2Z6JA

Crystal structure of s. pneumoniae enoyl-acyl carrier protein reductase (fabk) in complex with an inhibitor
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
320
structure length
307
Chain Sequence
b'MKTRITELLKIDYPIFQGGMAWVADGDLAGAVSKAGGLGIIGGGNAPKEVVKANIDKIKSLTDKPFGVNIMLLSPFVEDIVDLVIEEGVKVVTTGAGNPSKYMERFHEAGIIVIPVVPSVALAKRMEKIGADAVIAEGMEAGGHIGKLTTMTLVRQVATAISIPVIAAGGIADGEGAAAGFMLGAEAVQVGTRFVVAKESNAHPNYKEKILKARDIDTTISAQHAVRAIKNQLTRDFELAEKDAFEQMGAGALAKAVVHGDVDGGSVMAGQIAGLVSKEETAEEILKDLYYGAAKKIQEEASRWTGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trans-2-enoyl-ACP reductase II
publication title Crystal structure of enoyl-acyl carrier protein reductase (FabK) from Streptococcus pneumoniae reveals the binding mode of an inhibitor.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Oxidoreductase
total genus 112
structure length 307
sequence length 320
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2007-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03060 NMO Nitronate monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2z6jA00
3OVRA 1G7VA 3IGUA 4OV4A 5FEXA 4N9CA 1MEHA 3I6RA 5G2HA 3LOTA 1F2JA 1WXJA 1I2QA 2V2DA 3FS2A 4AAJA 2ZA3A 2DZXA 2YGYA 3C56A 5A8GA 1LLZA 1SSGA 4KFPA 2EKCA 2VFDA 1FCQA 3EXRA 4ADTA 3W2JA 3GNDA 4KWWA 1TPDA 5DXYA 3TIMA 3HGOA 1W8SA 4PC8A 3UY7A 1SO6A 3HPZA 1H1YA 5CPMA 4HNNA 1V7YA 1AL8A 5I3HA 4RCXA 3CPRA 3CIWA 1W0MA 2B7OA 3ATYA 5EKYA 3W84A 3QFEA 3CEUA 4O52A 1TPVA 1H7RA 1TSIA 3EKLA 4LWWA 1VGAA 4O8RA 1W31A 1YADA 2NLIA 3VE7A 3M5ZA 1KLYA 3DFSA 1GG1A 1MO0A 2X30A 1XUZA 2B7QA 4M19A 1M5WA 4CCCA 5FF2A 3FOKA 2DJXA 1YXYA 2IQTA 3RK8A 3E12A 3RLUA 4FO4A 3L5MA 4O28A 4H6KA 3MYPA 4M7TA 2Y6ZA 4LC8A 2A7RA 2J9YA 3S1VA 3PF3A 3WK0A 3LRLA 2YYUA 3O63A 3F4WA 3QMTA 2FPYA 1NFBA 3L2IA 5FF3A 3TXVA 3O15A 3QMSA 3WK2A 4JX5A 2YSWA 3W1QA 4WXYA 5CSRA 1OX4A 1ME9A 3TMQA 4MOZA 1EWDA 3M47A 1VYPX 3SZ8A 3W7HA 4NX5A 3PB2A 1LOSA 3QW3A 4O50A 4A29A 4O57A 3N19B 2C16A 1ZY9A 2CLMA 5D2VA 3FJ6A 5FI8A 1TJPA 1KTNA 3LHUA 4M7SA 3TROA 3CWNA 3PBVA 1YTEA 3L0GA 4UFHA 1QDSA 1KBJA 4FNUA 4JTKA 3U6WA 5F2IA 3G0UA 2C14A 2HS6A 4Z1CA 2R14A 4NXSA 1L6YA 3W9ZA 3GK0A 3B05A 4LVAA 3USBA 4S1FA 3BLIA 3WJSA 2YW4A 5DBUA 3NPWA 3NQCA 2NUXA 4IMDA 3W74A 3NQVA 5FEZA 2AQWA 4G1KA 4LW7A 5KITA 3EX3A 1JUEA 2NXIA 1DQXA 5BOOA 1TO3A 3PWAA 3HO8A 1EA0A 1H63A 5K7JA 4RLIA 1JCYA 1T0OA 2Q3RA 3UNDA 1OX6A 4ZL1A 1R2TA 3LV6A 5KINA 3GAKA 2DU2A 4JICA 4FB7A 3TFCA 1SW0A 1QNVA 3P61A 3PUDA 4O1AA 1GJPA 1KM0A 5E0KA 1TTIA 1GVRA 1OK4A 4UFJA 2VENA 4O19A 3L68A 1VRDA 2YPIA 4CNNA 2ZTJA 2QCHA 2D73A 3G3MA 2EHHA 2ISSA 3W7NA 4AWUA 1YPFA 4NJKA 5J5DA 5G4WA 3V75A 1G4PA 4MZ8A 3EWZA 3P81A 4NNAA 5AHNA 3KX6A 3EX4A 3GLCA 5AYYA 1H60A 3ABOA 5CZSA 3GR8A 3L0KA 4GUGA 4Z1AA 4JTHA 5D32A 3GXPA 2FJKA 3FKRA 2FFCA 1ZNNA 3CLMA 4DF0A 4IMFA 2P10A 3UWWA 2QF7A 1TV8A 3FFSA 5IM51 3LRMA 3SW6A 1KFJA 3W1LA 3UWYA 5K3VA 3NM1A 3F03K 4CNOA 3MUXA 1ALDA 1TQJA 3HIJA 4UFIA 4U4MA 1TPWA 1F6KA 3MJYA 2E5CA 4DPQA 5HUOA 1ZFJA 4LVDA 2JGQA 3Q94A 1A5AA 1LDCA 3S1UA 2FIQA 4Y90A 4I7WA 1AMKA 1C9DA 1HO1A 3CWOX 4IGHA 5DXXA 5D33A 2V5LA 5AOUA 1IXNA 2OX1A 5G1TA 1I2OA 5CSSA 2I9EA 4UR8A 1O5KA 2H8ZA 3G1VA 4CCDA 1Q45A 3A24A 3HGSA 3PSVA 3W1RA 3MWAA 2FB3A 4YL2A 2XFWA 3LX9A 3NL6A 1YDVA 3TNOA 4JIPA 2VKZG 4O53A 2VXNA 3S1WA 2UV8G 1DV7A 4EF8A 4ZQRA 3VNDA 3B04A 4GC4A 3UY8A 1LRQA 2BXVA 4MJMA 4JR5A 1GG0A 1GTHA 4OWGA 5AC8A 3BW2A 2DZVA 5EMUA 3LHWA 4OT7A 5I3GA 3PC0A 4O13A 3TXZA 3G0XA 1UJPA 2C18A 2W79A 2PRLA 4N9DA 1R46A 4Z1BA 3B03A 3NQ7A 3S5YA 4QITA 3HG5A 2VEPA 3M9YA 4FNPA 2RDWA 3IIPA 2O7SA 2WNZA 1DJQA 4WUIA 1FQ0A 1F5ZA 3NGJA 4UTJA 3W1NA 1RD5A 3NQFA 1EP2A 1ZALA 1KM1A 3PBWA 4JDYA 3C2FA 3W7OA 2VOMA 1TMHA 4TMCA 4N9EA 1PIIA 3BV4A 1H1ZA 1Q6OA 2E6YA 4UTIA 3PBYA 5E1QA 1G4TA 1WA3A 2O7QA 3DFQA 3EX1A 4YCPA 1TPEA 3KVJA 4UIOA 1J5TA 5CPLA 4X9SA 2V30A 1DVJA 1C29A 3PBUA 1QAPA 2ABAA 2RKXA 4S2BA 5DCDA 3WK1A 1W1ZA 4NZJA 4WOZA 4UTLA 3HJZA 4N6EA 3A5VA 3G3DA 1EX5A 1NF7A 3DHDA 1TRIA 1ZAIA 4QQ3A 4A22A 3MHUA 2VFEA 4QNEA 1IIHA 3KAOA 4BR1A 3N73A 3CQ0A 5D30A 4I7UA 3DFOA 1DBTA 4GWEA 3W7RA 3RF9A 4RZ6A 4UNKA 5J5RA 3VI2A 1AK5A 1TTQA 2WNQA 4K37A 3GVGA 3W87A 3N14A 4GUIA 1KM2A 1XM3A 2QUUA 3PB0A 5C6MA 1FX6A 2QDHA 5K4XA 2ZA2A 1X6UA 1O4UA 3LCHA 4Z0SA 3W7CA 4E2BA 1Q6LA 3LERA 3N3MA 1LLWA 1XFBA 1NSJA 1Q6RA 2YR1A 4GFSA 4KFOA 2FPVA 4FIRA 3W2UA 2FDSA 3HG3A 1GVOA 5HR7A 5K9XA 4UMAA 3P60A 4E0CA 5EPDA 1BKSA 2DZTA 1E51A 5IBXA 3ATZA 2BLEA 3NQ6A 4HSNA 1FUYA 1QMLA 4GE8A 5BNKA 3EX2A 2NXHA 3TW6A 3E96A 4LOCA 4AEOA 2ISWA 1WV2A 4FXRA 1ICSA 2V8ZA 4DO5A 4OV9A 1UASA 2YFNA 1KM4A 1VS1A 4AXKA 1B4KA 1C8VA 3TV8A 4QAIA 1F73A 2V5BA 1LTDA 4RR4A 3ZR4A 1JULA 4Y96A 1FXQA 4JEQA 3ABRA 5GVJA 1SFJA 4EIVA 1YTDA 3TCEA 3EB2A 3NDOA 3S9YA 1XDMA 1LZOA 2QCCA 3C4UA 2X1SA 1HFBA 3W7QA 3H53A 4XZ9A 4POCA 1H7PA 2QCNA 4JS3A 1JCJA 2RDUA 4QIUA 1H61A 4WZHA 1H7XA 1I8JA 2A5HA 4BI6A 2FB2A 1OYBA 1EUAA 1YYAA 4N2YA 2ZRVA 3FEMA 1DORA 3MHFA 2C13A 1Q6QA 1AW5A 5I3FA 1MEWA 2TPSA 4UFKA 1FWRA 4LUIA 4OQVA 1XKYA 3FA5A 1EP3A 2PRMA 2KZHA 2DZWA 2NX1A 1O60A 3THAA 2V9DA 3L21A 3NM3A 3SSJA 1F6PA 1ZJIA 3B0PA 1T99A 4GXMA 3A22A 4WOQA 3GX9A 4LT9A 