3U7BA

A new crystal structure of a fusarium oxysporum gh10 xylanase reveals the presence of an extended loop on top of the catalytic cleft
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
327
structure length
327
Chain Sequence
b'AASGLEAAMKAAGKQYFGTALTVRNDQGEIDIINNKNEIGSITPENAMKWEAIQPNRGQFNWGPADQHAAAATSRGYELRCHTLVWHSQLPSWVANGNWNNQTLQAVMRDHINAVMGRYRGKCTHWDVVNEALNEDGTYRDSVFLRVIGEAYIPIAFRMALAADPTTKLYYNDYNLEYGNAKTEGAKRIARLVKSYGLRIDGIGLQAHMTSESTPTQNTPTPSRAKLASVLQGLADLGVDVAYTELDIRMNTPATQQKLQTNADAYARIVGSCMDVKRCVGITVWGISDKYSWVPGTFPGEGSALLWNDNFQKKPSYTSTLNTINRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE
publication title The structure of a GH10 xylanase from Fusarium oxysporum reveals the presence of an extended loop on top of the catalytic cleft.
pubmed doi rcsb
molecule tags Hydrolase
total genus 134
structure length 327
sequence length 327
chains with identical sequence B, C, D, E
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2011-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3u7bA00
2DT2A 1M04A 4B9YA 1CYGA 1J0IA 3UG3A 2VTFA 2YA0A 5A2CA 3W24A 3N12A 3MMWA 2XIIA 4UFMA 3CHDA 6CGTA 1CTNA 1W2VA 1OIFA 1TG7A 1TFVA 4MJ2A 1MWOA 3SCOA 3WUFA 3BSGA 3VGFA 3WUGA 3MKKA 2YBTA 4AISA 3WDRA 3W38A 1DHKA 3DYOA 2PWDA 2CHOA 3OZPA 1B9ZA 1X6LA 4UQAA 1JYWA 4WK9A 3WFLA 4Z2LA 1JFHA 3AMCA 4P8WA 2AMGA 1C90A 3U57A 3QOKA 3B9EA 5D9NA 1FHLA 5A6MA 3NSNA 1GVYA 3VD9A 1E4NA 1XYFA 4PBGA 1DWFM 2VOTA 1EHNA 5FCZA 2X0HA 1QI5A 2WLZA 3G6MA 3WNMA 4S3KA 1ISXA 2WBKA 1FA2A 2BVYA 1E0XA 2XVNA 5GPRA 4ZXOA 4M1RA 2PF0A 5AC4A 3FNDA 1E3XA 1WNOA 2J47A 4QAWA 1UWRA 1CENA 3WQ4A 5CGMA 1JNEA 3GXIA 4DM1A 4CCEA 5C8BB 3GYCA 2WMKA 3CZEA 1E56A 5I77A 4J3WA 1V6UA 1I1WA 2DIEA 1TVNA 4KH2A 1JZ6A 2C0HA 2XM1A 3AI0A 5HXMA 2YLLA 1J0YA 1W2PA 4PUDA 5ABHA 1JYNA 4H8HA 5I6SA 1XD1A 2Y8KA 1UD2A 3FAWA 5A1AA 1I75A 2J7FA 4JFSA 1QHPA 3AHZA 1EGZA 3VTRA 5A69A 3AIBA 1IZJA 4AZBA 1E1EA 3A3HA 2V5DA 2E8YA 4F9JA 4WF7A 1FFRA 4ZENA 2Y5EA 2CITA 2JALA 1M01A 1Q6CA 4QLLA 2G41A 3IJ8A 4WKAA 1QNQA 1V0KA 4YN5A 3O9NA 4AZCB 4D6EA 3AMDA 1JI1A 5DFAA 2XHYA 1FFQA 4D6DA 4ZXLA 1IT0A 5LA1A 3WMCA 2WC7A 2DT3A 1GOOA 1CGVA 1OCQA 1PX4A 2VUYA 2NSXA 1ISVA 4MAVA 4PEEA 1VBRA 2O9RA 4AD5A 3VD7A 3RM4A 4PRWA 1C91A 3BMVA 1K9EA 3VM7A 3SUVA 1PBGA 3SUSA 2PBGA 2GFTA 2G3IA 3VDBA 2CHNA 1Q6DA 1LL4A 3WH7A 4D1IA 1GQLA 2D0HA 4H2CA 3ARQA 1UWQA 5M03A 3ARXA 4QLKA 3WNNA 1BF2A 2ESCA 1CECA 1E40A 4X0VA 4BQ2A 4CU6A 1XCXA 3U5YA 2VCAA 1E5NA 4UNIA 4F8XA 1M03A 5IFTA 2BHUA 4D6HA 2E8ZA 5LA0A 4M82A 3F5JA 5E70A 3BLPX 4KWUA 1E43A 4FMVA 3WEOA 2WLYA 1PJ9A 1UKTA 2FHCA 2DSWA 1UQYA 5ECUA 5EB8A 5FKYA 3L4UA 1B30A 1V08A 4YHGA 1W1YA 1BQCA 1VIWA 2VQUA 4YHEA 1QBBA 4H8VA 1C8QA 1Y7VA 1UWTA 1ZB5A 5CLTA 2J78A 3BH4A 1XD0A 4W85A 2HISA 9CGTA 3VIJA 1Z32X 1WCGA 4AIEA 4ML4A 4P7QA 2A3CA 3ZT6A 2GK1A 2XFFA 4BF7A 4Z2JA 1L8NA 1Q6EA 4AIOA 5C71A 1LWJA 1FOBA 1W3KA 4IPNB 4UOZA 2J8FA 5BCAA 8CGTA 3BXWA 1P6WA 3I3DA 1ZBVA 1GVIA 4HP5A 1BGAA 1UUQA 1KXTA 2W63A 2OWCA 1OM0A 2PB1A 1BFNA 3WFZA 3K8LA 3VDAA 4AC1X 4CU8A 3WF4A 1Q6FA 3WL0A 2VRJA 1VFFA 2UY5A 1IZKA 4M8UA 3EMCA 5CPTA 4Q7NA 5HPOA 4MTVA 1JNDA 3WD1A 4UFLA 4ACZA 1L0PA 2IXVA 3POHA 3T08A 4CVUA 1JF5A 1CDGA 2DPEA 4OBSA 5I0DA 4TX6A 5D9OA 1XSJA 5LA2A 4Z2HA 1QNSA 2E4TA 3GXMA 4PMQA 3RIKA 4JFWA 1GQIA 2D0FA 3PZNA 1CGXA 3NUKA 4LQ1A 1JYXA 6TAAA 3TTQA 1B1YA 1DTUA 2CYGA 3W0KA 1HVQA 1W32A 4QDMA 1UQZA 1TZ7A 3EDJA 3OIHA 3J7HA 2HVMA 3WQ6A 3OA5A 7CGTA 4D6FA 2OYLA 4ATLA 1JFXA 1HJQA 1OGSA 3CZLA 1KWKA 3AHXA 3SCSA 2FHFA 1EDQA 3WF2A 3MMUA 1JDCA 4LYPA 3VIFA 2ZUUA 4C7FA 4JCLA 4HMEA 3VM5A 3QOMA 2V3FA 4GO8A 1H0GA 3TONA 1B0IA 2J8GA 2X09A 5HDRA 2F8QA 1B2YA 3D3AA 2WMHA 1UR9A 1E6ZA 3BAJA 3VPLA 2EXOA 4W7UA 4WKHA 1BAGA 4MADA 3WQ8A 5ABGA 3CIVA 4RL3A 1HX0A 3EBVA 4DWSC 1VB9A 1CGUA 1PIFA 2GDUA 3SCNA 3W26A 4EK7A 1JZ8A 2WCGA 1SR0A 3VINA 3GDBA 4HA3A 5JBEA 3WIJA 4BQ5A 3AS0A 3IK2A 4ZE5A 5D9PA 2UY4A 3IJ9A 3GTNA 4D6IA 5FL0A 6A3HA 3MO4A 1QW8A 2V5CA 4W86A 2BVTA 4MAZA 3CTTA 4AW7A 2YIHA 3AZSA 2DT1A 3BAIA 3DC0A 3HN3A 1M7XA 5A6BA 4GPNA 3VD3A 3CUJA 1R8LA 3SEPA 1W3JA 2WHKA 2BXZA 4W8BA 1CBGA 4X9YA 4QFUA 1NP2A 3O6AA 5CPSA 5I23A 1V3JA 3W6MA 2WK2A 1LLOA 4H41A 2PBOA 4U3AA 3LPOA 4W7VA 1B3YA 4V27A 3DHPA 2WVSA 4XZBA 3VIOA 3PZMA 1XSIA 1B3XA 1ISYA 2AAAA 4P8XA 4H04A 1V3IA 1ZBWA 2E9LA 2VX5A 1KR0A 4F66A 2UY3A 1K9TA 4MNMA 4QLJA 3RPMA 2YKKA 5LYRA 4U5IA 2XVPA 2BHYA 3AOFA 2DIJA 5A2AA 1AQHA 2CCRA 5IFPA 1KB3A 4BQ4A 3AZRA 1S46A 4E4PA 1FP8A 1R87A 3L4YA 3VU2A 2VRKA 2WZEA 3T2QA 2WMFA 1EIBA 2XIBA 2FGZA 5A8NA 1C7SA 4MNJA 1BYDA 2WPGA 1GNXA 2BNJA 1BVNP 2EPNA 1KFWA 1CLVA 1GORA 5DT7A 3PHAA 3ARPA 2YL9A 2A3AA 2GK1B 4D1JA 1CGYA 4Q22A 1E15A 5BXSA 2WM0A 3N04A 4P7RA 3ZSSA 3LPFA 1NH6A 5BRPA 2JEQA 4R5EA 1VENA 2YA1A 1GOMA 1XH2A 4XB3A 1MW2A 1ESWA 3EDKA 3POCA 4LYRA 1V02E 3VO0A 3BC9A 1NOWA 4PN2A 3TA9A 4GZJA 1CXFA 1GW1A 4JKKA 5BRQA 3M46A 3ZMRA 4BS0A 2ZICA 1BYAA 5GNYA 1MQQA 5I5RA 4HU8A 2G3JA 4S3JA 2J7EA 1WDSA 3GBDA 2PWEA 2W67A 1KQYA 3MUZ1 4Z2KA 1NOUA 1UZ1A 2EQDA 5E0CA 4LGXA 5JBFA 1AVAA 4ACZB 5IDIA 1CGWA 2VX6A 2OLHA 2EPOA 4M24A 2BY3A 1B31A 4OZOA 3ZM8A 3K46A 4GQRA 3W82A 1CXKA 1WDQA 1OSEA 2V3GA 