3U7BA

A new crystal structure of a fusarium oxysporum gh10 xylanase reveals the presence of an extended loop on top of the catalytic cleft
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
327
structure length
327
Chain Sequence
AASGLEAAMKAAGKQYFGTALTVRNDQGEIDIINNKNEIGSITPENAMKWEAIQPNRGQFNWGPADQHAAAATSRGYELRCHTLVWHSQLPSWVANGNWNNQTLQAVMRDHINAVMGRYRGKCTHWDVVNEALNEDGTYRDSVFLRVIGEAYIPIAFRMALAADPTTKLYYNDYNLEYGNAKTEGAKRIARLVKSYGLRIDGIGLQAHMTSESTPTQNTPTPSRAKLASVLQGLADLGVDVAYTELDIRMNTPATQQKLQTNADAYARIVGSCMDVKRCVGITVWGISDKYSWVPGTFPGEGSALLWNDNFQKKPSYTSTLNTINRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a GH10 xylanase from Fusarium oxysporum reveals the presence of an extended loop on top of the catalytic cleft.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ENDO-1,4-BETA-XYLANASE
total genus 134
structure length 327
sequence length 327
chains with identical sequence B, C, D, E
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2011-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3u7bA00
4V27A 5HNNA 5BXTA 3VIFA 4HMCA 1CECA 2QV4A 2FHCA 3CZEA 3WQ8A 4F79A 3A6OA 1CIUA 2A3EA 4QLJA 5CXPA 2ZX5A 4WLCA 2YBTA 1XH0A 2GJPA 4GZJA 1CZ1A 1K9TA 1GQLA 1XC6A 4W89A 4AMCA 5A94A 1QNSA 1XSKA 2E9BA 4W5ZA 2JIWA 1GW1A 1A3HA 3WDJA 4AISA 1FH7A 3ARYA 1IZKA 1DWHM 4OJYA 2XWDA 3OGVA 3WY1A 1ZBKA 3MMUA 2DDXA 1V0NA 1W9DM 1UWUA 4M1RA 1XV8A 4Z2GA 1W9PA 3WDIA 1J0JA 1KQYA 3IK2A 4MNJA 3RDKA 5ABHA 5LA2A 1QNRA 1Z32X 1H5VA 4XB3A 2V5DA 3EMQA 3WBAA 1PJ9A 1BQCA 3BAYA 5IFTA 3VD5A 1Q6DA 3AIQA 3THDA 1TVNA 5A6MA 2D0HA 4DUWA 4M8UA 4FLRA 1EIBA 1JDDA 4CCDA 2OYMA 4TOQA 2J7BA 1G94A 1JYXA 2O9PA 3NSMA 5FCZA 4PTWA 1E6SM 2BFGA 1W91A 3AIUA 1E55A 1FP8A 3AI0A 5C8BB 1OD8A 3AHZA 2Y8KA 1QNQA 1V3LA 4U5KA 3II1A 1BVZA 2WMIB 3GM8A 3T2OA 1HJVA 2F2HA 1WO2A 2GDUA 2X8RA 4D6IA 2ZOXA 2YOCA 3N15A 3WDPP 2XVNA 4UZUA 2DSWA 1G01A 2VZUA 1HKMA 5HPCA 2EPOA 4QDMA 3VDHA 4FLOA 3HJEA 3AIBA 3UR7A 3BXWA 2OYLA 3BLPX 3IANA 4CD4A 2ZE0A 1DEDA 2EXOA 5M17A 3AS3A 4S3KA 3A3HA 1KXTA 1J01A 1NOFA 1V02A 3WFLA 1NP0A 4D6FA 2BVTA 3K4AA 2JF6A 4DWSB 5AYIA 2EPLX 1C8QA 2VX5A 1HKJA 3A47A 2GK1A 4GIAA 1W1YA 3ARRA 4W8AA 5CPSA 4AD3A 4GINA 3U7BA 2G3MA 3W28A 1ZBVA 1R86A 4UQ9A 3WD4A 1V0KA 1QNPA 3CUJA 2V38A 1E0XA 1GVYA 1Q4NX 1BG4A 1CGYA 1WZKA 2XSAA 3N04A 2YKKA 1LWHA 4QFUA 4CGTA 3DECA 5BXSA 3MU7A 1GCYA 4MAVA 4W84A 4IISA 4IPLA 3QOKA 3ZO9A 4GPNA 4W88A 2CBIA 5IDIA 4UTFA 2A3AA 4NF7A 3RJXA 2CETA 1WDPA 1OWQA 3WD3A 4PYSA 3PZMA 2ZXQA 5E6ZA 3WNLA 3EDEA 1R87A 4JL1A 5GQBA 1ISWA 3W53A 4P7LA 3AHVA 3NDZA 3W26A 1JZ8A 3PN8A 3PZUA 1H1NA 3NSXA 4UFLA 1YQ2A 3OGRA 2DT1A 1WP6A 3J7HA 3MV01 2AOSA 1HP5A 4PMOA 3SUSA 2VX6A 2CESA 1R8LA 5A6JA 2VI0A 4U3AA 5IHRA 5A69A 3OLIA 2IXUA 1HP4A 2W92A 2E9LA 1C3FA 4UOJA 1GQJA 1V3HA 2GJXB 5E6YA 4PTXA 2J8GA 5TD4A 1G1YA 5DEZA 2ZUTA 4L4OA 3VGDA 2YA1A 3BH4A 1NWSA 5KZ6A 5LYRA 3VPLA 2J8FA 3CHFA 5AY7A 1JDCA 1HJQA 1XGZA 5A6KA 2A3HA 1E4MM 1D7FA 3G6MA 4E8DA 1C92A 4B3LA 1HN1A 1RPKA 2ZXDA 5DFAA 5A2CA 2GFTA 4QP0A 4KGLA 1J0IA 3CUFA 2WB5A 1UWTA 3F5LA 3BMVA 5DMYA 3CGTA 1CXEA 4ZFMA 4D1JA 5I0DA 9CGTA 3MS8A 2DEPA 2WVVA 5M3WA 1B2YA 8CGTA 5ABGA 4PMUA 4GO9A 1ZS2A 5A8MA 2YL6A 1JF5A 2X05A 1B3XA 4F9JA 1Y7VA 1EOKA 4TTUA 3VINA 2XWEA 2BVDA 4TX6A 4AW7A 1UR8A 1CTNA 3RM9A 3CHDA 2JEPA 3ECQA 1UQYA 3TONA 3ZJ7A 4BF7A 2Z1SA 3PZTA 3ZM8A 4D72A 1JZ7A 2ZX9A 1JZ2A 5A3HA 3A4XA 2GJRA 2AAAA 1AQMA 4ATDA 1M04A 4PUDA 1E4NA 4OIFA 3ZR6A 1UUQA 1AQHA 1NARA 2WCGA 5IHSA 1IV8A 4WSJA 2NT0A 2DSUA 4CN1A 3UCQA 2G8ZA 4Z2KA 3ARUA 5M03A 2DIJA 5D8ZA 2XFRA 3BAXA 2WLZA 4AIUA 3HMCA 2QPUA 4B15A 1VAHA 1CGXA 2WZHA 5A6BA 4OOUA 4UFJA 4C7GA 3W25A 3VGEA 3MO4A 4W5UA 1H09A 5A2AA 3SUUA 5BWFA 5ABEA 1LQ0A 1XD1A 1JZ4A 3WQWA 4U31A 1WB0A 2WXDM 4ZXLA 4J3WA 5E70A 3WUGA 2CHOA 2WNWA 2XFYA 3CBWA 1V02E 4D71A 1QI4A 3UESA 1CENA 1B31A 4PMYA 1FP9A 2YL5A 1TG7A 5A6AA 2JFEX 1TA3B 4RL3A 1UA3A 3T2QA 3SURA 3N9KA 4W93A 1BYDA 3SIMA 5A1AA 2WANA 1U33A 2E0PA 1KBKA 3L2LA 2OSXA 1HNYA 1FHDA 3AIEA 3LPPA 3VKKA 5BRPA 4HOZA 1EA9C 3W38A 1W32A 1DWFM 3WNNA 5I77A 4HZ8A 3FHQA 1JG9A 1QHOA 2IXVA 8A3HA 1KBBA 3AS2A 4UCFA 1E6ZA 3AMLA 3U7VA 2YL9A 2E8ZA 3BCFA 5GPRA 5CSYA 1XSIA 1D2KA 1JZ6A 2VOTA 4J28A 1V0MA 4PTMA 2XVPA 1JD9A 3VGGA 4EE9A 4PMDA 1W2PA 3BC9A 1DWJM 5A8QA 2FGLA 1Q6CA 3ZQ9A 2GJXA 2WZIA 2OYKA 4V28A 4W7VA 1KXHA 3MUAA 4AIEA 3GXDA 4JCLA 3WEZA 1FFRA 1TMQA 3PHAA 1QBAA 4AZIA 1NOUA 2A3CA 1EGZA 5CLTA 4LPCA 3WD1A 3CZLA 4XUYA 3S2CA 3ARVA 1E56A 3AZSA 1VF8A 2Z1KA 5EFFA 2FGZA 4HMDA 3LPFA 1CXKA 3VGBA 1GJWA 2DIEA 3GNPA 1J0ZA 4UFIA 1ZU8A 3W37A 4U2YA 1CDGA 1OGGA 2O9OA 1TVPA 1KCKA 4JL2A 2EEXA 3CLWA 3AYSA 3VX0A 2PF0A 4KH2A 4E2OA 2WSKA 3DC0A 2ZWYA 1NWRA 5BXRA 3PZQA 3WH6A 2F61A 4DUVA 3RILA 3VD4A 3CUIA 3PTQA 3VD7A 1ZJAA 4C7FA 1TCMA 1PX8A 4D6CA 2WVTA 4BQ5A 1ODUA 1VFFA 3FAWA 1LJYA 3MUIA 4GZIA 1O7AA 1JXJA 1X1NA 4J3UA 2VTFA 1H4PA 1VJZA 4AZBA 4OKDA 1NOWA 2D20A 2J7CA 2J25A 1BYAA 4YHGA 3SEPA 2X09A 2GVYA 4PCSA 1ISYA 2VMFA 1E1FA 1NH6A 3M46A 1DWIM 1ESWA 1H3GA 3ZMRA 2YLAA 4Y7EA 3N1AA 3PZOA 4CN6A 1US3A 1IT0A 1H49A 3NYDA 1VEPA 3WD0A 3F4VA 1XCWA 1NP2A 1UOKA 4EAMA 2J75A 2PBOA 1BAGA 5E0CA 3GZAA 4GQRA 4Q7NA 3SCWA 3D3AA 1O6IA 