2Z6JA

Crystal structure of s. pneumoniae enoyl-acyl carrier protein reductase (fabk) in complex with an inhibitor
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
320
structure length
307
Chain Sequence
MKTRITELLKIDYPIFQGGMAWVADGDLAGAVSKAGGLGIIGGGNAPKEVVKANIDKIKSLTDKPFGVNIMLLSPFVEDIVDLVIEEGVKVVTTGAGNPSKYMERFHEAGIIVIPVVPSVALAKRMEKIGADAVIAEGMEAGGHIGKLTTMTLVRQVATAISIPVIAAGGIADGEGAAAGFMLGAEAVQVGTRFVVAKESNAHPNYKEKILKARDIDTTISAQHAVRAIKNQLTRDFELAEKDAFEQMGAGALAKAVVHGDVDGGSVMAGQIAGLVSKEETAEEILKDLYYGAAKKIQEEASRWTGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Trans-2-enoyl-ACP reductase II
publication title Crystal structure of enoyl-acyl carrier protein reductase (FabK) from Streptococcus pneumoniae reveals the binding mode of an inhibitor.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 112
structure length 307
sequence length 320
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2007-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03060 NMO Nitronate monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2z6jA00
1H60A 5CPNA 3SZ8A 3NXFA 4Z1AA 3E9AA 3HOJA 4A3UA 1SR9A 2Q8LA 3C52A 1I2QA 1OYAA 4X3ZA 2QAPA 4AWUA 3YPIA 4PFMA 1EB3A 3U8GA 3W1RA 2TSYA 2E6DA 4QAIA 2C18A 4WZHA 1DOSA 5G5IA 4DBEA 4FNUA 5HQEA 5BMWA 3W7OA 2O7SA 1Y0EA 3DXIA 3R89A 3U6WA 1OX5A 4O14A 1G4SA 1KM3A 1K7XA 2B7PA 3GZ3A 1PS9A 5CPLA 1DVJA 2VELA 4GE8A 4EVZA 4DF2A 3C2EA 1AL8A 3T55A 2YX0A 2YFOA 3O8AA 4UTTA 1TJRA 3H55A 3ABOA 3DHFA 2DZTA 4WJEA 2VFGA 4UR7A 3DKJA 5LNRA 3L5MA 3OEXA 4FNPA 4UFMA 4LVAA 4ZQOA 3EWZA 5EYWA 2GJLA 5FF3A 4ZMGA 3CEUA 3HF3A 3HO8A 1J2WA 4JS3A 1SFLA 3W74A 2C0AA 3W7MA 3KVJA 3TJXA 1EP2A 1P0KA 4JDYA 4UMAA 1KFEA 2WQPA 1F76A 3UQNA 3P62A 1S3HA 2CLFA 3L2IA 3GDMA 5TIMA 3CU2A 4QNEA 3G22A 3LCFA 1K03A 5E0KA 1FDYA 2QUTA 2YXGA 3S5NA 3CLMA 2GVJA 3FJ6A 3LHVA 4UNLA 5CPMA 4JR5A 3LDVA 4LVFA 2QCEA 2OCZA 5DXXA 5KMYA 3VNDA 4RKAA 4JTFA 2XN2A 5HMSA 4FB7A 5K3VA 2Y61A 3M5XA 3GAKA 3EX6A 4FNTA 3W7KA 2C16A 4DBDA 5H2ZA 2P1FA 2QCHA 4NVTA 5I3KA 3LCHA 5CPOA 2BSLA 5KTLA 3TUUA 3QPZA 1OK4A 3A5VA 4O54A 3NR0A 1TB3A 3TSMA 3I7QA 4IMDA 2QUVA 4DQWA 5K9CA 4E0CA 5F1VA 3W07A 3KVMA 1TV8A 4K39A 5K4ZA 3H53A 2NX9A 3QEZA 4GBUA 2DJLA 4JYDA 2V30A 4JXCA 2JK2A 1SW0A 1U83A 3QRHA 4NZJA 3W7GA 2ALDA 3KRZA 3TKFA 4MLJA 4GJ1A 4DELA 2NX1A 2PC4A 4RV8A 3LCGA 1W0MA 1QOQA 1VZWA 1JCMP 3M47A 4P2VA 5C5YA 3TC7A 3IGUA 3A24A 3VE9A 3PG9A 2OZ0A 4RZ4A 3CWNA 4Z08A 1TQXA 1TRDA 4WD0A 3TCEA 2VEIA 1R47A 1MXSA 4FXRA 1F74A 1KTNA 1MSSA 3TAKA 4EIVA 2OT1A 3MI6A 1ZJIA 2NWRA 1GEQA 4ZZ9A 1F05A 1WXJA 1QR7A 5IBXC 4WUIA 1LORA 4BF9A 3KFTA 2NWSA 4R53A 1FWTA 2QCDA 4O17A 4NX5A 1YLVA 3EXRA 4BWLA 4DXVA 3DU0A 4UFJA 3RK8A 2FJKA 1HL2A 1HUVA 1W3TA 3W1NA 6ALDA 3M1ZA 4OBTA 4MZYA 1HFBA 1I2NA 3WJYA 3L5LA 3WK2A 5TBOA 3G3MA 3DI1A 3M5VA 3QPYA 1XDMA 4YMZA 1H7RA 3I6RA 3PWAA 1R30A 1TPB1 3H54A 5KZMA 3LHYA 3OA3A 3Q58A 1GPWA 3C4UA 1AMKA 2DORA 3P61A 3R13A 4NXKA 4U28A 3E96A 4M19A 1GYNA 1SW7A 3SJ3A 1VYSX 1UB3A 3SGUA 3IV3A 3LOTA 1OFOA 1WYIA 1G7VA 3TSDA 4AAJA 3G8EA 4WQ6A 3P5ZA 2J27A 4MJMA 2AAMA 5EA9A 1ZENA 2A1YA 3W7JA 1OVDA 3G3DA 1IF2A 3G0SA 1VS1A 3RLVA 1OK6A 1IIGA 4ORMA 1ME7A 3SI9A 1FCQA 1H61A 1LM1A 1ZCOA 1V5XA 5C2XA 1JR1A 5F2GA 2NUYA 4K37A 1AK5A 4NNAA 5G2IA 1KFLA 1W3NA 1GZGA 5KZEA 1GVSA 3THAA 2ZA2A 3EXSA 3QJAA 2DU2A 1I4NA 1QO5A 1DHPA 3W1XA 3QYQA 1H63A 3LLFA 3PY2A 4N9CA 1TPUA 1P1XA 2ZZ4A 3PULA 3GVGA 2B7NA 5I3GA 3C56A 5LNVA 5D30A 2YDAA 1RZMA 3W71A 2V82A 3E02A 1X1ZA 2Y62A 1FWWA 2IQTA 1VJIA 3UPBA 3BG5A 2B4GA 4LUJA 2A85A 2QCFA 2V5BA 3S5ZA 1AW1A 2EF9A 1FDJA 2A7NA 3LRKA 1G4PA 1Q6RA 3BGJA 2ATSA 4UFLA 4UFIA 4NJHA 4IXXA 2CU0A 4WY0F 5LNWA 2VEPA 5AHFA 4XWUA 2X30A 3IGXA 4Q4KA 1CW2A 4WY0A 3L65A 2ZA1A 3ELFA 3MWAA 3TV8A 2Q3RA 5C6MA 1D3GA 4JEQA 2BXVA 1KV5A 2R94A 1YADA 2JKAA 3W7CA 3S6DA 1TREA 1XI3A 5EBUA 5C55A 1JCYA 1YPFA 4DPQA 1EIXA 5CZSA 3W22A 3L67A 1OFPA 3I65A 3DFNA 1Q6LA 3IIOA 1O5KA 3N19B 4Z1BA 2TMDA 5BNKA 3UWZA 4MVAA 2PE4A 2CZDA 2FPYA 4GXMA 5D05A 1GYLA 1KM2A 4HNTA 1QPOA 4LVGA 4UFKA 2FB3A 4JNMA 3LTSA 2WOQA 3W2KA 3OBKA 1LBFA 4D2JA 1TIMA 2G96A 2PRHA 1JCLA 3W86A 2V8ZA 3SFKA 5K4XA 1VGAA 3TK7A 1WA3A 3N2MA 3LB0A 4R33A 5CZTA 1KTBA 4K7VA 4RXFA 3W75A 1C9DA 2GUUA 2NV1A 1LOSA 3C3NA 3NVTA 4TMBA 3GXTA 4JGDA 1TPDA 1RR2A 1TYGA 1A5AA 3F03K 2JKPA 3O06A 1F6PA 1XUUA 1YTEA 4XTIA 1PIIA 3NZ1A 5DBTA 4K36A 4K38A 4O0ZA 3FS2A 3B0VC 4PH6A 4ZL1A 2YCEA 5D2WA 2X1UA 1B57A 1OX6A 1KA9F 1VCGA 1U5JA 1NVMA 1T99A 1N55A 5AYXA 4MJZA 8TIMA 4BI7A 3W7PA 4WOQA 4HPJA 3G0UA 1VR6A 3E12A 1I2OA 2JGYA 4GUHA 3RU6A 4LRTA 4JTKA 1EWEA 2GQAA 1VLWA 3GAYA 1O60A 4MOZA 4UTIA 3PBWA 3KXQA 2VXNA 2Y88A 3HGJA 3CB8A 3W6YA 3L0NA 3TE9A 4QSHA 5KITA 2ZZ7A 2ZZ6A 3TXZA 4HNVA 5HJLA 2VFFA 4Z1DA 4S1FA 4DF1A 3JS3A 1IIHA 1JUEA 1RPXA 3T7VA 1W5MA 1JQXA 2YZRA 3P67A 3NG3A 1M7OA 3LCXA 3TA6A 4UR8A 1DJNA 3TQKA 3C8FA 4JTEA 3LHWA 4MIMA 4S2CA 3NO5A 5I3FA 4FO4A 5AC8A 2FIQA 4UTTC 1JCJA 2H8XA 3NQMA 3TQVA 3W7QA 1BWLA 1NEYA 3P81A 4GUIA 1RV8A 1GVFA 1ME9A 3W1AA 3HPZA 4IQLA 4AEOA 3PBYA 4H4IA 3P74A 3R8RA 2E6FA 3M5YA 1E51A 1BTMA 2CLEA 3FKKA 3LLDA 4KKXA 4K8EA 3EXTA 1WBHA 3W7RA 1OYCA 3NAVA 4XKYB 2RDWA 4TIMA 5LZLA 4NJJA 4RK8A 