3U7BA

A new crystal structure of a fusarium oxysporum gh10 xylanase reveals the presence of an extended loop on top of the catalytic cleft
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
327
structure length
327
Chain Sequence
AASGLEAAMKAAGKQYFGTALTVRNDQGEIDIINNKNEIGSITPENAMKWEAIQPNRGQFNWGPADQHAAAATSRGYELRCHTLVWHSQLPSWVANGNWNNQTLQAVMRDHINAVMGRYRGKCTHWDVVNEALNEDGTYRDSVFLRVIGEAYIPIAFRMALAADPTTKLYYNDYNLEYGNAKTEGAKRIARLVKSYGLRIDGIGLQAHMTSESTPTQNTPTPSRAKLASVLQGLADLGVDVAYTELDIRMNTPATQQKLQTNADAYARIVGSCMDVKRCVGITVWGISDKYSWVPGTFPGEGSALLWNDNFQKKPSYTSTLNTINRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a GH10 xylanase from Fusarium oxysporum reveals the presence of an extended loop on top of the catalytic cleft.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ENDO-1,4-BETA-XYLANASE
total genus 134
structure length 327
sequence length 327
chains with identical sequence B, C, D, E
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2011-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00331 Glyco_hydro_10 Glycosyl hydrolase family 10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3u7bA00
4XZBA 3ZT6A 3VDHA 1WZMA 2DSKA 3WBAA 4DUWA 1J11A 1V03A 2W62A 4P7LA 2VCAA 1CXFA 2WCGA 3GBDA 3GXDA 4AXNA 4QLJA 1WKYA 2YDRA 5HDRA 4YPJA 4ZEPA 4AWEA 5GQBA 3OIHA 5BROA 4ACYA 3U5UA 2XUCA 3AYRA 4YN5A 2WMKA 5A3HA 4LX4A 1E40A 4PMQA 1ZBWA 4LGXA 3WQ6A 2OSWA 3QOKA 1XSKA 1MQRA 3L4WA 3DYPA 1UA7A 4L4PA 2WWCA 4U2YA 2XVLA 4A3YA 3WH9A 1N82A 4UOJA 1C90A 1KWGA 2WVSA 3VMPA 1JIBA 1QBBA 1WDQA 3ZSSA 2EEXA 4NI3A 3L2MA 2D23A 4W84A 4UCFA 2F61A 3U5YA 2D20A 3WNOA 1CDGA 4E2OA 1JNEA 3AMGA 1CXKA 1OINA 3VOCA 3PZIA 4PEEA 3T0DA 1E0XA 5LA1A 1CNVA 1CZ1A 1EQCA 5GNYA 1HL9A 2QV4A 3N12A 3K8KA 3SCOA 1W1VA 1HVXA 1TVNA 2NSXA 1K9FA 2J7BA 2BVDA 3WNPA 4GI6A 4R27A 3PZNA 4PMNA 2ZX6A 4PMXA 1HJWA 2E0PA 4BA0A 1NWTA 5CLTA 1GVYA 4M8UA 1UA3A 2CKSA 4H04A 3WSUA 2YDSA 1G0CA 3MMUA 2FH6A 4CKQA 3ARWA 1QNQA 3SUUA 4PMDA 2EPNA 3EDEA 1BHGA 1E73M 5E0FA 3NDZA 4UQDA 1VRXA 2D22A 4K68A 3ARYA 3VGBA 1LL7A 3VMNA 1DWIM 1UKQA 1B3VA 1YHTA 3WEOA 2VR5A 1R7OA 4KH2A 4OKDA 2D2OA 4AZ5A 3GBEA 3N1AA 3WF1A 2O9PA 2GJXB 2CEQA 4OOUA 3L4TA 1K9DA 2PI6A 4BZYA 4CN6A 2X0HA 2ESCA 3OGSA 2BS9A 1NWUA 3AMLA 4OZOA 1W1TA 2NT1A 3CZJA 3SCVA 1DP0A 2BY3A 1B90A 3EDJA 4H41A 3WD4A 2BXZA 2DEPA 3IJ7A 1BG4A 3MU7A 1V6WA 1PZ3A 4NSBA 1B3ZA 3WBEA 1V3KA 3CUFA 4JKMA 2BFGA 4HOXA 2EXOA 3RJXA 4CVWA 3BAKA 4UNIA 3I3EA 5D8WA 3ARSA 1AQHA 4W7WA 1ZL1A 3UESA 1CXHA 3IAQA 3M6DA 2QPUA 3MKKA 4PTVA 1GOIA 3NDYA 4MDPA 5BXPA 2VZTA 1HT6A 4HMCA 2CHNA 3RM4A 2EPMX 4CGTA 1J01A 4N42A 3ZJ8A 1ZJBA 2VNCA 3AMCA 4WKHA 3GNRA 5I3DA 4P7RA 2G3MA 7CGTA 1NM9A 4NRRA 1UR9A 4Z2IA 5I23A 2WK2A 5DF0A 1KXTA 4OIFA 1XRVA 5BXSA 1UWIA 4CD6A 2PBGA 4HZ6A 1U2YA 1HP5A 2JEPA 3AZTA 4RE3A 3CLWA 1FFQA 1IT0A 3ZT7A 2FDMA 1Q4NX 3VMOA 4Z2KA 5AY7A 1IZKA 2J7DA 2J25A 3GH7A 1OD8A 2VC9A 4KGLA 3IANA 2CKRA 3EMQA 4W88A 3W81A 2EPKX 5A95A 2UY2A 3LMYA 3AIRA 2GDVA 4P7QA 3GXMA 5I0DA 4W93A 3K8LA 4B3LA 3AJ7A 2WB5A 4UQEA 5AC5A 3D3AA 2G3NA 2JALA 3KL5A 1CGYA 4NZCA 3AYSA 5A6MA 4CD4A 2VVSA 1RP9A 4PSRA 2FGZA 4CU6A 4UFKA 4HPGA 1FFRA 1EO7A 4AD3A 1KGXA 1KWKA 1JYWA 3K46A 5EMYA 2XSAA 4ZFMA 1UR2A 3OLGA 4M56A 2PC8A 4AZCA 1I1WA 4PCTA 1QHOA 4CVUA 1U30A 3WN6A 4F66A 3K8MA 4D6HA 3F5LA 4UQAA 2E40A 2E9LA 4D6GA 2OYLA 1E72M 4IISA 5A69A 1C8YA 1MQPA 1V0MA 2DT0A 3BAYA 3AHVA 2VL4A 2JF6A 5CXPA 1GONA 4KRTA 1EDTA 5JBFA 1OGBA 3ZJKA 1NOWA 1R85A 3SCRA 5F7UA 4MADA 3WDRA 4EANA 4AISA 2VURA 2BHZA 5CPTA 4OUEA 4OOZA 1H1NA 3KL3A 4MNJA 3VM7A 3W0KA 2WXDM 3TOPA 3NSNA 1CXLA 3WQWA 3WL0A 1SMAA 2D0HA 1GQKA 5D9MA 4CN4A 3WD3A 1EHAA 2XVGA 4DM1A 2VX7A 4U3AA 3EDFA 3GM8A 1GOQA 1MFUA 2YLAA 1JD9A 3BXWA 4HA1A 3SEPA 4CU7A 2B31A 5E9AA 1GVIA 3A3HA 5D9OA 3ECQA 1FOBA 2WVUA 3AXHA 1YQ2A 1ITXA 2XFFA 4AZ7A 1E9LA 4PTXA 4GO9A 4WIWA 5LYRA 2OSYA 2O9OA 4HA4A 1XYFA 3PZGA 4W7VA 3UCQA 4CCCA 1HJSA 4U5KA 2G4FA 1VENA 1UWTA 2VQTA 3TP4A 1ZB5A 1V08A 1FP8A 1JG9A 4D71A 3WNNA 2RGLA 4WKAA 4UFHA 1KR0A 2J7GA 4WJXA 1ESWA 2A3HA 5CLWA 1XC6A 1JFXA 4J3SA 2BVYA 3M46A 2EO7A 3KL0A 1XD0A 3M7SA 2YL6A 3W25A 2ZWYA 2ZX5A 1UWUA 4EKJA 1AQMA 1TZ7A 1UR0A 3WNMA 4U33A 4ZE4A 4P7NA 1J10A 2BY0A 3PN8A 1VB9A 4LYRA 1CTNA 1C7SA 3AOFA 3AS0A 3DYMA 3GTNA 2ZWZA 4C7FA 5A8OA 2GJPA 1JZ2A 2WMJA 1F4AA 3KWXA 1QNRA 3VDCA 3OZOA 2IXUA 5I5RA 3N17A 4GI8A 4F8XA 3AZRA 2CERA 5I78A 1KR1A 1HL8A 3W29A 5C8BB 1HKJA 3ALFA 1FHLA 1WP6A 1QPKA 4ZXOA 1B1YA 1H5VA 1QVBA 3WUFA 4W5UA 1H49A 2WPGA 4HMDA 2DSVA 1UKOA 2VUYA 2E9MA 3WFLA 1E5NA 3IAPA 1G94A 2WAGA 2CBUA 5EBAA 1JDAA 3AROA 1CGXA 2VT0A 2J7HA 3SCSA 1NP0A 1CGVA 3U7VA 5A2BA 4JFVA 3ZJ7A 4XUYA 5CSUA 5BRQA 3W4RA 1XCXA 1WDPA 4U3CA 4W87A 4JCLA 1E6SM 1ZBKA 2NT0A 5AYIA 3VD7A 1AQ0A 3VM5A 2CPUA 3SUVA 1E15A 3RM8A 1R87A 4D1JA 1EQPA 1I1XA 3UG4A 1JXKA 3N15A 3WD2A 3VPLA 5C71A 2MANA 2V3DA 3T08A 1CXEA 1KGUA 1MXGA 4J3TA 2Y4SA 3BAWA 4AZBA 3PZ9A 3GXFA 3WMCA 4X9YA 1C93A 2XVKA 1UQZA 1V6VA 1W9VA 1M7XA 3WF2A 1UWSA 4DWSD 4WF7A 3SUWA 4W8LA 1DWGM 3N18A 3GZAA 4BF7A 6CGTA 3RDKA 4PMOA 1GCYA 3N9KA 1CXIA 1WZKA 5HNNA 2VRJA 2VOTA 1PEZA 2ZUVA 3ARUA 3NSMA 4PMZA 1QBAA 4JL1A 3IJ9A 1MW1A 4Q22A 1CYGA 1BLIA 2WVVB 