3U7BA

A new crystal structure of a fusarium oxysporum gh10 xylanase reveals the presence of an extended loop on top of the catalytic cleft
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
327
structure length
327
Chain Sequence
AASGLEAAMKAAGKQYFGTALTVRNDQGEIDIINNKNEIGSITPENAMKWEAIQPNRGQFNWGPADQHAAAATSRGYELRCHTLVWHSQLPSWVANGNWNNQTLQAVMRDHINAVMGRYRGKCTHWDVVNEALNEDGTYRDSVFLRVIGEAYIPIAFRMALAADPTTKLYYNDYNLEYGNAKTEGAKRIARLVKSYGLRIDGIGLQAHMTSESTPTQNTPTPSRAKLASVLQGLADLGVDVAYTELDIRMNTPATQQKLQTNADAYARIVGSCMDVKRCVGITVWGISDKYSWVPGTFPGEGSALLWNDNFQKKPSYTSTLNTINRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ENDO-1,4-BETA-XYLANASE
publication title The structure of a GH10 xylanase from Fusarium oxysporum reveals the presence of an extended loop on top of the catalytic cleft.
pubmed doi rcsb
total genus 134
structure length 327
sequence length 327
chains with identical sequence B, C, D, E
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2011-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3u7bA00
2EPLX 2VR5A 1DWAM 1FFRA 4HPGA 3T08A 1UR9A 3GNRA 5A6LA 2BFGA 3VIHA 1ISWA 3VKKA 3SURA 2WBKA 1L0PA 2VCAA 2WZIA 2JF6A 4MB4A 3KZSA 3L4WA 1XH1A 4U5KA 4PSRA 4B9YA 2YL6A 4J3WA 1CGTA 5CZKA 1GOQA 3GM8A 2UY3A 1CECA 1W1VA 1FH7A 1E4MM 4S3JA 3DYPA 3W37A 4GZJA 4QCFA 1E6RA 4JCLA 1KBBA 3E1F1 1FA2A 1CGUA 1E6XM 2G3IA 1UD2A 3EMCA 1CXFA 3UG3A 1E1FA 4CN6A 2WKLA 3O6AA 1E43A 1HVXA 4Q22A 1B31A 1H11A 2FGLA 3M07A 2QHAA 2XHYA 4P7RA 3CUHA 1WDQA 3FY1A 4J3UA 5EMYA 5CQ1A 3VTRA 5ABGA 9CGTA 3KEHA 3VM5A 2D3LA 2ZUWA 2NW0A 3VGHA 5JIPA 4AXNA 1ISXA 1LL4A 4OUEA 5BWFA 4V27A 1EOMA 3GBEA 3POHA 1W1PA 3WUEA 1WDPA 2X2YA 3GZAA 1RPKA 1EH9A 2ZE0A 2AAAA 2CBJA 1EDGA 3N13A 3CHEA 3PZVA 2HVMA 1BPLB 3THCA 4ZEPA 3WQ6A 2WLYA 1H09A 2YKKA 4D6CA 1M04A 3VGFA 2XGBA 1DWIM 4PMOA 1SMAA 3WD3A 4YHEA 2CCRA 1TA3B 1J9YA 2ZX5A 3GDBA 2RGMA 4FMVA 2FDMA 3RCNA 4WK9A 2CYGA 3L2LA 1KWGA 3MO4A 2VUYA 1Y7VA 2BNJA 4L4OA 1C90A 4P7LA 5AC4A 1QOXA 2DIJA 1CENA 4AZIA 5A8NA 2J78A 4L4PA 4X9YA 3WENA 3WDRA 3N15A 4Z2HA 3PTKA 3AIEA 2VZSA 3KL0A 5DT7A 2EO7A 3WQWA 4W7WA 1XH2A 2WCGA 1C7TA 4PCSA 5D9MA 5JBFA 1E6NA 1U30A 3VGBA 4CD6A 1J0IA 1UKSA 2WHMA 1MWOA 1OGGA 3AIBA 3UCQA 3AZTA 2CPUA 2J47A 4WIWA 4CUCA 1V6YA 2WSKA 1LF1A 1UZ4A 3DC0A 2DSWA 3EDKA 5A8OA 4OBSA 3FNDA 3SUSA 2J7DA 2G3JA 4HTYA 3OG2A 2EPKX 1UWUA 3AIVA 4CCEA 4HZ6A 2HISA 2ZWZA 3VIGA 2VVNA 2J8FA 2BY1A 1JYNA 3GXDA 1NWRA 2DGAA 2PC8A 3WUFA 1JGIA 3WH6A 3SIMA 2GFTA 1NM9A 3QOKA 3S6TA 3BLKA 4JZ5A 2DQXA 4W89A 1BGGA 4EANA 3ECQA 1PX4A 3VX1A 3VU2A 1UQYA 1E15A 2A3CA 4KWUA 1WCGA 2E3ZA 5GNZA 1UYQA 2XWDA 4QLJA 4UFLA 2Y4SA 4C7DA 3MMDA 3SEPA 3WFLA 3T0AA 1J0YA 1QNOA 3A4AA 1TCMA 8A3HA 1OT1A 1NOWA 4M82A 3BAKA 3DHPA 3A6OA 5TD4A 2WC3A 5I23A 5E0CA 2AOSA 4CU6A 2XVNA 1AQHA 3MUAA 4MB1A 3SCOA 1FP8A 2UY2A 2VR4A 2W62A 3RJYA 4D1JA 1XHGA 1ZS2A 3AHXA 2CKRA 3EMZA 3IAQA 4CCCA 1WPCA 4M81A 3UR7A 1J0HA 5KEZA 3ARWA 2QLYA 1IV8A 1JI1A 4AZBA 8CGTA 3WUBA 5D4YA 1J10A 3W6LA 4DUXA 1B9ZA 4PUEA 4ZXLA 1QI5A 5DEZA 1GZJA 2WMGA 4HA1A 1J0JA 3NJ3A 3AIQA 3AMDA 2D23A 2OLHA 3ARXA 3MMUA 4S3KA 4NI3A 1XCXA 1GUVA 1AQMA 4MTVA 1GHRA 3VIIA 3CMJA 4U3AA 1PAMA 3WDPP 1R7AA 3AJ7A 1UKTA 3GH7A 1V3LA 4M56A 1UA3A 2D0FA 3II1A 4KRUA 1TG7A 3VDCA 4AY1A 1QW9A 5I6SA 1PZ3A 4OZOA 4Z2KA 4LYRA 1O6IA 1EQCA 3GXFA 2OSWA 4H41A 2GDVA 3VNYA 4GO8A 1NH6A 1CGXA 1G1YA 1GPFA 1B2YA 3NSNA 2W61A 5C70A 3A4XA 2EPNA 2CERA 2D20A 4D6IA 1NWTA 2ZXQA 2PBOA 1E0WA 1BYCA 2J77A 3GBDA 3AIWA 4W5ZA 4LYPA 1E73M 5IFTA 4Z2IA 1M53A 2X09A 1QI3A 3W4RA 4B15A 2WANA 5GNYA 3VD7A 3L2MA 4GIAA 2VQTA 3JUGA 4W5UA 2C0HA 6TAAA 1HL9A 2VZUA 3AIRA 3UETA 1B90A 2WAGA 1MVYA 3CZ8A 4C7GA 4MPKA 1WZAA 2ZWYA 4W84A 2V5CA 4M29A 1C8YA 3WNNA 3N11A 1US3A 3ARTA 1QPKA 2FHBA 2OSYA 2ZX6A 3RDKA 1HKMA 1OB0A 1VFMA 1JZ7A 2OWXA 4JKLA 2J7EA 3OGSA 4PTMA 4UZSA 4JHZA 4DUVA 2DH2A 3KWXA 1HX0A 1UWQA 1XH0A 4KGJA 1VEPA 1WAWA 2PWHA 3CZLA 2CKSA 1I1WA 3F5JA 4MDOA 4JFWA 5IDIA 1VJSA 1V3IA 3PZNA 1E72M 2BVDA 4CKQA 3AYRA 4EK7A 3CH9A 3B9AA 1MW3A 4DWSA 3KL3A 4XV0A 4C7FA 3WKZA 2WMIA 4HMCA 4AZCB 2JF7A 4HA3A 4A3YA 1Q6FA 3AOFA 3UG5A 1RD6A 2E9MA 1OCQA 3CHDA 3SUUA 3RMEA 2X0HA 1CBGA 4URIA 2CNCA 3WL1A 3CHCA 5D9NA 4MADA 3K4DA 3AHVA 4LXFA 1PX8A 3W26A 1PIGA 3F5LA 3I3DA 4RE2A 3VGEA 5LA1A 1Q6DA 7CGTA 3MU7A 4IPNB 1GQIA 2W67A 1KQZA 1J0KA 4JKMA 2VRJA 5EBAA 1RH9A 1E0XA 1CXIA 3SCRA 2GUYA 1GJUA 1A3HA 2VX7A 1AVAA 2NT1A 2V3DA 1W9PA 4HZ7A 4AIEA 2G8ZA 1GORA 1R7OA 4CGTA 1LQ0A 1G9HA 3MUZ1 1H0GA 3CUJA 2BHUA 3QHOA 1QBBA 1H49A 3ARQA 4W86A 4TTGA 3PHAA 1JYXA 2ZUSA 1E1EA 2WZHA 4TUFA 4AD3A 4WLCA 1E40A 2Y8VA 1UQZA 4FLOA 4J28A 5A6JA 3K1DA 5HNNA 4GI6A 1V0LA 4V2XA 3FHAA 3W27A 1JAEA 3PZGA 3WL0A 3EDJA 4F9DA 3EDDA 2WVVB 4FLRA 2JALA 3ARUA 4KGLA 3M6DA 4W7VA 3HN3A 2XSBA 1MW1A 1OINA 3AMKA 1BG4A 3SCPA 2XVPA 1W2VA 1R8LA 3K8MA 1D7FA 2BY2A 3WH8A 4NZCA 3HU7A 4PMXA 2WHKA 1WB0A 1E55A 1XD1A 5ABFB 1MQRA 2O9OA 4E8DA 3WQ5A 4JFSA 5DO8A 3W28A 1BTCA 2VMFA 2JIWA 3GXMA 4J3VA 2VI0A 3WQVA 2PWEA 2WBGA 3L4ZA 3RM4A 5DFAA 1JZ5A 6CGTA 1K9DA 1ITXA 4JAWA 1JNDA 2X8RA 1H1NA 1Q6CA 5A6BD 4M8UA 3WD4A 3ZIZA 4PMVA 2X05A 2PWDA 2CXGA 1C7SA 2VURA 1UHVA 3VIFA 2J4GA 5GNXA 3RIKA 