2E6AA

Crystal structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with orotate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
312
structure length
312
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with orotate
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase
total genus 106
structure length 312
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2006-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 2e6aA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2e6aA01
2Y61A 3QW4B 4FX6M 3VKJA 3UWWA 4Y90A 1JCNA 4JY9A 5BMWA 1O5KA 4UTTC 4UTWA 1FBAA 2BZNA 3EEGA 3C2FA 1VHNA 2DJXA 3EXSA 5CPMA 3P82A 3IVTA 3C2VA 1JCMP 1H7OA 2Z2UA 4O0ZA 3V1PA 3O8AA 3O1NA 1TQJA 5AC6A 1VH7A 4FF7A 3O6CA 1WOAA 3M6YA 1VCFA 4UTKA 3HG5A 4N9CA 3VE7A 5BRBA 4NNCA 4RKAA 4A21A 7TIMA 4M6VA 3NAVA 4FHAA 1K8ZA 3BG9A 1NFBA 5C2XA 3S42A 3OEXA 2C6QA 3L0KA 3MYPA 5K4XA 1VYSX 4LS1A 1FWWA 5AHIA 2VFEA 2Q8LA 4O4VA 3MI3A 5DCBA 5D04C 2C16A 3LHYA 5J5RA 5CSSA 4K8EA 4IMCA 1VGAA 2CLKA 1FWRA 1QOPA 3LRKA 3NL2A 4IMGA 1VCVA 2VFGA 3CIWA 3DFNA 1SU5A 3I68A 3PG8A 1GTEA 4M7SA 1H5YA 1FWTA 1YPIA 2NXHA 3G1DA 2AAMA 3HGJA 1HO1A 1ML1A 3TFCA 3CU2A 2FTPA 4JTSA 2NXIA 4UTIA 4BI6A 1AW1A 3RLVA 1TIMA 3W70A 4HPJA 4LRSA 1V7YA 2FLIA 5BW6A 1KTCA 4NQ1A 4UFHA 3TIMA 1GG1A 2QUTA 3DAQA 4WX2A 1P4CA 4XKYB 2OX1A 3PR2A 2B7PA 3LERA 3IIXA 3M9YA 1M5WA 3W2LA 1JJKA 2OMAA 1L9WA 1EIXA 2P0OA 3QFEA 3PAJA 3GDRA 3KAOA 1LLWA 1S5TA 1FUYA 2PE4A 1KM1A 3MHFA 5LGZA 1QOQA 3NPWA 3QZEA 1P5BA 3MI6A 3W76A 1F6KA 3KFTA 3W1LA 3KHJA 2DZVA 1A5BA 2DZPA 1THFD 4PL1A 3TMQA 2EKCA 3HJZA 5LSMA 3NG3A 2CLFA 4NXSA 4KFNA 4EF9A 3UQNA 1KM4A 4I9AA 3BV4A 1JUEA 1LCOA 1RPXA 2C14A 1FDZA 1QPQA 3UPBA 1K7FA 1AL8A 5F4XA 5D2XA 1K8YA 3A21A 5J5DA 1OHLA 1TSIA 4MY8A 4KKXA 4ZQNA 3L5LA 4H3DA 4HNNA 3HF3A 3EWYA 1SPQA 1JUKA 3P8JA 3MP4A 1ZNNA 2JBMA 2QAFA 4TMCA 1TTQA 1YDOA 4DO4A 2FDSA 4RZ6A 2YYTA 1W1ZA 2RFGA 4DF1A 1GEQA 3M5YA 5FI8A 3BW2A 1YADA 2EF9A 2J9YA 2PC4A 3AJXA 3MYOA 5HNRA 2ZZ2A 4LVDA 1C9DA 1LYXA 4O1DA 4RZ5A 3UNDA 5C55A 1IIHA 1F5ZA 4I7VA 4FX8A 4LUJA 4UFJA 2ZZ4A 2HS8A 4X9SA 5DCDA 3SFKA 3AO0A 1KLZA 1XBZA 1TV8A 3ATYA 3G1AA 5KZMA 2TRSA 3IVSA 3W7HA 1QFEA 4R33A 5DELA 1UCWA 3W2UA 4DXVA 4XZ9A 2WKJA 4JYDA 3MWAA 3S5YA 1SZFA 3ZWSA 4POCA 5H2ZA 4JTIA 4HT3A 5D38A 2C1HA 1F76A 1JRCA 2Y89A 2NWSA 1Z42A 4JX6A 1W5PA 2V8ZA 3GLCA 5FF2A 1OFDA 2A4AA 5E0KA 2PRMA 3L2IA 1VR6A 1EB3A 3QMTA 5AYYA 3UZ5A 1DBTA 3W7JA 1KV8A 1XC4A 1YLVA 2CZDA 3DKLA 1ME7A 3BW4A 3EWZA 1OFEA 1SFJA 2VELA 3W1MA 3P5YA 3P81A 2ZDRA 1TPWA 1BWLA 3M5ZA 4EIVA 1R2SA 3P60A 1SFLA 1QAPA 3ABOA 5A8GA 2YCEA 4O0KA 2XN0A 3TK7A 1KM5A 4PTNA 3OVQA 4YLWA 3M47A 1SZGA 5C54A 1M7PA 2GQ8A 3TAKA 1O95A 3KVKA 4UNKA 3NQFA 4Y96A 2NZLA 2JGYA 3KVMA 3UXDA 1Z48A 1TRDA 3MP5A 5T26A 1DQWA 3YPIA 3GXNA 4GUJA 2W0UA 1NSJA 4FNSA 1UUOA 3BLIA 3N19B 1H62A 1XXXA 3UWZA 4YCOA 1JQVA 1DORA 2E6YA 3F03K 3S5OA 4GC4A 5AB3A 2F84A 4O1AA 3PBUA 2NV2A 3P62A 3C8FA 3H53A 3TE9A 3M1ZA 4N6EA 1YTKA 4MFDA 3IGSA 3IIZA 3W1XA 3WJYA 2LLEA 1ZENA 3S6DA 1W37A 2C3ZA 3TJXA 3G1YA 1QMLA 1LRTA 1PCWA 3NDOA 2VEKA 3FYOA 4Y6GA 1P0NA 3TA6A 2Z6IA 1GQNA 2ZRWA 4ML9A 1X8FA 4FNTA 4DBEA 3E12A 4OHQA 3W72A 2YDAA 2WNZA 1I2RA 5AYXA 1YDVA 3GKFA 3LXCA 3GR8A 1GVFA 4ZQPA 3NQ8A 1FCVA 1KLYA 3G22A 5LNWA 2CLEA 4IOTA 3P67A 5G5IA 5L9FA 3W7IA 4BF9A 2GJLA 5CZTA 3HO8A 5HMSA 2ISVA 1KFJA 3M43A 1SO6A 3W1AA 1LTDA 1XKYA 1QR7A 3HPZA 1SR9A 5F2GA 1VC4A 2ZRUA 5CSRA 1TTJA 4E2DA 4QITA 2GUUA 1MSSA 3GX9A 3H55A 2FIQA 3I7RA 4CCDA 4N9BA 1D9EA 4NXKA 4S1FA 4OBTA 5G2HA 3UZJA 1XI3A 3GIYA 1P1XA 3GB6A 4M6QA 2VENA 3LRMA 3I7SA 4S2BA 5FF3A 3QJAA 4DEFA 1C29A 4ZQOA 1ICQA 3W7GA 3BGGA 3CWOX 3GYEA 3WJSA 5D2TA 2BTMA 3G24A 1R46A 1O4UA 4M5PA 3O05A 3O16A 3UWQA 4Q32A 3KX6A 5EPDA 3BARA 1SZNA 4NT0A 4LVGA 1B4KA 1A5AA 3TQVA 5LZLA 1EX5A 1YDNA 1PHQA 1SSGA 4WUIA 2H8ZA 2E68A 3C3NA 2R14A 1WA3A 3OVRA 2QUVA 4JTLA 3QF0A 4JTJA 3HOJA 3HGOA 1I8JA 5DCEA 3THQA 2R91A 4FIQA 4JGDA 1NEYA 5F1UA 3LBMA 3BLEA 3GDKA 4O13A 2VOMA 2ZTJA 4B5NA 3PS7A 3T44A 1OF6A 1UASA 4PC8A 5CG7A 5K3VA 4WXYA 3S5ZA 4CNPA 4R53A 2JKPA 1W0MA 1XUZA 4S2CA 1GG0A 3CEUA 3GAYA 1AMKA 3NZRA 3G3DA 1EUAA 1X1OA 1EPXA 4E2BA 4EOUA 4Y9AA 1L6YA 1Q6OA 3O63A 3Q94A 3G1SA 4ZL1A 5HUOA 4AWUA 3W1UA 4AHOA 3TNOA 2B4GA 1N8FA 3S8HA 1TPVA 3NPXA 3B05A 4JXCA 1KW1A 4I7WA 1ZAHA 1R47A 2TYSA 2V2HA 1X7FA 5LKYA 4OU1A 3P5ZA 1EA0A 1GVRA 1DL3A 3FFSA 4AVFA 4FXRA 1GZGA 3L66A 2QCDA 1K02A 4DO6A 5KSWA 4XBKA 3UD6A 3SW6A 1OJXA 3WK0A 4O14A 4GBUA 4PFMA 3TSDA 2YZRA 1FXQA 2VKZG 1RV8A 3UXAA 2VFIA 4AAJA 3FIGA 1EP1A 4N6FA 5DY2A 1A50A 1UBSA 4ADTA 2J24A 2CFFA 3P74A 2WSRA 3P84A 3W1TA 1CW2A 5F4SA 3S9YA 3W7OA 2QR6A 3DKJA 3N3MA 1M6JA 2DZSA 2VXNA 1WDWA 1IXPA 4I7UA 1LOSA 2A7PA 1EEPA 1Y0EA 1Z44A 3SZ8A 4UFIA 4BK9A 4GUIA 4QQ3A 2GVLA 1DJQA 4O10A 5I3HA 4UIOA 1S5WA 5HJLA 4A29A 3QQ0A 3W88A 4DF0A 4N02A 5K7JA 4FNPA 4K7YA 4HSOA 2QAPA 1PE1A 4NUWA 1RQBA 2QJGA 4Z1BA 3NL3A 3T40A 2NX1A 3SSJA 4AWTA 5FEXA 4CNNA 1BWKA 2YSWA 3DFTA 5K9CA 4WY0A 1MO0A 3GNNA 3A22A 3W7QA 1H60A 1OX4A 4M7TA 4ORMA 4AB4A 3P80A 4N4PA 3CHVA 1KV5A 1YXCA 2R94A 3L0GA 4UFKA 5G2IA 3GAKA 2NXGA 