1XGZA

Structure of the n298s variant of human pancreatic alpha-amylase
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
496
structure length
496
Chain Sequence
b'EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDSHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha-amylase, pancreatic
publication title Structural and mechanistic studies of chloride induced activation of human pancreatic alpha-amylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 174
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xgzA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xgzA01
1UWUA 2VQTA 2CBVA 3AS2A 1CGYA 2VZOA 1V3JA 3WQWA 1ZB5A 1OGBA 2BXZA 1H4PA 2X0YA 4LYQA 3WNMA 3WL0A 4AMXA 4W86A 1W3JA 3AJ7A 3W6MA 1TFVA 1MWOA 3CO4A 1JYWA 1AVAA 4AYGA 1HKKA 1SZNA 1CXHA 1TQWA 4YN5A 4TXEA 1W9PA 4IPNB 4P7QA 1FFRA 1UZ1A 2EPMX 3NSMA 1EDQA 5A6AA 4J3UA 1UR0A 4AMCA 3ZR6A 3DYMA 4JFUA 3VTRA 4U5KA 1UWIA 3CZLA 1HJWA 5ABFA 1H0GA 1UWRA 4J27A 1KWGA 4A3YA 4NXKA 1H5VA 2EO7A 4Z2HA 3MMWA 4PTWA 3CIVA 1U33A 3RCNA 2CKSA 2PC8A 5HBFA 1PPIA 1E6QM 3LPOA 4E8DA 1GOMA 3EMQA 4KWUA 4UOZA 5D9MA 5DO8A 2JE8A 3AYRA 4YHEA 2V5CA 1E43A 3PTKA 5DF0A 1KB3A 2YDRA 3VGGA 2DH3A 3ARPA 4AC1X 1E5NA 4EK7A 1E6XM 1VFUA 2YIHA 3GNPA 3NDYA 2ZX6A 1DWHM 3AMDA 2NT1A 4MB5A 3SUUA 4IPLA 1N82A 3LRLA 2X2HA 2DPEA 2Q8XA 4AZGA 2V3GA 3VIIA 1D2KA 3TTOA 4HZ8A 2YBUA 4XUYA 2ZXAA 1E6NA 2D20A 5IHSA 1E4IA 1W32A 2C7FA 3BC9A 2D3NA 3WUGA 4OIFA 1E5JA 2YL5A 2J7BA 2XFRA 3WBAA 3OGSA 5AYBA 1FHDA 5E09A 2WM0A 4GXPA 1NOFA 9CGTA 3A4AA 4UQBA 3K8KA 3KE0A 1QBAA 1W9VA 1MVYA 1MFVA 4ATDA 5D9NA 3HJEA 2FH6A 3VMPA 1JFHA 3EJQA 5DT5A 1US3A 3WY2A 1VEPA 4KGLA 2O9RA 1K9TA 1Z32X 3O2LA 2Y2WA 4JFWA 3U7BA 3OLIA 4J3WA 3UR7A 2G3MA 3VDCA 2X1IA 4ATWA 2VX6A 2ZICA 5FOOA 4MAVA 3ARYA 3ARRA 4CGTA 2ESCA 4MAZA 1NWRA 1JF6A 2F1BA 5FD0A 2WVVB 1HP5A 1OIFA 1DHKA 1UHVA 4CCDA 1S46A 2UY5A 2BY1A 1KFWA 3GDBA 1W1TA 3CHEA 4DWSD 3SCQA 2BNJA 3CZGA 3RJXA 1V6UA 2X0HA 1JZ8A 2VX4A 4EAMA 3KL0A 1QI3A 1OWQA 1KXVA 1KCKA 3U5YA 1LG2A 4J3SA 4QLKA 3ZT7A 5GNYA 2XVPA 1CGXA 2WSPA 3BVWA 1J0KA 1TUXA 3N13A 1E3XA 1C7TA 4PRWA 4S3KA 3GXTA 4BCEA 4LYPA 3W4RA 3ARZA 5BYWA 4UFLA 1GORA 5DMYA 5JIWA 5DFAA 4WIWA 1ZBCA 1PS3A 2YA2A 4BQ4A 3WDIA 2AAAA 4W7UA 5M5DA 4AYSA 4WKAA 1U30A 1EDTA 3UG3A 2FDMA 2BHUA 3VILA 7A3HA 4JFVA 2Y4SA 3LPFA 1GJWA 4M81A 1EGZA 2ZUMA 2IGTA 4AD2A 3E1F1 2X2JA 2Y8VA 2OW6A 3FAXA 1GPFA 3U57A 4E4PA 4TOQA 2ZWZA 3VSUA 2G4FA 3N12A 2VZUA 1E6RA 3DECA 1WCGA 1R33A 4CD7A 2XTKA 1C7SA 2O9PA 3O6AA 4H7VA 4FNRA 1SYTA 3WEMA 1G01A 3ZJ8A 4MJ4A 4X0NA 1QI5A 1TQUA 1KGWA 1EXPA 1R86A 1ITCA 2VZTA 1KTBA 2VZSA 3MUZ1 2VR4A 4QCEA 5BXSA 3BAWA 3KL5A 3IAQA 1OIMA 2A3EA 1JZ2A 5LYRA 1PX4A 3WMCA 3BLBA 5E70A 4TTGA 2WZHA 4CD4A 1TVPA 3UCQA 4M8UA 1M01A 2CETA 5A6SA 1ISWA 1OSEA 3BSGA 3MKKA 1JZ7A 1PIFA 1WZAA 1V3IA 2XVGA 2V5DA 1JNEA 5IXEA 2FYVA 5M17A 5IFTA 1TQVA 1R8LA 1CWYA 2CERA 3G6MA 4DWSA 4ACYA 5AC5A 1EH9A 1MYRA 2F61A 3CUIA 3II1A 3OA5A 1W9UA 3WD3A 1NWTA 4DM2A 3AXHA 4PEEA 1ZJAA 3GH5A 2CKRA 1IV8A 3GNOA 3EMZA 2WLYA 4YPJA 4ZXLA 5C70A 1XRVA 2FGLA 1EIBA 4OZOA 3AHYA 2GK1A 4P7LA 1FFQA 4LXFA 1EOMA 1TQSA 2GJRA 2HVMA 4GI9A 4FNPA 4TVCA 4MNMA 2XM2A 5ABFB 3TTSA 4GPNA 1R87A 1VFMA 1E72M 2G3NA 3N04A 3LMYA 2F18A 4EANA 4W7WA 1VFOA 1K9EA 3TV8A 3VM5A 3BXWA 1J10A 4JKKA 1CIUA 1ISVA 1LL4A 1TQTA 1GQIA 1E3ZA 3WN6A 2E40A 4Z2LA 2W62A 1VJZA 2W67A 1OB0A 3DHUA 2DT1A 2WZEA 2E9MA 2YL6A 1VF8A 1G9HA 3VUPA 3MSGA 4ZE4A 4JL1A 3OZOA 1JFXA 2W4XA 3RIKA 2JFEX 1GQLA 5CPQA 1J01A 2W63A 4GO8A 4DO6A 4MPKA 3QGVA 4FNTA 4C7GA 1XYFA 2EEXA 1GHSA 3WD2A 5A8PA 5AC4A 1M7XA 2J79A 4E8CA 3AHTA 5A6BA 3AI0A 3HG4A 1I1WA 2BFGA 4IM4A 3CV5A 2VVSA 3BAJA 3J7HA 4UFHA 3TTQA 2WCAA 3M6DA 3BLKA 3WNPA 2VZVA 3UESA 3BAKA 4FK9A 2CITA 4DO4A 1V6VA 5A2AA 1H2JA 3HN3A 2WHJA 1J18A 2XIBA 1KXTA 1H49A 3VDBA 1MQRA 3BUQA 2EJ1A 1BFNA 1NOUA 1RP9A 5TD4A 1GZJA 5HNNA 2BVYA 2W5FA 4P7OA 4PMVA 3OLGA 1DWGM 3O9NA 2PWFA 4PSPA 4M24A 3VMNA 1JXJA 2FHCA 1E15A 3ARVA 2J25A 1QNRA 3AZSA 1V3LA 3W26A 2B31A 5CSUA 3AS1A 1HP4A 1RH9A 1GUVA 4IISA 3EDEA 1B3VA 2PB1A 3CPUA 2CYGA 3TOPA 3WF2A 2D73A 5A69A 1XCXA 3F5LA 2WVSA 4WSKA 2ALWA 3KEHA 3OG2A 1CBGA 3D5HA 4LQ1A 1E1EA 1KBBA 5FIPA 2OSWA 3NYDA 2EAEA 1FP8A 1UKTA 1Y7VA 3RO8A 1SMAA 5C71A 3SCUA 3AMGA 4N42A 1JIBA 2BHZA 1Q6CA 4XX6A 3BVVA 4PTMA 1HL9A 3BAIA 6CGTA 2WMKA 5A8QA 2VI0A 2OWWA 3APGA 2PF0A 1MXGA 3RM9A 5JIPA 3F5KA 4PTXA 4HMDA 2WW5A 2WHLA 5CPTA 1PBGA 4HMCA 1QVBA 3VU2A 3MUAA 7CGTA 1H0IA 1QHPA 3FHAA 3EJSA 3D51A 3GXDA 4GQRA 4NI3A 4D6FA 4OBRA 2ZUWA 1GQJA 4J28A 1E55A 4H2CA 3ZJKA 3L4WA 4FLSA 1HJQA 5D4YA 3W0KA 2DSUA 4FNUA 4UFKA 2WB5A 1PIGA 3ARTA 1JDCA 2JIWA 4OJYA 3ZQ9A 3B9AA 1CYGA 1MXDA 2Y5EA 2ZIDA 1MW1A 1EO5A 4Z2GA 4PMOA 4BS0A 1OT1A 1VAHA 1TZ7A 3NCOA 2D22A 4OBSA 5HOSA 1JL8A 3S5ZA 2PWGA 1TG7A 1XSIA 3VKKA 5BCAA 4AEEA 3IJ8A 3EYPA 3SCTA 4J7RA 2EABA 4JCMA 1CENA 5KEZA 4PMRA 2VVNA 2WC4A 2G41A 3T2PA 1QWNA 3W28A 4HA3A 3AIWA 5A95A 3A5VA 1CGWA 1BGAA 1WAWA 1EA9C 1B90A 4MNLA 2ZWYA 1V02E 3AMLA 7TAAA 1C8YA 2YDQA 4FF5A 1VJSA 4UZUA 3N9KA 1JG9A 1WO2A 3VO0A 4M1RA 5EFDA 2FGZA 4MB1A 4JL2A 1I75A 4PBGA 1BHGA 4HU0A 3MUIA 