2E6AA

Crystal structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with orotate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
312
structure length
312
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with orotate
rcsb
source organism Trypanosoma cruzi
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase
total genus 106
structure length 312
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2006-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 2e6aA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2e6aA01
3KVMA 2AQWA 1PVNA 3IEBA 1GEQA 1T99A 1Q45A 4MJZA 1FBAA 2WOQA 4LT9A 2ZFAA 4TU1A 3HG3A 3LHTA 1FCQA 3SI9A 1HUVA 3DAQA 4ICNA 2CLEA 1O5XA 1QDSA 4Z0SA 1F5ZA 1YLVA 3CIWA 3HB9A 3M9YA 1RZMA 4MZ1A 4AHQA 1RV8A 3NL2A 3C2FA 4BFAA 4ZQRA 3QF0A 3PBVA 3N19B 4RR4A 2E6DA 1TRIA 2YFOA 4H4IA 4KWWA 3OA3A 3P60A 4EVZA 3PUEA 3FKRA 1ZJIA 5L6UA 1JUBA 2V5LA 2Y7FA 3AO0A 3FIGA 4AHPA 1H51A 3GNDA 2DZTA 4HPXA 5LZLA 2E5DA 3M41A 5G2IA 4PH6A 3UXDA 1DHPA 1EA0A 1B4EA 1QPQA 3M5ZA 4I7VA 3A5VA 3Q58A 2NUYA 3RMJA 2AAMA 4JIQA 4DO4A 5DLCA 1SZEA 5LGZA 3M7WA 3ELFA 3W9ZA 2QJIA 4CNPA 4PFMA 3I7QA 2R94A 3TSDA 2A21A 2QAFA 3JS3A 1MO0A 3G8RA 3G24A 1IXOA 4N6EA 3TXVA 1YTDA 2QUTA 2ZA3A 3M43A 3NZRA 2NWSA 4OHQA 2DJLA 4K8HA 4RZ5A 1SO5A 5D02A 1G69A 5EA9A 2FDSA 3B4UA 4O11A 3M47A 2FQIA 5FEPA 4DPQA 3HGOA 5D2TA 4LVFA 3NQGA 4BI7A 2ZRYA 3NL6A 3P81A 3W7IA 3W2JA 3H53A 4UR7A 3LXBA 3B06A 3GDRA 4TMCA 2DZPA 3C2OA 3WJSA 2NXIA 3GR8A 1GVSA 3LBCA 3C8FA 4LV9A 3CWNA 1YTKA 3CHVA 1AG1O 4O4WA 3L0GA 4ONVA 3HGJA 1TJRA 2VEMA 1AW2A 4LC6A 3W7OA 4GUJA 3QPYA 4FNSA 3KVKA 5D2VA 2W79A 5KZDA 4N6FA 1HTIA 1XCFA 3GNNA 1VJIA 1KLYA 3UWZA 4LVDA 3FJLA 4ADUA 2FIQA 3SIZA 3QSRA 4L4LA 1YYAA 4NX0A 3VFLA 4LW7A 4FF7A 4M7TA 4N4PA 3K30A 1G4TA 3LV5A 4MYAA 2BXVA 2V81A 4A2SA 3NPUA 1H50A 3QW3A 1PCWA 4LU0A 4K7VA 1TCDA 1ZHAA 2Z1BA 3HG2A 1H7XA 4HHPA 2VKZG 3MI3A 2X1RA 3DXIA 5F2IA 2VFDA 1SW0A 1FXQA 4MLRA 4O0ZA 1F76A 1JCYA 4N02A 3O6DA 3LI0A 4P2VA 3NDOA 5FF7A 1H7NA 4N9EA 2PCQA 4QIUA 1DV7A 2UV8G 2J6XA 1QCWA 4YLWA 4PL2A 4CNOA 3O1NA 4K6AA 2JKPA 3BGGA 3W87A 1M7PA 5AYZA 2QUVA 3ANYA 3IV3A 4CCDA 1W3TA 3WJWA 3R5EA 2Y7GA 4K37A 4NXSA 3CEUA 5DCEA 5HULA 1E51A 3FS2A 4LVBA 2RH9A 4AB4A 1OF8A 4FEZA 3TUUA 3E49A 1KM6A 4CCEA 5AB3A 1XC4A 3P7YA 3Q2DA 4ML9A 3BG3A 2FPTA 1GJPA 1GVRA 1WAUA 1X1ZA 3SJ3A 4UTTA 1KFJA 4JX5A 1H1YA 3ZFHA 1LRTA 1OK6A 4LWWA 5F2LA 1G7VA 1P0KA 4UIOA 2JGQA 5DCDA 2E5CA 5CZSA 5H2ZA 1AL7A 1JCJA 1UASA 1T8XA 4TO8A 3PBWA 4UTWA 1DL3A 3QMRA 1GPWA 3LTPA 2R8WA 3R8RA 3LXAA 5HQEA 1RPXA 2FLIA 3HO8A 1LORA 3NQFA 5I3IA 1LCOA 3OVPA 3NGJA 3BO9A 3LCWA 8TIMA 5I3GA 3PVFA 1D9EA 4M6VA 1TREA 3G3MA 3SY5A 3MWAA 1S5VA 2V82A 1H7WA 2J24A 2JKAA 1THFD 3LTSA 1W3NA 2WO5A 3W2KA 2Y63A 4UCGA 4CNNA 1UB3A 1VR6A 3UZ5A 3PB2A 2C0AA 5KSWA 3W2UA 4ORMA 3ZWSA 1MEHA 2I1OA 3QSTA 1H7OA 2WQPA 3TAOA 1TV8A 1FXPA 2B7QA 1R46A 5D03A 3C61A 1LBLA 3B04A 4H6KA 1WBHA 1JCLA 3G8EA 3YPIA 3S1XA 2H8XA 4MKNA 2BLEA 1PIIA 3A22A 4JICA 4R53A 4IX2A 4MFEA 4EIVA 4Z0JA 3DKJA 1LP6A 4U28A 4FNRA 2E68A 2OZ0A 2Q8ZA 2ZRZA 3M5XA 3L2IA 3HIJA 4O16A 3ATZA 4Q33A 2V8ZA 3F1QA 1OFEA 4IOTA 1H7PA 1OX5A 4UTWC 3W83A 1TPUA 3B0PA 1DQXA 4UMAA 2BSLA 3THQA 5HR6A 1Q6QA 5I3HA 4IMGA 3M0ZA 5F1VA 3L5AA 4GNJA 5K4XA 4WY0F 4H3DA 7TIMA 4O12A 3W72A 1G4EA 3WK1A 3L0KA 1L9WA 4JTHA 4DBEA 4LUJA 5DN1A 3QFEA 1TPVA 2C13A 2Y70A 1R2SA 1QPRA 3NL5A 4FIRA 2VENA 2VXNA 4HIBA 3GZ3A 3E9AA 4O1DA 3TK7A 4XZ9A 1TPEA 3NQDA 4UTKA 1W1ZA 2A6LA 3HG4A 1F6PA 1I2OA 2O7QA 1N55A 1DJNA 2GVGA 5HWJA 1W56A 3MI6A 4UFIA 3JR2A 4WX2A 3P61A 4FNUA 3N9SA 4A21A 3LXCA 1SZFA 1H61A 3DHFA 2DP3A 3P67A 4ZQPA 3P84A 4E0CA 5G5IA 3G1VA 3BARA 5HWNA 4CLMA 2WNZA 2YDAA 3T55A 3OG3A 2ZZ2A 4WY0B 1MSSA 1M6JA 1W5NA 5HWMA 1CX9A 2CZEA 1P4CA 4X9SA 3SGZA 2QDHA 3QYQA 3DFTA 1H60A 5BW6A 4K36A 4GBUA 4M19A 5HJLA 4DEFA 2X16A 3W6YA 4YCPA 4UMBA 3EWXA 1TPB1 3C2EA 1GG1A 4QSHA 5EKYA 1A5BA 5FI8A 3PUOA 1SQ7A 5BMXA 1FDYA 3L21A 3W76A 4OBTA 1VHNA 1SFJA 3GXTA 1PCKA 3UWYA 1GWJA 3S1UA 3TMQA 3P8JA 4JX4A 1EWDA 1D3GA 2GJLA 2YYUA 3S9YA 1HO4A 1WA3A 1XFBA 3N14A 4K7YA 1KM3A 3F4WA 1KM4A 3G0XA 4A29A 2X1UA 2LLEA 5G2HA 3THAA 4JTLA 3QPZA 2CWNA 2CLHA 5AYXA 2QEZA 4JYEA 3LHWA 3LCHA 1WOAA 4P61A 5HUPA 2H3DA 4KFPA 3TJLA 1EP2A 3UWUA 3DU0A 1XBVA 3HGSA 2YX0A 3R13A 4LY8A 4GUFA 2QCHA 3BVJA 4XQ6A 1Q3NA 3NEVA 3OIXA 5G1TA 2B4GA 5CKSA 1DQWA 3EWUA 3IVTA 2QR6A 1U5JA 5AYYA 5F4SA 3WK2A 1JCMP 2E5BA 3RF9A 1GYNA 2ZZ3A 4BK9A 5C2XA 4Y9AA 3MW7A 1TB3A 3MJYA 5HINA 2EGZA 3UXAA 1RD5A 1BKSA 1W5QA 5KZEA 1H62A 1EIXA 5EYWA 2QCFA 2A6NA 5K9DA 2ZRWA 5CSSA 2WNQA 5D2XA 4QITA 4AWSA 5CZTA 1LLWA 1NAL1 3BLFA 3BW3A 3BW2A 4BR1A 1F2JA 3TFXA 2Y88A 3VE7A 4QNWA 1PS9A 4KFOA 1I2RA 3DKLA 4CCCA 2VFHA 3NQEA 2RKXA 2H90A 2QCDA 5KMYA 2VOMA 2P1FA 3W1QA 3IGUA 2NXHA 2I9EA 3PSVA 1NSJA 1AMKA 4A2RA 4MZYA 3WJXA 4LOCA 2FFCA 2TSYA 5LSMA 3KRZA 1DORA 2W0UA 3C4UA 4NX5A 4Y8FA 2QDGA 6TIMA 2CZFA 4JTEA 1P0NA 1WDWA 3EB2A 3O8AA 1N7KA 1T0OA 3WJZA 1XDMA 4K38A 1Q6LA 3ABSA 1IGSA 1TRDA 4RZ6A 3W7JA 1LRQA 2GOUA 3I7RA 1ALDA 4NJJA 5A8GA 3BGJA 1A50A 2YXGA 2V30A 4UMCA 4FB7A 4S2BA 5AHEA 3G1SA 3L9CA 