1TMLA

Crystal structure of the catalytic domain of a thermophilic endocellulase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
286
structure length
286
Chain Sequence
NDSPFYVNPNMSSAEWVRNNPNDPRTPVIRDRIASVPQGTWFAHHNPGQITGQVDALMSAAQAAGKIPILVVYNAPGRDCGNHSSGGAPSHSAYRSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQQEVLETMAYAGKALKAGSSQARIYFDAGHSAWHSPAQMASWLQQADISNSAHGIATNTSNYRWTADEVAYAKAVLSAIGNPSLRAVIDTSRNGNGPAGNEWCDPSGRAIGTPSTTNTGDPMIDAFLWIKLPGEADGCIAGAGQFVPQAAYEMAIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Beta-amylase
molecule keywords ENDO-1,4-BETA-D-GLUCANASE
publication title Crystal structure of the catalytic domain of a thermophilic endocellulase.
pubmed doi rcsb
source organism Thermobifida fusca
total genus 102
structure length 286
sequence length 286
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 1993-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 1tmlA00
2BOEX 3A9BA 1UP0A 1UP2A 4AVOA 3VOJA 1GZ1A 2BODX 4B4FA 4AX7A 1OCNA 1DYSA 1TMLA 4A05A 1QJWA 1UOZA 3VOHA 1OCBA 3A64A 1BVWA 1QK0A 2BOFX 2BVWA 1HGWA 1HGYA 1UP3A 3VOIA 2BOGX 3RPTA 1OC5A 4AVNA 3RU8X 4B4HA 4I5RA 4AU0A 1OC6A 3ABXA 1OCJA 4AX6A 1QK2A 1CB2A 4I5UA 3VOGA 3VOFA 1OC7A
chains in the Genus database with same CATH superfamily
1GVEA 2ZRYA 3MV01 4ZE4A 1HKJA 3G1SA 3M7WA 1GG1A 1W3KA 1GJWA 4S1FA 2POTA 2E6AA 3NA8A 1YXCA 1R3SA 4MY8A 1Z8AA 3MCNA 3QY6A 1XSJA 3NQ6A 5K3VA 5D9MA 8CGTA 3L23A 1MRQA 3PFMA 1PHWA 4L9ZA 5H8PA 3B4UA 2Y5SA 3ABSA 3EWYA 3CIXA 2FZMA 1R3TA 1KM2A 1DE6A 1M3UA 3W29A 3H2MA 2D73A 2I14A 4GE8A 4MAZA 2FPTA 1MSSA 4YNGA 2QMKA 2QEZA 2O4MA 4QX4A 1E4MM 4IIFA 5DLCA 4TX8A 1W9BM 4UUIA 1NF0A 1ICPA 1C29A 4ES4A 3DDMA 2C1IA 2QNEA 3B8VA 3WMSA 4EPDC 2QV5A 1VLIA 3GVGA 4NYYA 4B3LA 2WMKA 1SSDA 5FEPA 2ZXAA 5LIUX 5DF0A 2G37A 1UD5A 2NSOA 3N9KA 2REQA 2V69A 3E38A 1JZ3A 4DB7A 4PMDA 3CHVA 2NX1A 3WDIA 1F6YA 1FWEC 2CFFA 4MB1A 1LOSA 4GH1A 3DEQA 4DJED 3TROA 5BMWA 4CCEA 3SN4A 1HIZA 3IJ8A 4XD5A 1BWKA 1FCVA 4PGLA 3TZFA 1DQUA 3UU0A 3TX9A 1BF6A 3WQ6A 4YYCA 4IGHA 4KWOA 2WSPA 2W6RA 3M1ZA 3UG4A 2CBVA 1PHQA 4O1EA 2WVVB 3OLDA 4Q33A 1R3RA 1AQFA 2DP3A 3WJZA 1JIBA 5IDZA 4RDWA 3PBWA 1U33A 4UTWC 4MY1A 5FI8A 4WDTA 2Q3RA 5LZLA 1IYXA 2XU2A 3T0AA 3AAMA 3BPWA 2V5CA 2J8TA 1MZHA 2ZUNA 1LF1A 1DKWA 2VURA 2G3NA 4A8IA 3TA9A 4C6JA 3VIPA 3GHRA 4U28A 3N9RA 3VE7A 4CQ9A 2C91A 3LTSA 2DJLA 4QSFA 2WC4A 5FL0A 1YTDA 2D2OA 1W3LA 3OG2A 4QQ3A 1A49A 3CAKA 2Z6JA 2PTXA 4NZ4A 1ZFJA 1EP3A 4MWAB 1A5BA 2X1RA 1A5SA 2DZBA 2VEPA 1W31A 3CL7A 2AKMA 4EF9A 2QPXA 4RDYA 3F5LA 2YCLA 4CNNA 3SUUA 3ONBA 3BG3A 4X22A 5HWNA 1YHTA 3D5HA 1W9PA 2XYLA 4WJ8A 3B0UX 1N8IA 3GTFA 3GVVA 1AFSA 1TV7A 4IIGA 4EX4A 3LB0A 1J0ZA 4HN8A 1RY0A 3P80A 1TCDA 3FOKA 1ZBWA 3RO6A 3GXDA 4RE3A 3E74A 4ZTXA 3AROA 3U4FA 1NOFA 4BQ3A 1O68A 4LWWA 5A94A 3TU9A 4BCEA 1JYNA 4J7RA 2E6DA 2UZ9A 4W8AA 2VP8A 3SADA 4HD5A 2BY3A 2IKJA 1U30A 4PL2A 3A23A 3U7BA 4DF2A 3UW6A 4O1DA 3TTQA 3AICA 3CEPA 3PPCA 4AWSA 1R5YA 4CNTA 3S2MA 3N1AA 2EHHA 3KBJA 4QE1A 5E5CA 1PKYA 2HCVA 1VYRA 2VR2A 4BQ2A 2OGJA 3EMQA 2EG8A 4TUFA 2VR5A 4I9AA 3AIRA 1CX9A 3CL6A 2OYMA 3TQKA 2VGFA 2OB3A 1VCVA 1HP5A 3EWDA 3FA4A 1E6NA 4MF4A 4UFHA 3HPZA 1AMYA 1CNVA 4Q8MA 4IJBA 4ZQCA 4HZ7A 2CLPA 4Q4MA 2W27A 3UG5A 1A53A 2PRHA 3OLEA 4LUJA 2INEA 4JQ3A 2VXNA 3KRUA 4EOUA 3N19B 1Q85A 5EMYA 2ICSA 3SI9A 1ITQA 1K4GA 4IFKB 3WEOA 1U1JA 1IZCA 4M6PA 5C9UA 1M1BA 3PWAA 4KKXA 1TVLA 3VXGA 1BSLA 3WMCA 3GX9A 1DTUA 2G3MA 3QGVA 3J7HA 3VFCA 4IP5A 4KGLA 1BTMA 2W67A 1UR9A 2NQLA 5C9XA 4ML4A 1JRCA 2PTZA 1BLIA 3KHDA 2WC7A 3SCWA 2NZLA 4GZIA 3R89A 2G97A 2OEJA 2O9RA 3T0BA 3HTWA 4D6EA 4BEUA 4OOZA 3W73A 2INZA 3FSTA 4F40A 4Q3MA 4YYFA 3ARPA 4MYAA 3IWPA 4F0LA 2DGAA 4Z0JA 1TTIA 4A2SA 4GZEA 4MB5A 4C7FA 1MDLA 2QJGA 1W3NA 3WH9A 3S0CA 3II1A 2Y0FA 5AY7A 1AODA 1XV8A 1V4YA 2I5IA 4RNHA 1ZTVA 4M6QA 3S6OA 3KLKA 1OYCA 1XKYA 5DO8A 3ZVIA 1ME7A 4UTUA 3GTHA 3WNKA 3JZEA 4ORMA 4JY8A 3DXIA 2XSAA 3P5YA 5TQLA 3VM7A 1LLZA 1GJPA 1UKOA 1W3TA 2G3IA 1XPGA 1MO0A 1NWUA 2HTMA 1TV3A 4KEMA 1W5MA 3RU8X 1XFCA 3C2EA 3B8IA 2OKOA 1Y0EA 7A3HA 1JFHA 3QHMA 2YOCA 1XWYA 1RA5A 3WDHA 3LTYA 3S1XA 2PP3A 1E71M 3G1AA 5EPDA 4QAWA 4TOQA 1X8CA 4RCXA 1XLGA 3W26A 1UPPA 3OQEA 4CQAA 5G1YA 1HW6A 2PDPA 4C6PA 1WYIA 1XQKA 2EG7A 3QYQA 4WY0A 1BRLB 1GVFA 4PUJA 4YVXA 5FF2A 1QASA 7REQB 4LFYA 3PANA 4Z2KA 2VDGA 4L1XA 1O5XA 3UWVA 4DZAA 1JCLA 3PZVA 1J0YA 2CLHA 4H8NA 2ZX6A 4C5ZA 3EXSA 1LWIA 3F4VA 2VZUA 2OTDA 3EA3A 3UG8A 5C9WA 2E09A 2WSRA 1JPMA 3L4WA 2HNHA 2YL8A 4AY7A 3CZ8A 4ACYA 1BYDA 4LUSB 4ICCX 5I78A 2GWGA 3ZS4A 1JQVA 1MEHA 3KE0A 1VEOA 3KX6A 1TIMA 2KZHA 4H2CA 2CITA 1NWSA 1UP3A 3F1QA 2A0NA 4ZO8A 3WUFA 4DVOA 4NKCA 4GQ0A 3MSGA 1DQWA 2ZUMA 2HEJA 3AI0A 3Q67A 1XUZA 1HG3A 1E5JA 1SO3A 3E0VA 3RJYA 3PUOA 3RAOA 1RZMA 1OCBA 3GZ3A 1ECQA 1FCBA 1LL7A 3QFWA 4O14A 4LUTA 1KKOA 2GVGA 4DYJA 2E8YA 2GPTA 2A3AA 2BY0A 1TTQA 1J11A 2PPGA 4JKMA 1ZRQA 2ALDA 1T7LA 5FIPA 1FWSA 1OFQA 4MTVA 1CTNA 4M7TA 4U5IA 2GUYA 3O6DA 1PKMA 2G4JA 3KXQA 2VFHA 1D3CA 4DBDA 3I3DA 3DG3A 2Q71A 2ABAA 3VVGA 4B5VA 3KTCA 3FGCA 2O7SA 2WMIB 3PG8A 1RR2A 2BY2A 4AMAA 1BXBA 5C6MA 3F5KA 2OO0A 4UTHA 1X96A 1JVNA 4F0HA 3IIZA 2J7BA 