1GVFA

Structure of tagatose-1,6-bisphosphate aldolase
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
284
structure length
273
Chain Sequence
SIISTKYLLQDAQANGYAVPAFNIHNAETIQAILEVCSEMRSPVILAGTPGTFKHIALEEIYALCSAYSTTYNMPLALHLDHHESLDDIRRKVHAGVRSAMIDGSHFPFAENVKLVKSVVDFCHSQDCSVEAELGRLGSAFLTDPQEAKRFVELTGVDSLAVAIGTAHGLYSKTPKIDFQRLAEIREVVDVPLVLHGASDVPDEFVRRTIELGVTKVNVATELKIAFAGAVKAWFAENPQGNDPRYYMRVGMDAMKEVVRNKINVCGSANRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAGATOSE-BISPHOSPHATE ALDOLASE AGAY
publication title Structure of Tagatose-1,6-Bisphosphate Aldolase; Insight Into Chiral Discrimination, Mechanism and Specificity of Class II Aldolases
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 105
structure length 273
sequence length 284
chains with identical sequence B
ec nomenclature ec 4.1.2.40: Tagatose-bisphosphate aldolase.
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1gvfA00
1X6UA 4N2YA 3V75A 4MZ8A 3OHIA 3NGJA 1M7OA 3W84A 5D05A 1Q3NA 3PUOA 3EXTA 3DAQA 3P82A 5AFDA 2QCLA 1TPH1 3R5EA 1F74A 1X1ZA 3FFSA 3GDTA 2I1OA 3HGSA 1XFBA 1T0OA 3N34A 1SUXA 3W70A 4P2VA 1DORA 2VKZG 3MP4A 1VYSX 4IX0A 1OK4A 5F2IA 3W7NA 3HMJG 2DZUA 1OF6A 4CQAA 2NX3A 1QOPA 2B7PA 1K8XA 4PODA 5HUPA 1TPFA 2ZDRA 1YTEA 3OVPA 4JS3A 4MZYA 4N4QA 3S9YA 5AHMA 2V9DA 4E2BA 1DV7A 3LHYA 1W56A 1Y0EA 1OJXA 5I3JA 3PB0A 1RVGA 4OE7A 1JR1A 2A85A 1PVNA 3EWBX 3T4CA 3W2NA 1W1ZA 1QWGA 4AEOA 3LDVA 3M16A 3PM6A 1IXNA 4FX6M 3S8HA 3I6RA 3OIXA 4O52A 5EL1A 4CNPA 4DF2A 5FEXA 1ALDA 1JCYA 2ALDA 3TR2A 2FB2A 4C1LA 4OV4A 1K8YA 3W1UA 1O4UA 4DF0A 1WBJA 1YPIA 4U4MA 4O53A 1LORA 1KBIA 4AWUA 1ADOA 2EPHA 1ZNNA 3W88A 3SR7A 5A8GA 3TX9A 4UTLA 4LTSA 3JS3A 5HUOA 1ME9A 4NUWA 1ML1A 4FNSA 2NV2A 4DXVA 2VFGA 2YFNA 4O57A 4X2RA 2WNZA 5U4NA 2X1UA 3M6YA 1GZGA 1WX0A 3STGA 3KVLA 2V8ZA 4UFHA 1FCVA 1KM4A 3PC0A 4XKYB 4BR1A 4KFNA 1GEQA 2YXGA 1M5WA 2A7RA 3TJXA 4GRSA 1P0KA 2WV8A 1BWLA 4FF7A 4BFAA 4GUIA 4NXSA 4E2DA 3GDKA 1EUAA 4FXRA 4AHPA 3LTSA 3LHVA 3W87A 1K03A 3NL2A 1ICSA 4JDYA 3FKKA 3TROA 2DU2A 3DI0A 1PHWA 1JUBA 4HPJA 4PA8A 1KLYA 2C6QA 1M7PA 3RFAA 5AHFA 2J24A 1TQJA 3GR8A 4IUOA 3UWUA 1X8FA 1J2WA 3VCRA 3WJYA 5E1QA 1J5TA 1YPFA 4RXGA 4MVAA 4JTKA 3GAYA 4TMCA 4LRSA 1A5AA 2ZZ2A 1G4SA 4MPQA 4XTIA 2JKEA 1JQVA 4YCOA 5FF7A 1XBYA 2ABAA 3W7IA 1KM1A 4CCEA 4N6FA 1UUOA 2ZZ1A 3HBLA 1VQTA 4K39A 3WFAA 1YADA 2ZFAA 1RV8A 3SGUA 3BLFA 1G4TA 3BGGA 1R46A 4B5NA 5TQLA 2G97A 1G6CA 2QF7A 2DJXA 3G1SA 2E6DA 3NPVA 3FYPA 1SPQA 2ZRXA 2YW4A 5K9XA 1AW1A 4Z1BA 3IIXA 1FX6A 1F5ZA 3P74A 3DI1A 1W5OA 3CLMA 2BZNA 2NXHA 1QCWA 3C2FA 3EWXA 2VFEA 3CT7A 2OCZA 2CW6A 4ML9A 4TX9A 1P4CA 1P5BA 3W7DA 1TO3A 4JTSA 1Q6LA 5K4ZA 4MLJA 4UNKA 3T55A 2EKCA 4PFMA 3S1XA 3THAA 4ALDA 3S5OA 1G4PA 4N4PA 4QJ1A 3ATZA 5D2WA 2C1HA 2WNQA 4Q32A 4RR4A 3WJZA 3KXQA 5CPLA 4DEFA 3LCLA 4QNEA 4DO6A 1SFJA 3LCXA 2DZSA 2GQAA 4AXKA 3GYEA 1YTKA 4FNQA 1IIHA 2C13A 2ATMA 4LT9A 3RK8A 4BI7A 1TTIA 3STCA 3QW4B 1JCLA 2RDWA 4LVAA 1AW2A 2NWRA 5HINA 3QYQA 3NPUA 2WQPA 2Y63A 1MO0A 1Q6QA 3W83A 1X1OA 4M6QA 1TPDA 3C4UA 1EPXA 3TKFA 1N55A 3LRKA 5J5DA 1GTHA 1F6KA 1HUVA 3KOFA 2ZYFA 3TA6A 3W3OA 2ZRWA 1RQBA 2NX1A 4O1DA 4HSNA 1SZEA 1ICPA 2W6RA 4QQ3A 3IV3A 3QW3A 4MY9A 5DLCA 2C19A 4A2RA 4GXMA 3NQFA 1W3TA 2C15A 4LS2A 2OT1A 2X16A 2PCQA 4GUHA 4ZVJA 3KRUA 4O50A 2X1SA 1L9WA 2JKAA 2Z0IA 3PR2A 1PCWA 1KFJA 3TW7A 1H60A 2QCDB 3HB9A 2WNNA 2QCFA 1EUNA 2OMAA 1I45A 2YX0A 3G3DA 3PAJA 4WX2A 3W7JA 2WSYA 1H50A 3GNDA 4CCCA 3C6CA 1VYRA 3NQMA 1OFEA 2WSQA 2BTMA 3GXTA 1I4NA 1XBVA 2VEMA 1FY6A 4MLRA 1I2RA 2P1FA 4QISA 5G4EA 3HGRA 1R2RA 1DQXA 3HPZA 4AHOA 4UTWC 1SFLA 2ZA3A 3MHGA 4UTKA 4LVDA 3T7VA 2TPSA 1LOQA 3G0XA 1QOQA 1F73A 3NQ2A 4FEZA 5DBUA 2FLIA 3N19B 2B4GA 3P67A 3DFQA 3L0NA 2H6RA 2TMDA 1TRDA 1YLVA 1BTMA 2Y7DA 1A50A 1TSIA 4BI6A 5BRBA 3TAOA 3RLUA 3W07A 2J6XA 1VRDA 1KM0A 3ANYA 4A2SA 5LNWA 3DGRA 1NF7A 3Q2DA 4N9BA 4K38A 1PV8A 2NV1A 1JRBA 1WYIA 4ZQNA 6ALDA 1SO5A 4JR5A 2ZA2A 4JY9A 4JD4A 1H7XA 1FDYA 2A2IA 4UCGA 2DZTA 1GQNA 4XQ6A 3T44A 4O10A 3PUDA 5G5IA 4EF8A 4I9AA 1SZFA 1YXDA 1OYCA 3LCIA 5FF3A 1EEPA 4IPIA 5C6MA 1SZNA 3LM7A 3FYOA 1B9BA 4XBKA 1UUMA 3FLUA 3MHUA 4X22A 2Q3RA 4Q33A 1TIMA 5IBXC 1GT8A 5CZTA 3INPA 2TRSA 4MYAA 5G1TA 5C55A 2O7SA 4UIOA 2NXIA 4N6EA 3O6DA 4ORIA 4A3UA 3JR2A 1MXSA 3O8AA 5K7JA 3IVUA 2VFFA 3TH6A 2E1DA 2YW3A 3W76A 3E12A 3GVGA 3W2KA 2PRHA 3TFXA 5LHEA 3OVRA 5TBOA 3A23A 3EKLA 5F4XA 4XKYA 1W37A 4JIQA 4AF0B 4WZHA 3B0UX 3G0UA 1XDLA 2ZRZA 4JTLA 3PVFA 2ABBA 2HMCA 3C0JA 4O19A 4WXYA 1GVRA 1LP6A 3LI1A 1KM2A 3IRDA 1XXXA 4GE8A 2H3DA 1S5VA 3KAOA 4OQVA 1EWEA 4XTDA 4K37A 1GG1A 1LLWA 4H4IA 1PS9A 5HQEA 2ISVA 2YZRA 3N2MA 4OGZA 1G67A 3R12A 4JYEA 2QR6A 5I3FA 2CLEA 5D32A 2V81A 4HN4A 1H61A 5DCDA 2DJLA 5LNRA 4PEKA 2GVGA 3H53A 1SW7A 1F7BA 3G1VA 3NNTA 5IM51 4CNOA 2FTPA 4JYDA 3QSRA 4HSOA 4YLWA 1H5YA 1FXQA 1SO3A 4GWEA 3WK1A 4HNUA 1LZOA 5AC7A 1EWDA 5AHIA 5C2XA 1K7EA 3FEMA 2ISSA 1LM1A 2RDTA 1KFCA 1ZFJA 3W2UA 4FB7A 2Y61A 4PH6A 1TV5A 4I7WA 4FXSA 4LV9A 4M6PA 3NL6A 3USBA 2GOUA 4ZZ9A 3C3NA 3IGUA 3GAKA 3NM1A 3F4NA 1CX9A 7TIMA 1FDJA 3W72A 1WA3A 3LCHA 3DFSA 3MMTA 2X1TA 3P81A 2Y7FA 4AWSA 1FCQA 5C54A 4GUGA 1GVFA 