2V3FA 2OWCA 5GNXA 2F7OA 1BQCA 2CBJA 3IK2A 1E4LA 3DHPA 4CU6A 1VIWA 4UOQA 3WEOA 3AHVA 2GK1B 1E56A 5I0DA 2FHBA 2ZOXA 1FP9A 3GYCA 2EBNA 3SUSA 5LA0A 5HXMA 3MSDA 5CLTA 3PZIA 4GZEA 2WMIA 3T2QA 1GOQA 2VO5A 4UCFA 1BG9A 4ACZA 1C3FA 4PMZA 5FL0A 1UWTA 3WSUA 3L4ZA 2D1ZA 4ML4A 1OGSA 5A6KA 3M07A 2ZE0A 4V2XA 2RGLA 2CPUA 1J0ZA 1J0YA 1GW1A 3FNDA 1NP0A 4W5UA 2E8YA 1P6WA 1CXIA 2FE0A 5E9AA 4CCCA 3QHNA 3EDKA 2GJXB 1BAGA 1KXQA 2ZXQA 1OGGA 5E6ZA 5CJ5A 3WUFA 1DTUA 2EPNA 2OWXA 4KGJA 1UD2A 1NQ6A 3MI6A 2WMGA 2XSBA 4WJXA 3W6LA 2V38A 4ZFMA 3DDGA 1NWSA 2CESA 2XVNA 4EKJA 3BUBA 4KH2A 4DO5A 4HPGA 3RMEA 3TTYA 4AD1A 1QI2A 1DWIM 1K9FA 1OM0A 1R85A 1HXKA 1SFSA 3GM8A 4F66A 1UR8A 3VNYA 4M80A 4P8VA 3VD3A 4HZ7A 3VIMA 2DSKA 3D4YA 1TR1A 4W5ZA 2J62A 1J0JA 2HISA 3WY1A 5JBFA 2W92A 3UG4A 4KRTA 1CPUA 1US2A 2DSVA 5LA1A 5I3DA 2WBKA 2D2OA 1BVNP 3WQVA 3LRMA 3T09A 3N18A 4HU8A 4AD5A 1IZKA 3AHXA 2QLYA 3W29A 3L4UA 4U5IA 4J3XA 4GINA 2AOSA 3CZKA 2EPKX 1ZBWA 1B3YA 3AS3A 2WKGA 1GVIA 4CVWA 5I77A 4W87A 4AZBA 2E9LA 1UKOA 2XWEA 4W85A 3WDJA 4HOXA 1VENA 5HPCA 4RE3A 3VVGA 5IFPA 4U3AA 3UETA 3AIRA 3UEQA 3MU7A 3WIJA 3LXAA 2A3CA 1WB0A 3LPGA 3ZT5A 3ARQA 1TE1A 4MTVA 3UR8A 1PAMA 3MMUA 3SURA 2VNCA 2J8GA 4CD5A 2E0PA 3WBEA 1YHTA 3NDZA 1RPKA 4U2YA 1XV8A 4UFIA 5CGMA 3SCVA 3WL1A 2EXOA 3PBGA 3AZRA 1CLVA 2F7RA 1BLIA 3PTMA 3D4ZA 2X05A 2WXDM 1W9XA 1E6ZA 3DX0A 4LPCA 3WEZA 5CG0A 4UQDA 3AMCA 3WQ6A 4AY1A 2O9TA 2IXUA 2WAGA 4TTUA 5M03A 2CHNA 3AIVA 2WC7A 1CEOA 4JKMA 1D7FA 1OD0A 4FLRA 2VRKA 4PMXA 1XHGA 2G3JA 2XGIA 2IXVA 3WY4A 2YL8A 2BXYA 3ZJ6A 3VINA 1PEZA 1EOKA 2WHMA 4B15A 1DWJM 1NH6A 4ZENA 1R47A 1JYNA 1BSIA 1HKIA 1VFFA 1ISYA 5I23A 1XC6A 3NIYA 1UQYA 1R7AA 1E70M 3KWXA 3N11A 3L4YA 4PMYA 3BCDA 2PBGA 3W25A 4CN1A 3MMDA 1UD6A 1E4NA 4AZIA 1UYQA 3WNKA 1HKMA 4JHOA 1TA3B 3K4AA 3FW6A 2F7PA 2WVTA 2Y8KA 4CUCA 5E1QA 3WF3A 3PZMA 2VUYA 4JFSA 1GOIA 1HJXA 1B30A 1J11A 4D6JA 2VOTA 3SUTA 3AICA 4JIEA 3K8LA 4DUVA 1CGTA 1ZS2A 1HJVA 1UD5A 1HJSA 3VIGA 1GHRA 1BF2A 4PTVA 1GOOA 4FLQA 4BZYA 2XFFA 3VX1A 1AQHA 5ABHA 2Z1SA 3PTQA 1VBRA 3PZ9A 1JZ5A 3KZSA 3BUPA 3ZSSA 3VD4A 1BTCA 2ZUTA 3AZTA 4AWEA 3VNZA 6TAAA 3SCNA 1PZ3A 1XH2A 4AD3A 3RM4A 4XB3A 5EB8A 2CXGA 1KQZA 4HMEA 1CXEA 1K9DA 2XHYA 3K46A 3NSNA 4M56A 3VSVA 3HZ3A 3VGFA 1ESWA 4XZBA 1W2PA 2J7GA 1B1YA 2OYKA 3AXIA 3L2MA 2WC3A 1DWAM 3S6TA 1UH2A 1W9BM 3THDA 3ARUA 4AEFA 2VX5A 2WVUA 5A3HA 1JI1A 2JIEA 1TMQA 3FXYA 4V28A 3CHDA 1UD3A 4Z2JA 1XSKA 1CECA 4GKLA 4PCSA 3GZAA 2XM1A 3D52A 4MB4A 1W1PA 1X6LA 1DP0A 2J7DA 1EHNA 2GUYA 4AD0A 3MO4A 2VTFA 2W61A 4N0RA 1UKQA 2XN0A 1O7DC 2NSXA 3GNRA 2JEPA 1X1NA 4CKQA 3CZNA 1KWKA 1PX8A 1Q6DA 4AISA 3WMBA 1DEDA 3W27A 3WFZA 1QPKA 2BV9A 1QW9A 1LF1A 3FN9A 2MANA 4HOZA 4KRUA 1W1VA 1H11A 3K1DA 2YFNA 3WNLA 2VQUA 3IJ9A 4TVUA 5CSYA 3PZQA 2PI6A 3VOCA 4MDOA 3VGHA 3FAWA 3CUGA 4M29A 4CU8A 3ZSTA 4Q22A 4DWSC 4DUWA 4W8LA 4D6DA 4BQ3A 1D3CA 3A23A 4HA4A 5CGTA 3WH5A 4WF7A 1X6NA 2XWDA 2XVKA 1BVZA 2J7CA 1FHLA 1EHAA 4NZFA 5HPOA 2D0FA 3L4XA 2QPSA 3WELA 1CDGA 1R46A 4AW7A 6A3HA 3DYOA 3FHQA 3CUFA 1WNOA 5CQ1A 3FY1A 5JBEA 3GTNA 4WKFA 5A1AA 1ODUA 1QWUA 3WUBA 4ZXOA 3S5YA 5F7UA 2UY4A 4MNKA 3RILA 1WDQA 2YL9A 4GI6A 1LLOA 3ECQA 3CUJA 5E0CA 4AZCA 1OD8A 5ABGA 3U7VA 2WNWA 4MADA 1C90A 1E9LA 2CBUA 1W3LA 3BMWA 3W53A 1L0PA 2YOCA 1VRXA 1C8QA 4H41A 4F8XA 1NOWA 1M03A 1E6SM 1BYDA 5JUVA 1HNYA 2DT0A 4WKHA 4QCFA 3CBWA 1KCLA 3PZUA 1CLXA 1UWQA 1H1NA 1QX1A 4AIEA 4HOWA 4AXNA 4CVUA 1E4MM 2WVVA 3A3HA 3T08A 1XSJA 1JXKA 3VIFA 2ZUNA 5BXRA 3RDKA 3OLDA 5ABEA 1L8NA 3WD1A 2XN1A 2XUCA 3HG2A 1C93A 3VD7A 1NP2A 3F4VA 3CH9A 1RD6A 3ALFA 4PYSA 1GNXA 3VGBA 3HU7A 5CZKA 4BQ2A 4X9YA 5C8BB 2OYMA 4CU7A 4C7FA 1ISXA 1J0IA 1ITXA 4ATLA 3H55A 1I1XA 1WDRA 3RM8A 3GBDA 4B9YA 2D23A 2VCAA 1O7AA 3MANA 3PZNA 1MW0A 1V03A 4BA0A 2JEQA 3D50A 1G1YA 4BF7A 1F4HA 1KGUA 1F4AA 1V02A 3PZGA 3BVTA 1B3WA 4PMQA 2DT3A 5IDIA 4M82A 1PJ9A 3BAYA 4H8VA 3W24A 5AY7A 4Y7EA 1FH7A 4MJ2A 1HF6A 1M04A 4UR9A 4HTYA 1JYXA 2ZX5A 1AQ0A 1V3KA 4P8XA 4ZE5A 2JALA 4PMUA 3QOKA 5BXPA 1CXKA 3G6LA 3GH7A 2D3LA 4WK9A 1HL8A 4J3VA 2UWFA 3OZPA 3VD9A 5BXTA 2FHFA 1V0KA 1QI0A 1UKSA 5CPSA 1NWUA 3BCFA 1VB9A 2BVDA 3ZM8A 1B31A 1WP6A 4XZWA 3CZJA 1QHZA 1J12A 3K8MA 4EE9A 1E1FA 3IJ7A 4UTFA 1C8XA 1W91A 1E6PA 2J78A 3WQ5A 1BYBA 4JZ5A 1W3KA 3AIEA 4D71A 4TX6A 1GOKA 4TVDA 8CGTA 2E3ZA 1JD9A 2BY3A 1UD4A 1EDGA 3EJTA 1TCMA 1OCQA 4DWSB 2WK2A 1ODZA 4RL3A 3CGTA 2XPKA 3VX0A 2CEQA 3ZIZA 4NXSA 5E6YA 5AYIA 3L2LA 3WH9A 4U2ZA 2WWDA 1E40A 1OINA 3OIHA 2WPGA 1WKYA 3BMVA 3ARWA 5EMYA 4GO9A 4H04A 3WNNA 1XD1A 3KL3A 2C8NA 1OBAA 2ZUVA 5HDRA 4S3JA 4OOUA 3WNOA 3VIHA 2EACA 4R5EA 1KTCA 1A3HA 3SCWA 3B8SA 4D1JA 2CNCA 2VMFA 2XN2A 2WCGA 2WCSA 2XIIA 1B3ZA 3MV01 5D9OA 5EFFA 2GDVA 4CCEA 3AS0A 2BHYA 5E0FA 2D0HA 3OGRA 3RJYA 1HVQA 4C7DA 2C0HA 1KQYA 3PHAA 3IAPA 4TUFA 4FLOA 3T0AA 4D6IA 2DSZA 4MB3A 4U3CA 3HG3A 1V6YA 1K6AA 4HP5A 1V3HA 3WF0A 1UR4A 1W2VA 4RE4A 2ZXBA 3A47A 5I2UA 4PN2A 1QNSA 4B16A 2WMFA 1JI2A 1C91A 3EDFA 3JUGA 3T0BA 3W37A 3LPPA 4JAWA 2WMJA 4WSJA 3ARXA 1UASA 3DX2A 2DT2A 3DX4A 3WH6A 3L4TA 2J75A 1LL7A 4X0VA 1QBBA 1KXHA 3A4XA 1RP8A 1UQZA 4NX0A 1ZJBA 3TP4A 1FOBA 3THCA 3AISA 1Q6FA 