3W7KA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-6-066
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-6-066
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
total genus 107
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w7kA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w7kA01
3GXNA 1ZAHA 3NQFA 3PVFA 2JGQA 3HG3A 1NVMA 3W2MA 4O0KA 3W2UA 3P81A 3STFA 3DKLA 4N2YA 3W3OA 1GVFA 1GOXA 3H54A 1JRBA 2CWNA 3W07A 1TTIA 4S2CA 1EUAA 2ALDA 2TYSA 1ICPA 1F76A 1X8FA 2JBMA 1OX4A 4DO6A 1VCFA 3UY7A 4NNCA 1K7FA 3PB2A 2RHGA 1EPXA 4N4PA 4O12A 1QDSA 1W5PA 1DHPA 1EIXA 4FXRA 3THQA 2E09A 2ATMA 4N02A 3HPZA 5E1QA 2YGYA 5AHFA 1B3OA 1UASA 3HG5A 1VHNA 3QEZA 3LM7A 2RDUA 1HO1A 4K6AA 2DZVA 5G1YA 4CQ8A 1ME9A 1G7UA 1AL8A 5HQEA 4U4MA 4RXGA 2HS8A 3QSRA 3O1NA 4WXZA 4OQVA 2JGYA 1RV8A 2A6LA 4RJEA 4BF9A 2VFEA 3O06A 5H2ZA 4D2JA 2A7PA 3O05A 3VKJA 2V0TA 1QO5A 4FNPA 5SWUA 1J4EA 4OU1A 1PCKA 2G97A 3ELFA 2EKCA 1E51A 2CLEA 5BOOA 3PUDA 4YXGA 3TA6A 1PV8A 2FPTA 4LTSA 4C1LA 3E0IA 4UTTC 1O4UA 2X1TA 1OJXA 2PRMA 5DXXA 3IVUA 1VR6A 3BW3A 2ZYFA 1A5BA 4DF2A 1ZFJA 3S5NA 4DO5A 3ABSA 1MEWA 3HF3A 1I2RA 2I14A 3NQAA 4GUHA 3GXTA 1TV7A 3SGUA 3MI6A 5DLCA 5C54A 1KBJA 2C18A 3FFSA 1L6SA 3PG8A 3Q58A 1ZAJA 2W6RA 2ATSA 2Y7FA 4UMAA 4JTUA 3U6WA 3PG9A 1T0OA 3GDLA 4ORIA 4LS2A 3LERA 4O11A 3G1DA 2YYTA 1X7FA 4QJ1A 3W2JA 4RX0A 1P5BA 4MJZA 3NPXA 4LC6A 3W9ZA 3HGJA 2H8ZA 1ZY9A 3M47A 1IXQA 3SFKA 3H53A 4AEOA 3DHDA 3L5LA 2FIQA 4O16A 3TSMA 1TYGA 1SUXA 5LNSA 1YADA 2GJNA 1BKSA 1JCXA 3I65A 5C2XA 4EF8A 5F4XA 3QQ1A 1H61A 5G4WA 3W1PA 4IQLA 1K8YA 1KFCA 1X1ZA 4K8HA 3W85A 2QKFA 2WKJA 4JS3A 2V5LA 5EA9A 4CNPA 3HPXA 3W7DA 4LU0A 1O60A 1FBAA 3NYZA 3G1XA 2X1RA 3C56A 5I3GA 4FIQA 4CQAA 3TH6A 3TMLA 3EB2A 5D03A 3MYOA 3PY2A 4IPIA 3P5ZA 5IBXA 4O28A 2V5BA 4GBUA 3LCFA 3NVTA 4LC8A 1YDNA 1BWKA 1Q6RA 2A6NA 3KHJA 5HR7A 2RDTA 1I2PA 4KKXA 1C29A 1GPWA 1XUUA 4JN6A 3M16A 2E5BA 3T55A 2QEZA 3CT7A 3F03K 3TSBA 1JCYA 3KVLA 3GDTA 2ZQ0A 3FKKA 3E12A 3SSJA 3RU6A 3SGZA 1Q45A 4UUIA 2BXVA 1LYXA 1ZALA 4FXSA 3PF3A 5I3JA 1KFLA 2R14A 3G24A 1SO3A 2Y7EA 1IXNA 1OVDA 2QCDA 1U83A 3W84A 4Z1DA 3BK0A 3L5MA 3CEPA 3LHYA 1K8ZA 5F2LA 4IUOA 2Y7GA 2YXGA 3R89A 3C0JA 3OA3A 3Q2DA 1KTNA 4O0ZA 1JVNA 4CCEA 4FX8A 3CQ0A 5AHEA 1XBYA 1S5TA 1OYAA 3G22A 1B57A 1OF8A 2FTPA 4UNLA 2ZRVA 3NZ1A 4JTEA 2GOUA 3HG2A 1TRIA 3UPBA 5CPOA 2XFWA 2HTMA 1HTIA 3VE7A 4HNTA 2H90A 4HNVA 4JGDA 4TX9A 3WJYA 4DO4A 1P0NA 1GG0A 4GJ1A 4FF7A 5G4EA 2YFNA 1R46A 1ZNNA 5K9CA 4YWIA 1KFJA 1TQJA 1C9DA 3HBLA 2VFIA 5AHMA 3V1PA 4FEZA 3BG3A 1NEYA 2PE4A 4O13A 3M9YA 2NLIA 5HINA 1YYAA 2TSYA 4NVTA 2DZSA 3EWYA 1XL9A 3SECA 4AAJA 4ZQNA 4BWLA 3RLVA 3R2GA 3SIZA 3UYCA 4AH7A 4GUJA 3S6DA 2R91A 2W79A 4ZQPA 4AHPA 3RF9A 2P0OA 4HSNA 4AWSA 2A2IA 1W1ZA 4LOCA 4RCXA 3PR2A 4RZ5A 5ABTA 1UJPA 2Y63A 4UTKA 3SW6A 4BI7A 3L0KA 4KFNA 3RNDA 1OFPA 3CPRA 3C8FA 5DCDA 1WAUA 2YCEA 4WY0F 3DH7A 3LDVA 3NL6A 2YDAA 5KZEA 3B0VC 3HJZA 4AXKA 4X22A 1PS9A 1K8XA 5EY5A 1PHWA 3GXPA 4WQ6A 1O5KA 3B0UX 1R2SA 4NZFA 2FJKA 2W0UA 4A2RA 3QF0A 1WBJA 2H3BA 3PB0A 3LX9A 4K37A 1FXPA 1UBSA 4I9AA 4XTDA 2CLFA 1TQXA 2JKAA 4ONVA 2QF7A 4N9EA 4J9JA 3NR0A 5KSWA 3C2OA 2CFFA 4BK9A 3I6RA 1RZMA 3MWAA 1G4EA 2CW6A 3IGXA 3M43A 3W7QA 1LRTA 1W5QA 3INPA 4HN4A 4MLRA 4WJEA 1T99A 1W37A 3P60A 1DV7A 2NWRA 1JCJA 4MY1A 4YMZA 1TPWA 5AYZA 3CHVA 1CI1A 4K36A 1H60A 3DFPA 5LZLA 3ATZA 1G4TA 5LSMA 4POCA 3IVTA 1BEUA 3BVJA 3A24A 1THFD 2Q3RA 2WNQA 3W1LA 4OV9A 4MKNA 5BNKA 3F4NA 2QJHA 4UIOA 3IIOA 4LVAA 4OHQA 2ISWA 1KFBA 3QW3A 4K8EA 2OJPA 1VYPX 2E1DA 1TREA 2V8ZA 3UWVA 2H6RA 5LNVA 3BV4A 4R33A 3DI0A 3MP3A 2OT1A 3I68A 5DBTA 4UTIA 3W88A 1YTKA 4UFLA 3OG3A 2C0AA 1W8SA 4KFPA 2F7FA 1TPVA 5I3FA 3G0SA 2EHHA 5AC8A 1S3HA 1KFKA 2ZZ3A 4JXCA 3LXCA 2BX7A 3C61A 4PC8A 3NM3A 4UTLA 3T4CA 2DJLA 3N2MA 5DY2A 5AOUA 3AO0A 3N9SA 2Y6ZA 4H6KA 2QCHA 2WSYA 2NUYA 3E02A 4XUGA 3GYEA 4LVFA 2C3ZA 1ZAIA 3LCIA 3JS3A 1SPQA 4S1FA 3O6YX 3TJLA 4R34A 3KRUA 3LBMA 4JTJA 4AF0B 2B7PA 1EWDA 1SZEA 3TW6A 1OK4A 2FB3A 4E0CA 1LORA 3DBPA 4DEFA 2GUUA 3EWBX 3W86A 3ZWSA 4ADSA 3V75A 1KM0A 2DU2A 1BWLA 2YW3A 1TPUA 3BGJA 3G1SA 1W0MA 2Q3OA 3C6CA 3P84A 3LHTA 2WSQA 4ICNA 3HIJA 3TQKA 3A5VA 5K4XA 3W7OA 1ZCOA 3EX1A 3MO7A 3M7WA 2VEKA 5H91A 4KFOA 1ONRA 2QR6A 4P61A 3W7GA 3W7PA 1KM3A 4IXXA 3W6YA 1ME8A 2YX0A 8TIMA 1XDMA 1ML1A 3P7YA 2G95A 1SO4A 2ZZ6A 3NG3A 3WK0A 2XN1A 2FFCA 4PFMA 1KM4A 3WJZA 3Q94A 5DELA 3ZWTA 4NQ1A 3C2FA 2I9EA 3GNDA 1QR7A 4Z1AA 2A7RA 2Z1BA 4BFAA 4L4MA 1XKYA 3OIXA 2BWGA 1KV5A 1TB3A 2Y70A 1OHLA 5FF3A 1VJIA 5HUOA 3VCRA 2X2GA 2JKEA 2XN2A 3SR7A 1G67A 4R53A 4FO4A 1X1OA 4DBEA 1LOSA 2DZXA 2A7NA 3PSWA 1GG1A 1I2QA 2ZRZA 2ZA3A 1VCGA 4Q33A 4TMBA 3E9AA 1SU5A 1EB3A 1SW7A 2Z0IA 4CNNA 2A5HA 3I7SA 4A2SA 1XBVA 3MP5A 2E5CA 1OFEA 3A22A 3L9CA 1OFQA 2Y7DA 1S5VA 2ZZ4A 4MPQA 4QSHA 4O4WA 1F74A 4UMBA 2ZCGA 4PA8A 2JK2A 4RZ4A 2Y88A 4Y96A 5AHLA 3VNDA 4O52A 3W22A 3L67A 3TFXA 1D3HA 2QCGA 5E93A 5LNUA 4FNUA 2G5WA 3M5VA 1LZOA 2G96A 3L5AA 1XI3A 3LV5A 4DPQA 2CLLA 1IIGA 3W7JA 4IMEA 1UUOA 4NU7A 5CPLA 1EUNA 1W5OA 2ZRUA 3KVJA 2RKXA 2IQTA 2B7OA 1IXPA 4JR5A 1I2NA 