1GVFA

Structure of tagatose-1,6-bisphosphate aldolase
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
284
structure length
273
Chain Sequence
b'SIISTKYLLQDAQANGYAVPAFNIHNAETIQAILEVCSEMRSPVILAGTPGTFKHIALEEIYALCSAYSTTYNMPLALHLDHHESLDDIRRKVHAGVRSAMIDGSHFPFAENVKLVKSVVDFCHSQDCSVEAELGRLGSAFLTDPQEAKRFVELTGVDSLAVAIGTAHGLYSKTPKIDFQRLAEIREVVDVPLVLHGASDVPDEFVRRTIELGVTKVNVATELKIAFAGAVKAWFAENPQGNDPRYYMRVGMDAMKEVVRNKINVCGSANRIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAGATOSE-BISPHOSPHATE ALDOLASE AGAY
publication title Structure of Tagatose-1,6-Bisphosphate Aldolase; Insight Into Chiral Discrimination, Mechanism and Specificity of Class II Aldolases
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 105
structure length 273
sequence length 284
chains with identical sequence B
ec nomenclature ec 4.1.2.40: Tagatose-bisphosphate aldolase.
pdb deposition date 2002-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01116 F_bP_aldolase Fructose-bisphosphate aldolase class-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1gvfA00
2DZPA 1MXSA 3LHVA 3W7GA 8TIMA 4UTKA 1P0KA 1FUYA 1ML1A 1TTJA 2FDSA 4HSOA 1W56A 2B4GA 1JQXA 1MO0A 1LOSA 1TPDA 4MFEA 2CFFA 3LCWA 4RX0A 1LBFA 2DJLA 3ATYA 4RV8A 2ZRWA 2VEMA 4MZ8A 1L9WA 4HNNA 4LVAA 4MUZA 4JTEA 4QSHA 5LNRA 4K36A 4QJ1A 1GQNA 3THQA 3P80A 3KVJA 2ZFAA 4AWTA 3BO9A 5HULA 1PHQA 2FB2A 5CSRA 5D30A 3W7KA 3W23A 4DF2A 4M6VA 4CLMA 3M41A 5BOOA 4TR9A 4ICNA 3SGUA 4N6FA 3WJYA 3W2JA 3CU2A 4I9AA 4CCCA 3BVJA 2WKJA 1RQEA 4PL2A 1LZOA 4PL1A 4S2BA 4IWWA 3ABOA 4S1FA 1A53A 4BI6A 4FNPA 4BWLC 5D02A 1FWSA 3S42A 5BMXA 3R89A 2EF9A 1SO6A 1YXCA 1LRQA 4ZQPA 3NDOA 5BNKA 1DOSA 3DFSA 4K8EA 5G2WA 3B05A 5I3JA 3M5ZA 1JULA 5HUPA 3FS2A 3G8EA 4CCEA 2P0OA 4O0KA 2W6RA 3CM4A 1TREA 4GWEA 3M44A 1W31A 4HPXA 5F4SA 4AWUA 2V81A 4UTMA 5F4XA 2BZNA 3RFAA 5AYYA 3TJLA 3BW3A 4RZ5A 2Q3OA 3BLFA 4EIVA 2C13A 1DJQA 1S3HA 3SFKA 3U8GA 3LI1A 2V82A 5KINA 5AC7A 3MYPA 2VFHA 2PURA 5IBXC 5EY5A 1OX5A 2QCEA 3S1VA 1F05A 3M0ZA 2ZZ2A 1KV5A 6ALDA 3GKAA 5EYWA 2YYUA 3BV4A 2QUTA 3JS3A 1YTEA 3UD6A 1JJKA 4J9JA 3EX6A 2A6LA 3C4UA 3W2NA 3G0UA 1OG0A 1TIMA 4K7VA 2Z0IA 1GEQA 2WO5A 2DZUA 3HG5A 1KM6A 1OF8A 4YWIA 5LHFA 3F1QA 3DGRA 3LI0A 2QAPA 2ZBTA 2BXVA 5DCBA 3PSVA 5LNUA 1FWWA 1U5JA 1LP6A 3G22A 3P61A 4JR5A 3I7RA 3HPSA 1QCWA 2JBMA 2X1SA 3EWWA 3Q37A 3EWZA 2VC6A 1N55A 3PUEA 3EWBX 1EUAA 2J24A 1B9BA 3C2RA 1J4EA 1MSSA 1VH7A 1HTIA 2DZWA 1A5SA 1OFEA 4EWND 1XI3A 3W75A 1GTEA 4O12A 4RKAA 3NQVA 2JGYA 3SJ3A 4DO6A 2BSLA 1NF0A 4UR8A 4UFHA 3S5ZA 2QCHA 3WJSA 5D04C 2RDUA 1SFJA 2E6AA 3KX6A 1C9DA 2ZYFA 1LDCA 3NQ6A 2NXHA 4N9EA 2YPIA 3LV5A 1HG3A 3M5YA 1R2TA 3M43A 3QPYA 2ZZ5A 3GAYA 4JTLA 2C14A 2HMCA 2QUUA 1Q6LA 3ZS4A 1R2RA 2QAFA 1NVMA 4MLRA 3LTYA 1LCOA 1SSDA 5G2HA 1ICQA 1L6WA 3TA6A 1ADOA 4O15A 3LCLA 3LHWA 1H61A 1HO4A 2WSRA 2DZTA 4ADTA 3BK0A 3LV6A 3BG9A 4E0CA 3WJXA 1TYGA 4HNUA 5H91A 1I2QA 1QR7A 2X1RA 3W1RA 1H60A 4LUJA 1F6KA 3HGOA 2RDTA 5EMUA 2G5WA 3TXZA 1B3OA 3DI1A 2QEZA 1G4EA 4A2SA 4FX8A 2RKXA 3N2XA 4NX0A 3I6RA 1YXDA 1MEIA 1PV8A 3UPWA 4TMCA 2DU2A 3GDMA 2Y7FA 5EBUA 4ZQRA 2Y7DA 1GVRA 2H8ZA 3IIZA 3I65A 3M47A 4O0ZA 5DCEA 1P0NA 1R30A 3SSJA 3USBA 5J5RA 3S8HA 3GB6A 2V2CA 3LX9A 1ZENA 4Y96A 4FNTA 1VYPX 1TMHA 2Y63A 2V8ZA 4OGZA 4JDYA 4C1KA 3L21A 4UFLA 4L4LA 4K6AA 5H2ZA 2TRSA 2Q3RA 1SW7A 4HN4A 1WA3A 1ME7A 3MBFA 2X1TA 2YFNA 3S5NA 1FWRA 2PC4A 3NQCA 2GJLA 3P8IA 1E51A 4AAJA 4QM1A 1TPWA 1F76A 3TQ0A 3NEVA 4NNCA 2NWSA 3BG3A 5DBTA 2JKEA 1DJNA 2X2GA 3LM7A 4JX4A 5D33A 1QO2A 3ZFHA 3L5MA 3A22A 4RXFA 2F84A 2BX7A 3O15A 2VENA 4HNVA 1HO1A 5K4ZA 4NZJA 3SI9A 1M7OA 4MJZA 3KVKA 5LKYA 1OFOA 3QMSA 3PY2A 3ANYA 1HL2A 3M16A 2Q8LA 1KFLA 1ZJIA 1V7YA 1H7OA 2AQWA 1NAL1 4MJMA 3BGGA 1B4EA 2OMAA 1HUVA 3BW4A 1JCJA 2OCZA 4Y90A 3LCIA 1L2UA 4GUGA 4RK8A 1G4TA 2QDGA 4DXVA 2A2IA 1DV7A 4JTHA 4GE8A 2AAMA 1KM5A 2VEKA 1FDZA 3LXAA 2EGZA 4MY1A 3EX1A 4JTSA 2WNZA 1LROA 1SFLA 3HOJA 3PBVA 4PH6A 1QNVA 4Z0JA 3EX4A 3TFXA 1VLIA 1GPWA 3DFOA 2CLMA 3CPRA 3PBYA 3GXNA 4BFAA 4XWUA 2NX9A 4R33A 3ABRA 5CGQA 2JKAA 3UQNA 3MI2A 1TRDA 4WX2A 2E6YA 2R91A 3S9YA 3UWQA 3FJ6A 5HR6A 1TJPA 3NQAA 3IV3A 2CW6A 2QJIA 3W7RA 4O52A 2WSQA 1CX9A 3A21A 3KAOA 4E2BA 2D73A 4FXRA 4DEFA 4MZYA 3U2OA 1DBTA 3HPZA 4I7WA 1T8XA 1TPB1 2QCMA 5K2ZA 2QCDA 1TPH1 2FPYA 3QH2A 2YDAA 3KFTA 2WSYA 2ZRUA 1RZMA 3UXAA 1IXNA 3QMTA 2NX1A 5MHBA 2CLEA 3O1NA 4LVDA 4JTUA 2E6FA 1YADA 1SO5A 5G1TA 1FCUA 2B7NA 5C5YA 2A21A 4C1LA 2RH9A 3G8RA 4IUOA 4JXCA 4DELA 1GVSA 4PODA 2RFGA 3ZR4A 3EXTA 3N9SA 1W0MA 4QQ3A 1WV2A 4LVGA 1JR1A 2FIQA 3QRHA 1W1ZA 1G4PA 4TMBA 1X6UA 1L6YA 3SGZA 3SW6A 2VEPA 2DZVA 3U6WA 3DFPA 4IOTA 4RR4A 4W9TA 1R2SA 5K4XA 1LBMA 1H50A 3B04A 3GLCA 3DFQA 5CPLA 1KM4A 3PSWA 3NL3A 1BKSA 1Z42A 3NOEA 1LOQA 3N73A 4LRTA 3DH7A 3V75A 3W2KA 4L4MA 1I2RA 4UTHA 1FDJA 1WOBA 4JEQA 2F7FA 2Y85A 4Z1AA 4JGDA 3CEUA 4BI7A 3NAVA 1OYBA 3B0VC 5HNRA 3W1NA 1AMKA 3R5EA 3MWAA 4UC5A 4LOCA 3EXRA 3S6DA 5FF2A 1Z44A 3DKLA 4TIMA 3DZ1A 1EEPA 4JTFA 3W83A 1JVNA 1H1ZA 1N8FA 1FCQA 2CLHA 2ZTJA 1LRTA 1H7NA 1XM3A 3NZRA 1VQTA 4Z1BA 1L6SA 2WNNA 5AFDA 3TDFA 3B8DA 4GXMA 3DKJA 5D38A 5I3KA 3MYOA 1RD5A 4CQ9A 3GDKA 4BK9A 1QPRA 4CQ8A 