3AJ7A

Crystal structure of isomaltase from saccharomyces cerevisiae
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
586
structure length
586
Chain Sequence
SSAHPETEPKWWKEATFYQIYPASFKDSNDDGWGDMKGIASKLEYIKELGADAIWISPFYDSPQDDMGYDIANYEKVWPTYGTNEDCFALIEKTHKLGMKFITDLVINHCSSEHEWFKESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSYFGGSAWTFDEKTQEFYLRLFCSTQPDLNWENEDCRKAIYESAVGYWLDHGVDGFRIDVGSLYSKVVGLPDAPVVDKNSTWQSSDPYTLNGPRIHEFHQEMNQFIRNRVKDGREIMTVGEMQHASDETKRLYTSASRHELSELFNFSHTDVGTSPLFRYNLVPFELKDWKIALAELFRYINGTDCWSTIYLENHDQPRSITRFGDDSPKNRVISGKLLSVLLSALTGTLYVYQGQELGQINFKNWPVEKYEDVEIRNNYNAIKEEHGENSEEMKKFLEAIALISRDHARTPMQWSREEPNAGFSGPSAKPWFYLNDSFREGINVEDEIKDPNSVLNFWKEALKFRKAHKDITVYGYDFEFIDLDNKKLFSFTKKYNNKTLFAALNFSSDATDFKIPNDDSSFKLEFGNYPKKEVDASSRTLKPWEGRIYISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Oligo-1,6-glucosidase
publication title Crystal structures of isomaltase from Saccharomyces cerevisiae and in complex with its competitive inhibitor maltose
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 231
structure length 586
sequence length 586
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2010-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3aj7A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3aj7A01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3aj7A02
3BGAA 3IANA 2QMKA 2DPEA 3B9DA 4XUYA 1BYAA 1WPCA 1P6WA 2RGMA 4ZXOA 4EKJA 3BVUA 5IFPA 1W1PA 2JF7A 1H1NA 1LL6A 1JL8A 2WVVB 2GK1A 1QW9A 4N42A 3A47A 2OYKA 4FNRA 1R75A 2WMGA 5GQBA 5HPOA 3W37A 2DIEA 4U31A 2YFOA 3VIGA 1XYZA 4JIEA 3AICA 2ZUWA 4AZGA 1J0KA 1ISZA 4HA1A 1X6LA 1JYVA 3BUBA 1E71M 3DC0A 3VD9A 1FH8A 3CZJA 4W8LA 3A24A 3E1F1 3DHPA 2FGZA 1LL7A 2CBUA 1SZNA 1JZ5A 2JF6A 5D8WA 2Y24A 2CBJA 2EACA 3CZLA 1UR9A 1HJXA 1B9ZA 2XFRA 1CYGA 1NWUA 2WBKA 3W6MA 2BY3A 1VJSA 1GHSA 3T08A 1VFOA 3CUHA 3S2CA 3WY1A 3VD4A 3A22A 3BAJA 1PAMA 2XN2A 2F1AA 4HZ8A 4UQCA 1TQSA 1NWRA 1V6UA 5A69A 1ZBWA 2EPMX 2YA0A 2A3EA 2BV9A 5A6JA 2XWEA 5FD0A 3T2OA 1R7AA 2X1IA 1CGVA 2XWDA 4FF5A 1CLVA 3TOPA 1WDQA 3LPGA 2DSKA 1R46A 5AYIA 1LLOA 1GQKA 1R7OA 3A3HA 5D9OA 2W91A 2DT1A 1O7AA 1NOFA 1TQVA 2NSXA 4AZCA 3OIHA 4PTVA 1Q6GA 3OGSA 2J7FA 5JBFA 3VM7A 1B2YA 4UQDA 7CGTA 5EBAA 4D6EA 1BQCA 4OJYA 2X2JA 3S6TA 4ML4A 2OWWA 4ZXLA 2XM1A 3BMWA 1J0JA 3AZTA 2QLYA 3CLWA 4YN5A 1US2A 2NW0A 2GK1B 3CIVA 3WKZA 3W38A 1DWFM 1GOIA 1DWHM 4RE2A 3OA5A 4M81A 5TD4A 3T0DA 4CD5A 3GXDA 2DT0A 3SUSA 2WSPA 5I23A 5JBDA 3CH9A 1C8QA 1ZBVA 3VDHA 2QMJA 1E6QM 3VIFA 1JZ8A 4DUVA 4QLLA 1FFQA 5HBFA 1XH0A 3EMZA 3RM9A 4V2XA 3MUY1 5I79A 1T0OA 1EO5A 4PBGA 4CN4A 5JUVA 3JUGA 1UYQA 1BTCA 2G3JA 4FLOA 3KL5A 5CPQA 1FH7A 2W5FA 3WNNA 3MS8A 3N1AA 4QCEA 1IZKA 2J8GA 1RH9A 3ARQA 1GJWA 2F61A 3WQ4A 4HZ6A 1XV8A 4GI6A 2WYSA 1JDCA 1KXQA 3BAYA 3GNRA 5IXEA 1HKJA 5EMYA 3WUBA 2EO7A 3GH7A 3F5LA 4PMYA 5IHRA 5GPRA 3WDJA 4M80A 1ZJBA 1CECA 3CV5A 4MPKA 3W82A 2DSUA 1E9LA 5E1QA 1HIZA 2BVDA 2JFEX 2J7EA 2WHMA 5ABFB 4K68A 2UY5A 1W1TA 2DT3A 5DT5A 2WZHA 5GNZA 5BRQA 1FP9A 1JNDA 4AZCB 2OSXA 1ITCA 1W9VA 3W53A 1PIFA 2Q8XA 5JIWA 3EJUA 1UD4A 4U2ZA 1J10A 3II1A 1UR1A 4H41A 4AYGA 3MMUA 4A3YA 4AD5A 3VNYA 1QBAA 3AIUA 2XUCA 2YDQA 3LPOA 1I1XA 1QW8A 3LRLA 3BAKA 1PEZA 1LWJA 2FH8A 3AS2A 1KQYA 4P7NA 4AD2A 3QHMA 2J7DA 3CUJA 1B0IA 1JZ4A 1RP8A 2D22A 3CTTA 1E4MM 3M07A 1JGIA 1CXIA 4MNLA 2DDXA 2D0GA 1QVBA 3MUZ1 1K9TA 1WKYA 4AISA 1UKOA 1QI0A 3WQ6A 2JIEA 4JFUA 2WC3A 4MDPA 4GIAA 1UD2A 2J8FA 1Q6EA 3ARZA 1CGYA 3L4YA 5DEZA 2E9BA 2XYLA 2VZOA 5A8QA 2QPSA 3VVGA 2XM2A 3CC1A 2F7QA 3BUPA 1KCKA 2O9OA 1FFRA 4X9YA 4Q22A 1E15A 2J7HA 4CD7A 1NWSA 4S3JA 2DH2A 4NRSA 1TCMA 4TTUA 1V6XA 4PTXA 2YL8A 1J0HA 2JEPA 1EIBA 4P8UA 1OIMA 1UQYA 4V28A 4UTFA 3GXNA 2G3IA 1Z32X 1W9XA 4LX4A 3NSNA 3D4ZA 4BS0A 2ZX6A 2ZE0A 1RP9A 1HL9A 2CIPA 3WY2A 1OINA 3WDRA 1TE1A 3LXCA 2VNCA 3SCTA 1VBRA 4AIEA 3BC9A 5IDIA 4PMRA 2UWFA 1V0LA 5LA2A 4D6HA 3A6OA 4U3AA 2VC9A 4HPGA 2VRQA 5LA0A 1IT0A 1VFFA 3GXMA 1B30A 5CPTA 3VD3A 1HJVA 4HMCA 2IGTA 4D6JA 4HU0A 2YBUA 3GXFA 4NZFA 3AJ7A 3AIEA 2AMGA 2WMJA 2J75A 4E4PA 4OGZA 3MU7A 4AY1A 3CBWA 1KR1A 3K8KA 3NSMA 1UZ1A 3ZO9A 1K9DA 2XFFA 4RE3A 3UERA 1GPFA 1W32A 1WDRA 1B3YA 1QNQA 1VEOA 1JIBA 1PPIA 4OKDA 4W89A 3H55A 3CHFA 1CXKA 4KWUA 4CCDA 1B3VA 3CHDA 3SIMA 1HP4A 1UASA 1E0XA 3D3AA 4W7VA 5FCZA 2D0FA 1K9EA 1GONA 1MXGA 1WZKA 2XN0A 4HA4A 5E70A 2W4XA 4UZUA 3ARRA 3B9EA 4W88A 4AD4A 4WJXA 3I3EA 1BYCA 1ISYA 3AXXA 3BVWA 3W28A 5JIPA 3QOKA 5AC5A 5DMYA 4BA0A 4V27A 2XGBA 5A94A 1OWQA 1R86A 1BSIA 3CZSA 3FHQA 4HMDA 1HNYA 2VR5A 4E8DA 2VX5A 1Q6DA 1GNXA 4TUFA 7A3HA 1JFHA 1WB0A 3PZMA 2OW6A 3WBEA 3DYMA 1O7DC 2J74A 4GZEA 4AZ7A 1D2KA 5FOOA 2O92A 3WSUA 1LF1A 1QPKA 3LX9A 1GVYA 1XHGA 4OIFA 2J62A 3ARXA 5BXTA 2F7RA 4MB1A 3VGBA 1BVNP 3WY4A 4NF7A 4BCEA 1EHAA 3HMCA 3AXIA 2WMHA 3N9KA 4D6GA 5AC4A 2X2YA 3RILA 5CSYA 5I2UA 4P7OA 1KQZA 3T2PA 1MFUA 1RPKA 3MO4A 3H54A 4FLQA 1DWAM 2CETA 4U5KA 3ARYA 1MWOA 1V6YA 1ISVA 4ACZA 4F9JA 5CZKA 3DX0A 2PF0A 4D1IA 2YOCA 4UQAA 4WK9A 3I3BA 2E8YA 4QLJA 3AI0A 2DT2A 2ZICA 3WUFA 3NDZA 4M82A 2XVGA 2VR4A 3W6LA 3NSXA 4CCEA 2OLHA 3SCUA 2X09A 2Z1SA 3QHNA 3VMNA 1WAWA 3GXIA 5F7UA 3L4VA 4AZHA 4CN6A 1UD6A 3PZIA 1CGTA 3LMYA 5FKYA 3EDFA 1H41A 4AC1X 