2E6AA

Crystal structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with orotate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
312
structure length
312
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with orotate
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase
total genus 106
structure length 312
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2006-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 2e6aA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2e6aA01
2CU0A 1GVOA 3CIWA 4O1CA 2QCEA 3DXIA 4AB4A 1YLVA 4LOCA 4WY0B 4LS1A 3R5EA 3UXDA 4Z0JA 1JRCA 1A5AA 2AGKA 3HG4A 2ABAA 3GNDA 3BGGA 1B57A 2R8WA 5CPLA 2BZNA 1XBVA 3E49A 3SI9A 3IEBA 1SW3A 3W2NA 2ATMA 5CSSA 5H2ZA 4PL1A 2R94A 4AHQA 3W1AA 1F76A 3F4WA 3TUUA 5D30A 1AK5A 3BARA 4RR4A 5KZDA 3G1SA 1AW2A 1JCMP 4X2RA 5CKSA 5CSRA 3MP3A 1K8XA 2CLHA 5HR6A 3TQ0A 4ADUA 5F4XA 5U4NA 4N4PA 5H91A 1K7FA 4JDBA 4DPPA 4FXRA 3STGA 1D3HA 4O10A 2GOUA 3THAA 4U4MA 1THFD 1ZAHA 4LW7A 3LHTA 1YDNA 3G1HA 1IXPA 5FESA 5E93A 1W3TA 1XKYA 5DXYA 3CU2A 2R14A 2A4AA 2PE4A 2CZEA 2BX7A 3NA8A 1JCLA 1J2WA 1BKSA 3GXPA 2CLOA 1HG3A 4O4WA 1VS1A 3O07A 4FNUA 2H3BA 1EB3A 2QUTA 2Q8ZA 1MEWA 4K7VA 4OT7A 3S9YA 1H7WA 4QISA 2CLFA 1JQVA 4RZ6A 2EAWA 3W7LA 5EMUA 1PHQA 5T26A 1LRQA 4EF9A 3IVSA 2GQ8A 1LYXA 5AHLA 1BWLA 2GJLA 3NPVA 1SO6A 2FPVA 1Q45A 4Y9AA 4YL2A 2NUXA 1LZOA 1KFBA 3GK0A 1KTBA 4PTNA 1HTIA 4KKXA 2EF9A 3B4UA 1ZJIA 1SPQA 4IXXA 4JTEA 3ANYA 1SQ7A 2YSWA 4JICA 3SZ8A 1VZWA 3JS3A 4O16A 4PL2A 5HMSA 3ELFA 3W1MA 3QW4B 3G1FA 3OHIA 3SR7A 1VPXA 4TIMA 4JY8A 3S8HA 4AF0A 2ZYFA 4M7SA 5K3VA 4JS3A 3HF3A 1H1ZA 4QQ3A 1AG1O 1G4TA 2R91A 3GNNA 3B0VC 2Y61A 1EWDA 4UTHA 2FB2A 1A50A 1KM1A 3EWBX 2XN2A 3TW6A 4BWLC 4JXCA 4R7JA 1GVRA 5I3JA 2NV1A 3NG3A 4LVGA 3TKFA 3O16A 3NPWA 1QWGA 4MY8A 4K7YA 3OEXA 2VFFA 1TPFA 1OK6A 3S6DA 1PHWA 1JVNA 5KTLA 1KBJA 3LCIA 3TA6A 1LRNA 3U6WA 2HMCA 2YYUA 3TAOA 3H54A 3EB2A 3W7PA 1SR9A 4A29A 4LNYA 4NXSA 3AO0A 3TC7A 1W5PA 3W7OA 1GVFA 1IF2A 4FX7A 1WBJA 3UZ5A 3LXAA 1TV7A 2J9YA 4N9DA 1NVMA 2EGZA 3IRDA 3QMTA 4Y96A 3CT7A 1ADOA 5DCDA 5K2ZA 1QPRA 3KAOA 5D03A 5BOOA 3HPSA 3DAQA 4WOZA 5J5RA 1OFPA 3F4NA 3QSTA 4Z08A 5E1QA 2WO5A 5KINA 1ZY9A 4LUJA 1P5BA 3OVPA 4XZ9A 4LU0A 1OABA 4XKYA 5D2VA 2VFHA 4EF8A 3LHZA 4C1LA 1TJRA 2FPTA 2J9ZA 1L2UA 5D37A 4HSOA 4OV9A 5HULA 1VHCA 4CLMA 1TV5A 2EKCA 4ALDA 3MP4A 4LV9A 1T0OA 1C8VA 4IXHA 1KM4A 1F7BA 5D2YA 3LCXA 1DJNA 4AWSA 1GJPA 4MPQA 3NPUA 2DP3A 3B8DA 1JUEA 3T7VA 1G6CA 3SFKA 3ATZA 2JKEA 3W74A 1JQXA 1W8SA 1PL9A 3NM1A 4AWUA 4BWLA 2WNZA 1LRTA 2PURA 3LV6A 4JGDA 2FJKA 2W79A 3HGRA 4JTSA 4GFSA 3T44A 4JTIA 3M5VA 4O17A 2ZRZA 4NNBA 5AFDA 3LX9A 3R13A 1EIXA 2TRSA 5LKYA 4Q32A 4JTFA 4QNEA 1UUOA 2P10A 2DZVA 5C2XA 1KM0A 3NQVA 2J9XA 5AN7A 3EWWA 4UCGA 3RNDA 3G24A 3EWXA 5ABTA 1VHNA 3RFAA 1TIMA 2CZDA 5AC7A 1EUAA 3TW7A 1I2OA 3VCRA 2NX9A 3G0SA 5HUPA 3JR2A 1H51A 2WKJA 3PBYA 3P7YA 1NF0A 3IIZA 1TTIA 5D05A 1GVQA 3LHUA 3TFCA 1ZHAA 3N73A 1GVSA 1F73A 5G4EA 1G7UA 2RDWA 3LOTA 1O5XA 3FKRA 5EKYA 1QPNA 3M16A 3CM4A 3ZS4A 5BRBA 4ZZ9A 4HNVA 2H8XA 1I2NA 1OX4A 5KZEA 3GVGA 2A5HA 5I3HA 1RQBA 1EP2A 2OT1A 8TIMA 4JIQA 2OJPA 3QFEA 4HNUA 4PH6A 1DJQA 4TX9A 3E9AA 3W71A 1JJKA 1KFKA 3MP5A 4IMDA 3B0UX 4IWWA 1TTQA 3NZ1A 3C61A 3TSDA 2ZDRA 3LCGA 5G2IA 2B4GA 4M6QA 3IVUA 1VCVA 3IIVA 3O06A 1FDZA 4RZ4A 4MLRA 3MJYA 1VRDA 2DZPA 4ONVA 3TQVA 2A0NA 4E2BA 4JD4A 4MLJA 3KVMA 3BO9A 2NZLA 1W37A 3E02A 3OVRA 5FF4A 2TPSA 2Y62A 4IX2A 1RQEA 5J5DA 1T8XA 2AQWA 1P1XA 1QNVA 3KFTA 4DF1A 1FXQA 1UJPA 3L0KA 5AHEA 2QCHA 1P0NA 3FJLA 4RV8A 1G4EA 1OFDA 1JUKA 2V30A 4RX0A 4HNTA 3QC3A 4WXZA 4JY9A 5EL1A 1XDMA 4IMGA 1H60A 4ZMGA 1BWKA 2NX3A 4RK8A 3NAVA 2QCCA 3EEGA 4J9JA 4I9AA 5D32A 2J24A 1ALDA 4LV4A 3NGJA 1T96A 4MY1A 4TO8A 5FF7A 3G0UA 2VC6A 1OK4A 2V5BA 3IGSA 1H50A 5CPNA 2O7SA 4MVAA 3NDOA 2A7NA 2ZRVA 1IXQA 4ADTA 3N9SA 2B7OA 3QH2A 3DHFA 1TSIA 3SW6A 2QAPA 1DVJA 4UTWA 5BNKA 2ZZ6A 3GKAA 4JIPA 4OHQA 4HPXA 3KRZA 3NNTA 3A22A 3GR8A 1GPWA 4UTUA 3NYZA 5I3FA 3HBLA 3EX4A 4NJHA 1L9WA 1PV8A 2GUUA 1BTMA 3M44A 4LS0A 4AF0B 4N2YA 3LGEA 3M5ZA 4NJGA 2V81A 4K39A 3V75A 2HS6A 3W7MA 1EX5A 3QPZA 4JTHA 4LVDA 2ISWA 2ATSA 3WJYA 3W1NA 1D9EA 4O11A 4XUGA 4X3ZA 1MZHA 1HO1A 1KLYA 2C18A 3C8FA 5AOUA 3EWUA 1I45A 3TXVA 1G4SA 2VFIA 4AXKA 2ZRXA 4CQAA 1P0KA 5F2IA 3FJ6A 1SW7A 2X30A 2Y6ZA 1WDWA 2E1DA 1VYPX 3RF9A 1HUVA 3T4CA 4A3UA 3W7JA 2VFEA 4N6EA 2A6LA 1M7PA 3PR2A 2B7PA 3G1AA 1G67A 3C2RA 3O8AA 1VLIA 3LRMA 3W3OA 1TPB1 1N8FA 1AW5A 1XFBA 1FY6A 2C0AA 2ZTKA 3ABRA 3FFSA 1FCVA 2GJNA 2NX1A 2TMDA 2YZRA 2DJXA 3L21A 3A24A 3GDRA 1IXOA 5FI8A 1OYBA 2PRLA 3WK0A 4IJBA 1RQHA 3QW3A 2J6XA 3NQ7A 4HNNA 5AHFA 4Z0SA 3QRHA 1Q3NA 4DBEA 1ML1A 3G1YA 4NNCA 4M6PA 1LOSA 1SZNA 4N9EA 4K8EA 2E6YA 2CZFA 3OVQA 4MKNA 3FYPA 3LCWA 3E0IA 3BV4A 1NF7A 3MHGA 4CQ9A 1OFBA 3QEZA 2QAFA 2VFGA 1N7KA 1GG0A 2NV2A 2QKFA 3W70A 1KFCA 2QCLA 4OE7A 2FIQA 2X2GA 1R46A 1SO4A 2NXIA 3KXQA 2V5LA 1O94A 3LTYA 3TIMA 4OBTA 4XBSA 3QSRA 3YPIA 3A9IA 3LHWA 4R34A 3W86A 3CPRA 4UMCA 1KA9F 1RVGA 3GAKA 4LUIA 3T55A 5AHNA 2BSLA 4H3DA 3UPBA 2ZA1A 1EP1A 4AMAA 5F4SA 2GQAA 1SSDA 2V2HA 1VCGA 