1TMLA

Crystal structure of the catalytic domain of a thermophilic endocellulase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
286
structure length
286
Chain Sequence
NDSPFYVNPNMSSAEWVRNNPNDPRTPVIRDRIASVPQGTWFAHHNPGQITGQVDALMSAAQAAGKIPILVVYNAPGRDCGNHSSGGAPSHSAYRSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQQEVLETMAYAGKALKAGSSQARIYFDAGHSAWHSPAQMASWLQQADISNSAHGIATNTSNYRWTADEVAYAKAVLSAIGNPSLRAVIDTSRNGNGPAGNEWCDPSGRAIGTPSTTNTGDPMIDAFLWIKLPGEADGCIAGAGQFVPQAAYEMAIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the catalytic domain of a thermophilic endocellulase.
pubmed doi rcsb
source organism Thermobifida fusca
molecule tags Beta-amylase
molecule keywords ENDO-1,4-BETA-D-GLUCANASE
total genus 102
structure length 286
sequence length 286
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 1993-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 1tmlA00
4AVNA 1UOZA 1TMLA 4I5UA 2BOGX 1UP3A 1GZ1A 1UP2A 3VOGA 4AX7A 3A9BA 1HGWA 1OC5A 1DYSA 3VOHA 3A64A 4AVOA 4A05A 3VOJA 1OCNA 1UP0A 3RU8X 3RPTA 1CB2A 4I5RA 1QK2A 4B4HA 1OCJA 1BVWA 1OC6A 1HGYA 1OC7A 3ABXA 4B4FA 2BOFX 3VOIA 2BODX 2BVWA 1QJWA 4AU0A 4AX6A 3VOFA 2BOEX 1OCBA 1QK0A
chains in the Genus database with same CATH superfamily
1TR9A 2ZZ1A 1FH7A 2W62A 2AMGA 2W66A 3S9IA 3OGVA 3TR9A 3GNXA 2O9TA 1FCQA 4LSBA 4GH1A 1DJGA 4R88A 3BCJA 4MKVA 1JZ4A 4A3RA 5F4SA 4H04A 3W82A 3A23A 4LVDA 3GR8A 3TQVA 1CX9A 1H1ZA 4GGBA 3WK2A 3S5YA 4LEFA 3L5MA 2R91A 2V81A 2Z0IA 3WUGA 2EPKX 1P0KA 1GQLA 1WBHA 5F2LA 1VFSA 2RGMA 5XIAA 5K2ZA 2BFGA 3BW3A 3PBVA 1KTNA 2X1TA 4DIAA 5LIUX 4S3EA 3IJLA 1EC8A 1HIZA 2G50A 4LS2A 3VD5A 3SCTA 5D2YA 3TYZA 1LROA 4GQQA 1H09A 1K8CA 1ICSA 3B8VA 1XF0A 4LF1A 1XPYA 3N14A 3G77A 1XLAA 4EWJA 1SJDA 5B7ZA 3NQVA 1BGAA 1EJXC 4L56A 2BBFA 3SUUA 2YL9A 4DZAA 3UNDA 3GVVA 1E0WA 1PDZA 2C91A 1B3OA 3DC8A 1JCMP 1SW3A 1Q4WA 1LWIA 3M0VA 4D72A 4PCFA 3WD3A 4Z2GA 1FWSA 1ME9A 1FFQA 1YTEA 3QVQA 2WVTA 4JYDA 3PZ9A 3FGCA 4PYSA 2PPGA 4PFMA 3BG5A 1EPVA 3UWEA 4ZZ9A 2FH8A 4MGGA 1PYFA 4YNGA 4HOXA 5C9WA 3BANA 4HHMA 2PODA 3N73A 1O68A 3NDYA 2EGZA 4R7WA 4PMDA 1FWIC 3N11A 4G6CA 3PF3A 1PAMA 4AC1X 4PMXA 3C0QA 3S1GA 3SN0A 4MLRA 3CL7A 4LUSB 2C1GA 4POCA 3MCMA 4I8DA 4W5ZA 3IJ6A 5DMYA 5E6ZA 1SJBA 4UFHA 2DVXA 3T4CA 1YYAA 1CCWB 3B0PA 3W2MA 2X40A 1AH4A 3N6HA 3M5XA 4MNMA 3ITVA 1E1CA 3W1NA 2IPWA 3DYOA 1DIEA 4US5A 4D2JA 3NDOA 1OVDA 4B5TA 3ZSSA 4S3JA 4YHGA 1IIHA 2QT3A 4NF7A 3NL6A 5FOOA 3EPNA 2ZUTA 3BAWA 3LTPA 5TNVA 1QXLA 4H41A 2PE4A 4TVDA 3UGVA 3GC5A 2AGTA 5F2IA 1EDTA 4MYAA 2WCGA 3GHTA 3VD3A 1QW8A 2WXDM 4AZ5A 3PZQA 1O5XA 3P81A 3BE7A 4YVXA 3TN3A 4ZQPA 3O63A 1DTNA 5CZJA 4FLRA 1QW7A 3FKRA 4HIBA 2E09A 4WCJA 3ABSA 3TJLA 3GDKA 4HCDA 4ZSUA 3LV5A 3EWBX 3CAVA 1WXZA 1NF0A 5D8WA 4MWAB 1FXPA 1ZJHA 3C8NA 3POHA 5JMUA 3WDJA 1PTAA 3VDAA 4UTTC 4AD5A 4OZOA 3AIVA 1BSIA 4RL3A 3TSMA 3LENA 4AAJA 3ZJ6A 1NOFA 1V02A 4DBEA 1TO3A 3ES8A 2J7BA 1SSDA 2V5BA 2PWUA 3RCMA 3H2CA 2FH6A 3WDIA 1YNPA 2WMGA 1WKFA 5LGZA 4S3KA 1KQYA 1WX0A 1ONWA 4HNTA 1TWSA 4TVCA 2O55A 1EC7A 3W01A 5M2FX 3RPTA 2I5IA 2W0UA 3NAVA 1WOBA 3T81A 4KIRA 5DY2A 2PDXA 1FRBA 4AISA 4NNAA 4BF5A 3PZIA 1B57A 1K70A 4NJIA 4L1GA 3SUVA 1N8IA 4OIFA 2GJXA 1FUYA 2I56A 3V5CA 4Q8TA 5C7VA 1XYFA 2RH9A 4KT2A 1S2WA 1DIDA 1M7OA 3IGHX 1XYBA 4XZHA 1FP9A 1XH1A 3AMCA 3PBGA 1MW3A 4GIRA 1S3HA 4ML4A 1G9HA 2EG7A 3LYEA 3GIQA 1ZB5A 1MXDA 2BLEA 2QNEA 1O12A 3GNPA 4GG9A 5AC8A 3VIPA 4JXCA 2OXNA 5HWJA 2CLKA 4HN4A 3ZJ7A 2E8ZA 1CXEA 4XG1A 3UJEA 4WDTA 2QCHA 4AD0A 3ITCA 1S1RA 4F2TA 3AUOA 4HZ8A 1ZZMA 3SCWA 3I7SA 4IX2A 3PZVA 2Y8KA 2WPBA 3N6JA 4FO4A 1Z8AA 4OT7A 2Y7GA 4FB7A 4GYFA 4BCEA 3LS9A 5DCDA 3BDKA 4PUWA 3VO0A 3VD9A 5BWAA 4EAMA 2PDWA 2VX4A 4UOZA 1PE1A 2P3ZA 2OSXA 1UWTA 2PCQA 4PE8A 3F2DA 4NHVA 4J1OA 3A4JA 3BCFA 3T0TA 3AS0A 2AAMA 1MMFA 4GNJA 1EQPA 3EWZA 3B40A 4NZFA 4PA8A 1AH3A 2RAGA 1Q6GA 1H7WA 4H2HA 1WDWA 2FPVA 4V27A 3UETA 2H9AB 2WMHA 4FP1A 2XU2A 3BZGA 3IS4A 3MHGA 5CJMA 1A5NC 3L7RA 1DJZA 1JI1A 1UP3A 4J3ZA 2ZWYA 1W2VA 1EP1A 1S2CA 3V0UA 3OLEA 3S0CA 5G5IA 1JQVA 2AMXA 2RDTA 2WMFA 2P10A 1EYEA 2JQXA 5GJPA 5CJ5A 3CUGA 1LBFA 1A50A 2IMRA 3LZ3A 1CXKA 4ZFCA 3GTXA 5T8GA 2J88A 4AU0A 1J5TA 3B8IA 2NVCA 1HVXA 3BXWA 3V1PA 5HPOA 3MBDA 3PUGA 4PMRA 5LNUA 2GVYA 3W02A 5I3HA 5HR7A 3CV2A 1H1NA 1MZRA 4CKQA 4HYRA 5SWUA 1RCXB 2F38A 3KW3A 1HZYA 4AFYA 3IVUA 2ALRA 5KITA 3EB2A 3NXLA 4FI4A 1KM3A 7REQB 1FWFC 2PDCA 3W6LA 1NDYA 3IUIA 3LM3A 1J6PA 2WYSA 3TYDA 3WL0A 1VRXA 3SM0A 2Z26A 4UMCA 3EDEA 3TN4A 3ZWTA 3DOPA 1PYMA 2FLIA 3NCOA 3D46A 1PWMA 2EPNA 5AVHA 3MYOA 4JY9A 4JTUA 3VYLA 4FX8A 3NFUA 2PTZA 2XH7A 1A5BA 1V02E 4OBSA 3L21A 3M64A 1YTDA 3LCFA 5AFDA 2DV0A 4HU0A 3ATZA 1GVQA 3BH4A 3GH4A 3F5JA 2TAAA 3WLTA 5A6AA 4GFSA 2YDSA 4DLMA 1AK5A 4FALA 1W6TA 3NQAA 3PTDA 3O9NA 3EXTA 3TAKA 1BRLA 1SGJA 1DWIM 1GJWA 1V4YA 3MKKA 3UQNA 3W86A 3URNA 3PY2A 3WBWA 2PF0A 4CD5A 2CNCA 3VK5A 1AG1O 2QS8A 3GFYA 3BOFA 1OEPA 4FIRA 3RG6A 1UIOA 1O60A 4NI8A 4DBSA 3BGGA 9CGTA 3B0UX 3W26A 2Z6JA 4RDZA 1PKNA 4NZ1A 1NARA 3ITLA 4PEKA 5GNYA 2GWGA 2ZZ2A 3MTWA 1XX1A 4NASA 3A4XA 4NZJA 2ZXAA 1RK5A 5ABHA 4JTEA 1FTXA 4DZHA 2PDBA 4BI5A 2A79A 1AW5A 3PFMA 1JDEA 