1V0LA 3MSGA 4MNKA 1NWTA 1QNOA 1SFSA 4NI3A 2EPMX 2JIEA 4J3VA 3ARWA 2BXZA 3FW6A 4X0VA 1WDQA 3TTYA 1E6PA 3G6LA 3NSNA 1OT1A 4D6JA 1LLOA 2X0HA 3GXIA 2PBGA 1GUVA 5A8NA 2YDRA 4UZSA 4H8VA 3WBEA 3M07A 4X0NA 4HTYA 4WK9A 4Z2HA 2EPKX 1GJUA 3L2MA 3UG5A 1E71M 1V3JA 2ZIDA 2QF8A 4AC1X 1GZJA 4HPGA 2WMJA 1XYZA 3SCUA 3ALGA 3UETA 2CKSA 2O9TA 4E8CA 5CQ1A 2D22A 1W1PA 2W67A 3EDDA 5CLWA 2VRQA 4A3YA 2D0FA 1DWGM 2ZUMA 4UQBA 1WDSA 2ESCA 1MFVA 2XGIA 3KL3A 3NUKA 2V3FA 2QMJA 3PZGA 4KRTA 3PZIA 3RJYA 4UQCA 1EQCA 3FXYA 3ALFA 3WEOA 2VO5A 4JHOA 1E43A 1VIWA 3VIHA 2CERA 5GNZA 3ZJ8A 1J11A 2J79A 2WVUA 2UY3A 3EDFA 5D4YA 1FH9A 1SR0A 4F9DA 2XJ7A 2VCAA 5D9MA 1I75A 3WUBA 2DH2A 3CZKA 2VZOA 1J12A 4JKKA 3WFZA 3M6DA 1XH2A 5EBAA 3SUWA 2VCCA 3ARQA 1W9VA 3POHA 2WC4A 2J77A 2XUCA 4PCTA 1HIZA 3GBEA 3B9EA 1E6QM 4NRRA 1J10A 1EDTA 5FL0A 4TUFA 1MWOA 3GTNA 4TXEA 1MXDA 2ZUUA 4W85A 3GXFA 1QHZA 3WQ4A 3N18A 3AOFA 1GNXA 3M7SA 1HJWA 3WNOA 1E1EA 1W3KA 4KMQA 4CU6A 4QLKA 1LG2A 1C93A 3VILA 4M81A 1EOMA 5I24A 2J78A 3HU7A 2QPSA 1G0CA 1JFHA 1PIFA 1H41A 5I5RA 1W3JA 5M5DA 3WH7A 1PZ3A 3W29A 4KGJA 3MV11 1MQRA 4TVDA 1LL4A 1UH4A 1B1YA 1G9HA 2G3NA 5I6SA 1S46A 2FDMA 1NM9A 1DWAM 2VZVA 5D9PA 3KL0A 1WDRA 1H0GA 1EHNA 4M24A 3W6MA 3WL1A 3ARTA 1DHKA 1UKOA 2HISA 1FOBA 4OBRA 2WMIA 2VQTA 4OZOA 4ACZB 5A8PA 2JALA 2WHMA 1RH9A 6A3HA 2XHYA 2VT0A 2EBNA 2PWGA 1VB9A 1B3VA 1ZBCA 1QOXA 1BYCA 1E5JA 2DT0A 1VEOA 1BLIA 1M01A 3VIIA 5BYWA 5FD0A 4EKJA 2E8YA 3L4YA 1RP8A 4W8LA 2OWCA 3WUFA 2D3LA 4EANA 3N17A 4BS0A 2VVSA 1GQKA 1JDAA 3VIKA 2WYSA 5A6LA 2NT1A 1V03A 1ITXA 2CPUA 3B8SA 3TOPA 1QW9A 5C70A 2YL8A 1J9YA 3OZOA 4MTVA 3THCA 1VJSA 1KR1A 3AXHA 1B90A 3CUGA 3AIWA 1OGBA 1BG9A 1W9UA 4ZEPA 3WNMA 4HU8A 2BXYA 1E73M 4ATLA 1CNVA 1V3MA 3VDAA 3DYPA 1GVIA 4LYPA 3TTOA 3L4ZA 4GI9A 4B3KA 1V3IA 1EHAA 3NJ3A 2VR4A 4PMVA 2NW0A 4TVUA 3UERA 2VR5A 1K9DA 2WZEA 1Q6GA 4OOZA 1C8XA 1WAWA 4YHEA 4WKFA 4YN5A 2OSYA 4AY1A 1OM0A 1MFUA 1JZ5A 2XM2A 4UQEA 3QHNA 1B3WA 3GNOA 1BF2A 1HVQA 3NCOA 2X1IA 3BSHA 1UD4A 3WDRA 1UZ4A 4HOWA 4E4PA 4MJ2A 3ZT5A 4DUXA 2PWEA 3WDQA 1KGXA 2CNCA 2WK2A 2VRKA 2VVNA 4WIWA 5GNYA 3MMWA 2ZX6A 4RE4A 5BROA 2VJXA 4PMQA 3RO8A 5A6SA 3BMWA 4GZEA 1UQZA 2Y4SA 3RCNA 1PZ2A 2VCBA 4AZ6A 1M53A 1E5NA 3GDBA 3K8MA 1AVAA 1BVNP 3O9NA 3N13A 4JZ5A 4EK7A 1A47A 4TX8A 5ABFA 3LMYA 4P8WA 4AD4A 3K46A 3T0BA 1E0VA 3GH5A 4XZWA 3APGA 4CU8A 4AZ7A 1ISVA 4P8VA 1MQPA 4M29A 2CCRA 5CPTA 4AD5A 3TP4A 3WH9A 4LQ1A 2W63A 2J7FA 1OCQA 3WF1A 4CU7A 4HA1A 1CBGA 1TR1A 1BGAA 1JL8A 3VX1A 1WZMA 1UHVA 4W8BA 4JAWA 2CKRA 1K9FA 1KXVA 3N11A 5JBEA 2J7GA 2W91A 2BS9A 4GXPA 1UD6A 3VIPA 1QBBA 2W5FA 5DO8A 3CHEA 4HPHA 2WPGA 1UR0A 4S3JA 1VFUA 1JYVA 3ZIZA 1V6XA 3KWXA 1B0IA 1DTUA 1MXGA 3VUPA 2WM0A 2D0GA 1GOWA 1QI0A 4PEEA 5IXEA 1CPUA 2Y5EA 1W3HA 1L8NA 1F4HA 2CBUA 2O9RA 2ZX7A 3CIVA 2XTKA 2YDSA 3WNPA 5AC4A 1WE5A 2XVGA 3VOCA 4HZ6A 4AEEA 4IUGA 4NRSA 1GOQA 1QI5A 1SMAA 5HPOA 4H41A 4DM1A 4QCEA 4UOQA 2C7FA 3GH7A 4FK9A 3WENA 2HVMA 2F8QA 2JF7A 5E0FA 4GI6A 3BSGA 1D3CA 4PMXA 1CYGA 4URIA 1UKSA 1OB0A 3W81A 1BFNA 2WMKA 3UR8A 5I3DA 2C0HA 4AD0A 4XX6A 4Q22A 2VURA 3WN6A 1CGTA 1B30A 2YIHA 1WCGA 4MB1A 2W61A 4RE3A 4B9ZA 2BY2A 5AC5A 1SYTA 1CLXA 2BY0A 1HT6A 4P7OA 3BAKA 4BQ3A 4JFVA 2E4TA 5I2UA 1GHRA 3TA9A 3ARPA 3WMSA 6TAAA 4J7RA 1KWKA 5JBFA 1GQIA 1X6LA 3CHCA 1WNOA 1QVBA 4P7RA 1E0WA 2VUYA 3VNYA 2VC9A 3AMDA 1YHTA 4UNIA 2D23A 4H2CA 1BTCA 3OLGA 4ATWA 2VRJA 3CPUA 2BNJA 2W62A 1JF6A 2ZX8A 2VX4A 1XRVA 2OWWA 2FHFA 2WW5A 3CMGA 1V6UA 2C8NA 1UR9A 4MJ4A 1BYBA 3T08A 1M03A 3WSUA 2XFFA 3ARXA 4PMZA 3RMEA 4LGXA 1VBRA 4B16A 4DWSC 1UKTA 5E09A 2GDVA 1NQ6A 1GPFA 3VD9A 2UWFA 4XV0A 2V3DA 1Q6FA 1EH9A 4GQQA 3VDCA 5HOSA 1CLVA 1B3ZA 3AQUA 2UY2A 3SCRA 1W3LA 3SUTA 2WKGA 4X9YA 2YLLA 1UR4A 3EYPA 1XHGA 2MANA 5A95A 2RGLA 4WF7A 4IPNB 2G4FA 3BLKA 4Z2IA 3EBVA 3FAXA 3OLEA 1HX0A 1LL6A 1EO7A 1CEOA 3WF3A 4QAWA 3WQ6A 3BAIA 1FHLA 3IJ7A 4JFWA 1N82A 1E4IA 2J74A 1VFOA 4WSKA 4HA3A 4W7WA 2BY1A 3K4DA 1JI2A 1RD6A 1OGSA 2BHYA 1UWSA 3W4RA 1CGVA 4D6EA 1UKQA 4JFUA 3EDKA 3UG4A 2Y24A 2WAGA 1E3XA 1OIMA 3MSDA 1R7AA 3WMBA 3VM5A 2UY4A 3AMGA 3RM8A 3EDJA 5IFPA 1K9EA 4HZ7A 2DSZA 2XVLA 5BRQA 4AZ5A 3AS1A 3VMNA 7A3HA 2B31A 3AIVA 3NDYA 2BV9A 3BAJA 4OBSA 3VVGA 4GO8A 4MADA 3GH4A 2G41A 4BA0A 4JIEA 4M80A 5D9NA 3WF2A 1W9BM 4YPJA 3WQ5A 1KWGA 4AZCA 3DYOA 3W24A 1LL7A 2VNCA 1MVYA 2ZUWA 2EPNA 4W87A 4MDPA 5CGTA 1OIFA 4BZYA 3VGHA 2D2OA 4AZCB 3IAQA 1VFMA 3L4VA 2NSXA 2CBJA 5E9AA 3CMJA 4Z2JA 1UD3A 2VQUA 4W86A 1UD8A 1HL8A 1KXQA 2CEQA 3ARZA 2TAAA 3GBDA 1TA3A 3AZTA 5HXMA 1ZBWA 1E3ZA 3ARSA 5GNXA 4V2XA 4P7NA 3DHUA 3PTKA 3MANA 1MW3A 1C7TA 4TTGA 3K8LA 5BXPA 1UH3A 2E3ZA 3MUY1 5D9OA 3FN9A 3EMZA 3D5HA 2J7DA 5JBDA 2PB1A 2WMFA 1GORA 4HU0A 4OUEA 4UFMA 3LPOA 1PAMA 1CXFA 2WHKA 4FLQA 3AISA 5ECUA 4HA4A 1W1VA 2YJQA 3B9DA 2GSJA 5KEZA 2XIBA 4J27A 2ZUVA 2CHNA 3WELA 2XPKA 2YA2A 5F7UA 4UQAA 1JNDA 2WVVB 2D1ZA 2XGBA 1HJXA 4CN4A 3AMCA 1OT2A 3VD3A 5EMYA 1J0YA 1OSEA 1W9XA 3WKZA 4U3CA 2WHJA 1C8YA 3IJ8A 5JIPA 4J3XA 3SCOA 2V5CA 3PTMA 1GOOA 1FFQA 1R7OA 3N12A 5JIWA 3ZJ6A 4M82A 1PPIA 1JNEA 2EQDA 2XYLA 1BSIA 3PZVA 2DH3A 3T0AA 4GKLA 2OLHA 1J0KA 1BHGA 3ZSSA 3WH8A 4ACZA 1TE1A 1ODZA 1HJUA 1VRXA 1LF1A 3VMPA 1DP0A 2ZXBA 