3W7KA

Structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with mii-6-066
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
313
structure length
313
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Dihydroorotate dehydrogenase (fumarate)
publication title Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with MII-6-066
rcsb
source organism Trypanosoma cruzi
total genus 107
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 3w7kA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3w7kA01
3W6YA 1IXQA 1SFJA 1TPWA 1A5AA 6TIMA 1AW2A 3IIOA 3QPZA 4JY9A 2JGQA 3QH2A 2A0NA 2FFCA 2VFHA 4KFNA 2R14A 2C16A 3WJYA 2HMCA 3W7IA 3R2GA 3UXDA 1DORA 3BW3A 3T40A 2QAFA 4K8EA 3W2LA 1OX5A 1ZAIA 5F2IA 4O8RA 4IMFA 2A7PA 4O57A 4KWWA 3DU0A 4YMZA 4BFAA 5AYZA 4N2YA 4NJIA 1TV8A 1D3HA 1GPWA 1P1XA 3G3DA 3QQ0A 1SSGA 2DZUA 1FWSA 4K6AA 4TIMA 1ZNNA 2QCGA 1VC4A 4IWWA 4O1DA 1TTJA 2ALDA 4FB7A 3P61A 4M6QA 5CPLA 4LNYA 5EY5A 5HR7A 1SZGA 4CQ9A 4RXGA 3GR7A 3DFOA 1MEHA 1JCMP 4TMBA 1H7XA 2CZ5A 4UTUA 4LS1A 4CLMA 3L5AA 4FO4A 3NQVA 3RF9A 3CEUA 1K3UA 2J9ZA 3SFKA 4JR5A 2H6RA 3BK0A 4PODA 2A2IA 3BG5A 2C14A 1GQNA 1KFEA 3LXBA 1W5QA 1KFJA 4QITA 1EPXA 3HJZA 3PF3A 3NQMA 1IIGA 4Q4KA 5AB3A 1TIMA 3NM1A 4QAIA 2CZFA 1FQ0A 2C19A 3CM4A 3MP3A 3LGEA 2PE4A 1JUBA 4FIQA 4O12A 3RLVA 1K8XA 1M7PA 1KM1A 1AW5A 3N14A 4JTSA 4LVFA 4NXSA 3FJLA 1Z41A 3CQ0A 3W7MA 1T8XA 3EWUA 1KTCA 3GDLA 1SO3A 5DXYA 4LY8A 2E6DA 3SW6A 1T99A 2V30A 3FS2A 3HGRA 1W0MA 3I6RA 3C52A 1GVRA 4AWUA 1E51A 3G0XA 3S5NA 4U28A 3GX9A 4N02A 3TA6A 1WAUA 4OT7A 3FJ6A 3KX6A 2JKEA 3TROA 4ADUA 3M16A 5AHIA 3W84A 1VZWA 2AAMA 2DZTA 1YDOA 4QNWA 3NVTA 2C13A 4C1KA 4M6PA 1I2RA 3H53A 2E5BA 3WK1A 2C6QA 2QCEA 1C29A 3HOJA 1SZFA 2QCLA 3DI0A 3E96A 1O60A 5J5DA 1LROA 1ONRA 2WJZA 4K38A 1O94A 4UTTA 3C2FA 5HR6A 2RHGA 3W3OA 4U4MA 2DJLA 3HB9A 5FF3A 5HINA 1B4KA 4HNVA 4DBEA 4ZQNA 3PG8A 4TU1A 1F2JA 4LOCA 3W76A 3PB2A 2V2DA 4DO5A 3QRHA 5EA9A 4Z0SA 5D2YA 4HNTA 4MKNA 1G4PA 3BV4A 5G2HA 4CQ8A 3NQCA 4PFMA 3GR8A 3EKLA 1HFBA 3EXSA 3NDOA 5KITA 4LVAA 3W73A 1OFPA 1IXNA 4ZQPA 3W75A 1GT8A 3P60A 1L2UA 4FF7A 1TV5A 4UFHA 1G4EA 4BI5A 1BKSA 4AF0B 4D2JA 3QQ1A 1O4UA 3EWYA 4WXZA 3UD6A 3M41A 1R2TA 4A29A 3UNDA 4IPJA 1C9DA 2CLOA 1L6YA 1KM4A 3CIXA 3NQ7A 3GXPA 3UWVA 3W2UA 3PSVA 4DO4A 4POCA 4XKYB 1ADOA 5AYYA 4UTIA 2PRLA 5FEPA 1YLVA 3EXRA 2ZTJA 4K7YA 2DP3A 3NR0A 4R53A 3W1QA 1P0KA 2CFFA 2EPHA 1I2NA 3PG9A 4JX5A 5IBXA 3C8FA 1GTHA 3LRKA 3LCXA 1QNVA 1KTBA 4LC6A 4IXXA 4UTKA 3N9RA 5BRBA 2QDHA 2PCQA 3T4CA 4UMAA 4P2VA 2QUUA 1OFOA 3TX9A 3DFNA 4UFMA 4NX5A 2G5WA 3M5VA 1TMHA 5I3KA 1LBMA 2TSYA 3VCRA 3FIGA 3STGA 5BNKA 1OYCA 3W7OA 2OZ0A 4O4VA 3MMTA 4IMEA 2HS6A 4HIBA 4RKAA 1TYGA 3CEPA 3LI1A 3TQKA 4BF9A 2C3ZA 2NV2A 3EXTA 3P62A 4NNBA 3CIWA 3QSRA 2GQAA 4X9SA 3IIPA 1TQXA 4GRSA 1OFBA 4JYEA 3QZEA 3O07A 3O6DA 2O7SA 3LCWA 4O52A 1G4TA 3CU2A 2PRMA 1D9EA 1N55A 4ZQOA 3M47A 4S2BA 2YFOA 5KMYA 2VXNA 4IX2A 1S5VA 3Q37A 3HF3A 4M6VA 3O16A 2VFIA 3LTSA 2GQ8A 1M5WA 3NXFA 5K2ZA 3IRDA 3L9CA 3L21A 4FHAA 3UWWA 3S0CA 4M7SA 3TC6A 3OHIA 2A85A 1JRCA 1I2PA 3S5OA 4I7UA 1G7UA 3NA8A 3SI9A 4AHPA 3IIZA 1EA0A 4Q32A 1OX4A 3G22A 1ML1A 4I9AA 2QUTA 2BSLA 2FPTA 3CB8A 1S3HA 2ISSA 3FA5A 3TAOA 1EP1A 1TCDA 3R89A 3TSMA 3LHUA 4PA8A 4MY1A 2YYTA 1QO5A 4O13A 1WA3A 1VH7A 4DELA 5DCBA 3L0NA 5LNWA 4DF0A 4YL2A 2RDTA 4PC8A 4K39A 4TMCA 1FWNA 5SWUA 1AL7A 1QO2A 1X7FA 4RZ5A 3ZWSA 3S6DA 4L4LA 2B4GA 1XDMA 1GVOA 1Z48A 3H55A 1TJPA 1X8FA 4EF8A 1JCJA 3GKAA 3N2MA 3BLEA 4LUIA 1LDCA 4LTSA 5E1QA 1KV8A 4XBKA 5CGQA 2V5BA 5LGXA 2BTMA 1RPXA 1FBAA 1UUMA 3U8GA 3M9YA 1NSJA 3P82A 4Z1AA 4NQ1A 1W3TA 4JICA 4B5NA 3MBFA 4QQ3A 4EVZA 4HN4A 1LOLA 3STFA 4WY0A 1TSIA 2X1TA 4RCXA 4IMDA 3MI6A 1X1OA 1HG3A 3L67A 3NM3A 3PUDA 5LNSA 2EGZA 3TJLA 3RLUA 5DXXA 3TXVA 3I68A 4RXFA 3R8RA 3P81A 5DCEA 3EWBX 1BEUA 2A5HA 3ATYA 1BWLA 1UUOA 2ZDRA 4MPQA 3M6YA 2LLEA 4XTDA 1XC4A 1W54A 3DKLA 1W3IA 4O1CA 1TPC1 2C18A 2QF7A 3MW7A 5U7SA 1PHWA 3B0PA 3L0GA 5EPDA 1L9WA 3GAYA 1W5PA 3HQ1A 1GG1A 3FYPA 1GVFA 3ZS4A 1ZFJA 1EWDA 3F4NA 5G5IA 1FX6A 2V2CA 4JYFA 5AHNA 3W7QA 3L66A 1QCWA 2V81A 1XCFA 4JD4A 3OG3A 4JTFA 5U4NA 4HKPA 4MLJA 1K7FA 3UWZA 3TR2A 3NYZA 1G67A 3TXZA 4ZMGA 4AWTA 2DZXA 4NU7A 3PBWA 3P67A 3LTYA 4DO6A 3S42A 4ORIA 4LUJA 3ZR4A 1F73A 3THAA 3W87A 1I4NA 1F7BA 4PH6A 1SW7A 3M44A 3QFEA 1IXOA 1LP6A 1WBHA 1W5NA 3EB2A 3QW3A 2CW6A 3C6CA 3EX2A 4MZ1A 1MEIA 2EKCA 1LOSA 1ZAHA 3Q58A 1EUAA 3M7WA 3PWAA 5K4XA 3QSTA 3W1XA 2GJLA 3O15A 4RJEA 4AMAA 4HPJA 1Q6RA 1WDWA 2Z2UA 4X2RA 3BW2A 4UTHA 1WYIA 2Y70A 5H2ZA 2E09A 3RU6A 5KSWA 2Z6IA 1XM3A 1O95A 3DFSA 2FLIA 1WXJA 4WXYA 1V7YA 4PTNA 5AFDA 1W3NA 1I2QA 3NQGA 5G2WA 1FDJA 1H7WA 1OK4A 3OVQA 1QPOA 2FB3A 1ME8A 3E49A 3PUEA 4RK8A 3M5XA 5E93A 2F84A 1B57A 2CLHA 2VOMA 1H51A 5CSRA 1SR9A 1BTMA 3LLDA 3TFCA 2EF9A 3NPXA 3DFQA 4J9JA 1A5SA 1GWJA 4Y8FA 4JIQA 3TIMA 3OA3A 3W71A 3QW4B 4N9EA 3W7CA 4MYXA 1IF2A 5AC7A 3THQA 1H50A 1TQJA 4TR9A 5CKSA 4A3UA 2XN1A 1VYSX 1K8YA 2VENA 5D2VA 2FPYA 3C2OA 3N73A 5DY2A 3NGJA 1KM6A 2CWNA 1TPUA 1XXXA 4Z08A 4AWSA 2WPBA 1KFLA 1QPNA 4O14A 4FNUA 4LV4A 1OABA 1QPQA 5F1VA 1OHLA 3BVJA 