3GLCA 4DEFA 1UJPA 1FCVA 3O05A 1W5NA 2Z1BA 1OF6A 3V75A 3CIWA 1VPXA 1PHWA 5G4EA 4UTHA 3A9IA 4WX2A 1TTPA 3PC0A 2CWNA 6TIMA 1PV8A 1F7BA 2C13A 4H3DA 2A5HA 4Z0SA 4M7TA 4EF9A 5LKYA 3M6YA 1LOLA 3IEBA 4M7SA 1SPQA 1LCOA 1W1ZA 4UMBA 1GG0A 3ZR4A 4UCGA 3W88A 4IMEA 4O4WA 3MYPA 2Y63A 1QOPA 5F4SA 3PUEA 2ZTJA 3THQA 1G69A 2P0OA 5DELA 3HBLA 4O1CA 3A23A 2EAWA 3FOKA 4UTMA 2ZRWA 1F2JA 4FHAA 3W7EA 4E2BA 1WBJA 4QITA 1EUNA 3UWWA 1B4EA 4I7UA 1QPRA 4NZFA 1O5XA 4JX4A 3A22A 2D73A 2E5CA 3PSWA 1NFBA 3DFTA 3QMTA 3M0ZA 1XKYA 4ADTA 1X1OA 2JBMA 4LS1A 1Q45A 1OHLA 2H3DA 2I1OA 4RX0A 2J6XA 3G1AA 5D2XA 4Z0JA 2Z6IA 3GR8A 4UIOA 2QCMA 5G2HA 2A7PA 1ZAHA 2ZFAA 1FWSA 1MEIA 1K8XA 1XBVA 5I3IA 3T40A 3SECA 2TRSA 5LGZA 3B4UA 1LLZA 1H5YA 4BWLC 3G1HA 1R46A 3SSJA 1LZOA 4ALDA 4I9AA 2Q8ZA 2R91A 3L21A 4NJIA 3NM1A 2WKJA 4ZQCA 4Y9AA 1ALDA 2Y89A 3S0CA 2J9YA 1H50A 5FF4A 3VI2A 2EHHA 4OQVA 3MI2A 3S42A 1ZALA 1WDWA 1ICSA 2I14A 3OVRA 2Y6ZA 3DI0A 1HG3A 1FXQA 3UZJA 3EWYA 4MKNA 1IGSA 3SW6A 2FLIA 4EOUA 4FNQA 1IXOA 2VFHA 4AH7A 4U4MA 2YPIA 1WOBA 4IPIA 4TMCA 5LGXA 2CLMA 3W85A 1RQEA 1KW1A 2A6LA 3TW6A 1LLWA 2PRLA 1W8SA 3KRUA 1YDOA 2WNQA 1PVNA 5F2LA 1SU5A 2YFNA 3C2RA 3LM7A 3GDLA 3LXBA 1F5ZA 1PCKA 2EGZA 4RXGA 2FB2A 3HPSA 5FESA 3NQ8A 4O52A 5L9FA 3W23A 3NQ2A 3W84A 2VEMA 5D02A 4UTUA 2A6NA 2QCCA 2QCGA 3T44A 1OX4A 3ZFHA 5K2ZA 3KRSA 3TW7A 5F2IA 1G4TA 3RMJA 3W7HA 4HKPA 3FJLA 4HSOA 3K30A 4WXZA 2F7FA 4Q32A 1TSIA 2B7OA 3MHGA 1VYRA 1W5OA 3LHUA 3P8IA 4K7YA 1M7PA 3P84A 3S1UA 2VOMA 1LTDA 1M6JA 3M44A 2G5WA 1Z41A 1HTIA 2Z6JA 4ZVJA 3Q37A 5D2VA 3PB2A 3ZWSA 1AL7A 2X1RA 3W1MA 1J5TA 2JGQA 1CX9A 1GJPA 2CLKA 3I7RA 4JIQA 3QF0A 3G24A 5F4XA 1Q6QA 4LV9A 4AF0A 1TPC1 3W72A 3I7SA 3UZ5A 4EWND 1ADOA 4TX9A 2EPHA 2X1SA 1L6WA 1RVGA 4JTSA 4GUJA 5AHEA 1L6SA 4IXHA 3MBFA 4AWTA 4MY9A 5U4NA 4AXKA 4ONVA 2QDGA 1EP1A 1I2RA 4LY8A 3NZRA 2RKXA 1VCFA 5FEPA 3W1PA 1Z42A 4LV4A 2QJGA 4G1KA 1DORA 4IOTA 4O16A 5D32A 3MYOA 4N4PA 1KM1A 3NM3A 1IXQA 3MHUA 4HT3A 3OG3A 4DO6A 4FIQA 3NQEA 3O1NA 2DZXA 3S5OA 1FWNA 2C14A 2V2HA 4M5PA 3UYCA 3UPWA 4OE7A 3PF3A 4POCA 2J88A 3SR7A 3TC6A 3RLUA 1N8FA 5D2TA 2E6YA 3HGRA 3EX3A 3S1VA 1TTQA 1QFEA 3TDFA 4TU1A 1GG1A 4BK9A 1H51A 5I3JA 5DBUA 2VEKA 1FX6A 1UUMA 4M6QA 3B06A 4GUFA 1YTDA 3P5YA 5BRBA 5KSWA 2J24A 1NF0A 3EX1A 2CFFA 4KWWA 3MO7A 1EPXA 2QKFA 1RD5A 2G97A 1X8FA 3S8HA 3IRDA 1VLIA 2BLEA 3PBUA 4N6FA 1VHNA 3Q94A 4CQ8A 1I45A 4UMCA 1SZGA 1NAL1 3INPA 3UNDA 1K8YA 4OV9A 4LS0A 5LNUA 3F4NA 3WFAA 1JVNA 4MYAA 3VFLA 2C1HA 2W6RA 3C61A 3W7NA 3PG8A 4A29A 3ATZA 5IM51 1OYBA 4PL1A 5F2MA 1TRIA 2ISWA 1DL3A 2GOUA 3LX9A 4XQ6A 2B0MA 1LBMA 2WSQA 4GRSA 4ICNA 1XM3A 2HMCA 3RF9A 1OG0A 3CTLA 1KBJA 1SZFA 2V9DA 3C2OA 4FXSA 3B8DA 3CT7A 5FEZA 2C15A 4OT7A 3GYEA 1XUZA 2VC6A 4O53A 3LV6A 3M43A 1A5CA 2YW4A 3HPXA 5LNSA 1B3OA 3CHVA 4NNCA 1TPFA 4ML9A 2Y7FA 4O8RA 3BGGA 3QMRA 3TNOA 3QW3A 1SO5A 1LBLA 1JQVA 2FPTA 3B0UX 2DZWA 3NPWA 3LHZA 3LXCA 2QJIA 3HGSA 2X16A 2ABAA 3ABQA 4M6VA 4JDBA 1VHCA 1ZFJA 2AQWA 1LOQA 1EWDA 4JX6A 1DKWA 3G18A 1TPVA 3GB6A 3W7IA 4CNPA 2GQ9A 1CI1A 5BOOA 4CCDA 1XFBA 3EWXA 1S5TA 4IJBA 4X22A 3BARA 2XFWA 1P5BA 1TV5A 3W9ZA 3LERA 3SY5A 4NJKA 2KZHA 3W7LA 4FX7A 1F6KA 5D37A 4RLIA 2NX3A 3LI0A 4RJEA 1TTJA 5HR6A 4MYXA 3IVSA 3CM4A 3F1QA 4JY9A 3BW3A 3UXAA 4Y90A 4Z1CA 1G4EA 2V5LA 3FKRA 3DAQA 3TJLA 1JRCA 2ZTKA 4LNYA 4LOCA 3B04A 4UC5A 3CIXA 4K6AA 1XCFA 3KVLA 4M6PA 4N9EA 1T0OA 3FYOA 5G1YA 3SIZA 4OWGA 3BK0A 1DQXA 2WNZA 4WOZA 3QW4B 1FUYA 4UNKA 2YGYA 4J9JA 2HS8A 2EKCA 1ONRA 2C6QA 4N02A 3HG2A 1KM5A 1SO6A 3WJWA 3HG3A 3NGJA 1IXNA 3QQ1A 4KFNA 1DV7A 1YTKA 5TQLA 5E93A 1XC4A 4IUOA 5F1UA 4X2RA 4H6KA 2Z2UA 5G2WA 3EKLA 3BW4A 2G95A 4N4QA 2A21A 3B0PA 5D04C 4KFOA 2FQIA 3GXPA 3GXNA 1WAUA 4FIRA 1I2PA 1YDNA 2WSRA 1XBYA 2PCQA 4X9SA 3DFQA 1YXCA 3EWBX 3M16A 2QDHA 5FEWA 2E77A 3NEVA 1LRTA 1H1YA 4LC6A 5AC7A 3TFCA 5HULA 3M9YA 4GUGA 2CLOA 4JTIA 4HPXA 1D9EA 5LSMA 3QSTA 3C0JA 4JY8A 5AHMA 1ML1A 5AB3A 1TCDA 3IIPA 3W2MA 1AG1O 3EX4A 3LXAA 3CEPA 3QMSA 3W7DA 4AHQA 4KWVA 1EEPA 3GKAA 3GX9A 1XXXA 3IGSA 3ABSA 4PEKA 3KOFA 4UTLA 5LHEA 3CWOX 3HB9A 3P8JA 3TMLA 5FI8A 5U7SA 1SQ7A 4QIUA 4LVDA 1G7UA 2ABBA 4HSNA 2JKEA 2QR6A 4MFDA 4RR4A 4BR1A 2A4AA 4E38A 3G1DA 1O94A 3OIXA 4O19A 3QQ0A 2R14A 1WX0A 5DN1A 5T26A 2V0TA 4HNUA 2ZRYA 1FWRA 3GDTA 5FF0A 3QZEA 1A5SA 3A5FA 5D38A 2E1DA 3LCWA 3PVFA 1GQNA 2QF7A 4O50A 1YXYA 3FLUA 3MW7A 3ZS4A 1A5BA 3W87A 2QJHA 4UTWA 1QMLA 3GR7A 2YW3A 1VQTA 2RDUA 3UWVA 5H91A 3IIZA 1M5WA 1P0NA 2E5DA 2QCLA 1LP6A 4O0KA 3JRKA 1KLZA 1G67A 4LWWA 3QH2A 3Q2DA 4YWIA 1GVQA 5G1TA 1JUBA 3VCRA 3NPUA 1WOAA 4XBKA 3MP5A 2NZLA 2QUUA 4AVFA 4FNSA 1MZHA 2NXGA 2E09A 2Y7EA 1GWJA 1KBIA 3OHIA 1QO2A 2CZ5A 1F73A 4Y96A 1SO3A 1X7FA 1V7YA 2ATMA 3LCIA 1K02A 1QPNA 2CLIA 3AO0A 1KV8A 3NPVA 2RH9A 2CZEA 3V1PA 3QC3A 5AYZA 1SO4A 1B9BA 2RHGA 5I3HA 3WJZA 2FFCA 4GFSA 1IXPA 2DP3A 1MEWA 4Q33A 3STFA 2ZZ3A 1XBXA 4LUIA 3CPRA 2R8WA 1SZNA 2CLHA 3HG5A 3GKFA 3C6CA 4WY0B 2Y70A 3DFPA 4L4LA 5AHIA 4IPJA 2E5BA 2BTMA 2NLIA 2YYTA 3UY8A 4N6EA 3L0KA 4O4VA 1I8JA 1KFBA 4FEZA 4MZ1A 1H1ZA 2UV8G 3P60A 4GNJA 3M7WA 3NQ6A 3GIYA 7TIMA 1TJPA 1THFD 2WPBA 4IGHA 5K7JA 2FDSA 5KINA 4NXSA 3ZWTA 2ZRVA 1OFDA 1GTHA 1OJXA 3KX6A 3M5ZA 3C2FA 4S2BA 