1GVFA

Structure of tagatose-1,6-bisphosphate aldolase
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
284
structure length
273
Chain Sequence
SIISTKYLLQDAQANGYAVPAFNIHNAETIQAILEVCSEMRSPVILAGTPGTFKHIALEEIYALCSAYSTTYNMPLALHLDHHESLDDIRRKVHAGVRSAMIDGSHFPFAENVKLVKSVVDFCHSQDCSVEAELGRLGSAFLTDPQEAKRFVELTGVDSLAVAIGTAHGLYSKTPKIDFQRLAEIREVVDVPLVLHGASDVPDEFVRRTIELGVTKVNVATELKIAFAGAVKAWFAENPQGNDPRYYMRVGMDAMKEVVRNKINVCGSANRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords TAGATOSE-BISPHOSPHATE ALDOLASE AGAY
publication title Structure of Tagatose-1,6-Bisphosphate Aldolase; Insight Into Chiral Discrimination, Mechanism and Specificity of Class II Aldolases
pubmed doi rcsb
source organism Escherichia coli
total genus 105
structure length 273
sequence length 284
chains with identical sequence B
ec nomenclature ec 4.1.2.40: Tagatose-bisphosphate aldolase.
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1gvfA00
4NJJA 3RNDA 4UTHA 4GFSA 2QJHA 4RZ4A 3RK8A 3QRHA 4AF0A 2WO5A 1KW1A 3CQ0A 1V5XA 2R94A 3GDLA 3NZ1A 2HS6A 4FHAA 1JRCA 1SW7A 3LHUA 3W7DA 3O6CA 3PBVA 3PM6A 2CLOA 2X1RA 3STEA 2G95A 3T44A 4MY9A 3NXFA 1QNVA 3TH6A 1LORA 4WD0A 3Q2DA 3QW3A 2V0TA 4DELA 3UXAA 3DFQA 3HG5A 1KLZA 2TPSA 3BW2A 1EP2A 1C9DA 5I3GA 1OX6A 3MI3A 4D2JA 3NPUA 2E6YA 4Y8FA 4P2VA 3UZ5A 2QCCA 2CZFA 1JVNA 2PCQA 1NF7A 2ZZ3A 3W1QA 3QMRA 3W23A 1KM5A 1RZMA 3TCEA 1OX4A 1GT8A 3W7GA 3MHUA 1YTKA 1OYCA 5I3KA 1RV8A 2XFWA 1XBVA 4O12A 3W1NA 4BI7A 1PE1A 3NL3A 2EAWA 4IXXA 3E49A 3W7PA 4IX0A 3GDKA 3PBUA 4AXKA 3GYEA 4IX2A 4HSOA 6TIMA 3SGUA 3C2EA 3WJWA 1KM3A 1ZALA 5C55A 2ZYFA 5AHLA 3O6YX 3PF3A 1LOQA 1LROA 5KTLA 3W3OA 1PV8A 4N02A 1M7PA 2VKZG 1TMHA 3S9YA 3BG9A 2V82A 4LUJA 3EKLA 3S0CA 5CG7A 1WOBA 2A0NA 2Z2UA 1G67A 1ZHAA 2ZFAA 3E02A 3TMQA 2GJNA 3WJYA 3P82A 2ZZ7A 5I3IA 1GTEA 3M47A 2EKCA 1FCBA 4K37A 3W74A 3LCGA 3AJXA 1A5SA 2VEMA 3N2MA 4N6FA 1QCWA 2PE4A 1OK4A 3NVTA 4DF2A 2E6DA 4JD4A 3P5YA 5AYZA 1KA9F 3GR8A 1VHNA 1TRIA 1JQXA 2ZDRA 2V30A 1XBZA 3SR7A 3SZ8A 4O28A 1SZNA 2F84A 5CKSA 3HJZA 4DBEA 1X7FA 1QMLA 1T99A 2NXIA 3U2OA 4E2BA 3ANYA 4NT0A 2Y6ZA 4RXGA 3PB0A 4L4LA 4O1BA 3LCHA 1DHPA 1KM4A 3I6RA 3W9ZA 4RXFA 2OCZA 2ABBA 4FX8A 3TC7A 5CZ0A 2YX0A 4MLRA 4ZQPA 1RD5A 2VFIA 3GX9A 3QSRA 3FJ6A 4EF9A 3W76A 3G1DA 3RF9A 3UYCA 3QEZA 4XKYA 2DZUA 1W0MA 4O13A 5G1TA 3W7HA 2QUUA 5FEXA 2YFOA 3HG4A 4LNYA 4HNVA 3LX9A 4JNMA 4DXVA 2B4GA 3ABQA 3G0UA 3GDRA 3W7RA 4IMDA 1FXQA 3NPVA 1W5MA 1TTIA 4LVAA 3TDFA 3NPWA 5K9CA 1KLYA 3IIPA 1LOSA 1FWNA 4UTWC 3C52A 4I7VA 3LM7A 1W1ZA 3HO8A 5EPDA 2OT1A 1SO6A 1VYSX 3UWWA 5AHEA 3BLIA 3PUOA 1WXJA 3ZWSA 1OFBA 3TR2A 4WY0F 3C8FA 3S1UA 3P8JA 5F2GA 1DVJA 2BWGA 2NXGA 3TW7A 3NEVA 4O17A 2FJKA 3QM3A 4NNAA 2A1YA 5AOUA 3IIXA 1AK5A 3W7OA 1VCFA 3PVFA 4ORMA 1QAPA 5D30A 5LGZA 2P1FA 4X22A 4ZL1A 1EWEA 4GNJA 2B7PA 1ZFJA 4XTIA 3LLFA 3I7RA 3W88A 3M5VA 4UCGA 2YPIA 2W0UA 4ADTA 3EWUA 3DFOA 3LI1A 5CPMA 2PRHA 5I3JA 4UFMA 2OMAA 1I45A 2OJPA 1J4EA 4OGZA 2WJZA 1D9EA 2E1DA 4JTLA 3NQ6A 3LCWA 1K03A 3W87A 4AVFA 3C3NA 4UTIA 1SFLA 3L21A 3LHYA 2RHGA 3FFSA 1C8VA 4AWUA 3H55A 5FEWA 3V1PA 2QCFA 2V2DA 5G2HA 2JKEA 4FX7A 1FQ0A 2NV2A 1XXXA 1Z48A 3L68A 3A22A 1LRQA 3W7EA 5DN1A 4HSNA 4POCA 1S3HA 1GEQA 4O18A 2C14A 3TFCA 1R47A 3CIWA 4PL2A 3BV4A 3DKJA 2TMDA 3NPXA 3LBMA 3SFKA 4PEKA 2X1UA 2VEPA 4JX6A 5D38A 5G1YA 3FOKA 2GVGA 4MY8A 3M5XA 1ZAJA 5HQEA 1O60A 2HSAA 1IIGA 4M7TA 3LHWA 4UXDA 5KITA 1W3IA 3E12A 1BWLA 1Z42A 3SI9A 4O16A 4R34A 5D02A 1MEIA 1OFOA 3MUXA 2ZRUA 3W1LA 1JCNA 4LU0A 1LBLA 1VRDA 1R2RA 4KFPA 3MP4A 3BPWA 4UTKA 1XCFA 2NX9A 2BX7A 2XN1A 3TFXA 5T26A 1GG0A 3W07A 1SUXA 2Q8LA 2ZZ4A 1F2JA 1JJKA 4ZQCA 1VCGA 5K7JA 4I9AA 4DO6A 1W54A 3W86A 3NQ2A 1XL9A 1HL2A 2ZA2A 3DGRA 3F4WA 4LC6A 5G4WA 3I7SA 1GOXA 2NV1A 4NX5A 4Q33A 3L0NA 3OBKA 1OVDA 1JCYA 3T78A 3G3DA 1F7BA 1KFEA 4AH7A 3L9CA 1W5QA 1SO5A 1BKSA 2C1HA 3L5AA 2BSLA 5AHMA 2CZEA 4MPQA 4O1DA 2G97A 2CLKA 3P8IA 5IM51 3STFA 1JUKA 1FCUA 1ZNNA 2RH9A 2ZCGA 3QQ0A 4GUIA 2UV8G 4RX0A 3DFNA 4PODA 5FF2A 1D3HA 4N9EA 3RFAA 2JGQA 4FNPA 4JTTA 1DBTA 5FF3A 3T4CA 2YW3A 5EYWA 3RLUA 4KWWA 4QISA 3LCIA 2ISSA 4E2DA 4JGDA 1BWKA 3BG3A 4DF0A 2WSRA 5D2WA 1I4NA 1WA3A 2VFHA 4GXMA 3IIVA 3O8AA 2ZBTA 1WQ5A 3A24A 3PS7A 1GQNA 5K4XA 1ZJIA 4IUOA 4PC8A 1I2OA 4PFMA 1SZGA 3PAJA 2E68A 2ZTJA 3NQGA 5IBXA 1F74A 1H60A 3W7LA 2CWNA 1GYNA 4NJGA 1UUOA 3A9IA 1KTCA 3P60A 4RCXA 2E5DA 3MHGA 4LVDA 4NJIA 1Z41A 3A5VA 3IGSA 2Y61A 3GKAA 2EPHA 3LGEA 2H6RA 4K8HA 3TNOA 3L0KA 1H1YA 3FEMA 4N4PA 4JN6A 5BOOA 2X2GA 1FWTA 3O15A 1GJPA 3QJAA 1LLWA 1A50A 1RVGA 4BI6A 3CT7A 1Z44A 1RQHA 4OE7A 1IIHA 4GE8A 1QPRA 3DH7A 3TSBA 2B7NA 4L4MA 4KFOA 1I8JA 3FJLA 4LS0A 3UPBA 3CPRA 3UWYA 1UASA 3G1VA 4RK8A 4WOZA 2A7NA 3W72A 4EWND 2Y7GA 3JR2A 4O1AA 4O4WA 4JXCA 4NQ1A 4E0CA 2P0OA 1VPXA 3LCLA 2V5BA 3QQ1A 4N9BA 5F2LA 3P61A 1OJXA 4HIBA 3W75A 3TW6A 1ZENA 1OHLA 2NLIA 4AMAA 2RDUA 1OK6A 3H54A 3N2XA 3HBLA 4CQ8A 4NXKA 1R2SA 3M44A 3W70A 3TIMA 2A7RA 4UTLA 2JBMA 1SSGA 1OABA 1L6SA 3W84A 4NNBA 3N34A 4WY0A 1H7PA 4CCDA 1MXSA 3C56A 3F03K 3TQVA 3L67A 3W1PA 2ZRWA 3M5YA 1VZWA 1MO0A 2CLFA 4BWLC 2FLIA 2H90A 4Z0JA 2P10A 3MP3A 1PHWA 3W7KA 1L6YA 1YYAA 2DJLA 2H3DA 