2E6AA

Crystal structure of trypanosoma cruzi dihydroorotate dehydrogenase in complex with orotate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
312
structure length
312
Chain Sequence
MCLKLNLLDHVFANPFMNAAGVLCSTEEDLRCMTASSSGALVSKSCTSAPRDGNPEPRYMAFPLGSINSMGLPNLGFDFYLKYASDLHDYSKKPLFLSISGLSVEENVAMVRRLAPVAQEKGVLLELNLSCPNVPGKPQVAYDFEAMRTYLQQVSLAYGLPFGVKMPPYFDIAHFDTAAAVLNEFPLVKFVTCVNSVGNGLVIDAESESVVIKPKQGFGGLGGKYILPTALANVNAFYRRCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMARKGYRTLEEFRGRVKTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase
publication title Crystal structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with orotate
rcsb
source organism Trypanosoma cruzi
total genus 106
structure length 312
sequence length 312
chains with identical sequence B
ec nomenclature ec 1.3.98.1: Dihydroorotate oxidase (fumarate).
pdb deposition date 2006-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.26.10 Mainly Beta Roll Dihydroorotate Dehydrogenase A; chain A, domain 2 Dihydroorotate Dehydrogenase A, chain A, domain 2 2e6aA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2e6aA01
3PSVA 3FJ6A 2OX1A 3QW4B 1VQTA 3ABQA 4M5PA 3QZEA 2Y7EA 2WV8A 3LBMA 4K7YA 3O6DA 3HGSA 3U8GA 1G4EA 1UUOA 3QM3A 4H4IA 5BMXA 4BFAA 4UMBA 2BWGA 5KZEA 1TO3A 5DLCA 1SFJA 3CT7A 3P60A 1OFQA 3LXAA 5CZ0A 3BG5A 3W2MA 4S1FA 4POCA 2AQWA 5DCDA 4DF1A 3O06A 3VFLA 1X7FA 2QUVA 3LRMA 2TRSA 1G4PA 5DY3A 4Y96A 4GFSA 1A50A 3W87A 1SUXA 5CPNA 5CZTA 3KRUA 4NXSA 2ZDRA 1THFD 3NQ7A 2QCMA 3G8EA 4RZ6A 4N9BA 5LSMA 2ZCGA 4ORIA 3EWBX 2Y7FA 2BSLA 1G4TA 4XKYA 1NF7A 2R91A 2KZHA 3M6YA 5CPOA 2CZ5A 4UFKA 2Q8LA 4O0ZA 3C2RA 3O16A 2CLKA 1V5XA 1YTEA 4NUWA 2HS8A 1VLIA 1JCLA 1FWNA 3L5MA 2A7RA 4I7UA 1TRDA 1GZGA 3RU6A 1HG3A 2FLIA 3QMRA 3W22A 1YXCA 5AYZA 3LX9A 3TC7A 4JEQA 2WNNA 1H60A 3I7SA 1I8JA 1M7PA 3N34A 1EP3A 4Z08A 2AAMA 1LOLA 4GUGA 1EA0A 4Z1CA 3M7WA 3ABRA 4LRSA 1B57A 3ZFHA 1TPDA 2C1HA 2ZRWA 4WJEA 3CIXA 3DKLA 2E1DA 2VEPA 1ZY9A 4RR4A 3W3OA 2DP3A 2PURA 4UFHA 3W7PA 3L5LA 1RPXA 4UFIA 4XTIA 4PA8A 1Z44A 4KWVA 2PRLA 5BMWA 4IPJA 2JKAA 3NL5A 1U5JA 4WOZA 4RKAA 4WX2A 2YYTA 1QFEA 2EAWA 5L9FA 1UASA 3KFTA 2A21A 4DEFA 3NNTA 1SO6A 4RV8A 3LB0A 3TW6A 6ALDA 3SY5A 4O8RA 2UV8G 4IMCA 4O1CA 2ZA2A 2WKJA 3SJ3A 3B06A 5FEZA 4HPJA 4H6KA 1I2RA 3EWXA 4RZ5A 3STGA 1GVFA 3PAJA 3W1UA 3IV3A 3NM3A 2C6QA 2DZSA 2XN2A 1C29A 5ABTA 2Y63A 3M5ZA 1FBAA 5FESA 3N2MA 2R8WA 3UXAA 4KFPA 4AB4A 3G3MA 3ZS4A 2NX9A 3W74A 1C9DA 3TQVA 3EX6A 3W7JA 2A1YA 2E09A 2V30A 3HPSA 1R2RA 4IMEA 2ALDA 4FNSA 3KAOA 5K9CA 2Y7GA 3WJWA 3FEMA 3UD6A 1WX0A 5A8GA 1J4EA 2YR1A 3TMQA 2YCEA 1KM0A 5HWJA 4GWEA 5TIMA 3TFXA 1X8FA 3UWZA 3S8HA 4JX4A 3M43A 3CU2A 3O6CA 3NDOA 1LTDA 3B8DA 3NPUA 2FJKA 4YCPA 1W0MA 1FXQA 3E49A 2V0TA 3NEVA 4P2VA 1VZWA 3ABSA 1KM2A 3T7VA 2V2HA 5K3VA 3FS2A 1X1ZA 1PVNA 4M6PA 5FF2A 3P80A 3SFKA 1K8ZA 5MHBA 5AN7A 4NX0A 1DKWA 3IVTA 5D02A 3MMTA 4MVAA 4LS0A 4UFJA 1DQWA 2YSWA 4AEOA 5G1TA 4MY8A 1EWDA 3I7QA 5HWNA 3JR2A 2X1SA 1VYRA 3TSDA 3LBCA 3IVUA 2NUXA 4S2BA 2CLMA 4FF7A 3KRZA 3DXIA 4IX0A 3PVFA 1D3GA 4LVGA 3EKZA 4O1BA 3G1AA 4WY0B 1OX4B 1XUUA 3MYPA 3GDLA 1W5MA 1WA3A 2TMDA 3W9ZA 4LTSA 3TE9A 4X3ZA 3NQ8A 2WSQA 4EWND 2Z0IA 1ZHAA 1M6JA 1ICQA 4HT3A 3AO0A 1W5PA 2V82A 4UTTC 2H6RA 4HKPA 1TTPA 2Q3OA 1W3IA 3QPZA 3NQGA 3DFSA 4FO4A 1GYNA 1TREA 1JVNA 4JTTA 3G1DA 3HGOA 4O4WA 1A5BA 4MYAA 4FNPA 4ADSA 3LTPA 3CHVA 2H8ZA 4AWSA 2GVGA 2B7OA 4X2RA 1LRTA 4MY9A 2QUTA 3B03A 4FEZA 1TPC1 4ALDA 2Z1BA 1F6PA 1K3UA 3P81A 5LNRA 1OX5A 1TRIA 1QPOA 4UTWC 2JK2A 1K7EA 4GBUA 3RK8A 4N4QA 1EB3A 2NV1A 1GVOA 1F76A 5LZLA 1Q45A 3W1LA 1Y0EA 5CGQA 3NQMA 1HO4A 5F2GA 1TTIA 5D30A 2A85A 1G67A 1R2TA 4JXCA 4RXFA 4MZ1A 4MFEA 2CZEA 3G1YA 3LHUA 3PSWA 4PL2A 3GX9A 4Y90A 4NZFA 1N8FA 1ME7A 3UZJA 3FFSA 3PF3A 4Z1DA 3SR7A 3R13A 2B7QA 1XBXA 4EF9A 5F1UA 2FTPA 2QCCA 3STEA 1EPXA 3A5FA 2A6LA 1QO2A 4CLMA 1MO0A 4K8EA 1HTIA 3B05A 1TMHA 1SW0A 3A24A 1VH7A 3PBWA 3DAQA 1A5CA 1YDVA 1VRDA 1IIGA 3DBPA 4Z1BA 3E9AA 1XM3A 3PM6A 5FEPA 4O10A 1YXDA 5K2ZA 1HUVA 3WK3A 1XUZA 3L9CA 4MUZA 1DL3A 3VNDA 5AB3A 4JDBA 4PEKA 4DBEA 5C6MA 1KFCA 4QNEA 4M6QA 2BX7A 3IIPA 4OGZA 1TPH1 4BF9A 2C0AA 5KTLA 3W7DA 1SZEA 1WV2A 4XQ6A 4LNYA 4LUJA 3MW7A 1BWLA 4NU7A 4RXGA 2Y61A 4NZJA 2OMAA 1SW3A 2A7NA 2X16A 3VE7A 1OYBA 2P1FA 2G95A 3LXCA 1GVSA 2HMCA 4O53A 3ZWTA 4K8HA 1K03A 4JIQA 3TJXA 4N9EA 3W72A 2YDAA 3O05A 3U2OA 4ZQMA 5FF4A 3UWQA 1ME8A 3RLVA 1W5QA 3RLUA 3GXNA 1LP6A 3L68A 4JX5A 4DF2A 3KRSA 1F6KA 3UXDA 1G7UA 3W7QA 3WJSA 3DI0A 1UB3A 3HQ1A 3OBKA 2ZFAA 2VEKA 2GQ8A 4O52A 1G69A 3C4UA 3DI1A 1LCOA 4E0CA 4IMGA 3GB6A 2ZZ4A 3UY7A 4O16A 4YWIA 3PY2A 4PH6A 3LXBA 4GNJA 2JGQA 4JTGA 3PBYA 1XKYA 3PULA 2J9XA 1KFBA 2Q8ZA 3B4UA 2QCEA 3BARA 5D04C 5LNVA 3OA3A 1JUEA 3EXSA 2A4AA 2WJZA 1GWJA 2W0UA 1SU5A 4UR7A 1H7XA 4BR1A 3QEZA 2VFEA 4AHQA 1LOQA 1FWSA 1UJPA 2QF7A 3EKLA 5K9DA 2QJIA 2ISWA 5D38A 1CX9A 4N2YA 3C2VA 3LOTA 3L21A 4O50A 5AYYA 1H62A 3S6DA 4JS3A 3I65A 3O8AA 2Y70A 1KLZA 2JBMA 2CLHA 1BKSA 5E93A 3EB2A 3P61A 3MI2A 5KSWA 2ZTKA 3FYPA 4LOCA 3PB2A 4DQWA 5D33A 4N6FA 1RQBA 1ICSA 3B0UX 4S2CA 1VLWA 4ZQRA 1XDMA 1Z48A 1SO5A 3TV8A 1QNVA 3THAA 1W37A 3NPWA 4MIMA 3O6YX 