4HPHA 1JXJA 1JD7A 5M17A 2QV4A 4J27A 2G41A 4D1IA 1JAKA 1HP5A 1US2A 2WLZA 2WPGA 1V6WA 3CHFA 3VO0A 2WWCA 4ZFMA 1ZJBA 4BCEA 1V3KA 1JIBA 5M5DA 2WHJA 1SMDA 4R5EA 4YN5A 3W38A 4LGXA 4AEEA 1JZ3A 2RGLA 4TX8A 2GK1B 1DP0A 2CETA 4P7QA 2CESA 1XYFA 1JYWA 1OWQA 4X0NA 2PWFA 3OA5A 1DTUA 2Z1KA 5BXRA 5DT5A 1JFHA 1HXJA 2XTKA 1X6NA 1CGVA 5FIPA 3BAJA 4H04A 1QHPA 5D8WA 2V3EA 2J79A 1J0ZA 1JNEA 5FL0A 1RP8A 3QGVA 1HIZA 2ZX7A 4CVUA 4JL2A 1G0CA 4D6HA 3U5YA 1K6AA 1OD0A 1VEOA 3ALGA 4NRRA 4W8AA 4V28A 4UFMA 3EMQA 3WNOA 4PMQA 1ZJAA 4TX6A 2J7FA 1V3MA 2E0PA 3AHTA 2UWFA 4UOZA 1P6WA 1B3ZA 3SCNA 4PMDA 4U33A 2WM0A 1LL7A 4PUDA 1EDTA 1UA7A 5BROA 2OWCA 4ATDA 4QLLA 1NWUA 3BMVA 4OBRA 4E2OA 2O9PA 2YL5A 3ARPA 3L4YA 1FH8A 3QOMA 1ZU8A 4W88A 4P8VA 2CBIA 2CHOA 3WFZA 3OZOA 1QHZA 1CGWA 1PJ9A 3MV01 5D9PA 1AMYA 2VOTA 3NYDA 3OB8A 4W7UA 1XSJA 2FH8A 4CU8A 1XYZA 3VNZA 3MS8A 1JF5A 1GQJA 4UFJA 1WDRA 1KB3A 4BF7A 1HJWA 5E9AA 1EHAA 3TP4A 1MFUA 1CXKA 4H8HA 2VJXA 3FW6A 1E9LA 2VTFA 2XSAA 3AZSA 2DDXA 2J75A 5A8QA 2ZXAA 1E6SM 1XRVA 2YDRA 1O7AA 1JG9A 1Q6EA 2W66A 3M46A 5I24A 4A4AA 1J18A 1UOKA 2G3MA 1NOFA 1W3KA 2CBUA 1ITCA 4MDPA 2GJPA 2GJXB 4WKFA 3BAWA 4CCDA 2DH3A 3AHZA 5D9OA 4M1RA 3WMSA 2YLLA 4QLKA 1MW2A 4HMDA 3AI0A 4WKHA 4MNKA 1C93A 1H2JA 1YQ2A 4JIEA 4GQRA 1X6LA 4E8CA 1B3XA 2A3AA 1J12A 1W9DM 2GSJA 3OBAA 2DT2A 1GNXA 3AZRA 5FD0A 1BAGA 2W63A 3BAIA 3RO8A 5IXEA 1KR0A 4R27A 1X1NA 1KGWA 1W1TA 3B9DA 2BVYA 4BQ5A 1LWJA 5I78A 1PEZA 1W1YA 4PTWA 3OGVA 2VVSA 2J25A 4N42A 2WMJA 5I0DA 2ZUMA 1NQ6A 1VB9A 3CZEA 1V6VA 5AC5A 2E4TA 1WO2A 4D6JA 1TVPA 3O2LA 2J62A 4DM1A 1HJXA 1OGBA 1ODUA 1I75A 2DSKA 4GQQA 2YDSA 2JIEA 4QFUA 3SUWA 4PEEA 3WIJA 1IZKA 4BQ4A 1E3ZA 4MAVA 3TOPA 2YL8A 4AC1X 4OOZA 3BC9A 4GINA 3AHYA 2FGZA 3VVGA 2X1IA 1EIBA 3SCQA 4Z2JA 1ISZA 4WF7A 1BHGA 3IJ8A 4UQCA 5EFFA 1UKPA 2XVKA 4ACZB 7TAAA 4J3SA 1UD4A 2Y8KA 3GXIA 1ODZA 3PZMA 7A3HA 1FHLA 2OWWA 3WMCA 1PPIA 1M01A 1TA3A 1W9BM 1W9UA 5JUVA 4U2YA 3VIJA 2V38A 1TMQA 4UFHA 3WNLA 1G01A 2VC9A 1CEOA 3WH5A 4UTFA 3D3AA 5EB8A 4MB3A 2BXZA 4WSJA 3ZSTA 2XVGA 2W5FA 2YLAA 3BMWA 1QNSA 4H7VA 1DWGM 3GYCA 4BA0A 4HOWA 2GVYA 3VMOA 2TAAA 4GZIA 1DWJM 5A95A 5HXMA 1LWHA 4U31A 3TTOA 1EDQA 1HNYA 2D3NA 2ZICA 3F4VA 3ZM8A 1CWYA 1CPUA 4AEFA 1EGZA 3T09A 3U7VA 2VZTA 1M7XA 4TTUA 2WW5A 3BCDA 1IT0A 3N1AA 4M24A 1CXEA 3OZPA 2WSPA 2ZUUA 4PMYA 5E6ZA 4PTXA 4MNLA 2D2OA 2ZIDA 1E71M 1JZ2A 1LLOA 2Z1SA 2XWEA 3WF3A 4ACYA 3N9KA 2ESCA 2PI6A 3WDHA 5BXTA 1E56A 1GHSA 4AD0A 1KGUA 3EYPA 4MNJA 2G3NA 1G94A 1R87A 3ZT6A 3ZO9A 2FHCA 3WD2A 1KXHA 2O9RA 2OYKA 5HOSA 2WVTA 1W9VA 1W2PA 2ZOXA 4OJYA 2Y5EA 3A47A 3BAXA 1D3CA 4AYSA 2E9LA 4PBGA 1EXPA 3TTYA 1HJQA 1VBUA 5IHSA 1DEDA 4BQ3A 2WC7A 1JZ8A 1EA9C 4E4PA 3OLIA 2ZX8A 1DWHM 1DHKA 1JDAA 5CJ5A 1QW8A 3WF1A 6A3HA 1EO5A 2YA1A 3IAPA 1GJWA 3VMNA 4FLQA 1EHNA 1OBAA 4EKJA 2XFYA 3IK2A 1UR8A 3CZJA 1E4NA 3LPOA 1UKOA 5E09A 3UG4A 2VCCA 1UKQA 2WYSA 3VD4A 4AZ5A 1KFWA 3THDA 4FLSA 1JFXA 1C3FA 2ZX9A 2VL4A 5I5RA 3B9EA 2XIBA 3WY1A 5CXPA 4ZENA 2IXVA 4DWSC 2WVSA 3VGGA 3ZR6A 4AMCA 3N12A 1JD9A 1W9XA 3PN8A 4EAMA 1GVIA 1KCLA 1UWSA 5E6YA 1C8XA 2EJ1A 5A94A 3PZOA 4WJXA 4IISA 4RE4A 3HMCA 1BGAA 1PIFA 2BY0A 2ZUVA 3ZR5A 1V02A 3GNOA 2B31A 4JFUA 2CEQA 2EQDA 5M3WA 3L4XA 4BS0A 4PMRA 3LPFA 1H4PA 1H41A 4XX6A 2A3EA 1VFOA 2ZXBA 3CIVA 1TFVA 3EDFA 1E5JA 1EOKA 1W3HA 3TA9A 1W3JA 3VIOA 4IUGA 1OM0A 3ZT7A 3CLWA 2PB1A 2DSUA 3W0KA 1UH2A 5CLTA 4UFIA 4UQ9A 1V3HA 5LYRA 1UG6A 4AD1A 1XC6A 4D6GA 1CYGA 1VFUA 3DYOA 2CIPA 3VD3A 4Z2GA 3AS2A 4WKAA 1BF2A 2CHNA 5IFPA 1BLIA 2JE8A 5A2AA 4MJ2A 4A3HA 2YL9A 3VD5A 4B3KA 2J7HA 3WMBA 2XGIA 2DIEA 3GH5A 3RILA 1ESWA 1XSIA 1WP6A 1CTNA 3WDJA 1E0VA 2QMJA 2BHYA 3QR3A 1BFNA 5CLWA 3HJEA 5A8PA 3FAWA 4J7RA 1ZBWA 1MW0A 3NCOA 4FF5A 3MMWA 4RL3A 4F8XA 1C8QA 3AXXA 5DMYA 3L4VA 4P8UA 2NSXA 3VIPA 3ARYA 3WN6A 3CTTA 2O92A 1CGYA 2VX4A 4AZCA 2MANA 1J01A 3U5UA 1V0MA 2D1ZA 3CBWA 1MFVA 5LA2A 2IXUA 3WUGA 5A3HA 1OIFA 3OIHA 1I1XA 3CZKA 1LG2A 3ARZA 4PN2A 2VNCA 2V3GA 5E70A 3BAYA 1K9FA 2Y2WA 5A6MA 2FHFA 3VM7A 1PX3A 1HF6A 3W24A 4HP5A 2YDQA 1KGXA 1UD5A 1JZ6A 3AQUA 1EO7A 3AMLA 4XZWA 4LYQA 4GPNA 3I3BA 5BRPA 4AZ6A 1HJUA 3VILA 2WB5A 1GW1A 2J7GA 2EBNA 1JI2A 3PBGA 4P8WA 4HA4A 1UH4A 5AY7A 5A6BA 2QF8A 3AIUA 1HKIA 1KWKA 4GZEA 4HU8A 1OT2A 4W8BA 4CU7A 2Y24A 4BQ2A 2QPSA 4UZUA 1GOIA 3UEQA 5C8BB 1SR0A 2J7CA 4YPJA 2JEPA 1A47A 3OLEA 4RE3A 2WVVA 3IANA 3ZQ9A 1QNQA 3MUIA 3ZJ6A 3QHNA 2VRKA 2WXDM 5JBEA 3OLGA 5CPQA 2YJQA 2XM1A 1GOOA 4XB3A 3WELA 4ATWA 2XPKA 4OOUA 4PTVA 4B9ZA 1F4HA 4MJ4A 3NIYA 1M03A 2F8QA 1TE1A 3LMYA 5CG0A 3KE0A 5BRQA 3CMGA 4AIOA 2OSXA 2WCSA 3L4TA 1NWSA 5ABFA 1BYDA 5I3DA 1E6PA 1C91A 5CPSA 1F4AA 3VUPA 2ZXDA 3ARSA 1FP9A 2BXYA 3SCVA 4F79A 4P8XA 4F66A 3CUGA 3AFBA 1XCWA 1JYVA 4AZGA 3AROA 3G6MA 1B30A 4QP0A 1U33A 1SFSA 4JHOA 3WEMA 1ZL1A 1VEMA 1OIMA 1JF6A 3WBEA 2WWDA 2XFFA 5CSUA 1XV8A 4D6DA 1ZBVA 4CVWA 2VZVA 4OKDA 4HMEA 1WZLA 1C92A 3ZT5A 3I3EA 2BY3A 1VFFA 2Q8XA 4WSKA 2A3HA 5AYIA 2WHLA 4UFKA 1CZ1A 1HT6A 3APGA 3SUTA 5A2BA 3PTMA 1L8NA 2PF0A 1E4LA 2BHZA 5FOOA 1W32A 4W93A 3W82A 3BXWA 2DT3A 3VD9A 1KBKA 2GK1A 4W85A 2EEXA 1OD8A 3O9NA 4GI9A 1E70M 4AWEA 5A2CA 1B3YA 3RPMA 5A6SA 5ABHA 3W53A 2V5DA 1BYAA 5I79A 3CPUA 3FN9A 2DT1A 