3AJ7A

Crystal structure of isomaltase from saccharomyces cerevisiae
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
586
structure length
586
Chain Sequence
b'SSAHPETEPKWWKEATFYQIYPASFKDSNDDGWGDMKGIASKLEYIKELGADAIWISPFYDSPQDDMGYDIANYEKVWPTYGTNEDCFALIEKTHKLGMKFITDLVINHCSSEHEWFKESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSYFGGSAWTFDEKTQEFYLRLFCSTQPDLNWENEDCRKAIYESAVGYWLDHGVDGFRIDVGSLYSKVVGLPDAPVVDKNSTWQSSDPYTLNGPRIHEFHQEMNQFIRNRVKDGREIMTVGEMQHASDETKRLYTSASRHELSELFNFSHTDVGTSPLFRYNLVPFELKDWKIALAELFRYINGTDCWSTIYLENHDQPRSITRFGDDSPKNRVISGKLLSVLLSALTGTLYVYQGQELGQINFKNWPVEKYEDVEIRNNYNAIKEEHGENSEEMKKFLEAIALISRDHARTPMQWSREEPNAGFSGPSAKPWFYLNDSFREGINVEDEIKDPNSVLNFWKEALKFRKAHKDITVYGYDFEFIDLDNKKLFSFTKKYNNKTLFAALNFSSDATDFKIPNDDSSFKLEFGNYPKKEVDASSRTLKPWEGRIYISE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Oligo-1,6-glucosidase
publication title Crystal structures of isomaltase from Saccharomyces cerevisiae and in complex with its competitive inhibitor maltose
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 231
structure length 586
sequence length 586
ec nomenclature ec 3.2.1.10: Oligo-1,6-glucosidase.
pdb deposition date 2010-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3aj7A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3aj7A01
3.90.400.10 Alpha Beta Alpha-Beta Complex Oligo-1,6-glucosidase; domain 2 Oligo-1,6-glucosidase; Domain 2 3aj7A02
2XM2A 1XGZA 1BLIA 1CTNA 2WVVB 3BGAA 3SCPA 1R46A 1XCWA 4M8UA 1XH1A 2D24A 4PYSA 2W66A 3TTOA 1A3HA 4GO9A 3WSUA 2X1IA 2WZEA 4UCFA 2EPMX 2WVUA 3SIMA 3SUSA 3VOCA 3CHEA 5D9MA 4ZENA 2CPUA 3CC1A 2E8ZA 2PC8A 3K4DA 3WEZA 2QPUA 3IJ8A 1JL8A 4JKKA 4OUEA 2OW7A 3NSMA 1BHGA 3CTTA 3GXNA 4UZUA 1HKKA 5C8BB 3IGUA 1GNXA 1HP4A 4D71A 1DWJM 3ARSA 4GZJA 4UFLA 3CUJA 2GJXB 2V38A 3D4ZA 4JAWA 3BUPA 4YHEA 3AMKA 2XFYA 4Q22A 4TOQA 4PEEA 3GNOA 3GNRA 3B9AA 3VMNA 3AIUA 1TQTA 4UR9A 3ARPA 3AHYA 4FMVA 4P7LA 2X2IA 2CKSA 3A4XA 3PZVA 3WUFA 4CCEA 2JEQA 4KRTA 2J7BA 4A4AA 2J79A 2WVTA 4UNIA 3ARXA 2WSPA 4EK7A 1UR2A 1CGYA 4XUYA 2F1BA 1VEOA 3H53A 3PZGA 2CERA 3T0DA 8CGTA 3VX1A 2J8GA 1F4AA 3W25A 1R8LA 4J28A 4E8CA 2VZTA 1TQWA 1BYAA 4GIAA 1EQPA 1CXEA 4H2CA 4FLSA 1KGXA 4JCLA 3CLWA 1OB0A 3G6MA 3LPFA 3BLPX 1UOKA 3ARRA 1HXKA 5JBEA 4BQ4A 2QHAA 4TTUA 1KB3A 3UG5A 1X6NA 5HDRA 1E6SM 2JEPA 4TVUA 4JKLA 4FNRA 1M03A 3D4YA 3IJ7A 1OGGA 5I23A 3GNPA 1W3LA 3PZTA 3WQ5A 2UY3A 2EEXA 4WLCA 4GZIA 5I2UA 2ZXDA 2O9OA 4DO6A 3W81A 1GQKA 1WDRA 2DH2A 1GOWA 3T2PA 1JZ4A 2WANA 3T0AA 4JFSA 1JYWA 2XYLA 3ZSSA 2G4FA 2GK1B 3ARTA 3AJ7A 3AXHA 4PMOA 1UD8A 1H5VA 5A3HA 2EPNA 1HP5A 5D8ZA 3EDKA 2WZIA 1CXHA 1VFFA 1UQZA 1Q6DA 1JDDA 1UKTA 1U30A 1QBAA 5DF0A 2G3MA 3RMEA 2YLLA 3WD2A 1ODUA 1UH3A 3VDAA 1JNEA 3KL5A 1E9LA 4UOZA 3A47A 3WH7A 3U5UA 5D9NA 2Y4SA 3BAYA 1SFSA 1EH9A 2J7DA 1NWUA 3A22A 3WY3A 4DWSB 1V0KA 3HN3A 1JI1A 1FFRA 1LJYA 2WK2A 1G0CA 3ZMRA 1GVYA 1W91A 1PIGA 3CMGA 3CZKA 4GI8A 3D3AA 5IDIA 4PMQA 2CNCA 2EQDA 1LG2A 1QI2A 2XUCA 4P7QA 4BQ3A 3EJPA 2FGZA 3GTNA 2WMKA 3AMCA 4V2XA 1MYRA 1XCXA 1PJ9A 2CIPA 3WIJA 5IHRA 3EYPA 2FHFA 3M7SA 4OZOA 2QMJA 5FKYA 3RJYA 1BGGA 3GH7A 2JE8A 1JAKA 2J7FA 3MMDA 3VO0A 3HMCA 1E72M 3VIOA 1W2VA 3GM8A 3WMCA 1ESWA 1UKSA 2YL8A 2XM1A 1VB9A 4JFWA 2QV4A 2BHYA 1ZBVA 4H7VA 4MNKA 4GI6A 2D0HA 1BQCA 3DHPA 4HZ7A 4N42A 3VNYA 2J25A 4LYRA 2OSWA 3EJUA 2WHLA 3VD5A 1ODZA 1UD2A 4QLLA 4AD1A 1GOQA 2DSUA 3L4VA 1E43A 3MI6A 2CKRA 3FY1A 2YA2A 5M5DA 4U5KA 1CGVA 1V6UA 5DT5A 1K9EA 4P8XA 5ABFA 3SUWA 4AISA 2WKGA 2ZXAA 2ZUUA 2WVSA 1JZ2A 2XJ7A 3FXYA 4PUDA 3BUBA 1AMYA 2V3DA 3HG2A 4JL2A 1KXQA 2BVDA 1UR9A 1T0OA 3EDJA 4FNQA 2VVNA 2XFRA 2BHUA 5LA2A 4B3LA 2O9TA 2JFEX 3POHA 1ZU8A 4P7RA 4CCDA 1QI3A 3KZSA 2JALA 3IANA 4W7WA 3L2MA 3WFLA 2ZIDA 3VSUA 3AIQA 3GBEA 4JHZA 4QCEA 4HOXA 4ZXOA 3OLIA 3TV8A 3WY2A 1VFMA 1LL4A 1JNDA 1E0WA 3ECQA 3W27A 3VINA 3IAQA 1VIWA 1ZS2A 3AIVA 2ZUVA 5CPQA 2VCAA 1L8NA 4FF5A 2VZOA 1V6XA 4IPNB 4PSRA 2EJ1A 1C92A 3WELA 4MADA 3U7VA 3AS3A 4PMRA 1QBBA 1QHZA 4W5ZA 4R27A 4CUCA 4DO5A 1B31A 4V28A 4KWUA 3CBWA 3VD7A 1NWTA 1VFUA 4HA1A 3F5KA 3ZJ7A 3EDEA 1CXLA 3AIBA 4P7NA 1V02E 1NOFA 3AHVA 4X0NA 4GXPA 4JKMA 2DH3A 2CITA 1WAWA 3CUIA 4AYSA 1ZL1A 4PTVA 4W8AA 1ZB5A 4UFMA 4NXKA 5GNXA 3DDFA 1EDGA 3L4WA 2ZUMA 4TVCA 1V3LA 1D7FA 4LYPA 1DWIM 5A2BA 2F18A 4WJXA 1TMQA 2ZUSA 3UG4A 3CIVA 4BQ5A 2XGBA 1JGIA 5A6AA 1WNOA 1QNOA 1NOWA 2GSJA 2RGLA 5GQBA 1WB0A 4PBGA 2ZXQA 1JG9A 1EDQA 2V3GA 2RGMA 3DC0A 1I1XA 5LA1A 3VIGA 2PWGA 2ZX9A 3OG2A 5DMYA 3UERA 3GXPA 1UR4A 1NP2A 3WQ8A 1ZBKA 3N11A 2YKKA 3WH5A 5A8MA 3AHXA 3VIFA 3LRKA 4PSPA 2DPEA 2WMHA 2WCGA 3ZR5A 1E56A 1UUQA 1TA3B 1KXVA 2CCRA 1HKMA 3MMUA 1VJZA 1B3XA 1E6ZA 4K68A 3M46A 2J7EA 2BY1A 1AQ0A 5ABEA 4OGZA 2GJRA 1XHGA 5HXMA 2YA1A 3BLKA 1JD7A 5CQ1A 3WDQA 3WD4A 1EO7A 4AD0A 4HPGA 1H49A 3ZT7A 4PMVA 1U33A 3SCTA 4PMYA 1UWSA 4B9YA 3WF1A 2YL6A 4X0VA 4FLRA 2FE0A 2XN0A 1F4HA 4UOQA 4PRWA 5AC4A 3LX9A 2ZOXA 3VTRA 4CVWA 4DM2A 1FOBA 4UTFA 1A47A 4MNLA 4Z2KA 4AMXA 3PBGA 3ZT6A 5E09A 5A8NA 1G1YA 1EHAA 4OOZA 1EO5A 2CBIA 3CV5A 3RM8A 2ESCA 1JXJA 1HT6A 1UH2A 1WZKA 2WW5A 1GUVA 4U2ZA 7CGTA 1GQJA 4HPHA 1V02A 3DX4A 1JXKA 1BYDA 1S46A 1BAGA 2W62A 4FNSA 2PI6A 3BVTA 1HKIA 3WH8A 3N18A 3PTMA 3WMBA 1H09A 