4JQAA 5FD0A 4JTHA 1QI0A 3O0FA 4PA8A 2PDLA 3TH6A 3KVLA 1X1OA 3UVAA 1W9VA 1VF8A 2ASHA 2E7FA 4C6BA 3A21A 4ML9A 9XIMA 3T4WA 4JIHA 5CG0A 1BWVA 4AZIA 2YBTA 1WE5A 4FP1A 5LXEA 1MWOA 1JNDA 1V3JA 1FWFC 4PBGA 3SQLA 3BJFA 2CEQA 4OBSA 3TJ4A 2YJQA 4AZ7A 5HA7A 4X60A 4KWVA 1OX5A 4Q4RA 1QWGA 1BAGA 4F66A 3OZOA 1LTDA 1UP0A 3G8EA 4XX6A 3S5YA 4GFSA 3KHJA 1UIPA 1QU4A 3QV7A 3CH9A 4I7UA 1GQJA 4Y6GA 4LPCA 1QJWA 2D0GA 7ODCA 1X97A 3A6OA 1W1B1 4GOAA 1EQCA 1YNPA 3EWBX 1QW9A 1B0IA 4QLKA 3ARTA 2W63A 2CKSA 1BF2A 2PTWA 4IIEA 4E8CA 4Y9NA 4PCFA 3WBAA 3F2BA 4R34A 3CUGA 1GVSA 2GK1A 1XUUA 3FK4A 4NNBA 3DGRA 2ZZ5A 3O6YX 3NQEA 1OGSA 1XBYA 1NDVA 3PN8A 3VK5A 4V33A 2C18A 1ZJAA 4AQLA 3LCHA 4DWSC 2HJPA 3UBPC 4GUGA 3DZ1A 5BXPA 5CSYA 1W5OA 3PC0A 1Q2RA 1NH6A 4AZGA 5JVLA 1F76A 3MANA 2R8WA 2HBXA 2ZZ3A 1QFEA 4YWSA 4FNTA 2QF8A 1Q6LA 1LG2A 1CYGA 3M5XA 4Z1AA 3LZ3A 3ONCA 2RDUA 1QNRA 1V6XA 3QZ6A 3AMLA 3TSDA 4QQUA 5I3DA 2HSAA 4NY2A 2BODX 4JHOA 4AC1X 3NGJA 4N4QA 4PYSA 1LLWA 3E5PA 4PSPA 2V5DA 4Q4QA 3RFAA 1VENA 1QAPA 3W7KA 2ACQA 3QYSA 3OEXA 2VJXA 1I4NA 3OZMA 2VWTA 3BMXA 3INPA 3N2MA 2GDVA 4GO9A 4MNJA 4LCSA 2GJXB 2IPFA 3E2RA 4GUJA 1GNXA 3LENA 1EJ7L 3E6EA 1O5KA 1VFOA 3VE9A 1JZ8A 3WFLA 5D03A 5BRBA 2C0HA 4F9JA 1JZ6A 4CEUC 4XZNX 3ALGA 2FHBA 3I3BA 4PUWA 6REQA 4CU8A 2NSXA 3ICJA 4GPNA 4OKDA 3BDKA 4FA3A 2VX4A 4AY1A 2AL2A 4NVTA 3BMVA 1AQ0A 3FY1A 4I5UA 3L4UA 4E2DA 3GDLA 3HGOA 4GY7A 3MA8A 3N4FA 1E5NA 1RUSA 4H8VA 1CWYA 4KCWA 2QCMA 4C6KA 4ZE5A 3SUVA 1UOZA 4JTGA 3UWEA 1FRBA 3GVRA 1WDDA 1I9CB 2QCLA 4KETA 3I68A 1EX5A 2C16A 1K6AA 1ONXA 1LT7A 3C3UA 1MNSA 2F6UA 4R9OA 1A4MA 3V36A 4O1AA 5FF3A 2QJIA 2V5LA 3EB3A 3PZNA 4IPIA 3BANA 1W54A 2UV8G 1E4IA 2YL6A 1DJXA 4LUIA 4GISA 4E4UA 2JBMA 4C60A 1G4EA 1K7FA 2VDHA 1NF7A 1YYAA 3G0SA 4FX7A 1HJSA 3WX7A 1P0NA 1RSCA 3LERA 1ZJHA 3QHNA 3MYOA 1HNYA 3W7PA 3PJTA 4WKFA 4I9JA 2JALA 5BOFA 4PMRA 4QISA 3B4YA 2XN1A 2WZIA 3NEVA 5HNUA 1E6ZA 1AJ2A 2FYMA 3BOLA 3KBSA 4JTEA 4A3RA 5M1TA 3CIVA 3AIWA 4YN5A 4AVFA 3MJMA 1MEIA 3UJEA 3C8NA 3QOKA 4ZB5A 4MDOA 5HDRA 2AQVA 3SEPA 1J18A 4GYJA 5I3HA 4O11A 1BXCA 3U4AA 1REQB 3AOFA 3HGRA 1S1PA 4RKAA 1SU5A 4KIRA 2DH2A 3LI0A 3RR1A 1FH8A 4JQ4A 2DIKA 5M3WA 1QRQA 3A4XA 3M0JA 2V6AA 3ANUA 4ZEPA 2VRJA 3MMWA 4WIWA 2O92A 4D8AA 2D2JA 4S23A 1LT8A 4AB4A 1W1VA 2ZXDA 4HMCA 4CCZA 3R0KA 2J78A 1VEMA 1GORA 4P8VA 2RDTA 3ARUA 1FHDA 4PTNA 2E9MA 1V03A 1PUDA 2OPJA 3DCPA 4QJ5B 4RJEA 4FB7A 3BLOA 2QJJA 1GOKA 1XGEA 1W5NA 4L65A 4NG3A 1UH2A 5MHBA 5F4XA 4BR1A 3WQOA 4YXGA 3ZWSA 4G56A 4QBXA 4ZO7A 4P7LA 4X9YA 3H2FA 2X2GA 4HK5A 3CV6A 3GAYA 3JU2A 3KFTA 1JPIA 3TE9A 3DFYA 4DO5A 1X6LA 3P7YA 1PO9A 3GD6A 2WHJA 3CJPA 3E49A 5TD4A 2W91A 3AALA 4J27A 3GY1A 1C8QA 3LLFA 4C65A 4H83A 3BZJA 3EAUA 1R86A 2FFCA 4ZXLA 1WDWA 1EC8A 1FTXA 5T8GA 1IR2A 4PB5A 4XV0A 2ZVIA 1Q6FA 4Z0SA 2HK0A 3IIVA 1RCXB 4JN7A 5BYWA 1HGYA 3WH5A 3GXFA 3M64A 3DOPA 2GJLA 3ORWA 2W66A 5EKYA 3CU2A 4GWEA 4MMWA 1VFFA 3N25A 1RQBA 1KBJA 3LQLA 2E25A 1R9YA 3NQFA 2P50A 3KCOA 3G1HA 3M5ZA 2YYUA 4KBXA 1XYAA 2GGJA 1UH4A 1VAHA 2ZZ4A 4XWUA 9CGTA 3D6NA 2YL5A 2HRWA 3K4AA 2ZTJA 4JTFA 4ACZB 1J12A 1E0VA 3WF2A 4BI6A 3KRBA 1JCNA 2PTDA 3SFWA 2IMRA 1YBQA 3K1GA 4WRHA 3VKKA 1L2UA 4JXCA 4LRSA 1RJRA 3GNPA 3IIPA 3U2ZA 3F5JA 2OYKA 3VUPA 4H04A 3LU2A 3W6MA 3POCA 3UA3A 2R14A 2Z1BA 1O95A 2PC8A 2WVUA 3T78A 4S3KA 4FX6M 1DJZA 1OHLA 4C6QA 2OOFA 4NILA 2E0PA 4HMNA 4CD7A 4C90A 1FXPA 1AD1A 1F8IA 4UTIA 1XRVA 3CM4A 1ZENA 4K8EA 2JKPA 4NASA 1BYBA 2WSQA 1A47A 2XGIA 3WEMA 4HT3A 3KOYA 1TJPA 3B0PA 3B04A 3NQBA 3VKJA 3W7CA 5BU6A 4KRZA 3C0SA 2JK2A 1YMYA 4F48A 3SCOA 4GLEA 3ZT6A 3AXKA 1TJ1A 1TV4A 4JL2A 5GJMA 4KESA 3PTDA 3RX3A 5C2XA 4XZHA 1E72M 5C7VA 3PAJA 2E67A 3KL5A 3MMDA 3TN3A 1QNQA 2TSYA 3UXIA 4RE2A 2EQDA 4IIHA 1EGZA 3UYCA 1VD6A 1LJYA 4X9SA 3QQWA 5CLWA 1JYVA 1GZGA 5H1WA 3N15A 5DT7A 1VQTA 1OFBA 1V8EA 2ABBA 3M46A 3PTKA 3SGZA 3TP4A 2Q01A 4AIBA 2QF7A 4BF9A 3N6HA 3CT7A 1WXJA 4IT1A 2OVLA 1OYAA 1XLJA 3LXBA 3FS2A 4QS5A 1Q6CA 4QGCA 3WEZA 2FZDA 4M51A 3QMTA 4WHBA 1VEPA 4OZOA 2NVCA 1H41A 1WZKA 1OB0A 2CYGA 2CBIA 2WKGA 3AS2A 2PUZA 1J0KA 3I10A 4UNKA 1GUVA 1ONWA 3G1DA 1G5AA 7TIMA 4FXJA 4I3GA 4C1LA 3ATYA 2BTMA 2X0YA 3TQPA 1EA0A 4I7VA 4YL2A 1AW2A 1KW1A 3GG7A 4JICA 3ARRA 3SURA 2V3GA 1O6IA 2YCEA 3U5YA 5LGZA 2D24A 1HVQA 4FS9A 2J62A 4PTDA 1JZ7A 1D3HA 3LCWA 4NI8A 2VI0A 1ENUA 4YTRA 1HL8A 4QM1A 3AFBA 4UTMA 4AD2A 2XFRA 3M0IA 4N9EA 4LVDA 4V28A 1JUEA 1QPKA 3GWQA 3FNDA 2INFA 5A6LA 3WQPA 1CGXA 3TV8A 2IXVA 5BXRA 4CVUA 3KS6A 1IEXA 2VOMA 4MPQA 4KEVA 1LBLA 2FTYA 3LXCA 1DORA 3BUVA 4XZIA 1C92A 1ELSA 2IKIA 4WDWA 3W71A 5AHNA 3UY7A 1V93A 4C91A 5FOOA 2UWFA 3O6CA 4CQDA 2G8ZA 3ARZA 2DVUA 1TMLA 4JTCA 3M0XA 2OT0A 3W3OA 3MW7A 3QGAC 2R1PA 2PF8A 4WF7A 1W56A 1XLBA 4UCGA 5IDIA 3PWIA 3S1GA 4FAMA 1AW1A 1V51A 3EGJA 2G50A 3N13A 2DW6A 1GKRA 4ZFMA 4DF1A 1FWRA 3WZ0E 3MYPA 3Q4DA 2QCFA 1EP2A 1OD8A 4CNUA 1WOBA 2VUYA 1AL8A 5DELA 5T91A 2EJ1A 5E09A 1GHRA 5FJJA 2Q8LA 1W1ZA 3T0CA 3WQ8A 2D0FA 3EX6A 3QBUA 3NQMA 1H7WA 2H90A 2ZUWA 2PURA 1J8VA 4O52A 5HINA 4RL3A 4JYEA 5HWJA 4QAIA 3IRDA 1ONEA 4GQQA 1DP0A 3R6IA 2G96A 2NWSA 4H9ZA 3R8GA 2GGGA 3FDKA 4U5KA 2E3ZA 3BOFA 3NSMA 3TC7A 2CWNA 2OQYA 2V8ZA 1EEPA 3RRXA 