2JKAA 1VJIA 3LCGA 4UFMA 1K7FA 5EBUA 3OIXA 4FXSA 4FEZA 5AYZA 3SI9A 4PFMA 5LGXA 2ZYFA 1KTBA 1OFEA 4X22A 3OVQA 4Y9AA 8TIMA 5LSMA 2Y85A 4JTFA 3LXBA 3NQGA 3DZ1A 3R12A 1ZAJA 1FDZA 2NV2A 2CLFA 1F05A 1G4EA 3C6CA 1ZCOA 3OG3A 1KFKA 4JY8A 1GVSA 4IOTA 2A6LA 2E6AA 3STFA 1XDLA 5G2IA 5AYXA 5I3IA 1K02A 2V81A 3TK7A 5C5YA 2P1FA 1PCKA 3TQVA 3GR7A 3IIXA 3LTSA 5U4NA 3G1FA 3ZWTA 5CZJA 3EWYA 3R2GA 4JYFA 1BWLA 4LC6A 2VFIA 2EPHA 2NWRA 3M16A 3NQ8A 5K9CA 2E1DA 1JQXA 3O07A 2ZTKA 3OVPA 4DXVA 5LHFA 3HOJA 4UTUA 3A21A 4UUIA 5BW6A 1GWJA 2QKFA 2ZQ0A 2Y62A 2WKJA 1MZHA 3DFNA 3PVFA 3P62A 4K8EA 2VELA 2J27A 4UR7A 1S5VA 4HPJA 1LOLA 3W88A 4AH7A 3C2VA 4H4IA 3B0VC 3UZ5A 2NWSA 1VCVA 3K30A 5K9DA 5DCEA 3DBPA 3G1YA 1CX9A 3SGZA 1YPIA 2HMCA 2QCEA 1FBAA 4I7VA 2Y61A 2ZA1A 1U5JA 5CPNA 3W2NA 3W85A 2PCQA 2V0TA 5LNUA 3W86A 3PULA 4UTWC 1TPUA 4JY9A 1TPC1 3C52A 4UFLA 1TRDA 3NO5A 4E38A 1NF0A 4CQ9A 1I45A 3TAOA 3W2LA 5E93A 4XUGA 1H5YA 1HUVA 4NQ1A 5HWMA 4YLWA 4N6FA 4GUJA 3PUEA 2OZ0A 4MFDA 3IRDA 4UTMA 3R8RA 2DZSA 4ADUA 1QPNA 1PV8A 3W22A 3NNTA 2X1RA 1HO4A 4MY8A 3TE9A 5BMWA 1GYNA 4LRSA 4RXGA 3NPUA 1RR2A 2WSQA 3KVKA 4HN4A 2BX7A 3IIOA 1RQEA 1UB3A 3NR0A 3GDTA 1FWWA 4O4WA 3T7VA 2BSLA 2EGZA 1OF6A 4P61A 5KZDA 1OFQA 5CG7A 3S5OA 1B4EA 1CW2A 4WJEA 5FF0A 4O12A 2QCGA 4Z1DA 3NPXA 2JGYA 3GXNA 1G6CA 3NL5A 4MKNA 4NJHA 1H51A 5D04C 1S3HA 4JD4A 3YPIA 1JUKA 3QSTA 4YXGA 4Y6GA 2Z2UA 3MHGA 1VLWA 1K3UA 2DP3A 1WYIA 3MBFA 4NVTA 3TQ0A 1SW7A 2NUYA 3KVLA 3T55A 1LRNA 1Z41A 1OFPA 2QEZA 2ZZ5A 3UYCA 3I7SA 1KFLA 4XBKA 3G8EA 4ORMA 1VHNA 3TDFA 3FLUA 4NNCA 3O6CA 3L5LA 1A53A 1JQVA 3HMJG 1WBHA 1OVDA 3IV3A 1JCLA 3DU0A 3TU9A 2TRSA 5SWUA 3LTPA 4OHQA 1D9EA 4RX0A 1SO5A 4CLMA 4QM1A 1UUMA 4XKYB 4A3UA 1BWKA 3DXIA 4AF0B 1ONRA 4XBSA 3S6DA 4C1LA 1YDOA 4N4QA 3E49A 2WO5A 4O16A 2X16A 3A9IA 1AL7A 3M5XA 2C3ZA 3HB9A 3DAQA 4MUZA 2R91A 2VEKA 1FXPA 2Y7DA 1Z42A 1DKWA 1IXOA 1QO5A 1H62A 2QCDB 1A5SA 1NVMA 3NEVA 3W71A 3IIZA 3GKFA 5DLCA 3EEGA 2C6QA 3M0ZA 3I7QA 3R89A 3TFXA 2CWNA 3W1UA 4PEKA 3PSWA 3SJ3A 1OFBA 2RDTA 4NU7A 2WJZA 2ZZ2A 5KTLA 3WJWA 3IIVA 2PURA 1W3IA 5LHEA 4BWLC 4ADSA 3T4CA 1IXPA 1LBFA 3WJYA 4XTIA 2V2CA 1PL9A 3LBMA 1THFD 4UXDA 4LS2A 1SR9A 1JCXA 3GXTA 1O94A 2GQAA 2YCEA 3NPVA 1OABA 3W3OA 4HNTA 1VQTA 4NX0A 1X7FA 3PM6A 4NZFA 2XN0A 3LCWA 2ZZ1A 3W1XA 4GJ1A 5AC7A 5CZ0A 1JRBA 2Y70A 3LM7A 1TIMA 1V5XA 2H3BA 2A7NA 2YX0A 1SQ7A 4TX9A 3P7YA 1L2UA 1EEPA 5LKYA 2Y89A 1F74A 3HPSA 3KFTA 3QPYA 3STCA 5CPOA 3KRUA 3STEA 5KZEA 2A6NA 3M5VA 2C19A 3PG8A 1HTIA 3U2OA 3DKJA 5D03A 2WSRA 4MLRA 5L9FA 5G4EA 1KFEA 5HWNA 1TJRA 2VEIA 1XC4A 4LS0A 5D05A 2ZDRA 3BVJA 4R53A 3M7WA 3G1XA 1J4EA 4LUJA 1PS9A 3HQ1A 1S5WA 2DORA 3E9AA 3HGRA 5G1YA 3L0NA 3BLFA 3G0SA 3QPZA 2C15A 2X1TA 2AGKA 3P80A 4UTWA 3TW7A 3L5AA 2GJLA 3G22A 1IXQA 2QJHA 2TSYA 3L66A 3QQ0A 3HPXA 4XKYA 1DL3A 1RZMA 4ICNA 4KKXA 2GOUA 3KRSA 1TQXA 1JVNA 1PHWA 1RQBA 2A21A 3G24A 4TO8A 1GZGA 3S8HA 2DJLA 3S1XA 1DOSA 1W56A 1EPXA 2QCDA 3KHJA 1YDNA 3QEZA 3W07A 1OFDA 4AWSA 1K7XA 3GDLA 5LGZA 3SR7A 1HL2A 1LRTA 2ZFAA 4GRSA 4ZQCA 3PG9A 2CZ5A 3LBCA 1TTPA 4TR9A 2CW6A 2Q3OA 5DBTA 3UZJA 5LNWA 1WAUA 5ABTA 3GDRA 1VLIA 3VE9A 1OFAA 2NZLA 3WFAA 1X8FA 3QMRA 2OMAA 3C3NA 3Q37A 2ZRUA 3MP5A 5F1VA 2A1YA 5D37A 2GVGA 4X3ZA 1ZHAA 2VFFA 3OEXA 3TMLA 1R47A 3GB6A 4OE7A 6ALDA 3ZS4A 3FYOA 4ZQMA 3CIXA 5D2XA 3E0IA 4ZVJA 3MP4A 4L4MA 2J88A 4CQ8A 1EIXA 2E6DA 3NQ2A 2I14A 1GVQA 3NXFA 2A85A 4JTIA 3TKFA 3W23A 5T26A 1FWNA 4JTJA 3TSDA 1WOAA 4O4VA 1T8XA 1Q3NA 1K8ZA 4N9BA 2EF9A 4R33A 1UBSA 3SIZA 3LLFA 5CZTA 1SUXA 1VPXA 3W1PA 5FEPA 4O1DA 2WOQA 3W7IA 4CCEA 1TV5A 3NAVA 4OU1A 2GQ9A 5AN7A 3EWXA 1TREA 4YMZA 2Y88A 2YW3A 4WD0A 4FX7A 5AHIA 5C55A 3TC6A 3O1NA 5F2LA 1FWSA 3TUUA 1SZGA 2QCLA 4AMAA 2GVLA 4ONVA 1A50A 5D09A 5L6UA 1QCWA 4FNSA 4DBEA 3THQA 1G69A 5EYWA 1X1OA 1R2RA 3HG4A 4BWLA 1SZFA 3LHVA 2ZBTA 1IGSA 3JS3A 3G1DA 4UTTC 2NX3A 3WK3A 1ML1A 2BTMA 3GAYA 3B8DA 2ZRXA 3S5ZA 3I68A 4IPIA 5DY3A 3DKLA 2Z6JA 3DENA 2JBMA 2E68A 3AJXA 1U83A 3DH7A 4WY0B 3W1TA 2B7NA 1W5PA 5F1UA 3P82A 4EVZA 5LNSA 3A5FA 2WQPA 4JYDA 1D3HA 3W7GA 5HUPA 2Y7EA 4NJJA 5AB3A 3O6YX 1LORA 3NG3A 3I65A 5D38A 1WBJA 2G5WA 4H3DA 4MFEA 4ML9A 2Y7GA 1XCFA 4LRTA 1VHCA 4WY0F 3RU6A 2X2GA 1JJKA 2AAMA 3QC3A 3P5YA 1LBMA 1WQ5A 1B9BA 3HG2A 2YYTA 3GIYA 1BEUA 1TB3A 2CLEA 2J24A 5AHEA 5BMXA 1YTKA 5TIMA 3M41A 3HGJA 3PS7A 3OHIA 5H91A 3IGSA 3BGJA 1EUNA 2OT0A 3MO7A 5G5IA 1UUOA 3C0JA 3BPWA 4IMCA 4NUWA 4ZQOA 4JIQA 1OK6A 5F4SA 4PL1A 4O18A 1P0KA 1DHPA 1LM1A 4BI7A 3EX6A 5F4XA 1T96A 3VFLA 4A2RA 3DFTA 5MHBA 4O11A 1QFEA 3LI1A 1H50A 3JRKA 1K7EA 2J6XA 5AC6A 4S2CA 4MYAA 3CB8A 1A5BA 1GYLA 1IIGA 1XL9A 3LXAA 1TPB1 3EXSA 4O1BA 2HTMA 4R7JA 3B4UA 4IJBA 2QUVA 5DELA 3UWZA 2CZFA 5AHLA 3EWUA 4WQ6A 4DQWA 3OA3A 3QRHA 5K4ZA 1KLZA 3M5YA 5CGQA 2JKEA 1DJNA 2NX9A 4AHQA 3QM3A 3OBKA 5H2ZA 2ZRYA 4UMCA 2YDAA 1KBIA 3O16A 2A4AA 2Y7FA 4LV9A 5AHFA 5EY5A 3S5NA 4KFNA 2CLOA 3C61A 4HSOA 1VH7A 5G2WA 3EWBX 3AO0A 2QJGA 3O8AA 2G97A 4IX2A 4FF7A 4LU0A 1K8XA 1XBXA 3QJAA 3NZ1A 1P1XA 4IX0A 1EB3A 3E02A 3TSMA 3SFKA 4O10A 2CLIA 2ALDA 1EP1A 1GVFA 1I4NA 3NQDA 4DF1A 4WY0A 5TBOA 1KA9F 4UNLA 4XTDA 4Z0JA 3TJLA 1I2RA 3QYQA 2QR6A 4HIBA 3LRKA 3QQ1A 2CZDA 4K38A 4EF9A 3ABQA 4JXCA 1P4CA 