3AJ7A

Crystal structure of isomaltase from saccharomyces cerevisiae
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
586
structure length
586
Chain Sequence
SSAHPETEPKWWKEATFYQIYPASFKDSNDDGWGDMKGIASKLEYIKELGADAIWISPFYDSPQDDMGYDIANYEKVWPTYGTNEDCFALIEKTHKLGMKFITDLVINHCSSEHEWFKESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSYFGGSAWTFDEKTQEFYLRLFCSTQPDLNWENEDCRKAIYESAVGYWLDHGVDGFRIDVGSLYSKVVGLPDAPVVDKNSTWQSSDPYTLNGPRIHEFHQEMNQFIRNRVKDGREIMTVGEMQHASDETKRLYTSASRHELSELFNFSHTDVGTSPLFRYNLVPFELKDWKIALAELFRYINGTDCWSTIYLENHDQPRSITRFGDDSPKNRVISGKLLSVLLSALTGTLYVYQGQELGQINFKNWPVEKYEDVEIRNNYNAIKEEHGENSEEMKKFLEAIALISRDHARTPMQWSREEPNAGFSGPSAKPWFYLNDSFREGINVEDEIKDPNSVLNFWKEALKFRKAHKDITVYGYDFEFIDLDNKKLFSFTKKYNNKTLFAALNFSSDATDFKIPNDDSSFKLEFGNYPKKEVDASSRTLKPWEGRIYISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of isomaltase from Saccharomyces cerevisiae and in complex with its competitive inhibitor maltose
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords Oligo-1,6-glucosidase
total genus 231
structure length 586
sequence length 586
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2010-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3aj7A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3aj7A01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3aj7A02
5M03A 3VD3A 3L4XA 5I23A 4ZEPA 1PIFA 2PWDA 3A21A 4LYRA 5I77A 2W91A 4HZ8A 1TA3B 2XGIA 2YLAA 4AMCA 3VDHA 3M46A 4HTYA 3WQ4A 3TV8A 2PWEA 3ZJKA 2ZX7A 2ZUVA 4PTMA 1XCWA 4MNMA 4WSJA 5ABFB 2EJ1A 4EAMA 1R46A 1CLXA 4CD4A 1JZ3A 2D73A 3BLPX 4RL3A 4C7GA 3WQVA 2UY4A 2W67A 1QBBA 2YKKA 3BVVA 1UUQA 3EJQA 3HG2A 4JHZA 3T09A 3T2QA 4LGXA 3VNYA 1QNOA 3CUFA 3MSDA 1UHVA 2BS9A 1JDCA 1MW0A 2CKRA 3BLKA 3WDRA 4MDOA 4JFTA 1ISWA 1H5VA 2WK2A 4P8VA 1KCLA 3K46A 3FNDA 3WY1A 2YFNA 4GI8A 2XWEA 5C8BB 2CCRA 4QDMA 3EJPA 3GXTA 1EQPA 3QR3A 4JFUA 5I6SA 4ZE5A 1UKSA 4MNJA 4TTUA 4ZXLA 4JFWA 2W63A 5CQ1A 3PZTA 3WMCA 5HDRA 3KL3A 2VI0A 3MV11 3U5UA 3N11A 3UG3A 1G5AA 2JFEX 3VD5A 1QX1A 3VSTA 1DWIM 4GIAA 1LLOA 4MADA 3UR8A 4H8VA 2PWGA 5LA2A 1PPIA 2AMGA 2DSZA 4ZFMA 3F5JA 4KGLA 4LYPA 5A2BA 4CUCA 1ISVA 1E6SM 5D9OA 1ZJBA 1XD1A 1XYZA 1TMQA 1R75A 1B9ZA 3ECQA 2CETA 1JYNA 1MXDA 3RCNA 3IGUA 1MFUA 4PTXA 3SCVA 1GOOA 2OWXA 1WO2A 4W93A 3A24A 1HJSA 5D4YA 3AXXA 1QW9A 4X0VA 2Y2WA 2WVSA 2EPKX 2JALA 3VIIA 4UFLA 1C8YA 1GQJA 4B3LA 5EMYA 3W38A 4NZJA 3RM4A 1OM0A 4IPNB 1AVAA 4HOZA 1XYFA 1LWJA 2E8YA 5I0DA 4KWUA 4PRWA 4UFHA 1V3LA 2WCAA 4OKDA 1FFQA 2YOCA 2V5CA 3AICA 2X09A 3WH6A 1VBUA 3PTKA 3KEHA 1ZS2A 3K1DA 3OG2A 4D6GA 3WH7A 3CMJA 5ABEA 2Z1SA 3GBDA 3ARQA 3LXAA 5EFFA 8CGTA 1GQIA 5A6LA 1US3A 1BVZA 1KGXA 3PTQA 1V6WA 1CZ1A 1UQYA 1UR4A 5GNYA 1E0WA 3HG4A 3AIVA 4GI9A 1EGZA 3SURA 2YDSA 4PUEA 1W9UA 3ARXA 3CHCA 3U57A 2X1IA 3O6AA 2NT0A 2DGAA 2VX6A 4ZXOA 1QHZA 1SR0A 5A8PA 4W8AA 4GINA 4LX4A 4HMDA 4UQAA 5IFTA 4PMYA 3SUUA 5M3WA 3EJTA 1JXKA 3EJSA 1XCXA 1WZLA 4Z2HA 4W8BA 4CVUA 3W25A 1G1YA 4EKJA 1LF1A 4JCLA 2CNCA 1U2YA 2EPOA 1ZBKA 2VQUA 4C7DA 2VRKA 1HJUA 1LJYA 1JI1A 4YPJA 2WHJA 4ATLA 1XRVA 2RGMA 1BHGA 2QF8A 3RO8A 1JFXA 1PS3A 1VENA 3SCTA 1E6QM 1C93A 1CXHA 1MQQA 1QWUA 1YQ2A 4OOUA 5HOSA 1JD9A 2ZXQA 1B30A 4PTWA 2J7DA 4J27A 3RIKA 3A3HA 1E4IA 2VL4A 1QWNA 1VFOA 4BS0A 2YFOA 4AZ7A 2ZIDA 4W87A 4E8CA 3SUSA 1C3FA 3VIOA 2WMGA 4AD5A 1C8XA 2OYMA 4ML4A 4BCEA 5E09A 1MW3A 1J9YA 5A94A 3OGVA 5CZKA 3SCPA 5EFDA 3KLKA 1V6YA 2ZX6A 5BCAA 4FNPA 3B9DA 1EOMA 4EANA 4Q22A 3AQUA 3UESA 3AS2A 5IXEA 2J25A 3QHOA 3CH9A 2J7EA 2XFYA 3FAXA 3UG4A 1Q4NX 4W5ZA 3CZSA 4MNKA 1NWRA 4GO9A 3PZQA 2F1BA 2FDMA 3HJEA 3WH5A 4GI6A 5JBEA 1WKYA 1K9EA 2JF7A 3CUHA 1XGZA 1GHRA 2W5FA 3BVTA 3POHA 3TP4A 3A47A 2XVGA 5JBFA 1QBAA 2NW0A 4UFJA 3DX2A 1GONA 1BG4A 2GUYA 4RE4A 2EAEA 2DEPA 2BVTA 4FNSA 2WMIA 4XZBA 1HWWA 1OT1A 3LPPA 3AHYA 3SCRA 2EBNA 2EACA 3BVUA 3VGDA 4CD8A 3IANA 2WVVB 3GH7A 1OD0A 3BAIA 1KXVA 3WEOA 5CJ5A 3WN6A 1H0GA 1JYVA 3LMYA 1A47A 4W84A 3K8KA 1NP0A 1UR9A 3EDKA 3OIHA 2X2IA 3WDJA 3A5VA 4YN5A 4B16A 5E9AA 4PMUA 1OCQA 1WP6A 2WCGA 3BUIA 1M01A 3CZJA 1V3MA 1GUVA 1MVYA 1UR1A 1VRXA 2QPSA 3GXIA 1E70M 1J0KA 1GJUA 4NZCA 2YDQA 1J12A 2VRQA 4NSBA 4JFVA 2GJXB 1V08A 2WC7A 4WK9A 4AZCA 1J0YA 3D50A 3I3DA 1D2KA 1UWUA 2Y5EA 2DDXA 3EDJA 2CEQA 1WDPA 1TE1A 1GQKA 1W32A 1NWTA 1CECA 1K6AA 3AHXA 1TFVA 1WZAA 3BUDA 2O9OA 3KL5A 3IAQA 5JBDA 2YDRA 2D22A 1UWSA 1OWQA 1XH2A 2D2OA 2CBUA 3HG3A 1W1TA 4Z2KA 5IHRA 2DPEA 1ISYA 3AIRA 7TAAA 3W0KA 3DC0A 4V27A 4P8UA 2ZXBA 3BC9A 1GOIA 1M03A 1QHOA 3LPFA 1TCMA 1GCYA 3DX0A 3AZTA 2J7GA 4D6DA 2UY5A 3TTSA 2EPMX 1C92A 1DWGM 2O9TA 2FHFA 4LYQA 2J62A 2FHCA 3GNPA 3BMVA 5JIWA 1HP5A 2WHKA 1E43A 2Y24A 3S5ZA 4ZENA 4FLSA 5ABGA 3A4WA 1JYWA 3WELA 1OSEA 3SUWA 1J0HA 4PEEA 1W9PA 1U33A 2ZXAA 1UKOA 3ALGA 3IK2A 1CNVA 2ESCA 3WD0A 4RE2A 3T0BA 3WFZA 1ITXA 3SCQA 1GW1A 3OA5A 4CCDA 4NI3A 1HT6A 3N1AA 1OINA 1LQ0A 3RMEA 3WIJA 2YA0A 2VRJA 4XB3A 3D4ZA 1GVYA 2J78A 2BY1A 3DYMA 5BYWA 1B3VA 2ALWA 5D8ZA 1V3KA 3ZR6A 2GSJA 5JIPA 1ISZA 4BQ3A 1GOKA 3MANA 3BMWA 2J8FA 4HP5A 3QGVA 3A22A 1HF6A 2XVLA 4PCTA 3AMLA 4JL1A 1B3YA 3ZJ6A 2FH6A 4U2ZA 3U7BA 4F79A 3VSUA 1JYXA 3AS3A 1X1NA 3VGEA 2X0YA 2C7FA 5I24A 3EDEA 1G94A 4MDPA 4NRSA 2XGBA 1CTNA 2J4GA 1AQ0A 5DO8A 