2W0UA 5D2YA 3G1VA 3N3MA 2VKZG 1H7PA 1OFBA 1XDLA 1S5VA 3GNDA 4LU0A 3HIJA 5HWJA 1L6YA 4CNNA 4PTNA 1GTEA 1KLYA 3TR2A 3PM6A 3S9YA 3R5EA 4YCPA 2VFIA 4UUIA 3I68A 4MLRA 4O1BA 4Y6GA 5F4WA 1DQWA 2YR1A 3LGEA 4OU1A 4WXYA 2W79A 5HINA 3PR2A 2RDTA 3MP4A 1GT8A 3ABRA 2OJPA 3T78A 1RQBA 3BLEA 3VE7A 3GK0A 4Y8FA 1TPWA 3P7YA 1H7WA 4AB4A 4C1LA 4DF0A 2ZCGA 1O4UA 2FTPA 2ZA3A 1S5WA 4CNOA 4UTKA 4YLWA 1QAPA 1WQ5A 4O15A 5CZ0A 1C8VA 3OVQA 2OT0A 2TYSA 1QCWA 4JD4A 4A22A 3DZ1A 5D09A 2O7QA 3W2UA 3UWUA 4FF7A 4FNRA 1SSDA 3FEMA 4CQAA 3MI3A 3PAJA 1KFKA 5AYYA 2HTMA 3W73A 1OFQA 4NQ1A 4IMGA 2DZVA 1G6CA 3PBVA 3JR2A 1A53A 3EX2A 5G4WA 4O11A 4KFPA 1L2UA 3R12A 2BWGA 4A2RA 1JCXA 3MJYA 4NU7A 3W1LA 4MZ8A 3EEGA 4BI5A 4NT0A 4XBSA 2WNNA 3HJZA 2XN0A 2H8ZA 1XL9A 1KM6A 3O16A 2WJZA 1P4CA 2ZRXA 4PA8A 3NL6A 4EF8A 1UCWA 2Y85A 4TR9A 3TU9A 4DPPA 1JJKA 3BVJA 3TX9A 1YXDA 4I7WA 5CZJA 3W83A 3MBDA 4RZ5A 5HUPA 2OX1A 3P82A 3HMJG 2CW6A 2C19A 4MFEA 3T4CA 1VCVA 2X1TA 5HNRA 3NL2A 1SZEA 4MUZA 4MY8A 4LT9A 4O1AA 4LW7A 1TO3A 1YDVA 3RNDA 4R7JA 3WK1A 3NDOA 1T8XA 2I9EA 3NL3A 1UUOA 4LS2A 5AN7A 3LRLA 1W5QA 2ZZ2A 1JRBA 2WV8A 2NUWA 5D03A 2H90A 3L5AA 2ISSA 1R2TA 1SW3A 3BV4A 1YYAA 1ZAJA 4A21A 4PC8A 1HO4A 3LV5A 2OMAA 5EMUA 3NQCA 1BEUA 2DJXA 3UY7A 1QWGA 1T96A 4LTSA 4O10A 1K8ZA 5AFDA 2NUXA 3F4WA 3N14A 4RZ6A 4XKYA 4PCFA 1JCNA 1TMHA 2ZYFA 3BLFA 3FIGA 1GVRA 3W2NA 2PURA 5FEXA 1LYXA 3S5YA 4AWSA 1L9WA 4I7VA 2A0NA 3LRMA 4ORIA 3UXDA 2LLEA 2DZUA 4JYFA 5CKSA 4LRSA 1JULA 4ZQRA 4E2DA 2A7RA 3WJSA 5AC6A 2YYUA 3BO9A 4TO8A 5K9DA 5AOUA 4N9DA 5A8GA 3EWUA 4HNNA 3MMTA 2GQ8A 3NNTA 3DENA 1OFEA 4ADSA 5ABTA 3O6DA 3UD6A 4ZQNA 1EX5A 3G1FA 4YXGA 2WO5A 5EL1A 2GVGA 2RFGA 1TTIA 3N73A 2B7QA 4YL2A 1OFAA 4W9TA 3TROA 3TFXA 5K9XA 1ZNNA 1LRNA 1KTCA 3B05A 1FCBA 5DCDA 1D3HA 2P10A 3LTPA 5LHFA 1FY6A 3QSRA 2BZNA 1SFJA 3EB2A 4B5NA 3DFOA 3FA5A 3NQ7A 3E0IA 3FYPA 3KAOA 2ZZ1A 1EUAA 2F84A 2NV2A 5E1QA 2CLLA 1W37A 4JIPA 1AW2A 5KZDA 4IMFA 3HGOA 5BW6A 3O07A 1UBSA 1MEHA 1A50A 3NL5A 1H7OA 5DCEA 3CC1A 4JTJA 2ZQ0A 3ANYA 1PL9A 3N9SA 4UTJA 3DGRA 4QM1A 3C2VA 4NUWA 4UFHA 5DY2A 3DH7A 2VFDA 4UTWC 1FXPA 4OGZA 1AW5A 1FCUA 5SWUA 4UXDA 1XBZA 4ZQMA 1EP3A 5CSRA 4JTUA 5HUOA 2PRMA 4QNWA 3NQFA 4FX6M 3TMQA 1K7EA 5CSSA 4GWEA 1NSJA 1QDSA 3O6YX 4LVBA 5DXYA 3CQ0A 3B03A 4JTLA 3O63A 2QAFA 3UWQA 3WJXA 1PHQA 3RFAA 1GVOA 3G0XA 3STGA 1RQHA 5HR7A 5CGQA 1DJQA 3DBPA 1VYPX 3SGZA 5IBXA 1OX4B 4O28A 5HWMA 1C29A 3GNNA 2ZDRA 1K7FA 5EY5A 2Z0IA 4YCOA 1ME8A 1OFRA 2H3BA 4QJ1A 3U2OA 4CCCA 4JTGA 1N7KA 1MO0A 1PE1A 3VKJA 2HS6A 3G8RA 3NYZA 2Q3OA 3WK3A 3MP3A 3LTYA 3W76A 4BFAA 4L4MA 1ICPA 3IVTA 3S1WA 5EPDA 4O13A 1BKSA 2E68A 5J5RA 4RCXA 3S1XA 1Z44A 1Q6OA 1TPEA 3BW2A 4NNBA 3NOEA 4OV4A 3NQDA 1ZAIA 1W31A 3FFSA 5FF2A 4MY1A 3HQ1A 2VENA 1GOXA 3LBCA 4AHPA 2V2CA 2V81A 3GDRA 5AHNA 3WK0A 4AF0B 3LI1A 3PS7A 2XN1A 5FF7A 2A2IA 2Y7GA 4K8HA 3W1QA 1B4KA 3W1TA 5MHBA 1DBTA 1R2RA 3STCA 2HSAA 3G1XA 3W70A 2BX7A 3W2LA 4DO5A 4MPQA 1QNVA 3D0CA 4JYEA 1Z48A 1FDZA 3E49A 3G1SA 3ATYA 3N9RA 1X6UA 5GVJA 1KM4A 4XZ9A 3NPXA 2GPTA 2CZFA 4QISA 3BLIA 3PB0A 3MUXA 3TQ0A 3TIMA 2GJNA 4N2YA 3N34A 2QCDB 1O95A 4JTHA 3G1YA 5AHLA 1KM0A 3GDKA 4HIBA 4JTTA 1WV2A 4FX8A 1W54A 2QEZA 3L9CA 3AJXA 3BPWA 4JICA 3TSBA 5BMXA 5A5WA 3N2XA 2GVLA 4PODA 4JN6A 4O18A 1W56A 1SUXA 2J9ZA 1VC4A 3TXVA 4JX5A 4NX0A 3TAOA 4BI6A 5C54A 5CG7A 4ADUA 3PUOA 3LHTA 1PCWA 1UASA 1HO1A 3EWWA 4IX0A 3NQVA 2NXIA 3NQGA 3DFSA 4P61A 3M41A 1J4EA 3L68A 4R34A 3LCLA 5DY3A 5DCBA 4HN4A 1EA0A 2DZPA 3DKLA 2V2DA 4GC4A 1LRQA 2ZBTA 4N9BA 1FQ0A 4DO4A 4O57A 3STEA 2ISVA 5EKYA 1TV7A 1JUKA 4O12A 1OF8A 3O15A 1W5PA 4AHOA 1ICQA 1QPQA 1YPIA 2NXHA 3MHFA 4XUGA 2J9XA 3BG3A 1ZY9A 4IWWA 2VFEA 4O1DA 1ZHAA 1Q3NA 1VRDA 3QFEA 3KVKA 3W1UA 1H7NA 2E6AA 3IVUA 1TPH1 4C1KA 4CCEA 3NQAA 5L6UA 4CLMA 3L0GA 1SSGA 1NF7A 3LBMA 3OVPA 3DHDA 4XTDA 5HWNA 3R2GA 2FPVA 3PUDA 2H6RA 4QQ3A 4CQ9A 3QM3A 3BG9A 4HHPA 4A2SA 1BWKA 3HG4A 1KFCA 2ZZ5A 4AMAA 3P80A 3UWYA 4NJGA 5DLCA 1LROA 2YSWA 3KHJA 2Y7DA 2WSYA 1LDCA 3TH6A 3EKZA 3IIXA 3PSVA 1KFJA 1OABA 2ZRZA 3W2JA 3IIVA 2TPSA 3O6CA 2DZSA 4OHQA 4IMCA 1H7XA 4PL2A 5D33A 1W3IA 1K3UA 1TQJA 2C3ZA 4IX2A 3A21A 1H62A 2AGKA 3USBA 1FBAA 1R2SA 2QCNA 2ZRUA 2X2GA 3W3OA 4ZQPA 5J5DA 3NA8A 4LC8A 1VH7A 3L66A
chains in the Genus database with same CATH superfamily
1H60A 3LMZA 1M41A 4Z1AA 5BZAA 1WDRA 4DYJA 1NWUA 4D6FA 3UF9A 3C52A 1OYAA 3W4RA 3PZGA 4AWUA 3AIEA 3YPIA 3T42A 2E25A 3U8GA 3UXKA 1NWTA 2E6DA 1IWPA 2C18A 1RK5A 2PSNA 3L7RA 4K1WA 3DXIA 3CQKA 5BYWA 1PS9A 5CPLA 3CMJA 5IHRA 4DF2A 4UTTA 1TJRA 2VFGA 4UR7A 3L5MA 3DHUA 1GHSA 1QI3A 4LPCA 4H41A 1J2WA 4JS3A 5HNUA 4W85A 2C0AA 2D20A 3TJXA 3UQNA 4UMAA 1KFEA 2WCGA 2WQPA 1TZ7A 1S3HA 2GJRA 3KDOA 3CU2A 3G22A 1K03A 1EOKA 2YXGA 2QUTA 3S5NA 3O0FA 3FX4A 2GVJA 3LHVA 5CPMA 2FHFA 2OCZA 5DXXA 3ZQ9A 1MRAA 3VNDA 3WL0A 4PEEA 4KPLA 2CHNA 5HMSA 4FNTA 3WL1A 4ILSA 4GFIA 3SB0A 5H2ZA 1W2PA 4V33A 2P1FA 3FVDA 3LCHA 1RBLA 2BSLA 1PBGA 2E0PA 3QPZA 3A5VA 3TSMA 1GCYA 1H1NA 4NZ1A 3RXZA 2DT2A 5I09A 2BY2A 3AIQA 4GMEA 1ISVA 3AI0A 4K39A 2QNEA 1CXLA 5HQMA 4GBUA 2DJLA 2EPMX 1SR0A 1UD8A 3VCNA 3BMVA 4U33A 5AECA 1T40A 3BANA 4UOZA 4XUYA 1EKOA 2HE5A 4OOZA 3T4WA 4NZJA 1MRQA 1I0DA 4MWAC 