1Z41A 4X22A 2BX7A 2W6RA 3LM7A 1JVNA 2QDGA 2O7SA 1HG3A 4JYFA 4UR7A 4WY0B 4ICNA 2CWNA 4LY8A 4MJMA 3UY7A 1YPFA 1S5VA 2J6XA 3A23A 3N73A 2ABAA 3DU0A 1TRIA 3W86A 1XBYA 2RH9A 2ZTKA 1C8VA 5AYZA 1NVMA 1VZWA 3MJYA 4JTFA 2V5LA 5G1TA 2QCMA 1W8SA 3G1VA 3TCEA 3TV8A 4UTLA 3MW7A 2ZRYA 4KFPA 2RDTA 1OK6A 3NEVA 1L6WA 3NQMA 4FNRA 1I45A 3D0CA 3B4UA 1TB3A 3DGRA 3FS2A 3DXIA 3TW7A 4LU0A 3C2EA 3EB2A 3W7MA 3TW6A 1RZMA 1ZY9A 3O6DA 5EY5A 2VFFA 2G97A 5EMUA 3N2MA 3NQDA 4C1KA 1SZEA 2CLOA 1JQXA 3LLFA 3K30A 5E1QA 2CLMA 2FJKA 3G1XA 3ATZA 3MHGA 2DZWA 4IUOA 2EAWA 1MZHA 3JS3A 1OYAA 3WK1A 1QPNA 4O1CA 4AF0B 4YXGA 1W3TA 1H61A 2V81A 2BSLA 4XBSA 3NYZA 5MHBA 2JKEA 4JDYA 5D37A 3W07A 3R2GA 4CCEA 2E09A 3TSBA 4NJGA 2P1FA 4P61A 1FWSA 2E6DA 3ABQA 5BNKA 1T99A 1TTIA 1CX9A 1H7PA 1H51A 2RDWA 2WNQA 1O5XA 4LS0A 3TFXA 3SR7A 3QSTA 3ZFHA 3U6WA 8TIMA 3NR0A 3PC0A 2CLHA 4JIPA 4ZZ9A 3E9AA 3G3MA 4MIMA 3M0ZA 5LNUA 4LNYA 3RK8A 2QCHA 3FA5A 4XUGA 1FCQA 5CKSA 3HQ1A 2QF7A 3LCXA 4O17A 2I14A 5K9XA 5HR6A 1KBJA 1OFOA 1SW3A 4MYXA 4RCXA 1VYPX 1RQEA 1GYNA 4IGHA 2WOQA 3EX4A 1HFBA 3PB0A 3QMRA 3QMSA 4WY0F 1RQHA 1F74A 1TMHA 1OF8A 5LGXA 4PH6A 1ZAIA 3C56A 3SGZA 3NQCA 4GXMA 3S1XA 2A7RA 2VC6A 1R30A 3HPSA 4NNBA 3L65A 3IIVA 4XKYA 4N2YA 2CLIA 4NNAA 1R2TA 3KRUA 2QUUA 1TPFA 1G4EA 4UCGA 3W1PA 5DBTA 1FX6A 4NZFA 4NVTA 2EGZA 3MMTA 4LS2A 2OJPA 2ZA2A 3SI9A 3GKAA 3W23A 4QIUA 4EF8A 3L0NA 4IX2A 4C1LA 1FWNA 3W7PA 2QCNA 3THAA 2FPVA 4MOZA 3QPZA 3C4UA 1XBVA 2GVGA 4OWGA 5I3GA 5AHNA 1SO3A 4O19A 1ZFJA 3O06A 4K36A 2G95A 2A5HA 3EWWA 3ZWTA 1QWGA 3NL5A 4BFAA 1LDCA 2V30A 4UXDA 1BTMA 5G4EA 2IQTA 5FF7A 2XN2A 1SW0A 1T8XA 1LP6A 4Z0JA 5DXYA 2QDHA 1WV2A 1LBMA 3B0UX 3L67A 1TCDA 4IX0A 1T0OA 3IEBA 3DBPA 4JY8A 3CB8A 1GPWA 2NX9A 4DBDA 2J27A 4KWVA 1J5TA 2Y6ZA 3OHIA 4AH7A 2EPHA 3IIOA 1LOLA 3STGA 2Q3RA 1KTNA 1J4EA 4UUIA 4CQ8A 2V0TA 3DZ1A 5HWMA 1V5XA 2H6RA 3DFOA 3LLDA 3TU9A 1YTDA 4YL2A 4QAIA 4MZ8A 2H90A 5U7SA 5BOOA 3B03A 2X1RA 4HPXA 1B4EA 1K7EA 3L21A 3M5VA 2H3DA 5FEWA 1O94A 3G8RA 1W54A 2WSYA 2JKAA 3LBCA 1VJIA 1DQXA 2A7NA 4RXFA 3W2MA 3NNTA 1GYLA 3BPWA 3M44A 4DELA 2E6AA 3FKKA 4IWWA 2BXVA 4WXZA 1TJRA 1YXYA 2GPTA 2Y88A 3LCGA 3UWUA 3QC3A 3EX1A 3PG9A 4O1BA 5AHLA 4J9JA 2FQIA 3T55A 4HNTA 2YW3A 4HNVA 1G4PA 5F1VA 4OQVA 5AC8A 1E51A 3TDFA 1L2UA 2PRHA 4K8HA 3R89A 3LCHA 1JCYA 4O4WA 4CLMA 1PS9A 2X1UA 5KMYA 5CZ0A 3EWXA 3KRSA 4K37A 1VLWA 3PBVA 1NF0A 2D73A 4CCCA 4U28A 3LCLA 1VHCA 3UY8A 4WD0A 4OGZA 4Q4KA 4HHPA 1SO5A 1F7BA 4OV9A 1KA9F 3DI1A 3PULA 3QW3A 4LWWA 2Y85A 3TKFA 3QRHA 1A5SA 4PODA 3T7VA 2W79A 1K3UA 3GK0A 1MEHA 1S3HA 5DN1A 5I3IA 3NQ7A 1ICPA 2V2DA 3MBFA 2ZCGA 3PWAA 1FDJA 2A21A 5HR7A 4WOZA 3PUOA 1EP3A 4PA8A 4WQ6A 4FX7A 3MP3A 1ALDA 2WNNA 1I2QA 3R5EA 2R8WA 2NUXA 2FPTA 1L6SA 1PL9A 1H1YA 3C61A 3PSVA 3RFAA 4JIQA 3C2OA 1G67A 1KBIA 3LCIA 3KVLA 3UWYA 4TMBA 1TV7A 1XL9A 4WZHA 5I3JA 2G96A 1TYGA 2ZYFA 4JX4A 1TPEA 5DLCA 4G1KA 3TUUA 2OCZA 3O6YX 4L4LA 3B8DA 2X16A 3VI2A 3W9ZA 3O07A 3VFLA 5CZJA 1G7VA 3W84A 2WO5A 4RX0A 1K03A 2FFCA 4N9EA 3TR2A 5K9DA 2QCDB 3PM6A 5BMXA 2YX0A 2FB2A 4OV4A 5DY3A 3OVPA 4JEQA 4O52A 5FEZA 4MPQA 4O11A 4UTJA 5CPLA 1DV7A 4UR8A 4JTGA 4IXHA 4XTIA 5D30A 3BW3A 3NL6A 1LRNA 2CLLA 3TC7A 1KFEA 5ABTA 5D02A 1WAUA 5AOUA 1UB3A 1UJPA 1KM0A 1QO2A 2YXGA 3L68A 4IPJA 4YMZA 4UTHA 4LRTA 4MLJA 1P0KA 1T96A 4IMFA 4Q33A 4HNUA 1JCLA 5HINA 1XBXA 4LOCA 1QPRA 3R8RA 5HULA 5KZEA 2ATSA 4MVAA 3USBA 1JUBA 2DZTA 3BGJA 3G18A 5EKYA 3OIXA 1ONRA 3GR7A 3LI0A 2B0MA 2PCQA 3EXTA 4CNOA 4JTKA 1F2JA 4O50A 4NZJA 4M19A 3NQGA 3G0SA 2KZHA 4AMAA 3F1QA 3BG5A 3LB0A 2AGKA 5LNSA 2Z6JA 4IPIA 4K39A 3T78A 4AWSA 2I1OA 1KM6A 3ANYA 2DZUA 3B0VC 4JS3A 3IGUA 1G6CA 1MEIA 2NV1A 1OYBA 2G5WA 3VCRA 2ZA3A 3Q2DA 2GQ9A 1GTHA 4K7VA 4WOQA 2ABBA 5IBXA 1BEUA 3M7WA 2WSQA 3C2RA 3NM3A 3DFSA 4LV4A 3VE9A 1IXNA 4GWEA 1TJPA 3W83A 4QISA 2NUYA 3QPYA 3W7DA 4HN4A 1WBHA 1JULA 4MKNA 3R13A 5D2YA 4RK8A 2F7FA 3NM1A 3LCWA 3TROA 3MBDA 3LHWA 3TQKA 3RNDA 1N7KA 3WK3A 4Z1AA 1GOXA 4UMCA 3ZS4A 4JN6A 3W22A 2Y70A 2A0NA 1XCFA 3FLUA 1X1ZA 5C5YA 4AEOA 1TQXA 2FB3A 2ZA1A 5HUPA 1OFBA 3G0XA 2VEIA 1LZOA 1GJPA 3HPXA 2HS6A 5D32A 1F73A 5FEPA 3HG3A 3SJ3A 1KFLA 1WYIA 2P10A 2ZZ5A 1EWEA 3L9CA 4TR9A 3GXPA 3W7RA 1DOSA 4X2RA 1LBFA 5D2VA 1PVNA 3EX3A 2Q3OA 3H54A 3U2OA 3HMJG 5HQEA 1LOQA 3E02A 4JD4A 1Q45A 3HG4A 3KRZA 1QCWA 4FNUA 3CM4A 4YCPA 3LXAA 5SWUA 1I2NA 4N4QA 4E0CA 1MEWA 3B0PA 2Z1BA 3GDTA 2V82A 3N14A 3NPUA 2C18A 2E5DA 3OBKA 4NJHA 3CLMA 3STFA 2A6NA 2YW4A 2OZ0A 4LTSA 1TPUA 1OVDA 1H63A 4MY9A 2ZZ1A 3BO9A 3F4NA 4IJBA 2WV8A 2QCCA 1FDYA 1DHPA 2HMCA 3FEMA 4RXGA 3WK2A 4A3UA 3TH6A 4OE7A 3T4CA 5C6MA 4GUGA 3G0UA 4EVZA 3HG2A 1JR1A 4AHQA 1EUNA 2NWRA 3GDLA 5GVJA 1RVGA 3EX2A 5KITA 4Y8FA 3S1VA 4JTHA 1TPDA 3EKLA 3MHUA 4QJ1A 2V9DA 2E1DA 2B7NA 4W9TA 3B06A 1WOBA 3NO5A 4Z0SA 1SQ7A 3LTSA 2CZ5A 4UNLA 2ZZ6A 1H7NA 3I6RA 5EA9A 3LX9A 4O12A 4DO5A 5FESA 1XUUA 3G1FA 4FXSA 4L4MA 2X30A 5CGQA 5TQLA 3V75A 2ZFAA 3EXRA 3IRDA 4FO4A 4O15A 1XFBA 3NPVA 1W5NA 3QSRA 1TPB1 4K6AA 1VCGA 2Q8ZA 4RLIA 1HO4A 4JYEA 2A1YA 5D03A 1W5MA 4IQLA 1ZJIA 3W3OA 1D3HA 4MUZA 1AW5A 4LUIA 2ALDA 3N34A 4GJ1A 3SECA 1X6UA 2TMDA 1VS1A 