2IS7A

Crystal structure of aldose reductase complexed with dichlorophenylacetic acid
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
315
structure length
315
Chain Sequence
ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESNGVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHDKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase
publication title Structural and thermodynamic studies of simple aldose reductase-inhibitor complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 99
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2006-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2is7A00
2F38A 1PWMA 4XZNX 3WG6A 4DBSA 2ISFA 4YS1A 4AUBA 1XF0A 2ACUA 1EF3A 2HEJA 4XVDA 2IPFA 4XZLX 2FZDA 5LIUX 4YU1A 4QBXA 2FGBA 1AH0A 4FALA 2HV5A 3DOPA 4XO7A 4JIIX 3EAUA 4XO6A 1IHIA 4GQGA 2DUZA 3WBXA 3M0IA 4H7CA 3EB3A 4GIEA 3U2CA 3N2TA 2ALRA 2IPGA 1YE4A 2FVLA 4WDXA 1XJBA 3GUGA 3Q65A 3LNMA 2PDQA 3UGRA 4L1WA 1Z9AA 4XK2A 2IKHA 4GQ0A 3LENA 4FZIA 3WBWA 4IJCA 1RY8A 3V0SA 2FZBA 1M9HA 2PF8A 4PMJA 1PWLA 3GHRA 4LBSA 3UYIA 3B3DA 1X98A 2HE5A 3LQGA 4PRTA 2DV0A 4IGSA 2PDIA 1LWIA 4GACA 5C7HA 2PDNA 4XZIA 1Z3NA 1UR3M 4LBRA 1S2CA 1T41A 4FA3A 3RX3A 4JQ3A 3ONBA 2PDMA 4Q7BA 3CMFA 1S1PA 3Q67A 2PZNA 4G5DA 4DBUA 1AZ1A 3O3RA 2NVCA 1T40A 2BGSA 3P2VA 2I17A 5AZ0A 1OG6A 3H7RA 3COTA 2IQDA 4OTKA 1ZQ5A 3H4GA 4NKCA 1Q13A 1FRBA 4PUUA 3F7JA 2PDYA 4H8NA 4LAZA 3LN3A 4JTCA 5HNUA 1QWKA 1LQAA 2P5NA 2ACRA 4JQAA 4EXAA 4ZFCA 3VXGA 1YNPA 3BCJA 2PD5A 4WDUA 4FAMA 1XGDA 3KRBA 3CAVA 2HVNA 3UZWA 3FJNA 3BUVA 1MRQA 3LEPA 1RY0A 1VP5A 4LB4A 3LD5A 4YVPA 3WCZA 4L1XA 1S2AA 3DN5A 2PDKA 3CASA 3R43A 3R58A 4RPQA 4XZHA 5JH2A 3G1RA 3RX2A 3CV7A 4XVEA 4PUWA 2INZA 2WZTA 4JQ2A 1C9WA 2IKGA 2PDCA 3N6QA 1R38A 2IS7A 1HQTA 2A79A 2PDUA 4PR4A 1SM9A 2IQ0A 2HE8A 2PDXA 4JIRA 4LAUA 3S3GA 3ERPA 4ASTA 1Z8AA 2IPJA 4QX4A 1AZ2A 3UFYA 3CV6A 1PZ0A 3UZYA 1Z89A 1K8CA 2QXWA 1ZUAX 4JTQA 4XAPA 2PEVA 1A80A 1ZGDA 1AFSA 3O0KA 2R9RA 2BP1A 3CAQA 1PYFA 4WGHA 2IPWA 3UZZA 3LBOA 3V0UA 2VDGA 3M4HA 2FZ8A 4GABA 2PDLA 1YNQA 5LIYX 4QR6A 4JTAA 4DBWA 3NTYA 1X97A 1X96A 1AH3A 2J8TA 2PDPA 3FX4A 5M2FX 1S1RA 4IJRA 4GCAA 1IEIA 2IKJA 4JTDA 1RALA 1YE6A 2PDFA 3V0TA 2HVOA 1MI3A 2NVDA 3WBYA 5DANA 1Q5MA 3UG8A 2PFHA 3QKZA 4PRRA 4QXIA 4ICCX 3RX4A 4F40A 3M64A 5HA7A 3R6IA 3GHSA 2HDJA 4EXBA 5KETA 3C3UA 3UP8A 4LB3A 3LZ5A 2AGTA 2PDBA 3LZ3A 2PDJA 3UZXA 2F2KA 2FZ9A 1HW6A 3V36A 2IKIA 2I16A 3R7MA 3BURA 1EXBA 3R8GA 3LUTA 4JQ1A 3EB4A 4WEVX 1ZSXA 3MB9A 5LIKX 3GHTA 1US0A 5HNTA 1QRQA 3ONCA 3UWEA 4XZMX 4HBKA 2INEA 2CLPA 2WZMA 5LIXX 3R8HA 1VBJA 1JEZA 3R94A 3G5EA 3D3FA 1AH4A 2R24A 4Q3MA 4WDWA 3LQLA 5JH1A 1EL3A 2ACSA 4YVXA 2BGQA 3MC5A 1EKOA 4WRHA 1ADSA 4JIHA 1J96A 4JQ4A 4MHBA 3V35A 4YVVA 1PZ1A 1MZRA 2PD9A 4GA8A 2PDGA 4I5XA 3T42A 4R9OA 5AZ1A 3BV7A 5LIWX 4DZ5A 2PDHA 2ACQA 4WDTA 1GVEA 2C91A 4HMNA 3GHUA 4JTRA 3H7UA 2PDWA 2DUXA
chains in the Genus database with same CATH superfamily
1GEQA 2RFGA 2ZRYA 3HV9A 3KL0A 1BKHA 1PWMA 5HNNA 4AHQA 3OVQA 4DBSA 2ISFA 4E4FA 1Q2SA 2ZKMX 3W84A 1P7TB 1A5OC 3I6TA 4C6DA 5D9MA 3SSJA 4JFWA 4NJGA 3L23A 4E38A 1KBLA 3GNDA 3FA3A 1YX1A 3HIJA 4HNLA 3GU9A 1E6XM 2PB1A 3I4EA 3HMJG 1NM9A 1WXJA 2P8CA 1R86A 1VCGA 1V77A 3B8DA 1WKDA 1WA3A 2O7SA 3KXQA 1K70A 1UMYA 3WL0A 1J10A 3NFUA 1W5QA 1IEQA 1SFLA 1KFLA 5I3FA 2E68A 1NSJA 4JKLA 4PMNA 4F2BA 4O1AA 3PZMA 3E2VA 4BFAA 4ZQPA 2VEFA 2PODA 3E5PA 5ABFB 3QC0A 4I9JA 4NZFA 3G0XA 2PTXA 4GQ0A 1KD0A 4A6GA 1M68A 3EX4A 1YW1A 1PTDA 3EA2A 4IQJA 4WIWA 5CSRA 4MJ4A 4LV9A 3PJTA 1MW2A 3S6TA 1NTHA 2FQIA 1B31A 3LI1A 1DXFA 2VEPA 3CMJA 2WQDA 4YHGA 1DJWA 1XC4A 2EKGA 4ROPA 1EDQA 2RJGA 1ZP3A 4X2RA 2WMKA 1XIHA 1Z69A 3BLIA 3PB0A 2D0HA 3LDVA 3HPSA 3QZ6A 4LAOA 1VQTA 4K7YA 3W7RA 2WCSA 5F1VA 4FA3A 1BYDA 4C91A 1YTEA 2BX7A 3S4TA 1S1PA 1RZMA 4GG9A 4CD5A 2PGWA 1AD4A 4J3TA 4JFVA 9XIAA 1E6SM 5DY3A 1OT2A 2I17A 2XSXA 2XWDA 1OEPA 3KRZA 3OIHA 1EJVC 5T26A 1LM1A 3FKKA 1QR7A 3TE9A 4DVOA 2D23A 1GVRA 4WUIA 4UTWC 1K03A 1H0IA 1X39A 3IARA 4QRNA 4D2JA 1KWGA 4LAZA 2TRSA 4H9ZA 1JZ5A 2Y2WA 2RH9A 2V3FA 5IBXA 2OLSA 2ACRA 1OJXA 3U3HA 4PCNA 1RJRA 3WD4A 4RKAA 3WFZA 3RMEA 3GIQA 3SUWA 1KGUA 2ABBA 2YIHA 4D8AA 1SU5A 3PTQA 1EF2A 4W4QA 3TOPA 4LVAA 4WY0F 3T40A 1R47A 1EC9A 4GUGA 3L0KA 3FIGA 1TPVA 1S2AA 1TUFA 4O18A 3W00A 4AC7C 2WKLA 1OCJA 1Q6EA 1QTWA 4Z0SA 2GVEA 3DFHA 5DT5A 3G1RA 4GE8A 2BVDA 1UIOA 5CPNA 2NT0A 3TZFA 1CLXA 3B8VA 4IP4A 3A4XA 1FFQA 1KGXA 2WW5A 3UG3A 1W1A1 2E67A 3ATZA 2OOGA 1LBFA 3I6RA 1MW3A 4ALDA 1UASA 3NEVA 4NXKA 3TWAA 4LYKA 2J7HA 2VQUA 4GO9A 3A4AA 4L64A 2J9YA 1X8FA 3M6DA 2QCDA 2G4FA 5C2XA 2OJPA 4REQB 2Y8KA 2WNZA 5CH9A 3N34A 1GGOA 3HTWA 3W1MA 7TIMA 3POCA 2B7QA 2BVWA 4I6KA 4Q8UA 3C2FA 3TLQA 1BYAA 3W7DA 1OYCA 2WO5A 4XISA 3H22A 4R85A 1QPKA 1RQHA 1OC7A 1NQKA 1G69A 4B16A 1GT8A 2J7GA 3NDYA 3PANA 2YB4A 4GZ7A 1PZ0A 1Z7AA 2UWFA 4QSFA 1YDYA 1F3XA 4DYKA 2B7NA 2X7VA 1CGTA 1T5AA 3G24A 4C7DA 1PKYA 3O0KA 1J2BA 4J35A 2QV4A 3LMYA 1W8GA 4MAZA 4IFKA 3NIYA 1Y5VA 3W3OA 3NQCA 5I79A 2V82A 3OQEA 3N9KA 1ISYA 2HWGA 1QOPA 2YFNA 4DBWA 4K8HA 1UUOA 1LUCA 1CLVA 4CEXC 1OF6A 3CUFA 1X97A 1BPLB 1AJZA 