3U7BA

A new crystal structure of a fusarium oxysporum gh10 xylanase reveals the presence of an extended loop on top of the catalytic cleft
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
327
structure length
327
Chain Sequence
AASGLEAAMKAAGKQYFGTALTVRNDQGEIDIINNKNEIGSITPENAMKWEAIQPNRGQFNWGPADQHAAAATSRGYELRCHTLVWHSQLPSWVANGNWNNQTLQAVMRDHINAVMGRYRGKCTHWDVVNEALNEDGTYRDSVFLRVIGEAYIPIAFRMALAADPTTKLYYNDYNLEYGNAKTEGAKRIARLVKSYGLRIDGIGLQAHMTSESTPTQNTPTPSRAKLASVLQGLADLGVDVAYTELDIRMNTPATQQKLQTNADAYARIVGSCMDVKRCVGITVWGISDKYSWVPGTFPGEGSALLWNDNFQKKPSYTSTLNTINRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE
publication title The structure of a GH10 xylanase from Fusarium oxysporum reveals the presence of an extended loop on top of the catalytic cleft.
pubmed doi rcsb
molecule tags Hydrolase
total genus 134
structure length 327
sequence length 327
chains with identical sequence B, C, D, E
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2011-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3u7bA00
4DM2A 2AAAA 5ABFB 1OM0A 4W8AA 3F4VA 3G6MA 1C8QA 1Q6DA 2WCSA 4W8LA 3TONA 2WBKA 2CITA 1OT2A 3SIMA 4PTMA 2G8ZA 2XFFA 5GNZA 1EGZA 1R87A 3AZRA 5AC5A 1B0IA 5GNYA 4ZEPA 2PF0A 1E55A 1JYVA 1V03A 1R8LA 2Y4SA 3KL5A 1EO7A 1BLIA 3QR3A 2V38A 5BWFA 1WNOA 2ZUVA 2WHLA 4RE3A 1PZ2A 1BAGA 4U3CA 2CNCA 1UR0A 2WHKA 5E70A 2XJ7A 3CHEA 1J0IA 3TTYA 5C8BB 4C7FA 4HU8A 3K1DA 1HJQA 4B15A 4WIWA 1UD8A 3N04A 3M6DA 4C7GA 4M81A 2PWEA 4LQ1A 1TUXA 3VDHA 1EDQA 1CXFA 3BH4A 1BGAA 5HBFA 3FHQA 4X0VA 4X9YA 3PHAA 1Q6GA 3DC0A 4BQ5A 1DEDA 4DWSD 5BROA 1CTNA 2D0HA 4JL2A 3N12A 4BZYA 1HJWA 4D6DA 2DGAA 4KWUA 2WMGA 5I2UA 1US3A 5I24A 3WH5A 2J7CA 3AHZA 2AMGA 1VIWA 4FMVA 1AVAA 3IK2A 3WL1A 4D1IA 1HNYA 3RILA 4XZBA 5KZ6A 4DWSB 1WDQA 1TE1A 1X6NA 3L4YA 4BQ4A 3VIKA 2XVKA 2BV9A 3BSGA 4W7WA 1L0PA 3F5KA 2BNJA 4J3SA 4QFUA 4ACYA 1V0KA 5D9MA 1GHSA 3MS8A 4XZWA 1N82A 2CPUA 3DYOA 3FXYA 2GJPA 4M24A 5A8OA 3SCTA 4V27A 5A6BD 2GVYA 3SCQA 5M5DA 5D8ZA 1W9VA 5GPRA 2WWCA 4X0NA 1H5VA 1B3VA 4AZCA 3LMYA 1JNEA 3CZEA 4DUWA 3ZR5A 1CZ1A 1HJVA 1KWGA 3VM5A 2VX5A 2VVNA 1QNSA 2J47A 2VRJA 2VNCA 5A2BA 5I77A 4D6HA 3KEHA 2Y2WA 2YL6A 2WHJA 1HL8A 1WDPA 3TTSA 3N9KA 3IJ7A 4P8UA 3IANA 4IM4A 5A2AA 2WCGA 1MW3A 4OJYA 5LA0A 4HA4A 4CD4A 2UWFA 1ITCA 1E4LA 1W1YA 5DFAA 8CGTA 3WD1A 4YHGA 3ZO9A 2F61A 3SCPA 2FGLA 1NWSA 2BXYA 2XTKA 1JXJA 1YQ2A 1TR1A 2ZX9A 5M17A 1UD5A 1E0VA 1JF5A 3ZT6A 3CZLA 2AOSA 1HF6A 2XSAA 5AYBA 3VIGA 1OGSA 3L2LA 1UKTA 4UFLA 2WZHA 4A4AA 3QGVA 3WQ4A 3ARVA 1VENA 1BYAA 1V02E 1BYCA 1E43A 2PWDA 5EFFA 1V08A 1V3LA 1XHGA 4PTWA 3T2PA 3MO4A 3L2MA 4AD5A 2V3EA 1H3GA 2JF7A 3AXHA 1A3HA 3U57A 3VU2A 1LL6A 4IUGA 3FNDA 1DWFM 1MWOA 2O9TA 3AISA 3VM7A 4CD7A 3L4UA 2BHYA 5LYRA 3WQWA 1I75A 2BHUA 4LYPA 2JE8A 3GZAA 5A6AA 2OWWA 2VR5A 1QHPA 2VJXA 3SCWA 3AS1A 1U30A 4JFWA 1WZAA 5A1AA 1MXDA 2DEPA 2VMFA 3B9EA 4M29A 2UY5A 4CU7A 2B31A 2WAGA 3PZUA 2X0HA 5HPCA 1QI4A 3W27A 2GJRA 1KGXA 4MPKA 1ITXA 3CMJA 2EEXA 3WF2A 4MTVA 4HTYA 3TTOA 3AMDA 4H2CA 1FOBA 4J27A 4IISA 1J11A 4CVWA 1EQPA 4AD0A 4GI9A 3VGGA 3GH7A 3W82A 3VGBA 4UCFA 2Y24A 1UA3A 2X05A 3ZM8A 2YA1A 3CHDA 1R85A 3I3BA 3VGEA 3BAJA 3OZPA 1G1YA 3UCQA 1E6PA 4HPHA 2EPOA 4E8DA 5M3WA 1GNXA 1J0HA 2EBNA 5CPTA 3UG3A 4PSPA 3VX0A 2WVVA 1FFRA 1XRVA 1XYZA 2OLHA 3MMWA 1UZ1A 4A3YA 1KXHA 4PMXA 5BYWA 2XGIA 1TZ7A 4RL3A 1MW1A 3MUY1 3NSMA 4HA1A 3A4XA 5BXSA 1W1TA 2PWGA 3A6OA 2BFGA 1CXIA 4W8BA 5BXRA 1UUQA 1HKKA 4XUYA 2Z1SA 3N1AA 1H41A 4PCTA 3ZT5A 1JZ4A 2WK2A 3O6AA 4JCLA 1OD8A 2ZX7A 1F4AA 3PZTA 1VBRA 2FHBA 5A6LA 4UQBA 3WY1A 2WLYA 3GH5A 2GDUA 1UKSA 1HJSA 1ZL1A 4HOZA 1M01A 4KGJA 5CJ5A 3MU7A 1OSEA 1H2JA 4JKKA 1LF1A 3RM8A 5TD4A 1LLOA 3U7VA 1YHTA 1V6WA 3EDDA 2GJXB 1WCGA 1HXJA 2O9PA 3G6LA 4V28A 5FL0A 3ZT7A 1J18A 3OG2A 2HVMA 2PWHA 2EPLX 3WH9A 2XVLA 1MYRA 3AIBA 4J3VA 2YL9A 1J0JA 3CZJA 2J7BA 3A3HA 2VI0A 2QLYA 3WNLA 3WF1A 1UOKA 1IZJA 4ACZB 3GXFA 3AIRA 1KGUA 1NARA 3J7HA 4TOQA 5E0FA 5ABGA 4CCDA 4UTFA 1VF8A 5JBFA 4W86A 1XC6A 3RJYA 3T0AA 1KGWA 1K9DA 3RJXA 4P8WA 2CHNA 1CIUA 3CHCA 3WKZA 3CUFA 4QP0A 1QPKA 2ESCA 2VUYA 3QOMA 1GUVA 4LX4A 4LPCA 4YPJA 1EOMA 3ALFA 1UD6A 1TA3A 4XB3A 2EPKX 1S46A 4D6GA 2D1ZA 2XYLA 3WQVA 4AZ6A 3WDQA 1E6RA 1JI1A 2DH2A 1CXEA 3AIVA 3WSUA 3ZIZA 4TXEA 2XVPA 3VGFA 1ISXA 3ZJKA 2UY3A 5I23A 4AD3A 4FLRA 4AZHA 3WDHA 1VFFA 2J75A 3VD3A 3KE0A 3L4XA 3W24A 1XV8A 3CMGA 1HP5A 4K68A 3S6TA 2A3HA 3PZQA 3POCA 4GINA 3THCA 1NOFA 2EJ1A 3W53A 2G3JA 1BPLB 4P8XA 3PTKA 1HN1A 1OB0A 3WF3A 1JZ3A 2YDRA 3AMGA 1WZLA 4OZOA 3N17A 3PZ9A 7A3HA 4JHZA 1V3IA 2VZVA 3RDKA 3OBAA 1ZJBA 1ISYA 3O9NA 4AZ5A 4V2XA 5FIPA 3AMLA 3F5LA 3MMDA 2VTFA 3WEOA 5E09A 4HOXA 2WCAA 4KRTA 4PYSA 1C7SA 1QOXA 2W91A 2A3EA 2ZICA 1GPFA 3VPLA 4MB5A 5EBAA 1TVNA 4U5IA 1ZU8A 3WMCA 3CPUA 4EE9A 5ABHA 1ISZA 4UZSA 1SFSA 2WMIA 4M1RA 1GCYA 4MNLA 3CIVA 1OBAA 2WHMA 1K9FA 1TMQA 1BG9A 2DT3A 4HPGA 3WH6A 1U2YA 1LG2A 2XSBA 3WF4A 1O7AA 4PTVA 4J3UA 4P7OA 4EAMA 2E9MA 1KBKA 3VIFA 2VR4A 2E4TA 1GQKA 4C7DA 4IPLA 2W92A 5JIWA 1K6AA 2QV4A 2WVSA 1B1YA 2UY4A 2VZUA 4MB3A 1E4IA 3WN6A 3VIIA 4HA3A 4J3TA 2XVNA 1VB9A 4AEFA 1A47A 3WQ5A 2WZEA 3ZR6A 3WDIA 2D3LA 2CEQA 5EFDA 2IXUA 4GI8A 3QHOA 