1GVFA

Structure of tagatose-1,6-bisphosphate aldolase
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
284
structure length
273
Chain Sequence
SIISTKYLLQDAQANGYAVPAFNIHNAETIQAILEVCSEMRSPVILAGTPGTFKHIALEEIYALCSAYSTTYNMPLALHLDHHESLDDIRRKVHAGVRSAMIDGSHFPFAENVKLVKSVVDFCHSQDCSVEAELGRLGSAFLTDPQEAKRFVELTGVDSLAVAIGTAHGLYSKTPKIDFQRLAEIREVVDVPLVLHGASDVPDEFVRRTIELGVTKVNVATELKIAFAGAVKAWFAENPQGNDPRYYMRVGMDAMKEVVRNKINVCGSANRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Tagatose-1,6-Bisphosphate Aldolase; Insight Into Chiral Discrimination, Mechanism and Specificity of Class II Aldolases
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords TAGATOSE-BISPHOSPHATE ALDOLASE AGAY
total genus 105
structure length 273
sequence length 284
chains with identical sequence B
ec nomenclature ec 4.1.2.40: Tagatose-bisphosphate aldolase.
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1gvfA00
5D37A 3LCGA 1LTDA 4AEOA 3QW3A 1M6JA 3PB2A 3PF3A 3W7HA 3W1PA 1UASA 1TREA 3NM3A 1PVNA 1XC4A 1VYRA 3UWVA 2Y85A 3TC6A 5DY2A 1LBFA 4JTUA 4FX8A 4O0KA 4BWLA 4QJ1A 4OWGA 1IF2A 1G4SA 1T99A 4O8RA 3W6YA 2JKEA 4GUJA 1WQ5A 1YTDA 3TROA 1XBYA 4ICNA 5AFDA 3OVPA 5FF7A 3W74A 2NUYA 4A29A 1BEUA 4MY1A 3TQKA 3MI3A 1QPOA 4IJBA 2C1HA 1X7FA 3GZ3A 4JTKA 3TSDA 1LDCA 1S5VA 5BNKA 4DO6A 4AVFA 1TPDA 4AWSA 3DH7A 2GVJA 2ZFAA 3KRZA 4JTJA 3GKAA 5FEPA 2FB2A 2HS8A 1W5QA 1YPFA 4TO8A 1HFBA 3DZ1A 4DELA 1OG0A 4NUWA 4JD4A 4AMAA 4FNSA 3P81A 3Q94A 4K36A 1G69A 1K8YA 1GT8A 1X8FA 1EP1A 3BG3A 5DCDA 4BWLC 3T4CA 5LHFA 4QQ3A 3N34A 3QJAA 4FIQA 5K4ZA 1LLWA 4ORMA 3C2FA 4HNUA 2TYSA 3KVMA 1TV7A 3W1QA 3A24A 4GRSA 3OBKA 3NL5A 1VH7A 5AHIA 3P61A 2RDWA 2NX1A 4AAJA 3LHWA 3UY8A 1FCVA 5DY3A 3UWWA 3A23A 2NX3A 3G1YA 3O6YX 2VELA 4IMEA 5EMUA 3M1ZA 4X2RA 1SSDA 1L2UA 4LVBA 1WXJA 5HNRA 4ZMGA 3G24A 2R94A 3SGUA 2DZSA 1OX6A 2FQIA 4LVDA 1JQVA 1F76A 2FDSA 5IBXC 4GNJA 2CLOA 1YTKA 3I65A 1KM4A 2NX9A 2OZ0A 2ATSA 1EUNA 1O4UA 1ZHAA 5DBTA 4XZ9A 4R53A 3CWOX 3TW7A 1PHWA 1X1OA 3UZJA 3E0IA 2W0UA 3IVTA 2V5LA 3LBMA 4ZQMA 3UWQA 5I3FA 5DXYA 3W1AA 4Z0SA 2CZDA 3W7RA 1YTEA 1Z48A 5D2WA 3K30A 3PULA 1RQEA 3P67A 4TMCA 1Z44A 2QCLA 3VKJA 1NAL1 2ZYFA 5EKYA 4JYEA 4MUZA 1I45A 1R30A 3L21A 5CG7A 2QUVA 4J9JA 3CU2A 5CGQA 4YLWA 1TRIA 4EOUA 1JCNA 4UMBA 2ZBTA 3SSJA 4UFKA 3PBVA 1XFBA 3C2RA 5MHBA 3DBPA 4JTGA 2PRLA 1BWKA 3BW3A 4CCDA 4RCXA 2QCFA 2YW3A 4DF0A 5DBUA 2QJIA 4RLIA 5DLCA 4MLRA 4Z1AA 4FNQA 4ZQCA 2QDGA 1KBJA 3TA6A 1TPUA 4L4MA 3LV5A 4HNTA 4BI5A 4JTHA 4KFOA 3W86A 2ZZ5A 3P84A 4UTWC 2VC6A 2EHHA 3QQ0A 2C18A 1X6UA 1ICQA 3FJLA 3QSRA 3EKLA 3HG3A 2EKCA 1GVRA 1DORA 5J5RA 3B03A 1GWJA 3WK3A 2PE4A 3BGJA 3OA3A 4FNRA 4M5PA 4MJZA 3MW7A 1VHNA 1D3GA 1FX6A 2R8WA 1ZAJA 4LVFA 2CZ5A 4HPJA 2OX1A 3NQCA 3HGSA 1NF7A 3W87A 3KRUA 1W8SA 2WPBA 4NNAA 3W7LA 5F4WA 4LV9A 4PCFA 1QR7A 4UFMA 1KM3A 4Z0JA 1B9BA 1N8FA 4IXXA 5SWUA 1U83A 2Q3OA 1W5NA 4Y9AA 1I8JA 2QF7A 3P5ZA 3LGEA 4HNNA 2R91A 1MZHA 3NL6A 2B7NA 1XXXA 1WBJA 3L66A 4MOZA 3E12A 3O6CA 2BSLA 4UTWA 4XKYB 3TUUA 3FYPA 1SO4A 3SW6A 5DELA 2G5WA 1VS1A 3BO9A 3PSWA 2R14A 4NQ1A 3LTPA 1K8XA 3R8RA 2C0AA 1QPQA 1FQ0A 3NGJA 4N9CA 2OJPA 3RLVA 4O54A 4DBEA 3BG9A 4PFMA 4HN4A 1ME9A 2I9EA 3L65A 1ML1A 4ZQRA 4B5NA 4DQWA 4FXRA 3LCHA 1HO4A 3QFEA 4JYDA 3TH6A 5LGXA 1EP3A 2FJKA 5IM51 4RXFA 1FWTA 4K37A 4UTTC 3W83A 2WV8A 3DFSA 2YDAA 5HWJA 2WSYA 3NOEA 3KVKA 3JS3A 2VEPA 1OFRA 1DV7A 1W54A 6ALDA 2FPTA 1KBIA 1SW3A 3GDKA 1O95A 3IRDA 3A21A 3M16A 5K2ZA 2V8ZA 2ZRVA 1A5AA 3I7SA 1W0MA 3LCXA 2J27A 1G7UA 2F7FA 3A9IA 3ATYA 4R33A 5FF2A 4EVZA 2A7PA 2Y89A 1RQBA 2YGYA 1L6WA 4UNKA 2JKAA 3E96A 5CPOA 3STFA 4O18A 4D2JA 1K3UA 1AG1O 4K7VA 3TAKA 2WO5A 3UY7A 4O1BA 2YR1A 3VE9A 1XBVA 2A0NA 3SGZA 1XDMA 1YDNA 1VCVA 1KFCA 1VCGA 2X2GA 2DP3A 3GLCA 1B57A 5AYYA 2CLIA 1R2SA 1LCOA 1P0KA 1F6KA 5AYZA 3DAQA 1TTJA 4OV9A 3W84A 1LBLA 2ZZ2A 4FNTA 3S6DA 1H51A 2YYUA 2FTPA 3NQAA 1JUEA 5LZLA 3SY5A 4M6PA 1ALDA 4DF1A 1WAUA 1G7VA 1GOXA 2XFWA 1FBAA 4ZZ9A 2E09A 2YFNA 4NXSA 3WFAA 1KM0A 2Z2UA 4CLMA 5CZ0A 4UUIA 3M5VA 1TQXA 2YX0A 2BLEA 4S2BA 4LC6A 3UZ5A 1UUOA 4IX0A 3QRHA 3O15A 4PL1A 2VXNA 3DKJA 4DXVA 3A5FA 1H63A 1JVNA 1RZMA 1I2OA 2ZRWA 2CWNA 1SZNA 4JN6A 1TO3A 2B7OA 2E6AA 3KVJA 1G67A 2DZTA 1GVOA 1SO3A 3W2NA 2XN2A 4N6FA 3HGJA 2RFGA 4MFEA 3BK0A 2Y7GA 3LCWA 3PWAA 1ME7A 3I7QA 4NZJA 2FPYA 1WOAA 4PA8A 4YCOA 4KFNA 4WD0A 1N7KA 1PHQA 2NLIA 3P8JA 5AC6A 3S1VA 1H50A 3B06A 5D03A 5HULA 1PIIA 1VYSX 4JX5A 4LUJA 1GG0A 3QQ1A 3L5AA 5E1QA 1W5PA 2QJHA 4O16A 5F2MA 2EPHA 1OF6A 1AW5A 3HBLA 1H7XA 3WJXA 1QWGA 4K8EA 1LP6A 5IBXA 3G0UA 2E5DA 2ZZ7A 1Q6QA 3TMQA 3TW6A 1G4PA 4Y96A 1XBXA 4O4VA 3W1LA 3VCRA 2A85A 5BMXA 4AWTA 4RX0A 1H1ZA 2WKJA 4LW7A 2JK2A 4BI6A 5LNSA 3P60A 3NQ2A 3O63A 3B0UX 1QPRA 2E5BA 2NUXA 4XWUA 2ATMA 5KZMA 2QCCA 3LOTA 2GQAA 1T96A 4AF0B 3TFXA 2DZUA 5CPMA 3M6YA 1UJPA 4CCCA 2Z1BA 3WK1A 2Y63A 1TTIA 5A8GA 3QPZA 1YADA 4DPPA 3LLDA 1TSIA 4I9AA 3S5ZA 1OYCA 3M7WA 1FXQA 3T44A 3QSTA 2GJNA 1VHCA 5DN1A 1EWEA 1JJKA 3M0ZA 3W7JA 1DJNA 3TXZA 3W7GA 2DU2A 2I1OA 3BW4A 1G4TA 3EWUA 3G0XA 1KFEA 4RZ6A 2G95A 1LRNA 4CQ8A 3FKKA 4GUFA 4WX2A 5FEXA 4LS2A 4MZYA 4O52A 1KM5A 4E2DA 2PCQA 2C13A 4FX6M 4IWWA 4IX2A 