1TMLA

Crystal structure of the catalytic domain of a thermophilic endocellulase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
286
structure length
286
Chain Sequence
NDSPFYVNPNMSSAEWVRNNPNDPRTPVIRDRIASVPQGTWFAHHNPGQITGQVDALMSAAQAAGKIPILVVYNAPGRDCGNHSSGGAPSHSAYRSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQQEVLETMAYAGKALKAGSSQARIYFDAGHSAWHSPAQMASWLQQADISNSAHGIATNTSNYRWTADEVAYAKAVLSAIGNPSLRAVIDTSRNGNGPAGNEWCDPSGRAIGTPSTTNTGDPMIDAFLWIKLPGEADGCIAGAGQFVPQAAYEMAIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the catalytic domain of a thermophilic endocellulase.
pubmed doi rcsb
source organism Thermobifida fusca
molecule tags Beta-amylase
molecule keywords ENDO-1,4-BETA-D-GLUCANASE
total genus 102
structure length 286
sequence length 286
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 1993-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 1tmlA00
2BOGX 2BOFX 4AX6A 1CB2A 4I5UA 1OCJA 1OCNA 1QJWA 4I5RA 1QK2A 4AX7A 1UOZA 3ABXA 3RU8X 1HGYA 2BVWA 3VOJA 4A05A 1OC7A 2BOEX 1OC5A 1UP0A 3RPTA 1UP3A 4AVNA 4B4HA 3VOHA 1BVWA 4B4FA 3A64A 1TMLA 3VOGA 1GZ1A 4AU0A 1QK0A 1UP2A 3VOFA 1OC6A 3A9BA 1HGWA 3VOIA 4AVOA 2BODX 1DYSA 1OCBA
chains in the Genus database with same CATH superfamily
1OJXA 3RJXA 5D05A 2IUZA 1XYLA 4PCTA 4ORIA 3B4UA 2OTDA 2BY3A 4O57A 3STPA 1RA5A 4GNJA 4M3PA 4RJEA 1BKHA 1CBGA 1YDVA 3R5EA 4HYRA 4LJ3A 3ATYA 1HJXA 4DO4A 4MM1A 4EPDC 1BYCA 3FVDA 3TH6A 1HUVA 4WRHA 2WQDA 2XFWA 1ZBCA 4PTDA 1UUMA 3LTYA 4LF2A 2ZFAA 4WQ6A 3TUUA 1OD8A 4UQAA 1GZ1A 2J77A 2UWFA 4BJHA 3A9IA 4NXSA 3NWRA 1BYDA 3DXIA 1BWVA 3F4NA 3ARQA 3S4TA 2ZADA 4MFEA 4AXNA 1TWWA 3CZLA 2O7QA 1QK2A 3MQTA 1T41A 1ONWA 2DIKA 1A0DA 1BD0A 3HQNA 3NGFA 2RFGA 3Q65A 5AY7A 2ZE3A 4Y8EA 3PBGA 4LCRA 5HA7A 1KM5A 2ZRYA 4PUWA 1DBTA 5DCDA 3DI1A 1V7AA 1XUUA 4LEQA 4IIBA 4B9YA 3QHMA 1TE6A 3KRSA 4HU4A 2VFIA 2VNCA 1YNYA 1QI0A 2CITA 4PUUA 1KD0A 1ISZA 3W1PA 3VU2A 1JUKA 3R12A 3DHUA 3QHNA 4DUOA 1ADOA 2AOSA 4ZVJA 5F4WA 3HV9A 2HTMA 4AZCA 2VR4A 2PDNA 2XFYA 1SSDA 5HQMA 1CEOA 3PM6A 2FZ8A 3ARYA 3GC5A 2HPIA 3W6MA 1SSGA 3L21A 5A2CA 3M7SA 3OG3A 3MP3A 3OLIA 4D6DA 3ABRA 2GK1B 4DJED 2A3EA 2DQXA 4BF9A 2ZICA 3N73A 3GR7A 3NZRA 5DMLA 1TCMA 5AHNA 1GVIA 1K8YA 2V9DA 3EDJA 5GNXA 4Q6XA 4B3KA 2X09A 1GOXA 1Q6CA 3RAOA 4UFJA 3S8HA 1MUCA 1W1A1 3GXDA 4WJ8A 1FWRA 4IL2A 3W86A 1CB7B 1P43A 3LI1A 4QS5A 3VKDA 3GC2A 3RF9A 1XKJA 4KFPA 1BLIA 4DLMA 3GDKA 5HJLA 5GVJA 1TQJA 3L66A 3U5YA 2JKEA 3WH6A 2QCDA 1V6VA 4H01A 2YBVA 2DDXA 5E6YA 2CCRA 2PGFA 4NASA 1UH2A 4W85A 2WPGA 3PJWA 3K46A 4H8NA 4KESA 1V5XA 4WJEA 2WJFA 4W84A 4LANA 3KE0A 4FALA 5LXEA 3ITGA 4R3UA 3KOFA 4O8RA 3GB6A 4RDVA 1YDYA 4GNVA 4IMFA 3UETA 5HPOA 1EDQA 1U5HA 3SQSA 3VE7A 4IJRA 3NQGA 4PN2A 3VVGA 1P7TB 3E1F1 1C3FA 1HL9A 4S3GA 4GA8A 3M0HA 1XDLA 5BU6A 4JQ1A 3O0KA 1QTWA 2BHYA 2D73A 4OJYA 2OWXA 4D2JA 5C6MA 1F07A 3AISA 3HV8A 5DMNA 3THCA 2PU0A 4N9DA 3ARZA 1J8VA 4L1GA 1EO5A 2ZZ2A 3WEOA 3LCHA 1TG7A 3UZYA 1EH9A 1A3WA 3VIMA 2QAPA 2W67A 1EDGA 4LUTA 3W1LA 2VFGA 4IUGA 2E5CA 1KNWA 5KTLA 4HOZA 2OGJA 3PG8A 3GUGA 3RM4A 2P5NA 1KWGA 4E3VA 1F6PA 1DWFM 4NZ3A 3EB2A 3KL0A 3IIZA 2WVVB 4Y7EA 5E0CA 4QSHA 3TN6A 4N7QA 1JAEA 4LGXA 1VJIA 3S9IA 2IQDA 4DN1A 3H26A 3WQEA 4TR9A 4IJBA 1LLOA 4C5ZA 1IHIA 3AIUA 4UTJA 3VD4A 3VMPA 3L4TA 1ZBWA 3HPAA 4MLRA 1Q6RA 1BSIA 1K8CA 4B15A 4GXWA 4Z1DA 3PZIA 1YTKA 4MVAA 4K68A 3QRHA 2VX7A 2X2GA 4PMOA 3L0KA 3WJXA 1ODUA 3HQ1A 1GTEA 3IPWA 4MB4A 1FDYA 1H3GA 1VFHA 2IW0A 1HJSA 3H7RA 1KRAC 1JCXA 2V81A 4IPIA 3RK8A 1G4EA 4JY9A 2VZTA 5I23A 3RX3A 1OYCA 4F2TA 3CU2A 1FUYA 3RNDA 4E4FA 3W2NA 3OO2A 1BF2A 1GG1A 3MBDA 1Z48A 3CEUA 4QBXA 3R10A 2W0UA 4C6NA 3WQVA 3IIVA 3QN3A 3DCPA 4FX8A 5HANA 1HKMA 1N8FA 3B8SA 3SUVA 3S2CA 4QAIA 4PEEA 1VBUA 3L12A 4JICA 3THAA 1Q6LA 4IPJA 4QFUA 2YA0A 1L6FA 3W1MA 4YN5A 3DHPA 4N9CA 3BVJA 1ZHAA 3GO2A 4GYPA 4IQJA 3I6EA 1ZAIA 1XFBA 2B7OA 2X42A 1KM2A 2XIMA 1EJWC 1R2RA 4IMDA 3FYYA 1DVJA 3EWWA 1AW1A 4HSNA 4AW7A 4JKKA 2CNCA 1FVPA 3BPWA 1D8CA 3KVLA 5FF0A 3ATZA 2QCGA 3WNMA 2P76A 4PODA 4W93A 3WBAA 4NY2A 4ZB0A 3NQDA 2Z4GA 4DWSD 1O1HA 3SIZA 1KM6A 4DUVA 1PB0A 3E74A 3SB0A 3CQ0A 3A47A 5G4HC 5H2ZA 3GKAA 1K9TA 1LRQA 4S3KA 2O0TA 3MHFA 3QZ6A 4XTDA 4HMDA 3FJLA 1J6PA 2WM0A 4DJDC 3NQ8A 1R9YA 3A22A 3ARSA 4YIWA 2V6AA 2TSYA 1RBLA 5A8NA 4HVXA 3AJXA 1MDRA 4YHEA 4TV6A 7XIMA 4L64A 3LCXA 1HW6A 1LROA 2XIOA 4KKXA 3JUGA 4HZ6A 4JIPA 4AYSA 1Q5MA 3O06A 4AMAA 3WLMA 4WSKA 5CSUA 4LVAA 3EMQA 1UUQA 1XRFA 5HAOA 1V0LA 4LVBA 3FAWA 3T44A 1P7TA 3IJ7A 1TPEA 3VOGA 3F5JA 3KHDA 1Y5XA 2PDMA 4R9OA 1F73A 3BG5A 4ZL1A 3LSCA 2YGYA 5BXPA 5DLCA 2PE4A 1TRIA 3HJZA 1EX5A 1C93A 2A3CA 1FWEC 1QNRA 3UESA 3G2GA 3FHQA 3TYUA 4N9BA 5AYXA 1VEPA 3CTLA 1B2YA 2AMXA 5D2TA 2C19A 2IXUA 2V82A 2FKPA 3I7QA 1HX0A 4ZOCA 4F0RA 1GYLA 5BWFA 3LXBA 2Y5SA 1TPC1 1K7EA 3DG3A 3RPMA 3MJMA 2J75A 3VNMA 4JX6A 1MEHA 2DSKA 5DCBA 2WBKA 3U4AA 3B0PA 4GRSA 3EA2A 3DEQA 3LV5A 4WJXA 5E9XA 3GXFA 2Z1KA 4JHZA 1PBGA 1E15A 1QRQA 2V2DA 2GGGA 3GG0A 3SAZA 4OT7A 1Y0EA 1GQKA 3E96A 2HPMA 4CN1A 1J10A 3K30A 4EF8A 5HINA 4MADA 3STFA 4WLCA 1TTIA 2D24A 1OC5A 1XQKA 4HHHA 1MSSA 1S2AA 4XG1A 2DZAA 1SFTA 1NM9A 1ZPTA 2F7FA 1L8PA 