3U7BA

A new crystal structure of a fusarium oxysporum gh10 xylanase reveals the presence of an extended loop on top of the catalytic cleft
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
327
structure length
327
Chain Sequence
b'AASGLEAAMKAAGKQYFGTALTVRNDQGEIDIINNKNEIGSITPENAMKWEAIQPNRGQFNWGPADQHAAAATSRGYELRCHTLVWHSQLPSWVANGNWNNQTLQAVMRDHINAVMGRYRGKCTHWDVVNEALNEDGTYRDSVFLRVIGEAYIPIAFRMALAADPTTKLYYNDYNLEYGNAKTEGAKRIARLVKSYGLRIDGIGLQAHMTSESTPTQNTPTPSRAKLASVLQGLADLGVDVAYTELDIRMNTPATQQKLQTNADAYARIVGSCMDVKRCVGITVWGISDKYSWVPGTFPGEGSALLWNDNFQKKPSYTSTLNTINRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE
molecule tags Hydrolase
publication title The structure of a GH10 xylanase from Fusarium oxysporum reveals the presence of an extended loop on top of the catalytic cleft.
pubmed doi rcsb
total genus 134
structure length 327
sequence length 327
chains with identical sequence B, C, D, E
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2011-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3u7bA00
4GZIA 5A69A 1JD9A 1HJWA 1R7AA 2CITA 1F4AA 3DHUA 4XV0A 1E0XA 1ISXA 1QI3A 3AHTA 3ZSTA 1W2PA 4AW7A 3BMWA 4PBGA 3VNZA 1XYFA 1G0CA 2E8ZA 3WF4A 2XTKA 3MMWA 1ZBCA 4E2OA 1MQRA 5DEZA 3W28A 2YA1A 3VMNA 2OLHA 1CYGA 1WO2A 3WBEA 4KWUA 1PEZA 1KQZA 2EXOA 1N82A 4HOWA 1JGIA 3VD7A 1Z32X 1H0IA 2J77A 2XVKA 4FLRA 1UD5A 2UY4A 4PCSA 2J7BA 4AYSA 1NOWA 5DT7A 1HX0A 4MB1A 2WLYA 3OLGA 7A3HA 4F79A 5I77A 4BQ2A 2V3FA 3TONA 4H41A 1PIGA 4JKKA 1WZKA 5A2AA 3AMCA 4ZENA 1JZ5A 1R8LA 1G1YA 5CSYA 5CSUA 4TVUA 3WD2A 2WMIB 1CGYA 4BCEA 1MW1A 2ZUWA 4B3KA 2ZX9A 3T08A 2CESA 3MANA 2F8QA 2EPLX 1C3FA 4L4PA 4QLLA 2WVVA 4J3WA 5FD0A 3ZOAA 1E9LA 2BHYA 3CBWA 2VL4A 3MO4A 3ECQA 5F7UA 4HZ7A 5I2UA 1AVAA 4NF7A 1NP0A 3RILA 4J27A 2D23A 4UFJA 3SCRA 4PMZA 1C91A 2J7FA 1WDSA 4UTFA 1D7FA 2BV9A 4F9DA 4AZBA 1QPKA 2D0GA 3AIVA 2ZUTA 3OGVA 1HJQA 2YDSA 4P7LA 1BG4A 3BXWA 2XGIA 4JIEA 1BTCA 4GINA 1E1FA 1KXVA 3GZAA 2QLYA 4UZSA 3ZJ8A 1JYWA 4PMNA 2J79A 3HJEA 5M17A 5JBDA 1WKYA 2BY0A 4KGLA 5LA2A 4MNMA 1NQ6A 2Y24A 4OZOA 1BGAA 1CDGA 1HKKA 2AOSA 4QCEA 4D6GA 5FOOA 3OGRA 5DO8A 1NWSA 1V02A 4W7WA 3WENA 2ZX5A 2GK1B 3OLDA 3VIPA 1BAGA 2Y4SA 3BLPX 3PZUA 2DQXA 4ML4A 4H04A 5HPCA 3N9KA 5C70A 3CO4A 4XZBA 2XG9A 3BMVA 5CPTA 4D1IA 1MQQA 4DUWA 1VJSA 4H8HA 5DMYA 4XB3A 1QNQA 1UHVA 4AIEA 3VGDA 1JD7A 5A6SA 1VENA 5ABFA 5D8ZA 1FH9A 4QLJA 1J01A 2YL9A 4HP5A 1EDQA 2ZIDA 4H8UA 2BNJA 1FFQA 3OGSA 4PMUA 2YDRA 3VX0A 1XGZA 4J3UA 4AZ5A 1NOFA 2J7EA 4UQEA 2GJPA 3PZNA 2W67A 4PMDA 3EDFA 1XD1A 4P8VA 1MW2A 2XSBA 4U2ZA 4LYRA 5E70A 2DEPA 1QNPA 4E8CA 3CUJA 4BF7A 5M3WA 1VJZA 4TX6A 5EMYA 4DM1A 1IV8A 2CBIA 3MV11 1UWSA 4D6IA 1C8YA 4TXEA 3POCA 1JYXA 1SMAA 1ITCA 1GOIA 3U7BA 3G6LA 3WL1A 3GNRA 4WK9A 2VVNA 5D8WA 1QI2A 4F66A 1TA3B 2OYMA 3ARUA 4IPLA 1BYBA 1V6XA 4BS0A 2WWCA 3AS1A 5A3HA 4AC1X 2WZIA 3SUWA 2CEQA 3VUPA 1KGWA 3MS8A 3M07A 1SMDA 4UOZA 4UFHA 4U5KA 9CGTA 3BGAA 1TVNA 3CHFA 1FP9A 2UY3A 2J7DA 2XIBA 2G3MA 2PC8A 5I24A 1HT6A 1V3JA 1LL4A 5LA0A 4BA0A 3RM4A 1FFRA 5A6LA 1J9YA 1G01A 2EPKX 4M1RA 4AY1A 4DWSD 4U2YA 3AISA 3OZPA 2Y2WA 5AC4A 2ZUMA 1CNVA 3RDKA 1QHOA 5GNZA 2UWFA 2WCSA 3N11A 2XVLA 4DWSC 4P7RA 3SCNA 5E0CA 1JF5A 1V6YA 2V3GA 4Z2IA 1HKJA 3ZT7A 1HVQA 1OT2A 1YHTA 3OB8A 3MMDA 4UFLA 1UWRA 5D9OA 4PSRA 4CD7A 3L4XA 2XVNA 2XFRA 2XFYA 5HOSA 5JIWA 1C92A 2EQDA 1UKOA 1U2YA 4D72A 2VRQA 5HDRA 1TFVA 2J74A 3N12A 5CLTA 3VX1A 2PWHA 1W2VA 3RMEA 5HPOA 2J8FA 4AZCB 2ZUNA 1PX4A 1UUQA 4BZYA 2VJXA 4AZ6A 1HL9A 1SYTA 4AXNA 4Z2KA 1VIWA 5A2BA 1HP4A 2DH2A 5LYRA 3KL3A 1FA2A 1GNXA 1UR4A 2WMKA 1E56A 1JFXA 3E1F1 2FGZA 3WIJA 3UR7A 4AIOA 3I3DA 1KGXA 1BVZA 1OCQA 1KGUA 4UOQA 4GXPA 3PTKA 3K1DA 1FH8A 2NT1A 2Z1KA 3VMOA 4OBRA 1NM9A 1GVYA 5I78A 4YPJA 4WKHA 1QW9A 1UWTA 2D22A 3WSUA 4D6EA 1MXDA 5A2CA 1E5NA 3L4VA 2PB1A 1FHDA 3AHYA 4FF5A 2G8ZA 1TZ7A 3GH4A 4LQ1A 3PZQA 1XSIA 1GQJA 1B3YA 1EOKA 3IJ7A 4D6FA 3VD9A 1V3LA 4U5IA 2E9LA 2WCAA 3WKZA 1JXJA 4W5ZA 3TTQA 1J0ZA 2XYLA 4GZEA 1XCXA 1WDPA 2BY1A 4AD0A 5FIPA 3N13A 1WDQA 3L4UA 2DT2A 1JNEA 3N17A 4U31A 3WQVA 4ZXLA 3WEMA 1UZ1A 3WD1A 4DWSB 2DSZA 4MDPA 1JYNA 4ATLA 4JKLA 3BAKA 1NP2A 1Q6DA 3HU7A 3ZR6A 1D3CA 2YLLA 3RJYA 3W26A 4ACZB 3D5HA 1EH9A 4U3CA 4AZCA 2O92A 3WDIA 4CU8A 2J75A 4PTMA 4TUFA 3ZJ6A 1RP9A 5D4YA 3UG5A 2XWEA 1B3ZA 1G5AA 4HZ6A 4PMYA 3ZMRA 5D9MA 2D0FA 2W66A 2FHBA 4W89A 5E0FA 2X0HA 5BWFA 3AMGA 4K68A 1RP8A 5A8OA 3PZTA 4ZEPA 1H41A 1TCMA 3CZGA 1BLIA 1IZKA 3L2LA 4CD6A 3GXIA 1HNYA 2ZX6A 1QOXA 4W7VA 3AQUA 1R87A 3IAPA 5A8QA 4W93A 3VDAA 2PWEA 4AZIA 2NW0A 1XH1A 1J0HA 2C8NA 4P7QA 3UETA 2BXZA 3SCSA 5JBEA 1ECEA 1EGZA 1E4NA 2GUYA 4CCDA 1RPKA 4AZ7A 1WCGA 3IANA 1R86A 3IAQA 3GYCA 1X6LA 4CVUA 3SUSA 4M8UA 1QBAA 4A3HA 3VPLA 5D9PA 1EDGA 5JIPA 2DGAA 2WXDM 2ZX7A 3AMLA 3QHOA 2D2OA 5AY7A 3RPMA 3AZTA 3EBVA 3QHNA 2OSXA 8CGTA 5EB8A 3AZRA 1JYVA 3RIKA 4NI3A 3THDA 1A47A 4GQQA 1PX8A 2GDUA 1W1VA 4LXFA 3W37A 3K46A 3HMCA 2VQUA 3BSHA 3RM8A 4YHEA 4AD5A 1BYDA 3SURA 2VZSA 1CTNA 2DSKA 2Q8XA 3WD0A 1MWOA 3A4WA 5FL1A 5IFTA 1KQYA 4W87A 1C93A 1OIMA 3LPFA 5CXPA 5A6AA 4QDMA 1E71M 2EO7A 1L0PA 2DPEA 3B8SA 1GOMA 1DWJM 1E6QM 1WDRA 2TAAA 2WZEA 3DYPA 4W5UA 4BQ4A 4B9YA 