2D22A 2WSKA 1NOWA 4P8VA 4ZFMA 3GBDA 3E1F1 3UERA 1CGVA 1CXHA 4ZE4A 1UHVA 1CLXA 2BXZA 5BRQA 3FY1A 1W9PA 1E6SM 3QHMA 5GQBA 5M03A 4D72A 3EMCA 3OGSA 4DM1A 4OBSA 1UKOA 1RP9A 3W6MA 1BQCA 4D6IA 1ZBCA 3A47A 1OWQA 2VCCA 1B3XA 3A4AA 3TA9A 5ECUA 5ABFA 3AHVA 1B3WA 1H0GA 1XSJA 1BTCA 3WFZA 1GOOA 4GZIA 5HPOA 2ZUWA 3PZMA 2JALA 2PI6A 2CXGA 2CBIA 2WC3A 1X1NA 4MAVA 2WM0A 5A6KA 5FOOA 1PEZA 3UG4A 1DWGM 1KFWA 5IFPA 5E6YA 3D3AA 1VEOA 3CLWA 2QF8A 2VCBA 1ESWA 2YDQA 4MDPA 3SCNA 1CYGA 1JZ7A 4B16A 1SMAA 4U2ZA 2OSXA 1E73M 2CCRA 4UFJA 1VBUA 3VKKA 3SUUA 4F79A 1G9HA 1G01A 3L4TA 1CWYA 2ZWZA 4B9ZA 5CGMA 4FLSA 3BAIA 3QOKA 3OA5A 4AYSA 2JF6A 3SCOA 2UY2A 1QNOA 1FHDA 4E2OA 5DMYA 3SCUA 3VUPA 3PZNA 1ZBWA 3UEQA 3GXDA 4UOZA 4PMUA 3VIMA 1V6VA 5D9OA 4DWSC 4JFSA 1CPUA 2E9LA 2D20A 3QHNA 3AROA 4H8HA 1MFVA 3CUHA 4AD1A 1OINA 4YHEA 4B3LA 3PZGA 3BMWA 2WZIA 2BVTA 4PUDA 4GQQA 6A3HA 3K8MA 1SR0A 4J3XA 2VCAA 4QAWA 4DWSA 5ABEA 3L4VA 4B3KA 4FF5A 2VRQA 3FN9A 1CDGA 3VO0A 3AIQA 5I78A 2WWDA 1UYQA 3IJ9A 1XD1A 3PBGA 4CN6A 1EDTA 4H7VA 4PCSA 4UQAA 4MB4A 1GVYA 2ZE0A 1NP2A 2J7DA 3KL3A 4MB1A 2WMKA 3UETA 4BQ3A 4AW7A 1C8YA 2BVDA 1NQ6A 4GIAA 1JYNA 1CGUA 4ATLA 2C0HA 1HP4A 4WF7A 1CGWA 1WP6A 2GUYA 4HU0A 1XH1A 1ZJAA 2J78A 1J0YA 5A6BA 4W93A 3BXWA 2PWFA 1GORA 3OGVA 4Y7EA 4XV0A 2BHZA 2DSVA 4N0RA 2J8GA 1CLVA 3AFBA 4JAWA 8A3HA 3T2QA 1E6XM 3BC9A 2CBVA 1L8NA 1PX3A 4HOWA 2WPGA 3RCNA 2QMJA 5FL1A 1QW8A 3ZSSA 1GVIA 3BAYA 3AQUA 5D9PA 2WC7A 1G0CA 5CLTA 1HX0A 2OSWA 4W87A 5HOSA 4NRRA 4CCCA 1KXQA 4FLOA 4MJ4A 2WKLA 3CTTA 1FP8A 1MFUA 2ZUMA 4FLQA 2QHAA 2WBGA 1KCLA 1HT6A 5BXPA 3MSDA 1W1PA 1E4NA 1VFMA 2D23A 5HNNA 1F4HA 2ZWYA 3I3EA 3GDBA 1FH7A 3SUVA 2Z1KA 4WLCA 4GKLA 1QBAA 4D6JA 4YN5A 1E72M 1XD0A 2GDVA 3AIWA 4CU6A 5D8WA 2XM2A 1DWAM 3VOCA 4HZ6A 1WKYA 1HKJA 4PTXA 2ZIDA 1JDCA 1GJWA 4AZIA 4DUXA 1JYXA 5EMYA 3PZOA 1V3HA 1E70M 1OCQA 3VMPA 3ZMRA 3NUKA 1BF2A 5BXTA 2J7FA 5E0CA 2J7GA 5C71A 4PSRA 3VD7A 1E1EA 1QBBA 1KBBA 3ZSTA 3ARSA 3VIHA 4Q22A 4ZE5A 3ECQA 1QI0A 1B31A 4BCEA 3CUIA 2ZUTA 1KXTA 2FH8A 3BCDA 2V5DA 4URIA 5JUVA 3NSXA 4AZ7A 2WVVB 4AZGA 2DSKA 1C93A 2E0PA 3VX1A 4W5ZA 5FD0A 5IFTA 3VIOA 1Q6FA 1XH0A 2WB5A 1QI2A 3GXIA 2OWCA 5GNXA 3OB8A 3KWXA 4AXNA 1VEPA 1O6IA 2OWXA 2Q8XA 1M04A 4PN2A 3VIJA 3ARWA 6TAAA 2ZXBA 2CETA 2GK1B 3FHAA 3GM8A 2D3NA 1RPKA 4UR9A 1D7FA 5LA2A 2D2OA 4HMEA 2FHCA 1UWQA 2YLAA 3PTMA 3AHXA 2NT1A 5D4YA 5AYIA 3ZJ7A 3U5YA 1UD4A 2F2HA 2W66A 1HJXA 4QLJA 1JZ6A 3GH4A 4W7UA 4ATWA 2XWDA 3EDFA 5HXMA 2VRKA 4CUCA 3AZSA 3BGAA 2YDSA 1UR9A 1NWUA 2A3AA 2ZX6A 1FHLA 4AY1A 4ATDA 2ZXQA 4ZXOA 4MAZA 3VNZA 1IV8A 1XH2A 4W7VA 4J3WA 3T0DA 2OYMA 3WNOA 2GSJA 1UH3A 2YJQA 3AHTA 3AYRA 1KXVA 2DT2A 4JFVA 1H09A 1Q6CA 3B8SA 3AMCA 3RM9A 7CGTA 4UFHA 4W88A 2IXVA 5CLWA 2XIIA 1BFNA 4W5UA 3EMZA 2RGLA 4JL1A 4MDOA 1V6XA 1WDRA 2YOCA 2O92A 2J74A 3AMKA 4JFTA 3WIJA 3HJEA 3WNNA 3AS0A 5CSYA 3UESA 5A69A 3EDKA 2W63A 3BLKA 1JZ8A 2VX4A 4PMRA 1D3CA 2GJXA 4H04A 5A2CA 1E6QM 3APGA 5CZKA 1H49A 1HKIA 3II1A 2YBTA 4U3AA 1MW0A 3M46A 3VDBA 1LL4A 4MJ2A 2JIWA 1UQZA 3M07A 4ACZA 1UWRA 4W85A 3SUSA 4MNMA 2W67A 3OLIA 4AISA 2XG9A 4PMZA 1JZ5A 3WL0A 1JD7A 3AI0A 4PMQA 3DHUA 2XUCA 1QNQA 1E3XA 4CVUA 3WH8A 2V3DA 1UWUA 2XWEA 3ARRA 5A3HA 2ZX5A 1H4PA 1EXPA 3U7BA 3WUGA 3A4WA 3DYMA 1U33A 4QCEA 3BAKA 1UWIA 4PMVA 2RGMA 1XYFA 4Z2KA 1MQQA 1PIFA 3L4WA 2J4GA 3WF0A 1EIBA 1PPIA 2W5FA 3ALGA 1PAMA 4TVCA 2FH6A 3MUAA 3CHFA 1MXGA 3VDCA 2VC9A 5I3DA 3SCVA 2DH3A 2X8RA 4S3JA 3UG5A 2JIEA 2DT0A 2YL5A 1BHGA 2FGZA 2VZTA 4W84A 1MVYA 5IHRA 1M03A 3TOPA 1KR0A 2WC4A 4GPNA 4H41A 3SURA 1W9XA 2C8NA 1QVBA 1JNDA 3MV11 1G5AA 4FK9A 1Y7VA 1HIZA 4UFMA 4R5EA 1QI5A 4HMDA 3CZKA 3MMUA 5D9NA 2WMHA 3VDAA 3LPGA 1W3HA 5A6SA 3NJ3A 3MV01 2XFYA 2NW0A 2EXOA 4JHOA 3AIUA 4UQ9A 4CU8A 9CGTA 1NOUA 2BY0A 1KQZA 3IJ8A 2W4XA 4CD8A 2PB1A 3N18A 4ML4A 5FCZA 1C90A 4HZ8A 3I3DA 1E3ZA 1V0NA 3THDA 1JIBA 4RE2A 4ZENA 5CPSA 2E40A 4E4PA 1MW2A 4HP5A 1FH9A 1PIGA 4OKDA 4U2YA 4QDMA 3DHPA 1JFXA 2ZXAA 1JI2A 4N42A 3AICA 5EB8A 3O2LA 2DPEA 2JFEX 2WNWA 3M7SA 3SUWA 3NSNA 3WUEA 3WDRA 1LQ0A 4GXPA 1XCXA 1UZ4A 3DYPA 1LWHA 3SUTA 3WUFA 1G94A 2DSZA 1Z32X 2VQUA 3CBWA 1WB0A 3MSGA 1E56A 3W6LA 2VOTA 2VVSA 4H8VA 4AC1X 3ARTA 1E1FA 4M80A 2CBJA 3W4RA 2VT0A 3WMBA 1AMYA 3PZVA 3BAWA 2YA0A 4E8CA 5A8MA 1LWJA 2C7FA 1RH9A 1UKQA 3KL0A 4AIOA 2FHFA 1WE5A 4IPNB 1VJSA 2CKRA 3N11A 2WSPA 3SEPA 1WZKA 1LJYA 3VTRA 4ZXLA 1VJZA 1EQCA 5A6MA 1TCMA 3GXMA 4MADA 3AYSA 1NP0A 2Y5EA 4AIUA 3AS2A 1ODUA 3K8LA 1E5NA 4F66A 3WD2A 1C8XA 4UNIA 1LL7A 5JBDA 2CBUA 2WYSA 1DP0A 2YL8A 1XSKA 2CKSA 4OBRA 3B9DA 3GYCA 2VX6A 4R27A 1M7XA 2D24A 3EBVA 2YLLA 2ZX8A 3WNKA 1JDAA 5I5RA 3FAWA 2CYGA 3WD3A 1J01A 3NCOA 1EO5A 1EHAA 4WSJA 2ZXDA 5CG0A 2G3IA 1R7OA 2ZUSA 1JF6A 1UKPA 4UFKA 3SCRA 3WELA 2FDMA 2J7EA 2J77A 2JEQA 1V0LA 4AMCA 5AY7A 1PJ9A 4PMYA 4J7RA 2CIPA 4CGTA 1BG4A 2X09A 3VD9A 1AQHA 2DSUA 3T09A 5I6SA 1GOKA 2QPSA 3W29A 1ODZA 3CZ8A 4WK9A 2XIBA 4M82A 4B9YA 1KB3A 4TVUA 1GJUA 1UWSA 2WW5A 1J0ZA 3W25A 3EDEA 1K9TA 1B9ZA 1W32A 3PN8A 1UR1A 1OIMA 2YKKA 3HMCA 4P7NA 3WEZA 1CXLA 1TG7A 1XCWA 4EKJA 3WDPP 4TTGA 1BYBA 4NSBA 4UOJA 4OOZA 4PEEA 2X1IA 3L4ZA 2BVYA 4AZCB 1CEOA 4LYQA 1FH8A 2VZSA 4WKHA 4BS0A 4P7QA 3CGTA 4U5KA 4JIEA 