2J9YA 3W3OA 1TPC1 3LCGA 4JTKA 4LRSA 2WNNA 3G1XA 3W7EA 3MO7A 1V5XA 3FYOA 3UWQA 1TTQA 2Z6JA 3LDVA 1K7XA 3P82A 3TC6A 3W1NA 3IIZA 1JUEA 1XI3A 4A22A 3O16A 1BWKA 3TA6A 4IQLA 1GTEA 3VI2A 5DXYA 2VFEA 4IMCA 1LROA 1WOBA 3DFSA 3NPXA 3NVTA 4JNMA 3P5ZA 1UBSA 3C3NA 1OFAA 2ZTJA 3W70A 3STGA 2DZUA 2YGYA 4XTDA 3M1ZA 3L68A 1KTBA 4MZ8A 2E1DA 4E2BA 5F4XA 4ALDA 3QJAA 3PULA 4WD0A 3NA8A 3TIMA 4LS1A 3E96A 1EEPA 2G96A 1ME7A 2A0NA 1C9DA 4NJHA 1K7EA 2J9ZA 1VGAA 1F05A 4LC8A 4M7SA 1ZAIA 3LV6A 4RXFA 1NF7A 3GYEA 4NU7A 1PE1A 3FEMA 3WK3A 5AN7A 3CEPA 2AGKA 4KWVA 1GOXA 5MHBA 1GVOA 4UTHA 2Q3RA 1QR7A 1R30A 3E02A 4OE7A 1J5TA 2Y6ZA 1FWNA 1YPIA 2Y85A 5CGQA 5D04C 5HNRA 3N73A 3W7GA 1O5KA 1EP1A 2ZZ4A 3MP3A 3GAKA 4FXSA 1FWWA 4GUGA 3G3DA 1WV2A 1EUAA 3KOFA 1RVGA 3G1FA 3PBYA 3W1PA 1JCNA 5EY5A 4X2RA 4ORIA 3VKJA 3EWYA 4UNLA 3U2OA 1EB3A 3ZWTA 3KHJA 4O15A 2B0MA 3OEXA 3BG5A 3UZJA 1QO2A 1SW3A 2OJPA 2ZTKA 2NLIA 3ABOA 4WJEA 2FPYA 4UTTC 3RK8A 1BTMA 1JVNA 3KFTA 2NV2A 5FF2A 4FIQA 3EWWA 5LHEA 2CLOA 4JD4A 3G1DA 3IVUA 1YADA 2BWGA 1B3OA 1JCXA 3CT7A 5D30A 1JR1A 3W1UA 2ZZ1A 4X3ZA 4IMDA 4XUGA 4HNTA 1OFRA 1V7YA 3GX9A 3DHDA 3CIXA 5IM51 4UC5A 4MY9A 4UTJA 3R2GA 4KKXA 3W2LA 4ZQMA 5AFDA 2CLLA 1SZNA 3CPRA 3UY7A 4NUWA 5ABTA 3GXNA 2CW6A 3HF3A 2RDWA 2A85A 1Z44A 2YYTA 3DFQA 1TMHA 3DFOA 1KBJA 3NAVA 4KFNA 1XBYA 4FHAA 4R34A 3G22A 5DBUA 3W84A 4IPIA 2FJKA 1SZGA 3GXPA 1LOSA 1H63A 3FKKA 2CZDA 4G1KA 3T40A 1G7UA 4OQVA 4Z1CA 2ATSA 1T96A 5F1UA 4IUOA 3TROA 3MYOA 5LNRA 1VZWA 2QCGA 5C6MA 4XBKA 1K7FA 3M5VA 4MYXA 2GVJA 2A2IA 3MBFA 2ABAA 3F03K 2ZCGA 3KXQA 5C5YA 2J88A 4K8EA 1NEYA 2YZRA 2WSRA 4ZQCA 1MEWA 4Y96A 3ZR4A 4C1KA 3G1HA 2A4AA 1SSDA 1B9BA 3LRKA 2BTMA 3PSWA 2DZSA 3PB0A 4GJ1A 3P62A 4D2JA 2BZNA 2PURA 1W0MA 3PG8A 2X1TA 5K7JA 3BK0A 4AHOA 3DZ1A 2ZZ7A 1DOSA 1JQXA 1FDJA 2QCEA 3LCFA 3TQ0A 4HNUA 3EEGA 1DKWA 4Z08A 3SR7A 1L6YA 4EWND 4WQ6A 1LM1A 2RDUA 3TDFA 4UTMA 5AHNA 3R89A 2QCLA 1BWLA 5CPMA 1O60A 3KVLA 1FX6A 1SPQA 4DPPA 4S1FA 1Q6RA 1H7RA 2GQ8A 2CLIA 1QPOA 3FYPA 3N34A 4FNPA 4JGDA 1I2QA 4O1CA 1FDZA 3M5YA 4O28A 1AW1A 3NM3A 4IX0A 4AH7A 1A53A 3QRHA 3TH6A 1VH7A 2Z0IA 3S5YA 5EMUA 1FCUA 1VRDA 2A5HA 3MHUA 1GZGA 3IIXA 3TV8A 1QFEA 3LRMA 3ABQA 1TIMA 5FF4A 1K3UA 3LOTA 3PWAA 2ZYFA 3NPVA 5TIMA 4ZQNA 4RKAA 4JDYA 1SU5A 1KBIA 3EWBX 2X2GA 1LYXA 4NJGA 5AC7A 3LTYA 5J5DA 3GKAA 4BF9A 5LKYA 4JS3A 4RX0A 2VFIA 4O1BA 1QO5A 5EPDA 4NJIA 2CU0A 2C16A 1EX5A 3FJ6A 3IGXA 4AF0B 1C29A 1FWSA 4NXKA 4E38A 1LTDA 1YXDA 1L6SA 1QNVA 5LNWA 5U4NA 1ZFJA 4DBDA 4JR5A 3O63A 4O1AA 2DZVA 1N8FA 4O4VA 4NT0A 2VELA 2ISWA 3GDTA 2W6RA 3U6WA 5J5RA 3HJZA 3JRKA 3C56A 3GLCA 4JIPA 1FY6A 3VNDA 5D38A 1Y0EA 3V75A 1ME8A 2YW3A 3SGUA 3LHYA 2OT0A 3LLDA 5D37A 1SO3A 2G5WA 4DF2A 4MVAA 3S1VA 5I3FA 2Z2UA 3QZEA 4EOUA 3NQCA 4IXHA 4TX9A 3NG3A 3HG5A 2RHGA 2A7NA 3MHFA 2GVLA 5CZ0A 1QMLA 4WUIA 5T26A 1TQXA 1OFOA 1KFBA 1IIHA 2CFFA 4Z1BA 4JX6A 5A5WA 2GQAA 1W54A 3T78A 4L4MA 1Q6OA 4QQ3A 3TJXA 2PRHA 1WQ5A 2QUUA 4AWTA 3W2MA 3W7CA 4JY8A 1WYIA 2XN0A 3N9RA 4AVFA 4UFMA 2QCNA 3CU2A 3UPBA 5DBTA 4ZVJA 2CLKA 1NFBA 3KAOA 1ADOA 3O6YX 2H6RA 3A23A 2WSQA 2EHHA 2DJXA 4HT3A 4JTGA 1RQHA 2EF9A 4NNBA 1W3IA 2V9DA 4GUHA 3A21A 3W7KA 3MP5A 4ZL1A 3NQVA 1YXCA 1HFBA 1KW1A 5U7SA 1SO6A 3CLMA 1BEUA 4M5PA 5DCBA 3IIOA 3LRLA 2GJNA 4UFKA 4O0KA 1OX4A 5CZJA 4IJBA 2R91A 2QCCA 3BW4A 4FNTA 3A5FA 2BX7A 1TSIA 1VYRA 3D0CA 2WKJA 5LNSA 1TTIA 2QAPA 3O06A 3S5OA 4XKYA 3W7HA 2ZQ0A 1TO3A 1VPXA 2C1HA 3TX9A 3EX6A 3B0UX 2OMAA 4AWUA 3W75A 5DY3A 3T4CA 5IBXC 2GQ9A 3NM1A 1OJXA 2FB2A 3I65A 2XN2A 2B7NA 5SWUA 4AMAA 4CQ8A 5TQLA 3MUXA 1OX4B 4FXRA 3DI0A 1QOPA 1GG0A 3IIVA 3W1AA 3DFPA 4YXGA 3FLUA 2TRSA 3N2XA 1B57A 1TPWA 4R7JA 4OU1A 3QMTA 5K2ZA 3S5ZA 5EBUA 1VYSX 3NQ7A 2JKEA 2QCMA 5CG7A 4R33A 3LM7A 4ZQOA 4QM1A 4C1LA 3TMLA 1D3HA 1J4EA 4JTIA 4UTLA 3EX3A 1VYPX 2ABBA 5GVJA 1YXYA 2R14A 3TR2A 4DO5A 3KX6A 1NVMA 1KV5A 1KV8A 3IIPA 1ZNNA 1GYLA 1IIGA 4OGZA 4MLJA 1S3HA 1X8FA 1XM3A 3W07A 5K9XA 4IWWA 2ZRUA 4TR9A 1SUXA 3M44A 1VHCA 2VEPA 1LOQA 2DZXA 3HPXA 1KFLA 4CQAA 2ZDRA 1RQEA 3UD6A 3HQ1A 5CPLA 1A5AA 4B5NA 4WZHA 2PE4A 3KVJA 4AAJA 1EWEA 3QQ1A 2H3BA 1KA9F 3QEZA 1ONRA 2ZRVA 1R47A 5D2YA 4PEKA 3W73A 3AJXA 3GAYA 1JJKA 3W85A 4M6PA 1MEIA 5CPOA 3WFAA 1OABA 3UYCA 2E6YA 4N4QA 1ICPA 3PAJA 4NQ1A 1VCVA 1ZENA 4ADTA 4RLIA 5G4EA 3LX9A 3EXTA 4JDBA 1QWGA 2E09A 4LRTA 2KZHA 3MBDA 3OBKA 2E77A 4HPJA 4WY0A 1CI1A 2I14A 2WJZA 5D05A 3NQ8A 4O52A 4J9JA 4XBSA 3EX2A 4NNAA 1DVJA 1CW2A 3FA5A 1ZY9A 2Q8LA 2E6FA 3RLUA 1YDNA 1OYCA 5BOOA 3SFKA 1W5PA 1K8ZA 4MY1A 2HSAA 2V2CA 3NL3A 2QKFA 3P80A 3LCIA 3TW7A 2VFFA 4GXMA 1TJPA 5H91A 1L6WA 1OF6A 1YPFA 4Q4KA 1NF0A 4MFDA 3BLIA 3GIYA 3LLFA 3ZS4A 3M6YA 3KRUA 4NNCA 3W23A 3TXZA 3C6CA 1YDVA 4QJ1A 2YFNA 1IXPA 1FCBA 2ZA2A 3W7LA 3P5YA 4QAIA 2E6AA 1ICQA 4OV9A 4AF0A 1HG3A 3H55A 4JTSA 1MZHA 1EP3A 2GUUA 2VEIA 1P1XA 3E12A 4LVAA 4XTIA 3GKFA 4OV4A 2D73A 3OVQA 3GDKA 2NV1A 4IMEA 4PTNA 3G1YA 1ML1A 3B05A 3R12A 1JUKA 3A9IA 1M7OA 3PR2A 3G0UA 2TPSA 2NZLA 4WOQA 3OHIA 1TYGA 1FWRA 3W74A 1WX0A 2A1YA 1KM1A 3B8DA 3P74A 3SW6A 1SSGA 2XFWA 3S5NA 2YW4A 4RK8A 3TNOA 5FF0A 1K8YA 1ZALA 1F74A 4MPQA 4WOZA 3HMJG 1U83A 3TE9A 