3F2BA 4GFIA 2OT0A 4M19A 4UTFA 4Z2HA 2XU2A 4MLJA 3G1FA 4L6OA 2E40A 3W75A 1Q8AA 1IEIA 3UWWA 2WVVA 3THDA 1MQPA 3L4XA 3ERPA 2ONEA 3PZVA 3UR8A 5IDZA 1OG0A 3L2LA 3RMEA 4UTMA 3NXLA 3VILA 2GVEA 1CXKA 1E4LA 1ZBVA 3RG6A 3IS4A 3R89A 1KXTA 1R7OA 2VELA 3CWHA 2D22A 1XLJA 3C3NA 3SCVA 4XAGA 1TR9A 4UUIA 3LX9A 3IJIA 1ITXA 1K70A 4CQBA 1THFD 5I3KA 2PDWA 5EMKA 4BFAA 4JFTA 4MPKA 2Y5EA 3QGAC 2XN0A 4IT1A 5CH9A 2I9UA 1IZJA 3O3RA 3TC6A 5G5IA 3FKRA 3N4EA 3E49A 5HQEA 6TAAA 4V28A 2GOKA 1BYBA 3CZJA 1Q6GA 4HTBA 3NDZA 4UC5A 1F3TA 2HS8A 3ZWSA 4BQ5A 1UOZA 4LWWA 5BXSA 3N12A 3COTA 3RJYA 1GVRA 6A3HA 2O9RA 3WQDA 3UT0A 2YLAA 1AVAA 4V2XA 4I90A 1EL3A 4E4PA 5G1YA 1UD5A 3MI2A 3MDUA 4Z1BA 2ACSA 2PTDA 4PUEA 1LG2A 3Q45A 4PUDA 3UD6A 3PWGA 1Z44A 3IJDA 1AJ0A 1PTAA 3OQ8A 4GZIA 3AIRA 1F61A 1PTGA 2PRHA 3BJSA 3VNZA 4ZBCA 4EE9A 2X1IA 4WDUA 4FIRA 1YNQA 1GJWA 3EOSA 4CQDA 5LIWX 2GVLA 4AC7C 1R6WA 3OYXA 5DCEA 1Z9AA 1FWNA 3JZEA 2VEIA 5FJRA 2PDYA 1E3ZA 3ZS4A 1KKOA 1BXCA 5KZMA 4RCXA 2OGYA 1B3ZA 3BGAA 4R27A 4JFSA 3QM3A 1KFJA 1VIZA 2HS6A 1VQTA 3LHTA 2WJZA 4GYJA 4WSHA 4XV0A 3C4UA 1KFWA 3W7LA 3PWAA 3TLLA 4XZ9A 4Z42C 1JFHA 4IIEA 4YCOA 2WNZA 1FX6A 1NDVA 3FA4A 4QX4A 1PDYA 1R38A 4O1BA 1RQEA 3VCNA 5LZLA 4JKLA 4IISA 1IF2A 1H0IA 4HHPA 3SO7A 2QDDA 2XG9A 3W1TA 3GRIA 3U48A 2YBUA 4HJFA 3V75A 4YL2A 1HO1A 1DYSA 4CD7A 4B92A 3AS3A 2NQLA 5EMMA 1UZ4A 1A3HA 2YCKX 3LGGA 4C6JA 4JY8A 1SJBA 2Y61A 2JK2A 3NQMA 2F84A 1J2BA 2IKJA 4GJJA 4PC8A 3KRBA 5FL1A 3AI0A 1J2WA 2PP0A 4UZSA 3ZIZA 5KZDA 3QVQA 3FVMA 2XFRA 2WKLA 4FF5A 4G7EA 4Q7BA 4H7CA 1FA2A 1T6MA 5DFAA 1E51A 4HHLA 3SN0A 2VRQA 1A5UA 1ODZA 4Q4QA 4WZHA 1VBGA 3GFZA 4CD6A 5K3VA 5CC7A 2V5DA 3TW7A 4LSBA 2C16A 4H04A 3DFQA 1ZSXA 1ZAHA 3VGHA 3BCFA 1IEWA 3UYIA 2CYGA 2ON3A 1P5BA 3MSDA 4Z2JA 4GQBA 1D7FA 5LA0A 3N1AA 5D09A 1CGXA 5AHIA 3GDRA 1LOQA 1AH4A 1VH7A 3LGEA 3DN5A 3DFOA 4E2OA 4DJDA 1UWSA 2BXVA 4CD8A 4IMAA 1FDZA 3B8IA 2PDCA 3DGBA 5H6HA 1Q7ZA 1ZRQA 3CTTA 3GG7A 1CIUA 2QF8A 4XTIA 3GIQA 3OTRA 3ICJA 3UG4A 3E0WA 3O6DA 3R4IA 4WY0A 1R9XA 4NYUA 1H5YA 4E4UA 4IP5A 4X2RA 1Q85A 1HGYA 4P7QA 3VNJA 2FGLA 4AEOA 3RMJA 3H2CA 3S2LA 4O15A 1A5BA 2GDUA 3HPZA 4IFKA 4MHBA 1RBAA 1V03A 4KWWA 3NO1A 4UFMA 3A5VA 3UJSA 3KX6A 2GWNA 1SFLA 4AX7A 4DY1A 3WJWA 2PD9A 2DW6A 2HMCA 1EFZA 3O1NA 1EIBA 3B8UA 1G7UA 3GLCA 2G41A 4OBTA 4MB1A 4N4QA 2WJDA 3H21A 2JKPA 2BNJA 4O28A 2EGZA 3DZ1A 4ZO7A 2VFFA 4QCFA 3BGGA 3PZGA 1J96A 4IGMA 4Q32A 5J04A 5I3GA 3KCJA 1EC9A 1C9DA 3ANVA 1NU5A 3F4WA 4RDYA 2J25A 5CC3A 5KINA 1QVBA 2OSWA 1JYWA 1EP1A 1FWAC 1AQFA 1FFRA 4UTLA 3G0UA 4IGNA 3AYRA 2UY5A 1M68A 3EPOA 5LA2A 1TJPA 4S39A 3CV6A 1WBJA 4HK6A 1RCOB 1PJ9A 3ITYA 1I45A 3KBMA 3TN3A 2Y24A 1XG3A 3KTCA 4JEQA 3ZO9A 3CUGA 2V2HA 3MO4A 4B2DD 3HN3A 1U1HA 1T99A 3ZR5A 3BMVA 4BI5A 4J3ZA 5LKYA 2CLHA 4R34A 2WK2A 2PODA 3DHFA 2J7BA 1L9WA 2IMRA 3B8TA 4LPCA 4QDMA 2HV5A 3D6NA 3UJFA 3ARTA 3NSXA 3JW7A 1YXCA 2MNRA 3UCDA 4O1EA 3F2DA 5LA1A 2V5JA 4Y9AA 4CD4A 2WLZA 4M6PA 3VNIA 3PSVA 4L6DA 1IQ8A 4N6FA 3RCMA 1DKWA 3APGA 5C5YA 1W5OA 3PAJA 2ZBTA 4HCHA 3W7PA 1U2YA 3BOLA 3RLGA 1HJVA 1NDZA 1BTMA 4G56A 4OTKA 2POZA 1XD0A 1IIGA 3BOFA 4S38A 1LRNA 4XAFA 4F0KA 5EFFA 1Z89A 2OZ3A 5AZ0A 4XQ6A 2ATMA 1S5NA 2R1LA 4DNHA 3HGRA 3N6QA 5FAGA 2Y89A 4GIAA 1OCJA 4MUPA 1QHOA 4GH3A 4LUTB 4ZMGA 3MV11 1S3TC 4HMCA 4MJZA 5IXEA 1MXGA 1VCGA 3CUJA 1REQB 1J18A 2YDQA 1RD5A 2WNWA 3MB9A 3GAYA 3A23A 3SJNA 3R0KA 3V5CA 3EGJA 3THUA 5K7JA 3EX1A 3LB0A 5LIUX 4WKFA 4WX2A 4DEFA 2PDFA 2WHLA 4U33A 5TIMA 1Q4WA 1XG4A 2NXGA 4Q33A 2DSUA 2AL2B 4KMQA 4H8UA 4U31A 5C9ZA 1AMKA 1V77A 1JL8A 1W3HA 1FWBC 4JOMA 1T7LA 5JUVA 3OZPA 3R13A 3PTDA 2FHFA 3MYPA 4UTWC 4R33A 3UEQA 5BXRA 4ADTA 2VMFA 4YVPA 3W87A 1QWGA 3CUFA 4WDTA 4TX9A 4AF0A 3CM4A 4MPQA 2B7NA 3MA8A 3WF3A 2QCMA 1GQJA 5HUPA 4DJDD 3OVGA 4GUIA 3BZGA 1EGZA 5DRCA 1FWFC 2YDRA 2HK1A 1DWJM 1OIFA 3GNDA 1L6SA 4FIQA 1W6TA 4I5UA 5LHEA 2ZX6A 1GYNA 1P48A 3M16A 3GE7A 1GORA 4C6DA 2R1MA 2WXDM 5D03A 2WSPA 3PBWA 1CZ1A 1UWIA 5A1AA 4PFHA 4AISA 3WF0A 4ZFCA 2E8YA 1HO4A 2FZMA 3O16A 1B3XA 3DIPA 2FHCA 4WOZA 4I5RA 4ZQNA 1PIIA 2ZTKA 3NEHA 4JS3A 3IJ9A 1HP4A 4W4QA 2BY0A 3P6LA 2IS7A 1EHNA 2EPKX 4R53A 4S3AA 4D8LA 1H7RA 3T78A 2QGYA 1XUZA 3WLTA 5GNYA 3E0LA 1YQ2A 5AHFA 4OUEA 1JCMP 2OO0A 3MMTA 5KZ6A 3IV8A 2X2YA 1V6WA 4O1FA 1BWLA 3C2YA 5DY3A 4JX4A 3MKVA 2P50A 4LUIA 3MMDA 2YA1A 2DH2A 4RKAA 3VFCA 4KWOA 1MEIA 3M0JA 1NWRA 3ES8A 4K6AA 3D46A 3INPA 4RE4A 4UNIA 1W5QA 3W4RA 4XZMX 5AOUA 2QVNA 4B4FA 4ZOEA 3L5LA 3ZWTA 1GEQA 4MMWA 2I14A 4CD5A 4QP0A 2CWXA 3HQPA 4DXVA 3CZGA 1DL3A 3BLKA 1ZS2A 1ZJBA 1UD2A 4MWAA 3J7HA 3P5ZA 3W82A 3CHVA 2OYLA 1DJZA 2FB3A 2I1OA 3BC9A 1M04A 3V0TA 4MKNA 4QCEA 3I68A 4JFUA 3CV1A 4HSOA 1P1XA 4HPHA 4LYRA 1JCNA 1P0KA 4M29A 1L0PA 5AC8A 4AVFA 1TIMA 2YX0A 1GQIA 2BWGA 1QT1A 5BMWA 4ZQCA 5LNWA 4CNSA 3N15A 1D2KA 4FZIA 1OHLA 1R7AA 3VIGA 2NZLA 3NAVA 4ML4A 3LQLA 2PP1A 3FIGA 5I24A 4J35A 3ZM8A 3HQOA 3A4AA 1CNVA 3BV7A 4UOQA 2HEJA 4MY8A 2ABBA 5CJNA 5A94A 2QULA 3AHVA 3G18A 3O6YX 4HZ8A 4MNJA 1WKYA 4AEFA 3CZ8A 2OX4A 4JDYA 3V16A 1I1WA 4TX6A 3II1A 3ZVIA 3OLEA 3S1VA 3HZ3A 1R3TA 3QKEA 2GLKA 4HNNA 3UG8A 1YDNA 1E4NA 1TB3A 3JR2A 3OBKA 1GOOA 2P8BA 3ABOA 1WP6A 3IGUA 4CU6A 4ZSTA 3M0MA 