1OSEA 4OIFA 4TXEA 1HL8A 5A8MA 4UCFA 1K9EA 3T2QA 1V0KA 1H3GA 1V6UA 5FKYA 3W29A 3J7HA 3A4WA 3BSGA 3UESA 3TTSA 1JL8A 1BG9A 2E8YA 4QAWA 5A69A 2XFRA 3SCWA 2J8GA 3WF4A 2WK2A 4CN1A 1QI4A 4FK9A 2UY4A 1SYTA 2D0HA 4GKLA 3WDIA 4PRWA 3T2OA 4N0RA 5EFDA 3PZIA 3SUVA 3VDBA 3WNMA 4IPLA 1GQKA 2D0GA 2AMGA 3N18A 4H8UA 3BGAA 2D24A 3NDZA 4PSPA 3VOCA 1VIWA 5HDRA 5BCAA 4UNIA 4UQDA 2YA0A 3TONA 4PMZA 1GVYA 1UH3A 4AD4A 3BH4A 2WC4A 1HJVA 4LPCA 3U7BA 1S46A 4UQAA 1W91A 3IJ7A 5DF0A 4Y7EA 4JFVA 2VQUA 4TVDA 3B8SA 3EBVA 4U2ZA 3RM9A 1V03A 3VGDA 4AIUA 1H0IA 1KR1A 1ZB5A 1KXTA 3SCTA 3ZOAA 4H8VA 3RM8A 1G5AA 3VMPA 1CXLA 3WNKA 4UOJA 4AISA 1ECEA 1UD6A 1E6QM 2VO5A 1ISYA 4PMNA 1J11A 4UR9A 3UR8A 2YBTA 5BXSA 1UR0A 4J3TA 4U3CA 1CLXA 1V08A 4D72A 2QMKA 4NF7A 3PZUA 3VIMA 2GJXA 1XSKA 5M03A 3GH4A 1CXHA 3K46A 5HPOA 1UD3A 3WF0A 3KL5A 4H2CA 2CITA 3AISA 1E6ZA 3OGRA 1E4IA 3L4UA 2E40A 2IUZA 4MAZA 5KZ6A 1R86A 2V3FA 2XG9A 4QCEA 4X0VA 3G6LA 5CSYA 3SCSA 4CD4A 2PBGA 2VCBA 5HPCA 2WMFA 3MUY1 3WSUA 1VJZA 1B1YA 2F2HA 1V6XA 4MB5A 4F9JA 4HOXA 2W92A 5FCZA 5F7UA 4UOQA 1WZKA 3WH9A 4D71A 4DWSB 5BYWA 2E8ZA 2EXOA 2WMIB 3NDYA 1LL6A 1E5NA 1NOUA 4PCTA 3OLDA 1FH9A 1CIUA 1Q4NX 3U57A 3WNPA 1B0IA 1QVBA 4D6EA 5I77A 1K9TA 1BYBA 1RP9A 1HN1A 2DSVA 5ABEA 1V3JA 2QPUA 2WMKA 2DSZA 4HU0A 3ALFA 3ARVA 2YOCA 2C7FA 4U5IA 4ACZA 2OYLA 1VBRA 4JCMA 1CNVA 3N04A 1YHTA 4XZBA 3K4AA 2D22A 3WQ8A 5HBFA 4PYSA 4JFTA 1PBGA 2EPMX 1ZBKA 3PTQA 4AD5A 2G4FA 2YA2A 3PZQA 3VIKA 3AS3A 5D8ZA 1V0NA 4AZHA 3ZJ8A 4EE9A 2J74A 4ZXOA 1GCYA 1WKYA 3ZSSA 1UWRA 3VINA 2WVUA 1XD0A 3BCFA 4DWSD 2WKGA 2VZOA 2W4XA 3MANA 1TR1A 1UR1A 3AYSA 3LPPA 3W6MA 3F5KA 4CD8A 1UZ1A 1KCKA 1WDSA 3DHUA 1BVZA 5C71A 3WEOA 4DUWA 3NUKA 1E3XA 3T0BA 1FFQA 1GOKA 2GJRA 2W91A 1HJSA 1GOMA 1UWIA 4HOZA 1QI0A 1BVNP 2XIIA 1FHDA 2F61A 4XUYA 3WEZA 1Q6GA 2YBUA 2DT0A 1MQQA 5LA0A 3VDAA 3DYMA 2BS9A 1VRXA 1WZMA 1QI2A 4GO9A 1XGZA 4NRSA 3N17A 4Q7NA 1UWTA 4PMUA 4J3XA 4CN4A 3W81A 4GXPA 4B16A 4UQEA 1N82A 2A3BA 4KMQA 1GOWA 4UQBA 3VX0A 4NSBA 1CDGA 1ZBCA 5A1AA 1QNPA 1CLVA 5FL1A 3FHQA 2WNWA 3D5HA 3AXIA 5JIWA 4ML4A 2J7BA 4W87A 3WD1A 1GONA 1WNOA 1MQPA 3FXYA 2DEPA 1WE5A 3LPGA 3TTQA 1NP2A 3NSMA 3SCUA 2WMHA 1UR4A 1R85A 1TUXA 4MNMA 3ZJ7A 1UR2A 1W3LA 1LG1A 1D2KA 1IZJA 1PZ2A 3MSDA 1EQPA 4AW7A 1OGSA 4AZ7A 1TVNA 2DPEA 3MSGA 5A6KA 1HP4A 4P7OA 1Z32X 4M80A 3UERA 2XVLA 3NSXA 3K8LA 1KXVA 5IHRA 3W25A 2EPOA 3VPLA 3CZGA 3AXHA 3BSHA 4B3LA 4Z2LA 3WDQA 2WCAA 3AS0A 1QBAA 2XYLA 5CGTA 2FH6A 4BZYA 3AICA 1JDDA 2C8NA 4KRTA 2CBVA 1HVQA 3PZ9A 4ZE4A 3T0DA 1GQLA 1NARA 1TZ7A 5CGMA 1FOBA 1V02E 3T2PA 2X0YA 4KH2A 3MKKA 2WZEA 4GI8A 3PZTA 3WF2A 3CUIA 5AYBA 3GNPA 4D6FA 2XJ7A 5I2UA 3AMCA 5CPTA 1HKKA 3M7SA 1NP0A 1JXKA 3A3HA 1JDCA 4LQ1A 3CO4A 1JZ4A 3CGTA 2ZUTA 3S2CA 3EDEA 5E0FA 4TVCA 2VX6A 2JEQA 1MXDA 1AQ0A 5GQBA 3MV11 1QHOA 3POCA 3AMGA 1QNRA 1HKJA 1BQCA 5GPRA 4TVUA 4ZE5A 1MYRA 1UD8A 2ZUNA 1ISVA 4IM4A 2VRQA 4DM2A 3DECA 4K68A 5A6AA 2OYMA 3ARRA 3ZJKA 3RJXA 3K8KA 3WD0A 2O9TA 2VX5A 1B3WA 4ATLA 5JBDA 1UUQA 1MXGA 4LX4A 4JKKA 4JL1A 3WBAA 1VENA 2BV9A 3BLPX 3VDHA 2YIHA 4CD7A 4P7NA 3AS1A 1LJYA 2BVTA 2GDUA 1KXQA 4QDMA 1KQYA 4YHGA 2XM2A 5ECUA 3QHMA 3CUFA 3FAXA 1B3VA 2NT0A 1VAHA 3WQ4A 2VT0A 1H5VA 2E9BA 2UY5A 1VF8A 1DWFM 3IJ9A 3WH7A 4CD5A 1U2YA 4HZ8A 3GTNA 2XUCA 4TOQA 4AD2A 3ZMRA 5BXPA 2JFEX 2PWGA 1BSIA 4W8LA
chains in the Genus database with same CATH superfamily
2EPLX 3SJ3A 4HPGA 2NQ5A 3ITLA 2BFGA 4LEQA 1ISWA 5I3IA 1L0PA 1LRNA 3SQSA 1TPUA 3KZSA 4JN8A 1AODA 4Q3MA 1H1ZA 4J3WA 3C3NA 1DOSA 1XIGA 1CGTA 3GM8A 3PWGA 1CECA 2W79A 2PC4A 2RUSA 4LS0A 3SQMA 1OF8A 1EB3A 2F6XA 1AW2A 2WZTA 1E6RA 2PGFA 3E1F1 2PDHA 2PTZA 1E6XM 2G3IA 1UD2A 2PD9A 1CXFA 1LCOA 2DUZA 2P3EA 3O6AA 1E43A 1HVXA 4N7QA 1FWBC 4NYUA 4Q22A 5M1TA 3K2GA 2Z28A 1D9EA 4HTBA 2QHAA 1NFPA 4J3UA 5EMYA 1LZOA 3L5AA 5DRIA 2NW0A 3VGHA 4AXNA 1LL4A 4MY8A 4U28A 3IARA 2KAUC 3AJXA 2YCIX 2BBFA 1W0MA 2PLJA 2ZE0A 1I0BA 1EDGA 3N13A 4LVAA 3PZVA 1TUFA 2WLYA 3U2ZA 1H09A 3GG8A 1IGSA 4ERIA 4JBRA 2BSLA 3VGFA 4E3VA 3KAOA 4PMOA 2OGYA 1SMAA 1PZ0A 3KUMA 3LU2A 4GH1A 4JQAA 5EMKA 1ONXA 3BSMA 3QMSA 1JQVA 3R7MA 4WDUA 3L2LA 3FSTA 2X1RA 2VUYA 3U0HA 1C90A 3AO0A 1N2VA 3NO1A 4DPQA 4H6QA 2ON3A 4AZIA 4F40A 1WXYA 4L4PA 3WENA 2P5NA 4I5RA 3AIEA 4A2SA 2QGHA 1R3YA 5LNUA 1OYCA 4FEZA 1C7TA 1NEYA 4O18A 5D9MA 2WJEA 2VWTA 4NYYA 3GW3A 2WHMA 2XN2A 3UCQA 3TXVA 2ZRYA 2CPUA 4CUCA 3EWZA 3DC0A 1UZ4A 3EDKA 3Q58A 2Z00A 1OFEA 2G3JA 1K6WA 1F8MA 2EPKX 3AIVA 4CCEA 3GTIA 4HZ6A 2HISA 2VVNA 2XDFA 5H6HA 3GXDA 2DGAA 4KETA 1JGIA 4AX6A 3TYEA 4F0HA 5XIMA 4DX3A 4LRTA 1SW3A 4W89A 4XTIA 3ECQA 1PX4A 1E15A 1FY6A 2EHHA 3DKLA 4KWUA 4DZHA 1ME7A 3UXAA 2PP0A 3DFHA 5BU9A 3DFSA 1FWTA 4C7DA 3MMDA 2PGRA 3APYA 2FB3A 3UJRA 3WFLA 3M6YA 1QNOA 1GVRA 3A4AA 4C6IA 1NOWA 3CV2A 2Q3RA 1LROA 1A5CA 3QSRA 1EF2A 5TD4A 4ONVA 5T91A 3W1AA 4GX8A 2G4JA 2AOSA 2XVNA 2PRLA 3MUAA 4MB1A 3CC1A 2PAJA 4ALDA 2VR4A 4GY7A 3G1YA 3LGEA 3EMZA 4ASTA 2VDGA 3TV8A 5KEZA 1VFLA 1G4PA 5K7JA 3WUBA 1JCYA 4MJZA 4G8TA 3W6LA 1B9ZA 3WQEA 3W7EA 1MEWA 1UZDA 3TK7A 3DU0A 3C4UA 3DAQA 4RZ6A 2QUMA 2D23A 1OFPA 2OLHA 3G5EA 4C1NB 4A22A 4BI6A 2YW3A 4POCA 1AQMA 4MTVA 4WJEA 4CNSA 4U3AA 3AJ7A 3UGRA 2D0FA 1V77A 