5A8PA 1C3FA 2JEPA 1PZ3A 3WNPA 1NOFA 1G1YA 1LG2A 2QF8A 4PTWA 2ZXDA 4UZSA 3QHNA 2YBUA 2GJRA 4X0NA 1H1NA 1MXGA 2D24A 3I3EA 3NDZA 2J7HA 2VZSA 1HKJA 2ZIDA 4ZE4A 1QHOA 1HJXA 3PZ9A 1HJUA 2VO5A 4JHOA 1J0HA 2WKLA 1JZ3A 2XG9A 2EPMX 4QCEA 5A8QA 2WMGA 3CHEA 4GI9A 4FLSA 1H09A 5KZ6A 3CUHA 4XZWA 3CZ8A 2DSVA 4B3LA 1C8YA 3MSGA 2A3EA 4AYSA 1W1VA 1G9HA 3SCTA 1QNPA 4AIUA 1VF8A 5AC5A 3RM8A 3WSUA 2E0PA 4M29A 1QNRA 2OWXA 3L4TA 2D1ZA 4AD4A 1WPCA 1NQ6A 2FGLA 5A6JA 4U31A 4AD1A 3FXYA 1K6AA 5DO8A 3KL3A 4F79A 4J7RA 1BYCA 3T0DA 2YL8A 1Q4NX 4PTVA 4HZ8A 2DEPA 3L4VA 1ECEA 3OB8A 3MANA 1JGIA 3NSMA 3WH9A 1R85A 4U2YA 1G5AA 5I2UA 1UKSA 2PC8A 1E6SM 1B3ZA 3ARUA 3EDEA 4TVCA 3WNKA 5I24A 3RDKA 2WZHA 3L4XA 4NRSA 3EMQA 5M5DA 3QGVA 3AYRA 4PMNA 4W89A 3VX1A 4H7VA 1VEOA 5DT5A 2FDMA 3AISA 3WMSA 1UR2A 1D3CA 3GNPA 1EOKA 3MSDA 4UOQA 2ZOXA 3IAQA 3APGA 2VR5A 3B9DA 1F4HA 2EJ1A 4DWSD 3VVGA 2VX7A 2X1IA 1AMYA 1VBUA 4J3VA 2QHAA 4QP0A 4JFVA 1H3GA 1V0MA 4EAMA 1JL8A 1ODZA 2Y8VA 1RPKA 4B16A 5AYBA 5HPCA 4B15A 4MDOA 2CIPA 1XSKA 5A95A 4AXNA 4B9ZA 1ZBCA 2CKSA 3WUEA 4LYQA 3NCOA 1GOIA 1ITCA 1G94A 4HMDA 1LG1A 3ARZA 1W9UA 2J74A 3WENA 3AFBA 4PSPA 3TTSA 3AZTA 3AXXA 3DECA 3ARYA 1WP6A 1MQPA 3SURA 4L4OA 2ZXQA 5E09A 3II1A 3MV01 4AZ6A 1U30A 4JCMA 1CLXA 1PZ2A 4UQ9A 1UD5A 3TTOA 1ZJAA 2XVGA 4U3CA 1E72M 1GJWA 3GNOA 4ACYA 3CUFA 3GXFA 2JE8A 3UCQA 4P8UA 1HKIA 3SCWA 2VT0A 2J4GA 3AIQA 3WDHA 2VVNA 4CN6A 3PZUA 3OLEA 3WF0A 4MB1A 3N9KA 3GM8A 4XX6A 4KMQA 1LJYA 2D3LA 1QBAA 2PWGA 1LQ0A 1WAWA 3ZIZA 2VNCA 4IPLA 2DH3A 1UA7A 3WEMA 4E8CA 4C7DA 1NWUA 3PBGA 5ABEA 2VJXA 3BGAA 2XVKA 1ZL1A 3VMOA 2BXYA 3G6LA 1K9DA 2VMFA 2XSBA 3PZIA 1C93A 4W5UA 1OGGA 4TTGA 2ZUSA 1E0WA 3CUGA 2YL5A 4UQCA 3VGBA 1GZJA 3W4RA 3RILA 2G4FA 4OJYA 2G3NA 1JF6A 4BQ3A 3BLKA 4GZIA 2ZX8A 4PMZA 1SFSA 1E6XM 1D2KA 3EDDA 3NDYA 3PZOA 1TCMA 3KWXA 3VGGA 2OSWA 3WD2A 1KBBA 4DUWA 1JG9A 2BY1A 1EXPA 2XJ7A 3FY1A 4PMXA 5C70A 1HP4A 1SYTA 4AZIA 3N18A 1GOWA 1OB0A 5A94A 2J75A 4JFTA 1WO2A 1HVXA 2ZUMA 3VDCA 4HOZA 3M6DA 2VCCA 3N11A 3W6LA 3WN6A 2VQTA 1E6RA 1TR1A 5E9AA 4W7WA 4J27A 1W9PA 4RE3A 1V3KA 4OBRA 1EA9C 3M07A 4CN1A 4CD4A 3AS1A 4JAWA 4MNKA 1W3HA 2YLAA 2VX4A 3AMGA 2NW0A 5D8WA 2CEQA 4FLRA 4HU0A 2JIWA 2BV9A 4UFIA 2VURA 3WD4A 3AIRA 1V3HA 3W28A 3GH7A 4PMYA 2PI6A 4PMOA 4Z2GA 1JIBA 1HKKA 1V3MA 4C7GA 1EHAA 1CPUA 1MVYA 4LXFA 3VGEA 1DEDA 3L2LA 3KEHA 4W93A 2JF7A 3SCVA 3K4AA 2D0GA 3WDIA 2PWHA 2XGIA 2ZE0A 3OGRA 2TAAA 4N42A 1QNOA 1J01A 1OBAA 2WANA 1UD4A 5GQBA 1QI4A 4NI3A 2WVTA 3CH9A 2J79A 5BWFA 1CZ1A 3AS3A 1EO5A 4JHZA 4BZYA 2CXGA 3IJ7A 1G0CA 3CHFA 4MB3A 4DUXA 1ISWA 1UKOA 1XV8A 2DT0A 4NSBA 1YQ2A 4JKLA 1D7FA 3B8SA 2WC4A 3I3BA 1KXVA 4GI6A 2WWCA 4FF5A 1DWGM 5CGTA 2YA2A 4J28A 1J11A 4UQBA 1KQZA 2C7FA 5E6YA 1VRXA 2BHZA 1FH7A 2CBUA 1OT2A 2W62A 5CG0A 3W81A 2PWFA 2ZXBA 2WW5A 4KGJA 1CWYA 3VMPA 1QVBA 3GH5A 3VOCA 1BYBA 3T0AA 2ZX5A 3SCQA 1CXLA 1EDTA 1BGGA 2BVDA 4TVUA 3PTQA 1U33A 2J62A 1WZAA 1VJZA 3CLWA 2VCBA 4IM4A 4P7NA 4UFHA 4PMUA 1FHDA 1AQMA 2XPKA 3OZOA 2ZX9A 2J77A 3UEQA 4UR9A 2XUCA 2X0YA 2D22A 5BYWA 1SMAA 4KRTA 3SUTA 3AHVA 1QI3A 2OSXA 4P7LA 1CEOA 5IXEA 1CXEA 1UKQA 1NWSA 2X8RA 2VC9A 3AIWA 1LWHA 4M80A 5CQ1A 3A47A 3CGTA 4PTXA 4W8AA 2W61A 3WD3A 1VEPA 1GQJA 5CSUA 5I79A 4GINA 4CUCA 3VNYA 4DM2A 4AY1A 4CKQA 4J3XA 1WE5A 2E9BA 2WAGA 4GXPA 1BLIA 5JBDA 4JL1A 3F5KA 1E71M 1HT6A 3WDQA 2EBNA 2Y2WA 3OLIA 3VDHA 1EDGA 2GJXA 2DGAA 2RGLA 3FW6A 3VIMA 5I3DA 1FH9A 3AJ7A 3AS2A 3W53A 4HA1A 4AMCA 3GBEA 2FH8A 1HN1A 3WQVA 1ZJBA 4CD5A 3GZAA 1W9DM 1HF6A 2GJPA 3BSHA 3KZSA 2W92A 3WUBA 1V6WA 4ZEPA 1GOKA 1GJUA 1PEZA 3GH4A 2DSKA 1VEMA 1US2A 1GHSA 2Y4SA 2YL6A 5CLWA 4HZ6A 2CPUA 2WBGA 2ZXAA 1Q6GA 2WC3A 4QCFA 1WZLA 1OT1A 5FOOA 2DH2A 1R7AA 2J7DA 3AXIA 4AZHA 1GCYA 3VNZA 4FLQA 4HPGA 3BCFA 1JZ5A 3MV11 4ZFMA 2VZVA 3JUGA 3T09A 1QHZA 2XWDA 2XWEA 3EMZA 3WH6A 3BMWA 1JXKA 1GONA 1UR0A 1MW1A 1H41A 1O7AA 5CJ5A 2DSZA 2E40A 3QR3A 1BPLB 4MJ4A 3B9AA 3AXHA 4CCDA 4YPJA 2ZX6A 3WD0A 1IV8A 1TE1A 1KWGA 3NSXA 2ZWYA 3LPGA 3LPPA 1RP8A 4CD7A 3NIYA 3QHOA 3T2OA 2Q8XA 2JFEX 3M7SA 3HMCA 3VIIA 4W8LA 2CESA 1LL6A 4NF7A 1EQPA 4E8DA 4JFUA 1BG9A 4A3HA 1CNVA 1WKYA 2XFRA 4GIAA 3D5HA 5BROA 1B3VA 5JIPA 3A6OA 1C8XA 4NRRA 2ZWZA 4A3YA 1TA3A 2C8NA 3MUIA 2W91A 1E4MM 4TOQA 3WF3A 3WEZA 1VFMA 1W9VA 3VIPA 1PAMA 1BVZA 2V3EA 3ARSA 3PZVA 3WNLA 4P8VA 4F9DA 4UTFA 1QOXA 3A4AA 4IUGA 3GXDA 3PTKA 1BSIA 4CGTA 5AYIA 3ZR6A 3AHYA 2WVVA 2VI0A 1E4LA 4FLOA 1MQRA 2EO7A 4P7OA 1A47A 3L2MA 1R86A 4D6JA 5EFDA 1J9YA 2G3MA 2O92A 3GNRA 3T0BA 4JZ5A 5A8MA 3AIVA 2WCSA 4AZGA 4HOWA 2XVLA 1HXJA 1J12A 2ZUVA 1WZMA 1JZ2A 1KR1A 2WXDM 2YDRA 5BXPA 1SMDA 1AQ0A 3WBEA 2O9PA 5CPQA 2WHJA 3W25A 3TP4A 4WKFA 4N0RA 3FHAA 1E73M 4M56A 3BCDA 1OD0A 3MS8A 3AYSA 1JDAA 1KCLA 5HBFA 4CD6A 2ZUWA 1ZU8A 4OOZA 1C92A 5A2BA 2VVSA 2X05A 3THDA 1JD7A 1OGBA 1UWSA 4HPHA 3CMJA 4WIWA 1HL8A 4HZ7A 2XGBA 5M3WA 4MB5A 1X1NA 4UFJA 1CXIA 4LX4A 2WWDA 5CXPA 2D20A 3N1AA 1UYQA 4J3TA 1RH9A 4AD0A 1CGTA 1H11A 3F5LA 5A6SA 2QMKA 2UY2A 4PMRA 1JZ4A 2QLYA 3PZTA 2WMIA 1TMQA 2AOSA 3UG4A 2QPUA 4EKJA 5HOSA 1VAHA 4OUEA 1JYVA 2BFGA 2VZUA 1RD6A 3TOPA 2GJXB 5KEZA 1E6QM 2WKGA 2EPLX 1DWIM 4UQEA 5JUVA 2WCAA 2Y24A 2WB5A 3QHMA 4PUEA 5BXRA 4U5KA 2CETA 