2E6AA

Crystal structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with orotate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
312
structure length
312
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase
publication title Crystal structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with orotate
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase
total genus 106
structure length 312
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2006-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 2e6aA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2e6aA01
2KZHA 3VFLA 4BWLA 3UYCA 4Y8FA 4IMEA 1TTQA 2C1HA 3MUXA 3NVTA 4BFAA 1DQWA 3TXZA 5E0KA 5HMSA 4UMAA 3W75A 2CLFA 4FIRA 5LHEA 2B7OA 3IEBA 4WUIA 1ICQA 5D03A 1H7XA 3BG9A 1T8XA 3MBFA 3HQ1A 5HUPA 1TPWA 2CLLA 1X1OA 1X8FA 2QF7A 4RV8A 3TMLA 5FESA 1QAPA 3W1QA 4ZVJA 2QJIA 2Q8LA 1SFLA 4QISA 2UV8G 3SY5A 3GVGA 4WZHA 4YXGA 1Q6LA 2Q3OA 1VCVA 4GFSA 3QZEA 4LRTA 3P74A 1TPDA 4X9SA 1GVRA 3UPWA 2V2CA 3LTSA 5KTLA 3W7NA 4M5PA 4DPPA 3G1HA 2W6RA 3I7RA 3P60A 1EPXA 3G1DA 3DH7A 2DJXA 3R2GA 3W1PA 5AHMA 1T96A 2FB3A 5K3VA 1OX4B 2BZNA 4Q4KA 4WQ6A 3TK7A 3T78A 8TIMA 3S9YA 3CC1A 2TMDA 2EHHA 3ABQA 3EX1A 5CKSA 3B03A 2FPYA 5D38A 3SW6A 5AHEA 2NZLA 1T0OA 4MZYA 3SIZA 3TQ0A 1I2NA 3GKFA 3U6WA 5L9FA 3LCFA 4Z08A 1G7UA 4FEZA 2CLIA 2G97A 4UFLA 4Z1CA 1AW1A 4FX6M 3CB8A 3M5ZA 3PWAA 5DELA 2A4AA 2YFNA 5BNKA 5J5RA 2VKZG 1FX6A 5D2YA 1JCXA 1H50A 1KFJA 1JRBA 4O1AA 3NQ6A 4NJIA 1L9WA 1M5WA 4MKNA 1TB3A 1GYNA 5LHFA 2WNQA 4MOZA 3S5YA 1XFBA 2A85A 2OMAA 2DZWA 4QQ3A 3UWVA 1K8YA 1W0MA 1TO3A 2NWRA 1KM2A 3O1NA 3KOFA 2JGYA 3GXPA 3GZ3A 1ME7A 2G95A 4OU1A 3U2OA 3GX9A 3ANYA 3W83A 1TIMA 5D2XA 1G4TA 4RK8A 5H91A 5HINA 1H7RA 4MJMA 4DEFA 3A21A 5DXYA 3QMTA 3G22A 1ZJIA 2PURA 3H53A 2B0MA 1WBJA 1O5XA 1YPFA 4IMCA 4RZ5A 4N4QA 3L9CA 4UTWA 1KLZA 2C3ZA 4JEQA 2A7NA 2BX7A 4GUGA 4RLIA 5IBXA 4UTKA 3NQ8A 4RXGA 3STGA 2R14A 4JICA 2B7QA 1O60A 3LI1A 4LUIA 1GYLA 1F73A 4TO8A 1M6JA 4O1DA 4MLJA 4WD0A 2ZCGA 4O4VA 2HS6A 1H61A 4O14A 3IVSA 3O16A 3TSMA 4UXDA 4IMDA 4NNBA 1C29A 4ZL1A 1IXOA 1DORA 3LHVA 5I3GA 1EB3A 1H51A 3PSWA 5G1YA 1XXXA 4R33A 5LNVA 2DZXA 4JYDA 3YPIA 2HMCA 3T4CA 3A5VA 2GQ8A 4JTTA 4FB7A 3W7PA 4RXFA 1K8ZA 1Z41A 3PBWA 4HSNA 3WFAA 3NQ7A 3DFTA 2BTMA 5F2LA 3NGJA 2FJKA 4A3UA 1PE1A 1ONRA 1RVGA 3DGRA 5KINA 3VE9A 3HBLA 2AGKA 3W71A 1OX5A 4O4WA 4WX2A 1D3GA 5LGZA 1VCFA 1W5QA 1MZHA 1TPFA 1UUOA 1S5TA 5FF3A 1FXPA 1L6WA 3GR8A 3B06A 3E02A 3UWZA 3G1AA 2A0NA 1XDMA 1G4PA 1Q3NA 3C52A 3LV6A 4E2BA 1LOSA 1JJKA 1W5PA 4Y9AA 1DHPA 5HWJA 1ZALA 1VHCA 3W7RA 4N6FA 3BV4A 1XUZA 3S42A 1KFCA 1QOQA 3MMTA 3IIOA 3LTYA 5F4XA 1SQ7A 5AHNA 4FX7A 5BOOA 2NX9A 2R8WA 1ZFJA 4K37A 2H3DA 3W7GA 4HKPA 5E93A 4G1KA 1I45A 4O8RA 2Q3RA 4J9JA 1QPOA 1CW2A 1TREA 4M6QA 3ATYA 3HG4A 1TPVA 3MI6A 2CLEA 4NQ1A 3KVMA 4FNQA 3B05A 1G7VA 4MY8A 4UC5A 2YYTA 4NVTA 1EIXA 1GTEA 1MO0A 2I9EA 1VH7A 4GBUA 1YDOA 1YXDA 2VXNA 1UJPA 6TIMA 1GT8A 1KFBA 3EWUA 5F2MA 1JULA 4ADUA 3L5LA 2ZRXA 3W70A 1ZAIA 5K4ZA 4ZQCA 3DKLA 3NQDA 3E12A 3BLIA 3FS2A 4JN6A 5EA9A 1VYPX 3I7SA 3B0VC 2GQ9A 2BWGA 2GPTA 1ZCOA 3TFXA 3RK8A 3S5ZA 1LLWA 4JGDA 1EP3A 3E96A 2F7FA 1A5CA 1W3IA 4R34A 5D05A 1PCWA 3ZWSA 3RMJA 5KMYA 3N34A 4QIUA 5TIMA 3QC3A 4GRSA 3WJSA 1XDLA 3G3DA 3TC6A 2CLOA 2CZFA 2ZYFA 1HG3A 3BK0A 3M43A 5U4NA 3W22A 3NPVA 3GKAA 1Q6RA 3HPSA 3TXVA 4ZMGA 2E1DA 2VFGA 3HO8A 2V5LA 3OA3A 3IGSA 1JR1A 4P2VA 4NJHA 4GUIA 4O1BA 3HG2A 2TYSA 4A29A 2A7RA 2NUXA 4A22A 1F2JA 2ZZ5A 1JCLA 5HWNA 3K30A 3NM3A 1FCVA 4EF9A 3LHYA 3NZRA 1R2SA 2VFDA 5CZSA 1LP6A 5GVJA 4NX5A 2V9DA 1SO5A 4OQVA 3S1WA 4CQ9A 4PFMA 2C15A 2J9YA 4UTUA 3WK1A 4S2BA 3W23A 2DZPA 5AC7A 1TPC1 2GOUA 2YSWA 3W73A 1LLZA 3GR7A 3S8HA 4EF8A 5KSWA 5BRBA 2X1RA 1GG1A 1RPXA 4CNPA 3CTLA 1WXJA 2B4GA 1DVJA 3H54A 1TPEA 2HS8A 2Q8ZA 3LXBA 1W1ZA 3Q58A 4UFJA 3TW6A 1NAL1 1W56A 3LLFA 1PS9A 4JXCA 1OHLA 3LHZA 5CZ0A 3E0IA 5LZLA 4O15A 3LXCA 4Q32A 5CSSA 1HL2A 4WJEA 3ZS4A 1OABA 1WX0A 3BG5A 4UUIA 4MY1A 4CNNA 2ABBA 3SJ3A 3LCXA 3SI9A 5LSMA 4MZ8A 4UTTC 1QDSA 2E6YA 4HNUA 3G3MA 3DFPA 1QO2A 3TSDA 4AH7A 4IGHA 4KWVA 3W1MA 2V82A 1CX9A 4NJJA 4OE7A 1F05A 5DLCA 5CZTA 4ADSA 3IRDA 4I7VA 4E2DA 4P61A 3HGSA 1LOLA 4MPQA 4ORMA 1W5OA 3EX2A 4AEOA 5F1VA 4OWGA 1RQHA 3FJLA 5HR7A 4JX6A 3A22A 3LM7A 5CG7A 3V1PA 3IIVA 5HNRA 2QCHA 3QQ0A 3NQFA 3EB2A 1O95A 3N9RA 4GE8A 3S6DA 1YXCA 3L0NA 1JQVA 1K7XA 1VJIA 3MO7A 1F6PA 1I8JA 4MY9A 2E5CA 3G1VA 3QF0A 4HIBA 4JX4A 1IIGA 3GAYA 1EWEA 3NA8A 1WDWA 4LVFA 3KRUA 2QCCA 3MI2A 2GVJA 1EA0A 3M9YA 4LC8A 5FF7A 3HGJA 3MHFA 3W2LA 1MSSA 2B7NA 2PRHA 1YTKA 3B8DA 1W8SA 2VEIA 3MW7A 3C2OA 4NZFA 3GB6A 3HB9A 4N02A 3FOKA 3W7EA 2V8ZA 4S1FA 1VRDA 3KVLA 3ZFHA 4MZ1A 1R46A 3S1XA 1H62A 1K02A 2E77A 3TX9A 4DPQA 3CM4A 2ZRVA 2DZVA 3W3OA 3W87A 3C8FA 4O1CA 3C2RA 5KITA 2OT0A 1JRCA 1K7EA 3G1YA 2G5WA 2RKXA 2R91A 3SGZA 3W1XA 2BXVA 1JCMP 3TW7A 4WY0B 3EEGA 1TYGA 1HO4A 3ABRA 4FHAA 3VE7A 4JNMA 2ZRUA 3UXDA 1B57A 4IMFA 1ZHAA 2P10A 4YMZA 4WY0F 4JS3A 3U8GA 3WK2A 1OJXA 3NL5A 2QAPA 1XKYA 1M7PA 4N9EA 3OVPA 2WJZA 5G1TA 3F03K 3HG5A 4O13A 3W07A 1SSDA 3N2MA 2FFCA 1LYXA 1TPUA 3DXIA 1BKSA 