3BQ6A 2ICSA 5IHSA 2JKAA 3N2MA 3NEHA 3AS3A 3ZZ1A 4TU1A 3G1SA 1EB3A 1DJYA 5B80A 5D32A 4K36A 4JFUA 2GGEA 3C61A 5LIYX 1C7SA 6TAAA 1OT2A 1LLZA 2A7PA 4PTVA 4Z2LA 3BAKA 1TA3B 5DXYA 2GVLA 3IEBA 4OOZA 4K6AA 4XO6A 1JPIA 2QAPA 5C2GA 4M8UA 5A2AA 2J77A 4DB7A 3RMEA 3QY7A 5KETA 2ON3A 4PSRA 1EEXA 3OW1A 1MI3A 4LS0A 4GNKB 3M9YA 3CIXA 1UP0A 4A3HA 3CIWA 4M7TA 1EYWA 4IFRA 1T6MA 2OO6A 1QWKA 3WUBA 4Z2HA 3AHZA 3F4DA 2CZFA 4ADSA 1R2TA 2BY0A 4ECLA 1T99A 3PK7A 1R3SA 3G18A 3CS2A 2RDWA 1JRCA 1S5MA 4RPPA 5H8PA 4IMCA 4UZUA 3QYSA 3ZM8A 3W38A 4U2YA 5JBEA 5I79A 3UJRA 3CHFA 4F4RA 3ARVA 4N02A 2BASA 2PWHA 4DPQA 4E2OA 4RDVA 3ZJKA 1KRBC 3CAWA 1C90A 4V33A 3WUFA 4PGLA 3KTCA 4RKAA 2WWDA 1LLOA 1QHZA 5AYZA 4M19A 3FV9A 1W9VA 3HO8A 1XGDA 1EPXA 2J9YA 2JALA 1QPRA 3T8QA 1TJ0A 2PC4A 1XUUA 3V18A 3R4IA 5D9MA 3VIFA 4NKCA 2VX6A 3M6YA 5I3FA 4UTJA 1AZ2A 3F4WA 4N2YA 4IISA 4GNVA 1XIIA 2Q3OA 4J35A 2Z1XA 2E4TA 4IPJA 3WD0A 1CZ1A 4A21A 2ISWA 4GXWA 3LOTA 3GYEA 1HVQA 1GONA 2E67A 3WLJA 2QPUA 2Z28A 2ZVRA 1SQ7A 1FHUA 1R3QA 3WK0A 1O1ZA 2G37A 2Z1KA 4IUGA 1NEYA 3VIOA 2VVNA 3UCQA 4PUEA 3S2NA 2ONEA 3WLQA 3EWDA 5AHNA 4FMVA 1PZ1A 3WQCA 1M68A 2VC5A 1HT6A 2CLIA 1TTPA 2CBVA 5BZAA 4MJMA 2AOSA 3AWNA 1LORA 5DELA 3W2LA 2Z2BA 3GR4A 1AL7A 1QPQA 6ALDA 2BVYA 4OTKA 1XS2A 1RCOB 2X2GA 2YB4A 1FWTA 4U3AA 3W25A 4G1NA 3KVJA 5G4HC 2YW3A 6XIMA 4B5SA 4IIGA 3WELA 4DQWA 2X0HA 4Y2WA 3GS6A 4L9ZA 2Q71A 2J74A 3THAA 1HGWA 1R46A 4DWSB 4Q7IA 2ZICA 2EXOA 2YYTA 2CHRA 3MVIA 3WD2A 1BWLA 3BAJA 1E4LA 4KEMA 2FZBA 4KFOA 3RHGA 8A3HA 3APTA 3K4AA 2QUNA 3L2IA 3S47A 1P0DA 2Z7GA 3HPZA 2BOGX 3GZ3A 4HSOA 1VHNA 2ZZ3A 1F05A 3N19B 1JQXA 1GVIA 3ITYA 3OO2A 5MKGA 4B5WA 3PTQA 3HA1A 1D3CA 2VP8A 3W88A 4WY0B 4JTKA 3QPYA 1OC7A 1TV3A 4CD7A 1AJ0A 2V38A 3AROA 3L4YA 2O7SA 3HV8A 1I8JA 1AFSA 1XIDA 4CU6A 1IEIA 3FA3A 1XCFA 2QV5A 1ZRQA 3KVKA 1FWJC 3QQ1A 1EXPA 3SY8A 3AJ7A 4QG6A 3NQEA 3R12A 5FJPA 1XBVA 3TTEA 2GGHA 1TJ1A 2G5WA 5EB8A 5EY5A 1LBLA 1HKKA 1ITCA 3MC5A 3IARA 2X30A 4DM1A 2WSYA 3ARZA 4GYKA 4JFSA 5TBOA 3OGRA 1OBAA 2ASHA 3DBNA 4MJ2A 2ALDA 3LHVA 4WY0A 1YW1A 5C2CA 1XDMA 3W84A 4S3CA 1R6WA 1YEYA 3ES7A 2RJGA 2BGQA 3D3FA 1HJSA 4MUPA 3W00A 4IWWA 3EWYA 5BOOA 4DJED 1XLBA 1XYAA 1UWUA 5J5RA 5B7YA 2HK0A 2WNQA 1A5OC 4DO5A 2B7NA 4K8HA 3FXGA 1E6XM 1JEZA 5DLCA 2W9MA 4JN8A 4DX3A 4G2DA 1FWRA 7TAAA 3S46A 4ERGA 1VF8A 1EF3A 1UR9A 3DUGA 2YBUA 3RNDA 3VTRA 1V08A 1DJNA 5F1VA 3C2RA 1UJPA 3MUIA 3FKKA 3UVIA 2DW6A 3TW6A 4GQ0A 2OEJA 4K68A 5H2ZA 1WAWA 3WJYA 4BZYA 4WF7A 1PX3A 3AMGA 1XPGA 2O9PA 2QUMA 3DFYA 3VOFA 2VEGA 4PB5A 1ECEA 4HSNA 2O4MA 4FLOA 3MWCA 2J6VA 2C6QA 4N0RA 4EXQA 2VFGA 2E25A 3NQ8A 3ARUA 2Y24A 4JKLA 1WDSA 1JRBA 2PD5A 2W79A 1B4KA 4XK2A 4CN4A 1PBGA 2E0PA 3UZ5A 3WL1A 1S46A 4KWWA 1UUQA 1F3TA 1XJBA 2HISA 3CHVA 1WQ5A 1I1WA 5FEXA 1XQKA 1K4GA 3E02A 3TTYA 4HJWA 4CQAA 3N2CA 5CZKA 2OYMA 4P5UA 3TTSA 2XH0A 1QBAA 1ZUAX 3TTOA 1I0DA 2ACUA 3WFAA 3H54A 3COTA 3WQ8A 4H9XA 2VR5A 5HNRA 4UWMA 3S5SA 4OVXA 3W7IA 3RLVA 1TJ2A 1I0BA 5BRPA 4LVBA 4PTXA 7PTDA 2EPMX 4M6UA 4NAFA 2NW0A 5GPRA 3WQ4A 4DZ5A 4QITA 4DELA 3TW9A 1VFHA 4ZOAA 1UWSA 3B4YA 2QUUA 3W29A 3LM7A 4H1ZA 3SW6A 4KF1A 3VIKA 3AIRA 1TPEA 2QCLA 1GT8A 3CT7A 4J3SA 3KRZA 3LUTA 3JZEA 1L6SA 4JTRA 6A3HA 3ZXWA 1A0CA 1ZBWA 3N2BA 4DAIA 2V3GA 1W17A 1MXGA 3OVRA 5AYXA 3D3AA 4A35A 5J5DA 1DWHM 4V2XA 3W76A 2FHBA 4LVFA 5FAGA 1E6QM 1FKWA 4AHQA 3QYQA 4Z1BA 1GOXA 1KC7A 5HATA 4H01A 2PC8A 1YNQA 3FX4A 3ZFHA 1U30A 4GD0A 4CNUA 1VIZA 1EDQA 5LKYA 1JZ8A 2CLOA 1PO9A 4LQ1A 2WKGA 2W4XA 1AQFA 4DEFA 1HJVA 3RPMA 2A1YA 5LIWX 5I06A 1EJRC 2PWDA 4NZCA 1SFTA 3BGAA 3LCGA 2R82A 3LBMA 4MSSA 1EC9A 4HU3A 3UF9A 4RW5A 3PZGA 4UNKA 1NWRA 3EMQA 3HQ1A 3W1MA 2FB3A 3IANA 2QF8A 1DHPA 4UTMA 3GAYA 2IKIA 4ROQA 4XSMA 3BAXA 1G7UA 2YBTA 5J8LA 4WR3A 3G1DA 1JAKA 2PDHA 5LSMA 2Z27A 4G5DA 1YKWA 5EKYA 1XINA 5FSDC 2Q02A 4MDPA 4GJIA 1Y5VA 3ENLA 4HHHA 3TCEA 2WC3A 3GU2A 4HCHA 2Y6ZA 3S1WA 4PTDA 5HQEA 4QHRA 1UR1A 1WKEA 2W3ZA 4KWVA 4AD2A 3T78A 4AY8A 4FNQA 2Y85A 1JZ5A 1KM6A 3RO6A 3B97A 2VWSA 3AZTA 2P50A 1DV7A 3GVWA 1W5MA 1OZMA 4CN6A 4XZLX 2O0TA 4ZCWA 3CZEA 4REQA 4PUMA 4U5IA 5D30A 1VPXA 3WBEA 2OOFA 1Z3NA 3SI9A 4HBKA 3GXTA 1OABA 1ZCCA 3SGZA 5PTDA 4XAGA 4FAMA 4JTJA 4WY0F 1T8XA 1TTQA 3PVFA 3LHUA 5AHMA 3RRXA 1GG1A 3VZZA 1VQTA 3QFWA 4K1WA 4NSBA 1G01A 1UWIA 4CQDA 2ZUMA 3GFZA 5AYIA 2DZWA 1R3RA 1OGBA 1NP0A 1SUXA 1IEXA 1KR1A 5IOBA 2OT0A 1CGYA 2VDHA 4XD6A 4ACZB 3LCXA 2ABAA 4XV0A 2XSAA 1JD9A 3AIEA 1OCJA 3R10A 3THDA 4NILA 4I7VA 3W7LA 1KM4A 2Z2AA 2XN2A 2XIQA 1M65A 1IF2A 2Y88A 3LRMA 1JCXA 3D6NA 2WVSA 5XIMA 1QVBA 4O17A 3ZLHA 1Q6LA 3O6DA 3ATYA 4D8LA 3KBWA 4RXGA 5DN1A 3HGRA 4YXGA 4IX0A 1ZAJA 5HMFA 1UR8A 1BG4A 1MUWA 5CC5A 3SJNA 3N3MA 3PC0A 2NLYA 3OG3A 3L65A 4GOAA 1HKMA 1M53A 2W67A 1QHPA 1UQZA 1A53A 2WJZA 2BOFX 3BURA 1E4MM 4DO6A 3ZIZA 4WDWA 3BC9A 1ALDA 1PXGA 1QW9A 2VC6A 4UB9A 3R7MA 3EX2A 3P3BA 5I2UA 3TW7A 3SUSA 4JOMA 1IXQA 3BVJA 4HVXA 4WDXA 5BRQA 1F2JA 2GGJA 4K3ZA 3TQKA 2VDIA 1XRTA 1DXFA 1W56A 3OIXA 2D2GA 3R8HA 2ATMA 3WEOA 1EP3A 1XSJA 4WX2A 3TMQA 3EXSA 5HDRA 1AMYA 2GK1A 4EXAA 2GJRA 4MMWA 3FJLA 5A8NA 3H4XA 4BQ2A 5TQLA 3RM4A 3G5EA 3L23A 3Q67A 4E0CA 4AX6A 1SZRA 1V6UA 2XZ7A 5C5YA 1XC6A 3NPXA 4MB5A 