2UY4A 1UWQA 4AIEA 4F9JA 4CD6A 1H0GA 3LPGA 3HJEA 5GNYA 4HP5A 2CXGA 3AZRA 3RDKA 2YJQA 2F7PA 4NF7A 2IXUA 3RPMA 4KGJA 1E6NA 2E3ZA 3W38A 3ZJ6A 3WNKA 3F5LA 3OLEA 5EFFA 1R33A 3BUIA 2CBUA 4MB5A 2F7QA 2NSXA 5A6MA 2IGTA 3GDBA 2WHKA 1BPLB 1J0YA 4W8BA 1W32A 1OSEA 4W7UA 4YHGA 1US2A 4M81A 5JBFA 1MW1A 2Y2WA 3WNOA 2ZE0A 3AXIA 3A24A 4CD4A 2VR4A 2OWWA 3VMPA 2VRJA 1E4NA 5A8OA 1VENA 4DM1A 1UWIA 2F1AA 1HJQA 3ZT5A 4GKLA 3MUZ1 2F61A 3BSHA 2PWEA 1GOKA 5JIPA 1LL6A 3A21A 2WPGA 3ZQ9A 2Z1KA 1WCGA 3OLGA 4L4OA 1NOUA 2NT0A 1CLVA 3DX2A 2FHBA 1DEDA 3LRMA 4AW7A 2YL9A 6CGTA 1JZ3A 3D5HA 3EBVA 4C7FA 3VSTA 4AEEA 4UQDA 3WMSA 4QLKA 3I3BA 4UQCA 1IV8A 1W2PA 4CU8A 1CLXA 2ZUNA 1CGTA 1R7OA 1V3IA 2VI0A 3TONA 1JZ7A 1QNPA 4P8WA 1H41A 2WCSA 4D6HA 3NYDA 3VIKA 2Y8KA 3RILA 3VD9A 2XIBA 5C71A 1KCLA 1I1WA 5A6SA 2VR5A 2D23A 1DWGM 3S6TA 3W29A 2JF6A 3U5YA 5M17A 2UY5A 4WKAA 3WQVA 2CETA 4FLOA 3N12A 4U33A 4D1IA 3WNPA 1VBUA 4ACYA 1FHLA 1UKOA 3WD0A 3VGEA 3KEHA 1E73M 1C8XA 1B1YA 1J0HA 4M56A 4J7RA 2OWXA 4AZBA 1EOKA 4QDMA 3ALFA 3AHTA 1B90A 1DHKA 4BA0A 3WDPP 1BYBA 3THDA 1H1NA 1V6YA 3BAIA 2PF0A 2W67A 1W9XA 1JF5A 3WY4A 2YFNA 1W3HA 2DGAA 2E0PA 2BVYA 3VIMA 2Q8XA 4CU7A 2VURA 2W4XA 2ZXBA 1I75A 5F7UA 2YL5A 1V3JA 1NM9A 3B9DA 4YN5A 1UR0A 1CZ1A 3GXFA 3EDDA 1EIBA 1WDPA 2XIIA 2ZWYA 2VQUA 1UH4A 1GORA 3POCA 1YHTA 4FNTA 2E40A 4AZGA 2EADA 2WKLA 4DWSC 1H0IA 4MNJA 2PBGA 3HG3A 3GYCA 3MUAA 2DT1A 4CVUA 3BAWA 4TX6A 4D6GA 1C90A 1LF1A 2VZVA 2D0FA 3CZSA 1CXFA 2CEQA 3T2QA 5BXSA 3AS1A 3PZMA 4ZXLA 2BXZA 3M07A 3ARWA 4HMDA 3II1A 3AZTA 5D9OA 1EA9C 1UHVA 4ATLA 3MANA 3CPUA 1E4LA 1JZ6A 2VX4A 2XFFA 3DDGA 2G3IA 2VUYA 3W0KA 4KMQA 3N13A 5IFPA 4OKDA 5IXEA 1NP0A 3NCOA 1PX8A 3VMOA 1ISVA 1B3YA 5BYWA 4M1RA 3WQ6A 3H54A 2V3FA 4AC1X 4NRRA 1G5AA 4A3YA 5CSUA 1QVBA 3MKKA 2DSZA 4EANA 4F9DA 3VGHA 1CDGA 2YOCA 3WNLA 1J18A 1V6VA 2HVMA 4J3VA 1OD8A 1M04A 3AICA 3WF0A 3OGVA 4PMXA 5CLTA 3CHDA 1DTUA 4AD3A 1TVNA 4AY1A 4UQ9A 3WDJA 1KTCA 3VGDA 5EFDA 1U2YA 3N9KA 2DQXA 4ACZA 3HU7A 9CGTA 4MPKA 2A3HA 1ISXA 3OGSA 4AEFA 3OLDA 1C8YA 1R75A 2X0YA 5ABFB 1ITXA 1SYTA 5HNNA 4PN2A 4C7GA 5HPCA 1GPFA 1E70M 3VU2A 2D3LA 1EQCA 3OZOA 1B3ZA 1M53A 2WYSA 3EMZA 2ZX6A 1R47A 2EXOA 1OIMA 5LA0A 1J01A 2EPOA 3ARZA 2J7GA 3U7BA 2D2OA 3KLKA 2J47A 1CECA 1GOOA 3K8LA 2YBUA 2OYLA 3T09A 2XTKA 1HKJA 1PEZA 2V5CA 4QCFA 1UZ1A 3K4AA 2WC3A 4N0RA 1Q6EA 2BV9A 5A6JA 1CEOA 4WIWA 1UWTA 4TX8A 4PCTA 3BXWA 2XN2A 2W5FA 4B16A 1FA2A 1UG6A 5A1AA 4W88A 2PWHA 2WHMA 1E5JA 2ZX7A 5CGMA 4GPNA 3AIWA 1WDQA 3AYSA 1KGWA 3LXAA 5CGTA 1G9HA 2WBGA 3VD4A 3A3HA 4W5UA 2OYKA 2QPSA 2NW0A 3SUVA 4MB3A 2DIEA 3QHOA 1D2KA 1KFWA 3PN8A 2CBJA 1US3A 1E6RA 3WQ4A 3DECA 2JIWA 1HVQA 2WWDA 1BVZA 1Q4NX 1XH2A 3NIYA 1LLOA 4DUWA 1G94A 1TR1A 1R7AA 2VX6A 1BG9A 3L4ZA 1HTYA 3BAXA 1EXPA 3DYOA 4DWSD 4HOZA 4FNUA 3MV11 2FGLA 4MJ4A 1TZ7A 4HMEA 1E1EA 1M7XA 2VO5A 2A3CA 3B9EA 5I5RA 2PWFA 3GXIA 1E0VA 3BAKA 3AZSA 1XRVA 4AZCA 2X8RA 3CGTA 1QNRA 1BGAA 1HX0A 3F4VA 2VL4A 2VZSA 1OGBA 4XV0A 3EJRA 3VGBA 4J3XA 2XWEA 3OIHA 3EMQA 4UOJA 3D51A 2HISA 3GXTA 1J9YA 4AMWA 4PMUA 5JBDA 3AIEA 7A3HA 1V0LA 1DWFM 3BCDA 1TG7A 3TA9A 3VD3A 3WL0A 2ZUTA 3PHAA 3IJ9A 2QLYA 1KXHA 4W89A 1E6XM 2DSVA 5FD0A 1HJUA 4U5IA 5A6LA 1FHDA 1JDAA 1FP8A 1GQLA 1GJUA 3KE0A 3CZNA 2VQTA 1JYXA 3H55A 5E0CA 3GH4A 4NZCA 1K9DA 5IHSA 1V0NA 2VC9A 4M80A 1Y7VA 3WDRA 3VIIA 3I3EA 3UR7A 1IZKA 1J12A 3AOFA 3CMJA 1KGUA 4NI3A 3SUUA 1XSIA 3S5YA 4PMDA 2VOTA 2FDMA 3QOKA 2VRKA 4OJYA 3WDIA 4QLJA 3O2LA 2WC7A 2YDSA 4L4PA 1HJSA 1PX3A 1W9BM 3APGA 2WBKA 4MJ2A 4PMZA 3NSXA 1JZ5A 5HPOA 5CPTA 2CESA 3N04A 3W26A 1QI5A 4UZSA 3MU7A 1W9DM 1OM0A 2VNCA 3KL3A 3KWXA 4WF7A 2WWCA 1IT0A 1LWJA 1OGSA 1V6WA 1UD4A 2E9BA 3CUFA 4U3CA 2WMIA 3O9NA 3GXMA 5DFAA 3TTSA 4HZ8A 1PX4A 3SCNA 1CENA 3N17A 3BVUA 2VZUA 4Z2HA 2VVSA 3AQUA 2AAAA 2WM0A 3FN9A 1CPUA 1RPKA 3FHAA 4Y7EA 3MUY1 4BQ2A 2EO7A 3VKKA 5EBAA 3OBAA 3CZGA 3WF3A 4W8LA 5ECUA 3IK2A 1LQ0A 5I3DA 2VRQA 1V3KA 1GQIA 3K8MA 1R34A 3M6DA 1V3HA 4GINA 3B8SA 4X9YA 2WHJA 4Z2LA 3TTYA 2D1ZA 3EJSA 4RL3A 2ZICA 1UD3A 4E4PA 2BHZA 2A3BA 2PBOA 4B3KA 1RD6A 1LWHA 4W86A 4Z2GA 1O7AA 1UKQA 1PZ2A 1UA3A 3BC9A 1HF6A 4HMCA 2Y24A 3WEOA 4MAZA 5A94A 2C8NA 1JYNA 4M24A 5AC5A 1AVAA 2OYMA 3A6OA 5I0DA 3LPOA 3DYPA 2E8YA 1TE1A 2Y5EA 3CO4A 3DYMA 4D72A 1EOMA 1VRXA 2X2HA 2DT0A 3NDYA 4M29A 1KBKA 3WF2A 4A3HA 3CZLA 4DUVA 2YFOA 4U2YA 2X0HA 2YDQA 3TP4A 1E6QM 2ALWA 2DSWA 1E15A 5HOSA 2D3NA 1HJXA 3OZPA 1QI4A 3ARYA 1BF2A 2XWDA 4NXSA 3K1DA 1KWKA 3VIPA 1NQ6A 4URIA 4F66A 1HJWA 3PTKA 1HL8A 3VUPA 2BY0A 2BNJA 3E1F1 5A8PA 1TFVA 3D52A 1SMDA 2GVYA 3CH9A 5D9PA 2GUYA 1OBAA 2GFTA 4WK9A 2EPLX 2WMGA 1XYFA 4OIFA 3PZIA 4D1JA 5M3WA 3WD1A 2J75A 3OB8A 4GQRA 5BCAA 4BS0A 4HOWA 5JUVA 3NDZA 1O6IA 4HA4A 4PTXA 1MQPA 3WUBA 1OT1A 2CHOA 1EGZA 5TD4A 2VTFA 3F5JA 1J11A 2XN1A 3W6LA 3MSGA 1UQYA 2XGIA 3OGRA 2VCCA 3MSDA 1R85A 1E5NA 1B9ZA 3RIKA 3A5VA 1SZNA 4H8VA 3L4YA 4BZYA 1MXGA 6TAAA 2YIHA 2Y8VA 1OINA 1QWNA 3NUKA 1FFQA 3N15A 3O6AA 5FL1A 3GBDA 5C70A 3AHZA 1NARA 2TAAA 5ABGA 1CXIA 4H8UA 3LPPA 2BXYA 1N82A 3SCVA 3FNDA 2J7CA 1KBBA 5A2CA 2JF7A 4CCCA 4EAMA 1TCMA 4PTMA 5DO8A 3KL0A 3SCOA 1W1TA 5FOOA 3UESA 3W82A 3W4RA 1DWAM 1J0IA 1W3JA 3K46A 4D6IA 1K9TA 1ZBCA 3VNZA 4D6EA 2F8QA 5E1QA 1V03A 4R5EA 4S3JA 3BSGA 5LYRA 