3AJ7A

Crystal structure of isomaltase from saccharomyces cerevisiae
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
586
structure length
586
Chain Sequence
SSAHPETEPKWWKEATFYQIYPASFKDSNDDGWGDMKGIASKLEYIKELGADAIWISPFYDSPQDDMGYDIANYEKVWPTYGTNEDCFALIEKTHKLGMKFITDLVINHCSSEHEWFKESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSYFGGSAWTFDEKTQEFYLRLFCSTQPDLNWENEDCRKAIYESAVGYWLDHGVDGFRIDVGSLYSKVVGLPDAPVVDKNSTWQSSDPYTLNGPRIHEFHQEMNQFIRNRVKDGREIMTVGEMQHASDETKRLYTSASRHELSELFNFSHTDVGTSPLFRYNLVPFELKDWKIALAELFRYINGTDCWSTIYLENHDQPRSITRFGDDSPKNRVISGKLLSVLLSALTGTLYVYQGQELGQINFKNWPVEKYEDVEIRNNYNAIKEEHGENSEEMKKFLEAIALISRDHARTPMQWSREEPNAGFSGPSAKPWFYLNDSFREGINVEDEIKDPNSVLNFWKEALKFRKAHKDITVYGYDFEFIDLDNKKLFSFTKKYNNKTLFAALNFSSDATDFKIPNDDSSFKLEFGNYPKKEVDASSRTLKPWEGRIYISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structures of isomaltase from Saccharomyces cerevisiae and in complex with its competitive inhibitor maltose
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords Oligo-1,6-glucosidase
total genus 231
structure length 586
sequence length 586
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2010-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3aj7A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3aj7A01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3aj7A02
3AIBA 3HZ3A 4HMEA 1NP2A 2VRKA 2OYKA 5HPOA 4TTGA 1WP6A 3NDZA 1MQQA 1CZ1A 3U5UA 2WMHA 1JNDA 3W0KA 1HNYA 5D4YA 2XIIA 5M3WA 3VIPA 1ISXA 3AFBA 1TVPA 2JIEA 2OSWA 2EJ1A 4JIEA 3VD5A 1PS3A 4PTVA 4AD5A 5I6SA 4V27A 1K9EA 1S46A 5JBDA 3ZSTA 2C0HA 5A1AA 3W38A 1UD8A 2WVUA 1K9TA 3VINA 3WMSA 3UESA 5A8MA 2ZOXA 4LYRA 4QDMA 3M07A 3K8LA 3POCA 1LG2A 3K4AA 1U2YA 1VFFA 4U5KA 1J9YA 1E6ZA 1LF1A 2JFEX 4TTUA 3ARPA 4KMQA 4BQ5A 3I3DA 2FH8A 3WENA 4JZ5A 1WDPA 4DWSA 3VNYA 2VCCA 4EE9A 5C8BB 1CXHA 3VDCA 4AYSA 4EANA 1WB0A 4CD4A 1OGSA 3FAXA 1BGGA 4S3JA 3VVGA 2J7EA 5BCAA 1XH0A 3KLKA 3KZSA 2DEPA 4DO5A 3DYPA 1DWGM 4UFLA 4GKLA 1W9PA 3THCA 4ACZA 1WKYA 1GNXA 3T2OA 5ECUA 3GBEA 4H04A 4WF7A 1H3GA 2YL9A 1W2VA 4H7VA 1B31A 1EXPA 1HKMA 2BXYA 1IZKA 4WIWA 2V3FA 2J7HA 1HX0A 4AD3A 1UZ1A 5A3HA 3SCPA 2ZUWA 1J0JA 2QMKA 3BUDA 4PEEA 1GHSA 3MSGA 5CJ5A 2VJXA 5D9NA 1K6AA 3OLDA 2GK1B 3ALGA 2ZUVA 3MKKA 1DP0A 2XJ7A 5HPCA 2VRJA 3WUFA 9CGTA 3AHXA 2X09A 3N1AA 4CU6A 4YPJA 2CBIA 3N04A 3FHQA 2C7FA 1E40A 3LRMA 1C8XA 3WH7A 2IXUA 1BG4A 4J3SA 1TR1A 3KE0A 2V5DA 3SCOA 1UWQA 4BS0A 1JAKA 2WNWA 4JAWA 2JEQA 1PPIA 3KWXA 4MPKA 3CH9A 4YN5A 1GVIA 3NIYA 1AQHA 3WNLA 2VCAA 2ZE0A 4BQ3A 5BXTA 3DYMA 4BF7A 1V0LA 2JIWA 2OSXA 1PBGA 4R27A 4OIFA 2BV9A 1CXFA 1UG6A 1TZ7A 4ML4A 4IPNB 2D1ZA 2WSKA 1GOOA 2Q8XA 4WSJA 4AZ7A 1TFVA 3PBGA 2F1AA 2E3ZA 4U33A 1EIBA 1WNOA 1HP5A 2Z1KA 2DPEA 3GXMA 2J8FA 4S3KA 2J62A 5DT7A 1R7OA 4AMWA 3HN3A 1JZ6A 4HU8A 1WDRA 4DUXA 3FAWA 3IGUA 4FNQA 3ZT5A 2X2JA 2YBUA 3AIWA 4HA3A 3J7HA 5DT5A 1V3JA 1PEZA 3PZMA 3AS1A 1QWNA 1NH6A 1RP8A 1CXEA 2XN0A 2GDUA 2W61A 5GNXA 1PZ2A 1WO2A 4CD5A 1E3XA 3TV8A 2WBKA 4AZCA 2RGMA 2YBTA 3VMNA 5E0FA 5IDIA 4WLCA 4PMOA 3AIEA 1H2JA 2A3EA 4ZFMA 2OWCA 1JZ4A 1HJXA 3ZR6A 1CXIA 2J47A 2VX5A 2VX7A 7A3HA 4F79A 3T0BA 3WEZA 4HPGA 3WQ6A 3KLLA 1OBAA 2DSKA 3FW6A 1RP9A 4XV0A 2OW7A 2ZUUA 1Z32X 5AYBA 3EJQA 1I75A 1QI5A 3PTKA 1MWOA 1J0HA 1ECEA 3DX4A 1GVYA 1JZ2A 3AIVA 1C3FA 2RGLA 3WH9A 1HVXA 3BXWA 4B3KA 2F7OA 2WZIA 1JXKA 1R7AA 1WZLA 2NW0A 4W7VA 5A6LA 1V08A 5FL1A 1W1VA 4HOXA 4HA4A 5EFFA 3PHAA 3LXBA 3ZJ6A 2FGLA 6TAAA 4GQRA 3D52A 3WELA 2J7BA 1FP9A 1B2YA 2VTFA 4P8VA 1QI4A 3AISA 4UQBA 2G3IA 3TTOA 2CKRA 3RPMA 2XVGA 4AMCA 4NSBA 3CZLA 1QNQA 1GJWA 4PN2A 4B9YA 4NZCA 3RM9A 3LXAA 5ABFA 4D1JA 1XH1A 1Q4NX 2F7QA 1M03A 1UWSA 4PMVA 3VD9A 2J7DA 1B3XA 3LMYA 4E8DA 5E1QA 4NF7A 1KCLA 1QHZA 1OIFA 3UEQA 3ZJ8A 1G0CA 4DWSB 2CNCA 4J28A 1YQ2A 4PMNA 4JFUA 4LX4A 1HKJA 3WF4A 1ESWA 3CBWA 1R47A 1TQUA 2WCSA 4GI6A 2VR5A 3WBAA 3GH5A 3D4ZA 2D3NA 1UD3A 3ZIZA 3IJ7A 1YHTA 1ZJAA 2DT3A 2EPOA 1B3ZA 4Z2KA 5E9AA 3ARZA 1UKPA 2CERA 2F1BA 4L4PA 2NT0A 1J11A 1QWUA 1E4MM 2E9BA 3WQ5A 4LQ1A 2WMIB 4UQAA 3A5VA 4GPNA 4AZ6A 1MQPA 3UG4A 3F5KA 4EAMA 4WK9A 2GJXB 1FP8A 1HIZA 3LXCA 3UG5A 5A2CA 1B3WA 4UFIA 4HOZA 2VI0A 4IUGA 1FFRA 1HP4A 2VVNA 4P7QA 1JYVA 4UQDA 3OZOA 3VD3A 2PWDA 5IXEA 1MFUA 4CGTA 1EDGA 1CIUA 3CUJA 4DWSC 4ATDA 1HJQA 3GXDA 6A3HA 3BAYA 2GSJA 3TTSA 1JFHA 1GHRA 1W3LA 1OGGA 1NM9A 1J12A 2WKGA 2O92A 5LA1A 3CZ8A 4D6GA 4HP5A 4E8CA 4WSKA 1GQLA 1KWKA 2WZEA 3WMCA 3CHCA 1H11A 3AZRA 4JHOA 4KWUA 4AD4A 3VDBA 2DDXA 1NWRA 1G94A 3RO8A 2WMGA 3BVXA 2X8RA 5EBAA 1H4PA 1VF8A 5FOOA 2F18A 2W62A 3GH4A 2CXGA 3WEMA 2YA2A 3T09A 1C7TA 2WXDM 2V3EA 1M7XA 4D6CA 4B9ZA 2W63A 1E4LA 1XCXA 4MB4A 4LYPA 2VC9A 1JDDA 3DX1A 2CPUA 4W8LA 3W27A 3DYOA 3GH7A 1DHKA 5JBEA 2VZUA 3AOFA 1FH7A 3MV11 1J10A 1VFMA 3AIUA 2XM1A 3AHTA 1QW8A 1QVBA 2E40A 3WKZA 1E70M 3QGVA 2YA1A 3OA5A 1E55A 1OWQA 1V6WA 2CBVA 3WNPA 3UR7A 1UH4A 2X2HA 1EQPA 5LYRA 3BSHA 1KXTA 4OBRA 3DHPA 1TUXA 3CTTA 1PJ9A 1QOXA 3CLWA 2QLYA 3TONA 2GVYA 4V28A 3BUPA 1HJUA 1I1WA 1PX3A 3VM7A 2XG9A 4WJXA 4QLKA 3ARXA 3A4WA 5I78A 3PZIA 1OD0A 2WVVA 4AD1A 1UA7A 1VFOA 3NSMA 2WVVB 3GXFA 2VURA 1R85A 5BWFA 5JBFA 1F4HA 2DT2A 4J3UA 4MAVA 4JCLA 4D1IA 1KBKA 4B15A 5I2UA 1R75A 2ZUMA 2DQXA 