1TMLA

Crystal structure of the catalytic domain of a thermophilic endocellulase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
286
structure length
286
Chain Sequence
NDSPFYVNPNMSSAEWVRNNPNDPRTPVIRDRIASVPQGTWFAHHNPGQITGQVDALMSAAQAAGKIPILVVYNAPGRDCGNHSSGGAPSHSAYRSWIDEFAAGLKNRPAYIIVEPDLISLMSSCMQHVQQEVLETMAYAGKALKAGSSQARIYFDAGHSAWHSPAQMASWLQQADISNSAHGIATNTSNYRWTADEVAYAKAVLSAIGNPSLRAVIDTSRNGNGPAGNEWCDPSGRAIGTPSTTNTGDPMIDAFLWIKLPGEADGCIAGAGQFVPQAAYEMAIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-D-GLUCANASE
publication title Crystal structure of the catalytic domain of a thermophilic endocellulase.
pubmed doi rcsb
source organism Thermobifida fusca
molecule tags Beta-amylase
total genus 102
structure length 286
sequence length 286
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 1993-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01341 Glyco_hydro_6 Glycosyl hydrolases family 6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.40 Alpha Beta Alpha-Beta Barrel TIM Barrel 1, 4-beta cellobiohydrolase 1tmlA00
4AVOA 1DYSA 3VOIA 3RU8X 1QK0A 2BODX 1UP2A 1GZ1A 1QK2A 4I5RA 1OC6A 4I5UA 3RPTA 1QJWA 3A64A 1OC7A 3VOHA 3VOJA 4B4FA 4AVNA 1CB2A 1UP3A 2BOEX 1OCNA 1HGYA 1UP0A 1HGWA 3A9BA 1TMLA 3VOFA 4AU0A 2BOFX 4A05A 4AX7A 2BOGX 1OC5A 4AX6A 1OCJA 1OCBA 2BVWA 3ABXA 4B4HA 3VOGA 1UOZA 1BVWA
chains in the Genus database with same CATH superfamily
1PZ2A 3ARYA 5D9NA 3NXFA 1IEXA 4MVAA 4J7RA 3ARRA 2YBTA 2OSYA 3T0DA 2J27A 4WDWA 5D2XA 3WF4A 2WNWA 3DFHA 1J01A 4TX6A 2Z1SA 5HUOA 2QCGA 3AOFA 3Q2DA 3ZO9A 4XSLA 4NRRA 3FNDA 1H7NA 4UFIA 4ZZ9A 1FH9A 2PTYA 3M0MA 3VIPA 1H49A 1MZRA 5C6MA 3L0KA 3EEZA 3TOYA 5E9AA 3DDMA 3WF2A 2VYOA 1EQCA 3T0TA 2XGIA 1XIBA 2GJPA 2BVYA 3SW6A 5JIWA 1Q65A 1LJYA 2PDMA 2ZOXA 1VB9A 3CO8A 4XO7A 2DSZA 1NWRA 2ZA3A 1AVAA 4W8AA 1PIFA 1WBJA 5CGQA 1KFEA 4HPHA 4HHLA 1BVZA 3F4CA 3EMCA 5HOSA 2WVTA 4LAKA 1QI2A 1JGMA 4HPJA 4V2XA 4E2BA 1AJ2A 4YTUA 4JTKA 5CZ0A 4QCEA 1IT8A 1XLFA 1SO5A 4LPCA 4AU0A 2XSBA 1ZU8A 3LD5A 4WLCA 3RIKA 3E9AA 4RDVA 4UNIA 1OHLA 2GQ9A 3WUGA 2W0UA 4XX6A 4US6A 3H4XA 5CGTA 4ZTXA 4QG6A 4BA0A 1YXYA 3EMZA 3GU2A 5HQMA 3L0GA 3QN3A 4UMCA 5TF0A 2OEJA 2YW4A 3DC8A 4MUZA 2FPTA 1Q7ZA 2WCSA 3WUFA 1FWNA 2CHNA 2Y85A 3P67A 3EB2A 1VFFA 4OKDA 3TXZA 1Q6RA 4WX2A 5DBUA 1TVPA 1ZBVA 5I0DA 3GC4A 1KRMA 1Q6CA 2WHMA 1G0CA 2DSUA 1TG7A 1HF6A 1YYAA 4EE9A 1IV8A 3ZR4A 3SZ8A 3SCVA 1VEMA 2REQB 4K8EA 1E4LA 4HMEA 1F2JA 1Z9AA 4CCCA 3GXMA 3TC6A 1FP8A 4HIBA 4UQAA 1V6XA 5E0FA 3WF3A 1SO4A 4BF7A 4Q8OA 2PWUA 1XWYA 3CUZA 1JIBA 4IJBA 2JQXA 4I7VA 3KCJA 4S3EA 1NEYA 4RR4A 2OQYA 3NPUA 3LGDA 3UU0A 1XIEA 1PVNA 4OIFA 3CAWA 3VD3A 3DFTA 3T0CA 2Z25A 4ORMA 4HGXA 1K7FA 3M0IA 1AL8A 2X1TA 1MQPA 3F4WA 3UGVA 3W7CA 3GFXA 3C5QA 1R9ZA 3KLKA 4E3VA 1YPFA 2VDIA 1VKFA 4QDPA 2NSOA 5HMDA 3E6EA 2D2OA 1Q6OA 2Z6IA 4ALDA 3O63A 2VWTA 1LLOA 4E6MA 2C0AA 4UQBA 2QEZA 5D2YA 1CB7B 2WLZA 5CZJA 3UXDA 1NP0A 4H9VA 1ISYA 3G1DA 1F76A 2A5HA 1PHQA 1XYAA 4DUXA 1W5NA 3A47A 1QNRA 4H00A 3TTQA 1SVDA 4XO6A 5FJIA 5BNKA 2VT0A 1HG3A 2E6DA 3SRHA 2ABBA 3DI1A 1Q6GA 1ISVA 1SZFA 3GR8A 5FJJA 1ITCA 5CH9A 1WBHA 1IR1A 3N4AA 3L4YA 4QXIA 3BJTA 1R8LA 1E15A 3PNUA 3EDEA 1DVJA 1BD0A 1P5BA 4FX7A 3KS6A 3V75A 3CIVA 3UPMA 4XWUA 1TV3A 3P62A 4LYRA 3N4EA 3QFEA 2I56A 2YA0A 2GVLA 2BBFA 3NYDA 2PDIA 2VR2A 2J7EA 3AYRA 3DHFA 4KFNA 3W74A 3W70A 1MW0A 2BY0A 3PSVA 3S5OA 2DT2A 4CNOA 1VFSA 1KBBA 2BASA 1MUCA 3OB8A 5DEZA 5IDZA 2J6XA 4Y9PA 4R34A 2XHYA 1NY1A 4O14A 3SCUA 3M6DA 2BVTA 4XAPA 3TN5A 3UZJA 5FI8A 4DBEA 3NYZA 1I1XA 2ZKMX 3TTSA 2QJHA 4IPNB 4TU1A 4IPLA 4EXAA 3GC5A 5REQA 4MJZA 3S1WA 4HNUA 5C70A 4GLEA 3IV8A 1BF6A 4L1WA 2BVDA 1U83A 2E5BA 2E6YA 3UJRA 1AODA 4J1OA 2PGFA 4HNVA 4LCSA 5CZTA 1XSIA 3DFYA 4YMZA 2V5JA 2QMKA 5LXEA 3PTDA 3ZWTA 4MWAD 1TCDA 3IJLA 3L5AA 3MHFA 4C91A 4DWSD 3QV6A 1PE1A 2XN2A 2W61A 1KXTA 4PB5A 1M65A 1WAUA 4C60A 1VCGA 3I4EA 4DZ5A 3TFCA 1QNOA 3BUVA 3U0HA 3TMQA 4W5UA 1P0NA 4Q4OA 3K4DA 3BLIA 4AIBA 2G4JA 1KLYA 2Y5EA 1POJA 3VC5A 1UQZA 4YTTA 1KKRA 5CC3A 2HS6A 3NR0A 1AQMA 2J77A 2QCCA 2OO6A 1E4NA 1GG0A 3M0KA 2HRWA 3P6LA 4YPJA 5K7JA 1FVPA 4GI8A 2PMQA 1BVWA 3F5JA 5D03A 2PS2A 4GZJA 3KVKA 4TVUA 1JAKA 3ES8A 4UFJA 2VX4A 1B90A 2C13A 3C86A 4IIHA 4ZQPA 4J3UA 1PO9A 1NH6A 2WO5A 4WUIA 2D3NA 3KLLA 3RX4A 5K9CA 1QI3A 4IGNA 1TTQA 1SO3A 4GJIA 3OQEA 4MPKA 1PKLA 1PS9A 1FWHC 2CWNA 2VFEA 4EWND 6XIAA 8CGTA 3KBWA 4NXKA 1ITQA 4H9TA 4O28A 2OEMA 1VFMA 4MUPA 1RR2A 3UVIA 1LP6A 3RUBL 3E5BA 5HNNA 4JYEA 3F4VA 4JICA 2DZVA 4ILSA 3H70A 2OZ3A 5HJYA 2BGQA 4J9JA 3PPGA 1EXBA 4OZOA 3V36A 1WXZA 2H8ZA 4Q4MA 4FI4A 4NVTA 1EYEA 4KCUA 4CQAA 2ZBTA 3OZMA 3CV6A 4FOJA 2C1HA 1F3TA 2WC7A 3IIOA 5F2IA 3KBVA 1F74A 4D9PA 4YJ5A 4LCRA 5A6TC 1GEHA 1QO2A 4F40A 3QW3A 3FGCA 3PAOA 3N14A 4CD5A 1TSIA 3GNPA 4D6JA 2BODX 1DXIA 3NSNA 1YXCA 3NL2A 1UWIA 4DJDA 2GFTA 3F2DA 3VIHA 3MWAA 2IPJA 2QAFA 4EVZA 4XV0A 3HZ3A 4H7ZA 1Y8BA 2B7QA 1EZ2A 2FZDA 3FA5A 3SQSA 4E4UA 2IS7A 4U2YA 4DM2A 1WYIA 1EB3A 5CJNA 3KUMA 3IAQA 4LEFA 1T96A 4GJJA 1BKSA 5TBOA 4NAEA 1POKA 3EXTA 5DMLA 1S2AA 4I90A 3S0CA 4RW5A 1ONRA 1LQ2A 2X40A 4ATDA 4GIEA 1HKWA 2RUSA 4XIMA 1E0VA 2Z2UA 4NZ5A 1R3YA 1JR1A 1I45A 2E5DA 