3NPXA 2E09A 2CLKA 5ABTA 5U7SA 3G8RA 3M5ZA 1ZAJA 5EA9A 1Z44A 3T40A 2J88A 2GPTA 4AHQA 4NXKA 3FJ6A 3O6YX 5F2MA 2BLEA 3EB2A 2HS8A 3E02A 1VCFA 3QFEA 2Y70A 1NSJA 3I65A 2NXGA 3LV5A 3W7CA 4DPPA 1DL3A 1GVOA 3PULA 3TQ0A 1ZALA 3HIJA 4Y8FA 4M7TA 2QAFA 3QZEA 4LVGA 4FX8A 1SR9A 4RKAA 4FHAA 3A22A 1EP3A 2CLMA 1L6YA 3WK3A 5D2XA 1DVJA 2E6FA 4UMBA 1WAUA 2QDHA 4K8HA 4DO4A 1HO1A 1SSGA 3PSWA 3B04A 2C14A 3A21A 2XN2A 2R94A 1I2PA 1JCNA 1LOLA 4PCFA 3CPRA 3GDMA 3N9SA 4UTUA 4JTFA 2PRLA 5DY2A 4N9DA 3SW6A 3TJLA 2PURA 5F1VA 3UPBA 3C61A 4R33A 3NZRA 3O07A 2ATSA 3EX1A 3DKLA 3HG3A 4AB4A 3UYCA 5SWUA 1F76A 3P8JA 4ONVA 2OX1A 1S5TA 1D3HA 2X2GA 2QUVA 3P8IA 4L4LA 4UMAA 1WDWA 1TB3A 3PBWA 4P61A 1GOXA 3BGJA 3L9CA 5I3KA 4EF9A 1K8ZA 2ZQ0A 3G24A 3W6YA 3GDLA 2GQ9A 3LCFA 1QPRA 4JYFA 3SIZA 4M7SA 1N8FA 4M5PA 3AO0A 1RZMA 4FNTA 2QCDA 3HO8A 2V2HA 1RR2A 5E0KA 3EXSA 4ZMGA 3MI6A 1YTDA 4PTNA 4YMZA 3VE7A 3W7QA 4S2CA 2BX7A 3VKJA 3NO5A 4ZQCA 3SJ3A 2YYTA 3R2GA 2C16A 2V30A 2WKJA 2JGYA 3SFKA 5J5RA 2Q3OA 3MYPA 1CI1A 5BNKA 3M5VA 1QR7A 1L6SA 3W22A 3M7WA 1XKYA 5DN1A 1TQXA 3L5AA 2J9XA 4BK9A 1LOSA 2ZA1A 4OU1A 2A5HA 4EIVA 3L21A 4JTJA 4RZ5A 1W5PA 3HGJA 1JQXA 4UC5A 4I7UA 4IXXA 3P62A 4NT0A 3IIOA 5HWNA 2C3ZA 2NZLA 2I14A 3M47A 5I3GA 1FWRA 1QPQA 1Z42A 1KFKA 3TFCA 2CZFA 3W74A 2VEKA 3IIVA 3L2IA 3FIGA 4AWTA 1LRQA 2OT0A 1MEIA 3CQ0A 3LBCA 2Z1BA 3NG3A 4JTTA 5DY3A 1TPC1 5EPDA 5BMWA 3UZJA 2QEZA 3W23A 2ZRUA 3W1QA 5TIMA 4JX4A 3KRZA 3GXNA 3S42A 3NQDA 1X7FA 4NVTA 3MHFA 4JIPA 3OEXA 3MUXA 2Q8ZA 3GK0A 5BMXA 3A5FA 2ZZ6A 1C8VA 5I3HA 5G2WA 3NQAA 3P5ZA 4UTIA 1OFBA 4QITA 1G7UA 4UFJA 1IXOA 3NQ8A 1LBMA 4MFEA 5AHEA 4UTTA 2A6NA 3MWAA 4TR9A 4LWWA 4O1CA 1VYPX 3P80A 4GBUA 1ME8A 1W0MA 3G22A 5D03A 3CWNA 3EX6A 5AHLA 4MFDA 4E0CA 3HGOA 3ELFA 3QQ1A 3HJZA 5FI8A 4JY8A 1KTNA 1OX4A 4ZQMA 1ZCOA 4UFIA 3L0KA 1OYBA 2B0MA 3B0VC 1HL2A 1TREA 5CPNA 1DKWA 1H7NA 5CSSA 1G7VA 2YYUA 4PL2A 1QPOA 1AK5A 3LHWA 5H2ZA 4TMBA 4UUIA 4AF0A 3BK0A 2R8WA 4M19A 3HQ1A 1SW0A 1SW3A 3C52A 4M6VA 3B06A 3BO9A 4JNMA 4MY1A 3LHTA 4WUIA 5A5WA 5F2GA 1GWJA 3ZWTA 3TDFA 1WV2A 1R2SA 2VXNA 3A5VA 3V1PA 3VFLA 4DF1A 1IIGA 3W86A 4R53A 3OVQA 5AYXA 1P0NA 4LUJA 4UXDA 5HJLA 3LXAA 4R7JA 2NLIA 3OG3A 3W73A 2D73A 1FWNA 1NF0A 3UWYA 3PBVA 4CQ9A 2BWGA 4O14A 4NJHA 2X1RA 3Q58A 4HKPA 4POCA 3S1VA 4IMEA 1FUYA 3E96A 3NL5A 2E6AA 3W9ZA 3PBYA 3NEVA 4O4WA 3O63A 3QEZA 3CEPA 1K7FA 3MBFA 8TIMA 1LBLA 1MSSA 1KBJA 3DHDA 1QPNA 3F4WA 3TSBA 1O60A 2BSLA 3NQ6A 5G2HA 1I2OA 2F7FA 1VCGA 1ONRA 2VFHA 4FIQA 1F6PA 4FNRA 2DORA 2QCMA 3C2VA 4ZQRA 1EX5A 3W85A 4JICA 3LGEA 3LOTA 1LDCA 1E51A 5EKYA 1KV5A 2P10A 3DENA 5HNRA 3G0SA 1SO4A 2GQ8A 2DZVA 4RJEA 3LV6A 3SZ8A 2H3BA 3PUEA 3LRMA 4MIMA 4N9CA 1KM5A 2A0NA 2QCHA 4HIBA 4KFOA 5DXXA 3UNDA 3EWZA 4S1FA 4UMCA 5KZMA 3P7YA 4XZ9A 3UWVA 1MEHA 1XCFA 5E93A 4UFLA 5KTLA 4JTHA 3CC1A 4OBTA 3L67A 3N14A 4Z08A 1TTJA 2P0OA 2HSAA 3P5YA 3QF0A 5F4SA 1KM6A 5LZLA 4W9TA 3KHJA 4K36A 1O5KA 4OV9A 3ZWSA 4R34A 2BXVA 4AVFA 1V7YA 1SQ7A 5K2ZA 4DO5A 2GJLA 4EWND 3PWAA 4BWLA 3NL3A 4JGDA 4HNTA 3ABSA 1FBAA 2KZHA 1D3GA 3TXZA 3MW7A 4LUIA 1J4EA 3W1PA 3GZ3A 3UQNA 2QJIA 3BG9A 5LGXA 3WJWA 1KFBA 3S1WA 3TQVA 1A53A 1VCVA 3C8FA 5AHNA 4JTEA 1DHPA 4EOUA 4YXGA 1PCKA 4CCDA 1H63A 1K3UA 1VLIA 4NZFA 4YL2A 3UXDA 3S5NA 4DBEA 3LXCA 2CU0A 3HG5A 5D30A 4GUJA 1ME7A 3B03A 1HO4A 3NQEA 1TV8A 3DBPA 1OFAA 5D37A 3NZ1A 4IMDA 3ZR4A 3EKZA 4Z1AA 3WJSA 2C0AA 3S0CA 1ZENA 2W0UA 3CU2A 4JN6A 5KMYA 1Z48A 4Z0JA 3NA8A 4H6KA 1F05A 3O05A 3FA5A 1I2QA 1FCUA 5CG7A 3HPSA 5LNUA 4WXZA 2F84A 4A21A 3TSDA 4AH7A 2XFWA 4O15A 2AGKA 4IQLA 4JTGA 3T78A 3L5LA 2V5BA 1RPXA 1OX4B 4O13A 5CSRA 1OFQA 3W7HA 4GNJA 5G1YA 4YWIA 1T96A 3SGZA 5K9CA 4JTIA 1WQ5A 3E9AA 1IXQA 1QDSA 4O8RA 3ZFHA 3BW3A 1EB3A 3NOEA 1R47A 4MJZA 1FQ0A 4I7VA 4ORMA 1WBHA 2V0TA 2RHGA 2ISWA 3RLVA 4NNCA 1MZHA 4Z1DA 1QAPA 4XUGA 3UY8A 5K9DA 1KFLA 2E5CA 1WOBA 4IMCA 3STEA 4Y6GA 1S3HA 4LS0A 4NX5A 4K6AA 3N2XA 4RZ4A 3QPYA 2G5WA 5DBTA 4J9JA 1B3OA 1Z41A 3N9RA 5CPOA 3BVJA 2CZEA 3RMJA 1ZY9A 1QO2A 2ZZ3A 1VJIA 4LNYA 5L6UA 2CLIA 1TPUA 3O16A 2AQWA 3O1NA 3TUUA 5AN7A 3FJLA 2J9ZA 4IWWA 2E5DA 3B8DA 3N73A 5FEPA 3DFTA 3M44A 2NUWA 4TU1A 5KZEA 4Q4KA 4NQ1A 3F1QA 3LB0A 4FX7A 3BW2A 2E6YA 4K7YA 5MHBA 2A6LA 3E0IA 2OZ0A 1V5XA 1M6JA 3QRHA 3DH7A 4O1BA 3D0CA 3EEGA 5D2TA 3TNOA 3WK2A 2C18A 1W5QA 3TC6A 3DHFA 4GFSA 1ZJIA 4PC8A 1VH7A 4WOZA 1W3NA 2V2CA 3NQVA 3TV8A 1O95A 4Z1CA 4CQ8A 1A5SA 1XUZA 2GVLA 2ZRVA 5I3IA 1XBZA 2VOMA 2QDGA 4LV4A 3W75A 2TSYA 1I2NA 4HPXA 3RF9A 2QJHA 4PL1A 2ZZ4A 3NXFA 3DFOA 5LHFA 4WY0B 1YXYA 3QMSA 4NJIA 3U8GA 2TYSA 1UJPA 5AYZA 2ZZ5A 4NJKA 4IOTA 5F2LA 2JBMA 3LLFA 3W7RA 2QAPA 3CTLA 1W31A 1TRIA 1AG1O 5D04C 1FXPA 4XBSA 3A9IA 1NEYA 4UTJA 1W8SA 3W2JA 2I9EA 2ZZ7A 4CNNA 5FEZA 1VLWA 1PE1A 3BLIA 3P84A 3S1UA 1G4EA 1B4EA 1KA9F 4KFPA 5HR6A 4ADUA 3BW4A 2A7NA 3RNDA 3Q94A 1Q6RA 3UWZA 5KINA 4LC8A 3NPWA 3UZ5A 5D38A 2VENA 4A22A 4E38A 1EP2A 5AB3A 2B7OA 3N3MA 4WY0F 2PRMA 3W1MA 5FF0A 1LLZA 6TIMA 3BG3A 4BF9A 2Z6JA 5D33A 1LYXA 5DCBA 3P60A 4RZ6A 3LXBA 2QCGA 1DJNA 3L65A 3M5YA 3PB2A 2CWNA 3G1AA 2J9YA 4JX6A 2YSWA 1AL8A 4U28A 2NX9A 3W7MA 3C2OA 5CZJA 4KWVA 3MP5A 3SI9A 3MI3A 2VELA 1GVQA 4X9SA 2QCNA 4LY8A 2B7NA 4JEQA 1OFDA 