2XN1A 4O17A 1H62A 1QDSA 3BARA 2ZRXA 3QEZA 1XBZA 4LTSA 5FI8A 5LNVA 4HHPA 1XBXA 3NQFA 4N9DA 2X30A 2ISSA 4MIMA 4JYEA 3O16A 4MVAA 2EHHA 4MY9A 1DQWA 3PB2A 4QNWA 1U83A 3INPA 3O63A 4N9BA 3TNOA 4DF0A 3O6DA 3UWWA 1YPIA 1FQ0A 4XBSA 3T78A 1QFEA 3WJZA 3ZWSA 4UIOA 1AW1A 1M5WA 1GWJA 3W9ZA 3C52A 3NPVA 1GYNA 4IPIA 4HNTA 2YCEA 2NXIA 1KV8A 3S5YA 5C6MA 1KFEA 1O5KA 1QWGA 4LUIA 5HR7A 2C3ZA 3FOKA 2Y7GA 3N9RA 3NO5A 5F2GA 3P62A 4O14A 2QCDB 4AF0A 1D3HA 4OWGA 4MFDA 3G3MA 5F4WA 2QF7A 3W7CA 4Z08A 3NQEA 4UTTC 3S5OA 3JR2A 4OU1A 5HWMA 1P4CA 4YXGA 3CT7A 4N2YA 2W79A 1NF7A 3O6YX 1GT8A 5AHEA 4GBUA 3JRKA 4MLJA 3KVMA 2B7OA 4O1AA 3W88A 1ZCOA 2A1YA 4HSNA 1W3IA 2E1DA 1TPC1 2Y7EA 2E77A 3YPIA 4HKPA 4KFOA 4IXHA 5CSSA 3WK1A 5LSMA 1MEWA 3NPUA 1VCFA 2J6XA 1Q3NA 4AHQA 2BTMA 5C54A 3UWUA 3GZ3A 6TIMA 2C19A 2H6RA 3TH6A 2QCGA 3OHIA 1OHLA 5AHLA 1H1YA 3NL5A 3W7HA 3UNDA 2I9EA 5AHFA 3MO7A 5SWUA 1EUNA 2ZQ0A 3GXPA 4UCGA 2R8WA 3ATZA 3L9CA 1Q6QA 4UTJA 4YCOA 4FXSA 4LW7A 1VZWA 3TV8A 1KM3A 3OEXA 1B57A 1ICPA 3W7QA 5EKYA 1UASA 1XUUA 4CNNA 3W1QA 1SZNA 1PCKA 3LCGA 1GG0A 4LC8A 5KITA 3LRKA 2TSYA 4PA8A 1DQXA 3G1HA 1SU5A 3TK7A 1X7FA 1JCLA 1KFCA 4GUHA 1JCYA 5AC8A 4QNEA 3P5ZA 1B4KA 1TTQA 4O8RA 1ZAJA 3KVLA 1EIXA 5BRBA 1WQ5A 2E6DA 1KW1A 2KZHA 3V1PA 4UTWC 3G0XA 3RU6A 3QZEA 1X8FA 1YDVA 2GOUA 3HPXA 4AWSA 2GQAA 1FDYA 3EKZA 1W8SA 1XC4A 3T44A 1UJPA 4JIQA 4NVTA 5T26A 3FYOA 3CLMA 3W7EA 4EVZA 2A5HA 4IMCA 1Z48A 3VE7A 1MEHA 5TQLA 1NSJA 4WJEA 2ZZ7A 4RZ6A 3CIXA 5K7JA 3GR8A 4BWLA 1KTNA 4XQ6A 4WY0B 3EEGA 1VJIA 5DELA 5AHNA 3VCRA 2PRMA 4XZ9A 3PUDA 4I7UA 2OT1A 1A5BA 4DO5A 3QM3A 1RPXA 3Q58A 3NQDA 2ISVA 1YLVA 2E5DA 2YZRA 3E12A 3FYPA 4Y6GA 3F4NA 5G4EA 3N19B 1K3UA 3DAQA 1GZGA 1LOLA 4ZQNA 5LNSA 1I2NA 1JCMP 1LRNA 1EWEA 1KA9F 3A5VA 3M7WA 2NV1A 1ZFJA 1AG1O 3LLDA 7TIMA 4MY8A 1VLWA 3R2GA 4AF0B 2A7RA 3FFSA 1YPFA 2LLEA 2P10A 3IEBA 2ZDRA 2J27A 5FF7A 4XTIA 4ZMGA 3L0KA 3GNNA 3HJZA 4HIBA 4AMAA 4DBEA 1F74A 1TRIA 4UUIA 1OF6A 5IBXA 3NL2A 1IF2A 3TXVA 3DHFA 5G2IA 4OHQA 1ALDA 1SO4A 2ATMA 1D9EA 5HINA 2CLIA 1QPNA 1CW2A 4N02A 3W1TA 1JRCA 4ADSA 2CLKA 1UBSA 3OBKA 1M6JA 4LY8A 3P7YA 1RV8A 2Z1BA 1J5TA 3TR2A 5E1QA 5D2XA 3W7MA 4ONVA 3W1LA 1DKWA 5DXYA 2HTMA 4O4WA 5L9FA 3B03A 3NQ8A 3VFLA 1SR9A 3HGSA 4K7YA 1LM1A 3QSRA 3RNDA 2UV8G 4RXGA 3TAKA 2G97A 3OG3A 1JQVA 1LLWA 4UFKA 1OFAA 2QDHA 1XUZA 5U4NA 1P5BA 1TSIA 2Y61A 1TCDA 5F1VA 4S2CA 3B06A 3EWYA 3W1MA 3RLVA 4MYAA 3LXBA 1A5CA 2H3BA 1KFKA 4LT9A 1WBJA 4AHOA 3LTPA 4LVFA 1XDLA 1VS1A 3W7DA 3ELFA 2YSWA 3B4UA 2C0AA 2C16A 4K39A 3OIXA 4A2RA 1A50A 2NWRA 3IIVA 5DY3A 2J88A 5AB3A 4FF7A 4UFIA 2IQTA 1F2JA 1OFDA 3NYZA 4K37A 4K38A 1ZAIA 1R47A 3Q2DA 2PRLA 2Z6JA 1AW5A 1WX0A 4CNOA 3UWVA 3P60A 3STGA 3MP5A 2FTPA 1S5TA 3TAOA 3MW7A 4MKNA 3TC7A 3NM1A 2TYSA 4YMZA 3MP4A 4AB4A 2PCQA 3HQ1A 3UXDA 3W1UA 4ZVJA 5AN7A 3RLUA 5AHMA 1IXPA 2B7PA 2E5CA 5D2WA 5A8GA 4ZQOA 1VYSX 1ICSA 1YDOA 3LHYA 3TJXA 1D3GA 3W7IA 4KWWA 3IIXA 1JCNA 2ZZ1A 2C15A 3W1PA 1NEYA 1O60A 3NPXA 5K9DA 3W2LA 5AHIA 4GNJA 3HO8A 1QO5A 3CWNA 3E0IA 5KMYA 2A6NA 3LLFA 3GXTA 2NXGA 4O28A 5CZSA 3GR7A 2OJPA 3P81A 4UTLA 2P1FA 3KHJA 5LGXA 4FHAA 4U4MA 4GC4A 1ZAHA 2VFEA 3E96A 3LERA 1TQJA 2RDWA 2YW4A 2TMDA 1G67A 5EL1A 4BI5A 3W86A 1XXXA 2NUYA 3UWYA 2W0UA 5EPDA 4JTIA 5KSWA 5FF4A 3L5LA 3QF0A 1LLZA 3QSTA 4X3ZA 3TW7A 4UNLA 3G1DA 2FLIA 4A29A 3W84A 3G3DA 5FF3A 1EP2A 3LCFA 1K8XA 4LVBA 4N4PA 2QKFA 4AVFA 1WAUA 2ZZ4A 3B0UX 4NXSA 3UY8A 2GVGA 3PB0A 4M5PA 2EAWA 3QC3A 2GQ9A 1J2WA 2YW3A 3I7SA 1EA0A 1EWDA 2HS8A 1OFBA 4UFJA 3FEMA 3H53A 5TIMA 1JCXA 4DPQA 1H7RA 3W71A 4RZ4A 2QR6A 4HT3A 4GJ1A 1F73A 3TSMA 3NM3A 1VR6A 3IGXA 4UMBA 4XTDA 4X22A 2YGYA 1O95A 3A24A 3SECA 4WY0F 3NQMA 4NT0A 3NQGA 3TKFA 2TPSA 2WNQA 5E0KA 3B0PA 2DP3A 1I45A 5C2XA 2YX0A 3FA5A 4LS0A 3CB8A 5I3FA 4H4IA 2Q8ZA 3UWZA 3HB9A 5K3VA 5CKSA 5D32A 4ZL1A 3W7OA 4MZ1A 4JICA 2NUWA 1EP1A 1RQBA 2ZZ3A 3TSDA 4O57A 1IXOA 3MUXA 3KXQA 3EKLA 4X2RA 3T40A 1SZFA 1Q6RA 5GVJA 4FIQA 1FCBA 4TO8A 3PAJA 1XCFA 1PIIA 3GX9A 3LGEA 1VPXA 3VI2A 2BWGA 1ME8A 1H7WA 4LV4A 4Q32A 3H55A 3MBDA 5F2IA 5D2YA 4N6EA 5E93A 1FBAA 3HGRA 3IVTA 1F5ZA 3PUOA 4KWVA 1LORA 1GVFA 5L6UA 4Z0SA 4JTKA 3ZWTA 3NQ7A 2ZA2A 2GVJA 1TPEA 2GPTA 3C2OA 4DF1A 2I1OA 4PCFA 3BLIA 4P61A 5DLCA 3BW2A 1FX6A 2ZA1A 4EF9A 4O18A 2QJGA 1QPOA 2G95A 2QUVA 1VHNA 3TUUA 3G1SA 4LWWA 4ML9A 1RR2A 4U28A 4FNUA 2Y70A 3K30A 2CWNA 3BG5A 2H3DA 1N7KA 1ZY9A 5HQEA 1GJPA 3W74A 1M7PA 1Y0EA 3TMLA 3LB0A 3UY7A 3IIPA 4NJGA 3C2EA 2E68A 2E09A 3O8AA 4TU1A 3C0JA 3W3OA 1SSGA 5CPOA 5D2VA 1UCWA 4O4VA 3KRZA 3C8FA 3NQ2A 4Q33A 1W3TA 4LU0A 5HJLA 2DZSA 3N3MA 3GDTA 2CLOA 4WY0A 1GTHA 1WDWA 2ABAA 3W7LA 4KFNA 3HG2A 4I7VA 4RLIA 3TCEA 1SQ7A 4OE7A 4UFMA 5AOUA 4DPPA 3VNDA 2R94A 4JYDA 3VE9A 3RF9A 4Z1DA 1O5XA 2I14A 3NGJA 5D05A 1RVGA 1TPFA 4FNSA 4G1KA 3W7PA 1KFJA 3UZJA 3PR2A 2VFFA 2YXGA 3W72A 1JUKA 1YXYA 2V2DA 2FB3A 5ABTA 2ZCGA 3C61A 4ZQCA 4A21A 3L65A 3R12A 3EXSA 1SPQA 4QIUA 2CZFA 4AEOA 3PG8A 1G4SA 1X1ZA 3PS7A 1I2PA 1PVNA 4LS1A 4JTGA 4AXKA 1PS9A 3F03K 1Z41A 3O06A 1K8YA 3DXIA 2GJNA 1BWLA 3LDVA 4WUIA 4FNQA 3L0NA 3QQ1A 4DBDA 3L67A 4AHPA 3L0GA 4MOZA 3T7VA 5LHEA 4O50A 1KTBA 4O19A 4UTUA 2CZEA 4M19A 1TJRA 4UR7A 4O11A 3TSBA 4NJHA 3BPWA 4BR1A 3W1AA 