2IS7A

Crystal structure of aldose reductase complexed with dichlorophenylacetic acid
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
315
structure length
315
Chain Sequence
ASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESNGVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHDKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldose reductase
publication title Structural and thermodynamic studies of simple aldose reductase-inhibitor complexes.
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.21: Aldehyde reductase.
pdb deposition date 2006-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2is7A00
5HA7A 4EXAA 1ADSA 3V0SA 2DV0A 2PD5A 4XK2A 2IPGA 1R38A 3UP8A 3DN5A 4DBWA 2PDIA 2PDLA 3R94A 3UZYA 1XF0A 1X97A 3ONCA 2IKIA 4JQ3A 1GVEA 3WCZA 1MRQA 3H7UA 4PUWA 1US0A 3BV7A 3UGRA 3RX3A 1T40A 3RX4A 4FAMA 2IPJA 2PDXA 3GHRA 2INEA 5DANA 1XGDA 3M4HA 1LWIA 2IQDA 1QRQA 5M2FX 4WRHA 3GUGA 1AH4A 2VDGA 3H7RA 2DUXA 3G1RA 2PDUA 1IEIA 3LEPA 4XAPA 4ASTA 5LIUX 2ACQA 4H8NA 1VP5A 2HE8A 4RPQA 2INZA 2WZTA 4WDXA 3CAQA 2PFHA 3ONBA 3BUVA 1EF3A 1LQAA 1ZQ5A 2ACUA 2AGTA 4QXIA 5KETA 2PDWA 2PDCA 4XO7A 4JIHA 1S2AA 2FZ9A 3WBYA 2PDMA 3WG6A 3M0IA 3F7JA 3C3UA 2PZNA 3VXGA 4IJCA 4XZLX 1YE4A 3O3RA 4HMNA 2ACRA 3NTYA 3KRBA 4LBRA 4JQ1A 2BGQA 3EB3A 1Z3NA 4DBUA 2NVDA 4H7CA 4JTDA 2PDYA 3Q65A 2P5NA 2IQ0A 4XZIA 3LZ3A 1A80A 3R8GA 4Q7BA 3Q67A 2F38A 3COTA 4G5DA 3CASA 2R9RA 3V0UA 4JTQA 1RALA 1AFSA 4IGSA 4LAZA 2PD9A 1EKOA 1M9HA 3FJNA 3LNMA 4IJRA 4GABA 2J8TA 4GA8A 4YU1A 4EXBA 1ZUAX 4WDWA 4JTAA 2PEVA 2HV5A 2IKHA 2PDKA 1PZ0A 3UZXA 4F40A 2C91A 4XZMX 2HVNA 3LENA 4YS1A 4MHBA 1MZRA 4GIEA 4JQAA 1ZSXA 3CAVA 3S3GA 1YE6A 3UFYA 2FGBA 4XVEA 1MI3A 3DOPA 2HDJA 1AH0A 1EXBA 2IKGA 2PDGA 4DZ5A 4FZIA 1AH3A 1PWLA 3B3DA 1JEZA 4YVPA 1Q13A 2NVCA 3R8HA 4QBXA 1HW6A 2R24A 4JIRA 2QXWA 3R7MA 1AZ2A 2FZ8A 4JIIX 2PDHA 3MB9A 3WBXA 3BCJA 3P2VA 3R6IA 3LUTA 4GCAA 3MC5A 2I16A 1T41A 3EAUA 3LZ5A 5JH1A 3QKZA 4L1WA 4Q3MA 4LB3A 4LB4A 2BP1A 1K8CA 5AZ0A 3UWEA 4LBSA 3N6QA 4FA3A 2IKJA 1FRBA 3U2CA 4I5XA 4WDUA 3GHUA 5JH2A 5LIKX 1S2CA 3GHSA 1SM9A 2FZBA 1AZ1A 4R9OA 4PMJA 3UZWA 2PF8A 4QX4A 2I17A 1VBJA 2HVOA 5HNTA 5LIWX 3H4GA 4ICCX 4WDTA 3G5EA 3O0KA 1S1PA 3R43A 3RX2A 4XZNX 5AZ1A 3CMFA 1UR3M 1HQTA 4YVVA 5LIXX 4AUBA 1RY0A 4WGHA 2HE5A 2ALRA 1J96A 2HEJA 2ACSA 4WEVX 2PDNA 1YNQA 1Z89A 3EB4A 3LN3A 2IPWA 1X98A 1Z9AA 3GHTA 3LQGA 3BURA 2PDBA 3WBWA 1OG6A 3LQLA 4YVXA 3R58A 2A79A 1YNPA 4JQ2A 4FALA 1ZGDA 2PDQA 4JTRA 3LD5A 1Q5MA 4XVDA 3N2TA 2PDFA 3UYIA 4ZFCA 1RY8A 4PR4A 2IS7A 4PRRA 1X96A 3CV7A 4XZHA 3V0TA 2PDJA 5LIYX 1QWKA 2PDPA 1PWMA 2WZMA 3CV6A 3UG8A 2F2KA 1Z8AA 5HNUA 1PYFA 4PUUA 4DBSA 4XO6A 4NKCA 3V36A 4GACA 1C9WA 3V35A 2IPFA 4GQ0A 4JTCA 4LAUA 2CLPA 3T42A 2DUZA 4GQGA 4JQ4A 4L1XA 4HBKA 2BGSA 1XJBA 4PRTA 2FVLA 3LBOA 5C7HA 3D3FA 4OTKA 3ERPA 3FX4A 2FZDA 1EL3A 2ISFA 3UZZA 3M64A 4QR6A 1PZ1A 1IHIA 1S1RA
chains in the Genus database with same CATH superfamily
1LZOA 1W1YA 3B8IA 5HATA 2WCGA 3PZNA 4HP5A 3TJIA 4LNYA 3DKLA 1KRCC 1R38A 3B03A 1FH7A 1VJIA 2DUAA 1LORA 4ZQRA 2X40A 2WO5A 4K8HA 5I3JA 4K7VA 1GOKA 3N2OA 3O63A 3QMRA 4E5TA 4IIDA 5FJOA 3QR0A 1VYSX 3LHVA 3RGTA 1E1EA 2Z6JA 3C0SA 3WYZA 4RUBA 4UFLA 4M81A 2YB1A 1ZP3A 3U2EA 3CUIA 2ZUUA 4X22A 1KFKA 3ZZ1A 1RXOB 2OQHA 4PEEA 5F1VA 1EWDA 2J78A 3A4WA 4CCDA 2EPOA 3N13A 4K8GA 5H8PA 3E5BA 3P93A 1E51A 2Q3OA 3TA6A 2VDGA 3DENA 5D04C 2PDUA 5LIUX 4Y9NA 1F4HA 2QCDB 4CCCA 5AYBA 2DIEA 1FVPA 4S3GA 4AC1X 4HCLA 2EPKX 3VTRA 2ATMA 2C79A 3KP1A 5TF0A 3UZ5A 1HJVA 4U5KA 4S3JA 4POCA 1FWSA 3UERA 4F2UA 3LGEA 4NJJA 4G7EA 4MWAB 2REQB 2PGWA 3A12A 1MO0A 2CZ5A 3ARYA 1KB3A 1BRLB 3PZGA 1FWIC 1QW9A 1OB0A 4IG2B 3WNMA 1HJSA 2X2YA 3CLWA 3S2NA 3OQEA 2PLCA 1Q7MA 2QYGA 2FPTA 5H2ZA 3RM8A 4G8TA 1OCQA 3LSCA 4IWWA 3BAYA 1YADA 1W9PA 4DVOA 3LNPA 5M03A 3KS6A 1I4NA 1JCJA 4QNWA 3IGXA 3QHMA 4FLOA 2DZTA 1A0CA 1M9HA 3VGGA 5J5RA 1F3XA 5J5DA 4J2PA 1XS2A 3CPUA 1TE6A 2E9BA 2HNHA 1Q8AA 3S0CA 1TTIA 1EEXA 3BSGA 5FSEC 1P7TA 2OCZA 6XIMA 1DKWA 4QDWA 3DFPA 2XINA 3KX6A 3EDFA 4C1NA 3L0GA 1IT7A 1IT8A 3M0HA 4S3FA 3LGGA 4DJFC 4Z1AA 3M0VA 4XVEA 2OKTA 1VIZA 2ON3A 3NURA 1NM9A 4UFHA 3MUXA 4X2PA 3NSNA 5E0CA 1UP2A 2V2HA 1EBHA 3GFYA 3W25A 2Y8UA 3KBJA 3ZVHA 2D2GA 2NLYA 2NV9A 1GJPA 1EJVC 3K46A 4MWAE 3T07A 3MCMA 1KTNA 3ARTA 6TIMA 2EQDA 1TJ2A 5FEWA 1AL7A 3LUTA 3VIIA 4NY2A 3GUWA 4OV4A 1A3WA 2PURA 4HPNA 2EF9A 3GVVA 1RA0A 1FWBC 1GUVA 8XIAA 2OZ8A 3HMCA 2ZDSA 3MCNA 3IANA 1XSKA 4EK7A 4E2OA 1XGEA 4PULA 1M7JA 2OWXA 4TR9A 1IZJA 4OT7A 1VCVA 4TOQA 3CHFA 3G1FA 4B5WA 4EAMA 4GX9A 3WL1A 1UH2A 2HXTA 4EPBC 2HVOA 2WKGA 3MS8A 2ONEA 1Q63A 3NQ6A 1W56A 4P2VA 1W9VA 3M7WA 4DXKA 5BYWA 3HGRA 5EKYA 4E8CA 1BVZA 3DG6A 1K02A 3QR3A 1F6YA 2DZUA 4O1EA 3CV2A 3QC3A 2PDNA 3W2MA 1Z89A 4ADUA 4ADTA 3HOJA 2E5DA 1M7XA 4RL3A 3WQEA 3OBKA 2AAMA 2ZWYA 2XVPA 3L5LA 4GYPC 1MXDA 3F4WA 1BFNA 4AW7A 3LG3A 1XKYA 1ZGDA 3VCNA 4JTRA 1F61A 4I90A 1F5ZA 2GJRA 1GKQA 3UA3A 1RQHA 1GOMA 1Q5MA 4LUSA 4KCWA 2PC8A 4JFUA 3KTCA 3H8AA 3HTWA 2J9ZA 4WUIA 3M0MA 4KT2A 1OX5A 2Z24A 2CU0A 1QWKA 3L2LA 3CV6A 1X1NA 3OIXA 4W7WA 3Q45A 3MKVA 2GJNA 5CPNA 3EMZA 