5F1VA 3LLFA 4JEQA 4DO5A 4FXSA 5K3VA 3GR7A 1KM6A 3MJYA 4JGDA 3LB0A 4FB7A 1FCUA 1GVFA 3NL2A 2YCEA 4W9TA 1Q45A 1FCBA 1SZEA 3P80A 3W85A 1JUKA 1A5BA 3HG2A 1K8ZA 3BGGA 4P2VA 1W5MA 5LGZA 2RDUA 4Y90A 1VRDA 3C61A 3LHUA 3TAOA 3I7RA 3DHDA 2WJZA 4HT3A 3SIZA 3C6CA 4XTDA 2VFDA 1W37A 2OT0A 4EWND 1O5KA 5HWMA 1QMLA 5HUPA 4PH6A 1IIGA 2WSRA 4K7YA 5DCBA 1XDLA 3WJYA 1PS9A 1H1YA 3B04A 2NXIA 4N02A 4RKAA 4PTNA 1G4EA 2LLEA 1SW0A 4RR4A 3LHTA 5K9XA 3NAVA 3FA5A 4XQ6A 2C6QA 5DCEA 2VFGA 2X30A 3CC1A 4HNVA 3QEZA 3M44A 1AW2A 3QF0A 1KTCA 3DENA 3GDTA 4A2RA 3PUDA 1TV8A 3B8DA 2CZFA 3C56A 4H3DA 4Q32A 3T78A 3F1QA 1SUXA 1XBZA 1XCFA 2H8ZA 3W1UA 1TB3A 3MYOA 3DU0A 3LBCA 1TQJA 3LI1A 3DFOA 2YZRA 3FIGA 4UTMA 3PS7A 3NPXA 4NNCA 1TRDA 3CWNA 1ZAHA 1T8XA 1E51A 4LVGA 1A53A 3CPRA 3RF9A 3NPWA 3G1DA 3CEUA 4AF0A 2CLHA 3VNDA 2DORA 3IIPA 2QAFA 2GQ8A 5F1UA 2HS6A 1FWWA 1O5XA 3A22A 1JR1A 1JCJA 2JGQA 3TIMA 4N4QA 3R13A 1FDYA 3W9ZA 2XN1A 2E5CA 3OVQA 2J24A 2EAWA 3FKRA 3EXSA 4JTIA 1Y0EA 5AHLA 4RK8A 5U7SA 4NJHA 1LOLA 3WK2A 4GJ1A 5BW6A 2BTMA 4QIUA 2E6DA 2VEKA 3B4UA 5AC7A 1H5YA 1KA9F 2GOUA 1SO6A 2WQPA 1SSGA 2RHGA 2QCDA 5CPLA 3QPYA 3R12A 4GUHA 5CZTA 3TDFA 5CZJA 2A6LA 2D73A 2QEZA 3IGUA 1J5TA 1F6PA 2C14A 4NT0A 5I3JA 2F84A 3CIXA 4K38A 2ISWA 4NZFA 4QNWA 2A2IA 3UYCA 1LORA 3M43A 4YCPA 4WXYA 3N2XA 1A50A 4UFHA 1AL7A 3UQNA 3HGOA 4XTIA 4UTLA 3EX4A 5D2XA 1SU5A 3GDLA 3ABQA 3NPUA 3R89A 2CLFA 4P61A 3BLEA 5G5IA 4ADSA 1ICPA 2OCZA 1H7OA 4OHQA 3L67A 3HMJG 1LBMA 4UR7A 3LTYA 4A3UA 1K7XA 1LOSA 1M7PA 4O28A 4XBSA 5LSMA 3EXTA 3W2LA 3THQA 1D9EA 1DKWA 2TPSA 3HJZA 3S5OA 1TYGA 2J9XA 4K39A 4DF2A 5C55A 4NJIA 5AYXA 3S42A 5C6MA 5D05A 1QO2A 3QMSA 4DPQA 3EB2A 3Q58A 5AN7A 4RXGA 2VFEA 3W7QA 1ZNNA 2RKXA 1KV5A 3BPWA 2ZA3A 3F03K 1I2PA 2Y7EA 3LXBA 5FI8A 3N3MA 2QUUA 3TSMA 3JR2A 5AB3A 3PC0A 1FDZA 3NO5A 1OFPA 2KZHA 4O4WA 5G1TA 3GAYA 2P0OA 3U8GA 2WOQA 3EX6A 4MZ1A 1YDOA 3G1FA 4S2CA 1LLZA 2V0TA 4R7JA 1Q6RA 5FEZA 2Y7FA 3KHJA 1U5JA 5CSSA 1O94A 4MYXA 2Z6IA 2A6NA 3PR2A 1B3OA 1ONRA 1JCXA 3N2MA 1HL2A 4OQVA 5KITA 3UD6A 2ZRXA 3DFQA 3PBYA 4O1CA 3LDVA 5TQLA 1QCWA 4AXKA 3DFNA 3C2OA 4ONVA 2Q3RA 3BV4A 2YSWA 3LRKA 5D2TA 4FHAA 4UTKA 3C3NA 1Q6OA 1YXCA 1MEHA 2GUUA 2NXHA 1JRCA 2VKZG 1EIXA 3L0NA 3NR0A 3G1SA 1C9DA 2CLMA 3DXIA 4JR5A 3UPBA 1F73A 2C3ZA 4GWEA 1Z41A 2V2DA 2V81A 4PEKA 4TMBA 3HPXA 1EWDA 3W7PA 2Z6JA 1P4CA 4JXCA 1JCYA 3LV6A 1OFOA 4R34A 5D32A 1W3TA 1OYAA 5HMSA 3BLIA 1NSJA 3NQ6A 4E38A 1QNVA 4NVTA 4Q33A 3SI9A 1JCMP 3B0PA 2E1DA 3GNDA 3BLFA 1AK5A 2FLIA 1B4KA 4MY8A 5J5DA 4Z08A 1YXYA 3GDMA 3IIOA 3DI1A 5CPNA 3UWUA 2Y7DA 3GYEA 1VPXA 1OHLA 4JTEA 1VJIA 2TRSA 1R2TA 4OV4A 4UC5A 1VYPX 4AH7A 4N9EA 1KM2A 3ABRA 1MEWA 3FYOA 4YXGA 3FFSA 3TX9A 4LRTA 3M47A 4Z1BA 3RFAA 4WUIA 4BI7A 3LRMA 4GUGA 3C2EA 3W07A 4PL2A 1OX5A 3EWXA 3ZFHA 2X1RA 4M7TA 3WK0A 1VQTA 4KWVA 4X22A 5BRBA 1LROA 3IIXA 3LCIA 3INPA 1LRQA 2E68A 3HF3A 2Y62A 2VFHA 3I68A 4I7VA 1KW1A 5TIMA 4WQ6A 1KLYA 3MYPA 1I2QA 2QKFA 3W3OA 3NM1A 4MVAA 4C1LA 3I6RA 1KV8A 4UIOA 1TPFA 3STEA 5KZEA 2W79A 3KRSA 1RPXA 3VFLA 4GFSA 4H6KA 1DHPA 5AC8A 1R46A 1ZJIA 3DGRA 1XL9A 3LCLA 4FIRA 3MBFA 5D2VA 3KXQA 5EL1A 1SZGA 5HR6A 2VEIA 1F5ZA 3NNTA 1SO5A 3LXCA 3NQGA 5FF0A 2B7QA 1VR6A 3HOJA 5D30A 2V30A 2YFOA 5LHEA 5LNVA 4WY0A 3U6WA 3STCA 3GXTA 3YPIA 2GQ9A 2FPVA 3VE7A 2A5HA 1WV2A 2ISVA 5AHMA 3RNDA 1RV8A 3HB9A 1I2NA 4RJEA 4O11A 3BW2A 4X9SA 5KSWA 3EWZA 3W23A 3TE9A 1TCDA 2ABAA 2NWSA 4OGZA 4O50A 3S1WA 4UFIA 1GZGA 5T26A 4A21A 3G1XA 3FS2A 4Z1CA 3KFTA 3H55A 3PBWA 1SQ7A 4NJJA 3G1AA 5G1YA 4O0ZA 3EWBX 2ZTJA 4NX0A 1HUVA 1OFEA 2VENA 3HPSA 4IGHA 2Y61A 3PY2A 4JY9A 3ZWSA 2A7NA 2YW4A 5I3HA 1S3HA 2ABBA 3NG3A 3W88A 3TKFA 3P82A 4UMAA 4YWIA 4E0CA 4QM1A 2NUWA 5D09A 3PSVA 2DJLA 4CQAA 1OX4A 4Q4KA 3IIZA 4OU1A 4ZL1A 1YLVA 4IPIA 1C8VA 3NQMA 2H90A 2VOMA 3W7OA 2X16A 3CLMA 3USBA 2V2HA 4CNPA 1SPQA 4FEZA 1UUMA 4N9DA 5K4XA 4NJGA 5F4SA 4AHOA 2GVGA 3LCFA 1YYAA 1NFBA 5G4EA 2XN0A 4N4PA 3PBUA 4EF9A 3W72A 4MIMA 4N6EA 2O7SA 4POCA 3RK8A 3MHUA 4UR8A 5BOOA 1KLZA 1KTNA 3LM7A 3TSBA 3W7IA 4AB4A 1JRBA 1TPWA 5HWNA 1GVSA 5D2YA 4MZ8A 3NQDA 1K7EA 3B05A 4JDYA 2E6FA 3CHVA 2ZCGA 3LX9A 4UNLA 3PG8A 1VLIA 3WJZA 4EF8A 3C8FA 4O15A 2O7QA 3G22A 3HQ1A 1VZWA 3CB8A 3DI0A 3O05A 1W3IA 3H53A 4ZQOA 1M5WA 1QOQA 3MP5A 4ALDA 4IOTA 4ADTA 1CW2A 3MHGA 4PC8A 3PVFA 2P10A 3PB0A 4LS1A 3W1TA 1IXOA 4IPJA 4UTHA 3TQ0A 3M5YA 1DBTA 3GNNA 1HTIA 1UCWA 4RZ4A 5CKSA 1KFKA 4N9BA 4WY0B 2I14A 3F4WA 4GXMA 4AHPA 1ZALA 4TIMA 1PE1A 5AHEA 4WJEA 2QR6A 2BX7A 2G96A 4OBTA 3PUEA 4S1FA 1XI3A 3TXVA 1VLWA 4MKNA 3G1VA 3GAKA 2GPTA 4O12A 3B0VC 3UWZA 3EEGA 1IXNA 4IXHA 3T7VA 3MBDA 5H91A 2E77A 4ORIA 4GE8A 1GTEA 3Q37A 2FFCA 2X1SA 3N73A 1DQXA 1OFBA 1MXSA 1PL9A 2DZWA 3W2JA 1R2RA 2H3DA 3QC3A 3G1HA 1I4NA 2PRMA 4ZQNA 1J4EA 1DOSA 4TU1A 3NZRA 3N14A 2WNNA 3WJSA 2VFIA 2ALDA 4AWUA 5EA9A 1XM3A 4QNEA 4YMZA 2H8XA 4WY0F 1CI1A 3W70A 1M7OA 3GXPA 4UFLA 3GVGA 4WXZA 4JNMA 2OT1A 5H2ZA 2J9YA 2ZQ0A 4BK9A 4IUOA 3MP4A 3W7KA 3CM4A 4LS0A 3W7EA 4U28A 1AL8A 4RV8A 4N2YA 2QCMA 3GXNA 3P7YA 2YYTA 1OK4A 1S5TA 1H7WA 1GEQA 1AW1A 5G2WA 2C16A 4PODA 2G97A 1NVMA 2AAMA 2J6XA 3PAJA 5K7JA 1TPVA 5KTLA 3TK7A 3N19B 1LYXA 1H7PA 3NQVA 3GB6A 1YPIA 2AQWA 