5JUVA 2X2IA 2A3HA 2O9PA 4JKLA 3VGHA 3HG4A 1NARA 5A6AA 2BHUA 3EJSA 1W3HA 4QFUA 3W81A 3VSVA 2V3GA 3LPFA 4MADA 2GUYA 1WPCA 1PX4A 5BXPA 3QHNA 2XVLA 3D4YA 1PZ3A 5BROA 4HZ7A 3WF0A 4D6JA 3BUBA 3GZAA 1FHDA 1E0WA 1BQCA 4MNKA 3TTQA 1OD8A 3WFZA 1CGWA 1UKTA 4M81A 3QOMA 4MNLA 1EHAA 2EPKX 1UR0A 1AVAA 3VGEA 1A3HA 1VJZA 5AY7A 5FD0A 1EO7A 1ZS2A 2DIJA 2ZX9A 4AZIA 4AYGA 3D5HA 4P8UA 1K9DA 3EMZA 3BCFA 1JDAA 3IAQA 5I79A 2F8QA 1KQYA 1OSEA 4RE3A 2XIBA 4TUFA 5I3DA 2EAEA 1E0XA 2WHJA 4NRRA 4D6IA 1B3VA 4M1RA 1W32A 5ABFB 3A3HA 1BYCA 5AC5A 3GXIA 3RJYA 1UWUA 2YJQA 4MDOA 4J3VA 3SCTA 3U7BA 4Z2GA 3ARSA 4PMZA 1G01A 3CZJA 4BZYA 4AZ5A 4PCTA 2WB5A 5LA2A 1RH9A 1HF6A 2QHAA 3T0AA 1EDTA 1W9UA 1CNVA 5A2BA 3L2LA 4ATLA 1LJYA 4ATWA 1VB9A 2VZTA 3EJRA 1AQ0A 1JL8A 4P7RA 2EADA 4TVDA 1G5AA 4GZEA 4UQEA 5IFTA 2Y5EA 2CHNA 1CWYA 1UR2A 1QI3A 1ITXA 2WZHA 1H0IA 3W24A 2PF0A 3WY4A 4UFJA 1ISVA 1KFWA 5CSUA 1WDSA 2E9MA 7TAAA 3ARYA 1W9BM 3N18A 3NJ3A 3U57A 2NSXA 1CTNA 1BYAA 4PMYA 2WM0A 3M7SA 4TOQA 5IHSA 1C8QA 5ABHA 3WF2A 3T2PA 1VAHA 5HXMA 4JFSA 4OZOA 1TE1A 4UFKA 2TAAA 3W6MA 3DDFA 4FLQA 2ZUNA 3VSTA 1J0YA 4DUWA 1GOMA 4NZJA 3M6DA 1GJUA 1G1YA 2EBNA 1OINA 4FLRA 3AMDA 5A6JA 3AXIA 4URIA 1A47A 4AD2A 1CGUA 1C93A 3WDIA 3L4UA 4CD8A 3GNRA 1PX8A 5ABGA 1MVYA 5CQ1A 3AHYA 4D72A 1R87A 4GXPA 3WSUA 1ODUA 4CN4A 1QX1A 3A22A 3AZSA 2XFRA 3AHZA 1JNEA 1KQZA 3WUGA 1GPFA 3I3BA 2AMGA 4FNSA 3OLGA 4W7UA 2PWFA 4GIAA 1CGYA 2XVPA 4W88A 2O9OA 4BQ4A 2EO7A 4NI3A 3G6MA 4UNIA 3BVUA 3L4ZA 1UUQA 3U7VA 4U2YA 3S5ZA 1JF6A 1QI2A 3GNOA 3VIJA 1E43A 1MW1A 3BAJA 3A4XA 5DO8A 1WDQA 3S6TA 1XHGA 1GCYA 3EDEA 3BAWA 3O9NA 5E6ZA 1V3LA 4OOZA 1VJSA 1ITCA 4JKMA 1T0OA 1H0GA 1WZAA 3II1A 4Z2HA 1E6XM 3VMOA 5CPQA 3ZT7A 4JKKA 1KCKA 3GXNA 3WDJA 2OWXA 2WBGA 1LWHA 1LLOA 3MI6A 4TX6A 3RM4A 2PWHA 6CGTA 1W9DM 3CMJA 1UD5A 3VGGA 3VIMA 3PZTA 3EJTA 4X9YA 3SCRA 3PZNA 1XSJA 2X2YA 3ZSSA 2DT0A 3ARRA 5HOSA 2MANA 1MW3A 1EHNA 3N17A 2XYLA 1H1NA 2AAAA 2CESA 3W29A 2IUZA 5TD4A 1VFUA 3ZOAA 3VKKA 1E6QM 3WMBA 2J4GA 1FH9A 4AIOA 1M53A 3BSGA 4K68A 1FA2A 3WD2A 3IJ9A 2FGZA 4W5ZA 2GDVA 3EJUA 3CZEA 3RDKA 2WWDA 1LWJA 4C7FA 4AEFA 2X0YA 1CENA 3SIMA 4Q22A 3AJ7A 4ZEPA 2XWDA 3S5YA 3WY2A 2UY5A 2F2HA 3CZGA 5A95A 3CUHA 3VSUA 2ZIDA 1JF5A 1E4IA 2V38A 4UTFA 3THDA 1JZ8A 2YDRA 1US2A 3KL0A 2FH6A 4M82A 5CG0A 2CIPA 1E15A 1HTYA 3MUY1 3SUVA 1MFVA 3SUWA 1XD0A 1TMQA 2D0GA 2V3DA 1O7AA 3BH4A 2E8ZA 2WHMA 4NZFA 1TA3B 5FL0A 3DX0A 4B3LA 4AIEA 3UR8A 3G6LA 1UA3A 3A23A 3O2LA 3CIVA 2WC4A 2DSWA 3WD1A 3BAXA 1KBBA 3EJPA 5I5RA 2EEXA 1V3MA 3AXHA 1CYGA 5A6BD 2BHZA 4PMRA 2WCAA 2XGBA 1IZJA 3WIJA 4GO8A 1OT1A 4PUDA 1JI2A 1MYRA 2JF6A 1E4NA 1V6UA 3QHOA 4CU8A 3B9AA 1KXVA 3ALFA 3W26A 5D8WA 4QCFA 1E72M 3KL3A 1WCGA 3UG3A 1FH8A 2YFOA 3B8SA 1KGUA 1JZ3A 1J0ZA 1FHLA 3MANA 1MXGA 4C7GA 1D2KA 3TTYA 3MS8A 5A8NA 4MTVA 2YIHA 1PIGA 1GZJA 2EPMX 5LA0A 4W8BA 2J74A 3NSNA 2WK2A 4TVCA 3AZTA 2G3NA 2D2OA 4M8UA 1R46A 1ZL1A 1XSIA 4FNTA 2A3CA 3WUBA 3EYPA 3N13A 1XCWA 4AC1X 1JZ7A 4BCEA 5E09A 3CHFA 1GONA 4E2OA 1XYFA 1GQJA 4CUCA 2YDSA 1ODZA 1XRVA 1DTUA 4H2CA 4F9DA 1IT0A 1H09A 2DH2A 3VIIA 4EK7A 2FHCA 4LYQA 1QNOA 5CLWA 4HMDA 4DWSD 5A8PA 3WF1A 3HJEA 1B9ZA 1CECA 2XGIA 3MUAA 4Z2JA 2ZX7A 2X1IA 4PRWA 3I3EA 2BXZA 4J27A 4A3HA 2XHYA 2G4FA 2O9TA 4DM1A 3PZQA 1DWAM 5AC4A 2F61A 1E3ZA 1VIWA 4OKDA 1ISZA 2BNJA 3W4RA 2VZVA 3CV5A 2A3AA 5ABEA 1KWGA 3CUGA 2WC3A 1E5NA 2VRQA 2VX4A 3VTRA 2XVNA 4P8XA 2X0HA 3LPPA 1VEPA 3WFLA 1EOMA 4MNMA 4FK9A 3A24A 2WPGA 4UFHA 1O7DC 1M04A 3EBVA 4EKJA 5I24A 4N0RA 3VGBA 3VU2A 1TG7A 3SURA 4PMDA 3K8KA 2W66A 4C7DA 2QPSA 5HDRA 5CGTA 2VNCA 3W82A 3KL5A 3EDDA 1F4AA 1QNPA 2XPKA 2VUYA 3VIGA 1ISYA 2UY4A 2BY0A 3GBDA 1EA9C 3BLPX 1XC6A 2J77A 3HG2A 3BMVA 3BLBA 2CKSA 1QBBA 4QLLA 3MMWA 3WQVA 5GQBA 4MB3A 2J79A 2VOTA 1UR1A 1H5VA 1C91A 4DM2A 2VT0A 1JZ5A 4U2ZA 2XVKA 1V0MA 3POHA 1UQYA 3D3AA 1U33A 3ARTA 2FHFA 4DO4A 2Y4SA 1V02E 2ZXDA 4OUEA 3IJ8A 2J75A 2FDMA 1W1PA 4U3AA 3T2QA 1XV8A 3N9KA 3OB8A 1C8YA 3D51A 1QHOA 1UKOA 4M24A 2F7PA 2J7FA 2WLZA 2G3MA 5IHRA 5I0DA 2WKLA 3VPLA 2BVDA 4U5IA 4KGLA 1Q6FA 3HG3A 3ECQA 1V0KA 3MO4A 5I77A 1RD6A 1BFNA 3CZSA 1LL6A 3L2MA 3UERA 2G3JA 3ARVA 2XN1A 2EPNA 1EH9A 3BVWA 3BCDA 2ZICA 3RCNA 2F7RA 4CVUA 4Z2IA 3L4XA 1OCQA 2D20A 1MQRA 3VX1A 1V6YA 2V5CA 4ZXLA 2JALA 3MU7A 1UWIA 4H8HA 1B30A 4UR9A 1HXKA 4XX6A 4TXEA 4FNUA 2CETA 2PWEA 2YA0A 3DC0A 3K1DA 2YL8A 4OBSA 5CPSA 1ZBKA 1GOWA 1V03A 2ESCA 1KGXA 3VIFA 2WSPA 4AEEA 4GQQA 3PZVA 4Q7NA 3OLEA 4CVWA 7CGTA 1HJVA 2WCGA 1EGZA 3MSDA 1BG9A 3E1F1 3DX2A 1QW9A 2YOCA 1UD2A 1QI0A 1W9XA 4PTWA 5A8QA 3WUEA 4WKAA 4HTYA 4M29A 4W86A 1BAGA 2D3LA 4MDPA 2PWGA 2VZSA 2W91A 4U31A 1H49A 2J7GA 4M56A 1SFSA 3DDGA 3WBEA 3BUQA 1N82A 3O6AA 3AIQA 1UASA 5A94A 2D22A 2CHOA 1CBGA 1GQKA 4AY1A 3W28A 3FHAA 1K9FA 2WAGA 1JFXA 4D6HA 1HWWA 3CZNA 4PCSA 1CXKA 2AOSA 3T08A 1C92A 3ZMRA 1U30A 1H41A 5AYIA 5CXPA 3WD0A 3SUUA 2O9RA 3VO0A 4J3TA 1J0IA 2WMIA 4IM4A 2ZXBA 1XH2A 1E1EA 3MUZ1 4Z2LA 3OGVA 3UETA 4Y7EA 3TOPA 2WMJA 2BS9A 1WE5A 1HKIA 2VX6A 3TP4A 2DSVA 1B0IA 2VVSA 4E4PA 1V6XA 2IGTA 3ZJKA 2OLHA 1E6PA 1LL7A 1BSIA 3WF3A 4RE4A 1DWIM 1TA3A 2EPLX 3BVVA 5GNZA 4F8XA 2Z1SA 5JIPA 3BUIA 4PTMA 4OJYA 2WC7A 5JIWA 1CLVA 2Y2WA 3VIOA 2BHYA 3L4VA 4PMUA 2VQUA 4AWEA 5CGMA 4F66A 4RE2A 