1GZGA 2Y6ZA 4RCXA 3LCLA 4M6VA 3QEZA 4DF0A 3PBVA 1PCKA 3LCHA 4PL2A 3LRLA 2NX1A 4UFMA 1SR9A 1OFRA 4PC8A 1TV8A 4XQ6A 3WK3A 5MHBA 3NQ2A 2C13A 1T99A 1OYAA 3FEMA 1KM3A 2ATSA 2FQIA 1HO1A 1O5KA 3LXAA 3N3MA 3EX6A 4UTWC 3G0XA 1X6UA 2DZUA 1OX6A 4DBDA 3TJLA 2GJLA 5C5YA 3MYOA 2I14A 3MBDA 5AHIA 5IBXC 5AYYA 3UY8A 5F4SA 1K03A 1PL9A 4LVGA 1DJQA 4DELA 2ZZ7A 4JY8A 1OFBA 4ML9A 3W2JA 3F4NA 3PC0A 3TSBA 2ZZ6A 4QAIA 3W9ZA 3STFA 1FUYA 4LUJA 5KZEA 5AOUA 5G5IA 2HSAA 2CWNA 1UB3A 4L4MA 3UWQA 3PVFA 3C2VA 3R5EA 4XKYA 3EWYA 2ZA2A 1S3HA 2VC6A 5D32A 5HUOA 3TC7A 1TRIA 5G4WA 2E6FA 1H7PA 5BW6A 1WYIA 1RZMA 4XUGA 4OHQA 4CCDA 3L0GA 3LHTA 2Y89A 3CLMA 4IUOA 2VEKA 1SO3A 4WXZA 1VCGA 1C8VA 2J27A 1FWWA 2YXGA 3F4WA 1WV2A 3DI1A 1S5WA 4IWWA 4Z1AA 3RLVA 4XBKA 1HFBA 3PY2A 3GDLA 3D0CA 3EKZA 4XBSA 3UY7A 2VFEA 2Z0IA 2Z6JA 3Q2DA 2E5BA 3EX4A 2YCEA 1DJNA 1C9DA 3LRMA 3I6RA 4GC4A 1QO5A 4AHOA 4JYFA 3BLEA 1LBLA 2H8ZA 4PTNA 3L5AA 3GDKA 1IXQA 3PB2A 4KWWA 3G18A 3CEUA 4JTHA 2RDWA 1OX4A 4LTSA 2EKCA 1OFEA 1B4KA 5D04C 2YW4A 1A53A 3NEVA 1RV8A 4KFOA 4CLMA 3NQGA 3M5VA 1N8FA 4GUHA 3W1NA 4BK9A 4DF1A 1JUEA 3ABOA 3WJYA 2DZTA 2LLEA 2PE4A 2NWSA 3TNOA 4Q33A 1YDVA 4WOZA 3O6DA 2ZA3A 4NXSA 4GWEA 2IQTA 3DU0A 3TROA 1OG0A 3A5FA 3TA6A 3TMQA 3NL6A 1A5AA 3BVJA 1XUUA 1KM4A 4GNJA 4UNLA 1UASA 2V5BA 3W7CA 3JR2A 4LW7A 2DJLA 2Y62A 4UNKA 2QCLA 3NQCA 1XBVA 1QPNA 5F4WA 3TQKA 1LZOA 1IXPA 3DKJA 1KW1A 2J6XA 1H60A 4N6EA 2O7SA 3FYPA 1F6KA 4PA8A 3TU9A 4LRSA 4OBTA 5D37A 3SSJA 2Y7FA 5K2ZA 1S5VA 4LVBA 4JTUA 4HN4A 3RF9A 3PF3A 3PG8A 2C19A 4AHQA 5DCDA 4UTHA 3N9SA 3TH6A 4EVZA 1AG1O 1GVSA 1QR7A 4ZQNA 2Y88A 3CPRA 3MP4A 1H63A 1FWSA 3A23A 4R7JA 2BLEA 1TPB1 2QCMA 3DFOA 3GXNA 3HGOA 4HSOA 1GVOA 1DL3A 5K9XA 1BEUA 1ME9A 3UWYA 2WV8A 1X7FA 3W1UA 3FYOA 1KTNA 2VENA 3FLUA 4KFNA 3DFSA 3QH2A 1FCBA 3PBUA 2Y7DA 4U4MA 4LC6A 1V7YA 2R94A 3LDVA 3NAVA 4ONVA 2H90A 2Z6IA 4E0CA 2Y85A 1R2RA 4HPJA 4N9CA 4TMBA 4A2SA 4Y6GA 2FDSA 4WXYA 1VHNA 3GXTA 1EP2A 2EF9A 1Q45A 4O10A 4Y96A 5LNWA 4NJGA 4UCGA 5K7JA 1PV8A 1MEHA 3FJ6A 2OJPA 3NL2A 4BI7A 4PCFA 4QSHA 4BF9A 4FXSA 4OV4A 3OG3A 2RHGA 1YLVA 3OHIA 5DBTA 3RLUA 3L65A 4QITA 2CLMA 3DAQA 4O16A 2EPHA 1IF2A 2W0UA 5D02A 3NQAA 5F2GA 3DBPA 2F84A 4FNRA 3PM6A 3T40A 3O8AA 3NM1A 1AL8A 5HJLA 5U7SA 4MUZA 3KVJA 3W7MA 1WOAA 4AWSA 4NJKA 3B04A 3KRZA 1I4NA 4Y90A 2ABAA 3KRSA 1KBIA 5I3JA 2WSYA 1L2UA 1OVDA 1KTBA 3R12A 3UQNA 1KFEA 2YW3A 2WKJA 1AMKA 4EOUA 1GVFA 3P62A 2OZ0A 4I9AA 4DBEA 1A5BA 3PB0A 5A8GA 3ZR4A 5FF0A 1L6YA 3KFTA 3PSVA 1EUNA 1VR6A 1YXYA 2A5HA 4JTGA 1A50A 1OK4A 3O06A 5LKYA 2X1UA 1SZNA 5TBOA 2A1YA 3PULA 3V75A 1F76A 1SW0A 3NL3A 3VCRA 1AW2A 5H2ZA 2V2HA 4FIQA 3QW3A 4IX2A 3LTPA 4AAJA 1KV8A 4MFDA 2H3BA 2ZRWA 1LORA 4JYEA 3MP3A 1QNVA 3PUOA 1EUAA 1KM6A 3M1ZA 3LCGA 5DCBA 1VZWA 1FWNA 3IV3A 1SUXA 3P82A 1LOQA 1SSGA 3G1XA 3W85A 2QCDB 3QW4B 2TRSA 5CSRA 1TV5A 3KX6A 1GTHA 2Y63A 3NR0A 4WOQA 5FI8A 1AW5A 1GJPA 5LGXA 4KKXA 4AF0B 4H3DA 4AMAA 1LTDA 1Y0EA 1XM3A 2EAWA 2YFOA 2YGYA 4LWWA 4M7TA 3MYPA 3FIGA 5EBUA 3W76A 1ZAJA 2ZZ4A 1YTDA 3LV5A 3P8JA 3W7DA 1FCUA 3W72A 2HTMA 4GJ1A 4UTJA 3GNNA 1TTIA 3RFAA 2V0TA 3CEPA 1E51A 1TJRA 3STCA 4DO4A 2GQAA 2ATMA 4BWLC 2NV2A 4LOCA 2A6NA 3LCIA 5F2IA 4IPJA 4IPIA 1LRQA 3MHUA 3G8EA 2WNZA 3NYZA 3LB0A 3MWAA 4MVAA 4EWND 1TTJA 3G8RA 4YL2A 4MYXA 1K3UA 3STEA 4XWUA 4LV9A 4O17A 2Y7EA 4O28A 1G69A 1W3TA 4XZ9A 1YDNA 3INPA 2WOQA 1I2QA 4CCEA 2VEPA 3NPUA 2QDGA 3W1TA 4UTIA 2P0OA 3C2FA 2JKAA 2H6RA 4H6KA 3TV8A 2ZZ3A 4O53A 4JTJA 4K8EA 1QOPA 1JCYA 3RU6A 1PHQA 1H7WA 1DOSA 3EX3A 3DHDA 4IQLA 3EXTA 1TCDA 4JX5A 2PRLA 4A2RA 3GYEA 1P0KA 2TPSA 4QM1A 2E6AA 4M19A 5I3KA 3WJWA 2D73A 1FY6A 1H5YA 2FTPA 3TE9A 2GVLA 2RFGA 1XCFA 1D9EA 3W88A 1TRDA 1KV5A 3QQ1A 2CLKA 4PL1A 4W9TA 3LHWA 4I7UA 4CQAA 4N9BA 4UFKA 1QPRA 3W86A 3W7JA 3LGEA 1Z42A 1KM1A 2EGZA 4O0KA 1RR2A 1PVNA 1G67A 5EKYA 1XBXA 3CIWA 5EL1A 4DQWA 5I3HA 3W1AA 1KBJA 3ZWTA 3THAA 1B4EA 1H7OA 4BR1A 3QYQA 1ICPA 3G0UA 3UZJA 5K4XA 3LBMA 4E38A 3AJXA 1BWKA 1LBFA 4BI5A 3E49A 2QCEA 5AYZA 1SO4A 3SECA 1BTMA 3BO9A 1ZY9A 3P61A 4K7YA 4X22A 3UD6A 2QUUA 1KM0A 3QMSA 1U83A 1NSJA 2JKPA 1KFKA 3LCWA 1P0NA 2E68A 3L67A 3EWZA 3BW3A 2XFWA 4AWUA 4HNNA 4DF2A 5EPDA 4S2CA 5D09A 3VI2A 2NUWA 4X3ZA 4Z1BA 1AK5A 2BSLA 4PODA 2Z1BA 4JTLA 5G4EA 3ELFA 1Z48A 3E9AA 4NT0A 2CZ5A 3TAKA 3UNDA 3R13A 3L21A 3AO0A 1OYBA 1DKWA 1H7NA 1KTCA 1P5BA 3QSTA 1GG0A 1ICSA 1W5NA 1FQ0A 4AB4A 3O07A 5FF4A 2C6QA 5D2TA 2QR6A 3W7LA 3NNTA 2H8XA 4WY0A 5D2VA 2JGQA 4JIQA 3P84A 5AB3A 4RZ4A 4K8HA 4GUJA 4O11A 5J5DA 3CWOX 4LS2A 3L66A 1FDYA 1K8XA 4H4IA 3CT7A 1QWGA 3S5NA 2X2GA 3WJXA 1FBAA 3PAJA 3OBKA 3DFQA 3HPZA 3TAOA 2E09A 2P1FA 5FEPA 3TCEA 2A6LA 3HF3A 4NUWA 1KLYA 4RJEA 4JIPA 4QJ1A 1TTPA 1WQ5A 4LY8A 2YPIA 1OFPA 1JVNA 3W7HA 3EXSA 3G1SA 3TQVA 1DBTA 3C2EA 1SZEA 3TDFA 4AWTA 1XI3A 3I65A 4JTIA 3DZ1A 1G6CA 4DO5A 4RKAA 4TX9A 3N19B 2PC4A 1JCJA 4OT7A 2Y7GA 5IM51 3VNDA 2ZRZA 2DORA 1I2OA 3JS3A 3CWNA 1KFLA 3IIZA 4JDBA 1DV7A 4GXMA 5D30A 1EWDA 4LV4A 4BI6A 4UMBA 2J24A 2XN1A 3L5MA 3UZ5A 2A7PA 4X2RA 5ABTA 4JTKA 4LS1A 1IGSA 4TIMA 3FKRA 2FB2A 1J2WA 4JTEA 5L6UA 4HT3A 4UR7A 4K6AA 3WJZA 4IJBA 4ZQRA 1L6SA 3GDTA 4A21A 