3PZ9A 2G8ZA 1KQYA 5A6BD 2DIJA 3W37A 1E55A 3JUGA 4H41A 4AZIA 3DX1A 3WENA 1MW0A 3WUEA 4MDOA 4HU0A 1W9UA 3UETA 2W63A 3BLBA 4LPCA 1X1NA 4PTWA 3U57A 3BCFA 3WD3A 1JAEA 2F7RA 3K8KA 2OW6A 3VIJA 3AMLA 3VSVA 5E6YA 4LXFA 5ABHA 5I78A 5DEZA 4JHOA 5E70A 3CZJA 5GNZA 4ML4A 1KQZA 1QNQA 1JF6A 2AOSA 2C0HA 2WC4A 1W9VA 2PWDA 1XC6A 4MAVA 3GH5A 3SEPA 2E4TA 1CWYA 2X2YA 3RJXA 3RO8A 1ZBWA 3MV01 4AZ6A 4AYGA 5FIPA 4UFJA 3UR8A 4JFTA 1EHNA 2XSAA 2WLZA 4DUXA 3WNNA 2D73A 1HJVA 2Z1SA 1C8QA 3SCWA 4AD4A 4TXEA 3T0BA 4CN4A 2W91A 4GO8A 3T2OA 1H2JA 2UY2A 1GHRA 4LQ1A 1PS3A 1Q6FA 4ATWA 4P8VA 4ACZB 2WZHA 3EJQA 4CGTA 5I79A 1JI2A 1QW9A 3AISA 1UZ4A 1XD0A 2D20A 1ITCA 5A6KA 4U31A 4J27A 2WVVA 4C7DA 3W28A 3SCQA 1W3KA 4W87A 1RH9A 4MB4A 5A95A 4BF7A 1K6AA 2IUZA 4UFKA 4AIOA 1KTBA 2VCBA 1JD9A 3ARVA 1QW8A 4AMCA 4GZEA 3BMVA 4WKHA 1GJWA 4H04A 3RCNA 1WP6A 4FLQA 1CYGA 1WO2A 4J3UA 2ZX5A 1NWSA 3SURA 3FW6A 1WZAA 2E9MA 5I24A 3MS8A 2GJXA 3HG5A 3AFBA 1VF8A 1UASA 1E71M 3THCA 3A23A 3A4AA 5BRQA 3EJTA 1WZLA 1FP9A 1DWHM 4HZ6A 1TUXA 2FH6A 3I3DA 4FNPA 4LX4A 3AROA 1JYVA 4NRSA 2BVTA 2EBNA 2X2JA 1VFOA 3ZJKA 2XVGA 4W85A 2WMFA 2XPKA 1LL7A 4GI9A 3SCSA 2F7OA 2D0GA 5CG0A 1E4IA 2OWCA 4W93A 3PZQA 2YDRA 3WBEA 4MDPA 3KLLA 5BRPA 3WH9A 3VM7A 5E9AA 1C7TA 4H8HA 7TAAA 2WSKA 2WCAA 1RP9A 1MQQA 4J3TA 2EABA 2XVLA 1XSJA 3QGVA 1QNSA 3RM4A 4KH2A 1P6WA 4PMNA 2G41A 1AQHA 1QI0A 2XVPA 2WAGA 3QOMA 1EDTA 2FYVA 3ZOAA 1QPKA 4AZCB 1E6PA 4RE3A 2YLAA 1MWOA 3AI0A 4IISA 2IXVA 2C7FA 3UEQA 1MXDA 1GCYA 4AWEA 3VDHA 1W9PA 3ALGA 1GOMA 3BVWA 4AXNA 3D50A 3SCRA 2GK1A 1CGXA 3BUDA 4KRUA 2JIEA 1UR8A 1B3VA 4AZ5A 4PCSA 3MUIA 3L4TA 1E3ZA 3FAWA 2XG9A 3QHMA 4NSBA 3ZJ8A 2UWFA 4FK9A 1V0MA 4Z2JA 1QX1A 1CGUA 1ISWA 1C91A 1PZ3A 3UCQA 3LMYA 2VJXA 4OOUA 1OT2A 4IPLA 2VT0A 4PUEA 4JIEA 3VDBA 2VMFA 4Q7NA 2X09A 3TTQA 1GONA 1OIFA 2D22A 3SUTA 3LXBA 5AY7A 3WY1A 2WLYA 1OCQA 4RE4A 4W7VA 2EACA 4DWSA 3AMGA 3DHUA 1XYZA 1C7SA 2B31A 4M82A 4WKFA 3DX0A 2BY3A 5BWFA 4WSJA 3WL1A 3IAPA 4P8UA 2VX5A 3A4WA 1QHPA 2G3NA 4JCMA 4BCEA 5CZKA 5CXPA 3HZ3A 4AD2A 1AQMA 4ZFMA 3CHFA 1H3GA 1ISYA 2J8FA 2BS9A 2WMJA 1E0XA 1Z32X 3HG4A 1XSKA 1WDSA 3L4XA 1V08A 2WMIB 4E8DA 4UFHA 2AMGA 1HL9A 2WNWA 4DO4A 3WDHA 3AMDA 1JIBA 5FCZA 2QMKA 1HIZA 5A8QA 2J4GA 2OLHA 1BFNA 3AIRA 4HU8A 8A3HA 4ZE4A 1SMAA 3BVVA 1BG4A 4AD5A 3S5ZA 1ZJBA 1J10A 3MO4A 1G01A 5CLWA 5CPSA 1CIUA 4F8XA 1KXTA 3VPLA 1BYCA 2YA0A 1B0IA 3CZ8A 3VM5A 1HWWA 2J62A 3G6LA 1KCKA 1WPCA 4AZHA 3EMCA 3ARUA 2CYGA 1UD5A 2O92A 1JDCA 1PAMA 3WQWA 1O7DC 3AS0A 1CGWA 3N1AA 2X05A 4E2OA 4TTGA 1B30A 1K9FA 1CXKA 1UWRA 1CBGA 2ZWZA 4NZFA 1D3CA 1ZJAA 1KR0A 2GDVA 3WF4A 2V3EA 1RP8A 5KEZA 3AYRA 1FH8A 3L2LA 2O9PA 3BMWA 4UQBA 2W61A 5BXRA 2ZUWA 4D6DA 1VJSA 1OWQA 4TUFA 4Z2IA 5AYIA 5D4YA 1GVIA 1BTCA 4OBRA 1M01A 1C93A 1FH7A 5JIWA 1ECEA 1JFXA 2WB5A 4XB3A 1TQUA 4HA3A 1GHSA 1YQ2A 2A3EA 3LXCA 4LGXA 1QHOA 1HXJA 1R87A 3EDFA 1W1YA 3S2CA 3MMWA 4KGLA 1J0KA 1E3XA 3BH4A 4XZBA 1TQSA 1PPIA 4UQAA 3NJ3A 3FAXA 5BROA 1GOIA 2V5DA 2CHNA 1XV8A 3WBAA 1E4MM 3WFZA 1J0ZA 1B2YA 2XSBA 2DT3A 4JFUA 5AYBA 4V27A 3VDCA 4EKJA 3T08A 1VBRA 2FHCA 5A2AA 1KWGA 3BAJA 3GXDA 4NZJA 4J3SA 2QF8A 1LG1A 3CUGA 2XVNA 2YBTA 2BY2A 3QHNA 1MFVA 3WNMA 5GPRA 1UD6A 1ISZA 2BFGA 4RE2A 1CNVA 4D6FA 4JZ5A 1MW3A 2GDUA 1X6LA 3ZSTA 4J3WA 4QP0A 4CN6A 4MNMA 3W6MA 3ARQA 1VEMA 3ZIZA 4GQQA 1DP0A 4AZ7A 1GW1A 2DSKA 4UFIA 4EE9A 3W53A 1XD1A 1Q6CA 2WXDM 1UR1A 4F79A 4XZWA 1R86A 1J0JA 3FHQA 3CZEA 1QWUA 2GJPA 2XVKA 1B3WA 1JFHA 4UQEA 1UA7A 4WSKA 3VGFA 5BXPA 5BXTA 2E9LA 5HBFA 1FH9A 4HTYA 3ZR6A 1NWRA 2ZX8A 2NT1A 2CBVA 3WH6A 1OD0A 2A3AA 3PTQA 6A3HA 4IUGA 4CD7A 1SR0A 5E6ZA 1TVPA 1WE5A 3CHCA 3QR3A 1GZJA 5EB8A 4NX0A 1W1PA 1QOXA 1NH6A 3VGGA 3PZOA 1HVXA 3SCUA 3J7HA 2XHYA 1VEPA 3GZAA 1HNYA 4QFUA 3BUQA 3VILA 5KZ6A 4JFVA 2W92A 2DEPA 1PIFA 2G3JA 4YPJA 2EAEA 4TVDA 2J77A 4D6CA 4XX6A 5CSYA 3L4UA 2MANA 3PZNA 1TA3A 1WZMA 5FL0A 1BVNP 4MB1A 1XH0A 3WN6A 5D8WA 3WEMA 3WKZA 2EPKX 1IZJA 4CD5A 4LYQA 4OBSA 2J7HA 3VVGA 1H11A 1C3FA 2J74A 1WKYA 4P7OA 5E0FA 1PBGA 2J78A 1MW2A 1H4PA 5IFTA 1E1FA 4ZE5A 4CKQA 3RM9A 4D6JA 2F2HA 4CN1A 3TOPA 1V3MA 3VIHA 4W84A 1UWUA 5CJ5A 3AXXA 4AIUA 1MFUA 2OSXA 3NSNA 1KR1A 4CU6A 5EMYA 3ZM8A 1W1VA 4ATDA 1TQVA 1MVYA 3ZO9A 2VX7A 5I77A 3BVXA 3AS2A 1JZ8A 3OA5A 4JL1A 5I6SA 3LRLA 3W24A 1BSIA 1E40A 4U3AA 1UKPA 4QAWA 5A69A 3WUGA 1MQRA 5DT7A 4CD8A 1VAHA 2OSYA 2DT2A 4B9ZA 1HN1A 3PZUA 4IM4A 3DX3A 4S3KA 1UYQA 3CUHA 5M03A 4B15A 2PB1A 5A6BA 3UG3A 4MTVA 2DDXA 3VX0A 2O9RA 2FH8A 1Q6GA 4ZEPA 1L0PA
chains in the Genus database with same CATH superfamily