1EBHA 4AD4A 4ZQOA 1UH3A 3TMQA 5C70A 1RALA 2ZZ6A 4HNUA 1TUXA 4MPQA 4Z2KA 1EXPA 3TSMA 3UG8A 1KXQA 1DKWA 5BYWA 1UWRA 3RILA 2EEXA 5I3GA 2VQTA 3STPA 1R85A 5ENLA 1CTNA 3CHDA 1Q8AA 2PE4A 1X38A 3EZ4A 4J5NA 1HJVA 1SW3A 2H9AA 3AS1A 3UR7A 4ZB5A 1EXBA 3LNPA 3LPGA 4LGXA 2L5HA 1UD2A 5HINA 3AU6A 4RE2A 4EXQA 4I7VA 4D6CA 2NXIA 5JBEA 2A3BA 4K8EA 3S1UA 4XQ6A 2GUUA 2HSAA 3ITXA 4LFYA 3W88A 2Q01A 1MEWA 2CERA 3QGKC 1SR9A 4S38A 1EB3A 1LZOA 3NO1A 1AG1O 4X9YA 4UFIA 2VOTA 1SSGA 1V3LA 4MJZA 1GOKA 1EC8A 5BOOA 1AMKA 1EJRC 3BW2A 1M65A 5T9BG 4FNRA 3PSVA 1RP8A 3AIBA 1F4HA 4TTUA 2H3BA 3O6DA 3W75A 1XI3A 4EAYA 4AF0A 1V79A 1V02A 5CXPA 2X41A 2ZVIA 4I5XA 3T42A 3R79A 4GZJA 4H9TA 4GO8A 5LIWX 3TSBA 1GG0A 1UUQA 4BEQA 3PM6A 1C93A 3V5OA 4GUIA 4C5YA 3N15A 3HG5A 4PB4A 2PDWA 1W9BM 3SCWA 3PZVA 3LCWA 3OYXA 4Q8TA 1NJJA 3WYZA 3CT2A 3OLDA 3AIQA 1SMDA 3NSMA 4BI6A 4IPJA 4H01A 4LRTA 2ACUA 4X22A 4IMDA 3E2SA 3WJSA 1Q65A 4YU1A 4QBXA 1IF2A 2GPTA 4CNPA 3GX9A 4L65A 3URNA 3GTHA 2J8GA 3LV5A 3BDKA 2DQXA 2WMFA 2NX3A 4WOZA 1CPUA 4M6QA 3L21A 4XO6A 4MB5A 1UH4A 1ONXA 4E8DA 4IIBA 1KFBA 4O0KA 2CKSA 1V6TA 5K7JA 1R3RA 1V3IA 3IUIA 3EA3A 5HK4A 1RJPA 1WXYA 3SRKA 3VU2A 3FDKA 3GVWA 2A3CA 4OFCA 3AU2A 4QITA 4OV9A 1RY8A 5E0FA 3SN1A 3WH8A 5EMKA 4JBRA 3UJRA 4Z1BA 2ZX6A 3O0FA 2WNQA 1UR8A 1LOSA 4FX8A 1W3LA 2ODOA 1L6SA 4PMQA 4O1DA 4XZIA 3VD7A 4NILA 3RDKA 3MDWA 4Q7BA 1TREA 5D8WA 1TVPA 1WYIA 3Q67A 3CWHA 4RZ6A 5A6SA 1OYBA 3PZIA 4AZCA 4LC6A 3W70A 3KX6A 3UEQA 3AI0A 3P62A 3QOKA 3P2VA 5AZ0A 1W54A 1QO5A 1E5NA 3COTA 4WSJA 3L4ZA 5CJMA 2YLLA 2VFGA 3C2EA 1A0CA 2YYTA 4R7WA 1A4LA 3GDRA 1W5PA 1NEYA 3WD0A 3O6CA 4XIAA 3I7RA 1N8IA 4CCZA 3L0NA 1IIHA 4Q6JA 3MVTA 4AX6A 1MUMA 3EDKA 4TIMA 2ZA1A 2O9TA 3NM3A 5HATA 2DVXA 3UJSA 1VFTA 4JQAA 4S3DA 4HNCA 4LEQA 1RD5A 3BAJA 3FHQA 2EXOA 3NVTA 7ENLA 3GWQA 3GVVA 3BUVA 2B0MA 4KRTA 3U5UA 1B90A 3WDQA 4HCLA 3A5VA 3CUJA 1G4PA 3HF3A 4O1CA 3ABQA 5AHLA 3M5YA 3ITYA 4IX0A 3H54A 3LCIA 1DJNA 3G77A 3BMWA 1UA7A 3WLLA 4JFUA 1H63A 4M7TA 1FCVA 1AODA 4QAIA 2NT1A 1EGZA 2Z1VA 1A5MC 3VIMA 2AL2A 4C6CA 3PZ9A 4DY1A 4KIRA 4D6IA 3PWGA 2ZA2A 5H1WA 5BRQA 2OXNA 2ZUNA 3HBLA 3CL7A 1XRSA 3L7RA 2YA0A 3ZR4A 3AWNA 1TA3A 1ZAJA 2FHBA 2P3EA 1F6KA 1V3JA 3QMSA 4QTGA 1YPXA 3N6HA 5CZSA 7XIMA 4H2CA 3GK0A 3SCUA 5DXXA 3SQMA 3NQVA 3E74A 4JOMA 3UFYA 3K4WA 5FF4A 1L9WA 4IXHA 1WQ5A 3K4DA 1ZUAX 2GSEA 3LHZA 3LLDA 3DYPA 3EMCA 2GYIA 2Q8LA 1BSIA 3PPCA 3LPFA 5DFAA 3QBUA 4UMBA 3UNDA 4X9SA 4E8CA 4LCRA 1H5VA 4OECA 4AZGA 2A85A 3R12A 2NV1A 3RJXA 1E3ZA 1NELA 2RGLA 1FCBA 1OIFA 1K1DA 1VCFA 4JTAA 5FD0A 3R25A 3WLIA 4QCEA 1ONRA 3BW4A 2I5GA 4HB7A 4UTIA 4MAVA 1UD6A 4ORMA 4FLOA 3OQ8A 3CIXA 1P6CA 9CGTA 3RN6A 3C2OA 3W07A 1V3MA 2E40A 4IPLA 6XIMA 1ME8A 1MYRA 4F2UA 1O6IA 1V93A 1MI3A 5D9PA 3IUHA 3H2AA 3EEGA 1GVOA 3QTPA 3MY9A 4YCPA 2GK1A 4OWGA 2E5BA 4AG0A 2ZUWA 1E3XA 3L4TA 1DQUA 3GDBA 4IFKB 3RF9A 4D6JA 1TV3A 3WLPA 2WJFA 3ZT5A 2Q71A 4BK9A 1TCMA 3F03K 4XSLA 3VKAA 5A8QA 1WAUA 1SFTA 4N6EA 3NQFA 4L4MA 2V69A 3R8GA 1PKMA 1LUCB 1RPKA 2WB5A 4JQ1A 1UKSA 1HJUA 1ZSXA 5AHMA 3P80A 4KPLA 3ZSTA 4C6MA 1BWKA 4S39A 2F9RA 2YL6A 3NM1A 3VGBA 2INEA 4IMEA 3QYSA 4L9XA 4UTMA 3LV6A 5KEZA 1B1YA 4EF8A 3CZLA 1ML1A 2BDQA 4PTMA 4RZ5A 4H1ZA 1DTNA 3SUVA 3WLKX 4A22A 2WMJA 3VI2A 3NPWA 2DZWA 4HYRA 4LW7A 1XH0A 1HTIA 4WRHA 3S2JA 2QF7A 5CLWA 1SW0A 1NAL1 3GDTA 3FN9A 1J96A 1WZMA 4AD0A 3V35A 5A6JA 3WKZA 4GA8A 1WBJA 2NLYA 2E6YA 1CGYA 2O7QA 1UZ1A 4AZBA 2NW0A 1MUCA 2Y1HA 3W53A 5EGRA 4UTKA 3BZGA 3PFMA 4Y6GA 3B4UA 3ITOA 4DWSC 3QPYA 5AHEA 1H61A 3ECQA 5E70A 3UU0A 3VKCA 1GZGA 3FXGA 2V2CA 1EGVA 4H41A 1LTDA 3W02A 1UD3A 3ARTA 3N14A 3AXXA 4AUBA 3TJXA 1WDDA 3L65A 3H2CA 3HJEA 3NOYA 2VGGA 5H2ZA 6PTDA 2FZDA 4HU3A 5LNUA 2QV5A 1YDNA 3AMLA 3FNDA 2EG6A 2XG9A 1VIZA 3E0FA 3LB0A 1W3IA 3UWYA 3W1AA 1HL8A 4XO7A 4HP5A 2AQOA 3IIPA 5AHFA 4M0XA 4GQGA 4HIBA 4NYYA 1ZCCA 3M0IA 1V8EA 4AF0B 3M7SA 3FVMA 2XGIA 1EQPA 1ITQA 4RNHA 5HWNA 5FEZA 3FW6A 2ZXDA 4UTTC 5FF0A 1Z32X 2C18A 4EK7A 5DXYA 2WPGA 1E6RA 2ZTJA 4WJ8A 1XR2A 1LL7A 3KP1A 5EKYA 4FXRA 5HPCA 3BAKA 4F0LA 3GH4A 2WCAA 1CGUA 1L6WA 1Z9AA 1EHNA 3D47A 1F3EA 1XIMA 2XU2A 2QW5A 3M0JA 4CQAA 3ZR6A 3H21A 2WOQA 2VRKA 3B05A 3D0CA 2VJXA 4TO8A 1FHUA 1IZCA 5FJUA 4M1BA 2Z00A 2VGBA 3UWUA 4BJHA 1EO7A 5C7HA 1TPWA 1AQFA 3CL6A 3GXMA 4E2DA 4H9VA 5EPDA 1RLCL 4PSPA 2ON3A 3A64A 1Z3NA 3SGUA 3FGCA 2PAJA 2XN0A 1JDAA 2V5KA 3SIZA 3NQ8A 2TMDA 1TQXA 2NX1A 4LRSA 4CU7A 3W74A 3FCPA 3AHTA 1QATA 4JN8A 2OEMA 1OG6A 3DCPA 4JHMA 4AW7A 4TVUA 2X42A 3SSZA 2VM8A 4FIRA 4PUUA 4BF7A 1CB7B 3C56A 3TDFA 3WUBA 1CW2A 1QWKA 1JD9A 1RK6A 2JIWA 2XIOA 1GONA 1ZCOA 4S1FA 1K9EA 3T05A 3NJ3A 3P14A 3FAWA 3T4CA 3HA1A 2V5BA 1XCWA 3UZWA 1GEHA 5HUOA 4K39A 1RY0A 3WO8A 2W5FA 5PTDA 1YPFA 4L1XA 2FZMA 4GQQA 4OUEA 3SGZA 4RV3A 3VK5A 3CMGA 3MYOA 2VC6A 1C8QA 3EWYA 3GAYA 3HG4A 1VFOA 3PZOA 3RX2A 4JIPA 2J27A 2DW7A 2I57A 4C65A 5LA0A 2XH2A 1O4UA 3G22A 3FFSA 1VBHA 5GNZA 3L0GA 2XJ7A 3WQDA 2E1WA 5AC5A 3WQ4A 2E6AA 1VJZA 4OQVA 5A6KA 3INPA 2RDWA 1BGGA 3RNDA 4QGCA 4UQ9A 3FYPA 1E6NA 5LHFA 2GQ8A 3MSYA 1TE6A 3T2OA 5JU6A 2YDSA 4HPGA 3FA4A 2OLHA 2IQ0A 4H8HA 3EX1A 1U83A 2WC3A 3O6AA 4H9MA 3WENA 3MP5A 3QFEA 