3MMUA 4W84A 5IFPA 3VGDA 1KR0A 3WY3A 3WDQA 4JL2A 4H8VA 2WWCA 1E6SM 1KXHA 1R33A 3CGTA 3AQUA 1CGVA 3EDJA 4MJ4A 3AICA 2ZXAA 2J25A 1X6NA 3FXYA 1UWRA 3OGRA 2GFTA 1SR0A 3VILA 2YLAA 3VIHA 4V2XA 3WNKA 5M03A 4UOJA 2QPUA 5BXSA 3VM5A 2DH3A 1NWSA 3WEOA 5EB8A 4CKQA 5BRPA 2FE0A 2GJXA 1BYBA 4MB1A 2VL4A 3HMCA 4CN6A 5C70A 3FN9A 3RMEA 4UQ9A 2XFFA 1QHPA 1JGIA 2E9LA 3B9EA 2EQDA 3NCOA 4AZGA 2B31A 3CUFA 2BVYA 4H41A 1NOWA 3PN8A 3WDHA 5C71A 2Y8VA 3ZJ7A 1JD7A 2CITA 4N42A 1LL4A 1V0NA 5A6MA 2W5FA 5E70A 2WVTA 1KR1A 2CBUA 1UD4A 4JFVA 3WL0A 2VMFA 1OB0A 3IANA 5A6SA 2GJRA 3U5YA 4AD0A 5BXRA 1BVNP 2EXOA 4LGXA 3A21A 2JE8A 1QNSA 1BTCA 2G41A 3N11A 1VBRA 1UH3A 3EDKA 3SCSA 5FCZA 2VR4A 5F7UA 1R86A 4JCMA 1HN1A 3W37A 2WANA 2W92A 4R5EA 3RJXA 5M17A 1UHVA 3BC9A 1B3YA 5A2AA 3AMCA 3GDBA 2CYGA 3AHVA 3OZPA 4MB5A 1OIMA 2Y24A 2WMKA 2G8ZA 1HL8A 1WZMA 1HVQA 1JDCA 3HG5A 4CD7A 3ZO9A 2QMJA 1WZKA 4GZIA 3BVTA 3LPGA 1OGBA 3CHDA 3WD4A 1CXLA 4X0NA 3SCNA 3WY1A 1ZU8A 3EDFA 2PI6A 1J0KA 1VEMA 5D9OA 5GPRA 1W1YA 2BY3A 3VMPA 3W6LA 1NOFA 2WYSA 4FNPA 5A8OA 1KB3A 3ARUA 1P6WA 3OLIA 3FNDA 3JUGA 3AS2A 4PMQA 3NYDA 3SCUA 3WQ4A 1E56A 1E5JA 2OW6A 3SUSA 4CCCA 1GOQA 3CPUA 2DSUA 2DGAA 3WDPP 3WQWA 5BRQA 2OWWA 4X0VA 1G9HA 3L4YA 4TVUA 5E6YA 1E6RA 4DUVA 3AROA 4HA1A 1E71M 2XWEA 2D0HA 1DEDA 1HXJA 3VOCA 1TQVA 2E0PA 3S2CA 2ZX5A 1ISWA 2J8GA 2PC8A 2D0FA 1BGAA 2DSZA 3FY1A 4KRUA 4YHEA 1UYQA 4HZ6A 3BLKA 2X05A 2UY2A 3AMKA 4NRSA 1KTCA 1B1YA 1VENA 1HJSA 1Q6EA 3ZT6A 2IXVA 4H8UA 1UH2A 2HISA 2WW5A 1XGZA 3RIKA 3AIRA 2XSAA 5CSYA 4A3YA 1E6NA 1X6LA 4HU0A 2DT1A 2XSBA 1D7FA 4W8AA 2YL6A 3GXPA 4BQ2A 3SUTA 4BA0A 2D23A 1Y7VA 1FFQA 4HOWA 4UCFA 5DFAA 4D6EA 2XN2A 4D71A 3W25A 1Q6DA 1JG9A 3EMCA 4AZBA 1JYXA 3DX3A 1MW0A 2WHKA 3N12A 1EQCA 1ZB5A 5HNNA 1GUVA 3WD3A 3AYSA 1IV8A 1Q6CA 3SCWA 1HT6A 1JXJA 2GJPA 2OYLA 4AISA 2YKKA 1ZBWA 4AIUA 1ZBCA 1XYZA 3OIHA 2ZX8A 4P7NA 2BVTA 3A4AA 2CBJA 3L4TA 3CUIA 3RILA 3LRKA 3TA9A 2XM2A 4RL3A 1KXQA 4JHZA 3WL1A 3GM8A 2D73A 4AW7A 4MJ2A 3OBAA 1W3KA 1BPLB 1UOKA 1GOKA 1JYWA 2DIEA 3AXXA 3PTMA 1VBUA 3VUPA 1UD6A 4PBGA 1QNRA 3VIKA 3W53A 5E0CA 2VO5A 4UQCA 2UWFA 8CGTA 1DWHM 2XFYA 1AQMA 2E8YA 1FOBA 1CPUA 2A3BA 4UOZA 2EACA 5CZKA 4UFMA 1MXDA 1E1FA 3WH5A 2ZUSA 4PMXA 4QCEA 4CCEA 3QOKA 4FLOA 3F5LA 1EOKA 4ZE5A 1UQZA 3A6OA 5M5DA 3A47A 3NUKA 1UKQA 4KH2A 4PUEA 3APGA 3BGAA 1SMAA 2HVMA 4CD6A 3PZ9A 2E4TA 2XTKA 1GQIA 2PBGA 3VGFA 1NWTA 1L8NA 2OSYA 1KTBA 1SYTA 3WN6A 3AI0A 3QR3A 4QAWA 2J78A 3K46A 3F4VA 3VDAA 5BYWA 4UZUA 3L4WA 4JFTA 1B90A 4XUYA 1CDGA 2FYVA 1V6VA 4A4AA 3OG2A 1LQ0A 1D3CA 2GK1A 4L4OA 4P8WA 3WNNA 1GORA 1TQSA 2BFGA 1TQWA 4WKHA 1R34A 4QP0A 4PSPA 3QHMA 2XUCA 1NQ6A 1OT2A 1W91A 3MMDA 3DECA 4XB3A 2QV4A 1CLXA 5A6KA 1C90A 1OM0A 3VD4A 1NP0A 3ARWA 1UWTA 1DWJM 4J3XA 1J01A 3ARQA 1W2PA 2FHBA 4CCDA 4ZXOA 3NSXA 4WKFA 1EDQA 3CMGA 5GNYA 4UZSA 4NX0A 2Y8KA 1L0PA 3AMLA 1TCMA 3EMQA 4KGJA 2ZX6A 1VEOA 4B16A 4PYSA 4UOQA 1BF2A 3H53A 3BAKA 2C8NA 3AS3A 3KEHA 2D24A 1UR4A 2PBOA 5DF0A 4OOUA 4XZBA 4JFWA 4LPCA 1ZJBA 4AXNA 2ZWZA 1ZBVA 1BHGA 4GI9A 3MUIA 2YFNA 1E9LA 3ZR5A 1BYDA 3GNPA 5KEZA 1E0VA 1O6IA 1W1TA 3SCQA 4FF5A 3F5JA 3IK2A 5EFDA 4W85A 3VDHA 1C7SA 4HZ8A 3LPOA 3N15A 4AMXA 1UR8A 3HU7A 1TVNA 1UR9A 5CPTA 1UKSA 3GTNA 3H55A 2JF7A 4GINA 4U3CA 2UY3A 1NWUA 1NOUA 4FNRA 4TX8A 3WQ8A 2VQTA 3T0DA 2BY2A 1E73M 3BMWA 3AYRA 1PAMA 1HJWA 1TQTA 4CN1A 3GYCA 4JL1A 3WNMA 3CZKA 3LRLA 4FLSA 2VZOA 4HPHA 2JEPA 4DO6A 2WMFA 4ACYA 4F9JA 1LG1A 1VRXA 4W5UA 5EMYA 4QLJA 4YHGA 3PZGA 2CEQA 3MV01 3WDRA 4NXSA 3VX0A 1JIBA 2W67A 1V02A 4ZENA 4FMVA 4D6FA 2ZUTA 5I23A 1HL9A 2WLYA 2EABA 2WHLA 2J7CA 1KGWA 4CU7A 1V3IA 2YDQA 1JAEA 3K8MA 3VD7A 4XZWA 5D9MA 5A69A 4MAZA 1US3A 5KZ6A 3NDYA 1PIFA 3PZUA 3GXTA 1CEOA 3CHEA 3K4DA 4KRTA 3PZOA 4HMCA 5A6BA 4PSRA 5D9PA 1EO5A 4D6DA 4J7RA 3ZM8A 2NT1A 5D8ZA 5DEZA 4PTXA 4W89A 3WNOA 5FIPA 2ZXQA 2ALWA 3DHUA 3UCQA 1Q6GA 4IISA 1CGTA 4NXKA 1GW1A 4P7OA 1SZNA 2PB1A 2YL5A 2YLLA 1BLIA 4P7LA 1V3KA 3ZQ9A 4OGZA 3WH6A 4GI8A 3OGSA 2QF8A 1J18A 3PTQA 1MW2A 3LX9A 1DWFM 4IPLA 4M80A 2OYMA 2W4XA 1GOIA 3H54A 1XD1A 4MNJA 3B9DA 3D50A 4ZE4A 4LXFA 4W93A 1R8LA 3SCVA 1HKKA 4W7WA 4ACZB 4AZHA 1JYNA 3CO4A 2WVSA 1AMYA 1V3HA 2CCRA 3AMGA 1QBAA 3BAIA 4GZJA 1SMDA 3M46A 1JI1A 4J3WA 2VCBA 1XSKA 3WH8A 1QPKA 1JD9A 1I1XA 3CC1A 5DMYA 8A3HA 5FKYA 3RM8A 1W3JA 5CLTA 1CGXA 3SEPA 1BVZA 2BY1A 1UZ4A 2ZWYA 4GO9A 1X1NA 3AS0A 4W87A 1RPKA 3VNZA 1W9VA 4AZCB 1WAWA 5HBFA 3IAPA 1M01A
chains in the Genus database with same CATH superfamily
