1XGZA

Structure of the n298s variant of human pancreatic alpha-amylase
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDSHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase, pancreatic
publication title Structural and mechanistic studies of chloride induced activation of human pancreatic alpha-amylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 174
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xgzA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xgzA01
1XSJA 2YKKA 4KRUA 4MNLA 1I1WA 3VIGA 1CXHA 4M29A 2Q8XA 4C7DA 2E0PA 5AYBA 3RDKA 3WQVA 1FFQA 4R27A 5GQBA 5CQ1A 4AEFA 1BSIA 3OA5A 3W28A 3VSVA 2EABA 3F4VA 3QOKA 2F7OA 1GJWA 3MSGA 2EXOA 1H09A 3ARUA 1BVNP 3VGEA 3ZSSA 4HZ6A 1ZBWA 5ABGA 2X2JA 3VNZA 2BNJA 2WANA 1E6SM 2DT2A 2EJ1A 4IISA 3VMOA 1PZ3A 3AOFA 3KLKA 1CTNA 5I5RA 2E9LA 2NT0A 2PC8A 3SCUA 3CMJA 3U7VA 2Z1KA 2W67A 2WCSA 3WDQA 3ZJ7A 4H8UA 5HPOA 2PBGA 1UR4A 2X0HA 1KCKA 3K4AA 1B1YA 2DT0A 1X6NA 2CEQA 2G3IA 4EK7A 1UR2A 3MI6A 4FNTA 4C7FA 2WM0A 2VC9A 5CPSA 4HU0A 1LF1A 2VZVA 1W9PA 3AYSA 2Y2WA 3HG5A 3CUJA 4BQ5A 1UWRA 2V38A 1EDQA 5A2AA 2XHYA 3FHAA 1V0MA 3IJ9A 1XRVA 2WC7A 1PX8A 1O7DC 2W66A 4W87A 3RIKA 2UY2A 2D20A 3CMGA 1C8YA 1U33A 2HVMA 3TONA 4J27A 4GI6A 2YDQA 3CZNA 2VR5A 1BQCA 1S46A 3SUTA 1NP2A 1CXIA 1QNPA 2CITA 1B30A 1J0JA 3MV01 2BVDA 4D71A 1EOKA 4V28A 4F66A 2XN0A 5KZ6A 2VVNA 1V6XA 3A4AA 5DEZA 4UZUA 3SUSA 2YLLA 1C93A 3UEQA 1MXDA 2E9BA 3RM8A 4PMOA 1GUVA 4GIAA 2JEQA 3K8MA 2YFNA 1CXKA 3HN3A 1QNOA 2X1IA 2XJ7A 3ARYA 2CCRA 3EJQA 1QBBA 2DH3A 3PZUA 4OIFA 5A8MA 3WDPP 1HL8A 3MMDA 5HXMA 3VKKA 4FNPA 2Y8KA 3BVWA 3BVTA 4N0RA 2VZTA 2F7RA 3THDA 4W93A 1QBAA 3CZEA 2MANA 4LYQA 1GONA 3UETA 3JUGA 1XSIA 1QI4A 3CC1A 3RJYA 1M04A 1HX0A 2OSWA 2ZOXA 4FLRA 1WDRA 4J28A 5E9AA 2UY5A 3H54A 2O9OA 4A3HA 2GFTA 5JIWA 1JIBA 1W9DM 3CHEA 4FNSA 3A4XA 3KL0A 1R87A 4DO5A 1VEPA 5IFTA 2OYLA 4PMZA 2DSUA 4GZEA 3VUPA 2WK2A 3GH4A 3LXBA 3NJ3A 3MUY1 4UCFA 2XYLA 4J3VA 3KE0A 1OIFA 1QNQA 3EYPA 3WUEA 1RD6A 3VD7A 3T08A 5I77A 4MNMA 3A3HA 4V27A 5HNNA 2X2IA 1VEOA 1JFHA 1PBGA 2JEPA 3AMCA 1M03A 4WF7A 4JIEA 5E0CA 3WQ4A 1OINA 3AHXA 1C92A 1KTCA 4P8WA 1KGXA 3OZOA 3LXAA 3L4ZA 1TZ7A 1RP9A 1CGTA 4GQRA 2WW5A 1GOMA 2VR4A 3WDIA 2YIHA 4CN6A 4GI9A 1C91A 2GJXB 5JBEA 4UFJA 2DSZA 4CD6A 2EPNA 4U31A 1BLIA 3VGDA 1FH7A 3SCQA 2WMHA 2WHLA 1CWYA 3ZOAA 4NXKA 2QV4A 2E9MA 5JUVA 3WNNA 1OGSA 3BAIA 2DIJA 3AROA 4BF7A 3IAPA 3TTSA 2AOSA 1UKSA 1XCWA 1E55A 1CLVA 1LL6A 3AISA 1SR0A 4U5IA 3ZQ9A 1V3IA 1W1TA 1GQLA 2YL9A 3GM8A 4ZEPA 2EPOA 1UR1A 1JZ7A 5D8ZA 2W92A 4P7OA 1H41A 4DWSD 4BQ4A 4Z2HA 2VRQA 1W9XA 4GO9A 1VAHA 1JNEA 1NP0A 5IDIA 3ZIZA 3GXTA 4OUEA 4NX0A 5A6KA 3N17A 2XN2A 3VGFA 4MB4A 1TCMA 1XGZA 1KBKA 3WH7A 4J3TA 1GQIA 2JF7A 2WSPA 1UZ4A 4B9ZA 1H2JA 1UH4A 3BSGA 2PBOA 5A95A 3SIMA 5ABFA 1D7FA 3IANA 3N12A 3WNOA 1R85A 2XM1A 4IPLA 4JHOA 1TVPA 3WF3A 3W29A 4D72A 2CPUA 1TQUA 1GOOA 3QHMA 3SCNA 3D3AA 1QOXA 1HKJA 3ZT5A 1E40A 1UA7A 1XD1A 5I79A 2FHBA 2A3CA 2WYSA 1FA2A 1OGGA 3MMUA 5C8BB 3AZSA 1NQ6A 3SCOA 1JYWA 3LMYA 3PZQA 2F1AA 2WBKA 3TTQA 5A6BA 1JDDA 2Y5EA 1ITCA 5A6BD 3T2QA 1R46A 4J7RA 2J7CA 2WC4A 4U2ZA 4ZXLA 1GNXA 2DQXA 1UG6A 1LLOA 1WE5A 5FIPA 3VTRA 1J9YA 3AMKA 3ECQA 3L4UA 1KR0A 1GQJA 4ZFMA 4D6HA 2YL8A 1J0IA 2VCBA 4X9YA 5A1AA 3DX1A 2X05A 1W3LA 3AYRA 1HXKA 1HN1A 3B9AA 1UWSA 2J7DA 2BS9A 3ARVA 4OOUA 3M7SA 4JKMA 4Z2IA 3BMWA 1KBBA 3BXWA 1BGGA 3CZJA 1X6LA 2CHNA 1E5NA 1OSEA 1V0NA 1UH2A 4J3SA 4QFUA 1HF6A 3G6LA 3WUFA 2XSBA 4XZBA 3ZSTA 1OBAA 2V3GA 1BTCA 4KH2A 1G5AA 2DT1A 3K46A 1QWUA 2JIEA 3OGVA 3AICA 3VD9A 4S3JA 5CLTA 1W3JA 4AMWA 3WD4A 2ZUVA 5A8OA 3K8KA 3D51A 2QMKA 1OWQA 2ZE0A 2J25A 1QHPA 3T2OA 3CTTA 2F2HA 4D6CA 1QI3A 1BHGA 1GHSA 3WL0A 2WAGA 1D3CA 3WD1A 4AIOA 3EDJA 3VIIA 3D5HA 4MNKA 2EACA 4YHGA 1HIZA 3MU7A 2BVTA 3TA9A 3D4YA 1H0GA 1HKIA 2BHUA 4HZ8A 3VMNA 4MJ2A 1BYAA 4FNRA 1JD7A 3IK2A 4PEEA 2X2YA 3VSUA 1V6YA 4PSRA 4WSJA 4AZGA 1JGIA 2FDMA 1M7XA 4P7NA 2DH2A 1ZBKA 1BGAA 3SCWA 1C7SA 1UUQA 3BUBA 3RILA 1VEMA 4CKQA 4CU8A 5I78A 2WHMA 2V3DA 4GINA 2O92A 1G01A 1LL7A 3AHVA 5BCAA 5A6AA 4XUYA 2WLYA 3MUAA 2W4XA 3PTMA 3WFZA 4NZFA 1QI5A 3NDYA 3M07A 3GNRA 4IM4A 1WZLA 1GOWA 4AMCA 2E40A 4HOZA 4TXEA 1GCYA 4TTGA 1JI1A 4RE4A 1AMYA 3GXFA 3MV11 4FLQA 4UQEA 1CDGA 2CKRA 3MO4A 1HJSA 1UYQA 2GSJA 2J75A 1O7AA 2XFYA 2WMIB 2W63A 1UWQA 1JZ2A 4P8UA 1W3HA 1UHVA 4QCEA 3AQUA 5BYWA 5CPQA 4AYSA 3DHUA 2D23A 2AAAA 4HPHA 1GOQA 3LRLA 3NYDA 1BFNA 4Q7NA 3MSDA 3IJ7A 1ZBVA 3CUIA 2G4FA 3FXYA 1W1PA 1JNDA 3NDZA 3SCVA 4W89A 3W82A 1VJZA 3L4YA 5A6SA 2VL4A 4CCDA 3T2PA 3OBAA 1HT6A 5CSUA 4W8BA 5BROA 1UD6A 5EBAA 5M17A 3A21A 2J7EA 1P6WA 2WHKA 4CCEA 1CENA 3EBVA 3WUBA 1VFOA 3OLGA 4AIUA 1E43A 2WZEA 4TUFA 5ABHA 4CUCA 1VJSA 2ZX9A 2WPGA 1HTYA 4CVWA 3WQ5A 3AIWA 4JKKA 4AW7A 4CCCA 1J10A 2ZX7A 5E6YA 1CGVA 1G0CA 1UH3A 3QOMA 3BSHA 1HP4A 1Y7VA 3CUHA 3OIHA 2ZUNA 2GJXA 5CJ5A 4WKFA 5D9OA 1EIBA 4PCTA 3UERA 3L4VA 2F8QA 4B16A 1E9LA 3AJ7A 3D4ZA 2F7PA 4W7WA 3SUWA 1MW1A 3GYCA 1WB0A 4UR9A 3POHA 3BAKA 2CIPA 1W2PA 3WY3A 1E4LA 2YDSA 2XWEA 3WMCA 1SZNA 1DP0A 1FOBA 4HMDA 1QPKA 3VD3A 4WIWA 4RE2A 2ZIDA 1ZL1A 3AFBA 1V08A 3CZ8A 