3QM3A 3QW4B 5FF4A 2ZRUA 3EXRA 3O06A 4LU0A 5D38A 3G0SA 1TJPA 4QSHA 1BWLA 3GDRA 1X1ZA 4U4MA 3NQ8A 2DZVA 3MUXA 4JTTA 3W22A 3O6DA 4DO4A 1ADOA 5AOUA 5E0KA 3NDOA 4YL2A 3KX6A 1TMHA 4IMFA 1L6SA 3IVSA 4JDBA 6TIMA 1ZFJA 4MY9A 5DXXA 3W2MA 3Q2DA 3EKZA 4LC8A 4NJKA 4BR1A 3NZ1A 1W56A 4KFPA 4GBUA 4IMCA 4Y6GA 2H3BA 1EP2A 1W1ZA 1CX9A 3IIVA 1THFD 1KTBA 3C2VA 1QDSA 2A7RA 5CZSA 3O16A 3MI2A 2E6YA 3G3DA 4LT9A 4BFAA 5EY5A 1EEPA 3TJXA 1GYNA 2DZXA 3P74A 4M7SA 3UNDA 1GPWA 1TPC1 3NQEA 2UV8G 4WOZA 4MJMA 2RH9A 1EX5A 2ZZ6A 5FF3A 4KWWA 5K9CA 3O1NA 4O53A 5LNRA 2ZA1A 3GX9A 1DVJA 2OMAA 1FWSA 4HIBA 1HO1A 3QMTA 1EB3A 1EA0A 4CNNA 1WA3A 3QZEA 3LERA 4KKXA 1EPXA 1OX4B 3AO0A 3TQVA 3MHFA 4Y8FA 3UXDA 3QMRA 1H60A 3BVJA 4RZ5A 2Q8LA 1FY6A 5CSRA 2B4GA 2NV1A 1YXDA 2GVLA 4M6QA 4OT7A 2CW6A 4LOCA 3TMLA 3CEPA 3NL3A 4LWWA 1RVGA 1GG1A 5TBOA 3ATZA 4Z1DA 1OF8A 1MEIA 2Y6ZA 4LY8A 4JICA 2P1FA 2V9DA 1WX0A 1NF0A 5F4XA 3HIJA 2HMCA 1T0OA 4LV4A 1F7BA 3L68A 4DEFA 3TU9A 1TV5A 3E49A 1C29A 3N9RA 2QCEA 2X1TA 4UCGA 1LZOA 4QITA 4IQLA 3PG9A 3S9YA 3KAOA 1WOBA 4C1KA 2Q8ZA 3G18A 5GVJA 1PV8A 4QISA 3N9SA 2TSYA 5HJLA 3LRLA 4L4LA 4NXKA 3TC7A 4JTLA 4K6AA 2CU0A 3T40A 3OHIA 2ZZ4A 3ABOA 2QCHA 3EX1A 3C52A 2DJXA 2A21A 3V75A 3L2IA 1GTHA 2ZZ1A 1G6CA 3S5NA 1TJRA 4JIQA 1FWNA 3V1PA 1QO5A 4UMCA 4GC4A 2QCDB 3W2KA 3GK0A 3NQ7A 2NZLA 3EX3A 1OFAA 2QAPA 2GJLA 2QJGA 1W31A 5C5YA 3G3MA 5U4NA 3NXFA 1UBSA 3UPWA 4MYAA 3S1XA 4CCEA 3S0CA 1MSSA 2PRHA 1F2JA 2CLEA 3H54A 3L9CA 3HGRA 4JY8A 4UFJA 2VEMA 1VGAA 2WNQA 3SR7A 4M19A 3OG3A 4FNUA 3TNOA 3ZS4A 3E9AA 3LI0A 3P5YA 2BWGA 3R5EA 3BG5A 3OVRA 2ISSA 4XUGA 4JX4A 4XKYA 1RD5A 5HUOA 4CNOA 3M5ZA 1QPNA 4QAIA 2B7PA 5BMWA 3CTLA 3C4UA 3G8RA 1KFLA 4O19A 2BXVA 1BKSA 2RDTA 3QYQA 4E2BA 1RR2A 3BARA 4O1DA 5KMYA 4MPQA 1H7NA 1DQWA 3VI2A 3UWYA 1SR9A 3M41A 5G4WA 3IV3A 3L0KA 7TIMA 3HG4A 5AHFA 1JQXA 1H62A 1IIHA 1FCQA 4FNPA 1H7RA 4LUIA 1FUYA 4CQ9A 2ZRYA 3L0GA 4JTFA 3GR8A 3W1RA 2YXGA 5L6UA 1ZY9A 3TV8A 1Q3NA 4NU7A 2ZA2A 2YPIA 3L5MA 1I2RA 2HTMA 1YDVA 4WOQA 5D04C 3SJ3A 4MLJA 3FJ6A 3NQFA 1P0NA 1TPB1 2ZDRA 3F4NA 1MO0A 1WDWA 3C0JA 1L9WA 3W73A 3ELFA 1W3NA 1TPH1 1EUAA 3A5VA 3E02A 3GIYA 2Y88A 4FO4A 3ABSA 3W2UA 3IGSA 1IXPA 2PC4A 4HSNA 4K8HA 5HQEA 3TFCA 2Y70A 3FOKA 4NX5A 4H4IA 3SFKA 4FX7A 5D02A 4O13A 5K9DA 4G1KA 1KFJA 4IMGA 3LTSA 1JUBA 3S8HA 1BTMA 3LXAA 4LTSA 3M9YA 3O8AA 3RMJA 5LNUA 2PURA 1B4EA 3RLUA 1SZFA 2WSQA 1FXPA 1ZAIA 3RU6A 3EX2A 4LRSA 3W7CA 2CFFA 2QUTA 1AMKA 2ZZ3A 1OVDA 3FLUA 5D33A 3O07A 1Z42A 3DFTA 1W5OA 3AJXA 4O1AA 2CZEA 3DHFA 3NYZA 3W7MA 1TTPA 5FESA 1TIMA 1FWRA 1JULA 1LM1A 2V82A 3CIWA 3MO7A 4JS3A 3MP3A 1PCWA 1UB3A 1XKYA 1KFBA 4UTIA 1O60A 1F05A 4OE7A 4ZVJA 3EWYA 1IXQA 8TIMA 4I7WA 4UTUA 2QCGA 1OJXA 1A5SA 1OYBA 3GKFA 1ICSA 1VCFA 1JCLA 3HO8A 1SFJA 3NPVA 3HPZA 3ANYA 2FB3A 1GQNA 2ZTKA 3ZR4A 5C2XA 3UXAA 2C19A 2JBMA 3R2GA 3LHZA 1ME8A 4HKPA 3SECA 5ABTA 3JRKA 5EBUA 3W1NA 3NEVA 2NV2A 1P1XA 5G2HA 3W76A 3W71A 4AHQA 2J9ZA 3KOFA 1QFEA 4O17A 3OEXA 4JYFA 4XBKA 1NEYA 1K02A 1PCKA 1K03A 2JGYA 1FDJA 3W7DA 4UTJA 4BF9A 4FF7A 3HG5A 2QCNA 1F74A 1VC4A 3IGXA 1XUZA 1OFQA 3PM6A 5G2IA 5AHNA 1OFDA 4HHPA 5F2IA 2NWRA 4TX9A 3SZ8A 5EYWA 3TJLA 2W6RA 4LVAA 1OK6A 1D3HA 4JX6A 4HPXA 4ZQPA 3L5LA 4JTSA 4GUIA 2CLKA 2JKPA 3FEMA 4LNYA 2ZRZA 4JIPA 3P8IA 3LHYA 3LHVA 5L9FA 5I3GA 1LRTA 1DJQA 3QH2A 4A22A 3EWWA 1HG3A 3M5XA 3KVLA 3W1XA 4O14A 3U2OA 1A5CA 5I3KA 2DZPA 5KINA 5I3IA 2IQTA 1QAPA 3DKLA 5EPDA 2TMDA 4MFDA 1RQHA 1Q6LA 1SW7A 1N55A 3W7NA 3MI6A 4UTTA 1XUUA 1ZCOA 3MMTA 2AGKA 3TR2A 4IMDA 2FIQA 2BZNA 3NVTA 3PUOA 4I7UA 5LKYA 1KM1A 2EGZA 4NNBA 1V7YA 1WYIA 1K7FA 1TTQA 5HR7A 2B0MA 2Z0IA 5C54A 3S1UA 2EF9A 1R47A 5HINA 2NXGA 2A4AA 5LNWA 4O10A 3ZWTA 1P5BA 5KZDA 3CT7A 1OABA 3D0CA 5E93A 5FEWA 2X1UA 4WZHA 3DFPA 1QOPA 2CLLA 2HSAA 1GJPA 4X3ZA 3T55A 2V5BA 4UXDA 3CQ0A 4O57A 2VFFA 3P62A 3TCEA 1LOQA 1WBHA 1DL3A 3WJWA 3OIXA 2H6RA 4TR9A 3W75A 1TPEA 4M6VA 5A5WA 1J2WA 1V5XA 3IVUA 1IGSA 2J88A 4ML9A 3NA8A 3S5YA 1H61A 2QDHA 3STGA 4EIVA 2WNZA 1L6YA 1ZENA 4ADUA 2A1YA 3G8EA 3MWAA 1GYLA 4A2SA 2V2CA 1S5WA 5F2LA 1SFLA 5F2GA 1GVQA 4HSOA 3THAA 4DBDA 3W1MA 2C15A 3IEBA
chains in the Genus database with same CATH superfamily
1Q7QA 3LCGA 4YU1A 1MW0A 3QW3A 1M6JA 2HZGA 1UASA 3O0KA 5A6LA 5TF0A 1US0A 5M5DA 3CZJA 4J5NA 2Y85A 2J75A 1R87A 5C70A 4C91A 4BWLA 1LLOA 3DECA 3GIQA 1T99A 3CPUA 1TUFA 4RNHA 1XBYA 4ICNA 3QLDA 1W9DM 2WMKA 2VRKA 3VOIA 2NUYA 3GG1A 4A29A 2NV9A 3TSDA 4U3AA 2XH7A 3LPGA 1DXEA 5MF5A 4AVFA 4Q8MA 5E70A 2EPOA 5FEPA 2FB2A 3TYBA 4TO8A 3DZ1A 4JIRA 2XISA 3GNRA 4A35A 4JD4A 3T2QA 4AMAA 3Q45A 3P81A 5AC5A 1D3CA 3U48A 1HJVA 3G6LA 1ZB5A 1RK5A 3BG3A 1JF6A 1CENA 5DCDA 4AIEA 5LHFA 4ORMA 4LAKA 1TV7A 4MJ2A 1EXPA 1WZMA 4GRSA 3OBKA 3NL5A 2QVNA 4ERGA 1VH7A 2NX1A 4AAJA 3LHWA 3A23A 4KH2A 2ICSA 4NZ5A 1LL6A 3LU2A 5CC3A 4PN2A 3UW6A 4X2RA 1L2UA 2I5GA 1WXJA 4LVBA 4DNHA 3G24A 5FCZA 3RITA 1F76A 2FDSA 4HYVA 5IBXC 2PDNA 5CLWA 3M0IA 2OZ0A 1RD6A 1EUNA 1ZHAA 4ZO8A 1X1OA 3UZJA 4GO8A 4AC7C 5I3FA 1V8EA 3GNXA 3W38A 1QK2A 5D2WA 4A4AA 3PULA 3AIBA 3VKJA 2ZYFA 4JYEA 3OTRA 4MUZA 4XO7A 1I45A 3TYDA 2EG7A 3L21A 1TRIA 4HCLA 3AOFA 4F0LA 4JCLA 1JD7A 1B0IA 1JAKA 1FHVA 1XFBA 7A3HA 5FIPA 