1R46A 3RL2B 1LO3H 2XPGA 5C3TA 4PJXA 1IU1A 3RWJA 2X1IA 2EH7L 4P57B 4Y2NA 3ZS4A 4IGMA 2WNGA 3U6WA 4KWVA 1ZP4A 3IKCB 4G1MB 3F5WB 1SJDA 3NSJA 1CFVL 3CTTA 3GXNA 2PYED 2VDPL 4YZWA 2BB0A 1SF5A 2FKPA 1GNXA 5H8DA 2BC4A 4GFIA 3VFWA 2GJXB 2A73B 5EU3A 4QTGA 3Q43A 1TQTA 3ARPA 2V8MA 4EDXA 2XZAL 2XZAH 4PJ7E 3PZGA 3GMMB 4CQCA 1COBA 5LG1A 1TQWA 1BYAA 5E1HB 4U49A 4KRZA 3Q7JA 1GTHA 4Z3FA 4UMCA 2DZUA 4KOBA 3ISWA 3BLPX 1C8VA 5TQ2L 1KRAC 4BSVA 3G5XB 4WIQA 1GS8A 4N9OB 5TQ2H 3OKMA 1W3LA 1EX1A 2ZXDA 1H3WM 1A7PL 1SW7A 3LZRA 4KUCF 2QCGA 2FZBA 5AUMB 2Y22A 4FXGC 5CSSA 1DFBL 3OVQA 1HW6A 1DFBH 3AXHA 3EOEA 1AO7A 3PM6A 4X6DE 4WGHA 2VLRE 5D8ZA 1UUMA 2PPDA 1UKTA 3ARDC 3FN0L 4BKSC 2VR8A 3EWWA 1L6PA 5IEKB 3WD2A 5BNXD 2A6NA 1GSKA 4PB4A 3VDAA 5FLUA 2ENJA 3NPXA 3QFEA 5J7CC 3U5UA 2V5RA 2DN7A 3BN9D 1AK5A 4XH2B 2Z35B 1FFRA 4EOWL 2ALAA 1MVUB 4FMKA 4EOWH 5GZNA 4ERIA 4FFVD 2WMKA 2E7LA 5JW5A 4N0CC 5J6HA 2FHFA 4N0FB 4ANWA 2WLJA 3VSQA 1S3TC 3O9WD 3QZWB 1M3JA 1F6LL 2YXVA 4YUEH 5ECGA 4XOEA 2R83A 2BHYA 3LKQB 2IDQA 1VS1A 1NAKL 5HYSA 2H45A 2BNUB 1CICA 5AHMA 1NAKH 3W2UA 1V79A 3TZNA 1TPH1 3E0IA 3JV4B 4JOMA 2HJLB 4XVEA 2W0LA 3MLRH 4P4KC 4O02A 3G6JE 3CB8A 4JTCA 1EL3A 3FXYA 5SX5H 4LIQE 4ROQA 1YECL 3PFUA 3R4IA 4FNQA 1RPUA 4A2LA 1QI3A 5EBMB 1NCNA 3OL2A 4Q8OA 1EEUA 4RFEA 2C16A 2DI8A 2QCDB 4RESB 3GBEA 4ZAKD 1IGML 1H61A 5HJ3B 5D6DA 4OU3A 1IGMH 4U10A 1BVNT 2OMXA 2YN5A 4GY1A 1W54A 4PSRA 2BVUA 9RUBA 4PBEA 5T9BG 4G9DA 2G97A 3SSGA 1QSFA 3QUYA 3VFOA 3CFBA 2I14A 4D9QD 2IWFA 2CJTA 4Z08A 3LJ3A 2YGQA 2XQYA 3LKNA 1V02E 4YXHL 4YBQC 3HRZB 1TTFA 4PRIE 2EDKA 2FZ9A 1HWGB 4YXHH 3K5RA 2HEJA 4UM9D 1T7YA 4G7SB 3OQEA 4BXSV 3IMRA 4P23D 3LPWA 3LEXA 1YEDB 2Y2TA 2QSTA 1O60A 5GQBA 1T6WA 3MYOA 2ZXQA 2ED7A 5LA1A 3H22A 1U8IA 3M9YA 3LD5A 2WMHA 5DMIL 1E56A 3RHWF 4GXWA 4M93B 3TJIA 5DMIH 3T9WA 1BIIA 3TWBA 3QC3A 3AYVA 4HEMA 3T0EA 3GW0A 2D7NA 4FTVE 4XO3A 4U1IB 4L05A 5JMOC 1QR7A 2DD8L 1DL3A 2UV3A 2VAAA 3ZLFA 4FE9A 3M45A 3I6KB 1P2CA 2WYIA 2BSDA 5I02A 3L48A 3LTPA 5IBLC 3RPIB 5C0EB 1IBHA 4GRLB 5I28A 4X83A 1SLUA 1XGTB 1OLZA 4HAKA 4MAYC 3FN3A 4NBZB 1YC7A 3C2OA 1A3QA 3HE6A 1DQML 5SWZB 1FL3A 3LKSA 1DQMH 2BIIA 2P8BA 2QSCL 3AB0B 4OZFA 4LWWA 2QSCH 2DJ4A 1JNNL 3C56A 1JNNH 3W7KA 3W38A 4LEXH 1BX2A 5I75C 1J0YA 3PBYA 1JRHL 1US2A 3WNOA 4Y5VA 5LN8A 4BKLA 1JRHH 3DXAE 5F3BB 1E4NA 1WWWX 1BD2E 4Q32A 1FWJC 3QPQC 1B6DA 2UX6A 3EA3A 3SYQA 1A5FL 5GJMA 2N7AA 3LI1A 5J89A 3HLKA 1A5FH 5I18L 4DUOA 3VXSE 4E4UA 4Y90A 4PJGE 1T7XA 2P4AB 4FR1A 3VIKA 1I9CB 3KJ4C 5AALA 3I6RA 4WUKH 3HS9A 1Z6JT 3EYQD 4TSCL 4JDVA 5I03A 3MJGX 3N12A 4P4RA 1VBUA 4G71B 1OTSD 4IMLA 3V7AE 2ZZ1A 2MPVA 3QUGA 1ZHKB 4B0MM 5HJYA 3VU1A 1PY9A 4PBXA 4P2RE 5I8EB 4EAEA 1X44A 4UQ3A 3KDOA 1OYBA 4L8BA 1B6UA 3V1PA 1YTDA 2QJDA 2G2RB 1WDPA 2R51A 3IDMA 2VQUA 4EI5B 1OV8A 1YHTA 1AW5A 3B06A 3L9BA 4G2DA 3N34A 4CVUA 2DT1A 3MUAA 1C90A 1P6CA 3O2WH 2NMSA 5HMDA 3T2QA 1FWDC 2PRMA 1WUFA 3NG5A 4DAIA 4Z17A 4YSQA 1G4RA 2ZP9A 1HHIB 5HYQA 5I6XB 4R85A 4HAGA 3O0LA 3W0KA 4PV9B 2Y6SD 5B4MD 3C0SA 3K4ZA 4JDZB 1PX8A 5J6GA 4XPGL 3H85A 4RFOH 2A21A 5MHSE 4APQD 2MSPA 4XPGH 4NJIA 2R1LA 4E4FA 2FWLB 3ZE0B 5FYKL 1QVBA 1F05A 5HMFA 1BVLA 2R8SH 2YOCA 3GMPB 2KZWA 1EV2E 5K2ZA 2DQJL 5CPMA 3KM1A 4U6TA 3H42L 5JOFB 1KIUA 2EP6A 3H42H 2UWEE 3VFVA 4GBXB 1I3RA 3HLAA 1CQKA 4J6RL 4O50A 2PF6A 3FULA 2X0YA 3RI5K 3W2LA 4AUBA 5GGRY 4Z0SA 5HPCA 3CN3A 3LSCA 5L9DL 3SECA 1KFEA 1E27A 5L9DH 2Z26A 2DBLL 2XWJB 3M41A 1ESOA 1A4JB 2BIQA 2DBLH 1IWAA 4ODXB 4XO7A 4L5FE 2VEPA 3H7LA 3I84A 4LCWD 3HE7B 1JCLA 1GQNA 2MCPL 3WJJA 4L4TA 2VDOL 3UR2A 2MCPH 1AKJA 4HNOA 2VDOH 5T9CE 2NZLA 4US6A 4TX8A 3RR1A 3THML 3I6LD 2FO4B 1Z0NA 1XDMA 5C8JB 2W5FA 5FX3A 2OXGB 4Y4HA 4XD6A 3HVNA 2E9IA 2H9AB 4HCHA 5AEAA 4Y5YB 4IH3A 2WJ7A 4X6BB 3QXVA 5T1LA 1YNTF 1K8YA 1USQA 1TU2B 2Q7YB 5IK3A 4MJZA 5LGJB 4IIZA 1JV5A 6PAZA 4AYBA 2XV6B 1US3A 3RF9A 3DECA 3MT1A 2G4GA 1REQB 1BVZA 4X5WB 1TR1A 3G1AA 1A9BA 2YBRB 5E03A 4HMEA 2QUNA 4P59L 5IVXF 2Z1XA 2J9XA 4P59H 3B9KA 3H2FA 4OGAC 2D7QA 5CHNA 2GGIA 3TN4A 1ECQA 1AG0A 3EJRA 1PD1A 5DC0A 4BGLA 2VGLM 3N1FC 4WWPA 3UGEA 4DEUA 5JBDA 2BOCA 2PPFA 1NEYA 2WQPA 3WL0A 2FK9A 1A5MC 3GKFA 4W89A 3GR7A 5KSVB 1TVBA 3GAKA 2DSVA 2Z2UA 5KYXA 2TMDA 2HTKC 3I2CL 2RACA 3BJFA 3H2NA 3I2CH 4KVNH 3ILQC 4GKNB 1AMKA 3VFRA 3W88A 1OK4A 4XPBH 2QCEA 4P2QE 5HSFA 4PMDA 1JXGA 1T40A 3NQVA 3MX0B 3U8GA 1C8PA 3G2GA 4IGBB 5KBPA 3TPUA 4DPPA 4R3SB 2YAFA 4EI0A 5ACZB 2JFCA 4L0YA 3AUJA 3I65A 4MZRA 3U1SL 4L1DA 3BARA 3N4EA 3U1SH 4ZFZA 1XF3A 3NDZE 5J0BA 1W5QA 1XS2A 3IDGA 3UZQA 5FYJH 1LWJA 4JKNA 4N0UA 2J6XA 3CUFA 1FGVL 2OI9B 3TMQA 3WMPA 3TO4D 5FJPA 2QUVA 3CQIA 5T3XL 3EGSB 2XQ0A 4JK0D 4Y7EA 3RVXD 4BQ2A 3RUGF 5FJTA 1XGPB 1LQ0A 2BSTB 2V2TA 4D8LA 2LQRA 3EJSA 2BHZA 4XC1L 1U8NB 4WW2B 1RD6A 4GSUA 4XC1H 2P8PB 1HF6A 4F0RA 2Y7EA 5A94A 3QA3A 4OVVA 3LPOA 4AHQA 3BQUD 1YBQB 1A8JH 3QNZA 3WF2A 1KBGL 4MJIB 1JGEA 1KBGH 2J6EL 5CD5C 2AXWA 3BH8A 1NQ6A 2J6EH 4URIA 4F66A 4G6MH 3QNFA 4PUMA 4C8XA 5J13B 3WJLC 1RALA 3RBSA 1XYFA 1R30A 2V5BA 4YO0A 1OC6A 1XL6A 2XPGB 4BIKA 1QSED 4BS0A 4XN4A 3GHUA 4PTXA 3UZZA 1EGZA 1J11A 5HYFA 2CUMA 4L4LA 3FTYA 3LNIA 4Y7MA 1B9ZA 4MVAA 1VH7A 1SZNA 4BZYA 5KSAA 5TE4L 3MYZA 2QR0A 4XK2A 2RJHA 2DMKA 5TE4H 1OINA 1KY6A 3N43B 1LCOA 3NUKA 4UV4L 1NKOA 4OLYH 2I7SA 2R27A 2V8LA 4HGMA 4FEZA 4EMZA 4JY4A 4RUBA 2WNQA 5LQBL 4F9LC 1BF5A 2REQB 2ZUQB 3F7PC 5F2FA 2ZUXA 3UJIL 3NJJA 4K5NA 1DWAM 1YJDL 3THQA 1CZ8L 4UDUB 1YJDH 1CZ8H 2CRZA 3B2UD 4H41A 2CDGA 3DESA 3DX1A 3BE1L 5C6TL 4JPGA 2AGKA 1B3OA 3BGFB 3CV7A 3IU3B 5FF3A 5HI4C 3K8KA 3GDKA 5DK0A 2WV8A 4PUKA 3WX7A 5FDWB 4JHOA 2I85A 1KQZA 2HK0A 2OQHA 4KBPA 1KTNA 1X5FA 5DHYB 2CLRB 4AC2A 4JFTA 2WXPA 4ELDA 2H0FA 2WLZA 3FJTA 5C9RA 1HJVA 3M0VA 1IQ8A 4GRWB 2BSCA 1UC6A 4LNRB 3I6EA 5FGBA 3L3OB 2ODOA 4X7EC 4EWND 3X3FL 3W1MA 4P8VA 3WJSA 2BP8B 4WTQA 2H2PC 1I8LC 3HFFA 3TCSA 5AOLA 4BH7B 4BF7A 5B21A 2H90A 3L3GA 1G9NL 43C9B 4QCIA 5JW5B 3ARVA 1G9NH 4Y4FA 