1B2YA 1MFUA 3OLDA 2GUYA 1MYRA 1MW2A 3NCOA 3EJRA 3EMCA 2ZXQA 3A4WA 3POCA 1Q6GA 4ATWA 1MFVA 3B9EA 2WKGA 3GXIA 4XX6A 2Z1SA 1GJUA 1E1EA 3CUFA 3CO4A 4F9JA 2YA1A 3WN6A 2YBTA 1JF5A 1M01A 1XC6A 3WF0A 1QNSA 1WZKA 3W27A 1EO7A 1Z32X 2YA2A 4AIEA 2VOTA 3M6DA 3VD5A 1HJQA 2VNCA 4A4AA 1E56A 2D0HA 4D1JA 2JFEX 1K9TA 2UWFA 4KGJA 2BXZA 1JI2A 3DX3A 5HBFA 4J3WA 4WLCA 3PBGA 2WHJA 2E3ZA 1FP8A 1B3VA 1XH1A 1E4NA 1U30A 3AHZA 3EJUA 3RJXA 1SFSA 2QHAA 3LPFA 1KB3A 5E6ZA 3W25A 4AZBA 4TX6A 2QPUA 1CXLA 4HA1A 4WJXA 3U5YA 1D2KA 3W0KA 1J0KA 1I75A 2PWEA 1TFVA 1W1YA 3O6AA 3MMWA 2W5FA 4M24A 4HZ7A 1H49A 2A3EA 5GNZA 1CNVA 3PZVA 5EFDA 3VDAA 5DMYA 3KL3A 1TG7A 2CBUA 1UZ1A 2PWDA 3LPOA 1ZB5A 1ISWA 3AI0A 4MJ4A 4W88A 5JBFA 1BVZA 3WBAA 1VFMA 1ISXA 1WPCA 4XV0A 3EDDA 1R47A 3WH9A 3N15A 5BRQA 2CYGA 5D9MA 4NI3A 3N13A 2VQUA 4UQBA 2BY0A 1BF2A 4AC1X 3PTKA 1CZ1A 3CHCA 5A8PA 2VZOA 1UKOA 4QCFA 5JBDA 2Y24A 3BUQA 7TAAA 2EPMX 2ZX6A 4CD7A 3N1AA 3BLPX 2F61A 2VVSA 3VIKA 2D22A 4X0VA 2WCAA 2VURA 1SYTA 2WB5A 3CHFA 3SCSA 2OLHA 1PX4A 3WSUA 3TTOA 2J4GA 5IHRA 4B9YA 2TAAA 3MS8A 1UKPA 2WVVB 3AIRA 4W86A 3HZ3A 2X2HA 2WKLA 1NOUA 4U3CA 3WNLA 4HMEA 1HP5A 1HWWA 4MB5A 2QMJA 3WF4A 1GQKA 1NWUA 1B3YA 3A5VA 3CV5A 4JAWA 4PUDA 4JZ5A 2F18A 1I1XA 4DUWA 1HKMA 1A47A 1TR1A 1XD0A 2WVSA 4PMQA 2G3MA 5FL1A 2XVGA 2XTKA 2XIBA 3AS1A 3DYMA 4AZHA 1MW3A 3CZLA 3D52A 2O9RA 1DWHM 3UG5A 1KTBA 3H53A 3TP4A 1EQCA 2HISA 5IFPA 4WSKA 3I3DA 3PZ9A 1HVXA 1UD8A 4D6DA 1Q6DA 1J11A 1B90A 1CLXA 3O2LA 2OSYA 1NM9A 2A3BA 4AZCB 4KRTA 1CXFA 1H3GA 4OJYA 2CBVA 1WDPA 1GVIA 2PWHA 4QAWA 3VIFA 1E1FA 3ARQA 1IV8A 4AXNA 1EQPA 2ZXDA 1UD5A 3FNDA 1WDQA 1UOKA 4HTYA 3EDFA 4E8CA 2DGAA 1Q6CA 3I3EA 3ARZA 1UASA 2VO5A 5CGMA 2RGLA 1JZ3A 3HJEA 2ZUUA 1V02E 4NSBA 1KXQA 3L4WA 4E4PA 2G41A 3EMQA 4JFUA 1LL4A 2GK1B 4UOJA 3WQWA 4BCEA 3WDJA 3EMZA 2ZWZA 1J18A 4M80A 4V2XA 4HU8A 3F5KA 4TVDA 1KQYA 4R5EA 2X09A 1UWUA 5KEZA 3PZOA 4PTVA 1OD8A 4AISA 1TQTA 2WMIA 4UFKA 1BG4A 2V3EA 5FL0A 2WVUA 2WBGA 1KGUA 2O9TA 4GPNA 3VPLA 1IT0A 4AMXA 1W9BM 5FCZA 3S5ZA 3WD2A 2CHOA 2AMGA 2XVKA 1QNRA 4M8UA 1GOKA 2EPLX 2G3JA 3NSNA 1QHZA 3BAJA 4MDOA 1QI0A 2JIWA 4LYRA 1V3LA 5LYRA 4BA0A 3GH7A 4Q22A 3K8LA 4C7GA 4Z2LA 5C71A 3WEZA 1K9EA 4M1RA 4NRSA 1E0VA 4GZIA 4B15A 1V6VA 3BUPA 4AD2A 2GVYA 2D3LA 4FMVA 2WLZA 2D73A 3WDHA 1B9ZA 1CBGA 1XYFA 1FHLA 1XSKA 1NWTA 2WWCA 1E0XA 5BXPA 2J62A 4AYGA 4Z2GA 2W91A 3SCPA 1E6ZA 4HA4A 2NSXA 3BAYA 3A23A 9CGTA 1H11A 2VT0A 1ODZA 1UQYA 2ZUTA 3VIPA 1EHNA 1JAKA 3VGGA 3HU7A 5GNXA 3CUGA 3LPGA 3WNMA 3PZMA 3F5JA 3GBEA 4H8VA 4AY1A 1AQ0A 1V03A 2UY4A 3ZJ8A 1FH8A 2DSKA 2J47A 1AQMA 3GXDA 1NOWA 1UKTA 2GJRA 4H41A 3VINA 3W6LA 2WMGA 3RM9A 3PZNA 5EFFA 2CETA 3EJSA 1KGWA 1CPUA 2EQDA 1ZU8A 1Q6EA 1EO5A 1XV8A 3KZSA 3WD3A 1V6WA 6A3HA 4BZYA 1KWKA 3AHTA 3WY2A 5AC5A 1H4PA 3W38A 4ML4A 1DHKA 1TE1A 1WO2A 2DPEA 2JALA 1CGYA 4URIA 3CZGA 2J8FA 4YPJA 5CPTA 1E6NA 1V3MA 4E2OA 2YL6A 4MAVA 4FLOA 4XB3A 3ZJKA 4W85A 3RO8A 3BAWA 1OM0A 2F7QA 4AZ5A 2ZX5A 3AIQA 4HOXA 1TQSA 3BC9A 2WVTA 4DO4A 1US3A 4IUGA 3ZMRA 5ABEA 4GXPA 3GNOA 1MW0A 4MDPA 4MNJA 3RPMA 3FHQA 4D6EA 3OLEA 1Q6FA 2OWXA 5D9NA 5M3WA 1TQVA 3WY4A 1HXJA 3W53A 8A3HA 3W6MA 2WCGA 3ZT7A 1GPFA 1PAMA 4UNIA 3AS2A 1B0IA 2FE0A 2ZUMA 1QW9A 5CG0A 2BHZA 5EB8A 3A47A 1JZ5A 4OKDA 1JYXA 4UOQA 3FN9A 4TOQA 4UFIA 3ARSA 3UG4A 3AXHA 8CGTA 3GH5A 3LRKA 1CGXA 4UFLA 2XFFA 1V0LA 3PTQA 4QP0A 5GNYA 1BPLB 3WUGA 2OW7A 3J7HA 3TTYA 2GDUA 1PIGA 5EMYA 3VDBA 2OW6A 3BAXA 2J7FA 2VTFA 1J0HA 2GJPA 3ALFA 4ATDA 2IGTA 1WKYA 2OWCA 2D0FA 4U2YA 3SURA 5CLWA 6CGTA 4N42A 1LWJA 3K4DA 2IXVA 3ZR5A 1OIMA 2WZIA 2XSAA 1E15A 1XH2A 2RGMA 1SMAA 4ZXOA 1K6AA 3PN8A 4DWSB 4LX4A 1VF8A 3T0DA 4PMXA 3ALGA 1CYGA 4JCMA 5A6LA 1E70M 4UQ9A 3AIUA 4JL1A 1VBUA 4PMYA 4CN1A 4J3UA 1CIUA 1VRXA 1LQ0A 2PF0A 3UR8A 2EEXA 4CGTA 1F4AA 5DT7A 1XH0A 4U33A 1BAGA 4DM1A 4P7LA 1DWAM 5D4YA 2WC3A 1E6QM 2WVVA 2E4TA 3UG3A 2XUCA 1JF6A 1FP9A 2DDXA 3WH8A 5F7UA 1XCXA 2EO7A 3K1DA 1PEZA 1UWIA 4U5KA 2BY3A 1JFXA 3CH9A 4PMNA 2CBJA 4NF7A 4WKHA 3A22A 5A94A 5CSYA 1WP6A 3BUDA 2PB1A 2B31A 4OOZA 4ZE4A 1JYVA 3II1A 1PPIA 1LJYA 6TAAA 3U7BA 2ZXAA 4ACZB 4JCLA 4CVUA 1TQWA 4CD4A 7A3HA 3HG2A 3AXXA 2EADA 3BUIA 5A8QA 2FH6A 5HDRA 4H2CA 3NSXA 3W81A 3EDEA 4UFHA 4F9DA 1XHGA 1VIWA 2ZWYA 1NARA 4AZCA 2YDRA 1CECA 1E6PA 4P7RA 1HJVA 1X1NA 1DEDA 2E8ZA 2OYKA 3WIJA 4D6GA 3DDGA 5DT5A 4LPCA 3THCA 3NIYA 3VILA 5E0FA 3WY1A 4IPNB 3AMDA 2V5CA 2G3NA 5A6JA 3WKZA 1JG9A 1V3KA 1MQRA 3DHPA 2BY1A 1W9VA 2G8ZA 2E8YA 3AIBA 2WZHA 5A2BA 4TX8A 1EA9C 1QI2A 4MAZA 1EHAA 5E70A 1C7TA 3MUIA 5AYIA 3VX1A 2VQTA 3FAXA 2OWWA 3WNPA 4UTFA 3EDKA 2D24A 1GZJA 2PWGA 2ZICA 2J7GA 3VGBA 3O9NA 2DIEA 3DX4A 1E6RA 1UKQA 1E3ZA 1MXGA 3BCFA 4GQQA 2GK1A 5LA0A 1OB0A 4F79A 3S6TA 2XVLA 1OD0A 2QPSA 1HNYA 4HMCA 3SCTA 3KWXA 1UR8A 1C8XA 2BHYA 2CESA 4YN5A 1HVQA 2ZUWA 3TOPA 5I0DA 4EE9A 3VVGA 1TUXA 3BH4A 4DUVA 1RPKA 4TTUA 4PSPA 1ESWA 3GXPA 3SEPA 1G9HA 1BYCA 4XZWA 4UOZA 3DX0A 4UQCA 1QW8A 1E73M 3D50A 1KXTA 2QF8A 2YJQA 2VZSA 4FF5A 1UD4A 3FAWA 3H55A 4AZ6A 3EJPA 2DSVA 5A2CA 3BLBA 1ZJAA 1JD9A 4HPGA 2VCAA 2OSXA 3CHDA 2O9PA 1AQHA 1BYBA 4FLSA 1B31A 2CNCA 1NWRA 1R7AA 3MKKA 