4A37A 3AIBA 4PWEA 4MWAC 4YTRA 2VRKA 3SOBH 5FDWA 4L1DA 2OYKA 3RNDA 4XWUA 3ZE0E 4D9RE 1L9OA 1WP6A 1EZUA 4N8UA 3QZBA 5D33A 1DJXA 1LDPH 4CEUC 3ZMNA 4L3ED 3DETD 2ED8A 3LEXA 1JHKL 2Z0BA 4ZQRA 4W9IC 1C08B 3LGEA 1NAKL 1JNDA 1RZ8B 3QQDB 2W94A 2I5QA 1V7NL 2CJUL 1S9VA 2KZKA 3GFUA 1F0LA 3FKUS 5SX4I 2XIIA 3DOIA 5D4YA 3VIPA 4KJQC 1G7MB 1Z69A 2B77A 2Y06H 4NKOA 2J21A 4LPUA 1Z7AA 3OZLA 3OIXA 2HG5A 3N85H 4QM1A 2P5EB 4M1DL 1LRTA 3R0KA 2JLLA 1DQLL 1TNNA 2X5PA 3AAZB 4OFYA 5KYUB 1K9EA 4TQTA 3TFKD 5E2UL 2YGVA 4LEEA 5GS3A 2GK2A 1SJHB 3P3UA 2YAEA 5HAOA 1MCQA 3V0VA 4C47A 3IMSA 4J5NA 2PZNA 1G87A 4L64A 5A1AA 3CV7A 3HC0A 4YE0A 2WVUA 4K0OA 3RI5K 1R5YA 4HKPA 4YWIA 3VINA 2E46A 5M95B 4KDVA 1RHHB 3B1TA 4RGMC 4WWKA 5IMMA 2F5AH 3CFQA 3D39E 3SE8L 3UBXB 5C9JB 1NC2A 3Q8EA 2EC9U 4LYRA 3O4LB 2BGNE 5F2GA 4OBTA 2YAPA 4LPXA 4L8SA 1WZ1L 3VXMD 1PZAA 4Z7VA 1DSFH 5C2BH 1YJDC 2E56A 2PDFA 2MQGA 1J9YA 1HIMH 4NQEA 3K6SB 2YWYA 4LOEA 2XWTB 1NMBH 4UU9A 1LBLA 1LF1A 1ZLPA 2EJAA 4M6NL 2JFEX 3WO4C 4TTUA 4B3EA 3HB3C 2PWUA 2I9EA 3D39A 3ES6A 5KBDA 2VR8A 1HU8A 2WXOA 4HJIA 4UTBA 3AY4C 5C0FA 1CICA 4LBAA 1BDYA 3F01A 3QNZA 3R1GL 5HNUA 4EI5C 3C86A 3FJ6A 1HDMB 4E9VA 1C1EL 3C8FA 2DOCA 4GT7A 3RX8A 5HYQB 1LOLA 4EE9A 1CXHA 1KJ2H 4RGOH 1A49A 1Z42A 1KB9J 4QHUB 4XVJL 1YNTA 2XTLA 4AYSA 2CZVA 3CX2A 4HD5A 4CD4A 4EANA 5F70A 1UUOA 3LQZB 4M4PA 3HV9A 3H9ZA 2FO4A 3P0VL 3QC0A 5HQMA 1NJ9A 1TV2A 1FCQA 3HFMH 5ICXA 3TZVC 3GPSA 2EE3A 3H0TB 5CEZH 3NJFA 4DO5A 1UIPA 5G4HC 2BNRB 1QK2A 4PJFE 4JRYE 1G6RA 4OZFA 2J27A 1D3HA 3KBWA 3ORWA 1T1XA 3QKEA 2A6JB 1IVTA 3LSOA 4ACZA 4F58H 4HVXA 5ECUA 1TENA 5AZ0A 3D85B 1YNYA 4WF7A 2QCLA 5T8GA 4L05A 4QEEA 4S2CA 1H3GA 2BRQA 2Z8WC 5KSBB 1KV3A 3O3EB 3UP6A 2R7EB 3IFLH 1B31A 1EXPA 2GFBB 1HKMA 3FJLA 1QUNB 3NQ7A 3C4UA 1Z5YD 3HMXA 3BFOA 4QXWA 4O5LL 2FZMA 4JTHA 2LABA 4DBUA 4YSUA 5BO1L 4M6OH 1KIRA 1KM5A 2MCPH 1HX0A 1RQBA 3BP6B 2AGTA 3HPJB 5IB4B 4WWKC 5FLUA 3ULVF 1XYCA 5CZSA 4R7NB 4Y9GA 4WOQA 2CHZA 2AJ3A 3WXWH 5ACZB 3GLEA 1G4TA 1A5MC 3HKFA 5F3BA 1Q94B 3STEA 5C5YA 1KLGA 1GHSA 4LCSA 1PYMA 2QJJA 5JMUA 2VJXA 4F37K 5LKYA 4NENB 4ADSA 4HPOH 3P0YH 4JO3L 3TXZA 2W9EH 1Y0LA 3RDTB 4F0SA 5LGJB 3MKKA 4OZHE 5GSRA 3H7RA 4BCYA 3LN9A 2Y7QB 3EYOA 3OBKA 2J6EH 1GVRA 2YB4A 2E7DA 5G4WA 2QIWA 4GSRA 3NEVA 2V7HA 3AHXA 3WJYA 1DBML 5I0WA 1EDYA 2HKHH 3ECBB 3VOFA 1FYTE 1DXFA 3N1AA 4H26A 1IC7L 1TU2B 1VESA 3L3IB 4YPJA 3OJGA 4UTJA 3GO1H 3QIBD 2JB5H 3EPMA 2AK1H 3UZQA 1W1ZA 3JV0A 4HETA 4XMWA 2D8KA 4IOSA 4GOSA 2A9MH 5DJXA 3PBUA 1P5VA 3PG9A 4Q8WA 4M02A 1CX9A 3O41B 5CJQL 2BNRD 4QCIB 4XH2A 4A7UA 3IJHA 3QQ1A 4PBWD 1MDRA 2DQIL 4TO8A 5LKNA 5LGZA 4R5TA 1S5TA 4KCWA 2PCFB 4JRYB 4PM1A 1CDIA 1NUFA 1W72L 1KG0A 3AREB 2BTMA 2V5DA 3U2EA 1I1YB 1VRSA 3KNBB 3WK1A 2PRLA 3QHZH 3THMH 2IQTA 3Q4DA 4LT7A 4JAWA 1IM3A 3R0MA 4MVBC 3LHAA 1HQRB 2RJMA 3FUMA 4FQ2L 1LP6A 4CNNA 2WZTA 4FSAA 2GHWB 3KMDA 4JFDD 3G1FA 4YN5A 3AG3B 2OI9B 3ASNB 1AODA 3NIYA 2P5WA 4ZO8A 5DVNA 1LNUB 5LO7A 3WNLA 4XD5A 4U10A 1LEGB 3CUXA 3AZUA 4I3RH 5CGBA 1RZGA 1MRFL 1IGWA 4BF7A 3LD5A 4H0IA 1DO6A 5I6NA 1V0LA 2OSXA 3NJHA 1KB5H 4XWOC 2WWNA 4HXAH 4WAFA 5DJ6A 2YGNA 2FAUA 3SW6A 2PXYA 3MX0B 2BSRA 2BV9A 3RNKB 1J8HB 1AHMA 3Q8AA 1LOSA 3ULUE 3OJDB 1ZLWH 2C3ZA 5KSBF 4DWHA 4FXJA 4UI2A 2Y88A 5LGXA 3LAFA 1L8PA 4IPNB 3QA3A 25C8H 5HI5C 4UXDA 2VLKA 5LNRA 3HHMA 4JQAA 5JR1H 2P5EE 4XUGA 2J7LA 1A1MA 3SDXE 2B0MA 3JW7A 3PQYB 4I7ZC 2A4AA 3CN4A 5KZDA 3N6YA 3B2MA 3ZTDC 4YHLH 3MNZB 1E5ZA 5I7GA 3R8QA 3GXMA 3O8XC 2J8FA 4R0LC 5DT7A 4X5XA 4TUJA 1GMEA 2FUTA 4AMWA 2H0PA 4P3CL 5EC2A 4DKEL 1OFOA 4AQOA 4DRSA 5HGBA 3GSNA 4TULL 1X7QA 5IBLD 4HU8A 5E2WL 2I9TB 1JK9A 1EJWC 4LKCA 4QOKA 4MRBA 1WDRA 1XINA 1A1NA 1TRIA 5FAGA 4FNQA 3G1RA 3MZTA 4LBSA 3J7HA 2AXFB 4YFLI 3KYNA 3QQ3A 5CU5A 3K4WA 3DMMD 2PCXA 3SSJA 2OCFD 4KX9A 5CSZB 4HOMA 4KMTL 3RWEB 3CS2A 1RP8A 5IROC 2RFXA 5IV2B 2EDXA 5FF2A 4GLEA 4DQWA 3NCYS 4ENED 2FCBA 2GDUA 2PDYA 4WFHD 3CV1A 1KGCE 1WO2A 5JW5B 4FXGA 5F9WB 4PUJA 4FALA 1E3XA 2B9BA 3TV8A 3MV8D 3ZIMA 4JB9H 1B9BA 4UDUA 2PDXA 5D7JC 4J6RL 3H1ZA 2VZ1A 3QZPA 3SPGA 4DFIA 2EC9T 4Q7DA 2QKFA 3ATBA 1M9WA 3VJ6A 5L88L 2P8LB 5CH9A 1KPVA 3FEQA 5D7SL 4JM2D 1TUPA 5HTSA 1H2JA 5E1GA 4QIRA 4Y9BA 4HWBH 3N0AA 3SE3C 3WD5L 4BM7A 3NZ8A 5KSBA 2AQVA 3RZCD 5FEBA 1PCXA 3PP3K 4RGNC 3NFNA 5AVSB 1NCOA 5BW7C 1LOQA 4O52A 3C2EA 3TBYB 3EOUA 4Y9EA 2CZEA 1CXIA 3PYCA 5CEYA 5KWYC 1PHQA 1EEZA 1NDYA 2VX7A 4O57A 2CHWA 3DJSA 1AZNA 2D2JA 3DN5A 3GDMA 1UENA 1NMAH 3CLFL 4H9XA 4ABVA 4TR9A 4F79A 4XTIA 3O8XD 1HHKA 3L1GA 3WEZA 3PNWB 4F3FB 4WJ5B 4W9JC 3G6AB 4M6ML 4G6JH 1YEYA 2H7WA 4AWTA 5H2ZA 4N0UA 3O0FA 5KYYA 1H3PH 2AEPH 4G8GE 5B1KA 2N0KA 2HTMA 4EVNA 1CR9H 1VFSA 2A74A 3KVMA 3QXWA 3NZ1A 4JTAA 2JCCF 1C3FA 3MDWA 4QE1A 3PF2A 1FLRL 2NYYC 4UTTA 1HVXA 2NX3A 1YEHH 3BXWA 1JUFA 4LSPH 3L5IA 3K4ZA 4KK8C 3GIZL 3V95A 3KZ8A 2FEEL 1JXKA 4PD4K 2MPVA 4Z1DA 5C0AD 2HX9A 1H50A 2CIKA 3MRRB 1QVOA 1Q0YH 2D31B 3STFA 4DJED 1UACH 1G4RA 3NCFB 1AHWC 4FQJL 4RIRB 2P8CA 5A6LA 4D8PB 3KRBA 1QVOB 1JVLA 1QRNA 3L3HB 5FUZL 1S9YB 3ZQXA 1EPVA 4HA4A 1TX2A 3O63A 4PFHA 4G8TA 3ILDA 2OMAA 3LKSB 1XB8A 1W1IE 1MQKL 1QKZL 5EFDA 1S5IL 6TAAA 4HX1A 4YXLH 3FTWA 2EDBA 4P3DA 3PAVA 1FV1B 3EEGA 3FO2B 4M61B 3EEZA 1L3WA 1FNFA 2J7BA 2VXTH 3RR1A 1S7UA 3L5XL 1NF0A 2J6VA 4I9AA 4HSHA 4P8VA 1QI4A 5EFIB 4UQBA 1T7XA 4ZUWB 2OEKA 2JI1A 4KRPB 3ONCA 4AMCA 1JGDB 3DURB 3IN0A 1AD0B 4XTRD 1ASOA 1T1WA 2R29L 3MJYA 2CMRL 4J8QA 4FOKA 2CO7B 3U30B 4J1OA 1UM5H 1IJNA 2B20A 2BNUB 3HVNA 1NICA 3O3DA 1K72A 4LCWD 4B9YA 4GNKB 3QQ0A 1ZAHA 5CAHA 3QPKA 4P4RA 4UOW1 4WI7A 2DQ6A 3HNSL 3QYCA 2ZTKA 3CQFA 3HIJA 4IIHA 4H9MA 4IJBA 4YHPA 2NW2A 4PD4J 4U6HA 5JHDA 1LILA 3O16A 1UXWA 2FJKA 5E2TL 3B1UA 4I3SH 1N8ZA 2J7DA 4A05A 4RLDA 1AO7A 5LWYL 5E1QA 3A4EA 5DZJA 2BVWA 1KA9F 1ES0A 1ZLDA 2OMTA 3OAYK 4K71B 4XCNB 3UEQA 3VFSA 2CNCA 2WWMC 3HNTH 4GKNB 3PPFA 3V3WA 3SO3C 1BQUA 2WWKT 5DVKA 1YQ2A 3FFCB 3STLB 2WCPA 1GG0A 1GGOA 1XWYA 2PNDA 4FFWC 2Y0FA 4RW3A 4HUWA 1HKJA 3RPIB 3DHMA 1MHPH 2SEBA 