2YBUA 1ISXA 2PC8A 3WEMA 2WC3A 3B9AA 4ZE5A 1BPLB 3T2PA 1WKYA 3VMOA 1XYFA 5ABFB 4H8HA 3GYCA 4FLSA 4CKQA 1C90A 1CGUA 4CD8A 4LYRA 2Y2WA 3ZT7A 2D24A 5CZKA 3FY1A 2E40A 4QLLA 4UFKA 1KQZA 3WIJA 1ITCA 1HL9A 2WVSA 4WJXA 1CGWA 4A3HA 3I3EA 1PX4A 3AHXA 1E6RA 3VGFA 1QI3A 4MB3A 5DT5A 2PWHA 4IM4A 1JI1A 1XH1A 5EB8A 1E70M 1HJSA 2PWFA 4P8UA 2FH6A 2ZUNA 3SCSA 4PTVA 3A4AA 3L4XA 5D8WA 4CVWA 1OINA 3I3BA 5CSUA 1MW1A 3U5YA 3PZ9A 5CG0A 1MYRA 1I1XA 3WF0A 4KRUA 2X2YA 3PBGA 4CVUA 3QHMA 1ISZA 3AZRA 2WMHA 4J3TA 2WCSA 3GNRA 1V6VA 3VTRA 2XG9A 4R5EA 2AMGA 1M7XA 1KCLA 4JFTA 3BCDA 2QHAA 3RIKA 4RE2A 2A3BA 4AXNA 4AD2A 4AZHA 5I79A 4PMRA 3T09A 3AXXA 1V08A 2WBKA 3JUGA 3F5JA 2BY3A 5CGMA 2XSBA 1C91A 1U30A 3QGVA 3KL5A 4A4AA 2BHZA 3KZSA 3KE0A 1R85A 1P6WA 4HMEA 3AYRA 2VL4A 2J62A 4H04A 2WSPA 2V3EA 3QOMA 1U2YA 5FKYA 1JYNA 5HDRA 1KB3A 3NIYA 1SMDA 1TZ7A 2YA0A 4NSBA 4CD6A 1GOKA 1IZJA 2WHLA 3AHYA 1UWQA 1EXPA 1KR0A 2CITA 1JXKA 4AWEA 1PEZA 1UWRA 3SCVA 3VDBA 5LA1A 3L4UA 2X0YA 5FL1A 1VEMA 2EO7A 4W7UA 1J0HA 2DT2A 3W0KA 1V3KA 3FHAA 2ZICA 1UYQA 4NZCA 1PIGA 2BVYA 3I3DA 4LXFA 4D6DA 1HKIA 3GXMA 4U5IA 2DT3A 3WDHA 4JKMA 4LYQA 2PI6A 1UH2A 1ZB5A 1GHSA 4FF5A 4ML4A 4ACYA 1RP9A 3WMCA 5C71A 3OG2A 4M56A 4HOXA 2E9MA 3IJ9A 3W6LA 1V6YA 1C7SA 4PMNA 2GUYA 2OWXA 5FOOA 1JIBA 3OGSA 1Q6EA 1GONA 2DQXA 5JUVA 1UD5A 3K1DA 4WKHA 1EO5A 2XM1A 1QI2A 4PBGA 3U57A 1LWJA 1LG1A 2G3JA 4UOZA 2CBVA 5EFDA 2W4XA 1E4LA 4GI8A 4C7DA 2WCAA 1QPKA 3VIOA 4AYSA 1W2VA 2ZUSA 3LPGA 3S6TA 4MDOA 1W1TA 4H8UA 2JEQA 1CXLA 1QW8A 3OB8A 3VNZA 3O6AA 2WLYA 3MKKA 2J7EA 1PBGA 3CTTA 1JAEA 3CZGA 4AEFA 1H0IA 2WWDA 4P7QA 1XSJA 3T0DA 1E72M 2V3GA 1QHPA 4MNMA 1EDQA 4QCFA 2WC7A 1X6NA 2J7HA 5A2BA 3W27A 3IAPA 4D6HA 4JHZA 1E40A 1HXJA 2QLYA 5LA0A 1JZ3A 3AMKA 4FMVA 4D1IA 4ZE4A 1L0PA 3AFBA 3WH5A 4JKLA 3F5KA 3VIMA 4WKAA 2DSVA 4BCEA 1OD0A 2FHBA 7CGTA 1E6NA 2WKLA 6CGTA 3MMDA 4K68A 1JD7A 3RM4A 3DYMA 1K6AA 4CCCA 1CXIA 3ZT6A 1F4AA 4BQ2A 1HF6A 1JAKA 3MUZ1 2WBGA 3HN3A 2VX7A 1E9LA 1OBAA 2BHUA 4DWSA 2J47A 3SCPA 3WD2A 1ECEA 1H11A 1V6WA 3QR3A 3U5UA 2CIPA 2ZWZA 3OZPA 1KGWA 3OLDA 4AD1A 1GOIA 3TTSA 1MW2A 5DT7A 7TAAA 3CZ8A 3AS0A 1E15A 3L4WA 4TVCA 1NWUA 1ZJBA 4ZXOA 1WZAA 4HP5A 2OSWA 4P8XA 4DWSD 1UA7A 1WPCA 2CXGA 3ZJKA 5BCAA 4N42A 1AMYA 4F66A 3TTQA 3UG3A 2VZSA 3E1F1 4PN2A 1UR2A 4H7VA 4LX4A 3EMCA 4UQDA 1B3YA 3UEQA 1XCXA 4Z2LA 2QMKA 1UZ1A 5CPQA 4J3SA 4MAZA 4UR9A 1GOMA 3OA5A 4JFSA 5I78A 1UG6A 3O2LA 4JCMA 1BGGA 3WNKA 2O92A 5AYBA 2J4GA 3AXIA 1EDGA 2YDQA 3PZNA 3SCQA 1I1WA 3A4WA 4R27A 1VBUA 1MW0A 4U2ZA 4PUEA 1JYWA 1FA2A 4L4PA 4PRWA 2JE8A 2WMGA 3DHPA 4BQ4A 3AJ7A 2PWDA 1UWIA 4DM2A 2DPEA 3ZSTA 3WF4A 1JFXA 2FH8A 1UR1A 3AROA 1H2JA 4MB4A 3VIJA 1B9ZA 1E6XM 2DGAA 2IUZA 5HBFA 2UY5A 1CXHA 2CYGA 3WUEA 3CH9A 1PX3A 2EJ1A 5FIPA 4KWUA 2VZTA 2D3NA 4CD5A 3VU2A 1J18A 4MB5A 4PSPA 1ZL1A 4CD7A 3CZJA 2XIIA 1WZLA 2GK1B 3VO0A 3BGAA 4D6GA 1HKKA 2Q8XA 3KEHA 1EQPA 5A8OA 4CUCA 1XD0A 1TFVA 3QHOA 3AIRA 4B9YA 1TUXA 1VENA 3WL0A 4N0RA 3OBAA 3OIHA 4PSRA 5DF0A 3AHTA 3K8KA 3SCTA 3RPMA 3W82A 1KFWA 3SCNA 3SUVA 4UFHA 4XZBA 1FH8A 2RGMA 4AZGA 2WWCA 1KGUA 3L4TA 3VM7A 4AIOA 2ZXAA 3CO4A 1UD2A 1UKPA 4U33A 1US2A 3FNDA 3WQVA 5CJ5A 1HVXA 3ZR5A 3AICA 3ZOAA 2Y8VA 4ZENA 2G3IA 3CUHA 4MPKA 5I23A 4MNLA 4F8XA 1G5AA 2W66A 4CCEA 2DSKA 5A6BD 1AQ0A 2XVKA 3BAWA 3POCA 1MQQA 1CWYA 3VIGA 1JGIA
chains in the Genus database with same CATH superfamily
1P0DA 3G77A 3LBMA 5HNNA 3TYEA 3WQ8A 4ZTYA 4IIFA 1CIUA 2ZX5A 3BMXA 1ZSXA 4WGXA 4M3PA 1XH0A 3R8GA 4GZJA 2QJMA 1SJCA 4A29A 3S8HA 1GQLA 4O50A 1S2WA 3UYCA 4AMCA 5A94A 4PZVA 2QCMA 2BLEA 3HGJA 2PDNA 3W2LA 2XDFA 3ARYA 1IZKA 1DWHM 2XWDA 2Z28A 1ZBKA 3G1VA 1W9DM 5F4SA 1UWUA 2OQLA 3ZLGA 4GVIA 1AUSL 1DJZA 1FWTA 5H91A 3WDIA 3IK2A 4GUFA 4MNJA 5LA2A 2F38A 5I3KA 3WBAA 1UZHA 5IFTA 1J8VA 1VGAA 5G4WA 2QV5A 2HWGA 3RLVA 2XINA 1XPGA 1QWKA 1LBFA 3KRUA 2FMNA 3PC0A 3PR2A 1FP8A 4RNIA 4UWMA 3AHZA 3NGFA 1QNQA 1SZNA 2C3ZA 1ZNNA 2F2HA 4XVDA 4LSBA 4D6IA 3N15A 3OG3A 4PR4A 1ZTVA 4JIPA 4HJWA 3T1GA 3V3WA 3WDPP 3SGZA 3P82A 1G01A 2VZUA 1HKMA 3G5EA 2Q8LA 3S1WA 1GJPA 4HKPA 2BZNA 1I60A 2OYLA 2HVNA 1F7BA 1GKQA 1AZ1A 2FZ8A 2OZ8A 3OPSA 4MWAE 1VCFA 1DEDA 3AS3A 4GCAA 1H7OA 2QJGA 1GOXA 3QY7A 1RJQA 3EOEA 4R85A 1J01A 4H1ZA 4IP5A 4UNLA 1NP0A 3BW3A 1W1IE 1DOSA 3QXBA 1C8QA 2X1RA 4NJHA 4IJCA 4GIAA 4EXAA 3EXRA 4AD3A 3EOUA 4IMEA 2AL2A 4JQ3A 1XGDA 4PBEA 3I6EA 1EP3A 4REQB 5CG7A 3REQB 3CAWA 1BG4A 2XSAA 2YKKA 3HURA 3CHVA 1LWHA 3GVRA 2V82A 3DECA 4ZA0A 4W84A 3RG6A 3ZO9A 2CBIA 4UTFA 1EX5A 1WDPA 2XIQA 1OWQA 3PZMA 1Q3NA 3U2EA 3S5ZA 3C6CA 3EDEA 1R87A 1H7XA 2C1GA 3CMFA 4L1XA 3TYZA 3TN4A 3M7WA 3PN8A 4UTWA 1Z9AA 2DT1A 1WP6A 2J6XA 4JICA 2X7VA 1KM1A 4PMOA 1TWSA 3N6HA 4B2DD 4YXGA 1R8LA 1IIHA 5A6JA 1DHPA 4U3AA 5A69A 1KBJA 4A8RA 4Q8TA 1R3TA 1HP4A 2W92A 3U0HA 4UOJA 1VFLA 5E6YA 3RHGA 4PTXA 4AAJA 1SZRA 3U8GA 4M6QA 1OK6A 3BH4A 1A5MC 2WJZA 1AD4A 1YDNA 2J8FA 1GYNA 4PB3A 5AY7A 3TQPA 3U48A 4GIRA 3W2MA 4XWUA 2ZA2A 3E2RA 4B3LA 1GG0A 4IGNA 4C60A 5DFAA 2A4AA 3W88A 3UCCA 1O66A 4YWIA 2Y7FA 4QP0A 2CLOA 1JQVA 3NURA 4NIRA 5I0DA 1BKSA 3DU0A 4FXJA 3PJWA 9CGTA 2DEPA 4R88A 1LRTA 2YBVA 8CGTA 4PMUA 1AFSA 5A8MA 3E0IA 2INEA 1R2RA 1RXOB 2X05A 4QAIA 1R9YA 2O55A 