2QIWA 2XIMA 3G1AA 4Z2KA 1YDVA 2OSWA 3R0KA 3HFYA 4N4QA 4LS2A 3PR2A 3TWBA 4GO8A 1T41A 4EPEC 4DBWA 4HJFA 2YB1A 3TJIA 5DANA 4IMGA 2CERA 4D6IA 4X60A 2ZXQA 3E38A 1EL3A 3R2GA 4C6QA 3KTXA 2J77A 4KRZA 3EOOA 3GHSA 3LY0A 5IFTA 3HV9A 5G4EA 4ADTA 4BI7A 3BICA 3V18A 5GJPA 1PE1A 1QWKA 3L2MA 4GIAA 3JUGA 2GGHA 3AIRA 3OP2A 1RA0A 3H2CA 1B90A 1MVYA 4ZODA 2QPXA 3TWAA 2V5CA 1KLZA 3QM3A 2QF7A 4XAYA 2ONEA 3PULA 1A5MC 3URQA 1XLFA 3PJXA 3I10A 1JZ7A 4RDZA 1VR6A 4LJ3A 1UIPA 2J7EA 1Z44A 4YYFA 2DH2A 3GNNA 3KWXA 4YCPA 4KGJA 3CZLA 3F5JA 1V3IA 4MMWA 4Q7IA 1E72M 1KRMA 3L2IA 4KESA 2A21A 3G1VA 2G37A 2C6QA 3KL3A 1NIUA 4QEEA 2OQYA 4GUHA 4C7FA 5JQ9A 1MNZA 3R11A 3LCWA 2O0TA 4ZTXA 3HB9A 4YXGA 4QSFA 2X0HA 3SFKA 2CWNA 1XBYA 4MGGA 3AHVA 1PX8A 3W26A 1CW2A 2VHLA 2OX4A 5LA1A 1IEXA 3EB4A 5KINA 4IPNB 3H26A 3EB3A 5EBAA 4G56A 1CXIA 1EP3A 2GUYA 2E5DA 2Y7GA 1A3HA 1W9PA 1X8FA 1G9HA 1H0GA 2BHUA 1EGVA 1H49A 3ARQA 4W86A 4TTGA 1P4CA 1FCBA 3PHAA 1JYXA 3W76A 1E40A 3KBNA 4FNPA 5A6JA 5CKSA 5HNNA 1WV2A 3NYZA 3SSZA 4JTEA 4Q4QA 3PZGA 5LIUX 4F9DA 1EYEA 5KETA 1K03A 3O15A 3HN3A 1OINA 2QVHA 1BG4A 2BXVA 2ZA3A 3SCPA 3HZ3A 1O1HA 2A3LA 3H21A 2BY2A 5H8MA 2Z1BA 5FEPA 2IPFA 5F4XA 1TWIA 4IP5A 4K1WA 2GQAA 2OJPA 5LXEA 3USBA 1XGEA 1LUCA 1R9YA 2NVAA 3WQ5A 4DJDC 3A12A 1BTCA 4RZBA 2BLEA 3HMJG 2C1GA 2GOUA 1D8CA 2PWEA 3S3GA 2E6YA 4HK5A 4GHRA 1JZ5A 6CGTA 1ITXA 3BZGA 4YTQA 2X8RA 2QEZA 2AL2A 3WD4A 2GOKA 2NZLA 2X05A 3ES8A 2E25A 2R1KA 5GNXA 4KCWA 4HPHA 1JXJA 2HWGA 3FX4A 1RSCA 5M17A 2QV4A 1IT7A 1UC5A 4J27A 2G41A 1US2A 1GKPA 3NQDA 2WWCA 3ABSA 4I7WA 3P3BA 3BW4A 3THAA 3FVDA 3UWZA 4LNYA 4DRSA 5M5DA 1V7YA 2X41A 1R3QA 1SFJA 4LUYA 3H24A 1YEYA 4YN5A 1FDZA 2BP1A 2QCDA 3BLFA 2RGLA 3MHFA 3Q37A 3TE9A 4DIAA 1MI3A 4P7QA 3KS6A 1O95A 3CYVA 4X0NA 2PWFA 5DT5A 2ZE3A 4QE5A 4GYFA 1XDMA 2YYTA 3KRSA 3T9PA 3FA5A 4JTGA 3SDOA 2QV5A 3QGVA 1I9CB 1UJPA 3W1MA 4D6HA 5FF3A 3OTRA 2ZVRA 3U5YA 3T05A 1TR9A 3L66A 5F2IA 3EEZA 2FZDA 2PDJA 3EMQA 1NDYA 2ISFA 4ICNA 4PMQA 2HNEA 4TX6A 2J7FA 1V3MA 4MZYA 4MUPA 4LV4A 2CLMA 2A7PA 4OFCA 3N2OA 1PYFA 2WM0A 4PUDA 3AU6A 1EDTA 4IFRA 3THUA 1UA7A 2YFOA 1XIJA 4QLLA 3LI1A 4OBRA 4ZQRA 1IT8A 1MRAA 4E2OA 1TPB1 5GJNA 4WXYA 4L5ZA 2CBIA 3WLOA 3OZOA 3TMQA 3IGSA 1QHZA 1PJ9A 1P0EA 5D9PA 3IACA 3I4EA 3TW6A 3ZVHB 4QQUA 3QKZA 3QPZA 4LBSA 3OB8A 3NQFA 3ANUA 4W7UA 1Q7MA 3REQA 4WY0F 2PDMA 3VC5A 4CU8A 5C2CA 4PRRA 1YNQA 4XAPA 4UFJA 3MI6A 1WDRA 4WOZA 4BF7A 3NAVA 1DE5A 5IBXC 1MFUA 3O06A 2VTFA 2ZXAA 4GJJA 3LDVA 2V2DA 3BJFA 5C7VA 1KKOA 1EJWC 1UOKA 4ORMA 4JNMA 3TH6A 1TV8A 1O60A 1W3KA 5DRCA 1ITCA 4PL2A 1TKKA 2GJXB 2YB4A 2IS7A 4BWLC 1DXIA 3AHZA 3CV6A 3JU2A 3LHVA 2SFPA 4YYCA 4BWLA 4HMDA 3M0ZA 3AI0A 4WKHA 1YQ2A 4IJCA 1EUNA 1W9DM 3PJWA 4EOUA 4FPSA 2EAWA 1KR0A 1ZNNA 1KGWA 3NZ1A 3B9DA 3UZZA 3WMLA 4S3CA 1XIBA 2H8XA 2YXXA 4LW7A 2WMJA 3LLXA 2ZUMA 4H9YA 2WSQA 3CZEA 2Y0FA 1U83A 2HROA 4D6JA 5J04A 3MZNA 2J62A 4DM1A 1HO4A 1OGBA 3DIPA 3SUWA 3MBDA 4M6UA 3AHYA 2FGZA 2NQHA 4ZQOA 3SCQA 1GVOA 4Z2JA 1BHGA 3VAVA 2VC7A 1ZENA 4ZOAA 7A3HA 4XZNX 2PRHA 4OGZA 1RCXB 3HPFA 3OG3A 1NFBA 3ISIX 2QS8A 3CXOA 4Y9PA 2V38A 3S9ZA 1TMQA 3WNLA 3VOFA 4QE1A 3M0LA 5AYYA 4WSJA 3AYTA 3SI9A 4Z0JA 1DHPA 1DWGM 4HOWA 3GRIA 2TAAA 3T44A 5HXMA 4XKMA 4GUGA 4U31A 3V3WA 1HNYA 4LVBA 1G7UA 2E7FA 1Q65A 4IOTA 1CWYA 4AEFA 1EGZA 1A5SA 2HPMA 3NQCA 1XIHA 1M7XA 1IT0A 4UTWC 1IIGA 1CXEA 2ZUUA 5E6ZA 2A7RA 5HUOA 3TAKA 1JZ2A 3RPDA 3TU9A 3WF3A 1M7OA 2ESCA 1E56A 3R89A 1KGUA 5C5YA 3TUUA 2G3NA 1K1DA 6REQB 1W5MA 2VEMA 1J6OA 2JK2A 2GPTA 3ID7A 4UCGA 1W9VA 3S5NA 5I09A 3EOLA 2Y5EA 2B4GA 1BXNA 3MMTA 3KBVA 4CEXC 1DJWA 1KFCA 1DEDA 1OQFA 4AQLA 3W70A 4NJKA 3DBPA 3MWCA 2BMBA 5H2ZA 3DFOA 4GWEA 1QW8A 3IJDA 2QIIA 1EO5A 4MWAD 3IAPA 4FLQA 1EHNA 1OBAA 4EKJA 3IK2A 1UR8A 1E4NA 2BODX 1RK5A 3EWXA 2F9RA 1KFWA 2ZX9A 1C3FA 3NGFA 4DAFA 1G6CA 4XBSA 4ZENA 3H54A 4LAOA 1VFTA 5HNRA 4N9BA 4C1NA 3Q65A 4DN1A 2QUVA 4JGDA 4EAMA 3HM7A 1JPDX 1GVIA 1KCLA 2XIJA 1UWSA 1RJQA 4MWAA 2PDLA 3EOSA 4IQEA 4J1OA 2BY0A 2ZUVA 4QIUA 2D2JA 4LC6A 1K8XA 1DQUA 4BS0A 2E68A 4M19A 4Q4KA 5L6UA 3TQKA 3SRFA 1H41A 5JMUA 1QDSA 3XINA 1TMLA 2DZWA 1YADA 1TFVA 3Q45A 1E5JA 1EOKA 1W3HA 3TA9A 3VIOA 4Y8EA 3P81A 3U2OA 2PB1A 3W0KA 1UH2A 1L8PA 5DY2A 4D6GA 3PG9A 3W1XA 2Q71A 1ITQA 2EG8A 3ANYA 3HPSA 1Q6LA 4IIBA 8XIMA 2FLIA 2DFAA 2JE8A 5A2AA 3M9YA 3EOUA 2YL9A 1TQXA 3O6YX 1I45A 1ADOA 1ESWA 4GYPA 3V5CA 3WDJA 3E2QA 1E0VA 4M5PA 2YCKX 3CWNA 3IIXA 1XLHA 4HBKA 4NKCA 3QR3A 3STFA 3LRLA 1KM4A 3LX9A 3OA3A 5CLWA 2V5KA 4IPJA 3LCLA 6PTDA 1LBLA 4BKNA 5EA9A 2J9YA 1MW0A 3MMWA 4RL3A 2FIQA 2Q8LA 2NSXA 3VIPA 2O92A 2MANA 2ZZ2A 1V0MA 2D1ZA 3QGAC 5FF7A 4KEVA 5LA2A 1ZAJA 2IXUA 2CZEA 2IPGA 3QFEA 4K8HA 4IICA 4QJ4B 2VNCA 5E70A 4AHOA 1B3OA 3GSMA 1VGAA 4J2PA 4PH6A 5E9XA 3WFAA 2HS6A 3MY9A 2YDQA 3VKJA 1UD5A 4ADSA 5MF5A 1Q8AA 3U48A 4GCXA 4F4RA 4O0KA 4X22A 4ZOCA 4AZ6A 2PUZA 2WB5A 2EBNA 4Q4MA 4P8WA 4XKYB 3RXZA 3GK0A 1A53A 1W3TA 2QCNA 5D05A 3QVQA 2QF8A 4HJWA 1KWKA 3EKZA 4S3FA 4GZEA 4ERAA 2E6AA 4CQBA 4PB4A 5I3GA 3V75A 3C2FA 3R43A 2CC0A 4H6EA 4BQ2A 3ORWA 1FWHC 4R7JA 1N8IA 3ABZA 3IUDA 3UEQA 3WQFA 1F07A 1SR0A 3PUDA 2PCEA 1XUZA 5DCDA 3ZQ9A 3DFPA 3CQJA 4KERA 1A49A 3A5FA 1TE6A 3OLGA 3QPEA 5CPQA 3WELA 