 1V3KA 2J78A 4EANA 3WF4A 1UKPA 3WH6A 1JYVA 1CENA 4HP5A 3RIKA 4PTVA 5EFDA 5I0DA 1EQCA 2GSJA 4NZCA 4RE4A 3OIHA 5I3DA 2CHNA 4JZ5A 3RM8A 1Q6EA 4UOZA 4FLRA 1VFFA 3GTNA 2DSKA 2J25A 2J7DA 3WNLA 3VGEA 2VRJA 1PEZA 1LWJA 3RCNA 3CZLA 4JFUA 5HPCA 1MW0A 1ISYA 1V6XA 1KQYA 4FK9A 2CPUA 4NF7A 6A3HA 2O9TA 3WELA 3VNYA 1NQ6A 3CHFA 5BRQA 1R85A 1GOKA 3WNPA 3AS1A 1PX3A 1NARA 2J47A 4MNLA 4OBSA 2IXVA 2WXDM 2J79A 3AFBA 3FHAA 2EEXA 1E73M 1MQRA 3GZAA 1UWTA 5BXSA 4PMZA 3AIRA 4JAWA 3CGTA 3O6AA 4P7OA 3S2CA 3BLPX 3VM7A 5HDRA 2D3NA 3I3EA 2E40A 1HKKA 3CHEA 1ZBVA 1AQMA 2JF6A 1CXLA 4AISA 3ARRA 2BXYA 1US2A 2DH3A 2WC3A 2Z1SA 3W28A 5A6MA 1PIGA 1R86A 3NSMA 1J0JA 4HU8A 3NUKA 3MO4A 3EDEA 1LJYA 3WY1A 2DSVA 1UWSA 3AQUA 1Z32X 2BY2A 3MV01 4KRUA 5FKYA 4AWEA 1WDQA 5A94A 3PZVA 1NWSA 1J0ZA 5HNNA 4PMXA 2XM1A 2WLZA 4PMVA 4D72A 4MTVA 3TTYA 3W25A 4E8DA 3IAPA 3L4VA 1BPLB 4ML4A 1RD6A 3W4RA 2AMGA 3AZTA 3HN3A 2J7CA 1W32A 3O9NA 4HZ8A 4DUXA 1HKMA 5IXEA 1A3HA 3CZJA 3NDZA 4WKFA 5DF0A 1DP0A 4CCCA 4M81A 4PCTA 1FHLA 4X0NA 3E1F1 4Q7NA 4RE2A 5DT5A 3F4VA 3HJEA 1I75A 1RH9A 4UFJA 1AVAA 1W9UA 1E3XA 4F8XA 2E4TA 1BAGA 3AYRA 1SMAA 2BFGA 1NWRA 2V3DA 2DQXA 1PZ3A 3WH5A 4DUWA 1G1YA 5E0FA 4M8UA 4ZENA 1XRVA 1JZ6A 1UD2A 4UOJA 1NOFA 3NCOA 1XSKA 1E4LA 3NDYA 2XFFA 4TOQA 3U7BA 3VDHA 3ZIZA 1CGXA 3WQVA 1X1NA 3TP4A 1W9BM 3CPUA 2BVYA 3TA9A 4GZIA 4CN1A 4WKHA 3N04A 1UWRA 4AY1A 2VZTA 3MMWA 3IJ9A 2GFTA 3EDFA 3AXHA 1AQHA 1OD0A 1UR2A 1V3JA 1WDPA 3SCWA 5I77A 1GQIA 3AHVA 1KXQA 3KE0A 3GXDA 1KB3A 1B30A 1BSIA 2WNWA 2F2HA 3WEMA 1B3WA 4IM4A 5JIWA 1QHPA 1G01A 1Q6GA 3EDJA 2BS9A 4BQ5A 2WHMA 4LQ1A 3WL1A 1RP9A 2WHLA 3UESA 5CLWA 1C8XA 2EPNA 3WF2A 1CGWA 1V3MA 3HMCA 2OSXA 1E40A 5JBEA 4J3SA 1O6IA 4UQDA 5BWFA 2PBOA 4W8BA 1W3JA 5CGMA 2GUYA 2X05A 3WFLA 3ECQA 3CUHA 1UH3A 3OB8A 1JZ2A 2CKSA 1UKSA 4EK7A 1E56A 3SURA 1CZ1A 3RILA 3BAWA 1QNOA 4F9JA 5LA1A 1JZ4A 2BVTA 1E6ZA 4YHEA 4FLQA 1IV8A 1TVNA 3IAQA 3W27A 3CZKA 4PUDA 3ARQA 1H41A 3F5KA 1FH8A 4HU0A 4UFKA 1XD0A 2WCGA 1FFRA 3VIOA 3VIJA 5I23A 4ATDA 3MUZ1 3RM9A 1XYFA 4F66A 4HOXA 1AMYA 1CWYA 1KWKA 3W0KA 2DT0A 5I24A 2VX7A 2XVNA 3SUVA 2OWCA 4W88A 1U30A 1GNXA 1VF8A 2DEPA 2PBGA 2QMKA 2VRQA 2YJQA 4BZYA 4QLKA 1HL9A 2D3LA 3AZSA 3JUGA 4W7UA 2XVPA 2XVGA 1WDRA 2QF8A 4S3KA 3VGDA 3W24A 2ZIDA 1JAEA 3ZT5A 3T2QA 1XSJA 3ZJKA 2WM0A 2V3FA 1MVYA 2W91A 3VD5A 1BYDA 4PMDA 4PBGA 1VAHA 3CBWA 1MW1A 1PJ9A 2WAGA 1E72M 3VUPA 2UY5A 3OLGA 2F8QA 1WZMA 4C7GA 1EDGA 1WPCA 1NOWA 3AIQA 1QBAA 3ZR6A 1QBBA 3VM5A 1QNRA 4JL1A 1E71M 1K9TA 4NRRA 3EMQA 4F79A 3D3AA 5A6BA 4YPJA 1DEDA 3OLDA 1C8YA 4OBRA 3SIMA 2WZEA 1WE5A 5A2CA 2W61A 4BF7A 1P6WA 4UTFA 4OKDA 1MYRA 5FIPA 3SCTA 3POHA 1AQ0A 4ACZA 1YHTA 2J8GA 3W82A 4BQ2A 3VDCA 4AZGA 4HZ6A 4AXNA 1H4PA 4JFVA 1WB0A 4WKAA 2CNCA 2WHJA 3T2PA 3CO4A 3TTOA 2WYSA 4A3YA 3CHDA 3BSGA 1JNEA 1J18A 2FDMA 1TMQA 4AD0A 1TVPA 2X8RA 3WDJA 1V0MA 8CGTA 1ODUA 2D22A 3PTQA 2YA0A 3VMNA 3N13A 2VX5A 3KZSA 3VDAA 4M24A 5BXRA 4B9ZA 3RJYA 4QDMA 1CGVA 1KBKA 1CTNA 4H8HA 2W4XA 2WB5A 5IHRA 4AZ5A 4OOUA 5CG0A 4ZFMA 1BYCA 2IUZA 1UD6A 3A4WA 1E55A 1GJUA 2V5CA 4JCMA 1JAKA 1TFVA 4GQQA 4LYRA 4UFHA 1YQ2A 5E09A 5EBAA 4OZOA 3UCQA 1FA2A 3SUUA 1ZBWA 2E0PA 5A2BA 3N9KA 1V6VA 5C71A 3GXFA 2FHBA 2JE8A 2EO7A 3ZJ6A 4PSRA 1LLOA 2WLYA 3PZTA 2PWFA 5A1AA 3AIVA 1PX8A 2XWDA 3PZNA 5CPTA 3WBAA 2AOSA 5EB8A 5CZKA 2E3ZA 4PUEA 3W53A 3POCA 5GNZA 1JG9A 3WUGA 3QR3A 2UY2A 5CPSA 1ZJBA 1UKQA 4AEEA 4J3VA 1E1FA 1E9LA 4BQ4A 2QLYA 3F5JA 4RL3A 3LPGA 3DHUA 2OWXA 1K9FA 2GDVA 1VIWA 1W2PA 4AZCB 1KBBA 3AJ7A 3ALFA 4PMQA 2ESCA 2XYLA 1KGWA 4H2CA 3GNOA 3AIUA 1MQPA 1B90A 2WBKA 3VIPA 2WMKA 2O9OA 1E6RA 2A3CA 4U2ZA 4D6DA 1B31A 1CNVA 1L0PA 1W3KA 3WNKA 1XGZA 1HP5A 4W86A 3VGFA 2PB1A 1BLIA 3PZMA 3W38A 3DHPA 4WLCA 1HIZA 2ZWYA 4XUYA 1FH9A 2DT3A 4TVUA 1UYQA 3GH7A 4TX6A 5ABGA 5DT7A 3ZQ9A 2PF0A 1ISZA 3N12A 4K68A 1GPFA 2ZOXA 1KWGA 1JXJA 2G3NA 2VZSA 1OBAA 4U2YA 1XV8A 2NSXA 3ZR5A 4CGTA 4FF5A 4HMEA 1H0IA 1EH9A 4DWSC 4CCEA 5BRPA 5BXTA 3OZOA 1VFOA 1V0LA 3FNDA 4CVUA 3A47A 3WL0A 2WKLA 2WMHA 4Z2HA 1C8QA 4U3CA 5KEZA 2JIWA 2O9RA 3RPMA 2XM2A 5A8PA 4UFMA 3MS8A 3FAWA 3O2LA 3OLIA 2ZX9A 1J12A 2A3AA 3VMOA 3L4ZA 4H8VA 3SCNA 1UR1A 5M03A 4AD1A 2VURA 2D23A 1VFUA 2X0HA 3WH8A 4URIA 1J0YA 3LMYA 3AYSA 1LL7A 1GW1A 4U3AA 2G41A 3WMBA 1TUXA 1V6WA 2ZXQA 5DEZA 4J3WA 3WF1A 3GXMA 5HPOA 3PZ9A 