1KFBA 4AXKA 4JTEA 2DORA 1HTIA 2PURA 2JGQA 2WPBA 1LROA 1NAL1 1B9BA 1MXSA 1VPXA 3IGXA 2X2GA 1HL2A 1ICSA 3S0CA 4MYAA 3EKZA 2TSYA 1TPC1 3LRLA 1XDMA 1SSDA 5IM51 4UFLA 1W5QA 2ZZ3A 2Y62A 2QCLA 3RLUA 3SY5A 1OFAA 1AG1O 1FCUA 3NQVA 3PUEA 1OFRA 2XFWA 3HGRA 4O16A 5LNRA 3IV3A 5EL1A 3KXQA 3GNDA 1LORA 3WJXA 1O60A 3NA8A 4FB7A 5EBUA 5FF4A 5KZDA 1I2OA 3W85A 1W3IA 3TC6A 3G1HA 3OA3A 1B3OA 2J9XA 5D09A 5KTLA 1VQTA 1W56A 3ABSA 3ZR4A 1FCBA 1RD5A 2ISSA 1EWDA 2GJNA 5LHEA 1YTEA 4NJKA 4QM1A 4LVBA 4GNJA 3W7EA 1D3GA 1JCJA 3JRKA 1VYRA 3BK0A 3IIPA 2H8XA 4RR4A 4ZVJA 3TXVA 4ADUA 1ZALA 4EWND 5HWNA 5AN7A 3DH7A 4RZ4A 4ZMGA 4JX5A 1Q3NA 3W6YA 2C19A 4UC5A 4D2JA 4BWLA 1QDSA 4FEZA 3L5MA 4MFEA 1I4NA 1OX4B 3GZ3A 1OG0A 4HIBA 1U83A 2DJLA 3HB9A 1WX0A 1GVOA 2BLEA 4M6PA 4O54A 5E93A 2HTMA 4NJIA 2VEPA 4O53A 1F6PA 3LHVA 2TPSA 1GT8A 4HKPA 3P61A 1UUMA 1OFQA 2AQWA 2A2IA 4MY1A 4TIMA 4TU1A 2EHHA 3A24A 2NUWA 1H50A 3M41A 4O8RA 3I7QA 3LTPA 1AL7A 3LHZA 6TIMA 1ADOA 1IXQA 3GDMA 5D2WA 4JNMA 1DVJA 1WQ5A 3WFAA 1VRDA 1LBLA 4ZQMA 4CQAA 4UTUA 4QNWA 1LLZA 1H7RA 4ALDA 3Q58A 4LC6A 3BLFA 1LM1A 1KFKA 1QNVA 4RJEA 5CZSA 3LXBA 4JICA 1KTBA 6ALDA 3U8GA 2X1SA 2Y7FA 1IGSA 5F2IA 4IMEA 2HSAA 4BI5A 5D05A 2RHGA 1QPOA 1W3NA 2DP3A 4GE8A 3TMLA 3QM3A 1XDLA 3MI2A 4Z1DA 3W7LA 4ZQRA 1RR2A 3UWVA 3WJZA 3OG3A 3GXTA 2Z0IA 4WJEA 1TV5A 1ME9A 4R7JA 3G8EA 1OK4A 4JTTA 1VLIA 5AHEA 1DKWA 1W5OA 2FPYA 1OFPA 1U5JA 4A2RA 3C0JA 1H7XA 3NQ2A 3SGUA 5K2ZA 5AFDA 3ELFA 5TIMA 2QJIA 2DU2A 3W73A 3CEPA 3W7KA 2GVJA 1IXOA 4ADSA 3E96A 4O28A 2J88A 1PCKA 1PIIA 2V5BA 2RKXA 2Y7DA 1PHWA 2ZZ7A 3LV6A 4GUFA 2ISWA 5AHMA 4NX5A 2X1TA 3QQ1A 4KFOA 2GOUA 5F2LA 2VFHA 1ZAJA 1W31A 3PBWA 2PRLA 3KOFA 4PL2A 1G69A 1TTPA 1WXJA 4DQWA 3UYCA 5G2WA 4XWUA 1SW7A 5TBOA 2YPIA 3CQ0A 3E49A 4LV9A 5D33A 1ME8A 5I3FA 3DENA 3STCA 3W1RA 4CQ9A 1LRQA 3RMJA 3CPRA 3Q37A 2WJZA 2YGYA 1Q6RA 2C0AA 4PCFA 1N55A 5AHFA 2YFNA 5H91A 3RF9A 4UTMA 3C6CA 5HWJA 5LHFA 1SUXA 4ONVA 3FJLA 2ZRZA 4E38A 2I9EA 2QCEA 1B57A 4P2VA 5IBXC 3W75A 3I65A 3P8IA 3EX6A 4UTTA 4NU7A 2XN1A 3EWBX 2NLIA 4H4IA 4LVAA 4JTUA 4JDBA 5K4ZA 3LGEA 3NQAA 3HGSA 3NOEA 4RV8A 1FXPA 1IIGA 1FY6A 3RU6A 1OX6A 4UFMA 3W87A 2J9ZA 3LHTA 2A85A 2Y63A 5U4NA 2Y7EA 1J2WA 4X3ZA 1NF7A 5F4WA 3NQ6A 4FIRA 3S1WA 2H3BA 1EP2A 2QKFA 3CWNA 1IF2A 3KVJA 5KINA 2C13A 3A9IA 3LV5A 3LCFA 2C15A 3L5AA 4O57A 4YWIA 4TX9A 3FKRA 1JRBA 3LTYA 3FJ6A 2WQPA 2NX3A 4AHPA 4BI7A 1ZHAA 3DFPA 3SIZA 4GUHA 4BR1A 3TSMA 3S5NA 2BWGA 3M5XA 3W1QA 3A5VA 4GRSA 3CC1A 1A5CA 3DHDA 4ORIA 4U4MA 1HUVA 3MUXA 3LHUA 1Q6LA 4N9DA 2UV8G 1K7XA 1M7OA 1Q6QA 4TO8A 3A5FA 1XM3A 1G4TA 4LW7A 3LI1A 5G4WA 3QEZA 3BVJA 3S1UA 4LT9A 5FF0A 4O18A 2QCGA 1KM2A 3NGJA 5F2MA 2YFOA 2E6FA 5G1YA 3JR2A 3LOTA 3E0IA 4FNQA 2CW6A 4IMDA 4NX0A 1G7UA 3W2KA 3N9SA 4PEKA 3W2JA 4A2SA 3W7NA 1H1ZA 1WBJA 1YXDA 1KFCA 2E5BA 5DXXA 3R12A 2GQAA 3FYPA 5LNVA 2DZXA 4XQ6A 3DFQA 5CPNA 2B7QA 4LC8A 2ZRVA 3MO7A 3HBLA 4OT7A 3PY2A 2CZFA 3DI0A 4MZYA 3WJWA 4XTDA 3UPWA 3LDVA 1BKSA 1TREA 3W71A 2QJHA 1G4SA 4H6KA 3VNDA 1GWJA 5CPOA 2V2CA 4Z08A 3PB2A 2O7QA 4DF2A 1DJNA 3QH2A 3TAOA 1OABA 4NJJA 2CZEA 4UMBA 1FQ0A 4BWLC 3C52A 1TPH1 4KWWA 1CI1A 4Z1CA 5L6UA 3TX9A 3F4WA 3EWUA 3O15A 2OT0A 1OX5A 3W7CA 2YR1A 1I2PA 4DPPA 1YYAA 3PF3A 4MZ1A 3B04A 1A53A 2CU0A 2B7OA 1GVSA 3GVGA 3TJLA 4DPQA 4UMAA 4R34A 3CIXA 4AF0A 4MJZA 5I3KA 1F05A 2VFDA 3PVFA 3DHFA 4HSNA 2RDUA 3TXZA 2JK2A 4K38A 1PV8A 3W74A 3TQ0A 3IVUA 1H7WA 3NQEA 2E5CA 4UTWC 3PBYA 2QEZA 4GFSA 3FOKA 5EYWA 3ABRA 2ZRXA 4QNEA 3M16A 4IXXA 4JR5A 3PSWA 3NXFA 3N2XA 3BG3A 3CT7A 2A6LA 3P7YA 4QSHA 1AK5A 1GVQA 2ZQ0A 3CTLA 3NVTA 5A5WA 3PUDA 1TO3A 4MLRA 1OYCA 1KM3A 1AW2A 4A22A 2VEMA 3HIJA 1ZCOA 2QCFA 3NZ1A 2Y7GA 3W2NA 2ZBTA 3W1NA 2YYUA 2E77A 3N9RA 1JCXA 5DBUA 1SO4A 1K8XA 4LVFA 2OT1A 1QO5A 1R2RA 2ATMA 3INPA 4ZQCA 3STEA 3QYQA 5AC7A
chains in the Genus database with same CATH superfamily
4HJWA 4GQRA 2ODOA 1EX1A 3EDKA 1O5KA 2VVSA 1FBAA 4C6FA 3BJSA 2NLYA 1E0VA 3C2FA 3P82A 1MQPA 3GU9A 2Z4GA 5DX7A 1WZKA 1B3WA 1H7OA 4YWSA 1CWYA 5BXSA 4I6KA 3F5LA 1VH7A 4FF7A 2ZIDA 1WOAA 3WF0A 1HQTA 5A6LA 4UTKA 1K8CA 5BRBA 4NNCA 5CBIA 5FJOA 1W1PA 4XX6A 5K4XA 4LS1A 1FWWA 2P3ZA 1UKPA 2VFEA 3S9ZA 5DCBA 5JQ9A 2DSVA 5J5RA 3UG4A 3RILA 4IMGA 4EPBC 3PG8A 1MXDA 2NQ9A 3JZUA 2ADAA 1H5YA 3PTDA 3EMQA 1YPIA 3O0KA 5A8PA 3G1DA 4JL2A 4JTSA 2P8BA 2PODA 4BI6A 4IG2A 3GZAA 1UH3A 3GH4A 2ZC8A 4L64A 2J7EA 1KTCA 2Z24A 3P3BA 1TMQA 3DAQA 2X05A 1P4CA 4XKYB 4PMDA 4ZBCA 3IUIA 3W0KA 3W2LA 1JJKA 1EIXA 2V5CA 3QFEA 3PAJA 1GONA 2FZ8A 1LLWA 1S5TA 5LGZA 1BG4A 1RLDA 1V6XA 1UOZA 2PDLA 4BQ2A 1KO0A 4DBWA 3KHJA 3OZMA 4M82A 1XYCA 4E8GA 1L6GA 1E1CB 4PBFA 6A3HA 4C6QA 3M0HA 1GZJA 1JYXA 3NG3A 2CLFA 3PUGA 6XIAA 5E09A 1RJRA 5E0CA 1E4IA 4MB5A 4MNMA 1Q4NX 3FN9A 2WMHA 2BOEX 3WLHA 2EKGA 1VENA 1QPQA 3WLKX 1N82A 5D2XA 1K8YA 1OHLA 1TSIA 4PUUA 4YJ5A 4ES4A 4MY8A 2H9AB 4H3DA 5DEZA 1REQA 1O5RA 4O1EA 2XIOA 1W9VA 3S47A 1R9XA 2WJDA 4DO4A 2VGGA 4DM1A 1O1ZA 3PZIA 3EDDA 3SUUA 2JEPA 2PWHA 1QU4A 1GEQA 3VZYA 1W1VA 1YADA 2EF9A 2J9YA 5HXMA 3S2MA 9RUBA 1C9DA 4BQ5A 4O1DA 4RZ5A 4YHEA 4PB5A 4FOKA 4FPSA 4FX8A 4LUJA 4WSJA 1S2AA 1O1HA 3NVDA 4B5XA 