2Z6JA

Crystal structure of s. pneumoniae enoyl-acyl carrier protein reductase (fabk) in complex with an inhibitor
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
320
structure length
307
Chain Sequence
MKTRITELLKIDYPIFQGGMAWVADGDLAGAVSKAGGLGIIGGGNAPKEVVKANIDKIKSLTDKPFGVNIMLLSPFVEDIVDLVIEEGVKVVTTGAGNPSKYMERFHEAGIIVIPVVPSVALAKRMEKIGADAVIAEGMEAGGHIGKLTTMTLVRQVATAISIPVIAAGGIADGEGAAAGFMLGAEAVQVGTRFVVAKESNAHPNYKEKILKARDIDTTISAQHAVRAIKNQLTRDFELAEKDAFEQMGAGALAKAVVHGDVDGGSVMAGQIAGLVSKEETAEEILKDLYYGAAKKIQEEASRWTGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trans-2-enoyl-ACP reductase II
publication title Crystal structure of enoyl-acyl carrier protein reductase (FabK) from Streptococcus pneumoniae reveals the binding mode of an inhibitor.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Oxidoreductase
total genus 112
structure length 307
sequence length 320
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2007-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03060 NMO Nitronate monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2z6jA00
3LTYA 3QH2A 1YLVA 5D2YA 3NQ7A 3ZWSA 3DH7A 1D9EA 3O1NA 5IBXA 3UYCA 3VI2A 1OX4B 2A6LA 2AQWA 4WOZA 4TX9A 1OX5A 2VEKA 2ZZ6A 1F7BA 5EY5A 3FA5A 1KBIA 1W5OA 1P0KA 2O7QA 4UR7A 1Q6QA 3W1TA 3W1NA 2X16A 3LCHA 3SI9A 3GAYA 3G1FA 1OFAA 2NUXA 3BLEA 3PG8A 3SW6A 5HWMA 5F2GA 4AWSA 1LCOA 1TMHA 3QM3A 4AWTA 3P82A 1YTDA 3WK0A 1IXQA 5L9FA 2QDGA 4HIBA 4FX6M 3EWUA 3GNDA 2ZQ0A 3IGSA 3IV3A 4AB4A 4DELA 5HNRA 3EXSA 1UASA 1KV8A 1R30A 4JTTA 2DZTA 2B7NA 2ZZ3A 2CWNA 1QCWA 3O06A 3W7DA 5LNUA 2I9EA 2EGZA 5D2TA 4XZ9A 1JCNA 3W73A 4BR1A 1OFEA 1OFOA 4LC6A 2Z2UA 4QNWA 4A2RA 4X2RA 4O52A 4IMGA 2A7NA 3VCRA 1DV7A 3KRZA 4AMAA 5GVJA 5DCBA 1UUOA 2J88A 4OU1A 3I68A 2OCZA 4IWWA 1BKSA 3DHFA 4NNCA 4DO5A 3LTPA 2NUWA 4ML9A 3P81A 1OK6A 3UPBA 1EPXA 3NVTA 1HFBA 1JULA 3DI0A 1VRDA 4HNTA 5LNWA 3LV6A 5KMYA 3G1VA 3CWOX 4BI6A 1VGAA 4M6VA 1O4UA 4RZ5A 1TPDA 5IBXC 2Y7GA 5AOUA 1FQ0A 4KFOA 4U4MA 2DZXA 5C5YA 1Q6RA 2Y85A 4LVBA 3FOKA 3IGXA 5DCDA 1VYPX 3LCIA 2J9ZA 1TV8A 3MYOA 2FB2A 1IIHA 1LBLA 1S5WA 4FXRA 3HPZA 1OABA 1TPVA 1VR6A 4QAIA 2NV1A 4AHQA 4CQ9A 3HPXA 1KA9F 3BW3A 3NZRA 4DF1A 3B4UA 3PS7A 3PR2A 5D02A 3DKLA 1FY6A 3TKFA 1EP2A 4N9EA 1Q6LA 4UTUA 2EF9A 4RLIA 2OT0A 3W6YA 4FX7A 5EYWA 3UXDA 3V1PA 2DJXA 3IIVA 1LBFA 3N14A 5AFDA 1RQEA 3TAOA 3P7YA 1QWGA 1GQNA 3UD6A 3EX3A 3USBA 2JKPA 1IF2A 4NNBA 4ADTA 4FNRA 1YDVA 4AEOA 4IXHA 4JX4A 4G1KA 1TSIA 3QW3A 5A8GA 3MWAA 3NO5A 3R5EA 1OX6A 1WDWA 4A29A 2PRMA 4K38A 1VC4A 2VC6A 3FKKA 3HBLA 2TPSA 3NGJA 4DEFA 1SO5A 2E5BA 4CQAA 3S1UA 5K7JA 2WQPA 5H91A 1G4SA 1X7FA 3MYPA 2VFIA 2NLIA 4TO8A 1HUVA 1PCWA 4UTMA 3W1XA 2XN0A 4EF8A 3S1VA 1SFJA 4CNOA 3L9CA 4QISA 1BWKA 3G3DA 3G3MA 1TTIA 3NNTA 4O4VA 3EX4A 1QMLA 1RR2A 4ZQOA 4H6KA 3EX6A 1B57A 3GK0A 1TTQA 3PAJA 1WBHA 5KZDA 2QCNA 2RDWA 4NU7A 5FF0A 2GJNA 1EA0A 4WQ6A 1ICQA 1X6UA 5HUPA 4AVFA 3K30A 1FDJA 1SO3A 3G18A 1MZHA 3B04A 3W1PA 2ZZ4A 2GVJA 3M6YA 3E02A 5K9CA 4YCPA 3PBYA 2Y63A 1OFPA 1NVMA 3LCFA 5EBUA 2OMAA 3JRKA 5H2ZA 3S9YA 1G69A 2ABAA 5TBOA 1QPQA 3TSDA 5HINA 3WJYA 1F73A 3T40A 1H7WA 3ABOA 2C3ZA 3LCXA 4DF0A 4UNKA 1F2JA 3NG3A 4X3ZA 5BNKA 3IVUA 2Q8LA 4DXVA 3GR8A 3L5MA 4MPQA 3PSVA 1QOQA 5FF4A 2QUTA 3I6RA 1L6YA 1F74A 3B0UX 4MJZA 1KM6A 4HHPA 2YYUA 1K7FA 3LM7A 3B05A 4CCEA 4QSHA 1ML1A 4XWUA 4YMZA 1ZHAA 2WNQA 3PF3A 4PFMA 3BG3A 4EWND 4O1BA 1I2PA 4NXKA 1QPNA 3T7VA 5G2IA 1RPXA 2E77A 5U4NA 2Y89A 3STGA 3KHJA 1CW2A 3P8JA 3LI0A 4N4PA 3LRKA 3DFTA 1TO3A 3BW4A 1GTEA 2CZDA 5EA9A 5AC7A 5KZMA 4IMEA 4NJHA 4NJJA 4NQ1A 4JTFA 4UTKA 5KSWA 1DOSA 3PB0A 4PL1A 4XTIA 4HPXA 1DVJA 3BPWA 3PM6A 2Y62A 1ME8A 2HTMA 1D3GA 3F4NA 3M47A 5LNVA 4RJEA 4NT0A 3W7KA 3GDMA 4I7WA 5AHNA 5HWJA 2FB3A 3QFEA 3SECA 3OVQA 3R13A 4LS2A 1EX5A 5D32A 3M41A 4JTJA 4FXSA 4MY8A 1JRCA 3VKJA 2A7RA 2C14A 3LBCA 3NPUA 4UTTA 3HJZA 3TQVA 1SQ7A 3G1AA 4RZ4A 1LZOA 2ISVA 3QJAA 3L0GA 4JY8A 4K36A 3TQKA 4AF0B 1WXJA 2GJLA 2CZEA 1A50A 3NQ6A 1RD5A 3PB2A 2RFGA 4JTEA 3KFTA 3W7PA 1WAUA 1HG3A 3HQ1A 3OVPA 1JR1A 1FUYA 4LW7A 3DXIA 4FNQA 4O11A 2ZRXA 5T26A 3IRDA 3WJWA 3W3OA 4W9TA 2KZHA 2WSRA 3NQEA 3UWUA 2HSAA 2QCMA 4GUGA 4UMBA 3LCLA 1J5TA 3SGZA 4NNAA 2Z1BA 3ATZA 3O6YX 1F76A 2QJHA 2QUUA 3N9RA 2C13A 2E6FA 1XUUA 1SZFA 1MEWA 1H7OA 2GQ8A 3QC3A 1R2TA 1YPIA 4NZJA 3S5YA 3DFSA 4Z08A 1L9WA 4UC5A 4EF9A 4S2BA 1G4EA 4JX5A 5LNSA 1TJPA 2FDSA 5AC8A 2ISSA 1M7OA 1NSJA 3Q37A 1LRTA 1R47A 1PHWA 4RKAA 2YR1A 4GE8A 2J9XA 5LHFA 3GAKA 2ZZ5A 5LGZA 3TUUA 4IMFA 4GC4A 3LX9A 3TROA 4UMCA 4O1AA 2QEZA 2QCDB 3NQ2A 2WOQA 2ZRVA 5I3KA 3S5NA 4EVZA 3FYOA 1SW0A 2QKFA 1WOAA 3EWZA 3WJXA 4YWIA 4O14A 1G7VA 2ZZ1A 3W71A 2C18A 3MHFA 4UTTC 2G95A 3G1XA 4GNJA 1K7EA 4FIQA 2CW6A 2G5WA 3P62A 3W2UA 3C61A 1GT8A 1KM3A 1KTNA 2BX7A 5CZTA 4JGDA 4P61A 3W2LA 3E96A 1H50A 1FWTA 3LHYA 5TQLA 2CZFA 3CT7A 3ABQA 3M7WA 3W7CA 1JUKA 3GR7A 2QJIA 5F4WA 5CZSA 1KV5A 3EWBX 3O05A 3GZ3A 5AHIA 1TIMA 3WFAA 1HO1A 2NX1A 3S6DA 5F1VA 1OFQA 5F1UA 1VHNA 3G0UA 1TPFA 3STEA 3N3MA 2J24A 1LP6A 3NQVA 1ONRA 2XN1A 2Q3RA 2ZRUA 5K4ZA 3I7RA 4IQLA 2J6XA 1XDLA 5BMXA 1ME7A 1DJNA 1GVOA 2ZA3A 2XFWA 3PUEA 4NJGA 5E1QA 2CLFA 2I14A 3EWXA 4LY8A 2JBMA 