1S46A 3VIGA 1BF2A 1WZMA 2QV4A 3QHMA 1CLVA 1V6WA 1J10A 3SIMA 2WC7A 4PRWA 1KR0A 3ARZA 1UA7A 3AIUA 4OIFA 4CKQA 1CZ1A 3VKKA 4EAMA 3W6LA 2XM2A 3DHPA 4UQAA 2GJRA 2BY2A 1A3HA 1WPCA 4KMQA 3VNYA 2E40A 3FNDA 1V3MA 2EPMX 3PTMA 3WNPA 2ZXAA 2O9TA 2XVGA 3NJ3A 2BY3A 1V0NA 4UCFA 1CENA 4CN4A 1DEDA 3CPUA 5BROA 1GJWA 3O9NA 4WJXA 5HBFA 1E3XA 4CD5A 2GSJA 1EQPA 4UQCA 3F5LA 2G3JA 1QHPA 3VIJA 1LWHA 4J3SA 4HA3A 2IXVA 2WZHA 6A3HA 1VEOA 3GH7A 3I3EA 1H1NA 4CU7A 3WF0A 3K8KA 1MXGA 1JZ6A 4Z2JA 1VFMA 1E70M 1GCYA 3ZJKA 3I3BA 4F9JA 1C8QA 4PTVA 4B3LA 5I23A 2W63A 2OYKA 7CGTA 1VF8A 5DF0A 2WYSA 3DC0A 3VGEA 3WDRA 2WHJA 1VAHA 1P6WA 5LA1A 1SR0A 3VGFA 2F2HA 1B3VA 2W62A 1I1XA 2ZUUA 3BCDA 2VZOA 2E4TA 1ODZA 3AIRA 1V3IA 1V0LA 1J12A 3WBAA 2JE8A 4URIA 4MTVA 1X6NA 5A8MA 5DFAA 3WDJA 2YL6A 1FHLA 1E6ZA 3K8LA 3GM8A 3PTQA 1ITXA 3AYSA 5ABEA 2PF0A 3WUGA 2QF8A 1XV8A 1EO5A 1W3HA 3WNKA 4NZCA 2BHUA 3SCUA 4C7FA 4R5EA 2Y8KA 1UR9A 1TE1A 2OWXA 1JZ8A 4EANA 1LL6A 4B9ZA 4JAWA 4UFMA 3MV01 1OSEA 1WZLA 4KRUA 1ZBVA 1MFUA 2CBVA 2A3EA 3SCQA 2GJXA 1XH2A 1DWIM 2WPGA 4NSBA 3CHDA 3ZM8A 4X0NA 1HKMA 1HKIA 4Y7EA 3NSXA 1TG7A 3AI0A 2WVTA 2OSWA 1MW0A 3A6OA 1B3XA 4DUXA 4F8XA 4ZE4A 1JL8A 4CGTA 1KWKA 3N18A 3GDBA 1CXLA 3T0BA 4UFIA 2YLAA 2WVSA 4NRSA 2EBNA 1W9BM 1US3A 1JZ4A 2PWFA 4CN6A 2WC4A 1X1NA 4M80A 1GHSA 4OOZA 1V0KA 3AXHA 3PZVA 2RGMA 1B2YA 1PAMA 4WSJA 3OG2A 1B3WA 1GONA 3UG4A 3ZIZA 1R85A 5GQBA 4PYSA 1LG1A 3W24A 3AXXA 4Z2HA 2G3IA 1UZ4A 1V03A 3MMUA 1PZ3A 3WQ8A 4ATWA 5ABFB 3BH4A 4MDOA 5BXRA 1GQKA 1E0VA 3KL5A 1CGWA 1CGTA 2VO5A 1HL8A 1M53A 1MFVA 2VX5A 4IM4A 4MAZA 3T0DA 3WMCA 3OLIA 1B1YA 1M04A 5DT5A 2V38A 4DUVA 3BAIA 1W1TA 5JUVA 2BVDA 3EDKA 3WEOA 3AROA 5I6SA 2VT0A 1BPLB 2E0PA 2XVPA 1KBKA 2XWDA 2GVYA 3UESA 2ZXDA 1GOQA 3EDJA 4D6DA 3L4YA 1BQCA 1E6XM 2BHZA 2YBUA 2WMFA 3VOCA 4JKMA 1GPFA 2ZUSA 4ZXOA 3W29A 2VZVA 1HN1A 1CGXA 2QMKA 3L4TA 4MADA 3OBAA 4PMRA 3CHEA 1HF6A 3VDBA 5CZKA 3CUFA 4PMQA 5AYIA 4DWSA 2WWDA 3N1AA 1E4LA 2V3DA 4FLSA 1BVNP 2ZXBA 3VIFA 1BHGA 3OZOA 4UNIA 3QR3A 3MKKA 4AEEA 4OBSA 4PUDA 4N42A 4HA4A 3EYPA 4JZ5A 1UR2A 1PX3A 4A3YA 2GDVA 4GI6A 2HISA 3FN9A 3MSGA 4AEFA 1HIZA 4X9YA 1JI2A 2X0YA 2UY2A 1EXPA 4PCTA 2ZX8A 3W6MA 2V3EA 2FDMA 3POHA 1ISWA 3T2PA 1OGBA 4A4AA 4AZGA 2NT0A 1QHZA 3PZGA 2EEXA 1LJYA 3T2OA 1C7TA 1HP5A 2WBKA 2VNCA 1E6RA 4IISA 2WMGA 2VX4A 3UERA 1JDDA 1M03A 2PBOA 3ARYA 4PUEA 1SFSA 4PN2A 1EHAA 3A4AA 3SCWA 3CZKA 2WANA 4V28A 3VGHA 4FMVA 1KXTA 1UKQA 3EMQA 1W9PA 2WHKA 1W1PA 2J7CA 2PWDA 1E40A 2D1ZA 1DWHM 2PI6A 5EFDA 2BFGA 1H3GA 2A3CA 1W32A 3VD3A 4HOZA 5CPQA 1NWTA 4ACZA 3U5YA 5GPRA 2YIHA 2BVYA 1QW8A 3APGA 5ECUA 2DSVA 3WL0A 3WH6A 5BRQA 3AJ7A 3CHCA 4RE3A 1TUXA 4CCEA 2G3NA 2XHYA 3RJXA 2J7HA 5FL0A 4RE2A 3NCOA 2WKLA 3PZ9A 4MJ4A 3LPOA 4P8UA 4Q22A 5BRPA 4XZWA 3PN8A 3WDQA 1OGSA 1MYRA 1VBRA 5E6ZA 1GOKA 4FLQA 3WN6A 3ZJ7A 3UR8A 5KEZA 4MB4A 3WUBA 1KB3A 3ARQA 2QPSA 2VOTA 3ARVA 1K9FA 4OUEA 2D3NA 3SEPA 4AD4A 3B9AA 3FXYA 4AD2A 4W8LA 1GORA 4JFSA 1FP8A 4J3XA 5CLWA 1ZU8A 2GFTA 3RCNA 1C90A 3M7SA 1CXFA 3JUGA 2G4FA 1PJ9A 1LL7A 2WM0A 1KWGA 2OYLA 2EJ1A 5C8BB 1HXJA 2VTFA 1W1YA 3VM5A 4LYPA 1E3ZA 4Z2LA 1TVPA 2YKKA 1LF1A 3ZO9A 3F4VA 3VU2A 3QOMA 2FH6A 3CGTA 4ACYA 4CN1A 2WHLA 5A6KA 2WNWA 3LPPA 3WFZA 1VEPA 1E5JA 1JG9A 2FHCA 2CYGA 2EPOA 3CLWA 2WVUA 3KE0A 2YL5A 1UD8A 2ZXQA 1O6IA 1Q6FA 2AMGA 1RD6A 1ISYA 3W0KA 1QVBA 2CPUA 4M81A 3W4RA 4BQ5A 4MJ2A 3WMBA 1E4MM 1XRVA 4B15A 2V5DA 2VZUA 1UH3A 3VGGA 1B31A 1XD0A 1Q6GA 2DT3A 1OWQA 3HN3A 3T0AA 2DSWA 5M5DA 1QNOA 3AZSA 3ZT5A 1KFWA 3RO8A 5C71A 4J3TA 2ZE0A 1UR8A 5CPSA 3IK2A 2YDQA 2O9RA 2WKGA 1V08A 3PHAA 4L4OA 1CWYA 4MB5A 2WMHA 3BAXA 3LMYA 4QFUA 1DP0A 1CXEA 3EMZA 5I0DA 4M56A 2QHAA 1MW3A 5BXTA 2WAGA 1WE5A 3VD4A 1OGGA 3ARSA 1NWRA 1V6VA 4J28A 1YQ2A 1E72M 1E55A 3W82A 4CU6A 3UEQA 1V3HA 3ARTA 5HXMA 2CKRA 2A3AA 1CPUA 4Z2GA 1W91A 3IJ8A 1VFFA 2VURA 2G41A 3M6DA 4W7UA 3VILA 4BQ3A 1OD0A 3CTTA 3ZQ9A 2FGLA 1WNOA 1UH2A 1ISVA 4HU8A 3BAWA 1CLXA 1C8XA 1K6AA 1IT0A 4IPNB 1B90A 1W3JA 4TX8A 1V3KA 2ZICA 4V27A 2MANA 4WKAA 5A95A 2CNCA 2WK2A 4W88A 4P8WA 1K9TA 3WQWA 4QAWA 3VM7A 2JF7A 3KZSA 4KGJA 2ZWZA 4IUGA 3MUAA 2O9PA 3WFLA 4JL1A 3WDHA 4CCCA 3DECA 2WLZA 2YA0A 3SCVA 1AQ0A 4JFVA 1W9UA 3CZJA 5A6MA 3AS3A 3G6MA 4UQ9A 2VI0A 1TMQA 4RL3A 1CIUA 2VR5A 4M24A 2CBJA 4UOJA 3ARPA 1E15A 3CMGA 4LPCA 1ZBKA 3VO0A 1GJUA 2VR4A 4TVCA 5A6JA 2ZOXA 2VZTA 2Y8VA 1FOBA 1WP6A 2O9OA 2GK1A 3A47A 3AIQA 3IJ9A 3W81A 1ZB5A 1PBGA 1G94A 4S3JA 4UQDA 3UG3A 4HU0A 3OLEA 3SCPA 1CXHA 1O7AA 2WC3A 3CUIA 1LLOA 2ZUVA 3N15A 3AIWA 3ARRA 3L4ZA 4JFTA 2VX6A 2WSKA 3AS2A 2VRJA 4GPNA 1AQMA 1W9VA 4GIAA 1LG2A 3FW6A 2E9MA 5A6BD 1OIFA 2W5FA 4OKDA 4EE9A 4PMOA 4UR9A 2NSXA 3NSNA 3B9DA 3NSMA 5AC5A 3ZT6A 4S3KA 1UD3A 5ABGA 2X1IA 1MQPA 3T09A 4HZ8A 2YJQA 4H2CA 3GXDA 1EIBA 4JHOA 5A94A 3WELA 1PPIA 3AMDA 5FKYA 5CGMA 3EMCA 3WUEA 4EK7A 4JCMA 3ARXA 4PMXA 3B9EA 1MVYA 1GOWA 3SUTA 3MSDA 2IXUA 4R27A 4MNJA 1H09A 4HPHA 4V2XA 3SUUA 1DTUA 3EDDA 1H49A 4HMEA 2BS9A 4JCLA 2CERA 4TTUA 1KCKA 5ABHA 1JAKA 2CETA 2E9BA 5FCZA 1ODUA 1OB0A 2D24A 5E9AA 3CZLA 2WW5A 3RM9A 1BYCA 4ZFMA 1H11A 4GO9A 3FY1A 4W8AA 3GH5A 4YHGA 4KRTA 1HJUA 1JFHA 2YBTA 1UOKA 3MUY1 2WB5A 2J47A 5BYWA 1UKTA 1KR1A 5I5RA 4MNKA 