2CLLA 3LLFA 5FF3A 3CPRA 4QAIA 1WOBA 3FYOA 3KVMA 1QOQA 3L67A 1D9EA 5U4NA 3G24A 4K6AA 4MJZA 1O5XA 4HSNA 3M41A 4KFNA 3SZ8A 1K7FA 5I3FA 3L2IA 3N19B 2J27A 4JTEA 3UWYA 3NOEA 3C2FA 3PR2A 3MHUA 4MOZA 1QMLA 3C2EA 4LWWA 1YDNA 4MYXA 3G8RA 3HB9A 1RV8A 3NAVA 4KFOA 4RZ4A 5DBUA 3W1MA 3TDFA 2Y7DA 3CEPA 1I2PA 3W7GA 2QAPA 2YW3A 1W3TA 3TAKA 5CSRA 2V5BA 4UTMA 4YXGA 1OVDA 3PUDA 3W2UA 3WJYA 1AG1O 2G97A 5EYWA 4FX8A 2ZA1A 1DJQA 5LGXA 3ABOA 3TXZA 3R89A 3KHJA 3M5YA 1CW2A 4QSHA 2YGYA 5D09A 3EX2A 2B7PA 2FQIA 2X1RA 3HIJA 3DFNA 1K8XA 3V1PA 4UFMA 4ADUA 2CZDA 3NQ2A 3MBFA 3TH6A 4RX0A 2XN0A 1PS9A 1UBSA 2YFNA 4UUIA 3LV5A 5HR6A 1OF6A 3LCLA 5AC6A 3W75A 3W76A 3EX4A 2RDWA 4AWUA 5C54A 2E77A 2HTMA 3EWYA 1VCGA 2QCNA 3QSRA 3W7MA 3VKJA 4WOQA 1JULA 4U28A 2QCFA 3BLFA 3BW3A 4JR5A 3NR0A 3TQKA 1JCJA 1QCWA 1AL7A 2DU2A 5EMUA 3LGEA 4WUIA 1I2QA 3UYCA 4ZMGA 1KA9F 1QAPA 5D32A 2HS6A 1OK4A 4H3DA 5U7SA 1DOSA 2RDUA 4LS2A 2YZRA 2QUUA 4LW7A 4PTNA 5KITA 3LM7A 1H7RA 1R30A 4Q33A 2ZYFA 3P8JA 2CW6A 4JYDA 1ME9A 3IIOA 1A5AA 4KKXA 2EF9A 3O15A 3QW3A 1NVMA 1JRBA 2E6AA 3HGRA 4LUIA 2CLOA 1EUNA 2NLIA 1FQ0A 2E68A 4FNQA 1YXYA 1EEPA 4ZQCA 5HNRA 3G0XA 1C8VA 3S0CA 4C1KA 2CLIA 4AHOA 1OX6A 3P7YA 5HQEA 4HHPA 2GOUA 3KOFA 1Q6LA 4E38A 2F7FA 1NFBA 2GQ9A 3LHTA 5DY2A 1W8SA 4JY8A 3C0JA 5AYXA 3BK0A 3EEGA 2VENA 4FX7A 5IBXC 4FNRA 1OYAA 2I1OA 4LY8A 3HF3A 3E0IA 4BWLC 5D2XA 3EXTA 2VFDA 4QISA 5TBOA 3W7OA 4OQVA 1VS1A 3DU0A 2C14A 3GR7A 2Y88A 5DCBA 1TQJA 1OABA 5AHMA 3HG5A 1ZNNA 2LLEA 1W5NA 1VR6A 1XI3A 2VXNA 3IEBA 3L66A 1F05A 1FCVA 5F1VA 4OWGA 2C3ZA 3DKJA 1VYSX 5HMSA 3BG9A 2CFFA 4YLWA 4M19A 2R94A 4GUHA 1TTQA 2O7SA 3SGUA 3NPVA 1TPWA 3WK1A 2OJPA 4N4PA 3R8RA 1NF0A 4CQ8A 3WFAA 1ZAHA 4MZYA 2J88A 4L4LA 1F7BA 2B7NA 1PCWA 1DVJA 1PV8A 3T40A 3MP4A 3SIZA 2FFCA 5G5IA 5CG7A 3A9IA 2PC4A 3M9YA 2VC6A 1Z41A 3TFCA 5DN1A 3S1UA 3TK7A 1D3HA 1JCYA 4TMCA 1H5YA 2VOMA 3DH7A 5LHEA 3BLEA 3W1AA 4JICA 2ATSA 2H8XA 4N02A 4WXZA 4FIQA 3A23A 3P74A 3QC3A 3W7RA 3NQDA 1GQNA 4O11A 1GVQA 3OVPA 4QJ1A 3IGXA 3JS3A 3LRLA 4UR8A 3WJZA 5K9XA 3ATZA 3PG9A 4IX2A 2O7QA 5KZDA 4EIVA 3OEXA 4EF8A 3G0UA 1TV7A 2PCQA 2V2CA 3W23A 1H7WA 1DORA 1MSSA 3BGGA 1H1ZA 5EY5A 3LCIA 2RHGA 3G1FA 4LVBA 3P8IA 1GTEA 4K36A 5C55A 4HNTA 3DFTA 4J9JA 4RK8A 2E6DA 3OIXA 4DELA 1XXXA 5EPDA 3IIZA 3NYZA 1KFLA 3Q94A 3TW7A 3P67A 3QF0A 4NJKA 3QQ0A 5AC8A 3MWAA 3QYQA 5HJLA 2YPIA 4LVFA 1SZNA 3PBUA 1LDCA 1VGAA 4WY0A 1OX4A 4AXKA 4EVZA 4UTTA 1IIHA 1TPEA 3GK0A 1GPWA 4N9DA 1XFBA 1X6UA 4UCGA 2DZUA 5I3IA 2D73A 2Y6ZA 4OBTA 4OE7A 4AMAA 2WSRA 1TCDA 1OFAA 4GE8A 2VFIA 3L0GA 1EUAA 3TSMA 1TSIA 1U83A 3F03K 1UCWA 1KBJA 2JGYA 1TB3A 5HWMA 5HUPA 2FDSA 1P4CA 4GRSA 1L9WA 4Z1AA 3DENA 3F4WA 1FDZA 1ICPA 3LI0A 3LDVA 1T96A 4UTWA 1VCFA 3ATYA 1O4UA 3JRKA 1FWTA 4TIMA 5D2VA 1YTDA 5AHNA 1JCNA 2F84A 2Y85A 2YFOA 3UPBA 1EP2A 5AHFA 2YW4A 1OK6A 4FX6M 3H53A 5EA9A 3C61A 3L65A 2H3DA 3N14A 3SW6A 3A21A 5BNKA 1H63A 1H61A 2QAFA 4LVAA 3N2XA 1OF8A 2RDTA 4R53A 4JTUA 1G6CA 2E6YA 1W54A 1R2SA 1JCXA 2PE4A 1HL2A 3S1WA 2V81A 4Y8FA 2ZZ2A 2QDHA 3MYOA 3PC0A 2B4GA 1JCMP 1M5WA 4XBKA 4GJ1A 2TPSA 3M0ZA 4P61A 4AF0B 3LHZA 4JDYA 4CCCA 1GJPA 3GLCA 3GXTA 4MJMA 4A29A 1GOXA 3I6RA 2Q3RA 3KX6A 3UWUA 1O5KA 4A21A 3W7LA 2ZRXA 2JKEA 2FPVA 2NX1A 3Q58A 3STFA 2E6FA 3C3NA 3W73A 3CLMA 4IQLA 4CNPA 2EPHA 3S5NA 2CU0A 2NZLA 3CQ0A 4ADTA 4BI6A 3G1XA 4ZQOA 2NV2A 2ZRUA 3C8FA 3W7NA 5GVJA 5FF0A 1HFBA 3LCGA 1T8XA 1SFLA 2TSYA 1B4KA 2VELA 1AW5A 3CTLA 2Z2UA 4CQAA 4O15A 3G18A 4G1KA 5LHFA 3T4CA 2ZZ6A 3O1NA 1VCVA 2NX3A 3S42A 1KFJA 5G1YA 1KM1A 3C6CA 4JTIA 3I68A 3DFPA 4K38A 3MP3A 4NJGA 1LRQA 2VKZG 2OT1A 3M47A 3QMSA 3EX3A 1R47A 4HN4A 4NT0A 3S5OA 1O60A 4XUGA 1KM3A 1P0KA 4TX9A 2A7PA 1H7NA 3M5VA 4A2RA 2FIQA 2EKCA 4FNUA 3W84A 2ABAA 3W1RA 4ZQNA 1H7PA 1SO4A 1KW1A 1SQ7A 4IMDA 3P84A 1TJPA 4PCFA 4E2DA 1I45A 3EX1A 3MUXA 1SPQA 2NXIA 4GUIA 4E2BA 4NNAA 3FKRA 4NNBA 5F4WA 1KM4A 2ZTJA 3HG3A 1AW2A 1H50A 3W86A 3NO5A 3N9RA 4UTJA 1KTNA 2DZPA 1LBFA 4UC5A 2QCDB 1YPIA 1LBMA 5H91A 2ISSA 1SR9A 4ONVA 3IGUA 4LC8A 3QPYA 4M6VA 4UTLA 3W7CA 4C1LA 1WBJA 1BEUA 2NWSA 3GIYA 1FCBA 1TQXA 1Z42A 3YPIA 3W2LA 1LLZA 4YL2A 2GJLA 1K8YA 3CB8A 4O4VA 3KVJA 3S1VA 3S9YA 3CWNA 3R2GA 5LNWA 1DQXA 3W2KA 2YXGA 5HUOA 4U4MA 1FY6A 4OU1A 3TX9A 3GNNA 3HPZA 1I2OA 5E1QA 3TJLA 4O1DA 3BGJA 3DFQA 3P5ZA 1UUMA 1YYAA 4JX6A 4GUFA 4BI5A 4MLJA 4MLRA 1LZOA 3IIXA 3F4NA 1KBIA 4MZ8A 3TR2A 1FCQA 1WYIA 1I4NA 1PE1A 2X30A 3LLDA 4JTLA 1Q6QA 4OV9A 3NXFA 3M1ZA 1L6YA 3OG3A 5I3GA 3VI2A 3CC1A 4DF0A 2QCLA 4IUOA 3Q2DA 1YADA 3W71A 4JGDA 1FDYA 1LBLA 1RD5A 1OFDA 5G2IA 3NZRA 1KTCA 1ONRA 3W7EA 3HBLA 2G96A 2W6RA 1OYCA 3A22A 1RZMA 3FKKA 1OJXA 5D37A 3H54A 3EWUA 3QRHA 1FWWA 1VC4A 3W1TA 1VHNA 2V5LA 1A53A 2H3BA 5D05A 1YDOA 2X1UA 3TQ0A 2RH9A 5FEWA 3HG2A 3M16A 5T26A 2OCZA 5BOOA 4K39A 3LHWA 2BXVA 4JYEA 2XN1A 4O0KA 3MO7A 3RMJA 3CIWA 4TR9A 3QQ1A 3RFAA 5AHEA 1SSDA 2PRHA 3R5EA 3OVRA 1FX6A 2XFWA 3N3MA 1VPXA 5EKYA 5J5RA 1J2WA 3NQ6A 2VFHA 4GUJA 3T44A 2ZRZA 3IVSA 3W6YA 3GVGA 4DO4A 5AOUA 1OG0A 4IWWA 1KTBA 3O63A 4DPPA 3W1PA 3F1QA 2V2DA 4AAJA 1TPB1 4HPXA 4QM1A 4IMFA 3TMLA 2V8ZA 1R46A 5D2YA 1FDJA 2RFGA 1ZALA 2J24A 3BLIA 3BV4A 5F4SA 3TCEA 3UNDA 1LYXA 1IXPA 3G3DA 2DJLA 2VFGA 3GYEA 3PB0A 