3SFKA 1VIWA 3AO0A 3AIUA 1V3HA 4KERA 2PP3A 2ZXQA 3BE7A 3GM8A 2CESA 5CLTA 1YBQA 1E6RA 1J0ZA 2XGBA 1KKRA 1QFEA 2ZUWA 1J0KA 1RJQA 4NASA 4J3VA 2XIBA 1QW7A 3ZWSA 5H2ZA 5D38A 1B90A 2NWSA 4ZTYA 4JX6A 4QXIA 3H2OA 3WBWA 1BVWA 3WQEA 1XGDA 3SCQA 3GU2A 4PTMA 2R24A 4C6MA 3QMTA 3TYBA 3BH4A 3REQB 1DBTA 3BCDA 2DPEA 3W7JA 1KV8A 2C1IA 4D1JA 1QNSA 3DKLA 4B91A 3RN6A 5DMYA 1P48A 3UGRA 3P81A 5A2AA 4S3GA 4V33A 3LY0A 4EIVA 1FWDC 1R2SA 3P60A 3KS5A 3GG0A 3ABOA 2YCEA 1CXIA 1KM5A 3ZLGA 1QW9A 3M47A 1SR0A 2BVYA 5C54A 2GQ8A 1O95A 3QOMA 3H8AA 3N29A 3P0XA 3IJLA 5H1WA 2NZLA 3T1GA 3HA1A 2FHFA 3KVMA 3AS1A 3PAOA 1H4PA 1ODZA 4GUJA 4JAWA 1XXXA 1VJZA 3OLDA 4Z2JA 1JQVA 5I03A 2E6YA 2ALRA 3OLGA 1L0PA 3PBUA 3C8FA 3I6TA 3H53A 4ZXLA 1AA1B 4PCSA 3M1ZA 3BZJA 3IGSA 3TWAA 1AUSL 1SMDA 2LLEA 1IEIA 3B9EA 1W37A 2DUAA 3A3HA 3MJMA 4WRHA 1LRTA 4DM2A 5CC7A 3NDOA 2VEKA 1WKYA 1FWAC 2Z6IA 2W91A 4BEQA 4UQDA 1BYCA 4ML9A 1X8FA 4FNTA 2FKPA 1CENA 1EGVA 4OHQA 2P8CA 1OC6A 1I2RA 4W5UA 4IQEA 5A8NA 1YDVA 1QHZA 2VT0A 1Q2RA 1E55A 3LXCA 4ZQPA 1FCVA 2G3NA 4R27A 1KLYA 2ONEA 3P67A 3W7IA 5CZTA 3GO2A 1KFJA 3WMLA 4MHBA 4GH3A 3VU2A 2QVNA 3M43A 1SO6A 4WJ8A 3R1ZA 1SR9A 5F2GA 1GJWA 1RCQA 5EGRA 3AHYA 4HK5A 4F2UA 4TUFA 3VNLA 4QITA 3H55A 1MSSA 4P7RA 3ZSSA 2FIQA 3SB0A 5HJXA 4OBTA 3GVQA 5I07A 3A3WA 3LRMA 1B5TA 3I7SA 3LNPA 4S2BA 2FGLA 1OSEA 3BLDA 1QBAA 1C29A 3W7GA 3GYEA 3TEVA 3WJSA 5MKGA 3LPGA 1R46A 4M5PA 4KBXA 2D22A 1A5MC 5I02A 3BARA 4LVGA 3TQVA 1YDNA 1SSGA 3IARA 1KGWA 2H8ZA 4WUIA 3D3AA 3W27A 4DUXA 3UXLA 2VZSA 3C3NA 3OVRA 1VD6A 2QUVA 4QAWA 3AICA 4CEXC 2CC0A 3QZAA 2F61A 3BLEA 2OR2A 4K68A 4LYPA 4B5NA 2PP0A 3RO6A 4WXYA 4CNPA 3CUXA 2HE5A 3H7RA 4EAYA 2HV5A 4CQBA 1W17A 1DJZA 3D46A 1DWFM 3LM3A 1GG0A 1Y8BA 2GVEA 1EL3A 1AMKA 4KGJA 1EUAA 1X1OA 1EPXA 3O63A 4PSPA 2CBVA 4AWUA 3W1UA 3TNOA 2B4GA 1N8FA 1TPVA 1KWGA 3LEPA 2YDSA 2TODA 4Z17A 3VGBA 5J8LA 3P5ZA 3UG3A 4QFUA 1X38A 1BFNA 1BGAA 1GVYA 2Z7GA 1YW1A 1MUWA 1IV8A 5BU6A 3SN1A 4O14A 4HPNA 4KCWA 1LL7A 1RV8A 3FIGA 2PWUA 1RP9A 1UBSA 4ADTA 3MKCA 2WSRA 3W1TA 1QNQA 3UCDA 3VD3A 1M6JA 3SCOA 4XUYA 1VP5A 2F2HA 2OEMA 4EPKA 3PBMA 5ABFB 1R5YA 3ZZ1A 1E0WA 4YS1A 3AU6A 2X42A 3CT2A 1JD7A 3N18A 1DJQA 2VR4A 5I3HA 1XIIA 2D20A 3PN8A 4UIOA 3K1DA 3PFRA 4K7YA 2J6VA 4NUWA 1UKQA 3ZIZA 5CZKA 2H9AA 4Z1BA 1AZ2A 1EOKA 4AWTA 3OTRA 3WMSA 1ZUAX 3DFTA 1TUFA 4WY0A 4FF5A 4JFWA 3G6LA 4P8VA 3KLKA 4LCRA 3IS4A 1X39A 4WHBA 7XIMA 3I3DA 4LUTA 3CHVA 3RPTA 4A4AA 2CHOA 3B8TA 3CUJA 5M03A 3OBAA 4IP7A 2NXGA 2VX4A 1Z41A 2DSZA 2BX7A 1D7FA 1TZ7A 4PMOA 1ITCA 3ZLHA 4WY0B 3T9PA 4AIEA 4E2VA 1U1UA 3CV1A 2WLYA 4W8BA 1Z8AA 5B7YA 5HATA 4BJHA 1YPFA 2J6XA 3N73A 3G6MA 4X0NA 5FAGA 1TRIA 4MB1A 2ZUUA 2VWTA 1XBYA 2ZTKA 1NVMA 1VZWA 3ANVA 5G1TA 2QCMA 4H9XA 4JZ5A 2DT3A 1GZ1A 2EPLX 3DCPA 3VOJA 4AEEA 3WEMA 4ZTXA 3H2MA 2ASHA 3NQMA 1TJ1A 3W37A 3LD5A 5EB8A 3NZPA 4MG4A 1IEQA 3OO2A 4CUCA 1PTGA 1E4MM 4TV5A 3D0CA 4C5ZA 2PWEA 2WYSA 1AQHA 2BMBA 5JH1A 1JCTA 4PMRA 3EB2A 3W7MA 1GVIA 1UA3A 4XZMX 5EMUA 1W9UA 2W5FA 1JXJA 4RNIA 3NQDA 5D9OA 2CLOA 4FP1A 4ZOEA 1JQXA 2PLKA 3W81A 2VDHA 3MHGA 6PTDA 3CAWA 3WD0A 3JS3A 5IHSA 2VD8A 1NWSA 1W3TA 1H61A 2PI6A 1M04A 1XG4A 2J7FA 3DUGA 3R2GA 4CCEA 1REQB 4E4UA 3WYZA 4HZ7A 2E6DA 3QHOA 1HP5A 1TTIA 1MMFA 2WNQA 5A2CA 4LS0A 3W02A 1FH8A 1IR2A 3TN4A 3W24A 3ANUA 3VDBA 3N13A 2CLHA 3Q4DA 4J40A 3NTYA 4JIPA 4ZZ9A 2OLSA 3G3MA 5AZ0A 3ARZA 2YLAA 1UPMB 3M0ZA 1HJVA 5C9RA 3GS6A 1EKOA 3GVWA 1FCQA 3H2FA 2QF7A 2I14A 1KBJA 3CYVA 4GZIA 4MYXA 2WWCA 2WOQA 3EX4A 1HFBA 3QMSA 3XISA 1RQHA 1TMHA 2FZ9A 3ALFA 1DQUA 1OF8A 4PH6A 1ZAIA 2ZX8A 2PDNA 3NQCA 3ERPA 2PDKA 4WIWA 3T2OA 3TP4A 1U1JA 1B3ZA 2VC6A 2VZUA 3CB3A 4QP0A 3HPSA 4NNBA 1FP9A 4XKYA 2Y8VA 1PB0A 4NNAA 1UROA 1R2TA 3CHEA 2DUXA 4JCLA 1BTCA 2QUUA 3MSGA 1UIPA 4MWAB 3HQPA 3H22A 2XYLA 5GJMA 2EGZA 2VHLA 1AJ0A 3MMTA 1H2JA 1JGIA 5GPRA 3SI9A 4EF8A 2HNHA 3HFTA 3H4XA 4GVIA 2VX7A 4IX2A 4C1LA 3UCQA 3THAA 2FPVA 2GK1B 4GVFA 4WKHA 3C4UA 1XBVA 5I3GA 3OP2A 5AHNA 1SO3A 3U48A 2W92A 2XVKA 1YEYA 1ZFJA 1Q6DA 4AD4A 3SN4A 3AWOA 1A4LA 4K36A 3VD7A 3EWWA 3IJQA 4NRSA 1QWGA 1XG3A 5H8PA 3KP0A 2E0PA 4M80A 1MW2A 2J75A 5CJMA 4PMXA 2XN2A 1FVPA 1X96A 1LP6A 4Z0JA 5DXYA 2QDHA 1WV2A 3L67A 2Q71A 4IX0A 1OCNA 4TTUA 2NQHA 3IEBA 5JIPA 4OBRA 1M53A 2J27A 2XH4A 5CLWA 1B1YA 4GVGA 2KX9A 5A6TC 1KTNA 5HWMA 1C8QA 2H6RA 3DFOA 3KBVA 3TU9A 4XZBA 4MZ8A 1CXKA 2NVAA 1DJWA 1TWSA 2X1RA 5FJIA 4DJDA 1B4EA 1K7EA 3ZXWA 3VD9A 5FEWA 1O94A 3G8RA 4JFTA 3MANA 4Y8EA 1JPKA 2UY5A 5FKYA 1VJIA 4LNCA 1DQXA 3CHCA 3BPWA 4DELA 2BXVA 3D47A 2Y1HA 3WCZA 2UWFA 4R5EA 4U33A 3ID7A 1BAGA 5IRPA 2AMXA 2FQIA 4HNTA 3M0XA 1EH9A 2YW3A 4HNVA 4D6GA 1G4PA 2DIKA 5F1VA 4Z2GA 3TDFA 3R89A 4EXBA 1JCYA 3KBJA 3LN3A 4GKLA 5CZ0A 3KRSA 2FFIA 3P2VA 2D73A 4CCCA 1F3EA 3LCLA 1VHCA 3WD4A 1R86A 1US0A 4OV9A 3QW3A 2Y85A 4NAFB 1TG7A 4H9VA 1IGWA 4PMYA 1JPIA 3SUWA 3WY1A 4PTVA 1LLOA 1K9DA 3NQ7A 5CH9A 1ICPA 4X2PA 1V6WA 5HPOA 3PWAA 4XVEA 4P5UA 2UBPC 2A21A 5ENLA 5HR7A 1AQFA 2JQXA 8A3HA 1EP3A 3GUGA 4MGGA 2PDJA 3S6OA 2OWCA 4IQDA 4XAFA 1XQKA 4QRNA 1SM9A 1JZ3A 1H1YA 2GDUA 4W8LA 1KBIA 3KVLA 1TV7A 2V3EA 1TYGA 1X97A 2ZVIA 2ZYFA 