3EXRA 1VLWA 3O15A 3R8RA 3N2XA 3QPZA 4HHPA 2J9XA 3HMJG 3M6YA 3TUUA 1EX5A 3W1RA 1BWLA 2C18A 3P67A 3QMRA 3BG3A 3P81A 4NZJA 5CPLA 3TIMA 1P1XA 2V30A 5CPNA 1SU5A 1FWTA 1F7BA 3THQA 2YYUA 2ZFAA 2AQWA 3ABSA 3MI3A 2X30A 7TIMA 1SFJA 4ZQPA 3B4UA 4K36A 4LT9A 1QFEA 3UXAA 4O54A 2ZDRA 3PUEA 4YCPA 3MJYA 2RDUA 1OF8A 3HPXA 5CZJA 1LM1A 5E1QA 1SW7A 2CW6A 4MJZA 3FFSA 4QNWA 1RQEA 1LCOA 1W5MA 2QJGA 3PS7A 1D3HA 1OFAA 4C1LA 5C55A 4HNTA 1FDZA 4K39A 5I3IA 1ZENA 2YZRA 4PH6A 3M5YA 1FDJA 2AAMA 3KAOA 3N73A 1TSIA 3GLCA 1CI1A 1VS1A 3S5OA 4NU7A 4UFIA 4Z1DA 1ZAHA 3BW2A 4K7VA 3BGJA 1WBHA 2OT1A 4MIMA 3H55A 5DY3A 1SW3A 2NXHA 3NPXA 4JR5A 4UMCA 2DZSA 4LVAA 2QEZA 5EYWA 1UCWA 4DXVA 3G1FA 1TQXA 3LI0A 4IMGA 2WPBA 4TMCA 1Q6OA 3M41A 5K9CA 2VELA 3C0JA 5LNUA 1J5TA 2PCQA 2FPTA 3KXQA 3IGUA 1W3NA 3W6YA 3W74A 5F1UA 1SO6A 3T55A 5DY2A 4HPXA 5LNRA 2XN0A 1N7KA 1XBYA 1YYAA 1GPWA 2NXIA 2V81A 4OV9A 2ALDA 3LLDA 3BGGA 1FWRA 4NXKA 2NLIA 2ZQ0A 2ZZ1A 1WAUA 3QPYA 3NPWA 1V5XA 2VOMA 4EIVA 5FEWA 5HR6A 2YX0A 3QRHA 2QKFA 3HGRA 2WSQA 3W1LA 4C1KA 2JBMA 6ALDA 1EP1A 1DQXA 3DI0A 1LBMA 2GVGA 3UWUA 4O0ZA 3QFEA 2CU0A 1JUBA 4AHPA 3HIJA 3LBCA 4IXXA 2A2IA 3GDRA 1PHWA 4FXRA 1VQTA 4UTMA 4NX0A 2JK2A 2PRMA 3FKKA 3LERA 1F74A 3C56A 2TSYA 2ZA1A 1F5ZA 3I7QA 4CCCA 3F1QA 5DBUA 1TPH1 3PUDA 3Q94A 4AVFA 2CZDA 1LDCA 1Q6QA 2NX3A 1ADOA 1H1ZA 1N55A 1K7FA 2ISSA 5SWUA 1TV7A 1GVQA 3W2UA 2Y70A 3T44A 4Z0JA 5FEZA 2J88A 1UUMA 1W37A 1FXQA 2QAFA 4OGZA 4LU0A 4MFEA 2YR1A 1OYCA 1FCQA 1GEQA 1OK6A 3TR2A 4R53A 4MLRA 5DCEA 1M7OA 3NG3A 3P80A 4K38A 3OEXA 3R89A 4JTSA 2Y61A 5D2WA 5A5WA 4JDYA 3IVTA 2JKEA 3NQMA 2FLIA 3FA5A 3HOJA 2VFHA 4RX0A 2CLHA 3C6CA 2G96A 2WSRA 1TMHA 3OIXA 2WNNA 3DHFA 3NZ1A 4LVDA 2FPVA 1IIHA 3DENA 3QJAA 3SGUA 1EEPA 2WO5A 3MHGA 2DP3A 1NF7A 4IOTA 4KFPA 4N4PA 5CPOA 1OFDA 3B0UX 2QDHA 5EMUA 5AHLA 3KHJA 1O94A 3O6YX 4D2JA 2YDAA 2X16A 3USBA 4UR8A 4ZQMA 4O50A 4IX0A 1LRNA 1MXSA 3L68A 3W7IA 3P7YA 1LRTA 4JY9A 3IVUA 3CIXA 3LRKA 5AC8A 1OF6A 3BPWA 1TJPA 3QM3A 1VPXA 3W7KA 3W84A 3B0PA 4FO4A 2ZTKA 4IXHA 4XTIA 1IXNA 3TJXA 1QCWA 3CU2A 3UPBA 1O4UA 2ISWA 1YADA 3CQ0A 1ALDA 1ZNNA 4O57A 5HULA 3WK0A 3GAKA 3A24A 1W54A 4YWIA 1XBZA 3O05A 1ML1A 1VYSX 4DO6A 3LOTA 5G2HA 4LS0A 5I3FA 2E6DA 4ALDA 1YTEA 4RZ6A 2O7QA 1XL9A 4FNUA 5AN7A 4JD4A 1KM5A 1QPQA 3BARA 4NNAA 2VFFA 3TKFA 3W7OA 4Z0SA 1I2RA 3GIYA 4O52A 5C54A 2QUVA 3M0ZA 4NNCA 4YCOA 5AHFA 1WA3A 1VYRA 3LHUA 3NQVA 3OVQA 3C4UA 4ORIA 4L4LA 1B9BA 1SZFA 5KZMA 4LNYA 3W7QA 1G4SA 4FNPA 1GQNA 3N14A 3ATZA 2OCZA 3M5XA 1X1ZA 3BLFA 3EWBX 2GJNA 1NEYA 2QCGA 3GDMA 3NOEA 3SFKA 1R2TA 3P5YA 1JCNA 5T26A 4FX8A 3I68A 5KZDA 4TR9A 1VGAA 2OX1A 3TFCA 1NF0A 2Z2UA 5G2IA 3G0SA 3JRKA 3M7WA 3C61A 3CHVA 1KA9F 3NDOA 5FEXA 3HG3A 1A5SA 2VFIA 2X1TA 4ADTA 1NFBA 2A21A 3IGXA 4I7WA 3SR7A 3DFNA 1OFQA 3VKJA 2FIQA 5C2XA 5C6MA 2RDTA 2WQPA 4U28A 3SZ8A 4PEKA 1G4EA 5G2WA 3W2NA 3IIPA 2QCNA 5LNSA 3L2IA 4ICNA 3EWWA 4UTLA 5D33A 1I2PA 2QUTA 3S1UA 1UBSA 2J9ZA 3OVRA 1OFOA 4HNVA 2V2DA 1VC4A 5K9DA 2QCDA 3MP5A 1H1YA 1QMLA 3NQEA 5AC6A 3M44A 3S0CA 1GOXA 4JTFA 4GUFA 4UIOA 2X1SA 2CZEA 4FNTA 1MEWA 4AF0A 4FF7A 1AL7A 4ZZ9A 1NVMA 4MYAA 5HQEA 3BW4A 4N9DA 4AXKA 5DXXA 3NXFA 4CQ8A 5AFDA 3PR2A 5DN1A 3KVKA 4YLWA 1VLIA 5HWMA 4FNSA 3QSRA 2I1OA 1YPIA 3GNDA 4TU1A 2B7PA 4UFHA 3L0KA 1SPQA 3P8IA 1WOBA 3O63A 4XTDA 2ISVA 3M16A 1HUVA 2C14A 3M47A 1GWJA 3NO5A 3A9IA 2GUUA 3P5ZA 1RQBA 3O6CA 1JUKA 4RR4A 5BMWA 3LX9A 3PBYA 3G24A 5FF2A 1R30A 1RD5A 1PIIA 2RH9A 2QJHA 2W79A 1P4CA 3C3NA 1B3OA 1Z44A 4CNOA 2NV1A 2ZZ2A 1SZGA 3W2MA 1R47A 4N2YA 5BMXA 2QCFA 5CPMA 4B5NA 4M6PA 1W31A 4O19A 3IIXA 4O12A 5CGQA 3W2KA 5AYXA 2C0AA 1U5JA 3GK0A 2XN2A 1TQJA 4M7SA 4QNEA 2VEMA 3Q37A 5EY5A 5TQLA 2ZRYA 3RNDA 1MEIA 3T7VA 2DU2A 1HTIA 2C16A 2E5DA 3S1VA 3UWWA 3EWXA 1JQXA 2NXGA 1THFD 1ME8A 4UTTA 4O18A 2ZBTA 2CFFA 1LROA 2ZTJA 1XC4A 4POCA 4ZQOA 2NUYA 3PG9A 4XKYB 3EKLA 1J4EA 3HJZA
chains in the Genus database with same CATH superfamily
3MV11 2KZHA 1UP3A 4BFAA 4F48A 1TWWA 5A2CA 5HMSA 2OPJA 3WEOA 4UMAA 1TE1A 3W75A 4M56A 4QEEA 3R7MA 3AJ7A 3EMZA 3H2EA 2B7OA 3IEBA 5D03A 1EJRC 2ZE0A 1UP0A 1T8XA 2CETA 1C8XA 3MUIA 1AVAA 4E6MA 2VR4A 4QFUA 3SAZA 2V38A 1X1OA 4RV8A 1QAPA 4A8IA 1XYZA 3SY5A 3LNPA 1ONEA 4WZHA 4IUGA 1KRCC 1VCVA 2QLYA 2W63A 1TPDA 4X9SA 3CHDA 4XX6A 4XD6A 3B8TA 4M6UA 3W7NA 4DM2A 4MAZA 5EMMA 3UERA 1EPXA 3RILA 2WJEA 3G1DA 3WBEA 3GG0A 4QG6A 4YHEA 3OP2A 2BZNA 2J6VA 8TIMA 3S9YA 1YBQB 3EX1A 5CKSA 2FPYA 5D38A 3WIJA 1KBBA 1MW1A 3GO2A 1T0OA 3U6WA 3TQ0A 1I2NA 1L6GA 1KBKA 4FEZA 1J0IA 2PF0A 4FX6M 4TQTA 3CL6A 2A4AA 3SUVA 1V77A 2OR2A 5J5RA 1H50A 3MA8A 1XRVA 5BXPA 1UMYA 3NQ6A 4TX8A 4NJIA 2Z26A 2XISA 3S5YA 4ZO9A 1BYAA 2PD5A 3UWVA 1J0HA 3O1NA 4YYFA 4W89A 1BQCA 1RP9A 2RDXA 3ANYA 1RA0A 1U1HA 5D2XA 1G4TA 3A13A 3A21A 4PUJA 3MS8A 4OJYA 5BZAA 3M0LA 1AZ1A 3G22A 3K1GA 3H53A 2ZVRA 2X8RA 4HA3A 4F0SA 2B0MA 4IIBA 5CH9A 4PULA 4N4QA 3KOZA 1WPCA 3VDHA 1O6IA 3DHPA 3VVGA 4ATDA 1ODUA 3CUXA 4JEQA 5FJTA 1CGWA 3VUPA 4RLIA 3NQ8A 2GJRA 1Q6DA 2B7QA 4WK9A 2XHYA 4TO8A 1REQB 5BOEA 2HS6A 1TUXA 3O16A 4XB3A 4QJ3B 4ZR8A 2V5CA 3W26A 1HGWA 1XXXA 2PWGA 3T09A 4B5VA 1OGGA 3UF9A 3V3WA 4JYDA 