3CC1A 4AVFA 1F6KA 3SGZA 4CCCA 1F05A 1TTJA 3DGRA 4BR1A 3BW2A 3FIGA 1W5QA 5DN1A 3QPYA 5I3KA 3DKJA 3BGJA 4UUIA 3TCEA 5TBOA 1IXNA 4A2SA 3LRKA 3SY5A 3DZ1A 5HINA 3A5FA 1A5BA 1OYAA 3W9ZA 1YTDA 1K7XA 4EWND 2ZZ5A 4GWEA 4FNPA 1B4KA 2C6QA 3L0GA 3IIXA 3DFPA 1TB3A 1QFEA 1Z42A 4K38A 5G1TA 2ZZ2A 1TREA 4O14A 2ALDA 4UNKA 5FEZA 5AHMA 1FUYA 1K8ZA 3DFOA 1LCOA 4FEZA 3NL3A 3L65A 3TSMA 3W1TA 1YDVA 1L6YA 4DXVA 1S5VA 3NM3A 6TIMA 1FCBA 1ICQA 3KVLA 5BMXA 1XUUA 3NQCA 1OYCA 4C1KA 5AYXA 1PIIA 3G18A 5D33A 4UFJA 3W7EA 2X1TA 4I7VA 3W7QA 3EX3A 1TYGA 4GRSA 1U83A 1W3IA 2OCZA 3PG8A 3W83A 2ZTJA 5FEWA 4M6VA 1D3GA 2PC4A 5IM51 4NJIA 3P5YA 3WK1A 1GOXA 3C2VA 1OFEA 1FDYA 4BF9A 2WJZA 3RU6A 1TPUA 2Y7DA 4FNRA 4IPIA 3PBWA 4HSNA 3NQDA 3GDMA 4E2DA 3O6CA 5E0KA 4OQVA 2Y88A 3O6DA 4N4QA 4TU1A 1UB3A 3CTLA 1OG0A 5KMYA 3ZWSA 1CW2A 1F2JA 3W72A 3W7CA 1GEQA 2H6RA 5HNRA 3W7KA 2F84A 4AHOA 4QM1A 3WJSA 1SO5A 3G1DA 3P62A 1OX5A 1ZENA 2D73A 1YTEA 4Y8FA 1SW0A 2C1HA 2Q3RA 3S1XA 2DU2A 1VYSX 3GYEA 2WPBA 3NQ8A 2VEMA 1XBYA 2V82A 1EUNA 4UTTA 3S5ZA 4GC4A 2TYSA 5AC6A 2ZCGA 3BW4A 4LC6A 2C15A 1R2TA 2RDTA 1XUZA 5F1UA 3UPWA 1OHLA 1UUMA 4WJEA 3RMJA 1W5NA 3NOEA 4UIOA 4U28A 4JX5A 2VENA 4O53A 3IV3A 5GVJA 2DJLA 1VJIA 1W54A 1XCFA 4Q4KA 1FWSA 2A1YA 3B06A 5FF2A 3C52A 2NWSA 4L4MA 4Z1AA 3MMTA 3EX1A 2NXHA 2HSAA 2Y85A 4JTTA 4MZ1A 1DV7A 3GXTA 4N9BA 4Z1BA 1CX9A 5FF3A 3L66A 3W7DA 3CIXA 1X7FA 4H6KA 2ABBA 1B9BA 4ZQPA 4DELA 3T78A 4UFKA 1H7OA 2DZTA 1KFEA 4FNSA 2YXGA 3EX6A 3KVJA 1LROA 3STCA 4X22A 4N6FA 3OA3A 5D38A 4NUWA 4NU7A 3P67A 4N9CA 1ZNNA 4BK9A 5I3IA 4HPJA 3LI0A 3VE7A 3NVTA 3P74A 3RK8A 2EHHA 4ZQCA 3NEVA 1H7RA 2E77A 3TU9A 1OX4B 3IIOA 1OX6A 4IQLA 4UR7A 1FBAA 5LNWA 3GDTA 4PA8A 2YYTA 4O52A 3A21A 4LVBA 3LDVA 1XDLA 3HPZA 1DORA 4IGHA 3GDLA 3G3DA 1FWWA 2GQ9A 1RD5A 6ALDA 1NSJA 2C14A 1WA3A 3S1WA 1GQNA 1H5YA 3G1VA 1W1ZA 2P0OA 4YCPA 5DLCA 3LTPA 4E0CA 2V2CA 1DBTA 3OBKA 1GWJA 3PUDA 4NNAA 1WAUA 1FX6A 1KV8A 2X1SA 5DELA 5L6UA 4UMAA 3W7GA 1XI3A 3NPXA 1W3NA 2Y63A 3TROA 5K7JA 5LGZA 1H63A 2E6FA 1UBSA 2XFWA 3SSJA 3Q37A 3WJWA 4FX6M 3W75A 2BXVA 3W7RA 3EWZA 5DY2A 5A5WA 3LLFA 4QSHA 1TJPA 2QDHA 4MY9A 3S0CA 1YPIA 1K7EA 4UTMA 2QCDB 2WQPA 3M9YA 3EKZA 4Y6GA 1ZCOA 4RXGA 5HQEA 3R12A 3MBDA 1TRDA 4MFDA 2WSQA 4H4IA 1G69A 1SFJA 3MYOA 3UQNA 3TC6A 3QJAA 1F6PA 2CLLA 4MJZA 5CG7A 2VEPA 2A7PA 4LVAA 4XTDA 3TFXA 4A21A 4KWWA 3CHVA 4BI5A 2IQTA 2B7QA 3HO8A 3QQ1A 4Q33A 1ZAIA 2C13A 1X1OA 2CZ5A 1WXJA 1KM5A 1K03A 4N02A 1S3HA 1BEUA 5LHFA 4NXKA 1ICPA 4UNLA 3G0XA 3TAKA 2G95A 3UXAA 2ZQ0A 4UFLA 3GAYA 3C2OA 1QCWA 3O6YX 5L9FA 1G4PA 1S5TA 4M19A 2I9EA 1FCUA 1EA0A 2WV8A 3RLVA 1XBZA 5D02A 4XKYB 4UR8A 5HWJA 3HG5A 4XQ6A 5AYYA 4MZ8A 3DBPA 1FDJA 5G2HA 1JCNA 3S1VA 3EXSA 3CLMA 1JR1A 1H7NA 1ZAJA 5K9XA 4LY8A 3W88A 3I65A 4O12A 1HO4A 3W2JA 3W2LA 4K8HA 3N2MA 5EA9A 2ZZ3A 2ZA2A 4AAJA 3LB0A 2QCNA 5EYWA 3N2XA 3N14A 3UWWA 3I7QA 4ORIA 2YPIA 3MHFA 1O4UA 1A53A 3ABQA 3R8RA 1WOBA 1M6JA 1TCDA 1JCJA 4MYAA 4NVTA 5KZMA 3W76A 5LNVA 4NQ1A 3FEMA 1K3UA 3EX2A 3THQA 3D0CA 3INPA 4K37A 1T99A 3WJZA 5CPMA 3IGUA 3BG9A 3LCHA 1EPXA 4NJKA 3F1QA 4GUFA 1AL7A 2OZ0A 4RLIA 2QEZA 4L4LA 2H3DA 2DZUA 3S42A 4TMBA 2NXGA 2FQIA 1GT8A 3M47A 4M5PA 4QITA 3UWQA 3GIYA 3UY7A 5FEXA 1TPVA 3TR2A 3NQ2A 4DO6A 4UTJA 1RV8A 1V5XA 1JCXA 1ME9A 2ZFAA 3SJ3A 4FO4A 2ISVA 1UASA 3G3MA 3LV5A 4JX4A 1I8JA 3WJXA 1NAL1 1QAPA 2DZWA 2Q8LA 3SGUA 2OX1A 2V8ZA 5C5YA 1O95A 1IIHA 4MFEA 5AB3A 2FTPA 1VC4A 5KSWA 3B0PA 3DI0A 4WZHA 1R47A 3PY2A 3L5AA 2QJGA 3FOKA 4P61A 3VFLA 2H90A 4WOQA 4CCEA 1XL9A 4UTKA 3CEPA 1HFBA 2NLIA 1WYIA 3KOFA 2Z0IA 4NX0A 3ZFHA 1DHPA 3NQMA 1TQXA 3NQGA 4RCXA 3G8EA 3TSBA 4W9TA 4FNTA 2NWRA 1LLWA 3DENA 3S5YA 3UWYA 2QUUA 3NR0A 4HN4A 1P4CA 4UMBA 7TIMA 1LBMA 4DPQA 3MI2A 3M1ZA 3KVKA 5DCEA 4XWUA 5DY3A 3G1XA 3DU0A 1M5WA 3Q94A 4ZL1A 1GYLA 4LC8A 1SO3A 2QCFA 4ICNA 3R2GA 1KFJA 3M43A 4TR9A 5DCBA 4S2CA 2Y7GA 2E6AA 5IBXA 2F7FA 3L9CA 4LT9A 1PCKA 1Z48A 4MJMA 3G22A 1LLZA 2G5WA 4EVZA 5K4XA 1AW1A 3FLUA 2VEIA 1SZGA 3P8IA 1FWRA 2G96A 3W7IA 2WNNA 3C6CA 4CNNA 3DFTA 1FWNA 4HIBA 4UFIA 3W7HA 3MO7A 5DXXA 3W2KA 3W1PA 3HPXA 1MSSA 3B03A 1C29A 1FQ0A 1YXDA 2VFDA 4OU1A 3CWOX 3W2MA 4LRSA 1TPEA 4FNQA 3P80A 3GB6A 1SSGA 2OMAA 2RFGA 1NEYA 3C2EA 4IUOA 1QMLA 3S1UA 1WQ5A 3USBA 1TMHA 1C9DA 1K8YA 3UWZA 3VNDA 2J88A 3NQEA 2VOMA 3KRSA 2A2IA 3QYQA 2V2DA 3DI1A 4NZFA 4GJ1A 2QDGA 3BLIA 5LNRA 3QM3A 4DO5A 3MYPA 1QO2A 2V9DA 3DHDA 3QF0A 1Y0EA 3NQ6A 1DQWA 2E5BA 5EBUA 3WFAA 3LCFA 3MW7A 4G1KA 1WOAA 3FKKA 2VKZG 5DBUA 2TSYA 1J5TA 4JX6A 1TV8A 2HTMA 3BW3A 5BW6A 3N9RA 3I6RA 3UZJA 4B5NA 3EKLA 1KM6A 3KX6A 4EOUA 3TMLA 4UFMA 5K9CA 1R2SA 1LBLA 1KTNA 1LTDA 4FX8A 1VYRA 3DKLA 4MZYA 3P81A 1X1ZA 4LVFA 1OF8A 2A21A 2ZA3A 2P1FA 3GR7A 4Z1DA 2CWNA 4IOTA 3NXFA 4MIMA 2C3ZA 3STFA 1YYAA 5FF0A 5F2GA 2Z6JA 4CNPA 1QO5A 1KM3A 2FDSA 2LLEA 2CLIA 3PB0A 3CWNA 3LBMA 2QCDA 3ZWTA 3M41A 3HQ1A 1PVNA 3EWYA 3A5VA 3TMQA 3PC0A 2OT0A 2Y7FA 3STEA 3P8JA 2ISSA 5D09A 4I7UA 3BG5A 1L6WA 4NJJA 1V7YA 5CPOA 5HUOA 2I1OA 1J4EA 3MWAA 3S5OA 1KM2A 1W5OA 1Z41A 1WX0A 2DZXA 1EP3A 2AAMA 1QOQA 3WK3A 4GUHA 4ZQRA 4JEQA 1OFOA 5EY5A 3P61A 4O1AA 4QJ1A 5BMWA 1ZALA 