5G5IA 1ONRA 4JX5A 3SZ8A 4X9SA 1KBIA 3GAKA 4QITA 4R7JA 4Q4KA 3G1FA 4NNAA 5CPMA 5KTLA 3PVFA 3N14A 4CNPA 3FLUA 4R53A 1I2OA 3R13A 3NR0A 2ISWA 1IXQA 3T55A 3G18A 3G1AA 3HGJA 3UPBA 3DENA 3PC0A 4H3DA 3M6YA 2Z2UA 3BLEA 3PF3A 5I3IA 4R34A 3PM6A 4CQAA 4FIRA 5AYXA 3GKFA 3EWUA 3FIGA 3M5VA 3CC1A 4UTTA 3SY5A 3IGUA 1TTPA 3OVPA 4ZQMA 3OVRA 3IVUA 5HUOA 4JYFA 3FKRA 1C29A 1LBLA 5FEPA 2V30A 3GNDA 4E2DA 2ZRYA 4ADUA 3NVTA 3O6CA 5K9XA 1BWKA 4GUFA 3A23A 3LTSA 4DQWA 1EB3A 1G7UA 3L5AA 4PC8A 5D09A 5F1UA 3MJYA 3M1ZA 3IVSA 3W6YA 1NFBA 5FEWA 4AH7A 4WXYA 5D37A 5KZEA 3IRDA 1W5NA 2CLFA 3TIMA 3W73A 3NL6A 3OVQA 1X1OA 3LHUA 1TO3A 1W3NA 4LV9A 3GK0A 4O1CA 4JN6A 2DJXA 1XKYA 4BF9A 4A22A 1OX4B 1KM0A 3SIZA 3GYEA 2JGQA 2X1UA 4M7TA 4Y9AA 3O05A 3DFNA 3I68A 1ME9A 3EB2A 4JTTA 4UXDA 3KRUA 3TC6A 2GQ8A 3C3NA 4LNYA 2HS6A 2XN0A 3WK3A 3CHVA 1SO3A 1YTKA 2DZXA 1KBJA 3P67A 4QAIA 1VYRA 4FX6M 3GDLA 1THFD 4XKYB 3NZ1A 3P5YA 1TV5A 1H63A 4UTWA 5D03A 3QJAA 3D0CA 3A9IA 1O4UA 2DORA 4NZFA 4KKXA 2QCFA 2WPBA 1EX5A 3CIWA 5LNWA 4IX2A 3A5FA 1FWTA 1DVJA 3FKKA 3HF3A 1HFBA 3DFTA 1TQXA 4JX6A 4FNRA 5C55A 3QQ0A 1QOQA 1W37A 4XUGA 3E02A 3M5XA 2WJZA 3CWOX 4N9CA 2FJKA 1FXPA 4E38A 1YYAA 2VKZG 2GVLA 1DORA 2XFWA 4FEZA 1JUBA 5HMSA 1GVOA 3GIYA 4B5NA 3C56A 4Z1CA 3IGSA 4JNMA 3NPWA 5G4WA 1SZGA 4JY9A 4H6KA 5CG7A 4RJEA 3QW4B 4WOQA 3THAA 3OA3A 3STEA 4OT7A 2V5LA 3TQKA 4UMAA 3MMTA 3W07A 3TMQA 4M6QA 4IJBA 5CZJA 1LTDA 1VCGA 3C6CA 4P2VA 3N34A 3MHGA 3TFCA 1XFBA 2QCNA 1G7VA 4O1DA 4JIPA 3NG3A 1OVDA 2A85A 4O10A 3R8RA 1VC4A 2J9ZA 3W76A 3STFA 1BTMA 1K03A 4WXZA 1Q45A 1TTIA 4PEKA 5LZLA 1VRDA 3EX2A 1K7FA 1PE1A 1PCWA 2VFDA 2ABBA 1P1XA 2ATSA 3ABQA 4ORIA 2YFOA 1OX6A 1H7PA 1SUXA 4WD0A 2C1HA 2EKCA 2V5BA 2OT0A 4HPJA 2ZRZA 2NLIA 3MI3A 3W7NA 4RCXA 1G6CA 1WBHA 3C2FA 4A3UA 5K9CA 1R46A 5F2MA 3WJWA 1W5PA 2B0MA 2Y62A 2NV2A 3G1XA 3W70A 3WK2A 2J9YA 2X16A 3LBMA 2NUXA 3W87A 1SW0A 3LOTA 5A5WA 2ZRVA 3DBPA 4IQLA 1GYLA 4OV9A 5U7SA 3NNTA 3S1XA 2ZTKA 3L2IA 1Q6OA 1K02A 4OQVA 3M9YA 1TB3A 5G1YA 4UTIA 3P8JA 2A7PA 3UZ5A 4O53A 4NJJA 1VCVA 4NU7A 2QCLA 3W7JA 5IM51 4NJKA 3G1VA 4JS3A 2J9XA 4PFMA 3L66A 1BEUA 3DHDA 1UUMA 3MHUA 1JRBA 2YYTA 2FFCA 4GUJA 1KM2A 5KZMA 5TBOA 3S0CA 4NUWA 3G0SA 1FY6A 4WZHA 5I3HA 3SR7A 1H7XA 1KLYA 1KTCA 3G24A 2RHGA 1T99A 3MHFA 4LRSA 2PE4A 1XDMA 3PG9A 3UYCA 4N4QA 2BLEA 3I7QA 4D2JA 1EPXA 4IMFA 1XL9A 3TE9A 1C8VA 1WYIA 5J5DA 4FO4A 4FB7A 5LGZA 3VKJA 1OFQA 1G69A 1OABA 5BMWA 1GG1A 1ZHAA 2ZA3A 3W1XA 1OK4A 3QW3A 2JK2A 1T96A 4ORMA 2B7QA 4OV4A 3PBWA 3CQ0A 3LHZA 3LCHA 3LHTA 4FX7A 4IMGA 3EX3A 3W2MA 1TV8A 1RQHA 2V2HA 3HIJA 2CLLA 3NA8A 3QPZA 1TPVA 5AC6A 4M7SA 4PTNA 3PWAA 5DBUA 3HG3A 3W2UA 2AGKA 1QAPA 1GOXA 3QYQA 4UNKA 4POCA 5DXXA 5I3GA 2G96A 1AL7A 4JTJA 4O16A 5BW6A 2E5BA 1DHPA 3AJXA 1A5AA 3RK8A 1SZEA 1ZNNA 3WK0A 5CZ0A 1AK5A 1O94A 3RMJA 1H51A 4QISA 1UB3A 3IIOA 3LXCA 2VXNA 5HWNA 1VGAA 3TU9A 1ZALA 5F2LA 2OX1A 4GUIA 4LC6A 4NXKA 1WOAA 2YR1A 5FESA 1F7BA 5DN1A 5DY2A 3CEPA 1TPUA 2WOQA 4JD4A 2C6QA 3N2MA 2H8XA 4ALDA 3H54A 3HG4A 1W54A 4MYXA 1FCVA 4IMDA 2VELA 3DI0A 3E9AA 2Z6IA 2VFGA 3P84A 2FQIA 3LBCA 1EP3A 4MPQA 3EWXA 1GVQA 5KZDA 3STCA 2A7NA 4KFPA 1KLZA 2WQPA 3TROA 3KRSA 1W5QA 4YCPA 2CZDA 2H90A 1OFPA 4IPJA 1OYCA 1I8JA 3BGJA 5FF0A 2Y6ZA 2R14A 1OFRA 4YLWA 2OZ0A 1CI1A 3O07A 3S1UA 4IGHA 4LS2A 1DL3A 2XN2A 4OBTA 2VEIA 1W5OA 1W5MA 3FJLA 4O1BA 5EA9A 2O7SA 2A0NA 5CPNA 5HWJA 3MP3A 4IMEA 4IX0A 2V0TA 4IXXA 5DCDA 4WOZA 3E49A 2HSAA 2VOMA 1S5VA 1MZHA 2EPHA 2WV8A 3ABSA 3QFEA 2PRHA 4K8HA 2Y88A 1PHWA 2FPTA 1IIHA 1H5YA 3T4CA 1YTDA 2ZZ6A 3Q94A 2O7QA 3LRLA 1VHCA 1TV7A 2VFIA 2CU0A 1JUEA 3KOFA 4Y8FA 3AO0A 2NX3A 3L68A 3TW6A 2V9DA 4XBKA 3HMJG 1OK6A 1WXJA 3HBLA 3F4WA 5FEXA 3NXFA 1S5WA 2QCCA 1IGSA 1QOPA 3PULA 4EF8A 1OX4A 3WFAA 3DU0A 4YL2A 1QMLA 2GUUA 1OYAA 2FPVA 1QPQA 1F6PA 1KM1A 3CTLA 4WQ6A 1XBYA 2Y89A 4CCDA 4DO4A 3QMRA 2A4AA 2CZ5A 1IIGA 1T0OA 3P82A 3TQVA 2QJHA 4JDBA 4NNBA 3GDRA 5FEZA 4GRSA 3W22A 5CZTA 5D2TA 4JY8A 1OJXA 1AW2A 1K8ZA 3G1YA 1UUOA 4O54A 3LCXA 1FXQA 1PL9A 4NX5A 5AYZA 4NJIA 1SW3A 1LYXA 2JKPA 1AL8A 1V5XA 1YDNA 4XKYA 3C2VA 4GFSA 3MI6A 1K7EA 1XBVA 4O13A 4UMCA 2ALDA 4NQ1A 3GVGA 1K7XA 3W85A 1KFBA 4TX9A 1I4NA 4ZZ9A 2NZLA 2C18A 4EOUA 1FWNA 3LRMA 3S1WA 3TX9A 3P74A 3PBUA 4M6PA
chains in the Genus database with same CATH superfamily
4PUEA 2VCCA 2DZPA 1E4IA 1UR4A 2QV4A 3W7GA 3VNLA 8TIMA 4HSOA 3WSUA 4EXBA 1JQXA 4RZBA 1LOSA 1TPDA 3RM4A 3RHGA 4XAPA 4RV8A 3IANA 2CEQA 1WDPA 4BQ4A 1L9WA 4Q4PA 3WEOA 5LNRA 2GDVA 4K36A 3QVQA 1XC6A 3P80A 1MI3A 4AWTA 2GK1A 3BO9A 1PHQA 4CD7A 1MUMA 1JF6A 2O4MA 3TTSA 4TR9A 4DJEA 3SGUA 4XD6A 3W2JA 1J93A 2ZICA 1K6AA 4LAUA 4IQJA 4PL2A 2HNHA 4UR9A 3WO8A 1ZUAX 3ABOA 5E5CA 4XISA 4FNPA 3RCNA 4GIRA 2EF9A 2A79A 1JZ4A 1G5AA 3OGSA 1DOSA 3WLSA 1CBGA 1FWCC 3CNYA 1CXFA 4DXXA 1FWEC 3ZT5A 3D47A 2Z1XA 2J25A 3KEHA 3CM4A 1TKKA 1GVYA 3WLJA 4ZCWA 1DWHM 4HPXA 4AWUA 2HPMA 3UW6A 3AMCA 5F4XA 3MUIA 4GXPA 4C6EA 2J7BA 3BLFA 4EIVA 4LUTA 2C13A 4XB3A 1VBRA 3FEQA 4PSRA 3AROA 4V27A 4AD3A 1E6ZA 2D0HA 2PDIA 3RRXA 1OX5A 1F05A 1LWJA 3GKAA 5EYWA 2YYUA 1QPKA 3JS3A 4AD0A 1E0XA 1P7TA 3UD6A 4I9TA 1JJKA 1VBJA 2ZXBA 3EX6A 4IIHA 5ABFA 3G0UA 4NIRA 1QU4A 1LQ2A 1OG0A 1TIMA 1IEWA 5AY7A 