4ZL1A 2X30A 2YR1A 5CPMA 3LCWA 3CIXA 1KV8A 4NX0A 4MYXA 3ABRA 3MP3A 3B0PA 1ICQA 3FOKA 4C1KA 3BLEA 1BKSA 1TCDA 3HF3A 2QUUA 4O16A 2W79A 4D2JA 1UCWA 1RD5A 1H1YA 2EF9A 1TYGA 4JDBA 3WJXA 3DKJA 1WOAA 3NM3A 1DQWA 1YDVA 2VEIA 3EXRA 3TK7A 2FQIA 2E68A 5F4WA 2H8ZA 1N7KA 1O5XA 3U6WA 3DU0A 1OYAA 1H7OA 4RLIA 3E49A 1B4KA 3CB8A 3WK0A 2DZPA 3Q37A 2H90A 5T26A 3PS7A 3QM3A 4Y96A 3LBMA 4FNPA 2QCCA 3PSVA 4UFKA 1PIIA 2WO5A 3EX4A 4DBDA 5D02A 5FESA 1A5BA 3C2EA 2YDAA 1IXPA 5LGZA 3W2LA 3NQCA 2B7QA 1LRTA 2V5LA 2Z6IA 3LRLA 1XM3A 2DZWA 1S5WA 2QJGA 3W1NA 4JXCA 5DELA 3LTPA 3AJXA 5K3VA 2LLEA 2GUUA 3M41A 3IIZA 3W1AA 3VNDA 2A21A 3CEUA 5KSWA 4LU0A 4QAIA 3GLCA 5FF2A 2JKPA 3W71A 2J27A 1H7PA 1T8XA 2Y88A 1JRCA 3THQA 1KM3A 4O12A 3H55A 3HG4A 1MEWA 3JRKA 4QM1A 4UTTC 4MZ1A 1GYLA 3R13A 3IVSA 5D2VA 1LRNA 2ZCGA 3A24A 4Z0SA 3W1LA 1TTQA 3GNNA 3PF3A 1OHLA 3PG8A 1TV7A 4QSHA 2DP3A 1T99A 1K7XA 3KX6A 3TE9A 3LX9A 4LVBA 1AMKA 1EP1A 4DPQA 3BARA 3KVJA 2WSRA 2CLLA 3DFNA 1ZAIA 2R14A 1QFEA 3W2MA 3W7GA 3KFTA 4OT7A 3TSMA 1JCXA 2FFCA 5DCEA 3GX9A 3NQ7A 4UTMA 3G3MA 3YPIA 5C5YA 3P61A 2EHHA 1TPWA 2RKXA 3ABOA 1GPWA 3B4UA 1B57A 3NR0A 3BPWA 1WXJA 1K02A 4YCPA 3TCEA 3NDOA 4GJ1A 2A7PA 4RXFA 1VZWA 4DQWA 3L5MA 1H1ZA 1OX6A 1OX5A 4NJGA 3W7PA 4ADTA 1A5CA 4O28A 1KFEA 2FPVA 3GDRA 4HT3A 3BV4A 4IPJA 5DXYA 1TJPA 2EAWA 3W7EA 4WOQA 2AAMA 4NJJA 1OK6A 4O54A 1VC4A 5LKYA 2PC4A 2V2DA 3S6DA 1VS1A 1BWKA 5EMUA 1YYAA 1UB3A 3W1TA 5HR7A 2HS6A 1RQEA 4IMGA 2Y7EA 4S2BA 3LERA 1TPVA 4L4MA 5F1UA 2A4AA 3S5ZA 3M9YA 5CKSA 4H3DA 3I7QA 4RK8A 4TIMA 1Q6OA 5HWJA 4DELA 5HULA 1W54A 4QNWA 3TIMA 4FO4A 1H51A 1GVSA 3QMTA 2WOQA 2FPTA 3UXAA 3TU9A 2NUYA 3OA3A 3W7KA 1NFBA 3MI2A 5D2YA 1ZHAA 4AMAA 4FNUA 3G1XA 1VR6A 3C2RA 4BI5A 3TAKA 1VHNA 1OFRA 3W7LA 1FDZA 4O11A 4G1KA 4HNNA 1XBXA 1DJQA 2OJPA 2QUTA 4IXHA 5BW6A 3HPXA 1JCJA 4ICNA 3IEBA 4RCXA 1KW1A 1NVMA 4MUZA 1XL9A 1OVDA 4UTHA 4IX2A 1QNVA 1KTCA 2QKFA 3M0ZA 5H91A 1HG3A 3CHVA 3LHZA 2VC6A 5G2IA 1YDNA 3NQGA 3HOJA 5LNVA 2NUXA 2XN1A 3GR7A 4WY0A 1VPXA 1W3IA 4BWLC 1LTDA 5GVJA 3QH2A 3R89A 3GKAA 1HTIA 3EX2A 4MOZA 4NU7A 5K4XA 1IF2A 4HHPA 4OHQA 3I7RA 2CFFA 4O1AA 5CZSA 1JCMP 3G1YA 2DZXA 3TC7A 1JUKA 4LVFA 1GG0A 1IGSA 2YGYA 1UASA 2Y85A 3C56A 1XC4A 1YDOA 1HFBA 4IMFA 1JVNA 4RV8A 4O0KA 1PL9A 3GB6A 3IGSA 4LRTA 4QIUA 1O94A 4CLMA 2RDUA 3LI0A 4O17A 4HNVA 4IJBA 1FWWA 5HMSA 5G4WA 3LCGA 4O4VA 3SY5A 5HWMA 3TQKA 3VI2A 5EYWA 1KTBA 1LCOA 2YFOA 2RFGA 1D9EA 1G69A 2CLOA 3O15A 3UWWA 4UTWA 3MBDA 3F03K 1AW5A 2FJKA 3EX3A 3M1ZA 3OBKA 3UY7A 5CZ0A 4UR8A 5D09A 3PBUA 1VHCA 1XDMA 3QMRA 1P1XA 3UD6A 1AL7A 2UV8G 3S5YA 5FEWA 1EA0A 1U5JA 1LBFA 3GXPA 3TMQA 3ZS4A 3FKRA 3B05A 1QO5A 2E77A 3U2OA 2FDSA 2ZTJA 4LC6A 4JTUA 4EVZA 1TTPA 1TPB1 1FWTA 1SU5A 4AAJA 3QC3A 5BOOA 1H62A 3R8RA 1CW2A 3MO7A 3EWYA 4UNLA 1GJPA 2ZRYA 3M43A 1R2TA 2WJZA 2V82A 1VGAA 2NWSA 2ZBTA 1FWSA 4LW7A 5AOUA 3CWOX 2Q8LA 3LHUA 1OFOA 1H7WA 4NZJA 2JK2A 3PG9A 2GVJA 3G18A 3NYZA 1XI3A 1RQHA 3DXIA 4O0ZA 4OWGA 2VFIA 4N9EA 3QSTA 5AC6A 1C9DA 2XN0A 1OG0A 2RH9A 1Q45A 2FPYA 3LLDA 1JJKA 3UWQA 3PY2A 5IBXA 2FB3A 2Y7GA 2G95A 2HTMA 3NAVA 4FIRA 4UR7A 5L9FA 2CZ5A 2EGZA 3HG2A 1EIXA 5EBUA 4O18A 1OABA 2VEPA 4NNAA 3W1XA 4RX0A 4X3ZA 4Y90A 2ZTKA 3SSJA 3EWWA 2CLHA 1QMLA 2WPBA 1GTEA 4GC4A 3O6CA 4MJMA 5FF4A 1L2UA 2YPIA 2CZDA 3ABQA 1SSDA 2QCEA 5KZDA 4UFMA 1H7RA 1R30A 4MY8A 3I7SA 4ZQPA 4Y9AA 3IVTA 1LROA 3G1FA 2YCEA 3NVTA 4A29A 3SECA 3VE9A 2Z2UA 1W5MA 1THFD 2GJNA 2PE4A 3LTYA 2E5BA 2FIQA 3ATYA 3STFA 5AC8A 1DBTA 2Y62A 5AYYA 2O7QA 4MKNA 1C29A 1KLZA 4KKXA 3IIPA 1SO6A 3L0GA 3K30A 2G96A 1GYNA 1UBSA 2VFDA 3QJAA 1BEUA 3KVMA 3RU6A 1FCBA 1OFPA 3MYOA 1I8JA 1NAL1 3W1RA 2JGQA 1YXCA 1JULA 4TO8A 4ADSA 3DZ1A 3G1HA 4GUFA 3QQ0A 5LNSA 3TW6A 1F2JA 3FS2A 1U83A 4XWUA 4KWWA 3W7OA 3TXVA 3CIWA 2Y89A 3L66A 4NNBA 1JUEA 4N02A 3TMLA 3EWUA 3KRSA 2H8XA 4WJEA 3GIYA 4IGHA 1SZGA 4WD0A 3GKFA 1W5NA 1XUUA 3G1DA 2Y6ZA 5KITA 3I68A 4K7VA 3H54A 5LSMA 4LOCA 3MJYA 3BG5A 3QPZA 4JX5A 1OF8A 3DFPA 3KVKA 4K8EA 3UPWA 1TMHA 3L68A 5EY5A 2IQTA 2R91A 3G8EA 3O06A 4ZQOA 1DOSA 1ZAHA 1TPEA 2CLFA 2A1YA 3M5XA 4WQ6A 1L6WA 1PHQA 3IGXA 1TJRA 3CM4A 5CGQA 4LS1A
chains in the Genus database with same CATH superfamily
4AD2A 3OHIA 1M7OA 4DAIA 4W8AA 3PZUA 2CBJA 1Q3NA 3QR0A 3QGKC 3DAQA 1J0YA 1F74A 3FFSA 3TZFA 1JPIA 2IKGA 1UH4A 4U33A 3WQCA 1EXPA 1YNPA 4GI9A 1XFBA 4XZIA 4CD8A 1SUXA 1RALA 1NOFA 3TYAA 1VYSX 4CVUA 2ZX8A 2ZKMX 4KS0A 4CQAA 1MQPA 2NX3A 4PODA 3RJYA 3WFLA 1A80A 3OVPA 4JS3A 3OBEA 4F2TA 4MZYA 4C6KA 3R4IA 2X0YA 3QY7A 4U5IA 1OJXA 5I3JA 3ARQA 3PB0A 3CYVA 3FX4A 1JR1A 3WDIA 3EWBX 4KCUA 2B31A 3W2NA 1Y5XA 1S2WA 4GMEA 3EOOA 1JZ4A 4AEOA 4H7CA 2ZX9A 4FX6M 1GKRA 4DF2A 4P8WA 1ZP3A 4GYPC 1L8NA 2ZUWA 1K8YA 3OW1A 1O4UA 1WBJA 4U4MA 1AVAA 1YW1A 3CUHA 3T09A 2POZA 2WC4A 1KBIA 1GQKA 1WAWA 1ADOA 2OTDA 4HA4A 4LNCA 1ZNNA 4J28A 3W88A 1Z9AA 5EU9A 3ALFA 5AC5A 5A8GA 3TX9A 3OA5A 1XHGA 3R0DA 2GK1B 1Y7VA 3W01A 2P76A 1DIDA 1KB3A 1ME9A 4NUWA 1ML1A 1D8WA 4Z1YA 1BLIA 1ZBWA 4DYEA 2WNZA 3B8SA 2FTYA 2ZOXA 2QDEA 2V8ZA 3PC0A 1BF6A 4W85A 1UC4A 3TJXA 4GXWA 3FJNA 1EBGA 4JL2A 4BFAA 3GDKA 1EUAA 1WKYA 5AYIA 1TIWA 1QNOA 1ZL1A 3LHVA 3BZJA 2I17A 2P8BA 4RUBA 1ICSA 4H9ZA 4JDYA 