4PRIB 3NBNA 5T1JA 3GF8A 3VNJA 2RDTA 4ORMA 1YEIL 1FG9C 4ACPA 2P52A 3IDMB 1S2CA 1CTOA 1HH9B 4GI6A 4JFQB 4WI3A 1KV5A 2P53A 3C0SA 2QT6A 2NVDA 3E5PA 3GH5A 5GGTA 5JO5B 4MD0A 3N3TA 3WBAA 1TVBA 1UD3A 3CWGA 4Z7WF 3ZIZA 4PJGF 1R3LB 4YDJA 2CWNA 3IJ7A 3DG3A 3IMVA 5EOCJ 4K5MA 3OX8B 1B3ZA 2J20A 4JFFE 3VFRA 1RK5A 4XPBL 3ARZA 2C9AA 5HVFB 2CERA 5HHXL 4FO4A 5AZ1A 2C3WA 1B4KA 4F7CB 4OV5B 4Q8PA 2WIMA 4RDVA 1E9QB 5T9CE 2NT0A 4P23C 1E4MM 2H9GB 2E7BA 5MHSE 5EUKA 1GYLA 2RFXB 1TQBB 2E9BA 3WQ5A 1JV5A 2B4CH 3C2VA 3RYSA 1J5IA 2XZZA 1IGIH 3RX9A 3UG4A 4LBEB 1OSPH 1ID5I 4WK9A 1CL7H 1MRCL 1J4EA 4XNUL 1WBJA 1G7MA 1VBJA 5INCB 3T8XB 3H7BA 2RH9A 1M6OA 4RX4A 3VXMB 1RIHH 4JFOA 4CVZA 1NDWA 2VI0A 4XN4A 1BWVA 4MYAA 1AGFB 2EZ0D 5E6IA 4OI9A 4XMXA 3U9WA 3P9MA 3S5LA 3US0A 3JV4B 4QJ1A 5D8JH 2WM1A 4UTIA 2OZ0A 2YDQA 1WAAE 5IJVB 1RLDA 1OZUA 3FK3A 4R8WH 3RNKA 1A53A 2WW8A 3MXWH 3RL1B 3TPUB 3MLXH 5IXEA 1MFUA 3OPUA 5H35B 4JKNA 4M3PA 4PTNA 4AX6A 2BWDA 5C0AE 5IESH 5DD6B 3MJ9H 3UCDA 1XUZA 2KAUC 4KRZA 2FVMA 3URQA 4QSHA 1WEJH 2BP8A 3D0VA 3KPLA 4EI5A 1P43A 3D2UA 3EKLA 4UBPC 4BEUA 1WD8A 1H0DA 1WXZA 3QHTC 1AJZA 1QSFB 4F57L 6A3HA 4HKBA 5B80A 1GIGH 2BVPA 4O9HH 2RA1A 1DVJA 3HLKA 5IROD 3MRDA 3C5QA 3UXIA 3L23A 4GIYA 1XTLA 2I85A 1J6OA 2XFXB 1IQDA 2P8PB 4Y4KB 2G2NA 2AJXL 1RJYA 25C8L 4X0KA 4AWJC 4A1RA 4ES8A 2IADB 1J12A 2IWKA 4L8SC 4MXVE 1SYSB 4LAMA 1Q8MA 3VI3F 5KZCB 3M9YA 5F1NB 2JJSA 2QQNH 4YHNA 5C0CE 3HPSA 5CJQH 1HEZB 2HKAA 4WU5A 4QG6A 4E8CA 2V2XA 4J3BA 4AQEA 1XT5A 2W0PA 1KWKA 3II2A 3MRCA 4NO2B 1KTNA 3DUUB 4LSPL 4R3SA 3EWYA 5EKYA 4D0BA 2ZCLL 1W3TA 1XR8B 4ZFCA 4OCWH 1OP3K 2WPBA 1A7PH 2EG8A 1NIEA 1NWRA 3LS9A 3PUDA 3RWJA 5C0CA 3RO8A 2WTPA 3ISRA 3IIPA 2WMGA 3D18B 2HVJA 4ZTEA 3O0RH 4GAJL 2NX5D 4RZCA 3G5XB 2X8RA 3EOLA 5LBVA 1EIXA 5FOOA 3PGDB 2JQMA 3DK2A 3PLYA 5FA3B 4E41B 3GH4A 4LPWA 5F2IA 1FQ0A 1RK1A 2HVKA 3L1FA 4WR3A 3UX9B 1YMHA 3TIEB 3EXSA 4JTSA 4RXGA 4AEHL 3EWUA 4S2SB 1NKRA 4NQVA 5FXCH 5EZIL 1F7BA 1M7XA 3MLXL 3OZKA 1UBPC 2E67A 3KTXA 3A12A 4KT2A 4S3GA 2W63A 1KBVA 3W7QA 1LO3L 4XP1L 2Y7EA 5K9CA 2VC9A 1Z9AA 4XZUB 2WZ6A 4AENB 3BJTA 4GI4A 1IEQA 1T96A 2NUTB 2NW2B 3W27A 4V1DD 4K9JA 2CGRH 1DHKA 2MHAB 5D09A 4HHPA 5JBEA 5HK4A 1HQ4A 1TJHH 2CRYA 2H0JA 2YQGA 3T1WA 1O5KA 1GIGL 2VC2B 4O9HL 2R1PA 5D2NA 5JPMB 3Q2DA 1L6SA 1VFMA 5E8OB 3MLZH 3GX9A 5D1QD 1EEUA 2VQ1A 2XM1A 1QW8A 1QVBA 5DHYB 4GCXA 1GTEA 4JAMA 3PWJB 4KK9D 2I9LA 2K6YA 2ISFA 4ZT1A 3SODB 2YA1A 4NN7C 4Y2DD 5E1AA 3K6IA 4EPEC 1V8HA 1IUZA 4G8FA 5T1KA 3HI1B 1UM6H 4OD2A 2UX7A 3DX9B 2ATAA 1LRNA 5JQHC 4WV1C 3SQRA 3MLWL 2FVLA 4RK8A 1EERB 1RUQL 2AK4E 1TUXA 3OQEA 3ATDA 2JKLA 4KAQL 1PJ9A 4EI6B 5EG6C 3L9YA 3R58A 4JPGA 1HYRC 3G5VB 4LUSB 1BJ8A 1YNQA 2QLYA 4OJFL 2VGBA 2VSDA 4HJ0C 3TONA 3W5MA 3B8VA 2WBJC 3SDAA 3CQKA 4BSWA 1QRNB 3DERA 3LRHA 3VFRB 5IKCB 1PX3A 3ZDYF 3N3MA 3FOLB 5I15L 1XXDC 4P2RB 3W75A 3SYPA 3VM7A 4DF0A 1NCUA 3C12A 3Q06A 3T4WA 2XBDA 1IAII 1X1ZA 2I07B 3ARXA 1T1ZA 1W8GA 4WIQA 3A4WA 4YCPA 2C5DC 5HYQA 3PZIA 2Z31B 2CRMA 1RXOB 1VCFA 4HS8L 2WVVA 3VFVB 3M1ZA 4AD1A 2IS7A 4OCXL 5EBUA 5F1UA 4Z1AA 3DOHA 4DKFL 1DQXA 2WVVB 5CCGE 4WDUA 1UWXH 1R85A 4I7VA 1SO6A 3QO1A 1CFQA 4J3UA 3ARDB 4JCLA 4IGBC 3WGUB 5HY9B 3B6SA 3PWLA 4POZD 2X6UA 5ESVA 3HCVB 1XC4A 3L5AA 3USZA 2P28B 5L2KE 2P24A 4U1SB 5B3SB 1GC1C 2IG2L 2UUDK 3T3PF 2QJHA 3ZE2B 3HBLA 4U6HB 5JHDB 1ZS8A 5JUVA 1XQ4A 3EGJA 2J8UE 4IWWA 4GOAA 1EFXB 1NARA 1BXUA 2BHUA 3SJVD 1P5BA 4PJHA 2G5UA 2TRSA 4Z7AA 2V67A 3NRQA 1W3HA 3X12A 3W9DA 1CYWA 5E08L 3W81A 4R8WL 1R0AL 3EW3B 4AF0A 2M83A 4XGZB 2NX5E 2J55A 3LPFA 3W0WD 1VPOH 1TT6A 3QUZA 5ISZD 2JK2A 3FA4A 4DXKA 3OF6D 2Q7NA 1QSFA 4HBCL 3BD3A 4M5YL 4PH8A 2UXFA 2XVLA 3MV7D 3D4YA 1T5XA 5D2NB 2BJMH 2W07B 4HUUA 5JPMA 4FKKA 2J73A 1K8XA 1OFEA 3BUBA 5EZLA 2BVQB 1R3IL 4XPTL 2LR4A 3TT3H 1I8MB 3GZAA 3OVGA 3H2FA 4JO5A 3L5WB 5J6HA 1E9IA 3VFOA 2H6PA 4UT9A 3VD0A 1E0WA 3TTQA 3LD8B 4NG3A 1OD8A 1B0GB 4NWUH 1FVPA 3HB3D 3WSQH 2HXTA 1O6SB 1UKTA 3UBHA 1MY7A 3IPFA 4FQ1H 2DLEA 3RWEA 1X5AA 1EZ2A 2PP8A 3PU7A 4Q7BA 1QW7A 5DJ8A 1PTGA 4MNLA 1NEZG 3QG7L 1MWAA 1YYLH 1AVAA 2DQHH 2WN3A 1IEXA 4GUOA 4MJJA 3P0VH 1M41A 4FTVD 4V1YA 5H6HA 4DH2A 1EK3A 1KC5H 1WWBX 2FBJL 1A1NB 2DIJA 2ZX9A 3CDFA 4TTDD 1XM3A 5D55A 4DGIL 2PW2B 5JW4N 3R10A 3U46A 4ZMAT 2SFPA 2RJHA 4Y4HA 1PNDA 1ZLUH 1B9KA 3BCFA 5HPMA 5C0CB 1R4XA 3RWJB 4PJFA 2DM7A 1WUEA 1MHEB 4MSSA 3R8GA 1CFTA 2QVTA 4JRYD 1EZVX 4XZWA 4QDGA 4LARH 3KPMB 2FIKB 2BWIA 2H0FA 2I9UA 1OSEA 4OAWB 4KKBC 4TUFA 5F88A 5GJNA 2X41A 5D6CB 4ZZKA 1A50A 2F2KA 2EO1A 1E30A 3BZ4A 3SJVB 5I18H 2K8MA 4NQSB 4YFEA 1OQOA 3FSUA 4AVKA 1BP3B 5KYWB 1P7TB 3KDNA 1P0DA 3RUGE 4MKVA 3TVAA 3OAZH 3NZSA 5ABFB 1AJ0A 2APBA 3TWYA 1F76A 2XZCH 2PDQA 5I1CL 4G1EA 4Q32A 4C60A 5B1JA 3HRZB 3GWJA 2AQ2A 3PFQA 1S3RA 2ZP0T 2VEKA 3G22A 3NPUA 4RXFA 4S1FA 3HBQA 3SCTA 4YSRA 2IFFH 4AIXA 3ARSA 2HWGA 1S9XB 3C60B 2OQYA 4PMZA 4WI9A 5K33A 4OIBA 2QKIC 3CZJA 3FFCA 4OJEH 4NQXA 4AVJA 4BZYA 2V5BA 1I7RB 1GRWA 4TQ8A 4ALDA 4AZ5A 4OFPA 1TYJA 4LK4A 3CNYA 5KAQF 1ESOA 3E5BA 4HEPG 4O4YL 5DEJA 3WO3B 1P84J 4BR1A 1N6QL 3L1EA 3LN3A 2W60A 5D32A 1RH9A 2HT2C 4S1QL 3T0AA 1SJCA 3E3QE 1DBKH 1K3IA 2GBVA 1VF5C 5E9NA 1J7VR 1VFAA 4YZWA 3AVEA 1XCTA 4J1UA 4OCLC 4NPYA 1CNVA 2Z25A 3OU8A 4IMCA 