4UZSA 3CHFA 4GI8A 3L4VA 3N17A 1W1YA 1BYAA 1HVXA 1R34A 3HG5A 5I24A 2VR5A 4PUEA 3LX9A 3DC0A 4URIA 3ZMRA 1LL6A 4TX8A 1B3XA 1AMYA 4NRSA 3WFLA 2OYLA 3ZJ7A 4J3TA 2UY2A 1LWHA 4FNQA 4CN6A 2DH2A 1CTNA 2ZX9A 5DT7A 3VIKA 2E8ZA 1QNPA 4LGXA 1OT2A 3VM7A 4UOJA 5I79A 1MW2A 2E9BA 3EJRA 2A3AA 2PWEA 3H53A 4OUEA 3U5UA 2BS9A 2ZX7A 4AZCB 3CHCA 1H41A 1XCWA 4QP0A 4W84A 2NT0A 3IANA 1KR0A 4ZEPA 1C92A 4PUDA 4CD6A 4UQ9A 2F8QA 2V3DA 3VSTA 3GH4A 3LXCA 3VGEA 1HX0A 2XVLA 3SCSA 4W7VA 2D24A 3PN8A 3SEPA 3AXXA 3QHMA 4IUGA 3DYPA 1XD0A 3VIOA 1JDDA 1J0HA 2DSWA 2YDSA 3GXPA 4PCTA 4NZJA 1FH9A 5D8WA 1CGVA 2VJXA 4F79A 3ALGA 2YA1A 3AYSA 1U2YA 4D6HA 4UQEA 3BGAA 3BVUA 1GJUA 2J7HA 5A8MA 2WZIA 4YHGA 5I6SA 4GZJA 2J7EA 1MQPA 4B3LA 1V0NA 2CHOA 2IUZA 2FH8A 1QI4A 2YBTA 1Q6EA 1JDAA 2QPUA 1QOXA 4BQ5A 2G8ZA 3AHZA 4JFTA 3CZEA 4PMNA 4F9DA 1G94A 3HMCA 3SIMA 1CXLA 1HJUA 3AQUA 3ZOAA 4H8UA 4AIUA 3ZO9A 5D9PA 1WDPA 1CZ1A 3QOMA 1UWSA 3WF4A 2O92A 1NARA 1WDSA 3WD4A 1HKJA 1UR9A 1UH4A 5FCZA 1IT0A 1JAEA 4L4PA 1JD7A 3WDQA 3RPMA 2EADA 1XYZA 4D6GA 1ZBVA 2BY2A 4UFJA 4V27A 5GQBA 1JZ3A 1Q4NX 4UQCA 2GDUA 3N15A 3VDAA 3NJ3A 2BVTA 3SCOA 5GPRA 1W3HA 3A6OA 1V6XA 2A3HA 2DGAA 2VRQA 4AD4A 3GXNA 1LG1A 4P7RA 5D8ZA 2J4GA 2X8RA 1XGZA 3T2OA 1PZ2A 2RGMA 5A6BD 3DX1A 1VEMA 2DIEA 1WZKA 2UY3A 1KGXA 2VURA 2GJPA 4H8HA 1XH1A 2QF8A 1JF5A 3EDJA 5BRPA 3WQ4A 2XSAA 4GIAA 3BSHA 5EBAA 4HPHA 4W93A 4JCLA 1V3MA 1BPLB 3T0DA 3AIQA 1LJYA 4A4AA 3UERA 3WMSA 4RE2A 3SUWA 1IZJA 2YFOA 3AFBA 1SMDA 5A6MA 1EQCA 1B2YA 3CZSA 5GNZA 4Z2KA 4Z2IA 5A94A 1E0WA 3POCA 1MQQA 4Q7NA 3UG5A 1GVYA 3F5JA 3TA9A 3GXIA 2DDXA 4OKDA 1Q6GA 2JF6A 1ISZA 3WDPP 5M3WA 1HWWA 3EDDA 1DWFM 4UFMA 3VMOA 4GQQA 5CXPA 1QNOA 3SUVA 4JKLA 3BLPX 3WH7A 1ECEA 1QHOA 4W89A 1E71M 4AIOA 4PMDA 3BAXA 5BWFA 3W81A 2XGBA 2XG9A 4OGZA 5A2CA 2AMGA 1H09A 3AROA 3CTTA 3A24A 2WMIB 2O9OA 1UKPA 1T0OA 1YQ2A 1FH8A 2W66A 3OBAA 4ACZB 3SCRA 3WDHA 3S2CA 3EJPA 1V0LA 3K4DA 1R7OA 3AIBA 4UQAA 4GZIA 5JBDA 1G5AA 3WUEA 1CNVA 4B3KA 3I3EA 3OGVA 1WPCA 1W9DM 1UR2A 4F9JA 1KBKA 3CZ8A 3POHA 3A21A 3VGDA 2WWCA 3M46A 3GXMA 4U31A 4AZ7A 3CUHA 2V3EA 1GONA 4D6EA 2VC9A 3WKZA 2EQDA 3PZOA 1HXJA 4W8AA 1WZMA 1FA2A 4E2OA 3TONA 1G0CA 2X2YA 3AIUA 3LXBA 4MNJA 2ZUUA 1E0XA 1QNQA 2OLHA 2X2IA 2J47A 2GJXA 3WQ8A 1WZLA 2WYSA 2VRJA 2NW0A 3VPLA 1ZL1A 3MS8A 1M53A 2CCRA 2EPOA 3MV11 4NF7A 2ZUSA 2YLAA 1MFUA 1JGIA 5BROA 4AZHA 3WD0A 3WF1A 2J74A 8A3HA 4QFUA 4FMVA 2OSXA 2VCCA 2OSYA 3WDRA 3CLWA 3EJUA 2ZX8A 1WE5A 2D0GA 2WKLA 4P8UA 4W8BA 5A8OA 5BRQA 3D3AA 3CC1A 2JF7A 1NM9A 1BGGA 4AZ6A 4QDMA 2F7QA 4HZ6A 4AZ5A 2VX7A 1HT6A 1UZ4A 2WHKA 2YKKA 3NUKA 5A6LA 5DEZA 3DX3A 1CXFA 3VD5A 2GVYA 5IHRA 2DIJA 2XFYA 1MW3A 3W38A 3WH8A 1V0MA 3BVXA 4NZCA 2PBOA 4K68A 5ECUA 2J8FA 4DM1A 2GFTA 2YLLA 1HTYA 4U33A 2DEPA 3KLKA 4QLLA 5FL1A 1H3GA 2Y24A 4FNSA 3AMKA 5A6JA 4D72A 1VBUA 5I78A 3GXFA 1AQMA 3SCPA 4A3HA 3CMJA 1VEOA 2F2HA 1B0IA 1HIZA 4P7NA 2BY0A 2ZXDA 1UD8A 3NSXA 4DUXA 1JNDA 4B9ZA 1UR1A 2WBGA 3ZT6A 4PSRA 2CIPA 2CBIA 4L4OA 2QMJA 3A4WA 4OOZA 1UA7A 2XJ7A 4MDPA 1JZ6A 3QR3A 1HN1A 1UUQA 2XYLA 2QV4A 5A2BA 1BYCA 3BH4A 2WLZA 3I3BA 2WSKA 3B9EA 3H54A 4AMWA 5I5RA 1ZBKA 2TAAA 4D1IA 3PZTA 2VL4A 3CMGA 3BUIA 3MUY1 2EPLX 2A3BA 3VDHA 2VCBA 4HA1A 3OLEA 2G3IA 1UH3A 3ZR5A 1TVNA 2PWDA 1XH0A 2QHAA 1UG6A 2Z1KA 1EQPA 1O6IA 3KLLA 3GBEA 1KR1A 3W82A 3BUDA 3LRKA 1E73M 5A8NA 2E4TA 4NSBA 1EO7A 2OW7A 4JHZA 1ZU8A 3VIJA 1JAKA 1GOWA 4W88A 1V08A 2J7FA 4QLJA 1E0VA 4UNIA 3WENA 1QW8A 2VT0A 1J9YA 1JZ4A 2PWHA 2YA0A 4LX4A 1LWJA 3QHOA 3M7SA 5FKYA 2DQXA 3PZVA 2WMHA 3B9DA 2F1AA 1JYVA 4P8WA 3ARSA 4WLCA 3DDFA 1R75A 4NRRA 1BG4A 2QMKA 1LQ0A 1B9ZA 5KZ6A 2YJQA 3VIPA 1UA3A 1GQKA 1UOKA 2W91A 4XV0A 3A22A 1TA3A 2WANA 5LA2A 3I3DA 3AOFA 5CLWA 4D6CA 1SR0A 1A47A 3EBVA 4KMQA 4CD8A 2X09A 4LYRA 3OB8A 1V6WA 2GSJA 3IGUA 1PX3A 3N1AA 3WY3A 4CN4A 2J77A 3EMCA 4QAWA 1CGUA 4R27A 1GCYA
chains in the Genus database with same CATH superfamily
1DANT 1ZB5A 4PB4A 4M9OA 3QUMH 3WNMA 4AMXA 4PJIE 1UB5B 1XIBA 2E76C 3BH9A 4K3GA 3GI8L 4HPYL 5GRJL 1UZ1A 2EPMX 3M16A 3FRUA 3BSZL 2DQCH 4UILL 3TPKA 1UUSA 2E9JA 4QKTA 5AAMC 3AUOA 3C60B 1E8WA 3CJJA 3UTSE 1FH5H 5L4FA 3AREB 4NUWA 1R3SA 3PHOA 1FWXA 1J88A 2ZX6A 4MAUH 4G3YL 1GW9A 2XXMB 4FQXD 3VFNB 3R1ZA 5CEXA 3B2XA 2G0WA 3QRLA 2JJSC 4I1RA 1X9QA 1SY6H 2P5NA 3HI1A 3WUGA 4FGMA 2QCHA 2G2RA 4TQPA 3WAJA 3GTHA 4IFOA 5D9NA 5IT2H 3ZE1E 3LG3A 1US3A 4WW2F 1R3YA 1YEFH 4GUFA 5F1UA 4L18A 4JUTA 2VFHA 1V93A 3QYMA 4CGTA 2ESCA 4MAZA 4K71B 1WBZA 2G30A 2MMXA 2YSSB 3OSKA 1ASOA 4FJYA 4CCDA 4GW5A 1S46A 3CHEA 1Z9SB 3MJ7B 1ZQ5A 4MJMA 3U5YA 4JM4L 1CGXA 3MRMB 1OPOA 3GO2A 4BF9A 3Q2VA 4M6PA 4UTIA 2HLFC 5DFAA 1ZBCA 5BOFA 4F7MB 4BQ4A 1Q0YH 2AAAA 5AECA 2X12A 4WKAA 1SO5A 5EMUA 2BM3A 2EYSA 3Q3GA 5DUPH 4MHBA 1WWBX 2OMAA 2ZE3A 2HT2D 3U30B 2WP3O 1NBCA 4GG6F 4JFHE 4KTGA 2ADYA 2R2EB 1E5AA 1AKPA 3DECA 3QKEA 1G4TA 1SVZA 1YVLA 3FU5A 1JWMB 1C7SA 3LHPH 4BD4A 2E6JA 2FPVA 2YPLA 2VUOA 1D7CA 3JRKA 1YEJL 4LARL 3ITLA 1LEKA 6PCYA 2MKWA 1K6QH 4PI2A 4OZGF 5E2UL 3TASA 4HBCL 1U92A 2WJ7A 1J8HD 4M6UA 4AQAA 1OM3H 4WFHE 1IIKA 1E4XH 4KCTA 2P45B 3WN5A 1JNEA 1EL3A 5KN5B 5IFTA 4HJGB 3GNDA 4KAQH 3DRTA 3M41A 