3SCPA 3G22A 2IKGA 1XGEA 1MUWA 1N8FA 3MA8A 3S2NA 1UBPC 1W9UA 3AHTA 1VYRA 4R33A 4IIEA 5HNUA 1KWKA 3THUA 1TPH1 4UIOA 3AYSA 5JBFA 4D8LA 7REQA 3E49A 3V7PA 3U6WA 3A23A 3THAA 4LV4A 2JF6A 4Q33A 3JR2A 4IUOA 4DI8A 4IP4A 2FDMA 3NAVA 3MI2A 3ZS4A 3F03K 1TV2A 1MO0A 3GDRA 4DJFA 4Z1YA 1PL9A 3WQCA 4ML9A 2Z1VA 2TSYA 3KM8A 1TPC1 3LXCA 4Y9NA 4JPGA 5FAGA 4Y8FA 3EA3A 3OODA 2JGYA 4HJFA 1IWAA 2D0FA 3G2GA 3S46A 4GQRA 2VOMA 1GZGA 2YCLA 4FEZA 1LQ0A 4S3GA 3UT0A 1RCQA 3OVGA 1W56A 5ABTA 7PTDA 3T2OA 1QR7A 3FYPA 4Q8PA 1J18A 4MTVA 3FYOA 3QPYA 1XISA 3SIMA 3T78A 2O55A 4DPQA 2WSRA 2WZMA 2IPWA 4PMXA 1XD1A 2X7WA 1ZAHA 4L6OA 3R79A 3WK3A 3MZ2A 3D5HA 2QPSA 3EB4A 1XSKA 1V51A 2Z28A 4IWWA 3WH6A 4JKKA 1ONWA 3ITGA 4M82A 3KBSA 3T07A 1V77A 2FGBA 1LTDA 1GJUA 1XRVA 1LORA 1A5UA 1QHZA 3NQBA 1DHKA 2FZMA 3SJ3A 3UQNA 2PD9A 3TCSA 3HPXA 1UR3M 4R3UA 4NILA 4LWWA 2AGKA 1O4UA 1O5KA 5LNRA 4H8HA 1K4GA 2A3AA 4Y2WA 3TP4A 3G8EA 3A5FA 2FTYA 3NZRA 3U8GA 5A6LA 4JQAA 3KOYA 2IUZA 3ARVA 2ZZ4A 1GOKA 2Q3OA 4QLLA 1LOLA 3GD6A 3WQ5A 3TYBA 3FV9A 1J79A 4EPBC 3TJXA 1EGVA 5AHMA 4LALA 5AFDA 4YCOA 3WMLA 1V6VA 1FCQA 1W3HA 3GVGA 1W5QA 2Q3RA 2HJPA 1HW6A 4C1KA 5E9XA 2ZUTA 4JFSA 2Y6ZA 4TO8A 2GL5A 4EP8C 3Q65A 2UBPC 1CLKA 3QSRA 2P50A 4US5A 5LNVA 4W86A 2XN0A 4ZXOA 1A3WA 3TJIA 3TYDA 1DE6A 1EF3A 1PV8A 2F2KA 1F3WA 2WSQA 4ZO7A 1R87A 2WJEA 1B3YA 4UMAA 5G2WA 4WKHA 2DIJA 1IIGA 1OX6A 2E68A 2NVAA 3NOEA 4AWEA 4IFOA 4RZ6A 1RV8A 2XINA 4RPQA 3GG8A 3P7YA 3OU8A 1SFJA 1AMYA 4ZL1A 2QMJA 2XVLA 3ZM8A 4HNLA 4PCTA 4QBXA 3MMUA 1VH7A 1ME7A 1F4HA 1VJZA 1GVIA 1C92A 1MZHA 2V2DA 3AXHA 2RKXA 1NTHA 3NGFA 4M24A 2DZUA 4Z0SA 3VC6A 3TKFA 5A6BD 1CGXA 1KA9F 2V5BA 4S2CA 2INZA 1DEDA 2JGQA 4CQBA 1Q6DA 4HZ8A 1KXVA 4CKQA 3QGKC 1TELA 4HP5A 1H51A 3OBKA 1ZL1A 3LGGA 1Q66A 4PEEA 3GNRA 3BXWA 1WQ5A 4M0XA 1OM0A 3R2GA 3BLEA 4DPPA 2ZDSA 4AUBA 1XGDA 2WSKA 2FFIA 4KEVA 4I8YA 2WCAA 4FSAA 2Z1KA 1Q3NA 1QAPA 2BFGA 5CPSA 1JPIA 1RY0A 1SW7A 1E51A 3QOKA 4ICMA 3TH6A 5KTLA 2YPIA 4B4HA 1OCJA 4L5ZA 4O18A 1V02A 2I5IA 2DUAA 3H22A 1VLWA 5HR6A 4XG1A 1DKWA 3WK0A 2ACQA 2ZZ5A 3H2AA 4M6UA 4KESA 1H7PA 2XUCA 3EWCA 5AC8A 1IE7C 2GZXA 2EKGA 3QV9A 1W8GA 1XDJA 1L6YA 1PYFA 1A5SA 3SCSA 4GG9A 3W81A 3VNIA 1E3XA 4PRRA 4QITA 1TZZA 4E3TA 1OZQA 3ALFA 1E6NA 2ZYFA 3D47A 2VMFA 4NP7A 3NDOA 4PTWA 5CSRA 3BG9A 4MJMA 2VDGA 4J3ZA 2VZSA 9XIMA 5KITA 2ZRYA 1TPB1 5K4XA 1O1HA 1WE5A 3FAWA 5A6MA 1OIMA 3B9AA 3NUKA 3MKVA 4C1NB 3LTSA 4V33A 2W6RA 5FJUA 4N6EA 1CENA 3C61A 4GINA 1AZ1A 1LF1A 4AZBA 3VNYA 3FHQA 4MNKA 4IGHA 5DMYA 4BF9A 4MOZA 1MDRA 4LAMA 4L1GA 3TTOA 4L6HA 3TW9A 4IFKB 1QHPA 2Z2AA 1UP2A 3U7BA 4OV9A 4FXSA 3FVMA 2C16A 1WPCA 3HG2A 1H7OA 2H8XA 2CC0A 3V4BA 4PUUA 1E6XM 1XINA 1Z42A 4WEVX 1PTGA 3RM8A 5H8MA 3W7LA 3MP4A 4C6CA 2OT0A 3KXQA 2B7OA 3S6OA 4PE8A 2D1ZA 2W67A 3CYVA 1IIHA 2V69A 3GAYA 3PG9A 3VKJA 4TV5A 2D20A 4MFDA 2OYKA 4WGXA 3V5OA 3VKKA 3WEOA 1GG1A 3PUOA 1L2QA 4PCPA 2A4AA 2W3ZA 4QQ3A 4F2TA 1WDQA 1GVEA 4YNGA 1GKRA 1X6UA 1UPPA 5CPMA 1XIMA 2ZFAA 5H8UA 3RAOA 1RD6A 2XM2A 2ZXBA 3NZGA 2WHJA 1JZ7A 4QSHA 5AYZA 5IHSA 3LRKA 3ICJA 5I00A 3WLOA 1Z69A 3D3AA 3W38A 4C7FA 3RLVA 4DJEC 1E9LA 4JTSA 4JKMA 2PDGA 4GHRA 1K8CA 3MJYA 2VKZG 4B5NA 2DIEA 1YDNA 4ZOBA 1PBGA 2J7HA 3CTLA 4LVFA 2C6QA 3M0JA 2XIOA 4HHPA 4E4FA 3CQKA 4C65A 3NQDA 1GJWA 4X0NA 2VO5A 3G18A 3PPFA 2XIMA 4FLQA 5EGRA 4Q3MA 3WBAA 2PRLA 3AJXA 2QCFA 4P7NA 2QXWA 1FWAC 3N9KA 2OSWA 7ODCA 1UC5A 4WVXA 4PUKA 3SR7A 2DU2A 3KL5A 3AWNA 2PTXA 5EL1A 3CUIA 2MANA 1FFQA 3RLGA 1W1IE 1XQKA 3NL5A 3MY9A 2FB3A 1RK5A 4NQ1A 5BRQA 1LBMA 1FXQA 1K03A 4UBPC 3W73A 5DT7A 4QE4A 5M17A 5LSMA 4IL0A 4AXNA 3A3WA 2RHGA 1LZOA 3L9CA 4NT0A 3V18A 3PC0A 2DY3A 1FWEC 3UETA 4I9JA 1RD5A 4MB4A 5BW6A 3I3DA 1JF5A 1PZ3A 1DWFM 2ZZ1A 2HWGA 2HMCA 4H8NA 3GHRA 4QE5A 4IJRA 3TYEA 1MNSA 1V3HA 4Y7EA 1YPXA 3URAA 3B0VC 4TMBA 3QQ0A 3E02A 1OFBA 4LYQA 1VHNA 3VIGA 2XFFA 4P7QA 1REQA 4S38A 5FJTA 1GYNA 4EXBA 3N1AA 5GNXA 3R94A 3GQYA 1MEIA 1RVKA 4KMQA 1ZAIA 4RUBA 4IX2A 2YDSA 4GNVA 1XS2A 4ZVJA 3UCCA 3DKLA 1HO1A 3IIVA 2EF9A 2QULA 3UESA 3GVRA 2QCHA 5BRBA 1DV7A 3R4IA 3B04A 3DAQA 2Y63A 3H53A 5LNUA 3TTEA 3VDBA 5CJ5A 4F48A 4ZB0A 5AYYA 5HINA 1JZ6A 3INPA 5K4ZA 2TRSA 1YTDA 1S1RA 3WQGA 2J7DA 4WRHA 3KS5A 4BEUA 1EL3A 4HK7A 1F3EA 3Q45A 2KAUC 3SCWA 3N4FA 4LAOA 2Y70A 4B91A 3ELFA 3FHAA 3MI6A 2WPBA 4QLKA 1A5CA 1D2KA 3MBDA 3ABSA 4QQUA 5AHEA 3SN1A 3WLSA 1HN1A 3FDGA 5IDIA 2DT1A 1T8XA 3HBLA 4JTDA 6REQA 1QPQA 4MWAA 1UOZA 2FLIA 2IPFA 3PS7A 3GX9A 1F8IA 1Y5XA 4HK5A 4LUTA 4DWSA 1ZHAA 1W5PA 4K8GA 1WZMA 2VRQA 3NQ8A 5DRIA 2WZHA 4H01A 1UZHA 4UOJA 3REQB 1XYBA 1KD0A 4KCVA 3QF0A 4S39A 1G69A 3EWBX 4AZHA 3M41A 2D2HA 1YKWA 3PBUA 1P0KA 3DG6A 1FHLA 1XFCA 2CKRA 2V3DA 1YMYA 2W5FA 1M7JA 5AC6A 4K7YA 1W3IA 2FH6A 3WMSA 1CDGA 3CH9A 2R1MA 2YXXA 2GK1B 3URNA 1DHPA 4JFUA 1U1UA 4K39A 3Q94A 3WQPA 3RGTA 2A3LA 1MEWA 4QTGA 2FTPA 3C8NA 1KWGA 1ENUA 1RCOB 2PWVA 3WUEA 1HJWA 2H3BA 2PZ0A 1T0OA 1JCMP 2DUXA 2NQ5A 3U4FA 1IGWA 3GTNA 5F1VA 1SM9A 3WFLA 2NQLA 2AGTA 2V5LA 1KNWA 1F6PA 3W22A 3DYMA 4IMDA 1X97A 4I6VA 4O8RA 1GPFA 1UA3A 5G2IA 4FLRA 1A5KC 3UXIA 1OX5A 3GFZA 2PDHA 1TWDA 3L4UA 4XKMA 6CGTA 1Z41A 1NDYA 4L9XA 3EBVA 2X41A 2HTMA 2VWSA 3KZSA 2NVDA 1JEZA 2F84A 4UR8A 4U3CA 2GGGA 2BB0A 