1IXNA 4JNZA 1SJAA 2PD9A 1LCOA 3VDHA 3SIZA 1TPC1 3OQ8A 1XIGA 3LOTA 1JR1A 3W2LA 2DSKA 3WMBA 4DELA 4HTBA 1L9WA 3W1TA 1PX3A 2NXIA 1J6PA 1H7PA 4HGXA 3WLIA 4H9XA 4HPGA 1EDTA 3UGRA 1E70M 3N17A 4GVFA 3WLLA 2D69A 4NIRA 5IBXC 3CQ0A 4MADA 2DDXA 1NJJA 2Z29A 2V38A 2Y89A 4US6A 1UA7A 4LT9A 5AB3A 4BI5A 3MUAA 4L1WA 5H2ZA 4JN8A 4GZJA 4OTKA 3TW9A 4F3HA 5HR7A 4LY8A 3NTYA 2X1SA 1JQXA 1SJDA 3ABOA 1C7SA 3UG3A 2Y8KA 1RH9A 4W7UA 5F2GA 3GUGA 3CBWA 3L4TA 2Z24A 2E5CA 3M0VA 1PBGA 3BXWA 1JF5A 1Y5WA 4AEFA 4N9BA 4E0CA 5CPMA 4E8GA 2VGBA 3S42A 1J6OA 5A6MA 3GXPA 3L65A 2E9LA 3WD0A 3THAA 3EKZA 4UQCA 3W7DA 1IEIA 5DCDA 4UOZA 1ML1A 2ZUTA 1UMYA 3W1QA 3U5UA 5FACA 1SGJA 1XLKA 1YE4A 3O7UA 5H91A 2XIJA 1XINA 1GK8A 3VNMA 4WSHA 4I7WA 2Y5EA 3IJDA 4RV3A 4PMVA 3HQ1A 1E1CA 4GIAA 4GUFA 3DYOA 4WKHA 2ISFA 2WVVA 4FNPA 3TW6A 1BYCA 2A3CA 2BNJA 3LM7A 1TWZA 3CQIA 3EXTA 2DZTA 2W79A 1AZ1A 5KEZA 4OBRA 1TQXA 4C6EA 1UG6A 2A4AA 2QCGA 2QGYA 4AIEA 3CUXA 4AC7C 1T8QA 1VRXA 4YWIA 1Q7QA 4TIMA 3BAYA 3EDKA 3EEGA 3I4EA 1WKFA 3TK7A 5EBAA 3LPGA 3L4ZA 2Z1KA 3KRZA 1XRSA 4TO8A 1OF8A 3SECA 2WNWA 4UQBA 1C7TA 4W7WA 5HUPA 4E2VA 1RBAA 3H4WA 1DIEA 4B9YA 2UY5A 4Y9OA 1YPFA 4WJEA 2G3FA 3W28A 1NELA 2ZRZA 1C8VA 1CPUA 1SR0A 2XH2A 5D05A 5A8GA 2HISA 3LQGA 4CD5A 1EJRC 4ADUA 2C0AA 5M17A 3OGSA 5HPCA 4AHQA 2OMAA 2YBVA 5IFTA 2BGNE 3EPOA 4NYUA 1GOWA 4JCLA 3UT0A 1HKVA 2ZC1A 1ZSXA 1Q8AA 2V2HA 4TXEA 1NU5A 1T41A 5CC6A 1CEOA 3H6OA 1JRBA 2SFPA 4IQDA 3EXRA 3W07A 5H8UA 3THUA 2WZMA 2P3EA 2W62A 3GC4A 3ZR4A 4H6RA 5AC5A 1V08A 3FX4A 3JRKA 1JG9A 4MJ4A 1TZZA 2CLKA 1EZWA 1V3HA 4LYRA 2XFWA 3CZKA 3QSTA 4C7DA 5D2WA 1M03A 3JR2A 2GDUA 2HVOA 4HHHA 1EPVA 2OGYA 2PEVA 5A6SA 3DESA 1DJIA 3VCRA 4IPLA 4XAPA 3UPWA 4UQ9A 1IF2A 5AHFA 4TX9A 3DKLA 4A8RA 1Z7AA 2DQWA 1VKFA 3KDOA 4FNRA 4EXAA 1WZAA 3HFYA 1OFOA 2DY3A 4MM1A 3H2CA 1K9EA 3GIYA 5DBTA 4GVHA 1VP5A 1XPYA 1ZJIA 2FPVA 3M41A 3WLNA 1KWGA 5JH1A 3UNTA 3ITXA 1IT7A 4AWEA 1XJBA 3DHDA 2NX9A 3S9ZA 1S5VA 1G1YA 3GG1A 3RILA 1XD1A 2PMQA 1GG0A 1E51A 4PFMA 1LRNA 1OFEA 3NOYA 5B80A 2G41A 2C19A 3R43A 2AKZA 3K46A 1ISZA 3ECQA 3PB2A 2DH3A 1TE1A 1TPVA 4Y7EA 1JD7A 3VO0A 7XIMA 4XTIA 4AD4A 1VZWA 3ABQA 2Q09A 1LOQA 2J27A 3ZFHA 4UFMA 2V2CA 3AIQA 5LXXA 1VFSA 7PTDA 1G01A 2OLAA 2XSBA 3FIGA 3ZVHB 1M01A 2PS2A 1MW1A 4GQRA 3V5OA 3STFA 1Q4NX 3GKAA 3SCPA 2MNRA 3IS4A 3HPXA 2FGLA 3G0UA 1Q66A 3RX4A 1Y8BA 2WMGA 3R10A 3LCFA 3HQOA 5PTDA 1RJQA 2AGTA 2DIJA 5MF5A 2TODA 4GJIA 1HJUA 3SO7A 3UR7A 4O1FA 1XLAA 2VQTA 1Q65A 2QCNA 4Y9AA 2VOTA 1QT1A 1NEYA 1ODZA 4UTJA 1W1IE 4FIRA 4AU0A 4TVDA 2VDIA 3C4UA 2OKTA 3A3HA 3P93A 3GYCA 1KM6A 3HPFA 4M7SA 4F0RA 3N4EA 2YA0A 5HMEA 1S5NA 5GNYA 3GBDA 3WN6A 5DRCA 4G7FA 3MC5A 1TJ2A 3TC6A 4V2XA 2XTKA 2QT3A 1S2VA 2HE5A 3W02A 2WM0A 1TA3A 4P8XA 3T9PA 4G6CA 3LMZA 1YXYA 3G1XA 3EZ4A 5D37A 3G8RA 3A9IA 2Z2BA 3N2OA 3APTA 1XYFA 1BRLA 2WAGA 1OC5A 3PUGA 1RALA 1WDSA 4PMOA 1W17A 4K38A 3LHYA 1F07A 1C93A 2W0UA 3A9BA 4NHVA 1HKIA 3BG5A 1MMFA 5G4WA 3LRKA 1R46A 3WSUA 2PBGA 3EKGA 5FJPA 3RITA 1E55A 2FVKA 2PWFA 4CGTA 5CJ5A 2D3LA 1XIEA 4MWAD 3O05A 1H62A 5AYYA 5IFPA 3DKJA 1FQ0A 4REQB 3CV7A 1NP0A 3O0KA 2WO5A 5HQMA 3NEHA 3M6YA 4LUSA 2FLIA 4YTSA 4W7VA 3PTQA 5EA9A 2QMJA 1WQ5A 5ABEA 3CASA 2R1LA 4NZ3A 1A5NC 3F4WA 4DO6A 1VFUA 2OODA 4O0QA 5AVHA 3CZEA 4IUGA 1G69A 1QPOA 2F2HA 5TAOA 2YKKA 4JKKA 4OIFA 1E3XA 2XINA 3GFZA 1FKXA 4IUOA 2JGYA 1BEUA 3PBUA 1UROA 2ZE3A 4W89A 2X1UA 3MMTA 1EFZA 4HQVA 3VZYA 3VKAA 3GAKA 1P1XA 3HPAA 3E96A 4XO6A 4EPKA 3W2UA 1OWQA 3WQ5A 3FLUA 1GOIA 2VENA 2ISVA 1ZCCA 1GZJA 5JIWA 5DXXA 4D9PA 1AH3A 3VKCA 5HAOA 1GVQA 2QUUA 3LA4A 3CL8A 3HN3A 1L2QA 3CWOX 4G8TA 1CLXA 3S4TA 2YCIX 3CGTA 3GO2A 1FP8A 5KSWA 3GU2A 3B3DA 4Y8FA 3FSUA 2GVYA 4NSBA 7ENLA 1XBXA 4AZ5A 1B1YA 4RNJA 2H3DA 3ARQA 1TX0A 1GW9A 2WMIA 5GJPA 2XH4A 1WDQA 2FJUB 2XN2A 2ZTKA 3QMRA 4ZB0A 3TLLA 3W4RA 1KFLA 4B5UA 2VCAA 4OVXA 2WHKA 4HCLA 1HZYA 2PBOA 4E4PA 3TNBA 3RCYA 1IZKA 4HSHA 1AD4A 1FWNA 5DFAA 4G5DA 4HKPA 2PZ0A 2BOEX 2HXTA 4C6LA 1SR9A 3FV9A 2ATMA 4ALDA 3TSBA 4JQ2A 2A3EA 1JDEA 2I17A 4KMQA 2PTYA 3DENA 5E0KA 1QBBA 3GNXA 1TSIA 4DWSB 3ERPA 3S3GA 2ZA1A 3QW3A 1FFRA 1M7JA 2ZA3A 1YQ2A 1H09A 4NI3A 3AQUA 2X0HA 1MNZA 3KOXA 2QUMA 3BLDA 3GR8A 4EWJA 1BQGA 3W7NA 4HBKA 3VYLA 2ZUSA 2J6XA 3CEUA 1BHGA 5A6TC 4GIEA 2ON3A 3HBLA 3KM8A 1JGIA 4IX0A 1CGUA 2BXZA 6ENLA 5AZ1A 3Q45A 3UA4A 1ZNNA 3XINA 1T40A 1SW3A 3TFCA 1XC6A 5IHRA 2BMBA 1KXTA 3NM3A 4IXXA 4QDWA 1F3WA 1OABA 4CU7A 4HU0A 1C8XA 3YPIA 1HKMA 1IWAA 4L64A 1PAMA 1SZEA 2PDQA 4OE7A 1IV8A 2QPUA 1OYBA 4LXFA 1KGXA 3SJ3A 4CQCA 1OC6A 1KLYA 3CUHA 1B3VA 1QNPA 4FOKA 3HM7A 4JPGA 4HN4A 4TR9A 3IK2A 1UWSA 2YCJA 4WX2A 3VD4A 1QK0A 1JPKA 3QMSA 3H24A 3NGFA 5K2ZA 3R79A 3BLIA 3MO4A 1NOWA 1TCMA 1WPCA 3C61A 3E2SA 1R6WA 3CHDA 3SRFA 2XM2A 3MI3A 2NLIA 2E1WA 4JTQA 5FCZA 5HNRA 1FX6A 4EIVA 1GTHA 3CUJA 2DZVA 2VZTA 1GVIA 1HO4A 4HZ8A 1AW5A 4AD3A 4X2PA 1DQXA 3T4CA 1KTCA 3MQTA 5L9FA 5CPLA 2Y63A 1WNOA 2CKRA 3TYDA 2VM8A 4US5D 4ZBCA 5G2IA 4XZMX 1FA2A 1KFEA 4IOTA 4LVGA 3BICA 2A1YA 1FHUA 3BZGA 4AD5A 1OG6A 3VPLA 2E68A 2ZC8A 2VGGA 3H55A 2GJXA 1KCXA 2PSNA 4HJWA 4IP4A 4UZSA 4ICMA 3ZR6A 1F5ZA 1FHVA 2Y6ZA 1YX1A 2A85A 3CAWA 3S1UA 4XAYA 1Y5XA 3KOZA 5TNVA 3WLOA 4QROA 