3AJ7A

Crystal structure of isomaltase from saccharomyces cerevisiae
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
586
structure length
586
Chain Sequence
SSAHPETEPKWWKEATFYQIYPASFKDSNDDGWGDMKGIASKLEYIKELGADAIWISPFYDSPQDDMGYDIANYEKVWPTYGTNEDCFALIEKTHKLGMKFITDLVINHCSSEHEWFKESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSYFGGSAWTFDEKTQEFYLRLFCSTQPDLNWENEDCRKAIYESAVGYWLDHGVDGFRIDVGSLYSKVVGLPDAPVVDKNSTWQSSDPYTLNGPRIHEFHQEMNQFIRNRVKDGREIMTVGEMQHASDETKRLYTSASRHELSELFNFSHTDVGTSPLFRYNLVPFELKDWKIALAELFRYINGTDCWSTIYLENHDQPRSITRFGDDSPKNRVISGKLLSVLLSALTGTLYVYQGQELGQINFKNWPVEKYEDVEIRNNYNAIKEEHGENSEEMKKFLEAIALISRDHARTPMQWSREEPNAGFSGPSAKPWFYLNDSFREGINVEDEIKDPNSVLNFWKEALKFRKAHKDITVYGYDFEFIDLDNKKLFSFTKKYNNKTLFAALNFSSDATDFKIPNDDSSFKLEFGNYPKKEVDASSRTLKPWEGRIYISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Oligo-1,6-glucosidase
publication title Crystal structures of isomaltase from Saccharomyces cerevisiae and in complex with its competitive inhibitor maltose
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 231
structure length 586
sequence length 586
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2010-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3aj7A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3aj7A01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3aj7A02
5JUVA 5DMYA 5BXTA 4CVUA 3PTQA 4OOUA 5HPCA 3VX1A 3KLLA 4ATDA 4J3TA 1G9HA 1ZBWA 1JF6A 5ABEA 1J10A 1J12A 1JYWA 1MYRA 1R87A 2YDSA 4B3LA 5C8BB 4WKHA 1SR0A 3MANA 3WD4A 4UFHA 5A6JA 3SCNA 2E9BA 1WB0A 2D3NA 2XFYA 3BC9A 2ZX8A 3A3HA 3NDZA 3CUGA 2VC9A 4ZXLA 3WENA 3AHXA 3CIVA 1W3KA 4JIEA 4AD1A 4NXKA 4D71A 4A3HA 3T0DA 1JZ3A 2OSYA 3RPMA 3AMDA 3WFZA 3ZJKA 1US3A 2BHYA 1V3LA 3EMZA 3EJPA 2ZWYA 1RPKA 3VD5A 2DGAA 4WJXA 5GNXA 1VBRA 1V3IA 5E1QA 1GQIA 3FHQA 3W81A 2VRQA 3OLDA 4MB4A 2EQDA 1MVYA 4NZFA 3I3DA 2E9MA 1VEPA 1H1NA 3GNPA 3AIWA 1HT6A 5CPQA 1KTCA 5CLWA 4AZBA 2WC3A 1UQZA 4AWEA 2DIEA 3CO4A 1V3KA 4JKLA 7A3HA 4YN5A 4LXFA 4FNRA 3BLKA 4PCTA 6TAAA 3EMCA 3A4XA 1W9PA 3F5JA 3SCWA 4C7DA 3ZR5A 2FHCA 2CETA 1GJWA 3WDJA 1C92A 2J7BA 3HN3A 2B31A 5M5DA 1LWJA 2DSUA 4HMDA 2JFEX 1TE1A 2PF0A 1KQZA 5CZKA 5AYIA 1V6WA 4W84A 3DX4A 1ZBCA 3RM8A 1E4NA 2J7CA 4S3JA 2VZVA 1ZB5A 1K9TA 1UR1A 4XZWA 3TP4A 2J7HA 3GH4A 1C3FA 4HP5A 3M6DA 2NW0A 1UWIA 1RD6A 1J0IA 1GQJA 3TV8A 1JL8A 4BQ2A 2CXGA 4CD6A 3K46A 2QV4A 2J47A 4MJ2A 1UWRA 1EA9C 3N12A 4GKLA 3VGHA 1HIZA 2JEQA 4GXPA 3A5VA 3VM5A 4P8WA 3JUGA 3GTNA 3SURA 1BVNP 3II1A 5EMYA 4P8VA 3ZM8A 2DT1A 1UH3A 1EHNA 5F7UA 3VMOA 3PZVA 1XSKA 1XRVA 2WWDA 3L4UA 4PMZA 4L4PA 1PAMA 1V3HA 1J18A 1UD6A 1I1XA 3I3BA 2CKSA 2ZX5A 3AIVA 5BXPA 4PYSA 1QW8A 2FDMA 1CXLA 3EJRA 2WWCA 1H11A 2ZXBA 5A94A 2YA0A 1E15A 4AZHA 4JL1A 5EFFA 2VMFA 2XVNA 1E3XA 2XGBA 1RP8A 1WZKA 4MAZA 2BVTA 4M8UA 1B1YA 3BLBA 1R85A 3BUIA 3DHUA 4AZGA 3WF3A 4LPCA 4AD3A 1NWSA 2DEPA 5ECUA 2WMJA 1GZJA 2YFNA 4W5UA 2J7FA 3WUGA 3DYMA 5ABFB 4U33A 5BROA 2BY2A 1JYXA 4HZ8A 5I5RA 2OWXA 3B9EA 4F66A 1NM9A 1WDRA 1V0KA 2W61A 3SUUA 4GQRA 3VPLA 1UKTA 4JFTA 1QBBA 2ZUTA 5D8ZA 3WF1A 2VQTA 4CCEA 1XH1A 4UQDA 3TOPA 4F9JA 1CDGA 1HJXA 3B9AA 4Z2GA 1G94A 3MO4A 1VENA 1A3HA 3LPPA 4ZENA 5BXSA 5IHRA 4MB3A 3AMLA 2V3EA 1UR4A 4JHOA 3GXDA 1K9DA 3PBGA 1PX8A 4DUVA 3VIKA 4MPKA 4OKDA 2V5CA 2EO7A 3MUIA 5AC5A 3KLKA 2BY0A 1EDGA 4XB3A 3CZSA 1JGIA 2D1ZA 1TA3B 2YJQA 3IK2A 5BRQA 3SCUA 4CVWA 4QLKA 5TD4A 1GQLA 4BZYA 4H8VA 1NOFA 3D52A 1J01A 3SCSA 1B9ZA 5JIPA 3AMKA 2YLLA 4EKJA 4PSPA 2J8GA 1LG1A 3NUKA 2ZX9A 2FHFA 3WNLA 3CTTA 3OGVA 2WK2A 1E6PA 1FA2A 1KR0A 2VZSA 1ODUA 1CGXA 2D0GA 4AMWA 2EPOA 5C70A 1EGZA 1FHLA 1PS3A 1UWSA 1QBAA 3DX0A 1E0XA 3QOKA 1NWRA 4BA0A 1JZ7A 4W8AA 4LYQA 3EMQA 5CSUA 1TQVA 2BY1A 2WZEA 1B3WA 5CSYA 1XYFA 4U3AA 4HMCA 5CJ5A 1W9UA 2YA1A 3UEQA 5C71A 2XSBA 4GZIA 1OSEA 2PWDA 2WB5A 1LL6A 2DIJA 3DDGA 1VFUA 4AIEA 2WHJA 2C0HA 1KQYA 4BQ3A 1R75A 3BUQA 3UCQA 1GW1A 4C7FA 5HDRA 1G01A 4FF5A 2EPMX 3OIHA 3MUY1 3BAIA 1V6XA 1CNVA 5IDIA 3N17A 1BSIA 2Y24A 3ARQA 2VZUA 1E6QM 3CBWA 3WNNA 1E1FA 3WDIA 3WQ4A 1P6WA 5D4YA 4NXSA 4CGTA 4HPGA 1H3GA 1H41A 2E8ZA 3RM4A 5I2UA 4ACYA 3A22A 1LQ0A 1YQ2A 2ZUWA 1ISXA 5CPSA 1BYCA 1V03A 4PEEA 1BFNA 1CGUA 2G4FA 3DECA 5BWFA 1TZ7A 3LRLA 1UA3A 1I75A 1C93A 4KRUA 1W1VA 1HJUA 2VT0A 1CGYA 4W93A 1E5NA 1GUVA 3BMWA 4U2YA 2CKRA 4H04A 2QHAA 2Z1KA 4CD5A 4Q7NA 4KMQA 1AQ0A 4HTYA 5A69A 1JXJA 3U7BA 5ABHA 3WDRA 4BQ4A 4C7GA 1LWHA 4JHZA 2DT3A 4HZ7A 4H8HA 4CU6A 4AC1X 1XH0A 1CEOA 2OW6A 5A6AA 1DTUA 3K8MA 4KRTA 3WL0A 3WELA 5GNZA 1E3ZA 4HOZA 1E4IA 4GI6A 4W7UA 4KGJA 1FOBA 2OYLA 4UFIA 3W6LA 3WEOA 2QPSA 1HJQA 3CZ8A 1JZ6A 3WIJA 3BAXA 3AS1A 1IZJA 1B31A 1VFFA 5EB8A 6CGTA 4AD2A 4D1JA 4X9YA 4FLOA 1FP8A 3W82A 4V2XA 1VRXA 4U2ZA 2DH2A 3BAWA 4V27A 3L2MA 2D2OA 3D4ZA 2D24A 4F9DA 4Z2JA 3KE0A 5I23A 4P7NA 2XN0A 4DUXA 5JBFA 5DFAA 4QCFA 2ZXQA 1V02E 2XVLA 3WD2A 2J7GA 1W3JA 1SYTA 1CXEA 1GONA 4OUEA 2IUZA 4NF7A 4HA4A 4PTWA 5I3DA 1NWTA 2ZX7A 2WXDM 5M03A 4EAMA 3CZGA 3AS0A 1O6IA 4NRRA 3VGGA 4CCCA 5CG0A 4HPHA 4AD0A 3BAKA 4AZIA 1KXQA 2UY4A 2XGIA 3UG5A 1KGXA 1AQHA 2VVNA 1Q6CA 3HG4A 3VD4A 4OZOA 1HP4A 4OOZA 1DWFM 3APGA 3UERA 5GNYA 3T08A 2YIHA 1LLOA 4U3CA 5FOOA 3WQWA 3VD9A 2F1AA 1WE5A 3CGTA 2HVMA 1HL8A 