1XGZA

Structure of the n298s variant of human pancreatic alpha-amylase
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDSHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Alpha-amylase, pancreatic
publication title Structural and mechanistic studies of chloride induced activation of human pancreatic alpha-amylase
pubmed doi rcsb
source organism Homo sapiens
total genus 174
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2004-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1xgzA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1xgzA01
2X2JA 2VZUA 5D8WA 2WHLA 1FHLA 4XZBA 3UEQA 4OKDA 2OSYA 2WC7A 1ITXA 4J27A 1EIBA 3MV11 1E6RA 1XH0A 2E40A 5BCAA 3HZ3A 1UZ4A 5IHSA 2BXZA 4CD5A 5CGTA 3VIPA 2NT1A 5E6ZA 2ZE0A 1CGUA 4PBGA 4CU8A 5BYWA 3OGSA 2XFRA 3OLDA 1J9YA 1MQQA 1E6QM 3CUFA 1W3HA 4B3KA 2WHJA 1PZ2A 3NSXA 1SMAA 2EPOA 2WBGA 2F7OA 1V0KA 4JZ5A 1JZ3A 3M07A 1KTCA 3WENA 2X0YA 1HKJA 1E71M 1SZNA 4WSJA 3GXTA 3AYSA 1J0JA 3UCQA 1F4AA 1JYNA 3S2CA 3F5LA 3DYMA 3OLGA 1JFHA 2JF7A 1J0IA 4PMZA 5HBFA 2XG9A 1D2KA 4KRUA 4OOZA 4W7UA 1AMYA 1XGZA 1RP8A 1US2A 4H8VA 3WUGA 4Z2KA 3AYRA 1LL4A 3EMQA 4W5UA 1CBGA 2VX4A 2WMKA 4ACYA 2UY2A 3ZR6A 3NDYA 2VCCA 1W9XA 2VURA 3NDZA 2D0FA 4PMXA 4AYSA 1VFMA 5GNXA 1QWNA 3CZ8A 1RPKA 3MMDA 3K46A 5HOSA 3RMEA 5AYBA 1PX4A 1CGWA 2W91A 3HG5A 3ZSTA 1QHPA 1R47A 3L4ZA 3GM8A 1BYBA 1UOKA 1HXJA 3EMZA 3T2PA 2OLHA 6CGTA 3AMDA 4AMWA 4GZIA 1E15A 2YA0A 3AXXA 3WSUA 5A6SA 2VVNA 1HJUA 2VL4A 5A6LA 3VKKA 1J01A 4JAWA 2ZICA 2J62A 3VSTA 2ZX9A 3VMOA 3KWXA 5I6SA 3WDJA 3AFBA 4AZGA 1CXKA 1IT0A 1H2JA 2V5DA 4W8LA 5A8OA 2VI0A 3FHAA 5JBFA 2PWHA 2WCAA 2G3JA 3O9NA 2OWCA 3A3HA 1VRXA 2PWDA 1E43A 1E4NA 1U2YA 3EJQA 4UTFA 3WKZA 1NP0A 5JIWA 5BXPA 2GJPA 3D4ZA 3TOPA 1XD0A 2BVDA 1V08A 5A6KA 3CGTA 3HG3A 4Q22A 3WMBA 2YLLA 3QHMA 1V0NA 4B9YA 4EKJA 3ZJ7A 4PUDA 1KCLA 3D51A 2W92A 4P8WA 3VD3A 1PX8A 3VVGA 3AIRA 1B0IA 2OYKA 4MAZA 1UD6A 1XSKA 1C90A 4UFMA 3U7BA 3CO4A 2G41A 4CCDA 4AZHA 2D23A 3L4YA 3KL5A 3JUGA 3ZT7A 4ATWA 4BCEA 1ZJAA 2QMJA 2YOCA 2CCRA 1HN1A 1UWRA 1OD8A 3WQ6A 2BY3A 3EJRA 1WDPA 4IISA 2ALWA 3VIFA 4CCEA 1GVIA 3MS8A 1ZS2A 3WH6A 2YA2A 3QOKA 3WL1A 4D6DA 1TQVA 4AMCA 1H11A 1W3JA 3KEHA 1EO7A 4AD2A 2VC9A 2XJ7A 3THCA 3WDRA 3WEOA 4C7DA 1HWWA 5CZKA 5I23A 4JFVA 3G6LA 3BAJA 5C71A 4HP5A 2EO7A 2O9RA 1FH7A 4RL3A 2ZUWA 5CXPA 3U5YA 2BFGA 4L4PA 4MJ2A 1BG9A 2EPNA 8A3HA 1TZ7A 1UR9A 1H1NA 3WD2A 5DMYA 1KTBA 1VFOA 1E72M 3HN3A 3PZ9A 4CVWA 3SCOA 3EYPA 1UR2A 2GJRA 2D3LA 4J3WA 6A3HA 4XZWA 3KL3A 3GBDA 2X2HA 4HPHA 4TVCA 1E4LA 1GCYA 1CXLA 4HZ7A 4M82A 2A3CA 2CERA 3CIVA 5M17A 2X8RA 4PSPA 3G6MA 3TP4A 4DM1A 2W5FA 1C93A 3HMCA 4B3LA 1J0YA 2OSXA 2J77A 1HL8A 1C91A 2WMIA 3TV8A 2PWGA 4U5KA 3AHZA 4H41A 2OYMA 1DHKA 1QVBA 1E40A 4UZUA 1OM0A 1GUVA 3QOMA 1BQCA 2AOSA 4W88A 4RE4A 1LLOA 1X1NA 1KB3A 1E73M 2WMIB 1WZAA 4H8HA 3WD3A 3K8MA 4FLQA 1E6SM 1KBKA 2XIIA 1SR0A 2ZXBA 2WVTA 2BVTA 2JF6A 2DGAA 3CUIA 1VJSA 1QHOA 2X05A 3UR7A 1QBBA 4OBSA 1KWGA 1UKPA 2YLAA 3GH7A 1D3CA 2OW7A 1J18A 1E6PA 3O2LA 1PIFA 1OSEA 2J8FA 2WMJA 5HPCA 3AMLA 5CPTA 4KGLA 3CZGA 1KXQA 4QAWA 4TVUA 3WMCA 3LRLA 1UD5A 4U33A 3AIUA 4OOUA 2GDUA 2EQDA 4HA1A 4FK9A 2NW0A 3RILA 1NH6A 1Q6EA 3BUDA 3DYPA 3L4TA 3K4DA 1US3A 5EB8A 2XVNA 2VQTA 3D5HA 3RM4A 2D22A 1GVYA 1UR1A 4AWEA 4MNJA 5C8BB 1HJQA 3SUWA 4ACZB 2PI6A 3AIVA 1E5NA 1BFNA 1ISXA 3K1DA 4XB3A 1DWHM 2E4TA 3I3DA 1DWJM 2XN0A 3LXBA 4J7RA 5LA2A 1PS3A 4TX6A 1S46A 1CXIA 1EGZA 1EH9A 1GJWA 5D9PA 3ZO9A 1BTCA 3S5ZA 4AD5A 3WD0A 3LX9A 4TXEA 3W27A 4F9DA 2CYGA 2DIEA 1R85A 2CBUA 4WK9A 3BUIA 1CZ1A 1V3MA 4ZFMA 2DSUA 1OIFA 5A2CA 3MMUA 4ZEPA 5E1QA 3A22A 2YL6A 3FN9A 4J3VA 2XFYA 2VZVA 4UOJA 4OZOA 2ZXQA 1WAWA 5I77A 4CD6A 1JDCA 2TAAA 3CZSA 1Q6DA 4NF7A 3BAXA 1CDGA 2BXYA 2JALA 1GONA 1LG2A 1QNQA 4BQ4A 1WO2A 3VD5A 3VD9A 1JDDA 2Y2WA 4HPGA 3PZOA 1HXKA 1PIGA 1KXHA 3VIJA 1EHNA 4WSKA 1HP4A 4MNMA 5IXEA 4UZSA 5A6MA 4CUCA 1XYFA 4PMDA 2BHYA 4HA4A 3ARYA 4U5IA 4DWSC 2ZWZA 3OZPA 4FLSA 4P8VA 2ZX8A 3DHPA 3BUBA 1MYRA 4Z2IA 1CXHA 3FAWA 3ZT6A 3CTTA 2J7BA 3GH5A 1VB9A 5BRQA 5D9NA 4AZ7A 4UQ9A 5CJ5A 3PN8A 2ZXAA 5AC5A 4FLRA 1V03A 3ARRA 4DUVA 4AMXA 1KGWA 2WVVB 2DT2A 1C7SA 2WAGA 1C92A 2WXDM 4YHEA 4AZCA 5DT5A 1JD7A 4PTMA 1XD1A 3PZNA 2DSVA 2DQXA 1R87A 5FKYA 1JYVA 1CTNA 2XVPA 2XSBA 3AHYA 3ECQA 2OYLA 2Y8KA 1TA3A 3PZMA 2YA1A 1XSIA 2CNCA 1V6YA 3AS0A 1ISZA 4XV0A 1VFUA 4X0VA 4BQ2A 3LPFA 3WDPP 4DO4A 4GI6A 1GZJA 3AOFA 1TA3B 5M03A 2O9TA 2E0PA 3WY4A 4QLLA 2GSJA 3N04A 3VGGA 2WM0A 3MANA 3VDHA 4PMRA 5E6YA 2EEXA 4FLOA 1J0KA 2CBIA 4UQBA 1Q6CA 3VGEA 3AISA 2W61A 4J28A 1E3XA 3CZLA 2F1AA 3ZT5A 2XVKA 2BV9A 4GQRA 5A6JA 2J25A 4AIEA 1OINA 4R5EA 5D4YA 3W4RA 2DT1A 4EK7A 3OIHA 2OW6A 2Z1SA 3UERA 1HJWA 2XSAA 4UCFA 2ZIDA 3W28A 5TD4A 1H5VA 3B9DA 1O7AA 3BGAA 3W6LA 2ZOXA 5CLTA 4PCSA 1WDSA 3AS1A 3EJPA 3VSUA 3NUKA 5C70A 2AAAA 3D4YA 3J7HA 4AIUA 4JL2A 4W84A 4E8DA 2D3NA 2YDSA 1NWSA 2WK2A 3H54A 3WF2A 3EDFA 1GOMA 3TTQA 5ABEA 4J3SA 2AMGA 4S3JA 3A4WA 3WNPA 4PTVA 4EANA 4D72A 2WWCA 1NOWA 3W82A 1JZ6A 4D6FA 1OD0A 4MADA 5CPSA 2X2IA 4MB3A 5E0FA 4H04A 2DEPA 4H2CA 3AHVA 4AIOA 2YDQA 3A47A 2XGBA 4NXSA 3CZNA 5HPOA 