1HKKA 1WCGA 4DO6A 2VQTA 3CMGA 1QNQA 4MAZA 1B3WA 4CCCA 3GNOA 4PMXA 3GM8A 1MQRA 3VM5A 2WC4A 4GO8A 4LQ1A 2XG9A 5E6ZA 3T0DA 1H41A 3MSGA 1NOUA 4UR9A 1GORA 4FF5A 1WNOA 1DWFM 4BQ2A 5ABHA 4HMCA 5E0FA 2ZX5A 3TOPA 1UWTA 4FMVA 3W82A 5E70A 4JFSA 4PYSA 1UR0A 4D1JA 4IM4A 1AMYA 3UR7A 1LL7A 2GJRA 1V3HA 5M5DA 5GNXA 5GQBA 7CGTA 1TQSA 3OGSA 3DX3A 3H53A 4X0NA 3VDBA 4TVDA 3W4RA 1J18A 3WF1A 1CXKA 3TONA 1HVXA 2BY3A 1MXGA 3D52A 1GOMA 1Z32X 3IJ7A 1R85A 4TX8A 4PMQA 4PMRA 1CLVA 1UD4A 4OGZA 4WKHA 4GZJA 4S3JA 2VT0A 1QI4A 1FOBA 1QVBA 5A8MA 1YHTA 3WDPP 3KL0A 1E5NA 2CHNA 3VIFA 5A2CA 3CUJA 4FLQA 5AYIA 1EOKA 2XM2A 4D6HA 3AIUA 1H4PA 4Y7EA 3OGRA 2VNCA 3VPLA 4FNQA 3W6MA 1MW2A 4KRTA 5M17A 3AXIA 4J28A 3ZIZA 1J0ZA 3H55A 2CITA 4URIA 1WZMA 5HXMA 3N18A 4W85A 1UWIA 4UCFA 3MI6A 3FN9A 1EIBA 3O9NA 3WNKA 4D6CA 2PF0A 2VO5A 4NZFA 4NRRA 1JI2A 2V3EA 4HPHA 4D1IA 2VX7A 3KE0A 4ATDA 3CUGA 2J7HA 1VFUA 3DX4A 3BUBA 3VINA 4M81A 1SYTA 1RP8A 3SEPA 2UY3A 4CU8A 2WLYA 3RILA 3ARZA 4ZE4A 3D51A 4CN6A 2D3LA 5KZ6A 3WEMA 1NP2A 1CENA 2BNJA 4HZ6A 2ZOXA 4LXFA 2W92A 1KFWA 2CBVA 3VVGA 2YL6A 5EB8A 2BHZA 5HPOA 1UWQA 3WSUA 2OSXA 1E72M 3OZPA 3WDIA 4CKQA 4JKKA 2CHOA 4V28A 1CGVA 2G3MA 2BV9A 3MUIA 3WQWA 1KB3A 1FP9A 4MTVA 2WZEA 5CLWA 3EJUA 3WNPA 3F4VA 1XHGA 1HTYA 2YLLA 4B9YA 3BCDA 3THCA 1BF2A 2GK1B 3EMCA 4XZWA 4TVCA 2XYLA 3ARPA 4UOQA 1XH1A 1ZJAA 4IUGA 2A3HA 1H11A 1W9VA 3AOFA 3POCA 2E9MA 1DWHM 4F9DA 4UOJA 1MWOA 3NDYA 1M04A 3THDA 2F61A 1R87A 1CDGA 2EQDA 1C7SA 3PZMA 1JZ6A 6TAAA 2GVYA 1R7OA 3VDAA 1UYQA 2ZICA 5HNNA 3WQ5A 1F4HA 1OB0A 3WL0A 1ODZA 4BQ5A 4AZIA 3GBEA 1E73M 1VJZA 2V3GA 5CG0A 1J11A 4CD5A 1WPCA 1H0IA 3OLGA 3HN3A 3CZEA 1KGUA 3AXHA 3VD7A 1KWGA 4OOZA 3FHQA 1I75A 2F2HA 3RDKA 1NARA 3SCNA 1V3JA 3UETA 1UD3A 4ACYA 1UWRA 3VX1A 4QCEA 1HKJA 1XSIA 4P8WA 2YL8A 2W61A 4M24A 4P7QA 4TUFA 1EO5A 1C8QA 3VIHA 2V38A 2V3DA 1E9LA 2BXZA 1IV8A 4AYSA 1VF8A 4R5EA 1HJWA 5A6SA 2DT1A 1HL8A 2WSPA 3ARRA 1E55A 1UH3A 2ZX9A 3WMBA 1W2VA 4F9JA 1EO7A 2BHYA 1E1FA 1MYRA 2XWDA 2WHLA 3AIEA 4Q7NA 3QHNA 1E4MM 4HU0A 1QI5A 5BRQA 2YBTA 3WD2A 2BFGA 2NT1A 1K9TA 3ZJ8A 3BAKA 1UD6A 4W89A 3FHAA 3LPGA 3PHAA 3A4AA 4UZUA 2XJ7A 2EXOA 1W3KA 3MU7A 3BAXA 1J0IA 3ZT6A 3QOKA 1JF6A 3PZGA 2ZUWA 3N12A 2XM1A 1UKTA 1W9BM 2XFFA 1UR2A 3MUY1 3OB8A 1PIGA 3VDCA 3WF2A 3SIMA 3MMWA 1TR1A 3WNNA 2JEQA 3WNOA 2JEPA 4IISA 1TVPA 1Y7VA 1W2PA 1UD2A 4U2YA 3DECA 2ZWZA 2W4XA 3BUQA 4GXPA 4A3YA 2XUCA 1HKIA 3AHZA 3CLWA 1R34A 3A23A 3KZSA 3VD4A 1E6ZA 1H3GA 4AY1A 5BXTA 3ARUA 1EDGA 3L4VA 2EPLX 1MQPA 1V0LA 3ARWA 4M80A 5A95A 1FHDA 2A3BA 3CTTA 1V03A 4AZ5A 3K8LA 1DHKA 3SCUA 1KGWA 2JIEA 3WF4A 2CYGA 3AMGA 3L4TA 3DYOA 3MV01 2E9LA 8A3HA 4PCSA 2VMFA 1PZ3A 3N04A 3VGHA 3VM7A 2F7PA 2X0HA 4UQDA 3DDFA 2XIIA 2BVYA 1UOKA 1W1PA 3SCSA 3CZNA 1CYGA 1UD8A 3GXNA 3AHTA 5E0CA 4AISA 1HKMA 3WMSA 2J7FA 4ATWA 5D8WA 1QI0A 4UQBA 4GQQA 2VCAA 3OLIA 1G01A 3VGBA 4KGJA 5FOOA 5FKYA 1LWHA 3VILA 1FH9A 2D24A 2WM0A 4N0RA 4TOQA 4CN1A 3VTRA 3QHMA 1Q6FA 1E4LA 2WVUA 3BSHA 2OSYA 4QLJA 2DT0A 2E40A 2DSVA 3MMDA 5CPSA 3WBAA 4OBSA 3LXBA 4X9YA 2VVNA 4K68A 2C8NA 3VMPA 1UA3A 2DSKA 3ZR5A 1VAHA 2O9RA 3BXWA 5A6BA 3ALFA 1BYBA 4TVUA 2WVTA 4JCMA 5AYBA 3AI0A 4AIEA 1V3IA 1I1XA 1XSJA 3OBAA 2VTFA 3AMCA 1CXFA 3GZAA 2J47A 2EEXA 1O6IA 2WPGA 3K8MA 2DIEA 2XSBA 2X2YA 2WSKA 4AZ6A 1UG6A 1BFNA 3DDGA 1IT0A 1JNDA 2EADA 4H7VA 2CKSA 1KBKA 2ZX8A 3UG5A 1R8LA 3W27A 4AD3A 5CLTA 2VZVA 4GZEA 4AWEA 3ARSA 5IHSA 1KTCA 4CN4A 3T08A 4CD7A 9CGTA 5C70A 1QW8A 4MB3A 3CZLA 4QCFA 2YL5A 5I3DA 2F7RA 1E6RA 4Z2JA 1E56A 2G4FA 2A3CA 1VEOA 2G41A 1TQTA 2FGZA 2Z1KA 1XSKA 1RD6A 4DM1A 4TX6A 3BH4A 2WW5A 5FD0A 1CGWA 4IPLA 3CC1A 5C71A 5A1AA 3VIGA 1K9FA 2CXGA 2WMHA 2PB1A 3NJ3A 1PX3A 4AW7A 4P7RA 3T2PA 1JZ2A 2XHYA 5JUVA 1ZBVA 4CVWA 5BROA 1HX0A 1U30A 2ZUUA 3IAPA 4NXSA 1V02E 1V6UA 2VCCA 4PMVA 2VX5A 4L4PA 1SZNA 2F7QA 2O92A 2YJQA 3NCOA 3UERA 2AOSA 1PX4A 4QAWA 4HU8A 1JL8A 4AIUA 1NH6A 3B8SA 2BVDA 1DEDA 1R7AA 6A3HA 1KBBA 1E0XA 5CSYA 2JF6A 3DHPA 3EJRA 2X2JA 4CD6A 1PZ2A 3ZSTA 3ZMRA 1VJSA 3BAYA 1OBAA 1UR8A 2OW7A 3PBGA 2A3EA 3U7VA 1BYCA 6CGTA 1JD7A 2DIJA 4HZ7A 1P6WA 3DX1A 3VGGA 1CGTA 2V5DA 4J3VA 4JZ5A 3L4WA 4WJXA 4L4OA 3WKZA 3AIWA 1KCKA 1BVNP 3LRKA 1ZB5A 3IJ9A 2D1ZA 2QHAA 2G8ZA 3B9EA 4DWSC 5E1QA 2ZWYA 4AIOA 1E71M 3PZVA 5HPCA 5DMYA 4J3SA 3CGTA 2XN1A 4H8UA 1BAGA 3W6LA 5A6JA 3T0AA 1E6XM 4AZCB 3WENA 2J74A 4OUEA 4DWSD 1ISXA 3D4YA 4MJ4A 1C7TA 1J01A 4MAVA 3WUBA 2F7OA 1V0NA 2CERA 1W3LA 3B9AA 4PBGA 3ZJ7A 2VZOA 1O7DC 1JZ7A 3CPUA 4PMNA 2DH2A 4CCEA 2RGLA 5F7UA 4J3WA 2TAAA 4U31A 1US2A 3A6OA 4PTVA 4W86A 3WY2A 1E3XA 1CIUA 3I3EA 3W81A 3FAWA 4F8XA 1ITCA 2IUZA 3QOMA 1CXIA 3MO4A 1VEPA 3WD1A 4AD4A 5AC5A 1E0VA 4GZIA 1FHLA 3LX9A 2Y8KA 3SCWA 1JFHA 3AMKA 1BGGA 1V0KA 2GJPA 1X6LA 4GKLA 1QHPA 1R47A 3L4YA 4BZYA 1ZBWA 4H04A 4PMZA 3SUVA 3ZQ9A 4PSPA 4KH2A 2WANA 4M82A 1J10A 3LPOA 1BG9A 2GDUA 4AZGA 3ZO9A 4PSRA 3JUGA 3AZRA 2VZUA 1A3HA 1GZJA 1CXLA 1SMAA 3AHVA 3M7SA 2J8GA 3N15A 1EHNA 3G6LA 5DF0A 2Y4SA 2X05A 3NSXA 4B15A 2WAGA 3CHEA 5KEZA 1BPLB 4JKMA 3LRLA 3CBWA 3IJ8A 5AC4A 5DT7A 1MFVA 3PTMA 1ZU8A 2E0PA 3EDFA 2X2HA 4QFUA 2YL9A 4W7UA 5FIPA 1WZKA 2F18A 1V6VA 1B2YA 3PZ9A 4DWSB 3AFBA 1UH4A 3FW6A 4H41A 4MB4A 4F66A 1W1YA 4B3KA 3EMZA 1E40A 4PN2A 3SCOA 2Q8XA 