1UH4A 4PTXA 4CUCA 3BSGA 3O6AA 3W38A 3QOKA 4NRRA 5GNYA 1VFUA 3MU7A 4AWEA 2XIIA 5A1AA 1WB0A 1CBGA 4GQRA 4HMDA 1UYQA 2WHMA 2DIEA 5M03A 2J4GA 4JL2A 1RH9A 2B31A 4RE4A 1BSIA 3WQ6A 4N0RA 2GJXB 5IHSA 1DWAM 1W3LA 3J7HA 3WNMA 1JZ7A 1ISZA 1CECA 5CG0A 2WSPA 3VD5A 4MAVA 1Q6CA 1GOOA 1UD4A 3VIHA 1OD8A 3VTRA 5CJ5A 4W84A 1EHNA 4M29A 3AFBA 3S6TA 1QBBA 1E0WA 1UWIA 3S2CA 3ARWA 2DSUA 2XPKA 1QNSA 3GXFA 1E6NA 2E3ZA 1NARA 4DM2A 1UD6A 1XHGA 3WH9A 2VMFA 2JALA 3U57A 2W4XA 1WZAA 2DH3A 1UQZA 4MPKA 5GNXA 4U33A 3DYOA 4D6HA 1ZJAA 3WMSA 3WF2A 4PEEA 3BAYA 1KBBA 1WAWA 4D6JA 3WEZA 1GHRA 2BXYA 3DYMA 2VRKA 1KCLA 3BAJA 2A3HA 3BCFA 1M01A 3MUIA 4QCFA 6CGTA 2FHFA 3ZR5A 4FK9A 2CHOA 2DDXA 1J0JA 2J7GA 4D1JA 3L2MA 4W85A 2DT1A 1TA3A 3TOPA 3WF1A 2ZWYA 2HVMA 2D20A 4MB3A 1DHKA 4LGXA 3AOFA 2W92A 1CXIA 4PMVA 4MNLA 1ZS2A 2C0HA 1FH7A 3U5UA 1Q6EA 3A4XA 1H5VA 1C7SA 4X0VA 3TA9A 2XJ7A 1JIBA 3W53A 3WF3A 4HOXA 2YOCA 3O2LA 4WKFA 1UR1A 5CGTA 3M46A 3WH8A 3KWXA 5AYBA 1OM0A 1I1WA 5IHRA 3GBEA 1US2A 4E4PA 7TAAA 2JEQA 4UZUA 3N04A 3PBGA 2VX7A 3AS0A 1UD2A 4M82A 4TOQA 1K9DA 1VEMA 2J62A 2AAAA 5EBAA 2EPNA 3TP4A 1QI0A 2VCCA 2FH8A 1ZL1A 3VVGA 2PBGA 2A3BA 2VCBA 1BG9A 1JXKA 3WDPP 1PIFA 1J18A 1H0GA 4JFUA 1QI5A 4H8VA 1W9XA 4HPGA 3CUHA 4AZHA 1CGVA 3CH9A 4AISA 5I79A 1U30A 1U33A 2WMJA 2VVSA 3VIOA 1ESWA 2OWCA 4GO8A 1NOUA 3GBDA 2D3LA 1JDCA 2W61A 4AMCA 4HA1A 3NDYA 1V6UA 2PWGA 2YL8A 3LPGA 4P8XA 3AXIA 4AD3A 1UQYA 1E6PA 3AMKA 5E6YA 3FAWA 4ATDA 1QI4A 4JFWA 2J25A 1J0IA 1K9EA 3KEHA 4PTWA 4YN5A 1XYZA 4E8DA 1G9HA 2VQTA 1UR0A 3PZOA 4D6CA 5HNNA 2F61A 5A8NA 2V5CA 1JAEA 5BXSA 2Y5EA 3KL0A 1UG6A 1J0YA 3W25A 1B30A 4CVWA 3WNOA 2JIEA 3L4WA 1JZ2A 3WH5A 4KH2A 3THCA 2UY5A 4AIUA 3WD3A 1H2JA 3VGBA 2CBUA 1GQIA 1UKSA 1BGGA 1JZ3A 5A6BA 1IZJA 2X2YA 4GKLA 2QPUA 1UWUA 1E73M 1JF6A 1E1EA 1HJXA 3VIMA 3II1A 2WBGA 1BFNA 1KXQA 6TAAA 4PSPA 1EOMA 3T2QA 2WVVB 4QP0A 1V0MA 3U7VA 2YA2A 1W9DM 1QNRA 1VFOA 2D0HA 3CMJA 5KZ6A 2XSAA 1F4HA 1HJVA 5BXPA 1UKPA 1Q4NX 4LYQA 1DWFM 5JBFA 3NDZA 4C7GA 3VDHA 3FHQA 3PZMA 2WMIA 1OT1A 1UWQA 3VINA 4WLCA 3NUKA 3WY1A 3AIBA 3K4DA 3WH7A 3WUFA 2J78A 4GZJA 4W86A 1DWGM 1OINA 4XX6A 3F5JA 3SCTA 3TTSA 8A3HA 1ZBWA 1PZ2A 2CCRA 2XUCA 3ZSSA 3D3AA 3GNPA 3WD4A 1AMYA 3SCOA 1XC6A 1VB9A 4CD8A 5A8PA 3TTOA 4WF7A 3AYRA 3OA5A 5BCAA 2OSYA 3F5KA 3WQ5A 1EA9C 3ALGA 4P7OA 3QGVA 2OWWA 1XSKA 3UCQA 5EFFA 4XUYA 4EKJA 3FHAA 4H7VA 1BYAA 4UQBA 1VBUA 5E09A 1W3KA 4D71A 3VMPA 3EDEA 2Z1SA 4P7NA 2BVTA 2J8GA 4J7RA 3OIHA 4QLKA 3SUVA 2DIJA 5I3DA 1M7XA 2X8RA 3FAXA 4Q7NA 4C7DA 5IFPA 3WQ4A 3CIVA 1CXKA 4U3AA 3A3HA 2CIPA 1B9ZA 1LQ0A 2CHNA 4JHZA 1XCWA 3CZEA 2CXGA 5IXEA 4GI8A 1GW1A 1AQHA 1LWJA 2RGLA 1VRXA 1E4IA 4HTYA 4WSKA 2JFEX 3GXMA 1KXHA 1EDTA 1UA3A 4AD1A 2XM1A 2XGBA 2WCGA 1GZJA 4HMCA 3AHXA 1Y7VA 2VUYA 3VIIA 1L8NA 3WNLA 2CKSA 3TTYA 3GNOA 3PZIA 1NH6A 2XFFA 1R7OA 3AICA 5IDIA 4OOUA 2W91A 4B16A 3VIKA 1HJSA 3BLKA 1TR1A 5D9NA 1V02E 2E8YA 4TTGA 1XSJA 1H4PA 1HVXA 4W8BA 1GQLA 4J3VA 1CGUA 2X05A 2IUZA 1XH0A 2JEPA 3CUGA 1EO7A 3BC9A 1I75A 3AHVA 3GTNA 1D2KA 4GI9A 3MUZ1 2JF6A 3K8MA 1JI1A 3AHZA 1NWUA 4TVDA 1JNDA 2C7FA 1OBAA 1J0KA 1E6SM 1EQCA 3CZ8A 4FLOA 3NYDA 3AIEA 1ZJBA 2JIWA 3ALFA 2VCAA 2ESCA 4UFKA 4OJYA 1JDAA 2X09A 4CD4A 5CQ1A 3WNNA 1CEOA 1GUVA 4WIWA 2DT0A 4ZE5A 5TD4A 1E43A 3NIYA 3K4AA 3VDCA 1J11A 1B0IA 3W27A 2VC9A 2QMJA 4LX4A 1GVIA
chains in the Genus database with same CATH superfamily
4GZIA 1EP1A 4G7FA 4F2TA 2CITA 1ISXA 1QI3A 3DHDA 1VYSX 1CB2A 5D2TA 4A8LA 3MMWA 1ZBCA 2AQWA 3N3TA 1ALDA 4E2OA 3LBMA 2QXWA 3IUHA 5DEZA 3HA1A 2EKCA 3DKJA 2J9YA 1XJBA 3ANVA 1JCMP 1PUDA 1Q13A 3EA1A 4QG9A 4HOWA 1JGIA 3QV7A 4UCGA 4IPPA 4QEHA 2J77A 3W7PA 2XVKA 2UY4A 4IL0A 3NXLA 2WLYA 3ICJA 4CQDA 4HZMA 4JTSA 4F79A 1QW7A 5I77A 4BQ2A 2V3FA 3IIZA 3NL6A 4JKKA 3AMCA 4LB3A 4ZENA 1JZ5A 1R8LA 5CSYA 1ZLPA 3WD2A 2HPMA 3BV4A 4GYJA 3HFTA 1JDFA 4B3KA 5G1YA 4N4PA 1EUAA 4LUIA 2V68A 2WVVA 1QNVA 4JTRA 1XYBA 5F7UA 3C2YA 4HZ7A 5I2UA 1FWTA 5JH1A 3LLFA 1S2TA 4V1YA 3TLLA 3WK2A 3L7RA 3F4NA 1TQXA 1XIFA 2FIQA 1K7FA 1F8IA 4ERAA 1IIHA 4RNHA 3T7VA 3B9OA 2NQHA 3OGVA 1B5TA 2HVOA 4H6RA 3NGJA 4P7LA 1DIEA 3NA8A 1BTCA 4LF1A 4GINA 1E1FA 4C6KA 4FF7A 3ZJ8A 3P5ZA 1T5AA 2BY0A 4KGLA 4DYKA 3L2IA 1QPQA 1S39A 3GO2A 4MNMA 1NQ6A 2Y24A 1BGAA 3F4WA 1HKKA 1TZZA 3JZUA 5IM51 4DX3A 2Z25A 5DO8A 1P0EA 1AZ1A 4FX6M 3H7UA 2GGHA 3W74A 3B97A 2GK1B 1S2CA 3VIPA 2YCJA 2Y4SA 3MHUA 4H04A 5HPCA 3NL3A 3TFCA 4GQGA 5CH9A 1MXSA 3GXTA 3VNJA 1KRAC 4XSMA 3UXKA 3EWXA 3QTGA 1XBXA 4H8HA 1NQKA 4LUTB 4CLMA 5DMYA 3CM4A 1FQ0A 1UHVA 2PDMA 4ADUA 1VCGA 4QR6A 2ZKMX 5D8ZA 4QLJA 1HGYA 4FR6A 3S9IA 2PP1A 2ZIDA 1XLKA 2XGZA 3PUDA 3FIGA 3B8TA 1SO5A 1YXCA 4YCOA 1H7NA 4R88A 5LNRA 1NOFA 2W67A 4ORIA 1XD1A 4P8VA 1XUZA 1MW2A 3I7SA 3U2OA 1EB3A 4GUJA 1QNPA 4WX2A 4E8CA 2RH9A 4BF7A 3MMTA 4HB7A 4BFAA 5DY3A 3G1DA 3VA8A 4DLMA 4Q8NA 4JN7A 3HGOA 1UWSA 4GMEA 1C8YA 4TXEA 3BOFA 1VBHA 3POCA 4UTJA 1JYXA 1JPMA 2CW6A 3U7BA 4HK7A 5LIWX 3BVJA 4GKTA 4F66A 4KWOA 2HS6A 4W9TA 3ZLHA 1TPWA 4BEQA 4AC1X 3SUWA 5REQB 3M07A 3UXDA 1TTIA 3EXTA 1S1PA 1SMDA 1WX0A 2OVLA 1VS1A 4U5KA 9CGTA 1O4UA 1FP9A 2J7DA 2XIBA 3LXCA 1SJDA 2CLHA 2PC8A 2OODA 2J27A 3RMJA 1XIBA 4BA0A 5A6LA 4M1RA 3KZPA 4FXSA 1EWDA 