3PS7A 3IIVA 3BVJA 1SO3A 2Z6JA 3PWAA 3TSBA 3U6WA 2NXGA 3GDRA 3S5ZA 3AJXA 2WNZA 1VJIA 4WQ6A 4UMCA 4ZZ9A 1CI1A 2TYSA 1OFEA 4JD4A 4JTHA 1PL9A 2HSAA 1EP1A 4A2SA 4CNOA 2CWNA 1B3OA 1NSJA 3G1VA 1ZAJA 2BZNA 3SECA 3NPXA 4O13A 2DZWA 4LS1A 5DXYA 4JN6A 4XKYB 3STCA 5I3HA 3KVLA 3E12A 1F73A 3INPA 2BLEA 1MEIA 3QJAA 1FCUA 1F5ZA 4XWUA 1OFRA 1FWRA 3MHGA 5FEXA 4ZL1A 3IRDA 3UWVA 1JJKA 5BRBA 3DGRA 3GZ3A 2ZRVA 5G2WA 2EHHA 1QDSA 2VEIA 3GAKA 2P10A 4MKNA 4I7VA 4PODA 4XBSA 1DJNA 3W1XA 3BG3A 3E96A 2I14A 4XTDA 5LKYA 3LCWA 2ZZ7A 1G7VA 3LCHA 2ZA3A 1ALDA 4R7JA 5IBXA 5CSSA 4PFMA 4HNUA 1L2UA 3ELFA 4ZVJA 1YTKA 3PBVA 5CPMA 7TIMA 4BWLA 4CCEA 2QR6A 4NJIA 1DV7A 2X2GA 2QDGA 3MP5A 3LHYA 1GYLA 2C19A 1Q3NA 5C2XA 3N73A 2DZVA 2FB2A 3BW4A 1KFEA 3ZR4A 2CLEA 3FA5A 3G1HA 4ZQPA 3CM4A 1QO5A 1EIXA 2QJHA 3W2JA 4UMAA 5I3JA 1X1OA 2ZZ5A 4RJEA 4ML9A 4OV4A 1HO1A 3NG3A 2J6XA 5EBUA 3MI6A 4QITA 1AMKA 1Q6RA 3NZ1A 1Q6OA 2QCGA 4D2JA 1RQEA 3TC6A 1MXSA 5LNSA 1VYPX 4RLIA 4O18A 1IXOA 2FPTA 4IGHA 4Z0JA 4O19A 4O17A 4AH7A 3B0VC 5D03A 1W1ZA 4X9SA 2ISVA 3TUUA 1WOAA 2E5CA 2WNQA 3NQFA 2QKFA 4O54A 3TROA 1IGSA 3P82A 4AHPA 2GVLA 3NL6A 1S5WA 1GVRA 4Q32A 4CCDA 3MJYA 3M44A 1N55A 5H2ZA 3H55A 1H1YA 5CZSA 1EWEA 1EX5A 1IF2A 1W5OA 1LRNA 4O28A 3W1QA 3C52A 3GR8A 3RNDA 2ABBA 3G1SA 4FHAA 1VHCA 4LT9A 3UPWA 3UY8A 4TMBA 3W07A 4YMZA 3LV6A 3KXQA 3OHIA 1LM1A 2JKPA 3QMTA 1OFPA 5SWUA 1ML1A 3VE9A 3W83A 4UNLA 3GAYA 2ZQ0A 1LOSA 5AC7A 3PUOA 1FXPA 4X22A 1L6SA 5C5YA 1XBYA 2GVJA 3IGSA 3OVQA 3ANYA 3W88A 3M5XA 2WSYA 1XCFA 5DELA 2R14A 4A22A 1WXJA 2A6NA 3HPXA 4M7SA 3B0PA 3MBDA 3D0CA 3I7RA 3Q37A 1RR2A 4Y9AA 1GT8A 4WY0F 4L4MA 3T78A 4NJJA 1XC4A 1TIMA 1B4EA 2AGKA 3T55A 4OHQA 3LI1A 3HMJG 3DZ1A 3EXRA 3EWWA 4FXRA 1H51A 4OT7A 1LLWA 3P62A 3HO8A 4MY1A 5TQLA 1PHQA 1JUKA 2J9ZA 4PL1A 2RKXA 3FJLA 3WJXA 4UTKA 2Y62A 1DBTA 1OHLA 1SZFA 3NQEA 3W70A 3NL2A 4IPIA 5K4XA 3SGZA 4IJBA 1AW1A 1BTMA 3BO9A 4HNVA 2VEMA 3A5VA 4JTSA 3GDMA 1YLVA 1TPVA 3N9SA 4MPQA 4DO5A 3UWWA 2Y89A 3CWOX 1QR7A 4I7WA 5F4XA 4KWWA 5G4EA 3W7KA 3GDKA 2WPBA 1I2NA 3TNOA 4QNWA 4N9CA 2C15A 1F74A 3USBA 1K02A 1S5TA 3HJZA 4R34A 2GPTA 1W56A 3W1NA 3GNDA 1KV5A 1TJRA 4QQ3A 1ZCOA 3L0KA 3NQVA 4JIPA 3EWZA 2FB3A 1M7OA 1KV8A 3HG4A 3LCXA 4I9AA 3WK0A 1PIIA 1ZENA 2DORA 5EL1A 1PHWA 4O57A 4CQ9A 3FIGA 4O12A 1W31A 3KVKA 5LGZA 3W2NA 2GJNA 2ZZ1A 1DHPA 5G4WA 5D2TA 4NX5A 3MI3A 5DBTA 3BW2A 5IM51 3BPWA 3K30A 5KINA 1E51A 4JTKA 4LV4A 3DHDA 1GG0A 3SI9A 3PUEA 1QWGA 2P0OA 1MEWA 1W3NA 3GDTA 2CLFA 2I9EA 2J9YA 4XZ9A 1YPFA 4DXVA 5F2IA 5FF7A 1JR1A 1QOPA 4IXHA 5F2LA 1RVGA 4ICNA 4AF0A 2EGZA 1KFKA 2A0NA 5I3KA 3GXPA 2YYUA 3TKFA 2BTMA 4WD0A 1JUBA 2NUYA 2ZZ3A 2A5HA 2Z6IA 3UZ5A 1RQHA 3HGJA 4JTJA 4LRTA 2WQPA 1TV5A 1XDLA 3GKFA 2B0MA 4UFLA 2PRMA 1BWKA 1S3HA 2GQAA 5HR7A 1TTJA 2C13A 2E5BA 1OFOA 2VFFA 1JRCA 4HIBA 4R33A 5AHLA 2C18A 1GG1A 3QSTA 2FPYA 5HULA 3QH2A 4Y6GA 3LRKA 4LU0A 4TU1A 4UTHA 3NQAA 2OZ0A 3W7HA 4M7TA 1IXQA 1AK5A 5K7JA 4UTIA 2GUUA 5AHIA 5DXXA 1L6WA 2C16A 3FLUA 1QPNA 4GXMA 1NAL1 5E0KA 2NXHA 2QEZA 4FXSA 1SW7A 4K7VA 5AFDA 1J5TA 1B9BA 1TPUA 4BK9A 3C56A 2H90A 3P5YA 3LTSA 8TIMA 3UQNA 4RCXA 2IQTA 3S1XA 1H7OA 4K37A 3WK2A 4DO6A 4NVTA 4PC8A 4W9TA 2E5DA 5DCEA 4Q4KA 3SSJA 2WOQA 1T99A 4ORMA 3RF9A 5FI8A 3V75A 1KLYA 4O1AA 4AWTA 2WO5A 3S5YA 1S5VA 3B04A 4FB7A 4WZHA 5G2HA 4YCOA 1XBVA 5F2MA 2X1TA 1FUYA 2CZFA 3LTYA 1AL8A 2QCDA 2ZRYA 4NJHA 3W85A 5A5WA 1P1XA 3C2OA 4FNTA 4QIUA 5KZMA 1PCKA 5HINA 1N7KA 1QPQA 2QJGA 3QFEA 2OT0A 4FIRA 3CEUA 3NM1A 1JQVA 1P5BA 3LHVA 3NL3A 1ADOA 4NXKA 2ZBTA 1TYGA 2A2IA 2ATMA 2DJXA 3HOJA 4O14A 4IOTA 2YX0A 4UXDA 3THQA 3ZWSA 4NNCA 4JYFA 1ZJIA 4UIOA 4HSOA 1GTHA 2W79A 1ZFJA 1ZAIA 1GEQA 5L6UA 6TIMA 4JTFA 3GKAA 3G22A 2V9DA 2DZTA 3TAOA 1WAUA 3MHFA 3PG8A 2DZXA 1T0OA 4Z0SA 1A5SA 3R12A 3NA8A 3NGJA 5KMYA 4LV9A 3W7IA 3G0SA 1F2JA 1K7XA 4EOUA 1WDWA 4IXXA 3DFOA 4TO8A 1SZGA 1V7YA 4GC4A 5LNUA 4UNKA 2NWRA 5BW6A 1MZHA 4JNMA 4MFDA 1NEYA 1P0NA 5D2WA 3FOKA 3TXVA 5K4ZA 3NQCA 4CNNA 1TPFA 5CPLA 4DBDA 3L0NA 1QPRA 4WXYA 5J5DA 5CZJA 1WBHA 1O95A 4BI7A 4DPQA 2NUWA 4HNNA 1TV8A 1WQ5A 1IXNA 1OFBA 1SSGA 1O94A 4NQ1A 1KM5A 1JQXA 1MEHA 3TU9A 3TA6A 3O07A 4N6EA 4B5NA 4JY9A 3DHFA 3NVTA 2G5WA 4LVDA 5CKSA 2QCHA 4A3UA 3L5AA 1XL9A 3LERA 1LROA 4AVFA 1LORA 3LCFA 1KM6A 4UTUA 4LC6A 1XBZA 3TIMA 1G4SA 3VCRA 3E02A
chains in the Genus database with same CATH superfamily
1J79A 2AKZA 3FJ6A 2OX1A 3QW4B 1CT5A 3FA4A 1VQTA 3ABQA 4M5PA 2MNRA 4D8AA 4WVXA 3LBMA 3WD1A 4RE2A 1KWKA 3HGSA 1KXHA 4YWSA 3QM3A 3XINA 3AXIA 4ZOEA 1GJWA 1Q7QA 1Q6EA 3VIHA 4FK9A 1TMLA 3CT7A 4PUKA 3P60A 1FTXA 3BG5A 2ONEA 4POCA 2AQWA 1PZ1A 4DF1A 3O06A 1O12A 1DWHM 2X0SA 2QUVA 8CGTA 3W25A 1A50A 1NWTA 5CPNA 3KRUA 2OR2A 4NXSA 2IW0A 1THFD 1JNDA 1JI2A 2ZCGA 3GNPA 3CL8A 2BSLA 2AL1A 4GOAA 1FOBA 4NAFB 2W91A 2IMRA 1VPQA 3H2OA 4UFKA 1QBBA 3CZJA 1F4AA 3GW3A 1VLIA 1E9ZB 2Y5SA 3VIMA 3WD4A 5DMLA 1FWNA 2A7RA 1GZGA 1JDDA 3T08A 1E40A 1YXCA 5AYZA 1Q4NX 1VEOA 1EKOA 4GC3A 1YX1A 3C0SA 1M7PA 2HZGA 3V16A 3T0DA 5CQ1A 4GUGA 4LEQA 2Z1KA 3M7WA 3C3UA 1B57A 1A0DA 2XWDA 2O56A 4OBSA 1E0UA 3CO8A 3CIXA 1HNYA 2E1DA 4F40A 3TJIA 4HK6A 4NIRA 4RR4A 3W3OA 1E4IA 1MXGA 3AMGA 4UFHA 3QGAC 1RPXA 5DRCA 1KFWA 1P1MA 4PA8A 1Z44A 4KWVA 