1ODUA 1VBRA 3WFLA 3TTQA 4OJYA 5BRPA 4OBRA 4U5KA 3WBEA 3GXDA 2VX4A 2JE8A 1NM9A 5CGMA 1H49A 2VJXA 2VC9A 2WMJA 4XX6A 3VNZA 5A8NA 3GH4A 5LA0A 3APGA 4UFKA 3LXCA 3W28A 1S46A 4H8HA 5FL1A 3ARYA 3L4UA 7A3HA 1VEMA 2OWWA 4H2CA 2ZUNA 2DSWA 4UFMA 2PBGA 2G3NA 3WL1A 4JAWA 1GHSA 5LYRA 1AQMA 3N9KA 3VO0A 1HJQA 1EXPA 3S2CA 2BHUA 1KXQA 1HP4A 1NOWA 4UOZA 2E9BA 3WEZA 3KLLA 1WB0A 1R86A 4JHOA 2J7CA 3W29A 2WWCA 2CPUA 4WLCA 4J3UA 3VX0A 3NSNA 2GK1A 1BGAA 1ECEA 4V2XA 2D23A 1VFFA 4JKLA 4U33A 4JIEA 4M8UA 3WH8A 4D6EA 4DUWA 3ZM8A 2EO7A 5AY7A 2VR5A 2OWCA 1FH7A 1HXKA 3NDZA 1LG1A 3WNLA 3GXMA 1ESWA 1G9HA 3RJXA 3VIKA 4FK9A 1EDTA 2BY2A 4FNRA 1WDRA 2QPUA 2MANA 2XTKA 5CPTA 1JG9A 1PX8A 3S5YA 4R27A 2D0FA 2FGLA 5BXRA 3PZOA 3BVWA 1UKQA 2EABA 4C7FA 1UASA 1BSIA 2JIWA 2WLZA 1EA9C 2YA1A 4FLRA 2J77A 1QPKA 1XC6A 2QV4A 1GJWA 1GNXA 2VR4A 2VZSA 1E4NA 3VOCA 5I2UA 5D9NA 1GOQA 3AZSA 1IZJA 3VKKA 3WY3A 3MKKA 1B1YA 3GDBA 2WCSA 2WWDA 1TA3A 3VD9A 2PI6A 5CPQA 2OYLA 4XUYA 3GYCA 3GTNA 4Z2IA 2D3NA 3VUPA 4GPNA 4LPCA 3CHFA 2A3AA 1TZ7A 4W8LA 2YIHA 1UZ1A 1K9DA 4M56A 1HVQA 1W91A 4AEFA 2UWFA 2E8ZA 3PZUA 3ARVA 1GPFA 4AEEA 3HMCA 5BWFA 3OZOA 3AYSA 4W88A 2WC3A 2WYSA 4EK7A 3WUGA 1E5JA 2ZUMA 3TTYA 5A69A 2IGTA 4D6IA 4UZSA 3WD4A 3MUZ1 4PMDA 1E3ZA 4WKAA 4DM2A 1NOFA 1C90A 5A8QA 2OLHA 1TQVA 3A4XA 1JZ5A 4CU7A 4E8DA 1D7FA 1OIMA 1RP9A 1TUXA 4D71A 2WBKA 4U5IA 1O7AA 2WNWA 1TQWA 3L4ZA 2IXUA 2DT2A 4HA1A 4FNTA 2F1AA 1D3CA 2VZTA 3ARTA 4AZBA 4W7WA 3ZOAA 4BF7A 5FCZA 4AD1A 2PC8A 2Y8VA 1XH0A 3RM9A 2IXVA 4ACZA 4UNIA 2W66A 1SMDA 3F5KA 1FP8A 1Q6CA 2E3ZA 2X8RA 3II1A 1RH9A 1EHAA 3W26A 3F5LA 3DHUA 3N17A 4KMQA 3VSVA 5BXPA 1LG2A 1KQYA 1CWYA 3K4AA 3AMDA 2XN2A 1KWKA 2GDVA 1E6PA 4AYGA 2PBOA 1M53A 5BXSA 1TVNA 4P7NA 3AIBA 3LRMA 3D5HA 1V0MA 4B9ZA 1CGYA 1UA7A 2YA2A 5D9MA 3EDDA 1OGGA 1ZL1A 1DWJM 2CESA 1DWAM 2O9PA 2WMKA 1HL9A 2DSUA 3HU7A 4GQRA 1CXEA 1Q6GA 3BLBA 2OW6A 3WH9A 3ZT7A 4HMEA 3WQ6A 2BXYA 2CBJA 2WMFA 1E1EA 3AS1A 3TTOA 3GNRA 4TXEA 2CBIA 1GOWA 1BLIA 3EMQA 3DYPA 1WE5A 2XFRA 5DT5A 1QI2A 2WKLA 1W3HA 2WHMA 4P8XA 3TA9A 3CV5A 4M1RA 3UCQA 5A6BD 2G3IA 2WKGA 3AJ7A 3MS8A 2PWFA 2ZXDA 1Q6EA 3CZKA 4WIWA 2J7BA 2WB5A 3J7HA 1UZ4A 1X6NA 4AC1X 3WDHA 4AD2A 2WXDM 3VIMA 3CZGA 2D0HA 2W62A 3H54A 3ZSSA 3T2OA 3WF3A 3M07A 1JDAA 4UQ9A 1OT2A 2D0GA 1OD8A 3WUFA 3AISA 1HIZA 4KRUA 1W9XA 1GVIA 4FLOA 3RJYA 1HXJA 1M7XA 3CUIA 4UFIA 5A8OA 1B0IA 1PJ9A 4JL2A 2E4TA 1EH9A 3BAJA 4PMOA 2AAAA 5D9PA 3MUAA 4BA0A 5I78A 4W7VA 1L8NA 1PBGA 4M29A 2WVVA 1WDSA 2WZHA 2HISA 3WF0A 2XPKA 2GFTA 2G3JA 1NWUA 1TQUA 1KR0A 3MMUA 2ZUSA 1CGUA 4J7RA 1KQZA 2WMIB 1FFRA 5GNZA 1W1VA 1JAEA 1CPUA 1QOXA 1EQCA 4YHEA 1B3ZA 1UH2A 1W3JA 4S3KA 4J3XA 4A4AA 3VU2A 3PN8A 2NSXA 4Z2LA 3HZ3A 1JZ4A 1R33A 5LA1A 1OGBA 2PWHA 1CEOA 1N82A 3S6TA 3KWXA 3WUEA 1B31A 3BSGA 4UQCA 2UY2A 2XSAA 1HJVA 5EBAA 1UQZA 3GH5A 4YHGA 5FL0A 3HG5A 3N13A 1W9DM 5GPRA 1KTBA 4WF7A 3CO4A 5IFPA 1I1WA 4PUDA 4D6JA 5CGTA 4A3HA 4U3CA 3D3AA 2FE0A 4DO5A 4DUVA 3NUKA 3FY1A 4HPGA 4P7LA 4QLKA 2D20A 4HA3A 1VFMA 1WDQA 3OLDA 5A3HA 1OGSA 2OSWA 3RM8A 2XVKA 4CU6A 1PAMA 2DQXA 3W24A 4W5UA 1L0PA 5E6YA 4D6FA 2BY0A 3BCFA 1KXTA 1BQCA 3FXYA 4MPKA 4XV0A 4NF7A 2XIBA 1C91A 1Q6DA 5I79A 3L2LA 3G6MA 1B3XA 2QMKA 3VMOA 4AD0A 1SFSA 4D72A 2XVPA 4AZHA 2VOTA 1UKPA 2QMJA 2V3FA 2F8QA 1JDDA 4MB5A 1E15A 3AYRA 5IDIA 2FYVA 4HOWA 1KR1A 2WBGA 4WKFA 1FA2A 1JZ8A 3AIQA 1DP0A 3NSMA 4WSKA 4MB1A 3WQ8A 1EDQA 3GXPA 1MW1A 4HOXA 1BTCA 4RE3A 1QNSA 1H1NA 4DWSA 3ZT5A 2C0HA 3VIPA 3WDQA 1TG7A 4P7OA 1JIBA 4Z2GA 2OYKA 4QLLA 2DT3A 1IZKA 2J79A 4E4PA 5CSUA 4AMXA 4MNLA 4EE9A 1QI3A 5DFAA 1T0OA 4FNUA 3NYDA 5I5RA 3NIYA 5HBFA 1JNEA 1HNYA 3BVXA 4MJ2A 1PEZA 3CHDA 3SUTA 3BAWA 4OZOA 4AXNA 4AMWA 2ZUTA 2DH3A 1CGXA 1XV8A 3WY4A 1LL4A 5A6AA 1BYDA 2VCBA 1HN1A 1AQHA 3RPMA 3W53A 3OLEA 4UQEA 1LL6A 1WAWA 3GXFA 1FH8A 2VURA 2VUYA 1DTUA 1QNPA 5CXPA 1F4AA 3O2LA 4CGTA 2FH8A 4DO4A 1G0CA 4ACZB 4NXKA 4NX0A 2XVNA 3K4DA 1B90A 1RPKA 3W37A 1ZBCA 3EBVA 3BGAA 3VIJA 1H09A 1NQ6A 1UD5A 1JF5A 1HJXA 4UTFA 3EYPA 3CZ8A 4J3TA 4N42A 2QLYA 1KXHA 1VB9A 3VGFA 5ABFA 2YBUA 2HVMA 3PZNA 1OIFA 3AROA 1J0JA 5DEZA 2ZE0A 4TTGA 3VMNA 4OIFA 5A2AA 2FHBA 3L2MA 1QNRA 5A6MA 4DUXA 2VVSA 2B31A 4QP0A 2XN0A 4BQ4A 2WZIA 5ECUA 1GQLA 4U3AA 3M6DA 3UEQA 3I3BA 5TD4A 1H2JA 3E1F1 2CIPA 3U5YA 1NWSA 3WD3A 3WNMA 5A6KA 1JXJA 1XD0A 2EPNA 3AS0A 3BUPA 4HA4A 1E6NA 1JGIA 3CIVA 1V02A 2GJXA 2J75A 1VIWA 3PZIA 1V6XA 1JAKA 4E2OA 1BYAA 1CBGA
chains in the Genus database with same CATH superfamily