5ABHA 4PMNA 4Y7EA 5D9PA 1M7XA 1U33A 3GYCA 4UQEA 1TA3A 4MADA 4GI6A 1MWOA 4HZ7A 1GOOA 1ITCA 1JYWA 4LXFA 5CXPA 3WQ4A 4MAZA 4UQ9A 1UQZA 3L4UA 1N82A 2PWDA 2ZUSA 1CGTA 2ZX6A 1CEOA 3WH9A 2VOTA 5C70A 1CECA 2WMJA 3BAYA 5M17A 3EBVA 1XD1A 9CGTA 2NW0A 2D0HA 4W8AA 3VVGA 2DSZA 1VEPA 2OLHA 1HT6A 2ZWZA 1CLVA 2YBTA 3BMVA 3I3DA 5DO8A 1XSIA 1E6QM 4M56A 1UA3A 1MQQA 5ABEA 2Y5EA 2VR4A 4MB5A 2Y24A 4MDPA 1DWAM 3GNRA 5JIPA 2W92A 4QP0A 2PC8A 5A8OA 3WNMA 2YA1A 2WMIB 5GQBA 1HKIA 3AOFA 1R7AA 3KEHA 1E5NA 2XGIA 4B3LA 2VJXA 1M04A 4UCFA 4X0VA 3FHQA 5A6SA 5E9AA 2ZUUA 4FMVA 5CLTA 1GZJA 3A3HA 3L4XA 5IFTA 4GZJA 3VX1A 3ARVA 2D24A 5HXMA 3QHMA 3WBEA 4Z2LA 8A3HA 4PCSA 3WKZA 1EQPA 1E6PA 4P7QA 4B15A 4AIUA 2E8ZA 3BCDA 3SCRA 3AROA 1OGBA 4W87A 4EE9A 4ZEPA 1S46A 2W62A 3CUJA 3VILA 5CQ1A 1ISVA 3WD2A 1CGYA 1CIUA 4QFUA 2ZX8A 4GINA 2WZIA 1HVQA 4NSBA 4ZXLA 2WMIA 3AHXA 1QI2A 4UZUA 1OIMA 1TG7A 1EOKA 2CHOA 1QW9A 3PZUA 3M7SA 3M46A 1V3IA 2VRKA 1JL8A 3SUSA 3AHZA 4HA4A 4W7VA 4JHZA 3VGBA 3PZOA 3VIMA 1ESWA 1J11A 2E8YA 4J3XA 5GNXA 4CN4A 4MNKA 1NM9A 4P8WA 2J77A 4V2XA 1QW8A 3ARXA 4V27A 1EO7A 1UWQA 1JZ5A 1TZ7A 4IPNB 1WNOA 4AD2A 1NWTA 3UERA 3OLEA 4AZ6A 3IJ8A 4M1RA 4WK9A 2DIJA 1LWHA 1NOUA 1E70M 4DUVA 2HVMA 4XB3A 1BQCA 4B3KA 2J8FA 2XVLA 3W81A 2DT1A 2DIEA 2WPGA 2V5DA 1E4IA 4PTXA 1UG6A 2Z1KA 1PBGA 5FL1A 2J7FA 4JIEA 1FHDA 3DYPA 1PPIA 5D8ZA 3UG3A 1EA9C 3GDBA 2VQTA 3KL0A 5IFPA 3WUEA 4KWUA 1ZBKA 2DSUA 4D1IA 2BY3A 3NJ3A 1CXFA 5IDIA 4PEEA 4P8VA 2VL4A 4UQBA 1UD8A 1C92A 1GORA 1QHOA 1HJXA 1E43A 2CESA 2XWEA 4AD4A 1CDGA 2G3JA 2BVDA 4U31A 1V0NA 3G6LA 1C93A 2E9LA 1H09A 2BHUA 1JNDA 3AHYA 1JD9A 3WDQA 3PTMA 1WZLA 4CU8A 3BAKA 2WSKA 3NYDA 4CD4A 5DMYA 1KR0A 2OWWA 4CU6A 2CERA 1ISXA 1K6AA 3VINA 3ZSSA 3L4YA 2D0GA 1WO2A 3I3BA 3SCVA 3ARZA 3FY1A 4HA1A 5A69A 1UKTA 4QAWA 1FH7A 1JFHA 5JBFA 1KCKA 2ZX7A 5EFFA 5D9NA 4GKLA 1B9ZA 4ACZB 5ABFA 1LG2A 1JXKA 2DDXA 4R5EA 1BVNP 1B1YA 2VZOA 4WF7A 3CUGA 4H7VA 1QI4A 5F7UA 4ZE4A 5M3WA 3IJ7A 3DYOA 5TD4A 4FLOA 3L2MA 1F4AA 1EHNA 3OZPA 5HBFA 3VD7A 2WCSA 3CH9A 4DWSA 6TAAA 4KRTA 4KMQA 4B16A 5CPQA 3PTKA 3W29A 2VT0A 4NI3A 3VIHA 1Q6FA 1PAMA 5ECUA 4FLSA 1UD5A 1MXDA 3BCFA 3B9EA 2XG9A 1H1NA 2VR5A 4B9YA 1H3GA 2RGLA 1LG1A 1CBGA 1HNYA 2C7FA 5AC4A 3WD4A 5CSYA 1DWJM 1KXHA 1QI3A 3GBEA 1MXGA 3GXIA 4ACYA 3FN9A 3PN8A 3WMSA 4PTWA 1W91A 1QHZA 1GVYA 1UWIA 3GH5A 5FCZA 4AD3A 3CLWA 1GQJA 3K4AA 3KWXA 4GXPA 4W5ZA 1E0WA 1B3ZA
chains in the Genus database with same CATH superfamily
2D2JA 3LBCA 6ALDA 4HOWA 5KZMA 3TOPA 1DWIM 4DJEC 5I06A 1XHGA 2OGYA 3REQB 3TLLA 4HA3A 2A6NA 3BARA 5GJMA 5TIMA 3FJ4A 4DJFA 1HL2A 3UWZA 4OIFA 4DY1A 4IFRA 2WZMA 1I2QA 1DPMA 1L2QA 3AMKA 3DX5A 1W1YA 3URBA 3LPFA 1ZB5A 1U5JA 3LN3A 2PTXA 3P93A 1KCXA 1E5JA 1SW3A 3UZJA 3KVJA 1F7BA 2GJRA 1A5NC 3CMJA 1HO4A 2BOEX 4HSOA 1C3FA 3P62A 1IZJA 3UJEA 4A2SA 1AUSL 3M9YA 4UIOA 4L4OA 4QNWA 3TYCA 4IUGA 1YYAA 3W26A 2X2YA 4P8UA 1E1CB 5CJNA 2F38A 4FS9A 1PWMA 1KRAC 2E25A 3S0CA 3STGA 4JTFA 4Q8OA 1B57A 5HULA 4AC1X 4EAMA 1KBJA 1X38A 2YA2A 4JL2A 2HNEA 3BAXA 1J9YA 4MKSA 2W67A 5D05A 4B3ZA 2DZBA 2EPHA 4WJXA 3W84A 4AZIA 4UTHA 3L4TA 1TRIA 4H01A 4AG0A 4BEQA 1FY6A 3QFEA 4PRWA 1I2NA 3WLOA 5K3VA 2OT1A 3UU0A 1KR1A 1N55A 3OA3A 4UR9A 5I2UA 1TELA 2J74A 4O11A 1SW7A 4RDZA 1L9WA 2VMFA 3G24A 3V4BA 3CV1A 3DHFA 3BLFA 5JVLA 5CPNA 3DGBA 4UR7A 4GIRA 5FOOA 2YDRA 1JZ7A 3EEZA 1JGIA 1HXJA 1XUZA 3W1RA 1UR8A 2PI6A 1S2CA 1H7WA 3H4WA 3TZNA 2WQPA 3MBDA 4FIRA 4FX8A 3E49A 1F9CA 2WVVA 3F5LA 1U1UA 1GOWA 3R0KA 2PCQA 3KBMA 1S5TA 1NFPA 4TU1A 2PWVA 5G2WA 2VX4A 3QHNA 4KH2A 1Q6CA 1D8WA 1RXOB 2QIWA 1P0EA 2ATMA 3FVDA 1KO0A 3B4UA 3FAXA 1H2JA 1QWGA 3KL3A 4ATLA 1HN1A 1DJWA 1PX4A 4DHGA 4Z2JA 2XPKA 5AHMA 4JKKA 5CAKA 5A8MA 2O4MA 4O14A 1NJJA 1QNSA 5A8NA 3ABXA 4PMRA 1R2RA 1XC6A 4CVWA 1XR2A 3CWHA 4E8CA 2WSPA 3E0FA 3UR7A 1M53A 3KOYA 3KLLA 1OX4B 4U4MA 2RKXA 1M3UA 3AWOA 1TWWA 2PDHA 3R58A 4I5UA 4BK9A 3LPOA 3LCLA 3P5ZA 2Y8KA 1XIJA 3M64A 1AMKA 2X0YA 1T99A 5D30A 2HTMA 4H9XA 2XJ7A 3OBEA 1UPMB 3EX6A 4XBSA 1W0MA 3ZMRA 3SIZA 2Z29A 1V02A 2BVWA 3N17A 3DFHA 1KFLA 2UWFA 4I6VA 5FD0A 3URQA 5A6AA 4H04A 1HGWA 2CKRA 1AK5A 2ICSA 3GVVA 3WDRA 1J79A 1HJWA 3OVRA 4AFYA 1RK6A 1KXTA 3URNA 1XM3A 2ZTJA 5HMFA 2ZADA 1K7XA 4H7ZA 5A6TC 1GQKA 1OY0A 5A95A 3CUXA 5FACA 4XX6A 3TKFA 1LM1A 3W7PA 3O6CA 3C0JA 2CBIA 1ZP4A 3O06A 1EP1A 