5I3IA 1FUYA 1VLIA 2QUTA 3G18A 3BLFA 3VFLA 5AFDA 1KV8A 1KLYA 1A5CA 1KM6A 3BW4A 1EP3A 1Z41A 3IGSA 3TR2A 3T78A 4TR9A 1RPXA 1KFEA 4EOUA 1FDYA 1EA0A 3QM3A 3UQNA 5AC7A 2EGZA 5D2VA 4QISA 4GUFA 1LDCA 2FPVA 2NXGA 2CZDA 4JTKA 5FF0A 1V5XA 3B4UA 3MW7A 4R7JA 2VEPA 5TIMA 4AB4A 3GAYA 2NXHA 3NDOA 1I45A 3A5FA 3QMRA 1P0KA 1Z48A 3IIPA 3LLDA 4N9BA 2DZTA 3UPWA 1N8FA 3LRMA 5EKYA 4UTHA 3EKLA 1KM5A 3M5ZA 4IX0A 3NQDA 5DCBA 3W7RA 5HWMA 2AGKA 4MOZA 2ISVA 3QQ0A 2WO5A 1A5SA 3PUOA 5C6MA 2R94A 4GUIA 1VLWA 3I7QA 3KRSA 4S2BA 4GNJA 5D04C 4WOZA 3EKZA 3W7NA 4HIBA 4EWND 5LNRA 1TTJA 2RDWA 3CU2A 2Q8LA 3MJYA 2DZWA 4I7WA 3GR7A 1XXXA 3KX6A 4QAIA 3PM6A 2A21A 3LRKA 4PEKA 1QPNA 4AVFA 3VI2A 3NGJA 3TC6A 4GRSA 2QJIA 5BRBA 4RK8A 4AWUA 3LHWA 3WK2A 4BI5A 4CCDA 4IMCA 2V9DA 1IF2A 1TSIA 4HNUA 1C8VA 4E38A 4WUIA 4EF9A 3W2LA 1F6KA 3KFTA 2V2CA 4P2VA 2C14A 2TMDA 2NX1A 2H8XA 3M1ZA 4WY0A 3HPSA 1VYSX 4QQ3A 3P5YA 4CNOA 4FX6M 1YDVA 1XFBA 5FEPA 3OBKA 3G3MA 3W1MA 4JTHA 2RH9A 4I7VA 5DBUA 1OX5A 4LT9A 2NX3A 1MXSA 1H7WA 4IPJA 2VEMA 1CW2A 5T26A 5HULA 4JYEA 1KW1A 2WOQA 4IWWA 1IXOA 3GDMA 4M19A 3LI1A 4B5NA 1GTHA 3M0ZA 4NUWA 1LLZA 3W2KA 2WQPA 3A9IA 4UCGA 2Z6JA 3W7HA 3IEBA 3P61A 3STEA 4O17A 3Q37A 3TJXA 6ALDA 1H5YA 1UCWA 4CCCA 4O14A 4EVZA 3T44A 3G1FA 3C4UA 4LWWA 5MHBA 1N7KA 5K7JA 3BO9A 1PVNA 3GB6A 5LHFA 3M5YA 1LP6A 1SR9A 3UY8A 2VELA 5HJLA 1H50A 3O6CA 1WOAA 5HWJA 1BTMA 3UWUA 1G69A 1JCLA 1H7PA 3W7EA 1ZHAA 2VC6A 4M6PA 3P82A 1DQXA 3L0GA 1FCUA 1G4SA 3GDKA 1JJKA 2OCZA 3LCLA 5AHIA 1DOSA 4RXFA 1CX9A 1LCOA 4MYAA 1WBHA 3BLIA 2GQ8A 1GVQA 1R30A 4JTTA 5TQLA 5TBOA 3HQ1A 3R8RA 3QSTA 5FF2A 3W1XA 2LLEA 2QCMA 3S9YA 3P74A 5FESA 3QW4B 3N9RA 1K3UA 1KBIA 3TAKA 2Z2UA 4MFEA 4JX5A 3NOEA 1H62A 3NQ8A 3W1AA 3C2VA 2TRSA 3NL2A 3NQVA 2GQ9A 3W2NA 4ZQOA 1U5JA 3S1VA 2CZ5A 3S1XA 1EWEA 3KOFA 3MBDA 1B4KA 3STGA 5G1TA 3LHUA 3R5EA 5U7SA 3LTYA 1JUBA 3IIZA 3IIXA 3ZR4A 3TUUA 1N55A 2DZUA 5D02A 2WNZA 3TXZA 4H4IA 4NNAA 3KVKA 2C1HA 3ABOA 2V81A 2ZTKA 3U2OA 5F4SA 1GZGA 3DENA 1V7YA 1KM2A 1ADOA 3HGRA 3D0CA 3HG4A 1LOLA 3GDRA 3W71A 2CLHA 1FQ0A 4M6QA 1QWGA 3DHFA 5AN7A 3W1TA 1VZWA 3W70A 1DL3A 3NQMA 3L68A 3NQ2A 4RLIA 4M5PA 2GVLA 1NFBA 1XM3A 1AMKA 2PRLA 3TU9A 1SQ7A 3S42A 2B7NA 4MFDA 1F73A 3M41A 1SZGA 3LCXA 3LCGA 3TV8A 4CQ9A 4DBDA 2X30A 2RFGA 2YZRA 3LTPA 3NO5A 5DXYA 5L6UA 2VFDA 4UR7A 5G2WA 2GPTA 1VPXA 6TIMA 2PCQA 5D38A 2E77A 3HGSA 3QMTA 1OX4B 1FWSA 5F2GA 4IGHA 3OVPA 4M7SA 3IRDA 1LBMA 4FNSA 1ALDA 1FX6A 5F2IA 3EXSA 3UZJA 1TPDA 3U8GA 1W3IA 3UWYA 2J24A 4XWUA 3GLCA 2QCCA 5BMWA 4MYXA 4O4VA 1JQVA 3OEXA 1DBTA 4MVAA 3SJ3A 3BW2A 1OFDA 3TE9A 2BSLA 1TJPA 1TV5A 1Z44A 5I3KA 5AB3A 4PTNA 5CZJA 4N9DA 2ZRWA 1KM1A 1RQBA 2FDSA 1TPH1 3B04A 2YYUA 1XBXA 1JQXA 4LUJA 3LI0A 4LV9A 3LTSA 1RVGA 3TFCA 3MHFA 5K2ZA 3TKFA 4JTLA 2NV2A 3G1YA 1TPC1 1VQTA 1Q6QA 1YTEA 2WJZA 2FB2A 1YPIA 1W5NA 5D30A 3ABRA 2Z6IA 3TQVA 1PL9A 4Z0JA 3UD6A 4N6EA 1AW5A 2Q8ZA 4AF0A 3G0UA 3HO8A 3BLEA 2OZ0A 3QPZA 3HB9A 4C1KA 3CC1A 3OHIA 1WXJA 1R47A 3GR8A 2BZNA 4NT0A 2X1SA 4JDBA 1HL2A 1TPFA 4QM1A 1MZHA 1GVSA 1J2WA 2NUXA 5D32A 4IXHA 4FX7A 4OGZA 1MO0A 4GC4A 2CLIA 3HGOA 4OE7A 4UTWC 2V82A 4WOQA 3THAA 2KZHA 3FJ6A 3O15A 1VC4A 1M6JA 4PH6A 1TRDA 4UFIA 3M5XA 5IBXC 4FNQA 1OFRA 4AWTA 1J5TA 3UXDA 1QMLA 3TXVA 4NXSA 1RR2A 4HSOA 4UFHA 2NUWA 3IVSA 5F1VA 1OFAA 5CPMA 1FCBA 5G2IA 3W23A 2YW4A 3CWOX 5HWNA 5K4ZA 2QAFA 3BARA 4JEQA 1WYIA 4JIPA 2JKPA 4XKYB 3EEGA 3EWZA 3S0CA 3A21A 4OT7A 5E0KA 1PCWA 1P1XA 3NQ7A 1SFJA 1MEHA 1QFEA 4NJHA 4JYFA 3N19B 4DQWA 4MZ8A 1VH7A 1F5ZA 4UFJA 3W87A 5G5IA 4A21A 3O63A 2QAPA 3W1NA 4Q32A 3FIGA 4GWEA 1WOBA 1AG1O 2FPYA 4JNMA 5KINA 3NQGA 3W83A 4ZQCA 3ZS4A 5CG7A 1EP2A 2GQAA 3RK8A 2B0MA 4K38A 3G1AA 3LB0A 1TJRA 4X2RA 1I8JA 1WX0A 1LM1A 4UTJA 3NM1A 3CIXA 2QUUA 3BG9A 1W3NA 1NSJA 4MY8A 5A5WA 2D73A 5AHNA 4HKPA 5C5YA 4GUGA 1NF7A 2A0NA 1LBLA 3WJWA 1H51A 5HR6A 1QOQA 4TU1A 3R12A 5EPDA 3IGUA 2ZZ1A 1QPRA 3P80A 2NV1A 3LOTA 4IJBA 5HNRA 4Z08A 3LHZA 2BTMA 2F84A 1YXYA 4TO8A 4OBTA 3MMTA 3B0PA 3L66A 1K7EA 4DELA 2Y85A 4FNRA 4XBSA 3IIVA 3M6YA 1QAPA 1WV2A 1B9BA 3QPYA 2NXIA 5GVJA 2BLEA 3P8JA 3HMJG 4UXDA 3TNOA 5D2YA 3E49A 5FF4A 5L9FA 1SZNA 3OVRA 3EWWA 2DP3A 3KRZA 2PRHA 3SI9A 3TROA 4ML9A 4KWVA 1JCMP 1R2RA 1ZENA 5D37A 4MY9A 5F1UA 3W75A 1GEQA 1PE1A 3QC3A 1GVRA 3DFOA 1H7NA 1YTDA 2CLMA 2OMAA 1KTBA 5D2WA 2CU0A 3TCEA 5FEXA 4YLWA 1JUEA 4MLJA 3FA5A 4U28A 1A53A 4A22A 2R8WA 1OYCA 3G8RA 5G2HA 2ISSA 2QDHA 3WFAA 1XC4A 3QFEA 5BW6A 2C6QA 4RV8A 2ZZ5A 1TCDA 3DFSA 4HT3A 5LGXA 1FY6A 4WD0A 2ABBA 2ZRXA 2QDGA 1HG3A 1LRQA 2ZDRA 4Y8FA 3W1RA 1NF0A 3NQEA 1JRCA 3UWZA 4JTGA 3NPUA 3T7VA 2QCDB 1JUKA 3JR2A 3W1QA 5LKYA 3UXAA 2DZPA 4NJGA 4JICA 4X9SA 3FYOA 4FB7A 4Y9AA 2DORA 4IMFA 4Z0SA 2J9XA 2CZEA 4UC5A 4IOTA 3CIWA 4N4QA 3L0NA 4UTMA 2TPSA 4O53A 3BPWA 4PL1A 3STCA 1OFBA 3S1WA 4MZYA 4O50A 2DJXA 1W54A 4M7TA 2YSWA 3CWNA 4LUIA 5FF7A 2E5DA 3ZFHA 1ICQA 4JYDA 3P67A 4H3DA 1AW1A 2ZBTA 4UTUA 1GVOA 3DFQA 4QNWA 4JTIA 2CLKA 1GTEA 1PHQA 5F4WA 5KZMA 3N73A 2C15A 4OV4A 3GAKA 4UR8A 1EX5A 1MSSA 3TIMA 1YLVA 1XUZA 1ZJIA 1FDZA 4UMCA 2PC4A 3W74A 1Z42A 3S5OA 5K9DA 4M6VA 4YCPA 