3PTMA 1WUFA 3SQLA 4RK8A 3HTWA 3HG4A 1DE5A 1GVFA 4KCTA 3REQB 3OYZA 2OO6A 2VXNA 1OGGA 3EPNA 3N2MA 1XIGA 8XIAA 3REQA 1RHCA 1TTJA 4UTWA 2G96A 3AXMA 2G37A 2Q6ZA 4LVFA 4NILA 4LC8A 4AFYA 4EXBA 1DORA 4C1NB 3EWZA 3SSZA 2BFGA 3STEA 4EPKA 5J8LA 3S6OA 2E6AA 4M1RA 3G0XA 3SZ8A 2TODA 3W0KA 4M7SA 3FSTA 2CLIA 2FZDA 3L9CA 5KEZA 1VLIA 4MOZA 5A8GA 3LBMA 4UFKA 4ZQOA 4W7VA 1PPIA 3LENA 3ZT5A 5JIPA 5CEWA 4ZA0A 3FNDA 2OPJA 2WC3A 4HA0A 1K7FA 2J8TA 3VGEA 3HOJA 1EP2A 1OGBA 1EP3A 3IGSA 2FTWA 1TMLA 4DJEC 3BE7A 2BV9A 1OFRA 3FDGA 2O9OA 4EANA 1BQGA 1F74A 3DYMA 3PNUA 3L67A 3S1WA 2VQTA 3NQ7A 4XZBA 1SJAA 2YZ5A 1N7KA 3WLQA 4HPJA 1XBZA 4LNCA 4DJFA 4RNJA 3OA5A 3M43A 2EG6A 2ZUWA 4BF5A 3T7VA 2C13A 5E5CA 1QW8A 3KBWA 4LAUA 1Q8JA 2ZX7A 2YFNA 1E4IA 4H6EA 4NRSA 3UWZA 4ZE5A 3FJ6A 3IRSA 3WK3A 2YCIX 3CMJA 1I2NA 2E9BA 2WSQA 5HWJA 5J5RA 1SZGA 5M17A 3FXYA 1W31A 3GHSA 3SDOA 2R6OA 1KA9F 4IP4A 1J0IA 1XGZA 2WCAA 3UXDA 3NPUA 3OIHA 3NYDA 2AKMA 1UZDA 2YR1A 1O94A 2WB5A 3S1XA 1UMLA 1G6CA 1OCBA 1E0TA 1UR0A 4MWAC 2QPXA 4GKLA 1KRCC 3TJXA 1VGAA 4GY0A 2WWDA 2CLLA 3LCWA 3QTPA 4DELA 3VM5A 2FPVA 1OFQA 1KO0A 3GDLA 4GYPC 1QOQA 5GJNA 4PUKA 3BQ5A 4GD0A 5CC6A 4DX3A 4Q8OA 1W9DM 1MNSA 4XAPA 3EZ4A 5LYRA 4QJ3B 1EQPA 3R1ZA 3T4WA 4C6KA 2PC8A 2BVWA 4W89A 3ZR6A 2ZCGA 1TTPA 1T8XA 5XINA 1JQVA 3UGVA 2VEKA 5EBAA 4KEVA 5EU9A 3MPGA 2HNEA 4MDPA 1T0OA 4JIEA 3FJ4A 1HIZA 3V4BA 2XH2A 3QFEA 4EAYA 4H2HA 1E40A 3GSMA 4IGHA 1OFAA 2E8ZA 5EMLA 2Z26A 3A3XA 3BW3A 4NYYA 2AGTA 3ME3A 2VEMA 1RY8A 4XAYA 2OQYA 1WA3A 4NJGA 5AVHA 2D2GA 5CPLA 1R3RA 1TWDA 1JYXA 4IQDA 2XSBA 3FKKA 5C9XA 3W85A 3UZ5A 4NRRA 5TNVA 4AH7A 1NY1A 3RLUA 3KBNA 5ABHA 2J27A 4HYVA 3BTNA 3W7CA 3FV9A 5FJUA 5DRIA 5CZTA 5E1QA 2R82A 2X41A 4TX8A 2QXWA 2WAGA 1NAL1 3WD4A 3W7OA 1HT6A 3ZSSA 1TA3B 2XTKA 5I78A 4NZJA 4GGHA 3PZQA 1W3LA 1TV5A 4YVXA 2OXNA 1EEXA 2WMIA 2F61A 3H53A 4Q8TA 3GVGA 3CIWA 2RJGA 4K8HA 3PZNA 4P7RA 1U22A 2Z1WA 1CENA 3WFLA 1PKYA 2AGKA 3I4KA 3TCEA 1OX6A 1UPMB 4AVOA 2PDJA 4AIBA 3VZZA 1ZU8A 3TAOA 3LUTA 3F4CA 2XVLA 3DBPA 1M03A 3CT2A 1LZOA 3M0ZA 3ID7A 4ZEPA 4O17A 3AC0A 4HJWA 3BAWA 2ZZ5A 1HKIA 1VPQA 4H6KA 1XLCA 1XQLA 2YPIA 1UD8A 4F66A 5FA5A 2VX5A 2V68A 3PBYA 3WQGA 1A53A 2X8RA 5BCAA 4BWLC 2REQB 3MP5A 4ZQRA 4YXGA 5HUOA 4AXKA 2AAAA 5D9PA 5FSEC 1DHKA 1GVSA 3TJLA 2JEPA 4PB5A 1F6YA 3BO9A 4HZ7A 1Z41A 4NJIA 5MKGA 1DWIM 3N3MA 1T5AA 1RA0A 3HFYA 2CPUA 4KCWA 4D6HA 2H8XA 1I8JA 4F3HA 1SGJA 1VBRA 3UJRA 5A6LA 2VQUA 2PDIA 3QMTA 1EKOA 2WM1A 1K02A 1EJ7L 3RITA 3WQ5A 2ZTJA 3VZXA 3KCLA 1KGXA 1VENA 7CGTA 3ZZ1A 4H1ZA 1H41A 3DENA 1FCVA 4TU1A 2CERA 1QMLA 3EWYA 4NJJA 3CAWA 1OQFA 2PDHA 1E6NA 2I5IA 2OT1A 3TIMA 2F9RA 2YL6A 1DTNA 4I9JA 3W7EA 4N6EA 1PKMA 3IK4A 1U30A 2NSXA 2ESCA 3EB3A 3V7PA 4G7FA 2CLMA 3BLDA 1FWSA 3A9BA 3W7JA 4A21A 4H3DA 3PBMA 3AYSA 5A6SA 4ZB5A 4U3CA 1POJA 2HNHA 1JGMA 4DM2A 3P60A 1WZMA 1KR0A 1XISA 4NX0A 1PV8A 5FAJA 1F8MA 1HG3A 3DYPA 2WV8A 3LNPA 1W8SA 2P8CA 4L80A 3EA3A 1TIWA 1YW1A 4O1DA 2AQWA 4XSMA 1N8WA 4UMCA 3BJTA 2NXIA 5DN1A 4HGXA 4UFHA 2NX9A 4HU3A 1CGTA 4N42A 4KIEA 3PVFA 4J1OA 1WXJA 4Q3MA 3H23A 2WCGA 3FN9A 4KEZA 4BI6A 4RZBA 1HGWA 1HQTA 3WQ8A 2F6XA 2D2OA 1I2QA 2VR5A 1SU5A 4C6IA 4G2DA 2G3JA 2EXOA 3VD3A 3W71A 5REQB 3N3TA 5HMEA 3H70A 2IKHA 3QLLA 2A3BA 4O4WA 4PB4A 1KR1A 1Y65A 5FJIA 2MANA 3KP0A 5I09A 1TREA 4PMZA 3NM3A 4A3UA 1BGGA 3APTA 2NUXA 2L5HA 5EMJA 3W37A 2Y88A 3BAIA 5B7YA 4JTCA 3QYQA 2UZ9A 1S2CA 2AL2A 3W6YA 4QEHA 1HKJA 2DJLA 1HTIA 3CYJA 3XINA 3WD1A 3OHIA 2J66A 2QUUA 4ATWA 1ZENA 2E28A 1I2OA 3VD9A 1RQBA 3MYOA 1DE6A 1I2RA 1PYMA 4AC1X 3W9ZA 2NQJA 3WF4A 4NJHA 3HIJA 2HQAA 3RLHA 5DQPA 4HNCA 3M5VA 3P8JA 4DZAA 4UB9A 3M0YA 1A80A 4HYWA 4GO9A 3K1GA 1P6BA 2ZUSA 1PSCA 2QCEA 4PBGA 4WGXA 2V3GA 3P3BA 4TTGA 1CECA 3BG9A 4GCXA 2OSXA 3W88A 1E9YB 3HMJG 1QNQA 5I00A 3V35A 1C29A 4PBEA 4HB7A 1B9BA 4NL1A 4DBDA 2DZBA 4IICA 4DQWA 1JRBA 1OC7A 4S2CA 1ZALA 2QCDB 2A3AA 5B80A 3EDEA 4D6CA 2XIBA 1ZL1A 4PUJA 1JCJA 4EPEC 2J7HA 3IACA 4QIUA 4CQAA 4GABA 3HFTA 1XYCA 4K7VA 4M8UA 1E6QM 1X98A 5TAOA 3TZFA 3WNOA 3N4AA 2DY3A 1YE4A 4D6EA 4C7GA 3VGDA 1XYFA 4PMUA 1A5NC 3IJ8A 5MKGB 1XM3A 3C52A 1NH6A 1V02A 3GNRA 1X6UA 1ZBKA 4X0VA 1ZJHA 5I7GA 4UQBA 3TTEA 3LY0A 3UPBA 1ZAJA 4BQ3A 3EEZA 1KFEA 3ANYA 1DJIA 1BVWA 1DJXA 2DQWA 3MSYA 1WDDA 3W7DA 2Z27A 3I10A 3IRDA 3LHUA 1J5SA 4L6HA 4LV4A 1BRLA 1DJGA 3SI9A 4O54A 3ABXA 3GK0A 2DIEA 1UZHA 2Y4SA 1KKRA 1RVKA 2FPYA 2VM8A 4HMNA 4CEUC 3M07A 4RPPA 3P62A 3TYAA 3HM7A 1PL9A 4I9TA 3SEPA 1W9VA 3OOQA 3GZ3A 1W54A 1ZFJA 3A24A 1KQYA 2FHBA 3VI2A 2WVTA 3FA3A 3NA8A 3QFWA 3W1RA 3NSNA 4LTSA 1VR6A 4XISA 3LRLA 3TVAA 3UR7A 4YTUA 1E5JA 3LXAA 5D2YA 5FESA 4CCEA 1DEDA 4RW3A 2E5BA 2GVJA 4GZ7A 2XYLA 3USBA 1L6YA 3OB8A 4DF0A 1RK6A 5C71A 2H3BA 5A2BA 8TIMA 2PFHA 5IFTA 1XH1A 3BLOA 4K38A 1HXJA 7TIMA 1UKPA 5KMYA 2E09A 5FD0A 1V4YA 3WG6A 2CU0A 4E8GA 2BBFA 1XLBA 3A5FA 2CZVA 3PWIA 4Q22A 5C7HA 3LG3A 1JPHA 3CPRA 1RBOB 3MO7A 2CFFA 1E56A 4GKTA 1K4GA 1AJ2A 4J3UA 5CZJA 5LNSA 2HJPA 1JI2A 4WDXA 3CAKA 3B0XA 3UNTA 3FXGA 4PEKA 3LHVA 1WAWA 1S5WA 3GKFA 3K4DA 2EG8A 3GS6A 3EWUA 5HATA 3WUEA 3WLNA 4RLIA 4GNKB 1XRSA 3GIPA 3B4YA 3HB9A 2QJGA 4UR9A 4AIOA 5FACA 5DANA 3XISA 3BV4A 1VHNA 1W0MA 3OQEA 6REQA 