1GVFA

Structure of tagatose-1,6-bisphosphate aldolase
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
284
structure length
273
Chain Sequence
SIISTKYLLQDAQANGYAVPAFNIHNAETIQAILEVCSEMRSPVILAGTPGTFKHIALEEIYALCSAYSTTYNMPLALHLDHHESLDDIRRKVHAGVRSAMIDGSHFPFAENVKLVKSVVDFCHSQDCSVEAELGRLGSAFLTDPQEAKRFVELTGVDSLAVAIGTAHGLYSKTPKIDFQRLAEIREVVDVPLVLHGASDVPDEFVRRTIELGVTKVNVATELKIAFAGAVKAWFAENPQGNDPRYYMRVGMDAMKEVVRNKINVCGSANRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Tagatose-1,6-Bisphosphate Aldolase; Insight Into Chiral Discrimination, Mechanism and Specificity of Class II Aldolases
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords TAGATOSE-BISPHOSPHATE ALDOLASE AGAY
total genus 105
structure length 273
sequence length 284
chains with identical sequence B
ec nomenclature ec 4.1.2.40: Tagatose-bisphosphate aldolase.
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1gvfA00
3TCEA 1OFRA 3NQ7A 2EGZA 3OIXA 5G2HA 3G1VA 5FF4A 4DXVA 3WJYA 3NEVA 3L5LA 4WOZA 1WOBA 1ZNNA 1JUEA 4O15A 3N2MA 1EPXA 1KBJA 3PS7A 4N9CA 1XXXA 1NEYA 3WK2A 1PCKA 5CZSA 2VKZG 3TAOA 2VEMA 1FWTA 1ADOA 1BWKA 4WOQA 4NNCA 3UWQA 2R94A 2Z1BA 4JY8A 6ALDA 1W5MA 5AYZA 2TMDA 3W84A 2GJNA 4JY9A 4PODA 3IIOA 1AMKA 2RKXA 4UTUA 4NJJA 1OG0A 1TB3A 4ZQMA 3QW3A 1M6JA 3TFCA 1NFBA 1W5NA 2ZA2A 3B06A 4GXMA 4LS2A 3RF9A 3GK0A 3KVJA 1TSIA 3DBPA 4NX5A 5D33A 2BZNA 1F6PA 3M7WA 5HWJA 4NZFA 2V2CA 4CNPA 5FEWA 2VFIA 1H7RA 3NOEA 2WO5A 3T40A 3W7LA 2ZA1A 4RZ5A 5D05A 4WXYA 1O60A 4LVBA 4AWSA 2QDHA 3G22A 1X7FA 5AHEA 1FCUA 4QSHA 5F2GA 2PC4A 3ANYA 4RCXA 3AJXA 2VFDA 3PSWA 3USBA 5DY3A 5F2LA 2OJPA 5E93A 3ZS4A 1N55A 3M41A 4JX4A 3I68A 1QR7A 1H62A 3N19B 5HQEA 5CZTA 2ZZ5A 4BF9A 5DCDA 3IVUA 1W5OA 4N9DA 2WNNA 4UUIA 4LT9A 3C2OA 4IQLA 5KMYA 2DZPA 1PHQA 3DFNA 1H60A 4AF0A 3G0XA 1MZHA 3L0NA 4DF0A 4JIPA 1KV5A 5LNWA 3FJLA 4LS0A 3KVLA 5DBTA 2NUYA 3ZFHA 3LHUA 3TQKA 2OCZA 1HTIA 3H54A 3IVTA 5EL1A 5AHFA 5I3KA 3TC7A 1SW3A 3KAOA 1I2NA 3W2NA 2R91A 4CQAA 1TQJA 2YZRA 3W7HA 3W86A 2X1RA 5CPLA 1X8FA 3DI0A 4GUHA 4Z0JA 4BWLA 1S5TA 3GNNA 3QFEA 2ISWA 3M44A 4R7JA 4ZZ9A 2DZWA 3GAYA 1P0NA 1G69A 3MI3A 2VOMA 3TV8A 4O53A 3SI9A 3PG8A 1TPFA 3QZEA 5HUPA 1VYSX 4U28A 1EP2A 1FCVA 4RX0A 3P8JA 1TTQA 3ABSA 4XUGA 1SO3A 4JX5A 1IXPA 2V0TA 1IXNA 4NU7A 1HUVA 2Y70A 1O95A 3I7QA 1RR2A 4O12A 3ZWSA 3BW2A 1JUBA 3W76A 3O06A 5ABTA 3W71A 2QCMA 3M1ZA 4JX6A 3NDOA 4AVFA 1VS1A 5AN7A 2FIQA 2B7NA 3RNDA 1N8FA 4S1FA 3VI2A 3EWUA 4DO4A 3H55A 3M43A 1MEWA 1ZFJA 1OABA 3NM3A 3LX9A 1OYBA 1XUZA 1C8VA 2C3ZA 4XBKA 2A4AA 1J2WA 4CNOA 3MHUA 3HG5A 3TQ0A 1K7FA 4OE7A 3NQDA 3LHVA 3W7PA 3QJAA 4UNLA 2V2HA 1RV8A 2ZTKA 1QPNA 4PTNA 3CM4A 4DF2A 4O8RA 4M5PA 1VCVA 4MIMA 4O13A 1TPB1 1EUAA 4LV9A 1VJIA 4MYXA 3LCWA 3T44A 3CQ0A 4YLWA 1TV5A 2B7QA 2JBMA 5FF0A 1FXQA 5A8GA 1QFEA 3NQ6A 4OGZA 3W1QA 1YTEA 1QNVA 2OX1A 4UR8A 1LRTA 1SPQA 3ABQA 3L2IA 1OFDA 4N6FA 4NUWA 1NF0A 4NXSA 3NG3A 5FF3A 1GTEA 5G4EA 3W7NA 1TREA 5SWUA 4O18A 4UTWA 4HPJA 4X2RA 4IOTA 3DFSA 3FJ6A 2DJLA 2NV1A 1MEIA 4Y9AA 1THFD 3P84A 1T8XA 1W54A 4IMDA 3LI0A 4RLIA 1G6CA 2QUTA 2WSYA 3O6DA 5I3IA 1LYXA 2Y7GA 3LLDA 3KVMA 5L9FA 4P2VA 3MMTA 5L6UA 4S2CA 1TCDA 1Q3NA 1VCFA 5K4ZA 4R53A 2J9XA 4A29A 1OK6A 1XBZA 1O5KA 3NAVA 1GOXA 3HPXA 5D02A 2WNQA 4FO4A 3GB6A 2YDAA 2E77A 1GG0A 4O1BA 4TU1A 2X2GA 5FEPA 1F7BA 3GKAA 1YTDA 1SZFA 3SSJA 3KHJA 1TRDA 2CLIA 4MY8A 2ZCGA 3WK0A 5I3GA 5C6MA 3G1DA 3NL3A 1EWDA 1JQXA 1W3NA 4KFPA 2F7FA 3BVJA 1TJPA 3M5VA 1LDCA 3IIZA 1OF8A 4LU0A 3SGUA 4P61A 3EX2A 4IX2A 1Z42A 3K30A 1L2UA 1IXOA 4FXSA 5IBXC 3HG3A 2NX9A 4PL2A 5HWMA 2WKJA 2DZTA 4RR4A 3MW7A 4PCFA 1U83A 3R89A 2IQTA 5HULA 3M6YA 3NO5A 5D2WA 4DELA 3OA3A 4XTDA 1KM3A 1GVOA 2ZRVA 3DI1A 3HIJA 3LTYA 1DORA 4FX8A 4JTHA 3B0PA 1OK4A 3TJLA 3W1AA 2NUWA 4JYDA 3LHZA 2B4GA 4IJBA 5D09A 1TIMA 1O5XA 3EEGA 4YWIA 4O28A 1HO4A 2DZXA 3R2GA 4Y96A 3PUDA 1H7WA 1TV7A 1GT8A 2A6NA 1HO1A 4GFSA 1MEHA 4YMZA 3BGJA 1FDYA 5DXYA 3D0CA 4L4LA 2VFGA 2PRHA 4N9BA 2AAMA 2QDGA 3EX6A 3PAJA 2ABBA 3TX9A 3W7GA 5G4WA 3W74A 4BR1A 4HNNA 3BK0A 5G2IA 4AHQA 1A5CA 1XFBA 4NZJA 4K8EA 4I7WA 4KKXA 3W7QA 4HPXA 1UUMA 2V82A 3GXPA 2J9YA 3IIPA 2NLIA 4K39A 3LXCA 2ZRYA 2FJKA 4M6VA 3ABOA 2O7SA 3W7CA 3N34A 1I45A 3PC0A 2Y7EA 3L5MA 5J5DA 4WY0F 3HPSA 3TSMA 1RD5A 2AQWA 2QAFA 5AHIA 2W0UA 1H63A 3NA8A 3NZRA 4BK9A 5D2VA 2E5DA 3CWOX 2B7PA 5DBUA 1VGAA 1K03A 3QSTA 5EPDA 5IBXA 4LY8A 3CHVA 4GUJA 4HHPA 3NVTA 1FBAA 1H5YA 4O1AA 4X22A 1P0KA 4HNVA 5HNRA 2FPVA 4M6QA 1I8JA 2H8ZA 3QPZA 5U7SA 3QM3A 2X16A 4IXXA 3CIWA 1G4PA 4ZVJA 1RVGA 2YW3A 3TKFA 4A22A 1V7YA 2FB3A 4O50A 3TE9A 3PB2A 3LTPA 2NXIA 3U2OA 3I7RA 1KFBA 1NVMA 4POCA 1Q6LA 5C5YA 3RLVA 1AW2A 5CKSA 1M7OA 2WOQA 2LLEA 3TFXA 5HWNA 1FQ0A 2FLIA 2QCDA 4EVZA 1WX0A 1YLVA 5LZLA 4O19A 4GBUA 1YDOA 3BG3A 3QC3A 4ZQNA 3TU9A 2QAPA 2QR6A 4Z1DA 3WK3A 1AW5A 4KWWA 4YXGA 1A50A 1XDLA 3IIVA 1VHNA 2QCLA 5FESA 5FI8A 3R13A 3FA5A 2VFHA 5AYYA 3DU0A 1F74A 2RDUA 4AWTA 4M7SA 4E2DA 5C2XA 4YL2A 1SW0A 3ZR4A 1LBFA 1UB3A 3DKJA 1ZENA 3F1QA 4NJIA 2JKEA 1QDSA 4Y6GA 6TIMA 1LZOA 1PL9A 3QMSA 3BV4A 3P81A 2QUUA 1TPUA 1JJKA 4I9AA 5K3VA 1QAPA 4RXFA 4XBSA 5AFDA 4M6PA 3VNDA 2FFCA 1X1ZA 2A2IA 3C0JA 1IGSA 