3AJ7A

Crystal structure of isomaltase from saccharomyces cerevisiae
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
586
structure length
586
Chain Sequence
SSAHPETEPKWWKEATFYQIYPASFKDSNDDGWGDMKGIASKLEYIKELGADAIWISPFYDSPQDDMGYDIANYEKVWPTYGTNEDCFALIEKTHKLGMKFITDLVINHCSSEHEWFKESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSYFGGSAWTFDEKTQEFYLRLFCSTQPDLNWENEDCRKAIYESAVGYWLDHGVDGFRIDVGSLYSKVVGLPDAPVVDKNSTWQSSDPYTLNGPRIHEFHQEMNQFIRNRVKDGREIMTVGEMQHASDETKRLYTSASRHELSELFNFSHTDVGTSPLFRYNLVPFELKDWKIALAELFRYINGTDCWSTIYLENHDQPRSITRFGDDSPKNRVISGKLLSVLLSALTGTLYVYQGQELGQINFKNWPVEKYEDVEIRNNYNAIKEEHGENSEEMKKFLEAIALISRDHARTPMQWSREEPNAGFSGPSAKPWFYLNDSFREGINVEDEIKDPNSVLNFWKEALKFRKAHKDITVYGYDFEFIDLDNKKLFSFTKKYNNKTLFAALNFSSDATDFKIPNDDSSFKLEFGNYPKKEVDASSRTLKPWEGRIYISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Oligo-1,6-glucosidase
publication title Crystal structures of isomaltase from Saccharomyces cerevisiae and in complex with its competitive inhibitor maltose
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 231
structure length 586
sequence length 586
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2010-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3aj7A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3aj7A01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3aj7A02
5D9OA 1R85A 2V3GA 5A6SA 1JZ6A 2XFFA 5F7UA 2FGLA 3MSDA 4AYSA 3GXFA 1HJQA 2F2HA 4NZFA 2EABA 3BVWA 5E6YA 1QNQA 1YQ2A 2CESA 1KBKA 3KLKA 3EJSA 3AQUA 4D71A 4MNJA 2ZE0A 2G41A 1A3HA 3CGTA 3LPOA 5IFTA 4UQAA 3AFBA 1E71M 2WWCA 1E0WA 3LRKA 3G6LA 2J7CA 4V28A 2GJXA 2BHYA 4HOZA 2ZWYA 2J8GA 3GBEA 5HOSA 4GO9A 3WQWA 4M80A 4F9DA 2GSJA 2X8RA 5D8ZA 5I3DA 1ESWA 3O6AA 2YDSA 4MDPA 2J79A 1GVYA 2E9MA 8CGTA 1IZJA 1EXPA 4UFIA 4C7FA 4N0RA 4UOZA 1H2JA 1XH2A 5FKYA 4CUCA 3CH9A 1WZLA 2WC7A 1FP8A 2DT1A 3RCNA 1GHSA 3ALGA 4B15A 4NZJA 5EFDA 3ZMRA 3GH5A 1FH7A 4CVUA 3ARVA 3DYOA 3WEOA 2ZWZA 1TQSA 2J4GA 2Z1KA 1TVNA 2XTKA 3HJEA 4UFHA 5D9MA 2XVGA 5HDRA 4PMDA 2J78A 3HN3A 2BNJA 4QLKA 1EQPA 4W87A 1TG7A 1UR0A 4DUWA 1V3LA 4WIWA 4E8DA 1OIFA 3N1AA 4D6GA 2CITA 3G6MA 2YA0A 5FCZA 3POCA 1LG2A 3VKKA 1ZJBA 2BV9A 3ARPA 1OIMA 3VX0A 4PMQA 4JHOA 3RMEA 3VGEA 4AIEA 3MUAA 1RP8A 1W1VA 3AIVA 4C7GA 1H11A 3MI6A 1C93A 2CKRA 2VQUA 5M5DA 3VIPA 3VIHA 1V0KA 1XCWA 1ODUA 4P7NA 4J3WA 3OIHA 5A8NA 1TCMA 3OGVA 3PTMA 3ALFA 4IPLA 3VIGA 4UTFA 1WZMA 2VNCA 3QOKA 5CJ5A 2ZUMA 2F18A 3RJYA 3UERA 2BVDA 3DDFA 2CEQA 3EMCA 3T2QA 1BVZA 1MFUA 3SUVA 4AZGA 1GQKA 5CSUA 1GJUA 2XHYA 4U2YA 1VFMA 1X6LA 4OOZA 3CLWA 4W8BA 2XVNA 4FNSA 5C70A 2VC9A 2W66A 4OKDA 4URIA 2J7DA 4WKHA 3OZPA 1DWAM 4UZUA 1CIUA 4DWSD 4ZFMA 4E2OA 2BVTA 2CXGA 1GONA 5TD4A 2D3NA 2F7RA 4ATLA 1UA3A 4CD4A 1HJSA 5HXMA 2G4FA 4UOJA 1E1FA 1PAMA 1UR1A 1CGVA 1PX8A 1BF2A 3D50A 4CU8A 3BUDA 3ZT5A 1MW1A 1SZNA 3VPLA 2UY3A 3CHEA 3NIYA 3LPGA 4KGLA 4GI8A 2PWHA 3D52A 1UZ1A 5BRQA 3L4VA 3DDGA 1W9VA 3JUGA 2EO7A 4MNMA 3OBAA 2VVSA 2YKKA 3QGVA 1TFVA 1FHDA 1QWUA 2WVSA 4ATWA 4ZEPA 1V3HA 4MB3A 2VURA 2DT3A 1NOUA 3TTYA 4K68A 2W62A 1E3XA 1QHOA 4FLOA 1JD7A 4JL1A 2X0YA 2WZIA 1UR4A 1K9EA 3BUPA 3NUKA 3BH4A 1VRXA 1WB0A 2PC8A 2W91A 3WY4A 1HT6A 3ZT7A 5I23A 2XN0A 3B9DA 4ACZA 1NH6A 3GNRA 3VGHA 3U5UA 4H41A 2F1BA 4BA0A 2FYVA 3EMQA 2IXVA 1DTUA 3KL3A 2WCAA 3AHVA 3PZGA 4AMCA 1C92A 2JFEX 2WMIB 3AMLA 4RE3A 4TOQA 4XX6A 3IJ7A 4B3KA 1KFWA 4XZBA 3T2OA 4HOWA 3NDYA 5A2AA 1FHLA 3GBDA 1US3A 3SUWA 2DT0A 1M04A 3VGBA 4UQ9A 2WW5A 2VUYA 5A8MA 3UESA 3L4XA 1DWJM 5HPCA 4TVDA 2YL8A 3QHOA 3IJ8A 3T0AA 4E4PA 3PZTA 4TX8A 1FA2A 1PEZA 1CGTA 4M24A 3AHYA 4M81A 3L4UA 3FY1A 4Z2KA 3RO8A 3SIMA 2ZUTA 2GK1A 1EA9C 2YOCA 5BCAA 4WK9A 3VM5A 2J77A 3GNPA 3VD7A 4W84A 4UCFA 1K9DA 2BFGA 3I3DA 5CLWA 1V0LA 1TA3B 4H8UA 1CGXA 1J11A 1KB3A 3UETA 1GOMA 4DUVA 1WCGA 3W28A 1QOXA 5GNXA 3U7BA 1GQIA 1TQWA 5BXRA 5A1AA 4PMZA 1E6ZA 4P7LA 4R5EA 1LLOA 2YA2A 5JBEA 1QPKA 2GVYA 1E4NA 4ATDA 1M03A 4PSPA 4HMCA 3F5LA 5CXPA 5GNYA 5A6LA 1GOOA 3WH5A 1JGIA 3DYMA 3GM8A 3FNDA 3H54A 1V0NA 1V3MA 3CO4A 3L4ZA 4AZ7A 3MANA 3HMCA 1NM9A 4J7RA 2A3EA 1GOQA 2QPSA 2HISA 2VZSA 2FHBA 1CXIA 3U57A 1TQTA 2QMKA 3CUIA 3WQ8A 4JKKA 3BAJA 4B3LA 1QX1A 3MMUA 1JXKA 2DSZA 3A47A 5I5RA 1KR1A 2ZXDA 5DFAA 1F4AA 1XYZA 3WNKA 1UKTA 4W93A 3N04A 3WDRA 5AY7A 5I24A 1D3CA 2X09A 4WKFA 1CZ1A 4CU6A 1UD8A 3WKZA 1FFQA 4U2ZA 4BQ3A 3GXTA 1V6WA 4P8VA 2GJPA 4F66A 3N12A 4ML4A 3WEMA 4CCDA 4HA1A 1E6PA 3S5YA 4JFTA 4LX4A 3SCRA 3NYDA 1HJVA 4P8WA 1LWJA 4HP5A 2F7QA 2UWFA 4TX6A 3W26A 1W9DM 1UYQA 3AIUA 1JFXA 4DWSB 2E0PA 3SCTA 5KZ6A 1EDGA 1C8XA 1MWOA 1EGZA 3SUSA 1FFRA 3VSVA 2F1AA 1H1NA 2O9OA 1CPUA 2PI6A 3D3AA 3BC9A 4M1RA 3UG3A 1D7FA 3EYPA 1CLVA 1DEDA 1XCXA 1E4LA 4PEEA 1NP2A 1DWIM 2W63A 4CD8A 3IAQA 1HIZA 1OWQA 3LRLA 1M01A 3CZGA 3ZO9A 2XGIA 5CLTA 3OLGA 3WNLA 1UKOA 3N9KA 2E9BA 1BVNP 4NXKA 3BUBA 1EDQA 1E4MM 2VMFA 2AMGA 4OBRA 4YN5A 3OB8A 1EHAA 4OUEA 3L2LA 4HZ6A 3WH8A 3GH4A 1E73M 3A22A 2CERA 4CN6A 1UWIA 3W81A 1H4PA 1EOKA 3AMKA 1O6IA 3L2MA 2D2OA 1PPIA 3UCQA 3GXIA 5JIPA 2Y2WA 3SCVA 3K8MA 1AQHA 4CU7A 3CZSA 5A6KA 1ZBVA 2BVYA 1VBUA 3L4WA 3W24A 1E40A 4B9YA 1UHVA 3WNOA 3L4TA 1UQZA 3FAXA 1VBRA 2QPUA 1UD5A 3BMWA 3CPUA 5A2BA 3WDQA 2F7PA 3RIKA 1QNRA 4H2CA 3T09A 