1XGZA

Structure of the n298s variant of human pancreatic alpha-amylase
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDSHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and mechanistic studies of chloride induced activation of human pancreatic alpha-amylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Alpha-amylase, pancreatic
total genus 174
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xgzA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xgzA01
1UWTA 4LXFA 4WJXA 1FP8A 4AY1A 4OUEA 3W82A 1MXGA 1XRVA 2F1AA 3ZJ7A 1BTCA 5M17A 4W93A 2F8QA 2W4XA 1KB3A 4EAMA 1UUQA 2CBVA 2YA0A 4W5UA 1E6SM 1JYVA 2AAAA 5AY7A 4OKDA 3L4VA 1LL4A 4WIWA 2WZEA 4H7VA 4W8BA 3VDBA 1QWUA 1HXKA 1J01A 3BAWA 1R86A 1ISZA 1M7XA 3CUFA 2XVGA 2DSVA 1VRXA 3QR3A 3GDBA 2D1ZA 1T0OA 4GI6A 1DWFM 3WD4A 4AD3A 3WQWA 3VD5A 3UR7A 2J8GA 1BVZA 3CO4A 3K46A 4M1RA 4ACYA 1UD2A 3W53A 3AJ7A 5BRQA 3SCRA 3BLBA 4D1IA 1XGZA 2E9BA 1HKKA 2WB5A 5CPSA 3D51A 4PTXA 1UWSA 2DGAA 1E72M 3WQ6A 4W8LA 2D3LA 1GW1A 4DWSC 1E40A 1UHVA 3VMOA 1ODUA 1OGBA 1EIBA 4ZENA 5E6YA 1KQYA 2E9LA 2FDMA 1P6WA 2BHUA 3LPOA 2CPUA 1H0IA 1DWIM 2A3AA 2XSAA 4FF5A 2J7BA 1UQZA 3CHCA 2GJXB 2PBGA 4PMUA 2VOTA 2JF7A 4X9YA 3HG4A 5A6BD 4AZIA 1LWHA 2J74A 2PBOA 2VZTA 2FGZA 1UH3A 3D4ZA 1JD9A 1VEMA 2WPGA 3VGDA 1MXDA 3L4WA 3EJQA 3WMSA 5BWFA 2J75A 1E55A 1OWQA 1X1NA 4RE2A 3M7SA 3MI6A 2XGIA 3ECQA 3WDJA 3N11A 4Y7EA 1A47A 2ZWZA 2VMFA 2CBJA 4LGXA 3CUIA 1EQPA 1PX3A 3ARZA 4UOQA 3ZR6A 1LLOA 4AZCB 3SUSA 1GOMA 4D1JA 3LXBA 2J78A 2PWGA 3SEPA 1DEDA 6CGTA 3WEZA 2UY3A 3CZ8A 1MYRA 1C7TA 4URIA 5I79A 5I2UA 1AMYA 2X2JA 1QNRA 2XVKA 1VB9A 2VZUA 1ZJBA 1G1YA 2D20A 5F7UA 1HNYA 1DWHM 2X09A 4DO6A 2DSWA 3WH8A 2Y24A 4JIEA 4U5KA 1E6QM 2JEPA 2EPNA 3GXDA 3E1F1 3ARTA 2GUYA 4PMRA 5BXSA 4E8DA 2BVDA 5CLTA 5JBEA 4M81A 4CD5A 4PEEA 4WKAA 3T2OA 3DYMA 4QFUA 1JF5A 4KGLA 1H41A 1XD1A 2C0HA 4HPGA 4OBSA 4AD2A 1BSIA 1KXHA 1TQVA 1V0KA 4MDOA 1CXFA 2WSKA 1KR1A 3DHPA 4FNRA 1UR8A 1JFXA 1MFVA 3U5YA 1W1TA 2V3FA 3TV8A 1MQPA 1X6LA 2J7FA 1WPCA 1GQLA 4TUFA 5EMYA 3L4TA 4NX0A 2JF6A 3U57A 3VTRA 5I77A 4N0RA 5A8MA 3WELA 1AQMA 4FLSA 4IUGA 1B3ZA 2BY0A 3RM9A 5HPOA 3SUWA 1BFNA 3HG2A 1GORA 1QW8A 4A3YA 3GM8A 5A8QA 3ARYA 3WQ8A 2WHLA 3WDHA 4H8VA 3UG5A 5A6BA 3WENA 1WZAA 3AISA 5CZKA 1C8YA 4MB1A 2EABA 2WBKA 2BVTA 1MW0A 1QPKA 1FA2A 3ARPA 1O7AA 4WK9A 1OM0A 4GZJA 1IZJA 3T08A 2JFEX 6TAAA 2OW6A 1OGGA 2DT1A 3WQVA 4XUYA 1E6RA 2A3EA 3N13A 1GOQA 3T0AA 1CYGA 3KZSA 3WIJA 4ATWA 3RPMA 3FY1A 1W9DM 2UY2A 3QHMA 2WC4A 2HVMA 4X0VA 5D9PA 4WSJA 4KMQA 2WZIA 4JKKA 1TMQA 4HP5A 1RPKA 1J10A 2FYVA 2QHAA 3L4YA 3TTYA 4NRRA 2ZIDA 1JD7A 2F7QA 2WHKA 1UKPA 4WF7A 3T0BA 1HJXA 1CGWA 2GJRA 2Y8KA 3ZSSA 3PZ9A 3CMGA 4JCLA 2O9PA 4RE3A 3IJ7A 2CIPA 3F4VA 3MSDA 5E70A 2G3MA 1PZ2A 1B9ZA 2O9TA 4IPLA 4HU8A 1ZBKA 3T2QA 2MANA 1XCWA 3VIIA 5HOSA 1ISWA 4RE4A 3WFZA 1E43A 1R7OA 1C91A 5FL1A 3MKKA 1ZL1A 1E4IA 3THCA 4D71A 3LPPA 1C8QA 3SIMA 1VFOA 1JZ3A 3M6DA 1UR1A 1UASA 1JNDA 4HMCA 2F7RA 3AIEA 1C93A 4D6HA 1UD3A 2CESA 3VMPA 2Y2WA 1KGUA 4C7DA 5BXPA 1PZ3A 1H49A 3GNOA 1UH2A 1JNEA 1UWUA 4CU8A 1V0LA 1H3GA 4U3CA 4DWSD 1W3JA 3WUBA 1ZS2A 3VU2A 4DM2A 3RM8A 4AZ7A 2QF8A 3VM7A 1CGYA 3O6AA 3WDIA 1V0MA 3KWXA 4H41A 1SFSA 2CETA 3N15A 1HJQA 3SCOA 2X2HA 2WXDM 1R75A 1WZLA 2W66A 2V3EA 2OYMA 1UD8A 1VJZA 4P7QA 5ECUA 1KWGA 4AIOA 4IPNB 2VUYA 4PSPA 3EDJA 2WCSA 2DSZA 1JIBA 2GFTA 4CCCA 1SZNA 2E3ZA 2DSKA 3NIYA 2JIEA 2DEPA 3CH9A 2W61A 1WP6A 3A24A 1N82A 5BXRA 4U31A 2ZX5A 1HJWA 1UWQA 1QNSA 5FL0A 3WD2A 5I23A 4QLJA 4Q22A 3W26A 2YOCA 2G3IA 2W91A 4PMOA 3B9AA 4AXNA 5BXTA 1AVAA 2X8RA 4ACZA 3OZPA 3MUIA 1JDDA 5D9MA 3KEHA 4B16A 5JUVA 3SCQA 1NARA 3EJUA 2W92A 1SYTA 4R5EA 1ESWA 5D9NA 3ARRA 1EHAA 3F5KA 1JFHA 2VX7A 3EDKA 1R33A 3K8MA 5D9OA 2VL4A 2CBIA 2UWFA 3AZTA 4TVDA 1D7FA 3KL0A 3AZRA 1M03A 5DEZA 1FHDA 3AROA 3WUGA 1XV8A 1V02E 3D5HA 3IGUA 1V08A 3EMCA 5DT7A 7CGTA 3MMUA 3LX9A 1HN1A 5DO8A 3D3AA 1ZBCA 4ZFMA 4C7FA 3A47A 4QAWA 4EE9A 5LA0A 3ZT7A 1SMAA 3NSNA 5A6AA 4W85A 2BHYA 3VIJA 1GJUA 4HPHA 3PZGA 1ITXA 1HWWA 3I3BA 3M46A 2WMKA 4CD8A 3VD9A 4PRWA 3EJRA 1PAMA 3HN3A 5E0CA 3KLLA 2GDVA 1JZ4A 2ZUUA 3N1AA 2J62A 1XSKA 3LXCA 5GNXA 2JE8A 4H8UA 2FE0A 1KGXA 3MS8A 5I6SA 1HL9A 5BROA 1QOXA 3CGTA 1XH1A 1Q6FA 3W6LA 4JKLA 1LJYA 5IDIA 1OCQA 1TVNA 3WF3A 3J7HA 3WDRA 3WF4A 3TTOA 5I5RA 1F4HA 2PWFA 3WF0A 2X2YA 1KR0A 3CMJA 1JDCA 2WYSA 3CHFA 2YL8A 2EPOA 2GJXA 4FK9A 1CTNA 2EJ1A 3EDDA 3TOPA 1ECEA 3BVXA 1J12A 1JDAA 1W9UA 3G6LA 4MAVA 1PEZA 3PZUA 2OYLA 1PBGA 4HA1A 3N9KA 1HVQA 2FHFA 1L0PA 2YLLA 3WNNA 1HT6A 3AMGA 4MJ2A 1KBBA 2NT1A 3A3HA 1E15A 3WNPA 3DX4A 1A3HA 2O9OA 3AIWA 5FKYA 1D2KA 4M56A 3AMKA 5GQBA 1E1EA 4CN1A 2Z1KA 3AMDA 3TA9A 1B2YA 2C8NA 2E8YA 3VDHA 3APGA 1NP2A 4MNKA 1FOBA 3DDGA 1HP5A 1E5JA 2WHMA 1CLXA 2G8ZA 3AXXA 4QP0A 1G9HA 3I3EA 2ZUVA 5A6MA 1Q6DA 1E3ZA 1XYFA 2WVTA 3OB8A 1BGGA 2ZUMA 2G4FA 2BNJA 3NYDA 3SCUA 2XVLA 3PTMA 1AQ0A 3AS2A 2WBGA 2G3JA 1MW1A 1R87A 1S46A 2X0HA 4JZ5A 3WMCA 3LPFA 3L4ZA 1B1YA 3IAPA 3BAIA 2QV4A 3DX0A 1C3FA 5EFFA 4P7NA 1JI2A 5HNNA 4DO5A 5A95A 2VX4A 3VIGA 3T2PA 1UYQA 4KRTA 4AMCA 3UETA 2BHZA 4UQCA 2VCCA 2ZX9A 