1XC4A 4NX0A 4IMGA 3I68A 4DBDA 2QDGA 1OFAA 2ZZ1A 4ZZ9A 3OVPA 2O7QA 5CZSA 2Y7EA 3W2JA 3P74A 5K2ZA 4JYFA 5C54A 5E93A 4UMCA 1EP1A 1YPIA 3SW6A 4Z1DA 4N4QA 4LVFA 3PG9A 3MI6A 2Y63A 4MLJA 2BZNA 1TTPA 3NQ8A 2A85A 2ATSA 4O50A 1Q45A 3H53A 4RLIA 2G5WA 4UNKA 5TBOA 1WYIA 2FPTA 1OFEA 3C2RA 1H7OA 1KFBA 5LNUA 4O1CA 1JUEA 1K7EA 4YL2A 4AHOA 5K9DA 3HOJA 1G6CA 4CNOA 3G8RA 3E9AA 4XBKA 3EX3A 1W37A 1EUNA 3R2GA 2VFGA 4KFNA 1NVMA 3TUUA 3B8DA 3JRKA 4CLMA 5DBUA 2C6QA 4XTDA 3NR0A 3ABOA 5FF0A 4JEQA 4NZJA 3GXTA 3KRSA 1ZAIA 5IBXC 4ZQNA 1VGAA 2FB3A 5EY5A 1F05A 3KVJA 5FEZA 3F4NA 2FIQA 4O15A 3VI2A 3NQVA 4Y90A 1VLIA 3K30A 3WFAA 4IJBA 4QM1A 2JGYA 4CQAA 1S5VA 3QMSA 3LTYA 5KZDA 2GVLA 4Y6GA 4KWVA 4LC8A 4EOUA 3NQDA 2QEZA 3NQ7A 1UCWA 4AF0B 3HGSA 1FCVA 3GAYA 4LOCA 4JTEA 3ZR4A 1DOSA 3FYOA 1GG1A 3ZFHA 3LLDA 3EEGA 5F1VA 3CLMA 1Q3NA 4O0ZA 3NA8A 1H7RA 3IVSA 3I7QA 2DJXA 4GC4A 3QSTA 4O10A 1VHCA 2QCEA 3NNTA 2VXNA 1B57A 2V8ZA 4OV4A 4LY8A 1TV7A 3D0CA 4XBSA 3G1YA 4W9TA 2PRMA 2NUXA 2FPYA 3INPA 3W2LA 1JULA 2H8XA 3LDVA 4A22A 2GQAA 3O06A 4S1FA 2CW6A 1PL9A 3UPWA 5FESA 1QO5A 5HINA 4FXRA 2DP3A 4FNRA 4AHPA 2ZTKA 4NXSA 3C2OA 3UZJA 3EX1A 3UQNA 5DCBA 2PRLA 5D33A 3NL5A 1AMKA 3VNDA 3S5YA 4MZYA 3W1XA 2NWRA 3GXNA 1F5ZA 5FI8A 3M7WA 1DKWA 3QMTA 1Q6QA 2JK2A 2YR1A 2J27A 4LV9A 3DI0A 1KV5A 5FF7A 3VKJA 5ABTA 7TIMA 3TU9A 4QSHA 4XQ6A 4XWUA 1P4CA 1P0NA 3BGJA 1T0OA 3HF3A 2CLLA 3W2KA 1IF2A 2QCDB 4JIQA 5E0KA 4EVZA 3LV6A 1EUAA 4N9CA 1H5YA 4LRSA 4MVAA 2ISWA 2GOUA 2QCLA 3NAVA 1S5WA 3N19B 3FLUA 1N55A 2V81A 1NSJA 3YPIA 1EWDA 3NZRA 4DPPA 2ATMA 4PCFA 2YXGA 4FF7A 1H50A 2CFFA 1XUUA 3C2FA 4LW7A 3BK0A 3HGOA 2HMCA 1JCLA 1F6PA 1TJRA 3EX4A 5HULA 3T55A 1QPOA 3PSVA 4UTTA 4GRSA 3EX6A 2GQ8A 5LNVA 4ALDA 2ZRVA 1M5WA 1DJNA 3THAA 4P61A 1N8FA 4Z1CA 1W31A 2QUVA 1H7NA 3C61A 3HQ1A 3OVRA 4O53A 4YMZA 3CWOX 2ZRYA 2Y70A 1LCOA 4QAIA 3M9YA 1AL7A 3ZWTA 2QUTA 3DKLA 5DY2A 1QOQA 2C18A 1I2QA 4NJHA 4MY1A 1XBXA 4XKYB 1HFBA 2GPTA 1AG1O 3G1XA 3MWAA 4ADUA 3W1MA 1W5NA 3S1XA 3R5EA 4C1LA 2Z6JA 1G4SA 3CC1A 4UC5A 3BVJA 1ZCOA 1KFCA 3WJZA 5F4WA 3W71A 4MUZA 2QAPA 2CZDA 2RKXA 3UWQA 5BMXA 5K3VA 4AHQA 4JTFA 4O14A 3UY8A 4YXGA 1A5AA 4IQLA 1FWWA 4A2RA 2VEIA 3L65A 1JCXA 3G0XA 1TCDA 2HTMA 4QITA 1JR1A 3PULA 5I3FA 3WJSA 1Y0EA 5K9XA 1ICSA 3FA5A 1WAUA 4FNSA 1BEUA 3ELFA 5D09A 3BLEA 4BK9A 3TQKA 2Y7DA 3NQMA 3TSMA 4WOQA 2VEKA 3KAOA 1WOAA 2JKPA 2YFNA 4DQWA 5H91A 3PY2A 3VCRA 1H7WA 1K7XA 4UFKA 3O16A 3RMJA 3PC0A 4AWSA 3T7VA 5L9FA 2ZQ0A 1XI3A 4JTHA 1ALDA 1UBSA 2Y89A 4ICNA 1TREA 1L2UA 1JCMP 1HO1A 5HWNA 2VC6A 1FDYA 1SZFA 2OT0A 2V2HA 5G2IA 1LBFA 3DFTA 3HGJA 3KRUA 3GIYA 2Z6IA 3KVMA 3KXQA 4GWEA 5LSMA 3TKFA 5F2IA 5A5WA 2YYTA 4BR1A 5DXYA 5A8GA 1NF0A 4NZFA 2D73A 1THFD 4GJ1A 5DXXA 3W22A 1KM6A 3PBYA 1OF8A 2VFFA 5CZJA 3UXDA 1YDNA 1EB3A 2Z1BA 3ABSA 5H2ZA 5HJLA 4TIMA 1DORA 3AO0A 4GBUA 2A21A 2WSYA 4A2SA 1TRDA 1X1OA 2DZWA 1R2TA 4UFLA 2B0MA 1H7XA 2CLIA 3FKKA 4UTUA 4MJMA 1J2WA 3S42A 2J9YA 3TE9A 3FKRA 1TPWA 3HPSA 1LOLA 1Q6OA 3P7YA 1OFQA 1WBJA 1K8ZA 1G4TA 1TPEA 3CIXA 5AB3A 1R46A 5D04C 4IMFA 1IXPA 5AC8A 4JS3A 3R12A 5HNRA 2C3ZA 2QJGA 3BW3A 1SU5A 2DU2A 3RLVA 2C15A 4NVTA 4PA8A 4WX2A 3Q94A 1FBAA 3G24A 4U28A 2NZLA 3B06A 1G4EA 3ZS4A 3GDMA 1XFBA 5KINA 1K8YA 3B0VC 3TJLA 3QPYA 1MZHA 4FXSA 2EGZA 4YCOA 3GNDA 4Y9AA 1TPH1 4K7VA 3U8GA 3EWWA 3EB2A 2DZVA 1U5JA 3CM4A 3LTPA 3Q37A 4EIVA 5G4EA 4LTSA 3S1VA 2JKAA 2QCGA 4JX4A 3S5OA 1LBMA 2O7SA 2YCEA 3N9SA 3T40A 1LP6A 3G1SA 4X9SA 5HUPA 1KM2A 3OG3A 2GQ9A 1QFEA 1GPWA 2R14A 4MOZA 1X1ZA 1TB3A 1SO4A 2FPVA 3HB9A 4IMCA 1XDLA 2YGYA 3W7JA 4LS1A 1XKYA 4A29A 3ATYA 1LRTA 4CCEA 2ZRXA 2Y7FA 1VS1A 1EEPA 2J6XA 2PURA 3HG3A 2VFEA 3DU0A 1B4KA 1YDOA 3P5ZA 3PR2A 2A4AA 3CEUA 3DHFA 3W2NA 3KRZA 1H1ZA 2G96A 1KBIA 1TTQA 2ZZ5A 5LHEA 4N6EA 2YYUA 5AN7A 1EA0A 3GXPA 3LHZA 4JTIA 4JTGA 5KZEA 4ADSA 4FX6M 1ME8A 4JX5A 1K7FA 4MIMA 3NG3A 1NAL1 3C6CA 1O4UA 1VLWA 1ADOA 4DO5A 3IV3A 1OFPA 2C0AA 4C1KA 3CB8A 3FS2A 1GVOA 5CPOA 5GVJA 5LZLA 3PSWA 5AYYA 1G69A 4H3DA 1ME9A 4MZ8A 3SY5A 3LERA 3G1HA 1YTEA 4QIUA 2AQWA 3IIOA 3DI1A 3EWZA 4K7YA 2NXHA 2C19A 2QAFA 1SFJA 1IXNA 2J9ZA 3IIZA 4Q4KA 3DBPA 3L66A 1OF6A 2DZTA 2GUUA 3N14A 4B5NA 1EIXA 3W1TA 4OQVA 1KV8A 2X1TA 4MFDA 2NX3A 1TPVA 2AAMA 4HT3A 2TYSA 1K8XA 4E38A 1TQJA 2WPBA 3G18A 4GUGA 4AEOA 5KZMA 3O07A 4JTKA 4H6KA 4QNWA 2Q3OA 2QCNA 1JCJA 3OIXA 1A5CA 1QWGA 4CNNA 5CGQA 3CTLA 1AW1A 4NU7A 3MMTA 4OBTA 5KMYA 2HS8A 3W83A 1NFBA 3LRLA 3NM1A 5D32A 5U4NA 2FB2A 5LNSA 3WK2A 1X6UA 4JTJA 5EA9A 3P67A 3NM3A 1GVSA 2WOQA 5D37A 3B03A 3EKZA 4OT7A 1WV2A 1YXDA 1ICQA 4UR7A 3I65A 2E6FA 3LHVA 1OYAA 4M6VA 5AHNA 1MEHA 1IXQA 1TPFA 1FX6A 3LXBA 1SQ7A 2RDWA 5DCEA 1FDZA 1TPC1 3NQCA 4HPJA 2X30A 4JYEA 1W56A 2H8ZA 5FEPA 2ZRZA 2LLEA 2FTPA 1QPNA 5HWMA 2NX1A 3C4UA 4MJZA 5D2TA 1QOPA 1WBHA 4XUGA 4UTMA 2ABAA 2QDHA 3OHIA 3IEBA 2QKFA 8TIMA 1QDSA 3ATZA 4O4VA 1FY6A 2ZZ2A 1D3GA 4HPXA 4IPJA 4LS2A 1W3NA 1OX5A 3TV8A 2GJLA 3GK0A 5F2MA 3MO7A 3R13A 4O0KA 4AB4A 1ONRA 3O63A 3UD6A 4OV9A 4O57A 1SZEA 3FYPA 2OZ0A 1H63A 4JTSA 1QPQA 3DZ1A 2QF7A 1WDWA 3W2MA 4I7UA 1I2NA 4DEFA 2AGKA 5G5IA 3W1AA 3L2IA 3MJYA 1VC4A 4DO4A 4TX9A 1OYBA 1N7KA 4X3ZA 2OX1A 4M7SA 4O8RA 1HTIA 3E96A 3TMLA 5F1UA 2WNQA 