3KHJA 3V1HA 4OOUA 4HPNA 3S42A 3SAZA 3GTXA 4MJ4A 1W56A 3NIYA 3G18A 2ZRXA 3LMYA 5CAHA 1TV2A 3PPFA 2OSXA 3L4TA 4QTGA 5CPSA 3TN4A 3MHUA 4INFA 1RK6A 3ARSA 3WLKX 1EWEA 2BXYA 4F66A 1RLCL 2X2GA 4IGHA 5HULA 4ZQNA 3S5SA 2HJPA 4R88A 4PTNA 1A5UA 4L9YA 4ZO8A 4QP0A 3R5EA 1XFBA 3WEMA 1OIMA 3CQIA 3WBEA 1MDLA 4OUIA 5CSUA 1XV8A 3W7RA 1T40A 3LXAA 2V69A 4FP1A 2VZVA 4OKDA 2V0TA 3B97A 2VD9A 1KV5A 1VKFA 5LIYX 2BY3A 4KS0A 1VFFA 2Q8XA 2A3HA 4R53A 2PF0A 1FWCC 4S3EA 3QFWA 4W93A 4HA0A 3KBSA 1S5WA 2QT3A 3BXWA 4PUWA 1F3TA 3BLEA 4HSOA 4GMEA 1OD8A 2WQPA 1XYMA 2E5BA 4AWEA 4LAMA 1B3YA 4N6EA 3RPMA 3GHUA 5A6SA 2PDPA 4DJFA 3VC6A 2RJHA 3HGSA 5DXYA 1BYAA 3NG3A 2NX3A 1XBZA 2YPIA 1OSEA 3W3OA 3ES7A 3EA3A 1HL8A 4UCFA 4L64A 2ACUA 1V0KA 1V6UA 5FKYA 3J7HA 3L0NA 3BSGA 2E8YA 1UMYA 2J8GA 3ZR4A 4CN1A 2OO6A 4PBEA 3H4GA 3TSDA 3STEA 3WDIA 3NQ6A 1QO5A 5CPOA 3T7VA 2H3DA 2A85A 3VDBA 3V16A 3NQ7A 2D24A 4PSPA 5HDRA 3VNIA 2QCHA 4KFNA 5DELA 1OX5A 4K39A 2ZZ5A 1WBHA 2ALRA 4GVHA 1THFD 2BOGX 4UMCA 3F2BA 5A6TC 5LKYA 2WC4A 1R9XA 3U7BA 1EX5A 3BCJA 4UQAA 3OBEA 4AWUA 1GQNA 4O50A 4GOAA 3UWEA 3QRHA 3D3FA 2PZNA 4ERGA 1X7IA 3B8SA 3KDNA 2R14A 3SR7A 4PB5A 1V03A 1S5TA 4L9XA 3PP7A 1H0IA 3A24A 3W7JA 1YXCA 4IX2A 1CXLA 1F3WA 1WXZA 2H3BA 1UD6A 1E6QM 1ISYA 4PMNA 2YBTA 1U5VA 3UNDA 3LLFA 1ZRQA 2YCJA 1CLXA 1V08A 1XRSA 3VIMA 2GJXA 3IJLA 3CAQA 3WK0A 1ICSA 1KBIA 3WLNA 1UD3A 3RITA 4EWND 1ADDA 1I4NA 2NSOA 4S38A 4I3GA 1OFRA 4M7TA 3GDRA 3L4UA 2E40A 1F5ZA 4DZAA 5KZ6A 2HS8A 1R86A 2V3FA 2XG9A 4QCEA 4X0VA 3G6LA 1YPFA 3IV8A 5CSYA 5HWNA 2GGEA 4XUGA 1TRDA 1ONEA 2F7FA 4H9MA 2QJMA 1TRIA 1VJZA 4ZO9A 2ATSA 4MFDA 3N2MA 3RCYA 1SO3A 4OECA 3CL6A 5F7UA 2F84A 4ZOBA 4Z1BA 3RLVA 3DG3A 1UWAA 4QDWA 1E5NA 3KOWA 4RXGA 3U57A 1TCDA 3IWPA 1SVDA 4LUIA 2XU2A 1W5QA 3CIXA 5CSSA 3LBCA 5ABEA 1V3JA 1SZFA 3F4NA 2C7FA 4U5IA 2OYLA 1VBRA 2POZA 4JCMA 1J2BA 2QXWA 3K4AA 1KO0A 1ELSA 4C65A 3PY2A 4PYSA 4QX4A 3PTQA 4AD5A 1Q85A 3VOHA 3BVJA 2CW6A 4HSHA 4GY0A 1V0NA 1OZQA 1HTIA 3DESA 1FXQA 5MHBA 1A5AA 1VPXA 3WYZA 1UWRA 1PKMA 1SO5A 4EAYA 1TWDA 5CC3A 3BCFA 4AWTA 4DWSD 3G1RA 2VZOA 3R94A 3W6MA 1UR1A 4IH3A 3F5KA 4WEVX 2EKGA 1GG0A 3DHUA 1KFJA 3MP3A 1BVZA 4DZIA 2GJRA 2W91A 2XIOA 1YTDA 1U22A 1UWIA 2PU1A 4IGSA 3NQ2A 2Z24A 4IQDA 1FHDA 2INEA 3QY7A 1VZWA 3WEZA 2YBUA 1MQQA 3PB0A 3VDAA 4IT1A 2C14A 1XGZA 1VLWA 4ZQMA 4Q7NA 3FV9A 1OJXA 5C55A 1G4SA 4UQEA 3SN4A 4KMQA 1GOWA 4NSBA 3KVMA 3ONCA 5A1AA 4MKSA 4P5UA 2WNWA 3WZ0E 5HMEA 2J7BA 6REQA 4W87A 1LWIA 3FA4A 3FXYA 4NZJA 5CZTA 5FSDC 3SGGA 3UPBA 1VHNA 2CZVA 1ZJHA 1BRLB 4UTJA 1TUXA 3N29A 4GBUA 2DW6A 4RPPA 1GOXA 1HL2A 1KNWA 1LG1A 1IZJA 1DBTA 3MSDA 3R0DA 1TVNA 4HYVA 5A6KA 4KBXA 3AYVA 2XVLA 1A3WA 1FWAC 3K8LA 4K8EA 2EPOA 4N2YA 3CZGA 4RDWA 4K36A 5DLCA 1FDYA 4Z2LA 1M6JA 2XYLA 4XBJA 4KCVA 1SO4A 4BZYA 3DHFA 4KRTA 2CBVA 3D6NA 1NARA 2HDJA 2HK0A 1V02E 1YXYA 2Q3OA 3CM4A 4XVDA 1NDVA 3IK4A 3NURA 3AMCA 1NP0A 3R1ZA 3TQ0A 2XN0A 3S2NA 3A3HA 1P7TB 3ONBA 2WNQA 3CGTA 5FAJA 3S2CA 1MO0A 4TVCA 5C9UA 3SRHA 1MXDA 1XKJA 3POCA 4J2MA 1QNRA 1HKJA 2J88A 1ZPTA 4LAUA 4TVUA 4ZE5A 4WXZA 1MYRA 3GDKA 1UD8A 4NG3A 2AKZA 4IM4A 2VRQA 1BD0A 4UR7A 3RMJA 3DECA 2R8WA 2XIQA 3ARRA 3LCFA 3ZJKA 3RJXA 3QZAA 4YTSA 1T96A 1B3WA 4IJRA 4JKKA 4FIQA 4LF2A 1S2UA 1WKEA 3O6CA 3BLPX 4O4WA 1HKWA 3AS1A 4MKNA 3RRXA 2Q01A 4NT0A 1KXQA 4QDMA 4HNTA 3LV6A 1E9YB 5CCZA 4YHGA 1J79A 3CUFA 3P62A 4XD6A 4DLMA 1OX6A 3WQ4A 1KM3A 5FJOA 3BV7A 4GISA 1VF8A 5I00A 2VENA 4TOQA 5G4WA 4AD2A 1W5NA 4DO5A 3MO7A 1ECQA 4WY0B 3ZMRA 1W6TA 2JFEX 4W8LA 2ZC8A 1FFRA 3W9ZA 3TOYA 3B4UA 4PBFA 2WBKA 3UVIA 2D2GA 2WZIA 1N8WA 4ORIA 1JRCA 4U5KA 2YL6A 5CZKA 2UY3A 3NZPA 3T0CA 3W37A 2VFEA 3NPUA 3V0TA 4QCFA 4C6KA 2F6UA 2BWGA 1CGUA 3WLQA 3W1QA 2J13A 4C91A 1CX9A 4BFAA 3W07A 2C13A 2WKLA 3GDTA 4XIAA 1POKA 3T0TA 2A79A 3EWCA 1WDQA 3FY1A 3BDKA 3MP4A 9CGTA 3KEHA 2A5HA 2D3LA 1PSCA 2ZUWA 5RUBA 4XKYA 1ISXA 5BWFA 2DZUA 4V27A 3GB6A 1W1PA 3DI0A 3WUEA 4JTJA 1W37A 1RPKA 3VCNA 1EH9A 3ITVA 2Z0IA 3CHEA 2QUNA 1JPHA 3THCA 4B92A 3CAVA 3WQ6A 4YTRA 3N9SA 2IKJA 5U7SA 4HN4A 4HNLA 2XGBA 3RX4A 1DWIM 4YHEA 4C6JA 1KFEA 4JHMA 1J9YA 2ZRVA 1ALDA 4FMVA 2P53A 5E0KA 2PDYA 4P7LA 3KBWA 5AC4A 3D47A 3AXMA 4IPPA 3OZYA 4X9YA 1TPC1 4KIRA 1L6SA 1OZMA 3KL0A 2ZDRA 4CEUC 1TZZA 1XINA 3CH0A 3RPTA 3W7QA 3W85A 3WLLA 3VGBA 3FYYA 2CLOA 5AZ0A 1J0IA 3FFSA 3AUJA 1OGGA 3AIBA 4K1GA 5FF0A 1I6NA 4WIWA 3P6LA 2WSKA 2DSWA 1KFBA 5A8OA 4PL1A 3SUSA 3OG2A 1UWUA 4IMDA 2REQB 3VIGA 1EX1A 2J8FA 1X38A 2BGNE 3N2BA 4XO6A 2PC8A 3WUFA 5I3KA 4RV8A 3S6TA 1XDLA 3DENA 3LTSA 3W7MA 1BGGA 1BEUA 3L5MA 3QQ0A 4QG8A 4EANA 2P3ZA 1UQYA 3KOZA 3VI2A 4EWJA 2PDFA 2E3ZA 3N6HA 4KWSA 4LFYA 1K8ZA 4QLJA 1G69A 3NQEA 2A4AA 5LHFA 1QMLA 3GYEA 3T0AA 4B5TA 1A4LA 3WG6A 1AZ2A 1OT1A 4WHBA 1TX0A 3S1VA 3QQ1A 3A6OA 2Z7GA 5D2WA 2WC3A 4WD0A 4OQVA 3OVGA 3CYJA 2ODOA 4CU6A 3NQ8A 1XKYA 1XG3A 3SCOA 2UY2A 4V1XA 3RJYA 2W62A 3TYZA 1XS2A 2YXGA 1PS9A 2J8TA 4DYKA 4CCCA 3KBMA 1RCOB 5CJNA 6ALDA 5FEWA 1A50A 8CGTA 2CZDA 1DJIA 2OOFA 4DUXA 3UXKA 1VBGA 3LN3A 3ITTA 5DEZA 3ABQA 2OLAA 3AWOA 1LRQA 2WMGA 3E0VA 3NJ3A 4IMAA 1D3GA 4F2TA 4NI3A 4NXSA 3L5LA 3XIMA 1O4UA 3LM7A 1XP3A 3VIIA 1UKTA 4M56A 1VJIA 3SQLA 1TG7A 1BF6A 3VDCA 2VFGA 1PIIA 3MJYA 