1PV8A 4UFLA 3SECA 2JK2A 4FX6M 3INPA 3W71A 1O4UA 4HNVA 3WJYA 3W7MA 2V0TA 4Z1AA 3UY8A 2Y7EA 1SO4A 5AHFA 3VE9A 1SR9A 1MXSA 5AHMA 2IQTA 2CLMA 5CPNA 2NXGA 2RDTA 1I2NA 2B7OA 1OVDA 1HL2A 3TSBA 3PF3A 3LGEA 5KTLA 3LCXA 3NYZA 4GC4A 4IMFA 5G2WA 3C2RA 4NVTA 4PA8A 3M16A 4HNNA 1I4NA 3UWWA 3VCRA 5E1QA 2JGYA 1ZAJA 2G95A 1GT8A 3MHGA 3HPZA 3STCA 4JYFA 1AW5A 5BMWA 3W86A 4LUIA 3CQ0A 4DELA 1Z41A 1OX6A 4TMBA 4BWLC 4I9AA 3TKFA 3UQNA 3L0NA 1A5SA 1XBZA 1H5YA 5KINA 5AHIA 5F4WA 4O57A 3UPWA 3V1PA 3W7RA 1A5CA 2V2DA 5LHFA 3GR7A 2PC4A 5AC6A 3N3MA 4HKPA 5G4WA 3WK0A 1S5WA 1KLZA 5CSRA 3NQ6A 1SW7A 4CQ9A 4WXYA 5E0KA 1XUZA 2VEKA 3EXSA 4O14A 3HPSA 5AHLA 3EX4A 1UUOA 3QH2A 1M5WA 1XXXA 2FTPA 3W1XA 2ZA1A 3QC3A 3RLVA 1B4KA 4DXVA 4FX7A 1OYBA 5EL1A 3PBUA 2GPTA 1I45A 4UTUA 1VLIA 2VC6A 4O54A 4QISA 3RNDA 2HMCA 1TQJA 3S6DA 1GQNA 3W1MA 4AEOA 1LLZA 3TAKA 5FEZA 3LB0A 4OWGA 4WXZA 3QM3A 1VCGA 1KFEA 4ZMGA 5K3VA 2FPVA 4PCFA 4PC8A 3O05A 3HBLA 4EF9A 2NWRA 2CLFA 2OT1A 5KITA 1KFKA 4RZ4A 2Y61A 5BNKA 3USBA 3TSMA 3PUDA 3NXFA 4O53A 1OK4A 3LHZA 5FESA 3W7NA 3GVGA 1I2PA 3HGRA 4GWEA 2OCZA 3Q94A 4LS0A 3CWOX 2P0OA 3C2VA 3QW4B 5D2WA 4OT7A 3F4NA 3BLEA 2C15A 3NPWA 3NOEA 2TMDA 1W5OA 2RFGA 3L5LA 3O15A 4RCXA 4YMZA 2A7PA 3S0CA 4EF8A 1TPH1 3W2NA 2JBMA 4MUZA 4FX8A 4MJMA 3UNDA 3W22A 1ICSA 4GUIA 5C55A 6ALDA 3GDMA 5I3KA 4O13A 4ZZ9A 1R2TA 4IGHA 1TTJA 3U8GA 1PHQA 1FCVA 1G4PA 1S5TA 1LBFA 1OFPA 4UFHA 2V5BA 4JTJA 2NX3A 2ISVA 2WSYA 1IF2A 3EKZA 1F73A 3TQVA 3CB8A 1XBXA 5K9CA 1JRCA 3GK0A 1TV7A 1KM0A 3PC0A 4Y6GA 2Y7DA 3PS7A 4Q32A 3QMSA 5G1YA 3CM4A 1LDCA 2X30A 4S2CA 3RU6A 3W7QA 1SFLA 4YCOA 3BPWA 5L9FA 3MP4A 4RXGA 1TPDA 3TCEA 3EXRA 3O6CA 4E2DA 5K4ZA 1AK5A 5FEXA 3LHUA 3DH7A 2ZRXA 2PRMA 3GDLA 4GE8A 1R2RA 2QCDB 3SZ8A 1ME9A 1KM5A 3ATYA 3T44A 3EKLA 3G0SA 2C14A 2YSWA 1K03A 5HR7A 1C8VA 1OYAA 4FO4A 1QOQA 3DBPA 3TQKA 2NUXA 1XKYA 5E93A 2B7PA 4MY8A 4YL2A 1OFBA 3FFSA 3NNTA 3I6RA 3STEA 4I7WA 1KM2A 4Z1DA 4HN4A 4UUIA 4YWIA 1XL9A 1VLWA 4QNEA 3LCLA 4XWUA 3CC1A 2WV8A 3NZ1A 5D33A 2QJGA 3TW6A 4O10A 3DGRA 5C54A 3EWZA 2YPIA 2EPHA 1JULA 1VCFA 1G67A 4N2YA 3P8IA 4NZJA 2H8ZA 2F7FA 2HS6A 1FWTA 4JXCA 4UTIA 3DENA 3N2MA 2V2HA 2OX1A 4LS2A 4IPJA 1IXQA 1G4SA 1LZOA 3E0IA 5TBOA 3MMTA 2J9XA 3W7DA 2YCEA 1EPXA 4ADSA 5DY2A 1X1OA 3C0JA 5LNVA 1UUMA 1AL8A 1HO1A 3L5MA 2FB3A 3NQ2A 2HTMA 2ATMA 1G6CA 4DF1A 1F6KA 1LRNA 4HSOA 4N9DA 5FEWA 1O95A 2XN1A 1FUYA 3KRSA 3TC7A 2ZBTA 1OG0A 3TU9A 2C18A 4JTFA 5AC8A 2VFGA 5HUOA 4N9BA 3L67A 4PL1A 1X6UA 1K02A 1I8JA 3W7PA 4POCA 1W8SA 4PODA 1P5BA 1DJQA 3PM6A 5F2GA 4XKYB 5DXXA 4UNKA 3L66A 2O7SA 1LOLA 3NO5A 4JTUA 1PL9A 1WBJA 3T7VA 5AOUA 5FF3A 4MIMA 3A24A 3DI1A 3LERA 2Q3OA 1OHLA 3L65A 1Z48A 1PHWA 2X1SA 1YTEA 4BI5A 1L2UA 3Q37A 4GFSA 3UWVA 2CZ5A 3S1WA 3H54A 4DF0A 4JY9A 1GVQA 3IRDA 3BV4A 2DORA 3LI1A 3B03A 2A7RA 3TFCA 1UJPA 1OFDA 2ALDA 3G1AA 3NQAA 5DELA 1YDOA 1W31A 3FOKA 4LV4A 1EUNA 3MI2A 2ZZ6A 4U4MA 2Y62A 4NJKA 3IVSA 2P10A 3I7SA 1DBTA 5LNUA 3G18A 4JYDA 1JRBA 2HS8A 4X22A 2J27A 1W37A 4O17A 1XDLA 3W88A 4RV8A 3EX1A 1KTCA 3GB6A 3ABRA 4M6QA 5D32A 3STFA 3LHVA 2G97A 4HSNA 3C52A 5IBXA 1QPNA 5BRBA 1O94A 5LGXA 3PG9A 5I3JA 2Y89A 3RFAA 2WPBA 1ZAHA 3S42A 2QF7A 1TTPA 3LBMA 3B0VC 2EKCA 1RR2A 4IXXA 3W1TA 1F7BA 1JQVA 1IXNA 4UXDA 4BWLA 3HOJA 4GRSA 1Z42A 5KZMA 1ZCOA 4AXKA 4LTSA 4BI6A 5HMSA 5F2MA 4Y90A 2C3ZA 4W9TA 1TV5A 4K39A 4LNYA 4JEQA 1OFQA 1FQ0A 2C6QA 3O07A 4I7UA 4O8RA 2PRLA 2EAWA 1KFCA 3BG9A 4JTTA 2DU2A 3NQMA 1GVFA 3OVRA 4UFJA 4NZFA 1TPFA 2QJHA 1KTNA 4MOZA 2NX1A 4DQWA 4O19A 5D09A 3DFNA 2NX9A 3NR0A 1GTHA 4UR8A 1X7FA 2ISSA 3IGSA 1K8XA 4O50A 1XUUA 1WXJA 3CTLA 4JN6A 1QAPA 4DO6A 3W1LA 3QQ0A 1J2WA 2Z6IA 2ZZ5A 1UCWA 4TIMA 2DZWA 2NUWA 1VC4A 1LBMA 4A3UA 4O18A 3SSJA 4FNQA 4LVGA 1H1ZA 3S8HA 2YR1A 1W5MA 1VS1A 3W1RA 4RJEA 3PY2A 3MYPA 2TYSA 4N9CA 1VQTA 3I68A 1RQBA 2C19A 2F84A
chains in the Genus database with same CATH superfamily
2AQWA 3GO2A 1VFHA 4JKMA 1T99A 2OTDA 1NFGA 3UF9A 4ZB5A 5GPRA 2DT2A 1ZBVA 2I57A 4IPLA 2YDRA 1GZ1A 2YB1A 1HUVA 3DAQA 2CLEA 2YL8A 1R7OA 3S2MA 1QDSA 4Z0SA 1UR9A 3M9YA 3W28A 3W81A 5REQA 2PODA 3C2FA 3MUZ1 4ZQRA 5DO8A 3B9DA 2E4TA 1BRLB 4I3GA 4OUEA 3ZXWA 3N19B 4RR4A 3LG3A 3GW0A 1TRIA 2YBUA 4GY0A 3PUEA 1DQUA 1ZJIA 1JUBA 2Y7FA 3FIGA 1ITUA 1BQGA 3WUBA 1R3VA 3VNJA 4XZHA 3QTPA 5G2IA 5A6BA 3CPGA 4P7LA 4I7VA 1E1CA 4O1EA 1AQMA 2WVSA 2ZXQA 2FGBA 1EJVC 2EPNA 2AAMA 4TQTA 4QRNA 3TEVA 5DLCA 4CQCA 1OSEA 3IK2A 2E9BA 2P76A 3I7QA 3ABZA 1QOXA 1AQ0A 2A21A 3G24A 1IXOA 5H8UA 2PGEA 1YTDA 2ZA3A 3M43A 4MMWA 4OHQA 5D02A 1G69A 2FDSA 2FQIA 4Y9MA 2FZBA 1J11A 5CSUA 1WKYA 1Q63A 2JEPA 3NQGA 2WMIB 3NL6A 3UZZA 3W7IA 2ZX5A 3W2JA 1H3GA 1E6PA 3B06A 1IYXA 1Q7ZA 1UJQA 1T40A 3HU7A 3E2SA 3WLSA 1QTWA 3PPCA 1GVSA 2JQXA 3E2VA 3DFHA 3HGJA 1TJRA 2VEMA 1I0DA 3NZQA 3QPYA 3EOSA 5D2VA 4N6FA 4HN8A 3GNNA 5JXQA 2OFJA 3QSRA 4C6BA 1YYAA 3VFLA 4FF7A 3LV5A 1BVWA 3FA4A 1H50A 3QW3A 1PCWA 1H09A 2YA0A 4K7VA 3A47A 2VR4A 3HG2A 2IKJA 1PKLA 2QPXA 3MKVA 1CGUA 4Y9PA 4HHPA 3IAQA 2VKZG 3VC5A 3OLGA 5D4YA 2VFDA 3QV8A 1SW0A 1NQKA 1FXQA 2BVYA 2PDWA 1OCJA 4O0ZA 4MB5A 1PX4A 4FZIA 2A3EA 3O6DA 3ARVA 3IPWA 4P2VA 3V4BA 2BFGA 