4I7VA 3QY8A 3MQTA 3RDKA 3PAOA 1MDLA 3N11A 3W86A 3TYCA 3LG3A 4F40A 3CS2A 3SCNA 1JF5A 4HIBA 1VKFA 3W22A 1YHTA 3QMSA 4NZ3A 4UFLA 3KAOA 2FZDA 5D9OA 2OOFA 4PB3A 4MM1A 3TTEA 2XFYA 1F5ZA 1UKOA 3C0LA 3SECA 5CLTA 3W1QA 5TF0A 2A0NA 3RMEA 3Q4DA 2V8ZA 4QQ3A 4JTEA 1PX4A 3R25A 2VJXA 3NQDA 3LTSA 2HDJA 1HL9A 4AXNA 5HMFA 3VOJA 3T0TA 1HP4A 2DH2A 2J6XA 5LYRA 1FA2A 1QK2A 3E1F1 3EX6A 4CEXC 1T96A 4A29A 1Q8JA 3WYZA 1OCQA 2JGYA 3W7DA 4UOQA 3K1DA 1H51A 3RLGA 4OBRA 1GVYA 1F6YA 4GNJA 2ALDA 3GVGA 4WKHA 5HJXA 2D22A 3COTA 3WSUA 4G7EB 1E5NA 4S2BA 3TX9A 1XUUA 2G8ZA 3GH4A 3CUXA 4LQ1A 4PL2A 1AMKA 3UFYA 1KC7A 1R30A 1B3YA 3WBXA 1R3SA 4GH3A 3B04A 4Z0SA 3VCNA 2WCAA 2IKIA 2QVHA 2QCMA 3GC2A 1M5WA 4A2SA 3AJXA 1FWBC 3KOYA 1BWVA 2NQJA 1GVOA 4M5PA 1WDQA 4GE8A 3QXBA 3UG8A 3MJYA 1UZ1A 1XBZA 3WD1A 2Z1VA 1CB7B 4JDYA 1SZNA 4JKLA 4QDPA 3C2FA 4FX7A 1T6MA 3M0MA 2P5NA 4ACZB 3QC3A 2QR6A 4U3CA 4AZCA 2WZTA 1RP9A 3UG5A 2XWEA 1B3ZA 3BICA 1D8CA 3Q2DA 3URQA 2NUYA 3PBMA 4PMYA 1BSLA 2AL2A 3WQFA 1DJIA 1ITUA 1M6JA 1RP8A 3NEVA 4FB7A 4ZEPA 1IEVA 3CZGA 1QOXA 4W93A 3KRZA 1DJYA 3VAVA 3GHRA 1ZHAA 3I7RA 5AZ1A 1QOQA 2IKHA 1ECEA 2PA6A 1E4NA 2GUYA 4S3FA 4N2YA 2ISFA 4GNKB 4HNNA 1X6LA 2XU2A 3UQNA 1IEXA 3SUSA 1QBAA 2G3FA 4O1DA 3I6RA 3ITTA 1GKPA 4DZHA 5I7GA 1P6BA 3AMLA 4B5UA 4WGHA 4B5WA 5CCZA 3I65A 4I6VA 1I2NA 1HKWA 3FSTA 3SAZA 5AY7A 4QQUA 2Z6IA 4ZMGA 4LW7A 1XIJA 3QHNA 4F4RA 1D3GA 8CGTA 2ZRUA 4Q4PA 2FPVA 5H8UA 3IGUA 3VFCA 4LXFA 4YHEA 2VFFA 1CTNA 2D73A 3UZXA 3LRLA 2Q8XA 4X2PA 3WD0A 3GFYA 3A4WA 2VC6A 5FL1A 2QCGA 1OIMA 5KETA 1S5NA 3OQEA 1SW0A 1J6PA 3ZXWA 4DZAA 1E71M 3MB9A 1KTCA 3FA3A 3W23A 3B8SA 3B4YA 4RV8A 3T1GA 4R3UA 3BZGA 1DWJM 2VGIA 1R47A 4W5UA 2P10A 1WZMA 4REQA 3LXAA 3QMTA 5CG7A 1J10A 4C1NB 3AO0A 4DAIA 3S2LA 3C2RA 1XLIA 4PTNA 2W27A 3VKKA 3GK0A 3W6LA 1R3WA 3DHPA 4YLWA 4P2VA 2FLIA 4UWMA 4BKNA 2BY2A 1WPCA 3VNYA 1QAPA 2E40A 4ASTA 1JEZA 1BVWA 1RQBA 4HCLA 1M7OA 1U5VA 1V3MA 1XIEA 3LCLA 3H4WA 3PTMA 3PM6A 2Q6ZA 2RDWA 1V0NA 4V15A 4UCFA 2Z0IA 2C13A 5MKGA 1CENA 4H7ZA 4AYGA 4JTFA 1V8EA 4WJXA 4CD5A 3MJMA 4UQCA 1GYMA 5D02A 3C3UA 4J3SA 4HA3A 4AHQA 2IXVA 2WZHA 2X7WA 4EXBA 3I6EA 3H26A 1G7UA 1MXGA 4Z2JA 1VFMA 1B54A 4MJZA 3HZ3A 4QRNA 1VZWA 7CGTA 3BE7A 3CWOX 5DF0A 4O8AA 2WYSA 2WHJA 4GC3A 4JXCA 4QDWA 1QFEA 2IPJA 1I1XA 3GUGA 2VZOA 1IR1A 3Q58A 4KEUA 1V3IA 4H6KA 1A80A 1EC8A 1DIKA 4PODA 1NVMA 3PTQA 4DO7A 3AYSA 5ABEA 4FXFA 4BI5A 3UJEA 4J2MA 4FNSA 1FCBA 3LI1A 2BHUA 1GKRA 2FPYA 4XAZA 4R5EA 2HNEA 1TE1A 3BL3A 1YPIA 4C1NA 4UFMA 1K77A 4RUBA 4O53A 2INFA 2FTPA 5ENLA 2NVAA 1MFUA 5AC6A 2Y61A 3BLLA 2GJXA 3EKGA 3QR0A 4KPLA 1CW2A 1HKIA 1YE4A 3AI0A 3CC1A 4UIOA 1B3XA 4TR9A 4E4UA 2QIIA 3NQEA 3P7YA 3G1VA 4PUJA 3VYLA 2H3DA 1IXOA 3VZZA 1JDEA 4BJHA 3GDBA 3CUZA 2YLAA 3O0KA 3N6QA 3TQKA 4ZQOA 1US3A 1K03A 2WC4A 1X39A 4NAFB 3AUOA 4IQDA 3U48A 1FCUA 1PKYA 1Z9AA 3OQ8A 5CPLA 4O11A 3OG2A 1B3WA 5C0QA 1R85A 5GQBA 3W24A 3AXXA 3NL5A 4MWAB 4I8DA 1ZJHA 1V03A 3MMUA 4JN8A 1SFTA 3TU9A 1TWDA 3PJUA 2VYOA 1CGWA 1N7KA 2R82A 1HL8A 4L1XA 3OLIA 4C6FA 5FSEC 5DT5A 3GR7A 4LUSB 1W1TA 3YPIA 4O4WA 5JUVA 2BVDA 3WEOA 2YW4A 2XVPA 1VCFA 1F07A 1KBKA 2XWDA 3KOFA 2HROA 3EDJA 1X97A 1BQCA 1QXLA 4IJCA 3QH2A 1MEIA 1LT8A 1HN1A 1CGXA 1NF7A 4RR4A 3QJAA 3W75A 2BOFX 3DFYA 3WK0A 4LV9A 1KRMA 5G4WA 2XZ9A 3K13A 4PMQA 3W1TA 3JRKA 1VQTA 3N1AA 2ZYFA 2V3DA 4FLSA 2ZXBA 5H2ZA 3OZOA 4UNIA 1HFBA 3BZJA 3MKKA 2BTMA 4HA4A 2JKAA 3DGRA 3M5ZA 4LUSA 3KXQA 1UR2A 1KBLA 2ZRXA 3LLXA 4GX9A 2JGQA 1NFBA 4Y8EA 2O4MA 2PDQA 4X9YA 4WOZA 1JI2A 2UY2A 4PCTA 5F4WA 4EF9A 4Z0JA 2V3EA 1WA3A 3POHA 1ISWA 1Q45A 1MUCA 2Y7DA 4A4AA 1QHZA 1WOAA 1DVJA 3NXFA 1HP5A 4RZ4A 4FEZA 4IISA 1O94A 2VX4A 2PBOA 2OG9A 3ARYA 1SFSA 3S3GA 3CWNA 4M7SA 2WANA 1G7VA 5J5RA 5IRPA 4Y9MA 2XINA 3VGHA 2QS8A 2JKPA 2PWDA 2D1ZA 3SFWA 2PI6A 3VD3A 3VXGA 4HOZA 4B92A 3EA3A 2GSHA 3W07A 5ECUA 1OC5A 3OODA 2GWGA 3BURA 3WH6A 3Q94A 4C65A 4IFOA 1A4LA 4CCEA 3RJXA 2AGKA 2Y89A 2OLAA 3QKZA 1ICPA 2WKLA 3V7PA 4LAKA 3BG3A 1WBJA 3LPOA 4XAYA 3IPWA 3WDQA 1E0UA 1Z7AA 2QW5A 4JHMA 2QCCA 5E6ZA 4FLQA 2Z28A 2VKZG 2O56A 1O5RA 3TH6A 5KEZA 3WUBA 1F6PA 4A35A 3VKBA 4HU4A 3ARVA 5F1VA 2OGJA 4GFIA 4O16A 4XTDA 4OUEA 1FWGC 3UPWA 4Z1YA 2BOGX 1DTNA 3FVMA 2ZRZA 2DZBA 3RCNA 5B7ZA 1C90A 1Z69A 1CXFA 2G4FA 1PJ9A 3FKRA 4DJDD 3CV1A 4HYWA 2OYLA 1W5OA 6REQA 5C7VA 3WO8A 2EJ1A 1HXJA 2VTFA 1E3ZA 1OG6A 2Z1BA 1TVPA 1LF1A 3ZO9A 2WNNA 3VU2A 2FH6A 1Y5VA 3CEUA 3P6LA 3E2SA 1LP6A 3TFXA 3DXIA 3USZA 5C2CA 3LDVA 2CZDA 4B4FA 3AUJA 2ZXQA 2AMGA 1Q6FA 1RD6A 3W0KA 3C0SA 4HMNA 1C9WA 1LUCA 2CPUA 3GTFA 5I3HA 1BD0A 3WMBA 3TV8A 1E4MM 1XRVA 2V5DA 5G2WA 2DZWA 1B31A 3W73A 2HE8A 3PSWA 3R0UA 2DT3A 3T0AA 3GG0A 5I07A 3FYOA 4UR8A 3VC6A 3W7CA 3EWUA 4J3TA 3UGVA 1UR8A 1MRAA 5CPSA 3SSJA 1DQWA 2ZZ5A 2WKGA 3HB9A 2J24A 4HNTA 3MI2A 1TWZA 2HZGA 1YXDA 2Z2BA 4QFUA 4AMAA 2YCLB 2G0WA 3TN5A 1KW1A 2H8ZA 5I0DA 4M56A 3PULA 4GJJA 2QHAA 4H9VA 2A2IA 5IBXA 2PODA 2WAGA 3F4DA 2BVWA 3GTXA 3HPXA 4AVNA 1V6VA 4UNLA 3D47A 4CU6A 5HINA 3UEQA 1U83A 2QPXA 1CPUA 3NPVA 3VILA 2Z24A 1FWCC 1JJKA 4ICCX 1X1OA 3ZQ9A 1WNOA 4IQEA 4HQVA 1TWSA 4HPXA 4C6BA 3BAWA 1LQAA 4XTIA 2ZFAA 3UPMA 1B90A 4JTQA 5JQ9A 1PWLA 2OQLA 5DCDA 1NDVA 5A95A 2AQVA 1ZAIA 4Q6XA 