4LWWA 3KX6A 1YTDA 1TV8A 2I9EA 3TQ0A 3LOTA 4R53A 3LXAA 5BW6A 1GTHA 3PUDA 4M19A 4QNEA 4ZQOA 4YWIA 4JTUA 5BRBA 4UTWA 1FXPA 3EWBX 2BLEA 4YLWA 3W7NA 1QO2A 3LCXA 4A21A 1B4EA 1LLZA 3G1AA 1YXCA 4QJ1A 2B7OA 4Z0SA 5KSWA 3LXCA 1X8FA 4O11A 1QR7A 5HMSA 5SWUA 4GUFA 2A7PA 2BTMA 4UFIA 4PH6A 4O54A 1ME7A 1SSDA 3KOFA 4UMAA 2NWSA 3PUEA 1OX4B 1RR2A 3THQA 2H3BA 1TPDA 1KM0A 2WV8A 3LTSA 1G7VA 5BNKA 3C2VA 4LV4A 3TA6A 1K02A 3EWYA 2CLMA 3SIZA 1VH7A 1HUVA 1FWSA 3DAQA 3GLCA 4K36A 3HG2A 1RQEA 5DLCA 1YLVA 2QCDA 1TYGA 2V2CA 2WQPA 3W7MA 4JDBA 3TAKA 1LRNA 1V7YA 5CSRA 4Q32A 1F73A 1TIMA 3MI2A 4WZHA 2J24A 4Z1AA 2WNZA 4OHQA 5EL1A 2RDTA 1I2PA 1ZY9A 4MYAA 3W7IA 5CPNA 3M5ZA 2V9DA 3GDTA 4TO8A 3QF0A 1LTDA 4HHPA 5AFDA 3TSDA 2E09A 1AL8A 4EF8A 3PWAA 3BLFA 4M6PA 3M41A 4QQ3A 2FQIA 3L0GA 1KFKA 2Q3RA 3GZ3A 1M6JA 3F1QA 3TXZA 4HNNA 2F7FA 3TX9A 2J88A 3BW4A 4FIRA 3MW7A 3O05A 2Y62A 4ZQMA 4LRTA 4R33A 3CHVA 4NNCA 2DZPA 4Z1BA 5HR6A 5D2XA 4JR5A 4AAJA 3LI0A 4H4IA 1SPQA 3VE9A 4IPIA 3NQFA 4JY9A 2FDSA 3NDOA 3IGUA 5AHIA 1PHQA 4FEZA 4XZ9A 2X1SA 3LRKA 3MYPA 1KTBA 4FO4A 3DHDA 1T96A 2YW4A 5J5DA 3WK0A 3PG8A 2X16A 3M1ZA 1OG0A 3S1WA 1TV5A 2FFCA 2A2IA 4MKNA 3UNDA 4HNUA 3W6YA 2DZSA 3QYQA 5G2WA 2E77A 1I2RA 3MP5A 1XM3A 1S5TA 3IRDA 2Q8ZA 3GVGA 2ISVA 4WXZA 3IVTA 3KHJA 2CU0A 2E6AA 2TRSA 1OFDA 1UJPA 1GWJA 1H61A 3DXIA 1R30A 5C6MA 3G8EA 5FF4A 4I7WA 3W73A 1T8XA 5D05A 3BG5A 3M16A 1TJPA 2VELA 5HUOA 3W1UA 1LYXA 3LRMA 1PS9A 2PC4A 3S8HA 1SO3A 3VE7A 1TPUA 4JICA 3G1FA 3UWZA 5CZTA 2CZ5A 5TQLA 4S2CA 1PIIA 3LBCA 1RPXA 2R91A 3WK1A 1CI1A 4UIOA 1P0KA 4JIPA 3DFPA 3M43A 4PTNA 2RFGA 4IOTA 1DQWA 1TQXA 2A6LA 3P84A 1IXOA 1JRBA 3A23A 4ONVA 4DF1A 3LB0A 3EXRA 4RZ6A 3OEXA 1F6KA 2WNNA 4TR9A 4GUHA 1KBJA 2VOMA 1YPFA 1EP3A 3U6WA 4CCCA 5DCDA 4IWWA 3USBA 2WKJA 3M6YA 4FNTA 1FCQA 3UWVA 4RJEA 5C2XA 2ZA1A 2YZRA 3PBWA 3NQAA 2EF9A 4BF9A 4R7JA 5AC6A 3WK3A 4JY8A 5EBUA 5L6UA 2QJIA 5CPLA 4TU1A 3W2UA 1ML1A 5AYXA 1VCVA 4K39A 5LNRA 2CLHA 3A5FA 3N9RA 4ZVJA 4UR8A 1LM1A 1PCWA 4YCPA 3L5LA 4HKPA 5D2YA 4TMBA 1XUZA 1GZGA 1O94A 5EMUA 4UTTC 4UNLA 3S5ZA 1SW3A 4IGHA 3P62A 2C16A 5E1QA 1YADA 3OVQA 1FDJA 2C13A 3HGRA 2QCHA 3KVKA 1O5KA 5K4ZA 1W3TA 1KTNA 1H51A 5DBTA 4HNTA 3QZEA 1A53A 3DFSA 4UTJA 3EXTA 4UUIA 1CW2A 3QH2A 1VR6A 3EXSA 4PL1A 3E0IA 3B4UA 5AHFA 3W7CA 3NOEA 4AWTA 4LUIA 1DV7A 2XN2A 2Y88A 1JQVA 1XBYA 3BARA 3RU6A 3KVLA 1TO3A 3NO5A 4UFJA 2VFDA 1WX0A 2E5BA 3CEPA 4LT9A 4CQ9A 3TXVA 3NYZA 4BWLA 2DZXA 1TSIA 1SW0A 3BGGA 4RZ5A 4HN4A 1Q6RA 1GYLA 4Z08A 3S5NA 1UB3A 3PB2A 1PVNA 1UUMA 1J5TA 1GVFA 5LGXA 4LVBA 4G1KA 4WUIA 1KFJA 3QC3A 4JYDA 4FB7A 3WJXA 3LHTA 3SGZA 5BMWA 1IGSA 1G4PA 3P80A 3KFTA 5LHFA 3TK7A 1W8SA 5I3HA 4LVGA 1LDCA 1BTMA 2J9XA 4A3UA 3EX2A 5TIMA 2TSYA 3TJXA 3CWNA 3W1RA 4CNPA 4K38A 1C29A 4KKXA 1XDMA 3B04A 4ZMGA 2I14A 1AW2A 1FUYA 2WSQA 4ORIA 4RV8A 3STCA 1G7UA 3SSJA 3HPZA 3TC6A 4M6QA 2NUWA 1K3UA 4UFHA 5MHBA 4MZ1A 1YDVA 1P1XA 4ZQRA 4BFAA 2QR6A 3UWUA 3LV5A 2GVJA 1H62A 3W7QA 3R8RA 3JS3A 4K6AA 5LNWA 1VQTA 3G3MA 1SR9A 1AW5A 5HR7A 5AC7A 3NL2A 1JUBA 3G22A 3A21A 3QFEA 3R89A 5D03A 3B0PA 4O52A 1HO4A 1L6WA 4BI5A 2CLEA 3P81A 3VFLA 4WXYA 3IVUA 3MHFA 1LZOA 2DORA 2W79A 3GNNA 4ML9A 4NJKA 3QPZA 4JDYA 4RKAA 3TROA 1VYRA 3ABRA 3V75A 2A6NA 1ZAHA 3G0SA 3SJ3A 3MYOA 4Y96A 5LKYA 1CX9A 5C5YA 2A5HA 2Y85A 3TAOA 2NUYA 2V5LA 4M5PA 3SECA 1OFRA 1U83A 2YSWA 1O5XA 3NQEA 3BO9A 5CSSA 4MFEA 3GR7A 1GVRA 3O6DA 4K8EA 2YDAA 3HMJG 2Z0IA 5DY3A 1DJQA 1NEYA 3O1NA 5DELA 1PCKA 5U7SA 3IGXA 2B7QA 3B0UX 2EHHA 4S2BA 4NUWA 2IQTA 5D2VA 4WJEA 3NGJA 1VJIA 3EWXA 3MBDA 1YXYA 3N3MA 4N9DA 1B3OA 1O95A 1M7OA 2I1OA 1KFLA 4DPQA 2BXVA 1GVQA 1HG3A 2ALDA 4MYXA 5F4SA 1ICPA 1RQBA 3CU2A 4WQ6A 3N73A 3OA3A 4FNUA 3W85A 3B05A 3NL6A 3DENA 1MSSA 3MBFA 1B9BA 3HIJA 3QW4B 4IXHA 1DQXA 4WY0B 1F76A 3S6DA 5EKYA 1DL3A 1EPXA 5HWJA 1FWRA 2R8WA 3C0JA 1TTJA 1A5BA 4FNQA 5J5RA 2XN0A 3STGA 3GKFA 1W5PA 3FIGA 1EX5A 4OU1A 1KM1A 4X2RA 2KZHA 4U4MA 6ALDA 2ZZ6A 4GUJA 1L9WA 1VYPX 3L5MA 2ZA3A 4RR4A 2W6RA 1MEWA 1W5OA 4O19A 2VENA 4UMBA 4IMEA 3HPXA 4N2YA 2QCMA 5F4XA 1Q6LA 3UY7A 1P5BA 4OWGA 4TMCA 3M0ZA 2E5CA 3LCFA 3GAKA 3Q58A 4FIQA 1E51A 3GB6A 4J9JA 1TPB1
chains in the Genus database with same CATH superfamily
5CZKA 2QXWA 1DWJM 2WO5A 1AMYA 3BLKA 2I16A 3CO4A 3RLGA 4WLCA 5LIUX 1ISYA 4FHAA 4RE2A 3VM5A 1O68A 3W7DA 1QRQA 1N8WA 3VM7A 1E4NA 3NXFA 2X0YA 3TH6A 1LORA 1U33A 4WD0A 2OO6A 3Q2DA 2ZE0A 1L6GA 4X2PA 4KCUA 4KERA 2WKGA 3DFQA 3A4XA 2BGQA 3BJTA 2QCCA 4GD0A 2CZFA 1DE6A 2GSHA 3I4KA 2O55A 2C71A 3SUVA 1YTKA 1ZBVA 4ZODA 1XBVA 4O12A 4NG3A 4DY1A 3W1NA 1VFUA 3KTCA 3AZTA 1PE1A 4IXXA 3W7PA 4G6CA 1S38A 3AYSA 4EXQA 4HSOA 3C2EA 5DMYA 1ZALA 2BS9A 2ZYFA 3SURA 3MSGA 3PF3A 4GXWA 1LWIA 1UD4A 3E5PA 2ONEA 4ZO9A 4PMRA 3W3OA 4O1EA 3IV8A 4IF2A 1G01A 5ENLA 5AVHA 2FZ9A 2Z2UA 1G67A 1QASA 3WJYA 2VWSA 4UR9A 3CZGA 3AJXA 4YHGA 3I4EA 2PE4A 1OK4A 3NVTA 2E6DA 1KA9F 1TZ9A 1BAGA 5CLTA 2BOFX 3IAQA 3UCCA 3UW6A 4XIAA 3QKZA 5CKSA 1FH7A 4NKCA 3HJZA 3SM0A 5E6YA 2NXIA 3ISIX 5ABGA 2IW0A 5JUVA 4NT0A 3VILA 4L4LA 4Q4OA 3VMPA 3LCHA 3I6RA 4CN6A 4RXFA 2OCZA 4P7OA 1B2YA 4JIIX 1KR1A 3TLLA 4PMYA 5CZ0A 1IWPA 4XZLX 3L4VA 3MUIA 3PNUA 3EB3A 2J8FA 3D5HA 4KPLA 3F2CA 3UYCA 