4OZOA 3RR4A 4ZR8A 5BNKA 1Y5VA 1AG1O 2GDQA 4GYKA 3VNYA 1JDEA 3TROA 2FMNA 1B2YA 3SGUA 2W61A 2OZ3A 4Y2WA 1P48A 8RUCA 3L9CA 4LCSA 5ECVA 3UZJA 4EIVA 3ZS4A 4PFMA 2DORA 4JTIA 4NZ3A 2J27A 1E73M 1GT8A 3GXTA 4Z2IA 1EBHA 3S1XA 2VXNA 4UC5A 3H22A 4B5WA 4HHLA 3ITXA 4DBUA 2WANA 4KFPA 3VD7A 4P2VA 3S4TA 2VQTA 3VNJA 1O5KA 1K3UA 1ADSA 1JRBA 4G9PA 3UETA 5KITA 4V33A 1XWYA 3S5ZA 3MA8A 2AKMA 1EYWA 2ZZ4A 7ENLA 2ZWYA 2AL1A 3S47A 1C8YA 3WNNA 3G3DA 3M0HA 1US3A 2FHBA 2OSYA 4HNNA 4DF1A 2IQ0A 3FJ4A 1EJVC 1ICQA 3H2EA 1CB2A 3RX3A 4JHZA 4NZ1A 4DUVA 1HX0A 1XH0A 3M5YA 1AW5A 4C6NA 3W7OA 2CKSA 5JVLA 1I1WA 4JFWA 1VJSA 4KKXA 4JIIX 2BVDA 1F05A 3B9AA 4W9TA 1MW3A 2PDKA 3BLLA 3B8IA 1I2NA 1TPH1 1XJBA 4ECLA 3WKZA 2DZAA 4HA3A 1M5WA 2OZ8A 2PCQA 4A3YA 3AOFA 4DJED 1OFDA 4M1BA 3GU1A 2E9MA 1OCQA 3CHDA 3H4WA 4URIA 4DNMA 4XO7A 4IX0A 4IZGA 4GIYA 4NNCA 5D2YA 1A5KC 1A0CA 1PIGA 3F5LA 3PK7A 3RFAA 1SW0A 3VKDA 4DBDA 1Q6DA 8XIAA 4JKMA 4LS1A 3N2TA 1RH9A 1YDYA 3TW7A 1MEIA 3UCDA 1GJUA 1AVAA 2NT1A 3EX6A 1EWDA 3ABOA 5LXXA 4JPGA 2G8ZA 5EU9A 1M3UA 2V68A 4DUOA 2QUUA 3RN6A 3CUJA 4YS1A 1OCJA 3EWDA 1QBBA 3RGTA 3QF0A 2TSYA 4QM1A 3CV7A 3N34A 1OADA 1POJA 3GNXA 3VFCA 3ATZA 4LU0A 1RHCA 3EX2A 3K1DA 4IIFA 3CK5A 4GI6A 5AECA 2DP3A 2ALDA 2VEKA 4XAFA 1JAEA 2WVVB 2JALA 5LHEA 4R7OA 2E67A 3BWWA 3AMKA 3WQDA 5K4ZA 4UTUA 4YVXA 4ZFCA 5HMDA 3AUOA 1IXNA 3HGRA 3HU7A 3P61A 1E55A 4KCUA 4UXDA 2Y61A 1FWIC 3OQEA 2PWUA 2CU0A 4Q4OA 4E8DA 3RLGA 1I2RA 3UWUA 4MOZA 3C0JA 2VMFA 2JIWA 4Q8WA 3GXMA 2VI0A 1UJQA 4FO4A 3RM4A 2ZRWA 1H7OA 5CJMA 4PUKA 1H1NA 4UMAA 1XGDA 4M8UA 1KLYA 3ZIZA 3CMFA 4NUWA 4PMVA 2PDUA 4QRNA 1BRLA 4LTSA 3N2XA 1WA3A 1JCXA 2VURA 1TWWA 4AF0B 5FJPA 4D1IA 2Q6ZA 2WPGA 1V6WA 2V2HA 2OX1A 4LB3A 4ZO7A 2YYUA 4ZFMA 1Q8JA 2Y62A 1OFBA 1ZP4A 1UPMB 3P82A 1FHUA 4K7YA 2PD5A 2OEMA 9XIMA 2VR2A 5FA5A 4R5EA 5FF2A 4Z0SA 4LGXA 1JZ3A 3UQNA 1IF2A 1DP0A 2ATMA 1F76A 2CETA 1JYWA 1DIDA 7PTDA 1OWQA 3UXDA 3GR4A 4UUIA 1DTUA 1XBXA 3B8VA 4Q6XA 3M0MA 1X6NA 3BAJA 4GFIA 2DQWA 1QJWA 1QHPA 1J0ZA 3NPVA 3NWRA 3O07A 1RP8A 4JL2A 1EEPA 1X1ZA 1G0CA 3O63A 1ZAHA 1P7TA 2PE4A 4RJEA 4W8AA 1OFOA 5C7HA 4UFMA 4NI8A 4P61A 3WNOA 3OIXA 4FXSA 1ZJAA 4DELA 1WXJA 2UWFA 4UOZA 1P6WA 3TJ4A 4U33A 4WUIA 4A6GA 2JQXA 1LL7A 1XXXA 2PDIA 4FI4A 2QCLA 4UTTC 2YR1A 5BROA 1WYIA 4ATDA 1NWUA 2UZ9A 3BMVA 2YL5A 4MM1A 5FJIA 3UW6A 1FH8A 4UTTA 1ZU8A 1IXPA 4P8VA 4QITA 4PA8A 1CGWA 3LZ5A 3EX4A 1AMYA 3R0UA 3LBOA 1XLIA 1YW1A 1X6UA 4CNOA 5EMJA 4Q4SA 2FH8A 2XFWA 3B3DA 1AUSL 2A6NA 3VNZA 5G4HC 3MS8A 3NM3A 1B9BA 3U6WA 3DX5A 1EHAA 3FW6A 2I16A 4PUUA 1Q2SA 4IGMA 2J75A 3CJPA 3CO8A 5C2XA 1E6SM 1XRVA 3QLDA 1O7AA 3BURA 5EMUA 3OQ8A 1P6CA 1NOFA 2CBUA 4Z08A 2GJPA 2OODA 3KTCA 1QAPA 1S5NA 1U5JA 3BAWA 4O57A 5AVNA 3CAWA 3A9BA 1HGWA 3GXNA 1EXBA 4M1RA 3S46A 4QLKA 1FKWA 2QDGA 4O54A 4J3ZA 1CT5A 3DFNA 4MNKA 1C93A 4JIEA 1B3XA 1WUFA 2A3AA 3U4AA 2NWSA 5C2GA 3OBAA 3L65A 2DT2A 5FD0A 3AZRA 1BAGA 3RO8A 1W1TA 1AK5A 4BQ5A 3VCRA 4PTWA 3OGVA 4AH7A 1RJRA 2VVSA 4Y90A 4DHGA 1VB9A 1U1UA 4XSMA 1V6VA 5AC5A 1WO2A 3TN3A 2Z2BA 1QXLA 3P67A 3GXPA 4HGXA 1QPOA 1TVPA 1J96A 3PUOA 2WSYA 3TC6A 1HJXA 1R3WA 4NAFB 3LMZA 2DSKA 5D2VA 3G8EA 3BC9A 4GINA 7REQB 1I2QA 1QPNA 1GZGA 3F4WA 3VVGA 4UQCA 4GQGA 1ODZA 3PZMA 4MLRA 2CLKA 2I5IA 2ZRZA 4RCXA 1PKNA 5G2WA 2HK1A 3WLIA 1S2CA 1PPIA 1M01A 1W9UA 4U2YA 3VIJA 4KQNA 1PDZA 1F61A 1Z8AA 2QDHA 4JQ3A 3GDMA 3P14A 4IWWA 2PTWA 3D3AA 5EB8A 1DVJA 1PUDA 3M5VA 1B54A 3ZSTA 4JOMA 2W5FA 3WBWA 3BMWA 4CQDA 5CC7A 3GYCA 3LNPA 4O0QA 2GVYA 1FXPA 3C2VA 3I6EA 5B80A 5A95A 1FWEC 1R38A 1EDQA 4H4IA 1SO6A 2FTPA 3ZM8A 2VFIA 1L6FA 2ABAA 3T09A 4YVPA 3JRKA 1R3SA 3SJNA 4OV9A 2PZ0A 3BCDA 4YNGA 2RDTA 4M24A 3DXIA 3NVTA 4AY8A 4UWMA 2REQA 2VYOA 4ZSUA 1OK6A 4PMYA 3PBMA 4FF7A 2ZKMX 3ZYZA 4MNLA 1KM2A 1MXSA 1J93A 4HMNA 1C9WA 2ZIDA 2ASHA 5I3FA 1LLOA 2XWEA 3KRZA 1PWMA 1XF0A 2PI6A 3WDHA 5BXTA 5EPDA 1J6PA 3EYPA 3EGJA 4AVFA 3S6OA 1G94A 4QNWA 3ZT6A 2WV8A 2BDQA 3RYSA 2OYKA 5HOSA 1FX6A 4IHCA 1W2PA 2PFHA 2ZOXA 4OJYA 3GFXA 1LT7A 2E9LA 1VBUA 3C0QA 3H23A 3BUVA 2NXIA 3B8UA 4RNHA 3PSWA 3OLIA 3P80A 3W87A 1OX4B 3V36A 1AJ2A 3TLQA 1HQTA 3CEPA 2EG7A 2O7SA 2ZZ7A 2CHRA 2VEIA 3CZJA 3QZEA 3LPOA 1UKOA 3UG4A 1FWFC 4AZ5A 3THDA 4LY4A 1JFXA 1TPVA 3HPAA 3B9EA 2IXVA 4Y6GA 4DWSC 1FCVA 4GVGA 3VGGA 3ZR6A 1KCXA 2HVOA 1W9XA 2D69A 4NQ1A 4C1KA 1JUEA 3KRBA 3V35A 1YYAA 1TV5A 1C8XA 4MKVA 5A94A 3B0UX 1Q6QA 3OYZA 3PZOA 3CUXA 3HMCA 1NU5A 2FQIA 1PIFA 2OB3A 2B31A 5M3WA 4H9ZA 4D8ZA 1UPPA 2G50A 3FDKA 4PMRA 6ENLA 3DC8A 2DZXA 1ZHAA 2YFNA 3TN6A 2G97A 1SQ7A 7TIMA 2ZXBA 3EDFA 1EEXA 1S3TC 3HGJA 3UJEA 1Z42A 4YL2A 3UZYA 1OM0A 4L9ZA 4IQLA 4NAEA 3ZT7A 3CLWA 2DSUA 5CLTA 1A3XA 4PR4A 1AL7A 4UFIA 1MSSA 1UP0A 4GE8A 1YKWA 2VM8A 3GTFA 1XC6A 2PU0A 3UYIA 3P5YA 4Z2GA 3MBFA 3AS2A 4WKAA 1P0BA 3H2AA 3ITGA 5IFPA 3WQGA 2XH0A 4NZ5A 4DF2A 4A3HA 4GUIA 3VD5A 3W1PA 2XH2A 2V63A 4HD5A 3EWBX 3USZA 2DIEA 4M6QA 3CUZA 3PNUA 4B2DA 1XSIA 3JZUA 1CTNA 2VWSA 3PJUA 2FTYA 4H2HA 5DMMA 3L23A 1JPMA 2TMDA 4R34A 1SZNA 2FFIA 2RDUA 4JDYA 4RKAA 1BFNA 5TAOA 1DJZA 1TPDA 3GVVA 3FAWA 3R8HA 1ZBWA 3BQ5A 3HG3A 4FF5A 2OZ0A 3AXXA 1SM9A 1W31A 3UY8A 4JIHA 4P8UA 1DL3A 3IJIA 3ARYA 1CGYA 4DI8A 2E1WA 2FFCA 3U5UA 2QVNA 2GLKA 