1R33A 5A6MA 1UYQA 3CZJA 3W37A 1M04A 3T0BA 3GNRA 3IJ7A 1F4HA 3T2QA 3VX0A 3WY3A 2W92A 2DT2A 2VURA 1TVNA 4HA1A 3FHAA 4RE4A 1VB9A 1XCXA 3VNYA 2J75A 1XGZA 4UFLA 2PC8A 3BLPX 4FNTA 1HJWA 4ZE4A 1OD0A 1OIFA 3ARSA 5E0FA 4LYPA 4BS0A 2YDQA 4MNJA 1KCKA 3VO0A 1KCLA 2XHYA 4UOZA 1IV8A 4B3KA 1TG7A 1TQUA 2C8NA 3LPFA 3LX9A 4PMDA 3NSMA 3MSGA 5IXEA 1SMAA 1TMQA 2GJPA 4UFJA 2O9PA 4P7QA 3SUSA 1UD5A 1ISVA 4A3YA 1JF5A 2ZUSA 1Y7VA 4D6FA 2F7OA 2F7RA 4TTUA 2FGLA 1CZ1A 5KZ6A 3G6MA 4AIUA 2F2HA 2D73A 1MW1A 4UZSA 5ABFA 1WZMA 5GPRA 1E6ZA 3BH4A 3WF2A 3WUFA 5A2BA 1KWKA 1J0JA 2XVPA 1FH7A 3OGSA 1Q6DA 1AMYA 2FYVA 2IXVA 3B8SA 4R5EA 4W87A 3BUBA 1ISYA 4QAWA 5A6BA 4DM2A 2WMHA 1B0IA 1K6AA 1GVIA 1TUXA 1Q6GA 4D6JA 2X0HA 1W3LA 1GOKA 3L2LA 3KL0A 4E8DA 3ZQ9A 4EE9A 3OGRA 3L4TA 1S46A 1JXKA 1U2YA 5EBAA 1TA3A 2V5DA 3OG2A 2YL6A 3VDBA 3PZIA 1H2JA 2V3GA 2QPUA 5E0CA 1D3CA 3WNPA 2X2YA 2F7QA 3THDA 1JDDA 1UKSA 3D5HA 3LPGA 3SCQA 4H41A 3VTRA 1NWUA 2W67A 1KWGA 1TVPA 3A47A 4W85A 2W4XA 4AEEA 3BUPA 3LPOA 3ZJ6A 2VR5A 4QFUA 5BCAA 4H7VA 3GNOA 3GZAA 1NP2A 2G3NA 3D3AA 5FIPA 3W24A 3CHCA 3AQUA 4M82A 3CZKA 1R47A 1E0VA 2FE0A 1DP0A 1XCWA 3DX1A 1CBGA 2XYLA 4LX4A 3AICA 3SCRA 1PZ3A 2GDVA 3UR8A 3CC1A 4CU8A 1XHGA 4IM4A 2XPKA 3VIGA 4DO5A 1E70M 1EQCA 3SEPA 2YOCA 3K8LA 3VD7A 5I24A 3POCA 3WH7A 5A3HA 1EO5A 4UFKA 1HTYA 1V08A 3WNKA 1UWUA 2WHLA 2CBIA 1WZLA 2DQXA 2CIPA 1CENA 4IUGA 3OLEA 1OT2A 5GQBA 4AISA 3WD0A 5A95A 2WSKA 3WF0A 4Q22A 3K1DA 1E73M 3OBAA 3MKKA 3G6LA 1PPIA 3AXXA 3AFBA 4P7LA 3VU2A 1OGGA 3MS8A 3ZJ8A 3RJXA 5A8QA 2OSXA 1Q6FA 2TAAA 1W3HA 3NCOA 4BCEA 1JD9A 1NOUA 1O7DC 5DF0A 1H0GA 1HP5A 2EPNA 1HKKA 1UD4A 1JI2A 2FH8A 1WDSA 1CGTA 1GQKA 1CYGA 4PBGA 1HKMA 4TVCA 3ZSSA 4NZJA 4NZCA 5D9NA 1JFHA 1JZ2A 4CU7A 5BYWA 4AXNA 2OW7A 3TTSA 1BG4A 1OINA 1KGWA 4QCEA 3F5KA 1QX1A 2E0PA 2BVDA 4P7OA 8CGTA 3RCNA 3AHTA 4WLCA 3CV5A 1B3ZA 1WDQA 2QMKA 2YBUA 3FY1A 3WQ5A 4AZ7A 1V3JA 3AHYA 4CCDA 4D6DA 2EPLX 4X0NA 3VIMA 1E4LA 4PUEA 3S6TA 4FNPA 1UD2A 1B3XA 2ZIDA 3AIQA 2D0HA 2FGZA 3SCPA 5CGTA 5CGMA 3AISA 3HMCA 3ZMRA 1V6UA 4MJ4A 3H54A 1UKPA 1CTNA 2HISA 1EXPA 3WH6A 3LXBA 4MTVA 4OBSA 1QI4A 3KL3A 4Y7EA 4OJYA 1GOQA 1KBKA 4ZFMA 4W86A 4OIFA 2J25A 2BS9A 1J0KA 1JI1A 1UH4A 3L4ZA 3TTQA 3AIBA 3ARWA 3S5ZA 3ARVA 2E4TA 1QNQA 2D20A 1XH2A 2J8FA 2EEXA 3CUIA 3I3EA 2VCCA 4KH2A 4AZCB 2VQUA 2DDXA 3W38A 4EK7A 4A4AA 1JDAA 3EBVA 1KXHA 5JBEA 1VFMA 1NP0A 1R86A 3PZOA 4MDPA 3AYRA 1BTCA 2G41A 7TAAA 1HKIA 3F4VA 4FNSA 2WMIB 1KFWA 1KR1A 2A3CA 2WYSA 3PN8A 4TX8A 1V6VA 2WCGA 1JNEA 2YA2A 2ZXAA 2WLYA 4J7RA 3MU7A 3WF4A 3B9DA 1QW9A 4W7WA 3HZ3A 3O9NA 2J7DA 3VSVA 2JIWA 3SUTA 3AXHA 2QF8A 3GM8A 4WIWA 4DM1A 1V02A 3PZTA 2D0FA 3BVTA 1E71M 2F1BA 1U33A 4GZEA 3RIKA 1UH2A 2ZE0A 4LYRA 1HVXA 1PBGA 5KEZA 3ARZA 4GQQA 4ML4A 3QHMA 3GH5A 5FL0A 3IAPA 2X2HA 3ECQA 3IGUA 5LYRA 1OWQA 4GI8A 4XZBA 1UA7A 2W5FA 1C91A 5FCZA 1U30A 1XSJA 2ZWZA 4D6HA 2E8YA 4GZJA 3ARPA 2C7FA 5E6YA 3CMJA 1MW2A 1MWOA 3ZR6A 3AMGA 1FFRA 1ZJBA 3WMCA 4DWSB 4NX0A 1M7XA 1NQ6A 2PB1A 3VMNA 4M29A 1ZJAA 1GOIA 5E09A 3SCTA 3QOMA 1QI0A 3AJ7A 2FH6A 4PCSA 2OSWA 4S3KA 5DT7A 5A1AA 3GXPA 4YHEA 1Q6EA 4AD5A 4YPJA 2XFRA 2GJXB 4B16A 1UD8A 1XC6A 3KL5A 3WQ8A 1X1NA 3CZEA 3IJ9A 4UCFA 3O6AA 2XVGA 1OGSA 2VI0A 3GBEA 4PMRA 5M17A 1V0LA 3FXYA 1CGWA 1X6NA 1VBUA 3PZQA 4MDOA 1BPLB 4QDMA 3VOCA 4RL3A 8A3HA 4ATWA 3RMEA 2DSVA 4AYGA 3E1F1 1DEDA 3N18A 1BHGA 3GH7A 5HXMA 3GXNA 3D51A 2WSPA 4TVDA 3QR3A 3ZJ7A 1WP6A 1FH9A 1WZAA 1XSIA 3A4WA 1C7TA 4P8XA 2WM0A 3W26A 1CECA 1N82A 4J3XA 5A8PA 1BQCA 5A6LA 1L0PA 1OT1A 3VNZA 1MFVA 4NSBA 2XIBA 3N11A 1C90A 3W4RA 1JYNA 2WPGA 4CD4A 2E40A 5I6SA 3VGFA 1QNRA 2WMGA 3LRMA 3LXAA 2AMGA 3PHAA 3U5YA 3WD3A 1VIWA 5FD0A 3AHVA 3HU7A 2WC4A 3RDKA 1QNSA 4NRSA 1ITXA 2Q8XA 2NT1A 1DWGM 3RM9A 1JFXA 3AS3A 1I1WA 2WLZA 3ALGA 3L4YA 1E9LA 1GORA 1J0ZA 1UWTA 3PZ9A 3UETA 4UQCA 1J0HA 1UKQA 5I0DA 2WHMA 4QP0A 4PMUA 3PZMA 4ACZB 3KWXA 4EANA 3EDJA 4AD4A 4Z2IA 4LQ1A 4J3SA 1UD3A 1W1PA 3NYDA 1AVAA 1VJSA 3PZGA 2O9RA 3PZUA 3WSUA 2J79A 3WMSA 2PBOA 3DYPA 1Z32X 1FP9A 5E70A 5A8MA 3PTMA 2IXUA 2X0YA 4MB5A 2QLYA 2W91A 3HJEA 1K9EA 3WH8A 4B9YA 1VAHA 1JG9A 2WVUA 5FKYA 3EYPA 5A6SA 3AIEA 1BVZA 1E6SM 2EXOA 4GO9A 2XN1A 1PZ2A 1B3VA 2XSAA 2WCAA 3OZPA 3L4WA 1EHAA 1EOMA 1QNPA 3VIHA 4FK9A 2ESCA 3AIRA 2XG9A 3BAYA 2XUCA 4J28A 4BQ5A 1UZ4A 1B30A 2YFOA 1W1TA 3EDDA 3EJSA 4PN2A 1BGAA 2V3FA 4WSJA 4XUYA 2YL9A 1EH9A 2J77A 2BY3A 1GNXA 1J0YA 3K4AA 4E2OA 2GVYA 1GCYA 3WH9A 4E8CA 3BSHA 4P7RA 2VNCA 4YHGA 5CXPA 1GOOA 1XD1A 4Z2HA 2GDUA 3TTYA 2XIIA 1FFQA 1UOKA 1A47A 2WVVB 2WVSA 1OIMA 3W29A 4CKQA 3EDEA 4M1RA 2EBNA 3MI6A 2YL5A 4ZEPA 1CXFA 5HPOA 4CUCA 3NSNA 1QVBA 2W62A 2DSKA 1UHVA 3VILA 3EJUA 1V0NA 1XYZA 1H0IA 1R7OA 2VTFA 4N42A 1AQMA 2JEPA 3WD1A 1RP9A 1UG6A 1WO2A 1ZBKA 5HNNA 3W25A 1UKOA 2CNCA 1G1YA 1HKJA 2WHKA 1C8YA 1V0MA 1R8LA 4CD7A 2BFGA 3GBDA 2UY2A 5A8OA 2RGLA 3DX3A 2JIEA 4WKFA 3WDHA 4OBRA 4DWSC 2YBTA 1XD0A 3WEZA 1SFSA 4UFMA 1JIBA 3TA9A 1FH8A 3VIJA 4W89A 1XV8A 4RE3A 4AMXA 1QWUA 4W8BA 3L4XA 2WKLA 3VSTA 1UWQA 3T09A 4AZ5A 3RJYA 2CCRA 2XWDA 4MB1A 2AOSA 4AZCA 3AZSA 2JE8A 1GOMA 5IHSA 5D9PA 2Y5EA 4JFSA 2W66A 2V38A 4JCLA 2X8RA 1E6RA 1QI5A 4FLRA 2IGTA 1QHZA 1HJVA 4PUDA 2WMIA 3A21A 4TXEA 5AYBA 4D6IA 2VOTA 2YKKA 4JZ5A 1LG2A 1MQRA 