2FLIA 3B5GA 1I8IA 2KYIA 3KPNB 4IGMA 2A85A 1P53A 4TOYH 3TYCA 5F3HA 5JPMA 5CEYA 1A80A 4G8EA 4J4PA 5CCGE 1TO3A 4C56A 4IUOA 3B9KC 4UNLA 1KCRH 1UG9A 5G5DB 1JF1B 1MQ8A 1X8FA 3LZ3A 4O4VA 2YMXL 5CPLA 4OCNC 1PIFA 1MPAH 3BPOC 1FORH 1N0LA 3L1EA 4Q0XL 4B27A 4RWHA 4HZ8A 1TA3B 3QUML 4M6QA 5EZJB 4BY3A 2YLAA 2E7FA 3TJ4A 3EO9H 3TBWA 3C5ZA 3M46A 4HTYA 1WWCA 3WD5L 3GY1A 3WQ4A 1TYRA 4KMTH 4ZMGA 3ZJKA 2ZX7A 2EIZB 4YZFE 3WNJA 3QNFA 3HI6L 2XWTA 4G71B 4APQA 3KPRD 4FS9A 1S2VA 4ENLA 4IQEA 4R0LC 2Y5QA 1J8SA 2HLEB 4PYHA 3RDTC 5AKQA 3SO5A 3T6WA 3QJHA 5C0NC 3CBKB 2ZZ2A 4WSJA 3ARFC 2PP1A 3MJ8B 5AW5B 5AOIA 2AK4B 1KFCA 4QE4A 5FOJA 4GW1A 1W0VB 3KLHC 3VQ2C 1A4LA 1HH9B 4LNVA 1UOZA 3VNLA 4RAVB 3N44B 4UOW1 4JXCA 3CO8A 4C7GA 3MDUA 1MZRA 2ZWKA 4E5TA 4C5ZA 5IHZB 3MHFA 3KYMB 4XT1C 3SE3C 4XK2A 1AS7A 1WH0A 3DETC 1DORA 1UUQA 3EJQA 2CRIA 3VXNB 1YPIA 4F20A 1J9TA 2WQWA 3HG2A 2CDEA 4M9PA 1F8IA 1S2WA 1SFLA 4AG4L 4YXKL 3F4WA 1FNFA 5EU3B 3VNYA 3X14A 1QNOA 4LVFA 3DVGA 1UHVA 2VDOL 4XNUH 5IVXF 3MBDA 4HT1H 4GYPC 2WJFA 4U3XA 2FJFA 3V0EA 4A8NA 1GGTA 2AI0L 4I0PB 3O6FC 1PZ5A 1JDCA 4XNZC 3UD6A 3OB0H 1ZHBB 5I1KH 1RVKA 3OZOA 3TYEA 2DIBA 3CVBA 1A5FH 2Y7MA 3I50H 4JFTA 2DORA 4YDMA 2H90A 5CZVL 3SQLA 4RX4D 4PHZA 2WK2A 1H5VA 3AB0C 2YB1A 4XBPB 1R3HA 3WTUA 2P47B 2QVMA 4ZGYA 3P4MA 2BWGA 1AYRA 2P24A 3MNDA 3WY1A 4FG4A 4N8VG 3QFGA 4LGRB 5JDSA 3STZB 1A4MA 4LPWA 1QG3A 1VIZA 3TROA 1PWLA 3FB8A 1WFIA 1ICQA 4GBXD 2XRAL 4OF8A 1R19A 3P02A 3KOWA 3EJPA 3T9WA 4JN1H 3B56A 3REVB 4WW2F 4WTQA 3GGWA 4D3CL 5I6SA 4ZE5A 4LPXA 1A6ZA 2EYTA 4R7JA 4S0TD 1GGCL 3DOSA 1HJBC 3GTVA 3IJYA 1XRSA 1ZALA 1AXSA 3RCYA 2QJGA 4JFWA 4ZO9A 1H6UA 3UABA 1QO2A 1MCKA 1BEYH 4TNWK 3HHSA 1HKFA 1Z9SB 3D69A 3EXRA 3SCMC 1GKEA 4NIRA 3VRIA 4AGLA 3NA9L 5J06A 1LTXA 1VPQA 3ETSA 1GW0A 3QG7L 1OE3A 2E6FA 4DX3A 4PJIF 3MV11 2CKBB 1OC7A 3U5UA 3QHFH 3N11A 2YGPA 3VD5A 5H1WA 3ZLFA 3K3QA 2H9GB 5I5MA 4GIAA 3GIVA 3NJNA 1LLOA 1Z0NA 5IW6A 1O95A 3FQ1A 2Y07L 4H8VA 2BGQA 2HK0A 3QW3A 2CJSA 1EGJL 1FDLL 2BRRH 1GKQA 1OPGL 3VXGA 4JE0A 4ODSL 1TR7A 5B39A 4GCXA 4DQOH 5JW3L 1RJQA 1YEGH 5GGSA 4O10A 2WAQA 5H2ZA 4KGLA 3P30L 4PH6A 3B2UD 2DZXA 1KYAA 2DZPA 2Z2BA 3HE7C 5CFAA 4R97B 4ZS7H 3RWFA 4EXKA 1BEYL 2YBGA 5TH2A 1AIFA 5J12C 4JM2C 3VJ6B 5J56B 4HH9A 2OMYA 4H26B 1OAQH 1JWUA 3N1MC 3P4NB 4KQ4L 4L1DA 1R2SA 3BZDA 2AXWA 1EJSC 3WQDA 1II4E 5FJJA 4BHYA 2X7LA 2OMWA 4Z77B 3M0ZA 2HFFA 2CETA 5I9QC 1HILB 4WV1A 1JYNA 3S6DA 3FO2A 3L7EA 4L3EE 1QFUL 3PBMA 2Y3AA 1V7AA 4IPPA 3MRMA 5E6IC 1MFUA 5CR8A 3FT1A 1T21B 3L1OH 5F7FA 4F15B 1NU5A 3ATFA 4WWKD 3P1VA 1O7SA 3F7PC 5GRJL 2P50A 1H63A 1L9PA 1L0XA 3CLMA 4XBJA 4YL2A 2NZ9D 3EO0B 4YSOA 1YAZA 5ANHA 4JIHA 4X22A 1KXTB 4TUOB 1BEUA 5DUBB 3KPMA 3DGDA 1FXQA 3OC5A 5I1KL 4FSAA 1JVLA 4OGXL 3UZWA 1MUJA 2IG2L 3MRKA 1I7TA 4QRAA 4YAQB 4GP4B 3ZL4H 3RL1B 3CVIH 4QTHB 3ZUNC 3LY0A 1DBJH 3ZKMC 2F7IA 3IGXA 4GG9A 4W9IC 3TZVA 3VIIA 2XA3A 4R7NA 3OVPA 1C8YA 3ULVF 4HJFA 3TX9A 1G4SA 4K3GA 2C4FT 2I7SA 4HH8A 4QRPD 4Q9CA 1P5VA 3Q13A 4NZJA 1DIDA 1OM0A 3EOEA 1E27A 1E90A 2L7UA 4DP5X 1M9WA 5T3XD 5ADPH 1HC1A 4AITA 1NIAA 4Z3GA 5JNYB 4UFHA 3PIQA 4HPOH 4PRWA 3FTWA 4NY2A 1FFQA 4OKDA 6PCYA 4XR8C 4EIBA 3WGUB 3ARGC 3STGA 4HXBL 3WH6A 3KEHA 3GVQA 5C07A 4ZA0A 2KPNA 1ZS2A 2ARWA 4BDVA 4IFKB 3F2DA 3FUKA 1YEWA 2Q86A 3WO4B 1D7KA 3OG2A 3WH7A 4D6GA 1MJJA 3CMJA 4P57B 4MYAA 2Z1SA 4LFHD 1AOZA 4EIVA 1XLCA 5EA0H 4I0PC 1D5BA 4F2FA 2O56A 2K0RA 3BXNA 5AOJA 5TK2A 5E4OA 1TRDA 1QNZH 3SDDD 2NX3A 3ESNA 2NUXA 3PPCA 3OODA 1DANU 1BVZA 5EFIB 4EOWL 2MNWA 4QYAA 2JB5H 2Z7KA 4HS6B 1KGXA 1C9SA 3TU9A 1FJ1B 1V6WA 5ADPL 1UR4A 2DQTL 3NQKA 1AD9B 1DOSA 4QTIH 4XXWA 1E0WA 1Y1DA 2R15A 3F58L 4GI9A 2AJ3B 5MI0B 5FO8B 4TSCH 4J2QA 4MJHA 1FFPB 2VDLL 3IFLH 3MRJA 2ATPB 4BZ1A 4N90E 3CHCA 4F57L 1DE4A 4C6QA 1NBZB 2OSLA 2Y06H 3W2KA 4H9VA 3HAEH 1EX0A 8FABA 1HFBA 3LYEA 2XTJE 5I18H 1T0NB 1FFNA 1XWVA 4G8IB 4ZMZA 5HYIA 3W7EA 3ZHNA 2HT2C 1SR0A 3TO4D 4GINA 4XX1G 1IAKB 4AI7A 4LX4A 1I85C 2EDHA 3GB6A 3VFPB 2WXFA 5IFTA 2OZ4A 3FJTA 3NESA 3OVGA 3SUUA 1BP3B 2OTWA 2V8MA 3B83A 3W39B 3QUZA 2OMUA 5AUMA 3Q8FA 3T04D 1QPXA 2AJUL 3MCKB 4B3EA 1XCXA 3GTHA 2QUNA 4XX1E 1GOGA 1AW2A 4W8BA 1Z7AA 1LUCA 1NDWA 3DBXB 5EH1A 4R9OA 3ZS4A 2JH2A 1P1XA 3IETB 4QRQB 4CDGC 1K3IA 1DN0A 5FA3A 3GMMA 1JTTA 1U2YA 2CNCA 2W0UA 3CV1A 2PU1A 4O12A 3QT2A 4AWSA 1M3IA 5AENA 3L2IA 4OU1A 1A6UH 3MFFA 2VQUA 5DJ8A 3V0WL 1T89C 4C7DA 4YYCA 4TNFA 2VISA 2W60B 1LJYA 3KTCA 1ASQA 4BA8A 3S1WA 4HWZA 3BPNC 4QGTA 2WHJA 4C91A 4RXGA 1EGJH 1FDLH 1TFHA 3QUKB 2VC5A 1XRVA 5G2HA 1OG0A 1XRFA 2H2SC 1I8MA 1O9VA 4UNTA 4MJIA 5KTLA 4NB7A 3WHE0 5K1JA 3RO8A 1C5CH 4DCQB 1X5HA 3C87A 4IBQA 1JFXA 2XWRA 3A0OA 3BWUF 4NNXB 5DS8B 5B3NA 3BKCH 4MWAB 3ZKXC 2P8PB 1MQQA 4Z7OE 4MCZA 4BK5A 4DHLA 5LNUA 1QWUA 2BS71 3RYSA 1PW3A 1RSYA 1NLBH 3EEZA 2X4PB 4DXXA 3RK8A 2ZXQA 1BFTA 4YQXH 4PTWA 1MCQA 1H3TA 3BEVB 5C7XL 1BWVA 4PREA 1AO7E 3RIKA 4G1EA 2VL4A 1E4IA 3BI9X 1SF3A 4M4PA 1PQZA 2OTUA 3AY4A 5HGDB 1Z41A 3H2NA 3ES6A 3QSKB 5C08D 3IS1X 2ZYFA 3LDBC 1IQDB 2GSGA 2Y23A 1TCDA 3SE9H 1IB5A 4JTEA 1FNSL 3NPSC 3RDTA 4W87A 4LHUG 4U49A 2D2HA 4XAWL 4I5UA 3T07A 2R69L 2JK5B 3EOAB 1W2KT 4G6KL 4M5ZH 4RDQF 2WSRA 4MLRA 1T20B 3KXFD 4MD4B 2O6DA 3VIOA 4FL4B 4WEBH 5FW7A 3GZAA 4AL8H 2QQLH 4CC4C 2Y3NA 2DZBA 4NZUL 5IVXE 5E09A 1A6PA 2W79A 4JRLA 3GDLA 2QCGA 1TSRA 3PNUA 1Q6QA 1J9YA 5CC7A 4HT1L 3OGVA 3WKNA 1S5HB 6REQB 1BZ9B 4A7TA 2ZG2A 3KLKA 5HDWA 5GGTL 5JQIB 1MFEL 5BCAA 5I19H 5DQJB 1V6YA 4IKLA 4FNPA 1UW9A 2QSCH 1L9SA 5B3JF 2MUCA 3F7YA 2ADGB 1NCAL 2MIZA 1LJMA 1QK2A 4XZLX 1C12A 3AS2A 1LP6A 3BO9A 2AMXA 3IF1B 1B4TA 3BH8B 5HHMD 2YPKB 1FWAC 2HS6A 4EMZA 3OKMA 2HK1A 4WU5B 1JWSB 2YEQA 1HOCB 4RSVA 4XC3L 2XFYA 1H62A 3T81A 3FQUA 1NL0L 4J6RH 1DBKL 4JQIA 2DJSA 4L8BA 4NBZB 3ZTDC 1I1AA 3HJEA 2FDMA 3QG6A 3DUGA 3HG0A 3EX1A 3N3MA 4I0KA 3HI6H 3ZGIA 4PCPA 1GGIL 1NCTA 1NTDA 2HX9A 3N9GH 3QFJD 2I14A 1CLYH 3E2HC 2JF7A 3CUHA 2DQFB 2YCLA 2AABH 1XUUA 1F3XA 4WEBL 1PL9A 3AYVA 3MLUL 3MREB 1U3HD 2LLEA 2W5FA 4PJIE 3R7QA 