2B7NA 3CH0A 1GW9A 4IQDA 2PTXA 1R6WA 5I3FA 3S2JA 4TTUA 2EGZA 3ZVIA 4TX6A 2FIQA 1BWVA 1UR8A 2HQAA 3B9NA 1CTNA 2Y6ZA 1DJIA 4C6FA 2Z2AA 3ZJ7A 4D72A 3NR0A 3ENLA 3A4XA 2V2DA 2BTMA 1AQMA 1XQKA 3QZEA 4PUDA 3SQMA 2PU0A 2WCGA 2GL5A 5K3VA 3U3HA 2DSUA 3URBA 3UCQA 3M4HA 4Y9OA 4Z2KA 2NVDA 3ARUA 3B0VC 5M03A 3S2MA 1OG0A 3DH7A 5D8ZA 2XFRA 3BAXA 1OF8A 3HMCA 4ZB0A 2QPUA 4L6DA 1NAL1 1VAHA 4YU1A 3GDKA 3HV8A 1BXNA 2WZHA 1HG3A 4UFJA 5C2XA 4XISA 3MO4A 1LRNA 3W7IA 5ABEA 1UROA 3LCIA 4G1NA 4U31A 2WXDM 4QROA 3UJFA 2CHOA 2WNWA 2XFYA 1QU4A 4EX4A 3UESA 3THUA 4OECA 5A6AA 3L68A 1XGEA 3GR8A 4EXQA 3STPA 1POJA 3UGRA 5KZEA 4JXCA 1BYDA 1EEPA 3SIMA 1P1MA 1OFPA 4O0KA 3LHWA 1XYMA 1N8FA 1W32A 2D2GA 5I77A 4FF7A 8A3HA 1KBBA 1S5TA 3PUGA 1Q6QA 3QEZA 4OQVA 4HN8A 2IKGA 3W7RA 4DZHA 1JZ6A 3R10A 4J28A 1V0MA 1OYCA 2XVPA 1JD9A 3FKKA 2PRHA 1PO9A 3BC9A 3MVTA 1DWJM 1Q6CA 1VHCA 3NNTA 1J2BA 4L9YA 3MJMA 1OX6A 3SGGA 1KXHA 3RRAA 4A22A 5AVHA 3W1LA 4HHLA 4BEQA 1TMQA 3PHAA 1QBAA 3M0YA 1DXFA 1IHIA 3WD1A 3CZLA 3M0LA 4XUYA 2FZNA 2H90A 4J3ZA 2BVWA 3MCMA 1U5JA 3GU2A 3VGBA 3P67A 4OE7A 4QXIA 1EJ7L 3SFWA 4U2YA 5REQB 2ATSA 1W31A 1PIIA 2EEXA 2P0OA 1VKFA 3VX0A 3LCLA 2PF0A 5B80A 3SQLA 1GEQA 1DE6A 5CBJA 2WSKA 4NVTA 2ZWYA 1T40A 6REQB 2F61A 4GXWA 4DUVA 4C1NB 3VD4A 3PTQA 5CEWA 1ZJAA 3QVQA 4JTDA 4C7FA 1VFFA 3FAWA 3QYQA 1EGVA 1PSCA 4GI4A 4HGXA 4MKVA 2FPYA 1EC7A 1X1NA 3T07A 4J3UA 2VTFA 3H26A 2J25A 1BYAA 1RBLA 1J6PA 3UY7A 4S23A 2GVYA 4MYAA 5LGXA 4PCSA 1FDYA 5CPNA 1ISYA 2VMFA 1CI1A 4EWND 1E1FA 3EPNA 2YLAA 4PMJA 3KRBA 3SY1A 2OOGA 4QNWA 4Y7EA 3PUEA 4YVVA 1US3A 5DLCA 2V2HA 3TCSA 1R47A 1EC9A 3K13A 3LN3A 1ZZMA 1GVOA 2NSOA 3GZAA 4GQRA 4Q7NA 2VD9A 1EJTC 4ADTA 2Y85A 4C6MA 2GYIA 4MNKA 3YPIA 1EIXA 4KKXA 4NI3A 3E96A 3OHMB 4CLMA 4J3VA 3FW6A 1C9WA 3GNNA 1E6PA 3F4CA 4NL1A 2X0HA 3WLMA 4FSAA 1GUVA 4RZ4A 4O8RA 3GAKA 4H8VA 4NJGA 4Z2HA 4EPDC 3LTSA 2EPKX 4N02A 3APTA 3RPDA 3BVJA 1J2WA 2ALDA 3UG5A 1QJWA 1E71M 1S2CA 1TPUA 1V3JA 1KFCA 5I06A 3FS2A 4HPGA 2UZ9A 3UETA 4JEQA 4E8CA 3S3GA 2G3FA 2HK0A 1W1PA 2W67A 4PCNA 5CLWA 2CLMA 3W1NA 4KFPA 4CNTA 2D0FA 2E6DA 2ESCA 3ABQA 3KL3A 1N2VA 4AXKA 2QMJA 3PZIA 4LVAA 1H5YA 3RJYA 3FXYA 3ZVHA 3DHFA 4FR1A 2ZVRA 1MDRA 1E43A 2AGKA 1J11A 2J79A 3SFKA 4H83A 1JRBA 5D4YA 2DU2A 3LHZA 4CQDA 3IRSA 2VCAA 2EPHA 2DH2A 3M6DA 1K4HA 1RA0A 4M7SA 2HEJA 1W9VA 2PDCA 2XUCA 4JQ2A 4ZQCA 4NRRA 3HM7A 1EDTA 4KCUA 1UR3M 2OR2A 2R24A 3L23A 1PTDA 4GA8A 3TC3A 3N18A 2BDQA 4MSSA 4MZ8A 1HJWA 2I5QA 3WNOA 1W3KA 1LG2A 1EWEA 1S39A 4JD4A 4MF4A 2J78A 3HU7A 1XLIA 3DN5A 1J5SA 1PIFA 3W7NA 5M5DA 1UCWA 1A5BA 8TIMA 3AYTA 3LNMA 3P6LA 4M6VA 1E1CA 1LL4A 3ORWA 3NZRA 3WK2A 1S46A 2V69A 3HFYA 4KESA 2QUMA 1DWAM 3QV7A 3ITTA 4R34A 2POZA 2G97A 2VZVA 5D9PA 1PKLA 1DPMA 1WKFA 1X8FA 3KL0A 4YYFA 4C6JA 3ARTA 4XUGA 3EWBX 1FOBA 2WMIA 2X2GA 3LRMA 4D8ZA 4AFYA 1U22A 5AC6A 5A8PA 1LTDA 3QPYA 3CS2A 4LAZA 5HNUA 3SDOA 2WHMA 1RH9A 4GCXA 6A3HA 2VT0A 4O1DA 2PWGA 3UY8A 1VB9A 4XZHA 1T41A 3F03K 3K30A 4QIUA 1PDZA 2E8YA 3GUGA 3EAUA 4LUTB 1RP8A 4W8LA 4LUJA 3MJYA 1SZGA 3B8WA 2VVSA 1GQKA 1JDAA 4K39A 2X41A 3RXZA 2HE8A 2NT1A 4YTUA 4KF1A 1Q5MA 1DJNA 3B8SA 1OQFA 1W17A 1EJUC 1J9YA 2QCDB 4WD0A 2PP3A 3W07A 4MZ1A 4L80A 2GWNA 2RJHA 1BG9A 4ZEPA 1XIGA 1TWZA 3PB0A 3QW3A 4S38A 3PPHA 2BXYA 4ATLA 1V3MA 1GKRA 3O63A 4NKCA 2P50A 1PVNA 3M0XA 1YE4A 3UWUA 4YCPA 4L61A 4B3KA 1TPDA 1EHAA 2J6VA 2VR4A 5DMMA 4H6RA 4PMVA 3P5YA 4S39A 4TVUA 3UERA 1W56A 4G9PA 2WZEA 4Z1DA 1Q6GA 4YN5A 4M6UA 5CZTA 2ACRA 1XRFA 1JZ5A 4UQEA 2X1IA 3BSHA 2CLEA 3BSMA 1UZ4A 1OEPA 3ZT5A 1DV7A 1KRAC 3GQYA 1KGXA 4PBFA 3WCZA 2CNCA 1P0NA 3FEQA 1AH0A 2VVNA 3EA1A 4WIWA 2J9ZA 4RZ5A 4CQBA 2WJDA 2R9RA 3QW4B 2QEZA 3BMWA 2GVJA 5DRCA 1K8XA 3INPA 5J5DA 5FACA 1M53A 3PVFA 3V0UA 3N13A 2CU0A 2C15A 2XH7A 1E0VA 3SRHA 4B5SA 1IWAA 3A3XA 3CV1A 4CU8A 3NM3A 3TQVA 4Z1BA 2E6AA 4F3HA 1PL9A 5HA7A 1A3WA 4M29A 3N4AA 4AD5A 1H50A 3C4UA 3RCMA 1O94A 4ZR8A 4IT1A 2TRSA 4XD4A 4JNMA 3VZZA 4JAWA 4TU1A 5EKYA 4GACA 1XLAA 2ISDA 3VIPA 2O4QA 4I9AA 3W22A 2BP1A 3NEHA 4IX2A 2OZ0A 2WPGA 4S3JA 3UU0A 1JYVA 2A2IA 2XSXA 5D03A 3CTLA 4DLMA 1MXGA 4KIRA 4OV4A 2NZLA 3VKBA 4KCTA 5FJOA 1YRRA 3Q94A 2OQYA 2EG6A 5AB3A 2Y61A 4PEEA 3VOHA 3PBUA 5IXEA 2Y5EA 1UASA 2NXIA 4FR6A 1L8NA 3TIMA 4R7JA 1I2NA 3WNPA 1XLDA 2C0AA 4Q4PA 2YW3A 2X42A 1R2TA 3HO8A 4IH3A 2VKZG 1M41A 3H4GA 1TELA 3DFNA 3N2MA 3M44A 2PSNA 4C5ZA 2C7FA 4XD5A 2HVMA 3BQ6A 1FWAC 3GNDA 1KC7A 4B5NA 5IBXC 5B7ZA 4URIA 3UR8A 1L6WA 5I3DA 1OZMA 1WYIA 2BMBA 3SGUA 1B30A 2YIHA 1NELA 4RE3A 4B9ZA 2PTDA 1CLXA 4H8NA 3BAKA 3TJIA 4JFVA 3LI1A 5I2UA 3S2LA 3WMSA 4O0ZA 1EBGA 2PD5A 1S3HA 3MCNA 1OC6A 1X6LA 4IGSA 1QVBA 4F2UA 4LCRA 2VUYA 3N19B 2VC9A 3AWNA 4LAKA 4U28A 1S2TA 2PU1A 3CL8A 5F1VA 3CPUA 5CAKA 3FGCA 1ZJHA 1YXCA 1PKMA 3GRIA 2OWWA 2FTYA 1VH7A 4G7FA 1V6UA 2C8NA 1JDEA 1XIHA 1KFBA 4JTCA 2XFFA 1QOQA 5DY2A 4DWSC 1NQ6A 2HXUA 2UWFA 4XBJA 3E5PA 4GYFA 4KFNA 4EAYA 5LNSA 2Z7GA 3KCLA 7TIMA 3AQUA 2UY2A 3SCRA 4X9YA 1UR4A 2QJNA 3EYPA 3MUXA 4HQVA 3DC8A 4DRSA 2RGLA 1K6WA 2WSYA 4WF7A 2GQ3A 3L9CA 4PCFA 1VYSX 3EBVA 2IPJA 4GC3A 1LL6A 5I3HA 4QAWA 4JFWA 1B54A 1N82A 4E3VA 2X1SA 1E4IA 1IR2A 1VFOA 2P5NA 4WSKA 4GUHA 4W7WA 3TNOA 1DQXA 4IUOA 3WLHA 1CGVA 