4QG6A 1TPEA 1EXBA 4G1KA 3STPA 3ZYZA 2XFFA 3EPOA 4L4LA 2JEQA 5F7UA 3W9ZA 3VFLA 4IQJA 1U5VA 5JIWA 2XWDA 4LAZA 2WO5A 3M4HA 4RX0A 1K03A 2FFCA 4KEUA 2J7CA 4IIHA 1Y65A 4DI9A 1JI1A 3W26A 4S39A 4O11A 2PGFA 3SDOA 3BW3A 3I4EA 5KEZA 5D02A 3V7PA 3L68A 3ZSTA 4YMZA 1C91A 1HXJA 1YX1A 2J7GA 4MLJA 1P0KA 4WEVX 1E1CA 1J10A 4AW7A 1QK0A 3GW0A 3GHSA 3O7UA 1KBLA 2JALA 1QPRA 5C2CA 1E56A 1QI0A 2QPUA 3B4YA 3AIQA 4MVAA 1S3TC 1Q8AA 2R6OA 3BGJA 1WUEA 1K4GA 3G18A 4Z2LA 3OIXA 1DJIA 3GR7A 3KL0A 1BD0A 3EXTA 4CNOA 4OUIA 1F2JA 1ISYA 1WDQA 3EMZA 4NZJA 5C71A 3BQ6A 3VTRA 4IL0A 3SCRA 1UD5A 1H1NA 1E0XA 2ZUVA 5C9WA 4GC3A 2WCAA 4L6DA 2Z6JA 3WLOA 2QDEA 4K39A 5FA5A 1ZZMA 1KM6A 3ANYA 3RLGA 3B0VC 1G6CA 1MEIA 2PFHA 2WJEA 4WKFA 4ZOBA 3PZOA 1IWPA 2A3BA 3VCRA 3BCFA 4WOQA 5IBXA 1BEUA 3CWHA 3VE9A 2XISA 2PDQA 1IXNA 4GWEA 1OIMA 3QZ6A 1XH1A 4HN4A 4LGXA 1JULA 4C6OA 3R13A 5I24A 4RK8A 2F7FA 2J79A 3GXDA 5D9NA 4PB3A 3LHWA 1GOQA 1GUVA 4H41A 3RNDA 3TQKA 5C0QA 4Z1AA 2D2JA 2VM8A 4A8IA 2DQWA 1GHSA 1P0DA 4UMCA 3TLQA 3W22A 2A0NA 1XCFA 3HV8A 2FH8A 4YTQA 4AEOA 4GKTA 1XGZA 5HUPA 1OFBA 4HHMA 2Z00A 3HPXA 2VO5A 4OJYA 2GJXA 1LJYA 1EWEA 5E5CA 3L9CA 5EMYA 1DOSA 1LBFA 5D2VA 3U2OA 3HMJG 1QT1A 3HPFA 4JD4A 4LCQA 4FNUA 3LXAA 7REQA 1V77A 1MEWA 1DJGA 1NOUA 3GDTA 2X7WA 3W53A 2HZGA 1CEOA 4HK6A 4NJHA 3CLMA 2A6NA 4CKQA 2Z1VA 2YW4A 4G5DA 1EC7A 4IFRA 3CMFA 5H8MA 1XLGA 3EOUA 4JQAA 3MUZ1 3KWSA 1OVDA 1H63A 2NVCA 2DIJA 3KLLA 4MY9A 5GNYA 3F4NA 5CSYA 4IJBA 4JPGA 1UA7A 2QCCA 2OXNA 2VVNA 3SQSA 4MWAD 3GQYA 3WK2A 7PTDA 3G0UA 4AZHA 4EVZA 3VKKA 4AHQA 1ODUA 5GVJA 1RVGA 3N15A 3AXKA 3MHUA 2J8TA 4YYFA 1EFZA 2E1DA 4B9ZA 1MYRA 4W9TA 4PGLA 2Y8KA 5AZ1A 4Z0SA 1IQ8A 3GNPA 2CZ5A 1KR1A 1H7NA 3V3WA 2BOFX 4C6DA 3G1FA 1JZ4A 2FGBA 4OBSA 3CO4A 3IRDA 2YCKX 3QSRA 2OSWA 2UY4A 2Q8ZA 3JW7A 4RLIA 1BRLA 1UD8A 1ADDA 1XYLA 1AW5A 2ALDA 3N34A 4D72A 4JTEA 3K8KA 4IFKB 3N04A 3OIHA 2V38A 4MKSA 2PWFA 2W27A 1B9BA 3XIMA 3IGXA 1HL2A 4PMUA 3TVAA 3VILA 2ZXDA 1XDMA 1SSDA 1W5QA 1UD2A 5CC5A 1V93A 5JH2A 3SY5A 4ROPA 4IFOA 4FMVA 4Q4RA 4DZ5A 1AG1O 1WAWA 3DGBA 1FCUA 3NQVA 3LENA 3HGRA 3IV3A 4XK2A 1JNEA 2AOSA 4GVHA 3N6JA 1LORA 3NA8A 4U5KA 3AHZA 1XLCA 2PBGA 5FF4A 3GBEA 1ZBVA 3W85A 1BF6A 3WBAA 2GL5A 4CVWA 2R1LA 1VQTA 3E0LA 3WQCA 1P6CA 3MSRA 4R9OA 1FCBA 7ODCA 1XYAA 1XRSA 2PD9A 1ZJHA 1TIWA 1BSLA 4GNKB 1D3GA 1V7AA 3JRKA 3ECQA 3UWEA 3WDHA 4ZVJA 4MTVA 3TXVA 2C91A 3I6EA 1ZALA 3SUSA 3IK2A 3UW6A 1Z32X 2BDQA 4UC5A 4FEZA 4CD4A 4MFEA 1I4NA 2Q09A 4ZCWA 4PSRA 4AYGA 1WKDA 2VWSA 3NCOA 1O68A 1WX0A 3F7JA 4DB7A 2OVLA 3VIMA 3HMCA 3H2CA 3A13A 1GT8A 4IP5A 1UUQA 1GORA 2VGIA 3WNKA 1XV8A 1OFQA 5BZAA 2EHHA 3VKAA 1RSCA 2EPKX 4O8RA 3ITGA 1QNRA 3UA3A 1IR1A 3MS8A 2OLHA 1KRCC 1DVJA 3WFAA 4HOXA 2O9RA 4RE0A 1PPIA 2PGEA 5I5RA 3PBGA 4CQAA 4UTUA 4ALDA 4B5WA 3D6NA 1VIZA 1EJXC 3OW1A 2WHLA 3GTNA 3LXBA 4JICA 6ALDA 5C8BB 3CAQA 1IGSA 3KCLA 4BI5A 1M7XA 2D2HA 1XC6A 2RHGA 3VVGA 4LUTB 1W3NA 5CQ1A 3WQVA 1CCWB 3WDIA 1V0LA 1XDLA 3MI2A 4DY1A 1TR9A 3UWVA 4GYJA 3AWNA 3GIQA 3CZEA 5B80A 4R7JA 4JTTA 4E2OA 4UZSA 1JGMA 3OJGA 2WB5A 1OFPA 1W9DM 4XZNX 3C0JA 5K2ZA 3URAA 5AFDA 5I09A 5TIMA 1CDGA 2EO7A 4H7ZA 3CEPA 4IPPA 5EMLA 4FLRA 4D6DA 2WVUA 3T42A 3TWBA 4PMQA 2RKXA 4JOMA 4XIMA 3LV6A 5CCZA 3TTYA 4XAPA 3WDPP 4NX5A 4AZ7A 2X1TA 3RLHA 3C5QA 3QQ1A 2G0WA 3URBA 4EWJA 3LGGA 3KW3A 3V5FA 3PBWA 1L8NA 3KOFA 4L65A 1VFSA 4DQWA 3QC0A 2BB0A 1E6ZA 3RX4A 5HNTA 5TBOA 3KOWA 4LV9A 3GNOA 3DENA 1LRQA 3VZXA 3WLTA 4H83A 3EWDA 4F8XA 3MZ2A 4HMNA 4JNYA 1F4AA 5LHFA 1SUXA 1AH4A 3K4WA 5LIKX 5IBXC 3W75A 2MNRA 2BBFA 4L56A 4NU7A 4H4IA 2IPWA 4EAMA 2OWXA 3M07A 3LPPA 4QG8A 2PDMA 1OB0A 2BXYA 1VJSA 3ABXA 2Y63A 5I7GA 5XIAA 5CJ5A 1XWYA 5FCZA 5LA1A 1EP2A 2QKFA 2WW5A 3KVJA 5KINA 4ENLA 2Z28A 3H21A 3L5AA 1GOMA 1VBRA 1JRBA 3S2NA 3N12A 3WD3A 2WQPA 3DFPA 3ARVA 3SIZA 4GUHA 3AALA 2BWGA 3W1QA 3A5VA 1BQCA 3L12A 3WSUA 4IISA 4JTDA 3DHDA 4R3UA 4U4MA 3MUXA 3LHUA 3OLEA 2UV8G 1A47A 1K7XA 2ZUNA 1M1BA 4TTGA 1HZYA 1UH2A 1NWRA 3LI1A 3HTWA 2UY2A 3QEZA 4WSKA 3BVJA 2BVDA 3DEQA 2ACUA 1YQ2A 3LBOA 4O18A 5I00A 1UWTA 1KM2A 4QLKA 3QR3A 5G1YA 2E1WA 1CXHA 1G7UA 3N9SA 1M3UA 4C7GA 1KFCA 3WF4A 2PDUA 3DFQA 2B7QA 1NP0A 4YNGA 4DBUA 4OT7A 3PY2A 1F6YA 4PMJA 1TX0A 2CZFA 3F2BA 3WQ8A 2BVTA 4KGLA 4DNHA 4LUSA 4AY8A 4GA8A 4XTDA 1WB0A 3LDVA 2Y5JA 2PDIA 4H6KA 4Z08A 2D1ZA 3CUIA 2CWXA 2WBKA 3QH2A 3TAOA 2PGWA 3WBXA 3VKCA 3C52A 3ES8A 4H2HA 3R7MA 3CPGA 4JQ3A 3TX9A 1J6OA 3P14A 3EWUA 3DESA 2OT0A 1HF6A 1MW0A 3SCPA 3MTWA 3NEHA 1PXGA 1I2PA 2OGYA 2ACSA 3SEPA 4MZ1A 2CU0A 1I6NA 2B7OA 1GOIA 3TJLA 2IKJA 3AMDA 4AF0A 1F05A 2VFDA 5LA2A 3K13A 3TXZA 1PV8A 5DFAA 4WCJA 4FXJA 1H7WA 2O4MA 2FTWA 2EBNA 2QEZA 4JIHA 1UKOA 1TR1A 3FOKA 1EEXA 3TCSA 2VOTA 3R0DA 1Q65A 1FTXA 4CN6A 1XYZA 4QR6A 3BG3A 3P7YA 1GVQA 3CTLA 1WP6A 2RGLA 4AXNA 3TTSA 1TUXA 4NILA 2WVTA 3AMLA 3HIJA 1R7AA 3W2NA 1C92A 4C65A 1JNDA 2J7DA 1W3HA 3T0TA 3FX4A 1ISXA 3INPA 2ATMA 3I3BA 3TYZA 5AC7A 3QW4B 4FX6M 1JYNA 3UWWA 3K2GA 4X0VA 3NYDA 5BMWA 3WDRA 4GYPC 1A5OC 1XIJA 3EEGA 3VNJA 4X9YA 5CPMA 3I10A 3C2YA 3IVTA 5XINA 3O1NA 4JTQA 3AIBA 2O9PA 4S3CA 4DLFA 4GACA 2G4FA 1VCFA 4GXPA 3AXHA 3VE7A 4A21A 