5AHFA 2R9HC 5AW8B 3JWDH 2OSLA 3L2LA 2R2CA 4DZ8B 4JHVA 1THFD 4G80B 4L9LC 1RZKH 1VB9A 4L65A 4LP4A 4K3DH 3FTGB 3N9GH 4NBZB 2NQDA 5HDBE 5JUEH 4P7RA 4BEIA 5AVUB 4UQEA 4P5UA 1OK0A 3CZUB 3FHEA 1AHKA 1NBVH 2CUAA 2M1KA 3HUJB 4XNBA 5BVPL 1OFDA 1INDH 3IDGB 3F4NA 5J8LA 5B7YA 4M6QA 3OJMB 3PJUA 3MGOA 4O00A 2HVJB 4Y5XB 4Y5YC 2WZHA 1F6FB 1ISVA 2AQOA 1ZHBB 4YC2B 2IQ9H 1ZXQA 4E9SA 3VCLA 1T2QL 4I2XE 2O61A 3RBSA 1SQ2N 4EPDC 3CPLB 1FQ9C 4RWHA 2VM9A 1FKWA 3VCLB 5FESA 2FJFB 4JFEA 1A1MB 1GKQA 3B2VH 3ARYA 3AAMA 1S7XA 5FGCE 2F5AL 3DFOA 4NEHB 3JVAA 3NJGA 1FCGA 3GMPA 4U0RC 3EOSA 3OZPA 5PTDA 2PTWA 3ETTA 5DR5L 1J48A 2BCMA 5KN5A 1IILE 4N0CC 3MOBL 4CKVX 2I17A 3KRUA 4H0GA 3HI6L 4KK9C 1KB5L 3KXFE 4IJTA 4TOQA 4OZHA 2TRHA 5TQ2L 4LLWB 2FZ8A 2ZZUT 4JDZB 2FTPA 5AW0B 5K4XA 4BZ1A 3WF2A 5GISH 1SZEA 4OQVA 5DK2B 4TSCH 1MVUB 3AW5A 1M9HA 1GOXA 2XZAL 4L4TE 3P67A 2DBLH 3ARGC 4FN0A 4EN2A 1PG7H 2H26A 1UQSA 1KCSH 5DJAA 3FCBA 1J8HE 3MBEC 4BFJA 1E9ZB 4J9JA 1NTHA 3WJZA 4Y9PA 4NNXB 2ZUNA 1J0YA 3OL2A 4UIKH 1S8DB 4XGZA 4DUWA 3OVPA 3RFZA 4OUIA 3GC3A 4AF0B 1GJUA 1G1YA 4DOHB 2Y5TB 5TE7L 3N3EA 3BIKA 1XF0A 2Y69B 2L4OA 1VZGA 1XDMA 2VFEA 3GJFA 1EFQA 3WQEA 5HHPB 3ABGA 3MGTB 1TFHA 5DJ0A 3UBGA 1QLRA 4R7JA 2F74B 2JI2A 1C93A 2YQ3A 5CAKA 2JELL 3FUKA 3MLSH 2CDFA 4I89A 3U9PH 2A7NA 1J86A 3GNRA 3DIPA 3NZQA 4X9IA 3QH3A 2LGNA 5CQ1A 4ZAKA 5FACA 4M3HA 3REWB 1XLDA 5F7YC 3ANVA 3FO0L 5GJPA 3WSUA 2WAHA 5T1KD 3PWNA 4AW4A 5D7KD 4F7CA 4OV5A 2N1KA 12E8H 4IJCA 1UOLA 3FQUB 5LZLA 1Q9OB 1N7KA 3UR2A 1WG3A 1AR1D 4LESA 1OM3L 4DESA 5CJXA 1QXLA 3AZSA 2VABB 4MFEA 2DV6A 3APTA 2G96A 4JHMA 5MKGA 1IC4H 2TSBA 3EYFA 3LS5H 1A7NH 5GS2H 2IOOA 4KY1L 2BMKB 5LXGL 1GPFA 4MJZA 3AUOA 5T3XL 5CZXD 5DJYB 4KXBA 5LQBH 3LMJH 4FNSA 2ON3A 3GM0A 3P61A 4Y4HB 4I90A 6PAZA 5LDUA 5JXAH 1CICD 1DJYA 4GIAA 2VL5B 4I5BB 1P9MC 4KHXL 3T0EC 4HZ1A 1F74A 4W88A 5D2LA 4BQ4A 1MLCB 3LH2L 4KQ0A 3G6MA 1XH3B 3GMQA 4HN4A 3HR5B 4KVPA 4LDEB 5B4MC 1UUQA 4JR9L 3VKJA 4I0KA 5C07D 1I1FB 1KFKA 1JF6A 1JNNH 1LO0H 5GS1A 4ODBD 1CT8A 1E43A 2F9BT 2H32B 3EXLA 3GNOA 4LCCC 3BAJA 3DVGA 5EH1A 2YCLB 3A4XA 5EO0A 2A79A 2G9KA 4GY0A 3S6TA 3IGAA 1JZJA 4JR5A 2XIDA 3PUGA 1FNEB 2LTQB 4GRMB 1OWWA 1FRGL 2N0MA 3V0SA 4P4RB 2AJZA 1CFVH 4HCRL 2GBUA 5LGHH 3O6ML 4FOMA 1VRDA 3BWUC 5DVMA 3V4VB 4HWEL 4X7TB 4XKMA 5EOTA 4OOZA 1VJSA 3GSXB 3QNYB 4IMKC 4AXWA 2QJDA 2XQYG 3S47A 1T0OA 2VQ1B 1PS9A 4O51A 2B7NA 1E6XM 3W1XA 4X7TA 3VMOA 3TCEA 3ULSA 4X5WA 2EUXA 4Y5XC 4OGYH 2REQB 4JKKA 1AW2A 1KCKA 3GXNA 3WDJA 5HWMA 4M5PA 1L0XA 1YEDB 4D9LL 1GPOL 4K8EA 1KZYA 5D4JA 3VXUA 1SHMA 1GW9A 3KEDA 3LEXB 5D1ZC 4JE0A 5GGRY 3ZDYE 5JR1L 4FFZH 3VQLA 3RM4A 5C54A 4HAGA 4GMTL 1BFVL 1HEJC 1CF1A 1FGNH 4KZCA 4A7GA 1BSLA 4OD1L 2ZF9A 3R7QA 1J6PA 3CMJA 2CO7A 4A22A 2ODOA 1RCQA 3EO0B 1FFPA 1OCRB 4B9PA 2ZTJA 3PZTA 5B38B 3B5GA 1T2XA 2AXGA 2IBZX 3WCYA 2W27A 5HOSA 3EH3B 1MRFH 3PDDA 4EXQA 2CK0H 3X3GH 4IMDA 1HQTA 1GTNA 4ZTPL 4ONHA 3HB9A 2R9HD 3SRKA 4Q7IA 4KRLB 3SPVA 5C07B 2OK0L 4IZGA 4KWWA 5I1AA 1PY9A 1PYWA 4UNVA 2G4GA 3FT3A 4AY0A 2B5IC 1AL8A 1TJRA 4PGEB 4R3SB 2CESA 4BH7B 1B3IA 3O2DA 1CLYL 4MASA 2IUZA 1VFUA 3ZOAA 4YVPA 4QS6A 3TWCH 3T42A 2IG2H 5C7XH 4Q4PA 3MRIA 1MNUL 4G9DB 3QEUA 1X9RA 3PIQB 3IJ9A 4RMTA 4YQXL 2QUNA 1TCDA 4K8HA 1UYWH 1UIOA 3MQIA 5FUZH 1EA0A 3CUPA 3CZEA 5DQ9A 1ZPTA 3UYPA 2YZ1A 5FF3A 1XL6A 2AQ1A 4IBZA 4RFEB 2XV2A 1PY4A 4PJ8D 4XPAL 1KFGA 1J93A 2WXRA 5I76B 1U21A 3CK0L 4OF6A 5LNSA 3TH6A 5GISL 1VIZA 5IR1B 3II3A 4LKXB 1MI5E 2XWDA 3QI9D 1DJNA 2OG9A 4F3FA 3FB5B 2F2HA 3TKFA 1P4IH 4UZGA 3VSUA 1P6BA 1YECL 4K3ZA 2FATH 2ZOTA 1HQ4B 4P3WA 4N85A 2Z6JA 3SOBL 1QFHA 2V38A 4KERA 5GGSY 2DAVA 4NZ8A 1NGQL 2Y22A 3ZDXF 2JF1A 2P44B 4QTGA 1IC0A 3GUTB 1E15A 4WDIA 2HTKD 1AZRA 1HTYA 3DARA 4RISL 5DTFB 3MUY1 3SUVA 2DD8H 1RULL 3SUWA 2V69A 3QW4B 2D0GA 3Q6GH 4UWMA 3PP3H 4ZMNA 2K4WA 3QJSB 5CEXA 1IIGA 1XIMA 1NVMA 4GKTA 2DV0A 3WFHB 3EXJA 4L4VA 1TZGH 1VD6A 4OJAA 4LNYA 4O1AA 1ZHBA 3BMXA 3L0KA 3UF9A 3WFAA 4NZFA 2APTA 1PWLA 3G1DA 3FTXA 2XWCA 3G5EA 4B3LA 3NCMA 5J5DA 1V5XA 1UA3A 3TYGL 5FV2A 1M1XB 2ZSVA 3CIVA 4G7SB 3BAXA 2VDLH 5I5RA 2Z4QA 4ADIA 2IJ0C 3MLTA 2A6KB 4XE5B 3F7VB 4GKSA 5BZZA 2P24B 2YRZA 1ZGDA 5M94B 2IPFA 2QNEA 3VNDA 1Z5HA 4AGOA 2NXIA 1TUFA 5F7BA 5LNDA 4MUPA 2X0UA 4ANWA 2Z91B 1GKPA 4BFNA 2FKPA 4DHGA 2PDNA 1E4XH 3EO9H 3HJZA 2BNQD 1OT1A 2FTYA 4D0CB 3MJMA 2X6VA 2GTZA 1N0LB 1JI2A 1D7CA 2E7HA 5J1AA 1WK0A 4YHNB 3I4KA 3O6LH 1QSEE 2A0LD 3TR9A 5C2XA 4N2OA 5IJDC 3QFJB 4HW6A 4G9FD 4KK6C 4NQDB 4TQEL 5EU6D 2PD9A 3KOWA 4EWND 3KOYA 2KZ1B 2VLJA 3URAA 2YC1B 4E6MA 4YPGB 1ZD6A 3TIDA 2NQCA 3DPDA 4XXCA 4DP0X 3VGAB 1QRNE 5D8WA 2X3CA 4KWSA 2YXVA 3GO2A 3FXIC 1I1AB 3TCSA 2OKTA 2NX1A 1VFHA 2WJDA 4KTEL 3EX2A 2LW3A 1HSAA 3VOGA 5B1JC 2IDFA 2QDGA 3UG3A 2L0DA 1FH8A 2YFOA 2HLEB 3NABH 4ZXBD 2F6KA 1NINA 2VMEA 1G7QB 2C9RA 3MKCA 2CZFA 3KNBA 2E6YA 1J0ZA 1FHLA 3MANA 3URBA 4QXTA 2WLNA 4WHYG 3FFCD 5HDBF 3WFBH 2ESVD 1MXGA 1JHLL 1UUSA 3ZL4L 1TV5A 3ML8A 4ZXBC 2Q9OA 4ZO9A 3F58L 4L6HA 4Y90A 3HQOA 5I5IA 3MUXA 1OGAB 4MTVA 4NJGA 4K8RC 1GZJA 4M3KB 1JPST 2AKMA 2ZP9A 1QP1A 4NDMA 3AJXA 2EIZB 3MUCA 3DTXA 3VXSB 2APWA 3HRPA 1JTTA 2GG1A 5AKTA 1QOQA 3FB7B 1EP1A 2J74A 4UWQB 3QQ9D 3ABQA 3NSNA 2WBJD 5FGSA 3AB0B 4PS7A 2MHAA 1Z48A 1L0YA 