1HL8A 3GXNA 2VRQA 3ARUA 3WBEA 3TONA 1V0MA 2GJXB 1UH3A 1OCQA 3B8SA 3BAIA 4XB3A 1H5VA 1OB0A 2Y8KA 1AQ0A 3PTQA 3PZQA 4QCEA 3LPFA 4QDMA 4Z2GA 4UQDA 2WHMA 2FGZA 3UEQA 4DO5A 3WF3A 3F5KA 3VIKA 4AC1X 2ZUVA 4CKQA 3WDPP 1VEPA 1PIGA 1UKQA 3OGSA 1HXJA 4RL3A 2OYKA 2JF7A 3AISA 3DHUA 3LMYA 1Q6GA 3N11A 4Z2HA 3AIQA 4JFUA 4UQBA 1WO2A 2UY4A 2VCCA 3TV8A 3ARZA 2J74A 1O7DC 3VD5A 1EO7A 4V27A 1V6VA 1I1XA 2BY2A 2VRKA 1E6SM 4UNIA 3A4AA 1UR2A 5A6MA 3IJ9A 3EDDA 4MPKA 3NSXA 1KGXA 1PZ3A 4HA3A 2G3JA 5JBFA 1R87A 4NRRA 2Y5EA 5BWFA 4D6FA 4U31A 7CGTA 1VF8A 4GIAA 2X2IA 1N82A 5A3HA 3ZOAA 1KBBA 5E09A 5I79A 4XUYA 5IDIA 2XIIA 2CHOA 5CPTA 1GJWA 3M07A 1CXEA 3VDHA 3LXAA 2XM1A 1J18A 4PMUA 4L4PA 1C90A 3CTTA 2TAAA 2DSKA 1ITCA 1FH8A 5DEZA 2EBNA 4MB4A 3GXDA 3GH7A 5DT5A 1VEMA 1PJ9A 1B9ZA 4QLLA 1UD6A 2BXYA 2DGAA 5E0FA 2QMJA 2XVLA 4AD5A 4AD0A 4OGZA 4UQCA 1GCYA 3VIIA 4BF7A 2WKLA 4PMOA 1HP5A 4UOQA 3NSMA 1ISVA 4YPJA 4NRSA 5ABGA 1BFNA 4RE4A 1ZS2A 4WSKA 3CZLA 1OBAA 1PS3A 1TQVA 3VD9A 1QBBA 1J0KA 2EXOA 3K1DA 4X0VA 5E70A 1T0OA 1W9UA 2V5CA 2DSWA 2FH6A 1EOMA 1HN1A 2QF8A 5M17A 3VIFA 4FK9A 1VIWA 5C8BB 1B90A 4H8VA 4BQ4A 1OD8A 1DWHM 2V3FA 3AXXA 5A95A 2G8ZA 3FN9A 1HWWA 2DIEA 4EAMA 2G3MA 1WKYA 2ZUNA 1E6XM 1RH9A 1BGAA 2E4TA 1C7TA 3BCFA 3AHZA 2OSXA 5I6SA 1YHTA 4CN1A 4LYRA 2ZUSA 2GDVA 2D0GA 4AD3A 4LXFA 1HKIA 5A6JA 3CMGA 3ZT6A 1IT0A 2CYGA 3RM9A 3WIJA 4DO4A 3ZQ9A 3TTOA 2CETA 3WF1A 1XSIA 2XFRA 4MNKA 3GXMA 4W88A 4UFKA 1HVQA 2WK2A 2ALWA 3EDJA 2YBTA 1MQPA 3O9NA 1UH2A 4MB1A 4WKAA 3VGDA 2FDMA 3WFLA 1RD6A 1SMAA 2IXUA 4P7QA 2ZX6A 1W3JA 4BS0A 4ZXLA 2YL6A 3M46A 2YIHA 1E6QM 2E3ZA 3MU7A 1OSEA 4RE2A 3WH6A 1G0CA 4U5IA 3S2CA 2B31A 1UZ4A 2RGMA 1UD3A 4PCTA 3THDA 4KGJA 2DT2A 4H8HA 4HOXA 3EBVA 1QW8A 4TUFA 3SUUA 2V3DA 1JIBA 4MAVA 3CV5A 1JG9A 1L8NA 7A3HA 3CUJA 3WENA 1V08A 4AIUA 4M56A 2GK1B 4AISA 1B1YA 4QFUA 4CVWA 5FD0A 1H09A 2JF6A 4AD1A 1WPCA 3BVVA 4NX0A 2VZTA 4GZJA 1XH1A 3D5HA 3NSNA 5A8QA 3BVUA 4D72A 2WBGA 3UR8A 3DX3A 2OWCA 4LYPA 1W3LA 1BG4A 1GOWA 4ZE5A 1BYCA 2JIEA 5A6AA 4AD2A 3WY2A 1ZBWA 4DWSC 2A3HA 2PB1A 1G1YA 3WH7A 4W5ZA 2VX4A 1HKJA 2MANA 3WD2A 2CNCA 4AWEA 1WZAA 2OYMA 4GINA 5DMYA 3VMNA 3VMPA 3UR7A 3PN8A 1NWSA 1HX0A 3QHMA 1JD9A 2EPNA 1HTYA 1EDTA 2YLLA 1JZ2A 4LQ1A 4PMRA 2X2HA 1QNSA 4QP0A 3GDBA 4JAWA 3OLEA 1V03A 1NARA 3SCQA 1KWKA 5I77A 2ZIDA 1NOWA 3SURA 1XSKA 3OLDA 2EEXA 4TTGA 3WD0A 2OYLA 4U5KA 4TVCA 3WL1A 2EACA 1UOKA 2EAEA 1B3ZA 4GXPA 3CZEA 3LPPA 3WFZA 1NP0A 3EDFA 2X0HA 1K6AA 1SR0A 3F5JA 5DT7A 2WCSA 2NT1A 4WF7A 5BXSA 1CNVA 1CYGA 3POHA 3II1A 1MQRA 2BY0A 4PTXA 3WY1A 1LWHA 2VL4A 1JDDA 1WDPA 2J8FA 2YL5A 2W5FA 4YHEA 3LXCA 2GFTA 3WEZA 4JFVA 4Y7EA 2WSKA 2XIBA 1LL7A 3RILA 3CUHA 2WB5A 1KTBA 1CGWA 4CN4A 1H41A 2D23A 4UQEA 2X2YA 1BG9A 1W3KA 1VEOA 4S3KA 1PZ2A 6A3HA 4FNPA 1JI1A 2QV4A 2VOTA 4B16A 3TA9A 2Q8XA 2WSPA 3I3BA 1CLXA 1D2KA 1B31A 4X0NA 3WQ6A 4Q7NA 2XFYA 5E9AA 3AJ7A 3VTRA 5LA0A 2NT0A 4FNRA 1XC6A 3WELA 4UFJA 5CZKA 3VSTA 2E8YA 2IUZA 1UQYA 2W67A 1V3IA 4GQRA 1CDGA 1XD1A 3AXIA 2PWFA 4OBSA 3WBAA 1TUXA 2WM0A 1WNOA 3D51A 1OGBA 3MKKA 1JAEA 1BHGA 1HKKA 3DX1A 3BGAA 2V38A 1QBAA 4H04A 3SCUA 1OGSA 2ZUWA 2BHZA 1R7OA 8A3HA 4JL2A 3VIJA 1R34A 3ARQA 1XRVA 1HJUA 4AMWA 2A3CA 1UASA 4J3SA 1V02E 1UKSA 3MV11 1LF1A 1XSJA 1G9HA 3BLPX 3ARTA 4HZ8A 3AZSA 1KR0A 3WQ5A 1UR9A 1CECA 3TTQA 4D6CA 2CBIA 3H55A 1ODZA 4GO8A 4U33A 1UG6A 3CUGA 3AMDA 1KWGA 2YJQA 3I3EA 4AXNA 2X2JA 5IXEA 3OGRA 1B2YA 3ARSA 1VB9A 3ZJ8A 4J27A 5FIPA 1WP6A 2WWDA 3CBWA 4U3AA 4FLQA 1HJWA 3CZJA 1CEOA 3WF4A 1DWGM 3N18A 4PN2A 3VIOA 4W7VA 3WMSA 3O2LA 5ABHA 1ECEA 3BAWA 3ARRA 2WMIA 3AXHA 1E0XA 4U3CA 4ZENA 3FW6A 2XVKA 2CIPA 2J7GA 4HZ7A 1TVPA 2WVVA 2F7OA 3WQVA 4R27A 4ZXOA 3PZVA 5EBAA 1TQUA 2WBKA 4FNQA 5D4YA 2WVUA 7TAAA 2OSYA 1W9PA 4AZCA 3VIMA 3S6TA 4HPHA 3AIEA 4MDOA 3LX9A 1MQQA 4PMYA 3AIWA 5BXPA 1JFHA 2Z1SA 1GOIA 3W27A 1V6UA 3W6MA 1U2YA 1QI2A 3IK2A 2F8QA 1XV8A 2WC4A 3N17A 2VCAA 1E55A 1HKMA 2V3EA 1OT1A 2DDXA 1GUVA 3WMBA 3PZMA 1E4IA 4F8XA 3AROA 3SCWA 1MVYA 2WYSA 3KLLA 1JXJA 3W38A 3NCOA 2OW6A 3VD4A 1X6NA 3HU7A 1SMDA 4NSBA 1GPFA 2BS9A 3GTNA 1V6YA 1QI5A 1CGYA 1XYFA 1HXKA 4X9YA 1BSIA 2ZUUA 3DX2A 1KTCA 2EJ1A 3HG5A 4FMVA 2E9LA 3T2PA 1WDSA 2J7EA 3MUZ1 1CXFA 1E70M 4BCEA 4QLJA 3ZM8A 1R75A 3WD1A 4IUGA 2WZHA 5ABFA 1QNPA 1RPKA 3IGUA 2PF0A 4JKLA 4J3XA 3L4YA 5CSYA 4D6IA 1VJSA 4AEFA 1QI4A 1XHGA 1J0IA 2WMGA 4L4OA 2VX5A 4V2XA 4D6EA 1AQMA 1ISYA 4KRTA 2D73A 2WPGA 2VZOA 1CTNA 3EJQA 4J3UA 4MAZA 2EPKX 3UG5A 3AYRA 3A5VA 3BVXA 5CGMA 4JFSA 1BAGA 2ZX9A 3NDZA 1QVBA 1UWSA 2WMJA 2XWDA 1JNEA 4CD7A 5FL0A 3W0KA 1QI0A 4JCLA 1WE5A 2W4XA 2OW7A 1B3WA 2WAGA 4HTYA 5FOOA 3VSUA 1HL9A 3ZJKA 4LPCA 3EJUA 5BROA 1X1NA 1E6RA 1U30A 3T08A 2E40A 3BVTA 3M6DA 2VZVA 3J7HA 2XUCA 4GZIA 1QNOA 1Y7VA 4DO6A 2WLYA 1ITXA 3BAYA 1FP9A 4TVUA 1W3HA 3OLIA 3AHTA 3PZUA 1EQCA 1RP9A 2VT0A 1E1EA 2Y4SA 3ZSTA 3ARYA 1J0JA 1R46A 2VZUA 1BYAA 3M7SA 3VILA 1MW2A 5GNZA 3VVGA 2DEPA 2G3IA 1GZJA 2YDQA 3DHPA 4KRUA 4MNLA 4HPGA 1C3FA 3PTKA 3AZRA 1CXLA 2J62A 3MS8A 1K9FA 1BYDA 4MJ4A 2NW0A 3TTSA 3KL0A 5GQBA 3CUFA 4D6HA 1ISZA 2ZX5A 4H7VA 4M8UA 4PUDA 1XD0A 2E8ZA 1JL8A 3BSHA 3VGFA 4BZYA 1CWYA 5JBDA 4LGXA 9CGTA 3WN6A 4GKLA 4D6DA 3EJPA 5E6ZA 3BLBA 2FH8A 2FE0A 4FLSA 2EPLX 2EPMX 1GQJA 1R33A 1NWUA 