4PCTA 1BXNA 1TG7A 4ZQCA 4XO6A 4XBKA 1QDSA 3N12A 3EKGA 2AOSA 2O55A 3ZSTA 4ENLA 4LVGA 1OZMA 1THFD 4NJIA 2YGYA 5EB8A 3WJYA 2BHZA 4UWMA 5BZAA 3BAKA 3N3MA 2OOFA 1F05A 3LRMA 3ELFA 3LHTA 1E5NA 3VKDA 3R1ZA 3TQPA 1MDLA 3ARPA 1GORA 2J25A 3L4VA 2PLKA 1HT6A 2RAGA 3UCDA 2FVLA 3QGVA 3FW6A 1FCQA 1UZHA 4M19A 3UJRA 4WKAA 1UB3A 2ZCGA 2Y61A 5G2IA 4CQ8A 4MJ4A 4I9MA 2BOFX 2VX4A 3TH6A 2E1WA 3C8FA 3GDBA 4CD5A 3UNDA 3WBXA 5HA7A 4F0MA 3W00A 3F03K 3TLQA 5C55A 2BB0A 4AWSA 1UUOA 1ZTVA 3CHCA 1KXQA 3K13A 3ZS4A 1O5XA 4O1DA 3VIMA 3WUEA 4WLCA 2YDAA 3ANYA 5A5WA 4DI8A 4QJ4B 3SRFA 1X6UA 3BV7A 1W31A 4V15A 4WF7A 1EP1A 4J3WA 1WP6A 4HT3A 4F9JA 1MZHA 1YPIA 1JZ6A 3DYPA 3PHAA 2A5HA 1CPUA 4L4OA 3C61A 3GYCA 1VRXA 4C6BA 3SUWA 1H7RA 2Y70A 5IRPA 4XISA 4OV9A 3TN5A 5FF0A 5FESA 2ZRVA 1MFVA 1JUBA 2P3EA 4Z1YA 3ABXA 2FJKA 4NX0A 3GG0A 1S5TA 4C7FA 3OVGA 3K4DA 4UR9A 1UOZA 1V6YA 2WZTA 4D1IA 1WB0A 1XUZA 1F8IA 3FA3A 1QWGA 3L4ZA 4AD3A 3BQ5A 4TVCA 4NAEA 3MWCA 2CWNA 3A3XA 4UQDA 1QI3A 5FJIA 3LK6A 3B8SA 4B5XA 3CQJA 5CQ1A 4KIEA 3DG7A 3VZYA 1YIXA 4XIAA 1REQB 3WBYA 3M0IA 2ZUWA 3GVGA 2QUMA 4PL2A 1PKYA 4US5D 4Q6JA 3EB3A 4GVFA 1D8WA 1GJUA 3U57A 2WMFA 2ZZ1A 3Q65A 3Q58A 3UR7A 1H1NA 4D6DA 1HX0A 4O4WA 5DMYA 3STCA 3P60A 3EDEA 3R8GA 1UZDA 2F38A 3COTA 2R9RA 3PAOA 3HURA 5D8ZA 2GDUA 1KKOA 3IVUA 4LRSA 4F8XA 1R3QA 3LTSA 3N73A 4AQLA 3GH5A 1TX2A 5DO8A 3WEZA 1ZUAX 4LF1A 4C6MA 2Q02A 3N6HA 1E3ZA 4OOUA 3WJXA 1OYAA 4NAFB 1WNOA 1EJRC 2ZUMA 3AMLA 3B05A 1K6AA 5EL1A 4L6HA 2PWEA 4JQAA 1MZRA 3AFBA 3H4WA 1DE5A 3S3GA 1FWJC 1E4MM 3NGJA 3SCSA 4J35A 2BODX 4RDZA 2XGIA 3GTXA 5CGTA 1SSDA 4MZYA 1X1ZA 4C6IA 3OGVA 5F4SA 3W7CA 3CUGA 3ARQA 3BQ6A 1H3GA 3TYCA 3GSMA 3PULA 3VOFA 3I68A 1OK4A 3ARUA 1N7KA 3URAA 2PWUA 1PZ2A 1EC9A 1Q85A 4K6AA 5FF3A 4NP7A 1FCBA 3W88A 4YXGA 3FYYA 1HKIA 1IXQA 3LLDA 1OADA 1UUQA 3INPA 4UB9A 5KZ6A 3RO6A 5BRBA 4GCAA 1EZWA 3UT0A 2CESA 1P0EA 2DT0A 3DFQA 1WDDA 2BVDA 4LOCA 1VD6A 5KTLA 3QFEA 1L2QA 5I79A 1CWYA 1FWCC 2XWEA 5A8QA 3KHJA 1C92A 1OFPA 1AW2A 3KVMA 2WMJA 2CHOA 2ABBA 3KE0A 3O15A 3W1MA 1VB9A 4LPCA 3KBWA 3H12A 3ATZA 2DH3A 3ZR6A 2WKLA 3U5YA 4FP1A 3I6TA 4O0ZA 4DLMA 2VZVA 2OVLA 1DJHA 3QJAA 3DFNA 4NXSA 3EX6A 1A5AA 1B9ZA 3RXZA 3OW1A 2RUSA 4WVXA 3T78A 3G5EA 5GNZA 5DF0A 3GIPA 3AIUA 4N9CA 3PZTA 4D1JA 2C8NA 2OX4A 1NSJA 1K7FA 2DEPA 2DJXA 3L0KA 1TV3A 1E0XA 1VH7A 4CNOA 3HGSA 4LAKA 1J96A 2R1LA 2VEGA 2TPSA 2YDSA 1X1OA 3AYRA 3LN3A 3HM7A 3UESA 2QUTA 1Z9AA 5HJLA 1C8VA 3H2MA 1UD4A 2HK1A 3H2OA 3AXHA 3CUXA 3OEXA 1FFRA 1H11A 2VT0A 1E6SM 4D6CA 5BOEA 3CZGA 4HOWA 1FKXA 4FF7A 3C8NA 1JFHA 2EKGA 2PU1A 3H22A 3GYEA 5MKGA 4DWSD 3OHMB 3W74A 1EOKA 3UEQA 3LD5A 4DBDA 3TWAA 2JF6A 1PIIA 2G97A 3KS5A 1ZAHA 1O95A 1WZAA 4KBXA 3O6YX 3HIJA 1SW0A 3P74A 3QBUA 1YX1A 4E38A 7ODCA 5BW6A 1SO5A 5CGQA 3PS7A 4MY1A 3JZEA 1F73A 4DF1A 3K1GA 4QTGA 3W82A 3WENA 1H5VA 1QI4A 4X9SA 5I09A 3A21A 4ES4A 3ITGA 2G3FA 2WQPA 3GH4A 5FSDC 4O28A 2J4GA 3IVTA 1D8CA 3RILA 4XZBA 3FV9A 4G7EB 1K8ZA 2W3ZA 5FEZA 5AN7A 1FCVA 2X1TA 4UBPC 5A2CA 1RCQA 2X1SA 4O8AA 3GDKA 1UQZA 2E40A 4NRSA 1C7TA 4PH6A 1GHRA 1VENA 1LQ2A 3VDBA 2W27A 1W32A 3SZ8A 1J0ZA 2JEQA 1GW1A 4XK2A 2IPGA 2CZDA 3WH9A 3LCIA 1XBXA 4HNTA 3EWUA 4HA1A 3TK7A 3ONCA 1EH9A 3J7HA 3CH0A 5DRCA 2GUUA 3WQCA 4M6PA 3WDIA 3CQHA 3SCWA 3VKCA 1AUSL 1T40A 1OVDA 1G7UA 1XYZA 1D9EA 4Q32A 3AZSA 4J1OA 1FA2A 2VWSA 1CGWA 2OEJA 4LEFA 2EO7A 5DANA 4XUGA 4H6QA 4UOZA 1P7TB 4DYJA 4A29A 2QEZA 4C1NB 3WNLA 4AMCA 4ZE5A 4GD0A 2HZGA 1WDPA 3T81A 4Y9PA 4ASTA 1MXSA 4KQNA 1V3IA 3PZVA 1YTKA 3FJ4A 3CAQA 5C9UA 3ONBA 3QH2A 3HPAA 3RITA 3ZVHB 1Q6OA 3WQFA 3QQWA 2PUZA 2A6NA 3R4IA 3G8RA 2J24A 3I6RA 1JYXA 4KEMA 1KKRA 1IYXA 1P0NA 1V0KA 5HNRA 4JQ1A 2CLLA 3DH7A 1WCGA 4OBTA 1A4LA 3T1GA 1B0IA 4GYPA 3OU8A 1HO1A 4FS9A 2IQ0A 3T0DA 5F2LA 1A80A 3SFWA 4P8UA 4L61A 3L23A 2ICSA 1K77A 3H70A 5DEZA 3DFSA 1A50A 3A5FA 1PZ3A 3NQVA 4J27A 4R85A 3EA1A 1VJSA 7TAAA 4FO4A 2XJ7A 5E09A 1SZNA 1F74A 4FNPA 2J88A 4IX0A 3IIOA 1S5VA 3DUGA 1CXKA 3VK5A 3VAVA 2Y7GA 1NH6A 2DY3A 4UTWC 3S9IA 5EFFA 3W4RA 2C91A 3HPFA 3ARSA 4G56A 3P6LA 1GPWA 3C4UA 5JBFA 4MKNA 4D6EA 1W5PA 3UR8A 3OA3A 5C8BB 4CN6A 2PRMA 3C56A 1WKEA 3FJ6A 3GXIA 8TIMA 3R0DA 4DZ5A 4LU0A 1I2NA 3ZLFA 1OINA 3W84A 3S83A 4AY1A 4C6PA 3KTXA 3HPZA 2AQWA 1OC7A 1DORA 1W9XA 1Q13A 1FCUA 1XCFA 5REQB 1NQKA 1HIZA 3EPMA 4LUSB 2VFDA 3M41A 4I9AA 2EPNA 4W9TA 1OT2A 5LZLA 5JBEA 3NDZA 5AVNA 4YCOA 1D3HA 3R0KA 1T41A 1ZP4A 2QMJA 3RRAA 3SRKA 2O9RA 1JCYA 3O07A 4PYSA 1RAKA 4EACA 5CCZA 4LBSA 1PVNA 3UF9A 3TN3A 3KBNA 2G4FA 2Y5EA 4DRSA 2PAJA 1Z69A 3CZKA 5HWMA 3TYBA 1AVAA 4WR3A 2V3DA 3XISA 4S3AA 1CXFA 1EO5A 1YDOA 2XIMA 1XYBA 4WSKA 5G2HA 4DJED 3GDTA 4PMJA 1JPMA 5K2ZA 3ZT6A 5HNNA 3O6CA 5D03A 1BSLA 1H2JA 4ICCX 1R30A 2EPMX 4A05A 3NZPA 4LRTA 3A47A 1NQ6A 1W3JA 1E6XM 4M8UA 1IV8A 4IFKB 3PN8A 1CB7B 3PPHA 2QJJA 4ZB0A 3FYPA 3B9OA 4C6QA 1UR8A 4AYGA 4EP8C 1MYRA 2HE5A 2ALRA 3RJYA 3QY7A 1GEQA 3B4YA 4HB7A 2HWGA 3GH7A 1WAWA 4Y7EA 4LALA 3FIGA 3WBWA 4MADA 1H7XA 3MV01 4MTVA 1IXPA 4YWSA 1OX4A 4RW3A 1JRCA 3F2BA 4PZVA 4CQAA 1HUVA 3D6NA 4K39A 5H6HA 4DO5A 3VD5A 2WBGA 2XHYA 2Q71A 1U5HA 1IR1A 4O52A 3EYPA 2JE8A 3CWOX 4PE8A 2Y1HA 2CWXA 4JTLA 