3CZ8A 4UFJA 4H8UA 1TA3A 2XSAA 3RPMA 3ZM8A 3GXTA 1J0ZA 1C7TA 1HKKA 4KRTA 4DWSB 3DDGA 3OG2A 1H5VA 1MW1A 3L4XA 3LPPA 2G41A 2UY3A 5I78A 4Q7NA 4WKHA 1R87A 2CHNA 3AIBA 5A95A 1TQUA 3AFBA 4BF7A 1W9BM 3CO4A 3ZR5A 1EA9C 4J3WA 4J3XA 1VAHA 1H0IA 3OZPA 1GW1A 1KR0A 5D9MA 3RO8A 3PHAA 1ODUA 1QHOA 2EABA 3LRMA 3ARUA 3WDPP 1XSKA 5CGTA 3KWXA 1G94A 1US3A 1GCYA 3EJTA 4JKKA 3AOFA 3B9AA 4PTMA 3D52A 1OT1A 4BZYA 4J3VA 3J7HA 1CDGA 5E0CA 2G8ZA 4ACZB 1MYRA 2WW5A 1CGUA 4GZJA 1WZMA 3W29A 1X6NA 4Z2HA 2WVUA 2J78A 2BY1A 3A4XA 3K4AA 3IJ9A 3BUDA 3VGDA 5KEZA 1E5NA 3F5KA 2VVNA 4FNUA 3PZTA 1UH3A 1C3FA 5BCAA 2J4GA 1JI1A 1L8NA 1MQPA 1WNOA 3AHXA 1NWTA 1YHTA 5A8PA 3ARPA 1GORA 2W63A 3WD4A 1HT6A 3HJEA 1C8XA 1C91A 2VZUA 3W81A 2E9MA 4DM1A 3VGHA 2GFTA 5CLTA 4LXFA 1VEPA 4D71A 3IJ7A 4WF7A 1UZ4A 3K4DA 1JZ2A 1ZJAA 1PZ3A 1GVIA 1GOMA 2EADA 1UWIA 3OBAA 1TA3B 4CKQA 4ATLA 1KCLA 2WC7A 1HL8A 1AVAA 2BY0A 1E0WA 2GDVA 3ALFA 3U5YA 3VM5A 5BYWA 4JL2A 1JG9A 3D4YA 4OBSA 4LPCA 4W7UA 3VUPA 3WL1A 1W2VA 2W66A 4HOWA 2PWFA 1NQ6A 3MUAA 2GSJA 3SCVA 1SFSA 2OYMA 4GINA 5CSUA 5I6SA 1GOQA 4MNJA 3WMBA 1PX8A 4P7RA 3MSDA 5ABFA 1M53A 1V0KA 3PTQA 4Z2JA 4BQ3A 1HJUA 1CBGA 3HG5A 4EANA 4NRRA 2EBNA 4UZSA 3ZOAA 5FL1A 2O9RA 2UY4A 4CU6A 3LPFA 5M03A 2EQDA 1B3XA 1BYBA 4PMOA 1RD6A 1KGXA 1V02E 3VD7A 1J0IA 4M56A 5DFAA 1SMAA 3UR8A 1KWKA 3PZOA 5GNXA 2VZSA 1C7SA 2J79A 1PZ2A 3RJXA 1FA2A 4OOUA 2X2HA 1W3LA 1HVQA 4OBRA 2WBGA 3TONA 4P8VA 2AAAA 3UETA 2WLYA 3CHEA 5BROA 2E8ZA 3GH4A 3ZSSA 3ZT6A 3O2LA 2WK2A 3VNZA 5A1AA 4GI9A 1W2PA 3AHVA 2C8NA 4E2OA 3WNOA 4R27A 2YKKA 3N13A 2NT0A 1BG4A 3DYPA 3G6LA 4WKAA 1S46A 3BSHA 4UFHA 5JBEA 1VEMA 3D51A 4E8CA 2D0HA 5HNNA 3T0BA 1VRXA 2D24A 3DHUA 4W7WA 1KBKA 1PX3A 4DUWA 1QI2A 3WF0A 4J3TA 2WMFA 5A6MA 1UKTA 2J7GA 1WP6A 1GOWA 3AYRA 4UCFA 4AIOA 1J0YA 4JKLA 3UESA 1KWGA 3AMKA 3WUEA 4D72A 1GZJA 1W9DM 3N12A 3BLPX 4PUEA 3VIJA 2XN1A 2GDUA 1V02A 3QGVA 4B9ZA 4M1RA 3L4ZA 3WFLA 4B16A 3W24A 1G5AA 8CGTA 1KTCA 1EH9A 4ATDA 1WE5A 3SEPA 3HZ3A 4NZCA 2ALWA 2CKSA 3VOCA 1E6NA 3EYPA 4A3HA 1AQHA 4EK7A 2ZWYA 1LJYA 3IAQA 3ECQA 1ZBCA 1A47A 2DH3A 3VPLA 4YHGA 2YIHA 1LQ0A 2GUYA 2MANA 2V38A 2OWXA 4AXNA 1KTBA 3BAXA 1QI5A 4HOXA 2VZTA 3WDHA 1QHPA 2E0PA 2XG9A 3MV01 4Z2GA 3SUWA 3K46A 1NOWA 5ABHA 1OIFA 5I5RA 4D6IA 4DM2A 4W5UA 4J3UA 2D3LA 4FMVA 5A8MA 1DWJM 2WHLA 2XVKA 1JI2A 1I75A 4S3KA 4XZBA 5C70A 1QNSA 2WZEA 5BXSA 3EDKA 4PSPA 3THDA 3K1DA 3M6DA 4W87A 2V5CA 1XCWA 4C7GA 1QNRA 4NSBA 3WDQA 3NYDA 2ZX5A 3T09A 2X0HA 4WLCA 1MVYA 5FIPA 3OLGA 1JAEA 4CGTA 4FNQA 2O9TA 4JCLA 3AIVA 2DSVA 3BUIA 3BAWA 3EMQA 1PS3A 4HP5A 1V3KA 1DTUA 3U57A 4GQRA 3AS1A 4PMNA 1ZU8A 4J27A 1CXFA 2V3FA 4X0NA 1CXLA 2YDRA 4RL3A 5A6BA 2ZUSA 1JFXA 3WUGA 3TTSA 1HXJA 2J77A 2Y8KA 4URIA 4AZ5A 1K9FA 1R8LA 1MXDA 1UWRA 5DF0A 4Y7EA 3EDJA 4ZE4A 4D6DA 2BHUA 4WSJA 3VDBA 3NDYA 4MNKA 3WH6A 4MB3A 1HF6A 2EEXA 5HPCA 2E3ZA 4JAWA 3VTRA 3WD3A 1BGGA 2XGIA 2F8QA 3WH9A 1R33A 3HG4A 4DWSC 1UWSA 3DECA 5FL0A 2PI6A 3VIIA 1G1YA 2CCRA 4AD3A 5DT7A 2BS9A 1OGGA 3L4UA 2O9PA 2D20A 4FNTA 4TVUA 2XJ7A 3TTYA 3AXHA 4WKFA 5ABGA 2CEQA 1OD0A 4ZFMA 3BVXA 4MB4A 2WCGA 6TAAA 5I0DA 2BVYA 3PZUA 3OZOA 3VD5A 3LRKA 2J25A 2VURA 2CPUA 1BG9A 5AY7A 3FXYA 2ZOXA 5C8BB 4GI8A 2FHBA 5CXPA 1EXPA 2VOTA 3AZSA 3UG5A 2PWEA 4AD0A 1OM0A 2WWCA 4JHZA 5IHSA 1BAGA 3GBEA 3AHYA 3L4WA 3PTMA 1NH6A 3MV11 4MNMA 2PB1A 1JZ6A 1ODZA 3A4AA 2F1BA 1BHGA 3AROA 4LYPA 4JKMA 1XYFA 4XX6A 4JHOA 3DX3A 2XVPA 3ZJ6A 2YFNA 3WBAA 1IV8A 4J3SA 3O6AA 3WELA 1XH1A 2VL4A 1XD1A 4HPHA 2J7BA 4KGJA 1B31A 1HKIA 3RMEA 1QWNA 3EJSA 1PBGA 4N0RA 4AIUA 4HTYA 4TOQA 3HG2A 4ZEPA 2XIIA 2FE0A 1SMDA 4IPLA 1VIWA 5AYBA 1R47A 2JIWA 2UY2A 3BMVA 2HISA 3BH4A 3S5ZA 4OOZA 3VSUA 4FNPA 2VQUA 3EJRA 2ZXQA 4DWSA 2YJQA 5LA1A 1CENA 2FGLA 1JZ7A 3DDFA 2W61A 3EJPA 3G6MA 1WO2A 2VCAA 4MADA 3ARTA 1CIUA 1U30A 2V3EA 3AMLA 3OLIA 4HOZA 1BFNA 4TX8A 1LG2A 2WHKA 4QCFA 4CCCA 2VI0A 2EPKX 3B8SA 4W8BA 3VIPA 2PC8A 2WKLA 4UQEA 2EAEA 3RDKA 1JD9A 3DX4A 1KB3A 3HG3A 1EDTA 5E09A 5D4YA 2VCBA 1UHVA 1XGZA 4U33A 1TFVA 1HJWA 4UFIA 3RCNA 1GOOA 2ZXBA 3DYOA 2WAGA 4WSKA 1JF5A 1M01A 3WQVA 1XSJA 3AHZA 1W3HA 1TVPA 1C92A 2IXVA 3CZKA 3OLDA 3NJ3A 4TVDA 3BCFA 2VRKA 3CZNA 2XTKA 1V3LA 2PBOA 3APGA 4F9DA 1XCXA 1JDDA 4DWSD 4PCSA 3WNLA 3ALGA 3WMCA 5LYRA 2QV4A 3IAPA 1VJZA 5EFDA 4B9YA 3VSVA 3KLLA 2E9LA 2JALA 3AIRA 4F79A 3VIOA 1OB0A 3OB8A 3WENA 5DO8A 1G01A 2WANA 4Z2KA 2E4TA 2ZXAA 1MW3A 4P7LA 3WQWA 2PBGA 2WZIA 4GO9A 1N82A 1MW0A 1OD8A 1EDQA 1GJUA 3KL3A 2X2IA 1E56A 3SCQA 2YL5A 4TTGA 1E0VA 3CGTA 5M5DA 4PMUA 3GH5A 4IPNB 1MFVA 7TAAA 1QOXA 4PSRA 1OCQA 4WIWA 1VFUA 1BPLB 3WIJA 3WD2A 3WDIA 1GHRA 1HP5A 3PZ9A 1D3CA 1CGWA 3MMDA 2CKRA 2DSZA 1E1EA 1WCGA 1NP2A 4W86A 2J47A 4AW7A 1OT2A 1XRVA 1KBBA 1E4NA 4JFWA 3MMWA 2RGLA 4AEEA 1ESWA 3LXBA 2XPKA 4CVUA 4Z2IA 5EB8A 4MDOA 2IUZA 4XB3A 1KGWA 2BHZA 4EAMA 1XC6A 3WFZA 3FAXA 2FYVA 2PWHA 4H8HA 3WN6A 3WD1A 2F7OA 3VSTA 1TG7A 2VX6A 3VMOA 3DX1A 1J18A 1JNEA 1V6WA 1UH2A 3BVTA 3ARVA 2OW7A 3QOMA 2XVLA 4J28A 6A3HA 2ESCA 5BWFA 3HN3A 1E4IA 3PTKA 2CERA 4PTWA 4UNIA 2ZIDA 1JYXA 3VILA 2VMFA 5A6SA 2CITA 4UQBA 1W3JA 3GNPA 2A3HA 4A4AA 1G0CA 4MAVA 3D50A 2VRJA 3NUKA 1UUQA 1B3ZA 2BXZA 1FHDA 2GVYA 3BUQA 1QNOA 4P8XA 4NI3A 2DQXA 1H3GA 2E40A 1BGAA 2ZX7A 3AMDA 2G3MA 1CTNA 