1J8HD 3KNBB 4N1HB 3PWPE 1A3RH 3U1PA 4U1IA 2P4AB 2E09A 3TP4A 1JGDA 3DTXA 2XZQL 1W1ZA 1MNUL 2QZ5A 4NQDD 3CSYB 4ICWA 3D25B 3FC8A 4GC3A 3W7GA 2VN6A 2BDQA 2G5WA 2DD8L 2G4GA 3DOIA 1FWSA 4AHQA 4UFJA 5DVOA 1GONA 1NY1A 1QPPA 1CCWB 4TMPA 1IGJB 3C3NA 2GUYA 4WOZA 2BW5A 1HWHB 2FATL 2DQGH 2QHRL 1Y07A 3NA8A 4LC8A 4ODXB 3FT4A 4JFDB 2FEEL 4YVNA 2X2GA 3UXLA 4FXLA 1NELA 3DG7A 4UINL 5LGXA 3TEWA 1HWWA 3LPPA 2DWEA 1HEZA 4MKTA 5C0BE 5I3KA 1BQRA 5GHWL 4L8CA 3R25A 1YEYA 1BQUA 3GS4A 2CRYA 2WXOA 3BDYL 1LO5B 2F8IA 3THMH 4XGZB 5AN7A 1NPNA 2K4WA 3VGDA 3WE6B 3IANA 4LSVL 1OD0A 3Q3GA 2YD6A 3R1ZA 5C86A 1MFNA 1XLHA 3E0IA 2PDQA 4I3RH 3WEOA 3NQDA 3WN6A 5C0RL 4ZX6A 4QO1B 3OPSA 5FM5O 1ES0A 1PLAA 5LHDA 3RF9A 3FSZA 5HTSA 1E2VA 2ZP0T 3ME3A 1ZNNA 4ACTA 5FR3A 1NP0A 2XN9D 1UR9A 1WBYA 3EDKA 1ITBB 3ARED 4CEUC 4Q14A 2X2IA 3NACL 5SX4I 4KKCC 2XZ7A 3A5VA 3B05A 4NQXB 1NBCA 2J5LC 4B16A 4X8GA 5D93C 4IOIB 5E9AA 2OLDA 1FVEB 2L7EA 4BFNA 1A9BA 1F4YL 1OCQA 1M01A 5CUSH 2X9ZA 2EH8H 4OLUL 4JZOB 4ADSA 4C6OA 4TYUA 5M95B 3AB0B 3ARBC 5H94B 2VXTL 1MVYA 2E27L 4WRLA 4XODA 3GVVA 3LU2A 4OLYL 2ADYA 1E70M 4FAMA 3F7QA 4Y19B 4L1BA 2D2GA 3HMXA 4QDGA 4NZCA 4CA4A 3LQAL 4DBDA 2VRQA 3D48R 4X99A 5J6HB 3QYNA 4NZ3A 1CDIA 3T1FA 2X0VA 2WC7A 5C0DA 4FA8A 2A7RA 4AZCA 3V0AC 1O6TA 4HHGA 3SI9A 2DDXA 3EDJA 3N0AA 4QY8A 4K8EA 3NCJL 2G9HB 3KPOA 3RFRA 4JANB 3ELQA 3QXAA 1GQKA 1TE1A 1I1FB 3OEXA 5C6TL 5HGBA 3IMBA 3QWOA 4UTJA 3LEVH 3U9IA 3H6AA 4IRJB 2KDYA 3V8CA 3C52A 1P69B 3U4BL 5BU6A 3BUDA 2R8SL 4GXUM 2O9OA 2VXTH 1S39A 5XIAA 1SDAB 1PD6A 2FGWH 2DWYA 4IRSD 4JTRA 1E28B 1Z89A 3VFOA 4EQ3A 3OKKA 1G1KA 1SOKA 3HFML 5GS2D 5LWYH 2D22A 3KW7A 5T1DL 2QIWA 3TYDA 3W7HA 4Q8OA 4WVRA 1PCXA 3INUL 5I76A 3S2AA 1MHEA 1XH2A 2D2OA 3TEZA 1AW5A 2CBUA 3STPA 4I2XA 4UT9A 1EJ7L 2R0WH 2R2EB 1ROCA 3CFKB 3IK4A 4R4FH 4OZHB 5IHRA 2IANB 3UJIL 3ZDYE 2G3FA 1IM3A 2N1KA 5J7CC 3W1MA 7TAAA 3BK0A 3BKJH 2PO6A 5I1JL 5F0PB 4JO3H 4X0KA 5IB2A 1PYMA 3EPMA 3BC9A 4IGSA 1SEQL 4QRTB 3M1OA 4D0DB 2ALDA 1QHOA 4RDYA 1ZVSB 2X0SA 1GCYA 4D8PB 1BOYA 4JUSA 2Y6ZA 3AZTA 3GC2A 2FX9L 2WLMA 4AVIA 3US1A 3MKVA 3ASWA 2X9YA 5KITA 1PSKL 2P10A 2VLLB 4U3SA 1SJBA 4PRAA 2O9TA 5BOFA 3KAAA 4FFWD 1IKOP 4TV5A 4JJ5B 2R29H 1E4HA 2HCZX 4F93B 2J62A 3GNPA 2FSDA 4JIIX 4AU0A 4EF9A 3S5ZA 1KB9K 5DRZB 4MX7A 1SDDB 1UURA 4MAUL 1BGXL 2O30A 3CD4A 3N2OA 3PBYA 5FUCC 5AYYA 3TAOA 5ABGA 1A7RL 1AE6H 1J0HA 4PEEA 1XF2B 2MOGA 2D9QB 2SFPA 3BOFA 3QO1A 4Q6JA 1A1OA 1OV8A 2UYLB 4KK9C 3WXVH 4XTDA 1FRBA 2BVPB 2ORBH 4G7SB 4YTTA 3KWWA 2V82A 4OIIL 3MTWA 4PCFA 2LOEA 3QNYA 4RNRB 3CK5A 1CNVA 3K72B 3HBLA 5F97E 5FWQA 4G7RB 2HJKB 3WSQH 4Z7IA 1ITXA 3SCQA 2YR3A 1GW1A 2E4FA 5HVGB 2J88A 2A6DA 2DBJA 3FH7A 3IFOB 3LEYH 4NI3A 3CUXA 4BEQA 2QYGA 4CCDA 1Q2SA 4IDJL 3T0XA 3QIUD 1E1CB 1SO4A 2HS8A 2FZ3A 1LQ0A 3HN5A 4X6BA 3RMEA 3WIJA 1AFVL 6FABH 4XB3A 4HUXB 1XL4A 1BPVA 1VRSA 3C60D 1I7ZA 1MFDH 2JNZA 2CIIB 2H1PL 2MFNA 2V5JA 5I0VA 3JWDL 5EOCH 4YH6A 1GT8A 5DK2B 1SJXA 3IJHA 1H5BA 1L7IH 3B8YA 3QUZC 4FMKA 4IL0A 3C6SA 4NQDA 1OCBA 5JIPA 1A5AA 1K7XA 1ISZA 5AECA 2QADB 3FDWA 4EIUA 4KXAA 4G9FA 1JQXA 4I9TA 3U2EA 3FOMA 1NIBA 2GWNA 4L29B 2J8FA 3IMUA 5IBXA 2O55A 2R4RH 4PZVA 4HDIB 4MRBA 3EFFB 4LOUD 4YPGA 4NP4L 3RY4A 3ARDD 5HDOA 4PCTA 3WLKX 1WWWX 3UWVA 3B34A 3GIPA 3VXOB 5TDOB 1KTJA 1RU9H 1OCOB 3GJFB 3ABMB 1KLGB 4H1ZA 1KLUB 4BZ1L 4H25A 4WENB 3MLWL 2K3TA 1JZEA 3QXBA 3FCBA 3V4PB 5C0AA 1YTDA 3S9ZA 4XCYB 4PVMA 1LEIB 1UB6B 1NGQH 2BOCA 3AS3A 4L29A 3F7JA 5DZVA 5F89A 2QNEA 1R3KB 2KBGA 3HE6C 4QX4A 3MRRB 3QBTB 4XVJL 3TWCL 4CMMB 1TUPA 1L6GA 3ML9A 5KG9A 3B1TA 1T6VN 1MLBA 2HLFD 4G8AC 2HZHA 4OV6F 2A74C 2XG4B 3KJ4B 2W27A 2XGBA 5I2IB 2GABA 4I85A 4V1XA 4DPCX 1YTEA 3W0WE 4NZDA 4R7OA 3HC4H 1N4XL 2PW2A 5GJSL 4JTLA 1ZDSA 3HBQA 1QNQA 3I65A 3A67H 1OFPA 1MN4A 4DBEA 1XX9C 2VLJD 3ME0B 1MQRA 1MFAH 3AAMA 3L12A 3WAKA 2WC4A 2EAWA 2J6EH 2KS0A 3DFSA 5INCA 3IV3A 3LCGA 2G3ZA 3L48A 4G8GA 2X1QA 3GS0A 4KY1L 3QUXB 1UIOA 4KV5F 1YJDH 2WWOA 4IS6A 2E47A 1RJLA 2MQCA 4RRPA 1VFBA 5I1GH 4FF5A 4AIZA 3HI5H 4FOMA 4WU7A 3STFA 2ATKA 4NZTL 1P9MA 4M6OL 3LN5A 5CHNA 2OCFD 1Q9OA 4GS7C 1RD5A 1TR9A 1UWTA 3SDCA 5HANA 4FMVA 3BQVA 3VXPA 1GMEA 3KDPB 4GIEA 4JRXD 1BRLB 1I0DA 3RIFF 1Q9KB 2XOTA 3BP7A 4JFSA 1NGZA 3DKHA 4MJ6A 4PYSA 3HMXL 3RP1A 5DHXB 2NLJB 2XV6B 3N44F 4QOKD 3SGGA 3MRPA 2ZCLH 5DC4B 3TS8A 3O9WC 3L3GB 2DWDA 1XGQA 2FD6H 1L9QA 3EO1B 4W6XB 4E9SA 3QPQC 2LLNA 3CVHH 1REQB 3G24A 1XLAA 4ZZFA 1KTNA 1ZLSL 1J1OH 1BLNA 4E2VA 5GNXA 1FIGH 1WIPA 1T5WB 3H53A 1B0RB 1E4XL 5F4SA 3VDBA 3EJYC 3WS6C 1FL5B 1J18A 1F2XK 3VKBA 4ZMXA 2XBDA 2YPVH 3N1FC 3PHOA 4KX9A 1QUPA 2Y63A 3TONA 1F4XL 1HQRA 3U7WH 5E00A 2XDHA 4NKOB 4MMXB 4YZWA 4BQ6A 4YBHA 1GOMA 1JQVA 3BJTA 5LVEA 1TTJA 4P3CH 1HW6A 1TTBA 2I5QA 4A2MA 4Q33A 4HBCH 3K74B 5C0FB 1SU5A 4Q7BA 4GZJA 4RW3A 3HB3B 2JCCA 4ORZC 1QI4A 4RISL 1FOBA 1QVBA 3VWKA 3WTXA 5A8MA 4MYXA 4GT0A 2IBZX 4GAYB 3X1GA 3PFQA 5FYLE 2XWCA 1SXZA 2CHNA 5IG7B 5IJKC 1E5NA 2DYPA 3RBGA 1UA6H 3VIFA 3CUJA 3QW9A 3GZKA 4JM2B 4KHTL 1SJEB 1TUFA 3GS6A 4YC2B 4NQUA 4GRLA 4UMBA 4D6HA 1L6YA 1RUSA 3ZXAC 1BJ1J 1BZEA 4Y5XA 5H35B 2BNRE 3GAKA 3T1FB 4A3QA 1L5GB 5I9QB 5KS9A 4QEEA 4ZAKC 3PWUB 1QRNB 4URIA 5K9OB 2G2NA 1A5OC 5D2YA 2K7QA 4P5UA 1S8DB 2WYIA 3N18A 1CUOA 3E6EA 