2RGMA 4G2DA 2IPWA 4MLJA 4GBUA 2EPLX 4XB3A 5J5RA 4HNCA 4M3PA 2TPSA 3TQ0A 2WK2A 4LSBA 1EOKA 3TXZA 3GNDA 3ZWTA 3N3MA 1KM0A 1PIIA 1XDMA 1G7UA 3VIMA 1JDFA 5I6SA 5JBDA 1OINA 3ZR5A 2XZ7A 3DFTA 3USBA 3QSRA 1A5MC 3RMEA 3P84A 3B06A 4AZ6A 3UZ5A 3TYZA 4WOQA 2QDGA 3O9NA 2BBFA 1K8CA 2WLYA 2B0MA 1IEQA 2Y8VA 3MVTA 4DNMA 1VB9A 2Z26A 3CPUA 3R0UA 2DZAA 1EO5A 4UTFA 3UZZA 3CC1A 1YLVA 2JEQA 4IMCA 1U1HA 3NOEA 3QY8A 5I3FA 4JTTA 4P7OA 4IPPA 3CZGA 3IUHA 1V7YA 3OGVA 3M0HA 4W88A 1R3WA 4CNPA 2XISA 3S6TA 4DNHA 4DUVA 2PWEA 3MY9A 1U5JA 1P7TB 4Z2IA 1L6SA 1OADA 1M6JA 1OFAA 1K7XA 4DXXA 2OXNA 1PIGA 3TJXA 4GCAA 3RK8A 3BC9A 1W1PA 4PUKA 4JY9A 4TMBA 3TWBA 1UASA 3RM8A 1GJUA 5EGRA 4N42A 3LV6A 4XISA 4OT7A 2O9TA 4RW3A 2BVWA 3JS3A 3TR2A 3S9YA 2ALRA 3AYSA 4F0MA 1TR9A 3VAVA 1PIFA 3B0VC 2XFFA 5I00A 1F2JA 2DPEA 3QR3A 1QBAA 3ID7A 3M0KA 4GI4A 4S2CA 3LCGA 4HPJA 3S2JA 4QFUA 5AVNA 3CQKA 3W1NA 4QJ3B 1XIIA 2VD8A 3I7SA 3A5FA 2ZZ2A 4FK9A 1REQA 2DUXA 3CQJA 5AHIA 1HP4A 2ZIDA 3DG6A 3BSHA 6PTDA 2Z7KA 4EVZA 2YZRA 2WSYA 1U2YA 4PRRA 1BPLB 1IT8A 2ZA2A 3MDWA 1DWGM 1QPNA 4QCFA 5JBEA 1BVZA 1NWRA 5AHEA 4I8YA 1KM5A 2NWRA 1FOBA 1ZZMA 3EOUA 3LCIA 2HXUA 3SGUA 2H6RA 1PX4A 5TIMA 1LOLA 3CUFA 2BXYA 3DIPA 4E2OA 4DWDA 4Q4KA 4FNUA 1EHNA 1PPIA 3F2CA 3EPNA 1ZBCA 1TJ0A 4ONVA 2E8ZA 2QHAA 1VC4A 3QLDA 2NXHA 1TMHA 2QDDA 4XKYA 4PSRA 3KEHA 4PTVA 1Z41A 4DPQA 1JZ2A 3OLGA 3ZLFA 4O18A 3NL2A 3T42A 3QHOA 4GKTA 2Z1VA 3KCJA 1OX4B 2CETA 1XF0A 1OK4A 3VC6A 1EUAA 2PFHA 1H3GA 3VIJA 4I9TA 1A5AA 1TPUA 4Q7BA 3SRKA 3NG3A 2FB2A 1X7FA 4LNYA 1OCQA 2YB4A 5TF0A 4UTTA 1UCWA 5K9CA 1LORA 1JZ4A 5HJLA 3VINA 3WKZA 3BSGA 3LHUA 2F6XA 1E3ZA 1V3IA 4Y9PA 3DX5A 4K3ZA 3C2VA 2BFGA 2QPSA 5CZ0A 2D20A 1EPXA 3S5OA 4NX5A 4WY0F 1LUCB 4HA0A 1TZ9A 2ZX7A 3RNDA 4K68A 3LV5A 2EG6A 1SPQA 4EXQA 3V35A 5G5IA 3G3MA 3V7PA 4BQ4A 1GEQA 4S39A 1MW0A 4H7VA 1MZRA 4ACZA 1XCFA 4PTMA 4HHMA 1FDZA 1N2VA 2F84A 4J28A 1R2SA 3QEZA 3ANVA 5EB8A 2I57A 4TU1A 1V79A 2CIPA 2J88A 3WLSA 1JCTA 3P74A 3OODA 4A05A 5U4NA 3QLLA 2OZ3A 2R91A 4PRWA 4LANA 1F74A 2GUBA 3WBXA 5CPOA 5M5DA 4RX0A 2J9XA 1VH7A 4JTRA 1MYRA 3ARYA 3NZQA 3R12A 1D2KA 3D0CA 4KCUA 4WD0A 4ZENA 5D30A 1Q3NA 4G1KA 4DJFD 4C1NA 5CXPA 1B4EA 4IHCA 3VD7A 1LL4A 3D46A 4GQBA 3EDEA 1XYMA 2PGFA 2NV1A 2PWHA 1VYPX 3RM9A 1V0NA 2DSVA 3PUEA 1ICQA 2R9RA 3AMDA 3BAWA 5HOSA 1KWKA 1H50A 2VWSA 3WH6A 3H54A 3H7RA 3WNNA 5E6YA 1G67A 2ZXQA 4LB4A 4N9DA 5A6AA 3W25A 4HJFA 3RPDA 1VJZA 1KBKA 1VPYA 1E0XA 2HMCA 3FHAA 1V02A 4DIAA 3B9AA 2PWVA 1GCYA 1TVPA 1XBVA 4KRUA 2HQAA 3ZM8A 2A7RA 3LHZA 3DAQA 3IGUA 3MMUA 1V0KA 3CHEA 1HKKA 1E6SM 4O15A 3A22A 3IJQA 2WKJA 1C3FA 3FYPA 4I6KA 1EJUC 3EX3A 1IHIA 3LXAA 4O4WA 4HTYA 4FIQA 4DAFA 2VL4A 1QHPA 4HPHA 5T9BG 2QDHA 5HR6A 4GC4A 4KPLA 3K8MA 3CTTA 3O16A 1EJTC 4UFIA 3U2CA 3BW2A 1RLDA 3THCA 4AVOA 4S3BA 3MJYA 4Y96A 4A3UA 5CSSA 1EYEA 4FXFA 1I8JA 2X8RA 2Y7EA 3I7QA 2X2YA 3NL5A 1XIHA 3OA3A 4GJJA 4GI8A 4G7EA 2Y88A 1OIFA 2ZUUA 1EF3A 3BARA 3G24A 5I3IA 1XFBA 1VFTA 2PDCA 1WKYA 4DXKA 3SSZA 3NIYA 1EP1A 2GUUA 5KTLA 1XH1A 3IV3A 4JEQA 3L68A 4FX8A 3LPOA 3PVFA 4N0RA 4IH3A 3S47A 2QXWA 2R6OA 3HZ3A 3NL3A 1LRQA 2XWDA 4GZ7A 2NVDA 4HB7A 4I5XA 2RGLA 4UB9A 2VKZG 3QPEA 3W81A 2PGRA 1J0JA 2AMGA 2C6QA 2TYSA 5GVJA 9RUBA 3R13A 4YS1A 4MB3A 4JX4A 4WSKA 2ISDA 1FWAC 2BVYA 3NJ3A 3SUTA 4DYEA 3VKBA 3W22A 5FL1A 5IOBA 3KRSA 4H4IA 1E1FA 3W37A 1TREA 4J3WA 4ADTA 2WQPA 3LMYA 2ADAA 3ATZA 5CZSA 3V0TA 5HJYA 2WNNA 4A3QA 1UHVA 3AYRA 5ABTA 1G7VA 3RU6A 4CNOA 5G2HA 3FKRA 5DEZA 5E0CA 1AL7A 4HPNA 5KZDA 3OA5A 1PL9A 2NW0A 1QNVA 2WANA 1XLLA 3GDRA 4HSNA 2G0WA 3QZAA 1BYAA 1PYFA 3F4CA 4QITA 2QVHA 1DXEA 2VEKA 3B8SA 1J10A 3LSBA 4K6AA 4UTLA 3MO7A 3IARA 3VA8A 5DN1A 1TRIA 3WK3A 1NDWA 2H9AB 3EDJA 5XIMA 3W01A 3CZJA 1KFKA 3QPYA 2ZVRA 1E1EA 3B05A 4LALA 4RXFA 1T0OA 4CNSA 1X8FA 2YLLA 1W1YA 1KCLA 2C7FA 1FH9A 1XM3A 3FJ4A 4MYXA 1O60A 3SW6A 1E15A 1NFPA 1F6KA 5DX7A 2ZRWA 2ZDSA 1RCQA 3EB2A 1H61A 2A7NA 2OQHA 4FI4A 5FEWA 1SFSA 3LBOA 2P1FA 4M8UA 2DT3A 3GHUA 4M24A 3THDA 6A3HA 5I7GA 2Q3OA 3KAOA 4FLRA 2WQDA 3H2AA 2XVGA 2AAAA 2HK1A 2QS8A 5CH9A 4CLMA 5G1TA 3FEQA 2PDKA 1PKNA 3IJIA 3VGFA 2DZSA 4CKQA 3LNPA 4K37A 3STPA 4M0XA 2ZUVA 3QPZA 4J4KA 5AC6A 2XH7A 3IGHX 3K2GA 4L9YA 3NAVA 3I6RA 1Q6DA 5FF0A 1M7PA 1R85A 4HOXA 3DHFA 1XLMA 4WY0B 5FEZA 3OLIA 4ECLA 3NZ1A 4HU4A 1UOKA 5C0QA 2WC3A 3WQWA 1X98A 3WNPA 4BJHA 3MP3A 4HHPA 1ME9A 2DT1A 4ATLA 3S83A 1V6VA 1KXQA 2TRSA 2YBUA 1GKPA 3LTPA 5BXSA 1K9DA 3WMLA 2WWCA 1O66A 1WBHA 4KWWA 1QI5A 3OGRA 1PE1A 1W3HA 4GA8A 3N2TA 5AC4A 3CAQA 2PZNA 4DUOA 4HPXA 4OECA 1EEXA 1KQZA 3OU8A 1HF6A 4L9XA 5I09A 3K8LA 3OJGA 1IXQA 3ZZ1A 1AQMA 4ZQMA 5GNXA 3EEZA 2QIIA 4XKMA 3MHGA 2QJHA 5DXYA 2GZXA 5CPNA 1Z42A 1UD4A 1SW0A 4UTWA 2FB3A 2AAMA 3D47A 3S2NA 5K9DA 3NR0A 3PUDA 3GTNA 2NQ5A 1UYQA 4Z17A 3E0FA 2F9RA 2QVNA 2Z1XA 3BSMA 3IEBA 3MZ2A 5CPQA 2E1DA 4PODA 3TUUA 3T81A 4LUTB 4DBUA 5BROA 3S5NA 2GJRA 3JVAA 4DX3A 4NT0A 1XISA 4NRRA 3VNLA 2VZVA 1IWPA 4IFRA 4HNUA 3TZNA 1UJQA 4AISA 3UESA 3M4HA 1KGWA 1ZPTA 4TVUA 3GTXA 3SB0A 4NAFA 1LM1A 5L6UA 2PDBA 1A0CA 2PDWA 4C6OA 1X7IA 4XZLX 1JDDA 3W1XA 3NQAA 3ITYA 3ZMRA 3VKDA 2J75A 4O16A 1ADOA 1RVGA 3NPVA 4XIAA 2GQ3A 3FGCB 4PTWA 2CW6A 3KS5A 1GW1A 2XM1A 