2OX1A 1K8ZA 2NLIA 3LXCA 1DJNA 4N6FA 5HWMA 1VHCA 1HTIA 3W1MA 5D30A 4IOTA 1OFEA 3W1PA 1OVDA 3MYPA 2C1HA 4QJ1A 2ATSA 2Y62A 3TQVA 1JCLA 1XI3A 4EIVA 3DFTA 5KZDA 1EP2A 4MZ8A 2BZNA 1YDVA 2GQ9A 3SZ8A 5CPMA 2V9DA 1H61A 1ME7A 2B7QA 4XUGA 5K7JA 3W9ZA 5BOOA 2XN2A 1JUKA 5D38A 1CI1A 4GE8A 4N9DA 5I3FA 4PL1A 2YW3A 1KTNA 1W5MA 3W86A 3HGSA 3TMLA 3BGJA 1TRDA 4O10A 1VCFA 1RZMA 2CLEA 1A5CA 1ZJIA 2FIQA 4OU1A 4FX8A 3TE9A 3TUUA 5CPOA 1K03A 1ZCOA 4BWLA 3UWUA 3ABOA 1OFAA 1VR6A 2NWSA 3WK2A 1T96A 3O05A 1KLYA 3FEMA 3PS7A 4O16A 1AG1O 1LCOA 3QYQA 4BI6A 1FUYA 3UY7A 1SQ7A 3G1SA 3T7VA 3BPWA 3S5YA 4UUIA 5AHFA 1TREA 3B04A 3LLFA 2BX7A 3GYEA 1RV8A 2YZRA 3F03K 1QAPA 2Y7DA 3LI0A 4ZQCA 3E12A 3WJZA 4FNTA 5LNVA 3EEGA 3P7YA 3GIYA 2NUXA 2BWGA 4LWWA 1QPRA 5AYXA 1YYAA 3WJWA 3B4UA 5HMSA 3CT7A 2YDAA 4MIMA 2ZRZA 2UV8G 4OBTA 1LBFA 2JK2A 2B7NA 1SZEA 3TV8A 1LRTA 1Y0EA 1TJRA 3USBA 3HO8A 3M1ZA 4N9BA 3RMJA 1YPIA 3EX4A 3DXIA 4IJBA 1NF0A 5AHEA 3I65A 1KM5A 1RQEA 3BARA 1KW1A 5LSMA 1SW0A 2HTMA 4N4QA 4YXGA 2QR6A 1F5ZA 2OCZA 3LBMA 5HUOA 1W1ZA 3WJXA 1OFQA 5G4EA 1VJIA 1QFEA 3LCGA 3NL6A 4DF1A 3BLFA 4X3ZA 3O6CA 3PB0A 2ZZ2A 2YYUA 4JDYA 3MHFA 3DGRA 4GUHA 4P61A 4CCEA 4LRTA 3JR2A 1FWWA 4G1KA 4FNQA 3DI1A 5DBUA 5HUPA 4H3DA 3S5ZA 4H4IA 1LBLA 3QMTA 1TRIA 3PM6A 1NVMA 2W6RA 4UNKA 2DJXA 3HPSA 1YPFA 2R8WA 4O54A 3E0IA 3A9IA 1B9BA 1Q6QA 4Y90A 4O17A 3W22A 3CC1A 1OX6A 5IM51 3N9SA 2VFFA 3W70A 4LVDA 2CU0A 3LHVA 2W0UA 4JX6A 4FX6M 1EUNA 3W2KA 5DBTA 1EWEA 1VHNA 1AW1A 4RZ6A 3TW7A 5I3JA 5D37A 1KLZA 1KA9F 2QUVA 3FOKA 2FJKA 3CTLA 3N34A 1SPQA 1XBYA 4NZFA 2WO5A 1FCQA 2Q8LA 3CWOX 5EYWA 5DELA 1F74A 5LHFA 2NXIA 3RNDA 1TTQA 3W2JA 3N19B 4DPQA 2NX3A 1XBXA 1YXYA 4RR4A 3SGZA 1ZENA 1OFRA 4OE7A 2JGYA 3A5VA 2QCCA 4ZQMA 2RKXA 3PR2A 3G8EA 3G1VA 4O11A 1H1ZA 2Z0IA 4AXKA 4JTHA 2YPIA 1ALDA 4O28A 2X1SA 3NO5A 5G4WA 5F4XA 4MZYA 3LHYA 4IPIA 4RV8A 3HPZA 1FWRA 4O1BA 2TYSA 5LHEA 3Q2DA 5CPNA 4R34A 3NNTA 4M5PA 1XBZA 3PBVA 1OK6A 4NX0A 3L5LA 2P1FA 1AMKA 4UFLA 1A53A 1KFCA 4JNMA 2FB2A 1G6CA 4XQ6A 3R13A 5CZSA 3B0VC 3MUXA 4IMCA 4QISA 1HO1A 3SSJA 3NQDA 1H63A 1YXDA 3G24A 2G97A 2ZA2A 4NJKA 3QF0A 5K4ZA 4UTTC 4I7WA 1LLZA 2IQTA 3LX9A 4UMCA 4AHQA 4HNUA 3YPIA 3KHJA 3EWWA 3P8JA 3L5MA 3PC0A 2X2GA 3P5YA 3M5YA 3W7PA 1HL2A 4ZQRA 1I45A 4DQWA 2YW4A 1DJQA 2J9YA 3W74A 3GNNA 4UR8A 3TJXA 1TO3A 1OX4B 1XL9A 3EKZA 3LM7A 1THFD 1XUUA 4UFJA 3B06A 2RDWA 4UNLA 4WQ6A 3DKJA 2A7NA 2J6XA 2R94A 4QM1A 1GYNA 1P4CA 3G1DA 4JGDA 4QNEA 3TK7A 3W1AA 4PL2A 4Y9AA 1XFBA 1GYLA 2CLKA 2YX0A 4Y6GA 3E9AA 3NQAA 3ZFHA 4DBDA 3LBCA 2ZRUA 2VFDA 3K30A 1NEYA 1WOBA 3S1WA 3TKFA 4W9TA 4MOZA 3PBYA 2X1RA 4ZL1A 4IMGA 1JCNA 4GXMA 1J5TA 5K3VA 1A50A 1N7KA 3H54A 3W2NA 3S9YA 4GC4A 2E5CA 1DKWA 4CNPA 2CLIA 1VLWA 5DLCA 3N2XA 4WY0F 1WX0A 2DZWA 5IBXC 1RQHA 3HG4A 2JBMA 2RH9A 3G1XA 2CLLA 4ML9A 4HNNA 3W7EA 2X16A 1DHPA 4UTLA 3W1LA 3FLUA 4WY0B 3GVGA 3P8IA 1GEQA 1VQTA 4XTIA 2QCNA 1BWKA 5EL1A 1VCGA 1WOAA 1PV8A 1QR7A 3JS3A 1PHQA 2CLFA 3UWYA 1JJKA 2NUWA 3INPA 1RR2A 2H8XA 1LTDA 3ABQA 2ZZ5A 3SIZA 3TFXA 4LS0A 5FEXA 1VLIA 2ZRWA 3G0SA 1GTEA 5C54A 2VEMA 2ZFAA 1TPVA 3GLCA 3WFAA 1XKYA 3NQ2A 4LRSA 5I3HA 3I7RA 4ZVJA 1D3GA 1PCKA 3B0UX 3LTPA 3IGSA 2G96A 3FFSA 3VKJA 3C4UA 4LT9A 4OV9A 1SW3A 4S1FA 3G1AA 3G18A 3VE7A 5AC6A 3P80A 3KRSA 5DCDA 3LCLA 3CLMA 4IQLA 3CPRA 2NX9A 3ANYA 3NPWA 3VNDA 3C2VA 1UASA 2VC6A 2QKFA 4K8HA 1ZALA 1Q6OA 2QCHA 2V82A 1KBJA 2ZRVA 1TTPA 2VKZG 1FWTA 4OHQA 2YSWA 1UJPA 1I2OA 2Y85A 3OBKA 1W56A 5D2XA 3S1UA 3FKKA 4CQAA 1VGAA 4A22A 1H7PA 1W8SA 1VRDA 2TPSA 1ZHAA 2ATMA 1SZNA 4JEQA 4JTIA 4FXSA 2KZHA 4GFSA 4S2CA 3OVPA 3MP5A 7TIMA 3HMJG 1EB3A 3IVTA 4QIUA 3C61A 4NZJA 5D05A 1JVNA 1W5OA 1JCXA 8TIMA 2DZPA 3KRUA 3A22A 3NPUA 2AQWA 3OVRA 1KFBA 3IIXA 4RZ4A 4UTWC 1R30A 3LCFA 4TO8A 5J5RA 3EWZA 3S8HA 3BGGA 5CZTA 3P5ZA 2A1YA 3SECA 1ICQA 4I7VA 4R7JA 3DAQA 3HPXA 3NPVA 3DH7A 3NQEA 3STCA 3UWQA 5G1YA 1XBVA 2E1DA 4Z1CA 2QJHA 3IV3A 1VS1A 4L4MA 1LLWA 3AJXA 3BO9A 3U6WA 2J88A 2VEPA 3NL3A 3A24A 2ZQ0A 3DHDA 4UCGA 2A7RA 1SU5A 4RLIA 4NNCA 5HULA 2E5DA 2QCMA 3TAKA 4UFIA 3ATZA 3W85A 4FIRA 1H5YA 4A21A 4O50A 5FF0A 2RFGA 1Z42A 1JUEA 4HSNA 1TB3A 1TPFA 2QAPA 3GDMA 4NJHA 4KWVA 2A6NA 1F6PA 3MI2A 2X1UA 3TNOA 5F1UA 1TPB1 1FCBA 2ISVA 1UB3A 2DZSA 3LV5A 2WSRA 3HBLA 1IIHA 1VYRA 3NZ1A 2YGYA 4AH7A 4O19A 1TPH1 1WQ5A 4NT0A 3EWXA 4HT3A 1JCYA 2YR1A 3C2RA 2VFEA 5LNUA 4JTJA 1EIXA 2WKJA 1NAL1 1PL9A 1Q3NA 1EX5A 4GWEA 1R2RA 3GZ3A 3WJSA 3C2EA 1LZOA 1DL3A 1V5XA 1NF7A 4CCDA 3M5ZA 4LVGA 4OQVA 1H7OA 3GDTA 3TU9A 1VPXA 4A2SA 2I1OA 4FNSA 4HSOA 5HWNA 2Q3OA 4JTEA 4AVFA 4DF2A 2NUYA 1OYAA 3VE9A 3GKFA 4UXDA 4PEKA 3O6YX 4UMBA 4LW7A 1G4SA 3KRZA 1M7OA 5DN1A 1OF6A 5EMUA 3UZ5A 5E0KA 4IGHA 3NQ8A 4HPXA 2J27A 4FNPA 1FDZA 4O0ZA 3NL5A 2NX1A 2RDUA 1H1YA 2W79A 4WJEA 1F6KA 5BMXA 3ZWTA 5C5YA 1DQXA 2QCDA 3ABSA 3LHZA 4GUFA 4YLWA 1W37A 3LB0A 4E2DA 3L0KA 5I3IA 3V75A 2A6LA 2ZCGA 3QC3A 1HO4A 3OIXA 1UBSA 1GJPA 4GJ1A 1YDNA 3M0ZA 3FYOA 3PAJA 4JTTA 2HS8A 1TPEA 4NUWA 4AB4A 5KINA 4M19A 2A4AA 2NZLA 4K37A 4ZZ9A 3BW4A 4JYDA 5ABTA 3HG2A 3O63A 4LS2A 2I9EA 1KFKA 4GUJA 2Y7FA 1M6JA 5FESA 4E2BA 1JQXA 3W88A 1FCUA 2Y7GA 5FF2A 2D73A 