3FSUA 4JTRA 2YYUA 1KV8A 1OFPA 2PRLA 4JNYA 4G6CA 1U5VA 3T9PA 3AO0A 3LNMA 6ALDA 1SUXA 5XIAA 1H63A 2GGJA 4S3JA 2O56A 3CH9A 1PHQA 1W1ZA 2XH0A 1FOBA 1UASA 2W79A 4B16A 1V3IA 3EDFA 2QCFA 3BUVA 1GT8A 2QUNA 3AUOA 4JEJA 1WO2A 5KITA 4PTVA 2WLYA 1GHSA 1UQYA 3GFYA 1J12A 3E12A 4HSHA 4FK9A 2WHKA 4J2MA 1ONEA 1SMDA 2PAJA 1YHTA 2ACUA 3IIXA 4DAIA 2R8WA 3I3DA 5D30A 5E0FA 1KW1A 4WOQA 1FCUA 3OP2A 2Q3OA 3CL7A 3H8AA 2PZ0A 1HJWA 4HN4A 5D2VA 4GBDA 3TWAA 3ARVA 2DZPA 1B5TA 4GLEA 5IHRA 3VX0A 3GHRA 3SRKA 2XVNA 1Q63A 4BCEA 1UHVA 4BK9A 1XSJA 4NI3A 2ISDA 4LAMA 3EB4A 2PDQA 4IJCA 2BDQA 1XLAA 4K2SA 1JULA 1RD6A 4GMEA 4E38A 4FMVA 1LT7A 1CGYA 1LWJA 1W1TA 3N17A 4L7ZA 3NZQA 4OIFA 2PLKA 3FYOA 1O6IA 1ISVA 1FP8A 2Q8LA 2ASHA 1H7WA 4HNLA 3CZEA 5KSWA 1KM4A 2PCQA 5HULA 2DPEA 3W2UA 1OK4A 3RDKA 3C0LA 2ZYFA 3WF2A 2BP1A 1F9CA 3MCOA 3Q2DA 3QLDA 1ME7A 4RDZA 3WQ4A 5A6BA 3AWNA 3ALGA 1VFSA 3AXKA 3W38A 5D04C 2YSWA 3OG2A 4P7LA 1O4UA 5H8MA 3PF3A 4E5TA 4QE1A 4D6JA 3W72A 5BRPA 1UD6A 1UWUA 2VYOA 1FCQA 4Q8QA 2WZIA 1PO9A 2Z29A 1PZ2A 3W07A 1JUEA 1M7XA 3BARA 2DSWA 5HPCA 1G94A 4GX8A 3M0KA 5BU9A 4KF1A 3FX4A 2CHNA 3L4ZA 4LNYA 2ZUUA 1EX1A 4WKHA 5D32A 3F7JA 2WSKA 2FGBA 3LBOA 1M65A 1OFOA 1R5YA 1NDWA 2OQHA 2GUUA 2OQLA 3L23A 1VFUA 2DT0A 4QQUA 3W81A 4PL2A 5G4WA 3MZNA 2EPHA 4DUWA 3BSGA 2QLYA 5TD4A 3GU1A 3JU2A 4JIHA 4UFIA 2DZUA 4J3XA 4UBPC 1J11A 2PLJA 4NP7A 1IYXA 1D3CA 1G4SA 1QO5A 4Q4SA 1VFLA 3C3UA 3G8EA 2EKGA 3CQHA 1KQZA 2VTFA 3TK7A 2E6FA 2Y2WA 3CUHA 1HJQA 5DY2A 3ONBA 2XGBA 4E0CA 5AC5A 3K5XA 3QZAA 1P0EA 4NIRA 3W7NA 4GISA 1XCFA 3YPIA 2OWCA 4A8RA 3AIWA 1DQUA 4J2PA 3W7MA 2IXVA 3N9KA 2DGAA 1SZNA 3B9NA 1BVZA 4AZCB 1B3YA 4BA0A 2VP8A 3P81A 4US5D 3WFAA 1AG1O 2PCEA 4B2DA 3PZOA 4R9XA 3V36A 4G8TA 1B1YA 4JTHA 5H8UA 2H9AA 1Z69A 5BRQA 1IGSA 1TVLA 1Y5WA 3VOIA 1DXEA 4DZHA 2FLIA 1G9HA 3V3WA 1LQ0A 1ISXA 4MG4A 1E71M 3AIVA 4NT0A 4X63A 2EJ1A 2ZVIA 1OADA 1V3JA 3DFTA 1G67A 2VGGA 3RR1A 3SCNA 3K8MA 1KFKA 3VDHA 3D3FA 2NV2A 2A21A 4PZVA 2RDTA 1TPVA 1R87A 3KL5A 2P0IA 3VNYA 2B0MA 4D6FA 1ZY9A 2D23A 1OWQA 2E68A 2JEQA 3A4XA 1HFBA 2XGIA 4S3BA 3GYEA 5M1TA 1IZKA 1CX9A 1QPQA 3AMKA 2ZX5A 3KEHA 4XX6A 1IWAA 1NQ6A 3FGCB 4Q8VA 3PTQA 1WOBA 1M1BA 5MF5A 1V7YA 3EX3A 2XGZA 2CLEA 3TU9A 1VFMA 4WK9A 3PPFA 4UNLA 1W2PA 1E0WA 1UW9A 3A6OA 3LS9A 1UIPA 3CPGA 4FHAA 4LXFA 3VIFA 1T8QA 3CUXA 3VA8A 4GUFA 1VPXA 4UTHA 4M51A 3VC6A 1DXFA 3MWCA 5JIWA 4PMYA 1OF8A 1P4CA 3L2MA 4RX0A 2HVOA 1QW9A 1VLWA 4ZTYA 1OIMA 1GPFA 3P0XA 3G22A 2O9TA 3UCCA 1VJSA 3P84A 3PZUA 2GQ9A 4ZE4A 4GVIA 3FHAA 4DF1A 1GUVA 4C91A 1ADDA 3PPCA 3ECQA 4POCA 1OX5A 3UG3A 2CBVA 3PBVA 1XLFA 3EXTA 4WVXA 2I56A 5A2AA 3ZJ6A 1OCQA 1XXXA 4OE7A 3SGZA 3KVKA 5AB3A 2GJXA 3N9SA 4WKAA 3CLMA 3LMYA 3W23A 1K9EA 5D9OA 2DUZA 2VDHA 2R14A 3CWOX 1I0DA 1SJDA 1X1OA 2OEJA 3OA3A 4E2VA 4Y96A 4IUOA 2X7VA 7ENLA 3PBUA 4CEXC 3UZXA 1NWUA 3DFPA 2PUZA 3T2OA 4F4RA 2G4JA 2V5LA 2P53A 4UTUA 1J9YA 3MUXA 3V18A 5XIMA 1HKWA 4YWIA 1QHZA 2CKSA 3KS5A 3EKGA 2JKAA 2J88A 4BQ2A 1XH0A 5GQBA 1T40A 3N14A 3QQ0A 3B05A 3WZ0E 5CGQA 4IXHA 4IZGA 4BY3A 1DPMA 3CQKA 4L56A 1UC4A 4UR8A 4FNRA 2WOQA 1B30A 2XZ7A 2YXOA 4PGLA 3W7QA 1KTNA 2HISA 1R86A 4A6GA 1EJRC 3WQCA 4IMEA 4AIUA 1R46A 3BZJA 1OYAA 1L6GA 1BTCA 4YJ5A 3IV3A 5EMUA 1E72M 3S46A 6REQB 2PU1A 3E3HA 4GWEA 1CB2A 1R3VA 1JEZA 3URAA 3QY6A 3N6JA 4TVDA 4Z17A 3UR5A 3FY1A 3T0TA 1UP3A 4LYQA 4HK7A 4AZHA 1ZCOA 1JIBA 3RM8A 1VB9A 2PF8A 4DJFC 4C6FA 1TUFA 3KL3A 2WHMA 3FEMA 4L61A 2VDGA 1JDCA 4RNHA 5AC7A 4MJ4A 1XSKA 4GVFA 5EA9A 1QPOA 4EF9A 5LIKX 3EWBX 4XBJA 1N8IA 3PJXA 3M41A 1SO5A 1EEPA 4IF2A 2E0PA 3IVSA 1ADSA 3U2CA 2VUNA 3NPVA 2OCZA 1QU4A 3IUDA 4OKDA 2QPUA 4FOUA 1F76A 3N25A 4PTXA 1XBVA 1R85A 1ECEA 5D37A 3RX4A 2FJUB 3VINA 1LL4A 4HTYA 3W1UA 3KRZA 4J3SA 3LHYA 1V8EA 2E3ZA 4F0HA 1P6CA 4C6OA 4I5XA 3KW3A 2D3NA 3F4DA 4JBRA 3SRHA 2D0GA 2ZUNA 4YS1A 2H3DA 1XX1A 4PA8A 1UC5A 3MI6A 2TAAA 4NZ1A 3N18A 1VEOA 1MRAA 3O07A 2CBJA 1QCWA 1QI3A 1ISWA 4XBSA 4D71A 3E0IA 4KEMA 4GBUA 1P0NA 3AS0A 2C79A 1QBBA 3ZXWA 4JYFA 3HMCA 2Z1VA 1K4HA 3KWXA 4DRSA 1X39A 1FH9A 4LFYA 1ESWA 1XLIA 1O1ZA 3G6MA 4CKQA 1E4MM 1NDYA 3QF0A 1TPB1 4NKCA 1BRLB 1R30A 4PUNA 1O5KA 1YTEA 1IGWA 5A8QA 1NELA 4NI8A 2OLAA 2EKCA 3M6YA 3ITLA 3THQA 1TPH1 5F4SA 3TJ4A 3EX6A 4LAZA 4PFMA 1F3XA 1OX4A 1OFEA 1YRRA 2XN1A 1XS2A 4H4IA 1GVOA 1RCQA 3RXZA 4JIRA 2GZXA 4UTTA 3QBUA 2QS8A 4HBKA 1V3KA 1Y5VA 1QATA 1WDWA 4JN7A 1PCKA 1AA1B 1C8YA 2XWDA 3G3MA 3OPSA 1A5LC 1LBFA 1OCNA 4D72A 3QSTA 4KRZA 3U7BA 3EKZA 3E0VA 3TQPA 3E0FA 3UG5A 4ASTA 2CWNA 3S2MA 3POHA 1UWQA 2WW5A 3EDDA 4JR5A 3T07A 1EWEA 1VCVA 4XK2A 1OT1A 1XGEA 4C90A 1MVYA 1DIDA 1U83A 2NQ5A 1A5AA 4I7VA 1D7KA 2QGHA 4FXSA 2B7PA 2ZRVA 3BAXA 3GR4A 3G8RA 5ABTA 4H9ZA 2V67A 3LPPA 4P7OA 2RGLA 4ZOAA 3NQVA 4NF7A 3APYA 4H7ZA 3EMZA 1KGUA 3LN3A 2J8FA 3ITVA 3PSWA 4WHBA 4Y9MA 1NP0A 4ZO6A 3TW9A 4HOWA 4QR6A 5CPMA 3C2OA 3LCGA 4GY7A 2HZGA 3VD5A 3L4UA 2I57A 3A12A 4ZODA 3BG3A 3GH5A 4QLKA 3ITCA 4GXPA 2C91A 3W7RA 1Z7AA 6CGTA 1WNOA 3ZVHA 4C1LA 2ZUMA 3BLEA 3NUKA 3G1SA 2J7CA 2C1IA 1E6ZA 1FH8A 1OBAA 5CBIA 5FEWA 3CV7A 4KFNA 2R24A 1W56A 5FOOA 2NQZA 1FFQA 1UB3A 5BOEA 1K6WA 4TOQA 3PY2A 3GD6A 9XIMA 4YLWA 1A4MA 3AOFA 1E0UA 1LQ2A 2C0HA 4WGHA 