4RKAA 3NAVA 2YB1A 2E9BA 1K8ZA 1NFBA 5C2XA 4NSBA 3N4FA 1YBQB 3DFHA 3B9DA 1V0KA 1SGJA 3PZQA 5JMUA 2Q8LA 4GIYA 2F38A 4R85A 2C16A 3UR8A 4K8EA 4IMCA 2VQUA 1KRMA 4D8AA 2CLKA 3BJFA 3E2VA 2HK0A 2J4GA 4A35A 1VFTA 4S3BA 1V0MA 4AVNA 2QS8A 1RH9A 4KF1A 1FWTA 2CBUA 3THDA 2AAMA 3CU2A 4UTIA 3JUGA 1AW1A 3RLVA 1TJ2A 4H7VA 3W70A 4G7EB 4HPJA 4LRSA 1IEVA 5BW6A 4NQ1A 5CBBA 1HJSA 1GG1A 2CERA 4IMAA 2QUTA 2IW0A 1HKVA 1F8MA 2PWGA 4XBJA 1VBHA 3IIXA 3RR4A 2WHJA 1CLVA 2P0OA 2R1KA 3L2MA 4ZE5A 1UWRA 3UXIA 3VIHA 1FUYA 3MHFA 3NPWA 3QZEA 3MI6A 3PJUA 3W76A 4Z42C 1N2VA 5A6SA 1A5BA 1THFD 3TMQA 1KRAC 1VBJA 1OGGA 2SFPA 1M03A 3EZ4A 4KETA 2PTYA 2Z2BA 4NXSA 3UQNA 4KFNA 1SVDA 1AQ0A 1PIFA 3QR1A 1GJUA 4I9AA 1T8QA 5AECA 1RPXA 2JE8A 3UPBA 1K7FA 1AL8A 5F4XA 1PX3A 2D24A 1J6PA 2E3ZA 2QV4A 4KKXA 3EBVA 4UNIA 1NWUA 3HF3A 1JUKA 4A3RA 3P8JA 1V6VA 4QHRA 3MP4A 4DVOA 3VFCA 2OSXA 4HZ8A 2FDSA 4RZ6A 3RJXA 2RFGA 1JZ5A 4JQ1A 5FI8A 1IEXA 4DZHA 3B9NA 5IFTA 2OO0A 1ISVA 3GD6A 2ZZ2A 4LVDA 3UNTA 3UPMA 3V0TA 4JIEA 2WANA 1R9ZA 3FXYA 1XRFA 4L6OA 5KZMA 3ME3A 2TRSA 1QBBA 1A0EA 1FHVA 3ARTA 5DRCA 3DC8A 5DELA 1UCWA 1P7TB 2WKJA 4QE1A 1EDQA 4LY4A 5FJPA 3S5YA 3N4AA 4GQ0A 4POCA 4B90A 3N4EA 4AFYA 1HJWA 1Z42A 2QYGA 2V8ZA 4U3AA 3TTQA 5FF2A 1OFDA 2A4AA 1KXVA 4A8NA 4FA3A 4KCUA 2PRMA 3F2DA 4QEHA 4GMEA 2ZX7A 3EAUA 3MMWA 5AYYA 1AMYA 3KCOA 1E6NA 4AQLA 1JYWA 3RX3A 1YLVA 1PO9A 1ME7A 3BW4A 4EE9A 3EWZA 1OFEA 3WFLA 1SFJA 2I7GA 3A4AA 5D8ZA 3W1MA 3P5YA 1XLFA 2ZDRA 3OVGA 3RCNA 4W93A 1M9HA 1SFLA 3NFUA 2BGNE 4O0KA 2OODA 4DX3A 4YLWA 1SZGA 4PE8A 3MV11 3KVKA 4UNKA 1S46A 1C9WA 3NQFA 4XG1A 2JGYA 3AHXA 1Z48A 1TRDA 2PUZA 3BGAA 4RUBA 1RA5A 5A8MA 1ECEA 3LQLA 3VDHA 4FNSA 1ZCCA 3VKBA 3GWQA 2V3DA 4DJDD 1VRXA 3GBDA 4AWEA 3P62A 2D0GA 1LT8A 1EPVA 3ITVA 3EPNA 4N6EA 1YTKA 2Y5EA 3U3HA 3ZR6A 1O5QA 3S6DA 3QV9A 3ZLFA 1QMLA 1J8VA 1Q8JA 4D9PA 3B0YA 3FYOA 2QPSA 1A0CA 4WJXA 3TA6A 3MT1A 3LGDA 3VOIA 3CJPA 3W72A 2YDAA 4TVDA 2WNZA 3VGGA 4CD6A 4J27A 1GVFA 4GQBA 2AKMA 4LQ1A 1PTAA 3G22A 3S9IA 5EFFA 5L9FA 5CAKA 1TWIA 3HO8A 4C91A 3MUCA 3CZKA 4XO7A 3UJEA 3W1AA 1LTDA 4JHZA 1DIEA 4GABA 3ZR5A 1W9XA 2ZRUA 1VPYA 5CSRA 5I6SA 3GX9A 2PU0A 3I7RA 4CCDA 4QTGA 3UZJA 4B4FA 3GIYA 1P1XA 3GB6A 2VENA 2YA1A 1UZHA 1WZAA 4QDWA 2CETA 5FF3A 1S38A 4FZIA 3WELA 1G94A 2OYMA 2BTMA 3SIMA 1XF0A 3RR1A 3O05A 3O16A 3UWQA 3FSTA 4RW5A 5IDZA 1B4KA 1A5AA 2YL9A 5BRPA 1EX5A 4PUKA 1FHLA 3GFXA 5A69A 4IG2B 4C6NA 1WA3A 4JTLA 4XV0A 4DWSD 3PTKA 1MQRA 4H7CA 1M68A 3THQA 1I8JA 2R91A 1NEYA 2OEKA 3LBMA 3UR2A 1UR9A 2VOMA 3T44A 1OF6A 3VDAA 2NVDA 3ARYA 3S2LA 2Y5SA 1ENUA 4WSHA 4GLEA 2ACRA 3GHTA 4R53A 1J0HA 1F4HA 4S2CA 3B3DA 3CEUA 3T0CA 3ZVHB 4N0RA 4E2BA 4Y9AA 3ONBA 4DUOA 3UA4A 4ZL1A 2QVHA 4AHOA 4JXCA 4I7WA 1P0EA 2PDWA 1R47A 2V2HA 4OU1A 3PPGA 1RY8A 1OWQA 1PZ0A 1GVRA 3U2ZA 1FWHC 1GZGA 4L1WA 3L66A 5HBFA 2ZX5A 3K8LA 2HBVA 3WK0A 3VCCA 4P8XA 4GBUA 3TSDA 3EGJA 3F2CA 2IKHA 3P93A 1VFUA 4IP4A 1RHCA 3O9NA 1PX4A 2J24A 1UD3A 1BWVA 3SGGA 3W7OA 4I3GA 4D6FA 3N3MA 1GYMA 2ZWYA 3R94A 3WQDA 1IXPA 5HMDA 3MCMA 3N3TA 3BAJA 1Z44A 2YBVA 2POZA 1VFHA 4L80A 4GUIA 4QQ3A 2GVLA 4O10A 3TTOA 4RDYA 1S5WA 5HJLA 3QGVA 4A29A 3W88A 3VINA 2GUYA 2XM2A 4AUBA 4H9YA 3T40A 2NX1A 4JQ2A 5EU9A 3KBNA 5FEXA 5ABHA 4CNNA 4Q3MA 4H04A 1XFCA 1MO0A 4LB4A 4W84A 4IHCA 3W7QA 3WN6A 1OX4A 4M7TA 4DJEC 3NO1A 4G8TA 3P80A 2WZHA 1ZBCA 4J3XA 4H9UA 3GNRA 3SQLA 3RM4A 3L0GA 4MWAC 1E4NA 1XH2A 4Y9MA 1TWZA 2ESCA 4X22A 2XH7A 4H2CA 1W9PA 2FGZA 4HMCA 3V4BA 1CXLA 4LY8A 1ZU8A 4NY2A 4Q8PA 1Z3NA 1S5VA 3A23A 2ABAA 4UR9A 4OZOA 2C71A 1NM9A 3MJYA 2INEA 3V18A 3EA3A 4TVUA 4UTLA 4Q4MA 3BMVA 2DSUA 4GCXA 4KFPA 2XIJA 1IEWA 1TMLA 1QTWA 5KETA 5FAJA 2ZX6A 1DWAM 1Q6EA 1TB3A 1DP0A 4LUYA 3VNKA 4HU0A 1DWHM 1XX1A 1RZMA 5EY5A 1R3QA 3AXXA 3C86A 2G97A 3N2BA 1K77A 2VD9A 2POTA 4C1KA 1SZEA 1Y5WA 1XQLA 3UFYA 3M0VA 1DJYA 2WKGA 2FJKA 3ATZA 3FHAA 2EAWA 1OYAA 1Q63A 4YTTA 1N8WA 4E4PA 4PTWA 2HQAA 5REQA 5FJTA 2BSLA 3N2TA 1KBBA 2JKEA 1FA2A 2VUYA 5M2FX 3BUVA 2P1FA 1Q85A 4P61A 1FWSA 5BNKA 2ZVRA 3CHFA 1H7PA 4ZOCA 1K6WA 1O5XA 4RE4A 4P7OA 1P6WA 4AZ6A 2IKGA 3U6WA 3PC0A 2VX5A 4LYQA 3H7VA 4QJ5B 3HM7A 3BOFA 4NAFA 5LNUA 3RK8A 1JDDA 3AC0A 3LCXA 1OFOA 3FW6A 1SW3A 5EBAA 3GY1A 3MCNA 1VYPX 1RQEA 4YN5A 1GYNA 3QMRA 1B2YA 4J1OA 5LGXA 3NIYA 3V0SA 2YLLA 3C56A 7REQB 3APGA 2ZXAA 3WDJA 1OG6A 1R30A 2ICSA 3IIVA 2HDJA 1KBKA 4N2YA 3PTMA 3LSBA 4QCFA 1W1B1 4IPNB 1G4EA 1HT6A 3A4XA 3KE0A 3CBWA 2I5IA 4AZCA 1X98A 3HZ3A 3N1AA 2ZA2A 2VEGA 4US5A 4QIUA 4Q7BA 2OZTA 3L0NA 3ZT5A 4ZENA 1GW1A 1M7JA 2IPGA 3QPZA 1ZP3A 4CVUA 4YPJA 1QPKA 5IFPA 1N8IA 4C6IA 2G95A 4DXXA 1QI5A 2MUCA 4CEUC 4BFAA 1LDCA 2V30A 1K9FA 3W4RA 3OYXA 2WMGA 1JDAA 1UD4A 4DNMA 1SW0A 3OPSA 4XD5A 1W8GA 1T0OA 4GYKA 3FHQA 3DBPA 3IJ7A 1R3YA 4Y9OA 1BXBA 1J5TA 2YL8A 4ERIA 1JF6A 1LOLA 3CQIA 4UUIA 1Y7VA 2GJRA 3LLDA 1OZQA 1YTDA 4J3ZA 3VOGA 3KS6A 2DSKA 3UERA 2VRKA 3N2OA 1XP3A 5B7ZA 2AL2B 2BY1A 1VFLA 1XLJA 5LYRA 3ITYA 3CASA 1EXPA 3KTSA 4BY3A 3SN0A 1GHRA 4YIWA 3QV7A 1VBUA 1GGOA 1S1PA 2E6AA 4WXZA 4W4QA 1YXYA 2GPTA 2Y88A 4N42A 4L4OA 3EX1A 3PG9A 4O1BA 3IJ8A 2CHRA 1HL9A 2I5GA 4OQVA 3FVMA 1A5KC 1XSJA 3H6OA 3VIJA 