3TH6A 4O18A 2Y6ZA 1GG0A 2FTPA 1J4EA 1JR1A 2EHHA 3E02A 5C55A 4BR1A 3LCIA 1YTKA 2E68A 4OGZA 4M7TA 1B4EA 4RX0A 2ZZ4A 5TBOA 3VFLA 3W7DA 5FF4A 3Q94A 3STEA 4WZHA 4O4WA 2QEZA 6ALDA 2DU2A 2V2HA 1XDLA 5K9XA 3SY5A 3LV6A 3PY2A 3W7HA 4YWIA 2Q3RA 5LGZA 3NL2A 4UC5A 3MO7A 2H3DA 1I8JA 3GNDA 4FXRA 5D32A 5CZJA 3T44A 1Q45A 1O5XA 1OF8A 3QPYA 5T26A 3W1NA 5F2MA 4OV4A 1IXPA 4MY9A 3RK8A 4K36A 4JTUA 5G2IA 3B8DA 1O5KA 5CG7A 3W7NA 4BI7A 1K7EA 4KFPA 4NVTA 1L6WA 1H62A 5TIMA 5LNRA 1ICSA 4LV9A 4GBUA 3CHVA 3PUOA 3UY8A 1QMLA 3WK3A 4C1LA 3HIJA 5I3GA 1KV5A 1IGSA 4LVBA 4DEFA 2Y88A 4CNNA 3TSBA 1H7RA 1EP3A 2GJNA 4GUGA 5L6UA 1MZHA 2CLMA 2VEIA 5HJLA 5FI8A 2F7FA 3QJAA 4BWLC 3MI3A 2ZRYA 3NQ6A 2P10A 2QJGA 2ZA3A 4GNJA 3UPWA 3KVKA 1X1ZA 2Y63A 3KVMA 2GPTA 1OJXA 3MJYA 3IGXA 1TPDA 4K7VA 3IVSA 4WOQA 1PCWA 4O15A 3T78A 4H6KA 3DBPA 1FY6A 4AAJA 3KOFA 5EBUA 3G0UA 3C0JA 3JRKA 4LU0A 4MLRA 1F76A 2B7OA 2VEKA 1U83A 3TMQA 1LYXA 1PE1A 3MP4A 5LZLA 2Y89A 1SO4A 4PCFA 5D33A 2XN0A 1G69A 1CX9A 1MSSA 1KM0A 3GB6A 4JN6A 3S1VA 4WX2A 1P5BA 1H7NA 1RVGA 5CZ0A 3MHGA 2WOQA 5MHBA 1R2SA 3DFPA 3LHTA 2PC4A 4R33A 1PVNA 3B03A 5BMWA 4DPPA 1R46A 2QJIA 3D0CA 2Y7EA 1QOPA 4Z1DA 2QCFA 3SJ3A 2FDSA 4LC8A 4DXVA 3LHWA 2B0MA 3UPBA 4HHPA 5G1TA 2ZA1A 4AEOA 4IUOA 5AOUA 5F2LA 4IX0A 1ZAJA 3WK0A 3LCHA 2Y61A 3O8AA 3BLIA 3CWNA 1Q6LA 1FCVA 1TTIA 3OEXA 1VYPX 3HG5A 5D04C 4JTLA 1U5JA 3R12A 1FDYA 2BXVA 5FEZA 1VCVA 2NWRA 4MUZA 3MWAA 2J9XA 1DQWA 3TDFA 4FNRA 4X22A 1QWGA 3EX6A 3IEBA 4AF0A 2J24A 1PS9A 3FKRA 4Q33A 4ICNA 3KVJA 5D02A 2C0AA 4WD0A 1LM1A 5EKYA 4ORMA 3F4WA 3NQFA 3SR7A 1AL8A 2V8ZA 4XKYA 1DOSA 5K9CA 1C8VA 4YCPA 1LOQA 3LRLA 4JTGA 2TMDA 1KBIA 4EOUA 3DZ1A 1KM3A 1SFLA 1YXCA 1CW2A 3I7QA 3LERA 4YCOA 5AHMA 3QMRA 3HGJA 1J2WA 3UYCA 5KZMA 2R91A 2PRHA 1MO0A 4QSHA 4MFEA 1ICPA 1AK5A 1R47A 1NFBA 2FQIA 3G1YA 3I7SA 5FF7A 4CNOA 3GDRA 1GOXA 1GVSA 3KAOA 4JXCA 5D2TA 4OWGA 5DY3A 2YCEA 2XFWA 4KKXA 2WV8A 3IVUA 3V1PA 1DV7A 2OT0A 4EF9A 4UR7A 4WUIA 2VELA 3GXNA 3TSDA 3W83A 3U2OA 3N3MA 5F4SA 1T0OA 4UTMA 3W07A 4AHOA 3P74A 3AO0A 5D2WA 3A5FA 4XZ9A 4NNAA 3W7LA 5D03A 3NAVA 2ZTKA 4XBSA 3A23A 5AC8A 4XWUA 4ONVA 3S1XA 3ELFA 5GVJA 5K9DA 3TQ0A 1G7VA 1K02A 5D09A 2C15A 3P84A 2DZVA 3HG3A 5F2GA 3O06A 4ADSA 2V5LA 2OJPA 4E38A 1ZY9A 4UTWA 1XUZA 1L6SA 3LOTA 4KFOA 2E6YA 1P0NA 3T55A 1MXSA 3IGUA 2I14A 4Z1BA 1FXPA 5A5WA 1OG0A 4UIOA 3MBDA 4ADTA 2FPVA 3LDVA 2ZZ7A 4Y96A 3KXQA 2NXGA 4WOZA 4FEZA 3UQNA 3PVFA 2O7QA 3C3NA 2PURA 2ZRXA 2ABAA 1YADA 2TRSA 2NXHA 2G95A 3L68A 2BLEA 1LRQA 1EEPA 2ZZ3A 3NOEA 4MYAA 1TV7A 3SGUA 4EWND 4ALDA 2EAWA 2JKAA 4CCCA 2ZZ6A 4MJZA 4BK9A 3W1TA 3KVLA 3W7KA 1DVJA 1GZGA 3QM3A 1H60A 5H91A 4MFDA 4O1AA 4UFKA 4Z0JA 4GUIA 5KTLA 1S5WA 4IXHA 3W7GA 2GUUA 1SUXA 4A2RA 3IIVA 1SO5A 4TX9A 2A21A 2AGKA 3W2MA 2ISWA 2WSYA 4O0KA 5C2XA 2H3BA 2ABBA 3PBUA 4N6EA 2E6FA 1QDSA 3MHUA 2GVGA 5HWJA 4N4PA 5KZEA 3NZRA 3G8RA 3G1HA 4N9CA 1YTEA 2CZEA 1QOQA 3QEZA 2OMAA 2WNZA 1GVQA 3TC7A 2WNNA 5CSSA 3LXAA 2H8ZA 1S5TA 2NV1A 3G3MA 4JX4A 3ABRA 2QDGA 4NJGA 3GK0A 1B3OA 2CZDA 5C6MA 5FEWA 5F4WA 2H90A 2HSAA 3G1FA 5AHLA 1N8FA 2JKPA 3DENA 2ZYFA 3PULA 5L9FA 3TCEA 4NJJA 1Z44A 2E6AA 2X30A 3LRMA 3C56A 1A5BA 2YXGA 3NEVA 3TW6A 3O1NA 4MJMA 3W7RA 3B05A 3DHFA 4JDBA 3QMSA 2GVLA 4UTJA 5HQEA 2E77A 1JQVA 1F05A 2Z6JA 2DORA 3W1UA 2VFGA 1SO6A 4JS3A 3A21A 3UZJA 3VI2A 1FXQA 3R5EA 1W31A 1K7XA 4MVAA 3M43A 1OFDA 4FX7A 1JULA 3W1RA 1SSDA 4JIPA 2P0OA 3L65A 1HUVA 1ME9A 3KFTA 2Q8ZA 3GDKA 5HNRA 3UXAA 3W23A 2GOUA 4MY8A 1YTDA 1MEWA 3GXTA 2QCDB 3PSWA 2YFNA 4JTKA 3EX3A 3NG3A 5A8GA 5BW6A 2GVJA 3F1QA 2V0TA 2ZZ1A 2WNQA 1WBJA 3RFAA 1KM2A 4NXKA 1LORA 3BG3A 1RD5A 1DBTA 4JY8A 1LRNA 3L2IA 1PIIA 4E0CA 1WV2A 3W7JA 2ZBTA 4O53A 1UCWA 3HGOA 1JRBA 1RQBA 2OT1A 3EX1A 1OYBA 5TQLA 5LKYA 2WSQA 3W72A 3GAKA 3MYOA 2Z1BA 3BG9A 1X6UA 5AN7A 2WQPA 2B7PA
chains in the Genus database with same CATH superfamily
1SFJA 1TPWA 1KBBA 3IIOA 1L0PA 2DGAA 4JY9A 3QH2A 4QSFA 4KFNA 3E0LA 3QKEA 3EPMA 2VX6A 2A3BA 1OX5A 1PIGA 2CEQA 1GQKA 5A6KA 4O57A 4KWWA 4YMZA 1VD6A 2IMRA 1EGMA 4S23A 1R38A 3VOHA 1V6UA 4N2YA 3UR2A 2E8ZA 1MVYA 4GYPA 3WLNA 1DTNA 3G3DA 2FTWA 3DG3A 3MV11 2QCGA 2WVVA 2ALDA 4FB7A 3D5HA 5EY5A 4U2YA 1W8GA 4C6QA 3AXIA 5ECVA 3E2QA 2I5IA 1MEHA 4DYKA 4TMBA 2O9PA 1H7XA 3GUGA 3VCCA 4MWAD 4CLMA 1TWZA 3L5AA 3TZFA 3VMOA 2PPGA 3BK0A 5CJ5A 1HKKA 4D6JA 3W38A 1FWEC 4QITA 1XIDA 3E38A 3LMZA 3AMCA 3ZJKA 3NM1A 2Y2WA 4QAIA 1E4IA 2C19A 3CM4A 1OC5A 2PE4A 1BRLA 1Z32X 1YPXA 1XC6A 1LUCA 1K8XA 2G4JA 2GWGA 3WLTA 1MFUA 1UP0A 4I90A 4LY8A 2E6DA 3JU2A 3FS2A 4D8LA 4HNLA 4N02A 3FJ6A 2GVYA 3F4CA 2JKEA 2ZC1A 3ARQA 2HQAA 2VRJA 1XSKA 3M16A 3HTWA 3WDHA 2AAMA 4GVGA 4INFA 4CD7A 3GH5A 1RH9A 1ISWA 3S9ZA 4HMDA 5E6YA 3HMCA 3QQWA 2QCEA 5FAGA 1XHGA 3HOJA 5C0QA 1UR8A 4IIGA 4A3RA 3R58A 2MUCA 1ONRA 1Q6DA 4UTTA 3C2FA 3R0KA 2BHUA 3E6EA 2VD8A 3AROA 4HNVA 4ZQNA 3NOYA 1UWQA 1RXOB 2UY5A 4L5ZA 3GTIA 1O5RA 3O0FA 3WDRA 3W76A 4DO5A 3AS1A 5EA9A 2ZXDA 4GO8A 4HNTA 2FH6A 4MKNA 4ZB2A 5T91A 1G4PA 1FH8A 2GGJA 4DLMA 3EKLA 2OQHA 2ZX9A 3W73A 3P6LA 5CH9A 4Q7BA 1R3VA 2FJUB 2PZNA 2V3DA 4HK6A 4DZIA 1BKSA 3QQ1A 5HDRA 3AHZA 1TJ2A 4XUYA 1R2TA 