4U5KA 1W2PA 2BV9A 3A6OA 2VJXA 1G0CA 1F4AA 1IT0A 2MANA 1CGVA 3AZTA 4U5IA 1TQTA 2EPKX 4PRWA 3U7VA 5DT5A 1US2A 1UASA 4F79A 5DEZA 3CUFA 1GOWA 2VX6A 3FW6A 2YL8A 4JAWA 3ARRA 1GJUA 3DHPA 2DPEA 2BVYA 4H2CA 1ODZA 1E55A 1HVQA 1QI3A 1HX0A 3A23A 4UOQA 4FLSA 1C7SA 3WKZA 3VDHA 3L4VA 3H53A 4BF7A 3WNOA 2Y8VA 3AHZA 2GSJA 3AMCA 2J4GA 1MXDA 4AW7A 1VFOA 1OCQA 4PMYA 4HU8A 3H55A 1OBAA 3GXTA 2UWFA 5E9AA 3GYCA 5D8WA 2JF7A 4MNMA 4D6CA 1ESWA 3DX2A 1J11A 5I78A 1CIUA 2XN2A 3ZIZA 1JD7A 4ZE5A 5JIWA 4PMQA 4DWSA 1E43A 5A2AA 1CXKA 2EJ1A 2X2JA 3D4YA 4M80A 2PWGA 2NT0A 3A4AA 2XFFA 3UG4A 5JBDA 2VRJA 2DSZA 2XTKA 2FHBA 3M7SA 2WVTA 2V3DA 1K9FA 2G3JA 1UQYA 4PTMA 1D7FA 2OYKA 5E6ZA 3VIPA 2YDRA 3CH9A 1KTBA 4TTGA 3J7HA 2GJXA 1EOKA 3CUHA 1HF6A 5CLTA 3GXFA 4OGZA 4JCMA 1M03A 3ZT6A 1YHTA 3KZSA 4AY1A 1NOWA 4MNLA 2Z1SA 2W63A 4UQBA 1D2KA 1MFUA 2O92A 5A2CA 1W9BM 5FL1A 3LXCA 1E4MM 4AIOA 2A3HA 2CHOA 2VO5A 1ZL1A 3NIYA 1EIBA 1MW0A 3BAJA 1LF1A 3NJ3A 3AROA 4M24A 2PWHA 3OZOA 2DH3A 1T0OA 1X6LA 2Y4SA 3WMBA 1J9YA 2J78A 3MUZ1 2Y2WA 4CN1A 2EACA 3OA5A 2A3EA 3PZNA 3GXIA 3WY1A 1JAKA 2EAEA 3VIIA 2JF6A 3ARXA 2EABA 4GPNA 2VZTA 2CEQA 3N1AA 2WMFA 5I77A 4HOXA 4AYSA 3SIMA 3DC0A 3BGAA 4IISA 3FNDA 1EDQA 1R46A 4M81A 2XM1A 3MSDA 3U57A 4L4OA 3VKKA 3WY2A 2GK1B 2F61A 2VCBA 3DYOA 3VDCA 2WNWA 3WNMA 4CN6A 4H8UA 2YLAA 2OWWA 3VSUA 4TUFA 1PEZA 2ZX6A 4GINA 1VF8A 3DDFA 4GO8A 1OGBA 4ZXOA 2PWEA 3D50A 2BHUA 1W9DM 3VGBA 4AEFA 1HN1A 1BGGA 4PTVA 4D6EA 1B90A 1E1EA 2XVKA 4KGLA 2WKGA 2O9TA 2F7PA 1MW3A 4MADA 5ABGA 4TOQA 2J62A 1HXKA 2NSXA 3EDFA 3UESA 1QPKA 2WBKA 4ACZA 3CLWA 3WUBA 1MQPA 3CHDA 1TCMA 4J27A 1UZ1A 3AIUA 3NSXA 4JKKA 2WANA 4PSRA 4TX6A 4HZ6A 3EJQA 3K8KA 1H5VA 1WPCA 1ECEA 3VUPA 5I79A 1E0WA 1H4PA 2G3IA 4GIAA 5D9MA 2CYGA 2WW5A 1HNYA 3VD3A 3LRKA 1CWYA 3WH5A 3VM7A 1W91A 1V3MA 4HMEA 4Z2KA 2RGMA 3IAQA 1HJSA 2VRKA 2VX5A 2XWEA 4UZUA 4MAVA 1FHDA 5A8NA 2CBUA 1EQPA 1BYDA 1UUQA 3GDBA 1H09A 4MNKA 3AOFA 1M53A 3SUVA 4JKMA 3W0KA 4NI3A 3T0AA 3WQ6A 1QNOA 1JYVA 3MV11 2VR4A 4J3WA 1KGUA 1NH6A 1L8NA 4JFUA 4D1IA 7CGTA 3CZNA 1BAGA 2DT0A 3W6MA 1C8XA 1VEOA 1JZ8A 3SUWA 1CXIA 1ITCA 2D23A 1DWHM 3M46A 2WMKA 4UR9A 1R7AA 5A6BD 2CPUA 3SCOA 4X0VA 4RE2A 2PWFA 3FAXA 4HOWA 5D9OA 2XM2A 4N0RA 3TTOA 1BLIA 2CESA 3BVXA 3ARUA 2CBJA 3W28A 1JDCA 2J7EA 2AAAA 1EO7A 2WVVA 5LA0A 1HL9A 4DUWA 4LGXA 1DHKA 5EFDA 5AC4A 1JNDA 2CITA 3ZT5A 2QMJA 1BG9A 3BVUA 3NDYA 3POHA 3OB8A 1KXVA 1C8QA 3VGDA 2F8QA 3IANA 1JAEA 1CXHA 1R34A 3N15A 5BRPA 3PTKA 3VIOA 3BVVA 4AZ6A 1DWAM 2UY3A 3ZO9A 3VINA 4E4PA 1PIGA 3IJ8A 4J3VA 3VGEA 1SMDA 3K4DA 1TQSA 4PTXA 3W27A 1OB0A 5HOSA 4UNIA 1UR2A 1LL4A 3HG5A 4U31A 3VVGA 4V28A 4UTFA 2Y8KA 1PJ9A 3BCFA 3MMUA 1VEMA 1UR8A 4PMNA 1QWNA 3WFLA 3WBAA 2DSWA 1MXGA 1QHPA 5BXRA 2WZHA 4URIA 3KEHA 3W53A 1GVYA 1ISWA 1W32A 4WF7A 3BUDA 1KB3A 5AY7A 2GJRA 2XJ7A 1SZNA 3AS2A 1TQWA 3UG3A 1UR0A 2WCSA 4QLLA 2OWCA 3HG3A 4W5ZA 3MUAA 3U5UA 3UR7A 1E6NA 1Q4NX 1E56A 3FAWA 1QOXA 2VZOA 4PMXA 4GI9A 3AYSA 4W88A 3SCVA 3WDQA 4M56A 1V6YA 2E3ZA 5CQ1A 3T2OA 4UQAA 1W9XA 2VL4A 2JALA 2PBGA 2WZIA 6A3HA 1OM0A 4FNQA 4DWSD 1JZ5A 3AI0A 2UY5A 3ARTA 4HA3A 2WBGA 2ZOXA 1DWJM 2CERA 4B9ZA 3RO8A 2G3MA 1GHRA 1MQQA 5LA1A 2BXYA 2EADA 1W1YA 5IFTA 3A24A 2O9OA 4D72A 3WEMA 1M01A 3CPUA 5LA2A 1B2YA 3VDAA 3T2PA 1WAWA 3CHEA 2OYMA 2X05A 4UOJA 2D3LA 3TONA 1GPFA 2E9LA 3OLGA 2OLHA 2WC7A 4XV0A 3ALFA 4W7VA 1E72M 2WAGA 3WBEA 2VUYA 3AZRA 3CUJA 1CLVA 3RILA 2X09A 3F5LA 2VX7A 1E5JA 4WKAA 4AMCA 3VMPA 1VJZA 3WDPP 4DO6A 1KXTA 4FNUA 1QI2A 2ZUNA 1OD8A 1W9VA 3MMDA 3M07A 4FLQA 1BYBA 4IPLA 1PIFA 1ZU8A 4R27A 4WK9A 3WL1A 3VIFA 3ARYA 1WKYA 5IFPA 1GHSA 2CHNA 3WY4A 2VCAA 3N13A 1WNOA 5A6KA 3BMVA 4KWUA 2ALWA 3AXIA 2VVSA 1EDTA 2X1IA 2X2IA 3HG2A 3ZT7A 2PI6A 2F18A 1JZ4A 2BHZA 4K68A 3MMWA 5M3WA 1LL7A 3ZOAA 1BF2A 3WQVA 4P8UA 2D22A 4B15A 4CD8A 4PMOA 1H49A 1WCGA 2CBVA 1ZS2A 4F8XA 1ISZA 3S2CA 2A3BA 2J74A 1HWWA 4CN4A 3WN6A 4J3UA 4FMVA 3MV01 3CMGA 1G5AA 2ZXDA 3QGVA 3QHOA 1E40A 3OLIA 1KBBA 4D6GA 3CHFA 1O7AA 3FN9A 1NARA 1W2VA 4UQ9A 1TFVA 9CGTA 3N04A 1CPUA 5DO8A 2GFTA 3BXWA 3QHNA 4TVUA 1BYAA 1UR9A 1ZBVA 2VX4A 1PX3A 2ZUMA 3EJTA 1E6XM 3BSGA 3THCA 1TR1A 2BXZA 4QLJA 3BCDA 2G8ZA 4W8LA 4JL2A 2ZUUA 1DWIM 1B3YA 4ATLA 2A3AA 2GUYA 1LJYA 1PX4A 3ZSTA 3N9KA 4UQEA 4DO4A 4Z2LA 3O2LA 1QHOA 3WUEA 5HBFA 1WDPA 3S5YA 2ZUVA 3EDKA 1IZKA 5CPTA 2BNJA 4HU0A 3GXMA 1CLXA 3LMYA 1HXJA 2ZICA 3BVWA 4XX6A 3CZLA 4PMVA 4WSKA 4JFVA 2GK1A 1RH9A 4IPNB 4JFWA
chains in the Genus database with same CATH superfamily