2D1ZA 3MUIA 1JD7A 3GDBA 4CN1A 4UR9A 2CYGA 5D9PA 1QNPA 3UG3A 1R85A 1OGBA 1W9UA 1UG6A 4M29A 4FNSA 1C8YA 2QF8A 4AEFA 1MQQA 3AQUA 1TQWA 1NP0A 2YL9A 3M46A 3GXPA 1UA3A 1XSIA 4UOZA 3I3DA 3SCNA 4F66A 2WWDA 3PN8A 4NZJA 1UR8A 1QBBA 1L0PA 2YBTA 3TP4A 3WF1A 1FP8A 2WM0A 4MJ2A 5HOSA 1V03A 3PZNA 5CGMA 4GZIA 4JFVA 4U2YA 1TR1A 3FAWA 1UR4A 2VVSA 1W3KA 3N17A 4U3CA 1Y7VA 1DP0A 1QHZA 3U7BA 3BCDA 2VX4A 2XVNA 4GXPA 5I77A 2G4FA 3BXWA 1W9PA 3ZJ8A 3VMPA 1EOKA 2ZUTA 2BFGA 3CZGA 4LYQA 1UKSA 1JYWA 1NOUA 5CJ5A 1QI3A 3AMGA 4KMQA 1AQ0A 3WQ5A 4JL1A 2DGAA 2WSKA 2VQTA 4PMZA 2DSWA 1X1NA 2CXGA 2VCCA 4W84A 1J11A 3A4WA 3N11A 1TZ7A 3ZIZA 1CNVA 1HX0A 1KGUA 2Y2WA 2OSYA 1H4PA 3CMGA 1MW2A 3OLEA 1C90A 3UCQA 4C7FA 4CD4A 1BF2A 3UEQA 1C93A 5BXPA 3MKKA 4AZBA 3ZT5A 4CD6A 3VGEA 1JF6A 3WNMA 1UWTA 3F4VA 2WNWA 1CGXA 3ZT7A 9CGTA 1E6ZA 3VX0A 3D5HA 1V08A 2JE8A 1W1YA 5E0FA 3SUTA 4PUDA 2V3GA 3RM8A 2YLLA 3ARSA 3KE0A 4ATWA 4JFSA 1CLXA 3VDAA 3VO0A 3VX1A 1AQMA 4W85A 1CEOA 1ZS2A 4L4PA 1E43A 4AMXA 1V3JA 4BQ5A 4FLRA 3A5VA 4XV0A 5E6YA 2D3NA 8A3HA 4KGLA 2G3NA 1ISXA 2FHFA 1UA7A 1V3IA 4UFKA 3WMSA 1KXHA 3M7SA 2EXOA 1UOKA 3UR7A 2WC4A 1PX4A 1EOMA 1G9HA 3SURA 4IISA 4MB5A 3N15A 3WQ8A 3THCA 1JYNA 1JZ3A 3U7VA 3KZSA 2OWCA 4UQ9A 3AS3A 1OSEA 5A2BA 4AWEA 2WCSA 5A2CA 1EO7A 3VU2A 3CHCA 3A23A 5E6ZA 4LGXA 4CU7A 6CGTA 2VTFA 3ZMRA 4AZ6A 1HTYA 4DO5A 2BVTA 4HU8A 2Z1KA 4DUXA 3IK2A 4JFTA 4B3LA 4PMQA 3T2QA 2ZUVA 2PWDA 1YQ2A 1J9YA 4TX6A 3SUUA 1U2YA 5A6KA 1Q4NX 3NIYA 4NX0A 4U5IA 1UH4A 4P7QA 1HVXA 1TUXA 4YPJA 1QWUA 2ZXDA 5KZ6A 1ECEA 1HN1A 1GQLA 2XSBA 1XH2A 2OSWA 4DO6A 1E70M 4MJ4A 4AD1A 1KXTA 3EDEA 2VUYA 2D2OA 1PJ9A 4DO4A 2B31A 2WKGA 1E6RA 1E6XM 1HJSA 1M7XA 1B1YA 3WH7A 2D23A 2C0HA 4JCMA 3AZRA 3BVVA 3FW6A 1CXHA 5BXRA 4GKLA 2ZX8A 3MANA 4H8VA 4P8WA 2FH6A 5CPSA 1Q6FA 3SCSA 3SCWA 1F4HA 3L4TA 1JXKA 1H0GA 5CG0A 3MSGA 2J7CA 2QPUA 4NXSA 2W67A 2WCAA 2TAAA 1FOBA 2ZUMA 5HXMA 4JZ5A 5GNYA 3HU7A 5A6LA 5CLWA 1J01A 4UOJA 1K6AA 4W93A 3GYCA 2NT1A 2OYLA 1LL4A 5C71A 1H09A 3FNDA 1MQRA 5D9NA 4AMCA 1XD0A 1E3XA 3CZEA 2ZX9A 1CXEA 3TV8A 2EPLX 4HMEA 3T0AA 4RE4A 1WZAA 3H53A 3LXAA 2DIJA 2AOSA 3GZAA 3SCOA 3DX2A 5ABEA 3GTNA 3F5JA 1I1WA 2CESA 4NXKA 3WEMA 1H11A 2CHOA 2ZUUA 3AYSA 1E6PA 1BLIA 5EFFA 4B15A 2PWGA 3CPUA 4GO8A 1ZL1A 3CMJA 3W4RA 1VFMA 4FLSA 3TTQA 3ZJKA 5A6BD 3BLBA 4AZIA 2WB5A 2WVTA 4C7DA 5A8NA 4Z2LA 2F2HA 2VO5A 4F8XA 4YHEA 4BQ4A 1CWYA 1V0NA 3PZVA 1TVNA 1ISWA 3RIKA 4AMWA 1NARA 3GBDA 3UG4A 3IGUA 3WF2A 1E55A 1CZ1A 2FHCA 1V0MA 3AIWA 4D6FA 1BYDA 1J12A 2QHAA 5E9AA 4CD8A 1D7FA 4H2CA 1AMYA 4PMDA 4W5ZA 3WL0A 2VT0A 1V3MA 4B3KA 4QFUA 3POCA 1EDGA 4PYSA 4LYRA 2WHJA 1VENA 5I24A 2XHYA 4TXEA 1VF8A 3K8MA 3BLKA 1UKQA 2BY2A 3WEZA 2WPGA 1E40A 1OBAA 4ACYA 2Y4SA 3VGFA 2YA2A 1A3HA 1U33A 5BRPA 3QR3A 3VINA 3MI6A 1UD5A 3WH5A 1GQJA 2WMIA 3FHAA 4MAZA 3ARWA 1QI4A 1ITXA 1DHKA 4QP0A 1EGZA 4H7VA 3VGGA 3N18A 3EJQA 3BAIA 1LG1A 2A3AA 1JAKA 3CUFA 3GNOA 1V3HA 2EPNA 2WVSA 1JXJA 3RJYA 1UKPA 4PEEA 1DWGM 1UWQA 2A3BA 2Y8VA 3VIMA 1QX1A 1PIGA 4TVCA 2IXUA 3A21A 3WF3A 3PBGA 3WF4A 2CBIA 2VZVA 3K8LA 2X0YA 3KL0A 2YL6A 1KFWA 4PCTA 1TMQA 1FHLA 3IJ8A 1ZBKA 2BHYA 1GQIA 4PN2A 3CUIA 4QLKA 1HKMA 3POHA 5CQ1A 3ZJ7A 1Q6CA 3ZQ9A 1GUVA 4AYSA 2GJXA 1EQCA 4BQ2A 3TA9A 1F4AA 3QHOA 3VDCA 1BVZA 3KLKA 3W27A 3OGVA 4OUEA 2WLZA 2ZWZA 3WEOA 3RM4A 4M24A 1CPUA 4PMVA 3WNKA 3KEHA 3SUVA 3AHTA 2W62A 1EQPA 3AISA 1DWIM 3WH8A 3TTOA 4MTVA 1NM9A 3VKKA 1E73M 2XFYA 5A8OA 1E1FA 2YLAA 4UOQA 2CNCA 2W92A 1GOKA 1HWWA 1UR0A 4PMXA 4CU8A 5ECUA 4W8AA 1E6SM 4J7RA 3GM8A 1HJQA 3EMCA 1UD8A 2VJXA 2F7PA 3AS0A 4L4OA 3W26A 1M04A 4GPNA 5D8ZA 1H49A 2X05A 3PZQA 4KRUA 4QDMA 2C7FA 3CUGA 4QAWA 2WMIB 2YA1A 1TQTA 1LWHA 1H2JA 1VB9A 3VIKA 1WDSA 1UQZA 3VIHA 3ZSTA 3OGRA 2WVVA 1UD3A 1W1VA 4ZE5A 4R5EA 3FN9A 3BSGA 2V5DA 1WDPA 1OGSA 1O6IA 3FY1A 4HZ7A 3W25A 2ZUNA 4FK9A 3O9NA 2A3CA 3S5YA 4D1JA 4M8UA 3L2MA 1UWUA 4D6CA 3SCPA 2GJRA 4HA3A 4OZOA 4CVWA 5IFTA 1E4LA 4UFMA 1SYTA 3AMCA 3W0KA 4KH2A 2CBVA 2BNJA 1W91A 2GJPA 1FH9A 5A3HA 3AIQA 1VBUA 5M3WA 1HXKA 4GQQA 4IM4A 1E5JA 1WZLA 2WXDM 1EHNA 3WD0A 1E3ZA 2GJXB 3SCRA 3U5UA 1JDAA 2D73A 4EE9A 1E72M 3NCOA 2BXYA 1KXVA 3EBVA 2FDMA 5I3DA 5HDRA 2HVMA 2Y5EA 2V3DA 5A2AA 3WY3A 4LQ1A 1SR0A 4UFLA 4PRWA 1V6VA 2F18A 3PZGA 1R34A 3L2LA 2EJ1A 3EDDA 3WNPA 2XIBA 2YDSA 3N04A 4XZWA 4IUGA 1ZB5A 1B90A 5A6AA 2EPOA 2JEQA 1IZJA 2WMKA 3ZR6A 2VX7A 1M03A 4ZENA 5M17A 4H04A 2DEPA 1DEDA 4X0VA 1UR2A 1B3WA 2X8RA 4CUCA
chains in the Genus database with same CATH superfamily