3IJ7A 2X0HA 3VOGA 1EC9A 4JTGA 2WM1A 2PRLA 3ZIZA 1QUMA 2ZX9A 4H2CA 2VP8A 2DUXA 3V3WA 4ZQCA 3LENA 1V51A 4RE4A 4HNTA 4JHZA 4NAEB 4LYQA 3K4AA 3P84A 4FSAA 4M0XA 1N82A 3QQ0A 2XFFA 2JF6A 3DFYA 3SUWA 1UR8A 3HG3A 3UCCA 2VMFA 1GVRA 1H11A 5J5RA 1S5NA 3VO0A 3IUIA 3WK3A 3A64A 1XIMA 4FNRA 4H7VA 1TJ2A 3SCSA 2DSUA 1FX6A 4PRTA 2R8WA 1K4HA 1ZAJA 4L56A 3AMLA 3AC0A 3EDKA 3KLLA 3WMSA 3AISA 4LV9A 3ZT7A 2EG6A 1BYAA 4Z0JA 1N8FA 2JIEA 4L65A 5SWUA 4G7EB 2J7HA 4Y9AA 3P5ZA 2QF7A 3CXOA 3LGEA 3DC0A 3WFLA 4JNZA 3NL6A 3RJYA 3VILA 1SYTA 2YDRA 4MOZA 3E12A 3AHYA 4UTWA 1AA1B 3OYXA 3SW6A 2G5WA 4KT2A 3WNPA 3PSWA 2R14A 1WKYA 3NGJA 2NVDA 3BG9A 5KZ6A 3UZXA 4WR3A 4M6UA 1KRAC 4PULA 3LCHA 2NLYA 2POZA 2G3JA 3TH6A 5LGXA 3NXLA 4YYFA 3W83A 2WSYA 3KVKA 1HZYA 3BAJA 4JTDA 3CJPA 4GGHA 2ZRVA 3B8SA 3IV8A 1BWVA 1W0MA 3IGHX 3WQFA 3SB0A 2J27A 1G7UA 2F7FA 3T09A 3ATYA 4R33A 1UR2A 5FF2A 1BXBA 4EVZA 2Y89A 1EJRC 4AU0A 4KGLA 1L6WA 3WH5A 3WDRA 2QDEA 2E9LA 3CNYA 2WO5A 2VURA 4NF7A 3F5KA 3FVMA 5FAGA 1XBVA 4US6A 1CNVA 2A0NA 2E4TA 1CEOA 4OZOA 1RPKA 1VCGA 2AL1A 4XVEA 2DP3A 2CLIA 1R2SA 3N6JA 2PGRA 3PTQA 3W84A 2ZX5A 1LBLA 2ONEA 4FNTA 2WZIA 1PYMA 3GXIA 3NQAA 2QPUA 4M6PA 1C91A 4RE0A 2XFWA 4ZZ9A 2E09A 3WFAA 2VWTA 2WVUA 3CH9A 4GYFA 3VC6A 4UUIA 2VC5A 2YX0A 2NSXA 1NFPA 3J7HA 3CL7A 3PZGA 4KEVA 2IPFA 4IX0A 3VDCA 4PL1A 3U7BA 1I2OA 2CWNA 4CVWA 1Q6GA 1AQHA 1QBAA 4JN6A 1TO3A 2JF7A 1G67A 3BZJA 3WDPP 1EGMA 2QJJA 1SO3A 2I57A 3W2NA 4N6FA 3HGJA 2RFGA 3W28A 4F8XA 4UCFA 1IHIA 3LCWA 5JBEA 1ME7A 1ADSA 4HVXA 2FPYA 3H8AA 1XYLA 1JFXA 4GOAA 3M46A 4KFNA 1PHQA 3P8JA 1L6FA 1YDYA 1VYSX 3PPCA 2P8BA 1GG0A 3F7JA 3TONA 3L5AA 4ROPA 3ZLGA 4GYKA 1OSEA 4O16A 2EPHA 5LIYX 3WQ4A 2E5DA 2ZZ7A 4B9ZA 2Z7KA 3TW6A 1TIWA 3D6NA 2NVAA 2EPNA 3TOYA 5BMXA 5A95A 3ITYA 1H1ZA 1M68A 2JK2A 4BI6A 3DHUA 5LXXA 4L6HA 3RM8A 1V6YA 2E5BA 2NUXA 3LPOA 4GJIA 4XWUA 2FZ8A 2QCCA 1T96A 4AF0B 3AWOA 1XLMA 2DZUA 5CPMA 1W32A 4R85A 4GI9A 3WK1A 1TTIA 3LLDA 2ZADA 1OYCA 3QSTA 2GWNA 3TN3A 1JJKA 3M0ZA 2PDWA 3W7JA 9XIMA 4MWAE 1DJNA 3W7GA 1G4TA 2PDJA 3EWUA 4N7QA 4S3EA 4XISA 2UY2A 4RZ6A 3MSYA 1TR1A 2IKHA 1REQB 3EB3A 4AC1X 4LS2A 1FOBA 1H5VA 1GQLA 3H2CA 4XV0A 1UKQA 1J2BA 4A3QA 1LL7A 1LG2A 3EPNA 1CLXA 4D8AA 3MJYA 4JGDA 3LB0A 4FB7A 1EHAA 4GIRA 4M1BA 3L2MA 4H1ZA 1K8ZA 4IPLA 3VXGA 1W5MA 4O0QA 2CZVA 1ZP3A 3LHUA 3TAOA 4WF7A 1XF0A 5A69A 4DXKA 2W66A 4XZMX 4H00A 2VFDA 4IFKA 5HWMA 4I9TA 1QMLA 4PH6A 4I6VA 1UWUA 2WSRA 2OELA 4PMZA 1B2YA 3B04A 4F2BA 2GZXA 4RKAA 2ACRA 1OM0A 3L7RA 5DRCA 2G4FA 1PZ2A 3LHTA 3N18A 4BEQA 2C6QA 3LD5A 3M44A 7TAAA 2XVGA 3QY7A 3DENA 3U57A 4HHHA 4A2RA 1V0LA 1VFFA 1EPVA 1YEYA 1VIWA 3L4UA 2H8ZA 1A5OC 2PGEA 3RO6A 3ZYZA 3LI1A 4HMDA 2YZRA 1PTGA 1TELA 1MVYA 2YL6A 3RLGA 3S83A 3VIJA 1T8XA 3B40A 5CH9A 1V3HA 1E4NA 3ARZA 2HBXA 4ZSUA 4GI6A 3CEUA 4JN7A 1K9DA 4Q4SA 4XD6A 3RIKA 1EJSC 3RYSA 1JCJA 3W27A 3RRAA 4N4QA 3R13A 1OIMA 2E5CA 4E5TA 4JAWA 5J04A 3SN4A 3ITCA 1AVAA 1KKOA 2DPEA 3WQOA 3EXSA 1Y0EA 1XV8A 4H9XA 2B81A 3B97A 4NJHA 1DWFM 1HP4A 4UQBA 3CWHA 2VEKA 3AIEA 4GYPC 1SSGA 1NDYA 2QCDA 4KW2A 4I6KA 4WSHA 3QPYA 3H4WA 3R12A 4Z1YA 1E6QM 5CZJA 5JIWA 2D73A 2J7BA 2QEZA 4EKJA 1EEXA 4HNCA 4PTMA 4MNLA 4K38A 4ZCWA 2INEA 3TN6A 2J8GA 1UBPC 1XG3A 4UFHA 3K4DA 1AL7A 4XD4A 4DAFA 4R5EA 2R1KA 4PUWA 4AD1A 4P61A 3BLEA 3BOXA 4ADSA 4H6QA 4Q4MA 3H12A 1H7OA 1LBMA 1IYXA 5H8MA 1K6WA 2X41A 4H6RA 2PTDA 3LTYA 4A3UA 1DWHM 4O28A 2NT0A 1EFZA 3W2LA 3IUDA 4P7NA 3GVRA 4D1JA 2F6KA 3S5OA 2DY3A 3S42A 1UIPA 3QMSA 1WXYA 4DPQA 1XQLA 1BQGA 1ISYA 3L4ZA 4CU6A 2VC9A 1TCMA 4GVHA 2IPGA 3K2GA 3KTCA 1KV5A 3BPWA 3M0YA 3F03K 5FJJA 3KBNA 1UWTA 4NASA 3ZOAA 2ZVIA 1R3YA 4F66A 1UH2A 1H4PA 1OFPA 4IP5A 2V3GA 2VT0A 5G1TA 2IW0A 3GAYA 3U8GA 4EANA 2WOQA 3EX6A 4TTUA 3N6HA 4QS6A 5FEZA 5M03A 4IZGA 1U5JA 1O94A 2VM8A 2A6NA 4FI4A 1OGSA 3NJ3A 1FWIC 3UBPC 2ZRXA 3DFQA 2REQB 2PF0A 3CHEA 5I02A 2Q3RA 4GO9A 3VA8A 5E09A 1KFWA 4DWDA 3NEHA 3L0NA 1C9DA 3S1GA 1NY1A 4HK7A 1R3TA 4C6IA 5A2BA 4L1GA 2O92A 4D8LA 2Z6JA 1P4CA 3WLSA 1UPPA 3GU2A 1U1UA 5MKGA 1NSJA 2ZIDA 1F3TA 4C7FA 3FCPA 3WLOA 4Q33A 1EZWA 1XYBA 4PUJA 2Z1KA 2FLIA 1YE4A 3OQ8A 4MY8A 5J5DA 3JW7A 3AXXA 5ABFB 4MF4A 3IPWA 4RPPA 1V02E 3GYEA 4DYJA 1H41A 4JTEA 2PI6A 1R2TA 1FWBC 4HD5A 4OV4A 4UC5A 3ZVHB 1KCZA 4E2OA 2VDGA 3FYOA 3FFSA 3TX9A 3M47A 4Z1BA 4DI9A 3EWXA 4Z42C 2GUYA 1VQTA 4KWVA 3LCIA 1UKSA 1LRQA 2E68A 5A1AA 2Y62A 5TIMA 4P7RA 3R11A 3MYPA 1Q8AA 4C1LA 4G8TA 3STEA 1QI4A 2D3LA 2FH8A 6ENLA 1AD4A 2DVUA 3F4VA 1Z89A 4W89A 1W91A 3HM7A 3T9PA 5HR6A 2VEIA 4Y9NA 1QI3A 1SO5A 1B3XA 2B7QA 4J2PA 2G8ZA 3HOJA 5D30A 2V30A 3GQYA 3MCNA 1OC7A 4NAEA 2WHJA 1XIJA 1WKEA 3G6MA 1EOMA 3KZPA 4URIA 3O7UA 2BGQA 5LYRA 3CAQA 1WV2A 3KCLA 5AHMA 4YHGA 1RV8A 3HB9A 2YLAA 4GQ0A 3W23A 1OC5A 3PJXA 1A47A 1TCDA 2CCRA 1JPKA 4OGZA 3W25A 1ECEA 4C6EA 1R85A 2BOFX 4Z1CA 2OSWA 3KFTA 3PBWA 2XM2A 3V4BA 1D7FA 3EWBX 3WUEA 5LA0A 2G3MA 3HPSA 4IGHA 4K1WA 3ZWSA 2YW4A 1F3XA 3C0QA 5I3HA 3KHDA 4RW5A 4D6HA 3P82A 3OODA 3T4WA 3MSGA 2OWXA 5D09A 2CWXA 3VTRA 4Q4KA 2YDSA 1ITQA 3AYVA 1N8WA 1C8VA 1K9TA 4C90A 4W8AA 2PTZA 1IZCA 2X16A 3VGHA 3MANA 4N9DA 5K4XA 1HKJA 4NJGA 2V3DA 4AHOA 3WX7A 1YYAA 1NFBA 4IQDA 1U5VA 4EF9A 3W72A 3PFRA 1Q7ZA 