3ABSA 3KXQA 1TTJA 3R13A 1HG3A 4K6AA 1W5QA 2G96A 2ZZ3A 3KOFA 1R30A 4DO6A 3CTLA 1W3TA 3FIGA 4O0ZA 1PVNA 3KVMA 4QNWA 5KZMA 2HS8A 2ZZ6A 5I3JA 3NA8A 3W75A 4RJEA 5F2MA 3P8JA 3TJXA 5AFDA 3Q2DA 3BLEA 3BG5A 4XWUA 1LROA 3VKJA 4BFAA 5HQEA 4BF9A 1LOQA 2G95A 1TV7A 1RVGA 3GNNA 3W76A 4AVFA 1GPWA 4DF2A 3B0UX 4R34A 4K39A 1N8FA 3T78A 4UTTA 1W5NA 1SZNA 1LBLA 4P2VA 4UTHA 1L6SA 1M7PA 3STGA 5F4WA 1UCWA 3GDKA 4IPJA 2E09A 2W6RA 3TR2A 1AW1A 3H55A 4UMBA 3P67A 2H90A 4JGDA 3W7MA 1GOXA 4MPQA 4MY9A 5EA9A 2WSYA 4Y8FA 1MSSA 3MI6A 5LNRA 1KFCA 3M43A 3MMTA 1VZWA 4PL2A 1QPRA 1PE1A 4EOUA 1RPXA 2CFFA 4HHPA 1YXCA 1J2WA 3RLVA 5HNRA 6TIMA 3W7JA 1SFLA 1FCBA 4JX4A 2F7FA 2B4GA 4HNUA 3TAKA 4GNJA 5EL1A 1B3OA 2QAPA 1X1ZA 2Z6IA 2TMDA 5LNVA 3L9CA 3O6DA 4GUFA 4IMGA 4MZ1A 1OF8A 3FJLA 1FCVA 3NZRA 4RXFA 4DBDA 2VEMA 1KV5A 2ZRZA 3UWQA 4ORIA 1OJXA 3FKKA 3B06A 1NEYA 3IGXA 5K2ZA 4IXHA 3W70A 1QOQA 1JCMP 3W7DA 2QJIA 1KV8A 4LTSA 5LZLA 3SECA 2XN1A 4PCFA 1WDWA 4LS1A 4JTSA 1A5CA 3LLDA 1I2PA 2FQIA 2NV1A 1FDYA 3C2RA 5HMSA 3U8GA 4ZMGA 3UXDA 3CU2A 3IEBA 3QH2A 4O17A 2J9XA 3G1SA 3T40A 1RQHA 1ZENA 3RNDA 1ME8A 1W5MA 2R8WA 2PC4A 1VYRA 3GYEA 5D2WA 4JTGA 4MZYA 1JUBA 3JR2A 3O06A 1QWGA 2E5DA 3ELFA 1SU5A 4DEFA 3VCRA 3MW7A 3MI2A 4O14A 3HBLA 3NVTA 3V1PA 1PCWA 4ZQPA 2CLHA 2VFGA 3NL2A 3SGUA 1MXSA 1OHLA 1WOBA 1XBZA 1AW2A 2E77A 3RFAA 1NAL1 4GUHA 3DI1A 2PRHA 1QO2A 4M5PA 5F2GA 3BGGA 4AWTA 5IBXC 1Z48A 4DPPA 2FPTA 4OBTA 2ISVA 2ATMA 2E5BA 3IVSA 3W1MA 1BTMA 4FNRA 3DI0A 3UWVA 2QUTA 3A23A 4LNYA 3M1ZA 2A2IA 3ANYA 4K8HA 3NYZA 3ZFHA 1OG0A 3SY5A 1N55A 4FHAA 4NXKA 4IXXA 5KMYA 2PE4A 3TC7A 2WNNA 3HF3A 2X1UA 5BRBA 4AB4A 2VC6A 1I2NA 1KM6A 4LVGA 3W7KA 1TYGA 2YXGA 2RHGA 3RMJA 4TU1A 2A7PA 1SSDA 2ATSA 4NNBA 3MYOA 3N2XA 2Y63A 5HR6A 4WXZA 2QCMA 1SZEA 1H7NA 1KFBA 5DCBA 1H7OA 4OGZA 3BO9A 1F7BA 3UQNA 4JDBA 1XUUA 4C1KA 3F1QA 3FYPA 3UD6A 1GTEA 4BI5A 4U28A 1VCFA 5DY2A 4O15A 1R2SA 3W6YA 5D2YA 4PA8A 4JTLA 4QJ1A 4Q32A 3TA6A 1TPFA 2BWGA 2V2HA 4E2DA 4AF0A 1Y0EA 1SPQA 1OFRA 4MYXA 2CU0A 4GBUA 3NQMA 3LB0A 2BZNA 3S0CA 4QISA 1ME7A 3C8FA 1DQWA 1JR1A 4MIMA 5CKSA 3TQKA 4K36A 2E6FA 4NJIA 3ZWSA 1SW3A 4FNQA 2Z1BA 2YZRA 4O54A 3L65A 2CZEA 3IVUA 3PR2A 1KW1A 4RKAA 5C54A 4NJGA 3LCLA 1LP6A 3P74A 3MBDA 3QW4B 1XBYA 3CEPA 1TCDA 3CT7A 3N9RA 4MLJA 3R5EA 2GPTA 3UPBA 1ZAHA 4JNMA 4L4LA 5FESA 4YWIA 2CLLA 3P5ZA 3CC1A 2TYSA 4A2SA 3D0CA 3LCIA 5FF7A 3CM4A 4IMEA 1PHQA 3PAJA 1FY6A 3P84A 3EWWA 2QAFA 3QF0A 2GVJA 4AHPA 4LVBA 2ZZ4A 2OT1A 3W1AA 5HWJA 3M44A 4AHOA 3W73A 3WJZA 2FLIA 2XN2A 3QZEA 4D2JA 2V82A 1FDJA 1L9WA 3MI3A 5HJLA 5C2XA 3BW4A 1YXDA 4N02A 1XBVA 1GQNA 3F4NA 2ABBA 1OFOA 3W7PA 3CHVA 3GDMA 4M6VA 3W72A 4JTEA 5DN1A 2NUWA 4O0KA 5D02A 3PUOA 4FX6M 5U7SA 3TSBA 3LCFA 3G1HA 3BK0A 3NL3A 4PH6A 2LLEA 4ZZ9A 5KSWA 4K7YA 3LCXA 4NT0A 4PTNA 3IVTA 4LVFA 2H3DA 2J9ZA 2VFHA 4FNTA 3UPWA 4M6PA 4IWWA 4HT3A 5HULA 1OYCA 4LV4A 4A21A 2JKPA 3NQAA 1LCOA 4X2RA 4Q4KA 1H7WA 2FTPA 3INPA 1QPQA 4FX8A 7TIMA 2Q8ZA 3BG9A 4BK9A 2JK2A 4K7VA 1ICPA 2QCFA 5A5WA 5FEWA 5HINA 3GZ3A 3NOEA 2ZZ7A 4RZ5A 4B5NA 2WV8A 3BW3A 2DZPA 1CI1A 2H6RA 1B57A 1O95A 1K8YA 2HSAA 4UTKA 3UWUA 3TX9A 1G4SA 3N2MA 1G67A 3NQEA 4PODA 4EWND 1W3NA 2W0UA 4W9TA 2WPBA 3O05A 4MY1A 2H8XA 3LV5A 1WX0A 2B0MA 3LXCA 2C1HA 4JYEA 1M6JA 3G18A 4JX6A 4ZQNA 2P0OA 1QOPA 2B7PA 4JTTA 2RFGA 1XI3A 2C0AA 3KRZA 1OYAA 3LI0A 4UC5A 1ICQA 5TQLA 2OCZA 2EAWA 3L67A 1G7UA 2YFOA 1M7OA 1LYXA 1VC4A 3LDVA 3P8IA 4JN6A 3DFPA 1QR7A 2GJNA 3BG3A 3M6YA 3LHZA 4HPXA 5FF4A 3WJXA 1W5OA 1SO4A 3DHFA 4UCGA 3H54A 3MP3A 4IQLA 2Z0IA 4Q33A 3BARA 3G8RA 4QSHA 3W2KA 1N7KA 4MVAA 4LY8A 4DELA 3LHYA 5AHMA 4FIQA 2ZCGA 4CNPA 4N4PA 1L6WA 2R94A 1GEQA 3QSRA 1QPOA 4WX2A 2Q8LA 4IUOA 1EWEA 1D3GA 1TPH1 2NXGA 3W2MA 3EXTA 3LTYA 3W7EA 1SO3A 1FCUA 1O5XA 1P0NA 2I1OA 3N9SA 4RV8A 1KM3A 1JRCA 1KTCA 2RH9A 3DGRA 3UXAA 1JCNA 4TIMA 4XQ6A 2GQ8A 5D2TA 5I3KA 4HKPA 4DO4A 1MEIA 1Z44A 2QDGA 1AG1O 2GUUA 3GKAA 3C2EA 3LHTA 3PY2A 1ADOA 4RZ4A 3W7LA 1KM5A 4KWVA 1OX4B 4I9AA 1IF2A 4TMBA 2A0NA 1W37A 1XXXA 1VYSX 4CQAA 3G1AA 1S5TA 1YLVA 4YCOA 3S42A 3TH6A 1FWTA 2DZUA 2OJPA 3I7RA 4Z08A 4MJZA 3C2OA 3Q58A 1F76A 4JTUA 4O1CA 2ZRWA 4RK8A 4ALDA 2CLKA 1W54A 1P5BA 1VR6A 1GT8A 1VCGA 1RV8A 3N34A 1K03A 3LGEA 3T44A 1OX5A 4M6QA 3W83A 3EKZA 2F84A 4J9JA 4HNVA
chains in the Genus database with same CATH superfamily
1G7VA 4L1WA 4OV4A 3AXIA 3LOTA 4QP0A 2O9PA 4AAJA 3B0YA 4A6GA 1SSGA 2PF0A 1KRCC 3L4YA 3VOCA 1TPDA 5DXYA 1GKRA 3FVDA 4GKTA 4F48A 4PC8A 3UY7A 5JIWA 1S38A 4RCXA 4HHLA 4IIHA 1W0MA 2B7OA 3MTWA 3P14A 4GPNA 3ARWA 3CEUA 2WVVA 4O52A 3EKLA 4LWWA 1H2JA 1VGAA 1TV2A 3PWIA 4AY1A 3UFYA 2Z1WA 3DFSA 3AI0A 2X30A 2VVSA 4CCCA 2DJXA 1UPMB 1TELA 2BGNE 2IQTA 3SQSA 1E0XA 4D6EA 4O28A 4GYJA 4HMEA 4M7TA 4XAYA 3AMDA 2A7RA 3S1VA 4C7DA 3O63A 4GIAA 3VIOA 4AZCB 3HA1A 2G50A 3L2IA 3O15A 2VX7A 3QMSA 2INZA 4QE4A 2YCJA 1OX4A 3TMQA 4MOZA 4XSMA 1RJRA 1VYPX 2EXOA 3KEHA 4REQA 2HV5A 3UBPC 1Y7VA 5A6MA 2IXVA 3EEZA 1DWAM 1E9LA 2V5JA 4PUMA 4DBWA 3TW9A 2C16A 1X8CA 2CLMA 4YTRA 5D2VA 4FA3A 2CNCA 3GZAA 3T42A 1NH6A 3CWNA 3PBVA 4UFHA 4Y2WA 4Q4OA 1KBJA 4QDMA 1A5OC 1FHUA 1W1A1 3G0UA 2C14A 1PO9A 1C90A 1HGYA 2HS6A 1TVPA 1NELA 4LVAA 1W9DM 4NY2A 3WJSA 1Q7MA 1YNQA 5DBUA 