4UNLA 4HNVA 5HWNA 4JR5A 3A21A 3LHWA 4YXGA 1B3OA 2YGYA 4IJBA 4L4MA 1N8FA 1E51A 5EMUA 3TU9A 3W7HA 2C19A 1J4EA 3JS3A 1JJKA 2VENA 1WX0A 3W7NA 3PBUA 4YLWA 4AWUA 3AJXA 3UXAA 1ICPA 2H90A 1LM1A 4YL2A 2GQAA 3SIZA 4JXCA 3VFLA 1KTBA 4Q33A 3G0XA 1MEIA 3TXVA 2CLMA 5E93A 4ICNA 3W84A 2OZ0A 3MMTA 2BWGA 3P67A 5E0KA 4WZHA 3M5VA 3W07A 1PIIA 1TPWA 2VEIA 1WV2A 2EHHA 3EWYA 1CI1A 2BSLA 2Y70A 4UFIA 4UFLA 2OT1A 1O60A 2ZA2A 1H51A 2FIQA 2FQIA 5K9XA 1P4CA 1JQXA 3PUDA 3IIOA 1LORA 2CLLA 3N19B 3L5AA 5FEXA 1FWWA 1G4TA 4LC8A 1Q3NA 4ZL1A 2CLOA 3B0VC 3OIXA 3MI3A 2YFOA 5DXXA 2H6RA 3TFXA 3MI2A 2Y6ZA 1YXCA 4FEZA 1K8XA 4NVTA 3RMJA 3W9ZA 3EEGA 2F7FA 4KFNA 1TV7A 3KAOA 3RFAA 3PVFA 3AO0A 3P80A 4PEKA 3ZS4A 2DZSA 4A2SA 5D04C 4N4QA 1YDNA 2V9DA 4BI5A 1NAL1 4TMCA 1GVFA 2ZRWA 1LLZA 3NQFA 3FKRA 1GEQA 2RDTA 2FJKA 2GOUA 3VE7A 2A6NA 2DZWA 1TQXA 4X22A 5CGQA 1KFLA 1TREA 5F4SA 3PG9A 3VE9A 3C0JA 2TYSA 4GUIA 5FEZA 1W56A 2E1DA 4LV9A 1GG1A 2CLEA 3W88A 1OX4A 3KRUA 1TPC1 2FTPA 1LOQA 3CQ0A 4GRSA 4UTWC 1TV5A 1XKYA 3CHVA 1X1ZA 1XFBA 2X1TA 3S8HA 3CU2A 3QSTA 2ZBTA 3UWQA 3H54A 3I7QA 3C2EA 3I65A 4NX0A 3STFA 3DGRA 2Y7DA 1RV8A 2WO5A 4CNNA 4XBKA 3IVTA 5LZLA 2H8XA 1X1OA 1KW1A 1VYSX 4FX8A 5G2HA 1VCFA 1G7UA 4MKNA 5D30A 3HIJA 3G1DA 2G97A 5CSSA 3W75A 2BTMA 1A53A 5AHMA 4MOZA 3W72A 4O16A 1NEYA 2C15A 3TFCA 3TDFA 4UFKA 1XBYA 1KM1A 1ZAIA 2QJGA 2W0UA 1DKWA 3W1LA 3NXFA 4NXSA 4FNUA 4B5NA 3W87A 3TR2A 1KFJA 5HMSA 2ZRZA 4ZQNA 1GYNA 3TSMA 3TQ0A 1AK5A 2B0MA 5EL1A 5D2VA 3W22A 3RLVA 3FJ6A 1TJRA 5FF7A 3RK8A 3DHDA 3LXAA 4I7VA 2X1UA 4O8RA 4PL2A 1GVRA 3P74A 4NX5A 2V8ZA 1XC4A 3W85A 2P1FA 1VQTA 3GKAA 4LVFA 3O07A 2C6QA 3UWVA 4CCCA 1ZENA 3QQ0A 1FDYA 1Q45A 5C55A 4A21A 4UMAA 4RCXA 1F6KA 3WK2A 1FBAA 3QMTA 1WQ5A 4S2CA 2ISWA 3GB6A 1LLWA 4AHPA 3HB9A 3L2IA 3PBWA 2NWSA 2RH9A 1B9BA 5AHFA 3MP5A 1JCYA 4RZ6A 5KZEA 1QO2A 3DFQA 4JYEA 3S5ZA 2YW4A 4MZYA 3TX9A 3IIZA 5ABTA 3MJYA 1I2RA 4WOQA 1S5VA 1IXNA 2UV8G 2YFNA 3LV5A 4ZMGA 3E12A 3NL2A 4JTLA 4POCA 2PE4A 2DZUA 1TB3A 5KINA 3M5YA 4XBSA 1FCBA 4JS3A 3P61A 3W2JA 3M16A 2CFFA 3EX2A 3TJXA 5I3IA 2RHGA 4RK8A 4S1FA 4HNUA 2YPIA 5F2IA 1O94A 3SY5A 1IXPA 1G6CA 1QR7A 1KFBA 3THAA 5K9DA 2V2HA 1LRNA 5F2MA 2XN2A 5CPLA 4MVAA 1EUAA 4MFDA 4XUGA 3CM4A 1W5NA 1SUXA 3EB2A 5CG7A 4O10A 2GVLA 4Z1DA 3G8RA 1VCGA 2QAFA 2ZYFA 5DELA 3B0PA 4OV9A 1NFBA 4MZ8A 1FX6A 3W2KA 3IIPA 1MO0A 2NWRA 1ZAHA 3O6DA 4OBTA 4QIUA 1I2QA 1RQHA 4GJ1A 4LT9A 4IOTA 1YDOA 4UTLA 1I2OA 5D37A 1AL7A 4XKYA 1GYLA 3FS2A 3MO7A 2A7PA 4LV4A 1M7PA 1UBSA 3W1QA 5L6UA 3P5YA 2Y61A 4LRSA 3OBKA 1GTHA 3LOTA 1AMKA 5AN7A 1SSGA 5FF2A 5IM51 3W76A 2GVGA 4M7TA 3DFPA 3NQGA 1M5WA 2QCFA 1WYIA 3LHVA 4N2YA 5F4XA 3O63A 3TXZA 4HSNA 2A2IA 3P8IA 4O57A 2VEPA 3LRLA 4C1KA 5HR7A 2W6RA 1OJXA 2ZRYA 3TK7A 4JEQA 1B4EA 3LI1A 2JGQA 4NJIA 3NPVA 4NJKA 4FB7A 3S1WA 4E0CA 2GUUA 4H3DA 1RVGA 1VLWA 2VKZG 4WD0A 3L66A 3M5XA 3C3NA 4IXXA 4QNEA 3HG5A 4FNTA 1RZMA 1PV8A 1SZNA 4YCOA 3BW2A 5J5RA 1FCQA 4JICA 3R2GA 1TTJA 4O50A 1W8SA 1I45A 3BARA 4TMBA 2LLEA 5HJLA 1H63A 1K8ZA 1VLIA 4R33A 3TW7A 4DBDA 1QPOA 3TE9A 2FFCA 1D3HA 3TC6A 3LXCA 3KRSA 3OEXA 1FDZA 3O15A 3SR7A 2CLKA 3MHUA 3F03K 2VXNA 4WY0A 3QW4B 5G4EA 2YW3A 1TQJA 4DQWA 1DBTA 2YXGA 4Y90A 1P1XA 4JTKA 3N34A 5C6MA 4QQ3A 1H60A 3D0CA 3BG9A 1JUBA 1S5TA 4MLJA 4UXDA 3M9YA 2VELA 1YTEA 2VFDA 4JTIA 4JNMA 3NL6A 1FCUA 5F2LA 2QUVA 4Y96A 2ZZ7A 5D2XA 2OX1A 4ZQMA 3KXQA 4N9BA 1B4KA 4BI7A 1KM5A 1GOXA 1SR9A 3SFKA 1W54A 3HG4A 3P84A 1OK4A 3DZ1A 3W7JA 2ATSA 4PCFA 1L6SA 2QCHA 3W7RA 3HF3A 2X2GA 3O8AA 5HULA 3TW6A 3IEBA 2X1SA 1W3NA 2VEMA 4LUJA 1WOBA 4FO4A 1OF8A 5D05A 4O28A 3MP3A 4EOUA 2V82A 2R94A 4K7VA 1TRDA 3LCWA 3W7QA 1H1ZA 3M5ZA 3GYEA 3CEUA 3PUOA 1KFEA 1LOSA 3VNDA 4M6QA 1EWDA 1T8XA 3HGSA 1IXOA 3W1RA 1I4NA 1KM2A 1GVQA 1TYGA 4GBUA 1ZAJA 3LGEA 1C9DA 3EWWA 1I8JA 4WXYA 3NPWA 1C8VA 3UQNA 1TCDA 2DZPA 3S5OA 3T55A 2R91A 5CKSA 4LVGA 4KKXA 1UUMA 3MBDA 1XM3A 2EKCA 1V7YA 3NOEA 3DENA 3L21A 1Q6OA 4O53A 2BZNA 3GKFA 3QRHA 4GWEA 4JD4A 2WJZA 1LRQA 2IQTA 1N7KA 2E68A 4FF7A 4MY9A 2TMDA 1SSDA 2AGKA 4XQ6A 2A21A 4BF9A 2WSYA 4GUJA 2DU2A 2NX3A 4L4LA 2GPTA 3C6CA 5D03A 5I3HA 3QPYA 2ZDRA 3C2RA 3DU0A 1QAPA 1MSSA 5K2ZA 5DN1A 1JUEA 5AYZA 4GFSA 8TIMA 3NPXA 3OHIA 1TPH1 4NZFA 4Y8FA 5CPNA 2Q3OA 1UJPA 3KX6A 3GNNA 3NL5A 3GDRA 2RKXA 4NUWA 4Y9AA 1TTPA 4JIPA 1OHLA 3G24A 3WK1A 3ATYA 3G0SA 3FJLA 1GG0A 3Q94A 3OG3A 1FCVA 4OE7A 5HR6A 1O5KA 1XCFA 3YPIA 3GDTA 1XXXA 1Z48A 2V81A 1H61A 4ALDA 1H5YA 4TR9A 2Z6IA 4O1DA 3THQA 2J9YA 1KFKA 1WBJA 2HMCA 5LGXA 3L5LA 1BTMA 4JTHA 1DQWA 3Q58A 1KLYA 1OYCA 3M44A 4R53A 1GVSA 1ZALA 4ADUA 1Z44A 1SPQA 4BFAA 1JCXA 3HOJA 1ADOA 2CLHA 2WSQA 1PVNA 1PE1A 3W70A 4UFHA 4UFJA 3SGUA 4HNNA 2V0TA 3INPA 1A5SA 4UCGA 4UR8A 1ME9A 4TU1A 4P2VA 1JCJA 4JIQA 3LXBA 2QCGA 1UB3A 1QNVA 3NR0A 3QMRA 1HO4A 3M0ZA 3E0IA 3TH6A 1LTDA 4JDYA 3HGJA 3SZ8A 3QSRA 1I2NA 5CSRA 5J5DA 4LVDA 5CPMA 1QO5A 4UTWA 4KWWA 2V5LA 4IGHA 3W23A 5I3GA 1G67A 3PC0A 4E38A 3CIWA 3HPSA 5BMWA 3UWZA 7TIMA 4Z0JA 3EKZA 4Z1AA 2ALDA 3WJZA 1THFD 2ZFAA 3GXPA 1H7NA 3OA3A 2YSWA 3LBMA 1AG1O 3LHUA 4HKPA 4Q32A 2ABBA 1BEUA 2H3BA 3BLFA 1OFRA 1OFDA 3G1SA 1MXSA 1H1YA 1SO4A 3TCEA 1LOLA 1DQXA 3EX1A 4LUIA 4OWGA 3TNOA 2DZVA 1EUNA 3EXRA 3KVJA 1F5ZA 