2PRHA 2UY3A 3KOZA 3VAVA 2J47A 2VCCA 4HP5A 4CLMA 5AC4A 3WNLA 2X1UA 1UKTA 3EWXA 5HNUA 1VLWA 3WD2A 3PBVA 9CGTA 4WD0A 1Q6FA 4Q4KA 1NFGA 4HHPA 1UP0A 2QIWA 4MKVA 4UQCA 1UOKA 3BANA 1UWUA 1TE1A 3WENA 3S1GA 3L4ZA 1K3UA 3A4JA 4NZ4A 2EPOA 3MBFA 1E71M 3OA5A 4WOZA 3PUOA 1YKWA 4Z2IA 4WQ6A 4FX7A 1ALDA 4UQEA 3LG3A 1I2QA 3O3RA 2R8WA 1LUCB 2FPTA 4FALA 1PL9A 4JN7A 3C61A 3PSVA 3R8HA 4K8GA 2ZDSA 1G67A 3MWCA 2DT0A 3LCIA 3WNNA 4IF2A 3T8QA 1XL9A 4WZHA 3AMCA 1PIGA 2G96A 3AYRA 5BXTA 4JX4A 5DLCA 3TUUA 1S2VA 3WQWA 5CEWA 3AMGA 2PD5A 1MW1A 1OQFA 2QHAA 5IXEA 1GPFA 5CAHA 3PWIA 5T91A 3S6TA 4J5NA 1YIXA 3W84A 4CU6A 3AZTA 3WD1A 2OX4A 5FIPA 4KH2A 3NSMA 2GSHA 4KT2A 4RDVA 3TR2A 5K9DA 4NF7A 2QCDB 2HRWA 4REQB 5BMXA 1A5LC 1X1NA 2FB2A 4C6BA 2OOFA 4JEQA 4IL2A 4LAUA 4UTJA 5CPLA 1DV7A 4IXHA 1FKXA 4LSBA 3NL6A 4XD3A 2NV9A 2CLLA 3BURA 1KFEA 5ABTA 2J13A 3DFYA 1UB3A 2QZRA 1KM0A 1QO2A 4AZIA 4C60A 4IPJA 2PTXA 3WFZA 1E70M 4ACZA 4LRTA 4IMFA 2P50A 2X2YA 5HINA 4LOCA 2IQDA 5FL1A 5KZEA 3PTQA 4GO8A 2GGIA 4MNJA 3VZZA 3WBEA 4ZXOA 4J2MA 7CGTA 5EKYA 1XIHA 1ONRA 1HJUA 3UF9A 3GTXA 2NSOA 3VIGA 5BWAA 4PULA 1W2VA 1XD1A 4DWSC 4GNVA 2NQ5A 2PA6A 4O50A 2YL6A 3WEOA 2KZHA 4GINA 3WO8A 8RUCA 3IV8A 2AQVA 2G50A 3LB0A 5LNSA 3QY8A 4E6MA 2FMOA 2XVLA 2DVTA 2O55A 1US2A 2Z1XA 1HNYA 2V69A 3LUTA 2QPXA 4AWSA 2EG7A 3BSHA 2DZUA 4ZB2A 3IGUA 1J0JA 4D6EA 3VM7A 2ZXBA 2TAAA 3F4VA 4NZ5A 2VP8A 3VOCA 2GQ9A 1GTHA 2ABBA 3M7WA 2WSQA 2PTWA 3URQA 2CCRA 3DFSA 4QS5A 2NUYA 3QPYA 3W7DA 1B31A 2PZ0A 3KZPA 1JFXA 3NM1A 4ACYA 3SM0A 3LCWA 2VRQA 3MBDA 3A3XA 4HHLA 1N7KA 2Y70A 3UG8A 4KRTA 3E1F1 1TQXA 2FB3A 2ZA1A 1BGGA 3W01A 4ICMA 3UGVA 1B3YA 4MWAA 1GJPA 5D32A 3SJ3A 1KFLA 2DDXA 1R0MA 2WZEA 2ZZ5A 1WO2A 1LWJA 3I3EA 4MDOA 1W6TA 3GXPA 1V0NA 3LMZA 3M6DA 3GH7A 4V28A 3R4IA 2X09A 1QCWA 3CM4A 4YCPA 5SWUA 5I0DA 3GSMA 3B0PA 2Z1BA 3NPUA 2A3LA 3OBKA 4KWSA 4QJ3B 1OD8A 1RALA 4JKMA 4Q4SA 1SJCA 2OZ0A 3QKZA 3N6QA 1HX0A 3TW9A 3BXWA 4JFSA 4KIRA 2WV8A 4E8CA 2HMCA 3FEMA 2PC8A 3VMPA 1JR1A 4BQ4A 2NWRA 3GDLA 8XIMA 4Y8FA 1FH9A 4JTHA 1QATA 3EKLA 1Z9AA 2WWDA 1J96A 1F8IA 2ZUSA 4E4FA 1R6WA 3QGAC 5LIWX 4Q8QA 2EXOA 1PZ1A 4AISA 3B06A 3B8VA 1OGSA 3NO5A 1EJWC 1SQ7A 3LTSA 2ZZ6A 4LH8A 2Z1KA 5ECUA 3E6EA 3LX9A 4GJIA 4B15A 3NJ3A 4L4MA 3MMDA 5TQLA 1L6FA 2ZFAA 4GI6A 3V75A 2ISFA 5TNVA 1XFBA 3NPVA 1TPB1 4AD3A 1VCGA 3R10A 4JYEA 5D03A 5GQBA 1W5MA 4IQLA 5CXPA 1EO5A 3E0FA 4GJ1A 3U2CA 1X6UA 2TMDA 2YKKA 3WUEA 2WPBA 1LROA 1VAHA 3S0CA 1XLIA 6XIMA 1XLEA 2TSYA 1EC8A 1TPC1 5DT7A 4UFLA 1SFTA 4GIEA 1DXEA 4YVXA 2FH6A 2PWDA 4GXWA 4EP8C 4GIAA 2YCIX 5LNRA 1SMAA 2HBXA 5D4YA 4P8WA 1O60A 3V1HA 4FB7A 1UKSA 5EBUA 5KZDA 9XIMA 1I2OA 4B3KA 1V02A 3R79A 4G6CA 3DECA 5IDIA 3G1HA 5FSEC 2OGJA 5HMEA 1MI3A 1W56A 4DAFA 3GHUA 1EWDA 1V3JA 2OKTA 3PPHA 5DMMA 4LVBA 3W7EA 1K4HA 2PTDA 5AVHA 2Z1SA 3ZMRA 1Q4WA 2OO6A 3RCMA 4EWND 4IJRA 4RZ4A 4JX5A 3W6YA 1KB3A 5CC6A 4B3ZA 3L5MA 3QTPA 2IXUA 1OX4B 3GZ3A 3UYIA 4K1GA 3QY7A 1E3ZA 4Q6JA 2FYMA 1GVOA 1LUCA 2BLEA 3WF2A 4M6PA 4O54A 2DUZA 3CQJA 4W7VA 5C9UA 1QASA 5T9BG 2TPSA 3LS9A 1DIKA 3APYA 4HKPA 2HNEA 3VNYA 3P61A 4MY1A 4TIMA 4W5ZA 1UWIA 2XH2A 3A24A 3U9IA 2WAGA 2B31A 4F3HA 3M41A 4J3WA 3V16A 3GDMA 1I0BA 4S3FA 1XH0A 1S2UA 2WMFA 4V15A 4PFHA 1LBLA 4ZQMA 4US6A 1H7RA 1NY1A 3Q58A 4JFUA 1R3RA 2OFJA 1D7KA 1TZ9A 1KFKA 1ISWA 4RJEA 2GGJA 6REQB 5D05A 4EK7A 1KNWA 1QPOA 2DP3A 3TMLA 3C3UA 3ITXA 3FAXA 3MUIA 1RR2A 1XLBA 3RPMA 2PLMA 3OG3A 4H9ZA 3WLPA 3RRAA 1L2QA 1OK4A 2QULA 4G1NA 3DN5A 1DKWA 1W5OA 4OIFA 5DT5A 1J93A 3EB3A 2FPYA 2D2OA 4G9PA 1U5JA 1ZGDA 3Q45A 1H7XA 3IJIA 3SGUA 3SY8A 1IT8A 2FTYA 1AJZA 3K4AA 1E6SM 1U5HA 3W73A 4GI9A 1Q2SA 4E3VA 1IXOA 2JFEX 3DYMA 1EIBA 3MKKA 1PCKA 2ISWA 7A3HA 4IIDA 2CHNA 1B3XA 4KFOA 3CMJA 2GOUA 3OGVA 2REQA 1W31A 2OTDA 2PRLA 3AIWA 4PL2A 1MNSA 1WXJA 4O1FA 1QI3A 2NSXA 4XWUA 3RYSA 2YPIA 3URNA 1ELSA 4GYFA 3VX0A 4K3ZA 1UPPA 4LFYA 3IWPA 1JEZA 5D33A 5I3FA 4V27A 4IIBA 2QJJA 3W1RA 3E38A 3UG5A 3RMJA 3UJFA 3CPRA 1Q6RA 1QW8A 4G56A 5G1MA 2PDCA 2YFNA 3C6CA 3F4CA 4ONVA 4IGNA 2ZRZA 4BCEA 2FZNA 2I9EA 2QCEA 4M0XA 1B57A 3WMBA 3I65A 3P8IA 2HE8A 5CPQA 1EYWA 1LG2A 3UT0A 5E6YA 3NQAA 5E70A 1NTHA 4RV8A 1FXPA 1IIGA 2CYGA 3OG2A 3RU6A 3LSCA 3VOFA 3LHTA 2Y7EA 4X3ZA 3A4WA 2H3BA 3P6LA 2IQ0A 4PB4A 1CGXA 4DZAA 1IF2A 1NJJA 4PZVA 4G7FA 5GJPA 3LTYA 2NX3A 4AHPA 3KHDA 4OFCA 3L4XA 4J4KA 3TSMA 4XZIA 3M5XA 4GRSA 3CC1A 4M51A 3VGFA 1A5CA 2VUNA 2X8RA 4ORIA 3AIEA 4NKCA 3CL8A 3A5FA 4WDXA 1XM3A 4KESA 4LW7A 4Q8MA 3TN3A 2QMKA 2YDQA 4LT9A 5FF0A 4DI8A 2QCGA 3AYSA 3NGJA 5IHRA 5HQLA 3ZOAA 3JR2A 3VNMA 2QDDA 4FNQA 2G4JA 3AYTA 4A3HA 1GK8A 3W2JA 3RG6A 4A2SA 1WNOA 4AIBA 4NG3A 4XIAA 3R12A 3EOOA 4AC7C 4QDPA 4MSSA 4ZE4A 5LNVA 2BHZA 3ES7A 2FZDA 4I90A 4XQ6A 3JZEA 2PS2A 4RV3A 3SCVA 3DI0A 3FY1A 3BTNA 1FWBC 5HA7A 5I79A 1E6QM 3KOXA 2OKOA 5A6KA 4HA0A 4ZO8A 3UPWA 1K70A 3BLLA 3IAQA 3VNDA 1G4SA 1GWJA 3PB2A 1S39A 1DJNA 3NUKA 2EPMX 4DAIA 4NJJA 3CLWA 4UMBA 1OZMA 4BWLC 4FSAA 8XIAA 2Z25A 5L6UA 3BSMA 2AKZA 1OX5A 2PSNA 3W7CA 5FJRA 4CQCA 4IPLA 3CH9A 1EYEA 5HDRA 1A53A 1CLKA 1EJSC 1GVSA 4DPQA 3CIXA 2WC3A 5I3KA 3THUA 2X0HA 2BHYA 3W74A 3TQ0A 1RJPA 2E5CA 