4O54A 1W1ZA 4PTVA 2QQ6A 3U5YA 3EWUA 3EMQA 1XYCA 3KL3A 2XVNA 1ZU8A 1JAKA 3K46A 3DECA 2PSNA 1WUEA 1YYAA 1B3WA 3DYOA 2ZOXA 4CQ8A 1M04A 4U3AA 4O1FA 2VX7A 1FX6A 4RE4A 4H00A 3G3MA 2Z28A 4MLJA 3V0UA 4DEFA 2FYMA 3AHYA 5AKQA 1FP8A 1L8PA 4EANA 3KFTA 4XUGA 2ICSA 4BF9A 3L4YA 6REQB 2G96A 3URAA 3HG3A 3FOKA 1AL7A 1SO6A 4LUYA 6ENLA 4ZQRA 4YTSA 1QO2A 2HCVA 3URQA 3QMTA 3B0XA 2Y8UA 3FSTA 2XH0A 1W9DM 2QNEA 4FR6A 4HK7A 3ZLHA 3GG8A 3WF0A 5ABEA 2C8NA 4RDYA 3S9ZA 2YW4A 3W7JA 3W7IA 1E0WA 3P8JA 5C55A 4BQ2A 1VBRA 5A1AA 1E6ZA 4MTVA 2RDUA 4GNJA 4C6BA 2VMFA 1OD8A 1I1XA 3C0QA 4KFOA 5ABTA 2J7DA 1FXQA 3LZ3A 1O66A 3M0XA 4HHPA 3V36A 2XVGA 3GR7A 1G4SA 1XIEA 4FLRA 3GQYA 1EIBA 3KBNA 2X1IA 3QRHA 3DFOA 2DUAA 3SN4A 3FS2A 2V63A 1QU4A 4IM4A 1GWJA 4C90A 3NZQA 4QLLA 4ZL1A 3WD1A 3QV6A 1TV8A 4O4VA 3U8GA 1ZENA 3SFWA 2PWFA 3NPUA 2OVLA 3LERA 2Y5SA 4GGBA 2CU0A 1EL3A 4IFRA 4B92A 4XZ9A 1EKOA 1VFSA 4HPNA 3RCNA 1QPNA 3ATYA 4IMAA 3BGAA 4N4QA 2OKOA 1YEYA 1AJ0A 1FDYA 1N2VA 2QIIA 2ZICA 3VPLA 4GFIA 5A8NA 2WQPA 1XX1A 3BZJA 4ZO7A 4GFSA 3N9RA 5D2WA 1F05A 1TB3A 4ZOEA 4PTWA 2PLCA 4M56A 4OIFA 4CVUA 1OFQA 3GTNA 2W67A 5TIMA 5CC7A 3AIUA 4KIEA 1OGBA 4DF2A 4NUWA 2ZC1A 3GTIA 4M29A 1G1YA 3LCLA 4D1IA 4KF1A 4EIVA 1F73A 4HTYA 5BWFA 4NZ3A 4DO4A 1FKXA 2CLFA 4I5RA 2WM1A 1DJZA 4UTHA 2X1SA 1U2YA 1E9ZB 1V7AA 4KKXA 1A0EA 4JL2A 4ES4A 1S5NA 1JD7A 1H7RA 4Z2HA 1VPQA 1FA2A 1JYWA 3N2TA 4MB4A 4X63A 4M82A 1P0KA 3K8MA 3NPVA 4LBUA 2DSWA 4RDZA 3G18A 1TCDA 3UGRA 3L4VA 5BU6A 3HO8A 4L80A 1QVBA 4O8AA 3O6YX 1R5YA 2QCMA 3NPXA 1WP6A 4LBSA 3BMXA 1S2TA 2VP8A 2EJ1A 2FPVA 3LQGA 3ZMRA 4KERA 3WQ8A 3M0HA 3S5NA 4GUJA 1QW9A 2J6XA 3W1PA 5DRCA 4O12A 4N42A 1TE1A 3PB2A 2V3DA 4LH8A 3PVFA 2GVYA 1QXLA 3DERA 1E1FA 3SUSA 1AW2A 5F2LA 1XLLA 1UJQA 1T40A 1W37A 3KOZA 3WF2A 1UZHA 4BZYA 4ICMA 4AQLA 4EPEC 1GORA 1ZQ5A 1QNQA 4RR4A 1D8CA 2XFYA 3MCOA 4A3RA 1Q13A 2VNCA 3VNLA 5M03A 5J5DA 1Q4NX 2PP1A 5IM51 3UQNA 1VYPX 3GXNA 4QFUA 5HUPA 1JQXA 2P88A 1Q7QA 3H26A 1FWEC 1LBLA 4N4PA 4PUMA 1GPWA 2HS8A 2P5NA 4YPJA 3WDIA 2EPHA 4ZFCA 4FP1A 3TTQA 4EX4A 1F74A 4M51A 5DX7A 1XKYA 4OOZA 1KCLA 2X2YA 2WAGA 1VRDA 3FGCB 1KTNA 1XUZA 1HL2A 3CAWA 3R4IA 4W8LA 4W87A 4HT3A 4UFMA 4DJFD 3KDNA 4TX6A 1MWOA 1VKFA 2KAUC 4PCTA 5D37A 5A8MA 2YL9A 4E3VA 4OE7A 4XZHA 3GXIA 1PX3A 4HMCA 4KGJA 7A3HA 3NQDA 4JN6A 5D9OA 3CQ0A 2Z2UA 3EWBX 3LG3A 5E09A 4DI9A 4H3DA 3M0ZA 3AS3A 3TW9A 5CC5A 4S3GA 2EG7A 2Y24A 3F2CA 3DGRA 1GOIA 3GFXA 3GR4A 1UKPA 2JF6A 3CUHA 4CNNA 4H19A 2R6OA 1UG6A 1CIUA 2E09A 4S2CA 1QW7A 1R3VA 5E5CA 5FF3A 4ZTXA 3UESA 3B4YA 2VX6A 3C61A 1SFSA 2Y5JA 3ENLA 3QM3A 4L6HA 1I2QA 4D8ZA 1JCXA 3DGBA 2AGKA 1F6PA 2PDXA 1T96A 3P7YA 3UG4A 4IIFA 3BICA 4UR9A 1M53A 5FEWA 4KWSA 4QQ3A 2VRQA 4MWAB 2ZRXA 5DF0A 1S5MA 1NFPA 2VYOA 1RCQA 4HN4A 1KFJA 3PJWA 3MU7A 2OWWA 1KFEA 2XH4A 4FEZA 1A4MA 1KFKA 4XAPA 1W32A 1ZAIA 2F8QA 3BOXA 3NXFA 3EKLA 4R7JA 5D2YA 3FKRA 4DAIA 4UOJA 2VDGA 3PY2A 5F1UA 2FH6A 5A6BA 4WSKA 4LNCA 1SPQA 1ODUA 3VDHA 3DFPA 4HTBA 1FCQA 4PL1A 1D3GA 4PTNA 4JTLA 3AYRA 1DVJA 1SFJA 3H2FA 1QI4A 1H49A 2WMIA 4KW2A 5IDZA 2Z2AA 1NDWA 1T8QA 1NDYA 3WQCA 3T8LA 1TMLA 8XIAA 3STCA 4B5UA 1H7WA 2BZNA 4WOQA 1PV8A 3APGA 3UZJA 5ABGA 1XV8A 3NQGA 4CCDA 2VT0A 4EP8C 1U1JA 4OV4A 3W27A 4GLEA 2V68A 3S47A 4QG8A 3GR8A 4K68A 2POZA 3HFTA 2YGYA 3L67A 3NL5A 4H6QA 4PUEA 1FWBC 2AOSA 1XYZA 2A3EA 5HJXA 3WUGA 5A6LA 1O60A 3VIFA 2E9MA 2FZ9A 2ZWYA 4Q8VA 1EJSC 5BOFA 1TV7A 1EA9C 4I6VA 4AD3A 3GHTA 3LM3A 1PDZA 4O4WA 3IIOA 1M3UA 2H90A 5DMLA 5E1QA 3E0WA 3CLMA 2F6UA 2V2DA 3M0MA 1UR2A 3SRDA 1UA3A 5U4NA 1QDSA 1JCMP 1H7PA 1XLAA 4UCFA 3QPEA 1UC4A 2BG5A 5F2MA 4BCEA 2GJNA 4YHEA 2GSHA 1XRFA 4YIWA 3DHDA 2ATSA 4C6NA 5BNKA 2PD9A 5FKYA 1U30A 1OINA 4B90A 2VFEA 4W8AA 3K13A 7REQB 3GTFA 3S2LA 4Y96A 3CHEA 1E15A 4IQLA 3FEMA 3VM7A 3IGUA 1Y0EA 2QS8A 3P0XA 3KWSA 1UIPA 4A3HA 2VWSA 2HS6A 3DFYA 1B3VA 1Q6LA 1EF3A 3EA1A 3ZR5A 5DCEA 1H3GA 3ZVIA 1ME9A 3GXDA 4D6GA 1GQJA 3GVRA 3EX3A 3KBSA 4IMFA 4LTSA 4X3ZA 1JPDX 1LLZA 4QQUA 1WCGA 3ID7A 4GINA 4RV8A 5JUVA 4HJFA 4JIIX 1AMYA 3BG9A 1TKKA 4MPKA 4BWLC 2KZHA 1OX4B 4Z08A 3UF9A 2ZX9A 2ZXBA 2OQHA 2OZ8A 1I0DA 3AYSA 3VKKA 2BASA 3H7VA 1J01A 1V0KA 4JTSA 4AEEA 3GUGA 2JKPA 5LXXA 3WLHA 4ZGYA 4D6DA 2OU4A 4Y90A 1VIWA 4XK2A 1FHLA 1CGVA 2VCBA 3RM4A 1GJWA 4XG1A 3ANYA 3W6MA 1W56A 1O1HA 1A53A 1XRTA 4W7WA 4ZO8A 4TUFA 3MHUA 3F4CA 2PWDA 4AEOA 3W73A 2BVYA 3PWIA 3VILA 1XHGA 4N7QA 1V6WA 2UY3A 3A9IA 3LK6A 3T07A 4IWWA 3ONBA 1J18A 1DHKA 4US6A 4MFEA 4FXSA 3OJGA 3MSGA 2Y7GA 3E38A 3SURA 3MWCA 4S3BA 1H62A 4HU8A 3MZ2A 4U31A 3NL2A 1XISA 2ALDA 3KOXA 4MLRA 2QULA 4AZ5A 3C2RA 1UP2A 2ZTKA 4YWSA 2Z1SA 3ARXA 4IZGA 5JQ9A 3WJXA 4WZHA 3GBDA 1ADOA 2X1UA 1I9CB 3UR5A 1W3NA 3W2NA 1CGXA 2J47A 1KCZA 4C6KA 4EXAA 2DQWA 3WNKA 3VXGA 2HK0A 5TBOA 4DZHA 1TWZA 3VD3A 3KBMA 3ARSA 4MNKA 1XW8A 3EWXA 2Z1XA 3LEPA 3WFLA 4DJEC 4QCFA 2G3MA 4ZMGA 3WEOA 4RCXA 3S5OA 8RUCA 3VGEA 4P8XA 2A3HA 4J9JA 3R43A 3T0AA 3TJ4A 1TJ0A 4IF2A 3VKJA 4AZ7A 4E2OA 1Q7ZA 4FB7A 3P3BA 3E3HA 1ZJBA 3EOEA 2WZTA 3N2BA 3GY1A 1TQJA 1NIUA 8A3HA 5FESA 2OZ0A 2IKGA 3GU1A 5A69A 3PBVA 4JKKA 5LNSA 3DZ1A 4XSMA 4JL1A 2ZC8A 1NP2A 4UQDA 2CWNA 3KCJA 2OYMA 1V6XA 1J0IA 