3ZR4A 3W1LA 4BFAA 1YTKA 4D2JA 2CW6A 1SUXA 1FXPA 4DO4A 1TPDA 4YWIA 3IIPA 3PSWA 2QCMA 5LGXA 5LZLA 3MI6A 1FWTA 3PF3A 2UV8G 4XBKA 5C54A 1LORA 1YDOA 5CZSA 4O57A 1OFAA 3N3MA 4JYEA 4GUGA 1KLZA 1NFBA 1MXSA 4LWWA 3CEUA 5TIMA 5I3GA 4ML9A 4CQ8A 1S5WA 2ZBTA 4I7WA 1HL2A 3GXNA 4O1BA 3W84A 2FPYA 3HIJA 4QNWA 5SWUA 2W0UA 2WNQA 3NL6A 1Z44A 1R30A 4UTLA 3V1PA 2YW3A 1N55A 2A7RA 3L68A 3W07A 4NZJA 1LOLA 3PWAA 2YFOA 1H62A 1SZEA 2PRMA 1VGAA 1OF6A 3W1RA 5HR7A 1VR6A 2RH9A 3VE9A 3UYCA 5K4ZA 3PUEA 3Q58A 4Y90A 3W6YA 4RZ5A 4BI7A 4O54A 1U5JA 3N19B 4GXMA 4PODA 1VH7A 1W31A 3DH7A 3NQFA 2WOQA 2ZZ1A 3U2OA 3UD6A 4OV4A 3T40A 1ICSA 2QF7A 1JULA 1SZFA 4IX0A 3HG3A 3I7SA 3OIXA 1F74A 1QOPA 5LSMA 1WBHA 3K30A 2VXNA 4WY0F 1YXCA 1AL8A 3KHJA 2E5DA 4POCA 3G8RA 1K02A 3DFNA 2JK2A 3HMJG 3FS2A 2A6NA 4PC8A 2Y70A 3UWUA 3LM7A 2RDUA 4PEKA 1XBXA 3L5LA 2YDAA 4OWGA 4JTJA 4QIUA 3W87A 3L0NA 3VI2A 3W73A 2Y7EA 4AWTA 3QMRA 5CZTA 4WQ6A 1KW1A 5A8GA 3LHVA 5D04C 1YPFA 3BVJA 4HHPA 4OGZA 4QAIA 2EPHA 4PCFA 3UY8A 4YCOA 3W1XA 4WUIA 5KITA 3TNOA 4ZVJA 5AHIA 3BPWA 3TH6A 2JGYA 5G4WA 1LM1A 2YR1A 1CI1A 3PBUA 4NT0A 2V0TA 4LRTA 4YLWA 1H7PA 4AHPA 3LBCA 3I68A 2QJHA 5G1YA 1YXYA 1QPOA 5U7SA 1A5SA 1PE1A 3A23A 4K6AA 4JR5A 2CLEA 1DOSA 3DFSA 4DEFA 4UTIA 3TK7A 2JGQA 4FF7A 3LLDA 1X8FA 3NZRA 3RLUA 2E68A 3VKJA 1RPXA 5D2XA 1OFQA 2DORA 2YGYA 3HGOA 2ZZ7A 3QMSA 1H61A 1MEHA 4E38A 3PG9A 5HWMA 4AH7A 2B0MA 5TQLA 4A2RA 4TMCA 2ZRWA 3MHUA 1ZFJA 3C56A 4KWVA 3SECA 2QUVA 2C19A 2FB3A 2JBMA 3P5ZA 4R53A 1I2PA 1F5ZA 4P2VA 5AYZA 3PB2A 3HGJA 1X6UA 4HKPA 1TPH1 1O60A 4AEOA 4MOZA 3GKFA 1QPQA 2X1UA 3C2FA 1KFLA 5D2WA 3C3NA 4ZQOA 4ORMA 3BLEA 4FIRA 3O15A 4JTGA 3AJXA 4K36A 3O1NA 1QDSA 3LCLA 2JKAA 4JYFA 3H55A 1LOQA 4GBUA 1RR2A 1VQTA 4FB7A 5C55A 3PBVA 2E09A 4KFOA 4RXFA 1GZGA 1QR7A 4ZQMA 3LHYA 4WD0A 3R89A 4R33A 4S2BA 3H53A 2PRHA 1LP6A 3C4UA 4IPJA 1W0MA 1W56A 3OG3A 2Q3OA 1TRIA 3I7RA 3TE9A 3P60A 3W22A 2I14A 4DBDA 4CCDA 3EXTA 2WSYA 1KV5A 1RZMA 5F2LA 1GTHA 4IMCA 3Q2DA 2BWGA 3NO5A 2Z1BA 4WX2A 1H1YA 3LRLA 1IGSA 3W23A 4LTSA 2BLEA 2E6DA 4S1FA 1B4EA 3C0JA 3ATYA 3PAJA 3PULA 2XN0A 3B05A 1ME7A 5F2MA 1JUBA 3PM6A 1EEPA 2Y89A 4KFNA 1ONRA 4JNMA 4JDYA 4XTIA 5AC8A 3TJLA 1ME8A 3QZEA 4O0ZA 1W5MA 2X16A 3UWVA 1DQXA 1WV2A 2PCQA 1R2RA 2VEKA 5CZ0A 4GNJA 1XM3A 4WY0A 4LS2A 2KZHA 3P82A 1OJXA 4GUJA 4UXDA 2QJIA 3DFQA 3M6YA 2H8ZA 5MHBA 4O8RA 3O05A 4IMEA 4GE8A 3TX9A 4Z1CA 4PFMA 4KFPA 3PVFA 3HOJA 2QCGA 4FIQA 3LXCA 4O28A 1MEIA 3GX9A 2W6RA 1TO3A 2FFCA 1EWEA 1TPWA 5G2WA 1GYNA 5DBTA 3GLCA 4DQWA 2JKPA 1H7XA 3PUOA 4GUIA 1SFLA 1I2RA 1G7VA 4A22A 3MUXA 3IGXA 3N34A 1JCYA 4RKAA 3O63A 3W1UA 4UTTC 1TPC1 2GVGA 4YMZA 3HB9A 1SU5A 3ABOA 1Q6QA 3LTSA 1LDCA 5HWNA 3GZ3A 1XXXA 3MBFA 4O4VA 4CNOA 3CB8A 4BI6A 4EIVA 3M5YA 2GVJA 1MO0A 1I2QA 3HJZA 5K9DA 1PS9A 2O7QA 4WXYA 3W7NA 3TXZA 2ZZ4A 3FYOA 1LBFA 2J27A 4JN6A 3LXBA 5HJLA 3BLFA 1PCWA 3PS7A 3BK0A 3KRUA 4O1DA 4UTWC 3NQAA 2XN1A 5LNSA 1B3OA 4HT3A 5LNUA 4O19A 3UNDA 2YX0A 3F03K 5D2TA 2VELA 3L67A 3W1QA 3S5NA 2ZRYA 4DF2A 1Q6RA 2QR6A 3FA5A 3L5MA 2RKXA 4JTLA 1O5KA 3B04A 2FLIA 2CLKA 2WSRA 2GPTA 4JYDA 2CFFA 2ZRUA 4M7TA 2RHGA 3M7WA 2BTMA 1E51A 1XC4A 5EPDA 5FEPA 3GDKA 4UC5A 5CZJA 3TDFA 1OVDA 2DZSA 4DF0A 1JRBA 3M5XA 4YXGA 2YW4A 3TV8A 3E12A 2YFNA 1KBIA 4MUZA 3TQKA 3HGSA 3MI3A 4UFHA 3NL2A 4FXSA 1GTEA 1GG1A 4IMFA 1L6SA 5G5IA 3U8GA 4O15A 2HS8A 4RJEA 2E5CA 1KTCA 3TJXA 1UCWA 3M0ZA 5LHEA 1AMKA 3PSVA 1DL3A 3W2UA 3LERA 4NX5A 4O13A 3CQ0A 4O18A 2NUYA 1TTPA 3QQ0A 4O0KA 5C6MA 2NUWA 4MYXA 1FCQA 1DKWA 5IBXC 2X1RA 5F4WA 3JRKA 4JTKA 1TQJA 2B7NA 2YCEA 4FHAA 4X9SA 3W85A 3LI1A 4ZQNA 5F1VA 1YADA 1A5CA 1VLWA 2GVLA 1Q6LA 1M7OA 3NL5A 3E96A 3L2IA 2CLMA 3HG2A 3P84A 3BG3A 3WK2A 3SIZA 4JTUA 3IVTA 2A85A 2Z2UA 1IIGA 1VCFA 4ADSA 5CGQA 1OFRA 3ABSA 3EXRA 1I4NA 2Z6IA 2C16A 1Q6OA 2G97A 4O50A
chains in the Genus database with same CATH superfamily
1GVOA 2X0SA 3ZJ7A 1RK5A 1QI2A 1KR0A 4Z0JA 4GYJA 1LG1A 3F5LA 3WH6A 2R8WA 1YBQB 4JIEA 1XCWA 2BZNA 3MUCA 3M0HA 1SW3A 5CSSA 3RR4A 2R94A 3W1AA 3XINA 5CH9A 3KUMA 1AK5A 4CVWA 3KP1A 1LL6A 1X96A 3OLDA 2QXWA 1P0BA 2ACSA 1XLEA 5CSRA 1FKXA 2CLHA 3N2TA 2BGSA 3SGGA 4ADUA 3LQGA 3ZJKA 3QR0A 2JEQA 4W8AA 2X7VA 1HJXA 4DUXA 3KL5A 4LW7A 1ZAHA 2R24A 1TIWA 1HVXA 4XAFA 1IXPA 4B92A 5FESA 1VJZA 1W3TA 1YBQA 2Y5SA 2R14A 2A4AA 6XIMA 4HU0A 1JCLA 4PMDA 1HG3A 2XVKA 1VEOA 4O4WA 1VS1A 3O07A 4FNUA 1KXVA 1BFNA 1XISA 1J0YA 2DDXA 4M1RA 3EEZA 4IFKA 2PTWA 1KGWA 3SN4A 5AHLA 2GJLA 3W28A 3O0FA 1Q45A 1UWQA 4B90A 2NUXA 1Y5WA 3GK0A 1T40A 4PTNA 1V02A 1EJWC 1WNOA 4WKHA 1GOQA 2DUAA 1ZJIA 1SPQA 1CYGA 4HP5A 1XRSA 3ANYA 1B54A 1SQ7A 1VZWA 4O16A 3G1FA 3SR7A 4ZOCA 1VPXA 4TIMA 1E6ZA 4PRRA 3S8HA 3RM4A 1JZ2A 5K3VA 2YDSA 3QYSA 3DYMA 4QQ3A 2R91A 3REQB 2CZVA 1A50A 3TW6A 1L6FA 4BWLC 2OZTA 5I3JA 2NV1A 3SFWA 3L4VA 1CXLA 4YIWA 2WM1A 4HNOA 3NPWA 2WWCA 1ENUA 3MS8A 1CPUA 3KOWA 3KBMA 1RBAA 2VDHA 4L56A 1XRTA 1FA2A 4DRSA 1JVNA 3WQFA 1GNXA 4IICA 3LCIA 1NDWA 2HMCA 3KTCA 3TAOA 3H54A 3W7PA 4DYEA 1PWLA 4NXSA 5BRPA 4FX7A 4F8XA 3ES7A 3RAOA 1P0EA 1NVMA 2YZ5A 5K2ZA 1F3EA 3GY1A 1HT6A 5BCAA 5JVLA 5J5RA 1QUMA 3GHTA 4MB5A 3SB0A 4XZ9A 5D2VA 1A49A 