4A29A 4J1OA 3GXPA 2ZUWA 3KL5A 4WCJA 2F38A 2PGFA 4EAMA 3SY8A 5CPQA 3TN6A 3ZMRA 4Q4SA 1UKOA 3NDZA 7ODCA 2E9LA 1B3WA 3BQ6A 4JIIX 4PSRA 2ZTJA 4K7YA 4R53A 1EQCA 3NR0A 3M7SA 1GUVA 4Z2HA 5IBXA 1WB0A 3BSMA 3QY8A 3AU2A 1RBLA 3LCXA 4UTKA 5CJMA 3VIHA 2BG5A 4IMAA 4UMAA 2XVNA 3FYYA 1ITUA 4J3VA 4CU8A 4GVFA 3H70A 1XQKA 4W5UA 4UFMA 1XH0A 2G5WA 5I3KA 3GTHA 3VD3A 3FIGA 2XVKA 3ME3A 5BNKA 4BCEA 4YTSA 3MMTA 4HIBA 4RKAA 4ERGA 3OZPA 3W25A 5FJRA 3TQKA 4UOQA 3TW9A 3DYMA 3EXTA 4NNBA 3PZQA 3CIWA 4F4RA 2GQAA 4X9SA 1J6OA 1SMDA 1TQXA 3B8IA 3PBGA 5FSEC 1OFBA 3NIYA 4CKQA 3WMLA 3P14A 1YE4A 1G4TA 1C9WA 3T6CA 1QATA 4YWSA 4KGJA 2JF7A 1W91A 1WNOA 3QKZA 1Q85A 2VFIA 3MVTA 3WFZA 4AVOA 4AZBA 3L21A 3WH6A 1F4HA 4M7SA 2A85A 1JRCA 3NEHA 1OM0A 4MB4A 3NA8A 4AHPA 3OLIA 4JKLA 1FWFC 1IZJA 3G22A 2Q02A 4I9AA 3VVGA 4TX8A 4B4HA 1UR0A 1LL7A 3GTXA 3K5XA 2YYTA 1QO5A 4GZJA 1FWBC 3TWBA 4DB7A 1R3RA 1EA9C 1SR0A 4K1GA 3NVDA 3CL8A 2D23A 3GYCA 3H8AA 1XDMA 2AMXA 1TJPA 1X8FA 2PDLA 1JCJA 5CAKA 3GKAA 3WUEA 2CBVA 3DGBA 5E0CA 2DSZA 1FP8A 3E5BA 2BTMA 3WLIA 3M9YA 3PBMA 4MKSA 5EMMA 3TTOA 4NQ1A 1GCYA 3RRXA 4JICA 1MNZA 1S2VA 2PDCA 3KP1A 3MBFA 2FMOA 3ARUA 4DXXA 1UJQA 4JTAA 2Y5JA 3VGDA 1EDQA 1JDCA 5BOFA 4FF5A 2PDXA 1JF5A 3L67A 5LNSA 2EGZA 3DC8A 4CNSA 3EWBX 1OC7A 1BEUA 4G7EB 3ATYA 1AZ1A 1XC4A 3DKLA 1W3IA 4BY3A 2Z1WA 2WJEA 2VQTA 2OSYA 3BAKA 1PHWA 1FWDC 2HE5A 9XIMA 1L9WA 2AMGA 3THUA 3FYPA 1GVFA 2R1LA 5A6AA 1EWDA 2ZOXA 1UKPA 2V2CA 3JVAA 2V81A 4C6BA 3OG3A 5CPSA 3UWZA 3TXZA 4ZMGA 4WK9A 2W62A 1BGGA 5CJNA 4NU7A 3LTYA 4DO6A 3SCSA 4LUTB 4I3GA 4LUJA 1F73A 1CB2A 5HA7A 3W87A 2J7BA 4IGNA 4PH6A 3GM8A 1M04A 1V3MA 1X6LA 1WBHA 1W5NA 3QW3A 3EX2A 2ZKMX 4A35A 5CLWA 5ABFA 3LEPA 4AZIA 3W1XA 3E3HA 4RJEA 4CD5A 1D7KA 1TZZA 1XRVA 5CEWA 3SN1A 1QHOA 1QWKA 3LG3A 3RILA 4BKNA 1XM3A 3MQTA 4TQTA 1O95A 3DFYA 3V3WA 1V7YA 2OELA 3MZNA 4B3KA 1I2QA 1C90A 4HK5A 4IL0A 1GORA 1QPOA 3E49A 1ME8A 3OVQA 4Z2KA 2POTA 3DBNA 3EA1A 2VVNA 3EGJA 3NZGA 4Q4OA 1XIHA 2EF9A 4YTQA 3NPXA 3DFQA 3KCJA 4JIQA 2EPMX 3OA3A 3M0XA 4GJIA 3L4ZA 2JFEX 1XISA 4Z2GA 1PKMA 4J27A 2XINA 5DY2A 4HTBA 3DN5A 4F8XA 4RE0A 2WMJA 4FLQA 1TPUA 3B8VA 4PTDA 4DJEA 2OEMA 2WPBA 4Q6JA 4JTRA 3RO8A 1FWGC 2NLYA 1B1YA 2F6KA 3NZPA 2WMGA 1PX3A 1QPQA 1VFOA 2OX1A 1K8ZA 1HJWA 1V6TA 5J04A 4C6PA 1HTIA 2VGGA 3MV01 4R9XA 1QK0A 1OVDA 4D8ZA 4C6MA 2Y62A 3B0YA 2WCGA 4GYFA 3VTRA 3VAVA 2YL6A 1XI3A 4EIVA 1EP2A 4MZ8A 3WQPA 3H4XA 2D0FA 3GE7A 2GQ9A 3SZ8A 2OLHA 2V9DA 5K7JA 4Q6XA 3W9ZA 3J7HA 3ZLHA 2XN2A 1JUKA 1KCLA 1KCXA 2RUSA 2QDDA 3OPSA 3EWDA 3S2CA 3W86A 3APTA 4O10A 1MRAA 4XAYA 1AA1B 2PDHA 4HP5A 2FIQA 1ZJIA 4QFUA 1S1RA 4B5TA 3UXKA 1P7TB 1ADSA 3CH9A 1G5AA 1R3YA 1WAWA 3ID7A 3MA8A 3PS7A 1GGOA 1R9YA 2PODA 1W17A 3FK4A 4HB7A 2IPWA 3UA3A 4K68A 3GBEA 1TREA 1B90A 3LLFA 3IJ8A 2YZRA 1RV8A 3F03K 4A8NA 2WC4A 1YBQB 4AEFA 1HIZA 3WJZA 2FHCA 4G56A 5LNVA 3H2OA 3ONBA 2NUXA 2EEXA 3N6QA 3B4UA 2VHLA 2AKZA 2UV8G 2JK2A 4PMQA 4ACZA 4YIWA 3HO8A 4KWOA 3M1ZA 3U2EA 3I3DA 2IQDA 4US5D 3DXIA 4NL1A 3D47A 5AHEA 3R43A 4MG4A 3VX1A 2FGLA 1SW0A 5E9XA 2ZDSA 2QR6A 5HUOA 2GUBA 4ZEPA 1V6YA 3EOUA 4J40A 5D9PA 4Q8OA 1VJIA 1F6YA 1NQKA 3LU2A 5JMUA 3LCGA 1X96A 4C6OA 3S1GA 3PB0A 4F40A 2QVHA 3HURA 4CCEA 4LRTA 3R25A 1Y5WA 3CAWA 4FNQA 2IQ0A 2CHRA 3BLLA 1LBLA 1ZS2A 3DIPA 4F2TA 1HJUA 5IFPA 4L1WA 2V69A 1Q6QA 3W22A 1JYVA 5IM51 3N9SA 2VFFA 3LENA 1AZ2A 1Z69A 1HQTA 1VJSA 4JX6A 1XWYA 1NFGA 5DBTA 1QW7A 1PTGA 5DX7A 4RZ6A 1NOWA 3D46A 5D37A 3U48A 1KLZA 1VFFA 1KA9F 1E1EA 1AJ2A 2QUVA 4OUIA 3CTLA 1ESWA 1EF3A 1UWSA 1LLOA 4NASA 4NZFA 5I5RA 3QHOA 1JL8A 3RCNA 2YBUA 2EJ1A 2P8BA 4AFYA 4FR6A 1JF6A 4JN8A 2NX3A 1LJYA 4OE7A 3RG6A 8CGTA 2RKXA 1H09A 3G1VA 2G3JA 2REQA 2FKPA 4MB1A 4O28A 2X1SA 3RCMA 3SM0A 1NOFA 1ZCCA 4MZYA 3WEOA 3LHYA 3ARZA 1W1PA 4O1BA 4GIEA 3GIQA 2GJXA 3CXOA 3MUIA 4M5PA 3C8NA 3S6TA 1OK6A 1B3VA 4DWDA 4UFLA 1A53A 1KFCA 4DY1A 1G6CA 3R13A 5DMMA 3B0VC 4IMCA 2V6AA 2BV9A 4GXWA 3G24A 4GIAA 4MDOA 3EDDA 1V3IA 4NJKA 3VZYA 4AHQA 1POKA 3N4EA 3KHJA 2UY2A 2CPUA 3EWWA 3H2MA 1WZMA 1YIXA 3M5YA 2DQWA 3W7PA 1SZRA 1NWTA 4XAGA 2VL4A 1CXLA 4HBKA 2XFFA 3GNNA 1OX4B 2XGBA 3M4HA 1GKRA 4GHRA 4D72A 4U10A 2YJQA 1THFD 4UFJA 4AU0A 2RDWA 3AMLA 3AI0A 4L7ZA 3ITCA 3UU0A 3N2CA 3GRIA 2DVUA 5IXEA 1GYLA 4XZBA 3NQAA 3VNJA 4C6EA 2VFDA 4V28A 3S1WA 3DX5A 3QGKC 2X1RA 4ZL1A 3II1A 5H8PA 4GXMA 3W26A 3VNYA 1A50A 5I07A 3H54A 1G94A 5TNVA 5DMYA 3WUGA 3ITTA 3BAIA 3T2QA 3KOZA 3CZEA 5DLCA 3N2XA 1L2QA 4MKVA 4ZCWA 1E6RA 1RQHA 3HG4A 3R8HA 4JTQA 3FNDA 2HCVA 3W7EA 1ADDA 3V16A 2OR2A 3T42A 3SJNA 1M68A 3FLUA 3RM4A 1EJUC 4XAPA 4F3HA 3GDBA 4RPQA 1D8WA 1ZSXA 2QCNA 4J2PA 1XLDA 5EL1A 1VCGA 3JS3A 1QR7A 4D6FA 3NGFA 2YZ5A 1A3XA 1ITQA 3ABZA 3CUXA 4XVDA 2WBGA 3ABQA 1K6WA 3TFXA 2R82A 4AYGA 1CXFA 4LS0A 5FEXA 4G5DA 1YHTA 1FRBA 3V7PA 1Q65A 2CXGA 3WFAA 5I3HA 4A8LA 3BXWA 2IS7A 1D3GA 4ATLA 1V6VA 3IGSA 3KBSA 2G96A 3FFSA 3C4UA 4OV9A 3PTKA 4S1FA 3G18A 3VE7A 5KEZA 2INEA 5CAHA 4S39A 3NZQA 5HQLA 2XSBA 4AIBA 3Q4DA 3ANYA 1S2UA 3NPWA 4H1ZA 2V82A 1IHIA 2VKZG 4OHQA 3OBKA 4WEVX 1E3ZA 1H11A 4Y9MA 3QY7A 3KOYA 3FKKA 3AIVA 3W29A 1VGAA 1Q2RA 1H7PA 1KR1A 2J4GA 2ATMA 