4WSKA 4Q8VA 4IMDA 5C9ZA 3NQVA 3WKZA 3OO2A 1JUEA 4R3UA 3CAWA 3V36A 9CGTA 1DQXA 4BKNA 3F4VA 4PMQA 4RNIA 3R0KA 4M82A 1CZ1A 2O4MA 3JVAA 2ZX5A 1T0OA 2Q3RA 4B92A 1OX6A 4ZL1A 3LV6A 5KINA 1FP8A 3FW6A 2J7BA 4HOXA 2FGBA 2HPIA 1QNVA 1GJPA 4ROQA 4Y7EA 3O6AA 1KM0A 3REQB 1GVRA 1KR0A 2YPIA 1RK5A 3G3MA 2D73A 3WQCA 5BWAA 2EHHA 2ISSA 4IFKB 2WAGA 3CV7A 3V75A 3LGDA 3EX4A 1T6MA 3ERPA 4M1BA 3CUXA 1OG6A 2V5CA 1QHOA 4LCRA 2FJKA 4ZXOA 2CBIA 3FKRA 3MUY1 2FFCA 1ZNNA 3CLMA 4GIRA 1X39A 4HZ6A 4LXFA 1FKWA 4IMFA 2XG9A 2QF7A 3FFSA 3UWWA 3WNMA 4AZCA 5ABGA 1KFJA 3UWYA 3NM1A 4CNOA 1XPYA 4GY0A 4BEQA 4JNZA 2XH4A 4E8GA 1R0MA 2YB1A 4AZ5A 4DJDD 1REQB 4BCEA 5A6KA 1H4PA 4JZ5A 3U0HA 1K4GA 1PDYA 3RCMA 3MKKA 2AL1A 3PPGA 5C9WA 1PIFA 1G9HA 3WUBA 1CB7B 2UY3A 2BHZA 4I9TA 3ZSTA 1HO1A 2YKKA 5D33A 5CPTA 1BVNP 1UD2A 5A6BD 2HVNA 3LG3A 1I2OA 2FHBA 2PP0A 1L6GA 4HA0A 1GZJA 3W1RA 3CASA 3MWAA 3K1GA 2WCSA 4QAWA 1UWRA 2XFWA 4L61A 2QT3A 4IF2A 2XH7A 1DWHM 4ZE4A 2XFFA 1B5TA 1DV7A 3QBUA 4AD2A 4ZQRA 3VNDA 4GO8A 3W01A 3VKBA 5HQMA 2D1ZA 1ENUA 1FVPA 1JYNA 2WK2A 5XIMA 4W86A 3SCSA 5EMUA 3ABXA 3MSGA 4DBUA 3G0XA 2GJXB 3L2MA 1ISYA 2C18A 3IJLA 4QDWA 2A3LA 2ACRA 1JZ3A 1AMYA 4IIGA 1E6RA 2WWCA 1ISZA 2O56A 3RDKA 3IIPA 3REQA 4S3EA 1DJQA 3H70A 3W1NA 3NGJA 3NQFA 3PBWA 3C2FA 3W7OA 4TMCA 1TKKA 1XIMA 3BV4A 1H1ZA 1Q6OA 1S2AA 5BZAA 3AHVA 3PBYA 3PHAA 1UKQA 3VNZA 4X9SA 4D71A 1AJ2A 1C29A 4US5A 4QJ3B 1UR9A 1NU5A 2ABAA 1WKEA 2X42A 4S2BA 2AL2B 1SGJA 1QXLA 4N6EA 4ATWA 3KL3A 2PD5A 1HXJA 3GY1A 2CHNA 3BAYA 3CTTA 3GTIA 2Z24A 3WD0A 2VO5A 1ZAIA 1HKIA 3PPHA 2ZX7A 2XGBA 3MHUA 2VFEA 4QNEA 3KAOA 4BR1A 3CQ0A 3GIPA 3FGCB 1ZRQA 4GWEA 3C0LA 4C90A 5GPRA 5H8MA 3W7RA 1UKTA 3RF9A 1EO5A 4RZ6A 1UIPA 3GVWA 1TTQA 3KZSA 4HYWA 1XM3A 2DW7A 2QUUA 4HN8A 4S3KA 5ABHA 2HDJA 3WENA 4F8XA 3WQ5A 1KXHA 4JQ1A 3PPCA 4Q8OA 3LCHA 2XH0A 4E2BA 3LERA 2NVDA 4DB7A 1Q6RA 3UU0A 1MW2A 5K9XA 1DWIM 1ZJBA 5E5CA 4Q6XA 3P6LA 4E0CA 1K4HA 1BKSA 1E51A 3ATZA 3AU2A 2ACQA 4GE8A 4PB5A 1CGVA 4AEOA 2ISWA 1WV2A 2DT0A 5I6SA 4WRHA 2NLYA 4DO5A 2YFNA 2J8TA 1VS1A 4AXKA 1E5NA 3B8TA 4J3SA 1QPKA 3H2EA 3ZR4A 1VIWA 3EDJA 4CVUA 2IPWA 1FXQA 3ABRA 2DT1A 4S3CA 1X6NA 3W02A 4H6EA 3RIKA 3E2SA 2XUCA 1R3WA 1XDMA 8XIAA 2P3EA 1E4NA 3W7QA 1H7PA 3T9PA 2A3BA 2TAAA 1GOWA 4QIUA 1IEIA 3EYPA 3BICA 2XSXA 2FB2A 2PDLA 1OYBA 4GFIA 1YYAA 2ZRVA 3OOQA 1M53A 2POTA 4UFKA 1EBHA 4F66A 4OQVA 3TN5A 1BQGA 5D4YA 3NVDA 2KZHA 2V9DA 1SR0A 3L21A 1Q6CA 4GXMA 3WH7A 3A22A 3CK5A 4LT9A 4EWJA 2JKAA 2WW5A 5HMEA 4NRRA 1K7FA 4Z2KA 2VR4A 4FEZA 2J79A 3SI9A 2V3EA 5LGXA 2ZYFA 3HTWA 1OCNA 2VD8A 1TX2A 1XGZA 4GI6A 4GIYA 3GFYA 4BF5A 3LXBA 3R12A 2R1LA 1ZAJA 2QF8A 1KBBA 1XKJA 1FDZA 2FZNA 2GGJA 3O9NA 2QIIA 3KW3A 3OG3A 5J8LA 1KFKA 2C8NA 1KXQA 2OWWA 1UYQA 4IOTA 2A6LA 1MQPA 1XPGA 3H7RA 1ZQ5A 5G2IA 3TK7A 4NZ1A 4WR3A 4E4UA 2Z26A 1J18A 2ZC8A 4Y9MA 4PMDA 3CJPA 3GR7A 3LTSA 4LALA 1UG6A 4JCLA 1VF8A 3G1FA 4GI9A 5CZJA 1BWLA 3A3WA 2VFIA 2Z29A 1FFRA 2WBGA 1KO0A 3NQ8A 2E1DA 1MRAA 4DXVA 1QRQA 4UTUA 1OIFA 1D3CA 1LF1A 6XIAA 2QKFA 2Y62A 5BOEA 3ZMRA 1LOLA 3W88A 1IZKA 3EDEA 3H2CA 2E0PA 3PUGA 1JZ5A 3K30A 4GCAA 1YPIA 3LMYA 3U2ZA 4P5UA 5FJOA 3CUHA 1TPUA 1TPC1 4PZVA 4GY1A 4ACYA 1I1XA 1W9BM 1C7SA 1XQLA 4CQ9A 1I45A 5TAOA 1CXEA 3VU2A 3BL3A 4NQ1A 5HWMA 3GBDA 1LT7A 3UZZA 3IRDA 1J6PA 4LPCA 4UTMA 4QG6A 3R8RA 4H8UA 1VFHA 4Q7BA 1KBLA 2Y5JA 1PV8A 3NNTA 2X1RA 2D23A 1HO4A 4MY8A 1NWSA 1V79A 2J8GA 5BMWA 3WLSA 1GYNA 4LRSA 1RR2A 2WSQA 4HN4A 2VGBA 1KQYA 1RQEA 1BYAA 1HZYA 1EJTC 4H9VA 1FWWA 1OB0A 3M0HA 3T7VA 2BSLA 1JZ4A 2CERA 4I8DA 4IISA 3VUPA 3A12A 3BWWA 2HZGA 2Q71A 1D7FA 3CUFA 3NPXA 1G6CA 2J7FA 3T6CA 4JD4A 2VI0A 3DFYA 5I06A 4QE5A 1CXHA 3QSTA 4YXGA 4Y6GA 2Z2UA 2DP3A 1BF6A 4F0HA 3WH6A 1QUMA 2NUYA 4UZSA 1VFUA 1A3WA 1Z41A 2ICSA 1JNEA 4XBKA 3WDIA 1VHNA 4IHCA 3L5LA 3HMJG 1K9DA 1Z9AA 1JCLA 4C7FA 2QULA 4H8NA 5A95A 1HQTA 4OHQA 4RX0A 2OG9A 1DJWA 2DIEA 4A3UA 1V3IA 1ONRA 1W1TA 3E49A 2C79A 4KCUA 3WF3A 2NQZA 3BLLA 3WLQA 2ISDA 4ZOEA 3DAQA 3MUAA 2VEKA 1FXPA 2YXXA 1DKWA 1X1NA 1H62A 1NVMA 3W71A 4WGXA 1WZLA 3IIZA 4MG4A 2XSAA 1A5UA 3ZT6A 3TFXA 4NRSA 4NU7A 2ZICA 2WJZA 1S1PA 1UH2A 2EPKX 4JKMA 3M0KA 1N8WA 3TZFA 1CLVA 4XZBA 4BWLC 1S46A 1DIKA 4QCFA 1PL9A 3LBMA 4LF2A 3APTA 1JCXA 4GY7A 5PTDA 1VJSA 1OD0A 3GXTA 1O94A 4E8CA 2GQAA 1BYCA 4A8LA 1XLKA 4NX0A 3AS0A 2XN0A 3MS8A 5CZ0A 1JRBA 3R0UA 4PCNA 2Y70A 3LM7A 1YEYA 3HU7A 1VJZA 5C8BB 1SQ7A 1UROA 4XAZA 5FKYA 1L2UA 2VZVA 3HPSA 3JZUA 1VEOA 1M1BA 5KZEA 4IGNA 2A6NA 4E5TA 4CCZA 2WSRA 1XC4A 1RA5A 4LS0A 5D05A 3S1GA 2PWGA 3M7WA 4JFWA 3TVAA 2RAGA 3G1XA 1J4EA 4RE3A 1E1EA 1LWJA 1XLIA 3L0NA 4US6A 1WDPA 1LUCA 3G0SA 3QGVA 4GLEA 3HQPA 4X0VA 2X1TA 4JHZA 5AECA 1VKFA 2XU2A 4PBGA 1DE5A 3HM7A 3LU2A 1RPKA 3BE7A 2NQ5A 3UT0A 3QQ0A 2QV5A 3W4RA 1DL3A 3ZXWA 1RZMA 3URAA 2J74A 4FLSA 4KKXA 2GOUA 1JVNA 1OT2A 4HTBA 1GZGA 4S3DA 4D6IA 1UHVA 3WF0A 4L7ZA 3LEPA 1LQ0A 3VCCA 3WDRA 4Q7IA 1W56A 3LA4A 4TVCA 2VTFA 3UXIA 4FLOA 3B3DA 1YDNA 4M81A 4PRRA 1TX0A 1OFDA 1CTNA 4AWSA 1K7XA 4DLFA 3M64A 4YTQA 1HL2A 2O9OA 4GRSA 1NQKA 4TR9A 4WEVX 3EDKA 1ZBKA 5LNWA 3TTOA 4IPNB 3D3FA 1DE6A 1H49A 3CQIA 5LIUX 3WFAA 4AC7C 3K4AA 1V3JA 5DRCA 5JH2A 1DTUA 2VRQA 3ITOA 4PUWA 1XIGA 4DXXA 1GEHA 5F1VA 2JEPA 