1YX1A 4P8WA 1K9TA 3WQWA 3VM7A 2JF7A 4KGJA 1ZENA 2ZWZA 1NTHA 3MUAA 3QRHA 3DECA 4MJMA 4B3ZA 2CWXA 3AYVA 4XVDA 3H54A 1T99A 3DENA 2FJKA 3LCHA 4S3CA 4POCA 1TMQA 4RL3A 4PE8A 1PWMA 3ARPA 4XKMA 1E15A 3V0TA 1GJUA 1LWIA 4JYDA 3GS6A 2ZOXA 2VZTA 7XIMA 2Y5SA 4M1BA 3S5YA 1QPRA 1LRNA 1L6YA 3GQYA 1ZB5A 1UBSA 1PBGA 3R13A 4O1FA 3URAA 1SZEA 1ZAHA 5CAHA 2WC3A 3CWHA 1LQ2A 1IGWA 3AIWA 3AS2A 1AQMA 4GIAA 1DQXA 3FW6A 1M7PA 2PRMA 3KHDA 3PB0A 1OIFA 4EE9A 4UR9A 2QJJA 4MWAC 4HNUA 5AC5A 1I0BA 3ZT6A 3WQPA 5HAOA 3DKLA 2AAMA 3N14A 2GOKA 1ZP3A 4H2CA 4JTUA 1MMFA 2YCLA 3ZLGA 3LA4A 1EZ2A 1TJ2A 3MYOA 3AMDA 5FKYA 1LROA 1SSGA 4DJEA 5CGMA 2R6OA 2HV5A 3DBNA 4EK7A 2QCHA 4JCMA 3ARXA 3B9EA 2DP3A 2AKZA 3L0NA 3GC5A 4BHYA 4H9TA 3EWZA 1GEHA 3IUDA 4HPHA 3SUUA 1DTUA 4OWGA 1H49A 3MVTA 2BS9A 2PDNA 3ES8A 2HEJA 3PBVA 4NZFA 3DBPA 2D24A 2QJMA 2IKGA 1K8ZA 5DY2A 3WLTA 4QEEA 2C91A 1H11A 3T07A 4IGNA 3SFKA 4GO9A 4YHGA 1JFHA 2YBTA 1ITQA 3EOEA 3IGXA 2WZMA 4L6OA 1RSCA 1TVLA 3H4XA 2ZVIA 3I4KA 3GU2A 1M1BA 1UH4A 1DORA 4V1XA 1TTQA 4PTXA 4LSBA 4CUCA 3BSGA 3QGKC 1I2RA 2QDHA 3MU7A 3P67A 1W3NA 2XIIA 2QULA 4J5NA 2Z29A 1P7TA 1UYQA 1JCNA 4KEMA 5M03A 1IWPA 4JL2A 1RH9A 2B31A 3WQ6A 2F7FA 5M2FX 3GKAA 5G4EA 3IIOA 1YDVA 5DRCA 1ISZA 5CG0A 3PAJA 2WSPA 1VC4A 2FB3A 4MAVA 1DE6A 1Q6CA 1GOOA 1UD4A 1OD8A 3MSYA 4FA3A 4FZIA 3LCIA 2PTXA 1E0WA 2QVNA 4JR5A 5I3KA 3ARWA 3ID7A 1AL8A 2VFEA 1FTXA 3P62A 3EKLA 2VMFA 2PLMA 1U5HA 2X7VA 3H21A 3DYOA 3MI3A 2O7SA 4D6HA 1P7TB 1IEWA 1WDWA 1ZJAA 3WMSA 3IEBA 4PEEA 4M6VA 4MPQA 3LHUA 3KP0A 1EYWA 3OHIA 3EWCA 4IMFA 3BJSA 1KCZA 2FHFA 4XG1A 3OVRA 4FK9A 3B4UA 3IVTA 2YXOA 3L2MA 4W85A 2DT1A 4DNHA 4FS9A 3KRSA 4DBUA 2Z1XA 4XBSA 1AFSA 4IG2A 3M16A 1P0BA 1QPOA 3A4XA 1C7SA 1OYAA 5DLCA 4PFHA 2YOCA 4WKFA 4C6OA 4BR1A 3RITA 4ZQMA 3P80A 2HK0A 3ZZ1A 1KM1A 2G97A 3LK6A 4BWLA 3RGTA 3GU1A 1H63A 2OO0A 4M82A 4TOQA 3VABA 1Y5WA 2J62A 2VD9A 3QC0A 2EPNA 1QI0A 2DFAA 1AZ2A 4DPPA 2OZTA 2A3BA 2VCBA 2GJLA 2GGIA 3OZYA 1QTWA 4H8VA 3WJXA 1IGSA 4IHCA 3S1GA 1XLMA 3CH9A 2JQXA 8XIAA 4MFEA 3QV6A 1W8SA 3FEQA 4GO8A 3GBDA 1J5TA 1JQXA 4TU1A 2NQZA 4BI7A 3ABSA 2RJHA 3NDYA 4P8XA 3TXZA 4A05A 4YVVA 3AWNA 5CGQA 4GY1A 4W4QA 1LOSA 4IG2B 3UVIA 3BV7A 5E6YA 4GZ7A 4LCQA 5FJRA 4JFWA 2J25A 1J0IA 3PB2A 4PTWA 4YN5A 1G9HA 3GVVA 2NZLA 4S39A 5BXSA 1Q3NA 1UWAA 5HNRA 1J0YA 1AODA 3W25A 2OKTA 3ITOA 1N8FA 3BSMA 3WH5A 3THCA 4XO7A 4AIUA 1H2JA 3ZFHA 1QR7A 4H9UA 1GQIA 2UV8G 1IZJA 3OYZA 1B3OA 1XQLA 1JUKA 3VIMA 1PE1A 2WBGA 3Q65A 6TAAA 1R3RA 2Z4GA 3IARA 2YA2A 5HWMA 1SO4A 1X7IA 3DUGA 1UC4A 2I5GA 4IPIA 3SRHA 1V93A 2ODOA 1HJVA 3CTLA 2X0SA 1TV3A 3A23A 2WKJA 1XX1A 1QDSA 1YDNA 3CIWA 4C7GA 1EKOA 4YCPA 2WMIA 4IIEA 4AFYA 3K4DA 5DMNA 3WH7A 2ASHA 3O06A 3WUFA 1RUSA 4W86A 3BANA 4QSHA 4QITA 2CCRA 3ZSSA 1KNWA 1WQ5A 4PZVA 3GNPA 1AMYA 3FOKA 1XC6A 5LGZA 1VB9A 4CD8A 1PYFA 2OZ0A 3TTOA 4JEQA 1EFZA 3C4UA 5AECA 3F5KA 3IVUA 3STEA 3U2CA 3RR4A 3RFAA 3LCFA 4UTWA 2HBXA 2OWWA 3M0KA 4MY9A 3TSDA 4NI8A 3DFHA 2E25A 1S2AA 4EKJA 1DHPA 4GIYA 3H7VA 4D71A 1JPDX 3EPNA 3UYCA 1ZUAX 5FEZA 2J8GA 3PPFA 2OELA 4GYPA 3QZAA 2OB3A 1VD6A 3FAXA 3RNDA 3WQ4A 1QATA 2YSWA 5DMLA 1CXKA 1G4TA 2JBMA 1B9ZA 3R5EA 1LQ0A 3EB4A 2CHNA 1GW1A 1AQHA 1VRXA 4HTYA 2JFEX 3DFPA 2W3ZA 2Q02A 4JGDA 1KM3A 2BB0A 4DF2A 1UA3A 1ZCOA 2WCGA 1GZJA 4IMDA 3EOLA 3GDLA 1H1ZA 1L8NA 2J88A 4WR3A 2A3LA 1YBQA 3LRKA 1VFSA 2D2JA 3W7QA 4ECLA 3PZIA 1Q5MA 4LU0A 1PZ0A 1FDYA 3AICA 3PNZA 4OOUA 3ITYA 3KOXA 4B16A 1W37A 4KKXA 1F3EA 4XVEA 2E8YA 1XSJA 3W87A 1EL3A 4TV6A 1GQLA 2BG5A 2DZPA 4J3VA 3R89A 5EU9A 5LSMA 2Z1WA 5D2XA 1I75A 1D2KA 1UJQA 4GI9A 3KHJA 2V6AA 3CL6A 1OFPA 3AHZA 3OEXA 1NWUA 1W1B1 4C6LA 4J9JA 2C7FA 4FLOA 4FNQA 3AIEA 1ZJBA 1RXOB 2ZADA 4QJ5B 1WAUA 4OJYA 2V5KA 2F9RA 4H01A 2VEPA 2X09A 2E68A 3OJGA 4CD4A 3WNNA 3GFXA 4Z08A 1CEOA 2OOGA 2DT0A 3G2GA 3W00A 4L56A 3URNA 1QUMA 3P5YA 4C6EA 1J11A 1B0IA 2C1HA 4LX4A 4N9DA 5A69A 1JD9A 3HBLA 3DHUA 3GW0A 1E0XA 4PB5A 3WLMA 1TPB1 3AHTA 4PBGA 1RLDA 2CC0A 1EYEA 1XYFA 2FDSA 2E8ZA 4JIIX 3C0JA 3UWVA 3IACA 3LGDA 3CYVA 3LS9A 1XLEA 1CYGA 3S46A 4I5XA 4PUMA 1KQZA 2E09A 4GBUA 4FLRA 4B5TA 1HL2A 4RNJA 2J7BA 4AYSA 5DT7A 7A3HA 1Z44A 4I3GA 3HG5A 2B7QA 1WZKA 3PFMA 1KCXA 2V67A 4EPBC 2FZNA 2B7PA 4ERIA 3P3BA 4K39A 5MF5A 1LUCB 1H5YA 1PDYA 5KZEA 2CESA 4LUTA 2EPLX 4L4PA 1C3FA 2DUAA 4J3WA 4IGHA 4ZTYA 3OYXA 3CBWA 3MO4A 3ECQA 3MP3A 1LCOA 4NF7A 1NP0A 3RILA 1A3WA 4NUWA 1SW3A 1U5JA 5CBBA 2ACUA 2DU2A 4UTFA 2ZQ0A 3U6WA 3VCCA 3IGHX 2CHRA 3AIVA 2YDSA 4AX6A 4ZBCA 4DJFD 4JIEA 4XSLA 3XINA 2E77A 2J79A 4PMNA 5M17A 4RE0A 1WKYA 7ENLA 4NQ1A 1CDGA 1QRQA 3MKVA 2AOSA 4D6GA 3W1RA 4IX0A 3OGRA 2PC4A 1RR2A 4B2DD 3BLOA 3NQMA 4W7WA 3LCXA 4WGXA 2ZX5A 4YWSA 1O12A 1RPXA 3OLDA 3GIPA 1BAGA 4PRTA 3LNMA 3HPFA 4G56A 3OO2A 3BMVA 1K4GA 5CPTA 3OZMA 3R2GA 5IDZA 1MQQA 5CSRA 4DUWA 1VJSA 1DQUA 4O10A 2R1MA 1FVPA 4YTTA 3NQCA 3STCA 3XIMA 5A6SA 1E0TA 1K1DA 3TN4A 4FNPA 2YL9A 3T05A 2PCEA 3N6HA 3GG1A 3M5XA 2YDRA 2VUNA 4YTUA 3VX0A 2J7EA 2GJPA 4UMCA 4PMDA 3EDFA 1ZRQA 3GYEA 5E70A 4LTSA 4QIUA 3CUJA 1DXFA 5M3WA 2ZZ2A 1VJZA 2CBIA 1S5WA 1XLAA 2C15A 2X2GA 3G6LA 2VR2A 3GNRA 2VVNA 5D8WA 1GJPA 1QI2A 1V6XA 1A5NC 4QS5A 1ENUA 1KGWA 1OK6A 2YXXA 5C9WA 3TC3A 4L7ZA 4UOZA 