4HCHA 1XWYA 3VIJA 3A5VA 1HJQA 4FB7A 3W7PA 1K8ZA 4HSNA 3S4TA 2XSXA 3G77A 5F2LA 2FJKA 4A3UA 1MW3A 1ONRA 1RVGA 5AZ0A 3SRHA 1R3YA 3VE9A 1UQZA 1OX5A 1X97A 4O4WA 4WX2A 1VCFA 5JQ9A 3V16A 2A3EA 3BC9A 1MZHA 2OXNA 1TPFA 2R1LA 3B06A 3E02A 3GR8A 3SUTA 3B9NA 3VNZA 1G4PA 2G3NA 4PUDA 5BRPA 2NQZA 4Y9AA 3VD4A 3W7RA 2VJXA 1RALA 4N6FA 2ZUVA 5M3WA 2IMRA 3SIMA 1XUZA 4LBUA 3RJXA 4R7WA 1KFCA 1QOQA 3MMTA 4NYUA 3IIOA 3WQVA 1SQ7A 1R87A 2R8WA 4ICCX 4GOAA 1J2BA 3IWPA 2HJPA 5CC7A 4G1KA 2YXOA 1DJGA 4J9JA 3T0AA 1QPOA 1RY8A 4C1NA 4AZ6A 4M6QA 3ATYA 1POJA 3BV7A 3EBVA 3V0TA 1R85A 3KVMA 4FNQA 3B05A 3MSDA 1G7VA 1OADA 4MY8A 3UEQA 4WKAA 4GVFA 3VKDA 4UC5A 4NVTA 1EIXA 1R7AA 2VC9A 3QV9A 4GYPC 3NJ3A 1MO0A 3LK6A 4MWAD 4NYYA 1VH7A 1XYCA 2IKHA 1MW0A 1YDOA 1GYMA 1PZ0A 2PU0A 1GT8A 2GJXB 1ISWA 4KW2A 4LNCA 1JULA 3L5LA 3W70A 4ZQCA 4KERA 1TWDA 2DUXA 4L64A 3M46A 5A2AA 3FS2A 2HE5A 2DSWA 5EA9A 3G5EA 2BXYA 3I7SA 2GQ9A 1WKYA 4AY8A 1LLWA 4JGDA 4LYKA 3MKVA 2F7FA 1A5CA 1J93A 4R34A 3L4VA 2ZDSA 3RMJA 7REQB 3BSHA 1QNPA 3V35A 4GRSA 3I3DA 4L61A 1XYAA 4JFWA 3EZ4A 4DXXA 1HG3A 4ZOBA 4ZMGA 1WKFA 4GXWA 4B92A 2D2JA 4GA8A 4O1BA 3HG2A 3IJIA 1JDFA 3MC5A 3DOPA 4A22A 4QR6A 1DJYA 4ACZB 3M0XA 2EG8A 3NZRA 5GVJA 1JZ2A 3VIFA 4UTUA 2Y5EA 3KLLA 4XAFA 5AKQA 4LANA 4G5DA 3W23A 5AC7A 1E9LA 1TPC1 4AZHA 3W73A 2EXOA 3NCOA 1GQIA 3EKGA 3DFHA 5A6BA 1FHLA 2QULA 4TOQA 1EGMA 4NG3A 1KO0A 1V79A 2XDFA 2FZDA 3FDKA 3G2GA 1HVXA 4CNPA 1DVJA 1TPEA 1W1ZA 1EDTA 4UFJA 1NAL1 9XIMA 4XSLA 3W82A 1OHLA 4KMQA 2C79A 3DX5A 3D3AA 2ZWZA 4DAFA 3RIKA 4E2OA 1JDCA 2JF7A 1JPHA 3A6OA 1WZLA 3LCXA 5LSMA 4RNIA 5E0CA 3UR2A 4MF4A 4HNUA 2GSJA 3KCJA 2V82A 1CX9A 4B3LA 3TONA 5DLCA 3URQA 1UIOA 3ARYA 4MPQA 4FLRA 4ORMA 1XSKA 5A95A 2G41A 1RP8A 1FTXA 4JQ2A 1RQHA 4RDWA 4X0NA 1AD4A 3TN4A 1QOXA 4REQB 3IIVA 2QCHA 3QQ0A 1ZUAX 2DVUA 4PB3A 1O95A 4GE8A 1YXCA 1K7XA 2PDXA 1I8JA 2Z27A 3KDOA 4MY9A 2E5CA 4KPLA 1V4YA 2PZNA 3JW7A 4HB7A 4JX4A 1IIGA 1VKFA 1WDWA 3KRUA 3NURA 3OW1A 4RV3A 4LC8A 3WF3A 5FA5A 5FF7A 3W2LA 3KS5A 1LT8A 1U1JA 2VEIA 3MW7A 1DWHM 1ZJHA 3LY0A 3RCMA 4N02A 1XGDA 1VRDA 2GWNA 3KVLA 4X61A 2E40A 3ZFHA 2I17A 5ABHA 3S1XA 1QT1A 1W1B1 2ZRVA 5A6JA 3W87A 2OT0A 2C7FA 2VP8A 1K7EA 3VINA 1V02E 2R91A 1TWSA 1HF6A 4GXPA 4HCDA 4YN5A 1IEQA 1F3TA 4F8XA 3EEGA 4XZHA 3ABRA 4AY1A 4IGMA 4JNMA 3LSBA 4BKNA 3H4XA 1B57A 4A3YA 4IMFA 1EBHA 1ECEA 2VI0A 2OQYA 4JS3A 3U8GA 3NL5A 1FWJC 1XKYA 4N9EA 3OVPA 3M0HA 2WZHA 1EH9A 3FXYA 2INFA 3NDYA 1TPUA 3RPTA 8CGTA 1J0ZA 1GZGA 1J6OA 3LCLA 4ZB5A 4GIRA 1XYLA 4H8HA 1OFRA 4S3GA 2VZUA 1JPIA 3DECA 1S1RA 2C13A 3FEMA 2QMKA 4LUYA 3PJUA 4UTWC 3G0XA 2DZUA 2VQTA 3CIVA 1E9ZB 1QU4A 2NV9A 4MNJA 4Y8EA 2IXVA 2I14A 3MBDA 5AHIA 5AYYA 3WNNA 5F4SA 3SM0A 1K03A 4LVGA 4DELA 5E6YA 4L1XA 3ME3A 4P5UA 3EA3A 3WMLA 3F4NA 3PC0A 2WLYA 4QE4A 3DGBA 2QJJA 3BGAA 7CGTA 5KZEA 2QV4A 1VD6A 1NOWA 3R5EA 4XKYA 3LLXA 4EK7A 2TAAA 1FWHC 1TRIA 4Q4RA 2E6FA 5A94A 4P7OA 4GC3A 4OOUA 4DWSC 4IUOA 4LPCA 2VEKA 3WNPA 3C0SA 4WXZA 2J27A 3EB3A 3IJ7A 1M3UA 2QGYA 2YXGA 3CAWA 1P43A 3ZVHA 1OT1A 3KOYA 3QXBA 1A3XA 1GOWA 3R79A 2WMIB 4I5UA 4X9YA 3CAVA 4S3DA 3K4DA 2VFEA 2Z0IA 4L6HA 4GY0A 1EGVA 1EC7A 4R85A 1DJHA 3SURA 1C9DA 3CMFA 3IJLA 3OTRA 1A49A 4IP4A 5ABFA 3BLEA 1LBLA 2OEJA 2DSZA 3PB2A 1IXQA 1EF3A 1M7JA 3IJ9A 2EKCA 4B90A 1EXBA 1B4KA 1A53A 4CLMA 3NQGA 3ES7A 3M5VA 4DF1A 1JUEA 3WJYA 3CNYA 2ZICA 2PDGA 2F6KA 2PE4A 2NWSA 2YL9A 4LB4A 3TNOA 1FHVA 1BRLA 2V3GA 5FJUA 2QW5A 3SY1A 4GWEA 4ZTYA 3DU0A 3TROA 1HVQA 1RCQA 1UROA 1TELA 1XLHA 1HJSA 4UNLA 1Q4NX 3W7CA 4C7FA 2VX7A 5I00A 2WPGA 3WBYA 2A3BA 3VYLA 1XBVA 3IK4A 3SRFA 4K68A 1LZOA 5CC3A 3WQOA 1UZ4A 1IXPA 2I9UA 2Z24A 1H60A 4N6EA 3S2LA 1LWHA 4IH3A 2C0HA 1MI3A 1F6KA 3FVDA 3TU9A 3A4XA 4TV6A 5D37A 3SSJA 2Y7FA 4QJ5B 4LVBA 3OBAA 4HN4A 3RF9A 2C19A 3AYRA 3T8QA 5DCDA 3OZPA 3V7PA 2Z2AA 4BA0A 2G3IA 3BAYA 1BKHA 4QE5A 2CC0A 2W9MA 1EJVC 1FWSA 3A23A 2ZC1A 1TG7A 4FA3A 4UZUA 1GVOA 2GDVA 3NFUA 2WVVA 2FZ9A 1BEUA 1PPIA 1A5OC 2WBGA 2E1WA 4ZCWA 3R6IA 2HV5A 1BF2A 3FYOA 4PUWA 4KFNA 1Q7QA 2VNCA 2WLZA 1FCBA 1YX1A 3PBUA 3TOPA 4U4MA 2R94A 4RE4A 4L4PA 4XISA 4CQBA 4LEFA 4HPJA 1NQKA 1UR1A 4TMBA 4A2SA 1GPFA 1EP2A 4X63A 4Q8MA 2EF9A 1Q45A 4Y96A 4GCXA 3FGCB 5HMFA 1I1WA 4HHLA 1DE6A 1MEHA 3FJ6A 4Y2WA 2OJPA 1J6PA 4U2YA 3K1DA 3VOJA 4LYRA 4BF9A 2BY1A 3BJFA 1EJWC 3OG3A 1E1FA 1EGZA 3OHIA 5DBTA 4BHYA 3L65A 2QPUA 4QITA 1U5HA 3U4FA 1LL7A 2HXUA 4QLLA 3G6MA 2OO6A 4GZJA 3BLDA 3O8AA 1V0NA 5FJOA 2J47A 3W7MA 1E9IA 2ABAA 1KBIA 4R9XA 2HBXA 2ZX6A 3H2OA 4UOZA 1AMKA 2WXDM 4I9AA 4DJEC 4RE3A 5DT5A 3B9AA 4BEUA 4KWUA 3H12A 3V0SA 5CGMA 3OB8A 5FF0A 1EUNA 1YXYA 3AISA 1FOBA 2QUMA 2INEA 4C90A 1VBHA 1W9VA 2X09A 2A3LA 2F9RA 5C8BB 1AW2A 1H0GA 1KNWA 1N2VA 2QF8A 3ZO9A 1KV8A 2AL1A 1FWGC 1LORA 4FOKA 4YIWA 1YRRA 5DMYA 1Y65A 2VEGA 3UXKA 3LCGA 1VZWA 2RGLA 3CAKA 4CQDA 3PPHA 3BANA 2PAJA 1H0IA 1S46A 1LOQA 5JUVA 2ESCA 1SSGA 1XPYA 1E70M 4V33A 2XTKA 3CPUA 1E3ZA 2TRSA 1TV5A 2YDSA 5FI8A 2DW6A 5LGXA 2BOEX 4XZBA 3EA2A 4AF0B 3E0LA 2YFOA 3MT1A 5GJNA 4M7TA 1F4HA 3AC0A 1YTDA 3LV5A 3W7DA 1XH2A 2YBVA 1V6XA 4RW3A 1UQYA 2HTMA 4JNYA 3ARQA 4GPNA 3C0QA 4PUNA 4GBDA 1NH6A 3B9DA 3CEPA 1JPMA 