4G6CA 4QLJA 3KW3A 4KEUA 1XPYA 2GUYA 3R6IA 1PHWA 1JUBA 3C0LA 4O1FA 2C6QA 4NIRA 1F8IA 1J2WA 1XLBA 2Y2WA 3WJYA 3GS6A 2FZMA 2FZBA 1GVEA 4HMEA 1Z32X 3M0YA 4WDTA 1G4SA 1MMFA 1KM1A 3QPEA 4DAFA 4CCEA 4N6FA 3DN5A 1V6UA 2J7EA 1JAEA 1MQQA 5EMYA 2WMIB 4DZHA 1EX1A 1KCZA 4RPPA 2RUSA 1KNWA 1RV8A 3MTWA 3SGUA 3DDMA 2WLZA 4B5NA 1G01A 5IFPA 2E6DA 2ZRXA 4QDWA 4PUDA 3IIXA 5HAOA 1J0HA 4Y2WA 3H2AA 2FVKA 1QI5A 4C6QA 3B0YA 1QCWA 2VFEA 4PUJA 4CN4A 3L12A 5FL0A 1OSEA 3MMUA 4U10A 4MLJA 4WGHA 1JYXA 3WBWA 3S5OA 4R9OA 4N4PA 3LN3A 2C1HA 1FWDC 4RR4A 2HRWA 3QHNA 1UD6A 3KXQA 3CQJA 5CPLA 2WZHA 1F8MA 1M03A 2PA6A 1SFJA 8A3HA 1PZ1A 2GQAA 4F8XA 4AXKA 3AS3A 4FNQA 1IIHA 2QDDA 3RK8A 2V5DA 5XIAA 4W5ZA 2Z25A 4QE1A 3STCA 3W82A 3QW4B 1UD3A 3RX3A 1VBHA 2FGBA 1CLVA 4KQNA 2Z2BA 1MO0A 3ERPA 1Q6QA 5PTDA 3LRKA 1HUVA 4F3HA 1E9LA 3XIMA 3IGHX 2VNCA 3DOPA 1JDAA 2QF8A 3SJNA 1C8QA 4LUTA 3IV3A 5BROA 4MNKA 4O8AA 2PGRA 3EDEA 1JD7A 3CQIA 3DBNA 3W27A 4HK5A 5AY7A 3HPAA 4LS2A 4C6OA 4DUVA 2X16A 2E8ZA 1DTUA 2PCQA 3EWCA 4O50A 2X1SA 4A3HA 1H60A 2ACSA 1DTNA 2OMAA 3BCFA 4DY1A 2P8CA 2PCEA 2XM2A 3PAJA 2VURA 1H50A 2V3FA 3WQ6A 3C6CA 1FWFC 2GL5A 1VYRA 3N15A 3URNA 1OFEA 1PWLA 4AY7A 5BRPA 3CZLA 3UR2A 1QPKA 2QJNA 1PDZA 2R1NA 3NZPA 1XS2A 2PGWA 2J74A 1HKJA 4UTWC 3FK4A 2D23A 3MHGA 3CAKA 1VB9A 3VD4A 1KGWA 3MZ2A 3VVGA 2VD9A 3WNNA 4FEZA 5DBUA 2FLIA 2GGIA 2Y5SA 3SCOA 4E3TA 2TMDA 1YLVA 3VDCA 1BTMA 1A50A 4ZE4A 5BRBA 3RLUA 1DPMA 3GHUA 2O9RA 1QXLA 4HNLA 5ABHA 3DGRA 3Q2DA 4D72A 4K38A 1JRBA 3ALGA 3OZYA 1WYIA 1SO5A 3BSHA 4JY9A 2IKJA 2PP3A 1PKLA 3T44A 4O10A 1VPQA 1ISVA 1EGMA 4CD6A 4EF8A 1YXDA 1AZ2A 2XHYA 3VOGA 5A8MA 5FF3A 4H8HA 1EEPA 4O1EA 1W32A 5C6MA 1NOUA 5DFAA 4JQ3A 3WD2A 4EXAA 1TX2A 3N4AA 4JTCA 5CSUA 3RPDA 2TRSA 1ZS2A 2HNEA 2NXIA 4Q4RA 3L4VA 4A3UA 3JR2A 2GWNA 1WXYA 4DXXA 3GVGA 3W2KA 5BWAA 3QV8A 4A8IA 1V0NA 1LG2A 5CJMA 3GNXA 4Q4SA 3OVRA 5CSYA 4GQGA 2D69A 4A35A 3DUGA 3E5BA 5F4XA 2QS8A 4AW7A 4JIQA 4B5XA 4WZHA 4D8LA 3G0UA 1KKRA 4D6DA 5M2FX 4AX7A 3CHCA 1W2VA 1UBPC 3OLDA 2ABBA 3C0JA 4F0MA 1GVRA 1LP6A 1V6VA 1DWJM 2BNJA 1HGWA 1CLKA 2J78A 1V6XA 1AQMA 1JFHA 2YZRA 3N2MA 1TX0A 4DJEC 5E9XA 5I3FA 4DHGA 2CLEA 5D32A 2Y5EA 5IRPA 4AISA 1EJTC 2OYLA 3M0JA 5DCDA 1SW7A 1F7BA 1RK5A 3NNTA 2QHAA 4CNOA 3QSRA 4YLWA 1EEXA 1H49A 4ZO6A 4GWEA 3WBEA 4LAZA 4GZIA 4JIIX 2ODOA 2DSVA 1K7EA 3FEMA 1LM1A 3GNOA 3GQYA 4CEUC 1TWZA 2Y61A 4H6QA 3O0FA 3AAMA 4JIEA 3F4CA 3WUFA 3H2MA 3MO4A 3USBA 2GOUA 4R7OA 3S2CA 2NVAA 4G8TA 1X96A 3W72A 2WLYA 1WA3A 3SDOA 3HFTA 2ALRA 4GJIA 3DFSA 3MMTA 3UYIA 3P81A 2OKOA 4AWSA 3RYSA 3TOYA 2CLKA 1TVPA 3G8RA 5EA9A 1Z44A 4AHQA 1N8WA 4PUUA 5CC5A 4ZR8A 3O6YX 3GXDA 1K6AA 3MCOA 1H4PA 3QFEA 2Y70A 2NXGA 3W7CA 5DX7A 1GKQA 1N2VA 1V0KA 1ZALA 3HIJA 4Y8FA 4EXQA 2QAFA 2HZGA 4FOKA 4AG0A 1SR9A 2MUCA 5D2XA 4PCNA 3SY8A 3SB0A 4DO4A 3VIPA 1Q2SA 2F9RA 3V4BA 1I1WA 5FKYA 4IGNA 4XZHA 3CPRA 3SBFA 3IS4A 4JTFA 4N9DA 3MSRA 3UPBA 4Z2LA 4AEEA 3NZRA 3O07A 5DO8A 5SWUA 4YU1A 3LSCA 3THUA 3QYSA 4AZCA 1XSKA 4ONVA 1V8EA 2IQDA 1D3HA 4QEEA 1M04A 5FJRA 2QUVA 4L4LA 1DIOA 3S83A 3BOLA 1EA9C 5I3KA 3CH9A 3G24A 1VJZA 3LCFA 3SIZA 4MWAD 3U9IA 1S1RA 4M7SA 4M5PA 1OC7A 2IXVA 4US5A 2QCDA 1BHGA 3UG4A 1WP6A 2VQUA 1RR2A 3EXSA 2BVDA 4PTNA 3IK2A 2OB3A 4YMZA 1FH9A 3GZAA 2YA1A 2J8GA 4ZQCA 3A3XA 2WKJA 3CQKA 4JCMA 4KRUA 5J5RA 2VP8A 2Q3OA 5JXQA 1TQXA 3IJ9A 3L5AA 1E9YB 2DVXA 2ZA1A 4C6JA 3H2FA 3ZJ7A 4AWEA 1JQXA 2WW5A 2DUAA 3IIOA 5E6YA 2QIWA 3KWSA 2C3ZA 1D8CA 1ISZA 1FWRA 1WZKA 2CZFA 5BU6A 4LCSA 3W74A 1ZJHA 3C3UA 3IIVA 3ZZ1A 3ECQA 5T8GA 4I8YA 3OZOA 3QGAC 3WNLA 3CZEA 1UWRA 4GK8A 2L5HA 4RW5A 3EBVA 2Z1BA 2YL9A 3CPUA 4OVXA 1ECEA 1TPC1 5GJNA 4NRRA 3UZJA 3T0DA 3W23A 3ZVIA 2J8TA 3W1QA 4HSHA 3N6QA 3NWRA 3S42A 3NO3A 4NVTA 3WNKA 1X38A 2OYKA 4JIPA 2Q8ZA 4MM1A 4X0VA 1RD6A 4DWSD 5I3HA 4ILSA 5G2WA 2CCRA 3WMBA 4HHLA 4PCSA 1G7UA 2PD5A 1JXJA 1WZLA 5AHEA 4HU4A 4UTTA 1BQGA 1ME8A 2PDPA 1S46A 1CZ1A 5M1TA 3PTDA 3ELFA 4GI4A 3QQ1A 4V1XA 2QJJA 1EJRC 4ZQMA 4LQ1A 5I23A 2H9AB 3NGFA 1LQ0A 4J3UA 4R88A 3H7UA 1JNEA 1HL2A 2PWEA 1XYMA 3LPFA 4AXNA 2YYUA 2WSKA 3IUHA 2R8WA 1WKFA 1KQYA 1SW0A 3GDBA 3IJDA 2OLHA 4MY1A 3WMLA 4WUIA 4RDYA 1GWJA 4E8CA 4ATDA 3TDFA 3A5VA 4B9ZA 3F2CA 1IIGA 3MS8A 5FCZA 3W86A 3WEZA 1V3LA 1P0NA 4W89A 5HJLA 4R7JA 5AZ0A 3OG3A 4IT1A 3S2JA 4KCTA 2BWGA 4O14A 1FUYA 3NL5A 5FJOA 3AYVA 3PBYA 3NEVA 3NSMA 5DRIA 1IGWA 1IYXA 3QEZA 3O63A 6A3HA 1KGUA 1K7FA 3MBFA 5C9RA 8TIMA 3ARTA 1YIXA 3AIEA 3ZO9A 2GFTA 3TN4A 3DHPA 1PZ2A 1VCGA 3OOQA 4L61A 4QBXA 4ZFMA 4AZ6A 4DIAA 1A0EA 1EX5A 3W85A 3S3GA 3WLHA 3LGEA 2W27A 1QW7A 2NQHA 1OCBA 4H8VA 3A3WA 5FAGA 4HZMA 3ITXA 5HNRA 4DZAA 1ZBVA 3WLTA 4B2DA 2VZVA 2V67A 1P43A 3I4EA 4MIMA 1KM5A 2QCHA 4KETA 3UNDA 4S1FA 2VMFA 1XCFA 3R8HA 5E93A 4JTHA 1GGOA 2VX7A 4MTVA 1HN1A 3L67A 3N14A 4AVOA 2HSAA 2FZNA 4OV9A 2O9OA 4KIRA 4CNSA 1SQ7A 5JU6A 1D7FA 3PWAA 4BWLA 3VCNA 4B5WA 3CQHA 2EPLX 2KZHA 1TJ2A 3W24A 3MW7A 3SUTA 1J4EA 3U7BA 3L4XA 1OT1A 2QJIA 5CBIA 4FXFA 1E0TA 3E2SA 3OQ8A 2HXUA 1KFBA 4MJ2A 2WHJA 4L1WA 2XFRA 4RDVA 4GKTA 3IJ8A 4JTEA 1TR1A 2GOKA 4EOUA 2KAUC 5B7ZA 4CCDA 1H63A 4HMDA 2IQ0A 1H1NA 3UXIA 1BRLA 3ANUA 2Z1XA 3BQ6A 1HO4A 2F8QA 3AIQA 3MANA 1W9DM 1HKWA 4LYRA 