4WQ6A 2WSYA 5HULA 1H62A 4RDVA 2PDFA 3GZ3A 4IICA 1LL4A 1FFRA 5G5IA 3AAMA 1W3IA 2X30A 3TZFA 4DWSD 3ZR4A 2B81A 4DJED 1EWEA 3OZPA 1A5BA 1K7EA 4OU1A 5AC4A 3MZNA 1LTDA 5GNZA 1MI3A 2PUZA 5FF7A 2XVLA 4GLEA 4DWSC 5E0CA 3L65A 3UZWA 2V3GA 2NX3A 2QUTA 3B0YA 1HKJA 2ZDRA 4P61A 1OT2A 1ICSA 2C1IA 3MMDA 4XIAA 5FEXA 1U1HA 3BQ5A 3L4XA 1U2YA 4D72A 2D2GA 2J74A 3N12A 3PPHA 3VX1A 1VBGA 3HPZA 3LHWA 4LY4A 1MZRA 1W2VA 3RPTA 1OC6A 3WQGA 2ZUNA 2Y6ZA 4ZOEA 3S1WA 2IPWA 4BZYA 4DJEC 4QJ4B 2AQOA 1I8JA 4XZLX 3H7RA 2ZA3A 3T78A 5BMXA 1GNXA 2WMKA 1E56A 3QPEA 3WIJA 1S38A 4B91A 3UR7A 3LXBA 1BVZA 4X22A 3EX2A 4Q33A 4GXPA 1FH8A 1YRRA 3VMOA 4Q8MA 3OPSA 1AW1A 3L66A 4D6EA 4DPQA 4Y9AA 3A3WA 3AHYA 1FDZA 1TZ7A 4YTSA 1XSIA 3WLOA 3O16A 3IJ7A 4LCSA 3EX1A 3SY1A 2TYSA 1ZFJA 2J8TA 3W1PA 1V3LA 4U5IA 1Z41A 4JS3A 3PFRA 2R94A 4W5ZA 1TPUA 1J0ZA 3CB8A 3UF9A 5C9RA 1F3WA 4Z1CA 4HJWA 3O8AA 4PFMA 1XRSA 3CLMA 1JNEA 4O1AA 1QO2A 1ONEA 4I8YA 4DWSB 5DX7A 3V75A 1P1XA 2DZUA 1JYNA 4X3ZA 4LC6A 3BAKA 1Q6DA 6REQB 1TJ0A 3S5OA 3RJYA 3WJZA 4EIVA 5MHBA 2O92A 4CU8A 3TR9A 4C6MA 2DVUA 1IHIA 4KF1A 4UTKA 5D9MA 1S5TA 2A4AA 1XYAA 2NWSA 1J93A 5LXXA 1SFLA 1IZKA 3L2LA 4GACA 1HNYA 2VHLA 3AQUA 3IAPA 3VDAA 4HCDA 3TIMA 4LOCA 5JBEA 1EGZA 3MT1A 4CCDA 1RPKA 4AZ7A 1FWJC 1RA5A 3IAQA 1ZPTA 3N2OA 4OFCA 4M8UA 1XLDA 4A3HA 1J79A 3UZZA 5JIPA 2H9AA 2QIWA 4LRSA 5G1TA 4HK6A 4EPKA 1KKRA 2ZA2A 2RAGA 2D2OA 3C52A 4M3PA 3RPMA 4KFOA 3AZTA 3EBVA 1AD1A 1XI3A 4DJFA 1JYVA 2V81A 3RIKA 2XH4A 2Z27A 4NI3A 1EC7A 3THDA 2PSNA 4GQQA 3HJZA 4BWLC 3BLIA 4H1ZA 1MUMA 4JTLA 3FKKA 3S1UA 5CC5A 3GAKA 4AD5A 4IJRA 1BYDA 3SURA 2VZSA 3TW9A 3MHGA 2DSKA 4NX0A 1AJZA 4W87A 1E51A 1PHWA 3LPFA 2E7FA 4WJEA 5I3JA 3NZPA 4UB9A 1GOMA 1QOPA 1BWKA 1OABA 3DYPA 4B9YA 5I09A 3VIGA 1L6WA 3QHMA 7REQB 1V6WA 4WOQA 4UBPC 4PRWA 1KR0A 1YTKA 3GNXA 2O0TA 2PP0A 3E0LA 3TSMA 3GVWA 3ITLA 4K7YA 4H9MA 3HGSA 3C2VA 1TB3A 4KCVA 5GJPA 3FNDA 1M3UA 2CLLA 2EPMX 1HUVA 4NY2A 4JTAA 3NJ3A 4D8ZA 2BY3A 3S42A 3UJRA 3M5YA 2BODX 4NYYA 3DOPA 1KFBA 3CPUA 4O8RA 5U7SA 4DWDA 3M47A 5HBFA 4OT7A 2GSJA 4IFKA 2G3JA 3VIJA 1LWHA 2CLOA 6PTDA 2Q8ZA 3ABRA 3MWCA 3LRMA 1XWYA 4PUNA 3SB0A 4CU7A 3E74A 3TYZA 1JZ6A 2PD9A 3FFSA 3WK1A 4K8GA 1E70M 1GCYA 1EC9A 3KVMA 4PTVA 3B03A 3DH7A 4B3LA 3GTHA 3NZRA 3RYSA 1VF8A 1OX4B 3NR0A 3VZYA 2OX1A 1SR0A 1B3VA 2ZUUA 1JVNA 4N4QA 2E4TA 3AIRA 1ONRA 3RXZA 3WBAA 2JE8A 4URIA 4MTVA 1SM9A 1VBJA 4R7OA 3WDJA 1FHLA 1E6ZA 3K8LA 3JR2A 3V3WA 2QZRA 2IQ0A 4O0QA 4YTQA 2E1WA 3I6TA 3LX9A 1DE5A 3MCOA 3VCRA 1EO5A 5CSSA 4Q4KA 4TX9A 1MO0A 4B9ZA 3N9SA 5CZ0A 3MV01 5JU6A 1R2SA 4GUFA 4K1GA 1WZLA 4E38A 4KETA 2VDGA 1DXEA 5TBOA 4PR4A 1XH2A 2WPGA 1VPQA 1CX9A 3QVQA 2GUUA 3E38A 1TPC1 3ZM8A 3N2TA 4RZ6A 2VGGA 2Y5JA 1W56A 3NSXA 3QPZA 2C71A 3W1MA 5HMSA 3RHGA 1JL8A 1TRIA 4ZE4A 2GPTA 4CGTA 1KV8A 1YADA 3N18A 1OFDA 2WVSA 4NRSA 1AH0A 4LNYA 1AQFA 3ABZA 4Z17A 3O6YX 5K3VA 3G5EA 4HNCA 1X1NA 3STPA 3SY8A 5F4XA 2OJPA 3CQKA 4GX8A 4N6FA 1FHUA 1HZYA 3AXHA 3N25A 1B2YA 1EIXA 8TIMA 1PAMA 2Q3RA 4A22A 2BMBA 2I1OA 4K3ZA 4QE4A 4F0LA 1GONA 4PYSA 3TW7A 4Z2HA 1PZ3A 3WQ8A 4ATWA 5ABFB 4IXHA 4MDOA 2CXEA 4L9ZA 3QR1A 5GJNA 1E0VA 1S5MA 3VNLA 2BXVA 5T8GA 1REQA 2H8XA 1MFVA 1OX6A 1VPYA 2VX5A 4IM4A 4ZTXA 1KFKA 4S2CA 4MAZA 3WMCA 2R14A 1B1YA 3WX7A 3W7IA 3KBSA 3KWSA 2R1PA 3EDKA 1ML1A 3CL8A 5I3FA 1IF2A 1TPDA 1BPLB 2VT0A 2H3BA 4IIFA 2GVYA 1Q6LA 2ZXDA 2P3EA 3L4YA 2FPTA 3P61A 4CNPA 3W29A 2SFPA 3OBAA 4ZQNA 1HF6A 5CZKA 4J40A 4DWSA 3UNDA 4XKYA 1E4LA 2VXNA 1ZTVA 2NWRA 4B5XA 1UOZA 5HANA 4OBSA 3SQLA 3SGUA 4N42A 2F6UA 4A3RA 4A3YA 1Q66A 2GDVA 3MVIA 3PJTA 3RN6A 2PGRA 1G4EA 3FN9A 4ZQCA 5HMEA 3MSGA 4ZO7A 1VLWA 2B7NA 1EXPA 2ZX8A 3LU2A 4JQ3A 5EMMA 4PRRA 4JIPA 4GA8A 2O7QA 3V36A 5CJMA 2EEXA 2C14A 4FAMA 1D9EA 1C7TA 4QM1A 4UC5A 4EXAA 2VNCA 1E6RA 3MA8A 1FWWA 1WBHA 3UERA 4LRTA 3W7HA 4PUEA 4PN2A 3CZKA 1G6CA 1QO5A 1XIDA 2NQ9A 1FCQA 4X60A 4QXIA 2YPIA 1SR9A 4JX5A 3GY1A 1W9PA 1E40A 1JCXA 4WHBA 1KFEA 3QW3A 4UTTA 2WPBA 5CPQA 3B05A 1NWTA 4JEJA 3U5YA 2YIHA 2BVYA 1XPYA 2Z7GA 2CZEA 3G1HA 3MDUA 3AJ7A 1OF6A 2ANUA 3KDOA 4E3TA 2QAPA 4GG9A 2XHYA 2GOUA 2J7HA 4RE2A 3QY6A 3G22A 2ZZ4A 4IL2A 4UMAA 7ODCA 1RA0A 4MJ4A 5BRPA 3SADA 2NVDA 3PBWA 1WUEA 3UR8A 3RLVA 3QF0A 3U9IA 5FF4A 2VEKA 4Q3MA 2DV0A 4O28A 2QPSA 2VOTA 3W85A 3ZVHB 4FOKA 2D3NA 1XXXA 4AD2A 3BG5A 3N34A 3W71A 2Y7FA 4TIMA 4RZ5A 1ZU8A 5LHEA 3MTWA 1J2BA 4F2UA 2WM0A 3DZ1A 1JCJA 3RF9A 3RRXA 1UUMA 5I00A 3U2ZA 2W79A 2DZSA 1A5OC 3QOMA 3CGTA 4GQBA 1KM5A 1TPEA 2GVLA 2WHLA 2H9AB 3WFZA 1E5JA 3G77A 5LIKX 1JG9A 3T8QA 3VOFA 1POJA 2YL5A 5CZJA 1O6IA 3GVRA 1ZP4A 1EZWA 5U4NA 4BQ5A 4MJ2A 4R9OA 4CQAA 3SN4A 3K4WA 3INPA 5FEPA 4B15A 3F03K 3S47A 2VZUA 3VGGA 1Q6GA 3HN3A 1SJAA 1R3VA 3LZ3A 1IE7C 1XIIA 5DCBA 5M5DA 1QNOA 3QV8A 4HGXA 3AZSA 4GWEA 3RO8A 1W1IE 3E49A 3A64A 4AXKA 3LUTA 3KOZA 2O9RA 1V08A 3PHAA 1J96A 1CWYA 4MB5A 2WMHA 3KP1A 4C5ZA 3PPGA 1DIOA 2PTZA 5KZMA 3A12A 5BXTA 1OGGA 1W5PA 3RCYA 1OJXA 4B5SA 1YQ2A 4WD0A 5LXEA 3HG2A 3LB0A 4Q32A 3O6DA 3W82A 2OPJA 4ZVJA 4DB7A 3ARTA 5HXMA 5H8MA 4IXXA 2CKRA 2A3AA 2VENA 4B5VA 3IJ8A 3BK0A 3M6DA 3AWOA 4AC7C 4DYEA 4NNAA 4UMBA 3APYA 4CQBA 4DLFA 3S9ZA 3L5AA 1P6CA 1H61A 1ISVA 1REQB 4HU8A 1VCVA 4DRSA 5FSDC 1TPH1 3DI1A 