2PRLA 4ZO7A 5BMWA 1ODZA 3W0KA 2FVKA 4QG6A 3URNA 1SO6A 3TW6A 6ALDA 5IOBA 4O8RA 4NSBA 5LIXX 1TWIA 2AQOA 2ZA2A 1JF6A 3N2TA 1H3GA 4MADA 3B06A 4UQEA 5FEZA 4HPJA 2VCCA 4GGHA 4H6KA 3MVIA 3EWXA 4RZ5A 3PAJA 2QULA 4ICCX 1DIKA 3E1F1 2VD8A 3N2MA 2I7GA 4AB4A 3G3MA 2NX9A 4E4PA 1W17A 3LEPA 3EX6A 3W7JA 4Q3MA 1E15A 2V30A 4XZLX 1EJXC 2D0FA 3NXLA 4FNSA 3L4VA 2ACSA 2Y7GA 1PWMA 3SCWA 4Q7IA 3FEMA 3M0XA 3UD6A 4H8VA 1J4EA 5A8GA 3TMQA 5TIMA 4JFUA 4JPGA 1XS2A 4HBKA 3S8HA 4JX4A 3WLJA 3NDOA 3HQNA 2PWUA 3GNXA 1ZPTA 1KD0A 1W0MA 1L0PA 2V0TA 1WDSA 1KO0A 4ZTXA 3NEVA 4LFYA 2PDMA 2UY4A 4GK8A 1CPUA 3C8NA 1PVNA 1IEVA 2QUNA 3ZVIA 5AN7A 4CD7A 1YHTA 2NT1A 4AU0A 3MMTA 1YW1A 2YSWA 2J7EA 3WDRA 4PRTA 2GVYA 1V79A 4MY8A 1FP8A 4PMXA 2X1SA 4HMEA 4ZE4A 3IVUA 3CQKA 4AIOA 4GO8A 4X0NA 4NAEB 1MNZA 3DXIA 4IX0A 3R8HA 3CHDA 1D3GA 4O1BA 3G1AA 1XIHA 4WY0B 3EBVA 4PTWA 3MYPA 3FVDA 4M8UA 1DWJM 4X3ZA 3NQ8A 4HT3A 4TTGA 2V82A 4RE0A 4KWSA 1V3KA 4U33A 4Q4RA 5RUBA 1TTPA 3RLHA 3AALA 1W3IA 3NQGA 1OZMA 1S46A 1R38A 3DYPA 3DFSA 1GYNA 1JVNA 3HGOA 4O4WA 4PMYA 1AODA 5EGRA 1UYQA 3LTPA 1B1YA 2GVGA 4IIFA 3VU2A 4X2RA 1LRTA 3L12A 1BGAA 4TX6A 4AZBA 3GHUA 3S1GA 4H01A 4D72A 3TR9A 7XIMA 4G1NA 1KB3A 1EJ7L 5LA2A 1ISYA 2E40A 1HVQA 1TRIA 4AIUA 4UTWC 2DFAA 5A1AA 1RY0A 3O6AA 2VTFA 4GBUA 4ML4A 1Q6DA 4D6EA 5LZLA 1Q45A 3W1LA 3E0WA 2IQDA 2OKTA 1GONA 1HO4A 5D30A 2WM1A 2Z2AA 1YRRA 4FSAA 4HB7A 1H49A 2D2GA 2OOFA 1R2TA 3PJUA 4MZ1A 3PSWA 2OYLA 3M4HA 1ME7A 3UZJA 3EOLA 3POHA 1RCOB 5MKGB 4YIWA 4PB4A 3SR7A 3R13A 4KCUA 4CEUC 1XBXA 3U4FA 4F4RA 1VAHA 1O5RA 3W4RA 1EPXA 3H2NA 3B0YA 5EMMA 3MSRA 4EAYA 3PBWA 3DAQA 1YDVA 1VRDA 1FWCC 1IIGA 3UT0A 1FWDC 4JQ1A 1XUZA 4Q8QA 3UP8A 3UW6A 1QK2A 4MUPA 4MNLA 5A6BA 1TVNA 4M6QA 2BX7A 3TYZA 3T4WA 1SZEA 3AHVA 3N15A 3MW7A 3BMXA 3ZZ1A 2OXNA 1BVNP 4QJ5B 1ZCCA 4NZJA 1XIFA 1KQZA 4FLRA 2R82A 4L5ZA 4R27A 1K03A 3TJXA 3TTYA 4N9EA 2VZOA 3KBWA 3O05A 4ZQMA 3UWQA 1A80A 1W5QA 2A3CA 2QJJA 1JCTA 4IPPA 2O0TA 3KRSA 1CTNA 1F6KA 4ASTA 2Z29A 3CHCA 2VEKA 2GQ8A 4O52A 3DI1A 3C0LA 4PTXA 3GB6A 4BY3A 3SQMA 2DVXA 3PY2A 4OOUA 1UR2A 2DUAA 4JTGA 1UBPC 4DY1A 2J9XA 2Q8ZA 2GZXA 2QCEA 5I6SA 3KS6A 4FXJA 4LF1A 1PAMA 1MDLA 5LNVA 1XQKA 1E4LA 3WD0A 1BYCA 4RDWA 1HJUA 4HU3A 2UY2A 4UR7A 4IQDA 3KL5A 4XK2A 4QRNA 1H7XA 4DI9A 3QEZA 4B4FA 3PTDA 3GE7A 4AHQA 5IFTA 1C3FA 1UJPA 2QF7A 3EKLA 3LS9A 5D38A 1TWDA 3BQ5A 3C2VA 2I17A 1IR1A 3TTOA 3AI0A 2Y70A 3O8AA 4W8LA 4FA3A 1YPXA 1ITXA 4IJCA 4OJYA 1L6GA 4IQEA 5A2CA 3FYPA 3KL3A 3DC8A 3QOKA 5H1WA 1CGUA 1SFTA 2XSBA 2VHLA 1MFUA 1L6FA 1Z48A 2YXXA 2OKOA 4B9YA 1EGVA 3ZO9A 2F2HA 3VD9A 1E0WA 4MIMA 3IPWA 3O6YX 3S83A 4G9PA 4QAIA 1JI1A 1WOBA 1UC4A 2HE8A 1OM0A 1QOQA 2OSWA 1WXYA 4HSNA 3M41A 5ECVA 5I3FA 3UWYA 1K4GA 5KZ6A 3DG3A 2WZMA 4CNSA 3K4AA 1XKJA 3HB9A 2E25A 1JPHA 1A4MA 4ZSUA 1R3WA 1JZ4A 3FSTA 5CSRA 2V5BA 3OODA 4YXGA 1OVDA 2RAGA 3PUDA 1A3WA 3W28A 3WJYA 1AG1O 4IPLA 1FKXA 1DJQA 2P8BA 3WF1A 2ZX8A 5DT5A 1CW2A 4QG9A 2HVMA 2QPXA 2FQIA 2X1RA 3DFNA 3NSMA 3V1PA 4AD5A 2FTWA 4UFMA 2CZDA 4AWEA 3TC3A 1UBSA 4UUIA 4HU8A 3LV5A 3SRFA 1OF6A 3LCLA 3VIJA 1UR4A 3CAWA 5HNNA 1XLMA 4AWUA 3UXIA 3WH8A 2QS8A 1CXLA 3EWYA 1E9YB 3VKJA 3D3FA 3A3HA 4U28A 2QCFA 4EKJA 5I09A 4M56A 3TTQA 3NR0A 4GIAA 4KMQA 4IMAA 3TQKA 4JL1A 4I6VA 2QMKA 3SCNA 1XPYA 5JXQA 3VFCA 2HS6A 4CU7A 4HOXA 4LS2A 1M65A 2DH2A 4KESA 2R6OA 3VM7A 5KITA 1RBAA 5FD0A 4Q33A 3V4BA 2PDPA 3CZEA 2VMFA 4KKXA 4I9JA 3O15A 3THUA 3QW3A 1GKPA 1PXGA 1UP3A 2ZUSA 2JFEX 4GYJA 4LUIA 2CLOA 2DIJA 1EEPA 2WJFA 3G0XA 1YQ2A 1C8VA 1LWIA 3RM9A 1TR9A 1XWYA 2CLIA 1X96A 4JCMA 1NFBA 1MQQA 5DY2A 4ICMA 4XZHA 1ZBVA 4J1OA 4RNFA 3BK0A 2J79A 1OYAA 4FNRA 4GCXA 1FWEC 3VGDA 3P14A 3EXTA 4A8LA 3OGVA 4LXFA 1VS1A 3GR7A 1MW1A 1GKRA 5AHMA 2LLEA 3ZMRA 1W5NA 4GCAA 1ZJHA 4OWGA 2C3ZA 3ZJKA 4FF5A 5MF5A 2XVNA 2CXEA 2CFFA 1BG9A 3M0IA 2W66A 3WBWA 2WVVA 3UZWA 3SUWA 5CGTA 1TTQA 3IARA 3WK1A 4GD0A 1VBRA 4PMNA 3N6JA 3RJXA 3CPGA 1XQLA 1IGWA 1OY0A 1ISWA 3WFAA 3OYXA 4MZYA 1PCWA 3A9BA 1JEZA 3S6OA 2FFCA 5G5IA 3A9IA 1JCYA 3GUGA 2VOMA 3DH7A 1CZ1A 1V7AA 1Z7AA 2CBIA 4JICA 2H8XA 4W85A 4C90A 3KTSA 3JS3A 3BLLA 4UR8A 5K9XA 3PG9A 1X38A 3S2JA 3VOHA 4EIVA 4NF7A 2FMNA 2V2CA 4NYUA 1ZB5A 1DORA 1I75A 1H1ZA 3FHAA 3AIBA 4S23A 1NQKA 2Y8KA 3P8IA 4K36A 4LYQA 3POCA 3JU2A 3WMBA 3OZYA 3QN3A 3N2CA 4PUDA 1C8YA 2IPFA 4ROPA 3P67A 4PBGA 3LQGA 4F0KA 3QQ0A 1IWAA 3PTQA 3ZIZA 3IK2A 3MWAA 1EJRC 2YPIA 4LVFA 1VGAA 1OX4A 5JU6A 1SVDA 3Q67A 5A8MA 4CD8A 4MTVA 3RHGA 4ZA0A 1M03A 3BAWA 3HA1A 2YCLA 4OBTA 1W1TA 4J5NA 3TN4A 4AX7A 3CJPA 1EUAA 4Z17A 2EPLX 3GG7A 3QBUA 3IUHA 3F2BA 2ZC1A 3KZSA 1P4CA 1E3ZA 4GQRA 3ITCA 4AISA 3A13A 4ZCWA 4GRSA 3GH4A 2AAAA 1R87A 3LI0A 3LDVA 1T96A 4UTWA 5LIUX 1VCFA 3ATYA 1V6XA 1FWTA 4PMUA 5D2VA 1YTDA 3QLLA 2OLHA 4LBRA 1GOOA 2YFOA 1M68A 2YW4A 3H53A 3C61A 4FZIA 3OZPA 3G2GA 3ITTA 3P2VA 7A3HA 3L4ZA 1EBGA 1EC9A 2RDTA 1TV3A 4AY7A 1BWVA 3B4YA 1G6CA 1W54A 4XZNX 4DZIA 1OC5A 3QXBA 2V81A 2HE5A 2DIEA 4XBKA 4GJ1A 2WANA 3UJ2A 2TPSA 1RVKA 3M0ZA 3T8LA 4AF0B 5HQMA 2INFA 4JDYA 4MJMA 4CNUA 3EWDA 1GOXA 8XIMA 3UWUA 3VCNA 2BODX 3W7LA 2WMKA 3Q58A 1RP9A 2DSUA 3CUIA 4IQLA 4CNPA 3DERA 5A8PA 5C9RA 1SJBA 2EPHA 2CU0A 5HJXA 3PZVA 4KERA 3CQ0A 4BI6A 1IT7A 3G1XA 1OZQA 5FCZA 2VT0A 