4FIQA 1AR1C 4H0HB 1AC0A 4O1BA 1WP6A 4GY0A 1SUXA 5DUBA 3G0XA 4Z7WB 4MGGA 1FO0L 4ANKA 1VF8A 4XCFL 4PE8A 1AXTL 1RUQL 1TJGL 1JPSL 1UA6H 1BMWA 3M7WA 5CBEA 2BVTA 1AXTH 5H8UA 1CX9A 1V7NL 1V7NH 4CSZA 1QOPA 1TZGL 2VSKB 5C09E 3E38A 1R9YA 3GIVA 1KELH 4I88A 3JZYA 4FXTA 3TA4D 3H9HA 2YCJA 4DP9X 3CV6A 1XSJA 1QNSA 4H8QA 4XMTA 2FEDD 3B0PA 5T5NF 3SCMD 4DKTA 2C1PA 4AL8L 1ZMYA 3OQ8A 4AL8H 4CC0A 3UEQA 3D85B 3UPCA 4WCYL 1S5WA 4HG4K 2CZEA 2JIEA 2JK2A 4WCYH 4JVWA 2WBJD 3GMOA 4PCSA 4NSBA 1QWGA 4H19A 3EWUA 4NSKB 3QUYB 4XHJC 2IIJA 5FF0A 1BEXA 1TYRA 2HKFL 3UP6A 1T5KA 7XIMA 3DJSA 2HKFH 3VKBA 3WLQA 4JIEA 1V8HA 4P07A 3ASNB 1IBBA 4LKXA 3KVLA 3W2NA 4U1HB 1E8XA 4AENA 2IBZX 5CZVL 5BWFA 5CZVH 5BQ7B 3MWAA 3WQPA 3IAPA 4RQQB 3LEXB 5LBVA 4KROD 2INZA 3LY6A 4H8PA 1AQMA 2XRAH 4RMRA 4G8GA 2GYSA 5EA9A 2AAVA 1IGJB 4GG6E 3ATDA 5IROA 2QMKA 5A8QA 2J4GA 2A0LC 3B9OA 3UYIA 4XWGH 3QORC 2CKBH 3S5ZA 3NSDA 4HD5A 1U3ZA 1BIHA 2ADIB 3HNSL 3VOHA 1KCKA 1WPCA 4R8WL 3EMCA 1UD5A 1T21B 3HNSH 3PNWA 4KEZA 3SGGA 4R8WH 2P3EA 4Y8FA 5L2KE 1T96A 1KCUL 1XZ0A 2A6IA 1HQTA 1EEPA 3TEZA 4GH3A 2BMBA 3RJQB 4BGDA 5D4YA 3OHIA 4A7VA 1P7QB 4Z8FL 4LY4A 5H4YA 4XB3A 1A7RL 1G84A 4Z8FH 3WJWA 1GHSA 1U8KA 2UZXA 1A7RH 4ICXA 3OR7A 3EYOB 1E5BA 1VFAA 4QRBA 2KC0A 4N2AA 3CCHB 1K7XA 4C91A 3WJYA 1MI5A 1VQTA 3N19B 4WQ6A 5F7FA 4ZQRA 1S8DB 4I87A 1LG1A 3F3HA 1Q6OA 5DC4B 1WTLA 5C0DA 3P9MB 3D05A 4XIMA 1CB2A 1W6WA 2CUAA 2MWCA 1MW3A 5C08A 4UNVA 2GTQA 1AD9B 3U9UB 4QRQB 2X2UA 3H2WA 5CR1A 3W53A 2AL2A 2FB3A 2HPTA 4A2SA 3VXME 1A66A 1OZUA 2B0MA 3FSOA 2Y5SA 2VKZG 4Q56A 1L9PA 4N85A 4F5CA 4CD7A 4JTJA 4J6IA 2C9SA 2O6PA 2E5BA 1TTIA 4O16A 4PJDF 3BJTA 3KCPA 3O3EB 4GG8A 1T0MA 4PJAB 1FH5L 2DEPA 3QUZC 1FH5H 5BS0A 3UIZA 3IDYB 2IDFA 1XISA 1O1HA 2K6ZA 4P2OB 3I4KA 1LM1A 3NOYA 2DW7A 2WQDA 2XZCL 4TUKL 2HT2D 2XZCH 4TUKH 5DDHA 4DFHA 2VEGA 1CD9B 2XG5B 4ABUA 1DZBA 1XBXA 3AXXA 3KD4A 2EICA 3IDUA 4RX4D 2WXOA 3G1XA 3HTLX 4ACPA 2WO2B 2EIKB 3IDMB 5A69A 3LN5B 1IQWL 3HCVA 3F58L 4BQ6A 2HLEB 1IQWH 3F58H 4G7EA 3B3IB 2WXLA 3K1KC 4P04A 2NX9A 2KT6A 3APDA 3D6GA 3FO9A 1RZ7L 4ZEPA 4ILSA 5DBUA 3D3VE 5D09A 4MWAD 4PP2B 1XGZA 1O68A 1CTNA 2ZCZA 3IGSA 1U8OB 4X8JB 4RGMB 1OCRB 4UMBA 1EJOL 2YC1A 3QDHA 4XPAL 1EJOH 4XPAH 4JJHA 3TA3B 1FIEA 3K4DA 1YY9C 1OP4A 4JKKA 3HPAA 3R79A 4L3ED 2VH5H 4NQVB 3KDPB 3RAJL 4KDTC 3IGUA 3RAJH 4UFLA 5CCKL 1F2XK 1NGYA 5HNRA 1OFRA 5CCKH 1MEWA 2W9DL 1KIUB 1OABA 3N91A 2JEQA 4PV1C 2CIIB 2WNXA 3WIHA 4LEQA 3VX1A 1BQGA 5DZNA 3CQJA 4IU2B 4G7VL 4XCNA 3UTSE 4UTIA 2F53B 1OCWH 4G7VH 1EZ2A 4PJFE 1QBMH 43CAA 1KT2B 2YK1L 3BJLA 4JCLA 2YK1H 5D1ZB 4JG9A 5JBEA 4BQ4A 1I45A 4ZMPA 6TIMA 4DJFC 3F84A 3M64A 5TF0A 3GNPA 1A7BA 3EXJA 3VWJD 1CDUA 2IG2L 3S3JA 1WDRA 1MFNA 3T2PA 2WLMA 2IG2H 2AERT 2WANA 2OGYA 2BVQA 4LRSA 5EUKB 3CHQA 4X4YA 1H5VA 2OQJB 1IAOB 1L0XA 1JDDA 1LP9A 5LHEA 2QJIA 4OD1L 5CEXA 2H5UA 3PL6C 2ITEA 3LEVL 4DN3L 3C60A 3LEVH 4M61B 4S0TD 1AHWB 4DN3H 3GLDA 1RJLA 4WUUE 2C14A 3RY6C 3B9KB 4IHCA 4NAEB 1P4LA 3ZTJH 4FABH 5IIEB 4LLAA 2YD4A 1AODA 3GR4A 4V2XA 2H6RA 4Y9CA 4KKCC 1OGTB 3KOFA 3QV6A 3H9ZA 2ZZ5A 1KM5A 3GSVA 2DM7A 2PGEA 2Z3FA 3N2OA 2IMRA 2P8CA 4N2YA 3GVQA 1KXTB 2H6PB 1U92A 1T7LA 3VD2A 4YSDA 1IAMA 4HZ7A 1BPVA 2P24A 1FI8C 3VOIA 1FYTE 5JHBA 5D96C 1SF3A 4LLVB 4DJDA 1QNZL 3LZQA 1OAXL 4UANA 3MV9A 5M5DA 3HO8A 2OZ4L 5EEUA 2VLRD 5EU5A 1QNZH 1OAXH 3UBGA 2WKGA 2Y61A 3SDXB 1VADB 2WZ6A 1LDSA 1ZKAA 4EXBA 3S3SA 1D5BA 2EXWC 3IIVA 1AS6A 1EBHA 2XFRA 4N0UB 3ET9F 1ZU8A 3MFFB 3Q48A 3RO6A 1WT5A 3CVDA 1FWWA 4HOXA 1G9ML 4EIZC 2R7EA 1VP5A 1ME7A 2VFDA 1VFMA 3NPSB 1G9MH 3V4VH 3BD5A 4QXUH 4UBPC 2HUEA 2GITA 2RFXA 2H4EA 3W3OA 2EJ1A 3OYZA 4I5UA 3WV0A 2Y0SA 4PJBE 1ZGLB 3RWCB 4AYEC 2X41A 3CBWA 2B15A 4RNJA 3EDEA 5CCZA 1UMYA 3KJ6L 2ENSA 3N41F 1E30A 2DH3A 2YSTA 4YTTA 1XWYA 2UZIH 5F9JA 1R1CA 3QNZB 3FQNA 4ZW6A 1T0NA 3BP4B 3OJDB 1SLWA 3F12B 2XICA 4AZ8B 2BSSA 4WI4A 4AI7A 3VFGH 1YMYA 2PD9A 4PS7A 1PJWA 1T7WA 2GSJA 4TL4A 3MRPB 2RGMA 1I1XA 4N0CD 5AHFA 5IHZB 1Q4WA 3OG2A 3GXPA 4ICCX 3HTWA 2NX5D 4NQDA 4PSPA 5FSDC 2E7HA 4QRTA 1VJZA 5FW7A 2BY1A 1H5BA 1Q9LA 3BLKA 1NELA 2ZCHH 4Z7NE 3BOFA 4JFOB 4LDOB 3VKJA 5KVEL 4JE0A 4U0RB 4F7EB 5KVEH 1EP1A 2XCMC 4PMYA 3MNZA 3BSZH 1X7QA 2XQBL 4JY4B 3N50A 5KW9L 1Q9KA 4P4KD 3V6OA 5KW9H 5ESQA 1IEQA 4PB9L 3LN4B 3BL3A 2V9UA 3HIJA 4PB9H 3AWGA 1YIXA 1RQHA 3NK3A 1I8AA 3CBKB 1X7SA 2EDLA 4BCZA 3V5HA 1XF2A 3ITVA 1KBWA 4K4KA 4PUBL 2Z0UA 5E00A 1HKIA 3D47A 2EF9A 2XHNA 3A3YB 1C1EL 1C1EH 4MJ6A 3SQBA 2W80C 2I1OA 5IMLB 2X4NA 3PWJA 2F7PA 4JFYA 3TZVB 1FNHA 1S3HA 1E6NA 2E3ZA 1DE6A 3OZKA 5EA0L 1R3IL 3BUIA 4X7DC 4JFFA 2KAUC 4PJ5D 5A6MA 3SZ8A 1P7KB 2GHZA 4ZX4A 3QUMB 2FO8A 5ICZA 1MW1A 4HPYL 4F0HA 3A24A 2OWWA 4HPYH 4YBQD 4DM1A 4LBRA 1N5YL 2APXA 2FYYB 1FH2A 4FQPA 3H2EA 1DL7L 4Z1YA 1OKEA 6CGTA 3D5HA 1DL7H 2OSLA 4JRXE 4QLKA 2JLLA 3PAYA 5AVTB 4BWLC 1XT5A 1J9CT 1N7ML 4WEMB 1R7OA 5T91A 4YNYB 2DLEA 1UWAA 1N7MH 1KB5A 4FL4B 2WCSA 4JANB 4E2VA 3OF6A 2H1PL 1RJZA 4ODBD 3RGVC 3UAJA 4IRJA 2H1PH 4Q8NA 1LBLA 1WZ1L 1J05B 1C8XA 1B1YA 2PNDA 1WZ1H 4TSAL 2JKAA 1OL0A 1UT1A 5DUBB 3QG6B 3WQCA 2NUWA 2V6HA 1DHKA 5IV2B 1BEYL 4Y88A 2W67A 1BEYH 4Z7VB 1ADQL 1U1JA 3VIMA 4K38A 3FFDA 4LCUA 1W1IE 2PXYB 5IBLD 2XIIA 4FHBD 1S39A 3F7LA 2K1MA 4XQ6A 5KVFH 1P43A 1EUNA 2COVD 