4Z2LA 1VFUA 3WNMA 3N13A 4EANA 4LYRA 1V6YA 2NT0A 1QNPA 1AQMA 2A3CA 5LA1A 1CBGA 3S2CA 3VD5A 1HL9A 1FFQA 2DIJA 4S3KA 1IT0A 1GQLA 3VNYA 1JDDA 2OYKA 1KQYA 3ZJ6A 1W3JA 4PRWA 1UH2A 4MNKA 5DF0A 5CPQA 1EHNA 3AXIA 1QHOA 1J9YA 1VFOA 4OOUA 4PBGA 1C3FA 4GI6A 1BYDA 1K9EA 1QNRA 2YIHA 1E5JA 5IHSA 1GOQA 3WQ6A 2WVUA 1W3KA 1EA9C 3NYDA 4L4PA 3GTNA 1IZKA 1WO2A 4Z2GA 4GQRA 1E0XA 1B3YA 1SYTA 4GO9A 4UQEA 3BCFA 1E6NA 3WDJA 1NH6A 3JUGA 3CUGA 1ISVA 3RPMA 3U5UA 5JBEA 1NWRA 4Z2JA 2PBOA 4PMNA 4AD4A 1EOKA 2CERA 3VINA 1OGBA 1WAWA 2V5CA 1V6UA 2Y8VA 1B90A 3GNPA 1CXKA 4CD5A 1JFHA 4CCEA 5A95A 3N15A 1V3MA 2WLZA 4RE4A 1E15A 4D6EA 2XVGA 4CN4A 4AD2A 2WANA 3VVGA 3MKKA 1E9LA 3FAXA 5DT7A 1QHZA 2J79A 1V3KA 1P6WA 5CQ1A 5E6ZA 2VURA 3CZGA 5DT5A 2J25A 4NF7A 5DO8A 4AEEA 1W2PA 1UA7A 1HJUA 4OIFA 5E9AA 1EDGA 1GZJA 2BY1A 4CD6A 3IAQA 2EO7A 4QLKA 3ARZA 5IDIA 2E8ZA 4NI3A 2QPUA 1ECEA 2JEPA 4TX8A 3AXXA 1M53A 1US2A 3TTQA 4BF7A 1PZ3A 3W37A 4LGXA 1OD0A 4HMCA 1DWHM 3ARYA 4WKFA 1E4MM 2D0FA 4BQ2A 1WZMA 4XX6A 2WXDM 3LPOA 1NWTA 2BY2A 4GO8A 3ZJ8A 1HKMA 3WNPA 5A6JA 2G41A 2X0YA 3LPFA 3GNOA 3PZIA 3AIEA 3BMVA 4KH2A 3K4AA 4TUFA 1LG1A 2DDXA 1CGXA 4TX6A 2D0GA 3ZQ9A 4J28A 3F5JA 5I0DA 2G3NA 1RD6A 4MNJA 3AJ7A 3NDZA 1DWIM 2DSWA 1JL8A 4H8UA 1PX4A 3NIYA 1GQIA 3ARPA 2PBGA 4W89A 4WKAA 3NDYA 1QI3A 3HU7A 4Z2HA 4P7RA 2EPMX 4F8XA 3W26A 1E40A 3WENA 2EQDA 4CKQA 5CSUA 1KWKA 3TP4A 1CECA 2E8YA 1C92A 3AS3A 4M8UA 4UZUA 3WD4A 4JKLA 1C7TA 1OGGA 5HDRA 6CGTA 4Q7NA 1X6LA 2O9OA 2A3BA 1PX8A 4M56A 1W91A 3VD4A 3MUIA 3T2OA 1QW9A 3WQ8A 1GQJA 1BVZA 1HVXA 3K46A 1W9DM 1J12A 2OYLA 3T0BA 1W9UA 1JAEA 1V0MA 1GOWA 3W38A 2J62A 4OUEA 1KCKA 4D6CA 2DIEA 1GOIA 4DUVA 5CXPA 3VMNA 2BY3A 4AIEA 3PTQA 2WMFA 3BLPX 1UWTA 1V02A 1JGIA 3EDJA 3WFLA 1H0IA 4WJXA 4JFUA 2G3MA 3CUJA 2GK1A 1B30A 4UOQA 1W9BM 2XM1A 3FW6A 1ZBKA 3VIPA 1CNVA 2WKGA 1R7AA 3ARQA 1J10A 4F9JA 2GFTA 3CO4A 2DT1A 3T08A 1B2YA 3CH9A 1ZS2A 4BA0A 1WDSA 2W62A 4U31A 1UH4A 1TFVA 1GHRA 5DEZA 7TAAA 3WBAA 3VMOA 4L4OA 1WPCA 3OZOA 3WD0A 1E6ZA 1PBGA 1JXKA 2J7HA 3BSHA 1CENA 2Y8KA 5BCAA 1VAHA 5FKYA 3OGRA 1UG6A 3EMQA 4PUEA 1SMDA 4U33A 1W3LA 5A94A 5CGTA 1DWJM 1GONA 3ARXA 2EPNA 3AHYA 4GZJA 1B3ZA 1DTUA 3B9AA 4AWEA 3GBEA 3MANA 1TA3B 3ZOAA 5KEZA 5JIPA 3SCSA 1UD3A 1XSIA 1JAKA 3K4DA 1NM9A 1KR1A 1OIFA 1BSIA 2HISA 4GZEA 1BGGA 1ZBVA 2NSXA 1AQ0A 3RMEA 3W28A 3UR8A 1I1XA 2O9RA 2WMJA 3EYPA 2XHYA 2VQTA 1CGYA 3AZTA 4JKMA 2MANA 4LXFA 1ISWA 3W81A 2VZOA 1V3JA 1JG9A 4D1JA 3UR7A 4UFIA 1UQYA 4PMDA 4Z2IA 1CGTA 3IAPA 4EK7A 1UR4A 5IXEA 2V3FA 5A8NA 4KGLA 2ZUNA 3W0KA 3OLGA 2XFRA 2X2YA 4PMOA 2F8QA 4P7LA 4A3HA 3OLEA 3HN3A 1H1NA 1JYWA 1UD2A 2ZOXA 1VRXA 2CHOA 3VILA 1XGZA 4JZ5A 3KZSA 1Q6EA 1J0KA 4UQCA 2OSYA 5AC4A 4QCFA 3POHA 3BAXA 1D2KA 2DQXA 2PC8A 1W2VA 1BVNP 4D6FA 1ZB5A 3RO8A 1R86A 1VEMA 1FP9A 3WBEA 5F7UA 2WMIB 2VX7A 3OIHA 2YBUA 3WUBA 3LPPA 3D5HA 3MUZ1 1GOMA 3GNRA 4NRSA 1UR2A 1DHKA 3VGHA 2IUZA 3OLDA 3RIKA 5BRPA 1C91A 2VO5A 5C70A 4TTUA 5I79A 1OT1A 2V3GA 2J8FA 3AOFA 4F9DA 1JZ2A 1W1VA 3WH7A 2E9BA 2XGBA 5A8QA 2VL4A 1UR8A 2WVTA 2XPKA 2TAAA 1E0WA 4D71A 2E3ZA 4WSKA 3VGDA 4UQDA 4HZ7A 5A8PA 1I1WA 1Q4NX 1MQPA 2ZUUA 3RM4A 3K8KA 1E71M 4NZCA 3ARUA 4KRUA 4TVDA 1RP8A 1HVQA 1EH9A 4KMQA 1H11A 2QMKA 2W61A 1TVPA 2CESA 2BS9A 1GW1A 1MQRA 4QLLA 4CN1A 4JCMA 1JD9A 1FA2A 3DECA 3WMSA 3WEMA 4AZBA 2G4FA 2YA2A
chains in the Genus database with same CATH superfamily
5A6TC 2AAAA 1AL7A 3IACA 5ABFB 5H1WA 3GHSA 4ML9A 4HMNA 2WBKA 3GRIA 1A5CA 3WX7A 4DPPA 1EGZA 3LHYA 1R87A 3EWBX 2AL2A 5GNYA 5AECA 4ZEPA 2PF0A 1EZ2A 1V03A 2ADAA 2PS2A 3KL5A 4WEVX 2XIJA 4IXXA 2ATSA 1R0MA 5BWFA 4H9ZA 2A6NA 4RE3A 3NQ8A 3GTIA 1PIIA 3DBPA 3FV9A 3ITXA 1O5RA 1UR0A 3LRMA 1M3UA 3ZVHA 1E9YB 5E70A 3RPDA 3ABXA 3M6YA 2PRMA 5C8BB 1M9HA 1HJQA 4B15A 4WIWA 3GS6A 3NQ6A 2JQXA 3KRUA 2AQVA 3W1XA 3NL3A 5I09A 4WGXA 1H7XA 3VDHA 5G4EA 3N4AA 5HBFA 1XDMA 4ZO6A 4X0VA 4DWSD 1CTNA 4LCSA 4JL2A 4R7OA 3N12A 4BZYA 4KRZA 3CH0A 2DGAA 3TR2A 1F05A 4KWUA 3H2EA 3KXQA 1AK5A 3RRXA 4F2TA 1K8YA 1US3A 5HQMA 3RILA 1I2RA 4BQ4A 1TE1A 1L6YA 4C6PA 1XIDA 3STEA 5E0KA 2IKJA 4W7WA 3BG9A 4FP1A 4X63A 5DY2A 1T96A 3FXYA 5A8OA 2GVYA 3VUSA 1XYCA 3P62A 4LC6A 2P3ZA 2NVCA 3KLKA 3EEZA 3CZEA 1PWLA 3M7WA 3IIOA 4LCRA 3ZR5A 1CZ1A 5F1UA 2VVNA 5A2BA 4XKMA 3TROA 1EFZA 2YL6A 4NJJA 4TR9A 1WDPA 2GVJA 3TTSA 3IJ7A 3BLOA 5EYWA 3IANA 4C1NA 4UNKA 4HA4A 1W1ZA 2ODOA 3U4AA 2P0IA 2A3LA 1ITCA 1W1YA 1I2OA 2V68A 2VEPA 3SCPA 4ZR8A 4DBDA 3VOGA 1XW8A 2XTKA 3S4TA 1YQ2A 4KEUA 1POKA 3PPCA 2ZX9A 3GKFA 1UD5A 1E0VA 2ABAA 1W5PA 1HF6A 1A50A 3VIGA 5FJJA 3PK7A 4UFLA 8RUCA 1HO4A 3QGVA 3V16A 3MP5A 1V02E 3QMRA 2PWDA 5EFFA 3GXPA 4JTLA 3QZEA 3QFEA 1V3LA 1XHGA 3VCCA 3T2PA 1KFJA 2DUXA 5GVJA 4AD5A 2PU0A 3W7EA 4AF0A 3ES7A 4HHMA 3U57A 1DWFM 2OU4A 1RY8A 2O9TA 3QH2A 4H9MA 3LSBA 3L4UA 3RU8X 4NNCA 4O1DA 3ZYZA 3F4NA 1XINA 3W83A 4HVXA 3G3MA 2CZFA 2OWWA 3V0TA 4JTRA 1U30A 3C2FA 4M29A 2QJMA 3LCIA 1XLLA 2FB3A 4M6UA 3HQOA 1QI4A 1X39A 3LCXA 3P60A 3CMJA 4MTVA 4HTYA 3TTOA 3AMDA 3RCMA 4ADSA 4MY1A 5U7SA 4J27A 1NSJA 4DIAA 3MA8A 4H9TA 5JXQA 1FXQA 4QGCA 4YJ5A 3VGBA 5CC7A 4RZ6A 3LQLA 4IG2B 2YA1A 3LTSA 4MWAA 4ZOCA 3BW4A 1XR2A 4LALA 4H19A 3OZPA 3UCQA 2EPOA 8XIAA 4KS0A 1J0HA 