3WH8A 1ZTVA 1E5NA 4W7WA 4Y9NA 2J6XA 4YLWA 3D3FA 3DX5A 1TV4A 5IHSA 4QP0A 3BGGA 3QKEA 2Z26A 3GG1A 3QPEA 3ANYA 3GH5A 3EYPA 3WJWA 4E8CA 3MSGA 2HWGA 1XV8A 3UCDA 2RH9A 1TVNA 1RK5A 4GI9A 5AB3A 4GO9A 3K13A 1FFQA 1GVRA 4R7OA 4UTTA 3QHMA 4AIUA 4A05A 4LWWA 1G7VA 3VKBA 2HCVA 1P0KA 1MQRA 4CEXC 3EWCA 3VZZA 5H2ZA 4XZIA 3MMUA 1T8XA 4TO8A 3R4IA 2P3EA 4UTWA 1W3LA 5D9MA 2OELA 3LXAA 4NASA 5G4HC 5HPOA 5HQEA 3ZR5A 3NJ3A 1CXHA 1RLCL 5I3IA 4IFKB 4TVUA 4HYWA 3OVPA 3NGJA 3VIIA 5I3GA 4M6VA 1TREA 3SEPA 1I75A 4ZXLA 4GFIA 1JDAA 4PE8A 1THFD 1W3NA 2WO5A 4P5UA 3FHQA 2Y63A 1TE1A 1OD8A 1E6XM 3PB2A 2FZDA 2FKPA 4ORMA 4Z2IA 2WQPA 1BPLB 5A6LA 4DYEA 4QS5A 4C6DA 1EHAA 3B04A 1WBHA 5F7UA 4MKNA 1PZ1A 1PIIA 2BLEA 4JICA 6CGTA 3LPGA 4OOUA 2WSPA 2EPLX 4MFEA 4O1FA 1PWMA 3NSMA 4Z0JA 3BOFA 2MNRA 3DKJA 3KRBA 1LP6A 4U28A 5IOBA 1KWKA 4D9PA 2E68A 2OZ0A 4Q33A 2GK1B 1YNPA 3SCOA 1H7PA 4HPNA 1XINA 1TPUA 2ODOA 4PRTA 2BSLA 2DQWA 3THQA 3UR7A 5CAKA 5I3HA 5J04A 5CGTA 3ITLA 3AZRA 5F1VA 2C79A 4GNJA 4KEZA 2JALA 7TIMA 2XIJA 5FOOA 4CN6A 3L0KA 2EPKX 1XP3A 1XR2A 5DN1A 3MU7A 3QFEA 1TPVA 2H9AA 2Y70A 3KBVA 3ME3A 4NP7A 4HMEA 4PCTA 1YNYA 1CXKA 1GOMA 3UG4A 3GZ3A 1YBQA 3TOPA 3UCCA 3WDPP 4XZ9A 4KIRA 1QUMA 3QHOA 4WJ8A 3FXYA 3LGGA 2A6LA 1CB7B 3HG4A 1KWGA 1SR0A 1UW9A 1DJNA 1M04A 3MCMA 5HWJA 1WDSA 2VRJA 3LQGA 4UFIA 4JN7A 3P61A 4FNUA 2QUNA 3N9SA 3N4AA 1ZSXA 3DHFA 2F6XA 1UUQA 1GUVA 4E0CA 1FWCC 4LYRA 4DUWA 1H1NA 4Z1YA 4YVVA 1PYMA 3OG3A 1MSSA 4X9SA 1W3HA 2YCJA 3QYQA 1H60A 3VKAA 4PBEA 4YCPA 4L9ZA 5JH2A 3EWXA 3OU8A 3M0LA 4KF1A 3F5KA 3S6TA 4ZE4A 1SQ7A 1CENA 2FMNA 5BMXA 1RCQA 4OBTA 1VHNA 2VWSA 4B2DD 4X0VA 2HVMA 2P3ZA 1GWJA 2YL6A 3P8JA 1D3GA 4A35A 1IGWA 4PUJA 3KZPA 4PTXA 3QPZA 4RZBA 3T4WA 3DGBA 2CLHA 4JYEA 2PWVA 3LCHA 2NW0A 3WUFA 4DAIA 3TJLA 2E8YA 1EP2A 3RGTA 2DUXA 1XBVA 3QV6A 2BGQA 4NZ1A 1TFVA 1B3VA 3LNPA 2WB5A 4AZ6A 3PZVA 3B97A 1V6WA 3LU2A 3FXGA 1RK6A 3EWUA 3RX4A 5AYYA 3QXBA 5F4SA 1PTAA 3SQMA 1MDRA 2E5BA 1A5MC 4WSJA 2UZ9A 1TWZA 1ZQ5A 1P6WA 1HKWA 1DP0A 3COTA 2EGZA 3ERPA 3OLIA 5REQB 1IT7A 3APGA 3QVQA 5K9DA 2WNQA 7A3HA 2UY2A 4AWSA 1LLWA 4O8AA 1J6OA 1NAL1 2YL5A 4I9JA 3TW9A 3VE7A 1PS9A 2WKGA 1V7AA 1VP5A 4KFOA 3C0LA 2PDIA 1W3KA 3QZ6A 3MSYA 3NQEA 3WO8A 2VOMA 2F2KA 1JXJA 3AMLA 3W1QA 3AU6A 4H8NA 1AMKA 5AC5A 2FZ9A 2XGIA 1JI1A 3FAWA 4GIEA 2VO5A 2FFCA 3OO2A 2P8CA 1UD6A 2W0UA 1OC6A 2QDGA 1P0EA 4FK9A 6TIMA 4JTEA 4DAFA 1P0NA 2OQLA 1WDWA 1MW3A 4JNZA 3WH6A 2ANUA 3WJZA 3K5XA 4K38A 1Q6LA 1MXGA 1ALDA 3TYAA 2CKRA 2PD5A 2D23A 3V35A 3WH9A 2V30A 4UMCA 3UVIA 3WLHA 1CXFA 1DIKA 3VNZA 3TCSA 2WNNA 1YDYA 5A8NA 3URBA 2WHJA 2EEXA 3MO7A 3FYOA 3SN1A 2YBTA 3VOIA 2V5CA 5A6TC 3U5UA 3FJ4A 1K7XA 4DXKA 3TC6A 3W1NA 3IIZA 1SVDA 3USZA 3M07A 2Z25A 4ERGA 3O16A 1BWKA 3TA6A 1GTEA 3VI2A 5T9CE 3BJTA 1JZ6A 4QLJA 1Q13A 3NPXA 3AMKA 3NVTA 4JNMA 3P5ZA 3STGA 2YGYA 4XTDA 4J35A 3B0XA 3S4TA 3UVAA 3IRSA 3APYA 3LQLA 3QJAA 2OU4A 3F4DA 3WH7A 3PHAA 3TIMA 4BCEA 3TYZA 4GYFA 1V77A 4NJHA 1K7EA 4P8XA 1VEMA 1AQHA 1ZAIA 3GC4A 3LV6A 2P50A 4M1BA 1NF7A 3E6EA 4EPDC 5I24A 2Q09A 1D8CA 3HA1A 4UTHA 2Q3RA 1Y65A 2Y6ZA 2Y85A 5D04C 2I16A 1AVAA 1D7KA 4GVIA 1UWRA 1FWWA 1GHSA 1EUAA 3KOFA 1WNOA 3W1PA 4FXJA 4ORIA 2OEKA 4EXQA 2ZE0A 1NQ6A 3ZWTA 2PDNA 2B0MA 2FVMA 3BG5A 1UR0A 3OEXA 3UZJA 4NAEA 5BOFA 4TVDA 3ARYA 1OM0A 1G9HA 3RLGA 2PWFA 4RW5A 4UTTC 2NQHA 3SN4A 2X40A 2XH0A 4PUDA 2GQ3A 3F4CA 1B5TA 4PMVA 1D3CA 3KTSA 3IACA 3BMWA 3CL8A 2EBNA 2QLYA 1B3ZA 1GCYA 8A3HA 3SB0A 5ECUA 1IR2A 3IUHA 3CT7A 4QS6A 3ZT5A 5ENLA 2J47A 1GK8A 4CNSA 1O12A 3W1UA 4LF1A 5CBJA 1RLDA 4XUGA 5CPQA 3FSUA 3CQKA 2J7DA 4NZ3A 1EC9A 1XX1A 3R2GA 4J3UA 1F4AA 3ARWA 3H26A 3GFZA 4LYPA 1XYMA 2CLLA 5AY7A 1E6ZA 3UY7A 4D8LA 3LD5A 5BCAA 4PFHA 2CW6A 4KGJA 3IWPA 3DFQA 4DWSC 2NSOA 5M1TA 3NAVA 1KBJA 2ISFA 4JL1A 5DBUA 3K46A 3GXPA 4Q8PA 1LOSA 3AIWA 4MKVA 4G1KA 4PRRA 3IJQA 4GVFA 1ITQA 1T96A 4INFA 1FWHC 3H7RA 4IUOA 5LNRA 1VZWA 2QCGA 4PUUA 4XBKA 4MTVA 3M5VA 4LFYA 4MYXA 4OUIA 1XQLA 2GVJA 4EWJA 3KXQA 2J88A 2AKZA 2WSRA 2XINA 4ZQCA 3GC2A 1UR2A 3KLKA 4UOJA 2XGBA 1YKWA 4EX4A 4FLSA 1CLKA 3GG0A 1MUWA 3TN4A 1XISA 2HQAA 3PSWA 2DZSA 1PZ0A 3P62A 3VIGA 2G3JA 3ZSTA 1R85A 3TONA 3BOXA 1IWBA 4LXFA 4B91A 4I6VA 2ZZ7A 1GJUA 1DOSA 1JQXA 1B3YA 2EJAA 2W4XA 2H9AB 1PSCA 1QBAA 4Z08A 3SR7A 2ZICA 3CAKA 3GTFA 2JE8A 6ENLA 1V3IA 1B54A 1TELA 3R89A 2QCLA 1P0BA 4C6FA 2VZUA 5CPMA 3S83A 4Q8MA 1RP8A 1Q6RA 1H7RA 2GQ8A 4DBSA 3N34A 4NRSA 4QX4A 3M5YA 5EB8A 3NM3A 3VIJA 4CQDA 3KUMA 1A53A 3T2QA 4GY7A 2Z0IA 3S5YA 5CC5A 3GHTA 3MHUA 2HBVA 1GZGA 3TV8A 4H9YA 3WLOA 4IG2B 3NPVA 5CBBA 5TIMA 3NUKA 3UCQA 1UP0A 4JDYA 1KBIA 2X2GA 1OADA 5DT7A 2ZUSA 1EZWA 4JS3A 1CNVA 3I4EA 3KOXA 4GI4A 5BWAA 5EPDA 4NJIA 2XFFA 4G1NA 2Z7GA 4F8XA 4GCXA 1FWSA 2DEPA 1YXDA 1L6SA 3T42A 5BXSA 5U4NA 4DBDA 2BB0A 4JR5A 3O63A 2FZMA 5AYBA 1N8FA 4NT0A 3ZT7A 1BKHA 4R9XA 5J5RA 5FJUA 3EDFA 3GLCA 4JIPA 6TAAA 1JYNA 1FY6A 1OZMA 2XIMA 4OECA 3VNDA 4YJ5A 2YIHA 5D38A 1D2KA 3C3UA 3DOPA 3V75A 1YIXA 3LLDA 3KS5A 4DJED 3Q65A 4EOUA 4C60A 3U57A 3NG3A 2QMJA 4DI9A 4CU8A 2AQOA 4JIRA 1LQ0A 1XHGA 1M68A 1RJPA 1A3WA 3LPPA 1YW1A 1IIHA 3GSMA 1E56A 4GVGA 4JX6A 2GQAA 5A5WA 