4MAYD 5KBKA 5DYOA 4D6GA 1KV8A 4ZXLA 1SO3A 4JDEA 4ZDHA 4LVHB 1PLGL 3CZUB 3MGOA 3EA2A 1PLGH 1E4LA 5FM8A 2HPOA 1VFSA 2DZTA 2ALDA 3NIGE 2N3JA 3X3GH 4KMQA 3S0PA 2I9LB 3ETSA 4X4KA 5IXEA 3TNMA 35C8H 1OP5H 2M1KA 1NDVA 3V75A 4AC1X 1XLKA 4NI6A 4MUZA 3V6FB 4I13B 4LRNL 3WF0A 3PQYD 5DJ2A 2AQTA 1AFSA 4QE5A 3Q9QA 4R7DB 4XMWA 3QPQD 3WDJA 1KTCA 2O61B 1WOBA 3RN6A 4DF1A 5ABFB 4N8UA 2BOBA 3P2VA 1A5NC 4Q4QA 4B9CA 2OAAA 4DI8A 3FT1A 3FF8A 1TPC1 4AWSA 3KZ8A 1FHGA 3MCMA 1OIMA 1U8LB 4Q6IB 5DZ9A 4G8GB 3TCTA 4LU0A 5ID1A 4BFIA 3EOAA 3V5CA 3F7YB 3BVNB 4GYBA 3ZRFC 4WU5A 4QJ5B 4YS4A 1UIPA 2X7WA 5AFAA 1JHKL 1UWTA 1S5HB 5AZ2L 3BQ5A 2ZOKB 5D2LA 1ZLUH 4N2EA 1JHKH 5LJYH 3F62A 3GJFA 3DBSA 4OZIB 1ZNNA 4GT7A 5HJDA 4X98B 3VCLB 1GJIA 4E41A 2BNQD 5D5MB 3OVPA 2WZPD 2QPSA 3SUVA 8FABB 3WQ4A 5DVPA 2YEZB 4Z78B 5DTFB 3UFIA 5J1SC 2QSQA 3A4DA 1UW9A 4XAWH 3OKLA 4JKPL 2XN9B 4A6YB 4REQB 4G11A 5CEZE 3QP3A 4JKPH 3V6BR 1RK1A 4HJGB 3B9EA 1H62A 1HK6A 4Y6GA 4A05A 2VZSA 4QRPA 7ODCA 3ZDXB 1UT2A 3O3DA 2N01B 1NCGA 3FOLA 1PZ5A 4UOJA 2XNAA 3ULUE 2MOVA 2ODHA 2W9MA 2MQGA 3IJ9A 1MI5B 4JJOA 2HXUA 3QIUA 3RL1B 2IS7A 4FQHB 3D0AA 3N42F 3DX6B 3VFLA 3SD5A 2YXGA 1JYXA 3V0VB 3MRIA 2HBXA 1S9KC 3ID7A 3G7TA 1E4XL 3MA7A 1RLWA 4XZ4A 3SUUA 1JJKA 3DBNA 4HW6A 3P9LA 4MBOA 3WKQA 4MHHI 4KKLC 5J12C 3EO1A 4OH2A 1ZT4B 4UM8B 2BODX 2OK0L 4PMZA 4DAFA 3FB6B 2OK0H 3CVHA 4P46C 1W72A 3SGEH 3DIVA 5HHOA 4K2UH 1W9DM 4C6OA 1CGSH 1Q1PA 3UPWA 3X12A 5HATA 1GPOL 1T0MB 3NOIA 4Z2HA 2Q86A 2X4OB 2YWYA 2YPLD 3U6XS 5BS0B 1Q0YL 4CMMA 5AQ0A 1TPFA 2YD8A 4YC2B 5LWYL 1I1AC 5LWYH 5F7KC 4GINA 3B8SA 3RX7A 4P9ML 3N2CA 2G9KA 3S9YA 4RNRB 4P9MH 1G6RL 1WAAE 5FAJA 4WHTA 1RCYA 5ECVA 2I32A 3QDGD 2MH4A 1F74A 2DIKA 5KYWA 3BC9A 2QCMA 3ZVHA 1G6RH 3B4UA 1ROWA 1AVAA 2W94A 3FQUA 5I09A 3PF3A 3HS0B 4GO6B 4OCNC 3MTRA 4GABA 5BU6A 2YAMA 1RK6A 3G3DA 3JQOB 3LYRA 3QPXL 2BW4A 2ENQA 3VIPA 3QPXH 4OGAD 4JNMA 4K8RD 4TV6A 1TPXB 4D8ZA 4PW4A 1HQRB 5M3WA 5BVJA 2W65B 5D7IE 2ZQ0A 4U1SB 2CDFB 1J8HA 4PRHE 1MQPA 1O6SB 3OR6A 3CAVA 1QKZL 3H3PL 2HTKD 1QKZH 3H3PH 3SRKA 3NQDA 3ILQD 5E56A 5GISL 2Y8VA 1R9XA 5GISH 1FL6B 1LE9B 2TAAA 5ABGA 1D7KA 5GGTL 4IXHA 1N82A 2QEZA 4R9OA 1JHTB 2OEKA 2C3HA 5FOOA 4CEUC 1MREH 4PLOB 5TH2A 3KPOA 2ZKHH 5KYUB 1X9RA 3NJIA 2ZOTA 3PJWA 3S5LA 3QS3A 4JZJA 3KYNB 2Q1EA 1E55A 3QYNA 5I9QB 4LGRB 2OTWA 3KTXA 3LEYL 4Y19E 1ZZMA 3LEYH 3UOAB 4LCVA 3U79A 3HZVB 4F20A 4QR7A 2FTYA 3ILDA 3PAVA 3MUJA 4U1KA 1D6EA 4G6FB 1IBZA 5GNZA 3GVVA 1ADDA 2FVNA 1CFNA 2C0HA 3CXHK 3L3JB 3LENA 2EH7H 4QOKA 2LFEA 2OX1A 4R26L 1E9QA 4R26H 1ZRQA 1CFVH 4JY6A 1EHNA 4E2BA 2VDPH 1TCRB 4AT6A 1R3TA 3WO3B 4R4BA 5GRVK 1L9WA 2YPIA 4PRAB 2GDQA 1CD1B 3SZ6A 1Q0XL 3IVTA 5CD5D 1N3NB 1Q0XH 4HNLA 3EJQA 3QIWA 4U31A 1SEBB 4GRSA 3W7DA 3T1GA 4MB4A 4NQQA 1XGQB 5A40E 2E5EA 4NKIL 4GQPH 1TQCC 4GCXA 1XBYA 4NKIH 4X6EA 1GOGA 2ZA3A 4X7SL 4TVPL 3VNIA 1N8OE 4TVPH 1WD8A 3UDWA 1LLWA 3WK2A 3BMXA 3PY2A 2BDQA 2PCFA 3C5JB 2PMZA 3V5KB 4PY8I 3GSWB 4ZVJA 3VXRE 5IFJA 5E8PA 2CWNA 1A7PH 4L9YA 3A23A 2HE5A 5HVFB 1WZLA 4G6AC 3E6FA 4P2AA 1U3NA 3TVAA 3K5XA 1S5MA 3ISRA 2WB1A 1H1ZA 3BO9A 2Y85A 1DVSA 3C8NA 2QULA 3FN0H 3MSRA 4K94C 3FQXA 2AJZA 1IEIA 2BWGA 1MCNA 2VO8A 4C6EA 1NCWL 3PGFL 3HUJE 1NCWH 5LKYA 3PGFH 2ACUA 1A6TA 1D5BB 2J57A 3BZEB 4HETA 4JR9L 3ZIMA 4JFPA 3Q6FA 5HI4D 4Z7OF 5IBUG 4RK8A 4IMKA 2EYTA 1L6GA 4PRPD 2X3CA 5DURB 2RFXB 2AXFB 5FA4B 1E3ZA 1BVWA 3B8UA 5LUMA 4FK9A 2FECL 1QX1A 4LBEA 5JXEC 1D2PA 4G7FA 5BZWA 1ZVSB 3FQ4A 4ACTA 4JICA 2WAQA 3CXDL 2P53A 3WKNA 3CXDH 4PJ9C 2L5HA 4I0PA 4DPBX 2D22A 2WXRA 4PTUB 2XXMB 5AVVB 4ELMF 1UCBL 4RRPM 1OF2B 3WN5C 3S96A 1UCBH 3CDYA 2H2PD 5DFTA 1M65A 4RV3A 3NRPA 4X63A 1H6EA 2YQBA 4ZFMA 3L5LA 2QBWA 4R2GB 5DJDB 1YECH 3KPSE 1HKVA 1HL9A 4BF9A 1QFWI 5DLCA 1AR1D 5F21B 1W8OA 3BVVA 2IPGA 3ITTA 4PWGA 3VXUB 4NKMB 4CSTA 3M5VA 3ZHLA 4ONVA 4HKPA 1MPAL 1CF8L 4R0LC 4AVJA 3X14A 1MPAH 1CF8H 5F6IB 5C0JB 1A3XA 4TTGA 4W9GC 4NZFA 3WLWD 4NN7B 3BZ4A 3MNZB 1NMCC 2PP1A 4GKSB 2Q8ZA 1EGVA 2X30A 3BG3A 1A02N 1IGFL 1GGYA 2KS0A 1RZKC 2Y5TA 2DZVA 4GBDA 3LRSA 3EWZA 1TQUA 4HA3A 1HH6A 1B9KA 5DS1A 3CFJA 4G8EB 3NZPA 3BH4A 1YEHL 4HWEL 5DANA 3NJ3A 1YEHH 4HWEH 1I8UA 1QTWA 1EVUA 2B7NA 4MCNA 4H3DA 2X4NB 5I15L 2OKMA 5I15H 3NEVA 4MNHB 3C3UA 5HDBE 3MNVA 3OEXA 3N4FA 4HU2A 5IB2A 3P0WA 2RTTA 4XHJD 1MDRA 3W6MA 3MUHL 5C86A 3BW2A 2R29L 1DP0A 1RHHB 3T3ME 3HPXA 1XD1A 2R29H 1KZQA 4HS3B 4XZWA 2DD8H 4CNOA 4UTMA 1SQ7A 5FM5O 3ZR6A 3OG6B 4NBXB 1FG9C 3QR3A 3BX7C 2CM6A 3KYMB 3UYPA 2JCCF 3EYFA 4JO8A 2GQ9A 1E28A 3KW3A 4WI5A 1HNYA 1NAL1 1X3DA 4LDLB 4YPJA 3M1CA 1JUKA 2A0LD 2UY7B 1N0LB 4OJEH 1EC9A 3QORD 5DQDL 4AK1A 5DQDH 1I3VA 1P0BA 4N5EC 3ZKSD 3EHBC 1A9EA 5E0FA 4A3QA 4ZMOA 2IAND 3LVEA 4CKQA 2Z93A 3RTLA 2VELA 5D7JA 3VXNA 3VIHA 2X4TA 3S7GA 4NO0D 2OSXA 1MFUA 1JN6A 3FFDB 1W1VA 5D04C 4Y1AB 3MBWA 3ZO9A 2I57A 3BVXA 4M62L 3W3BA 2QJHA 4JL1A 3DIPA 3LRLA 5FHBL 1URZA 2CR0A 3WAJA 1I3UA 4AEIL 1NF0A 1QP1A 4G6CA 4AEIH 4B15A 4DFIA 5I18H 2QJGA 3OMZA 1C9DA 1U3HB 1E51A 1GZHC 4LCYA 5MENE 4HKZA 1J9RA 2NLJA 2WNNA 2JWYA 3RWDB 2Y2YA 4H25B 4L1BA 1SW0A 3O06A 4TSCH 2WNZA 1F6YA 5DJ8B 2OMTB 1LZOA 4UZUA 4LAQL 5EGRA 1M6OB 2NXYC 4NO2B 9XIAA 4HWBL 4Y1SA 4LLDB 3CU7A 4GG9A 4HWBH 1J5TA 3FB8A 3GNOA 4KK5C 3VMNA 4JTHA 1XYMA 2CZFA 