2DT3A 2A3EA 5A6BD 3VD4A 3BLKA 3U57A 1KXTA 3WNLA 1E70M 3OLEA 2ZUSA 3RIKA 3LMYA 4D6CA 1WPCA 1JNEA 3T08A 2IUZA 2DPEA 2ZXDA 4B16A 2J75A 3RM9A 4IPNB 3WFLA 5D8ZA 1UKQA 3W24A 4HU0A 3W38A 4LGXA 1W3KA 2ZUTA 5F7UA 1KGUA 1QHZA 2YIHA 3IJ8A 4YPJA 1V02A 4UQCA 3RJYA 4AXNA 4AZ6A 2YDRA 1CWYA 3DX4A 3I3EA 5AC4A 3RO8A 1C8YA 1U33A 2IXUA 2X09A 3W6MA 4D71A 4MTVA 1VFFA 1G01A 3F4VA 3IJ7A 3MU7A 2J7GA 3PTMA 2J8GA 1DWGM 3SUSA 4TUFA 4J3XA 1VENA 4JCMA 4GKLA 3T2QA 3FY1A 1HF6A 2XGIA 1RD6A 1TCMA 3CHCA 4Z2JA 3TTSA 4QCFA 1WZMA 2CBVA 1I75A 1J10A 2BHZA 2WHMA 3H55A 4W87A 4PMOA 4NZCA 2WPGA 3WNOA 4D6HA 1B3ZA 3QGVA 1FA2A 1JF6A 3A24A 3GXDA 1J11A 4UFIA 1NOFA 2XUCA 1UWIA 1UHVA 2VMFA 3NYDA 4LYPA 2WSPA 5D9OA 3VIOA 4AY1A 4HZ6A 1FP9A 3WDQA 1QW9A 2VZOA 1ITCA 1JAEA 1JZ8A 5DEZA 5A8QA 2VX7A 2CKRA 4OJYA 1V6UA 3MI6A 2VRKA 5CSYA 4FNSA 4GO9A 3ZSSA 4PUEA 4WLCA 4WKFA 1QNSA 4MDOA 4C7FA 3OGRA 4U3CA 3WUFA 4Z2HA 3WFZA 2WZIA 1QI5A 4AZIA 1QBAA 3AZTA 3U5UA 1UD3A 1ODZA 2BHUA 1V6WA 3OGVA 2VZSA 3CMGA 1NM9A 1YHTA 3DX3A 2WWDA 4TVDA 3L4UA 3GNOA 2FH6A 2VCAA 1R75A 2G3MA 5DFAA 1R34A 4RE2A 5I3DA 2EABA 2QMKA 3B9EA 1HL9A 3K4AA 4P8XA 1FHDA 1L8NA 4N0RA 5FL1A 5FOOA 3AS3A 3BXWA 4CU7A 3AHTA 2DSKA 1UYQA 5HNNA 4F9JA 1AQHA 4L4OA 1H49A 4PTWA 1H41A 4PMNA 4D6JA 4HMEA 1A3HA 4PYSA 2UY5A 2XIBA 1XRVA 1CYGA 5E9AA 4ZENA 1V3LA 4AD1A 4J3UA 2Y8VA 2E9BA 3T0BA 1CEOA 1I1WA 3AMGA 3VM5A 1BYDA 3POCA 1K9TA 1SFSA 5DT7A 3ZIZA 3PZIA 1I1XA 3VDCA 1H0GA 2C0HA 2E8ZA 4LX4A 1IZKA 1H0IA 1HJSA 2VZTA 1B1YA 1BSIA 2VUYA 1M01A 3ZR5A 1GNXA 5AYIA 3UG5A 1TVPA 2D1ZA 1IZJA 1XCWA 3W37A 1JZ7A 1HIZA 4MB1A 2VO5A 1B3WA 1FFRA 1BVZA 4TTUA 4GINA 4AD4A 1DWAM 4WKAA 1DWIM 3EDJA 5CQ1A 1KQZA 1QPKA 4B15A 3ZMRA 1GHRA 4M56A 3BVWA 2XN1A 4HA3A 4NI3A 1R86A 1ZBCA 1ISYA 2JIWA 1Q6GA 1SMDA 4C7GA 4MPKA 4CU6A 1PPIA 4PCTA 2WYSA 3VX1A 3WD4A 2WMGA 3APGA 3FAXA 2D0HA 1J12A 1BF2A 2BY1A 3BAKA 3MMWA 3WD1A 1XCXA 3VGFA 3ARVA 1HKKA 1G9HA 5E09A 3SEPA 2F7QA 4U2ZA 4IM4A 4GPNA 3AIEA 5GPRA 2NSXA 3ARPA 4GI8A 3WDIA 1VEPA 3WNNA 3SCVA 4CGTA 1W1VA 4WKHA 3WUBA 1NWRA 3BSGA 1WKYA 3H53A 5AY7A 5CSUA 2A3AA 2VRJA 2V5CA 1LF1A 1WP6A 3BAWA 2XM1A 3W0KA 3IJ9A 3A4AA 4MNLA 1TVNA 4UOQA 3SUUA 1K9FA 2J7CA 2Q8XA 1EDQA 2F18A 1B3XA 3PZGA 3BLBA 4JKLA 1BPLB 2E8YA 1R7AA 1UD4A 1GOQA 2WSKA 4D6EA 3SIMA 2XWDA 3L4VA 2DSWA 3CUGA 4KRTA 4X9YA 4Y7EA 3W25A 4NX0A 3WL0A 4PEEA 2UY3A 3A5VA 1MW0A 1OCQA 2EADA 4FNQA 1LWJA 3TTOA 3VUPA 1VBUA 4Z2LA 2D73A 3VGDA 3OG2A 2Y4SA 3WF3A 4UFJA 1B2YA 4A3YA 3M46A 5GQBA 1PJ9A 3WEZA 3MSGA 2VT0A 3VIIA 1W32A 4D1JA 3BCDA 3CBWA 2IGTA 3F5JA 2V3GA 3UETA 4CVUA 1GQIA 3MV01 2W63A 3ALGA 4MDPA 3WQVA 3GBEA 5I79A 4DWSD 1IV8A 3WH9A 4LXFA 3SCNA 2FYVA 3L4WA 2V3FA 3O6AA 5A8PA 3AIBA 1UQYA 1LQ0A 1G94A 1ZBVA 3DYOA 2X0HA 1A47A 3BVUA 3DX0A 1E56A 1XH2A 4ACZA 2IXVA 1OBAA 3SCUA 3AXIA 2D24A 1K9EA 3HU7A 1XV8A 2G3NA 4PMQA 5KEZA 4P7RA 3AS2A 2O9PA 5HXMA 3MUY1 2D20A 1W9DM 1TQUA 4DO6A 1VJZA 4AZ5A 3WQ8A 3VIHA 2CEQA 3KLKA 3L2LA 1KCKA 2CESA 1Y7VA 1T0OA 1W2VA 3CHDA 8CGTA 4LQ1A 3VILA 2W67A 4CD7A 4JIEA 2ZUVA 5ABGA 3WY1A 1BG4A 2VTFA 3AQUA 3CZJA 1Q6FA 3BUQA 1KR1A 3SCTA 3CLWA 1UKSA 3CZKA 3B8SA 1FOBA 1E0WA 3SCPA 3TTYA 2WB5A 5IFPA 2J47A 4W8BA 1HX0A 1WE5A 1G1YA 2FH8A 1HNYA 2BY2A 3ARWA 1QI0A 1UA3A 1JYXA 2JIEA 3PZUA 1BYCA 3SCQA 4D6IA 2CITA 4V27A 4ZXOA 2ZX7A 1JAKA 3VOCA 2B31A 4BZYA 4BS0A 3A21A 1UWTA 3GXPA 5EFFA 2EBNA 5A2AA 4DWSA 2J7DA 3WH8A 1OIMA 1LWHA 5A3HA 1HTYA 2EAEA 4KMQA 4FNPA 3OZOA 1UH2A 5I24A 2J7EA 4UQDA 2QV4A 1XC6A 1X6LA 4AISA 3BUPA 1GOOA 1U30A 4M81A 2BNJA 4W7WA 2VOTA 4DWSB 4QLKA 3EMCA 2QF8A 4HOXA 1E55A 3W26A 4M29A 3AROA 2WW5A 1B30A 1CNVA 3TA9A 4J3TA 2WVVA 1QWUA 3PTKA 3AZSA 3DDGA 1UWSA 2PBGA 3GH4A 2CHOA 1NOUA 3N12A 4P7QA 4UQEA 3ZQ9A 1E1FA 4FNRA 1B9ZA 2F8QA 4M24A 1MQRA 3IAPA 2DSZA 5CG0A 1FP8A 5JBDA 3ARXA 4LYRA 3KL0A 1UR8A 1GORA 3IAQA 2JEQA 3WQ4A 5BWFA 3L2MA 4AYGA 3NJ3A 4ZXLA 4U2YA 1UASA 5A69A 4EE9A 1E5JA 1B3VA 2WCGA 5I5RA 3WF0A 1ZBKA 2VCBA 3ARTA 1CECA 3SCSA 4JCLA 3EJUA 4Z2GA 4D6GA 1RP9A 1JF5A 2W62A 1XHGA 4CD4A 1UH4A 2C8NA 1WB0A 2WZHA 4R27A 2WC3A 3GNPA 3WN6A 1D7FA 2UWFA 2EPKX 3ZM8A 1QI2A 1MW1A 2XTKA 3VO0A 5ABHA 1E6NA 1QNPA 1TQSA 2F1BA 4P8UA 3VDAA 1CXEA 1V3JA 4JHZA 1DP0A 1CPUA 1C8QA 3GXFA 1V3KA 1ZBWA 2EPLX 3PZQA 3LPOA 1QW8A 1CGVA 3AZRA 2QLYA 3DX1A 2JE8A 1WNOA 2VJXA 2WVSA 3WY2A 2YBTA 3VIMA 4JFUA 3GXNA 4HOZA 1E3ZA 1V0LA 1RH9A 3A6OA 4UFLA 1R7OA 5FIPA 3N13A 3L4XA 4N42A 1YQ2A 1QX1A 1JXJA 3BMVA 3D3AA 3OBAA 1G5AA 1CXFA 4DM2A 5M5DA 1VEMA 1E0XA 3AMCA 3VIGA 1PX3A 1WZLA 1TG7A 1R8LA 3K8KA 3BVXA 1UKOA 3AJ7A 2CETA 2WANA 1JIBA 1BYAA 1W1YA 3BH4A 4OBRA 4UR9A 2VR4A 4MAVA 2GVYA 3CHFA 5GNYA 2WVUA 3WBAA 4M80A 3QR3A 3PZTA 3QHNA 3SUTA 5IDIA 1AQ0A 3I3BA 3NSMA 3VTRA 3EDKA 1GJUA 4AEEA 1VBRA 1E6XM 3VMNA 1QOXA 2X2YA 5ECUA 1JFXA 3EDDA 1CGTA 4NZJA 3VNYA 1MWOA 2J7HA 3GXMA 2J7FA 1CLXA 3OA5A 3FXYA 5KZ6A 3AXHA 1C8XA 1SYTA 1JI1A 2Y24A 3AIWA 4JL1A 2EJ1A 4UNIA 2F61A 1HP5A 5FD0A 4UQAA 2FDMA 4W8AA 1JGIA 1BGAA 5LYRA 3WEMA 2EPMX 2YL9A 5BXTA 2WKGA 1KWKA 3BMWA 4ATLA 1GOIA 1V3IA 2WNWA 4E4PA 1OGBA 1BGGA 4JFSA 3UG3A 3GYCA 3BSHA 2XPKA 1HVXA 5I0DA 4B9ZA 1LG1A 3MO4A 3KZSA 2PF0A 3T09A 3FW6A 3WQ5A 4ZE5A 