1C90A 2DUZA 2GQAA 4LOCA 3ARXA 2PF8A 4LY4A 5F2IA 1JIBA 3QZAA 2VM8A 4EWND 2PC8A 1GORA 3N3TA 1S2AA 4MYXA 3K8MA 2IPWA 3KWXA 3KTCA 3NIYA 4GH1A 4XWUA 5JBDA 3R0DA 4O17A 3W53A 1G69A 1AZ2A 3TZNA 5A3HA 2OYKA 3L2LA 2UWFA 2QDGA 4UTIA 5CSYA 2JKAA 1XG4A 4H6KA 4QDMA 3PTQA 4O53A 4K8EA 3A3WA 5A6LA 3ZT7A 4NASA 1UZ1A 5DRCA 3SN1A 2VR2A 3GFZA 1DOSA 3DHDA 4IQLA 3EXTA 2WHKA 3VC6A 4F9DA 3FEQA 2F2KA 3W29A 4JFSA 3KEHA 2D73A 3N6QA 1FY6A 5LIKX 1ITUA 2FTPA 4Z17A 4PEEA 5C9UA 3GRIA 2J7FA 3A3HA 3I3BA 3QQ1A 2CLKA 4P8VA 4PL1A 4W9TA 3BLKA 3DYMA 2Q09A 4KRUA 2Q02A 1E0VA 3W86A 1Z42A 1KM1A 2EGZA 3AZRA 1RR2A 3Q45A 1EJTC 4GO9A 3GBEA 3MKCA 1L0PA 1XIDA 1KBJA 3THAA 3E5BA 1MRAA 1H7OA 1ISYA 1ICPA 3G0UA 2GGHA 4BI5A 2HCVA 4Z1YA 2W91A 1MFUA 2W62A 3B8IA 3TWBA 5HATA 4KEZA 2BY0A 3BO9A 1UH4A 2XH7A 1ZY9A 3P61A 2QUUA 1GKPA 1EZ2A 1QHPA 3QMSA 1FFRA 4AVOA 2DT1A 3LCWA 4S3CA 1P0NA 2X1IA 2XH4A 3BW3A 3EWZA 4IG2A 5I77A 3RX2A 2XJ7A 1J12A 2WMJA 4GG9A 1NP0A 4E5TA 4GIEA 2BSLA 4PODA 2NT1A 5HQLA 3CAQA 2CBJA 3ELFA 1W3HA 3P6LA 4F0RA 4PUMA 1NFPA 5BU6A 3RG6A 3AMDA 3AFBA 3R13A 3PN8A 1P5BA 3RXZA 1GNXA 1W5NA 1SM9A 2X41A 4AB4A 2FGBA 2Z1VA 4Q8TA 4FLOA 3VZXA 3W7LA 3NNTA 1I0DA 4WY0A 1RJPA 3PZOA 3H24A 3TJ4A 2PWHA 4JIQA 4IMAA 4NAFB 1D7KA 2NVDA 5T9CE 3ONCA 2V3EA 1JFXA 3CWOX 4H4IA 3CT7A 2RGMA 2X2GA 3WJXA 3T05A 1FBAA 3PAJA 1QK2A 1R7OA 4QRNA 1FKWA 2A6LA 4Q4SA 4JIPA 1DJXA 1WQ5A 3ZR5A 3EXSA 1XSIA 9RUBA 1SZEA 4TTUA 1P6CA 1XI3A 3I65A 3WH8A 4Q8VA 1G6CA 4TX9A 3N19B 2ZE3A 4OT7A 1GK8A 3AIVA 4QGCA 3B40A 2DORA 1I2OA 2AKZA 1XIJA 3IIZA 2YL6A 4JDBA 2VR5A 1XINA 1EWDA 4KS0A 3WH5A 4FSAA 3GU1A 5CPQA 5L6UA 3IJQA 5A8OA 2PLKA 4HT3A 4TV5A 3MDUA 4UR7A 4A21A 1OGBA 1VLWA 1XKJA 3O15A 2Z29A 3E0VA 1MQPA 3QPZA 2VOTA 1PKNA 3M6YA 3AYTA 1KWGA 4LAOA 2C18A 3MJMA 3NSXA 4P7LA 4EE9A 5FKYA 1KWKA 7TIMA 2X30A 1SFJA 2YDQA 3W81A 3ZMRA 4J3VA 3UXAA 4O54A 3VGGA 2ZDRA 4P8XA 3TN6A 2RDUA 1OF8A 4PTVA 1DJIA 2CW6A 4DWSB 3GUWA 4UR9A 1EO5A 3UJFA 4HNTA 2OGYA 2BMBA 4WSKA 1FDJA 5C7HA 3V1HA 1IYXA 3BTNA 3CUGA 4DJDA 2P0IA 2GVEA 5M03A 2OSXA 4UFIA 1ZAHA 1V3IA 3GDBA 1CXKA 4K7VA 3BGJA 2VT0A 1QI5A 2Y2WA 1DTNA 5HOSA 3PBGA 3JUGA 3NPXA 4UMCA 4EXQA 4LVAA 2QEZA 3LPFA 3MVIA 5XIMA 3H7RA 1XLBA 1BXCA 2VELA 2FPTA 4BZYA 1S2WA 3W74A 3OOQA 2HEJA 2XN0A 2VDGA 3MSGA 1YYAA 2NXIA 2V81A 3CWHA 3BGGA 2JF6A 1YQ2A 1PIGA 3BMVA 3APTA 4ATLA 3NPWA 2VOMA 1OC6A 3XINA 2YX0A 3WLNA 1KCZA 2OYLA 4NRRA 6ALDA 1KQZA 1EP1A 3DDMA 2DSUA 3FA4A 1DQXA 1Q5MA 1LLOA 3F5JA 4H6QA 3AMKA 3UWUA 3WQCA 2YB4A 1JUBA 2KX9A 1S5NA 4WLCA 4FXRA 2FMNA 4UTMA 3PZNA 2CLPA 1F74A 5CCZA 1PB0A 2PTZA 3AXMA 2BOGX 5FJJA 1RA5A 2I7GA 4NHVA 4AVFA 2NX3A 1ADOA 1H1ZA 1JDEA 4GLEA 4L9XA 3O3RA 3PJXA 5FSDC 3MB9A 2Y70A 4QBXA 4YWSA 1W37A 1FXQA 4OGZA 4LU0A 2PDYA 1JYNA 3QY7A 3BH4A 5A6BD 3R58A 4AEEA 4R53A 4MLRA 5E5CA 3P80A 4AC7C 3R89A 1E1CA 2Y61A 4PUEA 4GIYA 1KR0A 4S3EA 4XVEA 3U2CA 2GK1B 3W25A 5A5WA 3IVTA 4H9ZA 3E1F1 3FA5A 4B5TA 3HOJA 5CBIA 1KCLA 4RX0A 3T9PA 2WM0A 4JHMA 2WSRA 3PZTA 1IIHA 3I4EA 3ORWA 1UD6A 1UD2A 4EXAA 2PGWA 2DP3A 4KRZA 5CPOA 2DGAA 4H7VA 3TW9A 1QK0A 2PGRA 3IGHX 3NEHA 1TZ9A 2YB1A 4OUIA 4XZIA 3E2RA 5DEZA 2HVNA 2PPGA 2X16A 3SUWA 1M65A 4W7VA 4JCLA 3KHDA 3AXXA 4MTVA 2O9PA 4IX0A 5MF5A 1YE6A 2YL5A 4W4QA 1LRNA 5CAHA 3HQNA 3P7YA 1E6ZA 3H2MA 1LRTA 3WLJA 3ZOAA 5G4HC 4HU8A 3QM3A 3W84A 2ZTKA 4XTIA 1P48A 4HMNA 3CQ0A 3WK0A 4J2MA 1VYSX 2WMKA 4HP5A 4LS0A 3UT0A 1T40A 1YTEA 2QJMA 4U3AA 1A5LC 1XL9A 4DJFA 4FNUA 1KM5A 2HRWA 4NNAA 2VFFA 3TKFA 5DMMA 1ZGDA 2XWEA 4O52A 1LT7A 5I06A 3C4UA 4L4LA 1SZFA 1XQKA 3VDBA 1G4SA 4MSSA 3N14A 3ATZA 3M5XA 3BLFA 3EWBX 3WLLA 2DT0A 3H22A 2EO7A 1JCNA 3UVIA 4GQRA 1DIKA 2X0SA 3LUTA 1HJWA 3TFCA 2BVTA 1KGXA 2PTWA 3N29A 4F3HA 3M7WA 1XGZA 3GTNA 3URAA 4L9ZA 3SR7A 4I7WA 4PGLA 3GNOA 3NDZA 3GVRA 1BG4A 2PP1A 3UG5A 3VKJA 5C2XA 3A64A 5C6MA 3KM8A 3ARVA 1HXJA 2D69A 4U28A 1W1VA 3A9BA 3CZGA 5LNSA 1EJ7L 3EWWA 4ICNA 3CL7A 2J9ZA 4JOMA 4HNVA 2AL2B 2V2DA 2HDJA 3AHZA 3ZVIA 1AJ0A 3MPGA 3WH7A 1XG3A 1QMLA 3DERA 3M44A 3LMZA 4FNTA 1XLMA 2QDEA 2DSVA 2QJNA 4DJEA 4HOZA 5DXXA 1SMAA 3NXFA 2BDQA 2D3LA 3PR2A 4IISA 3KVKA 4Q6JA 1Y7VA 1VLIA 2NQ5A 5E9AA 1UOKA 1W3LA 5HWMA 4FNSA 3UG8A 2GSHA 3QSRA 3DC8A 3FSTA 2I1OA 3GNDA 3FW6A 2Q71A 3P8IA 1WOBA 3M16A 1TVPA 1ZSXA 2C14A 3OQ8A 3A9IA 1ECQA 3P5ZA 1RQBA 1ZBCA 5CBBA 1GQLA 5IOBA 2X05A 3WNKA 2VD8A 4WCJA 3GNXA 3QGKC 3BLPX 3UGRA 3N1AA 5IRPA 3C3NA 4B5WA 4S23A 5BMXA 4S3FA 5CBJA 3CV7A 1W31A 1VIZA 4O19A 4A6GA 2C0AA 2PDCA 4WKFA 4WSJA 4K8GA 1X6LA 2YCKX 3Q37A 5LIWX 5EY5A 1A5NC 2ZRYA 3RNDA 3AHTA 3T7VA 9XIAA 4YTQA 1HKJA 4J27A 2C16A 3EWXA 1UYQA 1JQXA 1THFD 1ME8A 3VIPA 4UTTA 4M1RA 2NT0A 1FRBA 2ZBTA 2YCIX 1U30A 2XSAA 3RHGA 2WC3A 4HU3A 4ZQOA 2NUYA 4HK5A 3EOUA 4UQDA 3VFLA 2P3EA 4OKDA 4Z2LA 1TTQA 2C1HA 3NVTA 4UCFA 2IS7A 5E0KA 2UY5A 1J0JA 4DZAA 4WUIA 4J3ZA 3T6CA 1Q8AA 1GUVA 2WZEA 2A3CA 4H9YA 5D4YA 4V2XA 4IJRA 2BFGA 3HQ1A 3KTSA 3AICA 1L8PA 2FHBA 1S1PA 5HUPA 1WDPA 3TTYA 2QF7A 3ABXA 2VL4A 4Q8OA 2Q8LA 1SFLA 1HW6A 2UV8G 2R82A 1HX0A 4YXGA 1Q6LA 3SCWA 4Q7IA 1Y5WA 2L5HA 3O2LA 2IPGA 4C6OA 2W5FA 4M5PA 2FTYA 2J62A 5XINA 3I7RA 5A8NA 3QFWA 1Q8JA 3VIHA 2DJXA 1EJSC 5AHMA 