2F7FA 3W1XA 3SRHA 4LY8A 4AZ7A 4PN2A 3CQHA 3HZ3A 1S2TA 2FHCA 1KRCC 4XVEA 4S2CA 3BJTA 2TODA 2GGHA 1C9WA 3MSYA 1YADA 1MW2A 3OGRA 1EPVA 3HO8A 1TZ9A 1E6SM 1RK5A 3M6DA 4LYQA 2E28A 3C8NA 3W72A 4FI4A 2YYTA 4IMCA 1TCMA 1F61A 3M41A 2ASHA 1OYBA 4F40A 2QDHA 3AXXA 2PDUA 2V3EA 5IRPA 3N3TA 1U5HA 1GOXA 3B8DA 5F2IA 1DVJA 1K8YA 4CEUC 3HGRA 3W2NA 3EZ4A 3V7PA 3LHTA 1GUVA 3Q2DA 4D6CA 3UY7A 4PSPA 1EC9A 2RJHA 4PTNA 3WQDA 2OZ3A 3NR0A 2GQAA 3EKZA 1UZHA 3IV8A 1GTHA 3OVQA 1DOSA 1VZWA 1BD0A 1ZRQA 4A29A 4ICCX 3AS0A 4PFHA 1IXNA 1DTNA 4HNLA 1E0XA 5C54A 3NIYA 3PZQA 4TX9A 4Q8TA 1NF7A 1PZ2A 2QCMA 1O5KA 1EO5A 3WQ5A 4MWAA 5HOSA 3W23A 4N9EA 3ARTA 4WUIA 2PP1A 4NJHA 4C6EA 3UNTA 3IJ6A 1TV7A 3ZLGA 1W3HA 2VGFA 3ERPA 5AC7A 1MUWA 5CH9A 1V08A 3A13A 3OZMA 5D9MA 3DIPA 1HTIA 3BAJA 1NDYA 1KGUA 3GG1A 1XDMA 4RPQA 2E09A 4POCA 1EJSC 2RUSA 3VU2A 4LS2A 1F3TA 2QCLA 5LIXX 2H9AA 4YCPA 3WEOA 3K46A 1DJYA 3M0MA 3GVQA 4HB7A 3W83A 1O5RA 1X8FA 3MUY1 2AKMA 3PHAA 3ARYA 1GOIA 1HJUA 4ADTA 3O63A 1EBHA 4O18A 1JDAA 2F61A 3OVPA 4L7ZA 4DWSB 5JBDA 3NXLA 1V3HA 2ALDA 2Z24A 4NYUA 1W31A 5I7GA 1T96A 1BTCA 5I07A 4UFIA 4IIEA 2QUUA 4LAOA 3HMJG 4U28A 4D6FA 1OC7A 2NVCA 3E6EA 3JS3A 4P8XA 4YWSA 5I00A 5C9ZA 2OYKA 2XUCA 3PWGA 2ON3A 9XIAA 1GKQA 2VELA 1A0EA 4MJ4A 4UQCA 5CKSA 3V0SA 3V1HA 4KFNA 1XI3A 1G9HA 4G7EA 3PB2A 4LUSB 1QATA 1U5VA 4R7OA 4HT3A 2G3MA 5CZSA 1FFQA 4GYJA 4Q4QA 4NZ4A 3S1WA 5RUBA 4DO4A 3KLKA 1OABA 3RO8A 1E1EA 4YN5A 4O0KA 3W70A 3W73A 1KTNA 1M03A 4WXZA 3WF0A 2P8CA 5CEWA 4KCVA 4ECLA 3DFQA 5GNYA 2VFDA 2UY3A 4HSHA 3RDKA 1KCLA 1VHCA 1V79A 5AHFA 1UZDA 4BQ3A 1DXIA 1UR4A 3N34A 2INEA 4KRZA 4AHQA 2QGHA 3T2OA 1OQFA 2O0TA 4KPLA 1OGGA 1VRXA 2VVNA 1RZMA 2EXOA 1QI5A 5CZ0A 3T0AA 2DVXA 4QCEA 4M6UA 2YXXA 3SCSA 1UBPC 4DO6A 4Z42C 3WN6A 3HBLA 3DU0A 5TF0A 3SBFA 2FTYA 1TJ2A 4TTUA 1XH1A 2EPLX 4H8UA 3TWAA 1FWHC 3CAKA 3NO1A 2WJEA 2YCIX 3PAOA 1OFBA 1WZKA 3ES7A 1I1WA 3BG5A 3CYJA 1JI1A 3WQWA 4TVDA 3HQPA 1W9PA 3UR2A 1JDDA 1GVEA 4NX5A 4BS0A 5J5RA 3V18A 5AVNA 3BWWA 4GIAA 5HAOA 3LXBA 1HGYA 4FEZA 4WZHA 1SR0A 1XLBA 1I6NA 3QJAA 3MT1A 1R2TA 4EXBA 1A5LC 4LB4A 4PMOA 3W1AA 1XPGA 1HVXA 1J10A 3WIJA 2NSOA 5HR7A 3NZRA 1VYSX 5BRBA 2FH6A 3IJIA 5C2XA 4JTDA 4IGSA 2X30A 2O92A 4JN7A 4DJDC 1Z48A 3EDDA 1BYAA 1QK2A 4OU1A 1OC6A 4LAZA 4JTCA 3V0TA 3RGTA 2WSRA 1E4MM 1LORA 3MY9A 3BW4A 2XN1A 4LS1A 2YIHA 4IMEA 4P2VA 3BURA 4YIWA 3PR2A 2FVLA 3U9IA 4RUBA 4H9UA 3K30A 5FEZA 2JEQA 3QMRA 4NZJA 1GOMA 1JCMP 1V7YA 2Z27A 3ATZA 3NL3A 5CPMA 4ATWA 3VA8A 4Q22A 4UNIA 3MI6A 1UP2A 3I7RA 3E0WA 3NFUA 4GIEA 3N4FA 4OHQA 1YRRA 1PUDA 3BJSA 5LNWA 3E0LA 2D2GA 4A3UA 3GHRA 4EWJA 1YTDA 5AYIA 1XKYA 4GH1A 4IG2A 4DEFA 1CXEA 3V35A 3NPVA 2OEJA 2C71A 1LLWA 3PK7A 1UD3A 1P4CA 2BX7A 3OJGA 3CZ8A 1XYZA 2VGBA 3TAOA 1KXVA 4LOCA 3ENLA 3IJDA 1OCJA 5E6ZA 5FL0A 2OKTA 2EJ1A 2FHFA 3GXTA 6PTDA 3QHOA 3SEPA 3AXMA 1LL4A 1MFUA 5I78A 2CZDA 1WDSA 2V5BA 3MVTA 2XH0A 4QLJA 4H19A 4JN6A 3TR9A 5FJTA 3LXAA 1MSSA 1BHGA 2BTMA 3HG4A 3LQGA 4RCXA 3W86A 4NT0A 3LTPA 1BF2A 2NVDA 2KZHA 4KWVA 4ZMGA 4Q8QA 4K6AA 1YE4A 1KFWA 2CZFA 3CIVA 4RZ5A 7CGTA 3BLIA 1KM6A 2OTDA 3PNZA 2D1ZA 1HQTA 1VQTA 3GNDA 3N11A 3F4DA 4AZCA 4YHGA 2J9ZA 1QASA 2DFAA 2E5CA 4QEEA 1ZAIA 4J3ZA 1M5WA 4D6HA 4GY0A 2QHAA 2BXVA 5DXYA 1FWSA 4MNMA 5G4EA 5I79A 1W5PA 3O0KA 2PWEA 4XSMA 5BYWA 3B0UX 1ZL1A 4ZO8A 1DWHM 2ZE3A 2BLEA 4JIQA 1V3KA 4R34A 4EANA 1MUMA 3WF4A 1RAKA 3QW4B 3WH6A 4DPQA 4CNPA 3F4NA 4FNQA 1CENA 3H7VA 1QRQA 5D2VA 5I3FA 4HHLA 4L1GA 2PLMA 3NVDA 4EWND 3C4UA 3OIHA 5I3DA 2GGEA 2INZA 4MY1A 1Q6EA 2WNQA 2QKFA 4K38A 2PDCA 3VGEA 5K2ZA 4OE7A 3B05A 3BPWA 2VEPA 3RCNA 3YPIA 3DBPA 1R3YA 1MW0A 1ISYA 1KQYA 3ITLA 4CQDA 4NAFA 4NF7A 6A3HA 5IDZA 4X60A 2QVHA 1NQ6A 1OF6A 2X1SA 4XVDA 5BRQA 2IW0A 1LZOA 2QUVA 4RXGA 3AO0A 4QBXA 3W2JA 5G1YA 2NLIA 3TQPA 1A53A 3LCWA 4M3PA 1AL7A 4PMZA 3RF9A 3ITOA 3W22A 4GNJA 4WEVX 3UA4A 2CZ5A 5G1MA 3S2CA 4QG8A 3I3EA 4J4KA 2P5NA 1HKKA 1VIZA 2PAJA 1J93A 1ZENA 1D9EA 3BCJA 3H70A 2BXYA 7ODCA 5CPOA 5D2YA 3W28A 1PIGA 3LYEA 2QCHA 4HU8A 1YE6A 2RAGA 4G9PA 3NUKA 7XIMA 3AQUA 2FFIA 2BY2A 4JTSA 3HG3A 4KRUA 1ELSA 1EUNA 2PCEA 3H2MA 3BLDA 3VNIA 5HNNA 2XM1A 3I6TA 3ABSA 2QCNA 2ZZ1A 5ENLA 1J2BA 3W4RA 4IFKA 1AH4A 3AZTA 3N6QA 4C1NB 2Z1VA 2WKJA 4H6KA 3CZJA 1NDZA 2EKCA 4M81A 4PCTA 3ATYA 3G1SA 3T0TA 4Q7NA 5REQB 1I75A 1RH9A 4PRTA 3E96A 3KBVA 