4S3KA 3VU2A 5E0CA 5JIPA 1WDRA 3GDBA 7CGTA 4PMVA 3II1A 1R46A 4GZJA 2FGLA 5IHRA 1NWTA 4YN5A 3VMPA 1W9UA 1UG6A 1VF8A 2V3DA 4CD8A 5A6BA 3WELA 2ZWYA 1VEOA 4UFHA 4F8XA 4DUWA 3GXIA 4D1IA 1JL8A 1MFVA 2YL5A 2F7PA 1MXGA 3FNDA 4QCEA 3CPUA 3CUJA 5I2UA 2YFOA 4HU8A 4WJXA 2GUYA 2YL8A 1EO5A 2ZX5A 1ECEA 3VGBA 3WH5A 1QNRA 1ZL1A 4CN6A 3VD7A 3CZEA 1MW2A 3GTNA 1BVNP 4PTXA 9CGTA 3UESA 5CGMA 4W85A 3HJEA 4P7LA 4DO5A 4CN4A 1LJYA 3VDBA 3TONA 1FH8A 5BRPA 3BCFA 1CGXA 3WBEA 2G4FA 2OSWA 3AIQA 3AI0A 3AICA 2C7FA 1JNDA 1NARA 2WMFA 1JDAA 4CKQA 3ZJKA 3D50A 3WY3A 2HVMA 1M04A 2GK1A 1B31A 5A95A 4E2OA 3CUHA 3ARSA 2XM2A 2D0GA 1EOKA 4KGJA 2CBJA 2HISA 5D9MA 1TR1A 1WDQA 1JZ2A 1R33A 4PN2A 1G0CA 1W1PA 2WBKA 3RCNA 4Q7NA 4YHGA 4U31A 2GK1B 1J0ZA 4GQQA 4WIWA 2NT0A 1UZ1A 3NIYA 1TFVA 3DX2A 3N15A 3RJXA 4IUGA 1E9LA 3GNRA 4H8UA 7TAAA 2WZEA 3VINA 3MUZ1 4AZBA 1O7DC 3ZJ6A 2FGZA 1V6VA 1W91A 3W53A 1EHAA 2BY0A 3ARUA 2DH3A 3W29A 1ZJBA 4QFUA 3U7VA 2Y5EA 4GIAA 4P7OA 1BHGA 2XVGA 4M1RA 1OT1A 4V28A 4UFKA 5EBAA 4FNUA 1FFQA 1E4MM 3OLIA 3OB8A 2BS9A 1DEDA 5CLWA 3UR8A 2J4GA 2CXGA 1B90A 1BAGA 3W81A 1UUQA 4LYQA 2F7RA 3DC0A 5A6AA 1UWQA 1MQPA 2DDXA 1GW1A 1CIUA 2CIPA 3E1F1 3S5YA 5JBEA 2JEPA 1KBBA 2OWWA 2VX6A 1XSJA 4GI9A 4GZEA 4X0NA 3BC9A 2PWEA 2YFNA 1JXKA 3N18A 1KXVA 1DTUA 2O9OA 3A4XA 4W5ZA 1EQPA 1W3LA 4MNKA 1OT2A 5BROA 2QPSA 5EFDA 2PB1A 3WUEA 2W4XA 4NXKA 3MKKA 1UR0A 3S6TA 3ZOAA 3NSNA 3DHUA 1EA9C 1XYZA 3N9KA 3N11A 3B9AA 2ZUMA 1HKMA 1TE1A 2RGLA 2XFFA 2FHCA 1EXPA 3KE0A 3F5KA 2G3IA 3D52A 1W1TA 4CN1A 5A94A 3VNZA 2RGMA 1K6AA 2D2OA 1HT6A 1OGGA 5DO8A 4P7NA 1XH1A 3MSDA 4GXPA 3SUVA 1CENA 2O92A 1NWUA 2WKLA 4TTGA 1Z32X 1E4IA 3M6DA 4PSRA 3PTQA 4NZFA 4CCCA 2XHYA 3ALFA 1JG9A 1JI2A 1MFUA 1N82A 3BVTA 4HOWA 1H4PA 4MJ4A 1H09A 1UQZA 3LPGA 1QI4A 1UKTA 2XWEA 2WLZA 1W9BM 4PRWA 4A3HA 1MXDA 2XYLA 3WIJA 5ABFA 2VX5A 3LXCA 2ESCA 2QHAA 1O6IA 1EDGA 4OUEA 2OWXA 5GNZA 3BAYA 1B3YA 1QNOA 4AC1X 1HVQA 3LRMA 3VM7A 3GZAA 1UWUA 4LPCA 2VVSA 4RE3A 4H7VA 5E70A 5ABFB 2BVYA 1ZB5A 1ISVA 1C7TA 1KFWA 4XUYA 3LPPA 3RDKA 2DT0A 1WZKA 1EOMA 3WMSA 3VGHA 4OGZA 1V02E 4JKKA 3CHEA 3QHOA 2A3HA 2VR5A 3EJSA 3IANA 4URIA 4NSBA 2YKKA 1HKIA 1OB0A 3VPLA 2PBOA 3VX0A 4HTYA 2J74A 2Z1KA 6TAAA 2J78A 2GDVA 1TQWA 1TUXA 4W89A 1CGYA 1JZ4A 1QI3A 4BF7A 5BXSA 1KGXA 2ZX6A 3ARQA 2DIJA 5CPQA 3K8LA 3CH9A 5FL0A 4OIFA 3SURA 4FMVA 1F4HA 1AQMA 1AVAA 4BA0A 4NRRA 4E8CA 2WHKA 4GO8A 2E9LA 1J0HA 1PZ3A 5A8MA 1EDTA 4QP0A 3WH7A 3DECA 1TMQA 3NCOA 3ZJ8A 4JFTA 3PZVA 1V6XA 1HJVA 4ZE4A 1WCGA 2E3ZA 1UA7A 1LL7A 7A3HA 1HJXA 4V2XA 1CLVA 1GOWA 3KLLA 4PMUA 2VRQA 4A4AA 1DWFM 2CKSA 2XVLA 4NRSA 3WNKA 3MUIA 2W66A 4KH2A 3HG2A 4M8UA 1W9PA 2WCSA 3POHA 3RPMA 2WLYA 3SCRA 2CHNA 2VNCA 3CMJA 2DH2A 3T2OA 3WQWA 2JFEX 4BQ3A 1BLIA 5A8NA 1E6ZA 3AMKA 4AD0A 4KWUA 4F79A 3ARZA 2UY4A 3FHQA 5I78A 3RM8A 5A2BA 2PWFA 3EDEA 1X6NA 3WDHA 3DDFA 1GPFA 1ESWA 2V38A 4PMYA 5LA0A 1Q4NX 3MUAA 1E1EA 3LXAA 3CV5A 2VQUA 3THDA 2MANA 4TX8A 3BAIA 3T0AA 4FNTA 1OWQA 1FH9A 4HMCA 1M7XA 3N17A 2XN2A 1MW3A 3WNMA 3PBGA 4ML4A 4UOZA 5JUVA 5BXRA 3HG4A 4FF5A 4HZ8A 5A1AA 2QPUA 2YJQA 2WMHA 3SCWA 2V3EA 4AEFA 4BQ5A 1TQTA 3EBVA 1UH3A 1V3HA 1P6WA 1H3GA 4AD3A 2PC8A 4XX6A 1ODUA 2WC4A 1OGSA 4AZCB 3IK2A 1NP2A 4W7VA 1GHSA 1M53A 1VAHA 3M7SA 4K68A 2EACA 5HDRA 1KQYA 3WF1A 3BVVA 3BLPX 4TOQA 2FHFA 4JFWA 4W86A 3VIKA 1W9VA 3WF4A 3EJTA 1PAMA 1W2PA 1K9DA 1GQJA 2J79A 3LRKA 5FCZA 1L0PA 1UD8A 1KR0A 3T0DA 4QLJA 1V0MA 1ZU8A 4JHOA 1C3FA 2CPUA 1JZ5A 5LA1A 1MVYA 2F2HA 1JYWA 1PEZA 4IPLA 2ZUNA 4WF7A 4U3AA 2X1IA 5EMYA 1LL6A 4JKMA 5DF0A 3UG4A 1UD2A 1PBGA 1GQLA 1M03A 1EQCA 1ISWA 2G8ZA 2GJXA 4MB4A 2FHBA 2EXOA 4F66A 2FE0A 4DUXA 4W93A 2E9MA 1GOKA 2GFTA 1NQ6A 2ZUUA 1JD9A 4HMDA 5M3WA 4MB5A 1E0VA 1GQKA 3VSVA 3IGUA 4EAMA 4AW7A 3PHAA 3N1AA 2GJXB 4ATDA 5IFTA 2A3BA 3CC1A 4QDMA 3A23A 2YBUA 1UR4A 1VIWA 3AHXA
chains in the Genus database with same CATH superfamily
4NAFA 4R96B 5JMRA 2CPCA 4XZBA 4PJHB 5KG9B 4Z7WA 4OKDA 4XTRC 4FQIL 1W5PA 1GKEA 4GBXD 4AIZB 3W1LA 3QUKA 3L9RA 1XB6A 5EBMB 4Q2ZA 1V55B 2X4NB 2HKAA 1EDHA 1CI1A 4KKAD 3P2BA 3OLDA 5IW1B 5JXEA 1E6QM 3LBCA 1JZ3A 2YLKA 4HKPA 1PCKA 1E71M 1SZNA 2QJDA 4FHAA 3HG1E 3UYPA 2POZA 2RAMA 4IRZH 3DA0A 1XGZA 4Z2KA 2RQ8A 5CJOH 1JWUA 3GG1A 5HNRA 4Y88A 3BDXA 3W02A 4IJCA 4MAUL 3NDZA 2X9WA 3UBFA 1VFMA 1ZLUH 5HOSA 3KXQA 2ZDRA 3VAVA 1QHPA 2BB0A 3SE3A 4HPYL 3DSNA 3FB8B 1XX9C 4AUJA 3S8FB 3VXME 2QT3A 4PVLA 3AMDA 2P28B 1A5FL 4IDLA 2RKXA 3VA8A 4JPIB 2Z1PA 3DIDA 1NCBH 1DBAH 3AREB 2R7EA 4JM2A 3ELAT 2UXTA 4AZGA 1CXKA 1IT0A 2V5DA 4ADIA 1CL7H 1UA6H 3NZ1A 4Y4FC 4HUWA 2CKBH 4CEUC 4R4BA 4P46B 3NJKA 4U4MA 1DZ0A 4Y9FA 3TOPA 4AQ8C 2BVDA 2A0LD 4ILSA 4GKZA 5DUMH 5I30L 1MCWM 4QXUH 1GS7A 1HCVA 5FECB 3IE4A 3U7BA 2WBXA 2IXQB 1ITBB 5MEOB 4ZO7A 2VDQL 1IM3B 4PN6A 1OV8A 3H22A 2OTDA 4FGMA 2JVUA 4XZMX 4PVNA 5K9JH 5C07E 4GXUN 2EG6A 3V9CA 3QOKA 4XCEB 4IGBC 5E5RB 1YTKA 4NFDA 5D7IB 3IXAB 4BFAA 3O4LE 3W1TA 4JN2A 4NN5B 4HLJA 3TC3A 3MRDA 4PHXA 2AL1A 1SJEA 4BSWA 4H6KA 5L6UA 3E3HA 3R5EA 2FGBA 3N06B 1ED3A 1TG8A 3QY6A 2OMZA 4PTUA 3HN3A 5ANHA 1YPFA 4ES4A 4TNEA 3SKNA 3H85A 2VISA 3V6FA 1KM5A 4JFPA 1A7RH 3W7PA 1FFPA 1GGTA 