5JBFA 4ENLA 1K02A 3T09A 3WENA 1QXLA 2OLSA 5EMKA 4EF8A 1F7BA 1H49A 3OYZA 4EK7A 1HTIA 4R33A 4PUMA 4ROQA 2F7FA 2EBNA 3WQDA 2W92A 6TIMA 3UF9A 3UWUA 1D3GA 2LLEA 4LBRA 2ONEA 3N6QA 3LGEA 3LHTA 5KZMA 3IJLA 3B0YA 3WLJA 4N02A 3H70A 2R82A 2B7QA 4IL2A 4KWSA 2NT1A 2YW3A 3N4AA 1W3JA 1PV8A 4AIUA 2Z28A 2QYGA 3TMQA 1JDAA 3N14A 1K9TA 3EMZA 1H1YA 1RD5A 4B5NA 4AYSA 3MSDA 1IIHA 4B4FA 4M81A 4L6DA 4QDPA 5D8WA 4DZIA 4MZ8A 2VFEA 3R11A 2HWGA 4J5NA 2X7WA 2DJXA 1YDOA 2D2HA 5DMLA 4YTTA 2E77A 1UPMB 1HGWA 2X7VA 3SBFA 5LIKX 2OFJA 5AYZA 2C1HA 3G1VA 3O2LA 2NXGA 5BU9A 2GDQA 5T26A 1JI2A 4FOUA 1UKSA 3UCCA 2XGBA 4QEHA 3L4XA 4Y90A 1PEZA 4DJDA 3DERA 2OO6A 3EOOA 2Y7GA 4X3ZA 4JFSA 3P14A 3RJXA 2X1TA 5LHFA 4ATWA 4R7WA 2FGZA 2GQ8A 1T96A 3W2NA 3VCNA 1S5WA 1I60A 3OBAA 1T5AA 4PC8A 1AVAA 4FO4A 1WBJA 4Q6JA 4E3TA 4Z08A 5LA2A 3G0XA 1SUXA 2CLLA 2CXGA 3WNMA 5AOUA 4A4AA 3H12A 5JU6A 3SFKA 1XLFA 3BAXA 1IXPA 1FWJC 1K03A 2G5WA 1XRTA 3SIMA 5EY5A 1RJPA 2Q8XA 3GH7A 3V5CA 3CTLA 3TOYA 4QHRA 3LDVA 4GJ1A 3MKKA 3NVTA 2XSXA 3KP1A 2OOGA 3LLDA 4V1XA 4J9JA 4E38A 2OT1A 2PCEA 3OTRA 3QN3A 1MQRA 1FXQA 3AHTA 5AYIA 2TAAA 4Q7NA 3DH7A 3NQ7A 4F2BA 4CCCA 2GOUA 4DI9A 4JR5A 1XLEA 2AL1A 4D6IA 4K36A 2A6NA 5CCZA 3GDBA 1E0WA 4NZJA 1CGVA 1W8SA 1XC4A 2IQ0A 2YDRA 1HQTA 3CHCA 1XLHA 3WQEA 3T6CA 1AH4A 5E1QA 1Y5VA 2VCBA 2Y5JA 3AWNA 3TA6A 2WJEA 4NAEA 3CZLA 3KVJA 1XYLA 3LBCA 1HJWA 3ZVHA 3TAKA 4DLFA 5LNRA 5J5DA 1EGVA 3IIXA 1CZ1A 4NQ1A 4JKLA 3BLPX 1B3XA 1OEPA 3WQCA 2DVTA 1SQ7A 4WGHA 1CCWB 4HA4A 5FKYA 4Q32A 5F2LA 3W74A 1FP9A 3PBYA 4RZ5A 2VHLA 2V9DA 3IJ7A 4JTAA 3T8QA 4ASTA 3OVRA 1GQKA 1AMKA 3SCUA 5DQPA 2A2IA 2XIQA 4O54A 4M82A 5EU9A 2P10A 4GVGA 1S2WA 4KQNA 4R85A 1AQHA 1VCFA 1E9YB 1O5RA 5HBFA 4TQTA 3W1MA 2WMFA 1UBPC 3V1PA 3W0KA 1YXDA 1N55A 2QUTA 1XG3A 4DUXA 3WUGA 4MKSA 2O0TA 1WCGA 3CHFA 4FPSA 1EBHA 4XAGA 3IVTA 4OBTA 3MKCA 1ZS2A 5KZ6A 3RCNA 4HP5A 5XIAA 3HPSA 3ARXA 4M80A 1PXGA 3DFHA 3WL0A 1W9UA 4FNQA 4H8HA 2J24A 5AHMA 3CNYA 1NP2A 4IF2A 3ITTA 4FOJA 3IJ6A 1DXFA 3PJXA 4FR1A 4H3DA 1JFXA 4DUWA 1A5KC 1U1UA 1SFLA 4QE5A 3OPSA 3FYOA 4LOCA 4WLCA 3PK7A 2Y85A 3NWRA 3PPFA 3C6CA 3QKEA 4XAZA 3G2GA 2FHCA 4YIWA 4WSJA 2C71A 1RD6A 4U3AA 4L4LA 1EJWC 1CW2A 2XH0A 4Q8TA 2J74A 1OBAA 4DM2A 4QJ1A 2WCAA 4MZ1A 1Q6OA 5CJNA 1D7FA 4HCDA 4WKAA 2C8NA 3UCDA 3MU7A 1XCXA 3QC3A 1WX0A 3MUXA 4V15A 4JAWA 4OU1A 4O1CA 8XIAA 2YZ5A 3V18A 4LH8A 1RY8A 4REQA 2AGKA 1TUFA 3TWAA 1EH9A 2BSLA 3E02A 1AG1O 5MKGB 2QCDA 1QOXA 4J3VA 4JOMA 4LNCA 1B3OA 4AHOA 4KRTA 2A3HA 4ZFCA 1N82A 1ODUA 1CI1A 1Z44A 3FJLA 5FESA 4UR8A 3WJSA 2ZZ1A 3NPWA 3W2MA 1BKSA 1KR1A 1CXKA 2WYSA 4IG2B 4C6NA 4JTLA 4CCDA 4BKNA 4QE4A 3DFQA 3SUWA 1GYLA 2DV0A 4JIEA 3IV8A 4I8DA 3QW4B 1YIXA 4A35A 5DMNA 1R3QA 1QW8A 3QKZA 5REQB 2PLJA 4MNKA 2HPMA 2WV8A 1TX2A 3HQNA 1IEWA 4AUBA 2YX0A 1VBUA 1S38A 4A21A 2VRQA 1YKWA 1JXJA 1C9DA 4GXPA 4WDXA 4O13A 4B3ZA 3B03A 4W8LA 1HJVA 1EWEA 1BKHA 3OBKA 3M16A 2WKLA 1KRBC 2VEIA 2XUCA 4Z2HA 1HT6A 2X41A 2PDJA 5J8LA 3SY8A 1EJSC 3OB8A 1EB3A 1OG0A 4QDMA 4V1YA 1EXPA 2OSWA 3UYIA 5I23A 4GO8A 4LYKA 4N4PA 4PBFA 4D6CA 2PDXA 4X2RA 3R8RA 5D09A 4LAMA 4KCVA 5AYBA 4HOZA 3G77A 4Z2JA 3B9DA 3IAPA 3QR1A 1I0BA 3IPWA 4PCTA 3IUIA 2WOQA 4EP8C 8RUCA 2VZSA 2BOFX 3QQ1A 2ACUA 5FAJA 3A4WA 4GG9A 3VDAA 4GCXA 1KRMA 1JUBA 3R1ZA 2Q8ZA 4ZL1A 4RZ4A 4YLWA 2ZRUA 3WQGA 2IS7A 1UR1A 2PGWA 2CC0A 2EGZA 1L0PA 1R30A 4JL1A 4YCOA 3HU7A 2CNCA 1YPXA 3UJRA 1YE6A 2PDMA 2HS6A 3EA1A 2BX7A 1PSCA 2PAJA 1SMDA 3GG8A 2CLMA 1W6TA 3UJFA 1K8XA 5HULA 4U3CA 3BG9A 4GIYA 1UUMA 4ZQRA 3AHYA 1KV5A 3POHA 1YBQB 4O57A 3W6LA 2R94A 2ZRXA 3VFLA 2JF7A 1UB3A 4LY4A 1XCWA 1GGOA 3NPXA 1F4HA 3REQB 1OGBA 2QUNA 3CMFA 1AH0A 1R0MA 3NXFA 4XK2A 2OWXA 3S5ZA 1GQNA 2QR6A 3VM5A 5EMJA 2PF0A 2EKCA 1K8YA 1M5WA 4PMJA 3OG3A 4UTTC 1DEDA 3M0MA 2CCRA 3A5VA 4TVCA 4D6DA 3BWWA 4AZBA 3BURA 3RLVA 4J3UA 3LHVA 1CB2A 1ME8A 3AXIA 1VJSA 2AQWA 3U9IA 1KR0A 5H6HA 4GNJA 1EWDA 2EAWA 4YVVA 1QO2A 3LYEA 3V16A 3R58A 3MVIA 3U3HA 2PRLA 2DEPA 1E6XM 1KD0A 2DORA 4QJ4B 3AUJA 4UR7A 1CXFA 4PR4A 3U6WA 3BMWA 4CN6A 1JDCA 4LS1A 3L12A 4EAMA 1PX8A 3BCFA 4MDPA 4U10A 3NSNA 4IMEA 3N34A 4AIOA 4Y9MA 3WDRA 3TJLA 4KEUA 2CESA 2WJFA 1RVKA 1KFJA 3M9YA 3LRMA 3OOQA 2OSYA 1LQAA 2ZOXA 4D6JA 3IVUA 1LP6A 2I16A 1HVXA 1KFBA 3QM3A 1UR3M 1EJXC 3QC0A 3URNA 3WO8A 2Z2UA 3T1GA 1V02E 3WYZA 2V5JA 4UBPC 3RF9A 1B3YA 3M5YA 1I6NA 2BG5A 4WGXA 3L5AA 1CLKA 2VRKA 3GNRA 2WMHA 3SCNA 1VLWA 1ZL1A 4B5TA 3EB4A 2XHYA 3F2DA 1LG1A 1QNOA 4NNAA 1R2RA 3UGVA 3DUGA 5CG7A 3L4YA 4IXHA 2D0HA 1KXVA 2EF9A 1NDYA 2EJAA 1GOXA 3C52A 4GC3A 2QDEA 1ZCOA 3WD2A 1OCJA 4MLRA 3TW7A 4DO7A 3GFYA 2HVNA 3BV7A 4F79A 3SJNA 2ACRA 2ZZ7A 4HA3A 2WJDA 4PULA 4E8DA 1TV8A 3UWYA 3QQ0A 3VNJA 1S2CA 3RR4A 3UQNA 4S3AA 3NO1A 4DO4A 1RA0A 3DBNA 1WA3A 2JGQA 4A3HA 3MS8A 2RJGA 1EX1A 4TMCA 4PB3A 2VMFA 4S2BA 2HPIA 5C9ZA 3VDCA 3SDOA 4AD0A 4EXBA 1DL3A 3CAVA 4M1BA 4ATDA 1UQZA 3C2FA 4R88A 4AX6A 4PFHA 1I2RA 4CN1A 5KMYA 2J7GA 5F4WA 3VIKA 4IISA 4Z1CA 1P7TA 1PZ2A 4J40A 1ADDA 1PJ9A 1CGWA 4L4PA 1H0IA 2BHYA 4BFAA 2FDMA 1JYWA 4ILSA 5LIWX 4L56A 3STEA 2IQDA 3NO5A 1BXNA 4DLMA 4YJ5A 1SZFA 1Z48A 2GVEA 1DJNA 1ZY9A 3CYVA 1CENA 1D9EA 4Y2WA 1N8FA 3CYJA 4R7JA 2WLZA 2B7PA 4H01A 3G6LA 1PTDA 