2P0OA 3DKJA 2R14A 3GIYA 3W7GA 1W1ZA 5FEWA 3ABSA 2VFGA 3T4CA 1XBXA 3HO8A 4O12A 4O54A 1NF7A 1AW5A 1GJPA 3E9AA 3T44A 3QPZA 2JKEA 3W7IA 3SJ3A 1UCWA 2V2CA 4K8HA 3C8FA 5AHLA 1F05A 3NDOA 1IIGA 4FIRA 4E2BA 3RNDA 4A22A 4LTSA 4IMCA 3TMQA 2WV8A 4UTIA 2A0NA 1FWNA 4ZQRA 2JGYA 3MI6A 1EP1A 2EAWA 5DY3A 2WPBA 4GUHA 4ORMA 2F84A 1M6JA 4ZZ9A 3RU6A 3QMSA 4IX0A 1FXQA 4RR4A 3A23A 5FF3A 5DCEA 3BVJA 2ZA1A 2W79A 4K6AA 2QCCA 1T96A 2E09A 3C2OA 1W3IA 3W7EA 4C1LA 2E6YA 1GZGA 4Z1BA 3UZ5A 1JRBA 3H55A 3W1MA 3CIXA 4O0KA 3STCA 5KTLA 5FI8A 4KFPA 3LDVA 4Z1CA 1YYAA 1JCLA 2PCQA 3RLUA 2PRHA 2C1HA 1LBMA 5DBTA 4EIVA 2Q8ZA 1XBVA 4UIOA 3A5VA 1HTIA 4N6EA 1A5CA 5FESA 2NXHA 2X30A 4M19A 4BK9A 3M43A 2RDUA 3NQ8A 5LHEA 5CPOA 3FFSA 1A5BA 1SZEA 3A9IA 4FHAA 1KM4A 2B4GA 2FPVA 3N9SA 1O5XA 3KVMA 3P60A 3W2MA 1PL9A 3HGRA 2FPTA 2NXGA 3PWAA 3W7OA 4LS0A 4N9DA 1QOPA 1K3UA 5CZJA 1KM0A 1R2RA 4QITA 1W37A 5DXYA 4OV4A 1XDMA 4MZ1A 3CWNA 3BK0A 3G8EA 2FPYA 2G96A 1U83A 2EPHA 1ICSA 2C0AA 2OJPA 5U7SA 5DY2A 2YX0A 3QEZA 2P10A 3I7SA 4MYAA 1W5QA 4R7JA 3CPRA 5A5WA 3GXTA 5EPDA 2B7QA 4AXKA 1TRIA 4M7SA 1VH7A 4WY0F 1OYBA 4MIMA 4ADSA 2BXVA 3LLDA 1TPEA 3S42A 2X1RA 4DPQA 3T78A 2YCEA 4HSOA 4O19A 3PBVA 4K8EA 3H53A 3TV8A 3N2MA 3UNDA 2YYTA 2YDAA 4RXGA 5AB3A 5BW6A 5MHBA 1ALDA 1KBJA 2FLIA 4LRTA 1ZCOA 2WNZA 2DORA 2VOMA 4N6FA 3C2VA 3LLFA 3UZJA 1W5PA 1QDSA 2PRLA 1BWLA 1W5MA 1W3TA 3B8DA 3PULA 3Q2DA 4O18A 4PTNA 3W74A 4CCDA 3TJLA 2TSYA 4LOCA 2J27A 4I9AA 4XKYB 2ZTKA 4PC8A 3UWYA 3TA6A 2V30A 4AAJA 5I3JA 5FEPA 1KLZA 1DHPA 1N55A 4M5PA 2NZLA 1H62A 4LVAA 3DI1A 3BO9A 4JTSA 2YZRA 4WUIA 3P5ZA 1QFEA 3NQAA 1ZY9A 3DBPA 4HN4A 4HPJA 1AW1A 3L68A 5K3VA 3MHGA 3NZ1A 2E6DA 2R8WA 4IMDA 2Y7FA 1SW3A 2B7PA 3BV4A 1PS9A 3NL3A 3PY2A 3A22A 1F6PA 1OYAA 4FNPA 1C29A 1W0MA 4ZVJA 1XL9A 4UFMA 2VFEA 3IIXA 2NUYA 3EXTA 4HT3A 4IX2A 2DP3A 1XUZA 3R12A 4RV8A 3R89A 1JQVA 2DJLA 1H7XA 5D33A 3W1UA 5AC6A 2GQ9A 1PHQA 3M1ZA 5K4XA 3NA8A 1XI3A 1FXPA 1CX9A 3QQ1A 4X9SA 2H8ZA 1YPFA 3HG2A 4LWWA 5D38A 3UPWA 5LSMA 2VFFA 1YADA 3FEMA 3U8GA 3U2OA 4WY0B 2TRSA 4A3UA 2VFHA 5DLCA 3UWWA 4RX0A 5LNRA 4O17A 4ZQCA 3V75A 1SU5A 1QPRA 2B7OA 2HS8A 5AYXA 4K7YA 3C2FA 3C4UA 4QJ1A 2E5CA 2A4AA 1VYRA 4D2JA 4OGZA 1DJQA 1RQBA 2Y88A 4ZQPA 1JCMP 1OG0A 1SZGA 3TIMA 1H7PA 6TIMA 1VZWA 3WJSA 4MY1A 1P5BA 2H3DA 2ZTJA 1OVDA 1FWSA 4ONVA 1GPWA 3B06A 3KVKA 3MP4A 3UY7A 3BLIA 3G1HA 2O7SA 3O16A 3NAVA 3ELFA 3ZFHA 3L0NA 1Y0EA 2QAPA 4O4WA 1LDCA 2PURA 3MUXA 2CU0A 1LYXA 3CTLA 2HS6A 2PC4A 1T99A 3A24A 1YXYA 3BG5A 3MBFA 4O15A 1VS1A 3ANYA 3WK3A 4XTDA 5C2XA 2V5BA 4IPJA 2Y7EA 4IPIA 4JTGA 3NQDA 4MFEA 1K03A 4O1CA 5G5IA 1O95A 4ORIA 1IGSA 1L6WA 1PCKA 1J2WA 3NEVA 6ALDA 5HUOA 4PH6A 3RF9A 5D09A 1VJIA 3B03A 3S0CA 1DL3A 1X8FA 1VCVA 2A5HA 3TMLA 3LERA 1K7XA 4JTUA 1WA3A 2QCLA 3SSJA 2Z0IA 3KOFA 4MJMA 4RXFA 4CQ8A 4O13A 1V5XA 2V2DA 1OF6A 1G4PA 3LTSA 4LU0A 4JYDA 4DPPA 5CZ0A 1T0OA 4PA8A 4O0ZA 3IVSA 3LRMA 3LHTA 1HL2A 1OFBA 3UY8A 3F4WA 4R34A 1W31A 3G22A 1SFLA 3FIGA 4JN6A 5KITA 4K39A 2JK2A 1Z41A 1YTKA 2A85A 4WXZA 5SWUA 3O6CA 4JDBA 2E5DA 3QYQA 1K8YA 2NX9A 3W2NA 2NV2A 3N2XA 4FNSA 1P0NA 5BOOA 1NF0A 4LS1A 1SO6A 1KTCA 3LB0A 2CLIA 5BRBA 4BWLA 4WX2A 3JR2A 3DAQA 4KWVA 4TIMA 4JYFA 4PODA 3GDKA 5AYYA 2AAMA 2ZZ2A 3TAKA 4DBEA 1ZNNA 3GXNA 1A5AA 5DBUA 3GX9A 4AF0A 3U6WA 1VPXA 3TC7A 4UTHA 4JX6A 2CZ5A 3TSBA 4DO6A 2ZCGA 4UUIA 3NQCA 3LCGA 2WNNA 1TPUA 3G1YA 1VHCA 3HG3A 4AHOA 3QF0A 3L67A 2Z6JA 3DFOA 3F1QA 2QF7A 3NQMA 2I1OA 3HGOA 3W1AA 3ZR4A 4CLMA 3BGJA 5G1TA 3CB8A 2WKJA 5C54A 3L0KA 3N73A 4GUFA 4N02A 4QM1A 3PSWA 1EEPA 5LKYA 3OVRA 1GWJA 1K02A 5G1YA 3HMJG 3W7LA 3FLUA 3S1XA 4MLRA 4N9CA 3KVLA 1R46A 4OT7A 1YXDA 1L2UA 4H4IA 3CEPA 1LROA 1JVNA 1TPB1 3ABRA 3BGGA 4E2DA 1XBZA 3MW7A 1S3HA 3EKLA 4J9JA 3FYPA 4MYXA 4MUZA 2E6AA 4LNYA 4Z0SA 5G4WA 1KFCA 4AH7A 5TIMA 2ATMA 3ZWTA 1ZFJA 3C56A 1DORA 1ZJIA 1EWEA 4WJEA 2JKAA 3GDLA 3CLMA 5I3FA 3GVGA 3NM3A 1H7RA 2QCDA 3R8RA 4IUOA 2QCEA 4M6PA 2C16A 4OHQA 2BLEA 3CC1A 5AHEA 1MEHA 1Z42A 1EP3A 5D2WA 2QDHA 4I7UA 2D73A 4BWLC 4JY9A 1U5JA 4Y6GA 2A1YA 3W86A 3LHZA 4DO4A 3NM1A 3W7MA 3E49A 4DF2A 2QR6A 4GXMA 4U28A 1EB3A 1EIXA 3W83A 1FWRA 1AW2A 4K37A 4Q4KA 3GLCA 3L65A 4CNPA 2NXIA 3A5FA 4UTJA 3C52A 1SW7A 3DFNA 4OQVA 1AL8A 3IGUA 1R2SA 5G2WA 5HQEA 3QZEA 3NYZA 5EKYA
chains in the Genus database with same CATH superfamily
3RUBL 3E0WA 4LJ3A 3UYCA 1K8CA 3K1DA 2HQAA 3M64A 4DB7A 4DAIA 3BICA 3B9DA 1HX0A 2AQWA 1JXKA 1OX5A 2VEKA 4J3ZA 1F7BA 4B92A 3SSZA 2FYMA 3VIJA 1ZLPA 4W93A 4KF1A 4H19A 5HMDA 1W9UA 3IJ7A 2X16A 3SI9A 3GAYA 2NUXA 3A6OA 1S46A 2Y4SA 5HOSA 1ONWA 4QTGA 4C6OA 5L9FA 2QDGA 3VD5A 4GVGA 3ZJ7A 4AZ7A 1FH9A 1A5MC 2UZ9A 3T1GA 4QJ4B 4MKSA 3IGSA 1OSEA 4U2YA 3A4JA 5HQMA 1GPFA 1WKFA 3EXSA 4QG9A 2PD9A 3HPAA 2J79A 2ZZ3A 3SJNA 2OVLA 1VENA 2I9EA 1MWOA 3EYPA 1JCNA 1OFEA 4LC6A 4IFRA 4X2RA 3SRKA 4XO7A 4AMAA 3CLWA 5GVJA 2J88A 4RW3A 4OU1A 3I68A 1WO2A 2V5CA 3IJLA 4QGCA 4WK9A 4F0KA 3QYSA 4DO5A 1OK6A 5DRCA 3E0VA 3NVTA 3VKKA 1J0IA 3DI0A 3ITXA 3QXBA 5LNWA 3LV6A 4G7EA 3B9NA 1VGAA 3WMBA 2GOKA 1O4UA 4S3AA 5AOUA 3AXXA 2X8RA 4U4MA 4MWAD 3VD9A 4DWSB 2DZAA 4US5D 2ON3A 4ZODA 2EG6A 2Y85A 3BTNA 4O0QA 5H8PA 3IGXA 2HISA 3QOKA 1VYPX 3UJFA 2J9ZA 1XINA 3SB0A 3MYOA 2EG8A 