1U1HA 2O9PA 4Q6JA 3RK8A 2XGBA 1KTNA 3QKEA 3MUZ1 1TPWA 1Q13A 2V3FA 2CNCA 4X0NA 4QCEA 3NQDA 1BHGA 2FMOA 1CXKA 4TQTA 1DJGA 3LX9A 5J8LA 2C79A 1EC7A 2ZX7A 1WDRA 3F4CA 3G22A 3HQ1A 1VZWA 3CB8A 3O05A 1W3IA 1Q4WA 2CBIA 1CW2A 3XINA 2P50A 4HA4A 4PC8A 3PVFA 3H2NA 4QQUA 3AWNA 2P10A 4EXBA 4R7OA 3KZSA 2FZDA 4LS1A 4NZ4A 3W1TA 3WUBA 5E0FA 3M5YA 1ODZA 1WCGA 3QR0A 4N9BA 1E1EA 4GXMA 1GW1A 1ZALA 1P43A 2BP1A 2DVXA 3G77A 4MSSA 4TIMA 5GNZA 5AHEA 1CXEA 4LCRA 3TYEA 4S3CA 4DLFA 4K8GA 3SCUA 2OOGA 4DZHA 1V3MA 2GGGA 4ZOEA 1RCQA 4FK9A 2GPTA 3GHRA 3OGSA 3MO4A 4PCTA 3BUVA 2BS9A 3AUOA 1OFBA 4PCNA 1MXSA 1IEXA 1BF6A 3KUMA 4NSBA 2H3DA 1U5HA 1DOSA 3PJUA 2WNNA 3C5QA 3NVDA 5CSUA 4FLOA 3WJSA 1I75A 4YMZA 2H8XA 4WY0F 3W70A 4D8ZA 3GXPA 4WXZA 4GVFA 2J9YA 2E9BA 4C1NA 2PDGA 3CV1A 1OT1A 3RMEA 3N15A 1AL8A 3B3DA 2QCMA 3VKBA 1QNRA 1XYZA 2WB5A 3MTWA 3ARPA 1C7SA 3RM9A 1AW1A 5G2WA 2C16A 4PODA 4IJRA 2G97A 2AAMA 3PAJA 4ZTYA 5I5RA 2FHCA 2EPLX 3LEPA 2V5KA 4B4HA 2AQWA 5REQA 2ZWYA 2X09A 3O06A 1KRBC 1A5MC 3OLEA 4LU0A 1UWAA 4QSHA 1BWLA 4PFHA 4V15A 3QLLA 3RJXA 2YJQA 1QW7A 1J0JA 4DO4A 5E0KA 1R9XA 3COTA 4MNJA 1TMHA 3ZJ8A 1DTUA 4IMFA 4ACZB 1BRLA 1ZFJA 4EXAA 3W2MA 4M1RA 4E3VA 3DX5A 2WWDA 3ZR6A 4BR1A 4RE2A 1HGYA 3NSMA 3ARQA 2XFYA 4N42A 4S39A 2H3BA 1W1ZA 4CNTA 3CTTA 3B8IA 3FJNA 1THFD 2DSZA 4EX4A 2CBVA 4GG9A 3O16A 3MI2A 3G3DA 1M53A 5EY5A 3TJXA 4LAMA 1ITXA 2DZXA 4LY4A 3UNDA 1GPWA 1TPC1 2UV8G 4WOZA 4RDWA 1EX5A 2ZZ6A 2CIPA 3TJ4A 3O1NA 3A9BA 3KBWA 2ZA1A 1V0MA 1GYMA 1EB3A 1EA0A 2PUZA 4CNNA 4PUEA 4QEHA 1WA3A 1EHNA 1K6AA 1XRFA 4KKXA 4HZ7A 4E8CA 1E71M 1EPXA 3TQVA 2WVTA 3MHFA 4L1XA 2I5QA 3B8TA 3POCA 4NKCA 3ARYA 4B5UA 5CSRA 1UROA 5G4HC 2GVLA 3W00A 3IJ9A 3CEPA 3S6OA 3NL3A 4LWWA 1MZRA 4JQ3A 5TBOA 1V4YA 4Q4RA 1OF8A 1MEIA 2P1FA 4AZ6A 2L5HA 3R6IA 1WX0A 5CAKA 1W1B1 2HMCA 4LV4A 1R7AA 3O6AA 2YCJA 5AYIA 1V3IA 3DBNA 2GWGA 5LIXX 4CCZA 5CJMA 3PK7A 4QBXA 4QITA 4JFUA 2J4GA 3KAOA 2ZC8A 4FR1A 2Q8ZA 4C1KA 5GVJA 2TSYA 5AKQA 4PZVA 5DMNA 5HJLA 4NP7A 4NXKA 3TC7A 4W7UA 3GXFA 2CU0A 4PB5A 3T40A 3A4AA 2QCHA 3OJGA 3ISIX 1WDSA 3V75A 4CQBA 1G6CA 3GC2A 3OQEA 1R3WA 4GC4A 2QCDB 1ZP4A 3O0FA 3NQ7A 3BURA 1B1YA 3EX3A 4QHRA 4DI8A 3TTOA 1K8CA 4P7QA 4DWSA 1UBSA 2O4QA 2OX4A 3U3HA 3S1XA 2GL5A 4HJWA 3S0CA 4AIBA 2CLEA 3L9CA 2DT2A 4JY8A 3OZYA 4US5D 1HIZA 3OG3A 3LI0A 2CERA 5C7VA 2HEJA 4YNGA 2BWGA 3BG5A 2ISSA 4XUGA 4XKYA 1RD5A 5HUOA 2B7PA 4DAIA 1PZ3A 2XSAA 2AMGA 4GIEA 3L4TA 4DUXA 1PSCA 3VI2A 2XIQA 3E0VA 3OBEA 3PZIA 2ZUVA 3D3FA 3L0KA 1V79A 4H9MA 5AHFA 1NQ6A 2YZ5A 3TLLA 4FNPA 3S2JA 1OZMA 4JQ1A 3OHMB 3PPHA 4QJ4B 6XIAA 2Q8XA 3WQCA 1EO5A 2YL5A 2ISDA 4JTFA 4BCEA 3GH5A 4UQEA 2BFGA 2GGHA 2YXGA 2E7FA 1QASA 1TA3A 4CKQA 1BYBA 4NU7A 1O66A 3S5SA 3ITOA 2YPIA 3RCYA 5D04C 3SJ3A 2WPGA 2Z1WA 4PBFA 2ZDRA 2XIMA 3C0JA 1AJZA 4JOMA 3ELFA 1W3NA 2OYLA 3QOKA 3GIYA 1E56A 1OIFA 4K8HA 5HQEA 3PTDA 3TYZA 2R24A 3GHSA 4RV3A 1QHZA 4NX5A 1W1YA 1YHTA 2ZVRA 1QVBA 1T40A 4HMNA 3AFBA 1S2UA 3CYVA 1KFJA 4BHYA 3GVWA 2VL4A 4IH3A 2QNEA 3LXAA 3M9YA 3RMJA 4PMVA 4JKMA 3HURA 2GSEA 2EPKX 3BAYA 1B4EA 1V93A 4YN5A 4F0MA 2HROA 1SZFA 4RE3A 1YNQA 1FXPA 4WDTA 3WLPA 2WNWA 2CFFA 3JZUA 4QLJA 2NSOA 1Z42A 3AAMA 1LWJA 3K8LA 1NWSA 2PP3A 2P88A 3ARWA 2CZEA 2OZTA 3SCNA 5FESA 3C3UA 1TIMA 1FWRA 1JULA 1LM1A 3CIWA 1EX1A 3AMCA 3UJEA 4L9ZA 1E6NA 4JFWA 3MP3A 1H0GA 2DGAA 4DJDD 1PCWA 4YS1A 1KFBA 3I3EA 2QZRA 4Q4QA 4OE7A 3I3DA 4Z2GA 2QCGA 3OGRA 2D69A 4U5IA 1JCLA 1NTHA 1SFJA 4MNKA 3E74A 5CJ5A 2FB3A 1EGVA 3UXAA 1VFHA 3VD3A 2JBMA 1F07A 4HKPA 3IUHA 4WDXA 3MCOA 3SECA 4WCJA 4G1NA 3W1NA 6CGTA 3RAOA 1BKHA 3EOEA 4E8GA 2NV2A 3W76A 3W71A 3KOFA 1QFEA 4XG1A 3OEXA 4TX6A 3VNZA 1UWIA 3MS8A 4JYFA 4JIEA 2YA0A 2D22A 4XBKA 3DESA 1P0BA 2EEXA 1W9XA 3PZMA 3BJTA 1Y8BA 1PCKA 3H2FA 4UTJA 4PUMA 1ODUA 2QCNA 3VCNA 2ZKMX 1E0WA 3GUWA 1ZS2A 4HHPA 5DANA 3PJTA 3IJ8A 1XRTA 4TX9A 5CGMA 3SZ8A 2P8CA 4EACA 2QT3A 1BAGA 1BLIA 2BNJA 2PA6A 2PFHA 1R7OA 2BY3A 4ZQPA 4OOZA 2CLKA 4D71A 1QI5A 3FEMA 3LHVA 4GZEA 5L9FA 5I3GA 2HNHA 1E55A 1DJQA 2R1PA 1T7LA 4AZ5A 3AALA 3M5XA 4YTRA 3U2OA 3WMBA 3EA2A 1A5CA 4B2DA 2GVYA 5I3KA 2DZPA 4IG2A 5FD0A 5I3IA 2D1ZA 3DYMA 4QJ5B 4DB7A 2TMDA 3V36A 4PMQA 3WF2A 1N55A 4UTTA 3CQKA 1XUUA 3TTEA 1AFSA 4R88A 4AY8A 1FHUA 1OWQA 4OBRA 4Q8TA 2FIQA 2NT1A 2PCEA 2BZNA 5AC4A 1KM1A 2ZE3A 2GJXA 1V7YA 1UA7A 1K7FA 4PBEA 2Z0IA 5C54A 2VO5A 2GYIA 4E4PA 4JL1A 2D0GA 2EF9A 3GTHA 4J40A 5I23A 3GG8A 2VZVA 2VNCA 1E0UA 4XD3A 2NXGA 4UQAA 3ZWTA 4HMCA 4IFOA 4TOQA 4LAUA 2X1UA 3DFPA 2CLLA 5I07A 1J0ZA 5AZ0A 2CXEA 4B5TA 1LOQA 4U5KA 4TR9A 3W75A 3MU7A 2CETA 3KBVA 3QKZA 4M6VA 1JPIA 1IGSA 4KERA 1GPFA 4B3ZA 1H61A 1KXQA 2X0YA 3FXYA 4PCPA 2VEGA 1RVKA 2XU2A 1ZENA 1MXGA 4ADUA 2A1YA 1LQ2A 3MWAA 3R7MA 1TWWA 5F2GA 3VKDA 4H9VA 4MWAD 2OO0A 2C15A 2D2OA 4CN1A 5D37A 8XIAA 1LTDA 4AEOA 4GZJA 5DFAA 4GLEA 4J27A 1TREA 2OYMA 1PVNA 1GUVA 2WC3A 3S47A 4OECA 4JTUA 4IIDA 5I06A 1JFHA 1EYEA 1IF2A 4O8RA 1ONEA 2JKEA 2DZBA 5IDIA 1KR1A 1M65A 1VAHA 5AFDA 3DYPA 1GOKA 3W74A 2PDYA 4MY1A 4Q8PA 4K2SA 4Q4PA 3LGDA 2WMIA 3MI3A 2W4XA 4IJBA 4AIUA 3VD9A 3MUAA 3GZ3A 1J96A 3MKCA 4DO6A 4TVCA 1TPDA 4AWSA 3VX0A 2ZFAA 2Y2WA 3FV9A 2HS8A 2YCKX 4IQJA 2XM1A 1CGUA 4NUWA 1EDQA 1V0NA 