1NELA 3EOLA 3LM3A 4B3ZA 1OX4B 4FOJA 6XIAA 4WQ6A 5DX7A 3T78A 4LF1A 4FLQA 4DB7A 1E56A 3GWQA 2EHHA 3B03A 1H49A 3FSUA 3SIZA 3LCFA 4AZCA 4YVXA 4Z1CA 3F5KA 3M5ZA 2VD9A 3PWAA 5BNKA 3T8LA 4WGXA 1FX6A 2QYGA 1MZRA 1TKKA 1KFJA 1JRBA 4GYFA 1PKYA 3ZJ6A 5IDZA 3T0BA 5I78A 4M8UA 4HN8A 2WNQA 4MOZA 2X40A 4DUXA 1KM2A 1X96A 3OGVA 3CB3A 2JGYA 3GXPA 1ME7A 2G95A 4Z2JA 3GX9A 3KBVA 4QS6A 4F66A 4ZSUA 5I24A 4NAEA 5HINA 3WDRA 4DEFA 3PZGA 5DXYA 1KXQA 3S47A 1ZJIA 2J7CA 4JL2A 1O5XA 4EAMA 1W1PA 4PR4A 2NQHA 4AIBA 3JZEA 4D6FA 3AS1A 3VD5A 2C3ZA 3M4HA 4RPPA 3B97A 4GUGA 2BX7A 1OT2A 4UTKA 1E0TA 4RXGA 2R14A 4JICA 1O60A 4LUIA 3ZSSA 4O1DA 3C0LA 4MLJA 3VDGA 2ZCGA 4O4VA 2IW0A 1GOIA 4O14A 1WKDA 4UXDA 4IMDA 4NNBA 3TYDA 4AD3A 3CMGA 3CXOA 3VOIA 1C8YA 3II1A 1PTAA 1EB3A 4LH8A 5G1YA 2C1IA 2VO5A 2I5GA 1YIXA 1TIWA 2WMHA 2HMCA 2ZADA 4X0VA 1TA3A 1S39A 3GE7A 2OG9A 4PTDA 3BAWA 3NGJA 3M0VA 3EB4A 3DGRA 3REQA 1JDDA 3W71A 1XJBA 3I3EA 5LGZA 2IPFA 2V63A 3ZR6A 4HMDA 4Y9OA 1UUOA 5FF3A 1L6WA 1K1DA 3PTDA 3UWZA 3GFYA 4ES4A 4DYEA 3UG3A 1JJKA 3H4GA 1W5PA 4KEVA 4PMNA 1DHPA 5HWJA 1ZALA 1WXYA 4G9PA 3LTYA 2VRKA 3B8VA 2Z28A 1WZMA 3CT2A 2VVSA 2H3DA 4PSPA 1C3FA 1PXGA 1J01A 1E43A 3AUJA 2CZVA 3LA4A 1US0A 1E1EA 1TREA 2JFEX 1TPVA 3QOMA 3WLOA 2CLEA 2V3DA 1N8IA 1Z32X 2G3FA 1J11A 1UMLA 4G7EB 3VCNA 2BBFA 4HZMA 4AQLA 2I9EA 4DM1A 4MUPA 1EXPA 2ZX5A 4GBUA 5KZ6A 2GSEA 2VXNA 2XIIA 6TIMA 1KFBA 5FJRA 1BD0A 5HA7A 2ZRXA 1ZAIA 4AG0A 4IP7A 2PWDA 1T8QA 4JN6A 1MQQA 3B0VC 3S5ZA 3U0HA 3FY1A 1E4MM 1R3TA 3E96A 4I5RA 3SQSA 3TP4A 6A3HA 5D05A 1PCWA 3ZWSA 1RBLA 4QIUA 3AS0A 1XDLA 3G3DA 4GYKA 4DLFA 3OO2A 3BK0A 5U4NA 3TXVA 3CH9A 2E1DA 2VFGA 3H6OA 3HO8A 2R1PA 3OA3A 4P2VA 3NSNA 4PTWA 3UZZA 4P8UA 2TYSA 4LQ1A 4ZBCA 2NUXA 3O0FA 2CERA 1JGMA 1F2JA 3N17A 1HJVA 1MRQA 5BXSA 1JCLA 3NM3A 4JTCA 1FCVA 3QY6A 2CITA 3EYPA 4NX5A 2V9DA 1SO5A 4OQVA 3MANA 4CQ9A 3PUGA 1TE6A 2R6OA 4S2BA 2DZPA 3VZYA 2YSWA 3LD5A 2E9BA 3GR7A 3AIQA 3U7BA 4IT1A 5KSWA 5BRBA 1RPXA 3SCPA 3QV7A 3WBAA 2B4GA 1B2YA 3H54A 3LXBA 3QV6A 3RO6A 3TW6A 1Q6EA 1W56A 2ADAA 1PS9A 3BOFA 2J7EA 3WELA 4P7RA 1UD5A 2PLMA 3NO1A 3H2FA 1Q6FA 3LXCA 1TV4A 4KEMA 4ZEPA 3KOWA 4CKQA 1SVDA 4UQ9A 2ABBA 4Q7NA 1XIMA 5BXTA 2D2OA 4MZ8A 1QDSA 3NO3A 2E6YA 2ACSA 3TSDA 3GQYA 4IGHA 4KWVA 3RDKA 3KW3A 5CLTA 4ADSA 3IRDA 4I7VA 4E2DA 3HGSA 2WCAA 3EX2A 5F1VA 2FJUB 4OWGA 3WLSA 3FJLA 2GGEA 1ZRQA 1Q6CA 2Y1HA 5D9MA 4L1GA 3N9RA 1J8VA 1SJBA 5A8QA 1W3KA 1Z89A 3S83A 4DUOA 4MNMA 3CZKA 3T1GA 3GAYA 4HHHA 2OWWA 3MI2A 4US5A 1EA0A 3HGJA 5I79A 2BVWA 3WF2A 1MVYA 4WVXA 3DN5A 1YTKA 4NZFA 4O8AA 1EOKA 1J0YA 2ZUSA 3VK5A 3WUBA 3A12A 4JPGA 3FOKA 1MWOA 1ZU8A 4S1FA 5CQ1A 4MZ1A 1GJWA 3ZT5A 1V0KA 2ZIDA 3TX9A 3VNKA 2GFTA 4DPQA 4PUKA 4M81A 3W3OA 3C8FA 4KCTA 4O1CA 1O1ZA 3G1YA 2AQOA 3W1XA 2BXVA 1A0CA 3OHMB 1DIEA 3KBNA 4GMEA 3AXIA 1GOKA 4JKLA 4Y9PA 3VE7A 4FHAA 4PMYA 3SCSA 4D8AA 3TLQA 3DHUA 1ZHAA 2P10A 3WK2A 2PDJA 3DUGA 3CH0A 2F38A 3RR1A 3IJDA 3U4AA 4D72A 3N2MA 4LAKA 3CO4A 1OC5A 3DXIA 1OSEA 3MUAA 2QHAA 2PWVA 1B3WA 3BAXA 5DF0A 3QEZA 4DF0A 3EWDA 3LCHA 1J96A 1U33A 3VMOA 3FHAA 2ZUNA 2NX1A 3UJEA 4PC8A 4W7UA 4AWEA 4C65A 3BLLA 3XISA 3WFLA 4MADA 5JVLA 1JL8A 1KM3A 2ATSA 1W9UA 1XC6A 1B31A 3N3MA 3AROA 1E6NA 1X6UA 2PZ0A 1NWUA 4GK8A 5G1MA 4DBDA 4C6PA 3MYOA 1I60A 3ARWA 2Y24A 3WG6A 2J7GA 1P1MA 2Z1SA 3S9IA 3W2JA 5IFTA 3TSBA 2ZZ6A 4Q3MA 3VD3A 1GHRA 4W86A 4V28A 4AZIA 2GVYA 4LUJA 2HSAA 5FCZA 3WFZA 2GJPA 1UB3A 4M82A 3DC0A 4NKCA 3PVFA 3C2VA 2ZA2A 1S3HA 1B5TA 5D32A 1E6XM 3KP1A 3POHA 4CU6A 2IKIA 5G4WA 1DE5A 9CGTA 1RZMA 1KGWA 4OHQA 3C3UA 4CCDA 1HKWA 3ARZA 3LHTA 1XFCA 2J8TA 1DHKA 1SO3A 3IANA 2QZRA 1YPXA 3F7JA 5A2BA 1FWWA 1W1TA 4XBJA 4H1ZA 3QKZA 3QGVA 1UR8A 1RVKA 3GDLA 3CZ8A 2WC4A 4MGGA 3H2NA 4C6JA 4HQVA 2Z6JA 1XIFA 1UIPA 3TYBA 3I10A 1O7AA 3EX4A 3R8GA 4FR6A 3ALGA 2VMFA 3LRMA 3I6RA 1BAGA 2WVTA 5EMJA 4DWSD 1WZAA 1QO5A 1CNVA 4AHOA 4JYFA 4I8YA 2H8ZA 1P7TB 3GDKA 1LJYA 4JTHA 2F6XA 5H8PA 3W00A 4E3VA 2YW4A 1DWJM 3I4KA 3NEVA 4KFOA 3O7UA 2OYMA 3ABOA 1XS2A 1PWLA 1XIEA 2FYMA 4IHCA 3LS9A 2HVOA 4Q33A 4MPKA 1H2JA 1X98A 1YDVA 2HE8A 4NXSA 1DPMA 1OG0A 3TA6A 3NL6A 1JZ3A 3BVJA 1XUUA 2WAGA 5HNTA 2DPEA 3PZVA 4GNJA 3CGTA 2V5BA 1SMDA 3JR2A 2DJLA 2D3NA 3NQCA 2Z2BA 2XVGA 3WQ5A 2QIWA 4BQ4A 2QXWA 2J6XA 2O7SA 2W66A 3PP7A 2AQVA 1XPGA 4K1GA 4WDWA 4YJ5A 3TYEA 4JTUA 1Q13A 2HNEA 3PF3A 3USZA 4JTAA 3U5YA 3AQUA 4UTHA 1G0CA 4EVZA 3S2NA 2O4QA 3QGAC 1XLJA 5XIAA 2DT2A 1JI1A 2DQXA 1BSIA 2DH2A 4R7JA 2BGSA 3EAUA 2QCMA 3DG7A 3BCJA 3SDOA 1GKRA 2WSPA 3BXWA 5LYRA 1DL3A 2BASA 4IPPA 5K9XA 2VX6A 1RJQA 1T6MA 3BDKA 2AMGA 4JQ4A 2J4GA 1X7FA 4CGTA 2PU1A 1KTNA 3ENLA 4HBKA 3T42A 2YJQA 4IIHA 3QH2A 4R5EA 2Y7DA 1V7YA 3LDVA 4UQEA 2NW0A 4I9MA 3WNMA 1RBOB 1YNQA 1EJXC 1VFFA 3B9OA 3LPGA 3GXTA 1CZ1A 1JD9A 3PTKA 4BF7A 3EGJA 3DFYA 1GQJA 1A4LA 2FTWA 2Q01A 4NJGA 4UCGA 5K7JA 3SGGA 5BYWA 3O0KA 1M03A 1XLAA 4QSHA 2BS9A 3E6EA 1PEZA 4Z42C 2ALRA 2X42A 3H70A 1YLVA 4YNGA 5CXPA 2DT3A 2MANA 3HV8A 1AJZA 4L56A 2CLMA 2FHFA 4O16A 3GTHA 1IF2A 1IT8A 2YLLA 4LUTA 2W0UA 1XLGA 5F2GA 4F4RA 3VCCA 5HNNA 3T40A 3AIUA 3NM1A 4B3KA 5U7SA 3CZLA 3GY1A 4MKVA 4QCFA 2GZXA 1WOAA 3PZ9A 4RPQA 4R7OA 