3IACA 4XD4A 3LZ3A 1GKRA 3FV9A 1WXZA 4JTEA 3KWSA 4RW3A 7REQA 1NWRA 4Q4OA 2V3DA 2YB4A 2WSQA 1PZ3A 3WH5A 4MJMA 4C6LA 2XFFA 1TPFA 3NQ6A 5HR6A 3WQVA 3P60A 3TP4A 3G1FA 3TA9A 5HUOA 2BWGA 4AY1A 2YCLA 4HKPA 2R1MA 1XIGA 4AY8A 3IJ9A 3EDFA 2Z1XA 1UR2A 5I77A 1GQIA 1KCZA 3AHVA 1F2JA 2HE8A 3FDKA 1KB3A 1BSIA 2F2HA 1OFPA 3D47A 2XISA 3W1MA 1Q6GA 4BR1A 3A24A 2WHMA 2INFA 2EPNA 4FAMA 3WF2A 1ZTVA 3GTFA 3HMCA 4QR6A 3ZLHA 3S47A 1XS2A 5JBEA 4J3SA 1O6IA 3K13A 3WLNA 3P74A 8RUCA 2DZUA 3STFA 9XIMA 2C6QA 3ECQA 2FGBA 2YSWA 2CKSA 1KM4A 1QT1A 3R12A 1UKSA 2XDFA 3V5CA 3S5OA 1SZEA 4RV3A 1IEQA 1BRLB 4XBKA 3QW3A 3S2LA 1E6ZA 4YHEA 2VC5A 3IAQA 3OEXA 1IEVA 2VEMA 1L6GA 1B3OA 3ARQA 3GD6A 2WCGA 2B0MA 3VIJA 1XYFA 4CNSA 3QQWA 3W9ZA 3UQNA 3I7QA 1AMYA 1CWYA 3P2VA 3W0KA 2DT0A 5I24A 4OT7A 2XVNA 3GXPA 3SUVA 2OWCA 3DKJA 4CNTA 1Q4WA 1Z6KA 1VF8A 3FXGA 4BZYA 4Q4PA 2YXGA 4I5RA 3JUGA 4R9XA 1TMHA 2XVGA 3N2CA 1WDRA 4WJ8A 3PANA 3UXLA 3T2QA 5D09A 4V15A 3CM4A 4JQ4A 5HNUA 4DBEA 2VXNA 1BYDA 1GQNA 2ZFAA 1T6MA 3W1UA 1MW1A 4LB3A 1SO4A 2R91A 2QV5A 2Z28A 2ZRXA 1W1B1 4ICNA 4C7GA 5AZ0A 1WPCA 4N4PA 3AIQA 4LVDA 4JL1A 1K9TA 4WGXA 3BZJA 3EMQA 1RBLA 4F79A 5C9RA 3DH7A 2WZTA 4YPJA 1FWNA 1DEDA 3OLDA 5DRIA 2C3ZA 1BXBA 2W61A 1L6FA 4BF7A 4O1EA 3RMJA 3W82A 2HCVA 3IIOA 3N19B 3GIPA 5T8GA 3VZZA 3DKLA 4HZ6A 2GQ3A 2QXWA 3RLHA 5FF2A 4GE8A 3SY8A 4GYFA 1X8CA 4MZYA 4JFVA 1WB0A 8TIMA 5AC6A 3T2PA 3CO4A 3ABOA 4B5SA 1J18A 3DAQA 5HUPA 2R94A 2PLKA 2CWNA 3OO2A 1V6TA 2D22A 2ZZ5A 3VMNA 2VX5A 5L9FA 4B9ZA 1VP5A 3SQSA 4QDMA 8XIAA 3QGKC 4KESA 4M6QA 5IHRA 4OOUA 4ZFMA 3NL2A 2Y63A 4XTIA 3A4WA 4JCMA 2YX0A 1TFVA 4GQQA 3D6NA 1FRBA 2YW3A 5E09A 1S2UA 4OZOA 3UCQA 1W5MA 2PP0A 1YBQA 5A2BA 3EWCA 4UMBA 1KLZA 2ISVA 1V6VA 2I56A 2PGEA 3GG7A 3BK0A 3PZTA 4A8NA 5CPTA 1TCDA 3N3MA 3A5VA 4NJKA 5CZKA 4YCOA 1XDJA 4DRSA 4NNAA 1XRFA 1JG9A 1PS9A 3GU1A 3QR3A 5CPSA 2OODA 2V30A 1E1FA 1E9LA 3GHUA 3F5JA 3PPFA 1PB0A 1XLHA 2GL5A 4M19A 2OXNA 1W2PA 3NQBA 1F73A 3ALFA 2FVMA 5EMLA 4HN8A 4H2CA 1JRCA 3W2MA 3OW1A 1AJ2A 1H60A 5AVHA 4E38A 2PWUA 1B90A 2WBKA 3OP2A 1E6RA 4U2ZA 2BG5A 4K8GA 1XGZA 2NXGA 4XQ6A 1Q3NA 4N9BA 1BLIA 2HBXA 4JGDA 3NQCA 1FH9A 2Z7GA 1UYQA 2L5HA 2XINA 3L5LA 5ABGA 5A5WA 1QPRA 4KETA 2QUTA 1OFQA 4Q6JA 3SQLA 1IZCA 2ZOXA 2VZSA 4CGTA 4FF5A 1W37A 3OZOA 3UZZA 2GGIA 3FNDA 4CVUA 4GKTA 1IR2A 1FWRA 4DELA 4Z2HA 1SQ7A 4M0XA 1OK4A 1XXXA 2O9RA 1ICSA 3BLEA 4OFCA 2XM2A 1R38A 5AHIA 4X63A 3VDGA 3FGCA 3S1VA 4DPPA 1KW1A 2A3AA 1ADSA 2XH2A 4XZHA 1NEYA 3MB9A 4US5D 1C9DA 3GDKA 2D23A 2PDJA 1J0YA 1LL7A 1GW1A 2G41A 5DEZA 5C0QA 5FF3A 2X41A 1EEXA 1OX6A 5MF5A 5FAJA 4ZTYA 1MEWA 3RX2A 1TA3A 3SN1A 2A0NA 1H7PA 4HZ7A 4DJFC 3Q94A 6XIAA 1DQXA 2QDEA 1JYWA 2ZTKA 3PBUA 5JH1A 1GYNA 3MWCA 4M7TA 5DN1A 4DZHA 1CGTA 4AVNA 2Y0FA 3TNBA 3CLMA 3SRKA 1T0OA 5C70A 1CECA 3BAYA 5M17A 4WD0A 3C2RA 4NG3A 5LNSA 4H9VA 2NW0A 2D0HA 2OLHA 1CLVA 3BMVA 1ZP3A 1GG1A 4IIFA 1UA3A 5G1TA 3A64A 3P84A 3KDNA 5ABEA 4C1KA 2P0OA 1ICQA 3TJ4A 1DWAM 2GVLA 4KFOA 3RCMA 1IWBA 3GVWA 5BU6A 3VKDA 3K2GA 2Y7GA 3IJQA 2YA1A 1HKIA 3AOFA 1R7AA 1E5NA 3UPMA 4DUOA 3PBWA 4B3LA 2YB1A 2DZVA 1AODA 4F0SA 1OFEA 1EP3A 2O55A 4O8RA 3QTPA 1KFJA 1GZJA 3L4XA 3QV9A 1B5TA 3WQPA 2HDJA 8A3HA 1E6PA 1S2VA 1M41A 2VHLA 3GG8A 1VYRA 1XFCA 4P5UA 5C5YA 1OGBA 1XC4A 2J6VA 4YLWA 4EE9A 3FX4A 3AWNA 4F0KA 3IS4A 1S46A 5CQ1A 3E74A 2WZIA 2ZRVA 2VEIA 4TO8A 3S9YA 1LP6A 1HVQA 4NSBA 2WMIA 1QI2A 4ZCWA 4G7FA 1JULA 1TG7A 1EOKA 2CHOA 1UC4A 1VR6A 4HBKA 3G8EA 3WLIA 5JXQA 3NQ7A 2J8TA 3M7SA 2DJLA 2Q09A 3ZFHA 1CI1A 3SRFA 3CL8A 2QCEA 1RSCA 2F2KA 4OQVA 3PZOA 2E8YA 3QV6A 7ENLA 4MNKA 1NM9A 4H6RA 2CLIA 1NAL1 3M4HA 4P8WA 4AMAA 4UTMA 3C52A 1QW8A 1XIHA 1EO7A 4ILSA 4PFMA 3KVMA 4IPJA 1NWTA 5C7HA 3IRSA 2CHRA 1SPQA 1V8EA 3IJ8A 2E6DA 4M1RA 5AYYA 4PGLA 3GFZA 1E70M 3WCZA 4XB3A 3UR5A 4AWUA 3TSDA 3EWYA 2XVLA 4LCSA 4O57A 4ZO7A 1DJNA 5HA7A 4ES4A 4XZMX 1E4IA 4PCFA 4PTXA 3TMQA 5FL1A 1ZPTA 3AALA 1OZQA 5FESA 1FHDA 4ZGYA 1PPIA 5D8ZA 1JUKA 2CXEA 4M1BA 3UG3A 1J2WA 3W7EA 2QDGA 1I60A 3TCEA 1R3QA 2Z26A 3E2SA 3I6EA 1J6PA 4D1IA 5IDIA 2Z6IA 3RR1A 4I8DA 3XINA 4UQBA 2YBVA 1HJXA 1ZHAA 4QG9A 4IHCA 2DVTA 3G6LA 3NTYA 2E9LA 1H09A 1VPQA 3AHYA 1WZLA 2GPTA 3AYTA 4CD4A 1LCOA 1O1HA 2J88A 4NZ3A 4CU6A 5D2TA 1ISXA 1K6AA 3CQIA 3UY8A 5HQLA 1IEIA 1H1ZA 3QY6A 3I3BA 4LCQA 3BQ5A 1G6CA 1IT8A 1US0A 2C1HA 1OG6A 