4JRLA 1T7YA 4PJXF 4GFXA 4Z17A 2DWEB 1IBFA 3HA0A 3S8HA 1Z5LB 5AL0A 2GJRA 3FK4A 3MCNA 5FKPB 2NMSA 4YSTA 3ABLB 1KUMA 4NZTH 4ZO8A 1DVJA 1K9EA 2JQMA 3EB2A 1QFWI 2QQNH 2HS6A 4EPEC 1TETL 2NX5B 1LRNA 1OF6A 2VITA 5MI0C 3C0QA 4DAFA 2GVJA 1OB0A 3H12A 5MHBA 3ZMNA 4ZMAT 2ZJSH 2CR3A 2WXGA 2FLMA 3KPMB 1AQDB 4WQOA 5JW4Q 2VKWA 5IIEA 3X3FH 5EWIL 1RUPH 4I3GA 5ID0A 1M7OA 1PQZB 3Q0HA 1EFQA 4OZFA 4G9FD 4N9DA 3UESA 3QDJA 4QF1B 3MUCA 2XPZA 1WFIA 5I8OH 4PYHA 5E4AA 2IBBA 3K4ZA 4JM2C 2Z2UA 4PULA 5JW4M 4GFSA 1KEMH 3L6FB 3VXRD 2XFXB 4ADJA 3VXPA 2PTVA 4DZ8B 1ADQH 3KFTA 5IRPA 1LLAA 1OC6A 3G5ZA 5EPMB 3KD4A 4XVJH 4Y2OB 1CDCA 1IKNC 3GS7A 1F8TL 3MCYA 4KV5E 1B3VA 1PJWA 4Z7WE 4YGVA 4HT1H 3ROLA 3WF2A 3K2MC 4HZAA 4WSKA 4JY6B 5C2XA 4XX5A 3R8RA 1ELSA 1Q1JL 3SHSA 2FX7H 4BZ2A 3HKZA 1SXNA 5M2FX 1AY1L 4MLSA 5I74C 2A9MH 2VISA 4WZ9A 5C71A 2QW5A 2ENYA 1CURA 3BLDA 2AF2A 3PWVA 3HTLX 2E28A 1S3KH 3KYAA 2RUSA 3STGA 3U1SH 1SEQH 4R97C 5E1HB 3QTGA 1D5XA 4IOTA 4B0MB 5E4EB 2P5ED 3GBLA 1NAMH 2VELA 4Q8BA 5JHAA 3R8BB 4WDUA 3IIVA 2AJZB 3R89A 5JHLH 2C7UA 5ANHA 1MXDA 4E36A 1IO4C 4LCSA 4L48A 2X6UA 1TZOA 1OT1A 5J1AB 4N0YL 4OBSA 3IJ6A 2ZBTA 1A4KB 3L3KB 3O0KA 5CEZE 3P4MA 5D7IA 4FQ1H 4AEEA 2NQJA 3Q2CA 3B5GA 2BO0A 2VVNA 2GK0A 1RV8A 4XMWA 3K13A 4UBPC 2BVOA 4R83A 3IEAA 4H13C 1P5UC 4IJRA 3ARGC 4KO5A 3SPVA 2YDQA 4HN8A 3N9KA 3V4PL 4KK9D 1I1YB 3G1DA 4HU0A 1KPRB 2FEDD 1GGYA 3BLIA 3BDXA 1WWCA 4PG2A 3DN5A 5BRZD 1VFLA 4MXWL 1QACA 1EKOA 2A38A 3GRWA 1LO2L 1LZOA 1QR1B 1DQKA 1M41A 1BG9A 4LVAA 2A74C 3FX4A 1ETA1 2JK2A 2DQGL 4XE5B 2YXMA 1IM3A 4OGQC 4HOMA 2PPCA 2WZPD 4KJYB 4ONVA 4YNYB 4XN4A 4GKNB 1J87A 3EKCA 5CCZA 3SGJA 3YPIA 3P67A 4CA4A 2ZXQA 1SXBA 4IIQC 1A6AB 5FO7B 4DEWA 1B54A 4A21A 4Q9QH 1TPWA 4ZFMA 3TO4C 4GO6B 2G2PA 4X2RA 4RNFA 2EE6A 3GIYA 4E41E 4P2RB 4Q6XA 2DSKA 4QXIA 4XR8C 5K7JA 4GH7B 1Q6QA 3GMQA 3UG4A 5FJOA 5I2IA 1AYRA 4TMBA 1OLLA 4XT1C 5G5DA 3UYOD 5E5UB 2YMOA 3W2UA 3DIFB 2Z4QA 3L4UA 5F7HA 4J3XA 1CL7I 3SGKC 3KWSA 1Q7QA 4LSRL 4WOZA 4DERA 1UKOA 1LO0L 1DVUA 3VFOB 4GKTA 3OP2A 3FO1B 1WDAA 3R0UA 2V81A 3CQFA 5CINL 2PWUA 2VEKA 3AIRA 4P46C 1A6UH 1QG3A 3TC9A 2HPIA 2J8GA 1CDIA 4EX4A 1T4KB 3MRIB 4UFIA 3WJXA 1PKLA 4YL2A 5FFLA 1FCGA 3NQ6A 3PNWA 1K8IB 2AJVH 2KLRA 5I18L 3KW8A 4P59H 3FJNA 3OKMB 2NCMA 1IGFL 5TDPB 4NFCA 4TNEA 4AY1A 3BK0A 1TCDA 4YBQC 2RQ8A 4JPGA 1M05A 2VRKA 4I5BB 5I71C 5HJ3B 3I75B 3TQ0A 2FO4A 1ND0B 3OC8A 4LOEA 3WQFA 4XNZB 4H3DA 1EPFA 5J8OA 1HKIA 5I23A 1IEAA 3IEBA 5T1LA 4RNRB 4Y89A 4PMYA 4EPSA 2O7QA 3G6AB 3JT0A 1RZPA 2AJXH 3V6ZB 3HE6D 2WM1A 3UBPC 1GOIA 3C08H 1VR6A 3O9WA 2YUXA 4I9JA 4KEUA 3BKJL 2ZG2A 3IDNB 3D2TA 1KJVA 4H88H 3NXLA 4ICXA 4FC3E 5EOQL 4LHUD 3U4EB 3NL3A 1IGCL 3RVTD 4AQ1B 2IWEA 1JK8A 3ALWA 3LI1A 4HIEB 3FIGA 2J7GA 3JTSB 2VJ0A 2HTKD 2O72A 4RPPA 1QRKA 1HXYA 2IQAB 4X80H 4WDIB 3BZ4A 3CV7A 4H01A 4UMSA 5IFAL 3MLXH 4Z3JA 5KYUA 4B91A 5AHFA 1H5BC 3A4FA 2CIIA 5KSAD 4XCEA 4YHZL 2OZ4A 3IDMB 3GIZL 5D7IF 4YHKH 4LEBA 1MN4A 3GNRA 3OC5A 1DBML 3GSWA 1Z3GL 2ZWKA 3JT2A 3C5JB 4Z7WA 4O19A 3HTWA 4K07A 1JFQH 1KPVA 3T8VA 4UT9H 2D9CA 3WJMA 2Z93A 5F97E 4NFDA 4NKIH 4F0SA 1RIUL 2AQPA 3IDXH 1YEDA 5CCJA 2XG4A 3F2BA 2E7LC 3UROR 3WELA 2X4PB 4EDWH 2VLJA 5A1AA 3LCFA 2WWNA 1U2HA 3S5YA 1INQA 1POKA 5DMLA 4UI2A 5SV4A 1ZCCA 2BVPB 4R4ND 1D3HA 1HOEA 1I1AD 1H1NA 1QX1A 1FYTA 2WVVA 1YYMH 2BX5A 5B1CA 1ME8A 4CC4C 2FIKA 1S9WB 4UAOB 5JDSA 4JZNB 5FGCE 1KN2L 3CCHB 3SJVB 1JCYA 4X9YA 3MW7A 1AC6A 4CU7A 4K2SA 3PQYE 3T3ME 3FPYA 4Y4HD 1JK9A 5HVGB 1T5WB 4A55A 3EGDB 1E6JL 3D50A 2NQZA 5C0EB 1DL3A 1AAJA 2AJ3A 2C26A 2BRRL 4IOFC 4JYDA 4RNJA 3APYA 5BZWA 3NEOA 3RWJA 1Z5YD 2EXWC 5DS2A 3QOKA 3TSMA 4NC2B 3UXIA 3UPRA 1J5DA 2A4ZA 4AEOA 1DLFL 2ZSWB 3GNML 4LDLB 5ABDE 3T0VA 5C9JB 1QI0A 1N67A 3BP6A 1NWUA 5T3ZL 4R34A 3NGFA 3EOLA 3SO3B 4JIRA 4W6XB 5DR5L 3MBXH 1TUFA 2NXYD 3P2DA 4UQ3A 4MRCA 3OODA 3ENEA 1UD4A 4FI8A 3FUDA 3KPQB 3EXTA 1TCMA 1QRNE 2QXWA 3TSDA 3N29A 2XPKA 3K71B 1P4IH 5KITA 4BFIA 4IBLT 4RFOL 1F9CA 1WKYA 4GO9A 1MCCA 4HIHA 3TIEA 4XBGA 1FPTH 5FC9A 4PV8A 1AXIB 2EACA 25C8L 1EYWA 1W5OA 1E8YA 4E41A 3MV01 5D9OA 3WXVL 3R79A 4I88A 1XIHA 4LPTA 3OQ8A 3H70A 4N6RA 2Z35A 3PHAA 3D47A 5ADOL 3GI8H 4C56B 4HPYH 4UILH 3OPSA 5LO7A 3UPAA 3N85L 4UB0L 2DSZA 3A67L 1NGPL 1K6AA 1MQKL 1V3HA 2JKEA 3ABMB 1UP3A 1TQXA 1F2QA 3KNBA 3RNQB 4WSJA 4EF9A 2IDTA 2J75A 1EXHA 2G0LA 4D0DA 1N0XH 4GIOA 1JULA 4EN3B 2BS71 4UZSA 3UA3A 3VXUE 3IETB 1FNEB 4WO0A 5CU5A 1W1YA 1BYAA 4BQ8A 2ED7A 1OJXA 1A1MB 5E08L 2APTA 3P3RA 4CQCA 3SDAC 1GKEA 5FYJD 4QX4A 4F3FB 2FPYA 3P0YL 1RBLA 5JXQA 4A68A 5A40E 2YBVA 3CHCA 4OV9A 2DM2A 4CMHC 3AWFA 3LXCA 3VGEA 4I0PD 4JTRA 3QHMA 2QQ6A 3DOPA 4QHPA 4NYLA 4PCTA 4QKXB 3HE7B 3T0WA 2WXRA 3T6WA 1H7XA 3HZYA 3AYSA 3L5LA 3EFDH 3QHFL 1MFMA 1VS1A 5DS1A 4DHGA 6REQA 3FYPA 2FH8A 4HIIB 4JM4H 4DF9A 2E5EA 5LGXA 1JCXA 1P7BA 2NUWA 4DBWA 12E8L 2LV4A 5T1MA 5DVNA 5CP7A 1IM9B 1G0XA 1J5HA 5IW3A 4Y8EA 1CB4A 4XTRD 1NJ9A 1JD7A 3NJGA 1RK0A 5I1AB 1MRAA 2VEMA 3GUFA 4IIEA 4A04A 2BC4A 2BVTA 3SCOA 4MPQA 1XZWA 2OR9H 2VDQB 1IQWL 4AHOA 5IOPB 3FSOA 5EN3A 5DVKA 3TNBA 3U6XA 5G5IA 4J4PA 4UWMA 2GJPA 3N1GC 1G7UA 2QF8A 2EKGA 2P5WA 3OHMB 1Z9NA 4KUCF 