4Z1CA 1QO2A 4N9CA 3S8HA 3WK1A 2J9YA 2WSRA 3B06A 4AHOA 4BR1A 3L21A 1KA9F 3GIYA 3I7RA 3QRHA 3QZEA 3NL5A 3FYPA 3GNNA 2A85A 5EBUA 3GK0A 3G1HA 4XQ6A 1YDOA 4UFMA 4O57A 5KTLA 3UWQA 1NAL1 3LGEA 3MHUA 3CLMA 4A29A 5K3VA 2GVJA 3H55A 4OWGA 1PIIA 1TPEA 5KZDA 4DF1A 4E2BA 2WPBA 1H7XA 3M44A 3PBWA 4O1AA 3B8DA 2V30A 4RZ6A 3MYPA 1OK6A 2P1FA 2E6YA 5AYYA 5LHEA 3PS7A 4O19A 4CLMA 4UFKA 3DFTA 4WY0B 1F05A 1I2OA 4MIMA 4NNBA 3W7MA 4DF0A 3CM4A 3CTLA 5HMSA 3PBYA 3LCWA 3W1UA 4HPJA 2CLOA 3NNTA 1F6PA 1MEIA 1G7VA 2E6DA 3S5ZA 3AJXA 5AC6A 4MJMA 4LVBA 4LNYA 4DPPA 3LBCA 3NEVA 1SFLA 1DORA 4NJKA 1D3GA 3GVGA 2VFHA 4ZQRA 3L65A 2VEIA 3L2IA 1K03A 3K30A 4LW7A 5CZ0A 4YL2A 1KLZA 1GQNA 2C13A 1ME7A 5FI8A 5LNWA 1VCVA 4NJIA 1FWWA 4ADTA 3A23A 1DJQA 4O1CA 3B05A 1QPQA 5EMUA 4LVDA 2X1UA 1Y0EA 4JD4A 4UTWA 1M7PA 1T96A 3B03A 3NAVA 4PCFA 1YXCA 1TMHA 1R2TA 2ZTJA 1QNVA 3R13A 3NQCA 1UB3A 2A1YA 3WK3A 1H1YA 3GZ3A 1XDLA 4HPXA 3G1VA 3TK7A 3LCHA 2VOMA 1FWTA 3W72A 4ORMA 2WV8A 3TMQA 1O94A 2B7QA 2OT0A 3RLUA 2ZZ2A 1M7OA 3UZ5A 3W7IA 1EEPA 2XN0A 1QCWA 1FWRA 4LS1A 4TIMA 1W3TA 3G0XA 4O8RA 2CZFA 2J88A 4IMDA 2C16A 2EAWA 2VFFA 3TDFA 1A5AA 1Q6OA 4ZVJA 4DXVA 2E68A 1TIMA 4O1DA 2HS6A 3W7KA 3FLUA 7TIMA 2AAMA 4Q4KA 3DI1A 3LLFA 4FIRA 4TMCA 4K39A 1T8XA 3DFNA 3WJSA 1D9EA 3F1QA 1G4PA 1LROA 3NPWA 2J6XA 5D09A 1AW2A 5DN1A 4YCOA 3TC7A 3PUEA 3UWWA 1AL7A 5AYXA 3NL3A 1HO4A 1RQEA 1UUMA 3S1UA 2FLIA 4N6FA 4JTSA 1S5WA 4NZJA 2NZLA 4KWWA 1LOQA 1H7RA 2QCFA 5IM51 3YPIA 1WDWA 4G1KA 3MHGA 3KVMA 2VKZG 1ICSA 2O7QA 4E2DA 3MBFA 3NZRA 1GYLA 3RMJA 1FXQA 1LRNA 1FWNA 4AHQA 4WX2A 3LHVA 3CEUA 1TTPA 1X6UA 2Y89A 1FCQA 1EP1A 1SO6A 3GX9A 1B4EA 3TQ0A 5KITA 4NXKA 3TW7A 1LBFA 5CZSA 4HHPA 4RR4A 1VYRA 5FEZA 3E96A 3P8IA 3MP4A 5CGQA 2I1OA 1VHCA 2HMCA 1OX6A 3C52A 1F7BA 3F4WA 2J9ZA 4L4LA 5CZTA 2ZRYA 1RD5A 4ADUA 1KTCA 3N34A 1H63A 3W76A 3GKFA 3SZ8A 4BI6A 1LTDA 1L2UA 4XZ9A 2B4GA 1P4CA 3PAJA 3W7CA 4WZHA 1QOPA 1FCVA 2OX1A 1QPOA 4WXYA 1I4NA 4JX4A 4XTIA 2Y61A 2GJLA 2E6FA 5D33A 3OVQA 4NX0A 1DKWA 4X3ZA 4ZMGA 1F2JA 1GT8A 4BWLC 4O18A 4A3UA 1L9WA 4GXMA 1TTQA 4NJJA 3ATYA 1SW0A 3NPVA 5C55A 1SSDA 4K7VA 3FJLA 3CB8A 3DGRA 4O10A 2H3DA 3O07A 4PL2A 4EIVA 2EF9A 4W9TA 2VENA 1XBZA 2ZA2A 2YPIA 3PBVA 4I7UA 2ZFAA 3W7LA 2YFOA 3G8EA 4RKAA 3DXIA 1LLWA 3MI3A 2FQIA 3NXFA 2V2HA 5D2TA 1YXDA 3WJXA 1IGSA 2WNNA 1L6WA 4HNNA 3HOJA 3PBUA 1JULA 3G3DA 1WQ5A 4QITA 3LXBA 5U4NA 4UNKA 3LV6A 1HFBA 3LRLA 3EWUA 1IIHA 3EX6A 4O54A 3KXQA 4GFSA 1SO5A 5J5RA 1W5MA 1YPFA 2J27A 1JR1A 1VRDA 1A50A 1SW3A 2Y62A 1GYNA 1SZFA 5D2XA 3ANYA 4JIQA 3C3NA 3JRKA 3PWAA 5J5DA 3DAQA 3MI2A 1H7OA 3FS2A 4ALDA 2UV8G 3QH2A 2E6AA 1AK5A 4LRSA 3TAOA 1Q6LA 1GWJA 3N2XA 3USBA 5DY3A 4LY8A 4LVGA 1OG0A 1H1ZA 1JCNA 5CKSA 3VE9A 3IV3A 3EXTA 5HUPA 1M5WA 3PC0A 4JY9A 4JY8A 3EXRA 3QYQA 4FHAA 3PULA 1K02A 1RQHA 1TV8A 2NWSA 2PURA 3FKRA 1W31A 3FOKA 3QMSA 2O7SA 2VXNA 4IMGA 1DVJA 5DCEA 3W73A 5I3HA 2ABAA 5D05A 3NQ6A 5F2MA 1GJPA 1FDJA 1K7XA 3TX9A 1OABA 1L6YA 3FEMA 1DJNA 1OF6A 4JX6A 3NA8A 3GKAA 3DZ1A 1WA3A 2GVGA 1TO3A 4Y90A 3EWXA 1OFOA 3S5YA 2EPHA 2AQWA 5EYWA 3N3MA 5A8GA 2QUVA 2X16A 3SY5A 5LGZA 1O5XA 3EX2A 4IX2A 2QCNA 2QJGA 4ZL1A 1O95A 4AMAA 5EL1A 3T40A 4Z1BA 3BG5A 2A4AA 3O8AA 4O15A 3QJAA 2VFGA 2QCEA 2ZA1A 4JDYA 3RFAA 3P62A 4FNTA 1TPB1 4PODA 3UNDA 3EX4A 4MUZA 4XKYA 3KAOA 3PSVA 3EX3A 3MUXA 3O16A 1G6CA 4ZZ9A 5KMYA 1OYBA 3LXAA 4O1BA 1XCFA 1Q3NA 4Y6GA 1DQWA 1VS1A 5CSRA 3BGGA 4MZ1A 4XBKA 4LRTA 3N14A 5K9XA 2C19A 3TSDA 3DU0A 1SSGA 5FEWA 2P10A 4UTTA 2NX9A 4JTFA 4NX5A 2V2DA 3DKJA 3C2RA 5CSSA 3O6DA 4K7YA 4ZQMA 4GE8A 5CPNA 3C2EA 1HUVA 5BMXA 4QIUA 3ABQA 4LS0A 2QCLA 4LV4A 2YR1A 4QNEA 1VGAA 2HSAA 1W56A 2ZZ7A
chains in the Genus database with same CATH superfamily
3GXNA 2XH2A 3VKCA 4O0KA 3W2UA 3P81A 3RX3A 1ISXA 1GVFA 3H54A 2FKPA 1MMFA 1TVPA 3WEZA 2P0IA 2ALDA 3H12A 1A0EA 1KFWA 1F76A 1KBBA 2B31A 1HQTA 2YA1A 3W4RA 1KBKA 3VOJA 4A8LA 2E40A 2PWEA 3W6MA 1QDSA 2W4XA 3V5CA 3VIFA 4B91A 3THQA 3HPZA 1L0PA 2W91A 3M0JA 2PGEA 1VHNA 2A3LA 3ABZA 8A3HA 4QS6A 5AY7A 2R9RA 2DZVA 5I78A 5BXRA 1TUXA 1DXIA 2CBVA 2PP3A 4CN4A 3NIYA 3AIWA 4LUTA 4WXZA 4OQVA 4RJEA 4D2JA 2V3FA 3CAWA 4AZCB 4M8UA 2I5IA 4U2YA 2QV4A 1GK8A 3PUDA 2FPTA 1DWAM 4LTSA 4YTTA 1ECQA 1XH2A 3QTGA 3ITYA 3M46A 4DF2A 2ZOXA 3S5NA 3HU7A 3E2RA 3D46A 1VBHA 2I14A 4GUHA 3GXTA 1TV7A 4GABA 3FDKA 1KBJA 2OLHA 3PJXA 1ITUA 4DJFC 3PG8A 3Q58A 1AH4A 4LXFA 4PTDA 2F6KA 5J8LA 5MKGA 1WAWA 2X0SA 4H41A 3TW9A 3NXLA 4C6QA 4LS2A 2ZWZA 2R24A 2YYTA 1W17A 1X7FA 4QJ1A 3W2JA 4B3KA 1C3FA 5A3HA 1Z3NA 5GPRA 1CYGA 3SFKA 3WLIA 4BQ3A 3ID7A 1S2TA 3RDKA 2HROA 4O16A 1Q13A 1QRQA 2EG6A 1UWQA 1TYGA 1ESWA 4PUKA 3PHAA 2R1PA 4Q4OA 3VA8A 1I75A 1JCXA 5C2XA 3DYMA 3ZMRA 3W1PA 1KFCA 4PRWA 4D8ZA 1Q85A 3SO7A 4EX4A 1JAEA 4O1EA 3CYVA 3W7DA 1GJUA 1E5NA 5B7ZA 2X1RA 1UKTA 3MYOA 3PY2A 4GBUA 4HJWA 4LC8A 3MUCA 3N6JA 2VGBA 1Q6RA 3ITVA 4KKXA 2G4FA 1GPWA 1XUUA 3TWAA 5FD0A 2QEZA 3UETA 3ARUA 3KVLA 1S46A 3QHNA 3PNZA 1XLFA 3SSJA 5I02A 4UUIA 3GW3A 2BXVA 3WH9A 2OEKA 3ZIZA 4S3CA 1LYXA 2XGIA 3EOEA 4ICCX 1KFLA 2R14A 4A05A 2QCDA 1U83A 3W38A 3BK0A 1MNSA 2GVYA 3CEPA 3E5PA 3T09A 