3ZTJG 2K6ZA 4MOZA 4LBSA 2APFA 4B3LA 2BVQB 5CINL 4JRYA 3LV3A 4JZJB 2E5CA 3E80A 2OR8A 1DHKA 1BM3L 5U7SA 4E9LA 3W7EA 3SFKA 1G0DA 1X1NA 1NUNB 3SE4C 3IMRA 3IB4A 2JF6A 5ESAA 1N6UA 5FHBL 2E6QA 2AQOA 1BQRA 2WMJA 1J8VA 4ZMXA 3ARDD 1WQ5A 3Q5TA 1TTPA 4DNHA 2PPAA 4G8AC 4C6PA 4AEIH 2INEA 5CZ0A 4NQXB 3DYPA 5AYYA 3AAMA 3FT9A 1IGMH 4GBUA 3EH3B 3H7UA 4MJ5A 3RM4A 4FEZA 4NGHH 3B8TA 1QO5A 1JUKA 2PI6A 5HWJA 5HNTA 3VI3B 1EWHA 4E6MA 4P2RD 1GJWA 3DGGA 1NC4B 3QK0A 1UWFA 1GTNA 3L0KA 1KCRH 4ODVH 3EWZA 1NOLA 3OXRA 5ESVA 4QRUA 2CYGA 5DI8A 4CEXC 3MMUA 3G8RA 3OGCA 4J3VA 4FOUA 4HJJL 1GRWA 3NEHA 4DO7A 5GSVB 2CZEA 3PWIA 3ZYOA 5E03A 3ZMEA 3VFTA 1L0QA 2NXZD 5I18L 3VD5A 2A99A 1IGTB 2Y5TA 5KVMC 3FIGA 3SKJH 4PP2A 1DLHB 2OPCA 1ACYL 2GSIA 1QR4A 1QACA 1FZMB 2BHYA 1A64A 4XZ9A 2ZX8A 5DMIL 1GVEA 2YRLA 4WNJA 2ZXEB 4N2FA 3NFUA 3PP7A 3CTTA 3GH5A 3O1NA 3ROOA 3BE1L 5CKGA 3PREA 3ASWA 5HYIA 1D3GA 4PWHA 4AL8L 1VRSA 3SDAB 5DVNA 2VN3A 1I9IL 3B56A 3VFRB 2DD8H 3FV9A 1NFDA 3HUJF 4MDJB 5AZUA 3QJOA 5GZNA 4N9GA 4FXGB 1V6YA 1SM3L 3WDPP 4JGJA 3JU2A 4KHXH 1T1WB 4KPHH 2WM0A 2DVUA 3NTCL 1DBJH 1MY7A 4WUIA 3H26A 2K9UA 5I8KH 4UQBA 4FR1A 3FVMA 3B8IA 3CZFA 1RZ7L 4Z1BA 1RURH 4G8FB 5D2LA 4JTEA 3OD3A 4Y6GA 4JTGA 3L5MA 4NDMB 2YGQA 5ADOL 1CLYL 1ZJIA 4TSCH 1AMKA 4DIAA 2WNQA 5ICYB 1ZGLP 1K7XA 1ZSDB 2L7EA 4IBZA 3LNFA 2OMXA 1S39A 1KFAL 1FAIH 1E27B 4MD0B 3TTQA 4EZKA 4EI5B 1AACA 4S3JA 1G7MA 4ZFOB 2AJUH 4UIKH 4PTVA 2BHFA 4D72A 1TU2A 1XF1A 1OD0A 2X2IA 1EGJH 4DEWA 4H2CA 1QSEE 4WDTA 5GXBB 2NQCA 4QF1A 5A6BD 4OZGB 2MKLC 3Q2VA 1CF8H 2W81C 3S35L 1I2QA 5T33H 1WA2X 1EAPA 3IDGA 5FGRA 4IG2B 3GO1L 3MJ8B 1CBVH 4E5XB 4IPNB 4ZFFB 5E99H 5F7UA 2J72A 5IVOA 2VJ0A 2QT6A 2R29L 3RJYA 4JFYA 3I3EA 4HF5H 3MMTA 3DRTB 2WQ8A 2A9ML 5KJRL 2Z7ZA 3IJ7A 5MF5A 3SDDD 3M43A 3T2LA 1TPEA 3HI5L 2IQAB 1FNSH 4KO7A 2R2HA 3B83A 4K2SA 4FQQB 4O2CB 1DSWA 4H9MA 1KCUH 2F8VA 4QTIL 5I5IA 4RW5A 3ULVL 3S98A 3WKPA 4H01A 4LLYA 3A24A 4LYPA 1ELSA 3VFGH 3A6BH 4I1RA 4S39A 4H0HB 3RL2B 2HLFD 3D69B 2B4CL 1FWFC 4XN7A 1S7SA 3FQ2A 2XWJA 5LXGH 4QO1A 2DUXA 3QQ1A 5ELIA 3RKDC 3UJJL 3HC4L 3A4EA 1KEGL 3W1ZA 3TR9A 1PZ5A 4NERA 4XX5A 3S37X 4DGIL 2DM3A 1N7KA 3WQCA 3SDDA 3AS3A 1EUUA 5BS0B 5DT1L 4O16A 5K4ZA 2V7NA 2QKFA 3JVGA 2PCFB 3AQYA 3W1QA 3P74A 1C08B 4DELA 1JPTL 3MR9B 1NAL1 3A3XA 3OJVC 3WTXA 2A79A 5LG1A 2KDYA 3IU4H 3Q37A 4Y5XB 5IB2B 1Q8AA 8XIAA 3EOYG 5JHBA 4Z7NE 1U5HA 2CA4A 2VGIA 3OB0H 5ALBL 2DBJA 5ITBL 4AF0A 3O06A 3SRHA 1PE1A 4WKAA 3T8LA 2BS71 4BIKA 4DPBX 3OKNB 2ATAA 5CBBA 4LB8A 5FEBA 4EAYA 1ZK5A 4XQ6A 4U6XB 4GRWB 3WLIA 5AVVB 5CCJA 4AGLA 4S1DD 1H7RA 3RU8X 5H37A 3VH8B 2FT6A 2FX9H 4MFDA 2WTOA 3TYFA 2NRDA 3QPEA 4IM4A 3L3DA 1Q45A 3KPPB 4BFNA 1OE3A 4ZTEA 1WCQA 3GMMB 2ENQA 1U8LB 1EAQA 5A16A 2OODA 2NXYB 1EX0A 3IJ9A 5DK0A 2CC0A 3ESNA 1R24B 2VSCA 2Q8XA 3CYJA 3WQPA 4KI1A 2DTMH 4WJKB 4WOZA 3W6YA 1ZLDA 3E9TA 1NCIA 1NLDH 4D6EA 2CDGB 5FYJE 3MGAA 5E9DB 1AC6A 2UY3A 5EA0H 3BT2L 3NN8A 4PLKD 1FNGA 2D73A 2FBJL 5K39A 1FYTD 1XXDC 4XC3H 4IQLA 2V17L 2X6MA 4S3BA 1KGYE 3N25A 3MCMA 3F5JA 3TJXA 3QFDB 2HT3C 5J6HA 4PJFA 4UTCA 3T2NL 3GBEA 1MCJA 3GHRA 1X5HA 3BW9A 3EZ4A 2Y7EA 3OAUH 1WF5A 4DVOA 2WLNA 3ABSA 1SZEA 2WTRA 2X9ZA 3BWUC 3WJZA 5GGQL 2D20A 1VJZA 3NCBB 3KLKA 1KCKA 4KIEA 2VMDA 3QZWB 3KPRD 4QRRB 4ELMF 2VITB 3BUQA 5FYLH 1UATA 2R59A 1PG7W 4ZTOL 1X97A 4QHMA 2BDQA 3PULA 3P40A 3MNZA 3MO1B 2FH8A 3GG7A 1O6SA 1XCTA 1JYXA 4G70B 1KBGH 1OYBA 5GJTH 5KVFH 1JK9B 5D1ZA 1BVLB 3CWOX 1PCXA 2PWUA 5CEZH 1THCA 4BS0A 5EFFA 3VQ2C 3CYVA 4GRLB 4GUGA 3K6FA 2NNXA 1R17A 2JKAA 1ZVHA 3VGAB 4AL8C 3EMCA 5FYKH 3UO8B 3P80A 3W26A 5J7CC 3LBMA 4K9JA 4TV5A 3V3WA 2QCMA 3K0YA 4PJ5E 2R4SL 1OF0A 4PJXE 3VKCA 3NA9L 3V4PL 5ADPH 4YXLL 1CZ8H 4WO4A 1ECYA 2R8WA 1EJOL 5BV7C 3RFZA 3WJLC 5DS1A 2LABA 3BLDA 1Q9LA 3T07A 2JEQA 2GJZA 2IADA 4Y2LA 1E30A 1EFQA 5C09B 3QJRB 3O3EA 3ARTA 4UZGA 5EPMA 4KKXA 5DVPA 2XG4A 4KRMB 4WHBA 4JRFA 4MYXA 5DA4A 3P4MA 4C56A 1BMZA 1QNPA 3TJEL 2J4WH 2EIKB 7FABH 1CL7I 1URZA 3VDAA 3X12B 1V3JA 1DP0A 5DMGC 3ARFD 4ZUUB 3PZQA 5I1HL 1BREA 5FAAA 1YJDL 2WLHA 3A6OA 4PB9H 1R2RA 4U3HA 1TRIA 5F72S 2RJGA 1LQBC 3VIGA 1TG7A 1HQ4A 1G4MA 4RGMB 1Y0LA 2GJLA 1J05B 5HMEA 2RMNA 2BGSA 2VR4A 2GVYA 1I7TA 4O02L 4LP8A 4NRXA 4QAIA 2W3ZA 3PZTA 3MKCA 1ZLWH 1AQ0A 2OLSA 4NHUB 3DUHA 1P48A 3IDYB 1A5KC 5ECUA 2CCLA 4N2CA 2R56L 4O9HH 1RUKL 5CIPH 3QUMH 5T3XH 1TJHL 3UBXA 2N1KA 3E0FA 2C18A 4R84A 4UQAA 2CJTA 3ESUF 1S1PA 3Q3GA 1JTOA 2I26N 2OMTA 2J88L 3MLYH 5CILH 12E8L 4DX3A 3EA3A 2A21A 3QVQA 3N19B 3FW6A 3UP1A 5FF2A 4B5EA 4S3KA 1QUPA 1MELA 4MHBA 3EWYA 2B4CC 5JIPA 4P5RA 4US6A 3WFAA 2D2HA 2FEDD 1IFHL 3IF1A 3FVDA 3E2QA 3U46A 3LHTA 1CFSA 3V0TA 5FUOH 4Z3IA 1Z3NA 4UFHA 2J9XA 5D2VA 3EFOB 2DQCH 4C6FA 2OG9A 1NDGB 1N3NA 1PY0A 3U0WH 2Q86B 3WH5A 4AIBA 1FLRL 4J12A 4ZW7A 2X53A 3GTNA 1AP2B 4RSVA 4DO5A 5DWPA 3Q2CA 3KR3L 1G7JB 1GG0A 3VRLF 3ECBA 3OAYH 2HKHH 1IBFA 5A95A 2F19H 5DLML 3QZPA 4X8JA 3RTQA 4JZNA 3FX4A 4EDWL 4JIIX 4IBWA 5BO1H 3B9OA 4PN2A 4QKXB 5FKPB 3U7WH 1BIIA 3U4AA 2BDNH 3TSMA 3LDVA 4AZBA 1CG9B 3BKCL 3PFMA 4QT5A 4PC8A 4YDVA 2IQ0A 4P7OA 3AYTA 5KMYA 5KVGE 3PWPA 2XQYK 1IQWH 2GUUA 2JCCA 2C9AA 2PS2A 