1XHGA 1UH2A 1KBKA 2BY2A 2UWFA 2E3ZA 3PZGA 5D8ZA 4D71A 3LMYA 3TTYA 1M53A 3L4ZA 1HP5A 1MYRA 2D2OA 4BA0A 3SCPA 1W9BM 1V03A 4FK9A 3ECQA 3U7VA 3ZJKA 1GHRA 3WH8A 3ZO9A 3VGDA 3A4WA 5FD0A 1XH1A 1V6XA 4OIFA 3WKZA 4U2ZA 4MNLA 1W9XA 1W91A 4WSKA 4L4PA 1QI2A 1BHGA 1UG6A 5A6AA 4PMDA 2XSAA 4TUFA 2IXUA 3VIKA 1E70M 3KL0A 4XV0A 1JXJA 1MW3A 2W66A 2EEXA 1PX3A 3CBWA 3VD5A 3FAXA 1BTCA 2W4XA 4AWEA 3BAWA 2GVYA 4CD8A 3IANA 1PPIA 5GNXA 1ZS2A 3FHQA 2F2HA 3CO4A 3OGSA 4TVDA 2GSJA 2VRQA 3RM9A 1O6IA 1MFVA 3WELA 4PYSA 1HKMA 1PX8A 1UKPA 1W1TA 4AEEA 2XTKA 2V3DA 3WDJA 4KGLA 1V3LA 3K4DA 2ZUTA 4GI8A 1UR1A 1X6NA 2YDQA 1US3A 1DWJM 1E1FA 3ARWA 4URIA 4WSJA 1UD3A 1TA3B 2E9MA 3K8MA 2O9TA 2Z1KA 1XCWA 2ZX7A 4ATWA 5ABFA 4PMVA 1DP0A 1J0JA 3VD4A 2WHLA 1OD8A 4EANA 1W3LA 3K8KA 1UD6A 4HA4A 4KRUA 3VILA 3ZT5A 2VR4A 4J3UA 1G01A 5CSYA 4AZ7A 4IISA 4OKDA 3WF1A 4GO9A 1MXDA 2WVVB 2IUZA 1W1PA 2VZOA 4DWSA 1JAEA 3AIEA 5I78A 5JIWA 1E6NA 1U2YA 1RP9A 1TUXA 3E1F1 1GPFA 5A6BD 7TAAA 3EYPA 1NWTA 4GKLA 4UFKA 5M17A 3ZQ9A 4UCFA 1HJVA 1GUVA 4WJXA 4K68A 1H2JA 1UZ4A 1J0ZA 1C7TA 4PCTA 1J0KA 4DUVA 3U7BA 4AEFA 2XYLA 1V0NA 3ZOAA 4UOJA 2CERA 1GQKA 1V0LA 3VX0A 2QPSA 3VIHA 5FIPA 4CCCA 3MUY1 1UD8A 4J3SA 2WMJA 3DHUA 3PN8A 4NZCA 3W27A 3EDFA 5DMYA 2Z1SA 4HOXA 3RJXA 5D9MA 2WZIA 3ZJ6A 4M81A 1E0VA 1H49A 5CZKA 3SCUA 3MMDA 1UH3A 2OSYA 2W5FA 3UERA 5FL1A 5A3HA 2YDSA 3BAKA 3CZKA 5EMYA 1UH4A 1UWUA 1XH0A 2CKRA 3HU7A 2WMIB 1JDDA 3UG5A 1VJSA 3OBAA 1V02A 1ITXA 1FP9A 3MUAA 2O9OA 1CXHA 5TD4A 4AD2A 3DYPA 4MPKA 4A4AA 4Z2IA 5IHSA 4Y7EA 5DF0A 4RE4A 3N13A 4ATDA 3UR8A 3T2PA 1VFOA 1UA3A 2J25A 3ZJ8A 3VMNA 1E5JA 3UR7A 3AROA 4JL2A 4PTMA 2FH6A 2OWWA 3WBAA 2DSUA 4W87A 1E4IA 3O2LA 4CVWA 2X2YA 3MU7A 5D4YA 1PIGA 5E0FA 2B31A 2F61A 3ARRA 2ZUNA 2J7GA 1LL7A 7A3HA 3RMEA 1JZ7A 5HNNA 2YOCA 1NWRA 2G8ZA 1V6YA 2DDXA 1V6VA 4PSRA 4D6GA 3BAYA 3WQWA 4U33A 4W5ZA 5EFFA 2CNCA 2OYMA 3OG2A 3L4WA 3NYDA 3AHTA 5E6ZA 1UHVA 2FHBA 2WNWA 1E6PA 3A4XA 1KGUA 2OYKA 4UQDA 4HTYA 3OGVA 4V2XA 3ZSTA 2NT1A 4TTUA 1B90A 3SCRA 3CPUA 3WNOA 3S6TA 4B3KA 4TX8A 1VFUA 1MFUA 2EPKX 3AMKA 4MDPA 3RCNA 2A3BA 3ZT7A 3AMLA 3CZGA 4CN4A 2CBIA 1XC6A 1QPKA 5EBAA 1I1XA 1HL9A 4JIEA 3N17A 3RJYA 2V38A 1H4PA 1UR4A 4R27A 2DQXA 3THCA 4WLCA 2A3HA 1NM9A 1KGXA 2J7BA 3VGHA 1ZBKA 1A3HA 1UR8A 1WDPA 3U5UA 3CHCA 1JI2A 3BAXA 1UWIA 2GDVA 3ZR5A 2BS9A 1DWAM 3ARVA 1KCKA 2WVUA 1WZKA 1GOQA 3HJEA 3SUUA 1LF1A 4H8UA 1H5VA 1HIZA 4D6CA 2XFYA 1E55A 1K9FA 3OLDA 2RGMA 3VKKA 4D72A 5AY7A 1WDRA 3F4VA 3KL5A 2WSPA 1H0IA 3SIMA 5F7UA 1OIMA 2CBJA 1NARA 4AD3A 5ABFB 4CU7A 3W29A 3WQ5A 4GZEA 1XRVA 4PCSA 1BG4A 2WHMA 5A6LA 4HMCA 1FH8A 2VZTA 2QMJA 5DEZA 1E3ZA 5IHRA 3W37A 1ODUA 4UZUA 1TVPA 3ALGA 2JIEA 2QV4A 4AZCA 3PTMA 4DWSB 5BXTA 3ARTA 2YJQA 3CZJA 1NP0A 1E9LA 3KE0A 1B3WA 3PZQA 3WL1A 2MANA 3ZJ7A 2D3NA 3WY1A 1MW0A 1WB0A 1QI0A 3UETA 1HNYA 1QW9A 3OLGA 3FN9A 1F4AA 4GQQA 1N82A 4XUYA 3CUIA 1OWQA 3WMBA 1DWHM 2D23A 5GNZA 2JF6A 3AIUA 4TXEA 1J10A 4OOUA 1EQCA 4W84A 3S2CA 3AQUA 2BY0A 1R7OA 1EO7A 1J18A 3VIGA 4EE9A 3WDPP 1KGWA 2WSKA 2XM2A 1EH9A 1XGZA 3WH5A 3N15A 2NT0A 1ISZA 3DYMA 1JAKA 4RE2A 1UOKA 3CMGA 3SUWA 2GUYA 4JKMA 1EOMA 1JD9A 5A8OA 1OINA 8A3HA 1HJSA 4W88A 1KXHA 2WYSA 1YHTA 3VUPA 2J7CA 3K1DA 4AZ5A 4E2OA 2VL4A 1HJWA 4LPCA 4V28A 4BCEA 2CBVA 3RO8A 1CIUA 1KXQA 3UESA 1XYZA 4MB4A 3NJ3A 5A6KA 3IAPA 3AICA 3ALFA
chains in the Genus database with same CATH superfamily
2DT2A 1M04A 1CYGA 4F2TA 1X8FA 4HYWA 2Z1VA 4HJWA 1D3GA 3W24A 3N12A 6CGTA 2VDGA 2XIJA 4KPLA 4JXCA 3B8TA 4C6LA 4LC6A 3VC5A 3W7RA 3G3DA 3NVTA 3OVRA 4Q4MA 4MYAA 1SO5A 1YDVA 2PWDA 4K7VA 4UQAA 1X6LA 4XD5A 3UCCA 4Z2LA 1UBSA 4P8WA 3A5VA 1KCXA 5JU6A 3O1NA 3QOKA 4DJFA 3IS4A 1FHLA 1W5MA 3NL5A 1S5VA 1NIUA 4FXJA 1E4NA 5FJPA 2FZBA 4MFDA 1VCFA 1NDWA 4N6EA 3QV6A 5BMWA 4IMFA 2WQDA 1FXPA 1R30A 4F0HA 4UTIA 1DVJA 2EG6A 1ISXA 1KFCA 1GVEA 4RKAA 3VAVA 1FA2A 1XRFA 1XYBA 3KAOA 3W83A 2J66A 4TIMA 4LUSA 4F2BA 1AL7A 3OQ8A 5GPRA 2YYUA 3GXNA 3QV7A 4E38A 3G8EA 4EXAA 5AC4A 1AD1A 5C2GA 4C6IA 5AVNA 3WQ4A 5CGMA 1XP3A 1KM5A 3EEGA 1A3XA 5C8BB 4DJED 3GYCA 4J3WA 1I1WA 4U4MA 4KH2A 3YPIA 3V5OA 1JZ6A 3NG3A 2YLLA 5SWUA 2B7NA 2Y8KA 2PLCA 4JFSA 1J2WA 3AIBA 2Z2AA 1PTGA 2QJHA 3VABA 4O15A 4WF7A 4ZENA 3RNDA 4CQBA 3EWUA 1M7OA 3HB9A 4F40A 5I00A 4NNCA 4F2UA 1EIXA 2JALA 4I7WA 4H01A 4WKAA 4XG1A 4YN5A 2NSOA 4AZCB 1TPWA 4D6EA 5AHEA 1A0EA 3ZFHA 1FFQA 2NV2A 4GXMA 1IT0A 1GW9A 2VEKA 3P6LA 1CGVA 3T8QA 1Z7AA 3HOJA 2UV8G 3TZNA 4UTKA 4JQ1A 4UMAA 3M0HA 4NZ3A 5EGRA 1C91A 4G8TA 1K9EA 3VM7A 1W5NA 1PBGA 3P62A 2GFTA 3WH7A 1WXJA 4D1IA 3UXAA 5M03A 1TWIA 3WNNA 3A13A 1AH0A 1E40A 1XCXA 2VCAA 1FY6A 1BSLA 5IFTA 2BHUA 1V5XA 2E8ZA 4JNZA 4M82A 2F6KA 4IQJA 2V9DA 5I03A 1Q7QA 1CB7B 4F0LA 3WEOA 4QG9A 3Q45A 2DSWA 5ECUA 2XZ9A 4NZ4A 5FKYA 1FWEC 3M4HA 3ENLA 4LBUA 4HYVA 1XIFA 4Q8NA 1RK6A 1VIWA 3IGXA 1W5QA 2VQUA 4H8VA 5IDZA 5CLTA 1UWTA 3BH4A 1VFHA 1XD0A 4W85A 1FWFC 1Z32X 5EYWA 1WCGA 2NX3A 4ZFCA 4AIEA 4ML4A 3WLKX 5J04A 1SW3A 1XLEA 1T96A 3ZT6A 1S39A 4C6FA 4GGBA 3R43A 2XFFA 1F3TA 4Z2JA 2Z28A 4L1WA 2AKZA 4XBJA 1J6PA 1GVIA 1Q8AA 3PC0A 4HP5A 2PDGA 3N14A 4GKTA 1O68A 1BFNA 2QNEA 1SM9A 3H23A 3OJGA 3WL0A 2IS7A 3EMCA 5HPOA 2ISVA 1P0DA 3URBA 4A2SA 4OE7A 4UFLA 