3BGAA 3PGFH 3FUEA 5E6IA 1WPCA 3SKJL 1SYVB 4C6BA 4N42A 1KTLB 1AD9A 4FQQB 2W0UA 4U31A 4MS8D 4N2AA 3EJJX 4AZGA 3DC0A 3MRCA 4WHTB 5DD1L 5ABTA 4WTZG 1LL7A 1T5XB 8TIMA 3KLSA 3VWKA 1EP3A 3GS6A 4IGNA 3J2PA 4QRAA 3D3VD 1NWUA 1T2XA 2WQWA 3FK4A 2LVEA 1Q0EA 1Z3NA 4Q9CA 1ONXA 3VD4A 1PAMA 2F8OA 1IZCA 4GG9A 3LGEA 1Z9NA 2YA0A 4LBEB 3ZQXA 1FDJA 2HKFL 2CO7B 2HKHH 1KIPA 1R7AA 2GABA 2YBRB 3DA0A 1YEFL 4XODA 1BOGB 4HPJA 4Q58C 2X70A 4I4WA 1JVNA 3VM7A 5BRZA 4FQCL 5C97A 2VH5L 3LV3A 3DBPA 3ELAT 3GMLB 1RJPA 4FQ2H 2FLIA 3AXKA 4XE5B 2O61B 1QAPA 4ROQA 2QSCH 4KKAD 4RE2A 4NVTA 3H2PA 5F71A 2CO1A 3VC6A 2FQFA 3GC5A 4WHBA 3Q9PA 1NAMH 4M6PA 4LHUD 4B9PA 3E0FA 5BRBA 2AAVA 3PJSB 1IIKA 3ZKMC 3QAQA 1IE5A 1N4XL 3HKFA 5CJNA 32C2A 3MA9H 4OCRL 1OADA 4DW2H 1OP3H 1B88A 3GLZA 1SJHA 4PREA 5DHMC 3F7LA 3RDTD 1NGPH 3W5MA 2WHMA 4WDIB 3KS0J 4LHUB 1EAOA 1OCWH 2J6EA 4HV8B 4A39A 3CFJB 4GXVL 3C75A 1EEZA 4AZCB 3W53A 4Q4SA 3ORJA 4I77H 1QCWA 3BSZL 1YX1A 3UGVA 2RD0A 2XUCA 5GJMA 3LRLA 2WIIB 2OMZB 3QI9D 1LWJA 1KQYA 1SQ2N 2FR4B 1BWLA 3NRPA 3PWJA 4WFFD 4YDKH 1MJ8H 2BVUA 5MEPA 2IPKA 2A38A 1PCSA 1K9TA 1QI0A 2DQCL 2CDGB 2AQNA 4GAGH 3CH1B 2AGJL 4Z76B 1CO1A 4IRZA 3LEYH 4TSAH 5I2IA 1U8KA 3W7JA 1WCBB 1GGIH 4GIYA 2PLCA 2WWNA 1A6UL 3PAYA 5D96C 4JICA 5EBGA 1KJ2L 4NRSA 2V67A 1X5HA 4KVCL 3WKNA 4ORMA 4V28A 4UB0H 4XBPB 2ZRZA 4GNJA 1VHNA 1RZFH 3WLWD 3PHQB 2C3VB 1CT8B 3QNXA 2ZAIA 4M4PA 2AQPA 3AACA 4HPYH 4OFKA 5IOKA 3WXWH 2FJFB 1YYLH 3SGJC 1AFVL 4NKDA 3DSFH 5FCSH 3C08L 4HMCA 4LEOA 3MI3A 3QDAA 1IRAY 3FONB 4X83A 4LB4A 5D55A 1UBPC 5IHUL 1UZGA 4D0CB 2HEJA 4X0KA 1I0BA 3ZLGA 4E9TA 2EH7L 5LXXA 4MTMA 1B4RA 5L9DH 3E6HA 1Z3GH 4LGSB 5JOFA 4U1SB 3CHDA 2WINB 3PBVA 5D6CA 4YCOA 1RZKL 3RR1A 3UBXG 3VZYA 4JQVA 1NC2D 3KWVA 5K9QG 4WEUD 1NBCA 3FGCB 2NLYA 2OCZA 4W88A 2ZTBA 1XINA 5C0CD 1N9PA 1SJCA 1HNYA 3LKOB 4G70B 2VEIA 1MKFA 2VX5A 4PVMA 1JFHA 5IVNA 5DLML 3DK2A 2ZJSL 1NC2B 1NANH 2GBUA 1D2KA 5D7HA 3CB3A 5I02A 1LF1A 2HB0A 4NAQA 4PIRF 3NTCL 1SPQA 3L1OL 1BQKA 2R9HC 3S96B 3S4SB 5JTWA 4DCQB 3WY4A 3EXTA 3ZZQA 1KZYA 3E96A 3TT3L 5I5JA 5I1GL 5LB1A 4ABWA 3GLCA 4CSZA 3VG0L 4NBXB 3BXNA 3L81A 1BGXL 2OMUB 1ZT1B 1MWOA 3O3BA 5C9JA 5H4YA 2E8YA 4UXDA 4U1NA 2VR4A 1WIUA 4CCEA 3ZY7A 5HYQB 3V5HA 3VWKC 2Z1SA 3UYRH 5KYYA 1OTSD 1TMCB 1UJ3B 1ICTA 3NAVA 4L8CA 4LYKA 3CZ8A 4ZS7H 1G67A 4ZQNA 3H2EA 5HHOE 4IQJA 4LLYA 4HEMA 3C6EA 4XMWA 2GT9A 3WTXA 1MW1A 3KDOA 1DTNA 3IXAA 1SO3A 1AZZC 5D6DA 3MLRH 1NC4B 4G8IB 5CJOL 2D8KA 3SDDB 1VAHA 3O3DB 4Q2ZA 5D9MA 1KR0A 3ABOA 1A64A 3RO8A 5CPOA 5J06A 3ARUA 4ODVH 4U4BA 1TEYA 3GY1A 5D7IA 2YD3A 4HKPA 4XH2B 1TWZA 2OTUA 4PJHE 2IH1A 3A4XA 1PDZA 1H0DB 4YTUA 4XNQB 1Y18A 1JI1A 5D2TA 1GORA 3QYSA 3HJEA 1C8XA 4WNSA 1OO2A 1MG3C 5IB1A 3QYQA 3BE1H 4ETQA 2Y36H 4JDVB 2WC7A 3SCMD 3LAFA 4NO5A 3VM5A 1NMAH 1DBJL 2C1OA 4QIRA 4P5MA 4WSGA 4J4PD 5IBLD 4Y4HD 4NEHB 5F6HI 2OO0A 3WMBA 1PX8A 4EOUA 1T22A 4EANA 5CF3A 4FQIH 3HI1A 2JK2A 3FCPA 2EIJB 3UQNA 3F03K 1ITBB 2P0OA 3RJXA 4MZYA 3WBXA 3RWEB 3NFSH 2B4CH 1KTDA 4IMFA 4GX8A 4JAMA 5BROA 3S36X 2A6KB 5HHOB 2VDPH 5FKAA 3DGCR 1TTUA 5ETUA 1Q94A 3DYPA 3BKMH 2K78A 5TQ2H 5I3IA 2BIMA 3VFVB 1J5HA 2J13A 1N8IA 1QPOA 2BLFA 2IBZX 2GQ9A 4B90A 4A2EA 1MFBL 5I66B 4FFZL 3WD5L 4XGZA 3QG7H 4IS6B 4B16A 4OECA 4J3OH 4ATDA 1NIBA 3QDHA 1BM7A 1UCTA 1P6BA 5EU7E 3IAQA 1JPTH 4IRSD 5HMSA 4PJHB 3UXFA 4HIJB 4PCFA 2I69A 1P84K 3HMXL 2YWYA 5A40E 5C70A 3Q43A 3HE6D 4JY6B 4MAUH 2BASA 3LPWA 3M6DA 3TYFB 5CIPH 5D7EA 4XZ4A 4XC1H 2FPYA 4WX2A 3U83A 1QXLA 1FLRL 1FVDA 3UAEA 1PTDA 4KMTH 3ATDA 4LRNL 4CMHC 3NZQA 4Y9GA 4OLYL 1AGFB 5H2BA 4PRID 1GEHA 4X8JA 4MJZA 4XMKH 1CXLA 4ZODA 4A8LA 3NCEB 4JQVC 5T33L 3IWVA 5HGDA 3WXVL 5EG6C 4S1FA 4BSVA 5K7JA 4HUVA 4JCWA 4WTWA 2HN7B 4B3EA 2D4FA 1DUZA 5EKYA 4LIQH 1SJAA 4Y4KD 3NDYA 1O5DT 3HB3C 1SZEA 1Y1UA 2E3ZA 3PREA 1BGGA 1F6YA 3WQPA 5C2BH 2EF9A 3LHZA 3DLQR 1F8TL 3QIWA 3OJVC 4L4LA 2YB1A 4ZDHB 3PUGA 1X39A 1VFHA 4FG2A 3ZUNC 3HPLB 1IGCL 3VD5A 3T0EE 1TNNA 3TX4A 2BVEA 5MF5A 4NJIA 5GJPA 2JELH 1GZPB 4XN4A 3FA4A 3K72A 2C9UA 1MSSA 3AC0A 2B7DT 2IKHA 3WE1A 5DEGA 1ONQB 1TJXA 3IMSA 1HCYA 3GSUA 4XAFA 4WCJA 4ODXA 3FYPA 4PUNA 2GK2A 3WTSA 3VFLA 3QBUA 1VRDA 4TQEL 5KYWA 2CUAA 4G8EA 1FFNB 2ZKMX 1QABA 1AW2A 4AU0A 3MO1A 1ZRUA 5JA9A 3I4KA 4KT2A 1K4DA 1MFEH 1IGJA 1JWMA 3SQRA 2PCPA 1JPSL 3AZUA 1MIML 4MXQD 2PTUA 2FGLA 2DWDB 5D6DC 5F8RC 1CDHA 5E99H 4LOEA 5ESQA 2QDHA 4K37A 1RALA 2E6AA 3ES7A 1FL6A 2DI7A 4P2OA 1EC7A 3UTQA 43CAB 1VIZA 1JF1B 5D4YA 2VCBA 1A5FH 1FAIL 3RCNA 4DQWA 1HINH 2QZ5A 4NPJA 3SE6A 3BPCA 3KCPA 2CKNA 1UACL 3MSPA 4M62L 5DMLA 2D2CC 1LO4L 3ULVF 3KJ6H 1V7AA 4L9LC 4AYDC 5JMUA 1H15A 3WLLA 5I73B 1A5BA 4BEUA 4DWSD 3ETTA 4XP9H 4YHIA 5DJDB 1MCBA 2FSDA 4FJYA 1X97A 1IU1A 5AQ0A 4RJEA 2YK1L 4IFKB 4JO5A 1XX9C 2JQXA 2Y06H 2ZQ0A 1DJSA 3DETC 2X2IA 1A6VH 3MNZB 4UDUB 1LYXA 3T0EB 2BRRL 4BEQA 1ILSA 1GHRA 4GAJL 3LENA 2CLOA 2VFFA 4YXGA 4YCPA 2IPUG 1DVFA 3OJGA 3BLIA 3VFSB 1UWEL 1OP3K 3PRZA 2FWLB 3MMWA 3VG9B 3GVWA 1E8WA 4MDOA 3SE8H 3WFZA 3BJLA 2GSEA 4RIRA 3RZCB 4DELA 2VX6A 1XG4A 2E7LA 5FO8B 2H8PB 3DXAD 1UH2A 3VFPB 3B6SB 2JCCE 5GRYA 2ESCA 3R58A 3GBNH 1F86A 5T3ZH 4M1GL 2OI9B 1I8LC 1FVPA 1WBYB 4A4AA 5AKQA 4PS3A 3IFOB 2APVA 4K8HA 4G9DB 3V4UL 1OCCB 4IIQA 1WAUA 4ZRGA 4NI3A 3MNMA 3MCLH 1RQHA 1BGAA 2ZX7A 5GSVA 4XX5A 4A2SA 2IIJA 1B4EA 2PETA 4Y1AE 4X6BB 4XD4A 2I5YL 5FS5A 1I53A 2Y5JA 1S7QB 1UMLA 4K9JA 3ZE2E 2WBJB 4NZJA 2AQRA 1K1DA 1ZVHA 1H50A 1T1ZA 4UTCA 1ME8A 3UADA 4HIIB 3B2VH 1QHZA 5ISZE 1VJIA 3MPCA 4GW5B 2GY5A 5EWIL 3L6FA 2GGHA 1A3XA 4QGYA 2NSQA 2NXZD 3FV9A 4BKLB 1FDLL 4R34A 1JHTB 4YHML 1PKNA 3LQZA 3WQ5A 2VQTA 1LNUA 5FYJD 4DIAA 1J11A 3QXWA 2WN2A 4UTBL 3UACA 3T6QC 4AIZB 1OYAA 3TQVA 3CQFA 4AZBA 1H19A 1UWTA 2R1WA 3KH4A 2NXZB 3PHSA 1KBGH 3G5VB 3VOGA 3RDTA 3TIDB 3VDAA 4LLWB 4H6RA 1DVYA 1E8XA 3KOZA 4WEEA 3X12B 4DBWA 3K4ZA 4WJ5B 1JHLH 1BWMA 4UFKA 2Z34A 2JCCB 2PF6A 1V10A 3PU7A 5EORH 1BQSA 3TA4D 5EFIA 4Y8AA 4XNMA 3LZ3A 3QI9A 4YVPA 4UQ9A 1OSYA 4APQC 3VD1A 3MSYA 3QIWC 3H6AA 