2Y4SA 4Y7EA 1JAEA 3VNYA 1DWGM 1PZ2A 3PZGA 1PX3A 3VU2A 2C7FA 3CPUA 1EH9A 1UWTA 3BVXA 3UCQA 1XYZA 4DM2A 5DFAA 3WH5A 5I6SA 1H5VA 1AVAA 3ARTA 1J0YA 1ISYA 1CGUA 1UA3A 4ATLA 3W37A 3U5UA 1JDCA 3IJ8A 5CXPA 2XG9A 4QLKA 3RCNA 1W3KA 3RMEA 4AD4A 1QWNA 5A69A 2OYMA 2VMFA 3GZAA 1L8NA 4D6FA 3ARPA 4W5UA 3NSMA 3LRMA 2Y8VA 3BLKA 3VIOA 4HOWA 4W8AA 3T09A 3AZTA 5BWFA 5AY7A 4AD5A 1JXKA 2WMFA 3OGSA 3B9DA 1UD2A 3DECA 1NH6A 2EBNA 1TA3B 4KGLA 4LYPA 4QDMA 4DUXA 1HJXA 3VIHA 1JZ6A 5DF0A 4Z2JA 2NT1A 2WMJA 4PMDA 4D6IA 1CXEA 3A6OA 2J78A 1B3WA 1T0OA 2V3FA 4CU6A 2WMKA 2CXGA 1C8QA 4TVUA 1GVYA 2VRKA 2V5DA 3ZJ6A 4GO8A 1R7OA 3W4RA 1W9UA 3VMPA 4CU7A 1GHRA 4EKJA 1QX1A 5GPRA 1E3XA 1G94A 1TMQA 1CGWA 3UESA 3F5LA 2JF6A 3BCDA 1BYDA 1ZBCA 3W24A 4CD5A 3GBDA 3AMLA 1YQ2A 4PTXA 3HG3A 1JYNA 3WD0A 3SCRA 3E1F1 3OB8A 1ZS2A 2DEPA 1F4HA 4M82A 4JFTA 1HKKA 1OT1A 5LA1A 1UQZA 5AC4A 4QLLA 3AHYA 3AIEA 3DDFA 2FH8A 4NZJA 3HMCA 1EDGA 1TVNA 5TD4A 3KEHA 2ZUSA 4WK9A 4OBSA 3WF2A 4UQAA 1LG1A 3ZR6A 1K9DA 3VX0A 4AZIA 2WSKA 2FHFA 3BVUA 3AZRA 3L4XA 5BXTA 1E0WA 4J3XA 4TVCA 1R8LA 2FGLA 3RM4A 3S5YA 1OT2A 1DWIM 2ZX8A 1UD3A 2C8NA 3WMSA 2C0HA 3IGUA 3S2CA 5CGTA 1R75A 2YL5A 3QHNA 4OZOA 4GZJA 4AZ7A 1PS3A 2XGIA 2X8RA 5E1QA 2JE8A 1EXPA 4M81A 4PTWA 1ITXA 3ARRA 4KMQA 2A3AA 4AD1A 4W7UA 5HOSA 3N04A 4BS0A 3OG2A 3VD4A 3U57A 4PMVA 2WXDM 4L4PA 3AXIA 1R33A 4H8HA 3G6MA 3WELA 1HJWA 2BVYA 2PI6A 1JL8A 1U2YA 3AIVA 3QR3A 4DWSA 1FH9A 1KCLA 2BV9A 1FFRA 3CLWA 4B3KA 3M46A 5IXEA 1LWHA 4PUEA 1GW1A 2J7HA 4HA3A 4AD0A 5D9PA 4UZSA 5BRPA 2ZXBA 2XWDA 2NW0A 2VZUA 5FD0A 3OZPA 3LPPA 5D8WA 1JZ4A 4W7VA 4PCSA 1ZJBA 2CKSA 1WZAA 2A3HA 3KL5A 5I23A 2YOCA 2BY2A 1J01A 1B3ZA 2VX5A 2W61A 1VBRA 3LX9A 3WQ6A 3BVVA 1WZMA 2XVPA 3DX2A 4PBGA 5LA2A 1FHDA 1V0KA 5ECUA 3GTNA 2D3NA 2FHCA 4FK9A 5DO8A 3PZIA 4NZCA 5FOOA 3ARXA 4P8XA 1E72M 2VJXA 2FGZA 1IZJA 1K9FA 3IAQA 4JFWA 1H1NA 3VM7A 4ACZA 1WNOA 3GXNA 5I24A 1VB9A 3ARWA 3VM5A 1E4IA 3N11A 3AS0A 7CGTA 1ECEA 3CBWA 1LG2A 4DWSC 4JKLA 1EOMA 2WWDA 5A3HA 1RH9A 4PMRA 4MADA 2WNWA 3MUZ1 1KXHA 1PIFA 1MWOA 4MTVA 4PRWA 3WDRA 1UR9A 1L0PA 4U3AA 4JFVA 1WDSA 1B3XA 3WQ8A 4LQ1A 1J12A 2YBUA 3GNPA 1JZ8A 1NWSA 1US2A 1MQPA 3FW6A 4RL3A 1VENA 4ZE5A 2PWFA 3WF1A 1OCQA 3OLIA 4MPKA 1M53A 3VDCA 4M56A 1E71M 1R86A 1VFUA 1J0ZA 4W8LA 4LXFA 5I3DA 4L4OA 3FY1A 3A24A 3I3BA 4AD3A 4AEEA 1V6UA 1KQZA 2VX7A 2VCCA 4Z2KA 3WENA 4EAMA 1GOIA 3WEOA 4ACYA 3AMGA 3DYPA 1KR1A 5C70A 3VSTA 5IHSA 1EGZA 1HL9A 1MQQA 5E09A 4LGXA 1QVBA 4F8XA 3ZO9A 2VRJA 2XVNA 1W2VA 2J7BA 1YHTA 1BG9A 1R34A 4CD8A 3CZKA 1V02A 2J8GA 1SMDA 1OGBA 2ESCA 3CZSA 3MANA 2GDVA 3WL1A 3BGAA 2QLYA 4KWUA 3PZTA 2CBIA 4D1IA 5JIPA 4QLJA 1E4MM 2DSWA 4GI8A 4A3YA 3VOCA 2BFGA 3N9KA 2DT3A 2W62A 1PJ9A 2X0YA 4UFMA 1MVYA 2EPKX 3L2LA 2IXUA 2XGBA 2YLAA 3N18A 5M03A 4D6JA 2XIIA 4HP5A 1W32A 2D1ZA 2VX6A 3QHOA 3VIMA 3WFLA 1G1YA 4PYSA 2VI0A 4B3LA 4NRRA 4W84A 4NXSA 2YFOA 1ISZA 1V3HA 3KLLA 3APGA 4JL2A 4RE3A 3DYOA 3WEMA 3DC0A 2J74A 5A8NA 5M5DA 2IUZA 4GKLA 2FYVA 4FNUA 4H04A 3VO0A 1ODUA 3LXCA 2XPKA 3HG4A 3AS3A 4P8VA 3WMBA 2UY3A 4CN4A 1CEOA 1WCGA 5FKYA 4BQ3A 1DWFM 4YHEA 1JXJA 1RP8A 3W26A 1KXVA 3EJTA 4OBRA 3VGHA 4S3KA 1Q4NX 3BMVA 3GXMA 1W1VA 3L2MA 1VFFA 4ZENA 4MB1A 4K68A 4AWEA 2VX4A 3ZT6A 3B8SA 3T0BA 3VIJA 4EANA 1GORA 1KFWA 1A3HA 1QHOA 4UQDA 1C3FA 2J79A 3QGVA 1TA3A 4PTMA 4JHZA 3CGTA 4FNQA 4PN2A 2XM2A 1H0IA 3SUUA 2D0GA 2J77A 1NOFA 3T0AA 2VUYA 4BQ2A 4E8DA 1DTUA 2YA0A 5HPCA 1V3JA 1E6XM 3ZM8A 4X0NA 1EDTA 1N82A 2F1BA 5ABFB 3UR7A 4W5ZA 1DWJM 4WKAA 3VDHA 2BXYA 5CZKA 1HJUA 3SUVA 3OGRA 3NUKA 5BXRA 2ALWA 5I2UA 1C90A 4P7QA 1WAWA 1O6IA 2EAEA 4DO6A 3CIVA 3TV8A 3WNKA 2XN1A 3WH6A 2D2OA 1E5JA 1UR0A 1W91A 4JFSA 3GDBA 1KWGA 4MB3A 4OGZA 5A6MA 2XFRA 5BXSA 4PMUA 2CERA 4H7VA 1ISVA 3PHAA 1IZKA 1JDAA 3WBEA 3L4TA
chains in the Genus database with same CATH superfamily
2B5IC 2CLMA 3L7RA 5EU5A 4MNLA 5E9NA 4JREC 3FU5A 2FJFA 1N6QH 3SYAA 4Q4KA 5D2LA 3T0WA 2C0AA 2ZUQB 1GVQA 4PS3A 3RUGE 4KK8D 3FQXA 3MRQB 2EVFA 2UYLA 2Q76B 4K4KA 1ZA3A 4XVSH 2ZRUA 2FEEI 1WKDA 2NT0A 3HE7C 5EMUA 2BVOB 5A6IA 1KCKA 1RKRA 2IPUK 1UR2A 4PRIA 4YFDB 3FUNA 1SVDA 2NYKA 3K2IA 1GGOA 1GA2A 2V38A 3ULUF 1Z9OA 3WUWG 3V6ZB 1AZCA 5DCEA 2JJTA 4YBQC 3M1BB 2BERA 3IJ9A 1R3HA 3OAUH 4OGXH 4HWEH 5ADPH 2ESVB 2HVMA 1BD2E 2LVCA 3OX8A 4I0CC 2KT6A 1QRKA 4AVFA 3MLSH 4WV1C 4N4PA 2BNRD 1JRHL 2L04A 2XN0A 4M6NL 3ABQA 3RFZB 3LV3A 1S9XA 1D9KC 3TYDA 3EW3B 4R85A 1V7YA 1SOKA 1MVFA 1EJTC 3H8NA 4PM1A 5CWSB 3VGAC 1TB3A 3QAZC 1LOSA 4XMZA 3KPPB 3MMDA 3SZKC 1SEQH 3BVWA 2VZTA 1SZGA 5ALCH 4YS4A 3JUGA 1CF1A 3C08H 1RK1A 5E2JA 4XCCH 2Y61A 5FM4A 4A3HA 3DCPA 1OTUC 2VFHA 3A4XA 4PMZA 4LEEA 2XYLA 3EYPA 1URIA 3BE1L 3M0XA 4U6XA 4YIWA 4M02A 4JBRA 4B0MM 4YDKL 3HS0C 1TZ7A 4P59L 1MRCL 3B34A 2EKCA 3HNTL 4QT5B 2DZEA 4KETA 5GSRA 3G04B 3ZYIA 2EPNA 4JTUA 4HK6A 4N22A 4JQXA 1WFNA 1CLZH 2N01B 1EWDA 1I7TA 5BOPA 4P5MB 2X3CA 1RALA 4NP9A 4XPFL 2XXGA 5ANMA 2H3DA 1PY4A 4HKJB 3OR7A 4MWAB 1W1TA 4J9JA 3OJMB 3UR2A 3KYKH 2DQ6A 3REWB 1JNEA 1NP0A 5IDIA 2SFPA 2XUWA 3VWKA 2CZDA 1OSYA 3UJJH 2AF2A 1ES0B 2J88H 4PCYA 2FEDC 3JV4A 3ZKXC 1UZ4A 3VFOB 1R3WA 2J56A 2XJKA 5A95A 5DJYA 