5BXTA 2IH1B 4LHJB 3BL3A 3W7PA 3PDOA 3RCYA 1SR0A 3MANA 3O6KL 4OECA 3W7RA 1YNLH 2X0WA 5JW4N 3N5AA 1DUYB 1WB0A 1IBDA 3KPQB 4OQ1A 4UV4L 2HS6A 5T3XL 1URIA 4Q0XH 2OTDA 2BMKA 1U3NA 1JPEA 2YAHA 3C60B 3HNVL 3CL8A 2CXKA 3VXTB 1K7XA 3VXSD 1Q0YL 4I0PD 4IP7A 4CBPA 3G3DA 4WEEA 4D8AA 5L8LB 3QIWD 1GMEA 3GI9H 4F80A 2QCHA 4DK5A 1KXQE 4X6FA 2EQDA 3I3DA 5FJPA 2P5WD 3FOMA 1RERA 5DZPA 2XWCA 1P1ZB 4UC5A 1F4XH 3UTTB 4P2RB 3ULSA 3ZR5A 4LT9A 2R1YB 3QSRA 4H1LB 3UP8A 2IG2L 1GKRA 5JR1H 4FN0A 2YCLB 5C6TL 1KQZA 5AYIA 1ME9A 5J1AA 4S3JA 4F9PA 4PRPB 1OSYA 1OFEA 1YNQA 4P5SA 5L8KB 3GBNL 3O8AA 3TSDA 4G2DA 3M6DA 2DD8H 5KBPA 3R2GA 1FFPB 5IFAH 4PJEA 4DFHA 2QV4A 4HS8L 2V0TA 5HPMA 5RUBA 4IQDA 3B3BA 4H40A 3KYMA 3TF7C 1HIZA 4LAQL 4P8WA 4G8IA 3TYAA 3E6FA 4YFEA 3UTSB 1LUCB 5DZJA 4Q89A 3V7MA 4A3UA 3L4UA 3HMXL 4NP4H 5IQMA 1KELL 5DI8A 3H7BA 4W81A 4Q8UA 1R3TA 1QW8A 1NGWB 4KO7A 2FO4A 4ADUA 2FX8L 1W2KT 4D8ZA 2ZXBA 4I85A 4EXPX 2ZSVB 2FJSA 3CSBA 4UINL 1B1YA 3BLBA 1R85A 4L8BA 2FUQA 4L9ZA 4AZGA 5ECUA 4US6A 2RHEA 4PU2A 4HU3A 1FXPA 4U33A 4ZODA 5I5RA 1NM9A 2O5YH 3IS4A 2ZP8A 5C0CA 1QBBA 3EWZA 5HY9A 5LIKX 2EIEA 1VERA 4JQVC 3OX8B 4JY8A 1CDGA 3MN8A 1ECYA 4OZ4A 4HQQL 3PBGA 5CEXB 3L45A 4NKMA 7REQA 4QG8A 1R3JB 3LQGA 1V7NH 5L2KB 3CS2A 3RDJA 2EO1A 1EQWA 1JHLH 5BRQA 2JLLA 3FQTB 3IU4H 3D52A 2VEKA 2YCKX 1I8JA 4WO4B 3RMJA 1WAEA 2YLLA 1WITA 5I1GL 4AU0A 3SY1A 2ZKXA 3KWSA 4HK6A 43CAA 4K23L 4L56A 3SDXA 1FHLA 1TKWB 4A7VA 4JQXA 1OPGL 1JCMP 5E1HB 3SQBA 4PP2A 3W7KA 4NT6B 1NCWL 2TRYA 1QUMA 2QVIA 3VFSA 1RV6X 2A77H 4PLJD 2V4LA 3DLQR 4F2BA 3VXUD 2RFXB 2EEDA 1QSEB 3V18A 4AIEA 2Z34A 1KQYA 3UTOA 1Y0EA 3NVTA 5KANI 4DWDA 2ARJQ 3ZL4L 1BYPA 3KBVA 3COTA 5CSZA 4AQAA 4DGIL 4Q4OA 3CFJB 4HPGA 4UU9B 2E8ZA 1E4WL 4PJIA 2XFWA 3QDMD 3CB3A 3M1BA 2NY1C 3LD5A 3S9YA 1N2RB 1A65A 4IP5A 4KK8D 2DAVA 1SW3A 2G3XA 5IB5A 2K3TA 4KRUA 1KEMH 2CMRH 5IOPA 1GVOA 5J89A 1YNYA 1G9NC 2ZDRA 1W56A 5LAPA 4JDEB 1B88A 43C9A 3RIFK 2J8UA 4GKNB 3V5DA 4LCUA 2N1TE 1FQ9C 2Z28A 1E30A 3BT0A 3EGDA 3T05A 2OJZH 4P46B 4GI6A 4UFIA 4F7EA 1H61A 4FOKA 1FV1B 4ZSOB 4DUOA 1B31A 6CGTA 1HCFX 2WZAA 4JY5L 2P5EA 3MDUA 2DH2A 4N2YA 3CVHA 2CJ3A 4P7NA 2R14A 3P9LB 1WOAA 4F91B 3FYPA 4I90A 4HJFA 4NF7A 1RJRA 3QXBA 1EZVX 1UT2A 5EA0H 5CG0A 3SD2A 1A4KB 2KMWA 2YXWA 3TJEL 5KSAB 3OKMA 4XC3H 2VDPL 4F2MB 5GGRB 3DG3A 5GSRB 2VR7A 2CGYA 1GYWA 3CZFA 2V2CA 5MENE 1PCXA 3UERA 3MRRA 5FB8B 1BFTA 4J3BA 3LZNA 4U3CA 1XGDA 4GEIA 4MSWB 3VD9A 3EZ8A 5TE4L 3MI2A 3PFRA 4PGCB 2QKIA 1HL8A 5M7QA 5FSEC 3A67H 3KLDA 3IJ7A 5CZRA 5ICUA 3GLDA 2DT2A 3TS8A 2EKCA 3SE4A 3LY6A 3DH7A 3I50L 5DRNA 1YSOA 3MHGA 3PHOA 4H5SB 1V5XA 3QRBA 2YPLE 4LVNB 4C91A 3IVKA 5DURD 4H25A 1IC4H 3MP3A 3DRTA 1CR9L 5DQJB 4GPVA 35C8H 4AG4L 5GHWL 4P7QA 3BJTA 4JG5A 4U4IA 3AABA 1SNRA 3LTVA 1CZ1A 4AIUA 1J9RA 5LBVA 3O16A 3BQUA 1LL1A 1WZMA 2PYFA 2Q0ZX 3WUFA 2A9NH 4BRVA 4PB0L 3MBEB 3NA9H 2AQ2A 1UWFA 3W11C 5CBBA 1NL0H 2VR9A 5DHVH 2NUTA 1YAIA 3FC8A 2AEQL 5F9JB 4NQCD 3B7RL 1KFAH 3QJTB 3M64A 1K8ZA 3VDBA 4AZUA 2OFQA 3S1VA 2BNQA 1L9PA 4Y2OA 4LGPB 5MF5A 5DU7A 1KWGA 2QGYA 3GR4A 4GS7C 2VR5A 4QFUA 2I56A 4W9DC 1I1YA 4G2AA 4P5TC 3DX1A 5JMRA 2PNDA 2QQNH 3H2MA 1CGSH 3SCRA 3S34L 5CFHA 5LHFA 1PZ3A 2QSTA 1Z9NA 1MIML 5BS0E 5D6CB 2NY0C 2H32H 2ITFA 2B15A 4PH6A 1UJQA 1V08A 1A1OA 3MCKB 4S1DD 2CBIA 4U6XA 3V4VL 1TXKA 2HQAA 5FA4A 2JCCA 3UWWA 4MWAA 4LHUG 4AEIL 2EHHA 1A0QH 3WLRA 4GKTA 4ZMXA 4XMUA 2NWSA 3QCVH 3O1NA 4PJHF 3FCBA 4ADIA 1HKMA 2IWFA 3KRBA 2HSAA 4BWTA 4BFJA 4AXNA 2YD2A 3CJPA 4OLXH 3L0NA 3VSQA 3EGSA 4HG4J 4Q8QA 2QMKA 2IWGA 4JG0H 1R2SA 1YEDB 2H6OA 4X0NA 1SOXA 4MMXB 1HZHH 3V7PA 4HC1L 1JJKA 2C91A 2AMUA 3SCPA 2VFEA 4XTDA 1RK0B 5T1KD 2DV6A 3IETB 4ODUA 1E67A 4GAJH 5C6PB 3EW3B 4BXSV 4DAGL 1TQBC 4PWEA 2WV8A 4OFDA 1VGAA 1H7NA 3P1VA 1YPZA 5E2VL 1D6VH 4ALAC 1I3GH 3HNTL 4RNFA 2A1WL 1YPIA 4KRPD 4DZBB 4MZ8A 2PDPA 3PZOA 4HAFA 4PJ9C 2VKXA 3UY8A 1FL6A 1OLLA 4K8RD 2X44D 3NZSA 1OK6A 1V6VA 3MKCA 2HWGA 4ZFZA 2ZXAA 2FGWL 1IQDA 1X96A 2R6OA 3IDIA 3VSVA 1YYLL 4AQLA 5TE6L 1GAFH 2MKWA 2L5HA 2DQEL 2KDGA 4EZMA 1Y07A 1TDQA 4JEQA 1W80A 3QTGA 3CL6A 4Q4RA 2X2HA 4PJ8D 5JW3H 4FQXD 3II3A 2KZBA 2ZYSA 1D3HA 1YN6A 3DUSA 5FEWA 4OAWA 1VZGA 1YLBB 3CN1A 3P73A 1P5UB 4RMBA 1UXWB 5F7BA 3NQGA 2NVDA 5GS1A 4S3KA 5IK3B 2I5QA 3GXPA 5LGYA 3IMRA 1S7WA 2GT9A 5HD8D 4HJGB 4US5D 3W2UA 4NYLA 5JPMB 2ODIA 1TLKA 3HGJA 3FO9B 4KVCH 2ORBL 1JCLA 3DROB 5AB2A 4GLRI 4ALDA 1YNKH 2E6YA 4N2KA 2P8CA 1XPGA 1X6NA 3ZWTA 4E9QA 8A3HA 3OHXB 4ZO9A 2CCVA 4A2DA 2OMVA 3IXAB 1XLAA 1EJVC 4F5CA 3NIGF 3W26A 3LM7A 4FTVD 5HINA 4NSBA 4UTAH 4CD4A 4OQTA 3TN0C 3RLUA 1J8KA 1G4EA 1QFWL 4ZFFB 1ADOA 2ETWA 5IW1B 3MGOA 2QVTA 1ITXA 4LVEA 1W6WA 4GBXD 2TSYA 1OCWH 4FKEA 4RZ4A 4NO3A 1VADA 1T40A 3T0EE 5DJYA 1N68A 5GGVL 3CMFA 4AJ0A 4KUZL 2J79A 5DURB 4FI6A 3FDKA 2SODB 2VJ0A 1OPOA 3G6JA 1VR6A 1XC4A 4RAHA 2IEPA 2GY5A 3ML9A 1JG9A 4E2DA 3NPVA 3FBKA 3L12A 1QR4A 1EHAA 2YAOA 3VIHA 5CBJA 3UZEC 3GFZA 4JFDB 5IVXE 2XZCH 2XA8H 4NNPH 2ERJC 4PJDF 1UGNA 3SB0A 5HNTA 2VLKB 4XUYA 2BY3A 1A4AA 3K4AA 3PP4L 2VNCA 2CZNA 3VXPA 1KM4A 4NQCB 2GDUA 2PD5A 2ZCKH 2GPZA 3ARDC 2X1RA 2VDHA 1I9EA 5KAQG 3RG6A 2R2EB 2YL5A 3QQWA 4A7GF 3S3PA 4OGAC 4GW5A 4QOKA 2ZC1A 2IKGA 3B7TA 2Y5JA 3DXAB 5B38B 3UXDA 2X9WA 3EWXA 3L5AA 2NQ3A 2E56A 2DEYX 3H9YA 2VUOA 3HO8A 1ND0B 3N42B 5J12C 2LU4A 5GRWA 4QPEA 3TTEA 1UADC 1DVUA 4XCNB 3VWJD 2BX7A 4CNTA 2PGRA 2YRLA 3C8KA 3ABQA 1KLUA 1KIPA 1PVNA 2PRMA 1FVEA 1PZUB 1CD9B 3KPRB 3QQXA 3E8UH 2GIYA 3GDRA 1F8TL 4ZUUB 1LG2A 5D5MA 3KPOA 1ZZMA 2ZKMX 3TJHC 4G8FB 1FORH 1MSSA 3PCYA 4IBZA 4DW2L 1MRQA 3A4FA 5AKSA 1SQ7A 1FNEB 4JAWA 3GW0A 1RK1B 3KLHD 3W1NA 2BVYA 2PC4A 1LE9B 3CN4A 4UDTA 3T44A 5IESL 3AHZA 1AP2B 3AMCA 1B6DA 3HF3A 2C9UA 2HTMA 1YXDA 4Y2NA 4BH8A 4N2AA 1F74A 5I6KA 1AFVH 1TO5A 5F0JB 2CZ5A 4YH6A 1MCKA 5EUKB 4JGUA 1IKNA 3TWCL 3LNDA 1XBDA 3O0RL 3MJ9L 5TDPB 2NQHA 4F20A 5JBDA 3OB0K 4KX7A 5T1KB 1RD5A 5F88A 4X0KB 5FSDC 2KC0A 5GJTL 4L0ZA 4LSQL 3WIHL 2WLNA 5E24E 4XZNX 1O4UA 5KYYA 3O6ML 1N0LB 