2EJ1A 3PZ9A 3LHZA 4C1LA 4S3AA 2FPTA 4MAZA 4OV9A 2Z7KA 1OBAA 5HULA 4LYRA 4CLMA 1A5LC 3W82A 4ALDA 2Z26A 4LV9A 1MW1A 3CUFA 1L8NA 4IXHA 4D1JA 2FVMA 1Y5XA 1KWGA 1DJNA 3B8DA 1ELSA 3FSUA 1JUEA 4JTQA 2PGEA 2VL4A 3SFKA 3W74A 1FHDA 1JQXA 5JBFA 1W8SA 1TZ9A 2PURA 1LRTA 4E8GA 3VYLA 2FJKA 3LNMA 1ONEA 3HGRA 4GFSA 4IFOA 1FH8A 3T44A 3SRFA 2XGZA 2GDQA 4DI9A 1H09A 2BB0A 4NNBA 4NRSA 2BODX 2YL6A 1UR0A 4YTQA 4PMVA 3NQVA 4UCGA 4QLLA 3WQ6A 3RNDA 3QLDA 3GVRA 3EWXA 3N1AA 3TW7A 1I2OA 2NX9A 2W9MA 3CZKA 2HK0A 3DUGA 1ZHAA 2GGJA 4IHCA 4KBXA 3J7HA 2G50A 1GVSA 3S9IA 3GTIA 4OKDA 4LXFA 5G4EA 1O1HA 2ZX7A 4XSLA 4AZBA 2GLKA 4L7ZA 3NDYA 3M16A 3DESA 3CM4A 2IXVA 5BRBA 3SSZA 4XZLX 2H8XA 5I3HA 2OT1A 3PJWA 3K8MA 2FVLA 5KZ6A 2A3BA 3E9AA 1YHTA 2WC4A 4JQ3A 1MDRA 4IWWA 3EMZA 5EB8A 1JPHA 4BY3A 5LA0A 4F0KA 4XUYA 2ZDRA 1PPIA 1XKJA 2XIOA 3WQDA 2BS9A 4M6QA 1Q63A 4IPLA 4B5WA 1V6WA 4MLRA 1TVLA 5C9WA 2OXNA 4TUFA 4K2SA 3BOXA 3VGBA 4H8UA 1TE1A 2XIMA 1GQJA 3EB3A 1W37A 3SCRA 3TONA 4DJED 4IX2A 3QQWA 1X6NA 5DRIA 5J5DA 1P1XA 3U5YA 4DF1A 3L0KA 2YCIX 3V0UA 3RRAA 5AHEA 1E0WA 2VUYA 4FLQA 4Q8UA 5BXPA 2QCHA 4RV8A 2OLSA 1UKQA 1TWZA 2YBTA 3VKBA 4BEQA 3QC3A 1DWJM 1XDMA 2D2HA 1VKFA 1IE7C 1H60A 2VP8A 4ZMGA 1BWKA 4RK8A 1UWUA 3ME3A 3EEGA 4J9JA 1FOBA 3UR2A 2UY2A 4I9TA 4MY1A 5FF7A 3WQEA 3APGA 3WBWA 4UBPC 3IGSA 1H50A 1V0LA 2FTWA 4MVAA 5EBAA 4B9ZA 1AH3A 4IIHA 1R85A 4HVXA 3R25A 2OO0A 3SW6A 2QAPA 3MO4A 4JIPA 3OQ8A 2FFIA 3A22A 2WVSA 4W5ZA 2BXZA 5CC6A 4QRNA 5I3FA 3HBLA 4BA0A 4OTKA 3EX4A 4NAEA 1ZUAX 2P50A 4H01A 5C8BB 3F5KA 4O1FA 3VINA 3WDJA 2WAGA 1UC5A 1BGGA 4LS0A 3NYDA 4C6NA 6ENLA 4N2YA 1XRVA 3K4DA 3LGEA 3M5ZA 1BSIA 3QBUA 1EX5A 4JTHA 1BAGA 3WUFA 2ATSA 4RE3A 2VMFA 1L2QA 2XIQA 3KM8A 3T0DA 3VX0A 3L4UA 3TYUA 2VFIA 4AIBA 2ZRXA 4J5NA 5C2CA 4Q22A 2X30A 4NZCA 3R0KA 3NSNA 2GGGA 1Z89A 4YNGA 2B7PA 2BOEX 3VIPA 3O8AA 5A6BA 1N8FA 2J66A 1AW5A 4Y7EA 2C0AA 3ABRA 2J79A 1FCVA 5C9UA 3CQHA 2TMDA 2YZRA 4C1NB 7ENLA 1RLCL 2DJXA 4RPPA 3CXOA 3GDRA 4BCEA 1XLJA 3E0VA 4MNJA 3WLQA 5FI8A 3WK0A 1PUDA 3QW3A 3F2CA 5AYBA 1E4NA 3ITXA 1GZJA 1Q3NA 5REQA 3B8UA 2V3DA 1ML1A 3DG6A 5I77A 4NNCA 2OB3A 4OBRA 3TP4A 4AZCB 1A0DA 2VT0A 3LCWA 3MHGA 4JBRA 1OFBA 3QEZA 2CHNA 1GG0A 4RNHA 2W4XA 1KFCA 1P7TA 2QCLA 1JI2A 2FIQA 2HK1A 1HQTA 5IOBA 3URNA 4DZHA 2O55A 2QNEA 3LTYA 3TIMA 1Q6FA 4XBSA 3VXGA 2WKLA 3W26A 2HISA 4IZGA 3A9IA 1OD0A 4DWDA 3AIEA 1U1UA 3AWOA 1EP1A 3POHA 1K4HA 3VD3A 1KCXA 5AY7A 3ZLHA 1UD5A 3T9PA 4AVFA 1ZJAA 1F6KA 3DGRA 5EMLA 4YTTA 1E1CA 4F3HA 1J12A 2J62A 1PZ0A 3TCEA 5TBOA 1IXNA 1KRAC 2W66A 3SY5A 3S2JA 3GBDA 3WF0A 3GXDA 1WZKA 1M41A 4PMOA 3W9ZA 1YTDA 2XINA 4AY1A 1A80A 4G1NA 2Z28A 3WLSA 4FNPA 1B4KA 2C6QA 3L0GA 3BLOA 5HAOA 2BVDA 1ISWA 4F4RA 5BYWA 1VBGA 5BROA 1K8ZA 3E2VA 3U5UA 3NL3A 4MGGA 3TSMA 3W1TA 3W00A 3H2OA 3NM3A 3URAA 1ICQA 4YYCA 2G3FA 3GTNA 1HL9A 1OYCA 2X40A 3G18A 1DEDA 1RCQA 3HQNA 3UG4A 4FALA 3EX3A 1U83A 3KHDA 1CECA 3I3DA 2D2JA 2WMHA 3ZO9A 1EHAA 3W83A 3V7PA 1W9UA 5FEWA 1TG7A 2ZVIA 5GPRA 1XIFA 3AXMA 2Y7DA 4B5TA 1RXOB 1UPPA 1S2UA 3RM8A 3O6DA 1OG0A 8A3HA 3ZWSA 1CW2A 1CB7B 4MNKA 1GEQA 4AIEA 2F84A 4QM1A 2RJHA 1TV3A 1MW0A 2EPOA 4JQ2A 1O68A 2D73A 5E09A 3KBWA 4FA3A 2VEMA 2V82A 3M0MA 5E5CA 2TYSA 2ZCGA 1S1RA 3S2MA 3UPWA 1OHLA 4D8AA 1ZS2A 1RUSA 1LQ2A 5M03A 1JCTA 3LPGA 1AJ0A 1X98A 1XLGA 4NAFB 4JX5A 4KWUA 7A3HA 1WB0A 3G5EA 1V3IA 4PUJA 3B06A 3ARRA 5FF2A 4PUDA 2WMKA 2PWVA 4L4MA 2DPEA 3EX1A 3DIPA 3PWIA 3H2CA 1RVKA 1PBGA 1CEOA 1REQB 3GBEA 3W7DA 3RCNA 4E2VA 1B9BA 1ONXA 4DELA 3T78A 2FMNA 1H7OA 3COTA 4AZHA 4FNSA 2RUSA 2YXGA 2VDIA 2BGQA 1LROA 3AHXA 1MDLA 3NEHA 2HBVA 3B0YA 3VD9A 4NUWA 3VNLA 3P67A 5A2AA 1W9VA 4HPJA 3GC5A 3P74A 1SGJA 4A3QA 3I4EA 3NEVA 1E1FA 2E77A 4GO8A 1OX4B 1KFWA 4O52A 2PODA 3A21A 2JEPA 3HPZA 2RDXA 4GBDA 2WSPA 3G3DA 1VB9A 4HBKA 1NSJA 2C14A 3PTDA 4CU6A 1E5NA 4ASTA 3G1VA 4ES4A 2P0OA 5IRPA 4YCPA 4KCWA 3LTPA 4E0CA 2POZA 1GWJA 2SFPA 1FX6A 4GG9A 3D3FA 2GOKA 1DJGA 3EDKA 1XI3A 3NPXA 2Y63A 3TROA 5LGZA 3EOOA 1H63A 3ZMRA 1XRFA 1UBSA 1WE5A 2XFWA 5AKQA 2Q02A 3WJWA 4MADA 2BXVA 2Y5JA 5CSUA 4PYSA 1NY1A 4AIOA 2IQDA 3LLFA 4R9XA 4A3RA 1R3YA 4UQCA 1R3SA 4MY9A 1K7EA 2XH4A 3ONCA 2WZTA 4ATDA 3WQVA 1TWWA 3L23A 2BY1A 4MFDA 2GJXA 2WSQA 2ZVRA 3UQNA 1J0IA 1DPMA 1LJYA 2HXTA 4JN7A 2PD9A 1UKTA 4IG2A 3IRSA 3AIBA 5HQMA 4WCJA 2VEPA 4Q8MA 3QV8A 4CNSA 1UR8A 5I3DA 3CHVA 1VFUA 1F4HA 4Q33A 2CLPA 4CU7A 3KE0A 3ITYA 3GXIA 2CZ5A 1RCXB 4N02A 1XLMA 1CXKA 4PTXA 3TN5A 4NXKA 2BVYA 2OU4A 2Z1KA 5CZKA 4TVCA 4H2CA 3U0HA 3RO6A 2Y8KA 1G4PA 2I9EA 3AYVA 1EA0A 2WV8A 2XVGA 3BOLA 4WR3A 4KGJA 3AIUA 4JZ5A 1J01A 1JDDA 3OYXA 4UR8A 3HV8A 4XQ6A 2WC7A 4EPDC 3CWHA 2WWDA 1KC7A 2JALA 4LX4A 3DBPA 2IKJA 5G2HA 3S1VA 1DQUA 2QLYA 3MY9A 3TYCA 2HXUA 5K9XA 2Z27A 3EA3A 4GO9A 3W2LA 4ZOEA 5CGTA 1PIGA 2ZA2A 4P7NA 3NO1A 1E40A 1A53A 1PB0A 5GNZA 3R8RA 5BWAA 2P5NA 4DIAA 4NVTA 5KZMA 3CAKA 5LNVA 3CL8A 3RPTA 3OBEA 4DLMA 2G0WA 2PA6A 3THQA 3D0CA 3RX3A 4K37A 1AQHA 1T99A 3RM9A 1IZJA 1DIOA 3LCHA 1JG9A 1ZU8A 3VDGA 2H3DA 2AQVA 4I5RA 4TMBA 1S1PA 3APYA 4EXAA 1TE6A 3UWQA 1NWTA 3GQYA 4QCFA 3EOLA 1QJWA 5I5RA 4UTJA 1X97A 4FO4A 2ISVA 1UASA 4HN8A 