3HG5A 4BCEA 3RLUA 1JDAA 3R0KA 3EX1A 4HBKA 2PBOA 3H2NA 4Y9AA 3U2EA 2OZTA 4LCQA 2CETA 2FQIA 4H3DA 1V3MA 3SURA 1GVYA 4BWLA 3BDKA 1CEOA 4L9YA 4WZHA 1HJVA 4RPPA 2BY2A 4Z2LA 5JH2A 3WLKX 3WBYA 5HK4A 3CNYA 1YDOA 3KTSA 3FXYA 4EK7A 2DEPA 3W7EA 3L4XA 4RCXA 4F9DA 3W7IA 3ZVHB 1AH0A 2D2GA 5XIMA 2CBIA 2ISWA 4PCFA 4GH3A 4J40A 5I2UA 4KEZA 1UJQA 4OUIA 2XDFA 5IBXC 3ZVIA 1DBTA 1GOWA 2G95A 2WZTA 3FJNA 2XVGA 1W17A 1LROA 4XVDA 1DWHM 2UY3A 1UWTA 4OFCA 2PGRA 4LUSA 3MCMA 2G3MA 1PB0A 3CASA 3B3DA 3EB3A 2XZ9A 3A4WA 1EJVC 1S2TA 2W9MA 4I9TA 1ITUA 1FWGC 4ECLA 4O53A 4W89A 4W93A 4G1KA 1X96A 3GFYA 3BV4A 4H19A 3D46A 1DJXA 4MGGA 1S46A 4KCTA 3SFKA 4KIRA 2VFDA 1V3IA 2JF7A 1FWCC 1K7XA 3SAZA 1SGJA 4GCAA 5I79A 2VOTA 3CL6A 4IH3A 1TJRA 1BRLB 1XLGA 2HISA 3QQ1A 1TV4A 5A5WA 2XSAA 1WXJA 4O1AA 3W1XA 1DXFA 3UYCA 2HEJA 3AS1A 3EXSA 4HMCA 1WDRA 4FA3A 4OV4A 2AL2A 4LNYA 1ZUAX 3UERA 1DQXA 4AH7A 3UR2A 3UXLA 3CZKA 3CHDA 2J24A 2EBNA 3BLKA 2W4XA 1S5TA 1B54A 4JN6A 1JDCA 5BZAA 3KHJA 3TJ4A 5K9DA 3KFTA 3F5KA 1RXOB 4XBJA 3SY5A 4GKTA 4E2DA 1EBHA 1UD2A 1XKYA 2DPEA 1DIDA 1QNSA 2W66A 3N2CA 1UH3A 1VCFA 1WV2A 2DSKA 4ACZB 4A2RA 2VURA 2YFNA 2DT3A 3TA9A 5ENLA 2R24A 2F61A 2BV9A 1G4SA 3VUSA 4MG4A 4FX6M 4G7FA 2CCRA 4LTSA 1YIXA 4DYEA 1KRAC 1SYTA 4NXSA 2VX6A 3GY1A 1XRFA 7ENLA 4XZBA 2VP8A 3A3HA 3LCFA 1NFGA 3K13A 2PB1A 3ABXA 3A4AA 1MDLA 1GOQA 3VM7A 1Z89A 4MZYA 1GUVA 2QKFA 3EA2A 3CL7A 3NL3A 1CCWB 1CIUA 4PMYA 4Q8MA 2V68A 3ZWSA 2YOCA 1TWIA 3EDFA 1Z3NA 1E5JA 4LXFA 4EOUA 1XKJA 2CBVA 2VZUA 4BY3A 4KW2A 4A3RA 3A9IA 1SFTA 5MKGA 3UR7A 3H7VA 5CC6A 2XFRA 2C1IA 1ODUA 4J3SA 4MNMA 2A7PA 5DCBA 2ZUWA 1RLCL 3UG3A 3MO7A 3ONBA 3W4RA 1YHTA 4KWSA 1T41A 2J75A 2XU2A 3GKFA 4JQ2A 2AQWA 1LUCB 5CBBA 4PMDA 1LG1A 1XIJA 3QW4B 1UBSA 3EDDA 4LFYA 2Z1XA 2W63A 3VD4A 4MSSA 5A8MA 4PUJA 1EH9A 3TN6A 2ACSA 3FSTA 3GO2A 3UA4A 4DVOA 5I06A 3PZMA 1R3QA 4TTUA 3URQA 3BSMA 2CBJA 2I17A 4Z2KA 2WMIA 4ZMGA 1MI3A 3IGHX 4ERAA 5J8LA 1OQFA 1XLBA 4DUVA 4K1WA 5D30A 1F7BA 5CBJA 1ZPTA 4BS0A 2A79A 2J78A 2YIHA 1VBHA 2WKJA 5LIWX 2PE4A 1Z32X 3CV2A 2IMRA 3OYZA 4MAZA 1RLDA 1K77A 4GVGA 3LGEA 1XV8A 1R7AA 4EWJA 6ALDA 1HQTA 2QIIA 3NURA 5GQBA 4H2CA 1FBAA 3RMJA 2FMOA 3N6QA 3EX3A 1G1YA 2ON3A 5F7UA 4CEUC 2QUNA 4IXXA 3KP1A 2BY1A 3GHSA 4JTHA 3IJ7A 2WWCA 4DYJA 2ZZ6A 4A3UA 3CV1A 3UWUA 2TPSA 1TIMA 1SFSA 3QMTA 3SGZA 3TC7A 1OGGA 3B97A 4G7EA 2CLMA 3LHTA 3EWZA 4AWSA 1EX1A 5B7YA 3MZNA 4TR9A 5HXMA 4DZAA 4FLOA 1FCBA 3O0KA 2ZRWA 1EJSC 3BW3A 3U2CA 3MPGA 1OK6A 3HQNA 2PDJA 3ARPA 5FEPA 3R6IA 1TV8A 1VF8A 1A53A 4WDTA 1C93A 4YWSA 2ZZ2A 2AOSA 4GQQA 1XD0A 3W2NA 3EEGA 5AYXA 1IZKA 3GZ3A 1JCJA 1X1ZA 1AJ0A 3O2LA 4A22A 4E4PA 2VDHA 1EHAA 3NPVA 2ALRA 1HJUA 4PA8A 3TVAA 5KZMA 1JFXA 1EX5A 1P0EA 1B4EA 4WGHA 3SUSA 3GTXA 3CC1A 1FQ0A 4O1BA 4AD4A 4INFA 5M5DA 4PMZA 1LLZA 2X1SA 2YXGA 3TOPA 1UD6A 4NNBA 3KCLA 1A5MC 4Y96A 3RU6A 4O1CA 5CCZA 1OSEA 3W2LA 1KFLA 3U2OA 1LCOA 3HN3A 1PPIA 3W02A 2X42A 4L1XA 1SQ7A 2C18A 3FEQA 5DCEA 4CNTA 3UWWA 2WVVB 2JIWA 2OWXA 4ZQNA 3LCGA 5KSWA 4ZB5A 1ISZA 2NSXA 1RJPA 1ADOA 3WNLA 4B2DA 3T42A 1S2UA 2ZWYA 4O4WA 1OFOA 3CUGA 3WENA 3AS0A 3WQEA 1O7AA 4U5IA 4K38A 3M0HA 3N18A 3POHA 4O0ZA 5D2WA 2WNNA 4W9TA 1H0GA 4QSFA 2EO7A 2O9OA 1SUXA 4JTRA 1JCNA 1RA5A 2EPKX 4H41A 5LNSA 1IYXA 4I9MA 2ALDA 4XAGA 4DZHA 2JKPA 3LV5A 3EOUA 2P0OA 1OFRA 3QMRA 3CUHA 4A3HA 2AKZA 2PRHA 1TMLA 4WY0F 4H2HA 4JGDA 2YXOA 2J74A 1YEYA 3DYOA 4UTFA 3WQVA 1SR0A 5TQLA 2NQJA 1L2UA 4QISA 1M7OA 4F0MA 3S5ZA 2OEKA 3MJMA 2Y61A 4XD6A 3H6OA 3CWHA 1KW1A 3CS2A 3EOLA 4DUOA 4JQ3A 3SRFA 3L7RA 2VQTA 6TAAA 1TMQA 4L4LA 2JE8A 3IRDA 2BGNE 1FWRA 2HK0A 4AW7A 2X0HA 5C71A 3E0VA 4BEQA 4HT3A 4PB4A 4XIAA 4DB7A 1N2VA 1P1XA 1IT0A 1Q85A 1FDJA 5JUVA 1VFLA 4UFKA 2FYMA 1K4HA 1RBAA 2HZGA 2ISDA 1ISXA 4ZO6A 3V3WA 1Z6KA 5KZEA 4ONVA 3TAOA 2PP0A 4D6FA 4NJKA 5C7HA 3GIPA 4XD3A 2WM0A 3LRLA 3PBGA 1H63A 4AY7A 3BV7A 3GDTA 2FGZA 4N9EA 2RH9A 1O6IA 3GH5A 4HHHA 1GQNA 2A6LA 2Q6ZA 4Y9MA 1SZNA 4B3ZA 2PAJA 4JOMA 1H4PA 3EX4A 2FJUB 1U2YA 3RCNA 1WXYA 4IMCA 2VGGA 3VKDA 2E3ZA 2WMKA 1HT6A 4HZ6A 1EYWA 2FHBA 4BJHA 3YPIA 4LS1A 4RV3A 1HKKA 2OO0A 1GYMA 3GIYA 3THDA 4O52A 3W1LA 3P0WA 4JN7A 3TWAA 4J3WA 2CLLA 4XAFA 1UC4A 1EPVA 4ZE5A 3V1HA 4C6OA 1AK5A 1SW3A 5C7VA 3P82A 2GDQA 4ICCX 3UY8A 1FRBA 3JUGA 2UY5A 3LG3A 3NO3A 4HMDA 3HJEA 4AZCA 1EA9C 4HCDA 1NU5A 1EXPA 1RA0A 2BOFX 3M0YA 5JBEA 3GK0A 1T40A 2B4GA 4DRSA 3V0TA 1LRTA 1OK4A 3GBEA 4GYPC 3BANA 2AQVA 3UG8A 4LOCA 3AQUA 5FF0A 1XC4A 4DBUA 4NRSA 3IJIA 4B3LA 4JIQA 3W26A 1K7EA 2BY3A 2DIKA 1CXLA 2G4FA 4FXJA 2VZOA 3BG3A 4KWUA 4P5UA 2ZA2A 1MW3A 4KCWA 2QLYA 4QHRA 1EBGA 1KC7A 1TCMA 2FGLA 2XGBA 3ZT5A 2QJMA 1DPMA 3I7SA 1GKQA 1KRBC 1OF6A 3D6NA 3TLQA 3G8RA 3UZ5A 5A8PA 1XLCA 1OFQA 4DXVA 1A3XA 1MSSA 3BK0A 3IJDA 4ADSA 1B3WA 1RBOB 2WQPA 4N9BA 4CNUA 1DYSA 2GGJA 3URBA 2W92A 1R0MA 1G5AA 2PZNA 2Y5SA 2REQA 2XSXA 1VIWA 1XYFA 4F79A 1UWUA 2QGHA 2XWEA 2BSLA 5G1YA 1UASA 1W1ZA 3ARTA 3NQCA 4P7LA 4WJ8A 3WLPA 2YZ5A 3EA1A 3WH5A 4KGLA 3N2XA 3S1UA 4QS6A 3OGRA 5G2HA 1AQHA 3WNKA 4WDUA 5A94A 1UR4A 5REQB 1VBGA 3OVRA 1A5AA 3VOGA 2CFFA 2BZNA 4MYAA 3IGSA 3EOEA 3G1VA 1WNOA 1F8MA 5JH1A 4GZ7A 3ARSA 4YYCA 1ZLPA 4H7CA 4WXZA 4X9SA 3VU2A 1CXHA 2VRKA 4XD5A 1AQ0A 4Z17A 5JIPA 