4XPBH 1L9WA 2CHOA 4QTHA 2C19A 2Z26A 1HHIA 1EP3A 4N5EC 4ZSUA 4KRPB 2EC9T 1IHIA 1PTAA 2BSEA 2DH3A 4MD4A 4BUHA 2OJPA 4KIEA 1WDDA 4CN1A 4Q7DA 2WOQA 5KVGL 1K02A 4OZGB 3BP4A 4XVEA 3OMZA 1XYBA 2ZG1A 4ONGL 4GGHA 2VYOA 1KMGA 4DP1X 3UAJA 3ZYIA 3P93A 3SIMA 1ROCA 4GSUA 2YBRB 2EKJA 1FWNA 5JYMA 2ED9A 5HWNA 4QBXA 3WIFB 5J13B 2N56A 1EK3A 3D3VD 3VSUA 4QUOA 1DL3A 5D71H 3DDFA 1WAUA 1HN1A 4FQXB 5B3NA 4YEFA 4PCYA 4GI4A 3S4SG 1INEL 3GO2A 1G1OA 4MADA 4Q3MA 1JGDB 2DZWA 3VXRB 3RL2A 1OT4A 5BRZB 3O2DL 2A6DB 1K3IA 5KMYA 4HZ6A 4D9RD 3NM1A 1AA1B 2FB4L 1I2RA 4GIAA 2GEEA 3VD3A 4NUQA 2Y1HA 1AIFB 2XJKA 4L5FH 4IIGA 1A02N 1FZMB 4F37F 3ARGB 4PJXB 3L3GB 2X4NA 3CFNA 1EQPA 2XUWA 1K5NA 4K2SA 1RY7B 5IEKB 4HNTA 3P2TA 4MVBC 3WJWA 4UUIA 4WRLA 2VLRD 2DT0A 4MA3B 2AK4B 1BBDH 1WQ5A 1IBYA 5INDA 4KTDH 1I8KB 1KIQB 4LDCA 1HDMA 3PUGA 4G1MA 2AK1L 3ID7A 5I1EH 4KZEL 5JXAH 2ICEC 4LDLB 2E5DA 1SSGA 3STLA 5HJXA 1NCNA 5EIIB 3BK0A 5CBEB 4FP1A 4AZ6A 3F84A 3ZO9A 5EIQA 2IPUK 4FR6A 4U7SA 3BZFB 4PTXA 3W27A 3WG6A 2OX1A 4DGYH 3UWEA 3HKFA 2M83A 4UTFA 5B7YA 1K8IB 3SGDI 3O6FA 3UYOD 3IJYA 2L7QA 4ZI8A 1Z69A 1DSYA 4KXBA 1KPUB 5DD6B 5IVZA 3IPFA 1KB3A 1RUAL 3HG1E 2CALA 1TQWA 3ZRCC 2HXUA 2WNXA 5E4EB 2W59A 2NDFA 4NJAH 5I1HH 3AXLB 3QULB 3KYNA 4UAOB 2VL4A 4OZFB 3UBFA 1OM0A 1I9IH 3QWRA 5C0FB 4HA3A 1HE7A 4CDHA 3IDYB 1YNPA 2C4FT 3BP6A 2QCNA 1BWWA 5LNSA 4U4BA 2PN5A 3OHMB 5FO7B 5EZIL 4D72A 1J5CA 3RP1A 4X98A 2FFCA 4PTTB 2NW2A 2ZYFA 2WZMA 1WAWA 4F0MA 1CLYH 3OLGA 4XV0A 3C9NB 1E72M 3AZRA 1CBVL 2ILLA 3RI5F 2VX7A 3OAWA 1YG9A 4BFAA 2YD9A 3NACH 3EF4A 1F8IA 4KZCA 3QFJA 3M07A 4OB5L 4M8QA 5IM7B 1BX2A 1RZJL 2EKSB 4KWUA 2QDDA 3CX5K 3STEA 5KSBF 4H6RA 5IB4A 3ZT7A 3QM3A 2J7LA 3DSNB 4LP5A 2BHZA 3TYGH 3S1UA 5CH9A 2ALRA 4XCFH 3VZZA 5M3WA 5JIMA 1MNSA 4LASL 5EH1A 3LSOA 1G4RA 4C56A 1XR8A 3FB7B 4W70A 4YHPB 3FQWB 3VA2C 5DC4B 1VDGA 2APTA 1ZLSH 2FMNA 1GKEA 3U6WA 1O7AA 1Q7ZA 3BH9A 2XGZA 3T0XA 4FQPA 4PV8A 3BMXA 3TH3T 3BQ6A 1P7HL 2HVNA 3T6XA 4NQTA 3PG8A 4W8LA 2KBGA 2R15A 4O14A 2R0ZH 1S7TB 2IANE 3EYQD 1PX4A 3N9KA 1M2VA 3NCFB 4CL7A 3SO3B 4G7YL 4TUOB 4ZOCA 5CCHE 4HHAB 2IF7A 1T21B 1B4TA 3QDGD 1UMYA 2CG9X 4JRWA 2LLEA 1TJMA 4P0DA 1UMLA 1WG3A 3VX1A 3EYUH 2R29A 3HZVA 4ATDA 1ZBWA 5K4ZA 4FYQA 4Y6GA 4ZZKA 2YDSA 1CDCA 4WKHA 1V7NL 3P3RA 5FKAA 3TBVA 3GSVA 3MB9A 2BFVH 1JV5A 4S38A 4XI5C 2F9BT 5DHXB 4LRNH 3UWVA 1E6OH 3L9RA 1WAAF 4I5BA 4A7SA 4OD3H 2A38A 3CJJA 4JHUA 2V8ZA 1GQIA 3CEPA 5HJ3B 3AB0C 3HTWA 3P82A 3V4PB 3AIWA 5HTSA 5KTEL 3RZCA 1VD6A 2QW5A 1S7QA 3BSMA 4HCDA 3M1OA 4JKLA 3WLNA 2CW6A 2GVLA 2FHCA 4QNPE 5CLZA 5B4MD 4WU7A 1FL3A 3JWNH 4WW1A 2FZ8A 2YAMA 3TZVD 3WKMH 2JXMB 4E5XA 3KLAA 5BU6A 4HBKA 1XWVA 3U30B 1Q7MA 4ZNCD 1EP2A 3DX4A 2FZ9A 1MEIA 3MJWA 4JGJA 1H3XA 3BGMA 3KW3A 3A5FA 1NQKA 5TK4A 2EXYD 5ID0B 2IO5A 3IF1A 3LHPL 4GVGA 3D3VB 3I7RA 2CXGA 3LEXA 2ZCLH 4GKLA 4XN2A 1J1XH 4BKTC 3Q1SL 5E99H 4MNGA 3OJDB 3QDJD 5DZOA 5LHDA 3PWUB 1AJ7H 1FHNA 2VC6A 2CWXA 3T6CA 4PMZA 1KC7A 1TPXB 4KEVA 1Y18A 2CKSA 3NAAH 4I1RA 2FDMA 3GU2A 5C0AE 1H6TA 3O2WH 1VC4A 2V9TA 4DX3A 4R7NA 4R83A 3NURA 1CDBA 1ZQ5A 3N9GL 2BVTA 1YUHA 4ZTYA 3NL3A 3KBNA 1Y5WA 1KBJA 3VWKB 4DZ8B 2HFGL 5JHLH 3PL6D 1F11A 3ZBMA 1F4WH 5CC7A 4KDWA 4H20H 1UROA 2WTOA 1PZBA 2G2RA 4Q2ZB 3L5IA 5GZOC 4DUVA 4MPKA 2POZA 4LCQA 5C2BH 3QKZA 5EZOH 5K9XA 1Z3RA 2VDMB 3K72B 3QO1B 5U4NA 4YSAA 4FS0A 5CCKH 1GQLA 1DUZA 4EVZA 4C6LA 3U2ZA 1XISA 3PWLB 4Y16C 2H2PD 1KBPA 5I6XC 3BJ91 5ID1B 3CQHA 4XNBA 4QE4A 4AMWA 5C70A 3AJXA 3QUHA 5ADPL 3UXAA 3BLDA 2RA1A 2WZEA 5CBIA 4NO0D 1GY1A 1JZEA 2ROXA 2OVLA 4IK6A 1U1JA 2PYEB 2E9JA 3H22A 1XIWD 1PTDA 5EG6C 1DJYA 5I5JA 4L3ED 2WY3B 2JB5H 1BSIA 4Y5VB 1J05A 1D7CA 1DLFH 4HU4A 2IBZY 4C83A 5EU4B 3MOBL 2FJKA 2WIMA 4I3RL 3MLSL 4XNAA 2F19H 1XGYL 3W6YA 3EBHA 4N85A 1BYCA 5HI3D 1OG6A 2IADB 2G4FA 2MTPA 4JTIA 1QYGL 3IM1A 1DFBH 2H0FA 4FQJH 1T0NB 4XNMB 1UA3A 3SO5A 2G97A 3G5XB 4GAYA 4FZEL 3QJHA 4AOFA 1POJA 3PAYA 1TVDA 1CIDA 3EOEA 9XIAA 3U2JA 2CO7B 3O41B 1CD1A 2R51A 4LAMA 1RZIB 2FJHB 1MZHA 4HZ7A 4Z7VF 2P3EA 5C2GA 4MQXC 1IAKA 3UJJL 3DFHA 3WIIH 1FOBA 3TQKA 2QPSA 3O4LD 2O5ZH 3LSCA 1F18A 4L8SC 5DT1H 4AD2A 5AB0A 1TO3A 2Y07H 5LWYL 4NC1C 1OGTA 2WW8A 5LXEA 2DMKA 2GOUA 3IFPA 4JFOB 2DJLA 1KTJA 2XVLA 2YAFA 3SDAB 3QIUA 2A85A 5G5IA 4PGBA 3SCMA 2EVIA 3VXNB 4EAMA 3VOGA 3DOIA 2KLRA 2JKRM 4EDXB 2UY4A 1KBGH 3KWUA 3TBSA 1AKJA 3EOUA 2BSRA 1FO0H 3QDGB 1YEGL 1HU8A 4MNHB 4NQEB 2L7JA 3W9DB 4PJGA 1S6NA 3GNRA 2CUAA 2UZYA 1VB9A 2NXZB 3TZNA 1FH5H 4CAGA 3FB8A 4HJWA 1UPPA 2C9RA 4ISVB 1OIFA 5KVEL 3PUOA 4AM0B 8FABB 3WMPA 3P0VH 2MOVA 3U46A 4BZ1A 4PVBA 4G6JL 4TPRL 2K1MA 4JG0L 4F1SA 1IX2A 1AW1A 1VPOL 1R3KB 1XCQA 4LCWD 1KFGA 2FGLA 4S2CA 2DLFL 4X6CA 2HTKC 5I73B 1CC3A 2IPKB 4UT9H 4UTBL 5FUOH 1KWKA 4GRWE 1QAPA 2XVPA 3LLDA 3KCLA 3W85A 4OR1A 2IQAB 3BUBA 6FABH 2V9DA 3LTYA 3MBXH 1FUNA 1Q9WA 4PB9H 3QN3A 4WNJA 1LDCA 4K7YA 1K03A 1S46A 1I3RB 1JXKA 2QJGA 3DMMC 2PCFA 3INUH 3NPSC 1H2JA 4HS6B 2J43A 3FL7A 3THDA 2ID5A 1OEPA 1EPVA 3QDJB 3CFKB 3T3PE 3ESOA 1LP9B 1NFIA 3FCSA 4KAQH 1RIHH 1X7SA 1CO1A 1BCIA 4C6DA 3UC2A 3VFMB 5FIPA 4XAWH 3OXSB 3U6RB 1CBGA 4HV8B 5FO8B 4ALAH 3AICA 5DJDB 2O30A 2DFAA 4LWWA 4ODWA 3SEPA 5EO1A 3O6YX 2NQLA 3QPZA 3ATBA 2X4PA 4NKDB 1ASQA 4GRLC 3VG9B 4F57H 1S78C 4HIEB 