1H5VA 4MLJA 2DV0A 2EG6A 2NQLA 5CGTA 2NX1A 5AZ0A 1W0MA 1J12A 3QQWA 3KUMA 2ACRA 4P2VA 1E6PA 5C5YA 3TC7A 2J8FA 3PG9A 2OZ0A 3VIGA 3CWNA 4Z08A 4J2PA 1TQXA 1TRDA 4WD0A 1RCOB 4S3DA 1MXSA 4FXRA 4C6DA 3CZJA 3CH9A 1CLXA 4MB4A 1ZJIA 1BG4A 1GEQA 1QR7A 2RAGA 4CQCA 3W01A 2VUNA 3S3GA 4NX5A 1UZ4A 3LA4A 3EXRA 3DU0A 3HTWA 3FSUA 3ZIZA 3NXLA 2FJKA 2BVWA 3W1NA 6ALDA 3WQGA 3M1ZA 3R43A 3WJYA 2FVKA 3WK2A 1XDMA 1V0NA 3I6RA 2V5JA 3WF3A 1HJXA 5KZMA 4UWMA 3OA3A 3ZYZA 3Q58A 3C4UA 4ZE4A 5FL1A 5E70A 2XH7A 1UB3A 3LOTA 3VOGA 3N17A 3TSDA 4AAJA 4UQBA 3G8EA 4WQ6A 3P5ZA 1F3WA 2AAMA 5CLTA 2PDGA 3VGFA 3RLVA 3FCPA 4GQRA 1N2VA 1NM9A 2VZTA 3E2QA 4IPLA 2J8GA 1ME7A 2GGGA 3SI9A 1RCQA 5C2XA 3COTA 1DTNA 4H8VA 1W3NA 1GZGA 5KZEA 1GVSA 3THAA 2ZA2A 3EXSA 2DU2A 4NAFB 1VJSA 8CGTA 3ABZA 4XO7A 4N9CA 2VQUA 2ZZ4A 3KDNA 3PULA 2B7NA 4Q4PA 3TYDA 2YDAA 1RZMA 3APYA 2V82A 1X1ZA 2BB0A 1JXKA 1H09A 2C1GA 3A64A 1QI4A 1GKQA 1X39A 1TUXA 3ORWA 3S5ZA 5ABGA 1AW1A 4BZYA 2HZGA 1G4PA 3GRIA 4IXXA 4JIHA 1C8YA 1BGAA 4YVPA 3IGXA 4WY0A 3L65A 3LPPA 4FXJA 2ZA1A 3GTHA 3ELFA 2DQWA 2ACSA 1H41A 5ENLA 1DEDA 3N13A 3WBXA 4I3GA 2D22A 2BXVA 2RGLA 1Y5VA 1EIBA 2JKAA 2CBIA 1I9CB 2HVOA 3OYXA 1EIXA 3URBA 4WKAA 3I65A 3DFNA 1Q6LA 4UR9A 1EDTA 1X98A 1O5KA 3T2PA 2TMDA 1CXEA 3H12A 4MHBA 1Q8AA 5D05A 4J35A 1C3FA 4XO6A 2FB3A 3BZGA 3GM8A 3LTSA 4MAZA 2WOQA 2P50A 4UZUA 4J5NA 3W2KA 3OBKA 1ZBWA 1ITQA 1BF6A 4QTGA 1QK0A 3W86A 1UR2A 4MWAE 2ZX9A 1UIOA 2WMIA 3N2MA 1RK6A 1JI1A 4K7VA 3QHMA 3F5KA 3E6EA 4LF2A 1LOSA 3AYTA 3GXTA 3QOKA 1UA3A 5G1MA 1TPDA 2PODA 1TYGA 1A5AA 4GX8A 2QJMA 4DLMA 1GYMA 5JUVA 4OKDA 4RL3A 4K38A 5M03A 1F3TA 1F8MA 4ZL1A 5H8UA 1JPHA 3BOXA 5D2WA 5C9WA 2X1UA 5E6ZA 3AISA 1KA9F 1Q6DA 5CBIA 4KETA 3L12A 2EPLX 2GJXB 1N55A 4DBUA 5AYXA 3S9IA 8TIMA 4XSLA 4BI7A 4WOQA 1ITXA 1AJ0A 1I2OA 2JGYA 3ARXA 4LRTA 1EWEA 3W26A 1UR9A 1O60A 3PBWA 3GG0A 1AVAA 2Y88A 3CB8A 3W6YA 1PZ0A 3MPGA 2OLSA 2OXNA 4QSHA 4S3BA 1RA5A 4LUSB 2ZZ7A 3TYCA 3TXZA 4EKJA 1XYFA 4HNVA 5HJLA 4ENLA 5I03A 2VFFA 4A8NA 3T7VA 1G5AA 1M65A 1JQXA 3P67A 3RYSA 2P3ZA 1XYLA 1SJDA 4JTEA 4QHRA 3LHWA 3V0UA 4RV3A 4B4FA 4MIMA 4KBXA 4S2CA 1QNOA 1YEYA 3SM0A 5I3FA 4IFKA 5AC8A 1ODUA 4Z2IA 2WVVB 2YXXA 4UTTC 3W7QA 1TWZA 4LFYA 3P81A 4S3EA 3IK2A 1GVFA 1ME9A 3W1AA 3AHYA 4AEOA 4H4IA 3W82A 1F61A 3R8RA 1E51A 5CBJA 1AH3A 1US2A 4KKXA 5A2AA 3NAVA 3KM8A 4XKYB 4F79A 4J7RA 1DQUA 2RDWA 5LZLA 3UA4A 4NJJA 4V27A 1ECEA 4JTQA 4AZBA 3O05A 1OGBA 2Z27A 1W5NA 3KCLA 4OFCA 2IW0A 4QE4A 1V93A 1OF6A 1DXEA 4HN8A 2PWFA 3A9IA 4JHMA 4WX2A 1TTPA 2CWNA 4H3DA 3OZPA 2A5HA 2DUXA 1E9ZB 2GVYA 2DUAA 1M3UA 4JFSA 4PMVA 4B3KA 1W1ZA 2MNRA 4UMBA 4UCGA 4O4WA 3QR1A 2Y63A 1QOPA 4J3XA 2P0OA 3HBLA 4O1CA 4AEFA 4V15A 2EAWA 1QW8A 5DX7A 4PUWA 1WBJA 1UD4A 3WNMA 1EUNA 4I7UA 4UNIA 1BXNA 1VEOA 1QATA 4CU7A 4NZFA 1R8LA 2XWDA 2PDCA 3A22A 1QNSA 1NFBA 1GPFA 4CD6A 1Q5MA 3H7UA 4WSJA 1X1OA 1KXTA 4GH1A 4DBSA 2JBMA 4RZBA 4LS1A 1Q45A 1OHLA 4ZXLA 2GZXA 2H3DA 5KETA 3BCDA 4TX6A 4KRUA 4M80A 5D2XA 2HQAA 2VGGA 1KC7A 2ZUMA 4A8LA 3ES7A 2QCMA 2BV9A 1QUMA 3SCWA 4DUOA 3PPGA 1MW3A 4IM4A 3BMXA 3TYEA 3EEZA 1TJ1A 2YL8A 4OVXA 1R46A 5HMEA 4ALDA 4I9AA 1A0EA 1QJWA 3LQLA 3NVDA 3NZGA 3B9EA 3L21A 4NJIA 4ZXOA 4QEHA 1V6YA 3O6AA 4GHRA 1BXBA 4ICMA 1OG6A 3TN6A 3VI2A 1B3ZA 3TN5A 4M24A 1WKDA 1IGSA 2FLIA 2PDWA 4AH7A 3ZR6A 5GQBA 1XGEA 5B7YA 2YPIA 1WOBA 4CUCA 5LGXA 2CLMA 3W85A 1RQEA 3TW6A 1LLWA 3BH4A 2FZBA 2DFAA 3S2JA 2AQOA 2WNQA 1HIZA 5T9BG 1QNQA 3IUIA 1PCKA 4P8UA 4E4UA 3RILA 5L9FA 1UBPC 2VEMA 1JYNA 2REQA 4CEXC 4PUEA 1S2WA 1KB3A 1R0MA 2QCCA 4QAWA 3VMOA 2XUCA 5K2ZA 5HJYA 1O7AA 1S3TC 3I4EA 4D8AA 1WZLA 3WNOA 2E7FA 3RMJA 3FJLA 4HSOA 5XIAA 5DF0A 1TSIA 2F6KA 4PUJA 2B7OA 4A05A 1OZMA 3IAPA 3AQUA 5I3DA 1KNWA 4NYYA 1HTIA 4GNKB 4C6EA 2WM0A 3LM3A 2F2HA 4NZCA 3I7RA 4YWSA 1XIHA 5F4XA 3G24A 1Q6QA 4LV9A 4E8GA 3WMCA 3RIKA 4EWND 1M7XA 3PPCA 1L6WA 1E6SM 4JTSA 1K4GA 4ZFCA 4REQA 3RM8A 3F5LA 4IXHA 2J7EA 3MBFA 2PP3A 4NHVA 2J47A 3CUFA 4ONVA 3NZQA 1LUCB 3M07A 2XVKA 1T5AA 1Z42A 3W1PA 3KOXA 2WZHA 4G1KA 2PI6A 4IOTA 2GWNA 4F0KA 4UZSA 3S6OA 4HT3A 5DMNA 4NRSA 3ZO9A 2XM2A 1FWNA 2IKJA 4Q7NA 1NDZA 1HL8A 3UYCA 1H0IA 4OE7A 3TC6A 1N8FA 2E6YA 4KT2A 8RUCA 3N4EA 3EX3A 1TTQA 2VMFA 4P8XA 5LIUX 1A5UA 4TU1A 1GG1A 3RUBL 5I3JA 5DBUA 4C7GA 1J01A 1OCNA 2OU4A 2OOGA 3AHTA 3UG4A 3LGDA 1RHCA 2OPJA 2J24A 3S5SA 3K4DA 3E2VA 1EPXA 3HV9A 5A6BD 1C90A 3MQTA 4N6FA 4KEMA 3Q94A 1NAL1 3UNDA 2CC0A 5LNUA 1R7OA 3GTXA 2CCRA 3WFAA 1G1YA 1QI2A 3C61A 3CS2A 4J2MA 4GO9A 3ATZA 3MSYA 2ISWA 4I9MA 2GOUA 3AHVA 4H9ZA 3ZLHA 2X0YA 4PB3A 2WSQA 4W8BA 4ICNA 3UA3A 3T81A 1XM3A 3RF9A 1OG0A 3F7JA 2ICSA 3C2OA 4FXSA 3B8DA 5EMLA 4ASTA 1ZBCA 3WFZA 3CO4A 1XUZA 3CQIA 2YW4A 3GU1A 1B3OA 2XVPA 5A6KA 4RPQA 2V5DA 4QGCA 3BGGA 3QMRA 4HCHA 4E2VA 3QW3A 3AROA 4KS0A 4W86A 1PDYA 1PKNA 4C6BA 4XVEA 3B0UX 2DZWA 3CUIA 1VEMA 3ABQA 4JDBA 1E0VA 1VHCA 2OGYA 4BEQA 4JX6A 5I0DA 1S5NA 4R7WA 3URNA 1K6WA 3N2TA 3TEVA 1C8XA 1CI1A 3EWCA 1XFBA 1S5TA 4X22A 1P5BA 3W9ZA 3LERA 4AISA 1TVNA 3OJGA 4CNTA 1XLFA 2PMQA 2G3JA 3ALGA 3U2EA 2NX3A 4RJEA 4FOKA 2XSXA 3IVSA 4MYXA 3N9KA 1H4PA 3CM4A 5DMLA 3FKRA 4DJDA 3BURA 4F8XA 4LNYA 3B04A 5CC6A 3CIXA 1Q8JA 4CD8A 4QX4A 3I10A 1T0OA 2VRJA 1DQXA 1FUYA 