1JDFA 2ACRA 1RSCA 3K5XA 2J7GA 4NZ1A 1TJ0A 4FR6A 1KCZA 1EHNA 1Q2RA 4PMVA 4PN2A 4X9YA 3UG4A 3WL1A 4OECA 3HMCA 3LMYA 1U1HA 1XF0A 3BAIA 2QYGA 1UKOA 4CN6A 3W84A 3MBFA 2DZTA 4FALA 5FSEC 1VYSX 4BI6A 5I09A 2QCEA 5C9UA 4AXKA 2DSVA 3FIGA 2Z7KA 4DJED 3I6EA 3QXBA 1BAGA 3EWDA 1BG9A 4GXWA 4W8LA 1HL2A 2D0HA 2CLHA 5CPOA 1V02E 4NX5A 3PB2A 1ZB5A 1W8SA 4W88A 1PUDA 3RO8A 2HDJA 5T9CE 4XZWA 2E9LA 2QUVA 2X7VA 2OJPA 4UTUA 1VRXA 2E6FA 5DQPA 4Z1AA 1ZQ5A 4AY8A 2Z7GA 3TU9A 4W7WA 1N8WA 2ISFA 3A21A 1HP4A 3S5SA 4AC7C 3B05A 1M53A 2BXYA 3IK4A 5BRPA 4H4IA 1GVQA 2VL4A 2EHHA 3WY1A 3RLHA 3ANUA 2X2GA 3GNXA 2R1NA 3TYZA 4PBEA 1C3FA 3QMSA 1EP3A 5G4HC 2DORA 4HKPA 4FHAA 4HNOA 4BFAA 4J5NA 1LOQA 3HU7A 5CZSA 2DSWA 4DNMA 5I3FA 3QY8A 1Q7MA 2DV0A 4TOQA 1EDGA 1X7IA 2VEKA 2X09A 3WD4A 5C9ZA 1QUMA 4DXXA 2GSJA 4UTJA 2I57A 3U5YA 1A4MA 5D38A 5DFAA 1ALDA 1OCQA 3GG1A 3FGCB 3P5YA 1EUNA 1B30A 4F2BA 2W27A 4W84A 5ABFB 1VBUA 1QHOA 4DJFC 3VIIA 4HNCA 1C8VA 2EJ1A 3N3TA 4S3JA 1VP5A 1U5VA 4AQLA 1V7YA 4LVDA 1KO0A 1EP2A 3VKAA 1E9ZB 1A4LA 5E70A 4P8VA 5A69A 3PR2A 1LG2A 2RDTA 4JTCA 4A8IA 3FK4A 3E5PA 1K70A 4FK9A 1M04A 2V30A 4NAEB 3A3XA 1BXNA 4CCEA 3ARXA 2YCKX 2FPYA 2IQDA 2CXEA 4MADA 4S3FA 4QE1A 5CSSA 2R1PA 4G2DA 2CITA 4CCZA 4QAIA 1UCWA 2WZEA 3GH4A 1S1PA 2D24A 1F5ZA 3DYPA 3U9IA 3L4VA 1WUFA 4XISA 1NM9A 4W8BA 1EPXA 2O0TA 5CG7A 4GPNA 4GIYA 4UNLA 7REQB 3IV3A 5IBXA 2LLEA 4B5WA 5B80A 1KM0A 1E9IA 4JCLA 3A4XA 4A21A 3PULA 1TVLA 4A8LA 3AIRA 3SN4A 1QDSA 3QR1A 1ZJBA 2J7BA 3DFOA 3CT2A 1OVDA 4ATLA 5A6KA 4X61A 1V4YA 1QNQA 1FP9A 5AVHA 4HOWA 1R3RA 1PX8A 2R94A 1A3HA 2C19A 1V0MA 3LBOA 4OE7A 4NNCA 2J8FA 5C0QA 1F9CA 1BGGA 1O5QA 4LF1A 1G6CA 2OODA 2E8ZA 1Q45A 3BW4A 5I3HA 3FDKA 1GHSA 1LOSA 1TE6A 4HN8A 3KHDA 2NX9A 3UZXA 2NLYA 4H9UA 3LBMA 2WVUA 4V1XA 3VYLA 1UR8A 2X1IA 1O1ZA 2OLAA 1XFBA 3SB0A 1RVGA 3WDHA 4M51A 3BH4A 3EX6A 3QKZA 3IVUA 4GVHA 4JTEA 4WY0A 3TDFA 4AHQA 5MF5A 4O17A 2BVWA 3K2GA 3O07A 1QOXA 2Z6JA 3OZPA 4AG0A 8A3HA 3L23A 4OOZA 5FCZA 4LGXA 1S39A 1VQTA 3AIWA 3VGBA 1GQIA 3ZLFA 1W37A 3BQ6A 3MCNA 1ICSA 1LRNA 1W3KA 4AEOA 3LNMA 2Z29A 1BXBA 1I9CB 2BWGA 3O15A 1W9PA 3TROA 2EQDA 2JFEX 3N2BA 3LI0A 1B4KA 1FWWA 3VMOA 3VDAA 4Y8EA 3M5YA 5BU9A 3SSJA 3WELA 2WJDA 5AVNA 4YS1A 2BTMA 1JRCA 4J3VA 5LA0A 3WQFA 1PIGA 3RRXA 3JU2A 1HL9A 3B9OA 1EJUC 1PDYA 3WQ8A 4XZLX 5ECVA 1JPKA 4D1JA 3W71A 1JCTA 3EPMA 3DBNA 1H3GA 2DZXA 2OOFA 2ZXQA 1RPXA 3WMCA 3QZEA 3LTPA 2D73A 3RX2A 2QQ6A 3BSGA 1HZYA 1SZGA 3SADA 3CHFA 3FKRA 1KBKA 3WBWA 4JNYA 3EAUA 2R1KA 2NVCA 3G77A 3RM9A 5M03A 1YTKA 4LAUA 3AIQA 3WJYA 5HWMA 3PPCA 3DXIA 2V38A 3ABRA 2GJRA 2UV8G 4XUGA 3W07A 4PGLA 3JRKA 2EPOA 1AL7A 3TTYA 3O6DA 1IEVA 1CXEA 4OWGA 3AZTA 1NARA 4Q4KA 3DI0A 4WSHA 1PIIA 3AXIA 4D72A 3N13A 2J62A 1TJ1A 3L4ZA 4NF7A 1IQ8A 2Z1BA 1TREA 3H7UA 3TZNA 3PZIA 3STGA 2FPVA 2C79A 2YL5A 1DIKA 3SBFA 3EDKA 3POCA 4IL2A 1JDDA 1L6FA 4GZEA 2HPMA 3N25A 5KMYA 2V5DA 3N3MA 4HTBA 3GS6A 1XBVA 1DJQA 1PXGA 2I5GA 1M5WA 2V2HA 3CGTA 4GGHA 3D0CA 3VGEA 2NQZA 1OFPA 2OGYA 1KXHA 3UZZA 4OTKA 4WCJA 3C3NA 4GNKB 4LV9A 3OIHA 2QCNA 3BAWA 3I6RA 3FYYA 1NJJA 4GWEA 3VOIA 4ROQA 3TJLA 3VILA 2CZVA 3V1PA 4GMEA 2YR1A 3BOFA 4Z1BA 1ZP4A 4UFLA 3W7HA 2RGMA 3B8DA 4S23A 1JFHA 2PF8A 2XZ7A 4KBXA 1V3KA 2FZ9A 2Y7EA 3LLFA 1ECEA 3G24A 4UXDA 1BXCA 5H8PA 1V03A 3NZQA 3MWCA 3N04A 4C90A 3K46A 2R6OA 3RK8A 2XVNA 4H1ZA 1UIPA 3UWVA 4XSMA 1ZBCA 1XSJA 1KXQA 1BSIA 2INEA 1J5SA 1Z48A 4KS0A 3EZ4A 4YTQA 5D4YA 4NAFB 1UR9A 1D3GA 3MV11 4IMFA 1M6JA 2PLMA 2OYLA 2QJIA 4GVIA 2NZLA 3S9YA 1I8JA 1XH0A 2XFWA 4UQ9A 1SR9A 2VUNA 3GRIA 4HYVA 3QHOA 3FLUA 4DQWA 4K6AA 5XIAA 4DUWA 3LMZA 1N8IA 3P5ZA 4C6JA 3O7UA 1QOQA 4B92A 3E74A 4O0QA 1D8WA 4OVXA 3SECA 3WQDA 1TV7A 4MY8A 4TUFA 4DX3A 2WANA 4LVBA 1J96A 4AD5A 3CZEA 3NEHA 4Q22A 3WJWA 3GXIA 4AZGA 2OR2A 2PCEA 4WXYA 3M1ZA 5J04A 3DZ1A 3FX4A 1WAWA 2EKCA 3W75A 4MNJA 3QFWA 2RAGA 1TWZA 2OX1A 4UTWC 4F3HA 1ZRQA 1XPYA 3WQOA 3AZRA 8RUCA 1UWSA 4O11A 3K4AA 4ATWA 1R38A 1GKPA 1NP2A 2B7PA 2XWDA 1YADA 1JCLA 4KGJA 2DW7A 3WK2A 4WKAA 3VPLA 4FS9A 3CUXA 1A5BA 3HMJG 3HO8A 3OA5A 2C71A 4LB3A 2YB4A 1WB0A 4MYXA 1UH4A 1RQHA 2ZUSA 1T99A 1UR1A 1ODZA 4NZ4A 2GVGA 2DVUA 4FAMA 1HIZA 1KFWA 3FJ4A 4IT1A 5D02A 1ZBKA 1JYNA 3S42A 4LW7A 3MYOA 1EGZA 3GDMA 1JUKA 4A3YA 4XBSA 1OFEA 5BCAA 5I3GA 1R9XA 1TUXA 3OVPA 1JPHA 1QXLA 4R53A 1XUZA 3E0LA 1AZ2A 5DLCA 4IG2A 2QUMA 2QV5A 3T0BA 4H8VA 1KQYA 4FNRA 3P93A 1LBLA 3CIWA 4GACA 3QLLA 4BF5A 1MEHA 2PA6A 1L6WA 3IUDA 3QGVA 1PX3A 4Q8WA 1LYXA 4C6FA 4DM1A 1VLIA 5HMFA 3WG6A 4LVAA 3ANYA 1US3A 1YX1A 3ZQ9A 2PPGA 4JS3A 4C1NA 1VYPX 2EGZA 1MYRA 1C9DA 3N9RA 4K2SA 2YLAA 4NZCA 5M1TA 3F7JA 5FJOA 4WSJA 3Q67A 3WMBA 2V3GA 3T4WA 5LHEA 4O4VA 4AD2A 5DMMA 1P6CA 1ZGDA 2BXZA 4I8DA 3RDKA 2Z4GA 3PFRA 1VRDA 1J2WA 4MF4A 1WDDA 3R13A 2Z00A 3G1HA 1FUYA 4IFKA 3KWSA 1RJQA 2WK2A 4AZ5A 2ZX5A 4IJCA 1LT8A 4GYJA 4J27A 5HMEA 3VTRA 1KFKA 1T7LA 4JIRA 1UD4A 3GE7A 3SGGA 1DJZA 4PULA 1W54A 5I77A 1JJKA 3NQMA 3S3GA 5LNWA 3H12A 2PU1A 1XJBA 5CAHA 1KKOA 1B3VA 1H1YA 1WDWA 1G4EA 4WOZA 3EMQA 4KRUA 3QYQA 1J2BA 4UTHA 3ONCA 4FOUA 3UPWA 3CTTA 1UD8A 4MWAC 3M5ZA 4AVOA 5FIPA 3MT1A 4A29A 4DWSC 4PR4A 3RN6A 3FAXA 3W29A 1KM3A 2XVKA 4E38A 1REQB 1X8FA 3L65A 4U28A 2BHYA 3CPUA 5EKYA 4AEEA 