3G1YA 4WOZA 1A3WA 3LY0A 2Y70A 3W7GA 1CXEA 3WQFA 3NL6A 4GYPA 3W27A 2FVMA 2ZQ0A 1BFNA 5AN7A 3WQ4A 2DT0A 2V5BA 3NM1A 4CN4A 2ZDRA 3L0GA 3TTYA 3QVQA 4DWSD 4B5SA 4MB4A 2CXEA 3WG6A 3OVPA 3Q2DA 3AO0A 3SCSA 3APYA 3EPMA 2ZADA 2J25A 5D32A 3FXYA 1JUKA 3M0LA 4UC5A 1XRFA 1V3LA 2ZWZA 2OWWA 1ZBVA 2OR2A 3ZJ6A 2PC4A 4Y8EA 3L5MA 4L7ZA 1TTPA 1L6FA 3HJEA 4BZYA 4DPPA 1HL2A 1X38A 3UVIA 4XD6A 1VBGA 2X40A 3BJSA 4PMZA 3D3AA 4PMQA 4A6GA 2F38A 1OY0A 1CXHA 1EDGA 5JIPA 4GRSA 1BTCA 1G9HA 2E28A 4KFNA 3V0UA 3PZOA 3KLLA 2W5FA 3LBMA 3S2LA 3T05A 1WZMA 1HN1A 1LRTA 1DJQA 4RK8A 1J0HA 1S2UA 2Q02A 1CT5A 4O53A 3IGXA 3CO8A 4NXSA 2X0SA 1P1MA 1R38A 1R9XA 1UD6A 1Z9AA 3BE7A 3UNDA 1LQ0A 5D2XA 2J4GA 3CPRA 3N73A 3KZSA 4X0NA 1M65A 2B7OA 3KUMA 4JCMA 4PZVA 1O12A 4HSOA 5F7UA 1YDYA 4K7YA 1EJVC 2ZFAA 4LBSA 4U33A 3S5SA 5CC5A 4WCJA 2C79A 4IIDA 3DYPA 4ROPA 1B3WA 3SQMA 3TTSA 2DVXA 5AC7A 3V4BA 2JF6A 4Q22A 3KWSA 4IWWA 1OX4A 3AHXA 2YA2A 4NJKA 1W5QA 4LAZA 2FH8A 1EL3A 1JCYA 4JTUA 3FW6A 4NJGA 4YTQA 3WNOA 5E93A 2ODOA 3CWNA 1B3ZA 1KM3A 2YFNA 3NZGA 1UWIA 4JX5A 3ZLGA 3M44A 3PJUA 5E0FA 5BCAA 4ZGYA 5A6KA 2VNCA 3KCLA 1MFUA 4ZR8A 2E9BA 2I9EA 3R4IA 4C6DA 1UR8A 2V82A 4O12A 3IANA 4ZSUA 3NQVA 2PB1A 3NQ2A 2HE8A 4QNEA 5EBUA 1KRAC 5GNZA 3KOFA 3CK5A 1UKTA 5CEWA 4DZ5A 2DUZA 3ZT7A 1LUCA 1BGAA 5A6BA 1GOOA 1QUMA 3P67A 3WLHA 2VFGA 5D33A 3AS1A 5J04A 5FA5A 3UPBA 5D2VA 2VO5A 3LHWA 3N3TA 4N2YA 3U48A 1S2TA 4Z2GA 4Q8OA 1I2OA 3UZXA 4MG4A 3VGDA 4JQ1A 1E1CB 2IXUA 4U2ZA 1UMLA 4LS0A 5C2CA 3T40A 3QV8A 4W86A 4W9TA 1L6YA 1ITXA 3UFYA 4Z2LA 2VD9A 2V63A 1V0LA 4B4HA 4ZQOA 1VHNA 3AS3A 1TELA 1CXLA 1A0DA 1QOPA 3HF3A 4INFA 4JD4A 1CECA 1I2QA 2CLOA 2Y61A 3B8TA 5D2YA 4B92A 2J47A 3PWGA 4AW7A 4O50A 3C3NA 2VYOA 3MCMA 3W85A 1E6RA 3FKKA 3C8FA 2CLFA 3QH2A 4W85A 3MZNA 1LWJA 2RHGA 1RAKA 4PTXA 3VIHA 3BQ6A 2P88A 5LIYX 2MUCA 5LYRA 1JZ5A 3VIIA 4L4MA 3UZWA 4HOWA 4O8AA 4YTUA 2X42A 4OUIA 2GQ9A 3DBPA 4XZ9A 3COTA 5A2CA 2L5HA 3JUGA 4RZBA 4NL1A 4D6FA 3IAQA 3ITGA 5DY3A 5ABHA 4MGGA 3VCCA 3IIOA 3AIEA 5G1MA 5ABGA 4W4QA 3V75A 5JMUA 1VS1A 5LKYA 1GEHA 4O4VA 2OX1A 3C2RA 1WOAA 3MUIA 3LCXA 3AISA 2PDFA 3TIMA 1XSIA 1XP3A 3SCRA 3KL0A 2IW0A 4RLIA 4AEEA 1DHPA 1T99A 3VMPA 2E6FA 4DBWA 3A12A 2PP0A 3EOLA 1E6PA 3L21A 3HV8A 3WLRA 3ZO9A 1ISXA 3WF1A 2WB5A 4P61A 4G1NA 2X30A 3RO8A 3I4KA 5LNUA 3VIGA 5EMLA 2ZYFA 3ZT5A 2VX5A 1XDJA 3P6LA 3T2OA 5IRPA 1TPB1 4HYWA 4URIA 2FPYA 2UY2A 1N8WA 4D8LA 5ECVA 4IM4A 1EYWA 4FZIA 1K8ZA 1KLZA 2O56A 1ZAIA 2DZPA 3L2MA 1QHZA 1RHCA 3AS0A 3VOJA 4XAFA 2W9MA 3TR9A 3MTWA 4LU0A 5FJUA 2D22A 3F03K 3VNYA 4MSSA 3PBMA 1W5PA 3TOPA 3E2QA 1K77A 2DT2A 3O6AA 1EGMA 3HMCA 4FSAA 4NJJA 2EKGA 2DQXA 1G0CA 3CUZA 4H00A 4H9UA 1ESWA 4EKJA 1PS9A 3DG7A 1JGMA 3LI1A 1O4UA 2PWDA 1FUYA 4O10A 5CGMA 4LC6A 3WK0A 4JHZA 1H1ZA 5EYWA 2QAFA 4DJDC 4LGXA 5D04C 3CPGA 5LA0A 1WO2A 5GPRA 1XLDA 2YDQA 3W9ZA 1THFD 3STCA 1DWAM 2QULA 4RNIA 1QK2A 1XYZA 3ZXWA 2G4FA 1BSIA 2PDUA 2UY3A 4ZOAA 3O07A 1KNWA 3TSMA 2PU0A 1DXIA 4ERAA 2VCCA 4FMVA 3LM3A 1GTEA 5D4YA 1BG4A 3M7SA 3G18A 4QCEA 4HMDA 5BZAA 1PCKA 3G22A 4JYDA 3TYBA 1ZB5A 3CUIA 3W7OA 5D2TA 3ZYZA 1EKOA 2GL5A 4IMFA 1M04A 1FKWA 3TMLA 3L66A 3V5FA 3SN1A 4PUUA 3N11A 3K8KA 4X63A 3ES7A 4IL0A 1A50A 3UXKA 2H9AA 3QTGA 1TFVA 5K9XA 2YIHA 1E9ZB 4ZZ9A 1MEWA 4LX4A 1WXZA 3SN0A 1S3TC 1BD0A 3VOIA 3P82A 1P48A 4LYPA 3SY1A 3B8WA 2ZX8A 3PP7A 4XSLA 1CDGA 5C7HA 3M07A 1SW7A 5IBXA 4AMCA 3GVQA 1X6UA 1UP2A 2XG9A 2Y24A 3L9CA 3P62A 5DBUA 5I3GA 1XLIA 4HU8A 2WNQA 2WWDA 5ABFB 2HNEA 5H8MA 1VIWA 3PF3A 2CZ5A 1NM9A 1ECEA 2ATSA 4MHBA 4XVDA 4HA1A 1ZP3A 4PMYA 3LX9A 5CAHA 1PZ0A 1Y7VA 4LB3A 1KC7A 3AU2A 1VJIA 1GYMA 1TA3B 4NZ5A 1KFCA 3UZJA 2CLEA 4PMUA 3DYMA 3VGBA 3KOWA 1B4KA 3B9NA 3BL3A 4Q4OA 2I9UA 3NNTA 2OQLA 4R7OA 2ISWA 3BAIA 5CGQA 3W86A 2I5QA 4RE0A 3MI2A 4PH6A 3W1UA 3DFNA 1X39A 4UFKA 4DYKA 3S1WA 1RXOB 3PZIA 1FWGC 1J2WA 3WLMA 1DWFM 3DFOA 2OELA 1E4NA 1PB0A 5A8NA 1PYMA 4B16A 3B9EA 3FJ6A 4M6UA 4UIOA 3XIMA 2A3BA 1R3VA 1R9ZA 1I2PA 3W7JA 2DFAA 1J01A 3PB0A 4D6HA 3W7RA 3FVMA 1SO4A 2Y62A 3DI0A 4FR6A 5LSMA 5D9PA 4XVEA 2IPGA 2WVTA 4A8LA 3P0WA 1FDYA 1UD8A 3M6DA 1X1NA 2WM1A 1W3IA 3ME3A 4JX6A 4P7QA 1FCUA 1GT8A 1SFJA 3RPTA 3AXHA 2FHFA 4PB4A 3T0DA 1MVYA 4WZHA 3O8AA 4GY1A 3GXTA 2VEFA 4XO7A 3TYEA 2PD5A 1AA1B 3MSYA 5F1UA 3RYSA 4MWAA 3AJXA 4PEEA 1TKKA 3T2QA 2NUYA 5RUBA 1CXIA 4Q8UA 3G1RA 4MNMA 1H5VA 4ZTYA 2CU0A 1UD2A 1GVRA 4BWLA 4H41A 4LVBA 4AZCB 3HIJA 1O1ZA 1V77A 1XW8A 1OVDA 3F7JA 3MWAA 3TTOA 2P53A 1H7RA 2RAGA 3ELFA 1KCKA 3RPMA 2XZ9A 4RE4A 3N2BA 4R27A 3WDPP 3H21A 3U7VA 1Q5MA 2JIWA 1TO3A 3W84A 2VVNA 3ZIZA 1FCQA 3Q58A 4ZO6A 1UJPA 2D23A 3URAA 1Q7ZA 4UNLA 1V3MA 3CO4A 4AWTA 5HPOA 3LG3A 5CJMA 2Q6ZA 5AKQA 1UZHA 6TAAA 5F2MA 1UC5A 1ISWA 2YW4A 2QJMA 3EWUA 4ZQNA 5I07A 4GXWA 4XBSA 4IGMA 2POZA 4KFOA 3HA1A 4JEJA 5C71A 1I0DA 3PZGA 3M0ZA 3F4DA 3IRSA 2VR4A 3TCSA 2BVTA 3AHZA 4ZOBA 1L6WA 1NDZA 3I6TA 3RCMA 3RX2A 1UWRA 1XG4A 3R25A 4DJDD 3UR5A 1KCZA 3TEVA 4MUZA 3GXMA 4KW2A 3THQA 1EIXA 4MAVA 4C7GA 3N29A 4IFKA 2PE4A 3KVMA 1ZQ5A 5FF7A 4KS0A 5I2UA 3T55A 2B7NA 3SGGA 3GFXA 4FF5A 4WXZA 2Z7GA 3GZAA 2Z1SA 5E70A 5D8ZA 4E5TA 2AQOA 1XX1A 2NV9A 1TZ7A 5I79A 3VNKA 2A79A 2CHNA 2GLKA 2A5HA 2J79A 5HWMA 