4Q8TA 1P7TA 1SFSA 2VELA 2E3ZA 3GG0A 4G1KA 3VC6A 3T4CA 1HX0A 4O8AA 4HSHA 5REQA 2PD9A 1Q8JA 1BVWA 3MMWA 4WKAA 1W2PA 3RGTA 1LRQA 3QMSA 1WKDA 4UZUA 4HN4A 1O60A 4HCDA 3I6TA 2A7PA 3LA4A 1LT8A 4A2RA 2ABAA 4GI9A 1UD8A 4ZQNA 1H7PA 2OWCA 1SO4A 3W53A 1WXZA 3WQFA 4PCFA 3N4AA 1JAEA 1I45A 3EX1A 4E2DA 2V5DA 2R1MA 4LAKA 4L1GA 5ABFB 4LAMA 1KTNA 3NURA 2OGJA 4HA4A 4E4UA 3ARWA 4UQ9A 2Q01A 1J8VA 4ERGA 2ACQA 3FV9A 2V6AA 3WFZA 3IJIA 1TQXA 4HP5A 3BAKA 3QV9A 3HQPA 2EPNA 4MGGA 3URAA 5HDRA 2XFYA 4OU1A 3TX9A 3HPZA 2WZIA 1GHSA 3BGJA 3N4EA 4C6PA 1UUMA 1YYAA 4GUFA 2WSPA 4E8CA 2WJEA 1P0DA 4ZSTA 1H0IA 2D22A 4EACA 3NVDA 4JBRA 2E8YA 2E9BA 2VWSA 2UWFA 3OG3A 2DT1A 1PYFA 4AEEA 2H9AA 2IKIA 4PZVA 1YADA 4NKCA 1RD5A 1KRBC 3VTRA 5G2IA 1ONRA 1OYCA 1S2CA 4DXXA 1RZMA 3H54A 2WWCA 2YZ5A 1QXLA 1IZKA 3UG5A 1NWUA 1VHNA 1K9EA 2AKMA 1AH3A 3LZ3A 2X1UA 4KGLA 3VAVA 4P7RA 2OCZA 1DQUA 5BOOA 2NW0A 4JYEA 1JYNA 2BOEX 2XN1A 1Y8BA 2BVYA 3VO0A 4AZCA 3RMJA 5BWAA 4WGHA 3GU2A 3QQ1A 4W87A 4ACZB 1NH6A 3TYEA 4ZGYA 2GJPA 1V0KA 5J5RA 3NQ6A 4PMZA 1TELA 2ZRZA 3CUJA 3MO4A 4DN1A 4F2BA 3W1PA 2NSOA 2J7BA 3BZGA 2V8ZA 1LWJA 2J24A 3R8GA 3BLIA 2G4FA 2O9RA 3BV4A 5F4SA 1LYXA 1LQ0A 3B8SA 1F3TA 3GYEA 3N13A 2Z6JA 4D6FA 3H70A 3VCCA 3WF3A 3NDYA 4HU0A 1QK0A 1NFGA 2WNZA 3QOMA 1VJIA 2TYSA 3VIIA 4JD4A 1VFTA 1UKOA 2HSAA 1GEHA 3S2NA 2CITA 4MWAE 2BZNA 4IICA 3NPXA 2PLMA 4O13A 3VC5A 2JF6A 4F0RA 4XKYB 1F73A 2OZTA 1TA3B 4B5SA 3KOWA 1CENA 1FCUA 3IJ7A 3AISA 3KUMA 1JJKA 5BRBA 2I5IA 1DP0A 4LB3A 3ZVHB 1FKWA 4ZO6A 2WMIA 3WDHA 3QHOA 1PB0A 2P10A 2XFRA 3QLDA 4GIEA 4XBSA 3W1XA 3E96A 4IG2A 3PWGA 4XTDA 4JOMA 5I0DA 3GG8A 1EFZA 1DHKA 3WL1A 1ALDA 5B80A 3PBVA 5EMKA 3NZGA 1NOUA 2VZTA 3DEQA 3ONBA 3MP5A 2MANA 3LHYA 1S2AA 2C19A 2CETA 3N73A 2FB2A 4E5TA 3BCDA 3ME3A 2CLEA 1QO5A 3VKKA 5I3JA 1X1OA 5M3WA 2J7HA 3E5BA 1HO1A 2J6XA 5EBUA 5M5DA 2W4XA 1O1ZA 2QF8A 1GYMA 2HQAA 1HJQA 1OGSA 4DJDD 1MXSA 1W9XA 4O18A 2R24A 4H41A 4IGHA 4DRSA 3QR3A 1RK6A 2W61A 2PPGA 4BEUA 3AU6A 3LENA 5CBJA 1IGSA 4J3UA 2FYMA 3BICA 3O9NA 4CCDA 3TJ4A 2QT3A 3QTGA 1FFQA 2BVTA 4MB5A 3C5QA 4B5XA 4DM2A 1EX5A 4MDPA 1LRNA 4H6RA 4JTCA 3W1QA 4B92A 3EPNA 3G1SA 1VHCA 3UPWA 3UY8A 4TMBA 1RAKA 3W07A 3P3BA 3B40A 3OHIA 1LM1A 2F6KA 1DJZA 1FXPA 1L6SA 4FOJA 3OVQA 3IGSA 3FXYA 4CD4A 5DELA 1WXJA 5BU6A 3HPXA 3AMDA 3W37A 1J12A 1TX2A 5I79A 2YBVA 1GT8A 2XH0A 3T78A 1XC4A 2AGKA 3PPHA 2R1KA 1V6TA 3SDOA 3QY6A 2OEJA 2VQUA 2VEGA 4FLOA 3O3RA 5E09A 3P62A 3HO8A 4F66A 3EDJA 1JUKA 3N12A 2YIHA 2Y62A 1DBTA 5JIPA 1FFRA 3EB3A 3AWOA 4A3HA 1OHLA 1P0EA 4GKLA 3AZRA 4IPIA 1V4YA 5K4XA 1B9ZA 2ZXDA 2D24A 1XF0A 1E1FA 4P5UA 3RCNA 4DJED 3TYBA 2CEQA 3RG6A 1TJ2A 2GSHA 2P88A 1U1JA 4LCSA 2E7FA 3B9OA 3MANA 4ATDA 1QR7A 3RRAA 2ZDSA 3PTMA 5G4EA 4TVCA 2WPBA 3T8QA 4QNWA 3MSGA 4C91A 4N9CA 3UJSA 3SEPA 1F74A 3USBA 4R34A 4W86A 3GNDA 2VRKA 5D9PA 1TJRA 1UKQA 3ENLA 1TVPA 1W1YA 3OGSA 4I9AA 4XAGA 1PIIA 3IK4A 3W81A 1VJSA 1BRLB 5JQ9A 5FA5A 1F3WA 1MUCA 3RM4A 2GJNA 3PZIA 1DHPA 4Q6XA 4XBJA 4B5VA 3S9ZA 5KINA 1E51A 5A6MA 4LV4A 4M1RA 3GC5A 3K5XA 4UNIA 3DHDA 4NL1A 4LJ3A 3WQDA 4OBRA 5I03A 4LUSB 3TYAA 1M9HA 3GDTA 1B3YA 3LPGA 2I9EA 3KS5A 3S4TA 5D9NA 5FF7A 4IXHA 3FJNA 5F2LA 1RVGA 1XCWA 1AZ2A 3CL7A 4E3TA 4ERIA 1UKTA 2Z6IA 2WQPA 2V68A 3I4EA 5FIPA 4Q22A 4L1XA 1S3HA 1TTJA 1OFOA 1JRCA 4HIBA 3H4WA 1XLAA 2WBKA 1KCZA 1F4HA 4LU0A 4JQ2A 4K1WA 4US5D 5I7GA 1TZ9A 4YYFA 1BXBA 4H7ZA 1AK5A 4UTIA 5G1MA 3MKVA 1L6WA 3NQBA 4LUTA 6TAAA 4GXMA 4GIYA 1UA7A 4RW3A 1NAL1 5E0KA 1UWUA 2NXHA 2QEZA 1SW7A 2ISFA 1BAGA 3UR8A 3KTCA 2EBNA 2YOCA 2V3DA 2VRJA 4JTQA 4DO6A 2UZ9A 5DCEA 4Q4KA 2FH6A 3C0QA 1AH4A 5IRPA 5B7ZA 2OLAA 2FVMA 1S5VA 3KP1A 3B04A 4FB7A 1DTUA 1PKMA 2WC7A 1JZ5A 1XBVA 1FUYA 2D2JA 2VDHA 3GFXA 3VOGA 3WDIA 1LUCA 3W85A 3LG3A 4QIUA 3ZSSA 1ELSA 4PE8A 1IWBA 1JXJA 1WP6A 1HT6A 2PDCA 3FSUA 4G8TA 3QZ6A 1P5BA 1QJWA 3LHVA 3P0WA 1JZ2A 2ZBTA 2A2IA 2ATMA 3U7VA 1XINA 5CPQA 3R58A 5E9XA 2PDHA 4U5KA 3ZWSA 4JQ3A 4HSOA 3IACA 1ZFJA 1ZAIA 3WQGA 3TYDA 1RSCA 6TIMA 3GKAA 3RR1A 3WNMA 1V0MA 4H9MA 3PFRA 4A8RA 4NZ3A 3MHFA 2J8GA 1EF3A 1A5SA 3NA8A 3W7IA 1F2JA 3CWHA 1W91A 3GFZA 4IXXA 3GXDA 4GC4A 4D6DA 3GC2A 4ZOBA 3GIPA 1R8LA 1XJBA 1MZHA 4XD4A 1P0NA 3PZGA 4X61A 4B2DD 3FW6A 1J0YA 2ZIDA 2QLYA 2FH8A 5CZJA 3NO1A 3VOCA 1PX8A 2FGZA 2FTYA 1UR3M 2NUWA 4HNNA 1TV8A 1WQ5A 1IXNA 4KS0A 1SSGA 4Q8PA 3PNUA 3ISIX 3M46A 4NQ1A 1KM5A 1JQXA 2C1IA 1XLCA 2CERA 3ZJ8A 2YBTA 4AY8A 3O07A 4N6EA 4IFOA 4B5NA 4D9PA 1A0CA 1DIOA 4C6LA 2G5WA 2VR5A 5A8NA 2Z28A 1PDYA 2WWDA 4LYPA 2GSEA 4L6OA 1U2YA 2DT3A 4PULA 1TWSA 1BFNA 2Y7EA 5CJMA 3VGGA 7REQA 4PBEA 3RRXA 3O6DA 3U8GA 2HXTA 1GVIA 1G4EA 1L2QA 1UUOA 4BFAA 1E1EA 2J78A 2V63A 4M81A 2XISA 3B9EA 3JUGA 1IT8A 4I9TA 3PZ9A 4GVIA 3OJGA 4J28A 1T6MA 3GC4A 1WDRA 3EOSA 3W2MA 4MB3A 5DCDA 2CBVA 4M29A 4JHMA 1ZS2A 4XAZA 1G4PA 1E56A 1TUXA 4Y96A 4INFA 4M6UA 1SUXA 1KQYA 4GJJA 3H7RA 3ZJ7A 1KBKA 4IP5A 3G8EA 4RZ6A 1IT0A 4N9BA 4J3TA 4ORIA 2IPWA 5BZAA 3F4CA 1V02E 2PCEA 3HQOA 4S3GA 4AC7C 1O5QA 2R91A 2KZHA 3M6YA 5HPOA 3QVQA 2HNHA 1S5MA 3I4KA 4O0ZA 3AXXA 3C2RA 3VKAA 3O16A 1V5XA 4C6JA 3LUTA 1DE5A 3A6OA 3L5MA 5EB8A 4I7UA 2BGSA 3WLIA 3AMCA 3LX9A 3TC7A 3B97A 2WNNA 1N8WA 3L4WA 3N34A 4MWAB 3ABRA 3BV7A 4LRSA 2DVUA 