4UMAA 1TWSA 2PRMA 2CHRA 2XWEA 2X8RA 2PWVA 3ZO9A 4X60A 4PR4A 4CLMA 2PGEA 5I5RA 3PJXA 2QCGA 3I4KA 1JZ2A 1EJWC 3GXFA 3EPOA 3TSDA 2OX1A 4L9ZA 1YDOA 3H12A 3WMCA 4Q4PA 1K6WA 1LG2A 4EPBC 3WNOA 3B04A 1UW9A 2H6RA 1I2OA 2DW6A 3QTGA 1MUWA 3PG9A 4KWWA 1S39A 5HMSA 4V15A 1XLCA 4LY4A 3SQLA 4J27A 1EJUC 1PYFA 3RR4A 4AC1X 2O4QA 3NO3A 4PULA 3G8RA 3W83A 1CXKA 1MMFA 2WNWA 3GS6A 4C6JA 3KBWA 2E9LA 4O28A 1XRVA 2Q09A 2JKEA 2DZUA 1XIIA 1TVLA 4K37A 2Y62A 1GHSA 2HJPA 2YDQA 3NSXA 5M2FX 1S1RA 2G3FA 5AC7A 1ADDA 3KZPA 4GQRA 2C15A 2R8WA 1XDMA 2YKKA 1Z6KA 4HOWA 3BG5A 1H4PA 1N8WA 3PN8A 4EAMA 3ELFA 1W9UA 2E6FA 2GGHA 3RX4A 2F7FA 1OGGA 4CKQA 3CS2A 3LPOA 1RCOB 1ZL1A 5JBFA 2FIQA 4MYAA 5DMMA 1RVKA 3MWAA 3N19B 4NSBA 1OWQA 1J93A 3FJLA 2YOCA 4JD4A 2VD9A 1S5VA 1JR1A 2NQJA 3A13A 3MUIA 3NCOA 1S2VA 1UD8A 5FJJA 3TA9A 2MANA 2GGJA 3N4FA 5DMYA 1OY0A 3BANA 4JIEA 4KQNA 4UC5A 5LIKX 1JPMA 5HNTA 3GM8A 4Q4KA 3W1NA 2WMIB 3VYLA 2OZTA 2DT0A 5C9UA 4AYGA 2WZMA 1Z48A 1XFBA 2WYSA 4V28A 1XD0A 3BH4A 4G7EA 4WY0A 3D3FA 4PMYA 2HNHA 1J0HA 4HA1A 2ZX8A 1B57A 6CGTA 3V3WA 3UVIA 2G4JA 1YKWA 2NV9A 3MJYA 1XLHA 3U48A 1XIGA 4INFA 1TTPA 2G97A 3UXIA 1B54A 3SCNA 1WDQA 1DXIA 3A12A 4AHOA 2XZ9A 3CQHA 3EX2A 4AFYA 5F4XA 4XV0A 1TV2A 3CL8A 1EX1A 3BG3A 3AYTA 3GHUA 4GC3A 4JFTA 1WDPA 4UQAA 3OBKA 4XZNX 1C8YA 3HN3A 2HEJA 5CZKA 4OBTA 4DPPA 3KBVA 3E5BA 2YL8A 1V5XA 3GIYA 3IJLA 1SO3A 1Z41A 4G6CA 1QI3A 1FWCC 2A3LA 3EPNA 4FALA 3HM7A 3RM8A 3HU7A 1XSIA 1H5YA 4I9AA 1FOBA 1XCXA 1VHCA 3P8IA 5C2GA 4M8UA 4HNNA 3EB3A 1LOLA 2Q8ZA 4ADUA 3OBAA 3GFYA 3H24A 3NVDA 1PKLA 3C0LA 3WNPA 5CZTA 4A05A 4L56A 4URIA 1JYXA 1R2SA 1K9DA 4XD3A 2CC0A 5CPQA 1NY1A 3OZOA 3PBMA 1TFVA 1GQIA 1E0VA 4IT1A 3OVRA 3GVGA 5EMYA 2P3ZA 3I7SA 2POTA 3IS4A 2HE5A 2DV0A 1CBGA 1CXIA 3TYZA 1FY6A 1YRRA 8XIMA 5T8GA 2PDNA 3NQ6A 1QNSA 4MB1A 3K8LA 1P1XA 4AD2A 2E1DA 4AY7A 3CQKA 4J3UA 3QZAA 1UBPC 1QWGA 5D2VA 1MQQA 3NA8A 4IH3A 3OGSA 3RG6A 3W2JA 5D4YA 3W28A 4DXKA 1NOUA 4GIRA 3BK0A 3GB6A 1VJIA 3WFAA 4GUHA 4RDVA 3SAZA 4PE8A 4YCOA 3VZYA 3G1DA 4CQDA 4HMEA 3IIXA 3NGJA 2P76A 3F4DA 4Y9MA 3ZS4A 1IQ8A 1QFEA 4QJ5B 4OOUA 2BB0A 4RUBA 4S3AA 1K7FA 1L2UA 5D2XA 3VKDA 3RU8X 3BCJA 1ZRQA 1XLIA 4JIQA 3TN5A 4B4HA 1H11A 4FSAA 4PODA 1L0PA 4DXXA 4GYKA 1SMAA 3NL6A 1TJ1A 3OG2A 4Z17A 1VP5A 1XICA 1J5TA 3ZWSA 1M7PA 3PHAA 3QPZA 3BLPX 2PP0A 3TJIA 1R3TA 3R58A 4DYJA 4XBJA 5HQLA 5EY5A 2WHJA 5AHIA 3P6LA 2DEPA 2OSXA 3ZXWA 1OADA 3K8KA 1EYEA 4U2YA 3U0HA 3MI2A 1BD0A 4MMWA 1V3KA 4JFSA 1WE5A 3CTTA 4XD6A 4X2PA 3I68A 5JMUA 2FVMA 4PMXA 3GAKA 3N11A 1FP9A 3IJ7A 4J2MA 1J6OA 4JCMA 3TN4A 1GOOA 2FMOA 3SCVA 3WLTA 3PUOA 1VCVA 3O8AA 1NOFA 1P7TA 4DQWA 4QSHA 4NASA 1Q3NA 4MM1A 1R8LA 2J7BA 1G9HA 4DF0A 3EDDA 3IIVA 2IPJA 4J4KA 5A8PA 2OO6A 3B8WA 3UZYA 4R53A 4HK5A 1QW8A 1Z89A 2YCLA 1P0BA 2HNEA 3KBJA 3WQFA 1J0KA 3LHVA 5A6TC 1FXPA 2DT1A 5HR6A 3AIVA 5I3DA 3EB2A 2DZSA 4BY3A 3L68A 2J7EA 3EWCA 4WKFA 4FOJA 3ZSSA 3P5ZA 3QSTA 3A6OA 4WR3A 1HF6A 5ABFA 3NZRA 1OYAA 1J9YA 1YDVA 3SY8A 4QEEA 1BLIA 4WJXA 1F7BA 1K6AA 2FJKA 2QGYA 5REQB 1TPDA 4PFHA 5CPTA 4KWOA 3GNPA 4MUPA 4OVXA 1UH2A 1DWHM 3RRAA 4IMCA 4HPJA 1JDDA 3TP4A 4WXYA 4RW5A 5LHEA 3ZT7A 4WKHA 2Q02A 3KVKA 1JZ7A 4Y7EA 1OC5A 1Q2RA 2FLIA 2PFHA 1BXCA 1EQCA 3B0UX 1OFPA 4CU6A 4QXIA 3VC5A 4HOXA 3S2CA 3R6IA 3IAPA 3TYAA 1NH6A 1E55A 4GBDA 3CQIA 3V1HA 1A3HA 4JX6A 1F8MA 3KUMA 3OIXA 2QCNA 2C6QA 1M01A 1H1NA 2E8ZA 1LQ2A 1QNVA 2XDFA 3IJ6A 2WSKA 1F3TA 1FWAC 3UWEA 3VINA 4RZBA 2A7RA 4US5D 1FHVA 3W87A 5I06A 1ZP4A 2PLMA 3LYEA 3TNOA 3STFA 3NZPA 3KDOA 1XWYA 4YVXA 4JYDA 5E6ZA 3UVAA 3JU2A 4NAFA 2PU0A 3W25A 1DTUA 2OZ3A 2V30A 1PZ1A 4HZMA 3IK2A 1FWSA 4YL2A 2ZADA 5BXPA 1BAGA 1OQFA 1JFXA 5K9DA 1NFBA 4Q22A 1GVEA 4FPSA 3U6WA 3PBYA 1YIXA 4NZ1A 4HU0A 6A3HA 3IJ9A 3APYA 3W72A 4DWSB 3CH9A 3M0LA 5G4WA 1XIJA 3CYVA 3G1YA 2ZUUA 1RV8A 1OFDA 4QS6A 3SCOA 3ZT6A 2E0PA 4REQA 4WY0B 1AUSL 3TW6A 2PGFA 1HZYA 4HZ8A 1I8JA 1TPUA 3QH2A 1YXCA 2VEKA 2Z1WA 1IHIA 2DUZA 2VWTA 3O15A 1TO3A 3W7QA 4CQBA 2Y0FA 1P0NA 2NSOA 2O0TA 1ZS2A 3A24A 5KTLA 3LRKA 1A3XA 4YLWA 1DJHA 4L1WA 2IKHA 4O1BA 3LENA 1IEWA 1PXGA 2FH8A 1NWUA 2ZZ1A 3W7CA 2BHZA 1D3CA 4EACA 1KTBA 2NV2A 1V4YA 3A4WA 4KESA 3WDPP 5RUBA 4N2YA 3W1XA 4GX8A 1T7LA 1GJUA 4AZIA 1I60A 1DORA 1RJQA 4XBSA 3WMBA 5CC3A 2XVLA 5D30A 2VKZG 4ZSTA 4NF7A 5CBIA 2W3ZA 3W0KA 3OGRA 4JQ3A 1F6YA 2CLIA 4GYFA 1XGZA 1UR0A 5C9ZA 2G5WA 1GQKA 1LWHA 4DBUA 5CPMA 3T1GA 4W89A 4I5UA 3VE9A 1XG4A 4GVGA 2WCGA 4ZQCA 1U5HA 3SUUA 2A7NA 5FOOA 5DCBA 1LWJA 3H70A 1BTCA 4DHGA 3PJUA 1FRBA 3W6YA 3M47A 2Q3OA 1UZDA 3D3AA 4JXCA 1SZNA 2QPSA 1JCJA 1JZ8A 3W01A 1LQAA 1JDFA 1F3WA 2E3ZA 2Q8XA 2XFFA 3C8NA 4WF7A 2IQTA 1VFMA 3RITA 1WV2A 1I2NA 1BQCA 2WVVA 3SQSA 3OW1A 1BVNP 3NDOA 3MBDA 1F07A 1KLZA 4GISA 1RBAA 3M07A 5K9XA 1AW1A 1ESWA 4P7NA 2BLEA 1OK4A 5G2HA 1E5JA 3LPPA 5I0DA 3T7VA 4Y8FA 4GXPA 3LRMA 3L12A 1XCFA 1EEXA 3P5YA 5JH2A 3P81A 5F7UA 4L9YA 1KRCC 5LGZA 4PUDA 3I10A 5CPOA 3TTYA 3DG7A 4US5A 3MI3A 3DH7A 4NI3A 3WQGA 4PUWA 5D38A 2CBUA 3WK0A 1G7UA 3UWVA 5AFDA 4LYPA 3KRUA 4JQ2A 2Y6ZA 5EL1A 1UZ4A 1US3A 2IS7A 4MKVA 2ZXQA 3AIWA 3M46A 3YPIA 3MUAA 5KMYA 4ACYA 2PDUA 5AYYA 4Q8PA 2R1KA 2V9DA 4PSRA 3BV4A 