1UWIA 1RZPA 1XGUA 4HCRA 3UJFA 5GZOD 4DRSA 3SKJH 1E0OB 1EIBA 1L9OA 1R5WB 1YEDA 5EDSA 4MYWB 5JQ9A 3DLQR 3WJYA 4TQPA 4LRTA 3QZOA 2UWEF 2PF0A 3QK0A 2VO5A 1WOAA 4NQXA 5SWQB 1O5KA 1DVFA 4TTDD 4HLZH 3F7RA 1U83A 2CLFA 4BKNA 2VITB 1JI2A 3U8GA 1DDHB 4BHUA 4H9XA 4ROQA 3KE0A 3CUGA 3W1QA 3FZUC 1NEZB 4NWTL 4FXRA 3PNRB 2CUHA 4MWFA 5GIRA 1MEXH 2AXFA 4M81A 4Q9RH 5C54A 2WTPA 3GSRB 1RP8A 3I6SA 4LO9A 4LOUC 1T5KA 2VAAA 4BFEA 2H5UA 4ZE4A 2VLME 3LCFA 3D51A 1W72L 4CN6A 3PBUA 5CR1A 1KIUB 2Z31D 3QH3B 3GUGA 1K2DB 2QQNL 3MLXH 1JGMA 1CENA 3VU1A 1JR1A 4HZ6A 3L5IA 5C09E 4HLZG 5C0IB 4GJJA 1I3GH 5IBTH 5KTEL 3TBBA 1EBHA 2YL6A 5L4MA 1RUQH 4X6DB 3KVQA 4Q3MA 3MVTA 2R7EA 3CDZA 1JJUA 2Y9RT 3O11B 2CWXA 2NY6C 3N85L 2OSXA 4XNXH 1XIFA 1E72M 3UU0A 5E8NB 1AD4A 3WDIA 4OZGF 3KDMB 4JKKA 5I6LA 1LBLA 1A9EB 1HCYA 4L8SC 3RURA 3P9LB 4C4KT 5EF0A 5GXBB 1AJ0A 3H2EA 1FL3A 1YEEL 2YD0A 5ADOH 1ONWA 1YJDL 3KS0J 2Z1WA 8XIAA 4YK4B 3WQWA 1KB3A 7REQB 4HSQA 3MROA 4I8YA 3MUUA 3WNPA 2VMJA 4YXHH 1KCUL 2YRBA 3ZGHA 3BCDA 4M1CC 1OE1A 1RZIA 2GL5A 2OMXA 3GSWB 4YBQC 5ESAA 1S4IA 4JRFA 4GUGA 1TIUA 4IJRA 2WHVA 1CDUA 1KB9J 1HSBB 1HE8A 3EGXB 4N2GA 4QYOB 1XIWB 5LG6A 2GK1B 3PWAA 4QSHA 5I66B 2GOUA 1BM3H 3E5BA 4GY4A 3ARPA 1YNTB 4E9TA 2R2BA 4WTXA 4IUGA 3HG1D 2JKEA 1H11A 1F18A 5F7MC 2ZFAA 2E9MA 4F9DA 4UOJA 5CBAB 2BP0B 2R0LL 3ATEA 3RA7L 3N2BA 1CGSH 3NDYA 1TFPA 1GHFL 1ZVHA 15C8L 1DO6A 2PXYC 3RU8L 1M04A 5T3ZH 5FA4A 1KACB 3IXAB 2NQ5A 4K8RD 4NHCH 1YXYA 1CDGA 1KUMA 2EQDA 1JZ6A 5KAQG 2H0PA 5D30A 2GSHA 2GVYA 3VDAA 4OZIB 5DC2A 4EI5C 2ZICA 5JW5B 1OXYA 1F4HA 2B2XL 4U05A 4JNXA 1B57A 3Q45A 1MHHB 1KY6A 2OZ4H 2NQHA 2XKUA 4QHNB 1YNTF 1DUYA 1ODZA 4XMKL 4NKIL 4IQHA 1IARB 2BCMA 3AM8C 3QDMB 4FTVB 4JRXA 1INDH 3IU4L 4PJCA 1A8ZA 4HUCA 3BGMB 4OF6A 4X50A 4GXMA 3W2JA 5CG0A 4TF4A 3KVJA 4JIPA 5C2XA 1H0IA 1NGXB 4XMPL 3CJPA 3OLGA 4NOBA 5HGAB 3HN3A 5EUOF 1QW7A 2V67A 4HCHA 3KYKL 1KGUA 4ISVB 3EKCA 3HC0A 1Q13A 3QY8A 4ZPTB 4BCYA 3I50L 1TU2A 3CSTA 3SDYH 3QZWB 1KWGA 3JWDH 4UBDD 5T5FL 4IOFD 5IM7B 1Q4WA 4FA7B 3QY7A 5CSGA 3N43B 3HTLX 2IPWA 5DDHB 1WUNT 3H4XA 1FQ9C 5JQHC 3KCJA 4TNGA 3S5NA 3RDKA 5F7EH 3KPQB 3SCNA 4GVIA 2Q9OA 4YXKH 1BG1A 3S8HA 1UWRA 4YVUA 3OW1A 4AQ1B 4TVSa 2IAAC 4P8WA 3TVMB 4P7QA 1M42A 2Z8WC 5DDHA 4XXDB 3KS5A 3N6HA 5CZSA 5CAKA 4FXSA 3QQ4B 4G5ZL 1ZT4A 5CJQL 3WIHH 4E41A 4JYDA 2WGNB 4U0QB 3NXFA 3H7BA 4R5EA 1DQUA 1R0AH 2FWLB 4KQ3L 3FUDA 4NFDA 4UILH 1DYSA 2CR3A 2IALA 2BVEA 4R4BB 4TL5A 3W0WD 3U79A 1JEZA 1H3PL 3IEBA 1H3VA 4FDWA 5DJAB 3EB2A 3EKLA 2CHZA 5K9KB 2DTSA 3WBXA 4CMHC 3P0XA 3QUKA 2ZX9A 3IJQA 3W1LA 1QASA 3BGMA 3GC3A 3TA3C 1VH7A 3L5MA 4LSUH 4K15A 4OWGA 1MI5D 5C9WA 2DMBA 1UJ3C 1DUYB 1YVLA 1A7QL 2YPVL 3BJSA 5DD6A 5E2VH 1X9RA 1J1XH 2BCKB 2BSED 5F6IB 4Q7NA 3QHNA 2ZQKA 3B0YA 3D0LA 1CICD 1E4MM 3MVIA 2QCCA 1QI5A 5BRQA 4F8OA 2Z4QB 5F93C 3VI3A 2OK0L 4DKEL 4GRWB 1V7YA 5IROC 2VN5A 4B5SA 3MXWH 4L4VB 1YYLH 1ET5A 3ZJ8A 1S5MA 2QJJA 2RGLA 1CE6B 1XCQB 2BP0A 4N2AA 3RNQB 1SLWA 4W9FC 1I9RH 3A4AA 4V1DE 4UZUA 1PIIA 3RKPA 3HUJB 5DCDA 2EXOA 3G6JB 1V8EA 2Y62A 3KRSA 2P76A 2KLRA 5EBLA 3EG9B 1BAWA 3VABA 4PRPE 1G84A 2A79A 3FT3B 3ELFA 2LGNA 3QRGH 3ZT6A 3MLVL 5SWUA 1UOVA 3QOKA 4HETA 5HMDA 1FKWA 3QY6A 2DW7A 2I17A 1WXZA 4NJHA 5BV7H 3ESOA 3WS3B 1HHIB 3S8GB 3N12A 3VXUB 2XM1A 1I31A 2NY7H 3E2QA 1TO5A 3V5CA 3MUY1 4YU1A 3VKCA 2X4NB 3GMPB 5EU6A 5HD8D 4OZGE 1RAMA 2PYFB 3N1PC 3SIMA 5DFVC 1KJ2A 4EIGB 5F9JB 1RCXB 2YRLA 2GHWB 3G9VA 5AVSB 4WZ9A 2JEPA 1S5NA 3NPZB 4ZO8A 2V68A 4JQXA 4U2YA 3D4CA 3BRDA 5CINH 1MJUL 3XINA 3V4VA 5D1ZD 4CNIB 4E42A 4E0RA 3CB3A 1A0QL 2W4XA 3C8KB 4DK6A 3FU8A 3T1WA 4Q8WA 2C9XA 1W72A 2J13A 3JSSA 4AV5A 4Y9MA 4KKZA 1RZKH 5E8EA 3OTTA 4EZJA 4EI6A 3DZ1A 4RGMB 5IP4A 1A9VA 1GHFH 4DI8A 2JTDA 4GOAA 1K2DA 3CXHJ 3KZSA 1MJJB 5C0QA 3W70A 4F2TA 5BXTA 3FPXA 4OKVB 1F4YH 3V6BR 4M7LH 4WXYA 1L4IA 5J04A 4ISVA 4LLAA 1SSDA 3VVWA 4F9LC 2EPLX 1MQPA 3V7PA 2HRPL 5DMJB 4M80A 3PJTA 3CTTA 2EE0A 3C6LC 2A9BA 4XHQA 2DJLA 2EECA 1HU8A 4Z08A 2ZCKH 4FXGA 3Q67A 2OJPA 1KBVA 5EOTB 2VITA 3GQYA 2BRQA 2B81A 1T03H 2F5BL 4XISA 4Y5YC 3L4TA 3MV01 3I9PA 1GTEA 4UILL 1PSCA 1UCWA 2YMOA 2E9LA 3UY7A 4KKAC 2LTQC 4MFEA 1Q72L 3D6GA 3N04A 4DEFA 5D7IF 4RRPG 4UAOB 1ACZA 1A3LL 5DFWH 4XG1A 3CQIA 2WYTA 4JMXA 5EU6E 3NJVA 4K94L 2PDXA 2XIIA 3IV8A 4DOHB 2ERJC 2BVYA 2OX5B 4J8QA 1W1PA 4PRIA 2YKLL 1OWRM 3GXNA 5TDPB 3AHTA 2QUTA 5F7EL 4AT6B 4AISA 2HNHA 5FSEC 4FFTA 1NOLA 4DOHE 2PGEA 3RY6C 4NZ1A 4REQB 1UWAA 1DL7H 3KOXA 5EPDA 1TPVA 4NKQB 5LIUX 5DEJA 3SSZA 4M1DL 3SDYL 5HDQL 4GH3A 2PWUA 4Q97A 3FCSB 4YHYB 4FC3E 4JFFB 4UQBA 1KM4A 4F0LA 3QDAA 1JMXA 1NIEA 4H1LA 4J3OF 4YDNA 3M0YA 1W72H 1N68A 3OLIA 2YWZA 5GGTA 3EB4A 1GZHC 3VGBA 5C7HA 3QTGA 1BZ7B 5FGCE 1LWHA 1A7PL 4RRPM 4UTBL 1FWWA 4H6KA 3QRFM 3H3BC 2D24A 2WM0A 1CLZH 4FHKA 3ZN6A 2CXEA 2XIOA 1KEML 5ABZA 3P0WA 3ITCA 4CN1A 5D09A 4YO0B 3N06B 3EOBA 1G87A 2PDHA 5GJMA 3US9A 1E50A 5FIEA 2BIHA 5DD0L 3GG0A 3DO3A 4PWFA 4TR9A 3OO2A 4RNFA 1VZIA 2VXSH 4DAFA 4LS1A 2FX8H 2OSYA 4LASH 4X6DA 1S7QA 1YDYA 3WJLC 1NKGA 1CX9A 4S3JA 4IU2B 2UY7A 4FYSA 3WLSA 4AIBA 4IRSA 1YTKA 1URIA 2V2DA 4M3HA 1DQVA 1KJ3L 2FO1A 3GIZL 3D69B 3K2UH 5KVFH 1ICPA 3TJEL 4NBXB 3LV6A 2ZYHA 4X9YA 3MACL 4K9EH 2PGRA 3L3DB 4KKBC 1S9YB 4YDKL 1TV4A 