3IANA 4IPLA 1JVKA 2B3RA 2X4QB 4HHHA 3L0KA 3SYOA 1S9WA 2YOAA 3UMNA 1KDJA 3ME0B 3PNUA 4NZUH 1E5UI 5AAWC 1XDLA 4HJSA 3IPEA 3ECQA 2Z7WA 1L6YA 1I7UA 4PJ9B 4GAYB 4X99B 3HQPA 3TN0C 1VRSA 1NFKA 4PUMA 4U0QB 5CPNA 4G71B 3EFOB 3WMLA 5IV2B 3ARVA 4K3HA 3JT2A 3F2BA 2DJ4A 4LWWA 1KCSL 2LOEA 2DKUA 2VMDA 2Y0SA 5I0WA 4F2MA 1OVDA 3F5WA 4A6YL 3TBSA 4I4WA 3TC7A 1UH2A 4LUIA 2OX4A 3G5EA 1M65A 2A85A 3BZGA 1DUYB 4J3OD 1DJSA 3VD9A 2O6EA 3GI8H 1XCTA 4Z3JA 2IPJA 3D51A 1L0XA 1A5FL 1Q0XL 3UTPD 3T3MF 2F2HA 3DNKA 3M1CA 2J8TA 4JG1H 4CRPA 3V6OA 1ZLSH 3LNMA 1U8KB 4HIEB 4MNKA 4YHGA 4IOSA 1JZJA 3NPXA 1CICA 2X9XA 1OEPA 2ITCB 2CO1A 4FNRA 3UQNA 5SWZD 4AZGA 4YTSA 5H37G 3PP4H 3WLJA 2A7BA 4LCYB 3H85A 3BUBA 4MXQC 1K8XA 2IPFA 2Z4QB 1SHXA 3HZYA 2Z27A 3MUAA 3PTMA 3E5PA 4KXZI 5CBAA 1BEYL 4N68A 3GNRA 4MJHA 1AR1B 2QHRH 3BE7A 2WV3A 5BUGA 1IR1A 1CDGA 3A4FA 1MUJA 2IAMA 4U1NB 5E7FA 1FPTL 1UWQA 2APWA 4UMBA 5BYWA 4DBDA 2E5EA 3NYDA 3VCLA 4IIBA 3K72A 4J3OH 2KBGA 2DEYX 2Q5BA 4IRSA 3H26A 4OM0H 2E7LC 1WUEA 2XZCH 2PMQA 4FS0A 2YAEA 1UD6A 1NFIB 2I27N 4TVPL 4AK2A 3MT1A 2INFA 4U3XA 2WZEA 2W8CA 1C9DA 4FZIA 3LA4A 5FYJE 4MGGA 1HP4A 4NQ1A 1OZUA 3S36L 4WKFA 3HQOA 5D9OA 5E6IB 1NFGA 5DLML 1BXAA 4W7WA 4CEXC 1HGYA 3AGVA 1MW1A 3BD5A 3GSNA 3ZHNA 3QIWC 2Q20A 3GD6A 1Z42A 3TCLA 3W1PA 1W2PA 1ORSB 4PP2A 4LS2A 1A6ZA 1RK7A 5CF3A 3EADA 3T8VA 4DGIL 3LHUA 2ZC1A 3O8XA 2WLLB 3IDGA 3VJ6A 1B2YA 5MEOB 3S1GA 2VQ1B 5L6YH 2CG9X 4NUGH 4XX6A 1GJUA 1Y1DA 1N3NA 3LHPL 2WNZA 2HT4C 2A9NL 1JPTH 4I9XA 1M01A 1QNSA 1WZKA 4XP9L 1ZS8A 2OULB 1HJQA 3DX3A 2VLJA 4C56E 1U30A 1M9WA 2XWBA 5JW4N 5C07B 3S37H 1I75A 3FA3A 1QUMA 5ERWA 1EJFA 3T4WA 5KZDA 3VXPB 5HMDA 3GVVA 5GNZA 4B2DD 1JNNL 4XCFH 4HF5L 5EFDA 3L9YA 2VW6A 3RN6A 3KS0J 1ZB5A 3NM3A 3D2UD 4HU2A 1ISXA 5EWIH 4XP1L 2PTYA 4ONFL 4K2SA 4DGVH 1BX2A 4K8EA 1TJIH 2VQUA 1OAXL 3DSFL 5J13C 3MXWH 3WTYA 4F2UA 5F6IB 4WI2A 1R3TA 4TO8A 2E27H 4F24A 4Y88A 3PP3K 1F61A 1ICPA 3VQ2C 1RUPL 2OLHA 1PX4A 2XJLA 4ICXA 4HT1L 5TF1H 5HR6A 3QI9B 3D69A 4Q4MA 3KPSA 5L2JA 2JXMA 3LSOA 5EGRA 4PB9L 1ZFJA 1RVKA 1B3YA 4A6YB 4IIGA 2FD6L 4JFFD 2QIIA 1XD0A 5J6HA 1XS2A 3IJEB 4HS6B 2OTPA 5JPNC 3PIQA 3TP4A 4LHUD 4CQ8A 3NPWA 1WXJA 1CLXA 2OSYA 4IBZA 2X40A 1OLLA 1A5BA 1JK8A 4OJYA 4RW3A 3F7JA 3FQ1A 1FY6A 2Q8AH 4UTUA 2Z31A 3PAUA 4KX8A 1UOKA 4RNJA 1Q6CA 5DJ2B 1TPH1 4N0UB 2X4TA 5EC2B 3VH8A 2VDKH 3O4LB 2A2IA 3WXWL 3EMQA 4QHUA 3L12A 2IADB 1LL4A 1AD1A 5H94B 1P0DA 2GWNA 4V2XA 3VXNB 1SM3H 3W1MA 1ZT4B 4KQ4H 5LGJA 5DCCA 2QTEA 1BG4A 4M1GL 5IF0A 3VPLA 1TZ9A 3RDTC 5FCZA 4LVAA 5F9WC 3FXIC 1OCCB 3ZZ1A 4L0ZA 1C1EH 1X5ZA 4GUFA 2RUSA 3ZXAC 2WQPA 3RGVB 5CAYB 4EUPH 1MHHB 2EPLX 3NQAA 3ZQXA 4YIQA 3CPGA 1X5KA 2MSPA 4KS0A 3BUPA 4FQLL 4FMVA 2HVKB 1WBZB 3TH2T 4JEQA 4A21A 4N6EA 3IXAB 3S3DB 3ZK0A 3MNWA 4AYGA 4PE8A 4KKXA 1ODZA 4FQ1H 4KVCH 3EZ4A 1NGQH 2EINB 2NSQA 3LPGA 2FB4H 3D46A 43CAB 2HVNA 4OCSL 1P1MA 2BVQB 4YBLC 1NOWA 2GJRA 4J1OA 3W6LA 1XYLA 4N28A 1BP3B 4H13C 3ID7A 2OV0A 1Q6EA 1B88A 4P06A 3S37X 2Y1ZA 1OAQH 3WIIL 2Z2AA 1Q45A 4MYWB 3W38A 4ML4A 4D9LL 4C4BA 2JALA 3CZGA 4AEHL 4YC2C 3LCFA 1DQIA 5M1TA 3KDNA 3W71A 3BAWA 4AZ5A 3BC9A 3CLFL 1EZWA 5JW4R 2FSDA 3UPRB 3RPMA 1DQVA 2P8LA 3LNDA 4A05A 4NZ4A 5FEWA 2IWKA 4UTJA 3NJMA 4JQ4A 3D6NA 4KKQA 1OB1B 1ACXA 5CM1A 3GE7A 3G6AA 3KWTA 4O51B 1GTNA 4IK7A 4BUQA 1PIGA 3HRPA 5DS1A 3AY4C 2J7FA 3G24A 4ROQA 2F53B 2YAFA 2EH8H 1CE6A 2XVBA 3MBWA 1EAQA 3ZR5A 1OX4B 2DQGH 1A3RL 1E15A 4U6VH 4HXAH 2FMNA 3RWGA 3ALGA 1SZRA 4JCMA 5GRVK 3MYZA 3V4PH 3FH8A 4PRHA 4Q4EA 4L18A 4QF1A 5D1XE 2NR6C 2ZA1A 1IBGL 3F00A 4U5KA 3N2CA 3HFML 5CSYA 1NFAA 2W9EH 2ZKHL 3KCPB 2P47B 3BG5A 1LJYA 4UTWA 4YLWA 3P60A 2ZXAA 2YCIX 4N85A 4CD4A 2REQA 3LXUX 1LNUA 4UTBA 1UB3A 4LCUB 2VKXA 2JTYA 1SN5A 5G5IA 1MCFA 3MRFB 2OYKA 1RA0A 4HEPG 5K39B 2BOEX 1KBIA 2ID5A 1G6CA 5MHSD 1V3KA 1XIMA 5F7FA 3JXAA 3G8RA 5IB2B 3RJOA 4OBTA 4X80H 3AFLA 5M2FX 2FUTA 3VFRB 3N42F 1B5TA 4JPGA 3CEPA 1WV7T 1KM4A 2NXIA 5G4HC 1QPRA 3A0OA 2GK1A 4C91A 2OZ4H 1I9RL 2KLRA 2WQDA 1OCBA 3QMRA 2IALB 4JK0D 4FI8A 3FGCA 4JDTL 4DEUA 2JIXB 3W7NA 4DYEA 1XRSA 3M44A 4UTKA 3BXNB 4Q2ZB 1ESWA 1QRNE 1G9HA 1YC8A 3LHVA 4MJ6A 4JO1H 4ZUUB 1E73M 5I8KH 5T3ZD 2AJSH 3KPRE 2E7CA 3JWOH 4D9RD 3ZUCA 5F1NB 3BSZL 1P5UB 1N6UA 1IQWL 4KJWD 4BH8B 2HTKD 1VLWA 4DN1A 4GBXB 2YX0A 2PXYD 1VGEL 3Q67A 5C7XL 1QLEH 1CGUA 1UQSA 3GDRA 4OCNC 3RY6A 4ESKA 1W8OA 4IRJC 4X6EA 3RCNA 4P23B 1A6AB 2A74A 3PABA 5I5MA 1H6TA 3LY0A 4JQAA 5KS9B 4XO5A 1UWXK 4LSTL 3T09A 3HI6H 1HZHL 2V2WB 4GC4A 4BGLA 4Y4KB 3L9EA 1NH6A 3QGKC 4XAWH 3KVPA 1G6RH 1A7RH 2CXGA 4JY5H 4XD3A 2NX5B 4GNKB 5EBMA 4KZDH 3R19A 3VG0L 1N4XH 2NUYA 3B0UX 2GABA 5BUAA 3ZVHB 5JUEH 1MNNA 3SDDD 4PTXA 1TG8A 5IEHB 1UC6A 3WD0A 3TZVD 2R2EB 5DHDA 5AC4A 4WO4D 1GZHA 1U3HA 1OM3L 3KDMA 5CSSA 3CVBA 4DP9X 2ALRA 3AO0A 1J8HA 1Q7QA 1XCQB 3MUGB 2WSKA 3TSBA 1G6VK 2GI0A 5HANA 1JRBA 1F11A 4OD1H 3ARGD 3G77A 4O0KA 4BK5C 1CK0L 2J9ZA 2X70A 1K7EA 5CGTA 4HZAA 2A6KB 3ARDB 1BD2D 1TPFA 4AM0B 1L4IA 4OB5L 1F58H 1O5QA 2XGIA 1HEHC 4KZEL 3IDYC 4DKEH 1M7UA 3TJEL 3DJTA 3ILQC 1WAAA 2Y36L 3OG2A 4ODWA 3MA7A 3GU1A 5EMJA 5TE7L 2W0PA 1KF9B 3C5QA 3G9AB 2BV9A 1FFRA 