2J66A 3T0TA 5HOSA 1E73M 3H26A 4IIGA 3H23A 2PWDA 3MI2A 3ARXA 1QU4A 1P6BA 4DWSC 3QW4B 3SW6A 1BVWA 3UGVA 2BY1A 4ZGYA 3ICJA 5BXRA 3S8HA 4GNJA 1G67A 4GUGA 5GJNA 2BOGX 1NELA 1CYGA 1X8CA 2PP0A 3W1UA 3TUUA 2OWWA 5E6ZA 3W1NA 2YBUA 4QHRA 3KBMA 3W6MA 4KH2A 2ATSA 3WELA 2G3MA 3GC5A 4JTKA 4NILA 1E1FA 3S6DA 3A64A 2Q09A 2G0WA 4F0SA 3LBOA 3CZ8A 1XLLA 4AEFA 5C2XA 4WJ8A 4UTIA 4LSBA 2FB3A 3RK8A 3M64A 1DJWA 4FOJA 3MPGA 3W7DA 1VPQA 3UCQA 2WSKA 1L6GA 3PBGA 2DV0A 3SURA 5FL0A 3CUHA 3TMQA 4ATLA 2EPLX 3WZ0E 5G2WA 3W1AA 5K4ZA 4IQEA 2QLYA 3QTGA 3K30A 1XF0A 1BVNP 1JAKA 3DYMA 3SI9A 4LCQA 1EUAA 3V5OA 1YNYA 4MY9A 2V5JA 3WCZA 3TQKA 1TV7A 5CPQA 1R7AA 4OIFA 1MW0A 4UMBA 4Y96A 2QF8A 3B9EA 3AALA 4FAMA 1Y5VA 3VIJA 5I02A 1UYQA 2QUUA 3HG2A 1HGYA 4NVTA 2J7CA 1F6PA 3DHPA 3DFHA 4H2CA 1VR6A 2ZOXA 2CETA 3WQ4A 3UJFA 4RKAA 5U7SA 2NT1A 1XLAA 1TPB1 3CIXA 2H9AB 4QG8A 2XSBA 5I3FA 4FHAA 3A5VA 1SMDA 1C8YA 3ALFA 1H7OA 1MDRA 4QIUA 4LEQA 3CAKA 5M3WA 4O16A 2HE8A 2GGHA 5IBXA 5CGMA 4LYRA 3EA3A 4XV0A 4MZ1A 2R1PA 3MI3A 4MOZA 2QJMA 1DXIA 1Q3NA 1GONA 1YHTA 4BS0A 4D2JA 1KQYA 2ACUA 4CLMA 3ARZA 1ZBWA 1BXCA 5EPDA 4Q8NA 1Z6KA 2Y6ZA 3C2YA 2NQ9A 4JIEA 1A5MC 4M6QA 2FMNA 2WWCA 1JDDA 4TO8A 3SB0A 3BJSA 3WG6A 3W7KA 2HNEA 1AQMA 4XZ9A 2WK2A 2V82A 3FXGA 2C1HA 5F4XA 2ZBTA 1WKDA 4C1LA 2CEQA 3LMYA 4PEKA 1W91A 2J7HA 2Y7FA 3KM8A 1JXJA 3QOMA 1ZJHA 1UBPC 4QJ3B 4H9TA 3BMXA 4AZ5A 2D0HA 2YFOA 2GYIA 3G18A 5FJUA 5CC5A 3LPPA 4LY4A 3W72A 4QCEA 3VIFA 3KL5A 1HJQA 1MRAA 4ATDA 4ERIA 5AC6A 1ISVA 4E8DA 5A1AA 5FL1A 1KM4A 3E0FA 1QK0A 2VM8A 4GO8A 3EDDA 2QJGA 3VCCA 3WLLA 3PSVA 2V3FA 1QI5A 3W1LA 1WX0A 3AIEA 5G5IA 2PWFA 4FXJA 1MQQA 1W9DM 2CHRA 1WXYA 1PZ0A 3EPNA 2YZ5A 3SGZA 3MKKA 4JHOA 5AYIA 5FJRA 3LENA 4IQLA 1W3HA 2PWGA 3CAVA 1FUYA 6TAAA 3GDLA 1QI0A 2NQLA 4K2SA 3OVRA 1L9WA 1ITCA 3CHDA 3AMGA 3UG3A 1GVFA 3UXAA 1HL2A 3OVQA 4R34A 3RN6A 4MYAA 5AFDA 5HR6A 1GQJA 4C7GA 2GVGA 2VRKA 1OCJA 3FSTA 1H51A 3R8HA 2YCJA 2QXWA 1E6NA 1UKPA 5FF4A 3BW4A 4B3ZA 2VXNA 2Z7KA 1TRDA 3PK7A 2V3EA 4MY8A 2A2IA 2H3BA 4JN7A 1XSIA 5C9ZA 3CO8A 4BWLC 2HCVA 4LVBA 5MF5A 1XRFA 3VE9A 1W1B1 2QVHA 3EOSA 4X63A 4JHZA 3W2LA 2C7FA 4M6VA 3NVDA 4IIBA 4US6A 1DWFM 3DGBA 4R5EA 3RDKA 2FFCA 4B5UA 3GAYA 2J7DA 2IKJA 4XAGA 4AD1A 3GKAA 4QJ5B 1FRBA 4ECLA 3TVAA 4RNFA 1E4NA 2EHHA 3S2JA 5CKSA 2GPTA 3P67A 2H8ZA 4JKMA 1RJRA 1I45A 1DOSA 3WF0A 2AKMA 3ZJ7A 3LGDA 4AD4A 1Q65A 3M46A 4KRZA 2CZVA 4B5NA 3GX9A 4WZHA 3EZ4A 2Z2UA 1EA0A 2W62A 3WEMA 4LXFA 4NYUA 1KC7A 2OLSA 1P1MA 2CBIA 1EHAA 4WGHA 4DJEC 2OLAA 3SAZA 3UWWA 1B3ZA 1M65A 1W3KA 7REQA 1X7IA 3C0LA 2PDBA 4DYKA 2GVJA 1GVSA 3U6WA 4B16A 2UY3A 1DJXA 1SPQA 3VE7A 2Z1XA 2QQ6A 1L6WA 4XD4A 3S46A 3FS2A 1UD5A 4P5UA 3AIRA 1G01A 3NCOA 2GJXA 4A22A 1HG3A 3PUEA 1R87A 1MNSA 2XFYA 4KW2A 2A7NA 1Y8BA 2Z26A 3CYVA 3IGUA 3OLGA 1S39A 3KVKA 4ZA0A 5FEPA 3K8LA 3LM3A 3TMLA 1AMKA 4I5RA 2XU2A 3H2NA 1RZMA 4EKJA 2DT3A 3GDMA 4JHMA 1CDGA 1I1WA 3CWHA 2R1NA 4XTDA 4AZCA 3L7RA 2NVAA 2JEPA 3SQSA 3BOXA 4US5A 3WY1A 3T55A 1TR9A 3VINA 2DH2A 2WLYA 2QDDA 3V5CA 1E0WA 4LS2A 3VOIA 4JGDA 4JTCA 4LAUA 4S23A 4W93A 1KV5A 4RCXA 2OSYA 1BTMA 5D2WA 4JD4A 3OO2A 1TJ1A 3T6CA 3OB8A 3PUOA 5XIMA 4DUWA 3LPOA 4AHPA 4E3VA 3SDOA 1R86A 3SRHA 4EX4A 5CBBA 2PU0A 4QCFA 2IQTA 1ZL1A 2HK0A 5D38A 3TA9A 2YX0A 3C2FA 3NPUA 1EYWA 3BLKA 3LCWA 1GZGA 3EBVA 4BQ4A 3PTKA 3E0IA 2HVMA 5I3IA 5HINA 2OKOA 2BY2A 3AHXA 4RNHA 1WUEA 1KM3A 2OGYA 3QGAC 1ESWA 3RPTA 3DG3A 1YBQA 4U2ZA 2PZ0A 4ZCWA 1YXCA 1R9XA 4LUYA 4O50A 2PA6A 2PDLA 3MA8A 5C6MA 3EA2A 5LXXA 5LNUA 4RV3A 3NQ7A 3S9ZA 1FHDA 3TYEA 1GG0A 4LUTA 5U4NA 3I65A 1QNVA 3W6LA 3EXRA 3ITYA 2A3LA 1SO4A 4A3UA 1EEPA 1VFTA 1JCLA 4HZ7A 4M29A 2WC7A 3G1VA 2HJPA 1SSGA 4I9JA 3U5UA 3D47A 4W4QA 2AL2B 1OGSA 4BJHA 3MI6A 1WKFA 1V6TA 3GUGA 3T09A 3E5PA 5FCZA 1CLXA 3KCLA 2X05A 4MDPA 4FXSA 3QN3A 4XAPA 1YXDA 2Z1VA 4J7RA 2J8GA 3IRSA 3BOLA 3FHQA 4O1CA 4PGLA 4LCSA 1XLIA 5A6BA 2VC6A 5I3GA 1FDYA 4C91A 4PCSA 1VBHA 2NWRA 3DIPA 4FXRA 3UXKA 5FOOA 3VVGA 1BLIA 3TV8A 1VLIA 1RP9A 1S2AA 5D30A 3W87A 3TEVA 1A0EA 4O57A 1MVYA 1N55A 4JFSA 1ZBVA 4IMFA 5BRQA 1P0BA 2XVKA 1O1HA 2J6VA 2FJUB 4S3KA 4M0XA 4QP0A 2DIKA 1VYRA 3NXLA 4KRUA 4B91A 1OGGA 4XAYA 1PPIA 3HGOA 1UZ1A 3AMDA 3OODA 2CYGA 1SQ7A 1VBRA 3NZGA 3I3BA 3QPZA 4F79A 4G5DA 2PTZA 1K8XA 3FEMA 4QSFA 3LCLA 3SN4A 2V9DA 1KGXA 2A3EA 3RUBL 2DSVA 3W0KA 5LNRA 3MV11 1VCGA 4GI6A 3DU0A 2GGJA 4Z17A 3BVJA 1BYAA 1EO7A 3MMDA 1QT1A 3MW7A 1U5VA 1B4KA 4HNOA 4PSPA 3STEA 3WQDA 5SWUA 3QHNA 4F40A 1TWIA 1PTAA 1U22A 1IT0A 2Q8LA 3VO0A 4YS1A 4GZIA 3CTTA 1W1A1 4B5TA 4ORMA 2QJIA 1AQ0A 5T9BG 3UFYA 4AG0A 2UY4A 1NIUA 1WYIA 4GPNA 1I2QA 4LF2A 1QPQA 1DVJA 1EXBA 2IKGA 3UPBA 1AH3A 1PWLA 1OX4B 3RLVA 1BWVA 1GZJA 4B5SA 4QLKA 3QVQA 5IHRA 1JCXA 2FKPA 4YWIA 3BG3A 2Z1WA 3CT2A 4QBXA 1ZBCA 3LS9A 1KCXA 2YYUA 4X3ZA 4DNMA 4KFOA 3I6EA 4YTSA 1W37A 1BG9A 3NYDA 3M0ZA 4HK7A 1V3MA 3MC5A 3ZSSA 3RMEA 2XH7A 3WK3A 2XDFA 1OEPA 5B7ZA 2BP1A 3HZ3A 1XFBA 1KR1A 1B3WA 4FSAA 1VS1A 4HSNA 4GJJA 2GDQA 3CNYA 4E2DA 1M1BA 3P82A 5CZ0A 2XFRA 1XLBA 1K7EA 3CLMA 5F4WA 1DJYA 1E9ZB 2V6AA 6REQA 5C2GA 1AZ1A 1BWKA 3MHFA 1ZBKA 3EKZA 3UJEA 1R47A 1VBJA 4Q4RA 1DQUA 2VUNA 3R43A 3RX2A 5ECVA 