1BVWA 1M53A 3HG5A 4K8GA 1IEVA 4YWIA 4U5IA 3ALFA 3F1QA 2QAPA 3PSVA 5LNUA 1FWWA 3G22A 4Q4SA 3I7RA 1NWUA 4QHRA 3V3WA 3EWZA 3STPA 1UJQA 1B2YA 1N55A 1A0DA 4KGLA 3SCSA 2J24A 4DRSA 3PBMA 1EA9C 1MSSA 1S2WA 1A5SA 4TX6A 1OFEA 2BY2A 3VNJA 3NQVA 4UQEA 2JGYA 1R85A 5CSYA 2BSLA 3OLGA 3QV7A 1JAKA 2QCHA 1V0NA 1YX1A 5D04C 3MV11 2RDUA 3BSHA 3WLKX 3GXDA 3KX6A 4DLMA 5CBJA 4E4FA 1IWPA 4H8HA 1IE7C 4MB4A 1PKMA 1HG3A 5ENLA 1HJVA 3M43A 3QPYA 2XHYA 4HTBA 3GAYA 4JTLA 2HMCA 1Q6LA 2ISDA 3EA3A 2QAFA 1NVMA 1DJXA 5HMDA 1LCOA 3K8LA 1AODA 1ADOA 1H61A 4DJFA 4C7GA 4E0CA 1PJ9A 3SQSA 2WHLA 4LAZA 1I2QA 3W25A 4TQTA 5AECA 2X1RA 1KWKA 1R5YA 1EXBA 3O3RA 1WDQA 5EMUA 2VEGA 3BJTA 2Z2AA 1YKWA 2R1LA 2RKXA 3N2XA 4NX0A 2F6KA 2PDHA 3UPWA 2DU2A 4H83A 1V03A 3SCRA 2H8ZA 5J04A 3M47A 4O0ZA 1P0NA 4GKTA 3GB6A 4GX8A 1R86A 4PMJA 1TMHA 3VNKA 2REQB 3AJ7A 4OGZA 4JDYA 3WUGA 3QHMA 4UTFA 1KCXA 4L4LA 5H2ZA 2TRSA 4WKHA 4UZSA 1SGJA 1WA3A 4N42A 1ME7A 2KX9A 2X1TA 3GVVA 2YFNA 3WYZA 4EPEC 3I3BA 3P8IA 4B5SA 4PZVA 3IK2A 4QM1A 4FXFA 3TW9A 4W89A 2Y2WA 3MCNA 1N8WA 2B31A 4I3GA 3BG3A 2VL4A 4JX4A 3L5MA 2BX7A 1GHRA 3BAWA 4LANA 4OUIA 2Y5EA 1OFOA 2CBIA 3QMSA 3PY2A 3SN0A 1HL2A 3N3TA 3REQA 2Q8LA 1E4LA 4BEQA 1B4EA 1HUVA 2OYKA 1JCJA 2BB0A 1L2UA 2QDGA 4C90A 4H7ZA 2XWDA 4F8XA 1K8CA 4HD5A 3CO4A 4GE8A 1KM5A 1TZ7A 5FD0A 1PTGA 1FDZA 4MY1A 4U2YA 2J62A 1MXGA 3M6DA 2WNZA 1SFLA 2ZVIA 3HOJA 4NASA 1GKRA 3W6LA 3DFOA 1XIGA 4W8AA 3PBYA 4FK9A 1JZ3A 1IV8A 4J5NA 2O9TA 5CGQA 4PBFA 3C3UA 1G01A 3M0VA 3MI2A 4HK6A 3DG7A 1TRDA 2R91A 3KP0A 2ZUSA 3UWQA 1TJPA 3VMPA 3IV3A 2P88A 4DM1A 3W7RA 2VX6A 3KOXA 4AZIA 1CX9A 1S1RA 4FAMA 4DEFA 4MZYA 1Z69A 4JQ3A 4YTTA 1TPB1 5K2ZA 2QCDA 3ARTA 1GQIA 2FPYA 3PZ9A 1GQJA 1WO2A 3QFWA 5B7ZA 4W5ZA 1V4YA 1KQYA 1NWSA 4LVDA 3W0KA 1AA1B 3WMBA 4C6IA 2C79A 4ACZA 4FLOA 3UVIA 1YADA 3NZGA 3H23A 3CZJA 2A21A 4C1LA 2PU1A 3G8RA 4DELA 5FAGA 1D2KA 3OHMB 4NILA 3CQIA 1WV2A 2POTA 3FJ4A 3WH5A 3CJPA 2MNRA 1W6TA 3H70A 3CAVA 3U6WA 3T8QA 5EMMA 4W9TA 5AYBA 3IS4A 4CN4A 4EK7A 5K4XA 2PLCA 3B04A 2GGGA 1F3WA 5CLWA 2V6AA 3QGVA 2YBVA 3N73A 4V1YA 4UTHA 5E0CA 2FZMA 2F7FA 2Y85A 3GO2A 2EKGA 4JQ2A 4GBDA 3QKEA 3N18A 3NAVA 4GACA 4R7OA 3MWAA 1AD4A 2OSWA 4A3RA 1UIPA 2OWXA 3S6DA 5FF2A 3DKLA 4TIMA 1XW8A 5G1MA 1BXCA 4QDMA 1W1B1 4MNKA 1ODZA 2PB1A 1EBHA 1V0LA 1XH0A 4IFRA 1VQTA 4Z1BA 1A4MA 3EOOA 4MNMA 1DWFM 1N8IA 1MUCA 4GHRA 1IEXA 3WQGA 4GXMA 3DKJA 5I3KA 2CESA 4ZEPA 4PTDA 3GRIA 3GDKA 2Y4SA 3L2MA 2XN1A 2L5HA 1H62A 1BXBA 2ZRXA 5C8BB 2EG6A 5A95A 3DYPA 3NQFA 1RJQA 3KCOA 2ISSA 2WMGA 4MVAA 3PB2A 1JI2A 3O63A 2JE8A 4GG9A 4DF0A 1FQ0A 4FZIA 2EPLX 3WJZA 4ZBCA 1DWJM 2R82A 1GWJA 2YIHA 2WCSA 2D1ZA 2WK2A 1QNRA 3NPVA 3QHOA 1FP9A 4UQCA 2G3FA 2DT1A 4LUIA 5A6KA 2UBPC 4R9OA 5DF0A 1EQPA 2WZEA 4O14A 4PMVA 3RX2A 1MW1A 1JEZA 5F4WA 2GUBA 2QF7A 5H1WA 2BASA 3S6TA 4NL1A 3S5OA 5BXTA 2WKLA 4YXGA 1BQCA 3PHAA 1HT6A 4BZYA 3O6YX 1E4MM 4IZGA 5AHEA 2DPEA 3EA2A 3W88A 1ZCOA 4WGXA 3ABZA 2WM0A 1KC7A 3V7PA 4HKPA 4IXHA 5CSSA 4AIBA 3HQPA 3EZ4A 2J8TA 4PTVA 2BTMA 1XYZA 1TWIA 1GNXA 1REQB 3TH6A 5AHLA 1Q7MA 3WDPP 1SMDA 3NL5A 2QNEA 4DJDD 4C60A 1YQ2A 2ZQ0A 4KERA 3GXPA 4D6IA 3ATZA 1Q6QA 1FWDC 1B57A 2V63A 5JVLA 5EKYA 4CNNA 3N4EA 5DMMA 5BROA 2XIOA 1SZNA 1PCKA 4G7EB 1GG0A 4NZ5A 3ZVHB 1J6OA 2SFPA 3CZKA 4PA8A 2WJEA 1J10A 3G1HA 2PI6A 4XAZA 3AU6A 4L64A 3WLLA 1I6NA 4J28A 2BXYA 4S23A 2AOSA 4J35A 1JCLA 1OQFA 4AXNA 5AC8A 3ITYA 2F6XA 3L4YA 4L7ZA 5H8PA 3P5ZA 1B4KA 4JKLA 4O8RA 3GR4A 1R3VA 3V1PA 4S3FA 9XIMA 4AVNA 1EQCA 1X8FA 1MDRA 1W3JA 2REQA 3VZZA 3TC3A 3WLHA 3S9ZA 1EGMA 1FDYA 2UY5A 1XC4A 1OINA 4R88A 3CT2A 3BAIA 1U1HA 1Z89A 1UKPA 2EG7A 2FGZA 4XBJA 3W7EA 2W66A 4EVZA 4KRZA 1MEHA 5TQLA 1NSJA 1HKKA 1V3HA 1TV4A 2ZZ7A 3R0UA 1MZRA 1KTNA 4XQ6A 1HJWA 5AHNA 2GQ3A 3SFWA 1UR9A 1VPQA 4V33A 2R6OA 2XVGA 2W3ZA 3HN3A 1RPXA 1YLVA 3APTA 1OCNA 1GQLA 4Z2HA 2OYLA 1R87A 1LOLA 5FL0A 1V6XA 1LRNA 1O68A 1KA9F 3A5VA 3UZYA 1ZFJA 3LLDA 1MFUA 7TIMA 4MY8A 5I78A 3R2GA 2ZWYA 1XYAA 2FKPA 2C91A 1AH3A 3SUUA 2O9OA 2LLEA 5FJUA 2P10A 2V3GA 2QDEA 5FF7A 1L6FA 1XF0A 1G94A 4ZOEA 4KEZA 1XSIA 2E9BA 1RCOB 4AMAA 4IP4A 2WVVB 1B5TA 4HK7A 4TUFA 3NL2A 1IF2A 1SO4A 2ATMA 4FLSA 4GX9A 2Z27A 3I3DA 4E5TA 2CLIA 2VWSA 4NF7A 1JRCA 4NRRA 2WHJA 4LY8A 3TR9A 2DY3A 1XR2A 4AG0A 3TR2A 1NU5A 5D2XA 2HK1A 3E6EA 3AUOA 2PPGA 3W1LA 1JPMA 3MDWA 4M29A 5DXYA 3DG6A 1UQZA 1NWRA 3WQ8A 2RDXA 1EL3A 4RXGA 3TAKA 1XH2A 1QTWA 1LLWA 5ABEA 4NAFA 1UKTA 1XUZA 1U22A 1TSIA 2Y61A 1M3UA 4KGJA 4ZO6A 2WXDM 3EWYA 3W1MA 3RLVA 3T08A 1KFKA 2RJGA 1XKJA 4AHOA 3LTPA 2PD9A 1XDLA 3R0KA 3VIGA 3KTSA 1VBUA 5HBFA 2G3MA 4B16A 1TWWA 4MJ4A 3TWBA 2J88A 3V5CA 3D46A 5AB3A 4FF7A 4UFIA 4K37A 3ZXWA 2D2GA 4HZ6A 3Q2DA 4LCQA 3ZR5A 4OBRA 1IQ8A 4CNOA 3STGA 3MP5A 1TZZA 1HKJA 2FTPA 2CC0A 3MW7A 4MKNA 3OLDA 5TF0A 3P0WA 4FPSA 1NFGA 2BG5A 4D6HA 4AB4A 4EPKA 2D22A 5AN7A 3HURA 3SBFA 4F48A 3SCPA 4XZLX 1BF2A 5AHMA 4ZOBA 4ZQOA 1AZ2A 2BXZA 3IIXA 2ZZ1A 2C15A 2PS2A 2VP8A 3W24A 1O60A 3K4DA 3ZJ6A 3W2LA 1QI0A 3HO8A 4NI8A 3V0UA 1UH4A 3E0IA 4GVFA 5TD4A 5KMYA 2A6NA 2NXGA 5CZSA 4E4UA 2OJPA 2OZ3A 2GWNA 3P81A 3UCQA 4IFOA 2J75A 2P1FA 3KHJA 5LGXA 4YWSA 2OQYA 1XLKA 2RJHA 1DTNA 3SRKA 3QY6A 4JIRA 5HJYA 4Q8UA 3UGRA 4DZ5A 1G67A 5EL1A 