3BO8A 1MCWW 4P3DB 3GG0A 3LZNA 1FYTD 4IS6A 1BJMA 5D2VA 4Y5VA 4TVCA 5DD0H 3U0PB 1NEZA 1NDMB 1Z9SA 1MCNA 2D2OA 3QZWB 2A1YA 3SGGA 1A4BA 1A66A 4FNTA 5HHQA 1GHFL 4LVOB 5IBLC 5E23A 3HA1A 1U8OB 2G60L 2VITB 4UCGA 1JZ7A 2Q2EB 3R4RA 1KN2H 4S1DC 4FA8A 3UBXG 1RFDL 3LKQB 3MRLB 5D03A 2W65A 4NKQB 4K23L 3S4SA 3VRJB 2COQA 4XXDA 5E99L 1GONA 1E5UI 4JTJA 4PJAB 3BYYA 1IGCH 2CIKB 3CDGA 3ARDA 3DHJA 3MRRA 3NFPB 4E2OA 1AFSA 1D5ZB 2YDSA 5D1XD 2NY5L 4N1EA 1QSED 3ZYJA 3VKCA 8FABA 3DENA 4D94A 3Q45A 4W9CC 3S2LA 2IDUA 3HPAA 5C08A 2HKHL 1MUCA 4EK7A 4CEXC 3QISA 1JULA 1WIPA 4JYDA 3IYLW 1SM9A 4WV1B 5F9OL 4DFHA 1QNOA 1WQ5A 4IMGA 4HMDA 2MCG1 5CLWA 1X5ZA 3SE4A 2EDMA 1INQB 4OIIL 3VWJB 1XQKA 3K5RA 3GLZA 4HYVA 1PF3A 4LW7A 1PKQE 3MP3A 4JG0H 3Q5OA 1J2WA 5J5EA 1FWDC 4GRWH 4D9RD 2A5UA 3RIAF 2BMBA 4HWZA 5K59E 3CVBA 1H8NA 4PRWA 5T33H 4KAQH 4JQIH 2CDFB 1QSFD 1CGSH 4XNYH 5CR8A 2P8PA 1NFDA 3R7RA 4APQD 2NQZA 2PCEA 2J5LC 1TTIA 2BC4A 4K3JH 3KPOA 2G3ZA 5AW2B 2WYHA 5GRZA 5JQ6L 5KVMC 5LG6A 2ZRUA 3OJVC 4WOZA 5FJOA 4U49A 4HJGB 4ES9A 3PZQA 1BJ1H 2F61A 4Y88A 4GHRA 4D2JA 4OFCA 1U8MA 2LFEA 3ELQA 2PO6A 3P82A 4E0RB 1NTDA 3CQPA 1VIWA 5BRZA 3RAJL 4OKDA 3SJVE 3MRNA 3MLYH 2ALRA 2BNJA 4HK6A 4US5D 2VZVA 3W4RA 5FSEC 1G0XA 1MCKA 2KERA 1KWGA 2DMCA 3P4OB 3CUGA 5DDHB 2W6RA 1F41A 5I8KH 1AG1O 3C61A 5IMKB 1WCBA 4ZSOE 4Q9RH 3LENA 4PG2C 4ZX4A 4QD2E 2UY7B 1P48A 3Q3GB 4GCAA 4XHJD 2FDSA 1UZ6E 2NYYD 4P8XA 5F7WC 2IPUK 1PDKA 1WWWX 2VC2L 3D7PA 1S7QA 4Q4QA 4MNHB 3LHTA 3LZPA 4NAQA 4PJAE 3LQLA 2GY5A 4I8DA 4FK9A 1H8LA 1E7UA 1F3JB 2WPGA 1H3TA 1YEJH 4TVSa 5C0RL 3CPLA 2EYRA 2D69A 4F8NA 3IJLA 3V1PA 2DWDB 2VUKA 4LHQB 4EKJA 5BUGA 1KV8A 3KG5A 4LKCB 2MH4A 1T21A 1DCLA 4QOKB 4E9QA 5I24A 5SWSE 3KGTA 4F1ZA 3SURA 3V2AR 3VKAA 4PMDA 4FAAB 5CINH 1M7DB 2PW1B 5SV4A 5INDA 3TN0A 1Y8BA 5E5MA 2WJEA 3M0YA 4PRPD 1OAJA 2JKXA 2D4FA 1SFHA 5BXFB 3B3IB 1Q6OA 4NYUA 2HFFB 5FB8B 4RR4A 1J9QA 2VNCA 1A6TB 2ONEA 3W82A 3VFWB 2V8ZA 3KL5A 3HLAB 3QCUH 4G6KH 3EDDA 4KXAA 4QGYA 4UYPA 2VUYA 3HBPA 4IOSD 1SGKA 1ISYA 2DBLL 3GVQA 3FQ2A 4C83B 1ZHLB 1A3WA 5LUMA 4NS0A 3U4FA 2L7EA 1JPTL 5T3ZD 5IUCA 3Q8BA 3LLDA 1XC6A 5ITBH 1U22A 2J77A 3FEMA 2VN6A 2LQRA 2EG6A 3LIZH 4OLVL 1OX6A 2RHEA 2Y2YA 1F00I 3CMOL 4PLNC 1QNZH 1QBBA 3P6LA 1AZBA 1DQTA 3U6XS 1U93A 4QI3A 3DMMB 2IBGA 3BIKB 2EXWC 2VOTA 4UINL 4FR6A 1XAUA 3NIGF 4ZO6A 3QJHB 3S3DB 5ABZA 35C8L 1UR1A 2G97A 1YG9A 2VT0A 3OEXA 3OQRA 1WIOA 3IDNB 1LNUA 1MI5D 1TTJA 5CPOA 1A6AA 4AFYA 1RKRA 2QSTA 5HQEA 1RUQH 3ALPA 3S2MA 1VZIA 2P5WD 1RQEA 1UQYA 3N1FC 2BP8B 4EI5B 1HCYA 4MKNA 3ARTA 2YPLA 1P1ZB 4JZNB 2ZG3A 3DO4A 5AW9B 4I85A 1V02E 5HHVH 1B3JA 1ZGLM 5AYUL 1S2UA 3MJ7B 5AKVA 3T0CA 1NCNA 3KGUA 1TZZA 1KJ2A 2ZPKH 3G08B 2J6WA 3HR5A 5CM1A 3HMJG 1QHOA 2DKSA 4R33A 1KB5A 2O30A 2OMXB 3DIFB 4OD1H 2YZ5A 3UO8B 3RVTC 4CNUA 2A4EA 3DUSA 4NVTA 1BOGA 2X0SA 3TSBA 2OP4H 3ATFA 4UNKA 3QDGE 4F5CA 1JBJA 2J7FA 5AB3A 2WKLA 1S7XB 1NEPA 2BVDA 3NO5A 4X5XB 2QGCA 2NV2A 1AXTH 3M41A 4UTWC 1V0KA 3MO4A 5HGBB 1RD6A 2QKIB 1SJMA 4MQXC 4A2GA 4H8NA 4PVMA 3HZVA 1LL6A 3T1FA 4B9CA 4AQ1C 2E09A 4IG2A 4UV4H 4K2SA 5EMKA 3BP7B 3F84A 4HT1H 4ZTOL 1A7QL 2FUQA 5DSCA 5JXED 2XN1A 3L3JA 4JQ4A 5DX7A 3BVWA 4PS8A 3DFSA 5LBGA 4EOWL 2ZICA 4PZVA 3FT9A 3PREA 1WBZA 2UZIL 3G6DL 3ORJA 5EU4B 3GDCA 2K9FB 3TFKC 5EORH 5D6DA 3N4FA 1T6VN 1E6OL 3T6WA 5EUOE 4Y4FC 4CC4C 2VXUH 1UXMA 3L4XA 1WQVT 1X5XA 1MJUL 2C3HA 1KELH 3RB5A 4BH8B 1LE9A 1MQRA 4JFDA 1E9PA 4N8VA 5F93C 2D20A 5REQA 5EMUA 3FOMB 3FFDB 4MSWB 2RAMA 1S5IH 3ROOB 3AWNA 2ADGB 4P05A 1ECYA 4JY4A 4PJ8C 5DY2A 4ZXLA 4ZBCA 2GFBA 1DJHA 2P5WB 3HW7A 4Z7WB 3T9PA 4NFBA 2R2HA 5FHAH 2HROA 3QSTA 4CADA 3MOQA 3NRFA 4ZMYA 4EVZA 6ENLA 3O3BA 1B30A 3OKLA 4UR9A 1G7HA 2CETA 3SY5A 5IBTL 5KSWA 3N4EA 2QDDA 1R3IH 4PBDA 2K7PA 4CMMB 5LBSH 4N2CA 4BFOA 5BPPA 4PV8B 3DHFA 3OPSA 4MWAD 3EX6A 4K5NA 1F02I 3QJHA 4YWGH 4OCRH 3OP2A 3TBCA 2WP3T 1SUXA 4JDBA 1MFAH 3V5HB 5I5MA 2ATPA 1KIUB 1KGXA 5AC6A 2DI7A 3U6XA 4QRBA 2FSEA 3KOZA 4KKZA 4N02A 4GW5B 5D9SA 1YYLL 4RAUB 3S3BB 3PZVA 2VMJA 4PLJC 4MQ7B 3RVWD 2LTQC 3IMUA 1IKOP 1E2ZA 1U92A 5I0VA 2ZWKA 4AL8H 1K85A 2OJPA 4XPFL 1EJFA 7CGTA 3P3BA 5I8CA 1FYTA 4FIRA 2FIKA 3ECBA 3L3DB 3FRPB 3TVMA 5F6IB 3TXAA 1AH0A 5EU3B 3DX2A 4WCJA 4RCXA 4WTQA 5MEOA 1QI0A 1QO2A 3QWRD 3C3NA 3W39A 2ZSWB 4G2AA 3QPYA 2H8PA 1D8CA 4R9OA 4Y8FA 4P5RA 4UU9B 5GSRB 3TJHC 4GYFA 3T8LA 1FA4A 3WUEA 4PJEB 3MOAH 4UT6H 4HTYA 3O3UN 2KZHA 1T21B 3D39D 4QTIH 4O8RA 3VA8A 3PV6B 1BAGA 4QPEA 4XOAA 4MDPA 3SDOA 2PWGA 4GD0A 2VZSA 4RDWA 1MSSA 4XVDA 5DUPH 4M1CD 1U8PA 4DP5X 2XQBH 1SHXA 3D69A 4UV7H 1PBYA 1H49A 2E6AA 2J7GA 4WUIA 1X5HA 3DRTB 1JUEA 4GJ1A 3WBEA 1S9YA 2ZCKH 3BUQA 5MERA 1EC7A 2ZOUA 3PWVA 4CSSA 4L2YA 1EAPB 1YDYA 4A2RA 4B5NA 4M43H 1E90A 3N73A 5KUMA 2P5WE 4WDXA 4N2AA 5BZDA 4HYWA 3BVNA 4OJDH 2BVQA 1ZSHA 3OQ3B 1JFXA 2HT2D 5C07E 5IM7A 4NQQA 2ESVE 3BGFB 1HWWA 3CZNA 1CXKA 2IAMC 4LL4A 3LHYA 1PV8A 1YEKL 2Z3FA 1U30A 1MCEA 3ZMRA 4C54A 1H41A 2BCKB 2LLEA 3MCKB 3KFTA 4TV5A 1DLHB 3SJNA 2ICEA 2QCCA 1AD0A 4WO4B 1I0DA 4PRAB 1FN4A 2Y7SA 4KOCA 4J3TA 4DNMA 2RIKA 2X42A 5AW4B 3OGVA 3UETA 1OB1A 1FN4B 4HULB 2HPIA 3JRKA 4XAPA 4Y7EA 4C91A 3DX6B 2WUBH 5B1BB 3FQNA 2AEWA 4FQQA 4NM4L 4PY7B 3I10A 1EANA 3O0LA 4KUZH 5IHZB 3TP4A 5IQ7L 2C4FU 