4FNSA 1UWQA 2RAGA 3H4GA 1BXCA 3GC4A 3Q94A 4K36A 1K8YA 1GT8A 1EP1A 2YCLB 5FJOA 4BQ3A 4BWLC 3TYUA 4QQ3A 3N34A 3WD1A 3QJAA 4AWEA 2A3LA 1KR0A 3POHA 1XIIA 1Q65A 3N3TA 3W1QA 5ENLA 3A24A 5AHIA 2RDWA 3VU2A 4JTRA 4NG3A 1FCVA 2NX3A 4IMEA 2DEPA 3M1ZA 1KCKA 3VNKA 4ZMGA 2DZSA 5CXPA 1OX6A 4PTWA 1CB7B 3WLHA 2FQIA 1RA5A 1W6TA 1I0DA 4GNJA 3PFMA 3B0XA 2BY2A 5DEZA 4GH3A 4MWAC 2HPMA 1B3YA 2FMNA 1ZU8A 4XZ9A 4MMWA 4LFYA 3TW7A 3FYYA 2W0UA 3UWQA 4ZQMA 3BE7A 4GKLA 2CZDA 3SO7A 3K1GA 3SUUA 3W7RA 3QV8A 5M3WA 1Z48A 3K30A 1IWPA 3P67A 5BXPA 2Z24A 1Z44A 2QCLA 3BQ6A 1F3EA 3CQHA 3SEPA 3BL3A 5EKYA 2Z1SA 4GNVA 4XSMA 5IRPA 5HOSA 5CG7A 2QUVA 4PB4A 4EOUA 2XVLA 3H23A 4M82A 3BJSA 4UMBA 2CEQA 2OVLA 4J3WA 5MHBA 1IEVA 3GD6A 1XC6A 1JNDA 3MPGA 3N1AA 3KRBA 1BWKA 4B90A 4IP7A 1MUWA 2WMIB 3W53A 2QJIA 4MLRA 2QQ6A 1CLKA 4FNQA 4IPNB 1VBUA 3LV5A 2WBGA 4JTHA 4KFOA 3W86A 5A6KA 1SFSA 2VC6A 2EHHA 4BF5A 1X6UA 1W17A 2IPJA 3RN6A 3EKLA 2YOCA 2EKCA 3PWIA 3U4AA 1DORA 1HL9A 3B03A 1GWJA 1P6BA 1QT1A 3BGJA 4W8LA 4MJZA 3MW7A 1D3GA 4LBSA 4L4OA 4ZFMA 4HPNA 3SRHA 1QU4A 4IL2A 2CZ5A 3NQCA 4UTFA 1US3A 1QR7A 1OGBA 5MKGB 3LGGA 1KM3A 1B9BA 4FAMA 4PMUA 1GGOA 2TODA 2Q3OA 1DXIA 4AIOA 1OZQA 1DWAM 2ZX8A 1LWIA 4HNNA 2MANA 4GJJA 4QXIA 2B7NA 3G2GA 3WFZA 4UNIA 2ODOA 1VFLA 3QPEA 4UOZA 3SURA 4Y9PA 3L66A 3TUUA 1BVZA 1PDYA 5I79A 3BO9A 3C86A 1FQ0A 1W1IE 5KETA 4O54A 4AD4A 4DBEA 4PFMA 2JE8A 3CASA 1XGEA 4B5NA 2VX5A 3APYA 1SFTA 4LALA 1U22A 2F61A 3GE7A 1SMAA 1YBQA 3QFEA 4JYDA 1FWAC 3A3WA 1EP3A 5IM51 4K37A 4UTTC 3DFSA 5HWJA 1QNQA 1I1XA 4ML4A 3JS3A 2VEPA 3KM8A 1EC8A 6ALDA 3SAZA 1SW3A 3LSBA 3M64A 3UR5A 3IRDA 3A21A 5K2ZA 3W82A 2DH3A 2I7GA 3A9IA 3EPMA 1XINA 3KS6A 4DJDC 1UWRA 3V35A 3VINA 3DOPA 5CPOA 2WQDA 3STFA 4J3XA 2ON3A 1XWYA 4K7VA 2RJHA 3UY7A 4O1BA 1LQAA 4X2PA 4XD5A 2BXZA 4FOUA 1QW8A 1WP6A 5GJMA 5TD4A 1BG9A 1T8QA 1PO9A 3FSUA 1XDMA 1YDNA 1VCVA 3KBMA 1XP3A 1DJWA 1E40A 3AYRA 3GLCA 3U2ZA 2QLYA 1B57A 5AYYA 3FJ4A 1F6KA 2ANUA 4GD0A 2ZZ2A 4GQBA 3S6DA 1H51A 1JYWA 2YYUA 2VX6A 5JBFA 1CGVA 1JUEA 2ZUNA 2PWFA 2PWEA 1WAUA 1G7VA 4W7VA 2C1GA 1GOXA 1G01A 1A0EA 2YFNA 5I2UA 3EMZA 4MG4A 1TQXA 3T0AA 4C6BA 4V33A 5IXEA 4S2BA 1IZKA 4X9YA 3UZ5A 4BQ4A 1V0KA 1XLKA 2PDFA 3A5FA 3B0YA 3VMNA 1MWOA 4QDPA 1R5YA 1S2VA 1PXGA 4PRRA 6PTDA 3MKKA 2Z2BA 2E6AA 2B7OA 4H04A 4GQQA 5CEWA 3VDHA 1GVOA 1ONXA 1NU5A 3WLRA 5BXRA 3U5YA 1SJCA 1JNEA 4WIWA 3VNJA 1CIUA 1KGUA 3CZLA 3VOJA 1ESWA 1HW6A 5IFTA 3R25A 1NP0A 1X38A 4PA8A 4YCOA 4D1IA 1N7KA 2VCCA 3WQ6A 5AC6A 3S1VA 1H50A 4JX5A 2VEFA 2QGYA 4LUJA 3QQ1A 5EU9A 3NO3A 3T0BA 5FL1A 1XSKA 1W5PA 5F2MA 1AW5A 3WJXA 1QWGA 3ZT6A 5FJPA 4UBPC 1G4PA 1SR0A 1OD8A 3A4WA 1FP8A 1XIHA 4CD4A 5LNSA 4CD8A 2BV9A 1QPRA 4HB7A 3R79A 5KZMA 5HANA 1S3TC 1UOZA 4LAZA 2WVVB 3I6EA 3APGA 4G2DA 4JBRA 2INZA 1EL3A 4XSLA 3B9AA 3GFXA 1KGWA 2IKJA 3SN1A 3M7WA 1LF1A 3QV7A 1VHCA 2FGBA 1BG4A 4IGMA 3TXZA 2I1OA 4HNOA 4WDWA 2PWGA 2QGHA 1DWGM 4ERIA 3FKKA 3DERA 1VP5A 1S1RA 2A79A 4O52A 1JI1A 2XSXA 4RNJA 3KBSA 3S3GA 3TJIA 8A3HA 2C13A 1ZL1A 3QN3A 4GCAA 3OPSA 1RLCL 4W4QA 3GR7A 1KM6A 2ADAA 2UY5A 2YDQA 1X7IA 1Q45A 3WQGA 3HG2A 5JIPA 5LGZA 2RDUA 4Y90A 1XLIA 4QSFA 3N13A 3DHDA 4N0RA 4HU3A 5I24A 2WJZA 3B8WA 3SIZA 3CGTA 3VKKA 1Q7MA 3C6CA 2WKLA 3A3XA 2HK0A 3E1F1 1IIGA 4D6IA 1L6GA 4B91A 1OY0A 5DCBA 2VDIA 1H1YA 4GY7A 4N02A 1G4EA 3O3RA 3DC8A 5K9XA 3NAVA 2J62A 4XQ6A 4HOXA 4C5YA 1TZZA 5DCEA 2X30A 3C2YA 4HNVA 3EDEA 1AW2A 2QS8A 4AZ7A 1PIFA 2CZFA 2BOEX 3T78A 3TWBA 1EDGA 3ARTA 1EIBA 3GC5A 3VPLA 1XCFA 4Z2LA 3AMGA 1PWLA 3LBCA 4ZODA 4NHVA 4MPKA 3DFOA 4UTMA 3P93A 4NI8A 1VENA 4F0KA 2PDHA 1E51A 5I7GA 5CJNA 3C0SA 4D6JA 3N12A 3KWXA 5E6YA 2XDFA 1NWUA 3V16A 3S2CA 2XZ7A 1V08A 4U10A 4H41A 1FWWA 1J11A 2IQ0A 5BWFA 2AL2A 2JGQA 3NURA 3TIMA 3W9ZA 1EQCA 4NYUA 1B3VA 4B3KA 2J24A 3BICA 2EAWA 4AYSA 3FKRA 1H09A 1J18A 4JTIA 1RA0A 1LOLA 3WK2A 4GJ1A 2BTMA 1NH6A 1K70A 4HZMA 3OBAA 1SO6A 2WQPA 3G1RA 4GYPA 3EDFA 2WSPA 5CPLA 1UR4A 1GVYA 3TDFA 4C65A 1RLDA 1J5TA 3ITLA 5I3JA 2W63A 1BPLB 4L6OA 2F84A 3CIXA 3QC0A 1CGTA 3UYCA 1LORA 3HGOA 5BOEA 1IWBA 3ABQA 1KB3A 3R89A 4CNSA 5C2CA 4S3GA 1FVPA 2PWUA 4YPJA 3VCCA 3BAWA 1JAEA 2Z26A 3HMJG 4A6GA 3O9NA 1EJTC 4FPSA 2ZUMA 1K7XA 1M7PA 1U30A 3A4XA 4XBSA 3ZO9A 3EXTA 4OTKA 3BAXA 4J4KA 1TYGA 2J9XA 4K39A 5AYXA 2OWWA 5C6MA 2DZAA 1R9YA 4RXGA 2Y5SA 2ZA3A 2PWHA 1EJWC 1CTNA 4KRUA 3JR2A 4D9PA 5AB3A 3PC0A 3GXMA 1GHRA 3NO5A 1W3HA 2YCLA 1GQKA 3ES8A 3TEVA 3M0MA 1A3HA 1YDOA 4S2CA 2CHOA 1UMLA 3T08A 4R7JA 4BJHA 1P7TB 3TNBA 3VAVA 5T9CE 1E1CB 1US2A 3PR2A 2PLKA 2VZOA 4CQDA 1X8CA 2BXYA 4O1FA 4DLMA 1HL2A 4FALA 1Y5VA 2VGBA 2I16A 4ZO9A 5CAHA 4O1CA 5JVLA 3LDVA 2J8TA 1TMQA 3FHQA 3CK5A 1RY0A 3LRKA 2AMXA 3C3NA 4AD2A 2Z2AA 2GUUA 4Q4OA 1O5QA 3NDZA 2VKZG 1R3QA 4US5A 2CLMA 3DXIA 5BU6A 4JR5A 4NIRA 2G0WA 2PD9A 1WUFA 4PEKA 4TMBA 3HPXA 1EWDA 3W7PA 4LAOA 1UZDA 3EA1A 4DM1A 3W37A 3LV6A 4GQRA 3OLIA 4GQGA 1KQZA 2CHRA 3HFTA 1XIFA 3L4WA 3W26A 3PWGA 4NVTA 2E1DA 3GNDA 5JBDA 3AIRA 1AK5A 4PEEA 3RPDA 4HHLA 1L0PA 5FL0A 4XIAA 3GIPA 2Y7DA 2E8YA 3KTSA 2TRSA 1NP2A 4C1NB 4AH7A 4N9EA 1KM2A 4W84A 4YYCA 2R1MA 3RFAA 4BI7A 4QE5A 4GUGA 3GW0A 3C2EA 1OX5A 3INPA 3URNA 1Z6KA 3HF3A 1XPYA 4QE4A 5B7YA 4NAFA 4WQ6A 