3B9AA 4JN6A 3K4DA 3M0VA 1EHAA 9XIMA 1Z48A 4Z42C 4H6KA 4D71A 3EOSA 3POCA 1I2QA 3WQEA 5BOEA 3AIWA 1FCUA 5CG7A 3WQPA 1J11A 1KO0A 3CIVA 3OODA 4MB1A 1TE1A 2XFWA 4MWAB 4B5SA 1ZJAA 5CGMA 5ABFB 4KF1A 2VX4A 3MPGA 4WR3A 4C6PA 2WM1A 5I6SA 3O2LA 2J66A 1RPXA 1OX4B 3KOZA 2FGLA 5G1YA 1KWKA 3WY1A 3BAKA 4MNJA 5DQPA 2CWXA 3E9AA 4GI6A 1O7AA 4YVXA 4O8RA 6TAAA 2PLJA 4GG9A 3R7MA 2VR4A 4I7VA 4LX4A 4ORMA 2OX4A 1IT0A 1MRQA 2Z1WA 1LG1A 4JKMA 3WLSA 2BHZA 3BICA 3UA3A 1MZHA 4GHRA 3RO6A 1B3WA 4XUGA 1IZKA 4PRWA 3UY8A 1KFLA 1WKEA 2E5CA 2BGQA 3KBSA 3N2XA 4B15A 8RUCA 3NOYA 1B3OA 4GZEA 2CZEA 2ZZ3A 2CLIA 2YLAA 1NP0A 5G4HC 3TUUA 3ABZA 3B8DA 1KKOA 3N73A 4AD0A 3A9BA 4EKJA 3DFTA 2NUWA 2HJPA 1UP0A 1S39A 4HOWA 3F1QA 3BJSA 3S9IA 5I3DA 3ZOAA 5MHBA 3BLDA 2NV9A 2I57A 2VVSA 3TNOA 5M5DA 4DWSB 2E67A 2GGHA 3DHFA 1YMYA 3E2VA 1PUDA 5GNZA 2R1PA 1B2YA 3UA4A 4WOZA 1O95A 4H9UA 3WO8A 4P7NA 2BBFA 1A5SA 2GVLA 4Y9OA 4XZMX 2W4XA 1PIFA 4QJ4B 3W75A 1EOMA 1IR1A 4HPXA 3ZLHA 4PL1A 4AC1X 2Z24A 5LHFA 3AFBA 4NJIA 4PTVA 4KW2A 4MMWA 3U8GA 2TYSA 1GQJA 2RJHA 3MDWA 5AYZA 2ZZ5A 4NJKA 1YBQB 4IOTA 3BAYA 3GU9A 3LLFA 1R85A 1TRIA 1AG1O 5A6AA 1QI0A 1NEYA 1W8SA 3W2JA 1FH7A 2NT1A 2FVMA 3K4WA 2QGYA 5FEZA 1PE1A 1G4EA 1B4EA 1D2KA 2A7NA 3RNDA 1DEDA 4W7VA 1E6NA 5AB3A 2CXGA 2B7OA 3N3MA 2PRMA 1KRCC 6TIMA 4B3KA 1X6NA 3IPWA 2D1ZA 2CWNA 3G1AA 4HMCA 3NQBA 4AVNA 3ZIZA 4RNJA 2ZUNA 1GOOA 1HT6A 3C2OA 4KWVA 4PMJA 2O56A 2B7NA 2X30A 2YR1A 4JFVA 5HNTA 3TLLA 4PMDA 3CIXA 2WCGA 4NX0A 3A12A 4MSSA 3ABRA 3AYSA 4QP0A 1V3KA 3FOKA 4C1KA 2QUUA 4XD3A 1W17A 2CNCA 3IJIA 1I0BA 1UCWA 3AOFA 4HPHA 4JDBA 3WJXA 4OECA 3VOCA 1E1FA 4XAPA 2VEIA 1XYCA 4AIEA 3CMFA 1TVNA 1N7KA 3REQB 1H7OA 4RLIA 1B4KA 4DLFA 5T26A 4S3FA 3PS7A 3UCQA 3AZSA 1A5MC 2WM0A 1B1YA 5BXSA 4UFKA 2CKSA 1JNDA 4FLQA 1H0GA 1SYTA 3CUJA 4DBDA 4WDWA 1T41A 5D02A 4M0XA 3BC9A 1V03A 3WEOA 1LRTA 2ZX7A 5IHRA 1X97A 1S5WA 2QJGA 5ENLA 3NXLA 5DELA 3LTPA 4NZCA 4V2XA 5K3VA 4TQTA 3CUIA 1I0DA 1VFLA 3COTA 3WNMA 2A79A 2JKPA 3FNDA 3AIVA 3BXWA 3FW6A 2Y88A 1JRCA 1XV8A 1ZBKA 4Q4PA 3H55A 3HG4A 4UTTC 3IVSA 3T0TA 3GC5A 3PTQA 3AHXA 1ZSXA 4Q22A 4G2DA 4FP1A 1PZ3A 4ECLA 3FV9A 3KX6A 3TE9A 1R3WA 4HNOA 4U2ZA 4LUSA 2BP1A 1UP3A 3V0TA 3BCDA 1KRAC 3I6TA 4HU3A 1QFEA 4DNHA 3W2MA 4ENLA 4G5DA 3W7GA 4E8GA 3KFTA 1JPHA 4OT7A 1JCXA 2UY3A 3AMDA 2FZDA 5C7HA 3GX9A 3NQ7A 4UTMA 3G3MA 4YS1A 4PTXA 2RKXA 3VFCA 3B4UA 1Q65A 1REQB 1S2UA 1SJCA 2Z1SA 4J3SA 3NDOA 3L4TA 2CYGA 2A7PA 4PMRA 1XQKA 3GY1A 4W93A 3L5MA 1H1ZA 3MUY1 1AQHA 3W7PA 1UG6A 3E38A 4UOJA 1A5CA 3QKZA 3U2CA 1CGXA 2WHKA 1UD8A 3WFZA 4N7QA 3VIJA 3V35A 1OWQA 5DXYA 1NDVA 4CUCA 4DZIA 4E4FA 2AAMA 4IUGA 2INFA 1U30A 3SADA 1VS1A 5EMUA 2HS6A 4TVDA 4PMYA 1RY8A 1XH2A 2Y7EA 2CITA 1UZDA 1KGXA 1TPVA 3POHA 3ARYA 3S5ZA 2A4AA 5CKSA 1S38A 4H3DA 3AYTA 4TIMA 1Q6OA 5MKGB 5HWJA 4QNWA 3UG5A 4GVGA 4X63A 2FPTA 2EEXA 2XH4A 3OA3A 1ZZMA 2A3LA 1CGVA 1TMLA 2XVKA 4KCVA 1EDTA 4YVPA 1VHNA 1NELA 4IIEA 4HNNA 2OWCA 3AMLA 1XBXA 1DJQA 2QUTA 5AVNA 2D0FA 3ARPA 1HVXA 1KW1A 2G3IA 4MUZA 1R3SA 4UTHA 1GOQA 1QNVA 3ARZA 1OY0A 3L4YA 3AYRA 1HG3A 1WO2A 5A8PA 4GQQA 2NUXA 3GR7A 4WY0A 4IIDA 3QGVA 4BWLC 3QH2A 9XIAA 1YKWA 3L2LA 1R0MA 3GU1A 4C5YA 4ZFCA 3H2NA 1RCOB 5HBFA 1CTNA 1YPXA 1UD2A 1EO7A 3EKGA 3N4EA 1W9BM 1GG0A 4F2UA 5EMJA 4HMNA 1IGSA 3RILA 5C71A 4GYKA 1E4IA 1W3JA 1HFBA 3ZT5A 2WWDA 4O0KA 1MDLA 4LRTA 2F61A 1VIZA 3RAOA 5HMSA 4AUBA 3TQKA 5I00A 4IICA 2WANA 2QW5A 1XLFA 5FJTA 1VIWA 1UIPA 3MBDA 1DWHM 1MZRA 1P0BA 4FI4A 1I9CB 1W3KA 1VHCA 3QMRA 5REQA 1P1XA 2J75A 3AXKA 1AL7A 4AQLA 2UV8G 4GH3A 3USZA 3AHTA 2FHCA 3UZYA 1EA0A 3LGGA 3FKRA 5D8WA 1QBAA 1RY0A 2NQ9A 2FDSA 1HKKA 2YA0A 5HQLA 4L9XA 1TTPA 4EVZA 3CYJA 1HX0A 1SU5A 2FGZA 3CASA 4IG2A 5D9OA 2VEFA 7ODCA 3AS0A 3MO7A 1GJPA 1OBAA 1UR8A 3M43A 1R2TA 3CBWA 2WJZA 2O9TA 2G3NA 4HHMA 1FP8A 1BYCA 1OFOA 1H7WA 4KWSA 4TOQA 4DYJA 4PMQA 2JK2A 3DXIA 4NAEB 5T9BG 4CU7A 1C9DA 1OG0A 2FPYA 2OSXA 2PUZA 7PTDA 5IBXA 4H83A 4A8RA 4Q8NA 1BXNA 4FIRA 3UU0A 3HG2A 1FP9A 4NNAA 4X3ZA 4F0KA 1UR0A 3SN1A 4MJMA 1MDRA 1L2UA 2YPIA 2CZDA 5KZDA 2ZX5A 1O5RA 5CXPA 2PDMA 1LROA 5IXEA 1LL7A 2YCEA 2OZ3A 1NY1A 3NUKA 3GXIA 2E5BA 1DBTA 2Y62A 1Q63A 5AYYA 3V36A 2O7QA 1HNYA 4KKXA 1M01A 1E4LA 4QRNA 3L0GA 1B3VA 3QJAA 3WLIA 3KVMA 3MYOA 3ES7A 3K1GA 1JULA 3G1HA 3QQ0A 2REQB 1WB0A 1IE7C 1X7IA 4XWUA 3I6EA 3L66A 2ACRA 3CMJA 1JUEA 1PEZA 4QX4A 4Q8UA 3KRSA 3MZNA 2PZ0A 3GIYA 2OEJA 4HCHA 3OO2A 2Y6ZA 4WSKA 1UQZA 3I68A 4WIWA 4WJ8A 3A4AA 2NQLA 5C9WA 4K8EA 1PX3A 5CLWA 4GVHA 2J7BA 5GPRA 1NDWA 4ZQOA 1NQKA 1ZAHA 3OIHA 3SAZA 1TPEA 1L6WA 3AMGA 3LPPA 4G7EB 3H6OA 4LS1A 5H8PA 3V75A 4MZ8A 3W84A 3WG6A 2BODX 4FS9A 4INFA 1VPYA 1J0KA 1TELA 3WH5A 1LL6A 4PMVA 3DECA 2I1OA 1XD1A 2IKIA 2OKTA 3B9EA 3U2ZA 3HGSA 3BTNA 1XIMA 1CYGA 5A6KA 4F40A 4P2VA 1DORA 1XLCA 3FHQA 1OK4A 5F2IA 1OF6A 2OWXA 2VGFA 1R86A 4J3ZA 3PTMA 3VC6A 1EJ7L 4YHGA 2WQDA 1Z8AA 4N4QA 3S9YA 2TODA 1XWYA 2IUZA 2V9DA 4EP8C 1DV7A 4ZSUA 2V38A 4OUEA 2HE8A 1TUFA 1NDYA 2A85A 3T4CA 3PZTA 3THDA 3G2GA 4W87A 1W1ZA 1A4LA 1QWGA 3ZLGA 4LEQA 4PMZA 4BF5A 5EL1A 4CNPA 1VAHA 3CO4A 1JCYA 3NIYA 4OV4A 3H4WA 3UXLA 4I9MA 2SFPA 3VINA 4IQEA 2PTYA 4Y9NA 2V5KA 2BGSA 3AI0A 4UNIA 3WLQA 2HPIA 2NVDA 2NV2A 