3QYNA 5IB4B 3SUWA 1KBGL 1ITQA 1UWFA 5IMKA 4LSTL 1B2YA 5B3JF 2YRPA 2DQIL 1OEZW 4OCYH 4LARH 4D8ZA 1WA0X 3ZL1A 2F15A 1I53A 5E2UH 4S1FA 3TVMD 5C6MA 3EDDA 2OOFA 1RUKL 3Q67A 4HBCH 2ZFAA 2ADIB 4JKLA 1WKEA 4N1EA 3CLFL 1A4JA 3OO2A 3CFDA 4RWHA 3G7TA 5D1XC 2QJHA 3OPUA 3OBAA 1OK4A 4O1CA 1HHIB 3C6SA 3GFYA 3TYBA 1LP9B 2DQJH 3HNTH 4I9TA 5KMYA 1R7OA 2ONEA 1K02A 2QDWA 2KZWA 4F9JA 4L8CB 5T1KA 2OR8A 1GONA 4L65A 4ZQPA 4JTAA 3MLVL 4KMTH 5BS0E 3MTWA 4TO8A 3RCYA 4AB4A 4EVNA 4ERIA 2GFBB 4HJSA 1I9JL 3ULUH 3VPLA 5KZDA 3L67A 3KX6A 3M86A 3MS8A 3CLEH 1M53A 3UGEA 4LCWA 1JNLH 2ZUSA 1Q9KB 4MJJA 3NO1A 3V6BR 5EWIH 2OX1A 2G37A 2WKLA 1AGDB 1M2VA 3E74A 2CUHA 3CMFA 5GSRA 3NZHL 5A6LA 4FG6D 3NCYS 2GYSA 1P7TA 4PRHB 4ABUA 3HFML 5C09A 3LKOA 3RNKB 5CBJA 2XIQA 3GHTA 4YDZA 1FZOA 3OR7A 3LY6A 3Q05A 4NQCD 4X99A 1PG7W 3IB4A 3DV4B 5JIHA 1TJIH 2TRHA 4X5XB 3C5ZD 1Q1JH 1X7TA 3Q48A 2BNRE 4B9ZA 3ZT6A 1CDUA 3UPCA 3DGRA 1RHFA 2QQLL 3VXSB 1HEHC 4D1IA 1JRHH 2IV9A 5HWJA 3M0ZA 5LBVA 1I7RB 1PWMA 4BFBD 4MDJB 1S2VA 1VPXA 2OZNA 3BKCL 4JY4A 3LUTA 4NQDE 1H15B 4WJEA 4XXDA 4BA8A 5E93A 5E6IB 3TIDB 3MBDA 1LE9A 1E1CB 3WENA 4ORGA 4X4XB 1T5XB 3L0NA 3GPEA 1X1OA 4PS4L 3V7AE 1M6OA 5DFVC 2YSTA 4A7QA 1AANA 3USBA 3DSFL 3ISWA 3W9DB 3QNXB 5C2UB 1U8HB 3BMXA 4AJWA 2V9QA 3NG5A 2ALRA 5DO2C 3OTRA 2NXGA 1V6TA 1SR0A 1V6WA 1NY1A 3NOYA 4XD4A 1RMFH 3QUML 3VRJB 1JXFA 5EIIB 3MO1B 1TU2A 4EDXB 4S39A 3V4PH 3VXUA 1YADA 5D71L 3VYOA 1T5AA 2DQCL 2ZAGA 1DYZA 4MTMA 3FU8A 3GS4A 1JPST 4PPTA 4K7PX 3LLDA 3F4CA 2BSSA 3L5MA 4XH2B 3OGCB 3NOIA 5IG7A 2HT3C 2E77A 4WJ8A 1FH5L 4DWDA 1I7ZB 1MHEA 1HO1A 4S3GA 2UY7B 4ZMQA 4MAUL 1E43A 1FVPA 1FF5A 1EEXA 3PTKA 5DF0A 4LHUG 3VFPB 4JGJA 2KX9A 3EJYC 4QHNB 4AAJA 4IGBD 4MS8C 3P80A 4WXYA 1CD9B 4NAEB 4PP2A 4QO1B 1UXSA 1WKFA 2YBUA 1I3RB 5GGRY 1LEGA 4S1SH 4JFFB 4KFZC 4HNOA 1DUZB 1KTLB 5I5IA 4PIRF 1XRSA 1H1ZA 1KULA 3K2GA 5IT2L 5E09A 5EO1B 2PZNA 2XUWA 3CHXA 1W0VA 3P9WB 4P4KC 5C08A 5C3IA 5CILH 1KYUA 1MKFA 4H8WC 1AD1A 4Y4FC 4MNGB 1NLDH 1S5IH 1QZNA 3SN6N 1IU1A 2UY5A 2IXQB 4HVXA 1G9EA 3RJXA 1LE5A 1F3RB 3STZA 2J8UF 1BWMA 2YJLA 1I1FB 2F74B 2POZA 1G6RB 3S42A 4NERA 3DXIA 1I4FB 1LO0H 1WSST 2E6QA 5GNYA 1K4GA 3BP4B 3MGOB 4LPWA 4P4RA 4KCWA 2YGPA 2XTLA 3VABA 5LUMA 5CSSA 4BCEA 3BPNC 3HGRA 4RMVA 1M1XA 5T9BG 1S7RB 3DJTA 4XNQA 3P8JA 3RL2A 1EYEA 1AIZA 4JPIA 3T3MF 2FDMA 3CHVA 1QO3B 4FXRA 1UA6L 3BPOB 2NWSA 1UOVA 2NV2A 4DVOA 1E9QB 3LPFA 4M81A 1EGZA 3HC2A 2XWJB 2H3NA 5I18H 3FTUA 4TUJB 5D05A 2GITA 1VYSX 4YHLH 3LHPL 3E80A 5I16B 1SJHA 1TSRA 1LDCA 3GSXB 3E2SA 4HW6A 4GI4A 1G01A 1OW0A 3BFOA 3LRSB 4UIMA 3U9WA 2P8MA 2W9EL 4AQEB 2PO6C 1R86A 3ZDYB 3E9UA 3MUZ1 4KNTA 4CSZA 2OO6A 3D3FA 5D1QD 4MKNA 3SPCA 1U8QA 3OG6B 1E4XL 2UYLA 2L3BA 1DSFL 2ZA3A 4AX7A 3VAEA 4CAGA 2Z6IA 2MOGA 4KAQL 2CDFA 2J43A 5HPMB 4TQEH 2FYVA 3FFCD 1P7HL 1L5GB 3D2UB 4W9JC 3ASNB 1FNGB 3B8WA 5EOQH 4H1LG 1AR2A 1I8MB 1OVDA 2FGLA 3UC0L 2QTEA 2X4RA 5I82A 3GLZA 3B4NA 4US5D 4NRYB 3CIXA 4GI9A 4DB7A 4NZTL 2QQNL 1IBYA 4EANA 1BMWA 3E0GA 5HHOA 3LV3A 3NJJA 5IFAH 2UY6B 2ZJSL 1RZ7H 3AB0C 2BMKA 2W62A 4RRPG 3RY5A 2DT1A 3MRQA 2YL6A 4KJPD 2HVJA 2VWEE 3IJEB 5IBUG 2X7WA 3GIZH 1ZP3A 4MY9A 4Y9MA 2W63A 4XC1H 3X3FL 2LHAA 1RUPL 5EU4B 4R7DB 2ZXWB 4CSSA 3VE9A 1V7NL 3COOA 2VABB 5I8OL 5LNSA 2ICWI 1H7NA 3L4CA 2OK0L 1UM6H 1OP5K 3TZVB 2VMDA 1H49A 3P84A 2X1RA 3VDBA 1I8LA 3QN3A 4X6EA 2ATKA 4O12A 1CFBA 3UZEA 1FHGA 5TD4A 1BW8A 1ADQL 4EVZA 4NOBA 1JXJA 1LOLA 4Q0XL 3R4IA 4XVJL 2DEXX 3OHXA 4DN3L 5CJNA 4URTB 2A6IB 3CPUA 1ICPA 4NQDA 1DVFC 4DIAA 1OCBA 3DARA 4GX8A 4ATTA 1WS8A 2DZUA 1MI5D 3S34H 3QORA 3KEHA 2FX7L 3CFBA 4NQXA 2P3EA 3TNOA 1OCCB 4AJVA 2WLNA 3TNMA 3HCVB 4C1NB 2A9ML 2PPAA 4EF3A 2F54B 5EN2B 1Y7VA 4YHNB 4HUXB 1OYCA 1S7TB 3GLEA 4HCLA 4YPGB 3VNDA 3QZEA 5EMJA 4H8NA 3M0KA 4XNYH 1SEQL 4E2VA 5C7VA 2C0AA 4DFHA 1AR1C 4LP8A 4PTXA 1GVQA 3HB3C 3ZRFC 4G1MB 2HRLA 4HMCA 2NPLX 4IRSB 4UDTB 4DJFD 1R38A 1VCFA 1HCYA 3DOHA 2ZUWA 4J28A 1M3IA 4HKZA 4BSVB 2DSUA 1MZHA 4HJFA 1NZRA 5GRWA 3C2SA 4GQ0A 5CGYC 4GNVA 3NCOA 3S5ZA 3GMNB 3KR3H 2NQCA 4KNQA 3VNJA 3RE0A 3V52L 5HYSB 2V82A 1R3JA 2WBJD 3O6FA 3FQTA 1XR8B 3DFTA 43C9B 5BJTB 1TV8A 5E8PA 1OTUC 4M6ML 1TKWB 4GJJA 3TF4A 4RX0A 3BGFB 4WTWA 4AUYA 4P2OA 1JG9A 3QUZB 4PYGA 4M1RA 2TRYA 2HA1A 1M9SA 5EFDA 5ERWA 4MXQC 3H2AA 1OYBA 3SDCC 5K1VA 1E4LA 7FABH 3DHPA 2DIKA 4RFOH 3C2FA 1E56A 3G18A 3X13B 5C55A 2LOEA 1FP9A 5IV2A 1CICC 3GI9H 3QI9C 2HQAA 4Y9EA 4I9MA 1GCFA 25C8H 4LUSA 1EJWC 3BJ91 5FJJA 3WXVH 5EZIL 3BSMA 4ZUTB 1H6TA 3W23A 2OA9A 2XTJD 1JF1A 4OD2B 2E5CA 4EZLA 5D8JH 4ENED 5E9AA 1BZ9A 3BGGA 4F0MA 2UVEA 4UB0H 1XLHA 1MQKH 5CJ5A 3DV6A 4Q9QL 3ELFA 3M4HA 2WMGA 2YO3A 3X12A 4A22A 4ZPTB 1NWSA 3BUBA 3QRHA 2OKOA 3DFNA 4DO5A 4DJEA 5DUML 3WBXA 1K9FA 2VEPA 4LFHD 2QGCA 4YO0B 5FLVA 5IROA 1TPC1 4JYFA 3HRPA 4MBRA 3JV6B 3MDWA 1FNLA 2C3VB 1IR2A 3RGVC 1MUCA 4R2GC 2J6WA 3ZL2A 5DD6B 3H2WA 4NBZB 1X5ZA 4UNKA 1CFSB 4UMAA 5ANME 1BVNP 4X8CA 4FOKA 2Y69B 2CSPA 3T09A 1K4DB 1GVSA 4C6MA 5CNHA 3QDMA 3FA5A 3NPWA 4N0CC 2PP8A 2EPKX 2WQUA 1L9SA 4Y16B 2DUZA 2R69A 4GUCA 4Z23A 1XCTB 3WDJA 1A6UL 2XY1A 1AL8A 1DZ0A 2IPKA 4KFOA 4ZW7A 4H8WL 4ZW8A 3N43F 2DWSA 