1CGWA 2UY3A 2PF0A 3VIGA 1KQYA 1LG2A 1MQQA 1QHPA 5GPRA 4JL2A 3SUSA 2BHYA 1WDRA 1JAEA 3PTMA 1L0PA 2ZUMA 2V3GA 4V27A 4UTFA 3EDDA 3VIJA 1R86A 1GJWA 3SCQA 2FH8A 2W91A 1MW3A 2WMIB 1DHKA 4AD5A 1SYTA 2G8ZA 7A3HA 3G6MA 4BCEA 1NH6A 4AZGA 3BMWA 2YL9A 1EO5A 3CHFA 4RL3A 2X09A 2ZUTA 1H41A 3ZSTA 4CD7A 1E1EA 6TAAA 4FF5A 2YOCA 5JBDA 2V5DA 2BY1A 4HZ8A 5E09A 1QOXA 2BHUA 1HIZA 1BGAA 1CLXA 4XV0A 1M03A 1PBGA 2J74A 4OJYA 1E6XM 2VZUA 1EIBA 1IV8A 1UUQA 2WHLA 3MS8A 3SIMA 2OWXA 5M17A 4W85A 3CZKA 3WMSA 1UD2A 1QI3A 4C7GA 2A3BA 4R5EA 1B2YA 1ODUA 1PPIA 3PZQA 3U57A 3A4AA 1OD0A 2A3AA 3QGVA 2OWWA 1CLVA 4CCEA 3DYOA 4QAWA 4KGJA 3MMDA 4GINA 2YBUA 2C0HA 1EXPA 1W2VA 2XPKA 3EMCA 3LPFA 3SCNA 4QLLA 2YA1A 4AY1A 2WBGA 4M80A 1UD5A 4GI9A 2JFEX 2VTFA 2VZOA 1LL6A 3UETA 4H8VA 2W66A 4M1RA 3VGHA 1E56A 2D1ZA 1TFVA 2QMKA 2WYSA 4U2ZA 1KFWA 4AW7A 5IDIA 4AIUA 5BWFA 1WZLA 5BRPA 4FLSA 1OGGA 2WANA 3CZEA 4PSPA 3S2CA 4QLKA 3OA5A 4QFUA 3RO8A 5A6BD 3WDQA 5KEZA 2PWHA 2XHYA 3FY1A 1H11A 1WCGA 2DIEA 2IXVA 2CYGA 2PB1A 3T0AA 1ITCA 3MMWA 1J18A 1XD1A 1JF6A 3T2OA 3FNDA 4IPNB 2XIIA 3GH5A 1JF5A 1W3KA 1B31A 3LPOA 4U5IA 1BVZA 5FL0A 3AIBA 3AIEA 4AZCB 4PMRA 3O2LA 3ZO9A 1PX8A 1VFMA 1NOFA 3BLKA 3TONA 2AAAA 2DH2A 4Q7NA 3ZIZA 1OIMA 2G3IA 4MAVA 1W1YA 2J79A 3CUHA 4NF7A 4AIEA 4PCSA 1C8QA 4QCEA 3EBVA 3PBGA 4KMQA 4PMUA 3VIIA 1B3XA 3AS3A 3A6OA 2QF8A 1B30A 2PWDA 3F5JA 1K6AA 3FN9A 1BAGA 1OSEA 1LL4A 3I3DA 2E9BA 1GOMA 5FL1A 2E8ZA 3QR3A 2YA2A 3POHA 1LWJA 4AZIA 2CNCA 2AOSA 1WB0A 3G6LA 2QHAA 3MSGA 1GQLA 3L4VA 3WENA 4JHZA 2JIWA 1QI2A 1P6WA 4GKLA 2X05A 1E5JA 4D6DA 3L2LA 4H2CA 4B15A 2ZUUA 1X1NA 1E43A 2A3EA 4PTMA 1BPLB 1JZ6A 4ML4A 1UWQA 2CESA 1UKSA 2D0FA 2YL5A 2ZX7A 1HKMA 3S6TA 3BH4A 3BAJA 1TA3B 1TR1A 2J7CA 1H4PA 3WDJA 1ISXA 3WDPP 4OBRA 1JXJA 1VF8A 3B8SA 4J3WA 1HJXA 1QNOA 5D9PA 5BXTA 2V3EA 1IZJA 5IHRA 1US2A 5CSYA 2J8FA 1J0HA 3WQ4A 1XSIA 5FOOA 2WKGA 5CZKA 2D0GA 2CXGA 1E6RA 4FMVA 4JCMA 3OGVA 5D9NA 5AC4A 4IPLA 1GHRA 4TXEA 1BFNA 1J0JA 2WLZA 2WHKA 4C7DA 3FHAA 3GNPA 1GUVA 1E0VA 4JFSA 4ACZA 2CHOA 1J0YA 2VX5A 5ABFB 2VMFA 4IUGA 3O9NA 5CPQA 3HMCA 3J7HA 1CGUA 3VIOA 2EJ1A 4JFTA 1G5AA 3AS2A 5FCZA 3W27A 1CECA 3WD1A 1MFVA 1VBUA 1TCMA 3LPPA 3OG2A 2CITA 3PHAA 1JD7A 5LA2A 3TTQA 4MNLA 1WDSA 4A4AA 4GO8A 3VD5A 1VEMA 3VO0A 1V02E 2VCBA 5CJ5A 4GPNA 3NCOA 5ECUA 3WQ5A 5I2UA 2C7FA 4M82A 2QMJA 3CMJA 1JI1A 4J7RA 1D2KA 1ISWA 1VIWA 3AIVA 4IM4A 2EQDA 2GSJA 2XGIA 1MW0A 2F2HA 4PN2A 4H8HA 1JZ7A 1XGZA 3OLEA 4AZ6A 1DWAM 3DHUA 1Q6FA 2Y8VA 1RD6A 3VX0A 1JZ5A 2VJXA 1HJQA 3RJYA 1PAMA 1R7AA 1EGZA 2VVNA 4D6EA 4TVUA 3ARRA 2VZVA 2Q8XA 3AIQA 2D3LA 3AICA 1GQIA 5DT7A 1H0GA 2ZXAA 2XFYA 3E1F1 1PIFA 4LXFA 5EB8A 2XG9A 2FGLA 3PZVA 1RPKA 3F4VA 5E70A 1UD3A 3WH6A 1NARA 2HISA 3SCUA 1C92A 2WMGA 4MPKA 1BSIA 2GJXA 1QW9A 4QCFA 5HBFA 5HPOA 2DDXA 5A8QA 1Q6EA 1WZAA 2VX4A 1MW2A 1BGGA 1UOKA 3APGA 3VINA 3ZOAA 1KBBA 2WHMA 2W63A 2WC7A 5A6KA 3CTTA 2WSKA 1LQ0A 4D6IA 4JKKA 3W6MA 1UR8A 4S3JA 4MJ2A 2VQUA 2J62A 3VDBA 1US3A 3VILA 1PZ2A 5IHSA 4AD1A 4PTWA 1A47A 2ZX8A 3BCDA 1DWHM 2NW0A 4TVDA 2YJQA 1E4MM 5A8MA 1HF6A 3SCWA 3CHDA 3CZLA 1M53A 1VJZA 4E8CA 3PZMA 3SURA 1EOKA 1KQZA 1BTCA 2PWEA 4GXPA 1W3JA 3SCPA 1EDGA 3ZMRA 2E8YA 1OT2A 3K1DA 4WSKA 2J78A 2YL8A 1WE5A 1H2JA 1H3GA 2ZXBA 3CBWA 3AHXA 4FLQA 4MDOA 3L4UA 1K9TA 3UEQA 4HPHA 1FP9A 3BAXA 1QNSA 1HVQA 1UZ4A 3WKZA 2V5CA 2Y5EA 4PUDA 5FD0A 1JZ4A 1UQYA 3VTRA 3AS1A 2OLHA 2WKLA 3WF4A 3L4XA 1Y7VA 2AMGA 4MNMA 3W24A 1GOWA 1W9BM 1KCKA 4N0RA 1VEPA 4Z2LA 4JHOA 3ARZA 4DUVA 4HA3A 4CD8A 3TTSA 1FHDA 1ZJAA 3ZQ9A 1W9XA 2BVTA 2XM2A 4P8XA 1QI0A 2WSPA 3WF3A 1C91A 4JIEA 4GZIA 1KXHA 1E6ZA 3O6AA 1S46A 1V02A 4GZJA 4X0VA 5E6YA 4X0NA 3OLDA 2DT3A 5A6LA 3MUZ1 3VGGA 3JUGA 3MUAA 1BF2A 4HOZA 3FAWA 3GNOA 5AYBA 4JZ5A 4W86A 1GJUA 3VIPA 2BXYA 2GUYA 3ZT5A 2WC4A 4CU8A 1OWQA 3TA9A 1CPUA 2W92A 2WM0A 3A47A 2WVTA 4V28A 3KEHA 3N11A 1V0NA 1MXDA 1SFSA 4AD2A 2Z1KA 3PZTA 4YHEA 1OM0A 3AQUA 1AMYA 3BMVA 3RILA 1TVPA 3MUY1 5JUVA 4LYPA 1JDCA 1XSJA 1O6IA 2D24A 3WEZA 3FXYA 4J3VA 5ABGA 2JEQA 1UH4A 2C8NA 2WZEA 2ZICA 3KZSA 4UOZA 4UQBA 2CIPA 3PZUA 1JYVA 2VZSA 8A3HA 1M01A 1W3LA 1C8XA 2DSWA 1WNOA 3AZSA 3CH9A 5KZ6A 3VNYA 2ZXDA 3ZR5A 1V6YA 3WY1A 1ODZA 4UOQA 2DH3A 1C3FA 1BYAA 3BSHA 1CWYA 1UG6A 1V6UA 4XB3A 3WDHA 1TE1A 3AXIA 1AVAA 5A1AA 2XTKA 4J3XA 3MV11 1JDDA 3AIUA 3PTKA 3THCA 3SCTA 2J7FA 4BQ2A 5FIPA 2WCSA 5A6JA 2F8QA 4D6JA 2G3JA 4F9DA 3WUGA 2DGAA 2A3CA 1B3WA 2WNWA 5I77A 3BAIA 1V3MA 1E0WA 5A6BA 3DECA 2OSXA 5E6ZA 3QHOA 1W9UA 4ZE5A 1MYRA 4DWSC 5D4YA 4BQ4A 4RE4A 5JIPA 5JBEA 3AHZA 5CQ1A 1UKTA 4UQCA 3MUIA 2WC3A 2BV9A 3MANA 3WD0A 4ZXLA 5CGTA 4AEEA 4RE2A 2XGBA 1UD8A 3GDBA 5DO8A 4E4PA 1L8NA 2UY4A 3I3BA 1PJ9A 3B9AA 4QDMA 5E0CA 1UWRA 2J75A 2OWCA 1NWRA 2J47A 1EA9C 2ZIDA 1Q6CA 5A8NA 3NUKA 4WLCA 1DWJM 4ATDA 4H7VA 2W5FA 3W26A 4V2XA 3MV01 2ZE0A 1MWOA 2VRQA 1QI5A 1V3LA 1NWSA 3NJ3A 1LF1A 5DT5A 3MSDA 1V3JA 2WCAA 3K4DA 3F5KA 4Z2GA 3POCA 2DPEA 4AYSA 4D72A 3HJEA 4EK7A 1M04A 3CZ8A 2GVYA 3CHEA 3EYPA 4E8DA 1HJUA 5HXMA 4F9JA 1XYZA 4AIOA 4CD5A 5ABEA 4TUFA 1NP2A 4PMVA 3OB8A 3VDAA 1LLOA 3HN3A 4AC1X 2E4TA 5M5DA 3HU7A 1XH1A 3LPGA 3CUJA 1JZ8A 5ABFA 1GQJA 2Y24A 3GYCA 4WKFA 1GORA 1HXJA 1W91A 4AMCA 4J27A 1EHNA 4BS0A 5BYWA 1BYDA 