3WQVA 5F2LA 3L4ZA 3PPGA 1JYVA 2YXGA 2WZEA 3Q2DA 2V67A 4U5KA 4CCEA 1WDDA 3CQ0A 3SQSA 3MVIA 1S5TA 3G22A 4YWSA 3RR4A 1B57A 3ZO9A 4UNLA 4JKLA 3GM8A 1MW3A 1TRIA 3UJRA 1GW1A 3NSNA 4GY1A 2C7FA 1UYQA 4IL2A 3VE7A 4HNVA 4DO4A 1P0NA 1GG0A 3OW1A 1ZNNA 5K9CA 1FP9A 3OPSA 1C9DA 3HBLA 1BSIA 5AHMA 2CEQA 1E6XM 2PE4A 4GI8A 4O13A 5LXEA 1VP5A 4AAJA 1ADSA 2WBKA 2VGFA 3R2GA 3SIZA 3UYCA 4GUJA 1JEZA 2W79A 4ZQPA 2QT3A 4AWSA 2FJUB 2GOKA 3MDUA 2Y63A 4UTKA 1EJVC 3GXMA 2WMKA 4GPNA 4OBSA 1OFPA 3CPRA 2GSHA 1NFGA 1OC6A 1OGGA 5DCDA 3T2QA 3VCCA 1XCWA 1N8IA 3DH7A 3LDVA 2YDAA 4PUJA 4PMNA 4UQDA 1W9PA 4AXKA 1E1EA 1PJ9A 3CZKA 1KXHA 4AY8A 1B90A 3TN6A 4L7ZA 4FMVA 3HPAA 3FX4A 4A2RA 3AHXA 4O1FA 1J12A 1FXPA 1UBSA 1NP0A 4NRSA 4MNMA 1TQXA 2ASHA 4J9JA 1DXEA 4GIEA 2C8NA 2CFFA 1AJZA 6TAAA 3MWAA 2CW6A 1LRTA 5ABGA 1LJYA 3INPA 3T4CA 4MLRA 3BZGA 4Z1YA 1TZ7A 3P60A 3T0TA 1DV7A 2VX7A 4YMZA 3F4VA 5CPSA 7PTDA 5LZLA 3RX2A 3ATZA 1YMYA 5LSMA 5A2CA 4POCA 4WDTA 1TJ1A 2XM1A 3IVTA 1BEUA 4OOZA 2OZ3A 4GX9A 3CZ8A 2HCVA 4OV9A 1NDVA 5BNKA 4H2HA 1DJXA 3IIOA 4OHQA 2ISWA 3BOXA 3U2EA 2OJPA 2WW5A 3AFBA 3UWVA 2WZIA 4JZ5A 3WMBA 2OQYA 4WJ8A 3W88A 4HYWA 3QV7A 4M0XA 1EPVA 3WF4A 1TPVA 5CPTA 4AU0A 2REQA 3LXCA 4F4RA 3WLHA 1X6NA 1NWTA 2C79A 3OP2A 3WFLA 1KR0A 2DJLA 3N2MA 4NF7A 4HB7A 1CXIA 4W5UA 4LGXA 1R7OA 2WSYA 4DWSC 4PEEA 3CL8A 1VFUA 3CV7A 3LCIA 1HP4A 1SPQA 1AVAA 4DI8A 2E3ZA 4S1FA 4R34A 1B3VA 4JOMA 4P8XA 4L64A 4QCEA 2GK1B 3AS2A 4AF0B 4W93A 4B4HA 3NDZA 2VTFA 1LORA 1MRQA 3EWBX 2DW6A 5PTDA 3ARXA 1KM0A 2DU2A 1I60A 1J01A 3E2QA 2Z2BA 3AUJA 3G1SA 2R1MA 3LHTA 2WSQA 3MMUA 1M41A 2VZUA 1SGJA 4RNIA 1UKSA 4LAOA 3W7OA 1SVDA 4LUSB 4M81A 4DLMA 1ZP3A 3T07A 4KFOA 4GIRA 4IXXA 8TIMA 2HISA 1P6CA 3P7YA 4IICA 2J74A 3W37A 2J4GA 3WDHA 3GUGA 3WQWA 2ZUSA 4KRUA 3ZWTA 3ZYZA 5EB8A 3SRDA 2QMJA 3CV1A 5CXPA 4E3VA 3WLJA 5FF3A 3URNA 5HUOA 5I79A 2WMHA 3LG3A 4C6EA 2X2GA 2ZXAA 2BY0A 4FO4A 4D6EA 4CD7A 4DBEA 1JF6A 1E0UA 1V3MA 3VD9A 3A3WA 1UWSA 1E0XA 3QN3A 1SW7A 2OU4A 2Z0IA 3WNMA 2ZX9A 1XBVA 3R0UA 2FTYA 4OOUA 1K9TA 2YLLA 3L9CA 2NSOA 4Q8TA 3H2NA 2Y7DA 1S5VA 2ZZ4A 4MPQA 2EPLX 4JPGA 1O1ZA 2XIJA 4NAFA 4O4WA 1F74A 5HMFA 5A6MA 2AL2A 2CKSA 2ZCGA 3AOFA 4FPSA 2DQWA 5HATA 5AHLA 4KEZA 3VNDA 2ZC1A 4B5TA 4FNUA 2NVCA 1LZOA 1VJSA 2G96A 4P7RA 2BFGA 3KOWA 5M17A 3LV5A 1W1TA 4IMEA 1EDQA 1UUOA 1W5OA 1XCXA 3WO8A 2B7OA 3THCA 4INFA 1R86A 5I3IA 3DDMA 2CNCA 1FUYA 3BLFA 1JPDX 5AFDA 1W9XA 2BGNE 1KV8A 2BOEX 4DUVA 3IGSA 2P88A 3TR2A 1TFVA 3AIBA 1RPXA 2ONEA 4DB7A 1FDYA 1EA0A 4MWAC 3WQEA 3QM3A 3WD3A 1MQQA 1Q4NX 2DSWA 2V3EA 3PANA 1R0MA 1DWIM 4B5XA 4JTKA 2PDNA 4R7JA 5TIMA 4AB4A 3GAYA 1I45A 2YOCA 1Z48A 3LLDA 4N9BA 2DZTA 4UTHA 1OCNA 2NQ9A 4B90A 5DCBA 5HWMA 2AGKA 2A3HA 4XZNX 1ISYA 4BQ5A 3WDJA 3V18A 4DNHA 2R94A 3I7QA 4S2BA 1JFXA 5AZ0A 3C5QA 3W7NA 4EWND 3ITXA 3DIPA 4J3XA 2Q8LA 1Z9AA 2O56A 3LYEA 2DZWA 2DVTA 4TTUA 4E8DA 2H9AA 4QAIA 1AMYA 3R8GA 1REQB 1Y5WA 3GG1A 4QE1A 1KXQA 2F2HA 1P6WA 3ERPA 7ENLA 1QPNA 3VI2A 3TC6A 3BLOA 4RK8A 4AWUA 4BI5A 1TSIA 3CBWA 1PX3A 4WUIA 4EF9A 3W2LA 1GZ1A 2V2CA 1G0CA 4JQ4A 1NTHA 1S5MA 3B8SA 2XFYA 4QQ3A 4M51A 3P5YA 2HVNA 2WCGA 4XZMX 3POHA 4M56A 2XH0A 4FX6M 1W3KA 2ZKMX 3OODA 5FEPA 5FL1A 2INEA 4UB9A 3VKDA 4DZIA 4JTHA 3FAXA 4I7VA 4LT9A 4IPJA 1CW2A 5E9XA 2WOQA 1QI4A 3XISA 4GGBA 3LI1A 4AZHA 1P0EA 3W2KA 5XIAA 5CEWA 1V93A 3A9IA 3WQOA 4WKHA 1CEOA 5CJMA 3IEBA 4U3CA 4S3DA 3Q37A 2W63A 1H5YA 3QTPA 1UCWA 4H9XA 2D2JA 3H2CA 3MZNA 2VZTA 3O0FA 3DG3A 4LWWA 5CQ1A 3U57A 1W1A1 1R38A 3RM8A 4RDWA 3PN8A 3T42A 3AXXA 4ACYA 2GJXA 3U3HA 4KEMA 2PTZA 5HWJA 2VMFA 4HYRA 3NTYA 2VC6A 4HCHA 1WDSA 2DT0A 2OCZA 3LCLA 3MANA 4DYKA 5AHIA 3PBGA 4IL0A 1L6FA 3WQGA 4FS9A 3RPMA 5TQLA 1ISWA 1HT6A 2VX6A 5FF2A 3DFHA 3T4WA 3QW4B 4PZVA 4KGLA 3HURA 2Z2UA 4MFEA 1PUDA 3DYOA 1UR3M 3C2VA 4QTGA 1RCQA 4ZQOA 2GGJA 1KCZA 2VGIA 4FI4A 4Q7BA 3IANA 3ME3A 3S1VA 2IPFA 5GJMA 2CZ5A 2HWGA 4Q8VA 1UWRA 4AZ5A 1HKMA 4GQ0A 4S3KA 2D2GA 3UU0A 4ERIA 1MFVA 4Y9OA 7TAAA 4H4IA 8XIAA 2FH6A 2J13A 2V81A 2ZTKA 3U2OA 2QF8A 3FSTA 4AD4A 4B92A 4WSJA 1KM2A 1KGUA 1BQCA 4URIA 1K70A 3DHFA 5AN7A 1VZWA 2WC4A 4JTQA 2PWVA 3L68A 1JPHA 1UIOA 4QROA 1D8CA 1PEZA 1XYBA 3L7RA 2X30A 6XIMA 1EGMA 3BL3A 2VFDA 1JZ8A 4AEEA 6TIMA 1Q2RA 3WFZA 3QMTA 4Q8NA 1FWSA 2HVOA 4IGHA 3OVPA 4LSBA 3IRDA 1LBMA 4PR4A 4B9YA 3V0TA 1VIWA 1TPDA 3VNMA 1IZJA 1CT5A 2CLPA 2QCCA 1XRTA 4PSRA 2FZ9A 1RSCA 1Q2SA 4D9PA 5AC5A 3BW2A 1OFDA 1EIBA 1ISVA 2X42A 5AB3A 4PTNA 4J35A 5CZJA 2ZRWA 3T81A 4GO9A 1RQBA 2FDSA 1TPH1 4LV9A 3LTSA 4PMXA 3MHFA 3SJNA 1VQTA 1EDGA 1YTEA 3QR1A 1GVIA 2XVLA 1JPIA 4IGNA 4IG2B 3LSCA 1JF5A 3VOGA 4EXBA 1PL9A 4AF0A 4W8LA 3HO8A 4YVPA 4XK2A 1NP2A 2OZ0A 3VNLA 4C1KA 1WB0A 1SYTA 2H9AB 3VGEA 2BZNA 1AJ0A 1A80A 3SADA 2PS2A 3VDHA 1XYAA 3CHFA 1XQLA 1GVSA 3H2MA 1J0ZA 1WKYA 1J2WA 4K2SA 1FWBC 4HNCA 3URAA 1E9LA 4GNVA 4OGZA 1MO0A 3SQLA 4OE7A 4UTWC 2KZHA 1FHDA 2REQB 1M6JA 4QCFA 2I9UA 4PH6A 2VURA 4UFIA 3M5XA 4FNQA 3BOFA 3E1F1 2FVMA 4PUDA 4C6NA 4AWTA 1RJRA 4ZSTA 4NXSA 3EDEA 2NUWA 2XUCA 4D6DA 1WUFA 2BG5A 5CPMA 2VR5A 5A6BA 3CWOX 1E73M 3KZPA 3BARA 2QJJA 2C0HA 3WDPP 4RNJA 1SJAA 