3NM1A 2F6XA 5REQB 1KV8A 4UIOA 5CBIA 4D6EA 1ZSXA 1W3LA 1RPXA 4GFSA 1DHPA 4L64A 4MWAB 1VBJA 4AXNA 4XZNX 4O8AA 1SZGA 2YKKA 3BANA 1VEPA 3NNTA 1DE5A 3AS2A 3VMOA 2WHLA 2YFOA 3CUZA 1MDLA 3K13A 7ENLA 5LNVA 3TTSA 1EXBA 4WY0A 3GXTA 1VFTA 1U1JA 3VE7A 2A5HA 3VOHA 3GHUA 1E6SM 4K68A 1XPGA 1H1NA 3LMYA 2VGIA 4LGXA 2BVYA 4HTBA 4RL3A 4GVIA 3KP1A 4UB9A 2FTWA 3S1WA 7REQA 1GZGA 4A21A 3VIGA 3G1XA 4PRWA 4ES4A 4J35A 4MB3A 4TTGA 4EPBC 2Q01A 1MW2A 2GFTA 3VIFA 5G1YA 1SJAA 4NILA 2ZTJA 2VR2A 1OFEA 2VENA 2Y61A 2BODX 3OVGA 2OWCA 2A7NA 1XIEA 1M1BA 4M81A 2VCAA 1S3HA 2ABBA 2OQHA 3AIQA 1ZJAA 4UMAA 2JQXA 1MQRA 1G5AA 1TX0A 5CBBA 4I9MA 4CQAA 3TZNA 4DUVA 3CLWA 3IIZA 1PDZA 2FVKA 2GGEA 4NZCA 3BOFA 1Q85A 3WN6A 4IPIA 1WE5A 2VOMA 4D6GA 5C9XA 2C1IA 3QY8A 5DQPA 4YJ5A 4EK7A 1A3WA 2MUCA 3H21A 1DJYA 4W87A 2GVGA 5G4EA 4FLSA 2YBUA 1HXJA 3P0XA 3ITVA 1PTDA 3W6MA 4CEXC 1KLZA 4AB4A 2V5DA 1TJ1A 3BJFA 1GVSA 1GOIA 2BGNE 3VUPA 3B05A 5ABHA 5E0CA 4QCFA 2O7QA 1XYCA 1PUDA 1ITCA 3DI0A 4B4FA 4ZQOA 1QOQA 3MP5A 4IOTA 3SCQA 4ADTA 1NM9A 3HTWA 3MHGA 2POTA 1QNOA 3LA4A 3PB0A 3QGVA 4IPJA 1YQ2A 2F9RA 3GNNA 1HTIA 4FR6A 1UCWA 1KFKA 3HJEA 3F4WA 4DWSC 3M6DA 4WJEA 2QR6A 5FKYA 4AZCA 2AAAA 4F2TA 4OBTA 3PUEA 2D20A 3VZYA 4HBKA 3M07A 3I4EA 4ZO6A 1V02A 4B5XA 3MY9A 4H9TA 1VJSA 2BVWA 1Z3NA 1KNWA 3WDHA 3GNOA 4ORIA 4GE8A 3AICA 3D3AA 3WLTA 3ZZ1A 4H7CA 2X1SA 3N73A 5JH1A 1DQXA 1PL9A 4GZIA 3QC3A 3KL0A 1I4NA 1RJRA 1XGZA 2PRMA 3VMPA 3N14A 1FWFC 2VFIA 5EA9A 4QNEA 4GA8A 3UVIA 5TNVA 2R82A 3GVGA 2OT1A 5H2ZA 2ZQ0A 4A05A 4IUOA 3MP4A 3AROA 3CM4A 3TWAA 3H2EA 3HN3A 1CXHA 3W7EA 1EGZA 3MT1A 1M3UA 1VJZA 2E1WA 2GSJA 7XIMA 4L4PA 4DYKA 1IT7A 4M51A 2WVVA 1NVMA 4R3UA 4DBWA 1HL8A 3HPAA 1TPVA 3N19B 1EA9C 1LYXA 4GABA 4M56A 4AZBA 1YPIA 3QM3A 3WUFA 7CGTA 2X05A 5BRQA 5JQ9A 1TJPA 3GDRA 4LF1A 4GC3A 3MUXA 5EB8A 3O6DA 5AOUA 4D6CA 3GTFA 4Q8OA 3U5UA 2VUYA 1L6SA 2J7GA 4JDBA 1RALA 3CBWA 4MY9A 1JXJA 4Q7BA 1XJBA 2Z00A 3B8UA 2R6OA 1VFOA 1W56A 3T05A 4KFPA 4GBUA 2HBVA 2A3AA 3CL8A 3ZM8A 3IIVA 3M0VA 1O6IA 3ZJKA 4BQ5A 2EG8A 5FACA 5CZSA 2E6YA 4LT9A 3MWCA 3IRSA 4LX4A 3UERA 4XK2A 3T1GA 3P74A 4WKHA 1E1FA 5A6MA 3AMKA 1UR9A 5K9CA 1XDJA 1E0XA 1Z69A 3HV8A 5LNRA 5I03A 4C6LA 3WNKA 1IEIA 3GX9A 4HIBA 4WGHA 3WD3A 1HO1A 1QNPA 2XH4A 3OOQA 3V5CA 4YTSA 3CZEA 3LERA 1F9CA 1E15A 4FXFA 4K1GA 3F4DA 4Y8FA 3UXDA 1E5NA 2O9RA 2HVNA 3E2QA 4M6QA 3CUXA 2CW6A 1LQ0A 4LOCA 5I3DA 3IJDA 1JPHA 5AECA 1TWZA 1W1A1 4MB1A 4Z2IA 5ECUA 2Y6ZA 4C7GA 2V9DA 5FJRA 1RJPA 3HIJA 5E6ZA 3L68A 3TU9A 1ZBWA 1TV5A 1VKFA 2VR4A 1C29A 2IXUA 2QCEA 4UCGA 5CC6A 4WKFA 4UWMA 1LZOA 3BLPX 4JKLA 3PG9A 4Z2KA 1NFGA 1GW9A 4GY1A 2AL2B 1PV8A 3UP8A 4TV6A 4GX9A 1XKJA 4JTLA 3CV2A 1N8IA 3OHIA 1SZRA 2AOSA 3WQWA 3KWSA 3JZEA 2DJXA 4AEFA 3DFHA 1Q6CA 1GTHA 4A3YA 2XTKA 3H26A 3S5NA 3PNZA 4JIQA 3LBOA 4LYKA 3V1PA 1QO5A 3GK0A 2NZLA 5A6SA 1OFAA 3UG5A 1RP9A 2QJGA 5C5YA 3LK6A 1Q6FA 3RR1A 3G3MA 3VKAA 2BY1A 3H7VA 5U4NA 3NXFA 4Q6XA 2BOGX 1JPMA 3CV7A 2PRHA 2Q09A 4ZTXA 3HGRA 3SCWA 3WEMA 2I17A 1VGAA 2WNQA 4S23A 4M19A 4QR6A 3ZLHA 4PGLA 1WDQA 4GK8A 4LUSB 3R5EA 6REQB 5AVNA 3OVRA 4JX4A 4PMRA 3DIPA 2PDUA 4CNOA 4V27A 4QAIA 3AHVA 6TAAA 3VIPA 3C4UA 4JFVA 2BB0A 1GQIA 2RDTA 4I9JA 4YVVA 3BARA 2IKIA 4O1DA 3SQMA 1E4LA 2YLLA 3PUGA 1E5JA 1SR9A 4J3SA 1HT6A 5C71A 1MNZA 3HG4A 1UMYA 1JQXA 2GJXB 4B5WA 1P6WA 4JTCA 1E6PA 4LUIA 3WEZA 3R0UA 5AVHA 4CQ9A 3TP4A 1AZ1A 3L0GA 2OR2A 1HGWA 4GX8A 2W92A 1GKRA 1XHGA 5L6UA 3MSDA 1Q3NA 3WLKX 2AKZA 3AZSA 1F4AA 4WOQA 1RSCA 3B9OA 3FJ6A 3NQFA 4XKMA 1ENUA 2UZ9A 1MO0A 1WDWA 1YBQB 3T8QA 3T81A 1J10A 3CB3A 3WKZA 3AYSA 3E02A 2Y88A 4FO4A 1U2YA 3W2UA 2PC4A 2PTWA 1XLLA 3FW6A 1NOWA 3FOKA 3MVTA 4H4IA 3SFKA 4C7DA 5D02A 4XIMA 5K9DA 3LTSA 5HMEA 3MZNA 4PMNA 2PDBA 3ERPA 5EMYA 3ARXA 3TOPA 4CU8A 1GKQA 3REQA 2PF8A 2WSQA 2DT0A 3VNLA 4LRSA 3W7CA 2DV0A 1P48A 2ZZ3A 5D33A 3O07A 4RUBA 3DN5A 5D9MA 1UUQA 1JDDA 2PWDA 3SM0A 2E3ZA 2QYGA 3AJXA 4S38A 4O1AA 5JUVA 4P8UA 3HZ3A 3NYZA 3LG3A 3RUBL 5LIKX 3VGBA 3EPOA 2V82A 4DUOA 2DW6A 4J2MA 1UD5A 1UB3A 2XZ9A 3MKVA 4UTIA 1O60A 1F05A 3EZ4A 4JL2A 3T2PA 3BLDA 3SY1A 4UTUA 1OJXA 1A5SA 3ITTA 1E4IA 1VCFA 1M41A 3AU2A 1CDGA 3PNUA 3WNMA 4BKNA 1FTXA 3HO8A 1JGMA 3M7SA 1WKDA 3HPZA 2ZTKA 1TUXA 1UG6A 1DIKA 1X6NA 4LF2A 1GKPA 1X97A 3SRKA 2Z4GA 5ABTA 1LUCB 3JRKA 2BGSA 4BZYA 3F2DA 3UPMA 5TAOA 5BYWA 5I0DA 4M24A 5G2HA 3V0TA 3WLIA 2J9ZA 2QJNA 3UGVA 4O17A 2GK1B 3HMCA 1XLCA 2QUNA 1NEYA 1K02A 4ZXOA 2V68A 4BF9A 1F74A 1IEQA 1XUZA 4RW3A 4C6DA 4XAZA 3AXMA 3I6TA 5FJUA 3GTNA 4AMCA 1M7JA 5F2IA 1JL8A 1EKOA 2OLAA 4LVAA 4M3PA 4ZENA 1OK6A 1W3JA 3DEQA 4JX6A 4F0HA 2EO7A 3TYAA 4S3FA 2VWSA 1DXFA 3UR7A 4GINA 4JIPA 3P8IA 3LHYA 4L9YA 3VC5A 1XLJA 3CT2A 3TW9A 1H3GA 3KVLA 3LLXA 4AZIA 4LEFA 2GVEA 2IQTA 4XZLX 3GDBA 3REQB 1QAPA 4QDWA 5EPDA 1RQHA 3KDNA 4QROA 1SW7A 4GKTA 3MI6A 3QTPA 3RDKA 9XIAA 3MMTA 1XCXA 3ZT5A 3TR2A 5ABGA 1TV4A 2XH2A 3NVTA 3PUOA 4I7UA 2EGZA 1XLGA 1WYIA 1NELA 1M9HA 2HK1A 3ES7A 3BSMA 3GVQA 2B0MA 3VVGA 4W7WA 1KBKA 1RP8A 4HPHA 1CXFA 3GZAA 3R43A 1P5BA 1FH9A 3CT7A 2HXUA 3D0CA 2J13A 5FEWA 3UCDA 4WZHA 3CUJA 1PIGA 4UXDA 3CQ0A 1BTCA 4L80A 1WBHA 1DL3A 3OIXA 1RK6A 2H6RA 1C7TA 5A5WA 1OC6A 4A8LA 3IVUA 1HJWA 5HJXA 3IWPA 