4PMNA 1EDQA 4IG2A 2QUUA 5FEXA 2YFOA 3UYIA 3ABQA 3G0UA 3GDRA 4KCTA 2HWGA 1W5MA 3TEVA 3K8LA 5K9CA 3UZWA 1IEWA 1KLYA 5C7VA 3TN3A 3S2JA 4L56A 1RP8A 4I7VA 3LM7A 2VCBA 5EPDA 1SO6A 1VYSX 4PUEA 5AHEA 3N6HA 1IEIA 2CLPA 4HK5A 1OFBA 1UG6A 5J8LA 2NXGA 3TW7A 3NEVA 4MADA 1EX1A 4XVDA 2A1YA 2OO0A 2ZKMX 1QPKA 1QHPA 4WGXA 4AIEA 1WAWA 3PVFA 2XM2A 1OC6A 2PLJA 3WLQA 1R0MA 5LA0A 4IPLA 3FHAA 4ZL1A 3T8LA 5BXRA 5REQA 3NGFA 4J3XA 2FHBA 2W0UA 4ADTA 4KMQA 1CGUA 3LI1A 5JMUA 1IV8A 2PRHA 1V77A 2OMAA 1I45A 2Z1XA 1J4EA 4XD5A 3TA9A 1KC7A 1PZ2A 1KQYA 5E5CA 4GIAA 5CEWA 3DEQA 4ZXOA 4H8VA 1J0KA 2J79A 4PTDA 4AWUA 3TYDA 3V1PA 2PP3A 3WLIA 5G2HA 4IFRA 4KRZA 3L4WA 2OB3A 3QTGA 5DN1A 4D6JA 4RDZA 1GEQA 3MZ2A 4QGCA 3U2CA 3VGEA 3SCVA 2OWWA 3CIWA 1RPKA 3SFKA 4PEKA 4F2UA 2VEPA 5G1YA 3ZJ8A 1QK2A 1W1A1 4MY8A 1XIGA 1D8WA 1ZAJA 3AFBA 1HVQA 1IIGA 1WUFA 4F0MA 3NO3A 1RALA 2ASHA 3TC3A 3GO2A 3D47A 3WNPA 3NZPA 1XLLA 3Q67A 1BWVA 1JCNA 1SR0A 4CKQA 4ES4A 4D6DA 3ARYA 1PYMA 4PTMA 4G8TA 1O66A 1S1RA 2XN1A 3M07A 2GSEA 1XD0A 3W07A 1SUXA 1PAMA 1WCGA 1F2JA 3A6OA 4ZQCA 1VCGA 4MDOA 1Q4NX 1MUMA 5C7HA 3WIJA 1GQIA 2VL4A 4QLLA 1R7OA 5G4WA 1O5QA 1GOXA 2NV1A 3RJXA 2DPEA 3OBKA 4AH7A 3L9CA 1SO5A 5EMKA 1WPCA 4Z2LA 2VC5A 3P6LA 5IFTA 4ZCWA 1LL4A 2G97A 1MWOA 1XYAA 5GJMA 3P8IA 1S1PA 4PB5A 2ZOXA 4OOUA 4F2BA 4ZOCA 4DYKA 4MPKA 4N9EA 2QGYA 1V03A 4LAOA 2YW3A 3RLUA 1O6IA 2GJRA 3L7RA 1NH6A 1ZBWA 3E0FA 3FHQA 4HOZA 1I4NA 1MZRA 1Q7ZA 2F61A 2E9MA 1VFHA 3TYAA 1WQ5A 3A24A 1VEPA 1XH0A 2PDYA 1I2OA 4PFMA 4XO7A 1JZ5A 3NQGA 1DP0A 3WD1A 2CWNA 4M29A 4NL1A 3N13A 3HFTA 3A9IA 4DAIA 3IJ7A 1IEQA 2TODA 4TTUA 4LVDA 4NJIA 4ZOBA 3A5VA 2FFIA 3GKAA 4BQ5A 2IKGA 3LGEA 2H6RA 1KBKA 1JL8A 1H1YA 5HPCA 1HNYA 3AQUA 1GGOA 5BOOA 1VPYA 1FWTA 3AISA 2PDJA 1UH2A 4MB5A 1A50A 1PTDA 1RVGA 4JIRA 3BTNA 2GWNA 1IIHA 3SQLA 1QPRA 1GCYA 3DERA 3ABXA 1SYTA 2PB1A 3KCLA 3LMZA 3QR3A 1XLBA 3GHTA 2JEQA 2R1NA 3UA4A 3ZIZA 4DXKA 3S83A 1UASA 3QV7A 3T08A 3QBUA 4B92A 2HK1A 4MNMA 1VPXA 1ZSXA 5F2LA 5HNTA 3CUIA 1R3TA 1H3GA 4PB4A 1KRAC 1CCWB 3HBLA 1XYBA 3M44A 4NXKA 5LIWX 3QC0A 4UTLA 2JBMA 1SSGA 3WBYA 3W84A 4NNBA 3N34A 1H7PA 2ZUMA 4CCDA 4BQ3A 3ARVA 3F03K 2ZRWA 3MU7A 3OPSA 3DGBA 2WJDA 2Z29A 4LAZA 1V8EA 4NZ4A 3P0XA 3T0DA 3D3AA 2ZZ1A 3FK4A 4ZZ9A 5DMNA 4V1XA 3W02A 3P74A 4EPDC 2AOSA 1V08A 3TYCA 2PWEA 3SW6A 1E5NA 4HU0A 3PG9A 4MLJA 2ISDA 3GR4A 3HURA 4WDTA 3NQ8A 3OOQA 4GCAA 2GYIA 2G5WA 4B2DA 1V7AA 1DXFA 5AZ0A 1H7OA 5LNUA 3E0LA 3H2FA 4NYUA 4O1CA 1QVBA 2R24A 1DHKA 5K9DA 4GACA 3HOJA 4CNOA 1KBLA 3QHMA 3UJRA 3E9AA 5CPSA 4CD4A 1EGZA 4GXPA 3R2GA 2GGIA 1GYMA 3RLHA 1TWZA 4XTDA 3UZZA 3GXTA 3CWHA 3USZA 3W28A 4ZQNA 3ITXA 3KVJA 4E8CA 3AMDA 3KOWA 1Y65A 4OJYA 1QATA 3DCPA 3II1A 1DJZA 2ISFA 4J3UA 4XD6A 3S2CA 1ECQA 3DN5A 2XVLA 3WFAA 1RVKA 1S5VA 3LTYA 2JIEA 4KWVA 1GOWA 3NQDA 2WZHA 3NQ7A 1UCWA 1AQ0A 3HGSA 5FOOA 1V6XA 4LOCA 4ZO8A 3EBVA 1UZHA 1BFNA 1UA7A 3HTWA 5EMJA 3FYOA 3LLDA 4LNCA 5F1VA 3HPFA 4QAWA 4JTCA 1Q3NA 3U7BA 4B5SA 3GSMA 1RLCL 2WHJA 4Q3MA 3AHYA 3I7QA 3S47A 4GC4A 2EG8A 3QSTA 4O10A 6XIMA 2VVNA 2VXNA 1TE1A 4FF5A 4J3VA 4XBSA 2ZUTA 3LEPA 5BOFA 4W9TA 5DANA 2RDXA 1OGSA 3GNXA 6XIAA 3WUBA 3SUTA 2G3MA 3H24A 1TWWA 4C6MA 1FWIC 2CW6A 5PTDA 5HINA 4TV5A 4U3CA 2IPFA 4DAFA 3UQNA 3EX1A 1UQZA 1A5KC 3NL5A 4GC3A 3S5YA 2E8YA 4AZ5A 3S46A 1BF6A 3GXNA 4PSRA 1J01A 1UUQA 5C9XA 3RDKA 3QMTA 1L8PA 1QW7A 2J27A 4BA0A 4I5UA 5C9ZA 3IJ9A 4HGXA 4F79A 3TU9A 4F2TA 1Z6KA 4XQ6A 4XWUA 2R1MA 3H7RA 2FGBA 1G9HA 1C3FA 2HQAA 2E67A 4HJFA 5E0KA 1XISA 4EVZA 3GUGA 1CWYA 4UOJA 4MVAA 2DEPA 2ISWA 2FTYA 3CUGA 2JF7A 3ZJ6A 1N55A 4AXNA 4HA0A 2V81A 4XB3A 5I78A 1PUDA 4Q6XA 2ALRA 4O8AA 3WEMA 1XUUA 4C91A 3OQEA 1I9CB 3HGOA 2HMCA 3PSVA 4UTTA 4QTGA 1HGWA 2ZRVA 7ODCA 3PAOA 4FK9A 4CQDA 3B8TA 2R82A 3EMQA 4P61A 3TTOA 3GDBA 3BAWA 4OUIA 4HU3A 4MTVA 3NIYA 3JW7A 3BURA 3OVRA 4B5XA 4YMZA 1ZBCA 3CHCA 2QUTA 4F9DA 4W8BA 5HMEA 3R0KA 1HFBA 2D2OA 4Z2HA 3MWAA 4ADUA 1EOMA 3ZO9A 1PXGA 4S38A 1VPQA 2BOEX 2WHKA 4UC5A 3WJZA 5F4WA 5ABHA 4ATDA 4TUFA 4AVNA 5BMXA 1C90A 2DIKA 4O14A 3FEQA 3VNKA 2Z1WA 2HNHA 4YXGA 4IQLA 1FWWA 2HTMA 4QITA 3UR5A 5I3FA 2A3LA 1KXTA 3WJSA 2HEJA 1WAUA 2I7GA 4FMVA 4BK9A 2Y7DA 1TCMA 3TSMA 2G3JA 1SVDA 3KTSA 4I5XA 2G3FA 3F5KA 1S46A 4KRUA 4F8XA 3PY2A 2BDQA 3O16A 1E55A 6REQB 1FA2A 3STPA 1UBSA 1G1YA 3NTYA 1CB7B 2P8BA 1L2UA 1HO1A 3CNYA 2EJ1A 5G2IA 4E8GA 3MKVA 2C8NA 1AZ2A 1KGWA 4GYPA 3KXQA 5F2IA 1QNQA 2YYTA 2XIQA 4BR1A 1V93A 2PDFA 1NF0A 1C93A 3EEZA 5G4HC 4WJXA 4GJ1A 4LGXA 5DXXA 3POCA 1TR9A 3UXDA 1YDNA 3ABSA 5HJLA 4H7VA 3LGDA 3AO0A 1QNRA 2PI6A 1Z8AA 4Q22A 2DZWA 4PB3A 5JBEA 3CPUA 4US6A 2DSZA 3GC2A 3QFWA 3VCCA 4MJMA 1XLCA 2BFGA 3LMYA 3W01A 4BQ2A 1K8ZA 1G4TA 1TPEA 1BGAA 3QV9A 3GFYA 4R5EA 2VGGA 2C3ZA 4B9ZA 3GXDA 4GKTA 1U5VA 2DU2A 3SUWA 4PA8A 4Q8TA 4WX2A 1JD7A 2XVGA 2MANA 3UERA 1G4EA 1VKFA 3GDMA 1MNSA 1W9DM 1A4LA 1RK6A 4C6IA 3MUCA 4GI8A 2VRJA 3T0CA 2DW7A 4CEXC 4ZO7A 3MCNA 5D4YA 4BHYA 5G4EA 3B9AA 1R3VA 2PTDA 2QCGA 2YCEA 4MNJA 3N2TA 3VDAA 4IIHA 3OG3A 2GQ9A 1QFEA 1JCTA 2YBVA 2OEJA 4MOZA 3E5BA 1SO4A 1WO2A 4C6NA 4IMCA 1XDLA 2YGYA 3W7JA 4D6EA 1IWBA 4LS1A 1LRTA 1TZZA 2FMNA 2ZRXA 1EEPA 1GK8A 5CXPA 2D0FA 2PURA 1S2AA 1B4KA 1OCQA 2XWDA 3NURA 