4EAYA 2GSHA 4F9DA 2UZ9A 1UWAA 4D9PA 4EP8C 2P0OA 4PSPA 5A2CA 2E9LA 4QR6A 4YTTA 4ZQOA 4W8BA 4AHOA 2ZA3A 3FHAA 5CBJA 3MUAA 2GQAA 3GYCA 5F7UA 4K39A 2WMIB 3VGFA 4HPHA 4XX6A 1KCXA 3A5FA 2PLMA 2XVGA 4MJZA 1H7NA 3M0IA 3P93A 1V3MA 3E0VA 2GJPA 4LCSA 4JTFA 2VRQA 1WA3A 1JCLA 5CSYA 3L5AA 3PP7A 2HV5A 3HPAA 2J9XA 2VENA 3VOHA 2PEVA 5E93A 4P61A 3NOYA 3DBPA 3UESA 3EX6A 1KW1A 3CUJA 1C91A 3KBJA 5GJNA 3UXLA 4E4UA 3H7UA 3QGVA 2NZLA 3G22A 4M0XA 1P7TB 4AYSA 2I14A 1L9WA 4JTIA 3K1DA 3UT0A 3GG0A 1IT7A 1TZZA 3MYPA 1BVZA 3VKCA 4LUSA 2FTWA 1X8CA 4YTQA 2PP0A 1XIMA 4WXZA 5I3GA 3UU0A 1IXNA 4RV8A 4AVFA 1IXPA 2XGIA 2GOUA 5CGTA 3WFLA 5C9XA 4IXHA 3KXQA 4XQ6A 3PR2A 4Y8EA 4US6A 1D8WA 5D9PA 2XSXA 2J8FA 4L9YA 1GKRA 3L0NA 4GX8A 5D2XA 2OEMA 1W2PA 2XM1A 4YU1A 4FXRA 1YQ2A 3PBWA 2DZXA 4BWLA 1VENA 1GPWA 4FOUA 4NNCA 3MHFA 1RQBA 3EOOA 3BLIA 5HJLA 5JIPA 3K13A 1VGAA 4EACA 1PVNA 1B0IA 2G0WA 3W0KA 1W8SA 4KWSA 4GYPA 5IBXC 3SRFA 3FJ4A 1MEHA 2Z4GA 3TU9A 4A2SA 3HFYA 1L6GA 5I02A 4H19A 3WQ6A 1E4IA 2POTA 3I3EA 3BQ5A 6REQB 4TOQA 3IJIA 4G56A 3K4WA 3H8AA 1KFWA 3E5BA 3USBA 3GK0A 1EA0A 1MUMA 1CYGA 4H7ZA 3ERPA 2G3MA 2ZRWA 1R9XA 3UG8A 3UWYA 4GQGA 3RF9A 9XIMA 3WQDA 2BHZA 4C6NA 4LUYA 4LV4A 3DCPA 4HNUA 1R2RA 2W6RA 4C6BA 3T0BA 1FH9A 2DGAA 1OFBA 1SM9A 3L67A 3MB9A 2UY3A 1JD7A 3ZT5A 4FX7A 2VX5A 1CPUA 1O4UA 3GR7A 4OGZA 3QFEA 4WSHA 2FTPA 3DYMA 3HB9A 4UTUA 2QCFA 4ZSTA 3VGEA 1VCFA 3BLLA 3PZMA 1T40A 2P8CA 2DFAA 3ARXA 4KFPA 3SO7A 3TWBA 4CNTA 3IK2A 1FWCC 1FDZA 1MEIA 5FEWA 3OJGA 3FGCB 3NGJA 3IK4A 4M81A 1FWEC 3TQPA 1IGWA 4GABA 3TEVA 3M0HA 2WQPA 1UKPA 2D3LA 4KEUA 1V6WA 2PLCA 2Z1BA 4RE2A 1XISA 4AZCA 3AFBA 5C9RA 3QSTA 4KRUA 4C91A 4ALDA 9RUBA 4KEZA 3UERA 2PDGA 3EB4A 3KUMA 1K9FA 1GQJA 2G97A 2OX1A 1E6RA 3R94A 4ATLA 2DJLA 2A7NA 4UMAA 2QDEA 3IIVA 1JUBA 4MB1A 4ZXOA 3N4AA 2HE8A 3H2OA 4NZ3A 3WF1A 4PR4A 4C5YA 1IEWA 3TZNA 1MO0A 3VIIA 1ISVA 3MBFA 4O16A 1QNQA 5JBFA 2ANUA 4MFDA 4JTQA 1C92A 1P0BA 2X41A 1JUEA 1XM3A 2WZTA 3A9BA 4O15A 3R89A 2B4GA 4CCCA 2Y89A 2ZC8A 2PLKA 2YFOA 5EFFA 4FXFA 2E6AA 5AZ0A 2VTFA 1A47A 4HNOA 4RR4A 4YTUA 4IG2B 1QAPA 2RKXA 2C19A 4Z1AA 5CG7A 2G41A 3VGDA 3RU6A 4EE9A 1ADSA 5LXXA 4UXDA 3VIHA 3PTMA 2EKGA 1A5AA 2HQAA 1BVWA 4ICMA 3Q94A 2VC7A 2WCSA 1LP6A 1GGOA 4J3UA 3VNJA 1XD1A 3QQ0A 3D47A 4Y7EA 8RUCA 4R5EA 4RE3A 4Z1DA 4QLLA 2D2HA 1MFVA 3AXKA 2DIEA 2EHHA 4S3GA 2DZPA 3FEQA 4XIAA 2PDPA 1MYRA 3LDVA 3VIGA 4FNUA 1HO4A 3H4GA 4AIBA 2Z24A 1NAL1 4LYKA 1ITXA 1XD0A 4RJEA 1IE7C 1UKOA 1UZ1A 4J40A 4BKNA 3JVAA 1I9CB 2VEMA 1XCWA 4JIQA 4IPPA 2FPYA 1FHDA 5LIXX 3TC7A 5I23A 4YHEA 3M6DA 3RLGA 1GUVA 1YMYA 5EMYA 3REQB 2Z29A 4QAIA 1UMLA 3NQMA 4JDBA 4FF7A 2PAJA 4LAUA 4IG2A 1UWQA 2ZE0A 3V5OA 4CNNA 3UBPC 4UFKA 2NQ9A 2NUYA 4C6JA 4QQUA 4JIEA 2BHYA 2ZX6A 2JIWA 1V0KA 4DWSA 2GL5A 4F3HA 3WDRA 4NYYA 3EDJA 3SURA 3W07A 3E74A 3G2GA 2WSRA 1MQQA 2VKZG 4CD6A 3APGA 4U31A 4JTCA 1F3WA 3LK6A 4HTYA 4IL2A 3UCDA 3DFHA 3C0JA 1V93A 3TCSA 3ZR6A 3M5YA 3HGOA 4P8UA 1WXJA 1E72M 1DJXA 3ARYA 1EJWC 3C56A 3W1AA 4DJFC 3CWOX 1S2AA 5FKYA 1U5JA 4QG8A 1OX4A 2QDHA 4KGLA 4MVAA 4QS6A 3PZOA 1CXLA 3DG6A 3FFSA 4DUOA 2ZUSA 2AGKA 4W9TA 2E1DA 4GC4A 4N9CA 3M47A 5FA5A 3LGGA 4L80A 3OVPA 3FS2A 1B90A 1YTKA 2F6KA 1IZKA 1QT1A 5G2IA 2GQ3A 4RDWA 5M3WA 3B8TA 1DVJA 1UG6A 1VH7A 1OB0A 1ZCOA 2G95A 4IQLA 1UD2A 4F79A 1VP5A 4P2VA 2PURA 1B9BA 4N6FA 2ZXQA 3SCNA 3TYUA 2GK1B 2ZXDA 1SJCA 1TJPA 3VABA 2PA6A 1LRNA 4LYRA 3CQKA 4LNCA 4Z42C 3NSXA 1BQCA 1W31A 1KFKA 4R9XA 3SB0A 3MO4A 4REQB 1KCLA 1UC5A 3IGSA 4IPIA 1UB3A 3VGGA 3CUFA 1HQTA 4PMYA 1NTHA 5ENLA 4UR7A 3KRBA 3A21A 2OO0A 1TVPA 1W3LA 4B9ZA 4WJ8A 3VU2A 5I00A 3HTWA 1H0GA 3IIOA 4QEHA 4ZQMA 1VEMA 4ZBCA 4LU0A 1UQYA 4V1YA 3O0KA 3UWVA 1R0MA 4RNFA 1QNPA 3WCZA 3LTYA 5BCAA 4QNWA 3LRKA 3AU2A 4LUTB 3GRIA 1W54A 3KAOA 4IJBA 4ZOBA 4ZFMA 5GNZA 4MWAC 1DE5A 3WBXA 2Z1VA 5C8BB 1Q6OA 2VM8A 2VC9A 1ZP3A 1UZHA 4R3UA 5LYRA 4UIOA 3AISA 4PUUA 3GVRA 4J4KA 4ZO6A 5I77A 1H3GA 1N7KA 2YYUA 3UYIA 3ZO9A 3N9KA 1VS1A 1R7OA 3M41A 1XUZA 1U22A 4AEFA 3T6CA 1LG2A 2Z1SA 3L0KA 3ANYA 4NXSA 2J62A 2OLAA 1JAEA 4LYQA 1YX1A 4GX9A 3PZTA 1ZFJA 4M6QA 1SZEA 1BEUA 2BP1A 2W61A 3S83A 3S1UA 1F8MA 1OJXA 2E68A 1GZGA 1S38A 5EPDA 3LBCA 1LBMA 1BRLB 1AQHA 4PCSA 3OTRA 4B90A 2BXZA 2VI0A 2CPUA 2PBGA 3LB0A 2VGIA 3AS1A 2DJXA 3MSDA 4R27A 5A2BA 2INEA 1CNVA 2J79A 1FWGC 2Z1WA 4ATWA 4MWAE 5K7JA 5G4WA 2UY5A 1DOSA 1AA1B 1XHGA 1EIXA 2VFIA 3FEMA 4ILSA 3MY9A 1XQLA 3N9RA 1BKSA 4UFIA 2YL8A 2WLYA 4JIPA 3UZWA 1TZ7A 2Z25A 2HE5A 5TD4A 4OBTA 4GE8A 2BOEX 4HK7A 5IBXA 2C7FA 3G6MA 3EXRA 1QPKA 1TVLA 4WKHA 3W24A 1BKHA 4WSJA 3L4TA 1GEHA 3WLIA 1V5XA 1S5NA 5JXQA 2TRSA 3K4DA 2BODX 1C8VA 4AZIA 4HZ7A 4DI8A 3WX7A 4JD4A 4CEUC 1TMHA 2CXEA 3GG1A 1UPMB 2VQUA 3QV6A 3H2AA 2ZUWA 3VC5A 2RDXA 1YBQA 2HK1A 2J8GA 1RD5A 4E8CA 3DFTA 4L6DA 5I07A 1VBRA 4LTSA 1C8QA 4GACA 5I6SA 1XRSA 3GXMA 2FJKA 3W83A 1Z9AA 4FR1A 3UEQA 3HFTA 3MW7A 4KCWA 1CW2A 3R0KA 5FSEC 5I3IA 1BYAA 3FA4A 1Q6FA 2WLZA 4FZIA 1NWTA 3TYCA 3ECQA 1XWYA 3UYCA 5KZ6A 3L68A 4MF4A 3CHEA 1JFXA 2A7RA 5CLTA 2NT0A 2R1MA 1W3NA 4WLCA 3VC6A 5DMLA 3RJXA 1RAKA 2VOTA 2PGEA 3S2MA 2V3EA 5AHEA 1U33A 4H9VA 2OB3A 3QQWA 4U2ZA 5D04C 4B5VA 2XN0A 2J47A 3KOFA 5BXPA 3A13A 4MY8A 