2Z6JA

Crystal structure of s. pneumoniae enoyl-acyl carrier protein reductase (fabk) in complex with an inhibitor
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
320
structure length
307
Chain Sequence
MKTRITELLKIDYPIFQGGMAWVADGDLAGAVSKAGGLGIIGGGNAPKEVVKANIDKIKSLTDKPFGVNIMLLSPFVEDIVDLVIEEGVKVVTTGAGNPSKYMERFHEAGIIVIPVVPSVALAKRMEKIGADAVIAEGMEAGGHIGKLTTMTLVRQVATAISIPVIAAGGIADGEGAAAGFMLGAEAVQVGTRFVVAKESNAHPNYKEKILKARDIDTTISAQHAVRAIKNQLTRDFELAEKDAFEQMGAGALAKAVVHGDVDGGSVMAGQIAGLVSKEETAEEILKDLYYGAAKKIQEEASRWTGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of enoyl-acyl carrier protein reductase (FabK) from Streptococcus pneumoniae reveals the binding mode of an inhibitor.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Oxidoreductase
molecule keywords Trans-2-enoyl-ACP reductase II
total genus 112
structure length 307
sequence length 320
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2007-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03060 NMO Nitronate monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2z6jA00
1DL3A 1Q6OA 1QWGA 4KFNA 2J88A 3MO7A 4LW7A 4JIPA 3LTYA 3W23A 2ZRUA 3DI1A 1F5ZA 1TYGA 2OT1A 1NFBA 1TTJA 1IGSA 1X7FA 3M7WA 2DZXA 4IOTA 3EX4A 4WY0A 2PURA 2EPHA 1KLYA 3TKFA 2CZDA 3P82A 3WFAA 1WX0A 4RLIA 3EXTA 4WQ6A 1B4KA 1SZFA 2FIQA 5F1VA 1SR9A 3QPYA 3SR7A 5AC6A 1UUOA 2G5WA 4LV9A 2Z2UA 4ZZ9A 3GDTA 3QZEA 1KM6A 1Q3NA 2A85A 1R47A 1XKYA 2JKPA 1QFEA 4J9JA 4IPJA 5LNSA 1BEUA 4UTMA 1W5OA 2Y7GA 4BI5A 1WA3A 4YLWA 3LTSA 3P8JA 4CLMA 1FDJA 1ZNNA 3G1DA 2WO5A 3HGJA 3NOEA 4X3ZA 1VYPX 3LLFA 4KKXA 4MLRA 4ADSA 4AWSA 3W7KA 1SZNA 4DBEA 3QW3A 3DH7A 2A5HA 2WPBA 3U2OA 1LRQA 3NL2A 4PFMA 1TSIA 1H7PA 1QO2A 3W7OA 4JICA 2PC4A 4N02A 3TCEA 3QQ1A 3NQCA 4CNNA 5AHMA 3LX9A 1HFBA 5CSRA 1GTHA 4A29A 1O60A 3O15A 3PS7A 5D37A 3R5EA 1X6UA 3W83A 1WXJA 4Y90A 2J9XA 1S5VA 6TIMA 5AYZA 2E6AA 2X1RA 2YCEA 3DAQA 3GK0A 2QJIA 1GVOA 4EIVA 2A21A 2FFCA 1ML1A 2Y7DA 3LRMA 4EF9A 1AW5A 1KBJA 1TPB1 4MUZA 3T78A 1K8XA 2A4AA 5EY5A 4BWLC 1A5SA 1FDYA 3VI2A 2WKJA 3PWAA 4FIQA 4A2RA 2I9EA 4IX2A 3LB0A 4FNRA 3VFLA 3TDFA 3T40A 1TPH1 3O6CA 1W5MA 2GJLA 2J9YA 4CQ9A 3EWBX 4UTWA 1SO5A 1EUNA 1RPXA 3T44A 2TPSA 3STEA 3BGGA 4O52A 3TK7A 3NQFA 3QC3A 4UFHA 4QQ3A 3BVJA 1ZHAA 3KXQA 3OA3A 1K03A 3W7PA 3HPZA 4NZJA 1MEHA 4N4PA 2QCHA 2C0AA 4O28A 3NQDA 1ZCOA 3CWNA 2ABAA 2P1FA 2XN2A 3W86A 4GUHA 1YADA 1SW7A 4IPIA 1P0KA 3RK8A 3TQVA 3IIXA 5DCBA 1I2OA 1DJNA 3F4WA 4WOQA 2A7PA 3I7SA 4DELA 4Y8FA 1W3IA 4H3DA 5J5DA 4RV8A 2ZZ3A 3O6DA 4K6AA 4LVGA 2RHGA 4UMCA 5KINA 4DF0A 2QCFA 3TJXA 1TPDA 3NAVA 4UCGA 3O63A 2DJXA 1JCJA 1SW0A 3KFTA 5F2MA 2YDAA 4JTGA 4MJMA 3HBLA 3GX9A 1Q6QA 4IWWA 3TW7A 3W1RA 2JGYA 3E02A 1K7FA 4E38A 2WV8A 4XQ6A 1SW3A 1Q6LA 4DF1A 2WJZA 2VEIA 5D02A 3EWXA 5KITA 1ZAIA 5U7SA 3FEMA 1EWEA 3TW6A 1M7OA 3QFEA 4I9AA 3TE9A 3N34A 2ZZ1A 3PG9A 4HSOA 2J27A 3KVMA 1W3TA 4M6VA 4UFIA 2DP3A 5LGXA 4GFSA 3MBDA 3GDLA 2E5DA 3UPBA 3IVTA 4NJJA 1FWNA 3A24A 4PL2A 2LLEA 3DXIA 3QEZA 2FLIA 2DZWA 4NUWA 3IGUA 4HNNA 3FFSA 2R91A 5A8GA 3LBCA 4O15A 2CZFA 3W1UA 2X2GA 3I7RA 4O10A 2NV2A 4N9EA 5CGQA 4IXXA 4OT7A 3PBYA 5D32A 3V1PA 2QF7A 2YZRA 4XZ9A 3OBKA 4MOZA 4PEKA 3W22A 3LCHA 4PC8A 5CKSA 1QR7A 4JD4A 5LZLA 5KZDA 3HO8A 3W2KA 4KWWA 5CPMA 4ZQOA 2CLIA 2IQTA 1SO4A 2CLEA 1X1ZA 3F03K 3NQVA 4FNUA 5AYXA 4OWGA 1ZJIA 3LCGA 3MHUA 4UR7A 3GAYA 1H61A 3EKLA 4ZVJA 4LS2A 1SSGA 2DZSA 2H3DA 1W5QA 2AGKA 4XKYA 2EGZA 3DGRA 4R33A 1CX9A 2DZPA 3MP5A 4ALDA 4LRTA 1R2SA 1FX6A 2WNZA 3S1XA 3FIGA 2OX1A 3LXAA 2PCQA 2QCCA 2Z6IA 3BO9A 1P4CA 5I3FA 2X1UA 4IQLA 2G95A 1TCDA 3UWWA 3H54A 4DEFA 4YCOA 3A22A 2A2IA 2ATMA 3W7NA 3GKAA 3HOJA 4IGHA 1FCVA 3QM3A 3L0GA 1AW2A 3LRKA 3G24A 5HMSA 1GG0A 4NJHA 5HINA 4IJBA 3G22A 5F4SA 3N2XA 4N6EA 2NZLA 1XDMA 2Y70A 5DBTA 2PRMA 4ZL1A 5E1QA 2C16A 1DBTA 4JTHA 2VENA 2E6DA 1W37A 5LNVA 3S5ZA 3ABSA 1PL9A 2Z1BA 1OFEA 2B4GA 4FB7A 3MHFA 3I65A 2V8ZA 1VHNA 3QMTA 4TO8A 3JRKA 3P80A 3PVFA 3DENA 1MEWA 3UWUA 5FF0A 2B7QA 3HGSA 4O14A 4GNJA 3BV4A 1TJRA 4JR5A 2QUUA 3LCIA 5CZ0A 1OK4A 4N9DA 5G2WA 4UTJA 5AHIA 3WK3A 2Y85A 3BW3A 3DFTA 4Q32A 1FWTA 3L2IA 5A5WA 3PBWA 3PSWA 4LUJA 4NNAA 1G4EA 1I2PA 1KTCA 3G0XA 3NQ6A 4C1KA 4DBDA 2VELA 3M44A 3N73A 1QPRA 4MYXA 5AC8A 4JX6A 2E09A 4O12A 5F4WA 3C4UA 4HHPA 4IMCA 1F6PA 1W0MA 3CQ0A 1LBFA 3M5YA 4DXVA 2QCDA 3MYPA 3SI9A 3RNDA 1KBIA 1EWDA 1TPFA 4BI6A 1TO3A 5I3IA 2DU2A 1KM2A 3LOTA 3KHJA 4RCXA 3FJLA 3HGOA 1I4NA 4NX5A 3HB9A 1BTMA 3L66A 2BLEA 4N2YA 5DCEA 1W5NA 3UWZA 3STFA 2ZZ6A 3E96A 3C2EA 1EP3A 1JUBA 1JRBA 1DQWA 2OJPA 2UV8G 3QRHA 1L6WA 4NZFA 3VE9A 3IEBA 2HTMA 5K3VA 1VRDA 1OFAA 3M1ZA 3ATZA 3HMJG 1OFOA 3T4CA 5K7JA 3L5MA 2C13A 3NO5A 4XKYB 4DPQA 3O16A 4BWLA 3PUOA 2VEKA 4I7UA 4H4IA 5HWJA 5ABTA 4P61A 1Q45A 3RFAA 3SGZA 1J4EA 3CIXA 4Y9AA 2JKAA 4O18A 3G0UA 1R2TA 3LCLA 3KRZA 3BK0A 1VQTA 3NQEA 4LVFA 1G69A 1F6KA 1GYNA 4ML9A 1OX5A 3TUUA 1B4EA 2QJHA 3PBVA 1ZFJA 2CZEA 2VKZG 1RQHA 3G1FA 1ALDA 3BLEA 4AH7A 1JULA 2YXGA 1TPEA 4WD0A 3S9YA 3INPA 1LOSA 4LOCA 2H3BA 2VFEA 1VPXA 4IXHA 5C55A 4MY8A 4JTTA 1A50A 4U28A 4KFOA 1ME7A 3W7LA 3CM4A 3NVTA 3TX9A 1OYAA 3IVUA 3L0NA 1XFBA 5EA9A 4JX4A 1UCWA 4IMFA 4JX5A 5D2XA 3M16A 3JS3A 