4PTMA 1CPUA 1PX4A 4LQ1A 5GNZA 4AZGA 3PZTA 2VX5A 3D50A 1HKMA 4M24A 1E0XA 1FFRA 4M29A 1WAWA 1Y7VA 3FAXA 1WO2A 2BVYA 3DX2A 4B9YA 5EBAA 3AYSA 1GVIA 3CUHA 3FXYA 3WQ4A 2F1BA 1W1VA 1E5NA 2V38A 1BYBA 3NSXA 4PUEA 3IK2A 4LPCA 3ZJ8A 1CXKA 1V6YA 1KFWA 4OJYA 2DDXA 3WH9A 3BCDA 3AIUA 3VIPA 4CVWA 3HZ3A 1W32A 5E6ZA 1BAGA 1GONA 1UQYA 3PZNA 3BSHA 4UOJA 1H0GA 2OLHA 3BMVA 1XHGA 5LYRA 4UQAA 4QLLA 5KEZA 2VI0A 2D23A 2E40A 3VGBA 2ZXDA 2EEXA 1ISXA 4MJ4A 1M53A 1W2VA 1JXJA 2VVSA 3AHTA 5CQ1A 1V6VA 4AISA 2GK1B 4KGJA 4P7OA 4L4PA 4AD1A 5ABFB 4MTVA 4B3KA 5JIPA 4UFMA 2BS9A 2WK2A 2VZSA 1V3KA 3ZM8A 1Q6CA 1F4AA 3SURA 1J0YA 2XVNA 2DIJA 2OW7A 1QBBA 4QLKA 2ZXQA 1ZJAA 2WWCA 4DWSB 2J7GA 1VBRA 3S5ZA 1GOWA 1K9DA 1GVYA 4NF7A 3GZAA 3M07A 1FHLA 3K8KA 1HVXA 3DHUA 1V02A 2YL9A 2VR4A 4TOQA 1EOMA 3MANA 1V6WA 3F5LA 3OBAA 2OSXA 2UY4A 4B15A 2XHYA 2DSUA 5CJ5A 2DT0A 3W38A 2WNWA 4GI9A 1J0KA 2YL6A 1V3LA 1CENA 2F7PA 3GNRA 4WSKA 1H2JA 4GPNA 4OBRA 2NT0A 4UTFA 1R8LA 3WUFA 3GXMA 1UZ4A 1C92A 2XSBA 3EMZA 4U2YA 1GPFA 4UZUA 4P8VA 1MW3A 3UR8A 3BUPA 4AMXA 2XJ7A 3AIVA 1MW2A 4PMNA 2ZX7A 4W84A 4WKHA 4FLOA 3PHAA 1LWJA 5D4YA 4AD4A 1WNOA 1VJSA 4BA0A 1Z32X 3GNPA 2WVUA 2WZHA 4AIEA 2GJPA 1UH4A 4CN6A 3N17A 2VZVA 3ARWA 4ZE5A 3QHOA 4J3XA 3DYOA 3AHVA 1OB0A 3GXIA 1NQ6A 2EXOA 3WDQA 5I24A 1JYWA 4TVCA 1J18A 4FNPA 4YPJA 3AIBA 3CZJA 5DMYA 4D72A 1R47A 5A2CA 1JZ7A 1Q6EA 2V3GA 4UQ9A 3U7VA 4W88A 1GOOA 2BY2A 3BLPX 2PF0A 2JEQA 1V6XA 1W9VA 2WVVB 3THDA 2EPLX 2ZXBA 1ZBWA 3SCTA 2EO7A 2CYGA 1O7DC 1B3YA 1OT1A 4V28A 2D24A 4ML4A 3FNDA 1WZKA 2YJQA 3ZOAA 2CITA 1CXEA 3VO0A 3VIMA 1VBUA 4UFIA 5HDRA 3MMDA 4XV0A 1PJ9A 3BVTA 4AZHA 3WUEA 2EPKX 4U33A 4CVUA 1XCXA 2ZX8A 4X0NA 3QOKA 3W6MA 1ZBVA 1JGIA 2WLYA 2WMHA 3BAKA 1CXIA 4P8UA 2YFOA 3SUVA 3ARUA 1XSJA 4N42A 1QNQA 5IHRA 2OWCA 2D2OA 2XTKA 1WB0A 1W1YA 2EACA 4FLQA 3BUDA 3H53A 2XWEA 2F18A 3IJ9A 3CZKA 1EHNA 3WF1A 3WY4A 2VNCA 1K9EA 4UFJA 1GNXA 4GINA 1KWKA 4UZSA 2BY1A 4KH2A 2DT2A 3AICA 4MDPA 4PMYA 2ZX6A 5AYBA 1E4LA 3WMBA 1G01A 4P8XA 2YDRA 3KE0A 1UR9A 1TQWA 3VDAA 1LL7A 5CPTA 1UA3A 1J0ZA 1FH7A 3LPGA 3MV01 3AIQA 1J11A 5I3DA 1W2PA 3GH5A 5HBFA 4CD7A 2BXZA 1WDRA 2YL5A 1JZ5A 2QMKA 2UY5A 1JZ8A 3VVGA 4C7GA 1C8XA 3WH7A 1GZJA 2VZOA 1G5AA 1BQCA 3FN9A 2ZUNA 4NZFA 4HMEA 4NSBA 1W91A 3K8LA 1V0NA 1TCMA 4JFTA 3CLWA 1J0IA 2OYKA 2ALWA 4HOWA 3CZGA 1XYZA 4JFWA 3SCPA 4EK7A 3MMWA 4OZOA 1B31A 4W87A 1B3WA 1OINA 2VQTA 1HXJA 1B90A 4GQQA 2C7FA 1I1WA 1NH6A 3OGRA 3VIKA 3OLGA 1GCYA 3W28A 1H5VA 4HU0A 3FHQA 3U7BA 4BCEA 1D3CA 3BAJA 5A8PA 3BXWA 2X1IA 4CU7A 1EO5A 1QHZA 2DH2A 2OSWA 3BLKA 3LRKA 2J47A 3VSTA 4J3VA 3CC1A 1UD4A 2WWDA 5CG0A 2XUCA 4F66A 2GDUA 1NP0A 3DECA 1ZU8A 2YA2A 1KXTA 8CGTA 2XFRA 5A3HA 3VUPA 4JL1A 3WF2A 1HJUA 4W8AA 2CBUA 1R46A 1QHPA 3SCSA 2ZICA 3DDFA 2YA1A 1CGXA 1PIGA 2DH3A 2YDSA 5ABEA 5JIWA 1WZMA 1W9PA 3ZIZA 4AWEA 1OIFA 4F9JA 1EGZA 1XC6A 3ALFA 5DF0A 3A22A 4PCTA 2VJXA 1EO7A 4JFUA 1EDTA 4BQ4A 5C71A 2FGLA 2WMFA 3VOCA 1UWRA 4UFHA 2YBUA 3A5VA 1J9YA 4JFVA 4MADA 3GBEA 1UWIA 2WMGA 3CV5A 1KCKA 2QMJA 3W27A 4CD4A 3N12A 4D6FA 4AD5A 3BAYA 4GZIA 3VSVA 4KRUA 4KWUA 1QNOA 4M80A 3BUBA 4F9DA 3EJTA 3OA5A 4OIFA 2VRQA 4XB3A 2G3NA 1CWYA 5LA2A 2W5FA 4J27A 4U5IA 3LRLA 3O2LA 2J25A 3VIOA 2O9RA 3VD7A 3PTQA 5M5DA 1L8NA 2W63A 3WY2A 2F7OA 4J3WA 5HXMA 1OT2A 1E0WA 3U5UA 2JIWA 1HKIA 3CTTA 4GO9A 2FHCA 1WE5A 1B3VA 1CDGA 5I78A 4IM4A 1DHKA 1SR0A 2YKKA 4Z2IA 3S2CA 1HJSA 4W5ZA 3HG3A 1E6XM 3KL3A 1OD8A 1KCLA 1B30A 2WW5A 3BMWA 2VO5A 2WSPA 1TZ7A 2XG9A 2X05A 3WH5A 5CXPA 1V3HA 4LYPA 3WNKA 4RL3A 2WMIB 4GKLA 4M8UA 4GQRA 4MNLA 5JBFA 5CSYA 1GQKA 3PZVA 1K6AA 5A6SA 4W89A 5IXEA 3BUIA 3BC9A 3B8SA 3TTQA 4EKJA 1LL6A 2CERA 4PBGA 3W29A 3W4RA 1HKJA 4MB4A 4UQDA 3WY1A 2W62A 4ZE4A 4PMQA 3TONA 2IGTA 2VRKA 3QGVA 4JL2A 3FHAA 3OLEA 3BVUA 1MQRA 1JXKA 2XM2A 3MUAA 2EQDA 4NRSA 3WSUA 4D6IA 2VX6A 4Q7NA 3MSGA 1QI5A 3VMNA 2J7HA 3UG4A 2RGLA 2Y4SA 4J3TA 4HOXA 5BCAA 1TVPA 1VFFA 4TTGA 3AHXA 2D22A 2YDQA 2E4TA 1GHRA 3CZLA 2J7EA 5C8BB 1UKOA 4Z2HA 1QX1A 1W3KA 4AEFA 1NOFA 1BYCA 1VENA 1BHGA 4JKMA 2WCAA 3LMYA 4F8XA 4CCEA 4HOZA 1XSIA 3AQUA 3OLIA 4W86A 4AD0A 1QNPA 3MUZ1 4AIUA 1OSEA 3LRMA 4EANA 1RP9A 2PWDA 1Q6GA 3A23A 2WVVA 5A8OA 1GQJA 3OGVA 3D52A 5HPCA 3B9EA 3DYPA 5CSUA 3VD4A 1UR4A 3EMQA 2D73A 4UR9A 3GXNA 3VIHA 3CHDA 1E6NA 4JAWA 3ZR5A 1DWJM 2A3HA 1MFUA 1CLVA 4OOUA 1TUXA 3WY3A 2XPKA 1KXVA 2YIHA 3CZNA 1K9FA 1E4MM 4PSRA 2V5CA 1BYAA 1ISVA 1E1FA 1YHTA 1US2A 1WDSA 2D0HA 5FIPA 3CUJA 3WQ5A 3KL5A 4B3LA 3AXHA 2VT0A 2XN1A 1W3HA 4HZ7A 5IFTA 1DWAM 4JCMA 2VCBA 3A4AA 5CGMA 1R85A 4JFSA 1V3JA 3WNOA 4ZXOA 1W3LA 3SCNA 4HA3A 1PIFA 2Q8XA 4LYRA 4HZ8A 4V2XA 2XFYA 4V27A 1B0IA 1E6ZA 2VQUA 5I0DA 3RM4A 2EPMX 3A21A 3AHYA 4UNIA 2NW0A 4ATLA 4XZWA 1JAEA 2WANA 2XGBA 4AC1X 5FOOA 4PCSA 2XN2A 1G94A 5CGTA 5ABFA 1QBAA 1CIUA 3WEOA 3WNLA 4W7VA 3BVWA 2A3CA 4HA4A 4NXKA 3UEQA 2ZUSA 3AFBA 3QOMA 1M01A 3ARVA 2WMJA 1WDQA 4DUXA 5E9AA 1NWTA 2VTFA 1E3XA 4DWSA 2WM0A 3TTSA 4ZXLA 3KLKA 1M04A 1O6IA 4BF7A 1I1XA 3EJPA 1FH8A 1US3A 1GJWA 3L4UA 1MQQA 1CEOA 4FMVA 1NOUA 1V6UA 4QCEA 1EXPA 2Z1SA 4AZ5A 3UERA 1LQ0A 1J0JA 1HL8A 3AS3A 4PYSA 4P7LA 3BSGA 5KZ6A 3HU7A 