1SGJA 3T78A 1O5RA 1JZ2A 2PTDA 4Q4OA 1R86A 4UZUA 3FYYA 1SM9A 2PRHA 5T8GA 1AJZA 1NDYA 3R79A 4AVFA 2QCNA 3UPBA 1XGDA 2XWDA 1OGBA 2CLKA 1KD0A 1NFBA 2H6RA 2C71A 4CN1A 1L2QA 1EJXC 4NNBA 3R8GA 1W3IA 4GUHA 2VZTA 2CBJA 1NOUA 4ASTA 3MP5A 2Y5EA 3E3HA 3H8AA 1KW1A 3KZSA 3B8IA 5U7SA 3H2OA 4Q8UA 1M9HA 3LRLA 3M4HA 1M7XA 1TA3B 2WWDA 4D6DA 3H7VA 3D0CA 2WKJA 5LNSA 4JKLA 4YVPA 2QAPA 3VMNA 1VBUA 1VPXA 2XU2A 4P7QA 2OVLA 2OQHA 3W75A 5IBXC 1QNPA 1KQYA 3NM1A 1ECQA 3KE0A 4B2DA 3IIVA 3N2XA 4C6JA 4KETA 1B57A 1W6TA 3ENLA 1TPWA 2F38A 5CBIA 3B8TA 3NQ7A 3I3EA 2QCMA 4HZ7A 4CVWA 1U1UA 2BVWA 4H41A 4FXFA 4XSLA 1E1CB 4JTIA 5LYRA 5GVJA 2ABBA 2XH2A 2J25A 3B8VA 4V27A 1DJIA 4D6CA 3POHA 1I1WA 4WDUA 1TWSA 3IIPA 2QW5A 1ZNNA 1GYLA 1IIGA 4OGZA 1S3HA 2RDXA 1M65A 1W2PA 4ACZB 1UH4A 2R1KA 4H83A 2QPUA 3M44A 2DZXA 4CQAA 2ZDRA 3MSDA 4QDPA 1EXPA 3GQYA 3R0DA 4Q8VA 1A5AA 4X2PA 4GQGA 4WZHA 4AAJA 2QUMA 4A8IA 5CJ5A 2VM8A 1L6GA 2R9RA 5DRIA 5D2YA 4JQAA 2D3NA 3GAYA 1LT8A 3GVWA 1MEIA 5CPOA 3WD3A 5HANA 3RHGA 2E6YA 3GVRA 4NQ1A 4EACA 1OB0A 5CC7A 1KBKA 2XVPA 1TJ1A 4DJEA 3MBDA 3OBKA 3ZYZA 1CI1A 3FHAA 2I14A 2WJZA 3TYCA 1MYRA 4J9JA 4JQ2A 3SCVA 1CW2A 3UJRA 3WD2A 1C7SA 3MCNA 3LMYA 1K8ZA 3BOLA 1WKEA 1VD6A 3IANA 1HF6A 3RYSA 7TAAA 1E3ZA 1J0ZA 3TW7A 4GXMA 3M0YA 1WDPA 1JNEA 2WMGA 3DN5A 3OLEA 4HGXA 1RPKA 4LQ1A 4X60A 3GIYA 3FSTA 4HMCA 3KRUA 1XG3A 2EJ1A 4HZ6A 3DESA 1UWSA 5IRPA 4QAIA 2OZ3A 4H04A 4DBUA 2HK0A 1HG3A 4JTSA 1MZHA 1X6NA 2VEIA 2VNCA 4KPLA 3K1GA 3AHXA 2D73A 3OVQA 3GDKA 1ML1A 2QULA 3KTXA 4PMJA 1GPFA 3PR2A 4J3ZA 5HBFA 1RD6A 3S46A 1J10A 3EDKA 1KO0A 1UPPA 2NZLA 2Z00A 1FWRA 3W74A 6A3HA 3ZLHA 1F3EA 3O6AA 2J66A 5GJMA 4M82A 2YW4A 4RK8A 5FJPA 4DLMA 1K8YA 2ADAA 3TE9A 4MNLA 4QFUA 4UFLA 1P7TB 3INPA 4HNVA 5JBDA 3WJYA 1XLJA 3NO3A 2V0TA 4J5NA 1QI5A 4XAFA 1BWVA 3MWCA 3OYXA 1FFRA 2IQTA 2OX4A 2B7OA 1OVDA 2SFPA 3PF3A 3PNUA 3DC8A 3M0VA 1O5QA 4S3FA 2VR2A 2V67A 1UQZA 3WQ4A 4NVTA 1ONEA 4IH3A 4PA8A 3GH4A 3P14A 4LSBA 3KOWA 2ZWZA 1JG9A 3CGTA 4JYFA 5DMNA 4QSFA 3W86A 1RALA 4DELA 3CLWA 4TMBA 4EP8C 3NVDA 4I9AA 1FP9A 1M03A 1VIZA 4B3ZA 5KINA 3UPWA 1EJ7L 2V2DA 4XZMX 1XH0A 2YKKA 1HJUA 5AC6A 5G4WA 4U31A 3H23A 3AS2A 1HW6A 4ZB0A 2Z27A 2HXTA 1HJWA 3CYJA 1M53A 2HROA 1XUZA 4O14A 3EX4A 3BWWA 3FGCB 1ISZA 5HA7A 2FTPA 2G4FA 4FX7A 3PBUA 2GPTA 4H8HA 1JAKA 1I45A 4X63A 4QISA 3RNDA 5FCZA 2WZTA 4GKLA 4TXEA 4MWAD 1GQNA 3S6DA 1QJWA 3OZMA 4KRUA 3TAKA 3QM3A 1TX2A 4KERA 5K3VA 1KGUA 4D1IA 4EF9A 3RUBL 2OT1A 5KITA 1KFKA 3WDRA 2Y61A 2RJHA 3GW3A 4GABA 3NXFA 4RDZA 1OK4A 3ZSSA 3GVGA 1I2PA 4MDPA 5B7YA 1CGVA 3ARQA 1NDVA 4LS0A 1WDQA 4AWEA 3FDKA 4DUXA 2WYSA 2P0OA 1YPXA 1KRBC 2BY2A 3KW3A 4RV3A 3C2VA 3QW4B 3F4NA 1H5VA 3BICA 4XX6A 2C15A 3NPWA 2TMDA 4J40A 2BY3A 4FR1A 3T0TA 2A7PA 1F07A 4OIFA 3W2NA 3QGAC 1ISWA 6ALDA 3ZJ8A 1ZL1A 2WHLA 5AVHA 4LB4A 2VWTA 1LBFA 4UFHA 2ISVA 3TQVA 4Q8OA 2D3LA 3WBWA 3AHVA 5DEZA 1JRCA 3GK0A 3T0CA 4BQ5A 3O0KA 2OB3A 4F79A 4F2BA 1MFVA 2Y7DA 1REQB 4Q32A 3E0VA 3QMSA 2E25A 3CM4A 3N12A 1VFMA 1LDCA 2OYLA 4S2CA 1SFLA 3CAWA 3UFYA 3F5LA 5L9FA 1AFSA 1V0NA 3SDOA 1TPDA 1VAHA 3O6CA 5K4ZA 2FVKA 1R2RA 2BV9A 2QDDA 2QS8A 4GI6A 1HKKA 2VC5A 3NSXA 3SCRA 3WFZA 2C14A 2YSWA 2WMHA 4GIRA 4BZYA 1XKYA 2PDXA 4MY8A 1OFBA 1FH9A 4ZFMA 3GZAA 4V2XA 4YWIA 1E6NA 5D33A 2QJGA 4O10A 3HV8A 4AEFA 2NQJA 4XZBA 2EPHA 1JULA 1VCFA 2BODX 4MDOA 4N2YA 2ASHA 2HNHA 2FHFA 2H8ZA 3T8QA 1FWTA 1BF2A 1FWAC 1P43A 1PWLA 1X39A 3F2BA 5TBOA 1RH9A 1UP2A 4QCEA 4WKHA 3W7DA 2YCEA 4K2SA 1TZZA 2HDJA 3DG6A 1UUMA 1AL8A 4E3TA 2GYIA 3NQ2A 1G6CA 4DF1A 1LLOA 4HSOA 1LF1A 1J0JA 3KRSA 3VNIA 3G1RA 4HK5A 3TU9A 1XIDA 2G8ZA 1X96A 5AC8A 3U2CA 4N9BA 1PPIA 3QLDA 1K02A 4PEEA 1KCKA 4XKYB 4ZFCA 5DXXA 7REQA 3ALGA 1LOLA 4AD0A 1PX3A 4DNHA 4MIMA 1CGWA 3DI1A 3L65A 1Z48A 3MZ2A 1PHWA 1TIWA 2GGEA 2Q02A 7PTDA 1LQAA 1PKMA 3Q37A 4FF5A 2CZ5A 1UD4A 3CH9A 3S1WA 3LENA 1HL9A 4DF0A 3GRIA 1GVQA 3IRDA 3BV4A 1IZJA 3B03A 3GVVA 2QJNA 1H4PA 2PLCA 4ERAA 3TFCA 5TAOA 1OFDA 4AC1X 2OWWA 3VK5A 5DELA 1YDOA 3WLTA 3FOKA 3MI2A 4U4MA 2Y62A 3I7SA 4H6QA 4IISA 2HS8A 4XD5A 1NY1A 1W37A 3PP7A 1M01A 3EX1A 4J4KA 1CYGA 1LL4A 3DYOA 3REQB 1I60A 4AZIA 5IBXA 1JYVA 2WPBA 1XLCA 2QF7A 4F0SA 2DW6A 4J3WA 3LA4A 4YHGA 4FSAA 4GRSA 1ZCOA 2QQ6A 4WRHA 5XIMA 3URQA 5F2MA 3CUXA 1TG7A 2PF8A 4O8RA 1QVBA 3TP4A 4JPGA 4AD2A 5FL1A 3KOYA 3OVRA 1OD0A 5EMYA 4MOZA 3K8KA 3R6IA 1X7FA 4H7VA 1K8XA 2AKMA 3LN3A 1ZJAA 2GSEA 3W37A 4RDWA 2WM0A 3NGFA 2Z6IA 3KEHA 4YIWA 4HK7A 3T6CA 4B5SA 5C2GA 3PK7A 4DO7A 1LBMA 1R9XA 2PGFA 3SSJA 3UG3A 1NOFA 3CO8A 2UY4A 4IIBA 4RJEA 3AZTA 3D47A 3MYPA 2XIBA 3M0IA 1BGAA 1V3MA 3PZIA 2C91A 2Q01A 3VILA 1JZ4A 3C86A 3TJIA 1FBAA 5IHRA 2WOQA 4LT9A 4Q4SA 2ZFAA 3LHTA 2JIWA 1P7TA 4AW7A 4L1XA 4JBRA 5M5DA 1UWTA 3AMDA 5HATA 4EPKA 4KT2A 5I2UA 3AUJA 1AD1A 4AHQA 1QHPA 1XH2A 4U33A 1XIBA 1J8VA 3B8SA 4BFAA 4IIHA 3POCA 4HOWA 2D2HA 5CEWA 5A95A 3EOUA 4EXAA 2E6DA 1FWEC 1XYFA 4F66A 1MNSA 4HTBA 4KWWA 3OA3A 3P60A 3IJIA 3T0AA 1V6UA 3PN8A 2PS2A 3WLPA 4JAWA 3GNDA 3KDOA 3M41A 4MKSA 4I9TA 2PMQA 4PH6A 2VD9A 1QPQA 2XSAA 3A5VA 3WNPA 3VNKA 4C1NA 2TODA 2YJQA 3HQPA 4CCZA 4US6A 3CAVA 3VCNA 4DO4A 5D8WA 5LGZA 3M7WA 4DIAA 