2X09A 2A4AA 4A3YA 3DHFA 1C8YA 1H1ZA 1EBGA 4AZHA 4A8NA 3KBNA 2HVNA 1D8CA 2HE5A 2CYGA 3OLGA 4INFA 5AN7A 2J62A 3GXPA 3LHZA 2YA0A 4C6FA 1H0GA 2OKTA 3EZ4A 4JX5A 1ME8A 4MIMA 5M3WA 1XLAA 1OIMA 1QT1A 2Y5JA 3KOXA 3WYZA 1RUSA 4XZMX 3UR7A 3KLKA 5I7GA 2YL6A 4GYPC 1OFPA 1NQKA 4PMUA 5HA7A 1M01A 4H3DA 3M6DA 6ENLA 3G1HA 3DUGA 4B3ZA 1CEOA 1CB2A 4JFTA 3EWZA 1SFJA 2ZWYA 3IIZA 3L66A 2GUUA 3A3WA 2VUNA 3L23A 6A3HA 4OQVA 1XLMA 3M0YA 2IKIA 4MFDA 3FNDA 2AAMA 3R11A 4AEOA 5KZMA 3CO8A 3WDHA 4QNWA 1QWGA 3BOXA 3CTLA 4W7WA 4NZCA 2HBXA 3LZ5A 3ALGA 2B81A 4WK9A 1GZ1A 2FB2A 4E2OA 4DWSB 3NM3A 3VD7A 3RAOA 5D37A 3B03A 1WV2A 3U4AA 4KW2A 3HMCA 3GTNA 4M6VA 2POTA 1TPFA 3MMUA 1KGUA 3DECA 3BGAA 3NQCA 2C0HA 4JYEA 4BJHA 4QBXA 2VRKA 5CJ5A 2HJPA 2HISA 4W86A 1HKMA 5FD0A 1OWQA 3ZYZA 3BCDA 1QPNA 5D2TA 4LF2A 4UTMA 2ABAA 4V2XA 2QKFA 3CUFA 2WW5A 4KGJA 8TIMA 3DG6A 1JF5A 1EH9A 1QW8A 4PMQA 4LS2A 4NASA 5CSYA 5I2UA 1UHVA 1F3WA 1M53A 4OVXA 3T81A 3HV9A 5F2MA 3R13A 4O0KA 5D9OA 3GG8A 1H63A 3VIGA 2O4MA 1QPQA 2QF7A 1KB3A 1NJJA 3R1ZA 5G5IA 3W1AA 1UP0A 3WD0A 3WX7A 1VC4A 3QV6A 4X3ZA 3UXIA 4YU1A 4FA3A 3M0HA 1RCOB 3VIHA 5GJPA 3E2RA 4KRTA 2VCCA 2ANUA 2OGYA 4I9MA 2X42A 1L0PA 2I9EA 3WQ4A 3WKZA 4AD5A 3T2OA 4OBSA 1OCJA 2MNRA 4M19A 4PRTA 2PTZA 1V79A 1AD4A 2WCGA 2W27A 3AXXA 1EJXC 2BLEA 4XZNX 4A21A 2HRWA 2J7GA 5BXTA 4RPQA 4Z0SA 1D7FA 1K8CA 4O11A 1JI2A 3LG3A 4DWDA 2BHZA 1Q65A 2A7PA 3WUEA 4UFIA 3BAKA 1ME7A 2XM1A 3BLOA 3P14A 2NWSA 4UOQA 3PUEA 1RR2A 1JPKA 1VIWA 2WV8A 1G7VA 3C2VA 2ZC1A 4LV4A 3SUUA 4P8VA 1K02A 1IEXA 3XIMA 4AG0A 1VH7A 1PO9A 2PGEA 4K36A 3VIPA 1PKLA 2V2CA 2WQPA 4JDBA 5CSRA 1I75A 2V6AA 2OEKA 3UNTA 4OHQA 5EL1A 1I2PA 3W7IA 4US5A 1R9YA 2V9DA 4EPEC 2HPMA 4ERIA 3FSTA 3NSMA 3TSDA 4PTWA 2PU0A 3AXIA 4A35A 1PX8A 4M6PA 2G37A 3LD5A 3PZTA 3M41A 4QQ3A 2FYMA 4FLRA 1KFKA 3GZ3A 1EO5A 2W61A 1M6JA 4QRNA 1XSKA 2F7FA 3VFCA 1SFSA 4H9VA 5IDIA 1PZ0A 2ESCA 3O05A 3CS2A 4IMAA 3CHVA 5J04A 5D2XA 4HA4A 3MSDA 4QROA 2EEXA 2OZ3A 4LYPA 5EMMA 1DQUA 4IPIA 3NDOA 5AHIA 2GWGA 4MNLA 3V1HA 1B3YA 4GG9A 1PKMA 1ESWA 2YW4A 1GOKA 1CXEA 3SN0A 4A8LA 4NF7A 5BRPA 3GE7A 4DZ5A 1OG0A 3S1WA 1GKQA 2A2IA 4MKNA 5E9AA 5FJOA 5G2WA 3VKCA 3FY1A 4WXZA 3KHJA 2CU0A 4AD2A 4RNJA 1R30A 2VUYA 2YCKX 3G8EA 3W73A 5H8MA 2PDHA 1QBAA 3M16A 1TJPA 2VELA 5JIPA 1PS9A 1RJPA 4HTBA 3S8HA 3TYBA 4H9XA 3AU6A 2OU4A 2CZ5A 3PHAA 1PIIA 3WK1A 1TMQA 5FJJA 3R58A 5LIXX 4PTNA 5A6LA 3MO4A 4O0QA 5XIAA 1AUSL 2QLYA 3B8VA 3A23A 1W32A 4IGSA 2X41A 3H26A 4GMEA 4RZ6A 3N6QA 1OB0A 5C0QA 2AGTA 1JDAA 3SY1A 3U6WA 4TVCA 1KNWA 4L9XA 3M6YA 3UWVA 5FSDC 2EF9A 4JNYA 1J6OA 4BF9A 3SB0A 2C1IA 3CB3A 4JY8A 2D20A 2HDJA 1ML1A 4K39A 2Y8KA 3SCRA 3N9RA 4ZVJA 3ZLGA 5JQ9A 5FJIA 1W9PA 4L64A 1HJQA 1XUZA 1GZGA 2ZXQA 1QUMA 3P62A 2C16A 4D71A 1YADA 3BAYA 3BV7A 3HGRA 3KVKA 4XX6A 4AIBA 2D2HA 1H51A 2DGAA 3T2PA 3WUFA 5AKQA 4YVVA 4PUJA 8RUCA 1RHCA 4PL1A 3E0IA 3B4UA 5AHFA 3TWAA 4AWTA 1JPDX 1FKWA 5AECA 1DV7A 2XN2A 2C1GA 1JQVA 1T41A 1F8MA 2PEVA 3MPGA 1V02A 1CXKA 1OT1A 3GU2A 1MXDA 4BWLA 3BGGA 2W3ZA 2W63A 3OTRA 2WNWA 1EJUC 3PB2A 3EDEA 1PVNA 3GW0A 4QQUA 5CQ1A 1MRQA 4LVBA 3V36A 4WUIA 3U2EA 2YXXA 2X0HA 1F6YA 3KFTA 1E1CB 5I3HA 1SMAA 5E9XA 1XJBA 3AJ7A 1UKQA 3NQBA 4OOZA 1XLHA 2EG7A 4ZMGA 2I14A 2J8TA 1DIOA 2WSQA 4ORIA 3H70A 2F6UA 1S2VA 1XD1A 4YTRA 5MHBA 2Z1KA 1BYBA 6PTDA 3CZJA 1H09A 3CHFA 1EHNA 4ZQRA 2PPGA 4LFYA 4A3RA 3LV5A 3R10A 3T09A 3W7QA 4XK2A 3VOFA 3PK7A 3H7VA 3OGVA 4DXXA 3RO8A 1SR9A 5HR7A 1WUEA 4KT2A 4B15A 2Z1SA 3G22A 2CEQA 3ZZ1A 1EC9A 3B0PA 3IJ6A 2I17A 3OHMB 4A05A 4MG4A 4IZGA 4BI5A 3LSBA 3WNMA 5MF5A 1BPLB 3VFLA 3U5YA 1LZOA 2W79A 4C6QA 3QPZA 4JDYA 2A6NA 4QXIA 3SJ3A 3MYOA 5I00A 4H83A 2E0PA 4QE4A 5I6SA 2V5LA 4W88A 4EXBA 1RCQA 3SECA 4B2DD 2V5CA 5A94A 4FPSA 1O5XA 5CSSA 5CC6A 4MFEA 1NWUA 3GR7A 1GVRA 4GYFA 2OZTA 4K8EA 1QI4A 3CT2A 3A4AA 3HMJG 3WMLA 4UWMA 1XRVA 1PCKA 5U7SA 2B7QA 4H01A 2EHHA 5DF0A 2IQTA 4ICMA 5D2VA 1VJIA 3EWXA 4AIUA 3MUZ1 1S2WA 4N9DA 1B3OA 2I1OA 4FOUA 4RL3A 1XLEA 4YWSA 1UZ1A 2J7EA 4WKAA 3N73A 2OLHA 1U1HA 3Q45A 2FVMA 3OLIA 4B5TA 1J2BA 3MBFA 4WY0B 4AW7A 3S6DA 1DL3A 5HWJA 2R8WA 2BG5A 3LUTA 3GKFA 4NAFB 3STGA 1W5PA 1XWYA 2WBKA 1JZ3A 4OU1A 2OQYA 4J3WA 2OQLA 3ZR5A 2KZHA 6ALDA 1A5NC 3KEHA 1Y8BA 4YTSA 1IZJA 3V0TA 2ON3A 4Y9PA 4CEUC 4GVFA 3V3WA 4O19A 2VENA 3BCFA 2DUAA 3SCWA 3M0ZA 4IFKB 2E5CA 3Q58A 1E3ZA 3MC5A 3L4XA 3RPMA 4J9JA 3ERPA 1TPB1 2VEGA 3RNDA 4AZCB 4RZ4A 4JQ4A 2OFJA 3S2LA 4AF0A 4F40A 3T05A 3UCQA 2E4TA 3THDA 3GDLA 3NZ1A 4H2HA 2HS6A 1JRCA 3CK5A 2CETA 1SW7A 3MZNA 4GO8A 2INZA 3WNNA 2VR5A 4UNIA 2EXOA 3PBVA 5A6BD 3PM6A 3T44A 3MKCA 3AIWA 1QNVA 5BXPA 5A6AA 4DELA 3UXAA 3A3XA 1HX0A 1JFHA 3HG5A 2TPSA 4OTKA 2O9RA 1EJRC 4RW3A 3MI3A 3VO0A 3MUY1 3N4EA 5CPQA 3Q4DA 1HKWA 1U22A 3L2MA 1LJYA 4AEEA 2GUYA 1DIKA 2ZX6A 3LBOA 1RZMA 2CBVA 3TCEA 1E9ZB 3W7GA 4R7WA 1ZQ5A 5I3KA 1NDYA 9XIMA 3DIPA 3HM7A 3BE7A 3NL3A 1CLXA 3PPFA 5B7YA 1UJQA 4YS1A 4AXKA 3GYEA 1XRSA 2W92A 4MF4A 1KM3A 2PF0A 3AWNA 5HOSA 2PS2A 3PANA 3ARQA 3IJDA 2G4JA 1OZQA 2VQUA 1PV8A 4N02A 1M7PA 2VKZG 1IWAA 1ADSA 2YCLB 1TMHA 3SRHA 3EKLA 3S0CA 4MDPA 4EWJA 2A0NA 2GJNA 2WXDM 3WELA 2EKCA 4K37A 3VTRA 2VEMA 2YBUA 1TX0A 4N6FA 2QIWA 4DJEA 3V35A 3GR8A 