3NZPA 1OTTC 3QHFH 4GW1A 4D3CL 5HYQA 5CGMA 2AJVL 4H00A 5TNVA 2JXMA 1PHWA 3D4ZA 3SYCA 2V2WA 5FDWA 3UWYA 4HG4J 5HY9A 5EC1A 2UWEA 4Q8MA 3QNYA 4TTUA 4RCAA 3VGAB 3VWKD 3DIVA 4UIKL 5IJVA 3X14A 5EBUA 1DIDA 4AU0A 4QHUA 3OYZA 3WBDA 4P3WA 4V1YA 1WZ1L 2I9EA 1E5UI 3V0IA 3E2HC 2MEJB 3F7VA 1ET5A 1P4UA 4MJZA 5I0YA 1IQWH 4L4TD 4BXVA 3NDZE 3F7YA 3C9NA 3PHQB 4PBWD 3C08L 4LLWB 1BEUA 1KTNA 4E9WA 2VUYA 2MRYA 4FA7B 4KWOA 3BTNA 1K1DA 4H88L 3NYKA 1KBGH 2NTFA 1G7MB 1XF3B 4LSTH 2DQIH 1XBDA 2XNAA 4FA3A 6TAAA 2PDWA 3EHBB 3FKRA 1M6JA 2JCCE 4XN7A 2Y1VA 4XD5A 1RUKH 4Q56A 1F6PA 2XG5B 4X80L 4P5TA 2DZEA 2VC2B 3S6TA 1G0YR 3MLXL 3BANA 4Z5RA 1TMQA 4MQXC 4E9XA 3ULUC 1S9XA 1KRMA 5HGDB 3WKPA 3IKKA 4FX6M 1KNOB 2XZ9A 4F20A 1DP0A 4YHKL 3AU1A 4JZJA 1MCNA 1QUNB 2VTFA 4HJ0D 4PJ7B 4UANA 4DLMA 2JEPA 3FRPA 1IILE 2JMRA 4N8VA 4ZL1A 1JFQL 3WFHA 2YAQA 3PYCA 4EOUA 3C09B 4UT9L 4WJKB 2YCIX 2FB2A 3ABZA 2B08A 4NKIL 3QUYC 5ISZE 3IDXL 2ZZ3A 3RR4A 4ELMB 1S9YA 3QQNA 2HJKB 1O4UA 1K7XA 1RJYB 5K69A 3L4XA 3KOYA 2XKNA 2X0SA 3DI2B 4PMJA 2X0VA 3BVNA 3VRIB 2Z6FA 4E3VA 3FU9A 3SCMD 1N26A 5E8NA 1RJZA 5H35A 3EAKA 4OM1H 3KTSA 3HR5A 4JNXA 4YK4B 4FQ2L 3IFOA 4J2QA 4JVUA 2NNXA 1AD0A 1Y8BA 1VRXA 4GKOA 1YYML 1WAEA 4IGMA 3HFMH 3UPWA 3VH8B 4PY8J 3S96A 5IMLA 2Y63A 1NPNA 4ODTL 4IP4A 4G1KA 1QK0A 1HEZA 5IESL 3H9SD 1LQBC 5GS1C 1GS6X 1ISXA 1J2WA 4F57L 3RM8A 1BECA 1JCLA 4NAFA 1RQEA 3W85A 1G1YA 4GRWF 3IJIA 3SY5A 1B3WA 3DGGB 4PJEB 2QQLH 2YBGA 1Q63A 1UMYA 1Y0EA 5TFSH 1PNCA 4NPJA 1I8JA 4Y19D 5IEHB 1CK0L 3VD9A 3OJDB 3PDOA 4HG4K 4ZQCA 3U6RB 1DQLL 3EOAB 4KRPB 3KCLA 3M0JA 3DHFA 1E9OA 5I6KA 4TX6A 4PS4H 4F0RA 3MRNB 4WUUE 4JN2B 2WTOA 4OQVA 4FPSA 5JNYA 4XCCH 3DSFH 2BODX 2VGLM 3NZRA 4MY1A 3FCTA 3DNKA 1ZHNB 3PAJA 2EKCA 3L2LA 2C3HA 4HJJH 2Y8UA 1FPTL 3BMVA 3MX0B 2A3LA 3NPZB 4IKNA 3MRCB 1XD1A 3UCRA 4LTSA 2UWEF 4F7PA 4OV5B 3KPPA 2WZ6A 3BFQG 1T0NA 2XN2A 1BXUA 5CGBA 4FCAA 3ONCA 5EZOH 1EBAA 5D71H 1DVXA 4HD5A 4YIQB 1E7UA 1IMHC 4Y2NA 1CI3M 1MH5B 1ZLVK 1AW2A 5ANMA 4Q8WA 3AGWA 2E25A 2Z34A 3N3EA 5AB0A 1ZXKA 3WIAA 3VU1A 4HKXB 3WEXB 1NANI 5L2KA 1N0XL 2AV1A 4MXVE 3UVIA 4PH8A 3V1HA 3QIWB 1ZPUA 1RP8A 2AQOA 2J1XA 4P2QB 3REVB 3LKSB 3MYJB 4WI7A 2WN2A 2NUTB 2EVHA 4Z0JA 4PUEA 4A8LA 2JIXA 3LX9A 1OZQA 3TFKD 4XBSA 2HT4C 4QGCA 1LWHA 3G3LA 4DI9A 5C0GA 4YC2B 3O4OC 1JPIA 3IWPA 2V5TA 1ZA6B 1T7WA 1NL0L 1CDJA 1C9WA 1XX9C 4AQ8A 4Q4EA 4PUDA 2FJGB 3T71A 2XVLA 4NQED 3F7LA 4LS2A 1U0QA 3VIOA 5F9JA 1UEMA 1N5YH 3S83A 1QPNA 4HIJB 3BUYA 3EFDL 3N4AA 5D2LB 3OXRB 1U2YA 4DP1X 5AHMA 4LDOB 1KFLA 2X1PA 1K3UA 1WUZA 1YAIA 1U3HD 3KPNA 5E8OA 2IUZA 1KCBA 5D9SB 1FC2D 3AGVA 1P0DA 3FCBA 1YEGL 3QC5X 4DETA 4AMAA 1U58B 1FG9C 2H9AA 4NKCA 3EPOA 1WDSA 5G1YA 5ES4B 3TEXA 3R0MA 4ZUUB 3EBIA 3LSBA 4JQ3A 2VW4A 3O6MH 1RUAH 4V33A 2OR9L 5H94B 2GDUA 4PJFA 1UA6H 4AVFA 4GAYB 3QZOA 3GXNA 5D1ZC 4QUOA 3E6FB 1DANU 1Q2SA 3KCPA 1JNNL 5A6BD 1HKFA 3CFIC 1ZP4A 5ESAA 2O0TA 4DEUA 4KXZH 1UFUA 3I84A 4GIAA 2CLPA 4XD3A 1V3MA 2VDRB 2GJZB 1ME7A 1E0UA 3PGCA 1MEWA 5BUAA 3DMMC 4OCYL 3P69A 3FOLB 4Z2KA 4Z2IA 2HROA 2W9EH 1AA1B 3KHJA 4Q7NA 5DSCB 5C07A 4N6FA 3BOLA 3LMJL 1GQNA 5FGBA 2WJEA 3CFEA 1ISZA 4E2BA 3ZE2B 5DC2A 1QNOA 4P5UA 4S2BA 1CW2A 5FXCH 2YD2A 1DSFH 4MAYD 2Y7DA 2YZ1A 3VFVA 3P0GB 3S5SA 1FVDA 5ISZA 2DQJL 3INUL 1MDTA 5DJ2A 3HNTL 1FH8A 4AUJA 3EYVB 3DX7A 3WDHA 4MNQE 4JW3A 4KBXA 5EBGA 4QRBA 5GS2D 1R6VA 1CNVA 4I48A 3UC0H 3ZDXB 1KFKA 3M46A 4AV5A 1P4LA 4KMTL 5KVEH 4Z7UA 1PKYA 3FN0H 4WWKA 3TONA 3GSNB 1R3KB 4HXAH 3SSZA 3ULUL 4HZMA 3CLEL 3FFSA 1JNLL 4QRQB 4XPBH 2OGYA 4BWWA 3S9IA 4Y4KD 5E0QA 5CBIA 2DKMA 4P57B 4OB5H 4L3EA 1V7NH 2X28A 3RX2A 3C86A 3CLWA 3ZXAC 4N2CA 3P02A 3D3AA 3QIBD 4ZAKB 1R5VB 2QCCA 1XF1A 2OK0H 4Z3EA 5KUKA 1LLZA 3KYMA 1Q65A 4B9GA 2TSAA 1X7QB 3O3RA 3N3TA 4U1MA 3I6EA 4U4IA 1NFPA 3G08A 3Q4DA 3A13A 4DM1A 4Q0XH 2FUQA 3AUJA 3ABXA 4DN3H 5KUMA 5DJAA 3QFEA 2NXZC 3KLAB 1TJIL 5T5FA 2F2HA 1RUQH 2CMRL 3T0XA 4X4ZA 1DDHB 2J27A 1OO2A 2ZXCA 3B1UA 2Y7QB 1OVZA 2WBGA 1NAKH 5KSWA 3BN3B 3VI3E 1JRHL 3SQMA 1BLNB 2PDLA 3WKYA 2EPLX 3FSZA 1T83A 4IJ3B 4NO0B 3L45A 3LZQA 3PUGA 3DX5A 2FNBA 1T8XA 4AEIH 3I2CH 2ZNWA 3KLLA 3H7UA 1GYCA 1M2OA 5FECA 4WGKA 4JFDE 4MDRA 5EB9A 1V08A 1D5BB 4PY7A 3EOTL 1GJPA 4PJIA 1T0MB 3U46A 3FT9A 3VOFA 3VFUB 1EEYB 3P4OA 4DZHA 1QP1A 3DDFA 3GE7A 1YYCA 1CLZH 4K3JH 3OZMA 3V52H 3VWJB 3UTSA 5SX4H 1KENL 1RL1A 3OJGA 3QUGA 2Q01A 1RMFL 4C5YA 4KMQA 4JE4B 1CT8B 5BUPA 2GSJA 4M6MH 1YY9C 4XCYA 4BSWA 5AYBA 3BZGA 2NVDA 2H0FA 3S5LB 1V3JA 4M4RB 4Q3MA 3CDYA 4W86A 3A9IA 1XSOA 5EO0B 4ZS7L 2GJ6E 4AYGA 4PJFF 4GVFA 2R24A 1EZLA 2BINA 4Q6IC 4U28A 1UWIA 2YYUA 5TQ2L 3K0WA 5J9PA 3QFDA 2EO7A 1I82A 2EVJA 4X8GA 5JW5A 4LHQB 2PC8A 2K8QA 2Y7MA 5T5NF 5EZIH 1YMMB 3UJRA 5CJXC 4JTEA 4XMTA 1LDPH 1DO5A 4Z95H 4IPLA 2ENPA 4WFED 1D2KA 4NQSB 4S1SL 4EIUA 4K7FB 2R29A 5F6IC 1KRBC 3NH7H 1FWTA 2Y62A 3STFA 3CPLA 1XT5A 2VW7A 1X4ZA 3RYMA 2X7VA 1KG0B 5DUMH 2BP8B 4BKLB 4BKNA 5BRBA 2APXA 1MVYA 1JFHA 5F1IA 4U1LA 5CILL 2XZQH 4OCLC 1KJMA 3WLSA 3UR7A 4F0LA 1NLDL 3TYAA 1S5IL 4QTHB 3ARRA 2R83A 3HPFA 1KLYA 2DLHA 4Z7UF 3O3BA 3RKDC 1I8KA 1OSZB 3GDBA 1ET8A 4Y2WA 1K8CA 1A6PA 1X3DA 2F68X 5EPDA 1JVLA 4LYKA 