3LLDA 1QWGA 1XLGA 2YDRA 3G1YA 4NJHA 3CQIA 2PI6A 3BO9A 3PB2A 4JPGA 2CHOA 5HINA 3G1AA 3N17A 3TLQA 2V2DA 3ABQA 1IZJA 3KBNA 4OJYA 3SQMA 2HVMA 1OZQA 1J5SA 4ZGYA 3DXIA 3EA2A 3SBFA 3BV7A 4W85A 3WFZA 2A21A 1CENA 4P7QA 5LZLA 2VRKA 4XZNX 5AVNA 4W93A 2XGZA 1F07A 3P74A 3A4WA 1RP8A 3QZ6A 1FFRA 4Q8VA 4HU8A 4A8IA 4LNYA 1OX5A 2WQDA 3IAPA 4W7UA 3GDBA 5REQB 1A3XA 3N1AA 4PMOA 3WF2A 4HSHA 1NELA 5EBUA 1HL8A 5A6BA 1S2UA 1RV8A 1VJSA 3GTFA 3O6CA 2YSWA 1ZJBA 2HNEA 3QKEA 4MB3A 1KM1A 3DG3A 4GVFA 4QCFA 4AMAA 1V0NA 4RNHA 5E9XA 4INFA 1GKQA 4ZA0A 4W84A 4HNVA 4C6DA 3CIVA 1YPFA 2FHCA 3AU6A 4GBUA 3ZOAA 4B16A 4UQBA 3CO4A 1T7LA 4ML9A 1NWUA 1JULA 4M24A 5GQBA 1IWBA 2AL1A 4Z17A 1TSIA 2PDYA 3VKDA 4AB4A 5TF0A 1EFZA 4GJJA 1YDVA 2C13A 3PPCA 4G1KA 4IQJA 4Z2IA 1TE1A 1VHCA 1H0IA 3WF4A 1PL9A 3W3OA 1KRAC 1H7RA 4QDWA 1UP2A 2FJUB 3SSJA 4UFMA 4JX6A 2WJFA 3TC6A 2I7GA 3O06A 4QQ3A 3DIPA 1W1ZA 2XVPA 3MWAA 3ZR5A 1MW2A 5EU9A 3GTNA 1D7KA 1K8XA 2C1IA 4PMZA 3WLNA 3CTLA 3CLMA 3EB3A 5DXXA 2WHMA 1WZMA 1UZDA 4QDPA 1MSSA 1LCOA 3V7PA 2FVKA 1NP2A 4XBKA 1NH6A 2GUBA 2WJDA 3VMPA 3HMCA 1KV8A 4QE1A 4CEXC 2Y2WA 2GVEA 1K7XA 4O18A 2E28A 4Z08A 3VA8A 3FXYA 1JCNA 1QI4A 2B31A 2WVUA 7A3HA 5JUVA 4XZ9A 4C60A 3BL3A 5BU9A 4I3GA 4KETA 4GPNA 3LV6A 4FNTA 3ZVIA 1QK0A 5ABFA 2O56A 4UOQA 4I9AA 5BNKA 5FJOA 2BNJA 4B92A 1OT1A 1CGTA 3W6YA 4AZCB 1W1VA 5BXTA 4YWSA 1U5VA 4AZGA 1B3YA 1P6WA 4OOUA 1I75A 3MV01 4MPQA 5I24A 3UXDA 3I65A 1EUAA 4Q22A 3OPSA 1FWBC 1YPIA 3T09A 2C16A 1Q13A 2REQB 3AYRA 3OBAA 4L4PA 2YPIA 3T0AA 2QQ6A 1OSEA 3T1GA 1MEWA 1WZLA 3SN4A 5FI8A 4ZOEA 3AXXA 1X7IA 1YE4A 3U4AA 3VIJA 1BF6A 1WAUA 3AZSA 2QMKA 1SW7A 4TX6A 1JPDX 3T0DA 2FGZA 2XIOA 3EPMA 5IM51 3ARTA 2CWNA 2J7EA 2I9UA 4AQLA 2OKOA 4UNLA 2XIBA 3QSRA 1F8IA 1B30A 3QC3A 1LRQA 4N9BA 4AEEA 3CBWA 5XINA 3NZQA 2JGYA 2CLLA 1PSCA 2P76A 3FAXA 2DP3A 1JR1A 1G4EA 1X8FA 1GJPA 1PHQA 2J7HA 1XSKA 3DG7A 2YDQA 1GW1A 3FLUA 2UY2A 1DKWA 4EPDC 1WXYA 3FVDA 3O05A 4HZMA 1XH2A 4B5XA 2VR4A 2EKCA 4XB3A 3RO8A 3UWQA 3IGXA 3GIYA 3EEGA 4XAFA 2H9AA 3GB6A 2NV9A 3IJQA 3HPFA 3WNNA 3VNIA 1ITQA 1WE5A 2ZRYA 3W7RA 3WIJA 1KXTA 4U3CA 1TJRA 3QF0A 3GHSA 1R9YA 3U2OA 1CB2A 3DENA 3B03A 3RIKA 1QNOA 3OYZA 1WNOA 4ICCX 3MS8A 1XIJA 4D6CA 1Y8BA 3CPGA 3G1HA 1A5UA 4QEEA 3ZSTA 1NQKA 5IFTA 3W9ZA 2IKHA 4HYWA 3FSTA 2A2IA 1Z42A 4JFVA 3S6TA 4IMDA 4R7JA 3URAA 3S6DA 2Q8XA 2OQLA 1KFJA 3L4UA 4W5UA 4R85A 3GH7A 4YYFA 1JCTA 5G2WA 4ICNA 2WSKA 2YXOA 1T5AA 2ZUUA 1CTNA 4GUJA 3IJDA 4W7VA 1ENUA 1BXBA 2CFFA 2NXIA 5CGQA 3E5PA 3CB8A 3MT1A 3VGBA 2VZTA 2GZXA 5LXEA 4H7VA 3CASA 4RV3A 4CLMA 4NJJA 1NFGA 5KZEA 3OOQA 3U9IA 1J2WA 1XV8A 1CXFA 7ENLA 4W88A 1L2UA 4XBSA 4LUJA 3WNLA 1E9LA 4QJ5B 2D20A 1GYNA 3F2CA 2PWEA 2DZSA 3NQ2A 4KCUA 4TV6A 1NIUA 2Y1HA 4IQDA 4GI6A 3G0XA 5AKQA 3DHPA 3QGKC 3TSBA 4XO7A 2R8WA 3W22A 3R1ZA 4KIEA 3SCPA 1GHSA 1OF8A 2VZVA 1UUMA 1S3TC 4S3BA 2CU0A 4CQ8A 1IGSA 1EDGA 4X9SA 4YVVA 2PU0A 1TV2A 4CCDA 2CXGA 4LCRA 4WDUA 1Q8AA 4H2CA 1QNSA 1FHVA 3UJSA 1OINA 2GVJA 1JZ6A 4QG9A 1B3WA 1OGGA 3VAVA 5A3HA 4QSFA 4X63A 4HGXA 3HBLA 1ZTVA 3LLXA 3BUVA 1CGWA 1M7XA 4PUDA 4PODA 4UTIA 4LX4A 1VKFA 1SO5A 4DN1A 1D8CA 2V2HA 4GQBA 4S2CA 2OZ0A 4IGHA 3KDOA 4Y9PA 3QMTA 4Q8OA 4JIHA 1CEOA 4U10A 2X7VA 4G7FA 3WG6A 3ZLFA 3JR2A 3LHZA 4OUIA 1IXOA 3KVMA 4XD5A 3D5HA 1C29A 1BWVA 2ATSA 3ZLGA 4XVDA 1E70M 3ZVHA 4PTWA 5DCEA 5HPCA 3KCJA 3T7VA 4JTAA 4GY0A 1IQ8A 1L0PA 1US0A 5HQMA 4U4MA 2YL6A 4HMNA 2Z6IA 4QM1A 2F2HA 2VDGA 3BLKA 1A5CA 2FDSA 3IV3A 3KWSA 1RSCA 1X98A 4DF1A 4LXFA 2ZZ4A 1J6OA 2YR1A 3ICJA 4RUBA 2JEPA 1HP4A 1PCKA 4BY3A 4XTIA 2ZDRA 3BCDA 4AG0A 1RHCA 3EMCA 3E49A 4EK7A 1ZNNA 3PG9A 4J5NA 3RPDA 4LJ3A 3H7RA 2OPJA 1XLJA 2GGGA 5A95A 4LF2A 1KLYA 4E5TA 2CIPA 3W85A 3APYA 3B8UA 4KQNA 3MMDA 3G8EA 4MKNA 5LNWA 1K9DA 3AYVA 4PRWA 4PRRA 4NJGA 1JXJA 3MKVA 1OQFA 3DH7A 3GC4A 5D9OA 1HJWA 3QRHA 4BR1A 1W5PA 3VI2A 3EEZA 3CQHA 4F40A 2D73A 1MW1A 2P5NA 3TSDA 3WLHA 3A24A 3WDHA 1K8YA 3E96A 4C6MA 1CLXA 1E3XA 4P8VA 3LCIA 1VFLA 1LRTA 1PCWA 1KB3A 4XSLA 1LL4A 3CGTA 3PBYA 8CGTA 3SIMA 3FYPA 3UA4A 5BRBA 3GNOA 3WUEA 4AIUA 4CVWA 3URBA 2DIKA 4DWSC 4NP7A 4W86A 4DO4A 1V6YA 4D71A 4NXKA 1BYBA 3S9YA 1J4EA 4MOZA 1LG1A 2QJMA 3PHAA 1TPUA 1W3KA 3WK3A 1PZ3A 4O53A 3S2CA 1LWJA 5LA1A 1IZCA 2HVNA 3KRSA 4EF9A 1J9YA 1V6TA 4DBWA 3WJXA 1FCBA 1WYIA 4JN6A 2VMFA 3VD7A 3P80A 1F76A 2X09A 2GJXB 2B81A 3STPA 2NSXA 2FVLA 4JL2A 2JFEX 4H8VA 1LJYA 1S39A 3JS3A 2A5HA 4AH7A 1UKTA 4HNLA 5AYBA 3ONCA 3OQEA 3AO0A 4M3PA 3BLDA 3SEPA 3CV1A 1TQXA 2DZUA 1TRDA 1VBHA 2OELA 4KERA 1V3LA 3WMCA 4ZOCA 1ZJAA 2V9DA 2FZ8A 3CK5A 4WRHA 3BMVA 4H4IA 4I9JA 3RXZA 2H6RA 1OYCA 4E4PA 2NWRA 2BVDA 2WV8A 3B9AA 4DAFA 1UIPA 5D8ZA 3R0UA 5C55A 4GIEA 1MNZA 3N18A 4J28A 4BHYA 1RLCL 3OHMB 3BZJA 4XKMA 1V3JA 3ONBA 1L6FA 3LHTA 4RE0A 3NZ1A 1G6CA 4LUTA 1TFVA 3SSZA 4ENLA 1J0HA 1DE6A 3NQDA 2DEPA 2F61A 2WM0A 2WVVB 4IHCA 4A3YA 3NPVA 4M29A 3KP0A 4O8RA 1A3WA 3H6OA 4JHMA 3SUTA 2A85A 2Z2UA 1CBGA 4W8AA 3LY0A 3CPUA 1P7TA 1A5MC 1KV5A 3EDKA 2P8BA 1DXEA 3QW4B 3VGHA 1B4EA 1ZALA 4I7UA 3OBEA 3A6OA 5FESA 4QLJA 4DO7A 3FOKA 4UTLA 3V4BA 3D0CA 3LXBA 3AS2A 3CT2A 1XLCA 3LCWA 1GCYA 4H6EA 3NQGA 2INZA 1A4MA 5IDZA 3OYXA 2QPSA 4IIDA 4TMCA 1A3HA 1PZ2A 1JCYA 