3D87B 4RRPM 3LS5L 3QEHB 2WXHA 3ZTDC 5E8DL 3BZEB 5KSUA 2PLKA 1H1ZA 3QYMA 4OTKA 1F90H 3H3BC 4P3CL 2XBDA 2NW3A 3VXQB 4N8PA 4WUKL 1BD0A 3GTNA 4U1GB 3TJ4A 4ADGA 5DO8A 3N91A 1D9EA 1RU9H 1K9FA 1B3JA 1Y5VA 1DDTA 1N8ZA 2P8CA 1D3HA 3AQDA 1S38A 1TQBB 2OEMA 4QSFA 3QQ0A 1DQJA 3MO1B 4P49A 2PTUA 1E5BA 1CBVH 3U7YL 1YIXA 3WQ8A 1MFAH 1K8IA 2A77L 3OLIA 1OCQA 2P3ZA 3H1ZA 5JW4Q 3S2MA 1QSEA 1MLBA 3UJ2A 3PV6B 4H20L 2MOQA 2OR9H 3AMGA 3SCMD 1DPMA 3HGSA 5IHSA 5HGAA 2R14A 4IICA 1PW3A 3T6XA 1GR7A 1R34A 4N8VA 3PS6A 4FHAA 3L16A 3OHXC 5FYJU 2GDVA 4EZMA 4OCYH 3BKYL 2OMZA 2EO1A 5FK9B 3V0WL 5LXGL 2D2JA 2A83B 1C5BH 5GISH 3V9EA 2YLAA 5DJ6A 4PODA 4QY8B 5D6DA 3T4YA 5J1SC 4WCJA 5EWIL 3BHBA 1EP3A 4Y7OC 3LI1A 3NCBB 3TIDB 1EMTL 4R8WH 3OR6A 1R5VA 1HHIA 3W9DA 4LPXA 3ILDA 1S2WA 3RAOA 3ATEA 3VO0A 3LXCA 5J6SA 4WENB 2W0UA 4G7RB 1XLGA 5GRXG 4R4BA 1RSFA 5IJBC 4OBRA 4E9XA 3HA1A 4KK6C 4AWEA 2YXGA 4NQED 2AJYH 5JTWA 1L6WA 4PTMA 2K4WA 1W5MA 4KNTA 3GS0A 1SY6L 4N3UA 3SUUA 2R2BB 2HFTA 2AKZA 4X0KA 1AZUA 2F1BA 1U41A 4KF1A 2BVWA 4LP5A 1HJUA 3PG8A 3OKKA 3U30C 1IUZA 1INEL 3AREA 3ZE2B 1F3DJ 1Y18A 5EPDA 3SDAC 4AIXA 4MJIA 2BNRE 4UV4H 5DBUA 3IDMA 3FCBA 2CERA 3FQTB 4GT7A 5IOBA 4BFBD 4U7SA 1KMGA 4BDVB 4WRLA 3E74A 1AS8A 3WQVA 2J55A 1UATA 1JNHB 5D8JL 5I0XA 1MCOL 4QOKA 2YEZA 3W28A 1M05A 3ZHFA 2EDWA 1H09A 3QCTL 3P62A 5KINA 3NPUA 4NC1C 4NKCA 2K6YA 1YNLH 4WV1A 2WANA 5IQOA 1TETL 4WJ5B 4XE0A 5AQ0A 4GAFB 4R26L 2Z1XA 4LUTA 4PR5B 4C6LA 4G9DA 1D9KA 3BKCH 3EWZA 5DT1L 3K4AA 1B1YA 2CEQA 3TN6A 1ICQA 1RQHA 4DKFH 4HU0A 1OFDA 5I19H 2PRHA 5IREA 2ERJC 1QABA 3NG5A 1OC7A 4LOEA 4W87A 3GINA 1CN4A 3ZTEA 1LWIA 3O3DB 4K55A 1BXBA 2ZOKB 3ANVA 1WHPA 1FWDC 5D33A 2V5RA 4H0HB 4MAYC 3KYMA 2GGIA 4D71A 1U8NA 1FWHC 4MDJA 2ZOUA 1NMAH 1EEUA 1U8IB 4K9EH 5KZ6A 4QHNB 2YSSA 1V6XA 1OAQL 3JV6B 5FYKE 1OF0A 3SRHA 3FJLA 4X7TB 3BDXA 1T0MA 2I5IA 2WY3B 3FTGA 4YYFA 4BWLC 3LZOA 1KOAA 1ZTXH 2DH3A 1Z7JA 2CUIA 4L80A 3BVTA 3MRNB 5J1TC 3GVQA 1G9MC 5C3TA 1T66D 4YZFE 5L7XL 1GZQB 3VWJC 4NIKB 3CN3A 2DRUA 3H54A 3ANYA 5KN5B 1E4XI 1RHCA 1IGTB 3FYIB 4E4UA 4KERA 5EU7C 2EXYD 3HN5A 4YHNA 1J6OA 2AEWA 3LBOA 2Q8BL 4X4ZA 1TKWA 4LV9A 3T08A 4MNMA 3EAKA 1FXPA 1GPOH 3FQRA 3EOBB 4PMFA 4W9ZA 3CFMA 3ZDYF 2EH8L 1ADQA 4HPOH 3ELFA 1NBZA 3W7LA 4AWUA 3CUPB 2ITDB 3M5XA 1AGCB 4NUMA 2YSTA 4TNWK 3UVAA 4LVEA 4W9JC 5E2UH 3QG6A 2O55A 1QHQA 5FF6A 5KVEH 4JS3A 2PW1A 5B3JF 2B0SL 3ZDXB 4Z2HA 2VRQA 4FFVD 3MLUH 2RFGA 5DHVA 5HMSA 1F45A 3EKGA 1LQSR 5IESH 5ENWB 5DS2A 4MA7L 3TN0A 4J3TA 1JPMA 4ZQTA 4RMTA 3PUDA 2AFNA 4H9XA 4ADJA 5TPWH 1EBPA 1OFBA 4GY0A 5FF2A 3N12A 5DC4B 4YHYB 3QHMA 3NP3A 4L9LC 1HKJA 1D3GA 4DW2L 3UWVA 5SWZE 3IVTA 4X80L 3ABLB 3CQHA 4ZNEE 5K59F 5C09B 3T2QA 3AM8C 2WC4A 2QAPA 1QFWH 3WQCA 4EWND 1LLOA 2V9UA 2CKNA 4MYPA 1KR0A 2E09A 1KEGH 2YL8A 3JR2A 2CO6B 4NQVB 4IG2B 3JQOB 3ESPA 5CGYD 1NF7A 2WAHA 2X05A 5C2CA 4HBCL 3NPZB 2J4WL 4Z8FL 4HUNB 4MHHI 3C0QA 1UWSA 2BS9A 4G1EA 4QHMA 2Y69B 3O2WH 3O0FA 1KBBA 3MO7A 1BJ1H 2RHEA 1L2QA 3R7QA 3SSZA 4QRUB 1TQCC 1KIRA 4O58H 4QXTB 4XKYA 3C2SA 4DXVA 3IF1A 2D9CA 2N0MA 1RUKH 4Z1PA 1L9QA 4HXBH 4JFFB 2AV7A 2J25A 4ZBCA 1RJCA 1P7TA 3HZMA 1AS6A 3MLXH 4LHUB 5I1DA 4NSKB 3QO1B 3EWXA 5CU5A 3D4YA 4ZR8A 3VSUA 3BL3A 3GMNA 1O7DE 2OYPA 3UAFA 5I3IA 3V4UH 4POCA 3RVUD 1UB6B 4P04A 3QQ4B 2JKXA 2QPXA 2E7LA 1MSPA 5BCAA 1FORH 9PCYA 3HIZA 2ZFAA 4FABL 4LOVA 3SIZA 3HC0A 3ATAA 3MOAH 5ECVA 3UABA 3L3HA 3TN4A 2BZ7A 2F8XC 4HUCA 2AAVA 1F6AB 1EA0A 4NI6A 5T3ZL 2VXSL 3CNKA 4G56A 4AQ1B 1GVSA 3SY8A 1BREA 3ZZQA 1BF8A 3Q0HA 4LF2A 2MHAA 1IIHA 4R7JA 3VXOB 2E5DA 2ODHA 1UYWL 2EIBA 1A4KA 3NJIA 2EYRB 5FA5A 3WKQA 1W1PA 5E2TL 1QTSA 5EBUA 2R1WB 1OC5A 1LO2H 2X1RA 3OQ8A 3GYEA 3VFVA 4I48B 1H9VA 2GEEA 1VFOA 5AYUH 4TUFA 2X4OA 1VJSA 1MWAA 2FQIA 3B4YA 4I5BA 1O9WA 4K5MA 4BCYA 2SODB 1VKXB 1CGVA 3QOMA 2JCCE 4ZUWB 3MREA 1MJUH 2FZ8A 2AJUL 2ZUNA 4PTUB 4P4RB 4AVJA 1DQQA 4APQD 3GVRA 5I3KA 3UPMA 2D03L 5ICXB 1U58A 1UM5L 2I9LA 2FRGP 5FV2A 1AG0A 5CILL 3TJHC 1F6YA 3WY3A 3TF4A 3EWUA 2K7PA 4D2NA 3V4PB 1JUKA 2HTLC 3CDGB 1R5WA 3C6CA 3E9TA 1BYPA 4G7FA 1ZL1A 3K5XA 1V08A 4DP4X 4Z77A 3L13A 4O2FA 5CIPH 2VEGA 3FCTB 1XINA 3A4WA 4XCNB 1P5VB 1OTSC 5T1KB 4YDIH 1EJVC 3VB9A 1OVZA 5K4XA 3PGCA 5C0CA 1USQA 2ED6A 7FABH 4G5AA 3NAAL 3SDYH 4L1BA 4F92B 3F7VA 4JUTA 4JG0L 3AXKA 3NFSH 3KBJA 5B7ZA 4PR4A 2GOUA 1I3GH 5E1GA 4WJXA 4HA1A 3CSPA 1W1ZA 4GCAA 1TFVA 4E4FA 3E80A 2VXQA 4GX9A 1A3ZA 1IL1A 1DBKH 2HLFC 3I68A 2J20A 1ITQA 5BQDA 3HGJA 2QKSA 4QXUH 5JPNA 2I5YL 4KHXH 1R47A 4F15B 3ARBC 4DCQB 2D4DA 4AC1X 4KXAA 4NZTL 1PDKB 4LGPB 4X0VA 5HI4D 2VURA 2R8WA 4G8AC 4Y4HB 4X5XA 2Y5TB 1M7IB 1HQ4B 4H7CA 4PCPA 4X6CB 4J3OG 4ZRGA 4W86A 4JIHA 3QR1A 2CUAA 4WY0B 1DVFC 3IMTA 3H2WA 4ZAKC 4CW1A 5I7GA 1I1XA 2OXGB 4ZFZA 5DEGA 1ILSA 1QWKA 2WNNA 3NJXA 2WAQA 4TNVF 3FYPA 1JK9B 4NEHB 2G30A 5K93A 5PCYA 5IFPA 3H3PL 4GQ9L 2H0PA 1UD8A 2WNXA 5MERA 1Q6DA 5KSBB 1QPPA 4G7EB 5HQEA 5G4NA 5LGHH 3OGCA 1X8FA 2CBVA 4YHML 3RDTA 3PHQB 1SXCA 3KPRD 1GVIA 5HY9B 1NAMA 3QXAB 1O6SB 2WBJB 3WJJC 5IBTL 4GJIA 5DD6B 4F2BA 5I3HA 3NIGB 4QGCA 3ONBA 1I2NA 5C9RA 1FHGA 1JZ3A 1PNCA 1V02E 4NGHH 5KSVA 2E86A 4M80A 4Y2OA 1F00I 