3GS6A 4S39A 4CU7A 3H7VA 3AJ7A 5ABFB 3TMLA 1R47A 1RH9A 3CIXA 3E0IA 2UZ9A 3ZJ6A 3MP4A 2J88A 1BTCA 2E6DA 1AA1B 2I14A 1GVQA 3QY7A 4Q8UA 4L5ZA 4PCPA 4EKJA 3W23A 1FWNA 4O4VA 3FXYA 3UJEA 3OQ8A 4R33A 3EPMA 1VPXA 5FEPA 4JIRA 2R9RA 5G4HC 2GQ9A 4GG9A 1HJQA 3WCZA 1V02E 3ID7A 2YW3A 2DVUA 5AHIA 3NUKA 2QCLA 5D09A 3M0JA 1XYCA 4FNSA 3T07A 5IFTA 4LYQA 2CITA 1G69A 4JCMA 3TYDA 4BWLA 3N17A 5IDZA 3LHVA 3G1DA 4UTTC 3VCNA 1ML1A 1O6IA 1WO2A 1XR2A 4IPIA 3DKLA 4LY4A 1E4LA 2P50A 4FI4A 4QGCA 3UJRA 4ZB2A 1I75A 1PYFA 3RX4A 4WY0B 3CL6A 3W1TA 5HBFA 3BLDA 1W5PA 5F1UA 3P82A 3LYEA 3UVAA 1OC5A 3VNIA 1SJBA 2X0YA 2ZUMA 2WQPA 1D3HA 2BVTA 3W7GA 2Y7EA 5EBAA 1LORA 3NG3A 3VUSA 2V38A 3ONBA 2Z4GA 4ML9A 4WY0F 1BSIA 1C8YA 2R1KA 1CCWB 3TN4A 2X2GA 4MMWA 4OECA 1RP8A 3P5YA 1LBMA 3HG2A 2O9RA 1BEUA 1TB3A 3ANVA 5BMXA 1YTKA 2VRJA 2F9RA 3PS7A 8XIMA 3BGJA 2OT0A 5G5IA 4L56A 5D9MA 2EJ1A 4GXWA 1TZ7A 2XIJA 2OO6A 4JIQA 2FZDA 3VNYA 5I3DA 1U2YA 1NDVA 4A2RA 5HPCA 3SCOA 3VIMA 3QV6A 2PU0A 4S2CA 3BOXA 1GYLA 1IIGA 3LXAA 1BVZA 4R7JA 4DI8A 3T0TA 2QUVA 5DELA 3EOLA 3EWUA 4GMEA 4WQ6A 4GQ0A 3WUEA 3WIJA 4DQWA 3QRHA 5K4ZA 2RGLA 1ZUAX 2ZRYA 3EMZA 1XLAA 4M3PA 1KBIA 3O16A 4GKLA 4XZWA 2Y7FA 5FJPA 4HK5A 4LJ3A 4Q4RA 2O0TA 3KTSA 3BSHA 4V28A 2GOKA 2QJGA 1DP0A 4B4HA 1BF2A 1M41A 3NZ1A 1P1XA 4IX0A 3TSMA 1V6WA 2YCKX 4QXIA 2XWDA 3W81A 4WY0A 4UNLA 4XTDA 2BY3A 4HA3A 4PUUA 4RL3A 3QYQA 2Y5SA 3QQ1A 5C2GA 1H41A 2VC5A 1NOFA 4JXCA 2UY2A 2ZXQA 4K6AA 3RPDA 1IEXA 4PMVA 4UR9A 4S3AA 2YCIX 4US5D 1SMAA 5DT5A 2ZX6A 1POJA 4BQ5A 2WMKA 4HB7A 3KWSA 3MC5A 3P8JA 4WLCA 3SRDA 5E9AA 4GZIA 4IQDA 1E6ZA 3N6QA 3AMGA 2ZUSA 4AU0A 2Z1KA 4AVFA 1GPWA 4R34A 4K39A 3MWCA 4UTTA 2GYIA 1LBLA 4HMDA 3IAQA 3NZQA 2YLLA 2VZSA 3STGA 3IS4A 4IPJA 4TX8A 3OLIA 5A8NA 4UMBA 3QGKC 2H90A 1GOXA 3NO1A 4MPQA 3W6MA 2WSYA 4YTSA 1MSSA 4GQQA 3K2GA 3PJXA 5LNRA 1KFCA 2DH2A 3WUGA 4HA4A 1SZRA 2QXWA 1YMYA 1YXCA 3TOYA 3P3BA 6TIMA 1SFLA 4S38A 4RDVA 3TAKA 1B3OA 2INEA 2TMDA 3SCQA 3EDDA 5HATA 5XINA 4IMGA 4MZ1A 2GJPA 1FCVA 4RXFA 1OCQA 2OKOA 2ZRZA 4ORIA 1OJXA 5I00A 4E3VA 3PTMA 3NIYA 2A3HA 1UZDA 2QJIA 4LTSA 1JAKA 3SECA 3UJFA 2XN1A 3B97A 3H23A 3TTYA 4PCFA 2XSBA 2IPGA 4D72A 4JTSA 1J6OA 3LLDA 1UH3A 2FQIA 2NV1A 3C2RA 5HMSA 4B5XA 4ZMGA 1NOWA 3CU2A 1ZTVA 2Z27A 4O17A 4AQLA 1HVQA 3G1SA 4U2ZA 1ZENA 4RPPA 1ME8A 1DJZA 3WZ0E 1W5MA 2R8WA 5D2WA 2BOEX 2BFGA 3MO4A 1JUBA 3ITGA 1NWRA 4DEFA 2D24A 1SU5A 4O14A 4NAFA 6PTDA 3NVTA 1PCWA 1AD4A 4H7CA 1OHLA 3TN3A 1AW2A 2E77A 1TJ2A 2IQDA 3DI1A 2PRHA 3CL7A 2VGFA 5IBXC 1UC4A 5BROA 2E5BA 2OQYA 4E8DA 3IVSA 1UOZA 2GDVA 3D6NA 5H8PA 4AD1A 4QFUA 4KGJA 3SY5A 1KBKA 1UZ1A 3BLOA 1N55A 1V3HA 4DYKA 4FHAA 3BV7A 4IXXA 3GVVA 4IQEA 3CMGA 3TC7A 2PDPA 5GNYA 2WNNA 3HF3A 4PRWA 2ZVRA 1CEOA 2VC6A 3UETA 1I2NA 5RUBA 4M1RA 2ESCA 4M6UA 3RMJA 2RHGA 3WD4A 4A3YA 4DVOA 3ZVHA 3MYOA 4KEZA 3N2XA 2Y63A 1JI1A 3WQ8A 5GQBA 3CAVA 1H7NA 1KRAC 2RJHA 4DZ5A 3WLPA 1KFBA 1NFPA 1H7OA 5DCBA 4RDWA 2DY3A 3UQNA 3F1QA 1P7TB 3FYPA 1IT7A 3UD6A 2HEJA 4ZB0A 1W32A 4FOUA 3TTQA 3WH8A 1VCFA 3WFZA 5DY2A 5CBBA 3BSGA 3GDBA 3W6YA 4QJ1A 1H11A 1XH1A 1TPFA 1HX0A 4I9MA 4EXQA 3S2MA 2V2HA 2AOSA 3GG0A 4E2DA 1UKOA 4HOWA 1SPQA 1JZ6A 1BPLB 4DAIA 3WNLA 4OOUA 4QHRA 2CU0A 1WDDA 2RDXA 3FA3A 4QISA 2VWSA 4FOJA 4PBEA 3RITA 3K8LA 2EEXA 4MIMA 2PGWA 4KIRA 1HKVA 4FNQA 2Z00A 3HZ3A 1VFOA 1F8IA 1MW3A 4XIAA 3QW4B 4KCWA 2Y24A 4PULA 4JNMA 1F61A 3CQJA 3FY1A 3P5ZA 4TQTA 1E15A 5D9OA 2HBXA 1RVKA 3RM4A 3R4IA 3BH4A 4LAKA 4DUOA 3QF0A 2D3LA 3CZEA 2RJGA 3W73A 2JE8A 3QZEA 1YW1A 1FDJA 1TZZA 3MI3A 4MB4A 3BAWA 3V16A 5C2XA 1XBVA 4R85A 1UC5A 1A49A 2G4FA 3F4NA 1OFOA 3W7PA 4AWEA 4ZSUA 3IJQA 5DN1A 5I0DA 1NFGA 4O0KA 5U7SA 3TSBA 5CAHA 3G1HA 3NL3A 3PZTA 2HVOA 3R11A 4ZZ9A 2DDXA 4LVFA 3PJWA 1SVDA 4UBPC 4HHMA 6CGTA 4J40A 4FNTA 1P7TA 4HCHA 3RXZA 4LV4A 4ATDA 3NQAA 1EGZA 4UQAA 4Q4KA 3VIFA 1TG7A 2FTPA 3POHA 1TE1A 2V67A 4XD3A 3VGEA 2QCFA 1S5MA 2WVTA 3S9IA 3NJ3A 5HINA 3G5EA 2QYGA 2WV8A 3UF9A 2DZPA 1O95A 4UTKA 1G4SA 3N2MA 2R6OA 3QR3A 3GRIA 4PODA 2WNWA 1XYFA 2W0UA 3PFRA 4PYSA 3V18A 1J79A 3QOMA 4JX6A 2OLAA 1GOQA 4JTTA 4HU0A 3KRZA 5HPOA 2R82A 1YKWA 3ABZA 3SEPA 5BXPA 3CZJA 1Q7QA 1QHZA 4JN6A 3S6TA 4C1NA 4J2MA 3CMJA 2XYLA 3DHFA 2VCCA 3H54A 3MP3A 3T81A 4F0LA 4CEXC 2Z0IA 1MQQA 1RLDA 2G41A 1N7KA 2G3NA 1SFSA 4DELA 5AHMA 2Z1XA 3VGDA 3C5QA 1RAKA 4B3ZA 2R94A 5M1TA 3VDCA 1F6YA 1XLBA 2XM1A 1G5AA 1W3JA 3W2MA 1SO3A 3QR0A 4WKAA 4Y9PA 4QE1A 3RU8X 3V1HA 1PTAA 3WF4A 2I1OA 4QCEA 4RV8A 3SCNA 1UPPA 3U9IA 4HZ7A 2RH9A 3UXAA 1JCNA 4ICMA 4TIMA 5D2TA 2WLYA 4B15A 1TE6A 4D1JA 4C6JA 1Z44A 1AG1O 3MCNA 3C0QA 2WB5A 1A0DA 1XIJA 4TTGA 1VFMA 2WHMA 3LHTA 3W7LA 1KM5A 3GM8A 4I9AA 1FHLA 2WMGA 4OFCA 4DJFA 1YLVA 5HQLA 4YCOA 3TH6A 4IL2A 1FWTA 2DZUA 3W25A 2ZUTA 4H7VA 3I7RA 4MJZA 1WDSA 3C2OA 2E9BA 4O1CA 5HNTA 1IT0A 3S2CA 4ZOBA 4RK8A 3H26A 1AJZA 3I10A 1XLMA 2E67A 1P5BA 4IIDA 3N34A 3PZQA 2ZWZA 5CEWA 4M6QA 1CXIA 3EKZA 4J9JA 3GH4A 1YE6A 3LENA 1XP3A 1I0BA 3I6RA 4NYYA 1F2JA 4RZBA 3AC0A 2DZXA 2YGYA 3CIVA 2XGZA 3UGVA 2PBOA 3XISA 4KFPA 4PMUA 1FCQA 3EXRA 2ZADA 4BQ4A 1YPXA 3GHUA 3JW7A 3HGOA 1W8SA 1OBAA 3N2OA 2FTWA 2IMRA 4ZO7A 1ZBWA 3GC2A 4LUTB 1AL8A 3CPRA 4IFOA 3ATYA 5EKYA 3ZLHA 3TEVA 2INFA 3QFEA 1TSIA 1WZKA 