2OLAA 3NVDA 4KWSA 6REQB 3NFUA 1BSLA 3WG6A 4YTSA 1MW2A 2W67A 4AQLA 2DZWA 3CUHA 2Q8LA 3RYSA 1M7JA 1O95A 4DYKA 3RJYA 2FTPA 1VC4A 3PZUA 1NOFA 4US6A 2ZXBA 1R86A 4YHEA 3LMZA 4GZIA 4DHGA 5I79A 3PFMA 2XU2A 3U4AA 5HOSA 1M03A 1P1MA 2ONEA 5CJ5A 5IXEA 3WIJA 4P7OA 4TV5A 1E56A 3VFCA 1CGXA 3LGGA 1C8QA 2AQOA 3T81A 1NOUA 4FNTA 1ZTVA 3DCPA 7PTDA 1WKEA 3S5YA 4L1GA 2IKGA 1WXZA 2AL2B 4RUBA 1P4CA 2J7EA 2QW5A 4GVGA 3KCLA 3LNPA 4HSHA 1LBMA 3GC2A 4DPQA 1K9TA 2CNCA 2DZBA 3G1XA 1GQLA 2JQXA 3WQ8A 1TWIA 1MUMA 4ZOBA 3CH0A 1SO3A 3OW1A 3RRXA 2XVPA 3MKCA 5GNXA 2C0HA 3QY6A 2UBPC 3WDRA 2CPUA 3PTMA 4LT9A 3A12A 4X63A 4MJMA 5K4XA 1P6CA 2A3CA 5HQLA 2VEIA 1QK2A 3W7IA 4UCFA 3EWCA 2X8RA 5TNVA 4ZOAA 3C6CA 2PP3A 3NZPA 4UFIA 3W7HA 4G56A 3DOPA 3B03A 1C29A 4Y9OA 3S3GA 3HURA 4IISA 3OTRA 4FNQA 3GB6A 1NEYA 4IUOA 1QMLA 3CO4A 3W29A 1DWFM 1V0NA 3UWZA 1VFHA 3PZQA 2J88A 3I10A 3DERA 2QDGA 5ABEA 5BOFA 5LNRA 3QM3A 2V9DA 3QF0A 3NQ6A 1DQWA 2E5BA 1KKRA 1WOAA 2VKZG 4IT1A 4S3JA 3ZT7A 4S3DA 4GQRA 3IANA 3UZJA 2VRQA 3EKLA 2CITA 3CZ8A 2QIWA 3KX6A 3TMLA 1LBLA 1LTDA 1EZWA 1I9CB 3WD2A 1U2YA 4FX8A 1OC5A 4HA4A 1K9EA 4MZYA 1X1ZA 3I4KA 2A21A 3GR7A 5HJYA 5I07A 4IOTA 3NXFA 1NQKA 2C3ZA 3STFA 4GYKA 2O92A 4WLCA 1ZPTA 2FDSA 4KT2A 2J8TA 2WMIA 2CLIA 3ONBA 4RDVA 1V79A 3W24A 3ZWTA 5BZAA 1ZSXA 3HQ1A 2REQA 3H6OA 3EPNA 2Y7FA 1MXDA 2ISSA 3GZAA 2XGIA 4AD0A 1L6WA 3LG3A 4G2DA 4NJJA 1GVEA 5CPOA 1J4EA 3S5OA 2G4JA 1W5OA 2WMGA 5FD0A 2AAMA 4JEQA 2DSZA 4PUUA 1OFOA 1MRQA 4JFVA 4QJ1A 1YTKA 4D2JA 1SUXA 1TPDA 4WDXA 2I56A 3GH4A 3WDPP 1H5VA 4EAMA 5ABHA 5A2BA 3AHTA 3THUA 3BJFA 3MI6A 3GH7A 1PZ3A 1EX1A 1P7TB 1GHSA 4XBKA 3R8GA 2Q01A 1LORA 5CZSA 3RILA 2AKZA 3R11A 3N3MA 1X7IA 3CS2A 4PE8A 1NFBA 3USZA 1MXSA 4CQ8A 5FOOA 4I7WA 3S6OA 3O7UA 3HIJA 2OQYA 5SWUA 3VIHA 4LCQA 2W92A 2YW3A 1C9WA 2C71A 3ZSSA 4NZJA 3PWAA 5XINA 1H4PA 1XGDA 3D5HA 1OF6A 1KO0A 4OUIA 2OEJA 3OLGA 1EEXA 2DSUA 2XIIA 3WQPA 4L5ZA 1MWOA 4PODA 3VOJA 1A5KC 1UR9A 1B3WA 1W31A 3OLIA 4NHVA 1VBHA 2ZZ1A 4GPNA 3TWBA 3T40A 2QF7A 1SZFA 1M7XA 1IWAA 1X38A 2ODOA 3I7SA 3ENLA 4GLEA 3GFZA 3OIXA 1DWAM 5LSMA 1WBHA 2QMKA 4PTDA 4MHBA 3QR3A 1AL8A 3BSMA 2VUNA 4POCA 2D22A 3DFNA 3K4AA 3FS2A 1MYRA 2WHMA 3FA4A 4XAGA 3VI2A 4M0XA 4RNIA 2VCCA 3G1RA 2Y7EA 2E25A 4LCSA 3BL3A 3QMRA 1KW1A 4HOZA 4OGZA 3A9BA 4PCFA 3E2SA 4MB1A 4HB7A 4YCOA 1UBPC 4WUIA 5CC7A 3TNOA 1DTNA 3BPWA 3TH6A 2AMGA 3CYVA 4NT0A 3VOCA 4LRTA 3LPFA 1H7PA 5DX7A 1US3A 4C6PA 1XD1A 2BP1A 1TWSA 5U7SA 4D71A 1VBUA 1A5SA 4CEXC 3OB8A 4E6MA 4LF1A 4JR5A 1XIMA 4C65A 2UY5A 4HNCA 3UA4A 4UTIA 1POKA 4FF7A 3VNMA 3HQOA 2X09A 3RHGA 3AXKA 3VKJA 2Q6ZA 1OFQA 3HGOA 5I00A 2ZZ7A 2B31A 2WKGA 4RL3A 2IPGA 5EMKA 2BMBA 1ESWA 4TMCA 2ZRWA 2PC8A 2EPLX 1WDQA 3C56A 3KRBA 4GC3A 2JBMA 3P5ZA 2J7DA 3VTRA 4HZ8A 1J96A 5BRQA 3PB2A 4XV0A 3CGTA 1JYXA 1O60A 3T0TA 4MNLA 4H6RA 4Y9PA 4MOZA 3PZIA 4G7EA 1TVPA 1C93A 1FFRA 2BG5A 3TYDA 1QI0A 5CBBA 5D2WA 3UF9A 3C3NA 3WEZA 2P76A 4FIRA 3ZVHA 3O1NA 4MAVA 4GZEA 3H55A 3IJ6A 1PDZA 5C55A 2XH0A 4RXFA 2E09A 4EAYA 1GZGA 4LEFA 3GRIA 1DHKA 4Y9NA 3R89A 4R33A 3CYJA 4S2BA 3B97A 4U3AA 3AU6A 1BRLB 1UD2A 3C4UA 1GOMA 1W0MA 1W56A 2BHUA 4D6FA 3TW9A 4DBDA 2PSNA 3EXTA 4CCDA 5T91A 1KV5A 5F2LA 4E8DA 3Q2DA 2BWGA 3NO5A 1LQAA 4LTSA 2YDRA 2BLEA 2I9UA 4F0SA 1ZRQA 4S1FA 2WYSA 3RXZA 3PULA 4V27A 5F2MA 1ME7A 3WMSA 4BQ4A 2Y89A 4KFNA 4JNMA 5E0CA 3TJLA 4AD3A 1NDZA 5ENLA 1QBBA 2WC3A 1AH0A 2VEKA 2QGHA 5CZ0A 1J6OA 2KZHA 3P82A 1RBLA 4GUJA 2PF0A 3WL0A 2WHKA 3RPMA 2QJIA 2H9AB 3DFQA 3M6YA 2BOFX 3O05A 4HZ7A 1TELA 3GHRA 4KFPA 4AD2A 2QCGA 4FIQA 3WD4A 1MEIA 2W6RA 3B40A 1HP5A 1Q2RA 5DBTA 3EPMA 1ZP4A 3GLCA 3A4AA 5CBIA 1S5MA 1I1WA 3VNYA 2W61A 3U3HA 1SFLA 5JBEA 1US2A 2FGZA 3EGJA 2J75A 1HXJA 3SDOA 3O63A 1B30A 3QOKA 1K6AA 1AQFA 3OYZA 2GVGA 1SU5A 3STPA 1LDCA 1XXXA 1IWPA 1S2CA 4Y9MA 4D72A 4CNOA 4YVVA 1TWDA 2ACQA 1MO0A 5K9DA 2O7QA 1QT1A 1Q7ZA 3FYOA 3GO2A 4O0QA 4WJXA 4BKNA 1OGSA 4U3CA 3LXBA 1O5QA 1Q7MA 3BLFA 3TC3A 4LGXA 1PCWA 3W0KA 4O1DA 2D24A 3KS6A 3NQAA 4IGSA 1XX1A 4NF7A 7TAAA 5LNSA 1B3OA 5LNUA 3UNDA 1AH4A 2YB1A 3Q45A 3V5OA 4RNFA 2ZUUA 4RW3A 4B5SA 2WVVA 1O5KA 3ZLFA 1JNDA 2I7GA 4S3GA 1PKYA 3GG8A 3M7WA 5EPDA 5CZJA 3PWGA 4DF0A 3Q65A 2YW4A 3TV8A 1H3GA 3TQKA 5HMFA 4PEEA 4FXSA 4DM2A 1GG1A 5G5IA 4PB3A 4O15A 4RJEA 2E5CA 4WDUA 1UCWA 5LHEA 4L1WA 2I57A 3PSVA 1E43A 3LERA 3SCSA 4U33A 3SCWA 2PDKA 3CZEA 2WSKA 4O18A 4NYYA 3CK5A 4O0KA 4MYXA 3GE7A 4LAOA 3WQWA 4FHAA 2AKMA 4ZQNA 5F1VA 1LL4A 3LMYA 3IJQA 4KS0A 3N04A 3UWEA 4DNHA 1UIPA 3HG2A 3P84A 3BG3A 4JTUA 2Z2UA 3WH7A 3IS4A 1V6UA 1VCFA 5CGQA 4GI9A 1DYSA 5RUBA 3EXRA 4J40A 2Z1XA 2NQJA 5KETA 3HPAA 2CU0A 4KMQA 4O1CA 2QCEA 3DXIA 4LOCA 1DE6A 3R0UA 4PB4A 2WVTA 3R5EA 4I3GA 4AU0A 4CQDA 4QHRA 1CENA 3SUWA 3TOPA 2JFEX 3ARSA 3UERA 1RCOB 5CPLA 3E49A 3SI9A 2HJPA 2ATMA 2PLMA 2CIPA 4AHQA 3F4WA 3N4EA 5D30A 4CCZA 2G41A 3G1SA 3M4HA 1AW2A 3PPGA 1JCMP 4J2PA 3WNNA 5CKSA 2YL9A 2AAAA 1K8XA 1GCYA 1XDJA 1B3YA 5HR6A 3SUSA 2XWDA 1RLDA 1E6RA 4N4PA 3CJPA 3H24A 3MUIA 4QG6A 4C7FA 1RBOB 1D3HA 2EXOA 4C6KA 4O10A 2DIJA 1KBBA 3G1HA 1S2AA 1UP0A 1EGMA 1XKYA 3BAWA 1RD6A 2PE4A 5JUVA 1SR0A 3NA8A 5EGRA 4NP7A 1J5SA 