3RCMA 4DIAA 5CLWA 4PMZA 4HZMA 1JQXA 3ECQA 1WDSA 4GYKA 1XBZA 3SR7A 4O28A 2QYGA 5IRPA 1PKNA 3BJSA 1X7FA 2AAAA 1T99A 3ANYA 3ID7A 1WDDA 3RN6A 2NQJA 3WQGA 4J4KA 3PB0A 4O1BA 3AXMA 2VM8A 4FX8A 1I0DA 1LWHA 4ZQPA 4BS0A 1OINA 1RD5A 4H41A 3GX9A 1OZMA 3R4IA 3IGHX 2PGWA 4EF9A 3C0LA 3RF9A 5HPOA 3QEZA 4XKYA 3ITTA 1W0MA 1CDGA 3EAUA 4HD5A 4DXVA 2B4GA 3W7RA 3K13A 4ZB0A 3NPVA 3WFLA 1TTIA 3TDFA 4LB3A 3O2LA 4FI4A 2J7FA 1W1ZA 3HO8A 1V6WA 4LB4A 1NY1A 3VINA 3OJGA 4L61A 4Q8QA 2JE8A 1WXJA 1W1IE 4JIEA 1X98A 3TR2A 4QDMA 1EYEA 4KWOA 2GK1B 2X0SA 1A5OC 4LH8A 4NNAA 1TV3A 5AOUA 1UD8A 2F2HA 5IHRA 1VCFA 4ORMA 2PAJA 2WB5A 1QAPA 5D30A 4Q8WA 3K8MA 5LGZA 1J79A 3GH5A 1EWEA 2PBGA 4GNJA 2B7PA 1ZFJA 3B0YA 4XTIA 3S4TA 4DZIA 3LLFA 3M5VA 5RUBA 4UCGA 1IHIA 3EWUA 2Q02A 3DFOA 4BEQA 3CQIA 4MUPA 2OQHA 5I3JA 2PCEA 4UFMA 1P7TB 2OJPA 1BQCA 2WM1A 4OGZA 3WQOA 1GORA 2V5KA 4K8GA 1UIPA 1K03A 2CESA 4UTIA 1SFLA 1MFVA 1XICA 1D3CA 3LHYA 2X8RA 4M56A 3H55A 4A3HA 4DJEC 4L4PA 2V2DA 1B31A 3W37A 4FX7A 4W4QA 3MA8A 1F9CA 4FALA 3EYPA 4LBUA 3K4WA 4H7ZA 4HJWA 3BZJA 2G4FA 3L68A 3A22A 1XCXA 4GHRA 3BLLA 4OUEA 4PGLA 3EOSA 5DT7A 4B3LA 4O18A 2C14A 2QS8A 1R47A 4Q4QA 1R9XA 4XUYA 2CBIA 3MCOA 4Y9OA 5D38A 1AH3A 3M5XA 3R0UA 1J9YA 3GM8A 2HSAA 3U3HA 4WJ8A 1FHVA 2XIOA 1W3IA 4JFWA 5JVLA 3E12A 3SI9A 3WNLA 1MEIA 1OFOA 1E9LA 4JQ1A 1JDCA 4PUKA 2OSYA 1XIJA 3UG5A 3NJ3A 3MP4A 1U2YA 4BEUA 4GQQA 1VAHA 4GVIA 1AODA 1GG0A 4TOQA 2G3NA 1EJVC 1REQB 5K7JA 3NQ2A 2ZA2A 4LC6A 1OVDA 1DWAM 1JCYA 3G3DA 1E1CA 1W5QA 1R87A 5AHMA 2BSLA 3UG8A 4MPQA 3VGBA 3W82A 3POHA 4DJFC 5CAKA 4Q8OA 1W2VA 1WZMA 5IM51 3STFA 2XTKA 2HVOA 1K4HA 2UZ9A 1ZNNA 3QQ0A 2ZCGA 1DYSA 4RX0A 1Z7AA 3DFNA 2WVUA 4JTTA 5FF3A 3T4CA 4KWWA 1QNPA 2A3CA 4Z2IA 1CNVA 4ZSTA 1R9ZA 1W2PA 3CH9A 4E2DA 3BG3A 4DF0A 4H8UA 5FSEC 2HVMA 4GXMA 1MW0A 3IIVA 2X1IA 1FHLA 3V0UA 1NDVA 3BC9A 2WCSA 1DXEA 3LZ3A 1ZJIA 4PTVA 1JXJA 3GNPA 4PC8A 1SZGA 2E68A 1YBQB 1A49A 4JFVA 3AYRA 5IBXA 3L2LA 1UKOA 2J8GA 4UBPC 1KTCA 3P60A 3ANVA 2E5DA 1J8VA 4PZVA 2Y61A 2EPHA 5CBJA 1NIUA 4K8HA 4KIEA 3FEMA 3V16A 4IL0A 5M5DA 2Q01A 2X2GA 1J6PA 4XAYA 1Z44A 4QFUA 1UKPA 4AYSA 4OE7A 1M7JA 3WLHA 2B7NA 3FJLA 4IQEA 1ITXA 4LS0A 4AX7A 3G6LA 5A8QA 1EDGA 3G1VA 1P6WA 3IANA 4S3FA 2EQDA 1HJVA 4V33A 2P0OA 4Q8NA 3P61A 7ENLA 4DBSA 3LPFA 3GZAA 4HIBA 3TW6A 3SBFA 2HXUA 2NLIA 3PZUA 2RDUA 4RV3A 3WQDA 1SZRA 4WHBA 3I3DA 4CQ8A 3W70A 1R2SA 2V3EA 1VF8A 2Q8XA 1L6SA 4WY0A 3PTDA 3DESA 4MAVA 3SCNA 3ZM8A 2H90A 1XRTA 2NT0A 1TWDA 1ZGDA 3MP3A 1PHWA 3WDIA 3ENLA 2DJLA 4IUGA 3CL6A 1UWUA 2VZVA 4NX0A 4HK6A 2QDGA 2YBTA 3OVPA 1NDWA 1WDPA 2O7QA 3QZAA 4ZR8A 1D2KA 5K2ZA 5T9BG 4UMCA 3ONCA 1TJ2A 2NVCA 3F4CA 2FVKA 5HDRA 2Y63A 4IFKA 3U7VA 2A85A 3QTPA 2ATSA 4CD6A 1Q45A 4AZCA 3H53A 4UNKA 5TBOA 1WYIA 3C2RA 2BASA 1KFBA 1JUEA 4REQB 1MQRA 3BSHA 3NOYA 1XIEA 1Q2RA 2ZXBA 1EUNA 3RPTA 4KFNA 3T2QA 4HU4A 5FJRA 5FF0A 2ZUSA 2E9LA 5IBXC 3KRSA 3E6EA 3U57A 5EY5A 4DUWA 5LIYX 3PTQA 4LANA 3VPLA 2FIQA 1UQYA 4O15A 1FWBC 2V69A 2YIHA 3AS3A 3NQVA 3SGGA 3WG6A 1E6PA 3VIOA 2CCRA 1W9BM 4MKSA 4B9YA 5KZDA 1HL8A 4Y6GA 3H4XA 3KDNA 3LQLA 5HK4A 1LQAA 1F07A 3LYEA 3GAYA 5LYRA 3N15A 1UIOA 4V27A 4MNKA 3NZGA 3ALFA 3UZYA 1OIFA 1R3WA 4H6QA 2WVSA 1YE6A 3JZEA 1B57A 1Y5XA 4LY8A 2YCLA 4E2VA 4C6JA 2BY3A 4IISA 3LK6A 3FJ4A 4QR6A 2PRMA 2NUXA 2FPYA 1AQFA 3W2LA 4GK8A 3M0XA 2J25A 2H8XA 1UWTA 4F0KA 1P1MA 5LA2A 1JZ8A 3G5EA 1Y5VA 2O9OA 4HMNA 4CGTA 1JGIA 1W17A 4FNRA 2ZTKA 4NXSA 3H12A 5DCBA 3VNDA 3E74A 3R8GA 2FGLA 3GVVA 3W1XA 3OQ8A 1DPMA 4S3AA 1F5ZA 1LT8A 3GNOA 5FI8A 1E6NA 1DKWA 4MM1A 2JK2A 2YJQA 4XAZA 4FAMA 1KV5A 4Z2JA 4AZ7A 1ODUA 3BGJA 3N9KA 3EOOA 1T0OA 2X05A 3VIKA 2QCDB 3CL8A 1UC4A 2R1KA 3MANA 3WLRA 4N9CA 3F2DA 3NAVA 1S5WA 3PTKA 3N19B 3KL3A 3FVMA 1EWDA 4URIA 1W1YA 2YXGA 3M4HA 4CD5A 2CFFA 4C6OA 2P3ZA 3VIMA 1BF2A 1JCLA 1UKSA 1F6PA 4P7NA 1E6SM 5I0DA 4GRSA 1DE5A 2J77A 3C3UA 2YCIX 4ALDA 3VKDA 1DJNA 3XISA 1B9ZA 1N8FA 2IPWA 4Z1CA 3IPWA 3GFZA 3R0DA 2GK1A 1H7NA 2WSKA 3AUJA 3EB4A 4O53A 3MMWA 4W5UA 2Y70A 2PA6A 4QAIA 3M9YA 4M8UA 3WDQA 1AD1A 2XFYA 3ZWTA 4GVGA 1X6NA 3TN4A 1I2QA 2PDBA 1NWRA 3CL7A 3W1MA 1W5NA 4IG2B 3S1XA 1PWMA 3R5EA 3S9ZA 2FHFA 2Y24A 1H0IA 3ARZA 3VZXA 3BVJA 1KFCA 3W71A 2XG9A 1JAEA 4EPKA 1BLIA 1ZBKA 2CZDA 2EKGA 2PWVA 2DSUA 1Q4WA 3V5FA 1P7TA 3UWQA 4LUYA 4AHQA 1AVAA 1A0EA 1FWEC 1TELA 1TUFA 3G0XA 4GY7A 3PPGA 3TYUA 2XDFA 3PULA 1Y0EA 5K9XA 1WZLA 3OA5A 1JPMA 4FNSA 1BEUA 3ELFA 3QKEA 3NQMA 3WMCA 3URAA 3HZ3A 3TN5A 3KAOA 2JKPA 3MQTA 4FOJA 4GX8A 3VCRA 3BANA 1K7XA 4UFKA 3A13A 4JTDA 2EPOA 4AWSA 2ZDSA 5REQB 4ATLA 1ALDA 2Y89A 4ICNA 5JH1A 1TREA 3K8KA 8A3HA 2EPMX 5HMFA 1FDYA 4ZA0A 4JN8A 3HGJA 1F3EA 3GIYA 2Z6IA 2JQXA 3LPGA 4FLQA 2VTFA 5LSMA 4LAKA 3VC5A 3BWWA 1THFD 5I79A 1KM6A 5CZJA 3BSMA 1UBPC 2Z1BA 5H2ZA 1UH3A 3H22A 2EO7A 4GBUA 4AIOA 2WSYA 3WDRA 5JBFA 1CXFA 1AJ0A 3AYTA 3E38A 4HK7A 4JBRA 3J7HA 1H7XA 1J2WA 4CNSA 3NCOA 1REQA 3EOUA 4M1RA 5D04C 5CBIA 4S3CA 2VI0A 1B3XA 2QJGA 3BW3A 4IPNB 1SU5A 5A1AA 1NWTA 1DWHM 3NWRA 3Q94A 9RUBA 3G24A 4U28A 1JPHA 5A8PA 3CGTA 2P53A 2VC9A 3BUVA 5KINA 3VIJA 3B0VC 5EB8A 4I9JA 3SCQA 3QOMA 3QPYA 4FXSA 2EGZA 2XVKA 4Y9AA 2A3BA 3EB2A 2DZVA 3BICA 1HT6A 3LTPA 4WDUA 4EIVA 1GEHA 4LTSA 