5T8GA 4DYJA 3A3XA 2V3FA 3GC5A 2EPNA 3VE7A 1KLYA 4PMZA 3LBOA 1GG1A 3GO2A 4RNJA 3FOKA 1YXYA 3UA4A 2J47A 4ZENA 1JPHA 5FACA 3OW1A 1J0ZA 1E4IA 3OBEA 1UWQA 4H6KA 3MYPA 1EEXA 1R3YA 3PBMA 4C6OA 3C2YA 4KRZA 3QR1A 2BXZA 2F61A 4LC8A 2FZBA 3THDA 4YN5A 1FA2A 3WK0A 2YYUA 2D22A 3QMTA 2XIBA 5XIAA 4U10A 4GA8A 1TJ0A 3U4AA 1W9XA 5CSRA 1FTXA 3VC6A 1ME9A 3CAQA 1EWDA 4NX5A 4P7NA 4C60A 2QZRA 2OZTA 4AIEA 4O57A 2IKIA 4NZ3A 1QNOA 1F07A 1XHGA 4NP7A 1MQRA 1QT1A 2YIHA 4L9XA 1QK0A 4MWAA 4AEEA 3M0XA 3M46A 3G2GA 1W3HA 2EPMX 1XV8A 1Q6EA 3TROA 3CYVA 3VA8A 4W7UA 2PGEA 4FNUA 5EU9A 4KIEA 2X0HA 4V27A 2WSPA 4Z1CA 2R14A 4NXSA 1L6YA 1XRTA 3USBA 4S1FA 4QEEA 4PTXA 3GR4A 2YW4A 1KKRA 3OVGA 4H6QA 3W74A 4MPKA 2AQWA 2WLZA 4F2BA 3EX3A 4FK9A 4IPLA 2YBVA 3PJUA 3HO8A 1EA0A 3T2PA 1H63A 5K7JA 1B90A 3IJ9A 1JCYA 1DJGA 1O1ZA 3L12A 3UNDA 1TMLA 1HJSA 2DU2A 4JICA 4FB7A 3TFCA 1SW0A 5M3WA 1XISA 1EO7A 4URIA 1WB0A 3KTXA 1OK4A 1VFSA 1UZHA 4IP4A 3FN9A 2QVHA 3OJGA 4CNNA 1VRDA 5M2FX 2ZOXA 4AWUA 1EF3A 5G4WA 3B0XA 4NYUA 4NNAA 3IJ7A 4I6VA 3GLCA 5AYYA 1H60A 4XSLA 3ABOA 4MTVA 4GUGA 4JTHA 4P8UA 2YDRA 5D32A 1H09A 3UG5A 4AZ6A 1TWIA 5JQ9A 1SMDA 1ZU8A 4UQDA 4G9PA 4GYPC 4XK2A 4GCXA 1ALDA 1UD6A 1TQJA 3WSUA 1V3MA 2XDFA 4NF7A 1K6WA 4QS5A 3MJYA 5D8ZA 1K70A 3Q94A 5LXEA 3VMOA 2QUNA 4Y90A 4I7WA 1AMKA 3CWOX 4IGHA 4AUBA 4UQ9A 1BLIA 2PBGA 2J6VA 1C92A 2I9EA 2VC7A 2H8ZA 4XZHA 1B3XA 4CCDA 1Q45A 3DUGA 3A24A 3H7UA 3HPFA 2FB3A 1CXFA 3NL6A 3TNOA 3NSNA 3PTQA 5AZ1A 3S1WA 3FJ4A 3GXMA 1HJWA 4G2DA 4GC4A 1CLXA 4G8TA 3IK2A 4MJMA 2BXVA 1GVYA 2BHUA 4JR5A 1GG0A 2YCLA 3RR1A 1C91A 3ITTA 1P0DA 3LHWA 4OT7A 3ZOAA 2V63A 1D7KA 2PRLA 1G0CA 1LG1A 2W79A 3MZ2A 1EOKA 4U33A 1XICA 3NQ7A 5JXQA 4GH3A 3L23A 1B1YA 1Z3NA 3M9YA 2Z2BA 1A5NC 2BMBA 2ZE0A 2O7SA 1E56A 3N29A 1Q13A 3GNPA 5CPQA 4UTJA 4ZA0A 1ZALA 1KM1A 2WMJA 1PIIA 5EMKA 1KCLA 1WA3A 4LBUA 4Q22A 2BOFX 1EYEA 1TPEA 3KVJA 4UIOA 2V30A 1DVJA 2VL4A 3AFBA 4BA0A 1QAPA 3R58A 3ZVIA 4M8UA 1YDYA 1TWZA 3QOKA 3WK1A 3PANA 4WOZA 3HJZA 3G3DA 1POKA 1EX5A 6A3HA 1M03A 3CUZA 2HK0A 5D30A 4I7UA 3EZ4A 4OKDA 4F9JA 1E3XA 1UUQA 2XTKA 3N14A 1BRLB 4EPBC 1VIZA 1ONXA 3H21A 1KKOA 4DWDA 3R8GA 1MFVA 1CNVA 1O4UA 2BVYA 5IRPA 4FF5A 3WH5A 4N42A 4D8LA 2P5NA 3RPMA 1NSJA 2A3AA 4K2SA 2FPVA 2D3NA 3CHEA 5HR7A 1AQMA 2X2YA 3EOSA 1ODUA 4QLKA 3N12A 5CQ1A 2DZTA 3CUIA 3KCJA 2BLEA 3NQ6A 1ISWA 3GC4A 2POZA 1FUYA 1OT1A 3KE0A 4MF4A 1QMLA 5BNKA 3EX2A 3TW6A 1VRXA 4LOCA 4A35A 1EDGA 2AQVA 1Q8AA 2D0HA 4X0NA 3RRXA 4FXRA 2IXUA 3DESA 4OV9A 2NVCA 5HK4A 2J77A 4GI4A 1C8VA 2X41A 4QAIA 1CB2A 1TUFA 4QLLA 3H8AA 3AHXA 4GGBA 4L9ZA 5CBIA 3KS5A 3MDWA 4HOZA 1I0DA 1ZP4A 2Z7GA 1YTDA 1ELSA 3NDOA 1UW9A 1N2VA 1HFBA 2R1PA 4F0MA 1ONEA 3MCOA 1EJWC 5B7ZA 3UG3A 1EUAA 3UG8A 2PGFA 1DORA 3MHFA 6ENLA 4YS1A 3RO8A 3VIKA 2BGQA 2TPSA 1IGWA 4ERIA 2GFTA 5FJTA 3T0CA 1FWRA 4LUIA 2OWXA 3BXWA 1FWFC 2EO7A 1XKYA 5E70A 4W8BA 1KXVA 2DZWA 2EPLX 1JGIA 2JIEA 4JTQA 1L6FA 3SSJA 4DJEC 1ZJIA 3EB3A 4JPGA 3B0PA 1T99A 4HTYA 1UH4A 4WOQA 2E8YA 1BRLA 3AHTA 1V6YA 5AYZA 2WZHA 4PFMA 2O9TA 2Y1HA 1BXCA 2GLKA 2PWEA 4Y9AA 5LSMA 3SCTA 3NQGA 4PEEA 5JMUA 3RGTA 1F05A 4JIIX 3IJ6A 1ZCOA 2V3GA 3I3BA 1B2YA 1V3LA 4PUNA 1XDLA 4X61A 5AYXA 1K02A 2V81A 5C5YA 1PCKA 4B91A 5U4NA 3UA3A 2D2GA 1PDZA 2PDCA 3WLIA 2NWRA 4D6JA 5K9CA 5LIXX 4C6IA 3O07A 4G7EA 5LHFA 3O0KA 4UUIA 5C9UA 5A8QA 1ZS2A 1JZ2A 3MJMA 2PDIA 3PVFA 2BGSA 4UR7A 4HPJA 2IKHA 4AH7A 3C2VA 3B0VC 1OC7A 1E71M 1UKPA 2QCEA 1FBAA 4HZMA 4I7VA 2CBVA 3W2NA 2DUXA 3W86A 1PTDA 1PUDA 1T41A 3T8QA 3S47A 3C52A 1QI4A 1RSCA 3F5LA 2QGHA 4BF7A 4E38A 2VDIA 3RYSA 4L6OA 3RPTA 3GD6A 4XUGA 1HUVA 4N6FA 1IEQA 4PMOA 4L9YA 3PUEA 2JEQA 4DBSA 4MFDA 1GVIA 1W1B1 4F9DA 1UWAA 5CG0A 1DJYA 2DZSA 4MB5A 4HZ8A 3FEQA 4MADA 2ANUA 3QC0A 2PS2A 4MJ2A 4IM4A 3W29A 3WEMA 1XLFA 2I16A 2YXOA 4RXGA 3NPUA 1PTGA 3IIOA 1UB3A 4H9ZA 3NR0A 3T4WA 1EYWA 1OFQA 2FH6A 3KLKA 3S5OA 5FF0A 3BJSA 4Z1DA 4NJHA 3NL5A 4MKNA 2QIWA 3YPIA 1RBAA 3N2TA 5CPSA 1R7OA 3GNOA 3SCRA 4XVEA 3ISIX 3BDKA 1WYIA 4ZTYA 1U1HA 1V03A 1XS2A 3P93A 4M29A 1LRNA 1EF2A 4ORMA 4PGLA 3W00A 4NNCA 2B81A 4Q8MA 1CXLA 3DU0A 5CC5A 3ME3A 1J0KA 3K46A 4QM1A 5JIPA 1BWKA 3H2OA 5I7GA 4AF0B 4XBSA 1YRRA 4C6DA 3AAMA 3F2CA 3KM8A 4Z2GA 3GW0A 3A9IA 4NZ4A 4W88A 2YA1A 2Y7DA 4J28A 1AQ0A 1Z89A 1A5SA 2XVGA 4PTVA 3AICA 3GKFA 5DLCA 3EEGA 2C6QA 3R89A 4PEKA 3SJ3A 1OFBA 2RDTA 9RUBA 1Q6DA 2PURA 5C71A 1RUSA 2PDJA 1LJYA 4ADSA 3W37A 1H0GA 1LBFA 1K1DA 2V2CA 4XZLX 1FWIC 2DH3A 1A47A 3PZVA 4GHRA 1XC6A 2QDEA 2YCEA 3NPVA 1OSEA 1W6TA 1OABA 1IT8A 1X7FA 4NZFA 2ZZ1A 3SBFA 3P0WA 4YYFA 1GW1A 4DN1A 2H3BA 4UZUA 2YX0A 3IRSA 1RHCA 4DY1A 2WHJA 2VVNA 4AC1X 1EEPA 1D2KA 1F74A 3KFTA 2G3MA 3QPYA 4NIRA 3VX1A 3STEA 1TJ1A 2CETA 3M5VA 1L8PA 3DKJA 1J01A 3CZLA 1KFEA 3GVQA 3O3RA 2DPEA 2FZ8A 1LL4A 1VPYA 1R6WA 1S5WA 3E9AA 5G1YA 1MYRA 3BLFA 3QPZA 3EA2A 3TW7A 3G22A 1IXQA 2R1MA 2QJHA 2TSYA 2J4GA 2Y5EA 1Q5MA 1CGYA 2XGIA 3VGHA 2GVYA 1HKKA 7REQB 1HVXA 3EWCA 5DQPA 3AIBA 1PHWA 5A3HA 1QNRA 2A21A 3WD2A 4TO8A 3S8HA 1OADA 4QBXA 2FVLA 2FVMA 1XLCA 3V5OA 1DOSA 2I5IA 3FHAA 4E4PA 3EPOA 4ZOAA 2C71A 3PN8A 3B8UA 3GDLA 1GOIA 1TR1A 4U3CA 2ZFAA 3OIHA 3WD1A 4C6MA 2Q3OA 3VE9A 3PZOA 2QQ6A 1OFAA 1Q65A 2NZLA 4GNKB 3QMRA 5D9NA 