2ZRWA 2EKGA 4M82A 3CUZA 2VEPA 2DP3A 1KR1A 2PURA 2IKGA 2QW5A 2PU1A 4L1WA 1OGGA 1Z32X 4J7RA 3OA5A 4FPSA 2GK1B 4HNLA 2JKAA 3F5JA 4GI8A 1GOKA 2YYTA 1QFEA 4L6HA 5L9FA 3KFTA 2AMXA 2A21A 4GQGA 3LB0A 3AJ7A 2VZSA 1UD3A 3OPSA 4LAOA 1BPLB 3B0XA 1B5TA 1VBGA 2DY3A 3VIGA 3SJ3A 3AFBA 1JIBA 3STGA 3W1UA 3IV3A 2C6QA 4LCQA 5ABTA 3T0BA 3KTXA 4REQB 3IGHX 2CZVA 2R8WA 1MRQA 5I2UA 1J9YA 3PHAA 1C9DA 2YCJA 3HV9A 3HPSA 4PN2A 5AY7A 4CNTA 4CEXC 1YEYA 5K9CA 1CXHA 3UXLA 1XSJA 3WD2A 3WBEA 2VX4A 5HWJA 4GWEA 4G7EB 2YDRA 5ABGA 3E38A 1NTHA 3BLKA 4R88A 4ZXLA 1FXQA 3E49A 3QFWA 1HF6A 3IJ6A 1JZ6A 1JAKA 3LYEA 3PN8A 3EMZA 2JEQA 1UUQA 3WNNA 1KM2A 3T7VA 2PTZA 2V2HA 5K3VA 2Z1WA 1X1ZA 3PNZA 2VX7A 3SFKA 1K8ZA 5MHBA 4NX0A 1Q7ZA 3IVTA 3OP2A 2BY0A 2VCBA 3CAVA 4AFYA 4UFJA 1DQWA 5G1TA 2YKKA 5HWNA 5BWFA 4JL2A 4F2UA 3LBCA 1OD0A 2NUXA 4C5ZA 2R1LA 4J3WA 4IGMA 2GGHA 2PDQA 2VUYA 1REQA 2XG9A 1E55A 3GHTA 1BTCA 5CG0A 1UKSA 3GDLA 2FZNA 3CZKA 1WA3A 3W9ZA 2WSQA 3UESA 1GOMA 3PZUA 4EWND 1ZQ5A 2Z0IA 1ZHAA 5DMMA 1PIFA 1UIOA 4UTTC 2VI0A 4H8HA 1U22A 3CUHA 4FO4A 4J3XA 3CUXA 4U3CA 3BLDA 3LMZA 3G1DA 1K9TA 3MV01 3EWCA 4MYAA 4ADSA 1J0JA 5DO8A 4AWSA 3N6HA 4MY9A 4WEVX 3AICA 4ALDA 2Z1BA 4GH1A 4IIBA 3TTSA 1F6PA 2QVHA 3HM7A 8A3HA 1K7EA 3MDWA 3RK8A 4U2ZA 1EEXA 1F76A 3CZLA 1Y0EA 3L23A 2QGYA 3VUSA 5FJTA 5CAKA 2A85A 4JXCA 4RXFA 1E1CA 1IZJA 4MFEA 2CZEA 4Z2LA 3B8WA 1MQPA 4PL2A 3AS1A 1N8FA 4NZFA 1QU4A 3PF3A 1C91A 1BF2A 4LBSA 2VURA 3ARQA 2B7QA 2UBPC 2FHCA 5F1UA 2QCCA 3BSHA 4NRSA 4GXPA 3A5FA 3BJTA 1QO2A 1HTIA 1TMHA 1SW0A 3A24A 1DXIA 1PTGA 3ICJA 1VEMA 1XM3A 3R0UA 3EDFA 1E0TA 3PM6A 1RLCL 5K2ZA 2ZKMX 3WK3A 1P0BA 3L9CA 3VNDA 3E0LA 3OLDA 4GZEA 1XLKA 5C6MA 2Q71A 1I9CB 5KTLA 2YA2A 4XQ6A 1EJTC 4NU7A 2Y61A 1XH1A 4CN6A 1SW3A 1IQ8A 2A7NA 3KM8A 3VE7A 1F07A 3BMWA 3LXCA 1GVSA 2HMCA 4O53A 5IDZA 3DIPA 1H1NA 3RLVA 5BXPA 4Q4SA 3GXNA 1LP6A 1EX1A 3L68A 4JX5A 2VZUA 3GRIA 3AYRA 4F0MA 4DF2A 2AL2A 1Q4WA 3TN6A 3W7QA 3H21A 3UJEA 2F8QA 1UB3A 2VX6A 3HQ1A 3OBKA 2ZFAA 3MA8A 5C7VA 3PTKA 3ARSA 3C4UA 3LK6A 4H9ZA 4QEEA 1LCOA 4PMVA 3L2LA 4O16A 3EEZA 3PBMA 4QS5A 4PH6A 5LA1A 4P8XA 1ISXA 3VILA 4PUMA 4GNJA 1FWBC 5LXEA 4EPKA 2DSWA 1W1PA 3OA3A 3GTXA 4TTUA 2WJZA 1ITUA 4A8NA 1YNYA 4JTAA 6CGTA 3TYCA 1JNEA 1V08A 4BR1A 4C6KA 1G0CA 4C6IA 4H9VA 1WAWA 4Q4MA 3AIEA 3B8IA 3TONA 3WQ4A 4GQQA 2BMBA 2PDNA 3PJXA 2QJIA 5BYWA 1W8GA 1CX9A 3L21A 3VDBA 2D3NA 5AYYA 4JS3A 1GK8A 1KLZA 1US3A 4LCRA 3EB2A 1J93A 2DT0A 5KSWA 3CHFA 2ZTKA 4R85A 4LOCA 3PB2A 1RQBA 1ICSA 3B0UX 2J47A 4S2CA 4C6QA 1XDMA 2D20A 4UR9A 2GOKA 4XD6A 5KETA 3THAA 3NPWA 3LLFA 4DBUA 2V3FA 5FF3A 1JPKA 1D7FA 3FYOA 3CV7A 1VENA 4TX8A 1HP4A 1R3YA 3ZQ9A 3L67A 4EX4A 1D9EA 5U4NA 5BU9A 2JEPA 4K6AA 3DDMA 2DUZA 3CS2A 4JZ5A 1YNQA 4GG9A 1K7FA 4GY7A 2OWXA 2XIOA 3GDBA 2J27A 1QMLA 3C2EA 1VP5A 2Z4GA 4KFOA 3RIKA 2Y7DA 3CEPA 3W7GA 3VGHA 1Z8AA 1W3TA 1MYRA 3TAKA 4UTMA 4NY2A 1EOMA 3WEOA 3W2UA 4ATLA 4FX8A 4H00A 3ABOA 3TXZA 4ZBCA 3DN5A 1CGXA 3R89A 1EDQA 3GYCA 4QCEA 3H2FA 3VUPA 4AZHA 3MMDA 5D09A 3EX2A 3KBMA 2NT0A 3DESA 3LNPA 1K8XA 4WDWA 2JF7A 4C60A 4RX0A 1GKQA 5HR6A 3URQA 2YB4A 1B3XA 1R86A 1Z6KA 4QLJA 1E3XA 1ZLPA 4DZHA 1VCGA 3K8KA 4Y9MA 3W7MA 1NOWA 4L4OA 3E0VA 3IAPA 2I56A 3CAKA 3BLFA 3BW3A 4DX3A 1KRCC 2BGNE 4R5EA 4NAFA 3ARUA 2Z26A 2DU2A 2WMFA 3LGEA 1RJQA 4WUIA 1NDVA 3UYCA 1QAPA 3ZR5A 3AIWA 4CQBA 1H0GA 1OK4A 3VX0A 1DOSA 5FKYA 2QUUA 3PBGA 3CZ8A 2PDFA 3LM7A 1UZ1A 3P8JA 1ITCA 1V3LA 4KBXA 2CW6A 3LPFA 3BWWA 1ME9A 1A5AA 1KKOA 4HU4A 3WNPA 4B3KA 3ITGA 1K4HA 1NVMA 3CBWA 2E6AA 2PLKA 3L2MA 1FQ0A 1VIZA 1YXYA 4ZQCA 4HOZA 2FGBA 3S0CA 1XYLA 3BE7A 4C1KA 3FYYA 3P7YA 3XISA 5HQEA 2RUSA 4HHPA 4NZCA 3KOFA 4E38A 2F7FA 3LHTA 3A64A 4A6GA 1Y5XA 2IKHA 1VEPA 4S3CA 3EEGA 1UPPA 2VENA 3SCQA 1UWAA 5CGMA 3WDQA 3BSMA 3E0IA 2EJAA 1UP0A 4BWLC 5TBOA 2C14A 5DCBA 3HG5A 3IEBA 4A3RA 4MKVA 5F1VA 3DKJA 1VYSX 5HMSA 3BG9A 4M19A 1RBLA 2CESA 3QYSA 3SGUA 4H7VA 1TPWA 1VFUA 4RE3A 1WCGA 4N4PA 4GVHA 4DJEC 3N2OA 4AX6A 4CQ8A 3MUAA 5I77A 2IPGA 4QGCA 2ZX9A 2B7NA 1UWIA 1KXVA 3UVAA 3SQSA 3SO7A 4KCVA 9XIMA 2PC4A 2VC6A 4C65A 4CN1A 5DN1A 3TK7A 1UZDA 4LSBA 4DAIA 1RA0A 1A5OC 1DTNA 3BLEA 1C92A 1UWSA 3B3DA 3CMFA 2ATSA 4N02A 2PDXA 3AWNA 1HKWA 3P6LA 2O55A 3A23A 4A3QA 3W7RA 1BKHA 2E9MA 1GVQA 3K1GA 4MWAD 2QVNA 3ATZA 4AD2A 1XV8A 2O7QA 5KZDA 1K8CA 3G0UA 2PCQA 3MTWA 4I5XA 3LPPA 5GPRA 3WELA 4KIRA 3WQOA 2XIIA 2XPKA 5D8ZA 3W6MA 3AZSA 1G94A 1NDWA 3G1FA 5BROA 3AHYA 4HNTA 3DFTA 3OIXA 1K1DA 1ZUAX 1GGOA 1JD7A 3NYZA 1DJGA 3TW7A 4NJKA 3TYUA 3QYQA 3GIQA 1GOIA 4WY0A 2DVTA 4AXKA 4WSHA 3MQTA 5DMNA 6PTDA 4UTTA 5FSDC 3OLIA 4HK7A 2WC4A 1BYBA 1GPWA 1CXEA 2PS2A 1XFBA 1X6UA 4CGTA 4JTDA 2Y6ZA 3E6EA 4OE7A 2WSRA 2VC7A 7PTDA 3L0GA 1AJZA 3TSMA 1TSIA 2PAJA 3VMNA 1DXFA 1KBJA 2REQB 4A35A 3DYOA 2FDSA 3B9AA 3ZJ6A 4Z1AA 3DENA 7ODCA 3F4WA 2IXUA 1FDZA 3VNIA 1O4UA 3KWSA 5AHNA 1DYSA 3UFYA 3URBA 1EP2A 4YPJA 3E2QA 4FX6M 2HROA 4WKFA 3L65A 3MV11 3SW6A 5BNKA 1H63A 1H61A 2QAFA 3N2XA 5HMDA 3VMPA 3WZ0E 4CVUA 3BAYA 1JCXA 2PE4A 4Y8FA 2ZZ2A 5E0FA 3UETA 2XIBA 1JCMP 5MKGA 3GXTA 5JBDA 1WPCA 3SCOA 3I6RA 2Q3RA 3GTNA 1O5KA 2V5CA 2VUNA 1EXBA 3FDGA 2E6FA 1U1HA 2PDUA 2B81A 4W88A 3S3GA 3VD3A 3CLMA 1JDFA 1KGUA 4ZXOA 3OQEA 4C6EA 4ADTA 4KETA 