3W84A 3WUGA 3AXKA 3W2MA 1OIFA 1I1XA 3NQVA 1H61A 1TELA 2ADAA 3U9IA 3CQ0A 2DZSA 2OVLA 2V3GA 1K9FA 5A6MA 1W8GA 3ZZ1A 4IXHA 5CPNA 3ZLHA 3O05A 3IJQA 3BQ6A 2NLYA 3WLRA 2QJHA 1KGXA 1QFEA 2L5HA 4LYQA 4GPNA 4X2RA 8TIMA 3BTNA 2P10A 4QQ3A 1P0NA 3OO2A 2J7GA 3G0UA 3UPMA 1FWWA 4KEMA 3BLIA 3PBGA 1XLJA 1KD0A 3UWQA 4OTKA 4NZ4A 3PFMA 3W74A 1NDZA 1ZUAX 5A6BA 2P0OA 4FXRA 1H62A 5CBIA 4XBKA 3AIUA 4FX8A 1HKIA 4S1FA 4L1WA 1FCQA 3W75A 4CU7A 3ABXA 3TAOA 1OF6A 4I5UA 2QPSA 2ZTKA 1BXCA 1DQWA 2VEGA 2J7CA 3R8RA 3H2MA 3OLEA 3NXLA 4RE3A 3RR1A 2WVVA 1E1CA 3MUIA 2VRKA 2RDXA 3BZJA 3F2DA 4DNHA 2YJQA 1GOOA 4XB3A 3R6IA 4PTVA 5CG7A 1LRTA 4O28A 4QSHA 3R8GA 1M03A 2F8QA 3S2MA 1TE1A 5CG0A 2E5CA 2O4QA 4AIOA 5HNTA 1ZP3A 3LERA 3CQHA 2WCSA 1NWSA 5D33A 2R1LA 3NL5A 3O0KA 4XK2A 4K2SA 3VUPA 3A22A 2ZRUA 1FWRA 3SCVA 4HU4A 3NEVA 5FESA 1PHQA 2OOGA 3AFBA 5REQA 4AZGA 3LNMA 3AROA 2WM1A 1J4EA 2B7PA 1B30A 1U33A 1YPXA 3C52A 1W1IE 1K7XA 2VC5A 1JF6A 2D73A 4NASA 1R5YA 2WWDA 3KWSA 3VZXA 4D6DA 4Q8TA 4CVWA 3W7IA 3DDMA 1WZLA 4AF0A 2I14A 3I3EA 1O5XA 4GFSA 3CB8A 4WSKA 3GQYA 5AYIA 1IEVA 3GIPA 4X9SA 1HT6A 3APGA 3G2GA 5A2BA 4GKTA 2NV2A 2FJUB 3A3XA 1L8NA 1E4LA 4YTTA 3QC0A 5FOOA 3P5ZA 1VLIA 1W32A 2PTDA 1S2AA 4JICA 4HHPA 2DT3A 4W85A 1NFGA 3BJTA 3GVQA 3TW9A 1EA0A 3O9NA 1E70M 2W0UA 1MEHA 4Q8OA 3PBUA 4RV3A 1T0OA 2WZMA 2V5DA 5L9FA 3W1NA 4PGLA 4XVEA 3CPUA 2QJJA 5I79A 2DT1A 1XYLA 2XH7A 1J5TA 2X30A 4TXEA 3OVPA 4B5NA 3HV8A 5A8MA 2OLSA 4XZ9A 1H3GA 1X1OA 5LIKX 4AWSA 3UESA 1GZ1A 3TTSA 1JL8A 1UR3M 4QAWA 2WK2A 1QI4A 4XG1A 5AHEA 4FK9A 3TNBA 4GKLA 3T2OA 5BOFA 2RDWA 2GZXA 2Y88A 4N0RA 1ZLPA 1Z9AA 4QJ3B 4LCRA 3PZIA 3SUVA 3LZ3A 3WNMA 4IPLA 4ZQCA 1GQKA 5HQEA 3N18A 1I60A 3BGAA 3I7SA 5C0QA 1VIWA 4NILA 2YA0A 4XAZA 3UWWA 2D2HA 2F38A 1GVYA 4E8GA 3U2CA 2QJNA 2ZC1A 1FWNA 5AYZA 1RQHA 4C5ZA 4PEKA 1SJCA 3A5VA 4UTMA 2OZTA 3WQPA 1XRTA 1XLGA 5H1WA 1SZRA 5DF0A 4DO6A 4H7CA 4JFVA 3H2NA 1HGYA 1QOPA 4U2ZA 3VGDA 4S2BA 2ISVA 3MCNA 4IP4A 4HVXA 1OFAA 1PV8A 3SCTA 4H8VA 1KTCA 1G5AA 2BGQA 3GTHA 3WNKA 3N4FA 4NP7A 3STGA 3R10A 1TIMA 1J11A 5IRPA 1AD1A 2OXNA 1JUBA 3L67A 4D72A 4QNEA 4NF7A 3PZUA 2W9MA 1XSKA 5M03A 1GTEA 3SRKA 2PODA 1I2OA 1XQLA 2FKPA 3KL5A 5AHIA 3NZRA 1LOLA 1E6ZA 4ZSTA 1FCUA 2XINA 5LNVA 3P0XA 3GC5A 2IUZA 4KWVA 3UP8A 1XIFA 4L1GA 4XD4A 2A1YA 3SCSA 1LM1A 3HFTA 2ZDSA 3W23A 3N3TA 3HPXA 5MKGB 3V5FA 1MDRA 3WSUA 4Q8VA 1YBQB 4X63A 1B1YA 2F2HA 5TBOA 1XYAA 3RNDA 1XM3A 1P6BA 3EPOA 2W92A 4O1EA 3LLDA 1WZKA 4AFYA 4D71A 4LF1A 2EXOA 2WMIB 1YIXA 3NDYA 1LL6A 4PCTA 3OLDA 1FH9A 1CIUA 4NAFA 4XZMX 1B0IA 3G0SA 1QVBA 3EZ4A 5J8LA 1RP9A 2DSVA 4GH3A 7REQA 2PURA 2DVTA 1KBLA 3K1GA 1IEQA 4ILSA 4TMCA 1DIKA 4B90A 5G1MA 2OQLA 3NEHA 1XPYA 3W1TA 3N04A 4Q33A 2GQ9A 4A35A 2GSHA 2D22A 3WQ8A 3TJLA 4HNUA 1O68A 5HBFA 3LXCA 4JFTA 3MTWA 1PBGA 4HYRA 4Y9OA 3NQGA 2P1FA 2YA2A 3LQGA 4QROA 4IMCA 4TIMA 4E5TA 4CQCA 1YMYA 3NOEA 3ZJ8A 4EE9A 3GDLA 1NSJA 3B9NA 5BWAA 1WKYA 1YTKA 3VINA 1TYGA 2WVUA 4HK7A 4LOCA 2W4XA 5LIWX 4FX6M 1UZ1A 2HV5A 2LLEA 3WEOA 3NUKA 1TPFA 3T0BA 1FFQA 1GOKA 1SPQA 1Q6RA 1XDJA 1UW9A 3JVAA 1A5NC 5CSRA 1BVNP 2XIIA 2F61A 2YCLB 1Q6GA 4DB7A 1VRDA 3NDOA 3DYMA 1VYSX 2BS9A 1WZMA 1QI2A 4K7VA 3LSCA 3GW0A 1HKVA 1WOBA 1T7LA 3SSJA 1E0TA 3TC3A 4B16A 5I3HA 2V82A 1IEWA 4UQBA 3LTPA 3VX0A 3S2JA 1W1ZA 1ZBCA 1NY1A 1WDWA 3PUEA 3EKGA 3QY6A 2Z2UA 1XLDA 4ZO6A 4DJEC 3CPRA 1WNOA 4IIEA 1MQPA 4LAZA 2HE8A 3RF9A 2DEPA 1WE5A 3LPGA 3TTQA 1NP2A 2WMHA 3E2RA 4IXXA 1FTXA 1W3LA 3BK0A 2QZRA 3EXRA 3GX9A 1UIOA 3LD5A 3S5OA 1EC7A 4H1ZA 4NJHA 4X61A 1IZCA 4EXQA 1UB3A 4AZ7A 1OX4A 4BK9A 2HMCA 1KXVA 4WRHA 3VPLA 4QE4A 1H7XA 3SW6A 1SGJA 3L0KA 1KRBC 3QKEA 3KOXA 3BSHA 1LORA 3PPHA 1L6WA 2QGYA 2DZTA 3HO8A 3VABA 5CGTA 3FK4A 1JDDA 2C8NA 1SZGA 1HVQA 3PZ9A 4ZE4A 4JYFA 3T0DA 5D38A 5FJUA 4ES4A 4AVOA 4U10A 2NXGA 2C1HA 4KH2A 3MKKA 3BJSA 3WF2A 5AYBA 3GNPA 4I7VA 1Z89A 4D6FA 2XJ7A 5I2UA 2PDQA 4FNUA 5CPTA 4E2BA 1HKKA 1JXKA 3CO4A 1JZ4A 2PRMA 2VFFA 4O12A 3MSRA 2JEQA 1PWLA 3PJTA 5AOUA 3XISA 5I3JA 3ENLA 4B5UA 4FR1A 2PMQA 4O8AA 2NQZA 3CIWA 3DG6A 4ZCWA 5G1YA 2ZUNA 4CNTA 5IM51 3QW4B 4DJDA 5A6AA 4AVNA 3WD0A 1T5AA 3QEZA 3RAOA 2IPJA 4RDVA 4DF0A 4EF8A 4ATLA 1BKHA 1PTAA 4JL1A 3UCCA 4DVOA 3WBAA 3YPIA 4S2CA 4EACA 1VENA 5FJTA 4O1DA 2YIHA 5HMSA 2AGKA 1ZFJA 4HNVA 1LJYA 2GDUA 3FEMA 2QAPA 3MI3A 3QYQA 3MDWA 2XM2A 1DIOA 2PP3A 3FAXA 2WOQA 2Y5JA 3LB0A 3BO9A 1VAHA 4H19A 4Z42C 3URBA 1DWFM 2X16A 3IJ9A 2JBMA 4CD5A 4HZ8A 1Z69A 2HXUA 3UBPC 5FI8A 2HE5A 2PWGA 4BR1A 5CZ0A 2VR5A 1DWAM 4NXKA 3T08A 3GNRA 4LWWA 3W2KA 5DMNA 2I9EA 1A5LC 1IYXA 1ZCCA 3DEQA 4MB4A 3L4WA 1XH1A 2QDDA 4H83A 3DG7A 3ITYA 4B9YA 2HPIA 1LT8A 1W1VA 1FH7A 4UTIA 1LQAA 3I68A 1E4MM 3M1ZA 2Z4GA 2VELA 4JCLA 4LBRA 4GX9A 1FA2A 1ITUA 1Y0EA 4TU1A 2ICSA 1JDFA 2QKFA 1E1FA 3W72A 4CN6A 3A64A 1B31A 4I9JA 4DYEA 2FGLA 3ANVA 1QW7A 1AW1A 2XHYA 3F03K 3CUHA 3WJZA 5CQ1A 4E4FA 3VTRA 5ABGA 3TSMA 1TX2A 1T8QA 3B4YA 4A05A 2VDIA 3TFXA 4DAIA 3POHA 1VH7A 3TNOA 1WDPA 3GZAA 2QW5A 1OCBA 1AH0A 3T1GA 1KM5A 2AAAA 2TPSA 3G1FA 2HVMA 5HJYA 1GK8A 3DI1A 4ZEPA 4QS5A 5AC8A 2YKKA 1UROA 4D6CA 3UJ2A 3RUBL 3M0YA 3WD3A 2CCRA 1DORA 2ZX5A 4BEUA 1XCFA 4MVAA 2FGBA 4XIMA 5IBXA 1MRQA 2RGMA 3RCNA 4LSBA 2CYGA 4CLMA 1Z6KA 