2HLFD 4Z7WA 2VDOH 4B9IA 1OX5A 3KP0A 3C09B 5IF0A 3MW7A 4JFTA 1J9YA 3B2MA 3VGAC 2FJKA 4Q6JA 1MCOH 3BSZA 4XZUB 1UH4A 4Y1AB 2AXJA 1GQLA 5AL8A 5JHLL 3SDOA 5GISH 3RRAA 4XPHL 3UJJH 1GG0A 1N70A 3N4EA 2O30A 3ZE2B 3RL2B 2YD9A 3P61A 1PL9A 2ITDA 4IL0A 4F8LA 5LGXA 3FW6A 1CXHA 3L4TA 1QR7A 3ECUA 3VUSA 5F88A 3PV6B 3NMEA 4YXHL 5ISZB 1FNGA 3P4NA 4GFXA 2XVBA 1IGYB 2XTJC 3YPIA 4M5ZH 3W7GA 2E5CA 1ALDA 2FFIA 5D9NA 1XBZA 4LLUB 3FJTA 1XDMA 2WZ6A 1KJ2A 3W9EB 4XZHA 1NFDE 3EPOA 1G5GA 5AYUH 2EXTA 5C0NC 3X3GL 3QR1A 4ERIA 1E6JL 4KC3B 4P2OC 4NRZB 1ZL1A 2HJFA 5EN2A 3R8BB 1DN2A 3ZJKA 3FTUA 5A6BD 1VBHA 5AVVB 3LY6A 1HE8A 5TQ0L 1MFAL 4KX8A 3F6JA 3SIKA 1F13A 3O3AB 5DT1L 1GAFH 2P0IA 5EMKA 5H8PA 3LQLA 3HI5H 1A8JH 1X7SA 1K4CA 2IC2A 3MUUA 3SQOL 4F7EB 2R0KH 5EZIH 3S6DA 3S46A 1JTOA 5EMMA 1WV7T 5C8JB 3MV8A 2B1AL 5I24A 4F7TA 1MPAH 2F5BL 5I1LB 2F53D 1R3VA 4Y4FC 1A3HA 4V2CB 5D03A 1DSWA 1S78C 3FQWA 4QP0A 1W31A 3SYQA 4L9XA 4HALA 3H2NA 5KZMA 4U49A 3ZIMA 2I07B 1S2WA 1PIGA 2IXUA 3WF3A 3CYJA 2NY3C 4WI5A 2QEJA 1G84A 5H8DA 1ZA6B 1Z5YD 4KXAA 2C4XA 3O2WH 4HPNA 4H13C 2F6UA 4ENZA 4MS8C 2WWKT 5LCVH 2EUWA 1RIUL 3CSGA 2A1WH 4MX7A 2WLZA 2QCEA 3WEOA 2AV1A 2EO1A 4R4FL 3KWTA 5H37A 3WK2A 3EWZA 4YHLH 2C3ZA 5IK3B 1SM9A 2YLAA 2DEWX 4W8AA 3LK6A 1CFBA 1XF4B 4IIQC 1VH7A 5IFHL 3O11B 4Q89A 2A6IB 2X0SA 1NFDB 1SFHA 1KELL 1NBZA 4MLSA 4G3YL 2H45A 3ULUF 1VB9A 3I75A 1R3KB 1YDPB 1NGYA 5GGTL 1NOLA 1C8PA 1Q7QA 4AUYA 3W25A 4KK9C 4RETB 4JPVL 1HCVA 3ZRCC 3SCPA 2HJLB 4CILA 1C16A 5ACZB 1T8XA 5D96B 1G7IA 1TEFA 1ELSA 3B0XA 4O51A 2GJPA 5L88L 1VBUA 4GQ0A 4M19A 4KKAC 1YLBB 4PMFA 2BSRB 5T5FL 3RNKA 3DWTA 3EBVA 5I3DA 1K4GA 3P4MB 5EBMB 4I0CC 4ZVJA 4PRWA 4OFYD 3EYOB 1HZHL 2XIBA 3DX6B 2YDSA 2VO8A 4PL2A 3FB6A 2VABB 8RUCA 1OB1B 4IJBA 5HY9A 4FERA 3BZ5A 2TSBA 4A05A 3QWOB 1HAUA 1QLFB 4PUBH 5J5RA 2RGMA 3BVUA 3RDTC 3NM3A 3U0TA 5ACLA 3GFZA 4PLOB 4Y4HA 1A5SA 2YPVL 3A47A 4FEIA 1OAJA 4XP4H 3GBLA 3H4GA 1U2CA 3LHAA 2QCFA 5BRZE 1S3KH 2EUZA 1AUSL 4U6XA 3UTZA 3N50A 1T21A 1A50A 3L1FA 2C9SA 1NDMA 3H9HA 4RLIA 1WWWX 2MNJB 5FAJA 3CFIC 1UR9A 2VLJD 5FJTA 3ZGHA 2WBKA 2XCMC 2BTMA 3QI9C 2RMNA 4BFAA 1D5ZB 4NBYB 4YE4L 5E6ID 2Z93B 4F0LA 5E2UL 4LPYA 1UQSA 1NWRA 4LLQB 3WLSA 5A69A 2AXGB 5ESAB 1DQKA 4QO1B 4PHXA 5KWYC 1N67A 2YEQA 4GFSA 2UVEA 1WUZA 1A1MA 1R46A 4ZZKA 1VFSA 2OXGB 3G6AB 3NSCA 3EWCA 1FGVH 1R3HA 1S9WA 3EOBB 2H4EA 5KSBA 4L1LA 4RLDA 4FQPA 1CBVL 1NCGA 1Z0MA 4LDLB 4K71C 3BO8A 4R3SA 2VERN 3TWAA 1AD9B 3LKPA 3TJLA 1CG9A 4IBVA 1SW3A 2UWEF 3WLWC 1M2OA 4WK4B 1BM3L 5F3BA 4WNQA 4IRSA 4CDHA 1R3LA 4B50A 1FNLA 3SPCA 3VWKB 2GSIB 3CXDH 5DHVA 4CN4A 2XZZA 3RI5F 5KZCD 2G3JA 1H5BA 3HE6A 3SE3A 3BUTA 1JNLL 4FFZA 2AEPL 5BRZD 4M1DL 1SJXA 3ARQA 4OF8A 1YSOA 4YVVA 4US5A 4EO5A 1MI5D 4L56A 2PEVA 2LT9A 4HAKA 3KPTA 2EG8A 4P2VA 1SUJA 2GK0A 4R5TA 2EO7A 1KIPB 3APTA 1A9BA 3MOAL 3RLHA 1HU8A 3CN2A 2QSVA 3KW3A 1ZEAH 2BGNE 3V0DA 4NOFA 1F41A 1I6NA 4O18A 1S7SA 3HMXA 3FB5A 1XKYA 5EMLA 4PRIA 5F6IC 4F3HA 2X70B 3VNKA 3U4EA 1RK5A 4I4WB 5GZND 4ZI8A 5BZDA 5BRZB 4F58H 1UB6A 3C52A 3UTPD 1TPXC 3MJYA 3MMUA 3LV3B 4CNIB 4UC5A 3OC8A 5GS0H 2X6CA 2IAMD 4Y4KA 2DQEH 5BPPA 3BG9A 1FNHA 1GPOH 3FQ4A 4TU1A 4N22A 5LVEA 5EU6A 4MRCA 4MNLA 1INDH 4HUNB 1PLGL 3AO0A 1N59A 4RKAA 2FYMA 1PFOA 4KQ3L 4AM0A 32C2B 1KCKA 2O9OA 2A79A 1WOAA 1FFRA 4XO5A 3NH7H 4PREB 4S3JA 1TZOA 4JTAA 1A7OL 2EDQA 1GMEA 5IJVA 5EOCJ 2IADA 1AXTH 4QXUH 2FSEB 1Z32X 5TH2A 1Q65A 2DYSB 3CVHL 1EEZB 4K8GA 2YS4A 2OX5A 2PTXA 4HUMB 1BXAA 1UGNA 2VC9A 4G7QB 3R18A 3VFOB 1B30A 2HK1A 2AITA 1OTSC 3QH2A 3T0CA 3TUUA 3TYAA 4IGBA 3NESA 1QUPA 4L05A 1Q1JH 3PWJB 5ANMA 4MNQD 4JTDA 4JGNA 2Z0UA 5MEPB 2R23A 5HHNA 2XIJA 1WDRA 1J87A 2DZPA 1JIBA 4JFPA 5FHAH 1ZLDA 1ESOA 3U6XA 1GY2A 1BJ1J 1YDVA 5HUPA 5I2IB 2DN7A 3GG1A 1U8KB 1UASA 4REQA 2NZLA 1W1ZA 1MXGA 3EXSA 3OQRA 4PV9B 5E70A 3ARRA 5IQ7H 5LSMA 2A6JA 4NNBA 3UO1L 3BUVA 4JXCA 3CZSA 4NM4H 3VXSD 3QNXB 4OCSL 2BO0A 5C2XA 3VKAA 3QE5A 3OAZH 2AZUA 4NKDB 2OCCB 5EPMA 4JQIA 3RU8L 1TR7A 1PYMA 4C56D 5DX7A 1YN6A 4HEME 4OIFA 3ZKNC 2F7RA 3SCMC 3IDUA 3N9KA 2EKCA 3I9GH 4FG4A 4X0KB 3SSJA 4Y8EA 1JCTA 2VIRA 3DKJA 4J4PC 2ZYSA 3CQ0A 1MELA 5CINH 5IBLC 5AVTB 3RBSA 5E5MA 4Y4HC 3NO3A 1AMKA 4CMHB 3TCXA 1S7TA 5JOFB 4MNHA 4J1UA 4WZHA 3AYTA 5IUCA 4Z7AA 2EILB 1P0DA 5D6CB 4BQ6A 3GSMA 3B5TA 1RCYA 5D7IE 1DXEA 3DXAA 1RFDL 4OJFH 1FPTL 4M7LL 1UG9A 1E4XH 2QKIA 1XZ0A 1H3WM 1K2DA 4N2MA 3HB3B 4UFJA 3NZHL 3TN0D 3FTWA 3SI9A 1ZAGA 3GNMH 5FFGA 2IPGA 2PTVA 3BESR 2ADFL 3RBGA 3I9IA 1R9XA 1EGJH 4PJAA 2LLLA 1N8OE 3IETA 2OLDA 5E1HB 5DQDH 1SVCP 3TV3L 1N5AB 4AC7C 4E0RA 3PHAA 5FEWA 2QCCA 1U93A 4LDCA 3BXNB 3USBA 3QXUA 4NU7A 1PVHA 2WLHA 3EX6A 4J3VA 3QCUH 2YAOA 1CDGA 2DF3A 3O3BB 5C9JB 1QPNA 1B4TA 7PAZA 1F2QA 3K4AA 3IJ9A 2AK1L 3GR8A 1J9RA 4IRSC 1UH3A 1RVGA 1QUNA 3N2MA 4U1NB 2G3XA 4AH7A 1FO0L 3V5HB 4DM1A 1NFPA 2CXKA 5KYYB 1XJBA 4JNXA 1H5BC 5DRWA 3HE6C 3SE3C 4MQSB 3PJWA 4L8CB 3L9BA 4LLYB 2O4MA 1GXEA 3IKKA 2GT9B 1HFUA 3WL1A 1OLLA 1PCXA 1F4YL 1NLDL 3IXAB 5DD0H 3H8AA 4HDIB 5D1ZD 1SLXA 4AX7A 5BW7A 5CSUA 1GOQA 2CKBL 1YCSA 3IMWA 4Q2ZB 1GTHA 1YNTB 4NRXA 1KACB 3H42H 1BYBA 1RD6A 1TPWA 3QMSA 3ABQA 1CC3A 5D7IB 3DETD 1A9VA 5JZ7D 2OTUB 4RX0A 4Y4KC 3CL8A 2JFCA 4A6YH 2IH1B 4L9LB 4JM0A 3UC0L 4NZ5A 2DYRB 1LMIA 