4WHBA 2XHYA 4W93A 4AWEA 1M53A 1MEWA 4K7VA 3LN3A 1QHZA 3KBVA 5D4YA 4OBSA 4PMJA 1H11A 2QULA 1PHQA 3UBPC 3I3EA 1LRQA 1E9YB 4PTVA 2GQ8A 3T0BA 1LYXA 2OTDA 4MWAD 2TAAA 1SO6A 4MDPA 1UA3A 4YL2A 5A8PA 1FVPA 1LZOA 5H6HA 3DBNA 3VDHA 1SMDA 1XC6A 1UPMB 3VGDA 4JTEA 2YSWA 3SY8A 2IXUA 4JICA 4Q4SA 4PL2A 2AMXA 5A6LA 5FL0A 3ELFA 3W1MA 3K8LA 3TTYA 1OD8A 3RGTA 3TTSA 2QJJA 5HJXA 1UQYA 2PZ0A 3E0LA 2ZYFA 4GOAA 2XWEA 4PMZA 1X39A 4C6MA 3GNNA 4MJ2A 2Y61A 1M01A 4ZODA 1W1YA 1KM1A 5DMNA 2XN2A 4AW7A 4KW2A 3UPMA 2F2KA 4R7JA 1GVRA 3E2RA 3NG3A 3MUZ1 3TKFA 2HVOA 4KERA 4DNMA 1BVWA 4K7YA 4RE0A 4L4PA 2FDMA 3VNKA 5EFFA 2Z1SA 3U6WA 3LLXA 3ECQA 3SCQA 2WMIB 3TC7A 3EOEA 1W5PA 3W7OA 2HQAA 2JF7A 4NRRA 2PTXA 1L8PA 3BLPX 2J9YA 2PMQA 4P7QA 3UG3A 1E0XA 3GH5A 1QPRA 3KAOA 2ALRA 2XIBA 5BOOA 3HPSA 2VR5A 3N12A 4MTVA 4KH2A 4X2PA 1K77A 5KINA 3S6TA 4UZUA 1MUCA 1P5BA 1OABA 1QK0A 3H2NA 1UD3A 1JYVA 4RW5A 1EGZA 5C9ZA 5D37A 1RPKA 3W37A 4HSOA 4U2ZA 2YOCA 3BCDA 2VZSA 4AY8A 3MP4A 4CNUA 2QHAA 1C8VA 3ITOA 3W38A 1JDCA 1WDPA 5D2YA 3C3UA 3LCXA 4ZO6A 4AWSA 1GJPA 1UP3A 4MPQA 3NPUA 2DP3A 4HPGA 3T7VA 3WQ5A 4X0VA 4AWUA 1MQRA 2WNZA 3RIKA 4CU8A 1A5UA 3VVGA 2W79A 1EJ7L 3WDHA 4P7LA 4EXBA 3THDA 4H9ZA 4F66A 1K4GA 3WENA 4O17A 1EIXA 4Q32A 3EDJA 4JTFA 4QNEA 1KM0A 5AN7A 4KCVA 3GW0A 3BQ5A 3B9OA 3G24A 1VHNA 3MWCA 2YDQA 4CQCA 3W81A 1TIMA 5AC7A 1EUAA 4TVUA 5HUPA 2WKJA 1A0CA 5D9MA 3PBYA 1NF0A 2DH3A 3LHUA 4Y2WA 3WFZA 3WMCA 1A5OC 1G7UA 3MDUA 3H7VA 4BEUA 2WNWA 1FWFC 3FKRA 4W8LA 5G4HC 1NQ6A 1YMYA 1I2NA 1OX4A 1GZ1A 2A5HA 1RQBA 1IEWA 5CCZA 3ANVA 1PTDA 3BXWA 1DJQA 4AISA 3WLHA 4TX9A 2HPMA 1JJKA 3VC6A 3MA8A 4ZGYA 3QFWA 2JIEA 2H9AA 3C61A 3TSDA 4PCPA 2VCAA 4Q8VA 4N7QA 2B4GA 4AZCA 2YKKA 2YA0A 1XIGA 3GTXA 4XZBA 4HCLA 6TAAA 1JYWA 3IIVA 4RZ4A 4ONVA 2P53A 2XJ7A 1E6SM 2F6XA 2XGBA 4MLJA 2E8ZA 2UZ9A 3BO9A 2OO6A 3E02A 5FF4A 2TPSA 3GUWA 2Y62A 1D8CA 1NH6A 3FYYA 1R38A 1RQEA 2D1ZA 3S47A 1T8XA 3KFTA 1QNVA 1PSCA 2EG7A 3BMXA 4ZB5A 3AS1A 3U7VA 5GQBA 1P0NA 4BF5A 1G4EA 3A64A 3T09A 1IEXA 1JUKA 4HNTA 5EL1A 2OZ8A 3FVDA 3IAQA 1RY8A 4IMGA 2GVEA 4UQEA 5JXQA 2VC5A 1REQA 1C3FA 3B0XA 3NAVA 5ABFA 2J24A 3NGJA 4DJDA 3BAIA 2KX9A 1OK4A 5CPNA 3NQBA 2EPNA 4ADTA 2QPUA 3DHFA 3APTA 4ERIA 5HANA 4Z2GA 1ZJBA 2POTA 2ZZ6A 1J9YA 3EDFA 3NNTA 3OQEA 3ZOAA 5C9RA 3UNTA 2OWCA 2BFGA 1E71M 1DJWA 2CXGA 4NJHA 1L9WA 3EB4A 2GUUA 1BTMA 1W1TA 4DJEC 4QJ3B 3KP0A 3PN8A 3P0XA 2E4TA 3WEMA 4GQ0A 4ZB0A 4GI8A 3OZYA 3VMOA 4H8VA 2HS6A 4Q6XA 4O11A 4XUGA 2HV5A 3C8FA 1LWIA 5CGMA 5AOUA 3EWUA 1I45A 3TXVA 4EACA 8XIMA 2ZKMX 1S39A 5I0DA 3WLKX 2X0YA 1VYPX 2FHFA 4WKAA 1HUVA 1OG6A 2C7FA 2KAUC 2IW0A 1M7PA 2V3GA 1QNRA 1G67A 1TPB1 4AFYA 5IHRA 2J74A 1LUCB 1FY6A 2HCVA 4YTUA 2ZX9A 2BASA 3PZOA 3A24A 3PAOA 1OYBA 2PRLA 1RQHA 3IUHA 3F4VA 2NV9A 2ANUA 1YQ2A 2VOTA 1B3ZA 3AI0A 3LSCA 3VO0A 2CZFA 3OVQA 1UJQA 4MKNA 3FYPA 1R6WA 4B3LA 4CQ9A 3GUGA 2XZ9A 1EYWA 2EG8A 2BXYA 1R46A 1SO4A 2A79A 4FOKA 1F3WA 1O94A 4OBTA 1TMQA 3WBXA 3LHWA 1EOMA 3CPRA 4UMCA 1PTGA 5AHNA 2BSLA 4GZ7A 4DWSD 3IARA 2ZXDA 1MMFA 1R9YA 1SSDA 1QW9A 3CC1A 4QE1A 3AIWA 1WP6A 3WSUA 3FIGA 5BU9A 5I3KA 3W4RA 2ZX6A 3BGJA 3E0WA 3E0FA 1EBGA 1A3XA 1OYAA 3JZEA 5JIWA 1NFPA 4GWEA 2WVUA 3GVQA 4MWAC 1UKOA 2BNJA 3IIXA 1TB3A 4JIHA 1QFEA 5T9CE 1Z42A 3WMBA 4IFKB 2OEMA 4YN5A 1TREA 4O14A 4UNKA 1Z32X 5FEZA 3N4AA 4G7FA 4JTDA 3P14A 5D9PA 5F7UA 4E4FA 3N3TA 1YDVA 4GY7A 4C60A 3GNRA 1EKOA 4YPJA 1KRMA 4ECLA 2CXEA 1V77A 1KD0A 4NASA 4NIRA 4AD4A 3KZPA 2X1TA 1CXIA 4GRSA 1W3IA 5LIWX 2OCZA 3PG8A 2W5FA 3FW6A 1N2VA 5IM51 2CERA 3P5YA 2WXDM 3WK1A 1GOXA 4R7WA 1O5RA 1XHGA 1OFEA 4BF9A 1NJJA 4KCTA 1TZ7A 4E2DA 3CUZA 1ISXA 5E0KA 5A6AA 3KDOA 4OQVA 1BXNA 2V38A 3UGVA 3WQGA 3QGAC 1M9HA 7CGTA 1F2JA 3W7CA 1KXQA 2H6RA 4JTRA 4AHOA 3FHAA 3WJSA 1SO5A 1S2TA 4ERGA 3G1DA 2VRJA 5LYRA 1RALA 1HVQA 1HGYA 1SW0A 3CL6A 4DJDD 2Q3RA 1XF0A 1VYSX 3NQ8A 1EUNA 4UTTA 3UETA 3S5ZA 4GC4A 4LBSA 4Q8WA 2C15A 1H0GA 2RDTA 1JF6A 1XQLA 4GH3A 1UUMA 1KXTA 1IT8A 4LSBA 4I6KA 2UY3A 2QPXA 3VX1A 5GVJA 1GVYA 4AD5A 4ZR8A 1FWSA 1QNOA 1JD7A 1W1B1 1QASA 3GXTA 4N9BA 5A2CA 1CX9A 3D6NA 3UESA 3E2QA 3ARXA 1ITUA 1X7FA 4KWOA 3ALGA 4ZQPA 1YE4A 2ZIDA 5CPTA 1W8GA 3K1GA 3CZJA 4WSKA 4C91A 2YBUA 4QEEA 1XYBA 5D38A 3OA3A 1J6PA 4L65A 1OCJA 1JZ6A 1EFZA 4EE9A 3KL0A 3UVIA 5GJPA 4NU7A 5M2FX 2PDMA 4HU3A 1KBLA 3T05A 2OLHA 2PLCA 4BK9A 3IPWA 3EMQA 1VPYA 4XVDA 2ESCA 3NOYA 1NIUA 1UWTA 1NWUA 2EHHA 4ZQCA 4C5ZA 1SZRA 1ISVA 1UIOA 4GGHA 5A6TC 4AZGA 4KEVA 3IIOA 4UOJA 5LNWA 1BQCA 1XDLA 2PZNA 1WKYA 1VRXA 3MSRA 2C8NA 5BOEA 1VIWA 1NWRA 4PB5A 4RPQA 1XPGA 6ALDA 3M64A 2YL5A 3P6LA 5IFPA 1OGBA 1W1ZA 4AXNA 2V2CA 1T8QA 1VAHA 3WNOA 1VJSA 1XR2A 1KV8A 5ECUA 3ZYZA 1Z7AA 5L6UA 4JTAA 2E6FA 3WD1A 1F61A 3SSJA 5I78A 1OSEA 5REQB 4AEEA 3AZSA 1UKPA 3IK2A 2WLYA 2R1LA 1VEMA 3AROA 1JZ4A 3ZJ8A 1PKLA 4JQ1A 3S0CA 1YPIA 1E3XA 4QJ5B 4C6QA 2Z1VA 3BJSA 4UTMA 2QCDB 2QJMA 4TQTA 2PCEA 5HQEA 1EH9A 3R12A 4HYRA 4NZ5A 4UTFA 2YLAA 1TRDA 5LA2A 2QGYA 4H4IA 1SFJA 3MYOA 2MNRA 1B5TA 3QJAA 1GW9A 3C86A 1F6PA 3B8WA 2CLLA 4MJZA 4HU4A 1UP2A 4XD6A 2PTZA 3JUGA 2FKPA 4LVAA 4XTDA 2WCAA 4KWWA 5FJOA 2Q09A 5JBDA 1JPMA 4BI5A 5A94A 4FPSA 