1ISYA 1V7AA 2KZHA 4GFSA 1E71M 4S2CA 3WZ0E 3GS6A 5HANA 1E6SM 4QIUA 2X05A 1FA2A 4HU8A 1GVIA 1R7OA 1W5OA 3GY1A 3NPUA 3OVRA 4HGXA 1UYQA 3GHUA 4RZ4A 1MNSA 3LCFA 5J5RA 4LBSA 1PPIA 3BGGA 5CZTA 2ZIDA 1RBAA 1X1NA 1P6WA 2Y8UA 3FSTA 4R7JA 3M0LA 1AH4A 3H4WA 5AY7A 3HPXA 3NPVA 1SJBA 4J5NA 2ZX5A 2E1DA 2QJHA 1VBJA 4V15A 3AJXA 2J88A 1NWSA 4FS9A 1FKXA 4NNCA 5AC5A 1P0BA 1R6WA 3CHEA 3W85A 2BOEX 4PUJA 2ACRA 2R6OA 1J8VA 1HP5A 2VI0A 2DT1A 5BXRA 5FF0A 3CPUA 2RFGA 1IT0A 1TPFA 2QAPA 4GI8A 2W9MA 2A6NA 1WKYA 1F6PA 3MI2A 2X1UA 3PWIA 5F1UA 3GBDA 2ISVA 1UB3A 5KETA 4BS0A 2DZSA 1IR2A 3VM7A 1L8NA 1C7TA 5D9MA 2YGYA 3CAQA 3FGCA 1UH2A 4DUVA 2G0WA 2WZHA 5TD4A 2VFEA 4JTJA 1X6NA 2Y0FA 5DRIA 2WKJA 5GNXA 1PL9A 3COTA 3FAXA 3GZ3A 3WQ4A 1RALA 4JQ3A 3M5ZA 4OQVA 4A2SA 5HWNA 3W82A 4DF2A 1OYAA 1NDWA 1FKWA 4FK9A 3VE9A 3H2FA 1G4SA 5EMLA 1M7OA 1PAMA 2DEPA 1CECA 4GH3A 2I57A 4PCPA 1XKJA 4HPXA 3M0MA 1O7AA 3NSXA 5HMDA 3O9NA 2RDUA 3GC5A 1H1YA 2W79A 3NURA 1F6KA 5BMXA 5AECA 3WY1A 3ZR5A 4YLWA 2H9AA 1JZ3A 1UZ4A 2IUZA 5I3IA 2ZCGA 3QC3A 1DWHM 5HAOA 3OIXA 1UBSA 1S5MA 3A4AA 4GJ1A 3N2TA 4M3PA 4GOAA 3VGEA 1TJ1A 4PUMA 5EB8A 1VAHA 4D1JA 4IG2B 1Q4WA 5PTDA 4D6HA 2CLPA 3KCOA 1QK2A 4ZZ9A 3BW4A 4JYDA 2P76A 3O63A 2QGYA 4AXNA 1WXZA 4KRTA 3G1RA 5FESA 1E0XA 4HN8A 4K1WA 2DH2A 5FF2A 4MNKA 2OGJA 3SN4A 2PDYA 4C90A 2CC0A 3LY0A 1JAKA 2AL2A 4IP7A 2XFYA 4WZHA 1DJWA 3EDEA 2AGTA 4NZ4A 4PSPA 5E9AA 2FZBA 3F4DA 5K9XA 2VGBA 3SY5A 3K8MA 3LV6A 3VC5A 1LQAA 3PY2A 3NO3A 4YWIA 5LGZA 1V02A 3KUMA 4TV5A 3GNDA 5D32A 1Q45A 2VURA 2PTWA 1O66A 4FMVA 4ILSA 3FVDA 3AIBA 1ZGDA 2VDHA 3W1NA 5F2MA 4OV4A 4A3HA 5A6LA 2NSXA 4K36A 4UWMA 3B8DA 4BI7A 2D69A 3R10A 4E2VA 4GYPC 4KF1A 3CHVA 3WK3A 5I3GA 4LVBA 4DEFA 4CNNA 2PCEA 2JF6A 1XICA 4FLOA 4GUGA 3AUOA 3VIMA 3RPDA 1GQLA 1E40A 5DANA 1U5VA 3MI3A 4R7OA 1G1YA 2QJGA 2ZA3A 4GNJA 4AD4A 4R85A 2Y63A 3KVMA 1NH6A 4B3ZA 2BY2A 3MZ2A 1TPDA 3EA2A 4OKDA 2HVOA 4H6KA 1PTDA 4LBUA 3KOFA 5EBUA 3C0JA 3VABA 3B4YA 3N2OA 3SCWA 1F76A 2VEKA 2Z29A 1U83A 1UZHA 1LYXA 2A3EA 3H6OA 2PBOA 3HU7A 4O8AA 2WM1A 4PCFA 4I9JA 4KQNA 1PJ9A 3TYDA 4DM2A 1P5BA 5DO8A 3GH4A 3K4WA 2Z7GA 3ZJ7A 1J18A 2VQUA 3DFPA 3HPAA 2J7FA 2PC4A 4JQ4A 1KCZA 3B03A 1EJSC 4H83A 5TF0A 4IM4A 1P1MA 2G3NA 3B0XA 4DXVA 2B0MA 4HHPA 4IUOA 1AUSL 3T2PA 5F2LA 1FFQA 1ZAJA 3WK0A 2VUYA 4HHMA 3CWNA 3BLIA 2WK2A 1Q6LA 3C86A 3CJPA 2QT3A 2YCIX 1U5JA 3R12A 5FEZA 4RE4A 3T05A 2OQLA 4XZHA 3U5UA 4ZE4A 5E6ZA 2XFRA 3TDFA 1Q6CA 5ECUA 3OVGA 3VGGA 1QWGA 3SUTA 4NZ1A 3VIIA 1UW9A 5D8ZA 3FKRA 4ICNA 3KLKA 1AODA 3ZVHA 4MWAB 3F4WA 3SR7A 3N04A 2V8ZA 3QGAC 4GI6A 4XKYA 4DBSA 1C8VA 4WKAA 1QI4A 4ZENA 1KBIA 3W27A 3DZ1A 2HK1A 1SFLA 1YXCA 3AZTA 4LUSB 3KW3A 3F2CA 2GUYA 3WDPP 2R91A 4EXQA 1CT5A 2ZXQA 1MO0A 4CQDA 1R47A 4W7VA 5FF7A 3UW6A 2ISDA 4DJED 2IXVA 1AVAA 1GVSA 3KAOA 2XZ9A 1ODZA 1XLLA 2HV5A 5JBEA 4C1NA 4EF9A 4UR7A 1RBOB 1GEHA 2I56A 3QV9A 2QV5A 3DOPA 4WSJA 2ON3A 1EO5A 4AHOA 1XGEA 3FVMA 1WCGA 5D2WA 4TTGA 4LBRA 5D03A 5LA2A 3A23A 4XWUA 1XJBA 1W3LA 3S1XA 1IEWA 2VO5A 3QY6A 3WH8A 3TQ0A 3RRAA 4IJCA 5D09A 4S3GA 1L6FA 1SFSA 1JZ7A 3SAZA 4HD5A 4ZE5A 4C7FA 2HPMA 2WYSA 3HG3A 1RPKA 3GFXA 1VFTA 3IJQA 1VBHA 4E38A 4LUYA 4S3AA 3CV6A 2VNCA 3TYCA 3QV8A 3QVQA 4UTWA 2E6YA 3T55A 4GG9A 5A5WA 5C8BB 3AYTA 4UIOA 4YTRA 1OCBA 2ZZ7A 3MCOA 2OQYA 4J4KA 2NXGA 3UQNA 2O7QA 5G1MA 1K70A 3T0TA 3R0DA 1YADA 1XH1A 2G95A 3R8GA 1LRQA 2ZZ3A 4GZ7A 3NOEA 4MYAA 2CWXA 3P3BA 2EAWA 2D24A 1UKQA 5XIAA 3C2YA 3QM3A 3EEZA 4GUIA 3UG3A 4AD2A 3GXMA 5KTLA 1UC4A 3IJLA 2G37A 3KHDA 1XV8A 2GUUA 2J79A 2FZDA 2A21A 5CXPA 4O0KA 5C2XA 2H3BA 3AUJA 4RNFA 2XH7A 3LSBA 1PKNA 1I1XA 2NVDA 2DUZA 5C9UA 1QOQA 5LIKX 2FGBA 2OODA 2WNNA 4Z1YA 4H04A 2H8ZA 2NV1A 4D9PA 2WSPA 1WDPA 3SADA 2QDGA 4NJGA 1DJIA 4HVXA 5C7HA 3QR1A 5F4WA 4C6LA 3G1FA 2XIJA 4PN2A 3DENA 4ZTXA 4WJXA 1JDEA 3UERA 2E0PA 2X30A 4R3UA 3C56A 1E1CA 4KEMA 1B3ZA 2YXGA 5D8WA 8A3HA 1NQ6A 3W7RA 3DFHA 2BOFX 3VOIA 5HQEA 1IZCA 8XIMA 1JQVA 4NAFA 2XWEA 4H8VA 1IWBA 3VI2A 4JN7A 2WMFA 4JPGA 3W1RA 3GTFA 1SSDA 4RPPA 4W84A 1MQQA 3AWNA 4W86A 2VYOA 4MY8A 2GOUA 1MEWA 5REQB 1UD4A 2ZWZA 3GXTA 2ZE3A 2PWFA 1TFVA 2WHKA 1RSCA 2YFNA 2EKGA 2FDMA 5FL1A 2VZUA 5BW6A 3F1QA 1U22A 2V0TA 5A3HA 2PTZA 1WBJA 1KM2A 3PZIA 4C6CA 1LORA 4HA1A 4JY8A 4YN5A 3NO1A 1AJ0A 1PIIA 4KEUA 1JRBA 3GR4A 3EX1A 1OYBA 1BVWA 1S3TC 1ZBKA 3MYOA 3ITLA 3OGVA 5AN7A 3FJNA 3W6YA 4CGTA 1A5AA 1AW2A 3SCUA 3APYA 3QPZA 1V6XA 2A0NA 1MW0A 2Y8KA 2R14A 3WJYA 4QP0A 3W7IA 1QNOA 2A3AA 4FP1A 4GLEA 4K8EA 1W1TA 1ZAIA 3H2NA 5F2IA 2A7PA 3ZLFA 2INZA 1MYRA 5AYZA 4WGHA 1D3HA 2ACUA 1GPWA 1QI0A 1SSGA 1FWSA 1J0JA 2YL9A 4DYEA 3P61A 1JD7A 4LNYA 3GR7A 2PTYA 4D8AA 1Q5MA 1JCMP 4JFVA 1CZ1A 3BDKA 4FO4A 3NQVA 4BQ2A 1W6TA 2J9ZA 3SFKA 4G7FA 4DAFA 3SCPA 3MCNA 5C9RA 1ZRQA 4GYJA 3LXBA 1W5QA 1Q8AA 1IV8A 3PZGA 2J7GA 1IIGA 1DXIA 4LCRA 3VGHA 3CO8A 1NWRA 4MB5A 2CZFA 3VYLA 2C1IA 4IIBA 4FIQA 1CWYA 4O12A 1DHKA 2XVPA 2W91A 1XIMA 3FY1A 4MTVA 4Z2JA 2OSXA 4HU3A 1TWIA 3N14A 4NXSA 1SFTA 3BLKA 3W37A 1T8XA 3GO2A 2D2GA 1K6AA 1T99A 1EO7A 4YJ5A 3AXKA 3L4WA 4I5XA 3TA6A 3VNKA 3EZ4A 3KX6A 1Q13A 5G4HC 2XHYA 2WCAA 4FA3A 3W84A 5JBDA 4QNWA 5CC3A 2C13A 