4ACZA 1L0PA 4OFCA 1B3OA 4OBSA 4NNAA 3TJXA 5BW6A 3CL6A 2E4TA 1WBHA 4N9EA 3VOJA 1TUFA 1G7UA 4LC8A 2D0FA 4DY1A 1T41A 1CGXA 4QX4A 3UYCA 4KW2A 4XQ6A 6TAAA 2CYGA 1Z8AA 3W0KA 1BKSA 5DMNA 3M1ZA 3SSJA 3QTGA 4QDMA 2HE8A 4ASTA 3W2LA 1A4LA 3OA5A 4DBWA 2HXUA 3NFUA 1UR3M 2DZXA 4ATLA 1HJQA 3LHVA 1WDWA 1DJWA 3RRXA 2ZUUA 4C7FA 1TX0A 2AKMA 2E25A 2XGZA 2V3FA 1H0GA 2RJGA 3TONA 1JR1A 3KVMA 4LUYA 1XLGA 2G97A 3C2OA 2X2GA 3P60A 2OGYA 1E6ZA 3VPLA 3R10A 3F2BA 4L1XA 1RY0A 2PLJA 3P61A 1ZPTA 1PIIA 3CIVA 2Z24A 4EK7A 3W26A 3SW6A 1JZ8A 2Q6ZA 3VINA 3GDBA 4HA3A 3GG8A 1CLKA 3SJNA 1QPOA 3IK2A 3ONCA 1HL2A 3WLNA 2UY4A 1NFGA 5TAOA 2QCFA 3QSRA 4I6VA 2V5CA 4W86A 4MAZA 1Z89A 4ORMA 2QCMA 4B4HA 3ITTA 1BKHA 3L9CA 3CTTA 3R4IA 3HPZA 4XUGA 3TR9A 4JR5A 4CCZA 2B7QA 3AZSA 4CEUC 4FNPA 3CUJA 3W22A 3N2CA 1VHCA 1PCKA 4S3DA 4WDWA 4GUHA 2BXZA 3W7MA 3QZEA 3CL7A 3O6AA 1ME8A 1V3JA 3W6MA 5AFDA 3O0KA 3VXGA 4PFHA 1ZAIA 1X97A 3FKKA 4Z0SA 3MBDA 4PR4A 1FXQA 2WVSA 5BRBA 3VIOA 3PZMA 3BOXA 4IXXA 1ADDA 1FWGC 2ZRVA 3G1FA 3QGAC 1EF3A 2YXXA 2AAAA 4H04A 1V3IA 1ZBWA 1T7LA 2VX5A 4F66A 1K9TA 2PF8A 4QLJA 4BKNA 2QJIA 2YKKA 4U5IA 5GJMA 3T55A 2DIJA 3C0QA 5IFPA 3QMRA 1S46A 1W54A 4E4PA 3WQEA 1AJ2A 2WZEA 1EIBA 1LQAA 1ZGDA 1BYDA 1R3VA 2BNJA 4NAEB 4M3PA 3GDMA 1ONWA 2ZVRA 1CLVA 3DN5A 5DT7A 2GK1B 2X1UA 2LLEA 4Q22A 1E15A 3LRKA 2WM0A 5BRPA 2RUSA 2I17A 3LX9A 1Q6RA 4R5EA 3TYUA 4XB3A 4REQA 2QJGA 3EDKA 4Q6XA 1XDMA 2YFOA 4PN2A 4S3FA 2ZICA 3NXFA 3WLPA 1MQQA 3WJZA 1P0NA 4S3JA 2FTYA 2C1GA 4YXGA 4XZNX 1GEQA 4GLEA 5E0CA 2TYSA 1M41A 2VX6A 1EA0A 2GOUA 1LBFA 2B7PA 1PTDA 1IQ8A 4ZB0A 4B2DA 5HMFA 1VCVA 1B31A 1KBIA 4GQRA 4UXDA 3W82A 1CXKA 1WDQA 2ASHA 3I7QA 1N8FA 2V3GA 4AWSA 3CQIA 4J2PA 2PZNA 4RPQA 3WNPA 4L6DA 5PTDA 4RZ6A 3G1AA 1OFBA 1ZLPA 1OF6A 2VZSA 3FYPA 1HKJA 2ZIDA 2HZGA 4ZE4A 2NZLA 1S2TA 3R12A 2GOKA 1GVRA 3NM1A 3ORWA 1XBZA 3W01A 1FDZA 2NXGA 3VCCA 3CTLA 1H09A 3FK4A 4L65A 5EMJA 3CUHA 2CU0A 1AW1A 4K6AA 4XZWA 3CZ8A 4C1LA 5LKYA 2X7VA 2A3EA 3PBMA 1G9HA 2DY3A 1QNPA 4AIUA 4YYFA 1JQXA 3RM8A 5LXXA 5F1UA 5HAOA 1US0A 4IG2B 3QMTA 4M29A 1NQ6A 4I9AA 2WKJA 3BWWA 3QC0A 4LAUA 2P0OA 1YX1A 3H22A 3LUTA 3S8HA 5DO8A 3PAJA 1TV8A 5I3JA 2Y1HA 1O94A 3T0DA 3HV8A 3FKRA 4HZ8A 4YNGA 2O4QA 2DEPA 1K03A 3B4YA 2FZMA 1JGIA 3NSMA 1P4CA 3HV9A 2VFIA 4RW5A 1L2QA 1OFDA 2J9XA 2NQ9A 4JD4A 4A8LA 3L23A 4RDZA 1NFBA 1JEZA 1ZJIA 1AJ0A 3P84A 4WUIA 3QGVA 3NQGA 3RLVA 4XVEA 4HU3A 4H7VA 4GHRA 2Y70A 2FDMA 3UR2A 3TE9A 4MSSA 4ZO9A 4JTIA 4BF9A 1J4EA 1R3QA 4UOQA 3APGA 2L5HA 2EJ1A 3LQGA 4O16A 5FJRA 3VVGA 2QIWA 1VBUA 4LVFA 4Z1YA 1PKYA 4UTWC 1JL8A 1ZALA 2OZ3A 3ABZA 1ODZA 3JVAA 1RPKA 3WLOA 1JULA 4ORIA 4JGDA 4B15A 4D8LA 3G1VA 4PTNA 3APTA 3M0KA 2J13A 2PGRA 3WUEA 3P8IA 4KF1A 4KCUA 2QEZA 3GAYA 4Y9PA 4O4VA 1W9UA 4ZTXA 1K8ZA 3QZ6A 9RUBA 3B97A 3TTSA 5FAGA 1WP6A 3MQTA 1XLKA 2V82A 2ANUA 3MV01 2YR1A 3W00A 1GTEA 1LBLA 1E1CB 1EF2A 2V30A 3HGRA 2E5BA 6ENLA 3QM3A 3CU2A 1H61A 4P61A 3PPCA 1FWBC 3PSVA 3GSMA 3BANA 2JKPA 1HKIA 5HJLA 2J4GA 1RQEA 3OLEA 5I3KA 2OX4A 3CL8A 2BG5A 3KCJA 4KMQA 1LJYA 4YTSA 3PJWA 2D3LA 1QBAA 2PWGA 1LQ0A 3B0VC 3MHFA 5DX7A 4E8CA 4PUMA 5DQPA 2B81A 3IARA 1NWUA 1MRQA 2VJXA 4ERAA 5M2FX 2BXYA 4KQNA 1EX1A 2XSBA 1OVDA 4CNSA 2YL5A 4H9YA 4OJYA 1L6SA 5XIAA 5HATA 4XIMA 4IFKA 1UJQA 3CYJA 4AFYA 4PMZA 1SFSA 4TO8A 4M7SA 1H7WA 1D2KA 1J2BA 4MOZA 3QR1A 3KWXA 3G1RA 3VGGA 1L6WA 3WD2A 3WG6A 4MVAA 3MZ2A 1JG9A 3FY1A 1HP4A 1UBPC 4DELA 3N18A 1DORA 3W7LA 2J75A 3GVWA 4MKNA 1HVXA 1AZ1A 4MLRA 5HULA 3RO6A 1ZJHA 3W6LA 2ZZ3A 1E6RA 3PPHA 3NEVA 4AEOA 4GZ7A 4PFMA 4JBRA 2ZKMX 4CD4A 4CN1A 4JAWA 4MNKA 4KWVA 4GVFA 1WOBA 3AMGA 4Y96A 1KO0A 2GGIA 2NW0A 3M64A 4IP5A 2JIWA 4UFIA 3D6NA 4LS0A 3KLKA 2VURA 3MI2A 3W70A 1EUNA 1MVYA 3HFTA 2O56A 3OW1A 3VGEA 2BOGX 2JF7A 3MY9A 3K4AA 2CZDA 3WDIA 3W1PA 1X39A 2XGIA 2TAAA 3LGGA 4OT7A 2WANA 5GQBA 1LUCB 4AC7C 4H9TA 4GIRA 1CZ1A 2CXGA 2ACRA 2DIKA 2QCHA 4DUXA 1XV8A 1UIOA 2IKGA 3MT1A 3S4TA 4LS2A 4JQ3A 4G5DA 1KXVA 5JQ9A 2WPBA 1VD6A 2YA2A 3QW4B 1TPFA 2PD5A 4INFA 1QPQA 1XQKA 1YDYA 3MTWA 1FH7A 1ZENA 2OR2A 2J9YA 1KV8A 3W81A 3E96A 1RALA 1K8XA 4M0XA 5H2ZA 3PJXA 3GH5A 3VOCA 1PS9A 4RDVA 3T0AA 4G1NA 2Z00A 4B3ZA 3OVPA 1CXLA 3LS9A 3PTQA 1KRAC 2YCEA 5T26A 3V4BA 4XSMA 2ZX9A 3GYEA 5XINA 3MI3A 1JVNA 5FEZA 3R5EA 3CWHA 1LQ2A 3PULA 4RNJA 2CLHA 4P7LA 2CZ5A 2DW7A 1CXEA 3C8NA 1XFCA 7ODCA 3DFSA 2YCJA 4M80A 1LWHA 3MWAA 4W8AA 3EB4A 2PDHA 4L6OA 5CSRA 1XYMA 3ABXA 3TAOA 5CSUA 3FYOA 4CUCA 4ZOEA 3VNYA 2FFIA 4DM2A 1TV4A 3RCMA 1WE5A 2E9BA 3BW3A 3EX1A 2WAGA 1BLIA 3KBMA 1HT6A 2PCEA 3VDHA 2GJXA 4UNKA 3U8GA 2DGAA 5D2XA 5IM51 1FH9A 1OFEA 1PO9A 3AS2A 1CW2A 2NX9A 4O10A 4H9UA 3LV5A 4JIHA 4CD5A 1W9DM 1HF6A 3BMXA 1OC5A 3L5LA 3LGDA 1V6WA 3C3UA 1L6FA 2D73A 4ZEPA 5FACA 3UFYA 3UPMA 1GOKA 1GJUA 1WA3A 2DSKA 1OX5A 5A8GA 3IWPA 2PGWA 1SZNA 4FP1A 2J24A 4HZ6A 3TLQA 4Y8FA 5AC8A 1F76A 1UPMB 3UJ2A 4QDWA 1WZLA 2DH2A 3L5AA 1KBJA 3VNZA 4HPGA 4GUFA 1ME9A 2Z6JA 3W7IA 3IJDA 3N6HA 1QHZA 2QUMA 5CCZA 1GONA 1Z9AA 3UWQA 1PYFA 2E40A 3QR3A 4S38A 4DLFA 3LQLA 4CCDA 4QG6A 1KD0A 2JGYA 4GNKB 3DZ1A 1KWGA 1F9CA 3MW7A 1F2JA 2ZWYA 3LPPA 3GNXA 4CD7A 3NIYA 3PBUA 4GH1A 4F0RA 3WLHA 1EXBA 2JFEX 4FX7A 3U2OA 3H2CA 4W8LA 1KRCC 1GVOA 1EZWA 5KZEA 