5TQLA 1KFCA 3GXTA 3I6RA 3BLFA 1WBHA 2HS6A 3CHVA 3S1VA 1QPOA 3KRUA 2V2CA 5CZJA 3B04A 4LS1A 1TB3A 4BI7A 2VFDA 1AMKA 2NV1A 1UUMA 1NVMA 3P60A 2QJGA 1OYCA 1TV8A 4O4WA 2GVLA 2OZ0A 4C1LA 2F84A 1TJPA 3W2LA 1L2UA 1KM5A 4TMBA 4RXFA 2QCEA 3UWYA 3TQKA 1LCOA 3NDOA 5FEPA 1H7WA 2FDSA 1OFQA 1LBLA 1S5TA 4MYAA 3QW4B 4M6PA 3EWYA 2J6XA 4X2RA 3EWZA 4FXSA 3S1UA 2RDUA 4M5PA 4CQAA 3EWUA 2QDGA 2DORA 5HR6A 1QOPA 3L65A 1LLZA 4AVFA 1O5KA 4NNBA 2VFGA 4FHAA 1F7BA 4RK8A 5D2YA 4AXKA 2DZUA 1DQXA 1R30A 1RVGA 4UR8A 4ZMGA 1YXDA 1MO0A 1M7PA 1DOSA 3W2JA 3HF3A 1X8FA 4Z0SA 2NUYA 1JUKA 2ATSA 4KWVA 2VEPA 4O11A 1VH7A 5H91A 3M5XA 5TBOA 3MYOA 4NX0A 5EL1A 3MP4A 2P10A 2QDHA 3FLUA 3GKFA 3DZ1A 1FWSA 3G1VA 3NQ2A 3W1PA 1F73A 1YLVA 4O54A 4JXCA 3PBUA 4O19A 3G18A 4UTHA 1ONRA 5I3KA 4TMCA 2A7RA 3UZ5A 3MUXA 3CWOX 5F2IA 3TQ0A 2TYSA 4I7WA 4Z1BA 3M6YA 2Y89A 1AG1O 3ZWSA 1YXYA 1C29A 1EUAA 2NXHA 1OABA 5BW6A 2E68A 3MW7A 3LTPA 1EP2A 2C3ZA 1DHPA 1L9WA 4X9SA 5K4ZA 4RZ6A 3GNDA 4NJIA 2WNQA 3PM6A 5J5RA 2X16A 1IXNA 3W1TA 4DO5A 4K8EA 2GQAA 2YYTA 3VCRA 3CEPA 3NEVA 3G1HA 5AHEA 4QJ1A 2V5BA 3G1XA 4UTIA 3TMQA 1SZGA 3Q94A 3W7MA 3ZS4A 3LHTA 3N9RA 4UTLA 4QM1A 1VZWA 3L68A 4JTIA 1O5XA 4O57A 3A21A 1NF0A 1DORA 4HNUA 3EX3A 5D03A 1KM1A 1O4UA 2QR6A 2ZRVA 4QAIA 3STCA 1GJPA 2YFOA 1MXSA 1QO5A 3GLCA 3GR8A 1FDZA 1I2RA 2GVGA 2W6RA 4FIRA 2GOUA 4Z1DA 4JYEA 3L21A 2O7SA 3OVQA 3R2GA 4N9BA 1VJIA 3PAJA 3WK0A 5DY2A 3M5VA 3QSTA 3TSDA 3F1QA 3QSRA 1TV5A 3EB2A 4WOZA 2ZRZA 4YMZA 2Z0IA 3TSBA 2WSRA 2H6RA 4JY9A 4E2BA 3W7GA 3MWAA 4NQ1A 1F05A 1WAUA 4AHOA 1GYLA 3QPZA 3IIVA 4XTIA 7TIMA 1EB3A 3S6DA 4WXZA 1KLZA 4MKNA 3UWQA 3N14A 5CSSA 1SO6A 2B7NA 1WQ5A 3NPWA 1IF2A 3R12A 1JR1A 1VYRA 3LV6A 3FYPA 1LBMA 5D2TA 2R94A 4O1BA 3VE7A 1SFJA 2Z6JA 4L4MA 2VFIA 3LCWA 4O16A 4JS3A 3LHWA 4FXRA 3LGEA 3C2VA 1VR6A 3EXRA 1MEIA 2CLMA 4NVTA 1NSJA 5D33A 1O94A 3OVRA 5BMWA 3W1XA 2VFFA 3DFPA 1QDSA 2BX7A 4LWWA 4GUIA 3W7HA 2ZTJA 4S1FA 4ZQRA 5G1TA 2DZTA 2JGQA 2VOMA 1MZHA 3W2UA 4AB4A 1OF8A 2B7OA 5I3JA 2JK2A 2ZZ7A 2Y61A 5G4EA 3IVSA 4WJEA 1PHQA 2Y62A 3OEXA 4MFEA 3PB2A 3TV8A 2CWNA 1FWWA 3TAOA 3WJZA 3HQ1A 1DJQA 2Y63A 1YDOA 1S5WA 1YTKA 2CLKA 2RKXA 2WNNA 5LSMA 2ISVA 4OBTA 1OFRA 2CLFA 4AWUA 1HG3A 2DJLA 3FJ6A 3ELFA 3A9IA 3W3OA 4K39A 4MJZA 3QJAA 4O1DA 3GIYA 4POCA 1OX4B 2YYUA 1PCKA 1W8SA 4MVAA 2V0TA 1SUXA 4ICNA 1OFPA 3DBPA 5L6UA 4UTTC 1P1XA 4H6KA 2ZQ0A 4HNVA 1ZENA 1OJXA 2QCDB 3M0ZA 1ME9A 2ZRXA 2CW6A 5DXYA 4QIUA 3BG9A 3A5VA 1V7YA 2Y7FA 3R89A 3SFKA 2ZZ2A 5TIMA 1WOAA 3GAKA 4LVAA 4O53A 2ZFAA 5LNUA 2B7PA 2QCMA 4ORIA 3B05A 1EA0A 2PRHA 2X1SA 1OFDA 2VXNA 1KFJA 1GZGA 2I14A 4JNMA 2D73A 5CPLA 3HJZA 3UNDA 2WOQA 4CCEA 1F74A 3GDKA 3SGUA 1V5XA 3N9SA 1OHLA 1FBAA 4MY9A 4JDBA 4UFMA 2V9DA 3EX1A 3TIMA 3UQNA 4PA8A 5HUPA 1LZOA 4MPQA 3IGXA 4LUIA 3HG3A 2A7NA 1R2RA 4U4MA 1U83A 1Z41A 4OV4A 3EX6A 1N55A 4L4LA 3MMTA 4K8HA 4HPJA 3AO0A 3NA8A 4JTEA 1WV2A 3W7DA 3PUDA 4HPXA 5I3HA 1YDNA 4BF9A 1LTDA 1OFBA 2GQ9A 2Q8LA 3KOFA 3O6YX 3LM7A 4EF8A 2OMAA 1JRCA 2EHHA 4XUGA 1B9BA 3DFSA 3S5NA 1X1OA 1R46A 3NZ1A 1AK5A 3C0JA 1KTBA 3C8FA 1GVFA 1Z42A 2Y7EA 1CW2A 4QITA 5IBXA 5LKYA 3TU9A 4YL2A 1HUVA 3LXCA 2DZVA 3C56A 5BOOA 3BG5A 4JTSA 3LXBA 1H7RA 1K8YA 3Q37A 5CPOA 2G97A 1Q6RA 4ZQPA 4UNLA 2ZCGA 3G8RA 3WJWA 2NWRA 4FEZA 4AWTA 2NX9A 3W07A 1YTEA 1LOQA 1XM3A 4LT9A 3IIZA 3I7QA 4LVDA 2WQPA 3GR7A 5DLCA 4QISA 4NXSA 3DKLA 3IGSA 3DU0A 3C2RA 8TIMA 3NL6A 5AOUA 4FX6M 3KVLA 1FXPA 5D2VA 1RR2A 3USBA 2CU0A 1FCQA 1KFLA 1TPWA 1HO1A 2GVJA 4GE8A 5F1UA 4EWND 1GQNA 4WX2A 1TPUA 3CT7A 1FQ0A 5I3GA 3W88A 1IXOA 4UFKA 1OYBA 1GVSA 5EBUA 1SO3A 4FNPA 1LOLA 1QAPA 3DFOA 1ADOA 1UASA 1TTIA 2CFFA 3MJYA 2W0UA 2YR1A 3W87A 3DI0A 3TMLA 2QUTA 3P5YA 5T26A 1AL7A 2R14A 3TR2A 2V2DA 1AW1A 3O07A 4UMBA 1FCUA 4WXYA 2RH9A 3SECA 1L6SA 2BXVA 2OT0A 4IUOA 4MZ1A 1XCFA 5K9XA 1KM3A 1H1YA 3G1YA 2OCZA 3NGJA 5D04C 1EP1A 3DKJA 2QCGA 1K7EA 2I1OA 3L5LA 1PE1A 1LRNA 4KFPA 3W2MA 5K4XA 4LS0A 3EWWA 3KX6A 1JCLA 4FF7A 1XXXA 4OQVA 3UXDA 3WJSA 2EF9A 2YPIA 5KTLA 3V75A 1XBVA 1MSSA 2FB3A 1D3GA 4LVBA 4PH6A 2E5CA 3B03A 1K7XA 4O0KA 3W7IA 4R7JA 1G7VA 3W7CA 2YW4A 4YWIA 2Q3RA 3W1QA 3T7VA 2CZ5A 1GG1A 2WSQA 5EMUA 4BR1A 1T8XA 1PCWA 3CIWA 4JYDA 1YTDA 5G5IA 5AYYA 3LCXA 5HNRA 1PVNA 4MZYA 3ZR4A 1LLWA 4B5NA 3PC0A 3B4UA 3W1MA 4DPPA 3LLDA 3W76A 2ZZ4A 4UFJA 4LRSA 3TC7A 5K2ZA 1PHWA 1S3HA 4FNSA 4FNQA 1YPIA 1QPQA 1W56A 2FPVA 5AHLA 1W31A 2TRSA 4W9TA 1BWLA 3GZ3A 3NM1A 4EVZA 3L5AA 4E2DA 1FXQA 5AHNA 1IIGA 4A22A 3NQ7A 3QYQA 3W73A 1XC4A 1TPC1 3TH6A 1TV7A 5G4WA 1KFBA 4RJEA 1M5WA 2CLOA 4RKAA 1DKWA 4LTSA 3P67A 1OG0A 1A53A 5K9DA 4HIBA 4JEQA 3IIPA 3B8DA 3WJYA 3E12A 5BMXA 1F76A 3W2NA 1EEPA 3M43A 1UB3A 2PE4A 3T55A 3MBFA 1HO4A 1TQXA 1T96A 5G1YA 1IXPA 3GVGA 4O17A 3N3MA 3SIZA 1WYIA 3NPVA 5E0KA 1BKSA 3NM3A 5DELA 3NPXA 3G3MA 2VEMA 2EKCA 5H2ZA 2VC6A 4JTFA 4K38A 1KA9F 5F2GA 4MIMA 3QH2A 2JBMA 1GWJA 5DCDA 1T0OA 1P5BA 3B0PA 1UBSA 2BZNA 3KVKA 1N8FA 4M7SA 4RZ4A 1H63A 4YCPA 1B57A 2ISSA 2WSYA 5D2WA 2HMCA 2QEZA 3M9YA 3YPIA 3LHYA 3P84A 3RU6A 1TQJA 1LORA 1HL2A 1SQ7A 1TREA 2GUUA 3E9AA 3DFQA 3NQMA 4JTLA 4OGZA 5DBUA 5HWMA 3ANYA 3ZFHA 4N4QA 5D30A 1I45A 4UMAA 1RV8A 5HQEA 2YW3A 1KW1A 3KAOA 4K36A 1VC4A 1DVJA 3UWVA 3B0UX 5KZEA 1NAL1 