5C70A 1GOKA 4PN2A 4UQBA 1KTCA 2WMIA 1E0VA 3VNZA 2E9MA 5A69A 4UFKA 4AEEA 2GVYA 1CECA 7A3HA 1W1PA 1GHSA 1V3MA 1WDPA 3ZMRA 3RJYA 4D6EA 2ZXAA 4ZEPA 3ARXA 1TA3B 2EAEA 1IZKA 4W7UA 5FCZA 4BQ2A 1UA7A 3VNYA 3HG5A 4AYSA 7TAAA 1EOKA 1BG9A 3EDEA 3VGFA 3WN6A 3F5JA 3OLDA 2YFNA 1QI2A 5AYIA 1JAKA 3WDPP 3AHZA 3NDYA 5IHSA 3MU7A 4ACZB 1TR1A 4BZYA 4UFLA 1XD0A 3AS0A 1UZ1A 4A4AA 2Y5EA 3UG3A 2WCGA 4YHGA 4BQ5A 1J0HA 5A94A 1E6PA 1OBAA 2V5DA 5E09A 3ZQ9A 2VCAA 1KQZA 4HZ6A 2QLYA 2XM1A 4AMWA 4Z2LA 4WLCA 2BV9A 2WVSA 3S5YA 2AMGA 3WBEA 2GSJA 4BS0A 3G6MA 3EBVA 3EYPA 3IAQA 1CGTA 3JUGA 4Z2JA 3SUUA 2NSXA 2IXVA 1MWOA 4R27A 1FH9A 1QVBA 3ZT6A 2J4GA 4AZCA 3II1A 2Y8VA 3VIFA 4J3UA 1JZ2A 1AQHA 1BGAA 1E4NA 4CN4A 4XZBA 1UKSA 2ESCA 4CCDA 1PX8A 1HIZA 1E71M 2WKGA 3VX1A 3RMEA 1XH2A 3NUKA 4E4PA 3AIRA 1CGVA 4Z2GA 4PMZA 1UR0A 3DX3A 1EA9C 1RD6A 2O92A 2XN0A 4J7RA 1IT0A 1UD5A 3HJEA 3MUY1 1UR2A 4FNTA 2CXGA 4MB5A 3VPLA 4D6DA 1JL8A 2J8FA 3VM5A 3UCQA 4J3SA 4TX8A 4K68A 4JHOA 1DP0A 2CKSA 4TTUA 2VVNA 4GIAA 1W9XA 3AXIA 3MO4A 1VEPA 3WD1A 1KGWA 1JZ6A 1JI1A 4XX6A 3GXTA 4J28A 4QDMA 2DIEA 3VX0A 3ARQA 3VKKA 1JG9A 4NXSA 4CKQA 3PZQA 1PS3A 4CUCA 3RILA 1WCGA 2D0FA 3OZOA 4P8WA 1JF6A 1IV8A 2OSYA 1ISYA 1RH9A 3ZT5A 4AW7A 5D8WA 2VURA 1E9LA 3CZSA 5E1QA 1U33A 1TQTA 3A4XA 1E73M 2HISA 1VAHA 3GH4A 3VGGA 3GBDA 1VIWA 5EFDA 2PI6A 5TD4A 3T0DA 4W7WA 3CPUA 1TFVA 5IFPA 3ZJ6A 4GI8A 5ABHA 3N04A 5FD0A 2BXYA 4YN5A 4WKFA 3VILA 4P7RA 2QPSA 3K4DA 1UOKA 1HP4A 2YLAA 1EQCA 2RGMA 1UG6A 3WEMA 2OWWA 1GQIA 1HF6A 2G41A 1HTYA 3EJSA 4UCFA 2EADA 4AZBA 9CGTA 4NI3A 2XYLA 2PWHA 3WD0A 4GZEA 1QWNA 3IANA 2BY3A 3BGAA 1R7AA 4FLRA 3NCOA 4M82A 5A6KA 4DO4A 3CZEA 4B9ZA 4E2OA 1VF8A 3BUQA 1VFUA 3NDZA 4IISA 2WHJA 4DM1A 5M3WA 3PN8A 2QPUA 1TE1A 1BYDA 2XWDA 1R34A 2DPEA 2GK1A 3LXAA 3SCWA 3W0KA 1VFMA 3WFLA 3WH6A 4FNUA 4FNSA 5A6JA 1TG7A 2ZUTA 1BF2A 4DUVA 4D6GA 2V3DA 1U30A 4PMVA 2XIIA 4U3AA 3GXPA 2XVPA 8A3HA 3H55A 1RP8A 2XFFA 3I3DA 4QCFA 5GNYA 2J79A 3O9NA 4GO8A 1MVYA 1JYNA 2DQXA 3W81A 5JBDA 1KXQA 1BLIA 1B3XA 2J7DA 3POCA 1EDQA 1NWSA 2A3BA 5E0FA 1LF1A 1NWUA 1C90A 3ZJKA 1G0CA 1CNVA 1GUVA 2VR5A 4H04A 1FP9A 5BRPA 3GYCA 3W25A 4FNQA 4TXEA 3AYRA 4S3JA 4A3HA 3VGEA 1C7SA 4HTYA 3VGHA 1OIMA 4Z2KA 4CGTA 5AC4A 4LX4A 2FH8A 4ATDA 2F61A 3PBGA 2CNCA 3AS1A 2VRJA 4D6JA 3RIKA 3L4XA 1KBKA 5DFAA 3W24A 3AOFA 1E56A 3GXFA 3ZO9A 3WD3A 2J77A 1WKYA 3PTKA 3PZOA 2AOSA 1QHOA 3S6TA 3OIHA 2D3NA 5D8ZA 4D6CA 2CHNA 3PZIA 4GXPA 1EDGA 3RO8A 5A8NA 1OD0A 3QHNA 3B9DA 4MPKA 1UKTA 3L2LA 5A2AA 3UESA 1EH9A 3A4WA 4MNMA 3WKZA 1BVNP 3NSMA 3DC0A 4CD6A 4F79A 1W9BM 1DWGM 1OGSA 2ZWYA 3GTNA 5DT5A 6A3HA 3BVVA 3IJ8A 2W67A 2ZE0A 4L4OA 2F2HA 5A6LA 4CU6A 1H1NA 5ABGA 2WAGA 4OGZA 1LG1A 3AZSA 1CGUA 1V03A 1K9TA 1CBGA 4H2CA 3AMCA 4PUDA 4E8CA 1Q4NX 2ZUWA 3RDKA 1XH0A 2WLZA 1GOIA 4HMDA 3FAWA 2B31A 1V3IA 3ZSTA 5M03A 3CIVA 1BPLB 3SCVA 4DUWA 3D4YA 4UQEA 3WBAA 5BYWA 4PMXA 2VC9A 5EB8A 1SMDA 5A2BA 1H09A 2IUZA 3W37A 1QI0A 1ODZA 2YBTA 2E8ZA 3AI0A 3OG2A 1CXLA 3CBWA 1QI3A 1E70M 4AYGA 1QW9A 3NJ3A 4MB3A 3WNMA 4TX6A 2J7CA 2TAAA 1LG2A 1TQSA 1TQUA 3POHA 5A1AA 2CHOA 5CPQA 2EBNA 3N18A 3WL0A 3OGSA 2X0YA 4LYQA 3VD3A 4PTWA 2OWXA 4TVUA 3BAXA 2FHBA 2CCRA 2CEQA 2IXUA 3VINA 1DTUA 1NM9A 1PPIA 1X6NA 2ZOXA 1KTBA 1HJVA 4OOZA 4UOZA 1H11A 3EDFA 2X2IA 1UD6A 2PC8A 3ALGA 4PTVA 1UKQA 3PZMA 3BCFA 3MV11 1BG4A 1JYXA 3K4AA 3T09A 3VSUA 3BH4A 4S3KA 1ZB5A 5CLWA 2PB1A 3DX1A 3A6OA 2E0PA 4PMDA 4NZCA 4NZJA 4MAZA 1VEOA 3FW6A 2WC7A 2PWEA 1TA3A 2WKLA 2JALA 3SUTA 1HX0A 4JHZA 5AC5A 3AMLA 1ITCA 2D0GA 3WL1A 4AZ6A 1YQ2A 1CXHA 1QI4A 3ARSA 2BFGA 3CUGA 3H54A 3K1DA 3VDCA 5LA1A 2DT3A 4BQ3A 3L2MA 3RJXA 2XIBA 1CZ1A 4YHEA 4U2ZA 1I75A 2FH6A 3HMCA 3TP4A 1NWRA 3GH7A 3RCNA 4H8HA 4MNJA 1U2YA 1FFQA 2CKRA 1NOWA 1H4PA 2WC3A 3CHEA 5GPRA
chains in the Genus database with same CATH superfamily
3CSFA 4WJXA 2XJLA 3D3VE 5K3VA 3W1AA 2XCMC 1MXGA 1HE7A 1MI5A 4PBDA 4RSVA 3TJEH 1T7LA 4ZBCA 4ZRGA 4A39A 1WFNA 2P5EA 4MS8C 3HG1D 3GNXA 5HVWA 6PAZA 3PABA 3ZJ7A 4GT7A 1FWJC 5I1HH 4FFVD 2GJLA 3VWKC 1BSLA 3CYVA 4NZ5A 3Q13A 1NWOA 5JIQA 2HVJB 5M17A 3QNZB 3BK0A 4E5TA 1FLTX 2HCZX 1E30A 3KLHD 1KB3A 4JIIX 4EAMA 1EUAA 1FYHB 2Y07L 3IF1A 1G9EA 2BCKA 1WYJA 3HZVA 4W5UA 2WQDA 3ZRCC 2PD5A 4FZEH 2CO7B 3EH1A 1EXUA 3PNWA 4AYFA 2GL5A 5AY7A 1TVBB 1JCYA 5H4YA 1ZPTA 1ZLUH 3LN5B 4IOSA 1QWUA 3NCMA 1J9RA 1KXQE 1HXKA 4OZGB 1IXNA 1SNRA 3QQ3B 1HNGA 4PJ9C 2EDNA 4N0CC 1SGJA 3QPQD 4KZDH 3CB3A 2ZYSA 2GVLA 1T0NA 1VADA 3UC0H 1IR1A 4AWJC 4RDVA 5D2VA 1T0OA 3TX4A 1ROCA 1Y0LA 1BV8A 3GDCA 3EPOA 3LNEA 4JX6A 1SSDA 3IDJB 4IU3A 4M48L 1RHHA 5AC6A 2EXTA 3WO4B 2WSQA 4M1RA 2OAAA 5IFAH 1EDYA 3F7VA 3V7AG 1AIFB 1HESA 3STLB 1OAZH 5HYSA 2FX8H 4LPVA 2JCCF 2NLJB 2YSSA 3ARBD 4CA4A 4HLZG 3BIKA 3SCRA 2YQGA 5J6HB 2D2JA 2H2PC 3SY1A 3Q5TA 1SFHA 1KT2B 1HKKA 3O16A 4J40A 5CPSA 4MAYB 4YE0A 3N9SA 3UZJA 2YQ2A 1E1CA 1A6AA 4N2LA 2IFFL 4IU2A 3I50L 2D3LA 4WJKB 5LNRA 3VJ6A 1Q7MA 5K59F 5FF7A 3ZDXB 3AXLB 2YQBA 3OXRB 3QUXD 4Z7VE 5HMFA 3SBRA 5KG9A 3GUTA 5C08E 1NMAL 3RHWF 5G5IA 4NYLB 5EZJB 3Q5YA 3UGXA 1NF7A 2J24A 3U2IA 1XYAA 4FF5A 4JHAH 2A3AA 3P74A 2J7BA 3QJRB 4LSPL 1YYMH 3WV0A 