3VKBA 5CAKA 4Y90A 1A5KC 1PYFA 4LF2A 3BQ5A 3R12A 4Q8PA 1KFEA 1OD0A 2QIIA 3UQNA 2YW3A 4EOUA 1GVEA 2OZ0A 1XLEA 4CD5A 3TYZA 3OLIA 5C2GA 3JU2A 4X2PA 1L6YA 1AQHA 3VIIA 2A5HA 4PMJA 1OK4A 3N2CA 1SZNA 3ABZA 3V75A 4HK6A 1MXDA 1PX8A 1F76A 3NL3A 3KBMA 5HANA 5H2ZA 2YLAA 4FIQA 3QW3A 1UWRA 3LTPA 4AAJA 4AEFA 4ATWA 4DJED 1A5MC 4H9UA 1FHDA 3SFWA 1EUAA 1KM6A 3M1ZA 3SUUA 2J78A 2Z1KA 1EQPA 4PN2A 5GQBA 1S2TA 3IV3A 2BHYA 2PGEA 3WX7A 3QW4B 4AVNA 1V03A 3E38A 1GTHA 1ZS2A 4WOQA 1H1NA 3NQBA 1AW5A 1GJPA 4J40A 1UC5A 5CJ5A 3W37A 4AMAA 3UPMA 4F0LA 3VDCA 1YNPA 2WHLA 2XFRA 1LTDA 2CIPA 1XM3A 2YGYA 4LWWA 4ROPA 3MYPA 1O12A 3FIGA 5EBUA 1ZAJA 3P8JA 2Y5SA 3W6LA 3KUMA 5FD0A 4GI9A 4GJ1A 3WQ6A 3GNNA 2CBUA 3KE0A 3RFAA 2EPMX 4AD2A 5E0FA 1W91A 4N7QA 1E51A 1RHCA 3STCA 4BWLC 1AMYA 2NV2A 3N12A 2PI6A 5I7GA 4PMOA 3LCIA 4IPJA 4IPIA 3D47A 2WNZA 3LB0A 1FWDC 4MVAA 1TTJA 1U2YA 3G8RA 1KR1A 2NQLA 4F9JA 2G0WA 5FL1A 2C91A 4LV9A 1UR4A 3T2QA 1I2QA 4AMCA 3ITGA 3QHNA 3TA9A 2OSYA 3W27A 1H5VA 1WUFA 2Y8UA 4JTJA 1QOPA 3ITYA 5GJPA 3QVQA 4RNHA 2NQ9A 1TCDA 4A2RA 2J25A 2OWCA 4QM1A 1HQTA 3H23A 1O68A 2FGZA 1S38A 1H5YA 2W27A 3WBWA 2IUZA 2OSWA 1D9EA 1IT7A 3HPAA 1KV5A 1VBRA 2FVLA 3UW6A 2DIEA 3M0JA 3U7VA 4N9BA 3LGEA 3W7JA 4O0KA 1PVNA 1WKEA 1XBXA 5EL1A 4GABA 2FDMA 1QUMA 1UWQA 4GJJA 3IK2A 3QYQA 3PPCA 3LBMA 4E38A 1SR0A 3RJYA 1BWKA 4PRTA 4RW5A 3IS4A 1LBFA 2BNJA 3ZT6A 4PBEA 1BTMA 4X22A 4K7YA 4B9ZA 1KM0A 1U83A 2HK0A 4F2BA 2E68A 4XUYA 3VUSA 1F9CA 4JIIX 5EPDA 1NOUA 2WWCA 2PFHA 3S6OA 3K2GA 4GACA 3VI2A 1UUQA 3UZYA 4J35A 4NZ5A 1LQ2A 2HPIA 4LX4A 4PBGA 5G4EA 4LAUA 3FK4A 4QAWA 2CZ5A 3AU6A 3AO0A 4PBFA 1DKWA 1ICSA 3M64A 3V4BA 5M1TA 1JAEA 4IFKA 4A4AA 1IGWA 2ZKMX 1ZLPA 1H3GA 2JGQA 2OODA 1CTNA 3P84A 5AB3A 4KBXA 4K8HA 4GUJA 1MDLA 3FV9A 5JH2A 3L66A 4GISA 2PWFA 4F0MA 1E4LA 3T2OA 1UKOA 3OBKA 3NTYA 3HPZA 4CN6A 3RLGA 1LUCA 1PYMA 2E09A 2OKTA 1A0DA 3TCEA 3HF3A 4NUWA 4YPJA 1C91A 2YPIA 1OFPA 3IAPA 3AYVA 4L5ZA 3TWAA 2DZBA 3DZ1A 2OU4A 2PC4A 1VFUA 4LB3A 1HZYA 2Y7GA 4H41A 3ITXA 4E4UA 5IM51 2FHCA 5T91A 3CWNA 1R6WA 1KFLA 3AMCA 2P8BA 2ZWYA 4BI6A 3NZQA 4UMBA 3RN6A 3UZ5A 2A7PA 2VC5A 4LS1A 1J2WA 4JTEA 4QQUA 4KH2A 3VOGA 1L6SA 3CYJA 4NZ1A 4LSBA 3K4AA 1TX2A 2YCLA 3HMJG 1QVBA 3B8WA 1OCQA 3W1RA 3QMRA 2E0PA 3BG3A 4NZJA 5CPLA 5A6SA 2UY3A 2V30A 1NJJA 1B3XA 2YYUA 2ZFAA 2AQWA 3ABSA 4ZQPA 2IKJA 4S3JA 4DAIA 3PUEA 3UA4A 1LM1A 3PHAA 1PKMA 1SW7A 5AZ1A 3ZYZA 2BV9A 1RQEA 3AXKA 2OOGA 1W5MA 5KETA 1W9DM 3PZMA 1FDZA 1E73M 5I3IA 2XUCA 1XLCA 3GHRA 3V5OA 4KESA 4MKSA 1Z6KA 1CI1A 4ERGA 1R0MA 1B3YA 1G01A 8XIMA 4Z1DA 3GG7A 3BW2A 3QN3A 2PDBA 4XAYA 4L1WA 5DY3A 1SW3A 3TQPA 4WDXA 1UH2A 3BMWA 3U5UA 1Q6OA 3M41A 4GQBA 1BYBA 2VVNA 3W6YA 2P50A 4E3TA 1BFNA 1TVNA 4HPXA 3HA1A 3RAOA 1QBBA 4C1NB 1V8EA 5BROA 1TUFA 4J2PA 4NXKA 2E7FA 5B7ZA 3KRBA 1WAUA 4GD0A 3MTWA 1V5XA 4BEQA 5HR6A 3QRHA 1MXGA 1XIHA 3TNBA 3VD7A 3ARRA 3MCOA 3OQEA 3DI0A 1M01A 3QZ6A 3VNLA 5B80A 4O0ZA 3WF0A 4H6RA 1IZJA 1OCNA 2IPJA 1PHWA 2MUCA 1S2CA 3FKKA 4J4KA 3S2MA 2QPSA 2BHZA 2TSYA 4CD6A 4CCCA 2V5KA 4FP1A 2NQJA 4G2DA 1DXEA 3AZSA 3BUVA 3MCNA 4DN1A 7PTDA 1Q6QA 4XO7A 2R24A 1N55A 1Q63A 3VMNA 4GQQA 4AX7A 1Q65A 4P7QA 1AH4A 4HPNA 4U31A 3W2UA 1VFMA 3T44A 2RUSA 4LUSA 5FEZA 3QBUA 4Y9NA 1Q4WA 1PWMA 1F6YA 1VJSA 1M7OA 1VF8A 2YL8A 4DHGA 4JHZA 1NP2A 4QSFA 2NLYA 2JKEA 2VDIA 1CCWB 2ZVIA 5HAOA 4PMUA 2CLHA 3C6CA 1TMHA 3OIXA 4JN7A 3F2CA 3NZ1A 4HCLA 3M6DA 4U2ZA 4HPHA 2WO5A 4B5SA 4D6CA 1NF7A 1YEYA 2Y0FA 2WW5A 4IOTA 4JCMA 3BOLA 1MW2A 2QDHA 5EFFA 1HN1A 3A4WA 3KHJA 1O94A 3O6YX 4LGXA 4ZGYA 3USBA 1UWTA 3GTFA 5C9RA 4UR8A 4O50A 4WEVX 3SQLA 2WBKA 4MDPA 1GCYA 1PSCA 4AIUA 3IVUA 2DIKA 5TF0A 3SCNA 5AC8A 3OBEA 3WL1A 1OF6A 2WQDA 1TJPA 3BPWA 3W7KA 3S46A 1JYXA 2P53A 1IXNA 3CU2A 3UPBA 3HN3A 4S39A 2ISWA 4XD5A 3APYA 5HULA 1AA1B 3BCDA 1W54A 1QI4A 5CJMA 3O05A 4DO6A 4GI6A 3LOTA 3UA3A 3VGFA 5I3FA 5PTDA 4MWAA 4RZ6A 4JD4A 1ESWA 3W7OA 4Z0SA 3GIYA 2EJAA 3M0ZA 1OM0A 4NNCA 2Z1XA 2IKGA 5AHFA 1WA3A 4CD4A 1VYRA 3LHUA 1R3WA 4V27A 3OVQA 4J3WA 1B9BA 3VNIA 1LF1A 3A4AA 3BWWA 4L80A 3CLWA 4KQNA 4FNPA 1ZP4A 4EKJA 2F6UA 3R8HA 3VO0A 4ZO7A 1NEYA 3NOEA 3P5YA 3GNRA 2E28A 3WY1A 3APGA 4MDOA 2POZA 4PE8A 1W32A 4HK7A 5G2IA 4TTGA 1EDGA 1E72M 3G0SA 3HU7A 5I2UA 1N8WA 3CHVA 3NDOA 3TC3A 1A5SA 2X1TA 4U5IA 2YBTA 4DXKA 4C5ZA 2FIQA 1PX3A 4INFA 1OZMA 2G3JA 1Q85A 4PEKA 3W2NA 3IIPA 2QCNA 1TV3A 5D33A 1QPKA 2QUTA 3OIHA 1OFOA 1BPLB 3FXGA 3WENA 1OWQA 5K9DA 2QCDA 1HKVA 3MP5A 1B3ZA 3FDGA 1YKWA 3GU2A 5AC6A 3S0CA 1GOXA 4GUFA 2IQDA 2X1SA 2CZEA 3UXLA 4FF7A 1AL7A 1NVMA 3BW4A 4N9DA 4AXKA 2ZXBA 5DN1A 5CJNA 6PTDA 2J79A 1DIDA 2A3HA 3BCFA 1BG9A 3WLHA 1L2QA 2PP3A 2B7PA 2WZMA 4J3XA 1SPQA 2UY4A 3PJTA 3E74A 3T08A 1HUVA 3M47A 2OEKA 4H8VA 4FALA 1Y5XA 3HQOA 1TR9A 3O6CA 1QATA 4RR4A 5BMWA 3G24A 3IV8A 1WAWA 1H41A 1R30A 1C92A 4W8BA 3UJRA 4C6EA 2NV1A 3S3GA 4AIEA 3W2MA 1UWIA 1R47A 1U5VA 3NYDA 3BL3A 3VABA 4B5NA 2PDWA 2XINA 4ZXLA 5CGQA 3IIXA 2VX5A 4F79A 1A4MA 2VCCA 3GK0A 2XN2A 5TQLA 2F61A 1KXVA 4AD0A 2XH0A 1HTIA 2XVLA 3RYSA 4K3ZA 3S1VA 4QXIA 5C0QA 2XIJA 4AZ7A 3KBWA 2NXGA 2REQA 5REQA 2CFFA 1LROA 1XC4A 5EMYA 1M9HA 1XRTA 3PG9A 4XKYB 2H9AA 