3Q2DA 4K7YA 3HG2A 3LHVA 4JIQA 1JCMP 3SW6A 5C5YA 4XBSA 3G8EA 4JTJA 2ABBA 4JN6A 1YDVA 3E0IA 3P74A 5IBXC 3PUEA 4HSNA 1JJKA 2E1DA 4PODA 1HTIA 3ABQA 2PRLA 3RMJA 1M6JA 1VLWA 5FEZA 3STGA 3LCFA 1H5YA 5KZMA 1VLIA 2KZHA 2XN1A 2Q8ZA 3OG3A 4OV9A 3NQGA 1TTPA 1Z48A 1RZMA 3W85A 4Z0JA 3B06A 4ZQMA 3VNDA 1A5BA 1L6YA 2ZA1A 3TC6A 2BTMA 2HSAA 3M41A 5EKYA 4GUGA 3M47A 3IRDA 4M19A 3W7JA 3NG3A 4JTUA 5MHBA 5LNRA 2E5BA 5D38A 1G6CA 1EX5A 4UTWC 3AJXA 4IMGA 3QF0A 3W84A 1TMHA 3W7RA 5BRBA 2QKFA 3BGJA 4LC8A 5DN1A 3BPWA 4AHPA 3W9ZA 2ZA2A 1PV8A 1ICPA 2V81A 5LHFA 2QCLA 4M6QA 3UYCA 2J24A 5U4NA 1LYXA 3NZRA 2FJKA 2NLIA 5F4XA 3NPUA 1QPNA 4JDYA 3GDMA 4OE7A 3W7EA 4FNTA 4DF2A 4LV4A 4I7VA 3CPRA 1FUYA 3SZ8A 3G1SA 4UUIA 3P81A 4D2JA 2V82A 4QNWA 5FEWA 1XDLA 4LC6A 1XUUA 3UPWA 4DO4A 5FF4A 1LM1A 3FOKA 4AAJA 5C6MA 3NL3A 3HG5A 1RQBA 4GWEA 1K3UA 3TROA 3C6CA 2NXGA 2YFNA 3LI0A 3C2FA 4XWUA 5AC7A 4TX9A 4DO6A 3GDRA 4IMEA 3S5YA 4O13A 1Y0EA 2C1HA 1LDCA 4TU1A 4Z08A 1A5AA 4JGDA 3S42A 2E6FA 3UY7A 4UTUA 3OIXA 4UFLA 2NX1A 1H7XA 3LI1A 3WJXA 1G7UA 2XN0A 1BWKA 1E51A 3U8GA 4Y6GA 5D09A 2AAMA 1I8JA 5HWNA 1T99A 1VCVA 5G2IA 3W1LA 3C3NA 2BWGA 2GQ8A 1N7KA 5D05A 3S8HA 2RFGA 4XBKA 4UNKA 4DQWA 3LERA 3L67A 2ZA3A 2QAFA 1FWRA 3CLMA 3DHFA 4GUJA 1QCWA 4JTKA 3N2MA 5FEXA 1J5TA 1AL8A 1K8ZA 3RLUA 1LROA 1JQXA 1W1ZA 1SZEA 1ME8A 2C18A 3LBMA 5C54A 1GVRA 4O50A 3R8RA 1OF6A 2ZRWA 5FF2A 3D0CA 1ZY9A 3FKRA 4WZHA 2FPTA 2H8XA 4FO4A 3PG8A 4G1KA 4HKPA 1W3NA 3NQ8A 2C6QA 1F2JA 1RQEA 1J2WA 2E77A 3N19B 4BFAA 3A23A 3NXFA 5G2HA 2Q3OA 2NWSA 3DFNA 3NQAA 1YYAA 3M5ZA 4HNTA 1XBXA 4IX0A 2NXIA 1NF7A 1H7NA 3C2OA 4RR4A 3G0SA 1KV5A 3TSMA 3IV3A 1H1ZA 1JQVA 1YXCA 3FYOA 4WY0B 3QMSA 4RZ5A 4MZ8A 1ICSA 5SWUA 3W7QA 3EX2A 3H53A 1RD5A 3R13A 4AMAA 1OVDA 2A1YA 4AF0B 4GC4A 3HG4A 3NNTA 1WDWA 4AHQA 1JCNA 2JKEA 4N6FA 1JCYA 1PS9A 3W71A 2V30A 3LHUA 2FPYA 3ATYA 3TFXA 5F2LA 3CEUA 1CI1A 2YGYA 3P62A 3W6YA 4NJGA 2ZYFA 3TNOA 2VFHA 2ZBTA 4FX8A 4WUIA 3PR2A 3S5OA 3CU2A 3THQA 4CQ8A 2R8WA 3HGRA 2GJNA 3S0CA 2YX0A 3SSJA 2NX3A 2A6LA 5KSWA 1XBZA 3O1NA 1OX6A 3O8AA 4TR9A 4R53A 2H90A 4NU7A 5K9CA 1WBJA 1XBYA 3BARA 3RF9A 4CNOA 3HPSA 2ALDA 3A5FA 3TA6A 4CCDA 2HS8A 5FF3A 4HN4A 4O8RA 2C15A 3ZWTA 4S2CA 1C9DA 1DV7A 3LV5A 2C14A 5DY3A 1Z44A 2C19A 3W70A 1XI3A 3DHDA 1P0NA 1KV8A 2CLLA 3UY8A 1ZAHA 3NL5A 3MI3A 1H51A 2EAWA 3MHGA 1W54A 1NEYA 1XL9A 3EXSA 3L9CA 1C8VA 4RXGA 4GRSA 3ABOA 3NYZA 3SY5A 3S1WA 3P8IA 2BSLA 3GB6A 3K30A 4O4VA 2W79A 2ZTKA 4M7TA 3O05A 2FB2A 4RX0A 3JR2A 4HT3A 4WY0F 4P2VA 4R34A 4ZQCA 1JCXA 3E49A 1D3HA 5IM51 3MP3A 3B0VC 5L9FA 1EPXA 3GXNA 3Q58A 3W1NA 4Z1AA 5FESA 4O1CA 3UXAA 2FTPA 1KTNA 4UTKA 4LNYA 1FCBA 3OVPA 4X22A 4MFDA 4A3UA 1PIIA 1TIMA 2TSYA 3MI2A 2O7QA 5LHEA 3FKKA 5CG7A 3BLIA 1UJPA 3CTLA 1QOQA 4IMDA 5EYWA 4Y96A 3NR0A 3HIJA 3W74A 4YXGA 1QNVA 3L0KA 1G4PA 4S2BA 3W72A 3GYEA 3UZJA 3LDVA 5FI8A 4JYFA 1U5JA 3KRSA 4K37A 1JUEA 4A21A 4O0ZA 1GPWA 3MI6A 4LU0A 3RLVA 1SU5A 2NUXA 4Q33A 4NNCA 3PSVA 2RDWA 2FQIA 1ZALA 3C52A 1B3OA 4NJKA 3TAKA 3EKZA 1G67A 4GXMA 4PCFA 4UXDA 2V2HA 2B0MA 1GT8A 1W5PA 2AQWA 3PULA 3TXVA 3BG3A 3BW2A 3CC1A 2F7FA 3I68A 4FX7A 3GNNA 1IXQA 4ADTA 1GOXA 4BK9A 6ALDA 5DXXA 2ZRYA 1G4SA 1IIHA 4ADUA 3FS2A 1H7OA 1LRTA 4CCCA 3UD6A 1VGAA 5LGZA 3G3DA 3IIOA 2V5LA 4QSHA 3GXPA 4EOUA 2YSWA 5LNWA 1TTQA 2QAPA 1FY6A 1KM4A 1H62A 1KM0A 1GTEA 1SPQA 1H60A 2CLHA 5GVJA 3G1AA 2QUVA 3P61A 1GEQA 2TMDA 4CNPA 5HUOA 1QMLA 1VCGA 4GJ1A 2XFWA 4Q4KA 4A2SA 4PTNA 1SSDA 5AFDA 3C61A 1TPVA 3SJ3A 3W1AA 1OX4A 3ABRA 3WK2A 1VCFA 4AEOA 1LP6A 1SFLA 1VHCA 1I2NA 2X1TA 5CZTA 2J9ZA 1TRDA 2A0NA 1GVQA 1YPFA 5FF7A 1EIXA 1TRIA 2QCNA 5AN7A 1O95A 3TXZA 3OHIA 4NXKA 1ZAJA 2X30A 5KMYA 2Y6ZA 3PB0A 2A6NA 4OU1A 4GBUA 3LRLA 3KVJA 3P5ZA 2G96A 1OK6A 4PL1A 3HPXA 4UIOA 1JVNA 3TJLA 5E93A 1K02A 2P0OA 4AF0A 4ZQNA 3QQ0A 2Y88A 1WOBA 3PF3A 5HULA 4LY8A 2E6YA 4E0CA 4ORMA 5C2XA 3H55A 3O06A 3CB8A 4MLJA 4Z1CA 3THAA 4XTDA 5BNKA 5HR7A 3FA5A 5HJLA 5AHFA 1XUZA 3BW4A 4MY1A 3W75A 3U6WA 3VKJA 4K7VA 5AB3A 1D9EA 4N9CA 2ZZ5A 1THFD 2GPTA 2ISWA 3QMRA 1G4TA 5EPDA 1ICQA 4UTTA 3F4NA 2ZDRA 4QNEA 3PY2A 3LHZA 5CZSA 1VYSX 2RDTA 3P7YA 1KFEA 4OHQA 1KFKA 1I2QA 1A5CA 4NT0A 3WK1A 4UC5A 2NUWA 4TIMA 4JY8A 4GUFA 2H8ZA 3TFCA 4ONVA 5CPNA 1H50A 1VS1A 3EEGA 4O1AA
chains in the Genus database with same CATH superfamily
3UG5A 1QWGA 2P5NA 1CPUA 4JIPA 5FIPA 1YQ2A 5A6KA 4U2YA 4CN6A 4I8YA 1OGSA 1HJQA 4ROQA 1IT0A 5FJPA 4U5IA 3ECQA 1IGSA 1BLIA 3CMGA 3REQB 1QOXA 4U3AA 2I5GA 3EX4A 4WY0A 1CENA 2PURA 3AAMA 4GZJA 2EPHA 1KLYA 1FH7A 1KR0A 2CZDA 1V02A 4UNIA 3T6CA 1QK0A 3WFAA 4L5ZA 1LWIA 4RLIA 1B4KA 1SZFA 3UVIA 1GPFA 3CV7A 2CBJA 1UUOA 3XISA 4LV9A 1M01A 1OC5A 2XG9A 1KM6A 2PDUA 1NARA 3DFHA 3LLXA 4KMQA 4U5KA 1RCOB 5LNSA 1OCNA 2WVSA 2CESA 3NTYA 1WA3A 2QJMA 4KETA 4A05A 3P8JA 1ZNNA 5FJJA 4ADSA 2OXNA 3LLFA 3WN6A 2BGNE 3QW3A 1UMLA 2A5HA 3U2OA 1LRQA 1RBLA 4F9DA 2VI0A 2ZDSA 4KT2A 2PC4A 4IQEA 5CSRA 1I0DA 1SJBA 4C6IA 2Y5EA 1GTHA 1O60A 3O15A 4MWAD 5D37A 2BODX 3R5EA 4KRUA 2VCAA 3H4GA 5IHRA 4GGBA 4GYPA 3FXYA 4PMDA 1FWDC 2X1RA 4AISA 1ISWA 2RAGA 4EAYA 3GK0A 3DHPA 2QJIA 2PGFA 4EIVA 2J7EA 1RD6A 2FFCA 4GVHA 1ML1A 2Y7DA 3LRMA 4EF9A 1WZLA 1K8XA 2A4AA 5EY5A 1A5SA 2PWUA 3VI2A 4C6MA 