5E09A 1CLVA 2DSVA 1B3WA 3DC8A 2WO5A 2C7FA 3F4VA 1JYVA 2VOTA 3KDOA 3NYZA 4XKMA 2RKXA 2DT3A 1E1EA 4H41A 1QOXA 2BLEA 2FMOA 4PMJA 1TJ2A 3H2NA 4UOJA 3V0UA 3DUGA 1AQ0A 1UR9A 4GOAA 1OYBA 3TN5A 1X8FA 3EXSA 2NVCA 3WNNA 4H6RA 3VXGA 1ZJAA 2EPLX 2G97A 1R47A 3RX2A 1IXPA 4A35A 3PS7A 3URNA 4A4AA 3TAKA 4BEQA 2V8ZA 1DIOA 4MZ8A 3VAVA 3QW3A 3OJGA 1OINA 4Z1CA 3T40A 1H51A 1AQMA 3UXIA 2FH6A 5JXQA 4QNWA 1V3MA 3AFBA 1M53A 2TMDA 4V15A 4UCFA 4TTUA 1B4KA 4DLFA 4KGLA 2CXEA 2ZRUA 1W1IE 2OEMA 3GTNA 4FNUA 1S1RA 3WUBA 2JQXA 2D20A 3LOTA 1GJPA 2FPTA 3L2IA 3BAYA 1QNOA 4BS0A 1HKVA 4YYCA 1XRVA 2A7RA 4X2PA 4DBSA 5D9NA 2VGFA 1W3IA 3R79A 2QQ6A 2IQTA 1ITCA 4EWJA 3RCNA 3TTYA 4JTTA 2PZNA 1X1ZA 3GAKA 2ZWZA 4AMCA 2BB0A 1DWGM 4O16A 4O1CA 3VIIA 1UPPA 3QSRA 3WBYA 1TUXA 5C55A 2VRJA 4XUYA 3TYZA 3WH8A 1JDDA 4Q4MA 3UZJA 3SW6A 4LX4A 1EDTA 4OQVA 2XM2A 5DMYA 5T8GA 3SY8A 3OHMB 1W1YA 2G3MA 1CT5A 2O4MA 4H00A 1NWTA 2XN2A 5K9CA 2V2CA 1VCFA 3MMWA 3WYZA 3QGVA 4IX2A 2EJAA 4LBRA 2Q01A 5DF0A 1Z42A 5DT7A 3ZOAA 4GXMA 2PWUA 4XVDA 5I3FA 3MMUA 3TOYA 3WFZA 1GTHA 1K3UA 3NTYA 3E9AA 3C8NA 4NUWA 5F1UA 3CL8A 3E5BA 3FDKA 4V1XA 4D1JA 2E1DA 3BLFA 4PTNA 3B8DA 3VNKA 1BQCA 4Z0JA 1V51A 1Q6DA 3VNLA 3F1QA 5IFPA 3NJ3A 1SZFA 3AXXA 4AB4A 2QF7A 2P0OA 3W1AA 1I0BA 4C60A 1BXNA 4JDBA 2J78A 1LBMA 3OGVA 4PUMA 1QR7A 1H2JA 4MB3A 2GJNA 2PGRA 1XRTA 1RY0A 3PJTA 2J7EA 3WF1A 3T05A 3N19B 2NT1A 4WUIA 3TE9A 2R9RA 1A5SA 5EB8A 3VM7A 2WNQA 3T6CA 5GJPA 1QNPA 4XWUA 2RUSA 3SGUA 4B5TA 1LDCA 3HPSA 5CSRA 3CB8A 5A6AA 4MB5A 5CQ1A 4O52A 4YPJA 5JVLA 2NLYA 3AUJA 5LXXA 1JI1A 1WKEA 1SR0A 1YIXA 3WNKA 5MHBA 4IFOA 1KGWA 2B7QA 3T08A 3HG3A 4GI4A 4FB7A 2A3LA 1ELSA 1V6YA 2PGWA 3WLPA 1HP5A 5G2WA 3QV6A 3NVTA 1CXHA 1AMYA 2ZC1A 2C6QA 2I5GA 3DFSA 1Q6FA 2W6RA 2PWGA 4M81A 4P5UA 1S2WA 1ZLPA 3OVRA 2ISWA 3U3HA 4Y90A 1FQ0A 4CVUA 3GXIA 5HQLA 5E70A 2VURA 2IPFA 1OY0A 4IHCA 1W9XA 4EAMA 4KIRA 2QT3A 4BR1A 1HZYA 4L4PA 4ACZB 3VNDA 3WN6A 2BS9A 3KHJA 4A3YA 3DFYA 3RUBL 4GH1A 3WLOA 1YXYA 1XIIA 1US2A 3RYSA 4H9XA 4L5ZA 1M9HA 2QZRA 1VBHA 4Q6JA 2BG5A 4QJ5B 1VZWA 1EIXA 4MDOA 3QPZA 1CPUA 2ALDA 4CCDA 1BEUA 3TFXA 1MNZA 5ABFA 1RAKA 5EYWA 2FDMA 3VKCA 4I9AA 5A8OA 1ICPA 1VBJA 2ZRZA 5I77A 1KV5A 2PTWA 3H12A 2ACQA 2BMBA 2PBGA 1FWCC 4ZOBA 4M56A 3PUOA 3LPOA 3PR2A 3WMLA 5RUBA 1QK0A 3MCNA 4NAEB 3OU8A 4P61A 2F6UA 3NG3A 1NSJA 2BOGX 3NVDA 3QGKC 2GGEA 3GDBA 4M82A 2PWVA 2F8QA 1JPDX 3CAVA 3IVUA 4PYSA 1EUNA 2X1RA 4IIDA 1EUAA 2PWHA 3T8LA 4AD3A 4GIEA 4JYDA 2Z1XA 2A0NA 3VUPA 1K6AA 1PWLA 1PZ1A 1VD6A 2XVPA 1H7NA 3IGXA 1RVGA 2EPOA 4CQ9A 2A7NA 3PANA 1M41A 3R0DA 1J0ZA 1B90A 4Q8WA 1MZHA 2V38A 3NZ1A 1S5TA 4GJ1A 4PRWA 1XYAA 1UOKA 2J6VA 1IV8A 2OKOA 3DH7A 3EWDA 4FX7A 1WYIA 4W8AA 3MBFA 4A3HA 1KBIA 1YADA 1JUBA 1I1XA 3PB0A 5AN7A 3MI3A 1XIMA 1WDRA 3F5KA 1X38A 4MY9A 4A22A 1H7OA 3UFYA 3WLRA 5D38A 3T0BA 2PTYA 3AU6A 4LT9A 5GJMA 2BGNE 3MP4A 4W88A 3WMSA 2E6DA 3GVRA 1H50A 3N2BA 2E67A 5D4YA 3CAQA 1R9ZA 3ZJ8A 3UXLA 3OODA 5C54A 4D8AA 1DJNA 2CW6A 4A8IA 4CQCA 1OFDA 2BHZA 1CLXA 3G24A 2V5CA 3ZR4A 5A95A 3W02A 1O95A 1HJUA 2NWRA 1R3SA 4BQ4A 4KQNA 2QIIA 3NQBA 2IPJA 2B4GA 4UQEA 5FI8A 2V5BA 3G1XA 2O55A 4LUYA 3TLQA 2ZX9A 1E73M 4H9UA 3MW7A 2UY3A 4Y9OA 5DEZA 4EPBC 1MW3A 4JFWA 1UZ1A 2NVAA 3TONA 3WDRA 1G0CA 1GZJA 2C15A 4K8GA 5GNZA 1AZ2A 5I79A 4WXZA 4BI7A 3TTSA 4KBXA 3VKAA 4JTAA 1PYFA 3MS8A 1O5RA 4QJ4B 2HXUA 1A3XA 2JIWA 4ICCX 2VKZG 3S2JA 3AU2A 2NUYA 4Y8FA 3O6AA 3L65A 1AH3A 4Z1AA 3BW4A 5JQ9A 1KLZA 1UKQA 1IE7C 5ABGA 1RJPA 5SWUA 2P3ZA 2W63A 2Q8XA 4LRSA 4P8XA 4MTVA 2Y62A 4CNOA 1XLHA 2Z1BA 3NL2A 5LIYX 4MKSA 2DZVA 3WO8A 1FY6A 2D69A 1JJKA 3GTXA 1C8VA 3FEQA 4TMCA 5BZAA 3VYLA 3WK0A 4NU7A 4FNTA 1KTCA 3UZZA 2A6NA 4M0XA 1JXKA 3T4CA 3TQKA 3IIPA 5CBBA 4ONVA 4HNOA 5HNRA 2ZZ6A 1QI2A 3MVTA 1ZGDA 4OBRA 2GQAA 3CIVA 4OOUA 2Z6IA 1Q6QA 4US6A 3AXHA 3G3DA 1HVXA 1R3QA 3LM7A 4J3TA 2OG9A 2EG7A 1ENUA 2KAUC 1NOUA 1BPLB 4OFCA 1Q65A 3G1RA 4YYFA 1OSEA 4ROQA 1EYEA 4DBEA 2WPBA 3EXRA 3MU7A 1ZJIA 3TFCA 1HL8A 2WKGA 2DUXA 5C7VA 3BSHA 4F48A 2NVDA 4G7EB 3GHTA 4A29A 2C1GA 3MKCA 1SJCA 4V33A 1DJYA 4DUXA 3CV2A 3HBLA 1MO0A 4A3RA 3UP8A 2HVMA 4CCZA 2GQ3A 1P0DA 4K37A 5FIPA 4CN6A 4EIVA 3B9OA 3O05A 3UW6A 3NQ6A 2UY2A 3L0GA 1C92A 4EX4A 4YHGA 1XLEA 2YJQA 1YTDA 2W27A 3CZKA 3CB3A 3OEXA 3IAQA 3TMLA 3C2RA 4BEUA 1EJVC 3B8VA 4AD0A 1NFPA 4WCJA 3VDCA 4IM4A 4B5SA 3UJEA 3LLFA 3KZSA 1JF6A 3WQFA 3USZA 3ZYZA 1SZRA 4JQ4A 3RLVA 1IR2A 2FZBA 1A5OC 3M1ZA 3R11A 5FKYA 3C56A 3AIBA 3W7IA 4XZIA 4RXGA 1BYAA 2Y8VA 1LOSA 2DVUA 3CHCA 1XJBA 1RPKA 3GHUA 3LM3A 3GVWA 1XC6A 1G1YA 5BOOA 2PA6A 1GPWA 2Z28A 3CO4A 3N34A 4AD4A 1NIUA 5CLWA 2JF6A 3EOUA 4ZQMA 5HJXA 3WNPA 4WEVX 1Q4NX 3HJEA 2PGEA 3SUUA 1GHRA 2FIQA 1P1MA 3HO8A 1NQKA 1WDQA 3FK4A 4GIYA 1PXGA 3HPXA 1AD4A 1JR1A 3N6HA 5BOFA 1LLZA 4F0MA 3VK5A 3T2PA 3CNYA 5L9FA 2D2HA 3N2TA 4FS9A 2OELA 2FH8A 3A21A 3TR9A 3DG6A 3MUAA 5LIXX 3DHDA 2VHLA 1SMAA 4I7WA 3VOJA 3NNTA 4IFKB 1TV8A 2OMAA 3HURA 3TDFA 2GUBA 3WL0A 1SO6A 1ISYA 2JFEX 1H1YA 3SCWA 1AUSL 4UQ9A 1C7SA 1VFTA 1R8LA 3W3OA 1KRMA 8A3HA 1CXFA 1RP9A 1VFOA 4H9YA 3R7MA 2FQIA 4ALDA 3SUTA 2PRMA 3NO5A 4LEFA 3M6DA 4WR3A 3MVIA 3S3GA 3XIMA 2ZZ7A 3L5AA 3RRXA 1EBHA 3QZEA 3NDYA 2J6XA 1UMYA 3MTWA 