1VFUA 1ZP3A 4RXGA 5HQEA 1US2A 3ABOA 1W3JA 4GFIA 1RPKA 4LQ1A 2J47A 1QT1A 4JBRA 1XLEA 2YL8A 4RNIA 3VGGA 3WCZA 3L4WA 2VRJA 3VIFA 3HPAA 2F7FA 4Z42C 1C29A 3I65A 3KP0A 3WD0A 5XINA 1W1YA 4FZIA 1E43A 3LCIA 3LZ5A 5DANA 2D3LA 1R46A 3HGJA 4MZ8A 3QPZA 3OZYA 1BPLB 3B4YA 1C8YA 3CB3A 3PPHA 3LCWA 3ALGA 1TMHA 2QV4A 3W24A 2ZX6A 1D7FA 2DQXA 3GXNA 1DXEA 1R2RA 1KTBA 4RE3A 5D33A 3I6TA 2INFA 4JX4A 4C1LA 3VD7A 4J28A 4R85A 1Q7QA 3HGRA 2WC4A 4GYPA 1JD7A 3F1QA 3BE7A 3SY1A 3T4CA 3OZOA 1OT2A 5EY5A 5F4SA 6REQB 1MW1A 2QJGA 1E1CB 2VGIA 4PMJA 2NT1A 1CGVA 4AWTA 4IP5A 2H6RA 5HNRA 2ZIDA 1A0CA 1VBRA 5A2CA 1DJHA 4FIRA 3STFA 3N2MA 4HOXA 2DH2A 3BICA 1VFOA 3E2QA 1FCUA 3KW3A 5DY3A 4JL1A 5BXTA 3HURA 5HMSA 4UC5A 3ZJ6A 2WM1A 2C14A 1XLDA 4JDYA 1CGYA 3W27A 5A8NA 2CKSA 3VAVA 3RU8X 3C8FA 4S1FA 4LUJA 5AZ0A 5CPNA 1IWPA 5A6AA 2VUYA 1GPWA 4NJIA 3PBMA 2XYLA 2P10A 3GUWA 4JY9A 2YKKA 4BWLC 4A35A 4WD0A 1OBAA 2EEXA 4CU6A 1W5OA 3G1AA 3ZZ1A 1E6RA 3SCNA 4HYRA 2D2JA 3QZ6A 1Q8AA 3TWBA 3UWYA 2QDDA 4EF9A 3H4WA 1PAMA 4DHGA 5FF3A 3T09A 2QF7A 4CGTA 4JZ5A 4MB1A 2G96A 3EWYA 3O9NA 2EG6A 3HV8A 4JTIA 5LHFA 2QAPA 4BR1A 2NX1A 2WPGA 3WLIA 3SCOA 4YXGA 1NELA 1TJ2A 4ZGYA 4EIVA 4CQCA 1WDSA 2Y1HA 3A24A 4M1BA 1ZAJA 1BF2A 4ZEPA 2E1WA 3UCDA 4ADUA 1Q6QA 4LUIA 3B0YA 3L2MA 2VGBA 1BYDA 2E9BA 4DBSA 1GJPA 4JD4A 4IGMA 3I4KA 2PTWA 3LN3A 4NJHA 1IEWA 3H7RA 2R1LA 5E0KA 5C9RA 1CWYA 4JTFA 4F0KA 4PH6A 3L67A 5I02A 3VINA 3IRSA 4S3KA 3AFBA 3S9ZA 1CX9A 3KL0A 3G3MA 2BDQA 3DKJA 3ECQA 2VD9A 2V5CA 2YYTA 1OB0A 3MO4A 1XI3A 3TEVA 3H55A 2KX9A 3REQA 1EJ7L 3T6CA 4PB3A 3SGUA 2PBGA 1ITXA 3MC5A 4I7UA 4MAVA 1LLWA 1X8CA 4NNAA 3CBWA 4D6IA 1SMDA 2Y7GA 2IQTA 4Z2HA 3KVMA 1I4NA 3IJ9A 1VBJA 3BO9A 5BWAA 4LNCA 3EYPA 5RUBA 2NQHA 2BX7A 4QJ4B 4RZ4A 2ESCA 5D8WA 3NSXA 1XC6A 1G4PA 4DO5A 1DIOA 2F8QA 4IZGA 2Q71A 4LUSB 3C2RA 3WH8A 2J4GA 1VD6A 3PZNA 3EKGA 1DQUA 3IANA 3UWEA 1EWDA 1OYCA 3KBJA 1Y65A 2RJGA 3PZ9A 1H2JA 3O1NA 1H61A 1P0BA 1FDZA 1L8PA 5BU6A 4DNHA 3FEMA 5DCDA 1ECQA 3T08A 1AD1A 1NF7A 3M9YA 3PWIA 3W7DA 4L80A 1BYBA 5E6ZA 1R3WA 4MY9A 2ZWZA 1BEUA 4PRWA 1EP1A 2R91A 1PWLA 5KZDA 1SZRA 1MUMA 4LF2A 3MUY1 4Q8TA 4YL2A 1OCNA 1XIGA 2E0PA 2CERA 1W1VA 2WCGA 4A2SA 1XUUA 4JHZA 3UR8A 2AL2B 1IR2A 4WJXA 4YVPA 1X98A 4QGCA 2WKLA 1WKFA 2E28A 2F38A 3W7GA 1GVRA 4WF7A 5C9WA 4CU8A 4G1NA 5FESA 4HOZA 2X8RA 1H0IA 3MHGA 3IAPA 1QATA 4FF7A 3LPGA 2PSNA 5J5DA 5ABGA 2XIIA 3W7OA 1NWTA 5BOEA 1RCXB 3BARA 3OA3A 4AFYA 4FNPA 2YX0A 4A05A 3CMJA 1O12A 3LOTA 4PMRA 2ZX7A 1MXDA 3ZVHA 3DUGA 5H91A 3KRUA 4QFUA 2WC3A 5BMXA 1WUEA 4GUFA 2D23A 4WSKA 4UQEA 4ZSUA 1FHUA 3CAVA 4UOQA 2OVLA 3BZJA 1K8XA 1TV5A 1XBZA 1FH8A 5CSYA 4X0VA 3W1UA 5C54A 2PURA 1CTNA 3GHTA 3E2VA 3RCYA 3SUTA 1O94A 3VCRA 5KETA 4H9MA 3B0UX 1D9EA 4A8NA 3WDQA 3CZGA 4DJDD 3R8HA 4UOZA 2ZX8A 5GJPA 4GCXA 2QDEA 3TNOA 3LSCA 3W7MA 3THQA 7A3HA 3V5FA 1QOPA 1VPYA 3LHUA 4PTVA 3APYA 1RZMA 1MFVA 4G56A 3NQ7A 3DFSA 2Q8LA 1ML1A 3AHYA 2RGLA 3NVDA 3DG3A 1J11A 4UR9A 1E72M 2V3EA 1E71M 3ZT7A 3BCJA 4BI5A 2BOEX 3NPWA 3IGXA 3MUCA 2OQLA 2NV9A 4AHPA 4GUJA 3R0DA 3SCQA 1I1WA 3RNDA 1KFBA 2VTFA 5MKGB 3FVDA 1S5NA 4L9ZA 2E77A 4OT7A 5CLTA 4GRSA 2GQ3A 1VFTA 1U5HA 2XG9A 4TIMA 1W6TA 5BOOA 3QTGA 1GOXA 2X1UA 3VMPA 2JKAA 3RMEA 4NL1A 2GJXB 1ADDA 5TIMA 3RR1A 4RZBA 1BFNA 4K36A 3NOYA 1TTJA 3OIXA 4B5SA 1UR0A 2IQ0A 3E0FA 2ZZ3A 3S2LA 2GDUA 5E5CA 3CQHA 3WLLA 4HZMA 3G6LA 3VA8A 3KOZA 1UWRA 3ID7A 3K8MA 1ZNNA 3C2VA 3QHMA 5HANA 2ZRVA 3RPDA 5D04C 3CPRA 3W28A 1KR0A 3VVGA 5DO8A 4HPXA 4J3XA 3MKCA 5FL0A 2QCDB 5T9BG 4IGSA 1CGUA 1MNZA 3U5UA 1KM2A 1O60A 2XIJA 2WNZA 2FFCA 1UP3A 4GY1A 3S2MA 4AF0A 1AW1A 5HWJA 3DC0A 3ITCA 4ACZA 2E7FA 1EJRC 4HNNA 3GTHA 4I5XA 3OYXA 1RP8A 3VMNA 3CJPA 1EJTC 3NG3A 5FF4A 4GYKA 4XTIA 1OT1A 3G1SA 3RYSA 3K1DA 2AMGA 2WMJA 2O4QA 2NWSA 2YGYA 3GR7A 1W9DM 1L0PA 3VNLA 2O9TA 3L0NA 1F6KA 3PJWA 1V5XA 3BMVA 1E4MM 4AIUA 4H6QA 3VE9A 4ZODA 5SWUA 3C56A 1HNYA 3QTPA 4CEXC 1I2OA 2Y4SA 3NEVA 5CC5A 3L2IA 2BP1A 1V8EA 4K37A 4JIEA 2NXHA 1D3HA 1XG3A 4MLJA 1VFHA 2HXUA 5A6JA 2GQ8A 4JNMA 4G7EB 1OF8A 3LS9A 4N4QA 4KWVA 2VZVA 4PCNA 3WJZA 2WB5A 3S6TA 3NL6A 4X22A 1P6BA 3GNDA 1XM3A 8XIAA 1B3XA 4ZOEA 1L8NA 3ES7A 4ADTA 5BWFA 2AMXA 5M2FX 1UOKA 4TTGA 5HA7A 4W5ZA 3P3BA 4D71A 1E0UA 4XZHA 1B2YA 1QBAA 3VNKA 1KCXA 1S2WA 2PP1A 3W2UA 1OX4A 1V0NA 2E67A 4EANA 4IQLA 2YCIX 1CXKA 4NX0A 3H2FA 4D6GA 1UG6A 4S3AA 4RNJA 3W1NA 4GNJA 1X7FA 4D8AA 4UCFA 3BAKA 1S2CA 2Y89A 3LLXA 5TAOA 1DWAM 2JEPA 3ZT6A 4EPEC 3CEPA 4IFRA 4EXQA 3G1RA 4GXMA 4CQ8A 3HG4A 3E1F1 1IXQA 3L21A 3LPFA 2Z1WA 4R7OA 4IMAA 1VHCA 4O50A 4JHOA 1N55A 2TYSA 1H60A 2OKTA 2GWNA 4AWUA 2I9UA 2RDWA 3GC2A 2FMNA 1FWJC 2F6KA 1JF6A 1S5WA 1WO2A 1OC7A 1LL7A 2ZXDA 1CI1A 1XBXA 3N17A 3KRZA 1FWFC 1VZWA 2X0SA 2GWGA 2ZUUA 4X63A 2WOQA 3W2MA 2PWGA 4PC8A 1B3ZA 4LRSA 1M68A 5DT5A 3UWQA 3GVQA 3CM4A 5A8QA 4N4PA 4FX8A 5C9XA 4RXFA 6ENLA 1AJZA 2ZRUA 3GWQA 3OBAA 1M7PA 4D8ZA 3ZJKA 2CWXA 1EGMA 4FPSA 1KV5A 3VNMA 3TSDA 5FAJA 5A2AA 2BMBA 4FXFA 3UXAA 3WD3A 4Y9OA 1OD0A 2NUYA 1ISWA 3KOXA 3COTA 1NFPA 4HU0A 4XZIA 3WEZA 1CW2A 1EF2A 3GAKA 2MUCA 2XJ7A 1DQWA 2GOKA 1JNDA 1OD8A 3W01A 3PN8A 3H54A 4RKAA 2PDYA 3PZQA 1EO7A 3VZXA 2TAAA 3ATZA 3M64A 3M44A 4V27A 5LGXA 3BOXA 3G0XA 2HCVA 3L2LA 