3IACA 2I9EA 2WWCA 4QCFA 4XK2A 4WDUA 3TDFA 1E15A 3T40A 3O6CA 3TC3A 2GJLA 4D6DA 3EWBX 1B3XA 1XLEA 1SO5A 1RPXA 2X1IA 4GD0A 2O55A 4HPNA 4O52A 1U33A 3NQFA 4QQ3A 3WDPP 3BVJA 4JAWA 2XIBA 3F7JA 3VD5A 2X7VA 4N4PA 3M64A 3NQDA 4WJ8A 2P1FA 2XN2A 4J2PA 4WSKA 4B5UA 1I2OA 1H2JA 3N13A 3F4WA 2YCJA 1FP9A 2A7PA 3I7SA 2WMKA 3KWXA 4H3DA 1QVBA 1H5VA 3IAPA 4XUYA 3NDZA 3O6DA 4LVGA 3V3WA 5KINA 2YL5A 3TJXA 1SW0A 2JFEX 2YDAA 3GU9A 3GX9A 1Q6QA 3TW7A 3JUGA 4GY1A 3IWPA 2WWDA 3CAQA 3E02A 4A8IA 4HA4A 3SAZA 1XQKA 4XQ6A 1XFCA 4CD8A 4GQQA 2WQDA 3GC4A 1TE1A 1EWEA 3TW6A 1M7OA 4FI4A 2CIPA 1SM9A 3AYTA 4C6OA 2BXYA 3RXZA 3LM3A 1DWAM 2DQXA 4PTMA 3FSUA 3H70A 3OGVA 5I07A 4JZ5A 3XIMA 3G5EA 4XZWA 3IJ9A 2X09A 1U1JA 4MWAC 1R85A 3QEZA 4E8DA 1W9UA 3IGUA 3AS1A 1SMDA 2R91A 3LBCA 5C9XA 4PTVA 1ZU8A 3ARSA 2CZFA 2WZTA 3A4AA 3FJ4A 3W1UA 5IFPA 5CGQA 1A5UA 3C5QA 5D9NA 1AQFA 3H7RA 3MZNA 2XTKA 4MOZA 3LCHA 1XSIA 5KZDA 1FRBA 3W2KA 4ACYA 4EWJA 3QY8A 3NQBA 2Z1KA 4LJ3A 4XVEA 3AXMA 1M03A 5AYXA 4FNUA 3NQVA 1CGUA 1ZJIA 3MHUA 4UR7A 4XZLX 1R87A 1H61A 3TQPA 3EKLA 5EMKA 2XH4A 3A13A 2DZSA 2OOFA 4XAZA 3QY7A 4XKYA 3JW7A 2EGZA 3DGRA 4R33A 5BXPA 2OZ8A 2EEXA 1R2SA 1TV3A 2FVMA 2I5IA 1V3LA 1UKOA 2DSWA 4S3AA 4H9MA 2CZVA 1TG7A 4U31A 2X1UA 2G95A 3ZM8A 1W6TA 3A22A 5FD0A 3GKAA 4IGHA 1FCVA 1AW2A 3LRKA 1JYVA 5HINA 5F4SA 3N2XA 4N6EA 3VOFA 2CYGA 5E1QA 2C16A 1DBTA 3LEPA 3KM8A 4GABA 3ARWA 1A80A 1OFEA 2HRWA 3F2BA 4ML4A 3CS2A 5FCZA 3JRKA 3P80A 1UD8A 1NQKA 3UWUA 2YCLA 4GNJA 4JR5A 5CZ0A 2XJ7A 5HK4A 1NDWA 1IE7C 2Y0FA 3PSWA 3T0AA 4LUJA 5I09A 2WMFA 1X7IA 2DW7A 1G4EA 1I2PA 1XP3A 3G0XA 3NQ6A 2VELA 8RUCA 1CGVA 4S3EA 1JFXA 2E09A 2YXOA 3PPHA 1ZS2A 4IMCA 2Z2AA 5GJNA 3CQ0A 3I3BA 4W8BA 3AIBA 4DXVA 3I6TA 4CQCA 4ZCWA 3MYPA 3WLTA 3L12A 4ENLA 4CU8A 1TO3A 2DU2A 1FH9A 2WPGA 3VIHA 3KHJA 1K4GA 3FJLA 1I4NA 3MB9A 1W1IE 3LY0A 4N2YA 3STFA 1K77A 3KP0A 1EP3A 1US2A 2CEQA 3ARYA 2UV8G 3VE9A 1TWSA 2D0HA 3IEBA 5K3VA 4N0RA 1NH6A 2P76A 3Q67A 1R3TA 4NI8A 3F4VA 4Q7BA 3T4CA 3WQPA 5K7JA 4DPQA 2QJJA 3BE7A 2P88A 4IH3A 4P61A 3QHOA 3ITVA 2D24A 3MWCA 1GVIA 4PMRA 3VGDA 4O18A 3AYVA 3RITA 4LVFA 4BQ4A 1F6KA 2QJHA 3VOJA 4AY8A 1KBLA 1EF3A 1GNXA 3BH4A 2A3EA 3D3AA 3AMGA 1BXBA 1AFSA 2H3BA 2VFEA 4IXHA 3GS6A 4NZ4A 1A50A 4U28A 3WD0A 5DF0A 2EQDA 4IP7A 4KFOA 1AH0A 4IFOA 4CQDA 3KBSA 3CM4A 4G5DA 3TX9A 4PB5A 1R5YA 3L4ZA 1TZZA 2OWCA 7REQA 5AZ0A 1V3HA 3AUOA 1UCWA 4F3HA 1Q6EA 2F38A 2WMIA 1C3FA 4UZUA 5D2XA 3R8GA 3V5OA 3GXTA 1POKA 1F3WA 4L65A 2DUZA 3CHVA 4C6NA 3S1VA 3TLQA 3TWBA 3NO1A 1O68A 2PAJA 4LS1A 2VFDA 5BXSA 5REQB 2DVTA 1TV8A 1L2UA 3N2TA 4RDYA 2X05A 4LBSA 2ICSA 5IFTA 2FDSA 2X8RA 5I0DA 4DB7A 3L65A 4J27A 3WCZA 2DDXA 2VFGA 2DIJA 4FHAA 3PPCA 2HNEA 5IHSA 1R30A 4UR8A 1BXCA 4ZMGA 5C9WA 1M7PA 4YTRA 3W2JA 3HF3A 3CV6A 3KOWA 1TWIA 1X8FA 4QXIA 3SCSA 2P53A 1LT8A 2VEPA 4O11A 2V5KA 3PJTA 3GKFA 3GXMA 4PYSA 1JL8A 1F73A 3M07A 1YLVA 3ZLFA 3BTNA 3II1A 3MUXA 2VD9A 1TWZA 5F2IA 4NHVA 2NSOA 2TYSA 4Z1BA 2ZICA 1AG1O 3ZWSA 1TE6A 2QJNA 1CWYA 4KGLA 1EUAA 4W84A 1OABA 1EOMA 4MKVA 4GCXA 1MQPA 4I6VA 3AHTA 3GNDA 2PTWA 4NJIA 5GNXA 4MNMA 2ESCA 4AC1X 1ISZA 4ILSA 3W1TA 1EJRC 4DO5A 2PBOA 2QIIA 5I6SA 1R3WA 4F2UA 4GQBA 3HM7A 4PUKA 3W7MA 1UUQA 3N9RA 3AXXA 1V93A 1HN1A 3OZMA 1NF0A 3EX3A 4LUSA 2J75A 3H6OA 1ZJHA 1H4PA 3CZKA 2QR6A 1EO7A 2ZRVA 4QAIA 1GJPA 1B5TA 2YFOA 1MXSA 2V69A 1X6NA 2GOUA 4GXWA 1MDLA 1XLLA 1VJIA 3SCUA 4LY4A 3WK0A 3GDBA 1E71M 3WY1A 4M0XA 3F1QA 1E3XA 1TV5A 3EB2A 1MYRA 3HQOA 4LANA 1W9DM 3KRBA 2WSRA 2H6RA 3WQWA 4E2BA 3DFYA 4AHOA 1GYLA 7TIMA 4U33A 1MW1A 2G3JA 2O0TA 1K9FA 2WK2A 3LV6A 3OO2A 1LBMA 2DUAA 1KKOA 1J5SA 1B9ZA 2Z6JA 3M0KA 3MU7A 4JS3A 3C2VA 1J0JA 4JFTA 1Z9AA 2R1KA 3SRKA 4FOUA 3WLJA 2BX7A 4BQ5A 4FK9A 2FZMA 4GUIA 1JPKA 4LEFA 3UGVA 2JGQA 4MUPA 4JTCA 4IMAA 4HVXA 1MZHA 2WW5A 3A3WA 1UYQA 3WG6A 1WCGA 5I24A 1PHQA 4H1ZA 4MFEA 2CWNA 3AIEA 1OBAA 2PDFA 2JF6A 1YDOA 4G1NA 3RPDA 1YTKA 1ZRQA 1BQCA 2HJPA 5DMNA 1DXEA 2ISVA 2VWTA 1FKWA 4DZAA 3V35A 3DC8A 3OP2A 3AISA 1BTCA 3W4RA 2ZXAA 1E0UA 2WZIA 1REQB 3ABZA 3URAA 4O1DA 2HK1A 1RBOB 1W8SA 2OELA 3VKKA 1CXFA 3VGBA 2IW0A 4ICNA 5L6UA 3RU8X 3UG4A 4H6KA 3PJWA 1OJXA 1ITQA 2QCDB 1ME9A 2CW6A 5DXYA 3BG9A 2EJAA 1DJHA 1F8MA 2Y7FA 3R89A 2JE8A 2ZZ2A 5I00A 5DT7A 4N7QA 1ZBCA 2ZFAA 1BPLB 3AS2A 1OFDA 1IR2A 3HJZA 4WKHA 4FSAA 4CCEA 3GDKA 2PLKA 1K4HA 3H7VA 1OHLA 4DJEA 3VDAA 1VIWA 5HQLA 1OCJA 3EX1A 3ZSSA 3VD3A 1PAMA 2OWXA 5HUPA 5FOOA 4IL0A 3RMEA 4HPJA 5GPRA 4KIRA 2OGJA 4JTEA 3MVTA 2BASA 5JXQA 2VUYA 6A3HA 2A3HA 1LTDA 4FR1A 1JIBA 1XLBA 2J66A 1P7TA 5LA0A 4JHZA 3HFYA 2IMRA 3VD7A 3ERPA 4YWSA 2BP1A 3G2GA 3LM7A 1JRCA 1BVZA 1B9BA 1XIBA 4B2DA 1F8IA 4YVXA 4E6MA 3U2EA 1KTBA 2VR2A 5EGRA 3EZ4A 1GVFA 4UR9A 4AIBA 1ZBWA 2E28A 4YL2A 4KRTA 3TYEA 3LXCA 3C56A 5BOOA 4GY7A 1H7RA 1D7FA 1XISA 1Q6RA 3UERA 2ZCGA 3QGVA 2NWRA 3H22A 2WB5A 3H2CA 4P8VA 4K3ZA 1MFUA 4LVDA 4UQBA 4ZB0A 1SYTA 3C2RA 1C8QA 3NL6A 3KVLA 4WDWA 2CU0A 2BHUA 3H21A 1BF2A 3AMCA 2GVJA 2QPSA 4GE8A 1K9EA 4O1FA 4WX2A 1FQ0A 1XF0A 1GVSA 1C8YA 3AIVA 3T05A 4AZGA 3UGRA 4DAFA 3PPFA 4RNJA 3N6JA 3TMLA 3RN6A 1EIBA 3O9NA 3O07A 3RILA 4ZODA 4WXYA 4C7GA 4MADA 4FS9A 2FVLA 4IUOA 4MZ1A 1XCFA 4WCJA 3T8LA 4AC7C 1H1YA 1YEYA 3B3DA 3E5PA 1Q6DA 