1M9HA 1UKQA 3UG4A 2Y24A 5BWAA 1OIMA 4JEJA 3F2DA 2HJPA 3R58A 2PDFA 5IFPA 4B4FA 4QG6A 4AZ5A 3AS1A 3MKVA 3BV7A 1V51A 3AIVA 3NDYA 3B8UA 1TJ2A 3MQTA 4LAMA 4OBSA 3CJPA 4GO8A 2G41A 4BA0A 1D9EA 3KTSA 1XYBA 3WF2A 2FPVA 2VFFA 4YPJA 1KWGA 2PTYA 3LD5A 1LL7A 5CGTA 1OIFA 1AD1A 5D38A 4C6CA 3L4VA 3STFA 4Z2JA 2CZ5A 2VQUA 1MRAA 4YTTA 2CEQA 2XN0A 4O16A 1X96A 3GZ3A 3N6QA 1UPPA 3GBDA 3QLLA 4F0LA 4HHPA 7REQA 2VFIA 3Q67A 3W7CA 3W70A 1MW3A 2JKPA 1C7TA 4HIBA 4DJDA 3LY0A 3T8QA 2A3LA 1NDYA 5D9OA 3N4FA 3EMZA 2VEKA 5AHIA 4XSLA 1GORA 4HU0A 4UFMA 1G67A 3T9PA 1CXFA 4FLQA 5ECUA 1YTEA 4HA4A 4K37A 2YJQA 3UPMA 3LMZA 2CHNA 4JTHA 2Y1HA 4NAEA 2V5KA 3URQA 3VZYA 3AMCA 1BKHA 1OSEA 1W9XA 1C8YA 2H9AB 3IJ8A 3BGJA 2X1UA 4KEVA 4J3XA 4NNAA 3M0KA 1R7OA 2CFFA 3N12A 3PY2A 4M82A 3M0ZA 2PE4A 5DXXA 1JNEA 2XYLA 1BSIA 2DH3A 1R5YA 4G5DA 4B91A 1L6GA 3B0YA 4ACZA 1ODZA 3ERPA 3L5MA 3VMPA 2BX7A 2YBUA 4FXSA 4HA0A 7XIMA 3HQNA 4ZE5A 3HPSA 2QXWA 4I3GA 2NWSA 4FLSA 5CBIA 3TEVA 3O15A 5LSMA 3ITVA 4PB5A 3TUUA 1TJPA 4CD8A 3HGRA 4HTBA 4A2SA 5CZKA 1XKYA 2E40A 2HCVA 3WIJA 1S1RA 1ZAIA 4GNKB 3VC5A 4WJXA 3HQ1A 4A3HA 2DY3A 5DMNA 3TYBA 1ZCCA 3QC3A 5DT5A 4WDTA 2NX9A 4ZB5A 4KWWA 1O12A 3FVDA 3MBDA 1PUDA 3DZ1A 4P8UA 2OGYA 3SCSA 1RK5A 5AZ0A 3R13A 1V5XA 5D8WA 1GVEA 1D3HA 2NUXA 5IM51 1VIZA 4D9PA 3W7DA 3U5YA 2YZRA 4AQLA 3PZ9A 5FEPA 2PRMA 1SM9A 3OTRA 4CVUA 1VBJA 2AAMA 3BLFA 4J3TA 2WCSA 3GNRA 4PUKA 2PTZA 1M7XA 2VGIA 1FCBA 2EJAA 3BCDA 2QHAA 3KXQA 3RIKA 1MUMA 2V5LA 2X7WA 4ADUA 2R94A 4AZHA 5REQA 3AXXA 2WZMA 1RAKA 2BY3A 3EGJA 3IVUA 2O56A 1C91A 2QDEA 3IIVA 4HMEA 3AYRA 2VL4A 3CAVA 3D6NA 1QW7A 4QJ5B 2AKMA 3SY5A 4DWDA 5FKYA 1KB3A 1TZ7A 4NSBA 3CWNA 3FJLA 1JPIA 3A9BA 1PHWA 5JVLA 1JXKA 4AWEA 1T7LA 3W6YA 2F9RA 4L1WA 2V63A 3VDBA 3VCNA 3RCYA 1K02A 3RUBL 3L4UA 1VEMA 3T0TA 1J0HA 2DT2A 3TN3A 2YCLA 3A5FA 3O0FA 4O1EA 4RX0A 1UYQA 3C86A 4NZCA 2ZRXA 2YCJA 3S0CA 3E0VA 1K8CA 3FSTA 2REQA 3I3DA 4NZ3A 4LXFA 4L9XA 1Y65A 4JYEA 3PG9A 2PD9A 2QT3A 2DT3A 3WDHA 1F5ZA 2YFOA 3U2ZA 2PI6A 2PP1A 1UH2A 1PYFA 1GHSA 4ACYA 4HN4A 1WXYA 3OG2A 5D05A 3R4IA 2ZRWA 3UZZA 1EWDA 3W6LA 4JIHA 1EJVC 1V6YA 4ICNA 4PMNA 3LX9A 1NEYA 5JUVA 1WV2A 2KAUC 1UD5A 2IPGA 1DTNA 1Z44A 4B5UA 5XINA 3NQBA 4NAFB 2ZZ6A 4H9TA 5EFDA 3B4UA 2W4XA 1Q2RA 3WK0A 2WCAA 1QPKA 1QO2A 3VIOA 1V7YA 1X38A 2GOKA 4H9VA 4RPPA 4H8UA 4L6HA 4HCHA 3U2CA 3N3TA 3TMLA 2HZGA 1Z69A 2XN1A 4QSFA 3VNDA 2WNZA 4PEKA 1W3TA 1U5VA 2WWDA 4P7QA 3QMSA 3PF3A 1E72M 4NHVA 1QHPA 2RDUA 3PM6A 4MNMA 5EMUA 6ENLA 2QR6A 4O14A 4D6HA 3M5VA 4H2HA 1E40A 3KRSA 1IT8A 1LLWA 3F5KA 4WKAA 2IPFA 1U1JA 2TPSA 4BCEA 4F4RA 3BW4A 1ICPA 2FB3A 3QH2A 4MJZA 3V7PA 4BI6A 3TN5A 1A0CA 3MB9A 1SSGA 3MMDA 3FA5A 3QGAC 1JD7A 4K68A 3RM4A 4H3DA 2E5BA 1F8MA 1YE6A 3LDVA 4FPSA 3UD6A 1F4AA 4K3ZA 4BQ2A 4K6AA 2FJUB 1KFKA 3EWXA 1RLDA 3CNYA 4HCLA 1FWBC 3EPOA 2NQZA 3ABRA 4GBUA 3OZPA 4ENLA 1DYSA 2PEVA 3OLDA 2PMQA 4WQ6A 3HA1A 1GOIA 3WX7A 3CPRA 3TTSA 2PWVA 3CZ8A 3L4WA 4TVCA 4E6MA 1NWUA 3ZS4A 1ZJBA 1ZCOA 2V8ZA 4V1XA 3W1RA 1F73A 4HP5A 1F8IA 1Q7ZA 2VFHA 3NZPA 2CXGA 3ZJKA 4E2VA 4I90A 3UVIA 3CWHA 4XTDA 5IDZA 1R3WA 4IF2A 4DO6A 2QMKA 4MAZA 1XIIA 3NXFA 3OA5A 1A5NC 4IG2B 3D46A 1TPWA 1VCGA 4L65A 2A6NA 1P48A 1BGGA 2O92A 3LS9A 2J4GA 1YPXA 1HO4A 4DI9A 4IX0A 1BWKA 2YDQA 1ONWA 3PZNA 1HGYA 3HPXA 1XRSA 1DIEA 3URNA 4U2ZA 4O1FA 4MUZA 4NU7A 4BQ4A 2E1DA 3Q2DA 2PWDA 1UWIA 4K8HA 4NZ1A 2DPEA 3ABSA 3UR5A 4TX9A 1L2UA 3WF4A 1PDYA 4DPPA 2CLIA 4L56A 3P0XA 4X22A 1B9ZA 3B8VA 4XTIA 3C8FA 1K4GA 3PPFA 1GZ1A 2EJ1A 1Z42A 2MNRA 3SR7A 4PSPA 4CD7A 3WK1A 2XIIA 1WZLA 2I9EA 3NPXA 4D6GA 1AL8A 1ITQA 5A8OA 4ADSA 1TFVA 1XKJA 3QHOA 3AIRA 1A5LC 4K2SA 3BGGA 3LRKA 4B9YA 3W23A 1TUXA 1J5TA 1VENA 4Q4KA 3IIXA 3OIHA 2JQXA 2OGJA 4ZO6A 3I68A 4PTDA 5DF0A 3AHTA 3VOFA 1XC4A 4M6PA 1UUMA 5LIXX 3SCNA 4US6A 3SUVA 5LXEA 1LOSA 2FZMA 3CQKA 1NQKA 4BJHA 2VHLA 4Q8QA 1UKPA 1PZ0A 1SPQA 3FNDA 1HVXA 3ZR5A 3TFCA 3ZOAA 1XX1A 3ICJA 3RLUA 2G3IA 2PLCA 3U2OA 4MPKA 3OVQA 4XO7A 4MNLA 5DY3A 1AQ0A 3E2SA 1L6FA 1T99A 4Q8MA 2ZFAA 2XVKA 3BAWA 2C91A 3HPFA 3VIGA 3B0PA 2ZRVA 1U5HA 3TA6A 3S6OA 3EB3A 3CT7A 2BSLA 2FHCA 3P8JA 4DHGA 3A6OA 4HYRA 3A12A 2VM8A 5CXPA 4QLJA 1XIDA 2P10A 1R3VA 3M5XA 5DMLA 2CZEA 2Z26A 2GJPA 4AWSA 4W89A 1EJSC 1Y0EA 1GT8A 5F4XA 3BOXA 4RR4A 1IYXA 2JIWA 1GW1A 1TWDA 1A3HA 4S3DA 4MJMA 1FWSA 2DDXA 3E2VA 1XV8A 1MMFA 1J0JA 2CHRA 3KLLA 1QNRA 4NXSA 4LANA 1JCYA 4UCGA 3EMQA 3MMTA 1BQCA 3BAYA 1OFOA 3VD5A 4O8AA 4WDUA 3W7EA 4A3UA 1RJPA 3E2QA 3LCWA 5A6MA 2D0HA 3FJ4A 4M8UA 4FLRA 1EIBA 1PCKA 1JDDA 5D37A 4CCDA 3VABA 5AYZA 2OYMA 4B4HA 1RBOB 4TOQA 2J7BA 5HUPA 1JYXA 4BWLA 3NSMA 4K36A 2WSRA 4HSHA 1K7XA 3AIUA 2C19A 3MW7A 4UB9A 1V3LA 3II1A 4DJEC 2WSQA 1HJVA 3PAOA 2WJEA 1RZMA 1WO2A 1A4MA 4X61A 2X8RA 2YOCA 5HWJA 4H9MA 4N6EA 2FLIA 4KT2A 2RFGA 2XVNA 4UZUA 2DSWA 4LRSA 4GD0A 2EPOA 4FLOA 3MC5A 3HJEA 3AIBA 3UR7A 3BXWA 3BLPX 4XAPA 4A8NA 3FSUA 4Q4MA 3IANA 4PTNA 4ORMA 2NUYA 4Q8OA 2KZHA 2EXOA 1RQBA 5M17A 4IP7A 1A5OC 3A3HA 4LAOA 4LRTA 4RNFA 1V02A 4PH6A 2C13A 2QKFA 4D6FA 2JF6A 4HPJA 5AYIA 4FOUA 4MLRA 3PS7A 2VX5A 1HKJA 2GSHA 3VI2A 5FSDC 4GINA 3WLIA 3U7BA 2G3MA 1W5NA 5FJJA 1R86A 4IXHA 4UQ9A 1VPQA 3WD4A 1E0XA 4Z1CA 3NOEA 1CGYA 1FWNA 4ALDA 3IIOA 3N04A 