4JD4A 4AB4A 1C29A 4WQ6A 1K02A 3TK7A 4UFKA 5FEZA 2J6XA 1FWWA 1UCWA 3S1VA 3OBKA 5D37A 3THAA 1R46A 2NXGA 2Z6IA 4N4PA 3UWYA 3TQVA 3M5ZA 2FB2A 2E1DA 7TIMA 3O07A 2R14A 2YYUA 1EX5A 4FNRA 5KZDA 4ORIA 4Z1AA 1O4UA 4X9SA 1B9BA 3BLEA 3BW3A 1BEUA 1XC4A 2FDSA 4O11A 4PH6A 5TIMA 3HQ1A 4WZHA 4Q4KA 3G1HA 3WK1A 5TBOA 4GRSA 4TR9A 3HG2A 1DOSA 3G3MA 2GQ8A 3T55A 3M9YA 1WAUA 4PA8A 3NQFA 3NR0A 5D30A 1J5TA 5CPMA 3LOTA 4N2YA 3M0ZA 3S6DA 1D9EA 1KV8A 3LCFA 2QCDB 2EPHA 3IVSA 3E02A 3E49A 4LC6A 3DHFA 1X1OA 2Q3OA 1VH7A 5DCEA 1QCWA 3L0KA 3UWUA 3SECA 1SUXA 5HJLA 3TNOA 3NPUA 3WJSA 3E12A 1B3OA 1W56A 3LCHA 3LHYA 2DP3A 2UV8G 3OHIA 4QM1A 3MP5A 5DCBA 3C8FA 1A5SA 4AHOA 3A24A 4MY9A 4BI7A 2ZZ2A 1OFAA 4IMEA 4IX0A 3BLIA 3ELFA 3INPA 2V9DA 2WSRA 4MZ8A 2NXHA 4LW7A 2I14A 4DPQA 1RZMA 1GYLA 4UTTC 1LP6A 5K4XA 4ORMA 4UR7A 3L68A 2C6QA 2A7PA 1P4CA 4ZQCA 2XN2A 2QCNA 3T78A 1Z41A 1VCGA 5DELA 5G5IA 3O1NA 3LTSA 3W6YA 3TW6A 4NJKA 3R5EA 4WXZA 4A21A 3BGGA 2YW4A 1YXDA 3LGEA 2GJLA 4MJZA 1L6YA 3A5VA 3GAKA 4AEOA 1PV8A 4HIBA 3TMLA 2C15A 1K8ZA 2ZZ4A 2EHHA 1WDWA 4FNPA 2YYTA 1FCQA 3UWWA 5A5WA 1JCJA 3GR7A 5F2IA 2Q8LA 1XKYA 3S8HA 1XBXA 1L9WA 3LI1A 3MYOA 3PF3A 4JR5A 2VC6A 2J9ZA 5TQLA 3RFAA 2ATSA 3W7RA 3IEBA 3MI2A 1DQXA 3IGXA 4M7TA 3CB8A 3MI6A 3OG3A 5CG7A 4BWLC 3B0VC 5LGZA 3KOFA 1RQHA 5K9CA 4UFMA 4AAJA 4O54A 1ZALA 3NPXA 3CU2A 3NQ8A 3UPBA 3G24A 5F1UA 3B03A 2TYSA 4NXKA 1W3TA 3UXAA 2BSLA 2ATMA 3HB9A 1DVJA 2E6DA 3H53A 4HSNA 1YADA 2Y7FA 3SZ8A 4JN6A 3UD6A 1DBTA 4MZ1A 3TSBA 1WBJA 1WQ5A 5LHFA 3JRKA 1K7XA 1MSSA 1KFEA 1IIHA 4DO6A 3RK8A 2EKCA 2YFOA 3W23A 1OX5A 2NUXA 2V81A 4DO5A 1JVNA 1H7XA 3MP4A 3TMQA 3GXNA 4DBDA 1A53A 4JYFA 3ATYA 3CEPA 1VR6A 4O4WA 3LHWA 1KFLA 1BWLA 2H8XA 4H4IA 3EXRA 1KM0A 2Y89A 4R34A 3G3DA 3QMRA 4UTLA 4K38A 3W70A 4QQ3A 3W1PA 3Q37A 4LS1A 1YTKA 3S42A 2ZDRA 2Y85A 2V30A 4E38A 1ZAHA 1C9DA 2Z6JA 1DJNA 4RXGA 1XCFA 2EAWA 4LRTA 3DFTA 4AHPA 4WY0A 1EP1A 5G2WA 1K8XA 3TROA 3DFQA 2ZFAA 1W8SA 3UNDA 3GDRA 3NL2A 1ALDA 3IV3A 1JUKA 4FXRA 4HSOA 2QEZA 4JTJA 5C55A 3TH6A 1WV2A 4O16A 4U4MA 5MHBA 1GZGA 3C6CA 3P61A 4S2BA 3N14A 4FHAA 5EKYA 2CZEA 4FNTA 4UC5A 4MFEA 3W87A 3OVQA 1ICSA 1OX4A 2GUUA 3GDMA 3A21A 2NX1A 4AXKA 5DLCA 1SZGA 1Q6RA 3C2FA 4XQ6A 5FEXA 2PURA 2DORA 3OVRA 3NQCA 4K8HA 4ALDA 1LROA 2W6RA 1HFBA 2E5BA 1IF2A 2E68A 5HMSA 2CLHA 3CWNA 3I65A 4FEZA 3A22A 2X30A 3P8IA 3L5AA 2OMAA 2CLMA 4CCCA 3HMJG 4LVFA 3EKLA 2ALDA 4TMCA 3PR2A 1JULA 5G1TA 1TO3A 3DKLA 5HR7A 4RV8A 3QYQA 2HTMA 3NPWA 4C1LA 1GTHA 4Z1BA 2HSAA 3KFTA 4UMCA 1CW2A 4IUOA 5HINA 5K9DA 4O10A 4RJEA 4MFDA 3DENA 3YPIA 3W1TA 2YX0A 1F73A 4LC8A 2I9EA 3EX1A 3HF3A 2DZUA 3N9RA 3CT7A 2C13A 5BMXA 1HL2A 3IIXA 4UXDA 2G5WA 2GQAA 1UASA 3GVGA 4BI6A 4ZQPA 1VZWA 2A0NA 5H91A 3RU6A 2FPYA 1F05A 4MPQA 3W7JA 2A21A 3UY7A 3VE9A 4GWEA 4WY0B 4MJMA 3FOKA 3SJ3A 3HO8A 3W85A 3SFKA 2E6AA 3UPWA 1H51A 1YXCA 1H7PA 1SO6A 2A7NA 2OT0A 3PB0A 4G1KA 3CC1A 5J5RA 2H90A 3T4CA 4NX0A 2Q8ZA 3FKKA 4OQVA 3G1YA 2JKPA 3IRDA 2CLFA 1GJPA 2YXGA 4QNEA 1FDJA 4AMAA 3LXAA 1KW1A 2Q3RA 1OFPA 5D2YA 1ZHAA 1QO5A 3VKJA 2ZA3A 4JTKA 3EX4A 1H61A 2CLEA 3W75A 3DXIA 3PSVA 1SR9A 3WFAA 3W7IA 2XN0A 1DQWA 4Z08A 3E96A 4DQWA 1MO0A 1QOPA 3S1UA 1KFCA 3VCRA 3G1FA 2JKAA 3LRMA 1ICPA 4CQ8A 3W83A 1TYGA 3NM1A 5C54A 3S0CA 5AC6A 5EA9A 4LUIA 3DFOA 2QJHA 3W1UA 3TW7A 4ADSA 5AC8A 3G1AA 1G4TA 5LNUA 3L21A 4XTIA 3R12A 2H6RA 1YPIA 5HUOA 3LB0A 3N9SA 4EIVA 3PVFA 5KSWA 4NNAA 1GQNA 4FX7A 1LLWA 2BXVA 4OBTA 3UZ5A 2OT1A 2EF9A 3SGZA 4RZ4A 1OJXA 3EWBX 1TPWA 3L9CA 1WXJA 5K7JA 4JNMA 5D2XA 1B4EA 4UTHA 1PCWA 1TPEA 3BG5A 4FIQA 4FX6M 2YCEA 2YSWA 3W07A 1G7UA 1OFEA 4NNBA 3LERA 4R33A 3W3OA 1PE1A 4DBEA 4QAIA 3G1SA 2ABAA 3LBMA 1KM6A 3HGJA 2KZHA 1JCNA 1TTJA 4AWUA 4MLJA 3LRKA 1FY6A 4O1CA 4UTTA 2ISVA 1VC4A 2A1YA 4ONVA 4HKPA 1TPVA 4UMBA 2A7RA 2E09A 1TV8A 4UIOA 1EWEA 2TSYA 4LTSA 1XM3A 2O7QA 4JTTA 4KFNA 4UFIA 2J24A 4TO8A 3GZ3A 5I3JA 1KM4A 3F4NA 1JCLA 5EMUA 3E0IA 1T0OA 3PY2A 3BLFA 1R2TA 4FNQA 4LVAA 1SFJA 2RH9A 2P1FA 5D04C 2GPTA 3O15A 5AYXA 4JEQA 1FWSA 3FEMA 1JCXA 3W73A 2XN1A 5U4NA 2QJIA 3Q58A 4JTEA 5FF2A 4JTIA 2HS6A 1LLZA 4OWGA 1KM5A 3PBVA 4UCGA 4MVAA 4DPPA 2GVJA 2G96A 1TJRA 4ZQOA 3VE7A 2X1UA 3MHFA 5LNSA 4IPIA 2DJXA 1D3HA 1DV7A 2JGYA 2QKFA 3QEZA 1TQXA 3BPWA 3S5ZA 3LBCA 1LTDA 3HBLA 3TAKA 3HPZA 1JCYA 4YCPA 2CU0A 3G18A 3O8AA 4JTGA 4MUZA 3I6RA 4O1DA 1DKWA 1KTBA 4BFAA 2TPSA 2F84A 3KRSA 4JDBA 1QOQA 1FDZA 3NZ1A 4UTWC 4A2RA 4IPJA 1EA0A 4IWWA 4DF1A 1L6SA 5D38A 4PEKA 2JK2A 3MYPA 3M16A 2Y63A 2VEIA 4IMFA 1I4NA 2V2DA 4JIQA 8TIMA 1ZAIA 2J88A 4XWUA 4EOUA 1LOQA 1TTIA 1LBLA 2RHGA 5KZMA 1W3IA 3F4WA 1PVNA 3DH7A 4JS3A 1VRDA 2NWRA 3FKRA 3HGSA 1CI1A 1V5XA 2CLKA 4L4MA 1KA9F 4A3UA 3PUEA 5BW6A 1F76A 1IIGA 4GC4A 5BOOA 1FCBA 1OFOA 1TRIA 4PC8A 2Z0IA 2ZRZA 2YR1A 1SZEA 4H3DA 4LOCA 3W1LA 1T96A 4K37A 3GDTA 1SSGA 2PCQA 3W1XA 1GYNA 5LKYA 3U8GA 3NXFA 1AW1A 4HT3A 4FIRA 1VYRA 1H1ZA 4OV4A 2GVLA 3KRZA 5AHLA 4WX2A 4ZL1A 1WYIA 1SFLA 3QW4B 1PS9A 3QF0A 3RLUA 3L65A 4JDYA 2Y6ZA 2JGQA 2P10A 3GDKA 3V75A 2J27A 2C1HA 1ZAJA 4ADUA 3NQGA 4N4QA 3NGJA 3PBYA 3C2EA 5AOUA 3N3MA 4MLRA 3W2JA 1XDMA 3O6CA 4NQ1A 1EUNA 3BARA 1IXQA 3T7VA 2FPTA 1FXPA 1WBHA 1AK5A 2X1SA 4RZ6A 1QPOA 4K36A 3LV6A 