3VGFA 2YBTA 2ZUWA 2DSZA 2VCCA 1X6NA 1KB3A 4HU8A 4UFMA 4LQ1A 1J9YA 2ZOXA 1E55A 2WW5A 9CGTA 1E6QM 1VFOA 2EPOA 2QLYA 4H8UA 2VI0A 3SUTA 3VGDA 3II1A 1W9DM 1UYQA 4HMEA 4EAMA 1ISYA 1GHSA 4MB5A 2OYMA 1GZJA 1F4HA 1GPFA 2X8RA 4AD0A 3AIWA 1TMQA 1HX0A 2J7EA 1C7TA 2VRKA 1BG9A 3WUEA 3VIKA 7TAAA 1KGWA 4Z2JA 4YHGA 2WZIA 4J3UA 1J0KA 1OT1A 2XWDA 2JE8A 8CGTA 1G9HA 2Y8KA 3VX1A 3NSXA 4W89A 3T0BA 1NQ6A 2BNJA 5CGMA 3THDA 4MJ4A 2GJRA 2O9TA 4BQ3A 3W82A 3QHMA 2ZX9A 2VR4A 3A4XA 5A8PA 3WNKA 3PZOA 2DQXA 4PBGA 2UY5A 4DM2A 1V0KA 1LJYA 2EBNA 2WHJA 2WZHA 4U31A 3OLIA 1Z32X 3VKKA 1E4NA 1CGTA 2VO5A 4AZHA 2XWEA 2XIBA 5D8ZA 5GNXA 4B16A 4S3KA 3TTYA 1PX3A 3AHTA 1E71M 1TA3A 5CPSA 3WH7A 4M81A 1E1FA 5C70A 4LPCA 2D3NA 3CZGA 2V38A 2G41A 1FH8A 1DTUA 5A6AA 4PRWA 2FHCA 4P8VA 2GDUA 3WF0A 3B9EA 3WH8A 1W9PA 3TTOA 1WPCA 4BQ5A 2XVNA 1UZ1A 3WEMA 1W1PA 2CBIA 1JAKA 4UZUA 3U7BA 1JNDA 4M24A 3WMBA 5I24A 4GIAA 5IXEA 1XV8A 1BYCA 1FA2A 4CUCA 3W37A 2PWFA 4XZWA 2XJ7A 3RCNA 4KWUA 2CBVA 1HJVA 1OGSA 2PWGA 3CIVA 1TUXA 1VJSA 2XVPA 3AHYA 4B9YA 4FLRA 2BY2A 4UFIA 4W8AA 1E3XA 2UWFA 2WMHA 3VUPA 4W7UA 3OGRA 1G1YA 1B3YA 3DHPA 4JFUA 3ZJ6A 1HN1A 2WLYA 3ZR6A 4D6CA 4UQ9A 3BSGA 3UG3A 1JI2A 3DC0A 2CCRA 5BXRA 1NOUA 4JAWA 3A4WA 2J77A 1K9EA 4P8UA 1Q6GA 1O7AA 1UH3A 2PBOA 1ZS2A 2VX6A 1J12A 3N13A 1EDQA 4DUXA 3GXIA 2XYLA 3ARXA 2ZUNA 1KXQA 2YA0A 6A3HA 4HTYA 3W38A 4W5ZA 5HPCA 1E4LA 5TD4A 4HU0A 4GQQA 3RMEA 3VU2A 3EMZA 1ISZA 2W61A 2XM1A 1W2PA 3D5HA 2RGMA 5BCAA 4TVCA 5CG0A 2OYKA 1XCWA 1V3HA 5ABHA 3VIMA 1WO2A 1DEDA 1MVYA 4B3KA 1X6LA 3W53A 4P7OA 3CUIA 3IJ8A 1ZBCA 3UG5A 2O9RA 1CIUA 4JFWA 4TX6A 5DEZA 1PX4A 1BYBA 1D3CA 3CMGA 1OB0A 1VAHA 1Q6DA 3WIJA 3OZPA 3UR8A 4PUEA 4W8BA 3T09A 2Z1SA 1I75A 3CGTA 3WFZA 3CUGA 2O92A 4FK9A 4D1IA 4TX8A 3FAXA 2Y2WA 1H09A 4OBSA 5GNZA 3VIHA 2J4GA 2IUZA 4HP5A 2CETA 5I79A 4UZSA 3ARTA 1JFHA 1B9ZA 2WMIA 4AEFA 4M29A 1UKPA 5IFTA 2QPSA 4D6FA 3NYDA 2CBJA 1E70M 1UH2A 2XSBA 3AXXA 4URIA 1XH2A 1R8LA 1HKIA 1BQCA 2HVMA 4DWSA 4PMYA 3AISA 3WQ8A 4J28A 3WUBA 4XX6A 4GQRA 4DWSB 1LG1A 3FHQA 4UFLA 1JZ3A 3ARVA 3ZM8A 3RPMA 2WMFA 4F79A 2WBKA 2TAAA 4AD4A 3WL1A 1JYNA 1JL8A 3WELA 4A3HA 3WNLA 1HKKA 5IFPA 2ZXQA 3CO4A 1UR1A 1UHVA 4MNKA 1BVNP 5FKYA 3VIFA 2FHFA 4WK9A 5LA0A 2XFRA 1RP8A 1OIFA 3GH4A 1KCLA 1OCQA 3QOMA 4ACZB 1GNXA 1HP4A 1JYXA 2DIJA 1W3HA 3W28A 3CPUA 4UR9A 1CBGA 1GOOA 2FHBA 1QW8A 2YLLA 3QHNA 5HOSA 2DT2A 4UFJA 2GFTA 3FW6A 1PIGA 2X0YA 1EH9A 2X1IA 1U33A 5EFFA 2JF7A 4ATLA 3BCFA 5A2AA 3ALGA 1E6PA 2ZUSA 3WH5A 4ATWA 5EFDA 3VGEA 1GW1A 3RM9A 2EPLX 4MB4A 4MB3A 2DSUA 1G01A 4LYQA 2W67A 1TG7A 4WSJA 2YKKA 3EDKA 2YDQA 1EOMA 3RIKA 3UR7A 1E6NA 2WVVA 3AFBA 4PYSA 5I6SA 1UD4A 1RH9A 1OBAA 4TOQA 3VVGA 4EE9A 2V3FA 1H0IA 1J0ZA 1V6XA 4CN1A 3L4ZA 1SMDA 3K4AA 4HOWA 1J0IA 5JIWA 5M3WA 3UERA 1KXVA 3N04A 4TTUA 3VNZA 1ZU8A 3OBAA 3AMDA 1XH0A 5A2CA 3AMKA 3M07A 1B0IA 1A3HA 1XHGA 4MB1A 4MAZA 4MTVA 1D7FA 3BLPX 5A94A 1CEOA 3W6LA 3ARPA 4HZ7A 5DFAA 2GK1B 3T2PA 1HNYA 1QI4A 1SR0A 1V3IA 3VD3A 4P8WA 2DT1A 5DMYA 4JKLA 4GZEA 4CCDA 1ISVA 1JGIA 1VBRA 2X2YA 1GOKA 1DWFM 1VFUA 2J8GA 3CHCA 1ZBVA 1W32A 4B9ZA 4Z2HA 2WWDA 3BGAA 1VFFA 1UD6A 3VD4A 3VD9A 4KRUA 1KBKA 1ECEA 1QHZA 5A6SA 3BC9A 2W4XA 5M03A 3T2QA 2E3ZA 3WQVA 4TTGA 3IK2A 4Y7EA 3PTQA 1E4IA 1LWHA 3L4YA 1CENA 3KE0A 1FH9A 4ZENA 2JIEA 1WAWA 2YIHA 3NIYA 4NRSA 4QP0A 4FLOA 2GK1A 1V0LA 1UR4A 1QNPA 1VEOA 3MO4A 1FH7A 3B9DA 1E3ZA 3ARQA 3WDIA 3AI0A 4L4OA
chains in the Genus database with same CATH superfamily
3IARA 3DBNA 4XZBA 3ZT6A 1WZMA 3GDLA 3CAQA 2GGEA 1JVNA 4BFAA 3FKRA 1V03A 3TMLA 3GBDA 2RJGA 3KFTA 3VFLA 3QR0A 5DBUA 4MZYA 3UT0A 4YPJA 3RCYA 1F6KA 3QY8A 5GQBA 1OZQA 2DZUA 2A7PA 4YN5A 2WMKA 4N9BA 3W2KA 4LX4A 1JCLA 1FHUA 4Y8EA 4ZMGA 3NQBA 1JJKA 1NELA 1K7EA 3F4WA 5CPNA 1CB7B 2TSYA 2WWCA 3W7RA 3F2BA 4UOJA 2V68A 4X60A 4GX8A 3OVGA 3S1WA 1AL8A 4TIMA 1OINA 4LB3A 4ML9A 3VOCA 1P0BA 1RA0A 1CNVA 4IMAA 3N12A 3K8KA 3S3GA 3MHUA 4Q8TA 1QOQA 3TV8A 1GVOA 3B03A 3GG8A 1VPXA 3WNPA 2A1YA 1M6JA 1OZMA 3GW0A 2E0PA 4HNLA 1GKQA 1NWTA 5CLTA 3TN3A 1UA3A 3FA3A 3R58A 4H04A 4RLIA 1TTJA 5J8LA 2YDSA 3PJXA 3GVQA 3TC6A 2Y5SA 5FEPA 4D8ZA 1FVPA 4UQDA 2D22A 4O17A 3VGBA 1AK5A 3NQFA 3VMNA 1TIMA 5L9FA 3UU0A 1P4CA 1R7OA 3EA1A 4MWAE 3N1AA 2O9PA 2GJXB 3W7GA 1UMLA 5D37A 1OYBA 1K9DA 2PSNA 3SSJA 3JRKA 1ZCOA 1EBGA 2H8ZA 3M0YA 2R1MA 4LWWA 3SCVA 4GYPA 2BY3A 3EDJA 1GTEA 5FAGA 3UA3A 1OABA 2CFFA 2A85A 2Z1BA 2DEPA 5C9ZA 1BG4A 4DI9A 2Q8LA 3TA6A 1B3ZA 1EJTC 2DZWA 3DFTA 4LTSA 4JN7A 4Z1YA 1PDYA 5D8WA 3PUOA 3ARSA 3BGJA 4IIDA 3UESA 3MUCA 3NPXA 4MY8A 4LRSA 4UTTC 1N8FA 2VZTA 2GOKA 4WCJA 2DZTA 1RBLA 3AMCA 2R8WA 5I3DA 4NZ3A 4QM1A 1AUSL 4JY8A 4MJZA 4NAEB 3EX4A 1X7IA 1F5ZA 1FWNA 2IKGA 2WK2A 2V67A 1KXTA 3W7HA 4Q4QA 4ERIA 2PBGA 4DBDA 4LBSA 2VFEA 3UZZA 4PFHA 1AJ0A 4RE3A 1FFQA 3GVWA 4C6IA 4XG1A 3W71A 5AY7A 2HDJA 2J7DA 4DVOA 3SAZA 4K36A 2VC9A 2NLYA 3W81A 2NVCA 1T7LA 1GVRA 1QPRA 3R0KA 2ZE3A 4EXQA 1SJAA 2EPKX 3LMYA 4P7QA 3GXMA 3WFAA 5AC5A 3AJ7A 2WB5A 1Q45A 3KL5A 3FKKA 3O8AA 2ATSA 9XIAA 4CD4A 1TJRA 2IPWA 3S47A 3UXIA 4I9AA 3C2OA 4UFKA 4HPGA 3R25A 4ZO9A 2DUZA 3K46A 5EMYA 1HTIA 4ZFMA 3PUDA 1QXLA 4C6MA 4M56A 2PC8A 3KCOA 1I1WA 4PCTA 5D03A 1OFDA 4KFOA 4ZQOA 1U30A 5HK4A 1ONEA 4FB7A 