3DC0A 1PE1A 2H9AB 1V02E 3WLKX 3W01A 5CGMA 1PZ0A 4W9TA 5FEPA 2GSHA 1K03A 1OF6A 1XYZA 1D9EA 3CUIA 2V3DA 1O7AA 4YMZA 3WK1A 1WZAA 3H6OA 3GW3A 4P8UA 1AQHA 1JYNA 2FTPA 2YKKA 2E7FA 4IMCA 5FF7A 5ABEA 4FOJA 2XHYA 4AUBA 1ZNNA 1Y8BA 4NJKA 1QOPA 4I9MA 3W29A 2HBXA 4IMGA 2WZTA 4PRTA 4GE8A 1B3VA 5BRBA 4F0SA 3M5XA 1W17A 1EJTC 1YXDA 1U1UA 5DELA 3H2AA 5A6KA 2ODOA 2G50A 5CG7A 1I4NA 1C9WA 3S5NA 3O2LA 2BY2A 2ZKMX 3WQ6A 4EXQA 3M47A 3RM9A 1Z6KA 1U5JA 2ZA1A 4RE0A 1B9ZA 3STGA 3BMWA 3SBFA 4A05A 4GC4A 4M80A 1DIEA 1KC7A 1AZ1A 3OW1A 3K8KA 3ENLA 4EKJA 1EO7A 4QLLA 3AJ7A 1WDSA 3E5PA 4KCUA 3HGOA 3C6CA 4I7UA 4IPLA 4ADUA 4K1WA 2PDUA 5TBOA 3GBEA 1PX8A 3IUIA 1B54A 3RU8X 4MWAD 2VCAA 3H2FA 3WDQA 1GOMA 3QY8A 1RPXA 1E1FA 1FDJA 3POCA 2ZDSA 1XIDA 3D3AA 3ABZA 2BXYA 1OK6A 4QEEA 5LNUA 2ZWYA 3DBNA 3IK2A 2OFJA 3GXNA 3NL3A 2QUVA 1JQXA 4HCLA 2RDWA 4Z1YA 3HGJA 1M7OA 4LB4A 3AROA 1YDOA 4W7WA 3U2ZA 1W3TA 3KXQA 4P2VA 1PS9A 3DAQA 1XIJA 3WDIA 3KDNA 4JIQA 1E9ZB 4AYGA 6XIMA 2BVYA 4RZ6A 4DWSA 3B0VC 2OB3A 1X7IA 2PURA 4JIIX 5I3HA 3DESA 4H8VA 5KETA 2ZA2A 3EAUA 1XINA 9RUBA 4LBSA 5A6MA 1GOKA 1ZQ5A 3ALFA 4AZBA 2J8GA 3WJYA 2INFA 4NXKA 3BXWA 3BLPX 2WZMA 1TPWA 4DYKA 3GDMA 3SCPA 2PD5A 3LU2A 3CLWA 5AVNA 1JZ3A 5REQA 5I2UA 8XIMA 4KETA 1K1DA 3U2OA 1RXOB 4NQ1A 1Q7QA 1EOKA 3A64A 3BWWA 3GTFA 2QEZA 4IGSA 2VC7A 3O6CA 3IUHA 4E3TA 4R7OA 3AHTA 5E93A 3TC7A 3LTPA 5A6TC 2C8NA 1LCOA 3CUZA 1MYRA 1LF1A 4K3ZA 3ZT7A 1LQAA 1A49A 4HQVA 4AU0A 4Q8UA 2ACRA 5F2MA 4H9MA 1SVDA 1ALDA 3K1DA 1H61A 3UYCA 3WMCA 4ML9A 1XIEA 4O8AA 4AG0A 2NQ9A 1GKRA 3C2FA 3PB2A 3LPGA 1ZZMA 4MNMA 2EEXA 1QPKA 3TQ0A 2XIQA 1W1B1 2DH3A 1YBQA 2INZA 5CPQA 4AY8A 5C8BB 2GOUA 2OJPA 3GTHA 1NOWA 4IQLA 2BY1A 3TTQA 5CZSA 1UR3M 2QHAA 4M6UA 4US5A 2PLMA 4S1FA 2ZRWA 1XSIA 5ECUA 1WCGA 3BURA 4ZZ9A 3M0VA 2QDEA 3SR7A 3W53A 5C2GA 1W3NA 4JTEA 3GUWA 3S83A 2YW3A 2WWCA 1J0HA 4DZIA 4OVXA 1HKKA 4OGZA 2PB1A 3L4VA 3RILA 5AYBA 1YPXA 1L6WA 2GJPA 3TC3A 3OGRA 4AZGA 5B7ZA 4FXFA 2LLEA 2Z2BA 4GYKA 3CO8A 1XIBA 2CLPA 1F3WA 3QOKA 4ZO8A 4YCPA 2YOCA 2B81A 4H9VA 1PAMA 5CSYA 4QAWA 2PDPA 4LB3A 5AKQA 1VYRA 3HG2A 3VC5A 4FLOA 1YX1A 3TP4A 1W2VA 4RV3A 4Y9NA 1NP2A 2HK0A 4D8ZA 3CL6A 3U5UA 3W7KA 2ZE0A 1L2UA 1BSLA 3W2KA 7REQB 2G4FA 2R91A 3R94A 3R6IA 3EMCA 2DVTA 1YLVA 1RH9A 2A6LA 3NEVA 4XIMA 1K9DA 2BOEX 2C71A 4U2ZA 2I5QA 1XBXA 1OEPA 1CXLA 1DHPA 5E9AA 3ITXA 4WY0B 1TJ1A 3SGGA 3TSDA 3WX7A 3M5ZA 1GG0A 2CZDA 4AX6A 3WDHA 2JALA 1JD9A 1S5MA 3MT1A 1PKNA 2J9YA 3AWOA 4MY1A 4B3ZA 3BAKA 1EOMA 5EBUA 1F3EA 2FGZA 2CLOA 1FKXA 1YYAA 4NNCA 2O7SA 4JYEA 4ICNA 1PUDA 1PIGA 3ZVHB 5LHFA 1V6TA 2O92A 2CBUA 4I8DA 1JDFA 3SCTA 4G5DA 2DZXA 1BFNA 5CZKA 4GQGA 2Y7EA 3AZSA 2X30A 2OVLA 1EJXC 3GH4A 2ZDRA 1TV7A 1TA3A 4ZENA 1REQA 4IX0A 3WJZA 2E6YA 2WBGA 2Z7GA 4ERAA 2R1KA 4JN6A 4ERGA 4QXIA 4C1NA 3TKFA 3SCUA 4AZ5A 4Q4OA 1E9LA 1JZ2A 5HR7A 1RJRA 4PTWA 3OIXA 4NNBA 3WD0A 2XSXA 3KZPA 1EGVA 2TYSA 3VOHA 3N2XA 4O1AA 1E70M 1XDJA 5G2HA 3AS1A 4QQ3A 3RN6A 4F2BA 4ADSA 4D6GA 9CGTA 3M0IA 4GY1A 1SW7A 3IVTA 3M44A 5DBTA 4NZCA 3NSMA 3ZJKA 4LCQA 3RRAA 3TN4A 4DI9A 3HA1A 1PWMA 4H19A 1PZ3A 4JTUA 3GFXA 1GKQA 1LLWA 3TV8A 1UYQA 4PRRA 4JN8A 1JD7A 3BLIA 3VPLA 4ROPA 1CCWB 2VFHA 2ZIDA 1KBJA 3NZPA 4MGGA 1EA9C 4MJMA 2YCLB 2Y70A 4MF4A 1VFFA 2DT2A 2EPMX 4DBWA 4O4VA 4Q7NA 1FWDC 3B40A 3RO6A 4AAJA 1EGMA 4JTKA 4L4MA 1WZKA 4FXRA 2Z24A 4KCVA 3AHZA 3NGJA 2X7WA 3LD5A 4IXXA 1S2VA 3DOPA 1AL7A 1GZGA 2GGHA 4L1WA 1XR2A 2HE5A 3R2GA 4P7NA 1NF0A 4JCMA 1TPDA 1XV8A 4JD4A 3GIYA 2WMFA 3VMNA 3UCQA 5K2ZA 3UNDA 5CPTA 1DOSA 3QW4B 1NVMA 4J7RA 4PCFA 4QHRA 5JMUA 1O12A 2NV1A 1M3UA 1E6XM 3CYVA 3RO8A 3AMLA 3CGTA 3FFSA 2XINA 1DV7A 2RAGA 1F5ZA 2UY4A 3B9EA 1VAHA 4F8XA 4DJEA 2G8ZA 3UPWA 1JNDA 4FNQA 1W9PA 5E6ZA 2QJHA 2D0FA 4C6BA 2NX1A 2POTA 3SFKA 2VWSA 3OVQA 2I16A 3NCOA 1P6WA 2NV9A 2GWGA 1H49A 2GFTA 4D9PA 3NQ2A 4O53A 1HVQA 2W4XA 3GNXA 4D1IA 4GPNA 2YB4A 3D0CA 1KCZA 1UD3A 1LYXA 5H1WA 4FNSA 3WDJA 1BF6A 3N13A 1ZCCA 3UPMA 3P8IA 1KCLA 4QGCA 4HA4A 5D02A 4J28A 4LVGA 2WCSA 4URIA 1MW0A 2WZHA 3KBJA 3E2QA 5DT5A 4LS1A 1QI5A 3E38A 3H4GA 4M1BA 2OODA 3EX4A 3HF3A 5F2GA 1TX2A 1NOFA 3R8HA 2ZQ0A 1QW7A 2QJNA 3C2EA 1UKSA 3URQA 4PMXA 4QG8A 4XB3A 5JBFA 3CQJA 3NQAA 1VHCA 4OV4A 4I8YA 1F7BA 4FO4A 2D3LA 2A2IA 5C70A 1RSCA 3MCMA 1UR2A 4DO7A 5CZ0A 4N4PA 3EOEA 2X0SA 3WELA 4LBUA 2DSZA 3V1HA 1EF3A 3LLXA 3O63A 4XZLX 3M5YA 1YPFA 3TNBA 1JF5A 2CHRA 2DP3A 1XD1A 2AAMA 2AQVA 5HMFA 4HPNA 4NHVA 1NTHA 4FXJA 4KWUA 4IFRA 1CDGA 3M64A 3QC0A 4C5YA 1TFVA 4O0KA 1IWBA 2YCLA 3GVQA 3SCRA 4XO6A 3SJ3A 2BVDA 3PC0A 3KP1A 3I4EA 4ATDA 1AK5A 4XZNX 4ZXLA 1M6JA 1B4EA 3F5LA 3PAOA 4MYXA 4JXCA 1K8ZA 2W61A 2HVNA 1LL6A 4V27A 1EJUC 3BLLA 1SQ7A 3EYPA 2OLSA 2YCJA 1FTXA 4B5UA 1XC4A 2PF0A 2BGSA 5HBFA 5M5DA 2Q3RA 4UFLA 2J4GA 3QC3A 3SURA 3WJSA 1KTBA 2VD8A 2VEFA 1B31A 1QPNA 5C9WA 4C7FA 3WNLA 3QKZA 3H24A 5K9XA 4AD5A 4GQRA 4P8VA 1LOLA 2YXGA 4JCLA 4JTSA 2OEKA 3CPUA 2DVXA 4DAFA 1F4AA 5EMYA 5I3IA 4LQ1A 4FOKA 4IIHA 4PMRA 2PLCA 2MUCA 4TVUA 4DJFD 4I3GA 3LA4A 3E2VA 2VZOA 5BMXA 2VOMA 4NSBA 3W1XA 4DPQA 4X60A 3DECA 1PDZA 3LV6A 2ATSA 5T9CE 2GDQA 2NSOA 2BGQA 5AHEA 3UWVA 1UCWA 2WVUA 1OM0A 3PUEA 2UV8G 4NZFA 2ZXAA 3GNPA 4GI6A 4IQEA 4GCAA 3KS6A 