4RE4A 2R82A 3O6YX 3Q37A 1YNQA 1HKVA 4D2JA 1C8QA 5D9MA 1RP9A 2JALA 2DJXA 1TA3A 4CD6A 5E1QA 4G9PA 2VGFA 3PFMA 1PTAA 3OQ8A 4BI7A 3QEZA 3A22A 2CLOA 2DDXA 5H6HA 4Q7IA 1K9FA 3QVQA 5D09A 1KFCA 2V2CA 3IIXA 1V93A 1E0XA 3W1RA 3P74A 1OCBA 5LIXX 3P8IA 1V08A 1WA3A 3OTRA 1BWVA 1JXJA 2UY2A 4JIPA 4UCGA 2YLLA 3T44A 4AD3A 4UTWA 4M5PA 2Z24A 1KBIA 3W1MA 5CPTA 1KM1A 5BXPA 4FO4A 3T40A 1UWAA 3ZXWA 4YWIA 4EACA 2Y2WA 3TYCA 3VOFA 5CBIA 3C4UA 2CESA 2GSHA 3CIXA 5TNVA 4FOKA 3LI1A 3AU2A 4DF1A 1ZJAA 1OC6A 3QR3A 4C6IA 2ZTKA 3USZA 4Q8UA 3GXDA 1TX2A 3WZ0E 1DJNA 4ACYA 3TC3A 2DVTA 2OGJA 2WVVA 3VDGA 1IF2A 3MP3A 2C1GA 3LQGA 5CLWA 2Q09A 1LBFA 4E5TA 3DFPA 3A4JA 1M41A 4JHMA 4B5UA 2OT1A 3VGDA 2PLCA 2XTKA 2E6AA 4UTKA 1XG4A 3MV01 3GW0A 4QS5A 2POZA 4JXCA 4KPLA 4WQ6A 1RHCA 2GGIA 1OZMA 1UMLA 3QSTA 1J0HA 1FWIC 5C2XA 4GIAA 3OJGA 4PRTA 3CYJA 3ARQA 4O0KA 3OLDA 3W53A 4AZCB 4JEJA 3T81A 3CXOA 4BK9A 4HYWA 5FKYA 4L4PA 3GU1A 2CZFA 1XLIA 1E5NA 3MMTA 2VFIA 2O7QA 2PC4A 3L12A 4RW3A 4FIQA 3I68A 1MXSA 3NZPA 3BPWA 3NQAA 1R9YA 1L6GA 3W85A 1QWGA 1R3SA 3C3UA 2XISA 3NQ2A 3E3HA 4PUWA 4OBTA 5EMUA 2VFGA 4IIDA 1UZDA 5HWNA 1E73M 1QMLA 2XFYA 3WJSA 4ERGA 6A3HA 3SEPA 3MHUA 3C2OA 1V6WA 3R7MA 1TQJA 4ZO9A 3STCA 2HBVA 3E2RA 1BKHA 2XH4A 4C6NA 4GI6A 3R8GA 1UKQA 1XLLA 4CD8A 4P7OA 3IVSA 4N02A 3K4WA 3WNPA 1KGWA 2NT0A 1RY8A 2E1DA 1VJIA 1U30A 4JEQA 4NHVA 3PZOA 3MU7A 3TUUA 4B9YA 4ZOAA 1GOOA 1KGUA 3DESA 2EG7A 4LU0A 4QR6A 1E0TA 1O68A 5AYBA 5AC5A 3U4AA 6PTDA 3BMWA 1EEXA 1BG4A 2QZRA 4XB3A 1FA2A 1JZ3A 5E0CA 2CXGA 5L9FA 3LUTA 4O10A 4LX4A 1V0LA 1XLMA 2VVNA 4C5YA 2ASHA 1HKIA 4C5ZA 3M4HA 1WKDA 4E0CA 4KQNA 3IK2A 1JZ2A 4GQGA 4GBDA 4EAYA 3LNPA 4JY8A 4LS2A 1IZJA 1ZZMA 5D2VA 3LV6A 3N2TA 6XIMA 3CPGA 4ZCWA 4QCFA 1IXPA 4QJ5B 1TPEA 4BZYA 2EPMX 3BGAA 1T6MA 5HJXA 1PHWA 4U5KA 3IJ6A 3O3RA 5GJMA 4DO7A 1TPUA 1NDZA 5ABHA 1QK0A 1A0EA 3WLQA 1GZ1A 1W1B1 1UA7A 3F5LA 3H2OA 4LVGA 2E4TA 3T05A 3UD6A 3LM3A 1A5OC 5HULA 2VEMA 3QM3A 1TZ9A 4S3DA 1KB3A 1JZ5A 1P7TB 4U2ZA 2QDGA 2ABAA 4P2VA 4Q8QA 4U10A 1QNPA 1RBLA 4ES4A 2Y24A 3GDBA 1TIWA 2WAGA 5AECA 1M03A 5FSDC 5I7GA 4XK2A 1ZY9A 2ZUNA 3H26A 2H9AB 2Z26A 2KZHA 1JI1A 2E25A 5U7SA 1F73A 1UHVA 4Q8NA 1I75A 4PEKA 3O16A 2VC6A 1PCKA 4N42A 3UF9A 3QRHA 1W1TA 4ROPA 4ZXLA 3W1PA 1JULA 4NZJA 3B8VA 4MB5A 1QRQA 2PLKA 3BGJA 3BAYA 2QCMA 1CB2A 3PZTA 4REQB 4O1DA 1YDYA 4AB4A 3JVAA 2J9XA 3MSYA 1KCKA 3ENLA 3VIKA 3W1AA 4B16A 3ZJ7A 3VO0A 5T26A 1OABA 3LTYA 2CLIA 4L64A 1KTCA 1QW9A 1A50A 3VZZA 3CAKA 3WH9A 5D9OA 1KLZA 2GGEA 3SN0A 4FF5A 3ZLGA 4D6CA 1YDVA 1CNVA 4BKNA 4MMWA 4AYSA 4J2PA 2OCZA 2VC7A 1U1JA 5BXSA 4M6QA 9XIAA 4PUMA 3M5XA 1OY0A 2RDXA 2ZVRA 3SIZA 1VENA 1S38A 2F6XA 3H4GA 2ZRXA 5DXXA 5LZLA 4ASTA 1DE5A 4HA4A 3KOWA 2ZUMA 4JFWA 1GORA 3DCPA 2PC8A 4CNSA 3WLNA 1UR2A 2OLSA 3KCOA 4NYUA 2OG9A 3AC0A 2PDKA 1K1DA 5CG0A 3ISIX 4LBSA 4XVEA 5CGMA 1NDWA 1B3OA 3CZLA 1F05A 2L5HA 1H7XA 5H1WA 3VCNA 2Y7DA 1AQFA 2V0TA 4QM1A 7CGTA 5LIUX 1UH2A 3W83A 2AQOA 3FJLA 1UKPA 2OWCA 3E0WA 4B15A 3S5NA 1K8ZA 1J6OA 3NJ3A 4F0RA 4M8UA 3AIBA 3NWRA 4M6VA 4O15A 4ZBCA 4MFEA 2D0GA 5F4XA 3P2VA 1CLXA 1IEQA 3WLRA 3TIMA 1TTIA 1GQKA 4C6QA 4UR7A 3EX2A 5F1UA 1IZCA 1KQZA 3ITOA 3LXAA 1E70M 4HD5A 3VNDA 2FHFA 3STPA 3CHCA 4LBRA 4UQCA 2G0WA 3DBPA 3O6AA 2WLYA 2E5CA 2YSWA 4LYKA 2HVNA 3VOJA 4HU3A 3UP8A 3W72A 3WDRA 3WNMA 1XXXA 3MSRA 1JZ4A 2TMDA 3W6LA 5FEZA 1EC9A 2G3JA 1HFBA 2XIQA 1ZSXA 3VFLA 1XLKA 2A0NA 1JYXA 3RX3A 5AYIA 2C0HA 3EWUA 1MW2A 4H6RA 3LLDA 3WQ6A 4FB7A 1NF0A 4RDZA 1QCWA 4BHYA 3HPZA 4YTRA 3GBDA 1US0A 2ZE3A 3LHYA 1W0MA 2WZIA 5EMMA 3A5VA 1GVFA 2ZRZA 3S6DA 3QLDA 1SJCA 4DO6A 2W62A 2G41A 1Y5VA 1J5TA 3BLPX 2EJAA 2POTA 3D3FA 2G97A 2Y8UA 3CUFA 1MQQA 4UFMA 4B9ZA 4OGZA 1LM1A 3EWXA 1E4IA 1GT8A 3BOLA 3PZUA 4H83A 3RG6A 1H1NA 3CWNA 2DW6A 5ABFA 3LB0A 1GQJA 4PL1A 1K02A 3DFNA 3ABQA 1MWOA 4ZQCA 2OMAA 3AISA 4KT2A 3WEMA 4E8DA 1L9WA 3TQ0A 3W37A 3MI3A 1R47A 1PTDA 1F61A 2VR4A 5FF2A 3TQVA 4ZO8A 1CLVA 2GJNA 4YCPA 4TVCA 1MMFA 3CQ0A 1NWSA 4WY0B 3PJTA 3ITTA 1FDYA 1W3NA 2QJNA 3T2QA 3WNNA 2YL6A 4AC1X 4K8HA 3W6MA 1TO3A 3GKAA 1KM5A 3FSUA 3C2FA 5I23A 3GVWA 2JEQA 2HK1A 1I0DA 2WJFA 1MQRA 1RJRA 4XTDA 4V1YA 3HG3A 3IS4A 1GVSA 5MHBA 2OU4A 3VI2A 3AAMA 2DZBA 5EYWA 3QV7A 1ZFJA 3GYEA 5GNYA 2X16A 1D3CA 4I5UA 1R7OA 1KM4A 2FDSA 4MJ4A 1HJSA 3PUDA 5EMYA 2DH3A 3GH7A 1ONEA 3GW3A 4GY0A 4EAMA 1HO4A 2ZZ7A 1IT7A 1AW5A 5CEWA 1QO5A 3AXXA 3RRAA 4AYGA 1UJPA 2R14A 1PKNA 4YIWA 1WP6A 2QUTA 3P84A 3IUIA 5F2LA 3FKKA 3W82A 3ITYA 5FJRA 1YNYA 4R7JA 3QBUA 2P8CA 2VNCA 3EOOA 1QJWA 4WOQA 2WW5A 1ADSA 3M5VA 4OBSA 1E3ZA 4O8AA 1ZS2A 1HKMA 3OHMB 3T9PA 1G7UA 3N12A 1MFUA 1BGAA 3APTA 3RPTA 4B3KA 4IUGA 1J0ZA 1CECA 1F4AA 5A6BA 3RR4A 3PWAA 3GHUA 4ENLA 2VEFA 2P0IA 3RPMA 1XBYA 2PTZA 3AXKA 3UBPC 3AMLA 4HZ7A 4GX8A 3UGRA 2VC9A 5J5RA 3MW7A 3A9BA 4PTMA 1FFRA 4HB7A 3C2YA 3TZFA 3ZSTA 1TRDA 1XR2A 3H2EA 2CHOA 2VJXA 1NAL1 4XZMX 5K9XA 3QH2A 2OWWA 4UZSA 3QOMA 1K9TA 1UPMB 3SM0A 2DZWA 2BXVA 5HATA 3BWWA 3E0IA 3W6YA 3SUWA 2JK2A 4GKLA 5CZKA 1QI5A 1RQEA 4O1FA 3MS8A 4RZ5A 2B7NA 3WN6A 2V81A 1GW1A 3FA4A 1VR6A 4JTUA 3HTWA 3M7SA 5EPDA 1O5RA 2WWDA 4JFVA 2IKIA 3RILA 4URIA 1ZJIA 4EPKA 1SMAA 3R8RA 3AALA 4IQDA 1JL8A 3NM3A 1QW7A 4FMVA 1PCWA 2W91A 2PFHA 1R85A 