4F0MA 3FK4A 1RQHA 1LYXA 2E9LA 4D6GA 2G0WA 1C8YA 4IIGA 3NM1A 5FJPA 5A5WA 1KM6A 2ISSA 1I45A 3FDGA 2QJJA 4Q8VA 5I00A 1MEHA 4HU4A 2PGWA 3KVMA 4O8RA 3T81A 3TROA 4IUOA 4IFRA 3W0KA 5TAOA 1TX0A 3BG9A 1U1UA 2HROA 4DXVA 4K37A 4FHAA 3PF3A 1SMAA 4EPBC 5MKGA 1GQKA 3DFHA 4O18A 1JDFA 1H7NA 1EHAA 4UMCA 4DM1A 3I68A 3O6CA 3I10A 7PTDA 4HK5A 2YLAA 1JD9A 4O1BA 1VFTA 2YCIX 1KFBA 4XISA 3MKVA 4DZ5A 4M19A 5E9AA 4UMBA 1GVIA 3W87A 2QXWA 2R24A 1R2SA 3EXTA 4AZ7A 3CNYA 1BTMA 2OSYA 4HA4A 1XYFA 2RDXA 2FZMA 1HJSA 2TODA 4ZQCA 3KUMA 3EX3A 1T8XA 1KR0A 3RR4A 1N8IA 4S1FA 3ES7A 1JFXA 2FZNA 1IQ8A 4WGXA 4LV9A 1GEQA 1TTPA 1XD0A 2GJNA 2YL6A 4LALA 2ZWYA 4FX8A 4BI6A 3ABZA 1TZ7A 2Y89A 4Q3MA 3STEA 3R8HA 6XIMA 1J10A 4PFMA 2IQ0A 1CTNA 1C7SA 5A8OA 3ABSA 1JZ2A 2WMJA 2YYTA 3TSMA 3PBWA 4HN8A 1QNRA 3VDCA 3P80A 5HUPA 2MNRA 2IXUA 5I5RA 3TYAA 3B8UA 3TCEA 4PCFA 3S6DA 2DZSA 2Z6JA 3W22A 3K2GA 1HL8A 3W29A 1HKJA 2KAUC 4KRZA 4NU7A 3SZ8A 1QPKA 4ZXOA 1H5VA 3U8GA 4ZB0A 2OFJA 2PDQA 1G94A 3DFNA 1JDAA 3AROA 1CGXA 3SCSA 1CGVA 5FJIA 3RR1A 3ZJ7A 3LZ3A 4WXYA 5DCDA 2EG7A 1WDPA 4J2MA 4JCLA 1F6YA 4M7SA 1E6SM 1ICPA 1ZBKA 1KKRA 3VD7A 2CPUA 3SUVA 3MHGA 2E5CA 1E15A 1ZPTA 2XN0A 1XG4A 1I2OA 2ZDRA 2OO0A 2X40A 3N15A 3VPLA 3MHFA 4J3TA 2Y4SA 1UIOA 3URQA 3OIXA 3PZ9A 4QE5A 1KM4A 4GVIA 2J8TA 3R13A 1UQZA 4RK8A 1CCWB 1W9VA 3LLFA 1XYLA 4PUKA 4QISA 1X38A 4ZTXA 2ZZ5A 3T1GA 1CXIA 3HMJG 3LI0A 4S2CA 1B57A 3CB3A 4CNNA 2FFCA 2ZUVA 4PMZA 3NSMA 1QBAA 3CQKA 4JL1A 4PTDA 2C1GA 2WVVB 4JDBA 3RGTA 1CGWA 2WNNA 1TTQA 3FOKA 4LS1A 3CC1A 3HGSA 3L7RA 5D04C 1LG2A 3VIGA 3UG8A 4UR8A 3ZVHA 3I7QA 1WDRA 4UTWC 1L0PA 3GU1A 1F9CA 4KKXA 3PFRA 2WNZA 3VIJA 1XQKA 5CSSA 7ENLA 2I17A 2EJAA 3W83A 2ZZ4A 2WM1A 2GOUA 1UJPA 1P5BA 2RHGA 5AC7A 1OG0A 3G6MA 4BCEA 2INEA 3ZVIA 2OQLA 3CHFA 2E6AA 3QW3A 2ZUTA 1FWSA 2FFIA 2PD5A 4Q8NA 4QGCA 3ICJA 4O0QA 4A3UA 6TAAA 3GG0A 5H8UA 4NP7A 4FF5A 1R30A 2BY1A 1M7PA 4B5SA 3K4WA 1S3HA 3H7UA 4I3GA 5B80A 2CLIA 3W1NA 2YB4A 2X1TA 3UJRA 1IV8A 4E0CA 4ENLA 1WKDA 2R1KA 4C7GA 1ONRA 1EF3A 3S42A 5K2ZA 4YYCA 1F6PA 2HV5A 4IIEA 3GZ3A 2ACSA 4KBXA 1S5NA 5EMMA 4KGJA 3MMDA 4DWDA 1XXXA 3ITXA 5HWNA 2C0HA 2G3FA 4Q33A 1J5TA 2XPKA 1VD6A 5H6HA 3NURA 4JEQA 4QLLA 3OA3A 1UD5A 3IS4A 4GI9A 2VTFA 4GY7A 1LL6A 4WJEA 3W02A 4MYXA 3VGHA 4GG9A 1E56A 1TCDA 1TFVA 3V3WA 2WYSA 4Q7BA 5IDIA 3MC5A 2C18A 4FLSA 4IP4A 2WANA 8XIAA 4PSPA 4B5WA 3OA5A 2UV8G 4HNNA 3RO8A 2CLHA 5EBUA 1HGYA 5FEXA 3LMZA 2YFNA 3PNUA 5MHBA 5E9XA 3NQGA 3GHRA 4GYFA 1EA0A 2POTA 3DX5A 4RUBA 2PP0A 3GH5A 4E5TA 4TO8A 3ZLFA 2XDFA 1W3KA 2QCMA 2ZCGA 4WX2A 3AIBA 3V35A 3ZO9A 3O2LA 4FR6A 4H9MA 4RX0A 2OT1A 1R2RA 3BLKA 1EPXA 3TONA 3L0GA 1GJPA 3ZIZA 4PCSA 3GC5A 4KMQA 1VCFA 5AN7A 2PWDA 4BKNA 1L6WA 4DF2A 2A7NA 3A12A 3I3DA 4YVXA 3I6TA 5B7YA 1F05A 7REQB 2V69A 1LWJA 3LTYA 2NSOA 4YU1A 1CW2A 4KFPA 3LA4A 4POCA 2CNCA 4HZMA 5AZ0A 3MWCA 3G6LA 3F4DA 2QHAA 4ZVJA 3MSGA 5A6TC 1TWWA 3RLUA 3L4VA 3CAWA 4LS0A 4L4MA 2JIWA 4D6DA 4ORMA 5GJMA 1LT7A 2ZUUA 2D69A 1E43A 4QJ3B 1LBFA 5HMDA 4HK7A 4EIVA 4HSNA 2VFHA 4KESA 1JZ6A 4F4RA 2QNEA 1UWQA 2P1FA 4UUIA 1W3NA 4CNOA 3S6TA 3BH4A 3AJXA 3L23A 1TR1A 4IGSA 2J7CA 5TNVA 3O06A 1R9ZA 4Z1DA 3VNDA 1KTNA 4ES4A 3U0HA 1QNOA 5D9PA 5BXTA 2V3EA 3BO9A 3EPOA 3RITA 4DLFA 4PGLA 3NQDA 2QR6A 5FOOA 2CXGA 1RV8A 5HQEA 4NZ1A 3LM3A 3PSVA 4JTSA 4H6RA 1BFNA 4L56A 1J0JA 4XZHA 1PUDA 1MEWA 1XBYA 1KFCA 1J0YA 4LY8A 5ABFB 2VMFA 2Q6ZA 4H19A 3UPWA 4F0SA 3VIOA 4BY3A 5G5IA 3E74A 3WJZA 4FOKA 3IGUA 3DGRA 1TCMA 5LA2A 4CNSA 3TTQA 1I60A 5CC5A 2QAFA 1WDSA 3PFMA 3S2MA 1XDMA 2VCBA 5HQMA 4UWMA 2EAWA 4CNTA 3CUXA 4C91A 3CMJA 3TTEA 1D2KA 3NDOA 4RPPA 4LSBA 2X41A 4WDTA 1Q6OA 4H01A 3UGVA 4LEFA 4AZ6A 4IGHA 3DHUA 1TSIA 4FX7A 1PAMA 3MVIA 3N2CA 3QEZA 4MWAD 5AFDA 3UGRA 1RALA 1F07A 4TVUA 3R4IA 4FIQA 4L7ZA 1RK6A 2Q8XA 1XGDA 2D3LA 1KV8A 4JTKA 1VFSA 4Q32A 1GQIA 2WQDA 5DT7A 4AUBA 2Z29A 2XFYA 3M4HA 4MPQA 4DPQA 4MWAB 3F4VA 3SGGA 1OFRA 3OVPA 4A05A 3EX1A 5A8QA 1TUFA 3VFCA 2VX4A 1BGGA 3APGA 1Y5VA 1Y8BA 2W63A 4XAYA 1W56A 3W72A 3CTTA 1LQ0A 4D6IA 3W6MA 1BWLA 2WOQA 4S3JA 4L9ZA 5AHMA 3KBJA 3C2RA 4ZSTA 1FX6A 1YDNA 2QDGA 3T0CA 2Q3OA 4ALDA 3VABA 2ZX8A 3EWXA 1G4EA 3FV9A 1O66A 1BQGA 5A8MA 2TRSA 4FO4A 2PRHA 1M53A 3Q94A 1Z9AA 1WYIA 3CIXA 1EDGA 5D38A 2QCHA 1OT2A 3K1DA 3TQVA 1H2JA 1GTHA 3WYZA 3L4UA 3W1RA 1IF2A 4AHOA 1BRLB 1GWJA 1OVDA 4GQGA 3IVSA 1HVQA 1UZ4A 1JRCA 5G4WA 6ENLA 5FD0A 2Y5EA 2Q71A 3QZAA 2OLHA 2WKLA 5HJYA 4R85A 2H3BA 3SECA 3WF4A 3L4XA 2XZ7A 2AMGA 4MNMA 4GK8A 2E7FA 2W27A 4XKYA 1VGAA 1KCKA 1HKWA 4IIFA 3ONBA 1XICA 4Z2LA 4JHOA 3ARZA 4DUVA 4HA3A 5E1QA 1FHDA 1UUMA 1ZJAA 3KOFA 3ZQ9A 4H9UA 2BVTA 4MGGA 1ML1A 3NGJA 4RV3A 2WSPA 1F8IA 1RY8A 1P0DA 3O6AA 1DIKA 3LBMA 4Q8UA 4YTSA 2DT3A 3LTSA 4WGHA 4IMGA 1BF2A 1FWHC 3GNOA 4X3ZA 3LXCA 5AYBA 5G1MA 1SQ7A 2BXYA 3ZT5A 1OWQA 1V5XA 3GAYA 3GTXA 3CPRA 3A47A 3VE7A 2I9EA 2WVTA 3NOEA 4V28A 3KEHA 2EKCA 4CNPA 1SFSA 2YB1A 4EF9A 3AQUA 2NQHA 4NNBA 1TVPA 5JUVA 3QPYA 1JDCA 3KP1A 4D8LA 1XSJA 1O6IA 5AKQA 2QUUA 1BF6A 5CBIA 4IH3A 3W2JA 2JEQA 1UH4A 1XLEA 2C8NA 1YPIA 1RLCL 4UQBA 4MYAA 3RX4A 2YX0A 2VZSA 8A3HA 3PSWA 4M5PA 1A5KC 2Z1XA 3W86A 1S2CA 5DELA 3CMFA 1EB3A 2ZXDA 4QJ1A 2IKIA 3B8IA 3GO2A 1ODZA 1EPVA 4XKYB 4Q8QA 1CWYA 1V6UA 1UG6A 