3QLLA 1J05B 1I1AA 3O8XC 1RFDH 5DFVC 3STBA 2JB5H 4MD4A 4X9YA 3WEAA 4DP8X 4P4KD 3GC4A 3UTZA 4OZHB 2G5BA 4GP8B 3V4BA 2CG9X 4AZIA 1SXNA 4N3TA 1HILA 3QJHB 3L0KA 4Q4PA 2N1TE 2Z92A 1WDDA 4ZYKA 1AE6L 4E9TA 3MA9H 3OGOE 4XISA 3MBEA 4PJAA 4ZQPA 4C1KA 3PWNB 4LUTA 5ICUA 1JD9A 4L2LA 2OQLA 3OC5A 1X5HA 5MEND 3VGDA 3I4KA 4NQQA 2Q9OA 3OMIB 2MOGA 4OVUA 1D8WA 3PANA 3FUHA 3B8UA 1U92B 3ECUA 4RWHA 2AQ3A 4XX1E 4XKYA 4X61A 1EEYB 4AV0A 3C5SA 4HWEH 4FQXA 5EOCL 4M8QA 1E55A 1OWQA 4YHKL 1U1HA 3EAKA 2HAZA 1WITA 1X1NA 2PDWA 3MV7D 4ZW3A 3FMGH 4C47A 3NYZA 1FWEC 3OZKA 5TNVA 2UUDH 1SVCP 3M7SA 3IWVA 3MI6A 1OP9A 3EYQC 3ZBMA 1MI5D 1XGQA 4AYMC 4YDKH 4KBXA 1IFGA 4I4WB 4KPHL 4LRTA 3WDJA 3QIBB 5DK3A 4BE6A 4LGXA 1VFTA 1DSWA 5IVXF 3VXSB 1DJNA 1KACB 4JTTA 5HGAA 1AJ7L 1YC8A 2ROYA 3V4VH 4ZS7H 2J4WH 4Y9AA 1T8XA 1XIMA 3NZSA 3QY8A 4K94H 3AACA 3FCTB 4XQ6A 5I02A 3LHPL 3NFPB 2J78A 5DSCA 5T1KB 4Q8TA 3S7GA 3RN6A 2EYSA 2J8OA 4PRAA 4IJ3C 3ORWA 1DEDA 3TSBA 2H6UA 3MBXL 5AZEH 3BZEB 4MA1B 1EDHA 3C5ZD 1IFHL 2O5ZL 3QEHB 3WAKA 3WXVL 3BHBB 2A7NA 3AU6A 3QIWC 1PY4A 2G3XA 3SDYL 3CFUA 4AY8A 4F0RA 4AHOA 1MQKH 3WIHH 2D20A 3FFCD 2OEMA 1OE1A 1PL3A 4Q8OA 4GQBA 3W7RA 4WHCA 5TQLA 4HF5L 3NQIA 1QNVA 1RHCA 3HR5B 1DWHM 2DVXA 1GGBL 2HRPL 3KHOA 4RAVB 1X1ZA 5ANHA 5AOMA 3PHQA 4TPRH 3WH8A 2Y24A 3T81A 3NRFA 5CR1A 3D18B 2YR1A 5DZVA 4G8TA 3WEBA 3JV6A 2ISWA 2Q09A 3O81A 1JVNA 3GXDA 1KRMA 2JK2A 3V52L 3E1F1 4LW7A 4ILSA 4NN7C 3DO7B 2GUYA 3SDDA 4U1KB 5A40E 3S88L 1JULA 5ICZB 2DDQL 4BFAA 3P3BA 4PR5B 2RH9A 1ZLSL 3GG1A 4LL1A 4ZMWA 2Z8RA 4C56A 1QRQA 2VGFA 1OSZB 3BH9A 3QV7A 2CIIB 4PJ7B 5E9NA 5E8OA 5L8KB 5JBEA 4CD5A 1P5VB 3L3IA 3ZE0E 2YRLA 4ZUVA 4P2RA 1V7YA 5BRZE 1S7UA 5L6UA 1WFTA 4YSDA 5IKCB 3GO1L 1FDLH 2P80D 2Z91B 3DMMB 5FO8A 1HOCB 2BVUA 1M2VA 2IPFA 4MCYB 4L8BB 2ZTKA 4D8ZA 5IFJA 4NQCA 1V8HA 2X0UA 2EZ0C 5GRVK 5MP6H 4K2UH 4F8PA 5G4HC 3KG5A 5IR1A 1OK8A 3BFQG 4P3WA 5AW6B 1PKMA 4AD2A 1BSIA 4MD0A 4DI9A 5A6SA 4B6ZA 5JPMB 1V0KA 5LIYX 1CXFA 1DBAH 3V4UL 3RLVA 2V4LA 1ZVNA 5DWUH 3X3FH 4APQC 5CBIA 3SY0B 3EOBB 4QG9A 4DXKA 3GSNL 4N1HB 1MFVA 1LRTA 1HHHA 1K6QL 3RI5K 4ELDA 3TNNB 2ADFH 4QD2E 1W1TA 3LCWA 2N7BA 1CF8H 4IS6A 4W4OC 4AGLA 5K9KA 1OJXA 1WPCA 1ZCOA 4PUBH 1AGCA 3GS7A 3MX0B 3IGHX 4TO8A 3UXKA 2XX0A 3U0WL 3L4TA 1MHPH 3U7AA 1ACYH 3PDGA 4LOVA 3P2DA 2DW7A 3U57A 5I77A 4NYYA 5CIPB 5A8MA 1G7JB 2UYLA 4OZFH 4H1LA 3SOBH 2OMUA 4FDWA 2B7OA 4YGAB 3SDCD 3RFZB 1LP6A 4XMPL 2OEKA 3MYJB 1TUPA 1FVCA 4G9FA 1X9QA 2JKIS 4OZGE 2H1XA 3RM9A 3E2RA 4PJXF 4OD2B 2R94A 3CVHH 4EF3A 1BFNA 3SDDD 2XQYG 3BYYA 4B3EA 2I56A 1MUJB 1S7XB 1UP0A 3HG2A 5I1GH 1U58B 2IAMC 1HFBA 5K4XA 3WAJA 2YGOA 4BSWB 2Z0UA 1MRFL 3GM8A 2Y1ZA 3ARYA 4JMNA 4XBJA 5A8QA 1T7VA 3V5HA 3WDHA 3MKCA 4EBQH 1OSPH 3MW7A 2JTYA 4H8VA 2A0LD 4YFDB 3TN0D 3RGHA 5D1QE 2R69A 1A25A 1ASOA 1T0PB 2HFTA 4OUUB 4IMGA 4F37F 4PB4A 5IREA 1YPXA 1LQAA 1OX4A 3AISA 4NRXB 1MIEH 1UACH 5CZKA 1CFSA 2MMXA 4IL0A 5TQ0L 4ENZA 3W01A 1W72H 1CFTA 3KYOB 4A7UA 2OXNA 5JA9A 1DVFB 3RFAA 1PEWA 3SPIA 3QYQA 4FTVD 5KBMA 4AMKL 1CT8B 3PYCA 2ZCKL 4R4FL 3HN5A 1I2OA 2CW6A 2FFCA 4JGMA 5IW6B 1OYCA 3KHDA 2ISFA 5BUGA 4PJ5D 3KXQA 2CLZA 1A4BA 3CH8A 4LLUA 5IBUB 5A16A 1XFCA 4W9LC 2EDDA 3RX7A 1I3RB 4H6QA 2UV3A 2PR4H 2WMPB 1GTNA 1XF2B 3TH3T 3INPA 2B14A 4UM9B 3W76A 3T08A 2OKOA 1Q94A 5IMKA 6TAAA 2XLLA 2OW6A 4O2CB 5EULV 4DW2H 1XH3A 3O3AB 4QDPA 1U8NA 4G43A 3COTA 3LVEA 3DV6A 5D4JA 3DOHA 2WLIB 4YDKL 1PWLA 4HHPA 5I3GA 2AAVA 3VE0A 2MTAA 2VISA 1N18A 3INUH 3HHSB 1GOQA 3OTTA 4M3HA 1UM5L 5FPIA 4POCA 1IKNA 4GXVL 4PY7A 2YD2A 1NGPL 3VDGA 2D9QB 3E2HB 3IDNB 4HYTB 5CEXA 2WLJA 3DJZA 2FWOB 1J1PH 2XWZA 3TJEL 2QIWA 2ZZ2A 4L6HA 3LSBA 3CSPA 2IOIA 1R0MA 2PTWA 4X0VA 1Z5LA 3H2EA 5GHWH 5D9PA 1ZAGA 1ILUA 2I7SA 4KPLA 2NQ9A 1LL1A 1TMQA 1I1YA 1UMLA 1J10A 2HVNA 2QELA 2OTPA 3B8YA 1Z9NA 3QI9D 4N6QA 4W9ZA 4KCWA 1EWEA 2FVNA 3L4YA 4O8AA 4OM1H 4XAZA 4HJ1A 1KB9J 2XKSA 2GSGA 4OIIH 5G55A 3TTEA 2APWA 2WZ0A 4JJ5B 1KN4H 3DXAD 2NNFA 3F4NA 3NOEA 4WF7A 1UB6A 2HTKC 1T20A 3G5YA 4P2QA 3ZMNA 1TPEA 2ALRA 4MZ8A 3FUNA 3U6XA 3MBFA 4JFDA 4M7JH 2K0RA 4TUOA 4FG4A 3UJRA 3ASOB 3W2JA 5GZNA 3DTXB 3TBWA 1R5WB 3BPLB 3P84A 1KLFA 3PNZA 3MSDA 2QQNL 2G3MA 1E9PA 4FFVC 3VWKD 4W81A 1VHNA 1IAMA 1VJIA 4MNGE 4NZ8A 1KBGH 3AYTA 1M05B 1TXKA 5I1HL 5JYLA 3NK4A 1ZBKA 4WXYA 3ZTCC 3HFMH 2GT9B 2H8XA 2G75A 4BE5A 3RNKA 3W0WD 2Y1AA 3R25A 1S6NA 1E27A 4GS7B 5CSGA 4WFHE 5MERB 1BTMA 1G69A 1YPFA 3VIIA 3T55A 1QLRA 1D7BA 3MLWL 4DZBA 1C91A 1NMCC 3MWCA 2AL1A 5EU6E 4ERGA 3B2MA 3O0FA 1RMFH 2Z4QB 1EV2E 5HJ3A 4AV5A 1ZL1A 3EOLA 4BI5A 1BXUA 2F54A 3D87B 2VR8A 4CW1A 1DLHB 5D2NA 2IBBA 3RG6A 2IEPA 2Y5TA 3W3OA 4B5VA 3NZGA 4S1SH 1VFOA 4XCCL 1W1A1 1EEPA 4AWSA 3JWNE 3ESNA 3TCLB 3ZKMC 1WVZA 3W83A 2FQDA 2P8MA 4MWAB 2XRAL 3S3GA 1UASA 2Q7YA 3IFPB 4BD4A 3MNVA 4BELD 5IT2L 3UBPC 4AL8C 25C8L 1XIDA 3QPXL 2WYIA 2WWMD 3IGKA 4CQ9A 3LDVA 3AIEA 2KPWA 4NKOB 1TJXA 3S96B 4D6HA 3B1UA 3R1ZA 5HJDA 3GQYA 1ZHNB 4O51B 4WGHA 3S1VA 2E9IA 1KGUA 3HAEH 4AJ0A 3MSRA 1A9EA 3VZZA 5BXPA 3A6CH 3U9PH 4HKJA 1A1NA 4MD5A 1PZ3A 1X5YA 2HFEA 3P9WB 2PPGA 3SDOA 3BZGA 1NBVL 4ODWA 1E4WL 4MLJA 2X2UA 1WICA 1JNEA 1UWUA 4ONHB 