3MO4A 5AHMA 1Y7VA 3NO5A 4JEJA 4GYJA 4L4OA 3BG5A 5HANA 1R2RA 4AHPA 1QOXA 1V51A 4YLWA 1EFZA 1ML1A 3QXBA 2DIJA 2J78A 3BARA 4Z2HA 4NY2A 4MY9A 5DT7A 1H51A 3WQWA 4B5XA 4W7WA 2J24A 1XH2A 1OYAA 2PTXA 4PCSA 4BF9A 5JBFA 5ENLA 3SGZA 1E6NA 1U30A 3VE9A 1UKSA 3AZTA 5HINA 1LF1A 4Q6JA 3L7RA 2OT0A 4S39A 2J7DA 4IMFA 3SO7A 1N55A 2IQDA 2J6VA 2FZMA 2ZWZA 2GQ8A 3KZPA 3TSBA 2BY1A 5A5WA 3TYAA 2PLKA 3PUGA 2QR6A 3WLHA 3GKAA 4UMBA 3QOKA 3GLCA 2I57A 2DQXA 1TTIA 6XIMA 2DVXA 2Y70A 3U3HA 3E12A 5BMWA 3W1LA 2A3CA 3E74A 1WCGA 5GNZA 1UYQA 2XWDA 1J2WA 2Y4SA 3H4XA 4U4MA 3SEPA 4XAGA 3F2CA 3IRDA 1P0DA 1YLVA 2R94A 5DBTA 4M82A 3B0XA 1KKRA 3DHPA 5CZJA 4LY8A 3B9OA 3FSUA 5TQLA 3H2FA 2I9UA 3TVAA 3GAKA 3NM1A 1EZ2A 1FP8A 1O5QA 4BJHA 1FWSA 2A0NA 1S5VA 4AB4A 1ZS2A 1YDNA 3O1NA 1TWZA 3WCZA 1ENUA 1WPCA 4M81A 2QLYA 5TNVA 3PS7A 1JI1A 2XGZA 5D4YA 3QMTA 2PDBA 1J10A 2R91A 4NL1A 4PUEA 1XLLA 1YE6A 4PUJA 3KCLA 1QI5A 3T40A 4GRSA 4DQWA 3H7VA 3AIQA 4DI9A 3ARXA 4S3KA 3IVSA 1A5OC 1QTWA 2Q09A 2YDAA 1GHRA 3WDPP 1R7AA 4DO7A 3II1A 4KRUA 4AY1A 4LYRA 4PZVA 4FOKA 1EQCA 3GXFA 4UTWA 2XZ9A 4M3PA 5JXQA 4YCOA 1Q7ZA 2GDVA 3FA3A 2NV1A 4AG0A 1NH6A 1IHIA 1G1YA 4RNFA 4JQ4A 1GPFA 1TJ1A 4PCFA 1A5BA 2VFDA 3UU0A 2DIKA 2P88A 5CPLA 2P0IA 1BYCA 2R1MA 1OK4A 3AIWA 4GNKB 3IVUA 1R2SA 4W5ZA 4LYPA 4F0RA 3SN0A 3GVWA 1QI3A 3QV9A 1IWAA 3W4RA 2RKXA 4B15A 3HQNA 2ZBTA 3HF3A 5AN7A 3M5ZA 4UTKA 2C0HA 3PBYA 6TAAA 1HL9A 4IJBA 1FUYA 2WAGA 2XH4A 3CZ8A 3GR8A 3PVFA 3W22A 4Q8MA 4C60A 1WQ5A 4M29A 1QPKA 3ARTA 4O52A 5FEXA 4ICMA 1O12A 3EPNA 4Q8NA 1VFMA 3Q4DA 2FVMA 1Z41A 3OGSA 4PTMA 3WO8A 7XIMA 5MKGA 4NJGA 1YBQA 1WAWA 2PWHA 1RAKA 3L21A 3DZ1A 1VPQA 3B05A 4MDOA 2Z29A 3PZNA 3HG2A 5K9DA 4CKQA 3O16A 3CH9A 4Z1YA 1U1JA 3GVRA 1JVNA 1WX0A 4XV0A 5E1QA 2WMIA 4HMCA 4AZCB 3U8GA 3PTDA 1WDDA 4OHQA 1SJDA 2HBVA 1RD6A 3UG5A 4O11A 3LHTA 3RMEA 2XSXA 1CBGA 3CHCA 5D9NA 4MADA 4F0KA 3K4DA 3W00A 1A0EA 2QULA 4AXKA 1YE4A 3GU9A 3I3DA 2PEVA 4RE2A 5LNRA 3VGEA 3WLPA 1LBMA 7CGTA 3ITOA 1L6YA 4N9EA 4MG4A 5B7ZA 1GQIA 2ISSA 2W67A 1KQZA 3LRKA 4RE0A 2VRJA 3VKCA 1R46A 3COTA 1R3RA 4O53A 3UF9A 2R9RA 1Q6OA 3SIZA 1GORA 4CGTA 4QBXA 1DKWA 4GNJA 3QHOA 1TJPA 4DEFA 2WZHA 4NHVA 4TO8A 4TUFA 4WLCA 2HTMA 1UQZA 1TJ0A 2PLCA 4J28A 1MZHA 3QPYA 4LUTB 3KOFA 2CLEA 3EXTA 3N6QA 1V0LA 4V2XA 2QCMA 4J4KA 3E02A 3W27A 4S23A 3EDJA 4FLRA 3OODA 3ARUA 4EP8C 4JX6A 4JIRA 4US6A 4W7VA 2XSBA 1QPRA 9RUBA 1OC6A 1RXOB 1B4KA 1TB3A 2YCLA 3HQ1A 3BOXA 1R8LA 2DY3A 2WNNA 2VDHA 3K8MA 3RK8A 2DZPA 3WH8A 2NXHA 4NZCA 4PMXA 2WHKA 2V6AA 1WB0A 3B04A 3TYCA 2OR2A 3I6TA 3QV7A 2O9OA 5I06A 4JFSA 3P0WA 2IMRA 1E51A 1UP2A 4K37A 4Q7BA 4C6MA 3WQVA 2WBGA 3L4ZA 1K9DA 2CXEA 1JCJA 4JAWA 3SY8A 4HSNA 1Q6CA 2OO0A 4LALA 3TCSA 3NR0A 1GJPA 3NQBA 2DV0A 1YXDA 3BGJA 3GZ3A 4HKPA 2C15A 2YZRA 3RIKA 4FB7A 4HIBA 2WQDA 7ODCA 1JUKA 4EVZA 3GUWA 1JAKA 1HP5A 2WLZA 3SY5A 3CHFA 1KM6A 2ZA1A 3PPGA 3CEUA 1V3KA 9XIAA 4DBEA 6XIAA 3W2LA 4D9PA 2EJAA 2WHJA 2DJLA 4GG9A 3NVDA 1XX1A 3W38A 4AEEA 3O7UA 5CC6A 1JCNA 4TX8A 4ZVJA 1JPIA 4KEUA 3TZFA 1XYFA 5HWJA 1KRCC 1UP3A 2Z6IA 2HXTA 1HFBA 3SECA 2Z1KA 5BXRA 2XTKA 3UR5A 5FIPA 3LEPA 3DFQA 3E0FA 4LYKA 2VKZG 5D8WA 3GD6A 4UNLA 3JZEA 1GYNA 1DIEA 1PTDA 1ZALA 4WDXA 4R85A 1HIZA 4CVUA 3GFZA 3EX3A 2GGJA 2AQOA 1OD0A 1VEOA 3ALGA 4NRRA 1RJPA 4GUFA 2RFGA 2E0PA 3SBFA 3W7DA 1KM0A 5HNUA 1B3ZA 3SCNA 2FTWA 3PFRA 4XZHA 2ZA2A 4MJMA 3W2JA 4C6OA 2OKOA 4QJ5B 5F1VA 1S2WA 2EF9A 2POTA 2QQ6A 3QOMA 5EGRA 4W88A 5H91A 1EJSC 3QN3A 3SFWA 2CHOA 1UUMA 3ABRA 2VOMA 3H6OA 3M47A 4DZ5A 2YX0A 2VOTA 2V67A 3NYDA 4HNCA 1YTEA 4IPIA 3UA3A 2QYGA 4DJFD 1ME8A 1MMFA 3T78A 4GZ7A 4FX7A 2VGIA 1V93A 5DX7A 1T99A 3QV6A 1YPIA 1ONWA 1HJWA 1C8VA 3TP4A 4H8HA 2VJXA 1XYCA 1E9LA 4GC3A 3AZSA 2DDXA 1QT1A 1RQEA 5A8QA 1O66A 5F4WA 5I24A 4A4AA 1J18A 3R12A 3MW7A 3RLUA 4FSAA 3LI0A 4JX4A 3BW2A 3WBXA 3G1XA 4JTUA 4H3DA 4Y9AA 2R1NA 1PYMA 4GNVA 2FMOA 2DH3A 4CCDA 3WX7A 3WMSA 2YLLA 3BANA 1LLWA 1MW2A 1H2JA 3DHDA 1X6LA 4E8CA 2YXOA 1EPVA 3TYDA 1BVWA 4AHQA 5HJLA 4WGHA 2W63A 4L1XA 3BAIA 3P84A 2R6OA 5IXEA 4R27A 1X1NA 3MZ2A 4CNUA 1XLKA 5IDZA 4R33A 3UWYA 4N42A 3G3MA 3HURA 4HHMA 1PL9A 3N2CA 2GJNA 5FJJA 2UV8G 4ENLA 4PCPA 1BSLA 3O2LA 3MWAA 3FEQA 1RD5A 1WBJA 1I75A 2RHGA 4PEEA 5PTDA 5C9ZA 4BQ4A 3ZVHA 1E3ZA 1XRFA 4MAVA 3IIZA 4RR4A 2QJGA 1EIBA 3TMLA 2DUXA 5XIAA 4AEOA 1ISZA 4WF7A 3IJ8A 5EFFA 1UKPA 2XVKA 4IFOA 1RV8A 1UD4A 4YTUA 2Q8ZA 4CCZA 3FJNA 3GXIA 4GCAA 4TR9A 1FHLA 2OWWA 3GHRA 1JR1A 1W9BM 3LHUA 2ACSA 3RG6A 2FZNA 4UFHA 1G01A 1QASA 2VC9A 5E5CA 1CEOA 3WH5A 4E3TA 3CQKA 3EXSA 4UTFA 3WJSA 1K77A 4AC7C 4MB3A 5EKYA 1TVLA 1DPMA 2YLAA 1QNSA 5BW6A 3IGHX 3KVJA 3TKFA 4GZIA 2FZBA 2IKHA 3OU8A 2ZICA 3ELFA 1TTPA 4GD0A 3UXLA 4JQ1A 5CAKA 4MWAB 4TTUA 2WW5A 1PZ1A 3N1AA 3OZPA 3G22A 2YCEA 4PTXA 2D2OA 2H9AB 1E71M 3OOQA 4GXMA 1PHWA 4PTDA 2Z1SA 3DGRA 3LHWA 4ACYA 3N9KA 1M7JA 4E38A 4AD0A 4B4FA 2Y5SA 4MNJA 4JTLA 2V5LA 2FVLA 4C6BA 4PULA 1KXHA 2O9RA 3RU6A 4KF1A 2WVTA 4GA8A 1P0KA 4H7ZA 5AKQA 2VGGA 3ERPA 3T8LA 3BAXA 1FBAA 4L6HA 2WJDA 4AYSA 5CBBA 1EXPA 2ABBA 2MUCA 1WOAA 3TTYA 3UR2A 4BQ3A 2WC7A 1JZ8A 3WBYA 1EA9C 2J9XA 4E4PA 2ZQ0A 1DWHM 1DHKA 4YVVA 1UC4A 1JDAA 1M65A 1S5MA 1I2PA 6A3HA 1M68A 3IV3A 3S0CA 3PAOA 3VMNA 3LHZA