5GGUA 3ZZLA 2Y7EA 2ZD0A 5IBTH 2FSEB 4JFQA 1G7IA 3WO8A 1ZSDB 3G77A 4PREA 3WFDH 1KRCC 3D6GA 4H8WH 4AYSA 3GTFA 4RFEB 4HJUA 4KRMB 1I8IA 4D3CH 4MFDA 2WKOA 4D94A 2B20A 1WQVT 4YHLL 4OGAC 4Q4PA 4UIKH 3LENA 5GS3A 1RVFH 3N4FA 1E28B 1BQHA 2EDWA 3CAWA 4GXMA 4MNQA 4BFOA 2K4AA 4FNRA 3LTSA 5D4JA 3ZJ8A 1WZ1H 5FHBH 4Q7BA 5H91A 1LBMA 3SPHA 2RHGA 2QCEA 3JS3A 4EUPA 3WTXA 5CR8A 3M0MA 4HYWA 1HZYA 3WMCA 2Q86B 2RBLA 4U6TA 3BVDB 1TVPA 1PZSA 4PW3A 4TQEL 4PJGE 2XVGA 3AG1B 4XKYA 5FIEA 2EIZA 3KPSB 2Q6WB 4DWSA 4S0SD 5AC5A 2C1IA 3II1A 1G4RA 4DM2A 1MHCA 2XWCA 3C8KA 1BZOA 4D9RD 4RQQA 3UIZA 4PZVA 5CZVH 3MCKA 1C29A 3IS4A 2BJML 5HI3D 2OVLA 4JFEB 1F6YA 1L2UA 1VFOA 1IFRA 2HJLB 3B2MA 4DBSA 4PJIF 3TV8A 1RZ7L 4L3AA 1ISVA 1LL4A 1GQIA 1XEUA 3DURB 2E40A 4YVXA 4X0KA 5LXGH 2W67A 4RDZA 1EB3A 2XQYA 3DHUA 4GSXA 1TVHA 4YVNA 4XC1L 3QQ1A 3VDGA 1BP3B 5MHSD 4Z7NB 1ZJHA 4JLRB 1XGRB 1ETZA 1WEJH 4H9TA 4C7GA 3W73A 3VRLE 2GUOB 4YX2H 1UM6L 4N8PA 3ESUF 1NJJA 1B9KA 2WCAA 5A2AA 2VOMA 4IHCA 3PS6A 1OGAE 3SKOB 3I4EA 2MQ0A 5FK9B 3L48A 2C1OA 2H2SC 4P7OA 5C0BB 5D7JB 4UXDA 5DT1H 3VC6A 3L5WA 2WXMA 4N2MA 1U4EA 1REQA 2OQLA 3W26A 3S34L 4QG9A 4NO2A 3ZE1F 4FQ2H 3GMRB 4JFDA 5KZCD 1KW1A 2A99A 1VZWA 3MZTA 4GRMB 4RVBA 2IAMC 4C6NA 3D85A 3NYDA 4DOHB 3LLFA 3CVCA 1FP8A 5EU3B 1A4LA 1MNZA 1L9PA 3B2DC 5I1CL 4IIFA 3VFRB 1DN0B 4XNYL 4TF4A 4NT6A 1XIDA 1DQQB 1JPKA 3IPWA 4YR6A 4E68A 4ODTH 6CGTA 1IM3D 3VZZA 3TA3C 3APGA 5IESH 1A5UA 2PDCA 5JPMA 5CPTA 4L64A 2DFAA 4F57H 3FHAA 2Z64C 4HETA 4H2CA 5ENWA 1YE6A 3IRDA 4I1NB 2IQDA 2GJ6A 3LU2A 2R1WA 4QOKE 1KYDA 1TPXC 3KR3L 2JGQA 4B27A 5IQ9A 4TUOA 4Y5VB 1CK0H 1UYWL 2IDUA 1ZWIB 3K2UL 2WUCH 1GR7A 2WXIA 3FF7A 2KERA 1QWNA 1UP0A 3SE8L 3W28A 1DQLH 3KBVA 2OG9A 1IIIA 1WAWA 4ODXB 2Z65C 1AO7B 3E6HB 1WV7T 1NQBA 1MJ7L 4PBGA 7FABL 1U1HA 4JFHD 1KO0A 1MREL 4XAYA 4YDVB 1NGWA 1T22A 2WKOF 4Y2DC 3WEOA 3GI9L 3ALPA 1KGCE 3PWNB 4WENB 4J4KA 3APNA 3KBJA 4JN7A 3MSDA 2A85A 4L23A 3REQA 4F8PA 4ZUVA 3QEUB 4LK4A 4IIGA 3B2PA 4L1WA 1DHPA 3BXNB 1FCVA 5DRCA 5D8JL 4I18B 2OMZA 3ZKXC 2XWTA 2AK1H 2E8YA 4W9KC 1CXIA 1U8JB 5AW8B 5JXAL 3MREA 2ERJC 5H37H 1CD1A 1KTDA 3G6JE 4L3FA 1DTUA 3GEWB 4LVDA 1RXLA 1UD2A 3VW3H 3ZE0B 1K8XA 3I85A 3W6LA 3L66A 4FXKC 3V6OE 3FYEB 3RMEA 2QJGA 3W83A 1SFSA 1L9TA 4MZ1A 3RZCB 4RZCA 1VACB 5DMKA 5B1JA 3HRZA 4HZ7A 5IQ7L 3O4LE 3O8XC 3VFSA 5DC4B 2J62A 1USZA 4JB9H 3D8MA 3JUZA 1CPUA 5I09A 3MGAA 1NCBL 4B7LA 2V2TB 3WS6C 3O6KL 3PBUA 1H6UA 5DTFA 2WQSA 4GG9A 4P23B 3GDKA 1NL0H 1U9KA 2FWSA 4QY8A 1GVIA 5HATA 3NXFA 1QFWM 3STCA 4N4YB 2ZVIA 1P7QA 4E5XG 1MDRA 2JQAA 4KV5F 5KYXA 4Z7WF 3LV6A 3RLGA 3RWDA 1WK0A 3LXAA 1JMXA 3G9VA 4BHUI 1U8MA 3ZT5A 1URZA 4G43A 3CWOX 3WBEA 5EU5B 3O45B 2N7SA 3PTMA 2AGKA 1YEGH 2PTWA 3PR2A 4LPCA 2JTYA 2V5RA 3QS2A 5C3TA 1OQXA 2VE6A 3B9KB 1ORQB 4X3ZA 1XYAA 1O68A 1FWIC 2IFGA 3ZJ6A 2EIJB 3UZVA 2XFGB 4BGDA 1EOKA 4JEGB 1B6UA 4B15A 5DRNA 4IBWA 4HJTA 1B2WL 2Z31B 4C83A 1IC7H 4RV8A 4L9XA 1XICA 4NZ3A 5C54A 2NY7L 4PRIB 2PBGA 1UYQA 1JNNH 2P24A 4JHOA 1TJGL 5CN2A 3V9FA 2VLJD 3SUTA 3K8LA 4DUVA 4HPJA 3GVQA 2G75A 5EGRA 3FSWA 2X6BA 3UCCA 1FGNH 4H6QA 1OFAA 1XINA 2I1OA 3BQ5A 2F0CA 3LMJH 4DP8X 4Q8TA 1UW9A 1FYTD 1R2TA 1HSAB 3O2DL 4QYAA 3SDDC 5A16B 1DWAM 4KUCD 1W9BM 2WJFA 1TR7A 3V79C 1OGAA 3INUH 1RFDL 4HS3A 1CT5A 2EPHA 4NC1C 4UTBA 1EHNA 3KDMA 2PGRA 1DJSA 4LEQA 4XZHA 5DJDB 3DUGA 4IOIB 3B6SA 2L7UA 1X1NA 3FQXA 4CKQA 6XIAA 4KTYA 3MV8B 4MX7B 1ZS8B 2HRPH 4AWJC 4OAWB 1F07A 5CCGE 1WD9A 4X2PA 4WI0A 5C0FA 9RUBA 3VOCA 1TEFA 4CU8A 2QEJA 5HVHB 4Z7VE 4BQ3A 3FFDA 3QRBA 3SSJA 1B4TA 5FF3A 4FP8H 4Y9OA 1BZEA 3SZ6A 2V69A 1QSEE 4NKOB 1S7QA 1U42A 1WS7A 3PQYA 1UCBL 1TTAA 5BNKA 4OM1L 5CQ1A 2IDCA 2A4CA 4DWHA 4KIEA 2DLGA 3FU7B 4IT1A 4QNEA 3PWPE 2F53B 3ESNA 5E0CA 4FYTA 5D2NB 1ZNNA 4NNAA 3TBWB 1G9MC 5GZNC 5EMMA 2BSTB 3ECBB 4HVBA 4CVUA 2VLKE 3GW3A 4QOKA 2NY3D 1XFBA 2ATPA 4RA3A 3F4VA 2E67A 3LDBB 3KJ4B 4LKXA 1XLJA 2CMRH 5EBMA 3VFGH 1DJYA 3GBDA 1I9EA 4Z6AT 1MZZA 3KS0J 5E9DE 1EP1A 2I32A 1M4KA 5TFSL 1A64A 1RCQA 1QRNA 3DKLA 2FT7A 4FQXB 3T0EE 3K6OA 4KNSA 2H3BA 1C1EL 2X9XA 4Z7QE 3PL6D 5IR1B 2D3LA 3HAEG 3BEVA 4MNHA 3TYGL 5DZVA 3L0GA 1ZA3B 2HDJA 4CVZA 5ICXB 4OLZL 3RX4A 3AQZA 3S1UA 3F01A 3O3AB 4M61B 1X5KA 3EOTH 3CZJA 3BKMH 1KGIA 1E1FA 2NUXA 1YPXA 3AT9A 4XCCL 3PY2A 2V37A 8CGTA 1EDGA 3L3IB 2HFTA 1PHQA 1E9IA 5EIQA 3EYOA 4HJJL 3KS0H 4I0CC 2Y9RT 4NUPA 3IDIA 2MWCA 1ED3A 1KENH 2WWDA 5IW6B 5ESQB 1EP2A 3W01A 1Q66A 2XACC 1U8PA 4KEMA 4OZFG 4YSSA 2I7SA 3QWNA 4PGEA 3WNOA 5EZOL 5DUBA 5K93A 1O6VA 4ZS7H 4K8HA 5AC8A 4C7DA 3IAPA 4JO8A 5EY5A 1CE1L 4I6KA 2FECL 3WLBA 1HIMH 4B16A 2EKSA 5TQ2H 2WBWB 1AD9A 5JXEC 4U3HA 4YWIA 2WMJA 4G5DA 5G2NA 5HJYA 4NP7A 1QFPA 4UNTA 5KVFE 1ILSA 3PPEA 4KQ3L 1DXEA 3HQPA 3F2LA 1HVXA 2O5XL 5JORA 1HEJC 2WWMC 4J4PD 1XL4A 1W1B1 2OEMA 5LKNA 2P5WD 2UY2A 1RH8A 3RU8L 3TEWA 1J8HB 1MPAL 3MUXA 3S8WA 5I79A 2DICA 2E9BA 4FYRA 4MSSA 3BZFA 2ZX7A 4PCNA 5GJPA 1J1XH 1GYNA 5LXEA 5E5RB 5D6CA 4DN1A 3WO4C 4AXWB 1N5YL 5DC0A 3O6YX 4NQVB 4UNVA 2CCVA 1FVEA 2OTUB 1GGOA 2FZ8A 4NIKB 1NQKA 5IM7A 3ZTCC 3SGDH 3BGAA 3HNVL 4TULH 2J7EA 1DORA 2NYYC 3LNHA 4F93B 3F12A 4EPKA 4FULA 4HWNA 1PLAA 3ZDZB 2YK1L 