3DKJA 4V2XA 2I1OA 1PE1A 3K4AA 1Q2SA 3MUAA 1WKFA 3EWWA 1BSLA 1JCLA 3TTYA 4FF7A 3UXDA 3V75A 1XBVA 2NSXA 2G3NA 1I1XA 3W7IA 1GGOA 4R7JA 3W7CA 1KNWA 2VT0A 3S9IA 2CZ5A 1VB9A 2YB1A 1UKQA 4BR1A 3CZGA 4QG8A 1PWLA 3WKZA 4XAYA 1JD7A 2A3BA 3BMXA 5HNRA 1XS2A 3EMQA 4H83A 4Z2LA 2HCVA 3B4UA 3LLDA 3W76A 2WHMA 4LRSA 4B4HA 5B7YA 3KTSA 2QMJA 1YX1A 4D72A 4B5XA 4W9TA 1WO2A 4A3QA 2X0YA 3NM1A 4QSFA 4EVZA 5AHNA 3SCOA 3HTWA 4A22A 2ACQA 1T40A 3BJTA 1XC4A 1V6TA 1KFBA 3W6MA 1MFVA 4LTSA 4OZOA 1OG0A 4HIBA 4DUVA 1BG4A 3M43A 1UB3A 3AUJA 3T55A 1UP0A 1V4YA 2AL2B 4O17A 2BVTA 3WNLA 1WYIA 3PNUA 4JTDA 4R9XA 5DELA 2VEMA 5GQBA 1GHSA 4GO8A 3LSBA 5F2GA 2O4MA 4WLCA 2BV9A 2VJXA 4LCSA 4QBXA 4PCNA 1RCQA 1P5BA 3B0PA 1J12A 2ZE0A 3KVKA 4M7SA 4RZ4A 3PWGA 3V36A 2P3ZA 2I16A 4AZ7A 5DEZA 2J7BA 5DMLA 1AZ1A 3RU6A 4CU6A 1SQ7A 1HL2A 3BLLA 3NQMA 3PZUA 3IK4A 4QG9A 4JTLA 4OGZA 1PBGA 1YBQA 3ANYA 5D30A 1EYWA 1OADA 1S1PA 2YW3A 3GY1A 1TMLA 3APGA 3UFYA 4B92A 4IIFA 1NAL1 2YL6A 3GBDA 1QBBA 1Y5WA 1JCTA 1XRTA 2J47A 5C5YA 2XH7A 2OU4A 3E0IA 3LK6A 4H9TA 5IBXC 3EA2A 1XINA 4HSNA 1UHVA 2PF8A 1JJKA 4GC3A 4NF7A 2E1DA 5FJOA 3STGA 2PDJA 2E67A 3DX5A 5KZMA 3WL0A 4W86A 2XN1A 3OG3A 3CZEA 1OGGA 3B06A 3G1RA 3N25A 3GU1A 2ZA1A 3LMZA 5T8GA 1XLCA 2XGBA 2AKZA 3VNKA 1F3XA 1R9XA 3M0YA 4DNHA 4IM4A 3R7MA 3W7JA 1IHIA 5FACA 4BQ2A 5MHBA 1SJAA 3GG8A 3KL3A 5CPTA 3I10A 1AODA 3AJXA 3O6AA 3GW0A 2AOSA 3KL5A 2QKFA 1E1FA 1W2PA 2W5FA 4AVOA 2V81A 2J24A 2ISDA 3SY1A 2NLIA 4J5NA 2BOGX 1QPNA 1FWBC 4IIBA 2GK1A 3W7EA 4MDPA 4I7VA 4DAIA 3P6LA 1E5JA 3G1SA 3MTWA 4UBPC 4LBRA 2V82A 4GKLA 2VVSA 4LC6A 1XUUA 4NAEA 5CLTA 1RY8A 1NDYA 5C6MA 4UOZA 2XM2A 3CUIA 5D9MA 1K3UA 5MKGA 4ACZA 2YXXA 2UY2A 3C2FA 2VZSA 1FVPA 5JBDA 4IMEA 3S5YA 3OJGA 4O13A 2C1HA 1VFTA 1E1EA 4TU1A 1P0EA 3CL7A 4JGDA 3VC6A 2O9OA 4RDZA 4UTUA 4U2ZA 2CERA 2F6KA 2HE5A 1BD0A 1T99A 3C3NA 2BWGA 1AVAA 4NILA 3W81A 2RFGA 4XBKA 4PBGA 3WQ4A 1O5RA 2AKMA 4W8LA 2WZEA 2ZA3A 3GTHA 2ZIDA 5FSEC 4HA1A 1J5TA 1K8ZA 3GH7A 4M81A 3RLUA 1JDCA 1JQXA 2J7FA 4HCDA 2QIWA 2C18A 2BB0A 4R5EA 2Z1VA 3R10A 1RHCA 3OIHA 1ZTVA 2G3IA 2FPTA 3PG8A 1P0BA 3BUVA 5CAKA 2EPKX 1S46A 1JDFA 1JGIA 2B31A 5ABHA 4WR3A 3N19B 3MZ2A 2GJRA 3A23A 5G2HA 3DFNA 1OWQA 2YB4A 3BCJA 5HOSA 2Y4SA 4IX0A 3MS8A 1KV5A 4GOAA 1DPMA 1JQVA 1YXCA 3QMSA 4RZ5A 4MZ8A 1ICSA 5SWUA 2VM8A 1RD5A 3R13A 2A1YA 3UG8A 4HU8A 3K8MA 2FZNA 3SN0A 4AHQA 1MW0A 3MT1A 4ZO9A 1HF6A 3CEUA 3UZYA 2ZYFA 3TNOA 2VFHA 1E56A 1UZHA 3HGRA 1NQ6A 1R7AA 1RSCA 1UD4A 1FWCC 2NX3A 1EJWC 1WB0A 5ECVA 3CJPA 4S3KA 3TP4A 4R53A 1UD6A 5A6AA 3TYUA 1XBYA 2ALDA 3BC9A 2GUBA 3QLDA 3HFTA 4Q7IA 4CCDA 2HS8A 4XSMA 4O8RA 4HGXA 4IJRA 4UCFA 5B80A 1E3ZA 2YDSA 4S2CA 1C9DA 4LFYA 1VEMA 1ECQA 1YNQA 3HJEA 4Q6XA 2YDRA 2DPEA 1WKYA 3W70A 2PP1A 3DHDA 2CLLA 1XLMA 9XIMA 2ZXQA 1UC4A 3K2GA 1CGWA 3SN4A 3NL5A 3SEPA 2IPJA 5LIKX 3EXSA 3THDA 1R3RA 3AHYA 3P8IA 2BSLA 1J96A 4KF1A 1F61A 1K9TA 2ZX6A 2ZTKA 4M7TA 4RX0A 3JR2A 4L9ZA 3PZNA 4R34A 5EBAA 4ZQCA 5TF0A 1EO5A 4HMNA 5HMDA 3GXNA 3Q58A 1PYFA 4LSBA 5FESA 3UXAA 1KTNA 4UTKA 2P0IA 1EXPA 3CUFA 1XGEA 1JFHA 1FCBA 4HCHA 4A3UA 1XKJA 4RUBA 1W3LA 4M6UA 3VDBA 2ZE3A 5I77A 4W4QA 1M65A 4OVXA 2O9RA 1U5JA 2VO5A 2HISA 3RLVA 3C2YA 4NNCA 3PSVA 2QGHA 3UJSA 2FQIA 3TW9A 1ZALA 3C52A 3KTXA 3DOPA 4PCFA 3CHEA 1CLVA 1GT8A 2FGBA 1A47A 2YKKA 3PULA 3T42A 4DJEC 1T41A 2OPJA 3GNNA 1IXQA 1J01A 1GOXA 3W6LA 3NVDA 6ALDA 3AHXA 3SCPA 5DXXA 1G4SA 3MSDA 4EXBA 4PMYA 4AX6A 3T8QA 3FS2A 5A69A 2E0PA 1NOWA 3GUGA 2HXUA 3BAYA 1A3WA 3UD6A 3VO0A 3G3DA 4FXJA 4QSHA 2PTDA 1TTQA 1UJQA 3HN3A 2QAPA 2QMKA 3HPFA 5D4YA 3O3RA 1KM4A 2PEVA 4ZOAA 3G1AA 1BXNA 1RK5A 6XIAA 1VCGA 2XFWA 4Q4KA 1QBAA 1BHGA 5DRCA 5AFDA 2XFYA 3C61A 1E9LA 4IZGA 3W1AA 4QEEA 2NQLA 3ABRA 3WK2A 1VCFA 4AEOA 1CXHA 3D46A 5CZTA 2J9ZA 3GNRA 4RDVA 4JQ2A 1QUMA 1M3UA 4LYQA 3CMFA 2BY3A 1AJ2A 5EMYA 4JN7A 3QXBA 4DI9A 3RCYA 1LL7A 3KZPA 4HNLA 3PB0A 3BLDA 1JD9A 2X42A 2GK1B 1RPKA 1V6VA 3BSHA 3UW6A 4B16A 3P5ZA 2HV5A 3KDOA 1OK6A 5I23A 4M82A 4PL1A 4RW5A 4XZNX 1UP3A 3IK2A 1JVNA 4AMCA 3CYJA 1PWMA 2WANA 4ZQNA 1C90A 5HULA 1U5VA 4B15A 1E1CA 5E6ZA 3WQCA 1Z6KA 1Z89A 1XD0A 2HWGA 4QR6A 2VZTA 4XTDA 5BNKA 2HK0A 5HJLA 3BW4A 2BDQA 4DJDC 3DIPA 3SQLA 4N9CA 4J3XA 2PDIA 4L7ZA 2HVOA 4AUBA 2QHAA 3LHZA 4MAZA 3BJSA 3IJ7A 3KUMA 1OINA 4IUGA 3O0KA 3P7YA 1KFEA 4H8NA 3R0KA 4H7VA 1A5CA 5FAGA 1TV4A 4KCVA 1K6AA 2X0SA 1VFOA 3CIVA 4PCTA 1KRAC 4PUNA 4JOMA 5BRQA 4O50A 1VS1A 1DJZA 1Q6OA 4C6QA 5A2BA 2YBTA 3WBEA 1F5ZA 4L6OA 3WQFA 3NCOA 1UP2A 3L4UA 3BURA 2IPFA 1NFBA 1TTJA 2OT1A 5FJRA 5HQMA 4LXFA 4ZR8A 1HZYA 2QGYA 2CWXA 5A2AA 1VBGA 3CHDA 1AQMA 4PMQA 1WX0A 3S2NA 4WQ6A 2FIQA 5F1VA 5AC6A 4A35A 3PNZA 4PZVA 4V33A 1ESWA 1R47A 3T2PA 5JH2A 4HK5A 1GW1A 3B40A 2OYLA 3P2VA 5ABFB 4IPJA 1BEUA 3B8IA 1PO9A 4MGGA 1W5OA 2Y7GA 3N6QA 2XWEA 4QJ5B 4X3ZA 2VEFA 4KKXA 1SZNA 2REQA 2BG5A 1PKYA 3NL2A 2DW6A 5BYWA 4DM1A 2OLHA 1EDTA 1QO2A 4XIAA 3ZOAA 4N02A 4RW3A 4ZEPA 3QQ1A 4CNNA 3WBAA 1HFBA 5AKQA 3TWAA 3E0VA 4GJIA 4DJDA 4F2TA 3SUWA 3L2LA 1X6UA 4J1OA 1FH8A 3GTNA 2Z29A 2CBVA 5AYZA 1XRSA 2YCEA 3GTFA 1TIWA 3AROA 3DAQA 2ZXBA 2CLPA 3BMWA 4C5ZA 1GVOA 4MNKA 3WQ6A 4D6GA 2XZ7A 2DH2A 4F0SA 3L4WA 1JZ6A 1Y65A 3T78A 5M1TA 4BWLC 3AHVA 1C7TA 4IX2A 