3WJWA 4CCEA 2B0MA 4O0KA 4WJEA 5D03A 3O05A 2TRSA 4Z0SA 2H3DA 2WPBA 2ZRXA 3P82A 2C16A 1Z48A 4KFOA 3P60A 1CX9A 2CFFA 2CLLA 2ZZ7A 4N02A 5FF7A 1BKSA 3LCLA 1BTMA 1JQVA 3STGA 4NJGA 4HN4A 1OFBA 3P5ZA 1OX6A 2RFGA 3CEUA 4X3ZA 4LVGA 2X1TA 4C1KA 1W0MA 1VLWA 2BLEA 3SIZA 1H1YA 2WQPA 3W72A 3THQA 2NV2A 1GG1A 1UJPA 1OYCA 1TPDA 1FX6A 3NYZA 4PL1A 2CWNA 3NNTA 3EWXA 1KTNA 3EB2A 3LXBA 3Q2DA 3NQVA 3NQ2A 3EWZA 3O16A 3CIXA 3STEA 4BI5A 1R2SA 5EY5A 1H7NA 2H3BA 2PRMA 1RQBA 3FLUA 1GVFA 3G0SA 3W7DA 1GVRA 4JTLA 2BX7A 2C0AA 2WNZA 3M47A 4H6KA 5CZ0A 1F5ZA 4E2BA 2QCEA 4GE8A 1R30A 3C52A 5F1VA 3LCIA 2YGYA 4N6EA 3DZ1A 1F2JA 3TC6A 2PRLA 1OHLA 3U6WA 3G0UA 2OZ0A 2C18A 1VPXA 5F4WA 5KINA 5CPOA 1I2OA 3B4UA 1M5WA 4O14A 5E1QA 3W2MA 4B5NA 5E0KA 2C14A 3PG9A 3EWWA 1ME8A 4LWWA 4N9EA 5LNRA 2FTPA 3W9ZA 4YCOA 1NF7A 1KM1A 2V5LA 3STCA 3F03K 5LNVA 4RK8A 1H50A 1NAL1 4QISA 2QCCA 3V1PA 3SR7A 4IXHA 3KRUA 1W1ZA 2VFFA 1TPC1 5CZJA 2VEKA 4XKYA 2A6LA 1GVQA 2HS8A 3FYPA 1YDVA 3WJXA 4GNJA 4KWVA 1M7PA 3O63A 3B05A 4I7UA 2QCHA 2ISSA 2VENA 3NQAA 4JGDA 2E6YA 4JTUA 1JRBA 4IMCA 1GPWA 2QCFA 4LUJA 3L0GA 4QNWA 3LV5A 3MHGA 4MOZA 5F4SA 3IGUA 3QPYA 3MBDA 3AO0A 3TR2A 5AHMA 1TTPA 2GOUA 1JRCA 2QJGA 3S5NA 1N7KA 1KFKA 5K2ZA 1ICQA 5I3FA 1YDNA 3DGRA 1S3HA 5G1YA 2ZRWA 5LSMA 4QJ1A 1W5PA 1ZY9A 3PBUA 3TA6A 3G8EA 2VEPA 4EF9A 4QITA 4LV4A 4NJHA 3PBWA 1I2QA 3TXVA 1DJQA 3UY8A 1W31A 4ZQRA 4CLMA 5IM51 1TPH1 5CGQA 1H7OA 3UWVA 1OF6A 3EKZA 4Z1CA 4OHQA 3EXTA 4JTFA 2AGKA 4JTSA 1E51A 1LOSA 3MP3A 3A9IA 1J4EA 3MO7A 4JICA 3UWZA 3VFLA 2QF7A 4NVTA 1UBSA 2D73A 2DZSA 2Y88A 3W2KA 3SY5A 2A5HA 3HG4A 5BMWA 1AL7A 5LGXA 4UNKA 1I2PA 1G7VA 2CW6A 2ZRUA 3C56A 3TIMA 3CLMA 1RPXA 4W9TA 1L6WA 1R47A 3P5YA 4WD0A 3W22A 2WJZA 5LHEA 4OV9A 1JCMP 3QH2A 1I2RA 4O0ZA 2Y62A 4DEFA 2NWSA 5D2TA 3PWAA 3MJYA 1A5BA 3QMTA 3TDFA 3ATZA 1AL8A 2Y61A 4CCDA 1QMLA 3QSRA 1SSDA 3G1XA 1Z44A 5AC7A 1KLYA 5DXXA 2E6FA 3P62A 3QRHA 1GWJA 1X6UA 4XKYB 4UTKA 3JR2A 3LDVA 4UMAA 5K9XA 5T26A 3O6YX 1EEPA 4O52A 3E9AA 4LVDA 4M19A 1KTCA 1G67A 2Z2UA 1VHCA 3S1XA 3QQ0A 4MYAA 3W1RA 1SU5A 1YYAA 4I7VA 4FNUA 1UUOA 2RDTA 2VFEA 4GUIA 4HNTA 1ML1A 3MWAA 3UYCA 4TX9A 1B57A 3PULA 5DY2A 3BG9A 3A23A 1VQTA 3W7KA 1KLZA 1XI3A 4NT0A 1WA3A 3M5XA 4CQ9A 1A5AA 1DL3A 5CSSA 5DN1A 1RQEA 3QQ1A 5EYWA 2BWGA 4UTMA 4FNSA 3S9YA 3KXQA 3HGOA 3FS2A 1K8YA 3NL6A 4QIUA 4CNNA 4ICNA 5H2ZA 2V8ZA 1W37A 5BRBA 1K3UA 2ZQ0A 1LRQA 3KX6A 1ME9A 1PHWA 1Q6QA 2ZBTA 3LM7A 3OEXA 2CLOA 2B7OA 4K7YA 5BNKA 1EIXA 1WOAA 3FFSA 4JXCA 2CZFA 3W1MA 3JS3A 4LRSA 1DHPA 1QPRA 1LORA 1ONRA 3PM6A 3NQMA 4E0CA 4GJ1A 3MUXA 2I1OA 1S5VA 3P74A 1OVDA 3GX9A 1JR1A 3ABRA 5KZEA 2ZYFA 3GYEA 5CSRA 4LNYA 4JYEA 1QO2A 1P1XA 4ML9A 3B0UX 3W2UA 2DZVA 4IMGA 4O4VA 2VELA 2QUVA 2DU2A 1B4KA 2G95A 3RMJA 3HJZA 4XZ9A 1AG1O 1R2RA 3UQNA 1GEQA 3GXTA 4OU1A 1U5JA 2WSQA 1KM2A 1QWGA 3LCGA 1GVSA 3R8RA 1NSJA 2E5CA 1LBMA 3TSDA 3W1NA 3EX3A 1LM1A 3DFPA 5KITA 4WUIA 1SO4A 3ZWTA 1YXYA 1EB3A 3KVKA 4TMBA 4GUGA 2R8WA 5HR6A 1Y0EA 4RKAA 2P0OA 2GQ9A 4IGHA 3EXSA 3DHDA 1ME7A 5EBUA 3W2LA 3TXZA 3M5YA 4EWND 1VYPX 3BO9A 3EWYA 2XFWA 2NX3A 3NL5A 1OX4B 4MZYA 3LLFA 4TIMA 3Q94A 3W88A 1SW7A 3LRLA 3I7SA 1Q45A 1P5BA 3C3NA 1XBVA 4UTJA 4MKNA 1EP3A 1ZJIA 1O94A 1XUUA 3WJZA 2WV8A 1LRNA 2V5BA 3FYOA 3IGSA 4D2JA 1ZCOA 4UFHA 3N2XA 3UZJA 3W7MA 3MBFA 1SZNA 3SW6A 1XBYA 2CZDA 1SO5A 1LOLA 3B8DA 2QCGA 2ZZ6A 1FWNA 2C19A 3S5OA 1D3GA 5GVJA 3P7YA 4A2SA 2BTMA 3BW4A 3HGRA 3LHTA 2CZ5A 1OFQA 4EF8A 5AB3A 4UFLA 4MY1A 1HG3A 4UFJA 4FB7A 1FUYA 1G4EA 4UTIA 4HNUA 4Q33A 4Y8FA 3PUOA 4OT7A 1KBIA 2GVGA 2ZZ1A 4O17A 5F2MA 3S5YA 1K7EA 3HOJA 1S5WA 4Y90A 3L66A 5I3HA 1MXSA 3GIYA 2YPIA 3GKFA 3C2VA 5F4XA 2G97A 2W79A 1T99A 1XL9A 4J9JA 3G8RA 3W7OA 4GUFA 1FWRA 1W5QA 3C4UA 3N73A 3NQEA 4FF7A 4ADTA 5D32A 1KFJA 1PIIA 3P67A 1F6KA 3S1WA 3GR8A 5CPNA 3C2RA 3C61A 1SQ7A 4AF0B 4K7VA 3STFA 3GNDA 4Q32A 4AH7A 1G4SA 2HMCA 3FIGA 3CTLA 3L67A 1Q6OA 2NZLA 3TJXA 2Y7DA 3DAQA 2A85A 2VXNA 3CPRA 4K6AA 4O57A 2ZTJA 3A5FA 3B04A 1TMHA 1LCOA 2PE4A 2RDWA 3OVPA 4PFMA 3W7EA 3NPVA 3P80A 5AHNA 1QPQA 2FQIA 4ZMGA 3GDLA 3UXDA 2YFNA 2ZZ3A 5KTLA 3TUUA 1OYAA 1VLIA 1YPFA 3LCXA 3GLCA
chains in the Genus database with same CATH superfamily
1OFRA 4MHBA 4H8UA 1OGBA 4YVXA 3TQPA 3L5LA 1ZNNA 1JUEA 1IZJA 4MKVA 3N2MA 4LUYA 5LA2A 1XXXA 4GBDA 1X1NA 1PCKA 3CLWA 2VKZG 5CZSA 4F2BA 3QHOA 1EKOA 2CITA 2Z1BA 1Q85A 1UP2A 2FVKA 4JY8A 4NRRA 6ALDA 5IDZA 3SCQA 3W84A 2X42A 4PODA 3MMDA 1CXIA 2RKXA 3WFZA 1OG0A 4DXXA 3LZ3A 4S3JA 1E4LA 2OSYA 4LEQA 3OQEA 4GXMA 1HJQA 3UU0A 2BZNA 2VI0A 2OEMA 1F6PA 3M7WA 1HKWA 4NZFA 2V2CA 4CNPA 1CYGA 1DTNA 5FEWA 4JQ2A 1H7RA 4S3CA 3T40A 3W7LA 4DNMA 2ZA1A 2HBXA 4LVBA 1X7FA 3A9BA 3GWQA 5F2GA 1CGUA 2VFDA 1UPMB 5DY3A 5F2LA 5IHSA 4JX4A 1XGEA 2ZZ5A 3BUVA 4N9DA 1ECQA 3B8UA 4LT9A 3C2OA 4FLOA 3TWBA 5KMYA 5I7GA 1BPLB 3DFNA 3LLXA 3UGRA 5EFDA 5DANA 3NWRA 1KV5A 3FJLA 4LS0A 3N13A 3LHUA 4OZOA 2OCZA 4WRHA 5EL1A 5AHFA 2PGFA 3TC7A 3UT0A 1QI0A 3TYDA 2R91A 4CQAA 1DJGA 2PS2A 4ZCWA 3VGHA 3R0KA 3GVRA 3WLTA 2HISA 3THDA 4I3GA 1C93A 4GA8A 4CVWA 1M04A 2ISWA 5JH1A 3CUXA 2OYLA 4AIBA 1OINA 2H9AB 1P0NA 2VOMA 3TV8A 3SI9A 1EJRC 3PP7A 2V3FA 3DDMA 1EP2A 3CHCA 4RX0A 3P8JA 1TTQA 4J40A 1SO3A 