3MANA 1AJ2A 2WHMA 4JQAA 2ZC8A 2J66A 4JTIA 2QUNA 5KSWA 2JF7A 4X3ZA 1BYDA 2BMBA 1KO0A 4U3AA 1O5QA 2FLIA 3U4FA 1F4AA 1HZYA 1K8XA 2VZSA 4LVBA 4MNLA 1V77A 3SEPA 4L4PA 2OU4A 5AYIA 3B0UX 4NXSA 2GVYA 2B81A 4RE4A 2EAWA 1JPDX 4HCHA 3SN4A 1J2WA 4Q8QA 2YW3A 5M3WA 4RL3A 3FXGA 3FEMA 3H53A 3KW3A 8A3HA 1ONEA 5CC7A 4NYYA 3GSMA 2Z26A 4TVCA 4YN5A 3NM3A 1KBKA 3IGXA 3S1GA 2XIJA 3FGCB 3H26A 2IS7A 2YLLA 1EX1A 1PXGA 3NQMA 2TPSA 4DZIA 2WNQA 4JAWA 3UJEA 4E8DA 3M0HA 4JTRA 1XQLA 5I3FA 4H4IA 1ZB5A 2GGHA 4ZB2A 5CKSA 1EP1A 3TSDA 2ZZ3A 2NLYA 3MUXA 4AMCA 4B5XA 4X2RA 4MGGA 1FCBA 4W4QA 1XCFA 3SGGA 2D3NA 3VI2A 4MKSA 5GJMA 2CXGA 2UY3A 5A3HA 1H7WA 2ZE0A 5D2YA 4IICA 4MSSA 1IHIA 5E93A 5HXMA 3W53A 3IVTA 1ZSXA 4ENLA 4KWVA 1LORA 3T0CA 4G7EA 4UQDA 1TPEA 3H2CA 4EE9A 2ALRA 4WDXA 3C2OA 4PCFA 3ARQA 3OGRA 4M24A 4UQ9A 4O18A 2PF8A 1J18A 3UZZA 2G95A 4PE8A 4PUNA 4S3GA 3G1SA 4LWWA 1TWZA 4U28A 1PTDA 3LD5A 3K30A 4AY1A 1KBBA 2CWNA 2Q01A 2H3DA 3CUHA 2R1NA 5HQEA 3CAKA 3GIPA 1Y0EA 3UY7A 3GFYA 4BJHA 3IIPA 3ITLA 4NJGA 2UWFA 3C0JA 3M0KA 5CPOA 3KBMA 3KRZA 1KXHA 4XK2A 3WLOA 3C8NA 4LU0A 2YBUA 3F7JA 1EOKA 3B0XA 1M01A 4KFNA 3HG2A 3AAMA 2ZXQA 3U2CA 2YCLB 2R94A 1LT7A 3VC6A 4JYDA 3HA1A 2ZUUA 3MB9A 1QI2A 1I60A 4Z1DA 3T1GA 4C6NA 1TPFA 3W7PA 2YL8A 3FXYA 3H24A 1OBAA 1VRXA 1UWUA 1Q6CA 4ZENA 3EKGA 1RA0A 2YXXA 4OVXA 2PP1A 4CD6A 2ZCGA 3C61A 3KBWA 5HDRA 4MDPA 1PBGA 4QE5A 1E1EA 3PS7A 3KCJA 3CUXA 1B3VA 1CCWB 2VDHA 2WVVA 1PS9A 4HU0A 3F03K 3QC0A 1E4NA 3O06A 1K8YA 5CPTA 4DWSB 1SZRA 2WCAA 4GZ7A 4WUIA 3VCCA 3L0NA 2X2YA 3WQ6A 5A6BD 4ZE4A 3L0GA 2TODA 3U7VA 5A8PA 4CEUC 2E9MA 4YVVA 4WVXA 3BZGA 1WDRA 1S3TC 5C71A 4NJHA 3VGHA 2D0GA 1J9YA 3TYEA 3DBNA 3RN6A 3WQFA 1E5JA 2BS9A 3K46A 2EBNA 1MWOA 4ZR8A 5EMKA 4LYQA 5CPMA 3DG3A 3WBAA 3TOYA 4CNPA 4GGBA 2UY4A 5C9XA 3FLUA 4NRSA 3BV7A 2P3EA 2WBKA 5XIAA 3R13A 2D20A 2ISWA 2X09A 3G18A 1CB7B 2VQTA 2PDPA 3IJIA 3PC0A 1M03A 3BLEA 3L2LA 4QGCA 4R34A 3EOEA 1CENA 2J7EA 3EMZA 2EPMX 3P6LA 3CC1A 4UTTA 1C8YA 2VURA 4M1RA 2J4GA 1B0IA 1RCQA 4ZQMA 3I4EA 3FCPA 3FKRA 1LBLA 3GNDA 4XAFA 2IKIA 3GC4A 4DJDA 1XINA 4L6HA 4FP1A 5D09A 5F1UA 3MJYA 4B3LA 4WXYA 5KZEA 4I8DA 3AOFA 3N4AA 2CLFA 3W73A 3NL6A 5IDIA 4G8TA 3LHUA 1J79A 1GVEA 3N6QA 4L1XA 2QZRA 1W3NA 3GK0A 1TA3B 2OFJA 4KBXA 3VDGA 4RE3A 2DJXA 1XKYA 3GQYA 1E9IA 3ZM8A 2JGQA 4D1IA 4Y9AA 3NSXA 3O05A 1QI5A 1VPYA 1ME9A 2FFIA 4JTTA 4XKMA 3ZQ9A 3OO2A 3TC6A 3C3NA 4ZSTA 4LNYA 2HS6A 1IWAA 3SCVA 5AC5A 2PDCA 4MJ2A 3DCPA 2DZXA 2WMHA 1Q6GA 1OSEA 4DUVA 1EGZA 4FX6M 3XIMA 1H0IA 3FA4A 3UPMA 3CMGA 3MV01 4J4KA 1PSCA 3CL7A 2RAGA 4QLKA 4NZFA 2QCFA 1BYAA 1GHSA 1V02A 5ECUA 1I0DA 5LXXA 1EX5A 3IAQA 4Q8MA 1WKDA 1OC6A 3A5FA 3U4AA 3FKKA 1TQXA 1CDGA 4ZSUA 1QOQA 4J3WA 4N9CA 2HV5A 1QNSA 4E38A 1YYAA 3UERA 4FEZA 1HNYA 1W9BM 2QQ6A 2YJQA 4B5NA 4PUDA 3IGSA 4JNMA 5G4WA 1ONXA 3BAJA 5MKGB 4AD2A 4ML4A 1FHDA 3A3WA 3OA3A 3TJ4A 5CC5A 4DUWA 2IUZA 4P5UA 1AH4A 1QW9A 1BLIA 3W01A 3N34A 1JZ7A 1XFBA 1E71M 3ZJKA 3CUFA 1H4PA 4QDWA 1G7VA 1TE6A 4JIPA 3FGCA 2R9RA 2XJ7A 3W76A 3STFA 4DUXA 3G6MA 2XINA 4WXZA 1Q45A 1TTIA 4PEKA 3KTCA 1HF6A 3WD4A 1VRDA 1VFMA 1EJXC 1PE1A 1JGIA 1J0HA 1KR0A 2ATSA 2BVWA 3VIKA 4ORIA 2YFOA 3WY1A 4US5D 1W32A 2OOGA 4CEXC 1HL8A 2C1HA 4CD4A 1QBAA 1XLGA 4AIEA 4QJ4B 1GOKA 1G6CA 1WBHA 4DAFA 4MB3A 1GZ1A 4G6CA 4GFIA 4XO6A 4A3UA 4HZMA 2FTYA 3VILA 1FH7A 2NSOA 2Y62A 2NV2A 3W70A 3WK2A 3WQPA 2X16A 3QHNA 2IKHA 3HPAA 4IJCA 3LOTA 4GNKB 3KDOA 4XZBA 2W61A 1GYLA 3NNTA 3S1XA 2ZTKA 3JUGA 1K02A 3M9YA 5CC3A 1NARA 2OKOA 4UTIA 3P8JA 4GYKA 4NU7A 4JIHA 2HDJA 2QCLA 4L65A 1RP8A 3G1VA 2YA1A 3OYZA 1WDSA 2FFCA 2J6VA 4NUWA 1FY6A 3E5PA 2V67A 1KTCA 3G24A 3NOYA 2WQDA 4LRSA 3VGDA 3VDCA 1YHTA 1F3TA 2VX4A 2BLEA 2O56A 1CLXA 3I7QA 3FVMA 3LG3A 1EPXA 4IMFA 1WYIA 1IZJA 5M5DA 1G69A 4RDVA 1E15A 1OK4A 2ZXDA 1NP0A 1A5OC 3JZUA 2HE8A 2YCLA 4CNTA 3NA8A 1R3WA 1W9PA 4HNCA 3K5XA 4XG1A 3PWAA 4RE2A 4C5YA 3WMSA 2EEXA 4HMEA 1BF6A 1C92A 1QAPA 5DXXA 1AL7A 5M03A 1HQTA 2WZIA 2RGMA 4D9PA 4A3YA 1DHPA 1UWSA 2V38A 3TYUA 3Q45A 1ZNNA 3LZ3A 4AIUA 3MWCA 1UB3A 5HWNA 3NQBA 2VRQA 1A49A 3MU7A 5DO8A 1IYXA 1M9HA 1RCXB 3KM8A 4E8CA 1MYRA 5A6TC 5FESA 1F7BA 5DY2A 3UCDA 1E1CB 2DSZA 3BLPX 4NZ3A 2H8XA 3HG4A 4MYXA 2DUXA 2CCRA 3ARYA 1OADA 3VD4A 3LBCA 4JL1A 3GYCA 3MZNA 4QEEA 2INEA 1P43A 4FXJA 1XG4A 3TROA 2VRJA 3GXMA 4A35A 1EEXA 4IPJA 1OYCA 5FF0A 3OPSA 6PTDA 2DIKA 1OFRA 3GHUA 4YLWA 4KCWA 4RNFA 2OZ0A 3S1UA 4IGHA 2PWHA 5FA5A 3UU0A 4OBTA 4AZCA 2RGLA 1W5OA 4H8NA 4ZO9A 3E38A 3FJLA 2EPNA 1RBAA 4IMEA 3CZEA 2UZ9A 3E49A 1S5VA 1MZHA 2EPHA 2WV8A 3M0MA 4AEFA 2ODOA 3KLLA 1S5MA 3VABA 3OBAA 2ZE3A 2G3IA 3T4CA 3UA4A 2O7QA 4Y9OA 2O55A 3H2EA 4CU6A 1TV7A 2QPUA 2BY1A 5M17A 3N4FA 3TQPA 4Y8FA 4F9JA 3L68A 1UWRA 2V9DA 4FR1A 2Y24A 2C1IA 4WKFA 1OB0A 3EDFA 1S5WA 4D8LA 2VC9A 4Q3MA 1IGSA 4YL2A 3QV6A 2J7CA 1QMLA 2GUUA 1J96A 1F6PA 2O9RA 3E0VA 2Y89A 1LG2A 3NFUA 2CZ5A 1YMYA 4S3AA 1B54A 1T41A 4JDBA 3LM3A 3GU9A 4FOKA 3GDRA 3MKKA 3OQ8A 5FEZA 4H9TA 3CH0A 3ANUA 1K8ZA 4FLRA 4V2XA 3LCXA 4NX5A 1V6WA 2OLHA 3F5KA 2JKPA 4EPDC 5I7GA 4JBRA 4GVGA 4M82A 4GFSA 4RNHA 4GO8A 4UMCA 5PTDA 3GVGA 2NZLA 4EOUA 3LRMA 3APYA 3S1WA 3WX7A 4C6BA 2IXUA 1MFVA 4HQVA 2WZTA 3ITCA 1P0KA 1FUYA 1TTJA 2OWCA 4E6MA 