1K3ZA 1TV2A 2VWEE 4M7LT 2X09A 4OFQA 2YKLH 5I17A 2X7LA 4OVXA 2INZA 1DJHA 2P26A 2WBGA 4IKLA 5F7NC 1KZQA 2BSSB 4AMXA 4NHVA 1KYFA 3B9VA 2CIIA 1ZHKB 3U1SL 3RIFF 4PRRA 3VYLA 4QS6A 1P2CB 3N2XA 4ANVA 2EJAA 2PODA 3P4MA 3W9EB 4HHAB 4M8UA 4JPIA 3HV8A 1RI8A 2OJ1A 3BRDA 5KYXA 1EKOA 3TOYA 4YGVB 4L1LA 4RVBA 5C71A 5FJTA 3HV9A 4JM2B 3RZCA 1XBDA 2WKOF 2PXYB 1U6AL 1SBSL 1UWXH 4E5XG 2HE5A 1Q72H 3U6XA 3BWUF 2OZ3A 1XLCA 1XYFA 5HHVL 2Z2UA 2GUOA 4M4RB 3L5MA 2JFCA 1ECQA 4YS1A 3FB6B 3V8CA 3LU2A 3NRPA 3BKCL 3W5MA 1V03A 2H1LM 1MDTA 2E56A 3DRTA 5H8DA 5D7IE 3EBIA 4UCGA 3RM9A 1TMLA 1EJ8A 3IDIA 2OL3L 1K4HA 2RA1A 4GACA 4QQUA 5DA4A 2JWYA 4EI5C 3RUGB 4NAFB 2J2ZB 2NYYD 3OOQA 3AY4A 3SDDB 2DPEA 1CGYA 4YPJA 4AEIL 4MAVA 2YO3A 1E7UA 1A3LH 3WK1A 3AIQA 1US3A 3HBZA 3FU9A 3GNOA 3PV7A 1VACB 2NOYA 4GKZA 1AKPA 3CV7A 3SW6A 3NIFE 1LRQA 1PAMA 5MHSE 4G6FB 1ZSHA 3CAKA 1YDVA 4UUJA 3I75A 5HI5D 1ET5A 5C0IB 4ABQA 2FB3A 3U2SA 2NR6A 3ARGB 4G5ZH 2JNZA 1OQOA 1FWFC 4XHQA 5KBKA 1CGXA 2UZ9A 2VC7A 4MVBC 1BD2B 1QNIA 3DOPA 1FGVL 4DK6A 1BJMA 5D9SB 1HH6B 4HDIA 2D0FA 3R89A 1MHCA 1LWJA 2YPLE 3W75A 2EVHA 3QFJA 2VFEA 3DGGA 1ZT7B 2LABA 2KZWA 4CN1A 1FIGL 3T40A 3ZGHA 1XH0A 4PLNC 4HK0B 1FCBA 2FR4B 3WO8A 2GQAA 2CBJA 3UTTA 4ABUA 3BUDA 3HLKA 5A40E 5I3FA 2ICWB 1NUNB 2WZ0A 1M3IA 5IGXL 4JFPA 2F5BH 2BP8A 3LKQB 4LU5L 4P9MH 5FYJL 3KNBA 4F3FA 1PKNA 4F7EA 1IE5A 4D6GA 3SSGA 2Z0BA 1ZGLA 3RUBL 4GH1A 2F6AA 1KGCE 2WBXA 1D5MB 4FG2A 3BQ5A 1ZSDB 2NSOA 1TXKA 2LU7A 5T5NF 1TX0A 4GG6A 5C2BL 1OY0A 1C5CH 5K9QI 2PTDA 1C12B 4ELKB 2WYZA 4MD0A 4FN0A 3NACH 1YUKB 3TH6A 4CNNA 5D6CB 1U91A 3SCTA 2K70A 4YN5A 4IRJA 1EJSC 2J5LB 1R2SA 2OU4A 4H1LA 1TUXA 3EXLA 2YGVA 4QJ3B 4XPBH 4N9DA 4PJDA 3SSJA 4AV4A 4Z3IA 1KN2L 4PPTA 3MHUA 2AQWA 3FB5A 1BRLA 3L5WB 1VERA 1Y6NR 5EUKB 5GJTH 5ECGA 2O9PA 4OKVB 1ZOXA 3BESR 2HWGA 3VU2A 3C0SA 1A7PH 3P69A 5F7DA 4HS3B 1PZCA 1NJJA 3QCUL 3TYCA 5ITFA 1QOKA 5HUPA 4N0FA 4GG8B 2C1PB 3W37A 3ZYJA 4XNUL 1JDCA 2G5BA 3IJ8A 4JDEA 1EANA 2FQEA 1G7MA 1OF6A 5A69A 1E2WA 3N43B 2OX5A 4PJ7A 2PWVA 2Y8VA 1A7NH 3VIOA 5XIMA 1OAJA 2GLKA 4OZ4B 4KZ0A 3SN0A 3DJSA 3DECA 3F01A 4KGLA 3IRPX 4IIZA 4DUXA 1FVDA 4BK5A 2P4AB 4A6GA 3H0TA 1F07A 3F5LA 1XF5B 3E12A 3C75A 1JUFB 2XC8A 1BQUA 2OL3B 2PDXA 4GYKA 4O02H 1JMZA 2DEPA 1M4KA 4QHPA 3QDJD 3UWZA 2X9YA 1TVNA 1FORL 1QO3A 3PJSA 1KBVA 5XINA 3F2LA 3ZR6A 5JO5B 4PVBA 2EXTA 5IW1A 5CZXC 4X7FC 4OUUA 1SLWA 4TULH 4LY4A 2BWQA 4QRRE 1C8PA 3H2MA 2EUXA 1R3LA 2IPTH 2H0FA 4LOCA 2OBGA 3BQUD 3IFLL 1LK2A 5DRZA 4WW2B 4I9AA 2NY3D 4XNAA 4NPJA 3P2VA 3SI9A 5HJGA 1EAPB 5FO7A 4M3KB 3U7WL 1MNSA 2A3AA 3CWNA 4W7UA 4NB7A 3TZFA 4GSRA 1R33A 4AYFB 4H8HA 3V5OA 2AANA 4HGWB 5FYKD 1FH9A 1XEDA 2WINA 3CLWA 6REQB 3OWRA 3AACA 1F4WH 3MYOA 2BOBB 3QPQD 1ZRUA 4QXGH 2L7JA 2XWDA 2XQBH 3TZNA 5DQDL 3UJIH 4TX9A 2FMOA 1A8JH 4B9FA 4KCVA 4GWEA 3OJ2C 3GJFA 1VBRA 4E3TA 4FXKC 4Y8DC 2YW3A 1H0DA 5ECUA 2WMPA 2G60L 4L1HA 4XBKA 4EVNA 3BPOC 3VM7A 1DVYA 1RUAL 1FNHA 4EF8A 4PJ5E 4WHYH 3OHXA 3C6LC 3VM5A 1YYML 1NCAH 1ZKAA 5JQHC 1F4YL 4CNTA 1QK0A 4N2OA 1PIFA 5DJ8B 3SGDI 3SE9H 2VEPA 3CXHJ 1UR9A 3EWBX 4IOFD 3NQ7A 1N19A 1O75A 1YNTA 4ELMA 1YAIA 3FMGH 4WGKA 4NQEE 4JHMA 3FW6A 2C16A 4ZXBA 1T7VA 1HQRB 3BZ4A 1E71M 5DJCB 4LMQE 5FB8B 5AUMA 5DCBA 3MXVL 3WENA 4D9PA 5D5MF 3RPBA 5FYKH 4EOUA 1WWCA 5E09A 1QVBA 3TESA 2J7BA 3H7LA 3H4WA 1A66A 1XFPA 1SR9A 3DSNB 1UWEH 2ESCA 3HNVH 2O56A 2MEJB 5C0RH 3P0YL 1IAIL 3PZTA 2CPCA 5DY2A 3BLDA 4QLJA 4AQAA 1UP3A 3EFFA 2FX7H 2ZOWA 3NWRA 2OEJA 4WU7A 1NGPL 1OCWH 5I06A 1DL7H 4JFED 1S78C 1Y0EA 3SOBL 4HWUA 4NY2A 4EPEC 2QT6A 3SYPA 3QZLA 5LNGA 4C56B 2ICCA 3BDBA 1E28A 5DD0L 2Y2TA 3PWPD 3MC5A 2DBLL 1DVQA 1BOGA 2NZ9D 2C4FT 3V5KB 3FT1A 1N8WA 5FEBA 1ZTXE 3OZ9L 1QZ1A 4C6IA 3CDZA 1CEOA 2YEVB 3FQ4A 3NIDF 2D4FA 3IDJB 4K1GA 3MSRA 3C60D 2A9AA 5IFJB 4HGMA 3OHIA 4LLVB 3A4EA 4TV5A 1BEXA 4FXLA 4QNPE 1U8QA 5I73B 3CT2A 1X5AA 3QNFA 2DQEH 4LARL 4FNQA 3N06B 5I0ZA 4MZ2A 4HH8A 1NBYB 4FHBD 5GIRA 4ZW8A 2BGQA 3TXVA 4Q9CA 4TL5A 4S1DC 3DI1A 3WJXA 2AI0H 4GXFA 4Z7QF 1XM3A 3HQ1A 1VZIA 5JXAH 5AZ2L 2EAEA 3CD4A 3GRWH 2PW2A 1WWBX 2F2KA 3FYYA 2G3FA 3J8F7 3TWYA 4JPQA 1KWGA 2ATKB 5HATA 3TV3H 4NL1A 1W8GA 3NO5A 3SO3B 4H7VA 5DJAA 1IZKA 3UBHA 4L3AA 2EDJA 2MTPA 5KVEE 2HWZL 4R2GD 3GMQA 1XO8A 5DHMC 2E0PA 4PLKD 5CLZA 1H50A 1P53A 2CIKB 3QFWA 3OA5A 4HBKA 3MFFA 4IOIA 3FT0A 1CVSC 4ZSUA 4TSCL 4QGYA 2VIRA 4F0HA 3ARUA 1KBGH 2IH3A 1VRDA 4AH7A 2HG5B 4P5KB 4RGND 1WBYA 2YJLA 4MAYA 4HJGA 1AE6H 2WSRA 2E9LA 5SX4H 2Y6ZA 5HGGS 5KBDA 3TEWA 5D70L 4BWLA 1HILA 3T04D 1PF3A 1KY6A 2PR4L 3MLRL 4DIXA 2BX7A 4WNSA 4GAAA 3N50A 4HJFA 3ZDWA 2FATL 4G2AA 1QVOB 1EJ7L 1XCFA 3ZTCC 4J27A 1P7QA 1CB2A 5T1DL 4PJGE 5E5LA 2HVBA 1XRFA 5KVGH 3UD6A 1AI1H 5AOLA 1ULVA 4Z7OE 5HWNA 3KPMB 4WTQA 1LDPH 4E9SA 2VVNA 2F8VA 5I6LA 3WCYA 4ZTEA 2YXOA 4UZUA 3WTSA 4YSOA 4N3TA 2XA8L 3U0HA 4I87A 2R2HB 4A2MA 1UEMA 1MRQA 1KJ3H 3EWWA 3QN3A 3L3IA 3UL4A 5EKYA 5FM5M 4HWBH 5F7AA 1ZLWK 1XEUA 3EJQA 2Y72A 3QIUC 3W1ZA 1PD0A 1OP5K 1SVBA 1B0RB 2F7RA 3WK2A 1CS6A 1TO4A 4ZX5A 2EDRA 2ODOA 4LYQA 5D1ZB 4X98B 3QJAA 1MNUL 3W3OA 1SJMA 3QIBB 3QZPA 3MKCA 5HPMA 4C54A 4L65A 3PG9A 1O0VA 2X4UA 4Y5VC 