4HA1A 5A69A 1UKTA 1FTXA 1KCKA 2ZX7A 3H24A 4MLRA 1LG2A 1JXKA 2EKGA 4CNOA 3H23A 5F7UA 5M3WA 2UZ9A 4GGHA 1YLVA 2VWTA 2ZDRA 4KEVA 1O95A 3W88A 1F4AA 4US6A 3TTEA 4KRTA 4S3GA 3VAVA 2VT0A 3CQ0A 3LLDA 1MXDA 3B9EA 2VR5A 2EAWA 1H3GA 2BMBA 2P88A 1EKOA 3IIZA 3E5BA 4YJ5A 1NDVA 5CSYA 1DWJM 2R24A 3LDVA 5TQLA 1EX5A 5LNVA 1RQEA 1YXYA 1MXGA 5BMXA 3W1NA 4ACYA 1P0BA 3N2BA 3I10A 3CLWA 3GNNA 4O10A 3K4AA 5HANA 1E0WA 1B3ZA 2Q8ZA 3S6TA 3C2FA 1JVNA 3VYLA 3TN6A 2NVAA 4FX6M 1PKNA 2EQDA 2V67A 5EBUA 3UFYA 3W2LA 1FWIC 1U22A 4A21A 1A5KC 4MM1A 4XIMA 2BHZA 2V38A 1VBGA 2B81A 2PWHA 1W1VA 2PZ0A 4Q4KA 2YCJA 3N25A 3M0VA 3FEQA 4EPEC 4AZHA 1V6YA 3EXRA 1ZU8A 3KL5A 3B8TA 3T8LA 4W85A 4HPGA 3NQAA 1E3ZA 5LA2A 3M16A 1C7SA 2DU2A 3T0DA 2J13A 1ZBCA 3VZXA 4Q3MA 2PWGA 6REQB 1NQKA 3THQA 3SCUA 4FNSA 2Y8VA 2YDAA 2PDXA 5EMMA 1UH2A 1EEPA 4QRNA 3QY7A 7PTDA 3VNMA 1WAWA 4FOKA 3ZWTA 5FF4A 3WENA 3RM4A 4JKMA 5E70A 4MNJA 2GJPA 3ZO9A 3C3NA 1U2YA 1RLDA 2VCCA 2ZC1A 3LSCA 2V8ZA 3HIJA 4GI9A 3WJYA 1V0KA 3TUUA 3REQA 3VD9A 1NY1A 4WOZA 3L65A 3AS2A 4LNCA 4JEJA 1NVMA 3N9RA 2W63A 3S83A 2YLAA 1HX0A 1UA7A 2VI0A 4WVXA 4ERGA 4MB1A 2CEQA 4S3AA 4IIDA 1Y5XA 3QPEA 1ODZA 3WD1A 1VBUA 4GBDA 1SM9A 1P7TB 1VEMA 1A5SA 3ZOAA 1BG4A 3A12A 1M7OA 4RV8A 2A4AA 1AJ0A 3UJSA 2JIEA 4JCLA 4GGBA 4L6OA 5A6LA 3N18A 2RH9A 1LT8A 1KRBC 3IK4A 2EPKX 2ZZ7A 1YTKA 2HS6A 4L4PA 4PMYA 3EKGA 1JFXA 5ABTA 4ZSUA 4F9DA 4JY9A 4N0RA 4XAFA 2C16A 1JYXA 3WK1A 1KM1A 3K1GA 5LSMA 3P6LA 4REQB 3WJXA 1JJKA 3C61A 2XIOA 4HHHA 4XKMA 3FW6A 2OYLA 5D04C 3UG5A 3UETA 4GA8A 3UWEA 1Z41A 2VZUA 2C79A 4O8AA 4GQRA 3P67A 3QPZA 1XP3A 4JTAA 1J5TA 2ZICA 2CLEA 1OT2A 3LGEA 2C91A 4KWOA 1BGGA 1Y7VA 3W02A 3EMZA 4D9PA 1NP2A 1EDTA 2PODA 4P7LA 1ZQ5A 4GVFA 1H5YA 4WOQA 1K4HA 4R33A 4S3BA 4DIAA 2FZDA 1XQLA 2PDFA 3P8JA 2A7NA 2WMFA 3GFXA 4M29A 4Q8PA 1ZLPA 1TE1A 1CLXA 4PUJA 1S3TC 4JX6A 1O60A 1OYCA 3COTA 4IXHA 4Y9AA 2FYMA 4PB5A 1C7TA 1X6LA 1JRBA 2CCRA 3NPXA 3R8GA 1QPOA 2MNRA 4C7FA 3VD3A 4K3ZA 4Z1BA 4QJ4B 3SCOA 4DZAA 3P82A 1UWAA 1W1A1 3EB2A 1HJQA 5E1QA 4HIBA 5FEPA 1DWFM 2HS8A 1US3A 3W6MA 2Q01A 4CNUA 4ORMA 5DX7A 4NNBA 1QOXA 2WO5A 4PBFA 1UJQA 4Q33A 1BVZA 3VOCA 2OKOA 3BOLA 3IPWA 3MMTA 4W93A 3TVAA 2C15A 4I9MA 3BH4A 1Q45A 2XH4A 3N73A 5DCBA 1UZ1A 4IF2A 4NZFA 3GFYA 3SAZA 4EKJA 5M5DA 4CEXC 1HW6A 1KFBA 5K9CA 3UG4A 3MI3A 2ABBA 5DBUA 1GHSA 3TW7A 1A49A 3NQEA 2BY1A 4ICMA 2GWNA 2OSWA 3RAOA 1TJPA 1XH2A 3LZ5A 4LTSA 2NUXA 3ONBA 1UUQA 3EX4A 2H6RA 3K4DA 1SZRA 4C91A 5HQEA 2DZPA 2OYMA 4IISA 3LPPA 1XKJA 3TFXA 1JQVA 2JALA 3M0HA 1ZS2A 2C8NA 2XH7A 1UB3A 1IEWA 2E68A 2EGZA 1RALA 1YKWA 3WQGA 2GK1B 1I1XA 4TV5A 2RDWA 4Z17A 1NIUA 1X6UA 4TUFA 1K9EA 3L7RA 5EMYA 1FDZA 3UD6A 1QK0A 4LAMA 4MB4A 1LUCB 1W1TA 1VEOA 1TRDA 3VNDA 2MUCA 3CHCA 1RV8A 4I7WA 4A8RA 1ZAJA 1EFZA 4YTTA 3QEZA 4C1LA 1ZGDA 5A6JA 4C7DA 4JY8A 3KM8A 3APTA 4MKNA 4O28A 4TXEA 4RE0A 3QYQA 1IXOA 4TX8A 3P0WA 2YKKA 3UW6A 3CV2A 3CO8A 4JYEA 3W2KA 3TROA 4NIRA 3LUTA 4X2PA 3MKKA 2BODX 3WMCA 3GBDA 2ZRUA 4CN6A 1DJQA 2VQUA 4JHOA 4J5NA 5C55A 3GR8A 4DBDA 4MPQA 5FF7A 2A3EA 3MUAA 3N1AA 3WUFA 1F05A 2GUUA 4HPHA 1JF5A 5E6YA 1QMLA 3UF9A 2YYUA 2OU4A 1OYAA 1UZ4A 4AW7A 1HUVA 3QKZA 4LY4A 4A3QA 4DYJA 2VC9A 3ZR4A 1A47A 4Z1DA 5B7YA 1GHRA 3GHTA 3BZGA 4IQLA 2PDBA 1VJZA 2BXZA 1FWCC 1OB0A 4GJJA 1AH0A 1P6CA 5BROA 3VD4A 2PFHA 1R3WA 1PHWA 4GUHA 4PODA 3QM3A 3VOFA 1QNQA 3BXWA 4N42A 4E0CA 3WLSA 1DYSA 1VRDA 4RW5A 5AHNA 6XIMA 4PH6A 4MJZA 1EGZA 2DZXA 4MUPA 2QJHA 5DY3A 3ZVHB 5LYRA 2W27A 4DJDD 1CYGA 4MWAD 2GJXB 4K7VA 1NWUA 3EXTA 4H4IA 1L8NA 1F4HA 3O15A 4L1WA 2YDQA 1DXFA 4J3UA 1RD5A 2F6XA 3H21A 1SVDA 2R14A 3T4CA 1ISWA 3CUFA 3PJTA 5FEWA 1Y5VA 3APYA 2EG8A 1FCBA 3WEZA 2ZZ2A 1TR1A 2VDIA 4RZ6A 2X09A 4BI6A 2Z7KA 5AFDA 1LBLA 2WBGA 2JKEA 5DFAA 4XZ9A 1DHKA 1GKPA 2TPSA 1GZ1A 1UHVA 3LB0A 4ROPA 4HMDA 3AJXA 3LEPA 4PBEA 2PP3A 2E1DA 3OA5A 3AMGA 3F4CA 1G7VA 5XINA 4YTRA 1V3LA 1YPXA 7A3HA 3H55A 1WKFA 4WY0A 4EF8A 3R79A 3SY1A 1XLAA 3U5UA 4K36A 1EF2A 3DG7A 4QROA 3GM8A 2TAAA 3B8UA 3PG8A 5CJMA 2GJLA 4O15A 4ZB2A 3QQ1A 4XG1A 3UGRA 3L66A 3RX4A 1EC8A 1LQAA 4JHMA 3UYCA 1S5VA 1H11A 4GUJA 3BW2A 3MQTA 1I45A 2CZVA 1PIIA 1S5MA 3BO9A 4QQUA 3ZVIA 2KAUC 4GWEA 4A8LA 1PDYA 1XWYA 4WDXA 4IQDA 3MYPA 2IPGA 1J0HA 3K8MA 1HJVA 2Y8UA 3SY5A 3EDKA 5E9XA 3L0NA 2WVSA 3G1YA 3LNMA 1XG3A 3OGSA 3PUOA 1IF2A 3BC9A 4L61A 3G1VA 