2AGTA 2EBNA 5CPTA 3UG3A 5HWNA 1N7KA 3L21A 4L56A 3VX0A 3WLLA 4IOTA 4RXGA 3TW9A 1CCWB 2PSNA 4Q4MA 2WKJA 5BYWA 1TZ7A 3FS2A 1XLCA 3OQEA 4L6DA 2PWVA 1O1HA 1W1TA 1TX0A 3TAKA 2BFGA 1I2NA 1X96A 5BXRA 2J9XA 1OABA 4PCTA 3GDKA 4N9DA 2B0MA 5C9RA 1DXEA 4JCLA 1OD8A 2ZX7A 4BF5A 5A6LA 2GDUA 3UWZA 4HZMA 4IP7A 1HJSA 1OCBA 4GOAA 2BASA 3M0HA 3W7LA 3RM8A 5TD4A 2KAUC 2D2HA 3PANA 3ORWA 3P14A 4RV8A 2YYTA 4AG0A 1YHTA 1W3IA 2FPYA 3IUDA 4PL1A 1KCXA 3QN3A 1RCXB 2J9YA 1WCGA 3G6LA 4V28A 3R43A 4K2SA 4QJ1A 5FL0A 3H2OA 3OG2A 4OUIA 4AB4A 4KIRA 2PWHA 2EPLX 1Y5WA 1MYRA 3IJDA 2PGRA 4DXXA 2J7BA 2ISWA 2QLYA 5F2GA 3C61A 4ACZB 5RUBA 1RALA 1OG0A 1NTHA 1XBVA 1OFOA 1NARA 4ZOBA 4GGBA 3NYZA 2D2JA 4CCDA 2OLAA 1T99A 2J88A 2V81A 5JBFA 3A5VA 5AHFA 2VD8A 4FOKA 1PCKA 3NZ1A 1ZUAX 3TZFA 1K9DA 3CHCA 3CUFA 3QOMA 4KBXA 2HBVA 1GUVA 3JZEA 2PTZA 1Z9AA 3VNLA 3ALFA 1RV8A 1UD6A 1XLHA 3SQMA 5HR6A 4XB3A 3LUTA 4D6GA 3WQVA 4QDPA 1TIMA 1Z69A 1JI1A 1NU5A 1JPMA 2Z1VA 3MCNA 3THUA 1CXEA 3ZIZA 4Q8VA 2Z1XA 3KOZA 4PA8A 1XLJA 4RX0A 4AH7A 3L0NA 3VGFA 3W73A 3SRDA 1ISXA 2E6DA 2UY3A 2CW6A 3TSBA 5J5RA 4FIRA 4IGHA 3B0UX 4AZHA 5H6HA 4NG3A 2F7FA 1FWWA 2PDCA 3W24A 2YCLA 4C1LA 4GACA 2VGIA 1HP5A 3CMGA 3INPA 5I3KA 3PZQA 4GINA 3THCA 1NOFA 2E67A 2Y89A 1WZLA 2RKXA 5TQLA 1V3IA 2VZVA 3P5YA 3RDKA 4EIVA 1TV5A 4YTRA 1TQJA 1ISYA 3IIXA 3O9NA 3KZPA 1V6TA 1SO6A 1DJGA 4LRTA 1FCBA 5IM51 1M5WA 4MY9A 2WV8A 4XUGA 1NFGA 2WCAA 3CC1A 2A3EA 5CC3A 2YB1A 4JR5A 1SZEA 3CPUA 5ABHA 4K1GA 2X41A 3REQB 1SFSA 2WMIA 4AEOA 1KCZA 4ADTA 1GCYA 2IKIA 2PLCA 2X1TA 4H6RA 2WHMA 1K9FA 3TYEA 2OTDA 2P88A 5I06A 6ENLA 4ALDA 3O6CA 4PTVA 4AVFA 4S3CA 2E9MA 1KBKA 4DAFA 2VR4A 1IR2A 3RK8A 4GWEA 1A5KC 4L9XA 4IPLA 5JIWA 4O54A 4C5YA 4FOUA 2OQHA 3NO3A 4KESA 1I60A 2CLHA 2VZUA 4MB3A 4XZIA 1E4IA 1H63A 4AWUA 3QV7A 3WDIA 1XLEA 3W75A 5LIYX 1QPQA 1W3TA 4IGNA 1NOWA 4QSFA 1UHVA 1CLXA 5BRQA 2A6LA 3QHMA 5GQBA 4PZVA 3OGSA 4HPXA 1ZBCA 2C16A 3GO2A 1VCVA 2OELA 2PPGA 4QE4A 3A4AA 1I2QA 1B3WA 4F0SA 1DJWA 5LIUX 1BTCA 2R24A 5HPOA 1F73A 1TJ2A 3TCEA 4LWWA 3XISA 1LUCA 3BOXA 5D03A 4G1NA 4RCXA 5FOOA 3O1NA 1PEZA 3SW6A 3B97A 1QPOA 1SW7A 1KFWA 1OG6A 5E6YA 2VCBA 2PTWA 1ESWA 2QV5A 4MDPA 1J6OA 4B2DD 2I5IA 4FOJA 4YNGA 3S1UA 5F2IA 1SMAA 7REQB 1T8XA 1GZ1A 3HFYA 4RE0A 3QV6A 3GX9A 3M0LA 4AU0A 3VKKA 1XIJA 1UB3A 5DMNA 4K1WA 1G01A 2ZWZA 3CTLA 1UMLA 3OA5A 4LCQA 3SCOA 4UTWC 2ZDRA 4Q7BA 3TXZA 3EB3A 3UEQA 3GXDA 1P0EA 3GNNA 3LGDA 3VIMA 4GVFA 5T9CE 3SAZA 1KLZA 1W54A 4XD3A 4DWSC 1TJ0A 1TV7A 1K7XA 4N02A 3L12A 1K1DA 1PKMA 2VM8A 3BMWA 3OHIA 3LLDA 2WZIA 4GQQA 3K8MA 4ERIA 2DZAA 4QAWA 4WHBA 4DWSA 1V8EA 3CAQA 4DO7A 3AIQA 4XAZA 3W7QA 4N9EA 5H8MA 3IJIA 4IX0A 2UZ9A 4PCSA 4UQAA 3CM4A 2ZADA 3CWOX 4YVPA 2XH2A 1GVYA 2J66A 3UETA 3RHGA 5I03A 1C8YA 2GSHA 4NAEA 1NQ6A 3EOOA 4H3DA 3HJZA 2FKPA 4BKNA 2VC5A 3PR2A 1CGUA 4DBSA 3LMZA 4C6QA 5AB3A 3KS6A 4N9BA 4WF7A 2HNEA 1CGWA 1WP6A 1TRDA 1AJ0A 4CNTA 3PJWA 1J0YA 3BLFA 4J4KA 2Z6JA 3BXWA 7ODCA 2BWGA 1X98A 2BHZA 3P0XA 3AFBA 4GQBA 3T2QA 4NNAA 1M7JA 1L8NA 1PX3A 2G3FA 2WPGA 1X38A 1O95A 2ZZ6A 3ZSSA 3HB9A 4L4MA 3C2EA 2OSWA 5HOSA 3QR1A 4NRRA 4CCCA 1KXQA 1CB7B 4MJ4A 1K8XA 3CTTA 1FP8A 1EJRC 2QHAA 1V7YA 4AXKA 3HGRA 2XDFA 3CQKA 5AHEA 1HT6A 1TMHA 3R0DA 4WX2A 5KINA 3UQNA 3W2JA 4GD0A 4DVOA 2D23A 1F4HA 5BOEA 2PUZA 2WOQA 3QMTA 4C6JA 3PC0A 4QJ5B 4DJEC 1XD0A 2GDVA 3AIWA 3TOYA 4HCLA 3G1FA 5D8WA 2XM2A 3QC0A 5I3GA 4HZ6A 1SJAA 1JDCA 3BANA 1YEYA 1JYXA 4K8HA 3T44A 1V3HA 2Z24A 4ZL1A 2V6AA 2ZA3A 1DJNA 3FGCA 1SW0A 3LY0A 5BXTA 2HE5A 4R7WA 2PMQA 1K3UA 1H1YA 2AAMA 4B5SA 3VD7A 4NYUA 1OYAA 5CZ0A 3NL5A 1KBBA 3W70A 4FR6A 5E93A 4TQTA 1QI0A 1B31A 3BW2A 1KXTA 4C60A 4L1XA 4JIQA 3LBCA 1EJ7L 3ZZ1A 1C93A 3D0CA 3FA3A 4JYDA 3VX1A 4W5ZA 4RZ4A 1W31A 1P6CA 1AZ1A 1QI2A 4XIAA 2OWCA 4IHCA 2Z25A 3A4JA 3QV9A 3T07A 4BEQA 4AXNA 3TVAA 4F0KA 1X7IA 3VFCA 2I5QA 1UBSA 2Y62A 2RJGA 4LB3A 1VBJA 2D3NA 4UR9A 1D7FA 4HNTA 1UWQA 1QK0A 5D4YA 5XIAA 4YS1A 4GE8A 1EX5A 2F2HA 3I10A 4QLJA 4U28A 1YNYA 4ATWA 2Q3RA 3DKLA 2X7VA 1BXNA 1R2SA 2ZXQA 3S9YA 3VNZA 4HNOA 4Y9OA 3LHWA 1GW9A 2CWNA 1UH3A 1EIXA 4JFVA 4GI4A 4BR1A 2OG9A 3B8SA 7CGTA 3DH7A 1BSLA 4DBUA 2VGFA 1LQAA 4JL1A 3V3WA 3HPSA 4PEKA 1OEPA 1ICSA 3NM1A 2ZCGA 2GWGA 2V2HA 3WIJA 3AS0A 1EC8A 3UESA 1S5TA 4B4FA 5HUPA 3CEUA 3EDKA 3HPFA 1IHIA 3W72A 4RPQA 1RJPA 1XIMA 2OEKA 4JIHA 3BLKA 4PB4A 1MDRA 3C0SA 3ZLGA 3DBNA 9XIAA 1QAPA 1VPYA 5F4SA 3S46A 3M46A 2GWNA 4ZMGA 4QRNA 5DN1A 1LL4A 2JIWA 1UQZA 3GDLA 1EJUC 2NXHA 4CLMA 3MI3A 4C6CA 1NVMA 1BKHA 2W67A 1A49A 3OLIA 2X1UA 4AX7A 3B8IA 1ME8A 4S3EA 1NDZA 1RK6A 1AW2A 2PGFA 3WLIA 1QNQA 2V3DA 5A3HA 4R33A 4ZOAA 2P1FA 2XISA 5D30A 1BXCA 1U33A 3BAKA 1UWIA 3NGJA 4JN8A 1ZJIA 4PMVA 2P8CA 1XYFA 3W7NA 2P53A 1EIBA 2VFGA 2W5FA 3ALGA 3ANYA 3MUAA 4JY8A 5I3DA 2VUNA 2DH3A 2X8RA 3TNOA 3UG5A 2P10A 2QXWA 3EX1A 1OZMA 4W84A 1UPPA 4I3GA 1FWJC 4XZ9A 3FX4A 5IHRA 3ZXWA 3C2VA 3TOPA 4HNCA 4GABA 3HGJA 3GVRA 3D47A 2OZ0A 3GU2A 4QNWA 1QVBA 3MV11 1G5AA 4A8IA 3VKDA 1I4NA 4HU3A 2ACSA 4Q8MA 1MEWA 1XXXA 4R5EA 5D9NA 5EA9A 3G1SA 3R0UA 3MV01 2XFYA 2C6QA 3B0YA 4ICMA 4UQ9A 4FA3A 4CU8A 1NOUA 4ML4A 1C90A 1P7TB 3P80A 2V63A 2ZA1A 4HZ8A 1WYIA 3THDA 2ZFAA 3SN4A 4HP5A 4LW7A 1UP2A 3ZLHA 1JI2A 4XKYA 