4NU7A 3CU2A 4NRSA 5LNVA 4LOCA 3OG2A 3QH2A 2BXVA 4B15A 4Y6GA 3RM8A 3CWHA 5DEZA 2NXHA 3MI6A 3BG3A 3OA5A 3B0VC 3QBUA 5FF7A 4CNPA 2BS9A 2VFHA 3PWGA 4S39A 2F8QA 3W7QA 1JF6A 3PUOA 4XIMA 4KS0A 3BTNA 5HK4A 2EO7A 4QAWA 5BWFA 1KM5A 3WLRA 3V1HA 4GKTA 1EHAA 4I5UA 2ACQA 1KM0A 4LH8A 5E6YA 4RX0A 4JNZA 5CPLA 3EMZA 4D6FA 3QTGA 1RXOB 1TPC1 2WO5A 1W1PA 1LTDA 3OLGA 1I2RA 1EJTC 2CZEA 4LEQA 3MCNA 4L64A 1JYNA 2TYSA 4JCLA 3WMSA 3QR1A 3SCQA 2ZCGA 1XYLA 4IP4A 2ZBTA 2WPGA 2OWXA 2IW0A 3GBEA 4C6CA 1KNWA 5HOSA 2MANA 4DJEC 1ADOA 1VEPA 3T9PA 1K3UA 1GQNA 4MKSA 6REQA 3GG8A 2XIMA 2GWNA 2CCRA 5GJMA 2XWEA 4F0KA 3GBDA 2GFTA 3QEZA 3B8SA 3IGUA 2ZQ0A 3HG5A 4UMBA 4DNMA 2CWXA 3M43A 2TMDA 1I60A 1HN1A 1U5HA 3GY1A 4HCLA 1K1DA 3TROA 3TYEA 1E55A 2ACRA 5FF0A 4P7LA 1E5NA 1WCGA 1DP0A 1QATA 2G3JA 3FJ6A 3G3MA 1UR4A 3KBVA 1TTJA 1NSJA 1B31A 3EX4A 1YHTA 3LA4A 1M7JA 3LPOA 4LUIA 4UQCA 4E2VA 1MNSA 1CLKA 3U2ZA 2QCMA 1GKPA 4IJRA 1OFOA 3JUGA 9XIAA 2QJIA 3WJSA 3SCSA 3PUDA 1OFPA 3PSWA 1X6NA 3EGJA 2NV2A 2DVTA 2ZA2A 1RBAA 4JFTA 2BVTA 1PJ9A 2J75A 3F7JA 4NX5A 1PKYA 3MMWA 1WB0A 2VHLA 2DORA 1RQEA 1RUSA 3TFXA 1J18A 4JDYA 3VCRA 3H53A 1H41A 2WC7A 1OFRA 3FDGA 1QFEA 4QDMA 4D6IA 4HHLA 3ABRA 4MHBA 1IR1A 3T2QA 3DERA 1E6ZA 1JYVA 1ZL1A 4DUXA 4L4MA 1XL9A 1XC4A 4NRRA 2E1WA 4HJFA 4AWTA 1VZWA 2E40A 4TO8A 2HCVA 4XAZA 4CD4A 3E2VA 1DBTA 2AQVA 3E2QA 5I3KA 4E6MA 4FNSA 1HP5A 5HJYA 1E71M 3RFAA 1D2KA 4Q6XA 4DYKA 2XVKA 3HG4A 5LNRA 3TR2A 1JXKA 2BY3A 2YIHA 1OFQA 4MAVA 3NM1A 3ABXA 3CUZA 1G4SA 3H2EA 1K9EA 1Y5XA 3LPGA 1E4NA 4GI9A 5C6MA 2WMKA 6PTDA 1OC5A 4WJEA 4HQVA 3ELFA 3R8GA 4JHOA 1MQPA 3PUEA 1Q7MA 1LF1A 5K3VA 3VUPA 3LSBA 1V6VA 4XZWA 3S4TA 3G8RA 1EA9C 1DWGM 1KFLA 1U2YA 2E6DA 3IWPA 3K8LA 4HOWA 2WANA 3ZWSA 4A8NA 2FPTA 3FJNA 5CEWA 2PDNA 2Y0FA 4RE4A 1A4LA 2NQJA 1I2OA 4HHPA 4JKMA 3UA3A 4HMEA 3LXAA 1U1UA 1TWZA 4AD3A 1WZAA 3W4RA 1QI5A 3CQJA 1MDRA 4FLSA 4GUFA 3BOXA 2TPSA 2GUYA 1FWHC 1F7BA 5CPTA 2Y63A 3OZMA 1D3GA 3IJ7A 1NDWA 3K1GA 3W7PA 3QZEA 1TPWA 1BF2A 3A3HA 4XD4A 1B9ZA 5BMWA 5FIPA 2QHAA 4MTVA 1LOLA 4JKKA 3QW3A 3GDMA 3DECA 4GYPC 2CZVA 4DPPA 2DUZA 5HJXA 2ZADA 4E38A 4KW2A 4BK9A 2IXVA 3N12A 4UUIA 1RY0A 4D6HA 5M03A 4YS1A 1QPNA 2TODA 2JF6A 3N9SA 1LL7A 3I7QA 3UZYA 4O0ZA 1V6XA 4LVGA 3B4UA 5LGXA 5JVLA 1E56A 4O50A 4B4FA 1KWGA 3UNTA 2NQ5A 3U7VA 3B9DA 2ESCA 3BMWA 1KRMA 5E1QA 2F9RA 2QLYA 4Z0JA 2EAWA 2FYMA 5A69A 1R9ZA 2HXUA 2VWTA 1PIGA 1TE6A 2A3AA 2HBXA 3N15A 2G96A 4LS1A 1Q8JA 2PDLA 2C8NA 1D7FA 3GE7A 5BMXA 3H21A 1GNXA 4RK8A 4DBDA 4DJFD 4I9TA 1A5SA 1FWNA 1X96A 1EP2A 1YPXA 4AUBA 1F74A 4UBPC 3WH7A 3C0LA 1OWQA 1W9XA 8TIMA 3TLLA 1XIHA 4Y9NA 2QMJA 3N6QA 2V2CA 1MRQA 2GDVA 1XICA 3MMUA 1ICPA 2XINA 4A05A 3AIQA 3P62A 2C1HA 1XIGA 3HURA 1CXIA 4C6OA 4O14A 1TPFA 2OWWA 1KBLA 1TWWA 1GTEA 1E15A 3U8GA 1HL2A 3ZYZA 3MJMA 3QR3A 3WNOA 3TDFA 1SMDA 1E51A 2DQXA 3VIMA 4F0SA 3TH6A 4MWAD 5JH2A 3PJTA 4XBJA 1CECA 4NIRA 3PNUA 1W9BM 5ABGA 1L8NA 2EJAA 1XDJA 3TIMA 3KOXA 4E3VA 3STEA 4J2PA 2O9OA 2DSUA 3HG3A 4ZO8A 3DFNA 1Y7VA 2QIWA 3C4UA 1ME8A 2GDQA 3UXKA 1XDLA 4GINA 2WOQA 4JTGA 4DXXA 4MZ8A 3P14A 2DSWA 2OLSA 3CMJA 2ZZ6A 5KSWA 5K9CA 3W2UA 2HSAA 3U48A 2PRMA 5I09A 2GJLA 4GUHA 4GZEA 4Y8FA 2EQDA 2H8XA 4F9JA 2Y70A 5E09A 1FA2A 2VX7A 1ISXA 3RX2A 1EQCA 4F0LA 4KCVA 1XBYA 3NQ6A 3CQ0A 4CU7A 2Z7KA 3KFTA 3CZ8A 4WQ6A 1TMLA 3M07A 2DT1A 3AXMA 5FL1A 1LOQA 1AW2A 2Y4SA 1W3TA 1R3TA 5H1WA 5HBFA 4IQEA 3B9OA 3TAOA 4CCEA 3XIMA 4GJ1A 1CDGA 4GO9A 5A6SA 2PGRA 3AXIA 4ACYA 3IV8A 1OCNA 4RZBA 3BWWA 4EF8A 1W1IE 4ADUA 4YYCA 3WH9A 2Q01A 2P0IA 4DRSA 4Q6JA 1VR6A 1EGVA 2FGBA 3R5EA 3UWWA 1VJIA 4O4VA 3CUXA 1V77A 2YLLA 3DC0A 3H2FA 3WQWA 4NVTA 1X1ZA 4JIIX 1QCWA 3A22A 3FW6A 3MV11 2W5FA 3PJUA 1P5BA 3MUCA 3W81A 2L5HA 4H9YA 3W7KA 1IEVA 2D2JA 2GLKA 2PB1A 1CGVA 3HU7A 3U7BA 2R1PA 1VAHA 5E70A 1H7OA 3OZPA 4UQAA 1K9TA 3DHFA 3LNPA 4KKXA 4NY2A 3G1XA 3SIZA 4UR9A 2WBGA 1Q65A 4ZQRA 2A3BA 3REQA 4C6FA 3LCLA 2J13A 1ZSXA 3V5FA 1Z89A 1PZ0A 3MI3A 5A94A 1DL3A 4H9ZA 1ZQ5A 3LLFA 4RPQA 4UNIA 3SRDA 3GIPA 2YA2A 2DW7A 1YXYA 4IM4A 3C3UA 2WVVA 4UQDA 1P48A 3OU8A 1K03A 1O95A 4DXVA 1OHLA 4GYJA 4Q8UA 4RZ5A 3GHRA 2QYGA 4FNRA 4X22A 1W1YA 3O3RA 1G69A 3EKGA 3N3TA 4DYEA 3TJ4A 1AQ0A 2J7CA 2CBIA 3WKZA 2Y8UA 4N7QA 2BMBA 4UTFA 4PMJA 1GVFA 5DBTA 3R2GA 2CC0A 3UJFA 5CPOA 4K8EA 1UA7A 4HN8A 5E9AA 4GWEA 3QXBA 3DU0A 4K7VA 2NQLA 4JGDA 4H8UA 1OG0A 2RGLA 3CL6A 4GI4A 3S42A 4TR9A 4MLJA 4AW7A 1J0YA 7REQA 2DH3A 2E7FA 3F03K 3OP2A 4M56A 2GJNA 3EYPA 3QPEA 3ALGA 2ZOXA 2IPJA 1QR7A 1ZBCA 5MKGB 1P6BA 1JDDA 3N2TA 4Y9OA 2OQYA 3PJWA 3CV7A 3B9EA 4S3DA 4ZEPA 3NEVA 4O19A 3CZJA 2PMQA 1TPDA 3AUJA 3GM8A 4WZHA 1I45A 3USZA 5D2TA 2JEQA 3ZT6A 2G3IA 1FWDC 5A8MA 1TG7A 3WYZA 3W23A 3M0JA 2BHUA 2XFWA 3VOIA 3WJWA 1T8QA 3UFYA 4ATDA 3VX1A 2H3DA 1ONXA 4DM2A 1XH0A 2ZX9A 3WH8A 1OK6A 2PTXA 1AJ2A 5DCBA 2BSLA 3SFWA 3HQNA 1ZENA 5EFDA 4IJCA 3WLKX 4EWND 1WOAA 5D2VA 2INFA 1VBUA 3H7VA 3ARRA 4HNNA 3G6LA 1X6UA 4F48A 2Y7FA 3M0LA 4ZE5A 1BXNA 3GU9A 2WW5A 2OTDA 5C2XA 3VNZA 4P7OA 3W7CA 1I4NA 3V36A 2D0HA 1W8GA 3H4WA 3GKAA 4N6EA 1GYLA 1V3KA 1XP3A 4EPKA 1JGIA 2E5BA 2VCAA 2J7FA 1TVNA 5DRCA 4LVAA 4O1FA 1J8VA 1V51A 5M17A 1KXHA 1E43A 1N8FA 2JK2A 4BQ4A 2RUSA 4I6VA 3QY8A 