4FOUA 3MZ2A 3WDHA 2W79A 3AXIA 1AVAA 5A1AA 3C3NA 5U7SA 3NAVA 1LZOA 3MV11 1AD1A 1BRLA 2PRLA 2F8QA 4D6JA 4F9DA 2DGAA 1AH0A 2A3CA 1B3WA 1EUAA 5I77A 3LG3A 3DECA 1W9UA 3N6HA 3THAA 5D4YA 3GS6A 4UBPC 3Q65A 3EEZA 3AHZA 3SY1A 4FNSA 2C1IA 3UWQA 3FX4A 4REQB 1PDZA 3GKFA 4ZXLA 5AHNA 5D2YA 2XGBA 4FEZA 2AL2B 2GQ9A 3W1LA 2YFOA 3A64A 2J75A 3A5FA 1R6WA 3MQTA 2V2HA 3D47A 3GG1A 4XZMX 4ATDA 1DWJM 4JYFA 4V2XA 5K9CA 2ZE0A 4YNGA 2QKFA 1L9WA 1MWOA 2VRQA 1XFCA 4QAIA 1NWSA 3NJ3A 1LF1A 1TJPA 2AL2A 1VJIA 2DPEA 2ZZ1A 2QEZA 1M04A 3CHEA 3IIZA 4REQA 1HJUA 3QKZA 4Q6XA 4TR9A 1Q7MA 4DJFA 4B4FA 3APYA 4L64A 4GBDA 4AC1X 3QLDA 4QXIA 3LY0A 4O0KA 2HSAA 5BRBA 4WKFA 1K4GA 1HXJA 3GXNA 1C9DA 3VGFA 1LOLA 4D2JA 1RPXA 2YBTA 4S38A 1X6NA 4UFMA 3LS9A 3UXLA 4JXCA 1E6QM 1VFOA 1FWAC 4IG2B 1IT7A 1TV3A 3KRSA 1XM3A 5SWUA 1DE6A 2PDXA 4AF0A 4AFYA 1UYQA 1ISYA 2BOFX 3PR2A 4MB5A 5AB3A 1J93A 3Q45A 2Z2UA 4KW2A 4Y9AA 4ROPA 5CZTA 2JKEA 1HX0A 2J7EA 6TIMA 2GGJA 3WUEA 4B3ZA 3BG5A 2REQB 5T9CE 1H7XA 2XWDA 1G9HA 2VWTA 2Y8KA 3L5AA 2ZA3A 4W89A 5LNUA 5AVHA 2HPMA 3MJYA 2BODX 2BNJA 2GJRA 3L12A 4BQ3A 3UPMA 2ZX9A 5A8PA 3NVTA 2FPTA 4JYDA 4HNTA 1YBQA 3TK7A 4E4UA 1V0KA 3DHDA 1I9CB 4U31A 4ZOBA 3ITYA 5ABTA 1Z32X 2VO5A 1BXNA 4AZHA 2XWEA 1SSGA 1OYAA 2YSWA 4YTTA 2YCKX 1TA3A 1O1HA 2J24A 3ABQA 4LVGA 1U5VA 2P76A 5C70A 4LPCA 3BUVA 2D3NA 2F6XA 3DIPA 2G41A 1AZ1A 3TKFA 4KWOA 1Q8JA 3SGUA 3TTOA 1WPCA 2XVNA 3CAKA 4UZUA 4P5UA 3B8DA 4GIAA 4PMJA 4UR7A 1FHVA 3KOXA 2PWFA 5EKYA 2G5WA 2XJ7A 4N9DA 2CBVA 1HJVA 1OGSA 3S2LA 1TUXA 3AHYA 3MT1A 1EUNA 4FLRA 1YXDA 4C6LA 4UFIA 1QU4A 4W8AA 2WMHA 3LGGA 4DELA 2XIMA 1G1YA 3DHPA 3HJZA 4P61A 4JFUA 4JTDA 1HN1A 2WLYA 4YS1A 4D6CA 1WBJA 4F2TA 2PWUA 2X1RA 2ISVA 2V5JA 3A4WA 1X1ZA 4UTWA 2OPJA 2R82A 3H8AA 2DZPA 2QCCA 2XYLA 2YA0A 4LUSA 3H2AA 2Y8UA 3N34A 3P3BA 3STCA 3EMZA 3BG3A 1Q5MA 4MOZA 3QZEA 4TVCA 5CG0A 1EC9A 4DO7A 3MCMA 3VIMA 2DVXA 1ZP3A 2PEVA 2PTXA 1H50A 2Y7FA 4HSHA 4D8AA 3CUIA 4MUZA 3IJ8A 4GWEA 3BLIA 4OBTA 3UG5A 2O9RA 3GY1A 1CIUA 5DEZA 4TX6A 3FGCA 4WRHA 1UP2A 1KO0A 3B0YA 4L1XA 3T8LA 1TJ2A 1DQWA 4PUEA 1ZUAX 3MCNA 5BNKA 3T09A 3VZYA 4J3ZA 2Z1SA 1NDWA 3WFZA 3CUGA 3GTHA 5IM51 4TX8A 1EJRC 4G7FA 2QJGA 3UWEA 3MO7A 5GNZA 3VIHA 4A29A 2J4GA 3I4KA 5BWAA 4HP5A 2AKMA 2QS8A 1OYCA 4MWAC 1B9ZA 2WMIA 2QPSA 4D6FA 1REQB 3NYDA 3LHTA 4JN6A 3U4AA 2CBJA 4HGXA 4M7TA 1ZP4A 1BQCA 2HVMA 2GVEA 1YDVA 3EA2A 4PMYA 1LOQA 4L5ZA 3B8TA 4Q4SA 3VOJA 1WXZA 2DZVA 4FX6M 2WBKA 2J88A 2TAAA 3WELA 3WNLA 1A3WA 1HKKA 1UR1A 4MNKA 1BVNP 4N4PA 1T8QA 5LA0A 4XTIA 2GVLA 2Y62A 4XIMA 1GNXA 5I06A 1TR9A 1W3HA 4JD4A 5FF0A 3IIOA 1G7UA 3ZWTA 2AGTA 2JQXA 4IIHA 5H1WA 2EKGA 3QHNA 2QZRA 2GFTA 1LDCA 5REQA 2X1IA 2ZZ3A 1K8XA 2JF7A 5EFFA 4DJFD 1I2RA 4MB4A 2DSUA 1LRNA 3A5VA 1SZFA 4AVFA 2VUNA 1XS2A 2YDQA 4PYSA 3VVGA 4NIRA 5D30A 1V6XA 3K4AA 3C6CA 3DERA 3VC6A 2VDHA 5JIWA 5M3WA 3UNTA 4BJHA 2P3ZA 2E6DA 3W7LA 5C9RA 1KXVA 4R88A 4TTUA 3EB3A 3OBAA 4NY2A 2BASA 4S2BA 5K7JA 4AMAA 3BSMA 4MAZA 3BLPX 1GGOA 4HZ7A 2C0AA 3BLFA 2X30A 1QI4A 3LTPA 1XBVA 1Q2RA 1FCQA 4P8WA 5I3HA 4JKLA 1DJZA 2PDHA 4CCDA 3LCGA 1ISVA 2DW6A 1VBRA 4AX7A 4B9ZA 3KLKA 2WWDA 3BGAA 5CPMA 4Z1AA 3VD4A 4UTHA 3KVLA 1GYLA 3H6OA 1QTWA 2W4XA 2E3ZA 3Q67A 3LK6A 4H8NA 4HBKA 2ADAA 3PTQA 4QQ3A 1NU5A 3KS5A 3T55A 2JIEA 3NIYA 2YIHA 1ZHAA 1MNZA 4QP0A 1AH4A 4FLOA 2GK1A 3MMTA 2W6RA 3MO4A 3B9DA 1E3ZA 2P53A 4L4OA 5KETA 2FLIA 3QGAC 3VDHA 2OQYA 3RLGA 2W62A 2B7PA 4F2BA 4S23A 4P7LA 1XLHA 2CLPA 5HDRA 4M51A 4AWEA 3OIHA 3U5UA 3H4GA 3M1ZA 2FZ9A 4RW3A 4PMQA 3WQ6A 1XUUA 1OADA 1UR3M 3MP3A 3WG6A 3W7IA 3ZLHA 3L4WA 1Z6KA 2PPGA 2QV5A 2YCLB 3DYPA 4IQJA 1XIGA 4U2YA 3ID7A 2AAMA 4A3YA 1TPVA 3LSBA 1KWGA 2WVSA 3S2NA 4PR4A 1MEIA 1KM5A 1JIBA 1QBBA 4RNHA 1WDQA 4BWLA 2R1LA 2EEXA 3ERPA 3L2MA 4OV9A 1OX4B 3U5YA 1CDGA 3K30A 3AMGA 2VEKA 5DX7A 5G2WA 3L68A 3PZIA 1E0XA 2GPTA 4NX0A 3UWUA 1EQCA 2E5DA 1HL9A 1O94A 2FJKA 5BU6A 3SCOA 2ISDA 1TVNA 1ECQA 1K9FA 4DLMA 2VD8A 1C8VA 3NQ8A 2E77A 1UCWA 3PZNA 4PMXA 4BA0A 1GVYA 2V63A 2CKSA 4Q8PA 1ZJHA 4FS9A 4AF0B 3QBUA 4US5A 5C7VA 3FGCB 1G67A 3C61A 3ARWA 4CKQA 2E5BA 1O95A 1R47A 4PMDA 2NVAA 2EPNA 1DL3A 3NVDA 5E0FA 3NDZA 2OEJA 3EOOA 2OKTA 4K68A 1LL7A 2QCDA 2BGSA 1UKQA 3NQVA 1B3VA 3QFWA 3NZPA 4I9TA 3OEXA 1EP1A 1Y5XA 3NOYA 3GFXA 4AZ5A 3WF1A 2JGYA 3EOSA 1W1ZA 4PCNA 1Z44A 2CEQA 1DJYA 3L4TA 5MKGB 3EWWA 5F2IA 1TWIA 2ESCA 2PGRA 4AYGA 2XIJA 3OGSA 1LRTA 2XN2A 4OZOA 1D9EA 1OX5A 3VUSA 1ZCCA 4RV8A 2X7WA 3G1RA 3I7RA 4HIBA 3MU7A 1V6WA 1PZ3A 3GXPA 4NSBA 3WBEA 1V3KA 3CUFA 4JKMA 4B4HA 2BFGA 2EXOA 4KF1A 3OQEA 4M6PA 3IJIA 3BAKA 4UNIA 1AQHA 1QWGA 4ICMA 1BWKA 3IAQA 1AQFA 4LUYA 2QPUA 1OHLA 3M5ZA 3QV9A 2I9UA 5K9DA 2X1SA 4BEQA 4ZOAA 5HNTA 4HMCA 3W6YA 4CGTA 3ZJ8A 1ZJBA 2OJPA 2FYMA 3SI9A 3GNRA 2G3MA 4ERAA 1NM9A 5BMWA 2GVGA 5DF0A 4OIFA 2B0MA 1XRVA 5BXSA 4CD6A 3M41A 1PTDA 1RVGA 1U2YA 1DXFA 1HZYA 2JEPA 3LHVA 1SM9A 3ZT7A 4LNYA 4FXJA 4WJ8A 1OD8A 1EJVC 3IANA 4YTQA 5LHFA 2ZFAA 4IT1A 1Q6LA 3THUA 5HATA 2UY2A 3AIRA 2ZVRA 2GDVA 2PAJA 1E9ZB 2G3NA 2JALA 1CGYA 1C9WA 4NZCA 3TIMA 3R2GA 2HS6A 1A0EA 3LSCA 2ZC1A 2VVSA 2XGZA 3CV1A 3W1MA 4GYPC 3MVTA 1TX2A 1RP9A 2GWGA 2FGZA 3LRKA 3T42A 4CU6A 1FFRA 4JTEA 2C1HA 2QCFA 1KGXA 4IQLA 1KLYA 5L6UA 4OQVA 2XSAA 1UR2A 