2PURA 4JIRA 4Z1AA 1Q6FA 5A2AA 4NX0A 3WK1A 4L4OA 3RCYA 3WH7A 2Z6IA 2D3LA 2C16A 3DG6A 2QUMA 4R3UA 3PZQA 3GNRA 1QHPA 4L4PA 3G6MA 4PTDA 3MA8A 1X6LA 4LUJA 4FX6M 2R9RA 1KNWA 4MZ1A 2BP1A 1VLIA 4BKNA 1DWFM 3GIPA 2VR5A 3UYCA 4MF4A 3DESA 1R46A 3N12A 3RLUA 3QSRA 3BGGA 3T8QA 1XLGA 3OODA 4F3HA 3IGSA 3DHFA 5FACA 1KBJA 2D2JA 1DPMA 4I8DA 4UTFA 1HUVA 3R13A 3T9PA 4IJRA 1DV7A 3PC0A 1DJYA 4GCAA 3CGTA 2DH2A 2B4GA 3BMVA 4K2SA 4MIMA 1XXXA 4ZXOA 1RP9A 3KL5A 4GGHA 1CB2A 3BAWA 5CJ5A 2J66A 5FF7A 1ZTVA 5FAGA 1GTHA 2VR2A 3MBFA 3PUGA 1Q5MA 4JYEA 9XIMA 3WZ0E 2ZZ7A 2C7FA 3OZYA 2A6LA 2YCLB 2P10A 3GKAA 3ITGA 3TQ0A 2ZX5A 4GYJA 4F66A 4HJWA 2YFOA 1YMYA 3AZTA 3CZ8A 4PEKA 3LBMA 3RLGA 5A6MA 2QJJA 1SJCA 3OZPA 5IBXC 2Z7GA 2H8XA 2PWHA 4ATDA 4QG9A 3LHTA 2BMBA 1HW6A 3AMGA 1WKYA 2QCHA 1NU5A 3VNMA 2BNJA 4NJJA 3MDUA 4M3PA 2BY0A 4C1LA 4LWWA 3MB9A 2WSRA 3MTWA 2G37A 3UWWA 1GNXA 2D3NA 2BOGX 1XIDA 4NP7A 4Q6XA 2VCCA 5LIXX 4H83A 2J75A 2W62A 3TAOA 3DC8A 1YXDA 1E51A 4M5PA 3R94A 3NNTA 1DJXA 4NNBA 3SJNA 1A49A 1X6UA 3QW3A 2JQXA 3WSUA 2BGQA 3HPXA 4M19A 3DAQA 3CZEA 4JQ4A 2OLAA 1J8VA 3WLJA 3G0UA 1ODZA 3B9NA 5MKGA 4LNYA 3TA6A 3SBFA 1ZALA 2PDHA 4NVTA 3ARRA 1GPFA 5FL0A 3UWZA 2F38A 3LTYA 1TVNA 1W9PA 4NYUA 4L6DA 4NRSA 4YS1A 1VZWA 3KLLA 4KT2A 4RL3A 3U4AA 4N9DA 3T0BA 1GOXA 1TWIA 3QJAA 3MSRA 1IXNA 2IUZA 1XSJA 4RE3A 3MO4A 4H9YA 3RPTA 1ZFJA 2UY4A 1KFWA 1CXFA 2ZVRA 3OA3A 2DJXA 2NQ5A 1F5ZA 4H9UA 3UA3A 1P1MA 4NAFB 1I6NA 2R1NA 4IISA 3WD3A 1VYRA 4YYFA 5D03A 5D2TA 1SZGA 4Q8QA 1R7AA 2GWGA 1PIIA 3GDKA 1R6WA 2A6NA 1D9EA 3B0VC 2OTDA 2PF0A 4OT7A 1UQZA 3CAKA 4HNTA 1JZ3A 3LLXA 1HVXA 4ZR8A 3V0SA 1H60A 2FZBA 4X0VA 1MW1A 4O57A 1JNDA 1E70M 4ZTYA 4CNOA 3V5FA 3AOFA 3IIZA 1VEOA 4JICA 1GKQA 2FPYA 4O16A 1UR3M 1PSCA 4DUVA 3IGHX 3C5QA 1BVZA 1OBAA 2GQ3A 3A23A 3GZAA 3Q37A 4MJ2A 4P7OA 3SO7A 3TR9A 2XIQA 5CC6A 5KZEA 3O3RA 3N2CA 4GZEA 2ZZ3A 1X1NA 3C2YA 3NEHA 3D6NA 3CHVA 3IRDA 3KHJA 2XFRA 1TX2A 3EXTA 3SJ3A 1FHDA 4ADSA 3OEXA 3AQUA 2VXNA 2Y89A 4ZQNA 2ZUVA 1E4LA 1ONWA 2Y7EA 3T4WA 1MO0A 3F4WA 2C1GA 1JPIA 4IOTA 4P5UA 3S2NA 1K8YA 1PE1A 5HNUA 2G3IA 4C6PA 1TR9A 1S46A 2NWRA 1UHVA 1O5KA 1E1CB 2CBVA 2VURA 3QQ1A 3ES7A 2BHYA 4S2BA 1PAMA 4UZUA 2WANA 4P61A 3KRBA 1Q6RA 3FJNA 5FJRA 1NF0A 2IXUA 2BY3A 4H4IA 4GVHA 3H2MA 4V2XA 3TTEA 3OVGA 2OG9A 1MSSA 2XFWA 2NXHA 4KEVA 1S38A 1CEOA 3ZJ7A 3MKVA 3TOYA 1E6PA 1L6GA 5D33A 1D7FA 2IW0A 3E2RA 1QT1A 1UUMA 3KM8A 2C1IA 4KEMA 4G9PA 1Q6QA 2AAAA 2FGZA 3T0DA 2Z27A 1IYXA 3B8TA 3TONA 4UFHA 3RO6A 3RUBL 2YBVA 4O15A 3M16A 2O56A 1QK2A 4AX7A 3W6LA 3U2EA 5HULA 1FDZA 1DP0A 1BWVA 3W82A 2WVVB 2UZ9A 5DLCA 3AMKA 4GVIA 1LOQA 1H1ZA 4Q4QA 5G2WA 2YR1A 4UNKA 1LT8A 3NXLA 2Y88A 2TSYA 1KV8A 3A9BA 3L5MA 1Z8AA 4HQVA 3VFCA 3W1QA 3W23A 3TK7A 4E4PA 2PI6A 1EJTC 2QXWA 1Q85A 2CZDA 1U5JA 1JNEA 2PEVA 3G6LA 3TCEA 5BRPA 3QY6A 1JCNA 4GCXA 4EPDC 3LBOA 2Z0IA 3MMTA 2OQYA 4MNLA 3GDLA 2ISWA 1WZLA 4Q8NA 5M3WA 3GG7A 3VIOA 1DWJM 5A8OA 4XD4A 3K1GA 1SW7A 3ARVA 1J11A 1X96A 1E56A 4ZO6A 1DQXA 1HJQA 1QMLA 1YTDA 2QUUA 3N3MA 5I03A 3LBCA 1YE6A 1IWAA 2QT3A 4Q4RA 2VFHA 2NVDA 1XS2A 1YXYA 1OFBA 3MS8A 4DM2A 1FWGC 3UT0A 4ICCX 3C0JA 1EBGA 2YBUA 5HQMA 3GRIA 4MG4A 3M64A 3TMLA 4FXFA 4V1XA 2BODX 2BY2A 5LA2A 4EXBA 5AC6A 4KBXA 3C3UA 2BXVA 5FEPA 3AS0A 5I77A 4H8VA 3UPWA 1FVPA 4Q7NA 3DIPA 2OWXA 1TTQA 3VD4A 1RBLA 1MXDA 1G01A 3EB4A 4WEVX 4IHCA 3SDOA 1X1ZA 2V3GA 1SO5A 3ONCA 1UPMB 3R0DA 4JR5A 5BXRA 4B15A 2JALA 1JUKA 3O9NA 3H2EA 1OFAA 4ZE5A 4I9TA 1OG0A 3M0YA 4F0KA 1A5UA 3PFRA 1BGAA 5HWMA 1TZZA 5C5YA 3REQA 1BHGA 4M6UA 1ADSA 1H7OA 1C92A 1JDCA 1BG9A 2VCAA 3THQA 5I78A 4UFJA 2VC5A 4QIUA 2QAFA 1WAWA 1R87A 2V5DA 2G8ZA 2PDGA 2WHLA 3C2VA 3L4XA 4R88A 3A3XA 4DZ5A 4UTLA 5LYRA 4AYSA 1PS9A 2DVUA 3EOLA 3ZM8A 4DIAA 2OYKA 4LV4A 4UBPC 3ITCA 1TIMA 5I2UA 3VGDA 1Z42A 3Q58A 4JTRA 4EWJA 5AN7A 3UD6A 2C13A 3EOUA 1P5BA 4O10A 3OOQA 4DLMA 1VAHA 4RNJA 4P8WA 4YTQA 4A3QA 1KXVA 4W86A 1T6MA 1MEHA 1HO4A 1DWAM 2WVTA 1CI1A 1V51A 4W88A 4ILSA 3FDGA 1O5QA 1TTJA 4TX8A 3GKFA 4U5KA 3TV8A 3NYZA 4GI8A 2NUWA 3PULA 3VX0A 4CD7A 1LROA 1TJPA 3O7UA 1GK8A 4CGTA 3H4WA 2A2IA 3RXZA 3QY7A 4IPIA 3RIKA 1NP0A 3CU2A 4AZ6A 2GGGA 2VO5A 5MKGB 1KFCA 3AS2A 2V6AA 4QAWA 3EKZA 1RR2A 1DBTA 2J9XA 3S8HA 4WQ6A 4DBDA 5KINA 3HMCA 4F48A 4IJCA 2EJAA 5F4SA 4F2TA 1N8FA 1PWLA 3W7NA 3GHRA 4KS0A 4XKYA 1E72M 5FJTA 2PTZA 1MDRA 5DBUA 1LWIA 2KX9A 3IJDA 4GACA 3DHPA 6REQA 3W2KA 3GH5A 3NQMA 4IIEA 3ALGA 1ISXA 2WWCA 4FIQA 3BWWA 1LBMA 3PZTA 2PCQA 4JY8A 1YADA 2OPJA 3NR0A 3S6DA 3UY8A 4O19A 1J0YA 3GBEA 5LNRA 2Y70A 5XIMA 1JULA 1OHLA 1UWIA 4IJBA 1W9XA 4NJKA 3HURA 4PGLA 1KC7A 4MY1A 3H7RA 1IGSA 2IQDA 3T0TA 1ZJAA 1KM0A 3QHNA 4WXZA 2C1HA 5AHNA 1OIMA 1FWFC 4AWSA 4JNMA 3GG0A 2NUXA 4AXKA 3RO8A 4C5ZA 4XB3A 1KRBC 1PTGA 2GUBA 3HQOA 4RXGA 1KBBA 3N18A 5BMWA 3T09A 3VOFA 1KO0A 3PK7A 2CXEA 4DJDD 5LZLA 2DSZA 4AVOA 4R27A 5FJOA 1TELA 1IZKA 5A6AA 4UTJA 3UXKA 3Q4DA 5IHSA 2VRJA 1XLEA 1XGDA 5D05A 3DC0A 4MNMA 3OG3A 2OB3A 4YVPA 3VOJA 3SRFA 3WCZA 1UROA 2D0GA 1O5XA 4YXGA 1LJYA 1R0MA 4MUZA 1RCXB 3TWBA 1GKRA 4M6VA 4MJMA 1SZEA 2H8ZA 2W92A 2CPUA 1IGWA 1TTIA 4LEFA 2PS2A 3TYDA 4WD0A 3R11A 1ZNNA 4C6FA 4J40A 2J88A 3W7HA 2Y4SA 