2XFFA 1VD6A 3LSCA 1F73A 3NQ7A 3B8DA 1F3EA 4DJDC 1XLMA 3ABOA 3GDRA 3ME3A 5GNXA 4ZL1A 3IRDA 5HMDA 4HPXA 1K77A 3SCRA 1M3UA 3BPWA 4AVOA 1M7PA 2JKPA 2WJEA 4JY8A 3ZT7A 1W3IA 1E1FA 5DY3A 1ODUA 3MSYA 4Q4MA 3U2CA 3M44A 2ZKMX 3WENA 4PEEA 4CQCA 1SR9A 1HNYA 4GIYA 2ACSA 2A3LA 1KGWA 4PMNA 3KOWA 2Y62A 1GPFA 1MRAA 3BAYA 4PRTA 1RPKA 4EXBA 4Q3MA 3PBUA 5JIWA 1UCWA 3QN3A 3CYVA 4BF9A 4O1DA 3CAKA 5CZTA 3EOUA 3W7GA 2I1OA 2QVNA 3HQOA 3P84A 1BSLA 5FAJA 3LX9A 1EBGA 2RFGA 2PBOA 3A5VA 2YJQA 4G8TA 4FOJA 3VDHA 1PTDA 2EPOA 4UTWC 4FF5A 5A5WA 2O7QA 3STFA 1SFLA 2WNZA 4AXNA 2CETA 3GXPA 3H24A 2OWCA 4WXYA 4FX6M 1TTIA 3THCA 2YCLB 4HNCA 2QPXA 1TPVA 4A2RA 1Q6EA 2R6OA 2V30A 1ONEA 1DTUA 3PANA 4WIWA 5E0CA 2PDIA 4MM1A 2Y7DA 2A4AA 1QTWA 4FK9A 1J10A 4CN1A 1TWIA 1OYBA 2KZHA 2POZA 3MJYA 1E73M 1R3WA 3LEPA 3V3WA 3CNYA 3DHDA 5T9BG 2PWGA 3EWXA 1POJA 3VINA 3WH5A 4XUGA 4DWSD 5EA9A 2X42A 3QV8A 1TV8A 4Q7NA 1TA3A 3VNMA 2J7DA 5KINA 1EZWA 1XLFA 2FHFA 5AY7A 1FWWA 4M1RA 1FP8A 2E77A 4J7RA 5HUPA 2VYOA 1E6PA 4KMQA 4JTHA 3KLLA 3PJXA 3SCVA 4C6IA 4HZ6A 1TYGA 4Z0SA 2Y5EA 3KZPA 3BJTA 3CM4A 3E38A 5TAOA 1TQJA 1VLIA 4JQ4A 1GVEA 3CC1A 1FX6A 3EBVA 3DKLA 5CSRA 1U1HA 1QBBA 3C2VA 2V69A 1R87A 2A0NA 5I3DA 3EWCA 3TV8A 3WLPA 2ZC1A 4GI8A 3RGTA 4E4FA 3WY1A 5EYWA 3U2EA 4Y9MA 3MP4A 4YWIA 4HK5A 1IWPA 4MFEA 1GOOA 4GY1A 3LPPA 3VM5A 3TNOA 2ZUVA 3AAMA 1H4PA 3CTTA 1EOMA 3GW0A 4KRZA 1RZMA 2ZVIA 3VOJA 4V15A 4GZ7A 4WKFA 5DRIA 1BG9A 2NUWA 2ZX5A 3H55A 2NUXA 4QJ3B 3TZFA 3DAQA 1TZ9A 4IICA 2VEKA 3C3NA 3DDMA 5G2HA 5CSSA 2E8YA 2X1UA 4HPJA 1G7VA 1JDFA 3NL2A 1F6KA 3S9ZA 3STCA 2WCAA 1ZJIA 1F3XA 1KCZA 1QU4A 4C7DA 1TKKA 1GOIA 2EJ1A 3W72A 3L4XA 2XJ7A 1XRFA 2XUCA 3SFKA 3ARPA 3L12A 3W1QA 1EEPA 3WDQA 4AZHA 4BF7A 4C6KA 3YPIA 3KZSA 5EBAA 3BAIA 3GX9A 5DMMA 1REQB 3LBOA 3OVGA 1DQXA 1JPMA 4Q33A 5A6MA 4C1NB 4TXEA 2DQWA 2X7WA 2IPGA 2IXUA 2R1KA 3HV9A 1ISZA 3N13A 1RVKA 3QMSA 1VFUA 3O07A 2JIEA 3WNPA 2VZOA 6ENLA 2G8ZA 5T91A 5AHLA 2J4GA 5FD0A 3B04A 3TUUA 1WUFA 1SFJA 2C18A 2XFRA 2DUXA 1IT0A 3OA3A 1BXCA 2EBNA 4LALA 3BSGA 3BLFA 3TVAA 4K8GA 4FOKA 3WDPP 1A5KC 1HTIA 1JUKA 2QV4A 3W2KA 3W7HA 2NSOA 4LY4A 1YDNA 2VUYA 4B3ZA 4IIBA 1BFNA 3TE9A 3QY6A 3IUHA 3WK1A 3VKBA 3PPFA 3TWAA 3GWQA 4HA4A 1IV8A 5AC7A 3BSHA 3W2JA 1OGSA 3HPSA 1WKYA 1RP9A 1F9CA 1NDVA 4IPNB 1GVRA 1PTGA 3SZ8A 1M41A 2NVAA 2HROA 2OMAA 3I3BA 1D9EA 4D1JA 3S2JA 2QJGA 3EDDA 4IP5A 3IJ9A 2Z00A 1NOUA 3V0SA 2ZRUA 1KXVA 4JNMA 3KOZA 1J01A 4WOQA 2YX0A 1XLKA 4O8AA 1LUCA 4NJKA 3E12A 1QMLA 2OQHA 4H6QA 3E0LA 2ZDSA 4KBXA 1T0OA 5HNUA 1P0EA 4X60A 4JQ1A 1RVGA 1XBXA 2DZBA 4A8RA 4RW3A 3S5ZA 1X1NA 3GU1A 1P43A 3NSMA 3U5YA 3VOCA 3WH6A 2J27A 4D6EA 1RR2A 1WZKA 1J2BA 5CSUA 3U57A 2V3FA 4IGMA 4D1IA 2E6FA 2JBMA 4IMFA 3NL3A 4XAPA 3QLDA 2WZHA 2OU4A 4OECA 2YCIX 3P82A 3E0WA 4YVPA 4AC7C 1AODA 3EDFA 3A9IA 3DHUA 1RH9A 1K6WA 2VVSA 5EL1A 3GHUA 4ZB2A 3WMLA 2J78A 4B3KA 3M7SA 3M7WA 1RQHA 1ZAHA 2A6LA 3GD6A 1HKJA 8XIAA 1UZ4A 2QCDB 4MG4A 3BK0A 2RJHA 1CGXA 2XH2A 2YFNA 4XUYA 2FFIA 5AN7A 2W27A 1RBOB 4M82A 1BYCA 2EPHA 3KL5A 3WQOA 3R0DA 1M5WA 1QUMA 1WPCA 1ITUA 3SADA 4Q4SA 2E6YA 3MI2A 4N9DA 4JN7A 2ZA1A 1XGZA 3MCOA 2B7QA 4O13A 3VILA 1H60A 3AZRA 2XWDA 4RDYA 1GVSA 5T26A 1GZJA 3KTSA 2OR2A 4A3UA 1KXQA 3FYOA 1OD8A 3KLKA 5LHFA 2OVLA 4W87A 4I8YA 5D33A 3F5KA 3L0GA 4GZIA 1K7FA 1NU5A 4NQ1A 4B5NA 2NWSA 1EGMA 2QJJA 4GVHA 1JG9A 5F1UA 5HWMA 3TONA 3FCPA 3VKJA 1LLWA 1EGZA 3I4KA 1MDLA 2FB2A 1VYRA 1YADA 4JHZA 1UYQA 4ZTXA 2IQ0A 1G1YA 3CV6A 3GNNA 2PZ0A 2QDDA 3IPWA 4YN5A 4PTNA 3WZ0E 3IAQA 1OX6A 1UA3A 5FJIA 3TNBA 3VCCA 2MNRA 1SYTA 1YDOA 4WUIA 5IFPA 2PDJA 4JEJA 2DH2A 1XKYA 3HG2A 1PS9A 1A49A 1UUOA 4GXPA 3NG3A 1W9UA 1DIKA 3NVTA 1H5VA 2OZTA 2C0HA 4JFWA 1QPOA 1JDAA 3KX6A 4KRTA 2V0TA 4OV9A 1E9YB 5FEZA 8XIMA 3RCYA 1YBQB 1DIOA 4CVUA 2HJPA 1PDYA 3PBMA 3QOKA 4IIHA 1EH9A 2GSJA 3SCOA 1KGXA 1LDCA 1W9DM 2WBKA 3C0SA 2WAGA 3NO3A 4PB3A 4NZ5A 2J8TA 3VMNA 4TVUA 1KFCA 3U3HA 2F6XA 3FVMA 1EJUC 3C2OA 2C15A 1JPKA 3GLCA 4NAFB 2C79A 2WM1A 1W91A 3N4EA 3SJ3A 2FIQA 1KBKA 4WGHA 1V0MA 3E0FA 3VKAA 3FHQA 3S3GA 4DUWA 4UFLA 1SVDA 1QOXA 3O6YX 3MZNA 2V82A 2HMCA 1O5RA 2VEPA 3WEZA 1EOKA 4FIQA 1XYZA 3FSUA 3GNDA 4TX9A 1TUFA 2FZNA 3Q45A 1OFAA 1SJAA 3GVQA 3GW3A 4YJ5A 1YDYA 2VJXA 5ABFB 2DZVA 4IFKA 2ABBA 3T40A 3L4WA 2Q8ZA 4XD3A 3WO8A 5EMJA 1H50A 4JQ3A 1C3FA 2VEIA 1CWYA 3H2MA 2QJNA 2OSYA 2OFJA 4HPNA 3FYYA 1CGUA 4MPKA 2NX9A 1PB0A 2J25A 1VPYA 3P2VA 4IF2A 2G4JA 2VUNA 1TV5A 1JIBA 3EKLA 3L66A 2H90A 3TTQA 3BSMA 1O5QA 5CBIA 4B3LA 1KBBA 4JTTA 5FJUA 4MJ4A 3I6RA 4MNJA 4RZ6A 2VNCA 5C7HA 3LN3A 3CXOA 2OSWA 2VURA 4W89A 2UBPC 2PDMA 1YE6A 1B54A 2J66A 4S3FA 2CESA 5JU6A 1F6YA 3NQBA 4EOUA 3BOLA 4UQEA 3CO8A 3EX1A 2XVLA 2AKZA 2XIJA 4F0MA 4GISA 5D03A 3KL0A 3CH0A 4MIMA 5BXSA 5CAKA 4XZMX 1J12A 3K30A 1VFFA 2A3EA 4IPLA 1L6WA 3DGRA 4UFJA 2ODOA 4FR6A 2NLIA 4Q32A 2YBVA 3Q58A 3C86A 4AZBA 2PS2A 1ZP4A 4RCXA 4H9TA 2AQWA 3QV9A 3W28A 1QNRA 1ZBVA 4PMUA 1GOWA 3VCNA 2C3ZA 3UPMA 3TN5A 2EEXA 3WF3A 5ABTA 3BLOA 4PTMA 5KZDA 5D09A 4LWWA 2PDQA 3I68A 4DHGA 2FZDA 2QEZA 2QZRA 3GG7A 4O57A 3UJ2A 2HDJA 2V68A 3DKJA 3EAUA 2F7FA 3A4AA 3UWUA 1SO4A 3NUKA 3N04A 5ABEA 1OFDA 3GO2A 2W63A 1IT8A 1JZ2A 4A6GA 3GQYA 2PRLA 