3FX4A 1ZAIA 2C13A 1HP4A 1WXJA 2BGNE 2O4QA 2VZUA 4UNLA 1ZLPA 3TAKA 2G95A 3KOYA 3UXAA 1W3LA 1DJZA 3GAYA 4GH1A 3VKCA 3O6YX 3FAXA 3PK7A 4LEQA 3T2QA 1S5TA 1JFXA 4YJ5A 1JDFA 5FAJA 3IJDA 2PLJA 5D02A 4XKYB 2EKGA 5AYYA 2OWWA 3EAUA 3R10A 3VA8A 1OC6A 1CXHA 3EXSA 1WAWA 1H7NA 1HKKA 1V3HA 3LEPA 4QDPA 3W88A 1R9XA 3I65A 4K8HA 1HKVA 3PBGA 2V63A 5IDIA 2A3AA 1OCBA 5EYWA 4QGCA 3AALA 3UWWA 3MHFA 1DWIM 4R9OA 5JU6A 3A4XA 3ABQA 1BYDA 1WOBA 1M6JA 1TCDA 4MYAA 2ZXQA 3ARTA 1NP0A 4WF7A 3UJRA 4QQUA 4ZB2A 3UYIA 1VFMA 1K3UA 4LAUA 3TQPA 3INPA 4XBJA 2GWNA 5CPMA 3IGUA 1XG4A 5A95A 4HK5A 1EPXA 4NJKA 3IK4A 1XLIA 3E5BA 4RLIA 2OZ0A 2HVMA 2CC0A 2DZUA 4LBRA 4F0MA 2FQIA 1H2JA 2GJXB 4K3ZA 3M47A 4DWSA 4M5PA 4QITA 4LAMA 3UY7A 3H21A 3BC9A 4DO6A 1RV8A 4K1WA 4PGLA 1XLCA 1W91A 4YWSA 4UZSA 3OGRA 3TR9A 4TTUA 2OX1A 2DUXA 3SN1A 5KSWA 1C8YA 3B0PA 4V33A 2GGHA 3AMDA 3PY2A 2VX4A 3W01A 2O9RA 2H90A 1Q8JA 4PULA 4UTKA 4L80A 3CEPA 1HFBA 2NLIA 3NO3A 1TFVA 2Z0IA 1E73M 1CTNA 4NX0A 3ZFHA 1DHPA 1XIHA 3R6IA 1KXHA 3G77A 3NQGA 3G8EA 3V0TA 1G5AA 2PDHA 3HTWA 1EBHA 2ZUWA 1VPQA 3W6LA 4HN4A 3SRDA 1K6WA 4J2MA 4UMBA 2ZX5A 5I06A 1GPFA 3M1ZA 3KVKA 1W6TA 2HRWA 4XWUA 4KRZA 1WDDA 1GYLA 1KFJA 3M43A 4TR9A 3CLWA 1UH3A 2Y7GA 2HE8A 5IBXA 2DIEA 2F7FA 4XD5A 4IIBA 4Z2HA 4YVPA 1R3TA 3DC8A 3L9CA 3GDBA 3GFXA 2G5WA 4EVZA 3FLUA 2D0GA 2XFYA 5HXMA 3OZPA 4D6CA 4LF2A 4DJFA 4CNNA 3H8AA 4HIBA 3MO7A 4AG0A 3W2KA 2VO5A 3BCJA 3NZQA 6XIAA 2NQHA 3W2MA 1UW9A 4OUEA 3P80A 2HNHA 3AMLA 1WQ5A 2R1PA 3VNDA 4B2DA 3KRSA 1HKMA 4HZ6A 3CV6A 3QYQA 3DI1A 4L9YA 3ANUA 1LLOA 2XFFA 3LZ5A 3K13A 3LCFA 3MW7A 1YNQA 3FDGA 4G1KA 1PEZA 3ID7A 4LFYA 1S2VA 1J5TA 4JX6A 1OIFA 3VC5A 3BE7A 3BW3A 3SM0A 2O0TA 2QVNA 1GEHA 2PDCA 4B5NA 3HM7A 1KM6A 4UFMA 1R2SA 4NI8A 3HQPA 1LWJA 1VYRA 4RE4A 2B81A 5CAHA 5HDRA 1GOWA 3KWSA 3MUAA 4LVFA 2ZA3A 4Z1DA 2P1FA 4IJRA 2CWNA 1TJ2A 4GKLA 3CNYA 3CO8A 5DMLA 3ALFA 5F2GA 4M24A 1QO5A 3LUTA 4PR4A 1V8EA 5EU9A 4REQA 2OYLA 3CWNA 2E1WA 3M41A 3PUGA 4L4OA 3EWYA 4DBSA 3PC0A 2OT0A 4B5XA 1MQQA 4F40A 2VQUA 1BVNP 1V7YA 2YCLB 2DY3A 2I1OA 4XK2A 1KM2A 4N42A 2DZXA 4LUYA 1EP3A 4B3KA 4W88A 1N82A 4PMQA 4O1AA 1LUCA 3HN3A 5CJMA 3W1LA 4D1IA 3TNBA 1EC9A 1J0KA 4E3TA 2CW6A 4Q8PA 2HDJA 5JIPA 1FXPA 3WLPA 3IIPA 2HE5A 3ZXWA 3OPSA 1LWHA 1CNVA 2FHBA 5LGXA 5LZLA 1D8WA 1FWTA 2XISA 1BHGA 5C54A 3IAPA 1D3CA 3SCOA 1YDOA 1G0CA 4O57A 4KESA 5I23A 2D20A 2NVDA 3LSBA 1S5WA 3LENA 3FJ4A 4IL2A 1HL2A 2O4MA 5A6MA 4QNWA 4JFWA 2W0UA 1PYMA 2WNQA 1WPCA 4ZEPA 1EPVA 1Z44A 4UTLA 3O9NA 1HZYA 3V1PA 3VIOA 1AJ2A 4P8VA 3CT2A 1LOLA 2YFOA 3UZWA 3MU7A 1SZEA 2OKTA 4FF5A 1VR6A 2RH9A 4R85A 1I0BA 3UYCA 4Y90A 2VWSA 1AA1B 1K9DA 3QHOA 3N19B 1EGVA 3CUXA 1IWBA 3DH7A 4IM4A 4AUBA 2FZ8A 3GXMA 3BGAA 4NZ3A 4DWSC 3FK4A 3UD6A 2VDGA 3O6AA 2PGFA 1QOPA 4JQAA 1XG3A 4AZ6A 2NQ9A 3K30A 4E5TA 4KCUA 3RN6A 2E5DA 1TMLA 3QTPA 4IG2B 3VD7A 2J8GA 4JNZA 4PC8A 5HPOA 1XBXA 4Q8QA 2VZVA 4XISA 3I3BA 4CVUA 1GORA 5A8GA 1YPFA 4HHPA 2QT3A 3VIKA 1EA9C 3UY8A 3RJXA 2GSEA 4C1NA 5M1TA 4ZVJA 3VK5A 1JZ3A 4XZWA 5AHIA 3MC5A 1J8VA 3B8SA 3PBUA 4NI3A 4GIYA 4HMNA 3RLHA 3C5QA 3I68A 2QJHA 2VTFA 3M7SA 1ZL1A 5CPSA 3A23A 3RMEA 3WY1A 4RDZA 1G94A 4ZE4A 1YW1A 4AVOA 3MCMA 2CLEA 4IMAA 3DFSA 1PX4A 4A8LA 4XD3A 3LLDA 3T2PA 1E0VA 1C7TA 1I1XA 1U5HA 2E68A 1QBAA 5D2XA 3UXLA 1NP2A 5AECA 4K1GA 1RA0A 2Q8XA 3B9DA 1H61A 1IGWA 1MEHA 2PDUA 4E38A 3GHUA 4AH7A 4B4FA 5TQLA 2PDLA 3MDWA 1G9HA 1Q85A 2BY3A 4M6UA 2HWGA 2QUVA 1CBGA 4H9VA 1I2PA 2QDDA 2ZUMA 5AYZA 4PBFA 4AEOA 4EPKA 3CMGA 4KF1A 4PUNA 4H6QA 1QPQA 2X1UA 3C2FA 1KFLA 4JL1A 3TZFA 4IIGA 4Q4MA 3F2BA 4I6VA 3DEQA 2GDUA 3O15A 3REQA 2Z00A 3ZVHB 5C2GA 2JKAA 4MWAA 4GBUA 2Z4GA 5J8LA 1XH0A 4LCRA 4ATLA 3N6JA 4KFOA 2V68A 2PWFA 3GG0A 3LHYA 3WBYA 2PDGA 2OR2A 4WDWA 1T7LA 3MKVA 3OG3A 1N8IA 3WLOA 2Q3OA 1TRIA 3I7RA 3AISA 3R7MA 1GTHA 4IMCA 2Z1BA 3EA2A 3SQSA 1V3KA 3LRLA 3RR1A 3W23A 1V93A 3CV7A 2E6DA 4GQGA 1CLXA 3PAJA 1EHNA 1XGEA 3B05A 3M0LA 2PB1A 2DV0A 3PM6A 4HCHA 4TOQA 4XTIA 4WGHA 4J7RA 1ME8A 3SQMA 3N2BA 3UWVA 1WV2A 4GNJA 3KLKA 4WY0A 2VR2A 3UZZA 3MSDA 1U22A 1OJXA 2QS8A 1QHOA 2PWDA 4S39A 5E6ZA 4IMEA 4ZFMA 4XG1A 3PVFA 3HOJA 3LXCA 1UUQA 4O28A 3GX9A 4GNVA 4KIRA 1TO3A 3CH9A 1EWEA 1DIKA 4IGNA 1GYNA 1RK6A 3D3AA 3TLQA 1E0TA 4DQWA 4PCNA 5DT5A 4H8NA 2NQ5A 1DWGM 4NAEB 1TV2A 3BWWA 1HF6A 3T2OA 2V5DA 1I2RA 3E3HA 3S83A 4A22A 3MUXA 1VFTA 5HNUA 2OWXA 2VNCA 3W1UA 2E3ZA 3F5JA 1R7AA 5A6KA 2D0FA 3HB9A 4ICCX 1GGOA 1Q6QA 3LTSA 3VDAA 1ZGDA 4MWAE 4O4VA 3NJ3A 4JFSA 1KWKA 4DJFC 4QXIA 2GVJA 3HJZA 1BWVA 4IH3A 4WXYA 3W7NA 2X41A 1CLKA 2CEQA 1LBFA 2J27A 5HJLA 4FK9A 4B91A 1ITCA 3BK0A 5AC4A 4ZENA 2PWHA 3DHPA 5LXEA 1B2YA 1DE5A 3BMVA 4HT3A 2VGFA 4E4UA 5D2TA 3L67A 4QROA 4B15A 1ZBKA 5A8OA 2ZRYA 3L5MA 1UQZA 1XV8A 3KTSA 3JZUA 3LY0A 3B04A 1H0IA 2FLIA 4G5DA 3H4WA 2UWFA 2F61A 1E51A 5FEPA 4JIIX 4UC5A 4GISA 1OVDA 2Z7GA 1JRBA 2Y2WA 3MZ2A 4YXGA 4P8XA 2DT1A 3T4WA 4CEUC 1ADSA 3E12A 2YFNA 2J6VA 2TODA 4FOUA 2E9MA 3RUBL 3NL2A 3C8NA 2VGBA 4H00A 2HS8A 2W91A 1KTCA 2VX7A 3TJXA 1AMKA 2XIJA 3GU9A 4NX5A 2BY2A 1B90A 3FXGA 1R8LA 2DVTA 3C2YA 1OQFA 1C91A 3XIMA 2ACUA 4DBWA 3QQ0A 2NUWA 1UR2A 4X9SA 2B7NA 