4UNKA 3MCOA 2Q02A 4J9JA 3MV01 4AX7A 1KGXA 2HS8A 3UNTA 2EKCA 1W9BM 3CB3A 2TODA 5A8QA 1VB9A 1KXVA 1KM5A 3WJWA 2J79A 5DQPA 1IXNA 4PMJA 1DWFM 2BS9A 3HA1A 4PFHA 3JW7A 2WNWA 5F1UA 2XPKA 2Z2UA 5G2WA 3CZKA 4DYKA 2AL2A 3B0PA 4DRSA 5C9ZA 1VBJA 4W8AA 1LWIA 2QXWA 3GXNA 2PGEA 4XD6A 3IJ6A 3V5CA 3EPNA 5JH2A 2WSRA 1UP0A 2QDHA 5FEWA 5MKGA 3NEVA 1B0IA 1LRTA 3CMFA 5AC7A 1R3SA 3NYDA 4PMDA 5A8PA 3QSTA 3NIYA 2PDMA 3W2MA 2V63A 3EX4A 1HKJA 1EEPA 4LAKA 4GZJA 4ERIA 4PCSA 3ABSA 4PEKA 4Y8EA 4BKNA 3GH7A 2EBNA 5FI8A 4QIUA 1G7UA 2JKEA 4E38A 4RR4A 3WEZA 3G1DA 1SJBA 2IMRA 4QBXA 5DN1A 5T26A 3SY1A 1C7SA 2ZRYA 4M51A 1FWGC 5C9UA 5FF0A 1V77A 4QJ4B 1US3A 5D38A 2Z00A 2O4MA 4S3GA 4D72A 1FH7A 1OC6A 1RPKA 4CN1A 2WJDA 1VQTA 3PTDA 2RDUA 3ARWA 2YL5A 2BOEX 4IJRA 3TR9A 5CQ1A 1PIGA 3AWNA 4GO8A 5GPRA 5LIKX 4S3CA 2Y5SA 1LP6A 3JRKA 3VGDA 3RLHA 1ELSA 1KLZA 2OGJA 1G67A 4WIWA 3ZLGA 5G1TA 2B81A 3MP5A 3RDKA 4FNSA 2E09A 4PTVA 3WG6A 2PDFA 1KBIA 1L6FA 3MCMA 4YYFA 3DDMA 2V3GA 2CLIA 4Q4MA 3QC3A 3I3BA 3GVRA 2PGFA 5CGMA 3P3BA 4B9YA 4LUIA 1W9XA 4AZ6A 1SZNA 2CLHA 3HG5A 3C6CA 3HFYA 4XAYA 4XZMX 4FK9A 2O9OA 4L4LA 2YYTA 1UKPA 2G3MA 3CK5A 3LLXA 1KFBA 4FEZA 1OEPA 3AIWA 4MZ1A 4YPJA 3FV9A 4TTUA 3NQ6A 7TIMA 3MUZ1 4IGHA 4MPKA 5K7JA 5KINA 3S9ZA 3EWDA 3MSRA 1ZBVA 1JFXA 4M1RA 5H1WA 4PMUA 1TG7A 1EFZA 4C6FA 1F4HA 4S2BA 1XICA 1CEOA 3O2LA 4GKTA 4WKHA 1XYBA 4TQTA 1W1YA 1ZJHA 4W8LA 4CN4A 1ZQ5A 4PCTA 1IEVA 1NP2A 5HWJA 2FZDA 3PM6A 4FA3A 4JEJA 4UUIA 4Y6GA 1EJRC 5F4WA 4OU1A 3LGEA 5D8ZA 4DNHA 3GH4A 4DUWA 4K8GA 3VGGA 4JQ1A 3PR2A 3MP4A 5LIWX 5TF0A 3VE7A 3KBJA 5DT5A 1DJGA 2Q8XA 2GK1B 1XIDA 4AB4A 4DF0A 2WVUA 1WNOA 1ZLPA 1O4UA 1XCWA 2ZA3A 4CNOA 4UTKA 4YLWA 3E0WA 3FJ4A 5CJMA 1QAPA 2WJFA 4B5VA 3OVQA 5GNXA 1QCWA 4A22A 1OD8A 3UWUA 3NWRA 4EK7A 3PAOA 4AZ5A 4HMCA 3PAJA 2G8ZA 1KFKA 5AYYA 3W73A 5EB8A 3UW6A 1JDEA 2DZVA 5HAOA 1G6CA 3WLQA 3EX2A 2EPKX 1GW9A 3F4CA 4A2RA 1JCXA 3R0DA 3VDGA 4MZ8A 3EEGA 3EAUA 3POCA 1YW1A 3QPEA 3WLOA 2BY3A 1P4CA 1KKRA 2BNJA 2X42A 2ZRXA 3RMEA 1JZ4A 2QLYA 1JJKA 2I9UA 2KX9A 4GISA 3AWOA 4L4PA 1U22A 2VZVA 4YTQA 4DZHA 3EOEA 3ARTA 5REQB 3MBDA 1JDDA 2OX1A 3HMJG 2CLPA 5HQLA 1VCVA 2X1TA 3EOOA 3NL2A 4LT9A 3VDCA 3RNDA 4NY2A 1ZCCA 2OLAA 2I9EA 2XISA 3F2BA 3VTRA 3NL3A 2DSZA 5AN7A 1QTWA 5JIPA 1TV2A 5CPSA 1CGTA 2WV8A 2NUWA 3S4TA 4OECA 3VD5A 2QIIA 3L5AA 2ISSA 1R2TA 1CXFA 1A5KC 3QY8A 3NOYA 1SW3A 4JKLA 1OCBA 1Q6EA 1IGWA 3AS2A 2R6OA 2B31A 2IQ0A 4PC8A 3K13A 4E3TA 1HO4A 3LV5A 2OMAA 4EXQA 4NAEB 4AZCA 2Z28A 2Z29A 1A4MA 3SGGA 1T96A 1AH4A 3WLIA 1O68A 2QQ6A 3BLFA 3R94A 3HPFA 3UXLA 1QW9A 4EACA 2DY3A 4ES4A 1TR1A 3W28A 5M1TA 1U1UA 1A5MC 3RITA 4O8AA 1J9YA 4E2DA 1BHGA 4ZQRA 4LRSA 3B8TA 2PP1A 2WZMA 3BO9A 4TO8A 3V35A 5K9DA 3SSZA 5A8GA 4H8HA 1P6BA 1DJYA 4BHYA 3DENA 3A13A 4J27A 5I78A 2NV9A 3T08A 1NJJA 3O6DA 4ZQNA 5E0CA 1EX5A 2P0IA 4B91A 1TTIA 2O0TA 2WQDA 1ZNNA 5JBDA 3ZLFA 3WNNA 5DCDA 1ZS2A 3UGVA 4GNVA 5LHFA 1T8QA 1B90A 1SFJA 3PPHA 4A8IA 2O4QA 4HU0A 4KCWA 3AU2A 5E1QA 2CLLA 1W37A 4US6A 3N11A 2VC7A 3H7VA 3QGVA 1BD0A 1NP0A 3M6DA 1MEHA 3LENA 3MUAA 1H7OA 4ROQA 1PL9A 4UTJA 3DGRA 3C2VA 3KLLA 4NUWA 2WBGA 5I79A 2GVEA 1P0EA 2VGFA 4TUFA 2VFDA 2J78A 4FPSA 1AQHA 1ISXA 3CPGA 1Q4WA 2E8ZA 5HNNA 4JTUA 2PRMA 4QNWA 3NQFA 4DAFA 4PMNA 4GWEA 2CYGA 1QDSA 3B03A 3A3HA 3T8LA 3BDKA 4JTLA 4D9PA 1UP3A 2PD5A 2GLKA 2PDPA 2PTWA 1PHQA 4XAFA 2QVHA 1RALA 3STGA 1RQHA 1VBHA 4EPEC 5HWMA 1C29A 3GNNA 1XH0A 4YVVA 1K9DA 1NDWA 2QV4A 1OFRA 4QJ1A 3D46A 3EA1A 4MDPA 4CCCA 2YKKA 4JTGA 3EOUA 4QDWA 3BQ6A 2R1MA 1YX1A 3WELA 1E6ZA 1XFCA 3GG8A 1ICPA 5EPDA 5FIPA 2VHLA 5J5RA 3PBGA 3UR8A 3GTIA 2X40A 1Q6OA 1TPEA 4NNBA 2Q71A 5FJRA 3VK5A 5FF2A 2OQYA 4HTBA 3V7PA 3LBCA 1JPIA 4TTGA 3WQVA 1XQKA 3GNPA 3PHAA 5AHNA 4AF0B 3LI1A 1XIGA 2WMJA 1FKXA 2BP1A 4FR1A 4P8WA 1CXIA 3W1QA 4MG4A 3M0HA 1LL7A 4IL0A 4GC3A 5MHBA 1R2RA 2YDSA 3OQEA 4XB3A 3SURA 3T6CA 2F6UA 1YE4A 3S46A 3W2LA 4DO5A 4MPQA 2ACUA 3D0CA 4JYEA 1Z48A 1IQ8A 1MXGA 4H83A 2VOTA 1V6UA 2QHAA 3MDWA 1JD7A 4YN5A 1W9VA 2GPTA 3BLIA 4LF1A 1TJ0A 3WNPA 2D69A 3GDKA 4D6CA 1UWAA 1WV2A 1W54A 2VDGA 3MUIA 3L9CA 5A6JA 2RGMA 2IKHA 1JZ8A 3N2XA 4JN6A 4GQGA 1UH4A 1R38A 2FZ9A 3N2OA 2Q6ZA 3LS9A 1S46A 3TXVA 1IEIA 2VWTA 3TC3A 4G5DA 1UWUA 1OIFA 2ZX7A 4EXAA 1J96A 1ZSXA 3VNKA 4HMDA 4PBGA 3LHTA 3EWWA 3TTSA 3NQVA 2NXIA 3DFSA 1UR3M 3AS0A 3M41A 3FJNA 1EA0A 3DKLA 2I17A 1E1FA 4DY1A 1LRQA 1UKSA 2ZBTA 2CBJA 4P7LA 5AYIA 3RM9A 1JUKA 2D2HA 3OODA 1QPQA 1QBBA 1YPIA 4XUGA 1ZY9A 2QVNA 8XIAA 4R9OA 1MDLA 3R79A 4LANA 1VRDA 3REQB 4HD5A 1JZ6A 3IVUA 1GJWA 4RDWA 3VCCA 2MANA 4MKVA 3NQAA 2OKTA 3LBMA 4D1JA 4JOMA 4XTDA 5HA7A 5HWNA 3R2GA 4QQ3A 3SUWA 4Q8WA 3BG9A 2WMFA 2OTDA 4A2SA 3HG4A 1J0HA 1KFCA 3P80A 4Q6JA 5DLCA 1LROA 4V1XA 2P53A 3VDBA 1LDCA 1SFTA 3TH6A 3W2JA 4WEVX 4A3YA 1IHIA 3O6CA 1XYZA 4OOUA 3OVGA 3PZMA 5D33A 1W3IA 4S3AA 3GXFA 1POKA 3DG6A 1PPIA 1R2SA 4IF2A 3ARYA 3GZAA 3WQCA 4ZQPA 5J5DA 3NA8A 1Z8AA 4ZOEA 2PWUA 2E5BA 1DJIA 2VDIA 4LNCA 2POZA 5CPNA 4GIAA 3NXFA 3OU8A 4MWAD 4RNFA 2QMJA 2C0HA 3NSMA 4A3UA 4GVFA 3H24A 1I2QA 4X3ZA 3GDBA 2PZNA 2PLMA 3TYBA 1UD5A 2Q09A 4DBEA 4Q4QA 1W1B1 3GWQA 3AZRA 5HQEA 4XK2A 5BMWA 4TOQA 4GJJA 1Y0EA 2WMIB 4D6IA 1K7XA 1DVJA 4GE8A 2F61A 1IZKA 4EVZA 1DJHA 