4NWUL 1Y18B 4AM0Q 3H2OA 3T4YA 2C8NA 2FATL 3FN0L 1GWJA 2VAJA 4UNLA 3U2IA 5CM1A 4LRTA 1XAUA 2VDMB 5IB1B 2FK9A 3MXVL 2D0HA 4ETQB 3KBEA 1SY6L 4J3TA 1U92A 1UKTA 5CR1A 1U8PA 4NO5B 1P5UA 4OLXL 2R2CA 2NXYD 1GZJA 2RGSA 4WHCA 2FBRA 5HJXA 4H1ZA 4IQDA 1T22B 3UMTA 2CU0A 4FI6A 3VOCA 3MJ9A 4I18A 1CR9L 4OD1L 3HI1B 4JQ2A 2GUYA 4JO2H 1YECH 1PKOA 2B0SL 4JY5L 3NDYE 3D30A 1I75A 2ZYIA 2YBGA 5BXSA 4PAZA 3FS9A 4JAMB 4LCCA 3B83A 4HD5A 5G2HA 1MVYA 5H35A 2RFGA 4MXQC 5GVJA 5FKAB 5ETUB 3NYZA 4O17A 1Q94B 1OZUA 5SWSA 3M5XA 1MNZA 3PAZA 1ZWIA 2RTTA 1DXIA 1UZDA 5DRNB 4M7TA 4KUZL 5A6BA 3CM4A 3MLXH 5FM5M 1O6SA 5EEZA 2VMJA 2C5DC 4XGZB 5D72H 3MTWA 2J57A 3SBQA 4DWSC 3PABA 2H9AA 3U7WL 3EFDH 2XTJE 2F19H 1PCKA 3CXFA 1GRWA 2CE6A 2BS9A 4G6JH 4DK6A 1D6EA 1F4WH 4FNTA 4TVUA 2F53A 3PXLA 5K9OA 2YCLA 5I0DA 2CA4A 5I3JA 2RCSL 1SO5A 3F85A 3GBEA 3BISA 3L4WA 1U1UA 1L7TL 1FVDB 3A4AA 1BZEA 2J6VA 5A6TC 4DFHA 1MCPL 5H2BB 4TULL 1ETB1 1B4LA 4X8JB 1H6TA 3O6AA 5FYLD 3OODA 3K91A 1FGNH 2Q6WB 1B31A 4MSWA 5HGDB 4BSVB 4G6ML 4HUVB 1PY9A 1EFXB 1DUZB 1RSYA 4YDVA 1J5SA 1RMFH 2QKIC 3IIXA 3ZO0A 1P6FA 4KWOA 5A2JH 4PJFF 3GK8H 2BDNL 4JO3L 4OOZA 5ILTL 1DBKH 3MBFA 1ZPUA 7TIMA 2C0AA 4NFDA 4APQB 3QIWB 1HOCA 4OCLC 3RNQA 5HJYA 3UWYA 3WIHA 3ARTA 1CIUA 5DURB 4H0LC 3O4LD 2D03L 4HOZA 1NEYA 3VGAB 5IJCC 2WHKA 4PMEA 4U6TA 1OPGH 1XTMA 5FCUH 1IC7H 2WGXA 1S9XA 1UHVA 1BYNA 3K72B 3LH2L 3QPKA 1XX1A 2YW4A 1X5IA 3MTRA 5DEGB 1W3HA 1TVPA 2ZTKA 3W7DA 3IPWA 3GSUB 2OZ4H 4WCYH 4TVDA 4XMLL 3CZNA 4ODXB 4Z42C 2ZCGA 2H26B 1JDDA 3PHOA 5IM7A 5KYWB 3O45A 1FQ9C 2XTJB 2EDFA 3WENA 4G8EB 1EBHA 5J6SA 4AW4A 2JIXD 4AQAA 3GSNH 4ZD3H 4OFYA 3D3VE 1MW0A 3MO1B 1OD8A 2C3WA 3GH5A 5E4EC 1JWMB 4G7FA 3ULVL 2ODOA 2VDQB 3ZQWA 2DSZA 2WSRA 1WCGA 3LS9A 2XZCL 4MCYA 3DFSA 1LO3H 5ESQB 5T5FA 2PPDA 4QROA 1T3FA 3MROA 3UC2A 4F2EA 1DJQA 1FL6B 4P2OB 2GPTA 2VKZG 3UTQB 1O75A 4EAMA 3IU3A 1XGRA 4KZEH 1WUEA 3PUOA 3FT3B 2G60L 2HS6A 1CLOH 4HJSA 5BWFA 1SZRA 3PTKA 3BPCB 1RXLA 2P26A 3KCPB 2JQZA 2NLIA 1QHQA 2VLJA 1H15B 1DVFD 1FF5A 2YPVA 2GVYA 1FHDA 4YHIB 4BKSC 1S2CA 2HLFC 5K5YA 4Y4FB 5E2VH 4O5LL 5AOKA 4BQ8A 1QJWA 1VFBA 2CYGA 1MQ8A 2P8MA 3U1QA 3AG1B 3AQUA 4FHKA 3KWSA 1EJVC 4AKOA 1BZ8A 2CWXA 1P5UC 3W73A 3KR3L 5HYEA 1J8RA 1FNSH 2PC4A 2NY3B 1U5VA 3GHUA 3GHBH 1P6AB 2J6XA 1JXDA 3LEPA 1JDEA 2XVNA 1IE4A 3O4OC 4I18C 3QRHA 3APYA 1W9PA 4I9WD 3VE7A 3S3BB 4O12A 3VI4F 2C9VA 1AQ0A 4K07A 1FVEA 5DC9B 2VCCA 4KK9D 4LCCC 4DK5A 3D3VB 5JXAH 4HNCA 1PLBA 3AYVA 4JM2D 4Z7WE 4WFFE 4PRPD 1U8QA 1QTPA 4IIQB 3UVIA 2Z7KA 1TZGL 5E9NA 4RDVA 3OYXA 1MI5A 4PG2C 3ZT7A 3HAEA 4G43A 5GSVB 1Y0LA 4I7WA 2V3GA 8PAZA 1VADA 3QPYA 3F5WA 4ATWA 1T0NA 3WAJA 4YS1A 3L95A 1MRFH 1G7QB 3HZMB 3TBYB 3LHYA 4BZ1H 1XLIA 4XV0A 5GZNA 2G3NA 5I6LA 3CDCA 3QM3A 1T1ZB 2FHFA 3Q8EA 1B57A 3I6KB 3MBXL 4AVFA 3WLTA 3W83A 1FNFA 3QWQB 3H7LA 2IAMA 2Z4TA 1E9ZB 3KZSA 3L6FB 4OCYL 3SRDA 3EX3A 3FU8A 4YWGH 2GVJA 2VTFA 4FKKA 3OAZK 2CC0A 1JCNA 1U5JA 3IK2A 4B3LA 2PDFA 1LNUB 3L3GA 4TSCL 2CCLA 3X1NA 4XMVA 1RUMH 5F1VA 1B3OA 2A99A 3H22A 5CILH 3AU1B 4KFOA 2D2OA 5ES4B 4DO4A 3SKMA 5FYKL 2R1WB 3S0CA 2I9TA 2N0KA 1H60A 1WIOA 2P5EA 3W2NA 2CO2A 5BXRA 3RN6A 4RDBA 3EKCA 3RDTB 4PWHA 1IAIL 4B92A 4R3UA 2BZCA 3PTDA 3LD8C 2XXFA 1JQVA 2FX9L 3KLHD 2DQGL 3GYCA 4OTXH 3GLEA 2CK0H 2XWBA 3N42F 2FWSA 4Z3HA 4ORGA 4F24A 4KI5D 2K8QA 4MFEA 3ET9F 4KHTH 4AMKH 2DM3A 2Z65C 5FYKD 3U79A 1E3XA 3MV8E 5EIIA 2E6PA 3PY2A 4PLNC 1ONEA 5C0CE 5ICZA 5EFIB 1YNYA 2XH2A 4XNMB 3H7RA 2R14A 3QI9B 4S39A 4ANUA 2I56A 2EYTA 4PJEF 4Q4PA 2C16A 3I6GA 2O4EA 2CESA 4NXKA 4Z7WB 5IBUB 4P4KA 4RESB 3VTTA 4MNQA 4BGDA 3S1GA 5IF0B 5IBTH 4A7UA 3CVHA 3QRGH 1KW1A 4EOWH 4GY4A 1MFMA 2QUVA 2IOIA 1FUNA 5XIMA 3BZ4A 3BZFA 1OEPA 5F9OH 2QL1A 2VO5A 2F58H 4OCXL 4ZW6A 3ASNB 1N7KA 2MUCA 1IEWA 4U0QB 1E55A 2ITDB 1DLFH 4JPIA 5DUBA 2WOQA 1AMYA 4K71B 1QTYT 3WKMH 3WL0A 1SGJA 1I1RA 2A2QT 2XWCA 4XN1A 4H88L 4MZRA 5F88B 3V10A 2ISSA 3VXSA 1TQXA 4L1SA 3NQMA 2MJWA 3VYPA 4AK2A 4BWUA 4E5XG 4IBWA 5DJ2A 5J1SC 2OOGA 2E7FA 1ITXA 1SN5A 3CFDA 4C56A 3CUFA 1IJ9A 1KJ2B 1JXJA 1IFHH 4GRWH 4ZO7A 2ZVIA 1O5QA 1P0EA 3IACA 4LEFA 2BX5A 3MJWA 3MV8D 1N6VA 2IALA 3COTA 1CLKA 5LIUX 4NUPA 3KOXA 3T55A 3W75A 1PQZA 5F6IB 2BFVH 1GKQA 1UUOA 3SJ3A 4JG0L 5J6GA 1RJYA 1TPXB 3BN9D 3WH8A 3N5AA 1PD0A 2GJZA 3MV8B 5C2CA 3PS6A 5C0CB 4F7TB 3WTWA 4NENA 5BOEA 1HJQA 3TN0A 5E6IC 1Z89A 3W9DA 2G37A 2AXFA 2QKFA 3LKQB 3GMRA 3CAQA 1ZLSH 2C3GA 4O0ZA 1AZCA 4J3OG 1H2JA 3VIKA 3FQWB 1WDSA 3VIHA 3L4CA 3NACH 3V5KA 1AY1L 2V5DA 3JWDC 5C7VA 3ZBMA 5E23A 1OFQA 1N2RA 1KB9J 4D1JA 2A3CA 3D6GA 4ZNEA 4O1DA 3QW4B 4HC1L 2NDGA 3HRPA 2NY6D 2P28B 1NFIA 4KH2A 3KOWA 4NAMA 3EYFA 4S1RH 4BZ2L 5M3WA 2OM5A 4L3AA 2ZPKL 1GGOA 3SCRA 3U5UA 2WJDA 3VNDA 3FF7A 4MX7B 4GH3A 2XBDA 5FFOA 2V3DA 2AV1B 1OFDA 5CGYC 1V6VA 2F18A 1SFLA 1IT9L 2L8AA 5HHQB 3S8HA 4LLVA 1P4CA 1ZB5A 4GVHA 5A6AA 2NY5L 5I1EL 1MDLA 1LO2L 3L5IA 3LLXA 5C9WA 3DJZA 4R7LA 3FUHA 4H04A 4EXPX 2DEPA 4LRSA 3UNTA 1RJLA 1HL5A 2BC4A 3C0QA 1NBZB 4TXVB 3QB7C 1AP2B 4EKJA 3WEXA 5LN4A 3I75B 4E9XA 3BG3A 4WKXA 4KDTA 3FOKA 3MJ7B 3OXRA 5D1ZA 1FO0A 5C3IA 4JANA 5HPOA 2P24A 2JB5H 4U7KA 3QZOA 3CPGA 4JIEA 4JX4A 4AL8C 4HA1A 4H25A 3MRJA 4H2AA 1YEEH 5GZNC 2JBMA 3NCYS 1PS9A 5F3HB 4GZ7A 1C16B 1G7IB 1M68A 