4XC1H 2EKSB 3SFKA 3WLBA 5BUPA 1AQKH 1XRTA 1EDHA 4O0ZA 1UP2A 2PLCA 1N26A 1WFMA 3L5JA 1RP9A 2BDNL 2ADFH 4F3HA 5FA4A 4PWGA 4GI9A 3CVHA 2GJXB 4JFXB 1EEXA 4NI8A 2X0UA 3SCQA 5IMMB 3WIFB 4JN1H 4L9LA 1AYRA 3QRGH 5AW1B 3QYCA 2CDFA 3BAIA 3D3VA 5K1JA 3RB5A 3S96B 3EJYC 3U83A 2NVDA 1G1CA 1SR0A 5F4WA 1GQLA 4JO4H 3FQNB 2X6UA 2C9QA 3AM8A 4HOMA 4M7LH 4BQ4A 2Y88A 1EBGA 1Q7ZA 4KKCD 3H4FA 3NNTA 4MMXB 2MNWA 2R69A 3CQQA 3G1SA 2QGYA 3OZKA 2EEBA 3ECVA 2W65A 3CH0A 2BVPA 3WH7A 1ZV9A 3RZWA 4PTTB 3BIKA 1AO7A 4LVGA 3BSGA 3SIMA 5D1XB 1G7LB 4IU3B 3WLRA 4JHOA 2ENJA 4ZS7H 4N7QA 4KESA 1UA7A 1N6QL 2DD8H 1I1AB 2Z0IA 3M0LA 5E08H 3TTQA 2GVLA 5HHOD 1JDDA 3MLTA 2J7CA 4X60A 3TC9A 1AGFB 3MKVA 4MS6A 1JWUB 3ZUNC 2H26A 4KEMA 3MBDA 4Q7IA 2K3HA 1GQJA 4ZFMA 3UP8A 2E7DA 4LO9A 4PJEF 1E9QA 4XVSL 1Z44A 2P8BA 3IPWA 1TITA 1WIOA 1J05A 4WWOA 1YN7B 4JKMA 4G8GA 1R1CA 4M7SA 1JPEA 4Z9KB 3G6LA 1OBAA 1BQGA 1ZWIB 3C87A 3EKCA 3OAUL 1OX6A 1MI5D 4OGXL 1AMKA 4HWEL 4QTHA 5ADPL 3KP0A 1KIUB 2P5EE 5AD0B 1TVHA 3O11B 3HVDA 1QRNB 1U8OB 3MLSL 4GI4A 5K9CA 2XG4B 4KUCD 1ZCRA 4P46B 1TV3A 2GAZB 1IE4A 2YCLB 4HNOA 5AHNA 1A7NL 3KPRB 3MV7A 3OG6B 3DEQA 4RDBA 3UDWC 5BXFB 5KYYA 2J1ZA 3EGXB 2PSNA 2C6QA 2ZOOA 2ZRZA 1IM9D 4CNIA 3HJ0A 1SEQL 5GGRB 2WLYA 5ALCL 3IKCB 2CW6A 3PGFH 5HA7A 3C08L 4LK4A 4XCCL 1F5WA 4FLHA 3IMSA 3TBTB 3QZMA 4MD4B 5E4AA 2WLMA 4PGBB 2SEBA 3QHZH 5DXXA 1JTPA 5ISZE 1NFPA 4KW2A 2W9LA 4Z3TA 1AG6A 5K1NA 2AJ3B 5F0LB 3GSWA 4Y9MA 3IACA 4HTBA 4L1DA 1K6QH 1FZMA 3ENLA 2R29A 1XGTB 2VABB 1IGWA 3BMXA 1EJUC 3SE4C 2PS2A 4LBSA 2XU9A 2OTUB 3FO2B 3VRIA 2AL2A 3SADA 4ZK8A 1CLZL 4E2DA 1GTFA 4OUOA 1KB5A 4IFOA 3NZGA 3AIWA 4AW7A 2EE0A 1YZZA 2RDTA 3EO9H 3D09A 3KYKL 5ABZA 4NRXA 3AJ7A 2W6RA 1S7WB 1TVBB 4X9HA 5KSAB 1GKPA 3UJJL 5HYJE 2IEPA 4AXWA 4HGKC 2J88L 1FL3B 4LP4A 2GBVA 3NRQA 2AQTA 2GUYA 3N40P 3C56A 2YPLD 2WQAA 4JDZB 3Q2DA 5IMKB 1ZLVK 2VR7A 5CZVH 1NANI 1YDOA 1ZTVA 1SHMA 2V4LA 5C0GB 2NZLA 1I82A 3VD5A 4NZUL 3DGRA 1U92B 4BEUA 4KGJA 2UWFA 2XKSA 3VFMA 1I8IB 1DJIA 1E4NA 4NBZB 5IVOA 4XTRD 2P5WE 3PUUA 4WTWA 1DVFA 2W5FA 2ZA2A 4ZAKA 3GUTA 3UYPA 3EO0B 1CNVA 1OG0A 4KC3B 1JQVA 3VDAA 3WG7B 2CBUA 3ULVF 5E8EB 5FYKL 4Y2DD 2BH0A 2QR0A 4G80B 3QPXH 4EDXB 3EDDA 3WZ0E 4EJ1C 2UY7A 1HZYA 3GTTA 1EVTC 4YR6B 1VFBB 3LZQA 1KGCD 4IBSA 4FL4B 2C3ZA 3HBQA 1XAUA 3BLPX 1N64H 4C59B 1S6NA 3GI8L 3W0WD 3W22A 1PG7W 1XQLA 4HHPA 4UZGA 4Y1AA 3LKPA 3EWDA 5GS3A 3IIXA 4JG1L 4F1SA 3AU1A 4XOAA 1ZLSL 1HP5A 1TTPA 1O9VA 1R5YA 3A5VA 4PUDA 4NCDA 1UC5A 4TVSa 5T1LD 2QCLA 4NENA 3DYMA 3PP4L 5CN2A 2EDHA 5IROC 1VPQA 2DWSA 3GW0A 2PLTA 1SO5A 3I3DA 4HAKA 4O8AA 2UWEF 3BGFB 4XGZA 2DJXA 1SZFA 3SKOB 3G3LA 2QHRL 3P4NA 5FEPA 4I85A 3LQAC 1HHGB 4ML9A 4DB7A 4I1NB 4IXHA 3CLMA 3BISA 4E4PA 4QLRA 4JFUA 3MNVB 2ZWZA 3WHE1 2OFJA 5AVYB 2OQJB 1F6KA 2G3ZA 1JRCA 1EK3A 4TUJB 3PZOA 2ZCLH 1E5ZA 4ZX4A 3TO4D 4OM0L 4UNLA 3GKAA 2XZCL 3VFCA 2J8UA 4ZMXA 4E42B 2F58H 4F7TB 4KK9D 2X6BA 1KXTB 3C8HA 1UA6H 4N2KA 1IT8A 3D39A 3DPDA 1KNWA 3M0VA 2AXFB 2I7SA 1F3EA 2Q6ZA 2GUUA 2JIWA 4XAFA 4UTCA 3GH7A 4I3SH 4F7PB 4EI5A 1ZHNA 4XWOD 5C0DA 4GZIA 2ZWNA 3TNNB 4XBPA 4O2CB 2BZNA 2D73A 4Y8EA 4NBYB 2BNRB 1NWTA 5IQ9B 4Z2GA 2ZCKH 3OKDA 5C0AD 1H11A 2P46B 4CA4A 4Y16C 3PF3A 1M1SA 3D12B 1G0DA 5L6YL 4W4OC 3UTSE 4QRRD 2EYTA 4WNJA 5E9DA 4NUGL 4QHLA 1XT5A 3F7YA 3W74A 3BW2A 3HZKB 2FTPA 5EA9A 1JPTL 4HNCA 1FO0H 4E36A 5CS7A 1M71B 3G18A 3U48A 4IHBA 3OODA 3MYJA 1DHKA 3ZHLA 1E5AA 1AKJA 4BWWA 4KEUA 1CI1A 4FLOA 1ZHBA 2AKRB 3S37L 4BSJA 3APTA 4N90E 4KJPC 4GYPC 2MNUA 4OM1H 2J6EA 3UBGA 1QR1B 1RJRA 4XCFL 2RAGA 1JUBA 3G5VB 3W6MA 5ID0B 3RGTA 2VDRH 1RQBA 3DPBA 2JQMA 4DGVL 3KTXA 5DUJA 4A66A 1TJIL 3MXWL 3UZQA 1RV8A 3BQUB 5AW8B 1OCJA 1KGJA 1T6VN 2NY3B 2XFFA 3PTQA 2E27L 3N6YA 1A4AA 4G1KA 1Z3GH 1BQSA 1IAMA 4PJ5D 2GDUA 3Q3GA 2RKXA 4ILDA 4DH2A 3KS5A 3LEYH 5A2LH 1DSYA 2ILLA 5HDBF 1QUPA 5TF1L 3K4DA 3W7QA 4HJTA 4UM8A 2QGDA 5LBSH 4Q52A 1XH2A 2DZAA 4D2JA 3C0LA 2CE6A 4L9YA 4JL1A 1CIUA 4F8TA 3L9RA 1VESA 2BC4B 4JM4H 1LO5B 2YD1A 3UZVB 3T81A 4MGXA 3WH8A 2IH8A 3CMFA 2XIMA 4KNQA 3CQPA 3SGJC 1A1MB 4ZOCA 4TS6A 5TGBA 3MRMA 3WLWC 4KFMA 2HH0H 2Q8AL 1Q6OA 3WQDA 4JYEA 4YPGB 2XQYK 2OLDA 3MQIA 5EO1B 3HE7A 2VDKL 1KV5A 4P9HC 1H63A 1X1NA 1QEXA 3GPEA 1DBTA 3B56A 1L0QA 5E0FA 1XGQA 3S7GA 1KLZA 1E65A 9RUBA 2OJEA 1GIGH 3CQKA 2J9YA 1SM3L 2PU1A 4DQAA 4KQ4L 2NLJB 2A0NA 5EUOE 1CX9A 4UTFA 8FABA 3W7HA 2DIEA 5I71B 3WV0A 4M5PA 1QFHA 1K02A 4PBEA 1LUCA 1C1EL 1OFQA 1T99A 1YY9C 2ADAA 3S42A 2VC6A 1PYMA 2CRZA 3QDJE 3PDOA 4PJ6A 4O1DA 2DD8L 4HNVA 5H6HA 4XBGA 1QSFE 2WZ6A 4IIFA 3B4UA 4MKMA 3QV7A 5BOOA 1GS7A 5EEWA 2VZSA 2YJQA 1MZRA 1MDAA 4O00A 5CGBA 3U0PB 3PHSA 5GJSH 4GEJA 4JFEB 1ILUA 2M1KA 2WXIA 1NIBA 4C47A 4FQ1L 3VNYA 4LF1A 4KVCL 1GMIA 1NGQL 1MFBH 2XWCA 3UCQA 5SWZB 2FB4L 1OAUH 2EDXA 5D1QC 2VSKB 4Z42C 4WEBH 2GSIB 2GQ8A 5JMOC 1W3KA 2AKMA 2CC0A 3IXTA 3W1AA 3GFUA 3C60B 4R4NC 1QAPA 2GTWA 1M1XA 3HS0A 2IANE 4H8WC 4K6AA 2WJDA 4DAGH 3G6JA 2FBRA 4FX7A 4K2UH 1B3WA 2C34A 1WC7B 5IVXA 2AGKA 1XF2A 4J5VA 3VMPA 2KZBA 5TFSH 1R3RA 1X44A 3UA3A 1BYDA 4UQ3A 1CDIA 4PI2A 3J27A 4OLZH 3IRDA 5LA1A 2PCPB 3R5EA 2X9WA 1F9CA 3AADB 1I8UA 