3T0DA 3EDKA 4EKJA 2UY5A 1MW3A 5A94A 1SFSA 3W82A 4QAWA 1JNDA 5HBFA 2YA1A 4TTUA 4W5UA 4XZWA 1J0HA 1HJXA 4HMEA 4NF7A 4PUEA 3CHDA 3H53A 4AZHA 1EIBA 3WD3A 4BQ2A 1JZ3A 1PX3A 1Q6DA 1ZU8A 2WC3A 2VR5A 3T0BA 1GHRA 1KQYA 3VINA 2A3BA 3AS2A 3WD4A 4PTWA 4NI3A 3SCSA 1HF6A 4W7UA 3N15A 2OLHA 3RDKA 3VOCA 3WY3A 5ECUA 5IHRA 1EO5A 4GZEA 4A3HA 4HA4A 4CCCA 3OG2A 3DECA 2WVTA 3A3HA 1MXDA 3AICA 3HZ3A 2DSUA 1OT2A 2VQTA 3B9AA 1H0IA 1UD4A 1UUQA 5D9PA 1JZ8A 1NQ6A 3ZR6A 4AIOA 1H3GA 1JDCA 2V5DA 4W85A 1IZKA 3VO0A 4ACZB 5LA1A 1E3ZA 4EE9A 2EPOA 1G94A 2NSXA 2XSBA 1JYXA 3KZSA 2C0HA 2ZX8A 2DH2A 3MUIA 3KL5A 5BYWA 1M7XA 1ZB5A 2XG9A 2GDUA 4CGTA 4GI6A 3A23A 2XM2A 1CXKA 4WLCA 3PZIA 1JF6A 3CC1A 4P7RA 4S3JA 2F61A 1O7AA 2ZICA 3VNYA 2WZEA 1JAKA 1JZ5A 1M53A 5CPQA 2PWDA 1E15A 1XH0A 3MUY1 3TOPA 4AEEA 3MMDA 4YHGA 2JE8A 5LA2A 3VX1A 3WQ4A 2O9PA 2XGBA 1ISXA 1US2A 3PZNA 3VD3A 2PBOA 2ESCA 4F9JA 2JIWA 1XGZA 4JZ5A 4P8XA 3VNZA 1SYTA 5JIWA 5AYBA 4TXEA 1MFVA 4D6JA 2D1ZA 3WF0A 5HPOA 3E1F1 3IAPA 5EFFA 1ZL1A 5DF0A 4JKMA 1IV8A 3K8KA 3W4RA 2J7BA 2WMKA 4NXSA 2AOSA 4JCMA 1WDQA 1W2PA 1EH9A 1OD0A 4XV0A 3BCDA 5M3WA 1F4HA 4GPNA 4KMQA 2JEPA 3THCA 1E6NA 2D24A 3K8LA 1UWUA 1V3KA 1W9XA 1B3VA 5CQ1A 1KGUA 1R47A 3K4DA 1C91A 2C7FA 4UFLA 1VAHA 2J75A 3AS3A 1V6XA 4M82A 3BAXA 3TP4A 1HNYA 5I78A 1WZKA 2ZX7A 3FHAA 2VRJA 1KCKA 3NJ3A 3AZTA 3AS0A 1PX4A 4AZBA 1C8YA 4CD6A 1QHPA 2CPUA 3N13A 1W1YA 1J10A 3HG2A 2YL9A 4OOUA 3WDJA 1EHNA 5D9NA 3ZR5A 1ZJAA 1JDAA 1Q6CA 2A3AA 1E5JA 4Z2IA 5BRPA 4PMXA 1ZBKA 2HVMA 1ZBCA 3FXYA 3BUIA 1I75A 3CIVA 4CD5A 1UKPA 3PZ9A 3WDHA 4OZOA 4P7OA 5HNNA 2CBUA 3LXBA 4W8AA 3U5YA 2J7HA 3EMZA 4AZ6A 3APGA 1BYBA 4LYQA 3MV01 2VX7A 5FL1A 2WNWA 3VMOA 3CZNA 1JF5A 1E0VA 1CENA 1BTCA 2IGTA 3W37A 4FF5A 1HVXA 5I2UA 3CHCA 2WVVB 1GORA 3EJTA 1E56A 4IPNB 1B0IA 2YLAA 5LYRA 5AC4A 2D20A 2VI0A 3W6LA 4UR9A 3GZAA 1NWRA 3BMVA 1TMQA 1H0GA 5IHSA 2AAAA 4AZCB 2CBJA 1GQLA 1QWNA 1U33A 2GJRA 3FAWA 4C7DA 3WL0A 4PRWA 3WMCA 2QLYA 2BHUA 1V02A 5BXTA 3A4XA 3VDBA 2WCGA 4DUXA 2JALA 1CBGA 3A24A 2FHFA 3QOMA 2OWWA 3RJXA 1R8LA 4W86A 1BLIA 1V3JA 1OGGA 2J47A 2Y8VA 4GQQA 3WH9A 4PCSA 4KWUA 3QR3A 5KEZA 4IM4A 2VR4A 4AZIA 4PSRA 4AD4A 2W92A 4AYGA 1A47A 4W8LA 3AOFA 4KH2A 1WDRA 4ZE4A 2J7FA 1JZ7A 1KQZA 3WNNA 3VUPA 5D8WA 5EB8A 1W2VA 4HMDA 2XVPA 2ZXBA 1LQ0A 3BAKA 4NZCA 5E0CA 2GUYA 1J12A 1L0PA 1VFUA 2XN1A 1QI3A 3GNOA 2X05A 4E8CA 1UWRA 5JUVA 2QHAA 4MADA 1TE1A 5CG0A 4EK7A 1VFFA 1PIFA 4MTVA 5ABFB 1LL6A 2YFOA 3KEHA 4CCEA 2RGLA 1E43A 3VGGA 4W7WA 3CZ8A 3PHAA 5CGTA 1MYRA 1J0ZA 2XYLA 1KCLA 2D0HA 2PBGA 3GYCA 3W53A 1VENA 5A6BA 3HG3A 1MW0A 5I0DA 1BPLB 1GNXA 4JIEA 3UG4A 2JEQA 1VJZA 5AYIA 2D0FA 3WUGA 3W29A 1P6WA 4J28A 2WANA 3A4WA 1B30A 2XPKA 3AYSA 2XWEA 2CHNA 2ZOXA 3A6OA 1BGGA 4FLRA 4PBGA 1UH4A 3A21A 1C7SA 1JYWA 2BXZA 4B9ZA 1R7AA 4DM1A 3DC0A 1GW1A 3ZIZA 1CGUA 3AIRA 2PWGA 2YDRA 1TZ7A 3AS1A 3K4AA 4AMXA 4Z2LA 3ZJ7A 2VJXA 1H49A 3B9EA 4OIFA 2XJ7A 2PWEA 3BXWA 3S5ZA 4Z2JA 3WF2A 2WLZA 3QHNA 4EANA 4F79A 2ZXQA 1FH9A 5GPRA 3BLKA 2DPEA 4QCFA 4JHZA 4PYSA 1GOKA 1CXHA 4OJYA 3WUBA 3VDAA 1KXHA 1KXQA 6TAAA 2Y24A 3ECQA 4FNUA 4BQ5A 3AI0A 1E9LA 1W1TA 4M29A 1C8QA 1FOBA 3FHQA 5M03A 2VVNA 5A8PA 4PMNA 3PBGA 2BY3A 3F4VA 3CZKA 4DM2A 1JZ4A 3RM4A 3SCPA 1UWTA 3U7VA 2WHKA 2EADA 1PBGA 1TA3A 3RPMA 3D4YA 2VTFA 1E5NA 3ZJ6A 4MB5A 2WHLA 3BUQA 3CMJA 2VO5A 1DHKA 1VFOA 3KWXA 4UZSA 2CCRA 2ZXAA 1Q6FA 1E72M 3OA5A 4IISA 1J0YA 4WSJA 3MMWA 3WSUA 5EMYA 2D22A 1JYVA 4WJXA 1WAWA 1B3XA 2VCBA 3SCOA 2CBVA 5CPSA 3LRMA 2YFNA 4PTVA 1KXVA 2DSVA 3VM7A 5A69A 3DX4A 3ARXA 1KGWA 5A8OA 4J3TA 1R86A 4AZ5A 2YBUA 2WMHA 3RM8A 1JI2A 2C8NA 2D3LA 4AY1A 4JFWA 3IANA 1TR1A 1KXTA 3BSGA 4PTMA 3AIBA 2WXDM 1UA7A 1W32A 2OSWA 1NOFA 4FNTA 3WNPA 3WNMA 1UD2A 1UR8A 3ARWA 5IFPA 3SCNA 2WHJA 2OWXA 3WUFA 4GI9A 1QW9A 2WKGA 1DWFM 3DX0A 4Q22A 2WMFA 1HP4A 5AC5A 3WUEA 1J01A 1W91A 1B3YA 3ZSSA 2BY1A 4ACYA 4A3YA 1JYNA 1MXGA 1S46A 3EDEA 1Q4NX 3EJRA 4D1IA 4PMVA 1BQCA 1OM0A 3MO4A 3VU2A 3MSGA 1G01A 3AMGA 3AHXA 3PZOA 4P8UA 5ABEA 1LG1A 1K9TA 4A4AA 2XSAA 2DIJA 2X1IA 4AW7A 2G3NA 3GXPA 3D4ZA 3KE0A 2VX6A 4MJ2A 5A2CA 1AMYA 3SEPA 1W9BM 4D1JA 4DWSA 4UFMA 3AMCA 1LJYA 1I1WA 6CGTA 5E1QA 2EQDA 3OZOA 3W25A 1DP0A 4HU8A 1LL4A 1UWQA 1GVIA 4N42A 2O92A 3SUTA 1ISWA 2O9TA 2XN2A 1G5AA 3CHFA 1W1PA 2J25A 2O9RA 5C71A 2UY2A 2CKSA 1NWTA 4J3VA 3K46A 2DQXA 2W61A 4HU0A 3DYPA 1AVAA 3HG4A 2FHCA 2DH3A 3WDIA 5A6BD 5DO8A 3VDCA 1J9YA 1Q6EA 1Z32X 1QHZA 1OINA 4W89A
chains in the Genus database with same CATH superfamily