2PUZA 1FWCC 4CD5A 1IWPA 2OMAA 5H6HA 5KEZA 4E2VA 3GHSA 2YL5A 7A3HA 4IP5A 4ZFMA 5D37A 2GVGA 2Y4SA 2VFFA 3OEXA 3GB6A 6ALDA 3OP2A 1A0EA 3W53A 5HJXA 2WM0A 2HROA 2C1GA 3NXFA 4H2CA 3URNA 4XD5A 4JTIA 2OU4A 3T0DA 1T8XA 3UW6A 1Q3NA 4AFYA 1XRSA 2HISA 4N9BA 1UBSA 3KZPA 3SIZA 5CZTA 2OXNA 4O1DA 3W7IA 4OU1A 1MUCA 2GGGA 4AIBA 4CQDA 2J25A 1FKXA 1XD1A 4PTWA 4YYCA 3FK4A 1MVYA 1TREA 4EP8C 2I5QA 4WD0A 1W2PA 1DXFA 3KBWA 3TUUA 1SZGA 4R7WA 1Q6FA 4ONVA 3GXIA 4L1XA 1QCWA 4ZGYA 4DBEA 5BXTA 3THQA 3ZLFA 1R2RA 4MDOA 3VX0A 3C86A 1IGSA 3JS3A 4PMXA 2REQB 4ACZA 2NX3A 3WK3A 4W85A 3OB8A 4LB4A 4RV3A 2ZRXA 3BZJA 5DY3A 1OINA 1QJWA 1W9UA 4PBFA 2J7EA 3LPGA 1V6XA 1JXJA 1ZPTA 3URQA 3G6LA 2JBMA 1DJIA 2E68A 4HNLA 3AJXA 3VMPA 1UQYA 2GUYA 2B7NA 3AHZA 1Y5XA 3U7VA 4EVZA 3VYLA 3A5FA 3WO8A 2PDYA 5HUPA 4XO7A 2E9MA 4WKHA 2AMGA 2G5WA 4H3DA 3GU1A 2YZ5A 1UQZA 3MMDA 4QQUA 2AAMA 4O8AA 4HVXA 1B9BA 2GSHA 2WVVB 2XVLA 3WLHA 2HWGA 3WLRA 1NWTA 4QX4A 1ADSA 3IGSA 1O66A 4EXBA 5HMFA 1KCKA 5AVNA 2GSJA 4IZGA 3C0JA 2ZXAA 4IMCA 4INFA 3NYDA 4NUWA 1JNDA 5E9XA 5I78A 2XM2A 4HSHA 4O18A 5F4XA 1T96A 3DFTA 1QFEA 3KL0A 1H50A 2E1WA 1AH3A 4Q4SA 3RLHA 4DLMA 3UR7A 3EXSA 3B4UA 3RMEA 3VKAA 2X05A 1BAGA 1KLZA 3M5YA 2NX9A 3OBKA 3ZSSA 5FAGA 3SM0A 4PMNA 2OODA 2YDAA 3AUOA 3KDOA 4LV9A 3C61A 4HSOA 1VH7A 5G2WA 3XINA 1JZ8A 3WF2A 4OOZA 3E5PA 4P7OA 2G97A 2PA6A 4FF7A 1K8XA 1WUFA 1XBXA 3QJAA 5GNXA 4F0KA 2E7FA 5CBJA 4Z2JA 1EB3A 3E02A 3SFKA 3V3WA 4O10A 3OYXA 2H9AB 3B9DA 1GVFA 3ITCA 4Q3MA 2OYLA 1ONWA 5TBOA 1KA9F 2CWXA 3HV8A 3PP7A 3BQ5A 4Z0JA 3TJLA 2OWCA 3NGFA 3WQGA 4B3KA 3PZMA 3IPWA 2QR6A 4H8HA 1XIFA 1JXKA 4HIBA 3DIPA 4K38A 4EF9A 4CEUC 1GJWA 3FNDA 4IIFA 1BD0A 3ABSA 3KXQA 2J66A 6TAAA 3QQWA 3VINA 1W5QA 2G96A 3VC5A 2ZZ3A 1R30A 1PSCA 5HXMA 3CTLA 4PE8A 4QNWA 1R3SA 5KZMA 2ZZ6A 3NA8A 1UWIA 5F2MA 3RN6A 3TJXA 3BLEA 5CAKA 4BF9A 3PZ9A 2YOCA 3U2CA 4B90A 4U2YA 2OLSA 4K1WA 4LFYA 3WL0A 1SZNA 5HDRA 1E1CA 2NQHA 4UTHA 1EGVA 1MNZA 3GDKA 2E09A 3TR2A 2Q6ZA 3DECA 3H55A 3P67A 2WSKA 4Y8FA 3TJ4A 1UIOA 4ZTXA 4R88A 1NWUA 1N82A 4EOUA 1RPXA 5CLWA 3CQHA 5A2AA 3WQWA 3FA4A 1XLEA 1FWEC 4JX4A 3AZSA 2V3DA 2I5GA 5EL1A 1X1ZA 2Z6IA 3O6DA 4ZBCA 4XG1A 4DBDA 3MT1A 1J96A 1KV5A 3UWEA 1LT8A 3UCQA 1HP5A 2H9AA 4LGXA 4Z2LA 4DNHA 5K2ZA 3LSBA 3W70A 1BXNA 4J3TA 1JCMP 1KV8A 4Q8WA 4CN6A 3Q45A 3A13A 1XIHA 4H83A 3TYUA 2DIKA 2W3ZA 5FL1A 3ZR6A 2X8RA 1FDYA 1V7AA 3IEBA 2J9XA 1VEPA 1LWIA 3GYEA 3CH0A 4MZYA 1E55A 2VR2A 2CHOA 3QXBA 3O06A 3HFTA 1QWGA 3ELFA 4ZO6A 3WQPA 1PX4A 3BAJA 3HBLA 1RK6A 3WNOA 1EHNA 3V1PA 4BHYA 3M0LA 2VFGA 3SGUA 1MXSA 1WOBA 2OEJA 4EXAA 4Z2HA 5DT7A 4AWTA 4DPPA 1MXGA 3EMQA 2TODA 4W5UA 3W1MA 1XYBA 4LNYA 3AISA 3ANYA 5CJ5A 3R79A 3I3DA 4Q8QA 3OLEA 3T05A 2VMFA 3HMCA 1V6VA 4GISA 4KEUA 3SURA 2X1UA 5BRBA 3ZYZA 3ZO9A 4AB4A 3BANA 2FGLA 4YWSA 1TYGA 2QS8A 4CD7A 3AALA 4TU1A 2A7PA 2ZXBA 3AYTA 2J7HA 4ERAA 4NNBA 1O68A 4WSJA 4DYEA 1XFCA 4ZOCA 1R3RA 3UZXA 3AZTA 4RE2A 1F7BA 4CN4A 4C1KA 3MCMA 5ECUA 3WMBA 2GZXA 2J7GA 1GTEA 2VD9A 1EX1A 4U28A 1WKYA 3BAXA 1YX1A 2GDUA 1UJQA 4O15A 3S46A 4IMAA 4JTLA 4Q32A 3TA6A 4O0QA 3HV9A 2OEKA 2BWGA 4CGTA 2GVEA 4IICA 3SB0A 2F2HA 4ENLA 2PC8A 2VGIA 2PWDA 1EL3A 1ME7A 3ES8A 3G1RA 1DQWA 4FLQA 5C0QA 5LA1A 1V0MA 4K36A 1O5QA 4JFSA 1SW3A 2CZEA 1KW1A 5C54A 3ITXA 1LP6A 2WANA 1XBYA 1TCDA 2VRKA 2GPTA 3UPBA 1ZAHA 4Q4MA 3N15A 1VFFA 1W1IE 4YWIA 1GCYA 1FRBA 2C0HA 1M7XA 3KLLA 1P6BA 4J3UA 3FJNA 5JBFA 4I8YA 5FF7A 3CM4A 1LL7A 4IMEA 3QGAC 3SQMA 2BVDA 1FY6A 2GVJA 1XH2A 2C7FA 3S2LA 1UWTA 5IFPA 1KD0A 4NILA 3BC9A 1KFWA 1EFZA 4PUJA 2WMFA 3MSYA 1P0BA 4D6CA 1KRBC 2FLIA 2V82A 5HJLA 1L9WA 1V0KA 2PLJA 1RJQA 2CPUA 4TX6A 4H6RA 4N02A 3ENLA 2J75A 3GTNA 3AIVA 3GDMA 1U30A 3W72A 4V15A 1NTHA 5D02A 3S2NA 3KP1A 3LCFA 1XYLA 3BK0A 5REQA 1P1MA 4PH6A 2GUBA 4NT0A 4PTNA 1MZRA 1T5AA 4AZGA 2F8QA 2GGIA 2J9ZA 2O92A 2VFHA 5A8MA 3GWQA 2O55A 4IWWA 1PX8A 1E9ZB 4HT3A 5HULA 4A21A 4G7FA 2OKTA 1H7WA 1I1WA 3V7PA 3INPA 3BG9A 2JK2A 1VFTA 5DRIA 2P8BA 5A5WA 5FEWA 3VD5A 1RCOB 3RX3A 1IWBA 3BW3A 4KQNA 1B57A 1P0EA 3UWUA 1RA0A 2E28A 5FOOA 3A4XA 3A64A 4N7QA 3KOYA 1WUEA 2WC3A 3WMSA 2DFAA 2QPXA 3O05A 4MY1A 2H8XA 3LV5A 1WX0A 4IUGA 4L64A 3LXCA 2C1HA 4DJED 3MKCA 1JI2A 3AIWA 4TUFA 1BVWA 1XI3A 4EE9A 3SAZA 4LYKA 1T8QA 2OCZA 2EAWA 1VC4A 2ZX8A 1UP2A 3LHZA 2GJNA 3M6YA 1AFSA 1KQZA 1W5OA 1QW7A 1SO4A 1E70M 3L4VA 3E6EA 1XGDA 3ZQ9A 2CYGA 3LPOA 5DANA 4Q33A 3BARA 1WDQA 3W2KA 3DHUA 1C9WA 3LHYA 1PBGA 1XYZA 1B31A 5I03A 4NSBA 1JYXA 5D9PA 3QSRA 3MV11 4K8GA 5BYWA 4WX2A 1EKOA 4G5DA 2Q8LA 2HQAA 2NXGA 1PKMA 5AC4A 1EXPA 4WKFA 4H9XA 3EXTA 3EOEA 3LTYA 3W7EA 3TYEA 1OCBA 4DIAA 3N3TA 5CXPA 3V5FA 1EZ2A 3N9SA 1KM3A 1JGMA 5HOSA 2E3ZA 1JRCA 1KTCA 3S5SA 3ZJ8A 4DJDA 1H5VA 2YA0A 4C6PA 5I3KA 2I57A 4HKPA 5BXSA 1MEIA 2QDGA 2PCEA 3C2EA 1ADOA 3BGAA 4RZ4A 4KWVA 4LF1A 2A0NA 1XXXA 1VYSX 2IKGA 1S5TA 4CD4A 5A6BA 3A4AA 1W8GA 4DXKA 4IIEA 1AZ1A 2OOFA 2OJPA 3CHDA 4G1NA 4WVXA 1F76A 4JTUA 2ZRWA 4A4AA 1E9IA 4J4KA 3VFCA 3WQEA 1GT8A 1VCGA 4LCSA 3LGEA 5A8PA 2ALRA 3SO7A 3T44A 1UR1A 4GVHA 1OX5A 3BAIA 5LXXA 3W83A 2F84A 5BCAA 3OVRA 1XLGA 4N9CA 3BOLA 4BQ3A 1WXJA 2WJEA 5MKGA 1I2QA 3FS2A 3GXDA 3C56A 1LLZA 1XSJA 4ZR8A 3LS9A 2VFDA 2HCVA 4ADTA 4KWWA 1CGXA 5J04A 3TIMA 