3C2EA 3T55A 2YX0A 3MVIA 3H55A 3ABOA 3PZVA 3DHFA 2DZTA 4WJEA 3GC4A 5LNRA 3OEXA 4UFMA 3LYEA 3W0KA 1EJWC 4ZMGA 3HF3A 2VQTA 5GNYA 5I07A 3GIQA 3GDMA 3ITYA 3GE7A 4QNEA 2INFA 5E0KA 3FJ6A 4MF4A 4IICA 3VOCA 2BBFA 3LDVA 2QCEA 3VVGA 4YHGA 2GGEA 5ABFA 2VX6A 1VBUA 4H2CA 4RKAA 5BXSA 3VXGA 4ATWA 4JTFA 2XN2A 5AVHA 3MC5A 3M5XA 3GAKA 3W7KA 4NVTA 4W7WA 4HVXA 4PB4A 1Q2SA 5DMMA 3DUGA 3I7QA 3KBWA 2BFGA 1A80A 4QFUA 3R6IA 3H53A 4JTCA 4QROA 3QEZA 1HJVA 4QE1A 4FOUA 1LQAA 1OSEA 4JYDA 1DJXA 2KAUC 2ESCA 3JVAA 4HCDA 1U83A 3SRFA 4GZ7A 2XIMA 3W7GA 3SUSA 2VEGA 3H8AA 4RV8A 3KTCA 1QOQA 4GYPC 3RO8A 5GNZA 2X09A 2ZADA 3NSNA 1E9IA 4P7RA 4DXXA 1I6NA 2VEIA 5M3WA 3ZZ1A 1R47A 1QRQA 4AU0A 1F74A 1S5MA 3TAKA 4CGTA 3U5YA 1LLOA 2NWRA 4WUIA 1LORA 4BF9A 1XRFA 2NWSA 4Q4SA 4O17A 4S38A 1YLVA 1KWGA 4BWLA 3E1F1 3WUFA 4UFJA 1FTXA 1EJXC 4HU4A 1E6QM 1W3TA 4H6QA 1XRTA 2D0GA 4MZYA 3P2VA 4PBFA 1HFBA 1I2NA 5TBOA 4DVOA 3G3MA 3JZUA 3DI1A 3M5VA 1W3JA 3DBNA 4YMZA 1H7RA 3PWAA 1TPB1 4M81A 1GPWA 2XZ9A 4PRWA 1MUCA 2R1NA 3P61A 3R13A 4GABA 4U28A 3E96A 4M19A 4ZOBA 4CQDA 3AZSA 4QQUA 3HMCA 2Y8UA 3VIIA 4FZIA 2V3FA 4JQ3A 2VJXA 1G7VA 3NO1A 4YHEA 3GNXA 2WHJA 4L6DA 3DC0A 3N4FA 4NF7A 1V6VA 5M5DA 4BQ2A 4YS1A 1V5XA 1JR1A 1J79A 2NUYA 4K37A 2NLYA 1UD3A 1R9YA 1KFLA 1P6WA 1IWAA 3V0TA 4C6NA 1I4NA 1DHPA 2OB3A 4I6VA 3QYQA 1Z6KA 2WK2A 2CHOA 4I9JA 3VOJA 3C56A 5LNVA 4CVWA 1M7JA 2Y62A 1TVPA 4N42A 1FWWA 2XWEA 2IQTA 3BAYA 5J8LA 3DG3A 4F3HA 1VJIA 1MFUA 2VEFA 1WKYA 1LWHA 3OLDA 3OZOA 5HATA 1FDJA 2A7NA 2ZE0A 2ATSA 4NJHA 5FL0A 2CU0A 3V18A 5LNWA 4PUMA 4XWUA 1TE6A 3VZXA 3CAKA 4HBKA 3MWAA 4PYSA 2Q3RA 1W1IE 3GUWA 4GYKA 3VYLA 1B3WA 4CVUA 1D3GA 1KV5A 1CT5A 2WB5A 4W88A 3B8VA 3S6DA 1XI3A 4CCZA 2GGHA 1JG9A 5C55A 1JCYA 1YPFA 3UG8A 5CC7A 4DPQA 3ZVHA 4HU3A 5FJTA 1OFPA 1FWDC 2QS8A 3N19B 2EJAA 4HOWA 4Z1BA 4LH8A 5BNKA 3SCRA 4MB3A 4HHMA 1BRLA 2PE4A 1E9LA 1HNYA 1RY0A 2FPYA 1KM2A 4HNTA 1QPOA 1UR0A 2XHYA 3B9AA 2REQB 3SQMA 5HJXA 3BCJA 1J0JA 2ZUVA 1WZKA 4XD4A 4A4AA 1UHVA 3UBPC 3TK7A 2G3NA 1DXFA 4YTRA 4K3ZA 1NFGA 4R33A 4Q3MA 5BRPA 3GO2A 1C9DA 4TMBA 1D3CA 5BCAA 1TVLA 1U5VA 2G50A 1UROA 2CIPA 4ROPA 1PAMA 3IAQA 1VBGA 3F03K 1TR9A 4XG1A 1XUUA 4X0NA 1PIIA 4DJFA 3ZJKA 3ZOAA 1HGWA 3L2MA 3M0JA 3SRDA 3SUTA 1ADDA 3N12A 1VCGA 4IP5A 1T99A 4MJZA 3VD3A 3OIHA 3W7PA 3WLRA 3U4AA 1VR6A 1V3HA 4H19A 4JTKA 3V4BA 1VLWA 2ONEA 4UTIA 1AZ1A 2VXNA 4WDWA 4CD4A 3HGJA 3A4WA 3TE9A 3QHNA 1HL9A 3WQ8A 1XSJA 1IZCA 1XRVA 4WDTA 1HKWA 3Q45A 3CYVA 4S1FA 3THDA 4EANA 1IIHA 4JTDA 1S2TA 3L4YA 3H4GA 2YZRA 4HCLA 4IP4A 3TQKA 3IK4A 2Z25A 3NO5A 4PRRA 4X60A 2FIQA 1PX8A 2H8XA 3NQMA 3TQVA 1NEYA 1OY0A 4GUIA 4AY8A 1S2AA 3DOPA 4BQ4A 3HPZA 4J3UA 1VPQA 4IQLA 2WMHA 2Y5EA 5A95A 2PUZA 4P5UA 1X97A 1EYWA 3PWGA 2CLEA 3HN3A 3CH0A 3G6LA 1QNPA 3M7SA 1OYCA 4L6OA 5C71A 2HWGA 3O3RA 4RK8A 2YCIX 4O1FA 2OQHA 3M64A 1FCVA 4LXFA 5LA0A 2V69A 2Z1BA 3VMNA 4YYCA 2W9MA 5A69A 1HKVA 3CJPA 1VPXA 1PHWA 3P6LA 1GOMA 1PO9A 5FA5A 3CHDA 1C91A 3TCSA 3EYPA 3R4IA 3DYPA 2D3LA 1PV8A 4M7TA 4EF9A 4M7SA 1EC8A 1SPQA 1LCOA 4LJ3A 4GGHA 4IMEA 2XTKA 2PDKA 5F4SA 3AXXA 3THQA 5DELA 4G7EB 3XIMA 3OP2A 4JTRA 4LUTA 2IPJA 3FEQA 1MNZA 2G0WA 4QITA 3UWWA 5E5CA 1QPRA 5CG0A 1QK2A 2QUNA 1AUSL 2QV5A 1CIUA 3A4XA 2AMXA 3URQA 3MY9A 4RX0A 2J6XA 1TV3A 1UQYA 3A3XA 2ACQA 2Z24A 2FTYA 1HW6A 5G2HA 5ECUA 2A7PA 3GIPA 2ZFAA 3WYZA 1XBVA 4GA8A 2C71A 4AC7C 2FYMA 6A3HA 3T40A 3SECA 2TRSA 5LGZA 1LLZA 1H5YA 4BWLC 4GZEA 4NZ3A 2VI0A 4CU6A 3E38A 3ISIX 3AMGA 4ECLA 1VFLA 3VU2A 2R91A 4AW7A 4LX4A 2FH8A 2OWCA 1ALDA 1XIIA 3GW3A 3DN5A 2DPEA 3CUJA 4TV5A 3S42A 4AYGA 2I14A 4KESA 3VKBA 1HG3A 3IWPA 3PJUA 3UZJA 4JCLA 3EWYA 4MKNA 3SW6A 4FNQA 4QG8A 2E1WA 4Q7IA 4IPIA 4V2XA 3E5PA 4LQ1A 3WLTA 2YCLA 3HQOA 4PRTA 4C6QA 2YBVA 1PVNA 1Y5WA 1SU5A 4PCNA 3LXBA 4F0MA 5C0QA 4FSAA 3PWIA 2VVNA 2FB2A 3HPSA 3NQ8A 2GSHA 3W84A 5CAKA 1GEHA 4JIIX 4UTUA 2A6NA 2J7GA 1RSCA 1ZRQA 4MTVA 3T44A 1OX4A 3ZFHA 1YNPA 1ZB5A 5T9CE 2O9PA 3BICA 4HKPA 2HE8A 3OZYA 3FHQA 3KL5A 2NVCA 4LAUA 1W5OA 2VRKA 3ITCA 4E2OA 4C5YA 4K7YA 3P84A 3S1UA 2VOMA 1M6JA 3W53A 5MKGB 2OZ3A 3WNKA 3H2AA 4DBWA 4H6RA 3NGFA 2YLAA 4IHCA 1R9ZA 3PB2A 3TW9A 4ZODA 3ARZA 3M4HA 1AL7A 1PX3A 3W1MA 1J5TA 1GZ1A 1CX9A 2CLKA 2WCAA 3QC0A 1JZ3A 1E0TA 1FWFC 3QF0A 3I7SA 3LZ5A 3OW1A 2DDXA 5HPOA 1ADOA 3L4UA 3OLGA 4TX9A 1R3YA 4AIEA 2X1SA 4URIA 1RLCL 4H9UA 4GUJA 4AWTA 3VINA 1AFSA 4MY9A 3UPMA 5B80A 4AXKA 2QDGA 1KGUA 2Y2WA 1I2RA 1OT2A 3VNIA 3FXGA 2HROA 1R85A 1DORA 1HKIA 4G8TA 4N4PA 3I3EA 3NM3A 3TWAA 3D5HA 4J3TA 1GQIA 2XJ7A 4FIQA 3O1NA 2PDUA 4B5WA 1RY8A 4M5PA 3UZYA 3PF3A 3SR7A 6REQB 3CQHA 3H2MA 2BASA 2BVDA 4GCAA 5ABEA 3FXYA 3S1VA 1FWAC 3WMLA 1XR2A 2J66A 4ZO9A 4DJFC 7ODCA 1MW2A 1NY1A 4M6QA 4GUFA 4IH3A 2E9LA 5BRBA 2QF8A 1BAGA 1C9WA 3SIMA 3IJ8A 2HJPA 4KWWA 2QKFA 1RD5A 2G97A 1X6LA 3IRDA 5FKYA 1VLIA 2D2OA 1ZJAA 1P0BA 3VKKA 3OO2A 4UMCA 1SZGA 2BY1A 1U33A 4ACZA 1AQ0A 2G37A 3SO7A 3F4NA 1JVNA 3VFLA 3W7NA 3PG8A 1YBQA 4U5KA 5IM51 1OYBA 1P7TA 1PDZA 4WSHA 3EGJA 3SY8A 3RGTA 5H8PA 4IIEA 4O0QA 3LX9A 2XU2A 4R7OA 2B0MA 3SCOA 4DWSA 1KQZA 4Y2WA 1LT8A 1KBJA 1SZFA 2XZ7A 3CT7A 5IHSA 2PGWA 3VUPA 2VC6A 2YA1A 3WIJA 4I6KA 4O53A 3MSDA 4HZ7A 4JAWA 3HPXA 4XIAA 1TX0A 3CHVA 3O9NA 3KOZA 