1OQOA 3PV6B 3QBUA 4JY4A 2WWNA 4YBQD 4ERIA 4WFED 3OSKA 3NCBB 5DRWB 1W3HA 2VQ4A 1ORQA 2RR3A 3RG1C 4JK0D 1HKKA 1UD4A 3ZN6A 4N9EA 2X40A 2OL3L 1JFHA 4P57A 5DJ0A 4JFXA 4S39A 4RISL 5JUEL 2GUUA 1QUNA 3UTTD 4MMZB 4P2RD 1U42A 5CC5A 2ZWLT 3MLZH 4XVTL 4PR5B 3KOYA 1EJRC 4APQC 4HCRH 2HX9A 2BS8A 4UTAL 4TNGA 4RNIA 3S6TA 4NM8H 2GTWB 2R0WH 2DYPA 3K30A 1AG1O 4PRPD 3QK0A 2P5NA 4Y5XB 3ZE1F 1SBBA 1GK8A 5D8JH 4JM4L 4YDMA 3VI2A 3KW8A 4XMTA 3EBGA 4PB5A 1F6AB 1CU4H 3TH4T 3UF9A 1F3RB 3UTSD 3HGRA 4L3EB 1R3RA 4MCNA 1QOPA 5EMJA 1JRHH 3FK4A 4AQOA 3NA4A 4XOAA 1HTIA 4G9PA 4DQOH 3SUTA 2UX6A 3BZ5A 3E9UA 2XA8L 1NPNA 1FC2D 4IDLA 3BVTA 3F12A 2F1BA 2WXHA 5SX5K 4TNFA 1F3JB 4O5LL 5IJKA 4M5YH 2BNRE 5DJCA 1LM8V 4YDIH 3HQOA 4OZHB 3JZYA 4NN7B 2YCJA 1V79A 1S3TC 4M4RA 4IICA 4KCUA 1FFRA 3MRDB 3TGXA 5DDHB 3WV0A 2GBTA 3L54A 3R19A 1GL4B 1PF3A 2O61A 4R26H 4HSCX 3O4LB 1D9KD 2HG0A 4PUKA 3GEWB 2X38A 1W3TA 2GSIA 4P2CG 1AQDB 1NJ9B 4AD5A 2KLTA 1DDTA 4R2GD 5D7LE 2A9BA 2MOQA 4M9OA 3GXUB 5IJVB 4YHNA 1OEZW 4N2EA 3WFCH 4JN2A 3CCHB 1NGQH 5HA7A 4HFUL 1QNZL 1ADQA 3MA9L 3LV3B 4ATWA 2F5BL 1FY6A 4K7PL 3J27A 1PKQB 1XF5B 4I7VA 3EADA 4TVDA 1IM3D 1FH9A 4ZNEE 3UPRA 1L9OA 1XH3A 3S0PA 1E6JL 2F6UA 3FDWA 1RIUL 5DVNA 1AXTH 3OZ9H 1L9RA 4RMQA 1JGLH 1RQHA 4W4OC 5DJZB 2B81A 3RWJA 3LRMA 1HAWA 3KAAA 1ZAIA 1ZPLA 4K8HA 3P54A 4X8GA 5IZ7A 1QPPA 3T8XA 4P2OC 3FFDB 1N4XH 4G9DA 3KPMA 1BQ5A 1UKQA 5MEPB 4FQIH 3VTMA 2YGNA 5AAPA 3VRJB 4EOWH 2PUZA 5KETA 4B5NA 3SQMA 2OO0A 4W9TA 1MFDL 2IXUA 3S9DB 1JF1B 3H26A 2QLYA 4XNZB 3WX7A 2Z35A 2YB1A 3M1CA 4C54A 4QRQA 4P46D 2GTZA 1BGAA 2QQQA 3WXWL 2V3FA 1G87A 4X80H 4NUGL 4WR3A 3FVMA 1P4BH 1MLBA 1X9UA 2I9EA 1GZ1A 5AUMA 3FTVA 3LNFA 4WGVB 4KFZC 5CZ0A 2XIIA 4DSYA 4Y1AE 4G71B 1SY6A 1OIMA 2OQHA 4YXLL 3VQ1C 5C3IA 1JUBA 5HYQA 4IS6A 3MLUL 1VCVA 3QLDA 4HPYH 4HWUA 2QSCH 1Y6MR 4ZGYA 1UHVA 2WXRA 3C3NA 3GK8L 1H0IA 4N2DA 5D1ZC 3LHZA 4C5ZA 5KSAD 1IEIA 1HI6B 5JPNA 5IHZB 1V0MA 2YPLB 4L9LB 4JX0A 1TQCC 5K9QG 4RZKA 1YYAA 1VHCA 2XNAA 4NPYA 4Z18A 5IFHL 1BD2D 4XP1H 4EUPB 3SQSA 3ZRSA 6TIMA 1K4HA 1EJWC 4N0UB 4PP1C 2V9UA 3UFYA 5D9PA 2V2XB 2W66A 4JN7A 4LCCC 5LCVL 4Q4SA 4H1ZA 4WW2A 5E8PA 4JO1L 1TVHB 1A6AA 1DJZA 4Z7OE 4YHYB 4KJPD 4DVBA 2YPVL 3C5QA 4MJJA 3H1ZA 1RJZB 1CGVA 3OAUL 2VX6A 2BGQA 4PFEA 1BYNA 1QRQA 1KRBC 2DPEA 4QLWA 4W4NA 3ORWA 5EPMB 1BWVA 1MIEL 2KDYA 1AD0B 4N6RB 4PMYA 4XMLH 5F71A 3TEUA 3MBED 2WWMC 4MNMA 4UYPA 1YNTB 2J55A 2HXTA 2XN2A 5JIWA 2GVJA 1E43A 2EJ1A 2DL9A 1AE6H 1YPZF 3F58H 2AFNA 4XBGA 2R1WB 4L1BA 4ERGA 2FHBA 1H3VA 2PA6A 1MCPL 4PTMA 4WU5A 1XT5A 4V1DE 1K4DB 2F8IA 5IMKA 3GXFA 1WFJA 4UTKA 1YHTA 3WN5B 2XN9B 3IT8D 4PGEA 4QS5A 5J04A 4WJ5B 2DZUA 3GSUB 4O2CA 4K39A 4NWTL 2ZJSL 2BC4B 1RFDH 1PFCA 3CVHH 3QQ4A 3WXVH 5M94B 2DZVA 4PFMA 3QH3B 4AV0A 3UAFA 2JF6A 4GPNA 3BXNB 1UWXK 3N1AA 3T4YA 1OD7A 2H6PB 4NZRL 4TRPH 5LNVA 3RR1A 4LS1A 3FJNA 3UJEA 4IOSD 4AWUA 1Z9MA 5EN3A 3GSQA 3BSZH 5DMIL 1MHCB 3CDYA 3GK0A 4LVFA 2C14A 1WA3A 3D9AH 3IWVA 4PTVA 4DZIA 3VH8G 4KQNA 2O9TA 2HXAA 1T8XA 1D5XB 4JJHA 5TTRA 5IKCA 2LLGA 3H3BC 2PO6C 2WANA 3NIDE 1Z3GL 3JWNC 1D9KB 4XODA 1A6ZA 5FJUA 1HNYA 4PRBA 1X5FA 3ZE2E 3HLAB 5G2NA 4R2GB 2CZFA 4UZUA 4Q32A 3G5YA 3AUOA 3BURA 2YCEA 1QW7A 1CD8A 2W79A 5T5FL 2ZF9A 3INOA 4Y0GA 3U1QA 4QD2E 5DJ8A 2NR6A 1JZ8A 4BFFA 5F21B 4PIBA 1RQ5A 1IM3B 3QPQD 4KY1H 1CICA 5EZPA 1T7VA 2XM2A 2VIRB 3BZJA 3ARUA 4FXGB 4IGBC 5AC4A 1JNDA 3CNKA 3FU0A 5HYSB 4U1HA 3OAYH 3HGSA 3N15A 5BRPA 1IAII 4YZWA 1IUZA 3MZGB 1YC8A 3IJ8A 2F53A 4NHCH 3G6JF 1X5HA 3LTPA 5EOCH 4DCQB 4V28A 1MAML 5C0JB 1P0NA 4ILDA 1VZWA 1GGTA 4EIVA 1HEZA 2DSWA 1XAUA 3KEHA 1INQA 1ZHNB 2VEMA 1MFAL 5ABTA 5FFOA 1T1WA 4AXWA 4JG1H 3HPFA 3B4YA 5CILH 1JGEB 3NJGA 5D70L 4NYYA 1USZA 5DUPH 1Q4NX 1E56A 4CC4A 3Q7JA 3TV3H 1SRDA 4HGMA 1MCBA 4O2EB 2WMPB 2YGOA 3MQTA 3LCWA 2WQVA 2WO5A 3LJ3A 2GOKA 3AI0A 3GYRA 4WD0A 4NFBA 1CCWB 2JJVA 4HIJA 3ZDYB 1GHRA 2K7PA 5EU7E 5BWAA 1OK8A 1UC4A 1AZZC 1IXPA 3JYBA 5CZJA 2V17L 1G7JB 4I2XE 3CPUA 3W0WD 1B2YA 1RSYA 4HWEL 1KJMB 4YHKL 3G5VA 2OLHA 3EH3B 5ICYB 1FVCA 5I1KH 1A9EA 2Y3NA 3ENEA 1CLVA 5HDQH 4KUCD 4GC4A 3LZQA 4WCYL 3VMPA 2K7QA 2PFHA 2X4QB 4DLMA 4DJEC 4JJ5B 3N50A 2HRWA 4E9YA 4HLZG 3IJEA 3MRKB 2X1IA 4X7EC 5DCEA 4NO5A 1OSPH 1S8DB 2HT2D 5JO5A 1G6CA 2F18A 1O12A 2OK0L 4X8JB 4BYHA 2D22A 5E99L 1UB5B 3KOXA 1WCGA 3IDJB 2Z1WA 5SWSA 2B5IC 4FDWA 3S2CA 1BD2B 5HHOD 1IBFA 3DNKA 5D5MF 4K8GA 5IUSA 3OLIA 4X4XB 1A6TA 4U6HB 4UM8A 4EZJA 3ULVF 1NGZA 1WUFA 4H88L 3MO1A 1HFUA 1H7PA 3SPVA 3SE9L 2VX4A 1S5IL 1I9JH 1SDDA 3BDXA 1BJ8A 2G8ZA 1DWIM 3Q65A 1D5IL 5GRJH 3ZSTA 4UQEA 4OCSL 3MA7B 4ODHH 4AT6A 2ZUVA 4U7MA 1SJCA 3ECBB 3KBHE 2KI6A 1OY3B 4PMVA 3GTXA 3UR2A 4ONFL 4JFDD 2XX1A 4F7TA 4NN5B 1G9NL 3SN6N 4MS6A 2VLKD 3FONA 1Q8MA 2E46A 3FQXB 1XEUA 2ZZ2A 1LRNA 2NY7L 2JTDA 1ZP3A 5KS9A 3A4EA 3ML8A 3T0DA 4FFYL 2PTDA 3U36A 1X5XA 4IBWA 4QAIA 3BZEA 3RFRA 5C9KA 1NDGB 1E1CA 1FGVL 3CH1B 3MLVL 2MQGA 5DUML 1SDYA 3WFBL 3DXAD 1UT1A 3KXFB 5LGKA 3BHBA 3WGUB 2DSUA 4EACA 4BH7B 2JFEX 2APBA 5HMDA 1AR1D 1N6UA 1V6WA 3HZYA 2A83A 4QRPB 5EOTA 3LH9A 4Q8MA 1E4NA 2FB3A 2VB5A 1GMIA 4DZAA 4GRSA 1E8ZA 1EJXC 1IKFH 5JHDA 1REQB 4PJBB 4LBEB 2Z1VA 2P8LB 3HB9A 4B90A 5JHMA 3BRFA 4L4VE 1QFEA 4HUCA 3KBJA 3CHQA 4RX4A 1QWHA 3KPRD 2F19L 