4CN1A 2BOGX 1IXNA 1HUVA 2Y70A 3LY0A 3DC0A 1XRFA 4DBSA 2XVNA 1RK6A 4JL1A 3W71A 3KL0A 3NSMA 4GXWA 3S47A 1XIBA 4HZ8A 2FIQA 2B7NA 3VI2A 5JUVA 3M43A 3GM8A 2VCBA 3UR8A 3M0IA 1OABA 1OYBA 1KD0A 4CNOA 2VOTA 1JDAA 1K7FA 3EPMA 1A80A 3E2RA 1NQKA 3NQDA 5IHRA 2JF7A 3QJAA 3V4BA 4CNSA 2V2HA 1DJHA 2ZTKA 2XWDA 5J04A 3WQ8A 1XRTA 1S2VA 4LV9A 1XYMA 2EXOA 2HE5A 1TV5A 2B7QA 4YTUA 5A8GA 3R0DA 5A6MA 1QFEA 4O8AA 4OGZA 3W1QA 3IJLA 3ARVA 2O0TA 2CBVA 5D4YA 4GIAA 4AY7A 3BAXA 1GTEA 5G4EA 1XPGA 4R9XA 1EZWA 5CAHA 6REQB 4HPJA 1PJ9A 4JTAA 3GIPA 3OB8A 4QAWA 5C9UA 4Y9AA 1AD4A 4GISA 1T8XA 1ODUA 1PYMA 3SRDA 3N6JA 5C9RA 2INEA 3LLDA 2Y7GA 3GR4A 2WW5A 4P2VA 4OOZA 4V33A 5L6UA 5K4ZA 1XBZA 4CQDA 3NAVA 1WPCA 5D02A 3WQWA 2XU2A 4FO4A 4EE9A 1C8YA 4TVDA 4O1BA 2X2GA 1LWHA 1PIGA 1SZFA 5H6HA 1YX1A 3OLEA 5CAKA 2CLIA 4PB4A 2ZCGA 3TVAA 5I3GA 2D23A 3DGBA 1NOWA 4YU1A 4C91A 1JIBA 3G1DA 1JQXA 4PB3A 1TJPA 3M5VA 1PTGA 1NTHA 4IX2A 1J10A 2Y2WA 1PTAA 5KZ6A 4IISA 1IXOA 4FXSA 5IBXC 1E1CB 2NX9A 4PL2A 5A8NA 5HWMA 1EJTC 4IFOA 2DZTA 2IQTA 5HULA 3W02A 4IHCA 3CMGA 3KOWA 3OA3A 4XG1A 1GVOA 5BXPA 3U2CA 1OD0A 4H8HA 4HU4A 3LTYA 4IGSA 2HEJA 2NUWA 4JYDA 4GIYA 4LAMA 3EEGA 1HO4A 2D0GA 2DZXA 4DYJA 3R2GA 3NZGA 2VD9A 4IF2A 3CZGA 2A6NA 1VF8A 5CH9A 3RO6A 3BGJA 1FDYA 1XLAA 2YA0A 2DQXA 2VFGA 4S3DA 4NAEA 4WSHA 1RP9A 5G4WA 8A3HA 1S5MA 4TXEA 2AL1A 3GZAA 4ATLA 7REQB 1HKIA 3DECA 1ENUA 4AY1A 4HNNA 1A5CA 1E0TA 3CHEA 1GVIA 2VR2A 1UR4A 4AISA 1JFHA 1QATA 3HQOA 2W91A 2OSWA 2DPEA 2NLIA 1MZRA 2ZRYA 3CYJA 3CV6A 1WKFA 4RDWA 4M6VA 1HL8A 2FKPA 3ABOA 5BWAA 3RUBL 3WBAA 1RSCA 3W7CA 3N34A 2G3JA 3ZJ7A 4QE1A 1V6WA 2HNEA 1RD5A 2AQWA 5EMYA 4LAZA 1W1A1 1E1FA 4ZBCA 2XH7A 3CUJA 1OC7A 4W8AA 5D2VA 4QROA 1LL7A 3GXFA 4RE2A 3MSRA 3CHVA 2XIJA 4M1RA 2D2JA 1FBAA 4NZ5A 1H5YA 3F4CA 4O1AA 4IQDA 1P0KA 4M6QA 3UA3A 1OSEA 3L4TA 3H2FA 1JD7A 3QM3A 4F0SA 1G4PA 4LCQA 3WLPA 1ITUA 4EANA 4HP5A 3TE9A 3I7RA 1NVMA 1Q6LA 4F0RA 2WQDA 1M7OA 2XVKA 3N2OA 2R1PA 4P8XA 1WX0A 1YLVA 4O19A 1YDOA 2VDIA 3QC3A 2QAPA 1X97A 5HPOA 5MKGA 4KWWA 4B4HA 4YXGA 1XGDA 3WCZA 4NZCA 1ZJAA 5FI8A 3R13A 2QVNA 3FA5A 4CU6A 4AWTA 5CCZA 4ZE4A 4YL2A 1SW0A 3FA4A 3I3EA 4MWAA 3ZR4A 1UB3A 3F1QA 5MKGB 2JKEA 4YS1A 4W84A 4PMOA 1LZOA 2VX7A 2VX6A 4C6PA 1TPUA 1VFTA 3WH7A 1DHKA 1XLGA 4H6EA 4UQAA 4XBSA 5AFDA 2P3ZA 1OBAA 3T2QA 4AB4A 1PX3A 2VGGA 1K02A 4ZR8A 1TX0A 1FWWA 3S1VA 1V93A 2NXGA 1BRLB 3TQVA 2FB2A 4C6EA 2DT3A 3O07A 2R14A 4KT2A 2XH0A 4QBXA 4ORIA 1B9BA 4LGXA 1E6PA 4O11A 2OSXA 4PH6A 5TIMA 4FLQA 3HQ1A 1UR8A 4Q4KA 1LT8A 4TR9A 2TAAA 4QCEA 3DC8A 2C1IA 4CQBA 3G3MA 4AZ5A 4C6FA 3W81A 4HA4A 1R8LA 2R1NA 4PA8A 2WMIB 1XYZA 1J5TA 1JDDA 1RBLA 3AXHA 4M80A 4W8LA 3ES7A 1S2TA 4N2YA 4JZ5A 2QCDB 2EPHA 3HJEA 3UG5A 3DHFA 1JYXA 2Q3OA 5HAOA 1MQRA 3UXLA 3UWUA 3L0KA 1SUXA 5HJLA 3RO8A 3E12A 1B3OA 2HVMA 4LF1A 3LCHA 2DP3A 4GC3A 1EFZA 5HJYA 2YKKA 3C8FA 2WC4A 1S5NA 3WLOA 4AHOA 1RVKA 3DERA 4QEHA 3VNJA 5CSYA 3BLIA 3ELFA 2XFRA 4MZ8A 1IGWA 2Z4GA 4DPQA 1RZMA 1EXBA 4ORMA 4UR7A 2C6QA 4D8ZA 1P4CA 4MPKA 3UP8A 1PZ1A 4CD5A 2PODA 1WE5A 2VC7A 4WXZA 3BGGA 2YW4A 1EO7A 4ACYA 2BP1A 1EJUC 3VGBA 4YWSA 4NF7A 1KC7A 3MUY1 4QJ3B 4AEOA 5A8OA 4CN6A 3AS0A 4PUWA 4YJ5A 1K8ZA 4C6NA 2AOSA 4M3PA 1CWYA 1WDWA 4FNPA 4G7EA 1C91A 3GFYA 3UF9A 3UWWA 2IPJA 2IPFA 2Q8LA 2JIEA 4J7RA 4PUDA 3PF3A 3RFAA 2XIBA 4HK6A 3V5CA 3CB8A 3MI6A 3OG3A 5CG7A 4LYQA 3SCUA 3GBEA 4Q4OA 3W38A 1RQHA 3T8LA 1KFWA 4RW5A 1E3ZA 3W01A 4L9XA 1ZALA 4AD5A 3KBVA 1YE4A 2X7WA 4DWSA 1XLKA 1CDGA 4NZ1A 3KTCA 3H53A 1E40A 1YADA 2Y7FA 3UD6A 1VEOA 3GH5A 1DBTA 3TSBA 1MSSA 1KFEA 4PUKA 3ZT6A 4HD5A 3RK8A 3TP4A 2DEPA 3G2GA 1OCBA 1JI1A 4DBDA 3VMNA 1E6SM 4GYJA 3MUZ1 3RILA 4HBKA 3UG3A 1BWLA 2H8XA 2Y89A 3M46A 4GJJA 3Q37A 1UZHA 3AXKA 3M64A 2J75A 3M7SA 2PEVA 1BYBA 2DUAA 1GJUA 2WZTA 4DZHA 1UR0A 4FOKA 2EAWA 5G1MA 1JAEA 4AHPA 2WZEA 1IWPA 3DFQA 3FJ4A 4CQCA 3CUIA 3UNDA 3CHDA 4XO6A 1QW7A 2IKHA 1OQFA 2QEZA 4C5YA 5HOSA 5C55A 4O16A 5FOOA 1RJRA 4WKAA 2W27A 2CZEA 2Z00A 4UC5A 1QHPA 3UJFA 1ICSA 2GUUA 3GDMA 2E9LA 2Q01A 3N04A 5DLCA 1R3WA 1F3WA 3QKZA 3WNOA 4K8HA 4M8UA 2PLCA 2INZA 4IGMA 2E68A 3WQ4A 1E55A 4W7VA 3CWNA 1V8EA 1J0ZA 2GGGA 1FWEC 4WCJA 1E6QM 3P8IA 1XIHA 3N2BA 2EPMX 3MDUA 3RJXA 2UY3A 3PR2A 5G1TA 3QYQA 3H70A 3NPWA 4E2VA 2I5QA 4Z1BA 2VRKA 4UMCA 4H00A 1CW2A 4ZXLA 1OCQA 2PDJA 3K8LA 2PDNA 3E5PA 3QV8A 4IUOA 3BSHA 5HINA 1BG4A 4L9YA 3UJEA 4JKLA 4YTSA 4J2MA 3W1TA 5A6SA 2I9EA 2OG9A 4NAEB 4CU8A 2Y4SA 3ZMRA 4FAMA 4QG8A 4UXDA 3IIXA 1UASA 3AC0A 4GABA 1VZWA 2A0NA 3RU6A 2A21A 3N4FA 2UY2A 2UWFA 5A6AA 3AYRA 3AJ7A 3H8AA 4L1GA 3LBOA 3UPWA 5CBJA 1YXCA 1SO6A 3DHUA 3QHMA 4R3UA 1ZRQA 3BLKA 3MZNA 1XYAA 3M0VA 2CLFA 4QNEA 1AH0A 5BU6A 4Y9MA 3GYCA 2XDFA 3B4YA 2E1WA 1KW1A 2Q3RA 5D2YA 3VDGA 1CXHA 4FXFA 2D3NA 1DIEA 4LF2A 4CEXC 3EX4A 1H61A 2J4GA 3W75A 1FWIC 1GZJA 3BXWA 2WVTA 4FPSA 3TCSA 4GY0A 3PSVA 1W9VA 3VMOA 4I9TA 4B9YA 4Q7NA 1VEPA 4L6DA 3E96A 4MWAD 4DAIA 4XISA 3T08A 5AVHA 2IUZA 2OTDA 2CHNA 4HZMA 1W9XA 4JHZA 1D8WA 2JKAA 4PUMA 3WNPA 3ZIZA 1AZ1A 1T6MA 3S0CA 3BLPX 1T7LA 2QJHA 2VO5A 1D2KA 3BCFA 3PWIA 5KEZA 3G1AA 1EOMA 4RPQA 2XM2A 4EPBC 1L8NA 1I0BA 3EPOA 3R12A 2BNJA 2EG6A 4KPLA 1ZJHA 2EPLX 2V63A 5HUOA 3LB0A 4ECLA 4EIVA 