4HU0A 3QKEA 3KS6A 4BWLA 2CHRA 1NOFA 3AZTA 4IMEA 4GZ7A 1QW9A 3TXZA 3UVAA 1SJAA 1DJZA 1R9YA 5FL0A 7A3HA 4DNMA 5LHEA 2P8CA 3UCDA 4RUBA 1H7XA 4GFIA 2WANA 4DY1A 1QNQA 7XIMA 1K8CA 1YHTA 4GX9A 5HPCA 3ZVHB 1WDSA 2CLLA 1X8FA 5FESA 4GY1A 3W1QA 4ZVJA 4Q8NA 4DJDC 1CWYA 1IZKA 3GVGA 3IJ8A 5LA1A 2I16A 1BLIA 4UQAA 1EYWA 1ZL1A 4GFSA 1VB9A 4OOZA 3P74A 3OYXA 5MKGB 2XM1A 1J5SA 4H83A 3UPWA 2V2CA 2NVAA 1VBGA 4ZODA 1AQMA 4DPPA 5ABFB 3P60A 4QS5A 2VRJA 3DH7A 2GL5A 3A4JA 3R2GA 4JIRA 3W1PA 2FB3A 5K3VA 4DWDA 2WK2A 4Q4KA 3TK7A 5BWFA 4AX6A 3S6TA 5AHEA 2Z7KA 3GKFA 5L9FA 4HA4A 4I9TA 4WKHA 1G7UA 4UFLA 1JF5A 2OZ8A 1AW1A 3CB8A 3URNA 1BRLB 5DELA 3AXHA 2VKZG 4PCNA 1JCXA 1OINA 1UP2A 4JQ1A 3GXMA 4O1AA 1DXIA 1P0BA 1J79A 1GYNA 1XFBA 2A85A 2OMAA 2DZWA 2NWRA 1F4AA 1TO3A 1E55A 4MMWA 6REQA 3KOFA 3SCVA 1UJQA 3Q67A 3GZ3A 2ACUA 3ONBA 3U2OA 5KEZA 5MKGA 3BQ6A 3CV2A 1H7RA 3TTSA 3R25A 4MJMA 3L4ZA 3KZSA 3H7VA 4KWSA 3L4YA 3TEVA 3I6EA 1WBJA 1YPFA 1XLDA 4AYSA 4RZ5A 3ITCA 5B7YA 4LYPA 3L9CA 2QDDA 3WUGA 5T9BG 5IFPA 2UBPC 3ITVA 3L7RA 2A7NA 4MHBA 5IBXA 3STGA 3KZPA 3EDKA 1GYLA 1IEWA 2WVVB 2EQDA 4HZ7A 4V1XA 5H6HA 5C70A 3S2JA 1H61A 4ZXOA 4D8LA 3TSMA 4B4FA 4W5UA 4D6IA 1CYGA 5I3GA 3LHVA 1H51A 2PTXA 3A3XA 4R33A 5FOOA 2GLKA 3YPIA 4CD8A 2DSKA 3WDIA 4JTTA 1PO9A 4RXFA 1Z41A 3PBWA 3WFAA 1EBGA 1JZ5A 2HXTA 3HURA 3NQ7A 5LIYX 4M24A 1NDZA 2BTMA 3D3FA 3LU2A 1PE1A 2X7VA 3D5HA 2AGKA 2R1MA 1V3HA 2ZUMA 4EPKA 2XIQA 4I6VA 2QPXA 4RNJA 1S5TA 1FXPA 2VGBA 3DBNA 1XDMA 4WF7A 5I0DA 3LV6A 4E2BA 3PWGA 3UR5A 4IIDA 1RK5A 1VHCA 4JQ3A 4HPGA 3VFCA 1DQUA 4IM4A 3GU9A 3S42A 3WH6A 2V5DA 1EX1A 1UWUA 4L6DA 5F4XA 4DJFC 2QV5A 5I5RA 4HZ8A 2VYOA 5GPRA 5BOOA 2NX9A 3ZLHA 4K37A 4MB4A 1E6SM 3TN5A 4O8RA 1EPVA 1CW2A 4NI3A 1UWAA 3HG4A 1ISZA 3MI6A 5JIPA 4NQ1A 1BWVA 2O55A 2YYTA 4I8DA 3WLKX 3WSUA 3WNLA 1X1NA 1YXDA 3MVTA 4F2UA 3EWUA 4U10A 1AQFA 2OB3A 3NQDA 2PDKA 3WDQA 1VYPX 3DEQA 2O9RA 1DJWA 4HNCA 5CGTA 1ZCOA 3RK8A 1ONXA 3HPFA 3M0MA 1VENA 4TX6A 1DP0A 3THUA 4C91A 1LWIA 5JMUA 2PODA 3N4EA 3ARTA 5KMYA 3N34A 1HT6A 2BG5A 3QC3A 4PMVA 2CLOA 1VFSA 2CZFA 2ZYFA 3NGFA 3GR4A 4GI8A 3W22A 3GKAA 4NP7A 2EPOA 1JR1A 4NJHA 1WDRA 5DANA 4HZ6A 2Q8XA 2XIOA 1IHIA 2A7RA 2ZZ5A 3H7UA 2J13A 2GUBA 1ADSA 2XPKA 4E4PA 1V7AA 4XO6A 4EF9A 3LHYA 5RUBA 1CECA 3CQIA 1R8LA 4H8NA 4PFMA 2C15A 3OODA 4RDVA 3WK1A 3XIMA 4XK2A 4FAMA 2Z7GA 3WQGA 6CGTA 3S8HA 4Z2IA 1UZHA 4EF8A 5EFDA 1RLCL 1RAKA 2CXGA 3GVWA 3CTLA 1WXJA 4LCRA 3Q58A 3VDAA 3PZQA 1KRAC 3WQ8A 1DWFM 4JXCA 5CZ0A 2PA6A 1XRSA 5C71A 4B9YA 4O15A 3VA8A 4QEHA 1OZQA 4WJEA 4C6DA 4HMEA 4PYSA 1WX0A 2OQHA 2CBVA 4UUIA 5ABGA 3SJ3A 1XCXA 4UTTC 4D71A 3R0KA 3G3MA 1V6VA 4AH7A 5M5DA 4FR1A 4HSHA 3W1MA 4F2TA 4JKMA 4NJJA 4OE7A 3LMYA 8XIAA 5CZTA 1LOLA 3UNTA 2A79A 3LZ3A 2XVKA 5HR7A 4JX6A 3A22A 3LM7A 1W9BM 5HNRA 2V67A 3ISIX 1HJXA 2J77A 5A1AA 2E3ZA 1DXFA 1JQVA 1VJIA 4Z2HA 1F6PA 3R0UA 5E9XA 3KP0A 1J0KA 3UCCA 1NWRA 1IWBA 4J7RA 1EL3A 3QF0A 5LIUX 2D0FA 4HIBA 4FPSA 4I5XA 2ZUUA 4FS9A 5D8ZA 1LG1A 4QCEA 2P76A 3NA8A 4B16A 4LVFA 4IG2B 1HKIA 2GVJA 3M9YA 5TD4A 1KKRA 4NZ3A 1MSSA 1VJZA 4I90A 3B8DA 1W8SA 2EKGA 3C2OA 4HD5A 3GB6A 1S2UA 5A69A 1SJCA 3MSRA 2VURA 2PGFA 2BVYA 1V6YA 3ZJKA 4AC1X 1W17A 1WNOA 3C2RA 5KITA 1JRCA 1CENA 3CHEA 4B15A 3AHVA 4ROQA 1XLLA 3W4RA 4HYVA 2RKXA 4P8WA 3SGZA 2DVTA 3N4FA 4N42A 1V02A 1WO2A 2O9OA 4WY0B 4AFYA 1HO4A 3AIRA 3LGDA 3UXDA 2BGQA 4XAPA 4WY0F 3QLDA 3LQLA 3FA3A 5G1TA 3AMGA 1OG6A 2FZNA 4ERAA 3F03K 4O13A 4AXNA 1SSDA 1LYXA 3GH5A 1CIUA 1P0EA 4RCXA 4M6VA 2D20A 3PBVA 1PCKA 2PBOA 1JZ7A 3KL0A 3LRLA 2XIMA 2P5NA 4UFMA 4XQ6A 3VNJA 1SFSA 5EGRA 1KRMA 1T99A 4OBSA 1UPMB 2FQIA 1HO1A 1OB0A 1O5KA 3LXAA 4CNSA 1FFQA 3EX6A 1I75A 1DJQA 2Y5JA 2ZZ7A 3IACA 5BCAA 4JIHA 1OFBA 2I5QA 3CV1A 3STFA 1J9YA 1PZ3A 1ZCCA 2J8FA 3MO4A 5G5IA 3ARUA 3VC5A 4Q4PA 1IQ8A 3UWQA 5DMLA 3EWYA 1IEIA 3F5LA 4I9JA 4ZO6A 1H7PA 2D1ZA 4XUGA 3ANUA 1I9CB 2Y89A 2OZTA 4JFTA 2CESA 3NVDA 3RU8X 4HOWA 1VCGA 3WQPA 1C8VA 4IP5A 3RR4A 3F4WA 1M53A 3RM8A 1WV2A 1W2PA 3ITOA 4BQ3A 4DLMA 4XBKA 1CDGA 1HFBA 3PY2A 2YA0A 3VTRA 2F2HA 1QNSA 3D0CA 3H26A 3EKZA 4XBSA 3Q2DA 2E5BA 2EJ1A 2YCEA 1AJ2A 1DJNA 5A8MA 1OD8A 4PRWA 1G5AA 2D23A 4D1JA 1F8IA 2CHNA 1QI3A 4GZEA 2FKPA 3PZIA 4KWWA 3TYAA 2GYIA 2RDWA 1UR0A 1W9PA 2POTA 3UXIA 1C7TA 1UA3A 1OFEA 4XVDA 5D04C 1YBQA 4GUHA 4YTRA 4IF2A 4BK9A 4PFHA 4M80A 2DZTA 2J74A 3MKKA 4ASTA 3N18A 4WOZA 3O6DA 1EZWA 2IQTA 2DUAA 1OC7A 1CPUA 5C9ZA 3U3HA 4HMCA 1A5AA 1D3CA 1KM4A 4ILSA 1M04A 3MMDA 1UASA 3OZOA 4LW7A 2Y62A 4HA1A 2Y8KA 3TYUA 4C6LA 1QPNA 2CCRA 5F4WA 3TQKA 4AIOA 1T41A 3DKJA 5A6MA 3UU0A 4AZGA 4JTQA 3FYPA 3E2QA 3POCA 1S5VA 3PG8A 4J28A 3EOSA 3D46A 4AHQA 4CNTA 3N9SA 4DBUA 3TH6A 4ZQNA 3MSYA 3S9ZA 1GVIA 4J1OA 3MZ2A 2Y88A 3CPRA 3MP4A 1BSLA 1H63A 3CBWA 4S38A 4GVIA 3K8LA 1TPB1 1E1CB 2HK1A 4HSOA 1REQA 2G3MA 1XLKA 1ME9A 4MJ2A 1IEXA 2PWEA 2CPUA 3BAIA 3EMCA 3ZIZA 2VENA 3EOEA 4JIEA 3DFSA 4KCUA 2FZBA 3S1GA 1DTUA 1YNYA 2I56A 4ONVA 2Z6IA 4N9CA 3TR9A 4Y6GA 1GONA 2FDSA 4WXYA 3AAMA 4ML4A 1VHNA 3WD1A 3VKAA 1MUCA 1QBAA 1Z3NA 4IIFA 1DWIM 4DI9A 3EWCA 5LNWA 1EA9C 1P6BA 3VGHA 1NFGA 4BI7A 4PCFA 3WDHA 1DEDA 1AFSA 3WH9A 4A3HA 2HWGA 4OZOA