3LZ5A 1FCCA 4WY0A 1ZA6B 4KKPA 4MDJB 2E28A 4TNVF 4O2FA 4FQJL 4NQXB 2XG5A 3NXFA 1GWJA 3PHQA 4GKZB 5H37A 3AQYA 1N7KA 4PGLA 3PWJB 3QEUA 2EE2A 5BXPA 2BBFA 4XE0A 5HHVH 4FF9A 4AZHA 2B4CC 1ZTXE 1KGCD 5HHPB 2D31B 3UGVA 5GZNC 1PL9A 1BZQK 4LPCA 3WMLA 3DVIA 1NWSA 5DC0A 3X12B 2GQ3A 1EUAA 2WMJA 1TJXA 1RULH 3WUGA 3EWDA 1FRGL 5K5YA 1TJHH 4JFZL 3TH2T 1I3VA 4JFTA 3IDNB 2EYRB 3WUZA 3TOPA 3NRFA 2MPVA 3UG8A 3W9ZA 3NJIA 4NKQB 3DFYA 1EPFA 1KGJA 1GZQB 4JRXD 2GGEA 5EZJB 4XB3A 2FJFA 5K39A 3BFQG 1T7LA 3HZMA 3MNZB 1ZAJA 2E27L 3IK2A 5D6DA 4L37A 2OXGB 1FKXA 3C8NA 4XN9A 3VUSA 1DSWA 4RGNE 1CG9A 4WUUB 3TIEA 5FGBC 2YAPA 4MF4A 3IDMB 1BQUA 4N9BA 4PSPA 1SM3L 3GG0A 5HHME 5ENLA 2WK2A 3LS9A 3L3HB 1NMAH 2J8TA 3N3EA 4AXKA 1QVOA 3MCMA 5E8NB 5C9RA 5F7WC 1T5KA 3BPCA 2WZ0A 3D48R 2OX5B 3S7GA 2OYPA 5EB9A 5JIDA 2WB5A 4JVWA 4DP7X 5CINH 1RLDA 4R34A 4XNYL 3W1PA 3CBRA 2WHJA 3VFRA 4R96B 4C7FA 2QYGA 3F04A 4JDVB 3VXRD 4M4PA 1P6CA 5TNVA 5F72S 4GJJA 5BRZD 1OX4A 1AGBA 3U25A 2AV1A 2WUCL 4LEOA 4LUYA 1TMLA 3OWRA 3C2VA 2R9RA 1S7RA 2G0WA 3UU0A 1E65A 3ARGD 1Q65A 3W0WB 5BWFA 4PJ7E 2OZ8A 4ZMGA 4Z1DA 6FABL 3MCNA 3EFOB 3ULVH 2OMZA 1WEJH 2QHAA 4J6RL 5H35A 4WOZA 4XKYB 2UWEE 4YHOH 3S5NA 5AVYB 3T4AA 3C2YA 2AK4D 3QV7A 3F7VB 3FGCA 2HJFB 3BPLC 1GGBH 4HN8A 3F6IA 5FPIA 3INUL 2GB2A 5BOOA 2ENJA 3M17B 1B0RA 4RMRA 4E36A 5TPWL 4D3CH 3EA2A 4P2AA 1NAKL 2A6LA 1X5ZA 5K7JA 3NH7H 3LGEA 2P10A 3FO2B 1HUVA 1RIHL 5HHOB 4NQQA 2P47B 1F0LA 5JBFA 3RVTC 5LBSH 1GW6A 3N6HA 2A2IA 2WXDM 1Z9PA 3CFQA 1JFQH 5E2WH 3GSOB 1KGXA 4R7WA 5I66B 4RQQA 3N1FC 3H9SE 3IMTA 4BFNA 2Z0IA 1F4YL 2CM6A 3L0KA 5MEQA 5AKVA 3T08A 5H2BB 2WTPA 5JORB 4XVUD 1F42A 5CIPA 3QEQA 4UIKH 3CZJA 2BINA 3C5SB 4FP8L 4TLKA 1OCOB 1F4HA 3QSTA 2WLLB 5CEYB 4PRDA 1S3RA 3L5JA 3UIYA 4BWWA 5C07D 1TRDA 4UFLA 3MVIA 2HS8A 2FQFA 3ARSA 2BP0A 4F7MB 4KV5F 4MNJA 5SV3A 1FG2A 4QCIB 1KCLA 4MMYB 4EIBA 2IH3A 1TQUA 3FJTA 2AJYH 2ZUQB 1P0SE 4TULH 5LDUA 2CIIB 1KTLB 3E9TA 4ZXBD 3GQYA 1LMIA 1BXUA 4WTZA 2BWDA 4UYQA 4I4WB 4O54A 1G4PA 3TNMA 4YC2C 1GW0A 3H2CA 3EXTA 4DK3A 2YEVB 4EI6A 4W87A 4I13B 1BFOB 3QMRA 2AJSH 4HKJA 3RZWA 5ESVB 5HGBA 4DM2A 2YC1B 2G5BB 1AR1B 3DTDA 1QRNE 3UGUA 1L6YA 1FBIH 4QRAA 4E3TA 2CLPA 4G7RB 1CF8L 1LO0H 2AABH 4KMTL 2YL6A 4EBQL 2MJWA 3D39B 2QQKL 3SOTA 4DPCX 2AQPA 2TRHA 2F7QA 3QFDB 4DJFA 2Y85A 1KNOB 4ZQOA 5G1MA 1J1OH 2MNUA 1RPQA 1TVPA 2Y5SA 3LPOA 4WDIB 3OQ8A 4KVNH 3CHCA 4S3CA 3TAKA 1BEYL 4HT3A 4RV8A 3LKSB 2DICA 1ZLPA 5D2NB 3HPSA 1XTLA 3OYXA 2ANUA 4IMGA 3GKWH 3NJKA 4HK0A 2X4OB 4KH9A 4YLWA 3MCLL 1E27B 1BOGB 1EO5A 4U1LB 1U8QA 5E8OA 4FAAB 3QEHA 5INCA 1L2QA 4BA8A 3W7NA 5C0NC 3E2SA 4YQXL 4WV1B 1TJGL 1Z6JT 1S9KC 3OBAA 4LPVA 4HJ0C 3SE6A 2X7LB 1EBHA 4UIMB 4Y19D 4OFYD 1HP5A 4DEPB 3RWFA 4JRXB 3TN6A 1C08A 1YYML 1JWSA 2OR8A 4IF2A 3LCHA 3QCUL 2X28A 5L6YH 5HGDB 1CFBA 4MS8C 4QQUA 1MI5B 1VFHA 3U4EA 4ZMNA 3CZUB 4PM1A 4QCEA 4JQXC 2JJSC 4LLQA 3U1PA 3V6FB 8CGTA 1B3ZA 1WDQA 3WGVB 5J6HA 3G18A 2C9XA 3K2IA 1BMGA 1MELA 5C0AB 4BKSC 1QXLA 4TVPL 4FQQA 3H3KA 4HIXL 2CRZA 1A6WL 4MJ6B 1EGJA 2WYIA 5AWNL 1SMOA 3K5SA 5CU5A 1R86A 5DQ9A 4WWNA 1KFWA 5SX4H 2A3CA 3KGSA 2XV0A 2VDQL 2UV8G 4M6VA 4KS0A 4IJRA 1NAL1 4ICCX 3F7LA 1GS6X 3FRUA 3GM8A 5D1QE 2GYSA 3NZ8B 5D1XE 5C3LD 3AGWA 3VWKD 1UH2A 3HS0B 4ETQB 3TXAA 3S3SA 5HP5A 3W84A 2ED7A 3R1ZA 4MPQA 2E9GA 3ARPA 3F85A 2XDFA 2R82A 1NM4A 4OF5A 2W27A 1AD4A 4PGJA 4WHTA 4X5QA 1MRAA 3G2GA 2HFTA 3QOMA 1O6SA 1MQ8A 3CQQA 3VACA 3V75A 3QCTH 3G3MA 1RVGA 2OI9B 4JANB 2PW2A 5E6SB 2XZ7A 3O3AA 3OU8A 4YGVA 5E93A 4N2CA 1EFXD 4JRYE 2VI0A 4I3SH 1XWYA 1ZY9A 2P1YA 2BVOB 3RMEA 4PJGF 1CFQA 1BAFH 4B5TA 5HBBA 2Z93B 5TF1H 1ZLVK 1WP6A 3H2WA 5KINA 1YNLL 4ZK8A 4XH2B 3V5OA 4HKPA 1S1RA 3QDAA 3SE4C 2PYED 4Q0XL 3LRGA 1Z9SB 1BQCA 2C3VB 2ZRXA 5E9DA 4LUSA 4PVNA 3MRHB 3VE7A 2FBRA 4LGRB 5BV7H 1QNSA 1HHGB 1I2OA 3GI9L 1CL7I 3DX6A 1CDHA 5C07B 2WLZA 3KOWA 1IYXA 3DJTA 5I0WA 3W86A 3MJ7B 3M6YA 4U6YA 1F4XL 2Q1EA 4X6CF 3BQUC 3P2VA 1OE1A 2XTJE 5E70A 5A8MA 2EIDA 4M00A 5JR1L 3FU6A 3H21A 4G8GA 3LNPA 4ZXBB 3HUJA 3MBWB 2WIIB 3N2TA 3IAGC 3EYPA 1AE6L 4MCYB 1PTGA 4DN1A 4NAJA 1BZ9B 3KLQA 1FBAA 2ESCA 3TJPA 2XUCA 2DD8L 3C09C 4BSVA 4PY8I 5IFAL 3JV6A 2PF6A 2BOFX 4MFEA 3BKYH 2P8MA 2XU9A 1FSKB 2E74C 1O5RA 1DQLH 3R4DA 4CNSA 3MCOA 2P50A 1FFQA 2Q7YB 5LO7A 4EN3A 2FEDD 2YQGA 4NP4L 2WVSA 1NGYA 4ORMA 3SDAD 2ZQ0A 3TFKD 1MFMA 1GEHA 3OYZA 3NSNA 4F7KA 4F8NA 4ZTEA 2NLYA 1GRWA 3CPRA 1AQMA 1KFCA 3T07A 4TRPL 1WO2A 3B7YA 4X6DA 1RXOB 5EORH 4A6YA 5TDNA 3EEZA 5CZXD 1ZMYA 2HFFA 2OQJA 1RBAA 2DZAA 1SF3A 2O5YL 4JZOA 3ZHNA 4NQED 3MTWA 1HILB 4QHUB 2AXGA 3LCFA 1LDPH 4FI7A 1EEUA 1Q13A 1SFDA 4LVGA 4MWAC 4X2UA 4NAFB 2NY3D 3ZS4A 2YD3A 3V5KB 4ZMPA 2NXZD 3CIWA 3KBMA 3ILQD 2L04A 4XVSH 1JHLL 4LOCA 4DNMA 2IGTA 2YAEA 1Z41A 5ABZA 3IU4L 3MXWH 3IKCA 4CQCA 3LOWA 1GPWA 3BG5A 4U5KA 1MUJB 2VJXA 4Y19B 2VM8A 1XLEA 5GGSA 4JO5A 4H8WC 3U7VA 3F4DA 4K7FB 1M6JA 4CMHC 1BQHG 1ODZA 3OTTA 1FZJB 5EC2A 1MXDA 3OAZH 3NN8B 5CEZH 1DQTA 4YIWA 3DOSB 2A77L 3GYCA 4LGSB 2GGHA 5JA8B 3VKBA 3LUTA 4PMQA 1XGQB 4E41B 1U91B 4ILSA 3US9A 4C59B 3QZPA 3O3EB 3FQ2A 3EA1A 5EV7A 1ZT1B 3GLCA 1BZ7B 1CE6B 4RLIA 1XIIA 2OFJA 2DM4A 3DI0A 3MRLB 1I1CA 1RA0A 5I3KA 4MNLA 4M7SA 2O5XH 3T1WA 2W63A 4H01A 1RQBA 4ZVJA 1D5ZB 2WHVA 4HPOH 1MCLA 