4XX6A 5ABHA 4PN2A 3VKBA 4CNSA 1EGVA 2Z29A 4QTGA 1K9TA 2DJLA 3ATYA 2ZRWA 4EAMA 4MZ8A 1ECEA 1ITXA 4LVAA 1PB0A 4QSHA 4QJ1A 4QS6A 1GQNA 5MKGA 1HVQA 5HULA 3TYZA 3DC0A 4Q4MA 4M80A 3S4TA 4M6VA 1K6WA 3M41A 4TTGA 3AIUA 2NVDA 2WKJA 4Z2JA 1RQEA 4S2BA 1PTAA 2XSBA 4DBUA 4QX4A 2XM1A 4YYCA 4TXEA 5BMXA 1SO6A 1QASA 2QDDA 3S6OA 4K8EA 1XLEA 3B05A 3MZ2A 4I90A 3M5ZA 3FS2A 1D3CA 2P0OA 3PZUA 5E9XA 5HMFA 2WWCA 5AYYA 3RFAA 3AHTA 3RG6A 1NOFA 8CGTA 5F7UA 3W4RA 3GTXA 1QW7A 3VMNA 2R1KA 1DJQA 3DUGA 4PB3A 3LI1A 1WKFA 2V82A 1RK5A 2QIWA 3AS2A 5IBXC 4Y9NA 3M0ZA 1GEHA 1XIMA 2QS8A 1BYBA 2QUTA 8XIMA 3VUSA 1YTEA 1CLVA 2WAGA 1LUCA 3N29A 4L9ZA 3QKZA 1VFFA 1RK6A 3KLKA 3W2NA 1ZP4A 1SJCA 1GEQA 1E6PA 2DZUA 2AGTA 1KM6A 2DSUA 1HJSA 1OF8A 2WLYA 3DGRA 3C86A 5DCBA 5T91A 2VT0A 1U5JA 3P61A 1UPPA 4BQ2A 2X1SA 4I8YA 3Q37A 2VC6A 3E0WA 2DVUA 1E3ZA 2BDQA 2OGYA 3BLKA 1EUAA 3G1RA 1Y8BA 3ARRA 1B9BA 1V6VA 1QK0A 1HTIA 1E55A 2DZWA 3O0FA 5IFPA 1FWBC 1DPMA 3U57A 3W75A 4LBUA 1GTEA 3SJ3A 4DO6A 4S38A 4YIWA 2P5NA 2QXWA 4UR8A 4UFHA 4C7FA 1QNPA 2ESCA 3QBUA 3RILA 3GDBA 1SFJA 4AY8A 1C9DA 1VB9A 1EXPA 5GNZA 4N9EA 3WUEA 3M5YA 3ZLFA 3CQKA 1Q8AA 4B5WA 3R0DA 2ZZ5A 4F0LA 4PMUA 2VC5A 2QUUA 1R2RA 3AIEA 2QW5A 3LTYA 4H9MA 4U31A 3CV1A 2AAAA 1ICQA 1L6WA 3WDQA 3O7UA 2XUCA 1S2CA 1HO4A 2WSRA 4ADTA 3BK0A 1GGOA 1ZJAA 3BCDA 3WLPA 2FMOA 3KZSA 1OC5A 4GNVA 1H60A 4LUJA 1F6KA 2DIEA 2RDTA 2G5WA 3TXZA 1B3OA 3IJQA 3AISA 4PUWA 1CZ1A 3GUWA 1E1CA 1GW1A 4TV5A 4X2PA 1V3MA 1YXDA 3AS0A 4ZQRA 2ZIDA 1R30A 3SSJA 3R11A 3VMOA 3CQJA 2Z4GA 1ZENA 3T8LA 4Y96A 2NQZA 3MSRA 1ZQ5A 3T6CA 3LSBA 4C1KA 4KMQA 3SUSA 4K6AA 3WZ0E 2Q3RA 1HKWA 3PAOA 1W3KA 2CWXA 4HN4A 2WVSA 1PAMA 3MBFA 3TJIA 4US5A 3S5NA 1FWRA 3NQCA 2GJLA 3MCOA 1MUWA 3TQ0A 3UYIA 3NEVA 1TZ9A 4PMZA 3PTDA 3VGGA 1DJHA 2CKRA 1DJNA 3LM7A 1MVYA 1WPCA 2VENA 1Q7ZA 1HO1A 3DX5A 5K4ZA 4IG2B 4M56A 4I5XA 5GQBA 3KVKA 3BDKA 5BRQA 3KL5A 1C93A 1ZJIA 1V7YA 4NZCA 1H7OA 2AQWA 4JN8A 1GK8A 4H6EA 4MJMA 2OMAA 2TAAA 4Y9MA 3QLLA 2OCZA 4ROPA 4PR4A 2HVOA 3ZMRA 2C7FA 2XM2A 4QCFA 2A2IA 3PP7A 4JTHA 2Y1HA 1IR2A 2AAMA 4DWSC 2VGBA 2EGZA 5T9CE 1LROA 4WDWA 3PBVA 4PH6A 7CGTA 1P0EA 4Z0JA 1ZTVA 2GOKA 3MQTA 1F8MA 2CLMA 1CGVA 4AW7A 5BXPA 3GXNA 4BFAA 4GD0A 2F2HA 3UQNA 1XDJA 4XIAA 3VX1A 4WX2A 2E6YA 4DWDA 1H0GA 1P48A 3WQCA 2WZMA 3FJ6A 5HR6A 3SCUA 1E6QM 2XISA 2QJIA 1UR0A 1ZP3A 2V5KA 2D73A 3DHUA 2Q8XA 3U2OA 1FTXA 3HPZA 5XINA 3K13A 3F4CA 4WLCA 3AXKA 4LBSA 1X96A 3QH2A 1M7XA 4GQQA 4LYRA 4HMNA 4RDWA 2NX1A 7ENLA 4UCFA 2CLEA 3O1NA 3K4WA 2ZC1A 4HPGA 2E6FA 2WJDA 4AZ6A 4AYSA 1SO5A 1FCUA 5C5YA 2RH9A 4JXCA 1GVSA 1QUMA 4HOXA 5DMLA 2RFGA 3ZR4A 3AIRA 4F0KA 3ZLHA 1DJIA 3CHDA 4D1JA 3OQEA 2JIEA 1W1ZA 4TMBA 3C2YA 2PAJA 3MJMA 3R4IA 1WXYA 3AZTA 3SW6A 4GQ0A 2FZNA 2DZVA 4P8UA 4IOTA 3E2RA 5JIPA 2ZWZA 3GTFA 3GLCA 3LGDA 4E4PA 3PSWA 3NL3A 1LOQA 3ISIX 4LRTA 1PYFA 3V75A 4JL2A 2YCIX 1LF1A 4L4MA 1I2RA 1E0UA 3B9DA 1WOBA 3ARXA 5FSDC 3CEUA 4F2TA 4BI7A 3ARSA 2Z1SA 4H2HA 1DJWA 1OYBA 3B0VC 3NDYA 1AMKA 5FJTA 3H2AA 5C2GA 4ZTXA 1JPHA 1CGUA 1VF8A 2PBOA 4QLLA 1E56A 3W83A 1JVNA 1O1ZA 2Y8VA 1H1ZA 2PDQA 3T0DA 1FCQA 2CLHA 2ZTJA 3ARPA 2FHFA 1LRTA 3NZRA 3MUY1 2WNNA 4K1WA 5G4HC 4QROA 4BEUA 1U1JA 4Q22A 3PZMA 1DQUA 1RD5A 4G9PA 2Z28A 4BK9A 4HHLA 1CTNA 1QPRA 4CQ8A 1UKQA 3T07A 4O17A 1QDSA 4AQLA 5I06A 3BARA 3CPUA 2DT3A 4K3ZA 4WK9A 1LL6A 4IL2A 3AHVA 2XIIA 1MNSA 1TUFA 4N9DA 4DY1A 2X30A 2A3BA 1TE1A 4MF4A 3PZVA 4HPNA 1DQWA 3INPA 3NTYA 4XBSA 3T0TA 4NSBA 1QFEA 3TNBA 4IH3A 3ZWSA 4KT2A 4UIOA 4D6GA 1AW1A 3BWWA 4KW2A 5I6SA 5C9ZA 1WZMA 4W88A 2O9PA 3MPGA 3BAXA 2YCEA 1KV8A 1M04A 2NW0A 1QWGA 3HFTA 5HR7A 4B90A 2YA2A 2DVTA 1YNYA 2XGBA 3P62A 1X97A 1JDCA 3G3MA 3CBWA 3KP1A 2DQWA 2E4TA 5HAOA 2PDUA 1AVAA 1E43A 4OU1A 3CHCA 4W7VA 1UBPC 4F0RA 1GT8A 1V02E 2P3ZA 2XPKA 3GBEA 3JRKA 3CH9A 3KVMA 4O1AA 2VO5A 5CSUA 2IPJA 2EJ1A 2VR4A 3IJ9A 1ISZA 3YPIA 4IP7A 1J5SA 4YU1A 2GWGA 3EOUA 1VCFA 4GH3A 3OB8A 3AMLA 4Z42C 4RE0A 2C19A 3OHIA 1OHLA 3BQ5A 3XINA 4PMOA 2XSAA 5AHFA 1EUNA 2XYLA 4IIEA 3MSGA 2Q02A 1LG1A 4XD4A 4YCOA 1BG9A 2BGSA 3HJEA 1V79A 2ONEA 1YE4A 2A3LA 4EXQA 1NIUA 2C0HA 3W1QA 3IRSA 2TSYA 4X61A 1DQXA 1PIGA 1Z3NA 2VD9A 3B8WA 1SU5A 4BKNA 1RD6A 1X7FA 2VJXA 2Z00A 4M8UA 4GUHA 4R85A 2X40A 1JCYA 3VYLA 4QNEA 1TTQA 3ZJ8A 4GK8A 3G6LA 4H2CA 4Y9PA 3KVLA 3G0XA 4Z1YA 1YDVA 2VZTA 2ZX9A 2XGZA 4I5RA 2E0PA 3HPXA 3RDKA 1X6NA 5XIMA 2GQAA 1W8SA 1WZAA 5EFDA 1J8VA 2O4QA 4FR6A 1JZ6A 1DIEA 4LYKA 3BXWA 3IGHX 4ATLA 1UMYA 2PEVA 5DEZA 1UG6A 2E67A 1UR2A 1A80A 1VJIA 3N25A 4EP8C 3VDBA 4XZ9A 1NQ6A 1A3HA 4I7UA 3OBEA 1A5BA 2OEKA 3TVAA 4DO5A 4IM4A 4RW3A 1E0WA 4IG2A 5G4EA 3B40A 3RPDA 3N19B 2XVPA 5H6HA 1W8GA 4R7WA 3RPMA 4AZHA 3UXLA 8RUCA 1EWEA 2XZ9A 3M7WA 1AG1O 3NXLA 4AF0B 2YZ5A 3FFSA 1GPFA 5HNUA 3URAA 3IEBA 2J27A 3RAOA 1MQPA 3R79A 3L0KA 4Y8EA 4V28A 1UWAA 3SCOA 1JYXA 4LQ1A 4GYFA 4URIA 4UUIA 1UKOA 4QS5A 1E70M 3TXVA 3DHFA 3GG7A 2WW5A 4RV3A 3SUVA 1D9EA 4J2PA 1CW2A 4N02A 4AD4A 1TVLA 3WBXA 1UBSA 4D6DA 4LAOA 1LQAA 5E1QA 5BYWA 1PX3A 4XD3A 3VUPA 1UOKA 2OEMA 1DKWA 2HTMA 1H41A 3CHFA 3B03A 1SR9A 3HGSA 4C6LA 3QSRA 2DSWA 1BSLA 3S46A 3GD6A 4B4FA 1XYBA 1MDLA 5HPCA 4JNYA 4XZWA 4LUYA 1R9XA 1TCDA 2CITA 1A5CA 3UP8A 4LPCA 2H3BA 4LT9A 6CGTA 