3S4SB 5E94B 1BVWA 3IU3A 2IPKB 3GNNA 1VPYA 3D2UD 4K07A 1F56A 3U2OA 3LM3A 3BP7A 3QJFB 2OQJA 3QV7A 4OQTA 3FFDA 3DXAA 1LO2H 3RNKB 4UTWA 2KLSA 5KINA 1P4BL 1JK8B 3WG7B 3QUZA 3W7HA 1FN4B 1BEXA 4Z3EA 2ZUMA 4J4KA 1TE1A 2V2DA 2IDFA 3F5KA 3WQFA 3WBXA 4CC4A 4NWUH 1OGGA 3DO4A 2NZ9D 5IOKA 4HSHA 5D93C 2HFGH 2VENA 2FZ3A 5JDJA 1LE9B 3N73A 4C6IA 2Y69B 4R8WH 5CSBA 1TTFA 4US5D 4BHUA 3CXDH 1MREH 5D05A 4PRWA 2XYLA 3LIZA 3QEQB 1XBVA 1F3RB 5E8PA 5CBIA 3FUEA 1OZTG 1CK0H 1GKRA 3H8AA 3K72A 1ISVA 1ADQA 2XZAL 5KSAC 1H50A 2B1AL 3PNRB 2OVLA 2DJLA 2PDUA 3IMUA 3UC0L 3HGOA 4HULB 4U6YB 4QWWD 3BARA 4CNNA 2QVNA 3QJZA 1XG3A 1G4SA 2QF7A 1QI3A 2Y6TE 4A7VA 1YYAA 4XP9H 5D32A 3HKFA 3FRPG 3CFCH 2PDFA 4UTKA 1N59A 1F4HA 4KFNA 4YSOA 1OHLA 1SXAA 1MEWA 4NQCB 3QXVA 5TQLA 4XIMA 2LLLA 1DL7L 3W0WE 3OHXB 3F1QA 1CGSL 4L29A 1VGAA 4V2XA 3BQ5A 3T3PF 3LKPA 3BP5A 5EFIA 2J5LB 5FEPA 2WXFA 3L48A 3LKQA 1YQVL 2DH2A 3UZXA 2Z4QA 1RIUH 4Y16C 2YKLL 5E6UB 4WI5A 4F79A 4HNCA 2B7NA 4W4OC 3D25B 3FUIA 3S1UA 2I17A 1XFPA 1VFTA 3HNTH 5T9BG 3O45A 1SFHA 4YIQB 1SYVB 3INUH 2VXTH 4JQ2A 4OIIH 1P0KA 2WAQA 4TX8A 4FNTA 1OWQA 3WNMA 2NX5E 1G7IB 4L8CA 1KIUA 2BBFA 3JVFC 3SCWA 6TIMA 1HHGB 1TJIL 4GRMB 5JHMA 2X4TB 1G9MC 3IK2A 1GAFL 4GUOA 2FHFA 2FJFA 4MSWA 2NTFA 4C1LA 3SDXB 1YVLA 2QPXA 1FY6A 4F33A 3C2OA 4KJWC 3QIBD 3SKMB 2ZWKA 5B7MA 3PG2A 4GD0A 2EYSA 4F93B 4OFDA 2QPFA 4O1CA 2XKNA 1MO0A 2X1IA 4PR5A 3PF2A 3TCLA 4S0HA 3LSOA 1MRFL 1ALDA 5DS2A 1KENL 3T6VA 1C5DA 1E9YB 1EQCA 3PP4L 4MB4A 5DEFB 5I75C 4S1RL 3TESA 1FZOB 3IRPX 1FZKA 6PCYA 1H5BC 2R1WA 3LLXA 3IGUA 5AEAA 4RFEA 2QKIA 4EAMA 2A3BA 3W7DA 1OCOB 1YG9A 4QGYA 3HMXA 4CNUA 4Z3HA 4GP4B 4DJFD 3C4UA 3N6QA 2J56A 4PMJA 1F86A 1I4NA 5BVPL 1AQ8A 1BW8A 3U6XS 3ELQA 4Q4EA 2B5IB 4UAHA 2G5RA 4MWFA 1TVBA 1ZS8A 5EO0A 3EO1B 4HKZA 3B8DA 1ZGLM 5AZ0A 3EYFB 5E6IC 1NC2A 5ABDE 3QBTB 4QHLA 3MCLH 1NGQH 3MLSH 3WENA 2EE0A 3D0LA 3UCQA 3RNDA 1NFIB 1WV2A 1QLFB 4PH6A 3KBHE 1AMYA 3WUGA 4NIKB 1KJ2L 1YNLL 4KW2A 1CBGA 4PJEF 4CMMB 5BNKA 3NDYA 5K9CA 3S8WA 3BJTA 4GXMA 3TSBA 4RRPA 2G2PA 1RJZB 1RIHH 3LNIA 4H26A 3O6LH 1HXMA 1NQKA 4Y5YA 1MDAA 5T1DH 2YA0A 1A6TB 5A6SA 3FXIC 4LVOC 2CLZB 3G08A 3RVUC 2HXAA 3SPVA 4GG6B 2J8TA 3EADA 5A5WA 1BD2B 4J6IA 3DMMA 1LWRA 5JBFA 5A7EA 4ZAKC 2WCAA 4R5TA 1DCEA 1D5XA 2H1PL 3O41A 3IDUA 5CGQA 2GJPA 1RUML 1H6UA 2H0JA 3D3VE 4KKPA 4NT0A 4UM8B 3UX9B 2DMBA 3JWNE 3MZTA 3VD3A 4LKXA 1ZAIA 1NDVA 1TUFA 5KYYB 3CDGA 5ID0A 4MQXC 5EORH 2IBBA 4R4NC 4X99B 5HPMB 3P69A 5CO1A 1DBTA 1FWTA 4U49A 1VCFA 1MJUH 2VYOA 1DQDH 3CFMA 3ULUL 3G1HA 4HS3B 2ZZ4A 4IIFA 4QYOB 1B0GA 1K1DA 1PLGH 5C9JB 4DK6A 5L88L 2DZUA 1IE5A 1U1HA 5KSBB 1C5CL 3ZIYA 1T22A 1VHCA 3IJSA 1E4LA 3AG3B 2ODOA 4H5SB 3QRBA 1J0YA 2WMIA 1KNOA 3CG8A 4ZFCA 3AHZA 1LCOA 3FQTA 1RUQL 3DOHA 4PCKA 1E28A 4KWVA 1BQCA 5HHOE 5CEZD 4TQPA 3WK0A 5JHDD 5DO2C 2DQIH 3NPSB 1XF4A 2MRYA 1FL3A 2DGAA 2HTKD 4JKNA 3RCMA 3ARGA 4WKZB 2BOEX 3RB5A 2BK8A 3GMNB 1WIOA 5FI8A 5LQBL 4BGDA 4B91A 2OMVA 2UWEE 1FSKC 2X70A 1T04A 4HA1A 5FFLA 3IRZA 1Y1DA 1A02N 5DRXA 3BUDA 5FFGA 2CXEA 4LBUA 5EB8A 1RCXB 1DUYA 3RWJA 3QR0A 3SGJC 3WJJC 5DD6B 4WEMB 1U9KA 4ALAL 2R15A 2A2IA 5EEVA 1YTEA 5IQ7L 5DR5L 1XH3A 4PJCA 1PGRB 2CO6B 2VLRD 1CZ1A 4W9JC 2YD4A 4ZEPA 5FF7A 4R3UA 4WI3A 4HSNA 3LG3A 4P3DA 3L5WA 4I18A 2WZPD 4JFXA 3Q6FA 1H3PL 4M61B 3M5ZA 4DJEC 3FB5B 3ATZA 4G80A 1WFIA 1PYMA 3QN3A 1P7TA 3A13A 1ORSA 1TJ0A 4NO0B 1T0NB 4XNYL 5TDOA 5KAQG 1UW9A 1NY1A 1TV3A 5TE6L 2Z31B 4NZDA 1ZHLB 1R5WA 1R5VA 4M1GL 4YN3A 4LCIL 3U2ZA 3GR4A 2B0SH 1QJWA 1JV5B 4NKIL 3LB6C 3B5HA 3ZLHA 5DT5A 4JRWA 1AH4A 5H4YA 4IWWA 3TYEA 1R87A 1D5MB 3B2MA 3SN6N 2J6EA 5FUZL 2XSBA 1LEGB 3GHEH 5JHLL 3S9YA 3RPBA 4D94A 3MAWA 1C5BH 5T3XD 5T1KD 1ZA6B 3QQ3B 2VM8A 3E02A 3KCJA 2IWFA 2YQ2A 2X0SA 4LLQB 4JTRA 3CL7A 3LHWA 3INOA 1NMCB 3QEHA 2VEKA 1DQKA 1E8YA 1RFDH 2H7WA 2P5EE 4Y1AE 3FCGA 4LZKA 4ANVA 3VXNB 3OOQA 1HJWA 1XLDA 1U3HA 2PW1B 3GK8L 3VTAA 3CLEH 4LCYA 3CQJA 3FJNA 2LAGB 1NCAH 1HNGA 1D3HA 1VERA 1C1EL 1JBJA 4N2DA 1MZHA 1RJYB 5MI0B 1TPWA 1UM4H 1JJUA 4DOHE 2EE3A 2NV9A 5HPOA 1GGIH 2VEIA 1A1OB 2ZUSA 4RV3A 2YZRA 5DJYA 4K7FB 4EAEA 2XWBA 3WKML 3NL5A 4LGXA 1SNRA 4AMKL 3W9EB 2V4LA 2YIHA 1XIDA 4X6CF 3SB0A 1VFBA 3ES7A 2OGJA 5CZTA 3IGAB 1KM1A 1YEIH 4HXAL 5I82A 1YEWA 1H3WM 4IJ3C 2IANA 1U8QA 2YQ3A 1BAFL 1BLNB 3NVDA 4O14A 3T1WA 1QR1A 1MCDA 3MRLA 4UM9D 3CHCA 2W94A 4EBQL 3KW8A 2DICA 4UB0H 3CVHA 1EUNA 3VKBA 2KBGA 1U8CB 1THAA 3GXDA 2VMFA 4TSAH 2H1LM 5E00B 4PTTA 4ZL1A 3UTTE 4HZ6A 3HI1B 1HAWA 5INDB 1JPEA 1JGUL 4NQDB 3GDTA 2AHIA 3CL6A 1MLBB 3IGLA 1XR8B 3NZPA 5GGVL 4GO9A 1S7XB 2P8PA 3RJOA 3WUFA 3D08A 1V8EA 4G42A 2VDPL 3PWVA 1A4KA 1MFDH 4ATTA 2WXHA 3O6FD 3P93A 2XA3A 3KZ8A 4TKWA 4IUOA 3F01A 2DS4A 4YHYB 1OFAA 4OHQA 3GFZA 3KBFA 1ZY9A 3L3OA 1HKVA 4XNBA 2NY4C 3FLUA 3ONBA 1IT9L 1J1OL 1AO7D 3C52A 1A0QH 1H19A 3E9UA 1WVZA 4KUZH 4F0LA 4LX4A 1IZKA 2VZTA 1B1YA 5HYQB 2JQXA 4X2RA 2G60L 3DFQA 1ROCA 15C8H 5KANI 1HSAA 4N0UA 3CFKA 2V8LA 2VLME 1MHEA 4K8HA 1ISYA 3NABL 4MPKA 1QSFB 1G7PB 5TQ2L 4NYYA 4NNYB 1T20B 5DCDA 4DAGH 1W6WA 1ZVSB 2R0ZH 4ZW3A 2HLAA 3WLNA 4LCWA 4X5RA 2CGRL 3PABA 4WI0A 1TWWA 3IFNL 5H37H 2WMPB 1S5TA 4QIUA 