4O02A 4Q14A 1HKJA 3GDRA 5TAOA 3O6ML 2CLFA 1RUAL 4Z77A 3ZO0A 1HE7A 2BY2A 4G9FB 1ICQA 3L3OB 1Y18A 3EXLA 3FUIA 4KQNA 2OJEB 4ZFOB 2XRAL 2VGIA 5LNUA 3GKAA 2J4GA 1FZJA 1DXIA 4LCWD 3BG3A 5C9KA 3G3DA 2RGMA 8FABB 3VOIA 3QV7A 4OVUA 3INPA 1EJFA 3VXRB 4AGLA 43CAB 5B4MC 3L1OH 1MUWA 4LS1A 2PP1A 3E02A 1SMDA 4CDHA 5K9XA 3M43A 5BS0A 5F7LB 4WDTA 2XH2A 5C09D 5C6PB 2DZPA 4GQQA 1TO3A 3DBNA 3GSVA 4KKZA 1ECEA 3LSCA 3QZNA 1QHOA 1OCNA 3LYEA 4APXA 3QXDB 2XGBA 2XG9A 2GLKA 2HVOA 1UKPA 2ZDSA 4G7QB 2I9LB 3L95B 3SDOA 4M3KB 1HKVA 1XB3A 3ILQC 4WHBA 3VXTB 3OVQA 2MNWA 3I3EA 1DQIA 1W9DM 2D7TH 2BJMH 3K5RA 2WWCA 1I9IH 1AJ7L 5BVJB 5KVEL 5FR3A 3PE9A 5CP3H 3MJMA 2GUBA 1B4LA 2P5EB 2CKNA 3FN0L 4LRTA 4HXAL 5F9AC 3KYNA 3PWPA 2D2CC 1KC7A 3LXBA 4X7FC 2R1YB 4S3DA 2YEVB 4CNUA 5ECGA 4LBEB 4XPBL 3KWVA 4UM8B 3FT0A 2J47A 2RDUA 3MRKA 5JVLA 2WYSA 1X5LA 3TX9A 4OB5L 4C1LA 1CIDA 4HWZB 3N73A 2YLAA 4ERAA 2C3GA 4HCRH 1HILB 2PTTB 2PP9A 2Y22A 2BNRA 5HJBA 4AZ6A 3PP3H 1HT6A 1AKJA 4FQQA 4N2AA 4KY2A 5E9DA 5D2YA 4F2EA 1W80A 3NIDE 1ZAHA 4BKSC 3D0VA 3QDAA 1XR9B 4YJ5A 5AC7A 4RAUB 5CKSA 2J8FA 3T0EA 3QZMA 3B8VA 4M9PA 1NC4B 1DBJH 3I02A 4Y5YB 5DJ0B 1RUQL 3PWJA 2F84A 2ABBA 2FEEL 1AQMA 2X70B 4GAJL 1SGJA 2EUVA 4YHPB 3VA2C 1B0IA 3GEFA 1HIZA 3HOGA 1NAKL 1G9ML 1UD8A 4FXLA 1NFIB 4MD0A 1H7RA 4U0RB 1JXDA 2OMBA 2XJ7A 1HN1A 4IK6A 5I1CH 3DOSB 2DLFH 4G8IA 2O6PA 4XNMA 5JR1L 4NCDA 1AFVH 3CN0A 4AEIL 3VI2A 2GABA 3I2CL 2DLTA 3OLEA 5ADPL 2PWDA 2OTPA 2DM7A 3XISA 2BSRA 2OW7A 1II4E 1URIA 1MEHA 1V54B 5AW2B 3QHOA 1QPRA 2ZONA 4UTJA 1CLZL 3TX4A 4K3JL 4BFNA 1AHWA 3N2BA 1R75A 4N0UB 3AADB 3K80A 1TV7A 1Q6LA 3OEXA 1UYWH 4P3DB 3FUKA 3K2UH 3WMPA 3NESA 4M6VA 4MKTA 5LA2A 4LMQI 5C08D 3SE8H 3L12A 1KY7A 2E56A 2DKUA 4WHTB 2J77A 1GCYA 5HMDA 3AS2A 3ZTJG 1KBWA 2K6ZA 2BXZA 3MOAH 2X0YA 4ONFL 2XHNA 1FJ1A 1BD2E 4IIHA 3JVGA 1HE8A 1MJ7H 1YXYA 4P7QA 2G3FA 1MREH 4J3UA 2M83A 4GXUM 3L9RA 1HJWA 4MFEA 2AQVA 5L7XH 1KMGA 2Q2EB 4LNYA 1EJOH 4RDQF 1T5KA 4UCGA 3FT3B 3F4WA 3C12A 2Y7NA 9XIAA 1GOMA 1QA9B 3PP3K 1P7KB 3P77B 1AGFA 1LDPL 2V5CA 3PF2A 4Z95L 2J88H 1E6XM 2LLLA 2QZQA 3SUUA 4I8DA 1I85C 3QRGL 5JXAH 4XZ9A 5CSRA 2LW3A 1M65A 3ITOA 3G1RA 4KETA 3NH7L 1R4XA 2GBTA 4ZZFA 3SOTA 5ACLA 1E6NA 3L7EA 2QKIC 5FHAL 3HE6B 4NN5B 5HGHA 4N2DA 4OIFA 3SBRA 1E5JA 4L3CA 1PDKB 1M71B 1JVKA 4XO7A 3T4YA 2XZQL 1W9VA 1GY2A 3GJFH 2JK5A 1S7SB 1T4WA 3QXTA 3D48R 4WK0B 2CBQA 5IQ7H 3CX2A 3G5EA 4JFWA 4LHUB 3NGJA 4ACTA 1CFMA 4M6OH 4MAVA 3QLDA 1T1ZA 3MN8A 1AH0A 1NCBH 1QVOB 3O6KH 1DVSA 4UNUA 4PR5A 1NUNB 1EUTA 4YCPA 2D2JA 2GIXA 1OWQA 1KXVA 5IBTL 3MSYA 4O1EA 4NUGH 3AYVA 4ASTA 4FQJH 1CFTB 2C6QA 4MWAC 1X9LA 1J0KA 1CD8A 4PRWA 3WFDL 2OQYA 1V27A 1PZ5B 2ILLA 5JIWA 5HHOD 4BM7A 5JPNC 2ETWA 1DBBL 2ZZ1A 1BKHA 1O9WA 4KZCA 2CDEA 3EOBA 5IUSA 3FYIB 2BHUA 3MXWH 4XZMX 1GVOA 1S9VA 5KTLA 1A3RL 2BMBA 3H6JA 3MZ2A 3HEIB 2PCXA 1RVFL 3AWEA 3RURA 1VKFA 1U93B 5FHBL 4P5RA 2XTKA 3CUZA 1YN6A 3MGTB 2G3ZA 1ICSA 4ZFZA 3V4VA 4WY0A 5ICYB 1B2WH 3MUGB 1ITCA 3US9A 3QPKA 3IMUA 1LEIA 2IH1A 2NY7H 2OI9C 4JICA 1BWWA 5CJ8A 3NCEB 1Z3NA 1TJGH 4CEXC 4ZRGA 5AOJA 3W56A 4NQDD 4KKPA 2Z92B 2VR2A 1R8LA 3LB0A 5H4YA 3B8UA 1OSYA 2AQQA 5IB3A 3BT0A 5CZVL 1SBSH 2L04A 3RWGA 4PTUB 3KLHD 2NNAB 5H8MA 3HS9A 3DI1A 1EIBA 1BXVA 3LRGA 2WKJA 3O2DH 3WEBA 5CBEA 1E72M 5BVPH 4GUQA 3U2SB 2ADJB 4QAIA 3VM5A 5LXGL 5AL8A 5D37A 4OKVB 5DY3A 1Q45A 5IB1B 4GG8A 1RFDH 2IOOA 4I3SH 1RZIA 4LEOB 3MVSA 4YHIB 1MAKA 1WEJL 1FQ9C 2EIDA 3GJFK 1V7AA 3QEQE 1J01A 5I73B 3FBQA 1XYFA 4H1LB 4YX2L 1O5XA 1FWGC 3AI0A 3HG4A 3DAQA 5ALCL 2CZ5A 1J05B 1SYVA 3WLWC 1R5IB 2FWOA 2NXYB 4JK0D 2HV5A 1XIMA 1MQRA 2Z2BA 5HJLA 4U1KA 3O6FD 5DT1L 2HAZA 4KROD 3H2QA 5TF1H 4M24A 5EZLA 2FHCA 3GO1L 5IBUB 1NDTA 4HPOL 3N91A 1TEGA 4CJ1A 4JTGA 2H8PB 1UCBH 2EYRB 4JRFA 2HRHA 4LMQE 1BWVA 3EDEA 3M1CA 3VCCA 5EULV 2F38A 2D73A 2OBGA 2WVSA 1J5CA 1TXKA 2E59A 3IMSA 1J1PH 3MJ8A 1C16A 5LXVA 1NEUA 1FL5B 4KFPA 3M64A 3UDWA 4AL8C 2BHZA 1RLDA 2PODA 1N8ZB 1G87A 2IFFL 1DO6A 2PRLA 3QUXC 1BZ7B 1VPOL 1UXWB 2XBZA 3RM9A 3ITGA 4D7BA 4XOBA 1HGWA 5TDOB 2FR4B 2QELA 5FB8A 3CK0H 2J6EA 1HJQA 3B5TA 1XB8A 2IKJA 4UFKA 4ZFQA 1JDCA 3I4KA 1BD2A 3TXVA 4BFRA 4DJED 1EO5A 4UU9A 4PMOA 1C1EH 4BS0A 4OFIA 5L8KB 5DMMA 1N64L 2WUCL 5IROD 1CFQA 3TYGH 2PWGA 2CKBB 3HS0A 2QBWA 3WJZA 1T80A 4OLZH 2A83A 3U4FA 1N6UA 2W0FA 3W87A 1CGWA 4JNYA 3RDTA 4XMVA 4I0PB 4YDLB 3BW2A 1EA9C 4F33B 1IT7A 1SXZA 4ZUWA 3PBMA 1VJSA 2DZBA 1KJ2B 1WO2A 3QDMD 4B5VA 3G8EA 3ZYIA 4LSBA 3D18B 1KY6A 2FT8A 4NO3B 4WO4A 1GJIA 5IK3A 4UTCA 5AVYB 4XP1H 1KT2A 4UUJB 2MPAL 3SUSA 1GOQA 4UCFA 3TCXA 3WSUA 4WU7A 4Q6KA 5I0WA 1PDYA 3MLYH 3AWGA 2AK1L 3M07A 4PJ9A 4JPKH 3L7RA 2OMYA 4H1ZA 2B1AH 4WY0F 5LDSA 4Y9NA 5F7FA 3STEA 1CE1H 4DQWA 3HN5A 1SLUA 3VW3L 3OD3A 3TNNA 3X1EA 1ONQA 3BESR 4GJIA 1BOGB 3B5HA 5IBXC 4WJXA 2JKIS 4LVNC 3W11D 5F7BA 1KM3A 4GC4A 1WXYA 3TR2A 4M3HA 2APVA 2NLJB 1YMHB 3VJ6A 4JB9L 4KQ3H 1BQUA 2FL5B 3U36B 4HHAB 1VLWA 2O5XH 1XBRA 3QWRA 2B15A 1X5FA 3TVMB 2YAMA 2A7PA 4OECA 3IS0X 3RU8H 2GSMB 3R8QA 1BF6A 3W7LA 1MPAH 1IIHA 3W1UA 4JDTL 3OKDB 5DCDA 2IV8A 1KGJA 1TPB1 3NIDF 3MKCA 1EHXA 2INZA 2ITFA 2GC7C 4KRNA 3ANVA 1EEPA 4RW5A 4UMBA 3I6RA