3TV3L 4ZSUA 3KPMA 3SE3A 3T3PF 3DFSA 3TV3H 3TXZA 2WVTA 4PB5A 2CERA 1TDQA 4YZFE 5KVDE 3FU7A 3BZGA 4PVBA 1PZDA 1T20B 3IN2A 3OJVC 4WI7A 1MQ8A 4FLSA 4W6WB 1DVFC 4RBPK 5CN2A 2ZNWA 3EO0B 3QUZD 3GSQA 5C07A 4V1DA 4WJ5A 4DK6A 4QF1A 3ZDZB 1TELA 3DEQA 2H8PA 5ID1B 3F4WA 2ILLA 1VYPX 3W81A 3IFPB 3O8XC 5BZXA 1GOWA 1FHNA 3KPQB 1V8EA 1H3XA 4C6PA 3EDKA 1LBMA 3SY1A 1GGBL 5BO0D 3WLPA 4HOMA 1GGBH 3V4PL 3QHZL 5FYKH 1R38A 5DN1A 3V4PH 3QHZH 2CG9X 2DQJH 3LTSA 4FQLL 2BVEA 2K45A 3GBML 3V0FA 4C56A 3DHFA 3V0EA 3OKLB 4FQLH 3MRBB 4WGVB 4HB7A 3GBMH 2NY3C 4J6RH 4CEXC 2DB8A 1OSZA 1JI1A 1YPZB 2WK2A 4PCFA 4HKBA 3H70A 3COOA 1PZ5B 4EACA 4XNMB 3M7SA 4C4BA 1YY9D 1VBJA 2O4EA 3QYMA 1AQDA 3DI3B 1ESWA 2DIBA 3CEUA 4JGUA 3THMH 4JFWA 4BEQA 2D0HA 1ZJIA 1TO4A 1Q8MA 2KZBA 2YGOA 3WKYA 2AC0A 2D7TL 2DIAA 3FY1A 2EDDA 2YA2A 2APWA 3G1RA 5DT5A 2XWTB 2OT1A 3AC0A 1G87A 2XV0A 3SQSA 1VZIA 4LV4A 4MHBA 1AS7A 4BFEA 3BUBA 4WXYA 2BVDA 5HYJA 1OGAB 5I6LA 3GZPA 4BFNA 1A0DA 1E67A 4DJFD 2GY5A 3G18A 3QUXA 2ZKWA 4R97B 4ZXOA 4M7TA 5CJ8A 5HVGB 1CJYA 4XCYB 4G8IB 2ZRUA 4YS1A 2JJVA 4L1HA 2VR3A 2ZUVA 4N3UA 2B1HL 4OI7A 4C6KA 2ICWJ 4LOVA 1P5UC 3CJJA 1GS6X 1NMAL 3LB6C 4WHTB 1NMAH 4RH4A 5HINA 3I75B 3STEA 2PCPB 1UBSA 3PL6D 3VB8A 2Z92A 2BCKA 3IGFA 2K0RA 3B3BA 1F90L 4KPHL 2AK1L 4KPHH 4HUUA 2RA1A 4WUIA 2EUVA 2XGBA 1QO3A 5CH9A 4BFRA 3WHXA 4CVXA 3GS0A 2RGLA 2VGBA 1XBZA 4ZOEA 3MOAL 3V0SA 5TDPA 2QUTA 4AIXA 4KKCD 3PP7A 4YHOL 1FGVH 4JDBA 5BVJB 4M6PA 3KBWA 4YHOH 2GJ6E 2XX0A 2X1PA 5T3XH 4ZS6C 3OR6B 3TQKA 3Q6GL 3V55A 3A13A 3B8TA 1A5LC 3Q6GH 4JFZL 2JK5B 4DH2A 4JFZH 3R0KA 1N59A 4MCZA 1Z3GL 1H49A 4U1NA 3MRLA 2PO6C 2FE0A 2NQLA 5BRZA 2ZOXA 3IS0X 1ALDA 1WUZA 5DYFA 2XOTA 4TULL 4Z1BA 4TULH 3FTGA 3W7PA 4NN6C 2CBIA 5FEZA 3KPNB 4HQQL 3L8QA 1YAIA 3OKKA 5DJ6A 1ODAA 1EBAA 4HPHA 1XGRA 1J1OL 3HG1B 2EXWD 2WM1A 4F37F 4HT1L 1R3KB 1XHHA 4HU3A 4Z6AT 3RB7A 2XKSA 2HFEA 3IIZA 3UZYA 1XWVA 3KBPA 5HHNA 1G7HA 4BZ2L 2QVMA 2CKNA 4BZ2H 4PJXB 1YMMD 5AW1B 3RWJB 5EFFA 3QMSA 3EPNA 4Q6JA 2PAJA 4QOKB 3AZUA 1KTJA 3GDBA 5LHFA 3FT4A 1KFLA 3EH4B 3HM7A 3B5TA 1KENL 4JY6B 1MCDA 3QW9A 2BC4B 5E8NA 4UV4H 1XFBA 2ITCA 1KENH 1UWIA 4PV8A 3VFWB 1GOKA 3BW3A 5EU3B 2EDXA 3VI2A 3EB2A 3WFHA 5C0BD 5LQBH 4EDXB 4NKCA 3DROA 4IOSD 2VL5A 3UJIH 3GPSA 4FLHA 1OQXA 1HEJC 4IL2A 3TQPA 4LALA 3UXIA 1CFSA 1WA0X 3Q01A 2HVJA 4KJYA 5CBBA 1NF7A 2OOGA 3TYBA 5DK3A 1XG4A 3BE1H 4FP8L 5C6TH 2CETA 2DLGA 4BSVB 4FP8H 4XOAA 1A8ZA 1E73M 3OKMB 3TH6A 4K73A 3EBHA 1MHEA 2E7BA 5IFJB 3WDPP 1E9OA 3P40A 1N12A 3BAIA 1D3HA 3K0WA 2XZ9A 3CX5K 2XJLA 3FCPA 1AO7B 2E0PA 3NCCB 3S8FB 4CU7A 1DSWA 3G5VA 1V3JA 2O6EA 3OTTA 5AVXB 3Q2VA 3QEQD 3VI3E 2WKLA 1L0QA 3JR2A 4NQEE 1DQDL 3X3FH 1S1PA 3B8WA 1DQDH 4M5YL 3WS3A 3NAAL 3RY5A 4M5YH 4PRRA 1EA9C 3Q6FB 4HZAA 1AI1L 4GSRA 3LHTA 3UPAA 3PV6A 4W81A 1A5CA 1NCHA 5J6HB 5IQLA 1PVNA 1BCIA 1IYXA 1MLCA 3BWZA 3FTZA 1FO0H 2H2SC 1RV6X 3HB3B 1M04A 5E6IA 4XCFH 1RUQH 1ENUA 1TVNA 1TJGH 1JPSH 5HYSB 4X6CA 3BWWA 1VLIA 4GCAA 1CICB 4R5TA 2VLJE 5TIMA 5F96L 4OJCA 2YSSA 1TZGH 2ED9A 4O02B 1PF3A 4BK5A 1G4EA 1E70M 4LNYA 5C6WH 3EX3A 4EUPH 3QDMA 2DMHA 3RGVD 4HHLA 1QFWM 1FQ0A 4AH2A 4QCFA 4RFEB 1DIKA 3LZPA 1OYCA 1XLGA 5EPDA 3BXWA 1MAML 2ZSVA 3MOBL 2OMXB 4OCWL 4GPNA 4U7MA 1SFDA 4NZDA 4G9DB 4OCWH 1G9HA 2C3XA 3AWNA 3MJ7A 1QSFB 3KPLA 3VFOB 3CFBB 1HCVA 1D2KA 5I3KA 3LKNB 2LU4A 3TCLA 3CEPA 1LK2A 1QTYT 4BEIA 3O3AA 5BOFA 1GIGL 1GSMA 2P76A 2OELA 1O75A 2FGLA 4IP5A 1GIGH 3WFBL 3PBMA 3LRSB 3HOGA 2P7TA 4H01A 2Q8LA 3WFBH 4X6FA 1HH6B 4AV5A 3FFCA 2HVNA 2DM4A 1YNQA 1SXSA 2XWEA 3Q9PA 2PZ0A 3EMQA 4H9TA 4YBLC 4EO5A 3AIEA 1DWFM 1PKQA 1U8IB 3SY8A 4M43L 4RGOL 2VQTA 5EIVA 4MF4A 3HRPA 3NDYE 4RGOH 4NCDA 1BIIB 4HS6A 3WDRA 3MYPA 1R3VA 1IZKA 1J12A 1K3UA 1SO4A 1A1MA 4Y4KC 3IUDA 3T0EB 1X5HA 5D2TA 4NNPL 2ADFL 3L17A 5H4ZA 2X28A 4NNPH 2ADFH 4IMEA 1N8IA 2VAAB 5JW3L 1JZ5A 1KCUH 1P2CB 1XRTA 3G04A 5JW3H 1QI5A 2FYMA 4ZR8A 3R12A 4XZIA 2KBGA 5LVEA 3EH3B 5G4WA 4YMPA 2JKEA 2E9BA 3EGDA 3UYPB 3M1OA 1ED3A 1K7EA 3HE6B 5I3GA 3KBSA 3P02A 1YO4A 3V0UA 1FL3B 3LKSB 2VDNL 2VZUA 4FHAA 4OZFB 3Q94A 1I8IA 3SJ3A 4J8RA 4FYQA 1HHJA 3CZGA 1JULA 3C61A 3PG2A 1I8JA 4HWUA 1BX2B 3IB4A 3VXNB 1KW1A 3TCXA 4IG2A 2ESVE 4MMYA 4Y5VB 4BKLB 5SWUA 2JTYA 4NOBA 1RVGA 2FIQA 1AYRA 1E15A 4MNGA 5EO0A 2FMOA 4AQ1A 1BAFL 2IBBA 2ZRZA 5CSBA 1NFDE 1BAFH 3Q3GA 3VYOA 5IMOA 3D08A 1EJ8A 5BV7C 4HKZB 3QEGL 5HR7A 4DIXA 3PJXA 1BFVL 1E6OL 3QEGH 3ML9A 4JDVB 1TQJA 3NL2A 1XGUA 3TN0A 3MSDA 4P4RB 6TAAA 4IMLB 4MNQD 3NQ6A 4OY9A 4AK2A 1AC6A 4NVTA 4HGKC 5JLZA 2J6EA 2DEWX 3ELAT 5C70A 4LMQE 3GX9A 2Y1VA 2JJTA 5JVLA 5E6RB 4KKLD 3T2LA 1TCMA 4UQ3B 4L8BB 5I3IA 4EUPG 2C19A 2VKWA 2J88L 4DIAA 4WK0B 1ELSA 2GC7C 2Q2LA 4P46D 4X7TA 4MA1C 2J88H 1ZBCA 4ZZ9A 5FO9A 3MVSA 1RY7B 4G1EA 4PM1A 2G8ZA 2YGNA 2FD6L 2OKOA 3WUEA 1I7TA 3UETA 2W63A 1MIML 1QRQA 1MIMH 3DV6A 1RZ7H 3VSVA 2DICA 3EAKA 3RK8A 1I1AD 5HYQB 2DTML 2WZMA 3L7EA 2YKLL 2DTMH 4JRYA 4CCZA 4B5VA 4AEHL 2YKLH 4HZ1A 1W37A 4AEHH 3RJXA 1KPUA 3N6JA 1BTMA 5J6GB 4AYGA 3L08A 1CFBA 2HRPL 2CGRL 2PS2A 1Z9SA 4HPJA 2HRPH 1BVLB 1TZIA 2CGRH 1FC1A 4TXEA 4NJKA 3T2OA 1NCBL 5IR1A 3NJVA 2UY2A 3MRJA 4D0CA 2W9DH 3VFVB 4YHLL 1I3RB 1BKSA 3HLAB 4YHLH 4DP0X 5MEPA 1UZ4A 3SE8L 3QI9C 4XZNX 1A5KC 1E27B 5DBTA 1BXVA 4YSRA 3NTYA 