3RPDA 2PF0A 3IRSA 2XGZA 1X38A 5E0KA 5JH2A 1XGDA 3GVVA 1SFJA 3KL5A 3IJQA 3CZJA 1PKMA 1QFEA 2HK1A 2WVUA 4MZ8A 1TR1A 1F5ZA 4UFJA 1UD5A 1E6QM 2B81A 5FAGA 4LJ3A 3W1NA 1ZU8A 1JNDA 2W92A 1AG1O 2FPYA 1JDFA 4JNMA 3IPWA 3ZS4A 1CLXA 2GQAA 3F2CA 4K38A 3WH8A 1XLEA 4GZ7A 3CIXA 4H9VA 2QUUA 3VKAA 3SDOA 5A5WA 4AIBA 5AHNA 4HKPA 4ATWA 2I5QA 4V28A 3PPHA 1M65A 1Q6DA 3I3DA 3ZVHB 4TU1A 4JAWA 1E71M 3VMNA 3IGUA 1OEPA 2ZZ1A 3A4AA 1S3TC 3ARQA 3AIEA 1KRCC 3SCQA 3TTSA 2CESA 1F4HA 5BOFA 1XS2A 1B0IA 4YYFA 2F84A 1V3LA 6CGTA 1KD0A 1EOMA 3VGFA 3B0PA 4RE2A 4AY7A 3KS6A 3HQPA 3QPYA 1L2QA 3VMPA 1VRXA 3UR8A 5ABEA 4H9MA 3HMJG 2WMIA 5A6TC 5D2YA 2FVKA 3LNMA 4CUCA 1SZNA 1V79A 2VVSA 3EWWA 2DP3A 3KRZA 1TMQA 2WM0A 4JIEA 1S38A 1JCMP 3R6IA 4HNOA 2PDHA 1ZENA 2IXUA 4B4FA 3WUGA 4MY9A 4IZGA 1PE1A 1GVRA 1GQLA 3BLPX 1M7XA 1B9ZA 3TOPA 1A4LA 1OD0A 1JUEA 5FACA 2WSPA 4U28A 3S2LA 2ADAA 3DOPA 3UPMA 2NT1A 1TVLA 2QIWA 3TP4A 2ISSA 1V7AA 3QFEA 4JTCA 1CXHA 1KGWA 3SY1A 1PZ3A 4C6LA 2VDHA 3W28A 4YJ5A 2ZRXA 2QDGA 2FZNA 3W1RA 1JZ5A 3NQEA 1JRCA 3A3XA 1E6RA 4ZGYA 3T9PA 2JIWA 2QCDB 3BJTA 1K1DA 1WKDA 5LKYA 4NJGA 2ZIDA 2OO0A 2HBXA 3BTNA 4Z0SA 2ACRA 2CZEA 3R11A 3CIWA 3VIOA 3L0NA 4UTMA 1IZCA 3BPWA 3S1WA 1TVNA 2Z24A 2DJXA 1W54A 3BAIA 2VP8A 2X2YA 3CWNA 2E5DA 1Y7VA 1GUVA 3ZFHA 4CNTA 4QBXA 2JEPA 2WKLA 5E9AA 4D72A 3ARPA 4QNWA 3E0VA 1GTEA 2AGTA 4H1ZA 4LNCA 3FCPA 3QR3A 3CUIA 1RY8A 3OYZA 4OV4A 2PF8A 1ZJIA 2TODA 1VAHA 1FDZA 3A13A 3UR5A 3QV6A 1QHPA 3S5OA 5K9DA 2NW0A 3QHMA 4G9PA 1J0IA 2NQ5A 3CZGA 4KCWA 4UQAA 3VYLA 2WSRA 2DSZA 3PTKA 3RR1A 3GIYA 3I6TA 3I7RA 3VKBA 3NL5A 3PJWA 2J7CA 4LY4A 2X41A 6XIAA 3UJ2A 1XSJA 3W6LA 3G1HA 4O57A 4A29A 5K3VA 2GVJA 3AI0A 1PIIA 3W29A 3P0XA 1H7XA 3PBWA 1QNRA 4RZ6A 1D2KA 2WMFA 1J0HA 1X8CA 2PDLA 5AYYA 4V1XA 4G7EA 1SFTA 4O19A 3DFTA 1I2OA 4MIMA 4NNBA 4DF0A 3CM4A 5HMSA 3CTLA 3P3BA 3PBYA 2JEQA 4IG2A 3GG0A 3UXLA 3NNTA 2PWHA 1F6PA 4E4PA 2ON3A 4Q4QA 1X97A 4LNYA 2AKZA 2EKGA 1O5RA 3GVGA 3POCA 4ZQRA 3DN5A 3L65A 2VEIA 1OBAA 1KLZA 3KTCA 3T6CA 3CV6A 3RM9A 1POKA 1FWDC 4QLJA 3A23A 4H8UA 1E3ZA 4FZIA 4GVGA 2X1UA 4DUWA 1PDYA 4JIRA 1T96A 3NAVA 3ZJ6A 1MI3A 4MB4A 3GZ3A 1XDLA 2OWWA 3WLTA 2VCAA 3NO3A 1RA5A 1PDZA 4FXFA 3W72A 2WV8A 1O94A 3TN4A 3WF1A 3T2PA 2Z1VA 1E4IA 2DIKA 1QCWA 1FWRA 2BY2A 2Y24A 3AISA 3VX1A 1CDGA 4AMCA 3TDFA 4PBEA 7XIMA 4IJCA 4AIUA 2AAMA 4Q4KA 5A6AA 3DI1A 3ONCA 4K39A 1Y65A 4E4UA 1HF6A 2JIEA 3VIJA 1AW2A 5DN1A 1KCXA 5IRPA 3TC7A 4A8IA 1AL7A 1JXKA 3MY9A 5AZ1A 1XYZA 1ZRQA 4JKKA 5BWAA 3V0SA 1YNYA 4C90A 3OVGA 4CU7A 4PB4A 3PBMA 2YBTA 4KWWA 5T91A 1XIEA 3ZT7A 4H8VA 4G1KA 1MW2A 4E2DA 3MBFA 4ZODA 1O12A 3WD4A 3KOXA 1GYLA 3UGRA 1LRNA 2O9OA 4WX2A 4UOZA 3CEUA 1U5VA 4PYSA 1FCQA 1SO6A 2E8YA 1FOBA 4NXKA 3TW7A 3BDKA 1FHVA 4E8GA 1RP9A 3QOMA 4HHPA 3GH7A 5HANA 3E96A 3ZZ1A 5CGQA 1OX6A 1M03A 4L4LA 2Y5JA 4WZHA 1FCVA 2OX1A 4WXYA 2Y61A 1QUMA 4QP0A 2BVTA 2X7WA 1MZRA 3SGGA 4X3ZA 1F2JA 4BWLC 4O18A 1W1YA 3TYDA 2X05A 3PJUA 1TA3A 5C55A 1RBLA 2PC8A 5BROA 3B3DA 4RPQA 3O07A 1NELA 3NYDA 3VD3A 4MJ2A 1HJUA 1J2BA 1HKKA 3GHSA 3LPOA 2YPIA 3PBVA 3TEVA 3PPCA 3ICJA 5I07A 3SUTA 1YIXA 4RKAA 4PMZA 3Q65A 3MI3A 4Y9NA 1RLCL 3WJXA 1IGSA 3HOJA 3PBUA 4KERA 4J5NA 4BS0A 3LXBA 1QXLA 3LV6A 3EX6A 4LCSA 3AWOA 3NSXA 1AH0A 1SO5A 2O4MA 1W5MA 5HNNA 4DI9A 1A50A 1SW3A 6REQB 4WLCA 3BXWA 3C3NA 3ARYA 5J5DA 1UPPA 4J3WA 2D22A 4ALDA 4XZIA 4ILSA 4M29A 1Q6LA 4FLSA 4UTFA 2ZX6A 4WDXA 3GXDA 1R85A 1KQYA 1M5WA 3QXBA 3GXIA 4JY8A 3PZGA 4Z2KA 4FHAA 3QYQA 3WMCA 3PULA 1EJRC 3URQA 1G01A 2QVHA 3RCNA 4DWSD 4X2PA 1WKFA 1W31A 2PTDA 4YTSA 2D2OA 4XIMA 2VGGA 1DVJA 4F0HA 5I24A 4PTMA 2ABAA 3F2BA 3NQ6A 1GJPA 3GRIA 1TELA 3GHRA 4U5IA 1L6YA 1CLKA 3FEMA 2BHYA 3AQUA 4GOAA 3PZQA 2XDFA 4M1BA 4QEEA 4V15A 4B5UA 3B8WA 4XVDA 4XB3A 3AAMA 3EWXA 4ZFCA 1H41A 2C71A 2E9LA 1Q6FA 3N3MA 2QUVA 4RE4A 5LGZA 4CNSA 1O5XA 2Q09A 4AZ7A 4HCDA 1CTNA 2QCNA 2PZ0A 4AMAA 1AZ2A 1LLOA 3ZSTA 4Z2LA 1ZLPA 3QJAA 2VFGA 2QCEA 2ZA1A 1JZ4A 4JDYA 4XBJA 4FNTA 1NWSA 3GFZA 4XKYA 3CZEA 3KAOA 2QUMA 3MUXA 3O16A 4KCVA 4O1BA 4RNHA 1Q3NA 4GKLA 3CGTA 4W7WA 1VS1A 5GNZA 1DHKA 3KDNA 3WQCA 4F48A 4XBKA 1OY0A 4NZ5A 5HNUA 2CWXA 5FAJA 1MW0A 2P10A 3VGHA 3GFYA 4FLOA 3HV9A 4NX5A 2V2DA 1BGGA 2CBJA 2FHFA 4MUPA 3PZUA 4GE8A 3C2EA 4OKDA 9CGTA 4K1GA 2QCLA 1Q5MA 4KQNA 1BPLB 3ITTA 4QNEA 2Z1SA 2NQJA 3SJ3A 2OEJA 4ENLA 2ZZ7A 1YNPA 1M53A 3PVFA 5D9PA 3R43A 1NVMA 3W2MA 4HU4A 1KRMA 4NASA 1HKWA 1JRBA 1J0JA 1FWAC 3W07A 3CUHA 3U2CA 2TYSA 2Y8VA 4H9YA 2BODX 1OX4A 4DO6A 1VCFA 2CXEA 4NNCA 1EPXA 4JFVA 4PUWA 4N4PA 4E2OA 4O12A 1DHPA 5IXEA 2ATMA 4UQ9A 4BF7A 5EU9A 2ZX8A 2YGYA 4LUYA 1ZL1A 5AHFA 1UASA 3HG5A 1OSEA 1XG4A 2RDUA 3WKZA 3TTEA 4MSSA 4K6AA 5G1YA 3AHVA 4B2DD 3VUSA 3NZPA 1ME9A 1G7UA 3L4YA 4U4MA 1EJSC 3ITLA 4RXGA 2HS8A 3OZOA 3O1NA 2JGYA 1RV8A 4AG0A 5H2ZA 1RPKA 2VFEA 3TLLA 1O5QA 1AQ0A 1YEYA 2A7PA 3O05A 4N0RA 3RYSA 1QO5A 1J4EA 4AVNA 3ELFA 3H26A 2EKCA 1E51A 5BOOA 2P8CA 5HPOA 4CD6A 3TA6A 1PV8A 3L23A 2QXWA 3MB9A 3E0IA 4UTTC 3GVQA 3BW3A 1A5BA 4P5UA 3WX7A 4I5UA 3E0FA 1R6WA 1HP5A 1LL6A 1QU4A 3KUMA 3HF3A 1I2RA 3SBFA 4DJDA 3VKKA 1WZLA 4LBRA 5DLCA 5HJXA 2HE8A 