3LB0A 3B4YA 4HOZA 4L1WA 1BKHA 1W5MA 5HBFA 2J9YA 4UTWA 4GIRA 4MTVA 1EUNA 1FKXA 2TPSA 2YL8A 4MB4A 3EWDA 3QC3A 4UFHA 1S1RA 1ZHAA 3OA3A 2Z27A 4OBSA 3H26A 3RM8A 3WL1A 3HPZA 4IPLA 1J18A 5G1MA 2QCHA 1ZCOA 1ONWA 4LPCA 2JIEA 3W86A 3V0SA 1SW7A 3KWSA 4IPIA 1P0KA 3E1F1 3VIMA 4GZIA 3TQVA 4TXEA 4PUUA 5DCBA 1DJNA 1GK8A 4WOQA 3R58A 1OD0A 1W3IA 3R94A 4C6JA 3T08A 3URQA 2ZZ3A 4K6AA 2OVLA 4UMCA 3TYDA 4DF0A 3O63A 2DJXA 1W9PA 1DIOA 4GVIA 3POCA 4MJMA 1V51A 3V0TA 3U7BA 2WJEA 1JF5A 5BU6A 1XV8A 2YLLA 2WJZA 1O1HA 3JU2A 4Z2IA 2UBPC 1ISXA 3EWXA 1M9HA 1F07A 3L4TA 3PG9A 4HSOA 2J27A 1IQ8A 3KVMA 2ZVRA 3U2CA 5CC3A 4P8XA 3SUVA 1QI4A 4DWSA 2PLMA 3UPBA 3GHRA 4NJJA 3DXIA 1QW9A 4CGTA 4LAOA 4NUWA 1UIOA 3FFSA 2Q71A 4O15A 3G77A 3M7SA 1SZRA 3I7RA 4N9EA 4Y9MA 1UROA 3CK5A 1J9YA 1EJSC 5D32A 2GFTA 3V1PA 3DCPA 2XH2A 1W9XA 2YZRA 2VGBA 3OBKA 4D6HA 1HJSA 2VOTA 4PEKA 5CKSA 4C90A 1QR7A 3R43A 2D2HA 4KWWA 4L6HA 4EPBC 2GYIA 1VBJA 1YMYA 2IQTA 1SO4A 3VDCA 3LCGA 5XIAA 4ZVJA 2TODA 2CETA 2PB1A 2H3DA 1W5QA 1E9IA 1E73M 3C0LA 3ITLA 2CXEA 5KETA 3WQ5A 1UA7A 3FIGA 2OX1A 1TVLA 3T2QA 2FVKA 1TJ0A 2HXTA 3DERA 3ITGA 5I3FA 1DIEA 2VEGA 3PTDA 4C1NB 3SDOA 5DX7A 3H54A 1A0DA 2ATMA 3GWQA 3S83A 3WDIA 3KCLA 1EOKA 3QM3A 4HJWA 3CZJA 4IJBA 3G22A 1KKRA 2EPNA 2RJHA 3F4CA 2PRMA 3CL8A 4J35A 1LJYA 1JZ8A 4JTHA 3ARRA 3ES8A 4BY3A 2OLAA 3ABSA 1H0GA 2Z1BA 1NU5A 2B4GA 3CAWA 2YA1A 4TTGA 1G9HA 3MHFA 2ZX7A 4YYFA 2OODA 4TO8A 3PVFA 3DENA 3EWCA 5FF0A 1KFWA 3HGSA 3LCIA 2GGGA 1OK4A 1JYNA 3QPEA 3WK3A 2XINA 2PDWA 5CLWA 2Y85A 4Q32A 3UF9A 1CXIA 3WEOA 1HKIA 4LUSB 3L2IA 5A5WA 1XD1A 4XZHA 1KXHA 3TN6A 2AGTA 1B30A 1HKMA 4DBDA 3KOZA 4YTSA 1QPRA 3QOMA 4Q3MA 2BY0A 4CU7A 1P6WA 3C4UA 4R7WA 1W0MA 1E6PA 4MWAE 4H41A 4JEJA 4JFWA 1IV8A 2PZNA 2QZRA 3GR4A 3SI9A 4HBKA 4E4UA 3RNDA 1R3SA 1KBIA 2EG7A 4GO9A 5BRPA 3LOTA 3RPMA 3UT0A 4NX5A 4HYWA 4XD4A 1AD1A 4DYEA 1BTMA 5G4HC 1DE5A 2BLEA 4L61A 5DCEA 2ZZ6A 1JUBA 1S2WA 2CBUA 3V7PA 4LYPA 3C0SA 4GIYA 1ELSA 1CB2A 4C91A 3OLEA 4AYGA 3MMWA 3GTIA 2E1WA 1OFOA 1UH3A 4WVXA 3ZO9A 3NO5A 4XKYB 4A6GA 4BWLA 1MI3A 3PUOA 4DXXA 1EZWA 5HWJA 3RX4A 3SGZA 3G0UA 1PJ9A 3ALGA 3WH9A 3BK0A 1TR9A 1GYNA 3OLGA 3L7RA 3TUUA 1B4EA 3PBVA 1KXVA 3I3DA 4NZ3A 3H23A 3BLEA 3HURA 4AH7A 1HKVA 3NEHA 3DYPA 2R1NA 2YXGA 4WD0A 4DY1A 1LOSA 4H7CA 2GDUA 3EMCA 1VPXA 4MY8A 3RG6A 3SSZA 4X63A 1J0YA 4P7QA 3NVTA 3CZLA 1OYAA 3IVUA 4PMUA 1XFBA 3N11A 5EA9A 2FHCA 5KEZA 4JX5A 3FSTA 4DBUA 3JS3A 3UJFA 3I6RA 1CNVA 3OHMB 3WDQA 1BAGA 2C0HA 8XIAA 4DN1A 4DYJA 3CT2A 3VNYA 1C92A 3B04A 2NLYA 1AMYA 2B81A 1UUMA 1E5NA 2QJGA 4C1LA 3W2LA 4GINA 4JKLA 4QJ4B 2FTYA 3URBA 2QCEA 2HPIA 3CUJA 5FEPA 4LF2A 1H7WA 1E4NA 3KS5A 1LBLA 4MYAA 1JAEA 4US5D 3QW4B 4M6PA 2J6XA 3ZMRA 2QVNA 2RDUA 4M5PA 4CQAA 1KBKA 3WFLA 2YCKX 4B9YA 1QOPA 5HR6A 4AVFA 2Q8XA 1CLKA 4I5XA 5A6BD 3L4YA 5D2YA 1RVGA 4C6BA 4W5ZA 4A3RA 4PBEA 4ZFCA 4AIEA 4I3GA 1MO0A 5JBEA 5T91A 1GZ1A 1Y5VA 1GOWA 2FZBA 1QWKA 4Z0SA 4WF7A 1JUKA 2ATSA 3D5HA 3WBYA 4F40A 1H11A 5FAJA 3TLLA 3LSCA 4YU1A 3FLUA 2QDHA 1RLDA 4H8UA 4US5A 3UJRA 3AWNA 3DDMA 3PBUA 3G18A 1CTNA 3ANUA 4UTHA 4TMCA 4YHEA 2A7RA 1UD5A 3HU7A 4F0LA 2IKGA 4PR4A 1H0IA 4I7WA 4ZO6A 1FFRA 3M6YA 4P7OA 3WLSA 3RYSA 1C29A 1XYFA 2NXHA 2ZWYA 1M7XA 3RX3A 1KGWA 4LX4A 3LTPA 1EP2A 3MSRA 4NASA 1DHPA 2VURA 4L56A 3EYPA 4DRSA 3EPMA 1EJXC 2BY2A 2WNQA 7PTDA 4IISA 1IXNA 3VPLA 4QJ1A 2V5BA 3ARQA 3Q94A 4QP0A 1LL4A 4JTIA 1QJWA 1ONXA 4G2DA 1QI2A 3B9NA 4HNUA 1NELA 3IAQA 5D03A 4C65A 4TV6A 1O4UA 2Q09A 4XAPA 4GG9A 1QO5A 3CBWA 1W3HA 4HSHA 1BVNP 2W6RA 2R24A 4X60A 3ITXA 4S3CA 4JYEA 2O7SA 4W89A 5A6TC 2WCAA 5DY2A 4V27A 3M5VA 1W91A 5B7ZA 5C71A 1J0ZA 3TSDA 3QSRA 4KWSA 4LAZA 3FEQA 2ALRA 4CD4A 1Y8BA 4YMZA 2R1MA 3NURA 3OBAA 3RR1A 3TSBA 2W61A 5A8MA 2XYLA 4D8AA 1WAUA 1OY0A 4YS1A 3QPZA 3IIVA 3MKKA 3S6DA 1HQTA 1YNPA 1F3TA 3NPWA 4W85A 2FYMA 3WD2A 1JR1A 1HKKA 3FYPA 4O1BA 1UC5A 4L4MA 2C79A 2ZOXA 3MKVA 3LHWA 2PSNA 3EPOA 2UY4A 4GI6A 1MEIA 5D33A 1O94A 2OGYA 3OVRA 2VFFA 3UZXA 2ZUWA 5DMMA 4KBXA 2P8BA 5AYIA 4S1FA 4ZQRA 2DZTA 2XZ9A 4DUOA 2VOMA 4Q4QA 4AB4A 1MMFA 5EFFA 4WSJA 2JK2A 2ZZ7A 2Y61A 4GZ7A 3THUA 1JEZA 3IJQA 4IIDA 3OEXA 3PB2A 2PZ0A 4ZTYA 5KZ6A 1FWWA 3WJZA 3HQ1A 1DJQA 2CHRA 2OKOA 3GXFA 4PMOA 3N6HA 2CLKA 1MQQA 4ICCX 7XIMA 2WNNA 4F0HA 3FY1A 4GHRA 3ZJ8A 2FZDA 4K68A 1KD0A 4FLSA 4AWUA 3ELFA 1J0KA 3A9IA 3IGHX 4HZ8A 3QJAA 5JMUA 4QE1A 2YYUA 2V0TA 4LF1A 1SUXA 3R0UA 4OECA 1OFPA 4S23A 1S2AA 4UTTC 3PZOA 3SCQA 3AYRA 4HNVA 3VKAA 3A4XA 2Y8VA 3CUZA 2VX6A 3ARUA 3A5VA 4WKFA 1ZP4A 2ZUMA 3SFKA 1JPDX 3VC5A 1W2VA 1JNDA 3TTQA 3CGTA 4ORIA 3B05A 1H09A 2PGEA 2PRHA 3VOGA 2VUNA 5CXPA 1KFJA 1GZGA 2I14A 5JUVA 1KBBA 1UOZA 1T5AA 4W7VA 3BAKA 2EPOA 1J10A 4Q4SA 3N9SA 1WDDA 2XVKA 1FBAA 4UFMA 3N15A 2V9DA 1XCXA 3WUFA 4B2DD 5LXEA 3UQNA 1B0IA 1LZOA 1KRBC 1R86A 4LUIA 1XIEA 2A7NA 5E0FA 1N55A 1IT7A 5D8ZA 1XYMA 3NA8A 1DXFA 3PUDA 4QDPA 3VOIA 4HPXA 5I3HA 5C9UA 1OSEA 1HJWA 3NWRA 4AX7A 4G7EB 4JQ1A 4HK7A 3G6LA 1E9ZB 3VIGA 3WQDA 3O6YX 2OFJA 4EF8A 2OMAA 2OO0A 1VFUA 1F4AA 2EHHA 2WMIB 3N4EA 3S9ZA 3RCMA 1PDZA 4DLMA 3C8FA 3IJLA 3V0UA 5IBXA 1HUVA 3PFMA 2DZVA 3N18A 4JTSA 4LB4A 4S3FA 2VP8A 5CPOA 2OZTA 2G97A 4FEZA 3ANVA 3K46A 2G3FA 1RJQA 3MO4A 3W07A 1XR2A 2ONEA 