3KWXA 2VFGA 4IF2A 4QAWA 3M6YA 1WX0A 3F4DA 2GJXA 4JHMA 3KVLA 4UFHA 3K8LA 4XKYB 4G9PA 2C1IA 4KFNA 2PDUA 3VD9A 1CCWB 1M5WA 2A7RA 1N8IA 3RR1A 4GRSA 2CHRA 4IQJA 4E2DA 1KC7A 5E70A 2Z1VA 3H23A 3LTSA 1K03A 3T08A 1RJPA 3JUGA 3FKKA 3QR1A 4IH3A 1LUCB 3DI0A 4ZOEA 4PA8A 1XYAA 2BDQA 1M7PA 1SGJA 2J24A 2AL2B 3VMPA 4C6FA 4JKLA 5BXTA 4OTKA 1ODZA 5A1AA 4FZIA 1P1MA 1J5TA 3P3BA 1IZCA 4WK9A 1A4MA 4MVAA 4LRSA 2ZZ2A 4MPQA 1XKJA 1T40A 3TTOA 3MUAA 3BH4A 4RE2A 3ZSTA 5FACA 3W7IA 4UOZA 3SQSA 1UUOA 1T8QA 3KS5A 4H9YA 4RNIA 1ITQA 1KXVA 4K39A 3RGTA 3AIRA 1YADA 3UVIA 4KEVA 3L4ZA 1G4TA 1G6CA 2GVEA 5CCZA 2DJXA 3G1SA 4NZ5A 3AXIA 1FFQA 1SPQA 1H5VA 3N9KA 4BY3A 1X8CA 4XIAA 1AH3A 2EG7A 1F5ZA 3P74A 1W5OA 2CPUA 2BZNA 3RM4A 2NXHA 4A3YA 3SCSA 2V3GA 3EWXA 1QW8A 2OCZA 4TX9A 3Q65A 3RHGA 2PTXA 3W7DA 2JEQA 1H0IA 4UNKA 3FXGA 4DI8A 3EB4A 5C9ZA 3S1XA 2RGLA 1A3XA 4UTFA 4QDPA 2UY2A 4PSPA 4DEFA 4DO6A 3CAVA 4BS0A 4YJ5A 3VKAA 4JN7A 3NTYA 5LYRA 4KWOA 3GYEA 2YIHA 2ISDA 2QV4A 4LT9A 4ZSTA 4BI7A 1TTIA 5GNYA 4WCJA 3HFYA 1AW2A 1J2BA 5HINA 1Q8AA 3QYQA 3NPUA 3TTEA 2WQPA 5IDZA 1JYWA 1RAKA 4DJDC 2Y63A 5CGTA 1XIIA 4M6QA 1TPDA 4QSFA 3TKFA 1N55A 3CPGA 5J5DA 3BLLA 4OZOA 2ZYFA 1YQ2A 2XG9A 4WLCA 3WLMA 3UJEA 1PYMA 1B90A 1SZEA 2W6RA 1A47A 3WLPA 3SCVA 1US2A 3QW3A 1LWJA 1BXCA 1EJUC 5HJXA 1QI4A 4GXMA 3NQFA 4HA3A 3SSZA 2Y5JA 1E0XA 2C15A 2PF0A 2OT1A 2C91A 3KRUA 2W62A 4S3DA 1W9VA 3PR2A 1PCWA 4IFKA 4IGSA 2IMRA 3IAQA 3GWQA 1I45A 3JU2A 3CT2A 5C70A 3WDPP 3W7JA 3S6OA 3W0KA 1FWAC 4CCCA 1JPDX 1ITUA 1F4AA 3NQMA 4X0NA 1Q6DA 4HA0A 3RCMA 2VUNA 4NY2A 1UKOA 4MB4A 2VR2A 3MSDA 2P1FA 3RX4A 1VBUA 3HGRA 1UZ4A 2OU4A 1EZ2A 4IP5A 2VUYA 1NWSA 1MVYA 3GO2A 2E40A 3WQWA 2PLCA 3UVAA 1F73A 1XSIA 3SY1A 2I16A 1YDYA 1US3A 2I5IA 4D6FA 5MF5A 1EJXC 1XIHA 2H6RA 1UD4A 4Q8VA 4HCDA 4REQB 4IM4A 1AA1B 4HB7A 3DG3A 4BI6A 1XC6A 2J6XA 2YCLB 4A2SA 5LNWA 4HA1A 1NF7A 2C79A 3ORWA 1U33A 4I6VA 3UEQA 2VC7A 1NDZA 2ZA2A 2PTZA 4M3PA 1Q6CA 4KRZA 1SFSA 2J7CA 4AIOA 2DZTA 3WD0A 1W1PA 3DCPA 3PFMA 1E4NA 4QLKA 4JN8A 4LAKA 1SZFA 3CHEA 1JEZA 3DG6A 1SZNA 3LM7A 5HQMA 2QZRA 1FHLA 4X61A 1UUMA 4X22A 4Q33A 1TIMA 5IBXC 2P53A 1HGYA 4IIFA 5G1TA 3SQLA 2WMGA 3O8AA 4BHYA 5K7JA 3BLPX 3VIMA 2VFFA 2GK1A 2VC9A 1ITCA 3MVIA 1AFSA 1XICA 3PZQA 5A2CA 2CHNA 2PRHA 3TFXA 5A94A 4JHZA 1Z7AA 3NSNA 2E8YA 3NYDA 3PP7A 1W37A 1S2AA 1M1BA 1M68A 4HNCA 1U1UA 2DH3A 3B0UX 2D3NA 3L23A 4ACZA 4TVCA 1KXHA 3PVFA 2OLAA 4J3XA 4MAZA 4WXYA 4I5XA 4J27A 2O0TA 3LI1A 3AU6A 3IRDA 4L5ZA 1S5VA 3KAOA 7REQA 4K37A 2JQXA 2UWFA 2PWFA 1BPLB 1XYFA 3IARA 3R12A 3LZ5A 2PF8A 1UPMB 4JYEA 2QR6A 1E70M 2WJFA 1A5OC 2DY3A 2XJ7A 4HN4A 1H61A 2FH6A 1QHPA 4C7FA 5CAKA 1B3YA 4XD4A 2FTPA 4JYDA 3EAUA 4HSOA 1XH1A 1H5YA 1FXQA 1SO3A 3WK1A 4F48A 4HNUA 1LZOA 1OCJA 4HU8A 4Z2JA 3WBYA 1FH8A 3ZMRA 2RDTA 3D3FA 2EPMX 3ZR5A 1ZFJA 2X0SA 3WBAA 1TZ7A 1JL8A 4TTGA 2P0IA 2R1KA 4HK7A 4ZZ9A 2WMIA 3IGUA 4US5D 2OZTA 3F4NA 5TNVA 2ZICA 4JQ1A 3LCHA 5BXPA 4LXFA 3RLGA 1FCQA 5I07A 2WB5A 3PPCA 4DM2A 1S2TA 5C54A 4F79A 3NPXA 2E09A 1HJQA 4NXKA 3AWOA 3EB2A 2HS8A 1UOKA 1ZLPA 1VCFA 4MB3A 3I3DA 1M9HA 2PZNA 3PULA 4A6GA 1M7XA 2GWGA 2R6OA 3CH0A 1JDCA 2IPFA 4RKAA 3A22A 2FKPA 1L6YA 4GH1A 1DVJA 2E6FA 5BWFA 4UMBA 4C6CA 4K8HA 1SSGA 3FSUA 3PSWA 1UMYA 2XTKA 2R94A 1I2PA 1LOLA 4PCFA 3KLKA 2EBNA 1DWIM 5DY2A 3TJLA 2QV5A 1XLAA 4HHHA 3LM3A 2WKLA 3UYCA 3P8JA 1S5TA 3RRAA 2X2GA 3P8IA 2INEA 1HJUA 1ONXA 1E43A 4EX4A 1WDWA 4P61A 1ISXA 3BGJA 2Z7KA 3FA4A 4EF9A 1QNRA 3VDBA 1CXLA 5HDRA 2AKZA 3UPMA 3PZIA 5F7UA 1QPRA 1E6QM 1NU5A 4PRTA 4L1GA 3IWPA 3ARVA 4IJCA 3AO0A 4FNTA 1PKYA 3GVWA 3AALA 5E0KA 1YTDA 1BSIA 1RA5A 4J7RA 4S2CA 5I0DA 2YDQA 2BX7A 4NHVA 3GG7A 3NO5A 4GYPA 5E09A 2YYTA 3EZ4A 2WMKA 3V0SA 2C16A 3M0HA 3VPLA 3SFKA 5IFTA 3MYPA 3VDGA 1WDSA 3M5VA 3W22A 1C9WA 1W6TA 2J77A 4C1NA 2JF6A 1LOSA 4BCEA 1JZ3A 3L21A 4RZ5A 1R3YA 2A3BA 3D5HA 2WHMA 1W5PA 2XVPA 2PDWA 2GZXA 4UC5A 4I7UA 3VD3A 4IXXA 3P62A 3N18A 1Q66A 4GZJA 4W86A 3CNYA 4Q8MA 3WNOA 1Z42A 3TFCA 1UR4A 3QZ6A 1UR9A 4HTBA 3AHZA 2CZVA 3GVRA 3IRSA 4AWTA 1MEIA 3CQ0A 8XIAA 4YTTA 3DESA 3S46A 5DY3A 3EOEA 2ZRUA 3RXZA 3MUZ1 1BKHA 5A95A 3GXNA 4OUIA 1FA2A 1GHRA 1BXBA 1QU4A 2Q71A 1XLGA 3MHFA 1DE6A 1O68A 4GABA 3KL3A 3OEXA 4OOUA 3MUXA 3NURA 4PMXA 4Q4OA 2ZZ6A 3S47A 4GC3A 3BLOA 4B2DD 4QITA 3MSYA 4UFJA 3WH9A 4E4PA 1I60A 3MWAA 4ERAA 4LWWA 4O1CA 4GBUA 5CC6A 3APYA 3G22A 5D03A 1TA3B 1Z6KA 3FVMA 4MFDA 1O12A 1J01A 4Z2IA 2OR2A 3STPA 1EC7A 1ZCOA 4B4HA 4UFIA 9CGTA 1XISA 2B0MA 3MVTA 5CPNA 1L0PA 2QQ6A 3KOYA 1H7NA 3UJSA 4MPKA 4PL2A 4TMBA 4JPGA 3BK0A 4M19A 3IJQA 5I79A 3LHTA 1GOWA 4CU8A 2G3JA 3OQEA 5AYBA 4GX8A 5CPTA 2OGJA 4WF7A 2J8FA 2VXNA 3VFLA 4DF1A 3OVQA 1W1B1 3AJ7A 5AYXA 4Q6JA 4UXDA 3LXAA 2EPNA 4B3LA 2D73A 1NF0A 3PBVA 4CQ9A 4TUFA 1FFRA 4B5TA 3Q58A 2PDKA 4IMEA 3NVDA 3E96A 2YBUA 3GD6A 2E6AA 1L6GA 4UZSA 3KOXA 3NDZA 8CGTA 4GQ0A 3GR4A 4E5TA 1KBJA 3DHDA 4W5UA 3VGEA 4AZCB 1C7SA 1I2OA 3GFYA 3QC0A 3GBEA 3H24A 1PB0A 2XGIA 3WD3A 1ONRA 2VFHA 1F6PA 3R58A 2QCMA 2O92A 1OT2A 3SURA 3OZPA 3EPMA 4JICA 4G56A 4A3RA 3LQLA 3B97A 3LOTA 4I5RA 3B8VA 1E51A 5EKYA 1HJXA 1YEYA 3WN6A 2FYMA 3BMXA 4ACYA 3LV6A 1XFCA 2A0NA 3AMKA 4HIBA 3S2NA 5DXXA 4A05A 4UMCA 3SN0A 1HJSA 