3T55A 1EBGA 3TBSB 1JZ6A 2MQ3A 1NGPH 2KLSA 4O57A 4DEFA 2YD8A 1N0LA 1BZOA 5AYTA 5C0CA 1W72B 2X6UA 2BHYA 3JT2A 4JM2F 3LMJH 3OTTA 3V6OE 4BFRA 1ESWA 1GAFL 5DY3A 4JPSA 3T77B 3M43A 4Y89A 5EC2B 3YPIA 5D03A 3FONA 1M71A 2X4UA 1XMEB 1IWAA 3ALGA 3MC0A 4JO1H 3LGEA 3SDDA 2GJ6A 4ICMA 3CK0H 1MKFA 1USQA 4NX5A 2NX5E 3WEOA 3E3QE 3MACH 1W8OA 3IVUA 4JRFA 5JQ6H 3PHOB 4L29B 4WIWA 1HSAA 1N6QH 2YA0A 3WL9B 4OD3H 2EAWA 3VFMA 4XG1A 1CUOA 2PCQA 2DKMA 3ZTNH 1EAPB 3VIHA 3PREA 4NIRA 3O6FD 5AVHA 5D7IB 1YECL 4IPLA 5ECJE 1A7QH 4FDWA 1WZMA 1LEGB 4TLTA 1CDIA 5HPMB 3MCKA 5C7ZA 4AZGA 3TX4A 5BQ7B 1TRDA 4RPPA 5FF2A 3MV8A 3K80A 4PJFA 8TIMA 1SXNA 1N5YL 2ITFA 4UZUA 2XU2A 1DQIA 1JVKA 2NR6D 2KQNA 1F6FB 4ATLA 1NCDH 2NZ9C 3CTLA 2OK0L 2FLMA 3RNDA 4F91B 4WKZA 4DFHA 3MLXH 4KGLA 2NVCA 5EN3A 3DDGA 3BZ4B 5T33H 2VURA 2GK2A 2ZOLA 4OQ1A 3AG2B 1E3XA 4MPQA 1GVSA 1NCBH 5MENE 3P5ZA 5KZDA 2B4CL 4X7DC 2YMXL 3F6JA 4PG2A 3KL3A 1ZK5A 3NQAA 1VZIA 1SM3H 3FRPA 4DXVA 2VUNA 4XX6A 4ZVJA 3DVFA 4CNNA 1KFWA 1KLZA 4N25A 1NFPA 4FLHA 5F6IC 1Q5MA 3BVNA 3B8YA 3RDTB 1F6AB 4ZUTB 2YGNA 4GAGH 2CSPA 4FTVA 1T20A 3NVQA 2P5EE 4E4PA 1JTPA 3X3GH 1Z41A 4XT1C 3TBYB 3L7EA 1QG3A 3L4UA 4HDIB 5I1JL 4K3ZA 1NCOA 5TJWK 2BGSA 4QNPF 5DQ9B 5J57B 3VM5A 1XXFC 3GNPA 4MKNA 3WJZA 1MZRA 4AYFA 4RRPG 3DO7A 3MOBH 3FHEA 1OF0A 5BW7C 5J12B 3IGFA 1CDCA 1EFXD 1F1GA 2PPDA 1WZ1L 2OGYA 4G80A 1IR1A 2GVYA 3B3IB 3QAZC 5F7KC 3TN0C 3MLZL 2PO6C 5A7BA 4MWAB 4M1GL 4FQQA 3BPCB 4J7RA 2HZHA 4JFEE 3T0EE 4K71C 4HJJL 2QMKA 3D85D 4QIRA 3RWGB 1H7RA 1KCSL 1KR1A 4NBXB 2H2PD 3OZMA 3PBYA 4YXHL 4W93A 2OZTA 3NAAL 1T0MA 4M1DH 1GZHC 1NJJA 2DQTH 4EUPA 1DN2A 1V6WA 1TIMA 2KLRA 4IK7A 4NQEA 4HA1A 2DMCA 1HI6A 2XDHA 4P8WA 5I03A 2K7QA 4DCQB 1KGCE 1PBYA 4PGDB 1LBLA 2BRRH 5D1QD 3IS0X 4KZEH 3W5MA 4PRRA 1YAIA 1EHKB 1CPUA 2UV3A 4M8RA 3UG3A 2J21A 1M01A 1AXSA 5D70L 4HU2A 3N43B 4XNUL 1TTRA 4OLUL 4ZTPH 5T1DH 4GSUA 5KSVB 4I9MA 2CERA 1UWIA 3W81A 4R7JA 4JJ5B 1VACA 4ZTYA 4ZMOA 2BCKA 3AMKA 3HAEG 3MV9B 1UPMB 1YHPA 3VGAC 1K3IA 1T1YB 3GUFA 1AQHA 1UUSA 4JYFA 2X6BA 3IPFA 3O3BA 4PLJD 1EJRC 1ZBVA 1SZRA 4I0PC 2ACRA 2Z7KA 1UEMA 3TWYA 3W57A 2QADB 4ZZKA 5AOIA 5DJYB 4O53A 4IMGA 2O1AA 2WBXA 3O07A 5C9KA 4E9TA 1NBVL 1H5VA 4CGUB 4KKZA 4P4RA 1JGUL 5EBMB 1HQ4B 5CR8A 4NJIA 1EJSC 3UAFA 4B7LA 2Z4GA 3S9ZA 3QZNA 1K6WA 1LTXA 3UZEA 3EZ4A 4E3TA 5I6KA 4ZUWA 4UUJB 4WHYH 3BVJA 2MQ0A 5DI8A 3ZDZE 3GSQB 3I6EA 4LHQB 4WGXA 3AREA 2KHAA 4X50A 2ARJB 2Y5EA 1KPRA 4LLYB 4HPJA 4F2FA 3DBNA 1KBBA 3M9YA 4XUYA 3FJLA 1OKEA 1RUMH 1A1MB 4O2EB 4HEME 3FQTB 1J18A 3WUWG 5D7LB 3CL8A 3B9NA 3VYLA 5D1XE 4PJGA 1ITCA 4NM8H 2J27A 4NHCH 3VWJB 4NENB 5BZXA 5DUPL 5E0FA 4PRHD 2PRLA 2QMJA 3ZW3A 1AGDA 5DX7A 3GSWA 3S5LG 3C86A 4DSYA 4PWHA 1RQEA 3L0KA 4HUVB 4RE0A 1T0OA 2PF6A 4NCC1 3O6LH 3TZVA 3SKNA 3FO0L 4HWUA 4CC4A 3US0A 4LASH 1R19A 4GSQA 1ZT7B 3DX6A 4QG9A 1PO9A 4Y5XC 3RGVD 3IWVA 3W7JA 2PMQA 1MRFH 3ESUF 4DGWC 2OMVB 3WLRA 3H9SA 3HW7A 5GRXG 3VNLA 1EGMA 3QXUA 4EZJA 3RM9A 3WIJA 1U41A 3VH8G 2K6WA 4BCZA 2ALWA 1X5IA 4UDTB 4R5VA 3GX9A 1ACZA 1A9VA 2W27A 3AABA 2Y06H 4RMSA 5HAOA 1KYAA 5DS2A 5LXGH 4DKDC 2Y7DA 5HGBA 1SDDB 1TJGL 1ZLSL 3TCTA 1MCOH 3NQ6A 2E74C 3F7YA 4OFYA 2Z2UA 4KGJA 1ZEAH 2DT2A 4H8HA 2X9ZA 1IT7A 3GJFA 3QZOA 3ZE2F 4PY7A 9XIAA 2Q6ZA 5KS9B 4OV9A 1AD0A 4JM2B 4ZTOL 1KUMA 4L4TE 1XSOA 1YRKA 1I8UA 2EDTA 4RLIA 4KFMA 3B04A 3O3EB 3UR8A 4Y7OC 1VPYA 5CBJA 2OO0A 1D5ZA 4YDMA 1IMHC 1NEZA 2D7NA 1IT9H 4M9PA 1G0DA 5C7VA 2XH7A 4KJWD 1PKLA 3MJ7A 3OVRA 4LOVA 3FQWB 1JK9B 1HX0A 1YNKL 4C60A 4TRPH 4OJDH 1CICA 5E4IA 1JPMA 2Y1HA 3Q58A 1KWKA 3JTTB 2H0FA 3CT7A 3A64A 2J5LC 3QLLA 4HCDA 3TUUA 1UOKA 3GFZA 4D3CH 1W72H 1IM3D 1R3QA 3TGXA 3EHBD 1I4NA 3GB7B 1TU2B 2QQQA 2WMPA 2WTOA 3W11D 4KK8C 2GFTA 4Y7EA 2PN5A 1YNYA 3S96A 1A3ZA 1HZLA 2AC0A 4RMQA 4GHRA 1CZ8H 4Z3HA 1OPOA 3QEGH 3S8GB 2VOTA 4DBUA 3TL5A 3ZDXE 4QWWC 3WV0A 1OSZA 3DRTA 1CO1A 3WQOA 4A8IA 4YL2A 1ZKAA 2IUZA 3F85A 1RV8A 2PU0A 3KOZA 1VPQA 3KDNA 1QBAA 3UDWC 3V4PL 3F04A 2BHZA 2AJYH 4IMFA 5GS0H 1A6AA 1JV2A 3EH2A 5JIKA 4CNOA 3CFCL 2P8PB 4DP4X 1L7TL 5GRWA 3UYRH 3OD3A 3AZSA 3PE9A 1UR9A 4OZFG 4XHJC 2X4PB 3PWVA 4PJ8A 4QYOB 5ERWB 5EPMB 4KXZH 4XTRD 4HS8L 3CZJA 5G1MA 3N9GL 1PZ0A 4PMJA 4M5PA 1S9YB 3AXHA 2R2EA 2YBRB 1KN4H 2EE6A 2F5AH 1H6TA 4ZXOA 3PZVA 2FDBP 2WVUA 7TAAA 4Q33A 4NQUA 1AGBB 2EIMB 1Z9NA 4BWWA 5DZ9A 3ETBF 4IIQA 4FQHA 1TZGH 5FM5M 1H7XA 2PYEE 4TUJA 3RFZB 5FFLA 2V3EA 3QULA 3TYFA 5GISH 1BJ1H 5ADOL 4FOUA 2DRUA 3OKEB 1OEZW 2DIAA 3W38A 4JGJA 4RMBA 2YUXA 4NSBA 5JQHC 3HRZC 4YGVB 3HE6A 4HA0A 4IU3B 5CKGA 3E2RA 3RLSA 3UJFA 4FMVA 4OZ4B 4ADGA 3ZTCC 3OVUB 2JELH 3LZPA 4S11A 5EUKA 3R4DA 4F3HA 4WHTA 4UTTC 3FNKA 4DKEH 4KZCA 5I15L 5DHMC 5GZOA 4PUWA 7FABH 3QR0A 2VX5A 2BZNA 1T5XB 4RGMC 2L7EA 3E12A 1P1MA 3DXAA 5SV4A 4J3OF 2VR9A 5CN1A 4UNUA 2ZX9A 2VEGA 4X83A 3VI2A 1OP3K 3NIFB 4LHJB 5FL0A 1R9FA 4KF1A 4A22A 2DM2A 3VSUA 2B2XH 3FFOA 3VJ6A 5E03A 1X1NA 4O12A 4E0RB 1T2QH 2E40A 3M6DA 4IOFD 3ZDWA 5IBTL 2NTFA 3LTSA 2NY0C 5FYLL 5EEZA 5GNZA 2DORA 3W56A 1G1KA 1T7XA 2D03L 3U30C 3DHPA 4JJHA 2IAMA 1BYDA 4OF0A 3TVAA 5AW6B 2ZCLH 4ONVA 1UC5A 5IM51 3DDMA 2V30A 5IK3A 3S35H 1OVDA 2YPLE 3KPRD 3VGFA 4R88A 4LGXA 2Y7QA 1KTDA 2K8MA 3P62A 2AS5M 1E4JA 6XIMA 3EYOB 1ICPA 3HPJA 1D2PA 3FFSA 4NG3A 3RURA 2OJZL 2V17L 4KCTA 3NABH 4HIEB 1MW3A 1DLFL 3ECUA 3W82A 3NG3A 2DMKA 1DO5A 4Z7NE 2DLEA 2CO4A 4AZHA 4ZODA 2WXKA 5I2IB 1IARB 3HC3L 5SWZA 3MBEA 5D8JL 5C9XA 1GHRA 4F2BA 4FQ1H 3WD4A 2E75C 4HX1A 1QWHA 5HMSA 3QQDB 5HJBA 4RGNE 4HA4A 3DECA 1M7UA 2WVTA 3S3JA 1J93A 1XDJA 4KK9D 2MKWA 4X22A 3TJLA 3DEQA 1FIEA 3UZVB 4GIEA 4PWKA 1AC6A 4A38A 4EI5B 2VN3A 4E4UA 2NW2A 1MCPL 2VN4A 4YHYC 2OKOA 3WLJA 2C0HA 5AB9A 1PSCA 1NCTA 1HQTA 2I7GA 2DYRB 3WJLA 1JCJA 3LYEA 4Z3GA 1VC4A 5F7DB 5AB3A 1YEKL 3DJSA 3NCBB 4EZMA 3PZIA 2BOCB 3BD3A 2XFGB 1SXBA 5IFJB 1NDYA 5EMJA 5TE4H 4JRYE 5J1AA 1QLFB 1I8LC 3VD3A 2Y6ZA 4YFEA 3C5ZC 3AY4A 4JNMA 5KSBE 2D1ZA 4MKSA 4P3DA 5EFFA 3MCNA 4BV1A 1PCWA 1MRCL 1N19A 3VQLA 4Q6JA 5KTLA 3LZLA 5L88L 