1JJKA 2X0SA 3F5JA 5LIXX 3PTDA 4OECA 1UIOA 1C8QA 2CERA 3NFUA 4GXPA 2OLHA 4GC4A 2R1KA 1OWQA 3EB4A 4P8XA 4ZO6A 2PMQA 1B2YA 1X6NA 3GG8A 1XINA 3G6MA 1FXPA 3LQLA 2EG6A 2WM1A 3UR5A 2QVNA 3VKAA 6XIAA 4RJEA 3KBSA 2Z1SA 1M6JA 1NP0A 2JQXA 4RZ5A 1M7OA 4JX5A 4O13A 3EEZA 2E9MA 5DT5A 2VCCA 4JAWA 2E09A 2XWDA 3EWZA 4AHQA 5FIPA 3UYIA 2DDXA 1EDGA 3B04A 5AC4A 2WVUA 1JZ7A 1X96A 3TNOA 1CXHA 3POHA 1VEOA 5FKYA 3RFAA 3UG8A 4AF0B 5FACA 5HNUA 3DBNA 1VFMA 1W1TA 2F7FA 3NUKA 4MJMA 1F3WA 1W2PA 1TX0A 2OYKA 3NOEA 5I00A 4C5ZA 4B2DA 1FY6A 4ICMA 1ISYA 3W7LA 1OCBA 4O17A 3AHZA 2J79A 4GZJA 2PTYA 3WQPA 2ZX9A 1OZQA 3R25A 1XYLA 1QHOA 4JQ4A 4FOKA 2EG8A 3W07A 1FP9A 3CB3A 3A3WA 3NQCA 1UOKA 1GTHA 1MQRA 2VQTA 1X39A 3RLUA 3TSBA 3TW7A 3RIKA 4N4QA 2XN2A 1KCLA 1AA1B 2FTYA 1O5KA 4AD0A 4LC8A 2WOQA 3SSJA 3VD4A 4NT0A 4MYXA 3TCEA 1V8EA 3VNLA 1S2TA 1J2WA 2PD5A 2DZSA 2QUVA 3DN5A 4C6LA 2VL4A 2F6XA 3VIPA 4DBWA 3BLEA 4S3DA 3WL0A 3FFSA 2OEMA 3KEHA 2IKIA 4DUVA 4OVXA 3PBUA 2PWHA 1YDYA 2A85A 3OZPA 2ZRWA 4JFTA 4MKVA 3W27A 1VKFA 5FA5A 4TXEA 2VX6A 1ICSA 4BA0A 2EBNA 4BZYA 3GHRA 1LRNA 1PO9A 1TIWA 3CT7A 1MQPA 4N9EA 2VEKA 1LWIA 1XR2A 4YCPA 1RQBA 3M5XA 3WF4A 3W7NA 4F66A 1FWEC 3UW6A 1RBOB 4HA3A 3W7MA 1QOPA 4IISA 2ZADA 4AYSA 1E4LA 2X09A 4IMAA 1L8NA 2BBFA 4YMZA 3UQNA 3GC4A 3F5KA 3GU9A 2PPGA 1H1YA 4AC7C 1KCZA 1QATA 3M0XA 2HS8A 4HKPA 3HF3A 1VLWA 3MUZ1 1FWDC 5KETA 4GQBA 1SGJA 3EX3A 2V5CA 2W61A 3DC0A 4DJEA 1IGSA 2CPUA 3BDKA 1R2SA 2HQAA 2PZNA 1E56A 1E5JA 2F6KA 2C0AA 3PZUA 3TW9A 2XN0A 4GUFA 5HMSA 3MYOA 5H8UA 4GUJA 1Z3NA 2WMKA 2NVDA 4H7CA 4J3TA 3FEQA 3KDNA 2C0HA 4Z2LA 3ITXA 4Z2IA 3V4BA 1G0CA 3TTQA 3M0LA 4HOXA 2GJLA 2XSAA 1PL9A 3E2RA 1CECA 1RD5A 4LBUA 4Q6XA 3TROA 1E15A 4EANA 2AQOA 1ADOA 4UQAA 4LFYA 2NQZA 3QV7A 3V0UA 3QR1A 1NDZA 3T2QA 1KXHA 4LAZA 4PTWA 3THUA 3SO7A 3AC0A 4Q4QA 3G1HA 1G4EA 4RDVA 2OU4A 2DJLA 2P8BA 2MNRA 1E9LA 3BLDA 3VPLA 4N0RA 2YDQA 5BMWA 4J3ZA 3LXCA 1NWRA 1T0OA 2I7GA 3IJQA 1VRDA 2V5BA 3UYCA 4FIRA 2VR4A 1XQLA 3N18A 4A8IA 4MHBA 3G3DA 1DL3A 4WD0A 1V3HA 1S3HA 7REQB 4OOZA 1ZCOA 4AXKA 2Z1BA 1GYMA 2A3BA 3BAIA 3HG4A 4TV5A 1UWTA 1US3A 4U33A 3BL3A 4HNVA 3L21A 3TC3A 3AU2A 1J12A 4MNMA 9CGTA 1A5LC 5HBFA 5CXPA 4CNPA 2OB3A 2Z2AA 2DW6A 1JCTA 4B3KA 5I03A 1HL9A 1V6VA 1FWTA 3BCJA 1V3JA 3S2MA 4H9MA 3QM3A 3TYDA 2GGIA 1L2UA 1TJ0A 1VEPA 4IIHA 2NX1A 3MU7A 1TYGA 4L1WA 1Q6QA 4U3AA 4AX6A 1VPYA 4JYEA 2XM1A 4DJDD 3DZ1A 4Q4KA 1E72M 1ISZA 2ZZ2A 4LT9A 4K68A 1GOWA 1IEWA 2VWTA 3NIYA 1EX5A 1R6WA 3CJPA 1XPYA 4IICA 4AWTA 3ZT5A 3EOLA 3GAKA 4DF0A 2XIJA 2BY3A 4UTFA 4HD5A 2GGEA 1PIGA 2IMRA 3SUSA 3GXMA 1TQJA 2PRLA 3WLKX 1DIDA 4NG3A 1ZENA 4K37A 3GIQA 1EZ2A 4NRRA 4KFNA 4HK5A 4TMCA 4V1YA 4NI3A 3O7UA 3QF0A 2UBPC 2X8RA 1UH3A 4EVZA 4D71A 2IW0A 2NXGA 3NEVA 2FVKA 3G24A 4H8HA 2GQAA 4JCMA 5HUPA 1CB2A 1LT7A 3WLSA 3OIHA 4KERA 3RO8A 1LLZA 3AQUA 4JIQA 3BC9A 1KLZA 9XIMA 1V6WA 3KOZA 3WLTA 3GBDA 4RV8A 2ABAA 3C2RA 1DEDA 3GB6A 4LNCA 2DGAA 2DZWA 4DAIA 4LUTB 3WLMA 5LGXA 3B0UX 3RRXA 2BX7A 5D05A 1ONRA 1V3LA 1PYMA 5CEWA 4PTMA 1ZY9A 4DN1A 4DWDA 1X6LA 3LERA 4K1WA 1SW7A 3BSMA 3P8JA 1DE6A 1PYFA 4X60A 5D4YA 3GZ3A 3W73A 2RKXA 2YA2A 3N14A 4DBSA 3WJWA 1SFLA 1S5MA 1CXEA 2RDTA 2FMOA 3REQA 2PTWA 5HWJA 3U3HA 3NM3A 1P6WA 3PZMA 4Q7NA 1F4AA 3NOYA 1SZEA 4KCUA 4IMDA 4Q8QA 2PGFA 3P80A 3WJSA 3ZXWA 1I0DA 4NI8A 5TQLA 2Z0IA 1KBLA 3T4WA 2E9LA 4S38A 5LGZA 1EL3A 3LTYA 2I14A 2DVXA 4IIFA 4QR6A 5K3VA 1I9CB 4PMXA 4E4PA 4F0RA 1Q7ZA 1HTIA 4KWVA 3RM4A 1V6UA 4ZQPA 3VM5A 1RR2A 3D46A 4AVNA 4EWJA 1CLVA 2Y5JA 1YDNA 3B8TA 3WMLA 5C71A 1RA5A 1OM0A 1RLDA 3WQWA 4GG9A 4IL2A 1JPDX 5LNVA 3E74A 4TUFA 4GYJA 4P7QA 1RP8A 1TE1A 4Q8UA 3IAPA 5KITA 4ZFMA 3U7VA 1CCWB 5BRPA 3OGRA 1RJQA 9XIAA 3RX3A 2ZZ4A 4DWSB 1EQPA 1XRTA 4RXGA 1V0LA 1DWGM 4UZUA 5C9XA 2INEA 2O4MA 4REQA 5BXSA 1MEIA 2GVEA 1TV4A 4LYKA 3NPWA 4TQTA 3CQIA 4GXMA 4QEEA 3N2XA 3W7RA 4A3HA 1JF6A 1N2VA 1UWIA 4ZXLA 4MDOA 4IGNA 3TONA 3SM0A 3EWDA 2JIWA 3FGCB 2A4AA 1LLWA 3S42A 5A3HA 1GNXA 5TAOA 1DYSA 3VFCA 3L2IA 4WDXA 1ISWA 3L4UA 2ZYFA 3G22A 4MIMA 1ZZMA 1FX6A 4H83A 1A5BA 4D9PA 3FHAA 3KOXA 4CNSA 4M7TA 4GFIA 1ITXA 2FZ9A 2FHBA 3I4EA 3VIGA 1EGMA 4HPXA 3N15A 1UW9A 4IJCA 4WXYA 2NX9A 5AHEA 1H61A 3MYPA 4DPQA 3VNDA 3CHEA 1FWNA 3FYOA 3S4TA 4B4FA 1OIMA 1YRRA 1ZAIA 1NU5A 3TAOA 3W2JA 4MB3A 5EYWA 5KEZA 2X1RA 1TCDA 2P53A 3E3HA 2XVLA 4RR4A 3OGSA 3BZJA 2DVTA 6REQB 3GR7A 1TJPA 3H2EA 3GTIA 1IEVA 1C7SA 2DQWA 1LBFA 4PTDA 1WOAA 3G0UA 4YU1A 4IHCA 3BE7A 3KAOA 4KPLA 3AJ7A 4FLQA 4QE4A 4TX9A 4AH7A 4JTEA 2AMXA 3VNYA 4NZ5A 5CC7A 4GIYA 4CNNA 1L6SA 2VCAA 3QTPA 4W85A 1A5SA 4JN6A 1KO0A 5GJMA 3OVPA 1S2WA 4HU3A 4I6VA 4A35A 1DJQA 2BTMA 4R33A 3PFMA 3VD7A 4HZ6A 2HDJA 5A6KA 5AC7A 1VHNA 2WANA 1AH0A 2G41A 2ZX5A 4IP4A 3VZZA 1H4PA 3M07A 3PSWA 3TZFA 4L6DA 4UNKA 1EDQA 3Q4DA 1V0NA 2TMDA 1BGAA 1B3VA 1GKRA 2Z7GA 3ZM8A 4EWND 4Q4OA 2X30A 4LWWA 4I3GA 4HZ8A 2FQIA 3N4FA 2PDHA 3ES8A 1Q6EA 4D6HA 1WA3A 4GLEA 3CHVA 2CNCA 2BGNE 3UNTA 4UQ9A 3QSRA 4Q3MA 5DX7A 3NGFA 4KWUA 4MPQA 3AMCA 1K8CA 3UVIA 4AFYA 5AZ0A 1GKPA 4XD3A 3UWEA 2CHNA 4R7WA 2P10A 2VEFA 3S6OA 1W8GA 5BCAA 1AQFA 1QBBA 3VGDA 4HMDA 1K70A 4YNGA 4S2BA 3W85A 4UMCA 1SM9A 3RJXA 2D0GA 