5KZMA 3UWVA 5D9MA 2YL8A 2Y1HA 3C86A 4UFLA 2EKGA 3S2MA 3CC1A 2VI0A 3DFHA 3N13A 5LIWX 3MSGA 3P5YA 3E2QA 3WF1A 1KM6A 3BJTA 2FZ8A 2ONEA 3ZWSA 4R34A 1QNPA 4AVFA 3T0CA 5K2ZA 2GJLA 1V02A 3SUWA 2PEVA 3NL3A 4H7VA 1FBAA 1BGGA 3VCCA 3GH5A 3MT1A 3WKZA 3E2RA 2W63A 5LGXA 2CKRA 3PK7A 1EIBA 4FSAA 3TWBA 3KBJA 3A13A 1K6WA 3C8FA 4V15A 1TKKA 4US6A 6XIMA 2A3CA 3AZRA 4RE0A 1E40A 1K3UA 5KETA 1VLIA 2XFFA 4NZFA 5DMNA 3UXDA 3FXYA 3OB8A 4K3ZA 1ME7A 3RITA 3MKKA 5D37A 4AD5A 3QOKA 4IMDA 3WJSA 3S0CA 1ZENA 5KMYA 4Q6XA 5CZKA 3KUMA 4Z0JA 3N2BA 3NA8A 1F05A 4WHBA 4FF5A 2BY2A 4NG3A 4M29A 3HPSA 3SRDA 3SRKA 5E6ZA 4C6MA 5LNUA 3NZGA 2Z27A 4QCEA 4KERA 2Z28A 4D8AA 4M51A 4DN1A 1A5LC 1XYLA 3Q67A 4JTGA 3VIOA 2FTWA 4DWDA 4WKHA 4O13A 3VM7A 1OEPA 3W7HA 1UQYA 1CENA 3WNPA 1UH3A 4PEEA 2G3FA 1MYRA 1WQ5A 1CLXA 4NRSA 1JZ5A 1ODUA 2W91A 2ASHA 1QDSA 4HD5A 5I02A 5C9UA 5CBBA 1EB3A 2HBVA 3NOEA 1R47A 3E74A 2BOGX 2PSNA 4CNTA 4NF7A 1OB0A 2DVUA 1QTWA 1HP5A 2RHGA 2ISWA 3UGVA 4Z1DA 1QAPA 1YE4A 1E6RA 4PMOA 1LF1A 3STEA 3B8TA 4I90A 1JYVA 3HM7A 4JQAA 3QPYA 1V3HA 4PUWA 1AODA 2A3AA 5CPOA 3BVJA 3RMJA 5HNNA 2BS9A 1VJIA 5LXXA 4UR9A 3O1NA 5GNXA 4IWWA 2DW6A 5DT5A 5J04A 4F0HA 5KZEA 4Q4KA 2VZOA 5B7YA 2E6YA 4UOQA 2A6LA 3E0IA 4H8NA 2PDNA 3QVQA 7TAAA 2IKHA 3KRBA 5BOFA 2NT0A 3DFYA 2C18A 3KZSA 2BGNE 3TC6A 4GFSA 1G1YA 4GY7A 1W3NA 2V2CA 3TV8A 3KS6A 4D1JA 2CERA 1XUZA 1UR1A 4C91A 4Z17A 5I3IA 1XBZA 3CB3A 4MUPA 4P8XA 3S2LA 5I77A 4QJ3B 2G50A 3NXFA 3DFOA 1YXYA 5CLTA 2ZXQA 2ZXBA 2H9AA 3SCWA 4H00A 1KXQA 3W7RA 2QAPA 3CTLA 1W31A 3WLKX 3CO8A 3EMCA 1UR3M 3UNTA 1GPFA 4I9JA 2I5GA 3GXMA 2ZZ7A 1VLWA 1CGTA 3BLIA 2YBVA 4ADUA 5FAJA 4LANA 5KINA 3GU2A 3UZ5A 4NYYA 3RG6A 1VBRA 1EP2A 4XO7A 1YX1A 1LLZA 3KOWA 1IEQA 2Z6JA 4BF9A 4AYGA 1UKTA 2HVNA 5DCBA 4LF1A 4RZ6A 2QCGA 5FSDC 5JH2A 3M5YA 3RR4A 1X39A 4JX6A 2YSWA 3T9PA 3GFXA 4YTQA 3DERA 4U28A 1QI3A 2NX9A 3V3WA 4K8GA 3MI3A 1K9EA 2VELA 1E6PA 1W2PA 5GJPA 3UWEA 3H70A 4X9SA 2QCNA 3MKCA 1I1XA 4JEQA 1ZPTA 4Z2HA 5A8NA 3LCWA 3R25A 4K1GA 1POJA 1RH9A 1TUXA 5XINA 1OC5A 3KL5A 3G77A 2Z7GA 3BSGA 2DSZA 4I9TA 3ZQ9A 4O16A 4D2JA 1Q6EA 1JPMA 1RD5A 5IDIA 1WUEA 1WOAA 3NM3A 1DJHA 1WZMA 1BQCA 3EXRA 1BG9A 2FQIA 3VIFA 4MHBA 3VO0A 3U6WA 4GD0A 4LBSA 5GJMA 3E49A 3WK0A 2DZPA 1JZ8A 4J1OA 4WSHA 4ZODA 3QM3A 3EYPA 4H19A 3C0SA 4OKDA 4Y96A 2QCCA 1P48A 4M81A 4EPDC 1B5TA 3C2EA 4TXEA 2YDAA 5LGZA 3W2LA 4EACA 2Z6IA 3LRLA 2OELA 1J0IA 3WMSA 3W1NA 4BKNA 4IPLA 4ZB5A 1KQZA 5I5RA 3PHAA 3ONBA 2LLEA 3I10A 1VP5A 3IIZA 4FR1A 3VNDA 5FL1A 3CEUA 1UJQA 2IPWA 3GLCA 1T8XA 1F9CA 3WLNA 2HISA 1KCLA 4P7OA 4MZ1A 3R13A 1LRNA 2ZCGA 3VMOA 3MQTA 5ECUA 3GNNA 1OHLA 3PG8A 1TV7A 1M53A 4QSHA 1DJIA 1T99A 1XP3A 4AZ7A 3UGRA 3KBMA 3LX9A 3TNBA 4QE4A 4DPQA 4HN8A 5ABFA 2WSRA 2CLLA 2YBTA 1UROA 2WXDM 1AD1A 2VGGA 1HVQA 2FFCA 2WVVB 3B9DA 3WQ5A 1Y8BA 5C5YA 4ERGA 2Y0FA 3RMEA 4DBUA 1TPWA 2CBUA 3SFWA 3W37A 4YCPA 4GJ1A 4RXFA 1H3GA 2KX9A 1OX6A 5FJIA 5A2AA 4JTDA 3NZQA 1GYMA 1XIJA 2EJAA 4FLOA 3BV4A 1XR2A 1MW2A 1OZQA 1TJPA 3W7EA 2A3HA 2XDFA 1EDQA 1OD0A 5ABEA 3PZNA 2PC4A 4BQ4A 2R24A 3UP8A 3S6DA 1SJDA 4J2MA 1YYAA 2PDGA 4ATWA 4ZTXA 5E0CA 3LERA 2BMBA 3KDOA 3W4RA 3KDNA 2XGZA 3P0XA 3L2MA 5HULA 4LH8A 5CJNA 3TIMA 3BAIA 2OOFA 2V6AA 7ENLA 2WOQA 3VGGA 3W7KA 4BEUA 5A8QA 4H41A 3MI2A 5D2YA 4B92A 2I7GA 4FNUA 3G1XA 1VR6A 4BI5A 5I2UA 3SN4A 4NZ3A 1OFRA 4N0RA 4DWSA 4H9XA 2X7VA 1FDZA 4H6RA 2OJPA 3M7SA 4TX8A 5BW6A 1VEMA 2CXEA 4UZUA 1KTCA 2X41A 2G37A 4Q8PA 2VWTA 4DJFA 1IV8A 1Z69A 5G2IA 5A2BA 2NQ5A 2HEJA 3HOJA 4AZIA 1VJSA 5JIWA 1XLEA 5GVJA 1XG3A 1HTIA 1YBQA 4NASA 4KGJA 4MOZA 3N3TA 3V18A 4O1AA 5CZSA 1JCMP 2WC3A 3PPGA 1CIUA 3SCNA 4KMQA 3C56A 3LEPA 4IMFA 1JVNA 1GJUA 2VZSA 1J10A 2ADAA 2RDUA 1CNVA 3DYMA 4IJBA 5I78A 2XIIA 5G4WA 2E0PA 3SY5A 5HWMA 1XRSA 5FD0A 3VI2A 1K1DA 5EYWA 1DWFM 2YFOA 3CGTA 2RFGA 4AD4A 6REQA 1R3RA 3O15A 3O0KA 3U0HA 3OBKA 3UY7A 3GYCA 4Q3MA 4UR8A 1WPCA 1XDMA 3GIQA 1A5UA 3S5YA 5FEWA 3GXPA 4F0SA 5EB8A 3ZS4A 1Q13A 3FCPA 4JTUA 1P6CA 4DRSA 1FWTA 3MDUA 3QC3A 3XISA 2G3MA 1TMQA 1XGZA 1Q2RA 4UNLA 2WSPA 2PLMA 2PDBA 2ZRYA 4KRTA 3QZAA 5CAHA 1VGAA 4O0QA 1S2VA 4LW7A 5AOUA 3W81A 5GQBA 3MCNA 1X98A 2GVJA 3G18A 2DFAA 1RQHA 3LUTA 3REQA 3WIJA 4N9EA 1X1NA 2XN0A 1Q45A 1RJQA 3C2YA 1E5JA 3LLDA 1Q7MA 2J7FA 1CXIA 3UJRA 3RX2A 2V63A 2YZ5A 2Y7GA 4AZGA 5L9FA 2AAAA 2EGZA 4UBPC 1OABA 1C92A 4WDUA 5TF0A 3EWWA 2CLHA 2WPBA 1GTEA 4GC4A 3O6CA 2VR5A 2O9PA 3WELA 4LY4A 2VX6A 4TX6A 5AC4A 1SSDA 1R30A 4MY8A 1M41A 1FWCC 1HKVA 2DQXA 4ZQPA 3IVTA 1B30A 3G1FA 3NVTA 3N2OA 4IISA 4PRRA 3SECA 1T7LA 1IEIA 3VE9A 3H7VA 2Z2UA 3M07A 4AY8A 5EFFA 3LTYA 1W1TA 3STFA 2V3DA 2F38A 3WL1A 4XZLX 1BGAA 1SO6A 3CUGA 1OFPA 1NAL1 3OGRA 3IJ6A 4XO6A 3W1RA 2PDYA 1Z3NA 2JGQA 2CHOA 2UY5A 4D9PA 1JDEA 3DZ1A 2J4GA 5LNSA 3TW6A 2GSHA 2ZX6A 2JALA 5CH9A 3CIWA 3TXVA 2Y89A 5LIYX 1J6OA 3RM9A 2VDHA 1V4YA 3EWUA 3G5EA 1KBKA 4RNHA 2PWVA 3KM8A 1EHNA 3ZJ8A 1W5NA 3NJ3A 1CXKA 3VIKA 5LSMA 4RZBA 4TVUA 2PI6A 4LOCA 3AICA 4W4QA 3BG5A 3SGGA 3DFPA 1R8LA 5EY5A 2WVUA 1BD0A 1E0WA 3V5FA 3O06A 3GHSA 4GA8A 1YE6A 3UG3A 1RK6A 2A1YA 3M5XA 1P6WA 3CM4A 3DG7A 5CGQA 2WZIA 4LAOA 2NQZA 4R3UA 2YLLA 3NGJA 2D24A 4UCFA 2OODA 5D05A 3D46A 3PUOA 4S38A 5AFDA 