3PUOA 3M88A 3CSTA 5G55A 2AOSA 1M6OB 1VA9A 3D2TA 1E6NA 5I6PA 1JZJA 4C4UA 3QRBA 5HHOA 5L6YL 1T8QA 1VAHA 5F7AA 1IU1A 4N8VB 1DN0B 3UVIA 4CSZA 3MNVB 4RWYH 3FHAA 4UBPC 1OGTA 4U4IA 1OK8A 1OW0C 4U6YA 3PWPE 3N13A 2P80A 1EFZA 4KV5F 4GQGA 5IW1A 1IIIA 4O11A 3LHUA 2NX5D 2HWZL 2OMTB 2W6RA 1I75A 4TNFA 3V52L 5HNNA 2HRLA 4YHPA 2C19A 2H3KA 4ROQA 2OOFA 5XINA 1U8MB 5D7KD 3T2NL 4I2XA 5F1KC 2YAOA 2YGPA 3GFXA 1JCTA 2EDWA 1E56A 5LNVA 3KYMA 2PXYD 4AZCB 4WVXA 4HK3J 5D9SB 2IQ9L 4HWEL 1RU9L 2BHUA 5D04C 4WNJA 4GQZA 3TO4A 1Z7JA 2OT0A 3K6SB 2NVAA 4QT5A 5FO2A 4M6QA 1LGVA 4FXFA 1HHGA 1LHZA 1WBZB 4FX7A 4KH2A 3KOWA 4H0GA 5EOCH 3LCHA 4QO1A 4QF1A 4JRXE 2OTWA 2BIQA 5EB8A 1M1XB 5MEQA 5DD5H 3AXLB 1ZHLA 2F6KA 4LCUB 1U3HB 4FE9A 4HK0A 3MX0A 3WXVL 5HWJA 3FTZA 3O05A 2RA1A 4MADA 6ENLA 1RBOB 3L5WB 3TCSA 2J6EH 5AW8B 1IM9D 1E43A 1ZGLP 3W53A 4IPPA 3MBWB 5I0DA 3FO2A 3G5WA 4MMXA 4TMCA 4DH2A 4M02A 3A4WA 3RP1A 2R4SH 1NMBH 2GITA 5FA4A 3SDAC 5F2MA 1NC4B 3LYRA 2ERJC 3UCCA 4UB9A 5B39G 3PHQA 4QXTA 5AVQB 4FPSA 4M5YL 4FOJA 2NWRA 4POYA 3UJRA 5BUGA 1C8PA 3BXWA 2R0ZH 1K6QL 2W0LA 1CD9B 4AWJC 5LG1A 5T1KD 5E7FA 3DX8B 4HVBA 5BZAA 4OJYA 4RFOH 3T8VA 2YCLA 1CL7H 5KMYA 3KOXA 5FECA 2BIOA 3GKWL 3AT8A 4ZD3L 4DM2A 2HS8A 1Y0LA 4XX5A 4GVGA 3C60D 1A22B 5HGHB 4OF3A 5JH2A 3CMJA 2X4RA 3H70A 2WXMA 4N9OB 1IL1A 3HNTH 2C1HA 3N3EA 3L9BA 4NNXA 4YHLH 3MRRB 5HHMD 4P2RB 1R2TA 1OP3H 3HZMB 3KLQA 2WJFA 4EPBC 1OIOA 2ZXWB 1VYPX 4PG9A 3SPVB 1LEIB 2FLIA 2XQYK 4YAQB 5DS1A 3OBKA 2WHJA 4Y8EA 3ZE1F 4UTAH 2JB5L 1I1AA 1PZBA 1B3YA 4D2JA 2CKBB 1Z3RA 3KXQA 1DXFA 4RDWA 4AUJA 3SYCA 1AYOA 1N59A 4IJBA 3LEVL 1J8HE 1WGOA 1DJQA 4LSTH 3W39A 3AMGA 1LG1A 4K9JA 2H9GB 3TWBA 3UZJA 4OV5A 4Y2OA 3GZPA 4UTCA 3CQPA 1CFSB 1IGSA 4JPQA 4I7VA 1Q0XH 4DWSA 3I6LE 1OF2A 4XH2B 1TX0A 4KUZH 5E1QA 4YO0B 3OZOA 3N6JA 4QGCA 3UTTA 5KYNA 2V6HA 2B9BA 2QQLL 1RJZB 4HXAH 2J25A 3I85A 5F8RC 1WFJA 1QVOA 2NY6B 2FHCA 3URAA 2FECI 2OEMA 3UG8A 4XSLA 5C7HA 5E6YA 4KTGA 1Y65A 5KVEH 4BDVA 1VJIA 2FR4A 3RUGA 5IFTA 2YLHA 4AYID 2WWCA 1X6UA 1Q6QA 4CNSA 1KY6A 3WGVB 4ETQB 4PZVA 3QH3A 1RUQH 2RB8A 4R7WA 2W9DH 4WZ9A 3VFSB 4RNIA 5D8ZA 2YDSA 4ODUA 2Z92B 2WWKT 1Q90A 4IRJD 5I0ZA 1IBBA 1DZ0A 2VEMA 3SGKA 5F21B 3W7CA 4M00A 3RVVD 4GG6F 5EU6E 4P48A 4DZHA 2LVCA 3CFEB 4UNVA 4UQ2A 1YN7B 4B15A 4LPVA 1DFBL 4XWOC 4Y4HD 3IGSA 2WUCL 1M7IA 3LEXA 4XTIA 1IJNA 3BP6B 2H7WA 1A4BA 4FCHA 5J04A 1OFDA 1LUCB 4S38A 1WX0A 3G6MA 4Z3JA 2ZAGA 1CN4A 5HYSA 2BV9A 3D33A 3ARPA 1GZPA 3FFCE 3MCG1 1UC6A 1KCVL 2KZ1B 4UTKA 3CAWA 4GG8B 1N67A 1T03L 2VDNB 2NY4C 4UWMA 4WNSA 4Q2ZB 5F0JB 1TCMA 1R3IH 2HA1A 3V7AG 2AGJL 4JGNA 3NEVA 3D2UD 1YEIL 3LDBC 1PXGA 3C5SB 3UO1L 5D1XD 3T2QA 3L1OL 2LR4A 4MXVE 2CBPA 3QG6B 1GJUA 4IBTA 5EBLB 5DQDH 3VQ1C 2EUZA 3SOBL 5HK4A 1CE6A 2GQ3A 1XLMA 2H3XC 2C1PB 4WGKA 1A4MA 1DWAM 5HTSA 1IEHA 2CWRA 3IF1A 5KANI 3PPEA 4S23A 1PTAA 1RAKA 2FL5B 5KAQF 1PX8A 1OLZA 2PTVA 3KRZA 3A6CL 1DBML 2OR7A 4GI8A 4R3SB 3L4VA 2AEQL 4AWTA 2VZ1A 4PP2A 2QJDA 1XF0A 3N06B 2YKKA 2VKXA 2ICEC 4MB3A 3NA9L 3LKSA 1D9EA 1KJMB 2RJGA 3QQXA 3N9RA 1AO7A 3BUPA 1FWCC 3BH4A 2YZ8A 1HT6A 4ACZA 4PUNA 3ARDB 1NGQL 1MFDL 3VTTA 4M62L 1X7TA 5L2KA 4XO3A 5KG9A 3DRQA 1QSFE 4IXXA 1NA8A 2X4SB 3P73A 1FHLA 4WUUE 2C7UB 2WW5A 3FU6A 1DWJM 3VWKA 5AWNL 3VUAA 2VXVH 5T5FL 1PAZA 5KITA 4ZNEE 3E1ZA 4M24A 4HKXB 4GQ0A 4UIMA 4YDLC 3VNDA 4Y4FC 4AK1A 4KCVA 3IFNH 4JFHE 1ADSA 2CO6A 4LNRB 4ISVB 4UCFA 1FVCB 1BXUA 4XOBA 5AUMA 3I3DA 4ZQMA 2XISA 3LD8B 4U3SA 4PRBA 4X7TA 1LQSR 2C9PA 1BFSA 2V2TB 2CDEA 3HNVL 1E6ZA 1XISA 1A6TA 3GIVA 3BDKA 4LSBA 3IXTA 1E6OL 3FNDA 1UM6L 3H54A 1JHTB 4AZ7A 2VZSA 3IRSA 1AH1A 1BQHA 1BZEA 1Z9SA 2ZNWA 5K9KB 4OUUB 3MRKA 1B9KA 1M42A 2B8OT 4GS7C 5EFIB 2Y85A 4Q8PA 4KWOA 5TBOA 3SBFA 1UD8A 3G6AA 1VLXA 3M1ZA 1SJHB 2PDMA 4JNYA 3BKYL 4X7FC 2HE8A 1UB3A 3F01A 4HK6A 4F5CE 4Z7WF 3RX7A 3SQBB 4R26L 1NFDA 3FB7A 3AIUA 3QUKA 4WGWB 5DLML 2R15A 3QDGA 5ANME 1MHCA 4NUJB 2J5WA 2O9OA 1C12B 3MKGA 4U1NB 1KFBA 4J2PA 3CZGA 4Q7DA 4BRVA 5FYKE 1UKOA 1CD1B 4OBRA 1E4MM 5I6LA 4B5TA 3WH8A 3FT2B 4FQJH 2QV5A 1EOKA 4YIQA 5JIPA 5JORB 4DI8A 4KQ4L 3ITXA 4QUOA 1VFBB 1RJQA 4HFWA 1J86A 1R3KA 4B9YA 1ENUA 1A5UA 3BRDA 2RFXB 4XWGH 3RIKA 3M1OA 4H2CA 2HFFB 4LPXA 3EZJB 3TONA 4Y9OA 4DN4L 3FB8A 2WHMA 3LRSA 5B1BB 3OMZA 3HMWH 4KQ3L 4C83B 1BFVL 3W1XA 1ACYH 3AIQA 4ZT1A 5BMXA 3ZL4H 1EP1A 5HYJE 1EO7A 4KKCC 6REQA 5DZJA 3TCLB 3NA8A 3RX2A 4B50A 1XH3B 4HA3A 8RUCA 2FUTA 2FEDC 5I8CA 1TYGA 4XCEA 2L7QA 3D1MC 1CXEA 3UMNA 4QOKB 1EHLL 4QHUB 1FNSL 4WDWA 3WLPA 4YHNA 2HFGH 1FH8A 2A74B 2VDGA 2YJLA 2VEIA 2ZVIA 1OC7A 3QCUL 3N40F 3Q6GH 4FKHA 5DMIH 5CZVL 4KVCH 1ED3B 2IC2A 3B7RL 1Z7AA 4OGZA 1TTUA 1L6WA 2V7NB 1GCYA 5D7IF 2Q2LA 5C0IB 3WTTA 1CQYA 4ABWA 5EU5A 1ISVA 4PV9A 3B05A 4QRSA 4GIPD 1IAIM 1WAPA 1R0AL 3P0GB 3LHZA 4FYTA 3KLAB 3GAKA 3VXME 3L3DB 1HN1A 3LUTA 5I19L 4D8ZA 3LV6A 5HWMA 5EO1A 4OZHA 2WBJA 2ZWKA 2CHRA 5E6RB 1DWHM 4FCAA 5LGJA 4ECLA 4Z8FH 2KI6A 1LO4L 2DIEA 4ZO6A 4WTXA 3NEHA 2UWEF 1QCWA 5JO5B 5TE6H 4H88H 4MAUH 3T0VA 3LN4A 3AHZA 5I6SA 4CN1A 3V9CA 2YXWA 3EJCA 2ZUSA 5KYUA 1BX2B 1Q9WA 3CMGA 1EO8H 3DG3A 4JFDB 1CR9L 4ZW6A 2CETA 3PL6C 4OD1H 3MUGA 2YQGA 1A6ZB 3DHDA 4D0DA 3RVWD 1NDWA 3UL4A 3FDGA 4P7QA 5IB1A 1XF5B 1VPOL 3ULVF 5I1CH 3KLDA 1FO0A 1DHPA 5CC3A 3C2FA 