1EJUC 3WUBA 2PBGA 3P62A 2H3DA 1UR1A 4U2YA 6ALDA 2B7QA 3QXBA 1P1XA 1K4HA 4CEUC 4WDTA 4ADSA 2GOKA 1MW1A 1S1PA 1U2YA 3MUIA 3AOFA 2WSYA 1LWJA 4PMQA 5BOOA 3MDWA 5DY3A 3UPMA 4E4FA 1NVMA 4AUBA 1PS9A 3KL0A 4WK9A 3W3OA 1RY0A 2F6UA 3W22A 3LHYA 3WBAA 2ASHA 1TB3A 2ACSA 2WHKA 1XHGA 4CQDA 1XGZA 2DSZA 2AAAA 2XG9A 4IF2A 3GR4A 4N7QA 3BURA 1K7XA 3GRIA 4IGHA 5EFDA 3H53A 2ZRZA 2G3JA 1GYLA 4L4LA 2YXXA 3HQPA 1CZ1A 1WDQA 3U48A 2J9YA 3QPYA 4MAVA 3EEGA 3TIMA 2X42A 1V77A 1VFHA 4UC5A 1V79A 2ZIDA 4S3EA 2IS7A 1O7AA 1CEOA 2QPUA 4Y6GA 4UTMA 2JF7A 4ZTXA 2PDJA 1EUNA 1HJXA 1SU5A 3AS3A 4CVWA 2ZICA 4CCEA 1GG1A 2OT0A 3WEOA 5DXYA 1Z8AA 4PMNA 1LYXA 1UG6A 1Q6RA 2BDQA 4J40A 4JTTA 3QZEA 3I7RA 1XM3A 5F2IA 3NXFA 1B3XA 4Z2HA 4NKCA 2PGRA 3BAWA 1J79A 2E6FA 4Z2JA 4YTRA 4IMGA 3FA5A 5F2GA 2NXHA 4JNYA 4JDBA 3S2CA 3JR2A 3GNNA 2ZZ7A 3NQMA 4G9PA 2SFPA 3G1AA 3T42A 4ROQA 3IJ6A 3NO3A 3OYXA 3AI0A 4GE8A 1G7VA 1E6QM 1JF5A 4L1XA 1LBMA 3T8LA 2PGEA 2XSXA 3BJFA 5CZTA 1US2A 3D3FA 5T26A 1JVNA 2WQDA 1BKHA 4GGHA 3UA4A 2KZHA 1XIMA 5D8WA 5GVJA 5FJJA 3B9NA 3ZWSA 2ZRUA 2Z25A 5C9RA 3IEBA 2VUYA 4B90A 1Y0EA 1PB0A 1XD1A 3UZYA 1SJAA 4INFA 4YTQA 4YLWA 4HNLA 5G4HC 1SR9A 1BYDA 2D22A 4CD8A 4PUMA 2E25A 4PN2A 3H7UA 1NDWA 5HQMA 4QJ1A 4RDWA 3UGRA 2R82A 4CN1A 4ZOBA 2IPJA 3SQMA 3O6AA 4IPIA 1UASA 2TSYA 2Y85A 3ABZA 4IX2A 4WOZA 1XGDA 3LHZA 1GVRA 4AMAA 1DBTA 2IQDA 3N6JA 2X7VA 4IMEA 1W3IA 4PB5A 3ZLGA 4FNSA 4HSOA 3AHVA 4CD4A 4B4HA 3OBAA 1PKLA 2ZUVA 4AIOA 3VILA 5LA0A 1HVQA 4MZ8A 1ZFJA 3PBWA 2V0TA 4AY8A 1IEIA 3BH4A 4RPQA 1J0YA 4MAZA 2VI0A 1C93A 3TE9A 3ZR4A 2EG7A 2GSHA 1TIMA 1A5NC 1EF3A 3B8DA 3GTFA 4OUIA 3O8AA 3NEHA 1TR1A 5CSRA 2Q01A 1XL9A 5ABGA 1OQFA 2ZDRA 4JIHA 5D32A 4JCLA 3F7JA 4RZ4A 7TIMA 3URQA 1BYBA 3H21A 3KOWA 4AY7A 1RLCL 2BGQA 2RJHA 1ZJBA 4BKNA 5E0FA 1XYCA 1RPXA 4LV4A 1K4GA 3QLLA 1QNPA 1QFEA 2O56A 3WQOA 4O12A 4XZIA 4RNIA 5K7JA 4W88A 4WGXA 2O0TA 3F2DA 1EC7A 3MDUA 2OELA 1CGVA 3L67A 3N3TA 4DZHA 1GQKA 1LL6A 2GK1B 3H54A 2QULA 2MUCA 3SSZA 3IUDA 3S1GA 2VC9A 3AS0A 4IJRA 4O0QA 1LF1A 2BV9A 3GXTA 3QLDA 2GOUA 2XZ7A 3FN9A 3M0JA 3DHFA 4DLFA 2XISA 2F84A 4Z0JA 3W7PA 2CLFA 2PTDA 3NQDA 2D3NA 3MO4A 3UWYA 1WAUA 1W1IE 1Q4NX 3VFLA 5D9OA 4GIEA 2JGQA 3BLPX 1E1CA 4KEVA 3LRLA 4ATWA 4JL1A 1ICPA 1UQYA 3TQ0A 2WHMA 3AZRA 4QS6A 3B97A 5HPOA 1B57A 4PA8A 3PTMA 1H63A 2OOGA 4EAYA 1B30A 3CQKA 3WUGA 4BQ3A 5HAOA 5A69A 2RDWA 4HYVA 5CG0A 3AROA 3BG5A 3AS2A 1T99A 1O66A 1UWRA 5HQEA 4HHLA 2XYLA 4BF9A 4CN4A 3DERA 4HTYA 4NZCA 3T08A 4HOZA 4W5ZA 5ABHA 4JN8A 4IPPA 1KTBA 1MUWA 3LY0A 2W4XA 1LRTA 1LLOA 2GDVA 3EAUA 1TA3A 4XD6A 4Q4MA 3QKZA 4RE4A 4URIA 4A3RA 1GYNA 1BTCA 1N8IA 4LCRA 4MNKA 1GQLA 1R3SA 4D8AA 1GJWA 2GGGA 3REQB 4W87A 1B4EA 1YPXA 3AZTA 3L5AA 4KWOA 4ZODA 1ZALA 4I8YA 3HV9A 4LYQA 4GIRA 5LSMA 1RVGA 4XUYA 2J75A 2VYOA 3UZWA 3AXMA 5E0KA 1E4IA 1G4TA 3ORWA 3WFZA 1HO4A 4DUOA 3N9SA 3KP0A 1AD4A 1XBZA 1F76A 1GK8A 4FNUA 1JZ4A 3PJXA 3KLKA 3GO2A 4AIBA 3XIMA 2X41A 1P0DA 1O1ZA 4JS3A 4MJZA 4IFRA 1ODUA 3GW0A 2DT2A 1JIBA 2WVSA 4V27A 2PI6A 3GNOA 5F1UA 3WQ5A 3LLFA 3FXYA 4TTGA 1E71M 3MSGA 4MPKA 4IQJA 1SFSA 1DV7A 1UD8A 4WXZA 1EGZA 2VFIA 1BWLA 3VDHA 1I75A 5D37A 1W0MA 1BXBA 4QITA 2WHLA 3FKRA 2OMAA 4AZHA 1NFPA 4PRRA 4ZR8A 4W89A 4MB1A 4XZHA 3A3HA 3UG4A 1R46A 2C13A 4YHGA 2VFFA 2JBMA 5LA2A 3P5ZA 1XYFA 3MQTA 4MWAA 1AL8A 3HJZA 2REQA 3F4NA 4S3BA 4UCFA 1MW3A 2QAFA 3AYSA 5FD0A 3PZIA 1PEZA 1V08A 1BRLA 2WZIA 4M1RA 5F2MA 4TVDA 2QW5A 4NXKA 2ZC1A 3I7QA 3EX1A 2O9OA 2CIPA 3E2SA 1ZCCA 1SFTA 2IPFA 4WOQA 5M1TA 4WKFA 3RLHA 3TNBA 3L68A 2KX9A 5DBUA 3AIWA 1C91A 3HQOA 2BNJA 1TELA 5LYRA 3LHUA 2W66A 4GKLA 2RDXA 4UZSA 4ML4A 4QLJA 3G6LA 1JZ5A 2YB4A 3ITCA 4YPJA 4QDPA 2VR2A 3PB0A 3DFYA 2W0UA 4D8LA 3KTSA 1BG4A 4O14A 3W81A 3SY1A 1GVOA 3PJWA 1YQ2A 5GQBA 3NNTA 1Z48A 1HKWA 1GQIA 2GVLA 1A5KC 4G6CA 2QNEA 3BLOA 5E9AA 3PVFA 1H0IA 3WLJA 1FDJA 4EXAA 4DI9A 1AW1A 1MSSA 1TVNA 4JEQA 4JTJA 7CGTA 4A8NA 2J6XA 5HK4A 3U9IA 3AXIA 2AGKA 1TVLA 4W5UA 4CQBA 3VC5A 1EJ7L 1W1ZA 1A49A 1ZAJA 4JQ3A 1E55A 5E5CA 4E6MA 3WF3A 1PX8A 1SJDA 5M17A 3ENLA 3IJ9A 4A2RA 3PJUA 3FDKA 4Y9AA 3GIYA 3SRDA 3EX4A 1JI1A 1TMLA 1CGUA 5AYZA 4PMVA 4R7JA 2GSJA 1OG0A 3II1A 5I2UA 1J93A 3M9YA 3W71A 4P7LA 3RHGA 5M2FX 1F07A 1YW1A 4XB3A 5A8OA 1PCKA 2BXZA 4I6KA 3UWZA 3Q2DA 1AH4A 4DYEA 4DQWA 3MJMA 3OG3A 2WXDM 3WNKA 3WN6A 4Q8MA 2VVNA 4H8NA 4Z1CA 1TV2A 2IXVA 3NQEA 3H24A 3M16A 5CBIA 2CBUA 3QMSA 4DJDA 2PFHA 3W6YA 4YN5A 3RYSA 1HJUA 1I2OA 3W9ZA 1PHWA 1TV5A 4QXIA 1UMYA 4ZB5A 3N4EA 1XLKA 1J6PA 3OYZA 1K3UA 1OFQA 2EAWA 3S47A 3TTSA 4C1KA 1TO3A 1DXEA 4MLJA 3PM6A 3MANA 1RBLA 4J3VA 5AKQA 5A6BD 1OFBA 5IM51 4LBRA 1TREA 3IV8A 3POCA 4GGBA 2WJEA 4XAFA 3PF3A 1KV8A 4PUJA 2ZFAA 1WDWA 3DC8A 3WJZA 1KGUA 1JUKA 3Q67A 4KWSA 1L0PA 3V75A 1LOQA 1V3KA 2GWGA 3PBYA 5IBXC 4DO4A 3L0NA 1ITUA 1FBAA 1EKOA 2DFAA 5JUVA 4PC8A 1JG9A 3ZOAA 3CB8A 4OQVA 1ADDA 2DSWA 4Y90A 1BQGA 5A6SA 3UZXA 1C90A 3QOKA 4XZMX 4H41A 3URNA 1QPKA 3PG8A 4L9YA 1XSJA 4DELA 1YE6A 2NW0A 3AISA 4O1BA 1WZLA 1CGTA 4MFDA 4AEEA 2ZA1A 3NZRA 4PCPA 5FI8A 2UY2A 3AU6A 2QCNA 4QAIA 4ACYA 3A23A 4Y9MA 4UTKA 2C15A 1JD7A 4CNUA 4EF8A 4UMAA 4G1NA 1R2TA 4HNCA 2ADAA 3QQ1A 4DZAA 