2VL4A 1XR2A 1JDCA 1UWRA 1OC6A 4FPSA 4RXFA 2PZNA 1UR0A 2WSPA 3FK4A 2BX7A 3QC0A 4W8LA 1UOKA 3S1XA 4W7WA 3THQA 2GUUA 2OLHA 4IFOA 2VZSA 2VGBA 1VC4A 1NJJA 4MWAA 5HXMA 1PX8A 4XTDA 1S5TA 1V8EA 1QRQA 4S2BA 2O92A 3MU7A 5IHRA 4ZB0A 3LTSA 2NXGA 2X05A 3QJAA 1V3HA 1AJZA 1K7EA 2B0MA 4GQRA 4Z2KA 3UXIA 5CPQA 2OYLA 4HA1A 3O7UA 2BV9A 4PCPA 5F4XA 4M7SA 1UBSA 3NO1A 3TK7A 2WC4A 1JF5A 4G7EA 1KFEA 3QR0A 4H00A 1TB3A 3S2LA 3SQSA 4AWEA 3C8FA 2PDUA 2YZ5A 2XPKA 3P5ZA 1JYXA 1GQKA 2CLPA 3LMYA 3ANUA 1BHGA 4D6JA 4CU8A 2PP1A 3EWUA 4OWGA 4I6KA 5K9DA 4O0QA 4JTDA 1ICQA 4QXIA 2P1FA 1M1BA 1GOKA 3DGBA 3II1A 1G67A 1YRRA 4Y90A 1S5VA 3SGUA 4IOTA 2NQHA 4LRSA 4C6QA 4TV5A 1U1JA 4V28A 3IIXA 3M0YA 4Y9AA 4I5RA 1HUVA 3RR1A 4IXXA 1QOQA 1E1EA 1LYXA 2GYIA 2CW6A 2W91A 3A3WA 4I90A 5H8UA 1XCXA 2PCEA 3LI1A 1GG0A 3W1XA 2ZX7A 1RPXA 5A8GA 3AI0A 1UC4A 2HXTA 1H7XA 4FNPA 1BYDA 1TELA 4JX4A 3GTIA 4JQAA 2XZ9A 2RDUA 3SN1A 1TV7A 3W7JA 5U4NA 4O1CA 3IRSA 2C14A 4Y96A 2VCCA 1Z6KA 2KAUC 1V03A 3WF0A 5HUOA 1L8PA 3R58A 3LQGA 1TUXA 3T42A 1X38A 2YGYA 2CITA 1N55A 1XXXA 1K6AA 1XI3A 2WZIA 4TIMA 1DWFM 4WKAA 1R30A 3F1QA 1OIMA 4E3TA 2PWVA 3Q65A 5E0FA 5CXPA 2IKJA 3NZGA 1QDSA 1OD0A 3G3DA 4YL2A 1X7FA 1UH3A 3W1RA 4LBRA 1EX5A 2EF9A 3KCLA 3WJZA 5LIKX 1NWSA 3GXFA 1XBZA 1Q2SA 1G5AA 3RDKA 3F4CA 2D24A 2CLMA 4D8ZA 3DEQA 3ZR4A 4CNSA 4LFYA 4IIEA 3URQA 4PCNA 1OF6A 3PWAA 4HA3A 1E0XA 4F0HA 2BGSA 1FQ0A 1M04A 5CC6A 3HJEA 3PFRA 3VXGA 1A80A 3I3DA 4CUCA 2FFCA 3EOLA 4ZVJA 1MUCA 3INPA 1Q6DA 4PULA 1EL3A 1KBJA 1ONRA 2WZMA 1QNVA 4QSHA 4US5D 1C9WA 3MP3A 1EWEA 1V79A 2I16A 3NDZA 3ITOA 4OE7A 3A47A 5I0DA 3I7RA 3I6TA 1XYCA 1EJ7L 4L61A 1X39A 3GTHA 4JYFA 4K37A 4ZO9A 2D22A 3TX9A 3EWWA 5AZ1A 1R7AA 1VFOA 4CQBA 5U7SA 2GVGA 3LERA 2OYKA 1C8XA 3W1UA 4RLIA 1RY8A 1F4AA 4AWSA 3WLSA 3SUWA 1XLDA 3G1VA 3N29A 3RN6A 1UASA 1RLDA 4WK9A 2R1LA 2CKRA 4LY8A 1V7AA 2I57A 4M1BA 2YZRA 3THUA 5HANA 2BVWA 4YCPA 1RBLA 5DT7A 4NYUA 1UH2A 3UWZA 2XGBA 3E0IA 1BGGA 3R79A 1HXJA 4L4LA 4AX7A 4ZMGA 4ONVA 1UHVA 5T9CE 1ZGDA 1V7YA 3STGA 2HNHA 1WP6A 3BW2A 4LGXA 4DVOA 3UCCA 1HKWA 4PH6A 1CI1A 4J3XA 1EO7A 1LL6A 5A1AA 3DFPA 4IZGA 1XYMA 3WNMA 2A3CA 1TX0A 3T07A 2TSYA 1QO5A 3VOGA 4GRSA 1KKOA 2XDFA 2WHLA 3PPHA 3BLPX 2WK2A 1C9DA 2XISA 3BMXA 3HGJA 3P60A 2Y5JA 2EG6A 4OQVA 3ZQ9A 4O52A 4EPBC 4BWLC 2X1SA 4UOJA 3SQLA 5G1MA 3KP1A 2IPFA 2XM2A 3UR5A 1BTCA 1KKRA 4U28A 3O2LA 4GUGA 3ARWA 4IP7A 4O1BA 4PN2A 3MMTA 3P0XA 4GIAA 4Q8WA 1SFSA 3QTPA 2PLJA 3W6MA 2V5KA 3V16A 4DYJA 2VFFA 4KESA 5HA7A 4JNYA 1BLIA 3C5QA 2VZUA 4GLEA 4HT3A 4HD5A 3M5VA 2WZEA 3PN8A 4PMVA 1JVNA 5I3JA 4UTHA 1UD8A 1D3HA 1I2PA 4A22A 3AHVA 1E40A 1SU5A 4DF0A 4QCEA 4QE4A 1IR2A 3M0KA 3IVTA 5FACA 4JEQA 3M4HA 2BG5A 4WGXA 5C9ZA 3HN3A 3PB0A 4PC8A 5FJJA 3NIYA 4JAWA 5HWNA 5I78A 4M51A 3O0FA 3CUHA 1GOQA 4WSKA 3AICA 3ZS4A 1PIIA 1UD5A 3S1VA 1RA0A 4CNOA 3N25A 3GAKA 1XIBA 2WNNA 2DT0A 1SW0A 1ODZA 4IGSA 2DVUA 1Q3NA 5E5CA 2V6AA 4L7ZA 4Z2JA 5ECUA 3WBYA 4B91A 1OIFA 1H61A 1VFMA 1FDJA 2ISSA 4LAMA 4KFNA 1H7PA 2P53A 3QM3A 2DUAA 2QULA 2ZFAA 3RU8X 3TP4A 4L5ZA 2F6UA 4NAEB 3KS5A 1W0MA 1JNDA 4CGTA 4O10A 3O1NA 4N9EA 3VFLA 2A3HA 4E2DA 3LG3A 3T08A 1Q7QA 1A5LC 4P7RA 2BY2A 3W71A 4H3DA 1E3ZA 3UZZA 3WEMA 4XWUA 3F4NA 2JKEA 4L9XA 3OGSA 4TTGA 1J0KA 1ISWA 1OG6A 1Z69A 2QGYA 2E9MA 1CLVA 3S8HA 4BQ3A 2YA1A 3FNDA 3QOMA 2GDUA 2ZE3A 3T2OA 4DJDD 3WSUA 3WQGA 1YXCA 2VGGA 4LC6A 1EKOA 1Q6CA 3M0XA 4X9YA 4ACZA 1UD3A 4O28A 4AY7A 3NA8A 5A6LA 3NNTA 1EF2A 1R2SA 2H3BA 3VVGA 3VUSA 5D9NA 3NZPA 5BOEA 1KM2A 3MDWA 1EX1A 4CQ9A 1W5QA 4U5KA 3J7HA 1P6CA 1LQ0A 1FXQA 3E1F1 3GUWA 4WOZA 3B0XA 2CERA 4HK6A 2VXNA 3NM3A 2QAFA 4AZ7A 4DUVA 1J0JA 5D05A 2ZZ5A 4RNIA 1B3ZA 3L4ZA 3ITGA 3W7DA 3CAQA 5L9FA 2B7PA 4MZ1A 1LZOA 4J3WA 4EPEC 1I6NA 4LB3A 1O5KA 4OHQA 5BU6A 4DY1A 4FSAA 1KA9F 4C1KA 4U33A 1GK8A 4OUEA 3A12A 4AEOA 4HA0A 3MO7A 3ANVA 3O15A 1UBPC 1W9PA 5FL0A 3WLMA 4ASTA 5DBUA 4L1WA 1Z7AA 5CJNA 2HZGA 1ZY9A 4OFCA 4KWUA 3HJZA 3QPZA 3SGGA 3GSMA 1DQWA 2FZMA 5C9UA 1MXSA 1X97A 3TQ0A 3VDCA 3BARA 3VNDA 4BS0A 2E3ZA 3KVLA 3GKFA 2VGFA 4YTRA 2G3NA 1FOBA 4DI9A 3I10A 1KCKA 2V8ZA 3KBSA 3OIHA 2Q6ZA 3F2BA 3KBMA 4JS3A 4HB7A 3PTKA 3T44A 3NYDA 1AL8A 3OLIA 1BD0A 1H63A 2W92A 3PULA 4LC8A 3W7NA 3VE9A 2VELA 1XLLA 2D1ZA 3W75A 2ZX8A 2A6NA 5C71A 4W4QA 1GHRA 3DYPA 1MZHA 3G1RA 3PPGA 3SCUA 3KOYA 1WDPA 1PV8A 1RJQA 2OCZA 3EOSA 3LD5A 4GBDA 4V1XA 3C52A 2RHGA 1TPH1 5D02A 1I2NA 2FKPA 4QGCA 5DANA 2VQTA 3UZJA 3IIPA 1BVNP 2AL2B 1E9ZB 3BGJA 2I5QA 3EKZA 3ISIX 4QFUA 4X61A 1IYXA 3P5YA 3W73A 5CZSA 5BROA 4GCXA 4L6OA 4H9MA 1JYWA 4M6PA 5D4YA 3RILA 4AZ6A 4O0KA 1RA5A 1S5WA 3KWXA 3AMKA 3CHCA 5CPNA 3UR2A 1KTCA 2ZTJA 3R8RA 3NR0A 1R86A 3NWRA 3S5NA 2UWFA 2QCGA 1ME7A 2PDFA 4L4OA 3AJXA 1MFUA 5A6JA 4H8NA 4GH3A 5HMEA 4FA3A 1BPLB 4QTGA 4FLQA 3OBKA 3AOFA 2X1RA 1R85A 1LQAA 3BJSA 4GO8A 4O11A 2FMOA 1OM0A 1VYPX 2CZ5A 1B1YA 1EZ2A 1S2TA 1FHLA 1OY0A 4GK8A 3RUBL 5MF5A 1AQMA 1VEOA 4A8LA 3VX0A 1DHKA 3NO5A 2QCDA 2XFYA 3B3DA 2IKGA 3QHNA 1Q4NX 1HO1A 4RNJA 4S1FA 4GKLA 3LNMA 1FCUA 2EPLX 3EOEA 3MUY1 4LRTA 1QASA 1EIBA 3NYZA 4ADTA 4ES4A 4BFAA 5ECVA 1LOSA 2CLHA 3T05A 1ISYA 3AWOA 2FZ9A 2PUZA 1B3VA 1XSIA 2O4QA 3TJIA 3UPBA 3DFOA 4PL1A 4MAZA 4QS5A 3O16A 4OU1A 