3FFSA 2GK1A 2HEJA 2HXUA 1V6VA 1L6SA 4H83A 1ZAJA 4ZXOA 1Q6GA 4UMAA 2BB0A 3MWCA 4LALA 4JTUA 1PZ2A 3PG9A 1T0OA 2DVUA 3VIMA 2DY3A 5CJNA 4O11A 3G1DA 4NAEA 4X9YA 4MJZA 4S3EA 3TC3A 2GYIA 3HGJA 2YCLA 1NQ6A 4MF4A 4HGXA 3HMCA 4MWAE 3H53A 1CGUA 3VD7A 1E15A 1GW9A 3GBEA 2FIQA 3CJPA 2PDWA 1YADA 2GJNA 5IHSA 3IV8A 1XISA 4K8GA 4X61A 3LBOA 2GGGA 2WVSA 4CNPA 5EA9A 1OG6A 3NYZA 1V6XA 3R25A 1JI2A 3HN3A 4CQAA 5KEZA 4R7WA 1PPIA 3JVAA 4UOQA 1XICA 4IPIA 4JFWA 5IBXA 3CO4A 4O28A 2V5BA 3LCFA 2CYGA 1NWUA 1GPFA 3CT2A 2OZTA 4EKJA 3KHJA 1I2PA 1BYAA 1UD3A 1C29A 3M16A 3V4BA 3REQA 2E5BA 2O0TA 4YNGA 3CT7A 3D3FA 5LXXA 5HOSA 1XYLA 3GDTA 4PTXA 2YCIX 3RU6A 5B7YA 2F6XA 1Q45A 1ZTVA 4HZMA 5A69A 1IYXA 2ZXBA 1SO3A 3C0QA 3VUPA 2Y7EA 5E0FA 1XLCA 3DG7A 1QW9A 2AKMA 3L5MA 3LHYA 4ACZA 3QPEA 1UZ4A 3VGBA 1BLIA 1DIEA 2V3DA 3MV01 3R89A 1JIBA 4KRTA 3C0JA 3OA3A 1VPQA 4O0ZA 2AQVA 1CIUA 3AYTA 5AHEA 1U22A 5EMJA 1XBYA 1OB0A 1OYAA 3QV8A 1XC6A 2ZRVA 4JTEA 3PTDA 1YBQA 2XISA 2PTWA 2XFWA 4HHHA 1HTIA 2H90A 3EDJA 3MS8A 3WJYA 7ODCA 4GJ1A 3FJ4A 1R46A 1XIFA 4YWIA 1KFJA 1TQJA 2J7BA 3NZQA 2DIEA 3V1PA 5C7HA 5ABFB 4FEZA 4FA3A 3UEQA 1KKRA 1ZZMA 5BWFA 1R3RA 2I57A 2NLIA 5HINA 4NVTA 2ACQA 1XL9A 1PO9A 3QFWA 5F7UA 4BWLA 2O9PA 4MADA 2XGBA 1KRAC 3EGJA 8CGTA 5D9NA 4HSNA 2A2IA 1W1ZA 3GIPA 4RZ5A 4FR6A 2UBPC 1KXTA 3SW6A 1GQKA 4YVXA 2GFTA 3RNDA 2VDIA 3C8FA 2XSXA 2YCEA 3QR0A 1XD0A 2AOSA 4JHOA 2JE8A 2ZC8A 2C91A 3ITGA 1YBQB 4X22A 2NQLA 1PHWA 5DRIA 2CERA 3RITA 1R2SA 3HTWA 1K4GA 1V3JA 4BEQA 4KWOA 2FJKA 1XSKA 1R3QA 2H3BA 4QAWA 3ES7A 4QDPA 2JKAA 3WYZA 2VUYA 4N9EA 2YL9A 1CLVA 2JFEX 3NR0A 3C2OA 5KSWA 1XLBA 4C91A 3I6RA 5AECA 2I16A 4IIBA 1G4EA 4WJEA 3IGXA 3M43A 4BA0A 2CC0A 3BAJA 2NWRA 2IS7A 5CGTA 4K36A 3DFPA 3FY1A 3GC4A 4J28A 3BVJA 1U33A 1ITCA 1WDQA 2Q71A 4DY1A 1OT2A 4GINA 4TX6A 1HNYA 4MKNA 4WR3A 3L4VA 3F4NA 3VD4A 1S1PA 3IJDA 3MCOA 4PBGA 2QUNA 2E1DA 4RDYA 3S46A 5LNVA 1IWPA 3LS9A 3CHCA 2OT1A 5DBTA 2E4TA 1L8NA 1GCYA 1YTKA 4UFLA 4BZYA 4W5ZA 4JFSA 1TIWA 1LUCB 2WLYA 3UXKA 4LAKA 2EHHA 3WDQA 5AC8A 4EPDC 4JXCA 2BX7A 2G3IA 4UOJA 3H22A 3NM3A 5FSDC 2YIHA 5AOUA 2CXGA 2DQXA 2QCHA 3B9OA 3FSUA 1PZ0A 2C3ZA 1ZAIA 3VXGA 3JS3A 3VAVA 3O6YX 1E9ZB 2VX4A 4LYQA 1XH1A 5JXQA 4JTJA 2W5FA 4PUMA 3BMVA 3TW6A 1OK4A 4DXKA 2FB3A 4LCQA 2WC7A 5DT7A 2GUUA 1HX0A 1X39A 3O3RA 3ZWSA 4KCTA 1PYFA 1XYMA 2Q3OA 4P7QA 1UKOA 2ISFA 3D6NA 1W1VA 3A5VA 5CC6A 4F0LA 5K4XA 1ZCOA 1TX2A 3EX1A 3P2VA 4CD4A 4DZ5A 4R5EA 4P61A 2QR6A 1QBAA 3W7GA 2VVNA 3WH6A 1DE5A 2VEGA 2ZZ6A 3NG3A 2FFCA 4JCLA 5DELA 4NQ1A 2ODOA 4ZOCA 1MUWA 3DFYA 3GNDA 2PDGA 4BFAA 3OIXA 3G6MA 2WCAA 5C2CA 3FVMA 4GIAA 2XN2A 4M80A 4RNFA 3MSRA 4JL2A 1YE4A 1G67A 1I2QA 1PYMA 1SU5A 2DH2A 3I7SA 3WNNA 3KDOA 3A22A 4RZBA 4QSHA 4C7FA 4D1IA 1K4HA 3ZJ8A 1JGMA 1QASA 4UMBA 2V68A 2Z27A 1D3HA 2WC3A 3CYJA 3K8LA 3VDBA 3L5AA 4DPQA 2CLLA 4FK9A 4GMEA 4S3GA 4NU7A 3R10A 1EUNA 2ZRUA 3VO0A 2AL2B 2MNRA 2YBUA 3R94A 1WE5A 1XLAA 3GH4A 1W9VA 2D69A 2HE5A 2QUTA 3S9IA 3UA3A 1KLYA 1VBGA 1J5SA 4MNJA 4EOUA 3GYCA 2PDXA 5D2VA 3GC2A 2IKGA 4GUFA 2FPVA 4MJ4A 4NI3A 5FF0A 1V5XA 2VEPA 4Q7IA 3VIPA 3ZT6A 3TQPA 3LRMA 5EKYA 1KM5A 1JYWA 1R9XA 3NQDA 3W7RA 2ISVA 3OTRA 1EX1A 2WXDM 4FSAA 4BCEA 2QPXA 1OC7A 4GUIA 1VLWA 3KRSA 4GNJA 4B5VA 3EKZA 4A4AA 1DJHA 1JZ7A 3N6QA 3QY8A 4M6UA 1VF8A 1JYXA 5A6BD 3C2YA 4LYRA 1V3KA 4KWSA 2Z00A 3PM6A 2A21A 3MPGA 2V5KA 4MWAA 4AVFA 3NGJA 5BRBA 5I0DA 1IF2A 4HNUA 4HA3A 4E38A 1F6KA 1PKLA 2EJ1A 2R6OA 4P2VA 1I9CB 2NX1A 2D23A 4JNYA 1AJ2A 4QG9A 2W67A 4GLEA 4XO6A 3NDYA 1FRBA 3TZNA 4CNOA 3EOUA 1NOFA 4ACZB 2Z25A 4W84A 3WMSA 1OX5A 5BU6A 3AZTA 3F5JA 5T26A 1KW1A 3DGBA 1IXOA 4RDZA 1GTHA 3M0ZA 3EMCA 1LLZA 1G5AA 4UCGA 2DSUA 2Z6JA 4JL1A 4O17A 6ALDA 2OWCA 4AFYA 5T9CE 3LM3A 3R0DA 4O14A 2XWEA 3LPPA 2PD5A 4PTVA 3C4UA 1UP3A 3H21A 5LHFA 1LP6A 1C9WA 3UY8A 6PTDA 5HJLA 2CETA 1DIKA 1H50A 4D6JA 1ENUA 3O6CA 4J7RA 3AU6A 4DJDD 2XWDA 4HPHA 5DT5A 4KBXA 2Z2AA 4E3TA 4ZR8A 4W86A 1FCUA 1YE6A 1QK0A 1TV2A 1FFQA 5E6ZA 1ZJHA 1LCOA 1WBHA 3BLIA 4H8HA 1R30A 4JTTA 3S6TA 3PWGA 2BHZA 2Z7GA 3W1XA 2LLEA 1ZBCA 3S9YA 5FESA 3E0LA 3MMDA 1K3UA 3TAKA 3PZTA 1H62A 4ZA0A 3NQ8A 1RVKA 3E0WA 3W2NA 2VC5A 1U5JA 3T08A 3VZZA 2EO7A 3IK4A 4ATLA 4CKQA 3QGVA 3JZEA 2J77A 3S1XA 3MBDA 3W01A 3VCNA 3R5EA 5U7SA 4OJYA 3GD6A 1Z8AA 3ZR4A 3TUUA 2DDXA 2DZUA 1C91A 5D9MA 5KETA 3KBWA 1R87A 3LD5A 2FYMA 1IT0A 1ZBKA 5F4SA 4W89A 4TTGA 3DENA 1V7YA 3HGRA 3D0CA 3HG4A 4AD5A 1FQ0A 4M6QA 4NYUA 3W1TA 1SMAA 5T8GA 3WG6A 2J78A 1DL3A 3ZR5A 1W1PA 3NQMA 4GNKB 4L56A 3NQ2A 1AQMA 1XM3A 3T05A 3TU9A 1SQ7A 1XIGA 4L6HA 3S42A 2B7NA 1F73A 3LCXA 2J8GA 1V4YA 3THUA 5A8OA 4EP8C 3OBAA 4C65A 4D1JA 1VBUA 1BAGA 4UR7A 5G2WA 1X98A 4UZUA 3BLKA 2PAJA 1POJA 5D38A 4AD3A 3HGSA 2BGQA 1V51A 3MV11 1OX4B 5F2GA 1SR0A 1EBHA 1ALDA 1FX6A 2X1IA 1RY0A 3BSHA 3VZYA 2Z1XA 3U8GA 5CAHA 4ZB0A 1W3IA 3O0KA 5BCAA 1VEPA 2J24A 3GLCA 5BMWA 1T8QA 2FZMA 3EDKA 2XG9A 2PD9A 2DEPA 3VNZA 2SFPA 4Z2IA 4ZO7A 3TE9A 1UZDA 1TJPA 1Z44A 1TZ9A 5I3KA 2VRKA 1BFNA 1ZB5A 3DX5A 4N9DA 2ZUNA 2EPNA 3B04A 2YYUA 1JQXA 3UZZA 1HJSA 4CQCA 1Q6QA 2WJZA 1K6WA 2E9BA 1LF1A 1UD2A 1YPIA 1HJWA 4EE9A 