2WMIA 4HHPA 4MSSA 5IOBA 4KGLA 2ISDA 2NT0A 3CPGA 3G0XA 1RPKA 2OODA 2GFTA 4WJEA 5G4EA 4UFKA 2F9RA 1NDVA 4GNVA 1TPC1 3NR0A 3RCYA 2WPBA 4W7VA 1ITQA 5D9PA 3O6DA 2IXUA 1EJXC 4WX2A 3UVAA 3TC7A 1VFOA 1J0KA 4S2CA 4O54A 3TJ4A 1UPMB 4H9YA 2QV5A 4H1ZA 1XBYA 2DSUA 1KBJA 4H3DA 1LDCA 3IJDA 1V02A 4FPSA 5AYXA 4R9OA 1M7PA 1LL4A 3OG2A 5BU9A 4ROPA 3SY8A 2NV2A 5LIWX 3W7OA 2XIBA 2BVTA 4UQCA 2B7NA 1GW9A 3GG1A 4NZ4A 3T8QA 4BI6A 4XZNX 1A4MA 4IP7A 3LBMA 2X16A 1UWUA 4PFHA 3TYZA 3VNIA 2W67A 4LQ1A 2ZUSA 3WMSA 4DXXA 4OBRA 3LQGA 1Q8JA 1SR0A 1EPXA 1G9HA 4PCNA 1I2PA 3MMTA 5M5DA 3EDKA 4F3HA 4PMRA 5D33A 2A79A 4GKTA 3BO9A 3WKZA 4JQ2A 3AAMA 1W9BM 1GCYA 3W7IA 1TTJA 1XYMA 3W7HA 2J62A 4B92A 2CBJA 4JTUA 3WD1A 2WW5A 2BWGA 1KBBA 3APYA 3RF9A 1XLJA 1RD6A 4WJXA 2YCLA 3KOFA 1T8XA 2ISVA 2CZFA 4BHYA 1ECEA 5LIYX 4AD5A 1KM2A 5T9CE 1PWMA 1TFVA 4NHVA 2VX5A 3T40A 2BZNA 3GNDA 4JNZA 2QV4A 2YXGA 4BY3A 2QCFA 5CZJA 4AU0A 1UHVA 2GL5A 3QPEA 1RVKA 4I8DA 5D2XA 1JAEA 2X7WA 3VDCA 1IIGA 4AAJA 1JGIA 4F48A 4ZOAA 1OX6A 4YHEA 4P7OA 3TX9A 1A53A 3RCNA 1TWDA 3NL6A 2NZLA 2GWNA 2Q6ZA 1HFBA 4ZBCA 3EWYA 2BASA 1DP0A 1WZMA 2OSXA 4PSRA 2VFHA 1OFEA 4B2DD 3HB9A 1XH2A 1AW5A 4HBKA 3TOYA 1QUMA 4LS0A 4ALDA 3MZ2A 4DAFA 3WDHA 3MO7A 3IJ8A 4QROA 1HKJA 1X38A 2PBOA 2YLLA 2YFNA 4HHMA 4GNKB 5L9FA 4J3UA 2P8CA 2VEPA 3UZZA 1EGVA 2QCMA 4CGTA 4HU0A 3AMKA 3ZMRA 1H7PA 1E9IA 2F8QA 2BXVA 3EXSA 4E0CA 4M51A 1BHGA 2G3NA 1IEQA 4QAWA 5DN1A 4HN4A 1Y5WA 1RJPA 3QKEA 1OSEA 2X0YA 4JZ5A 3CMGA 2FPYA 4GJ1A 2CCRA 3VOHA 5A8MA 3QSTA 4XAZA 3PG9A 3VA8A 4IP5A 4RNJA 3TR9A 4HPGA 4ZQNA 3VD9A 4UR7A 4PUWA 1OCNA 1G1YA 4PMDA 2DSKA 1EPVA 1PDYA 3RPMA 4GK8A 2PDXA 1QPNA 1Q45A 3I10A 3EWXA 4AZ6A 5I24A 3AIQA 5C9WA 3UBPC 3BLFA 3VGFA 4PBEA 3M6DA 1B9BA 1U5JA 1LG2A 1QRQA 4UQEA 4C7DA 3N04A 3G2GA 1QJWA 3SCOA 2Z4GA 1E1CB 3AS1A 1B54A 3MP5A 4B15A 1KM6A 3GR8A 1O4UA 3WMBA 2XH0A 4GRSA 1TRIA 1CENA 3UY7A 3G3MA 1OY0A 1VP5A 4YIWA 1GQNA 1DWHM 3O2LA 2FGLA 5E9XA 3RR4A 1LQAA 1VC4A 3ZWTA 2CBVA 2C6QA 3CBWA 1H7NA 3KVJA 1A5CA 1XIGA 4PBFA 4Q8WA 1NWSA 1FWWA 5L6UA 1UKSA 2J9XA 2RFGA 3GNRA 4K38A 3S5OA 4D6IA 2PDMA 2GQ8A 2J74A 1UKQA 1YXYA 2WMGA 4IFOA 2FDSA 2ACRA 3ARVA 4DX3A 4BK9A 4ERAA 1TA3B 1VFFA 4UIOA 3SCQA 5I06A 5A2BA 1DXFA 5B80A 2ANUA 4JTDA 5DCBA 1TWWA 2PDYA 5HDRA 4H6KA 3VGEA 4GYFA 3TCSA 3BGGA 2Y63A 5BOFA 4BQ5A 2XIOA 1OFAA 2PLMA 3GNXA 3IGSA 2QF7A 4QRNA 3CV1A 4JY9A 1PTDA 4O53A 1XLFA 4PUEA 1N8WA 1ECQA 3GKFA 4XIMA 5JQ9A 4PBGA 4GA8A 4NJKA 1XDLA 2I57A 3EB2A 4E2BA 4WDWA 1X8FA 1XLGA 2WNWA 3BAXA 2OYLA 3TR2A 5IDIA 4CQCA 2DORA 4AB4A 4LGXA 5DXXA 2YL6A 2DIJA 4HMCA 2R94A 1V4YA 1JNDA 5CZSA 5LNWA 4EE9A 3IK4A 3T44A 3OHIA 1FTXA 1KM0A 2YLAA 2FH6A 2EXOA 5FAGA 4A8LA 3EOUA 2WC3A 3SGGA 1G4PA 2ZC8A 1JQVA 4ACZA 4FZIA 3GNPA 3VI2A 3WD0A 4BI5A 3QW3A 2XPKA 2VURA 3KCOA 1YLVA 3DX5A 2XM2A 4JX4A 3SN0A 4WY0F 4QE1A 2YL8A 3MB9A 3ZJ8A 3GE7A 3LRKA 3P2VA 4TV6A 1JPHA 1U83A 4MGGA 1QHPA 2HBVA 2GQ3A 3PBVA 2V38A 3NL5A 3S1WA 1G5AA 1W5NA 1D3CA 4XWUA 3GDRA 4GZEA 5G4WA 2P3ZA 3R79A 4GJIA 3N6QA 3THCA 1PTGA 3SCVA 3IUIA 4QLLA 1XLDA 1IF2A 4NAEB 1S2CA 3H55A 3MP4A 1ZJAA 4RX0A 4XSLA 4QX4A 4GCXA 2I56A 5HMFA 2E68A 2VKZG 1KNWA 4V28A 2HBXA 3DECA 1QW7A 1EA9C 1LL7A 5AECA 4L65A 4C6KA 1JDFA 3S2LA 4ILSA 3TAKA 4HK6A 1UROA 1HZYA 1QI2A 2H8XA 4BEQA 1UMLA 4DUXA 4H2HA 3GVRA 2P76A 2W5FA 2QDGA 4N2YA 4CNTA 1R85A 2HEJA 1D7KA 4FR1A 4H19A 4A6GA 5I78A 2IPWA 3GY1A 3WLNA 4IGMA 3VIKA 1L8PA 4H8VA 1E6RA 1XWYA 3WH8A 1GVQA 3W1RA 1POJA 1JCNA 4XKMA 4YVXA 4CD7A 2QCGA 3M7SA 3SCUA 1YNPA 4RK8A 4MVAA 5A8NA 2BSLA 4HZMA 1VIWA 3H2FA 2C3ZA 3IAQA 3GQYA 1G69A 2YZRA 2AKZA 1IQ8A 3R0UA 2WNZA 4CU7A 4RE3A 1UWQA 2ZUNA 2XIQA 4H6RA 2E4TA 2WKJA 1FHLA 3UPWA 5JIWA 1IWPA 3V3WA 3V0TA 3TOPA 3ECQA 2QT3A 1OC6A 3MVIA 1FH9A 4GC3A 2XN1A 5CPOA 4CQ9A 1D3GA 5CSUA 4ONVA 1Z42A 3CL6A 4LAMA 2WMHA 3CEPA 1F3TA 3LM7A 4IZGA 3V36A 3WLOA 4GINA 1OIFA 3UWVA 2ZXBA 3TJXA 3E12A 4H6EA 3URBA 1XW8A 1IXNA 4E2VA 1FWFC 1NP2A 4GHRA 5ECUA 3RCMA 1UWAA 5IFPA 3QEZA 2J8FA 2VX7A 2PC4A 4RZ6A 2G96A 2VGIA 4IH3A 2E3ZA 4I9TA 1FWHC 5EMJA 4X61A 3VZXA 4PB4A 3A4JA 3FSUA 3HFYA 5A6LA 4HA4A 1F6KA 3OP2A 4V2XA 8XIMA 2WB5A 5H91A 3CEUA 1XQKA 5AHIA 1Y7VA 1P48A 2WBKA 1ADSA 2I9UA 5H8MA 3HQ1A 3C52A 4C60A 1KGWA 3HN3A 3DYOA 4FI4A 5EMYA 5KINA 1XH0A 3CIWA 5DELA 1ONEA 3DEQA 4KCTA 4FK9A 2J7BA 2TRSA 1MW2A 1KWGA 3VOGA 1JR1A 1OHLA 4H9XA 3LCGA 3B8WA 3C6CA 4UCGA 3SIZA 1OJXA 3OJGA 1NF7A 2DZVA 4M7SA 4IIEA 3GG7A 3VABA 5REQA 4AZBA 2C1GA 1LP6A 4GY1A 1NOUA 3L4WA 3JZUA 5LNSA 1ZNNA 3SJ3A 1DIOA 3Q37A 3M5ZA 4O4VA 4ZXOA 2Y8VA 3HA1A 5MKGB 2BHYA 4XBSA 4DXVA 4CU6A 3G1RA 5ABEA 3HG5A 5EBAA 3U4AA 1QTWA 3W7GA 3G8EA 2PE4A 2G8ZA 3W01A 1SO6A 3IVSA 3LMZA 2E0PA 4NZJA 5DCEA 1ZQ5A 4L9ZA 4ERGA 1UH4A 3NSMA 1EQCA 2WMIB 1ZB5A 3WNNA 1TV8A 5XIAA 1U30A 1E0UA 1OYCA 5A8PA 2QS8A 2Z2BA 3ATYA 3BZGA 1RK6A 4E8GA 3WF1A 3FLUA 1WO2A 2VJXA 4XZLX 2YA1A 4HMNA 4Y9OA 5KSWA 3KRBA 2NQHA 3AYVA 3NQFA 5AY7A 4IFKA 4HYWA 2Y4SA 4GZ7A 1R8LA 3PAJA 3GLCA 3QC0A 1PX3A 3OLDA 4F9DA 1CGXA 3K2GA 4XZWA 1O12A 3W2KA 4HQVA 1V6XA 3BW3A 2Z1KA 2AL1A 5DMLA 1W6TA 1ME7A 1B1YA 1LCOA 3TDFA 3ZQ9A 1JDEA 3E2VA 4H8UA 2EJAA 3SBFA 1NWTA 4N9BA 4C6FA 5EY5A 