1N0XH 4R7XA 2PRMA 2DIBA 3ZY7A 3FA4A 4JKLA 2HV5A 1JWMA 3W2UA 4R0LA 1OGAE 4KRTA 4GUPB 1Z7AA 2V6HA 4G6AC 4BBWA 3BP4A 2QVKA 4IRJC 1HXYB 1T0MB 5DQ9B 3AUWB 3WHXB 2ZAGA 4ML9A 1VBUA 3BP6B 5HDBB 1G1KA 2ZCHH 2G3XA 2QKSA 1A9EA 3QO1B 4JFED 3IK4A 4P4KC 3FQNA 3D4CA 5ICUA 4YE4H 3TAKA 2JK5B 2A7NA 2FZDA 5CSZA 4AE0A 4GMEA 2IPTL 3VCRA 4WHTA 4YGVA 4X61A 1ZBVA 4PGBB 5IMLA 4UI2A 3CTLA 3DX7B 4ALAC 2D24A 1K9EA 1SEBB 4CC1A 1OFBA 2OT1A 4JM4L 2AABL 2KL6A 1PZCA 3KBPA 2UVFA 1S7UA 3DX8A 3SJVD 1QFWL 4W6WB 1Y7VA 1XF0A 2HUEA 5D04C 1VCBC 1J9TA 4W1TA 3R8BB 4LS0A 4QY8A 1BG4A 3APNA 1MFAL 3SCTA 3HKZA 3IXTB 4S1FA 2Y85A 1IT7A 3SCPA 4PJAB 2WB5A 3Q9QA 2E9WA 5CWSB 5T3ZH 5EU5A 4YOKA 4WDIB 1QI0A 1UA3A 5D96C 5HGHB 2EIMB 3K6SB 3KJ4B 5IMOA 2NZIA 4MQ7A 4BZYA 3CWNA 1DV7A 3ZDYB 4QISA 4G9PA 4JAMA 3B5GA 5F7FA 4WWNA 4MF4A 3QDMD 5I24A 1FI8C 1WWBX 4KX9A 1KCSH 5CFHA 1NIEA 3EFFA 5DJZB 4IGSA 1XF5B 2ENSA 2PCPB 1IC0A 1RZFH 4FJYA 4A8LA 1Q0XH 5AALA 1NOUA 4QG9A 2XZQH 3KW3A 5GGTL 1IAOA 2C16A 4IGMA 1T2QH 4FNRA 1KGIA 4ELKB 2VDKL 2DSZA 4GAYB 4JTSA 2WLMA 1MLCA 3MREB 1SJHA 1A5SA 2C26A 4P9ML 1KGCE 5KVDL 4K94L 1S5HA 3HTWA 4MSSA 3CH8A 5DXYA 4MBOA 2H2SC 1S3HA 4HK0B 4CD4A 4RBPK 1VZHA 4FQHB 5F7NC 3PNWA 4R27A 4LB3A 4RXFA 5I74C 4NM8L 3IMVA 2EPKX 3BGFB 1E6NA 5F7AA 4X5LA 4KAQL 2OZ8A 4Z8FH 1TITA 3K4WA 5D37A 4WENB 5EUOF 1MAJA 2EPLX 4XXCC 3RWCA 2WLIA 4ZTYA 1WAPA 4Q9RL 5J6GA 4NKDA 2P76A 3B8VA 5ICXA 4HX1A 3OZKA 1UZ6E 2OJZL 4UIOA 2JI3A 2EEBA 3BMVA 2FLBT 4XN5A 4C90A 1AW1A 2HH0L 1PX3A 3IJIA 1U58A 3ME0A 4YTUA 4M1CD 4ABUA 4B9FA 4DJDC 3LNPA 1OJXA 4QLWA 2IGFH 2NSQA 1R3HB 4WFGE 2X1PA 2VJ8A 5G4HC 4LAZA 1TVDA 4HGMA 3OEXA 2PDPA 5ERWB 1ID5I 2O6CA 2NXIA 1XYBA 3LERA 3DVGA 1SYTA 4CW1A 1EF2A 1GJIA 4AXWB 3WN5A 3GBNL 4PJHF 1QOQA 1DFBL 3MJ6A 4JM2D 1E4KA 1H7XA 4QR7A 2WNWA 1YYLL 8PAZA 4G6FB 4GMSH 2IWKA 4TULL 5EU6B 4APQA 4JGDA 4Z95H 3OG6B 1XIEA 4XCNB 3L3HB 2OU4A 3Q6GH 4Q6YA 5HDWA 1UCTA 5KTLA 1J8HE 2V5KA 4NO5B 1F00I 3ZRFC 1MHPH 5EHFA 2JKSA 3QXDA 4MMWA 3FRUA 1AOHA 1NCGA 4AXKA 5JW5B 1TTAA 4U1JB 3O9WA 3MP3A 4WJXA 1Z6JT 1YEGH 4L5ZA 4MCYA 4NPJA 1BKHA 5MHBA 1A7NL 3D18B 4WGWB 4CN4A 4CQCA 1VD6A 4BH7B 2HJKB 5IVXF 1UIOA 2XN9E 4N8VA 3QCUL 1BFOB 1GR7A 1B31A 2H3NA 1F41A 2VELA 4KGJA 2VWSA 2HISA 1U4FA 3KPSE 1TR1A 3MOBH 4ZXBC 1SOKA 1W1PA 2CK0L 5D02A 2REQA 4KFOA 4IUGA 3SGKA 4H8UA 4C5YA 4LASL 4MQSB 1MFEL 2EXWD 5JLZB 3V52H 2GBTA 4KZDH 2WUCH 4JRYD 4V28A 2QVFB 2BOBB 1IBYA 5E0QA 5HYJE 3H3PL 3ZE0B 1DQLH 3UJ2A 5IGXH 5GJNA 1JRCA 4HU4A 3A4DA 1AS7A 3DJZA 3UZWA 3M17B 3QJHB 1NAKL 2OTWA 4GI9A 4OCXH 3D39A 4DPPA 2Q3AA 2M8XA 4XCCL 2X3AA 3OZMA 4FQ2L 2ALDA 4TS6A 1QOPA 2BRRL 1JCJA 5ITFB 4JQ3A 4M6OH 3JTTB 1YPZE 1ZIBA 3ZOAA 4E41B 4KWOA 2VDLB 3M8OH 2G97A 4MZYA 1EZLA 5C0AB 1S78D 1L6WA 2RGMA 4OQTH 1QAWA 5IBUG 2CU0A 4QCIA 3DFOA 1E4IA 4CCCA 5FW8A 5LBSA 3BRFA 2YPLD 3ETSA 3D06A 4EPEC 1PFCA 4MQTB 1AI1L 1MXDA 7ENLA 1TV2A 4N8PA 3FQXB 3DBXB 3QZMA 3RZCB 1E1CB 4IFKB 4AT6A 3TT1L 3H2OA 2EXSA 2Y36L 1X8FA 1N55A 3H4HA 2P53A 3B8YA 3LIZH 1AD9A 4TNWK 4KCTA 4AG4L 4NYUA 1ESOA 4E36A 1MNSA 1S8DB 2OPJA 3JTSA 5CP7B 3VPLA 4LIQL 2EDXA 2XZCH 5EO1A 1KGXA 3UXKA 2CDFB 3CEUA 1ADQH 1MUJB 3IN0A 3HGJA 1XIWA 3VI3F 5DVMA 2YPLA 2GEQA 3M0KA 4BI7A 1EDTA 5DBUA 3B1TA 3KDPB 2BMKB 5F3HB 3WOVA 5GZND 4JUTA 1DWFM 4NPYA 5JMOC 1XIHA 4NRSA 1I0DA 3UFIA 2FCBA 3S2MA 3AW5A 4L3EE 2RD0A 1BLIA 4PH8A 1U8KB 3FA5A 4AD0A 4NBXB 4EF9A 1H6FA 3DI1A 3HE6D 4K94C 2KQNA 5GS1C 2P5NA 4QX4A 4Y2WA 7TIMA 2C9XA 2NY2C 2WSDA 2POTA 1L6ZA 1P1VA 4M48H 4GYBA 3ILEA 3Q65A 4GFSA 3E2SA 2VLJA 5AUMA 4LY8A 1EXBA 4PFHA 4LQFH 3L95B 3D9AH 1P7QA 3IKCA 4L61A 2VLLA 1ZXKA 2NVCA 3LTSA 5LBGA 1V6TA 5F89B 5BV7L 1B3IA 1XR9B 4K68A 1VAHA 2C7UB 3BLPX 3EXSA 3CAVA 4GEJA 3WF4A 4Z7OE 2RDUA 3BUYA 3EX1A 1WT5A 5CCGE 1KR0A 4DH2A 4QLJA 2BIOA 1PCWA 2DKMA 3HE6A 2I16A 5BMFH 1ZT1A 4XP4H 2X4PB 1NVMA 1HQRA 3AM8A 4AWJC 1K4DB 1S2EA 2OAAA 1OAQH 4HKJA 1XLCA 3I6LE 1MFMA 2FHBA 4ONHB 5C0JA 2K3TA 2JI2A 2E9MA 4XBKA 5DY3A 2YXGA 3LI0A 1R9ZA 9XIMA 4AQ1A 3JS3A 3T1GA 1M05B 3PHQB 3HGSA 3IMBA 1AKJB 2NZ1A 4OZIE 1PSKL 1RMFH 2OR9L 1QEWA 1CU4L 4YZFF 3T55A 4FG6C 3BURA 3SD5A 4JEGB 2OSYA 2Q8AL 1NZRA 3MBXL 1X4YA 2F08A 4PWIA 5BCAA 3BLOA 2QQ6A 4FULA 4DZBA 4WY0A 1VZGA 3A64A 3B2UD 3Q7JA 3HMXH 3TVMA 2F53E 1PZ2A 3KDMA 4P57B 4NKQB 3V0FA 1M42A 3M07A 3BXNA 4TNWF 5F7YC 2BSDA 1WYIA 2NY7H 4R7NA 4OGAD 3RHGA 1X3DA 5HBFA 3H9SB 3ATAA 4N5EC 4GAGH 1QFPA 1PL9A 3QDJE 3QUXC 4NC1E 2D0FA 4F9PA 4GT0A 2YD9A 5IB4A 5LNDA 1EPVA 3GNMH 2CLHA 5GRJL 3WGVB 4GHRA 2R27A 1TUPA 3HG5A 1SJCA 3UJTL 1SVDA 4XKMA 3GM8A 1B0RA 5DK2A 1RR2A 4DBUA 3S36L 3ABKB 1D7BA 3KYKL 2IFFH 1HJUA 5KWYC 5I6MA 1ZPLA 1WKEA 4X8GA 3VMOA 5HMSA 3K80A 1XGEA 2H6UA 4XMWA 5K59F 3SB3A 4KEUA 2XYCA 4G1EA 1DORA 3OQ3B 5EC1B 3ZFHA 1F2JA 2J21A 4N28A 1E4NA 3WKZA 5JIWA 5BXPA 2Z8VC 5D7LE 5INCA 5A6KA 2YC1B 1AR1B 4Q22A 1OFDA 2EVHA 2ITEA 4P5KB 3PJWA 2QVHA 2D31A 4IP4A 4LPUA 2WUBH 4AIXA 3EYQD 5IQOA 4KUCD 1G84A 4OZFG 2FSDA 2IKHA 3QLDA 4YWGH 4BZ2A 4BELD 3IGSA 4BJHA 4WQOA 3LVEA 4DBEA 3P0WA 4LL1A 3VCLB 2D03L 2C1PA 3DI3B 2NPLX 1H8NA 1HU8A 4XPHH 2TMDA 3GZPA 1TZ7A 4H25B 5DMYA 1X5ZA 1WHPA 3PJXA 2UX6A 3HCVA 3LH2L 