3GZ3A 5A6KA 2J7GA 2WVUA 1A0CA 2FZBA 4CKQA 1WKYA 3OBAA 3V75A 1TUFA 3OU8A 3THUA 1RJQA 2GSHA 3RG6A 2VX6A 1Q65A 2X1IA 4A3HA 4X61A 4Z1YA 3TSMA 1KC7A 2AKZA 4G6CA 1OFRA 4MJ2A 1VFSA 1ITUA 5EMUA 3QRHA 2XFYA 4C6FA 3U3HA 1TPDA 1BTMA 2QUMA 3AZRA 2Q8XA 1M68A 2WVVB 1UQYA 2AAMA 1H7RA 1KQZA 4LEQA 5HNRA 3AIWA 2PRHA 3BE7A 1D7FA 6CGTA 1Z7AA 1RP8A 4YVVA 2E1WA 3NO3A 2Y89A 3APGA 3CZGA 1SFLA 4W89A 1GOQA 4NASA 2GYIA 3B0YA 1RPKA 4Z2GA 3O6YX 1OFOA 4LF2A 4XZWA 2G4FA 4CU7A 1SZNA 1JPHA 3NG3A 4JS3A 5I02A 4LALA 4S3JA 2REQB 3VKKA 3LV5A 4OBTA 5DQPA 3VTRA 3TX9A 1K9DA 1OWQA 1JUBA 3QBUA 1AG1O 2CETA 4JQ3A 4GQGA 4WQ6A 4E4PA 4DI8A 3RPTA 3FKKA 1F6KA 2J7EA 2QCCA 1OX5A 3OQEA 4US5A 2ACRA 3CHVA 3CV7A 3WNOA 1XCXA 3VPLA 4ZOAA 1AQFA 3PWAA 4QE4A 3W1LA 2VFEA 2XSXA 4PYSA 4Y9MA 3OG2A 1QDSA 1CLKA 2Y4SA 2XVKA 5F1VA 2EPOA 1LF1A 1YX1A 4JICA 1JPDX 4IQEA 1R46A 1KM3A 1FWEC 2Y61A 4H9ZA 2O56A 2NZLA 3ARPA 3S2MA 4C6QA 4AIOA 2WWDA 2Z2BA 4GIYA 3B8SA 4C6CA 3VO0A 4HTBA 4XK2A 2GGJA 3VCRA 4OUEA 1G94A 4JTLA 4E2BA 1OD8A 1KGXA 3WSUA 5E0CA 4QEHA 5CJ5A 5E0KA 4I9JA 3GG0A 1JDFA 1POKA 3MANA 1RJPA 3Q37A 4M82A 1A3XA 1C29A 3ZXWA 5D32A 4XAYA 3LHWA 1UH4A 4EIVA 4Q7BA 4O12A 5IHSA 1K77A 3EOSA 3QOMA 4DAFA 2Y62A 3VC6A 4LF1A 1QTWA 1EGMA 2J78A 4S38A 4AU0A 3I68A 1W8SA 2W9MA 3OODA 4H83A 1X96A 3RIKA 4ERAA 1UOZA 4PTVA 5EFDA 5LIUX 1EQCA 2GSJA 3FJNA 4G2DA 4JYDA 3RM8A 2QQ6A 1LYXA 1XYBA 3G1HA 4FLRA 3PF3A 3TNOA 2DSKA 3TK7A 3MDUA 2J25A 4MVAA 3HF3A 4S3DA 2IS7A 3MUCA 3WNLA 4OWGA 1M1BA 5IBXA 3E12A 3MDWA 1S1PA 1LWJA 3CZLA 2QR6A 2YFOA 3IGHX 4KCTA 1V6XA 3P8IA 3V36A 2O9TA 3LRMA 4F4RA 4UNKA 2A6LA 3GU9A 3QV8A 1GOKA 4DZ5A 1G7UA 3QH2A 1PX3A 4HU3A 4IGMA 3DUGA 4E4UA 4C90A 4OBSA 3GK0A 3O8AA 4GC4A 4O1AA 4QM1A 3FHAA 3QZ6A 4TQTA 2EEXA 2ANUA 2CLLA 4OV9A 3NQ2A 1MQRA 3NZ1A 5BXSA 6TIMA 4KQNA 3AIRA 5H1WA 4J40A 4JIPA 2F9RA 3O6AA 1YMYA 4P7OA 3BLPX 5HDRA 1EJXC 1SJAA 2E40A 3KVLA 3C2EA 3L67A 4IUOA 1FCQA 3CHEA 4LFYA 1CXLA 1DKWA 3ARRA 4S23A 1TPH1 4HHMA 3XIMA 2ACQA 2PGRA 3R1ZA 3O16A 4IP5A 1O68A 1YDYA 1R86A 4L56A 4DN1A 2ZYFA 1UWSA 4QJ3B 1Z32X 2EG6A 3BMXA 3RNDA 5FKYA 5A94A 4JIIX 1EX1A 2O7SA 4PMXA 2PDMA 2WLZA 2HROA 4IOTA 4NU7A 4DJEA 1RD6A 4HPJA 2AMGA 2XZ7A 3O9NA 1B4EA 4HZ8A 1HKMA 5IXEA 3LCXA 3LCFA 3DFSA 1JPIA 3ELFA 1TV8A 1AW5A 3GVRA 4X0NA 4RE2A 3HJEA 2BB0A 5JH2A 4IIGA 4UFJA 1QJWA 2QJJA 2ZRYA 1TX2A 2J24A 1DV7A 4F8XA 3WJZA 1BAGA 4MY8A 3NAVA 3EEGA 2BFGA 4C5YA 3STEA 3B9NA 1GVOA 2VYOA 4DUWA 2OG9A 4WDWA 3K4WA 2BBFA 1NOFA 4TOQA 3VDHA 1E4LA 6ENLA 2IKHA 4FXFA 1X1NA 3SGUA 3N9SA 2Y5SA 4C6IA 1UWRA 4LRSA 2HVOA 3WLLA 2GFTA 3GAKA 1OD0A 3T9PA 1KXQA 4JDBA 3KE0A 3TC7A 3E0IA 4G7EB 3UT0A 5KMYA 1SZFA 3WEMA 4IM4A 3PJUA 1QHPA 1XIDA 3BSMA 3EXSA 4UMAA 2BS9A 4BQ5A 3UESA 5D2XA 2AGTA 3TMLA 1TE6A 2FTWA 4X3ZA 1CGWA 2ZRWA 2GVGA 4YTQA 1E40A 1Z8AA 3GDLA 2PURA 3CH0A 4A2RA 2GJNA 3G0XA 4HZMA 1W3JA 2I14A 5U7SA 3KTXA 5CGMA 4N02A 3TFCA 4HJWA 5FI8A 3QSTA 4DF1A 3VNLA 3PUDA 1JZ2A 3OB8A 4J9JA 3W87A 4EAYA 1J96A 3RILA 4JTKA 3BAWA 4B91A 3LENA 3W7HA 5LA1A 3CPRA 3UWQA 4AUBA 1XIFA 4FLQA 2NUYA 3W27A 4PUDA 1A5OC 4UFKA 4HU0A 3QSRA 1ALDA 5HMDA 3CB8A 1WQ5A 2QS8A 1XFBA 3MHUA 4LUTB 3PP7A 5KINA 3R7MA 1Y65A 2VC6A 4JTIA 4F66A 3G3MA 4I90A 5BMWA 1XYLA 4ZQMA 3S9IA 4ONVA 4L80A 4W88A 1GNXA 3VK5A 3ZS4A 3OZYA 3V1PA 4M6VA 2PBGA 4PA8A 3W00A 3G0UA 4QLKA 3KRUA 1HL9A 4W7UA 4S3KA 4L4MA 2PS2A 1JAEA 1PVNA 4TR9A 3IV3A 5KSWA 3OG3A 3ZJKA 2V3FA 3VD5A 3SN4A 4PBGA 1VAHA 1XLKA 1E72M 4YU1A 3VUPA 3IJLA 1WZMA 1ME7A 1EDGA 1XIEA 4IP7A 1REQA 3A3XA 4GFIA 1QBBA 1E71M 3OVGA 4LT9A 1QW7A 4GVIA 3NQVA 4JX5A 3M47A 1RHCA 2ZZ3A 1C8YA 1LWIA 4OBRA 3SIMA 2WZEA 3VKBA 1WE5A 2R82A 3EA2A 1DIEA 4GISA 1MYRA 2ONEA 3H12A 1AQ0A 1XUUA 4ACZA 1YHTA 2J8GA 4BQ2A 2V0TA 5HJLA 4AZGA 2C18A 2PE4A 3LU2A 1H4PA 4RK8A 3HJZA 1GGOA 2WHJA 1JCJA 1JGMA 2WYSA 4FALA 3CHDA 4YWIA 2FDMA 4UNLA 2X8RA 4IG2B 5TAOA 2C1GA 1PKLA 2NQZA 1LLZA 2GUBA 2DY3A 3U6WA 2VFIA 1Q66A 2ATSA 2YPIA 4ZOEA 3INPA 1CGVA 4H8HA 2O7QA 2WB5A 3GWQA 4L65A 2H8ZA 4LV4A 3KRZA 3LTSA 3A3WA 3PUEA 4LYKA 1GJUA 1O5QA 3AC0A 5CPLA 4DF0A 2Q02A 1O66A 2PSNA 2V2DA 3G8RA 5K4ZA 4I5XA 4C5ZA 1I2OA 1BWKA 1YQ2A 1U1HA 3DESA 3FSTA 2A79A 3SUUA 3G22A 2QIIA 2E0PA 4YVPA 3IGSA 4M51A 3ABRA 3VCNA 4K39A 2FHBA 2EO7A 3ZJ6A 3MTWA 1Q13A 2PWFA 5A1AA 1V7AA 1X1OA 3RO6A 3ISIX 3POCA 4E3VA 1ECQA 2CLFA 2ISWA 3N29A 