5AYZA 2OMWB 1W0VA 4WK9A 1QP1A 4UQAA 1KW1A 1T1YA 2R83A 2PCYA 4R2GB 3GRBA 1UBPC 5T8IA 4E5XB 4WKZB 2DQGL 4TVCA 2ZKMX 4XOBA 4KRPD 4FXKA 4U6VL 3H12A 4HXAL 2C0HA 4PULA 1ZZMA 2H8XA 4PGCA 4YK4B 3V4PL 2G9HA 1PS3A 2OXHB 4FXFA 1OO2A 3UO8B 3GMMA 1LWRA 2V63A 5AVQB 4KMQA 4AD1A 4V1DA 3IIZA 1QT1A 4RGNB 4GIOA 4HZ1A 1A80A 3T6VA 4KXBA 2NDGA 4GIEA 4JTAA 5CJ8A 5AAWA 2W9EL 2MNRA 4HA3A 4IGMA 4AD0A 3C09B 5D9PA 4L29A 4NRYA 4L8SB 3QEUB 4JHAH 4PJHE 1HSBB 4UBPC 5FOBA 3M0YA 4Z7IA 4DZIA 1B3ZA 4JFEE 4AG0A 4D7PA 3RKDD 5FW6A 1XF3B 4UT6H 4LB8A 2HVJA 4ORGA 1HFUA 2F19H 3A64A 1QUNA 2NCEA 4JFDE 5I76A 1H1NA 4S0HA 3PWPE 4ACZA 1NOLA 4N24A 2QVNA 4EVZA 3VI4A 4DN3H 1WVZA 4CQCA 1YPZA 4FOJA 1DCEA 3A6BH 4JKLA 1N0LA 2FLMA 2R56H 1OP5H 4DRSA 4DSYA 4MADA 3F03K 1B4LA 4IRZH 1HWGB 3PP3H 3NJFA 1N6VA 1L9MA 2I5QA 1NGWA 2OZ4L 2VDKB 3D2UB 4KKBC 5FF7A 2JCCB 1MQPA 1ZALA 4DESA 4A7UA 3VRLF 4JFZH 2EXWC 5I3DA 1NEYA 3QUHA 4F7CB 1OEZW 5DK2B 4DETA 3KG5A 1GY2A 5B38A 5I6KA 4JO2H 2ZCGA 4P2OD 3H2QA 2LQRA 4JO1L 3RGHA 5IQLA 1GSKA 4W9LC 5I8KL 4QPEA 1IR2A 1IKOP 2XWTA 2AJSL 3LRSB 3JWOL 1BG9A 3S9IA 4W6YB 5DMKB 2Y6TE 2H2PD 3BGAA 2QEZA 4N86A 4G6AD 4EUPB 1NGZB 2ENYA 4N2EA 4GKSA 4HWZB 1QLEL 5KVGE 4ZMVA 1A4JB 3TAKA 5FFGA 4JE4B 3LD5A 3BN9D 4W84A 2UZYA 1UXWA 1QD0A 4BFIB 4D0BB 4WQOA 3HI6L 5J4MA 5BZWB 3KX6A 2ATPA 3VOGA 1JV2B 3HG4A 2Q71A 4RBPK 5TDOA 5DD5H 4XAWL 3WMBA 1G6RL 1FG2A 4N1EA 1DWFM 1A7RL 2J6VA 1OG6A 4RGNE 4JY5L 3GO2A 5LAXA 2QJJA 4PV8B 3M0JA 4FQHA 1EZVY 4KZDL 5EIIA 4UTAH 4L1XA 2ACUA 4G8IA 4NBXB 3GK0A 1N4XL 4X4KA 5KG9A 3S8HA 1UT2A 5JUEL 3FONB 3TC6A 1A3HA 1C3FA 4XP6H 1DQLH 5E6UB 3V0VA 3BZFA 2XY1A 4AQEB 4M3JA 2R59A 2K6WA 2P8MA 3WD5H 4JNMA 4WI0A 3A3WA 1NA8A 3QIWA 1FNEB 3H6AA 1GT8A 3EX6A 4S2BA 4ZSOA 4OD1L 2O4EA 1WAWA 5H8PA 1DHPA 3VXRA 2CLVB 5CCHE 3WH6A 4D0CB 1UR0A 4WHYG 1FI8C 5A6MA 2WXRA 1UZ6F 3ET9F 2P5ED 1F58L 2OJPA 3QB7C 1BMWA 5GGTH 1XIHA 3HW7A 4DKEL 2X89D 4KRUA 3TA4D 1AL8A 3CASA 4Y5YB 1UIOA 2ADIB 4L3ED 4HEMA 3WJZA 3WYRA 1FFQA 3PCYA 1BSIA 3P74A 3T0EC 1QFPA 3USZA 5BRZA 4TUOB 3VSVA 1REQB 2DZSA 5FEZA 2DORA 4N6FA 2EUWA 4NS0A 5T9BG 1QBLH 2G50A 4CQ9A 5E4EC 1F90L 1LO0H 1E6SM 4UTHA 3CG8A 1GG1A 4OV5B 2CUHA 1CTNA 3HR5A 1R9XA 1FTXA 1MI5B 4L0PB 4ENZA 5ICZB 1XH3A 1QFUH 2WD0A 3RX7A 3N19B 3PNWB 1RU9L 5ISZD 1F6FB 2BM3A 3LQLA 4PWHA 1FC1A 1GYLA 3QIUA 4JY9A 1ZPUA 4HJEA 1LGVA 2B4CC 2COQA 2QV5A 4A37A 4ZTPH 5CSZA 2FIKB 3EYOB 4S3CA 5ILTH 1CBVL 2N1TE 3P3YA 4NUJA 1EDYA 1MFAL 1YEIH 1AMXA 3HG1A 1OP4A 1TYEB 3MX0B 4FFZH 4ZTYA 3KBVA 4NHCH 1NC4A 3BP4A 3WFCH 3MV01 5C92A 4S2CA 3TVMC 4Y5VA 1FO0L 5HULA 1DLHB 2OR9L 4X50A 5HGHA 1A6UH 3DIVA 1N5YH 1EC9A 4OD3H 3O2VH 2ZTKA 3AB0C 3O3BB 4OCYL 2A6JB 5BQ7B 1G0XA 4P4KC 4ZUTA 2PCFB 1REIA 3BP6A 1J1XH 1C5BL 5D7IB 5GISL 3UETA 5DK0A 5HYJD 1YPXA 1QI4A 4FKEA 4H5SB 3JTTA 2ZOXA 4K38A 3PWLB 4M6OH 3EXRA 4YE4H 3N2BA 4R8WL 1VS1A 3NJ3A 4J3VA 4G43B 4RAVB 2VW4A 5HHOE 3VD7A 2FPTA 2X2IA 3ZFHA 2ZG2A 3OZOA 3LXAA 3S2JA 4L61A 4NQXA 1QLEB 3NIFB 2XICA 4GSXA 1UZDA 3FTYA 3BP5A 3MJ9H 3CDCA 2AJYL 3WLMA 3OKNB 2P5WD 2J21A 3R79A 3U46A 2JKIS 3I9AA 1XLLA 3BQVA 3QMTA 2WJEA 3FYOA 3UPAA 3B2XA 2P48B 4DWSD 2ZSVB 1G6RB 5DTFA 1MI5E 2J72A 1G7QA 3GXTA 2YPLB 4NX0A 1AANA 1GC1H 5ADOH 3NZQA 5CSGA 4TMBA 3Q2VA 4UV4L 3CYVA 5GZNC 3S1WA 2V8LA 5FCUH 3K74B 4FFWD 3B2PA 3L9CA 2CDGA 3DVGB 4QROA 2A3CA 2WYSA 3T2NH 2FO4A 2VM9A 3MGOB 1FA2A 5C8BB 4G7YH 4BI7A 1IXPA 5A6BD 5C3LD 5DGQA 3DRQA 3KDPB 3AYVA 3PULA 3BKJH 3P9LB 3L7EA 3TJPA 3L4UA 2I56A 2Q7NA 5LO7A 2ZYRA 2IC2A 1NDWA 1YNLL 1HEZA 3DX1A 2NQ3A 4LBEA 1AD9A 5E94A 3PUOA 3M17A 4I89A 1YEYA 3ITLA 4IJRA 4O2EA 3W0WB 1Z8AA 3OZMA 3BXWA 3P11H 1BGGA 4DKFL 4PJIB 5I19L 3QXVA 3R0MA 4HC1H 3K6IA 4QFUA 3MI2A 4XZBA 1WFTA 3E6FB 4ZMGA 4MZYA 5EFIB 4CMHB 1QWUA 4PRTA 4L2LA 3LCHA 3WX7A 1HOEA 3FKUS 2CRMA 2ACRA 5T1LB 3TZVB 1T2JA 3WJWA 1RZPA 2PPEA 5DVLA 2HZGA 1F3RB 3GSVA 3T2OA 3ZE0E 3TROA 5DRNB 3M5YA 4RRPA 4WO4B 1SFHA 3SQBA 4NO0D 1NMAL 4K9EL 4EDWH 1Q8JA 4P2AA 3EJJX 2MOVA 5CJOH 5CEYB 3V9CA 4PEEA 2ZUQC 3R18A 4Q33A 4YCOA 3SCWA 3PDDA 3MV9A 5HYSA 3LEXB 1VEMA 1ZTXL 3B0VC 3GUWA 2VITA 2G0WA 3SE4A 3LGGA 1NL0H 3UGRA 2PYEA 4NZFA 1O5DT 2BSED 2F7IA 4IIEA 1PE1A 1JPIA 3R1GH 4C6KA 3QTGA 3DETD 2QJMA 1Z2KA 1FO0B 2IDQA 1C08A 2B2XH 1BVKB 4OLZL 3TO4B 2POTA 3VCCA 3SQRA 1UENA 1F18A 1UHVA 3UTSD 4QCEA 2HKFH 1ZVNA 5DZPA 2HJFB 1MHEA 3LRLA 5AC6A 4PHZA 2E25A 1Q6QA 1GPOL 4H83A 2FJGB 2CAKA 1QTWA 1EZUA 4A39A 1SM9A 1XXXA 4HPOL 2HMIC 4EUPG 4KX9A 4U1MB 4LPWA 3R10A 1BZ9A 3QJHA 5AW0B 3LDVA 3RFZC 4IJ3B 4YXHH 5FYKU 5E2UL 2XN9D 4GOSA 4ADIA 1KIQB 4N90D 5KVEL 1ONQA 3L66A 1JJKA 5C0AB 4LYKA 4JTGA 2GJ6D 5IVNA 4GW5A 3CTLA 1F3JA 5DQ9A 3MLUL 2PYFA 4PBXA 4X4XA 4XH2B 4C83A 4QRRB 2DVXA 4G1MB 1M2OA 4AM0Q 3W0WE 1DTNA 5IESL 3QJFA 3EYUH 1F8TH 1IAKA 3KCJA 2R0KH 4JW3A 4PJIE 3CQJA 3TNBA 2ICEB 3IGKA 4JKNA 1FOBA 5TPWL 3VD3A 4ACTA 3SCMB 3CZ8A 3F2CA 3EJRA 1MFVA 4ODSH 3U1PA 1B6UA 3MR9B 3CUFA 3ESMA 4AGPA 2DWDA 3CLEH 3WN6A 3CFBB 4PCFA 1H61A 1EO7A 4AIEA 1QFWL 1K9TA 1G7HB 3BG9A 2GKIA 1U21A 5EOCJ 3CN0A 4L4VA 3F6LA 3R0KA 1KEGL 2DQUH 4B53A 5TH2B 3H24A 1S9YB 1HI6A 3OKMA 4AZBA 3HUJA 1CXLA 4JPVH 4MWAC 3Q4DA 3MLVH