4NSBA 4JFTA 1J0JA 2WZHA 1IIHA 1R38A 1S5WA 4FXRA 1TPVA 3HPXA 2F6UA 3BW3A 3MCMA 5A2CA 3CHCA 3NZRA 1QI3A 4WIWA 4YWSA 1BVWA 1WB0A 4J1OA 3TKFA 1EP2A 4DM1A 2DVTA 1Q6LA 3EPNA 1IR2A 2WMIA 4WEVX 3W6YA 3BSMA 4IP5A 1UUQA 3IIVA 4DUVA 5AFDA 4D8AA 1RQEA 1CBGA 4S3CA 3USBA 2JKPA 4O1EA 4R9XA 4ADTA 4GYPC 2VQUA 3SQLA 3VIIA 3CIVA 4WF7A 4IXHA 4JX4A 4G1KA 1TSIA 3SCTA 4M24A 3GG7A 1Z9AA 2EEXA 3CQIA 1LWIA 1DWJM 2PRMA 4K38A 1RPKA 3FKKA 2J7DA 1KKOA 3JZEA 3HBLA 4PCSA 2TPSA 3NGJA 3SCVA 4U5IA 2WQPA 3G5EA 1G4SA 7XIMA 4JHZA 4MNMA 2YLAA 1I60A 2VFIA 2NLIA 4DZHA 3NJ3A 4U3CA 3NUKA 3MSYA 3UXKA 2YBTA 4EF8A 1SFJA 1B30A 3H2OA 4IH3A 4GGBA 1NARA 3ZLHA 2Y5SA 5C9RA 1RR2A 4LYQA 4ZQOA 1B57A 1L6GA 1WBHA 3W37A 5KZDA 1IT8A 3IJDA 5FF0A 2GJNA 3EOLA 4IIEA 4PE8A 1X6UA 4QDPA 1HP4A 1SO3A 3B04A 3DC0A 4TV5A 3S2MA 3W1PA 3ALFA 4C7GA 4YCPA 4AY8A 5DMYA 2XWEA 3LCFA 4XAYA 1FTXA 3BJTA 5HINA 3T40A 1BVNP 5BNKA 2Q8LA 4LQ1A 4MPQA 1QOQA 5FF4A 1AZ1A 4MKVA 1F74A 3E2VA 3B0UX 4MJZA 4AZ6A 1MW2A 4Q6JA 1JXJA 3LM7A 4XWUA 2DQWA 4YMZA 1MW1A 1YE6A 3THUA 2WKGA 5DT7A 4ZO8A 4PFMA 2WMHA 4GINA 1BF6A 4DUOA 1UQZA 3VKAA 3CXOA 3MDUA 3RCYA 5U4NA 1XS2A 3VIMA 2J7GA 3N9KA 5AC7A 2ZOXA 2IPFA 1DJGA 3GM8A 3NZPA 3AWNA 5KSWA 4IT1A 1AQMA 1AUSL 4MAVA 2ZVIA 4AC7C 4GVFA 3VMOA 4AIOA 4AZCA 3SQMA 2YKKA 3TTYA 1VB9A 2X7WA 1ITCA 5IDZA 3GDMA 3RR1A 1QK2A 1HVXA 3UYIA 4LS2A 1E0XA 5I79A 4Q4MA 2C14A 2CHOA 1UOKA 3G1AA 2R24A 4RZ4A 3CMFA 1V7AA 1W91A 4DWDA 3MZ2A 4AF0B 1WXJA 1ECQA 3NQ6A 4Q8QA 3PB2A 4YTSA 2DUZA 1YX1A 1A3WA 3HQ1A 1L8PA 4YIWA 1TJ1A 3P2VA 4LW7A 4QJ3B 1EQCA 2ZRXA 3KWSA 3NDZA 5CLTA 2FTWA 2OYKA 3OP2A 1OZQA 4BA0A 4ZSTA 5FJIA 3W3OA 2F61A 3LMYA 3QTGA 2KZHA 3RPDA 3NQEA 3QZ6A 3UWUA 4LNCA 1TJ2A 2HSAA 3B9AA 2GQ3A 3OZMA 1UP3A 1FRBA 3UJEA 3WQEA 3NIYA 2OGJA 1C8QA 5FJOA 2QUUA 1UR9A 3N9RA 3T6CA 4PMDA 1SZFA 1M03A 3QC3A 1R2TA 2OO0A 1K9EA 4NZCA 4EF9A 3H7RA 4S2BA 5CC7A 1PIGA 4XSMA 4IQEA 1V79A 3Q37A 2WM0A 1R47A 4CCZA 1UPPA 2EPKX 1CB7B 4GE8A 2J9XA 1OC7A 3A9BA 1B3XA 4X9YA 4GC4A 3LX9A 4CQBA 3MKKA 2GSJA 2ZX9A 2QCDB 3S5NA 1F3WA 3GUGA 5BWFA 2ZZ1A 1MXDA 2G95A 4E5TA 3G1XA 4RV3A 1EBHA 4B5VA 2G5WA 4ATWA 3W2UA 3MZNA 4QBXA 4IMAA 2J7EA 3OQ8A 3E96A 1FWTA 2Z28A 4Q4PA 5TQLA 3ES7A 1W3KA 1XLKA 3TWAA 4GABA 3EWBX 2D2HA 7PTDA 3CUJA 3MVTA 5CBIA 1PEZA 3WFAA 1HO1A 2NX1A 4IL0A 4C6QA 2WQDA 1OFQA 3AIVA 2BGNE 1XLBA 3CGTA 3M07A 2J24A 1W2PA 3VDAA 3TLQA 1DIDA 5K4ZA 3GE7A 3KTSA 4CN4A 4IQLA 1XDLA 1ME7A 4GY1A 3WNKA 2GUYA 4B91A 2PWGA 2PBGA 3GDBA 2WANA 3KW3A 5BOEA 3PJWA 3RM4A 2CLFA 5HNNA 4GYFA 4A05A 1LUCA 1IHIA 4LY8A 4UNLA 2YXXA 3R79A 4BF5A 4JR5A 3LHWA 4V2XA 2IKHA 1EH9A 2OWXA 4H9MA 3TU9A 2ZWZA 3W7HA 1JJKA 4C6PA 2VENA 3VNIA 2YDQA 4PZVA 1XYAA 2QJJA 4YLWA 1ICPA 4DI9A 4DO7A 1LM1A 1DJYA 3UWEA 1GKRA 1J0YA 1W1PA 3VFLA 1XYLA 1MEIA 4AEEA 3SM0A 4OKDA 3W84A 2OZ0A 1PTAA 2GDQA 3M5VA 2P88A 2XH0A 3DEQA 3HTWA 2DV0A 2EHHA 1V51A 3H2FA 5CGMA 4UFIA 1ITXA 1M01A 1YKWA 1F8MA 5C9WA 1PAMA 1VFHA 5K9XA 4LBSA 2HXUA 3WDIA 4G7EB 3U5UA 1Q3NA 3B0VC 4BY3A 2YFOA 4EK7A 2W5FA 5JBDA 3L7RA 1JF5A 3KOWA 3PZGA 3RMJA 5BRQA 3W9ZA 3EEGA 3FHAA 3KAOA 2PBOA 2PFHA 2Y5EA 5EU9A 2V9DA 4GYPA 1NAL1 3PP7A 2OQYA 2SFPA 3I3DA 3EAUA 1UWSA 2IKIA 3KS6A 2QXWA 2FJKA 4Q4QA 3IGHX 3VE7A 3WD0A 5JBFA 5LIXX 1DE5A 4TTGA 1XG3A 2DZWA 1HN1A 1HGYA 1KCLA 5BU9A 1TREA 3PG9A 3U0HA 2WMIB 4LV9A 2CLEA 5RUBA 2WJDA 1OX4A 5HK4A 4LUSA 4OOZA 4GRSA 2ICSA 3MUZ1 1VRXA 1XKYA 1LL7A 1X6NA 3SRHA 3VGDA 3I7QA 3C2EA 1S5NA 4NX0A 4AX6A 3BAKA 3KBWA 2Y7DA 2WO5A 4RDWA 1VPYA 4CNNA 4KRUA 3ZT5A 4H9VA 1X1OA 3PTMA 5G2HA 1CLKA 5DEZA 1G7UA 1ZRQA 1GYMA 4YTQA 2OEJA 1A53A 5AHMA 4MOZA 4O16A 3DHUA 4PUDA 3VD3A 3TDFA 3KBMA 4M29A 1L8NA 3LENA 1XBYA 1KM1A 1RSCA 3T0BA 1WDSA 1DKWA 3W1LA 4CN6A 2VDIA 4NXSA 4FNUA 4A35A 3W6MA 3TR2A 5HMSA 4J3XA 2ZRZA 3TSMA 1AK5A 3RDKA 2B0MA 5D2VA 4AUBA 4ZOAA 1SFTA 1VFLA 2PF8A 3RK8A 3LXAA 4I7VA 2RDXA 3APYA 4YVXA 4O8RA 2WBGA 1GVRA 3P74A 2V8ZA 4LVFA 3O07A 4M1RA 3UWVA 4KERA 5HMFA 4U2ZA 4UMAA 1EIBA 3WK2A 2PGEA 4S2CA 3CB3A 3MMDA 2A3CA 1XG4A 4BQ3A 1B9BA 3TA9A 5AHFA 1JCYA 2HVMA 5KZEA 4KBXA 3W25A 3T07A 1Z7AA 1D2KA 1QI2A 1O1HA 2AL2B 1QWKA 3TX9A 2XJ7A 2DT0A 5BXTA 4B2DD 2I56A 1I2RA 1OT1A 4ZMGA 1EJXC 2PDWA 3NL2A 2CKSA 3FXGA 3D3FA 2PE4A 1R9ZA 2DZUA 1JD9A 3P61A 4Q4SA 2BY1A 3B9OA 2W92A 3EX2A 5I3IA 4S1FA 2FJUB 2ZADA 4Z2LA 1EEXA 1GQKA 2V2HA 1K70A 1TZZA 4AD1A 2WHMA 1EUAA 4FI4A 2ZDSA 1W5NA 2X0YA 1QT1A 4UWMA 2J8TA 3FVDA 1J9YA 2WSPA 3UJ2A 3GO2A 1NFBA 2J8GA 6A3HA 4PB4A 4J3VA 1PKYA 1A5LC 3O6DA 4OBTA 5DX7A 3HQOA 4AZCB 4LT9A 1Z3NA 3OGVA 4IOTA 1YDOA 1IEIA 1GYLA 3MO7A 3UERA 2OWWA 3P5YA 4GIRA 1TE6A 2Y61A 2F8QA 5AN7A 1B3YA 4M7TA 2YA0A 1AH0A 1MDRA 1NWSA 2X1IA 1E3XA 5F4XA 3O63A 3TXZA 2A2IA 3WNOA 4C1KA 3CZJA 4CD7A 5HR7A 2ACUA 2DH2A 2ZE0A 1E56A 1B90A 2ZRYA 1Y5WA 3A4XA 3TEVA 2PTXA 4E0CA 2GUUA 1CXEA 3NOYA 4QNEA 2FGLA 3TYBA 1RZMA 3QV7A 4D6FA 3R2GA 3NGFA 1TTJA 4DNHA 1DIKA 3BJFA 1LG2A 4IF2A 4GXPA 4TMBA 4OECA 3S2CA 5HJLA 1H63A 2YCJA 3TW7A 3GHSA 3TE9A 5A6AA 1D3HA 3LXCA 2V6AA 3KRSA 3OEXA 4J27A 4LUYA 4OBSA 4PN2A 3WUEA 5JU6A 4AD2A 2BS9A 2VNCA 2V3DA 2INEA 3D5HA 3QW4B 4UR9A 4CQCA 1DBTA 1S39A 5AC4A 5FD0A 5C6MA 4QQ3A 1H60A 3BG9A 1S5TA 1W9BM 1VBHA 4JNMA 2D2OA 1B4KA 3VD4A 4KIEA 1KM5A 