4WJXA 1CB7B 2G3NA 1W5NA 1X7IA 4IFOA 2WZHA 4PUEA 3B9EA 1P7TA 3UD6A 3B0YA 1GOIA 3BLEA 1EEXA 3QPZA 3CC1A 3OHIA 1WXJA 2RAGA 3AICA 1IR1A 2W66A 5JMUA 3R1ZA 1MYRA 4DLFA 2WHKA 3BLDA 1ZBVA 2NUXA 4IXHA 4FX7A 2CLIA 2ZICA 4Y9MA 3FJ6A 3O15A 1TJ0A 1TRDA 4QS5A 2VR4A 3A4XA 5C9WA 1J5TA 1QMLA 4A35A 1OM0A 3TZFA 4UFHA 3IVSA 1UBPC 1W9UA 4U33A 3NEHA 4NY2A 3W24A 5G2IA 2OSWA 3W23A 1B54A 2QAFA 3BICA 4C60A 1WYIA 2JKPA 2WNWA 4IISA 4WF7A 4I8YA 5BRQA 1P1XA 1MEHA 2IQDA 4JYFA 4DO7A 3U4FA 4DQWA 1EF3A 3W87A 1OD8A 5G5IA 4C5YA 3GTHA 3O63A 4J2PA 1UR4A 3FIGA 4I5XA 5KINA 3NQGA 2PFHA 4D71A 1EP2A 4TXEA 3RK8A 8RUCA 2B0MA 4ROQA 5CCZA 5CGMA 1TX0A 3G1AA 3LB0A 4PCNA 1TJRA 1I8JA 1WX0A 4QG6A 1J6PA 4OVXA 1PX4A 1NSJA 4FLQA 4NIRA 4LAMA 5C5YA 4GUGA 1OCBA 5HBFA 3WJWA 1H51A 3APGA 4H19A 4PFHA 1IEVA 5EPDA 1QPRA 4C6BA 3SCNA 1HJQA 3LHZA 5CC7A 4TO8A 4N7QA 1EZWA 3MMTA 4XISA 3L66A 4PN2A 2OZ8A 2Y85A 4XBSA 2YDSA 1A5NC 3O6AA 4HU8A 1K6AA 4IIEA 1QAPA 1WV2A 2D3LA 1JAKA 3DERA 1B9BA 4K1WA 5GVJA 3I10A 3W00A 1REQA 3K5XA 2BLEA 5FSEC 2VNCA 3TNOA 1D8WA 5FF4A 1VKFA 5L9FA 3SY8A 2PBOA 3CB3A 3SI9A 3TROA 4ML9A 5LYRA 2OO6A 1EGVA 1V6YA 1M3UA 4F9JA 2FHBA 1GEQA 3T8LA 3RJYA 3MDWA 4ML4A 5DANA 1H7NA 2CLMA 3WLRA 5DMMA 1K8CA 3EB3A 4EACA 1SM9A 4W87A 4C6FA 2I17A 1JDCA 1XPYA 4GJJA 1KKOA 5G2HA 1XC4A 1Q8JA 3EBVA 3SUWA 3QC0A 5AKQA 1EKOA 2C6QA 4GG9A 2WHLA 4RV8A 2E67A 4F0RA 2PWGA 1V0MA 3JU2A 3VNIA 2E0PA 3M0IA 2BBFA 3GQYA 2ZDRA 5BXPA 1NF0A 3AMKA 3AUOA 4JICA 1JPMA 3WNOA 5GQBA 4X9SA 1VFLA 2EPOA 4Y9AA 2DORA 4IMFA 3RRAA 4UC5A 3CL6A 2Y5SA 4O53A 3OB8A 2IKHA 5JBEA 3STCA 4MZYA 4ERAA 4M7TA 1EC7A 3IACA 4ZOAA 2QGYA 1AW1A 2ZBTA 4UTUA 1GVOA 2CLKA 2FMNA 5KZMA 3N73A 1E1FA 5CJ5A 3GAKA 4UR8A 1EX5A 1YLVA 2PC4A 3W74A 3OU8A 3S2CA 2WVTA 1GNXA 2D3NA 3VIIA 1HGWA 1X96A 4GI9A 4DX3A 5I03A 3XIMA 3TNBA 3WK1A 2J9YA 4IIHA 3V35A 1RCXB 3L21A 1A0CA 4KRZA 3WCZA 2VR2A 3GNNA 5EBUA 4ZSUA 1TJ2A 1YDOA 4W85A 1WZAA 5D4YA 3LGEA 3MHUA 3H55A 1J9YA 2V3GA 3WELA 1PAMA 4DF1A 2DPEA 3M44A 1S2WA 1V6UA 4O1AA 3RUBL 4R9XA 4L4PA 4RW3A 1B3XA 1OK6A 1MQRA 3PS7A 4GQQA 4LUSA 3W26A 1EC9A 4WY0B 1LQ0A 4DJFD 2OPJA 1UROA 3M0LA 3W7MA 1Q65A 4HN8A 4HPJA 3UJSA 2GDUA 2OQHA 4AD0A 1MEIA 3SUUA 4OTKA 1Q66A 1OCJA 4DPPA 1R9YA 3LBCA 2A3BA 3BJSA 1DORA 1D3GA 2VFHA 1BWVA 3L2IA 1K03A 3K30A 2P50A 2C13A 1RUSA 5FI8A 2P8BA 2WSKA 1FWWA 3TA9A 4IQJA 4FALA 3ZJ7A 5EMUA 4LVDA 1DYSA 2IPWA 2PSNA 4JD4A 4DN1A 1M7PA 3B03A 3BSGA 2ZTJA 1LL7A 1QNVA 4F2TA 2GZXA 4MKSA 3NQCA 1UB3A 4IPLA 3OLDA 4HPXA 3F5KA 3G1VA 1A3XA 1NY1A 3LCHA 1FWTA 3TMQA 2PWFA 2P76A 4Z2GA 2QZRA 2AQOA 1M7OA 1XLKA 3GVWA 2Q01A 3W7IA 1EEPA 1W91A 4TIMA 2OYMA 1W3TA 4L65A 2EPKX 4O8RA 1QK2A 2J88A 3CZLA 1Q6OA 2PDMA 1KRBC 4ZVJA 4R88A 4O1DA 3W7KA 3FLUA 7TIMA 3FXGA 1JI1A 3LLFA 4FIRA 2EXOA 1D9EA 3F1QA 3UR2A 1LROA 2A3EA 2J6XA 3UF9A 5DO8A 4B16A 5I23A 1XLMA 4G7FA 1GGOA 1WXZA 1HXJA 3A64A 1LWJA 2GQ3A 1UUMA 3FEQA 1UZHA 1HZYA 3IWPA 4YPJA 3RIKA 2ZXQA 1YPXA 4BJHA 5A6LA 2YCLB 4HA4A 4U3AA 4HMDA 3MHGA 1M9HA 4GACA 1BXNA 4O0QA 3NZRA 4HK6A 3FJNA 3KBJA 2CBUA 4AZGA 4F2BA 2PA6A 3GXFA 4EAYA 3U4AA 1FWNA 3KE0A 1TWDA 3GX9A 5JQ9A 1B4EA 3OLGA 3RG6A 1EOKA 4JIIX 4AQLA 1LBFA 3KM8A 5CZSA 4ICMA 4RR4A 1VYRA 3SSZA 1UR8A 3P8IA 3MU7A 3VABA 7A3HA 3MP4A 3M0MA 2YA2A 1F7BA 1T7LA 1A49A 2ZRYA 4LB4A 2KAUC 4BI6A 1LTDA 1L2UA 4XZ9A 1JCTA 2B4GA 1IZKA 3W7CA 1C8XA 1QOPA 3TN3A 4I8DA 3UP8A 1QPOA 3WNPA 4B3ZA 4XTIA 3K2GA 2GJLA 3A9BA 5AVHA 5D33A 4UQBA 3RILA 2OLSA 1R3TA 4AIEA 1B5TA 2G3FA 1L9WA 3AIQA 4HA1A 3ATYA 1EO5A 2BVYA 3XINA 1ONEA 3CPGA 1Q6CA 4HQVA 4A3HA 3G6LA 4A6GA 4PL2A 4EIVA 3AMCA 3VOFA 4W9TA 2XIIA 3MSYA 2ZFAA 5G1MA 3KCLA 4XVEA 5C9ZA 4WKAA 3DXIA 3SFWA 4PRTA 2FQIA 3NXFA 2V2HA 1KCKA 5D2TA 4JHMA 1TWZA 1L6WA 4U10A 1MUCA 1JULA 3G3DA 4G7EB 3E2VA 3EWUA 4M1RA 4GFIA 4P7NA 3OGVA 1OGBA 4O54A 2VI0A 1E6NA 1NFPA 1V0KA 4GFSA 2IUZA 7CGTA 5J5RA 2O4QA 3VC5A 2RDXA 1YPFA 2J27A 3KS5A 4FOKA 4J2MA 2FGLA 3AZRA 2GUYA 1JD7A 5DQPA 3N18A 2VJXA 4X60A 3DAQA 3VK5A 3MI2A 1H7OA 3QH2A 3CK5A 1NJJA 1AK5A 1H11A 1GWJA 3USBA 4WEVX 2OLAA 1P43A 4IIDA 4KGJA 4V1YA 1RBOB 2F38A 3W53A 3VE9A 3IV3A 3EXTA 4PMYA 9RUBA 4WK9A 2X8RA 2CZVA 3OYXA 2P5NA 2EG7A 3UWEA 1UUQA 4AVOA 1J6OA 4GQGA 3ABXA 2O7SA 2VXNA 1LT7A 1VFMA 3W73A 5I3HA 3OIHA 3QLLA 2XH4A 4PMRA 2ZADA 4C6IA 1FDJA 3GHTA 1OABA 1XJBA 1DJNA 2VL4A 3ORWA 2OG9A 4TUFA 1OF6A 3NA8A 2QDEA 1XPGA 2YA0A 3ZOAA 1TO3A 1OFOA 3S5YA 3A12A 4JCMA 2AQWA 4KPLA 5EYWA 4EPBC 3GTFA 2F6UA 3GE7A 3FVDA 3SY5A 3WQ4A 3V5FA 3WLPA 5TAOA 4IX2A 1BQGA 2QULA 4YS1A 3LK6A 3PZOA 5HMDA 4R3UA 1V03A 3MO4A 3U5UA 3O2LA 2OSXA 3BG5A 3O8AA 4DM1A 4KCUA 3KL0A 5IFTA 3AS1A 3RFAA 3P62A 4PODA 3TJ4A 1B30A 1IT8A 1YQ2A 2HBVA 4GA8A 5FJJA 4TOQA 3RU8X 1WZKA 3CO8A 1XCFA 4R7OA 2OKTA 4Y6GA 1EHAA 3NVDA 1VFHA 2D20A 4L80A 2VZVA 3BGGA 1MRAA 4MZ1A 3B0XA 4P8VA 4HK7A 1UQYA 4JNZA 5K9XA 3F4CA 1Z69A 3TSDA 3DU0A 5FEWA 4UTTA 3DEQA 4JTFA 4XZLX 4KETA 4K7YA 4ZQMA 5CPNA 4AWEA 1ODZA 1HUVA 4AC1X 3UXIA 5CC5A 4QIUA 4LS0A 5CSYA 2YLAA 1VGAA 3BLLA 3H4GA 1F8MA 1FH8A 1TKKA 1HW6A 3NQFA 5IOBA 5CBBA 3HG3A 1VFFA 4BY3A 3VOIA 5LA2A 1GOQA 2CWNA 2QLYA 4IFKA 1EUAA 4A3QA 