4JDBA 3WLTA 1DWJM 4NXKA 2YYTA 4N7QA 1JXKA 3A3XA 1GVYA 4ZO9A 5A3HA 1F05A 1JI1A 1VIZA 1KTNA 3MUZ1 1YTKA 3OVGA 3DI1A 3KW3A 2YB1A 2F2KA 4IGNA 5BW6A 1I1XA 2A3LA 1TWIA 1EIBA 3B0XA 3IGSA 1XICA 1ZLPA 1WZLA 3O06A 4OFCA 4HHLA 5K7JA 3EOSA 5JQ9A 1A3XA 3GUWA 4S3JA 4K1GA 1NOUA 4AF0B 4B15A 3TN4A 1TE6A 4M5PA 3RHGA 1BVNP 4UOQA 2YCKX 3KWXA 2PDYA 2BDQA 1RQEA 1R2TA 4AVNA 3ZQ9A 5I03A 1RK5A 3B97A 2WZTA 2VTFA 5HMSA 4GYFA 1Z89A 1TPDA 4ZOEA 3PG9A 2ZXBA 3Q37A 4NU7A 4FLQA 2H8XA 2J7CA 3KTSA 2WVSA 4J3ZA 3ZJKA 3AZTA 4GUIA 4MKVA 3QV9A 4JIRA 1R7OA 1A0EA 1GWJA 3R2GA 3SY5A 3GTIA 4NZ1A 4TTUA 4ORIA 3U8GA 3LD5A 2Z1WA 2RH9A 1V6YA 5I5RA 3A4JA 1RP8A 3GU9A 1PTAA 3GXNA 2WNZA 1LWHA 1SO5A 2XVKA 4BS0A 1XLCA 1E0UA 3L0NA 7REQA 3UR2A 3DU0A 4Z42C 4LS2A 1WAWA 1VYSX 3GH4A 4J3SA 4C6CA 3PFRA 2X05A 3WD4A 3BK0A 4BK9A 1KKRA 3CB8A 2YXGA 4HYVA 2CZVA 2CBJA 4US5A 4J2PA 3M0YA 4JTIA 1P0DA 5T9CE 4UTKA 1OT2A 3T7VA 2PI6A 4FNSA 1OZMA 2PP1A 2WHLA 4CD8A 3L5LA 1DE5A 3TN6A 3WH8A 3SCTA 1F3EA 2XFYA 1EUNA 1DIOA 3NYDA 4S3FA 3A64A 5IXEA 2FFIA 3R94A 1I1WA 5G4EA 4IICA 1JL8A 1NARA 3NCOA 7CGTA 3EX4A 4W8BA 3PJWA 3ITLA 1K1DA 4J3XA 4WEVX 1OZQA 3GC2A 3HMJG 1UUQA 3VDGA 1Q45A 2BXVA 1SJCA 3FCPA 3OYXA 5LA1A 1XYBA 1MRAA 1RQHA 5AECA 1K7EA 3EDFA 3PY2A 4G9PA 1RLCL 1EC9A 3GK0A 4S3GA 4MNLA 2MANA 3VU2A 3GQYA 3VZZA 4AFYA 1Z69A 3H26A 3APGA 1E56A 2FVLA 5C9RA 2GVLA 2FTPA 3KDNA 2E40A 4BEQA 4YVPA 4HNTA 5FAGA 1TPEA 1S5MA 3HO8A 3WFAA 4B3KA 5CBBA 4LUYA 2ZBTA 3G1FA 3AC0A 2ANUA 1WKEA 2XDFA 2ZWYA 1G4SA 4B2DA 3EX1A 5CQ1A 1MXDA 3DHPA 2ZZ6A 4W93A 1K9FA 4DI8A 3E12A 1ZUAX 3VIFA 1SVDA 2GJNA 4KGJA 3WBYA 3TN5A 2Z25A 3WJXA 1XGZA 4L5ZA 5DMMA 4H1ZA 1R8LA 2Z2AA 3O15A 2XVLA 3G3DA 1SFTA 3P8IA 2BV9A 4D1IA 5MKGA 2QIWA 1EDQA 1MW3A 2CHOA 2BVDA 1Z3NA 3T8LA 3ABXA 4IZGA 3K1DA 5DRIA 1TVNA 1VFMA 3URQA 4LTSA 1MDRA 2C13A 5BXTA 1QNSA 1MXSA 5LIXX 5LGXA 4XIMA 4HNVA 5B7YA 2YDSA 3LGGA 4IG2A 4F0SA 3LZ5A 5I3KA 4YHEA 3GIQA 1IGWA 3OZPA 1DBTA 3WF0A 2NQ9A 3N9SA 4O1BA 5M03A 3E3HA 2FTWA 1TV5A 5I02A 5C70A 3W7IA 4S3DA 2PDGA 1TQJA 4GYPC 4WQ6A 5REQA 3MBFA 4XKYB 5A8PA 4XBJA 3NVDA 5AC8A 3H22A 3S6DA 1M41A 1A5LC 1G94A 2QCEA 4DHGA 4RPQA 4F2UA 2P5NA 1B90A 4DAIA 2E5DA 1LDCA 3WL1A 1N7KA 1B9BA 4KCTA 4UFLA 1CBGA 2JEPA 4RR4A 4IP7A 4AXNA 3DC8A 1GQIA 3CV1A 4BQ5A 1R7AA 3HG4A 1JYXA 1LROA 4Q7IA 2O9PA 1JNEA 1X1ZA 2QZRA 3C5QA 4GINA 1V6WA 4MKNA 5FJTA 3VX1A 1DTNA 4EANA 3GDMA 1OT1A 2XIOA 3N2XA 1O1HA 3GE7A 3SRDA 1QO5A 2RJHA 4P8UA 3W7LA 3W88A 1W0MA 4W84A 1J0IA 4U2YA 5CLTA 3U57A 1B30A 2QW5A 3BQ5A 1SZGA 4CUCA 2EPNA 1U5VA 1VPXA 4LRTA 5U7SA 4PCPA 2BHZA 3BVJA 2DZXA 3W23A 2WHMA 1F3XA 1ZAJA 4Q4PA 5C54A 3AXMA 3QOMA 2R1KA 1US0A 3T08A 1UWAA 2XJ7A 4LW7A 2FKPA 3SR7A 2I56A 2JIEA 2WBKA 1H7NA 3REQA 3WY1A 4PBEA 4QXIA 4E6MA 3WD3A 5C2GA 3BH4A 1E0TA 4HZ6A 3LN3A 4WUIA 1H7OA 4C1NB 3H4XA 3LPPA 4H9MA 1MQQA 1OX6A 8XIMA 3GRIA 1C8YA 3LGDA 2DIEA 3MKVA 4FLSA 3W7EA 4QP0A 3W1LA 1EOMA 3RIKA 4CQBA 1ISYA 3ZSSA 4LEFA 1IXOA 5C55A 1KA9F 3TQVA 2ZX5A 3FVDA 2GJPA 3BJTA 2XVPA 1BGGA 1YNQA 3HURA 5ECUA 2BHUA 2KX9A 4DJFA 3TLQA 4LAOA 2HVMA 3SSJA 3VIOA 2NVAA 4RNFA 2OYLA 2Y7FA 4NX0A 3T44A 3ALFA 5CKSA 1GPWA 4O0ZA 4Z1BA 1PWMA 4P2VA 2V2DA 2D2GA 1Z6KA 2OEMA 4XUYA 4P8WA 1XXXA 4OV9A 2YA1A 5A1AA 1PWLA 2NLYA 1WB0A 4GGBA 1K3UA 1B9ZA 5XINA 4R53A 1BQCA 1YADA 2Y7DA 3CLWA 5CGTA 4HK6A 4HNOA 3HQPA 3UXLA 3XISA 2H3BA 2VEGA 1TRDA 1QPQA 3AIUA 3GSMA 1QDSA 1J79A 4RW5A 1AZ2A 2PDNA 1QHOA 2PWUA 3VGEA 3VMNA 2P0OA 4G7EB 2J13A 3N04A 1TWWA 1DIKA 3W7MA 1PVNA 1H4PA 2QQ6A 2RUSA 2YPIA 4I90A 4JIPA 3F4NA 3AZSA 4NZCA 4XZBA 2F6KA 4AWUA 1MXGA 3LRLA 3Q65A 4QG6A 2H8ZA 1CB7B 4IGSA 5A8OA 1QI2A 3ANYA 5CSUA 3P8JA 1XIFA 1PDYA 4EAYA 2O9OA 2CZDA 4LAKA 3KVKA 3GXIA 3SZ8A 5E9XA 4LAUA 2BLEA 1PCWA 1CGYA 3BGAA 3LPFA 3AUOA 4PCNA 2BGSA 2D3NA 4I5RA 4OGZA 3AJ7A 3RLGA 4V27A 1VR6A 4YU1A 2XIMA 2CERA 2YGYA 3DN5A 1KBLA 3FFSA 4C6MA 3L67A 3WNLA 2IKHA 2BP1A 3TC3A 1SZRA 1EO7A 3D3FA 3EWXA 1POJA 3AYTA 1W91A 5G4HC 5CZTA 3M47A 1PZ1A 4P5UA 1K6WA 5KETA 3QY7A 4LVFA 1DV7A 4UQDA 1S5TA 2TMDA 2WBGA 3WK1A 1W8GA 5CZJA 4LF2A 4ZQPA 4HNNA 4QEEA 2Z00A 3WDQA 4KF1A 3WK2A 1AUSL 3R8HA 4RXGA 4H7CA 4I9MA 3IACA 1Z32X 1FWDC 3GDTA 2YLAA 1K4HA 2IUZA 3DHUA 3GNNA 3P60A 3E5BA 3MCOA 2IPJA 2WMJA 2GGEA 2QKFA 3HGJA 3VABA 3BO9A 1L6GA 2KAUC 3GM8A 5DT5A 3VNZA 1T6MA 4AY8A 1FWTA 4JFUA 1QI3A 3W38A 1HKWA 3MUY1 4U4MA 2BASA 3UXDA 4W5UA 4KT2A 3STGA 3U2EA 2I1OA 3JZUA 4R3UA 1U83A 4MFDA 4ERIA 3PZMA 4N6EA 1X6NA 3ABZA 1EF2A 2HBVA 1ZGDA 3ARSA 2V67A 4H6KA 4NJHA 3OZYA 4WVXA 2V68A 3UD6A 4HMEA 3W7QA 3B8UA 3WBWA 4GKLA 1H1NA 1ZAHA 2REQB 3RG6A 1M53A 5CPTA 1RBLA 3SM0A 2EXOA 2QCHA 1IR1A 2YL9A 2EPMX 4XSMA 4O8RA 5CSRA 3WQVA 1AK5A 4EPEC 3NUKA 5KINA 4K8GA 1WDRA 5K4XA 2I7GA 4GD0A 4AEOA 1WUFA 3GVWA 3GNOA 3GHSA 4MJMA 5FJRA 4L6HA 1GKQA 4JTJA 4N6FA 1XIDA 1ISVA 3TYCA 3TCEA 1G6CA 3U2OA 1RPKA 1UD3A 3E0WA 1XSKA 1VBRA 3NDOA 1GVOA 4ICNA 4TX6A 1U22A 2DZUA 1B54A 2QAPA 4CD6A 4LCRA 4DJEA 3CIWA 4GY0A 2XN0A 1WP6A 3C0QA 2C3ZA 4ZCWA 4L6OA 3NQ8A 5A6BD 1C91A 1YDVA 4EE9A 1TPWA 2BY1A 5KZEA 4MZYA 3PPGA 1XGDA 1FWBC 5SWUA 4M1RA 2NV2A 3GYEA 3P61A 3L0KA 3TTEA 1TPH1 1XHGA 1V0MA 3H23A 3MP5A 1UQYA 1NWTA 1TTJA 1S2AA 1VBHA 2F8QA 4L61A 3G5EA 4LJ3A 