4BI7A 1GOXA 3HG4A 3P84A 3W7JA 3FW6A 1J01A 1Q7MA 1BRLA 3O8AA 3QR0A 4BKNA 2WMJA 4TTUA 2X1SA 3VILA 2VEMA 4XUYA 3IJIA 4HQVA 1FWDC 5D9PA 1CEOA 4HJFA 2QIWA 1PB0A 4EOUA 1M53A 1BXCA 4ZFMA 2Z27A 3CV2A 4OVXA 3LCWA 1A47A 3M46A 1LOSA 3VNDA 5DO8A 1NQ6A 4F79A 1I4NA 4GBUA 4Z2JA 2ZXQA 1CGTA 3QOMA 2WCSA 3WMSA 4WXYA 1C8VA 3VINA 3S5OA 3T55A 4IPPA 4LVGA 3AWOA 2HJPA 3PFRA 4YHGA 3MBDA 1BWVA 2J47A 3DENA 2XPKA 3GKFA 3SCPA 3VVGA 4LUTA 3MDWA 4FF7A 4MY9A 1SSDA 4JIEA 3II1A 1U2YA 1V6UA 1R3SA 1Q6DA 2J8FA 3SEPA 4L4LA 1US0A 1LUCB 4LEFA 3QPYA 3AMGA 5A6LA 1MSSA 5K2ZA 5DN1A 4CUCA 5JBEA 4DXKA 1JGMA 1V0KA 4X63A 5A1AA 4Y8FA 1J2BA 1M3UA 3RU8X 5CPQA 1UJPA 2DQXA 5IRPA 1Q2SA 1W3LA 2ZXDA 4TVUA 1OHLA 4IPLA 2NQ5A 1MRAA 3FJLA 2NQZA 1YRRA 1QNSA 2X2YA 1XCFA 2OODA 4ALDA 3ZO9A 4TR9A 2Z6IA 4O1DA 4GQ0A 4CQDA 1Q2RA 2FTYA 1E6PA 3WDRA 2VZTA 3TOYA 3APGA 3AXHA 3H7UA 1DQWA 1US2A 2C71A 2QV4A 3ZLGA 3VOGA 2V38A 3GXFA 3B4YA 3CPUA 1SPQA 4BFAA 4LEQA 1PE1A 3W70A 4UFJA 3SGUA 1WPCA 4HNNA 3IUHA 3ZJKA 3W4RA 4W7UA 4Q8VA 4UCGA 1BG9A 2IUZA 4TU1A 4P2VA 2QCGA 5CBJA 1QNVA 1XLAA 3NR0A 1M68A 2E3ZA 4EPKA 5T8GA 4Q22A 2TODA 1H1NA 1EOMA 1UR0A 3TH6A 1TMQA 1XYBA 1WZMA 4ZR8A 5CPMA 1QO5A 3AUJA 4KWWA 3LD5A 5FKYA 5ABGA 3VFCA 3PC0A 7TIMA 1OT2A 3WJZA 4LYRA 3GXPA 3QGKC 1ZUAX 3PNUA 2AKMA 3XIMA 4H7CA 4L65A 2H3BA 3HA1A 2J74A 3G1SA 1H1YA 1SO4A 1JFHA 3ITGA 3CUIA 2BVWA 1LQ2A 1FKWA 3PZMA 4WDWA 4LUSB 3DKJA 5D8WA 1K1DA 3WDHA 5FEWA 2INZA 1XBXA 1PDYA 4O12A 4S39A 4LALA 2PLMA 2ZUWA 3BURA 1AW5A 2PU1A 1UKOA 4CNTA 1JNEA 3SJ3A 3BZGA 1JI1A 1UCWA 2XIMA 3C8FA 2WMGA 2HZGA 2ESCA 1F05A 4LTSA 3THCA 3TMQA 1SVDA 2W9MA 4PMXA 2A0NA 4EAYA 4R5EA 2NQJA 2OPJA 4ZQRA 1FWIC 2EAWA 1VFMA 1XSKA 3AHYA 4GUHA 2F84A 1HT6A 1C92A 1WCGA 2VQTA 6PTDA 5HQLA 1EDQA 1RAKA 4XZIA 2OGYA 4RR4A 1QBBA 3BVJA 1YNYA 2W79A 4ZBCA 2QCCA 2E09A 3C2OA 3RO6A 3W7EA 1GZGA 3KS5A 3KHDA 5A6KA 3H4WA 1UD8A 3CIXA 4O0KA 4AD4A 5KTLA 1QI4A 4DJFA 4Z1CA 4ZO6A 3SCSA 1HGWA 1XLIA 1UZHA 5M1TA 1F61A 1ZL1A 4UIOA 4KH2A 4OUIA 4XX6A 2G3IA 2X30A 3NQBA 3FXYA 2RDUA 5LHEA 3KZSA 1XW8A 3B8UA 4NZ3A 3KL5A 3KVMA 3W2MA 1UR8A 2FPTA 2J6VA 1Q85A 4N9DA 5B7ZA 4LAUA 5CZJA 1R2RA 1UPMB 4QITA 2HPIA 5DXYA 1W1YA 2XIQA 2F6KA 1XDMA 3AXMA 3LPFA 3CWNA 2G96A 4MB3A 2EPHA 3PZIA 2OJPA 5DY2A 1XCWA 2WWDA 2P10A 2WVVB 3CJPA 3I7SA 1GCYA 1W5QA 3RJYA 4R7JA 3CPRA 5A5WA 1HF6A 1XRFA 1LG1A 4AXKA 2VL4A 4M51A 2VD8A 4K8GA 4DPQA 4IQJA 1VFSA 4WLCA 4HSOA 3UZYA 3PBVA 4U10A 1KCZA 3P3BA 3O3RA 4PUNA 3CT2A 4RXGA 5AB3A 4MJ4A 4YTUA 3FDGA 1KBJA 3B8SA 3LSCA 1W3JA 3ZMRA 2WNZA 2PRLA 4Z1YA 1BWLA 3V0TA 1W3TA 3B8DA 3Q2DA 4O18A 4CCDA 3PPHA 4HCDA 3DG6A 3WLQA 4UZUA 1U1HA 2ZTKA 3TA6A 2POZA 3GH4A 5I3JA 3PBMA 5FEPA 3H2NA 1GQIA 1TJ0A 4NZ1A 2O55A 1N55A 3T8LA 4LVAA 3DI1A 1GEHA 3IK4A 3BO9A 1WE5A 4WUIA 4C1NA 4MGGA 1I0DA 2QV5A 3P5ZA 3WLJA 1XF0A 1ZY9A 4HN4A 4LY4A 3AYVA 2Y7FA 2B7PA 3NL3A 3A22A 2X7VA 1XL9A 3LG3A 3TYDA 3T9PA 1NP0A 2NUYA 3EXTA 4GX9A 4HT3A 2VEGA 3LA4A 3EA3A 1YEYA 5AC6A 2CETA 4I9JA 3WLRA 5FAJA 1FXPA 4X9SA 3EGJA 3DIPA 4D6JA 2DIJA 3V5CA 2OG9A 2WSKA 2HROA 5LSMA 2VFFA 1JZ5A 3U8GA 3U2OA 4JQ3A 1EJTC 2B7OA 3T09A 4XSLA 4KCUA 3T4WA 5KETA 5IHRA 1WDPA 4I5XA 1TCMA 3WQ6A 1DJQA 1RQBA 5T91A 4ZQPA 1H7PA 1VZWA 1V3LA 2ZTJA 3KZPA 4LBUA 4PMJA 4RNJA 4ONVA 1GVEA 4ATDA 3AIQA 4GYKA 3G1HA 1BVZA 1XX1A 1BRLB 1XH0A 4BCEA 2O92A 2A3AA 2QAPA 1LDCA 4HA4A 1EJ7L 2CU0A 1LYXA 1T99A 2YDRA 3EWCA 3MBFA 4O15A 3UJSA 1HXJA 5I03A 4U33A 3W28A 4L1XA 4JPGA 2Y7EA 4RNIA 4JTGA 3NQDA 4MB5A 1EA9C 1A49A 1XJBA 3CL7A 1O95A 2V63A 4ORIA 1PCKA 1J2WA 6ALDA 5FSDC 5J8LA 2YLLA 1XPGA 3H2EA 5D09A 3OGRA 1X8FA 3CMGA 1VCVA 1NWTA 1EJUC 5FJTA 3SSJA 3TYUA 4LUTB 3MANA 4MJMA 4RXFA 4Q8TA 4CQ8A 1H4PA 2V2DA 1FWBC 1WXZA 3H22A 1XRSA 2PGRA 4IZGA 4EE9A 1M7JA 1UG6A 3PPGA 1UP0A 3F4WA 2FZ9A 3R0KA 1R85A 4ZTYA 2VCBA 1Z41A 4GQGA 4WXZA 2BB0A 3E5PA 3O6CA 4BF7A 4JDBA 2ZC1A 2NX9A 3W2NA 4FNSA 1P0NA 3S2LA 2WXDM 4Q8UA 3T0CA 1NF0A 1SO6A 1KTCA 2PWEA 4DWSD 4DJDC 4ICCX 2R1MA 1KQYA 4ICMA 3VOHA 3VX1A 5CPSA 1SR0A 4WX2A 1JZ4A 3TZFA 4KWVA 2VOTA 5IFTA 4JYFA 4W84A 3GDKA 3GXNA 1E43A 3GX9A 3DN5A 3BJSA 2WVUA 3CV6A 4UTHA 4JX6A 4HPHA 4UUIA 1TELA 3LCGA 3G6MA 1VHCA 1U22A 2GVEA 4GO8A 4KCWA 4AHOA 1J79A 3QF0A 2Z6JA 3DFOA 3F1QA 4MAZA 3TNBA 2QF7A 3W1AA 3PANA 2PDQA 5C54A 2Z7KA 3L0KA 1B0IA 2VRQA 4N02A 1DJHA 3VYLA 2QNEA 3F5LA 4F8XA 4GZ7A 1R46A 1L2UA 4H4IA 1AFSA 3CEPA 3K13A 4M3PA 3ABRA 1AVAA 2OOFA 1DWFM 4E2DA 3A12A 3MW7A 1E40A 3FYPA 1Y8BA 2ISFA 5G4WA 2W27A 3TZNA 1LWJA 2ATMA 1U1UA 1K9FA 2DFAA 1IEWA 4PUJA 3WL0A 3CLMA 5I3FA 4K1WA 4IGNA 3UG3A 1HZYA 5AC5A 1LLOA 3GVGA 2EJAA 4DJEA 4GKLA 3GXIA 2BLEA 1EQPA 1MEHA 3EZ4A 3L4XA 4LFYA 2QDHA 5BXSA 2WHKA 1CCWB 3W7MA 1EIXA 4INFA 4MWAC 1MZRA 1OD0A 4K37A 1EXBA 3L65A 4CNPA 2JALA 2PDUA 3ZVIA 2QS8A 2WB5A 4FAMA 1ZTVA 1CWYA 4WDUA 1G9HA 3WH9A 3IGUA 3NYZA 2XGIA 3QH2A 3ZWSA 3DH7A 4Q6XA 2J75A 5IBXA 1J93A 2XVPA 1WKEA 1PKLA 3T0AA 3C0QA 4WOZA 3VAVA 4F48A 4NZ5A 4AXNA 3QR3A 3FA5A 3KLKA 1KBIA 1W5OA 1P0KA 2PWVA 1Q6QA 4WJXA 3GC5A 4DX3A 3JUGA 2Y8KA 1ZZMA 3G1FA 3PZNA 3SW6A 5HWMA 4AWSA 1TMHA 3P82A 3WK0A 3DGBA 2NW0A 1DXEA 4UTFA 1TWIA 4C6CA 4I90A 4AB4A 4DELA 3NSXA 5HNRA 2GSEA 1R30A 2G4FA 1RY8A 2B7NA 1W1B1 3TN5A 5I06A 5GJMA 1QCWA 2P8CA 