3S1VA 1GVIA 3PZNA 2I56A 3W6MA 3WUGA 5DQPA 1LBMA 1XPYA 4U2YA 2O7SA 2FKPA 2OZ8A 3DBNA 3PFRA 3DYOA 2WBGA 5HUPA 2XFRA 4ZENA 1WB0A 1X1ZA 3WBWA 3CHDA 2XJ7A 4X9YA 2FPVA 4DHGA 3HB9A 4JFUA 4I9TA 3UJEA 3W26A 3ATYA 1S39A 3WQ5A 3FDGA 3TTYA 3HG3A 2VFEA 3P5ZA 5FIPA 1HKVA 3SO7A 3W2NA 5A2AA 2G96A 4QDWA 1TTQA 1RD6A 5CC3A 1SJCA 2YYUA 4S3DA 5KZEA 2CHNA 4MHBA 3WF1A 1K9DA 1NAL1 5ABEA 3C6CA 1VLWA 2Z4GA 3RM4A 3KWXA 2QHAA 2PGRA 2FZ8A 4Y7EA 2ZADA 3B9OA 3WF3A 1G5AA 3VD4A 1QI2A 2Q6ZA 4D72A 3CB8A 2ZXDA 3F2BA 3QGAC 5CPOA 1GVOA 4KEZA 4ZXLA 5AYYA 1XKJA 2XGZA 4MZ8A 1ME9A 3SY5A 1VJZA 3LERA 3NXLA 4KWSA 3RCYA 2AQWA 2HXTA 3DI1A 2GL5A 4B5VA 3ARWA 3K1DA 2C19A 4Q4KA 3WCZA 3R8HA 1WXZA 2ZC8A 3Q65A 2X1TA 5A6SA 1TPVA 4DI9A 2TYSA 1XQKA 1TQJA 2FZDA 3O07A 4H19A 4JTKA 3CHEA 2QCNA 4NU7A 1AW1A 3A4WA 1ONEA 1NFBA 3LRLA 1RBLA 3FJNA 4QCEA 5D32A 5U4NA 5LNSA 1X6UA 2PDMA 2CPUA 3CH0A 1J10A 1GKRA 5A8MA 1F3TA 4DUXA 2W62A 1GW9A 2DT3A 1ICQA 1OYAA 1MEHA 3V7PA 3N17A 1AQHA 4P7RA 3LXBA 2W91A 3IJIA 1X39A 1W56A 1TA3A 4REQA 3MSYA 3CUZA 2WMJA 3PJTA 5FEPA 2CBJA 2ZRZA 1J12A 3KBMA 5ECVA 3PBGA 2FZBA 1E0WA 1KCXA 5HWMA 1YX1A 3C4UA 2NQZA 4PMOA 4XUGA 2GJXA 1XYFA 3M46A 2OEMA 3OHIA 1QDSA 5KZ6A 4C6DA 1FY6A 2F2KA 1W3NA 3TV8A 1RY8A 3MWCA 3ZT5A 4GIRA 1R3QA 3MO7A 4TX6A 4AB4A 3KOZA 1M04A 1SZEA 3FYPA 1FVPA 4JTSA 3DZ1A 4LEFA 1XLFA 5H1WA 4I7UA 2CHOA 1F4AA 4DEFA 4HCHA 3RX2A 2AGKA 2YOCA 3L2IA 3SSZA 4DO4A 5ECUA 4M80A 1T5AA 5A2CA 4M7SA 1M9HA 5A6MA 5BROA 3S5SA 3KX6A 3BDKA 4HN8A 1RXOB 1FP8A 4GJJA 1RLDA 4DJED 4A8RA 4R53A 3AI0A 5BW6A 5I5RA 3PUDA 2VZSA 1QU4A 4ZQOA 3QQWA 4JTUA 3A12A 1BG9A 1UWRA 5CCZA 1IE7C 2YB1A 3EWBX 1Q6GA 1Q85A 4DWSC 3LCXA 3PPHA 1JAKA 1B4EA 2HPIA 4HVXA 1W3HA 4L80A 2REQA 1LLZA 2FGZA 1YXCA 3G1AA 4ROPA 3SDOA 1B1YA 3ITLA 2RJHA 4EX4A 3PP7A 3HQPA 1QR7A 1A0CA 4UQ9A 7CGTA 2GDQA 3PJXA 1GZJA 1BSLA 4G9PA 1HJXA 4O54A 3OIHA 5AZ1A 1YW1A 3CUHA 1CT5A 4L5ZA 3IJQA 1RY0A 4YTTA 1KM0A 3VCNA 3LTSA 2PLMA 3VKBA 1PEZA 2AKMA 2QPUA 4RPPA 1E4MM 3GYCA 4UTFA 3TA6A 3ARTA 1I6NA 3NSXA 1V3HA 4IIGA 4PCTA 1WP6A 3EWYA 3O6AA 3VOIA 3H2OA 5BWAA 1FWSA 1GQLA 4XISA 3UBPC 1B30A 3HG2A 1RQEA 5DLCA 1YLVA 2QCDA 2EPLX 4XVEA 3H6OA 3LU2A 1V7YA 3MMDA 4Q32A 1FFRA 2DDXA 1TIMA 3HA1A 3T0TA 1S2CA 2RDTA 2D0HA 5CPNA 2OWXA 1QJWA 4HHPA 2E09A 1V0NA 1AL8A 4EF8A 3CASA 4DJFD 3NO1A 1HXJA 3L0GA 3VX0A 2XSAA 1GPFA 3AXKA 3TXZA 1KCZA 1KGXA 2E25A 3B0XA 4NIRA 3TX9A 2GGHA 3BW4A 4WDWA 1W9UA 1E9IA 4LRTA 4R33A 5C9UA 4NNCA 4I90A 2QULA 4Z1BA 2GGEA 5HR6A 1CZ1A 4NY2A 1J96A 3XINA 3APYA 4H4IA 5BXSA 3QN3A 4QEEA 3B8SA 1ITCA 4A8IA 3O7UA 1W8GA 2PDLA 4JY9A 1QI0A 2FDSA 3QYSA 2GZXA 3MYPA 3DHDA 1W3JA 5J5DA 2VZTA 1M03A 3UXKA 1L6FA 1OT2A 3QHOA 1TV5A 2Z24A 4HNUA 4HA3A 3THCA 3W6YA 2DZSA 3QYQA 3RXZA 2E77A 1I2RA 1XM3A 2Q8ZA 1RA0A 2E6AA 2TRSA 1KXQA 1P43A 2VCAA 3WD3A 5DMLA 3OBEA 4GCXA 1M68A 1T8XA 1UD6A 5D05A 2BODX 1QNOA 5HUOA 1EZ2A 3OP2A 1LYXA 2F8QA 4WVXA 1SO3A 3AIUA 2ZUNA 3VAVA 1S3TC 3UWZA 2BHYA 2NQ5A 1VEMA 2R6OA 2JIWA 3CLWA 3BOFA 2DQWA 3GHRA 3OODA 3CIVA 3AMLA 1LL6A 4QSFA 1TQXA 5FACA 2XUCA 1NWSA 2QV4A 1JRBA 1E70M 3CMFA 4ONVA 3VDBA 4PMVA 1NOWA 1XLGA 2OR2A 4CD8A 4TR9A 2IUZA 2SFPA 4GUHA 3RCNA 1EP3A 1X8CA 3E2SA 2HE8A 2DZAA 4IWWA 3USBA 3WN6A 2JALA 2WKJA 2VX4A 2DT0A 4X61A 3VGDA 1T40A 3EOLA 3L4TA 1XIBA 5DMMA 3ES7A 2ZA1A 4P5UA 2YZRA 3NQAA 3VKKA 5AC6A 4OFCA 1E40A 4Y9MA 3GU1A 2QJIA 4TU1A 5AYXA 1H2JA 2PWHA 2OXNA 3A5FA 3DC8A 3KBVA 1HP4A 1PCWA 1JYNA 3F4VA 1RBAA 1GHSA 4TMBA 3VK5A 3B40A 4TQTA 1O94A 1V6TA 2VYOA 3S5ZA 4IGHA 5E1QA 5GQBA 1XC6A 1W3TA 1CXIA 2WZTA 5DBTA 3KL0A 3DFSA 2HZGA 4UTJA 4MWAA 4D6HA 4Z2GA 5HAOA 4C6BA 1OM0A 4DLFA 1LF1A 3CMGA 3EXSA 5D8ZA 4H9MA 4LYKA 3W7CA 5C9WA 1I60A 3PJUA 2Y88A 3ARRA 4IIFA 3BARA 2QPXA 3PNZA 3NO5A 2VFDA 1E72M 4DBUA 5GPRA 3DX5A 4CQ9A 5EFFA 3TXVA 3WQCA 3PWIA 1V3IA 2J75A 4QS5A 3D46A 1GYLA 4Z08A 4GJIA 3T0AA 3H4GA 3WLNA 4BQ4A 3GD6A 4JHOA 1C8QA 1GW1A 1TMLA 1GVFA 4EAYA 4G1KA 2HV5A 4QP0A 1KFJA 1IT8A 3WJXA 4KS0A 5BMWA 1MVYA 4G1NA 1BXNA 4Z42C 2QV5A 2J7CA 4JQAA 3BXWA 3TJXA 3W1RA 2I5IA 2P3EA 1XDMA 3B04A 3WF4A 4RV8A 3STCA 3FGCB 1G7UA 3SSJA 3VMOA 3T1GA 3M64A 2QJNA 4MZ1A 3REQB 1M41A 4AZIA 4BFAA 1Q8JA 3S9IA 3UWUA 1TWSA 2P88A 3CAQA 4LX4A 3ZVIA 2GVJA 1S5MA 3OZPA 3HPAA 2PGFA 2IPGA 3PZIA 4K6AA 7XIMA 3JUGA 4HOXA 3G3MA 1AW5A 3UVIA 1DJHA 5AC7A 3FCPA 3NL2A 2QVHA 3PPCA 2VZUA 4CQBA 2QF8A 1JZ6A 5FAGA 1V3KA 3A9BA 3I10A 1DIEA 1JXKA 3MHFA 5T9CE 2DORA 2YB4A 1FWAC 4NJKA 3TROA 1QHOA 3D3FA 3G0SA 4Y96A 3W24A 5LKYA 1CX9A 3GHSA 7REQB 4H9UA 3AC0A 2Y85A 3N4AA 3TAOA 1BQGA 3NQEA 3BO9A 1VJSA 3O6DA 4GZ7A 3KM8A 4PR4A 2YDAA 3VIIA 3T4WA 2BNJA 3OZMA 1DJQA 3C0SA 4C65A 5CAHA 2VGBA 1K4GA 1KFWA 4MWAC 1XQLA 4WJEA 3NGJA 4H04A 4GI4A 3APGA 4QE5A 3WD4A 3MV11 1DTUA 3CAKA 1QOXA 4DPQA 3BMWA 4YTQA 1JDDA 1GKPA 2IS7A 3CU2A 1TVLA 1WDQA 3AS2A 1QW9A 5TAOA 2XIBA 4FNUA 1R85A 3NL6A 2VR4A 2FMOA 5BYWA 1PSCA 2BBFA 2QMJA 1POJA 3C0JA 1TTJA 1C92A 1XG3A 4IICA 4FP1A 2VX6A 1YKWA 2ACRA 2Y2WA 2OG9A 2PDQA 4HZ6A 4ATWA 2IXVA 1XYMA 3MT1A 4N2YA 4QCFA 1GNXA 1MRAA 3LS9A 4TMCA 3LCFA 3RUBL 1F8IA 1E51A 2YLLA 4WIWA 4WGHA 2CZVA 4GFSA 4AC7C 5CG0A 5HQMA 1OCBA 1KW1A 3CQ0A 1KWKA 2R94A 4JKMA 3GXMA 2YL5A 3LHUA 3ITVA 4H9YA 