1NJJA 1F73A 2XFRA 5JIPA 3A6OA 1C8XA 4NRRA 2XDFA 4A3YA 1TA3A 2C8NA 1ME7A 2PDKA 3LV6A 1OQFA 4FX6M 1WUFA 3NZQA 3WF3A 4B4FA 3VNKA 3S2MA 3VIPA 3PZVA 3WNLA 2QCGA 3A4AA 4RZ5A 1JPHA 3E74A 1BSIA 3AUJA 3ZR6A 2V2DA 3MHGA 2V5KA 3KDNA 2DZSA 2WVVA 2VI0A 4O28A 3LN3A 3NGFA 4D6JA 5J5RA 1J9YA 1OZQA 1SO3A 2DZAA 2O92A 2IQTA 3GNRA 3T0BA 3SZ8A 4Z1AA 5A8MA 1XDLA 2YB1A 3RF9A 2PU0A 3W7KA 2WCSA 5ECVA 1FWTA 2DJLA 4C6JA 1HXJA 1JZ2A 1MRAA 5BXPA 3DH7A 5CAKA 4NP7A 3TR2A 1XLCA 2O9PA 5CPQA 3W25A 3BLEA 4N0RA 1E73M 4EF8A 5D33A 3MS8A 3AYSA 1H50A 1QWKA 3ABSA 3MKCA 2ZUWA 4GY7A 2VVSA 1LLZA 2X05A 2A7NA 4GC4A 4IX2A 4DHGA 4HPHA 4A05A 1BWKA 3LY0A 2PDBA 3R11A 6ALDA 2WWDA 4YYCA 4LV9A 3N1AA 3DDMA 2QMKA 2UY2A 4LS1A 3IVTA 4GQGA 2W27A 1JZ4A 3PZTA 1TMQA 3I6RA 1VHNA 2DORA 2QPUA 1IWPA 1DIOA 1VAHA 3GVRA 4OUEA 1JYVA 1RLDA 1Q2RA 3TDFA 1RD6A 1N8IA 1W1ZA 1DWIM 1QFEA 1MZRA 2Y24A 1A0CA 2WB5A 3K2GA 1ICPA 4X9SA 1ZQ5A 4PZVA 3KP1A 5F4WA 5DXYA 2I5QA 4IX0A 4MKVA 4A2RA 1I60A 2D2OA 5F2IA 3ECQA 2H9AA 3BGJA 5G4EA 3WH8A 2VFGA 3ZO9A 3VGDA 3A4WA 5FD0A 4GUIA 1V6XA 1G7VA 3WKZA 4U2ZA 4MNLA 3RR4A 2NUYA 1W91A 4H00A 5K9DA 4WSKA 1P0EA 2QAFA 3CAWA 4HHLA 4L4PA 3DBNA 2PU1A 1BHGA 4I6KA 4PMDA 4TX9A 3MO7A 3R58A 4O1FA 5E9XA 3GU2A 2WNQA 3E5PA 4XV0A 1EJUC 4NG3A 1PX3A 1XGDA 1YPXA 1BTCA 1SFLA 3QYSA 2W4XA 5C9RA 4C6EA 4AWEA 1X7IA 3W23A 2E6AA 5GNXA 4AY7A 3A22A 4XTIA 1TCDA 4TVDA 4N4PA 3KOXA 2WJZA 4RNFA 1GT8A 5TNVA 3EA3A 4G6CA 1MFVA 2X7WA 3MP3A 1UKPA 3STCA 1FBAA 4EPDC 2NXHA 4S2BA 1NTHA 2Z7KA 1IGWA 4KGLA 1V3LA 4R88A 3W87A 2PGFA 4GISA 3OHMB 1VPXA 3G0XA 1UR1A 4TQTA 1E1FA 4DXKA 4V15A 1UD3A 1ADSA 2RDXA 2YCLB 4UTMA 1RR2A 3K8MA 1FWIC 4NNBA 2JQXA 3H7UA 1J0JA 4TU1A 3SN1A 5K3VA 3FLUA 3FEQA 4H9XA 3EPMA 3K8KA 3VILA 4KRUA 4QJ3B 1OX6A 4WGXA 4BI5A 4IISA 4EX4A 4GO9A 1MXDA 3GX9A 4Q4OA 2EJAA 1TYGA 3EYPA 4IGSA 4UFKA 5REQB 5C7HA 1UOZA 3KX6A 4LNCA 1EKOA 1GUVA 1E9ZB 3GW3A 1UZ4A 4DUVA 5FEPA 2DUAA 1V0NA 4UOJA 3IGHX 1XYLA 4FNUA 4XAGA 3GHRA 2A0NA 1I2QA 1M65A 3O0FA 2GSEA 4I5XA 5IBXC 1UD8A 1UROA 3DHUA 4FXRA 5B7ZA 4NJGA 5DMYA 1PKNA 3GHSA 3P67A 2WZIA 4E2BA 3EKLA 4B5TA 4M81A 1IEVA 1E0VA 5CZKA 3HPXA 1UH3A 2W5FA 4XKYA 5FL1A 4DWDA 4LH8A 1BQGA 3VNJA 4A8RA 2PDQA 1UH4A 1UWUA 2W9MA 4OQVA 3DC8A 1JDDA 2CW6A 4GJJA 4Q8WA 1HO4A 2C0AA 3VUSA 4Z2IA 3VE9A 5IHSA 3C5QA 5DF0A 4ATDA 3RXZA 4GWEA 2XH0A 1UA3A 5M1TA 2Z27A 3ZJ8A 4L6HA 2OVLA 4I5RA 2ON3A 1E5JA 3UR7A 1OG0A 4JL2A 4PTMA 3WBAA 2DSUA 4W87A 4JQ4A 3SFWA 2X2YA 5D4YA 2B31A 2F61A 1RJQA 2ZUNA 2VP8A 1OYAA 5KITA 4KWWA 7A3HA 5HNNA 3WBXA 1NWRA 1V6YA 1EGVA 3T0CA 4U33A 2PEVA 3P93A 2OYMA 2Y7DA 3OG2A 3L4WA 1AMKA 3BL3A 3AHTA 5E6ZA 4ALDA 1TJ1A 2FHBA 2Z6IA 1E6PA 5FA5A 2F2KA 3ITXA 4V2XA 3ZSTA 4QGCA 4FNQA 3SCRA 3WNOA 2V81A 3K13A 4B3KA 1PSCA 1VFUA 3LBMA 4MY8A 1X1ZA 2ZTJA 3QVQA 1PV8A 3ZT7A 4A21A 1GGOA 4AX7A 2CHRA 4AF0B 2A7RA 3ELFA 4LANA 5EBAA 1UZHA 1HL9A 1U5HA 4X63A 1H4PA 4R27A 3P0WA 1KGXA 5CBJA 1A3HA 4NJHA 1TJRA 3BAXA 3CHCA 1YLVA 2Z26A 5CPNA 5D02A 4B5VA 1VRDA 3ARVA 2QPXA 1SGJA 1UASA 3KVKA 3W88A 1YXDA 3W1NA 1U83A 2FTPA 3S5YA 4FOKA 4GX8A 1E55A 5LNUA 1RQBA 2WSPA 2DP3A 2CBJA 2EPHA 4Q8TA 3TKFA 1Z3NA 1YPFA 2D2HA 4CU7A 3WQGA 4GZEA 2VC7A 4UCGA 4PRTA 4PCSA 3BO9A 2WHMA 3M0VA 5A6LA 2GLKA 4JTHA 1FH8A 2VZTA 2QMJA 3IJLA 1E3ZA 2NQLA 4UZUA 3DU0A 2QV4A 5AZ0A 4AZCA 1DE6A 3WLTA 3PWGA 3QF0A 3IRDA 2RDUA 1JCTA 3TJ4A 3F03K 1UP2A 1E9LA 3KE0A 1Y8BA 1E9IA 1B5TA 4QRNA 3HG4A 2CLMA 2FIQA 2D3NA 1I0DA 1TTQA 2OQHA 1N82A 3JZUA 2Z1XA 3CUIA 1OWQA 3STFA 1MDLA 2FYMA 3AIUA 1EQCA 2ACQA 4Y2WA 4Q6JA 1WUEA 4QROA 1XG3A 3ABQA 3PBWA 3W7CA 2OEKA 1EH9A 3WH5A 3S46A 2NT0A 3TC6A 3CMGA 2VGFA 2GUYA 3KBNA 3OVQA 4X2RA 4PRRA 1HJSA 3PSWA 4NX5A 3BTNA 4CLMA 4QJ4B 4W88A 4ENLA 2J7CA 3K1DA 4AZ5A 4I90A 4NAFA 1HJWA 3HG5A 2CBVA 3UJFA 1L6YA 1CIUA 2OU4A 1C29A 4EPBC 1R9XA 1KCZA 3H7VA 3GIPA 3IAPA 3O7UA 3ALFA 2ZYFA 4AAJA 3VZZA 4XD4A 2Z2UA 4PMJA 2VTFA 2YA0A 1QATA 2E09A 3VZYA 4UFMA 4HSNA 1RLCL 3C4UA 1MWOA 5HNUA 3N2BA 1R47A 3WUFA 4PH6A 3BSGA 5E1QA 3VGFA 2ACUA 3FYYA 2YBTA 5T9CE 3W38A 3EOLA 2CHOA 1HFBA 3OZPA 2G37A 4N2YA 2BOFX 4XZIA 2C16A 1JFHA 2FZDA 3IUDA 3DX5A 3PG9A 3B9EA 3U2CA 3NPUA 3GKAA 4PCFA 4WY0A 1GVYA 4N7QA 1XYFA 4HHPA 4KIRA 2X0HA 3UR5A 1X96A 5HNTA 2BVYA 5FI8A 1L6GA 1E0XA 4UWMA 2VC6A 1RVKA 3C3NA 2XVNA 4ZXOA 4M1RA 2GVEA 3FNDA 4J35A 1JGMA 3KRUA 1CENA 2R6OA 3LG3A 1AW2A 4DM1A 1J6OA 1SQ7A 4KETA 1W37A 3S42A 4R33A 1QPRA 4GD0A 1XUUA 4IPIA 1TPDA 1E56A 3GS6A 2D2GA 1V6UA 2DIEA 1G4SA 4Y9MA 4DQWA 3AI0A 4KEZA 3UNDA 3N9RA 4K8HA 4PUDA 5CC5A 5ABHA 1JYNA 4H8HA 5AOUA 3M6YA 2QV5A 1XD1A 5A1AA 3HQOA 3AHZA 1EGZA 1RSCA 1TPEA 2XH7A 3TH6A 2V5DA 4F9JA 2ZA3A 4JTGA 3M7WA 1MEWA 4BR1A 2CITA 3LTPA 3IJ8A 1R3YA 4LVGA 1QNQA 1V0KA 1TE6A 2AQVA 3M0YA 3LMZA 4PEKA 3AMDA 3RAOA 1KC7A 4IFOA 3QY7A 4D6DA 1YW1A 5LA1A 5TQLA 1GOOA 1PX4A 4LCSA 3S9ZA 3A9IA 4MAVA 3IIOA 4AD5A 1QASA 3RM4A 4PRWA 4LCRA 1EJWC 1Y5XA 3EWWA 3VNLA 4HQVA 2VEPA 1EPVA 3GTFA 4HN4A 1G69A 3SUSA 3WX7A 3T8LA 2D0HA 3ARQA 1UWQA 2MUCA 2PZ0A 3G18A 2ESCA 1CECA 4X0VA 4BQ2A 1JPDX 2YX0A 1E5NA 4F8XA 4YIWA 1QR7A 5LA0A 2XZ7A 1E43A 1KFKA 8TIMA 1UKTA 1IEQA 2FHCA 4O18A 1UQYA 1REQA 3E0WA 1V08A 3N4EA 1W1YA 2XSXA 2ISSA 1R3RA 1J79A 5GJNA 4YHEA 4WRHA 1C8QA 