3GJFH 1YEGH 3UP6A 1HQRA 2G5RA 5A3ID 1KT2A 4WR3A 1HJXA 3ZKND 2IAMC 3WTUA 3RGHA 2BWIA 3ZWSA 4XAYA 3CWOX 2DZBA 2F1AA 2BSDA 3RNKB 3CL6A 3MUCA 2G2RA 2GSGA 1V79A 3T2OA 2O6CA 1VZIA 1BFOA 5AD0A 2OL3H 1UWYA 5TE4H 3FB6B 1JPST 3DENA 4GKTA 4PPTA 4LSRL 4F2UA 5HY9B 2DEXX 1VP5A 3ZDZF 1GHFH 4JUSA 1GOGA 3SCMB 4H20H 4ZXBA 5ITBH 2K7QA 1AS7A 4LSQL 4DGUA 5CLYA 3U0TB 4XO6A 4PRIE 4Y4HB 3E9AA 5I30H 1AJ0A 3EB3A 2JKWA 3S1UA 1EHXA 4U6XB 4KO6A 2WSPA 3CH9A 1B2WL 1T21B 1XH0A 3CNKA 3ZHLA 1SY6A 4QXIA 5T1JA 2CGRL 3GBMH 1L7IH 5ALBH 4AXWA 3MODL 3RX7A 1OZTG 4ZOBA 4IYKA 2DVUA 4XWOD 3A5FA 1UQSB 1AH4A 4LCVA 2GPZA 3W82A 4YXLL 2XWZA 2VR6A 1A1MB 1TJHH 2B2XL 1XR9A 4JN2B 5ITFA 1C9WA 4DGYL 4XCEA 5J5EA 5SX5H 4X9HA 4AEIH 4MCZA 1S9WB 1ITCA 1TO5A 2X88A 1T1YA 3KPRD 1K77A 3UL4A 1FORL 4OFDA 3IAGC 4DNMA 1I7TA 4S1SH 3ZWTA 1GGCH 3ZL4H 1MHEA 3GS4A 5E56A 2BP8A 3VNYA 3BO8B 4JS7A 4R3SB 2YDQA 5JQ9A 3MBEA 1D9KD 3LKPB 4US5D 4ZUWA 4RMUA 3LZNA 4X42A 3TZVD 3GEFA 1QR4A 3HNSH 3M07A 4IRSB 1JGIA 1BDYA 1R3LB 2D0GA 2BWDA 3BT2H 5DHVB 4Q74A 1H5BB 3HE6B 3S97C 5I8OL 5ANME 3RB5A 1EFZA 4PGBA 1MI3A 1BFTA 4H9MA 1EX1A 2GK0B 1U8JA 4HNOA 2J7HA 1IE7C 1A9BB 2ED6A 4N9DA 2DIBA 1Q4WA 3MYPA 4XB7A 4L8DA 1S7SB 4JLRB 5INCA 3FB5B 4KKRA 1F02I 4PRIB 4XD3A 1JGLL 4IMLA 4Z7VF 5IBXA 1JGDB 5EU6D 1SM3H 3U4EB 4PD4J 4DKFH 3ICJA 4HS6A 1GYLA 4JKPH 4MCMA 1ERNA 4KI1A 4PJCF 2I60H 3PBWA 2GHWB 4B9KC 3GZPA 2FLRT 4WWID 2H32A 1JPDX 4JY8A 4MA8H 4M5SA 3F2DA 4Y4KB 2NY0C 1URIA 1EAPA 2B59B 3SGDI 1JV2A 3TN0C 3NPSC 1X5FA 1QSZA 3AQXA 3MU7A 4LKCA 4AY1A 4DKEH 1KR1A 5DMGC 3B8UA 4HWUA 2AJSL 5GRVL 4NIRA 1ITUA 3OR7A 4G42A 4S3GA 4UQ3A 5DS1A 3HQ1A 3O4LA 4YVXA 3EB4A 4CCDA 4UF7C 2VLMD 2H7WA 1SSDA 1TB3A 4QXVA 3KWWA 3EOUA 4O4YL 5DQJB 1PL3A 4AM0B 4W7VA 3IJ6A 1K9EA 4MYXA 5D7KD 1UATA 1WZKA 4HA4A 1XVSA 2XV6B 3LS4H 2W4XA 4IGBD 1BQLL 3KPQA 5IJVB 3GKAA 1Q6OA 2IADB 4GQGA 3KCWA 4B5EA 5TH2B 4BA0A 3ZTNL 1OJXA 1M3UA 2CLMA 3WE6A 2VR5A 5IIEA 4XVTL 3QPXL 3ITXA 3DXAE 4XZMX 1OARH 3LZFL 3NABH 1TZ8A 1F76A 2X3AA 1TJIH 4N3TA 3M64A 2FTWA 2JIXA 2INEA 3B2XA 1GGBH 4BFIA 1RY8A 3PG9A 3CFMA 1N12A 5ANMB 2KQNA 3EO9L 2A5UA 1R3RA 4PJAE 3BHBB 2Y6TE 2R23B 5HHNB 1J05A 4ZT1A 5EZOH 3FS2A 3CJPA 1RZPA 2Y6SC 5D1ZC 1AGEA 3AABA 3EA3A 1YC8A 4REQB 4ERSH 3W1UA 4JRWA 2ZC8A 3OGCA 4FQHA 1HZKA 2Y23A 1NM4A 1T03L 3U9PL 2A6JB 1UADC 5JZ7C 2HWZL 3J07A 2B7PA 3RPMA 3DHJA 2DW6A 1RKRA 1HKKA 4DWSB 5I26A 3X3FH 4UT6L 1Q2SA 3QIBD 1QKZL 5FYJE 3TZNA 3AFBA 1D3HA 4MZ2A 5LIKX 4O4WA 1M6JA 4J3WA 3K4WA 1F2XK 3FU0A 4YX2H 1AD0A 1XFBA 2AQ3A 1UZ6F 3JSSA 3P11L 2C9XA 2EABA 4WI7A 2OZ0A 1XSKA 2VIRB 2NXYC 3B9AA 3K5RA 2PU0A 3DVNA 5F4WA 5E5MB 1S7TB 4MNHB 4J1UB 1MYRA 1Q0XL 1O9ZA 1OC5A 4YHNA 3P9LA 1ICQA 5CP3H 5KEZA 1E5NA 5C0RH 3Q45A 2JTYA 1THAA 3RWJA 3EKZA 4K94L 3DXAB 2BVOA 3VGHA 1PG7W 3CXHK 4FG0A 4NO3A 4ONGH 4D71A 1JZ2A 2QKIB 1XZ0B 1K2DB 3CT7A 4KZCA 3M0IA 1EWHA 3D4YA 4JM2A 5DD3L 3CLMA 4PRPA 3RA7H 4DZ5A 1GW9A 2PDQA 1ULVA 2MCPH 5ALCL 5K59E 4PJAB 3FU5A 4GINA 5I6SA 3IETB 3ZIYA 4P59H 3IXTA 4RX4A 2W9MA 3RPTA 3CU7A 4E0RB 1UIPA 3DBNA 1PWLA 1U93B 5DD6A 2QZRA 3TQKA 1KWKA 1FA2A 3N14A 4B5ZA 2K4WA 3MBEC 3B9NA 5KW9H 1XB8A 1CT5A 2R51A 3HA1A 4I1PA 3TF4A 2O4QA 2DD8H 1HEZA 4R96B 1QUNB 4GI9A 4H2HA 7PCYA 1N2VA 3S2NA 1BG4A 2YAQA 1I2QA 5CBJA 1BLNB 2NUPA 5AYQA 4DPQA 1RU9L 5DRWB 4MAYD 3STPA 1FC2D 2L7JA 4GEIA 5E4EB 1TTJA 5A6MA 3U9UA 3U2OA 1GOWA 4YQXH 4G6AC 4JRYD 5IOPB 4ZUVA 5SWSE 2GVLA 3GSXA 5HI5D 2XN1A 4BSWA 1Q7ZA 1OIOA 1F3WA 5IBXC 2CKSA 1UUMA 1BECA 2VC5A 5DUPH 3QTPA 4N20A 4HOXA 3MV01 1EJ7L 4IDLA 1ZSXA 2ZSVA 1OCBA 3BPLC 3Q0HA 4GUOA 2QCLA 3GR7A 4A7GA 2Y61A 2V5RA 4K9EH 2F53E 1NBVL 4NUGH 3T4YB 2PWUA 1KLGA 1LXMA 2DSVA 1VCGA 3NG3A 1V3KA 1N0XL 4NZUH 4Q6YA 4LESA 2PPFA 4Z5RB 5FI8A 4JRXD 2HPIA 2H5UA 1U92B 1ADOA 2IFGA 3WUGA 1P5UB 3MRGB 4LUTA 5C7HA 1JGEA 1UA6L 2XFXA 1ZCCA 4IKNA 4Y7EA 2E27H 4ZE4A 4HT3A 3VDBA 1U3JA 3U30C 4EWJA 3O4OB 1XBRA 4I18B 1OX4A 1A7PL 1UWSA 1F4XL 5FL0A 5AW4B 3VIIA 4AD3A 5SWSD 3EXRA 1W0VA 1OGAA 4LSTH 3ZE0F 4OSUL 2P4AB 3PAVA 4HJ0D 1W16A 5DEJA 3RHWK 4KERA 3S35L 4LCCB 5CXPA 2RDTA 5H35B 3ILQD 1I3GL 4EQ2A 4DKAA 5SWSB 4AITA 1ZWIB 4P8QA 1N0LA 2EKSA 2AANA 3ZXAC 2Y69B 1ENUA 2W9EH 4KGJA 1HSBB 1J1XL 4DVBA 3RMEA 3EJSA 1PBGA 4AIUA 3IIVA 1XBDA 3HG2A 1JGUH 4KQ4H 1SMDA 1T1WB 2FPVA 1FCUA 3JVGA 3FJ6A 3GJFK 3H2CA 4JGDA 3NL3A 4HK0B 4GISA 3KYOA 1P69B 4OY9A 1G9NL 2BMKA 4D9RD 2P8PA 3EOSA 2Z31A 2H9AB 1DVFC 4YHKL 1A0CA 2JLLA 4P2RD 3VOHA 1D6EB 2F53B 1L0YA 5K9OB 5DRZA 2YCLB 3OLIA 5I1IH 2EPKX 2E7LC 2XGZA 1BAFL 4Z1BA 3DX4A 1JXFA 3NIGF 2Z1WA 1EDTA 2Y62A 4UFIA 3U6XS 2YQGA 4FJ6A 2ZXBA 3FQYA 2B7OA 1M7DA 3SE4A 4H8WC 4WSKA 1JULA 2J88L 3NOIA 2RA1A 1Z7JA 3VVVA 1BXNA 3JT2A 1C92A 3UD6A 2YR1A 3N9SA 4ELMA 3GDRA 1Q66A 3BCFA 2P42B 4NHCL 3CLFL 4N0UE 3LD8B 4MSWB 2LQRA 1Z9PA 5JMOC 7FABH 3SDXA 5DO8A 2WUCH 2VLJE 3MLVH 3GU1A 2QPDB 1E56A 4HC1A 4C57C 3GG8A 7TAAA 3QQ1A 1OCQA 1HYSD 3UAAA 4Q4KA 2LOEA 3F1QA 4JM2C 4BZ2A 1HOCB 1E1EA 4JTCA 3DAQA 1DR9A 1DO6A 4H00A 4B4HA 1RY7B 1KCUH 4JFWA 3OG3A 2WN3A 4CVUA 2Y7NA 1XQLA 4G8AC 1TPH1 5D9SA 4HPXA 5SX5K 1AW5A 5CBBA 3DV6A 2F7OA 4JGJA 4YSOA 4IEFB 2E9WA 1FWBC 5D7SL 3APNA 5A6SA 4N6QA 5IJDC 2GBTA 1SUXA 3O0KA 3PHOB 5IM7B 2K6YA 3S2JA 3O45B 5BVPL 4AF0A 2ATMA 3STEA 4ZUTA 3KZ8A 