2XBTA 3CQFA 1JPGB 1KEML 4FXTA 2CMRL 5KUMA 2EDEA 1TCRA 2ITCA 4G7FA 4O53A 3QDHA 3MUZ1 1L6XA 1KV3A 1VFAA 3TV3L 2G2NA 3QHFH 2VZTA 3ZLQC 3CFEB 1U8HA 5I77A 2X3AA 4G80A 4HH9B 3MSDA 4GBDA 3BP5B 2OJZL 2GSEA 4H9XA 1AXIB 3KD4A 4QHMB 4DJDC 4GINA 5GXBB 5D2LA 1B90A 5GS1C 1SYVA 5KZCB 4E9XA 4K71C 3JBG7 4FMKA 4ZQKB 4GG8B 2QJDA 2YZ1A 2Z7UA 1A1MA 3GHPA 2N3JA 4GJ1A 1JCNA 5F0LB 3I84A 1WXYA 3AAZB 1BZOA 3VI3B 3GWQA 3PWVA 1AI1H 4Y9PA 3BAEH 5EA0L 3LRKA 1YIXA 4XC3L 1UJ3B 3COOA 2RGMA 1KLFB 1HKFA 4I48A 5T1DH 3LKQA 2IFFH 4MKTA 1ZHKB 1ZT4B 3B7SA 4BZ1H 2ADJB 2J13A 2FVKA 4MNKA 1TZAA 2KQNA 1EFXB 5H1WA 4IBTA 2VO8A 5LN4A 1W37A 1JMXA 1M7DB 4A66A 4P4KA 1V8EA 1TUFA 4H6KA 3A67L 1NH6A 5I7GA 4D1IA 3W6MA 4EMZA 2D23A 1P69B 3KH3A 4Z7WE 4EWND 3RFZB 1BQSA 1BLIA 2CESA 4ONOA 1U8PB 1MZRA 3VXSA 1YEWA 4I0PA 4XB7A 2QMJA 1U8CA 3NDYA 3OB8A 3QIWA 1IC4L 2R23A 2AGKA 3U0WH 1DWAM 2H0JA 35C8L 4Z7QF 3VGEA 2P5WA 3K4DA 2MHAA 4JYEA 4XHJC 2CGRH 2JGQA 3WK2A 4Z7UA 4O02A 4U28A 2R2BB 1T41A 3PVFA 1V27A 3AT8A 2A9NL 3ZDZF 2BDQA 1J96A 2BGNE 1AACA 4WF7A 1JN6A 3WI9A 3NA9L 1UUSA 4UT6A 5D7LB 1NL0L 1EVTC 2MTAA 1SW0A 3UG3A 2HCVA 3D2UD 2EDXA 1EAOA 4JREB 4PW3A 2O7QA 1IZCA 5DA4A 4PRTA 5CQ1A 2PBGA 1KFAL 4K4KA 5K59E 4FJZA 2AL1A 3TBWB 4TUJA 4X9BA 5FYKE 1MQQA 2AXFB 3NGBB 3LM3A 3C56A 2DM3A 2JK5B 1F05A 2NY6B 3LERA 3EB2A 4OCYH 1K2DA 3M4HA 4LCIH 3UMNA 4LLWB 4RIRB 4XCEB 2Z4QB 4CNPA 4QHNA 3QNFA 2V7NB 2Q5BA 3WK1A 3CUJA 2QQNL 5I07A 1CGSL 3KPSE 1E5JA 2IPJA 4FNUA 3MMDA 4FLQA 4ELKA 2JGYA 3LBMA 4JX6A 3GZOA 3G22A 1EZSA 5A6KA 3WQPA 2ALWA 4X99B 2ZADA 1B4EA 1E42A 1BVKA 1G6RB 1EEYB 3SGKA 2ZD0A 4AQ1A 1SZRA 4PMEA 2AXJA 4NRXB 3FCUB 4WW2F 3HN8A 3MPCA 1A0QL 1FWXA 1IQ8A 1TNNA 4HJUA 2F15A 4JOMA 3I6KB 1VCFA 3QCVL 1AGCB 2NY3B 5HNRA 2V8LA 5ESAA 1XL6A 1ZVNA 3B3IA 3ULVC 1CPUA 4ZW8A 4ECNA 4OLXL 3EJTA 4NRYB 1OQXA 4JL2A 1KTDA 4MLSA 3REQB 5J56B 3RIAF 1PG7X 4LBSA 1LJYA 2ZAGA 4NNXB 3HBZA 3CDCA 4GQPH 1UWEH 1HZHL 2Z6JA 4OUUA 4GAJL 3VFUA 3VXUA 4D8LA 1G9HA 3O11B 1HSAA 4LKXB 1OP5H 3EJYD 3W1ZA 1ZJHA 3TYBA 2LLLA 7PTDA 2Q10A 5HDBF 3WD4A 4PJEF 3S1XA 3PS7A 5A6JA 3MRIB 3V6OA 3ERXA 5BRBA 2ZX8A 1D6VL 3NDZA 1I3GL 4P5MA 4XPFH 2B4CH 4FYTA 1QWKA 3TW6A 3F2BA 4GXVH 1VFSA 1JZ3A 3QDMA 1SYSA 2CDGB 3NG5A 3EJPA 1JCTA 2OT1A 1OAYH 1XF3B 3WO3B 4TMPA 3APFA 5DWPA 3W00A 1ZA3B 1Q94B 3Q3GB 1KTCA 1GAFL 3P6LA 4IU2B 4AWEA 3RDTA 4ICXA 1I2PA 2B59B 3UBXA 2YPLD 2CLFA 4C7DA 1JVNA 3U0TA 5G2HA 1KDJA 1ML1A 2DJMA 1I53A 1MAJA 5M5DA 1LWJA 1GTNA 5JW3L 3QXDB 3MP5A 5LG6A 4AENA 4PRHE 1KKOA 1A2YB 4HEMA 1ADQH 4O8RA 4EXBA 2BIMA 4K1WA 2NXYD 1UR1A 3O6LH 5EUOE 1FYTE 2HRLA 4YK4B 5EF0A 4HZAA 4DF0A 3LQMA 4XTRD 2NXIA 7FABH 1KYUA 3M0MA 1VACB 1HXMA 4CJ0A 2HV5A 3VK5A 1AW5A 2D2HA 3L67A 4KVCL 4JPVH 1BVNP 1XGUB 1D5RA 4C4BA 3RY4A 3A9IA 1YNKL 1GTHA 5MI0C 1KJ2H 1LT8A 3IRZA 5F1UA 4OIBA 4QF1B 3SDXF 5C0EA 2BVPA 2N7AA 1NEZB 5J9PA 3P02A 4AITA 1BKHA 4GHRA 1GYVA 2IAMB 5A16B 2QBWA 4G43A 3VKCA 4K3ZA 4AD3A 5AW9B 2V37A 3Q2LA 3I6GA 3M5YA 3DPDA 5ACLA 5E1IA 1WDRA 4H9MA 3WJXA 4RNRA 4L1WA 5JW4M 1EJSC 2MFNA 5BS0D 3NL2A 1HJXA 3B2MA 1G94A 1OTTC 5LIUX 1OCWL 3ES7A 1AQFA 4PJIF 2C0AA 1LK3H 1A3XA 4F27A 2XN9D 3HW7A 3ZVHB 5F3BA 2MCMA 1U8MB 1JFQL 3V2AR 2V0AA 2BNUB 1PLAA 4QLKA 1PSKH 4GW1B 3O6FC 4GYFA 3ZXAC 3HMJG 4LU5H 4LSRH 1CZ8H 2DEWX 3VRLE 1SY6H 1LG1A 3WNLA 5BZAA 5T5NF 5K33A 1FA2A 3HB3C 3JTTA 2C71A 1XYMA 2GFBA 1ETZA 4J1OA 4DP0X 1UWSA 2XZCL 1QBAA 2J8UF 3HI1B 1OF2A 4NNPL 5IBLC 5CKGA 3PQYE 2QPDB 2DMHA 3RNKB 2YA1A 1XZ0A 1CLKA 2WB1A 3D2UB 3C3UA 4AQ8A 1X5JA 4F1ZA 4OZIE 5DYOB 2ZCKL 5K4XA 3R8QA 4MAYA 2X0UA 3AC0A 3ARQA 4CNIB 4BSJA 4KCVA 3NJLA 3SBPA 3H85A 3U0PB 5I2UA 4FE9A 2X7WA 3L5XH 5CGYC 4PWHA 3FJ4A 1CGUA 4AG0A 1SJEA 1UPMB 1FJ1A 4E9RA 2K6ZA 4WHDA 5IQ9A 5DO2D 4JTSA 1OWRM 1QPQA 3CPLA 3EWUA 4V2BA 4DVRH 2G37A 3S1GA 5IIEB 2IPWA 4FFVC 5AD0A 1ZDQA 4H7CA 3EO1B 4DKTA 3FXGA 2OW6A 4JX5A 1GVSA 1VFBB 3HKZA 3E8UL 3S9ZA 3QT2A 3NMEA 1JZ6A 2BTMA 5GJSH 2HVKB 1S5HB 3KNBB 5LGJA 2BCKA 3W82A 5C0BA 1FORL 3KFTA 4FFTA 4IPIA 4DEWA 4WWKA 3IRPX 4GXUN 4XAPA 1X5IA 1PDKA 4QDGA 1I1AB 3RVXC 1C16B 5EO9B 3B0VC 4N9GB 2JQZA 1AFVL 5FYKU 2PLMA 4QHKJ 3BW3A 1UUMA 4QE5A 5IR1A 1LLOA 2CNZA 1KCZA 1CE1H 3GUWA 5B39G 5KS9F 4Q8WA 2E75C 4LVBA 1U4EA 3M5ZA 3ZDXE 4P23B 2ZDSA 3BLIA 1TVNA 1DQJA 3B4NA 4RE4A 3VNYA 3OZYA 3QZWB 1QBMH 5MENB 3RL1A 3CX5J 3R58A 3NVDA 5MHSD 4BS0A 4XPBL 4C6MA 2EJAA 1U1UA 1BOYA 4MX7B 3WZ0E 4BFIA 5AFDA 4AC2A 15C8H 3RZCC 4HU2A 4F15B 4M93B 5GGTA 4O0KA 3VRIB 3OSVA 3K81A 3MSGA 2YXMA 5CD3A 2FDSA 1TMQA 4Q6IB 1P5VB 3FQ4A 2PUQT 5I1LB 4B5ZA 3T0ED 3O9WD 5BV7C 2JIXD 3R1GH 5BQDA 2ED8A 3SDYH 5D71L 4LLMB 4JFPA 4R5EA 1WC7B 2JCCF 1OSZA 1IF2A 2WMHA 3MRNB 4WY0F 4ZAKA 1DVJA 1PLBA 3KL0A 2NXYB 7PAZA 2PPGA 2FT7A 4ODXA 4N0CD 2A6IB 1IM9B 4RDWA 4LAJH 4ES8A 4US5A 3NCCB 1DQVA 1BAWA 3UXFA 2AANA 2H7WA 3EYVB 4L5FL 3LPGA 4DT2A 1A7RH 5KYUB 2Q3RA 3KOZA 3HE7A 1EJ7L 2I5IA 4W85A 4L9YA 4AJVA 2ZAHA 5F1KC 4NJ9H 1KRMA 5J5RA 4JQIA 1NC2A 1TYEB 1AD1A 1L9MA 3JV4B 2H3BA 3EOAB 5I17B 4TUKH 1BBDL 3TT1H 4FTVA 4KTDL 4HKZB 4K9JA 4MY9A 2V9RA 3V0TA 4J5VA 4LEBA 3SE3A 5I1EL 5HJDA 5JXAL 3OLEA 5LNDA 4BJLA 3WD0A 5ETUA 1NDMB 4J1UA 1XGRB 1JHTB 4RBPH 1XW8A 4TTDD 2EZ0D 1O5DT 3S3GA 4GBXA 2Z2UA 4KXAA 5A40E 5BS0B 4BCEA 3Q6FA 4ZX5A 1NOUA 4LC6A