1Y7VA 1ZB5A 9CGTA 5LIXX 4UTUA 4NAEA 2X0SA 3GQYA 1AA1B 1YNPA 1GZ1A 5HQEA 3A12A 2GK1A 1L8NA 1YNYA 2IQDA 2RDTA 1CCWB 1FOBA 3DG3A 3O16A 3R25A 4LU0A 4IPNB 1BWVA 2J8FA 5BCAA 2VEMA 3TYEA 1P6WA 1ZBVA 1BGAA 4QEHA 2W63A 3N2TA 1Q8JA 2OFJA 3R0UA 2PB1A 3WFZA 3I4KA 5KTLA 3VKAA 2IPWA 3WF4A 4DBUA 2REQB 5FJJA 3LHTA 3WQFA 1IZKA 4N9CA 4M8UA 5CPTA 1J5SA 3CQJA 2PS2A 1UC5A 1DKWA 1JNDA 1ZNNA 3DKLA 3W07A 4LUTB 1D7KA 3SM0A 3PPFA 4A29A 1JF5A 1CDGA 4DBSA 2DPEA 1I45A 1VPQA 4PUNA 5I0DA 3HO8A 5D9OA 1TELA 3TA6A 1XSJA 3KTXA 3QSTA 2GGJA 2QCEA 4PMQA 3F1QA 3DUGA 3RIKA 1PDYA 3SFKA 3MA8A 3R94A 3NUKA 1ZAJA 4LQ1A 1RA5A 1DTUA 2NV9A 3KCLA 1UQZA 1XWYA 1TZ7A 2BSLA 2PTXA 4YCPA 1PZ0A 1SPQA 3WK3A 1WX0A 3NPWA 3DFYA 3W6YA 2CZEA 3C86A 4M5PA 2XIOA 1XCFA 2QDEA 2C1IA 1N8WA 3SCSA 1X8CA 2FHFA 4L9XA 3WF2A 3LNPA 5KINA 3VIFA 1A53A 3QMSA 4QSFA 4HMEA 3QOMA 1TPVA 2J8GA 3HMJG 3VCNA 4O50A 2WMHA 3BAJA 1C8VA 3SJ3A 4IG2A 4XD3A 4QJ1A 3L66A 4C5YA 2HXTA 1HX0A 4DWSC 4ROQA 4JY9A 1XLIA 4ERIA 4B5XA 2OJPA 2CZFA 2Z25A 1XF0A 4ZE5A 4Z1BA 3IJ9A 3EPOA 3UT0A 2GQAA 3MO4A 2YB4A 3QLLA 4I9TA 1PVNA 4DI8A 3JZEA 2GQ8A 3IV8A 2YIHA 3VNMA 2DT1A 3HQPA 4R9OA 3DC0A 3HN3A 1M7XA 4JTDA 5A6BA 4K39A 3R13A 4XIAA 2WHKA 2NX1A 4X9YA 2OXNA 5I23A 2WK2A 5A5WA 2PBOA 2FJKA 3GHTA 3KRSA 4LBRA 3VA8A 3M9YA 4V27A 3DHPA 3FJLA 3CPRA 4M51A 1L9WA 4K38A 1KFEA 4DO7A 4QITA 1AH4A 2E9LA 4F48A 4EIVA 4EAYA 2UY3A 4MNMA 1DIEA 2YZRA 1P6BA 3RPMA 2C79A 3BUVA 2ISWA 3MHUA 2X40A 3CV7A 3R8GA 4IJBA 1V7YA 5FF4A 2EAWA 5A2AA 2CCRA 3C2VA 4BQ4A 3AZRA 3UXKA 1JCYA 3VU2A 5HJYA 4I8YA 3T2QA 1MZHA 1GJPA 1MXSA 1C7SA 3ANYA 5G1YA 1L8PA 4JTFA 2HDJA 4AH7A 2EPNA 2O0TA 1GG0A 5EMMA 2YYTA 3L0NA 3ARPA 2BOEX 1IZCA 2E6YA 2F84A 3ZSSA 1K6WA 2A3LA 4WR3A 5GJPA 3IJIA 5JXQA 3DAQA 4JQAA 1GOMA 1MW2A 4GOAA 1F6KA 1JCLA 5J5DA 4QR6A 1KM6A 3VO0A 1ZHAA 2IPGA 4C6DA 1CXFA 3M46A 4BS0A 2AQWA 5GNYA 3EWXA 2J7EA 4DZIA 3GBDA 3Q37A 2TRSA 4DAIA 1KQYA 3MUZ1 1NOUA 5IRPA 1UZ1A 1WXZA 4QS6A 3LNMA 2CLEA 2BY3A 1SR9A 3K46A 3ZM8A 4JEQA 3TAKA 3HPFA 4JTEA 3VOFA 4JICA 2A79A 5A8PA 1C3FA 5DCBA 2JEPA 3APYA 3VK5A 4WY0F 1TTJA 1NOFA 5AC6A 1J93A 2QYGA 3H54A 1LG2A 3TYDA 4PTWA 3WJYA 4HVXA 4LRSA 4UZSA 2YBUA 2GJRA 4PUWA 2D24A 3I3EA 4M1BA 4TR9A 3CLMA 2V6AA 1C9DA 2Y5JA 1PE1A 3T44A 1QHOA 3FGCB 3PZ9A 1Q63A 1TV3A 4JTSA 3RG6A 3TN5A 3W3OA 3A5FA 4QCEA 2I9UA 3TXVA 1UUOA 1WYIA 2FZ9A 5G4HC 3O63A 1TREA 2DSVA 4HNLA 2POTA 4GX9A 3S5ZA 1W1VA 4AYSA 2XN0A 4B91A 2KAUC 9XIAA 3NL3A 3SCTA 1EYEA 5CJMA 5EMUA 5AC5A 1TX2A 1VGAA 4ZOCA 1ZFJA 4RZ4A 3BARA 4JDBA 3L4TA 3MBFA 4L64A 2D1ZA 5EA9A 2I7GA 4U31A 4HU4A 4WVXA 4AD1A 4HNNA 1SFTA 3D46A 4F79A 1B9BA 2RHGA 3GHUA 3W74A 2W79A 3T81A 4H83A 3BK0A 4PB5A 5FSEC 3RPTA 2G50A 2O7SA 4IQEA 1AW5A 1SSGA 3L4VA 4UR7A 3OB8A 1ELSA 3C6CA 4JNMA 5CH9A 1K7FA 4U2YA 5D09A 3WCZA 5I2UA 1W1IE 2C14A 5TF0A 3ARUA 4C90A 1W17A 3EDEA 3UXIA 3WNKA 4QAIA 3FA3A 3L4XA 4NRSA 3OPSA 3MCNA 1DIKA 1OZMA 3O6YX 1JUBA 3RLHA 4W89A 1VEOA 3BW4A 3GAKA 3MSDA 2X16A 2ZOXA 3IAQA 1Z44A 1F4HA 1QOPA 4DWSD 3RX4A 2INEA 4I8DA 1S2CA 2V2CA 4DAFA 1EJTC 2C15A 1AL8A 1H3GA 1V0MA 2V0TA 4PODA 2G5WA 1VJIA 2NQHA 2VYOA 2Y8VA 5HPCA 3RU8X 4GUJA 2CIPA 2ZZ2A 4HGXA 5G2IA 3N2OA 3CWNA 3SR7A 4G7FA 4NUWA 3ES7A 2DZVA 2INFA 3C0JA 4S1FA 3L67A 5HINA 3P14A 1LG1A 4KKXA 3UA4A 1FWAC 2ZE3A 3L0GA 2D2JA 1UW9A 1FKXA 3AZTA 2QCDB 4O57A 2HBVA 4L4OA 1DPMA 2ZXQA 5E09A 3II1A 4GABA 3P5YA 3BZGA 3AYVA 1ZJAA 3E02A 3GNOA 2VR2A 1R2SA 3CUFA 4M6QA 2JE8A 4P8UA 1SJBA 3SCWA 2VT0A 3H2OA 5CZSA 3C0SA 4IMAA 3N9KA 1T6MA 4XX6A 1R3TA 5DBTA 4IL2A 4IPLA 2DH3A 3WEMA 2H8ZA 4C7DA 1TTPA 2QGHA 1MEHA 3T4WA 4DF0A 2XVKA 3NQ8A 2DVUA 1ZL1A 3VMOA 4Q32A 1QTWA 2GVJA 1C93A 4TTGA 4FS9A 1E0WA 3W4RA 3OODA 2G3NA 2EHHA 3BLKA 4GZIA 4R3UA 3LI0A 3HIJA 3AO0A 1E6XM 4AVFA 4JTTA 3LXAA 3NDYA 4DZAA 1TCMA 2IPFA 1KBBA 4DUWA 4DXXA 4JY8A 4BEQA 2BY1A 4GH3A 1MI3A 1EXPA 1J96A 4KT2A 1SYTA 3FEMA 1GOWA 1OYBA 2NV1A 4JOMA 4XO6A 4JFTA 2ZUMA 1UIPA 4DJEA 2QJJA 4IIBA 2DUZA 5HMSA 4HIBA 1R9YA 2VCCA 3T4CA 3LHUA 3N11A 1X7FA 3WN6A 5E9AA 1W9PA 3HGJA 3IVUA 4BY3A 1JRBA 5H6HA 4LY4A 5K4XA 3WJXA 3AS1A 1W3HA 4O12A 3G77A 2CEQA 3W7PA 4Q7IA 3BURA 3H21A 2BV9A 4DB7A 2Z29A 4GA8A 3WD4A 3W28A 1IWBA 3GH7A 4JTQA 7XIMA 1HTIA 2PI6A 3OBEA 1HKKA 1V3MA 1OY0A 2IMRA 3QFWA 5LIKX 1CPUA 5BOEA 3KEHA 4P2VA 3EX6A 4Q4QA 3NOEA 2D0GA 4N42A 2F38A 3TN4A 3B06A 3WJWA 3IJ7A 1HGWA 4MB3A 2DT0A 3T6CA 2CLIA 3G5EA 3P8JA 4JKLA 4A3RA 2R8WA 1D7FA 2WC4A 2ODOA 4ES4A 3RHGA 4H2HA 4GI4A 3SY8A 5K2ZA 2FKPA 1M7JA 1J11A 1NVMA 4UTJA 2C7FA 2HNEA 4LB3A 5EPDA 3TIMA 1XLFA 1OT2A 1UCWA 4JS3A 5CG0A 4Z08A 1VPYA 2PWFA 2FZ8A 2ZXBA 2UZ9A 4UTHA 4KGJA 1CWYA 1S5MA 3IRSA 2Y7GA 4Z42C 1V77A 1G4EA 4S3CA 3CEUA 1BYBA 2ZX5A 3P5ZA 4IGMA 1GPWA 2J62A 3S47A 3CLWA 2HNHA 3LLDA 1FCUA 2PPGA 3LTSA 4Q7BA 4UFHA 2QAPA 1A49A 1KKOA 4R7WA 3CJPA 4PMUA 1FHDA 3F4NA 1XLMA 4UR9A 4DJEC 2XUCA 2CLPA 3Q58A 1KBLA 1XX1A 3AHVA 3KBWA 1G67A 2OSXA 1CEOA 2XIMA 3IUIA 4O1BA 2ZRWA 5IXEA 5F4XA 4XTDA 3IJQA 2VC9A 3AIWA 5CQ1A 3A47A 1I4NA 2AAMA 2W61A 3WD3A 3NQEA 3R79A 1PZ1A 4O1EA 4GINA 5I79A 3ZR4A 4E5TA 4CKQA 4OECA 5HNRA 3G3MA 3S9IA 3F5KA 1E71M 3VYLA 1RXOB 1EDGA 1XDJA 2QJNA 3VIMA 3ZVHB 3W53A 3B0YA 3TQVA 1RVGA 3GBEA 2VWSA 3WQVA 2EKGA 4FNRA 1ZJBA 