1HL2A 2NZLA 3BW4A 4AZCA 1UB3A 3HG3A 3TW6A 4HYWA 2A5HA 1NVMA 2O56A 4F66A 1TO3A 4D6HA 3UY8A 1HUVA 3EPMA 5FESA 1UUOA 2OYLA 4IISA 4H7ZA 1MQPA 4XAFA 2PODA 1V0MA 2DT0A 4Z08A 2VL4A 2XZ9A 1GONA 4KRTA 2HNEA 5KSWA 5JBFA 2IQTA 4JYEA 1NOWA 1W5OA 3QN3A 2WZTA 3RLVA 4NJGA 4JTJA 4MADA 4AISA 1A5AA 5EMUA 3VM7A 2QULA 2FJUB 2WXDM 1FDYA 4B5UA 3TOPA 1F3EA 1Q66A 3H7RA 3HGRA 4ICCX 3B0VC 3D46A 4Z1CA 1EXBA 3WQWA 4ICNA 2D0HA 4JDYA 5D9MA 4IZGA 3LXAA 2XVGA 1ME7A 1D7KA 2D2GA 1H7RA 3GM8A 3KVKA 1FDJA 1MFUA 2NXHA 4HA1A 2OOFA 3AWNA 3CTLA 3E38A 4XD3A 4ZOEA 4F3HA 2OX1A 3V5OA 2GYIA 1T0OA 3ECQA 1ONWA 1OX6A 4GIRA 4GO9A 4UMAA 4WIWA 5LYRA 1PHQA 5T26A 4KIEA 4LAMA 2O9OA 3GW3A 3ATYA 5CSRA 3UCQA 4U5KA 1RQEA 4KFNA 2INFA 4K8GA 3URNA 1THFD 3WNNA 2RGLA 4QROA 4JPGA 1KV5A 2J7GA 4US5D 1V51A 2QGHA 3E96A 1QK0A 5CLWA 3FA5A 1XC6A 4RNJA 1W1B1 4ZZ9A 1DORA 4DZHA 2OVLA 1MDRA 3NNTA 4TMBA 1XLIA 1AZ2A 1UR0A 1O68A 4ZE4A 4LYRA 3AOFA 3DYMA 1YXCA 4JEJA 2ZWZA 4LW7A 4C7FA 4LY4A 1OF8A 2V2CA 3E0LA 5LNVA 5F4WA 1U83A 2B7QA 5GJPA 4JS3A 3MJMA 4S3EA 3VYLA 4K3ZA 3PWAA 2C3ZA 5FA5A 3N17A 3R6IA 4IP7A 1IT8A 2NUWA 1QUMA 3AZRA 1TQXA 1TKKA 1KR1A 1SPQA 1H1ZA 4LJ3A 3M0MA 4MLJA 5C8BB 1FHLA 3WX7A 1QVBA 2BWGA 3VOGA 4HMDA 2E9MA 1E5NA 5HQLA 3IAPA 3CQHA 2DVTA 2WAGA 2CBUA 1S2AA 4M0XA 2VT0A 2J7HA 2Z27A 4LB4A 4NL1A 5EYWA 3DKJA 3W4RA 4O12A 3P93A 4U3CA 3LGEA 2OELA 2VOMA 1XC4A 2NT0A 5AYIA 2W3ZA 3PWIA 3AUJA 3PPFA 3KRBA 3EWCA 1R87A 4PUWA 4D1JA 2EPHA 2E1DA 5AYZA 4ZOCA 4N4QA 1OCBA 3M5YA 2ZRXA 1JXKA 1YNQA 5C71A 2V3DA 2CLEA 3T08A 1CXEA 1KGUA 4DYJA 4H4IA 2AQOA 4QBXA 3GXFA 3G1VA 4X9YA 3MUXA 5IBXC 5CPOA 3N4EA 3CS2A 3IRSA 4WD0A 4DWSD 1RK5A 2ZDSA 4ZO8A 4GCXA 4B92A 3GZAA 4BF7A 2REQA 4DO6A 1QO5A 2CLFA 3TAKA 1WZKA 1EEXA 1HG3A 5HNNA 3H4WA 2VOTA 3DG3A 1PEZA 3ARUA 3P82A 3HPXA 2A6NA 1FCBA 4PZVA 1MW1A 1DE5A 2P8CA 3UF9A 4LVAA 3TQKA 2DZAA 2YXXA 4RDVA 3FYYA 1R9YA 3PTMA 5G1YA 4GLEA 3A23A 2V3GA 3NQ7A 4QEHA 3T4WA 2NQJA 3DOPA 4GYKA 1GJWA 2FH8A 3GFZA 3TSBA 1MW3A 1E51A 1XLLA 4AD5A 4IX2A 3CO8A 4AZGA 1TJ1A 3BMWA 1GVSA 1EO5A 3T07A 2XN1A 4RL3A 2PD9A 3KTSA 4CD7A 3N6JA 1E1EA 4IMFA 3KCLA 3PJUA 4GBUA 4LAKA 5JBDA 3PBYA 5E09A 1QOXA 5CG7A 1Q13A 4Y90A 3CASA 4GVHA 3NPVA 3V5FA 1CLXA 4LUIA 1W8GA 1M03A 1S5WA 4E3TA 3E0FA 2J74A 4OJYA 1DJGA 1E6XM 4ASTA 1RLDA 3TWBA 4JTCA 1UUQA 2WHLA 3MS8A 4P2VA 3LNMA 3VCNA 2OWXA 4IMEA 3CL7A 2VWSA 1QI3A 2A3BA 4R5EA 3QPEA 1V79A 1R3WA 1V7AA 5H8MA 2HBVA 4UIOA 3QGVA 2OWWA 3UNDA 3LBCA 3GK0A 3BQ5A 1W17A 4I5UA 4UCGA 1J6OA 4HPNA 2JK2A 3P60A 4JNYA 1W2VA 4I90A 2QJNA 4IMCA 2YA1A 3EOEA 3RX2A 3U2ZA 1K7FA 3OHIA 3UJSA 1RQBA 1VLWA 1A4LA 1P6BA 3S5ZA 3XIMA 4DYEA 1K03A 1V8EA 2GUBA 1KFWA 4NHVA 5BRPA 5K3VA 1YRRA 1PZ1A 3CWHA 3S2CA 4Z0SA 3LHUA 2PWHA 4FA3A 2PDKA 1WCGA 1JCYA 4K6AA 3TJXA 1E9IA 3DDMA 4A8IA 3MDUA 4H9TA 1J18A 1XD1A 3FNDA 4IPNB 2XIIA 1JF5A 5CC3A 5HMFA 3KOWA 1Q7ZA 2V0TA 1BVZA 5FL0A 1PSCA 1YX1A 1SU5A 5FF2A 4AZCB 2GWNA 1WBHA 4JR5A 2GJLA 2ZBTA 4EP8C 2R9RA 1TMHA 2AAAA 3H12A 1VBJA 4Q7NA 3W2LA 2G3IA 4MAVA 3CUHA 4NF7A 2CW6A 4QCEA 4PMUA 1Z89A 1ZLPA 4GHRA 5M2FX 3VKJA 3BGGA 4O1CA 3XINA 5FEWA 2JKAA 3F5JA 1K6AA 1BAGA 3BZJA 5DMLA 1OSEA 2OXNA 1JCTA 3SFWA 1GOMA 1EKOA 3REQB 2QCLA 3RLHA 4LFYA 3EX2A 4AZIA 4X22A 3U3HA 1GVQA 1OK6A 1MXSA 2AOSA 4H00A 1SO6A 3WENA 4JHZA 2HS8A 1QI2A 3NZQA 3C5QA 3FJ4A 4E8GA 4A8RA 2A3EA 4ZGYA 4PTMA 1BPLB 1KD0A 3CB8A 3H70A 3QKEA 4EWJA 1UKSA 2DJLA 3GIPA 3OBKA 1DYSA 1P1XA 2ZX7A 3CQJA 3CUZA 1HKMA 3PK7A 3IK4A 3BAJA 3S9YA 2WZMA 1XYBA 2PTZA 4OBRA 1IE7C 2OU4A 2WJDA 1I2PA 2WQPA 3ITTA 5DBTA 3ZFHA 4G1KA 3I6EA 1J0HA 5E5CA 1QMLA 1LT8A 5CZKA 5IOBA 4JCMA 1GK8A 5D9NA 4IPLA 3BICA 4TXEA 3FA4A 1GT8A 2WLZA 3ORWA 3OU8A 4C7DA 1QFEA 2ZC8A 3TC3A 1ONXA 2I56A 4GJIA 4QNEA 3GAKA 3W1PA 1MO0A 3HMCA 4ZSUA 1P7TB 3GR7A 2J9XA 4JFTA 2XH7A 3OYXA 5FCZA 2BSLA 4K1GA 4Q4KA 2HVOA 2HZGA 1VBUA 3PNZA 2FIQA 3G8RA 3PHAA 3AXMA 3VNJA 1Z8AA 4A4AA 5CEWA 3VD5A 1VEMA 3V0UA 3VO0A 5CJ5A 3IWPA 3WQFA 4QTGA 3V36A 3NCOA 1XIMA 1U22A 2C7FA 1Z3NA 4M82A 3P61A 4Q4OA 2QMJA 1FDZA 1DJQA 1VFHA 5FACA 5I09A 4L6HA 3LQGA 3GC2A 4Y6GA 5HJLA 4KCWA 4PN2A 3W2UA 4H8HA 1XGZA 3OLEA 1RUSA 2G4JA 1DWAM 1H7OA 2RUSA 3GU9A 3BK0A 5JVLA 1HJQA 3RJYA 1R7AA 1EGZA 5DY3A 3SSZA 4D6EA 4X61A 5HMSA 3ARRA 3AIQA 1XBXA 4L65A 1TV4A 1NF0A 2ZA1A 3PPCA 5C9WA 3E1F1 1PIFA 5EB8A 5T8GA 1RPKA 2NUXA 1UD3A 3PB0A 5E70A 5FSDC 4K7YA 3SCUA 3TZNA 3ABXA 4A35A 4FP1A 4MPKA 3TN6A 4QCFA 1EWDA 5HBFA 3S5YA 1O1ZA 1WZAA 5AC6A 1MW2A 3ZOAA 4O52A 2WC7A 3CPGA 1OJXA 4O15A 1UROA 4FR1A 3KVJA 5F2MA 4NAFB 2FTPA 3VDBA 4XBKA 4L9XA 3W7DA 3FJ6A 1K8CA 5I03A 4PTWA 1YNPA 5CZ0A 2NW0A 2BOEX 2OQHA 4HCDA 1F8MA 3SCWA 2Z6IA 1KM1A 3PZMA 1R3VA 1W3JA 3P5YA 1XPGA 4A8LA 4LCSA 4DO4A 2J78A 4ZQPA 1WE5A 2P0OA 3SFKA 1H3GA 2DQWA 2ZXBA 4Q4PA 3CBWA 3AHXA 3U6WA 3FIGA 1AD4A 4NI8A 4Y9NA 3C2FA 1L6SA 2BOGX 1KRCC 1EYEA 1FP9A 1D3GA 3C3UA 2OGJA 1EJSC 3WKZA 1YDYA 4RR4A 3AS1A 2XINA 3F2CA 4MIMA 2H9AB 3UD6A 2PU0A 1XIBA 1O5RA 4WVXA 4E3VA 3VOFA 4X2PA 1M7OA 4PEKA 1W9XA 3UJ2A 3WF3A 3PJWA 1C91A 4JIIX 4JIEA 3ELFA 1E6ZA 4JTIA 1V02A 4GZJA 2Y70A 3OG3A 3V5CA 4FNRA 3JUGA 2ON3A 1PTAA 3FAWA 5D2XA 3O7UA 3LHZA 4R9XA 4Y9PA 4ECLA 4LVFA 3CL8A 3FXGA 3OJGA 1HW6A 3PBVA 2OCZA 3CV7A 2W92A 3V18A 4LRTA 3SADA 