1ICPA 1X8FA 2JBMA 5MF5A 2I56A 4JQ2A 4F8XA 3RJXA 1SMDA 3PB2A 2RHGA 2IQ0A 4LEFA 5DX7A 1QW8A 1W5PA 4EK7A 4FXRA 2E09A 3G5EA 4WVXA 3SB0A 1B3OA 1E4LA 1XF0A 3LM7A 5T9BG 4C6MA 1HO1A 4C6OA 3C0LA 1CENA 4CQ8A 4PRRA 4ZE5A 5C7VA 2A6LA 5AYIA 3RXZA 4FNPA 3HA1A 1PCKA 4GX8A 3CUFA 3USZA 4Q4SA 4C1LA 1OJXA 1J8VA 3IVUA 4CEXC 1B2YA 2ZYFA 3DBNA 4IPNB 5RUBA 3IUHA 3KLLA 2GJPA 2G3MA 3NQAA 3VX0A 4W8BA 3N4EA 3MI6A 3N2TA 1HVXA 1CXEA 2FFIA 4HPGA 2R82A 1UPMB 2W6RA 1N82A 2Y7FA 4U2ZA 2DUXA 4H7CA 4TVCA 2Y8UA 3GDLA 3GTXA 4ORIA 3LERA 1TCMA 1P5BA 3NPXA 3W9ZA 3B9NA 4BQ4A 3M47A 4AEOA 3DHDA 4Z42C 3BGAA 3L5LA 2XTKA 3EPMA 3TSMA 5LNSA 5A6JA 1GZJA 3BAYA 3K4AA 3V0UA 2UY4A 3I65A 3PZVA 2XVNA 4J4KA 4A8NA 2Y1HA 2WQDA 5F4XA 3M0KA 5A8QA 1FTXA 4HHLA 1K8YA 1Q63A 1V0LA 3VOCA 1E1CA 3W85A 2WKJA 4JS3A 2V5LA 3AYVA 3HPXA 3B9DA 2VYOA 1CXKA 1FBAA 3H24A 3NQBA 3G1XA 5I3GA 3GWQA 2G0WA 3EB2A 4DWSB 3P5ZA 3A47A 3NVTA 4ASTA 1YDNA 1WP6A 1US0A 2ZE3A 1BWKA 2DSVA 1E6SM 5HR7A 5CBIA 3GSMA 4IJRA 2J7FA 4S3FA 2QJMA 1DPMA 1JCYA 3BMWA 2IMRA 3QKEA 3O9NA 3E12A 3SGZA 2QPSA 4MMWA 3S2JA 5LA1A 3EOOA 1TUFA 3PF3A 5I2UA 1WZMA 3G24A 1AA1B 3LGGA 4QFUA 3ZLFA 5FJOA 3T2OA 1XLJA 3UZXA 4LBUA 1K8ZA 2GJRA 2QW5A 2Y7GA 3TTQA 1J79A 1R3YA 4FX8A 1EJ7L 1NOWA 2WJDA 3CNYA 1OF8A 2ALRA 4GYPC 2FTPA 3CMGA 3NZ1A 2PI6A 3C86A 5CPOA 3WSUA 2HTMA 4EPEC 3PZNA 3HM7A 1LWHA 5FL0A 4FF7A 4I90A 1MXGA 5G4EA 3BV7A 2YFNA 4PUNA 3AMDA 2X7VA 5TD4A 5FOOA 2VFIA 1NU5A 4S39A 1V8EA 3WQDA 1NEYA 1XGZA 1S39A 3CAVA 2TSYA 3EWYA 4HA0A 4ZQNA 3RLVA 2VEFA 3KCJA 3MJMA 3MKCA 3WBAA 5E09A 4J1OA 2WAGA 5I00A 3PR2A 1UJPA 3UZWA 4BI7A 3L0KA 3H6OA 4KFNA 4GZIA 4DRSA 1FWFC 3IS4A 2BXYA 3W02A 3M07A 4WY0F 1VFSA 3WEMA 1E70M 2V69A 4PB3A 5LIXX 4O8AA 3WUBA 1PS9A 1XW8A 4WQ6A 1O5KA 3QLDA 4NZFA 3PUGA 1UMYA 3DCPA 1IEWA 3KBMA 3QF0A 1WBJA 3PB0A 1LWIA 4H7ZA 3LQGA 3LX9A 5A8MA 3NCOA 2GGHA 4XTDA 3AXKA 4ES4A 3I4EA 3S4TA 3EWCA 1IEIA 1BVWA 3VGGA 1US3A 1OC5A 2PTXA 4B9ZA 4ZCWA 3DESA 3OG2A 1W37A 2G41A 2J47A 1JCJA 4MY1A 3T0DA 2UWFA 5AYZA 1CI1A 2VRJA 1WCGA 1DWGM 3T8QA 3GNOA 5C71A 1XP3A 3GC5A 3A24A 3VZXA 1THFD 2Q3RA 2WNQA 2GWNA 4C6JA 5I5RA 3GG7A 4PMVA 3W1LA 3NZGA 2QJHA 1YRRA 2WM1A 2WBGA 4LVAA 3GS6A 1KFBA 2O92A 3QW3A 1VYPX 4DAIA 1TREA 3M0VA 2VOTA 1KNWA 3BV4A 4ZFMA 4QX4A 3DI0A 4L61A 1Z89A 4H01A 1KR1A 3I68A 3OO2A 4UTIA 3OG3A 1W8SA 4KFPA 4L4OA 2F7FA 1VFTA 4Y7EA 4PCTA 4Z2JA 5JBDA 5I3FA 1S3HA 2PGFA 5A2AA 3C61A 4FAMA 3VM5A 4PC8A 3WBXA 4UTLA 4QQUA 4WSHA 1IE7C 1T6MA 2Y6ZA 4H6KA 3OZMA 3SCTA 2E7FA 2NUYA 3E02A 2WJEA 4LVFA 2PWUA 4AX6A 3LEPA 2INZA 3KRUA 3K4DA 3EPNA 3LBMA 2FZBA 2XZ9A 2MUCA 4IH3A 5ABFA 2B7PA 1SZEA 3N11A 4E0CA 2HNHA 1F07A 4DEFA 1G1YA 3W86A 4ADSA 3V75A 1BD0A 1TPUA 1OCQA 1W0MA 3OLEA 2BP1A 4IFKB 4ICNA 4IM4A 3LN3A 3GNPA 4D8AA 3HIJA 3TQKA 4F0SA 2CHRA 4DYEA 6REQA 3AS3A 3BAXA 3E3HA 4YN5A 3M7WA 2FZ8A 2VEKA 1ONRA 5DMNA 3WQPA 3W7PA 1KM3A 1RHCA 5I09A 3HJEA 4Q8OA 3IAPA 4GY7A 1KM4A 4J3SA 3BOLA 3Q94A 2E9MA 4PB5A 3VVGA 4EXAA 3C2FA 1QR7A 4Z1AA 2D0FA 2Z1BA 4AUBA 2BWGA 4IP4A 3AU2A 2Y70A 3BCDA 3UCQA 3VCRA 4NG3A 1E43A 2ZDSA 2DZXA 2A7NA 5M3WA 2ZRZA 1VCGA 3E9AA 3PZ9A 2XYLA 3H4WA 1K9DA 3ZLHA 4HZ8A 1H0IA 2A5HA 2J66A 1DWJM 1OFEA 3QOKA 1C90A 3CMJA 5GNXA 4PE8A 5I7GA 1CGYA 3FV9A 2HVMA 2UY5A 4LEQA 4PA8A 2JK2A 3N15A 2Y88A 4Y96A 3PK7A 3U9IA 2NVAA 3BAKA 5E93A 4DUXA 2G5WA 3ZQ9A 3GHUA 2DT3A 3TYEA 1Q7QA 3W7JA 5CPLA 5JIPA 2GDQA 3KVJA 4QXIA 1C8YA 1VEMA 3IAQA 1XIHA 4XD3A 1IXPA 3LNPA 5I6SA 4JR5A 1FKXA 4NZ1A 3ANUA 3N12A 7REQA 1ZJAA 4MB5A 2OXNA 3UR7A 2PP1A 1U1HA 4J3ZA 1F3TA 3BW4A 1TV3A 1EP3A 4ZE4A 1J96A 1CGXA 3T78A 1E1CB 3BWWA 4TR9A 1QT1A 1QNQA 1BRLB 3BAWA 1W2VA 1DIDA 1OIFA 2F61A 3OOQA 3NSMA 5CSUA 1LDCA 1TG7A 2JF6A 2NXGA 3BSMA 4Z2HA 3A5FA 3QMRA 4J40A 1P0KA 3IIPA 5HQMA 3UPWA 1N8FA 2EQDA 1I0DA 3EKLA 3ZSSA 1F3EA 4IX0A 1KO0A 5CBJA 2FHCA 4HCLA 1XRSA 4XV0A 3K1GA 4MOZA 4WCJA 2DUZA 4F9DA 3QQ0A 1A5SA 4MG4A 2WJFA 3KTXA 3VTRA 2KX9A 1EXPA 3S83A 5LNRA 2RDWA 2E1WA 4CNUA 4D8LA 1QHZA 4XAFA 1PKNA 3CU2A 3WBWA 2QHAA 3WNKA 1ODUA 3P14A 3WY1A 3KX6A 3EA1A 4BHYA 3LRKA 5IHRA 2HRWA 1FWEC 4GRSA 2QJIA 4F2UA 4TV6A 3K8MA 3LHWA 4YTRA 2V9DA 5M2FX 1C8VA 2VQUA 3KFTA 5A8NA 1AZ1A 3F7JA 1EXBA 4WY0A 3HPSA 1N8WA 2CKRA 1HKVA 4NZCA 3LZ3A 1WXYA 1FWJC 4C6KA 4H6EA 1XFBA 3FK4A 3G3MA 5C70A 2O9RA 1CWYA 2NX3A 2WMIB 1H7WA 2ICSA 4JYEA 2VWTA 5AVNA 2YXXA 4QJ5B 3B8TA 1V02A 4NUWA 2VD8A 2WQPA 2P3EA 1RD6A 4Q8QA 4ZENA 3UW6A 3FGCA 4XZHA 2INFA 3AMLA 4PMDA 1A0DA 1SFSA 4QJ4B 2C1IA 3AROA 1OADA 3T44A 1N7KA 3TONA 2OSYA 3BO9A 3GB6A 1SR9A 4R27A 3R8HA 2W61A 4NI8A 1EH9A 3UCDA 1W32A 1MDLA 3SN0A 1WOAA 3WH5A 1N2VA 1BTMA 1R5YA 2OX4A 4GC3A 3UWUA 1G69A 1H7PA 1ZHAA 4TQTA 1JD9A 4I3GA 1W3HA 1QVBA 3QHOA 3P82A 1DQXA 1G4SA 3UERA 3GDKA 1P1MA 3MVTA 4RXFA 1CX9A 1P0BA 2PCEA 3VM7A 2GQ8A 1GVQA 1QI3A 4GI6A 3LU2A 5TBOA 3WQFA 3HQ1A 3R8RA 3KOYA 5IFPA 5JH1A 3P74A 1YNQA 3CTTA 4DBUA 4MB1A 3NOEA 5IDZA 3QQWA 3W1AA 3UFYA 1Q7MA 3NL2A 5E70A 5C9XA 3NFUA 1BKHA 1TMLA 4Y8EA 4EXQA 1E4NA 1EWEA 2G4JA 3KOFA 1B4KA 5JVLA 3STGA 5G1TA 1JUBA 1XRFA 3IIZA 3IIXA 4DWDA 3TXZA 3C8NA 2F2KA 1Y8BA 3ABOA 4OECA 4ZTXA 3ZT5A 1H0GA 5JUVA