1KC7A 3O2LA 2DPEA 1WX0A 3WDRA 1ZCOA 1UZ4A 4MHBA 3BLLA 1DPMA 1Z41A 1BVWA 2VQUA 2IKGA 3CBWA 3MSGA 1E56A 1UC4A 3FVMA 3G24A 1SO3A 3W4RA 1R2TA 3WMBA 5MKGA 3PZVA 4DPQA 1I0BA 1B5TA 2YA0A 3R4IA 1LBMA 1RH9A 3IIPA 2VC7A 4AIOA 1WE5A 1FBAA 1QDSA 2FIQA 3SEPA 1LJYA 3QPYA 1VJZA 1OFRA 5JH1A 3DKJA 1VHNA 3L23A 1VFHA 1HQTA 2Y5EA 4AIUA 3AS2A 4DJFC 3WD2A 3APTA 5JBDA 4UMAA 4PGLA 2PLKA 4TMBA 4IZGA 1XSKA 3F7JA 2VX6A 2HMCA 4UBPC 2TSYA 2D24A 1YE6A 1J01A 3F1QA 1FWIC 5K7JA 4WSJA 5C2CA 2G3IA 3CV2A 3KDNA 4LVFA 1XM3A 2FDMA 3FA5A 2J77A 3VKCA 1OK6A 1TX2A 4J7RA 4MIMA 1BG4A 2X09A 4RXFA 3BGGA 5I3IA 5I6SA 1LQ2A 3W29A 3MI6A 5HK4A 1ODZA 2XIBA 3WLKX 5CBJA 4NILA 4Q4RA 1KB3A 4B9YA 3IARA 2ZZ2A 2WW5A 1B9ZA 4QG6A 4OFCA 1W32A 3WEZA 1XCWA 4WCJA 5CPOA 4NSBA 3PUEA 1P6BA 1TWIA 2G0WA 3NEVA 4M6PA 2BVYA 1CEOA 2GPTA 4HQVA 3KLLA 5DXXA 2VZSA 4WKHA 4BS0A 3MWAA 4NAFA 1GQNA 4FR1A 1J2WA 4J2PA 4WDUA 3WNMA 2YR1A 3A12A 3N13A 4JTFA 3DI0A 3KBSA 1AQMA 3T4CA 4Q4SA 3M47A 3LN3A 4JX4A 1X1ZA 3EKLA 3Q67A 4EX4A 6TIMA 1GQLA 3M0ZA 3S9ZA 2HVOA 4AQLA 1KQYA 2GL5A 1J4EA 1W3JA 2FJUB 3MB9A 1YADA 2TYSA 2NV2A 2VEIA 3UZJA 5DF0A 3USZA 2OQYA 3AXIA 5C7HA 1J9YA 4FNRA 3LTPA 1QNRA 3V35A 2GGHA 4XO7A 3NG3A 1FWFC 1WO2A 5JQ9A 4GQRA 4AY7A 1BWKA 1JPDX 3HG3A 4JIIX 1TPVA 1NH6A 3JUGA 4IUOA 1NWRA 4PMNA 2Y7DA 3G0XA 4X2RA 3VINA 2V5CA 3TLQA 4JQ4A 1HO1A 3GNPA 1CXKA 3V5FA 4CD5A 2PDLA 2WLZA 4JDBA 1EPXA 4GNKB 4AD2A 1ML1A 5DBUA 1AFSA 4Q33A 1MNZA 3MKKA 1E9LA 3FAXA 5DT7A 1QHZA 5L9FA 1LBFA 4I9TA 3R2GA 4HT3A 4QNEA 2NXIA 5CQ1A 1XFCA 3E2SA 5DT5A 4NF7A 1WXZA 2Z6IA 4A3UA 4GG9A 3NGFA 2DZXA 1T41A 5DO8A 4AEEA 1W2PA 1UA7A 4O8RA 2EKGA 1YKWA 2BXVA 3OHMB 1VCGA 5IDIA 2E8ZA 5AZ1A 2XN2A 4LVBA 4TX8A 3AXXA 1M53A 1TREA 1JCJA 3TTQA 3ABQA 4XD4A 3UJ2A 4FXSA 4BQ2A 4Z1DA 3LB0A 2BY2A 4HK6A 3ZJ8A 3PJXA 5HJXA 5HNUA 3SI9A 3R94A 3TJXA 3GNOA 3PZIA 1S2WA 2DZBA 3AIEA 4TUFA 3WLRA 4YVVA 1UUMA 1WUEA 3FYPA 4Y96A 2DDXA 4TX6A 2JKPA 1G7VA 1LDCA 3BSMA 1PDYA 3F5JA 4P2VA 2I9UA 1E1CA 3AJ7A 1N8WA 1PX4A 3NIYA 2QDHA 2Y5SA 4HJFA 5LIXX 4P7RA 3WQDA 3W26A 3ITCA 1KWKA 1AL8A 4JS3A 4O12A 3MSYA 3QTPA 3TP4A 4OECA 1M65A 2ICSA 2E8YA 1C92A 4JIPA 4UZUA 3WD4A 4N2YA 4K7VA 1OGGA 5M1TA 1IT8A 3E2QA 4Q7NA 2O9OA 4DELA 3O7UA 1SUXA 2RDUA 4G5DA 3RX4A 3K4WA 2HWGA 1TKKA 1QW9A 3KWSA 4C5ZA 3TX9A 3K46A 1GOWA 3W38A 1VBHA 2G95A 2DIEA 2GJLA 2PLMA 5HUOA 3VMNA 4AIEA 4KIEA 1V02A 5HQLA 3EDJA 4H6QA 1ONEA 4HIBA 3AAMA 3CUJA 1A5SA 3RITA 2HNHA 1EC7A 1QO2A 4UOQA 5AVNA 2GLKA 3HV9A 2PEVA 1H61A 2PTXA 1K02A 2XM1A 3W22A 3FW6A 4IQDA 2GFTA 1XL9A 3CO4A 4OVXA 4BA0A 3B0PA 1WDSA 3H4XA 4PULA 1UP3A 1UH4A 3OODA 3C2OA 4J35A 3WBAA 1Z42A 3DDMA 4L4OA 3DHFA 3OZOA 3M16A 3MP3A 2Z29A 4PCFA 1F2JA 1PBGA 2QPXA 1JXKA 3W74A 1CENA 2Y8KA 5FSEC 1Y5VA 1VAHA 1A4LA 4Q32A 3CNYA 4LUSA 4US6A 3GTFA 1OFEA 3TFXA 1SO5A 5A94A 4IT1A 3AJXA 3V1HA 3M5XA 4GZJA 1OX4A 3PAJA 4JNZA 5AC7A 1TA3B 5KEZA 5ECVA 1XSIA 1NM9A 1S2UA 2HISA 1ZRQA 1F76A 1RBLA 2OJPA 1ZBVA 1FWDC 3PP7A 3TYCA 3W28A 2O9RA 1AH4A 3EYPA 2RDXA 2NXGA 2VQTA 3PNUA 4K38A 4JKMA 2MANA 4UC5A 1O5QA 1OFDA 1S2CA 4JXCA 3EX2A 4ZFCA 1UQYA 3MO7A 1YE4A 4G1KA 4YU1A 4I90A 2YPIA 4ZOEA 1XBZA 4TU1A 3LA4A 2F8QA 3RRAA 3HN3A 2ALRA 3UY8A 1UD2A 5AZ0A 4GA8A 3VKAA 6XIAA 2R6OA 3WQOA 1K8CA 3KZSA 1J0KA 2OSYA 4FSAA 3MBDA 3DHDA 3P0WA 3KTSA 2DIKA 3CIXA 4GZ7A 3W23A 3GD6A 2O55A 2ZRVA 1R86A 5PTDA 1VEMA 1Y0EA 2VWTA 2Z1BA 3UR5A 2DUZA 3OIHA 3WUBA 1FWHC 3D5HA 3QYSA 2ZZ5A 3GNRA 3MVTA 4US5D 3QVQA 4GVGA 2IUZA 1HKWA 2CC0A 2VO5A 3S1VA 5C70A 4TTUA 2V3GA 2QNEA 1JZ2A 4IFOA 1W1VA 3BJSA 3WH7A 3NQEA 2XPKA 1TPH1 2DZPA 2IPFA 1JQXA 1H1ZA 3QY6A 3PSVA 1U5HA 3VGDA 3LS9A 5D09A 2RFGA 1MQPA 2NSOA 3EB2A 3KVMA 4GUJA 3G77A 4NZCA 3RMJA 3QYQA 5DCDA 4QE5A 5HWMA 4UMBA 2DVUA 3SY5A 5FJRA 1P0NA 2LLEA 3BMXA 5GJPA 1GW1A 2X40A 3GIYA 2VDGA 5FEXA 6XIMA 4S3FA 2PURA 3HV8A 2V67A 4O1BA 3KVKA 5L6UA 4DM2A 1OM0A 3G6MA 2WCSA 4W8LA 5DCBA 4WQ6A 3SIMA 3NPUA 4PTMA 3IJQA 5GNZA 3AZRA 4MLRA 4MMWA 5AC5A 4C6MA 3NQDA 1R8LA 2OEJA 4UIOA 3QR3A 1PKNA 2Y1HA 3WK3A 3S3GA 3PM6A 1Y65A 5LZLA 5LGZA 1BAGA 3MZNA 2CNCA 4EACA 2WHKA 3V4BA 1GVEA 2XJ7A 4JN6A 3TTYA 4C7FA 5CJMA 4REQB 1RVGA 4WY0B 2PWUA 4M81A 1XDLA 2GUBA 2OR2A 4LQ1A 4M0XA 4YLWA 1Q7ZA 3NQ7A 1EDQA 1EJXC 3BH4A 3CAWA 4X9YA 1JUBA 5BNKA 3PHAA 1YTKA 4BQ5A 1DEDA 3KCOA 3VNJA 2WNQA 4LC8A 2V2DA 1HJWA 4EPBC 1FWSA 4D6DA 5I2UA 4U4MA 2YCKX 5AYXA 1B54A 3WH5A 2J7CA 2AMGA 4X9SA 1VIWA 1SVDA 4GUHA 4C6BA 3WL1A 4RW3A 3BOLA 1R3YA 3R12A 3PULA 2BV9A 3BSGA 5EMMA 3RUBL 4X22A 4PH6A 1JEZA 2EG8A 3LM3A 1VP5A 2BNJA 4J3SA 4RKAA 2Z2UA 7TIMA 1V0KA 3MS8A 2PGEA 2FTYA 2P5NA 4GBUA 2GJPA 3SCTA 3D6NA 4IMDA 1NELA 5D8ZA 3UXLA 4KERA 2E6AA 4Y9NA 1B3VA 3TJIA 1JNEA 2WM1A 3FJNA 1W1B1 3W1AA 3QGKC 3VM5A 2VX5A 2VNCA 4D6HA 3KEHA 4ZB5A 2A85A 3BPWA 4PRRA 5HR7A 4GNVA 4BK9A 5EGRA 3G2GA 3WK0A 2PP3A 4IM4A 4Q8WA 2WCGA 4S3DA 3O8AA 3TN5A 2UWFA 3CQHA 3DFYA 5DFAA 3W7OA 8CGTA 3WD1A 4YHGA 4EXAA 3B06A 3ZO9A 1FDYA 5G2IA 3F03K 4NNBA 2IW0A 1TR1A 2FGBA 7ENLA 3MSRA 5H8UA 5M17A 3C0JA 4FS9A 2FQIA 1S5MA 2ZBTA 3MKVA 4LAUA 2Y85A 4LUJA 1UKTA 4DBWA 2BGQA 1VRDA 2WZHA 4NY2A 3WQ4A 3ARVA 1VENA 3S8HA 2F6KA 4PTWA 3R8RA 1AODA 3TDFA 2HXTA 5FJIA 2V3EA 2G4JA 1H3GA 2JF7A 3ZLFA 4Q8TA 4Q8OA 3P81A 4IUGA 