5KSWA 4NNAA 1LLWA 2BXVA 3AZTA 3G6MA 3UZ5A 3QFWA 4IL2A 1Q2RA 4RZ4A 4DX3A 3LM3A 4A3HA 1WXJA 3VVGA 2P88A 4HTBA 4UTHA 3EDEA 5JIWA 4FX6M 2YCEA 1PSCA 3W07A 3HM7A 2QPSA 4QDWA 1HT6A 3LPFA 2Y24A 4DBEA 4W7UA 2ABAA 2PLKA 1FH7A 3H7RA 2ISVA 1M53A 2AQVA 2W5FA 3D3AA 4S23A 2Z29A 2GVYA 4JTTA 4K1GA 4TO8A 4FR6A 3EDFA 3F4NA 3E0IA 1T0OA 4DUVA 3PY2A 4FNQA 1NY1A 2RH9A 4J35A 1UD8A 3Q45A 2WCSA 1FWSA 3OZYA 4XZBA 4ZFCA 1JCXA 3FA3A 3W73A 2CC0A 4JTEA 2PB1A 2BVTA 1W9DM 1XSJA 5BXRA 1UD4A 3UXIA 2VC9A 4LCSA 3TNBA 3IK4A 2X1UA 3VE7A 5LNSA 2JGYA 4ZE5A 1TQXA 2HVOA 3LBCA 2VZSA 3LPGA 3TAKA 3HPZA 1JCYA 3NSNA 4IIHA 5A3HA 1BXBA 2CU0A 3G18A 2VZOA 4YCPA 2VQTA 1UKQA 4MUZA 2EPNA 3I6RA 2GK1B 4O1DA 1UOKA 4HK5A 1HP4A 3WBWA 1VENA 4CCZA 4C6BA 1VBRA 2DSZA 1QHZA 1FDZA 1MW1A 3IRSA 3NZ1A 5I2UA 1VFMA 1U5VA 1EA0A 4IWWA 5D38A 3AISA 3VIKA 3M16A 4X0NA 2VEIA 8TIMA 3PZOA 2VZTA 1CLVA 1ZAIA 1W3IA 4JS3A 5JQ9A 2NWRA 4D6HA 4ERGA 3HGSA 3BAWA 3AWNA 4HA1A 1TFVA 4GC4A 3SCRA 2OELA 2YR1A 5M2FX 2WVVB 4LOCA 1T96A 3DEQA 4K37A 3GDTA 2YCLA 5LKYA 3R94A 4WJXA 5HMDA 1VYRA 1M03A 4Z1YA 2GVLA 5LIYX 3GC4A 4WX2A 2FDMA 1UJQA 3W53A 3QW4B 1PS9A 2Q02A 3SUVA 3II1A 4JDYA 2JGQA 2WVVA 9XIMA 1XIGA 3V75A 3GC2A 3NQGA 3PBYA 4G7EB 1CXEA 1VD6A 3GG7A 1YIXA 5AOUA 1C8XA 3O6CA 4AWEA 1EUNA 4ZTXA 4S3BA 4XK2A 3AS3A 1IZCA 2QULA 2XG9A 4WDUA 3URNA 1DJYA 3MB9A 2PTYA 4JN7A 4B2DD 3M0LA 1HZYA 3SRFA 4Z0SA 1AODA 3HURA 2NQLA 2C16A 4KFOA 4N02A 5AY7A 3A4JA 4QSFA 4YN5A 1BTMA 2BHUA 3AI0A 4KGLA 1A0CA 1OFBA 5CQ1A 2DVXA 2BY3A 3T81A 4DWSB 2GGEA 2ZUNA 1TZZA 3O2LA 3W72A 1CNVA 1XCWA 4URIA 2CIPA 1FX6A 3NYZA 2V6AA 3Q2DA 3QBUA 1REQA 4ZO9A 4V2XA 3LGGA 3SCWA 2QIWA 3RCMA 3B8IA 3TYBA 5CZ0A 5CPTA 2XJ7A 2QCEA 3C52A 4TV5A 4RE3A 1NU5A 2DY3A 3GH4A 3DZ1A 1F2JA 1OHLA 3SQSA 2ZXQA 4H7CA 5KINA 1M5WA 4O14A 2WKLA 3AUJA 1V6XA 4MB3A 4HMDA 5H8UA 2HBVA 3BMVA 4LWWA 9XIAA 4ZODA 1V6TA 3C86A 2V5LA 2OOGA 3QY7A 4QISA 3V1PA 3SR7A 2OO0A 4D6DA 1Q2SA 5CZJA 4XKYA 3G77A 2A6LA 3FYPA 4I9JA 2PDGA 1UW9A 1L2QA 5D8WA 3OYXA 3OIHA 2E6YA 4JTUA 4JHMA 4LUJA 3LV5A 3RM9A 4XZNX 5F4SA 3SDOA 3IGUA 3WMCA 3WL1A 3AO0A 1GVYA 5AHMA 3BE7A 4A3YA 1KFKA 2YDQA 3LSBA 2CNCA 2ZX6A 2VD8A 5ECVA 5LSMA 5B80A 4QJ1A 4H8NA 5TD4A 4D6IA 2E40A 2CCRA 1RAKA 1UBPC 2XISA 3PZUA 3U4AA 2E4TA 1H09A 3PBWA 2PTDA 1DJQA 1ITCA 3UCCA 2Q71A 3PHAA 1IHIA 3I3BA 1TPH1 4NI8A 1MQPA 3VOCA 4OHQA 3EXTA 4KWSA 2AGKA 1KB3A 1E51A 5HQMA 1KGXA 3OQ8A 1H1NA 1LWIA 4QLJA 4NVTA 2YB1A 4QFUA 3FCPA 2OKOA 4REQB 2VDGA 3ZJ6A 2Y88A 4GPNA 3IJ7A 5D9OA 4IIFA 4C1NB 5LGXA 4UNKA 3M0HA 2NV9A 1H3GA 4CGTA 1RPXA 1TE1A 4W9TA 3IJ9A 1L6WA 1R47A 1VJZA 1F6YA 4QS5A 1NQ6A 1E0UA 4OV9A 4B5XA 1FHDA 1I2RA 3UBPC 5D2TA 5JVLA 4ERAA 2DW6A 1A5BA 3ARPA 3ATZA 1Z44A 1NP2A 2F6UA 3MKVA 3V3WA 5AVNA 2E6FA 4NYUA 3P62A 3QRHA 4F9DA 2G3MA 2YLAA 1GWJA 3GTNA 4XKYB 2I7GA 3JR2A 3LDVA 5T26A 5M03A 4ROPA 1MDLA 3CHFA 4W85A 4DWSD 1EEPA 3LYEA 1BHGA 1XLEA 3CL7A 3VKCA 3S1XA 1V6UA 3SGGA 1YYAA 4I7VA 2RDTA 1BRLA 2R82A 3CZEA 4KRZA 4GI8A 2DGAA 1R3TA 3WMSA 4TX9A 3PULA 5DY2A 1VQTA 1QNPA 4NT0A 4GKLA 2GWNA 3QQ1A 3GTFA 1R6WA 3S9YA 1K8YA 3BMXA 4QIUA 4BEUA 2OYMA 3SADA 1W37A 3M0XA 5BRBA 3OOQA 3I6EA 1U1HA 3H23A 4NASA 3OEXA 2CLOA 2J7HA 2B7OA 4E8CA 1VKFA 3BOXA 4K7YA 5BCAA 1Q66A 2UBPC 4JXCA 5JBEA 3T9PA 1I1WA 2XVLA 5BOEA 2YB4A 1LORA 3OLIA 3WF3A 3VPLA 2I1OA 3BAJA 3GX9A 1JR1A 3ABRA 1XISA 4W87A 2PDPA 5CSRA 4G56A 4YYCA 4IP4A 4PBGA 4CNUA 1QUMA 3JZEA 4JTRA 1DJWA 5T8GA 1YW1A 3UQNA 1U5JA 3WQOA 4I90A 3E38A 4KESA 3C8NA 1PX8A 2E5CA 2GJXA 3UZXA 1G1YA 3EX3A 3LN3A 3U4FA 2YA1A 1EB3A 3QGVA 3ZYZA 2DSVA 4GUGA 3OBEA 5HR6A 1Y0EA 2GQ9A 3UVAA 4OECA 5EBUA 3W2LA 4Y9PA 4MKSA 4HMCA 3GVQA 4UTFA 4EWND 3BO9A 1EBGA 2XFWA 1Q8AA 3OGRA 3FGCB 3H6OA 4TIMA 1QK0A 4JHOA 1KRMA 3W88A 5E09A 1Q45A 3V16A 3C3NA 2IKGA 4UTJA 3KRBA 1O94A 3H21A 3NDYA 5M1TA 1LRNA 1NM9A 3V0UA 1E3XA 1ONWA 1DE6A 4UFHA 3N2XA 4JKKA 2ZX8A 1K6AA 3SAZA 1XBYA 3AU6A 4LUTB 4MMWA 4LBSA 2ZZ6A 2C19A 4WLCA 3QZ6A 3UR7A 4Q4RA 4DWSC 3UGVA 1OFQA 1CXKA 3BMWA 3QKEA 1HG3A 1FUYA 3U57A 1G4EA 2A3EA 4UTIA 4HNUA 1X38A 2J7EA 2V38A 1EPVA 3WBYA 1EC8A 1L8PA 1XPYA 1ZU8A 3S5YA 3HOJA 1K7EA 1M9HA 1KQZA 1WZLA 3IJQA 5I3HA 3GKFA 5F4XA 2G97A 4J9JA 3W7OA 3ZR5A 3KUMA 2QJJA 3NQEA 3WLHA 3A4XA 5TNVA 3UA4A 1EF3A 2Z24A 1DJZA 1JYVA 1KFJA 3A12A 3S1WA 1W1YA 2ANUA 3C61A 2GSJA 1JDFA 1IEQA 3FIGA 2WJDA 4Z2LA 3L67A 3A3XA 3DAQA 2VXNA 3CPRA 1ZP4A 3A5FA 3B04A 1HNYA 2NLYA 3EAUA 5E6ZA 1UH4A 3SQMA 3IARA 2O9PA 3NDZA 2WNWA 2NQ5A 4GH1A 1V3LA 3UXDA 1UWUA 3CH0A 1X39A 4LUSA 5EU9A 4CD8A 3WDPP 4PMJA 4WSJA 3NUKA 1FH8A 1S2UA 2EGZA 2WC3A 3WG6A 3OIXA 1C9WA 1Z7AA 1PDZA 3DUGA 1A5OC 3NEVA 4AX6A 2XWEA 2DIJA 4H9YA 1XGZA 1V3IA 1EPXA 4HU0A 1BVWA 4KGJA 3VC6A 1GOWA 3E0LA 3MVTA 3BLDA 4I5RA 1ZBVA 1BWKA 3GFXA 3I4KA 3RCYA 4BQ4A 1W2PA 4OFCA 2GJNA 4JY9A 3EYPA 3IIOA 1AMKA 4IL0A 1DYSA 2OWWA 1XYFA 1MXGA 1NFBA 3B06A 4LJ3A 3RF9A 3DFHA 2BODX 4NX5A 5D33A 2X0HA 1Z6KA 4KWUA 2J7BA 3WQGA 1J6PA 4FLSA 2Z1WA 4YHEA 5D05A 3OVGA 3AALA 2D2HA 2QDHA 3MUIA 3PFMA 1UWQA 3MKKA 4AD1A 4CD4A 4QSHA 3ZQ9A 2PC4A 5JMUA 3RRAA 3PSWA 4RDVA 2VUNA 3OGSA 3ZS4A 1N55A 4DN1A 3I68A 1H62A 4PULA 5HQEA 4PE8A 3RIKA 5CZTA 5DCDA 4MM1A 3CQIA 5HMEA 1VBUA 5CG0A 1TWSA 1TA3B 