3W7DA 2EGZA 4XZ9A 5E9XA 3AS1A 2XFRA 1J10A 4H00A 5HATA 4A2RA 5JIWA 4O52A 4I5UA 3VCRA 1AMYA 4AG0A 5DCBA 3GD6A 3EMZA 1KRMA 2OCZA 1KRCC 3MV11 3EA2A 5T9CE 3U2ZA 3UPBA 1HFBA 3VZYA 1IZKA 1QRQA 4HNTA 2EPMX 3NVDA 4PCPA 3G1VA 3CWOX 1UIPA 1FQ0A 2QQ6A 3SN0A 4WSHA 2DZXA 3MU7A 5BOFA 2WCGA 5LXXA 1TUFA 3V18A 3N2CA 3KEHA 2PCEA 1ITQA 3LCIA 1XYFA 2IPGA 3QY6A 1EL3A 4HBKA 1LBLA 3HPZA 1OABA 3GNOA 1VR6A 4JFUA 4UQEA 1KA9F 4YYCA 3TTEA 2DDXA 3ARRA 1EYEA 4DF1A 3R25A 2PDNA 3PS7A 2QVNA 1J12A 4FOUA 4O1FA 4C1NB 3VABA 2IPWA 3CL6A 1GOQA 2XH2A 4RLIA 3PNZA 1W1IE 4E4FA 2OT0A 3FY1A 4J7RA 2WC3A 3UXDA 1LBFA 3ID7A 4QRNA 1QHZA 5DANA 3A3WA 1BLIA 2BGQA 4FOKA 1XFCA 1AJ0A 4QROA 4QLLA 1SJBA 3QW3A 3MWAA 3R5EA 4PRWA 1WDWA 1YNPA 4A29A 3WZ0E 1DWGM 1VC4A 3H4XA 3EOEA 2FHBA 3OZOA 4DEFA 2AMXA 4CQAA 2XZ9A 5K7JA 5H91A 3MYPA 1JZ3A 5JUVA 3K5XA 1PCWA 2YBVA 3J7HA 1VJZA 1BWKA 1TTIA 2XGZA 3NNTA 3VGFA 4Q8NA 3EX4A 3GW3A 3ZVHA 2R1LA 5H6HA 2AQVA 3FJNA 2OKTA 4FLOA 2RDWA 4RDZA 4J3UA 1ICQA 5HUPA 1JCTA 1HKMA 1N8WA 4FMVA 3MB9A 1HKJA 3G18A 3CUGA 1UC5A 4KPLA 1RBLA 2JF6A 3L12A 4GG9A 3LU2A 3VZXA 5H2ZA 3VDGA 2ABAA 2JEPA 1F73A 1EKOA 3ABOA 5E5CA 3LCXA 2AAAA 1F2JA 1Q8JA 3NG3A 3SCUA 3IVUA 3RJXA 1UR3M 4E4PA 3A3HA 1AH4A 2VZVA 3UBPC 3AZSA 4M56A 1L6YA 4E8DA 4HHPA 3DYPA 2DGAA 3RN6A 3B05A 3C8NA 4QSHA 1ML1A 1GJUA 4YYFA 2WNQA 1LL4A 2DVUA 1LL6A 2KAUC 2J78A 4O1BA 3F2BA 1I2PA 4NXKA 3E0LA 3HQPA 1LT7A 2E77A 2IMRA 3STGA 4OTKA 2XM2A 3H8AA 1CW2A 1GZJA 3P8JA 4XIAA 1Q66A 2GGEA 3LRKA 1RK6A 1JI2A 3ARPA 5CJNA 8RUCA 2VR5A 4NQ1A 4QEHA 1VBRA 4JTFA 3F4CA 3GFYA 1MXGA 2YL9A 5FA5A 1S2CA 3HU7A 1DVJA 3PM6A 2Y62A 3F4NA 2PWFA 3HQNA 3M47A 3B8WA 3OVGA 4QQUA 3W7KA 5AHNA 3QFEA 3SECA 3URNA 3GYCA 1B1YA 1LWHA 3A4WA 4Z2IA 1EX5A 4D9PA 1Z69A 5D32A 4JTJA 3SURA 2A7RA 2QIIA 1TKKA 5I7GA 1M9HA 3HJZA 1SQ7A 1WZKA 1PYMA 2ISVA 3QJAA 3L0GA 1X38A 3E2RA 4JY8A 3TQKA 2XIOA 1LQ0A 2GJLA 3TP4A 1RD5A 5AYIA 4QE1A 3KFTA 1HG3A 4JIRA 1I75A 3D3AA 4D8LA 3RCMA 1E6XM 1XRVA 3STPA 4D6IA 8A3HA 5T26A 4GA8A 3VIHA 3VPLA 4W9TA 4EKJA 2WSRA 3L4TA 2BXZA 4JTQA 4JCLA 2Q6ZA 3GH7A 4AWEA 3L4UA 4GUGA 4UMBA 4G5DA 3M0HA 1S2WA 4CKQA 3ATZA 2VMFA 1P0EA 4DYKA 3O6YX 3AALA 3UPMA 2E4TA 1XUUA 5ECUA 1MEWA 4P7RA 1DJIA 4NZJA 1AD1A 4Z08A 1MQQA 1L9WA 4JX5A 5LNSA 4H9TA 1I9CB 4Y9NA 2FDSA 2ISSA 3S3GA 3WX7A 2ACSA 2J7BA 1TIWA 1E9LA 1F6YA 2VUNA 4KESA 3W27A 4PSRA 2ZZ5A 3TUUA 4IMFA 3NO3A 1R3VA 3TROA 4O1AA 2QEZA 1IWBA 5I3KA 3FYOA 2MNRA 3OIHA 1SW0A 3EWZA 3XINA 5CSYA 3W71A 5DFAA 4UTTC 1CYGA 3S83A 5XIMA 1A3HA 3P62A 1UKTA 1KM3A 5ABFA 1RCXB 4XD3A 1EDTA 2XHYA 2VT0A 4P61A 4DAFA 2FZBA 3LHYA 1EBGA 2CZFA 3W7CA 3LSBA 3M7WA 2QJIA 2WMKA 1KV5A 4JTRA 2UWFA 3HV9A 3GZ3A 1VEOA 1TIMA 5F1VA 1EZ2A 5F1UA 2EKGA 1E4MM 1UZ4A 4F4RA 5I24A 1LP6A 5B7YA 1ONRA 1WP6A 4JHMA 3I7RA 3RRXA 3SGGA 3LN3A 5BMXA 5D9NA 3CK5A 2OEMA 4F66A 2QW5A 3AMDA 1WDRA 5E1QA 2I14A 2VR4A 3EWXA 1R87A 2JBMA 3AS0A 2GWNA 1F8IA 4A8RA 4YXGA 4ZXLA 1B3OA 2JQXA 4L4MA 1E51A 5EMUA 1MUCA 1SMDA 1TMLA 3F2DA 1OEPA 2C19A 2WCAA 4A8LA 3PBUA 3UXAA 2GK1A 1RK5A 2C7FA 1E1CB 1ISVA 4JXCA 3EWDA 1CIUA 3T2OA 3T2PA 3TXVA 2CLMA 5E93A 1SM9A 1V6YA 2UY4A 3MMTA 3AISA 2FVMA 4HHHA 2R1PA 1KCKA 2DSVA 1WV2A 4PTXA 4ZB5A 2AQOA 1E1EA 2V5DA 6ENLA 1NWRA 2DSKA 2OT1A 1O60A 4E3TA 5FACA 2FQIA 2VUYA 1JQXA 4HOZA 3GBEA 1LORA 1AJZA 5FEXA 1FWWA 1G4TA 2OFJA 2G3FA 2Z2AA 3OIXA 5CGTA 3AJ7A 3MI2A 1BKHA 1E6NA 4FEZA 1K8XA 2GZXA 5GPRA 1QW8A 2V67A 3P80A 4PEKA 3ARQA 2G4JA 1XH1A 1YDNA 4H2CA 1UR2A 3PAOA 4L6DA 4PMZA 4TMCA 4H9YA 1DE6A 1GVFA 3MUAA 2PTWA 3UR7A 3VA8A 1GEQA 1IZCA 4KEZA 1J6OA 1TQXA 2GSHA 1JGIA 2HEJA 1PYFA 2BDQA 2HE5A 4AZ5A 5FEZA 1W1TA 2WLYA 1TPC1 1LOQA 2CERA 2JF7A 4TVCA 3OB8A 2XVLA 3GHRA 1X1ZA 3CU2A 4XV0A 1OWQA 3H54A 3AS3A 3DGRA 2YZ5A 1XPYA 3GTIA 1EF3A 1QTWA 2OLAA 4IIDA 2H8XA 1ZBVA 3TWBA 1VYSX 1UJQA 1VCFA 1V08A 1Q4NX 3CHFA 2FZNA 3AC0A 1GORA 2VZOA 5CSSA 3ZR5A 1FH8A 3IS4A 3W72A 1NEYA 3TFCA 2BVDA 1ZAIA 1EGVA 2PP1A 4MM1A 1SJCA 3BSGA 4QXIA 3W87A 1KFJA 3WG6A 3WD1A 3QV6A 1QI5A 3O0KA 4JFWA 3ZVHB 2VC7A 3RLVA 2X1UA 4PL2A 1HKVA 4XAGA 2X41A 1XC4A 2A3LA 5E0FA 2C6QA 4PUUA 4CCCA 1ZENA 4C6MA 1FDYA 1Q45A 4A21A 5AZ0A 4RCXA 1P48A 1F6KA 2QVHA 3BQ6A 1WQ5A 2ISWA 3GB6A 4OJYA 4MHBA 4AHPA 3L2IA 1W9DM 3PBWA 4DNMA 4JKLA 2D24A 1V03A 3WQVA 3S5SA 1QO2A 4GOAA 5AKQA 2FKPA 3KBVA 5ABTA 2B81A 3MJYA 3GTHA 5LIYX 4WOQA 1GW1A 3LV5A 4U31A 5DRIA 2HDJA 4POCA 4A4AA 3U4AA 3IK2A 3MKVA 5H1WA 1W17A 1XDJA 2YB1A 2QPUA 2P53A 4C7FA 3W2JA 1J0HA 3TJXA 4Q7NA 2RHGA 2Q09A 5F2IA 1O94A 5AECA 4XVDA 3FN9A 3SY5A 1IXPA 1G6CA 1QR7A 5K9DA 1LRNA 5F2MA 2I16A 4PRTA 2XN2A 3E2SA 4R7OA 1DP0A 4MFDA 4XUGA 3EB2A 4KETA 1Q7QA 1GKPA 4O10A 5C7HA 2ZUUA 3B0PA 1JZ7A 4OV9A 4KS0A 4MZ8A 4HMNA 3GC2A 1MO0A 3NWRA 3BCFA 1I2QA 3NEHA 1GONA 2E25A 4X60A 2HV5A 3IUIA 3HM7A 3KTCA 3WDJA 4Q8OA 1XLDA 1XLFA 4XZBA 1B31A 4EAMA 1M7PA 3W1QA 1A5NC 4LRSA 4G8TA 2BY2A 1GTHA 3WDQA 1XIFA 5FF2A 4P7NA 3N15A 1WYIA 4N2YA 1KRBC 4HSNA 5A8PA 3P8IA 4O57A 2VEPA 3LRLA 2C0HA 3R1ZA 1OJXA 3UG4A 1Y7VA 3TK7A 3WH7A 3ITOA 1NDYA 4D6EA 2GGGA 4AYGA 1R7OA 3NPVA 3U2EA 1XIIA 4KEUA 4I3GA 4H3DA 2GUBA 1RVGA 1OIFA 1VLWA 3GSMA 3L66A 2XM1A 2F6XA 3C3NA 4D8ZA 3TONA 3GR4A 3ARTA 4GQBA 1V0LA 1FCQA 3AZRA 4O50A 4XZLX 1E0WA 1I45A 