5CC6A 3UVAA 1T96A 4AG0A 3MTWA 3PZTA 1WUFA 1AMYA 3BURA 2UBPC 7REQA 2D73A 1XJBA 4LYPA 1QR7A 5DCEA 3H53A 3H2EA 1LQAA 1W1IE 1UIPA 4XBSA 4ZTYA 4DJEC 3FXYA 3VAVA 1J5SA 2VC7A 2ZICA 4UOZA 1I4NA 4JQ4A 3E2SA 1IIGA 1A4MA 3OW1A 4JIRA 1B4EA 4NG3A 3TYEA 1CB2A 1LLWA 1PXGA 5G4EA 4MM1A 1EJWC 2PTDA 4IHCA 5FJUA 2VXNA 2DH3A 4NZ5A 3G1FA 3QXBA 1SW7A 1BYAA 1JUEA 3M16A 4XB3A 4FIRA 3KDOA 3HURA 3WLHA 2V8ZA 3KOYA 4XAZA 1Z7AA 3NA8A 3SCTA 2AKZA 4AWTA 1AW2A 1TWZA 1P43A 1VP5A 1S2TA 2GGIA 3MP5A 3H2MA 1XLFA 4W4QA 1V3MA 5LGXA 4S3GA 4XO7A 1P1MA 5E6ZA 3SRKA 1ADSA 1KW1A 3WBXA 1MYRA 3WQPA 1TPWA 4KWWA 4DWSC 1V6TA 4NNCA 4RE4A 5JBEA 5D02A 3V1HA 5CQ1A 1M68A 2VDIA 5CC7A 3MUIA 1GG1A 2WC3A 3MANA 3M0KA 2FDSA 5CGTA 1NFGA 2FVKA 5DY2A 3BLLA 3I3BA 1PJ9A 5EMKA 3B9AA 5A8GA 1MUCA 2RDTA 4RXGA 1DJIA 3WBYA 1EA9C 1Q6CA 3V16A 5A8NA 4WLCA 2A6LA 4IQEA 3TW7A 3W26A 4QG8A 3TYUA 1UP3A 1SGJA 4WY0F 3MV01 1TZZA 3EWZA 3MSDA 1ZNNA 3TDFA 1V3JA 3A9IA 3RF9A 1FQ0A 4JTUA 3QTPA 4D72A 4EK7A 3G0XA 3M6YA 4F9JA 4Q8OA 3VNKA 3M7WA 2PLCA 5BOFA 3ES8A 2Q02A 3G77A 1VIZA 4PMVA 1RJPA 5LNRA 3VDAA 3IV8A 1TWDA 2E4TA 1QATA 2QGYA 1FKWA 3O0FA 3GYCA 2PS2A 3IJDA 4IQDA 3V7PA 4MG4A 2BXVA 5EL1A 4AMCA 4J27A 1KFKA 4R3UA 2NV9A 2EF9A 2ZUWA 4CQCA 3DFSA 3W1UA 4Z17A 3AU6A 4GZ7A 2ZOXA 2Q01A 1E55A 1EC8A 4XAPA 3UYCA 3LRMA 2QLYA 4U28A 1HFBA 4XWUA 2VI0A 3II1A 1W9DM 3O0KA 3O15A 3GDKA 3VOHA 3O1NA 2QUVA 1JRBA 5FF4A 1FXQA 4E38A 4AD0A 4HCLA 4XD5A 3T44A 1TMQA 3JU2A 4PBFA 1MUMA 1BG9A 3VIKA 3CEPA 7TAAA 3R94A 4HNVA 3NZRA 4PL1A 1DQXA 1OT1A 3KBMA 3FSUA 1IXPA 4WUIA 3OOQA 4IIBA 3E0VA 3LOTA 5CGMA 3THDA 4DPPA 5DXXA 1KRMA 2G37A 1TRDA 1YPFA 3M43A 2VFDA 4PUJA 3WNKA 3EAUA 4ZQNA 1SFJA 2DQXA 3TYZA 2GQ8A 3MI6A 3ZWSA 3TU9A 1ZZMA 1LJYA 3SJ3A 2WJZA 4ZO6A 4GI4A 5JMUA 2EBNA 2P88A 4RZ6A 3VKKA 1CGTA 3W7KA 5D8ZA 3W85A 3PS7A 4B16A 4S3KA 5CJNA 2CWXA 1PX3A 3MYOA 3HFYA 3WH7A 4E2BA 1XFBA 5FJJA 3STFA 1E1FA 3IUHA 3STGA 4XZ9A 3CZGA 5U4NA 1M3UA 2XH0A 1TJ0A 1FH8A 3TC7A 1DTUA 3RFAA 3VKDA 2FHCA 3N4AA 2GDUA 3NGFA 1W9PA 3RNDA 4B91A 4BQ5A 2CLMA 4HCHA 3T05A 4XVDA 1W1PA 2P0IA 3WMBA 5I24A 3LDVA 2IKHA 4GC4A 1BYCA 3HM7A 3HFTA 3W37A 3NM3A 2F6UA 1VPYA 4UTLA 4RJEA 4GFIA 4Z1BA 3O16A 4KWUA 1P0KA 3CIVA 4C6EA 1ZJIA 1DJXA 4JQ1A 4B5NA 2XVPA 1IEQA 4XZIA 4YVVA 2UWFA 3VUPA 2D2JA 4DUOA 2FGBA 3LZ5A 4UQ9A 2P3EA 5DLCA 2DZXA 3UG3A 3QV6A 3WO8A 2INZA 2GUUA 3DC0A 2CCRA 4NILA 1NOUA 2J77A 1K9EA 1DIEA 1JULA 3FCPA 3TW9A 2E1WA 1UH3A 2VX6A 1IXQA 1J12A 1EDQA 4INFA 2ISFA 3QZ6A 4Q4MA 3W38A 1SO3A 1JPHA 1MZRA 4GQQA 3RMEA 3VU2A 3CH0A 5I3KA 4LVDA 4DZAA 2XM1A 1W2PA 5BCAA 5FEZA 3DFYA 3UW6A 2PDUA 1XCWA 3TZFA 4CEUC 1WO2A 4HMNA 4B3KA 4DB7A 3FEMA 3OP2A 1L6FA 1KKOA 1YIXA 4O1AA 3PWGA 4MUPA 4H9XA 3SR7A 2VENA 1UOZA 4GUIA 3CMGA 1ALDA 1M5WA 1SJBA 3G8EA 5AZ1A 1S5VA 3L21A 2I5GA 4W8BA 1I75A 1J2BA 3CGTA 1O4UA 3IGXA 3RCMA 1K8YA 1T5AA 4S3CA 3SIZA 4XZNX 3GDTA 4TQTA 2QF7A 3RG6A 3KTCA 1OY0A 4GCAA 5I79A 1ADDA 1JFHA 4AEFA 3KW3A 1GVEA 3NQMA 2X0SA 1E70M 5CZJA 4RNFA 1SJCA 4V1XA 2YW4A 1XH2A 3DI1A 3CYVA 4DWSA 3L0KA 1MI3A 2I7GA 1UBSA 3AISA 3LM7A 2QUTA 4B5XA 4J28A 4C90A 4ADUA 3LERA 4XX6A 3EXRA 3WJWA 1LG1A 2NVDA 4UFLA 1IWBA 2QT3A 4ZQMA 2ODOA 3BARA 1U1HA 3ENLA 3T4CA 1C29A 1K4HA 3HIJA 4F79A 1YW1A 5H91A 3WL1A 4EACA 4IP5A 4FXSA 1OFBA 3K1GA 4A22A 1T41A 5IFPA 1G4TA 4AEOA 1P48A 2FHFA 1OIFA 2Z25A 3CT2A 3GH4A 2EHHA 1OCQA 1YPXA 4HYVA 3PULA 1PE1A 4G2DA 3ZLGA 2DIJA 1FWFC 2ABAA 1LORA 3IUIA 1N8WA 4UR9A 1GOOA 2YLLA 3GRIA 5HOSA 3FW6A 2X0YA 2QVNA 1EH9A 1U33A 4ATLA 3BCFA 3SY5A 5A2AA 3ALGA 3EOUA 2W0UA 2YCLA 3WH5A 5EFDA 1GW1A 3RM9A 2EPLX 1EP3A 4MB3A 4LYQA 1TG7A 1SR9A 2YKKA 4NJHA 3UR7A 1E6NA 3AFBA 5I6SA 2R1PA 1UD4A 1F7BA 2WSQA 4PUUA 3TMQA 2VGIA 2PGFA 3L4ZA 1SMDA 3QMRA 1U5HA 2FVMA 3UERA 3ZZ1A 4MLRA 3N04A 4DRSA 1OC7A 3W7PA 3AMKA 5FJTA 1A3HA 2PDJA 4MTVA 4MB1A 1QJWA 1D7FA 2PLKA 1RBOB 3ARPA 2GK1B 3LCWA 4C6JA 1AW1A 3AU2A 3XISA 1SR0A 5LIWX 1V3IA 4Y9OA 3BQ6A 4O4VA 2DT1A 3TX9A 5FJOA 3BJTA 3DC8A 2X2YA 1GOKA 4L4LA 2BG5A 4Z2HA 3P81A 1VFFA 3VD9A 4NKCA 4B2DD 4KRUA 1ECEA 3BC9A 3L67A 1SW3A 5M03A 3E02A 4TTGA 3VXGA 5HMEA 1QPNA 1E4IA 1LWHA 3L4YA 1CENA 1XCFA 2PDCA 1UZHA 2OZ8A 4NRSA 5JXQA 2O4MA 2B7NA 2V5LA 2Y6ZA 1X1OA 4HD5A 1M7JA 1QNPA 4UTUA 1KFJA 1YDOA 1FH7A 4YL2A 5I02A 3AI0A 1XLAA 3MDWA 4EVZA 3I4EA 2HMCA 2QJMA 5F4SA 3WBAA 4NXSA 4DUWA 4GE8A 4CQ9A 3AO0A 1CXFA 3GXDA 5GVJA 2OMAA 4AXNA 4QLJA 2YDRA 1LUCB 1H51A 5BROA 4KIRA 3AYRA 2H9AA 1ZBWA 1KLZA 3QOKA 4O14A 3SN0A 1MQRA 1UA7A 4L4PA 2QCEA 2XVLA 3WH9A 1SJDA 1N82A 1RXOB 4M3PA 1GG0A 1C90A 3DENA 1KFLA 5EMJA 1KBIA 7ODCA 3QVQA 4NI3A 4W84A 1OEPA 4DJED 1IIHA 5TQLA 4PEEA 4PB5A 3A22A 1JQVA 1H62A 3TN5A 1I0DA 1LLZA 1AJZA 2Y7GA 5I3IA 1W1VA 2NSXA 2FZBA 2HVNA 3UPBA 4GI6A 1I8JA 4A21A 1HJWA 4CQAA 3UP8A 1HO4A 4QSFA 1S2VA 1H60A 3F7JA 3DN5A 3WSUA 1OFPA 4RZ5A 1KBJA 3SUUA 1G7VA 3TJIA 4S3BA 3EDEA 2VFIA 1OG6A 1IEVA 4NZ4A 1JPKA 2HXTA 3SM0A 3VA8A 5PTDA 4G7EB 1YHTA 2BBFA 1ZAIA 3WEOA 2X16A 3COTA 4GYJA 3A24A 4KH2A 5D32A 3HPZA 4OKDA 2D2OA 3GBEA 1BKHA 3M9YA 4BZYA 3B8VA 2X0HA 3IVUA 2YGYA 4MKSA 2BS9A 1NWUA 1TPH1 5G2IA 2WPBA 1NIUA 3AMLA 1DHPA 1DP0A 1GKPA 1B90A 5C2XA 3U2EA 4NVTA 4H41A 3WD4A 4DJDA 3IJ7A 3B06A 3P2VA 2NQ5A 3TH6A 1DXEA 4HOXA 4CVWA 4DJFC 