4CD8A 3RK8A 3VNYA 3O8AA 4MNLA 3TKFA 1TCDA 2JE8A 3BV4A 3OB8A 4OV4A 2QF7A 5LNSA 3C2FA 3UP8A 3L9CA 2WSQA 2FGLA 3RX3A 2P88A 1HF6A 4BI6A 4EVZA 4B9YA 2PGWA 4ORIA 4PFHA 1Q45A 3MSGA 2ZZ7A 4HP5A 4NG3A 3OLDA 1ZLPA 2JF7A 2D0FA 1A0EA 2ISDA 4JCMA 2YCEA 4UTKA 1O94A 4UTTA 1UD4A 2HVOA 1Z32X 2E5DA 2NX1A 1R3VA 1EJSC 1ELSA 4R34A 5CC3A 4AD1A 4QLKA 1LT8A 5CZ0A 4DLFA 2YXGA 3WBAA 4J2MA 3VMOA 5AECA 3KDNA 3GC2A 1SO6A 1TMQA 1Q6QA 4WEVX 4AIOA 5JBDA 2OG9A 1UROA 1NFPA 2D2OA 2CZDA 4ZENA 1R47A 4X0VA 3RJYA 1MVYA 5G1YA 2E9BA 2Y8VA 1HW6A 2PF8A 4QJ1A 3MUZ1 1KFBA 3M0ZA 2ZTKA 3CPRA 1DYSA 4J3TA 4KH2A 5K4XA 4IFKB 4S3AA 4RZ4A 5F2MA 3G24A 3GFXA 1PIFA 3DFSA 1Q63A 4XZBA 1KBIA 2PGFA 3RITA 3FIGA 1UW9A 1AD1A 1UPPA 2V3DA 4NI3A 4AWUA 5FCZA 5A6TC 2CLFA 3TOPA 3EPOA 4QE5A 3ITXA 3R11A 2HWGA 2QJHA 3QGAC 7XIMA 2VD9A 1CT5A 4BEUA 2CBUA 2ZWZA 1WDQA 2UV8G 1IEQA 1XKJA 2YLAA 4HMCA 2HPMA 1C8YA 4A4AA 3AHXA 5KZMA 1TREA 1OYAA 4S23A 3UG4A 2CKSA 2GQ9A 2PP3A 5CG0A 7ODCA 1PPIA 4IH3A 4MZYA 4XKYB 5CCZA 1J79A 3FN9A 1JZ3A 2QCNA 5KEZA 2R9RA 5A8OA 2WMIA 3UZXA 1DJQA 4H83A 4FXJA 4GUIA 1XW8A 3LRLA 3IVSA 4JTLA 1Q66A 5DFAA 2KX9A 3MANA 3N2XA 1W1B1 3SR7A 1ML1A 4D6DA 4R7OA 1HX0A 5J04A 4ZO7A 1HJQA 1DJHA 5F4WA 3QHOA 4K7YA 4H7CA 4BJHA 3RLUA 4LBUA 5I5RA 1P0NA 1CXHA 3WQ5A 1J11A 1QI0A 1US2A 4Q7BA 3MPGA 2OODA 3PAOA 7TIMA 3GXIA 3HIJA 1GEQA 1Q7ZA 3GDTA 4HOZA 1M9HA 3PNZA 1RK6A 2DPEA 3GXNA 3B0YA 2FMNA 4QROA 3AYSA 1Z44A 2BB0A 4OKDA 1WDDA 1VPQA 2PFHA 3CZGA 1E0TA 3KE0A 4Q8PA 2BZNA 3T8LA 4C5ZA 2NVDA 3SDOA 2R1NA 4ZQCA 3C6CA 4BEQA 1DQUA 3LQLA 5IXEA 2QKFA 1ZS2A 2DY3A 1MQRA 3MQTA 3L4VA 3PS7A 3K2GA 4J9JA 1B3XA 3AMLA 3H12A 4JBRA 4AYGA 1THFD 6CGTA 4KGJA 3T2PA 1P1XA 1YLVA 1DJIA 4DJEA 4MB4A 3NPUA 3RLHA 5EMUA 3PM6A 3WNKA 4LANA 4A3QA 3SY1A 3WN6A 1XG3A 3B8WA 3KCOA 2SFPA 4X0NA 1O7AA 1R8LA 4ZR8A 5CPMA 2WMJA 1DWJM 1DPMA 1EHNA 1TV4A 3B05A 2XH4A 2QGHA 4Q4KA 3WLOA 4O4WA 3W7MA 3AIUA 5EMLA 4AMCA 1F5ZA 3OVQA 4H9UA 3UR7A 1Y65A 1HJUA 1BQGA 3ITTA 2QDGA 2LLEA 3LHWA 5L6UA 1XG4A 2WHKA 2ZUNA 3P67A 5CKSA 3VM7A 1N8WA 1TX2A 1E6NA 3KRUA 4PBGA 4EX4A 4GHRA 3P8JA 1AZ1A 1X1OA 1JCJA 3W2NA 3UY8A 1GQIA 3SY5A 3OHIA 2X8RA 4UC5A 1MWOA 4QRNA 5CH9A 4I9MA 3CL8A 5JQ9A 4P8XA 4NZ4A 2XTKA 4Q4PA 2WWCA 1U83A 2QVHA 3V35A 4C7FA 4GY7A 3LGEA 3WQFA 5BOFA 3GVGA 3QKZA 4DNHA 1H49A 1LUCB 3FDKA 3U0HA 3W7OA 1KGUA 4IMGA 2BGNE 1HFBA 4ROPA 3E2RA 5BXRA 4EKJA 3HGSA 4TQTA 1VLWA 2PDKA 4TTUA 1JNEA 3PG8A 3UG3A 1NY1A 1W5OA 1JPHA 2IQDA 2Y7EA 1DXIA 5DX7A 3F5LA 2FDMA 3KHJA 3GZAA 1TPB1 1K02A 2HRWA 3PAJA 2QXWA 3AC0A 3PWIA 3B06A 3C2EA 2OEKA 3Q4DA 4PBFA 4PUJA 3H70A 3ID7A 3DX5A 4EIVA 1AMKA 4QNEA 2C71A 2F2KA 2ZXBA 1VIWA 3K8KA 4AVNA 2J24A 1FY6A 2GGIA 1SZFA 1OADA 4FXSA 4MADA 2OGYA 3ORWA 2D69A 4XVEA 1W3JA 4Q4RA 3W27A 3TFCA 1GTHA 3UG5A 3NJ3A 3XINA 1H11A 1Z41A 3B9NA 2QUTA 3Q37A 3G0SA 3Q2DA 1AW1A 3IACA 5C70A 4Q8NA 3HOJA 3K8MA 3MHUA 4O12A 1P1MA 1ECQA 2AQOA 3RYSA 1SPQA 2R14A 3IIZA 4P7NA 1X6LA 3BG9A 4QP0A 3WQPA 3SECA 1H2JA 3WQVA 5REQA 2BWGA 3P0WA 3P6LA 1AUSL 1DORA 3GDLA 2Y61A 3VE7A 3H23A 5CC7A 4ZODA 2QCEA 4HPGA 3A3XA 4X3ZA 1GYMA 1IHIA 4GFIA 2YOCA 3KHDA 3IUDA 5HAOA 5MHBA 4IT1A 4E8DA 1B2YA 3NQFA 4LV9A 3LMZA 1GZ1A 3VFCA 2XYLA 4R53A 1NQ6A 3QMRA 4HMDA 1XGEA 2DZAA 1V3IA 3MUXA 5G4EA 4P8WA 3TOYA 2ZYFA 3DFQA 1UR3M 1BWKA 1M03A 1RJRA 2WNWA 1QI2A 4GGHA 2YXXA 4LW7A 5HNNA 2GQ8A 1GJUA 4AHPA 3U6WA 5A8QA 1TIWA 1UOZA 5CLWA 1LWHA 4C7GA 4K1GA 3HQPA 3KTXA 1TR1A 3NURA 3RCNA 3CYJA 3VZYA 3WD4A 3CJPA 3UR8A 3H2NA 3GNRA 3PZNA 2NT1A 2Q09A 2QUVA 1W1A1 1G94A 2QW5A 1J96A 4ERIA 3HM7A 1HL9A 2VR2A 2OGJA 1DEDA 4EANA 3W87A 1HKIA 4JIRA 2YCKX 1W32A 2YA0A 1JI2A 3NSNA 3N4FA 3CZKA 3OQ8A 4IIFA 4WJXA 1EUNA 5A6BD 3R43A 4IUOA 4URIA 2PRHA 2X0SA 4R33A 1UJQA 4ZXLA 4O1EA 3H22A 3M46A 5DMNA 4YLWA 1WO2A 3CB3A 3NOEA 3W7EA 5D2WA 4C6EA 3S5OA 4QBXA 3IJ8A 2XN1A 1KO0A 2D3NA 1KTBA 3OEXA 3K46A 4A29A 3PSVA 1WV2A 4HU4A 3CUIA 1O1HA 1EBHA 1XIEA 3G0UA 2I5GA 2YB1A 4HKPA 4YMZA 2E5CA 3M0MA 3P8IA 1JL8A 6TIMA 2VD8A 1V0LA 3RM9A 4NX0A 1Q5MA 5AHIA 4FHAA 4PB4A 1UR2A 1UH4A 4JR5A 2DT2A 5C54A 4DXKA 3OZYA 2GOKA 3MSRA 3ARQA 5DF0A 1KD0A 1LQ2A 5CPSA 4QJ4B 2GSEA 2DSVA 3K5XA 1PEZA 2EG8A 4LPCA 5D38A 5CBBA 4JL1A 4PCTA 1R38A 2ZRXA 3C2YA 1TRIA 4PZVA 3TN6A 1OK4A 4F66A 1QI3A 4XKYA 1TIMA 4GA8A 3GXDA 4ORMA 3MZ2A 2G4FA 2ADAA 3L5LA 1H5YA 7CGTA 1I1XA 3F4VA 1O66A 5IRPA 1VBJA 4GVIA 2ZRVA 4WHBA 1SO3A 5I7GA 2YDAA 2HS6A 3OZOA 3HPXA 2WKLA 5K9XA 4F2BA 1HGYA 5BW6A 2DT3A 2VOMA 1YNYA 4H8HA 5HQLA 1N2VA 4LAZA 4NL1A 4I5XA 3VNLA 3TYBA 5FJTA 3HF3A 3UY7A 1NF7A 1SR0A 2V67A 4FEZA 1S2VA 2OKTA 3G1FA 4IMEA 2R94A 2WKJA 1YIXA 2V5LA 2OJPA 4C65A 3PZUA 1J93A 4J27A 2YKKA 3NVDA 4DJFA 2FTYA 4KCTA 3NZRA 4TX8A 5DO8A 5FF2A 4BI7A 2X16A 3EA3A 3LGDA 4B4HA 4GVGA 3U4FA 2AL2A 2B7OA 4L6HA 3AQUA 1EJVC 1R5YA 5FJRA 2VT0A 4LCQA 2J9ZA 4TMBA 5LA0A 5AB3A 1GWJA 1ZHAA 1ZPTA 2X1IA 1E0UA 1Q85A 5TIMA 1PUDA 1XLHA 4XZIA 3WMBA 1XFCA 4M5PA 2DZTA 1A0DA 4F2UA 3KS6A 3W1LA 2HPIA 3E6EA 3CMFA 3OODA 4YPJA 3W1PA 2V63A 3ZJ8A 1ZU8A 1E0VA 2R24A 3E2SA 1ZBKA 1HKVA 5IDIA 3UVAA 3UXAA 2NV1A 4JICA 1EWDA 3VDBA 3KM8A 1RJPA 3DZ1A 4C1NA 2XVNA 4M6VA 4AXKA 4MY1A 1XLEA 1SMAA 3R25A 5EMMA 3UD6A 1YXDA 4G7EB 3ZVHB 3W74A 2PD9A