3O6CA 2XIJA 1XX1A 2CKRA 1E6RA 3DFYA 4AYGA 2I57A 2BGNE 2I9UA 3QW3A 4CNUA 1N2VA 3SUSA 1KLZA 3GUWA 1EP2A 4D2JA 3NPUA 1M3UA 2E6YA 2V3GA 4Y8FA 2V5JA 5H8UA 3UZ5A 1NF7A 2ZZ3A 3W1QA 3QMRA 1Q5MA 1KM5A 4EACA 2YKKA 4E4PA 3H23A 1UR8A 4RE4A 1RV8A 2QUMA 5T8GA 2XFWA 5AY7A 3R7MA 4D6FA 3E49A 2O9TA 2DW6A 4FLSA 4IX2A 2XZ9A 6TIMA 5HNNA 3WJWA 3WQVA 2ZIDA 3S2NA 4DUOA 5IHSA 4W85A 4JHZA 3O6YX 4OECA 2JF6A 3UJSA 1MFUA 4W84A 1LROA 1ZP4A 2JEPA 4GVHA 3F7JA 1VFLA 3S9YA 3BG9A 4E5TA 2V82A 3K2GA 1KCKA 1ZHAA 2ZFAA 3TMQA 1ZTVA 4QLKA 1GTEA 3FA3A 1XYLA 1FCBA 3W74A 4FZIA 4DNHA 1HVXA 5A6BA 2POZA 2J4GA 3FVDA 4DF2A 4JD4A 3P5YA 4S3BA 5AYZA 4IL2A 2ZDRA 2GVEA 3GFXA 2V30A 5DRIA 1LWJA 5BU6A 1K9EA 3ZT6A 1R8LA 1TG7A 4DBEA 3EMZA 2AL2B 5I09A 3U2OA 4PCNA 2VO5A 2Y6ZA 3GW3A 3PZOA 4RXGA 3IUIA 4W89A 4UZSA 4AZGA 1DHPA 2GQ3A 4AVOA 2XSXA 2ABBA 2DVTA 3TWBA 3TC7A 4DVOA 4MLRA 2VFIA 4M1BA 3QSRA 1V3LA 4CUCA 3LENA 1J0ZA 3FJ6A 3W76A 1J5SA 1UR9A 5H8PA 4O13A 2OTDA 4HYRA 3W7HA 2Q71A 3TCSA 3HG4A 4JNMA 4TV6A 5C8BB 4IQJA 3GH7A 1FXQA 2CWXA 3NPWA 4D6GA 1UOZA 4AX6A 3IIPA 1QTWA 3B8IA 1FWNA 4UTWC 1JIBA 3UWWA 1CIUA 3BLIA 5FKYA 1MQPA 5M1TA 3C8FA 3S1UA 3W0KA 3P8JA 2Z2AA 3U4FA 1CPUA 3VU2A 2BWGA 4O17A 1XLDA 2WJEA 1AFSA 1AK5A 4U5KA 1Q13A 1EJTC 3T9PA 5AVNA 1E56A 4X22A 3N04A 4Q4RA 1BD0A 2GJPA 3I7RA 3W88A 1PTGA 4HTYA 4LUTB 2YPIA 1FHDA 5CBBA 3WH7A 1WDRA 2BVWA 3UJFA 5CPMA 1MDRA 2E8ZA 2PF8A 2WJZA 1D9EA 3IUHA 4JTLA 3NQ6A 3KBWA 3AICA 3W87A 4AVFA 1ITQA 3L21A 2P5NA 5I06A 2D2JA 3FFSA 1C8VA 4L1GA 4MGGA 2QCFA 4Q6JA 2JKEA 1PWLA 3GWQA 4HZ7A 4LAUA 2PWGA 1FQ0A 3KBSA 7A3HA 3TTSA 1AA1B 1Z48A 2DVUA 3DG7A 3FAWA 4QG9A 1YIXA 4XV0A 3W7EA 4H6EA 1R38A 4ZBCA 4Q4PA 1S3HA 4PL2A 3BV4A 3DKJA 3SADA 1D7KA 2TMDA 3NPXA 3VIFA 4PFHA 1FH8A 1UPMB 2DZBA 2X1UA 2GVGA 1ZB5A 2WMKA 4M7TA 5FJTA 3LHWA 4UXDA 5KITA 4BZYA 1BWLA 1TIWA 4TVDA 2WM0A 2E9BA 2XIIA 4O16A 4R34A 4DNMA 2VVSA 3MUXA 4MMWA 1XG4A 4PUNA 1LBLA 5CPTA 1R2RA 4RZBA 2FJUB 3BPWA 4UTKA 3IUDA 1XCFA 4DRSA 2BX7A 5DRCA 4R7OA 5T26A 3UT0A 2D3NA 2D69A 3VKAA 5CH9A 3CBWA 3WBEA 2Q8LA 2ZZ4A 4V1YA 4CNTA 4I9AA 3UJ2A 4DO6A 4IQDA 1CLKA 3DGRA 4YN5A 6TAAA 4Q33A 4LCSA 3T78A 1F7BA 2QJJA 2C1HA 3L5AA 2CZEA 1XGZA 1OY0A 1HQTA 1Z89A 4O1DA 1UWSA 4C7DA 4GQ0A 5FJPA 2OGJA 4D6IA 4PMJA 1JUKA 3AHZA 3FGCA 1LUCB 1FCUA 2BY1A 4GUIA 2WC7A 4FR1A 4TTGA 4PODA 1JNEA 3REQA 1D3HA 1VEOA 1US0A 4JCMA 2JGQA 2DFAA 1HKJA 4Q8UA 1MI3A 1C91A 5EYWA 1UMLA 4QISA 4HCDA 1EKOA 2J78A 3LCIA 3AHVA 4JGDA 3URQA 5BWFA 1BWKA 2WSRA 5D2WA 2VFHA 1W91A 3LPPA 3B3DA 1TZ7A 2IMRA 1I0BA 4LXFA 3MVIA 1K70A 1RSCA 1R6WA 3LPOA 5JBDA 1UYQA 3PAJA 2R9RA 2ZTJA 2PODA 1EO7A 1MMFA 2WVTA 1GYNA 3VOJA 1TVNA 1EOKA 2QUNA 1V51A 4XO6A 4RCXA 3MHGA 4ZOAA 7REQA 3CQHA 5DO8A 3TNOA 3KCJA 4DJDA 1XGEA 3O15A 1LLWA 3GTHA 4CQCA 1RQHA 1KD0A 3OYZA 4QJ5B 3TSBA 5AYBA 1BSIA 4D9PA 4GI9A 1UR4A 4P7LA 4WOZA 3UWYA 2A7NA 4ERGA 4EWND 2ZXAA 4WR3A 4IP7A 4O1AA 4O4WA 4NQ1A 4E0CA 4UQEA 3CZKA 4J2PA 3QQ1A 5GNZA 4D1JA 3FXYA 1JZ4A 3U2ZA 3WLLA 5CGTA 3H54A 3N2XA 3E2VA 3UG4A 1UZDA 2GDVA 3TIMA 4UB9A 2A7RA 2G3IA 4W87A 4GINA 3SCPA 1A5MC 1MXSA 2CITA 3C56A 3R79A 1GQKA 1PIGA 3W1PA 3WLKX 3FDKA 1X96A 2CLFA 3G1RA 4GNKB 3CZLA 2P10A 3DYMA 3QLDA 4LQ1A 2H3DA 4ZTXA 2GUBA 1XC4A 3I68A 1MXGA 4DBDA 1OFAA 1SFTA 5CZSA 3W2JA 3GVQA 4MB3A 2WVVB 1GONA 5C54A 5E93A 1EP1A 5CSUA 2QDEA 4Z1DA 3MI6A 3K5XA 2BZNA 1TTPA 1EHAA 4YPJA 4CVWA 4JOMA 1B5TA 4RLIA 2QVNA 2FPTA 4U31A 3OBAA 1K7EA 1YPXA 4YL2A 4AHOA 4DLMA 1G6CA 4G7EA 1TX2A 4RDWA 5E6ZA 4XBKA 3EX3A 1W37A 3KZSA 1XIHA 2VFGA 4IIEA 1NVMA 3N2CA 4NHVA 3VA8A 3B8DA 3JRKA 4CLMA 3H2MA 3ARSA 3NR0A 3ABOA 3EA1A 4JEQA 4NZJA 4C6EA 3HFYA 3CV1A 2FB3A 5FEZA 3F4NA 4RNFA 1NQ6A 4PBFA 1V6VA 3K30A 4IJBA 4QM1A 4B3KA 2JGYA 2FTWA 3QMSA 4DJDC 1Z3NA 3TOYA 4LC8A 4EOUA 1EF3A 7TAAA 2QEZA 4AF0B 5LIKX 3ZR4A 4JTEA 1C7SA 5IOBA 1GG1A 1ISWA 5EBAA 3EEGA 4Q8PA 1XDJA 4HA1A 3NA8A 1I1WA 3IVSA 2DJXA 4P8XA 2QCEA 2V8ZA 1TV7A 2BHUA 3W6LA 4PN2A 3D0CA 3W25A 1QNSA 3G1YA 3AMCA 3GIQA 3INPA 3LN3A 3TZNA 3NFUA 3KE0A 1CGXA 3LDVA 3O06A 1EGVA 1PL9A 5FESA 1EXPA 3I6EA 1QO5A 2O9PA 1LG2A 1NELA 4FXRA 2DP3A 3VXGA 4GOAA 4AHPA 3CUXA 2QT3A 3UZJA 1CYGA 2PRLA 5D33A 1DJGA 1AMKA 1V0MA 5A8OA 4PTXA 2P76A 4XD4A 5A2BA 4MZYA 2ZVIA 2NWRA 4Q8MA 3EA3A 1HKIA 2PTYA 4PMDA 1B54A 2OYKA 1T7LA 2A3HA 3M7WA 1Q6QA 2AL2A 3QLLA 3N4FA 4LV9A 3DI0A 3KZPA 5FF7A 3VKJA 5TNVA 2OYMA 4QSHA 2EG6A 3AIVA 4M51A 1P0NA 6CGTA 3W2KA 2IQ0A 1IF2A 4WSHA 5XINA 1OQFA 3NEHA 2HK0A 5XIMA 1H5YA 4LJ3A 4LRSA 4KH2A 2GOUA 3ZSTA 1GUVA 1NSJA 1P6BA 2QGHA 3TN6A 1US2A 2EPKX 3NZRA 2V67A 2ATMA 1PX4A 1JDEA 4AZBA 3C2FA 1EYWA 4IP5A 4OKDA 3AALA 4DN1A 1JYVA 1UD2A 4LW7A 3BK0A 4H7CA 3WNOA 1LQ2A 1TJRA 3EX4A 5HULA 3T55A 2D0GA 4J2MA 3EX6A 2YZ5A 3ZR6A 4MJ2A 5LNVA 1PDYA 2FH8A 2WMHA 3THAA 3W29A 4H8HA 1UPPA 2J7HA 4MSSA 1DJYA 1P0BA 2QUVA 3GRIA 3SFWA 1LCOA 4E3TA 3FSUA 1GOIA 4B4FA 4EE9A 3DKLA 1QOQA 4UQBA 2C18A 2CXGA 3AHXA 4NJHA 3F5JA 3M0LA 4MY1A 3UZXA 4XKYB 4NRSA 2Z6JA 3WQPA 3WMBA 4LUTA 1M65A 3CC1A 4GZJA 5EU9A 1ZCOA 3VOGA 3LSCA 3O9NA 4RE0A 2QAPA 1XHGA 2WJFA 3B9NA 1IEVA 5K3VA 4JTFA 1ZJHA 3UY8A 2YCJA 1A5AA 3R43A 4A2RA 1KO0A 3L65A 1JCXA 2P0IA 2Z25A 1ITUA 1ONXA 2BVTA 1JR1A 2PSNA 3C5QA 4K1WA 1ODZA