4OQVA 4GRWF 2HG5A 3PWNA 3GJFB 1J2BA 1GS8A 3CQIA 1TMCB 5M17A 5FKAA 5D4QA 3CC5B 2LVEA 3M45A 5T3ZD 4APXB 1BAWA 3AB0C 3RKPA 2FQIA 5KOMC 3S83A 3V6ZA 2G30A 1NF7A 3RUGA 4GVFA 1S7QB 4LCUB 1QBBA 1I1YA 5D1ZD 4WTZA 1PHWA 5IV2B 4PUWA 4Z3JA 4I5BB 4V1DE 3O3DA 2GT9B 1BQUA 5JQIB 4PS3A 3UFYA 4JY4B 1J6OA 1NJ9B 1K3UA 1KTJA 4FB7A 1JPGA 5MENB 5C9UA 2Y61A 1PV8A 2E6YA 4ZX5A 1DWHM 3U9UB 4PY7B 3O81A 3L45A 4WO4D 4AK2A 4Q8NA 5EOCH 1T89A 4TX9A 4FI4A 1S7WB 4H88H 2HFTA 1OIFA 3C2YA 3WGUB 1BEUA 2XFYA 3CZUB 4IIQA 1EUAA 4U3SB 2YUWA 3GKFA 2W9EL 1IM9B 3KBWA 2KT6A 1QNQA 3L2NA 2H3KA 4EDXA 5HDOA 4C56D 5IESL 3G5XB 4N0CC 3MBEC 3FUJA 2BOGX 1BQHB 2AGTA 1QPNA 3PDGA 3UNDA 3VXSE 4WSKA 3UBXG 2L5HA 3V0JA 4URKA 3SBQA 5B3NA 1IBBA 1RUAH 1KBJA 1MYRA 1NGYA 1WJ3A 1E6JL 3I2CL 2R1YA 2Y22A 2C3XA 5KUMA 2H32A 4PJDF 4UQ9A 4OLYH 1INEL 1KN4H 4FLRA 1R3KB 4Y9GA 3EAUA 5CMAB 1I7RB 4EN3B 3KYNA 3BZJA 3BMXA 3GFUA 1C7SA 4X4ZA 3SY1A 3M0ZA 3P73B 2ED6A 2FZMA 5JOFA 5J5EA 3EXLA 5A6TC 1X5GA 3GMRB 1F4XL 4P9HL 2XVPA 3QY8A 1KLUA 2WQVA 1J2WA 1MI5E 3QZ6A 4X0VA 4BQ2A 4PJ7A 5DD0L 1BZDA 3V0AC 4LFYA 4NJJA 1PDYA 1TPUA 3GNDA 4X80L 1FE8H 1HHIB 4LAJH 1J0KA 4MAYC 2J6EH 4C6MA 2H3DA 4QXVA 4GGBA 2WJ5A 1WCBA 2BSSB 1YYML 3CZLA 1HDMA 4Z77B 1AFSA 2XVKA 2Y7FA 3T3MF 2DI9A 3GX9A 2UZIH 1A22B 4OFVA 2YPKB 1G9ML 2JELL 3W28A 2XSAA 1PD6A 4WW2C 2YZ8A 5CPLA 3QNXB 4N85A 3CL8A 3FSTA 2XC8A 3J7HA 3EH5B 4W84A 5L2KB 4E8DA 4XNMB 3U1PA 2GWGA 2G95A 2WK2A 4UUJA 3KS6A 1B6UA 3L0GA 4Z7UB 5IFHL 3QZNA 3M16A 1S2WA 1S9WA 2YDQA 4FTVA 3GK0A 4PG9B 4MJMA 3OX8B 4GABA 3OTTA 4NPKA 3OLEA 3HA1A 5D1XE 4AYID 5DXWA 1QFHA 3KX6A 3LZOA 5DRWB 4BFIA 3W38A 2EC9T 3SGEH 3C56A 1AC0A 3HZKB 5IBLC 4JO4H 5EZJA 3S96B 2Y6SD 4B9GA 3C5SB 2DLTA 4EZMA 4R3SB 4MWAB 3QUYC 4F7MB 4KZEL 1BFVH 1ZK9A 3NQFA 4Y5VA 2KYIA 4JB9L 3PTMA 4OCYL 4PREB 3LEPA 4J3XA 2PXYC 1OK6A 3X2QB 4ODXA 4JRXD 2Y7QA 3RTQD 3GPSA 2WHMA 1KIPA 8FABA 1WBXB 1UQSB 1HINH 3QIWA 1UACH 3GSOB 2Y1VA 2YOAA 5EN2B 1Q63A 4QNWA 3QYNA 3DGCR 3QTPA 3MI6A 4FCHA 2EDFA 1FG2A 2ESVE 2OJEA 3PAZA 3ZSSA 4XD4A 3CVHH 1NCOA 4MLRA 2PA6A 3L7RA 1Z0NA 2PFHA 4U3CA 2PU1A 2BOFX 4R4FH 3U30C 4AKOA 4FKKA 3PWPD 2A7RA 1F6AA 5IFJB 2X6BA 4BHUI 1W1A1 1XIJA 4XVJH 2OMWB 1FWNA 4XRCA 4BF9A 1C12B 3K4AA 5FL1A 4XPFH 3VXOA 5C2UB 1TQBB 1D6EA 1UYQA 3KRSA 3IDIA 2WKOA 4JRXA 3EJCA 3GSRB 2XH7A 4LVFA 3IDMA 4KRPB 3KBNA 3DXAD 4ZENA 2YB1A 1MFCH 2PDYA 1NGPL 3QUZD 5EF0A 4RNIA 2COQA 3ZIZA 1H0GA 2C0HA 4DEPC 1P1MA 25C8H 2UZYA 1OZQA 1AXIB 4I2XE 1VFAB 4Z7VE 4KNTA 1AE6H 3RY6C 2JKLA 3CDZA 4M6NL 1OHQA 4KRLB 1HCZA 4L3CA 3CWGA 1V7ML 3K4ZA 1JMXA 1GHRA 1PKMA 4EOWH 3FCSA 3WCZA 1SW3A 2HS6A 2FZNA 5JW3H 1XVSA 2JXMB 5SX4H 4KCUA 3QI9C 2K7QA 3SQOH 4L48A 4YSDA 3ARPA 2EDBA 1T03H 5D09A 4CGTA 2VIRB 2P88A 3H53A 3TZVC 4D0BA 2Q02A 2EYRB 3AQXA 3UACA 3DVNB 5LHEA 2BNQB 3BAWA 2XM1A 3QFWA 4WJG3 3L23A 1PZSA 1B3XA 3GWJA 2Y1YA 5HHVH 4OIBA 2WSKA 2VWEE 4JFDA 4CADB 4NX0A 3LB0A 3HQ1A 3GMPB 3B3DA 2EADA 1VIZA 4N0YH 3VGDA 1ZHKA 1AMXA 4LANA 3WLSA 3RL1A 2RDXA 2YBRA 1J1PH 3U0PA 4NNPH 3RAJH 5KBNC 2HDJA 1CX9A 2CHZA 4OLWH 2AQ3A 1Z2KA 3WHE1 2VXVL 4RWYL 1E9ZB 3LXUX 2V3FA 5TF0A 3MWCA 3S0PA 1P1ZB 3VAEA 4I7UA 3GU9A 2X4UA 4S1QL 3SCUA 5DHYA 2WLLB 4ENLA 4P59H 1O9ZA 1XV8A 3NOYA 5B7ZA 4PBWD 4LVBA 1HUVA 2PP7A 4TL5A 1OALA 2V30A 2RHGA 4KK9C 2CESA 2XPYA 4L7ZA 1JPFA 3SJNA 1I1AB 2X89A 4JIEA 3F03K 1ASPA 3GG0A 1OHZA 4OZHA 2IAMB 3PGDB 5JH2A 4OJFL 3W1UA 1A49A 3Q13A 3VXQB 2E7HA 3MRRB 1WBZB 4JN1H 3V0VB 4A37A 4QM1A 4XBEL 5D6CA 1HHHB 2C91A 4URTB 1JUFA 3T4AC 1JAKA 3VOCA 2QVTA 3MCNA 4JG1L 2EBNA 1S7TB 1PKQB 3B9KB 1OIMA 3QPQC 3GAYA 4YHNA 3LQMA 4TPRH 3BE7A 5C3TA 2VOTA 5E6SB 1E55A 2HE5A 1WDAA 1QMLA 2O5YH 5E8OB 4IQEA 3IGFA 1X44A 4IEFA 2V7HB 3FO9A 4A21A 4DUOA 4P9HC 1V4YA 2F8QA 3NQ8A 5JBDA 5DD1H 1YEFH 3THQA 5C2GA 3C6LA 3MRPA 3NJ3A 4HNNA 1PG7H 3IMSA 1WS7A 3ZKNC 1O7DE 1J5OH 1E5JA 3QAZB 2W80C 1ORQB 4DF2A 2FWSA 4MMXB 3UY8A 1D7FA 3NQBA 4UTJA 1TIMA 3FYEB 3W75A 3U2CA 4J3OH 2Q7AA 1B54A 4BK5C 5LGJB 5JQ9A 2GYSA 1C8QA 5CUSL 1QW8A 2PDJA 3DX1A 3DK2A 3PNUA 2UX7A 1WRFA 4YHZH 2G3ZA 1EL3A 3L68A 3N13A 5KYWB 1W5QA 2EIEA 4GW5B 1JXJA 1NC2D 5IK3B 3SDXF 1S1RA 2ATMA 4WNQB 5L0QC 3HFYA 1JWSB 1KCVH 3WCYA 4YTTA 4RAVA 3ZVVA 5F7DA 3KRZA 4YVPA 2Y7GA 5DC2A 1HH9B 3TYUA 4JO1L 4RIRA 2P5PA 3MYZA 4LOUD 3NSFA 2EIZA 4NT6A 3GI8H 2GY7B 2ZONA 4KHTH 3KVQA 4KK8D 2B77A 5FV1L 1JFXA 4F8QA 3EDDA 3WU1A 1P5UA 1YEEL 1IAIM 1QTYT 4UNTA 3QZEA 1XZ0A 3OA5A 1PNCA 2R23A 2XX0A 2Y24A 4G9DB 3C5ZC 2F61A 4M7SA 5IMMA 1BGAA 3QPXH 4JM0A 2WKGA 1R9XA 4NNCA 1V3IA 4OU1A 3DMMD 5SWQA 3GYCA 4S3EA 3T8XA 3ATEA 5I0DA 4QTFA 3D4GA 3LLFA 3R6IA 2ODIA 4FXKB 5AW4B 4EACA 3N0AA 1ZA3B 1P0EA 3G6JA 5JVLA 4IOTA 4GG8A 3M0YA 2OL3A 4HQQL 1TZIB 3FTGA 2YL5A 1MXGA 4ZYKB 4LVNC 2JF1A 5FFOA 2GCYA 2Q87A 1EO5A 4FI7A 1TZGH 1QNRA 4HHPA 3FQ4A 1T4KA 3R0UA 1ZIAA 1CYXA 5IHUL 3CPGA 1LJYA 5KW9H 3R8RA 3P9LB 4GEIA 1UURA 5PCYA 1XQ4A 2OSWA 5I9QC 1NARA 4AEHL 3BOLA 4DGVH 1SRDA 1KCXA 2EZ0D 4DGYL 1WDDA 1M04A 4Q8TA 2OZ4A 3RPIB 3NJVA 3QJVB 2WQUA 4LO9A 5C9WA 2BC4B 3URBA 1WAEA 3B2VH 4R7LA 5I71C 5FEWA 2A6DB 1Q65A 1E9LA 1N64L 5CZRA 3W7CA 2WZEA 2DQUH 5H2BB 4TTDC 3W53A 1LK2A 2GJ6E 5H35A 3TFCA 