2FZDA 3RLGA 4ZO8A 2DZAA 4IJBA 3QOKA 5IDIA 1S5VA 1E0TA 3AO0A 3BDKA 3DBPA 1PS9A 1DL3A 1YLVA 1IIGA 1I6NA 3MZ2A 4OBTA 2R82A 4LY4A 3WNLA 5AVNA 3KHDA 4JL1A 2XISA 1ISWA 2HBVA 4IIDA 3QQ0A 3NDZA 5KINA 3BZJA 2F2KA 1J4EA 3DFOA 1SVDA 3EOOA 2GUUA 3J7HA 3SN1A 5HWMA 4PGLA 1R2SA 4UR8A 4ICMA 3SUSA 1FXPA 1GYMA 3UA4A 3ZLFA 2IXUA 2B4GA 4MIMA 2B7QA 1GQJA 2J8GA 5TD4A 2ZUTA 4L4OA 4LB3A 5J04A 3QSTA 2YA1A 1EC8A 1LYXA 1W3IA 3GHSA 5AYYA 3VPLA 3IRDA 5A5WA 4N4PA 2VC6A 3NDOA 3APYA 3NPVA 1D7FA 3BURA 1C92A 1TPVA 2WJFA 2YSWA 2P0IA 3GW3A 3CAKA 1S2AA 4Z1YA 5A2CA 1W54A 1RSCA 2VOMA 3ITCA 5FF2A 1J0IA 2WB5A 1KO0A 3F5LA 2Y5JA 4C1NA 2H9AA 3WLPA 4D1JA 2DUZA 4QJ3B 3C3UA 2C1IA 1AJZA 3W2KA 2Y88A 3GU9A 3G0XA 3MS8A 2DVXA 1UMLA 5ABGA 1X98A 5BRBA 3LXAA 3GVQA 2YL6A 2JGYA 3A3WA 3G22A 1B3XA 4LFYA 2A5HA 3VXGA 3Q58A 2Q6ZA 5F4WA 4A3RA 5HQMA 5JQ9A 3VINA 4AW7A 4JX6A 5E5CA 3RM9A 2JEPA 3ECQA 2Z1SA 1JZ7A 2ZX9A 1K8ZA 2Z2UA 3FDGA 5E1QA 2GJRA 4XG1A 3H4XA 4HVXA 1E4NA 5LNRA 1S2VA 4OIFA 3ZWSA 4AWTA 2V9DA 5K9XA 3K1GA 4ZTXA 3VKJA 4KERA 1TWWA 5LIYX 1MNZA 1TKKA 1QPNA 1MUWA 1ZHAA 4ERIA 3NQVA 3PULA 1H09A 3SUUA 4YL2A 1LDCA 5BWFA 1TQXA 4IFKA 3WQWA 5EMLA 3IJ6A 3WQEA 1C29A 3A5VA 5CH9A 3W1MA 1V02E 4D71A 1VZWA 1CENA 7ODCA 4PMYA 3UCDA 1FP9A 2YL5A 1LOQA 2JFEX 3EB2A 1XISA 1SZFA 4W93A 2WANA 1KBKA 2OSXA 1HNYA 1FHDA 4B5VA 3LPPA 3VKKA 5BRPA 4HOZA 1P43A 4ZFCA 1DWFM 4EVZA 3HB9A 2OT1A 3FHQA 1JG9A 2B7PA 1TV8A 2GJNA 5DN1A 3BCFA 1XSIA 4BF9A 1WBHA 5D33A 3VGGA 3BCJA 4C6LA 4MPQA 5CC5A 5C9XA 5A8QA 5EU9A 3W01A 3ZQ9A 1YW1A 4YCOA 2X30A 4R33A 1JUBA 3ONBA 4V28A 1IQ8A 1TYGA 3GXDA 1W5PA 3WEZA 1FFRA 2A3CA 3UP8A 4G7EA 3S2CA 3ARVA 2Z1KA 5EFFA 2FGZA 1O1HA 4HMDA 5EMMA 3MO7A 2PS2A 1CXKA 2VC7A 1GJWA 4UFIA 3G2GA 4LVGA 1KM4A 4JTRA 1JPMA 4QSHA 1V79A 1KCKA 1XLMA 1Q7MA 4HU3A 4FOJA 4KH2A 4E2OA 4V1YA 4US5D 3TK7A 1NWRA 4XBSA 3CUIA 4O13A 5K4ZA 3K4WA 2WKJA 2WVTA 4BQ5A 5KTLA 5D04C 1ODUA 1N55A 5HINA 3SN4A 1LJYA 1E1CB 2Z00A 5LIUX 3GDRA 3MUIA 3CPGA 1VJZA 1NOWA 2GWGA 2BODX 3IUDA 4YHGA 3QV9A 4YTSA 3QQWA 3EXSA 4R9OA 1FUYA 1NH6A 1ESWA 1PWLA 3ZMRA 3GXPA 4K38A 3N1AA 3PZOA 2I14A 4R53A 3PPCA 4TO8A 3F2BA 3NYDA 2QZRA 3N25A 4I9TA 1VEPA 2EF9A 3HV9A 3MP5A 2I9UA 5FJRA 2PBOA 5E0CA 3D3FA 2HNHA 3WQFA 1FCQA 1FKWA 3PTDA 3MT1A 4DPQA 3D3AA 4CCZA 1O6IA 3RR1A 1RCQA 3MSGA 4KEMA 3TR9A 4GG9A 4Y6GA 1XR2A 2EPMX 4UR7A 3L5AA 3ARWA 1Y5XA 3C52A 4WEVX 4CNPA 3G6LA 3NSNA 3AXMA 1P0BA 1M5WA 3CQJA 5HMDA 5A8NA 4UZSA 3LK6A 3M07A 4X0NA 1QO5A 3LXBA 4OT7A 4WOZA 3KBWA 1GJUA 3LTYA 1P0EA 4LUSA 3MDWA 4GZ7A 4AC1X 2Q3RA 3CLMA 3QGKC 1EZWA 4RW5A 3FDKA 1DJYA 2CKSA 4J4KA 3EXTA 2PUZA 5HMEA 4AH7A 2R1KA 3V75A 2D22A 1TTPA 5PTDA 4A3YA 1AMKA 2ZUMA 3A24A 3N9RA 1IEQA 3UXAA 3FX4A 4UQCA 3ALFA 3IGUA 3WEOA 3HQOA 5GNZA 2W6RA 3R43A 3P0WA 2WVUA 3JU2A 4RV8A 5AHFA 2UY3A 4Y9NA 3EDFA 1WQ5A 2B81A 1FH9A 5F2MA 1F05A 4F9DA 4MG4A 1I75A 3HFTA 1LUCA 1QCWA 3WUBA 3CZKA 4EWJA 1J12A 3WFZA 1XH2A 3IIPA 5AKQA 3SUWA 1OZQA 3DERA 3IUHA 1Z48A 2J77A 4PCTA 3B9EA 1KM5A 1H7PA 1EUAA 3NQ7A 2RJGA 4LF2A 1MWOA 3QV8A 1GYLA 5BOEA 3NQ2A 4W85A 4LVFA 2PDGA 3GXFA 3B0XA 3GAYA 3WQ4A 4GLEA 2PCQA 3M7SA 4CNUA 4CU6A 4QLKA 1IXOA 3VILA 5I24A 2F6UA 4FI4A 3WBWA 2QPSA 3CYJA 2V68A 4GVGA 1JFHA 1H41A 5I5RA 4O15A 3S5SA 3ZFHA 1DQUA 1PZ3A 3FOKA 3HG5A 1REQB 3WQOA 3TXZA 3CC1A 1IXPA 4JTSA 2ZADA 1DIDA 1T0OA 1FDZA 4ASTA 4LVBA 1WDRA 3QR0A 4IICA 4M24A 3W6MA 1KTBA 2PDLA 3WL1A 4JX5A 4OBRA 2Z1VA 3NQAA 4FIQA 4MKSA 4ACZB 3TX9A 3ITGA 1FCVA 2GQ8A 2HVOA 2GGIA 2XHYA 2EBNA 3G3DA 4IG2A 1ZBCA 1BYCA 2DT0A 3AUJA 4OUIA 1VEOA 4IIBA 3VIIA 3L65A 3L4YA 1KFJA 3WBYA 5C55A 4Y90A 4GX9A 1L8PA 3GVVA 2CPUA 4P2VA 1QW9A 5I02A 2YL8A 1TCDA 3B8IA 4N9DA 1OX4B 1KR1A 3AXHA 2OKOA 3M43A 3AYVA 1YMYA 4C90A 5I07A 2XZ7A 4G1KA 1I0BA 2PLJA 2EAWA 1D3GA 3M64A 1M3UA 1IEVA 4WY0B 4UTUA 4UTTC 2ZA1A 4WY0A 2NLIA 1E73M 1W5MA 2ZVIA 3LGEA 4DJEA 1YDVA 4QJ1A 2XFWA 4GI9A 4JX4A 4LS0A 3S47A 1XW8A 1YBQB 4DN1A 5G2WA 2NW0A 3NQEA 2VR5A 1FHVA 1RCOB 3C0QA 3P3BA 3TDFA 3HPAA 1C8XA 4AY1A 1DQWA 3RX3A 3NWRA 1TREA 3EKLA 4KEZA 2XM2A 3NM1A 1SJDA 3GNOA 2O4MA 1UD4A 3LZ3A 3UWEA 3WDRA 2UBPC 3MSYA 2GVLA 1K7EA 4GKTA 3QYSA 4E4PA 4MJ2A 3W76A 1PYMA 4DF2A 4DUXA 5DRIA 3B05A 3E12A 3NZGA 4JQ1A 2D69A 2Y8UA 3EOSA 3STCA 3V0TA 4QE1A 4RE4A 5BROA 4PMQA 1X97A 5A6SA 1UQZA 1U1HA 1Y5VA 3AU6A 2Y4SA 1J6OA 1PZ2A 2Z25A 1LUCB 3NVTA 1E5NA 3TQKA 3U4FA 3GDBA 2YFNA 3H24A 4ZOCA 2HE5A 5XIAA 3OQEA 3SAZA 3LENA 3GB6A 2VUNA 2VR2A 3GH5A 2PURA 3FIGA 4XZWA 3T8LA 3A13A 3I4KA 1XG3A 2FTPA 3QPZA 4AZ7A 5C9UA 5H2ZA 4QQ3A 3EX4A 8RUCA 4GBDA 1SR9A 5LGZA 1JCJA 3WLLA 3QMRA 2W27A 4LQ1A 4K7VA 4HNTA 1OCQA 1R30A 1CBGA 4HA1A 5G1YA 3N4EA 3VX1A 1WZMA 1UHVA 3DHDA 3UGVA 4IMCA 3OOQA 2AQOA 4AYGA 3NL2A 5H8PA 4PULA 3N11A 5JBEA 2W91A 2BS9A 1RPXA 4TV5A 4KRZA 1F3WA 5JMUA 3RYSA 5DO8A 1LOLA 3CHEA 1YDYA 1VFUA 2Z6IA 1V6XA 3E49A 3VUPA 1B0IA 4LUYA 5EGRA 4C6NA 1F6PA 1K1DA 1KTCA 4EXBA 1CPUA 5GJNA 1VPXA 1F4HA 3BLLA 3CIVA 2XTKA 2YDSA 3MHUA 1FWGC 5TAOA 4F2TA 2XVGA 4HZ6A 1G69A 4GX8A 4NRSA 1QI5A 1SMAA 4FZIA 4LBSA 4DXVA 3T78A 5HPOA 2GVEA 4FOKA 4H41A 4YIWA 4DZAA 2ZCGA 2Q8ZA 5E0FA 2ZYFA 1D3CA 3B40A 5D02A 5LNUA 4RZ6A 3PWAA 2YB1A 1OB0A 3W81A 1BFNA 3I10A 4Q7IA 4XX6A 1A5AA 4Q22A 2VURA 3AC0A 