1UKSA 3S6OA 1YMYA 1W6TA 3L0NA 4DF0A 2ZOXA 4JIPA 3B3DA 3V7PA 2OODA 3IVTA 3WBXA 3UG4A 4IGNA 5I77A 1T8QA 1W91A 2P0IA 3W7HA 5A69A 5CPLA 1X8FA 3DI0A 4Z0JA 3WSUA 5LA1A 3TTEA 3QXBA 4BWLA 1PDYA 3M44A 2B81A 1EEXA 1J6OA 1US0A 4C7DA 4JTDA 1A5KC 5JBFA 1B2YA 1G69A 1XLHA 3PG8A 1TPFA 4PB5A 4U28A 1FCVA 3KOXA 3ZO9A 2V0TA 2A79A 1UROA 3POCA 1MMFA 1DWFM 3BW2A 5HANA 4L1XA 3W76A 3O06A 2QCMA 2X1IA 3R43A 1CGYA 3BWWA 4DO4A 4DM1A 1MEWA 3TR9A 1JAKA 5G4HC 3LX9A 3FNDA 1B54A 4DI9A 4QG6A 2VEGA 4XBKA 1J2WA 1ZLPA 3MHUA 2DFAA 3RMEA 1FFQA 3RCNA 4AD0A 5FL1A 4AZGA 2PTZA 4OE7A 1C90A 3ES8A 1JXJA 1QPNA 4PTNA 3CM4A 5HDRA 4M5PA 1VCVA 5FCZA 4O13A 1EUAA 1PPIA 4MYXA 4YLWA 4XUYA 4DJDC 1OT2A 5FF0A 3MA8A 5CGTA 3PZMA 3H12A 1W1PA 1YTEA 1MI3A 3KOZA 1SPQA 3L2IA 1OFDA 4XAPA 3RPMA 1IT7A 5FJUA 3WDJA 3B9OA 3NG3A 2DH2A 1UPPA 3M6DA 4RZBA 4O18A 3GD6A 4R7WA 2QW5A 3DFSA 2O9OA 3FJ6A 2VGIA 1PEZA 2HXUA 1EXPA 3EOSA 4IMDA 3ITXA 4LY4A 4RLIA 1G6CA 5I0DA 5I3IA 3GO2A 1G94A 4CU7A 5L9FA 4J2PA 3VKBA 4S2CA 1VCFA 4R53A 4A29A 1XS2A 4QE4A 3CT2A 5D9NA 1EC7A 3H2AA 4ROQA 3FSTA 3J7HA 1GG0A 1SJCA 1FP8A 4M0XA 3ZLGA 4UWMA 4Q8WA 1PWLA 3WDIA 2DVUA 1TRDA 2J25A 1BGGA 2OPJA 3AXIA 3APYA 3MZ2A 2SFPA 4EXBA 3NL3A 5HATA 4F0LA 2ASHA 2WWDA 4LU0A 1LDCA 1OF8A 1GOKA 4P7RA 3SGUA 4P61A 3ZOAA 3EX2A 1XKJA 3K30A 1L2UA 1S2WA 4L7ZA 1OWQA 3CPGA 3OG2A 1RY0A 3HG3A 4ZO7A 1RBAA 1I0DA 2WKJA 5FA5A 3VX0A 3VOGA 3R89A 4C6CA 5BU9A 5D2WA 4DELA 3HIJA 3KS5A 1DP0A 1EYWA 4FX8A 4RNHA 4F66A 3B0PA 4WGXA 3T2OA 1KQYA 5C8BB 3MTWA 3TJLA 3LHZA 3TLQA 3AIUA 1KKOA 1HKVA 1TIMA 2ODOA 3EOLA 4O28A 3I3DA 4MJ2A 3LMZA 1HO1A 1MEHA 2VX5A 5DEZA 1CGXA 4LAOA 2J47A 1PIFA 1KCLA 3NVDA 4N9BA 2AAMA 2QDGA 3EX6A 3TX9A 3W7GA 2W9MA 3SCPA 3F2CA 4A05A 3H4WA 3CUGA 4GZ7A 1KKRA 4H9UA 3S9ZA 4QP0A 4MDPA 1EHAA 4I7WA 3W7QA 4C60A 3QN3A 2V82A 3UWEA 2JQXA 3IIPA 4U5IA 2VGFA 1WXZA 3LXCA 1T40A 3MCOA 4FXJA 1M7JA 3OW1A 3PC0A 2J78A 5I00A 3TSMA 2OZTA 3KDOA 2W62A 1H63A 3S4TA 4C65A 2DUXA 3QR3A 2B7PA 1VGAA 1XLIA 5IBXA 3QSTA 4CNTA 2VCAA 4LUTA 2ZXBA 5IOBA 3C3UA 3VKAA 4PMDA 4X22A 4HNVA 5HNRA 4S3EA 5CJ5A 4Q8TA 2ACUA 3TTQA 1YNQA 1PKMA 2X16A 4E3VA 4IXXA 5XIMA 2O9RA 1BLIA 1RVGA 2WJEA 2FZBA 4L1WA 1DWGM 3LSCA 2FB3A 4O50A 3Q4DA 4DLFA 2FGBA 3BZJA 4HJFA 3PB2A 4JIRA 4C7FA 1KFBA 5C5YA 3RLVA 3VD9A 1YKWA 3MV11 2WOQA 2LLEA 3TFXA 3T8QA 1WKYA 1FQ0A 4ES4A 5HPCA 4GBUA 1WO2A 3BG3A 1DIDA 3TU9A 1SMDA 5REQB 1XRSA 3IIVA 3U48A 1CZ1A 3RX3A 2VFHA 8XIAA 1F74A 2WSKA 1TMLA 2CXEA 5C2XA 4FALA 1GGOA 5CSUA 4NJIA 4MNJA 1QDSA 1KBKA 2WB5A 3BV4A 4S3FA 2I9UA 2PDIA 1VFOA 1QAPA 3K8MA 1TVPA 4RXFA 3VINA 1XLMA 2A2IA 3C0JA 1Z69A 1EJ7L 1UKTA 1J2BA 1C29A 5KETA 4Q22A 4WQ6A 3TK7A 3MC5A 1NELA 4R5EA 4IPNB 2Z6IA 3UWYA 1NFGA 3VUPA 2E25A 2YYUA 4KRTA 3R8HA 5KZDA 4X9SA 3BW3A 4WF7A 4ZO6A 3GG1A 1XP3A 5CZKA 1XC4A 2FDSA 4DJEA 3EDKA 4D72A 4CUCA 3K8KA 4L64A 3G1HA 2PTWA 1XIEA 2HQAA 4UQCA 3ALFA 3N6HA 1DOSA 7TAAA 2CETA 5M5DA 4H7ZA 1I9CB 1K70A 3NQFA 1V3KA 3GRIA 3LOTA 3XINA 5LYRA 2WVUA 2HK1A 3LCFA 5FAGA 3LS9A 1BFNA 1ZSXA 3CB3A 1J0IA 3IVSA 3E49A 5C70A 1W8GA 1X1OA 1VH7A 3OA5A 1TJ0A 5DCEA 4JIEA 2XZ7A 1QCWA 3GXIA 2BB0A 1MNSA 2OFJA 4HNOA 3TNOA 1FKWA 3WJSA 1US2A 6CGTA 2UV8G 3VD3A 2BASA 2GSEA 3K4DA 3WF4A 3HFTA 2G41A 1JZ5A 4BI7A 2ZZ2A 1OFAA 3INPA 2WSRA 3AMGA 5CLTA 1GYLA 5K4XA 1R0MA 3L68A 1UWIA 1O5RA 2A7PA 4ZQCA 2XN2A 3QLLA 3T78A 3W29A 1Z41A 1VCGA 2BS9A 1RXOB 5G5IA 4LYPA 3LTSA 3W6YA 2PC8A 4A21A 3ENLA 2WAGA 5C0QA 3WLIA 2GJLA 3TMLA 3WX7A 3R1ZA 2O9TA 3QOMA 3WLRA 1KXTA 2QV5A 2YYTA 4HOZA 1JCJA 1YBQA 3GR7A 1FHVA 1DJIA 1N8IA 1S1PA 5TQLA 4KERA 4Z2IA 3MI2A 3OZPA 3ZXWA 3IGXA 1EQCA 2R6OA 4ZFMA 3TEVA 2VM8A 3BCDA 4BWLC 3B0VC 1YBQB 5LGZA 2RGLA 1ZS2A 4AVOA 1FTXA 1U5HA 3VCCA 3H2NA 2BDQA 3FJNA 5K9CA 4UFMA 4AAJA 4O54A 3UPBA 1E9YB 3B03A 2TYSA 1R5YA 3HB9A 4XZHA 2E6DA 1VPYA 4HSNA 4JN6A 5FSDC 4MZ1A 1WBJA 1WQ5A 4IJCA 1K7XA 4HA0A 4RV3A 4EWJA 2VZUA 2YBTA 2NQJA 4Q8QA 3W23A 1OX5A 2NUXA 1JVNA 4FOUA 3MP4A 1S3TC 3MKCA 3TMQA 5IRPA 1WXYA 3ATYA 4X0VA 1KFLA 3M0KA 1J79A 3MSYA 2PFHA 3EXRA 3QMRA 1RJQA 5LIUX 2YXXA 3S42A 2GZXA 2ZDRA 1NDVA 3ORWA 1Q5MA 1E72M 1C9DA 4RXGA 1KCZA 3AIWA 5FJOA 1VP5A 3ITVA 4CKQA 5G2WA 1R3VA 1WZAA 3TROA 3ABZA 1NOFA 2HK0A 2IW0A 3DG6A 1J0JA 1KRBC 2ZIDA 1UMYA 1A5UA 3A3HA 2J8GA 3TH6A 1XWYA 1DWAM 5MHBA 3C6CA 2ESCA 4S2BA 4FHAA 4MFEA 2FH8A 2YCLB 1VRXA 2PCEA 3Q65A 4ZSTA 2V5JA 3DFYA 3OLGA 1SZGA 1UA7A 5A2AA 4MWAC 4M29A 3L4VA 1HFBA 2E5BA 1UKPA 4ZA0A 1P0DA 1LQ2A 3I65A 4FEZA 3BAYA 3TYCA 2X30A 3AXMA 1TKKA 2OMAA 5I5RA 2CLMA 3ME3A 2NT0A 3EKLA 1N2VA 1JULA 2VHLA 3UXKA 2O56A 4EX4A 3VNYA 2QPUA 3DKLA 4IPLA 3UEQA 2HTMA 4XD5A 2OOFA 1GTHA 1AD1A 3VNIA 3JVAA 4BA0A 4DJFD 5CXPA 2BVYA 2ZVRA 1KR0A 4JNYA 3DENA 3WENA 1YPXA 4Z2HA 3CT7A 1I1XA 4IP7A 5HBFA 1PUDA 1JPDX 4ZB0A 5BMXA 2G5WA 3GVGA 4BI6A 5M17A 3LZ5A 4DZAA 4J27A 3BV7A 4Q8UA 4FZIA 4GCAA 1F05A 3IJ8A 4MPQA 3W7JA 2JFEX 3A4AA 3L4XA 3VGEA 4GWEA 5FJRA 3FOKA 3SJ3A 3HO8A 3W85A 4AZ7A 1NJJA 1H51A 2F61A 4J3VA 2OT0A 3S83A 2GDVA 4G1KA 1WZMA 3CC1A 3IJ6A 5J5RA 1EGVA 3QY6A 4OQVA 3G1YA 3IRDA 1GJPA 2YXGA 4DYKA 3P14A 4AZCB 1FDJA 4AMAA 3LXAA 3WLMA 1XYLA 2X09A 1QO5A 3VABA 3VKJA 2ZA3A 3RRXA 1W17A 2CLEA 2NQZA 4C6LA 4R85A 3WFAA 2E67A 3VU2A 