3SCMD 5FAGA 4Y1SA 5AHEA 3SFKA 2Y7DA 4WCJA 1AD0B 1T83C 5DJXB 1L6GA 4UIOA 5ICYA 2X1QA 3D7PA 4ZS6C 4BCXA 4PPTA 4DM2A 2DZPA 3BQ6A 1NOAA 1OKEA 2FWOA 3X1EA 5D2TA 3EH5B 2YARA 4X6CB 2F7IA 4PTUB 1SUJA 2ZG3A 4PREA 3EHBD 4R4ND 1K7FA 2QF8A 1FIEA 4RMWA 4PJIE 3CIWA 3WU1A 4WHTB 3CJPA 2QUVA 2NNAB 1SFSA 3HA0A 4MJHA 3SGDH 4EXKA 2JKLA 3QIUB 1E5CA 5GGUA 3GHRA 2VISB 3P80A 3FK4A 2IDCA 4U6HA 1K77A 1R75A 3HQ1A 1WZLA 2MHAA 4IHOB 1H8LA 4ANXA 2R0KH 2WYHA 4JO5A 3IJHB 3AT9A 5ECUA 3GF8A 2FQGA 3JR2A 2WMPA 5CCZA 4ORZC 1GTFA 2N59A 4A05A 3C2AL 3Q48A 2WZPA 5E5RB 5AG9A 1KM3A 3OJDB 2YWYA 4GBXB 4PJEB 4NPKA 3S37X 1PCSA 1CLOL 1CT8A 2XUWA 2E3ZA 3WGUB 1ITUA 2J8TA 1X5FA 2XVBA 4L4TA 3SKMB 1ME8A 4A37A 4TOYH 3I6KB 3STZB 1WWAX 2XZCL 5JLZA 1U93B 5C0IA 1X96A 3GLAA 2W0KA 2XPGB 1H7OA 1IKFH 4OTXL 4U31A 3T8VA 3UC2A 2PYEE 4D0DA 1HJWA 2EDOA 1DQML 3CAWA 4P5UA 1AZVA 2VN5A 4V2CB 2V5MA 1EZ2A 5DWUL 5T3XE 3EX3A 1X5IA 3V5HB 5JLZB 1S7RB 4IGBD 2W91A 1LEGA 4PMOA 3B9AA 2ED8A 8PAZA 3B40A 5DLMH 2LU4A 4ONGL 5BZDB 4IMDA 3O2VL 3M64A 4KI5E 5FFOA 1HXMB 2E7MA 1IC0A 3SBQA 5I1GL 4PV8B 3HFFA 1Z48A 3RLUA 3CN2A 3OJDA 1K8IA 4TULL 3VXOA 2CLVB 3OMZA 3MUIA 4LVDA 3QWOA 5D9MA 3O6FD 5KYWA 3NOYA 5BZXA 2P46B 3MP3A 3B2PA 3KYNB 3D9AL 1NBZA 2YPVA 5IESL 2VEIA 3LENA 2R2BA 2QDHA 3FSAA 1KPVB 4PJBF 5C7HA 1IVTA 1QQDA 1N6QH 1KB5B 3GUWA 4QUOA 2LGNA 2E9JA 1SYTA 1RQHA 3L3OB 4K8RD 3ULVF 4JIQA 4R5EA 4RW5A 3GD6A 1KRBC 3TEUA 1TUFA 2FVKA 3UTTE 3ARRA 3HZYA 4H20H 5J6GB 4F3HA 3BW9B 1VGKA 5BNXD 3U0WH 4JUSA 2R4RL 4JGDA 5ACZA 2IANE 4QHKI 1KFLA 3ULSB 3DEQA 3W11C 1JQVA 3AZTA 2OOFA 1P6FA 4TVDA 1D7FA 4MF4A 3D06A 4OCRL 5MHSE 5KAQF 4FX6M 3GVVA 5DEZA 4JS3A 1L7TL 3ULVC 3K6SA 4MSWA 1FHDA 1N7ML 4P3DA 2UBPC 1T7XA 4Z0BL 3WUGA 2NQ5A 2MSPA 3OJ2C 2X12A 4YWGL 1V02E 4KEUA 1N2RA 5CC7A 2NCEA 3IGUA 4CNIA 5DT7A 3RMJA 3MMUA 1M2VB 3WS6C 4KFNA 3S3PA 5D5MA 5EZLA 2EUWA 1R3SA 3UTQA 1S7UB 5F44A 4M7LT 3RU8L 4ZFMA 3VXRE 1MWAL 3AU1A 2A1WH 5SWUA 3I6GA 5EF0A 5LA0A 3HTWA 1GS8A 2ESVE 4N2EA 1OSZA 1RCQA 3Q67A 4O4WA 4I3SH 4IJ3B 5A6AA 4W85A 1AMKA 4YHIA 1BCIA 4HPHA 3L2NA 4M43L 1SXZA 3S96A 4IT1A 3F6IA 1HWWA 5GRWA 3PP4H 3OJMB 1PLGH 3KEDA 5I1AA 4NFCA 2F53D 4LCWA 3PAJA 4UFLA 4EOUA 1TV2A 1X8CA 4PRWA 4WRLA 3HUJE 4J8RB 3MNVB 1FGNH 5E9DD 3D18A 3IBEA 3HN3A 2QJHA 2RDUA 2VXQA 2YCIX 4RCAA 2V17H 4XMPH 5CBEA 4APQD 1NDWA 2QBWA 4GGBA 1V7ML 5HHQA 2ATMA 3MRDA 2DAVA 4H8UA 4XNDA 2B0MA 1KGXA 2H3KA 2P8CA 5G4EA 4MNGB 3IJDA 2Y88A 3MS8A 3ELAT 1ACYL 4DPBX 3V0SA 1DLHA 5D2NB 2JKAA 5FESA 4UTAA 2A74A 5BROA 1FN4A 1YDVA 2JQAA 4F7EA 2SEBA 2MEJB 2E28A 1OCCB 3P2VA 1KJ2L 3RPIB 3TWYA 4MJIB 1XH1A 3S5NA 1K6QH 1OD9A 4I13B 3BZEA 4A4AA 3G1DA 1FYTD 4HJEA 4G8FA 4JO4H 2GSEA 2I16A 3W6LA 5C09A 2GT9A 4JKLA 1XQLA 3JRKA 3BESR 4PRNA 4F8TA 4ZW5A 1HS6A 3V0WL 4PQXA 4KUCD 1TVNA 1SHWA 2IQDA 3DI0A 3WDRA 3WF3A 1EUUA 3TTOA 1F4HA 4JRYD 5I5RA 2TRHA 1ORSB 3KPMB 1LO0L 4KKZA 4PUMA 4NN6B 4LEOB 4MYPA 1HDMB 2MNJB 4L9ZA 3SKJH 1NGQH 2NZ1A 3KPSA 4PN6A 4ZB5A 3GSMA 3HV9A 2HBXA 4FK9A 2AI0H 4JM2B 3LOWA 2AABL 2PDXA 5ALBL 2W8CA 3LLXA 5GRVL 1FAIL 5JQ6L 4MWAD 3DVNB 3MBWA 3BVXA 5F7FA 4NQSB 2FTAA 4PWJA 2DZWA 3NXFA 5K9XA 1FL6A 3G6LA 4KX7A 4AY7A 1PEZA 4D8AA 2JKTM 1OTSD 1W5OA 2EKCA 4G7QB 2G9HA 5IVZB 2PRHA 5D7EA 4PRHB 3PZUA 1XLEA 2ZZ7A 4HIXH 1TJIL 1GYAA 4M51A 3C5SB 2BW4A 4HA1A 4WENB 4GKTA 3FUMA 3LZLA 4WW1B 5FEXA 5SX4I 4DGIL 3BT2L 2JK5A 3APFA 3ZDWA 5K9JL 3WNNA 1MNNA 1AI1L 2X6MA 4Z17A 3GK8L 4DP2X 2XV3A 4REQB 2NT1A 1HZYA 4M6QA 3A3HA 3FO2B 3LV6A 4CGUB 2DLEA 1ZPLA 1KN2H 1P9MC 1SLXA 3BIAX 3DX4A 3WNPA 5IMMB 1A3HA 1LLWA 1E5AA 2O9OA 3AIWA 5ISZA 4MVBC 4H3DA 3AMKA 1OK4A 3GYEA 2Z92B 4KCTA 4XODA 2ATKA 2N3JA 1E28B 3GI8H 3INOA 5B1KA 4JN2A 4CN1A 1J1XH 3CDCA 4Q8PA 2P26A 3UTZB 5MI0C 5GRXG 1A5AA 3DV6B 3TA9A 1IAIL 5I30L 4P2RD 4WO4A 4JR9H 3BPNC 5A2LH 1KYAA 3RVXC 5CGYD 4MNKA 3N1PC 3W85A 4F40A 5JXAH 1OZQA 2H6PA 2C1PA 1WKDA 3TT1H 5JOPD 4Y4KD 3QHFH 2C91A 2EG6A 3S37L 5IQ7L 1TMCB 3TZVC 4L6OA 2VFFA 3LZNA 3S35X 1MLBB 1XTMA 5IHUH 4GCAA 2IMMA 2ZZ4A 4GY1A 4X6EB 3I3EA 3VE9A 4A04A 3I7QA 1Q6RA 3WTYA 3O2DL 3VNLA 1YLBB 4QRBA 3GX9A 5HTSA 4F58H 1PTZA 3FPYA 2RCSL 2RA1A 3IXTB 4WW2A 4YDLC 2F54E 1IE5A 2G4FA 1KT2A 2J88A 2ZUMA 1ED3A 3PTMA 3QH3B 2IPTH 2R7EA 4GXVH 3W39B 2DWYA 4AGMA 1ITQA 4R53A 2WBGA 1MHCA 2G3JA 3MLXH 4HWZA 1BOGB 1R87A 4JFQA 1ME9A 2V2WA 1AIFA 3STLA 4L4TD 3SRFA 1ZLUK 2GSIB 4XCYA 3T6VA 2RFXA 2YPKB 3WMCA 1U58A 2HH0L 3KPNB 1MWAB 2DKSA 5FA4A 1X98A 3LEYL 3G9AB 3IAPA 1NGZA 1KTNA 5C6WH 3C87A 1U36A 1BVLB 2R56H 1C3FA 2ZRUA 1JF1A 1GG1A 2UX7A 4K1GA 3GTFA 1P1VA 4KZCA 2O93L 2Z1VA 1H7RA 3I65A 3C5JB 4B5WA 5E6RB 3TF4A 1RJLA 1VLWA 4P05A 2WZ6A 1KENL 2VCOA 3FB6A 3P7YA 4HU4A 1MCFA 1THCA 1UYQA 1JMXA 1BD2A 1MCWM 4LARL 1HG3A 4UQCA 1YJDC 4A2GA 1R17A 2Y0SA 4K71C 1F3EA 4PTMA 5I3JA 4IEFA 4XXCC 4UAOB 3CK5A 4HIXL 3F6JA 1FZOB 4QRUB 2P42B 1AC6A 3DK0A 5F3HB 3PZTA 3O2DA 3TBVA 5C2UB 2X4QB 3MC0A 5DT1L 5LG6A 1MEIA 2BIQA 3B4YA 4QR6A 4JY4B 3QFJB 1DJZA 3H42L 1SJVA 1ONEA 1IGML 2BVQB 1WO2A 4OT1H 2BVYA 2NW3A 4ZSTA 1QCWA 5MF5A 1F3DJ 4B9YA 1CK0H 5EBAA 4NQUA 3RIAF 3AYSA 1GVIA 4HIJA 3L81A 4L8BA 1XT5A 2NDGA 3GSRB 5E9DE 3NN8A 3GLEA 