2GSJA 2ZRUA 3ZSTA 1C8QA 1HL8A 2GLKA 1L8NA 5GVJA 2Y0FA 1K9DA 2EG6A 1P7TB 4PRRA 5CLTA 5DX7A 1C7TA 4KWUA 4FS9A 2CKSA 4C6FA 2Z2UA 4CQAA 2XSXA 3O1NA 4IFKB 1X39A 4X9YA 4JKLA 2NX3A 4MKSA 3S42A 3ZLHA 1KFJA 3Q4DA 3T9PA 1KM1A 2O4QA 4JTIA 1PTAA 3DFPA 3I68A 3LM3A 1UWRA 2NQ5A 2OT1A 2O9TA 1TWWA 2DUXA 5CAHA 3V36A 4NT0A 4CU6A 1AUSL 3EKGA 1KM3A 4MB4A 3F7JA 3M5VA 4BCEA 4FNUA 2ON3A 4F3HA 5BOFA 3P84A 1GZJA 5DQPA 1TJPA 3FX4A 3NZQA 2R1PA 2EPOA 4NNAA 4NNBA 2XYLA 3A4WA 1H50A 3W86A 4WDUA 1GVEA 3U0HA 1LBFA 2WHMA 2QCDB 3RILA 1CGVA 5H91A 3F5KA 2TAAA 1QHPA 1SR9A 4PRWA 3IGUA 3RCYA 3M0LA 4I5UA 3RLGA 1SMDA 3MCOA 3VGBA 4IIDA 2CYGA 1QI3A 3S1VA 4I9MA 3S9YA 5LNWA 1DQXA 3W2KA 2FZDA 3BUVA 2POTA 1WZKA 4U4MA 1LG2A 1I2OA 2Z25A 5E1QA 3TJLA 3RU8X 2HK1A 1Q6CA 4IIEA 1GHRA 3P5ZA 2NQ9A 4MLJA 1NM9A 1KBIA 4MZ8A 3TR2A 4Q8UA 1I4NA 2BB0A 1Q6QA 4XO6A 1DIDA 1HIZA 2XIJA 2ASHA 1W9BM 3LQLA 4KPLA 3KBNA 1OFDA 1UD4A 1OC7A 1KTCA 1QWKA 2DSZA 3A22A 3FKKA 3K1DA 3T81A 3VM5A 1FWWA 3QQWA 1MWOA 2ZUWA 1A53A 2H3BA 4QFUA 5D05A 3I10A 3PPGA 3LSCA 4KCWA 3TQ0A 2ACUA 4Y8EA 2RH9A 3HG2A 3M16A 1RK5A 2BXVA 4D6CA 4W84A 3BL3A 1NELA 1WDPA 1UWQA 1HZYA 3CIWA 3RFAA 2XSAA 1MW2A 4EPBC 5I78A 2PRHA 4WRHA 1P48A 5EKYA 3BANA 2CHOA 1XGZA 4YTSA 3W6YA 3GVGA 5AOUA 3O63A 2QV5A 2ZVIA 2VVNA 3UR5A 3VNYA 1LQAA 4IPNB 2JQXA 4G5DA 2V2DA 4AAJA 1TPB1 2HEJA 4IMFA 2PDJA 4BS0A 3G77A 4UQCA 3EYPA 3GNRA 1FDJA 3CB3A 1YMYA 1XG4A 4K2SA 3MVTA 3IWPA 3S47A 4PB3A 5C70A 1EC8A 1AA1B 3TCEA 1HJVA 2QIWA 1IXPA 3UG8A 3IIVA 4HPHA 9XIAA 5M1TA 3GDRA 4GABA 4WQ6A 3UR2A 1CI1A 1OFEA 3WNKA 4JTHA 4GZJA 1PL9A 4A2SA 1F8IA 1QI5A 1B3OA 1NSJA 1ZZMA 3ALGA 2DZWA 1B31A 1MZRA 3W38A 3PZOA 4JN6A 1FVPA 3N18A 3STCA 2DW6A 4Q8VA 1MEIA 2HXUA 3CH0A 3VOFA 1OADA 4ZO8A 2QDDA 4XAFA 4XWUA 1RALA 1FWRA 5FEXA 2OVLA 3IRDA 3AYTA 1KBBA 3DGRA 3GZ3A 3N17A 1KGWA 3GAKA 3CT2A 3NWRA 4G7FA 2I14A 4C1NA 4ZO9A 1OCJA 3TLQA 2WM0A 5M03A 2ZZ7A 2PWGA 4KWOA 4ZR8A 1R7OA 3ELFA 1YTKA 4ZVJA 1D2KA 1EZ2A 4BWLA 4CCEA 4DNHA 4E4FA 1K6AA 2XFFA 1DXEA 1Q3NA 3EPMA 2Q8XA 3VNJA 3BW4A 3DC0A 4ZQPA 4PCTA 2ZX7A 2FVLA 2E67A 3CM4A 3W2JA 2G41A 3FY1A 4RJEA 4OV4A 3MI6A 3RM8A 3UERA 1AMKA 1Q6RA 4DJEA 3U7BA 5LNSA 3WLTA 1ENUA 5F7UA 5FJPA 1V3HA 4EWJA 5HMEA 3IUIA 2OB3A 3TUUA 2WNQA 3NQFA 4Y9NA 2O9OA 2QKFA 4O54A 3RYSA 4AHPA 3NL6A 1S5WA 3LN3A 1T8QA 1PKLA 5H2ZA 1XRVA 1Y5VA 1E6RA 4FLQA 4TXEA 1EYEA 1W5OA 4O28A 4WR3A 3GR8A 3OZOA 4LT9A 3MSDA 1V6YA 4YMZA 3GBDA 1L8PA 1QATA 2FFIA 1OFPA 1O68A 1V6WA 2ZQ0A 5AC7A 2MUCA 3OLEA 2WMGA 1XBYA 2GVJA 1NJJA 1XCFA 1QI0A 4A22A 2A6NA 1PUDA 4M7SA 2VGIA 2XTKA 3MBDA 3Q37A 4MSSA 3VD4A 1ISZA 4WY0F 4D1JA 1PZ0A 2NVAA 2WNWA 4S3EA 3SURA 3HMJG 3DZ1A 3EXRA 3EWWA 1LLWA 3I3DA 3RO8A 2WVUA 3LY0A 3RO6A 4MY1A 5TQLA 2RKXA 3T2OA 1BD0A 1BHGA 3NQEA 3UGRA 5CLWA 2OSXA 2VCAA 3G6MA 3SCRA 4GVGA 1HVXA 1AW1A 1J01A 5FAJA 1BTMA 3BO9A 3WH9A 3A5VA 4GX9A 1V03A 4L56A 3GDMA 3CGTA 2IQ0A 5DEZA 1DE6A 2WK2A 3H2AA 3W7KA 3GDKA 1X7IA 3LZ5A 1IEXA 2Q6ZA 1FH8A 1W56A 3KL0A 1XX1A 7TAAA 4NILA 3O0KA 2BASA 2FB3A 5BOEA 4GQBA 4C6BA 4Y2WA 1PHWA 4O57A 4Z1YA 4O12A 1W31A 3DGBA 1H2JA 2ZZ1A 3MY9A 2J66A 5G4WA 3VD5A 4NX5A 3MI3A 4HNCA 2QDEA 3K30A 2PTXA 3PUEA 1VRXA 2P0OA 1W3NA 3UYIA 2CCRA 2CLFA 5D9OA 2J9YA 1XDJA 4DXVA 1XYZA 1MI3A 4AF0A 2EGZA 2A0NA 4UCFA 1CYGA 2W5FA 2O4MA 2YYUA 4C7GA 2PLCA 3GXFA 3TKFA 3HFTA 5A6LA 4QJ4B 4ZE5A 1TFVA 3WLLA 4FOKA 4NI8A 3HGJA 3UZYA 1XDLA 5CJ5A 4MJ2A 2FGLA 2BS9A 3OIHA 1JPDX 2BVWA 4UFLA 1CXIA 2GQAA 3SCSA 4NRRA 3RJYA 3KZPA 5BRPA 2OYMA 4JIRA 5HULA 2PFHA 2Q09A 1R7AA 3QH2A 4X60A 4CD5A 4OFCA 4MPKA 3NQAA 2OZ0A 3VA8A 3W7HA 2BG5A 1WKYA 2GJXB 4J4KA 1AJ2A 1ODUA 3VNZA 4XVDA 3FDKA 4Q8NA 1BQGA 2WBGA 2WPGA 3AIQA 4L6DA 1I60A 1YE4A 1P6BA 1QPNA 1XLEA 3GBEA 4PSPA 3UF9A 4I8YA 2BHYA 3APTA 2EJ1A 1F9CA 4FXSA 4B2DA 1J5TA 2GWNA 3THCA 3EDEA 3IJ8A 4BK9A 3C56A 1ZU8A 5E9AA 3UQNA 3S1XA 5J04A 3WK2A 3AYVA 3NSXA 3CQIA 3BC9A 2QIIA 4U3AA 3NJ3A 4W9TA 2E5DA 4W93A 2V5JA 3WNLA 1GVYA 3H12A 1NARA 2NVCA 5FI8A 2A3AA 4L80A 4QLKA 3V75A 1KLYA 4O1AA 4AWTA 4UB9A 3OLGA 5FAGA 3S5YA 2BVDA 3OG2A 4WZHA 5ABFA 4YCOA 5CCZA 4QDMA 3WFLA 2CZFA 4JN7A 3DHUA 4DXKA 4NJHA 4PCPA 3C2OA 3BAIA 5KZMA 2XVLA 3ES7A 4C7FA 4LYRA 1JQVA 3OYZA 3NL3A 3TZNA 3BXWA 4AZ5A 3HOJA 3WCZA 3ZT7A 1BVZA 4IGSA 1GTHA 3CYVA 3EB4A 4LYKA 5TD4A 1CWYA 5AECA 3SUVA 4NYYA 3AZTA 3GVVA 3G22A 3TAOA 4MB1A 3PG8A 2DZXA 5GJMA 2HPIA 2F2KA 4GI6A 2EO7A 3GVRA 3R12A 3NGJA 5DF0A 4LV9A 2PODA 3G0SA 3ORWA 2CBUA 1K7XA 3ZLGA 4EOUA 4GXWA 4TO8A 2QGHA 1V7YA 2J74A 4DBSA 3U2EA 2BNJA 1VD6A 3U9IA 3TP4A 4JNMA 2BOGX 5D2WA 3FOKA 3TXVA 4AD0A 1RJPA 1XR2A 4CNNA 5CPLA 1X6LA 4WXYA 5IXEA 2J13A 1O95A 4BI7A 3EAUA 4E8DA 1RP8A 3FA3A 2F6XA 1E5NA 6REQB 1MEHA 2WB5A 2XIQA 1QNOA 1W2VA 5CKSA 4A3UA 2GUYA 2TODA 1BSLA 2Z24A 1XL9A 4ACZA 3LERA 5C9WA 4AVFA 4HGXA 1LORA 1BYDA 1Q2RA 1W3LA 2VNCA 4LC6A 1XBZA 4BQ2A 4E8GA 3WYZA 3PSVA 3KWXA 2WV8A 1RPKA 4K7YA 3REQB 3PK7A 4JFVA 3AROA 4RV3A 5BMXA 3WO8A 5AC5A 4O0QA 3ALFA 4F79A 1XLGA 1TZ7A 4S3BA 1TO3A 5DLCA 4P7QA 3WLKX 4HPNA 3BJSA 1VPYA 4GINA 1JD9A 1EJUC 5CZ0A 2XIMA 3D5HA 1MQRA 4S1FA 3V3WA 1QT1A 1U33A 3VFLA 1RUSA 1X7FA 3LRMA 4L65A 2XH2A 2TRSA 3P0XA 1NP0A 4MNMA 3RN6A 2OWWA 5CZTA 4DUWA 3LD5A 4OIFA 2FMOA 5CC6A 4DWSB 2ZDRA 