2HG5B 3GM0A 2CKBH 1PQZB 3S47A 2HJLA 2ZYFA 4PCTA 1KRAC 1YPZB 3HS0A 4TUFA 4R90L 1TTBA 3DK2A 3BN9D 2IGFL 2W65A 1QPXA 4X5PA 4FHBD 4Y0GA 4Y16C 4OCYL 1KGYE 4AISA 1YNLH 4BRJA 1WPCA 1P7BA 4ESKA 3BGJA 4LYPA 1GOWA 3SBPA 3U7YL 1W5PA 2VW7A 4JEJA 3GTXA 1KTJA 2OFQA 1JBJA 4GINA 1KFCA 2YZRA 1TE6A 1MG3C 4A63A 1NWSA 3JTSA 5KBNC 3G0SA 2MRYA 3VXQB 4NGHH 3SYQA 2F19L 1LORA 2PDBA 1EVTC 2FWUA 1KB5L 1NOWA 1BM3H 4U5KA 3WL1A 3R7QA 3OPSA 3VG0L 2HUEA 4M7TA 3NZHH 4GXPA 3CZEA 4F9LA 4LEEA 5EU4A 5DT7A 5L9DH 4N9DA 4J3OH 5FR3A 3FUNA 4LCCC 3KCOA 3V0GA 4MDIA 4LUTA 1GOXA 4G7EB 4GAAA 4Q97A 2CD0A 1CGSH 5IVZB 2I85A 3HJZA 4O17A 2YGVA 4GRLD 4RV8A 4GBXD 3AYVA 5DRWA 1W3KA 4GP5B 1J6OA 4S3KA 3DJZA 1SFJA 3OV6A 1B3OA 1M7DB 1PMYA 4P2OA 2WJDA 3D06A 2F74B 2GQHA 3VTRA 5MI0B 1F5WA 4GYKA 2FO1A 1XC6A 4X6DA 1T4WA 3WELA 4UFJA 3B03A 4XPHH 5GGUB 4BZ2A 3GSNA 3KZPA 3ERPA 3DX1A 3N43F 3FS9A 2YGQA 4I9TA 2ZG3A 3ARQA 2XX1A 5TGBB 2VDNH 1BVWA 4LNCA 3BN3B 3QHZL 1U58A 1GVOA 4U1LB 1E9YB 4L4LA 2O5ZH 4G8IA 4LSRH 1OGAA 4IRSC 4PN2A 5JR1L 4O58L 2WMIA 3BWSA 2Z6IA 1P5VB 1E0XA 2XVKA 3QNZA 1H15A 1YVLA 1SRDA 5ADPL 1O6SB 4F2UA 3ULSA 1N7MH 1UCTA 1L3NA 4G6MH 1RZ7L 1RJLA 4L3ED 4ANUA 1QFWI 1OL0A 4NO5B 2QCDA 5JMRA 4M6NL 1E55A 1IC7L 4XGZB 4E4FA 4KK6C 3RLVA 2WYSA 2FIKB 4W4NA 5AZEL 2DQJL 4FG2A 4ORIA 5HMEA 3GMPB 1QI5A 2OI9C 1J1OH 3BAEL 1P4LB 3W23A 4EOUA 1KTCA 4FXRA 4PL1A 1UM4H 3TYCA 2HQAA 2BTMA 3P60A 1TEYA 5DC9B 4QLJA 1QYGL 3B97A 4DBDA 2R4RL 1JGLL 1N0LB 3IGUA 5C0CB 2OELA 4UTBH 4J3XA 4Q52A 3OJMB 3FCSA 3NCEB 3DU0A 1ET5A 4DJMA 5FCUL 2NXYB 1O5KA 4P5MB 5LN4A 4JREB 1VQTA 1NIFA 3QZEA 2GCYB 3V79C 3BVXA 3AXKA 5D2TA 4PJ7F 4MXWL 3APDA 5FO7A 1UWSA 2WMJA 3BIKA 3KYKL 3QRFM 3V35A 4Z7WB 3SDDB 5I5IA 1G5GA 5EIIA 4HPNA 3KTCA 1S2EA 4KKLC 4QRPA 3L9YA 4UT9H 4APQC 4JO2L 3SIZA 3J7HA 5INDB 1QNOA 1TTFA 1QPRA 1Y7VA 4PUMA 5EZPA 3C2EA 4Q56A 1HSAB 4Y90A 3M1BA 1W6WA 3ZVHB 4NRZB 3VFMB 4PFMA 3QRGL 3ZX1A 2EO1A 3QORC 4MFEA 3O9WA 4MRCA 3NP3A 2NW0A 1X4XA 4EI0A 4RCAA 4Z3IA 2VDQL 2X1PA 2E8ZA 3L2NA 3CV6A 4BZYA 2NXZB 3SO5A 5BRZB 2WW8A 3EH3B 5HUPA 3C09C 3JT0A 2NLIA 4X61A 5GGSA 1NWUA 4W9LC 3MV8B 3EDKA 1HZYA 3W7GA 1JWMB 2JJWA 4GAFB 1WV7T 2Q9OA 1M65A 5KS9F 5HJ3A 3H53A 1EIBA 1JZ3A 3WN5A 4C59B 4XVEA 4GXVH 1ZU8A 1ZAJA 4WDIB 4DI9A 3UNTA 1MY5A 2DJSA 4YL9A 3BX7C 1F4XL 3KDMA 2HLFC 4P59L 4QRRB 2ZOTA 3GEWB 3QO1B 4Y9PA 5IMOA 3UXKA 2ZOLB 1SSDA 3PWJB 5K4ZA 1UUQA 2BIHA 4K36A 1U8CA 4BQ9A 1JF1B 4FO4A 3QA3A 3WBWA 5LA1A 2NCMA 4LK4A 4LF3B 4YTTA 3I6LD 4AQ8A 2HT4D 5HI4D 1JCXA 2XG9A 1IE7C 2A7BA 3RRQA 2AQSA 1XBXA 2IPGA 3KAOA 3CFQA 1T20B 4BF9A 4P4KC 3TWCL 2BNQD 3PNZA 1AQ8A 3RHGA 5EA0H 2QTVA 3TO2B 1FNEB 2MQGA 4MJIA 2ESCA 1IGIL 2VQ1B 2JIWA 3EXRA 3G6JB 4UCGA 5JIWA 2B4GA 1H7WA 4W6YB 4DZBA 1CB2A 1I3RA 3DO7B 3RIAF 3IRDA 3ONCA 2ZZ6A 1TKWA 5EA9A 4WAFA 3MR9B 4XZLX 3X12B 3V4PB 3WNIA 3JWNC 3TLLA 3IEBA 1J5TA 1F2JA 1E4XL 3ALPA 1ZWIA 3K91A 3EA2A 3KJ4C 2UWEB 3A13A 1YECH 4M3JA 5H1WA 3MJWA 2XI9A 2B0MA 4LESA 3DO4A 2C79A 4LARL 2FNBA 2VUOA 4EN3C 1C8YA 1KG0A 2OVLA 4I18B 1N5YH 1PU0A 2IQTA 1GZ1A 4PRNA 4XNMA 2LTQC 2AK4B 1M7PA 4AZ6A 2AW2A 2OK0H 4H25B 2DEYX 3VMOA 4OUIA 1AGEA 1LM8V 1W0VB 2J8OA 2IGTA 3W37A 4W9ZA 1HVXA 1HH9A 2WVVB 3VXSE 5EEVA 1V55B 3PIQB 2E86A 1QSVA 1HILB 1G7MB 4FZEL 4C7DA 3VDBA 2JALA 2B4CH 2PW1A 2FBJH 2J9YA 4H6EA 1CBGA 1H6UA 4ZMXA 5H2BB 2YMXH 1BLIA 3HE7C 1KPUA 4K8GA 4PCSA 1Q6OA 2QJIA 4R3UA 4MMZA 1WIPA 3RY6C 1VACB 2SFPA 2BCKB 1OP5H 4GKZA 2OTUB 3GRWA 1BRLA 5XIAA 2XVPA 1Y6KR 2HCVA 3H7BA 4BZ2L 2CE6A 4M7ZC 2PUQT 5D1ZC 4R8WL 1J5DA 3CCHB 1Z3GH 2YO3A 1VCGA 3ZHNA 1ZXQA 1ETZA 1J05A 4I9JA 4K5PA 4P49A 3MZNA 2ICWA 3REQA 4IOSA 3U7AA 2Q3RA 3PXJA 3VXUA 3PB0A 5M7QA 3OXSA 1UOWA 3KCWA 1E28A 1I9JL 1R7AA 3NPSB 3B2VL 2PWGA 4HNLA 1WZ1H 4ZUWB 1FKWA 1HWHB 4LCWD 3MLZH 1G9EA 3WF2A 3V5HA 2J12B 2VXQA 4FGMA 4PWFA 4YE0A 3NIFF 4M1GH 3KX6A 1F18A 3UGEA 1KLGA 3AREB 2BO0A 4TR9A 4MD0B 1V5XA 4QRBA 4HJJH 1KPRB 4YXLH 4G1MB 3MROB 3FHQA 2TSYA 3FMGL 1E7VA 1ND0B 3FU5A 3IU4L 4PW3A 4YXHH 3LNMA 3NAAH 4XNQB 1UWTA 4X6CB 1TA3A 3S3GA 4UMAA 4PJGB 5GRUL 5HDBB 4YDKL 4Q8NA 5IR1A 1TYJA 2MEJB 3ECBB 1LRQA 5EEXA 2NY2B 1W2KT 2O61A 3GSWB 2C8NA 2VM9A 5AVNA 1N9PA 2J44A 1N8FA 2F8IA 5T3XL 3GZQA 1PHWA 3VKJA 1IC4L 1OFAA 3WNMA 2XSKA 2Y72A 4RZ6A 5D70H 4XNUH 1I2OA 2NRDA 4OLUH 4WJ5B 5I66A 3TZVB 2BIIA 2F53E 3DFNA 4O1AA 3BDXA 2ZCKL 3LU2A 4PJAA 3DX6B 1U42A 4D1IA 5D1ZI 4Y5VB 3GU9A 3VCLA 2BDQA 1ZCCA 3F1QA 4FS9A 3IETA 4XPBL 2G3NA 3DROB 1DJSA 3EYQC 1BQ5A 4MJ2A 2ENJA 3WAKA 2B7NA 4E41A 1IEAA 2XIMA 3AMCA 1EIXA 4ZFOL 4HG4K 5BJTA 1SEBA 3TH3T 1NBVH 1P9MA 1TVDA 3LQZA 5C71A 4LOCA 4OAWA 3NK4A 4JVWA 2W61A 3FTXA 5HGBB 5F9WB 5T1MA 1LRNA 1KIRA 1N5AB 5LIUX 1WAAF 4LU5H 3L3HA 1BWKA 4RQQA 3V7AE 2DBLL 5FYKD 3QWNA 1P7QA 1AC0A 3FJTA 5ISZA 4E9VA 1UCWA 3GJFB 3EB2A 4B5UA 1RSCA 5D2YA 3LGDA 3RTLA 5DZLA 1MH5A 3LRKA 3NOYA 1RLDA 1A1OA 4G82A 2GJXA 2J8GA 3LB6D 4UU9A 1RK6A 2PR9A 5I3DA 3MRFB 4PJ7B 1GVYA 1T8XA 2B20A 1ROWA 4ENLA 2V5MA 1EXPA 4UM8A 3KH3A 4KMLB 4P46B 5LGKA 2BS71 2YD4A 3FTYA 1NM4A 3P0YL 1GHSA 5E94B 5DUPH 4NAEA 1SLWA 1ADDA 4N9EA 1WFTA 3V7PA 1W5NA 1CICB 2X1UA 2Z1KA 2YB4A 2OMNA 4DNLA 2D3JA 2WOBA 1POKA 4G56A 2AAMA 1MI5B 4RFNC 3VKCA 2XINA 1TG7A 4BWLC 2AKZA 4PHXA 1OIFA 3N1AA 4FI6A 2CITA 3URBA 