2AZAA 1KBLA 1NGWB 1VACB 4FNUA 3UPRB 1IXPA 4OLUL 1AW2A 4KTGA 5FDWB 1NEZB 4ZMPA 4RISH 1A80A 3O3AB 4BE5A 1F6KA 3VFNA 5KS9E 3T0CA 3ARGD 4AOFA 1ACCA 2J12B 1SUXA 1Z5LA 2L04A 1OZUA 1UJ3A 2ZOLB 4PS4H 2WCPA 1CDUA 2HVJA 5FM5O 3NZQA 5E9XA 1KCWA 1GEHA 2QPSA 4B90A 3QGKC 1KB5A 1P53A 3DHUA 1H62A 3LH9A 2VDNH 2VHLA 3IJEA 3QRLA 5D1QA 3GDCA 1DJNA 5BJTA 3FU5A 2G3IA 1QPPA 3JV0A 5G4OA 1J9SA 5HJ3A 3BAEL 3ZWSA 3B8UA 4F9LA 2QSTA 3SUVA 3EO0A 3B9VA 2ZP0T 4K3GA 2XHYA 3CSPA 4MJIA 1E8WA 4A2LA 3OZ9L 3N9GH 3RNQA 1A21A 4AYMC 4UDTA 5ABFA 2NXHA 1UYWL 2R8SH 4UTBA 2OZNA 3BAYA 1QNOA 5LBSH 3OG4B 3LRMA 1FWWA 4TLTA 1SZGA 4JN6A 2PCEA 3EJJX 3S6CA 3WFCL 2WXLA 5E70A 4GC3A 5AOZA 3R7RA 3PL6B 1Q4WA 3FTSA 4B53A 1BMGA 4IKNA 4XVSL 4YR6A 2FGWL 4GSDL 1RPQA 3EJSA 1R0AL 3IANA 2VDML 4FZEL 3MSYA 1Y0EA 3JZEA 2Z1KA 6TAAA 4KKCD 1VR6A 3B0YA 3W2KA 2C9UA 4XBPA 3NGBC 3UCRA 5B21A 4BEIA 3UJRA 1S2UA 2WHKA 4GO8A 4FCAA 3V4PA 1J0HA 4AWTA 2OGYA 3BEVA 1ZV2A 4OT1L 1UJQA 5T1MB 3VWJB 1M3IA 3SGEI 1G5GA 5C0IA 3E8UH 2BJMH 5LO7A 1LL7A 1CLVA 4N9CA 4KDWA 5IVXE 4M19A 5JXAL 3PWJA 5AVTB 2G9HB 5DRCA 2W66A 2OSLB 4TVPE 2WCSA 1VPOL 3F7VA 4FG2A 4BQ3A 3GHPA 4KWUA 1KGJA 1DQXA 5HK4A 4NKMA 1BJ8A 1G43A 4OD3L 1W72B 4DGUA 1PY9A 4OGXH 1U3HD 3V7AG 1WD8A 4WDXA 2PR4L 4YLCA 3Q8FA 5LSMA 2XXFA 3PBGA 1VFLA 3W71A 3U6RA 4F58L 5BRZA 2WMHA 5FGCE 2OK0L 1DVFB 5T1LA 4XP1H 2Q6WB 3B3BA 5DURB 5ABTA 4PBDA 1HH6A 4WNSA 4ENEC 1YMME 3BVVA 2YWZA 3ZL1A 1U8HA 1RVKA 5KYNA 1PAMA 1AH0A 1PWLA 1FAKT 4UU9B 3O15A 2C79A 3FYOA 3R94A 1CFNB 1XXFC 2PTZA 4AUUA 2IAND 3SPCA 2RACA 3QZBA 5DHMC 3GZOA 3VFMB 2NXGA 1M03A 2X2UA 5EU7E 3STZA 5MP6L 4W93A 2AEIT 3EGDA 2AI0H 4GAFB 1UWYA 3LNDA 4N90D 4QDMA 5D2NE 3WEBA 1LBFA 2A9NL 5DCCA 3N1QC 2AJYH 5FYJL 5I1DA 3BIKA 3GRBA 3MV11 4PRHA 3LZPA 1T66C 3QNYA 4Y2DB 4PODA 3I65A 4GXVL 5KZDA 4GW4B 4F3HA 1I1FA 1W3HA 4IMEA 1SMAA 5AW2B 4FFWD 1MIML 3RJDA 4NZTL 3BPOB 5ICZA 5SX5H 3JV6A 3N2XA 5FK9A 3I9GL 1ND0A 4F7EA 3HB3D 3GRWA 4LUTA 5IQ9A 3Q48A 1KYDA 2H4EA 1Z42A 5HI3D 4CSTA 1O1HA 1TTIA 3H2CA 2VD8A 4AY8A 4HFWA 1AANA 4E9WA 2AJSH 4H8WH 3P9MA 1RULL 5GNXA 1JGEB 1ODAA 3K46A 3OKYA 1XF3A 2CBMA 2HRPH 2LLGA 1EZVX 4BI5A 4EIBA 3BVNB 4I5RA 3QYMA 5K9KA 3AXXA 3PUGA 4N2OA 4FQXC 3VG9C 4OV5B 1Z69A 3FU6A 3MA7B 4HUUB 3LD8C 1OX6A 1TJXA 4DESA 4Q7DA 1VRXA 4ORMA 4NN7B 2PWDA 5IJKC 1BIHA 2NY0B 4AE1A 3QHMA 5AL8A 3RWGB 2ON3A 3VUSA 1W31A 4LSPH 3E5BA 5I06A 4FQJL 3HUJE 4LCWD 2O6DA 2R2EA 2CBOA 3TA6A 5BU6A 4ATWA 1N6QL 4KROB 3U0TA 4J2PA 1OD8A 3NOEA 2I07B 4M6MH 2PP1A 3GM0A 3HPFA 3L5XL 5E24E 1R3WA 1HEZA 1WDPA 5KZCD 4MNGE 3NL3A 3DVIA 4H13C 3SGDH 2ADYA 5J1AB 4D6DA 2BIHA 1QWHA 2PDNA 3OA3A 4U1LA 4YHIB 1HWWA 1BQGA 3FDGA 2LU7A 2O9RA 4TNGA 4YFEA 1PZUB 1K03A 1TPVA 3CQQA 5MEPB 3S1XA 4BZ2H 4MJ2A 4MCNA 2EPNA 1XO8A 4NKCA 3FFCA 1UR9A 1H1NA 2NY6B 2ICWA 1I53A 1MNZA 1D9KC 3M7OA 1C9WA 3ZUCA 4XI5D 4TLKA 3SCOA 2R0LH 5JPMC 3KYOA 4P5TC 3WLOA 6A3HA 2HRHA 3EZJB 4PVMA 3F8UB 4RZKA 4GKNA 4UQIM 3W2NA 3G6MA 1AXTL 3QZOA 2W5FA 3ROLA 4PRIB 1KXVC 1ZWIA 3TV8A 4Y9PA 4U5KA 3M1OA 2FDSA 3G5VA 4L80A 4K9EC 1HKFA 5EV7A 2VUNA 3DUUA 5ISZD 4J3OG 3QFJB 1X39A 5DD5L 5IB5B 4NHCH 4KKQA 4ADSA 4PJ8C 1XF2A 4EIZC 2ZA1A 4LV9A 4NZ8A 3GH7A 4DCQB 5BW7C 1J18A 4HGKC 2YAFA 5BUAA 4CVZB 3DN5A 3AMLA 4F2UA 4E9YA 3N9SA 4KK6D 3QCTH 2MHAB 3AIUA 5TPWL 3DUSB 1SPDA 2LU4A 3P4LA 4HIEA 4XB7A 3LNGA 4HJTA 2CLVB 1MUCA 4F2BA 3RCYA 3SQMA 5MKGA 3D5OF 2GTZA 3QDGA 3WG6A 1P2CA 2XN0A 2IH9A 4OJCA 1FNEA 1KPVB 4ADJA 4F9DA 1NSJA 3WJSA 4PPTA 1RZ8B 5ISZA 2YEZB 2ARJA 1P4UA 2DSUA 4J3OD 2XFXA 3CT2A 3W5NA 3WE6A 2ADGB 4OSUH 2ZXQA 3ARBC 2WZMA 3E9AA 2JALA 1HCYA 4D9LL 4MFEA 3NSJA 4ZFZB 3HRZC 1TZ8A 2QGYA 4NLAA 3GINA 1EHNA 3U79A 1ZQ5A 3MPCA 1S9XB 1XHHA 3N4FA 4GKSB 1CFTB 3WEAA 4RQQA 3ZDYF 2OYPA 3X17A 1TRDA 4Z2IA 1LRQA 3UABA 2WJ7A 2YGYA 1K85A 4LUJA 5CJ5A 3RWHA 4Z1YA 1BXUA 2AQPA 4QLRA 1OT4A 1NCCL 4BXVA 3QF0A 4FZIA 4XH2B 2FT8A 1SO5A 4F3FA 4GPVA 1OY0A 1HHJA 2PRHA 2H32H 3SZ6A 4YHOL 4PMFA 3WLPA 3ZL2A 4ZSOE 4G59C 4ZS7H 3GJEA 2PYEB 4GI6A 1FVCB 4YLBA 4RNJA 4QLLA 2GSJA 4OU3A 4PJGB 2BVWA 3MANA 4UR7A 1I2PA 1QUNB 1D5ZB 2CMRL 1F8TH 4J28A 3W73A 3ZT5A 5F1SA 3QGAC 1W2KT 4PRPB 5KVGL 2H0PA 1TR7A 2V8ZA 4M6VA 4PJBB 3LCIA 1A5MC 3AS1A 5FOBA 4N8VG 4MNQE 2YDSA 5F96L 2EYTB 1EV2E 4APQD 3QRGH 2V0AA 3J2PA 4WVRA 4K8GA 1OC5A 4FQCL 4AYFA 1YEDA 4H7CA 3A0OA 2DEPA 1CVRA 2ATPB 2G75A 4ZMQA 4W9LC 1QXLA 5D33A 3JWOC 3U36B 1JXGA 3MLZL 4ROPA 1YNKH 3TYBA 3GSNA 1E6OH 1A7QH 4OI9A 4KEVA 1KJ2A 3RIKA 3O9WD 3BGMA 5M2FX 4MA7L 2HJLA 4HPOH 2IQTA 1A0DA 1S9YA 2Z91A 1AGFB 2Y07H 5GJMA 1AYOA 2VDRL 3TQ0A 3T71A 1L9OA 4AZUA 3MMEB 1M65A 1MPAH 3T2QA 2OTUA 2AXFA 3PHSA 4ELME 3WS3B 4K5MA 3WEXB 4CMHC 4QCFA 3V0EA 3O2DL 4TUJB 5DVLA 2NYYD 3H55A 3ZMNA 4D8OA 4PMOA 2WPGA 1J11A 1D2PA 4Y9MA 4WAFA 4NKOB 4OI7A 3B0UX 2WGNB 3VFOA 1RZGA 1MJ7H 4JFFA 3QYSA 1YAZA 5FA3B 5CPOA 4G8GE 2OFQA 1JAEA 2BSRA 2EIJB 3C12A 4G7EB 5DZVA 4HIJB 1KTRL 4WIQA 4YLQT 2VRKA 1LO3L 1SXSA 4JKPH 4XB8A 2EDOA 3V0HA 4E0CA 1QI5A 5HYFA 1ICPA 4L0ZA 1AHWC 1WAUA 3OGVA 4UTTC 3O11A 1NM9A 1IX2A 5EZPA 1OF6A 2CCWA 4GBXB 1H15B 4PD4J 3KOWA 2JFCA 2VSKB 4RE2A 3TN0D 2DAVA 3K6OA 4X7CC 3FB6A 4PJDE 4MLIA 1FHDA