4XHQA 3CIQA 4AMCA 3BMVA 1ZLVK 1GJWA 5CBAA 4L4TB 1D2OA 3UTZA 1AKJB 1DZ0A 3NQAA 1CYXA 3ZR4A 3HG5A 5JHDA 2OV0A 5J04A 4DESA 1PLAA 1NC4A 4Y4HB 2BWDA 2GK0A 3AU1A 1KKRA 4EOUA 3ZJKA 5T1LB 4NYLA 3CSTA 5IK3B 2CRMA 1JV5B 3RKDC 3PREA 4OD1H 1W31A 3VM7A 3RFAA 1ILUA 4TNWK 3H9SA 1A9BB 1MCWM 1J8KA 5TTRA 4JUSA 3DBXA 2MQ3A 4KO6A 5CHNB 3RX8A 3FTUA 5M94B 1FWGC 1T1ZA 3CL8A 2FWOA 3CHSA 4KRUA 1UR8A 2BOCB 1ZCCA 2XU2A 3L4TA 3P81A 4HN8A 3QMRA 1TVBB 5KYXB 4MSSA 3RFZA 4C6QA 3T4AA 4ZTYA 2VJ8A 2Z2BA 3QJFA 1CGUA 3LB0A 4HSHA 2A7BA 5HVHC 4YIWA 1PZ3A 3OVGA 4WJG3 1YDNA 1OT2A 1ONWA 3VFRB 3VXRD 2UV8G 2J43A 3TTQA 2DW6A 2Z92B 3WLMA 2WLYA 3TPUB 1A7OL 2OZ4H 2B59A 3O6CA 1A7OH 1QAWA 3DH7A 1FWSA 1BJMA 3W5NA 2YO3A 1J86A 2DF3A 2G3NA 3RNKA 4ZNEA 1NKRA 4ZFZB 1XF3B 2PDXA 1ITBB 3BWAA 3WS6A 3RURA 3IDGB 3UZQB 3JYCA 5FGCB 4MRCA 5I6OA 1V08A 2NY4C 3OOQA 3WFAA 5F70A 1ZLDA 3N2JA 2BWQA 1FL5A 1G01A 2BJML 2BJMH 2V2TB 1IVTA 3DIFA 4ODTL 5ICYA 2V2XA 4PCNA 1WKEA 4ODTH 1CGWA 4G6AD 1WBYA 4E2OA 4BKTC 5E1AA 3S36X 1CBGA 2ZWZA 3L3IA 1D3CA 3ARDD 4Z7QB 1UJPA 2A6KA 3HPJA 3QA3B 4KCWA 5DY2A 1SY6L 2X7LA 3KJ6H 3FKUS 1BTCA 4Q9CA 1SY6H 4ZX3A 1OG6A 4EZJA 3C2EA 3QQ9C 4KI1A 2CKBA 3T8VA 3R0UA 1XIBA 3SYAA 1JGEB 1OTUC 4G9FE 3ATZA 3EDFA 1W1YA 3BH8B 4XZBA 5D38A 1MFCL 2ZZ3A 1MFCH 1OW0C 2Y5JA 4TNFA 3UEZA 1XLLA 4YO0B 4BZ1L 1YTKA 4ZPVA 3ABKB 1OVZA 1DE5A 2QF8A 5GRYA 1MCEA 1H1YA 1UD6A 5JPNA 5JXED 2IQAA 2VXUL 5L4IA 5KSAB 2VXUH 1Y0EA 2QR0B 3TYZA 4BY3A 3IMSA 3O07A 2ITCB 1L5GA 3AW5A 4NILA 3S0CA 1GVRA 4PRTA 1QA9A 2XQBH 4IRSC 2IH1A 1SZFA 3II3A 3KLSA 4WO4A 4WR3A 2ZCGA 3B40A 4PRID 4C6MA 3EFOA 3ABLB 3QVAA 4LS1A 4PUBH 3D87B 4AYID 2CDGB 2HMIC 3QV8A 2OS7A 3KRUA 3B6SA 2B4CL 1O9VA 1PNCA 5HGHA 3WHE0 5DK0B 2Z34A 5FO7A 1PKOA 5CJBA 3E5BA 2LU5A 5GGUA 1H4PA 3TESA 5EA0H 1R3IH 1XBVA 1A6WL 1F6FB 4CN1A 3K4WA 5CJ5A 3VGAB 3O6FA 3INOA 3BT0A 2YDAA 4PS3A 2BSED 5H37H 4FTVD 1N5YH 2WUBL 1MJ8L 3USBA 2WUBH 3MV7A 1AJZA 1MJ8H 3QC6X 1HH9A 3UMTA 3HIZA 2CO3A 1L0PA 1AGCA 1DQVA 1N68A 2D24A 4PYSA 2KYIA 2W66A 3L2NA 4PJ7F 5LNEA 3JWNE 3L3GB 3W9ZA 4QCIB 5D55A 4Y4FB 4GHRA 1FNFA 4HUKB 4AVNA 4TSAH 3PBWA 1KG0A 1MLCB 4GQZA 4KEUA 2FT6A 2Y63A 1D7CA 4YHEA 1L6FA 3DGGA 4Q22A 4DQWA 4HWNA 5CBEB 4FA7B 3T1WA 4NHUA 4HG4J 4CCEA 4X6CB 5FA5A 1ADQH 2AEQL 4HIJA 4OF8A 4LUSA 5A6IA 8CGTA 1GA2A 3DXAD 1KLZA 2HWGA 1NPNA 3A5FA 3W25A 4X6DF 3ELFA 4ZB2A 1BD2D 3GIVB 4BELD 3H9HB 1UOKA 4FIRA 3PDGA 3WTWA 4PG2C 3VXSD 2O6CA 2VWTA 2C1PB 1G4PA 3NM1A 2B39A 4N5ED 1DXEA 4S38A 3EHBD 4PJCF 5D4HA 2KHAA 4IX2A 1V93A 1VC4A 2X70A 3BPOB 3GMOB 2Y7OA 1HP5A 5KANI 3G22A 1YRKA 4FQQA 3VC5A 3E6EA 4LRNH 2IFGA 1RJPA 4LEOA 4UOZA 4FHKA 3BZJA 4P2RD 4LKXB 2V4LA 4LS0A 1NWUA 5EF1A 4AENB 1TEFA 5HPMA 4N4YB 1H7NA 4U1GC 1WBHA 4ALAC 4UB9A 5T8GA 1YY8A 2QGCA 1L6XA 1PJ9A 2VERN 2P10A 3G6JF 4HK0A 2WNKA 3EXLA 4YFDB 4GNJA 1JPFA 1PKQB 1BGGA 5FYJU 1QR4A 3BEWA 3S1XA 1E72M 3C5QA 3GM8A 2NXYD 2M8XA 2RH0A 4YR6A 5AZ2H 2WB7A 1U95A 3ULUC 4N42A 2A1YA 3PNWB 4KK5D 5JW4M 4PJIA 1HS6A 1UWFA 1YQVL 2BNRA 1F2QA 1YQVH 3WYRA 3RVUC 5MHSD 1KJ3L 1SUHA 1XZ0B 2A6IB 1X6UA 4KO9A 2ZXAA 3O6LL 1A3RL 3G04B 2MKLC 1MEIA 3O6LH 1A3RH 5DHMC 3DI1A 2EUZA 2L04A 1UR9A 5AVNA 2VVNA 1DVFD 4YVNA 3M0KA 3V4LA 1GPWA 1U8KB 2UZXB 1VGEL 3OR7B 1VFAB 1VGEH 4QCEA 4QSFA 4IHBA 4JYDA 4JDTL 4YU1A 3O8XD 4GQ0A 2OZ4A 3M44A 4N20A 4HGXA 5I74C 2IPTL 4PJHA 1IO4C 4EF3A 4N9GA 4PMRA 4QEHA 2IPTH 1EEZA 5C0DB 5H37G 1I8KA 2CR6A 3D0LA 2EAWA 5G55A 1WA2X 3AIBA 1E4XH 5C08B 4CRPA 3CUIA 1OANA 5I1LA 3LS5L 2AL2B 4OT1L 3LS5H 3OKEA 4OT1H 3V4VA 2NY3D 1UIOA 2A3LA 4MNGB 1HL2A 1EMTL 5A6AA 4AQ1B 1JUBA 1BQKA 1EMTH 1JCMP 3ZGIA 3Q3GB 4I6VA 4B3VA 4N2HA 1RR2A 1U8CA 5CC3A 3KCPB 4QHNA 4GG8B 1EHLL 2V30A 1TQBC 1GPOH 2OMZA 3EO9L 1X4XA 5A8MA 1LROA 3EO9H 4IIQA 2VGGA 1Q0YH 1HKMA 3MMUA 1S7XA 4B5ZA 2VLKE 3SQLA 4XZHA 5CZJA 2AW2A 3QJSB 3FYIB 4K23L 2QNEA 4B9YA 4K23H 5DDHB 4YSAA 4CVWA 3MKVA 3EEGA 4OV5A 3W1RA 3SKJL 3NGBC 1AOZA 1UXMA 3SKJH 3K2GA 2GKIA 4P2QD 2NY5L 4UZGA 1GUVA 4U2ZA 2BP5M 3HCVB 4HISA 1BWKA 4G7EB 4NQCA 3GK8L 1H09A 5DI8A 2UY4A 4AIEA 4CD6A 4OLZL 3GK8H 3DFTA 3FO9B 3TIDA 3AADB 4OLZH 3BSZA 4QXTA 4BJHA 2YC1B 4W4NA 4Q52A 2CBUA 4PJGF 4IBYA 5D37A 3LB6D 3QVQA 2G3XA 1RZPA 2WYTA 1EWEA 2MQ0A 3WQGA 1NGYB 3WTXA 5E23A 2GIXA 4EN3C 5GGTH 3W7NA 3OLGA 3DMMA 4JTKA 4GY4A 1ECYA 5F4XA 4I4WA 3RTQA 2W59A 4RGNC 4LRTA 1FVDA 1ZE3C 3RNDA 4JFEE 1N70A 4FADA 1POKA 4P8WA 4XCNB 4CILA 1X98A 2P5WA 3QUHA 4FA6A 43CAB 3IRCA 1DCEA 4C5ZA 1A4MA 4YLCA 4YLQT 4WKAA 1PTDA 3IWUA 2QUUA 2WN2A 4ZS6D 1J88A 3DFHA 3TBSA 3H7VA 4MASA 4M56A 4YDJA 3TYDA 5DGRA 2EIZA 1WHOA 4XT1C 1M7IA 2BVQB 4KITB 3P3RA 2PO6D 1XUUA 3NL3A 4G3YL 3VNJA 5AW2B 2BVYA 4X4YB 1VHNA 4RGNE 1LP9B 3PP3K 2FZDA 3BDBA 4QJ1A 1KLUA 1QRNE 3IFNL 5CEXB 3EH5B 4DWSC 4EJ1C 1TO3A 4DAGL 3PUUA 3DTDA 3C60B 4DAGH 1A64A 4JFXA 2H3DA 4LSPL 1RJLB 4GUPA 4IGHA 3IDJA 1ORSA 3PWPE 4LSPH 4HMDA 3GC5A 4A7UA 2UWEF 1YHPA 1P4LB 3MANA 2YRBA 4AE0A 2H3KA 2CUIA 1TZOA 1P1MA 2A4AA 2NY1C 4X7SH 4LOUC 3ES8A 1KEML 3FA4A 2DVUA 3GSVB 1KEMH 3HAEH 2V3FA 1UB6A 2AP2A 4M3PA 2NY0C 2DSZA 4EANA 1U92B 3PPCA 3ZDYE 5CEWA 3EJJX 5KJ7E 1U8PA 4AY1A 2P24B 3W86A 4HD9A 1LWRA 5EFDA 1TENA 1IEBA 2RAGA 2AEPL 3DK0A 3MV9B 5EU5B 2AEPH 1R75A 1T0PB 4NB7A 4ZUTA 1QWHA 1NY1A 5IMMA 4DBSA 3SE4A 3L5MA 4FYTA