3WLLA 2Z7KA 3I3EA 1Q63A 3L0NA 3GIYA 4W7WA 1ZL1A 3M6DA 3IACA 2R94A 3DFPA 4MDPA 4XSMA 1HT6A 1J01A 3TWAA 2OX4A 5E0KA 4IF2A 4WKHA 3GNNA 4N7QA 4HNCA 5EY5A 4GUHA 3SN4A 1E0TA 4NRRA 3VCRA 3FSTA 3E5PA 5I23A 3ZYZA 3A13A 3QM3A 4HB7A 2DVUA 4I6VA 3PB2A 4HZ6A 1HP5A 2G97A 3AZTA 2VEPA 3NR0A 4Q6JA 1IT0A 1XINA 2FDMA 1Q4NX 3VMOA 4Z2KA 3BMXA 2Z1WA 4ZL1A 3GH7A 4KGLA 1UP0A 2CKRA 1RJRA 1ZAJA 3FVMA 5TIMA 3N19B 1IGWA 5A95A 4GY0A 2WV8A 3K8LA 4B3LA 1A0CA 3GVVA 4WDUA 3D3AA 1FWIC 3UJEA 2FQIA 4C6DA 1DIOA 4NX5A 3TQPA 5A6MA 3QYQA 3WLTA 1E1CB 4QG6A 4ORIA 4LAUA 3FYPA 3O63A 3IVTA 3RU8X 1FCUA 1FWGC 1F3XA 2BMBA 1KWKA 1JYWA 2Z00A 3UZJA 5FJRA 1HO1A 3OLGA 3TYDA 1GPWA 1KC7A 3TJ4A 4GXMA 1QHOA 4IGNA 1R38A 4GVGA 2FB3A 1H1YA 2QCGA 2ALDA 2X2GA 3F5LA 2E40A 5A69A 1E72M 3HQ1A 2VFFA 3BAYA 4YLWA 1YBQB 3QRHA 1EDTA 4C6CA 3TNOA 3ABOA 1OGBA 1EF2A 3SCRA 3CAVA 4GUGA 5F7UA 4XVEA 2VURA 2BHZA 3DHFA 4MNJA 1H1NA 3KL3A 4I9JA 4OUEA 4OOZA 3ABRA 4KCTA 1IYXA 3REQA 4LCQA 3PG9A 4MZ1A 4E4FA 1ICQA 4S3DA 4CN4A 3QYSA 1XP3A 3VNIA 4G7EA 3W01A 3MCOA 2TMDA 2NWSA 3RHGA 4JGDA 1IZCA 5HWMA 3FYOA 1TELA 3SEPA 4CU7A 2B31A 3R12A 3JW7A 5FF3A 1FWDC 4GISA 3A3HA 5D9OA 3DFOA 4IXHA 3ITOA 4I8DA 4JTGA 3BV7A 3HQOA 3RX3A 2PDGA 1YQ2A 4E6MA 5DANA 1E9LA 1ZALA 2XIOA 1F2JA 4EX4A 4C6QA 2H90A 4R7OA 1DJHA 5J5DA 4W7VA 4CCCA 2VQTA 3TN4A 4C5YA 3FLUA 1ZB5A 5LZLA 1V08A 1FP8A 4C5ZA 1JG9A 5JH1A 4WKAA 3GHUA 4UFHA 2XIQA 2QIWA 2AQVA 3C0LA 4WJXA 2E67A 1ESWA 4C1KA 2PU1A 2A3HA 1V77A 3PUEA 4O1FA 3GDRA 4IJCA 1TQJA 4YYFA 3W25A 1Q6QA 2ZX5A 1UWUA 4EKJA 4PRTA 1RSCA 2YCJA 3R11A 1E1CA 4HNOA 4U33A 2BY0A 3PN8A 1HGWA 1VB9A 3AS0A 3GTNA 3W2NA 2GJPA 4WSHA 2Y0FA 4UTIA 3NZ1A 2TPSA 3SBFA 4K2SA 1F4AA 3OHMB 1FWEC 3SQLA 3LLDA 4F8XA 1S3TC 3GU2A 2CERA 2ACRA 3H55A 1WP6A 4H9VA 3NQ6A 2FTWA 2RKXA 1B1YA 4W5UA 2WPGA 6PTDA 2DSVA 1UKOA 1UMYA 2AGKA 3U7VA 5D2WA 5AVNA 4JFVA 2GLKA 5CSUA 5BRQA 3LHWA 1KM2A 4MKNA 4W87A 2Z0IA 3V4BA 3VM5A 2XSXA 3NWRA 4HHPA 3S8HA 3WD2A 2OKOA 1FUYA 1MXGA 1FWWA 1FY6A 4DBSA 3F2DA 4HJWA 3C8FA 4C6KA 4XD6A 4GD0A 3E2RA 2A3LA 4WF7A 2E25A 3SUWA 3L65A 3R8GA 4W8LA 2C71A 3N18A 4AHPA 1W37A 1TWSA 1TVLA 2YZRA 3L9CA 3RDKA 3R89A 3OYZA 1GCYA 4OFCA 3N9KA 3FJLA 3OODA 2OOGA 4QE1A 2HBXA 4QRNA 3R79A 1V4YA 4Q22A 1DOSA 1BLIA 4X63A 2DIKA 4HYRA 3FFSA 3H2CA 5XIAA 1QHPA 5CH9A 5G4HC 4HN4A 4CLMA 4NYUA 4A2SA 4BEUA 1EIXA 1X6UA 1S5TA 4V27A 4UTFA 4C6NA 8RUCA 3EDDA 3OTRA 3AYVA 2W91A 3VCCA 3RUBL 3QV7A 2WMIB 1H7PA 1JPDX 3DAQA 4RNIA 1W0MA 1YNYA 5F2LA 1NDZA 2YL9A 3M44A 1FWCC 4YWSA 1VKFA 2X09A 4DO5A 3UZXA 3UWYA 2DJXA 2C6QA 2CZ5A 4O54A 4FNPA 4HZ8A 2PCQA 3LI1A 3Q37A 1HIZA 3GTIA 1F76A 2WNQA 1G6CA 3WK2A 2B4GA 3TFXA 2PP1A 3P8JA 3CZKA 3KRUA 3NG3A 2OG9A 1Q8AA 2PGEA 5DMMA 3QQ0A 4CNUA 4UB9A 1B2YA 3SY8A 4ADTA 4JNMA 1PPIA 4C1LA 2Y5JA 3G18A 4QNWA 3U57A 3A4AA 1OD0A 2NX3A 4F0LA 2A3AA 1TPFA 4J2PA 1CLVA 4CCEA 1OQFA 3DYOA 4AWUA 3N14A 4RE0A 2DORA 4GINA 1NQKA 1SFLA 2YBUA 1EXPA 1VRDA 5I3GA 3EMCA 3KZPA 5LIKX 3SCNA 5D05A 1MSSA 2DUAA 3NQ2A 3OO2A 2VZOA 3UETA 3LUTA 4H8VA 2CZEA 1KTBA 3M0HA 4U2ZA 4AIUA 5BWFA 2YZ5A 4UTMA 1IXNA 3CZEA 1UWAA 1TTIA 4QLKA 2LLEA 3CWOX 1H5YA 1XLMA 5IDZA 3TE9A 5AHFA 5C2GA 3PPHA 2CYGA 3GUGA 4DHGA 2PB1A 3MMWA 2ONEA 4RDZA 1JF6A 3T2OA 4PH6A 1OK4A 1R3YA 3GSMA 1QWKA 3E49A 1W1A1 3E0IA 4PMRA 3BZGA 2OTDA 1VFMA 3EA3A 1KCZA 1KRBC 2DH2A 1R3QA 1JQXA 1EJXC 2GL5A 4H3DA 3ANYA 4V15A 3C86A 2J79A 3O3RA 3UVIA 3WLPA 3LYEA 1PKLA 3RN6A 1K6WA 1C8QA 1S1RA 3KP0A 3VIIA 1B3XA 3AS3A 3A6OA 1BSLA 2QF8A 1JUBA 2PDPA 3IJQA 3V0SA 2E9BA 4UTTA 5FL1A 3T8QA 4I5RA 3S1UA 2KZHA 2E8ZA 2YA2A 3POHA 2PF8A 3VDGA 1W31A 2WSRA 4MF4A 5I3JA 3CWNA 4F2UA 3USZA 3HF3A 1WB0A 3UY7A 4WHBA 1RVKA 1A5LC 3KX6A 1GQLA 2BTMA 5C6MA 4GKLA 1E5JA 2IPFA 3MSYA 3L2LA 4GJ1A 3N2TA 1X1NA 1YLVA 4KT2A 5DMNA 1W3IA 2BX7A 1W8SA 4ML4A 4E2VA 2CESA 4PB4A 1L6GA 5LIXX 3W73A 5LHEA 4XK2A 4GABA 1GVFA 2A0NA 2Q3RA 3THQA 4HHHA 3RRXA 4ZO7A 3W7JA 3WDJA 1VS1A 4LUTB 4MHBA 4K38A 3D3FA 2PP3A 1JXJA 4J3WA 3WQGA 1R3RA 1VBHA 5IHRA 4J9JA 3GB6A 3HOJA 5CSYA 1YE4A 1Z42A 1QOPA 2GVJA 1A5UA 1S2UA 4IG2A 3WQ4A 4DYKA 3M47A 4MMWA 2YR1A 2WKGA 1IR2A 2O55A 2YDAA 5F2GA 4FMVA 1SZNA 3B4YA 3ANUA 2FMNA 2V82A 1XLKA 2HTMA 2V30A 2NLIA 2HNHA 3GNPA 4ZB2A 2QIIA 1XIEA 4H83A 3HA1A 3E12A 1E0VA 3MKCA 4ACZA 4XIAA 4IUGA 2ZRYA 3O9NA 3J7HA 2F84A 4N6EA 4U4MA 3KBVA 2DZBA 1CECA 1TMLA 3WD1A 4AVOA 1VC4A 1MFVA 4LNCA 3OG2A 2HK0A 4CQBA 2QUNA 2CITA 3B9OA 1JD7A 4GXWA 4W9TA 2I1OA 3B05A 1VYPX 4EPEC 3GQYA 2X1UA 5EPDA 4GPNA 2FZ8A 5ECUA 1PTGA 4FNUA 3QSRA 3V75A 3NL2A 1JI1A 1ISWA 1VIWA 3AIVA 4AY8A 2EQDA 2GSJA 2XGIA 1MW0A 2F2HA 1JZ7A 1EGVA 4S3AA 3ZXWA 3C0JA 4O16A 1GOXA 2Y8VA 1RD6A 2VJXA 2P8BA 4DN1A 4Q7IA 1TREA 3T78A 2EG8A 3SW6A 2GQAA 3RAOA 1UZDA 1XBZA 2ZXAA 4L1GA 3TJLA 4BF9A 4LXFA 3BOLA 2XG9A 2FGLA 3PZVA 3WH6A 1SZGA 3TXZA 4A3RA 1JCNA 1C92A 1Q6RA 2I14A 5HUOA 5DRCA 5XINA 1QW9A 2CLKA 5HPOA 5DN1A 5GJNA 3VINA 4EOUA 2WHMA 3UA4A 3LD5A 1XRTA 5A6KA 4JKKA 5HANA 2JBMA 4WDXA 3KXQA 4MJ2A 2J62A 3TSDA 2Y61A 3VILA 4HVXA 1PZ2A 3KRZA 3EWYA 4OECA 3UZ5A 3EWBX 1A47A 3RMJA 2Z24A 3SRDA 2I5QA 3BCDA 5C0QA 1DWHM 1R46A 1XIDA 4QQUA 3R8RA 2YJQA 1H7WA 3PAOA 3JVAA 1HF6A 3AALA 2BGNE 3CHDA 3NYZA 3B40A 4E8CA 5KITA 1K3UA 3UYIA 1EOKA 1KQZA 3WBWA