3CV6A 2FJFA 4JTDA 3JT0A 3HC4H 4NHCH 3W57A 5IKCA 3U2SB 3NIGE 3HPZA 2F1BA 1W1VA 1BWWA 1QNZL 2VDQL 3EJCA 2KBGA 3NSXA 3DMMC 3QDGB 3TBTA 1UCTA 3S3CB 3IK2A 4PUEA 2CIIA 4PJ7A 3I85A 3IVSA 1CXKA 4IGBA 2H9AB 3VYLA 1NAKL 4K73A 4HJIA 2DDXA 4BKTC 3KM2A 3M0IA 5HVHB 5GGRA 4K7YA 4DP6X 5D04C 4WTXA 1T0MB 5TDOB 4JHVA 1I7UA 4KCVA 4NAEB 3KW8A 3PZNA 4FERA 5DMLA 5HGBA 2VABA 3QRGH 5C7ZA 3BSHA 1A64A 4NN7B 4XX1G 3THML 3XIMA 3F64A 3VVWA 1DBAL 3ZDZF 1H0GA 3DBNA 3PP4L 3DRQB 4X6DF 2DYPD 4R4NC 2ITDB 3BMVA 3MYZA 3EYFA 1EP3A 4FQCL 2BMBA 4RAVA 5HD8C 3T3PB 2C7UB 4OJEH 5BO1L 5I1EL 2AI0L 2D23A 4Q4KA 3DOIA 2RJMA 3VGBA 4HV8A 4HLJA 3VRJB 3ZHDA 3QW9A 6FABH 4ETQA 1KKOA 4XWGH 1P0BA 1OZTG 3QJOA 3QZWB 2EE6A 3H7RA 3IGSA 1ISXA 5DMGC 5A6TC 1PY9A 2VAAB 1FLRL 3IACA 5FUCC 4HUUB 1T5XA 2GK1B 4KGJA 2WZPD 3QHTC 5FYJU 3DSNB 4L4PA 4B3KA 3AY4A 4UFMA 2DIBA 1IC5L 4DF9A 4EUPA 1UBSA 5F7MC 4U49A 3M17A 1E4JA 3K6FA 4IJTA 3RP1A 1Q6CA 4BF9A 3RR4A 5D93C 2A38A 1F4WH 1F4AA 2XG5A 3KWWA 2EDEA 4N0YL 5FOJA 1BXBA 3LRHA 2Z2UA 3Q94A 4NB7A 3S4TA 3SURA 3M0VA 1E2ZA 3GR7A 4FZ8H 3WD5H 3WNJA 2VH5H 4X7DC 5E5MA 1K8YA 4N8CL 3ABOA 3T1FB 3MDUA 1UWEH 2EAWA 5AKSA 4BINA 2J7GA 3FF7A 4ZUUB 2MNRA 5KVEH 3WFAA 2V17L 1T04A 4ZFQA 4K8HA 2H26B 2OTWA 3QIWA 5EPMB 1IE7C 3GG7A 3GZAA 4EO5A 2XZAL 3O3DA 5KYUB 5FO9B 1I4FB 4M8QB 3OG3A 1FHLA 4NDMB 1AGDB 3B6SA 4GC4A 3HGOA 5FFLA 1XLBA 4TOQA 4MGXA 5F1NA 4HAFA 5G4NA 5CEZH 4P5TA 5DMIL 3FQNA 5JW3H 1EOMA 1S1RA 3KJ4B 3M0XA 2V5KA 1VFSA 5AC7A 2Z25A 1HYSD 3FFDA 4MJ6B 3UGEA 4F2FA 1HAWA 3WLBB 5I8CA 4B15A 2N7SA 2DT0A 2KYIA 4KXZH 3B9KD 2WNWA 3NACH 4KH9A 2ZKWA 5C0AE 3C2FA 1Y6KR 2VDNB 3E8UH 3GC3A 1N55A 4XBGA 3IIXA 1SPQA 3QFGA 4ONVA 4N6FA 4EPEC 1SDYA 3MLTA 4JLRA 3WLJA 3WMLA 5T5FA 4LCWE 5EU6A 2EE2A 3X3GL 1H2JA 4LLDA 4AZ8A 4JREC 4OF0A 5D02A 3VXSE 5JXED 3T04D 4G6JL 4M6VA 3OPZL 4AITA 2BDQA 1XF4B 1C92A 1UZ4A 3PAOA 1FZMA 3NTYA 5EYWA 5I0XA 5BVPL 4CJ0A 4U4MA 4NHVA 1DORA 1F2XK 4WW2F 1HSAB 1GPFA 2OR7A 5EU5A 4AF0B 5CAYB 3HC0A 4HUXA 5D2XA 2Q8AH 1IEBA 1JUFA 1OAUH 2E1DA 3CD4A 3UR8A 2NUTB 4OGAD 1KLUA 4QNPF 3ABQA 4TKWA 4WV1B 1ICPA 3AIVA 4MAYA 4ENED 2E27H 1YMHA 4UTBH 2GTZB 3NCWA 1AH3A 2ZA2A 3CQKA 4PMNA 3C2AH 3REWB 5FECB 1AFSA 1JPMA 4W84A 4RXGA 3D05A 3CQFA 3ASNB 5FUOH 4Z7VA 3PJTA 4GRWF 4MAYC 4CDHA 4GE8A 3SQBA 4DKAA 1X5JA 5I6OA 3TFKD 3GFZA 5HDQL 3SBFA 2FDBP 4M48H 5CBBA 3NIDE 3S36L 2DJSA 4FJZA 1NC2A 3GSNA 4XC1H 1OP5K 2Y0FA 4GIEA 3FUJA 4HK0B 1F02I 5HSFA 2VERA 5L88L 2X4UA 3ZDYE 1MDRA 5BOOA 4JHAL 2YN5A 3N17A 3ARWA 2VLKD 4N02A 5IQNA 2CR0A 4BEIA 4ZE5A 1PKOA 1NMAH 4J3XA 3RRQA 3CPRA 2GHWB 1YEGH 1OB0A 2X1XR 2AK4E 3F05A 5JNYA 4Y9PA 4A2LA 4I3RH 4LLVB 3NJKA 1NQ6A 1I82A 2RQ8A 3V6FB 2DZSA 4E8GA 3WDQA 3WIIL 1A5FH 2C4FT 2BWGA 5C9JB 1OOAA 1JYWA 4MTMA 2CH8A 4DNMA 1T5XB 4K15A 3H3PL 4YPJA 2I5YL 2Z2AA 1LOLA 3AIBA 3L5XH 4D72A 5A2CA 1JZ7A 2YZ8A 5ES4B 3H85A 1QU4A 3N4EA 4Z76B 3U7VA 3S8WA 3QZWA 1M56B 1LE5B 1GOOA 2O6FA 3NGBC 5T1MB 3TURA 4G5ZH 3LZ3A 3AQYA 1DIKA 4TSBL 5D7IE 2VMDA 2WVVB 4MS8D 2ZYHA 3SGDI 5MHSD 5AL8A 4H83A 3U9IA 2DJUA 4AUYA 3VKJA 5FO2A 3NQMA 4GYFA 3SCTA 3NAAL 5EZOL 1O7DC 2BSDA 2XBZA 3ZE0F 4AKQA 4DJMA 2CYGA 3ELFA 3EEZA 3TJ4A 3BP7B 1CDIA 3G5XA 4KX8A 4KQNA 1PNCA 5K9QI 2NX1A 1R5VB 2ZC8A 2DQTH 1IAKA 2KZKA 4G6AD 2AJXH 1HCZA 2V30A 3DPBA 5FUCE 1KM1A 4S3EA 4UFIA 2X4NA 1FWTA 4LNRB 4IUOA 5GRYA 2DYRB 5CCJA 2EPKX 4DGYL 3N91A 4R84A 2F8XC 1MO0A 1O5XA 4YGVB 1KYOK 1ADQA 3IUIA 3VNKA 1E8YA 2ZF8A 4UIKH 3NIGB 5ENWA 5GGVL 1TJRA 2V8ZA 3EWDA 3S2NA 1PCKA 1BLNA 4XC3L 4ODSL 3QQXA 3TLRA 1ENUA 1IKNC 3GTTA 2QTEA 2YFOA 2AEIT 2PXYC 1HHKA 2DM3A 2EICA 3M1BB 5HHNA 4RNRA 4O1BA 4LL9A 1E0UA 1D5XA 2BIIA 4HH9B 1QNQA 5IHRA 3FTXA 1R38A 2D2OA 3TIDA 1B4RA 1YDYA 2TRYA 1X1OA 4LAKA 4HAGA 4LYKA 4FLQA 2BVQA 2NW3B 3HC3L 4ONOA 1VKXA 4H7ZA 1MNUL 2E6QA 1D5BA 1S5IL 3H53A 2F18A 1KLGA 4OI9A 3SY6A 3LUTA 4GAYA 4S1RH 2X4TA 1EXHA 1GY1A 3HE7A 3PHOA 4EEEA 4H2HA 4XIAA 4OCWL 1CICA 1RIVL 3QARA 4GKZA 3WY4A 4C60A 3P93A 4HZAA 3TA3D 2VNCA 4NNAA 3OVUB 4UFJA 1C9SA 3W7IA 1S9VB 1FZOA 4QRUA 3RVXD 5L88H 4Y9GA 1JHLL 5TPWL 4LDEB 2GYSA 4X5PA 3GB7B 2PDNA 1YYCA 2C1OA 4KK9D 2W5PA 4LHUD 3ARDB 4JTKA 5DRNB 3IMSA 1KWKA 3ITVA 2BY1A 5DXXA 2NRDA 1NAMH 5T3ZH 3PV6A 4PMYA 3ENLA 3GTIA 3TJIA 5LXVA 3VNJA 1MFNA 4I77L 5D1ZC 4IBZA 4L1WA 4YNYA 1JGLL 3MCKB 1QNZH 4GOAA 2WLKA 1UCWA 5F93C 4S3CA 1UR9A 1TQWA 1PWMA 4IL2A 2YPKA 2GQAA 1TQBC 4NAQA 4DB7A 2NNRA 2L7EA 4IZGA 2PE4A 2FGWH 3PUOA 3W1RA 1SLUA 1LL7A 5IIEA 2ISSA 1R3LA 2A6DA 5HVFB 1UA3A 1EJ6A 4L1DA 43CAB 5JOFA 1K3IA 4IIQA 4UQ3B 4F80A 5GS3A 1FH7A 4KMTL 3S5LA 3FOKA 3AIQA 3H4GA 3V6BR 4MCNA 5AAMC 3QVAA 2X6CA 2YL5A 3E02A 3UW6A 2NX5D 3RDTA 3EOSA 4Z7NE 2QMKA 5H37A 3B37A 3N25A 3CSYA 3PV7A 3HNTH 1XL4A 4FNLL 4H13C 3BWSA 4JRYA 3BO8B 5F9AC 5IB3A 1JZ8A 2QT3A 1BZDA 3HUJA 1OCWH 1BQSA 4YDVB 3WH7A 4B4FA 1GZJA 4L05A 5FKAB 2BSSA 3MQIA 3KYKH 1BQCA 4Y1AD 1A7BA 4NZFA 3WBDA 3LYEA 3VI2A 2Z31B 4PJXB 4HMEA 2VEKA 4ZMNA 4HIIA 4A2EA 2DQFB 5J13B 4BCYA 3K8LA 3WTVA 1E5BA 2WQRA 2FO4B 3M1ZA 3KPLA 1JS4A 3FB8B 1J0IA 5DEJA 1GGIH 2ALWA 2DI7A 4HOWA 4UMGA 4LEQA 5KETA 1RVFL 4GI4A 3UO8B 1XYZA 4O5LL 4CVXA 4YSRA 5KSWA 3QXDB 5C0CE 