4AW7A 4UTFA 1OB0A 4HJWA 1Q63A 3H53A 3AHYA 8RUCA 1HJVA 3PPGA 1SJDA 3B3DA 1O60A 1QNPA 2WJZA 3WNLA 4GISA 5HR6A 1J01A 4XAZA 5A6JA 5C71A 1ZBCA 5HINA 3ANUA 3PJXA 2ZVIA 4DBEA 3PG8A 2Q8XA 5JVLA 1JPHA 1F2JA 2OG9A 4QS5A 4DJDA 3BZJA 1AMYA 3QRHA 4GQ0A 2CIPA 1T6MA 9RUBA 1ZLPA 3NQCA 4PFMA 1HFBA 2Y8VA 1OFPA 1GT8A 3ITXA 1CPUA 4FF7A 4RE2A 3SN0A 2P5NA 3MDUA 3SCQA 3WD1A 1M53A 1O4UA 2WKGA 3VD7A 3UD6A 4M51A 3M41A 3VOJA 3U3HA 3UNDA 4IPJA 2CLOA 1L6YA 3VDGA 3W2UA 3M0YA 1ADOA 2PLKA 2XSXA 3VIOA 1MXDA 3KEHA 4Q3MA 2CESA 2W5FA 4L80A 3GFZA 3EXRA 1DJGA 1UIOA 3MMDA 3H22A 1I2NA 3PG9A 3HV8A 2ZICA 4QS6A 1GTHA 1QNVA 1V6WA 4IXXA 4N42A 2E67A 3TN4A 2QDHA 4CNUA 2UWFA 4O0QA 1O5QA 4BQ4A 1OFOA 2QIIA 2WMIB 4A6GA 1CLVA 1OEPA 2TSYA 3B8WA 3DERA 4IMEA 1EF2A 1EIBA 4Z17A 3CEPA 1GVYA 2C3ZA 4RDZA 1DWJM 3CASA 3QSRA 3PZUA 3IIPA 3V0SA 1J93A 4V2XA 1REQA 2X41A 3I4EA 2UY4A 4X2PA 1D9EA 1N55A 4ZQOA 1LWHA 4S2BA 4PEEA 5KMYA 2VXNA 4Q7IA 1QVBA 3EMZA 3HF3A 3SO7A 1W2PA 3UWWA 3E2SA 3S0CA 4AC7C 1I2PA 3MB9A 3JW7A 4IIDA 3IIZA 5IDZA 2VMFA 4Q32A 3OGRA 1TX0A 1PYFA 1S3HA 2ISSA 2J25A 1TCDA 3F4VA 3KDOA 4GX8A 4PA8A 4ZOEA 1VH7A 5DCBA 4QG9A 3VKKA 4PC8A 4TMCA 2X8RA 1A5LC 1QO2A 1U30A 3ZWSA 1XIFA 2B4GA 1Z48A 3H55A 1HZYA 1QASA 2OLAA 3N2MA 3BLEA 5E1QA 4BQ3A 3W02A 1KD0A 4L1GA 1RPXA 4AZCA 2PB1A 2WZMA 1FBAA 1UUMA 4NYYA 5H6HA 5MKGA 4REQB 3MKVA 1NSJA 3VMPA 3P82A 3CV2A 1TV2A 1W3TA 2P88A 3UFYA 1JPDX 4QQ3A 4OTKA 1IR1A 1HKWA 2WW5A 5RUBA 2X1TA 4RCXA 4Q8VA 1US3A 4F0LA 3R8RA 1VIWA 3M6YA 4KCUA 1TA3B 2V3FA 3R7MA 3GUWA 4PTVA 4UQCA 4O1CA 2NQ5A 3MW7A 5U7SA 2UY3A 4HNCA 1M7JA 1EFZA 3L4VA 4EKJA 1W5PA 1GG1A 3ZS4A 3F4NA 5G5IA 1RLDA 3W7QA 2IPJA 1BQGA 1XYZA 5U4NA 3T0CA 4MLJA 1EC8A 3TR2A 3EDKA 4AWTA 7XIMA 1MUWA 2DZXA 5A8OA 1R86A 2CNCA 3ZR4A 4QDMA 1ZU8A 3RGTA 2FFIA 2BY1A 3KBJA 1CGTA 1BTCA 4KCTA 4Y9PA 3EB2A 2CW6A 4Y7EA 2J62A 4DLFA 4F79A 3PWAA 2WKLA 3QSTA 2NT1A 2GJLA 1KFWA 1Q6RA 5CGMA 4Q8MA 3MS8A 1XIJA 2QPSA 1X38A 3WQCA 4UTHA 3S5SA 3P0XA 1WYIA 3OZMA 3OYXA 3ZT7A 5KSWA 2Z6IA 2YCLA 1Q7ZA 3USZA 3DFSA 4S3CA 2FLIA 4WXYA 4PTNA 2DUXA 1W3NA 5G2WA 1HJXA 3UG8A 3STPA 1OK4A 2KAUC 1UD6A 3PUEA 4LJ3A 5EFFA 3RX3A 1LL4A 4EXBA 4AIUA 5E93A 5C70A 4FI4A 1B57A 1H51A 4XZNX 3WELA 3ICJA 3LLDA 4WSHA 3FA4A 3S6OA 4J9JA 1SMAA 3KZSA 3W71A 3ITYA 2D2HA 2J7CA 3H21A 5LIUX 1BQCA 3THQA 4JQ1A 1CEOA 2UBPC 1TQJA 4A3UA 4J28A 1K8YA 2VENA 4L4OA 4CD4A 5BROA 3C2OA 2CKRA 4GPNA 4GO9A 1B9ZA 1KM6A 5LIXX 4KESA 1XXXA 4Z08A 4AWSA 1C92A 1M03A 3KRBA 3QV7A 3GVVA 3RIKA 5F1VA 1OHLA 3BVJA 2NLIA 2WVVB 4CU6A 4ZXLA 4B2DA 5I00A 1VHCA 2ZUMA 3W1MA 5D30A 2V3GA 3W1PA 2EG7A 3MYPA 2WJFA 2ATSA 2AOSA 3NCOA 1VPQA 4CNTA 2B31A 4U3AA 2BZNA 3KBWA 3BAXA 4UOJA 5CPMA 2HDJA 2B7QA 3FDKA 3UGVA 3F7JA 3W4RA 4LQ1A 3FCPA 1JYNA 4N9DA 1CXIA 4PMDA 3S83A 5FJPA 3VM5A 1KTNA 2ZE0A 1W5MA 3KDNA 1RK5A 3HGSA 3TMLA 3LLXA 3UZWA 1TRDA 4MJ2A 3BJTA 4NZCA 1LF1A 1VCFA 1A3WA 2DV0A 4B91A 1BRLB 4HHLA 4ERIA 1DE5A 1LUCB 1K03A 3ABOA 1VR6A 3WK2A 1BXNA 1KR0A 1E6QM 2VGIA 3FEMA 3DYOA 1AG1O 3QYQA 2VR5A 1F61A 3VGFA 1FUYA 4B3LA 3UY7A 4NRSA 3RX2A 1J12A 3M64A 3W01A 2PLCA 1TWDA 3EA3A 3N17A 3VNIA 1XS2A 1PSCA 3MSRA 3GXDA 1QAPA 2X09A 3LI0A 4ZQCA 4NP7A 1U33A 4GX9A 3CPGA 3EEGA 3BCDA 3P7YA 5C9WA 5AYXA 2Z26A 4QTGA 3S9IA 3E0FA 3A64A 3HZ3A 3LSCA 3VNMA 4MIMA 4OBTA 2B7NA 1Y0EA 3S2MA 4AQLA 1PIFA 4L65A 3MANA 4IJBA 2VR2A 1E55A 3CGTA 3ALFA 3K8KA 3BARA 1KW1A 1MMFA 2HTMA 1OIFA 4W4QA 1F5ZA 2Z1SA 4BA0A 1E3XA 3WJXA 1OFQA 4DZ5A 1QFEA 3UZXA 4DF1A 1QXLA 3BLFA 3WQOA 2PDNA 4AZ5A 4ECLA 2ZZ2A 4M82A 4HOXA 4GI9A 4GUHA 2VZVA 4P61A 1GQJA 3U7BA 2VCCA 1XLHA 3TEVA 4JAWA 1QJWA 5HUPA 4H3DA 3S5ZA 3QMTA 4C6IA 3A4XA 3PM6A 2W6RA 4UNKA 2WHMA 3B9OA 3N9KA 1Z6KA 3ARRA 1PZ2A 4CU7A 2CU0A 3W0KA 2W0UA 4YYFA 3UJFA 3S46A 4KWUA 3EWCA 5CZKA 1FWHC 1K9TA 2W4XA 1VHNA 1WKFA 1AW1A 3TW7A 5I3JA 2X0SA 3OBAA 3FOKA 4ML4A 1OY0A 2VX5A 2FJKA 4U31A 3N34A 2CCRA 4TOQA 1XFCA 2WO5A 4P5UA 4Y9OA 5T8GA 4JZ5A 2XGIA 4H01A 5LHFA 2BGSA 1EBGA 3W2JA 1XBXA 3BUVA 3H7VA 1YXYA 3TLQA 3SGZA 1OFRA 3IJDA 1ZJHA 2QCCA 3QHMA 4O11A 1UD5A 1H1ZA 3VKCA 1PZ1A 3ABXA 4AXKA 4JTHA 2YPIA 4FAMA 1ALDA 2WZIA 4H9XA 4DZAA 4H41A 4MB3A 5DFAA 4M0XA 1US2A 3C0LA 4PTXA 4GZEA 3WQDA 3EKGA 2YLAA 3Q2DA 5CPNA 3AISA 4ES4A 1XBZA 4XD4A 4N7QA 1D7FA 1J0ZA 2BP1A 2CXEA 4HZ8A 1AMKA 4HU0A 4JNMA 2FB2A 4CN4A 1V77A 1BFNA 4CQCA 3UVIA 4QISA 2ZUVA 1AD1A 1YXDA 2G97A 4KS0A 3QF0A 5K4ZA 3SSZA 4I7WA 4HNUA 3LX9A 3YPIA 4JHMA 1JGMA 3MSGA 3P5YA 5CSUA 4HSHA 5KZ6A 2BVDA 1FTXA 2YW4A 2HWGA 3RN6A 5A8PA 3H12A 1EYWA 1J79A 3WH9A 1XUUA 4UNLA 4ATDA 4WQ6A 4LAMA 4NAEA 2A7NA 4DX3A 4PMNA 4DBUA 2A3CA 3EYPA 4BQ5A 4QM1A 1GYNA 1XYFA 4JGDA 3TK7A 1EPVA 2YX0A 3E9AA 3IAPA 3ZFHA 1S46A 1DIOA 3K30A 5A6TC 3ZSTA 1QHPA 4XISA 4WDTA 3FDGA 3PBYA 2XU2A 1XLJA 1JCNA 1F3EA 5K3VA 1N7KA 3B9AA 3M0JA 4S3KA 1DKWA 1YMYA 1DWGM 2ZX6A 1TKKA 1WX0A 2JBMA 2CLLA 1GZJA 2YCJA 4AD3A 2X16A 1CB7B 2XG9A 3WX7A 3GVGA 1GEQA 2OOFA 4E4PA 3N3TA 1PV8A 3K4AA 5FKYA 4JFSA 4FOKA 1GW9A 2WVSA 3A6OA 3SIZA 1FWAC 3CZJA 3U4FA 1GTEA 5C54A 5T9BG 2VEMA 3HV9A 4PYSA 1QW9A 2Q01A 3GLCA 1XKYA 3NQ2A 1KXQA 3I7RA 4ZVJA 1OZMA 1MI3A 3V35A 4MF4A 1SW3A 4A4AA 1QRQA 3K1GA 