2QCMA 1J10A 4JHZA 2VWTA 5LSMA 2F6UA 4XG1A 3G6LA 2FZBA 2P8CA 2Y7FA 4XKYA 1OBAA 1WZLA 4HZMA 1TA3A 4EK7A 3T2QA 5AZ0A 2CZ5A 2NV9A 2Q8LA 4HN8A 1XLBA 5EU9A 2G0WA 1DJHA 2HISA 1YTEA 4GNKB 2HS8A 3ZVHA 4GYPC 2VR4A 3B9NA 4W4QA 2G8ZA 3GD6A 1UQYA 3KCOA 1AQHA 2RJGA 1JL8A 3QMRA 1Z3NA 4RW5A 1NU5A 5HQLA 2XM1A 3I7SA 1I8JA 2ANUA 4WCJA 4YN5A 1IR2A 4AZ7A 4DLFA 3LBOA 2AAMA 1B2YA 1W1VA 3TZFA 3WLNA 1VBUA 2PGWA 1UOKA 3ITYA 1SGJA 4ZODA 5DMYA 2X8RA 3UEQA 3DKLA 4DJFD 2EPMX 4YNGA 1ZY9A 4MWAC 4XD3A 4B4HA 3W7PA 3L5LA 4EPDC 4KT2A 4UFIA 4XTIA 5A8OA 4W7VA 4IPJA 2DPEA 2PWFA 4WOZA 3SUTA 4N42A 4AD4A 4H6EA 4DEFA 2PGFA 3SY5A 4IMCA 1XIDA 3ID7A 1WZMA 4KW2A 5HBFA 1PEZA 4QG8A 3DOPA 2POZA 1GVFA 4CKQA 4E2VA 2DZSA 2GDVA 2XN2A 1C29A 1US2A 2Y63A 5EMJA 1FBAA 1DWIM 4CN4A 1NP2A 4KFPA 3ONCA 4KRTA 4PMQA 1ZTVA 4NHVA 4NG3A 3QGVA 3OBAA 3TQVA 3GSMA 1ZGDA 3AS0A 2A1YA 4Q4QA 3KAOA 2XZ9A 1BG4A 4S3JA 5A6AA 3UVIA 1KM0A 6ENLA 4AG0A 1X8FA 3H8AA 3UWZA 3JZEA 3AC0A 3O6CA 1YBQB 1N82A 5E0CA 3N04A 2OELA 1LTDA 3B8DA 3MUCA 3NPUA 3VOIA 2J8TA 4AXNA 1SJAA 4P2VA 1VZWA 5FSEC 1D7KA 2W67A 5CC5A 2A3EA 4YTRA 3LGDA 4U5IA 4M6PA 3OQ8A 4J3SA 4TVUA 2ISDA 1V93A 5GNXA 1DKWA 3O0FA 2PWEA 2ZC8A 1ECEA 4MVAA 1Q85A 3I7QA 4HPGA 3TSDA 2X09A 3WLOA 3KOXA 2OX4A 3SRHA 3QTPA 1PWLA 4KRUA 3O7UA 3KRZA 1Q5MA 1EC7A 3GQYA 4LVGA 2W92A 3EKZA 2BP1A 1XUUA 2NSXA 3VNLA 3AUOA 1JDAA 4NI3A 1R3VA 2WW5A 1W5MA 3SBFA 4LTSA 3T0CA 3TE9A 1KRAC 2VRQA 1M6JA 3A4JA 1E9IA 3AO0A 1W5PA 1W9PA 4AYGA 4HKPA 3VNMA 1IHIA 3NYDA 2Q3OA 4DUXA 3QPZA 3SY8A 3DYMA 3RITA 2XJ7A 4W8BA 5HANA 1UR1A 1J6PA 3A4XA 1PX4A 4OVXA 3WMLA 2B7OA 4FP1A 1BRLA 4K8GA 4WLCA 2QUTA 4FEZA 1KXQA 5AKQA 3H24A 4Q7NA 5I24A 3WF2A 5LNRA 1OX5A 2JK2A 4L9XA 1GORA 2ZXQA 5XINA 2NV1A 1QRQA 1HJXA 1V0LA 5CGQA 1UPMB 5F2GA 1M1BA 2VQTA 4YS1A 3VOJA 1G67A 3TEVA 1E6QM 5HJYA 3LHUA 4DYKA 5JBFA 4Y90A 1V0NA 3FFSA 2J7FA 4Z1DA 1RLDA 4QAWA 1UD5A 1FHLA 4UBPC 2FTPA 3ARVA 4GA8A 3ARXA 4CLMA 1MO0A 4K8EA 1XGEA 3B05A 1VH7A 3UZZA 4Z2GA 4A3YA 3WLHA 4Q4PA 2VD9A 2G37A 1M04A 4DI8A 3V0SA 3E9AA 5FEPA 4JFSA 1NDYA 1HUVA 2GUBA 4MUZA 1VBHA 2Y4SA 1XHGA 1KBLA 5AB3A 1OCNA 4JDBA 4PEKA 4P8UA 1EDGA 1JDEA 4DBEA 3VIPA 4QNEA 4K68A 4OGZA 1AQMA 1CB2A 4BF9A 1V3IA 3W7DA 3U4AA 2WHKA 4LNYA 4LUJA 4U31A 1AVAA 3N3TA 4I3GA 4RXGA 4AMCA 3CXOA 3SY1A 5FJRA 1WKEA 2X16A 3WBYA 3EMCA 1CIUA 3UCCA 2G95A 3KLLA 1VFMA 4H9XA 4HJFA 4XIMA 3MS8A 4K8HA 4JIQA 3W72A 3BOFA 5A3HA 3BAJA 2NLYA 1GUVA 3VDHA 1BLIA 4GYKA 4F48A 3UXDA 1G7UA 5EMLA 1UD6A 5TAOA 1G69A 4J27A 3KDNA 4IMGA 2I5QA 1VFOA 2ZZ4A 1ZBCA 1GW9A 3SRDA 3T0AA 3LXBA 3PBYA 2QYGA 1XKYA 3PULA 1KFBA 3B4UA 1SM9A 5D04C 4N0RA 2L5HA 2ZE3A 2HBVA 2YXOA 3EXSA 3PP7A 3SN1A 2BHUA 4GBDA 3ARPA 2ZX6A 3F2CA 4WGXA 4YVVA 3FK4A 2FZ9A 2YL6A 2YL8A 1HJWA 3OTRA 4DVOA 4C6DA 2VFEA 1M53A 2FHBA 1LOQA 1FWSA 3CZGA 2PTYA 2X40A 1JFHA 1QW9A 4N2YA 2EG8A 5HAOA 4O50A 4L4PA 1H62A 4C6NA 3B8VA 3I65A 3MUIA 1UH3A 2ZVRA 1BKSA 5E93A 1W32A 2V3GA 1A49A 5D33A 4N6FA 3BQ6A 1K9FA 1VLWA 4ZQRA 4ACYA 1SO5A 3W26A 1QNVA 3AHXA 3TTEA 5A2AA 5CEWA 3CPRA 2OTDA 3HU7A 3KVMA 4HTBA 5HPCA 2WXDM 1AMYA 3G24A 3OZMA 4KFNA 3SZ8A 3E2SA 1LG1A 3OOQA 3N19B 4JTEA 2J7DA 3C2FA 3PR2A 3MHUA 4MOZA 3WDPP 1YDNA 4MYXA 3NAVA 3OGRA 3BURA 3W1MA 1HL9A 1C93A 1HQTA 3HMCA 3IRSA 3R4IA 2QAPA 1FRBA 4OUIA 1S3TC 2OODA 2WAGA 2OFJA 5EYWA 2GVEA 1UZHA 2ZA1A 3VKBA 4US6A 1HKKA 4IP7A 3R6IA 3KHJA 1FHVA 3QV6A 1XGDA 1XCXA 4AYSA 5A6SA 3TH6A 5A6JA 4DWDA 2X7WA 3L4XA 5AC6A 3IJDA 3EX4A 1B30A 5C54A 4XISA 1F61A 2I5GA 1Q66A 5FJJA 2HTMA 2QCNA 1LT7A 1JULA 3TQPA 4JR5A 4GHRA 1QCWA 4GNVA 1AL7A 1CGTA 4GYPA 4ERAA 4B15A 3MKCA 2GGJA 1A5UA 1I2QA 4ZFMA 1DWAM 4ZMGA 1HW6A 1SZRA 3STPA 5ABHA 5U7SA 4B16A 1HJSA 2YZRA 4JQ4A 4TUFA 3KDOA 3QR1A 4S39A 1R30A 1ZP3A 2ZYFA 5A6KA 1GOQA 4JYDA 3IIOA 1AH0A 4ES4A 2EF9A 4AQLA 4RNHA 2PBOA 5JIWA 4K1GA 3HGRA 4GYFA 1EUNA 3ES8A 4L64A 2E68A 2HK0A 4MWAA 2BHZA 1OX6A 4QQUA 1G1YA 3APGA 9RUBA 2GOUA 5HOSA 4Y7EA 4B91A 4KRZA 4FALA 3S5SA 1JXKA 1ADSA 1PKNA 5AYXA 5CBIA 2J75A 2ZX5A 4HZ8A 5BCAA 2GK1A 3QC0A 4FX7A 1QOXA 5IBXC 4E3VA 2I1OA 3GU9A 2E4TA 3HF3A 4IJRA 3UCDA 1F3XA 4QISA 3W7OA 4OQVA 2GJRA 1EJSC 2Y88A 4PUNA 1TQJA 4W7WA 1OABA 3Q45A 5EBAA 4NZ4A 1E4NA 2WKGA 1XI3A 2VXNA 1AJ0A 3L66A 1FCVA 3TN3A 5HMFA 4DWSD 4YLWA 4REQA 3SM0A 4GUHA 2O7SA 3NPVA 1W9UA 4CUCA 1A5NC 4JEJA 2OJPA 3MB9A 1N2VA 3R8RA 4IUGA 4I90A 3CLWA 1ZAHA 3R0KA 4L4LA 1F7BA 4PUEA 1DVJA 4MG4A 3BLPX 3T40A 3MUZ1 3MP4A 2BBFA 3EGJA 4MM1A 3M9YA 4JFTA 3CQHA 4G7EA 2F61A 3TFCA 4XV0A 3S1UA 4F2TA 1D3HA 1H41A 4Q8OA 2YLLA 3UWEA 1JYWA 5LHEA 3W1AA 3ZLFA 4WXZA 2JALA 1B90A 2D2HA 3P74A 3QC3A 3VZZA 4HA0A 4O11A 3SN4A 3OVPA 1V6UA 3PWIA 4DUOA 4IX2A 6XIAA 2FZMA 1FH9A 4BKNA 1YKWA 3OEXA 4EF8A 1TV7A 1TMQA 2PF0A 2P50A 1H7WA 4GLEA 1EIBA 3BGGA 4AD3A 3ZT6A 3LCIA 4H8UA 3MKKA 4LVBA 1Q6FA 1GTEA 1MUMA 2P3EA 4LNCA 4NASA 2HPMA 4J9JA 4RK8A 2E6DA 4B5UA 4DELA 5EPDA 1KFLA 4F0HA 3Q94A 5M2FX 1W3JA 1NWSA 2YDQA 3QF0A 5AC8A 1KCKA 1ECQA 3PBUA 1LDCA 1RJRA 3WUFA 4W89A 2GQ3A 4D6IA 4QP0A 2XGZA 2XZ7A 4UCGA 1E6SM 2X7VA 2Z1SA 1TCDA 1BF6A 5XIAA 1OFAA 4GE8A 1A0EA 4QBXA 1U83A 1UCWA 2JGYA 2F38A 1KKRA 5HWMA 5HUPA 2PU0A 3DFHA 4EPEC 4DYJA 2WCSA 1X6NA 3WQPA 3FEQA 5A2BA 5FJUA 1VKFA 1TVLA 2F84A 1DJIA 2Y85A 3ARZA