1KCXA 3S5ZA 2RHGA 1J0JA 1G4PA 2NW0A 5BNKA 2FJKA 4YNGA 3V0SA 4QE5A 4LRTA 1KWKA 1EJSC 1CGVA 5GPRA 2EF9A 1TV2A 3VDGA 1TPUA 1TTQA 3W2LA 4RUBA 3MANA 3Q37A 3AZTA 3GXPA 3U7VA 4BHYA 3MV01 2F2KA 4A8NA 1DTUA 3FW6A 4BWLA 2HWGA 2VUYA 3ANUA 3EEGA 2EQDA 2C18A 2WMHA 4RNFA 1FH7A 1AD1A 3QV7A 3RIKA 5CC5A 1RUSA 4TUFA 1DWAM 5DBUA 3WH5A 1CXIA 4C7DA 2WMKA 1X6LA 2GVGA 2WSYA 4HP5A 1EC7A 3QOMA 1XHGA 1GK8A 4EACA 3HU7A 2Z1SA 4JGDA 4H6QA 1JRCA 2FZ9A 2OOGA 1XI3A 3T55A 1VEMA 3H22A 2QNEA 3CHDA 2CZ5A 4DXKA 1W3JA 4QRNA 1A0CA 3CASA 4ORMA 3PHAA 3TNOA 1OX4B 2DU2A 4GZJA 1XYMA 4B5VA 2B31A 4OWGA 2AL1A 3SADA 1H11A 4CGTA 1EF2A 4EWND 4HIBA 3B0UX 3SUWA 3C0QA 1S39A 2VZUA 4F2UA 4E8DA 5IBXA 5L6UA 1PIFA 1WUEA 2FYMA 1IWPA 2NQHA 1TX0A 3GR8A 3C2VA 1XPGA 1MDLA 2VI0A 4J3WA 3FJNA 3EX2A 4C6EA 3QEZA 2E9MA 2NT0A 1RJQA 1B57A 2ZXQA 3S42A 3CMFA 1Q3NA 4MIMA 4PB3A 4W5UA 4MNKA 3M7WA 4O13A 4XIAA 1E3XA 1XP3A 2Y8KA 1RZMA 3GG1A 4AHQA 3W00A 2QIWA 2VX6A 1IEQA 3EOLA 1QI4A 2E9LA 1NEYA 4G1KA 4UQDA 4O14A 4FAMA 3RPDA 1RCXB 3B97A 2E5DA 1MWOA 3VIPA 3VFLA 2HSAA 1IEXA 4DIAA 1F4HA 2BVTA 4NG3A 1FP9A 2OLHA 5LNVA 2AMGA 1VS1A 1TMQA 1HNYA 1Q66A 1ICQA 2I17A 3P61A 5F4XA 4D6IA 1VYSX 1D3HA 3AYTA 3WEZA 3TW6A 3QHOA 1OD0A 1E5NA 2AQOA 3QY7A 3NO3A 1JFXA 4JNMA 2REQA 4LAOA 1IZCA 1X7FA 3A3HA 3UXAA 3SN1A 3AHYA 4IG2B 2FFCA 2WJEA 5A5WA 2WSRA 2PWEA 2GUYA 1VYPX 3SM0A 1JNEA 3BDKA 3WLIA 2J24A 3WBWA 1DJQA 1T96A 2DZSA 2V3EA 4ECLA 4C6QA 4R85A 1LTDA 3Q4DA 3UU0A 3NQCA 4TQTA 4AY7A 8RUCA 4ILSA 3S0CA 3ZLHA 1K77A 3S47A 1H5VA 4PE8A 4HKPA 2A5HA 4Q7IA 4ZQPA 3TSBA 5F2IA 1KFCA 4UNKA 1WDPA 3P0WA 4F9JA 1TZ9A 1EB3A 1JCTA 1QNVA 1WKDA 4JL2A 4O12A 2FTYA 3UZWA 4IPPA 1HL2A 4LY4A 2XH7A 4JTQA 2DZWA 4DYEA 1HN1A 2YLLA 1JAKA 3DKJA 4AQLA 2VFEA 1FWJC 3P82A 5G2IA 3LSBA 2XM1A 4DBUA 1RP8A 2VZSA 5DX7A 1WBHA 4Z2IA 3BGJA 2QPSA 2R94A 3O15A 2O9PA 4W7UA 3SSJA 3OZYA 5FCZA 1W1PA 4K8EA 4G9PA 1ZUAX 4FA3A 4N9EA 3IJ6A 2PDBA 5TF0A 1ZP3A 1B0IA 5CJMA 3AAMA 1SW3A 1E0XA 1RR2A 4O19A 1J6OA 2PTXA 4YTRA 1EA0A 2CXGA 2X40A 4HNUA 2X1UA 2NXHA 5AECA 3BK0A 4Z2KA 3TQVA 4YTSA 2QCLA 4LF1A 4AY1A 4AZ7A 2Y5JA 4OU1A 1UP2A 2D0HA 3G6LA 5CKSA 3D5HA 2GSJA 1XGDA 2BOFX 3UA3A 3M0LA 3MSRA 3L4YA 3ARPA 3KLKA 1JZ6A 3LHZA 3VZYA 3DU0A 2PDXA 2VX4A 1QHPA 1XCXA 2P88A 3U4FA 3LCIA 4GJIA 3NURA 1V93A 3H7VA 2YB1A 1G7VA 1YBQB 5ENLA 1TJRA 1MUMA 5AHMA 2V63A 3Q58A 4LW7A 2Q02A 3KOYA 4GGBA 2HE8A 3E2SA 3NL6A 2QMKA 4GQ0A 4H8HA 2VJXA 4JTJA 1MEWA 1OGSA 1MXDA 4PSRA 1MW2A 2GL5A 3T8QA 4JPGA 2BASA 4RZ4A 2DT1A 2J7GA 3P67A 1UKTA 5A8PA 2YDSA 1K8XA 3NPWA 1KFLA 3NL5A 4CLMA 3GTIA 4XVEA 4KWVA 4C6MA 1YEYA 3GXTA 2QV5A 4FLRA 4J3VA 3DI0A 2HCVA 2OX1A 1GCYA 1G69A 1C8QA 4GO8A 3WQWA 1GOIA 4L65A 2PBOA 3WD2A 5C2CA 1XICA 2WNNA 1NFBA 3DFNA 1MI3A 4U3AA 4W87A 4HMEA 4LH8A 1EXBA 4ENLA 3W28A 3SCQA 2VGBA 2W91A 4PR4A 3ISIX 3W76A 3RU6A 1H1NA 3Q94A 1GW9A 1S3HA 2D1ZA 1XL9A 4GHRA 1SO4A 1TZ7A 1OZMA 2VEPA 3C0SA 3G1AA 3SECA 2VZVA 3LCLA 1PHWA 2QCCA 1TKKA 1GW1A 6ENLA 2CHOA 3P5YA 3C0JA 2PC4A 3NR0A 2V0TA 5EL1A 3I7SA 1YMYA 1I2PA 3GXMA 1JPMA 5TQLA 4GQQA 1UP0A 1PEZA 2ABAA 2J7FA 1GVYA 2Q09A 4IPNB 2ISVA 4EOUA 4HA1A 4KT2A 2ZZ1A 4AD1A 3H7UA 3CH0A 1LRTA 2BHUA 4A3QA 1QBAA 2ZUVA 3TXZA 2QCHA 1XLKA 1XCWA 5HMDA 2KX9A 5HXMA 4NZ5A 3GC4A 2VRKA 4TXEA 1IXOA 1XDMA 1CGUA 1TV4A 9XIAA 2V3FA 4IP7A 1W8GA 1W9UA 1KXHA 3A4JA 1UIOA 4KRUA 3MZ2A 5ABFB 5AYYA 2Q71A 3BL3A 8CGTA 3BMXA 4M24A 4M6VA 7TAAA 3VTRA 4U28A 4NVTA 3WUFA 3RFAA 4PH6A 2G95A 4UR7A 3QV8A 2ZZ3A 4GI9A 3WH9A 1FWIC 1IR1A 3T09A 1W5NA 5C0QA 3KVJA 4MSSA 2QV4A 3N04A 5IDIA 4LAKA 2EO7A 3GM8A 1H60A 3PFRA 3PPHA 4DI8A 1EWDA 4O50A 2IPWA 3UGRA 2XWEA 4RPQA 4GZEA 4XKYA 2FVMA 4M7TA 2XFFA 3VOFA 4M6QA 2GJRA 2VCCA 3VO0A 3ITTA 3ZQ9A 1LT8A 3PPGA 4UQCA 4PMVA 4GACA 1E43A 1OFBA 1XLGA 3VIOA 3U2EA 2QUTA 3E2RA 1JCLA 4X9YA 5BW6A 5A8MA 4W86A 4WD0A 3SRDA 3P7YA 3G1HA 1IT7A 1W5PA 1KM0A 1CTNA 3SIMA 2C14A 3VUSA 4AWUA 1GWJA 4OUIA 5CCZA 1EPVA 4FX6M 1UH3A 4A8LA 5JU6A 1GGOA 3W26A 2ZC8A 4R88A 2FDSA 2WMGA 1BGAA 3L7RA 4DWSC 4I6KA 2QJIA 4KERA 2FZNA 2EPNA 4J4KA 1LWIA 2A7PA 5FJPA 1SR9A 2OZ8A 3G1YA 4QTGA 3K13A 2FFIA 3WLJA 1TRDA 4DM1A 4UCGA 4R7WA 1F05A 1ZB5A 4QG9A 4AWEA 1VRXA 3M9YA 2J7DA 4UOZA 2Y85A 2G3IA 4TMBA 1M7PA 4KW2A 1WQ5A 4Y9PA 1TWIA 2OOFA 3F03K 3DYOA 4AWTA 3S9ZA 3ARUA 5FEZA 3N11A 1SZEA 4ACZA 1GKPA 3TOPA 1ITQA 3S5OA 4X9SA 3PZ9A 1YPIA 4E2BA 3AICA 3VCCA 3SUSA 2QR6A 5H91A 1GOWA 1UJPA 5D9MA 4AZIA 4CU7A 4F9DA 1PKLA 4S3CA 4REQA 4CQ8A 4ZFMA 3TA6A 2OSYA 4CU8A 4O0QA 1NF7A 5FF2A 3DGRA 3ABQA 3WL1A 1TELA 3VGGA 2FMNA 4LS2A 5K4XA 1RV8A 2WZEA 4B3LA 1R2SA 3WMBA 1NWSA 3ZSTA 1TZZA 3N2OA 1OB0A 3B04A 1I6NA 6PTDA 5K4ZA 5LGZA 3O9NA 4FR1A 2C1HA 2G3NA 4XBKA 2A4AA 5LGXA 4LY8A 4Q4KA 5CAKA 2D2JA 1E9IA 4EVZA 2Z2AA 4LS0A 4ZGYA 5BWAA 4FF7A 1E0VA 4DHGA 5KZEA 3O8AA 1KM1A 2BSLA 4A2SA 5A69A 3LERA 2KZHA 3CEPA 4S2BA 3NZGA 3VE9A 1JPKA 3I6TA 4K39A 3SCOA 4GK8A 3S5SA 4H7VA 4RW5A 2Z7KA 1MW1A 4UTIA 1I9CB 2OZTA 1JG9A 2J9XA 3QQWA 3PUDA 1AW5A 3LBCA 3U9IA 2H6RA 1VF8A 2PEVA 3KUMA 5ECVA 1LG1A 4N02A 4DO5A 4DYJA 4JAWA 3DFHA 3OLDA 5F1VA 1TWZA 2Y6ZA 3VGBA 4QDWA 5AYIA 1BAGA 4MKVA 4GIRA 4WF7A 3T0DA 4FI4A 1PTDA 2CESA 4LU0A 3SRFA 1FHDA 1UR1A 3R25A 5DXYA 1V0KA 2GJLA 2WANA 