2QCLA 1TPH1 4C6BA 1X1ZA 3UW6A 1ONEA 4XVDA 3W38A 1IT7A 3HV8A 1T0OA 3TQPA 4HJFA 1L6FA 3W70A 1ZGDA 2VKZG 1XIEA 5JQ9A 3W7NA 2DZUA 1DJYA 4XSMA 1QOPA 2B7PA 1U5HA 1PSCA 1CPUA 5HUPA 4S3JA 4IL2A 5FA5A 1VENA 1XRVA 4E8DA 2GDQA 5REQB 2ZE3A 4JEJA 4E2BA 4FLSA 3UJFA 4Q8TA 3LHYA 1W56A 1Y0EA 3QKEA 2WBKA 1RVGA 3K46A 4OE7A 4Y7EA 1YHTA 4JNYA 4FOUA 4B3ZA 2BOFX 1U22A 3H2CA 1IEXA 1IXNA 4IG2B 3S8HA 5J8LA 4O52A 4Z2KA 2ZE0A 3WH6A 3TYDA 2FB2A 1W1IE 3A4XA 1PPIA 3ABXA 2W3ZA 4DF0A 1XG4A 1YPIA 1S3TC 4O53A 1LORA 1VFFA 2GGGA 3GH4A 1MW3A 4AWUA 1B3ZA 3T05A 3WQ8A 3SR7A 1V51A 1TE6A 4UTLA 2JIEA 3JS3A 4LTSA 4MDPA 5HUOA 1NOWA 2VOTA 2YFNA 2WZTA 4O57A 4X2RA 3VD5A 5U4NA 2X1UA 4FLRA 4AD3A 1XH0A 5HMFA 3SRHA 4BR1A 1UP2A 4P8VA 1BWLA 4FF7A 4GUIA 2WCAA 4NXSA 4FALA 3VXGA 1QUMA 4AHPA 3W87A 2I9UA 3NL2A 4KESA 2GLKA 4M8UA 1EQCA 2DU2A 4YHEA 1BVNP 4HPJA 3UR8A 4EE9A 1KLYA 3RFAA 2HE5A 1RLDA 3GR8A 4DLMA 1X8FA 4NAFA 3F5KA 5E1QA 1C91A 5EMMA 4RXGA 7XIMA 4JTKA 3GAYA 3UG8A 4MWAC 4GIAA 2BASA 1KD0A 2JKEA 3SUSA 4YCOA 2ABAA 2DSUA 3WQOA 2QJMA 2PWGA 1LJYA 4QHRA 3CLWA 1KBLA 2NLYA 3KP1A 3HBLA 1VQTA 4LB4A 3ITLA 4HTYA 1MNZA 3URQA 1V3JA 2XVGA 3SRFA 1M3UA 4PSRA 1R46A 3T0AA 1GHSA 1RPKA 3LENA 3ZXWA 3FA3A 1EXBA 4UQBA 2QF7A 4YWSA 3U7VA 3NPVA 3FYPA 2YW4A 5K9XA 1XLIA 1EZWA 4Z1BA 3OLIA 4JZ5A 3LPOA 3UR5A 1DJWA 1ECQA 3CLMA 1ZQ5A 1C8XA 2GJRA 4W8LA 2CW6A 2J13A 1P4CA 4IP4A 2PDQA 1P5BA 3WQ4A 4JTRA 4JTSA 1Q6LA 3T55A 3UBPC 2EKCA 4PFMA 3THAA 4GFIA 4W88A 5D2WA 2WNWA 2WNQA 4Q32A 5ABGA 2ZDSA 1E9ZB 3WJZA 1A0DA 3GNPA 3E3HA 4B16A 1IT8A 3VMNA 1S5MA 3TEVA 1RXOB 1YTKA 2UZ9A 4Q7IA 2C13A 2ATMA 4QDMA 1OD8A 4OBRA 4EPBC 3GTIA 1ZB5A 4LBRA 3PFRA 1JCLA 4WSJA 1PYFA 4LVAA 3PNUA 4UQ9A 2IPGA 5CG0A 2W61A 2AQVA 4JNZA 4QR6A 1X1OA 3C4UA 1EPXA 4U5KA 3AS2A 2EG6A 3PUGA 4DWSC 1GTHA 4WVXA 1RLCL 4GISA 3TA6A 2ZRWA 1RQBA 2NX1A 4O1DA 4HSNA 3TA9A 1J5SA 1MI3A 1ICPA 3LD5A 5FJPA 1QOXA 2REQA 1WDPA 3ZLFA 4CVWA 5A3HA 4DJFC 4MY9A 4DUWA 5DLCA 5C0QA 4WGXA 4GYFA 1F3TA 3VUSA 3HTWA 3H2OA 4GUHA 4RDZA 3KE0A 4ZVJA 3W6LA 1ZU8A 2Z0IA 5AVHA 4UQEA 2WWCA 3WEMA 9RUBA 3UZWA 1BYAA 3TW7A 3HB9A 4GACA 1EUNA 3CZKA 4KGLA 3WLJA 2YX0A 3G3DA 2INZA 2W92A 4X60A 4WX2A 2WSYA 4H01A 3CHFA 4YPJA 3GNDA 4NI8A 3O6AA 4BQ5A 4H9VA 2WSQA 2BTMA 3KCJA 3GXTA 4IIBA 5T9CE 1I4NA 4B4FA 2W67A 1LT8A 4MLRA 3WF0A 1I2RA 3MMDA 1F61A 1UKQA 3H22A 4QISA 1ENUA 5G4EA 2ZVRA 4GQRA 1G0CA 4AHOA 3GG0A 3QV9A 1A5NC 4GO9A 4R7WA 4ICMA 4UTKA 3AISA 4LVDA 2X09A 2TPSA 1LOQA 3G0XA 3PJUA 1N82A 1QOQA 3N12A 3TP4A 2E9BA 1T6MA 3NO1A 3N19B 3P67A 3BE7A 3DFQA 4H1ZA 4IPPA 2C1GA 1TRDA 3W53A 1TSIA 4FMVA 3R11A 3ID7A 3W07A 1KM0A 3ANYA 1UD5A 3UZZA 4HBKA 3BL3A 1PV8A 2NV1A 3AHYA 4KT2A 4PBFA 4DM1A 6ALDA 4JR5A 4JD4A 1H7XA 3FAXA 2UY4A 1FDYA 2A2IA 4UCGA 3PZ9A 4XQ6A 3UXKA 5A6JA 4I9AA 3WD4A 1OYCA 3LCIA 1JD9A 2XSAA 4IPIA 3GRIA 4B91A 3FYOA 3TJIA 1PKMA 5JH1A 3ARWA 3MHUA 4QGCA 5CZTA 2BG5A 1I75A 3QV7A 2QPSA 4N6EA 3O6DA 4ORIA 1MXSA 4F9JA 4A3QA 1DIEA 3VGHA 1JGMA 4S3KA 1HW6A 1W8GA 3TH6A 2E1DA 2YW3A 5A6BA 2VZTA 3H4XA 3W76A 2HXTA 1D3CA 1XGEA 2OZ8A 5LHEA 4V28A 1DHKA 3UJ2A 1JF5A 2HK1A 3A23A 3EKLA 4XKYA 1E3XA 4AF0B 4MGGA 1D7KA 2ZUVA 2XSBA 3G6LA 3OZMA 4PFHA 4F0RA 4C6IA 3VZZA 3DIPA 4AEFA 3MUIA 4JTLA 1J0ZA 2HMCA 3R10A 3BURA 3GIPA 1XXXA 1CWYA 2H3DA 4OQVA 4XTDA 1EWEA 1LUCA 1GG1A 1PZ0A 1H2JA 4H4IA 3T1GA 1PS9A 1KRMA 1PDYA 2ISVA 4OGZA 5E9AA 2OXNA 2QIIA 3OLEA 2WZEA 4PR4A 3OYZA 2GVGA 3H53A 4LCRA 3G1VA 2RDXA 5IM51 3TONA 4L9YA 5C2XA 4NZ4A 3PWIA 3W2UA 4FB7A 4AFYA 4PH6A 1TV5A 4I7WA 4ZB0A 4FXSA 4M6PA 2VDIA 5TAOA 1FWGC 3C3NA 2DT0A 3H12A 3ZJ6A 3WDQA 7TIMA 2WMHA 4J3WA 4I8DA 1XRTA 1BYBA 4C6LA 1GZJA 2ISFA 1PWMA 1NM9A 3T6CA 1GVFA 2BY3A 1NQ6A 5U7SA 4L6OA 3T40A 1LWIA 2GPTA 1OZMA 2FMNA 2DT3A 2XVNA 4GGHA 3BMVA 4C60A 3E02A 2OGYA 3AU2A 3LV5A 4HPGA 3VNIA 2ON3A 1GVOA 1V08A 4K1WA 1C3FA 3TQ0A 1MFUA 2ZUSA 4M7TA 1E6SM 1PTGA 1QT1A 1A3HA 4FHAA 2CLMA 1FTXA 4GCXA 1WAUA 2QDHA 3DC0A 1HO1A 3G1RA 5JBEA 4QG6A 1IQ8A 2XN2A 4ES4A 2WKGA 1JCNA 3ITGA 3EDKA 3GG8A 4XVEA 2PRLA 3VKKA 1JPKA 1XLMA 3SW6A 2PURA 3C61A 1WE5A 3Q45A 4R33A 3TYBA 3DKLA 3HURA 3A47A 3TCSA 1HF6A 4L64A 5HATA 2YXXA 1UWSA 4OBSA 1EJVC 7A3HA 1OC6A 4GI8A 3N04A 3PBWA 3L9CA 3UETA 4W8BA 3LS9A 2ZQ0A 3VOFA 3P2VA 3GDLA 1EC9A 2GQ9A 3M0KA 3PBGA 1VFTA 3AXHA 3VKDA 1RZMA 4ML4A 3VZYA 4C6EA 2YB1A 3HO8A 3H21A 5JBFA 1PXGA 1HKIA 4ZMGA 2VDGA 3MI6A 4QROA 3VAVA 4RE4A 4NP7A 5FJJA 3W7QA 1J93A 1DIKA 2P50A 3VKJA 3LSBA 3OHMB 3R2GA 4FA3A 2V30A 4PCPA 5EMKA 2JGYA 3H7RA 3I3EA 5BNKA 1CI1A 1QR7A 3BOFA 4MKSA 3M7WA 1XKYA 4H7ZA 4AU0A 2J9XA 4BK9A 4ACZB 3E0WA 3RUBL 2MANA 2A5HA 1G5AA 4EIVA 4JTJA 4XKMA 3WQGA 2Z29A 4NT0A 3M46A 5HWNA 2NZLA 3M47A 5I3GA 1QPQA 7REQB 4R27A 1P7TA 3R1ZA 1AZ1A 2B81A 2FJUB 2VEKA 4ZTYA 1DYSA 3FIGA 1LRQA 2OT0A 4REQA 1ISWA 3FSTA 4MNMA 2XUCA 3SO7A 4DBWA 4IGMA 3RCYA 4JTTA 2YCLA 5BMWA 4M80A 4JFWA 2RGMA 4U3CA 1WCGA 3KRZA 2VT0A 1UH2A 1X7FA 1EGZA 4ZGYA 5BMXA 3A5FA 1R3TA 1C8VA 4GPNA 4F66A 4Z2GA 1UWQA 3W00A 1FWIC 3P5ZA 4UTIA 3MJMA 1OFBA 1JCTA 3V5CA 3U57A 1IXOA 3NQ8A 1G9HA 1LBMA 2PB1A 1E56A 3CZJA 4C7DA 2PLKA 3JW7A 3MY9A 3WDJA 2F2HA 2XSXA 3CWNA 3EX6A 1SM9A 2X42A 5M3WA 3HGOA 3S9ZA 3PNZA 1C90A 3HJZA 5FI8A 5C2CA 1OYBA 3QXB<