2ATMA 3QC0A 3KEHA 4OHQA 1ZENA 2HE8A 3V0SA 5D37A 1XH1A 2YBVA 3WF0A 4B90A 3PANA 4GA8A 2J9ZA 1EDTA 3AMCA 4X2PA 4RDWA 2E40A 4UUIA 2V3FA 1NSJA 3JS3A 3MKKA 4PTDA 1FOBA 3EGJA 4NU7A 2VR5A 4DEFA 3BGGA 3CK5A 3WLJA 4XKYB 1WZLA 3JW7A 3F2BA 3HV9A 4WR3A 3PTKA 3ZOAA 5HPCA 3W23A 1AG1O 5A8GA 4JTJA 4NY2A 1QPKA 5CPLA 3T8QA 4HU4A 4DF0A 5CKSA 3N2OA 3NGJA 4N2YA 9CGTA 2EPHA 2PDCA 2GDVA 4BQ5A 3UXKA 1SPQA 5CAKA 4L61A 2IKHA 4Z0JA 1TKKA 1NFBA 1IEIA 4QEEA 3C6CA 4JFTA 1AH4A 3BG5A 1OFDA 3NQFA 4KKXA 4EF8A 4K3ZA 4KF1A 4ZQOA 4KRTA 2O7SA 1R2TA 3R10A 2V82A 2ZICA 3G1XA 4S2BA 3W1TA 4JTGA 3WLTA 3PP7A 3MMDA 3IIPA 4GYFA 3AHVA 3SI9A 2JKEA 4H6KA 1V0KA 5JXQA 3ATYA 2EAWA 3PNZA 5CPQA 5FL1A 3LZ3A 4TXEA 2G3FA 2VEGA 3W7JA 3CZ8A 3P60A 3AI0A 3OVQA 3B8SA 4JNZA 3WLMA 3RCMA 2SFPA 2ODOA 3WD1A 5GJNA 4MY1A 3DERA 3ARZA 4Y90A 1JCXA 3LBCA 1BWKA 4DIAA 3VNZA 2ZADA 4YHEA 5CXPA 3BQ5A 3VNJA 4D1IA 1EIXA 1M01A 3LENA 1TPVA 1MRAA 1EFZA 4GO9A 3TSBA 4ZFMA 4PBFA 3R43A 3HPFA 3QGAC 4OBRA 3B4UA 4PFMA 2JIEA 3LXBA 3T55A 4KH2A 2FZ8A 1HGYA 3OOQA 1TVNA 1IHIA 2QCLA 3TN3A 4CQ9A 2WMGA 1SU5A 5K2ZA 4UTLA 2QW5A 4KERA 1AW2A 3PJUA 3AMDA 5I3DA 4TX8A 3L68A 4IMEA 3H24A 3OG2A 2GJLA 2PGEA 1JRBA 3M6YA 3S83A 2Q8ZA 3UZWA 3CL8A 4A3QA 1YBQA 3WSUA 2QF8A 1AD4A 5AHFA 1QNVA 3UNTA 2VX7A 4V15A 3NO5A 4HHMA 1GQLA 2ZX9A 5AB3A 2B31A 2VI0A 1D7KA 1GOMA 4FNSA 1Q63A 3W7RA 1JQXA 2WNQA 4GBUA 3CQIA 2J79A 2AKMA 3E2SA 4IG2B 3B8TA 4WKFA 3V5CA 1TWSA 2Z0IA 3DHPA 3HM7A 4NZFA 1YE6A 3M46A 4O12A 2X05A 4NAFA 2Y8KA 1NOWA 4PCSA 1OWQA 3G5EA 3C2EA 3WH7A 3G1FA 3B0PA 3GTFA 1YRRA 3W7QA 5I3JA 1YPIA 1W1PA 3I3BA 2PDUA 3IPWA 3OGVA 4LS0A 4DBWA 3BCFA 2J6VA 1NDVA 4M7SA 2VQUA 1S3HA 1RAKA 1K9DA 2X1RA 4L6DA 5A1AA 2YZRA 1HTIA 3RF9A 1MVYA 3PUGA 4HTYA 1TR1A 5AN7A 4K1GA 1G01A 1HGWA 2QS8A 3JZUA 4PFHA 1J9YA 2ZVIA 9RUBA 3AWOA 4GY7A 3N6JA 4AMCA 1IWBA 2FZNA 3AU6A 3A64A 4LC6A 1P1MA 1SJDA 3OG3A 4MKVA 7TAAA 2ATSA 3W7PA 1MXGA 2NLIA 2ICSA 4DN1A 1UROA 2Y7FA 3EKLA 4M6PA 2OFJA 2PDLA 4FNTA 4TQTA 4B2DD 4C7GA 1VGAA 1JVNA 1QU4A 3ABZA 1M9HA 1E56A 3MYPA 4D6DA 5C5YA 4HJWA 3UJEA 5KINA 1OIFA 5G5IA 3M0ZA 4JIHA 3C0SA 3S1GA 4AIOA 4MKSA 5G1MA 3BL3A 2ADAA 2GVYA 1B31A 4BQ2A 4U4MA 5AHIA 2PU0A 1M1BA 4XAYA 4DO4A 1R2SA 4ORIA 1QPRA 3HQ1A 3E38A 1EOKA 4HPNA 1XLAA 4QP0A 1CYGA 1M7XA 3WBEA 4Z1DA 3VKBA 1K6AA 3G1YA 2X0YA 1FTXA 3PY2A 3U3HA 1EZWA 4R88A 3CZJA 2OZ0A 3OEXA 1GTHA 5FEWA 1WX0A 2HSAA 2ZXAA 2DZPA 1C90A 4Q7NA 4AHOA 4L4MA 3DH7A 4AEFA 5D2TA 2CLPA 1VEPA 3WQ4A 5A6SA 1EA0A 2NUWA 3BLLA 4W4QA 3SQMA 3VGFA 1J4EA 3AUOA 3VFCA 3V35A 2XH2A 3BJSA 4JTTA 3ZYZA 1EEPA 1X6LA 3G0SA 2YA1A 3H8AA 1FWDC 1OGSA 1J0KA 4PSRA 2A7NA 3KBMA 4AD1A 1LQAA 1QW8A 3FCPA 4N0RA 5I24A 3PG8A 4MPQA 3L66A 3R58A 1FCVA 4Q4RA 5CJMA 3WX7A 1XCWA 4JYDA 2ZC8A 3WLHA 1KBJA 2QDHA 1GYLA 2G3NA 2DP3A 4I7WA 3PF3A 4M1RA 4PMUA 3TONA 3WDIA 4MM1A 1N7KA 3N29A 3MVTA 4JDBA 3K8LA 4UTTC 2WHLA 1EUAA 2HXTA 1OC5A 3T8LA 2A3EA 3B0XA 4FLSA 2QVHA 1W3LA 4QLJA 4IHCA 3WJXA 4J4KA 2GUBA 4Q4SA 4C6EA 3NDYA 4AZIA 3IWPA 5T8GA 2PWEA 4KEUA 3S5YA 4L4OA 1UB3A 2A3HA 1FXPA 2BGSA 1WOAA 4XZ9A 2ZDRA 3KWXA 2VXNA 4GGBA 3UYIA 4LSBA 3P81A 1JGIA 5I5RA 3STEA 1H5VA 5GNZA 2Q01A 4F9JA 3M0VA 3CU2A 3BCDA 5DF0A 2F6UA 5C2GA 4PUDA 4QDWA 1A5NC 4N9DA 3TQPA 4NI3A 5AY7A 2PLJA 4Z2GA 2VENA 3PAJA 4F0SA 4NKCA 3PM6A 5JMUA 5I6SA 1UUQA 2D22A 1UW9A 3SCTA 4GVFA 4A8RA 3W3OA 4MIMA 3LU2A 4JTQA 3CHEA 3P0XA 4HN4A 4PUEA 2QVNA 3OW1A 3VIMA 5C2CA 1OGBA 1Y0EA 3WF1A 1SW0A 1C7SA 2A7RA 1F07A 2PTDA 4CUCA 3NXLA 4UTMA 3H2MA 5F4WA 2NUXA 1SJAA 2EPLX 5AC4A 3B8WA 2P5NA 1O66A 3OHIA 3H23A 1E1CA 4QRNA 3KL3A 4M7TA 4CNPA 1QK2A 1I2PA 2HQAA 4GZIA 1XIFA 4JQ4A 1DTUA 4H7VA 1YNPA 3BURA 3LX9A 1WZKA 4O19A 1QVBA 1TZ7A 3JZEA 1JDEA 1H11A 3DFQA 3NQGA 1C8XA 1HJXA 1RH9A 2DZSA 3FFSA 2G50A 3USBA 1E40A 4UB9A 4B4FA 1EJWC 1X1OA 2CZEA 3HOJA 3QPEA 1TX0A 4PBGA 4MDPA 5EB8A 3TYAA 1PEZA 4HVXA 2J7FA 3KTXA 1H41A 1UKTA 2BHZA 2NV2A 5I78A 4I5RA 1Q6LA 1EIBA 4M29A 3N6HA 3A12A 4WIWA 3S2JA 3UPBA 1NQKA 2EXOA 2PGWA 4ZR8A 4NI8A 1EC8A 1VC4A 3M0XA 5HBFA 2YBUA 1U5JA 3VM5A 1QPOA 2V9DA 3WBXA 4Q7BA 1Q13A 1Z44A 4QJ1A 4AY1A 1BQCA 4Z1CA 1J0YA 5CSUA 1CT5A 4FNUA 1FX6A 2VC5A 1I0BA 1VS1A 5AZ1A 1XICA 5HR7A 2PDWA 1E6ZA 1XHGA 3BLOA 3TMLA 4YN5A 3UJ2A 1THFD 4DAFA 4GC3A 2HNHA 3B8IA 4NSBA 1F6YA 2PODA 5LYRA 1O5XA 2YYUA 2H90A 4HA0A 3TX9A 2YJQA 1XPGA 5GPRA 4W7UA 4XUYA 1DIEA 1QI0A 3VGHA 3V0UA 1YTEA 3MSGA 3PB0A 1V6UA 3SCRA 1KFJA 5FEXA 4QNWA 2G8ZA 3TR2A 1YQ2A 1W1A1 2PRMA 3GNNA 4F2UA 4PODA 2YCLB 1BVNP 4QIUA 1W2VA 4BQ3A 2GUUA 1TUFA 1WDPA 5I3IA 3WK1A 4NJGA 3S4TA 5U4NA 7XIMA 5I03A 3WDJA 3AYTA 3TR9A 3MP5A 1SSDA 2P53A 3AHXA 2CW6A 4K7VA 3CV7A 2J66A 3O0FA 1EQPA 4C6LA 5FF7A 4RLIA 3DHUA 1AFSA 1E1FA 3WO8A 3FOKA 4PMNA 1CGTA 2C8NA 1V3JA 1JXKA 3WYZA 4MNLA 3PZVA 8TIMA 2AAAA 2WV8A 1EKOA 1KCLA 1F3XA 1FHDA 1UZ1A 4KEMA 5EFDA 4IQJA 3GM8A 2C91A 4DYKA 4OUEA 1MRQA 3U7VA 3UWZA 3MB9A 1QFEA 2B0MA 1W31A 3IGUA 3I7QA 3F2CA 1X6NA 1FHVA 1NOFA 4E2OA 2VD8A 5BXRA 3W2JA 3R1ZA 3W0KA 2I5QA 4UMBA 2PWHA 4M81A 2Y62A 3BLDA 3SSZA 5D8ZA 1V6YA 4J2MA 3VK5A 3DG7A 3PUEA 4RNFA 1P6WA 2A6NA 2VEIA 1JD9A 1VPQA 1NWUA 4HCLA 3XIMA 4RNHA 4CVUA 1XIDA 3WD2A 3OPSA 4FR1A 4E8CA 1G9HA 3N15A 4LBUA 2V67A 4QAWA 4O54A 3LPPA 2ONEA 