3W7IA 4RNFA 4K2SA 1DQWA 4G7FA 1QRQA 3PWGA 1BKHA 1RLDA 1GHSA 1KFCA 1M68A 3CUFA 1ICPA 2QJNA 4A35A 1H49A 2GGHA 4LUIA 3DFOA 4L80A 1R9XA 3W1UA 3TW7A 4ADSA 5FKYA 5HA7A 1BQCA 3L21A 4XTIA 5CPSA 4MSSA 2H6RA 4E2OA 1YPIA 1GOMA 2BGQA 3PVFA 1S38A 4W5ZA 1ESWA 1GQNA 4OBTA 4D8LA 5C71A 4GYPC 3R10A 4GQQA 1FH9A 2I17A 3SGZA 1R3YA 3UYIA 1FWGC 4MDOA 4PUNA 1TPWA 3WD0A 4FK9A 3BC9A 5K7JA 3REQB 4JNMA 5D2XA 1AMYA 4PUJA 2POZA 2YSWA 1G7UA 1OFEA 2VL4A 4NNBA 4Q4PA 1F3EA 4R33A 4P8VA 4HZ7A 1L0PA 3LBMA 4AY8A 3HGJA 4O1CA 1UYQA 1VC4A 2A1YA 4HKPA 3VTRA 1TV8A 4UIOA 1WDDA 4LTSA 4UFIA 2J24A 5J8LA 3GZ3A 5I3JA 4ZGYA 2Z2BA 1XFCA 4LAUA 4XB3A 1VIWA 1JCLA 3KTXA 5EMUA 1JD9A 3C0QA 4WJ8A 1I60A 3BLFA 1R2TA 1IWAA 4C1NA 1DIOA 1SFJA 2GPTA 4JEQA 4ZB5A 5I3DA 2W92A 1GOIA 2FYMA 2XN1A 5U4NA 4W5UA 5EBAA 2QJIA 2PAJA 4JTIA 1LLZA 3UETA 4OWGA 4CEUC 2WZHA 1YDYA 4UCGA 2PSNA 4A3RA 2MUCA 7ENLA 2GVJA 2G96A 3AWOA 2QXWA 2KX9A 4IPIA 2DJXA 1D3HA 4NZ4A 4PTWA 3WQPA 1RPKA 2Y8VA 4F0HA 2OZ8A 3FSUA 2PWUA 3O8AA 4JTGA 2CKRA 1M01A 2E9MA 4MGGA 5D9MA 1J0KA 2NW0A 1DKWA 1KTBA 4BFAA 5CBIA 1DQUA 3FEQA 2F84A 4D9PA 1H41A 2E3ZA 3KRSA 1OGSA 4X9YA 3VNMA 4Q3MA 3FVMA 2P3EA 3EOOA 1WDSA 1OT1A 4UQBA 1L6SA 2VP8A 3SUUA 1TG7A 4KETA 1FOBA 2Y63A 1HX0A 2PDBA 3TONA 2CBUA 2WYSA 4XWUA 1TTIA 1LBLA 5KZMA 3F4WA 3DH7A 1VRDA 3ARQA 3FKRA 1ZQ5A 3GW0A 4K1WA 4K3ZA 1W9PA 2ZUVA 4PSPA 2OYKA 3SQLA 3HV8A 1VFLA 4RW3A 7ODCA 1US3A 3N15A 4J5NA 4X61A 1OFOA 4PC8A 1TRIA 4UBPC 2Z0IA 2Z26A 2WMFA 3VIMA 3U5UA 3N2CA 3IUDA 1J12A 1X7IA 1AW1A 3ZSTA 4HT3A 4AYGA 4OV4A 5CJMA 1V6VA 3GNOA 3EZ4A 2HVNA 4GQ0A 5AHLA 1DPMA 1WYIA 5CEWA 3QF0A 2E7FA 4YTQA 1JL8A 3VO0A 3AHVA 1GONA 4KMQA 1ZAJA 2DV0A 3NGJA 1V08A 3FV9A 2C1GA 3ONBA 3C2EA 1UQYA 3GU2A 1E70M 3N3MA 3W2JA 1Q6GA 1XDMA 4NQ1A 1FXPA 2XH4A 3IUIA 4RZ6A 1W3KA 3NO3A 3WQVA 4KW2A 3WJWA 2B0MA 1EHNA 4RDZA 2VDHA 5D03A 1U22A 3A3WA 4OBRA 3P82A 3TA9A 1CX9A 4B5VA 5FF7A 4E6MA 3LCLA 3STGA 1XQLA 3LENA 4HN4A 4P5UA 1OX6A 2RFGA 1M7XA 1P1MA 3K13A 2G4JA 3KP0A 4LVGA 1M65A 3PBMA 2D22A 3NZQA 3SIZA 1H1YA 1UH2A 2OVLA 4DJFA 4DHGA 3U0HA 3V5OA 3L23A 1OYCA 1TPDA 1J9YA 4Q4SA 1R3SA 1HN1A 3NNTA 4G8TA 1PB0A 3NQVA 1RA5A 3NQ2A 3EWZA 3O16A 3H2CA 4LYKA 1H7NA 3F2DA 3IWPA 1C8QA 1UZDA 1J0YA 1RQBA 2WWCA 1GVFA 3UR5A 3ARTA 1GVRA 4JTLA 3DYPA 2WNZA 4Q6XA 4H6KA 3NEHA 3ERPA 4JL2A 2FHBA 2QNEA 4GE8A 3UJRA 2PD5A 2QUMA 1KRAC 3TC6A 4FS9A 3G0UA 5F4WA 1VPXA 3WD4A 3W2MA 2A3CA 2QPXA 1WDPA 1NOUA 3TOYA 4LAKA 4LB4A 5RUBA 3T0TA 3WLLA 1JZ6A 2FTPA 3W9ZA 2PP1A 4B3KA 5GPRA 3STCA 5LNVA 1NAL1 1SR0A 3G1RA 1O68A 2QV4A 3SFWA 1R86A 3EWDA 3KCJA 3WJXA 1TWDA 2ISSA 1HW6A 3AICA 4JGDA 1JRBA 3KTSA 1GPWA 2WVSA 2HE8A 4QNWA 3MHGA 2ON3A 5ENLA 1TV4A 1EO5A 2FVLA 3A13A 3B0YA 3SN1A 3MBDA 3V5FA 1XH1A 1JRCA 3BCJA 3U2EA 1TCMA 3B97A 3VIOA 3HFYA 5G1YA 2WZIA 2INFA 1EDTA 1CBGA 1W5PA 4LEFA 1J0HA 3TA6A 2WBGA 2WLYA 2GVEA 2VEPA 3VNKA 3IAQA 1GOOA 4F9JA 2YJQA 4HPNA 3XISA 1W31A 5IM51 4JCLA 4Z17A 2YDRA 1OF6A 1UUQA 3SURA 1CPUA 2OU4A 2VGBA 3B40A 5JU6A 3OU8A 4DUXA 3MO7A 2VCCA 3VFLA 2PLJA 3GW3A 3W2KA 3SY5A 2XIQA 1L6FA 2DT1A 3CAVA 4B90A 1NIUA 3R79A 1JYNA 1F3TA 1IWBA 3C56A 4MJ4A 5LHEA 1JCMP 4DB7A 2Y62A 2NWSA 2V3EA 5FJJA 4ZEPA 1UHVA 1VFHA 2JF6A 1KXHA 1Q6FA 2Y61A 1KCXA 3L4ZA 1KXQA 1VFSA 1BTCA 1KLYA 5DXXA 5AC7A 3MJMA 5BXTA 4JTQA 1RCOB 2PP0A 3KBNA 4PFHA 4XBJA 5CBBA 3O6YX 1E71M 3E9AA 3CQKA 1CIUA 1KTCA 3DHPA 3LNPA 5I79A 3NTYA 3TN5A 1E9LA 3VD7A 4FNUA 1TWWA 3R25A 2C0HA 1ML1A 4F79A 4RL3A 1E5NA 1EJWC 3A23A 4LB3A 3W7KA 3SEPA 1WA3A 4CQ9A 2ONEA 3L12A 5EYWA 2YZ5A 3KXQA 3HGOA 3H2MA 1V0LA 2ZE3A 1PX4A 3NL6A 2BBFA 5H2ZA 1Y8BA 1ME9A 4GYPA 1MFUA 1R3QA 2FFIA 2CZFA 3W1MA 3KE0A 1FWHC 1QPRA 3PM6A 4O0QA 4G1NA 4LBUA 5I02A 4WKFA 1FHLA 1WUEA 2HPMA 4HTYA 4QEEA 5JBDA 4JYEA 3NQBA 1P1XA 2Z7KA 4ML9A 1AUSL 2WXDM 1QNSA 4IMGA 2ZKMX 4L4OA 5ABEA 3GS6A 3HJZA 4XZ9A 1DEDA 1AG1O 1R3RA 1GEQA 1MDRA 3KWSA 3VOJA 1WNOA 4W8BA 1BD0A 3O9NA 4JFSA 3TSDA 3ZWTA 3N9KA 4IQEA 1YXYA 3KVKA 3ARSA 4IIGA 3KBSA 4TMBA 5E9AA 1A0EA 2FZNA 1GORA 4RKAA 4A3QA 3MT1A 4F48A 4IGHA 5LIKX 3FHQA 5HJXA 4BF7A 4WK9A 4PTXA 3TXZA 3M5YA 3DG7A 3TC3A 3OLDA 2QDDA 4WGHA 2IS7A 1RBOB 2VEFA 1IV8A 1QBBA 5IXEA 1CT5A 3LRLA 4GO8A 4MKNA 1ZJIA 1AZ2A 2WV8A 4V27A 4TVCA 3FYOA 3IGSA 4ATWA 3QPEA 1GZ1A 3UZJA 3W7MA 1NWTA 1OY0A 1XH0A 2QDEA 1SZNA 3H24A 1E5JA 3BDKA 2XHYA 1SO5A 3O0FA 4IM4A 3VIPA 2QCGA 1H11A 3WDQA 4KEVA 1D3GA 3W4RA 3W0KA 1OADA 1RHCA 2BTMA 5GQBA 3GNXA 3P3BA 4NRSA 2C71A 1UZ1A 4EF8A 1MUCA 4MY1A 5LXXA 1QNOA 1Y5VA 2I56A 4Q8PA 1T5AA 4Y8FA 4OT7A 2BXZA 4PGLA 3NYDA 2D20A 2ZZ1A 4UQEA 4U10A 4L4PA 4NHVA 1KCKA 1OZQA 2YBVA 1PKYA 3IPWA 5FSEC 5BYWA 1XLBA 1E43A 3C2VA 1S2AA 2W79A 3GDBA 3VIFA 3R8GA 1H5VA 3EMCA 3G8RA 4M6UA 1W1IE 1W5QA 2HV5A 5A2CA 4ADTA 1DXFA 4H9ZA 3KM8A 1WB0A 3WQDA 1IR1A 3QGAC 1PTDA 5LA0A 1SQ7A 3STFA 3GNDA 2CBJA 4Q32A 1R87A 4WR3A 3PNUA 1JI2A 1GVEA 2F9RA 1RCQA 1P48A 3CTLA 1GEHA 1Q6OA 2NZLA 2EPOA 1POKA 1WUFA 4XZMX 4IG2A 2YIHA 1VJSA 3OVPA 4KWOA 4XIAA 4DZIA 1W3LA 2YFNA 3QQWA 3TUUA 1SGJA 3JW7A 3GLCA 3TCEA 3NQ7A 4NIRA 3U5YA 2PI6A 5FF4A 4Z2JA 1ISZA 2CBIA 1Z89A 4DXVA 5C7HA 3SBFA 5HNNA 1WOBA 4J3XA 2F6XA 1W1B1 2WHLA 4Y9NA 3QV6A 2BG5A 3PS7A 4N9CA 1NEYA 4O1FA 2VEMA 1ADOA 