3ELFA 1GW9A 2GDVA 3N18A 3VABA 3TSDA 2WZEA 1JPHA 2QAFA 1MO0A 1RBOB 2XIOA 3CQHA 1PKNA 3NZRA 5FSEC 2DJLA 1S3TC 4RZ5A 4LBRA 4MB3A 5EA9A 3T09A 5BU9A 3M47A 3WQOA 4U2ZA 3DERA 1DWAM 3B3DA 4BI7A 2ZRYA 4GX8A 5MF5A 4CQBA 7CGTA 4ZO7A 3MSRA 1NU5A 2POTA 3BQ6A 4WDWA 4ERIA 5E0FA 3PTKA 3RM8A 3P0XA 1KBBA 1JAEA 3C8FA 3DHPA 1HX0A 3CHVA 4O4WA 1UKPA 2GWNA 1AW2A 4MHBA 2VZOA 4LC6A 4PUKA 1UZ4A 2OWCA 5KZDA 1IWAA 1VJIA 3UWZA 4ATWA 4ADUA 2HE5A 4L4LA 1J93A 3ZT6A 3N2CA 4PTVA 3QBUA 4DWSA 1CXIA 2DSKA 3VPLA 1G4TA 3M0HA 2ACUA 3PZGA 3IJ8A 3U48A 1CLVA 1KCZA 4X9YA 1DIDA 3FNDA 3B8UA 5JBEA 3HTWA 1K6WA 2WVTA 1E0WA 5D9PA 1BVNP 3LI0A 2XZ9A 1H7NA 1N2VA 4NL1A 4N9EA 2PCQA 4WK9A 4C7DA 5KZ6A 4UQDA 3J7HA 3WUGA 3H6OA 1REQA 2QUVA 4E4PA 5XIAA 3SUTA 1ODZA 1W3TA 1C9WA 4KBXA 1JXKA 3GUWA 2Y7GA 5IDZA 2DY3A 2CCRA 1E51A 3N25A 1ESWA 3VX1A 2Y24A 4D6JA 3E49A 4CCEA 1VB9A 1XC4A 3P7YA 1XLFA 2FPTA 1F8IA 1X1ZA 2P0IA 2WC4A 5E6YA 1E6QM 4E5TA 3CASA 1Q7QA 1XQKA 3I3DA 2CNCA 4UIOA 2JGQA 3AYRA 4CD5A 3V36A 5CZSA 4KEUA 4EPBC 1MW1A 1AL7A 1JCJA 4PMRA 2NVDA 1UASA 1PBGA 2FGZA 2AQVA 2AL2A 3AIEA 3QMRA 1UHVA 3R8RA 3TWBA 2DSZA 1Y8BA 4F0LA 1YQ2A 3HO8A 4CN4A 4EPEC 3NQFA 3SSZA 4J3SA 2Y0FA 4AY1A 3BO9A 3EEZA 4QJ5B 3G3MA 3RU8X 3M46A 3SY5A 3EOLA 2VUYA 4XISA 1S5VA 1F4HA 2V82A 3LTSA 3CIVA 3W2KA 1P6BA 4UCGA 3VKDA 1UB3A 1VR6A 3MC5A 3WBYA 2C0AA 3W2UA 1V3LA 3ZWSA 1UKOA 2PBGA 1R46A 1DXIA 5D03A 1LBLA 3R0UA 4H6KA 1JCLA 2GGJA 3G8EA 3YPIA 2GDQA 1KBLA 3BSMA 1TR1A 4IX2A 5GNZA 1KQZA 3KL0A 4JQ1A 2WAGA 3H7UA 3VUPA 3HIJA 4R85A 4ZA0A 3PNZA 4W89A 3W83A 1DE5A 3B0PA 3THDA 1XICA 2X05A 2HISA 4WY0F 5AZ0A 1G4EA 1JFXA 4JFVA 1L9WA 4DBEA 3AHTA 4J27A 4UBPC 4JCLA 3UU0A 2R24A 2C13A 1UA7A 3NL5A 2QPSA 4LAKA 3BC9A 3E9AA 5A6KA 4F0MA 1TPEA 1W1ZA 1F6PA 2O7QA 4PR4A 4PBGA 4Z42C 1N55A 4E3VA 3AC0A 3JR2A 1QPKA 3BSHA 2YOCA 3LXCA 1SZFA 1W3JA 3K4DA 2IKGA 2VEGA 3EDJA 4XAZA 3P84A 3BARA 3SCSA 2RJGA 1O66A 3B40A 3HPFA 2HNEA 5HWNA 3DEQA 3WBEA 3T55A 2G3MA 3D6NA 4PZVA 3FA3A 1W2VA 1W5NA 1JF6A 2CZEA 4XBJA 3BXWA 3SGZA 4HK6A 3L4YA 2QDHA 1JGMA 3DFTA 4GBUA 5HJLA 1HJXA 4NI3A 2W91A 3RR4A 3WEOA 3QOKA 4UMBA 4QSHA 1TPB1 2E7FA 1GG1A 4YYCA 5EKYA 2CERA 3PUOA 2VRKA 1Y5XA 1SFJA 3GXTA 4W86A 1EJUC 1UMLA 2EO7A 3UP8A 3XIMA 1QI4A 2GUYA 1QHOA 4K7YA 3OG2A 3N14A 4HPHA 1VFFA 3F4WA 3GR4A 2BOFX 5J8LA 4A29A 3W82A 2WSKA 2XFRA 1ITCA 3W26A 1B3WA 3WDJA 3A3HA 4P61A 1J6PA 1HKVA 1CGYA 3WLNA 1MZRA 1XFCA 2BOGX 2H3DA 4KFPA 3H4GA 1TV2A 3LZ5A 3O9NA 3HGSA 3VDHA 3R13A 4LY8A 3BVJA 3OIXA 1DQWA 3FJNA 3WF1A 3EAUA 4JTRA 1U5JA 3QTGA 2WVUA 2E1WA 1LG2A 1X1NA 4BK9A 3MW7A 3MJYA 4ZENA 3BSGA 5HINA 3S9IA 3UXAA 4G7EB 2QV5A 2ZXBA 1SZRA 2B81A 5CPSA 5EYWA 2F8QA 2ZRWA 2IPWA 3S3GA 3GH7A 4QITA 4WIWA 3BW2A 1F2JA 5I03A 2FHBA 4YN5A 1R87A 2PDJA 3L4WA 1W9XA 2H90A 2QCDA 5KMYA 4W7UA 1PXGA 2ZX9A 3BLLA 1YX1A 4GOAA 3PSVA 1B3XA 1HKIA 4ML4A 4GX9A 2Y8VA 1MW2A 2D22A 2J62A 4ROQA 1XYZA 4F0RA 4D8ZA 3ZR6A 4Y8FA 1HP5A 1LG1A 2G3FA 4Y2WA 1UQYA 5EU9A 3UR8A 3EB2A 3O8AA 1TRDA 2J7BA 4RZ6A 1LRQA 1Q65A 2INFA 1OC5A 3CUFA 4BS0A 4M8UA 2Y8KA 1EGMA 3NOYA 5A8GA 4D6HA 4MNJA 4Z17A 4FB7A 2J9YA 2W61A 3OVGA 4F40A 4JTKA 4LRSA 3K4WA 2I5IA 4TOQA 1V5XA 4H7ZA 3UWQA 2GZXA 3LDVA 1BF6A 1DWGM 4A3RA 3SCPA 1HKJA 1A5LC 3H70A 4A22A 3SY1A 3W6LA 4IQLA 3ZJ7A 3EPMA 4RL3A 1W1PA 1U2YA 3WBAA 4KH2A 4IUGA 3C3NA 1OFAA 3VCCA 3L68A 1KTBA 4MZ8A 2E1DA 3PJXA 5B7ZA 4ALDA 1B9ZA 2YXXA 3BCFA 3PULA 1EF2A 1NDWA 4WD0A 3AYSA 4QR6A 2WM1A 1HJQA 3SM0A 4GJJA 3E96A 3CQJA 3VDGA 1Y7VA 1H11A 4L64A 1C9DA 3W00A 4LC8A 3AYTA 3UBPC 3P3BA 4HU8A 2YZ5A 4JIHA 1V6TA 4RXFA 1UR1A 3GYEA 3VO0A 4C6QA 2VGFA 3BLOA 1ZP4A 2PDBA 4GLEA 2AGKA 1GOXA 5KETA 1TJ2A 4P8WA 1GVOA 4AZHA 1QR7A 3E02A 5HNTA 1YPIA 5CGQA 5HNRA 4HA4A 2ZZ4A 3N17A 3DYMA 2Y8UA 4DZIA 1XYAA 1DHKA 3TN3A 3G3DA 4AISA 1WV2A 1RVGA 2ZUWA 2PSNA 1U30A 2P88A 3U2OA 3AIQA 3KHJA 2D69A 1SW3A 3B9NA 1FTXA 2MANA 4WJEA 2FPYA 3UA3A 4G2DA 3RK8A 3OJGA 1E0XA 2VT0A 2ZUVA 2D1ZA 1VBJA 1MMFA 3MY9A 1NWTA 1JVNA 3KFTA 2OEJA 1VFTA 5FF2A 4B5WA 4KQNA 3NQBA 4IJRA 3G1DA 1YADA 3RM4A 9CGTA 4AVNA 2ZZ1A 3OPSA 1A5KC 3SQSA 2FTYA 4HNTA 1OFRA 2QGHA 1V7YA 3GX9A 1TA3A 1S38A 3DHDA 5ABFA 4MY9A 4L80A 4FOUA 5HJXA 3MUCA 2PDUA 3EZ4A 4B4FA 4GACA 4ZSUA 1Q8JA 1XG4A 3W2LA 5CLWA 4ZQMA 4ZOCA 5AFDA 2VTFA 2CKSA 5ABTA 2R1NA 4UQCA 3GXNA 1KXVA 4GINA 1OEPA 1V3HA 3EMQA 2A79A 3AUOA 3CZGA 1J0IA 3WLIA 3G22A 2OZTA 2IKIA 2FJKA 2AL2B 1SZGA 1H63A 1KXTA 3VDCA 4BQ3A 3PWGA 3ITTA 1LT7A 3WD1A 4Z1CA 3RIKA 2ATSA 2ZX7A 1R5YA 4PMUA 3TROA 3ITYA 3OZPA 4U5KA 1UMYA 1K7FA 1HIZA 4GA8A 4EE9A 5A6SA 4Q4QA 3CV2A 3DC0A 3FVMA 4B16A 3AOFA 3EB3A 5C5YA 1OWQA 2WMIA 3SCWA 1J12A 3R10A 4CD6A 3V5FA 1E1EA 3UR2A 4CU7A 2BVTA 4HB7A 3PB0A 4GJ1A 2BZNA 2PURA 3PG8A 2X1TA 1K4HA 2XVLA 3LSBA 2J6VA 1BHGA 3FVDA 3EBVA 4FAMA 3UESA 5DMYA 3QR1A 4UQ9A 4F0KA 5A3HA 1DJZA 4UTMA 1XD0A 5AHNA 4H9VA 2Z29A 1ZP3A 3H2NA 1O60A 4XAGA 3KVLA 1XYBA 1N8WA 4RW3A 3EA3A 2EPOA 4IQEA 1E0VA 3AROA 4W5ZA 1QPOA 3FYPA 1POKA 4JGDA 1I2QA 3WQWA 1IHIA 4X0NA 3XISA 1AW1A 1DTUA 4IX0A 5HMDA 4LUSA 4P8VA 1FCUA 1UWAA 2A5HA 4HNOA 5CG0A 3E0WA 2QGYA 3ABQA 1K3UA 2A3BA 2PF0A 4DJDD 1NP2A 4JHZA 2AMGA 2ZYFA 3BAIA 1RBAA 