4XVEA 3P0WA 3VIPA 4CNUA 1MNSA 3W24A 4GWEA 1W3JA 3I65A 3VO0A 4ACZB 3VTRA 3AO0A 1Q6OA 4KCVA 2A3AA 4DNHA 2PDCA 1QPQA 3QHOA 1B4EA 4MWAD 2VEMA 1XYBA 4QNWA 2JEPA 2GDVA 1PHWA 4FF7A 3T78A 2XVKA 1B2YA 4TMBA 2HE8A 3DFTA 4TQTA 2WBKA 1KGWA 3T2QA 4CCEA 1HKJA 1KM3A 4AD1A 4NT0A 1VLWA 2R1PA 2TAAA 2Y8VA 3H2NA 3K2GA 2VVSA 3O16A 4JTIA 5K3VA 4JTQA 5I3JA 3ISIX 5D8ZA 3F4NA 2QLYA 3AXHA 4PB3A 1NARA 2W0UA 2IPWA 1XLFA 4QHRA 1S5TA 3MUZ1 1EUNA 3WDJA 3OPSA 3ARPA 4JHZA 3UPBA 1HN1A 5C6MA 1B9BA 1POJA 1XM3A 1EOMA 3CC1A 1IR1A 3F5JA 1JPHA 2G3JA 3SECA 2J7CA 4RW3A 1XBXA 4AD5A 2ZQ0A 4KCUA 3CV1A 3OGVA 3IVUA 4NZ5A 2VC7A 2DU2A 1HFBA 1U22A 3C52A 4EWND 2YCJA 3QEZA 3MI6A 3OBEA 2PZ0A 1IT0A 3PP7A 3KW3A 4PTXA 3GW0A 1GCYA 4H2HA 1RBOB 1W91A 5FI8A 2DP3A 4IP7A 4QLJA 4IP5A 3EKGA 3GYCA 3ICJA 4NJIA 3BQ5A 3UNTA 1KV5A 1TMQA 1YBQA 2QCLA 2FFIA 4Y9OA 3QC3A 4DYEA 1B3OA 4B4FA 3UZXA 4K6AA 2PBOA 2NUYA 4NZJA 3BURA 2WKJA 3LGDA 3TQPA 3S1GA 4HZ6A 3WMSA 1EH9A 1SZFA 5CSSA 1G0CA 3SM0A 3ZLFA 3UJEA 3NL3A 4AHPA 3GH7A 5BW6A 2JE8A 1E71M 5F2GA 1C7SA 3R8HA 3G2GA 4FK9A 5TF0A 3WH6A 4NY2A 3DFSA 4O53A 4IIGA 2CHNA 1AH4A 4LS1A 1ONEA 3BOFA 2E25A 3TYUA 4DAFA 4XAYA 5JH1A 3WELA 1DE5A 2JGQA 3E6EA 2CLLA 1NF7A 2OX4A 3CHCA 1JAEA 1HP4A 4UNLA 3RJYA 3ZQ9A 1H7NA 1UR9A 3G3DA 4RPPA 1Q6DA 4JTEA 4DJDA 3ABOA 2OELA 1ICSA 4CCCA 4A2SA 1QI5A 2PTDA 4R9OA 1TR1A 4Q8OA 3CUZA 5AYXA 4NAEB 4IXXA 3H7UA 4CN6A 1XG3A 2W61A 4GJ1A 4WKAA 4IUGA 4RZ4A 4O11A 3GNOA 1VJSA 2X0HA 5J04A 2DIJA 4RNIA 1I2RA 4YTRA 1WZKA 2VD8A 3KCOA 1E40A 4PZVA 5AOUA 1D7KA 3ZLGA 2XHYA 4XVDA 2A21A 1Q45A 1PX4A 2CETA 2IPFA 3MW7A 1C8VA 4O1EA 5G4HC 4DN1A 3GVQA 4MSSA 5D32A 1FH7A 3SCQA 1VC4A 3VNJA 3REQB 4R7OA 3LM7A 3KTSA 2GVLA 2NXGA 4MWAA 2P50A 1QOXA 1K8XA 1ZHAA 2O9RA 4RLIA 3L66A 4HU4A 2BVTA 5FCZA 5LGXA 2ALRA 1C8XA 1CENA 1ZBVA 2JKAA 4DO5A 3WQ6A 4GI6A 3K30A 1YE4A 1VB9A 1AK5A 4GQBA 3BO9A 5I6SA 2C19A 2DPEA 3UZ5A 1GQLA 3VC6A 3VOGA 4K36A 3SIMA 2OGYA 1J12A 4AMAA 1MEIA 5CPLA 3S5ZA 2X16A 2XYLA 1BRLB 5C54A 8TIMA 4DWDA 4M6PA 3PBGA 1NVMA 5C9XA 3J7HA 3E96A 2YJQA 4EKJA 1JF5A 1E9LA 4LBRA 1T41A 3RX3A 2V5LA 4QDWA 3VIJA 4PCPA 3VGHA 3CHFA 4NG3A 4ZODA 2D24A 1LCOA 2DSUA 4G5DA 1JPKA 3GC5A 3N04A 3CH0A 3F5LA 3MUCA 3VD9A 2QDGA 3F4VA 5J5RA 3NQBA 1THFD 4KEUA 2BGSA 3KVLA 4AIUA 5DY2A 1RAKA 4QE1A 2VHLA 5LNWA 4E4UA 2QR6A 3RLHA 2AL1A 4CEUC 3P67A 4RE0A 4U4MA 2PDYA 1AJ2A 4LUTA 4H8NA 3LN3A 4H6EA 4H7ZA 4ZOCA 1QNPA 2VUNA 4DNMA 1PJ9A 3BLEA 2VELA 1RXOB 1H09A 1CXLA 3MYPA 5KZMA 4XKYB 4GY0A 1XUUA 3EDEA 4JTUA 1W1IE 3S5SA 1BXBA 3S42A 3WQEA 5M17A 3U7BA 4NI8A 4O8RA 1J6PA 3HFYA 3CAVA 4IG2A 1LL6A 5FA5A 2CNCA 3LD5A 4YTUA 3AJ7A 4ZB2A 1HVQA 5BROA 3VNIA 4EVZA 1FWHC 4KRZA 4Y9AA 2ISDA 1AQ0A 1LLOA 4XWUA 4NJHA 4F0RA 3LSBA 2PTYA 4LS2A 4RPQA 2ZWZA 5HMEA 3QLLA 1KQYA 3VIHA 5BU9A 2OOFA 1RVGA 4IIHA 5DN1A 3PR2A 4LF2A 4GD0A 2P1FA 1A5SA 1EWEA 2XSBA 2PRHA 4AH7A 2GDQA 2V3EA 1CT5A 3LTPA 7REQA 5A5WA 3LSCA 3N1AA 3TXZA 3N6QA 1VYSX 2C3ZA 3P84A 1WKEA 3RGTA 7PTDA 3W29A 3WQOA 3H2OA 4GKTA 3W1RA 4A8NA 2PLJA 4XAGA 2NLIA 1GHRA 2ABAA 3S83A 2R82A 1KRAC 3ANVA 2V0TA 1XL9A 1UWQA 1JZ6A 1ZBCA 1P48A 1DJQA 1KXHA 4UCGA 1VBGA 2F6KA 4Y9NA 1CNVA 3IPWA 2X7WA 2WVSA 1BKSA 1OABA 1QUMA 1A80A 2VENA 4IMGA 1CCWB 1OX4A 3ARZA 5IXEA 3W7KA 1QAPA 1GW1A 3M4HA 3PTDA 3VFLA 1G4EA 3RPMA 3M7WA 2OEJA 4LF1A 3GC4A 1FWTA 3ZVHB 5B7YA 2EQDA 4GUFA 1XIFA 5EMMA 1OFEA 3AZRA 3VIKA 4DX3A 2GVJA 4ORIA 2A4AA 4ERAA 3M5ZA 1HKMA 3FX4A 1EPXA 1WOBA 4U5IA 4UNIA 4WLCA 1TIWA 3PZUA 2E8YA 4J3WA 1TRIA 4J3SA 3CUGA 2RJHA 3V0TA 3QV9A 3BAXA 1ZAHA 3TJLA 1PVNA 1JGIA 4A8IA 4PFMA 4Z2IA 1FCUA 4JTTA 4GPNA 2YZ5A 5EYWA 3UY7A 2BXYA 3CV2A 5A6BD 4FF5A 4F40A 3TNBA 5LSMA 3PPGA 4JTHA 2CWXA 3LCFA 2WSYA 4V33A 3TCSA 6XIAA 1PTAA 3IEBA 3NZGA 3BLKA 3VM5A 5CQ1A 2AMGA 3R0KA 4TXEA 5HXMA 1Q6GA 3VZZA 2AGTA 4AZHA 1GOQA 3ABZA 3WJWA 1L2QA 3E0IA 2ZUSA 2YSWA 2IMRA 1KRMA 4ZEPA 1LRQA 3WF4A 3TTSA 1PIFA 3W1UA 5HOSA 4UTWA 3TU9A 1EDGA 2VUYA 3TX9A 3AHVA 3MUXA 1C9DA 1BVWA 1PZ2A 2WLZA 1RUSA 4XZMX 3NQEA 2CITA 1GUVA 3QYQA 3CPRA 2V5CA 2X30A 1H2JA 1XLKA 5DRIA 4HOZA 3FY1A 4MZ8A 3JVAA 3MC5A 5CG7A 3GZ3A 1QASA 1EYWA 2ATMA 4ZOAA 2QJHA 2WSPA 4L1GA 4QDPA 1XBVA 4C6QA 3TFCA 2WJZA 5I7GA 2QUTA 4TVCA 1YBQB 1W5OA 3LMZA 3IRSA 1V08A 2FB2A 3GXPA 1NDVA 2NSXA 3W37A 1V6YA 2ZCGA 5D02A 1W5MA 2QCCA 2JGYA 2XGZA 2Q6ZA 1XH1A 3PPFA 2EPOA 2WZEA 3CEPA 2OT0A 2VR4A 4NU7A 4FO4A 1XF0A 4RJEA 1ECEA 1LL4A 3P93A 1US2A 1V0NA 4OHQA 1IWBA 2CW6A 4XZLX 3WJZA 1L6FA 5G4EA 4MB3A 3TYEA 3LRLA 3W85A 2DORA 3NZ1A 3QVQA 3QZEA 3MQTA 1M5WA 2XH7A 4P8VA 4HCHA 3G1XA 2EKCA 2EPMX 3A47A 1KW1A 4PMZA 5U7SA 1POKA 5FIPA 1XPGA 1C91A 4PCFA 3ZFHA 2FVLA 5CGMA 4WDXA 4IGHA 3Q65A 5E0CA 4JEJA 3LNMA 3DKLA 1SSDA 3RAOA 3TLLA 5GNYA 3H8AA 1W2PA 2OMAA 3VNDA 2WBGA 4LS0A 3ORWA 2FHFA 2CKRA 3B8UA 5EU9A 5KITA 4PRTA 5HWJA 4GK8A 2Z24A 1ITXA 4YWIA 4GYPC 4Q8MA 3HV8A 1WX0A 3SGGA 1GOMA 3KTXA 4GY1A 4PBEA 4QROA 2ZDRA 2F61A 3CUIA 5LKYA 4RXFA 3LHUA 4H9XA 4FNTA 2WZIA 2QZRA 3TEVA 4QEHA 1BF2A 4MVAA 4G7FA 3SCPA 2Y63A 3LA4A 1I45A 2ZRZA 1BSLA 1EZWA 1PDYA 4I7UA 4RNFA 3FK4A 3CB3A 1P0EA 3NDZA 4JY9A 1FWIC 2MNRA 3MPGA 1PCKA 1EIXA 1GYMA 7CGTA 4GMEA 2DZVA 2HXTA 4QDMA 3QOMA 