1MUCA 1QUMA 2O4QA 5LYRA 2DZTA 3HPAA 3VKBA 4YCOA 2VR5A 2AQWA 1BEUA 2VEFA 2VJXA 3SCWA 4Z08A 1WZAA 5A1AA 5FEWA 4CU7A 3P61A 2WAGA 2P50A 2GJRA 4J3ZA 3WF2A 4L5ZA 4A2RA 3HGSA 2OKTA 3COTA 3W7CA 3O0KA 4G7EB 1FOBA 3IS4A 3PNZA 2PDKA 4IISA 4CVWA 1WXYA 1EQPA 4WDWA 4KCWA 3VGGA 5HAOA 1PV8A 5AHLA 1KBLA 1XG4A 2Y24A 2X05A 4PB5A 1JCTA 3CHDA 3SGGA 3VGEA 3RYSA 1U1UA 4H00A 3VNIA 1G1YA 5AOUA 3LYEA 2VELA 1E6PA 4HPHA 3AUOA 5H8PA 1VPXA 1GNXA 3BG5A 3LSCA 3PB0A 1XRVA 1XYZA 3MMWA 4UTHA 4A3YA 3GQYA 2PDYA 1EJWC 3TZNA 2R1KA 3QPEA 1OK4A 2A7PA 2XSXA 3MUY1 3DX5A 1T40A 2PWGA 3K1GA 4KWOA 4GY0A 1UUQA 4B5TA 4XUYA 4LBSA 3CV1A 3USBA 3ZT5A 4CEUC 2WK2A 5LIWX 5DBTA 4BI5A 2HJPA 3PZTA 3I6EA 5T9BG 4YL2A 4UTIA 2E5DA 3VZYA 2WLYA 2ZC1A 3KBNA 3RFAA 2R82A 5CJ5A 3MU7A 1LBLA 1TIWA 5BZAA 1H2JA 4H83A 1LF1A 1ENUA 4JKKA 4FI4A 5LKYA 2NQ9A 1LROA 3U7VA 1V6WA 3TFCA 3EDDA 2GJXB 2TODA 1KTNA 3IGHX 1WA3A 5F2LA 2HDJA 2E6FA 2HVMA 4M5PA 1F6KA 2YL9A 2A2IA 3W2NA 3DGRA 3DZ1A 5EMUA 1VS1A 2PDJA 3EB4A 2QKFA 3MY9A 1VH7A 4ZB0A 5ABGA 4UTFA 2XIOA 2QVNA 2PAJA 1AG1O 3FA4A 3E02A 4C6KA 4V15A 3RJYA 5FJOA 3KAOA 4HD5A 2Q6ZA 3JS3A 2EGZA 4O1FA 3RJXA 4P8WA 1CIUA 4LV9A 1GKPA 4QP0A 2ESCA 2VUYA 3FEQA 1A80A 4LX4A 1EXBA 4YPJA 5E1QA 4DWDA 1SO4A 4FF7A 3GC4A 1JPHA 1UC5A 4WGHA 3LERA 3T78A 4KEMA 3WSUA 3N25A 1R30A 4TXEA 2OT1A 4O15A 2HPMA 3ZJKA 4XWUA 4IFRA 3SO7A 1RHCA 3L4XA 3OZMA 3DFTA 3EPMA 1HN1A 4TIMA 3PG8A 1TZZA 1A5UA 4OZOA 3N17A 5I7GA 4DI9A 1OF6A 3NPXA 1NDYA 3W7GA 3THAA 2GGIA 3DU0A 4L1GA 5CAHA 4V1XA 3F5LA 1IGSA 1GVFA 1RK5A 1VQTA 3WEOA 5E09A 4PUUA 4FZIA 1OX5A 1C7SA 3C8FA 1QOXA 1GYMA 3HF3A 1S1RA 3KVLA 4HU4A 1R5YA 4YVXA 4D8ZA 1TVNA 1JPKA 3WMCA 2CHRA 4EE9A 1Q7MA 2QCGA 3NZGA 4UZSA 3MJYA 3NA8A 3CL8A 4OV9A 4MNLA 3WFAA 1SR9A 4HHPA 4UXDA 1TMQA 4O0KA 1L8PA 1I9CB 1KM6A 1P1MA 1U5JA 2VXNA 3EX4A 4EAMA 2Y7EA 3VIFA 3BZGA 1YLVA 1H7WA 2E4TA 1GQKA 3W1TA 2W92A 4LBUA 4DJDC 4NX0A 2JGQA 4RNIA 3SRKA 2V69A 4US5A 5DQPA 3T42A 4WOZA 2O7SA 3MQTA 2O0TA 2GGGA 1VB9A 4AEFA 4DZAA 2BOEX 5EFDA 1OC5A 2WSKA 1Q4WA 4MZ1A 4P8VA 4DJDA 3GXTA 3CO8A 1CGVA 2A0NA 3S2JA 3FY1A 1W9PA 1E6SM 1B9BA 1GVQA 3RX3A 3WLJA 3EMCA 1XLDA 4OBSA 4JTKA 1RP9A 3W6MA 3IGSA 1S2TA 4IMGA 4D6IA 3PF3A 2VCCA 3W2MA 1B3XA 3TA9A 3KUMA 2VGBA 1KFBA 3WFZA 3LXBA 2QS8A 1QFEA 3OA3A 3PZMA 2JALA 1LRNA 2PI6A 5IBXA 2CXGA 4IGMA 5D2WA 3H7UA 3PUOA 1X1NA 2POTA 4BJHA 5LNRA 4F2BA 1ITQA 1O4UA 1VEOA 4Q8UA 4WZHA 3SGZA 1CYGA 4B16A 3N34A 4R3UA 4U2ZA 2OSXA 3BK0A 2CCRA 2PDNA 2CZVA 4KPLA 4L64A 1Q2RA 4A8NA 3SUUA 2DVXA 3L4TA 4FEZA 3XIMA 4K36A 2VP8A 4AYSA 2JF6A 3L5LA 4E2OA 2GQAA 3VUPA 2W6RA 4UOZA 2Y8UA 4J1OA 4Y8FA 1LZOA 2EHHA 3PUGA 1F61A 3QHNA 1MFVA 2INEA 4AD1A 1OINA 4AWSA 4B3LA 1L2QA 3G3DA 5HANA 2BVTA 4PUDA 3O07A 1SR0A 4A3RA 4J3XA 4RV3A 2E6YA 2VCAA 4G56A 1S5WA 3CJPA 3E9AA 3L4VA 4GY7A 1K7EA 4TV6A 3BL3A 4FF5A 2DZSA 2FZ9A 2D73A 3PTDA 3VO0A 1XD1A 1YBQB 4ZCWA 4DF2A 3FYOA 4MB4A 1ZQ5A 4CNPA 1M1BA 1NP2A 2HK0A 3KL3A 2V8ZA 1DJXA 1RJRA 4F0MA 1SPQA 3RR1A 2BVDA 2QW5A 2EJAA 5D2XA 2NQ5A 3VOIA 1Q45A 4K3ZA 3QGAC 1QMLA 2GUYA 4HU0A 5EPDA 2H8ZA 4UTUA 5REQB 2J78A 2FJKA 3MCOA 1EF3A 4W93A 4NZFA 3VC6A 3Q65A 3S6OA 2D69A 2PWFA 1FWAC 2DSVA 1HW6A 2J8GA 3A9IA 3GDTA 2REQA 1D8WA 1P5BA 2QMJA 3JZUA 3PWGA 1SJCA 2PDFA 2YFOA 3BAYA 3AQUA 4ERAA 1DJYA 3HTWA 3K5XA 4GHRA 5CH9A 5EKYA 4EPEC 4UTTC 2WBGA 1Z7AA 1KCLA 1LM1A 3W2KA 4INFA 5BXPA 1VFMA 1G6CA 1YDVA 5HNNA 2GGEA 4UTLA 4RLIA 2H3BA 2ZWYA 1A5LC 3I3EA 3LTYA 3SUVA 2Z1KA 5LHEA 4WLCA 3NQBA 1T5AA 4JY9A 4D6JA 1PZ1A 1DQXA 3H2MA 1OCJA 4CU6A 1ME9A 4O14A 1HUVA 2C91A 2QJIA 1WKYA 1HKJA 3TSDA 2ZIDA 5C9XA 3W1LA 3PFMA 4AZIA 4IIFA 4DUXA 4L6HA 3V75A 3I6RA 1EA0A 3NUKA 4I6VA 3V36A 5E0CA 5C71A 3N2BA 2IKHA 4PSRA 4DHGA 4DF1A 1QBBA 4JTAA 4HYVA 3IVTA 3ZSTA 5HMFA 4Q8PA 4ZE5A 4PTNA 3C0QA 4GXMA 3ECQA 4BCEA 3CUIA 3OVGA 2H90A 1IEXA 3BCDA 2V5DA 3QFWA 3QSRA 4MYXA 4URIA 2E7FA 3NSXA 5K4ZA 3R8GA 2WVVB 3BOFA 2BDQA 3ELFA 5IFTA 1Q6FA 4O4VA 2NUWA 3TXVA 2ZRYA 5GNXA 3OB8A 4L7ZA 4E4FA 3DG3A 4WJEA 1O6IA 4TO8A 3WO8A 2Q8XA 5K4XA 6TAAA 1LWIA 2HV5A 2GK1B 3GM8A 4XSLA 1R9YA 4BWLA 1EYWA 1S3HA 1KO0A 1YPIA 2D2OA 3OIXA 3H2FA 3HGOA 1GTHA 2YLAA 3PTMA 2IPJA 3UNTA 1D7KA 2V2CA 4YTUA 2GVGA 3SJ3A 3ZJ7A 1UD4A 2G37A 3B8WA 3C3NA 4O50A 2BG5A 1TVLA 3WBYA 1JZ6A 3S83A 3EDFA 2VRKA 4CUCA 2IS7A 4O8AA 1UR9A 2ZX6A 3M0XA 4AY1A 1MXSA 3LLFA 4ZXOA 1R2RA 3TIMA 1IV8A 2Y88A 4J3WA 1GVRA 3T0DA 3OU8A 3WNOA 1ZY9A 2GSJA 1H09A 3H4GA 1Q6CA 4BY3A 3VOHA 1BWLA 4EWJA 2IXVA 4KFNA 2AGKA 2X7WA 2F84A 3EMZA 4O53A 4MDOA 4S2CA 2YOCA 3B8DA 2J74A 4I7UA 1UWAA 3S5YA 4JFTA 3UP8A 5CGQA 4JEJA 3RU6A 5A69A 5ABTA 4XZLX 4XAGA 2HXUA 2YXGA 1D3CA 1IQ8A 5A2CA 2FMNA 5CZKA 4NVTA 1HKIA 2PCQA 3TKFA 1OADA 4U3AA 1ONXA 4KWVA 4H6KA 1X8CA 3QV8A 4XISA 2QF7A 2YFNA 4CQCA 4DZHA 4HK7A 3DI1A 1W3NA 2V5JA 1SQ7A 1VYSX 2BODX 3O06A 2XG9A 2H6RA 5HATA 1DIKA 2C18A 3M0JA 3QY8A 2QCNA 2A21A 3WH8A 1UWUA 3SJNA 3N2MA 1H4PA 2QUUA 3P7YA 1EXPA 3WUGA 2OQLA 5AC8A 3DENA 4JTQA 2AL1A 1V77A 4Z2KA 1TV8A 2J4GA 1PTGA 3M0VA 1KRCC 1ZGDA 4TVCA 3P84A 3CHFA 3SM0A 1MXGA 1AA1B 3VDCA 2VC9A 4GUFA 4S3JA 3UWWA 1B57A 5LNSA 2JIEA 1VPQA 2DT0A 1BHGA 2XGZA 2FGZA 3QY7A 3OZYA 2VZTA 1MVYA 2C0AA 5C2XA 4AWTA 4CQDA 1KR0A 3OW1A 4GPNA 4G7FA 