1K8CA 1U5HA 2PDXA 4N0RA 4HPNA 4FOKA 1ZB5A 1SO6A 5CPMA 4HNNA 1V7YA 5I3HA 3UG4A 2CIPA 4JKLA 1BQCA 3CIWA 4D8ZA 1JPIA 3RR4A 3QHOA 3PZIA 3W84A 1H7RA 3WBAA 1JL8A 1YADA 2NLIA 5GJMA 1HN1A 2P0IA 3GFZA 4UOQA 4KCVA 4L6DA 3OA5A 4M19A 1XUZA 3DG7A 3QY6A 4CU6A 2WKGA 4C6CA 2Z28A 1C3FA 3E12A 3PNZA 4FO4A 3QV8A 3RLUA 4CN1A 4BJHA 3L5MA 1KR1A 2VUNA 2ZWYA 1NP0A 1XYMA 1PJ9A 3PF3A 4OZOA 4JEJA 1GJUA 1DWGM 4OVXA 1NFBA 4Q4QA 2IS7A 5FF3A 3WK2A 1KXTA 1A80A 2VZOA 3DERA 4KWOA 3EDFA 3M47A 3SZ8A 1ISXA 2W63A 2GL5A 3PB2A 5C9XA 1LOSA 4C6NA 2VUYA 3DCPA 3QW3A 4O50A 1Y5VA 4A29A 3STPA 3OODA 3SCVA 4UB9A 4KESA 1ZY9A 3FJ6A 3SCUA 4FALA 1FWAC 1TJPA 4GJJA 3LHUA 5DMYA 1EGMA 1YTEA 2D69A 1QDSA 4GBDA 4DM1A 5AY7A 2WCGA 3U6WA 3S3GA 1ZLPA 1E6SM 2CZVA 1LUCB 3MSDA 3B05A 3NDZA 2V6AA 3BLIA 2F6KA 4IG2B 1TCMA 3NPWA 4ZB5A 4DZHA 1TFVA 2NUXA 3MMWA 4JQAA 5KITA 1OIMA 3EB4A 1OWQA 2D20A 1V0LA 3AS1A 3CQKA 1MW1A 2PDNA 1TO3A 1X6LA 3LPPA 3FHQA 2NV9A 2BDQA 1QI3A 1ZBVA 3IARA 2YLAA 1R2TA 4P8VA 3SCPA 4XAFA 3SCWA 3ZT5A 4HQVA 4AZ7A 4C91A 5E0KA 2VM8A 1TTIA 4RDZA 3FXGA 4C5ZA 2VENA 2J8FA 4UOZA 2HE8A 2QCHA 4GINA 1GKQA 3WQ6A 1SJCA 1G4PA 1EH9A 4MZ8A 1F3TA 3EWZA 3P81A 5AHNA 3VABA 2FKPA 2OGJA 4TV5A 1SJDA 3GR8A 3L0KA 1NDWA 4Z1AA 4F79A 3GXPA 1X97A 2OTDA 1OCJA 1DIEA 4V33A 4MHBA 4HHHA 5IM51 3LRMA 2W9MA 3SW6A 4KRUA 4U31A 3W1LA 5K3VA 2NW0A 4WDTA 1DWJM 2IW0A 3HIJA 4U4MA 1TPWA 1F6KA 4S3GA 2E5CA 2X09A 2WQDA 2PTZA 1WP6A 1ZFJA 2OX4A 4GJIA 3F2BA 3JZEA 7ENLA 3VIPA 1FH8A 3U7BA 3VIIA 5ECVA 1A5AA 1LDCA 3KP0A 1XLJA 5DXXA 1QTWA 2ZUNA 4AG0A 3U57A 2OX1A 2PZNA 5G1TA 3KOWA 1OD8A 3N4FA 4UR8A 1O5KA 2W92A 2PI6A 4YNGA 4L1GA 3MV01 4YL2A 3ICJA 3KBSA 1YDVA 1UR0A 4JIPA 4QROA 3GSMA 2VKZG 3LUTA 3VOIA 4IG2A 2UV8G 4GVIA 4O1FA 1M65A 4YJ5A 1M68A 4OWGA 3BW2A 2PLKA 5AVHA 2UY4A 2V68A 4GVGA 3PC0A 3TXZA 1JYWA 1UJPA 3P0XA 3A6OA 2Q8XA 2GWNA 4Z1BA 1JPKA 3B03A 3CV1A 4QITA 2WYSA 1W9PA 2V5DA 3IJDA 2PDUA 1XLDA 2VEPA 4FNPA 2RDWA 4HK6A 4FXJA 3TN6A 4WUIA 1FQ0A 1JCTA 2CCRA 3SUSA 4JDYA 3CV6A 2VOMA 1TMHA 3KS6A 3ARTA 3T09A 3AS3A 5E1QA 1G4TA 2O7QA 2OZ3A 1HJVA 3DFQA 4YCPA 1J5SA 2Q02A 5CPLA 3NTYA 3AWOA 2V5KA 3MB9A 2OQLA 3R0DA 2J7CA 3PNUA 5DCDA 1W1ZA 1FWHC 2HXUA 4NZJA 4JTDA 4D6GA 4B5VA 1UP3A 3DHDA 1TRIA 2XPKA 2VHLA 4QQ3A 4A22A 1Q4NX 4MUPA 2VOTA 1IIHA 1NOUA 1E73M 5H8UA 1JFXA 4UNKA 5J5RA 3VI2A 5IDIA 4QDPA 4K37A 3ZM8A 4GACA 3W87A 7ODCA 3WBEA 1F3XA 4J7RA 1ZBCA 1FX6A 3VIHA 1P43A 1OGBA 2ZA2A 1X6UA 3NOYA 2V69A 3RUBL 5AZ0A 3RCYA 1Q6LA 3PK7A 3GTXA 4GI8A 1XFBA 1US2A 5G1MA 2YR1A 3E2QA 5A6LA 4PR4A 3HG3A 4UMAA 1R85A 3P60A 3WQ4A 1NQ6A 4J1OA 2D2OA 2NQJA 1EC8A 4KGLA 3PZNA 4LUSB 2NXHA 5FJRA 4KS0A 4CQCA 1QU4A 3R1ZA 1JF5A 1ICSA 3FAXA 1B4KA 4BS0A 3DC8A 5AC5A 1F73A 2V5BA 1OZMA 4RR4A 4F2UA 4Y96A 2HBVA 4AISA 2EJAA 1J0HA 1J0YA 1Q85A 1R8LA 4JEQA 1XQKA 1SFJA 2BVWA 3WNNA 3S9YA 1NARA 1FWGC 3C4UA 2X1SA 4D9PA 3PFMA 3UCDA 3H53A 1DXIA 2QCNA 4H8VA 4JS3A 2RDUA 1H61A 4JIEA 4QSFA 5FL0A 4WZHA 2PDMA 1I8JA 4BI6A 7XIMA 5I79A 1QW8A 3WLLA 1HJUA 4D1IA 5B80A 5I3FA 1V93A 4XX6A 1PWMA 1JDDA 4JTCA 3TZNA 3U5YA 3CUGA 2ZUVA 4XISA 1EP3A 2PRMA 4MB3A 2XISA 5CC6A 1O60A 5FSEC 1UD4A 1DEDA 4NAEB 4HYRA 4DRSA 3NM3A 1F6PA 4HD5A 1XX1A 3JU2A 4JTRA 3GX9A 3N11A 1ITQA 3PBGA 1VJIA 1Z6KA 3LCGA 1GW9A 4H9TA 4IJCA 1P6WA 3DBNA 1FP9A 1KTBA 3AOFA 8TIMA 4JTFA 4KWSA 1UWUA 1UR4A 4IT1A 3VIJA 2NV2A 1SJAA 2OSXA 3PPFA 2WHKA 1EC7A 1VBRA 2PWVA 5HNUA 4KEVA 4JY8A 3N18A 1HW6A 1JPMA 3MVIA 3ZIZA 4LEQA 4IL0A 5I3IA 4HNOA 1M9HA 4LUSA 2P1FA 2MNRA 3QHNA 3TQVA 3IIXA 1F3WA 3ZWTA 3OHMB 3EWYA 4LB3A 2EPHA 5FJIA 3C0SA 1JQXA 1GOKA 3OVPA 3POCA 4MM1A 1HKJA 1HF6A 1GWJA 2GDQA 5DMNA 2ZQ0A 2Y8UA 2WKJA 3P62A 2VELA 4H19A 2J27A 1S5VA 4H4IA 2NWSA 3DFHA 4M80A 1VCVA 3UPMA 5DCEA 4A8NA 3DBPA 3G1YA 2X0SA 1CX9A 3SGZA 1M04A 2VQUA 2HMCA 4AYSA 1VBGA 2ZA1A 3FVMA 5CPNA 1R7AA 4EX4A 2HJPA 5LNUA 4JL2A 1RD6A 2AKZA 3VGGA 2FMNA 1DIDA 1TRDA 2ODOA 1EQPA 3NO5A 3OGSA 1Q8JA 4EPKA 3ITLA 3MUCA 4B4FA 3QY8A 3W2LA 1QNQA 4YLWA 3IJ8A 3WLTA 4NAFB 4GUJA 3KRBA 2HNHA 2DUZA 8RUCA 3TCSA 3LQGA 1F3EA 1UMYA 2NSOA 3ALGA 1QBAA 1QPNA 4NAEA 4AMCA 1V0NA 5E6ZA 1B3ZA 3WELA 1K6AA 4AD5A 5FA5A 1I9CB 4PUDA 2PF8A 4ZODA 3BLPX 3KVKA 1AQHA 2EPOA 1D8CA 5HA7A 4XZIA 2WZIA 3GDTA 3EWDA 5CZKA 3ANUA 1Q2RA 1Z8AA 3LN3A 4CVWA 4AX6A 5KZDA 1B4EA 2D0GA 5T91A 4O12A 3GXNA 3K4DA 2I9UA 5IHRA 1LL6A 3ZVHB 1JUKA 1T7LA 3MHGA 1MUMA 1IWAA 1VLWA 2VZUA 3MBFA 1SW7A 4YTTA 3DX5A 3T55A 1TV4A 2YBTA 5F7UA 1E6PA 1XDJA 3I7SA 3ZZ1A 4F2TA 3TDFA 3O6CA 4CD8A 1DJHA 2J7DA 1WBHA 3IV3A 1EZWA 3TU9A 4NI3A 1GHSA 3LTPA 4JL1A 1D9EA 2P88A 3WX7A 4HU3A 2ASHA 2ZDSA 3WDHA 1YDOA 4N4QA 2Z7KA 4LEFA 4Q4PA 3H4WA 5DMLA 3E0VA 4O16A 4IQJA 3LLXA 3PTKA 3NEHA 3NZGA 1TMQA 1IXOA 1QO5A 3AXKA 3SFWA 2QCDB 1GQJA 2PLCA 1IEWA 5B7YA 3B9NA 1CXKA 5BOFA 1ZP3A 3TP4A 3I7QA 2JFEX 2ZZ2A 4C6KA 2XZ9A 3WJWA 3ARPA 2XIMA 2G37A 4HK7A 4I9JA 1PEZA 3T4CA 1S2CA 1IXPA 5GJNA 4MJ4A 3QPEA 4UXDA 3I3EA 2GSEA 4KW2A 5FJJA 3SRFA 3GG1A 3UJ2A 5KZ6A 2VEGA 3M0YA 4HNTA 1VQTA 3PM6A 3M6DA 3W1XA 4GJ1A 1QVBA 1R9YA 1LLOA 3WLJA 1V5XA 2A7NA 2QW5A 4TX9A 5LKYA 2Y89A 3E74A 5CPOA 3WLKX 3KRUA 3SN1A 1HTIA 3U2OA 4AZHA 4MLRA 5HWNA 2DUAA 1TJRA 2VEIA 2ZDRA 3BVJA 3V35A 1CWYA 4J2PA 4PMRA 4LUJA 3ALFA 7CGTA 1X98A