3UG8A 3WUGA 2UY2A 1UKQA 4AEEA 4J3VA 1FWDC 3S5ZA 4RL3A 2OWXA 3KOFA 2PDQA 2HPMA 2GDVA 5BOFA 4GYPA 4NJGA 3TSBA 1VIWA 3EA1A 4ZVJA 4AZCB 5T9CE 2ESCA 3M44A 5FJPA 3C0SA 4DX3A 3MHFA 4RNIA 3RPDA 4IP4A 2VD9A 2FZ9A 3TQKA 4F0LA 4GBUA 4ZO6A 2O9OA 3LHUA 2IKIA 3S1GA 1FXPA 3N2TA 3B8WA 3RCYA 4YS1A 3WJSA 3SQMA 2VDHA 2W6RA 2PB1A 1UUOA 3OYXA 3PZMA 3VGFA 3LOTA 3S1UA 2QCGA 3WK2A 5LNUA 2QDDA 3RLGA 5E93A 4GX8A 2PF0A 4MF4A 3P5YA 4JEQA 4IMDA 5BOOA 2NSXA 3P3BA 3U2OA 1VFOA 3TQ0A 4IFOA 3USBA 2WKLA 2ADAA 1MRQA 4NAEA 4DWDA 3HGSA 2OPJA 2I5GA 1YDNA 3RPMA 1FKWA 4PRRA 1TTPA 5A8PA 3W75A 3MS8A 3PSVA 5DCDA 4CQ8A 3OLIA 1UMYA 1HKWA 2QYGA 2RFGA 1K02A 1W8GA 2XZ9A 1VJIA 2FFCA 2TSYA 4H8VA 1D7KA 1T40A 4QG6A 2X0HA 4URIA 1VLIA 1JPMA 4U3AA 1W3IA 1TUXA 5HWMA 2P3ZA 4J3WA 3GXMA 1R3TA 3IEBA 4Y7EA 5D9PA 4GCXA 5FEXA 1M7XA 1U33A 4DQWA 3GYCA 3A23A 4EF9A 4H00A 3QC0A 4GI6A 1MWOA 2PTZA 3SW6A 1GOOA 4DXKA 3W2UA 4MAZA 2R8WA 2A3LA 3NQGA 2ZX6A 4GXWA 3WH9A 2VOTA 3ITVA 1L6SA 3S6DA 3HG5A 3VVGA 3O3RA 1MMFA 1VEPA 3KW3A 3GY1A 2ZWZA 4XAZA 3VNJA 3I3DA 5DO8A 2QPXA 4M56A 4ZSTA 1MQQA 2Y5EA 3N4EA 2VR4A 4MDPA 4EPDC 3USZA 2ZA3A 3QZEA 4RJEA 3EOOA 3TOYA 1YTEA 2E5BA 4UTTC 2VM8A 4PUWA 4E2VA 4BJHA 4GXMA 3KEHA 2QZRA 4MG4A 2V5LA 4J2MA 1EL3A 5E5CA 1UP3A 4E4FA 4LS0A 2X2GA 3GTHA 1YNPA 4FP1A 3DOPA 3QV7A 4JTJA 7REQB 3FHQA 3IIVA 5A6SA 2X42A 2HPIA 4FMVA 3R0DA 3LRKA 3VC5A 5IFTA 3ARVA 3MSRA 4QAIA 1XLDA 3EWBX 5LHFA 4Z2LA 3WKZA 2F84A 2E8ZA 3BCDA 3HURA 3DFTA 3TAKA 2YCLB 1EA0A 3W85A 5KITA 5AYZA 3DFNA 3AROA 3PM6A 1VGAA 1S2AA 1F6YA 1PTAA 3FYYA 2DW6A 1F74A 3BV4A 4GMEA 3UWVA 1LBMA 2ZX8A 4OTKA 3R6IA 4ZXLA 5K9DA 2FJKA 3AHXA 3BGJA 1OIMA 1MUCA 5EPDA 4O19A 3JZUA 5HJYA 3M46A 1XINA 2VRKA 3BW3A 1K70A 4HA4A 4W7VA 4B5UA 2E77A 1W17A 3E2QA 3BG9A 3VIMA 3LLFA 1J11A 1N7KA 1PYMA 2WV8A 4IICA 1JQXA 4C6MA 3ARXA 4V27A 3OIXA 4O53A 4DJDA 1JZ5A 3TN4A 3NVTA 1TZ7A 4IPNB 3GDTA 4UUIA 4AZ6A 1LWHA 2HXUA 1BQCA 4PZVA 4B3KA 3NZQA 4IH3A 1LRTA 2DT1A 2Q3OA 2NX3A 2DIEA 2WPGA 3UXIA 1CX9A 2OLAA 2WNZA 3F2BA 1UG6A 2Z1KA 4PR4A 4P61A 3KUMA 3B8IA 1OFDA 4JIEA 4JR5A 3LCHA 3MP5A 4XSLA 1XBVA 3DYPA 3GLCA 1DJHA 3LMZA 1EA9C 4RKAA 3GDBA 4S2BA 5SWUA 4UTUA 3FDGA 3KOXA 1IWAA 3SRDA 1SFTA 3W74A 1QAPA 4KIEA 2WOQA 3N14A 3M0XA 5F1UA 4IL2A 1GORA 2ZQ0A 2C13A 1E43A 2CESA 2XWEA 4PUNA 4F2BA 2BVDA 4U31A 3ANUA 1C93A 3LXCA 2BHUA 2PU0A 3CYVA 3WDQA 1DQUA 4CU8A 1TKKA 4K1WA 2IPJA 4UTLA 2OWWA 1FXQA 2V82A 2D0GA 2P10A 2NX1A 3HG2A 4GFSA 5HWJA 2C1IA 3UJ2A 4QE1A 3W01A 4NKCA 4XBJA 4XZNX 4GKLA 1K7EA 4JX4A 3FS2A 5ABFA 3KRBA 2DDXA 4GI4A 2VZOA 1B1YA 4WF7A 4ZE4A 4QSHA 3DYOA 3U48A 5CBJA 3LERA 4C6KA 3DBNA 3OOQA 1FWTA 2D69A 5HBFA 3WZ0E 2WCSA 4B16A 4M5PA 3EWWA 2B7OA 4LBRA 4LU0A 1X1ZA 4CCZA 1QXLA 1L8PA 4WR3A 3URAA 1IT7A 4HCLA 3SFKA 2XG9A 1H1NA 1G4TA 3H54A 4B9YA 2RGLA 3LTYA 1CBGA 5AC4A 3BLLA 3WD4A 3I4KA 1KXHA 2PU1A 3GBEA 4AVOA 3GQYA 3FLUA 2OT0A 4PTWA 1XPYA 3KXQA 2E6FA 5EGRA 4EXAA 1QU4A 1GTEA 3KWXA 3C0QA 3EX1A 3W3OA 3NURA 3VOHA 4Q8VA 4ZODA 1JCYA 2YL6A 3KCLA 4EOUA 3SFWA 5M1TA 1JCNA 2YOCA 4JFSA 4ZQNA 1Y8BA 3GU2A 4KS0A 3W7LA 4DXXA 4MZ1A 1OCQA 2QAPA 2PMQA 1GVRA 2VUYA 1GVQA 3KS6A 2QW5A 1JYNA 1CGUA 2DH2A 3CMGA 4XD5A 1LRNA 5CBIA 1UR9A 3B3DA 1JIBA 1Q8JA 4HNTA 4A3RA 3VKJA 1GPWA 4FXJA 4XZIA 2D20A 2XSAA 3QPYA 2G8ZA 3WFZA 1BG9A 1WDWA 4FPSA 3SDOA 1S5WA 3T6CA 4J7RA 1KM2A 3EGJA 4ADUA 5J04A 4RE3A 5I09A 1GCYA 5A2AA 3H53A 2IPWA 2VCBA 4V33A 4TVCA 3K5XA 4GI8A 4M6PA 5A8QA 1GW9A 4CQCA 3THAA 3ABZA 1KRMA 4CUCA 5CC5A 4ZQRA 5G2HA 4UWMA 1R9XA 1FDYA 3TJLA 3EB3A 4K8HA 5CG7A 4ADSA 4QE5A 2OZ8A 1R0MA 1XLIA 4FOUA 1EDQA 3AMDA 4A4AA 2OFJA 3N6JA 1JCTA 3VGGA 4LUJA 1D2KA 3ZJ8A 3WBWA 2XFRA 4JXCA 3UXDA 4KEUA 1FBAA 5U4NA 3E2VA 3UXKA 4IX0A 1SU5A 1W3LA 5H8PA 2PTYA 1BKHA 4K8EA 4D6EA 1RR2A 3FGCB 3F2CA 5LNRA 3M5ZA 4JTRA 1RBAA 4HPXA 1EHAA 3G1DA 2YR1A 4FA3A 3RRAA 1TV4A 2RDUA 3FA3A 1B3VA 4IZGA 2YZRA 1WYIA 3DI1A 1J0KA 1PYFA 1HJSA 2QJNA 4UTJA 2NXHA 1W1ZA 2GLKA 2A3HA 2FVKA 1OCBA 1JCLA 1KM5A 3ZJ7A 3TR2A 1DL3A 1TA3B 2EBNA 3LQLA 3T09A 4CCDA 1OSEA 5HNTA 4WSHA 3CEPA 2PRLA 2PDLA 4E3TA 3VE9A 2HK1A 1P7TA 4O17A 3RLVA 4BWLC 3RK8A 2XIJA 5D4YA 4HYRA 3RX3A 4JQ1A 3Q67A 4MPKA 3E0VA 1BVWA 3GDMA 1E9IA 4O4VA 4LCRA 1ZY9A 1VCVA 3SCQA 2J9XA 4MGGA 1H49A 2W66A 3TYAA 1B0IA 1B3YA 3VABA 2ZDSA 1ONWA 4U33A 3GC4A 2AAAA 1MRAA 4ZA0A 2JGYA 1PTDA 1GWJA 3GB6A 