3GUWA 2GJPA 3KZSA 3QXBA 3RX2A 4LWWA 4IHCA 1YTDA 1ENUA 2Y7FA 2AGTA 3A3WA 3O07A 1OX4B 4QSHA 1VZWA 3COTA 3SRKA 2J27A 1XS2A 1UMYA 3CS2A 5EY5A 3OYXA 1KTNA 3GZ3A 1RCOB 5FOOA 4YTQA 2OELA 1XLAA 2PDFA 1J5TA 3E3HA 4FLQA 2OCZA 3BCFA 7TIMA 1PL9A 1JZ5A 2V2HA 1NAL1 1XIJA 2E5DA 2VZVA 4WOZA 4JN7A 5H1WA 3GW0A 2XWDA 4DEFA 2XWEA 2ZRXA 1Q6QA 3WH6A 1HO1A 3OTRA 1MW1A 1H41A 1O7AA 2P3ZA 3LB0A 3OYZA 2DSZA 3QBUA 3B9AA 3AXHA 3L68A 1H5YA 3W1RA 2ZX6A 3ABOA 1AG1O 4LTSA 4DJDC 2VELA 3WD0A 1IV8A 1TE1A 1WDDA 1PHWA 3NSXA 2QS8A 3KOWA 3T2OA 2Q8XA 1XLJA 1GWJA 3DXIA 3VIIA 2EG8A 4HTBA 2V8ZA 1LL6A 2WJDA 1EQPA 4NF7A 1G6CA 1BG9A 3K30A 5F2LA 4GIAA 5FJOA 5BROA 2X41A 4D8ZA 4IP4A 4WXYA 3FA5A 2ZWZA 1NDYA 3LBCA 2YCLA 1DHPA 3BICA 4G9PA 3MUIA 2VDHA 4TOQA 4MWAD 1GVQA 5HA7A 1VFMA 1AJZA 4OUIA 3ARSA 3PWAA 4I9MA 4S3BA 1TKKA 1QOXA 1BRLA 1VYRA 4L4LA 3U9IA 5AYIA 2HVOA 1SJAA 3AHYA 3E38A 3GIQA 1QCWA 1MQRA 3BSMA 3WLMA 4FNSA 1LT7A 3QV8A 3BOLA 3RR1A 4EPEC 2Q8ZA 4JZ5A 5FAJA 5EMKA 1FKWA 5REQA 4F0MA 3CAVA 3SSZA 1WBJA 2ZUVA 1KR1A 2WXDM 2YDRA 3WBEA 4QM1A 5I7GA 1RK5A 3TP4A 8XIAA 3FHAA 1XLBA 3VCRA 1KCLA 4H9VA 4DUOA 2E7FA 5E0KA 4OOZA 1ZU8A 5A2BA 3CIXA 5CC3A 3THDA 1UWSA 4KS0A 3CMJA 1TB3A 4WIWA 3D3FA 3KVJA 1X6UA 2XGBA 3V1HA 3CEPA 3NAVA 2PURA 1EJ7L 2GYIA 3TK7A 2FPTA 4GCAA 3LCWA 4J3TA 2QZRA 2ZRUA 4AD0A 1SJDA 2G95A 4YTRA 5A6SA 4GFSA 1K3UA 2E1WA 2V5BA 1GQNA 3NQVA 1FWRA 2QLYA 3AC0A 4MKSA 2AOSA 4OVXA 1MSSA 2IW0A 4GK8A 3S1UA 3PUDA 1IR2A 2BFGA 2H8XA 1E6QM 5JUVA 2ISFA 3QHMA 1GVSA 3NURA 4ZL1A 4JYFA 4DPQA 3PB2A 2UWFA 5H8PA 4H9ZA 1M53A 1QPNA 3MP4A 1MYRA 5HK4A 3NZRA 3RK8A 4BA0A 1W9BM 3LA4A 3QPYA 6TIMA 4FK9A 5LZLA 2PWUA 1UWAA 5G4WA 1Q7MA 3AU2A 4WD0A 3W71A 1QT1A 1POKA 4C1NB 2CLOA 4A3QA 1ZAHA 3VIKA 4AF0A 4EWJA 3IVSA 2YSWA 3UZXA 2PDJA 4J5NA 2QDDA 4H6RA 3H8AA 4GY0A 1PPIA 1K4HA 5LGXA 1ZS2A 1SW0A 3BG9A 4LW7A 4WJEA 2F2HA 1EX5A 1TQXA 3OGSA 3CK5A 4HKPA 4EPKA 3PUOA 4C91A 3KBSA 3W1UA 3U4AA 2CC0A 4BJHA 3WELA 3SDOA 3N19B 5A6TC 4JYEA 4US5D 4IMDA 3CH0A 2XTKA 3AYTA 5BU9A 3W7EA 3K5XA 3PTDA 1X6NA 2YDQA 1US3A 3ITCA 2WZMA 1DWJM 1OG6A 2E9MA 3IGUA 1GKPA 2ZX7A 4Z17A 4ATWA 4OWGA 4LUJA 1U22A 1RA0A 3NQFA 1OD8A 4EANA 2P1FA 2HS6A 1YTEA 3D0CA 2Z1BA 4AZ7A 5DY2A 4DJDD 2QIIA 2IUZA 3Q4DA 1HKVA 1W1PA 2VZOA 1VFSA 2OQLA 1W3TA 5JIWA 4L9YA 1E6NA 4AYGA 3WLIA 1RP9A 5C9XA 1BWLA 2E5CA 3B8UA 4BI6A 2VKZG 3GWQA 1GPFA 1NF0A 4GKLA 2O55A 3FV9A 3BOFA 3TC7A 4YLWA 2VFEA 1VR6A 4E4FA 4PCTA 2HJPA 4K1GA 1QMLA 2CERA 3E5BA 1GQKA 3BZJA 4WGHA 1V0LA 3R8RA 3VIHA 4CCCA 3PN8A 3ICJA 1MEIA 4K36A 1P48A 4HOXA 4RUBA 3TYAA 2QKFA 3B0UX 4L56A 3ZJ6A 3NQ6A 2BDQA 1EEPA 4KFOA 3INPA 4K8EA 2YFNA 2BTMA 3BAKA 1OABA 3HPSA 1KW1A 1V02A 2VM8A 3BW2A 3H2FA 3DYPA 4A4AA 4NY2A 4HSHA 5HWMA 2OLSA 3N13A 1RUSA 3ABRA 3T2PA 1VFOA 2J25A 3I6TA 3BPWA 3VMNA 4JN6A 3H6OA 1VQTA 1E4IA 4CVWA 2KZHA 3MU7A 1PIGA 5E0FA 3GR4A 4DZHA 3WO8A 1SSDA 1XIGA 3PNZA 2J7GA 3W85A 1FX6A 3UF9A 3ANUA 2RJHA 2G8ZA 1QW7A 1W31A 2DDXA 2QF7A 5DN1A 5JH1A 4FOJA 4PSRA 4YVVA 5D37A 1N2VA 5DMLA 1BTMA 1S1RA 2P0IA 1K02A 1FVPA 2POZA 3CHVA 2TPSA 4GCXA 4UQDA 3O05A 1ZUAX 1Q6LA 1B90A 1DQXA 3S6TA 1WKEA 2Q3RA 4NJJA 3SQSA 2EPKX 3AMKA 3TU9A 4MDPA 1VCGA 1EC7A 2A3BA 4IOTA 3RCNA 1WAUA 3CZGA 3LERA 3G22A 4UR8A 3UBPC 1JUEA 1UR4A 1IR1A 3EB3A 3W7DA 1O5XA 3U4FA 3TYZA 1VBGA 1YRRA 2J7BA 3VGHA 4KFPA 1UR8A 3GDTA 5I06A 3HQ1A 3DI1A 3W7QA 2GDVA 2GJLA 3GK0A 3ZR5A 3SQMA 2BS9A 3IPWA 5IOBA 1TV5A 2C13A 1O12A 3EOUA 4MZ1A 1I9CB 4XZHA 3E9AA 1ICQA 4B5WA 3HJEA 4FB7A 3HPAA 1H5VA 3C61A 3SAZA 1HIZA 2J6VA 4XAZA 4XVDA 2PDWA 3H4GA 2QQ6A 5AHMA 3TSBA 1K9FA 3OLDA 3NA8A 4V1XA 3ANVA 5AY7A 1FWSA 4PB3A 3F4VA 3GFZA 4AUBA 1AH3A 3MKVA 3GKFA 4IFKB 3W02A 4DVOA 5F7UA 1C9WA 1QOQA 5ABFB 1I2RA 3WQ5A 3NOYA 4HN8A 1BVWA 3NM3A 4POCA 1XIMA 1O5KA 4FIRA 5DEZA 5IHRA 4DBEA 3HG3A 3HTWA 5LHEA 3QLDA 4CQ8A 3CWOX 2V63A 5I3GA 3GE7A 3JU2A 3MDUA 3V75A 2ISDA 4DWSB 1Y5VA 3ARTA 2YJQA 3CZJA 1XLDA 4FIQA 3SY5A 1V51A 1OHLA 2ZA1A 4QE5A 3CV2A 3NR0A 1OJXA 3WL1A 5C0QA 3WJSA 1M9HA 1MW0A 1OC6A 4O17A 1RCQA 3FN9A 3TC3A 4GQQA 4HNVA 2PDUA 1DWHM 2JF6A 3N29A 4OOUA 2DVTA 3CT2A 4GYJA 1R3SA 4YTUA 2BY0A 3P82A 1MNSA 5EU9A 1ZP4A 1T8XA 3FS2A 1BXBA 4HK7A 4ZA0A 2OEMA 1SZFA 2OZTA 3N15A 1NU5A 1UOKA 3BLLA 3DGBA 3OU8A 1EOMA 1JD9A 1IT7A 1OINA 8A3HA 4IQDA 4E2VA 1R6WA 1KXHA 3GVQA 3PUGA 4UTLA 4UTWA 5KETA 2FB2A 2QCCA 2OB3A 4FALA 1MUCA 2PD9A 2VL4A 3I10A 4BCEA 3XINA 1H63A 3EZ4A 3UESA 3N34A 1RPXA 4MB4A 2VGIA 2C19A 5H91A 1VH7A 4GG9A 2EKCA 4UB9A 1FCBA 4WJ8A 1MUMA 5L6UA 4LAKA 4LB4A 5A2CA 5C2CA 3MMWA 2RFGA 3C56A 4E8GA 3CHDA 1CTNA 1A5UA 1W2VA 1OIFA 1TG7A 2WM1A 4MJ2A 3SCOA 3V0UA 3TSMA 4FOUA 3M0LA 1V8EA 3RX3A 2REQA 3EOEA 2WQPA 3W2JA 4WSHA 3WFLA 2AMGA 2KX9A 4LY8A 3RLUA 4LUTA 5HMDA 3VNIA 2DZBA 3V35A 5RUBA 3VD9A 3URNA 1K1DA 3KDOA 1K7EA 1EZ2A 2VOTA 1EHNA 5FCZA 2GGEA 3G6MA 3WNMA 4S3KA 1JCXA 2A1YA 2ABBA 2WBKA 4ZQRA 2ZDSA 1VBJA 3G1XA 2OG9A 1A5LC 3UWEA 1XLHA 4ONVA 1N7KA 1SO6A 4MFEA 2QDGA 1XC4A 1WNOA 4QAWA 3IIXA 3GXIA 3U2ZA 3TN3A 4CCEA 4DX3A 4TV6A 2WMKA 5I77A 4CQDA 1TVNA 4AHPA 2C0HA 1EP3A 2GWNA 1J0YA 2PTDA 3OQEA 4IP7A 1SW7A 2YZ5A 5I6SA 4S2CA 1UD2A 1I75A 2J7FA 1QHPA 1PB0A 3VTRA 5D2TA 1IZJA 4IF2A 3UZYA 3A3HA 1Z48A 4C6KA 4DPPA 1FFRA 4HYRA 