3S5YA 3STGA 4FOJA 2J79A 1W9UA 3GTXA 1UP0A 2WNZA 3F5JA 1GYLA 1A5NC 4A2SA 2WZTA 5I6SA 1AH4A 4HSOA 3RO8A 3THAA 5IFPA 3STPA 2YL8A 3PB2A 5BCAA 2WJEA 3NM3A 1VYRA 1JCTA 3ZJ6A 3UWVA 1O5RA 3TC6A 3FEQA 1LBFA 3Q4DA 4FX8A 2OEMA 5A6BD 2WJDA 4QJ1A 2F38A 2WMHA 3SQSA 5CBJA 4GUJA 2OLHA 2IPWA 3TROA 2GK1A 3QR1A 3NWRA 3MUY1 2WZEA 1KBBA 2GUBA 1I6NA 3OVPA 4MHBA 4HZ6A 4LQ1A 1BEUA 4NY2A 5ECVA 3TQKA 1QHPA 1QPOA 5D8ZA 1MQQA 3W01A 2OQLA 1WDPA 2C1HA 1LDCA 1S5VA 2QUMA 1D8WA 4GXPA 4DJDA 4C6JA 1AZ2A 3DH7A 1RHCA 3KRZA 1MDRA 1ZUAX 1YPFA 1HFBA 3S2LA 4DELA 2OEKA 1F61A 2FVMA 1B3WA 4G7EA 3QHNA 1P6CA 4RNFA 3E0LA 4DVOA 5HXMA 2WCSA 5T8GA 3CIVA 1XQKA 3T4CA 4FIQA 3C2FA 1OGGA 4HNUA 2IS7A 1DJIA 1BFNA 4HJFA 1W3KA 4FZIA 2PGFA 3URBA 2FZ9A 5A6AA 3P61A 2BG5A 5D8WA 3JUGA 5CC7A 2CESA 1ZGDA 3UWWA 1HJSA 4MGGA 3QTGA 3G1YA 3O6YX 2VELA 5EMUA 3UCQA 1RAKA 3MMDA 3LNPA 5HNRA 4LUTB 4ACYA 3SGUA 1JQVA 5B7ZA 2CLOA 3QGAC 1SVDA 5CPTA 1YTKA 3I65A 4L7ZA 2HDJA 4EP8C 3WENA 2ZOXA 4DN1A 3CWOX 1PHWA 1RCXB 3E0IA 2V5LA 3LBMA 4MADA 2X2YA 5IHSA 3UVAA 5DXYA 4DZ5A 3W24A 1YTEA 1OBAA 1NOFA 1ISVA 1NAL1 2DSVA 4GI8A 2X7VA 4P7OA 4H83A 5CGQA 5E9AA 3WNNA 2ZBTA 3PBVA 1J93A 2WCAA 3OW1A 1KD0A 4P8XA 4AVOA 3I3BA 1QWKA 4CCDA 2YW3A 4DF0A 5DLCA 4XO6A 4ASTA 3EA3A 3WLQA 3NO1A 2QDGA 3TA6A 3ITGA 3TCSA 3B8VA 2R1LA 4UTWC 1VIZA 3MUCA 2AQVA 2PDCA 1ICQA 3QSRA 3MZ2A 2PE4A 3LQGA 1E9ZB 3CAVA 4GMEA 1AQFA 1TR9A 1ZLPA 1C93A 2WZHA 3UEQA 4AEEA 3UJSA 4LVFA 3KLKA 3KP0A 4PYSA 4WGXA 5C9RA 1EJVC 4OUIA 4LPCA 4UQCA 3KRUA 2DT3A 3QZ6A 1W8SA 4NNAA 3W7LA 2ZXQA 1E72M 1DJXA 1L8PA 1EJ7L 1TV2A 4PCFA 3QQWA 3AS1A 3QV6A 4UFMA 2XVKA 2A3HA 1IR1A 1JEZA 5A8NA 1W5NA 1I8JA 3TN4A 4QFUA 2AQOA 3WH9A 3U0HA 1MZHA 1NWTA 1GONA 4QE1A 1XXXA 3CAKA 3OG2A 1WBJA 1EYWA 1B5TA 3KOYA 2YBVA 1HKKA 3O6CA 2VI0A 4WDUA 2BSLA 3ZJ7A 2VJXA 5A6BA 3IK2A 3BWWA 5DELA 1UR0A 2E25A 3LTPA 1IWAA 2C0AA 1QPQA 2CC0A 2IKGA 1EF3A 4IJCA 4HN4A 4WHBA 4ZOAA 2I9EA 1ML1A 2ALRA 4ZQRA 1FFRA 3IANA 1J9YA 4DQWA 4FXRA 5D9PA 1Y7VA 3H2OA 3WUGA 2WV8A 4MDPA 2YDAA 3BDKA 3NOEA 2J77A 3CMGA 2WLZA 1OFRA 1DV7A 3VGFA 1W54A 4JTAA 2FPTA 1KBIA 2V67A 3GDKA 3P6LA 1CZ1A 1O95A 4GBDA 3PZUA 3KOWA 1X39A 2V8ZA 2E8ZA 1CGYA 3K8MA 3C8NA 1E3ZA 3LCXA 3UG8A 1JDFA 4AD3A 2DUZA 1RQBA 1PB0A 4UNKA 3E96A 4G6CA 4D2JA 1AG1O 4H8HA 4MTVA 2VOTA 1Z32X 1EBGA 1M7XA 4ZB0A 5DX7A 3ARVA 1MUCA 3FK4A 1VBHA 2HV5A 4PTDA 1KFCA 3N6QA 2V69A 3VGGA 3WDQA 4KF1A 3FHAA 1P0KA 1L2QA 3CUGA 3WBEA 4V28A 1TTJA 4OV9A 2XG9A 4HOWA 1REQA 2WW5A 2FTPA 1IT0A 1UYQA 5LZLA 1IQ8A 4UOJA 4V1XA 2NVCA 1FBAA 4NXSA 1DE6A 1KM0A 2SFPA 4A3RA 3RHGA 2PDIA 5CZ0A 3M5VA 1OCNA 1F8MA 2PTXA 3ARRA 2BHYA 4S3KA 2D2HA 3MA8A 4LC6A 1UUOA 4MJ4A 3QRHA 3O15A 1Q6DA 2VXNA 4MB5A 3WNLA 4DXVA 4Z2HA 1H63A 1UH4A 3TTYA 1XLFA 4QDMA 3PTMA 3KVJA 2GDQA 2FTYA 2DZTA 5H8UA 2W27A 3AI0A 3LMZA 1XGDA 3RPMA 1K77A 2Y7GA 3PWAA 1YW1A 1CT5A 4AVNA 2UWFA 5KEZA 5EMLA 3DG3A 4NZJA 1WPCA 1J6PA 2VVNA 1WOAA 1DWIM 2NLIA 4FOKA 3N2CA 3B06A 5D03A 8RUCA 1K4GA 2YL9A 2OPJA 3HBLA 3AJ7A 3G0UA 3TMQA 1Q6QA 2OKOA 1CXIA 4WVXA 3QFWA 1XBXA 1MFVA 2I9UA 3W1LA 3VCRA 2A85A 4GACA 3GNPA 2IMRA 1AD1A 3MMWA 4RX0A 2WKJA 4PB3A 3RCMA 1C90A 1FWHC 3AS0A 3ZQ9A 1YIXA 3O63A 4MKVA 3FDKA 4G7FA 2GQAA 2WC4A 2ZXBA 1B31A 3TFXA 1HJXA 1UH3A 4PMXA 2Y63A 1YADA 4DPPA 4I9AA 3S5ZA 3QZAA 1EZ2A 1FXQA 2W9MA 2GJNA 4RNIA 4Q8WA 3AIVA 1EWEA 2PDXA 4X60A 4MAVA 1ISWA 2WHKA 2DU2A 1SGJA 3ECQA 3G0XA 1KFEA 3LS9A 2AKMA 2G95A 1UR1A 2XIBA 3II1A 3CUIA 1J01A 1KM5A 1IR2A 4E2DA 3I4KA 3GVVA 4FX6M 4IWWA 4YVPA 3LLFA 4JEQA 1OT2A 4LB3A 1SJDA 1FCUA 1GVFA 4W9TA 2D3NA 1PEZA 3W85A 3CMJA 1A5BA 2CITA 3BGGA 1TJ0A 1VRDA 1UD3A 3I7RA 4HT3A 1EOKA 5DMYA 4XTDA 2OT0A 3W0KA 4EWND 3PZQA 4EPDC 4R7WA 1KRCC 4K7YA 4F79A 3MC5A 3WJYA 1S2AA 5IOBA 1X96A 1GZ1A 5I77A 3HV9A 4PTNA 1HN1A 1ISZA 1BF2A 4IHCA 3FA5A 4FF5A 1J5SA 1NJJA 4ACZA 3QF0A 5LXEA 1B3ZA 3N4EA 3C56A 4Q32A 3F1QA 1SUXA 1XBZA 3CAWA 3W1UA 3EGJA 4B92A 3MYOA 3DU0A 1GQJA 4IPPA 1TQJA 2ASHA 2QIWA 2PSNA 3MJMA 2XIOA 4PUUA 2XYLA 3WD4A 4NI3A 3E6EA 2ZUTA 3P0WA 1TRDA 3CWNA 4NNCA 1ECQA 1T41A 1XYFA 4AZGA 4UR9A 3CPRA 3G1DA 2OZ3A 3BH4A 2WXDM 1ZBKA 4AF0A 2DORA 3IIPA 4V2XA 2QAFA 2GQ8A 1O5XA 2WK2A 3WF4A 4BEUA 1GVEA 3OVQA 2FFIA 4O1EA 1GOMA 4JKKA 3CL6A 4AISA 1JD9A 3BCFA 3L4VA 3UXIA 1VBRA 1V6WA 3BMVA 3M0HA 5U7SA 4KCVA 5BW6A 2E6DA 4AX6A 3B4UA 2EJ1A 3RR4A 2CBUA 4GUHA 5T91A 2I56A 3NIYA 3W81A 1QK0A 1F6PA 4NT0A 4Q7NA 3VABA 1UR3M 4C6FA 4H9ZA 4KESA 1G9HA 4NZFA 2A2IA 3GXDA 1XD1A 5CG0A 4WXYA 3N2XA 1A50A 3VFCA 4CEUC 4UTLA 9CGTA 1AJ0A 4CD5A 1MFUA 4HZ8A 2CLFA 4DZAA 4C60A 1NDZA 1CGWA 3GH4A 2OCZA 1TWSA 4UR7A 2VUNA 4CD6A 2C0HA 1P0DA 1LOSA 5LSMA 3OZMA 1DKWA 2TPSA 2J8FA 2J47A 2OODA 4ZE4A 4DF2A 1W1TA 2EKGA 5T9BG 3F5LA 2G3FA 5D05A 2WWCA 4LNCA 3SCOA 2HRWA 1UJQA 3EB2A 5AN7A 3BMXA 2JEPA 2VFEA 1IV8A 3W7QA 1ZNNA 2RKXA 2BASA 3VIKA 1IE7C 1FKXA 2Y7EA 3LXBA 5FI8A 3EMCA 3N3MA 2FZMA 2VTFA 1FDZA 1JPDX 2KZHA 3CH0A 3IAPA 1RY8A 4MZ1A 4OIFA 1J12A 1Q6RA 2Q71A 2PP0A 2XH0A 1Q2SA 3NUKA 2Z6IA 1K9EA 4PTVA 3WIJA 3VGEA 1B3OA 3FAWA 3GUGA 1JCXA 3N2MA 3WQVA 3UD6A 2VR5A 4X63A 4KIRA 2A3CA 4W86A 1FWDC 1FP9A 5TQLA 1QCWA 3DFNA 3C2OA 4ONVA 3DCPA 3BV4A 3W02A 1MMFA 3R0KA 5D2TA 4FHAA 4D6DA 1YXCA