5JUVA 3H26A 1H7XA 2FH8A 2UV8G 1PHQA 3C0LA 4OOZA 1HO1A 2CITA 4HD5A 3DECA 3I6RA 1Q5MA 4HMNA 4CQAA 3SO7A 3EWZA 2HQAA 1M7JA 3IUHA 5LGXA 4JPGA 2J62A 1UD4A 2ZE0A 1RY8A 5D03A 3NL5A 3VFLA 3SECA 1RUSA 3VE7A 1XISA 1YXCA 3CMFA 2ZVRA 4EX4A 3FSUA 3NSXA 2RHGA 2XTKA 3QLDA 2D2OA 3HFYA 1W1PA 3BL3A 2OOFA 2YCEA 4B5WA 2CXGA 2WJDA 3TONA 3MSDA 1LDCA 3EOLA 3W7CA 3H2AA 5HQMA 2HBVA 2G3FA 2ZUMA 1J01A 3P0XA 4C6NA 2PD9A 1W5QA 1OVDA 2BHYA 3H22A 1GJPA 4QISA 4FOJA 1BGAA 3TE9A 3W07A 4GO9A 4HTYA 1I2PA 3GUWA 1FWWA 1IYXA 1RQBA 2PTWA 1Z44A 4WX2A 3S5NA 1QUMA 5GVJA 3RU6A 2IXUA 2WC4A 3CT2A 1EF3A 3R0UA 4AF0A 1B4KA 3STPA 1E6NA 5CZJA 3R94A 3KS5A 4UTIA 4ALDA 5DBTA 1KNWA 3GH4A 4KW2A 5DLCA 4B5TA 4QIUA 3T07A 4QQ3A 1H5VA 3K8KA 3UZWA 4WSKA 2YL8A 1IEXA 5I3HA 4ZQOA 4J28A 3KP0A 3PPHA 2AQVA 2MANA 2OGJA 3S4TA 1KFEA 3T8QA 3HQNA 2QCDB 2VC7A 3MKVA 3B9DA 1C91A 1V51A 2UY4A 4QCFA 1MFVA 3DC0A 3SZ8A 5F2GA 2CLOA 1KM0A 4S39A 2J7BA 5AZ1A 5L6UA 4MAVA 1BXNA 4TMBA 3NM3A 2G3IA 2BY0A 2CU0A 1FOBA 5C8BB 1YDVA 3UVIA 1MZRA 2ZX5A 1WX0A 5CSRA 1J5SA 4U5KA 3FOKA 2DPEA 3WD0A 1W56A 1EOMA 2GK1A 1LT7A 2PUZA 2A3BA 3JVAA 3AISA 1P5BA 2NUWA 4NZ1A 1XH0A 1JI2A 1HZYA 3EMCA 4H9YA 1G69A 5H6HA 1N8IA 3BICA 1XCFA 1JDEA 1VBRA 1LUCA 1W9DM 3KOWA 2X7WA 1WZAA 4KGJA 1R3VA 4GRSA 4HGXA 3S3GA 4C6OA 1J0IA 2V5JA 3PBVA 3MC5A 4RZ4A 5FSEC 1VD6A 3MYOA 5MHBA 4HVXA 3IK2A 4LBSA 3L2IA 3QY8A 2O9PA 1W9VA 3ALGA 2B31A 3LNPA 1TVLA 4EVZA 3L68A 1V77A 1UKOA 2G95A 3KFTA 2VP8A 2WWCA 4Y8EA 2WC7A 5XIMA 3WLTA 3RJXA 1XYMA 1GONA 3P61A 2AL2B 3PJXA 3QR0A 4MSSA 3WUBA 2E9MA 1Q7MA 2WJFA 3MUXA 2BOGX 4EPKA 3O0FA 1ZZMA 3M0IA 2XHYA 4O50A 1NP0A 4FNUA 3BMWA 1VLWA 2R1PA 3R8HA 3KOZA 4N6EA 2NXIA 1PKMA 1E0UA 3B0VC 3ZT7A 3M1ZA 5AY7A 2ALRA 5CC6A 1HF6A 3ZYZA 3UZ5A 1UP0A 3U2EA 4GUGA 3T0BA 4RNJA 5I03A 4NJJA 1P0NA 3MWAA 4J3TA 3WLHA 1DIKA 1RA5A 4X9YA 4HNNA 3W6LA 3H2EA 1LTDA 4AD5A 5LHEA 4GVGA 1PXGA 3AIBA 2V2HA 3MZ2A 4L6HA 1D3HA 2GQ8A 3WQOA 3VIIA 1EJUC 2FPTA 4L9ZA 1T41A 1JD7A 2CLHA 3ZVHA 1TPB1 1G4SA 1F3XA 3BG3A 3MO7A 5A3HA 1XL9A 2VZVA 5KTLA 1R8LA 2GJXA 4ZE5A 1PZ1A 1EPXA 2C0HA 4PTMA 3T08A 1EJWC 2XN0A 4JKLA 1UMLA 4CQBA 4NXKA 1IT0A 4CD6A 2FZ8A 2WZHA 3QTGA 4PCPA 1X6NA 4NJIA 2ZXDA 1V02E 1B2YA 5AHEA 4PMJA 1Q6LA 2OSYA 2FLIA 4BF5A 1VFLA 3WF3A 5H2ZA 4FIQA 4H6QA 1ME9A 3EOUA 4NHVA 3CTTA 4R9OA 3ARUA 3B03A 2RGMA 4L9YA 1LOLA 1I9CB 3FIGA 1ITXA 5IM51 3HPAA 3WQCA 1H7OA 1ZCCA 4KWSA 1VENA 2W5FA 3AS3A 4GYKA 4C65A 1RVKA 4ENLA 1H51A 4DWSD 3TYBA 3AMLA 4EXQA 3TLQA 1HP4A 4S3EA 3KVKA 3NL6A 1X7IA 4GVHA 4HK5A 3WQ6A 1HL8A 2YW4A 1EBGA 4LPCA 4WSJA 2CZEA 3NSNA 1JEZA 4NILA 3W1QA 3THDA 3THCA 3QMSA 1QVBA 3UCCA 2ZKMX 3HM7A 3SUTA 1FP8A 1W5OA 3IUDA 3JU2A 4HNOA 3MV11 5H91A 4O0ZA 3VDBA 3A6OA 3VOJA 1KBLA 1TSIA 4N2YA 2XN2A 2ZUVA 4R7JA 4DLMA 3BVJA 4GK8A 3AXIA 5CC7A 4A05A 4JTTA 4LGXA 4BY3A 3NGJA 1VH7A 3A21A 3GNPA 2FQIA 4QGCA 4MDOA 3WG6A 3W7IA 4DM2A 3VGHA 2HE5A 4J27A 3WD3A 3AIEA 3QF0A 3WX7A 5AHLA 1PSCA 5J5DA 4R88A 1FDJA 3AI0A 5FSDC 2FTPA 3KTCA 4CD5A 3R11A 3E9AA 1OM0A 1C8VA 4AWTA 2HV5A 4G5DA 3MA8A 4LYPA 3U57A 4M80A 4MWAE 3M07A 2PDGA 1EIBA 3QGVA 3P7YA 3F4WA 5I5RA 3K1DA 3WLQA 3VIFA 4TTGA 4BEUA 1TTIA 5F2MA 3KRSA 2D73A 3MBFA 1BXCA 4KF1A 4YTUA 1WDDA 3J7HA 1FWGC 3DYMA 2NX9A 4AB4A 4JD4A 3R43A 4D6JA 3MMUA 4LVBA 1SO5A 5LZLA 2REQA 3NQFA 3DG3A 2GVYA 2X1RA 3VNKA 1UOKA 1MEIA 2DV0A 3CUIA 4O16A 1ZJHA 1R7OA 5HJXA 1EXPA 3QOKA 1TB3A 3UR8A 4HK7A 3PUGA 3ZM8A 2VCAA 2VTFA 4U5IA 2POZA 2JFEX 1V4YA 4JFWA 4UMCA 3II1A 3C5QA 1H1YA 1RVGA 4UTWC 1ITQA 1W5NA 4XV0A 4LVGA 4MB3A 2PDYA 3ARWA 3R8RA 3D5HA 3GIYA 2QCFA 5CCZA 1UKPA 4NUWA 3ITXA 5EU9A 2E67A 2VOMA 1XLCA 2POTA 4JTQA 4OUIA 1J4EA 5I0DA 2E6YA 3UVAA 4NI8A 4NZCA 1GYMA 2OEMA 4JZ5A 1V93A 4UOZA 2NQJA 4PL2A 3GTNA 3KX6A 4F0HA 4GNKB 2J7DA 4JOMA 2VRJA 1PEZA 3O1NA 4LV9A 4XKYA 5HPCA 2OQYA 4FK9A 2CPUA 1R9YA 3CHFA 2FIQA 1IXQA 1R85A 3WNPA 1FCUA 3VFCA 4MNLA 4DXVA 2IXVA 1M7PA 3NO5A 3SGGA 3LBMA 2H90A 3H4XA 4B4HA 4OECA 4MYXA 4LUIA 5AC8A 3QMTA 3MP4A 4QITA 3GZAA 1UWTA 2CWXA 3GSMA 2ZVIA 1WV2A 4FNPA 3ITTA 1F3WA 2W79A 4GC3A 4PEKA 1MZHA 3BUVA 4I9AA 5B7ZA 2YGYA 3QKEA 4AISA 2Z1SA 2DH3A 3CAWA 1XLFA 2P53A 1DORA 3C86A 1LJYA 4H6EA 2G4JA 3SB0A 3WY1A 5T9BG 3MV01 4AWEA 4LAKA 3PZVA 1J0ZA 1VFTA 4PMVA 4D72A 4MTVA 3TTYA 3W25A 4AY7A 3GX9A 4GYPC 2VD8A 3L4VA 4X2RA 1BPLB 4ML4A 2J7CA 3CJPA 4DUXA 4WKFA