3A4EA 4PRTA 1LG2A 6TIMA 4TM9A 5AG9A 3FO0H 1KEML 2Q86B 2DJ4A 1AR1B 3RBSA 1W1VA 2V5JA 4JY8A 2NX3A 3LXUX 1WBJA 1TTIA 5F96L 4QR7A 1QP1A 1SOXA 3UOAB 2ADAA 3NM3A 2BP0B 1IZCA 4HB7A 2EC8A 3N25A 4E38A 2G5UA 4M6VA 4WI7A 2FCBA 3QQ1A 3OZPA 2JJSC 2OU4A 2B5IC 5TD4A 5HXMA 4AKOA 1TJGH 1ZLSH 2VWEE 2OPCA 3SPJA 2UY3A 3RTQD 3VXMD 2A9NL 2IGLA 4BH8A 5H4YA 1W9VA 3JUGA 1FI8C 4W6WB 5GSRA 4ATWA 2AKRB 1V3HA 3CPRA 4A1RA 4PJ8B 4PJXB 2XN9A 2BZDA 1AQDB 1BVLB 3IM1A 2XSXA 3VI3E 5JXEA 4MZRA 4R84A 3EMQA 3U4AA 1DTUA 4GJIA 1MQ8A 4X9IA 1F11B 2ED6A 4B7IA 2JFEX 2WIIA 4K7FA 2BODX 3NCYP 3TJHD 4EF3A 2KL6A 1NGZA 1GA2A 1LT8A 1FXPA 1FBAA 1ZCOA 3QIWC 1Q66A 3R10A 1IUZA 2P7TA 3MUJA 4ELKA 3WUZA 4JHVA 1YNKH 4TVDA 3MRBA 4XKMA 2UXFA 1BQSA 3IJ8A 4FQHB 2OJ1A 5CJXC 5CSSA 3GS6A 4DJDC 3PAJA 4M81A 4G72B 4PJIA 4WZHA 3QULB 3LNGA 4V1DD 2ARWA 2J66A 4ZW8A 3CIQA 3FT1A 4JZJC 3SFKA 2L3BA 3PHSA 1XYMA 1MFAL 1TZZA 2FDSA 4C58B 3NT0A 5BQDA 4N8CL 4IKNA 1QOXA 1XW8A 2WJEA 3SCMD 3MNDA 3O2VH 1F1DA 2IO5A 3N6HA 5CXPA 1CT8A 3C8FA 4WHTB 1RIUL 3AGVA 3D34A 3GRWL 4RWHA 3O8XA 3P02A 3EO1A 1DEEB 4L0ZA 3UWQA 1UMYA 2X40A 1QLEL 1FYTB 3GLEA 5I5RA 4DP2X 3BKJH 1N55A 2V4LA 3U9WA 1KCBA 3N04A 3DOIA 3B06A 1D3CA 1HFBA 1ZSDB 1IBYA 5C09D 5H2ZA 4X0KB 3V4PH 3LQGA 3W1TA 4YHML 3S5YA 4LX4A 3QUYC 2A4AA 3VJ6B 3WLQA 4K2SA 1DL7L 4LH8A 3CFCH 4RDBA 4QTIL 1L7TH 1QW7A 1FC2D 1RH8A 4M6OL 5AOZA 1JFXA 4L18A 3AQZA 1E1CB 1C8XA 2FJSA 4Y1AE 1UWAA 1H1NA 3IS4A 3EYPA 2EH8L 3RLUA 4HS8H 5DHYB 2Q7AA 2IAMB 4PJ5D 4O14A 1WAUA 2AXHA 4XO6A 1CDYA 2ALRA 1NFIB 3OB8A 3A6BL 1EFQA 4DUOA 1AS7A 2X9YA 4I7ZC 1U36A 4N1EA 4BKNA 2GYIA 1LDCA 2OXHA 4MSWA 3ULVH 1PPIA 4N02A 4RMRA 3FIGA 4PRAA 5AVUB 2Q8AL 4YPGB 1AKJD 1TUPA 4LBSA 3HGJA 3FUFA 3LQAL 4J8QA 4BUGA 4ZMVA 4MNQA 3ARUA 5ADOH 5GS0C 4BKLB 1UH3A 2WWNA 3ZDYE 4DLFA 1OSPL 1Q45A 5TNVA 5SWZB 4B53A 1DO6A 3GSVB 1E0UA 2ZUVA 1VEPA 1PIGA 4PGZA 3DVNA 3AISA 4FYQA 4P8QA 3NCMA 4DPBX 2VCCA 1SQ7A 1K4HA 1O7DC 3CUZA 1Q9OA 1I1XA 5I15H 3TSBA 5KZMA 4F0LA 2DWYA 1BWVA 2FIQA 3STPA 3ULAB 5KANG 4NZRL 3KDOA 3AQDA 1A49A 3RIAK 4OCWL 4URKA 3ETBJ 4D6FA 4UDUA 3FT9A 3EOOA 5DBUA 4Y19E 4LLQB 3T9PA 2VLJA 4K8RL 3WTXA 3DESA 4Z0JA 1FG2B 3VAVA 1BJ8A 5TF0A 1XIIA 1E8XA 4P9HC 4H8PA 1P84K 5FA3B 4DGYH 1I60A 5F4SA 1B9ZA 3NJLA 4B4HA 3UBXI 3SY0A 2DGAA 3PPGA 5IBTH 3H3BC 5DC0A 4UQCA 2XWJA 4BF7A 1QRQA 5FYLH 3OJ2C 4UOQA 3DHMA 2BSSA 2X6MA 3H6AA 4KS0A 3RX8A 3C2VA 1MJJB 2D03H 3FQ4A 3ASWA 3NH7L 3ML9A 1MREH 2DSWA 5DVNA 5CBEB 4CNPA 4ZOEA 1BBDL 5KYYB 4ZMZA 1R24A 1ICTA 2YSSB 3IVTA 4OFCA 2JJUA 3BZ5A 3U9PL 3ZYZA 4EAMA 2J8UF 1KYDA 3HFML 1S7RB 1EHXA 1OGTB 3BCFA 2OJZH 2V17H 2DICA 3KYNA 5CJQL 5A6JA 4X7EC 3B0UX 4F33B 4KJPD 3DKLA 3DVGA 1I6NA 4N0YL 3WF1A 4MNKA 4Y9GA 4H1LG 4W9TA 2BWIA 4ZAKA 3HC3H 4YHPB 4WKAA 3QUZD 5D8JH 1M5WA 5E9DD 9RUBA 3UBGA 4I2XB 5FF6A 5IJVA 1EJFA 2EZ0D 1R6VA 3KLHD 1P4IL 3ABXA 1CLYL 3EX2A 1JPIA 3C2YA 3AXMA 1MAJA 2K1MA 4C91A 5IJDC 1TMLA 4G7QB 3KHDA 1MCPH 3QH2A 2FBOJ 3K2IA 3WS6A 3KVMA 3DI0A 1VD6A 2DJXA 2E5BA 4QO1B 1BECA 4HAFA 1YEKH 3S5OA 1AMXA 1ET8A 2OTWB 1WVZA 4B97A 5JMOC 5TF1L 3NQEA 4AJWA 5I0WA 3VW3H 2A3HA 1ZHLB 4DP9X 4AWEA 3NPXA 3ZLQC 1IAIH 3VMPA 1TFHA 1MRQA 3PN8A 1J1XH 2XETA 2LLGA 1K72A 5F89A 1OZMA 4LQ1A 4WO4B 2OP4L 2BGQA 4YIWA 5J3HC 1MRCH 5L88H 5LBGA 1CX9A 4HF5L 5DZVA 4Y8FA 1VESA 4XBGA 5AW5B 2P88A 5CBAB 1MQRA 4U0RB 1JDDA 4XMVA 3DGDA 5L6YH 1JPTL 1RVFL 3RILA 1MCRA 4U1GB 5IB2A 1KTBA 2QDVA 4CN4A 2IOOA 3S3CB 4N6EA 3F64A 1AHKA 5HHPB 5FECB 4DF0A 3DMMC 2CZFA 2HWZH 4N4PA 3R11A 1Y0LB 3UYPB 4FNRA 3NXLA 3F7RA 2YK1L 3T2NH 1NPNA 2XKUA 4HMNA 1IL1B 5DRXA 3RVUD 2HP4A 3GHBH 5DZAA 1W54A 1WTGT 2X70B 2IQ9H 4HWEH 4AMWA 2UY6A 2A3CA 3CQFA 3OB0K 5DRNA 1RU9H 4DVOA 1V02E 1WJ3A 3ARTA 5I6XC 4EIBA 3TTQA 4JGUA 3SFWA 2ZKWA 3AMDA 2Q3OA 4Q6IC 5I1HL 2Z1VA 2WXOA 1TIUA 5J11C 1N59B 4P2QA 4KTDH 2LV4A 2Q8BL 5MEND 3TURA 2AXFA 2HTLD 1I7UA 4OV5B 3WXVH 3HQ1A 4B5NA 4CQ8A 2VYRE 2I56A 1SHXA 3PS6A 2HV5A 2Z1SA 3W27A 2XZCL 3UTTB 3NVTA 3QEQE 3HCVB 1HKMA 4ODVL 2WINA 1OT1A 2H26A 3KRSA 2P8LB 3DG6A 2P5ED 2G30A 2A9BA 4HH8A 4JKWA 2AVFA 1MNZA 1X7QA 3LK6A 4ZDHA 4M5YH 3RYMA 1KFLA 5KZCD 3KTXA 1U8KA 3FQRB 1K6QH 1LO3L 5DDHA 4BCEA 3HBQA 5FS5A 1NIBA 3ARBA 2A1YA 4IUGA 4K7PX 3RJOA 1E4HA 3MRPB 4JKLA 3DFQA 5DR5L 4NY2A 4MS8C 3T1GA 4ZD3H 4L4OA 1ISYA 4PJCA 2CHXA 4ODUB 5SWSB 1JPST 4LVOC 5IP4A 3A5VA 4JFSA 2A0NA 4Z77A 4JFED 3T0ED 1YEHL 1NFBA 2XWDA 1JNEA 2QPEB 4MNGB 2EG6A 4OQTA 2OW7A 3QWRA 4IMLB 3UFIA 2ZYRA 4G6AD 2PLCA 4RAUA 1FP9A 3AZUA 3SKJL 2JB5H 5C0BA 2Y7GA 5HATA 1J0JA 4U49A 5HYSB 3D3VA 1KGCD 5KYWB 1FRGH 1Q72L 2CIIA 3CSBA 1E65A 3QPXH 3H7UA 4YMZA 4G71B 3WK2A 3TTSA 3LEVH 3W1RA 3KL0A 4HZ1A 2P24B 4H7VA 3BICA 3NJNA 3TW6A 5JBDA 1X7FA 3NAVA 2QGYA 3TBWA 3CAKA 2V5RA 3EJPA 2FFCA 1B4LA 2FH8A 2FE0A 4AIZB 4Y2DD 3ME0A 5D7HA 3IRPX 1MCFA 5F3FA 1YPZF 1QR1A 3STFA 4ES8A 2QQLH 4R7NA 1PKOA 5I1DA 1CYWA 3KXFA 3VA6A 3G0XA 1DQQB 5E5LA 1YXCA 3BQUB 5JPNB 1SQMA 4JM4L 4LUSB 3VUSA 1GGIL 4XHQA 1FFNB 4FABH 4EDWL 4Q3MA 2QJMA 3EF4A 5D7JA 4ENED 4Q89A 1QHQA 1AAJA 1KB5B 2CO1A 2JLPA 3RPIA 3VXRE 4TS6A 2PA6A 1JNHA 1EA0A 4ACZB 2YR1A 2OJEA 1A4JA 2W9LA 3R89A 4GRMA 4UTHA 4DQOL 4R96B 5KG9B 3O6DA 3X1FA 3JW7A 4U4BA 4HETA 3T7VA 1PLBA 4MZYA 2H8ZA 1DFBH 3SJVE 4JVPA 1DXEA 5C6WH 5IQOA 4JFFE 