1C8XA 2AKMA 1SGJA 4QHRA 3S5ZA 2CZVA 2X42A 1WXZA 1CI1A 4KESA 3M4HA 1B4KA 1U1JA 2PU0A 5T91A 2ZICA 4V27A 3E2RA 2VWTA 2CNCA 4W88A 3DAQA 4QAWA 2YX0A 1O1ZA 4IUGA 2O9PA 1FUYA 5AFDA 4JL1A 4AY8A 3NPWA 3CYJA 2Y63A 3LMZA 4UUIA 2OFJA 2WJFA 4NXSA 4JFVA 1EPXA 4ROQA 4FALA 1F3XA 3AS3A 3G6MA 1ZAJA 3QQ0A 3P0XA 2VI0A 1UJPA 1Y8BA 2CBJA 5HR6A 5G2IA 6XIMA 1EJRC 1GOXA 4LPCA 1XLFA 1ZBKA 2OZ3A 1SJCA 4O54A 5H91A 3UJ2A 4NU7A 4HNOA 2O9OA 2QAFA 4JTGA 4PUKA 1NU5A 3W81A 3WNOA 4S3JA 3UG3A 3N3MA 1NFGA 4HU0A 3OLEA 4MZ8A 2PZNA 4X2RA 3CUIA 4I5RA 2Q09A 2OEJA 2I9EA 3ARRA 1MNZA 4LH8A 3LENA 2WSKA 4S3DA 2CLEA 4GPNA 3M44A 3A22A 2O55A 4QE1A 1F73A 4HU3A 4P5UA 1EJUC 1U1UA 4LVFA 4MOZA 3ZVHA 1WXYA 2V69A 2PWUA 4LF2A 1PDZA 2KZHA 3NSNA 2CLFA 3LGEA 1FWFC 2PP3A 4HK5A 1UD3A 1V4YA 5AC8A 2Y88A 1RBOB 1BWLA 3BOXA 3FCPA 3M1ZA 4UNKA 4HZ8A 3T09A 2YJQA 1EIBA 3EX3A 3BGJA 1A4MA 3MBDA 4AEOA 3WUEA 3V5FA 2QJHA 4NZJA 4KCUA 4FNTA 4JQ2A 3UZ5A 1XG4A 5HQMA 4HMEA 2R1NA 4BK9A 4QBXA 2CERA 3NQBA 1PZ1A 2Y7EA 1XG3A 1JAKA 2CETA 2E9BA 3SR7A 5FCZA 1ODUA 4JIHA 2WW5A 3WLKX 5EA9A 4BF5A 5FAGA 2HJPA 4GYPC 5HNUA 3ELFA 3GH5A 4KFNA 1KO0A 1V79A 4FX8A 3MUY1 3GR8A 3EXSA 3ME3A 3N19B 1UKTA 4C5YA 1UPMB 3S4TA 5EMLA 3O6AA 3W38A 4O18A 1VFUA 3UZYA 5HJYA 2HS8A 3C8NA 2PDJA 3LCWA 3FSUA 2Z2UA 4ROPA 3NM1A 2WHMA 2DIEA 4H9ZA 4RE4A 4WDXA 4N0RA 2GJXB 4CEUC 3TJIA 5IHSA 1N2VA 1DWAM 4G8TA 5FACA 4XD4A 4ZO8A 1JZ7A 3EPMA 1DL3A 1FWEC 2PGWA 3HQNA 1CCWB 2HTMA 3VIHA 3VTRA 5CJ5A 3TJLA 4UTUA 4M29A 2ZZ6A 3TROA 3IIPA 5PTDA 5TNVA 3O15A 1NARA 1ZSXA 3JW7A 1QPNA 4DF1A 2DH3A 5LGXA 3W7RA 1W6TA 1OG0A 4L1GA 2FVMA 4U33A 4WXYA 2J13A 1B9BA 3NL2A 3LY0A 3CNYA 4DNMA 3BAYA 1K6WA 3W7LA 1WAWA 4D6JA 3DYMA 3BAJA 1GVEA 3BCFA 4TMBA 1M9HA 2ZZ7A 2DDXA 1J0JA 2J7GA 4D1JA 5D33A 2ONEA 4G1KA 3TOPA 1EEXA 2ZWYA 2HVMA 4EPDC 2NX1A 1DHKA 2BLEA 3AOFA 1CXIA 1BXCA 1J8VA 3URBA 3OVPA 2JKEA 4QTGA 1OYBA 5C9ZA 3UWQA 2DJXA 2E6AA 2J66A 1UR1A 3ENLA 6XIAA 5CGTA 4MYAA 3KWXA 3TKFA 5AYBA 4REQB 1KRBC 3OW1A 2YB1A 2GVGA 1I1WA 5IHRA 4HBKA 4E4PA 4UZUA 3N04A 5CC3A 3PPCA 5B7YA 1EBHA 3P60A 3R6IA 1UD2A 1XW8A 3PJWA 5EBAA 4ZOAA 3TP4A 2VCCA 2FH8A 3R0KA 5HK4A 2OTDA 1JXKA 3DIPA 3IJDA 3UVAA 1W9XA 2IQDA 4HPGA 3PWAA 4AZHA 3B8WA 1XRFA 4NAEB 4LBSA 4R9XA 4AISA 3BGGA 3CQJA 2QEZA 1U30A 2JK2A 1DJWA 4MIMA 2VVSA 3VIOA 4LVAA 5AYZA 4DAFA 1JDCA 2W61A 4HA1A 2PZ0A 3LPGA 3H2FA 4MF4A 3UT0A 3A24A 4ATDA 3FJ4A 1XYZA 4E8DA 3PZOA 4D6CA 4XZIA 2F61A 3MCNA 3RO6A 2YFOA 4QAIA 3PSVA 3C86A 5FAJA 2GVJA 3TQVA 4EXQA 3R8HA 1B30A 4CVWA 4XD5A 4RPPA 1GYNA 3HTWA 2JIEA 3L4WA 1JZ2A 4KH2A 1M7JA 1RQHA 5EMUA 4MYXA 1YPFA 1JQVA 3QZ6A 1UKSA 5CPMA 1XFCA 2INZA 4PBFA 2AMXA 4BI6A 2CLMA 3KRBA 1RCXB 2QPUA 3ES7A 3GNNA 3TAKA 1JF6A 3II1A 5H6HA 5K2ZA 4PSPA 3FS2A 3V16A 2EF9A 1PL9A 3I4EA 1V0MA 3U7VA 3S2JA 1W17A 1P1MA 2D0HA 5KZ6A 4G9PA 2XSAA 1F4HA 2G50A 1EUNA 1ADOA 2HXUA 4PEKA 1Q2SA 3GB6A 1YYAA 4JDBA 1DWFM 4LYQA 3GC4A 3TYAA 3NDZA 1XRTA 4GCAA 3NOYA 1UBPC 1PKNA 3VDHA 3G24A 1LYXA 1OZMA 1OFRA 5ECVA 1UWQA 1HO4A 1AK5A 2GDQA 3WY1A 2XSXA 5IOBA 2CWNA 3KS6A 3SCTA 1L9WA 8A3HA 1YDOA 1UB3A 5AB3A 2ISVA 3H12A 3A5VA 3W6YA 3FA5A 2VELA 5FA5A 5A8PA 4XWUA 4MSSA 4UR7A 1I4NA 4ENLA 2E5BA 3AYRA 3WLNA 3E5PA 3OA5A 1Q6RA 3KLKA 5REQA 3WQ5A 1EA9C 3FA4A 3DFQA 3W3OA 2Z7KA 3WG6A 3T9PA 4UTIA 2FVKA 4GOAA 3QGVA 1TTJA 1XSKA 2PDXA 1A5LC 4DO5A 2QCFA 3UCQA 1RK5A 1RQEA 1H50A 1EX1A 3G1XA 3LEPA 2RDXA 4LS2A 3W2MA 4XISA 2E6FA 2HQAA 1BRLB 3VMPA 2ICSA 3P8IA 3V35A 2BOEX 4GUGA 4JNZA 4J7RA 3CQIA 5BW6A 3HPSA 4Q7NA 3LBOA 3N4AA 1IYXA 3D0CA 2NXHA 1W1ZA 3A3HA 4WDWA 1XLJA 4Z42C 1XCWA 1YNPA 3BQ6A 4LB4A 2RGLA 2WJZA 1E4IA 5JMUA 2XM1A 3AHXA 1TWWA 4HMCA 3DDMA 2VUYA 2CKSA 3TTYA 4MKNA 3E12A 4TMCA 4KWVA 3GNOA 4BEUA 5D37A 1R7OA 3W7KA 2WSQA 3DERA 1A5UA 4GC4A 5BWAA 3HFYA 3VIKA 3H4GA 3BLKA 5D9NA 2OR2A 4I5UA 3REQA 4RDZA 4AIBA 4TTGA 1XYLA 3DG7A 1HVXA 1DJXA 3ONBA 5K9XA 2E6DA 2IQTA 3M0HA 2IUZA 3BC9A 2FYMA 3NPUA 3S0CA 4GIRA 3KBWA 2D69A 2BASA 1K4HA 3NG3A 1ELSA 4GYFA 1OBAA 3SIZA 1O5KA 4GCXA 1EQCA 1TX2A 3M0LA 3NYDA 1FKWA 2JIWA 3ALFA 3H53A 4Z1DA 1OK4A 2ZA1A 3GX9A 3C3NA 2XDFA 3FX4A 5TD4A 1PO9A 1E43A 3KW3A 5EPDA 3C5QA 3VDCA 3FJLA 4GH1A 3W27A 3VVGA 1GVIA 1R7AA 2YCKX 2PDGA 4DZIA 3WBYA 3BMWA 4PULA 1EP2A 3VNZA 3FXGA 4N6EA 1G0CA 5HMDA 2XTKA 2OQYA 1YEYA 5F2GA 2QDEA 4OQVA 3W2UA 4ZA0A 2W9MA 1S3HA 3W28A 2YA1A 5FJOA 2OLHA 1RK6A 3LOTA 2PF8A 1WO2A 3WBEA 4IMCA 3W7OA 3HG3A 1W8GA 3ZLFA 3VD7A 4J35A 3TNBA 1X6UA 1PKMA 3GHSA 1UD5A 1JRBA 3NAVA 4PCSA 1NOWA 4GJ1A 5KTLA 1HX0A 3V5CA 4MB1A 1DIDA 4M6PA 1XBVA 4F0HA 1PIGA 2PTDA 5A2AA 1G1YA 5CSUA 1CGYA 5T9BG 4K36A 2IPGA 4JQ1A 4JTCA 2E28A 2P53A 3STGA 4BCEA 4DN1A 4S23A 1ZZMA 3PF3A 4NP7A 2ZUWA 1J5SA 2ZX9A 4ES4A 3EWDA 3EZ4A 3MANA 4ORMA 3QSTA 4QLLA 2VD8A 5FD0A 2C3ZA 1EF3A 1E9LA 2VL4A 4GISA 2YB4A 3GAYA 4UFJA 3B3DA 3NM3A 3SCRA 3W1AA 1WDSA 3PBYA 1DXIA 4Y6GA 3RRAA 1D7FA 1RJQA 2BV9A 4AZBA 1X98A 2D0GA 3NEHA 3W72A 3PP7A 2ZUTA 1SW7A 3B8VA 3BXWA 3REQB 2XGIA 3P82A 3A4JA 1KXVA 2BGSA 3GZAA 2QLYA 4UZSA 3ITXA 3HJEA 3GVQA 5FJTA 3V1PA 2ZDSA 1TPFA 4QCEA 4WDUA 5FOOA 2XISA 1V02A 3WENA 4Q8TA 5K9DA 1X8CA 4S3BA 4XK2A 3GIYA 3BLPX 1A49A 3DESA 3PZUA 2DQXA 4ML4A 5C2XA 1ONXA 1TV5A 1SVDA 4JY8A 3N9KA 3USBA 5TQLA 