1SU5A 4KWUA 3LTYA 5J5DA 4H9XA 3MV11 3AXKA 5LKYA 1FHVA 4O1BA 1QO5A 3ARXA 4IFOA 5I78A 1VBRA 4REQA 3FJ6A 1C29A 4UTFA 1QNVA 5LNWA 1ZFJA 2JF6A 2W5FA 2DZVA 4FLRA 2VGGA 3QY8A 3GDTA 1EF3A 2XSXA 4UQEA 2Z1VA 3HJZA 4GBDA 4Q6JA 1TUXA 3OB8A 4S3JA 1ME8A 3T2PA 2YW3A 1EX1A 2C0HA 5CH9A 3LHYA 1C8QA 4XSMA 2JEQA 4DF2A 3EMCA 5I3FA 4M1RA 4AY8A 4GNKB 4JOMA 3RMEA 4IT1A 1BYBA 2Z2AA 3VGBA 4TTUA 2PCEA 3HG5A 1V03A 4I8YA 3MHFA 3VD7A 1C91A 2OODA 3AXHA 2WLZA 4QQUA 5CZ0A 1QMLA 4WUIA 3CZLA 4Z1BA 2J79A 4QXIA 1K1DA 3GC5A 1Q6OA 2DUZA 1HN1A 4ZO8A 4Q8WA 1TMLA 2J7GA 3HJEA 4F2UA 1K77A 1UC4A 2QUUA 2OG9A 3B9AA 4QCFA 5HMFA 3LM3A 4X61A 5DBTA 1ADOA 3NWRA 1M7JA 1QK0A 1G94A 2VGBA 2EHHA 4HT3A 4JTGA 2EF9A 2GK1A 4B3KA 1KCLA 2P5NA 5C9RA 3VYLA 5HDRA 1OCQA 4BQ2A 1SO6A 1BEUA 4P7NA 4UFKA 4KS0A 1GEHA 3FAXA 5CZJA 2QCCA 4FNTA 3AXXA 2ACQA 3A5FA 1VYRA 1JDCA 1TTIA 3RRAA 1PIFA 4KRZA 2WMKA 2BXYA 3O06A 4US5D 5LIUX 2YBVA 3PPFA 3W7HA 5C2CA 2ZQ0A 2QHAA 3JVAA 4K68A 3EX6A 3PZ9A 2OMAA 2NV9A 1X98A 3T4CA 2VRQA 3SJNA 5SWUA 5DMLA 5TQLA 1EDTA 1EIBA 3K4AA 3DI0A 1QOPA 1HGYA 2W92A 1GG0A 1G1YA 1W1VA 3DFPA 3DG7A 4PYSA 1AMYA 2TRSA 5AC4A 1EC8A 1FHLA 2CHRA 2DUAA 1ZBKA 8XIMA 1I9CB 5K2ZA 5EBUA 1VYSX 1R8LA 2JKEA 4M29A 4DUVA 1X8CA 4R33A 1TWWA 3OBEA 1JFHA 1NWUA 1I6NA 3SCUA 9RUBA 1US0A 1DJYA 1EPVA 2PEVA 3EX3A 1VYPX 1YXYA 3EKGA 4DO5A 3KX6A 3U7BA 4RE0A 1A0EA 4NSBA 2FMOA 1DXFA 4Q4RA 2ICSA 1C7TA 3ZVHA 4MLJA 1X8FA 3ITGA 1UZHA 4WDTA 5K9XA 4TR9A 2KX9A 2XJ7A 1VHCA 2VEPA 3HPXA 1VJZA 3UD6A 2VUNA 1VFOA 2PE4A 3KVJA 1PYFA 3QQ1A 3FX4A 5HJYA 3IJDA 1ONRA 1R0MA 3SRHA 1T41A 4UWMA 4XD3A 2EG6A 1E9IA 3WQ6A 2MUCA 4V1YA 3W73A 3W85A 4E4FA 4ZOBA 3V16A 1OABA 1JNDA 5DX7A 1ICPA 1CPUA 2X7VA 3GHRA 3RCNA 1VCVA 3B0YA 4ADTA 3R94A 4QJ4B 4RLIA 1XLHA 5G4EA 3WKZA 1FRBA 4HPJA 2CITA 4WY0A 4AZCB 5D05A 4OJYA 5AZ1A 1FA2A 4XBSA 2UBPC 4ZODA 3EX2A 4NNAA 3FA5A 2E6FA 2IPJA 1YDNA 2P8BA 2HVOA 5CPTA 3SFKA 4MY1A 1LL7A 3NL3A 2QKFA 3P80A 3G6LA 2BGSA 2VFFA 3OGSA 1ISXA 1Y5WA 1HP4A 1L6WA 1CT5A 1NF0A 4M51A 3SY8A 3BLIA 1DJWA 3ZS4A 4LPCA 2YB4A 4JIEA 1XRFA 3C6CA 1M3UA 1YDVA 4IFKA 2QT3A 1EGVA 4AIEA 3KCJA 3P5YA 2RGMA 2DIEA 3SCQA 3H55A 3IJ6A 2GUUA 4C7GA 3GNPA 1P1XA 4I5RA 3QFWA 2CETA 1R3SA 4XTIA 4MAZA 2NV1A 4IMEA 4AX6A 5H8MA 3PZOA 2UWFA 1E0TA 1H41A 2GGGA 4ICCX 1LWHA 1QNRA 1LUCA 2TPSA 4GMEA 4B5UA 1WXYA 1WZKA 2CIPA 3F4VA 3AS1A 1KM1A 3B8DA 3JU2A 3S5NA 2V5DA 3TNOA 1DE6A 3Q45A 4MPQA 2WJFA 1KR1A 1EO5A 3SECA 2JK2A 4KCUA 4GH1A 2W63A 4HCDA 3W7MA 3MJMA 4Z1AA 3UY8A 5H8PA 3BUVA 1SO4A 3ZMRA 5AHFA 3CL7A 4C6EA 1UYQA 3VE9A 1SR9A 1CZ1A 2NXGA 2RDTA 4XIMA 1I2NA 3TSBA 3NYZA 4AUBA 4IMFA 4D6GA 3C2RA 1SJBA 4HNNA 1B0IA 1I4NA 1R9YA 2FGLA 3AXIA 3NSNA 2POZA 2ZWYA 3PAOA 4HZ8A 2V69A 3HPZA 3STCA 1AW5A 4DWSD 2PTWA 3CQ0A 4MPKA 2E67A 3BE7A 2OOFA 3TKFA 3L0NA 1A5SA 1H5YA 3MANA 2PC8A 4BA0A 5F4WA 1A5CA 3REQA 5LHFA 3KWSA 2DW7A 3OW1A 2WJEA 4HKPA 3WK0A 3V7PA 3WMLA 1NWRA 4ZBCA 2XIQA 2V68A 3NQ6A 4C65A 1Q5MA 3SRDA 4L9YA 2VEKA 3A9BA 3EXSA 3DDMA 4MF4A 3UG8A 3VD3A 3W1XA 4QG8A 3BURA 3RLVA 3TR9A 4UTUA 1VLIA 1K8CA 2VC6A 4O54A 2HMCA 3B9OA 1TX0A 1OY0A 3AZSA 4GQQA 3LB0A 1FHDA 4C6NA 5G1MA 2FPVA 3O05A 3HBLA 1MUCA 1KFWA 1CXEA 4Q3MA 3N04A 1H0IA 3KBWA 3S2LA 3TSMA 3PUDA 1U5HA 4H9TA 4O53A 3LHZA 4CKQA 3STPA 2RUSA 4A3QA 1AZ2A 4HPGA 4HTYA 3ES7A 2OCZA 2GJXA 5RUBA 5IXEA 5D2WA 3BLEA 3TA9A 4JKKA 2RFGA 3O15A 4RCXA 1WZMA 4EF8A 4DM1A 2FH8A 4MJMA 3UNDA 3WNNA 1ICSA 4GUIA 5HK4A 3CL6A 2PDMA 1G4PA 2XSBA 3DYPA 2E9LA 5HXMA 2XM2A 2V5BA 2QJMA 2EG7A 2VX7A 1QI2A 1F73A 5BXTA 3AYVA 3CB8A 2NVCA 2PWDA 2PLKA 1KKOA 3RCYA 1AH0A 2V63A 3LK6A 4QE4A 1J96A 1V02A 2BS9A 3CZKA 1SJDA 4HHLA 5G1YA 4NI8A 2X30A 3WLJA 3W7QA 4IPPA 2HV5A 3L2LA 3MP4A 4RXGA 3TCEA 3EXRA 1JYXA 5PTDA 1AK5A 2J75A 4B90A 2Y2WA 2XISA 4ZB2A 3DH7A 2PRMA 3GUGA 5EGRA 1V0MA 3ATYA 3CBWA 1IEXA 4C1NB 1C8VA 4FO4A 1QOQA 2OGJA 3AFBA 3TQKA 3M7SA 1KB3A 1CBGA 1XLGA 5A2CA 3FFSA 3I6RA 3S2CA 3STEA 1U22A 4Z1DA 1EJSC 4QNEA 1XL9A 1VLWA 4GIYA 1Z8AA 1FHUA 2PBOA 4GZEA 1VBGA 4GZIA 1PIGA 2YPIA 2VGIA 1G67A 1CGTA 5JU6A 3ECQA 4NZJA 4NHVA 1UC5A 4LH8A 4ATDA 2HS6A 4JXCA 4UTIA 3N2MA 2OX1A 5C9ZA 3PZUA 1G4SA 4LUTB 3ORWA 1ZUAX 3L4UA 4ADSA 4RNHA 3VC6A 5DY2A 3C0JA 1T7LA 1TE6A 3LZ3A 3L5MA 1A0CA 1D7FA 2ATMA 2RAGA 3WLMA 3UR5A 4MWAB 1F6KA 1V3KA 3A6OA 8XIAA 2ACRA 2VHLA 1O95A 3QOMA 3WF2A 3UT0A 3CXOA 3EWDA 3L67A 1UROA 4PL1A 2QXWA 1X6UA 1PTDA 3W7PA 4POCA 4PODA 3V5OA 4WKFA 2PFHA 3RG6A 1DJQA 5F2GA 3S1GA 1OQFA 4Z2KA 3UJFA 3VA8A 3BAWA 5FJTA 3QN3A 2Q3OA 2OEMA 4ENLA 1L6FA 3O7UA 3SADA 1L2UA 3TWAA 4GFSA 3UWVA 1XLBA 3GHUA 4FOKA 4HQVA 2PDPA 3H21A 3GE7A 4JY9A 3LI1A 3CHDA 3L12A 1ELSA 3G1AA 1C90A 5FACA 3VIMA 1W31A 4TV5A 3IARA 1E70M 5A94A 4KWSA 4EXBA 4PMQA 3IVSA 2OKTA 2P10A 1DBTA 3G18A 1XSJA 2Z7KA 4X22A 4H6EA 3W88A 3ABRA 5D32A 3CS2A 3LHVA 3C52A 3WD4A 1PX8A 1QPNA 5LGXA 1DEDA 1QI3A 3GTIA 4Q7IA 5I3JA 3S42A 4EANA 1TZ7A 1XS2A 3ANVA 2VYOA 1JQVA 1IXNA 1Z42A 4LTSA 4LCRA 1OFQA 5LA1A 1FQ0A 3FY1A 2PRLA 2DU2A 4UFJA 4HU4A 2QJHA 1KTNA 4A8NA 2NX1A 1XCXA 3TN6A 4HZMA 5TD4A 3NR0A 2ZIDA 1P48A 3WELA 1C3FA 1XIFA 1E4LA 3W1LA 4TX6A 5A6AA 3TTEA 4TIMA 1EGZA 4BJHA 4JTDA 4HMNA 3HPAA 