1E55A 2CDFA 4U1HB 5F96L 1F42A 3S34H 3FF8A 3ZR5A 1KTDA 4AX3A 3KPQA 2FQEA 2X6VA 1I1AC 4LLWA 1LDCA 1VAHA 2HAZA 2HJLA 3DMMA 3LCYA 4JFED 2YD9A 1M9SA 4KK6D 3RZCA 1S1PA 3V0UA 3EYUL 3SDOA 3FB8B 2H0EA 2XWJA 4W6WB 4AQZA 4ZMOA 5EZIL 3NJFA 3WJXA 4OVUA 3FFSA 5G1YA 3LOWA 5I06A 2V7NB 3W2DL 3V7AE 4H4NA 2EDEA 1D9EA 1IFRA 3FSAA 4M4RB 3T3PB 5IMOA 4JOMA 5DMKB 1GTHA 2DVTA 4G7FA 4ZBJA 1YAIA 3BPOB 3UY8A 4JHVA 2C9PA 1G9MH 1R5WA 2VFGA 5EIVA 1JZHA 4TVUA 1G9MC 1O0VA 4UT6L 3EHBD 1XGUB 7FABL 2TSYA 3AI0A 4HN4A 4O58H 4MZ3A 3FU3A 1J93A 4F9PC 3JUZA 5FV1L 4FQHA 2PYED 3IRZA 1XSJA 4H1LH 5FJRA 1TEYA 1OJXA 4L2YA 4JTUA 1CXFA 3REQB 4JJOA 4OLEA 5D8JL 1R9FA 2V5BA 2DI9A 1X5LA 1MRCL 4YEEA 2DIEA 1X5IA 4FXTA 1YC7A 3NJJA 2CO3A 4N1CA 2WSKA 2UZ9A 1UG6A 3C9NA 4DP9X 2OXNA 3DDGA 1N6QL 2OX4A 2VP8A 4P4RA 3D8MA 4H7VA 3RU6A 2CKSA 3H3PH 3CUPA 3UG5A 3V9EA 3IIXA 3WLBB 3L95A 4JKPL 3JUYA 2OLAA 3DG6A 2GTZA 2BJML 4PULA 1AXIB 3EYSH 3MRRA 1YYAA 4C1NA 3KBHE 1NANH 4GW5B 4HUVB 1Y18B 5F89B 5GS1C 4GZEA 1XIWA 1Q7ZA 1ZRUA 4POZD 3P9MB 1FFOB 4NG3A 1QSVA 1IC4L 2D7OA 3GSWA 5E9NA 3X11B 4HUWB 4CD7A 3DROB 2EE2A 5C70A 4MB3A 3CZLA 5HHME 4KT2A 2VM4A 2BNQD 4DEWA 3PBWA 5B1AB 2F58L 2C9AA 2ITFA 1IJNA 1GCFA 5JYLA 1N8OE 2ETWA 2F7RA 4OUUB 2PAJA 3U7AA 1QRQA 3R8GA 4X7EC 4J3BA 3SY6A 3VXMA 5BVJB 2G4FA 2CHDA 1OAYL 1DJSA 2FGZA 4MJJA 5AC8A 4Y19D 4AGPA 1BMGA 2VH5L 5C0CD 1G4EA 2W94A 1ZGLP 4MCYA 3W1PA 5FD0A 1IWPA 1XGQB 3CN4A 3EWZA 4FI8A 3GHSA 4UV4L 3CC1A 5F3HB 3OKDB 2P8LB 3QC6X 1BOGB 5FO2A 2F8XC 3CPLB 1JDEA 1K9FA 1I8IB 3KPNA 5FYLL 3OKNB 1E6OL 1YY9D 3PDDA 5D7IE 2WMHA 4HC1A 4HUXA 5AL8A 4AW7A 1OYCA 3DC8A 1WITA 1RZQA 4ZS6D 3GK8L 4O16A 1UENA 5C0IA 3O3DB 4ORGA 4MWAC 3X13A 5CIPH 3WNIA 4MPQA 2R1YA 3S96B 2D7NA 1DVSA 4EPDC 2P5WB 4EEEA 3D3VD 3W7LA 3LNFA 1WYIA 4JB9H 4F2MB 1XR8B 4F7CB 1NFIB 4NXSA 5E5UB 2WTRA 1K8CA 1FHNA 2NXZC 4X98A 3W11D 1DEEB 2C4XA 3KWWB 2A1WH 3GB7A 5MHSD 3B40A 4NOFA 4UYQA 3SQOL 4HKXB 4HTBA 1J7VR 5EDXA 1DDHA 3D4GA 4KZ0A 3AG3B 5INCB 3WUZA 5FF6A 3FEMA 2YJQA 1ZMYA 4NNAA 3UERA 5AD0A 2AOSA 5K33A 3C08H 4IF2A 3T1GA 1PX4A 3SY1A 5K4ZA 2P8CA 4QAWA 4HU8A 4HIJB 4Z0BH 1OF0A 5ENWA 2YPLB 2IO5A 1GR7A 2VO8A 2GJ6E 4OI9A 3SDXE 2BVDA 5TGBA 4JJ5A 2DB8A 1U8JB 4U0RB 1IQWL 1R7AA 4PJDF 6A3HA 4XP9H 1WAAF 2GZXA 2JQMA 2HG5A 3FK4A 2FD6L 2EXTA 3DHPA 2X2JA 3EJRA 4LLVA 4NSKB 5LGYA 3ZSTA 5KSUB 3W01A 5I2IA 4WFGD 4ZTEA 4G70B 5F2LA 3W75A 3MV8D 2MNRA 5B8CA 1F02I 3ISWA 4YE0A 4Q58C 5KG9B 1ZVSA 3WQPA 1CICA 1ZS8B 3CAQA 2VWEC 5EOCL 3LRGA 4O51B 4AUYA 3PBGA 3MT1A 4WGWB 4XP6L 1X1ZA 3UPWA 1BMWA 2OMTA 3LXUX 2DIJA 4R8WL 3QQ0A 3ZDZB 5DCEA 4DAGH 1KN4H 4TPRH 5F7HA 2DYPB 2DKUA 3ZYZA 5E1GA 1UYWL 3U6XA 3VGGA 1ONQA 2W1NA 3LS4H 5DD5H 5I1EH 4IXXA 2WIIA 3IPWA 4WW2B 5LXVA 2ENPA 5D71L 4MAYB 3ZE2E 5LGHL 4XC1H 1EJ6A 1CLKA 2PZNA 2J88L 4HIXL 3GRBA 5GJTL 4O19A 2EXYC 2HNEA 1BTMA 4PJ9C 3OMAB 8TIMA 3ZRCC 3C5SB 3IJ9A 4WNQB 2E6DA 3EOLA 4NQSA 5IR1B 1RZ7H 3KYAA 2G8ZA 3R4DA 4OV5A 1CVRA 5D1ZB 4DT2A 3PHOB 1NCHA 5E1QA 2ZWYA 1AKPA 1BA9A 3G3DA 4JG0H 2XTJD 1E71M 3VNKA 2WIIB 3WG6A 1IGFL 2MRYA 3AQDA 2PP0A 1H5BB 1MIML 1ONQB 3B7SA 4K7PL 1AZNA 3G5VA 4P8QA 2GJ6D 5DMYA 1BVNT 2A0NA 2VDGA 4E0CA 2XN1A 1TZ9A 3ASOB 4JYEA 3M17A 3T3ME 1YQVL 4KKQA 2ZRYA 5IVXB 3T0AA 4LYKA 3R8RA 4FA6A 4AZCB 5DT1H 3BOXA 4AUJA 3WENA 1T6BX 4R96B 5J1SC 3DU0A 2J74A 2CKBH 3HGOA 3ETTA 1JNHB 3MRPB 4OUEA 5E08L 4DWSD 1EAPB 3QJOA 3W7JA 1DBTA 2HJKA 5KSUA 3GBNL 3MLZH 4H8WH 1SNRA 4MJ4A 1J01A 2OMVB 4MAVA 3WUBA 2F7OA 1AC0A 3J07A 4JVPA 3QQ9C 3UIZA 3ARDB 2CERA 3AALA 5GS3A 1OK4A 1F3EA 1JZ7A 1Z6JT 2Q3RA 1TTFA 4PMNA 4QFUA 3TEVA 3QJFB 1Q9OB 5CHNB 4ZUWA 3ILPB 3NGBC 4M03A 4U31A 5C08B 4CKVX 1P0NA 4MDJB 1OHQA 4JVWA 2P5EE 4WU7B 5CZXC 4DP0X 4UDTA 2IKGA 2ZRUA 1SM9A 3GDKA 3JS3A 4NQCD 4ATTA 3XISA 1A6VH 4QBXA 6PTDA 1SDDA 3HM7A 5H2BA 3QHFL 1PCSA 3I3EA 3QJFA 3FAWA 1I1YB 1OCCB 5L7XH 2WKJA 1TOXA 3ITLA 2OJEB 1LWIA 4NPYB 3P6LA 3V7AG 2IAMB 1OW0A 1IGIH 3VYNA 4PJGE 3MO4A 1HEJC 1VEPA 3MSRA 5AW6B 2N0MA 5AFDA 1PKLA 4DP7X 5AC5A 3F4DA 1MFDL 2H1PH 1E0VA 3HO8A 2A74A 2F53D 3O2VH 1S78C 1KFLA 3NZ1A 1KBGL 1ZTVA 4NKDB 4PJGB 1V0KA 1VS1A 4O4WA 4OV4A 4A29A 4J2PA 4OCSL 4KKPA 4H3DA 3LEYL 1FNGB 4LDOB 4D7PA 1QHPA 1R47A 2RA1A 3G5VB 4BZYA 1QK0A 3PNZA 3JWNG 2A3LA 3SUVA 5GS0D 4DNMA 3E02A 2C71A 5ISZD 4WFHD 2VGFA 4IMEA 4O4YH 1J10A 3LPOA 4CMMA 4M82A 1MHEB 4B4HA 4UTUA 3NL3A 4LCRA 5EPMA 3JUGA 4I9XA 3M4HA 3FFOA 3WLWC 1MH5A 3RVVD 3IMTA 1FWEC 2VZUA 1WHOA 1IEQA 2QKFA 4LMQI 3C61A 3QSRA 1GZJA 3GUFA 5FYJE 4H8QA 4LCIL 2NQDA 5AALA 4PS8A 1K3ZA 1R3JA 1O7VA 1SMAA 3GDCA 4H25B 3T0VA 4ILSA 4C4UA 4RLIA 4N5ED 4ERGA 2NVCA 3WHXA 3GO1H 4N8PA 5CC3A 5DJ6B 1TITA 2CNYA 5DF0A 4JREC 5CD5D 2FFCA 4HUWA 5EC1A 1R3TA 2R6OA 3HRPA 3ZZSA 3CHEA 2MOQA 1WA2X 3L7FA 3UZJA 2H3DA 4KTDH 3KVMA 3E74A 2E6JA 2G4EA 4AVHA 5C2BL 2GY7B 3EYUH 4JQIL 4KXZI 4KFZC 1G7HB 3QG6B 2IDUA 1KY7A 2O5NA 4XVOA 3LRLA 1T7LA 2OL3H 2A99A 3DHMA 1LXMA 4WRHA 4QNEA 1QSED 2MJWA 4PRHE 2WOBA 3X3FL 2BIQA 4DVOA 2X2HA 5EU5A 4HJ1A 3WKML 1F6AB 4DGIH 5B3JE 4JFEB 5FKPB 2XV0A 1JNNH 3C9NB 4FABH 4J2XA 2DZSA 5F2MA 1P4IH 3TCSA 3W9ZA 4LSSH 4U10A 2O1AA 1J6OA 1M05B 1PZSA 2ZXGA 3KLAB 3GLZA 3MJ7A 4NQTA 5FB8A 3VXRA 5F9WC 3TN0A 3WIAA 3BWZA 5I0WA 3PF2A 2XVBA 1BVKB 2VXSL 1H7WA 4JFEE 5C1MB 2IADA 