1EXPA 1PKNA 2QKFA 3BCFA 1U1JA 1AQHA 2UWFA 1TZ7A 1LOSA 2P0OA 2D2JA 3VMNA 3O16A 3NQAA 4R9XA 4OHQA 3PPGA 4ZO8A 3CIVA 1MI3A 5A6JA 3UR2A 3DOPA 1F3EA 1J5SA 3SEPA 3IJ7A 5JXQA 3TSMA 3APGA 4UUIA 4KF1A 4KMQA 3B3DA 1I6NA 1XICA 2WCSA 1UR9A 4QFUA 2OPJA 1X7FA 2R24A 4RW5A 1OC5A 2FZ8A 4JIIX 2YCLB 4A2SA 3CGTA 4H7VA 2WVTA 5E6YA 1KM1A 3W70A 3WH7A 1XG3A 3W53A 1FWAC 4FB7A 3KRSA 2YDRA 3VX0A 4FR6A 4AXNA 2OEKA 2ALDA 3N4AA 3JUGA 5I6SA 2RHGA 4LB3A 2OXNA 3QYQA 5PTDA 2PP1A 2ZX7A 1W9UA 4OBSA 4PTXA 1A47A 1R3TA 1K9FA 5CH9A 1L6FA 1WPCA 4FA3A 3A24A 3GVQA 3RU6A 1IE7C 4DO6A 4MM1A 3W2NA 5HANA 1KFBA 1TPFA 3C3NA 1V02E 1UP3A 4WDUA 1PAMA 7XIMA 3NWRA 3QV9A 3TFXA 4M56A 1JYWA 2V30A 3MSDA 4KIRA 1UPPA 2WCAA 3WNPA 1MEWA 3O05A 1K9DA 4MNJA 5HNTA 4QISA 3N29A 3F1QA 2C71A 2INFA 3B8UA 5B7YA 3MSYA 3DXIA 4Z2KA 3U0HA 1O5QA 1XI3A 1TWSA 3FNDA 3LA4A 1H1ZA 1KD0A 5JU6A 2JKEA 1R0MA 4MJ2A 2I5IA 1JDAA 4O8RA 4R7OA 2YSWA 1EP2A 2Y8KA 1YMYA 3TN6A 4GISA 3NZ1A 3QV6A 1M3UA 2O92A 3OZMA 3ITOA 4MNLA 1E70M 3NL3A 1XCXA 1LUCA 2VC7A 4C90A 4PB3A 4HA0A 2FVMA 4K3ZA 5DFAA 2H9AA 4IL0A 3TTYA 2XH4A 4NUWA 3VC6A 4H00A 2QPXA 3K4WA 3N34A 1E0TA 3W23A 2Q8XA 3PZ9A 3GM8A 3E49A 4UOJA 3EOOA 3ITLA 1M5WA 3UZJA 3BWWA 3B9AA 3S6TA 2V67A 2FHCA 1XYAA 4J9JA 5A6MA 3PR2A 4MG4A 1WQ5A 1Q66A 1A3XA 1QOQA 2R6OA 1XFCA 3PPCA 3VX1A 2BFGA 1KCKA 4GH1A 4KCVA 2VEIA 2O4QA 1I1XA 1XKJA 3CUFA 2Y88A 2D73A 4P8VA 2VD9A 4GACA 3WSUA 2PTXA 3V18A 3USZA 3WF2A 4DY1A 4GQ0A 1EOMA 2A3HA 4R27A 3CK5A 4MF4A 3LSBA 2DUZA 4GQGA 2DU2A 4HTBA 2OT1A 2A7RA 3V7PA 4N02A 4HJFA 4R53A 3WD2A 1O94A 6ENLA 1WOBA 3QZ6A 3GXFA 1I2RA 4JL2A 1O68A 2YW4A 1VQTA 5DBTA 5BNKA 4NIRA 2D1ZA 4HVXA 3DESA 5TBOA 3L5MA 4IPLA 1JPKA 1YTDA 3CWNA 4DF2A 3M5VA 1CT5A 1JPIA 1XX1A 2WWDA 2FTWA 4HMEA 4Y8FA 2ZRYA 4IMCA 2EGZA 1O5RA 4GY0A 2V81A 8CGTA 3O1NA 4BF5A 1NOFA 3CZLA 1VBGA 3W28A 5CPSA 1VAHA 2R1MA 3VKBA 4LTSA 3IPWA 3LPFA 5HWNA 5KZEA 2CLIA 1FDZA 3CM4A 4NU7A 3TW6A 3NO1A 5AC5A 1IWBA 1W5QA 1US0A 5I23A 2OZ0A 3RX4A 4AHOA 4WKHA 2Y5SA 2BY0A 4W8AA 1CTNA 2EEXA 4PRWA 3AXKA 5AHFA 4Q8PA 2YCKX 1KBKA 2VZTA 1ODZA 1RUSA 2OSWA 1QXLA 2XVNA 4U31A 1TQXA 3WNOA 1KQZA 3SFKA 4J3SA 1BPLB 2DUXA 1SZFA 4PODA 3VD3A 1AJZA 2XZ9A 3B06A 3LEPA 4ACZB 2VTFA 3NVTA 2LLEA 3IS4A 4M6UA 5GNYA 3FY1A 3DFTA 1QPRA 4UTJA 4QM1A 1XDMA 4Q8TA 4R3UA 2AMGA 4DM1A 3ZO9A 2NSOA 5JIPA 1WDRA 3LXAA 4AISA 3N25A 1NY1A 1KFEA 3AUJA 2OQLA 2BVWA 1TMHA 3KRZA 3VXGA 3L9CA 2VP8A 5D09A 5I5RA 4ZQOA 1PV8A 3BARA 3G1SA 2Y24A 3CAWA 2ZVRA 4DJFA 1U33A 4J28A 4OUEA 3W1PA 2JALA 1Q6FA 3LZ3A 5I77A 3NZQA 1A5UA 2JGYA 1PHQA 4Q7BA 5J8LA 1GTEA 1VF8A 3SUTA 3F4VA 4F0HA 2QUNA 2YBVA 4FX7A 3CMJA 5G1YA 4J3XA 2D2HA 3ABQA 3N1AA 3L66A 4TMBA 1FOBA 3HBLA 2NQJA 4PL1A 3OZOA 4TX6A 2W91A 1SUXA 2HV5A 1YEYA 2IKHA 3AXXA 1DTUA 2VELA 3MT1A 2PDKA 5XINA 4MMWA 1J0JA 2PWVA 2WC4A 4F2TA 2Y7DA 1VCFA 4GO9A 2VRJA 2XGBA 4ZE4A 1G6CA 1MWOA 3GXPA 2VD8A 1M68A 4BI7A 3NO5A 3QY8A 4O19A 4JBRA 3B4UA 3DKJA 3STGA 3IIPA 5BXPA 1NWUA 1TPEA 3GXDA 1KXVA 2ZWZA 3AWNA 2EJ1A 2GZXA 3T4CA 4Q4PA 3B0PA 2WJFA 3E9AA 5EU9A 2TODA 3LCXA 2FGZA 3FK4A 4OWGA 1TVPA 2KAUC 2ZTJA 4JIRA 1UKOA 1KR0A 4AZIA 1QO5A 3K5XA 1S5NA 5C2CA 4H01A 1GHSA 3A6OA 1ZPTA 4IPJA 3R6IA 4AWUA 5CAKA 1EWEA 1F8MA 1T96A 3C2VA 1VHCA 1CI1A 1VBUA 3SUUA 2Z00A 3EMQA 3SCTA 5A8GA 2CKSA 5HMDA 5BROA 2FHFA 5CZKA 2PCQA 1QAPA 2ZZ6A 5C54A 5I3DA 1H60A 3XINA 3U2OA 4NNBA 4IJBA 3TN4A 2V68A 3IIZA 5JH2A 2OQYA 4FIQA 5LIKX 3RLGA 2QGYA 4XKYA 2PF8A 4JTSA 1RBAA 1PDZA 4H9ZA 3MHGA 4WSHA 2D0FA 2ZZ5A 2I17A 2A0NA 1JYNA 2GQ9A 2WLZA 2PLJA 2E7FA 4EF9A 3LX9A 3O0KA 3WFLA 3DBPA 3B9DA 1CXLA 3QYSA 5AZ1A 2A1YA 1TTPA 1TUXA 1KXTA 4DIAA 1HQTA 3HQNA 1FWGC 4L4MA 4D72A 3N9KA 1IZKA 1PBGA 1J10A 2FIQA 1ENUA 2W92A 3W26A 4WEVX 4MUPA 2QCLA 4RXFA 2B7OA 3LDVA 3GHTA 5ABFA 1IGWA 1EJSC 2QJNA 3I3DA 2AL2A 2DZPA 3S1XA 1ZS2A 3IJIA 1GWJA 1HL8A 4FOUA 5GPRA 1GVIA 2GJPA 3M43A 1ELSA 4I7WA 6CGTA 4EIVA 4MB4A 5C5YA 4JR5A 2PDFA 4ICNA 5HMEA 1DJIA 2JKAA 3LV6A 2NUXA 3N19B 3CV7A 3C0QA 5C0QA 2WZMA 1AJ0A 3CC1A 5F7UA 3RNDA 4JOMA 1V7AA 3BOFA 4JKLA 2IUZA 4YJ5A 4AWEA 3NL2A 1GOIA 4HPJA 1ML1A 2D24A 3EX2A 4FNTA 1V03A 4GH3A 4D6JA 4DO7A 3BG9A 5EA9A 2ZE0A 2GUYA 3SCNA 1Z32X 4Y2WA 1ME9A 1H09A 3W75A 1WBHA 3K8KA 3LI1A 3I3EA 3NJ3A 5KZMA 2WM0A 3W1XA 2DZBA 2C16A 4GI9A 8A3HA 4MWAD 3ZVIA 1QVBA 1UZ4A 2B31A 2VMFA 2E6DA 2RGMA 3WD3A 1WDSA 4N6FA 2A7PA 3WMCA 1HP5A 3NQ2A 1XPGA 1XV8A 3GVWA 1Q4WA 1VEMA 2HRWA 3W7EA 4ZEPA 2FZDA 2OR2A 3HO8A 3Q94A 1RV8A 4U28A 4P7NA 2P1FA 1IHIA 2CXEA 2J77A 1MXGA 1E6ZA 1XIIA 4WCJA 3T7VA 2VGBA 1W5MA 4A21A 2PRHA 2QPSA 3UP8A 1PKMA 1XCWA 2V63A 3FA4A 3R94A 1KFWA 2OZTA 2D20A 3HPXA 1EX1A 2WNNA 3KRUA 3W7JA 4GFSA 3AWOA 2BMBA 2JKPA 1KW1A 3S9YA 2ZA3A 1JI2A 1E43A 3W1TA 3OLEA 2C18A 4M24A 1DQWA 2NXIA 4K8EA 2ZX6A 3OBEA 4FLSA 2DQXA 4NF7A 2VENA 3UWQA 3MCOA 4RE0A 2CC0A 1RCXB 1UWSA 3K4AA 1VPXA 1ONWA 2NV1A 2G50A 2Y7EA 2ZXDA 1R9ZA 1J18A 4QSHA 4RLIA 4AIEA 2GSEA 4ZOCA 4L6OA 2O7QA 1HKKA 5T8GA 4AX7A 1IR2A 3M6YA 3TXVA 1PJ9A 1W5OA 3VKJA 3ZFHA 1JXKA 4GVIA 3LCHA 3WFAA 4ZMGA 4JYDA 4GIAA 4YYCA 3P5YA 2GJXB 1XLHA 3L65A 4Z08A 3AIVA 3NYZA 3BJTA 4GY7A 3LHWA 2FH8A 4QQUA 3AHTA 4JXCA 4QNEA 1K6WA 4KEZA 5GJPA 