3NZQA 1VLIA 5FOOA 4DBDA 1TVNA 2Y0FA 1FDZA 3O15A 3MJMA 2CLKA 1PWLA 2W66A 4WY0A 4C6KA 2WBKA 5G4EA 2YW3A 1TQJA 4DQWA 2YXGA 4K1GA 1P1XA 4JTKA 3N34A 3SUTA 2IXUA 1JD7A 3GG8A 1YTEA 2VFDA 3KDOA 3QV8A 1FCUA 1EDGA 2GWGA 3SN1A 4KGLA 1S38A 4KCVA 3IANA 4HNOA 3W29A 3LQGA 3SFKA 4EPDC 3DZ1A 3PZQA 2ATSA 2BHUA 5LIKX 2NLYA 1L6SA 1WUEA 4ZTXA 2X2GA 1RA0A 4JN8A 4ROPA 3AXKA 4LUJA 4FO4A 1FHVA 4MJ2A 4HZ7A 2QPXA 1W9VA 5BXPA 3QLDA 2R94A 3GNRA 1X96A 1K4GA 4GZJA 5A3HA 1H1ZA 1E3ZA 1XLJA 3WF0A 3DX5A 1B9ZA 1EWDA 3HJEA 3LPOA 1M7XA 4LAKA 1TYGA 4IIHA 4W85A 3EWWA 1I8JA 3LGGA 3NPWA 3KBJA 2DZPA 3WLNA 3CV1A 5CKSA 5I07A 1D3CA 1OZMA 5CH9A 1UUMA 4PBEA 1V7YA 2WC4A 2UBPC 4O53A 4JD4A 3IJ6A 4CGTA 4KWSA 2NVDA 5H8UA 4FF5A 1EZWA 4IIFA 4L80A 3EDKA 1U33A 2A21A 4GLEA 2CHRA 3UA4A 3RYSA 1E73M 4RPQA 2GPTA 1C3FA 3BAIA 5D03A 1JIBA 2ZDRA 3C2RA 3DU0A 2GYIA 1QAPA 1H11A 3DHPA 2XVKA 3GG1A 1K9TA 2RJHA 3NPXA 3FAXA 2Q3OA 1VEMA 3FJ4A 5A2AA 3H12A 3KX6A 5TF0A 1VJSA 2XSBA 3GDRA 3V5OA 1PXGA 1TTPA 3Q67A 1NFGA 1QW7A 1XIHA 2GK1B 3N12A 1V3HA 3OG3A 1FCVA 3H6OA 3I3BA 3K2GA 2PEVA 4OE7A 5HR6A 4BEQA 5LIWX 3CPGA 1O5KA 1PSCA 1SFSA 1H61A 4QG6A 3PN8A 3THQA 2QGYA 2J9YA 4XK2A 5LGXA 1BTMA 1OYCA 1XSJA 3V4BA 1GOOA 4R53A 4CN1A 5A8OA 3HOJA 3KOZA 1ADOA 2WSQA 3B8TA 2ASHA 1X39A 2Z29A 2FH6A 1SJAA 1ME9A 4NYYA 1OBAA 5A8MA 5HNTA 1HO4A 3E0IA 1LTDA 3MV01 1VFFA 3SZ8A 1I2NA 1RA5A 5C8BB 4LVDA 4L4OA 3G77A 3M0LA 4CD8A 3W23A 1G67A 4KW2A 3CIWA 3HPSA 2FGZA 5BMWA 4Z0JA 3EKZA 4MDOA 3MUCA 1TV2A 1THFD 2ZFAA 1H7NA 2YSWA 2QYGA 1AG1O 4HKPA 4WDXA 4Q32A 4JHOA 4W8LA 2WPGA 1OFRA 3N4EA 1MXSA 2XZ7A 2XFFA 1DQXA 4B5XA 1TWZA 3TNOA 1IV8A 2DZVA 3EXRA 3TQPA 2P0OA 2BP1A 1V3MA 4LF2A 1CT5A 5HDRA 2XVGA 3AU6A 4H7ZA 1C7SA 4MB1A 3RMEA 1V0MA 1E5NA 2G3NA 2WHLA 1GJPA 4M0XA 4JQAA 2JKEA 3BOXA 2V2CA 1KC7A 2ZICA 3CUZA 3PBGA 3UZXA 5AHLA 1IZJA 1IIGA 4E2BA 3RNDA 2BNJA 1IGWA 3GY1A 3WIJA 2ZUVA 4HGXA 1R3RA 2C8NA 4C6NA 2P3EA 4LCQA 5EGRA 1DIEA 2BVTA 2WPBA 4ORMA 1GOIA 4ZZ9A 3RU6A 1NFPA 1O68A 1IT0A 3A23A 3SCWA 5DCEA 3S6OA 1BGGA 4K6AA 5DMNA 2VGBA 1UWRA 5CPTA 5I0DA 1BQCA 2E6YA 3R8HA 3C5QA 3UZ5A 4C6IA 1EYWA 1CB2A 2ZE3A 3W1MA 1EJSC 1BG4A 4LCSA 5FI8A 4AY7A 1F9CA 2NQLA 3LDVA 2WZEA 1JCLA 1A0CA 2AGTA 2PI6A 4EIVA 3A5VA 3THDA 3TTSA 4N6EA 4ZXOA 5FESA 4RDYA 1ISYA 4BK9A 1KBLA 1ONXA 3M43A 1J0KA 2VWSA 4E6MA 5EMMA 3FFSA 1A5BA 3A9IA 4GMEA 2B4GA 2FH8A 1O5XA 2NXGA 4LS0A 1NDZA 3H23A 1KM0A 3TYCA 3AMKA 5CAKA 3R6IA 4HTBA 3MCNA 3G8EA 2FPYA 2KX9A 3VOCA 2C0AA 2YX0A 3QEZA 1S3TC 2VCCA 1YE4A 4Z2KA 4D6GA 3P14A 3GXTA 4XD4A 1F4HA 3BAWA 1HKIA 4R3UA 1TRIA 1FP9A 3WUFA 3PK7A 1OYBA 5A8QA 3WQ5A 1TPEA 3S42A 3WFZA 3N18A 2X1RA 3T78A 3U4FA 4ATLA 3H2MA 1VBUA 4UOJA 2Y8UA 4K8EA 3WUBA 3LUTA 1G1YA 1A80A 3ZLFA 2F9RA 1XV8A 1H0GA 3BMWA 1B3WA 1W9XA 1XQLA 1AQHA 1ZCOA 1I1WA 3LLFA 1W5PA 3VK5A 3WYZA 3WEZA 2GGIA 3PULA 4Q3MA 1QPKA 2TSYA 4I9AA 5A95A 2O9PA 2QF8A 3DESA 2CESA 4IIGA 1KLZA 1BYAA 1AQ0A 1H62A 2CKRA 2VD9A 5M5DA 3TN6A 3C3UA 4H8UA 4JTSA 3K1GA 3VKBA 4QFUA 2YBUA 1QXLA 3OLIA 5CZKA 2ALRA 3DBPA 4C91A 5D4YA 4TX8A 6XIMA 5HNUA 1KWKA 4HPJA 3L68A 1C9WA 3MHGA 4IMDA 2CZVA 3KP1A 5I77A 3H7VA 1G5AA 2D0GA 4Q4RA 3BV4A 2A3HA 4WSKA 1OYAA 1W0MA 4UFMA 2VFEA 1XGDA 4MWAE 4G2DA 1C90A 3MCOA 1UD4A 2CYGA 2Z24A 2DP3A 1XUZA 2PS2A 1GJWA 2DJLA 2EPLX 2WJEA 5D33A 3JZUA 3MSGA 2GQ9A 1EHAA 3CHEA 5ABHA 2PDGA 1XI3A 3NA8A 3JW7A 1CX9A 2OYMA 2H8ZA 3HG2A 3C2YA 4LWWA 4F0LA 3GXDA 4M80A 2AL2A 1YADA 1QVBA 1UMYA 1DWHM 3DYMA 4WY0B 3MPGA 3TVAA 4A3UA 1Z8AA 4H1ZA 4RX0A 5LNRA 1YNQA 3KL3A 4GI9A 1S2AA 3VOJA 2VGIA 4ZE5A 2HS8A 5AYXA 3C2FA 4QJ1A 2VX6A 3KTXA 5CLWA 3OPSA 1I6NA 1V3KA 1MYRA 1P7TA 4ZOCA 2Y88A 3G6LA 1JCMP 1SZGA 6TIMA 3WJSA 1P5BA 2H3DA 1OVDA 2BMBA 4M8UA 2D2JA 3RAOA 4KWOA 1OCBA 5C70A 2J13A 1DJZA 3SDOA 3C0LA 3NAVA 2QJNA 3ZFHA 1ZBWA 4HHLA 1Y0EA 5BWAA 3DG3A 3MUXA 4HK7A 3TC3A 4C5ZA 2QUNA 3GUWA 3CTLA 2I17A 3CQKA 4DJFD 1U30A 2WKLA 3BG5A 5GNXA 1Q5MA 1VS1A 3URQA 4XTDA 2GL5A 3MO4A 3ARUA 4IPJA 1K03A 2FDMA 4D1IA 2O4MA 4HOXA 4J3SA 1L6WA 1P0BA 3WDPP 3NEVA 5HUOA 4HA1A 3HPFA 3OTRA 4PH6A 4ERGA 3RR4A 1K77A 3S0CA 4UB9A 5E9AA 3A47A 4JQ2A 1Y5XA 1XLGA 3N29A 1S2UA 3UR5A 4GVHA 4JTUA 5A2BA 3UW6A 5HPOA 5A6BA 3GVRA 2V3EA 4O13A 3SY8A 1VFUA 3GHUA 1PJ9A 5IXEA 1G4PA 4LU0A 1G0CA 3PZOA 4JFSA 4JYDA 3ARWA 3BAJA 1UD2A 3WLOA 5CZ0A 1ADSA 3EA1A 4UQAA 4GIEA 4KWUA 3ME3A 1WZAA 4UQCA 2VR2A 3L2MA 2D69A 1HL2A 3AXIA 2PODA 2WC7A 3UY8A 4QEEA 1FKXA 3MS8A 2HXTA 2E9MA 2YB4A 2PPGA 4RDVA 2A85A 2FMNA 5C0QA 2VGGA 4L61A 3AIUA 3QYQA 1K8YA 3GVQA 3N2XA 3V7PA 5BOOA 4LS1A 1MFUA 4RUBA 3M0MA 2PDYA 4GO9A 2WM1A 2MANA 3WBXA 4D1JA 4TIMA 3PPCA 3W38A 5AYYA 2AAMA 2ZZ2A 3VDBA 1NY1A 1VPXA 1R9XA 3NQCA 3BE7A 4IPNB 4YTRA 3U57A 4NY2A 3WELA 2C1IA 3L67A 1PZ0A 2REQA 3ZR4A 3BGJA 1V3IA 3TN4A 5I23A 3AYTA 1E0UA 4GUFA 3VOIA 4CNUA 4PYSA 3VTRA 5LKYA 1CDGA 4UCFA 4W7VA 1YMYA 4IQDA 3SFWA 1FHUA 4Y8EA 1NOWA 4MB4A 3I4EA 4N9CA 2J62A 1ZCCA 3KVLA 4PRRA 1YXDA 4I9TA 1LROA 1JVNA 1PBGA 4C6EA 1YPXA 1RP9A 3LNPA 4QS6A 4Z2HA 2HVOA 4QDWA 3VKDA 5FL1A 2E6AA 4LNYA 8XIMA 3ICJA 1B3ZA 1KFCA 2J66A 4PTDA 4G1NA 3C56A 1DORA 1EGZA 4YU1A 3COTA 4J5NA 2JKAA 3BSHA 3EOSA 4YVVA 4RE4A 1EJVC 3GNPA 4MDPA 3T8QA 4V33A 3G2GA 3R8RA 2QCEA 4I9MA 5AHEA 5IDIA 