3K4WA 3ITLA 2JK2A 4A8IA 1BXNA 4NYUA 3EA2A 4R34A 4C6PA 4QLLA 4MZYA 4NU7A 1NELA 3O9NA 3UWZA 5CZ0A 1BEUA 5DFAA 5DXXA 1H7OA 2XN1A 2ZDRA 2QT3A 5CJNA 3WMCA 1RBOB 3EX2A 1OCQA 2NSXA 4ZR8A 3WQPA 1ISVA 3NQ2A 4ICMA 3N6QA 2OO6A 3VD7A 3V36A 1QDSA 3BMVA 2VC5A 3SUVA 2PBGA 3VDBA 2G3IA 4DI9A 1Q6DA 1LL4A 2GGGA 1GQLA 1PWMA 1LDCA 1OF8A 1BF2A 5FESA 2E1DA 5HWNA 3M5ZA 5HUOA 3GUGA 3H2MA 4UNIA 2F9RA 3STEA 1M03A 4XZLX 4D6HA 3LTYA 3F5JA 4LAZA 4L7ZA 2PAJA 5E70A 3PB0A 4AG0A 2PDYA 4FMVA 4J40A 2WLYA 4ECLA 3R89A 3KRZA 5EB8A 1B30A 3TJLA 1BQCA 3Q94A 5CG7A 2GL5A 2Y88A 3LM7A 1QBBA 1IGSA 1KRMA 2J78A 1F6YA 2NVDA 3TQ0A 2HISA 3VIJA 3ITYA 1TWDA 4HT3A 3QKEA 2A3CA 4LSBA 2X1SA 1TVLA 1W3KA 4NI8A 4UOZA 4Q4KA 3OEXA 3BXWA 3RYSA 2DZPA 2QJMA 1E0UA 2OWCA 3LRMA 1OM0A 1ML1A 3K8LA 1IHIA 1I6NA 1KM4A 3VDAA 4AC1X 3N4FA 1TPH1 4CU8A 3LM3A 2VRJA 1VFFA 2BWGA 3DESA 3ITOA 4Q7NA 1W5PA 4ZB2A 2Y6ZA 4MTVA 3S1XA 3WD1A 1P5BA 3QW3A 3POHA 4WOQA 3KS5A 3KTCA 3T08A 4CVUA 3BVJA 2NUWA 4NXSA 2W3ZA 5LA2A 1SUXA 4Z2HA 2VEGA 3TFCA 1GQIA 4F0KA 4ERGA 5LIYX 4FX8A 5CC6A 3ITGA 1J8VA 3TTQA 4PL2A 4KCVA 1HVQA 3N2XA 4YL2A 2ALRA 1W32A 2AQOA 3IIPA 5BMXA 1F3WA 2HVMA 3S2JA 2GQ3A 3WQ6A 4B92A 1SFJA 4D6FA 2OYLA 3FGCA 5CGQA 1XRTA 3CZLA 1O66A 4CNNA 5U7SA 3QC3A 3B8IA 2PTWA 1KNWA 3MMUA 4NZJA 3TTEA 4LYPA 3FSUA 3TFXA 3LCGA 4JCLA 2GVGA 4GO8A 4PUJA 1B0IA 1DJNA 2HPIA 1YBQB 1PWLA 2VXNA 1P0BA 2X09A 2F8QA 2XIQA 3DFHA 1V6TA 3LZ5A 1UR9A 3KHJA 2H9AB 2R82A 1A5MC 3ERPA 2EXOA 4W7UA 2GDQA 2C18A 1BAGA 4MADA 1RZMA 4RL3A 3F2CA 2B7OA 4F3HA 1VB9A 4MWAB 1XPYA 1PIFA 3N4AA 2Q09A 4OV4A 3EWZA 3WIJA 3AS0A 2PDLA 4GBUA 2IKJA 4QS5A 5FL0A 3PG8A 6A3HA 2RH9A 2FJUB 4KFNA 3UYIA 1D8CA 2ZADA 4GXWA 3UCDA 3QYQA 1XBVA 4W4QA 4AW7A 1DL3A 1NF7A 4IMEA 1TPUA 1P0KA 3CB8A 1W56A 4GPNA 3PF3A 3VD3A 1R8LA 2RDWA 1W3JA 2E68A 5CPSA 3FJ4A 5CPMA 1VBHA 1TSIA 4H41A 3LHWA 3UZZA 1F07A 4HB7A 3N2MA 4W7VA 1B3YA 3B0XA 1OC7A 4XZBA 2A6LA 1XSIA 5HR7A 5CBBA 1TTIA 4IICA 4P8XA 4L80A 4O1AA 1S2WA 4ZSTA 4HNOA 4HBKA 3U6WA 7ENLA 1IIGA 4ICCX 4MJMA 3EAUA 5DBUA 2XVPA 2BHYA 4FA3A 1AQHA 5AYYA 1FDJA 4HCDA 3RPDA 4MMWA 1R2TA 1FP8A 1R87A 3L4YA 1Q5MA 1KLYA 1LBMA 3T1GA 2NXIA 5A8NA 4N6FA 4MNJA 3RMJA 4J1OA 2BGSA 2WPGA 4EWND 1GZGA 1KFWA 3GVVA 2QCDA 4ZTYA 4PUUA 4JYDA 2PWVA 3PHAA 1CGYA 5BXSA 3N04A 4P7RA 3LPFA 2JEQA 2WSYA 1XH2A 2R94A 3DCPA 1ESWA 4YJ5A 2Q8LA 2HV5A 4EVZA 2OKTA 1V02E 4NX0A 3BC9A 1NOWA 3TA9A 4CEXC 2BBFA 1GW1A 5BRQA 3ZMRA 1QO5A 3VC6A 4HU8A 3CT7A 5KSWA 3UZJA 1MDRA 3VFLA 4BFAA 2W67A 2XN2A 4J2MA 1GTHA 4P5UA 1YYAA 2EQDA 3EX3A 3KZPA 1PDZA 5JBFA 1AVAA 1CGWA 2CWXA 4ILSA 3S6OA 2EF9A 1T99A 1ZCCA 3W7JA 3URQA 4IPPA 4A6GA 2EPOA 2YBVA 4M24A 3T05A 1YNQA 1LWIA 1FWJC 2OZ8A 3PANA 1LOSA 1UC4A 3KFTA 1DQUA 2AL2A 4XO7A 3TROA 4MZ8A 1R38A 4N9BA 1KFLA 1S2AA 1H1NA 1TPC1 3NDZA 2J7HA 3MSRA 2HMCA 1HJXA 1HJUA 2VO5A 4JHOA 1J0HA 4GVHA 2WKLA 4HD5A 2EPMX 2VENA 5A8QA 2TODA 4EF9A 5C2XA 3LU2A 1FWCC 4B3LA 3S1WA 3MSGA 2R1LA 3B0PA 3C2FA 1VLWA 4HPJA 2C3ZA 2F6UA 3PJTA 1VF8A 5L9FA 1KM0A 3HZ3A 2E0PA 4YU1A 1FWWA 2A5HA 5K4ZA 1R3WA 4AD4A 1WPCA 2ADAA 5HUPA 4IIHA 2R1PA 2Q71A 2PDCA 1UUMA 2Y89A 3IJ6A 3VI2A 4YWSA 3NO5A 3UY8A 1Q4NX 4PTVA 4HCHA 4OV9A 1EJVC 1ECEA 3MANA 3WH9A 4K7YA 1G5AA 1UKSA 2I1OA 1VFLA 2SFPA 1E6SM 1UZDA 3QPEA 4ICNA 1I2OA 3SGGA 4D9PA 3RDKA 2WZHA 3RITA 1JRCA 3DFOA 3AYRA 1I0BA 5I02A 4I5UA 3VX1A 4H7CA 4N02A 1DV7A 5DT5A 4E6MA 4R9XA 5I3FA 4LALA 3AISA 4RE0A 3W1MA 2BODX 3GNPA 2WNZA 2RKXA 2VR5A 3KOFA 5CPLA 4HK5A 3LXBA 2QW5A 5CBIA 2PRHA 2YXGA 2VX7A 1FTXA 2X1IA 1AMYA 1H62A 2QHAA 4QP0A 1W0MA 1O95A 4JFVA 3H4XA 6REQB 3I65A 3N25A 3CASA 3R0DA 4B16A 3M5XA 3S0CA 4LEFA 5AYBA 5MF5A 3C52A 3UJEA 4EACA 4J4KA 4MDOA 1XSKA 1IEIA 3WLJA 5A95A 3ATYA 4AXNA 4B9ZA 4PC8A 2HS8A 5KMYA 2NWRA 4LYQA 1GOIA 1G94A 5FJUA 3NGJA 2J74A 3W7HA 4A3UA 5HWJA 4C6BA 3WENA 3BLOA 3AFBA 1FCQA 4PSPA 3AXXA 4MGGA 3WQOA 1JCNA 3MI6A 4AZ6A 5C54A 5FJIA 4KEVA 3E2SA 1U30A 1EWEA 4ZQMA 1EJXC 5U4NA 3V3WA 1TO3A 1UD5A 3KUMA 4NHVA 5IBXA 4U3CA 4ACYA 3M0ZA 2NVAA 4DJFC 2HK0A 2VVNA 1OCNA 4QTGA 1TMHA 1AFSA 1LP6A 1QJWA 4MB1A 3FCPA 3N3MA 3GM8A 1F5ZA 1RQHA 5JH2A 2FPYA 3GTXA 3ZIZA 1UPPA 3B3DA 3G1HA 3ZVHA 1O60A 3B03A 3VKDA 4GY1A 3DOPA 2ZRYA 2VUNA 3PBGA 3N3TA 1K7XA 3BGAA 4K1WA 2OKOA 4DYKA 3B8WA 2OMAA 3SRFA 3G6LA 1K9DA 3PZIA 4W5UA 1OGGA 2ZUSA 1PYMA 5AHLA 2PE4A 4C60A 1GZJA 4AQLA 4NAFB 3RILA 4A8NA 2YXOA 1W8SA 3UG8A 2ZBTA 1JF6A 3DFTA 2IPJA 4BQ3A 1VKFA 1NFPA 3B04A 1OX4A 1XBYA 3G24A 4AX6A 3L5MA 3BG3A 3PZOA 2PDIA 3QV9A 2Y8UA 1EL3A 3QH2A 2BZNA 1CX9A 1IXOA 2XFWA 3HQNA 5C70A 2AMXA 1IYXA 1F8IA 3WMLA 2WNNA 4AZIA 3F4DA 3G8RA 2QUNA 2FMNA 1OB0A 3EPNA 3T0TA 5A94A 2WO5A 1WO2A 1S5TA 1TV7A 3M6DA 2NLYA 3CQHA 3G0SA 4MM1A 3GDLA 2B4GA 4GGHA 3T42A 4TV5A 4RE3A 3TW6A 2JGQA 4UTTA 4OBRA 1DIDA 3M07A 2Z2BA 1OCJA 3TW7A 2P10A 1WQ5A 3AWOA 2DUXA 2VX4A 2GJNA 4MUPA 5D8WA 4FLRA 4HU0A 4WY0B 3GTIA 5DMMA 1XIDA 5E93A 1LZOA 5CZJA 1JIBA 3KLLA 4C7GA 5HMEA 4LXFA 1S5WA 3E6EA 2I56A 3HG2A 3MUCA 2OT0A 3SCVA 2W6RA 1S2UA 2PWHA 2ZE0A 1QNOA 1J01A 1OBAA 1UD4A 3S5OA 1JCJA 2WVTA 1YEYA 2GQ9A 1D8WA 2J79A 1ICSA 3SRHA 5BWFA 4HZMA 3W7OA 1G0CA 4DN1A 3LDVA 1ISWA 4B90A 4XD6A 3ISIX 2I5GA 4ZB5A 3I3BA 2WWCA 3CIWA 3A3XA 5XIMA 1TPB1 4FF5A 1DWGM