5TD4A 1RCXB 3TNOA 1SO5A 1LBLA 2FPTA 4JL2A 2ZXBA 1BG9A 3DECA 4GIRA 1UZHA 4ZB2A 1FA2A 2O9TA 4M6VA 4E8CA 1X1NA 2AQWA 1LOQA 2J7DA 4S23A 4F9JA 5E9XA 4IIGA 4CNPA 3A12A 4R85A 2YJQA 3WCZA 4JQAA 2IKIA 3EDDA 1VFSA 4AQLA 3LN3A 2I5GA 1MQPA 3WQEA 3W7LA 4FX7A 1F6KA 5CLWA 3PZOA 1QASA 3WH7A 1YQ2A 3EOSA 1J11A 4NASA 5ECVA 4D6JA 3DHPA 3MTWA 1BVWA 4DUXA 4M0XA 2V6AA 1HF6A 3F1QA 1G4EA 2V5LA 1VBRA 2ODOA 3TJLA 4AD3A 4MJ2A 3GTFA 3AAMA 3C0LA 4FI4A 1JXJA 1UUQA 4LOCA 4UC5A 3GHTA 3KVLA 3AXIA 5G1YA 3BK0A 3QW4B 3W29A 4CNSA 3WF0A 1D8CA 3TZFA 4LYKA 1DP0A 2R24A 3U4FA 2WKLA 2VWSA 1SO6A 4L9YA 3HG3A 4EAMA 4F48A 2J7HA 3B8SA 3QGAC 3QQ1A 1DV7A 3CZLA 2PF0A 4MSSA 1KR1A 5TQLA 5E93A 4EPDC 2E4TA 4HSHA 4H6KA 4L1XA 3FGCB 2Y4SA 3ARQA 1DWGM 2FZMA 1OGGA 5FJPA 2OEKA 4BCEA 3VABA 1I2PA 1YDNA 3NEHA 3FA4A 1MDRA 3M16A 1QI5A 4H01A 3MVTA 5BOFA 1FWHC 1V6TA 5HULA 4GK8A 3M9YA 4JTIA 4HPXA 1D9EA 1YHTA 2YA2A 2V38A 1ML1A 1TCDA 3UR7A 4HA0A 1FOBA 1AG1O 1A5OC 5FJOA 4V1YA 1LWJA 3GX9A 3C0SA 2Z7KA 2ASHA 4NI3A 3GXMA 3D47A 3S2NA 5BXRA 5LHEA 1C93A 3L4TA 3RX4A 3LBOA 2INEA 1SQ7A 2QW5A 4MFDA 4BR1A 3OIXA 4Z1YA 2R14A 1WX0A 4EWJA 2F2KA 2HXUA 3WLHA 1M1BA 3QBUA 1QHPA 4AYSA 2BOFX 5DRIA 1CGXA 3VAVA 2QPSA 2E1DA 3PVFA 4XD5A 1GQNA 1DJZA 2QF7A 4O50A 2DSUA 3MW7A 3W87A 2HK1A 2PDBA 3UJ2A 2QJHA 4UTWA 2YW3A 4AD0A 7A3HA 3UWVA 5EFFA 2CITA 3T0CA 1TZ9A 3VNLA 2SFPA 1O5RA 4H9VA 5I02A 3AJ7A 1FH8A 3QH2A 3ARPA 3Q2DA 1WZAA 3WN6A 1GVQA 1GKRA 3NPUA 3R0KA 2QUUA 5D9NA 2NXGA 2RDXA 3ITTA 2XSBA 4ZE5A 1JDAA 1HVXA 1PZ1A 1X7FA 2VRQA 1K02A 3AO0A 4YTTA 1ITUA 2RH9A 1IR1A 4GCXA 3WD4A 3T07A 4ZTYA 2RHGA 5I3HA 4W7VA 2X7VA 4AX6A 5C9XA 2XFYA 2YB4A 3CPRA 3MKVA 4JNYA 4J28A 4NAFA 4DNMA 3DFPA 3CAQA 4D6EA 2BTMA 1LG2A 3L0KA 2AKMA 3KL0A 3CQJA 4JHOA 3VD9A 1J6OA 1H1ZA 3EZ4A 3P60A 1UWRA 1THFD 2OQLA 2WPBA 3ZWTA 5BXTA 1FRBA 2WCSA 3M5ZA 1XRSA 1RUSA 4IGSA 3C2FA 3EMQA 1F07A 3QV9A 4LBUA 4NKCA 1X6NA 3NDYA 3PK7A 1GOWA 3N3MA 3UWEA 2VKZG 1S5VA 4LU0A 4TVCA 1FP8A 3NO3A 1YNYA 4CNNA 1JPKA 4PTNA 4LAOA 1NQKA 1XG4A 8A3HA 3W02A 3S9YA 5I7GA 4HYVA 3I68A 4C7FA 2X0SA 1DQWA 2W79A 4DJDD 1UKOA 2RDTA 1M53A 3ABRA 4MB1A 1E5NA 4YIWA 3T78A 4JBRA 5D8WA 3GK0A 4MKSA 3N1AA 3RLGA 2XSAA 4DWSC 1JAKA 4X2PA 1S5WA 1CGYA 2VGIA 2XVNA 4G7FA 4PCPA 1CZ1A 3VGEA 2DW7A 1NWRA 3NZPA 1WQ5A 5CZ0A 4AIBA 3E2RA 5A6MA 1NOFA 1Q6GA 5D09A 3DZ1A 2O7QA 3W2UA 1ZBKA 1CNVA 4FNRA 1HKMA 3TQPA 3PBVA 4GLEA 3OOQA 4O11A 4KFPA 4C7DA 3R12A 4WF7A 3MJYA 2PWGA 4NT0A 4XBSA 3FDKA 4AC1X 2WNNA 3KBVA 5FD0A 2ZE3A 4RW5A 1BSIA 2XFRA 2G4JA 3O16A 4NI8A 4KWOA 2YL9A 3WQFA 3TU9A 5IFPA 1VFTA 4GI9A 4W87A 3VNMA 4PUUA 3BVJA 2E3ZA 3TX9A 1R7AA 5CZJA 5J04A 5HUPA 3P82A 3K8LA 3G6MA 2C19A 4LUSA 5DANA 4GXPA 1SZEA 2PDQA 4XVDA 1YDVA 2HBXA 3ITXA 3MUY1 3WK1A 1NOWA 2FDMA 1UD6A 1UUOA 1W5QA 4ZFMA 2GQ3A 3AIVA 4GBDA 2H90A 2QPUA 1JI2A 2VTFA 3RM4A 2WVVA 5HNTA 4WJXA 3BV4A 3C0QA 4UOJA 1EEXA 5EMMA 3LUTA 3TYUA 4D1IA 3V0SA 3EPMA 3UY7A 3SUVA 4GY1A 1QWGA 3R11A 4EPKA 5AFDA 3F4WA 3N14A 4XKYA 1W1VA 1JCNA 1OM0A 4DYEA 1GVRA 3W2NA 1LYXA 1E0WA 4C6IA 4GY0A 3VC5A 3UVIA 2ISDA 2DZUA 3QV8A 4RE2A 2A7RA 5AC6A 4JQ2A 1J2BA 2YYUA 2DIKA 1J10A 4XSMA 3RO6A 1RA0A 1DE5A 3CHCA 1XIMA 4HA1A 4B90A 1OFEA 2QGHA 4WDUA 2NQ9A 1BVZA 4NP7A 1AODA 2J6VA 3N15A 1A5LC 4PN2A 4X0VA 1OFAA 4W9TA 3TROA 3L4WA 1LRNA 3B05A 1FCBA 2QULA 2NSOA 3WMSA 5DT7A 1XLHA 2PU1A 2BZNA 1FFRA 1B2YA 3DFOA 3FA5A 3R7MA 3ARSA 3H2NA 3WDHA 3FYPA 4F2UA 2WHKA 1BLIA 2ZZ1A 2F84A 2OX4A 3OLEA 1AW2A 5KZDA 4Y9OA 2D3NA 4AY1A 1AD1A 5HANA 3O07A 1UBSA 4Z2LA 2NQ5A 3CC1A 4NIRA 2OO6A 3TTOA 1JDFA 3ANYA 2HPMA 3N9SA 3UG5A 4TXEA 1SZRA 4DN1A 4UFHA 3VMPA 3PNZA 1XHGA 3BJTA 1EZWA 1JGMA 2WXDM 1FKWA 4PGLA 1EZ2A 2O56A 3FW6A 1LL6A 3WLSA 4UTWC 1KR0A 4OGZA 1AW5A 4UXDA 1BSLA 4F66A 4ZQMA 3WKZA 1XYCA 1EGMA 3K2GA 3O6YX 3CQ0A 3AOFA 2HRWA 1EX1A 4AUBA 3PTQA 2ZXAA 1XLAA 5HR7A 5CGQA 1DJQA 1VYPX 2GDVA 3TLQA 4O28A 5CXPA 1KCKA 1NARA 3GFYA 1K7FA 1ME8A 2H3BA 2HVMA 3U2OA 1A4LA 1GK8A 3VKJA 2HS6A 4FALA 3T0BA 4BFAA 2VNCA 3S1WA 4PUNA 4KQNA 1BKSA 2W91A 4RCXA 3S1XA 1EL3A 3BW2A 2PTDA 4OV4A 3NQDA 1ZAIA 3HQ1A 1W6TA 1A0CA 3LK6A 2PDYA 3GDRA 5C8BB 3WK0A 2A3LA 2XG9A 3ANUA 2A2IA 2Y7GA 4K8HA 1B4KA 2PLKA 1QHOA 3V1HA 3R1ZA 3EKGA 6ENLA 2DUZA 2E40A 4HMEA 4L1WA 3G1XA 3STCA 1P48A 4O1EA 2QYGA 7REQB 2BX7A 4PR4A 3OBEA 1IEXA 3PZTA 1DIDA 1RJRA 1E71M 3G1SA 3ATYA 5GVJA 2JF7A 3PBMA 1CXHA 1UIPA 2CZFA 4K68A 3MUXA 3OLIA 4C6OA 3N34A 1O95A 3G1YA 3UERA 4FX8A 1VIWA 3DCPA 1X96A 3BPWA 3ZJ6A 1KCXA 5D9OA 4C6LA 1W56A 1OB0A 1REQB 1DTUA 2J9ZA 3BSMA 1Q65A 4AFYA 4JX5A 1KRAC 1AMYA 3LU2A 1T7LA 1CWYA 4DHGA 4H1ZA 1GW1A 4NX0A 4KMQA 3TAOA 5C54A 4YU1A 2QZRA 3QY6A 4IX0A 1EGZA 1UASA 3BE7A 2OYLA 1NELA 5BWAA 1E4MM 1R3TA 1TWDA 2FZNA 4C1NA 3L68A 2ISFA 3U2ZA 2DZPA 1K9FA 3DG7A 4QLKA 3N6JA 4XKMA 1FQ0A 4DO4A 4QS6A 9RUBA 1F6YA 2ISVA 5EKYA 1TV7A 4H9MA 4Y7EA 5C7HA 4FLSA 4AHOA 2NXHA 3BG3A 4IWWA 2FKPA 4W5ZA 3TP4A 4KH2A 4O1DA 4RDVA 1H11A 3OTRA 1UP2A 3QFEA 3W1UA 1H7NA 1DE6A 3KTSA 3THUA 2E6AA 1BQCA 1UD2A 3AXHA 4IQJA 3IANA 4C1KA 3VFCA 2OYKA 3L0GA 2BOGX 3DESA 4D6GA 3DHDA 3U3HA 4B2DD 2FPVA 3Q67A 2RJGA 3CV7A 3BAKA 2H6RA 3UFYA 3OGVA 3QM3A 4CQ9A 1KRMA 2PWVA 2GGIA 4AMAA 3FK4A 3UWYA 4HZMA 3MS8A 4ZOAA 2YSWA 3TNBA 2PDIA 