2YDRA 2WMHA 2CZ5A 5E6YA 2VCAA 1XX1A 3CH0A 4D6EA 1ME9A 2GVEA 4K68A 2A2IA 1PSCA 3NZ1A 4IMGA 4DY1A 2FVKA 3AO0A 2OQHA 1JPMA 2PWFA 1XCXA 4IIBA 5A2BA 4X3ZA 3SO7A 4L56A 1ZCOA 4O16A 4FNQA 3WQWA 2GUYA 5C8BB 2TODA 4CCDA 1R5YA 4PMQA 4A4AA 3TNBA 1JCYA 1CBGA 4MWAE 4Q6JA 4BQ4A 4GD0A 4R9XA 2J9YA 1HX0A 4JAWA 1O95A 2VEPA 4C6BA 1EJXC 2DUZA 2NV1A 2FKPA 1PX4A 5EMLA 5FOOA 4OQVA 1ICQA 1V3LA 3FS2A 3GSMA 1W9BM 2P8BA 3MDUA 3TCEA 4AF0B 1LDCA 2CPUA 3LK6A 1ESWA 3GIQA 3MQTA 3EDJA 4RL3A 3RITA 2W79A 5D05A 1DWGM 5BOFA 1R86A 4O13A 5HDRA 3MUAA 3R12A 4JYFA 1I60A 4W87A 2NQ9A 3AUJA 2X2YA 1FKXA 2FVLA 3HQOA 3LERA 2NXIA 2FJKA 5LA1A 4TMCA 4N6FA 1W3TA 3CO4A 3IACA 1UWQA 4F8XA 2V63A 1W2PA 2YFOA 3RO6A 3THCA 2YL9A 4P8XA 4G8TA 3PWGA 1UP0A 1J93A 5LIKX 1HVQA 1AMKA 5ABEA 1OADA 5D32A 4MHBA 3MVIA 1SO6A 3BW2A 4P7RA 3B40A 3ARUA 2F2HA 3W2KA 2UWFA 2O4MA 1Q2SA 1TJPA 4H9XA 4YLWA 4J3TA 4GJ1A 2XH0A 3KDNA 3W1QA 3IARA 1DWJM 4I3GA 3R5EA 2QIWA 3G3DA 2CYGA 4F4RA 4JKLA 2XGZA 4ZB2A 2CZDA 3IUHA 5DN1A 2CU0A 3BJFA 1XDLA 1PKYA 3QY7A 4GABA 5ECUA 1TYGA 4W7VA 4ZQRA 1JI2A 1JUBA 4HA3A 1WCGA 3MTWA 1LWJA 2GJXA 3KOFA 1Q4NX 3LHZA 3HGSA 3KVJA 5IHRA 1XYLA 1OX4B 1J8VA 2DZAA 3VOCA 1S5VA 1C7TA 1HXJA 2QHAA 1A5LC 1GVOA 2A3BA 4PL2A 4MLRA 1VPXA 1OJXA 3LEPA 2OB3A 4PUNA 4F0HA 3DIPA 1GW9A 4RE2A 1PWMA 4JX6A 4PMOA 2HV5A 2FH8A 2QCDA 1KV8A 1J10A 4H6EA 4E8GA 1TB3A 2O9PA 3UJSA 2P88A 3AJ7A 3NA8A 1RK6A 2NXGA 3KDOA 2PDFA 3BMXA 1BYCA 4HQVA 3HA1A 3AIVA 2QGYA 4Q8VA 5I07A 1BTCA 3TYUA 4H8UA 2QT3A 2RDUA 1OFAA 1KBLA 5AOUA 2MNRA 4LJ3A 1M3UA 3ZJ8A 3CMFA 2PCQA 3HF3A 2FTWA 4IM4A 3AS2A 3HB9A 1LL4A 2OYMA 4CQDA 4DWDA 3NPXA 4IIFA 1CZ1A 3UEQA 4ZOCA 4GFSA 1Z8AA 4I9AA 4KFPA 3LA4A 2GGHA 1RQBA 1WKYA 3ZR5A 1AUSL 5FA5A 4Q4QA 2ZQ0A 4DI9A 1ICPA 3APGA 4R5EA 3QV8A 1JPDX 1XLJA 3U48A 3VX1A 1GOIA 2ZUVA 1EDQA 5HNTA 3GXPA 3P14A 5DBTA 3NIYA 3LPOA 3CLMA 3GDKA 1W9VA 3TQKA 1UUMA 4AMAA 2YW3A 3SDOA 2OTDA 4JN8A 8XIMA 1J0JA 4HSOA 2OSXA 4R7WA 1SZEA 1TTPA 2A21A 4ZSTA 3GG0A 4PSPA 5IXEA 4OU1A 3M47A 2C15A 2QUUA 4NJJA 2PD5A 1UMYA 7TIMA 4NG3A 1IXNA 1WZAA 2HS8A 2UZ9A 3NCOA 2QNEA 1A0DA 4A6GA 1XIIA 2R9RA 2CLFA 4P8UA 3UG5A 4LANA 4JTLA 1A80A 1GK8A 5IRPA 4MJ2A 3O05A 2YB1A 1TA3B 2BLEA 3I7RA 1HKJA 1OEPA 3S1XA 1OINA 3IJQA 2DT0A 3PTMA 2OZ8A 1H7WA 2HVMA 1GNXA 2YDQA 2QPXA 3BLFA 4C6DA 4OJYA 5HJLA 3UY7A 3TW7A 3NQVA 4GUHA 1Q4WA 4IP7A 1EWEA 2VVSA 4KWOA 3UNDA 1OG0A 5G4WA 3LSBA 4CU7A 1TQXA 2DVXA 3DECA 1R6WA 2YDAA 3TW6A 4AAJA 2J25A 1R3VA 1B5TA 2ANUA 4JR5A 4QROA 5GVJA 5IFTA 1JG9A 2Q8XA 1TPWA 3KX6A 2FHCA 2WHKA 3W25A 1G4TA 1DP0A 3I3EA 3LCXA 1Y7VA 2O92A 4GI9A 4GUGA 4TX9A 2XVPA 3ITVA 1E6QM 3DN5A 1AA1B 1HL8A 1JAEA 1SSGA 2IPGA 1B9BA 3HFTA 2G37A 2OXNA 3AS3A 3AMKA 3VZYA 2G3IA 2VX5A 5LA2A 3HGOA 2J8TA 3VDHA 1OYBA 1UZ4A 3KZPA 2I16A 2E09A 4IQEA 3N9SA 5AHLA 1T8QA 3FN9A 3W7NA 2OPJA 4KRZA 1PDZA 3AZSA 3VUPA 5PTDA 2YCEA 3NSMA 3S9IA 4J35A 5DXYA 4V28A 3L4TA 1NQ6A 3P8JA 1XYMA 3GNOA 4PYSA 2A85A 3OBEA 3SRKA 2IW0A 4M56A 4XZNX 4UNKA 3P80A 2GYIA 1B0IA 1H5YA 2DQWA 3QQWA 4ZQMA 2JBMA 5LKYA 2PDQA 5EFFA 4IISA 4RDYA 2I9EA 1XL9A 2G5WA 3DGBA 3VABA 2B81A 3MDWA 1P48A 3GU9A 3ZFHA 3V16A 4DXKA 5K3VA 1A47A 4UTIA 4CVWA 3GXFA 2BHUA 3EPOA 1ZTVA 3LRMA 1VEOA 2WXDM 3OO2A 3RJXA 4XBKA 5FACA 1LT7A 2WSPA 1ZBWA 4G6CA 3O6CA 1I6NA 1HP5A 4C6MA 3NTYA 4PTXA 1NIUA 3GVVA 2XN1A 2XH7A 1QASA 3KTCA 1H7RA 3B9DA 2J7CA 2PI6A 4LY8A 5CQ1A 5EBAA 2BG5A 3KE0A 1JNEA 3B9EA 1XCFA 1S5MA 1N82A 4X2RA 4YTSA 2FIQA 4WJEA 2Y5JA 5IOBA 3SUVA 3GXTA 2P3ZA 1J12A 3QKEA 5EMJA 4MWAB 1TE1A 4DZIA 3M16A 1HVXA 4LUTB 2BS9A 1T5AA 1X38A 1JYWA 3H2CA 4DWSB 1FH7A 4LYPA 1C91A 5L6UA 1W9XA 3G0UA 2Y8VA 4HK6A 3DX5A 1K8YA 4L7ZA 2VCBA 3RHGA 1X1NA 1Y5WA 3UFYA 5DX7A 4NASA 4Z08A 4LT9A 1UQYA 3B9NA 4POCA 4GO8A 2GQAA 2Q02A 1BSLA 1K3UA 3AXMA 3OLGA 4KIEA 2PDXA 1I2NA 1ELSA 4WK9A 4B5TA 5DRCA 1H62A 1R3TA 1WKEA 3LDVA 4DELA 4YU1A 1S3TC 2FZBA 1DWIM 4KETA 1BTMA 1TPDA 4Z2JA 1PJ9A 3VD5A 3CAQA 4DJEA 1I2QA 1VAHA 1B9ZA 1QPNA 3CT7A 1GONA 3NQ6A 3KVLA 1PYMA 5E93A 3QJAA 1D8CA 1JUEA 1H1ZA 2YCJA 3T2PA 2GPTA 1GWJA 2BOGX 3DEQA 3ZLHA 2V8ZA 4HMNA 3EXRA 2VZTA 3A6OA 3C0JA 3M43A 3U2ZA 3WL0A 4UQDA 4IPIA 5EMKA 1W32A 2P76A 1G94A 3L5MA 3T1GA 3NDZA 3W86A 1RALA 5M3WA 3CHVA 1W91A 1DJYA 1P43A 3SQLA 4ML4A 5LXXA 5C55A 2I7GA 2CIPA 3WDPP 2QR6A 1DTNA 2ZC1A 1FKWA 3PJXA 4HCHA 2A3CA 1KRCC 3UW6A 4YYFA 4GI4A 5DELA 4B5VA 2OX4A 4QEHA 3CWOX 4YVVA 5JBDA 3GR4A 4DAIA 1XYCA 5G4EA 3LM7A 3S8HA 1X39A 3EKZA 3XISA 1Q8JA 5HQLA 2RJHA 4ZFCA 3PBYA 4UTTA 3F4DA 2WVSA 2WSYA 5T91A 2PDNA 3BZGA 3TK7A 3C52A 3PSWA 2HE5A 3ITXA 1CGWA 1NOUA 3MMWA 1GEQA 4KWWA 1E6PA 3CB8A 3BAJA 1XGZA 3N73A 3MSDA 4DF2A 3BTNA 3M07A 1V7AA 3E12A 5IM51 1QBBA 2WBGA 3MUZ1 3DGRA 1TR9A 3PK7A 4HSNA 2XPKA 3MUXA 3R11A 4H04A 3VX0A 3N19B 3RJYA 3S1VA 3WKZA 4CD4A 5HPOA 5JU6A 3B03A 2X30A 3VXGA 1VJSA 4N9CA 2VFHA 4EPDC 1G7VA 2Y0FA 3TXVA 4P8WA 1LL6A 2PDPA 2GK1A 2WMFA 2WBKA 5KZ6A 2XIBA 3B8UA 3BC9A 4MDOA 3PBVA 3TV8A 4NYYA 3R25A 3Q58A 3R89A 3ZIZA 1FWTA 3GG7A 2DFAA 1DJIA 1Q6EA 3UZYA 3NM1A 4OOUA 3QC3A 1H09A 4AX6A 3VD9A 5I3KA 3BSHA 3VIOA 2P3EA 5B7ZA 3LHVA 1FWSA 3N11A 5BROA 3LQLA 4EX4A 4G5DA 3W7KA 1P7TA 5EA9A 4E2VA 4AZ6A 4CLMA 4C7DA 5LIYX 1DL3A 2Z2BA 2IXVA 4C6KA 4M3PA 4ZE4A 1W5MA