1TPC1 4MB1A 2W61A 4O10A 2BY2A 4RDYA 1NJJA 6XIAA 1XG4A 2EKGA 3TA9A 5BMXA 3ARPA 6TAAA 4NJIA 3QPEA 3TC7A 2W3ZA 1RVGA 3GKFA 2PC4A 3CHCA 5FJTA 4P7RA 1E0WA 3VNYA 3AMDA 2FKPA 2VRJA 3UJ2A 2DUAA 1VQTA 3E5BA 4LV9A 2FJKA 2ZX8A 1XRVA 2FHFA 4A6GA 3TVAA 5M2FX 3CMGA 2RH9A 3PB2A 3BG9A 3GDMA 1ML1A 4MJ4A 3UG8A 4BY3A 1I2RA 4X63A 2ZKMX 4MWAB 3RMEA 4LGXA 3LU2A 1VBRA 4RDWA 5ENLA 4AC7C 4ORIA 2QYGA 4B16A 3N9SA 2GDVA 4DX3A 1N7KA 3W02A 2V3DA 4ZVJA 3NZ1A 3VDCA 3FV9A 1B3ZA 1NFPA 5I7GA 4HCDA 4HK6A 4F48A 3B0UX 1XHGA 1O5RA 4Z2IA 2NQLA 3USZA 1ZAHA 2NV1A 1ME9A 1KM6A 3HOJA 5HULA 2O7QA 2W79A 2J74A 1VRDA 3CO8A 1G7VA 3G1FA 4HA3A 1CB7B 1VFHA 1SFTA 1RD6A 3S5OA 2ZRUA 3O8AA 1UWSA 1EPVA 2Q01A 3N73A 2XIMA 3RF9A 3NL3A 4C5YA 2JKAA 3MWCA 3EWCA 3MSDA 1KRCC 1R7AA 3IIZA 3VM5A 2UY4A 3RM8A 1NDZA 3GNXA 4LAUA 3N6JA 1T8XA 2QCLA 3PSWA 3VVGA 4MADA 1H51A 3WQ5A 1MVYA 4US5A 1Z41A 3LTPA 4BZYA 3VGHA 1Q45A 2VGGA 3GKAA 3CMJA 1UD3A 4DYKA 4NYYA 5HR7A 1FWEC 4D8LA 2XN2A 3QSRA 4UMBA 3AZTA 1F74A 5HXMA 1ZBWA 1E3ZA 4V2XA 4IXXA 1BQGA 3EWYA 3OQ8A 4AHQA 1QPRA 4G56A 2IQDA 3K8LA 2QCFA 3H22A 5T91A 3MUY1 3D5HA 1I2OA 2ZDRA 3R8HA 3LPOA 2PDHA 5KEZA 1GVRA 2ZUVA 1S3TC 2YA2A 5F7UA 1POKA 4LVDA 4UQAA 3KP0A 4GJIA 4ROQA 3WLOA 4IFOA 4KETA 1OT2A 4CN4A 2R1LA 5EMYA 3R5EA 1J0YA 3NL6A 4X2PA 3SSJA 2WHJA 3BANA 1OCJA 1THFD 2DZWA 2OKTA 2C18A 4JNYA 3AXKA 4S2BA 1V7AA 2NQHA 2EQDA 4HBKA 4QG8A 1J0KA 1OC5A 2MUCA 4I7VA 3BL3A 3LQLA 1DP0A 9XIMA 1QXLA 3WEMA 2WC3A 3B9AA 1BPLB 4LJ3A 3VMOA 4DF1A 1XYFA 4M5PA 3H2FA 3GYCA 3KW3A 4E38A 3VNJA 1G4TA 4IZGA 5TNVA 4DLFA 3G0SA 5KETA 1QT1A 4CKQA 3NYZA 4QM1A 4EF8A 4QLLA 3N2CA 4UFKA 1KQZA 3DIPA 4JN8A 3TV8A 5BW6A 3UWVA 4C6QA 4JIQA 1XINA 2WVSA 1CGWA 2I5IA 2J66A 4LYKA 3GE7A 4XIMA 1JI1A 1XH1A 4LT9A 2PWFA 4PTVA 2Q09A 3A4AA 1PZ1A 2VEGA 4Z08A 3IK4A 3TZNA 5CSUA 1MW1A 3IUIA 1I8JA 4Y96A 2DZBA 1RBAA 4K1WA 3V5FA 5CG0A 2E25A 1I1XA 1VYRA 3PBGA 4GUGA 3T7VA 5MF5A 2A7NA 1LP6A 2WMHA 3AZRA 4GYPC 4PL2A 1EGMA 2XG9A 1IE7C 4R5EA 2AMGA 3PAJA 3BLOA 4QRNA 4FNSA 4JFTA 3TU9A 3WJXA 6PTDA 3LHUA 1FWCC 5I79A 3CV6A 4QITA 4EACA 3LZ5A 2AMXA 2QDDA 3F5JA 5CGMA 1U30A 3V1PA 4EIVA 3OA3A 4ZO7A 1P6WA 1R3YA 1AW2A 4H04A 4NT0A 3GIYA 5AHEA 1M6JA 1JYNA 4LS2A 3MI2A 2OX4A 1VBGA 2W0UA 4KFOA 1UWQA 1KR0A 4NNCA 1OABA 2ZTKA 4GFIA 4MFDA 5FJPA 3KLKA 3DGBA 5CZ0A 3I6TA 5LA1A 2X0YA 4ZSTA 4DO4A 2ISVA 2EO7A 1KBLA 3PBYA 3W0KA 1TJ0A 1LM1A 4WJEA 3W7KA 4QDPA 3TJXA 4NX0A 2DJLA 2QULA 2VGFA 4LH8A 4D6DA 1EL3A 2QCEA 1A49A 4UMCA 5HJXA 4U5IA 5LIWX 1HKWA 3BZGA 3E0LA 1GGOA 4JKMA 5M1TA 2QPXA 1ZB5A 3DFHA 3O06A 4FF5A 1M65A 3NG3A 3WMCA 1BF6A 1TV5A 1Q65A 4HOXA 3BWWA 2E9MA 3CAQA 2R91A 1C7SA 3P60A 2GUYA 5I09A 2OWXA 1JIBA 2DQXA 4LEFA 3K1DA 4WKHA 2PZNA 4O52A 1QI2A 4NYUA 1LWJA 4MHBA 1LG1A 2G3JA 1DIOA 3GTXA 1E4LA 4GI8A 3WQGA 2PAJA 1LT7A 1W2VA 3LPGA 1WXJA 3VC6A 2JEQA 3OB8A 2WQDA 5K9CA 1K7FA 1W8GA 3O6AA 2WLYA 3MKKA 3G1DA 4W9TA 3M0VA 3SRFA 4WDWA 2OEMA 3R11A 4ZOBA 5LIKX 1XSJA 4PFHA 3T0DA 2OODA 1TRDA 2V3GA 1QMLA 4REQA 1SO3A 2Z1XA 3NQCA 1W5OA 4QCFA 1XIFA 2ABAA 3HF3A 1KV8A 3W27A 3IAPA 2C16A 1JDFA 2YYTA 5LA0A 2NQJA 3AMKA 4FMVA 3KBJA 1ME8A 4JKLA 1ZLPA 4XKYB 3PK7A 2FHBA 3QJAA 2ISWA 2WKLA 4L6OA 5HMSA 2DIKA 4YTRA 1PB0A 2LLEA 5JXQA 1K6AA 2WO5A 4I7WA 1EYEA 4UTWC 1NSJA 3SJ3A 2WBGA 3HN3A 3EX2A 2QUNA 4DWSA 1KD0A 3SCPA 5TQLA 4HNNA 1ECEA 3LOTA 4J9JA 4QX4A 4AVFA 4ZL1A 3MI6A 3U5UA 4C1LA 4EPBC 3QBUA 2Z4GA 4BEUA 3CEPA 2QCGA 5DT7A 3AS0A 3BOFA 4O57A 3GLCA 4FNUA 1NF0A 4B5TA 1ZJIA 4DWSD 3KWSA 3ISIX 3V18A 5BCAA 3WJZA 4PN2A 1UR2A 4H7VA 4IIEA 4UQDA 4FNTA 1XCXA 3W7OA 1E9YB 3GX9A 2Q02A 4J3SA 1CLKA 4JFSA 2IKIA 1LORA 4UBPC 1XF0A 2V0TA 3O2LA 3UXLA 4HNCA 5AYBA 3UWYA 2I5GA 3PJUA 4KWSA 5F2GA 3AXIA 4HNOA 3N2TA 1TTJA 3A4WA 4JQ4A 1EEXA 4R27A 1VBUA 3KDOA 3RU8X 2VDHA 2TSYA 3TJ4A 2WMGA 3DHPA 1G4SA 4MFEA 3AJ7A 3SECA 1SJAA 3LCGA 9XIAA 1CB2A 4M7TA 3AROA 3GXTA 3R7MA 3E38A 4LCQA 4L7ZA 2GOUA 3VIJA 2Y89A 2QJJA 5CSSA 4HMNA 2DGAA 3A22A 4NQ1A 4CQ9A 2IUZA 3REQA 3EEGA 2UY5A 2CYGA 3CH9A 1PX3A 4QG9A 3W87A 1OC7A 3QF0A 4KWUA 1UJPA 2VZTA 2D3NA 4CD5A 3VU2A 1J18A 1ZQ5A 4MB5A 1ZL1A 1UOZA 3CZJA 3KDNA 1FCUA 2GK1B 4YVXA 2E68A 3T6CA 1HKKA 1L6YA 5FF0A 4ZOEA 3I65A 3WQPA 3WL0A 1Q6LA 1Y5WA 4Q8PA 4PSRA 2GGGA 1AJ2A 4FP1A 1I4NA 3AALA 4A3QA 3GW0A 3E0WA 4RCXA 3AUOA 1OCBA 2RGMA 4GVFA 1K8YA 4AZGA 4GQGA 5C9ZA 4AIOA 4U10A 3CO4A 3RNDA 2RHGA 3T55A 1XLJA 5CJ5A 3VDGA 3GY1A 3AICA 2OLAA 1TPH1 3SO7A 4GGBA 3S9ZA 3CUHA 1XUUA 2PGWA 1VYPX 3H23A 3WLRA 1F6KA 3POCA 1MQQA 3LGDA 3EX3A 4V27A 3EX1A 2XZ9A 3VIFA 1CECA 4JS3A 2QV4A 3CZEA 3RRXA 4F79A 4DJFC 2A3EA 1WOAA 2OXNA 4WLCA 2YBTA 4DELA 3O0KA 4LS1A 1OFEA 4WHBA 2NVAA 1KLYA 3DX5A 3FYYA 3HG3A 4W5ZA 1KA9F 5AC8A 4QE4A 4MWAC 3WDJA 4OJYA 3MP3A 4ZQRA 3QMTA 3JR2A 4GFSA 3WY1A 2V6AA 3MMUA 4KIEA 2QDGA 4M1RA 3SN0A 3GIPA 4Z2GA 3LLFA 3KP1A 1KQYA 3RDKA 1OYBA 1Q2SA 1H5VA 3ANVA 3VOGA 4HB7A 2V5DA 1RD5A 5ECVA 1PJ9A 1PTGA 4MY1A 2ATMA 1JULA 1Q6DA 4DNHA 3THDA 5I3JA 1TVNA 3QTPA 1CW2A 5H6HA 2E6YA 4DUWA 4WRHA 2XGZA 4WVXA 3CEUA 3CB3A 3KTXA 5FJUA 3G1XA 3M16A 2YCIX 2O9PA 3W85A 1EZ2A 4PTWA 1E6SM 2BFGA 1SU5A 1OY0A 2G96A 1E55A 1BRLA 1BVZA 2WMIB 3GM8A 3T2OA 3KOWA 4ZSUA 2YXXA 3UA3A 3SRDA 2GDUA 1ZFJA 3B9OA 3SY8A 4F0RA 2ZOXA 