5C70A 3CO4A 4XZBA 1I0DA 2XG9A 1FHVA 4MWAA 5CZTA 1NDWA 1V5XA 4EX4A 4QISA 4MGGA 4MY1A 5AZ0A 5L6UA 5FEWA 2OZ8A 4NAFA 3UA3A 3LN3A 2Q01A 4XB3A 4AIEA 4LNCA 1O5XA 3VGDA 1VLIA 3D46A 5ABFA 1FH9A 1GWJA 1J01A 1A5MC 2TODA 1EDQA 4H8UA 2BNJA 3OGSA 1XGZA 5BZAA 4IIDA 3PZNA 4YU1A 3P81A 2XSBA 4U2ZA 4LYRA 4O52A 3T6CA 2DEPA 1I2PA 2YYUA 3O7UA 4TX6A 5EMYA 4DM1A 1IV8A 3MV11 1XDMA 2INEA 4GFSA 1EJTC 4D6IA 1GOIA 3ATYA 3WL1A 1GZGA 1UCWA 3BARA 2PDIA 4WK9A 3LHZA 3S2MA 5C7HA 1BYBA 1R9YA 5EKYA 4BS0A 5A3HA 4JTTA 2X16A 2CEQA 5CBJA 2FTWA 2Z6JA 3MS8A 2HSAA 2HWGA 4B90A 2CZ5A 4UFHA 3FDGA 1EJSC 2GUBA 3BGAA 2FTYA 2UY3A 4MLJA 4PB4A 2G3MA 2PCQA 1V3JA 4HJFA 2IW0A 5LA0A 1JUBA 2HBVA 3RM4A 4HHMA 4L64A 1J9YA 2EPKX 1HQTA 1W5QA 3CB3A 3TZNA 2Y2WA 4E8GA 2ZUMA 2NQ5A 3EB3A 1CLKA 1QHOA 4LAUA 2UWFA 1KFCA 1JCLA 1QMLA 3QLLA 4P7RA 3BW3A 4H9YA 3TSBA 3T4CA 3QSRA 4Z2IA 5E0KA 3OB8A 3V1HA 1NSJA 2QJNA 4CD7A 1TV4A 2XVNA 5JIWA 3F2BA 3CO8A 3WFAA 2PRLA 1O60A 3GRIA 4DEFA 3N2XA 3HM7A 2J8FA 1N8IA 3UJSA 1GVQA 2OKOA 4ZODA 1YE6A 4E4FA 6TIMA 3MW7A 5LNUA 1SYTA 3SGZA 3VKJA 4Z2KA 4L6HA 2X1TA 5TIMA 3PVFA 3RX2A 3UWEA 3KL3A 3T42A 1UR4A 2YGYA 1JFXA 3WQDA 2FGZA 1F7BA 4AIOA 4OECA 1OCBA 4ICMA 3PTKA 2NT1A 3P84A 4ZOCA 1X7FA 5I78A 5LKYA 1OQFA 2CLPA 4YPJA 4AU0A 1QW9A 1UWTA 4EAYA 3NFUA 5LIUX 2OO6A 3GHTA 5A2CA 3QQWA 3L4VA 2PB1A 3LQLA 5K4ZA 1E9ZB 4F2BA 1W1A1 2A5HA 4D6FA 3VD9A 4WY0F 4O19A 2E9LA 2Y70A 4DBDA 3AALA 1JXJA 1EPVA 3TTQA 2CLKA 2XYLA 1WDPA 3UBPC 3KX6A 2BY1A 5FJPA 3IRSA 4AD0A 1AH4A 5FIPA 2I16A 3DHFA 4GHRA 3L4UA 2FMNA 3N17A 4XIMA 5AN7A 2RHGA 4U31A 3WQVA 4ZXLA 4WXZA 3UGRA 2DSZA 4EOUA 2NXGA 2WO5A 4ATLA 3HU7A 3ZR6A 4IQLA 5K9CA 3W26A 3ZWSA 3HQ1A 1EH9A 1L8PA 1I6NA 3WDIA 3SDOA 2J75A 4PTMA 1TCDA 4TUFA 2ADAA 3ITGA 3ZJ6A 4RXFA 5D4YA 4YXGA 5GVJA 1FWRA 4HZ6A 2D0FA 2OEKA 2W66A 3W88A 3CQHA 4LBRA 1DPMA 3AMGA 4I9MA 1TV7A 5A8OA 4JY9A 2HNHA 4WUIA 3R79A 2ZZ1A 1TCMA 2P0IA 4N9BA 4OVXA 3GU9A 4H19A 1BLIA 5CPNA 1YBQB 1OY0A 4CD6A 4HCHA 2ZX6A 4FXJA 4W7VA 5A8QA 4IQJA 2PWEA 1RY8A 2NW0A 1XH1A 2C8NA 4I9TA 3SCSA 1ECQA 5D32A 1QT1A 2V0TA 4H6QA 3CT7A 1R86A 1KFJA 3IJ6A 4A6GA 4LWWA 4AHOA 1QCWA 4N02A 3U2EA 3SQSA 4H4IA 1J2WA 2UBPC 5CAKA 5AKQA 3CU2A 2ZRYA 2OSXA 1V6TA 5EB8A 3AZRA 3R4IA 1PX8A 5HJLA 2GDUA 1JPKA 1W1VA 3RX4A 3W37A 1Q7QA 4I6KA 1PCWA 4HYRA 3DN5A 4NNCA 5F2IA 1MWOA 1KQYA 2X40A 1OC7A 1C93A 4XZHA 3NZ1A 3DC8A 5CXPA 3HG4A 1Q8AA 4QDMA 2EO7A 3P8JA 3SQMA 3WLPA 5E1QA 1E6QM 1WDRA 1XCFA 2WZEA 3M0JA 4GVIA 4R53A 4BQ4A 4HHLA 5AHLA 3WBWA 1Z8AA 1BF2A 1BXNA 1CLVA 4O1CA 4MWAD 4EWND 1NFPA 2WC7A 1B4EA 1THFD 1UA7A 3AIUA 1CZ1A 2PLCA 1SQ7A 2QCNA 1A3HA 4FHAA 4JYFA 3MYPA 1WOBA 1I2QA 1FDJA 1SFJA 5C55A 4NJGA 3WNPA 2ZXAA 2XVGA 3L0GA 3MP5A 3BWWA 2F6XA 2QCLA 3C6CA 3NO1A 4TQTA 3HIJA 4ZFCA 2QDGA 1DEDA 5BROA 1GJWA 1DJNA 4OTKA 3O9NA 2G96A 1EQPA 1P43A 3GXPA 1F76A 4A8IA 1FWDC 6A3HA 4ALDA 1VEOA 4HTBA 3TXVA 3I3EA 3H24A 1H1NA 3WF0A 3HGRA 4Q8OA 1C8QA 5XIMA 2QNEA 5I23A 2W63A 2OYKA 5F1UA 3LBCA 3WDRA 3K5XA 5HUOA 2WJDA 1DBTA 4MLRA 3VGFA 2W62A 4A2RA 1LRQA 3BUVA 1ODZA 1H7PA 3CJPA 4JQ4A 1V0LA 1Y65A 4OHQA 1PKLA 1J12A 3FYPA 1X6NA 3EWWA 3W2KA 4G6CA 3UU0A 5DFAA 2TPSA 3GM8A 1ITXA 1MUWA 2XIMA 2PF0A 1LOLA 3WUGA 1OYCA 2QF8A 1W3HA 3WNKA 4NZCA 3SCUA 4C7FA 2Y8KA 4Z1BA 1UR9A 1JZ8A 4EANA 1OFAA 3AXMA 4JAWA 3VE7A 4GUIA 1OSEA 1O68A 4J2PA 3B8IA 4KRUA 1ZBVA 3SM0A 4X9SA 2CBVA 2A3EA 4R7JA 3SCQA 1BRLA 4NSBA 3CHDA 5FESA 1U22A 4NX5A 4C91A 4X0NA 2AGTA 4GNVA 4EF8A 1HKMA 1W5MA 3CPRA 1TG7A 1IT7A 4GY7A 1MW0A 4DUXA 3I7QA 4H8NA 3B06A 1JRCA 5XINA 1CXLA 3T0BA 3TK7A 1W9BM 2PWFA 5HATA 4ZOBA 6ALDA 1E1CA 5EMJA 2YW3A 4F0SA 4OOZA 1V0KA 4LUYA 3PZVA 2RGMA 4YWIA 3H2AA 2F6KA 3UG4A 3ZIZA 4K6AA 2G3IA 1UZ4A 4NT0A 1T8XA 3G1RA 5BXRA 1NF0A 2Y8UA 3KFTA 1CGTA 2PRHA 1KLYA 2VO5A 2R91A 3T44A 4MWAE 3ORWA 3TQPA 5A5WA 1PV8A 1XC4A 1M04A 4DUVA 3BAIA 4Y2WA 3NQ8A 1SSDA 2P0OA 1KRCC 4AHPA 5AHIA 3CMFA 3UPBA 3AROA 5I6SA 1K02A 2E0PA 3KOWA 1ZCCA 3SJNA 3UESA 3PUEA 3H6OA 1GOQA 2PTYA 4KEZA 5XIAA 4IP5A 2HPIA 1E6XM 2BHZA 2YBUA 4XZ9A 3W02A 2WMFA 2BSLA 2V30A 4JKMA 1GPFA 4KQNA 2ZUSA 4ZXOA 2VZVA 2QMKA 1OFBA 4MADA 2P1FA 2I56A 4G2DA 3R1ZA 9XIMA 4FIQA 3LM3A 1PHQA 1XKJA 3VDBA 3ZWTA 2REQA 3R94A 3CUFA 5AYIA 2WWDA 1BVNP 3VIFA 1BHGA 3CPGA 4IOTA 4AEEA 3S1VA 3N73A 4JZ5A 4UTLA 2ISWA 1XIHA 3R8RA 4K38A 4GI6A 3NQGA 2O4QA 3NZGA 3CQ0A 1XQKA 2RDUA 2OEMA 3A9IA 4NZ1A 2X0YA 4IFRA 2FZ8A 3W6MA 2FDMA 3T2PA 1IIGA 1OGBA 2FKPA 2NT0A 3CAVA 3NO3A 4JPGA 1Q7ZA 1LJYA 1OHLA 3WJSA 4E2VA 3KTSA 2QUUA 1TPVA 2ATSA 3WQCA 3SCWA 1T8QA 3E2QA 3TVAA 4RXGA 5C9XA 3EMQA 3HQOA 3LHTA 1W1PA 2J7CA 5EFDA 1DWHM 3NQ7A 5E5CA 3HV8A 2A3CA 1W32A 5CEWA 3NQVA 2F38A 3GD6A 3IUIA 4HT3A 4KEVA 4JIQA 1QW8A 5MKGB 2DSVA 1VHCA 4HN4A 5HA7A 3EWBX 1RV8A 3WL0A 4NASA 1ONWA 1S1RA 4C1LA 4M6UA 4RE3A 1TUXA 3NQ6A 4O14A 3NCOA 3UY7A 3SJ3A 4O12A 3PZ9A 4HPJA 4Q22A 4XZWA 3PN8A 1VBRA 4NILA 1ZGDA 1L6GA 1S2WA 3A21A 3E96A 2E67A 1M65A 4MB4A 4QSFA 3H2NA 2OLSA 4K2SA 4C6IA 4JX4A 3CASA 4JIRA 2VP8A 1TJRA 3B9AA 3V4BA 3FXYA 3B0UX 4JFSA 3MC5A 4JTKA 1LDCA 2B4GA 5DXYA 1XLHA 3JUGA 1PYMA 3QY7A 1KWGA 4DUOA 4DVOA 3WQOA 3TAOA 2G95A 2YKKA 3SW6A 5AHNA 2EHHA 2R1KA 4CN1A 4N9CA 3N4EA 5A6KA 3TYEA 2WNWA 3LPPA 3DFOA 4RNFA 4LANA