4O4VA 5IM7B 2WUCH 5JPMC 4UIKL 4PJHA 5LA2A 4D9LH 1TLKA 1PJWA 3UTPE 3CN2A 1F05A 1QRNB 1L9MA 2YCKX 3P2BA 2XFWA 4Z0BL 3P14A 5BOJA 1MFVA 3DVIA 3ERXA 5AUMB 4DJED 1OK6A 5KWYC 3WLKX 1Q38A 4U3SB 4L5FE 5A7EA 2ZBTA 2JKWA 1ZTXE 5CEZL 5IJKC 1U5HA 3NL5A 4WV1C 2CA3A 2AGKA 1T03H 5AKTA 4GPNA 3B9OA 4KMQA 3CBRA 1LO2L 2J8UB 3NQ8A 3CJJA 3LV3A 5GGVL 1A8ZA 2AGJH 4DO7A 1SGKA 2J75A 4PBDA 1V6XA 2JQZA 2V5BA 1YEIH 2IS7A 1EXUB 3UO1H 4PJ9C 2VRJA 1TV5A 2DZXA 2CPUA 1BQHB 4JICA 2AV1B 4O0QA 2R83A 3FXYA 3BUIA 3WDHA 1IKFL 1U22A 2DIBA 3G6AB 3VD0A 3TZFA 5FEWA 2J1WA 2XCMC 3A6CH 4FF5A 5KETA 2AEQH 1T83C 1V05A 3SGDH 2ZCZA 4ZXBA 1NFDB 1UCBL 2UX7A 4GXWA 3NA9H 1VFSA 1OARL 3QUKB 5DVLA 3QG7L 3QDGB 1MHCB 3AU2A 3OB0H 2FATL 3REVB 5H37A 1NGQH 4QISA 3GZ3A 1FWTA 2HJKA 1MFDH 4M62H 2N7SA 2W59A 4Y2LA 4AITA 5MP6L 4YIQB 5I0VA 3B4YA 1JZ7A 3RMJA 3ZE0B 4L4TD 1A8JH 4S3FA 1B4JL 3G8EA 4XAFA 3TN4A 1C08A 4HFWB 4C6DA 3BAKA 2VHLA 1R3KB 5I1LA 1TPWA 5AWNH 4IX2A 1QI3A 1PL3A 5T5FH 1MLCA 5AVTB 1CS6A 2QGHA 2ZAHA 5MERB 1PIFA 3X17A 3BEVB 4ZI8A 1EXHA 3IMBA 5BWAA 2WQ8A 1G7PA 1HDMB 1T1XB 4A7VA 1DKWA 3PHAA 4WW2B 4WY0A 1J0ZA 1OCBA 2DQMA 1B30A 3WLWC 4LLDB 3L5HA 4G8GB 3ZIZA 3HNVH 2B0SH 1YPFA 1Q94B 4I89A 3MHFA 2WQVA 6REQB 2ZXQA 1E6OH 1UM6H 2D4DA 1G7JA 3U46B 3C8DA 2I57A 3WUBA 5FWQA 3H9YA 3MRNA 3MA9L 4OIBA 3ECQA 4BQ5A 5I8CB 4GY0A 4CNTA 2VDQB 4LDLB 2BY3A 3HR5B 1L6ZA 1QUNA 4J8RA 4X80L 3O4LA 1ASOA 4BQBA 3E6HB 4WRHA 5I9QB 1DHKA 4NQDB 4RNRA 3BKYH 3WSUA 3U48A 2VCBA 3ZLGA 3MRLA 2GEEA 1Z69A 2AL1A 4AZ5A 1RUAL 4H26A 4R26H 3DV6A 3R1ZA 3RM8A 3I6KB 5IMLA 3O16A 1ONQA 4QRSB 4NN5B 3TT3H 2DV6A 2XBDA 4J2QA 4HNUA 3GS4A 3QEHA 1HP4A 2EXYD 1O66A 1M41A 4ACTA 1FZOA 4A3YA 2WBJB 5GGTA 4D94A 1MXGA 3EJRA 3L5XL 1MHPL 3V9EA 4PMVA 1WYIA 4KQ4H 4M1BA 3PM6A 3DPBB 1OM0A 4ALAL 5HR6A 3ZXAC 3PZOA 3VXPA 1BV8A 4X2UA 1IKNA 4P06A 3LN4B 1IYXA 5CKAA 3UXDA 3SEPA 1KJ3L 4Z7UA 3O8AA 5KYUB 2WNZA 3NL3A 1U4FA 2WO3B 3IFPA 1PG7X 3RR1A 5LNEA 2EQDA 3GK0A 1SVBA 3LKOA 4JQXA 4DN4H 1LL4A 4D0DB 1J8VA 1KC5L 4O1DA 2CKSA 3QDJE 5IB1B 4J3VA 2PYED 4KQ3H 3I9GL 1BFVH 4U1IA 4DKTA 5IDZA 1TDQA 3DSFL 5BZWB 3CFDA 3HS0B 5JH1A 3GXFA 1YQ2A 4JKPL 1GYUA 4WU7A 4IRZA 1I82A 4UQAA 4H9UA 1G0YR 1AIZA 4V28A 2MPVA 5DS8A 5CP3A 3ESPA 4JE0A 3G6JF 3PGCB 1A9EA 3KPSB 4KVPA 4P23C 1THFD 4BWTA 1EHLH 4MBOA 1AJ7L 1H2JA 1KIQA 3RQ3A 4AQ1C 1WZLA 3RCNA 4D8PA 3QCUH 3RVXD 1A6UL 4O28A 5KSAA 1D5BA 1D5MA 3CVHA 3JTSB 3GH5A 3BIBX 3MNZB 2X1QA 4JFYA 3M0XA 3LCLA 2OMYB 5HDRA 2XTJB 4LLVA 1A25A 1EQPA 3RU6A 1R0AH 5FKAA 1HH6B 3QZ6A 4QHRA 1ZJBA 4Y1SA 3OHMB 5I19H 1WXJA 3S2LA 3SOTA 3RMEA 3VGEA 3IUHA 3MUAA 3FB6B 3I4EA 4C7GA 4KO7A 5M5DA 2XV6B 3SBWC 1LO4H 4P7NA 2BP3A 3HPLA 1MCIA 4LLMA 3IVSA 3VCNA 4FQCL 1XGYH 1QDSA 4R9HA 5KSUB 3VIGA 2B3RA 5EOQH 1E5ZA 5DRWB 3JWNG 3ZLHA 3EMCA 4P2OB 1SFHA 2NZ9D 4LCIL 2YPLD 3VRIA 3S3DB 1FWSA 2REQB 4X6DB 4WKHA 2CXGA 1AD9A 2JVUA 1UA3A 1VPOH 4DIAA 5ANHA 5HSFA 4NOBA 3LS4L 1HZHL 4GIYA 1BF2A 3FUIA 3TEZA 2V2XB 4ELMB 2PWHA 1MCDA 3QE5A 1MRAA 4FQXA 2VVSA 4WEBL 4R90H 1NGWA 3CH0A 1AW5A 2IGFH 4N6FA 1TZIB 3EGSA 1AA1B 4HK5A 2VKZG 3H2OA 5CF3A 4DGUA 4PIBA 4RGND 1I8KB 2EICA 1ZGLA 5EO9A 3VQMA 3U7YH 4HWBA 3SE3C 1WBXA 2WMIB 4RE3A 1SF3A 1BJ1J 4TOQA 3PJTA 1PKMA 2MH4A 2AJZA 4HOWA 3NDYA 2DQGL 1RJLB 2X9WA 1HCYA 4F1ZA 4O52A 1GJIA 3DI3B 3DPDA 1TITA 2F19H 1Q9LA 2OQHA 5XIMA 4FFVC 1KB5H 3CC5B 3FSAA 2A4ZA 4X7CC 3QPKA 3FULA 3VG0H 5LIXX 5DN1A 4JRYD 2WIMA 2E1DA 3QUXA 1AZUA 3TN0D 2PO6D 4JTJA 1RLBA 3ZKMC 2KH2B 3REWB 1TV3A 5E5RB 4X6CF 4R5EA 2KLTA 2YA2A 1NCCH 1M03A 4MD4A 4PSPA 4QSHA 4XN2A 5GNYA 3CHQA 5E9NA 5DJXA 4PJGF 4OM1L 5HDBF 3LBCA 5F0LB 3GM8A 5E4EB 2VIRB 3UXIA 1NM9A 2H1PL 4ZS6C 2ZKYA 3QI9A 2FHBA 4KWSA 3W3OA 5DFWH 4R5TA 4CW1B 4XVOA 3ITOA 5C0NC 2B1HL 2IXQA 2ISWA 1BZQK 2VMCA 5FO7B 1OP5K 3PWPD 4OLYL 4OV6F 4PRPE 3BLIA 3MJ9A 2PDLA 3GXTA 1AQKL 3UTOA 5EIIB 3ITLA 1TWDA 4QRPB 2FLRT 3HFFA 4LUJA 3TVMB 4ZFOB 3KVJA 4Q7BA 4B9KC 4RNFA 1LWJA 2F7QA 3VACA 3EJYD 3S1UA 1KFJA 2R51A 4OI7A 2V2WA 2WZMA 2ZRVA 1CLVA 1KJVA 1M3IA 1HIZA 4MLJA 2WZ6A 5HD8C 1Y18A 3WNLA 4HIIA 5KVFL 1H3VA 5JR1H 4O58H 2ENYA 1BF6A 1LNUB 2GUBA 3ONBA 4LCQA 5E6IA 3MREB 2WV3A 3CDGB 1H4PA 5ADPH 3ABSA 1UFUA 1AHWA 3OXRA 5K4XA 1SVDA 4OFDA 1HESA 4BI7A 1RZ7H 5GGSB 1H8NA 4JRXD 4M6NH 2ZDSA 1IC7H 2N7AA 2P1FA 4LDOB 3WN5B 3JV6A 5AZEH 2K6YA 1AQ0A 1DQDL 3VG9C 2I24N 2FGZA 3O4OC 2A6DA 3BAEH 2NUTA 1Q8JA 5F9JA 1UKQA 5T1LD 3FONB 1SOQA 1M71B 3N11A 3Q94A 2X4UB 1YMHA 4JFUA 5GGTL 4EPKA 1RCOB 1QYGH 1SN5A 2R4RH 2OYPA 2GJ6B 5PAZA 2AEPL 5A6MA 4MPKA 1YEEL 1JS4A 5A2JH 2VDHA 1AOZA 5DVMA 5FCUH 7CGTA 3RK8A 5LSMA 4UQ3A 4JN2A 5I79A 1QSEE 3KOFA 4MXWH 5D5MA 2X0VA 3S36X 2EEFA 1E9IA 3LOTA 1CFQA 3LXAA 1NF7A 2EDXA 3K5XA 1EPXA 3VD1A 4NZUL 3MCYA 4KVNL 4JQ2A 1NC2A 4MJIB 1XFCA 1KLYA 4XMZA 3MCKB 4PV1C 2HVNA 1NEUA 3VIIA 4NQCA 1SHWA 2OCFD 1JZHA 1T96A 3QRGH 1BYPA 4PJFB 1Y5VA 1SZGA 1R0MA 1XO8A 1UROA 1XICA 4IHBA 1LD9A 1ZWIB 2FVNA 2VDQH 2F54A 3WQPA 3VIFA 3T2LA 3WKPA 4LT9A 2CR6A 2FAUA 2MNWA 4WKZB 3P5YA 2ZFAA 5A95A 4A2LA 1QPOA 2TYSA 3EKGA 2DM3A 5ESAA 1HL2A 1WKYA 3I4KA 1MFBL 1Z9PA 3B8UA 4S2BA 4J39A 3MHUA 4I5UA 1E7UA 5G4HC 4HSCX 1J8HD 4YVPA 3PFQA 2JIXA 2HROA 3UC0L 4JN6A 1E0OB 4ZFZA 4PRNB 4F27A 3WKYA 3JBG7 3IU3A 3CBKB 4M8QA 1K7XA 3BWUF 3MODL 4A21A