1FZOA 3N40F 4AQAB 1MJUH 2IBGA 4I87A 4PB4A 1PIIA 1W9UA 4M29A 4AEFA 1CE1H 2NZ9D 1FLTX 3LTPA 1Q7MA 3TNNA 4X60A 1MI5E 4DO7A 3PN8A 3QMTA 3IFLH 2EDWA 1EMTL 1UEYA 4MCYB 3MROB 2FEEL 2GYSA 2DBJA 3H3PH 1IGFH 1ZV5A 3RAJH 1XGRB 4N0UB 5G2NA 1ITQA 5DR5L 5CLZA 4QHRA 3UTPE 3KLHC 1JBJA 4M3KB 3ANYA 4KI5C 2AXWA 1IC0A 2DSWA 2RHGA 1GTFA 4DF0A 2WLIA 4YAQA 3N2BA 3SGEH 2VLJB 1KIQB 4DGIH 1LBLA 5E6IB 1IVTA 1TO4A 5E0FA 5F2GA 1VFBB 3ZLHA 4MXWL 1ACCA 3CFEA 4FA3A 4H8QA 4JFSA 2ARJA 5CBEA 4TNVF 4LMQI 3RWGA 5LAXA 3DUHA 3MRCB 2MPVA 3S36H 1XIGA 1V3JA 2AEQH 2JK5A 5D2NA 1LT8A 5CGYD 3KPRA 5LXGH 3PGDA 5LBSH 4YUEL 1LMKA 2R0LL 1ISXA 4F9PA 4JDZA 3QNZA 1KXHA 4Z7IA 3A6CL 1JYNA 4RWHA 1D9KA 2UZ9A 5EV7A 1OSEA 2N56A 3DFOA 2WCSA 3MRMA 1C5BH 3TZVA 2EE3A 1BW8A 1HTYA 4M7LT 4HA0A 5CJMA 3N43F 1W6TA 3H70A 5D1ZI 1FVEB 2INFA 4FB7A 2VEFA 3NIYA 3RPDA 3PXJA 5I0VA 5KZCB 4IHBA 3VE9A 4I0KA 4MBOA 5D4IA 3QHFH 1U8QB 4MNQE 2A5HA 2I9LA 1MI5B 2P3YA 1HJSA 3HAEB 4RGMC 9XIMA 3IVSA 4G43B 1Y0LB 3ITVA 4EQ3A 3RIAF 3AZRA 1VADB 4WGXA 3F5WB 4J39A 1T0NB 4FQXD 3T6WA 1A6AA 5HNTA 3B3DA 4GY7A 3O8AA 2KS0A 1FOBA 4IGSA 1WFOA 5A6LA 5CLWA 1B4JL 1UWGL 1RUQL 4X4XA 1RZKC 2NT1A 1ZJHA 3N1MC 3NCCB 2P88A 2XLLA 4I85A 3JVGC 4YU1A 4KFPA 2QW5A 3C8HA 3BN9C 3CZEA 3B5HA 2I27N 2IAMB 3SOTA 3VXSE 2Z31C 4A35A 1CURA 2P5ED 1XICA 1H8NA 1SJHB 3M0HA 1J9QA 4XPTH 4PBXA 2P76A 4I9JA 4W9EC 4OVXA 4C56E 3L3GB 4Y89A 2CJUL 1Q2RA 3HHSA 1WWBX 4EBQH 3SKMB 3SE4C 3IGUA 1NSJA 3WJZA 2A2IA 1WGOA 2NY6C 2IGLA 3W2DL 3PAUA 3S8GB 2VT0A 4Z17A 5AB0A 2QVFB 4PRHD 2GSHA 4AQ1A 1X4XA 4P4KD 2BY2A 3JWNH 2IPKB 3QHTC 3HGOA 2XWBB 1U33A 4JBSA 4ORGB 3MI6A 1N3NA 4NZTL 3HCVA 1E8YA 5LHFA 4POYA 5EIIB 4Q8MA 2DM2A 2R1MA 1JAKA 4DPAX 5ICZB 1UWQA 3QEZA 2EYTB 3ONCA 4IXXA 1T83A 3AQZA 3I6GB 1WDWA 3T40A 5ADPH 4OQTH 3KL0A 3I74A 4MNQB 4CNNA 3QP3A 4AWJC 3F7VA 2DB8A 3WJWA 3Q8FA 1RJCA 5HQEA 2QKSA 1S5NA 4AEHL 4ZNEE 4M6VA 1UYWL 2NY5C 3VDCA 4Y9FA 4YBLC 5DY3A 4XP1H 1Q38A 1KBVA 1EL3A 3MUGA 4LEOB 3FVDA 5E0QA 4JPIB 1ET8A 5DUBB 3OWEA 5A3IC 4MTVA 2P80D 4KUCF 1NM9A 1E1FA 2V17L 4LMQE 2E1WA 1S5MA 4XX1E 3EMCA 3VXSB 4DXKA 4BH7A 3AS0A 3W26A 2IQAA 3DKLA 3BLDA 1ZANH 1TIUA 1BMGA 4PJGF 2HFEA 3E6HB 35C8H 3QIBA 5EMUA 4GI4A 3RCYA 2QIWA 1E90A 4C56B 2X6UA 4HOMA 1OGSA 1BX2A 2Z9TA 2B0MA 5I1CL 1R3TA 3VCCA 3O9NA 4C6FA 4YHZH 3LEXA 5SWQA 3TO4A 2IALB 2NY0D 3AIQA 4UT6A 3T2NH 4ZFCA 1TJGH 1P1VA 1EPXA 1PQZB 5DMGD 3E3QC 1OTUD 3JYBA 2R2BA 1PG7L 5J6GB 2QELA 4UFLA 3PZGA 1IKFH 4DESA 4XPAL 4J5NA 2ARJQ 2GJZB 1B90A 3L08A 4ZW8A 2NY0B 4XWOC 4NENB 1M03A 3TN0B 5M17A 1BVNT 3NPSB 2OX1A 4YZFF 1W3IA 1BWVA 2B81A 1XCTA 3W9DB 3MHGA 1XYBA 3SECA 5FUZL 4W4NA 1UXSA 5IFPA 3TM6A 2X7LA 4Q8VA 1ZT4A 4OM1H 2CPCA 2YYTA 4Y19D 3JUZA 4HJWA 1E4WL 3UTTD 1N2RB 4YTSA 3D4GA 2OZTA 1ISZA 1X6LA 3ULAB 5D2NC 3A24A 2E7MA 1JZ5A 1NFIB 3CZLA 5FAGA 3EYFB 2V6HA 5J5DA 3QCTH 1I0DA 4F2MA 2UVFA 4MLIA 1GHSA 4O8AA 1N7MH 1D9KC 3OVRA 3CUHA 3RY4A 4Q8WA 1CTMA 3LMZA 2XACC 3TZVC 3O6MH 4JO4H 5A6JA 2Y6SD 3S2MA 3L0NA 2Y7SA 3FBKA 1WDQA 5FF7A 4LLVB 5DRXA 5KVGL 4JDEA 1MF2H 4JPKL 1O7AA 4MAYA 4UTBA 5E94A 1RJLB 2BC4B 4FYTA 1BQCA 3OPSA 4JRYA 4JE4B 3WEXB 5BOPA 1NAKL 5CFAA 4L29A 5D1ZB 1FO0B 4MDIA 4JANB 1D7CA 2P24B 2GJNA 1IBHA 3M0LA 1IF2A 2DT0A 4H25B 2RH9A 3MRJB 3U0WH 1QBLL 4M3PA 2VW6A 4DUVA 1HQRB 5FPIA 2J1KA 1KT2B 4IIHA 3CDGA 1AQDA 4YYFA 2UY6A 3H7VA 1TSIA 5I16A 2BIQA 4EZJA 4ZXBD 2C1OB 4GI6A 2G2RB 2GSGB 4P5MB 2PDCA 2EPHA 4DKTA 2BVDA 5IVXF 2JFEX 4RISH 5AD0B 5B39G 5K9KA 1XHHA 3HHRB 1FP9A 1ADQL 4JRXA 5IHBA 3C0JA 2HRLA 5JHLA 4RDQF 1IBYA 2NXYB 3WV0A 4IGBC 1A7BA 1KTDB 1VLWA 3OAWA 5FYLE 5BOFA 3N2XA 4AQ1C 1G0DA 2O5ZH 1B0IA 5JMRA 3W7HA 1A02N 4ZSUA 4OF0A 2I24N 2CIKA 4HGWA 4RRPA 3UJRA 4NKIL 3R8QA 4AXWB 2DU2A 4MDPA 4M7JL 4ACTA 3OZYA 3O6CA 3LQMA 1H9DA 4YLWA 3B4UA 1A7QL 3UYPA 4J5VA 3WUWG 1KCSH 4B27A 1JPKA 1Z9SA 1E15A 3U4BL 3MBED 1OF8A 1RZQA 2YL8A 3O4LE 2OBGA 1EP1A 4EUPH 4AZ8A 4Z78A 1XR9B 5ITFB 1NPJA 4XCEB 2WXPA 3A3YB 4MCZB 4YMPA 4IJ3C 2ZE0A 1LO0H 3WY2A 4J3ZA 1OINA 1T1YB 1YNLH 3GNDA 4Y9BA 1I7TB 1TWSA 1U6AH 2R29H 4HK6A 3TEYA 3FTZA 1MHEB 1IT0A 1VFFA 1DQQA 5E8NA 3MBEB 3WJSA 3MZTA 2E6QA 1KYOK 4G6AD 2CDFA 4ZUWB 4PHZA 2J1WA 1N10A 1OYBA 1F90L 1KB5L 4KZDH 1UZ1A 1K4HA 4P2RA 2XFFA 5BU9A 3QIBC 4KROD 1QNQA 2VP8A 3WJXA 3RFZA 3B56A 3F6LA 1IYXA 1FYTD 4PGBB 1CU4H 3Q9QA 3PPEA 4WXYA 3SDYL 3EOTL 1UWFA 5E2WL 2VELA 3TYGH 2JCWA 2MKLC 5KTLA 1EXBA 3W28A 3QOKA 5A94A 3WFDL 2CR0A 3ESUF 2JF1A 1IAII 4B3ZA 3FUDA 5GJSH 1KFEA 4XMPL 3O2DH 1INEH 4IBZA 4UTAH 4HS6B 3BW2A 3G9VA 3V9CA 1O1HA 7ENLA 3BPLB 1L9WA 2AJZA 2J88A 4GYPA 1EAPB 3P67A 4BFNA 1JV2B 2C3HA 3D2UA 4LKCB 2X2YA 4PL1A 3OR7B 4G42B 3T2PA 3W85A 1Z3RA 4UQ3B 1KM1A 5DHEA 5JQ6H 5I6MA 1DWAM 1MFNA 2QADD 4W68A 1IMHC 4JO8A 3O4LB 4AT6A 3ZKXC 4XCYA 3I68A 5GGTA 2O6EA 3GFXA 3KWWB 2LHAA 1V5XA 1US0A 3WFEH 1SVDA 2R24A 3NSXA 3FLUA 3LZQA 3W70A 5J1AA 1JN6A 1SLUA 1K4DB 4Y9AA 2XXCB 1IGJB 1PZUB 1IQWL 2PCPB 4EZMA 3I50H 5CUSL 3WE6B 3U30B 1CL7H 4TNFA 1BQHA 4I9WE 5IIEB 3V4PH 1SQ7A 5ICXA 2WZ5A 4HD9A 5BW7C 5E2TH 3PJTA 2JIXB 2V2TA 3FO0H 1IC5H 2L7EA 1LDSA 4MAYC 5EF1A 2GOUA 4YLBA 4PRPE 3EB2A 3ULVD 4J3BA 4P2QD 3N34A 1G94A 3EJTA 1J05B 5KYUA 1OT1A 5HI5C 4F1ZA 1AGEB 4QRSA 4HYRA 3LI0A 1N8ZA 2HBXA 2NCEA 3H9ZA 2Z2UA 2VXQH 3R19A