1A3XA 4IFRA 3QV7A 2UY5A 5MKGA 1W5MA 3W1RA 4HVXA 3PY2A 3BJSA 3DG3A 3USBA 4FNRA 5HQMA 4PGLA 1IT8A 1KRAC 2X1IA 4MJZA 1SYTA 4TU1A 2DSVA 1FCQA 3SI9A 4ICNA 1QBBA 2PTXA 4S3AA 1O5XA 1B30A 3VINA 2CWXA 1YLVA 3CIWA 3HB9A 3ES8A 1RZMA 4MZ1A 2ZVIA 4IHCA 1X38A 2WJDA 1XKJA 3ISIX 1ZLPA 4L7ZA 1YNQA 3QKZA 1UZ1A 4YTSA 1TZ9A 3QF0A 3PBVA 5D8ZA 1FWDC 1UIPA 3FCPA 1JDDA 4GYPA 2CESA 3NIYA 4PTWA 3CZJA 3WF4A 1IEVA 4PB3A 3SFWA 3BQ5A 3WLRA 3AO0A 1Z3NA 1H51A 3MT1A 4W84A 1Q6FA 4IIFA 1F9CA 5LZLA 1QW9A 1F3TA 3UXDA 1DHPA 3VOFA 1EA0A 1B4EA 1PZ2A 3M5ZA 3RM9A 3Q58A 1EXBA 3VAVA 4DLFA 4GPNA 1E9LA 3W9ZA 2QJIA 3VKKA 2R94A 1BQCA 4LCQA 5C8BB 2DT0A 3BH4A 3TXVA 3W4RA 4DVOA 2QUTA 3AS3A 2NWSA 1KGWA 1SO5A 1RHCA 3B4UA 5AYIA 1A4LA 4DPQA 5D2TA 4H9MA 4LVFA 1R3QA 4H2HA 3P81A 3N6JA 4GXPA 3GDRA 4W7VA 1TMQA 3V0SA 2DZPA 3WJSA 4LEFA 1NM9A 2NXIA 3GR8A 1T8QA 3WF0A 3WQFA 4FOJA 4US5A 3LBCA 2E8ZA 1ZZMA 3CWNA 1J79A 3U3HA 4ONVA 4IQJA 2O4MA 3A64A 3SGGA 5DFAA 4OVXA 4FNSA 3R43A 1UWUA 4NKCA 2W79A 4MM1A 1HTIA 1XCFA 3EOEA 2AOSA 2FIQA 3E0LA 3SIZA 4NX0A 3K30A 1W1B1 3WX7A 4MYAA 2V81A 4A2SA 3NPUA 4LU0A 2Y5SA 4DY1A 5C71A 4IGNA 1TCDA 4ZEPA 1H7XA 3MI3A 3C0QA 5F2IA 1GQJA 1V6VA 4MLRA 4XK2A 3WBXA 1J0YA 1JCYA 4N02A 5FJOA 3CMFA 5FF7A 5GNYA 1DV7A 2WMFA 1QCWA 3D5HA 4PL2A 4OBSA 2Q6ZA 5CZKA 3O1NA 4BF7A 3G5EA 4YHEA 4HU0A 4NYUA 1M7PA 1E72M 1J18A 4GZJA 3IV3A 1A5UA 2GJXB 3CMGA 5HOSA 4NXSA 5DCEA 2YDQA 5HULA 3FS2A 1OF8A 1HVQA 3TUUA 3BDKA 3TVAA 1KM6A 4ML9A 3BG3A 3W29A 1GJPA 1WAUA 3SJ3A 4JX5A 4MUPA 1H1YA 3ZFHA 2G3NA 1OK6A 2WHMA 5F2LA 2VEFA 5DCDA 2E5CA 3R1ZA 1NP0A 4DZ5A 2WMJA 3PBWA 4OBRA 3II1A 3VNYA 4LAMA 1PDZA 1XLLA 2PP1A 3LTPA 4FR6A 2V3EA 2FLIA 1JIBA 5FJRA 1MNZA 1O68A 1UIOA 1VKFA 2YA1A 1LCOA 3B9EA 3PFMA 8TIMA 1QHZA 3KBMA 4A3YA 3MWAA 2D20A 4I6KA 1BXCA 3TZFA 1XRSA 2Q71A 3ITVA 6PTDA 4CNNA 1W1A1 1XDJA 3CUGA 3UZ5A 5KSWA 5M3WA 4DI8A 1Q85A 1MEHA 2I1OA 3QSTA 4C90A 1H7OA 3TAOA 1FXPA 2B7QA 4MADA 1NELA 4FALA 1F61A 3IV8A 3H2EA 1E40A 3S1XA 5A8OA 2HXUA 1U1HA 4W8AA 4LB3A 5BOEA 1Q8AA 3JW7A 4EIVA 2E0PA 1ZGDA 2PDQA 4HHMA 2XH7A 2ZC8A 2ZRZA 3M5XA 4AZGA 4O16A 3ATZA 3K1DA 2V8ZA 4K3ZA 3F1QA 1FOBA 3NZGA 2ZVRA 3VUSA 1QI0A 1WCGA 3MUAA 1OX5A 4UTWC 2I7GA 1DQXA 3VTRA 1Q6QA 1PZ3A 3T2OA 5I23A 2EXOA 4RE2A 3VOCA 3E1F1 3L5AA 2OO0A 5K4XA 4YPJA 3KBJA 2DSWA 3WK1A 2YCKX 2IQDA 4KCWA 5HNUA 1O1HA 2ZUTA 1XIIA 3WEMA 3QY6A 1TVLA 2VENA 4V28A 3ZJKA 2A3HA 2GVGA 3WLQA 1W56A 3MI6A 1FWBC 4PMNA 1XLDA 2Z24A 5C9WA 2DP3A 3P67A 4ZQPA 3H22A 4AYGA 5G5IA 1QNSA 1TJ0A 3G1VA 4WSKA 2WNZA 4ZTYA 5JUVA 2IQ0A 2ZZ2A 3VFCA 1M6JA 1GNXA 5HWMA 3BCJA 1FH7A 1E1FA 2DT1A 1CX9A 8CGTA 1B90A 2J8FA 4M19A 1I0BA 4DEFA 3W6YA 3PJUA 4GGHA 1V79A 1WAWA 1B31A 1YEYA 1A5BA 4Q6XA 1E4IA 1XIEA 4FS9A 5JH1A 3H4WA 1FDYA 1PB0A 1UG6A 3MMWA 2PZNA 1UR4A 4FLQA 1PCKA 3UWYA 3TMQA 2I5QA 1EWDA 1ITXA 2GJLA 2YYUA 2C1IA 1WA3A 2ZDSA 1KM3A 4MSSA 3G0XA 5G2HA 3SBFA 3VKCA 2V5KA 2JF7A 1ZCCA 5AYXA 2QEZA 1UZDA 4JFWA 3LHWA 1HJSA 4F0HA 3RO6A 3VOJA 1MQPA 2UY3A 2YX0A 4PUMA 4XQ6A 1Q3NA 3NDZA 4I5UA 2WVVB 2B4GA 5CKSA 5DMMA 2J7FA 1W9BM 2QR6A 4WSHA 3FDGA 5FD0A 2ZZ3A 3OZYA 5C2XA 4Y9AA 1TB3A 4M0XA 1JF5A 2F61A 1S5NA 1S39A 5ABHA 3WMBA 1GQIA 4C6OA 5JMUA 3CNYA 1BKSA 1W5QA 1H62A 1ZBWA 3I3BA 2WPGA 5CSSA 2XIIA 5D2XA 3C8NA 1XPYA 1BSIA 3BLFA 3BW3A 3VD9A 4BR1A 2Y88A 3OHMB 2V3GA 1Q2SA 1D8WA 2TAAA 1S1RA 2VFHA 3GU1A 3A3XA 3IJ9A 3VM5A 4PUWA 2P1FA 1LQ2A 3IGUA 2NXHA 1BTCA 5JBFA 1F3XA 1A49A 3A12A 2VQUA 4A2RA 3FW6A 4G7EA 3WJXA 2V6AA 3ITOA 2TSYA 3EA1A 3KRZA 1DORA 2HE8A 2DSUA 2DQXA 2D2JA 3VM7A 2CZFA 4WKAA 4C6PA 3CUHA 4V15A 1JZ3A 2EG8A 1A5NC 1N7KA 2GVYA 1XF0A 1XDMA 3ABSA 1IGSA 4UZSA 1HZYA 1NWSA 1J01A 2GOUA 1PJ9A 3I7RA 4AIOA 4AFYA 4V1XA 1KR0A 3SN0A 2WCGA 2YXGA 4W85A 3VMOA 4S2BA 3G1SA 3L9CA 3W3OA 3WZ0E 1TPC1 3LCGA 3WNLA 5C9XA 1VFSA 3OGRA 3W7EA 2Z4GA 3MUIA 3P82A 3MA8A 1JUEA 3VD5A 1EYEA 4HCHA 2A3LA 4C5ZA 1HVXA 1CTNA 4IMCA 3GVQA 1G0CA 4JQ3A 3ZM8A 5EBAA 3DFSA 4H00A 3PPHA 1UBSA 1EQPA 2ZTJA 3RR1A 2DZUA 3KOZA 2DH3A 2Z28A 2GGIA 3M1ZA 1UD3A 1V6YA 4B9YA 3LS9A 1E9ZB 4QBXA 4GNVA 4AC7C 3NA8A 4LS1A 3WMSA 1EEPA 4QJ3B 5BXRA 2G96A 1EJWC 5FL0A 2A0NA 1EKOA 2J9ZA 1F05A 3T0BA 4M7SA 1O6IA 3S5SA 5I00A 5IDIA 5AN7A 3WUEA 4KWVA 3WF3A 4I5XA 1R30A 1EDQA 3RN6A 2REQB 3W7GA 3MP3A 1OGSA 4FXSA 1WZLA 4AXNA 1ZJHA 3G1FA 3PBYA 1JCNA 3ICJA 3QGKC 4UNLA 1AJ0A 1W17A 4DJFC 1TVPA 1EB3A 2ZC1A 2VOTA 4RNIA 2QNEA 4RUBA 4IMAA 3WQDA 2ZTKA 2NLIA 3SO7A 5C70A 3ABOA 3HURA 3UPMA 2DVXA 1XIMA 2BOEX 1A80A 4AX7A 2NV2A 4FIQA 2E3ZA 2PAJA 3PTQA 4B5TA 1RXOB 4BKNA 3GNOA 5BRPA 5LXEA 1B3OA 1JCXA 1JI2A 2IMRA 1BYCA 1K4GA 1GVIA 4W8LA 2VDIA 4R88A 4BHYA 4X3ZA 1V4YA 3QZAA 2PU0A 4IMDA 2ZX6A 3BL3A 3UGVA 4F3HA 4H19A 3CIXA 5IM51 4UC5A 4XZNX 1G5AA 5KEZA 4YNGA 5A8MA 2GLKA 4Y8EA 2O9PA 1UD8A 1GOIA 3AQUA 2E9MA 1SZNA 3GXFA 1ECEA 1JDEA 1IV8A 4IJCA 1UOZA 4ZTXA 3E38A 3HF3A 2RDWA 4GI8A 1KRMA 2A85A 2I9UA 2OSWA 1TMHA 4KFNA 1XBYA 4ZCWA 4R34A 3W84A 1TUFA 1FP8A 2CZDA 4AVOA 5F1UA 4IGSA 5LIWX 5E9AA 2X42A 5C6MA 3FN9A 2A2IA 1T5AA 1HL8A 3F03K 1GKRA 3N3TA 3U9IA 4K8EA 1NEYA 2YZRA 4ZO9A 2PUZA 3NCOA 3IUIA 4C1KA 4W88A 2XDFA 1SSDA 2QYGA 2ISDA 1B9BA 1R3WA 4XZWA 4D2JA