3E0VA 5DEZA 5EBUA 3IV8A 1M7OA 3CWOX 3UGVA 5MHBA 4J1OA 4XD5A 2ASHA 4WGXA 3P74A 1FH8A 4F4RA 4TTGA 4OKDA 1Y5WA 2BY1A 2BBFA 1JCYA 3C0SA 4HNOA 4DZIA 3P82A 4W7VA 5G2IA 3OB8A 1DJGA 1QK0A 3VCCA 3U2OA 1PBGA 3B9AA 3T0CA 7ODCA 1HIZA 4KWUA 1SJDA 2PLKA 4EF9A 2ZX7A 4LUSA 3VOCA 3L9CA 4DJFC 1J4EA 3RM9A 3DG3A 3PUDA 1JXJA 2CFFA 4O13A 4LALA 1QI2A 3VABA 4TVDA 2XIIA 5T91A 1E43A 4JNYA 4UR7A 2INZA 4LUTB 1JQVA 1S3HA 3UG5A 1S2WA 1IT8A 3MV11 1C9WA 3E0LA 4HSOA 4NZCA 1R3WA 1R38A 3SY5A 2PC8A 1SR0A 2Y61A 4DPQA 2UY5A 3JS3A 1JVNA 1B9ZA 3W7MA 2QPUA 3W81A 1JFHA 4ROQA 3VUSA 4UZSA 4F79A 4IG2B 3QFWA 5DO8A 2VZVA 3S3GA 4IGMA 2WZHA 4ATWA 2FVKA 2RDTA 4QNEA 4EPKA 1AZ2A 3CV6A 4Q32A 5AECA 4D8LA 1O7AA 1Y65A 2I5IA 3AMCA 2XGBA 3EGJA 4HSNA 1OCBA 5KSWA 2ONEA 3G1AA 3T44A 3I3BA 4NXSA 1XDLA 2V8ZA 1TZ9A 1O68A 4PBGA 4GX9A 4POCA 3CAQA 5EMJA 3E1F1 5C0QA 2HBVA 2O4MA 3ZYZA 4GABA 1QOQA 4XZWA 4LVDA 2PDLA 1YNQA 5BWAA 1GOWA 4QR6A 4IGNA 3GSMA 4KMQA 1TSIA 4Z2JA 2NX9A 3NTYA 4CQ9A 5IHRA 4R9XA 3IVSA 3IANA 3WEZA 2FZNA 4HPHA 1SO4A 3QN3A 4G2DA 3ARUA 1MW0A 1G5AA 2D0FA 3HQPA 2SFPA 3BC9A 3VD5A 2VFIA 1KWKA 3TZNA 3KVJA 4IIDA 1HKKA 1K7XA 3MUY1 1HO1A 4RDWA 3FYYA 1C3FA 2RUSA 1PPIA 4QM1A 3G1HA 1QHOA 2ISSA 5A2CA 2RGMA 4AY1A 2QDHA 2QCFA 5HA7A 4HK6A 4OJYA 5I07A 3NQ7A 3V5CA 4A8RA 2PC4A 4QS5A 1N55A 4DELA 3TFXA 4BQ4A 1VFFA 2CHOA 2PDJA 3QR3A 3MSDA 3QLDA 2VFFA 4G1KA 3HGOA 1XBYA 3M43A 1CXHA 1KBIA 2ZA3A 4MKSA 1A5KC 2BOFX 1EO5A 2E28A 3R0UA 5L9FA 3ZJ6A 2CLMA 2FFCA 2I9UA 2D1ZA 3N2MA 3LOTA 2MUCA 4WCJA 3ARQA 4GC4A 2YCKX 4LCQA 4TV6A 3QF0A 3THDA 4I90A 3ES8A 1J79A 2W79A 2WKGA 1MZRA 2YYUA 1IR2A 3VMNA 4DWSD 3TAKA 1ISZA 3SR7A 2CIPA 3K4AA 1GJPA 3BV7A 5CKSA 3TC6A 4W8BA 4GH1A 4R34A 4IQEA 4H04A 2QCEA 3WDRA 1P6WA 2DZPA 3K5XA 3LHWA 2QCDB 1TRDA 2DZTA 3BVJA 1SQ7A 3KE0A 2O92A 3CZGA 4HNVA 2E77A 2DFAA 3W1LA 3EBVA 3ZZ1A 5J8LA 5CBJA 3W71A 4F9JA 2WM0A 4YMZA 2BWGA 5CCZA 2ZYFA 2ZE3A 2JK2A 3GD6A 4H6RA 1UWSA 3ABRA 1AH0A 5L6UA 4HMDA 4XIMA 1UB3A 4ERIA 2QIWA 1K7EA 1FTXA 4L61A 1PKNA 2UV8G 3WBAA 1W5NA 5M1TA 1MQRA 1H51A 4OBRA 5LXEA 2DT2A 4DO6A 3KAOA 4GIEA 5FL1A 5HAOA 5E93A 4OGZA 4LQ1A 2DZAA 3R2GA 2GJPA 5AC4A 1SJBA 1V3HA 4LUIA 1DOSA 2YPIA 3G1SA 2ZFAA 1M9HA 1E4MM 3EWZA 3MMDA 1X98A 3HG2A 2DIEA 3WLQA 5M5DA 5I00A 3MMWA 3W2UA 1EC7A 1HX0A 4B3KA 3RLVA 4DUXA 3CO8A 5REQA 4KFPA 2TYSA 4JTGA 3O63A 1W3HA 2YDRA 4ERGA 1UP3A 1X6NA 3WH5A 3HPZA 1FWDC 2VFDA 3A5FA 3CZJA 5A2BA 1KLYA 3CMFA 4AWEA 3O05A 2WC4A 1UJPA 3AHXA 4O14A 3OHIA 5CGTA 4M80A 3PNUA 1AZ1A 4FMVA 1RK5A 4K38A 1UPPA 1LYXA 3DDMA 3OLGA 3SRHA 1HKWA 4HSHA 3KVMA 4LT9A 3UERA 3VMOA 3H4GA 1MFUA 3C3NA 1FBAA 4NKCA 1KM6A 1RQEA 2H9AB 3E2QA 4N02A 2A7PA 3F7JA 1F61A 4ZXLA 3KTCA 1KCKA 1XLDA 1XINA 1VEMA 4K8GA 4FNQA 1W31A 1W6TA 5HDRA 3UXAA 1EOKA 1L6YA 5JIPA 1QBBA 2PCEA 3SW6A 1YNPA 1VS1A 5DBTA 3MJMA 5I24A 3BAIA 3SI9A 2B81A 3BJTA 2HVNA 1UR1A 2P8BA 1I1WA 2FTWA 2F84A 2BHUA 3QGAC 3GYEA 1EJ7L 3GXTA 3DI1A 3A21A 1UWAA 3WQVA 4BI7A 4LJ3A 3CNYA 1HKVA 4W9TA 4LXFA 4XAFA 4GI4A 1XDJA 3Q94A 3CB8A 3V16A 1PIGA 2F2HA 3UWQA 2I14A 1UWUA 4PN2A 1WXZA 2OT1A 3UR2A 4ONVA 2GJLA 3W38A 2QVNA 1OFOA 2GUYA 4ZB0A 3D5HA 1WO2A 3N4EA 3MP3A 2C0HA 5GPRA 4MZYA 3KWXA 1HNYA 4HHHA 1GVFA 4TR9A 4QJ3B 1JCLA 1XKJA 2RAGA 3N6JA 1MZHA 4X0NA 1C7TA 4WHBA 4Z42C 1CWYA 3D46A 5TQLA 2PBGA 2BOEX 5ECVA 2C0AA 4DWSA 2DT3A 1YNYA 3NOEA 2J25A 4JPGA 4Y9PA 3OA5A 4AEFA 3IV3A 3CO4A 3ERPA 3SN0A 4K3ZA 1XYLA 4KH2A 3TKFA 2ZBTA 4O0QA 4O0ZA 4F8XA 2QHAA 1IV8A 1R2RA 3SY1A 3GLCA 5IFPA 1E0UA 1UR4A 2I5QA 3WDHA 1K8CA 4LUSB 3A3WA 1X8CA 1U5VA 2D73A 1VD6A 1ZGDA 1AFSA 3TR2A 5AYIA 3VOIA 2WSQA 3W2MA 1N82A 3RPDA 5C9WA 4KEZA 5CGQA 4JDYA 3L4WA 4XTDA 3BLDA 4JCLA 4LVBA 2HPMA 2FZ8A 1RH9A 1OSEA 1A5AA 3M0VA 3RU6A 4UTTA 1F4AA 3BQ6A 2GOKA 3KRSA 1A50A 1AD1A 1R2TA 4I7WA 1AH3A 1Q4WA 3NGFA 1ZB5A 4AVNA 3DI0A 1ZBKA 1FFRA 2B7OA 1W0MA 3BJSA 2BFGA 4KCTA 2D2HA 1TYGA 4JTKA 3R5EA 1LORA 4Y2WA 2Z1KA 1MNZA 3TN6A 4B91A 4JZ5A 1A5NC 3N2OA 4AZCB 4ZENA 5DANA 3QQWA 3SUTA 2VL4A 3TC3A 2GQ9A 4PRRA 4ZFMA 2J9ZA 2OKTA 3L5LA 3PS7A 2Z6JA 4EOUA 3F5KA 2B7PA 4MFDA 1RQBA 5KETA 3AWOA 1OC6A 5EFFA 9RUBA 2CLOA 1D8WA 2QUNA 4F0MA 1F2JA 5FJIA 3VOHA 2VEGA 3VMPA 4HKPA 1OCQA 3WUFA 4CD8A 1K4HA 2PP3A 2IKIA 4GH3A 5JXQA 4A29A 3BSHA 5BXTA 1ISVA 2I9EA 3S6OA 4ZCWA 1WDSA 1FUYA 1M03A 1XLBA 2PWGA 1GTEA 2J78A 1S5WA 2QPXA 3LLFA 2VEIA 3MO7A 1VBJA 2P0IA 3KS6A 2CBJA 4QJ4B 1EA0A 2CZFA 1KR0A 3V7PA 1JI2A 3PAOA 4X61A 1IIGA 4C7GA 1DHPA 2QDEA 3QMRA 4BA0A 1TX0A 4Q33A 5CG0A 3DHUA 3VE7A 1UOKA 1W1YA 3XISA 1TWWA 3M44A 2AL2B 2TPSA 1HGYA 3U7VA 1REQA 2OYLA 3CXOA 3GNXA 1E9IA 2EPKX 4ML4A 1KQZA 1LLWA 5C9RA 3CT7A 1LDCA 3AYVA 4S3EA 5KZ6A 3O2LA 1KCXA 3TIMA 1QPRA 2DSVA 4LCSA 1R9ZA 1TA3B 4K7VA 3ZIZA 1A5BA 2FTYA 3SADA 5JBDA 3LXCA 3PSWA 4GXMA 3L2MA 2NZLA 3PUEA 2DZBA 4B5SA 4B3ZA 3B8SA 1Y8BA 2FGBA 5XINA 3B9DA 2G50A 2HZGA 3AMDA 5A8GA 4LC8A 1WOAA 2WXDM 4UXDA 4PMOA 1UBSA 3FEQA 3EAUA 3LTSA 2YDAA 4D71A 2E6DA 1JYNA 4PMVA 3MKCA 5CJNA 2IPGA 3CQJA 4P2VA 3B03A 2J77A 3W2LA 1J5SA 5F4WA 5C2CA 2X1RA 1XFCA 2J4GA 2YBTA 5I3HA 3EDFA 5H8MA 3RR1A 3SB0A 3WBWA 1CYGA 3UBPC 1U1HA 2A5HA 3CM4A 3PWAA 1VPYA 4PC8A 4PMJA 4GNVA 2Z7KA 4GIAA 