1HKVA 2V2DA 1CIUA 1YTEA 1TCMA 3CS2A 4NZFA 4IPNB 3EWBX 2YYTA 4N42A 1SO3A 4MB5A 1YE4A 2OJPA 3O3RA 4KETA 4KESA 1FXQA 4O15A 1XLMA 4AZCB 5D2YA 4NSBA 2VRQA 1JZ3A 1WXJA 4LJ3A 1D7FA 1OF8A 2VHLA 4FLRA 1BAGA 3WQ8A 3ITVA 4TVUA 3TLLA 2NUYA 3D5HA 3QZAA 1FKWA 2TYSA 1GVYA 4ZQMA 3T05A 2V5DA 4PUKA 2DZXA 3U4FA 4F0KA 1HJWA 2VGFA 3NDYA 4G1KA 4GX8A 1OFDA 3QMTA 4UTUA 3A4XA 2ZX8A 1JYVA 4EXBA 4LV9A 4JTAA 1Q2RA 2HS6A 3MVTA 4H7ZA 3IJLA 3CO4A 3JW7A 4F4RA 5FF2A 3EXTA 1FHUA 2HVNA 3G1DA 1YBQB 3G0SA 2OGJA 1PXGA 2Y0FA 4AF0A 1OT1A 4NX5A 2ESCA 4MKSA 5TNVA 4Q7IA 5CSYA 2FGBA 4KGJA 3TC6A 4C6EA 2VVSA 3NA8A 4Z0SA 2QAPA 3V1PA 3W1QA 2FZMA 2V5LA 3M0KA 4NYYA 4M82A 3ALGA 5I0DA 1LUCB 1HP4A 1JZ2A 1V7YA 4YL2A 1JEZA 4UOQA 3BLLA 3BCDA 4IXHA 2JFEX 4YVPA 1AJ2A 3QQ0A 2NVCA 3DI1A 4GUHA 3AJXA 1TKKA 4DPPA 3PPFA 2NQ5A 2PF0A 4AZ7A 5IHSA 1H5YA 3F2CA 5A6TC 4UR8A 5AHMA 1DHPA 2AQVA 2XIIA 1XDJA 4I5UA 3M47A 3KLLA 4I5XA 4LAOA 3MSRA 4DNHA 4CCZA 1XBVA 4LVFA 1C9DA 3UWUA 4PTVA 2HXUA 3U7BA 3IK2A 3CPRA 4OGZA 5D02A 1GOXA 1JDCA 1NFGA 3HG3A 3ABOA 4FEZA 4L5ZA 1UR3M 3WLPA 4JTGA 4BFAA 1RCOB 2HPMA 2E1DA 1BSIA 1EYEA 3H6OA 6PTDA 4A4AA 2C1IA 4X0NA 1X98A 1Z44A 4MFEA 3GWQA 3KW3A 1QNQA 3NAVA 4L80A 4NJHA 2WZHA 3K1DA 4TIMA 2ZRXA 2ZVIA 3NSXA 1EC8A 3WQGA 4XQ6A 4RPPA 2QMKA 3H7VA 3UG5A 3FCPA 4HU8A 4UTHA 4HSHA 1V51A 4U3CA 3RPDA 1LG1A 5CPTA 4FNRA 4PUDA 3T0CA 2XH2A 5CPLA 2J7FA 3KDOA 4QS5A 5RUBA 3N2TA 1JD9A 3I4KA 1RY8A 4Q4SA 3LXBA 5AB3A 3VDAA 5A6AA 5A94A 2PDPA 1GPFA 1GEHA 1UJQA 1KA9F 5CLTA 1D2KA 5D2VA 1QBAA 2QIIA 4J5NA 1UBSA 3TZNA 2E6YA 3LOTA 1EF2A 7PTDA 4S3CA 3PWGA 1I0BA 3SIMA 5BU6A 4UFJA 4L7ZA 4L56A 2FZNA 1TTQA 3V35A 1QO2A 1V0MA 4QGCA 4LS1A 2XFWA 2I9EA 4UFMA 1H49A 3IIXA 3N17A 1S46A 2V69A 2PODA 5CG7A 4WSJA 5AC8A 5EMUA 1NJJA 1PCWA 3ABSA 1XUUA 1UJPA 4PRTA 4BF7A 5J04A 4BCEA 1U1UA 2RGLA 3PP7A 3LI0A 3W29A 2XVGA 2A3AA 3S5ZA 2HTMA 1QR7A 4ZL1A 2QDEA 1JL8A 1EDTA 2HSAA 4MWAC 4O18A 5HR7A 3LV5A 3QV8A 1SFJA 3VNJA 3GU2A 3UETA 2FDMA 3ANUA 4LC6A 4UTLA 1RQEA 2MANA 4V33A 3FVMA 2C19A 3EWWA 4H9VA 3BAJA 3PZOA 4IUOA 2GUBA 4DZIA 2VNCA 1SMAA 2CLKA 1X97A 3VGHA 1WZKA 4Z42C 2WSRA 3GTNA 3QRHA 4J2MA 2J7EA 1YKWA 4CU8A 1KRAC 1VJZA 4JY8A 4X9YA 2A3CA 2I1OA 1E3XA 3UU0A 1XIEA 1P0KA 1FWRA 3M5YA 2O7SA 4NNAA 3WLQA 5HJXA 4C5YA 2X1UA 4GBUA 1JFXA 1HKMA 3PNUA 1MUCA 3GBEA 3KZPA 1XRVA 4ORIA 3SADA 3B0VC 1DJGA 4CD6A 4B5VA 4WHBA 2G3IA 1EIXA 4KWWA 3PC0A 2OFJA 3DCPA 1WV2A 4KEUA 4D6GA 3RG6A 2OG9A 3GK0A 1B90A 1H41A 2R8WA 1F9CA 3QFWA 2WYSA 3P0XA 1GOQA 4M5PA 3KUMA 2BHUA 3MP3A 3R11A 4NL1A 2PDWA 2WVVA 4D6FA 4UNIA 3HMJG 2O9PA 3E02A 2ZA2A 4Z1DA 1UA3A 1CW2A 4UTWA 3BMWA 3P0WA 3OA5A 3GS6A 2QJHA 3NTYA 5HJYA 1T8QA 8RUCA 3E2QA 4E3TA 1LTDA 2FB2A 2V5KA 3RMJA 4DBUA 3W7QA 5IDZA 4GXWA 5HQLA 4DHGA 3THAA 1W1PA 1O6IA 3B0YA 2YL5A 2OO6A 4IUGA 4Q33A 5EMLA 2OZ3A 4MLRA 3FOKA 4GQQA 4P8WA 1KRMA 1DHKA 1RSCA 1P43A 2OTDA 1J8VA 3CASA 3OLIA 4EPDC 3HU7A 4OE7A 4JTQA 3KL3A 4RE2A 1JULA 4IGSA 4XKYB 1TZ9A 3SGUA 4DJDC 4J4KA 3H2CA 3GZAA 4N9DA 4FNQA 1ZLPA 1P6CA 3LNMA 1R9YA 5C70A 4GABA 3FAXA 3LTPA 3PWIA 3R5EA 5HUOA 2Y62A 3G1YA 3T2OA 3VCRA 5T91A 4HHHA 2PEVA 2Z28A 5JMUA 5K9XA 3O06A 4LANA 1EB3A 1NFBA 3KOYA 3STPA 3A9IA 3BGJA 2WNQA 4S39A 4FX8A 5DCDA 5H1WA 1K03A 1W2VA 1G4SA 1NTHA 1POKA 1ZSXA 2GLKA 2NX3A 3VMOA 3WK1A 3NQ8A 4LW7A 3PNZA 5BMXA 5ABFB 2CW6A 2WSQA 2FTPA 4HNNA 1J5TA 1AMYA 3FKKA 2YIHA 5GNXA 3V1HA 3B8VA 1B3YA 3USBA 4EPKA 3TKFA 4ZO7A 1EIBA 1DWAM 7ENLA 1FFQA 5E1QA 1HW6A 3MZNA 1CGYA 4O0KA 5FAJA 3DDMA 3CH9A 4B3LA 1FHVA 3E38A 4HPHA 3OTRA 1XH1A 3F4CA 4CEXC 3LZ5A 1DIKA 4HN8A 3W38A 5FEXA 3K8MA 4EPEC 4FXFA 3FVDA 4A3YA 1CNVA 2ZQ0A 2VCBA 2CLEA 4EXQA 2I5QA 3A9BA 3ARRA 1F7BA 2EPHA 3GW3A 2G37A 1WUFA 3MY9A 2WZEA 3NQBA 4JTIA 1BKSA 3CTLA 3P14A 2VO5A 3P7YA 3GD6A 1EFZA 5DMMA 1UKTA 4P7RA 3FDGA 4QDMA 1LJYA 2J7GA 3DGRA 1SJBA 6A3HA 2JIEA 5CJ5A 1H50A 4DWSA 1E6PA 1HN1A 3TJLA 1OBAA 1W1VA 3PWAA 3MWAA 3IWPA 2E28A 1XLEA 3MUAA 1BD0A 2RDUA 3M1ZA 4GYKA 5DY2A 1W3TA 4QG6A 1XISA 4V1XA 3SR7A 1JQXA 3M0YA 3P81A 3DI0A 2CITA 1OF6A 3OPSA 4F0LA 1MNZA 1C3FA 5CJNA 4FALA 3FGCA 2PDQA 1R5YA 4TTUA 5E93A 3BICA 5D9MA 2DZAA 1UA7A 3B40A 4ZVJA 1XIHA 4XVDA 5CBJA 3MMWA 4JICA 3C2EA 3QY6A 1V5XA 2WJDA 2QCCA 1K1DA 3LBCA 4JTFA 3C86A 1Q7QA 3TTEA 2YOCA 1QASA 2F2KA 4M80A 1NOWA 2VOMA 4IXXA 2TAAA 3SECA 1H62A 1T7LA 4B9YA 3CQ0A 1Q2SA 3PZQA 3PBMA 1CBGA 2L5HA 1QMLA 1IXOA 5D2TA 3AHYA 4KS0A 3WD4A 5K9CA 3MBDA 3MJYA 3PUDA 3VMPA 1EBGA 3UJSA 2CLPA 3JS3A 4WY0A 4TX8A 3L4YA 1GZ1A 3STFA 1TPVA 3A4AA 4AVOA 3BTNA 3O0FA 2HPIA 1S2VA 1ONXA 3EPOA 3L4TA 4O1FA 4JEJA 3TTOA 3KFTA 3NDOA 2W6RA 2WV8A 2RH9A 2O9TA 5C7HA 1TZZA 3ERPA 3FX4A 3PY2A 4PMZA 2VFGA 3BSHA 1MUMA 4DM2A 1AODA 1ZRQA 3UXLA 4GI8A 5BWAA 3H2AA 3V16A 4UTTC 5JVLA 4OZOA 4BR1A 3TWBA 1S1RA 3WLHA 3WQVA 5LXEA 4M1BA 3V0SA 1J6OA 5IXEA 1AD1A 2CXGA 2QDHA 3CUZA 1YDVA 1KFLA 3GC2A 2BVYA 4C6OA 1WBJA 4GBDA 1W3LA 3MBFA 4HYRA 1IZCA 5LKYA 3E0WA 3N11A 4ZSTA 1SW3A 1XD0A 2PDIA 5HPCA 1JGMA 5CC6A 1TPDA 3LU2A 3ANVA 3ES7A 3WDRA 1GVEA 1IWAA 2VQUA 2BLEA 3TP4A 4F2BA 3HV8A 3LLXA 2P50A 3VOJA 4ZENA 1UR2A 4H4IA 4GMEA 4Z2GA 1IIHA 4PUNA 3BV4A 2A21A 1TPWA 2WSPA 3PUGA 1FH8A 2GVYA 5MHBA