4E2DA 1JVNA 3NDOA 2W62A 4CNTA 1FWTA 1XF0A 2INEA 3FCPA 4L4OA 1TWSA 2GGIA 3SQMA 4RV8A 1JCYA 3GYCA 5HOSA 1VJZA 3BSMA 4GVHA 2H8ZA 4INFA 4MZYA 3KTSA 4ES4A 3H55A 3MUIA 5A3HA 4YU1A 2WQPA 4DWDA 3V5FA 2QJJA 2DIJA 4LV9A 2I7GA 1E55A 3AALA 2I9EA 4JTIA 2ZXBA 4LYKA 1XKYA 1A5CA 3CIXA 1US0A 4JTFA 3VIKA 4S3EA 3PZTA 4RXFA 3EOOA 1JDEA 4HK5A 3ABSA 3MKKA 1R3YA 4PCSA 4YWSA 5M3WA 1TQXA 1UG6A 5LSMA 1LUCB 4K36A 3FLUA 1C91A 4UMAA 3W2JA 3TYBA 4QSFA 3ARWA 1GQLA 5I3DA 1WPCA 2F38A 3RR4A 1ICSA 4ERIA 2WMIB 1KBLA 4GUHA 4JKMA 3WQPA 2YZRA 1WB0A 2Y7DA 1W1VA 2PI6A 1FWHC 3S1GA 5LNRA 3MDWA 1EQCA 2YL5A 4O10A 1OABA 4B5XA 1LUCA 4FPSA 1JZ5A 4GC3A 3LTSA 1MFUA 3WIJA 2VO5A 1DIKA 3W27A 4Y6GA 1LP6A 4RNIA 1S46A 2VDIA 4EP8C 4O11A 2YYTA 1A5MC 4PSPA 1I75A 3M4HA 3B06A 4CNPA 1CXEA 1RLCL 4Q8PA 1Q2RA 4S23A 2X16A 3LCFA 2HDJA 5J5DA 4FLQA 2YL9A 2A85A 3TTOA 1W32A 5FJTA 5HDRA 2R1NA 2ZVRA 6XIAA 1W37A 2IKGA 3OVPA 2J74A 3QMRA 5I07A 4K1GA 3G0SA 1R0MA 3BH4A 1FCBA 1SYTA 3T2QA 3AIQA 3PNZA 4HNVA 2V5KA 3ZFHA 3LGDA 3IJQA 4XD5A 5H8PA 1J0KA 2DJXA 3TMQA 2YCEA 3ELFA 4DF2A 1YKWA 4J27A 5FF4A 1F2JA 1YNPA 2ALRA 1RLDA 1KLYA 3T0AA 3AHXA 1PX3A 4GG9A 1MRQA 4Q4RA 4PCPA 5CSSA 3TYCA 1D8WA 3A13A 3K4WA 4OOZA 4S3FA 3S6TA 2P3EA 4B5WA 1JZ4A 3C86A 2QDHA 1MFVA 5CPNA 2VC9A 4ACYA 3AYVA 1GYMA 2XJ7A 4YTQA 1V0MA 2XIIA 3R58A 1IT0A 2CLKA 4JQ3A 1F6KA 4HA3A 3CXOA 5AFDA 3T81A 1X96A 1MZRA 5I06A 2E77A 4MUZA 5CLTA 2JF7A 3UERA 1K7XA 4GVGA 2DV0A 3MUCA 2HROA 1R2TA 3K2GA 3TYEA 1WXZA 1LM1A 2QAFA 1IT8A 4WDWA 4NX5A 1SFJA 2VCBA 3GVVA 2YBTA 3HGSA 3I3BA 2C3ZA 3KLLA 4Z0SA 3C5QA 1FHLA 3TA9A 2PSNA 3I7RA 4HU8A 4P8WA 3LMZA 3IAPA 2YIHA 3KFTA 1R3WA 4M5PA 1TPFA 2ADAA 3WEMA 3DX5A 4XD6A 5FEXA 3LZ3A 1CI1A 1PCWA 2BX7A 1TCDA 3VIHA 5DO8A 1C7TA 7REQA 1M01A 3RPTA 3CS2A 4PMNA 1GNXA 1POKA 1MMFA 3UA4A 1EYWA 4KGJA 1O66A 5CPSA 2OU4A 1A47A 7ODCA 5C2XA 2JIEA 4EK7A 5D2WA 1XLLA 1IIHA 2G0WA 1I60A 1FHVA 4X3ZA 1TV3A 3M46A 4DXXA 5BROA 3PJUA 2XVKA 4LC6A 2CKRA 2Y7FA 4HD5A 3ZMRA 3CHFA 4HT3A 3KTXA 1S5VA 1OC6A 4XAZA 2AKZA 1XWYA 4HCDA 2TPSA 2WVSA 3TZNA 3UVIA 2CZFA 4B90A 1UR8A 2EBNA 4J40A 2HRWA 1U1JA 3I65A 5FJOA 3KBVA 4UIOA 3TCSA 4FLSA 4LUSB 4PCNA 4MFDA 1ONXA 2TRSA 1WV2A 5EGRA 1D3GA 3UY7A 1FRBA 1DJWA 3W6LA 3FOKA 4Q4PA 2J79A 1KM3A 3L4WA 1J5TA 2GQ8A 1QAPA 1M5WA 3KWSA 1N55A 3NQEA 3FA5A 1X8CA 4QS6A 3W25A 2VC5A 3W22A 2EHHA 3HPFA 2W92A 3VKJA 4B4HA 2OWWA 4DB7A 3TSMA 4XZHA 5DXXA 1YE6A 3VCRA 3BW2A 3DDMA 4WIWA 4JQ2A 2P10A 4Z08A 4CUCA 2A79A 3K8LA 4QJ1A 1FHUA 1QNSA 1XLDA 5CXPA 3GG8A 3L5MA 5K9DA 3T42A 2PWFA 3RHGA 3FS2A 5JBEA 5F7UA 4KEUA 5A6BD 2GJXB 4HNTA 4AVNA 3AMDA 2QW5A 3B3DA 2Y1HA 2FVKA 3CJPA 5IOBA 3IGHX 1MXSA 4C6LA 1C8XA 1Z32X 1XFCA 3D47A 1US3A 1EXPA 3RCYA 1QPRA 4AHOA 4NNAA 3QXBA 1AH0A 3B8WA 3KCOA 3W24A 2ISSA 2XVGA 3NFUA 3CHEA 1QWKA 3GW0A 2WKJA 2OZ0A 1TYGA 1IXQA 4OECA 1W9BM 4JTDA 2BODX 3C8FA 1UUOA 4C1KA 1DXIA 4C65A 1HF6A 4JFVA 4BKNA 1G5AA 2CZEA 1GJUA 3GU9A 3BANA 2EAWA 1XYBA 2ISFA 2G3FA 1N82A 3W1QA 2CBIA 1LORA 4QE4A 1KBKA 1AL8A 2UBPC 4U5IA 4B5NA 2CLFA 3W84A 2F6KA 1EPXA 3A4WA 3EA1A 3PP7A 1UJQA 1TSIA 3ORWA 4LALA 4MZ1A 4ZO9A 1O5QA 4L9ZA 1KBBA 5JBDA 1JXJA 4JX5A 2X0YA 5AZ1A 1KB3A 1TJ0A 4BZYA 4MWAB 2VT0A 4U2YA 4CNUA 1UA7A 4X22A 1SPQA 3R0UA 2PDGA 3B03A 3MJYA 3MUY1 5G4EA 3VIJA 3ES7A 5G1MA 3N4FA 1LJYA 4PBFA 2ICSA 3BOXA 3QV9A 1TVNA 2E4TA 1V08A 1H1ZA 2DUAA 3TROA 3H4XA 1UWAA 1JZ8A 4U4MA 4KFOA 1Q7MA 3DG7A 2ANUA 2IQ0A 2CETA 3JVAA 3R8RA 3LRKA 3OLGA 1J01A 1Q2SA 3W7GA 1P0BA 4OBSA 4JZ5A 1VP5A 2W66A 1XLMA 1CLKA 1V0NA 4HOXA 4HHMA 2ZX8A 1WX0A 3KAOA 4V1YA 3ARXA 3GZAA 5I5RA 1S2TA 1XIFA 5FSDC 3MC5A 3ZJ7A 1J93A 3AS2A 3N2CA 3N29A 5CJ5A 1JDAA 3GDTA 3VKBA 4DPPA 3O7UA 4GX9A 5AYZA 3GX9A 4GFSA 1Z3NA 3LXCA 3M0XA 1OG6A 1XPYA 1V6XA 1QASA 1QO2A 4E6MA 3GNNA 3WLSA 3W83A 3S6DA 5BXTA 3B9DA 1TE1A 1DQXA 4JHOA 4FSAA 5HJYA 4MNLA 2DORA 2W3ZA 4GINA 1DQWA 4IL0A 3AXIA 5CAHA 1UR4A 3UWUA 1Q45A 1WE5A 4IOTA 1FXPA 1AODA 4JL1A 3KM8A 3BQ6A 3BCDA 4E8CA 1NFGA 2VWTA 1NJJA 2GYIA 4XO7A 4G1NA 2Z00A 4PMQA 1WOAA 3MHGA 2PWDA 2YA2A 3PUGA 4UTTC 4IWWA 1QUMA 3R43A 2H90A 5AC6A 1L2QA 1KRBC 1UWRA 4AF0B 3G1DA 1UROA 1J79A 3H2MA 3CQIA 3QMSA 1UWTA 3WLLA 3W74A 2Q8ZA 5EPDA 4DNMA 1WZLA 3LLDA 5T9BG 3QH2A 4S3DA 5HNTA 3IANA 5D8WA 2FVLA 4WXYA 3ARRA 2XUCA 1Q6EA 3JRKA 3OZMA 3UWYA 3CT7A 1S38A 2PTZA 3IIOA 3LEPA 4LUSA 3H2OA 1CW2A 4PTMA 2QVHA 4KS0A 3EBVA 2GK1A 3KOWA 4DO6A 1A50A 5T26A 2DZTA 2JBMA 4OHQA 1JZ7A 1O5XA 2Y63A 1KXQA 3BJFA 1ME9A 4K7YA 3SCSA 1NARA 4XD3A 4ICMA 1PX4A 2VENA 2IPGA 1E1CA 3LZ5A 3UY8A 2JGYA 4TV5A 4HZMA 3LI0A 3CWNA 4HPGA 4QG6A 2WYSA 1TR1A 4X0NA 3W70A 3VDBA 2OR2A 3N9RA 2RH9A 3BICA 1C90A 3UR2A 1V3HA 4JTGA 1VKFA 3BCJA 2QDGA 3WLHA 3QTGA 5CG0A 3UWEA 4LYPA 4ZR8A 4XUGA 3K4AA 2V30A 3WKZA 5BYWA 5HWMA 4RZ5A 5AC4A 1BWKA 3TXVA 1N2VA 3G77A 2VD9A 5IM51 2VGIA 4PMDA 4QLJA 4J5NA 4X61A 3E02A 4W8LA 4JTLA 3MY9A 1U33A 2Z25A 5PTDA 1BG4A 1QXLA 2A3HA 3EWCA 2E25A 5F2LA 2OKTA 3WBXA 2BZNA 4XZWA 1VIWA 3PN8A 2HXTA 1H62A 4ZCWA 2ZA3A 4J9JA 3DERA 5I02A 5U7SA 3VABA 4OZOA 3IEBA 1X97A 3T0CA 4CNNA 2Z2UA 4LOCA 5DMMA 3WENA 5HWNA 3OBEA 3PFMA 3UQNA 1Q13A 2VC6A 2YFOA 5C9RA 4R5EA 4Z2GA 4W8BA 1DP0A 2GSEA 3GU2A 3UJ2A 4QM1A 3MUZ1 4OV9A 4W5ZA