1MDLA 3GC2A 4HT3A 4RJEA 4O17A 3S1VA 1JEZA 2YZ5A 3LUTA 3R89A 1BVWA 3Q45A 5HPCA 3VKAA 4E2BA 4QDMA 3VDHA 4J5NA 3TWAA 4YVPA 4BKNA 3W73A 2G4JA 5ABTA 4DVOA 2R6OA 2ZE0A 3GS6A 4S3KA 4XBKA 4M19A 1KXTA 3UWQA 3WFLA 3N2XA 2BVTA 3K4AA 2HBXA 2ISSA 3A47A 1W1YA 3ARRA 3M0JA 3VKDA 3U6WA 3W28A 4NAFA 1V0KA 4AHPA 1QNPA 4O11A 3CUJA 4BWLC 4OV9A 5AC7A 2V38A 1KM2A 1GVYA 1TPEA 3QR1A 4O18A 2VEIA 3CL6A 4OTKA 4XAYA 1VBHA 2OQHA 5BXSA 1TVLA 4IPLA 5EA9A 1X7FA 4W88A 3W1TA 2DUXA 4NF7A 4OHQA 2CETA 3TROA 1FXQA 4IWWA 3M47A 2WM1A 3PWGA 3UZJA 3WD3A 1V93A 4GIYA 2V5BA 1O95A 2ZXQA 5E6ZA 3GK0A 3H2OA 5GQBA 4P7LA 3W26A 1JZ8A 3TYCA 1M68A 3B06A 1H1NA 4UFLA 3IVTA 3T42A 3OGRA 5LKYA 3Q4DA 1SW7A 2AOSA 1HP5A 4IHCA 2VX6A 2CESA 2VFDA 1A5UA 5IHRA 1TTQA 5EL1A 1ITUA 2YYUA 4L5ZA 3KTCA 3KOZA 4GJJA 2GJXB 2B0MA 1G1YA 2FFCA 5DEZA 4JNZA 3KHJA 1NWSA 3EWDA 5HATA 3VCRA 4AF0A 3TXVA 1UMYA 3EOLA 1I2QA 1HZYA 1XGZA 3CXOA 5A6KA 2A3HA 1E4MM 3G6MA 4QR6A 4H6EA 1RPKA 2ZXDA 2GFTA 4KGLA 3CUFA 3O7UA 1CXEA 4ZFMA 4ZZ9A 2QW5A 3HIJA 3IACA 3V1HA 4MY8A 5M3WA 3TSMA 4E8GA 4DY1A 3ZYZA 1B2YA 5T8GA 1W1A1 3GXNA 5G1TA 4UTLA 1ZS2A 3M0HA 3NFUA 1D8CA 1QR7A 3O6YX 1LCOA 4NJJA 2V81A 1TZ9A 3G1RA 1Y7VA 4YS1A 3OIXA 4ERAA 1ONEA 2BVDA 3HG4A 8XIMA 3CHDA 1LQ2A 1UQYA 5K7JA 3H8AA 1ONRA 4BF7A 3PZTA 3ZM8A 2PDPA 1MEWA 5A3HA 1H7NA 2AAAA 3D0CA 4C6PA 2WPBA 3Q37A 1M04A 5E93A 1UBPC 5G4HC 1AQHA 3ZR6A 2VD8A 1NARA 5G4EA 5IHSA 4AX6A 2PDJA 1IV8A 3IGHX 1I2PA 3HJZA 4IFKB 3R6IA 2NX1A 2DIJA 3WLSA 1P7TA 4IIHA 3BW2A 2WLZA 4AIUA 4CNNA 4WR3A 1F3EA 4OOUA 3ZZ1A 4C7GA 4L4LA 3VGEA 3SADA 3AAMA 1XLBA 1TRIA 4W5UA 3F1QA 5HANA 3GFZA 1EBHA 1LQ0A 4FAMA 2CC0A 3HPZA 2QIIA 3DGRA 1WB0A 3E02A 4FXRA 4QISA 1XFBA 1SW3A 2I56A 3TMQA 3E6EA 1GTHA 1Q85A 1QI4A 1XYAA 4K8GA 3CIWA 2AQVA 3W1UA 4RL3A 3H7VA 4Y2WA 3T2QA 3KS5A 2Z27A 5A1AA 5JH2A 1XLHA 2E0PA 1G7UA 5HAOA 4GJ1A 1IEXA 2DVTA 1EUNA 2PDQA 4Q8WA 5XIMA 4MVAA 3WNNA 4HZ8A 2C14A 3KVLA 2NXGA 2IXVA 1RV8A 3AS2A 3C61A 4UCFA 2YL9A 2E8ZA 5GPRA 1D2KA 2ZZ5A 1M7PA 4EE9A 1W2PA 2OCZA 4MYXA 2HROA 5CC6A 1DBTA 4DJDD 5C2GA 1KM3A 2GUBA 4FX6M 4AZIA 3KX6A 4RNJA 1NOUA 4DJFD 5CLTA 5DBUA 4LPCA 3DAQA 1E56A 3AZSA 1VF8A 1TV7A 4ZO9A 1TB3A 2QUVA 4AWUA 1RJRA 3T40A 3GNPA 1J0ZA 1ZU8A 3W37A 1H7RA 1CDGA 1OGGA 1QPQA 1F9CA 1TVPA 1D8WA 3NZQA 3CLWA 1TPFA 3DC0A 1XYCA 3PZQA 3WH6A 2G0WA 3RILA 2C79A 3VD7A 1TCMA 1XDJA 3NXLA 5AYXA 4XSMA 1JCLA 4GZIA 1JXJA 2OU4A 1AQFA 1H4PA 2ADAA 4OKDA 2D20A 2YGYA 2VXNA 4DBDA 1O1ZA 2I16A 4CEUC 1WUEA 3OBEA 1VP5A 2G5WA 2OMAA 3M46A 1DWIM 3STEA 1H3GA 2PGRA 3V4BA 4C6DA 3G24A 1TQJA 1IT0A 3N2BA 3HBLA 4PL1A 3GHUA 3F4VA 3WK3A 5TF0A 1MZHA 4GNVA 1NFBA 1XCWA 1GEHA 5JH1A 3VYLA 5CPLA 3TNBA 3QY6A 3L0GA 3DFQA 1V0LA 2AQWA 4Q4RA 4S3GA 2ASHA 5MKGB 3PFRA 1MEIA 3HGOA 1P6CA 4X0VA 2A21A 4HSNA 1OT1A 3MHFA 4D6JA 1LLOA 1XIMA 2J88A 5AZ1A 4O4WA 3BOLA 2IS7A 3JS3A 2YDRA 2DW7A 3TYDA 3WBEA 3SJNA 4Q6XA 4WK9A 4YYCA 4FHAA 3BK0A 3MZNA 4S2CA 2BG5A 5AOUA 3FCPA 4IQLA 3EX6A 4BF5A 2QF8A 1VPYA 3DBNA 1PV8A 3LYEA 2WMJA 3SCUA 2BASA 4MKNA 1XFCA 3WYZA 2O9TA 4NNBA 5CQ1A 1H1ZA 2PP0A 1IGSA 3EDDA 2GLKA 2VRQA 1DWGM 3ABOA 2A0NA 4GXMA 2V3FA 5BZAA 5G2HA 2DVUA 1FX6A 5CJMA 3WG6A 1I0DA 3NTYA 4BK9A 3VIHA 4QTGA 2CERA 3PG8A 3FGCB 4PFMA 3IPWA 1Z3NA 2PDKA 1XLLA 1FWDC 1B4EA 2YB4A 4NY2A 2XJ7A 2VZOA 4JKKA 3DUGA 2CLPA 3B4YA 4KQNA 2VCCA 3ARQA 4TIMA 4E0CA 4YJ5A 3GBEA 4H9YA 3I7QA 3Q65A 2R1NA 1HUVA 4GOAA 3H2NA 4TXEA 1W8SA 1QHZA 3USBA 4LTSA 2NVCA 3S46A 4NAEB 5FEWA 1GNXA 3W2JA 4HZMA 4F40A 2QVNA 3U4AA 1PKYA 5K4XA 1J79A 4M81A 1UB3A 1EOMA 3WBXA 1IT7A 3GHRA 1G0CA 5HNRA 3PJXA 5I00A 3H2CA 4AIBA 1W3JA 3H21A 3WH7A 5BNKA 3LBOA 4GUIA 3W29A 1VLWA 2DV0A 4H01A 4TVDA 4Z17A 1UH4A 1B1YA 1G9HA 3DENA 1FWFC 3W7PA 2G3NA 1HL2A 1X7IA 2FDMA 2E5DA 3CK5A 4O0QA 4UTJA 4O28A 1XLGA 1QNVA 5SWUA 3UQNA 1EHNA 1KCXA 1KKOA 2QCHA 2HISA 3I4EA 1LLZA 2VQTA 4LY8A 3SM0A 1KW1A 1XLFA 1AH4A 2VELA 4JIIX 1B3VA 2HSAA 4FNQA 1AL7A 2E5CA 4HJFA 1BLIA 5BYWA 4EKJA 3VFCA 1A80A 3COTA 1WXZA 2OWCA 4M0XA 4EANA 3N17A 4LWWA 4BS0A 1DJWA 5DCEA 4AX7A 3A9IA 4JTIA 5A6LA 2DQWA 1V03A 1QPOA 1SO5A 3T4WA 1G6CA 3TOPA 3L21A 2ZZ4A 3THCA 1VJSA 1FRBA 3CASA 3NOYA 3CL7A 1DVJA 3IS4A 2IW0A 4L1GA 2DZPA 1W3NA 5T9BG 1W9UA 3GYEA 4DAFA 3KRZA 3CV2A 2FQIA 4ICCX 4KPLA 3WNMA 3P5ZA 4HU8A 4P61A 5I03A 3VZXA 1GVIA 3G18A 4LYPA 4QHRA 3TTOA 3NJ3A 5BOOA 4QEHA 2RKXA 5DELA 1K9DA 3OEXA 1MUCA 4OOZA 1WAWA 4HPXA 4WKFA 2OSYA 2H3DA 5EMKA 1LBMA 4ZQOA 2Z2BA 3ELFA 2HV5A 3W83A 4RV3A 3QHNA 4I5RA 1BF2A 2P3ZA 2PTWA 4RPQA 3NO5A 2BGNE 1C8VA 2YCEA 2INFA 1WUFA 3W1PA 3M9YA 2VRKA 3FA4A 3MMWA 5F1UA 3GC5A 2PCEA 1QUMA 3DOPA 3RCNA 3LSBA 2QUTA 2VCBA 4AZ6A 1E9ZB 1L2QA 5D09A 5EBUA 1JCNA 3O9NA 3A4JA 4EK7A 1A47A 4TX8A 2POTA 2IQTA 4KCVA 2B7OA 4J2MA 2Y7DA 4P8WA 4AD4A 1FWIC 3SZ8A 4WGHA 4AEOA 3O07A 1SGJA 4GK8A 5LNVA 1ISVA 5J5RA 1MQPA 5C6MA 2H3BA 4MY9A 1TWIA 1FWRA 3TP4A 3IWPA 3WH9A 4C65A 1X1OA 1BD0A 2J7FA 2NUWA 2IMRA 3WF1A 4CU7A 4J2PA 4KCWA 1TR1A 1BGAA 4XVEA 2VEFA 1JL8A 3E74A 3NQMA 3QY8A 4W8BA 1S1PA 3L5LA 4S1FA 1K9FA 4Q32A 4AMAA 4O53A 4A2RA 4GXPA 3N34A 1UD6A 1XPYA 3BLIA 2FPTA 2W5FA 1AW1A 1UR0A 3W74A 4FNPA 3VNLA 1TUFA 4NUWA 2EHHA 1FHUA 5EY5A 3CT2A 3TZFA 3DKJA 2D0GA 2IKHA 4JTLA 3GHTA 2P88A 4RZBA 5L9FA