6PTDA 5IOBA 3BH9A 2Q3OA 1O0VA 1HWGB 3GAYA 3KOFA 4YHZL 3ZJKA 4DZHA 4WHTB 1H5BB 1AHWA 1KCBA 3F62A 5A2JH 1E6PA 5AFDA 4WENB 1BSIA 2F8VA 4PCFA 1Z8AA 1Q72H 3N41F 5JIIA 3WF3A 4WY7H 1DWIM 4OJFH 3BVVA 5EPDA 3MXVL 5GNZA 5I16B 2FZ9A 4F8XA 1HNGA 5FW8A 3AU1A 2Z1SA 3V6OC 5JIPA 2AANA 3FDWA 2CDEB 5B38G 1I45A 2R56H 2ZADA 3C3UA 4ASTA 4O4YH 4L4VD 3FZUD 3RP1A 5D30A 4GKZA 1PLAA 4B5SA 2Z4GA 1TTFA 1KEMH 4EZLA 1PTDA 3C8NA 2OI9C 4BQ8A 2GVEA 3VIOA 2X1XR 2XWTA 4GKZB 4A7SA 3F1QA 4MGGA 4PMUA 4YLWA 4LMQI 1M1SA 3SKNB 2V6AA 4F66A 3ARBB 4RE2A 3UZVA 2CLZB 3R13A 3JZUA 4LVHB 4W84A 4AZUA 1JPSL 2WYTA 5DQJA 4Z23A 1KR0A 1TV7A 1UZHA 3WY3A 4KFNA 4JL2A 4WY0A 1A5NC 3PP4L 1KXHA 1E6SM 2YCKX 3FOLA 2KLRA 4YAQB 4X2RA 4ZB5A 3WK0A 4HYTB 2ZXAA 3TA3D 3CJJA 3VYOA 3GWQA 2J25A 1X6NA 2NY7H 2V6HA 3FZUC 1M7JA 3NL5A 3OD3A 3IFNH 1ROCA 4GISA 4H4IA 2GFTA 1U9KA 1OSYA 3VILA 2HJFB 3FUJA 4LDOB 5DYOA 1LEIB 5M03A 1AE6H 2VW7A 3D48R 2E7LA 2PFHA 3VM5A 2DH3A 3D06A 3WEOA 3QRBA 4LHUG 2V2TB 4CKQA 3NSDA 2EIZA 3O8XB 4P46C 2HG5B 2VL4A 1BYBA 4MB1A 1I8JA 3HC2A 3CFTA 4JVWA 1KYFA 1BZ9A 5D7JA 2R1WB 2P5EA 2ZKHL 5JZ7D 1DLHA 4S0TD 1DL7H 1DN2A 3HUJF 3IVUA 3UPMA 4UQ9A 2XFFA 3D85D 2CLRA 2YPIA 1JGIA 2E9LA 3U7WL 1JR1A 3B9EA 1JN6A 2IH3A 2DYPD 5B1AB 3QLDA 4O1CA 3UXDA 1J8HA 3XIMA 2B31A 4D8ZA 1M42A 1CI3M 1BVKB 2J72A 3ME0B 2PRHA 3W02A 5C71A 2DIAA 2OKMA 5ALBH 2Y8VA 1Q1JH 3ZJ7A 1T7VA 1ZEAL 1V0NA 3GGWA 3HM7A 2BO0A 1IL1B 5E70A 4CILA 4PBVC 5F1VA 1OE1A 3VFCA 1SF3A 1TWDA 4NM8H 2WLMA 1UD4A 1KR1A 3QZAA 1CG9B 5H94A 4I48A 3IANA 3TXVA 2JBMA 3HI5H 5ES4B 5AVQB 4AE0A 1JWUB 3T44A 2C6QA 4Y2NA 4KRPC 5SWZE 2DIBA 2EXOA 2ZVIA 4P04A 4IRSC 4R0LA 3SCMB 4YHKH 4OFDA 2OELA 1GZQA 1AAJA 2X89A 3C5JB 5TNVA 1KIQA 5LDSA 1BTCA 5EU7C 2XIQA 3GYRA 4B53A 3E0LA 4YHZH 5CWSB 5LIUX 4PJ9A 3EDKA 3SCSA 1DO5A 5FCZA 4JTRA 4WCYH 5L2KD 1JPIA 5F4WA 5F7UA 1EDHA 1IEIA 1VLXA 1Q0YL 1IHIA 4R5EA 3IGHX 3L95B 3NJIA 3S8HA 5M17A 1MI5B 5DJXB 3BC9A 4Z5RA 5HJYA 1USZA 5FEPA 4Q8OA 2O4EA 2CBMA 3QDMD 2HT3C 4JDEB 2PU1A 4MNGE 7FABH 1NCTA 5IGXH 1DCEA 4JBRA 4CJ1A 1OIMA 2VEFA 4AT6B 4B96A 2IXQB 2DEYX 3LVTA 3WJLC 1RHFA 5JOPE 3D25A 5AOMA 2H3NA 3B34A 1HVQA 1BIIB 4CD7A 4QRQB 2N7AA 1D2PA 2VZ3A 1QO5A 4PLJD 5LCVH 3NEXA 1T03L 4JX6A 4WDWA 3UJRA 2UZYA 4M7KL 4CMMA 1BQGA 1E4WL 1FZMB 2VERN 4FCAA 5D5MA 3IU4L 2H26B 4GXUN 5FF4A 4YDLB 1AO7B 1ORSA 1SJEA 3OSKA 4NOBA 1TTUA 2ADAA 4FXSA 4X6DB 4IIBA 1T6WA 3NAVA 4RRPG 3HGJA 3W2DH 4GY7A 2K3TA 5C0JA 5DK0B 3IXTB 3SCNA 2Z6FA 3JZ7A 3FUNA 1ZU8A 3BP6A 5FOBA 1RVFL 4UQ2B 3TO4C 2FNBA 2Y23A 4WW2F 1OFQA 1VEMA 3F83A 2GUBA 3LQAC 2QF7A 2YD8A 3I75A 3OXRA 2X1WL 4AM0Q 5TE6H 3TYEA 1XFPA 2FPVA 1KM0A 5CD3B 1NCAL 4G1MA 3BSZA 2XG5B 1WHPA 3RITA 1KFEA 1KB3A 4XAWL 3KGSA 2G75A 2ZXWB 2WMPB 3OXSB 4GRLB 4JO3H 1AYRA 1NWPA 2E59A 3TF4A 2HBVA 4MAYC 4QE5A 3OKKB 1A6UL 3JWNG 1RY8A 1A9VA 5CMAA 3PQYD 1WFIA 4P5SA 4AG4H 4DJDC 1IX2A 4NRYB 2E5BA 3NYDA 4PMQA 3MRCB 2OMYA 1KZQA 4L5FE 1E5JA 2XKUA 3IJYA 5T3ZH 2EYRB 2OW6A 4ZAKD 1LK3H 3QW3A 3SUSA 4CCCA 1HH6A 2X4QA 3PFMA 4XNZC 3NCWA 5DQJB 5SX4H 4RZ6A 4PRBA 2DJMA 3P77B 4YN3A 3VXNB 3FRUB 2QDEA 4DYKA 1LMKA 1HZKA 5I1IH 1KUMA 1PD1A 1QWHA 4FI6A 1QEWB 4YVXA 3V0UA 1XF1A 1C16A 2W79A 3FIGA 3DROA 3G3MA 3M0VA 2OCZA 3S2CA 2PC8A 1EX1A 4X6EB 4OCMC 1U95A 5DHVB 4A7QA 4ABWA 3K2IA 4HNNA 5A2IH 4HNLA 2DSZA 4YHEA 1UZ6F 3K6NA 1MZRA 1P7QD 1LD9A 2Q7YB 5ICYB 2ZDRA 1UYQA 2P8BA 4JQ2A 3BLKA 3GJFH 2UV3A 2X05A 2Y89A 3AMKA 1KLUB 1KTCA 2BSEA 3MCLL 2QW5A 4NJJA 3TQKA 4C7GA 2MOGA 1V93A 1HHIA 2OXGA 1XLFA 1UYWL 3OKEA 2IPGA 2XPYA 1SLUA 3ZT6A 5C0CD 2IXVA 2YCJA 4HJGA 3E49A 3RYMA 3BICA 2OXHB 3OSVA 2HISA 1UWFA 2XI9A 3QNFA 3RIKA 5DD5L 4YHPB 1P7KB 5CSYA 4IHCA 3QC6X 4O28A 5DLCA 5T1LA 1HYSC 1EF3A 5KZEA 2A5HA 1E51A 4M1GL 2O5XH 3GJEA 4APXB 5T1LB 1K8YA 3UWVA 3WLNA 4FDWA 1SF5A 3EJZC 4GRLD 1AO7D 1L9PA 4U4IA 4KKAC 1NGYB 4XAWH 4EEEA 1M3UA 1YLVA 3TQVA 4Z7UA 2EZ0C 4X5PA 2ICWJ 2UVEA 3TW6A 1Y7VA 5C0BE 3KPNB 2HZHA 4L3CA 1V7AA 2GT9A 2Z7ZA 3ELAT 4R26L 2RDXA 1YEGH 2XWXA 3V7AE 1Q6DA 2WB1A 4OSUL 4D3CH 3EWZA 4JTDA 4HBCH 5C2UB 5M7QA 2CIIA 1E8WA 5KJRH 1HS6A 4KKRA 3WLPA 5FA4B 3WN5B 3N12A 3V5DA 1RAMA 4OUOA 4OUUB 5ETUA 3PJSB 1W8EA 5CC5A 5EF1A 2O93L 1S7SB 4CW1B 4GXWA 1UJTA 4MMXA 1TDQA 3SGKC 3W7IA 1PW3A 3NIGE 1XYAA 4R96B 4PJFF 3I02A 1F58H 4RDQG 3Q7JA 2CWRA 5EBLA 5HDQH 1ZLWK 1TX0A 3QORD 2BZNA 5DUML 3MTXA 2FVKA 1Q0EA 4PL2A 1Q6CA 1EO8L 3I02B 5EBLB 5C0AB 1XRTA 1FLRH 5AVNA 3OB0H 1U8OA 4K73A 1ZA3B 2NUXA 3VNMA 2CK2A 3BSZL 4JX4A 2GITA 4QJ3B 3T3MF 3VB9A 1ZBWA 4NJAL 3LCLA 2IANB 2ZX8A 2BVTA 5LLIC 3FKRA 1QEWA 1TZAA 2H3KA 4UT7H 4JFZL 5DJCB 1DE5A 5FYKU 4AYMC 3Q0HA 3F5WB 2XM2A 4RL3A 1KXQA 4GUFA 3MLYL 5D02A 3WL1A 4XNUH 2JVUA 1M7IB 1ZY9A 2ARJB 2OV0A 3DV4B 4A2LA 4QX4A 2F68X 4TKWA 2ZCKL 1AR1B 3IRPX 5E2VH 1AE6L 1J9TA 3DXAA 4D7BA 3OBAA 1IFGA 1EEZB 2CO6B 3QUYA 2C9XA 3GRWH 1Y6NR 4PBGA 1U92B 5CBEB 1H9VA 3KXFB 3NT0A 4UQCA 3COTA 1JNLH 2HFTA 1DWHM 1AQMA 3KHDA 3TAOA 5E9DB 2E8YA 3UA3A 5FAAA 3TVMD 1OFAA 3WH5A 3DVIA 3LEYH 4HCGA 4QRUB 4PJBB 2ISSA 2ZUSA 1KENH 3VE0B 4QCEA 4N2DA 5LXGH 4CCEA 2DQJH 4K3EH 4G1MB 2QTVA 3NACL 5DD1H 3M5ZA 1U8HA 2FYYA 2YAOA 3BDYH 2PEVA 1BF6A 3R11A 4ZE5A 1G6VK 2PLCA 4B9GA 3LA4A 1ZTVA 1YXYA 3HTLX 3A47A 3E0GA 2B7OA 3TYFB 3QCTH 1NGXB 2HVMA 4C4BA 4Q2ZA</