1UZDA 3WMLA 3W85A 3MMDA 4S3FA 3MSYA 3PJUA 1XLBA 1Q6LA 4R7OA 3NL5A 3E96A 3L2IA 2OYMA 3OZOA 1VP5A 3IVTA 2VJXA 1I4NA 3OIHA 1YEYA 2C16A 2G4FA 1V6YA 2AOSA 4LBUA 4O50A 3PJXA 2O56A 3CIWA 4PCSA 4W84A 4AB4A 1YLVA 4LS1A 4KEUA 3PZVA 3UXDA 1A5AA 2AGKA 3BGGA 1B57A 3DX5A 2I5IA 1XBVA 2QV4A 3NWRA 1F76A 1JZ7A 4PMRA 1E4MM 4RR4A 3M0KA 2PI6A 4X2RA 1DXIA 4V1YA 1EF2A 2QPSA 5E9AA 2E40A 5F4XA 1MRAA 1VFSA 2IMRA 1JGMA 1P6WA 1K7FA 4JDBA 4PTMA 4DPPA 2YCJA 2R1NA 3P2VA 3UXKA 3QGKC 8XIAA 3AOFA 1THFD 1JFHA 1D7KA 1T41A 1YDNA 2I17A 3ITVA 5E93A 4GA8A 5DXYA 3CU2A 3WNLA 1HKIA 1BKSA 3AWNA 3GXPA 2CLOA 4DB7A 1EB3A 2QUTA 2Q8ZA 1ODZA 3S9YA 1Q2SA 2CLFA 1JQVA 2EAWA 5CPQA 1HJSA 3W7LA 3MQTA 5EMUA 3RX4A 5T26A 2XYLA 3IVSA 4LH8A 4OJYA 5DANA 4HNLA 2WVVB 1KFBA 2PDFA 1KTBA 3BDKA 1HTIA 4KKXA 3H26A 3TTOA 2EF9A 4I9MA 3RG6A 4S3BA 2BY0A 2FGLA 1TKKA 3SZ8A 3JS3A 1PX8A 5HMSA 2D2GA 3WFLA 1N8WA 3QW4B 3OHIA 5E70A 4FR6A 1UZHA 4AF0A 4ZO8A 1U1JA 4HGXA 4JS3A 3DGBA 3HF3A 1H1ZA 1G4TA 1EWDA 1XSJA 4UTHA 3Q4DA 4CQBA 4WKFA 2DSVA 3N2OA 3QTGA 2J77A 2PTYA 1T6MA 1QWGA 2VFFA 6REQA 1PHWA 5KTLA 1LRNA 2J4GA 4DXXA 2YYUA 4N0RA 1SR9A 3H2EA 1VFOA 1EL3A 2ADAA 3P0WA 2DVUA 4LNYA 5CC5A 4ZO9A 1GVFA 5CAKA 3POCA 3RCYA 4N9DA 3EBVA 1RA5A 1RSCA 4R5EA 3F4CA 1UYQA 3IRDA 2X42A 4Y96A 1ADOA 5H1WA 3M0VA 3DAQA 3FNDA 3H2AA 2X2YA 2BBFA 3QSTA 5E1QA 2WO5A 1J10A 4GXPA 2GK1B 4LU0A 3B9EA 1WUEA 1TJRA 4GYPC 2J9ZA 3ZIZA 3QV9A 3AS0A 1VF8A 1HJQA 1VHCA 4DAIA 4GX9A 4J4KA 3VDBA 4US5D 5CQ1A 1GYMA 1GONA 1KM4A 3ICJA 2VEFA 4OFCA 1IHIA 1G6CA 2GSJA 1AODA 1VENA 1JAEA 1E9ZB 3NM1A 3PJTA 3LV6A 4YS1A 1MW3A 1EO7A 4Q8TA 2ZUVA 2PF8A 2W63A 3U57A 1QVBA 4A35A 1HGWA 4FLOA 4B3ZA 3R13A 4GACA 5LKYA 3KTXA 2PDYA 3CAVA 3BAXA 5C2XA 4GIEA 1RJQA 2J9XA 5FJPA 3QZAA 2OODA 4IIFA 4QFUA 2CZDA 3AMGA 1IZCA 1V08A 3VCRA 3G0SA 2ZC8A 3IIZA 1TTIA 1GVQA 1GOOA 3TFCA 3QV7A 4IUGA 2Y8UA 1DJYA 3WLTA 3LOTA 4NKCA 4GGBA 1O5XA 2MUCA 1W3JA 1CXEA 4L64A 3SAZA 3ZS4A 5M17A 4HNVA 1UD4A 2PDNA 1ITXA 1VD6A 3OGSA 4XIMA 5KZEA 1EP2A 8TIMA 2OJPA 1X8CA 3QFEA 4J3UA 4KEZA 4HNUA 1OCNA 2Z25A 3W71A 3FCPA 1PKNA 1BF2A 2WCGA 3NZ1A 3CQIA 3S2CA 5TD4A 3IVUA 4A8RA 3M6DA 1VCVA 1ONWA 3O0KA 1CZ1A 1E1CB 3MJYA 1XIDA 3TQVA 2A0NA 4E2BA 2YCLA 3WL1A 3KVMA 3ABXA 2PU1A 3QR1A 2NZLA 2P88A 4UQAA 4HA1A 1TUFA 2AQWA 1FXQA 1UJPA 2FH8A 3N29A 2JF6A 1DP0A 1NOWA 3FJLA 5M5DA 3ARPA 1GJUA 2V30A 4RX0A 4WXZA 1OT2A 4JY9A 5FKYA 4QLKA 2Z29A 4V1XA 1W1PA 3IWPA 4J3XA 4XAZA 3SCVA 2QCCA 2F8QA 5D32A 4LV4A 2G8ZA 1A4MA 3G0UA 3M0JA 2VC6A 2F38A 3WX7A 5HNTA 1W1VA 3H4XA 3NDOA 1IXQA 3N9SA 2B7OA 2ISDA 3BANA 1W9DM 3KS5A 1TSIA 4ACZB 4UTWA 1WO2A 3CUGA 2FHCA 3AU2A 4HPXA 3KRZA 4JQ4A 3F7JA 3VAVA 3WQ4A 1Y8BA 1PV8A 1EZ2A 4C6OA 1XQKA 3BSGA 3M44A 2NLYA 5DF0A 1ITQA 2DT2A 4NJGA 2V81A 4K39A 1XPYA 3GSMA 4MKVA 4JKKA 4LVDA 2ISWA 4JCLA 1FWIC 3ZLGA 1QHPA 5C7VA 1KRCC 1D7FA 4X3ZA 1HO1A 2C18A 4FR1A 4F9JA 1G4SA 4FI4A 3H22A 4AC1X 2GUBA 4AXKA 4CQAA 5F2IA 2Y6ZA 1WDWA 2E1DA 2BV9A 4A3UA 3W7JA 2VFEA 2I16A 4N6EA 3R79A 2A6LA 3BAYA 3G1AA 2DQWA 3OOQA 3SUVA 1VLIA 2XSAA 3U2EA 3FFSA 1QATA 1GKRA 9CGTA 3SY1A 2NX1A 1XP3A 3L21A 2P3EA 2PD5A 3EDDA 2J8FA 4G7EB 1KGXA 4HHLA 5AHFA 4Z0SA 3VGEA 3HPFA 4DBEA 3IGHX 2J25A 1SZNA 3CMJA 4G6CA 4CD4A 2C1GA 4K8EA 2E6YA 2OSYA 4CGTA 4RV3A 1QI4A 5HMEA 3E0IA 1NF7A 4DWSB 1R9ZA 2QAFA 2VFGA 4HD5A 3AYRA 3W70A 4OE7A 1V51A 3N9KA 3KXQA 3JW7A 2V5LA 4JFTA 5FJIA 3QSRA 3QLLA 4R34A 1OZMA 3VM7A 3FY1A 1ZJHA 3F4DA 3QKZA 1KA9F 4DJDC 4D6IA 4AZIA 1RVGA 3GAKA 3MV01 3T55A 3VGFA 4H3DA 4GI6A 3PZTA 1UC4A 2ZA1A 3WZ0E 4NY2A 1Q7QA 5BXRA 4S23A 4AMAA 2EQDA 5F4SA 2GQAA 2V2HA 3MVIA 4MKSA 2G3JA 3SGZA 4CCCA 2C1IA 1YDYA 1F05A 1TTJA 3FXYA 3BW2A 1A0EA 5DN1A 3GR4A 3QPYA 3VOHA 1JXJA 4UUIA 4A2SA 3B8VA 4QE4A 4PBEA 1W32A 2DH2A 3A5FA 3BTNA 1XWYA 4X9YA 1K7XA 4EWND 1NARA 4K8GA 1KQZA 1E6NA 1V3JA 1QW8A 2VVNA 2GFTA 3CQKA 1B9ZA 2P8CA 5G1TA 4OIFA 4QAWA 2ZZ2A 3H2FA 2OFJA 3DG3A 1FUYA 3DFOA 1B1YA 3L65A 2V69A 3U48A 4DXVA 1S5VA 3KVLA 1XUUA 1PIIA 4PMNA 4QTGA 4UFJA 3W7QA 3GNPA 1F3TA 2IPFA 4DYJA 1UR1A 2FZ9A 2J47A 3WDIA 4GQBA 4X60A 1E6XM 1SM9A 1CXFA 1D3GA 1V3MA 4NJIA 3CHDA 4JTCA 3DDMA 3C2VA 3N2CA 1FDYA 2WJZA 1TPUA 4FNRA 4F9DA 2ZC1A 1EOKA 2AL1A 2Y88A 4N4QA 3R4IA 4TU1A 3SCTA 1UB3A 3CTLA 2G3IA 1E4LA 2XPKA 1XLLA 3W7KA 1A3HA 4OVXA 4LUTA 3P62A 3V5FA 3VILA 1OX5A 1ZENA 4H9MA 3OP2A 1FP8A 3UCQA 3S1XA 1G01A 3GYEA 2WPBA 3DFHA 3TJIA 1U33A 4HPHA 5AC6A 3BW4A 4F0LA 3KBSA 3KEHA 2J7BA 4WJEA 1FWGC 2HROA 3RMJA 1W5NA 3NOEA 4U28A 3TYZA 2XVLA 2VENA 4MNMA 4O53A 2DJLA 1VJIA 1W54A 2GQ3A 4DZIA 1IT7A 1XCFA 3I6EA 3PNUA 2A1YA 3UU0A 2NWSA 3V4BA 4QDMA 2NXHA 3GVVA 2HSAA 1E3ZA 4JTTA 1DV7A 4U31A 3BLDA 5FF3A 3L66A 1BRLA 1QW7A 3TN6A 3LYEA 4W86A 4HTBA 1VIZA 2Y5EA 1KFEA 4JKMA 4X22A 4XO6A 1J93A 1PTAA 4QG9A 3WLIA 2DVXA 2HPIA 2GDVA 4LYQA 1ZNNA 4F0HA 2QYGA 3VDCA 1EJVC 1XLFA 4C6JA 3NVTA 3GIPA 3AQUA 1EQPA 2O9OA 1IYXA 1NELA 4L1XA 2WK2A 4IGMA 3TU9A 3R1ZA 4UR7A 1XYCA 4PA8A 3AZTA 2YYTA 3BMWA 4AY7A 4LVBA 4J1OA 1DORA 5HPCA 1FWWA 1RD5A 3S1WA 1B3VA 3QHMA 4QSFA 3QY8A 3NDZA 5TAOA 4PUMA 3T8LA 3AUOA 5DLCA 1DBTA 3OBKA 2X7WA 3UJ2A 3JU2A 3PUDA 2NSOA 3MSGA 4NNAA 1WAUA 2PDBA 5M3WA