1QO3A 1QSVA 1JHTA 3GLDA 1B31A 4IRZA 3PR2A 1SJEA 3BFOA 3GI8L 5EU7E 4MJZA 4TSBH 2H1LM 4LSSL 5EBGA 6TIMA 1OF0A 1FG2B 4XNQB 5GIRA 4EZKA 1YN6A 3SBWA 4LEBA 1XGUA 1ADQH 4YTQA 1GCYA 3TVMD 2XWJB 1GA2A 2HSAA 2OZTA 2PLJA 1E9OB 4N87A 1TTAA 3FHQA 1TEYA 2VM4A 1DCEA 2YC1B 4HU0A 4AH7A 3CHOA 3ANUA 5FA3B 3FT4A 3K4WA 5D6DC 1CFVH 3S6OA 3EWZA 3RNDA 3DX7B 2AK4D 4S1DD 3I7SA 1YUKB 4QXIA 5I6LA 1XEUA 2ZSVA 2PW2B 1QHZA 2ON3A 1FL3B 3MZ2A 1ZVHA 2X10A 4QPEA 3ABSA 3OA3A 5CG0A 2WWDA 5DJ0B 3WG6A 1UD4A 3DVNA 1INEH 1OL0A 3RYMA 4F66A 4JDZA 4O58H 2GDUA 4WOZA 5IEKA 3LD5A 1DN0A 2ICEA 5D7HA 3MCMA 2VLKB 5JDJA 2V63A 5AWNH 2VC7A 4FSAA 2OMTB 4XD3A 1OGTA 2D3VA 1IMHC 1S38A 3RI5F 1CN4A 3P77A 3U82B 4U1JB 5I1IL 1NCBL 5BOPA 3WF2A 5A43C 1RY0A 3TBSA 1WLHA 5HD8D 1RZJH 5I8OL 1S9KC 4HSNA 2CKNA 2YA1A 3SJVB 4FQCH 1DBTA 1BWKA 4JY5L 4JX5A 3S1XA 5D1ZI 3EO9L 1G4MA 1PIGA 5FAAA 3STEA 2OX5B 1I7TA 3JTBA 4HIQA 2F6KA 1ICTA 3E0VA 2QKIB 2FLBT 3S0PA 4X5XB 1TCRA 4EX4A 3NPSB 3FFCE 1XC6A 3PDOA 3H2FA 3I02B 3A22A 3DOSA 2K45A 2PP9A 4W9IC 2IPGA 1AGBB 4FABH 2NY2B 3S46A 3G5EA 4Y5XC 5EU4A 1EO7A 2HLAB 1EDTA 2VIRB 3QZBA 1BVNT 3BVJA 3RGVD 3QZEA 2YMOA 5F7KC 1ULVA 4DQWA 2BJMH 4OAWB 1QA9B 2E7LC 1BM3L 2C3VB 1DJWA 3OAUH 2NY1D 3MV9E 4QJ3B 4UTAL 3HC4L 4NHCL 5DCCA 4O02L 2FJKA 4JFEA 3VACA 5D7JD 4KKQA 4JFVA 4MADA 1UB3A 5HWMA 1ZT4B 1UWIA 1YEIH 4NJJA 4L3AA 5KTEH 3GJEB 5ESAB 1EJWC 3FV9A 3RR1A 4KW2A 1KCKA 3CFTA 3K72B 2AC0A 4YHIB 3W27A 1F00I 3URNA 1DJXA 2H45A 2LLGA 3FULA 3VWJD 1LOQA 1XF0A 3TH6A 3R4DA 4G72B 4GZIA 4KWUA 3UBFA 1ACZA 1QNOA 1WWWX 2JNZA 2BTMA 4NAMA 1S78C 3DROA 3U36B 4XAWL 4NZUH 4Y88A 4RESB 1DSFH 3FO9B 1G7UA 3MRMB 1OD7A 1MDAA 2GUUA 4NC1C 2O5ZH 3MACL 4HUMB 5ICXB 5CEZL 2GJ6D 3QEGH 4HJFA 1QATA 4LP8A 2G3NA 4TVSa 1FDZA 2DICA 3JWDC 5LA2A 4YSUA 2I5GA 1TJ1A 3CSBA 3LRLA 1UOLA 1KJ2A 5HVHC 1QJWA 2VSDA 3G1HA 3O2LA 4OCSL 2CA4A 4HKPA 1D6EA 2J25A 4DRSA 3VIOA 2O9RA 5G4OA 3VD7A 1B4JL 3IETA 4MZ3A 1L8NA 2W63A 2GTQA 3RZCA 4LSBA 2A6IB 4TPRL 1CU4L 1RURL 3D85B 4X99B 3F5WB 4X7SH 3M7FB 1KLZA 2JKPA 4JY9A 4ZSOA 2NQJA 4WY7H 4DK5A 1YEKH 5AW3B 2NZIA 3PULA 2EG8A 4EPKA 1VGKB 1KBWA 4HF5H 3G77A 1LWIA 2WKOA 1GOHA 1HKIA 3CTTA 4KUCF 4EI6A 3EX4A 4MA3B 4K2SA 1S5HB 1MQKL 5E4EC 3WIHL 2FHCA 5KSBB 4ETYA 1RVFH 1N0XL 1KB5A 4AWTA 1M7JA 4FAMA 3L95B 1WE5A 4BQBA 4PJHF 4RGNC 4DCQA 4MBOA 1B3VA 2L04A 2A73A 3L3OC 3ZE1B 1NBZB 1AG1O 2BP5M 4DKEH 1UP2A 3H2AA 1RK0B 1IC7H 2FJHB 1TTRA 2V7HA 1DHKA 4IM4A 1TZZA 4DJFA 2Y5SA 2F8OA 2YKKA 1WXZA 2BS8A 3W2LA 4HMNA 1NLBH 5E2TL 3QM3A 1XAUA 1ANUA 3KL3A 1DFXA 2QGCA 4G80A 1KCLA 1E6XM 3DFSA 4WGXA 5BZDA 5ESVB 4DK6A 4ZMLA 2X3CA 4I5UA 3CFEB 3V4VB 2ATPA 1FJ1A 2NY5C 2OTUA 1IWBA 2XIDA 3UCCA 5C3IA 3WH5A 1GW6A 1V3IA 2MQ0A 1AE6H 2BCMA 3QUYD 4ONFL 4U6VH 3EYQD 1UOWA 1HL2A 4LYPA 5F88B 3DX8A 3AUWB 3DAQA 4NL1A 1TTBA 4Q2ZA 2HPMA 3D2UA 4H44C 5JIIA 5AECA 1BM3H 3GQFA 3G3DA 4LVNC 1NC4B 1FVPA 4N2YA 3GRWH 3UWUA 2WXNA 1ZT7A 4EI5B 4M8UA 3SY8A 3T05A 1WBHA 3LI1A 4C54A 1RHFA 2B20A 1H8NA 5F7BA 1LD9B 1H6TA 4LNVA 1NDZA 3KNBA 1SOSA 2ETWA 2BPBA 3MZTA 3DX6B 1K6AA 2VC6A 3LCXA 2LE9A 1KN2L 3BUIA 4OV5B 5IXEA 1R3IH 1X5AA 4OCXL 4Y2WA 3WLRA 2V7HB 3VTAA 4Z18A 5HYJA 3Q6FA 5LGJA 3DFYA 1AH4A 3C5ZC 5IV2A 2CERA 1Z3GH 4XMTA 3IU4H 5HYEA 3EO9H 3CV2A 4PBGA 3UACA 1F3TA 3VKAA 3W4RA 4MRBA 4Z0JA 4HPNA 4Z95H 3WY1A 1QRNB 3MLVH 1F6KA 1H3VA 4R5TA 4C6CA 3UJTH 4BI7A 4GLRI 3DRTA 2VKWA 3HCVA 3GMLA 1RUMH 3JZYA 4JL2A 3SKNB 4S3GA 2ENSA 2R91A 4JEQA 4ES4A 3TWCH 5DJ6B 1N6UA 3WSUA 1LTXA 3D6NA 4E0RA 4D6IA 3MV8D 4PTNA 2VX6A 2KLSA 2IDFA 3L5AA 2YAQA 1GXEA 3MSGA 2QZQA 4CC4A 1LDPL 3O2DH 3CL8A 1ASQA 1UT9A 3NIFB 4KTYA 4G6AC 5HI4D 2J7HA 3EX2A 1AGFB 2FPVA 3FYYA 4JTJA 1CB2A 2RGLA 1F2QA 5DC9B 3UTSB 4TXVB 2J1ZA 1Z9LA 4X98A 3V1PA 4ONHA 4TTGA 4NP7A 1IBHA 5AW4B 1R2SA 2V37A 4ZFFA 1FHNA 4FTDA 1AW5A 4QXVA 4YHYC 2IADB 2J7EA 1S1PA 1A4MA 5C8BB 3EXRA 1UKOA 2CZNA 1QX1A 4MQTB 2QJNA 1FO0B 1W3KA 3H7BB 1O9VA 1BFSA 4UDUA 5A2KH 3U4EB 4GT0A 1JUKA 2ZAGA 4ICNA 3P6LA 2Y7QA 3QXBA 3VXUD 2AK1H 1X5LA 2J21A 35C8L 4TLSA 2Q7NA 2EO9A 3IJEA 1PG7H 4WDIB 4Q9CA 1VR6A 4TU1A 3IBOA 4HCRA 3AQUA 1XSIA 5LBSL 2NY5H 4IDLA 4LIQE 4K7FB 4NQXA 2ZTJA 3U3HA 3IRDA 2NWRA 5AFDA 2QPXA 1DIOA 1RZKC 3HMWH 1RUSA 2HK1A 2Q10A 1FWBC 4Z1BA 1QLEB 4NQDE 1CFMA 3C6EA 2VIRA 1MAKA 4KVNL 4IBYA 1B0WA 5I1KL 3ZN6A 3LEVL 5CF3A 3BWZA 5A8OA 2AQTA 1S3KH 2NY6B 2K78A 5LBSA 5FHAH 4NC1E 1GQJA 4JTAA 3SO7A 3K5SA 1VPQA 3DFTA 2DZTA 5HPCA 3I02A 1RU9H 5HJ3B 1YPZA 4HT3A 5IBXA 1MVUB 1JGVL 5TDPA 4BK5A 1AFVL 1T1YB 1D9KD 3BISA 3FXIC 1DKWA 4Y9FA 1TZAA 4ODTL 3M7OA 4OQTA 4EIGB 2R2HB 4YHNA 4ERSH 4P46A 2OCFD 1L7IH 5L2KE 1UBPC 4QQ3A 4N2MA 5I16A 2DY3A 2D73A 5IVXE 3UP1A 4BQ5A 4JQXA 3JW7A 1L9SA 2QQKH 4UT6L 2Z6JA 3SPCA 3SKJL 4JB9L 1E6NA 3A9BA 5FYLL 1X44A 5D6CB 3ZR5A 1DWJM 3BG5A 1QSFB 3DIPA 1FCBA 3WLWC 1PHQA 3JWDL 2B5IB 4LIQH 1SXAA 3GSUB 2EYTB 2YBGA 1ZGLB 4Z0BH 5HHXH 5IMLB 2QKSA 2ICEB 2YIHA 3CZNA 3CE1A 1K9FA 1BFOA 4PSRA 4AK1A 3B5TA 3G04A 4H1LG 5IB5B 2PYED 2UZ9A 4IW4C 4NZRH 1MJ7H 4JJ5A 1E1FA 4HIEA 1KIUA 1FSKC 2ZSVB 2PP8A 5B38A 1RULL 2OMBA 1U8PA 3RVTD 3CUJA 4QGYA 4PL2A 5FIPA 3WQ5A 4XNBA 3VA2C 4RJEA 3P0VH 5I00A 