4A4AA 2PDIA 1A5LC 4W84A 5BOEA 3N3TA 3WEMA 2OWCA 4ML9A 2YXGA 1GYLA 1P0DA 1C29A 1B30A 4C6LA 1EDTA 1AA1B 4MYXA 1WKFA 5DELA 3F2DA 2Z1BA 3S2MA 3S46A 2GK1B 2IXVA 3C6CA 2J74A 4W5UA 2O55A 2PDMA 3ME3A 4FS9A 4F9DA 1K9TA 1KKRA 3CBWA 4KWVA 5FSDC 1ENUA 1PL9A 1W1B1 5JIWA 4Z2LA 2NVCA 3BL3A 3AUOA 2HVMA 3E12A 1JG9A 3CTLA 3VKBA 4GBUA 1HJXA 4UUIA 2FHCA 3U2ZA 1EP1A 3SCTA 2YZRA 4EE9A 3UCQA 2G3NA 3Q2DA 3GU2A 4DI8A 2AQWA 4GZIA 4CN1A 3GFZA 4YN5A 4A3UA 1I4NA 1QHZA 1H50A 5E9XA 1OCNA 3USBA 1GVQA 3S1WA 5BRBA 5FF2A 2FDMA 4D9PA 4NL1A 5AYZA 2VZOA 1MRQA 5HJLA 1HG3A 4LB4A 3CK5A 4QLKA 2DZXA 3GO2A 2J7FA 2EBNA 3CUXA 1RD6A 1V02E 3QQ0A 2NQHA 2CEQA 3DN5A 3SCRA 1G67A 2PA6A 3FVDA 3WQ5A 3HGSA 1F9CA 3MCNA 2ZDSA 3IGXA 4D6EA 1W1TA 2O9PA 4V27A 3KS5A 1JL8A 3CV7A 3I3EA 3MANA 2RKXA 3SFKA 2OSWA 3USZA 1VBUA 1UKOA 1DE6A 1W3KA 2JFEX 3B9EA 3IVTA 4PUKA 4LY8A 4WX2A 3VNKA 4AVFA 4AISA 2YXOA 4J3VA 5DMNA 1PHQA 1PB0A 2V67A 2YA2A 2P53A 1HXJA 4HYWA 4PL2A 3N17A 3T6CA 2I1OA 2HRWA 4TX9A 1IT7A 2X0SA 4Z2GA 2HK1A 1R9XA 1JZ4A 3AIRA 2QF8A 3AISA 3W1TA 4ZZ9A 4LAUA 1TZ7A 1SYTA 3VDBA 2BSLA 2NQLA 1VRXA 2HROA 1E1EA 1LP6A 1JJKA 4UOZA 2HXUA 4QX4A 1VFUA 5I3IA 5CAKA 4FNPA 4ADTA 1T99A 3P61A 3SEPA 1VFLA 3WK2A 1UD4A 3TXVA 3GTXA 5CZJA 1TMHA 3GUWA 1DWIM 3N25A 4XX6A 3TYCA 1EP3A 2WHKA 1XYFA 4J2PA 1ITCA 4MOZA 4GIYA 5LIYX 1FDJA 3QXBA 3L2IA 1XLJA 3BE7A 1OVDA 3ZOAA 2ZZ4A 3GG1A 1EFZA 3KZSA 3R8RA 1UP0A 4Z0JA 2Y5EA 3EYPA 3UETA 1GKPA 1IEIA 3WBEA 3W7LA 1UMLA 5AVHA 3HPAA 5EMLA 4D1JA 1K9FA 2PDFA 2Z2BA 1MFVA 3MZNA 2E4TA 1VHNA 1BYBA 3L4UA 2OCZA 3WBYA 2VZSA 2Z26A 5H91A 3ABXA 2X2GA 3QKZA 5FSEC 3HJZA 2PGRA 3FJ4A 4BQ3A 3BAYA 4IFOA 3LZ5A 1TPH1 3B97A 2B31A 3BLFA 1QBAA 2W91A 5CZ0A 3QV8A 4LOCA 3W86A 4ECLA 2Z25A 2HBXA 4E5TA 3ITTA 3NURA 1IXQA 1CLKA 2I16A 3HB9A 3CYJA 4XZBA 4I3GA 1JUBA 2VGIA 3ALFA 2ZIDA 3VNZA 4UWMA 5D04C 4QISA 1JXKA 1EP2A 3QKEA 6ALDA 3M0KA 3VGGA 3M5VA 1KXTA 3WX7A 1FH9A 4OBSA 1E1CA 2GVGA 3UA4A 1HT6A 2VZUA 2R24A 1ME7A 4LVGA 4W5ZA 4Y8EA 3LU2A 1L8NA 1XPYA 4E0CA 3UCDA 1OB0A 5G1MA 3APTA 4UOQA 3MMUA 1BWLA 1SZRA 1ZLPA 3TH6A 3M41A 5DCDA 4IQDA 3AAMA 3M6YA 5AB3A 1W17A 2OGJA 3O1NA 3UJ2A 1OZQA 3MHFA 3EOOA 1LQ0A 3PTKA 3GC2A 3TW7A 5A3HA 3UR8A 1IXOA 1S2UA 1JCTA 3FLUA 1LT7A 1N7KA 2C91A 4HMNA 3S1VA 1M1BA 1PEZA 1WB0A 4WJEA 4HGXA 2XVPA 1H41A 3PG8A 3WLRA 3T55A 3E49A 4LAMA 5H8UA 3XIMA 2W66A 2J62A 3AALA 1MQPA 3EWDA 3RHGA 3WY1A 1S3TC 2EG8A 4L6OA 3WUEA 4GYPA 3BJFA 3AXIA 3B06A 4KCWA 6TAAA 2ADAA 2FPTA 4E2VA 5AYBA 4Z1DA 1Q7MA 4GOAA 4O50A 2YB1A 1TJRA 3PNZA 5CBBA 2HMCA 1IXPA 2ZUMA 1T8XA 2QVHA 1REQB 3LI0A 4O17A 1HGWA 1MVYA 2A1YA 3HQNA 4GNKB 3CIVA 3U57A 3URBA 2PDQA 2P0OA 4ZSUA 2E5DA 5TAOA 4A2RA 2G95A 4JX4A 1IE7C 2YCIX 3WQPA 2R94A 3UYIA 3A4JA 3VIIA 4CQCA 4IGSA 4A35A 5JVLA 4UQEA 2OODA 2ZZ2A 4P7RA 3WK3A 1DEDA 1RSCA 2X1TA 4UTUA 1OD0A 1OFRA 3VZXA 1GVIA 3PBWA 4IPNB 2PZNA 4HZ7A 1PX8A 1M7XA 5FJPA 3EOSA 5KZDA 1R30A 4U33A 4HN8A 3BCDA 1BG4A 1FWWA 3MT1A 4PUJA 1XIBA 3AJXA 4DJFA 3AROA 3B0PA 5HBFA 4FXJA 4JTCA 2D2GA 2PWEA 2WLYA 4TU1A 2R91A 2AKMA 3POHA 4FLQA 2ZRVA 3S9YA 1LRTA 1J2WA 4LVFA 2YW3A 2VZTA 4DJED 3IACA 2PD5A 1U1UA 4FAMA 3HOJA 2X09A 5G1TA 3A22A 4CN4A 2EPNA 3ARWA 1TG7A 3CJPA 2WK2A 3KOWA 3AIEA 4JX5A 4C1NA 4LSBA 5E9AA 4B2DD 2A0NA 2XM2A 4I9MA 1IZJA 2BS9A 1XD1A 4CU8A 1ELSA 5I3KA 3CASA 2GJXA 5ABHA 2PTWA 1TJ2A 4NNCA 5A94A 1HJWA 3OU8A 2QJNA 4HVXA 2NWSA 5H8PA 2VI0A 4M7SA 5K9CA 1FKWA 2R1MA 1GVYA 5GJPA 4B5VA 2WJDA 2GOUA 4B5NA 2VTFA 5EBAA 3NYDA 3NUKA 3W22A 3THAA 2DH3A 3W7PA 1PCWA 3F1QA 2PPGA 1HL9A 3FAXA 5EB8A 1KB3A 1HQTA 1ZJIA 2WC7A 1CDGA 4NX5A 1G6CA 2ESCA 1E0TA 4JYFA 3ITLA 4UFLA 1B5TA 1RA5A 2CBIA 3HGRA 4HHMA 4CD4A 5GQBA 4FNUA 2ZUTA 3IJIA 2CYGA 3LGEA 5IOBA 1TWDA 1GYNA 1SM9A 3TROA 2D2OA 1PZ3A 3QHMA 3ZWTA 2WNNA 3KLKA 3JZUA 3VCNA 3JW7A 4FX7A 2PRLA 4DXVA 2J24A 4DO7A 1EEPA 4OU1A 2QYGA 5E6YA 3QR0A 5IFTA 3EWWA 2OQLA 1AW5A 5HJYA 4GY7A 1XBZA 4WGHA 4MKNA 4O52A 1UYQA 5SWUA 4BWLA 4W7UA 1VR6A 5HR7A 1P6BA 4MGGA 3TQKA 4UQCA 3R1ZA 3LXBA 1WDRA 2W4XA 1D3HA 3I6EA 2REQA 4HA0A 6TIMA 2JF7A 2VOMA 2XINA 2DIKA 3C8FA 3DEQA 4UQBA 3H6OA 3H4XA 2YX0A 1VEPA 3W4RA 2IKJA 1PUDA 3PZNA 3OHMB 3EXSA 3TVAA 1V6UA 1CGWA 1MDLA 2DY3A 4L5ZA 4KRUA 3T08A 1AVAA 4ZBCA 1UWTA 2DVTA 2Y85A 1XYAA 3THCA 2D22A 3V1PA 1I2PA 1KBKA 2PWUA 1VFHA 1E9YB 3BTNA 2VDHA 5B80A 3KOFA 2Z29A 2F6XA 3GHSA 4UIOA 3DBNA 1GG1A 1NWRA 3WMLA 4LB3A 3DYMA 3QV7A 1R3QA 1B3XA 5D9NA 3UCCA 4D72A 2VVNA 3G1FA 4HHLA 2BTMA 3CWNA 3CPGA 1DIDA 3LUTA 1W3TA 2WJEA 3ANUA 4RX0A 4BHYA 3STEA 5DT7A 3B40A 2QJMA 3KHDA 3RK8A 4MWAE 5EA9A 4AU0A 3IAQA 3NO5A 2CLPA 4M81A 3HGJA 4YJ5A 3TN3A 2W27A 1JEZA 2PU1A 1MRAA 4FLSA 3OLIA 3CIWA 2D20A 4Q3MA 3WN6A 1JI1A 1LF1A 3LQLA 4BQ5A 2BV9A 3W76A 3HPFA 1RLDA 4J3ZA 3LS9A 5BCAA 4DJEA 2EHHA 4U10A 1QNOA 4XTIA 5HPOA 1V6VA 4XBKA 3AICA 3W26A 2OR2A 3OVPA 1SGJA 4FHAA 3JR2A 1AQMA 4WDTA 4GRSA 2UY2A 1A3WA 1KA9F 3WIJA 4NHVA 4B2DA 2QMKA 4S3JA 4ACZA 4R33A 1UOZA 3BOLA 1UQYA 2QMJA 4V1YA 4ZOBA 4DLFA 3N29A 3WLOA 2X0YA 1K02A 1GQNA 4QE4A 3S5YA 5MF5A 2CLKA 1M41A 2NQ9A 1DL3A 1ICPA 3N2XA 3CZKA 2EPLX 5HQEA 5LIUX 2GDUA 3PAJA 2C79A 2X40A 5CLTA 2O9OA 3WLSA 1VGAA 3CEUA 1ICQA 2XM1A 4Q4MA