3M07A 3CLMA 1XLKA 3CPRA 4AY8A 4LYQA 3WLLA 2NX9A 4KRUA 4RW3A 1WDRA 1I1WA 3VNDA 2OEKA 1KRAC 3EPNA 1UASA 2HXUA 4K8HA 2QCHA 4JL1A 2I7GA 1W56A 5D2XA 1UQYA 4ZOBA 4GZIA 5T9CE 2I5QA 5ABFB 1VRDA 1ZHAA 2QZRA 4GY0A 4JEQA 4JTIA 4FXSA 4QQUA 3C3UA 3MPGA 4XZIA 3PZ9A 1EB3A 4M80A 3W28A 2PGWA 3C61A 2Z28A 1JVNA 8TIMA 2X7VA 3L23A 3KRUA 3VU2A 3PJUA 3CS2A 3VC6A 3TR9A 4UTWC 5EMJA 1TR1A 1B54A 2J8TA 2GDVA 2W67A 1EL3A 4MADA 3OLEA 2ADAA 2ZUUA 5G1YA 5A2CA 2YDRA 1ZBWA 1LLWA 3BO9A 1V3LA 3NL3A 4MAZA 4J7RA 3N13A 4UCGA 3EDFA 5XIMA 1W3HA 1R8LA 3ATZA 4DJDD 4A21A 2Q6ZA 4O50A 3CZKA 1EZ2A 1JUEA 1Z42A 4HSNA 4M24A 1ECQA 1KBLA 2FZ9A 1S2AA 1ODUA 2Z1VA 7ENLA 1NDYA 1TE1A 2QYGA 5AKQA 2WSRA 5HNTA 1VYRA 3W53A 3OQ8A 4O19A 4NT0A 3N15A 3RR1A 1XLAA 2YR1A 4P8WA 1EIXA 4C91A 3U2CA 3MJMA 4PBEA 2PDQA 3WJSA 1V5XA 4CCDA 1Q2SA 1H7OA 3GDTA 3CHCA 1YDYA 1DIKA 2O9RA 4GVIA 4HSOA 3BOLA 2Q3OA 2C71A 2DT0A 2NQHA 3GKFA 5IDIA 1HKJA 3O6YX 4UMBA 2IKIA 4LW7A 3KRZA 3ZT6A 1Y7VA 5DN1A 4C5ZA 5EMUA 4IQDA 3DEQA 1FHVA 1HGWA 4IGHA 3SCRA 3NQ8A 2ASHA 2J27A 3CZLA 2GGGA 4EK7A 4M1BA 2IXUA 1OCJA 3ZWTA 2QCDA 2AQOA 3LB0A 1EJWC 2EPNA 5CQ1A 2PFHA 3XISA 2A6LA 2E28A 3B8SA 3FW6A 1CGWA 4C65A 1GJPA 2D0HA 1MUMA 4JTTA 1TPEA 1IQ8A 2WHLA 4M19A 2XSAA 4XB3A 4K37A 4PCSA 4JFUA 2XIIA 4K8GA 2I9EA 4ACZB 1IYXA 1KFKA 1M6JA 3CT2A 4E2BA 1CENA 2XPKA 4LCQA 2IKHA 1IEVA 2ZUTA 3RX4A 4O18A 3QOMA 1CLKA 1UHVA 5BWFA 3LCIA 2WNWA 3GHRA 4LGXA 1B4EA 4RX0A 4GJJA 1WZKA 2IKJA 5TBOA 1XLGA 4WDUA 2TAAA 6ALDA 2DU2A 4ATWA 3U57A 3WLHA 3WUBA 4LXFA 3VKAA 1BGAA 1PZ3A 1NIUA 3KBNA 1GQIA 5BRQA 1TVPA 1XIBA 1E1FA 2H3DA 2DSKA 3RPMA 3RM8A 1WUEA 3QTPA 4NZ3A 1OF8A 5CC5A 4QE1A 5T26A 1NARA 1IXPA 1B3YA 2ZUNA 4RDWA 3POHA 4C6JA 5G2IA 1YX1A 3PJTA 5CG7A 4KFPA 2QHAA 4L61A 4LV9A 1UR3M 2WBKA 4E2OA 1KV5A 3GW0A 5C9XA 5C9ZA 1C91A 1G9HA 1MZHA 7REQA 2CLMA 2VEIA 3O6AA 3DG7A 2PF8A 3L4XA 3CQIA 5FI8A 4BWLC 5GJNA 4P8XA 2P10A 1LQ2A 4S3FA 3QGVA 1DJZA 1X1ZA 4QE4A 2GPTA 1OJXA 1AJZA 3MJYA 3M0KA 1DWIM 4U3CA 2JALA 3T78A 3UP8A 1FY6A 1X8CA 2REQB 2EG6A 4E5TA 2EBNA 3G0UA 3IV8A 3FA3A 2BDQA 4MLRA 3SB0A 4H8NA 5CBJA 3AXXA 4DVOA 3LD5A 1JEZA 2XIOA 2GJXB 3AMKA 4FSAA 3IUIA 4F0MA 4RNIA 6A3HA 1UD3A 2E25A 1GONA 4ZOAA 4JN6A 1A49A 2EPLX 4WX2A 4PULA 1XINA 5CZ0A 1XQLA 4XX6A 5MHBA 3RJXA 1LWIA 1XPGA 3LHTA 2JE8A 4R33A 1A47A 1PVNA 3EMQA 1JDDA 5BMWA 3RMEA 1R46A 4LC8A 4WKFA 5G1TA 5I24A 4PMZA 3LCHA 4LEQA 2WC3A 4IIHA 1VYPX 1A0EA 5D04C 3SDOA 3V5FA 3U2ZA 2IPGA 3ZSSA 1YNPA 3WSUA 5FJTA 2Z7KA 3MWAA 3IUHA 4K2SA 1TUFA 2J9XA 1E0VA 3CUFA 1J0KA 4X22A 2BHYA 2FH8A 3IEBA 4AF0A 3ECQA 3KVJA 4DJDC 5D02A 2C0HA 4WD0A 4YHGA 1IEXA 3GXFA 4TUFA 3THDA 3ZVIA 1Z8AA 3N4FA 5DEZA 1EHAA 4GQGA 2J8GA 1UZ1A 4MNLA 1KM3A 3AJ7A 3T0BA 2Y5EA 3EOEA 3SEPA 1J2WA 1NU5A 3P0WA 2PRHA 1SGJA 4JCLA 4MFEA 1AK5A 3I7SA 2YCEA 2XFWA 4KBXA 3IVUA 2OT0A 3LS9A 4ZFMA 2XVLA 3TOPA 3BTNA 3GXNA 3WBEA 3W83A 3U2OA 3TNBA 2VOTA 4B2DD 2P3EA 3W07A 3AO0A 4GIYA 2PDFA 1D2KA 1EJVC 1UOZA 2XJ7A 4BF7A 3VD9A 4XZ9A 4AD1A 4PFHA 4OOUA 1NTHA 3NAVA 3ORWA 4ONVA 2Z1XA 4IP5A 3ELFA 2QMJA 4E3TA 4LYRA 3A47A 4AD0A 3KTSA 2PD9A 2MANA 2XH2A 1MW2A 3P84A 3WF3A 2DZVA 1I60A 4F2BA 4ADSA 4LYKA 2HVNA 2A79A 4QEEA 3AS2A 4DJFA 1GOOA 2WZEA 1XYCA 2DUAA 2WMHA 1MQPA 2YBVA 1VEPA 3PWGA 1XUZA 1MQRA 1ISXA 3A3XA 1IWAA 2I14A 4Z1BA 1FXPA 2BY0A 1E15A 3KWXA 1P0EA 1CGVA 2PWEA 1JI2A 5LIYX 3DECA 4B5VA 1QTWA 4QDPA 2ZRXA 2ABAA 2TRSA 1GOQA 2HZGA 3E0VA 2DH3A 3WBYA 1EEPA 3RITA 1KRBC 5MF5A 2AL1A 1TV7A 4CVWA 2JKAA 3UJRA 4CCCA 2J7HA 1B31A 4WLCA 1DVJA 2GDQA 1H60A 4IH3A 4MFDA 4O1AA 4UFKA 2ZXAA 4MWAC 4ZXOA 3WYZA 4EXAA 3BICA 1S5WA 4PBFA 3W7GA 3VKDA 1SUXA 2J8FA 3TZNA 1MDRA 1SO5A 2YB1A 3W2MA 2TODA 5EBAA 4H2CA 4GACA 3OTRA 5M5DA 2E6FA 4Q7NA 5D4YA 5KZEA 3G8RA 1YTEA 4P7NA 2J47A 1BSIA 2OMAA 1GVQA 1KRCC 4ZFCA 3WLOA 1RCQA 4B9ZA 5CSSA 5I2UA 3TYUA 1E5NA 1TG7A 3QR3A 1Q66A 1S5TA 3PPHA 4JKMA 3ITGA 4JIRA 1NP0A 1HN1A 2P0IA 3GK0A 3GIPA 1KXTA 5AHLA 1N8FA 5LXEA 1GOIA 1U1HA 1E9YB 3FGCB 3EPOA 2YIHA 5HNUA 1NP2A 1A5BA 1ZJAA 1JG9A 2WPGA 1E0WA 5FA5A 3O1NA 3PNUA 4DWSA 1RY0A 1Q6FA 4JDBA 2GVLA 4GGBA 3ZO9A 3CUGA 4XIAA 1F05A 2Z6JA 3W1UA 3GNOA 3R5EA 3RHGA 1K7XA 5JIPA 1JULA 3UWEA 1VFMA 1OCQA 1GOKA 4JIPA 3TCSA 1YW1A 3KFTA 1GW1A 2Q8ZA 3QFWA 4KGLA 4JHOA 1YTDA 1E9LA 4Q8UA 2QLYA 1WZAA 3CQJA 3PFMA 2H9AB 3WF0A 3PSWA 1XGDA 4JTKA 1V03A 4BEQA 2DY3A 3BAJA 2GVJA 2VC7A 3RLGA 1RD5A 3L2IA 4GC3A 5FIPA 1VEOA 4K3ZA 4IFRA 4XO7A 2WSQA 3GAKA 5FJUA 5EMYA 2WSKA 1LG1A 4NZ5A 1POJA 3VZXA 1RUSA 4HMCA 2RAGA 1ZTVA 2V67A 2AL2B 4KCWA 2OLSA 1WZLA 2QAFA 3LM3A 3W2LA 4O8RA 4IMFA 2OO0A 3DU0A 1X97A 3IK2A 1DEDA 3NJ3A 4LNCA 2PZ0A 1PX8A 5HQMA 3FX4A 1P1XA 4H9YA 2VZSA 1EBHA 1H41A 4TIMA 1RK6A 2GWNA 1K9EA 1VC4A 4O1DA 3URNA 4IFKA 6REQA 1TTJA 3URBA 2WMKA 1CXKA 4M6QA 2G3IA 1G0CA 5FD0A 1SZGA 3TYBA 4RXGA 3D3FA 4IGSA 3CYJA 2POZA 4GQQA 3DFOA 3ENLA 2BNJA 2OPJA 2CZ5A 3WDQA 4UTUA 4LS1A 3UF9A 1AH0A 5GNZA 3W6LA 1K3UA 4JR5A 3PAOA 2H6RA 4MMWA 3QYSA 2A2IA 4DI8A 3AAMA 3CZGA 3UGRA 1E6ZA 1GQNA 3CUIA 3LBOA 3PF3A 3WMSA 1S2WA 3GC4A 5AB3A 1TIMA 2JIEA 4IT1A 1FQ0A 1RCOB 3MP3A 3LGEA 5I6SA 3CQKA 2HNEA 1JYXA 3RLVA 1BD0A 4HPGA 4LF2A 2OZ8A 4QG8A 