2OU4A 4O28A 3RDKA 2YCLB 3HOJA 2CBUA 5F2IA 2Y4SA 1XDLA 2JFEX 1DJWA 3BW4A 1GONA 1EZ2A 4ADSA 3RMJA 1JF6A 3VD9A 1LQ2A 5FJOA 1E6QM 4DZHA 3EBVA 1MUCA 4NAFB 4AXKA 3VTRA 3LSCA 2BOGX 3L2LA 3ARVA 4H2HA 5A2AA 4GVIA 3K5XA 1XH2A 1OFRA 1QPRA 2CZFA 4PRTA 5I77A 1YDNA 1FDJA 1H7XA 4DEFA 1S1RA 4MWAE 2FQIA 5CAKA 4ZXOA 1SZNA 2I5GA 3MHUA 3I7RA 4FLOA 3HG2A 4QR6A 4IX2A 2DU2A 2VFIA 3K4WA 1FY6A 2HV5A 5HNNA 4M6VA 1XBZA 3SCQA 2F61A 4MWAC 2ACSA 1MFVA 2PLMA 4GXMA 4UMCA 2VC5A 3H2NA 4AX7A 2E4TA 4UFJA 3MB9A 3UCQA 2NUXA 4BWLC 4PN2A 1QCWA 3PSVA 1XD0A 3GKFA 3ZSTA 1TR1A 2W4XA 3GH5A 2VUNA 4E2BA 1TWSA 3SQSA 1KQYA 4D2JA 2V3EA 1FH7A 3CWHA 4LQ1A 1RK6A 4W5ZA 1H11A 1H5YA 1P43A 4W87A 3EWZA 4L4OA 3FJNA 1FWCC 2FZ9A 4UOJA 3ZJ7A 2J7EA 1KXHA 3BLFA 1O5QA 4LC8A 1ZP4A 1J9YA 4XD4A 4JTSA 3W1RA 6CGTA 3CLMA 3P2VA 2JE8A 1A5OC 4QLLA 1Q6RA 4OWGA 2GVJA 1DJHA 3FN9A 3O63A 3DFSA 1GYNA 2RFGA 1SO6A 3BV4A 4K2SA 4QNWA 3SUSA 3GHTA 1Q13A 2P8CA 4JIQA 2B31A 4Q8PA 4I6VA 5HK4A 4JGDA 5DCBA 3CS2A 1DHKA 1LBFA 6XIAA 2ISSA 1TPFA 1VGAA 4XD3A 1KTBA 1XI3A 4Z1DA 4C1KA 4B5WA 2A6LA 2P0IA 1NY1A 5LNWA 1S39A 3S2CA 2XIBA 3HJZA 2DSUA 3V3WA 3AYVA 2YSWA 3NZRA 3EWWA 5DCEA 4IQLA 3VOHA 2C15A 5HMFA 1A4LA 1H63A 4MY9A 4DN1A 1Y65A 1VRDA 5GQBA 4BA0A 1K70A 3UWZA 4M19A 3WELA 1S3HA 4QRNA 4NP7A 3PAOA 1J5TA 2W61A 2WCGA 4OJYA 3BTNA 1LBMA 1UZDA 3AU6A 2O7QA 3S46A 4C5YA 3WJWA 5HMDA 5A2BA 4YCPA 1HXJA 1ZU8A 2ZE0A 1EC7A 3NSXA 3OO2A 1JAEA 3W82A 3UP8A 2J66A 1ALDA 3W76A 4DQWA 1G4PA 3W1PA 2WPBA 3FA3A 1YTEA 3C86A 3HG5A 4FHAA 1XYCA 4BF5A 3OBEA 3BCJA 2OEKA 4JDYA 3E0IA 4HZMA 3UWQA 3RM4A 3WDJA 2J9YA 1KM4A 2V0TA 3W00A 4IMGA 5FF4A 2V30A 3OHIA 1ONRA 4KFPA 1YW1A 1LLOA 1IZJA 3TFXA 2E5BA 3O1NA 1I2NA 4NAEB 2GOKA 2DSZA 3WBEA 4A22A 4JZ5A 1WKDA 1B2YA 2B81A 4GI9A 2EO7A 4NNCA 4XUGA 2OCZA 4GYKA 1H60A 3QXBA 4GABA 3N6JA 2OWCA 2ZRVA 4IMDA 1AJZA 3H2OA 4LEQA 1SSGA 5D38A 3FEMA 5HQEA 5AZ0A 3TJIA 2A7PA 2FZBA 3EYPA 4YPJA 1TB3A 1UWQA 3Q94A 3VGHA 1M68A 3VMOA 1BVWA 4HYRA 1R3YA 1UA3A 1US2A 2OG9A 4HVXA 4WJXA 3QRHA 4JIIX 1WV2A 2HZGA 1HJXA 5ABFA 4Q6XA 2VGIA 2BB0A 5CBIA 1D8CA 2CZEA 3EX2A 1Q8JA 2YXXA 3UR8A 1QWKA 2DZWA 4RDZA 3VILA 1E4LA 1PDZA 3NFUA 3ABRA 3KBMA 1NQ6A 3B40A 1P6WA 5C8BB 4F2TA 2O55A 4WR3A 1RPXA 2NX3A 5AFDA 3PZ9A 1GPFA 2PRMA 4J3TA 1KM1A 1PKLA 3BAKA 1TWDA 2XIIA 2E6YA 4XBKA 3WFZA 2WPGA 1KO0A 1SMAA 3UWWA 1MI3A 2VELA 3CV2A 4NZFA 2J8FA 4HU3A 3MI6A 5HUOA 3I65A 3GC5A 1D8WA 4AD1A 4IJCA 3P3BA 3RLHA 3BGGA 5FJIA 4AAJA 2V5KA 3EA2A 2VC9A 1KBBA 3TVAA 1TIWA 4MFEA 4GK8A 1GQLA 4H6EA 5AYXA 3JW7A 1NVMA 3SCVA 4WK9A 1TG7A 2RDXA 5G2WA 1F3TA 3ZLHA 4GI6A 4Q4SA 1VFLA 3BW3A 2EPOA 4GH3A 2QCDB 5IM51 1W2VA 5B7ZA 3IUDA 4B91A 3WF4A 2VQUA 5HQLA 1IIGA 4QTGA 1OFDA 3NPUA 1CLVA 3WIJA 1NTHA 4B9ZA 4H7ZA 1DWIM 5BNKA 3VC5A 1T8XA 1A80A 4NUWA 3QFEA 1JULA 3A47A 1V6TA 1JAKA 4GX9A 1F73A 4ZMGA 4F9DA 1QI4A 2QV4A 1OIMA 5HXMA 1C9WA 3OW1A 3K13A 2WXDM 2XVNA 3UERA 1QW7A 2D1ZA 4ZODA 4AZCA 2G95A 1DYSA 2CLIA 3OIXA 4J1OA 4Q8QA 4AYGA 2HDJA 3AHVA 3FXGA 1YRRA 3PNZA 2VC6A 3LK6A 3C0LA 3N18A 3BGJA 3UXAA 2XPKA 3TNOA 3PM6A 1KFWA 1W37A 4XG1A 3TYAA 4CVWA 2X09A 3UPMA 5HANA 2PA6A 3H2EA 3NXLA 4EACA 1OSEA 1W9DM 4ZB2A 3N2CA 4UMAA 1UR4A 2A21A 4WXYA 2CWXA 4IQEA 1NFGA 1VCGA 1EXBA 4ZVJA 4M29A 4DBSA 4HK7A 4POCA 2WJZA 4UCFA 3VOFA 2NUWA 3NURA 1TYGA 3W53A 5BWAA 2GK1B 2GSJA 1RBOB 2OZTA 1EQPA 3W24A 4O0KA 1MQPA 3FA5A 1ZJBA 1UKQA 4A2RA 8TIMA 3N12A 1P6CA 4AH7A 3VNDA 1Q7MA 1OM0A 3MBDA 3H8AA 4JFVA 2Z4GA 3HG3A 6ALDA 3P0XA 4E4FA 1FVPA 3VD5A 1KRCC 4PCSA 4P7NA 4ZA0A 3WLQA 3CQHA 2GSEA 5A95A 2FDSA 3C0JA 4OHQA 4HIBA 4S3EA 4O17A 1JJKA 4RZ6A 4L1GA 1QTWA 5DANA 4P7RA 5D9OA 3TYUA 3URBA 1E40A 5E9AA 1OC7A 2X1IA 1DJGA 1IGSA 1PZ3A 3S9IA 1SM9A 3WJYA 4JNMA 3K4DA 3RXZA 1HJQA 3H7UA 3MP4A 3WF3A 2PGEA 3GBEA 3UETA 3IJ9A 4JNYA 4AZHA 4AG0A 1P4CA 3KTXA 5FEXA 4BHYA 4ZOCA 3VI2A 1Q6EA 1U5HA 1JCXA 4HCHA 4H8UA 1OFPA 4DF0A 1J93A 1NSJA 3EKLA 2PCQA 5LHEA 1OCNA 2PDIA 4IPJA 3UEQA 3BLLA 4N9CA 3K30A 2QGHA 5LNSA 1JCJA 2Z27A 4PEKA 5FSEC 4PUNA 1KGUA 1KBIA 3QJAA 5D02A 4UMBA 2HS8A 3GIPA 3ZOAA 4TV6A 1Q6GA 3KBVA 4GBDA 1KB3A 1P6BA 3MWCA 4DY1A 1HL9A 3R5EA 1E43A 1W9XA 3NYZA 3E0LA 4L80A 3ITVA 3UJ2A 3EMCA 6REQB 1FFQA 1OGGA 4MVAA 1XIMA 2DW7A 4B5XA 3SRHA 1GZ1A 5CPSA 3P5ZA 2AL2B 4LV9A 3HV9A 3CT2A 5CC7A 4PMNA 5EFFA 4AF0A 3GS6A 4UZUA 2V3FA 2VX6A 6XIMA 2CPUA 1F9CA 3KBWA 2FMOA 4CQ8A 3VGGA 5D9NA 3MDUA 2PDHA 3WD1A 3W70A 3ITCA 3W1AA 3NDZA 2JQXA 1D7KA 4OV4A 4F0KA 3PHAA 4GIRA 2VVSA 4D1JA 2WSKA 4TTGA 3DFPA 4IJRA 1W32A 1QMLA 4H19A 3BLEA 5K4ZA 1ZALA 5C5YA 4B90A 1M7XA 2X16A 3WLKX 1W2PA 1NIUA 2PLKA 3H7VA 3A24A 4F4RA 1FWHC 3QV6A 4DM1A 2IQTA 3C2OA 2ESCA 4M56A 1CGTA 1E73M 1ITCA 1UW9A 1XL9A 2IKGA 5I3JA 2BGQA 3G6MA 3MUCA 1MUWA 4LBUA 3LNMA 1XR2A 5F1VA 1FHLA 1HX0A 3NO3A 3VOCA 3VUSA 3BLKA 3TAOA 4K1WA 1QR7A 1YNYA 2GYIA 1ITUA 1B31A 2P8BA 4DBEA 2J7FA 2Y2WA 4MJZA 4DJFC 1V5XA 2PWGA 3WUBA 2OSXA 1QVBA 4A3YA 1FWWA 2QUVA 2J9ZA 4X61A 1MW2A 3PULA 2RKXA 3FAWA 2P3ZA 1HO1A 5BMXA 3GLCA 2VX7A 4H9VA 2VEMA 3ES8A 4JFTA 3AMCA 2C14A 3RUBL 2WW5A 1YEYA 3RLUA 2R24A 3LEPA 9XIAA 2GWNA 1CIUA 3MT1A 2ZCGA 3OHMB 1B57A 2G3JA 4GGHA 2OLHA 4MUPA 4PMXA 1RP9A 3AMGA 4LCQA 3MSRA 4D71A 1J5SA 2HROA 2NQZA 2QLYA