4XZNX 1DXIA 1UPMB 1VBGA 3MDUA 5JIWA 1VS1A 3B9AA 4S39A 3ELFA 2YSWA 3B4UA 1LL7A 1VIZA 4K39A 3IIVA 5HOSA 4H41A 1OFDA 1ZAIA 5E09A 2ADAA 2Z6JA 1AW5A 3PTKA 2VR5A 5JH1A 3VNZA 1U5HA 1V08A 3UWVA 2BGQA 1JDAA 1S5TA 3CV7A 3TEVA 3NIYA 4X9YA 3TC7A 3SCTA 3SJNA 3VD7A 2TYSA 3BCFA 5CZKA 3MP4A 1S1PA 2PCQA 3UXDA 1Y5WA 3KE0A 3RLUA 3USZA 3N15A 3TN3A 5D2WA 1D3GA 2DT2A 2YKKA 1EF3A 5FOOA 1NEYA 1VFUA 4OFCA 2W27A 3VOHA 3V4BA 3CWNA 5CGMA 2HXUA 4GQRA 4Z2IA 4YNGA 3LLFA 3GXTA 4PBGA 3GR7A 1OGGA 3CV6A 4G56A 3APGA 4UTLA 3WLQA 3I6TA 3WL0A 4OIFA 4U4MA 4F40A 1Q6DA 4GC4A 4XVEA 1UW9A 1ZAHA 2VFEA 1FWGC 2BP1A 1TQJA 2RDWA 5I07A 3UG4A 5C9WA 1D8CA 2W0UA 4KIRA 3L5LA 3TW7A 3NWRA 3B8VA 4PRRA 4UNLA 3G1DA 1FWJC 3S2CA 3G3DA 3WG6A 3S2JA 3LCFA 5CBBA 1J2BA 4N4PA 4P7OA 3OVGA 2QKFA 3WF4A 1BRLB 1C90A 9XIAA 4Z2KA 2GVGA 4M5PA 3UGVA 3QC3A 1AQFA 2GQ9A 4M81A 1OFBA 1SJBA 2NQLA 1JCXA 4DPQA 3WMLA 3WD2A 1PYMA 1SVDA 2PGWA 3KDNA 4NG3A 4HT3A 4JTDA 2W67A 1VR6A 3PANA 3FY1A 1YW1A 1UC4A 2YGYA 3BJFA 3WLMA 3NQGA 2F9RA 4ZOCA 1JYNA 3BMXA 5E0KA 3B0PA 2DP3A 1I45A 2YX0A 3K8KA 4O8AA 3CB8A 5CBIA 3RM8A 3FDGA 1RQBA 1TX0A 2BNJA 1AJ0A 3T09A 3EKLA 1T40A 3A9BA 1Q6RA 4FIQA 3WNKA 3PAJA 4HCDA 2ICSA 5DMNA 3LGEA 1VPXA 1IGWA 1JNEA 1LT8A 1EZWA 5CPSA 1Q66A 2QULA 3MBDA 3PZIA 5E70A 4AD1A 2J7FA 1KRMA 1E1FA 1NQKA 3NQ7A 3QZ6A 2ZA2A 3FNDA 2GVJA 4DI8A 4P61A 5DLCA 3GM8A 3M07A 2QJGA 2QUVA 1FKXA 2A3CA 2DSVA 1XGDA 1RR2A 2G3JA 2Y70A 1OT2A 3OODA 3V18A 3BG5A 1PKYA 1ZY9A 3AALA 1Z8AA 1M7PA 3TMLA 3LB0A 4MMWA 3V16A 4X63A 2ZOXA 3PJUA 1QBBA 3C2EA 4TU1A 2PBGA 4Q7NA 1V3LA 5BCAA 1F07A 1VKFA 4LF1A 1SM9A 3C8FA 4RNIA 3NQ2A 4Q33A 2CBUA 2Y5SA 2DZSA 4QE4A 3F2CA 2HZGA 1WDWA 2WLZA 4JNZA 1H5VA 2OODA 3CHEA 4HYVA 2V5CA 4OE7A 1W1VA 2XTKA 5AOUA 2CHNA 3ITXA 2YBTA 1FWIC 1KRCC 4GZEA 4QEHA 3NGJA 4LB3A 1NY1A 1GZJA 4FNSA 3PR2A 1OCQA 1W1A1 3G77A 3TN4A 4F3HA 2VFFA 4A8LA 3W72A 5JBDA 2NQ5A 1YXYA 2V2DA 3EXSA 4QIUA 3ES7A 2CZFA 2QMJA 4GI4A 3PG8A 2X7WA 1RALA 1G4SA 1X1ZA 1POKA 1PVNA 3PZNA 4LS1A 1PEZA 5BU9A 1SR0A 1RHCA 5LIUX 4KS0A 5BU6A 3DXIA 4L6DA 3QY8A 3LDVA 4A3HA 4H9XA 4MAZA 3AYRA 4MOZA 1RP9A 5LHEA 2D2JA 4IHCA 4QP0A 1KTBA 4O19A 1YNPA 4WR3A 1TJRA 4UR7A 1DIDA 4BR1A 1UWTA 5G5IA 1ONRA 4JX5A 3SZ8A 1KBIA 3G1FA 4NNAA 5KTLA 3EDDA 4R53A 1I2OA 3LSCA 1Y65A 3NR0A 1M65A 1W2PA 1PKLA 1TX2A 5DANA 3HGJA 4C6FA 5I3IA 3MS8A 1A47A 4B92A 1K4GA 5AYXA 3GKFA 5LYRA 4QRNA 1QHZA 3M5VA 3IGUA 1W1IE 1VEPA 2E1WA 2J77A 3IVUA 4PUJA 1XLJA 3RR4A 4UQBA 3UR7A 2V30A 1PX4A 3NVTA 2VUNA 2OXNA 4KRUA 3BURA 1G7UA 3FAXA 1VFTA 1ZGDA 5A1AA 3W6YA 5FEWA 4HGXA 1W5NA 4JFVA 5EGRA 4D71A 4LV9A 4PSPA 3EGJA 4N0RA 4JN6A 5A8NA 1UMLA 4BF9A 1TWSA 1OX4B 1KM0A 3TTYA 2X1UA 4W5UA 3L12A 4UXDA 1W1PA 2WMJA 2QLYA 3HFYA 1QI4A 2XN0A 2VGGA 1CGXA 2CBVA 1YTKA 1L0PA 1AQ0A 1ELSA 4QAIA 1VYRA 4JQ1A 4GY7A 1AUSL 3WH7A 1O6IA 5IHSA 3GDLA 1THFD 4XKYB 4Y2WA 3P5YA 1TV5A 2ON3A 1NTHA 1TMQA 3A9IA 2DORA 3H2OA 4KKXA 4JZ5A 3ECQA 3V0SA 4CQCA 1ZU8A 4GYPC 2X1IA 1FWTA 2BHZA 3EOLA 2GFTA 3AICA 1X39A 3LENA 4JX6A 3DFTA 2EPOA 4FNRA 4GC3A 3E02A 4WSJA 2INZA 2WJZA 1XICA 5CGTA 5IFTA 2FJKA 2VKZG 5DRIA 2XFWA 4W87A 4DZHA 3S2LA 1BRLA 1UROA 4ECLA 1GVOA 3EYPA 4Z1CA 3UCCA 1F3XA 2GJXB 4H6KA 5CG7A 4RJEA 4A8NA 3IUHA 3O0KA 4WOQA 2PDFA 3GY1A 4GCXA 3STEA 4OT7A 4AWEA 4UMAA 3W07A 3TMQA 5CZJA 1LTDA 3QR0A 4I6KA 2OWWA 3TFCA 2FTWA 1V6TA 2E25A 2WBGA 4DM2A 1U33A 3NG3A 3U3HA 2VUYA 3E5BA 4O10A 1BTMA 1K03A 5BWAA 1V3IA 3SCWA 2VFDA 1P1XA 3BL3A 4Q8OA 4WD0A 1GOWA 1UR3M 2NT1A 2ZRZA 3RLHA 3MI3A 4MWAE 3FA3A 4G1NA 3WJWA 1F61A 1R3SA 3GIQA 1CNVA 1GYMA 4GQGA 2J9YA 3I10A 2ASHA 5LA0A 2NUXA 1CEOA 1OIFA 3BAKA 5A5WA 2ZRVA 2FGBA 1VFOA 3DBPA 4J1OA 4IQLA 4OV9A 1Q8JA 3AHZA 1HGWA 3L2IA 1Q6OA 3A4AA 4GIEA 4QCEA 2GZXA 4YS1A 4ZA0A 5IHRA 4IP5A 3CK5A 1MQRA 1X1NA 1EJUC 4PTXA 2I5GA 1OGBA 3L66A 1UUMA 3MHUA 4C6DA 1V3KA 4JIIX 3WDRA 3B9OA 3S0CA 3G0SA 1GCYA 3SR7A 1H7XA 2RHGA 1T99A 2V5JA 3MHFA 1XDMA 3PG9A 4AUBA 2CETA 3GE7A 3MT1A 3UETA 5A6JA 4REQB 2Z1VA 1Q2RA 1XL9A 4PRTA 4FO4A 1OFQA 2GLKA 1Q4WA 1ITUA 1GG1A 3W1XA 3I4KA 2JK2A 1T96A 5A6SA 1JD7A 4KF1A 2P0IA 3CQ0A 3HM7A 1EJTC 3NO3A 5FJJA 3W2MA 2V2HA 1FHLA 5A2CA 4XAGA 1JG9A 4M7SA 4AFYA 2QGYA 1QRQA 4PTNA 2VX7A 3EWCA 1YNQA 2AGKA 3KWXA 3QYQA 4UNKA 1U30A 4POCA 1A4LA 2D3LA 3UNTA 5I3GA 1MW3A 2G96A 3VOCA 2IQDA 5BW6A 3D6NA 3ZIZA 1LJYA 4W93A 1TCMA 1WCGA 3AJXA 4D6FA 5CJ5A 3RRAA 4HA4A 1O94A 3RMJA 3T9PA 3FW6A 2FVLA 3AI0A 3EDKA 2VXNA 3RR1A 1VGAA 2I9UA 3TU9A 1ZALA 2GYIA 4GUIA 2HBXA 3R43A 4AX7A 1OZQA 5DN1A 4CKQA 4ZXLA 5B80A 2NSXA 2CYGA 5LIXX 1LQ0A 3H54A 1W54A 2VELA 5E6ZA 2J7GA 2VFGA 3R6IA 1CB2A 3P84A 4MM1A 1DXFA 3KTXA 4MPQA 3B4YA 3EWXA 1FVPA 3RU8X 3STCA 1RBOB 4KFPA 1KLZA 2WQPA 1W5QA 2ACQA 4YCPA 2CZDA 3MTWA 1OFPA 3C0QA 3DHPA 3ITOA 5GJPA 4XSMA 7XIMA 4LS2A 3QTGA 1TFVA 4O1BA 3AIBA 2HK0A 4X0NA 4ERIA 2DQXA 2XGIA 2A0NA 5CPNA 4DB7A 4IX0A 1X98A 3UR2A 4B5VA 5D9PA 4IXXA 4QJ5B 3BLLA 5DCDA 4WOZA 3RX3A 2PTZA 2PRHA 3TYAA 4K8HA 5FJOA 2FPTA 4JFWA 2BHUA 4W8LA 4US6A 1X38A 1KBLA 2X0HA 5AZ1A 3S2NA 5I00A 1A3XA 1EC9A 2OB3A 4MTVA 1A3WA 1JUEA 2CU0A 3DGBA 3Q4DA 4IF2A 1VFLA 3AO0A 4XBKA 1OK6A 3HBLA 3K8MA 3RPTA 5LXEA 4JPGA 4LCRA 4KEMA 3RYSA 1QOPA 2CPUA 3PULA 4EF8A 1OX4A 3T2OA 3VDAA 3HPFA 1OYAA 