4EPBC 3SQLA 2OFJA 4JTSA 3UCQA 3FJLA 1FHUA 2PBGA 3UBPC 3EWUA 1KTCA 3GDLA 1SO3A 2V30A 4X9YA 1W0MA 3I6RA 3C52A 2V68A 1GVRA 2G50A 1E51A 4PMVA 3G0XA 3S5NA 1GVEA 3GX9A 2QJNA 1M1BA 3GQYA 4S3JA 1WUFA 4NI3A 1H4PA 4MNMA 4R9OA 2WVTA 2YL5A 2HPIA 1ZBVA 4GYKA 2UZ9A 1YDOA 4DRSA 3GU1A 3RM9A 2E1WA 1Y8BA 3A3HA 3WK1A 2C6QA 3SUWA 1Q6GA 3PZMA 3AMDA 1SZFA 2QCLA 3DI0A 3E96A 2DVXA 1OD0A 1EDTA 3KM8A 4K38A 1O94A 2RHGA 3W3OA 5FF3A 1B4KA 3IARA 1PZ0A 4TU1A 2FTYA 4LOCA 5HK4A 3PB2A 2V2DA 1J10A 4Z0SA 2C79A 5D2YA 1F3WA 1GOWA 3GD6A 5IHRA 2XIBA 5G2HA 4CQ8A 1KRMA 5HPOA 3GR8A 2V5JA 4LVAA 4LY4A 1E4LA 1IXNA 4ZQPA 3CMGA 2GOKA 3P60A 1L2UA 3RR4A 1G4EA 4W5ZA 4BI5A 4EX4A 3MU7A 2D2OA 3AFBA 4J3UA 4ICMA 4WXZA 3AU6A 4NRRA 3TJ4A 5A94A 3ZVHB 2HNHA 1C9DA 1KM4A 3NQ7A 1LQ0A 3R1ZA 3PSVA 1B0IA 4XKYB 3CNYA 4E8DA 2BB0A 3MMUA 1ONWA 4IPLA 1LT7A 5FEPA 1YLVA 5LA0A 3DUGA 3IK4A 4Q4RA 2EPHA 2E9MA 4JX5A 3CZ8A 5HJXA 4R88A 3SCNA 3C8FA 1OD8A 1S38A 4A8IA 1MFVA 3LRKA 1KTBA 2GK1A 2O9TA 5BRBA 3AC0A 1EH9A 5EU9A 4ASTA 4CUCA 2XYLA 4C1NB 2XH4A 3IANA 4P2VA 1UQZA 1DJHA 3AIEA 1TMHA 1LBMA 3JZUA 3STGA 2NVAA 4O4VA 1SVDA 2EJAA 3HQNA 3MWCA 1TYGA 2VCBA 2NV2A 4B5WA 2D0GA 4B9YA 3LUTA 3P62A 5C2CA 1XDJA 4BZYA 3NXLA 3VPLA 3WL0A 1SJCA 4CN1A 1DQUA 3T0DA 3UR5A 4YTTA 3V5OA 4HYWA 3QZEA 3O07A 2O7SA 3LCWA 4O52A 3CU2A 4YNGA 3M47A 2IW0A 2YFOA 7A3HA 3AZRA 5H1WA 4UQ9A 2JQXA 1JDAA 3GHSA 4M6VA 1ZP4A 2GQ8A 1M5WA 5K2ZA 3E1F1 2W61A 3L9CA 3LPOA 4UR9A 4OBRA 3NSMA 3OHIA 1Q8JA 3S5OA 1A0CA 4I7UA 3KS5A 1HL9A 1Y65A 3SI9A 1KGXA 1C93A 2QUTA 2BSLA 1EKOA 2FPTA 5CC7A 3TAOA 3R89A 4QCEA 3TSMA 3N1AA 3LHUA 4DI9A 5BXTA 3BURA 1OGBA 4L4PA 4DELA 4XSLA 1PUDA 1EC7A 3SCOA 4DF0A 5LNWA 4YL2A 2RDTA 4U33A 4K39A 3QR0A 4WJ8A 1FWNA 5SWUA 1UWIA 1AL7A 1H49A 5A69A 3T08A 2GSEA 4RZ5A 4L4LA 1VFHA 1GVOA 4XD5A 2OSWA 4H2HA 4EF8A 4GA8A 5I3DA 4LUIA 3UPMA 3UYIA 3SRDA 1LDCA 4WDWA 3RDKA 5CGQA 4Q22A 3BMWA 5FSDC 1UOKA 3U8GA 2DIJA 4B5XA 1GNXA 1OQFA 4B5NA 4GFIA 2PLMA 2OX4A 3FAWA 3STFA 4WY0A 3H2AA 2HJPA 4ZSTA 1TSIA 3MI6A 1X1OA 1HG3A 4PUDA 4ZB0A 3NM3A 3L7RA 4A8RA 3TJLA 5B7ZA 2OXNA 1QOXA 3I68A 4RXFA 4X61A 5AZ1A 3RLHA 4H00A 3KWSA 3WDIA 3GNPA 2ZDRA 4MPQA 4XTDA 4X0NA 3LPFA 4LAOA 3OJGA 3PZNA 1UH4A 1E6XM 2HRWA 4GQBA 1TPC1 2C18A 1Z3NA 1LL6A 1LWJA 1E1CB 3L0GA 3MVIA 2L5HA 3GAYA 3WNMA 1W1IE 3HQ1A 2VJXA 2X0HA 2I16A 1FX6A 4IP4A 1ENUA 1XR2A 1JGIA 2QNEA 1QCWA 5JIWA 1OGGA 4OJYA 3UXIA 4NAFB 3WCZA 1K7FA 1G67A 4DAIA 4B92A 4Q8NA 4S3BA 2OYLA 2QUMA 4UQEA 2WC7A 4YVVA 4QDWA 3REQA 3THAA 1I4NA 1F7BA 1SW7A 3QFEA 1LP6A 1EYEA 4QXIA 3C6CA 2VEFA 4MZ1A 2YA1A 1MEIA 4H9VA 4H7VA 2OWWA 4L9ZA 1ZAHA 1XYLA 1F4AA 4ZTYA 1ZQ5A 3Q58A 3M7WA 1TR9A 3VDCA 4HPJA 4IL2A 1WDWA 4OECA 2ACSA 3L2MA 2Z2UA 3PUGA 4WHBA 4KCVA 1CGXA 4JCMA 3PPFA 1R3QA 5H2ZA 4KH2A 2E09A 3RU6A 3DC0A 3SUSA 1C8YA 1XIIA 4KWSA 4HU4A 4J3WA 1R3TA 1FDJA 1H7WA 4F2UA 2FB3A 2VX7A 1BAGA 3M5XA 1BXCA 2VOMA 1TV3A 3PJWA 1BTMA 4P8VA 5D9NA 2PMQA 4N9EA 4RDVA 4MYXA 1IF2A 3XIMA 1H50A 4AY7A 2NQLA 4QEHA 5CKSA 1T8QA 1VYSX 5D2VA 3N73A 5A95A 1GHSA 1OINA 4UB9A 1QPNA 4DM1A 4FNUA 5CC6A 1J9YA 2VC5A 2QIWA 3I4KA 3VINA 2XVGA 1YNYA 1YEYA 1O1HA 3BH4A 3LXCA 4N6FA 5HWMA 1XYBA 3EAUA 1I9CB 1W9XA 3CYVA 4IOTA 1OFEA 2P3ZA 1F8MA 2C1HA 4QJ1A 4H7CA 3UEQA 1A80A 1JCLA 3VOFA 3DFTA 5KZDA 5DMLA 3EB3A 2QW5A 1HX0A 1YDVA 3CUHA 3WLJA 5FOOA 4W7UA 3G5EA 1H61A 1ME7A 4L6DA 4I9MA 4XG1A 4PMUA 5I3FA 3MKCA 4Z2IA 2PWUA 1EOMA 1KWGA 3CAVA 4A3QA 4F66A 2NSOA 3EOSA 3LNPA 3E5PA 1IT7A 3C0SA 4OU1A 1UMLA 4FX8A 4LX4A 5CPOA 1ZCOA 1BF6A 1CYGA 3UWUA 2NWSA 3O05A 1LCOA 1SJAA 3TONA 1SQ7A 2PP3A 4B4FA 3T7VA 1R3SA 3BPWA 2E40A 3B04A 1JI1A 3B9DA 3F5JA 1N82A 2Y7DA 4CVUA 3VFCA 3E12A 2PUZA 4FNTA 1CLXA 3DG6A 1IEIA 2Z2AA 4IPPA 3B9NA 1ITCA 3MSDA 1OADA 1GJWA 2F2HA 3OP2A 2OYKA 1ELSA 4XV0A 5LXXA 1UPMB 1LBFA 3H24A 1SZEA 3TV8A 1NWUA 3IJ6A 4DJFD 4CN6A 4N9BA 1YPIA 1RQEA 3TN3A 4J3SA 3FN9A 1SYTA 4Z42C 3I6TA 4DXKA 2WLZA 4N4QA 4YXGA 2OCZA 1W1ZA 5HXMA 3MT1A 3WQGA 4NILA 2EPKX 3NL6A 3TTEA 3R11A 3O6CA 4JDYA 3HQPA 4LANA 1NJJA 3DGRA 1TWSA 3JR2A 3WLPA 1FWWA 3N18A 3DI1A 4B5UA 5DBUA 4IGMA 2O4QA 1YE6A 4HQVA 1NVMA 2DJXA 1F07A 3HPSA 1YPFA 2A3HA 2R8WA 4O54A 4Y90A 3GH7A 4O17A 1W1VA 3CC1A 1OX6A 2BGQA 3MO4A 4RNHA 5EGRA 4HA4A 3LHVA 2GJPA 5HATA 2W66A 3KP0A 4GVHA 3GTNA 1W1B1 1MUCA 1W1A1 4WIWA 4AISA 4KETA 2QPXA 4PB4A 1X98A 2GDUA 1XBYA 3GG7A 4MM1A 3N4AA 4O1EA 2Q8LA 1V79A 1VKFA 2YXOA 5DELA 1F74A 1OCNA 3N19B 4X63A 4DPQA 3KCLA 3A5VA 4I6VA 4ZQMA 3PR2A 3G8EA 3W6MA 1O6IA 1VBUA 1Y5VA 4ENLA 4D1IA 4NI8A 4H9MA 3NO5A 2PDBA 5G4WA 3H4GA 3T81A 4RV8A 3HPZA 1FWRA 1SM9A 4Q4MA 5LHEA 1XIEA 4DWSD 3NNTA 1G01A 4JQAA 3PBVA 4NX0A 2QJJA 4W85A 3L5LA 2PU0A 2WVUA 3WIJA 1REQB 5JU6A 1QI3A 3SGGA 3WBWA 4L6HA 3MUXA 3SCTA 3UG4A 3SSJA 3MUCA 2QV4A 4AX6A 4EWJA 4UTTC 1TVLA 2IQTA 3ZQ9A 2E7FA 3P8JA 3L5MA 2X2GA 3BLPX 4ZQRA 5I79A 3ES8A 4E4FA 3D6NA 3Q65A 4PZVA 3WEZA 1T41A 3W74A 2J9YA 2QDEA 3BLDA 3V36A 3TJXA 3GHTA 4H8HA 1XL9A 3LYEA 5AYBA 3LM7A 3VDBA 2OTDA 3B06A 1TWWA 4QX4A 2V38A 1J5SA 4H9TA 3PN8A 2ZX8A 4YS1A 3W1AA 4PL2A 4Y9AA 1T5AA 1XFBA 4Y6GA 4DBDA 1MRQA 3AS0A 3VZZA 3WL1A 1NEYA 3VIKA 4GNVA 2Y4SA 2PDUA 4IMGA 2W63A