3VDGA 5DLCA 4QISA 4NXSA 3DKLA 3IGSA 3DU0A 3PZGA 1XLIA 5D2VA 2WHLA 1FCQA 2H9AA 3N29A 1PZ2A 1WDSA 1ZJAA 4QQUA 4UQ9A 1GVEA 3CT7A 1R0MA 5I3GA 3Q65A 3W88A 4UFKA 8A3HA 4FNPA 3PZIA 1LOLA 3SQMA 1GQJA 2CFFA 3MJYA 1V08A 2W0UA 2PWHA 4KERA 4H9VA 1KGXA 2XISA 3QV7A 3P5YA 1AL7A 2PWEA 3TR2A 2RH9A 4W87A 1L6SA 1FFQA 2XSXA 2OT0A 1US3A 4PCSA 5TAOA 3EB3A 3KBVA 4DBWA 3W28A 4HPHA 1VBUA 3NZPA 4KFPA 1C7SA 5MKGB 1V0NA 2J78A 2J7DA 5K4XA 2GOKA 4PUDA 1XXXA 4Y8EA 5KTLA 5J8LA 4NAEB 3CQIA 4CQBA 2FB3A 1TFVA 1D3GA 2Z28A 4KEZA 1VKFA 5E6YA 4M24A 2E5CA 1EF2A 1K7XA 4O0KA 1E70M 3E0LA 1G7VA 2YW4A 4C6DA 2Q3RA 5HA7A 4BEQA 2RJGA 2YA2A 1T8XA 3DBNA 3UPMA 1U2YA 2VX4A 5G5IA 5CSUA 4E4FA 1PSCA 4L4OA 3GC5A 1PVNA 4JTQA 1O12A 4B5NA 1RAKA 2QT3A 1F4HA 5CSYA 3WENA 3PC0A 3LNPA 3TC7A 4MB1A 5K2ZA 4MM1A 1PHWA 4FNSA 1YPIA 1SR0A 3RRXA 5AHLA 1W56A 1AJZA 3IJ6A 4QDWA 5MF5A 3GZ3A 1XLGA 4E2DA 1FXQA 4CN1A 3W29A 3A9BA 3NQ7A 4TVUA 3OYZA 4HA3A 1JDEA 5AY7A 4TUFA 1UWRA 1TPC1 3UCQA 3HPAA 3WUBA 4H2CA 1M5WA 2VQTA 4IJCA 4KGJA 1DKWA 4RKAA 3V1HA 4LB3A 4JEQA 2XIJA 5BMXA 1WNOA 2PE4A 1HO4A 4P7LA 1TQXA 5G1YA 4BA0A 5D8WA 1HVXA 3SIZA 4CUCA 3H24A 3UZWA 1BKSA 2DY3A 4YN5A 4D6IA 3NPXA 4J3SA 2EKCA 2FZ8A 1XICA 1WXZA 2EBNA 3B8SA 3IS4A 4MIMA 3QH2A 2JBMA 1GWJA 2Q02A 2HBVA 4LALA 4UQCA 1H63A 2ISSA 2VDHA 2WSYA 3N04A 1ITUA 1L6FA 2QEZA 3CH0A 3MUZ1 3YPIA 4BS0A 3DFQA 3ARTA 1WKEA 4N4QA 1XC6A 1VENA 3E74A 4UMAA 3F5LA 1VIZA 3CQKA 4ERAA 6ENLA 3VNLA 3WH6A 3BAIA 3HG2A 3OW1A 1JCMP 3EB4A 4XBSA 3WD1A 3G8EA 5HPOA 4GYPC 4H9ZA 3UJ2A 5LIUX 1YNYA 3M0HA 1HTIA 1A5LC 3ABQA 3RMJA 1M6JA 4KIEA 1GOQA 1VLIA 2KZHA 1FHLA 1S2TA 4H6QA 2HPMA 4Z0JA 4NL1A 1KC7A 4HYVA 1FHUA 2DUXA 2WMGA 2WSKA 3M41A 3WFZA 5EKYA 3WNMA 4H9XA 5A8QA 2DIKA 1Z7AA 2D2OA 1EGMA 4JTUA 4RE2A 1A5KC 4QLJA 1QASA 2WLYA 4QX4A 5D38A 1G6CA 3PTQA 1EX5A 4UTWC 4IMGA 3MV01 4GJJA 4CD6A 5BRBA 3BPWA 3CV2A 1Z32X 5C2GA 5LHFA 3TEVA 5U4NA 4LQ1A 3U5UA 2FJKA 5F4XA 3NPUA 4NAFB 2XM1A 3GDMA 3RM4A 1TVNA 3MQTA 2FGZA 2P3EA 3VCCA 1W17A 3VIPA 1R9ZA 5A2CA 3KTCA 2ISFA 2WKLA 3AIWA 2XHYA 4FAMA 3NL3A 1N82A 1RQBA 1UBPC 3T4WA 2QV4A 3C6CA 5CBIA 3APTA 1W32A 4XWUA 3TZNA 3PTMA 1VPQA 3GDRA 4TQTA 1ODZA 4G56A 1LDCA 1VAHA 3PZMA 4UQAA 4S3GA 3D6NA 4Z2GA 1JG9A 2XIMA 2Z7KA 1G7UA 1BWKA 1E51A 5E9XA 2AAMA 2YL9A 2POTA 3KHDA 3VA8A 1VCVA 2FKPA 3W1LA 2INZA 1JYXA 1N7KA 5D05A 3S8HA 3FYYA 3N1AA 4M3PA 2QQ6A 1KRCC 5DO8A 4IGMA 4UNKA 1C93A 4DQWA 1BWVA 1W3KA 4B9ZA 4ZOBA 1JXKA 4JTKA 3N2MA 5FEXA 3VU2A 3GFXA 4HNOA 1AL8A 4ZBCA 1LROA 1W1ZA 2ZADA 3TN4A 3RM9A 4RPQA 3KOYA 5JQ9A 2OSXA 3R8RA 1OF6A 2ZRWA 2J8GA 2KX9A 3FKRA 2PODA 4E3VA 4FLRA 3B9AA 4HKPA 4KH2A 3NQ8A 3B8VA 3AZTA 1J2WA 4GZEA 3GTXA 4BFAA 1XH0A 3UETA 3NXFA 4L4PA 3VZYA 3NQAA 1YYAA 4P7NA 3M5ZA 2E9LA 1VF8A 1H41A 3BQ6A 3G0SA 3TSMA 4ZB2A 3IV3A 2J4GA 3REQA 1H1ZA 3FYOA 3WH8A 4DYKA 4AFYA 3L4XA 2HVMA 3H53A 3B8WA 4AF0B 2WMJA 3HG4A 1TVPA 3P0WA 3UCCA 4V15A 4OFCA 3HQPA 1B2YA 1W1YA 1PS9A 3W71A 2V30A 4DWDA 1O6IA 3LHUA 2FPYA 3ATYA 3TFXA 3KBJA 3TVAA 1S2UA 3W6YA 1UR1A 1LT7A 2ZBTA 3THQA 2R8WA 4WHBA 4YTUA 3B8TA 3Q4DA 2YX0A 1JI2A 4MB3A 4XV0A 2A6LA 3ZLGA 3UR2A 2EJ1A 2OYMA 1OX6A 3O8AA 2H90A 4NU7A 4XAGA 2E4TA 3BARA 1AUSL 2PDLA 1V0MA 4JFVA 4K2SA 5FF3A 4HN4A 2R6OA 4PB3A 1UR9A 5HNNA 3UA3A 1DV7A 3VIFA 2OTDA 2Z25A 3UYIA 3WX7A 1P0NA 7A3HA 1EHAA 3QR1A 4Q4RA 4X61A 4CVUA 2PWFA 4XIMA 1NP0A 1H51A 4KWUA 5EFDA 3NYDA 3WDRA 3T0CA 3M0MA 2XDFA 4RXGA 1GONA 3NYZA 5HMEA 4L1GA 1DQUA 3WDJA 1Q85A 2VGIA 3SY5A 1EJUC 2RDXA 2FZ9A 3S1WA 4AWEA 3UG3A 1S5MA 1JZ5A 3EOLA 4WSHA 4O4VA 2FB2A 3N9KA 1CEOA 1Y7VA 1JCXA 1ADDA 5E9AA 4JQ3A 1D3HA 3A3XA 3B0VC 3WUGA 1B1YA 2BOEX 1M1BA 4IPPA 4MJ2A 3W1NA 3GD6A 4EACA 4Z1AA 3EOUA 1DTNA 2IKHA 3OVPA 1QRQA 3I6EA 3O0FA 4MFDA 1HJUA 3CASA 1H1NA 2CNCA 3TYCA 4IT1A 5DMYA 1V0KA 1IEQA 5LHEA 3GW3A 3BLIA 3MCMA 3CTLA 4AZCB 1QOQA 4EANA 9CGTA 3JZEA 3P14A 4Y9NA 3VKCA 3L0KA 3W72A 3LDVA 1WDQA 1UZDA 2IQDA 2PMQA 3KRSA 4A21A 4O0ZA 3MDUA 4IIGA 2PU1A 3G6MA 1Q7MA 1B3OA 3TAKA 3EKZA 4UXDA 1X6LA 1W5PA 4GQ0A 2PA6A 3SCNA 4MWAB 3AZRA 1UWUA 4RDWA 1OCQA 4D1IA 3QHNA 1MQRA 4ADTA 2RUSA 3AWOA 3S4TA 2ZRYA 1IWPA 1IIHA 4XX6A 1H7OA 4TV5A 5H8UA 4DJED 3CTTA 4CCCA 4C6LA 4KWOA 5LGZA 4QJ3B 4GBDA 4DZ5A 2V5LA 3GXPA 1DIDA 1KM0A 4NP7A 2VCBA 1H60A 5GVJA 5HPCA 2QUVA 4HHLA 1M7JA 5HUOA 1QMLA 4A2SA 3QVQA 3DN5A 2IPWA 1TPVA 5M2FX 2ADAA 2GVEA 1TRDA 2A0NA 1GVQA 4UOQA 1YPFA 3WNOA 2VX7A 4EKJA 1TRIA 2WMHA 2AMXA 2JEPA 2QCNA 1KB3A 2VDGA 4ZXLA 3OHIA 3LMYA 1OC6A 1ZAJA 2X30A 2A6NA 4PTXA 4OU1A 3AC0A 3WMLA 3O7UA 3SY8A 3ZT6A 3AS0A 1CXLA 3HPXA 4UIOA 1UD2A 2DSVA 3TJIA 4PMZA 3QR0A 2ZKMX 1K02A 3F2CA 1EHNA 1GEHA 2Y88A 5HXMA 2E6YA 2WVVB 3E2RA 4ORMA 5C2XA 3O06A 3CB8A 4MLJA 4Z1CA 1P7TB 3FA5A 1XUZA 1X39A 2Y5JA 4S39A 4QLLA 4K7VA 5AB3A 3BICA 1UQYA 2ISWA 3F4NA 3BSMA 5AECA 4QNEA 4Q4OA 3PY2A 4ZB5A 3IPWA 2RDTA 4PSRA 4H19A 3QZ6A 3RJYA 1VRXA 3UWEA 3W24A 4XAFA 1I2QA 5IDIA 3VYLA 4UC5A 4TIMA 1D8WA 4RNFA 3OA5A 1EGVA 4C6CA 5DANA 2HDJA 3H2NA 5IDZA 1DL3A 1XCWA 4AZ6A 3GNOA 3LTYA 2WCSA 2BHYA 4FPSA 4GH1A 4PUMA 3LUTA 1B3WA 1MXGA 4MB5A 3LZ3A 3U7VA 4IOTA 5T9CE 2FGLA 3KE0A 3TKFA 3P82A 5JBFA 1IGWA 3WLPA 2GL5A 4Q8TA 2CHOA 3QPYA 3SR7A 3WSUA 3R4IA 3ABXA 1V6UA 2G5WA 1VFFA 4ZZ9A 4K1WA 2I5QA 