1GIGH 1ZK5A 3QNYA 2XGZA 2A2QT 5FEPA 3R8GA 3TX9A 1GYUA 3PFRA 4HZ7A 1Z5LB 4PWEA 1AH1A 1DWAM 2VCBA 5FSEC 2DQTL 2YAOA 1PDYA 1TB3A 4X5WB 3GU9A 1DL3A 5FF2A 5F71A 4JFSA 4MMZC 2ADJB 2FSEA 1RPXA 2X9YA 5I1JH 1FGNL 5IOPB 1W3LA 2DWSA 5JPNB 5I06A 3ANYA 5HHOB 4JTCA 4UCGA 2HRGA 4QT5A 2QL1A 1NGQL 3F3HA 5C8JA 3OEXA 4LYRA 4XZHA 2VXVH 1G7IA 1JZHA 1NFGA 4N2CA 4V2XA 3SRDA 3OXSB 1R3KA 4IGBC 4XE0A 4AQAA 3UY8A 5JW5A 3FOLB 4JO3L 3T77A 3ULUD 1MZRA 3NJFA 1F3JB 3OR6A 1E8WA 1VZHA 2DJ4A 1XF2A 1RV8A 4QGCA 1KGIA 2GK0B 5D2LB 2EPMX 2PDBA 5CFAA 4RX0A 4K9EL 3NO1A 4XCFH 5BU6A 3QGKC 4Q6KA 3NGBB 5LWYL 2XGBA 4PCSA 4Y9CA 1RZFH 2XN2A 1TJHH 1C16B 1G94A 5DEFB 4JN1H 3IU3A 5IB1A 9PCYA 3QJFA 3D1MC 3E9UA 1IYXA 2X89D 4JYFA 1HSBB 1S9XB 2R23A 3FYPA 3N3EA 2DTML 1A8JH 3ZDXF 2PW1A 2BSCA 4K5MA 1RZGA 2XKNB 5A7BA 4HPYH 1W0VA 3LMJL 3T6CA 3RDTD 3O9WA 4PJAF 2WMJA 3HTLX 3LGDA 5F9WC 1E5YA 1M68A 5F1IB 1KNOA 2WXFA 5D70H 4JTHA 3BGJA 5KINA 1K8DA 5IRPA 3VFRB 2F9RA 3BLOA 5C54A 5FM4A 5E5UB 4C8XA 5IIEB 2PDCA 1NWTA 2HT2C 1RSCA 5E1HB 2VTFA 1HO4A 1E3XA 2JIXD 3IE9A 3PIQB 4AM0B 4HPJA 3ZL2A 4Z3JA 3T3ME 2EKSB 4ZNEA 2AMXA 3GBML 1XISA 5F7DB 5AW7B 2W94A 4Y19D 1XIBA 3KLDA 1NCDL 3Q01A 5EFIB 1FVCB 4G9FB 1FH8A 1GJWA 5DO2C 2EILB 4P23D 1HKLL 4CAGA 1A4LA 4M4PA 2GEEA 1GVRA 1V6UA 3C2YA 1T5WA 4U6XB 1Q0EA 3NABL 5LQBH 5GRUH 2HMIC 4QCEA 3JWNC 3MJ9A 3BLDA 1ZSDA 3V0VA 3U46A 5CAHA 5DRNA 3AS3A 1NKOA 2OBGA 4KKAC 3HNTL 4FNLH 3BSGA 5TDNB 3BARA 2Q71A 3N4FA 4B60A 4K3EL 4PRPA 4IS6B 5K9DA 2DLGA 4PN2A 3NFUA 4L37A 4AKPA 3QG7H 4KERA 4ZO9A 1S7SB 3BJ91 2PLMA 1TT6A 4M8VA 3SE4A 4WY0F 2JCCA 3VNZA 1EEXA 3HE7B 3PHOB 2E9MA 1F73A 2F53E 2D2CC 4DO7A 2GVYA 5I18L 1CECA 3LS5L 3BOFA 3CNKA 4OIAA 2B9BA 1O7VA 1VKXB 3W23A 4NZTL 1A22B 2D31A 4OFKA 1DPMA 1M41A 1V3MA 4OR1A 1WDPA 2WWMC 3SAZA 1ZHLA 2I24N 4ZEPA 4WO4C 2ESVD 1V55B 4MCYA 5FCZA 3FEMA 4BQ2A 3P14A 1UA7A 3B8WA 4U3HA 4RBPK 5J6SA 2A9DA 2K9FB 5ECJE 3KTCA 3UCDA 2KC0A 3GMNB 2PPEA 4UTBL 3MKGA 4AYSA 5CPOA 3VGFA 5BW7C 1I2RA 3CO8A 4WUUA 4TSAL 1OV8A 3KVMA 4LKXA 3TYFA 1OFQA 2DB8A 1UQSB 3N2OA 5GZNC 4X8GA 2ZRVA 3O6FB 2KLTA 3BXNB 2RH0A 3C60B 4FQXD 5CD5D 5ICZA 3FUDA 1KTLB 1RU9L 1T1WA 3B7YA 1SJCA 2J9YA 4KUZH 3CVIL 3LZQA 1UFUA 4GEIA 4PJFA 5E5LA 4NO5A 1EYEA 1XD0A 3FTZA 4BRVA 5C3TA 1X39A 1YNLH 1UZ1A 2YBRA 2A2IA 4KFZC 2I17A 2Y23A 4F3FA 1J8RA 1OGAB 3MODL 5KVGE 3LIZH 2ADGB 3V52H 4OH2A 4RZKA 3WI9A 1W0MA 2ZUQC 4YHGA 5E93A 1QSEE 3IDYB 3JWDH 3T40A 1OO2A 3C9NA 2P5PA 3UPRA 1E6PA 1O60A 5E09A 5K9QG 4R2GD 3V4PL 4ES8A 3SRKA 4FQLH 2NY5L 1DUZB 3ATEA 4O1FA 2Y7NA 2XM1A 4O1EA 1E7VA 2XYBA 2IH3B 3GSXB 4TOYL 4AGNA 2IQ9L 4ELMF 1GQNA 1PSCA 1QFEA 4J3OD 3VFCA 4QOKD 3RL1B 4ZFOB 1MDTA 4UINL 3CDGA 2BV9A 2UZIL 1MI5E 3RVVD 3D5OF 1WFOA 4P2RE 3D8MA 5DJAA 1XMEB 1SO6A 1KEGL 4RGND 3TNMB 1SJHB 1QVOA 4YWSA 1JZIA 2OXHA 3S5LG 3EBVA 4Q3MA 3BZ4B 3R89A 4Z2JA 3SJNA 3M5XA 5SWSE 4LLVA 3W9ZA 1MJUL 2R2EB 2NSXA 3LU2A 5JPMC 3QMTA 1RZJC 1FH9A 5I0YA 3ZT6A 2J4GA 4RV3A 2G50A 1NGWA 2UWEE 4DPAX 2FLIA 1PY0A 1JV5B 1HHJB 2Y8VA 4QSHA 3QG6A 4JFDE 3ARBB 5TH2A 1Z6JT 3LDBB 3H9YA 1BGAA 1E0TA 3GBLA 3EF7A 4Y4FC 2R6OA 3KBSA 3VA8A 5DRZA 4OFVA 4OV9A 3TJHD 3FU8A 5A7EA 3QYNA 4CCDA 1PYWB 3OZLA 4HQQH 4X4ME 3RUGA 1HH6B 3V5DB 1H1ZA 4WR3A 2OJZH 3BX7C 4DJDD 4YC2C 2NLIA 1TJ0A 4WDTA 4E4PA 1Q0YL 5D2LF 4A68A 4N2BA 3AIRA 4UAHA 2HT3D 1QK2A 3MRPB 1TWIA 2VFHA 2X7VA 2VDKB 3NYKA 4JJHA 5EEUA 1VA9A 4C58B 2HG5A 4PMZA 1Q0XH 1L6XA 2ZWLT 5BXFB 4MMZB 4HG4K 4O50A 2HWGA 2YD3A 5D1XA 4HUVB 4DN4H 3HGJA 3V5FA 4NM8H 1KSRA 4P2AA 1TSRA 2O92A 4MDIA 3L9RA 5C9ZA 1UD5A 3UZEC 1YY8B 3O6FC 4P59L 4DT2A 4ZUSA 4FNTA 2Y1HA 4AF0A 4TNGA 1R3IL 4OCXH 4XPFL 2KDGA 1IEWA 3HE6B 3TWBA 1I53A 1G7HA 2GAZB 1JRHI 3IS4A 1FZMB 4MGGA 1JL8A 2YZ5A 2J8FA 3VM5A 4U1LB 4AVHA 4X7TA 3L65A 4JHOA 4YHLL 4X60A 2CKSA 4EVNB 4TTUA 4Q6JA 2G5BB 2VVNA 3S2JA 2VRAA 5AYTA 4AJYV 1L6WA 1PUDA 1T4WA 1VEPA 2GW5A 3WNIA 3MO4A 3QDJD 3KR3H 1U8JB 2DQDH 1MKFA 1P1XA 4XX6A 2CBPA 4TQEH 4OLWL 4J28A 3MLVL 3H1ZA 3ZPDA 4QDMA 3TWCL 3V79C 5E9XA 4KKXA 4YE4L 5DRWA 4B5ZA 4R3SB 1SGKA 3HE6A 2JKEA 1JG9A 1TPFA 1AIZA 1PZ5A 2IDTA 1SUXA 3LLDA 3QC3A 1PS3A 1G6RB 4W4QA 3T3MF 2XDHA 1T6VN 1WCGA 3Q6GL 4U0RC 4F7MA 2J7LA 2H9GA 4PGDA 1CWVA 3U7WH 1ISYA 5FXCH 1RUAH 3DUUB 4IRJA 1LDCA 3EH4B 3L0GA 1JDEA 5REQA 1U8CB 4W1TA 5AW2B 5KSAC 3CZSA 5E1QA 1PMYA 1TQTA 2C9RA 4KKBC 1UM5H 1OW0C 4OLVL 1W56A 3CMFA 1MHPL 3A4XA 5H2ZA 3O6LH 4QXGL 3NSCA 4FB7A 1M3IA 4JHWH 4A8NA 3A3XA 2HLEB 4RIRB 4RCXA 3WLTA 4E2DA 4QOKE 2FX8L 1U95A 5GJPA 1E5UI 1VIWA 3BEVA 5DRZB 5EFDA 1JCMP 3NZPA 1IGJA 4X7CC 3CVDA 1B0RA 2KZBA 1PE1A 3GRWA 3GRBA 3S1WA 3N43B 2Y36H 4NI8A 1YDOA 3UXIA 3N04A 1CQYA 3RU6A 1XM3A 3GC2A 4LH8A 5DQDH 2M83A 4KHTH 2GBAA 3CCHA 5E2TH 1FXPA 3QQ3A 4GHRA 5LHEA 2BXYA 1JGEB 4E42A 2V67A 4WKFA 2FT8A 3NT0A 4TL4A 1U1JA 5IW1B 3LNGA 3LOTA 1PZUB 3LN5A 4NJ9H 3CBJB 4P7RA 4WUIA 1NAMA 4PB9H 1HP4A 4PV1C 2YRZA 1UZDA 1VKFA 2YLAA 3ATYA 4EN3D 3EG9A 3WEMA 3Q3GB 2OWWA 1GQIA 1HF6A 3CDGB 3M0JA 4G42B 1Z0MA 4OFIA 2APVA 3PBVA 4K38A 4M1CC 3RJOA 3TZVB 1WAAA 4JUTA 4Z7QB 1JV2A 2V8LA 1G67A 3C0LA 3WD0A 4YLQT 5EC1B 5AOJA 1MVFA 1QWNA 5AKQA 2OMWA 3ME0B 4PW3A 3IANA 3RUBL