2FPVA 1O12A 1P0BA 4WQ6A 4DO4A 3FK4A 3EPMA 1IIGA 4DBWA 3P82A 4AISA 3N12A 3GW0A 4GA8A 1W9UA 4NNBA 1TG7A 4GRSA 2WMIB 5EFFA 1OJXA 3G1YA 2X0YA 1Q2SA 1EOMA 1PL9A 4NJIA 1SW3A 2I5IA 3F5LA 1M1BA 1AL8A 4XKYA 4BQ3A 2Z7KA 1R7AA 1QNOA 4NQ1A 1GOIA 1B1YA 1KFBA 3W85A 4BCEA 1JAEA 4HK5A 2C18A 1FWFC 4CUCA 3TX9A 3A3XA 3PBUA 2HISA 1HGYA 3SN1A 3PFRA 4IPNB 4BF5A 1ML1A 2FDSA 3DERA 1W56A 1BQGA 1J11A 3VPLA 4DVOA 2Z1KA 4MFEA 3PN8A 2CFFA 4RX0A 1LBFA 3MC5A 2VQUA 4J2MA 3SUTA 1ZZMA 1HIZA 2E8YA 2QHAA 1AZ1A 3VCNA 3AIWA 4JTEA 2YDRA 3AXIA 3L4TA 1V7AA 3H2MA 1RPKA 3KVJA 2PDXA 3VIOA 3DOPA 2FB2A 5D8ZA 5CSRA 5D30A 3W7KA 1FFRA 4DF2A 3RCYA 3GH4A 1FP8A 4ICNA 1E9ZB 4N6FA 1XV8A 2VX5A 3CU2A 4CCCA 2CXEA 3BVJA 2OQLA 1HJQA 5T8GA 5BXSA 3CGTA 3GH7A 3TYCA 4S1FA 1K1DA 4BWLC 1FHVA 1K4HA 5D02A 1FWSA 2G50A 3R89A 4IT1A 3DIPA 1XWYA 2C71A 1LRQA 3GNPA 3NDOA 3QPEA 5BNKA 1XIHA 5G2WA 1UD2A 5C2CA 5I3JA 1JULA 2QV5A 4S3DA 5D9MA 3G8EA 4CCEA 1SFSA 2W6RA 1KR1A 1TREA 4GWEA 4ICMA 1WNOA 1R8LA 5HQLA 4UOJA 2V81A 2F6UA 2BZNA 3BOXA 1XLDA 1EYEA 3TJLA 4D6EA 5LA2A 2P8CA 2XH0A 3BW3A 1ESWA 4HZ7A 2Q3OA 3FSTA 3ANVA 1ZJHA 1TIWA 3W27A 1G0CA 1S3HA 5AVNA 5AC7A 3MYPA 3T05A 5EY5A 2JALA 2QCEA 1PDYA 3L4WA 1YIXA 6ALDA 3ABXA 4HHMA 3BV4A 4J3TA 3VIMA 2VZUA 3E1F1 4EACA 4DN1A 1VEOA 1XIFA 1XLIA 2WO5A 4GJIA 3AXXA 5LHFA 3JU2A 2ZBTA 3CZGA 3VOIA 3TLQA 3HPSA 3EWWA 5A69A 4Y7EA 3CAWA 2EPKX 1JDDA 2HVNA 4KEVA 1EKOA 3PUEA 3EWBX 3RJYA 3WQDA 2WJFA 2WC7A 2QJNA 2VZOA 3C2RA 1J4EA 4PCTA 4ERGA 5A94A 3GUGA 2XU2A 3MO4A 4EWND 2UY2A 4RKAA 2IKJA 2VHLA 4EKJA 3LBOA 3W82A 4YTUA 4C6KA 3BICA 3ITGA 3WJSA 1RBLA 4HZ8A 2E6AA 4FF5A 1LDCA 4DNHA 1FRBA 3NSNA 3NQ6A 4O0QA 2NXHA 2YPIA 3LV5A 2PFHA 3U9IA 2GK1B 4UBPC 5CAHA 2QF8A 1GKQA 4ZGYA 4MLRA 2D23A 1SSDA 4ACYA 2ZUNA 5G2HA 4IMAA 3ZT7A 3LCLA 1XYCA 1A5LC 4WGHA 2FVKA 3LY0A 1DIKA 4H9YA 4MPKA 2O92A 3RO8A 2DZTA 4OUEA 3LV6A 1VAHA 3GG1A 1TYGA 2R24A 4HNUA 1QR7A 5RUBA 2R1PA 1H49A 3W1RA 4GMEA 1MW2A 4P8XA 3OZMA 4BS0A 3HGOA 1ECQA 1EO5A 3PPHA 1HXJA 4GINA 2QEZA 1DIOA 7PTDA 1L6GA 4B9ZA 4BQ5A 3I6RA 1MEIA 1PV8A 3GDMA 4LUSB 1OD0A 2DZBA 2Z7GA 5EBUA 1GVRA 5DCEA 2YA0A 1NDVA 3NDZA 3USBA 5J5RA 3VNMA 1KXVA 5BZAA 4GI6A 2V2CA 3LX9A 4LUTB 3WQ5A 4NZ4A 2CKSA 5LIYX 3AIVA 3W38A 1MRAA 2V8ZA 3GWQA 2EG8A 2FZBA 3L21A 3PBGA 4KWSA 1KFWA 2IQ0A 1EIBA 4HB7A 2DIJA 2PC4A 1E51A 1TPWA 1DE6A 3A6OA 4RDYA 4NNCA 5ABFB 2CERA 2YOCA 1KCLA 4GVHA 2AQVA 1EO7A 2V3FA 3HZ3A 5CC6A 3ZFHA 2VEFA 2F84A 4I9JA 1OG6A 3O15A 2BY3A 3SI9A 4MJZA 3ONCA 3VFCA 3ANYA 3M16A 4PEEA 2HWGA 1RY8A 4QAWA 3BGGA 3MKVA 3BW4A 3GH5A 3LCIA 3URBA 4MWAC 1ZLPA 4GUGA 3H7VA 1G4TA 1JXJA 2XZ7A 2DH3A 3V5OA 1DJZA 3LXAA 1T5AA 3EX1A 3AIQA 4E2OA 1E40A 4X60A 1PZ1A 2YXOA 1QNVA 3MMUA 1YEYA 3MUAA 1GPWA 3CXOA 1TV2A 3CPRA 2WMFA 3GW3A 3R10A 4BF7A 3LMYA 1ITCA 3AQUA 4XWUA 2WMIA 3OIHA 3ABRA 1KGWA 2VMFA 3HMCA 1SFTA 4DWSD 3KBSA 4J3XA 2VR2A 1EF2A 3NQAA 3RLGA 3SCNA 3TYBA 3PUGA 3FAWA 5I02A 2WSQA 3NYDA 3A21A 3AU2A 4E2BA 1PWMA 1V93A 2V69A 4GCAA 3GZAA 1TPH1 2I17A 2IXVA 2YDAA 2ZRUA 1RZMA 4ZTYA 1IXNA 4ATDA 1YRRA 1LWIA 3QMTA 4KEUA 3ZYZA 3VD3A 5G1TA 4NI3A 2B7NA 1KRAC 3GXFA 3WF1A 5KEZA 4IUOA 2BV9A 4QQ3A 4F66A 2FIQA 3QRHA 4MG4A 1XS2A 1OD8A 1DWIM 3SGZA 2VEPA 4RR4A 3R7MA 1LBMA 4PUKA 1H50A 1REQA 1BKSA 2ACSA 3EB3A 3DH7A 3W2KA 3AXHA 3IJ7A 4K1GA 4Q4QA 1FDJA 4JEQA 4B3KA 4Z1AA 2DDXA 2EXOA 5HNRA 3W1NA 3R5EA 5HQMA 5IDZA 4H6QA 4LOCA 3ZVHA 3EXRA 2I57A 2VDGA 1Z44A 4B15A 1EEPA 3P2VA 4JTFA 3RGTA 3MSDA 1N8FA 3WBYA 3TLLA 3UXIA 5AFDA 5BXRA 4W7WA 1ZCCA 2YCJA 3R25A 3TDFA 4LBRA 3ZOAA 4CQ9A 1XLFA 2I7GA 2GUYA 2O0TA 3PTMA 4PULA 3GG8A 1DXEA 4LYPA 3VIFA 4HYRA 5E0FA 1XBXA 3G2GA 3O16A 2EHHA 4MY9A 4WEVX 4N9BA 3TNOA 4H19A 3S47A 3GVQA 4LB4A 1YPIA 3T78A 1ZBKA 1P6CA 1S39A 5EU9A 1M5WA 3W9ZA 4DNMA 4R9XA 1GYNA 4HNTA 5CAKA 2NXIA 3NZPA 2PDMA 3S5YA 5C6MA 1KFEA 1O5KA 3FOKA 2Y7GA 3NO5A 1EJ7L 4ZFMA 2QCDB 1R7OA 4P7RA 3KRBA 5M1TA 3WUBA 1EDGA 1RJRA 5HATA 3W7CA 1QNQA 4U10A 4Q8WA 1XPGA 5TNVA 3WEMA 4HA3A 1TVNA 4ACZB 1HJXA 3JR2A 5HWMA 4N2YA 3VZXA 2W79A 3WNOA 1LWHA 1J0ZA 1R9ZA 3MUZ1 5I09A 1UZ1A 1S46A 3NJ3A 4JOMA 4MLJA 2VVNA 2A1YA 4R3UA 1W9VA 1EPVA 1TPC1 2E77A 2BBFA 4KFOA 5LSMA 2INFA 3NPUA 6XIAA 3GTIA 1XLCA 4AHQA 4UB9A 5I5RA 6TIMA 4YYFA 4LXFA 1H1YA 3ME3A 3UNDA 3PNUA 3UG3A 1L8PA 1WP6A 4FXSA 4J3UA 3TV8A 1XCXA 1ICPA 1QOXA 1WKEA 1XUUA 4OECA 2PWEA 3GVRA 3PJTA 3LCGA 4GI9A 3MMWA 1NM9A 4FMVA 3RIKA 1HN1A 4MUPA 3AHYA 2PLJA 1KFCA 4LUSA 3XISA 1UZDA 1CYGA 1ZAJA 4CGTA 5BRBA 3H4WA 1WQ5A 2E6DA 1KW1A 2KZHA 4UTWC 3RU6A 1CECA 1W1YA 3QZEA 2NQHA 4YPJA 4AWSA 1HX0A 3EKZA 4JCLA 3ORWA 1UA3A 1UJPA 1NJJA 4JIQA 3TOPA 1XIIA 5T26A 2PGRA 1CIUA 1BGGA 3FYOA 2PLKA 3CLMA 4C91A 2OGJA 4IIFA 3KOYA 1Z48A 3EAUA 3A4XA 2CHOA 4WJEA 1QHPA 4RZ6A 5BWFA 3WF3A 3VIPA 3EEGA 3R8GA 2J74A 3WIJA 3VCRA 2PRMA 1UZHA 3OJGA 3U5UA 2PODA 5HMEA 4B3ZA 3QM3A 3Q58A 3NQDA 2ISVA 1P1MA 2YZRA 3M64A 3FYPA 1BG4A 1UP3A 4Y6GA 3F4NA 1XRTA 1RJPA 2D2HA 1K3UA 3DAQA 1JL8A 4HSHA 2X7VA 1GZGA 4ZQNA 5FAJA 1JCMP 2XSXA 2NV1A 1DYSA 3AS1A 2A7RA 2D0FA 3A13A 2ACUA 2ZDRA 4ZMGA 5C7VA 1V0MA 2PDNA 2F38A 4LJ3A 3HJZA 4HJFA 1TRIA 5IBXA 3JVAA 2PF0A 3NSMA 4ROQA 5G2IA 3B8TA 4OHQA 1ALDA 3GTHA 2ACRA 3L4VA 1QPNA 3VU2A 1PWLA 4XSLA 2CLKA 3BZJA