3GO1L 1W5QA 4DWSB 1YUKB 3AFBA 3K72A 4PMFA 3I02B 1T6MA 4O1DA 5I15L 1E40A 2EDDA 1PJWA 2DZEA 2XQYA 3UH8A 2Q8XA 3B03A 3KPRB 1TSIA 2ZXEB 3U4BH 1D9KA 1WG3A 5LBSH 3G04B 3UACA 4OJYA 1CDHA 2WXQA 4OBRA 5JORA 1XR8A 4R6UA 4F7CA 4IXHA 3TYGH 4CQAA 1GOXA 4D2JA 3EOOA 4BGDA 2JE8A 5DRZA 3VWKC 2XWJB 5TE7H 4WEMB 4BWWA 5T9BG 2AV1B 2R1NA 3G6AB 3CT2A 3S48A 3P11L 3X1FA 1IE5A 1H49A 2N7AA 1MJ7L 3S8FB 1L0YA 2VJXA 2PLJA 4DZBB 3R7RA 3CPLA 1TIMA 4PM1A 3ZMNA 3BEVA 1RK5A 4LDCA 2TSAA 3APMA 5GISH 4B0MB 1PFOA 4D8PA 4JFQB 3NO1A 1J5IA 1IGJA 4PWEA 3GJFK 5G4MA 4IRSB 5CU5A 3ZDYB 1F58L 3QPYA 1BQ5A 3HUJF 2UY7B 3CDCA 4AXKA 3FB5B 3W28A 3ARYA 3NCYP 3N2TA 3E5PA 1A3LH 2F5AL 1GVFA 5IT2L 5AYXA 2WNZA 2ZG3A 1P5UB 3CYJA 4GRSA 4OUUA 3LCXA 2ZF9A 4GPVA 4W68A 2DQDL 1ZEAL 4M7KH 5HHXH 2DSWA 4WV1C 5FM8A 4UFMA 4AVFA 4DWSC 4GG8B 1QTPA 2G3NA 5I76B 3WL1A 2Z91B 4Q4RA 3K6NA 3WFAA 2YPVA 3MRIB 3AWEA 1G6RB 4DN4H 1VFAB 25C8H 5C0RH 1ZANH 4M62H 3I84A 3KPSB 4NUPA 3TN0C 4GW5A 1AD1A 1HJQA 5I8OH 2GSMB 2QQLL 4Q8MA 4C1NB 5JU6A 1KXQA 4ANVA 4OQ1A 5KVDH 1H15A 3ROOA 4QRQA 1XKJA 3P82A 1KEGH 2BG5A 4PFHA 3FRPA 2E9BA 4FG6C 4L9YA 3PREA 3KLLA 3NA9H 4GKNA 1DANT 1I60A 4NC0B 3TZVC 3SPVA 5CMAB 5JPNA 4AT6A 4A6GA 4WLCA 5FF0A 4ZG1A 5EMKA 1CK0H 5I73B 1P4LB 5LNRA 4M7JH 1M7JA 3CB8A 1FN4A 2BO0A 3LVEA 1BGAA 1ECEA 4WUUD 3USZA 4R3UA 2P46B 3PRZA 5I1IL 3E0WA 4JIEA 3WH8A 5LIXX 2DD8H 3T0CA 4DY1A 4DUWA 4ZDHB 1ZHAA 3H0TB 3NEEA 3RLSA 2OWCA 3MNVA 5I71C 3CWNA 1VFHA 1HXKA 3A4FA 4X5LA 2FWUA 2WBJA 1UZHA 4JRXE 3NDZA 4GBXA 3ATZA 3WNLA 2R56L 2WZ5A 4YSCA 1G9HA 4WEUD 1H8NA 1T7WA 3D2UD 1J5DA 4P5TB 1IT8A 1XR2A 5FO8A 4FK9A 1RUML 1ZHLA 4OQTL 4E9RA 3ZDYF 1EDTA 2DZUA 3QDJB 4KDVA 4FKKA 4JN6A 3FA5A 2MQ0A 3N9GL 2RCSH 3IWPA 4FNRA 1EF3A 2E1DA 3NBNA 3SYQA 3EXTA 3ES6B 4OM1L 2C1PA 3M7WA 3CQFA 4FR1A 4R27A 1CLCA 2XH7A 3BGFC 2NY3B 4EPSA 3PZOA 1SEBB 3BVWA 3L5WA 4PTUB 2EABA 3KHJA 4E9QA 2QV2A 5AW2B 4YHKH 2CHRA 3ATBA 2OQJB 2X1PA 3FNKA 4X6EA 2ITDB 2Q8AH 2V7HA 4MQTB 3VH8B 4C7FA 4XGZA 1SM3H 1XVSA 1BSIA 1P48A 4W9TA 1WVZA 2NY4D 2E68A 3SR7A 4UTWC 1HE7A 4L8CB 2J77A 1QPKA 4NDMB 4Q4SA 2P8PA 2QSCL 2I9TA 2PP3A 2ZCHL 1NIFA 1BX2A 4K3DL 1I7RA 5D1QA 1HHHB 2VZSA 2WUBL 2YSWA 4L4TE 4I0PD 4CBPA 3KX6A 3VC6A 4XIMA 3VOCA 5D9NA 2DLFL 4FADA 2DQJH 2NNAA 1PKQB 4U1GC 3AZSA 2GDQA 3IS0X 4PN6A 1B1YA 3BN9D 3HR5B 1O6SA 4YO0A 4AYEC 3W6YA 3BUYA 1K70A 4BRJA 2GUOA 3GRWA 3PLYA 4O9HH 2V5RA 3SFWA 3T55A 4HWZB 4MNHA 3SGJC 3GKZA 4AL8L 5I18L 2O7SA 2DQCL 2BVUA 1XGTA 2VISB 1OGAA 1WDAA 4ZW7A 1VFLA 3EWWA 3GTNA 5KVDE 3TN5A 2JSFA 4Y4HB 5D7LE 1RZKC 3BPNB 1DQTA 3GHUA 4MA3A 5I75C 4GPNA 4WIQA 5D05A 5A43C 4H1LB 4CSSA 3TYGL 3CHVA 1MPAL 3RL1A 1LO2L 3CHFA 1UOWA 3LG3A 2JTYA 4B2DD 3MRKB 4PUBL 1TZ7A 1BVOA 1P2CB 4LVAA 4W8LA 3TEUA 5FW8A 2A77H 1K9DA 1HVQA 1ZTXE 3NQBA 1UWYA 4JHBA 4Y4FA 2AEQH 3MOAH 3B0UX 4MXWH 4AEFA 2UWFA 2ZYSA 2OTWB 2N7SA 1GPFA 4KFOA 5HDLA 4P59H 5J11C 1IAOA 5IFHL 3ATAA 2EYRB 2E5BA 1U91A 1LO4L 3KGSA 4N90D 3BIAX 4WV1B 2ZF8A 3IF1A 1S7WA 1VHPA 2IMMA 3DKJA 1IGMH 3LSOB 1C12B 1IEWA 2WC3A 2WYSA 4JQ3A 4N4PA 1DFXA 3WUGA 4MNGB 2GTWA 3TYAA 2ZUMA 4A37A 4EK7A 1DQJB 1B3JA 5HHOE 3WKMH 2GGGA 3N6JA 1BWWA 2IGTA 2C91A 2O5XL 1E6JH 2YLHA 2YOAA 3CHXA 4X80L 1HZHL 5LQBL 4GFSA 1D5ZB 4JRYD 1RAKA 4ZMTA 2E6AA 4JG1L 3KHQA 3BP6B 4PMDA 1E3ZA 4DM2A 5DN1A 4GUOA 1NOFA 5E9DB 1C90A 1W8SA 3NABH 1YKWA 5GGSB 4FXGB 1R2TA 1X7IA 4Y8FA 4AM0B 5HI4C 3FGCB 1ILUA 3I6TA 4O1AA 1D7FA 3LHYA 1YUHA 4BFAA 1B4JL 4JG1H 3V1HA 1DE5A 5A94A 5CNHA 1JUFA 2LU3A 2AK4D 5IQLA 5B1JA 4ONVA 1I8KB 4JO5A 5KYNA 3QFDB 2Z26A 1DLFL 2F53B 4J4PC 4Z7QF 5J9PB 1TPB1 3EHBC 4P9MH 4IBVA 4ZR8A 1FVDB 4F7MA 5HYSA 4GG6E 2MQGA 3L4ZA 2BTMA 4B9JA 2IXUA 1LO4H 3A3XA 1J9QA 3T4AC 5EUKB 2VDMH 2N3JA 4FNTA 4Q9QL 1YEJH 2F1AA 4JTGA 4TX9A 4W7WA 4K4KA 4AQ1A 1L0QA 4DNHA 3V6FA 3SGDH 2WP3T 3PGCA 4NJAH 5AB0A 1AGFA 2PDJA 2Y8VA 1KNWA 1R6WA 4ABVA 4OI8A 3BPCA 4UNIA 3O4LD 2Q7YB 3KW3A 2POTA 2W66A 1XL6A 2HKFH 1FBIH 3MAWA 1X38A 4M43H 3FEQA 4ICMA 9XIAA 2OTPA 3G0XA 4KKBD 1LHZA 3P3YA 2D7QA 3II1A 3IMSA 4NUQA 2B7NA 1EFXA 4NNXA 3I9GL 1W1A1 3D0CA 2CNZA 4RGMC 5SX5H 4DCQA 3G1DA 3CSBA 4R7NB 2YD8A 1RHFA 3ZHKA 3N17A 1MFCH 2KL6A 1WFJA 4PRID 1XF3B 2DQCH 4AC7C 1U4FA 3D3VB 3VSVA 1XBVA 4J3OG 2DW5A 1TVHB 3DNKA 1WD9A 2EIMB 3H8NA 3THAA 2RFGA 5FK9B 2BH0A 1OAZL 3T3MB 1XSOA 1ZLVK 5LGHH 2VFFA 4M5YL 1KG0B 1XAUA 3MFFB 4H01A 3UYIA 3V4VH 4PH8A 4PGDB 2O61B 3CZUB 4HS3A 1PBYA 3TXAA 3F64A 1UYWH 2PBOA 5DX7A 1RCOB 1YNLH 1FHVA 5B4MD 2I56A 3AIBA 1FI8C 4WO4D 3C86A 1SM3L 4FZ8H 2JVUA 3TH3T 2CZ5A 3MCKA 7ENLA 4R7VA 1I3GL 2H6UA 5IBTL 3SPGA 2Q8AL 3UTSB 4B9ZA 2YA2A 3GNML 5KN5B 3MZ2A 3EDDA 4QRUB 2VL5B 1O4UA 3C5QA 3DJTA 2VLJB 4KEUA 1BZQK 3DJ9A 4DVRH 4HOMA 2WMKA 5TDPA 4DZHA 1KPVA 3KXFB 3QCVH 1I2QA 2DSUA 4OZFB 4ZTPL 5E2JA 1T1WA 4GQRA 5MEND 1UWGH 1ID5I 2A4CA 2XIDA 5GJPA 4X5XA 2XN9A 1Q6GA 3QIBD 3WH9A 5FHAH 4Z0BL 5IHHA 1UCTA 4ZB2A 1I85A 3F8UB 4OTXH 5E4IA 5HHVL 4UMGA 4XNBA 4FX8A 1KCSL 3RPDA 2OM5A 2H9GA 4B5ZA 1E1EA 2A6IB 2V37A 3GIQA 3MSPA 1RLCL 4KAQH 2RIKA 5AEAA 3SZ6A 3QFWA 3STCA 4LW7A 4NT0A 5HSFA 1DKWA 2XFRA 5DT5A 4DGYL 1QI2A 1UZDA 4K9JA 4ZQKA 4R0LA 1T2QL 2QPEB 4QDPA 1FJ1A 1O1ZA 4HCFA 3ZTJH 5FX3A 5T5FA 1DLHB 3UBXI 3A5FA 3IRDA 2F8VA 3BWUC 3TT1L 1IC1A 1AG0A 4JDEA 5D71H</