2XINA 3B40A 3FDKA 1Q65A 3C2RA 4XTIA 1JNDA 1OFPA 2QUNA 4FK9A 3LCHA 1HIZA 1XPYA 4IPJA 1QI5A 3CZKA 2WMHA 2CLPA 3MJMA 1Q85A 3GVGA 4HKPA 5A6SA 5IOBA 3AIUA 3EOUA 5MHBA 2B7NA 3IJ8A 2PB1A 5FCZA 2VEGA 3P3BA 5BWAA 1X97A 4TV5A 2GUUA 1E3ZA 4B5NA 1X1OA 1JIBA 4RE2A 4ZENA 4E4PA 1YXYA 1PIGA 3CAKA 4XD6A 3RLVA 4QDMA 1N8FA 2ZXAA 2PD9A 4H9YA 3BARA 1P1XA 1DIOA 5HMEA 5FACA 1RPXA 2WNWA 3M7SA 3SUWA 3G1YA 4A6GA 1D9EA 4GXPA 1XCXA 3DYPA 1LWHA 1QRQA 2AL2B 4XBKA 1N2VA 1KM1A 3W6LA 4RDZA 2VVSA 4H8VA 4AC1X 1CB2A 1E1FA 4M80A 4RDVA 2VT0A 4LY4A 1DJHA 1NY1A 3KTCA 2RJHA 4E8CA 1UKQA 4UNLA 3CASA 2FHFA 2BB0A 2Z27A 4IPNB 4E2DA 3VTRA 3ZVHB 4ZXLA 3A9BA 2H9AA 5AKQA 5A6MA 4XVEA 3GXMA 3LCLA 4MADA 4S3BA 3EXSA 4YTSA 1WV2A 1ODUA 3K8LA 2VEKA 4P5UA 1C8XA 1VR6A 3B8VA 3G1DA 5LGXA 1W5OA 2YL8A 2CKSA 4F48A 4OBRA 4PCNA 1Q6QA 4R27A 4I7VA 1M7XA 3FKRA 2YLLA 2ZX8A 1JDAA 3FAWA 4DLFA 3LXCA 3QKEA 4IQLA 2ZXDA 3GG0A 3T0CA 4B90A 1JF6A 1UKPA 4UFKA 1RXOB 2Q02A 2J7EA 1TB3A 2JEQA 3WQEA 1V0LA 4AMCA 5AY7A 1PJ9A 3TN4A 2QT3A 3DXIA 1OC6A 4CGTA 4DYEA 3W02A 3B4YA 4QEEA 2DSUA 2W0UA 3T09A 4DX3A 3K2GA 3WQPA 4AC7C 3NEHA 3R13A 3PWAA 4M82A 3PVFA 1J0ZA 1W1IE 3EDEA 3SR7A 2QVHA 5CBIA 4YMZA 3PN8A 1UR1A 1OIMA 2YKKA 3HMCA 1XCFA 4EKJA 4GFSA 4J5NA 4O57A 3TW7A 3AWNA 1A3XA 4HBKA 4TTGA 1YXDA 5GJMA 2F2KA 4LYQA 1XICA 3TQKA 2C1IA 4S1FA 4JIEA 4H4IA 1VFUA 4EANA 4CNSA 2QCFA 3TW6A 1V6YA 3W1QA 4E2VA 1L6WA 1QNPA 4Q3MA 1CBGA 3NDOA 4C1NB 4GMEA 3VNYA 4S3KA 1JDDA 3SDOA 4A21A 2PODA 1UW9A 1UH2A 4IIHA 3PWIA 3O15A 1EPVA 2AMXA 5CPQA 3M0YA 4AHQA 5CC6A 4PUKA 2CLIA 1BYDA 2VENA 2NX1A 4LT9A 1UCWA 1H7PA 3WQ6A 1ZFJA 3W86A 3DESA 2OX1A 2P3EA 1XQKA 3B0VC 4CNUA 1KKRA 1B3YA 2DQWA 3BCFA 4GVHA 1E6NA 3WDJA 1IXQA 1WAUA 3RF9A 1IEIA 3H53A 3QF0A 2PBOA 4AD4A 1EOKA 4JNMA 2FVKA 1TR9A 1WAWA 1V6UA 2Y8VA 3N4EA 4AF0B 2QIIA 4QAIA 3R11A 4S38A 4HTBA 5A95A 4RE4A 1AJZA 1V3MA 1E15A 1X8FA 3CPRA 2YXOA 1EUNA 2XVGA 3CWHA 3JR2A 3LNPA 2VDHA 4D8AA 4NZJA 2WANA 3CB8A 5D37A 3LM7A 3BJTA 3BE7A 4QX4A 4DN1A 4ZSTA 4HYRA 4LF1A 1P6WA 2ZC8A 4NZ4A 5E6ZA 2ZRZA 3R10A 2XH7A 1YRRA 3FEMA 1IXPA 4LAKA 2BY1A 5HJYA 1KFEA 3IAQA 4NL1A 1QASA 4JEQA 3T81A 1SGJA 3FJ4A 1ECEA 2CLKA 5I3JA 3L7RA 3DC8A 1EUAA 4WD0A 4BF7A 1PZ3A 4DXVA 1FDZA 3W37A 1OD0A 3EWCA 4XK2A 3EOSA 4ZA0A 1PKYA 4GCAA 1OFQA 3H12A 3T0TA 1UZHA 1IGWA 2WXDM 1BF6A 4GO8A 3NXLA 3NQCA 3WNPA 2JK2A 3SSZA 4XO6A 4DYKA 3LPFA 2F6UA 1T0OA 3NNTA 1PYFA 4OT7A 1TMLA 1LG1A 1XUZA 5FF0A 4MWAB 1PTDA 2D0GA 5DY3A 3ZQ9A 4JOMA 1Q6OA 4OV4A 2XU2A 2G3NA 3C0LA 1DXIA 4MNJA 2DSWA 4MM1A 5BOOA 4MWAC 2OOFA 3M4HA 2AKMA 2PBGA 5FEPA 4EPDC 3NDYA 1QI3A 4Z2HA 1E40A 1O5KA 1AD4A 2EQDA 4LS1A 3IEBA 4ZQNA 3AC0A 4WJ8A 4KEVA 1XP3A 1MO0A 1TRIA 1GJPA 3CPGA 2OEMA 4PBFA 3TUUA 1YDYA 6CGTA 5CSSA 3VNDA 4JTDA 4S2BA 4NJHA 3F2BA 2G97A 3FSUA 3T2OA 4NJKA 2RHGA 2OYLA 1W9UA 1JAEA 3ZWTA 3L66A 2YCIX 4D6CA 4I5XA 5CXPA 2BY3A 4K8GA 1NQKA 4ORIA 2DJXA 3D3FA 4OU1A 3WFLA 1H0IA 2FZ8A 3HIJA 4Q4QA 2G3MA 1ADSA 3B05A 1B30A 1W9BM 1ZBKA 3B8TA 3T08A 4U31A 3EAUA 4IJBA 1A5MC 1FTXA 3H24A 3N2TA 3QEZA 3F4WA 4IPPA 3STPA 1JULA 2J7HA 1OZQA 3RLUA 3EMQA 3ITLA 3LK6A 1SMDA 3NVTA 3GVQA 3H7RA 3CYVA 1DWJM 3ARXA 5M2FX 1ITUA 3S5NA 4XIMA 1DTUA 3QLDA 2PDHA 4C90A 4ZTYA 5BW6A 3KX6A 3ZOAA 5JIPA 5TBOA 3SCSA 3RG6A 4QR6A 2NX3A 4GZEA 1JCYA 1RBOB 2NSXA 4XBJA 1UJQA 5AHMA 1AQ0A 4F0HA 3UR8A 3U8GA 1DE5A 4HHLA 2IQTA 3AZTA 3LGGA 4AIBA 4LXFA 1ISWA 4N6EA 3NZQA 4PUNA 1JG9A 4O1AA 4IPIA 3UR7A 2YDAA 1R3RA 4UFIA 3MZ2A 2YCLB 3EGJA 4Z2IA 4RDYA 4DRSA 2NLIA 5IXEA 2VFEA 5H2ZA 3W0KA 2PDBA 4A3HA 4G2DA 3C2YA 3GW3A 1IXNA 1H1NA 1JYWA 3E5BA 1KM0A 4H1ZA 2W3ZA 1FWTA 3H7VA 3MDUA 3VILA 4IP5A 1ZSXA 2C15A 1Z3NA 3TLLA 1XGZA 2MUCA 4DXKA 4JZ5A 3QZ6A 4DYJA 1PO9A 5FF2A 3A3XA 4QCFA 3BZJA 1EZWA 3BAXA 1NAL1 4M1BA 1SZFA 4GJIA 1R3VA 1BVNP 2RH9A 4D6FA 1F5ZA 3RO8A 4IFKA 4ZQMA 3W85A 5F7UA 2WMIB 1ZP3A 3FLUA 4HYWA 1CX9A 3DAQA 3P5ZA 3BQ5A 3LPPA 1LT7A 1RUSA 4NRSA 1UR2A 5BRPA 1EP1A 4PCPA 2Q3OA 1KV8A 2J8FA 3AOFA 4F9DA 1J96A 2E9BA 3GAYA 4UCGA 3I7RA 1UR8A 4ZSUA 1IWPA 4Y2WA 1XYBA 3BUVA 1E0WA 4WDXA 3U2ZA 4NP7A 3AU6A 2E3ZA 1MNSA 1DIEA 4UQDA 2FZMA 1I1WA 1Q4NX 3FCPA 3UZYA 4AMAA 1E71M 3UT0A 1QT1A 3RNDA 3H22A 3V1PA 2ZZ1A 4I6KA 3H2AA 4CEXC 2QMKA 4WXZA 1TPWA 3TYAA 1TVPA 4GYKA 1XS2A 2D2GA 2VFDA 4LF2A 1WOBA 1FA2A 1V5XA 3JU2A 1TZ9A 1UP0A 4AZBA 3I7SA 3UW6A 3MWCA 3UWVA 2G4FA 2YA2A 2X0SA 5HMDA 2CITA 3P82A 5HMSA 1OT2A 3V7PA 2G8ZA 2XFFA 2GVEA 2BLEA 1LUCB 1Y5XA 1B0IA 3S0CA 4RJEA 4O1EA 2Y4SA 3LHZA 1BLIA 1XDJA 1ADOA 3UD6A 4JTEA 3IRSA 1WNOA 2ZUVA 2WHLA 2XFWA 2WZMA 3LDVA 3TC6A 2NVAA 4ERGA 3UR2A 2RDTA 2CZDA 3CHEA 4IL0A 3UF9A 3JRKA 1YDOA 4HU8A 1TV4A 1JRCA 1RA5A 3ID7A 4O18A 4I8DA 4YWSA 4C7GA 4JQ2A 1A5BA 8XIMA 1CXFA 3ITOA 1BGAA 4F2UA 5KETA 1IIHA 4L65A 3DC0A 3CT2A 5BROA 3UGVA 3PSWA 2VR2A 3HG4A 4RPPA 5FJPA 1ZAIA 4EF8A 5C2GA 4MZYA 4D1IA 1HNYA 2FB2A 1W56A 3MKCA 3T55A 4BFAA 4DWSB 2XVKA 3EA3A 3LCGA 1TTPA 3F5KA 5D2VA 4QFUA 4ACYA 1IR1A 4H9XA 1EGVA 4XZWA 4IMCA 4H2HA 1M7PA 2J9ZA 4B4HA 4C1KA 3S2MA 5M5DA 3URAA 4NAEB 4O10A 2WWCA 4E3VA 4X0NA 4AZCA 1O12A 1WKFA 2PU1A 4DUWA 1HJVA 3UY7A 1EYEA 2QCDA 1QNSA 2J47A 2VRJA 3QRHA 4YCPA 4LB4A 3U6WA 3TH6A 3JW7A 3SBFA 1HL8A 4K6AA 3BV7A 3N9KA 4QEHA 5A2AA 2CFFA 