3GVVA 2P76A 3I10A 3LM3A 1EP3A 5D2WA 4Y7EA 4BWLC 1U5JA 3R7MA 4DO4A 3NM1A 2VX4A 2X0SA 3WH5A 4QLJA 4U28A 1EB3A 3WLSA 2PZ0A 4JAWA 2PWDA 1SGJA 3C0SA 1F4AA 2WYSA 1V3JA 3M0JA 5C2GA 4RPPA 3A5FA 3CHDA 2DSWA 3UJRA 3C52A 4L7ZA 1OM0A 1PX4A 4NRSA 3PTKA 1AL8A 5G2WA 2UY2A 1JFXA 4D6DA 3QZEA 4HZ6A 3MMUA 5CXPA 3BCDA 2Z26A 1NJJA 1YLVA 5D2YA 4CEUC 1D9EA 2E67A 3VI2A 5CC3A 1MRQA 3ITTA 4KIRA 4B5TA 1D7KA 3OA5A 2PTYA 3VC5A 4P7QA 1JYVA 2A6LA 2V3FA 4TX9A 1W1VA 2Y2WA 3FNDA 2RGMA 1Q6GA 1AQFA 1XD0A 3MY9A 3P93A 2O7QA 4NKCA 3CUXA 1UA3A 2VWTA 4B5WA 3AHZA 3BLEA 5F2GA 3W82A 1LCOA 2XGBA 3PJXA 2XISA 3QM3A 1IXQA 4HYWA 3EWUA 3IWPA 2ZQ0A 2VM8A 3R0DA 3N2BA 3IV3A 1OB0A 3GU9A 1PPIA 3RRAA 1UASA 1O1ZA 4DHGA 4JTTA 3M0YA 1TX2A 1DEDA 2A3BA 3GS6A 4C6DA 5D2TA 4QR6A 1QASA 3A4AA 3LZ5A 4BR1A 3NSMA 2Z2UA 3V36A 4QNWA 1RLCL 4A3YA 1XC6A 2A7NA 1MDLA 1UUOA 2IKJA 3BUVA 4HTYA 1BKSA 1E9YB 1ZS2A 5LXEA 2NUWA 4ML9A 4DXXA 2HBVA 1JULA 4DRSA 3GRIA 1P6CA 1O66A 2OLSA 5KMYA 5E09A 1QHPA 4RZ5A 1TPDA 2ISDA 2Y7GA 1PKNA 1UR1A 3E1F1 1V02E 3URAA 1Q6RA 4LVBA 2G3JA 1TV8A 1O7AA 2BY0A 3M0KA 2NV9A 5GJPA 4QAIA 2NV1A 4CQ9A 4GI6A 4LAOA 1XYMA 4I6KA 2WZIA 2VX7A 3PR2A 5D9MA 4JFVA 1UH3A 1FY6A 3WLIA 3AS2A 4N9EA 3VD7A 4KRTA 4UTUA 2EF9A 1HKKA 1YHTA 2X09A 4FX7A 5EYWA 3HZ3A 3V1PA 2DJXA 3N14A 1DQUA 1BAGA 1S1RA 3P7YA 1QWGA 1GQNA 4DLMA 4GI8A 4FNRA 1YDVA 3EPOA 4Y2WA 4IGMA 1HNYA 1BXNA 4HA0A 3V3WA 1FH7A 1NIUA 3KRBA 3VDCA 2PF0A 4P7OA 5MF5A 2VC6A 4DJED 3WBWA 3E0FA 3PZ9A 1CPUA 3I6TA 2PSNA 4AD3A 1HUVA 4UTMA 3W1XA 3GIQA 4UNIA 1UH4A 1EX1A 1JPDX 1JPIA 3S1VA 2OZTA 2BOFX 3L9CA 3G3DA 3G3MA 4J40A 4IP7A 4O4VA 1C8YA 3RCNA 4B4HA 1LF1A 4H6KA 1IYXA 2WVVA 4BHYA 3FSUA 3GK0A 1F07A 3PAJA 3UVAA 4WR3A 1NWUA 1JDDA 4TV6A 3BLOA 2Z1KA 1P7TB 4WQ6A 5I6SA 4KMQA 1XLLA 3E3HA 3EMCA 1R9YA 3H2AA 1FDJA 3CAWA 4IFKA 4UOZA 2WAGA 3TOPA 2ZZ4A 1PZ2A 2EJ1A 2GVJA 3M6YA 2DSUA 5K9CA 3UETA 1S2TA 3T08A 2Y63A 1OFPA 1VFOA 3OZYA 1HKWA 1OIMA 3JRKA 4GY0A 4J3WA 4U5KA 3KCLA 1G69A 5TBOA 4GQQA 4PTMA 4AD5A 2CXEA 3QKZA 4I8YA 2IQDA 2C3ZA 3CS2A 4K68A 1EJWC 1ODZA 4IICA 4C6JA 4GHRA 2EO7A 3WCZA 4DXVA 2QUTA 2DVXA 2CPUA 1S1PA 5CJMA 3I6RA 3N4FA 4ZB0A 2I7GA 1KM6A 1XIBA 2ZC8A 3QZAA 2YCIX 3AICA 1GHRA 2BBFA 4CCEA 2Z1SA 1XHGA 5A6JA 1KD0A 3ZIZA 1ZHAA 3PF3A 4ZO9A 4J2MA 2OX4A 1TWSA 2PDJA 1QPNA 4BQ4A 1RPXA 4PMQA 3VXGA 4FOJA 1RCQA 2Y89A 3VNLA 3KHJA 1KKRA 4QJ5B 4I5RA 2PP0A 3LI0A 4N4PA 4HNCA 3BW4A 3QC0A 3GZAA 1GTEA 5KZMA 4EP8C 4IMEA 4NJHA 2PDBA 4NJJA 2WVTA 3NURA 1DOSA 2HCVA 2XIIA 4PL1A 4XTIA 4HPXA 2CBIA 1JDEA 3N25A 1EXPA 1J6PA 2OSXA 1E1FA 1ME8A 5LNVA 4OUEA 4RJEA 1OC6A 4NT0A 3S2NA 5HWJA 9XIAA 3R13A 1GHSA 2PWUA 3NO1A 4GBDA 3M41A 4H8HA 1JRCA 3LBCA 3NPUA 3CAQA 3PUGA 4GZIA 3TQVA 3P0XA 1A5KC 3SBFA 4K36A 3N2TA 4MMWA 2CZEA 3DC8A 1A50A 5BXRA 3K8LA 3VMPA 2RFGA 1DWIM 4JTEA 3FVMA 1EOKA 1HL8A 1WAUA 2HWGA 1Y5VA 1YBQA 4FLSA 3DXIA 4O11A 2REQB 1OINA 3WJWA 4ML4A 5M3WA 1R0MA 3CZLA 3LCLA 5I5RA 1M1BA 3SGZA 1ECEA 4NNAA 1VPQA 1GVIA 2PDXA 1F76A 4YTTA 2GQ8A 1YPIA 3S5YA 3SUWA 1BHGA 1TJPA 2QMKA 5AC8A 1M7OA 1NSJA 3T81A 4E3VA 1LRTA 5FL0A 1PHWA 1VIWA 4RKAA 2YR1A 1XD1A 3R43A 5LHFA 1D7FA 1KB3A 1J11A 1AODA 3IJ9A 4UMCA 3NQ2A 4FLQA 3WO8A 2ZRVA 1GK8A 1QNRA 1WOAA 4NYUA 4YWIA 1G7VA 2C18A 1X7IA 4GNJA 4JTCA 3WNNA 1K7EA 1P6WA 4HYVA 2Q8XA 3C61A 4GD0A 1GT8A 2BX7A 2Y8VA 4JGDA 1W8GA 4NAFA 3S46A 1EFZA 2GJPA 1H50A 3CT7A 4PB3A 3ABQA 1JUKA 3GR7A 5CZSA 4E2OA 1MI3A 1T40A 3O05A 3ITYA 4H8NA 1ODUA 3S1GA 3S6DA 3OOQA 1X6LA 1K6AA 3FA4A 3GQYA 3SUVA 4AISA 3STEA 3N3MA 3NQVA 1AZ2A 2XN1A 3CQJA 2ZRUA 1BPLB 3JU2A 4NHVA 1DJNA 5JH1A 4ACZA 3HFTA 4A3QA 4HK6A 2ZA3A 2XFWA 3PUEA 3REQA 2PLJA 4XVEA 1VBGA 3UF9A 2O9RA 2PC8A 1OD8A 4HNVA 5HWNA 4AIEA 3A21A 1TE1A 4IJBA 3TN3A 1N8FA 5E0CA 4V27A 1J4EA 4H9ZA 1BXBA 1RLDA 2VEFA 3ABZA 1ADDA 3W7NA 4AWUA 3AJXA 4FXFA 3GU2A 2H90A 3RX2A 4KGJA 1CENA 2OXNA 4PMNA 3SADA 4F40A 3K8KA 1KTBA 4UOQA 1E0TA 3WEOA 4YPJA 4NAEA 1KFWA 1GOWA 4ICNA 3P67A 3E38A 5E0KA 3R94A 4WZHA 1V6XA 3W07A 1PIIA 1TPWA 2VEIA 3OLDA 3N2OA 2E28A 2Z1VA 4GXWA 2ADAA 9RUBA 3T0DA 4C6FA 4NASA 1CI1A 2WWCA 2BSLA 2Y70A 3M7SA 3DERA 4GNVA 4NI8A 3M0VA 2ZA2A 3TJIA 3RLHA 3U48A 1Q6CA 3BH4A 2FIQA 3GIPA 3PUDA 1HIZA 3IIOA 2CLLA 2D1ZA 4QHRA 3N19B 1JYXA 4ZL1A 2CLOA 3RO8A 1DTNA 5DXXA 3MUY1 4F9JA 3SCNA 2E8YA 3POHA 2F38A 2WW5A 4XZMX 4KFNA 1TV7A 4B5UA 3RFAA 3TTQA 3AO0A 3ZS4A 2DZSA 4A2SA 3B8IA 5GNZA 3RX3A 2O0TA 4BI5A 4FR1A 4X0VA 3VUSA 1VD6A 1UIOA 1KR1A 4ZE4A 1LLZA 4JN7A 3BDKA 3IAQA 4Y9OA 3CBWA 4B15A 2GOUA 2UY5A 1WDQA 4X22A 4GK8A 5F4SA 3VE9A 5A6MA 2TYSA 4GUIA 1CGXA 1GG1A 3KRUA 2FTPA 1HQTA 3CQ0A 4S38A 2YCLA 1UD5A 4MF4A 1XLMA 1TV5A 3CHVA 1EO7A 4ECLA 4HK5A 2X1TA 3GW0A 2ZBTA 3UWQA 3U2CA 2XWDA 4R88A 5DMMA 1RV8A 3NFUA 3QN3A 2OLHA 5LZLA 3UVIA 2RAGA 3HURA 1WKYA 4FX8A 5D30A 2BFGA 3W75A 3KM8A 2BTMA 3EDDA 3CAKA 3VNMA 2EQDA 4V1XA 5KEZA 2QJGA 2W0UA 3DOPA 3NXFA 4B5NA 2J7FA 2DW7A 1GYNA 1RD6A 4Z17A 1YQ2A 3AAMA 3V35A 5EL1A 7CGTA 2ZUTA 3G1RA 3W22A 4PMOA 3VNJA 3FJ6A 1TJRA 3QHOA 5FF7A 3DHDA 4M1BA 4NX5A 2VC9A 1FVPA 6REQA 2P1FA 1VQTA 3GKAA 1TUXA 4PR4A 1X98A 2J77A 1TVLA 4IFKB 3ZXWA 2FGBA 4MSSA 1TR9A 1CLVA 3QMTA 4J4KA 1DYSA 4XZWA 5TD4A 4XZHA 2NWSA 2RH9A 2G8ZA 3MP5A 2RUSA 4FP1A 3AOFA 3DFQA 1PWMA