4UTWC 3TNBA 5H8UA 3PBYA 1E3XA 1NDVA 4X60A 4HA4A 2EPNA 2HROA 4QNEA 4DUVA 3NOYA 4PRWA 2WVVB 1LQ0A 3NXFA 1XYFA 3VKDA 3AMKA 1AK5A 2ZQ0A 1GQLA 2DT1A 4M3PA 4HYWA 2XINA 4A22A 2VEMA 1ZCOA 3NZ1A 2Y7GA 2ZBTA 2YYUA 3N9RA 5DBUA 1SO4A 4LVFA 1US3A 3RHGA 2HEJA 4HNLA 4R9XA 2EG6A 1MDLA 4Y90A 3VCNA 1RBLA 1JCNA 4JY9A 4UTWA 3VD5A 2WK2A 4MB3A 5BCAA 3AISA 2DJXA 1OCJA 3EXSA 3NXLA 3AJ7A 1F3TA 3OLIA 4QBXA 3LA4A 1PDZA 3C2VA 3AXMA 5EMKA 1H3GA 3O8AA 4H6EA 3SCSA 2QLYA 1TQJA 1J5SA 3O6CA 3M6YA 4PN2A 7TIMA 2F6UA 4DO7A 4FHAA 4GO9A 5A95A 4REQA 3VD4A 5FJJA 3OEXA 2C6QA 2XVGA 4NAEB 4XKMA 2D0HA 3R8GA 2A3HA 4OECA 3WIJA 4B92A 1KFWA 1VYSX 4LYKA 1TVNA 2F2KA 4O4VA 5HOSA 1BPLB 3VDCA 3NZGA 4EACA 1DTUA 3LHYA 4GGBA 2FVMA 1FWRA 1JDEA 1R8LA 1SU5A 2FVKA 3I68A 4JTRA 3GFZA 1CTNA 2QIIA 4M7SA 3BOXA 2Q8XA 5TAOA 4CD7A 1ECQA 3HGJA 1HO1A 1ML1A 5BROA 4HCHA 2FTPA 4DJFC 1OY0A 1IT0A 3W00A 1MXGA 3PK7A 3U5UA 3FA3A 5A8OA 5BXRA 4KCVA 4OVXA 2V67A 2FLIA 2RJHA 3TJIA 4HNCA 4F0KA 1YDYA 2VYOA 2C0HA 2I16A 1PBGA 2B7PA 3LERA 3M9YA 3PNUA 1WDRA 3MO4A 1W3KA 3LPOA 1JZ6A 1Y5XA 3GDRA 4Z2KA 3KAOA 4I6VA 2PE4A 2HPIA 3WH9A 1QOQA 1P1MA 2NT1A 3OODA 3B40A 1F6KA 3KFTA 3BAWA 3W1LA 3MPGA 4IIFA 2DZVA 4K2SA 3WLQA 2DZPA 4PL1A 1EDGA 5LSMA 1KXTA 1FHUA 1TJ0A 3E2SA 1PTDA 5I3DA 4JHOA 3WH5A 1UC4A 4A8LA 3J7HA 1B9ZA 1O66A 3ZJ7A 1ONWA 3BV4A 4UWMA 1LCOA 2OYLA 3AZSA 2C14A 1FDZA 4HZ6A 4J2PA 2Z27A 3R11A 4HOZA 3ITTA 2BY2A 1J0YA 5EFDA 2OLAA 2YCJA 3EWYA 1SPQA 4RDWA 3UJ2A 3ZQ9A 4K1WA 4ZA0A 1AVAA 2QAFA 3ARPA 4TMCA 1TTQA 4Z2HA 1YDOA 2QF8A 4TX8A 2YYTA 1W1ZA 4HMEA 4DF1A 3TA9A 2AMGA 5G4HC 3BL3A 3BW2A 4HU4A 3RCYA 1UHVA 3AJXA 3CUGA 3MYOA 5HNRA 3ARWA 2A3CA 1LYXA 4D6HA 2J8GA 5C55A 4I7VA 1QUMA 1J12A 3C0QA 2ZZ4A 2C8NA 2HS8A 4X9SA 2Y8UA 1XBZA 1UZDA 3ATYA 1XR2A 4QDMA 3MSYA 1XSKA 1QJWA 3IVSA 3KEHA 3W7HA 4R33A 3CIVA 3W2UA 4DXVA 3HV9A 4JYDA 1SZFA 4EPEC 3VMNA 1EJRC 4JTIA 4HT3A 1F76A 1W5PA 4RPQA 4H1ZA 2QUMA 3L2IA 3R0KA 1BYDA 1VR6A 2VJXA 1J0IA 1EB3A 1PKYA 3UZ5A 5HJYA 3GIPA 4H8NA 3BMWA 4S3DA 2VELA 1TPWA 1BWLA 2XSAA 2XM1A 4XAGA 1UMYA 2PCEA 5TD4A 3GTHA 5A8GA 1JZ8A 3VIIA 4YVPA 3ISIX 3TK7A 1XIGA 5LA0A 3IUHA 4PTNA 1JD9A 1M7PA 3TAKA 3SQMA 4GK8A 3WLIA 2W63A 3PZTA 4URIA 3MP5A 4YTUA 5T26A 1IWAA 1DQWA 1BG9A 4AU0A 3MCOA 2FHCA 2W0UA 1NSJA 3TZNA 2XPKA 3N19B 4RW3A 3UWZA 3BCJA 3EOLA 1DORA 3F03K 3PZVA 3AHVA 4F2TA 2J66A 4MPKA 2NV2A 1MUCA 1HKWA 2Q01A 4MFDA 1JPDX 1NOWA 4CD5A 1ZENA 1PEZA 2G3IA 4B2DA 3G1YA 1CB2A 2J78A 4QGCA 5MF5A 2DY3A 3SRDA 4GIRA 4MJ2A 1P0NA 3RDKA 1E72M 1GQNA 2ZRWA 2BS9A 4S23A 1VFMA 3KBWA 3V35A 1OIFA 4DBEA 4BF7A 2XIMA 4HHHA 2F6KA 4ASTA 3W28A 3GR8A 3RPDA 3TTEA 2CLEA 4HCLA 4IOTA 1XGEA 4BF9A 2OG9A 4QCEA 3VNIA 3IJDA 3WLSA 1XKYA 4Q4PA 3HPZA 1WDPA 3JVAA 4FR1A 3AS3A 2QXWA 5J04A 1VC4A 3KWXA 4PTXA 2GUUA 1XICA 3H2NA 2O92A 4LANA 4N9BA 1D9EA 4S1FA 4KWOA 3BLOA 1XI3A 4NI3A 1IZKA 4H8VA 3ARUA 3PFMA 4DEFA 5A6MA 3S5SA 4ZQOA 3BGGA 4MAZA 1E1EA 1O4UA 1E9LA 5HAOA 1P7TA 2GWGA 4JN8A 2BY3A 1SZNA 4NT0A 4DWDA 1A4MA 1PHQA 4Q8NA 4LAKA 2E68A 3NGFA 2R14A 2XUCA 1NQ6A 2CBIA 3KOYA 4JTJA 1D3CA 2VNCA 3HOJA 3HGOA 2D3NA 4FIQA 5F1UA 3KP1A 3GDKA 4EANA 4O13A 2ZTJA 2PB1A 3PS7A 3VIFA 5K3VA 5CG7A 2XHYA 3DBNA 4ATDA 3KM8A 5E6ZA 4ZR8A 3CAKA 2I5QA 4HOWA 2JKPA 1W0MA 1CYGA 1M65A 4Y2WA 1TVLA 1VFOA 3GAYA 4E3TA 3G3DA 4EOUA 1XYBA 1Q6OA 4KS0A 3FJNA 3EDJA 3Q94A 3G1SA 5HUOA 2FHBA 1YNQA 3S8HA 3H7UA 3NPXA 4B4HA 3B05A 2HWGA 2J74A 2HK1A 4KPLA 4HA3A 3DYOA 2TYSA 1X7FA 2E7FA 4M24A 1EA0A 1EDTA 3C8NA 4J35A 1DL3A 1PSCA 3FFSA 4AVFA 4FXRA 1JDFA 2PMQA 3OZOA 2QCDA 1R38A 3CUFA 1AODA 4HVXA 3AQUA 3LNMA 4KWUA 4DO6A 5KSWA 3SW6A 4H9MA 2O56A 3K4DA 2RAGA 1OJXA 5CG0A 1TWDA 3VIKA 4PFMA 1FXQA 1PWLA 1D2KA 3CZLA 3IJ6A 2PDHA 1UP3A 2GUBA 1T40A 1EP1A 1HVXA 1NDWA 2GGHA 5I06A 2I56A 2CFFA 3CZJA 3GC4A 3VNZA 4DLMA 5F4SA 3T05A 3UEQA 2QR6A 3DG6A 4FOJA 2OWWA 3ARQA 3KBMA 2VXNA 1WDWA 4I7UA 1LOSA 1Y0EA 3W6LA 4UFIA 1S1RA 3OZYA 1NFPA 2EG8A 2E8YA 4MAVA 4QS6A 1YE6A 2V68A 3QQ0A 4JTCA 4N02A 5K7JA 4FNPA 1UWAA 1V3IA 4HSOA 1FWFC 1PE1A 4IUGA 2QJGA 4ERAA 2V3GA 3NL3A 1O6IA 1Y5VA 5I23A 1G1YA 1BWKA 2YSWA 4GFIA 4GI8A 3A22A 3B8IA 4ORMA 4AB4A 3ZT7A 4JEJA 6REQA 2GZXA 3H4WA 1KV5A 2XSXA 1HL8A 2XU2A 1YXCA 2R94A 5G2IA 2V63A 4XVDA 1XIMA 2W6RA 5HANA 5GJNA 1JVNA 1UC5A 1HG3A 4JYFA 3BAKA 2CWNA 2IS7A 5ABGA 3UY7A 5JBEA 2HPMA 2RUSA 2W9MA 3V36A 3DU0A 4NZ3A 1EQPA 1C8VA 1XCWA 4JTFA 1W8SA 2ZUTA 2A3AA 3TCEA 3TV8A 3MW7A 3M0MA 2ZRYA 3QR0A 3UP8A 1L6WA 2XFYA 1ADSA 5ABEA 3TJ4A 4FNRA 2W67A 3CAVA 3B4UA 3TN6A 3DGRA 3DXIA 3TW7A 4LU0A 3TW6A 3WQPA 3RITA 3O6DA 1HJXA 2Y2WA 3N2MA 4YU1A 3ALGA 3KCJA 4H8HA 3LLFA 1EC9A 3K30A 3T0BA 3UR7A 2V5JA 3PNZA 3VGDA 2DZWA 4XISA 2OELA 4DWSB 3WK1A 5AC5A 2JIEA 4O1CA 4YXGA 2CBJA 3TC3A 4AZ5A 1EBHA 1V6YA 2PGRA 2V81A 1H41A 4XBSA 4I5XA 4JDYA 4HPGA 2RGMA 3TSBA 4NJGA 3VGHA 3IRSA 3ABQA 2BASA 3BC9A 1CX9A 5FOOA 1CT5A 3R25A 4RE2A 1H51A 2RJGA 3TFXA 4E5TA 1XYMA 4HGXA 4MNKA 2DZBA 1UR3M 3K5XA 2D2GA 3NR0A 4D8ZA 1RAKA 3E9AA 4Q8WA 4LNYA 3SURA 2QCHA 3FA5A 5HR6A 2BGSA 4F2BA 1UQYA 1TE6A 4P7QA 2CEQA 3PB0A 4J28A 4FI4A 1F74A 1ZJAA 2XTKA 4ACZB 2QMJA 3K8MA 1LL4A 4W85A 2INZA 4BHYA 3ARXA 1CGVA