1A0EA 3QZEA 1Q3NA 2A85A 3U3HA 3WMBA 4WKAA 3BWWA 5BROA 4UWMA 3S2JA 2D2GA 4GMEA 1NWTA 7CGTA 2HE8A 3CQJA 2C8NA 3LTSA 4LUYA 4CLMA 1FDJA 2WM1A 1AH3A 2QPXA 4KS0A 5CBBA 3HGJA 4AWSA 1XLJA 1VYPX 1I6NA 3M0JA 3W7KA 1D7KA 3F5JA 5CCZA 3GH4A 4WEVX 2DZBA 1H7PA 4A4AA 3RHGA 4C6PA 5BOFA 3OGRA 3LX9A 5CGTA 2WVVA 2AMGA 3BZJA 1W1B1 1UOKA 4A29A 1BQGA 3A6OA 4DM2A 3PBGA 3A3HA 1UKTA 4FP1A 4Y90A 3U9IA 2H9AB 4D8LA 2J9XA 1EXBA 6TIMA 2E6AA 3CPUA 3PJUA 4LAUA 1VJZA 1OCBA 3ZJ6A 4H04A 3U48A 2WKGA 4Q8OA 1AW5A 1TPB1 3GNPA 2R9RA 5F7UA 2HZGA 3PWAA 4FIQA 4UOJA 3T09A 1Q65A 4YYCA 5HAOA 3VFLA 8CGTA 2ZUSA 4M80A 4CQ9A 5HDRA 2Y2WA 1AJ0A 4AYSA 3STEA 3TK7A 1CYGA 3VIKA 3KXQA 3WLNA 4QAWA 1K03A 7TAAA 3W7PA 3ZXWA 5HNTA 1XW8A 2BVYA 2C0AA 1V3JA 4O28A 1X38A 1HXJA 3DG7A 3UVAA 1YADA 3FVDA 4AIOA 1DP0A 1A5OC 4CEUC 3IIXA 3QGKC 2C1IA 4MAVA 4ROPA 1Q4NX 4DELA 4Y8FA 2Y24A 4HCLA 1Q7QA 5EB8A 1A3XA 5J5DA 2RHGA 2PGRA 1TELA 4TX6A 4UCGA 1TCMA 4HA0A 2MANA 2Z1WA 2V63A 4DVOA 3VNIA 4L9XA 4JTGA 4JNZA 3PZVA 1K7FA 1SFTA 4NI3A 4WJXA 4UQDA 5A6MA 1RP9A 4W88A 1SW3A 2EPMX 1E43A 1Q6LA 2PDHA 2WM0A 2A3CA 3LGGA 2CCRA 7REQB 1HL9A 3LQGA 4MG4A 1ZAIA 4AW7A 5U7SA 3FEMA 4I9AA 2XU2A 3BCDA 3TE9A 1IT8A 2ZZ1A 2XIQA 3GVQA 3TOYA 1AQHA 4E5TA 4M6VA 2GGHA 4UFIA 4MNJA 1O1ZA 5LGXA 3NSNA 3M6DA 3LYEA 1V6WA 4GFSA 1PYMA 3GDLA 4I9MA 2D3LA 3MUY1 5DT5A 2FLIA 3N2OA 4HNNA 4JQAA 3GVVA 3VIIA 3V18A 2X2GA 3AOFA 3AXIA 1N8WA 4O10A 2A79A 4IXXA 3VKBA 4OT7A 3PBYA 2QF7A 4XZ9A 1XJBA 1JPHA 4JD4A 2OQYA 3HO8A 4HOWA 4ZQOA 2CLIA 4KRZA 3IUIA 1ZP3A 2CLEA 3HA1A 4OWGA 4M1BA 1WUEA 1DWIM 3GAYA 4QGCA 3VDHA 2DSZA 4W7UA 2AGKA 4AZBA 3QV9A 1FA2A 3AYSA 1ZQ5A 1CX9A 2DZPA 3MP5A 2HVNA 4ALDA 1QNQA 3L4VA 4LRTA 2WNZA 2W66A 4J3VA 2PCQA 3N2BA 1E72M 2FH6A 3SUSA 2QCCA 4FOJA 1UH2A 1E1CB 1SJCA 3UCDA 1E9YB 3RLHA 2F2KA 2PWDA 1WZMA 1MDRA 6CGTA 1JAKA 3GO2A 4GIAA 1JNEA 3HOJA 1GYMA 1OG6A 4JBRA 1C8XA 3G24A 1JZ7A 1GG0A 4EXQA 2V3FA 2NZLA 1XDMA 2Y70A 4ZL1A 5A6SA 1XX1A 1W37A 5LNVA 4ACZB 2NVDA 3S5ZA 4KPLA 2G0WA 3UNTA 4B5TA 3R6IA 3QOKA 4LUTA 2BGQA 1RJRA 2C71A 3TYBA 1XIHA 1MEWA 3R0DA 1YPXA 3MVIA 4HNCA 3BV4A 2QUUA 2O4QA 4DNMA 2WJFA 4N9DA 1NP2A 3MMUA 4HB7A 5G2WA 4UTJA 5AHIA 3BW3A 4PEEA 5CJMA 5C0QA 3T9PA 3CUXA 1FWTA 1A4LA 3E2VA 1KTCA 4C1KA 3M44A 3N73A 3VAVA 2QPUA 2AQOA 4MYXA 5AC8A 3AU6A 3LPOA 3IJIA 4JX6A 3E5BA 2UY5A 4QCEA 2GJXA 5F4WA 1HP4A 1C9WA 1BF6A 4HHPA 4A3YA 1F6PA 3KBWA 5I78A 5E0CA 4MDOA 3PWIA 2D0FA 3OZYA 2VVNA 5FA5A 3LA4A 2X0HA 1L8PA 3MUIA 2NQHA 1N8IA 3LPFA 4WGXA 3UP8A 1W1TA 3URNA 3BOXA 1EWDA 1TPFA 4BI6A 5I3IA 4Q8PA 4FMVA 1KM2A 3C3UA 4RPPA 4RCXA 1YIXA 5I7GA 3HGOA 4D6CA 3P0XA 4PTWA 3HB9A 3L66A 3UWZA 1R38A 4AD5A 1JRBA 4HTBA 2OJPA 1H49A 5CEWA 1EYEA 1OFAA 4YPJA 3ATZA 1ZL1A 4FLOA 2PWGA 2ACRA 2HNHA 3VM5A 4F48A 4F0KA 2VEKA 2PDBA 2D0GA 3WQ8A 5ABTA 3RFAA 3LG3A 5BXRA 3NSMA 1D8CA 3CIXA 3ITOA 1Q63A 4Y9AA 1CXKA 1J0HA 3KRZA 1ZCCA 3R8HA 4E3TA 4ML9A 1IZJA 4AVNA 1ZFJA 3PZTA 2VKZG 1RQHA 1ALDA 1XYAA 1XSKA 3BLOA 4QS6A 3SUTA 1TUXA 5C55A 3AZSA 4LAKA 3GNXA 1HJXA 1ME7A 3W7LA 1HX0A 1HP5A 1KQYA 4JX4A 3XINA 4IMFA 3M16A 1XRFA 3BOLA 1KFCA 1VFLA 3VGFA 3BLFA 4R7OA 3MSYA 3UXKA 3KRUA 2V2CA 5CZJA 2WC7A 2NV1A 4P5UA 3TA9A 3CPGA 1CXEA 1DYSA 1Q8AA 1E0TA 2F84A 1VBRA 2W3ZA 2BGSA 2OSWA 4RXFA 4J3UA 3UWYA 3E2QA 4OIFA 4EX4A 1NWUA 3EWYA 2DH3A 1DTUA 4JTAA 3S1UA 1U1HA 2DORA 3TZFA 3WF0A 1LLZA 4NNBA 1F7BA 4XG1A 4AXKA 2DZUA 3H7UA 1DQXA 4DLFA 8XIMA 4YTQA 3CUHA 2PDYA 4GISA 4H8VA 1YXDA 1BRLA 4IICA 4PRRA 3PN8A 5FL1A 3SRDA 3VCNA 3T07A 3V5CA 3K13A 2A3AA 3MP4A 4MHBA 1FWSA 3G1VA 3GSMA 3W1PA 2XIIA 5EMMA 1V3MA 4JXCA 3N2CA 1W9BM 2PUZA 3OU8A 5I3KA 1DEDA 3WD3A 3UZ5A 4ZXOA 4X9YA 3TQ0A 3RCNA 3QN3A 1UZ4A 2OX4A 2J8TA 2DIEA 4RV3A 5CC6A 2PD9A 3WQVA 4O0QA 2Y89A 4QHRA 4G8TA 1YXYA 3S2CA 2E68A 3APYA 3MW7A 1S3TC 1HJVA 4X9SA 4RZ6A 1ZBKA 1S5NA 3SCWA 3PM6A 4QG6A 5JVLA 2X16A 2G4FA 2GQAA 4A8LA 5FL0A 2Z7GA 5FJIA 3ZS4A 2PDXA 3FGCA 1VZWA 5AVNA 2O56A 4ERIA 1KM1A 5LA1A 2PP3A 4FZIA 4KCUA 3K8KA 1YE6A 1FDZA 4JL1A 3FXGA 4FIRA 4GLEA 3MV11 4Z1DA 2EPLX 1JZ3A 3ITCA 3L21A 3OVQA 1XLFA 2QV5A 4DJFC 5A6BA 3KP1A 3FV9A 4X0NA 3VXGA 4IFKA 1NFGA 2R1LA 2ZRZA 1RK6A 4JY9A 3MWAA 3EKGA 4B3KA 4NQ1A 4C7FA 1F05A 1F9CA 3K5XA 4WXZA 1R6WA 1UG6A 3ENLA 3ONCA 1KLZA 3UWQA 3N14A 5CSSA 3PFRA 1VYRA 4GX9A 3C0QA 3QYSA 4GVFA 1O66A 1PB0A 1SFJA 4NYUA 3PHAA 3LCWA 4O16A 1W1A1 1J79A 2ZXDA 3EXRA 3GVWA 2CLMA 2QNEA 3JVAA 2DVXA 2Y1HA 4NVTA 4B3ZA 3VK5A 1Q4WA 5BMWA 3W1XA 3QZAA 4LWWA 3WLMA 3IARA 4XD5A 2QXWA 3W2UA 3RO6A 1OF8A 3W82A 3IVSA 4HU4A 3DYOA 4WJEA 1LUCA 2Y62A 4W8AA 1OZMA 1QNSA 2GJPA 3BLKA 3TAOA 1OM0A 2I57A 1GW9A 1I0BA 5LSMA 5BWFA 3OLIA 3CV1A 2Z26A 1OFRA 3SJNA 3IJDA 2DJLA 4RE4A 1E6QM 4XKMA 2DT3A 2INFA 1G5AA 3WBXA 4IF2A 4MVAA 3LN3A 2VC5A 2F6XA 3VGHA 2WC4A 4Q7NA 3E0WA 1P1XA 2D23A 3C8NA 2ZQ0A 1J11A 1TZ7A 3NO3A 1L6GA 2ZRXA 4QIUA 1HIZA 1JDAA 1V7YA 4BJHA 4Q8VA 1WOAA 1XHGA 3GAKA 4LVAA 3CQHA 1BRLB 2B7PA 3KBMA 2X1SA 1M41A 2R82A 4JNMA 3SGUA 3MANA 1PUDA 4MY9A 4JDBA 4PRWA 4TVDA 4IFKB 3VOCA 3VD9A 1NY1A 1WZAA 1ZZMA 4ZE5A 3TIMA 4PA8A 4MPQA 1Q2RA 3IGXA 3HG3A 1R2RA 4HU3A 4U4MA 3GIQA 2QUNA 1LL6A 1Z41A 4L4LA 3QTGA 4G6CA 4LYRA 1VFSA 3HV9A 4H9YA 5CC7A 2OG9A 3ARPA 1I60A 1ZBVA 1YDNA 4W93A 2OQHA