1MW3A 4OJYA 4J2MA 5TAOA 2WSQA 1WQ5A 3VNMA 1XQLA 3OP2A 1PL9A 3E74A 4QS5A 3UZ5A 2Z4GA 2F61A 1JR1A 1NWSA 1REQA 1ZTVA 1JXJA 1JQVA 3WJYA 3ZWSA 3UZWA 3VK5A 3W00A 5SWUA 4LVGA 2FYMA 4EP8C 1JF5A 3ZT6A 4C65A 3CZLA 1YXCA 2AOSA 2XSAA 3CEPA 1PUDA 3ABOA 1OGSA 4IQJA 3CL7A 4PUWA 1A0CA 4JDYA 4RZ5A 3GG7A 1R3WA 2ZRWA 3UNDA 2YX0A 2ANUA 3CXOA 1G4EA 5AC6A 2EF9A 1CI1A 5TNVA 2Z0IA 3GE7A 3L2MA 5BOFA 1B4KA 5F1VA 4QE1A 1KBJA 1A3HA 1L9WA 4PBEA 3VM7A 3FGCB 2PRLA 3K30A 2C13A 3W76A 3E38A 2BHUA 4NZ1A 4LYPA 1YTEA 3PBYA 1VFSA 3GZAA 5A6AA 3S5OA 1QHPA 3TJLA 3AO0A 1D3GA 3M44A 5EBUA 1XFBA 3HG2A 3B03A 2DEPA 5FI8A 3KRZA 4Y9AA 1EP3A 2B31A 2J27A 3MHGA 2BGNE 3PZUA 2X0HA 5HPCA 3H4WA 1ICQA 2OO6A 4HPNA 1ITXA 4Q4KA 4PMJA 2EEXA 4LNYA 4JX6A 1DYSA 2DY3A 5DELA 5CC5A 2B7QA 1TPC1 4C6OA 4H2CA 4Y90A 5C5YA 3OVQA 5AHIA 1LT8A 3NQFA 3GH7A 4HSOA 2O7QA 4IMEA 3IJ6A 3WLHA 1KM5A 2HZGA 4KEZA 2P0OA 4UCFA 4IWWA 3ICJA 1IWAA 1XWYA 3LZ5A 1UA3A 2OGYA 2BMBA 3O6DA 4UR7A 1QATA 1NFBA 3I3BA 3T40A 3BAJA 5G1YA 1TO3A 3CYJA 4E8DA 5M3WA 3A5FA 1BRLA 2YW3A 1OHLA 2XH4A 3GVVA 3ANVA 4NXSA 4PSPA 5HA7A 1TYGA 2WVVA 1FFRA 2GQ3A 2OLHA 1UZ1A 3G18A 1LP6A 1KXHA 1A0DA 4RL3A 4LS2A 2X1RA 1MW1A 4LUTA 5D02A 1TSIA 4HA1A 4ENLA 4M3PA 1R38A 3A4XA 3OBKA 5BXSA 4IMFA 3A6OA 3SN1A 3ERPA 3I65A 1HKKA 1FDJA 4EXQA 1H41A 1JZ4A 3O6AA 1F3TA 1F4AA 1VBRA 2QDGA 4UQBA 3EXRA 3WY1A 2QCHA 1R6WA 1UKSA 1RLCL 4MY8A 2NZLA 4JTTA 1M01A 1OSEA 2J6VA 1LLOA 1PTAA 1ONRA 5H91A 2QEZA 3HBLA 3W07A 3P2VA 5IRPA 1PDZA 3M0MA 1J18A 4AYGA 4ASTA 2Y63A 4NUWA 3WH9A 2XVLA 3AIBA 4J3VA 1J0JA 3CZJA 3A3HA 3NAVA 4S39A 1UOKA 1IZJA 2Q8ZA 3AIRA 1KGUA 3GU1A 3LHVA 3L9CA 4BHYA 5E0FA 2PLJA 3NXFA 5U4NA 5BU9A 3DFPA 4ADUA 4KWWA 3MHUA 1LLWA 4QHRA 3OPSA 3S5ZA 3LV6A 4HA0A 1A5AA 1RAKA 2FPTA 3LCWA 3WKZA 2VOMA 3V0UA 1WKEA 4LPCA 1G69A 3C86A 3G5EA 3KVJA 1UR3M 3B04A 4LV4A 4B91A 5K2ZA 1S46A 1KFLA 3GZ3A 1MEIA 4AZ6A 4PFHA 4NT0A 1XIBA 3C52A 2NQLA 2KX9A 2WZTA 2Z1WA 4HHHA 2XVPA 1IEWA 2OO0A 5I23A 2X2GA 4C6IA 4F40A 1KFKA 4AD3A 4FLRA 4H9UA 1VD6A 1VFFA 3W01A 3WDHA 1D8CA 3KE0A 1ZHAA 3GSMA 4ZO8A 2VD9A 2A3HA 3OQ8A 3IUIA 3POCA 3R0KA 2G3JA 3HQNA 4HNLA 3WF3A 8TIMA 2YDRA 3AMGA 3SY1A 3QQ1A 3NTYA 3PZ9A 4F0LA 3OBAA 1W8GA 1Q7QA 3IJLA 2Q8LA 3AMLA 3WQGA 3MMDA 3DCPA 1JDEA 2PDUA 4O13A 5JMUA 2GOKA 4HOXA 4KRTA 5I07A 2W91A 2ZICA 4XKYB 1WBHA 5EBAA 3UWEA 3HFTA 2QIWA 3I4EA 1ZU8A 2A4AA 2QUTA 3GHTA 5HWJA 4DZ5A 1F6PA 3GYEA 4M1RA 2GQ9A 4TX9A 5F4WA 2QCMA 4S23A 1S1PA 4CCZA 3FOKA 1OBAA 4HPGA 3WH6A 1P0DA 1ZP4A 5MKGB 4V33A 1L6GA 4JQAA 1O7AA 4P7OA 4Z1BA 4UTMA 2I9EA 1H60A 2I57A 4C7DA 1K6AA 2ZE3A 4Y9MA 1B1YA 2YZ5A 1RCQA 1VFLA 1G7UA 1XGDA 2Z7GA 3VIIA 2V30A 3WN6A 4HA3A 2ATMA 4EOUA 1A47A 1K4HA 3TYDA 2D3LA 5AVHA 2CEQA 5FA5A 3UXKA 2IXUA 4GI8A 1MRAA 2D22A 4ZFMA 3GBDA 3E1F1 3NPWA 1CXHA 2BXZA 4D72A 1GKQA 3FXGA 2WSYA 3A47A 2ISFA 1OWQA 3STFA 1MUMA 4DEFA 3NO1A 5ABFA 1H0GA 3SFWA 1XSJA 1OCNA 3KW3A 2E68A 5C54A 1ZCCA 2ZUWA 1Q66A 1H50A 2CBIA 2EAWA 1UMYA 4R9XA 4Y9PA 2WC3A 3NOEA 2WM0A 3TE9A 3VI2A 5XIMA 5IFPA 4QM1A 2YDQA 3SCNA 3BV4A 3O05A 1FVPA 4XZNX 1JZ7A 3OYZA 2NVDA 3S1XA 1PSCA 3TK7A 4NAFB 1VBUA 1UIPA 4JQ1A 2CZEA 1KRMA 3QW4B 2F6XA 5CZSA 1CWYA 4B9ZA 5CGMA 4FLSA 3QOKA 3RX2A 3EKGA 1QNOA 4BF9A 3SCUA 1ZBWA 1QWGA 2A7NA 2VYOA 2HPIA 3G1VA 1L6SA 1V6VA 5LXEA 1CPUA 4Z17A 3UPBA 1HL2A 2QUVA 3AROA 4POCA 3CUHA 4YHEA 3UYIA 1PHWA 1IXOA 3PZGA 4PR4A 4ZODA 1XBYA 6A3HA 2GOUA 4B2DA 3EPNA 4U10A 5FF4A 3W3OA 3S42A 1TV2A 3W2LA 4B3KA 2Y61A 3KP1A 3WLMA 1US0A 3TSMA 3PBGA 4CN6A 4IX2A 4H7VA 4HSNA 4RNFA 2G50A 1UASA 5T91A 2F38A 4GIAA 4QROA 4X60A 1GEQA 4ATLA 5CKSA 1HP4A 4GQ0A 1J93A 4HGXA 5BU6A 3SY8A 2VFHA 5LHFA 3Q45A 2E5BA 3BDKA 2OT0A 1XRTA 2XZ7A 5FF3A 2QQ6A 8A3HA 3QKZA 3S47A 3BC9A 4B5XA 2CBVA 4HOWA 3RCNA 4DJED 3TN6A 4DZIA 5D9PA 3B4UA 3CV6A 1HX0A 5CLTA 1XF0A 4W87A 3L68A 4FHAA 4M19A 4LTSA 4FLOA 2WKLA 1YPFA 4JD4A 1WDDA 1TCDA 4EF9A 1MFUA 2ZUMA 4FLQA 4EXBA 1MI3A 4A3QA 3MSDA 1E4NA 2R1LA 4RUBA 3NO5A 5AHNA 3T8LA 1O1ZA 1S3TC 4GKLA 1FRBA 3AALA 3R79A 4QDWA 1R9XA 4YN5A 1E72M 2W27A 5C9ZA 3VOCA 3NWRA 1E1CB 4IP4A 4IJRA 3VC5A 1FWNA 1F74A 5G2HA 4A05A 3PZOA 3TYBA 1E70M 2X30A 4DO4A 4GYJA 2Y5JA 1PE1A 1OCQA 4O0ZA 3ZMRA 1BF2A 2R1PA 2J7FA 3MUXA 1MEHA 5DMLA 4TMCA 1TPUA 3URBA 2FVLA 1E1EA 1NFPA 3WBXA 4MJMA 1EL3A 3ARSA 1VLIA 3VIHA 4Q22A 4D8LA 4RDWA 3PY2A 2ZUTA 3EWWA 3FSTA 4IXHA 4FNUA 2DVTA 4JX5A 3T1GA 3RN6A 4AZ7A 3TWAA 1PS9A 4MSSA 3VE7A 2DSKA 4JYEA 5FD0A 3MPGA 3VIOA 3MUCA 1XH0A 2WB5A 2GSEA 3MTWA 4A35A 1JCNA 3GXIA 1A4MA 3ABZA 2ZA2A 3KWXA 4AHOA 4FNPA 2OWXA 4KF1A 4PN2A 3VIJA 1EWEA 3EWYA 3OEXA 3FHAA 3MBFA 1RPKA 3H54A 4OBTA 4LY8A 5LA2A 2YYUA 4IG2A 4GFIA 2RDWA 1KFCA 3AHXA 3PPGA 3CUXA 3R1ZA 3VCNA 5A8GA 3MMTA 1HJXA 1EBHA 3BTNA 5C9WA 3W7IA 3GH4A 1O68A 1YNPA 5HXMA 2V82A 3E2VA 4Z1CA 4LUSB 2YXXA 2VDIA 3NQAA 3U2EA 4W7VA 1WBJA 3SQLA 1I45A 4OTKA 1OX4B 2OYMA 4A8RA 4ZQOA 2YJQA 3AHTA 1KXVA 3LEPA 3EEGA 3AMCA 3OTRA 4UFHA 4E8GA 4W88A 1I8JA 1DJQA 1BFNA 2XIIA 2RGLA 3GIPA 4IIGA 5B7YA 2E09A 4N4PA 1V6XA 3H2NA 4LAMA 3AMKA 4GK8A 3E0IA 4BI6A 3XINA 5FAGA 3HJEA 3WNNA 2QZRA 5CSYA 3DIPA 2QR6A 3A13A 2WNNA 2W63A 1JZ8A 3V5CA 4B92A 3R6IA 1E6QM 3S9IA 3APGA 3DFHA 3NVDA 1QW7A 4D9PA 2WQPA 3II1A 2YBTA 3P93A 1Q8JA