4HK6A 3FAXA 3EKZA 3PSVA 5I6SA 1KFJA 1OABA 1US0A 2ZRZA 3IIVA 2TPSA 2DZSA 2Y8KA 1EJ7L 3ZXWA 2BGQA 1H7XA 3MUCA 1K3UA 2PCEA 5IFTA 3AUJA 3OYZA 4LALA 4IL2A 1J0YA 2EJ1A 2ZUNA 2QIWA 1FBAA 3DC8A 3GW0A 1ADSA 3UZZA 4L5ZA 3L66A 5CPQA 3BLLA 3SZ8A 1UH2A 1BRLB 3MO4A 1OD0A 4KCTA 3BAXA 1TWIA 3H4XA 3E9AA 3HOJA 1SR9A 2Q8LA 5I00A 2DGAA 1TFVA 1PYMA 3W1RA 3UESA 3WLKX 4QAIA 4FNUA 4NILA 1D2KA 2O7SA 5HMDA 3RCYA 3U6WA 1G4SA 1XIBA 2GSEA 3N6HA 2B7PA 3GZ3A 3SCSA 2VELA 3U0HA 1HVQA 3H6OA 1AL8A 2R1LA 5GJNA 4NYUA 3WQOA 4FNPA 4LVAA 2IPFA 3ZMRA 2BGSA 4FLQA 1HJSA 1EP2A 1P0KA 1F76A 4XAZA 3UVAA 5A6TC 2DH3A 1BXCA 3LCFA 3WDIA 1WXYA 2WWDA 1ESWA 3FAWA 4UNLA 4HPHA 3R8GA 4H7VA 4LVFA 1VEPA 1J5SA 3DEQA 1XISA 6PTDA 3QZ6A 5KMYA 4B5SA 2FGLA 1J93A 2PS2A 5K3VA 2W66A 3EX6A 3LG3A 3CYJA 4DBDA 1F3XA 3ARUA 4ZGYA 2QCHA 2JFEX 5CPOA 5KTLA 1UMLA 3NR0A 3F4VA 3G1RA 4INFA 4DZAA 2QUVA 5XINA 4DQWA 2PWDA 3QXBA 5F1VA 3W07A 2WZEA 4XZLX 4GIEA 2NX9A 1KFWA 3LEPA 4KF1A 1K6AA 1EGVA 3CV2A 3TN4A 3N6QA 1ZP3A 1AJ2A 3KBSA 1E43A 2V30A 2JK2A 2W92A 1SMDA 1SW0A 5DMYA 3QRHA 2ALDA 3BLPX 2PDLA 1TZZA 3KRZA 3TKFA 3B8UA 3H26A 4DELA 1Q4NX 3R25A 2OG9A 1K4HA 3A24A 3VE9A 1CGWA 1XS2A 4QJ3B 3ZSSA 3TCEA 2NW0A 4XISA 5H8MA 3P14A 1KTNA 1M04A 1MSSA 2OT1A 3MI6A 2Y8VA 1F05A 1WXJA 3KFTA 1BQGA 2YIHA 4R53A 1XD0A 1FWTA 2QCDA 1PX4A 3CIVA 3D6NA 4DXVA 1CBGA 1XV8A 3N18A 4AZHA 1GGOA 1EH9A 3FY1A 3RK8A 1J0ZA 1HL2A 1HUVA 4C6JA 2ZC8A 1TKKA 4OBTA 1V03A 3OQ8A 1XIJA 1PJ9A 3L5LA 4M56A 3GFZA 3ME3A 3N04A 2ALRA 4P8VA 2QJJA 4C90A 1Q7QA 3LHYA 3UCQA 1KWKA 1AMKA 2DORA 4JIRA 3V3WA 1SYTA 1GYNA 2TAAA 4HYWA 3SJ3A 1VYSX 4AD4A 1RP8A 4RPPA 3CLWA 1OFOA 1Y65A 2P8CA 3SUUA 2J27A 1ZENA 1AA1B 1OVDA 2WC7A 3G3DA 3RCNA 4L65A 1VS1A 3ICJA 4LEQA 2PF8A 1HX0A 5F2GA 1MXDA 4TX8A 1AK5A 4NNAA 3WQ4A 4Q8UA 4ZR8A 1NTHA 3WQWA 1T6MA 4MB5A 4LBRA 1W3LA 3LLFA 1TPUA 3W6MA 2DT3A 2HNHA 2HEJA 3WF1A 1YMYA 1ISYA 5D30A 1FHLA 3A4AA 1JF6A 4B16A 3H4WA 2IPWA 3H2EA 3CASA 3OPSA 4HHHA 3AC0A 2B4GA 4LUJA 5AC5A 3VIPA 4LB3A 2V5BA 2OEJA 3AMKA 2EF9A 1EQPA 2YZ5A 1Q6RA 4UFLA 4UFIA 4OUIA 4QEEA 3UZWA 1HZYA 4GG9A 1GVYA 2X30A 4Q4KA 3DX5A 5AKQA 3TV8A 1E6RA 4DI8A 3M0IA 3GTNA 1V3JA 1NFPA 1EC7A 3W7CA 4PTXA 4A3QA 2ZUWA 3QGKC 3RU8X 4GJIA 1OC5A 3W22A 2VCBA 3L67A 4EE9A 2YCLB 4PMXA 2P88A 1YIXA 3IIOA 3SBFA 5LA2A 4U2YA 3UWZA 3TTQA 4MVAA 5TAOA 1E1CA 4LVGA 4UFKA 3AIUA 2VL4A 4JNMA 1WKFA 1BGGA 1LBFA 1U30A 4D2JA 2G96A 3LNPA 2FTWA 1JCLA 1I60A 1LL4A 2H9AA 2X7WA 4LCQA 3RG6A 1UKQA 3UR2A 3A9BA 1KTBA 4RXFA 3W75A 5JBFA 2NV1A 3NVTA 4L7ZA 2INZA 4JGDA 1PXGA 1V7AA 2VR5A 3KP0A 3O06A 2BVTA 1FWJC 4AWEA 4GX9A 1MZRA 1OCJA 1YTEA 4XTIA 1F4AA 1V6WA 2GK1A 4ACYA 3B0VC 2BG5A 4PH6A 4IIHA 4XAGA 2YCEA 2XIOA 1OX6A 5T8GA 3FA3A 1R3RA 1TA3B 4UBPC 1NVMA 2UY3A 3G2GA 5H6HA 3O0KA 4HPJA 3G0UA 5BU6A 4MM1A 3S6TA 3QKEA 4DWDA 2VP8A 3KXQA 1YDYA 3GS6A 3L0NA 3G77A 5KITA 1XPGA 2NQZA 4AIOA 1E72M 5EMYA 3GXDA 1HJUA 1E6NA 1RPXA 1W5MA 3GHUA 3NG3A 3SQSA 5A2BA 1E55A 4ZB0A 1M7OA 3TA6A 1B31A 1DJNA 3C8FA 3CPUA 1EDQA 4C5ZA 5REQA 1JCJA 1DHKA 1RV8A 5FCZA 3PBYA 2WPGA 3P74A 2E6FA 3IJ9A 1N8IA 3R10A 3UXIA 2XIJA 3V36A 4FP1A 3FKKA 1JGIA 3WLNA 4K8EA 4Q8PA 4ML4A 2X41A 4DEFA 1UJPA 2WLZA 3MT1A 3PJXA 3EMCA 2PFHA 2XM1A 5AZ1A 3GBDA 2J62A 1HJQA 3V75A 4OBRA 3IACA 4ACZB 3CIWA 3W24A 4J4KA 1LJYA 2OSXA 3EDEA 3E0VA 3F5JA 4UTHA 1E1EA 6TIMA 2FHCA 4Z0SA 4NAEA 2FMNA 1LOLA 3TTEA 4E4FA 2PAJA 2XGBA 3ZR4A 3W88A 4DZ5A 1WE5A 4G2DA 4FLOA 3WD1A 3NDZA 4OUEA 2X1IA 3ENLA 3T0AA 4UTMA 1YRRA 2ZRWA 2HVNA 2CPUA 3W7EA 1B4EA 5F7UA 3BAWA 1JZ7A 4JX4A 4JKKA 2W5FA 4W4QA 4HYRA 3QMTA 4H8UA 3LSBA 3M0ZA 1XKYA 3IUHA 4A8RA 5EBAA 3TOYA 3CO8A 1EBGA 1POJA 4WGXA 5PTDA 2PEVA 3GR8A 4UIOA 3CUZA 1NQ6A 4RNIA 1J0KA 3N2CA 5CEWA 2GDUA 1EQCA 1FWSA 1K70A 2I57A 3B4UA 2VX7A 2OWXA 4HK5A 3VNYA 1ONWA 3G1HA 3VIHA 4MWAB 3BLOA 3QR0A 4Y9AA 1G0CA 2Y89A 4MDOA 2BXZA 1KCLA 5FF4A 2NQJA 4OQVA 4B3LA 3KHDA 3MI2A 1UOZA 1ZALA 3SCTA 1ICSA 5JMUA 2PDJA 2Y6ZA 3DI0A 6XIAA 3HURA 3ZSTA 2PBGA 1UQZA 1IXOA 2VFHA 2GGJA 4F0RA 1Y5XA 4PBEA 2FMOA 2PA6A 4TMCA 4UQCA 5I77A 1KW1A 1MW1A 2PRLA 2NVAA 3QOMA 1YDOA 3SCUA 5A6AA 2OFJA 2YFNA 3GDLA 4L9ZA 4RXGA 1FP9A 1WZMA 3W23A 4IGNA 3ARVA 1KXQA 4CEUC 8XIMA 5D02A 4DJFD 2QCGA 2V67A 3KRSA 3TW7A 2XGIA 1G4TA 1Q6FA 2XIQA 3K30A 4WXZA 4Q32A 3PN8A 2J77A 2UBPC 6TAAA 1HN1A 2R1PA 3L4XA 3JUGA 1V3KA 2D24A 2VGBA 1M7PA 4US5A 3CUHA 3RX3A 1L6GA 4C6MA 5IDIA 2G5WA 3ZJ8A 4ZVJA 4ZEPA 3TJIA 3ZWSA 5HOSA 1UA7A 2HNEA 2JGQA 1GJPA 3SCQA 4GY7A 1L8NA 4JIQA 4AF0A 1UR4A 1TPC1 3W72A 6CGTA 3UZ5A 3RN6A 2ZUUA 5BU9A 2EPHA 3WBAA 4TVDA 1RVGA 3MJMA 1GVEA 3VIMA 1OC7A 3QKZA 3CL6A 4FXFA 1BVNP 1EP1A 4Q4OA 1KBBA 4LY4A 3AICA 1XG3A 1XLGA 3NZRA 4LY8A 4D71A 3T09A 2EPOA 1VCFA 3CAVA 4B5XA 1IYXA 3ONBA 3WF4A 2V3EA 2QJGA 3THCA 2CNCA 1KM1A 2Y1HA 1IXQA 3HQPA 2J7FA 3CHEA 3S5OA 2YA0A 2C14A 1X7IA 1UR8A 2FGBA 3SN1A 3UPWA 2QJNA 1O1HA 1RVKA 4DJDC 3RLUA 5D2TA 3GU2A 3HGRA 3TDFA 2OVLA 1V08A 1H51A 1UC4A 2VEKA 3B06A 5IRPA 3P5YA 5KSWA 1XWYA 1NF0A 5LIXX 4W93A 3EX1A 1EF3A 1SM9A 3OA5A 2FVLA 2J8TA 1M01A 3MO7A 2ZICA 1X8FA 1WUFA 4PMZA 3S8HA 4LAZA 2BLEA 3CT2A 4K1GA 4CQ8A 1I45A 3WH5A 4IG2B 3AMCA 3ECQA 2ANUA 3GU9A 2NSXA 2W6RA 4CD7A 5CJNA 2PTXA 4PL1A 5F2MA 2POTA 1TRIA 3REQA