4WOQA 1K6WA 1XR2A 1W5MA 5AYZA 1BXNA 4UTUA 4NJJA 1TB3A 4ZQMA 4JIIX 1W5NA 4LS2A 2PDQA 2ZA2A 3EGJA 3GK0A 1AFSA 3KVJA 4XX6A 2W66A 3WQEA 4QDMA 2XZ9A 2VFIA 3TOPA 2PWDA 4QS6A 5DT5A 2WO5A 4RZ5A 1O60A 1QASA 4JNZA 2YL5A 2D0FA 3VMPA 1FCUA 4RE4A 3PJXA 3CGTA 3ANYA 5DMLA 1E4MM 5HXMA 4HPGA 3WO8A 2AL2A 2OJPA 2EG7A 3M41A 3VGDA 4CD7A 4C6JA 4D6JA 3N19B 1N8WA 3ZLHA 3ARWA 3IVUA 2BY0A 2WNNA 5H8PA 1PHQA 1H60A 4AF0A 1JZ7A 1CXFA 1MZHA 4IFKB 4HOWA 4M82A 4XZLX 5ABFA 3W82A 5LNWA 4CVUA 5DBTA 3WD3A 2NUYA 5GJNA 3ZFHA 1PBGA 1TUFA 4OOUA 3GTHA 3TQKA 2XIOA 4NI3A 4AC1X 3VAVA 4ACZB 5EMMA 5I3KA 1OIMA 1I2NA 3W2NA 2Z2AA 4L61A 2XVPA 1TQJA 4Y2WA 2OEKA 2X1RA 4GUHA 3RHGA 2OWXA 3QGKC 4JCMA 4EK7A 4R88A 3QFEA 4B4FA 4P7LA 1J93A 2DZWA 4A8IA 4UB9A 1J01A 5FJIA 3MI3A 1UIOA 4BEQA 3ID7A 1JDCA 3OO2A 4J3TA 3QZEA 1CENA 1VYSX 3SCNA 3CMJA 3I4EA 4ZOAA 4AEEA 3RPTA 3CYVA 3KP1A 4XUGA 1V3JA 1IXPA 3DX5A 4NU7A 3M0JA 3I7QA 4KF1A 4BQ3A 5A6BD 1RR2A 4G2DA 3ZWSA 3MCNA 2DT0A 3NDOA 4KCTA 4AVFA 3GHSA 1N8FA 3RNDA 1WKDA 4S1FA 3RM8A 3EWUA 1QOXA 5D8ZA 3T1GA 4GNKB 1XUZA 4FA3A 3ZM8A 1G01A 2VR4A 3PPHA 4P7NA 3CZ8A 2PWVA 3O3RA 1E1CA 3PZQA 3POHA 3RX2A 3VX1A 3VXGA 4DF2A 4O8RA 4MIMA 3NCOA 2X40A 1TPB1 1VJIA 1OCNA 1PZ2A 3LCWA 4B91A 3AFBA 2PUZA 2OX1A 4LFYA 4UR8A 1D7KA 3ABQA 4ENLA 1U33A 2HROA 3ITLA 2WK2A 3MSDA 4N6FA 3V0SA 2OX4A 1NF0A 4NXSA 1J11A 1TREA 4N0RA 5SWUA 4UTWA 2ISDA 4X2RA 4IOTA 4ERIA 2OO6A 3P0WA 3FVDA 1OZMA 2DJLA 2G3IA 2NV1A 1LWJA 1MEIA 3VD5A 4PRWA 8XIMA 4GI4A 4TQTA 3LI0A 2FTYA 2HNHA 2QUTA 3KZPA 1LYXA 1YHTA 4X2PA 2FHFA 3ITCA 5EGRA 3GIQA 3MMTA 3EMQA 2OQLA 3VC5A 3AHZA 2J9XA 1OK6A 1R7OA 1O5KA 1GOXA 3NURA 2YDAA 2E77A 3TJIA 1XRVA 4TU1A 4N42A 3S2NA 4DJED 3GKAA 4GGBA 1YTDA 2ZADA 1RJPA 3AOFA 1OG6A 2CYGA 1AQ0A 5AZ1A 1VBHA 4MY8A 4US5D 2OLHA 5AYIA 2WCGA 1XH2A 1EWDA 2QLYA 3BVJA 3IIZA 1Y5XA 4IQJA 1Z42A 1YQ2A 3ITTA 3WH5A 1O1HA 1EH9A 1BWVA 1XLCA 3SCOA 2ZVIA 1QI3A 3MW7A 4PCFA 4QJ4B 2EG8A 4Z2KA 4GVGA 3SRKA 1I6NA 3B9EA 3FK4A 4XTDA 4QG9A 1JNDA 1KM3A 1P6CA 1ZCCA 3DI1A 4AX7A 3RAOA 1DORA 4JTHA 2P53A 2D3LA 4QRNA 1OK4A 1W9UA 1QI4A 2I5IA 4DIAA 4YWIA 2J8FA 4C6OA 4Y96A 3PUDA 3LD5A 1H7WA 3W6LA 4AVNA 1GT8A 4PBEA 1PWMA 4YMZA 1JPHA 1X96A 2ZC1A 5DXYA 4L4LA 2DSKA 1HJWA 4D1JA 4AC7C 3UZWA 2ABBA 4F0MA 4FLRA 2Z25A 1VFUA 3K5XA 4BR1A 4KIRA 3BK0A 5G2IA 4AHQA 4X63A 4UQDA 1XFBA 4NZJA 4OBSA 3E0VA 3VM7A 5HK4A 4E4PA 4HPXA 3GXPA 4J3ZA 2QMJA 4I9MA 3PJTA 3LQLA 4Y7EA 2O7SA 3OPSA 3VOIA 3VD4A 2Y7EA 3ZT7A 3HPSA 4MWAE 1XC6A 3WUEA 3AIEA 4R7OA 2QAFA 3OTRA 3BL3A 2W0UA 3NZRA 4BK9A 2DQWA 2E5DA 5DBUA 1K03A 2F38A 2EKGA 1UC5A 4GUJA 1Q65A 4HHPA 3ZR6A 4US5A 3GVWA 1I8JA 2H8ZA 5U7SA 2PU1A 3CIWA 3QTGA 4DUWA 2YW3A 4TV6A 3VDCA 3TKFA 1V7YA 2G3NA 2ZXAA 4F2TA 2Y1HA 5FJTA 4DLMA 1AW2A 2O55A 5CKSA 2QCDA 1ISVA 4EVZA 1VPQA 5LZLA 4AZHA 4ZQNA 2QR6A 4Z1DA 3W27A 5A95A 1V7AA 1A50A 1XDLA 3E0FA 1FWFC 1VHNA 2QCLA 3ANVA 3LK6A 5AYYA 3DU0A 2RDUA 4M7SA 4C7GA 4KEMA 3DKJA 1ZENA 2HCVA 3GU9A 2PWGA 1R9YA 3QMSA 4A8LA 2X05A 2ACRA 2DUZA 3VILA 1XICA 4E8GA 4JIHA 4E4FA 1XLDA 1P0BA 2FH6A 4JD4A 2BFGA 4GVIA 4GJIA 1ZBWA 2ZC8A 3CK5A 1UD3A 2X2YA 6TAAA 3LG3A 2J6XA 3KBJA 1HJXA 4GVHA 3MU7A 2IPWA 3OBKA 1R46A 4N4PA 1KBLA 3BOFA 1E0VA 4AEFA 3M5ZA 2VUYA 7TIMA 3HQNA 3WNLA 2FGLA 4Z1AA 3QR0A 3TZNA 4FF5A 1CEOA 3PANA 3GG0A 1FWDC 2QHAA 3ZVIA 1XF0A 3GHUA 3W25A 3TWAA 4WZHA 5IFPA 4L6HA 4UOJA 4QLLA 3WK1A 4HYRA 2Z1VA 5A6BA 2GQ8A 3B8VA 3E74A 1CB2A 3S46A 3M9YA 5BRPA 3NR0A 4TVUA 5D30A 4LALA 2GK1A 3S6DA 1R85A 4PYSA 1KV8A 1YE6A 2OWCA 4ASTA 4W4QA 1WZKA 3E02A 1U30A 4LC6A 4KH2A 1MUWA 1UKOA 1Y5WA 2BXYA 4NILA 4L65A 3OBAA 4MUPA 5I23A 4GGHA 4OJYA 4LQ1A 4EACA 3BLOA 2G4FA 2OKTA 4M1BA 2GUBA 5DCBA 2Y8UA 1A5SA 4UCFA 3A24A 4MY9A 5ABFB 1E6XM 4IMEA 4IX0A 1AQFA 3BOLA 4H9MA 4EKJA 2NXHA 1NWSA 4LW7A 2BY2A 5AYBA 1JCTA 3GUGA 3W28A 4DRSA 2WSPA 1JYWA 1Q6DA 3T6CA 3PZVA 1GPFA 4GH3A 2ZUUA 5DELA 3O1NA 4DJEC 1CGVA 5DRCA 4J3UA 1KO0A 2FZDA 4IIDA 3FGCA 2VYOA 2OLAA 2H9AA 1HXJA 2J13A 3LGEA 4XVEA 4MJZA 3A5VA 3GAKA 4HIBA 2C15A 4XV0A 2HXTA 2NT1A 1OC5A 4LBRA 2ZZ4A 2EHHA 3MMWA 2VQUA 1FCQA 5A5WA 4TTUA 3CV2A 1E4IA 5AC5A 3LI1A 3MYOA 4XD3A 4JR5A 2J9ZA 3IEBA 1DQXA 3CL6A 3AMKA 2PDUA 4AIUA 2HWGA 2PWEA 4FP1A 2A3HA 4H6RA 4B5UA 1S1RA 4L5ZA 3N25A 3MDWA 1MW2A 4XIMA 3CU2A 3H2OA 3D3FA 4AW7A 2MNRA 2FTWA 4H6QA 3ITOA 3LA4A 4NXKA 2WHKA 2ATMA 4P8UA 1DIKA 1DVJA 3EWCA 3SZ8A 4W7WA 1CCWB 3VA8A 5LHFA 3JRKA 3V35A 1UH3A 2W3ZA 5CC6A 4DO6A 4UOZA 2EKCA 2YFOA 4Q8NA 3LU2A 2MANA 3RXZA 4DI8A 3GXNA 3WUBA 1A53A 4P7QA 3CEPA 1XG3A 1RUSA 2CKSA 3LHWA 1UIPA 2POTA 4ZXOA 4MF4A 1KM0A 4K38A 3W70A 4QQ3A 4HNLA 3W1PA 5FACA 1YTKA 3WN6A 3SCVA 1XD0A 4OUEA 4E38A 1ZAHA 2Z6JA 1DJNA 1MFVA 2QS8A 5FL0A 2NVCA 4LRTA 2RJHA 3WNMA 4H2HA 3NO1A 1A0DA 1CTNA 2G0WA 3GDRA 4OUIA 3NL2A 3U7BA 3IV3A 3GFZA 3WMLA 3IAPA 3JZUA 4JTJA 4AIOA 4PRRA 4DBUA 3CASA 4YTTA 4HCHA 4U4MA 4WDWA 5A8QA 2ZUSA 3P61A 2ZX9A 2J8TA 2OEJA 4FNTA 3VK5A 4AZBA 1BYDA 1DJXA 5TF0A 3W37A 3FN9A 3A21A 4AXKA 1Q6RA 3C2FA 3XIMA 2PURA 3OVRA 3KBMA 3NQCA 4K68A 3E3HA 1FA2A 5HMSA 2R9RA 4PSRA 3RR4A 5F7UA 3N12A 3A22A 3AIVA 1LLOA 3L5AA 3URQA 1DWHM 4CCCA 3HMJG 3DYMA 4LVFA 2ALDA 1P43A 4ZSUA 1JF6A 3UVIA 2VWSA 2E28A 3WUGA 1ADSA 1TO3A